1ZBUA

Crystal structure of full-length 3'-exonuclease
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
225
structure length
225
Chain Sequence
SYYDYICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYVRPEINTQLSDFCISLTGITQDQVDRADTFPQVLKKVIDLMKLKELGTKYKYSLLTDGSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPHCGLDDSKNIARIAVRMLQDGCELRINEKMHAGQLMSVSSSLPIEGTPPPQMPHFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3'-5' exonuclease ERI1
publication title Structural basis for 3'-end specific recognition of histone mRNA stem-loop by 3'-exonuclease, a human nuclease that also targets siRNA
rcsb
source organism Homo sapiens
total genus 62
structure length 225
sequence length 225
chains with identical sequence B, C, D
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
A PF02037 SAP SAP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1zbuA01
4CEAA 3SV3A 3ZSRA 3V6DA 3PX6A 1RBVA 1C0TA 4CGHA 2GUIA 4B8AB 3L2QA 3G0ZA 4DFJA 2Z1JA 3SUQA 4J2AA 4E19A 1IO2A 4O0IA 3V81A 3S3OA 1LWCA 4FLXA 2R7YA 3QO9A 1T8EA 4HCCA 5HRNA 3OS2A 4IFYA 4CJTA 3V9ZA 3NF8A 3OS1A 5KI6A 3T1AA 3SQ0A 1SKSA 4B3OA 1CXQA 1J54A 1TKTA 3C6UA 1D8YA 2F96A 4CHYA 3TAPA 1RT1A 1S5JA 2W42A 4E7JA 3VQ5A 4DTMA 2VG7A 4Z0UA 4KHYA 4KREA 4H8KA 3QERA 4FJ5A 1U45A 4LD0A 3VQQA 3K5NA 4EZ9A 4CJSA 4ID1A 2YKMA 3VQDA 3HT3A 5DMRA 3F73A 3S9HA 1C1CA 3KD1E 4CJ4A 4CHNA 2DY4A 4DS5A 1IH7A 2D0AA 3SUOA 3SJJA 1TK8A 4HCBA 1IG9A 3LP0A 3OYGA 2P5OA 3ZSQA 4FM2A 1J5OA 1Q8IA 4KAZA 2KFZA 2WOMA 4B9TA 2HHQA 3DM2A 1C0MA 1BIZA 2EX3A 3SNNA 4KPYA 5HRSA 3AVAA 1D9FA 3AA4A 1B92A 3UIQA 4CGDA 2VG5A 4NCBA 3I0SA 1S1WA 3OS0A 4DQQA 3DLGA 3CQ8A 1NJZA 4BACA 4DU1A 4M3TA 1VSHA 3NF9A 4CJRA 4CF2A 4DTXA 4DTOA 1RT2A 4CF0A 2XO7A 1X9MA 1HQEA 4AHSA 4W5OA 4BDYA 4CJ3A 3TAGA 3WNEA 2P5GA 4E0DA 4PQUA 4DLGA 1DLOA 2B5JA 4C8MA 2OPQA 5CZ1A 4CIEA 1IKYA 4F3TA 4CEOA 4K8XA 4F3OA 3RRHA 1RDCA 4DQSA 4YNQA 4C8OA 2XRIA 5CYQA 4CF1A 2HNZA 4CGFA 1LV5A 1R0AA 3HPHA 3MEGA 4AH9A 4JRQA 2FBXA 5FROA 3OYLA 3OYIA 4LH5A 2HHTA 1SUQA 1X9SA 3ZT2A 3BGRA 4FLUA 3VA3A 1I39A 3CM5A 4BWJA 3QETA 4ID5A 4ICLA 1LW0A 1WAJA 4CEDA 1WSIA 4DTUA 1NJWA 4CCHA 1TL1A 1RILA 2HHUA 1U49A 1KFDA 1Q9YA 3HSTB 3AO4A 4OKKA 5KRSA 1FKOA 1G15A 4PWDA 3TAMA 1RT6A 3AVIA 1UA1A 3KD5E 3MAQA 4B9NA 4FJXA 4RW8A 3THVA 3SI6A 2KW4A 1T03A 3SCXA 3L2VA 1RT4A 2B4JA 1JLAA 3KLEA 3LZIA 4RW7A 1ZBFA 1N5YA 3K5OA 4MQ3A 3D45A 4YFUA 3SYZA 1J9AA 1NJYA 3VQEA 4FK4A 3DYAA 3ASMA 4CIGA 3AVHA 1WSEA 1VSKA 4CEQA 1S1XA 3DLBA 1NOZA 2FBYA 3L8BA 3C6TA 3KLFA 4Z4EA 3HJFA 2QKBA 3K5LA 3HM9A 4H4MA 3NAEA 4O5BA 4W5NA 4L8RB 2YKNA 4ELUA 4M3RA 3HXMA 5I42A 4I7FA 2Q3SA 4AHUA 1C0UA 4CFAA 3SQ1A 4B9MA 3KKRA 2RF2A 3O4QA 2XY5A 3DOKA 1QSYA 2X74A 4FVMA 4ELTA 4EZ6A 4KI6A 1SKWA 3NFAA 1ITGA 3KLIA 2KQ2A 4FYDA 1NK0A 2HNDA 3QIOA 4CK2A 4BE2A 3P5JA 3OYEA 1W0HA 4LSLA 1S1VA 2LSNA 5JS2A 1F21A 1TL3A 3LPUA 4FLVA 1UWBA 4E3SA 2XHBA 1ASUA 4BE1A 4DTNA 4B9VA 4DSJA 2HHSA 1DTTA 3OJUA 1C1AA 1LWEA 3OYKA 3CFPA 3TABA 1HNIA 2I5JA 3VA0A 4M42A 3OYCA 4DMNA 1RTJA 3V9XA 4BWMA 3CM6A 1BQNA 2HNYA 4OKEA 2YNFA 2ZQBA 4IG3A 4OJRA 4CEFA 3LAMA 5J1EA 3NE6A 1ASVA 5KGXA 4DTPA 1U4BA 3PX0A 3LP3A 4CJVA 4FJKA 3OYMA 1UA0A 3SZ2A 4M3UA 4E89A 4CK3A 4Y1CA 4KHSA 3NGIA 1QS4A 4FJMA 4BDZA 4M3ZA 1JL2A 3ZCMA 4B9LA 3QNOA 3ZSZA 4F8RA 3LDSA 4R5PA 3PO4A 3V4IA 4KTQA 1QHTA 1VSIA 3VQ7A 4FJLA 4FJHA 3L2WA 5C42A 3I8DA 1D5AA 2HVIA 1EETA 1VSDA 1X9WA 2X6NA 4I2QA 1NK7A 1B9DA 3VQ6A 2O4IA 4ZTJA 4HUGA 1TKDA 1RCHA 4KI4A 4M3XA 1EKEA 2X78A 4N56A 4ZTFA 2JLEA 2QXFA 4ZHRA 4Q5VA 2HHWA 3CG7A 4FJ7A 3AVBA 2KTQA 1SV5A 3LAKA 4FZXC 4CHOA 1HQUA 4DU3A 4EP5A 3PX4A 3S3MA 4FJ9A 5FRNA 4Q0BA 4J2EA 3KIOA 1NK8A 3I0RA 2HMIA 4FK0A 3ISNC 4Z4GA 1VSEA 2FBVA 1RTIA 4NCGA 3NCIA 2QKKA 1TV6A 4KTWA 2DFHA 2HW3A 2GV9A 1NKCA 3ALYA 2YNIA 1KFSA 1YTAA 4O44A 1LAVA 3WNHA 3QESA 4F2RA 3ZSYA 1W9HA 1VSMA 2IS3A 4CJQA 1HYZA 3MEDA 4FLZA 4B08A 1FKPA 2VWJA 1CZ9A 1S9GA 3MXMA 2Y1JA 4M3YA 3TANA 4B9SA 2JGUA 4CFCA 1WN7A 3KKSA 3NGZA 4FCYA 1RDAA 4FLWA 4HUEA 1NJXA 2OZSA 4CJEA 4KRFA 2ATQA 1KLNA 5CZ2A 4FW1A 4CHZA 4OGCA 3V9WA 2PYLA 4C8LA 4K8ZA 4KHWA 1BGXT 1BI4A 2YHAA 4EP4A 4DSEA 3SPYA 5JS1A 3P1GA 3LALA 1KVAA 1S1TA 4PA1A 4FM0A 4AHCA 4RG8A 3KJVA 1NOYA 4G1QA 3ZT0A 5J2PA 1GOBA 1L3VA 1IKVA 3PV8A 4F2SA 3QEIA 4E7HA 1I3AA 4J2BA 2X6SA 3DLKA 3OY9A 2XY6A 1KLMA 1QSLA 4AHRA 2G8HA 3F9KA 3QEWA 4M41A 1NK6A 1L5UA 4DSKA 1RNHA 3CFOA 4KTZA 4DQPA 5J2MA 2YHBA 2OA8A 1L3UA 3U3GA 3AVMA 3MXIA 4HTUA 4M3WA 2FC0A 1FXXA 3OYNA 4DQIA 3ZSWA 3VQ9A 3PY8A 3AA2A 1XHXA 1JLQA 4OGEA 4E1MA 4OVLA 3K2PA 4F4KA 1ASWA 2HB5A 3HP6A 3QEVA 4C8KA 3G10A 1BI4B 4Z4HA 2G8KA 1EP4A 3O3FA 4DFKA 3EYZA 4FXDA 3P83D 1VSJA 1RBRA 5KRTA 4IFVA 1XHZA 4DWIA 4AILC 2YV0X 4JS5A 4KB0A 2A1SA 4DSLA 1HYVA 1EX4A 4CJPA 3NH2A 3DLHA 4FW2A 1KSPA 2EHGA 1TK0A 3NH0A 3AA5X 4CECA 5SZTA 1SL0A 2E6MA 1TAQA 3FFIA 1KCFA 2PZSA 1ZBHA 4CGGA 4HVJA 4DLEA 2OPRA 4W5TA 3OVNA 4OPJA 3NHGA 1GOCA 4KFBA 3KK2A 1T7PA 4KB1A 2ETJA 2IGIA 1JL1A 4O0JA 3ZSOA 4CJKA 3NH1A 4OKJA 3D0PA 1X1PA 3VQPA 2KZZA 1BCOA 2YNHA 3LPTA 3L2UA 3M8SA 1B9FA 2IDOA 4E7LA 3TARA 2PYJA 1ZBUA 3K58A 4HUFA 3KLHA 4N41A 2Z1IA 3LWLA 4KO0A 1TVRA 1O1WA 3AO2A 5D3GA 4FLTA 3TWHA 2D0CA 4M45A 3MECA 1VSFA 4DFMA 3SQ4A 1RDBA 1VK0A 2E6LA 3ZSXA 3KLGA 1QSSA 1YT3A 3WNFA 4DSFA 1RTHA 5HP1A 1N6QA 2BDPA 4GW6A 4CIFA 1BISA 4GMJB 1WSHA 2NUBA 2A1RA 1WSGA 3B6PA 4CGJA 3HPOA 3OJSA 3KK3A 2BANA 3U6FA 2QK9A 3K5MA 3OYFA 3BDPA 2F8SA 3CYMA 1NKEA 4CE9A 4CGIA 2B6AA 4RW6A 5CYMA 4QOZB 1KVBA 4W5RA 1RTDA 4Z4CA 1YTUA 2Y1IA 4LSNA 1S6PA 5C24A 4CJUA 4FLYA 3SUPA 2G8UA 5HBMA 4XIUA 1WAFA 1MU2A 1NK9A 4AHVA 3RR7A 2G8WA 4KHUA 3HL8A 4E1NA 2VWKA 4JRPA 1ZBIA 1BQMA 4O4GA 1Q9XA 1A5XA 4CF9A 3U3YA 2KFNA 2G8IA 4DU4A 3TAFA 3VQBA 1BCMA 3LP1A 4CEEA 4KV8A 4E7IA 4DSIA 4CF8A 4CJLA 3SPZA 1T05A 1VRUA 2DFFA 3QNNA 1SKRA 1RBSA 1REVA 3HVRA 5HLFA 4FZYA 4FK2A 4OLBA 3VN5A 2DTUA 2HHVA 1JXEA 3IRXA 3DRRA 3ZT1A 4RW9A 3LZJA 1Z25A 4CHPA 1S9EA 2P51A 3ZT4A 4CFBA 4PUOA 1U04A 1KRPA 3ULDA 5EU7A 4ELVA 4N47A 2XY7A 3O3HA 3SUNA 1RT3A 2XY8A 3RMBA 1L3SA 2G8FA 3AVKA 3O3GA 5I3UA 4WE1A 3IS9A 2BGGA 1HRHA 4LH4A 4Y1DA 1FK9A 4J2DA 5HROA 4CHQA 1XC9A 1XI1A 4DTSA 1ZYQA 3CFRA 4KHNA 3V9SA 3V1OA 4QAGA 1JLCA 3RMDA 4JLHA 3AO3A 2G8VA 2HHXA 2KZMA 3EY1A 2PY5A 2GBZA 3V9UA 2E4LA 3DLRA 4B8CA 1SL2A 5HRPA 3NGYA 3QEXA 2IAJA 4NYNA 3HK2A 3AVFA 3LP2A 1S6QA 1KTQA 3A2FA 3IAYA 2BE2A 5KGWA 4CFDA 4I9QA 5FRMA 2IOCA 3DI6A 4BE0A 3H08A 4C8NA 2RKIA 1JLEA 5J2NA 3DLEA 1LW2A 3V1QA 3AVJA 3VQCA 1ZBLA 3QIPA 3WNGA 3T3FA 3PUFA 1GOAA 1A5VA 4PY5A 1U47A 3VQAA 1TGOA 3M8PA 1WSFA 3AVCA 4FM1A 1WNSA 4KKOA 1K6YA 4NYFA 4CESA 1NKBA 3DRPA 1JLFA 1QTMA 3RR8A 4DF4A 3L3VA 3T19A 1HNVA 3ZSVA 2RPIA 3NBPA 3DMJA 4DTRA 4FJIA 1A5WA 1RDDA 2ITGA 3VQ4A 1TK5A 1QQCA 4IKFA 1NK4A 4B9UA 3HYFA 3HO1A 1D9DA 4RW4A 3JSMA 3QLHA 1IKXA 3M8QA 4CEZA 1C1BA 3NF6A 3SV4A 1RT7A 3PO5A 3KK1A 1CLQA 4AHTA 3ITHA 5E41A 4IG0A 4CEBA 1EXQA 3VQ8A 4UQGA 3AVGA 3RMAA 1JXBA 1CZBA 2Z1HA 5K14A 5C25A 4GVMA 2ZD1A 3LWMA 2Z1GA 1IKWA 2ZE2A 1WSJA 4CJWA 4N5SA 1Y97A 1TKXA 3V1RA 5SWMA 3L2RA 4FJJA 3RWUA 2O4GA 1JKHA 2OPSA 3OYAA 1KVCA 4I2PA 4LY7A 1VRTA 4O55A 4I9LA 4DS4A 3B6OA 1S1UA 4CERA 5FDLA 5T7BA 3SQ2A 3QEPA 4MFBA 5HRRA 2F8TA 3K57A 4CK1A 1NK5A 1BL3A 2D0BA 1LAWA 4BDPA 4W5QA 4KHQA 4HHTA 4FJNA 4H4OA 1LWFA 2OPPA 2P1JA 3KTQA 3DRSA 1JLBA 1L3TA 3MEEA 3QINA 4E7KA 4NCAA 4DF8A 3NF7A 5DK5A 3AV9A 5J2QA 3MXJA 2D5RA 4QCLA 4Z4IA 1UOCA 2DFEA 3AA3A 3OYJA 1HPZA 1BHLA 4OLAA 2HVHA 3OYHA 1RBUA 1VSLA 3AVLA 3O4NA 4IDKA 3HP9A 3RTVA 4DFPA 3DOLA 3TR8A 3S3NA 1TAUA 3EZ5A 1C6VA 4DTJA 1BIUA 3C95A 3HVTA 3TAEA 2AJQA 1J53A 3LANA 2OYQA 1YVUA 1QE1A 3M8RA 1DTQA 3K59A 1CXUA 5CY4A 3OYDA 4DQRA 3RRGA 3C94A 1Z26A 1RBTA 1SL1A 4N76A 4JS4A 3HPGA 3ZT3A 4OPKA 4TSXA 1HYSA 2OZMA 3IG1A 4DG1A 1RT5A 4CJ5A 1U48A 1WLJA 4IBNA 4CJFA 4FJGA 1UAXA 2IC3A 4FZZA 3RMCA 1HJRA 3NDKA 3AVNA 2VG6A 4Z4FA 1HMVA 3AO1A 1TKZA 5KTQA 2RN2A 1XWLA 1JLGA 2WONA 3L3UA 3OYBA 3TI0A 3TAQA 3AO5A 2FBTA 4FJ8A 2YNGA 3E01A 3JYTA
chains in the Genus database with same CATH superfamily
4CEAA 3SV3A 3V6DA 1RFQA 3PX6A 4B8AB 3G0ZA 2E1ZA 1ESVA 5MLCQ 1IO2A 3VETA 3V81A 3S3OA 1T8EA 3MN5A 5HRNA 4IFYA 1OH5A 4CW7B 5EVZA 5KI6A 4B3OA 3H6EA 1QQMA 1D8YA 1VQPN 2P9LA 5JLHA 4Z0UA 3CC7N 4KHYA 3K5NA 4CJSA 2YKMA 3L0QA 3F73A 3S9HA 1C1CA 3KD1E 3CJ9A 5BR9A 3SUOA 1H1VA 4BQLA 4FWSA 2P5OA 1GLDG 2WOMA 2HHQA 1P8ZA 2EX3A 4KPYA 2Q2RA 3SBGA 3VEVA 2FF6A 1D9FA 3AA4A 1NG9A 3I0SA 3OS0A 3CQ8A 1NJZA 4BACA 4CD1A 1VSHA 2P9SB 3NF9A 3QFUA 3LM9A 2XO7A 3BZKA 4PKGA 1HKBA 3I56N 5GIOA 4FWOA 4CIEA 4Z94A 3RVCA 4CEOA 3PLAA 4F3OA 1VQON 3KWIA 3HPHA 3MEGA 1YI2N 2FBXA 3AGKA 4LH5A 4YORA 1SUQA 4BY9C 4FLUA 3DXMA 2ZGZA 4DV3K 3OW2M 1FW6A 5AQIA 4ID5A 1XNRK 1U49A 3HSTB 3CIPA 4K0KK 2PFUA 2YI1A 3TAMA 1RT6A 4FJXA 3SI6A 1T03A 1CZAN 1RT4A 4RW7A 3BF3A 3DAWA 5GIPA 3D45A 2H3GX 1K8KB 3AAPA 4FO0A 4FK4A 3AVHA 2P9IB 1WSEA 3O5BA 4L8RB 4M3RA 3AGRA 4I7FA 4AHUA 4CFAA 3SQ1A 1NNEA 4NLCA 4FWPA 3VF2A 1QSYA 3FZKA 3ZX3A 4FVMA 4ELTA 1SKWA 3SAFA 2NRHA 1ITGA 1NK0A 5KPRA 4BE2A 3OYEA 3AY9A 3OHRA 1F21A 4E3SA 4B9VA 4DSJA 2HHSA 5M1PA 3C65A 4LF7K 2I5JA 3VA0A 5ELZA 3OYCA 1RTJA 4IOAL 2HNYA 4OKEA 5BR8K 4HWIA 1U4BA 3PX0A 2FSNA 4Y1CA 1QS4A 4FJMA 4M3ZA 3ZCMA 3ZEUA 3QB0A 3V4IA 4KTQA 4IOCL 4FJHA 3FZMA 1TYQA 2HVIA 1XUPO 4LC9B 4DB3A 1NK7A 3VQ6A 4ZTJA 1TKDA 4CD3A 1QVGM 4KI4A 1EKEA 4JD2A 2QXFA 4FJ7A 5AQJA 4AM6A 3R8EA 5FRNA 3S3MA 3UKRB 3THYB 3KIOA 4J2EA 4FK0A 3ISNC 5C12A 3NCIA 4M7XA 2YNIA 1DT9A 3IMXA 3QESA 5JVHL 2E2OA 2QXLA 3CJ1A 3O1BA 1WBBA 1S9GA 3MXMA 2Y1JA 3TANA 3D2EA 1LOTB 4HUEA 4K8ZA 4KHWA 2P9LB 5FPMA 1ATSA 4QS9A 1S1TA 3CI5A 4RG8A 1ILYA 1XQSC 4BRAA 1NOYA 5J2PA 1GOBA 3EE8A 4JI5K 3QEIA 1IBKK 1I3AA 4J2BA 2QEXN 3WUHA 3DLKA 3OY9A 1K73O 1KLMA 3ULEA 2G8HA 3CJCA 3D7EO 3L6QA 1X9JA 2YHBA 3CQXA 1L3UA 3LM2A 3AVMA 3ZSWA 3VQ9A 3PY8A 3AA2A 4OGEA 3ENHA 3K2PA 1ASWA 4BG8A 4CZIA 4Z4HA 3EYZA 1JCFA 4MDAA 4JHDA 1RBRA 5KRTA 1JJ2M 4NO7A 3VEWA 3J80O 1NGGA 1HPMA 5GINA 4CECA 5SZTA 4DR1K 2E6MA 5AZJA 4JI0K 3I55N 3LDOA 2OPRA 3P39A 3OVNA 4W5TA 3NHGA 3KK2A 2PAVA 3OBWA 1KD1O 4NLBA 1X1PA 2F9TA 3LPTA 3HOSA 2IDOA 4H0YB 1ZBUA 3KLHA 4N41A 5CE3A 3U4LA 3HI0A 1O1WA 3TWHA 4H5RA 3H3OB 3MN9A 2JWLA 1YJ9N 3ZX0A 5E26A 1R59O 1QSSA 3WNFA 4DSFA 5AR0A 5HP1A 4BRDA 2NUBA 4IXCA 3B6PA 3KK3A 3U6FA 2BANA 5C2DA 5H1SQ 3CYMA 1NGBA 4CE9A 4JKBA 4W5RA 3ZETA 2G8UA 1S6PA 4CJUA 5LMNK 1NMDA 1BOTO 4CZHA 1NK9A 4X64K 1N34K 4NXMK 4BG9A 3QDKA 3HL8A 4O4GA 4CF9A 3U3YA 5AQZA 1YVNA 2VQFK 3VQBA 1MWKA 4CEEA 3EE9A 4CF8A 1VRUA 3WXIA 3MX5A 1REVA 4BRKA 3HVRA 5HLFA 4LFBK 3SBTA 4OLBA 3LZJA 1Z25A 1KAYA 1RGIA 2V52B 1WBDA 4ELVA 3AAQA 3IUCA 3O3HA 3SUNA 4CZMA 4YOUA 2YJFA 5I3UA 2FF3B 2VGNA 5HROA 4G9ZA 1TYQB 2EWSA 1WUAA 4C1NK 1KAXA 4JLHA 3AO3A 4EAHD 2HHXA 4FWMA 2KZMA 2PY5A 1K8AO 4B8CA 1SL2A 1MA9B 5HRPA 3NGYA 2AP1A 4NYNA 3HK2A 2GX9A 3LP2A 1HX1A 1S6QA 3C6AA 3E1YA 4PHTX 5KGWA 4I9QA 5FRMA 4BE0A 1E4GT 2FLOA 4DV2K 2RKIA 4YDUA 4BVOA 5J2NA 1NGDA 3VQCA 2AA4A 4FWRA 3PUFA 4B1ZA 3VQAA 3D2EB 2W6LA 4A2AA 2W41A 3CJAA 4RCHA 3RR8A 4IO9L 1OH8A 3ZSVA 3DMJA 4KHPK 1A5WA 1TK5A 3E9OA 3HYFA 4XH5A 3PO5A 4WFBL 1CLQA 3S41A 3CCMN 4CEBA 5F2RA 1VQ6N 2E20A 4AM7A 5K14A 1V4SA 2QWLA 5AQTA 2ASOA 2HF3A 5SWMA 3L2RA 3OYAA 3QEPA 3UKUA 3VF6A 3F9MA 2F8TA 3K57A 4CK1A 3O6WA 2D0BA 2VCPA 3VGLA 4JAXA 4W5QA 2Q0RA 4KH4A 4HHTA 4H4OA 4DKWA 4M7YA 3DRSA 4E7KA 3AA3A 4JI1K 3CCRN 4HTLA 2YHXA 1RBUA 1VSLA 2W6KA 4DFPA 3HP9A 3TR8A 3C95A 3TAEA 3M8RA 4B1VA 5FPDA 1ZC6A 3RRGA 1LCUA 5M1NA 1SL1A 3CCLN 2FSJA 4JS4A 4IDHA 4LFCK 4OPKA 4JKAA 4WFNL 3IG1A 4IBNA 2IC3A 3RMCA 3AVNA 5F1XA 4DV4K 1T44A 1XNQK 4BRNA 1JLGA 1OVYA 2VWBA 4MLHA 3JYTA 4U7BA 3NMUA 3ZSRA 2YCHA 1RBVA 3L2QA 4NXNK 5DM7L 4HCCA 1LWCA 2R7YA 4CJTA 2D1KA 4H5TA 1RT1A 4FWKA 2IVPA 3VQ5A 4DTMA 2P9SA 3VQQA 4EZ9A 5KQ8A 4QS7A 1VAZA 4CJ4A 4CHNA 3LP0A 1S72N 3ZSQA 5JICA 4K43A 4FM2A 1J5OA 3WXKA 1YIJN 3AVAA 1VQMN 4NCBA 5AFUH 3C7NB 1VQ8N 4X62K 3U9DA 3BY5A 3B8AX 4JK9A 4CF2A 4RWTA 4CZLA 4CF0A 3SLCA 4PQUA 4CJ3A 4ILJA 4PKIA 3WNEA 4DLGA 1DLOA 2B5JA 4C8MA 5CZ1A 4F3TA 3P4IA 1K8KA 2P9IA 2HNZA 4CGFA 4BRHA 3TSUA 4AH9A 5FROA 3E9PA 3OYIA 3QICA 1X9SA 5GADP 1U6ZA 4BWJA 2ITMA 4BROA 4CVNE 4CEDA 1WSIA 1TL1A 2HHUA 5KRSA 1FKOA 2PBDA 3BZCA 3VERA 5M1QA 3MAQA 2O8CA 3TSQA 1TUYA 2YHWA 3SCXA 3KLEA 3MDQA 3LZIA 5FLXO 1N5YA 4YFUA 4JN4A 4CIGA 3ASMA 3PIOL 4UY8O 3L8BA 1NU0A 3R9PA 4IEIA 4YOVA 3K5LA 4FWLA 4O5BA 3ZYYX 3BF1A 2NZTA 3HXMA 3OA9A 5I42A 2Q3SA 2QW9A 4B9MA 3KKRA 1BUPA 3UKUB 3Q7CA 2KQ2A 3H46O 2HNDA 3CJBA 4IO8A 3QIOA 1W0HA 1JCEA 2LSNA 4EHUA 4FLVA 4DTNA 4BE1A 4IZ9A 5M1KA 1DTTA 1LWEA 1HNIA 5J1EA 2YNFA 2ZQBA 3LAMA 4DR5K 3F5TA 3NE6A 5KGXA 3ENBA 3VF4A 4CJVA 2QTDA 1EWRA 4BC2A 3NGIA 3ZLJA 2NNWA 4BDZA 3P38A 3VENA 3THWA 2P9KB 3O08A 5AQNA 1GLJO 1QHTA 1VSIA 4FJLA 5GAHP 1EETA 2WTUA 2VYPA 3FZFA 2HHWA 2JLEA 5AQLA 3C0BA 4H03B 3LAKA 5AQOA 1HQUA 4DU3A 4LF4K 3BEXA 4BRGA 4JI3K 4Z4GA 3I0RA 5M1FA 3FE1A 4JI8K 4NCGA 2QKKA 2Q31A 1TV6A 2DFHA 2GV9A 3E66A 1NKCA 3ALYA 1BO5O 1W9HA 1VSMA 2IS3A 4CJQA 1Q18A 1HLUA 2GELA 2QWMA 1FKPA 2UU9K 1O13A 3NVMA 4BR7A 1QQNA 4B9SA 5KQDA 1WN7A 1OH7A 2WC9A 4FLWA 4KRFA 2OZSA 2ATQA 5CZ2A 4CHZA 3V9WA 3DXKA 4H0XB 1QHAA 2YHAA 5JS1A 4DSEA 3SPYA 3P1GA 5BREA 4AHCA 3KJVA 2GEMA 1WB9A 3QBXA 4G1QA 1L3VA 1YUWA 2QWQA 5AJ3K 3F9KA 4M41A 4B3MK 2HSTA 3CMEN 2QWNA 4KTZA 3CFOA 4JYAK 2OA8A 4JI4K 4JEPA 3MXIA 4BR2A 3CD6N 4V19S 4F4KA 1IJJA 3HP6A 5E84A 3G10A 1BI4B 2G8KA 3O3FA 1ZXOA 4DFKA 4O8KA 3RSEA 4DWIA 4AILC 2YV0X 2HBMA 4JS5A 4KB0A 3THXA 2A1SA 4DSLA 1EX4A 4CJPA 3H1QA 5BPNA 3DLHA 1TK0A 3AA5X 1SL0A 1MDUB 1N8RO 4KH5A 4GVEA 3HOTA 4OPJA 2NRVA 1T7PA 1YJNN 4PL7A 2IGIA 5F0XA 4YOXA 1D4XA 4O0JA 4JKGB 5LY3A 3GL1A 4DV1K 1NGCA 3D0PA 1BCOA 2YNHA 2VGMA 4HUFA 5CHIA 5BN9A 1TVRA 3AO2A 4FLTA 2O8CB 4YOWA 2D0CA 4M45A 4A2BA 3MECA 1VSFA 3SQ4A 1RDBA 3CCSN 3ZSXA 3JS6A 1Z05A 1RTHA 1N6QA 4CIFA 1BISA 1WSHA 2A1RA 1WSGA 3HPOA 4CGJA 3DLLL 3M5RA 3K5MA 3OYFA 3CF5L 3BDPA 2F8SA 2NRWA 2A41A 1Q86O 5CYMA 2CGLA 1YTUA 1T6DA 4YOYA 3SUPA 2I7NA 5HBMA 5BRDA 4XIUA 1WAFA 4KHUA 5LJWA 2G8WA 3O9TA 4E1NA 2VWKA 4JRPA 1BQMA 1GLEG 2P9NA 2P9PA 4KV8A 1V4TA 4BR4A 1EQYA 4CJLA 1SKRA 1RBSA 4CZJA 4FZYA 2OANA 3VN5A 2DTUA 4B1XB 4RW9A 2P51A 2E2PA 1U04A 1KRPA 4Y0WA 2ZWHA 4XH1A 1RT3A 1X3MA 3RMBA 1I94K 3N4PA 3THWB 4BRQA 5AQKA 4IJNA 4JKFA 5DM6L 2BGGA 2HOEA 4LH4A 4QS8A 2BUPA 3GG4A 4J2DA 3H1VX 2YHYA 1ZYQA 4DR7K 5KPZA 3V1OA 4ISEA 2E8AA 3EY1A 3G6EN 3FZLA 2IAJA 3AVFA 3A2FA 4K25A 2A6AA 2BE2A 2IOCA 3K0SA 3DI6A 2I7PA 1SQKA 3CC4N 4JI7K 1LW2A 3V1QA 5ADXH 1ZBLA 2A3ZA 1A5VA 4PY5A 1K9MO 3AVCA 4FM1A 1WNSA 3CPWM 3O80A 1JLFA 5C0YA 3DXKB 3L3VA 1HNVA 4DTRA 4IKFA 1RDDA 1QQCA 2KLAA 1D9DA 1NLVA 1IKXA 3GE1A 4CEZA 4H5NA 3NF6A 3CCVN 4AHTA 4WYBA 5E41A 3VQ8A 3SMPA 4UQGA 3AVGA 5TKWA 5C25A 3LWMA 2ZD1A 3V1RA 4IEEA 1KVCA 4O55A 1VRTA 4DS4A 3B6OA 4K42A 4CERA 5T7BA 4B3RK 1LAWA 4DQ8A 4BDPA 4CZEA 4BRPA 3KTQA 3EN9A 4LF8K 2YX6A 4A57A 4NCAA 4DF8A 5J2QA 3AV9A 1OH6A 4QCLA 4Z4IA 3RSEB 1BHLA 3FLCO 3THXB 1BA1A 3AVLA 1J6ZA 4OX9K 4DTJA 3HVTA 3TTCA 1J53A 3LANA 1KXPA 3K59A 1YAGA 1CXUA 2VQEK 4DV6K 4DQRA 3CQYA 1RBTA 1BA0A 3KZBA 4H0PA 4ILGB 4WQ4A 3ZT3A 1HYSA 2OZMA 4X66K 4CJ5A 3A0IX 1U48A 1HJRA 3NDKA 1HMVA 3OTOK 1TKZA 5KTQA 2O8BA 1XWLA 3OYBA 1IBLK 4XH4A 4CGHA 2Z1JA 3SUQA 4J2AA 4E19A 4O0IA 4OO1J 3JAMO 4FLXA 3O9QA 3ID6A 4EIAA 3OS2A 1T3VA 3NF8A 3OS1A 3SQ0A 1CXQA 1TKTA 3P31A 2F96A 3C7NA 3VGKA 1S5JA 3ATUA 1M90O 4KREA 4IWVA 4H8KA 4MO4A 1U45A 4LD0A 2P9NB 2P9PB 3HT3A 3VQDA 5DMRA 4DV7K 2DY4A 3VTIA 2D0AA 1TK8A 3R6MA 4L3QA 3OYGA 3O9SA 2D4WA 1S3XA 2KFZA 1NGJA 4DR4K 4JV5K 2E2QA 4FL9A 3WXJA 4CZFA 5AQFA 1W2BM 1BDGA 3UIQA 4CGDA 4I6MB 4DU1A 3CETA 3O1WA 4A5BA 4DTOA 4AHSA 4W5OA 3TAGA 2P5GA 2ASPA 4BR5A 4R79A 3GDQA 4K8XA 3J8AA 2CGJA 4DQSA 4CF1A 1YXQA 4JRQA 3BUZB 2BTFA 2J4RA 3BGRA 4FOIA 3ZT2A 3VA3A 3QETA 1LW0A 1WAJA 4CCHA 1KFDA 4K41A 3AO4A 4AF1A 4GNIA 4OKKA 2F7TA 1N36K 1N33K 1G15A 3AVIA 4FWNA 1UA1A 2NRXA 3KD5E 3MN6A 5AQSA 2O8FA 5ADXA 3THVA 2KW4A 1HKCA 2B4JA 1JLAA 2Q97A 5M1OA 4MQ3A 3DYAA 1VSKA 4ISFA 1S1XA 1NOZA 2FBYA 4Z4EA 3KLFA 1NBWA 2QKBA 3HM9A 4H4MA 4EHTA 3NAEA 3GBTA 3A5OC 2YKNA 3U9ZA 4ELUA 1YF5L 1C0UA 2P9KA 2RF2A 2RHKA 3DOKA 4CJ7A 3EKUA 3KLIA 4FYDA 1SAZA 3P5JA 4LSLA 1S1VA 3LPUA 1TL3A 1UWBA 2XHBA 1ASUA 3OYKA 3CFPA 3CHWA 4M42A 2HHHK 4DMNA 4CEFA 3HZ6A 4DTPA 3LP3A 3SZ2A 4CK3A 4KHSA 1W7AA 3UE5A 1HUXA 3QFPA 4B9LA 3K9KA 3VEXA 3VOVA 4R5PA 3PO4A 1NJIO 3I8DA 4ISGA 3T69A 1VSDA 3I8BA 2X6NA 1YJWN 4HUGA 4M3XA 4N56A 4W5NA 1W97L 1G99A 1M1KO 1E4FT 3CG7A 2ZJPL 2KTQA 3PX4A 3UB5A 4FJ9A 2O8BB 1X3NA 5LJVA 1VSEA 2FBVA 3WXMB 3J7AP 4KTWA 2HW3A 1YTAA 4O44A 3WNHA 4F2RA 3ZSYA 3MWTA 3A5LC 1U2VA 4FLZA 4DR2K 4YOTA 3A5NC 4M3YA 1N32K 5B8HA 4X65K 4CFCA 3KKSA 3NGZA 1RDAA 2A42A 5JMVA 2WUSA 4CZGA 4KBOA 2PYLA 4OGCA 2O8EA 1RDUA 3VPZA 1BI4A 1IG8A 3FZHA 4PA1A 2QA4N 4CBWA 1FJGK 3ZT0A 1IKVA 4F2SA 1NGFA 2F4VK 2KHOA 1NK6A 3HM8A 3D6RA 2QI2A 4YHHK 4DQPA 5J2MA 3U3GA 4M3WA 2FC0A 4DQIA 4JKGA 5AQMA 4GV6A 4BRIA 1XMOK 1JLQA 4OVLA 3G4SN 2HB5A 3L4QA 3WXLA 4FXDA 3P83D 1ATRA 4DUYK 3WQUA 4B1UB 3T1YK 5HOOA 3SAHA 4FW2A 3NH0A 1GLBG 1WOQA 1KCFA 2E1YA 4DLEA 1GOCA 2HBKA 1VQ9N 3LDPA 1JL1A 3ZSOA 3NH1A 4OKJA 3VQPA 3HBTA 1VQKN 4FVUA 2ASMA 3M1FA 2PYJA 4E7LA 3TARA 3TTFA 3MCAB 2UXCK 3PSFA 3LWLA 2NRZA 4KO0A 2QM1A 2O8FB 5EOYA 1VQ7N 1VK0A 2E6LA 3CXCM 4JI6K 4GW6A 4GMJB 3OJSA 3PSIA 4AQYK 2B6AA 4RW6A 4QOZB 1RTDA 4LFAK 2Y1IA 3VEYA 4FLYA 1ZBSA 3RR7A 3QMLA 2WFBA 1ZBIA 1Q9XA 1A5XA 2G8IA 1KAZA 3TAFA 3LP1A 3TTDA 4E7IA 4DSIA 3QNNA 4FK2A 2W40A 2YJEA 2HHVA 1JXEA 2FXUA 3DRRA 3F2KA 4CHPA 4PUOA 4BVPA 3ULDA 5EU7A 2BH1A 4N47A 4DCHA 2HBJA 2XY7A 3VMFB 3PIPL 2XY8A 2A5XA 3HTVA 1L3SA 5BPLA 4H5VA 3AVKA 3O3GA 1QZ6A 3WEEA 3TSPA 2A40A 1C0GA 1XC3A 4WE1A 4YDUC 5JLFA 1J5EK 1HR0K 4WQ5C 4CHQA 1XC9A 2CGKA 1XI1A 3O9UA 4DTSA 3CFRA 3V9SA 2OTLN 2G8VA 2GWJA 5I9EB 5KPTA 1NGHA 2E4LA 3FGUA 4XEIA 2P9UA 2UXDK 3QEXA 4BC4A 5AQRA 3SAGA 1QZ5A 3T7ZA 4OPHA 4CFDA 1Q7YO 3H08A 1JLEA 2UUBK 3DLEA 1YHQN 3QIPA 3ATVA 3WNGA 1U2VB 4FPBA 3T1HK 3M3ZA 3TU5A 3EZWA 3SJHA 1WSFA 4KKOA 1K6YA 3W0LA 5EXWA 4CESA 1NKBA 4DR3K 2O8EB 1IV0A 3L4IA 4PL8A 2RPIA 2Q1NA 4FJIA 3HO1A 1IBMK 1NK4A 2F9WA 4RW4A 3JSMA 4BQZA 3M8QA 1NWKA 5AFUA 1C1BA 3SV4A 3Q7BA 3WQTA 2RE2A 3KK1A 3ITHA 2FSKA 3SK3A 1JXBA 5EY4A 3VGMA 4A61A 2Z1GA 2ZE2A 1WSJA 4CJWA 1Y97A 1TKXA 3U8XA 4FJJA 3RWUA 4GY2B 2O4GA 1JKHA 2OPSA 1NJYA 2UXBK 4I9LA 3SQ2A 1HNXK 3EEQA 1BL3A 5AQUA 5GAGP 2OPPA 4F9OA 1JLBA 3QINA 1VQ4N 3KK7A 3NF7A 5DK5A 4IJAA 1HPZA 3S3NA 3DOLA 1C6VA 5BN8A 2HBLA 2NRTA 5BRHA 1YVUA 1QE1A 4BREA 2OYQA 1DTQA 3C94A 1Z26A 2QWPA 5IWAK 4BGAA 4TSXA 3M6GA 4JKHA 4JKCA 2OCEA 4CJFA 1DEJA 1SS6A 2UUAK 4FZZA 3C6HA 2KKZA 1BU6O 3HRGA 3CCJN 2WONA 3TAQA 3AO5A 2FBTA 2YNGA 1EO1A 3H45C 1C0TA 2GUIA 4EFHA 2WBNA 4DFJA 2V51B 3KWGA 3QO9A 4MDBA 3FR0A 3A8YA 3V9ZA 2GWKA 3T1AA 1SKSA 4CZKA 1J54A 3C6UA 4I6MA 4CHYA 5BPMA 4B1YB 3TAPA 5IT9O 1GLCG 2W42A 2UYTA 4E7JA 2VG7A 3D2FA 3QERA 4FJ5A 2QWRA 3CC2N 4BR0A 4ID1A 4O8UA 4DS5A 1IH7A 3SJJA 4HCBA 5FPEA 1IG9A 1Q8IA 4KAZA 4B9TA 3DM2A 1C0MA 1BIZA 3MMVA 3SNNA 2DPNA 3G71N 2HF4A 5AQXA 5HRSA 2O8DA 1YITN 1B92A 2VG5A 5C15A 4C23A 3WEEB 1S1WA 4DQQA 3DLGA 1Y64A 4M3TA 3H3NO 4JI2K 4CJRA 4DTXA 5HL7L 1RT2A 1X9MA 1HQEA 4BDYA 4E0DA 3HSCA 3TPQA 2OPQA 3IKMA 1IKYA 3RRHA 1RDCA 4YY3K 2ZJRL 2P9UB 4YNQA 2XRIA 5CYQA 3CPEA 4C8OA 1JCGA 5AZIA 1LV5A 1NGIA 4CBUA 1R0AA 3OBYA 3OYLA 2HHTA 4BC3A 4DUZK 1I39A 3CM5A 3MK6A 5LMUK 3SMSA 1GLLO 4ICLA 3KVGA 4DTUA 1NJWA 1RILA 5AQYA 1Q9YA 2E5LK 4PWDA 4WF9L 4IFEA 4B9NA 4RW8A 2NRRA 4FSVA 3L2VA 1ZBFA 3K5OA 3G25A 3SYZA 1J9AA 3VQEA 4CEQA 4FOEA 3DLBA 1E3MA 1BWFO 3HJFA 3C6TA 4JNEA 3DXMB 5AQQA 3AARA 5FPNA 4DV5K 3O4QA 2XY5A 3CMAN 3N4QA 2X74A 4KI6A 4EZ6A 4BR9A 3NFAA 1C0FA 4CK2A 2IVNA 5JS2A 1KQSM 5C2FA 3O8MA 3OJUA 1C1AA 3TABA 1DGKN 5AQGA 4NB4A 4BWMA 3CM6A 1BQNA 3V9XA 4IG3A 4OJRA 1ASVA 2JWKA 4FJKA 3J7YP 3OYMA 1UA0A 3EO3A 4E89A 4M3UA 1MWMA 1HKGA 2ZJQL 1JL2A 3QNOA 3ZSZA 4F8RA 3LDSA 1SZ2A 5AQWA 3VTHA 1NGAA 2D0PA 1QQOA 5AQPA 3VQ7A 3L2WA 5C42A 1D5AA 1X9WA 4I2QA 4DR6K 3CERA 1B9DA 2O4IA 3J81O 1RCHA 2X78A 4ZTFA 4ZHRA 4Q5VA 3AVBA 1SV5A 4FZXC 4CHOA 4EP5A 1VQNN 4Q0BA 2ZGYA 4E1JA 2HMIA 2CH5A 1RTIA 3CCUN 1VQLN 1KFSA 1Q82O 1LAVA 3JXUA 3ZEUB 1HYZA 3MEDA 4B08A 3KHYA 2VWJA 1CZ9A 1VQ5N 1XMQK 1HNZK 2JGUA 4C1NI 4B1WB 4FCYA 4B3SK 1NJXA 2V7YA 4CJEA 1KLNA 4FW1A 4C8LA 4B3TK 3D2FB 4JD2B 1BGXT 4EP4A 1OVQA 2Q0UA 3LALA 1KVAA 4FM0A 3ZX2A 2IIRA 3W3DA 3MX2A 2GTDA 4JK7A 1Z6RA 3FFKB 3PV8A 4E7HA 5LL6Z 2X6SA 2XY6A 1QSLA 4AHRA 4BRFA 4WQ5A 3QEWA 1L5UA 4DSKA 1RNHA 4O5FA 2O8DB 2E2NA 4HTUA 1FXXA 3BP8A 3J7ZO 3OYNA 1XHXA 1NM1A 4E1MA 4C8KA 3QEVA 3CJ7A 1P90A 1EP4A 3EL2A 3A5MC 2GUPA 1VSJA 4IFVA 1XHZA 1HYVA 4U67L 3NH2A 1KSPA 2EHGA 3ULEB 5AZIB 1OKJA 1Q81O 3EKSA 4FWQA 2ZM6K 1TAQA 3FFIA 3MN7A 2PZSA 4MO5A 1ZBHA 4CGGA 4HVJA 1KC8O 4KFBA 4LF5K 3R1XA 1ATNA 4H0TB 1NGEA 4KB1A 2ETJA 4A5AA 4CJKA 3LDNA 2KZZA 1GLAG 3L2UA 3M8SA 1B9FA 1GLFO 3K58A 2Z1IA 2QWOA 5D3GA 1DKGD 4JHDB 4DFMA 4DV0K 4H0VB 3LL3A 3KLGA 1YT3A 2CH6A 5AQHA 2BDPA 2NLXA 1S22A 4GKKK 1HNWK 2QK9A 5AZJB 1NKEA 4BRMA 3O4WA 4CGIA 4CBXA 4J8FA 1KVBA 4Z4CA 4LSNA 5C24A 1MU2A 4AHVA 3ID8A 2KFNA 4DU4A 1BCMA 1RDWX 3LDQA 2E88A 1T05A 3SPZA 2DFFA 3R3LA 4DHYA 4H5WA 5AQVA 3IRXA 3ZT1A 1S9EA 4CFBA 3ZT4A 4OPAA 4M63C 3QBWA 3ZETB 2G8FA 3MCPA 4GV3A 3I33A 3IS9A 1HRHA 3VEZA 4Y1DA 1FK9A 4GKJK 2OTJN 3IFRA 4JKDA 1T6CA 4KHNA 4QAGA 1JLCA 3CCQN 3RMDA 3GOIA 2GBZA 3V9UA 3DLRA 4ILHA 2ZF5O 5EX5A 1HJOA 1KTQA 3IAYA 4B9QA 4C8NA 4BRCA 3ENOA 3AVJA 1QVFM 5TKYA 3T3FA 4BRLA 4FPAA 1GOAA 1U47A 1TGOA 3CCEN 3M8PA 4NYFA 3DRPA 1QTMA 4DF4A 3E9LA 3T19A 2UUCK 3NBPA 2ITGA 3VQ4A 4B9UA 1EWQA 3QLHA 1RT7A 4IOXA 2HMPA 4IG0A 3WT0A 1EXQA 3RMAA 4LF9K 1CZBA 2Q36A 2Z1HA 4GVMA 2IVOA 1VHXA 1TUUA 1IKWA 4WFAL 4N5SA 4PKHA 4BGBA 5GAEP 1NK8A 4I2PA 4LY7A 4JKEA 1S1UA 3DJCA 5FDLA 4MFBA 5HRRA 1NK5A 4CI6A 4A62A 4KHQA 4FJNA 1LWFA 2P1JA 4H0OA 4WQ4C 4A59A 3MEEA 1L3TA 3DWLA 4JK8A 3MXJA 2D5RA 1UOCA 2DFEA 3OYJA 4OLAA 2HVHA 5C10A 1BG3A 3OYHA 4KH6A 3O4NA 4IDKA 3K9JA 3RTVA 4WCEL 3VESA 1TAUA 3NVKA 3EZ5A 3LDLA 1BIUA 2AJQA 4BC5A 5CY4A 3OYDA 4MLEA 4N76A 3MWPA 3HPGA 3O9RA 4LF6K 4DG1A 1RT5A 2D0OA 4FJGA 1WLJA 1UAXA 4Z4FA 2VG6A 1NMNA 3AO1A 3UKRA 5BRFA 2RN2A 3THYA 5CR4A 3VEOA 3IDHA 2V7ZA 3L3UA 4RTFD 5A2QO 5JVGL 3TI0A 4FJ8A 3E01A 4GV9A
chains in the Genus database with same CATH topology
4CEAA 3SV3A 3ZSRA 3V6DA 3PX6A 1RBVA 1C0TA 4CGHA 2GUIA 4B8AB 3L2QA 3G0ZA 4DFJA 2Z1JA 3SUQA 4J2AA 4E19A 1IO2A 4O0IA 3V81A 3S3OA 1LWCA 4FLXA 2R7YA 3QO9A 1T8EA 4HCCA 5HRNA 3OS2A 4IFYA 4CJTA 3V9ZA 3NF8A 3OS1A 5KI6A 3T1AA 3SQ0A 1SKSA 4B3OA 1CXQA 1J54A 1TKTA 3C6UA 1D8YA 2F96A 4CHYA 3TAPA 1RT1A 1S5JA 2W42A 4E7JA 3VQ5A 4DTMA 2VG7A 4Z0UA 4KHYA 4KREA 4H8KA 3QERA 4FJ5A 1U45A 4LD0A 3VQQA 3K5NA 4EZ9A 4CJSA 4ID1A 2YKMA 3VQDA 3HT3A 5DMRA 3F73A 3S9HA 1C1CA 3KD1E 4CJ4A 4CHNA 2DY4A 4DS5A 1IH7A 2D0AA 3SUOA 3SJJA 1TK8A 4HCBA 1IG9A 3LP0A 3OYGA 2P5OA 3ZSQA 4FM2A 1J5OA 1Q8IA 4KAZA 2KFZA 2WOMA 4B9TA 2HHQA 3DM2A 1C0MA 1BIZA 2EX3A 3SNNA 4KPYA 5HRSA 3AVAA 1D9FA 3AA4A 1B92A 3UIQA 4CGDA 2VG5A 4NCBA 3I0SA 1S1WA 3OS0A 4DQQA 3DLGA 3CQ8A 1NJZA 4BACA 4DU1A 4M3TA 1VSHA 3NF9A 4CJRA 4CF2A 4DTXA 4DTOA 1RT2A 4CF0A 2XO7A 1X9MA 1HQEA 4AHSA 4W5OA 4BDYA 4CJ3A 3TAGA 3WNEA 2P5GA 4E0DA 4PQUA 4DLGA 1DLOA 2B5JA 4C8MA 2OPQA 5CZ1A 4CIEA 1IKYA 4F3TA 4CEOA 4K8XA 4F3OA 3RRHA 1RDCA 4DQSA 4YNQA 4C8OA 2XRIA 5CYQA 4CF1A 2HNZA 4CGFA 1LV5A 1R0AA 3HPHA 3MEGA 4AH9A 4JRQA 2FBXA 5FROA 3OYLA 3OYIA 4LH5A 2HHTA 1SUQA 1X9SA 3ZT2A 3BGRA 4FLUA 3VA3A 1I39A 3CM5A 4BWJA 3QETA 4ID5A 4ICLA 1LW0A 1WAJA 4CEDA 1WSIA 4DTUA 1NJWA 4CCHA 1TL1A 1RILA 2HHUA 1U49A 1KFDA 1Q9YA 3HSTB 3AO4A 4OKKA 5KRSA 1FKOA 1G15A 4PWDA 3TAMA 1RT6A 3AVIA 1UA1A 3KD5E 3MAQA 4B9NA 4FJXA 4RW8A 3THVA 3SI6A 2KW4A 1T03A 3SCXA 3L2VA 1RT4A 2B4JA 1JLAA 3KLEA 3LZIA 4RW7A 1ZBFA 1N5YA 3K5OA 4MQ3A 3D45A 4YFUA 3SYZA 1J9AA 1NJYA 3VQEA 4FK4A 3DYAA 3ASMA 4CIGA 3AVHA 1WSEA 1VSKA 4CEQA 1S1XA 3DLBA 1NOZA 2FBYA 3L8BA 3C6TA 3KLFA 4Z4EA 3HJFA 2QKBA 3K5LA 3HM9A 4H4MA 3NAEA 4O5BA 4W5NA 4L8RB 2YKNA 4ELUA 4M3RA 3HXMA 5I42A 4I7FA 2Q3SA 4AHUA 1C0UA 4CFAA 3SQ1A 4B9MA 3KKRA 2RF2A 3O4QA 2XY5A 3DOKA 1QSYA 2X74A 4FVMA 4ELTA 4EZ6A 4KI6A 1SKWA 3NFAA 1ITGA 3KLIA 2KQ2A 4FYDA 1NK0A 2HNDA 3QIOA 4CK2A 4BE2A 3P5JA 3OYEA 1W0HA 4LSLA 1S1VA 2LSNA 5JS2A 1F21A 1TL3A 3LPUA 4FLVA 1UWBA 4E3SA 2XHBA 1ASUA 4BE1A 4DTNA 4B9VA 4DSJA 2HHSA 1DTTA 3OJUA 1C1AA 1LWEA 3OYKA 3CFPA 3TABA 1HNIA 2I5JA 3VA0A 4M42A 3OYCA 4DMNA 1RTJA 3V9XA 4BWMA 3CM6A 1BQNA 2HNYA 4OKEA 2YNFA 2ZQBA 4IG3A 4OJRA 4CEFA 3LAMA 5J1EA 3NE6A 1ASVA 5KGXA 4DTPA 1U4BA 3PX0A 3LP3A 4CJVA 4FJKA 3OYMA 1UA0A 3SZ2A 4M3UA 4E89A 4CK3A 4Y1CA 4KHSA 3NGIA 1QS4A 4FJMA 4BDZA 4M3ZA 1JL2A 3ZCMA 4B9LA 3QNOA 3ZSZA 4F8RA 3LDSA 4R5PA 3PO4A 3V4IA 4KTQA 1QHTA 1VSIA 3VQ7A 4FJLA 4FJHA 3L2WA 5C42A 3I8DA 1D5AA 2HVIA 1EETA 1VSDA 1X9WA 2X6NA 4I2QA 1NK7A 1B9DA 3VQ6A 2O4IA 4ZTJA 4HUGA 1TKDA 1RCHA 4KI4A 4M3XA 1EKEA 2X78A 4N56A 4ZTFA 2JLEA 2QXFA 4ZHRA 4Q5VA 2HHWA 3CG7A 4FJ7A 3AVBA 2KTQA 1SV5A 3LAKA 4FZXC 4CHOA 1HQUA 4DU3A 4EP5A 3PX4A 3S3MA 4FJ9A 5FRNA 4Q0BA 4J2EA 3KIOA 1NK8A 3I0RA 2HMIA 4FK0A 3ISNC 4Z4GA 1VSEA 2FBVA 1RTIA 4NCGA 3NCIA 2QKKA 1TV6A 4KTWA 2DFHA 2HW3A 2GV9A 1NKCA 3ALYA 2YNIA 1KFSA 1YTAA 4O44A 1LAVA 3WNHA 3QESA 4F2RA 3ZSYA 1W9HA 1VSMA 2IS3A 4CJQA 1HYZA 3MEDA 4FLZA 4B08A 1FKPA 2VWJA 1CZ9A 1S9GA 3MXMA 2Y1JA 4M3YA 3TANA 4B9SA 2JGUA 4CFCA 1WN7A 3KKSA 3NGZA 4FCYA 1RDAA 4FLWA 4HUEA 1NJXA 2OZSA 4CJEA 4KRFA 2ATQA 1KLNA 5CZ2A 4FW1A 4CHZA 4OGCA 3V9WA 2PYLA 4C8LA 4K8ZA 4KHWA 1BGXT 1BI4A 2YHAA 4EP4A 4DSEA 3SPYA 5JS1A 3P1GA 3LALA 1KVAA 1S1TA 4PA1A 4FM0A 4AHCA 4RG8A 3KJVA 1NOYA 4G1QA 3ZT0A 5J2PA 1GOBA 1L3VA 1IKVA 3PV8A 4F2SA 3QEIA 4E7HA 1I3AA 4J2BA 2X6SA 3DLKA 3OY9A 2XY6A 1KLMA 1QSLA 4AHRA 2G8HA 3F9KA 3QEWA 4M41A 1NK6A 1L5UA 4DSKA 1RNHA 3CFOA 4KTZA 4DQPA 5J2MA 2YHBA 2OA8A 1L3UA 3U3GA 3AVMA 3MXIA 4HTUA 4M3WA 2FC0A 1FXXA 3OYNA 4DQIA 3ZSWA 3VQ9A 3PY8A 3AA2A 1XHXA 1JLQA 4OGEA 4E1MA 4OVLA 3K2PA 4F4KA 1ASWA 2HB5A 3HP6A 3QEVA 4C8KA 3G10A 1BI4B 4Z4HA 2G8KA 1EP4A 3O3FA 4DFKA 3EYZA 4FXDA 3P83D 1VSJA 1RBRA 5KRTA 4IFVA 1XHZA 4DWIA 4AILC 2YV0X 4JS5A 4KB0A 2A1SA 4DSLA 1HYVA 1EX4A 4CJPA 3NH2A 3DLHA 4FW2A 1KSPA 2EHGA 1TK0A 3NH0A 3AA5X 4CECA 5SZTA 1SL0A 2E6MA 1TAQA 3FFIA 1KCFA 2PZSA 1ZBHA 4CGGA 4HVJA 4DLEA 2OPRA 4W5TA 3OVNA 4OPJA 3NHGA 1GOCA 4KFBA 3KK2A 1T7PA 4KB1A 2ETJA 2IGIA 1JL1A 4O0JA 3ZSOA 4CJKA 3NH1A 4OKJA 3D0PA 1X1PA 3VQPA 2KZZA 1BCOA 2YNHA 3LPTA 3L2UA 3M8SA 1B9FA 2IDOA 4E7LA 3TARA 2PYJA 1ZBUA 3K58A 4HUFA 3KLHA 4N41A 2Z1IA 3LWLA 4KO0A 1TVRA 1O1WA 3AO2A 5D3GA 4FLTA 3TWHA 2D0CA 4M45A 3MECA 1VSFA 4DFMA 3SQ4A 1RDBA 1VK0A 2E6LA 3ZSXA 3KLGA 1QSSA 1YT3A 3WNFA 4DSFA 1RTHA 5HP1A 1N6QA 2BDPA 4GW6A 4CIFA 1BISA 4GMJB 1WSHA 2NUBA 2A1RA 1WSGA 3B6PA 4CGJA 3HPOA 3OJSA 3KK3A 2BANA 3U6FA 2QK9A 3K5MA 3OYFA 3BDPA 2F8SA 3CYMA 1NKEA 4CE9A 4CGIA 2B6AA 4RW6A 5CYMA 4QOZB 1KVBA 4W5RA 1RTDA 4Z4CA 1YTUA 2Y1IA 4LSNA 1S6PA 5C24A 4CJUA 4FLYA 3SUPA 2G8UA 5HBMA 4XIUA 1WAFA 1MU2A 1NK9A 4AHVA 3RR7A 2G8WA 4KHUA 3HL8A 4E1NA 2VWKA 4JRPA 1ZBIA 1BQMA 4O4GA 1Q9XA 1A5XA 4CF9A 3U3YA 2KFNA 2G8IA 4DU4A 3TAFA 3VQBA 1BCMA 3LP1A 4CEEA 4KV8A 4E7IA 4DSIA 4CF8A 4CJLA 3SPZA 1T05A 1VRUA 2DFFA 3QNNA 1SKRA 1RBSA 1REVA 3HVRA 5HLFA 4FZYA 4FK2A 4OLBA 3VN5A 2DTUA 2HHVA 1JXEA 3IRXA 3DRRA 3ZT1A 4RW9A 3LZJA 1Z25A 4CHPA 1S9EA 2P51A 3ZT4A 4CFBA 4PUOA 1U04A 1KRPA 3ULDA 5EU7A 4ELVA 4N47A 2XY7A 3O3HA 3SUNA 1RT3A 2XY8A 3RMBA 1L3SA 2G8FA 3AVKA 3O3GA 5I3UA 4WE1A 3IS9A 2BGGA 1HRHA 4LH4A 4Y1DA 1FK9A 4J2DA 5HROA 4CHQA 1XC9A 1XI1A 4DTSA 1ZYQA 3CFRA 4KHNA 3V9SA 3V1OA 4QAGA 1JLCA 3RMDA 4JLHA 3AO3A 2G8VA 2HHXA 2KZMA 3EY1A 2PY5A 2GBZA 3V9UA 2E4LA 3DLRA 4B8CA 1SL2A 5HRPA 3NGYA 3QEXA 2IAJA 4NYNA 3HK2A 3AVFA 3LP2A 1S6QA 1KTQA 3A2FA 3IAYA 2BE2A 5KGWA 4CFDA 4I9QA 5FRMA 2IOCA 3DI6A 4BE0A 3H08A 4C8NA 2RKIA 1JLEA 5J2NA 3DLEA 1LW2A 3V1QA 3AVJA 3VQCA 1ZBLA 3QIPA 3WNGA 3T3FA 3PUFA 1GOAA 1A5VA 4PY5A 1U47A 3VQAA 1TGOA 3M8PA 1WSFA 3AVCA 4FM1A 1WNSA 4KKOA 1K6YA 4NYFA 4CESA 1NKBA 3DRPA 1JLFA 1QTMA 3RR8A 4DF4A 3L3VA 3T19A 1HNVA 3ZSVA 2RPIA 3NBPA 3DMJA 4DTRA 4FJIA 1A5WA 1RDDA 2ITGA 3VQ4A 1TK5A 1QQCA 4IKFA 1NK4A 4B9UA 3HYFA 3HO1A 1D9DA 4RW4A 3JSMA 3QLHA 1IKXA 3M8QA 4CEZA 1C1BA 3NF6A 3SV4A 1RT7A 3PO5A 3KK1A 1CLQA 4AHTA 3ITHA 5E41A 4IG0A 4CEBA 1EXQA 3VQ8A 4UQGA 3AVGA 3RMAA 1JXBA 1CZBA 2Z1HA 5K14A 5C25A 4GVMA 2ZD1A 3LWMA 2Z1GA 1IKWA 2ZE2A 1WSJA 4CJWA 4N5SA 1Y97A 1TKXA 3V1RA 5SWMA 3L2RA 4FJJA 3RWUA 2O4GA 1JKHA 2OPSA 3OYAA 1KVCA 4I2PA 4LY7A 1VRTA 4O55A 4I9LA 4DS4A 3B6OA 1S1UA 4CERA 5FDLA 5T7BA 3SQ2A 3QEPA 4MFBA 5HRRA 2F8TA 3K57A 4CK1A 1NK5A 1BL3A 2D0BA 1LAWA 4BDPA 4W5QA 4KHQA 4HHTA 4FJNA 4H4OA 1LWFA 2OPPA 2P1JA 3KTQA 3DRSA 1JLBA 1L3TA 3MEEA 3QINA 4E7KA 4NCAA 4DF8A 3NF7A 5DK5A 3AV9A 5J2QA 3MXJA 2D5RA 4QCLA 4Z4IA 1UOCA 2DFEA 3AA3A 3OYJA 1HPZA 1BHLA 4OLAA 2HVHA 3OYHA 1RBUA 1VSLA 3AVLA 3O4NA 4IDKA 3HP9A 3RTVA 4DFPA 3DOLA 3TR8A 3S3NA 1TAUA 3EZ5A 1C6VA 4DTJA 1BIUA 3C95A 3HVTA 3TAEA 2AJQA 1J53A 3LANA 2OYQA 1YVUA 1QE1A 3M8RA 1DTQA 3K59A 1CXUA 5CY4A 3OYDA 4DQRA 3RRGA 3C94A 1Z26A 1RBTA 1SL1A 4N76A 4JS4A 3HPGA 3ZT3A 4OPKA 4TSXA 1HYSA 2OZMA 3IG1A 4DG1A 1RT5A 4CJ5A 1U48A 1WLJA 4IBNA 4CJFA 4FJGA 1UAXA 2IC3A 4FZZA 3RMCA 1HJRA 3NDKA 3AVNA 2VG6A 4Z4FA 1HMVA 3AO1A 1TKZA 5KTQA 2RN2A 1XWLA 1JLGA 2WONA 3L3UA 3OYBA 3TI0A 3TAQA 3AO5A 2FBTA 4FJ8A 2YNGA 3E01A 3JYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CEA A;  3SV3 A;  3ZSR A;  3V6D A;  3PX6 A;  1RBV A;  1C0T A;  4CGH A;  2GUI A;  4B8A B;  3L2Q A;  3G0Z A;  4DFJ A;  2Z1J A;  3SUQ A;  4J2A A;  4E19 A;  1IO2 A;  4O0I A;  3V81 A;  3S3O A;  1LWC A;  4FLX A;  2R7Y A;  3QO9 A;  1T8E A;  4HCC A;  5HRN A;  3OS2 A;  4IFY A;  4CJT A;  3V9Z A;  3NF8 A;  3OS1 A;  5KI6 A;  3T1A A;  3SQ0 A;  1SKS A;  4B3O A;  1CXQ A;  1J54 A;  1TKT A;  3C6U A;  1D8Y A;  2F96 A;  4CHY A;  3TAP A;  1RT1 A;  1S5J A;  2W42 A;  4E7J A;  3VQ5 A;  4DTM A;  2VG7 A;  4Z0U A;  4KHY A;  4KRE A;  4H8K A;  3QER A;  4FJ5 A;  1U45 A;  4LD0 A;  3VQQ A;  3K5N A;  4EZ9 A;  4CJS A;  4ID1 A;  2YKM A;  3VQD A;  3HT3 A;  5DMR A;  3F73 A;  3S9H A;  1C1C A;  3KD1 E;  4CJ4 A;  4CHN A;  2DY4 A;  4DS5 A;  1IH7 A;  2D0A A;  3SUO A;  3SJJ A;  1TK8 A;  4HCB A;  1IG9 A;  3LP0 A;  3OYG A;  2P5O A;  3ZSQ A;  4FM2 A;  1J5O A;  1Q8I A;  4KAZ A;  2KFZ A;  2WOM A;  4B9T A;  2HHQ A;  3DM2 A;  1C0M A;  1BIZ A;  2EX3 A;  3SNN A;  4KPY A;  5HRS A;  3AVA A;  1D9F A;  3AA4 A;  1B92 A;  3UIQ A;  4CGD A;  2VG5 A;  4NCB A;  3I0S A;  1S1W A;  3OS0 A;  4DQQ A;  3DLG A;  3CQ8 A;  1NJZ A;  4BAC A;  4DU1 A;  4M3T A;  1VSH A;  3NF9 A;  4CJR A;  4CF2 A;  4DTX A;  4DTO A;  1RT2 A;  4CF0 A;  2XO7 A;  1X9M A;  1HQE A;  4AHS A;  4W5O A;  4BDY A;  4CJ3 A;  3TAG A;  3WNE A;  2P5G A;  4E0D A;  4PQU A;  4DLG A;  1DLO A;  2B5J A;  4C8M A;  2OPQ A;  5CZ1 A;  4CIE A;  1IKY A;  4F3T A;  4CEO A;  4K8X A;  4F3O A;  3RRH A;  1RDC A;  4DQS A;  4YNQ A;  4C8O A;  2XRI A;  5CYQ A;  4CF1 A;  2HNZ A;  4CGF A;  1LV5 A;  1R0A A;  3HPH A;  3MEG A;  4AH9 A;  4JRQ A;  2FBX A;  5FRO A;  3OYL A;  3OYI A;  4LH5 A;  2HHT A;  1SUQ A;  1X9S A;  3ZT2 A;  3BGR A;  4FLU A;  3VA3 A;  1I39 A;  3CM5 A;  4BWJ A;  3QET A;  4ID5 A;  4ICL A;  1LW0 A;  1WAJ A;  4CED A;  1WSI A;  4DTU A;  1NJW A;  4CCH A;  1TL1 A;  1RIL A;  2HHU A;  1U49 A;  1KFD A;  1Q9Y A;  3HST B;  3AO4 A;  4OKK A;  5KRS A;  1FKO A;  1G15 A;  4PWD A;  3TAM A;  1RT6 A;  3AVI A;  1UA1 A;  3KD5 E;  3MAQ A;  4B9N A;  4FJX A;  4RW8 A;  3THV A;  3SI6 A;  2KW4 A;  1T03 A;  3SCX A;  3L2V A;  1RT4 A;  2B4J A;  1JLA A;  3KLE A;  3LZI A;  4RW7 A;  1ZBF A;  1N5Y A;  3K5O A;  4MQ3 A;  3D45 A;  4YFU A;  3SYZ A;  1J9A A;  1NJY A;  3VQE A;  4FK4 A;  3DYA A;  3ASM A;  4CIG A;  3AVH A;  1WSE A;  1VSK A;  4CEQ A;  1S1X A;  3DLB A;  1NOZ A;  2FBY A;  3L8B A;  3C6T A;  3KLF A;  4Z4E A;  3HJF A;  2QKB A;  3K5L A;  3HM9 A;  4H4M A;  3NAE A;  4O5B A;  4W5N A;  4L8R B;  2YKN A;  4ELU A;  4M3R A;  3HXM A;  5I42 A;  4I7F A;  2Q3S A;  4AHU A;  1C0U A;  4CFA A;  3SQ1 A;  4B9M A;  3KKR A;  2RF2 A;  3O4Q A;  2XY5 A;  3DOK A;  1QSY A;  2X74 A;  4FVM A;  4ELT A;  4EZ6 A;  4KI6 A;  1SKW A;  3NFA A;  1ITG A;  3KLI A;  2KQ2 A;  4FYD A;  1NK0 A;  2HND A;  3QIO A;  4CK2 A;  4BE2 A;  3P5J A;  3OYE A;  1W0H A;  4LSL A;  1S1V A;  2LSN A;  5JS2 A;  1F21 A;  1TL3 A;  3LPU A;  4FLV A;  1UWB A;  4E3S A;  2XHB A;  1ASU A;  4BE1 A;  4DTN A;  4B9V A;  4DSJ A;  2HHS A;  1DTT A;  3OJU A;  1C1A A;  1LWE A;  3OYK A;  3CFP A;  3TAB A;  1HNI A;  2I5J A;  3VA0 A;  4M42 A;  3OYC A;  4DMN A;  1RTJ A;  3V9X A;  4BWM A;  3CM6 A;  1BQN A;  2HNY A;  4OKE A;  2YNF A;  2ZQB A;  4IG3 A;  4OJR A;  4CEF A;  3LAM A;  5J1E A;  3NE6 A;  1ASV A;  5KGX A;  4DTP A;  1U4B A;  3PX0 A;  3LP3 A;  4CJV A;  4FJK A;  3OYM A;  1UA0 A;  3SZ2 A;  4M3U A;  4E89 A;  4CK3 A;  4Y1C A;  4KHS A;  3NGI A;  1QS4 A;  4FJM A;  4BDZ A;  4M3Z A;  1JL2 A;  3ZCM A;  4B9L A;  3QNO A;  3ZSZ A;  4F8R A;  3LDS A;  4R5P A;  3PO4 A;  3V4I A;  4KTQ A;  1QHT A;  1VSI A;  3VQ7 A;  4FJL A;  4FJH A;  3L2W A;  5C42 A;  3I8D A;  1D5A A;  2HVI A;  1EET A;  1VSD A;  1X9W A;  2X6N A;  4I2Q A;  1NK7 A;  1B9D A;  3VQ6 A;  2O4I A;  4ZTJ A;  4HUG A;  1TKD A;  1RCH A;  4KI4 A;  4M3X A;  1EKE A;  2X78 A;  4N56 A;  4ZTF A;  2JLE A;  2QXF A;  4ZHR A;  4Q5V A;  2HHW A;  3CG7 A;  4FJ7 A;  3AVB A;  2KTQ A;  1SV5 A;  3LAK A;  4FZX C;  4CHO A;  1HQU A;  4DU3 A;  4EP5 A;  3PX4 A;  3S3M A;  4FJ9 A;  5FRN A;  4Q0B A;  4J2E A;  3KIO A;  1NK8 A;  3I0R A;  2HMI A;  4FK0 A;  3ISN C;  4Z4G A;  1VSE A;  2FBV A;  1RTI A;  4NCG A;  3NCI A;  2QKK A;  1TV6 A;  4KTW A;  2DFH A;  2HW3 A;  2GV9 A;  1NKC A;  3ALY A;  2YNI A;  1KFS A;  1YTA A;  4O44 A;  1LAV A;  3WNH A;  3QES A;  4F2R A;  3ZSY A;  1W9H A;  1VSM A;  2IS3 A;  4CJQ A;  1HYZ A;  3MED A;  4FLZ A;  4B08 A;  1FKP A;  2VWJ A;  1CZ9 A;  1S9G A;  3MXM A;  2Y1J A;  4M3Y A;  3TAN A;  4B9S A;  2JGU A;  4CFC A;  1WN7 A;  3KKS A;  3NGZ A;  4FCY A;  1RDA A;  4FLW A;  4HUE A;  1NJX A;  2OZS A;  4CJE A;  4KRF A;  2ATQ A;  1KLN A;  5CZ2 A;  4FW1 A;  4CHZ A;  4OGC A;  3V9W A;  2PYL A;  4C8L A;  4K8Z A;  4KHW A;  1BGX T;  1BI4 A;  2YHA A;  4EP4 A;  4DSE A;  3SPY A;  5JS1 A;  3P1G A;  3LAL A;  1KVA A;  1S1T A;  4PA1 A;  4FM0 A;  4AHC A;  4RG8 A;  3KJV A;  1NOY A;  4G1Q A;  3ZT0 A;  5J2P A;  1GOB A;  1L3V A;  1IKV A;  3PV8 A;  4F2S A;  3QEI A;  4E7H A;  1I3A A;  4J2B A;  2X6S A;  3DLK A;  3OY9 A;  2XY6 A;  1KLM A;  1QSL A;  4AHR A;  2G8H A;  3F9K A;  3QEW A;  4M41 A;  1NK6 A;  1L5U A;  4DSK A;  1RNH A;  3CFO A;  4KTZ A;  4DQP A;  5J2M A;  2YHB A;  2OA8 A;  1L3U A;  3U3G A;  3AVM A;  3MXI A;  4HTU A;  4M3W A;  2FC0 A;  1FXX A;  3OYN A;  4DQI A;  3ZSW A;  3VQ9 A;  3PY8 A;  3AA2 A;  1XHX A;  1JLQ A;  4OGE A;  4E1M A;  4OVL A;  3K2P A;  4F4K A;  1ASW A;  2HB5 A;  3HP6 A;  3QEV A;  4C8K A;  3G10 A;  1BI4 B;  4Z4H A;  2G8K A;  1EP4 A;  3O3F A;  4DFK A;  3EYZ A;  4FXD A;  3P83 D;  1VSJ A;  1RBR A;  5KRT A;  4IFV A;  1XHZ A;  4DWI A;  4AIL C;  2YV0 X;  4JS5 A;  4KB0 A;  2A1S A;  4DSL A;  1HYV A;  1EX4 A;  4CJP A;  3NH2 A;  3DLH A;  4FW2 A;  1KSP A;  2EHG A;  1TK0 A;  3NH0 A;  3AA5 X;  4CEC A;  5SZT A;  1SL0 A;  2E6M A;  1TAQ A;  3FFI A;  1KCF A;  2PZS A;  1ZBH A;  4CGG A;  4HVJ A;  4DLE A;  2OPR A;  4W5T A;  3OVN A;  4OPJ A;  3NHG A;  1GOC A;  4KFB A;  3KK2 A;  1T7P A;  4KB1 A;  2ETJ A;  2IGI A;  1JL1 A;  4O0J A;  3ZSO A;  4CJK A;  3NH1 A;  4OKJ A;  3D0P A;  1X1P A;  3VQP A;  2KZZ A;  1BCO A;  2YNH A;  3LPT A;  3L2U A;  3M8S A;  1B9F A;  2IDO A;  4E7L A;  3TAR A;  2PYJ A;  1ZBU A;  3K58 A;  4HUF A;  3KLH A;  4N41 A;  2Z1I A;  3LWL A;  4KO0 A;  1TVR A;  1O1W A;  3AO2 A;  5D3G A;  4FLT A;  3TWH A;  2D0C A;  4M45 A;  3MEC A;  1VSF A;  4DFM A;  3SQ4 A;  1RDB A;  1VK0 A;  2E6L A;  3ZSX A;  3KLG A;  1QSS A;  1YT3 A;  3WNF A;  4DSF A;  1RTH A;  5HP1 A;  1N6Q A;  2BDP A;  4GW6 A;  4CIF A;  1BIS A;  4GMJ B;  1WSH A;  2NUB A;  2A1R A;  1WSG A;  3B6P A;  4CGJ A;  3HPO A;  3OJS A;  3KK3 A;  2BAN A;  3U6F A;  2QK9 A;  3K5M A;  3OYF A;  3BDP A;  2F8S A;  3CYM A;  1NKE A;  4CE9 A;  4CGI A;  2B6A A;  4RW6 A;  5CYM A;  4QOZ B;  1KVB A;  4W5R A;  1RTD A;  4Z4C A;  1YTU A;  2Y1I A;  4LSN A;  1S6P A;  5C24 A;  4CJU A;  4FLY A;  3SUP A;  2G8U A;  5HBM A;  4XIU A;  1WAF A;  1MU2 A;  1NK9 A;  4AHV A;  3RR7 A;  2G8W A;  4KHU A;  3HL8 A;  4E1N A;  2VWK A;  4JRP A;  1ZBI A;  1BQM A;  4O4G A;  1Q9X A;  1A5X A;  4CF9 A;  3U3Y A;  2KFN A;  2G8I A;  4DU4 A;  3TAF A;  3VQB A;  1BCM A;  3LP1 A;  4CEE A;  4KV8 A;  4E7I A;  4DSI A;  4CF8 A;  4CJL A;  3SPZ A;  1T05 A;  1VRU A;  2DFF A;  3QNN A;  1SKR A;  1RBS A;  1REV A;  3HVR A;  5HLF A;  4FZY A;  4FK2 A;  4OLB A;  3VN5 A;  2DTU A;  2HHV A;  1JXE A;  3IRX A;  3DRR A;  3ZT1 A;  4RW9 A;  3LZJ A;  1Z25 A;  4CHP A;  1S9E A;  2P51 A;  3ZT4 A;  4CFB A;  4PUO A;  1U04 A;  1KRP A;  3ULD A;  5EU7 A;  4ELV A;  4N47 A;  2XY7 A;  3O3H A;  3SUN A;  1RT3 A;  2XY8 A;  3RMB A;  1L3S A;  2G8F A;  3AVK A;  3O3G A;  5I3U A;  4WE1 A;  3IS9 A;  2BGG A;  1HRH A;  4LH4 A;  4Y1D A;  1FK9 A;  4J2D A;  5HRO A;  4CHQ A;  1XC9 A;  1XI1 A;  4DTS A;  1ZYQ A;  3CFR A;  4KHN A;  3V9S A;  3V1O A;  4QAG A;  1JLC A;  3RMD A;  4JLH A;  3AO3 A;  2G8V A;  2HHX A;  2KZM A;  3EY1 A;  2PY5 A;  2GBZ A;  3V9U A;  2E4L A;  3DLR A;  4B8C A;  1SL2 A;  5HRP A;  3NGY A;  3QEX A;  2IAJ A;  4NYN A;  3HK2 A;  3AVF A;  3LP2 A;  1S6Q A;  1KTQ A;  3A2F A;  3IAY A;  2BE2 A;  5KGW A;  4CFD A;  4I9Q A;  5FRM A;  2IOC A;  3DI6 A;  4BE0 A;  3H08 A;  4C8N A;  2RKI A;  1JLE A;  5J2N A;  3DLE A;  1LW2 A;  3V1Q A;  3AVJ A;  3VQC A;  1ZBL A;  3QIP A;  3WNG A;  3T3F A;  3PUF A;  1GOA A;  1A5V A;  4PY5 A;  1U47 A;  3VQA A;  1TGO A;  3M8P A;  1WSF A;  3AVC A;  4FM1 A;  1WNS A;  4KKO A;  1K6Y A;  4NYF A;  4CES A;  1NKB A;  3DRP A;  1JLF A;  1QTM A;  3RR8 A;  4DF4 A;  3L3V A;  3T19 A;  1HNV A;  3ZSV A;  2RPI A;  3NBP A;  3DMJ A;  4DTR A;  4FJI A;  1A5W A;  1RDD A;  2ITG A;  3VQ4 A;  1TK5 A;  1QQC A;  4IKF A;  1NK4 A;  4B9U A;  3HYF A;  3HO1 A;  1D9D A;  4RW4 A;  3JSM A;  3QLH A;  1IKX A;  3M8Q A;  4CEZ A;  1C1B A;  3NF6 A;  3SV4 A;  1RT7 A;  3PO5 A;  3KK1 A;  1CLQ A;  4AHT A;  3ITH A;  5E41 A;  4IG0 A;  4CEB A;  1EXQ A;  3VQ8 A;  4UQG A;  3AVG A;  3RMA A;  1JXB A;  1CZB A;  2Z1H A;  5K14 A;  5C25 A;  4GVM A;  2ZD1 A;  3LWM A;  2Z1G A;  1IKW A;  2ZE2 A;  1WSJ A;  4CJW A;  4N5S A;  1Y97 A;  1TKX A;  3V1R A;  5SWM A;  3L2R A;  4FJJ A;  3RWU A;  2O4G A;  1JKH A;  2OPS A;  3OYA A;  1KVC A;  4I2P A;  4LY7 A;  1VRT A;  4O55 A;  4I9L A;  4DS4 A;  3B6O A;  1S1U A;  4CER A;  5FDL A;  5T7B A;  3SQ2 A;  3QEP A;  4MFB A;  5HRR A;  2F8T A;  3K57 A;  4CK1 A;  1NK5 A;  1BL3 A;  2D0B A;  1LAW A;  4BDP A;  4W5Q A;  4KHQ A;  4HHT A;  4FJN A;  4H4O A;  1LWF A;  2OPP A;  2P1J A;  3KTQ A;  3DRS A;  1JLB A;  1L3T A;  3MEE A;  3QIN A;  4E7K A;  4NCA A;  4DF8 A;  3NF7 A;  5DK5 A;  3AV9 A;  5J2Q A;  3MXJ A;  2D5R A;  4QCL A;  4Z4I A;  1UOC A;  2DFE A;  3AA3 A;  3OYJ A;  1HPZ A;  1BHL A;  4OLA A;  2HVH A;  3OYH A;  1RBU A;  1VSL A;  3AVL A;  3O4N A;  4IDK A;  3HP9 A;  3RTV A;  4DFP A;  3DOL A;  3TR8 A;  3S3N A;  1TAU A;  3EZ5 A;  1C6V A;  4DTJ A;  1BIU A;  3C95 A;  3HVT A;  3TAE A;  2AJQ A;  1J53 A;  3LAN A;  2OYQ A;  1YVU A;  1QE1 A;  3M8R A;  1DTQ A;  3K59 A;  1CXU A;  5CY4 A;  3OYD A;  4DQR A;  3RRG A;  3C94 A;  1Z26 A;  1RBT A;  1SL1 A;  4N76 A;  4JS4 A;  3HPG A;  3ZT3 A;  4OPK A;  4TSX A;  1HYS A;  2OZM A;  3IG1 A;  4DG1 A;  1RT5 A;  4CJ5 A;  1U48 A;  1WLJ A;  4IBN A;  4CJF A;  4FJG A;  1UAX A;  2IC3 A;  4FZZ A;  3RMC A;  1HJR A;  3NDK A;  3AVN A;  2VG6 A;  4Z4F A;  1HMV A;  3AO1 A;  1TKZ A;  5KTQ A;  2RN2 A;  1XWL A;  1JLG A;  2WON A;  3L3U A;  3OYB A;  3TI0 A;  3TAQ A;  3AO5 A;  2FBT A;  4FJ8 A;  2YNG A;  3E01 A;  3JYT A; 
#chains in the Genus database with same CATH topology
 4CEA A;  3SV3 A;  3V6D A;  1RFQ A;  3PX6 A;  4B8A B;  3G0Z A;  2E1Z A;  1ESV A;  5MLC Q;  1IO2 A;  3VET A;  3V81 A;  3S3O A;  1T8E A;  3MN5 A;  5HRN A;  4IFY A;  1OH5 A;  4CW7 B;  5EVZ A;  5KI6 A;  4B3O A;  3H6E A;  1QQM A;  1D8Y A;  1VQP N;  2P9L A;  5JLH A;  4Z0U A;  3CC7 N;  4KHY A;  3K5N A;  4CJS A;  2YKM A;  3L0Q A;  3F73 A;  3S9H A;  1C1C A;  3KD1 E;  3CJ9 A;  5BR9 A;  3SUO A;  1H1V A;  4BQL A;  4FWS A;  2P5O A;  1GLD G;  2WOM A;  2HHQ A;  1P8Z A;  2EX3 A;  4KPY A;  2Q2R A;  3SBG A;  3VEV A;  2FF6 A;  1D9F A;  3AA4 A;  1NG9 A;  3I0S A;  3OS0 A;  3CQ8 A;  1NJZ A;  4BAC A;  4CD1 A;  1VSH A;  2P9S B;  3NF9 A;  3QFU A;  3LM9 A;  2XO7 A;  3BZK A;  4PKG A;  1HKB A;  3I56 N;  5GIO A;  4FWO A;  4CIE A;  4Z94 A;  3RVC A;  4CEO A;  3PLA A;  4F3O A;  1VQO N;  3KWI A;  3HPH A;  3MEG A;  1YI2 N;  2FBX A;  3AGK A;  4LH5 A;  4YOR A;  1SUQ A;  4BY9 C;  4FLU A;  3DXM A;  2ZGZ A;  4DV3 K;  3OW2 M;  1FW6 A;  5AQI A;  4ID5 A;  1XNR K;  1U49 A;  3HST B;  3CIP A;  4K0K K;  2PFU A;  2YI1 A;  3TAM A;  1RT6 A;  4FJX A;  3SI6 A;  1T03 A;  1CZA N;  1RT4 A;  4RW7 A;  3BF3 A;  3DAW A;  5GIP A;  3D45 A;  2H3G X;  1K8K B;  3AAP A;  4FO0 A;  4FK4 A;  3AVH A;  2P9I B;  1WSE A;  3O5B A;  4L8R B;  4M3R A;  3AGR A;  4I7F A;  4AHU A;  4CFA A;  3SQ1 A;  1NNE A;  4NLC A;  4FWP A;  3VF2 A;  1QSY A;  3FZK A;  3ZX3 A;  4FVM A;  4ELT A;  1SKW A;  3SAF A;  2NRH A;  1ITG A;  1NK0 A;  5KPR A;  4BE2 A;  3OYE A;  3AY9 A;  3OHR A;  1F21 A;  4E3S A;  4B9V A;  4DSJ A;  2HHS A;  5M1P A;  3C65 A;  4LF7 K;  2I5J A;  3VA0 A;  5ELZ A;  3OYC A;  1RTJ A;  4IOA L;  2HNY A;  4OKE A;  5BR8 K;  4HWI A;  1U4B A;  3PX0 A;  2FSN A;  4Y1C A;  1QS4 A;  4FJM A;  4M3Z A;  3ZCM A;  3ZEU A;  3QB0 A;  3V4I A;  4KTQ A;  4IOC L;  4FJH A;  3FZM A;  1TYQ A;  2HVI A;  1XUP O;  4LC9 B;  4DB3 A;  1NK7 A;  3VQ6 A;  4ZTJ A;  1TKD A;  4CD3 A;  1QVG M;  4KI4 A;  1EKE A;  4JD2 A;  2QXF A;  4FJ7 A;  5AQJ A;  4AM6 A;  3R8E A;  5FRN A;  3S3M A;  3UKR B;  3THY B;  3KIO A;  4J2E A;  4FK0 A;  3ISN C;  5C12 A;  3NCI A;  4M7X A;  2YNI A;  1DT9 A;  3IMX A;  3QES A;  5JVH L;  2E2O A;  2QXL A;  3CJ1 A;  3O1B A;  1WBB A;  1S9G A;  3MXM A;  2Y1J A;  3TAN A;  3D2E A;  1LOT B;  4HUE A;  4K8Z A;  4KHW A;  2P9L B;  5FPM A;  1ATS A;  4QS9 A;  1S1T A;  3CI5 A;  4RG8 A;  1ILY A;  1XQS C;  4BRA A;  1NOY A;  5J2P A;  1GOB A;  3EE8 A;  4JI5 K;  3QEI A;  1IBK K;  1I3A A;  4J2B A;  2QEX N;  3WUH A;  3DLK A;  3OY9 A;  1K73 O;  1KLM A;  3ULE A;  2G8H A;  3CJC A;  3D7E O;  3L6Q A;  1X9J A;  2YHB A;  3CQX A;  1L3U A;  3LM2 A;  3AVM A;  3ZSW A;  3VQ9 A;  3PY8 A;  3AA2 A;  4OGE A;  3ENH A;  3K2P A;  1ASW A;  4BG8 A;  4CZI A;  4Z4H A;  3EYZ A;  1JCF A;  4MDA A;  4JHD A;  1RBR A;  5KRT A;  1JJ2 M;  4NO7 A;  3VEW A;  3J80 O;  1NGG A;  1HPM A;  5GIN A;  4CEC A;  5SZT A;  4DR1 K;  2E6M A;  5AZJ A;  4JI0 K;  3I55 N;  3LDO A;  2OPR A;  3P39 A;  3OVN A;  4W5T A;  3NHG A;  3KK2 A;  2PAV A;  3OBW A;  1KD1 O;  4NLB A;  1X1P A;  2F9T A;  3LPT A;  3HOS A;  2IDO A;  4H0Y B;  1ZBU A;  3KLH A;  4N41 A;  5CE3 A;  3U4L A;  3HI0 A;  1O1W A;  3TWH A;  4H5R A;  3H3O B;  3MN9 A;  2JWL A;  1YJ9 N;  3ZX0 A;  5E26 A;  1R59 O;  1QSS A;  3WNF A;  4DSF A;  5AR0 A;  5HP1 A;  4BRD A;  2NUB A;  4IXC A;  3B6P A;  3KK3 A;  3U6F A;  2BAN A;  5C2D A;  5H1S Q;  3CYM A;  1NGB A;  4CE9 A;  4JKB A;  4W5R A;  3ZET A;  2G8U A;  1S6P A;  4CJU A;  5LMN K;  1NMD A;  1BOT O;  4CZH A;  1NK9 A;  4X64 K;  1N34 K;  4NXM K;  4BG9 A;  3QDK A;  3HL8 A;  4O4G A;  4CF9 A;  3U3Y A;  5AQZ A;  1YVN A;  2VQF K;  3VQB A;  1MWK A;  4CEE A;  3EE9 A;  4CF8 A;  1VRU A;  3WXI A;  3MX5 A;  1REV A;  4BRK A;  3HVR A;  5HLF A;  4LFB K;  3SBT A;  4OLB A;  3LZJ A;  1Z25 A;  1KAY A;  1RGI A;  2V52 B;  1WBD A;  4ELV A;  3AAQ A;  3IUC A;  3O3H A;  3SUN A;  4CZM A;  4YOU A;  2YJF A;  5I3U A;  2FF3 B;  2VGN A;  5HRO A;  4G9Z A;  1TYQ B;  2EWS A;  1WUA A;  4C1N K;  1KAX A;  4JLH A;  3AO3 A;  4EAH D;  2HHX A;  4FWM A;  2KZM A;  2PY5 A;  1K8A O;  4B8C A;  1SL2 A;  1MA9 B;  5HRP A;  3NGY A;  2AP1 A;  4NYN A;  3HK2 A;  2GX9 A;  3LP2 A;  1HX1 A;  1S6Q A;  3C6A A;  3E1Y A;  4PHT X;  5KGW A;  4I9Q A;  5FRM A;  4BE0 A;  1E4G T;  2FLO A;  4DV2 K;  2RKI A;  4YDU A;  4BVO A;  5J2N A;  1NGD A;  3VQC A;  2AA4 A;  4FWR A;  3PUF A;  4B1Z A;  3VQA A;  3D2E B;  2W6L A;  4A2A A;  2W41 A;  3CJA A;  4RCH A;  3RR8 A;  4IO9 L;  1OH8 A;  3ZSV A;  3DMJ A;  4KHP K;  1A5W A;  1TK5 A;  3E9O A;  3HYF A;  4XH5 A;  3PO5 A;  4WFB L;  1CLQ A;  3S41 A;  3CCM N;  4CEB A;  5F2R A;  1VQ6 N;  2E20 A;  4AM7 A;  5K14 A;  1V4S A;  2QWL A;  5AQT A;  2ASO A;  2HF3 A;  5SWM A;  3L2R A;  3OYA A;  3QEP A;  3UKU A;  3VF6 A;  3F9M A;  2F8T A;  3K57 A;  4CK1 A;  3O6W A;  2D0B A;  2VCP A;  3VGL A;  4JAX A;  4W5Q A;  2Q0R A;  4KH4 A;  4HHT A;  4H4O A;  4DKW A;  4M7Y A;  3DRS A;  4E7K A;  3AA3 A;  4JI1 K;  3CCR N;  4HTL A;  2YHX A;  1RBU A;  1VSL A;  2W6K A;  4DFP A;  3HP9 A;  3TR8 A;  3C95 A;  3TAE A;  3M8R A;  4B1V A;  5FPD A;  1ZC6 A;  3RRG A;  1LCU A;  5M1N A;  1SL1 A;  3CCL N;  2FSJ A;  4JS4 A;  4IDH A;  4LFC K;  4OPK A;  4JKA A;  4WFN L;  3IG1 A;  4IBN A;  2IC3 A;  3RMC A;  3AVN A;  5F1X A;  4DV4 K;  1T44 A;  1XNQ K;  4BRN A;  1JLG A;  1OVY A;  2VWB A;  4MLH A;  3JYT A;  4U7B A;  3NMU A;  3ZSR A;  2YCH A;  1RBV A;  3L2Q A;  4NXN K;  5DM7 L;  4HCC A;  1LWC A;  2R7Y A;  4CJT A;  2D1K A;  4H5T A;  1RT1 A;  4FWK A;  2IVP A;  3VQ5 A;  4DTM A;  2P9S A;  3VQQ A;  4EZ9 A;  5KQ8 A;  4QS7 A;  1VAZ A;  4CJ4 A;  4CHN A;  3LP0 A;  1S72 N;  3ZSQ A;  5JIC A;  4K43 A;  4FM2 A;  1J5O A;  3WXK A;  1YIJ N;  3AVA A;  1VQM N;  4NCB A;  5AFU H;  3C7N B;  1VQ8 N;  4X62 K;  3U9D A;  3BY5 A;  3B8A X;  4JK9 A;  4CF2 A;  4RWT A;  4CZL A;  4CF0 A;  3SLC A;  4PQU A;  4CJ3 A;  4ILJ A;  4PKI A;  3WNE A;  4DLG A;  1DLO A;  2B5J A;  4C8M A;  5CZ1 A;  4F3T A;  3P4I A;  1K8K A;  2P9I A;  2HNZ A;  4CGF A;  4BRH A;  3TSU A;  4AH9 A;  5FRO A;  3E9P A;  3OYI A;  3QIC A;  1X9S A;  5GAD P;  1U6Z A;  4BWJ A;  2ITM A;  4BRO A;  4CVN E;  4CED A;  1WSI A;  1TL1 A;  2HHU A;  5KRS A;  1FKO A;  2PBD A;  3BZC A;  3VER A;  5M1Q A;  3MAQ A;  2O8C A;  3TSQ A;  1TUY A;  2YHW A;  3SCX A;  3KLE A;  3MDQ A;  3LZI A;  5FLX O;  1N5Y A;  4YFU A;  4JN4 A;  4CIG A;  3ASM A;  3PIO L;  4UY8 O;  3L8B A;  1NU0 A;  3R9P A;  4IEI A;  4YOV A;  3K5L A;  4FWL A;  4O5B A;  3ZYY X;  3BF1 A;  2NZT A;  3HXM A;  3OA9 A;  5I42 A;  2Q3S A;  2QW9 A;  4B9M A;  3KKR A;  1BUP A;  3UKU B;  3Q7C A;  2KQ2 A;  3H46 O;  2HND A;  3CJB A;  4IO8 A;  3QIO A;  1W0H A;  1JCE A;  2LSN A;  4EHU A;  4FLV A;  4DTN A;  4BE1 A;  4IZ9 A;  5M1K A;  1DTT A;  1LWE A;  1HNI A;  5J1E A;  2YNF A;  2ZQB A;  3LAM A;  4DR5 K;  3F5T A;  3NE6 A;  5KGX A;  3ENB A;  3VF4 A;  4CJV A;  2QTD A;  1EWR A;  4BC2 A;  3NGI A;  3ZLJ A;  2NNW A;  4BDZ A;  3P38 A;  3VEN A;  3THW A;  2P9K B;  3O08 A;  5AQN A;  1GLJ O;  1QHT A;  1VSI A;  4FJL A;  5GAH P;  1EET A;  2WTU A;  2VYP A;  3FZF A;  2HHW A;  2JLE A;  5AQL A;  3C0B A;  4H03 B;  3LAK A;  5AQO A;  1HQU A;  4DU3 A;  4LF4 K;  3BEX A;  4BRG A;  4JI3 K;  4Z4G A;  3I0R A;  5M1F A;  3FE1 A;  4JI8 K;  4NCG A;  2QKK A;  2Q31 A;  1TV6 A;  2DFH A;  2GV9 A;  3E66 A;  1NKC A;  3ALY A;  1BO5 O;  1W9H A;  1VSM A;  2IS3 A;  4CJQ A;  1Q18 A;  1HLU A;  2GEL A;  2QWM A;  1FKP A;  2UU9 K;  1O13 A;  3NVM A;  4BR7 A;  1QQN A;  4B9S A;  5KQD A;  1WN7 A;  1OH7 A;  2WC9 A;  4FLW A;  4KRF A;  2OZS A;  2ATQ A;  5CZ2 A;  4CHZ A;  3V9W A;  3DXK A;  4H0X B;  1QHA A;  2YHA A;  5JS1 A;  4DSE A;  3SPY A;  3P1G A;  5BRE A;  4AHC A;  3KJV A;  2GEM A;  1WB9 A;  3QBX A;  4G1Q A;  1L3V A;  1YUW A;  2QWQ A;  5AJ3 K;  3F9K A;  4M41 A;  4B3M K;  2HST A;  3CME N;  2QWN A;  4KTZ A;  3CFO A;  4JYA K;  2OA8 A;  4JI4 K;  4JEP A;  3MXI A;  4BR2 A;  3CD6 N;  4V19 S;  4F4K A;  1IJJ A;  3HP6 A;  5E84 A;  3G10 A;  1BI4 B;  2G8K A;  3O3F A;  1ZXO A;  4DFK A;  4O8K A;  3RSE A;  4DWI A;  4AIL C;  2YV0 X;  2HBM A;  4JS5 A;  4KB0 A;  3THX A;  2A1S A;  4DSL A;  1EX4 A;  4CJP A;  3H1Q A;  5BPN A;  3DLH A;  1TK0 A;  3AA5 X;  1SL0 A;  1MDU B;  1N8R O;  4KH5 A;  4GVE A;  3HOT A;  4OPJ A;  2NRV A;  1T7P A;  1YJN N;  4PL7 A;  2IGI A;  5F0X A;  4YOX A;  1D4X A;  4O0J A;  4JKG B;  5LY3 A;  3GL1 A;  4DV1 K;  1NGC A;  3D0P A;  1BCO A;  2YNH A;  2VGM A;  4HUF A;  5CHI A;  5BN9 A;  1TVR A;  3AO2 A;  4FLT A;  2O8C B;  4YOW A;  2D0C A;  4M45 A;  4A2B A;  3MEC A;  1VSF A;  3SQ4 A;  1RDB A;  3CCS N;  3ZSX A;  3JS6 A;  1Z05 A;  1RTH A;  1N6Q A;  4CIF A;  1BIS A;  1WSH A;  2A1R A;  1WSG A;  3HPO A;  4CGJ A;  3DLL L;  3M5R A;  3K5M A;  3OYF A;  3CF5 L;  3BDP A;  2F8S A;  2NRW A;  2A41 A;  1Q86 O;  5CYM A;  2CGL A;  1YTU A;  1T6D A;  4YOY A;  3SUP A;  2I7N A;  5HBM A;  5BRD A;  4XIU A;  1WAF A;  4KHU A;  5LJW A;  2G8W A;  3O9T A;  4E1N A;  2VWK A;  4JRP A;  1BQM A;  1GLE G;  2P9N A;  2P9P A;  4KV8 A;  1V4T A;  4BR4 A;  1EQY A;  4CJL A;  1SKR A;  1RBS A;  4CZJ A;  4FZY A;  2OAN A;  3VN5 A;  2DTU A;  4B1X B;  4RW9 A;  2P51 A;  2E2P A;  1U04 A;  1KRP A;  4Y0W A;  2ZWH A;  4XH1 A;  1RT3 A;  1X3M A;  3RMB A;  1I94 K;  3N4P A;  3THW B;  4BRQ A;  5AQK A;  4IJN A;  4JKF A;  5DM6 L;  2BGG A;  2HOE A;  4LH4 A;  4QS8 A;  2BUP A;  3GG4 A;  4J2D A;  3H1V X;  2YHY A;  1ZYQ A;  4DR7 K;  5KPZ A;  3V1O A;  4ISE A;  2E8A A;  3EY1 A;  3G6E N;  3FZL A;  2IAJ A;  3AVF A;  3A2F A;  4K25 A;  2A6A A;  2BE2 A;  2IOC A;  3K0S A;  3DI6 A;  2I7P A;  1SQK A;  3CC4 N;  4JI7 K;  1LW2 A;  3V1Q A;  5ADX H;  1ZBL A;  2A3Z A;  1A5V A;  4PY5 A;  1K9M O;  3AVC A;  4FM1 A;  1WNS A;  3CPW M;  3O80 A;  1JLF A;  5C0Y A;  3DXK B;  3L3V A;  1HNV A;  4DTR A;  4IKF A;  1RDD A;  1QQC A;  2KLA A;  1D9D A;  1NLV A;  1IKX A;  3GE1 A;  4CEZ A;  4H5N A;  3NF6 A;  3CCV N;  4AHT A;  4WYB A;  5E41 A;  3VQ8 A;  3SMP A;  4UQG A;  3AVG A;  5TKW A;  5C25 A;  3LWM A;  2ZD1 A;  3V1R A;  4IEE A;  1KVC A;  4O55 A;  1VRT A;  4DS4 A;  3B6O A;  4K42 A;  4CER A;  5T7B A;  4B3R K;  1LAW A;  4DQ8 A;  4BDP A;  4CZE A;  4BRP A;  3KTQ A;  3EN9 A;  4LF8 K;  2YX6 A;  4A57 A;  4NCA A;  4DF8 A;  5J2Q A;  3AV9 A;  1OH6 A;  4QCL A;  4Z4I A;  3RSE B;  1BHL A;  3FLC O;  3THX B;  1BA1 A;  3AVL A;  1J6Z A;  4OX9 K;  4DTJ A;  3HVT A;  3TTC A;  1J53 A;  3LAN A;  1KXP A;  3K59 A;  1YAG A;  1CXU A;  2VQE K;  4DV6 K;  4DQR A;  3CQY A;  1RBT A;  1BA0 A;  3KZB A;  4H0P A;  4ILG B;  4WQ4 A;  3ZT3 A;  1HYS A;  2OZM A;  4X66 K;  4CJ5 A;  3A0I X;  1U48 A;  1HJR A;  3NDK A;  1HMV A;  3OTO K;  1TKZ A;  5KTQ A;  2O8B A;  1XWL A;  3OYB A;  1IBL K;  4XH4 A;  4CGH A;  2Z1J A;  3SUQ A;  4J2A A;  4E19 A;  4O0I A;  4OO1 J;  3JAM O;  4FLX A;  3O9Q A;  3ID6 A;  4EIA A;  3OS2 A;  1T3V A;  3NF8 A;  3OS1 A;  3SQ0 A;  1CXQ A;  1TKT A;  3P31 A;  2F96 A;  3C7N A;  3VGK A;  1S5J A;  3ATU A;  1M90 O;  4KRE A;  4IWV A;  4H8K A;  4MO4 A;  1U45 A;  4LD0 A;  2P9N B;  2P9P B;  3HT3 A;  3VQD A;  5DMR A;  4DV7 K;  2DY4 A;  3VTI A;  2D0A A;  1TK8 A;  3R6M A;  4L3Q A;  3OYG A;  3O9S A;  2D4W A;  1S3X A;  2KFZ A;  1NGJ A;  4DR4 K;  4JV5 K;  2E2Q A;  4FL9 A;  3WXJ A;  4CZF A;  5AQF A;  1W2B M;  1BDG A;  3UIQ A;  4CGD A;  4I6M B;  4DU1 A;  3CET A;  3O1W A;  4A5B A;  4DTO A;  4AHS A;  4W5O A;  3TAG A;  2P5G A;  2ASP A;  4BR5 A;  4R79 A;  3GDQ A;  4K8X A;  3J8A A;  2CGJ A;  4DQS A;  4CF1 A;  1YXQ A;  4JRQ A;  3BUZ B;  2BTF A;  2J4R A;  3BGR A;  4FOI A;  3ZT2 A;  3VA3 A;  3QET A;  1LW0 A;  1WAJ A;  4CCH A;  1KFD A;  4K41 A;  3AO4 A;  4AF1 A;  4GNI A;  4OKK A;  2F7T A;  1N36 K;  1N33 K;  1G15 A;  3AVI A;  4FWN A;  1UA1 A;  2NRX A;  3KD5 E;  3MN6 A;  5AQS A;  2O8F A;  5ADX A;  3THV A;  2KW4 A;  1HKC A;  2B4J A;  1JLA A;  2Q97 A;  5M1O A;  4MQ3 A;  3DYA A;  1VSK A;  4ISF A;  1S1X A;  1NOZ A;  2FBY A;  4Z4E A;  3KLF A;  1NBW A;  2QKB A;  3HM9 A;  4H4M A;  4EHT A;  3NAE A;  3GBT A;  3A5O C;  2YKN A;  3U9Z A;  4ELU A;  1YF5 L;  1C0U A;  2P9K A;  2RF2 A;  2RHK A;  3DOK A;  4CJ7 A;  3EKU A;  3KLI A;  4FYD A;  1SAZ A;  3P5J A;  4LSL A;  1S1V A;  3LPU A;  1TL3 A;  1UWB A;  2XHB A;  1ASU A;  3OYK A;  3CFP A;  3CHW A;  4M42 A;  2HHH K;  4DMN A;  4CEF A;  3HZ6 A;  4DTP A;  3LP3 A;  3SZ2 A;  4CK3 A;  4KHS A;  1W7A A;  3UE5 A;  1HUX A;  3QFP A;  4B9L A;  3K9K A;  3VEX A;  3VOV A;  4R5P A;  3PO4 A;  1NJI O;  3I8D A;  4ISG A;  3T69 A;  1VSD A;  3I8B A;  2X6N A;  1YJW N;  4HUG A;  4M3X A;  4N56 A;  4W5N A;  1W97 L;  1G99 A;  1M1K O;  1E4F T;  3CG7 A;  2ZJP L;  2KTQ A;  3PX4 A;  3UB5 A;  4FJ9 A;  2O8B B;  1X3N A;  5LJV A;  1VSE A;  2FBV A;  3WXM B;  3J7A P;  4KTW A;  2HW3 A;  1YTA A;  4O44 A;  3WNH A;  4F2R A;  3ZSY A;  3MWT A;  3A5L C;  1U2V A;  4FLZ A;  4DR2 K;  4YOT A;  3A5N C;  4M3Y A;  1N32 K;  5B8H A;  4X65 K;  4CFC A;  3KKS A;  3NGZ A;  1RDA A;  2A42 A;  5JMV A;  2WUS A;  4CZG A;  4KBO A;  2PYL A;  4OGC A;  2O8E A;  1RDU A;  3VPZ A;  1BI4 A;  1IG8 A;  3FZH A;  4PA1 A;  2QA4 N;  4CBW A;  1FJG K;  3ZT0 A;  1IKV A;  4F2S A;  1NGF A;  2F4V K;  2KHO A;  1NK6 A;  3HM8 A;  3D6R A;  2QI2 A;  4YHH K;  4DQP A;  5J2M A;  3U3G A;  4M3W A;  2FC0 A;  4DQI A;  4JKG A;  5AQM A;  4GV6 A;  4BRI A;  1XMO K;  1JLQ A;  4OVL A;  3G4S N;  2HB5 A;  3L4Q A;  3WXL A;  4FXD A;  3P83 D;  1ATR A;  4DUY K;  3WQU A;  4B1U B;  3T1Y K;  5HOO A;  3SAH A;  4FW2 A;  3NH0 A;  1GLB G;  1WOQ A;  1KCF A;  2E1Y A;  4DLE A;  1GOC A;  2HBK A;  1VQ9 N;  3LDP A;  1JL1 A;  3ZSO A;  3NH1 A;  4OKJ A;  3VQP A;  3HBT A;  1VQK N;  4FVU A;  2ASM A;  3M1F A;  2PYJ A;  4E7L A;  3TAR A;  3TTF A;  3MCA B;  2UXC K;  3PSF A;  3LWL A;  2NRZ A;  4KO0 A;  2QM1 A;  2O8F B;  5EOY A;  1VQ7 N;  1VK0 A;  2E6L A;  3CXC M;  4JI6 K;  4GW6 A;  4GMJ B;  3OJS A;  3PSI A;  4AQY K;  2B6A A;  4RW6 A;  4QOZ B;  1RTD A;  4LFA K;  2Y1I A;  3VEY A;  4FLY A;  1ZBS A;  3RR7 A;  3QML A;  2WFB A;  1ZBI A;  1Q9X A;  1A5X A;  2G8I A;  1KAZ A;  3TAF A;  3LP1 A;  3TTD A;  4E7I A;  4DSI A;  3QNN A;  4FK2 A;  2W40 A;  2YJE A;  2HHV A;  1JXE A;  2FXU A;  3DRR A;  3F2K A;  4CHP A;  4PUO A;  4BVP A;  3ULD A;  5EU7 A;  2BH1 A;  4N47 A;  4DCH A;  2HBJ A;  2XY7 A;  3VMF B;  3PIP L;  2XY8 A;  2A5X A;  3HTV A;  1L3S A;  5BPL A;  4H5V A;  3AVK A;  3O3G A;  1QZ6 A;  3WEE A;  3TSP A;  2A40 A;  1C0G A;  1XC3 A;  4WE1 A;  4YDU C;  5JLF A;  1J5E K;  1HR0 K;  4WQ5 C;  4CHQ A;  1XC9 A;  2CGK A;  1XI1 A;  3O9U A;  4DTS A;  3CFR A;  3V9S A;  2OTL N;  2G8V A;  2GWJ A;  5I9E B;  5KPT A;  1NGH A;  2E4L A;  3FGU A;  4XEI A;  2P9U A;  2UXD K;  3QEX A;  4BC4 A;  5AQR A;  3SAG A;  1QZ5 A;  3T7Z A;  4OPH A;  4CFD A;  1Q7Y O;  3H08 A;  1JLE A;  2UUB K;  3DLE A;  1YHQ N;  3QIP A;  3ATV A;  3WNG A;  1U2V B;  4FPB A;  3T1H K;  3M3Z A;  3TU5 A;  3EZW A;  3SJH A;  1WSF A;  4KKO A;  1K6Y A;  3W0L A;  5EXW A;  4CES A;  1NKB A;  4DR3 K;  2O8E B;  1IV0 A;  3L4I A;  4PL8 A;  2RPI A;  2Q1N A;  4FJI A;  3HO1 A;  1IBM K;  1NK4 A;  2F9W A;  4RW4 A;  3JSM A;  4BQZ A;  3M8Q A;  1NWK A;  5AFU A;  1C1B A;  3SV4 A;  3Q7B A;  3WQT A;  2RE2 A;  3KK1 A;  3ITH A;  2FSK A;  3SK3 A;  1JXB A;  5EY4 A;  3VGM A;  4A61 A;  2Z1G A;  2ZE2 A;  1WSJ A;  4CJW A;  1Y97 A;  1TKX A;  3U8X A;  4FJJ A;  3RWU A;  4GY2 B;  2O4G A;  1JKH A;  2OPS A;  1NJY A;  2UXB K;  4I9L A;  3SQ2 A;  1HNX K;  3EEQ A;  1BL3 A;  5AQU A;  5GAG P;  2OPP A;  4F9O A;  1JLB A;  3QIN A;  1VQ4 N;  3KK7 A;  3NF7 A;  5DK5 A;  4IJA A;  1HPZ A;  3S3N A;  3DOL A;  1C6V A;  5BN8 A;  2HBL A;  2NRT A;  5BRH A;  1YVU A;  1QE1 A;  4BRE A;  2OYQ A;  1DTQ A;  3C94 A;  1Z26 A;  2QWP A;  5IWA K;  4BGA A;  4TSX A;  3M6G A;  4JKH A;  4JKC A;  2OCE A;  4CJF A;  1DEJ A;  1SS6 A;  2UUA K;  4FZZ A;  3C6H A;  2KKZ A;  1BU6 O;  3HRG A;  3CCJ N;  2WON A;  3TAQ A;  3AO5 A;  2FBT A;  2YNG A;  1EO1 A;  3H45 C;  1C0T A;  2GUI A;  4EFH A;  2WBN A;  4DFJ A;  2V51 B;  3KWG A;  3QO9 A;  4MDB A;  3FR0 A;  3A8Y A;  3V9Z A;  2GWK A;  3T1A A;  1SKS A;  4CZK A;  1J54 A;  3C6U A;  4I6M A;  4CHY A;  5BPM A;  4B1Y B;  3TAP A;  5IT9 O;  1GLC G;  2W42 A;  2UYT A;  4E7J A;  2VG7 A;  3D2F A;  3QER A;  4FJ5 A;  2QWR A;  3CC2 N;  4BR0 A;  4ID1 A;  4O8U A;  4DS5 A;  1IH7 A;  3SJJ A;  4HCB A;  5FPE A;  1IG9 A;  1Q8I A;  4KAZ A;  4B9T A;  3DM2 A;  1C0M A;  1BIZ A;  3MMV A;  3SNN A;  2DPN A;  3G71 N;  2HF4 A;  5AQX A;  5HRS A;  2O8D A;  1YIT N;  1B92 A;  2VG5 A;  5C15 A;  4C23 A;  3WEE B;  1S1W A;  4DQQ A;  3DLG A;  1Y64 A;  4M3T A;  3H3N O;  4JI2 K;  4CJR A;  4DTX A;  5HL7 L;  1RT2 A;  1X9M A;  1HQE A;  4BDY A;  4E0D A;  3HSC A;  3TPQ A;  2OPQ A;  3IKM A;  1IKY A;  3RRH A;  1RDC A;  4YY3 K;  2ZJR L;  2P9U B;  4YNQ A;  2XRI A;  5CYQ A;  3CPE A;  4C8O A;  1JCG A;  5AZI A;  1LV5 A;  1NGI A;  4CBU A;  1R0A A;  3OBY A;  3OYL A;  2HHT A;  4BC3 A;  4DUZ K;  1I39 A;  3CM5 A;  3MK6 A;  5LMU K;  3SMS A;  1GLL O;  4ICL A;  3KVG A;  4DTU A;  1NJW A;  1RIL A;  5AQY A;  1Q9Y A;  2E5L K;  4PWD A;  4WF9 L;  4IFE A;  4B9N A;  4RW8 A;  2NRR A;  4FSV A;  3L2V A;  1ZBF A;  3K5O A;  3G25 A;  3SYZ A;  1J9A A;  3VQE A;  4CEQ A;  4FOE A;  3DLB A;  1E3M A;  1BWF O;  3HJF A;  3C6T A;  4JNE A;  3DXM B;  5AQQ A;  3AAR A;  5FPN A;  4DV5 K;  3O4Q A;  2XY5 A;  3CMA N;  3N4Q A;  2X74 A;  4KI6 A;  4EZ6 A;  4BR9 A;  3NFA A;  1C0F A;  4CK2 A;  2IVN A;  5JS2 A;  1KQS M;  5C2F A;  3O8M A;  3OJU A;  1C1A A;  3TAB A;  1DGK N;  5AQG A;  4NB4 A;  4BWM A;  3CM6 A;  1BQN A;  3V9X A;  4IG3 A;  4OJR A;  1ASV A;  2JWK A;  4FJK A;  3J7Y P;  3OYM A;  1UA0 A;  3EO3 A;  4E89 A;  4M3U A;  1MWM A;  1HKG A;  2ZJQ L;  1JL2 A;  3QNO A;  3ZSZ A;  4F8R A;  3LDS A;  1SZ2 A;  5AQW A;  3VTH A;  1NGA A;  2D0P A;  1QQO A;  5AQP A;  3VQ7 A;  3L2W A;  5C42 A;  1D5A A;  1X9W A;  4I2Q A;  4DR6 K;  3CER A;  1B9D A;  2O4I A;  3J81 O;  1RCH A;  2X78 A;  4ZTF A;  4ZHR A;  4Q5V A;  3AVB A;  1SV5 A;  4FZX C;  4CHO A;  4EP5 A;  1VQN N;  4Q0B A;  2ZGY A;  4E1J A;  2HMI A;  2CH5 A;  1RTI A;  3CCU N;  1VQL N;  1KFS A;  1Q82 O;  1LAV A;  3JXU A;  3ZEU B;  1HYZ A;  3MED A;  4B08 A;  3KHY A;  2VWJ A;  1CZ9 A;  1VQ5 N;  1XMQ K;  1HNZ K;  2JGU A;  4C1N I;  4B1W B;  4FCY A;  4B3S K;  1NJX A;  2V7Y A;  4CJE A;  1KLN A;  4FW1 A;  4C8L A;  4B3T K;  3D2F B;  4JD2 B;  1BGX T;  4EP4 A;  1OVQ A;  2Q0U A;  3LAL A;  1KVA A;  4FM0 A;  3ZX2 A;  2IIR A;  3W3D A;  3MX2 A;  2GTD A;  4JK7 A;  1Z6R A;  3FFK B;  3PV8 A;  4E7H A;  5LL6 Z;  2X6S A;  2XY6 A;  1QSL A;  4AHR A;  4BRF A;  4WQ5 A;  3QEW A;  1L5U A;  4DSK A;  1RNH A;  4O5F A;  2O8D B;  2E2N A;  4HTU A;  1FXX A;  3BP8 A;  3J7Z O;  3OYN A;  1XHX A;  1NM1 A;  4E1M A;  4C8K A;  3QEV A;  3CJ7 A;  1P90 A;  1EP4 A;  3EL2 A;  3A5M C;  2GUP A;  1VSJ A;  4IFV A;  1XHZ A;  1HYV A;  4U67 L;  3NH2 A;  1KSP A;  2EHG A;  3ULE B;  5AZI B;  1OKJ A;  1Q81 O;  3EKS A;  4FWQ A;  2ZM6 K;  1TAQ A;  3FFI A;  3MN7 A;  2PZS A;  4MO5 A;  1ZBH A;  4CGG A;  4HVJ A;  1KC8 O;  4KFB A;  4LF5 K;  3R1X A;  1ATN A;  4H0T B;  1NGE A;  4KB1 A;  2ETJ A;  4A5A A;  4CJK A;  3LDN A;  2KZZ A;  1GLA G;  3L2U A;  3M8S A;  1B9F A;  1GLF O;  3K58 A;  2Z1I A;  2QWO A;  5D3G A;  1DKG D;  4JHD B;  4DFM A;  4DV0 K;  4H0V B;  3LL3 A;  3KLG A;  1YT3 A;  2CH6 A;  5AQH A;  2BDP A;  2NLX A;  1S22 A;  4GKK K;  1HNW K;  2QK9 A;  5AZJ B;  1NKE A;  4BRM A;  3O4W A;  4CGI A;  4CBX A;  4J8F A;  1KVB A;  4Z4C A;  4LSN A;  5C24 A;  1MU2 A;  4AHV A;  3ID8 A;  2KFN A;  4DU4 A;  1BCM A;  1RDW X;  3LDQ A;  2E88 A;  1T05 A;  3SPZ A;  2DFF A;  3R3L A;  4DHY A;  4H5W A;  5AQV A;  3IRX A;  3ZT1 A;  1S9E A;  4CFB A;  3ZT4 A;  4OPA A;  4M63 C;  3QBW A;  3ZET B;  2G8F A;  3MCP A;  4GV3 A;  3I33 A;  3IS9 A;  1HRH A;  3VEZ A;  4Y1D A;  1FK9 A;  4GKJ K;  2OTJ N;  3IFR A;  4JKD A;  1T6C A;  4KHN A;  4QAG A;  1JLC A;  3CCQ N;  3RMD A;  3GOI A;  2GBZ A;  3V9U A;  3DLR A;  4ILH A;  2ZF5 O;  5EX5 A;  1HJO A;  1KTQ A;  3IAY A;  4B9Q A;  4C8N A;  4BRC A;  3ENO A;  3AVJ A;  1QVF M;  5TKY A;  3T3F A;  4BRL A;  4FPA A;  1GOA A;  1U47 A;  1TGO A;  3CCE N;  3M8P A;  4NYF A;  3DRP A;  1QTM A;  4DF4 A;  3E9L A;  3T19 A;  2UUC K;  3NBP A;  2ITG A;  3VQ4 A;  4B9U A;  1EWQ A;  3QLH A;  1RT7 A;  4IOX A;  2HMP A;  4IG0 A;  3WT0 A;  1EXQ A;  3RMA A;  4LF9 K;  1CZB A;  2Q36 A;  2Z1H A;  4GVM A;  2IVO A;  1VHX A;  1TUU A;  1IKW A;  4WFA L;  4N5S A;  4PKH A;  4BGB A;  5GAE P;  1NK8 A;  4I2P A;  4LY7 A;  4JKE A;  1S1U A;  3DJC A;  5FDL A;  4MFB A;  5HRR A;  1NK5 A;  4CI6 A;  4A62 A;  4KHQ A;  4FJN A;  1LWF A;  2P1J A;  4H0O A;  4WQ4 C;  4A59 A;  3MEE A;  1L3T A;  3DWL A;  4JK8 A;  3MXJ A;  2D5R A;  1UOC A;  2DFE A;  3OYJ A;  4OLA A;  2HVH A;  5C10 A;  1BG3 A;  3OYH A;  4KH6 A;  3O4N A;  4IDK A;  3K9J A;  3RTV A;  4WCE L;  3VES A;  1TAU A;  3NVK A;  3EZ5 A;  3LDL A;  1BIU A;  2AJQ A;  4BC5 A;  5CY4 A;  3OYD A;  4MLE A;  4N76 A;  3MWP A;  3HPG A;  3O9R A;  4LF6 K;  4DG1 A;  1RT5 A;  2D0O A;  4FJG A;  1WLJ A;  1UAX A;  4Z4F A;  2VG6 A;  1NMN A;  3AO1 A;  3UKR A;  5BRF A;  2RN2 A;  3THY A;  5CR4 A;  3VEO A;  3IDH A;  2V7Z A;  3L3U A;  4RTF D;  5A2Q O;  5JVG L;  3TI0 A;  4FJ8 A;  3E01 A;  4GV9 A; 
#chains in the Genus database with same CATH homology
 4CEA A;  3SV3 A;  3ZSR A;  3V6D A;  3PX6 A;  1RBV A;  1C0T A;  4CGH A;  2GUI A;  4B8A B;  3L2Q A;  3G0Z A;  4DFJ A;  2Z1J A;  3SUQ A;  4J2A A;  4E19 A;  1IO2 A;  4O0I A;  3V81 A;  3S3O A;  1LWC A;  4FLX A;  2R7Y A;  3QO9 A;  1T8E A;  4HCC A;  5HRN A;  3OS2 A;  4IFY A;  4CJT A;  3V9Z A;  3NF8 A;  3OS1 A;  5KI6 A;  3T1A A;  3SQ0 A;  1SKS A;  4B3O A;  1CXQ A;  1J54 A;  1TKT A;  3C6U A;  1D8Y A;  2F96 A;  4CHY A;  3TAP A;  1RT1 A;  1S5J A;  2W42 A;  4E7J A;  3VQ5 A;  4DTM A;  2VG7 A;  4Z0U A;  4KHY A;  4KRE A;  4H8K A;  3QER A;  4FJ5 A;  1U45 A;  4LD0 A;  3VQQ A;  3K5N A;  4EZ9 A;  4CJS A;  4ID1 A;  2YKM A;  3VQD A;  3HT3 A;  5DMR A;  3F73 A;  3S9H A;  1C1C A;  3KD1 E;  4CJ4 A;  4CHN A;  2DY4 A;  4DS5 A;  1IH7 A;  2D0A A;  3SUO A;  3SJJ A;  1TK8 A;  4HCB A;  1IG9 A;  3LP0 A;  3OYG A;  2P5O A;  3ZSQ A;  4FM2 A;  1J5O A;  1Q8I A;  4KAZ A;  2KFZ A;  2WOM A;  4B9T A;  2HHQ A;  3DM2 A;  1C0M A;  1BIZ A;  2EX3 A;  3SNN A;  4KPY A;  5HRS A;  3AVA A;  1D9F A;  3AA4 A;  1B92 A;  3UIQ A;  4CGD A;  2VG5 A;  4NCB A;  3I0S A;  1S1W A;  3OS0 A;  4DQQ A;  3DLG A;  3CQ8 A;  1NJZ A;  4BAC A;  4DU1 A;  4M3T A;  1VSH A;  3NF9 A;  4CJR A;  4CF2 A;  4DTX A;  4DTO A;  1RT2 A;  4CF0 A;  2XO7 A;  1X9M A;  1HQE A;  4AHS A;  4W5O A;  4BDY A;  4CJ3 A;  3TAG A;  3WNE A;  2P5G A;  4E0D A;  4PQU A;  4DLG A;  1DLO A;  2B5J A;  4C8M A;  2OPQ A;  5CZ1 A;  4CIE A;  1IKY A;  4F3T A;  4CEO A;  4K8X A;  4F3O A;  3RRH A;  1RDC A;  4DQS A;  4YNQ A;  4C8O A;  2XRI A;  5CYQ A;  4CF1 A;  2HNZ A;  4CGF A;  1LV5 A;  1R0A A;  3HPH A;  3MEG A;  4AH9 A;  4JRQ A;  2FBX A;  5FRO A;  3OYL A;  3OYI A;  4LH5 A;  2HHT A;  1SUQ A;  1X9S A;  3ZT2 A;  3BGR A;  4FLU A;  3VA3 A;  1I39 A;  3CM5 A;  4BWJ A;  3QET A;  4ID5 A;  4ICL A;  1LW0 A;  1WAJ A;  4CED A;  1WSI A;  4DTU A;  1NJW A;  4CCH A;  1TL1 A;  1RIL A;  2HHU A;  1U49 A;  1KFD A;  1Q9Y A;  3HST B;  3AO4 A;  4OKK A;  5KRS A;  1FKO A;  1G15 A;  4PWD A;  3TAM A;  1RT6 A;  3AVI A;  1UA1 A;  3KD5 E;  3MAQ A;  4B9N A;  4FJX A;  4RW8 A;  3THV A;  3SI6 A;  2KW4 A;  1T03 A;  3SCX A;  3L2V A;  1RT4 A;  2B4J A;  1JLA A;  3KLE A;  3LZI A;  4RW7 A;  1ZBF A;  1N5Y A;  3K5O A;  4MQ3 A;  3D45 A;  4YFU A;  3SYZ A;  1J9A A;  1NJY A;  3VQE A;  4FK4 A;  3DYA A;  3ASM A;  4CIG A;  3AVH A;  1WSE A;  1VSK A;  4CEQ A;  1S1X A;  3DLB A;  1NOZ A;  2FBY A;  3L8B A;  3C6T A;  3KLF A;  4Z4E A;  3HJF A;  2QKB A;  3K5L A;  3HM9 A;  4H4M A;  3NAE A;  4O5B A;  4W5N A;  4L8R B;  2YKN A;  4ELU A;  4M3R A;  3HXM A;  5I42 A;  4I7F A;  2Q3S A;  4AHU A;  1C0U A;  4CFA A;  3SQ1 A;  4B9M A;  3KKR A;  2RF2 A;  3O4Q A;  2XY5 A;  3DOK A;  1QSY A;  2X74 A;  4FVM A;  4ELT A;  4EZ6 A;  4KI6 A;  1SKW A;  3NFA A;  1ITG A;  3KLI A;  2KQ2 A;  4FYD A;  1NK0 A;  2HND A;  3QIO A;  4CK2 A;  4BE2 A;  3P5J A;  3OYE A;  1W0H A;  4LSL A;  1S1V A;  2LSN A;  5JS2 A;  1F21 A;  1TL3 A;  3LPU A;  4FLV A;  1UWB A;  4E3S A;  2XHB A;  1ASU A;  4BE1 A;  4DTN A;  4B9V A;  4DSJ A;  2HHS A;  1DTT A;  3OJU A;  1C1A A;  1LWE A;  3OYK A;  3CFP A;  3TAB A;  1HNI A;  2I5J A;  3VA0 A;  4M42 A;  3OYC A;  4DMN A;  1RTJ A;  3V9X A;  4BWM A;  3CM6 A;  1BQN A;  2HNY A;  4OKE A;  2YNF A;  2ZQB A;  4IG3 A;  4OJR A;  4CEF A;  3LAM A;  5J1E A;  3NE6 A;  1ASV A;  5KGX A;  4DTP A;  1U4B A;  3PX0 A;  3LP3 A;  4CJV A;  4FJK A;  3OYM A;  1UA0 A;  3SZ2 A;  4M3U A;  4E89 A;  4CK3 A;  4Y1C A;  4KHS A;  3NGI A;  1QS4 A;  4FJM A;  4BDZ A;  4M3Z A;  1JL2 A;  3ZCM A;  4B9L A;  3QNO A;  3ZSZ A;  4F8R A;  3LDS A;  4R5P A;  3PO4 A;  3V4I A;  4KTQ A;  1QHT A;  1VSI A;  3VQ7 A;  4FJL A;  4FJH A;  3L2W A;  5C42 A;  3I8D A;  1D5A A;  2HVI A;  1EET A;  1VSD A;  1X9W A;  2X6N A;  4I2Q A;  1NK7 A;  1B9D A;  3VQ6 A;  2O4I A;  4ZTJ A;  4HUG A;  1TKD A;  1RCH A;  4KI4 A;  4M3X A;  1EKE A;  2X78 A;  4N56 A;  4ZTF A;  2JLE A;  2QXF A;  4ZHR A;  4Q5V A;  2HHW A;  3CG7 A;  4FJ7 A;  3AVB A;  2KTQ A;  1SV5 A;  3LAK A;  4FZX C;  4CHO A;  1HQU A;  4DU3 A;  4EP5 A;  3PX4 A;  3S3M A;  4FJ9 A;  5FRN A;  4Q0B A;  4J2E A;  3KIO A;  1NK8 A;  3I0R A;  2HMI A;  4FK0 A;  3ISN C;  4Z4G A;  1VSE A;  2FBV A;  1RTI A;  4NCG A;  3NCI A;  2QKK A;  1TV6 A;  4KTW A;  2DFH A;  2HW3 A;  2GV9 A;  1NKC A;  3ALY A;  2YNI A;  1KFS A;  1YTA A;  4O44 A;  1LAV A;  3WNH A;  3QES A;  4F2R A;  3ZSY A;  1W9H A;  1VSM A;  2IS3 A;  4CJQ A;  1HYZ A;  3MED A;  4FLZ A;  4B08 A;  1FKP A;  2VWJ A;  1CZ9 A;  1S9G A;  3MXM A;  2Y1J A;  4M3Y A;  3TAN A;  4B9S A;  2JGU A;  4CFC A;  1WN7 A;  3KKS A;  3NGZ A;  4FCY A;  1RDA A;  4FLW A;  4HUE A;  1NJX A;  2OZS A;  4CJE A;  4KRF A;  2ATQ A;  1KLN A;  5CZ2 A;  4FW1 A;  4CHZ A;  4OGC A;  3V9W A;  2PYL A;  4C8L A;  4K8Z A;  4KHW A;  1BGX T;  1BI4 A;  2YHA A;  4EP4 A;  4DSE A;  3SPY A;  5JS1 A;  3P1G A;  3LAL A;  1KVA A;  1S1T A;  4PA1 A;  4FM0 A;  4AHC A;  4RG8 A;  3KJV A;  1NOY A;  4G1Q A;  3ZT0 A;  5J2P A;  1GOB A;  1L3V A;  1IKV A;  3PV8 A;  4F2S A;  3QEI A;  4E7H A;  1I3A A;  4J2B A;  2X6S A;  3DLK A;  3OY9 A;  2XY6 A;  1KLM A;  1QSL A;  4AHR A;  2G8H A;  3F9K A;  3QEW A;  4M41 A;  1NK6 A;  1L5U A;  4DSK A;  1RNH A;  3CFO A;  4KTZ A;  4DQP A;  5J2M A;  2YHB A;  2OA8 A;  1L3U A;  3U3G A;  3AVM A;  3MXI A;  4HTU A;  4M3W A;  2FC0 A;  1FXX A;  3OYN A;  4DQI A;  3ZSW A;  3VQ9 A;  3PY8 A;  3AA2 A;  1XHX A;  1JLQ A;  4OGE A;  4E1M A;  4OVL A;  3K2P A;  4F4K A;  1ASW A;  2HB5 A;  3HP6 A;  3QEV A;  4C8K A;  3G10 A;  1BI4 B;  4Z4H A;  2G8K A;  1EP4 A;  3O3F A;  4DFK A;  3EYZ A;  4FXD A;  3P83 D;  1VSJ A;  1RBR A;  5KRT A;  4IFV A;  1XHZ A;  4DWI A;  4AIL C;  2YV0 X;  4JS5 A;  4KB0 A;  2A1S A;  4DSL A;  1HYV A;  1EX4 A;  4CJP A;  3NH2 A;  3DLH A;  4FW2 A;  1KSP A;  2EHG A;  1TK0 A;  3NH0 A;  3AA5 X;  4CEC A;  5SZT A;  1SL0 A;  2E6M A;  1TAQ A;  3FFI A;  1KCF A;  2PZS A;  1ZBH A;  4CGG A;  4HVJ A;  4DLE A;  2OPR A;  4W5T A;  3OVN A;  4OPJ A;  3NHG A;  1GOC A;  4KFB A;  3KK2 A;  1T7P A;  4KB1 A;  2ETJ A;  2IGI A;  1JL1 A;  4O0J A;  3ZSO A;  4CJK A;  3NH1 A;  4OKJ A;  3D0P A;  1X1P A;  3VQP A;  2KZZ A;  1BCO A;  2YNH A;  3LPT A;  3L2U A;  3M8S A;  1B9F A;  2IDO A;  4E7L A;  3TAR A;  2PYJ A;  1ZBU A;  3K58 A;  4HUF A;  3KLH A;  4N41 A;  2Z1I A;  3LWL A;  4KO0 A;  1TVR A;  1O1W A;  3AO2 A;  5D3G A;  4FLT A;  3TWH A;  2D0C A;  4M45 A;  3MEC A;  1VSF A;  4DFM A;  3SQ4 A;  1RDB A;  1VK0 A;  2E6L A;  3ZSX A;  3KLG A;  1QSS A;  1YT3 A;  3WNF A;  4DSF A;  1RTH A;  5HP1 A;  1N6Q A;  2BDP A;  4GW6 A;  4CIF A;  1BIS A;  4GMJ B;  1WSH A;  2NUB A;  2A1R A;  1WSG A;  3B6P A;  4CGJ A;  3HPO A;  3OJS A;  3KK3 A;  2BAN A;  3U6F A;  2QK9 A;  3K5M A;  3OYF A;  3BDP A;  2F8S A;  3CYM A;  1NKE A;  4CE9 A;  4CGI A;  2B6A A;  4RW6 A;  5CYM A;  4QOZ B;  1KVB A;  4W5R A;  1RTD A;  4Z4C A;  1YTU A;  2Y1I A;  4LSN A;  1S6P A;  5C24 A;  4CJU A;  4FLY A;  3SUP A;  2G8U A;  5HBM A;  4XIU A;  1WAF A;  1MU2 A;  1NK9 A;  4AHV A;  3RR7 A;  2G8W A;  4KHU A;  3HL8 A;  4E1N A;  2VWK A;  4JRP A;  1ZBI A;  1BQM A;  4O4G A;  1Q9X A;  1A5X A;  4CF9 A;  3U3Y A;  2KFN A;  2G8I A;  4DU4 A;  3TAF A;  3VQB A;  1BCM A;  3LP1 A;  4CEE A;  4KV8 A;  4E7I A;  4DSI A;  4CF8 A;  4CJL A;  3SPZ A;  1T05 A;  1VRU A;  2DFF A;  3QNN A;  1SKR A;  1RBS A;  1REV A;  3HVR A;  5HLF A;  4FZY A;  4FK2 A;  4OLB A;  3VN5 A;  2DTU A;  2HHV A;  1JXE A;  3IRX A;  3DRR A;  3ZT1 A;  4RW9 A;  3LZJ A;  1Z25 A;  4CHP A;  1S9E A;  2P51 A;  3ZT4 A;  4CFB A;  4PUO A;  1U04 A;  1KRP A;  3ULD A;  5EU7 A;  4ELV A;  4N47 A;  2XY7 A;  3O3H A;  3SUN A;  1RT3 A;  2XY8 A;  3RMB A;  1L3S A;  2G8F A;  3AVK A;  3O3G A;  5I3U A;  4WE1 A;  3IS9 A;  2BGG A;  1HRH A;  4LH4 A;  4Y1D A;  1FK9 A;  4J2D A;  5HRO A;  4CHQ A;  1XC9 A;  1XI1 A;  4DTS A;  1ZYQ A;  3CFR A;  4KHN A;  3V9S A;  3V1O A;  4QAG A;  1JLC A;  3RMD A;  4JLH A;  3AO3 A;  2G8V A;  2HHX A;  2KZM A;  3EY1 A;  2PY5 A;  2GBZ A;  3V9U A;  2E4L A;  3DLR A;  4B8C A;  1SL2 A;  5HRP A;  3NGY A;  3QEX A;  2IAJ A;  4NYN A;  3HK2 A;  3AVF A;  3LP2 A;  1S6Q A;  1KTQ A;  3A2F A;  3IAY A;  2BE2 A;  5KGW A;  4CFD A;  4I9Q A;  5FRM A;  2IOC A;  3DI6 A;  4BE0 A;  3H08 A;  4C8N A;  2RKI A;  1JLE A;  5J2N A;  3DLE A;  1LW2 A;  3V1Q A;  3AVJ A;  3VQC A;  1ZBL A;  3QIP A;  3WNG A;  3T3F A;  3PUF A;  1GOA A;  1A5V A;  4PY5 A;  1U47 A;  3VQA A;  1TGO A;  3M8P A;  1WSF A;  3AVC A;  4FM1 A;  1WNS A;  4KKO A;  1K6Y A;  4NYF A;  4CES A;  1NKB A;  3DRP A;  1JLF A;  1QTM A;  3RR8 A;  4DF4 A;  3L3V A;  3T19 A;  1HNV A;  3ZSV A;  2RPI A;  3NBP A;  3DMJ A;  4DTR A;  4FJI A;  1A5W A;  1RDD A;  2ITG A;  3VQ4 A;  1TK5 A;  1QQC A;  4IKF A;  1NK4 A;  4B9U A;  3HYF A;  3HO1 A;  1D9D A;  4RW4 A;  3JSM A;  3QLH A;  1IKX A;  3M8Q A;  4CEZ A;  1C1B A;  3NF6 A;  3SV4 A;  1RT7 A;  3PO5 A;  3KK1 A;  1CLQ A;  4AHT A;  3ITH A;  5E41 A;  4IG0 A;  4CEB A;  1EXQ A;  3VQ8 A;  4UQG A;  3AVG A;  3RMA A;  1JXB A;  1CZB A;  2Z1H A;  5K14 A;  5C25 A;  4GVM A;  2ZD1 A;  3LWM A;  2Z1G A;  1IKW A;  2ZE2 A;  1WSJ A;  4CJW A;  4N5S A;  1Y97 A;  1TKX A;  3V1R A;  5SWM A;  3L2R A;  4FJJ A;  3RWU A;  2O4G A;  1JKH A;  2OPS A;  3OYA A;  1KVC A;  4I2P A;  4LY7 A;  1VRT A;  4O55 A;  4I9L A;  4DS4 A;  3B6O A;  1S1U A;  4CER A;  5FDL A;  5T7B A;  3SQ2 A;  3QEP A;  4MFB A;  5HRR A;  2F8T A;  3K57 A;  4CK1 A;  1NK5 A;  1BL3 A;  2D0B A;  1LAW A;  4BDP A;  4W5Q A;  4KHQ A;  4HHT A;  4FJN A;  4H4O A;  1LWF A;  2OPP A;  2P1J A;  3KTQ A;  3DRS A;  1JLB A;  1L3T A;  3MEE A;  3QIN A;  4E7K A;  4NCA A;  4DF8 A;  3NF7 A;  5DK5 A;  3AV9 A;  5J2Q A;  3MXJ A;  2D5R A;  4QCL A;  4Z4I A;  1UOC A;  2DFE A;  3AA3 A;  3OYJ A;  1HPZ A;  1BHL A;  4OLA A;  2HVH A;  3OYH A;  1RBU A;  1VSL A;  3AVL A;  3O4N A;  4IDK A;  3HP9 A;  3RTV A;  4DFP A;  3DOL A;  3TR8 A;  3S3N A;  1TAU A;  3EZ5 A;  1C6V A;  4DTJ A;  1BIU A;  3C95 A;  3HVT A;  3TAE A;  2AJQ A;  1J53 A;  3LAN A;  2OYQ A;  1YVU A;  1QE1 A;  3M8R A;  1DTQ A;  3K59 A;  1CXU A;  5CY4 A;  3OYD A;  4DQR A;  3RRG A;  3C94 A;  1Z26 A;  1RBT A;  1SL1 A;  4N76 A;  4JS4 A;  3HPG A;  3ZT3 A;  4OPK A;  4TSX A;  1HYS A;  2OZM A;  3IG1 A;  4DG1 A;  1RT5 A;  4CJ5 A;  1U48 A;  1WLJ A;  4IBN A;  4CJF A;  4FJG A;  1UAX A;  2IC3 A;  4FZZ A;  3RMC A;  1HJR A;  3NDK A;  3AVN A;  2VG6 A;  4Z4F A;  1HMV A;  3AO1 A;  1TKZ A;  5KTQ A;  2RN2 A;  1XWL A;  1JLG A;  2WON A;  3L3U A;  3OYB A;  3TI0 A;  3TAQ A;  3AO5 A;  2FBT A;  4FJ8 A;  2YNG A;  3E01 A;  3JYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...