1ZBUA

Crystal structure of full-length 3'-exonuclease
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
225
structure length
225
Chain Sequence
SYYDYICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYVRPEINTQLSDFCISLTGITQDQVDRADTFPQVLKKVIDLMKLKELGTKYKYSLLTDGSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPHCGLDDSKNIARIAVRMLQDGCELRINEKMHAGQLMSVSSSLPIEGTPPPQMPHFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3'-5' exonuclease ERI1
publication title Structural basis for 3'-end specific recognition of histone mRNA stem-loop by 3'-exonuclease, a human nuclease that also targets siRNA
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 62
structure length 225
sequence length 225
chains with identical sequence B, C, D
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
A PF02037 SAP SAP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1zbuA01
2QXFA 3VA3A 3SI6A 1L5UA 4Y1CA 3TR8A 4DTNA 3S3NA 3CQ8A 2FBTA 2Z1JA 4DQPA 1WSIA 4O55A 1DTQA 4I9LA 2W42A 4M3WA 5KI6A 3MXIA 3NCIA 3V9UA 4AHCA 2VWJA 1YVUA 1FK9A 1CZ9A 4UQGA 4ELTA 2HHSA 3OYHA 1VK0A 5I3UA 1ITGA 5CZ2A 2KFZA 3LP2A 4RW6A 1C0UA 4DSJA 4PQUA 4K8XA 2YV0X 3D45A 4FLZA 3HP9A 1KVCA 3S3MA 3EY1A 4PWDA 1S6PA 4FJNA 3T19A 1IKXA 4DLEA 4ELVA 2HNYA 3KIOA 2G8VA 2Z1GA 1GOAA 4FLUA 3C6UA 5SZTA 5J2MA 2Y1IA 2PZSA 3K5NA 2OPQA 3U6FA 3SCXA 3NH2A 4OGCA 2HNZA 4I2QA 4CFCA 3V1QA 1J9AA 3RMBA 5K14A 4CGFA 3TAQA 4PY5A 3WNHA 3ZT3A 3KKSA 1BI4B 3F9KA 2YNGA 4CJLA 5KTQA 4DTJA 2HHWA 3KD1E 4CIFA 3SPYA 1U47A 3QEWA 1Z25A 3C94A 1S5JA 3ZT0A 3NE6A 4BE1A 4FJGA 4EP4A 1LV5A 1CXQA 1RNHA 4LSLA 1VSDA 5D3GA 2YNIA 4XIUA 1EETA 4DSEA 3LDSA 3QEIA 4B9MA 3C95A 4GW6A 2X6SA 3O4NA 4HUGA 5J2PA 1C1AA 3NAEA 4HCBA 1NJYA 3HP6A 1T03A 2PYJA 4Z4IA 3KK1A 5HBMA 1YTAA 1S1XA 4BWJA 1A5VA 4CHOA 4KREA 1C0MA 1WAJA 4DSFA 4CF9A 4DU4A 4OKJA 3WNGA 4CE9A 4CJVA 3HM9A 4KB1A 4FJIA 4O0IA 4JRPA 3MEEA 3PY8A 5KGXA 4FK4A 3QIOA 4F3OA 2HMIA 3VQ7A 4M3UA 4KHUA 1KCFA 4OKEA 3RMDA 4HCCA 2D0CA 2QKBA 2D0BA 2DFHA 3S3OA 1G15A 2EX3A 3AVHA 1A5WA 1VSHA 3NFAA 3OYDA 2KTQA 1TKXA 3U3YA 3KJVA 1VSMA 4O4GA 4FZXC 1EKEA 1EX4A 4F4KA 1X9SA 3F73A 3AA2A 3QINA 4GVMA 4KV8A 4ZTJA 4KHWA 1S6QA 2DFFA 3DM2A 3QLHA 2OZSA 3OY9A 1GOBA 4CJSA 1CXUA 3TAEA 4OKKA 1DLOA 4KAZA 1KFSA 1VSJA 4FJLA 3NGIA 4KRFA 1U49A 3VQQA 4I2PA 4H4OA 1I39A 3OVNA 4KTWA 2P51A 4BWMA 2ZD1A 4HUEA 4FLYA 4HVJA 1IKWA 4CK1A 1RDDA 3O3GA 3JYTA 3M8QA 3HO1A 4FJHA 4Z4FA 1MU2A 1TKZA 3OYNA 2OA8A 2VG5A 3A2FA 5J2QA 2OPPA 2XHBA 2E4LA 3QEXA 3SUNA 4CJQA 4QOZB 1HYVA 4JRQA 3AO1A 4DSLA 3LZIA 1NK5A 1QTMA 3QESA 4FLWA 1DTTA 1S1TA 4IG3A 2LSNA 1RBVA 1IKYA 1BIZA 4CJ4A 4DF4A 4DTPA 1S1UA 1KRPA 3NBPA 3RTVA 4CF8A 4FM1A 4IBNA 4RG8A 2Y1JA 1IKVA 2HHVA 3CM5A 1TKDA 4QAGA 4MFBA 1ZBHA 1X1PA 3IS9A 4F8RA 2HHXA 4E1NA 5C24A 3PV8A 4MQ3A 1VSFA 1RT4A 3AVFA 4IKFA 2EHGA 1S9GA 3TABA 2F8TA 1W9HA 3AO4A 4DSIA 3OYAA 3E01A 4OVLA 3VQ6A 4DG1A 3NH0A 2HHTA 3ZT4A 4E19A 2WONA 4BDYA 4FK0A 2FBXA 2YKMA 1O1WA 5CYQA 1IH7A 4LH4A 4DFPA 4OPKA 3PX0A 3DLGA 1WSJA 5FDLA 3ZCMA 4E1MA 3OYKA 3V81A 5HLFA 1T05A 1RILA 1U45A 2RF2A 1D9FA 1BL3A 4FJ9A 4CJWA 1XC9A 4CJ5A 1WSEA 3ZSQA 5KGWA 4DTUA 3SUPA 5DMRA 4FXDA 3ASMA 1NOYA 1BCOA 3WNEA 4H4MA 3NGYA 1ZBIA 5HROA 2BE2A 4KHQA 3OJSA 4I9QA 4PUOA 3KLEA 1NJXA 5KRSA 4FJ8A 4JS5A 3AVBA 3KKRA 4BDPA 1BI4A 4CIEA 4DQQA 3ZSXA 3OYIA 4CGDA 3CFOA 4CJRA 4ELUA 1HQUA 1RBTA 3H08A 4AHRA 2YKNA 2YNHA 5SWMA 4B9UA 4EZ6A 3BDPA 3MEDA 1C0TA 3RR8A 3SQ4A 4KTQA 1RT5A 1REVA 4CHPA 3JSMA 2P5OA 3TARA 4W5QA 3V1RA 3VA0A 2KW4A 1WNSA 3ITHA 1NK7A 3ALYA 2JGUA 4OGEA 2X6NA 2XO7A 3SYZA 4F2SA 2IDOA 1HMVA 2RN2A 4CEQA 4FCYA 1NK0A 1YTUA 1HNVA 1NJWA 1N5YA 4BE2A 3RWUA 3NF9A 3L2QA 1SUQA 1U04A 1XHXA 4CJTA 4ICLA 4LY7A 4W5OA 2YHAA 3DOKA 3QEVA 4J2DA 1QQCA 4M3TA 3AO3A 4CEDA 3KLHA 1J5OA 2HHUA 4FM2A 3VQ9A 1C6VA 3AO5A 4Z4EA 3B6PA 4KKOA 3TAGA 4M41A 4CHZA 2G8IA 1CLQA 4DTOA 3QNOA 4FJ7A 4DTSA 1EP4A 4B08A 4FLTA 3KLGA 1BQMA 4B3OA 4LD0A 3AO2A 3L8BA 4E0DA 5JS1A 2ITGA 2ZE2A 2DY4A 3V9WA 3LANA 3NH1A 1C1CA 1JLGA 3MXJA 4AHUA 1UWBA 4OLAA 3DRPA 2P1JA 4ID5A 1N6QA 1RBRA 3SV4A 1ASWA 4N56A 1TK0A 4LSNA 4DTXA 3PX6A 3SPZA 4F2RA 1VSEA 3CM6A 2DFEA 3C6TA 4CJKA 5EU7A 5E41A 4W5RA 1JLCA 3KLFA 3THVA 4CEBA 1WSFA 4DS4A 4CEEA 4EP5A 3DYAA 5HP1A 3MAQA 4FW2A 3HJFA 4CECA 4RW7A 4IFVA 3DRSA 4CGGA 4Q5VA 4ZTFA 4B9TA 4DFMA 4CERA 4CIGA 4CFDA 3M8SA 2XY6A 2A1RA 4CF0A 3I0RA 1TV6A 3V9XA 1WAFA 2IS3A 1NK6A 4E7IA 3IAYA 2RPIA 1LWFA 2YHBA 3I8DA 5I42A 4LH5A 5FRNA 2G8WA 3SJJA 2BGGA 1VSIA 4CHNA 4CCHA 2VWKA 3P83D 3K57A 4CESA 1NK4A 3HVTA 4JS4A 3NF8A 4B9SA 1NKCA 3B6OA 1JXEA 2F8SA 3O3FA 4B8CA 4DU3A 3PO5A 4K8ZA 1QE1A 4HHTA 3ULDA 2HHQA 1D5AA 4YFUA 1LWCA 1QSYA 3HSTB 3AV9A 2KZZA 3VQAA 4DTRA 2OYQA 1XHZA 1L3SA 4FM0A 4CF1A 3VQDA 4CJEA 1WSGA 3VQPA 3G10A 1U48A 3LPTA 3V1OA 3NHGA 3ZT2A 3OYLA 4FLXA 3K59A 4KFBA 4BDZA 1D8YA 2A1SA 2I5JA 3QETA 3M8PA 3KK2A 1B92A 2ATQA 3OYBA 2HVIA 5FROA 1HRHA 1RBUA 3AA5X 3AVMA 1RTIA 3NF7A 4FYDA 1TL3A 3TAPA 4DQRA 4OLBA 4FVMA 1RT3A 1HQEA 1UAXA 3ZSRA 3OYEA 4Z4HA 1BHLA 5FRMA 3SNNA 4E7LA 1RTDA 4O0JA 3MXMA 2DTUA 3RMAA 1JLFA 1QSSA 3P5JA 4RW4A 3L2WA 4DLGA 1D9DA 1S1WA 4DMNA 4F3TA 4DFJA 4N47A 1JKHA 4M3ZA 1W0HA 3VQBA 4CHQA 3EYZA 1IO2A 3OS0A 3FFIA 4M42A 1Y97A 4B9LA 2KZMA 2VG7A 1SKRA 4C8LA 4NCBA 2ETJA 4O5BA 1UA1A 1Q8IA 2YNFA 3D0PA 4C8KA 4PA1A 3CYMA 3OS1A 4QCLA 4KO0A 4M3RA 1ASVA 1U4BA 3DLRA 3TI0A 2XY5A 3PO4A 3K2PA 2FBYA 3TWHA 3DLHA 3HYFA 4DQIA 4KTZA 3K5MA 3L2RA 4EZ9A 1KVAA 3IRXA 4IDKA 4CJUA 4ZHRA 4L8RB 2FBVA 1X9MA 3AVGA 1NK8A 1FXXA 2B5JA 4N41A 4WE1A 3VQ5A 4JLHA 2R7YA 4AHTA 1VRTA 3PX4A 4ID1A 2NUBA 4DQSA 1T7PA 2P5GA 3OJUA 3IG1A 3RRHA 3SUQA 3RR7A 4FJKA 5HRSA 4B9VA 4YNQA 4DF8A 1RT1A 4KI6A 3ZSYA 1RTHA 1A5XA 1RT2A 1VSLA 4CJFA 4FLVA 1XI1A 1L3UA 4Q0BA 3O4QA 5HRRA 1WN7A 3KD5E 3SV3A 4CEOA 4Z0UA 1JLAA 3O3HA 2XY7A 3QEPA 3RRGA 1SV5A 1RDBA 5CZ1A 1ASUA 4FW1A 4CGJA 4CJPA 2RKIA 4C8NA 4KHYA 1VSKA 1BCMA 4FJXA 5J2NA 3SQ0A 1NJZA 1KLNA 3L3VA 1KVBA 1B9DA 4N5SA 2X78A 4Z4GA 1GOCA 4NYNA 2QKKA 1NK9A 2WOMA 3AA4A 4GMJB 4B8AB 3V4IA 1HYSA 2Z1HA 4IFYA 2KQ2A 4CF2A 2OZMA 1FKPA 1BGXT 2HB5A 3ZSWA 3HPHA 5C25A 1HPZA 4IG0A 3SQ1A 4CGIA 2D0AA 4R5PA 4NCAA 3HT3A 2G8UA 3AA3A 2HW3A 3QIPA 4NYFA 2GBZA 4DFKA 4M3YA 4AILC 1ZYQA 1S1VA 1JL1A 1TK5A 4CEZA 4J2EA 2G8HA 3LWLA 1LAVA 3DRRA 3V9ZA 4KB0A 3TAFA 1QS4A 3VQEA 1Q9YA 4DU1A 3V6DA 3NGZA 1YT3A 2KFNA 3T1AA 3OYJA 1JL2A 1HNIA 3G0ZA 1TK8A 2PY5A 3CFPA 3LP1A 3HPGA 2OPRA 1KLMA 1RDCA 1R0AA 1L3VA 1X9WA 2Q3SA 3VQCA 3K5OA 1I3AA 1RT7A 3WNFA 1VRUA 2X74A 3DOLA 5T7BA 4FJMA 3L2VA 4KHNA 1TL1A 4TSXA 3AVJA 1L3TA 3KTQA 1SKSA 2HNDA 3HVRA 4DSKA 2XY8A 3NDKA 1IG9A 2QK9A 1TKTA 1LW2A 3HL8A 3LALA 1NKBA 2GV9A 3K58A 2OPSA 4OJRA 3SZ2A 3SUOA 3OYGA 1BIUA 1KSPA 2PYLA 4CJ3A 4E7HA 5C42A 1TAQA 4FK2A 1BQNA 4C8MA 2BANA 3M8RA 3V9SA 4Y1DA 1T8EA 4B9NA 1B9FA 4DS5A 3P1GA 4DWIA 4N76A 2AJQA 1UA0A 4W5TA 1BISA 1RTJA 3VN5A 3LZJA 3AVIA 4KPYA 3LPUA 4J2BA 4RW9A 2IGIA 1JLEA 1LAWA 4H8KA 3OS2A 3VQ4A 3KK3A 3ZSZA 3MECA 4E3SA 1RT6A 4CFBA 3DI6A 3NF6A 3DMJA 4CFAA 3KLIA 2BDPA 3QO9A 4CHYA 3L3UA 1J53A 4AHSA 2FC0A 4FZYA 3ISNC 1HJRA 4KHSA 1WSHA 3L2UA 2JLEA 3TANA 1WLJA 1FKOA 3AVKA 4G1QA 1ZBLA 1NOZA 1KFDA 1EXQA 4CK3A 4E89A 2G8FA 3SQ2A 5JS2A 4E7JA 2IOCA 2VG6A 3LAMA 1RCHA 1ZBUA 5DK5A 3U3GA 4M45A 4AH9A 3AVNA 4CGHA 1ZBFA 4OPJA 4BE0A 4E7KA 1SKWA 2O4IA 3K5LA 4I7FA 3OYCA 3PUFA 2F96A 1S9EA 4KI4A 1TAUA 2IAJA 1K6YA 4BACA 4C8OA 4Z4CA 2G8KA 1J54A 1F21A 5KRTA 3DLBA 5HRNA 4O44A 5J1EA 2HVHA 1LWEA 3BGRA 4W5NA 3T3FA 1SL0A 2ZQBA 4FJ5A 2IC3A 4RW8A 2E6MA 2O4GA 3OYMA 3HXMA 3LP0A 1Z26A 1JLBA 1SL2A 3AVLA 5CY4A 4AHVA 1SL1A 3HK2A 3QERA 2XRIA 2D5RA 1JLQA 4CK2A 1XWLA 3LAKA 1RDAA 5HRPA 3CG7A 1QHTA 1TGOA 3ZT1A 3ZSOA 3VQ8A 2B6AA 1LW0A 5CYMA 4DTMA 1CZBA 3RMCA 1Q9XA 4FZZA 2GUIA 3LP3A 3AVAA 3MEGA 4HTUA 3HPOA 4J2AA 1UOCA 1JXBA 4HUFA 3TAMA 4FJJA 3LWMA 3ZSVA 1C1BA 3CFRA 1KTQA 3EZ5A 1TVRA 3AVCA 4CEFA 3S9HA 1QSLA 3OYFA 3QNNA 1RBSA 4NCGA 3DLEA 4CEAA 1HYZA 3I0SA 3UIQA 4M3XA 2Z1IA 1NKEA 2E6LA 3DLKA 2B4JA
chains in the Genus database with same CATH superfamily
2QXFA 3D7EO 3CIPA 3VA3A 3SI6A 1L5UA 3CQ8A 2HOEA 1XUPO 4DQPA 2O8CB 3VEXA 4BC3A 2W42A 3MXIA 3V9UA 4AHCA 1YVUA 1FK9A 4CBWA 1V4SA 1ITGA 1HR0K 5CZ2A 2KFZA 4RW6A 4DSJA 2YV0X 3VESA 3HP9A 1OKJA 3T19A 1IKXA 4FJNA 2HNYA 1VQNN 4PKIA 4ISFA 5KPTA 3K5NA 3U6FA 3SCXA 3NMUA 5AR0A 1N33K 5K14A 4CGFA 4CD1A 5CHIA 4I6MB 2YNGA 2HHWA 2UXBK 3QEWA 1Z25A 2KKZA 3C94A 5DM6L 4FJGA 2NRTA 1RNHA 5BPLA 1VSDA 3KZBA 4XIUA 5D3GA 1YHQN 3C95A 2WUSA 4DR2K 3J7AP 4BRNA 1C1AA 4ISEA 3KK1A 2QWOA 4BWJA 4DU4A 4JKBA 4OKJA 3WNGA 4BGAA 1J5EK 3HM9A 4FJIA 4G9ZA 4C1NK 2BH1A 1MA9B 3ZX0A 4KHUA 1S3XA 3RMDA 3OBYA 2D0BA 3KWGA 4YDUA 3S3OA 2EX3A 3LDOA 1A5WA 2KTQA 3U3YA 4IZ9A 3P31A 2FLOA 1GLCG 1NU0A 3DM2A 4DV5K 2UUBK 3FZMA 1KFSA 4KRFA 3NGIA 3KVGA 1U49A 4DUZK 3D2EB 3VQQA 4KTWA 5AZIA 3JYTA 5GAGP 4FJHA 4Z4FA 3WQTA 2VG5A 3QEXA 3SUNA 4AQYK 4H0OA 4JRQA 3AO1A 4DSLA 1QTMA 1S1TA 4IG3A 2LSNA 4IOAL 1IKYA 3DAWA 4CJ4A 4BC2A 1Z05A 3RTVA 4CF8A 3CJ1A 1QVGM 2HHVA 3CM5A 4QS7A 1ZBHA 3FLCO 1M90O 1G99A 3IS9A 2HHXA 5C24A 3PV8A 3RR8A 2UU9K 3O5BA 4IKFA 5E84A 2EHGA 1S9GA 3TABA 2F8TA 3VETA 1BDGA 1W9HA 3AO4A 4LF7K 3OYAA 3VQ6A 4BRMA 3NH0A 4UY8O 4JKFA 4FK0A 4JI8K 2YKMA 1O1WA 4ILGB 3OW2M 1IH7A 1HX1A 4DFPA 3PX0A 3VEZA 4BR9A 1BL3A 4H5TA 2QWNA 3ASMA 3DXMB 3NGYA 5HROA 5AZJB 3VF2A 2YJEA 1JCFA 3BZKA 3OJSA 4H0TB 1VHXA 3A5OC 4BDPA 1BI4A 3GDQA 2NRRA 4R79A 4CGDA 2E5LK 4IO8A 4GV3A 4AHRA 3BF3A 4EZ6A 4Z4IA 3H3OB 4BVPA 1C0TA 2IVOA 3SQ4A 1VQ7N 4CW7B 1REVA 4GY2B 2D4WA 2P5OA 3TARA 4W5QA 4M7YA 3VA0A 1WNSA 3U4LA 2JGUA 2XO7A 5EVZA 1MDUB 1HMVA 4CEQA 4U67L 4OX9K 1YTUA 1HNVA 3RWUA 1YVNA 2A40A 4CJTA 2YHAA 4M3TA 3O9QA 4CEDA 2HHUA 3AO5A 4Z4EA 3E9OA 1K73O 4YY3K 1Q18A 2P9IB 4H5RA 3AO2A 3L8BA 3V9WA 4WFBL 1C1CA 3IKMA 1FW6A 1UWBA 4ID5A 1N6QA 2E2NA 1RBRA 4N56A 3EL2A 2O8DA 5EU7A 1C0GA 4CEEA 3T69A 2PFUA 3HJFA 4BQLA 4IFVA 2VWBA 1HPMA 4B9TA 5BPMA 4CF0A 3CCSN 3V9XA 1WAFA 2IS3A 5I42A 4E1JA 2G8WA 4C23A 1KAXA 5AQQA 3VTHA 4O8UA 4C1NI 3LDQA 3NF8A 4B9SA 1NKCA 2F8SA 3O9SA 4DU3A 3BZCA 1RFQA 1D5AA 4DTRA 2OYQA 4FM0A 5IWAK 2IVNA 2VCPA 1WSGA 2ASPA 3G10A 3L6QA 3NHGA 3MN9A 3VOVA 3BP8A 1D8YA 2YHYA 2I5JA 1B92A 4GVEA 3OYBA 5FROA 1HRHA 3AA5X 1TUUA 3TSUA 4CI6A 3THYA 4OLBA 3OYEA 2KHOA 4H5NA 2DTUA 2NRHA 3P5JA 2VGNA 4F3TA 1M1KO 1JKHA 2A3ZA 4YOTA 1IO2A 3OS0A 3VEYA 3HM8A 4FWSA 1I94K 5LMNK 3EEQA 5AQFA 4O5BA 1Q8IA 5AQIA 1KXPA 1NNEA 2XY5A 3QMLA 3K9KA 3BUZB 1ZC6A 3L2RA 4EZ9A 4X66K 5JLHA 4LF8K 2E8AA 4CZFA 3C6HA 4JLHA 1U2VA 4CZEA 5M1NA 4AHTA 2QWMA 1NG9A 4DQSA 1T7PA 2P5GA 3RRHA 4FJKA 1ZBSA 5HRSA 4B9VA 1RT1A 2W6LA 5AQKA 1BU6O 4CJFA 3SV3A 2QM1A 4LFCK 2JWLA 1SQKA 2XY7A 5BREA 4IEEA 2RKIA 4KHYA 1VSKA 1BCMA 4BC5A 1YI2N 1KLNA 1B9DA 5AQTA 4N5SA 1GOCA 3D2FA 4GMJB 1HYSA 2Z1HA 3EO3A 4IFYA 4CF2A 5LMUK 3NVKA 1NGBA 3ZSWA 4Z94A 4CVNE 4IG0A 4BRFA 1X3MA 1T44A 4NCAA 1LOTB 4NYFA 2HW3A 4V19S 1YIJN 4H03B 4GV9A 3TTCA 3C65A 3VQEA 4NO7A 1Q9YA 4CZKA 3QICA 3MK6A 1HNIA 3G0ZA 4KH6A 4ISGA 2OPRA 2QA4N 1DEJA 4JK8A 2FF6A 1X9WA 2Q3SA 3QBWA 5T7BA 2NRZA 3ENOA 3H45C 4KHNA 4TSXA 3AVJA 1L3TA 3KTQA 3DJCA 1E3MA 3K58A 1TAQA 4PL8A 3E9LA 3MX2A 3QB0A 3V9SA 4B9NA 4YOUA 1B9FA 1W7AA 1OVYA 3R8EA 1BISA 1EO1A 4CZMA 3AVIA 4RW9A 1OH7A 3VQ4A 3KK3A 3U8XA 2FSJA 3C6AA 3MECA 3EKUA 3DI6A 3Q7BA 3DLLL 5BRHA 2P9SB 2BDPA 3QO9A 2FC0A 3ISNC 5JICA 2OANA 4G1QA 1ZBLA 1EXQA 4CK3A 2IOCA 2VG6A 3E66A 4AH9A 4CGHA 4ILHA 4OPJA 3AVNA 5C0YA 2IAJA 1K6YA 1RDWX 3ULEA 4Z4CA 1J54A 1F21A 3MMVA 5KRTA 2Q0UA 5EXWA 4B3SK 2O4GA 2ZJPL 1JLBA 3J81O 3HK2A 2D5RA 1QQOA 1XWLA 5HRPA 4PHTX 5A2QO 3ZT1A 4FSVA 4DB3A 5CYMA 3RMCA 1OH5A 3VTIA 1RDUA 4HTUA 3T1HK 3HPOA 4EHTA 3LWMA 4WFNL 1C1BA 3CFRA 3EZ5A 1QSLA 3AVCA 1QHAA 1RBSA 3AGRA 5B8HA 3J80O 1HYZA 3FZHA 3WXIA 2Z1IA 1SZ2A 4DKWA 4QS9A 4Y1CA 3S3NA 4O55A 1DTQA 3CQYA 3CJAA 3NCIA 3C7NB 2VWJA 3SMPA 4UQGA 3WEEA 4PQUA 4FLZA 4PWDA 1KVCA 3S3MA 4IJNA 5AFUA 1R59O 4X64K 2Z1GA 5J2MA 3VEVA 3R1XA 2P9PA 3NH2A 2HNZA 1J9AA 3NVMA 3RMBA 3THXA 4DCHA 3TAQA 5JVGL 1BI4B 4BRCA 1QZ6A 1EWRA 4CIFA 4JI0K 1EETA 3LDSA 3QEIA 1VQ5N 2X6SA 3O4NA 4HUGA 4LFBK 4KREA 1YTAA 1S1XA 2A41A 1WAJA 4DSFA 4CE9A 4KB1A 1XQSC 3TTDA 4FO0A 1NMNA 4FK4A 5F0XA 3QIOA 4F3OA 4LF6K 1KCFA 1BO5O 2D0CA 3NFAA 1TKXA 3KJVA 4FZXC 4FVUA 1EX4A 3VENA 1H1VA 2Q31A 1S6QA 2AA4A 2DFFA 3OY9A 3EZWA 1CXUA 1SAZA 1DLOA 1ESVA 1BG3A 2O8DB 1N8RO 4H4OA 3OVNA 5GIPA 3CC7N 4HUEA 2AP1A 1RDDA 2FF3B 3HO1A 3M8QA 4OPHA 4MDAA 1TKZA 4A61A 2F9TA 2E4LA 3UKUA 4CJQA 1HYVA 2P9UA 3M1FA 3O1WA 2ZWHA 1NK5A 4FLWA 1QVFM 2CGLA 5F1XA 1KQSM 4LC9B 3HBTA 3UE5A 5JMVA 4BRIA 3QFUA 4IBNA 1P90A 1IKVA 4MFBA 4E1NA 3G4SN 2VQEK 4J8FA 1LCUA 1IBLK 1J6ZA 4DSIA 2W40A 1K8KA 3EN9A 4OVLA 4E19A 4BDYA 5ADXA 5CYQA 4OPKA 3IMXA 5FDLA 3ZCMA 3OYKA 2QEXN 5AQHA 1U45A 2RF2A 1XNRK 4FJ9A 4CJWA 1XC9A 4CJ5A 2J4RA 4MLEA 5KGWA 4DTUA 5DMRA 5M1PA 3CCLN 3THYB 1NOYA 1BCOA 1ZBIA 4AM6A 3HOSA 4I9QA 4A2BA 5KRSA 4FJ8A 4JS5A 3KKRA 4CIEA 5I9EB 4BRHA 1V4TA 1IJJA 3WQUA 3H08A 2YKNA 3BDPA 3MEDA 1RT5A 3JSMA 3V1RA 3VGKA 4OGEA 3N4PA 2I7PA 4KH4A 3SYZA 4F2SA 2IDOA 3MWTA 2RN2A 3S41A 4K25A 4FCYA 1HKCA 4BE2A 3SBTA 3DWLA 1U04A 2D1KA 1J5OA 2OCEA 3B6PA 4KKOA 3TAGA 4DR4K 2G8IA 1XC3A 2Q97A 3O9UA 3ZEUB 1U2VB 4FJ7A 4DTSA 1EP4A 4LD0A 5C12A 2ZE2A 2DY4A 1VQPN 4AHUA 3MXJA 5C2DA 3DRPA 2P1JA 4JEPA 4YOVA 4HTLA 5CR4A 3CM6A 1JLCA 5CE3A 4AF1A 1QZ5A 4DV0K 4FW2A 2FXUA 4CECA 3DRSA 5AQMA 3D2FB 4PKGA 2E2PA 4WQ5A 4DFMA 2A1RA 3M8SA 3M3ZA 2FSNA 3I0RA 3L4IA 2YCHA 2YHBA 3I8DA 3UKRA 3SJJA 4OPAA 4CHNA 1QQMA 4CCHA 3P83D 3CI5A 3RSEA 4CESA 3OTOK 4DR5K 5AQLA 1NK4A 3AARA 2O8BA 1NBWA 3I33A 5FPMA 3O3FA 4B8CA 2HHQA 4YFUA 3HSTB 2A5XA 4B1WB 3H46O 4MO4A 5TKWA 1GLBG 1FJGK 3VQDA 3VQPA 3MDQA 1ATNA 4NXMK 3VERA 1NM1A 3ZT2A 4FLXA 3K59A 1W97L 3QETA 4B3TK 3KK2A 1KC8O 4MDBA 5BRDA 2HMPA 3NF7A 4FWLA 3TAPA 1HQEA 1UAXA 3ZX2A 4Z4HA 1BHLA 2WBNA 3SNNA 4E7LA 1GLLO 3MXMA 3T7ZA 3ZETA 1S72N 3L2WA 1S1WA 4FWMA 4M42A 5AQZA 4B9LA 1SKRA 1EWQA 2YNFA 4QCLA 4PA1A 3OS1A 1JCGA 4KO0A 1YXQA 3CC2N 2F7TA 1U4BA 3PO4A 1GLAG 4EIAA 2FBYA 4A62A 4DQIA 3HYFA 4JKEA 4GV6A 3IRXA 4IDKA 4EHUA 1X9MA 3AVGA 4N41A 1X3NA 3ULEB 3PX4A 1VQ9N 4KI6A 1VSLA 1RT2A 4IXCA 1WN7A 1NJIO 3RRGA 2QXLA 3CCJN 4C8NA 4BRKA 2UUCK 5KPRA 1W2BM 2NZTA 1KVBA 5KQDA 3THWB 4Z4GA 2QKKA 4JHDA 3O6WA 3V4IA 2HB5A 1IV0A 5C25A 1HPZA 4CGIA 2D0AA 1XMOK 3EE9A 1N32K 4BRAA 3CJ9A 1JL1A 4J2EA 4DHYA 1HKBA 1VQON 3V9ZA 4KB0A 3TAFA 4BY9C 3G25A 3V6DA 1YT3A 3VPZA 4BRPA 3WEEB 1L3VA 3VQCA 3K5OA 4XH1A 5AQYA 3WNFA 1S22A 4FJMA 2P9PB 1TL1A 1SKSA 3THXB 1IG9A 2Q1NA 1KSPA 4OJRA 3SZ2A 3SUOA 3OYGA 2PYLA 4CJ3A 4E7HA 5C42A 4FWKA 4FK2A 1BQNA 1IG8A 1T8EA 3P1GA 4W5TA 4PKHA 1JCEA 3LPUA 4BGBA 3H6EA 1LAWA 3OS2A 3P38A 1DGKN 1NGEA 1BUPA 3AAQA 4CHYA 3N4QA 2CH5A 3CPWM 4FZYA 2BTFA 3VF4A 3TANA 1WLJA 1FKOA 3IDHA 4FWOA 1NOZA 1KFDA 4NB4A 2G8FA 2NLXA 5DK5A 1SKWA 4I7FA 3OYCA 2F96A 1C0FA 1RGIA 3HOTA 4WF9L 2UXDK 4A57A 3CMEN 3DLBA 1TYQB 3O8MA 5J1EA 1LWEA 3BGRA 4W5NA 4FJ5A 2E20A 2IC3A 5AQNA 4RTFD 3LP0A 1SL2A 1SL1A 2ASOA 3VGLA 1JLQA 3UKUB 2O8CA 2P9UB 1RDAA 3CG7A 3VQ8A 3FR0A 4FZZA 1Q9XA 3MEGA 3LP3A 4J2AA 2VQFK 1UOCA 2ZF5O 4FWNA 4BRDA 3SJHA 2DPNA 3S9HA 4CEFA 3OYFA 4NCGA 3UIQA 2ASMA 2PAVA 4BROA 1NKEA 3DLKA 1NGCA 3LM9A 3TR8A 2FBTA 2Z1JA 4Y0WA 4M3WA 4I9LA 3J8AA 2W6KA 1CZ9A 2HHSA 1O13A 3LP2A 5AQGA 2W41A 4WQ4A 3D45A 4IWVA 4DUYK 1BWFO 1S6PA 4DLEA 4ELVA 3HTVA 2PZSA 4JKDA 4O8KA 1GOAA 4NLCA 4BRLA 4FLUA 3A8YA 3SAGA 5TKYA 2F4VK 4CZGA 4CFCA 3E9PA 1Q86O 4PY5A 3WNHA 3ZT3A 3G71N 4CJLA 4DTJA 3CCMN 1GLFO 3ZT0A 3NE6A 1WBDA 4EP4A 4LF9K 4LSLA 5GADP 3PIOL 3AGKA 4GW6A 4GKKK 3HI0A 2PYJA 3HP6A 1T03A 3MWPA 3TSPA 4BG9A 1A5VA 4CF9A 5FPNA 4CJVA 3D2EA 4IEIA 4JRPA 3MEEA 4YOYA 3LDLA 3F2KA 4H0VB 4OKEA 5LJVA 1NGDA 1G15A 3AVHA 3KWIA 1VSMA 4O4GA 1X9SA 3AA2A 3QINA 4GVMA 3QLHA 5FPEA 4OKKA 2CGKA 4KAZA 4FJLA 4B1UB 4I2PA 2HBMA 4YORA 2GWKA 4FLYA 2OTLN 5C2FA 3SBGA 4CK1A 4X62K 3O3GA 2OA8A 5J2QA 4XEIA 3M6GA 3SAFA 3O1BA 4QOZB 5KQ8A 3PSFA 3LZIA 1GLJO 3FFKB 3UKRB 4DQ8A 5BN8A 1BIZA 3CCEN 3NBPA 2HF3A 4RG8A 2O8EA 4QAGA 5AFUH 4F8RA 2O8BB 5AZIB 4MQ3A 3AVFA 5AZJA 3K0SA 2GELA 2QTDA 4DG1A 3ID6A 3CPEA 3ZT4A 4JN4A 4LH4A 3G6EN 5HLFA 1WSJA 3V81A 1RILA 4B9QA 1ILYA 1D9FA 5BR9A 4LF5K 3ZSQA 1NWKA 5AQJA 4KBOA 4H4MA 4WCEL 2BE2A 4KHQA 1U6ZA 4PUOA 1NGHA 1E4GT 3ZETB 3A0IX 2Q0RA 4DQQA 3OYIA 5AQPA 3CFOA 2P9IA 5M1KA 4ELUA 1HQUA 1RBTA 5SWMA 3WT0A 3MN6A 2KW4A 4JKCA 1NK7A 3ALYA 2X6NA 2GWJA 1ATRA 3VMFB 1VQ8N 1NJWA 1N5YA 1JJ2M 3NF9A 3L2QA 1SUQA 4W5OA 2Q2RA 4ICLA 1IBMK 4J2DA 3DOKA 2D0PA 1QQCA 3AO3A 3KLHA 2P9KA 1C6VA 2QWRA 4M41A 3U9ZA 4B08A 4JK7A 4B3OA 4E0DA 5JS1A 2ITGA 1NGAA 3OA9A 5AQVA 1JLGA 3I8BA 1XMQK 4WQ5C 3SV4A 1ASWA 4LSNA 4DTXA 3PX6A 3FZFA 3SPZA 1VSEA 3I56N 4W5RA 2DFEA 5E41A 3KLFA 3THVA 2I7NA 3ENHA 3MX5A 4B1VA 3WXKA 3MAQA 5HOOA 1BOTO 4FL9A 3PIPL 2WFBA 2E1YA 4CGGA 3A5MC 4JHDB 4Q5VA 4ZTFA 4JAXA 4CERA 4CFDA 2XY6A 2Q36A 4E7IA 3IAYA 4JKGA 5ADXH 1HNWK 5FRNA 4DR1K 3PLAA 2UUAK 3R9PA 3K57A 4KHPK 2NRVA 4XH5A 1OH8A 3B6OA 1JXEA 4K8ZA 3PO5A 1QE1A 3ULDA 1QSYA 5LL6Z 3AV9A 2CH6A 1XHZA 1L3SA 4B3RK 3CCVN 3LPTA 4KFBA 2P9LA 3IUCA 4BDZA 2ATQA 2HVIA 1RBUA 3AVMA 1RTIA 4H5WA 1TL3A 1NGFA 5AQOA 5HL7L 1RT3A 3H3NO 3ZSRA 1T3VA 1RTDA 2QWLA 4DV2K 4O0JA 3LM2A 3RMAA 1JLFA 2IIRA 3R3LA 3CC4N 4RW4A 2A42A 4DLGA 1D9DA 4DMNA 4FOEA 3A5NC 2V7ZA 4CHQA 3OHRA 1YITN 1Y97A 2KZMA 2H3GX 3I55N 4NCBA 3EKSA 3F9MA 3D0PA 3CYMA 1YJWN 4L3QA 5LJWA 2GTDA 3DLRA 3TI0A 5BRFA 4MO5A 4DV4K 3K2PA 3DLHA 2O8FA 4KTZA 3W0LA 3T1YK 2ZM6K 1KAYA 4L8RB 3DXKA 1VQ6N 2HHHK 1NK8A 1FXXA 2B5JA 3O9TA 4WE1A 4A5BA 5E26A 2R7YA 1VRTA 5KPZA 4ID1A 3CJCA 3OJUA 3RR7A 4YNQA 4DF8A 3O4WA 1RTHA 3M5RA 1A5XA 1XI1A 4Q0BA 3O4QA 3HRGA 1HJOA 4CEOA 3L4QA 3QDKA 3O3HA 3QEPA 1SV5A 1RDBA 4CGJA 4FW1A 1VAZA 1YAGA 4FJXA 5AQSA 5J2NA 3SQ0A 4H5VA 4JKAA 3WUHA 5H1SQ 2X78A 4DR6K 1NK9A 3GBTA 3CCRN 2HBLA 2KQ2A 2OZMA 3HPHA 4PL7A 3E1YA 3HT3A 4ILJA 3QIPA 2GBZA 4DFKA 4M3YA 4AILC 1ZYQA 4CEZA 1GLEG 3C0BA 3KK7A 3LWLA 2P9NA 3DRRA 5EY4A 1QS4A 4CBUA 4DU1A 4JK9A 3NGZA 3T1AA 4H0XB 1JL2A 3WXMB 2PY5A 4DV1K 3CFPA 3CXCM 3CJBA 1KLMA 1QQNA 2ITMA 1NGJA 1I3AA 1RT7A 1VRUA 4DV7K 2X74A 4DV6K 3DOLA 3L2VA 4BREA 2YJFA 2HNDA 3HVRA 2P9SA 2XY8A 5IT9O 1TKTA 1T6DA 3HL8A 3LALA 1NKBA 2GV9A 2OPSA 3AAPA 4C8MA 2BANA 4H0YB 3M8RA 2GEMA 5FPDA 4DS5A 2AJQA 5GAHP 4EFHA 1RTJA 3VN5A 3LZJA 5C10A 4J2BA 2IGIA 4YOWA 5JVHL 1HUXA 1Q7YO 1RT6A 1WB9A 3DMJA 3O9RA 1J53A 4AHSA 1HJRA 4KHSA 2E2QA 1WSHA 2NRWA 3L2UA 2JLEA 2HBJA 5C15A 2A6AA 4E7JA 3U3GA 3SPYA 4BE0A 1U47A 2O4IA 1TAUA 3PUFA 1BA1A 1S9EA 4KI4A 4FWQA 2EWSA 4BQZA 4C8OA 2WC9A 2G8KA 1NGGA 3CD6N 2HVHA 4O44A 4NXNK 3T3FA 1SL0A 5AQUA 4RW8A 2YX6A 3JAMO 3OYMA 3HXMA 3VF6A 3SMSA 3H1QA 4AHVA 5BR8K 1KAZA 1VQ4N 2XRIA 2E2OA 3LAKA 5BPNA 3AY9A 1QHTA 1TGOA 3ZSOA 5FLXO 1WUAA 3C7NA 2B6AA 1CZBA 3GG4A 2GUIA 3JXUA 1XNQK 1JXBA 3R6MA 4IOXA 3SLCA 1X9JA 1Z6RA 4JD2A 1CZAN 2O8EB 1TVRA 3DLEA 1ZXOA 2E6LA 4WQ4C 3SAHA 4M3ZA 4DTNA 5BN9A 1WSIA 2F9WA 2HBKA 5KI6A 4CZIA 4ELTA 4BRGA 3OYHA 1VK0A 5I3UA 4M63C 4BRQA 1C0UA 5M1QA 2ZGYA 4MLHA 3RVCA 4K8XA 3EY1A 2PBDA 3P4IA 1HLUA 3KIOA 3ZYYX 2G8VA 3C6UA 5SZTA 2ZJRL 3CQXA 2Y1IA 2OPQA 4OGCA 4I2QA 3V1QA 5AQRA 3O08A 1NMDA 3KKSA 3F9KA 5KTQA 1YJNN 4BR4A 4CZLA 3KD1E 4JI5K 1S5JA 4BE1A 2YHXA 1LV5A 3CJ7A 1CXQA 3BY5A 2YNIA 4DSEA 4B1ZA 4AM7A 4B9MA 5J2PA 3TTFA 4CJ7A 3NAEA 4HCBA 1NJYA 1NLVA 5HBMA 4CHOA 1C0MA 4DR3K 2IVPA 4O0IA 2P9KB 3PY8A 5KGXA 2HMIA 1HKGA 3VQ7A 4M3UA 1NGIA 3BF1A 2QKBA 4HCCA 4JNEA 2DFHA 3MCAB 4B1YB 1VSHA 3OYDA 1EKEA 4JKHA 4F4KA 1Y64A 3J7YP 3F73A 4ZTJA 4KHWA 4KV8A 4GNIA 4FXDA 3SK3A 1K8AO 2OZSA 1GOBA 4CJSA 3CMAN 3TAEA 5AJ3K 1VSJA 3A5LC 1I39A 2P51A 4BWMA 2ZD1A 4HVJA 1IKWA 3VEOA 4CZJA 1MU2A 2HF4A 3OYNA 4JI7K 3A2FA 2BUPA 2OPPA 3ID8A 2XHBA 3Q7CA 4CD3A 4DV3K 4JKGB 3QESA 1DTTA 1RBVA 2UXCK 4DF4A 4DTPA 1S1UA 1KRPA 3LL3A 4FM1A 4K42A 3QBXA 2Y1JA 1IBKK 3MCPA 3JS6A 3HZ6A 1TKDA 4LFAK 1X1PA 1VSFA 1RT4A 2KLAA 1YF5L 1VQKN 3E01A 2E1ZA 2HHTA 4M7XA 2WONA 2FBXA 2QWQA 3DLGA 4E1MA 2P9LB 1T05A 4FPAA 1WSEA 3SUPA 2V51B 3FE1A 3WNEA 4JI4K 3KLEA 1NJXA 3AVBA 1K8KB 4I6MA 3PSIA 3ZSXA 4JI2K 4CJRA 3ZEUA 5AQXA 2YNHA 4B9UA 5EOYA 4KTQA 4CHPA 3ITHA 3OBWA 4JI6K 1NK0A 1XHXA 2BGGA 4LY7A 3QEVA 2O8FB 3GE1A 3TSQA 4FM2A 3VQ9A 2JWKA 3DXKB 1WOQA 4CHZA 1P8ZA 1CLQA 4DTOA 3QNOA 1HNXK 3H1VX 4FLTA 3KLGA 1BQMA 3L0QA 4BR0A 2HSTA 3HSCA 3W3DA 2VYPA 3LANA 3NH1A 1MWMA 4IFEA 1EQYA 2QI2A 2RHKA 4OLAA 3WXJA 3MN7A 1TK0A 4F2RA 4B3MK 3C6TA 4CJKA 4BC4A 4CEBA 1WSFA 4DS4A 4BR5A 4EP5A 3DYAA 3LDNA 5HP1A 3GL1A 4RW7A 4IO9L 4CIGA 3EE8A 5GAEP 1TV6A 1NK6A 2RPIA 1LWFA 3UB5A 4JI3K 4LH5A 2ZGZA 5M1OA 1DKGD 1YUWA 1VSIA 2GUPA 1VQMN 4EAHD 2VWKA 4O5FA 5DM7L 2P9NB 1OVQA 3HVTA 4JS4A 5M1FA 1VQLN 4YOXA 4NLBA 4CZHA 2YI1A 4BG8A 2E88A 4HHTA 3ZX3A 1LWCA 4FPBA 2KZZA 3VQAA 4WFAL 4CF1A 4CJEA 1U48A 2GX9A 3V1OA 5GIOA 4A59A 3OYLA 4DR7K 2A1SA 3ENBA 3M8PA 1ATSA 1KD1O 2V7YA 3RSEB 4FWRA 4FYDA 4DQRA 4QS8A 1E4FT 4FVMA 3DXMA 5GINA 1BA0A 3B8AX 4U7BA 5FRMA 4OO1J 3VGMA 1QSSA 3CCQN 4DFJA 4N47A 1W0HA 4RCHA 3VQBA 3EYZA 2NNWA 3FFIA 4HWIA 4WYBA 2VG7A 4C8LA 3KHYA 2ETJA 1UA1A 5JLFA 4C8KA 4XH4A 4M3RA 1ASVA 4A2AA 1OH6A 3TWHA 3K5MA 1KVAA 4ZHRA 4CJUA 1DT9A 2FBVA 5AQWA 4KH5A 2QW9A 3VQ5A 4A5AA 3THWA 4FOIA 3ZLJA 2NUBA 3IG1A 3SUQA 3CHWA 3VEWA 3ZSYA 4YHHK 4FLVA 5ELZA 1L3UA 5HRRA 3KD5E 4RWTA 3U9DA 4Z0UA 1K9MO 1JLAA 3FZLA 5CZ1A 1ASUA 3D6RA 3CETA 4CJPA 3TU5A 2WTUA 2YHWA 1NJZA 3L3VA 2VGMA 4NYNA 2WOMA 3AA4A 4JD2B 5EX5A 4B8AB 4CBXA 5LY3A 1FKPA 1BGXT 3IFRA 3SQ1A 4R5PA 2G8UA 3AA3A 1GLDG 2CGJA 2V52B 1S1VA 1TK5A 4IJAA 2G8HA 4K41A 1LAVA 1N36K 3FGUA 4B1XB 2KFNA 1YJ9N 3OYJA 1TK8A 2OTJN 2UYTA 3LP1A 5MLCQ 4IOCL 3HPGA 1R0AA 4LF4K 1RDCA 1TUYA 4X65K 4BR2A 2QWPA 4YDUC 1Q81O 4BR7A 1T6CA 5F2RA 3P39A 3CCUN 4DSKA 2QK9A 3NDKA 4JYAK 1LW2A 1BIUA 1D4XA 4JI1K 4Y1DA 4DWIA 1HNZK 4N76A 1UA0A 3LDPA 4H0PA 4KPYA 3F5TA 3O80A 1JLEA 4IDHA 4H8KA 3ZSZA 2FSKA 3J7ZO 4E3SA 4CFBA 4BVOA 2ZJQL 3NF6A 3TPQA 4CFAA 1TYQA 3KLIA 3CF5L 3L3UA 1N34K 3AVKA 3K9JA 3MN5A 2NRXA 4E89A 3SQ2A 1MWKA 5JS2A 2RE2A 4K43A 3LAMA 1RCHA 1ZBUA 1SS6A 4M45A 4E7KA 1ZBFA 3K5LA 4BACA 4K0KK 3WXLA 1Q82O 5HRNA 1WBBA 2ZQBA 3QFPA 4GKJK 2E6MA 3FZKA 1Z26A 3AVLA 4FWPA 5CY4A 3QERA 4CK2A 3BEXA 4F9OA 3ATVA 1LW0A 4DTMA 3AVAA 4HUFA 3TAMA 4FJJA 3ZSVA 2D0OA 1KTQA 3QNNA 3CERA 4CEAA 3I0SA 4M3XA 4JV5K 3GOIA 3ATUA 2B4JA
chains in the Genus database with same CATH topology
2QXFA 3VA3A 3SI6A 1L5UA 4Y1CA 3TR8A 4DTNA 3S3NA 3CQ8A 2FBTA 2Z1JA 4DQPA 1WSIA 4O55A 1DTQA 4I9LA 2W42A 4M3WA 5KI6A 3MXIA 3NCIA 3V9UA 4AHCA 2VWJA 1YVUA 1FK9A 1CZ9A 4UQGA 4ELTA 2HHSA 3OYHA 1VK0A 5I3UA 1ITGA 5CZ2A 2KFZA 3LP2A 4RW6A 1C0UA 4DSJA 4PQUA 4K8XA 2YV0X 3D45A 4FLZA 3HP9A 1KVCA 3S3MA 3EY1A 4PWDA 1S6PA 4FJNA 3T19A 1IKXA 4DLEA 4ELVA 2HNYA 3KIOA 2G8VA 2Z1GA 1GOAA 4FLUA 3C6UA 5SZTA 5J2MA 2Y1IA 2PZSA 3K5NA 2OPQA 3U6FA 3SCXA 3NH2A 4OGCA 2HNZA 4I2QA 4CFCA 3V1QA 1J9AA 3RMBA 5K14A 4CGFA 3TAQA 4PY5A 3WNHA 3ZT3A 3KKSA 1BI4B 3F9KA 2YNGA 4CJLA 5KTQA 4DTJA 2HHWA 3KD1E 4CIFA 3SPYA 1U47A 3QEWA 1Z25A 3C94A 1S5JA 3ZT0A 3NE6A 4BE1A 4FJGA 4EP4A 1LV5A 1CXQA 1RNHA 4LSLA 1VSDA 5D3GA 2YNIA 4XIUA 1EETA 4DSEA 3LDSA 3QEIA 4B9MA 3C95A 4GW6A 2X6SA 3O4NA 4HUGA 5J2PA 1C1AA 3NAEA 4HCBA 1NJYA 3HP6A 1T03A 2PYJA 4Z4IA 3KK1A 5HBMA 1YTAA 1S1XA 4BWJA 1A5VA 4CHOA 4KREA 1C0MA 1WAJA 4DSFA 4CF9A 4DU4A 4OKJA 3WNGA 4CE9A 4CJVA 3HM9A 4KB1A 4FJIA 4O0IA 4JRPA 3MEEA 3PY8A 5KGXA 4FK4A 3QIOA 4F3OA 2HMIA 3VQ7A 4M3UA 4KHUA 1KCFA 4OKEA 3RMDA 4HCCA 2D0CA 2QKBA 2D0BA 2DFHA 3S3OA 1G15A 2EX3A 3AVHA 1A5WA 1VSHA 3NFAA 3OYDA 2KTQA 1TKXA 3U3YA 3KJVA 1VSMA 4O4GA 4FZXC 1EKEA 1EX4A 4F4KA 1X9SA 3F73A 3AA2A 3QINA 4GVMA 4KV8A 4ZTJA 4KHWA 1S6QA 2DFFA 3DM2A 3QLHA 2OZSA 3OY9A 1GOBA 4CJSA 1CXUA 3TAEA 4OKKA 1DLOA 4KAZA 1KFSA 1VSJA 4FJLA 3NGIA 4KRFA 1U49A 3VQQA 4I2PA 4H4OA 1I39A 3OVNA 4KTWA 2P51A 4BWMA 2ZD1A 4HUEA 4FLYA 4HVJA 1IKWA 4CK1A 1RDDA 3O3GA 3JYTA 3M8QA 3HO1A 4FJHA 4Z4FA 1MU2A 1TKZA 3OYNA 2OA8A 2VG5A 3A2FA 5J2QA 2OPPA 2XHBA 2E4LA 3QEXA 3SUNA 4CJQA 4QOZB 1HYVA 4JRQA 3AO1A 4DSLA 3LZIA 1NK5A 1QTMA 3QESA 4FLWA 1DTTA 1S1TA 4IG3A 2LSNA 1RBVA 1IKYA 1BIZA 4CJ4A 4DF4A 4DTPA 1S1UA 1KRPA 3NBPA 3RTVA 4CF8A 4FM1A 4IBNA 4RG8A 2Y1JA 1IKVA 2HHVA 3CM5A 1TKDA 4QAGA 4MFBA 1ZBHA 1X1PA 3IS9A 4F8RA 2HHXA 4E1NA 5C24A 3PV8A 4MQ3A 1VSFA 1RT4A 3AVFA 4IKFA 2EHGA 1S9GA 3TABA 2F8TA 1W9HA 3AO4A 4DSIA 3OYAA 3E01A 4OVLA 3VQ6A 4DG1A 3NH0A 2HHTA 3ZT4A 4E19A 2WONA 4BDYA 4FK0A 2FBXA 2YKMA 1O1WA 5CYQA 1IH7A 4LH4A 4DFPA 4OPKA 3PX0A 3DLGA 1WSJA 5FDLA 3ZCMA 4E1MA 3OYKA 3V81A 5HLFA 1T05A 1RILA 1U45A 2RF2A 1D9FA 1BL3A 4FJ9A 4CJWA 1XC9A 4CJ5A 1WSEA 3ZSQA 5KGWA 4DTUA 3SUPA 5DMRA 4FXDA 3ASMA 1NOYA 1BCOA 3WNEA 4H4MA 3NGYA 1ZBIA 5HROA 2BE2A 4KHQA 3OJSA 4I9QA 4PUOA 3KLEA 1NJXA 5KRSA 4FJ8A 4JS5A 3AVBA 3KKRA 4BDPA 1BI4A 4CIEA 4DQQA 3ZSXA 3OYIA 4CGDA 3CFOA 4CJRA 4ELUA 1HQUA 1RBTA 3H08A 4AHRA 2YKNA 2YNHA 5SWMA 4B9UA 4EZ6A 3BDPA 3MEDA 1C0TA 3RR8A 3SQ4A 4KTQA 1RT5A 1REVA 4CHPA 3JSMA 2P5OA 3TARA 4W5QA 3V1RA 3VA0A 2KW4A 1WNSA 3ITHA 1NK7A 3ALYA 2JGUA 4OGEA 2X6NA 2XO7A 3SYZA 4F2SA 2IDOA 1HMVA 2RN2A 4CEQA 4FCYA 1NK0A 1YTUA 1HNVA 1NJWA 1N5YA 4BE2A 3RWUA 3NF9A 3L2QA 1SUQA 1U04A 1XHXA 4CJTA 4ICLA 4LY7A 4W5OA 2YHAA 3DOKA 3QEVA 4J2DA 1QQCA 4M3TA 3AO3A 4CEDA 3KLHA 1J5OA 2HHUA 4FM2A 3VQ9A 1C6VA 3AO5A 4Z4EA 3B6PA 4KKOA 3TAGA 4M41A 4CHZA 2G8IA 1CLQA 4DTOA 3QNOA 4FJ7A 4DTSA 1EP4A 4B08A 4FLTA 3KLGA 1BQMA 4B3OA 4LD0A 3AO2A 3L8BA 4E0DA 5JS1A 2ITGA 2ZE2A 2DY4A 3V9WA 3LANA 3NH1A 1C1CA 1JLGA 3MXJA 4AHUA 1UWBA 4OLAA 3DRPA 2P1JA 4ID5A 1N6QA 1RBRA 3SV4A 1ASWA 4N56A 1TK0A 4LSNA 4DTXA 3PX6A 3SPZA 4F2RA 1VSEA 3CM6A 2DFEA 3C6TA 4CJKA 5EU7A 5E41A 4W5RA 1JLCA 3KLFA 3THVA 4CEBA 1WSFA 4DS4A 4CEEA 4EP5A 3DYAA 5HP1A 3MAQA 4FW2A 3HJFA 4CECA 4RW7A 4IFVA 3DRSA 4CGGA 4Q5VA 4ZTFA 4B9TA 4DFMA 4CERA 4CIGA 4CFDA 3M8SA 2XY6A 2A1RA 4CF0A 3I0RA 1TV6A 3V9XA 1WAFA 2IS3A 1NK6A 4E7IA 3IAYA 2RPIA 1LWFA 2YHBA 3I8DA 5I42A 4LH5A 5FRNA 2G8WA 3SJJA 2BGGA 1VSIA 4CHNA 4CCHA 2VWKA 3P83D 3K57A 4CESA 1NK4A 3HVTA 4JS4A 3NF8A 4B9SA 1NKCA 3B6OA 1JXEA 2F8SA 3O3FA 4B8CA 4DU3A 3PO5A 4K8ZA 1QE1A 4HHTA 3ULDA 2HHQA 1D5AA 4YFUA 1LWCA 1QSYA 3HSTB 3AV9A 2KZZA 3VQAA 4DTRA 2OYQA 1XHZA 1L3SA 4FM0A 4CF1A 3VQDA 4CJEA 1WSGA 3VQPA 3G10A 1U48A 3LPTA 3V1OA 3NHGA 3ZT2A 3OYLA 4FLXA 3K59A 4KFBA 4BDZA 1D8YA 2A1SA 2I5JA 3QETA 3M8PA 3KK2A 1B92A 2ATQA 3OYBA 2HVIA 5FROA 1HRHA 1RBUA 3AA5X 3AVMA 1RTIA 3NF7A 4FYDA 1TL3A 3TAPA 4DQRA 4OLBA 4FVMA 1RT3A 1HQEA 1UAXA 3ZSRA 3OYEA 4Z4HA 1BHLA 5FRMA 3SNNA 4E7LA 1RTDA 4O0JA 3MXMA 2DTUA 3RMAA 1JLFA 1QSSA 3P5JA 4RW4A 3L2WA 4DLGA 1D9DA 1S1WA 4DMNA 4F3TA 4DFJA 4N47A 1JKHA 4M3ZA 1W0HA 3VQBA 4CHQA 3EYZA 1IO2A 3OS0A 3FFIA 4M42A 1Y97A 4B9LA 2KZMA 2VG7A 1SKRA 4C8LA 4NCBA 2ETJA 4O5BA 1UA1A 1Q8IA 2YNFA 3D0PA 4C8KA 4PA1A 3CYMA 3OS1A 4QCLA 4KO0A 4M3RA 1ASVA 1U4BA 3DLRA 3TI0A 2XY5A 3PO4A 3K2PA 2FBYA 3TWHA 3DLHA 3HYFA 4DQIA 4KTZA 3K5MA 3L2RA 4EZ9A 1KVAA 3IRXA 4IDKA 4CJUA 4ZHRA 4L8RB 2FBVA 1X9MA 3AVGA 1NK8A 1FXXA 2B5JA 4N41A 4WE1A 3VQ5A 4JLHA 2R7YA 4AHTA 1VRTA 3PX4A 4ID1A 2NUBA 4DQSA 1T7PA 2P5GA 3OJUA 3IG1A 3RRHA 3SUQA 3RR7A 4FJKA 5HRSA 4B9VA 4YNQA 4DF8A 1RT1A 4KI6A 3ZSYA 1RTHA 1A5XA 1RT2A 1VSLA 4CJFA 4FLVA 1XI1A 1L3UA 4Q0BA 3O4QA 5HRRA 1WN7A 3KD5E 3SV3A 4CEOA 4Z0UA 1JLAA 3O3HA 2XY7A 3QEPA 3RRGA 1SV5A 1RDBA 5CZ1A 1ASUA 4FW1A 4CGJA 4CJPA 2RKIA 4C8NA 4KHYA 1VSKA 1BCMA 4FJXA 5J2NA 3SQ0A 1NJZA 1KLNA 3L3VA 1KVBA 1B9DA 4N5SA 2X78A 4Z4GA 1GOCA 4NYNA 2QKKA 1NK9A 2WOMA 3AA4A 4GMJB 4B8AB 3V4IA 1HYSA 2Z1HA 4IFYA 2KQ2A 4CF2A 2OZMA 1FKPA 1BGXT 2HB5A 3ZSWA 3HPHA 5C25A 1HPZA 4IG0A 3SQ1A 4CGIA 2D0AA 4R5PA 4NCAA 3HT3A 2G8UA 3AA3A 2HW3A 3QIPA 4NYFA 2GBZA 4DFKA 4M3YA 4AILC 1ZYQA 1S1VA 1JL1A 1TK5A 4CEZA 4J2EA 2G8HA 3LWLA 1LAVA 3DRRA 3V9ZA 4KB0A 3TAFA 1QS4A 3VQEA 1Q9YA 4DU1A 3V6DA 3NGZA 1YT3A 2KFNA 3T1AA 3OYJA 1JL2A 1HNIA 3G0ZA 1TK8A 2PY5A 3CFPA 3LP1A 3HPGA 2OPRA 1KLMA 1RDCA 1R0AA 1L3VA 1X9WA 2Q3SA 3VQCA 3K5OA 1I3AA 1RT7A 3WNFA 1VRUA 2X74A 3DOLA 5T7BA 4FJMA 3L2VA 4KHNA 1TL1A 4TSXA 3AVJA 1L3TA 3KTQA 1SKSA 2HNDA 3HVRA 4DSKA 2XY8A 3NDKA 1IG9A 2QK9A 1TKTA 1LW2A 3HL8A 3LALA 1NKBA 2GV9A 3K58A 2OPSA 4OJRA 3SZ2A 3SUOA 3OYGA 1BIUA 1KSPA 2PYLA 4CJ3A 4E7HA 5C42A 1TAQA 4FK2A 1BQNA 4C8MA 2BANA 3M8RA 3V9SA 4Y1DA 1T8EA 4B9NA 1B9FA 4DS5A 3P1GA 4DWIA 4N76A 2AJQA 1UA0A 4W5TA 1BISA 1RTJA 3VN5A 3LZJA 3AVIA 4KPYA 3LPUA 4J2BA 4RW9A 2IGIA 1JLEA 1LAWA 4H8KA 3OS2A 3VQ4A 3KK3A 3ZSZA 3MECA 4E3SA 1RT6A 4CFBA 3DI6A 3NF6A 3DMJA 4CFAA 3KLIA 2BDPA 3QO9A 4CHYA 3L3UA 1J53A 4AHSA 2FC0A 4FZYA 3ISNC 1HJRA 4KHSA 1WSHA 3L2UA 2JLEA 3TANA 1WLJA 1FKOA 3AVKA 4G1QA 1ZBLA 1NOZA 1KFDA 1EXQA 4CK3A 4E89A 2G8FA 3SQ2A 5JS2A 4E7JA 2IOCA 2VG6A 3LAMA 1RCHA 1ZBUA 5DK5A 3U3GA 4M45A 4AH9A 3AVNA 4CGHA 1ZBFA 4OPJA 4BE0A 4E7KA 1SKWA 2O4IA 3K5LA 4I7FA 3OYCA 3PUFA 2F96A 1S9EA 4KI4A 1TAUA 2IAJA 1K6YA 4BACA 4C8OA 4Z4CA 2G8KA 1J54A 1F21A 5KRTA 3DLBA 5HRNA 4O44A 5J1EA 2HVHA 1LWEA 3BGRA 4W5NA 3T3FA 1SL0A 2ZQBA 4FJ5A 2IC3A 4RW8A 2E6MA 2O4GA 3OYMA 3HXMA 3LP0A 1Z26A 1JLBA 1SL2A 3AVLA 5CY4A 4AHVA 1SL1A 3HK2A 3QERA 2XRIA 2D5RA 1JLQA 4CK2A 1XWLA 3LAKA 1RDAA 5HRPA 3CG7A 1QHTA 1TGOA 3ZT1A 3ZSOA 3VQ8A 2B6AA 1LW0A 5CYMA 4DTMA 1CZBA 3RMCA 1Q9XA 4FZZA 2GUIA 3LP3A 3AVAA 3MEGA 4HTUA 3HPOA 4J2AA 1UOCA 1JXBA 4HUFA 3TAMA 4FJJA 3LWMA 3ZSVA 1C1BA 3CFRA 1KTQA 3EZ5A 1TVRA 3AVCA 4CEFA 3S9HA 1QSLA 3OYFA 3QNNA 1RBSA 4NCGA 3DLEA 4CEAA 1HYZA 3I0SA 3UIQA 4M3XA 2Z1IA 1NKEA 2E6LA 3DLKA 2B4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QXF A;  3VA3 A;  3SI6 A;  1L5U A;  4Y1C A;  3TR8 A;  4DTN A;  3S3N A;  3CQ8 A;  2FBT A;  2Z1J A;  4DQP A;  1WSI A;  4O55 A;  1DTQ A;  4I9L A;  2W42 A;  4M3W A;  5KI6 A;  3MXI A;  3NCI A;  3V9U A;  4AHC A;  2VWJ A;  1YVU A;  1FK9 A;  1CZ9 A;  4UQG A;  4ELT A;  2HHS A;  3OYH A;  1VK0 A;  5I3U A;  1ITG A;  5CZ2 A;  2KFZ A;  3LP2 A;  4RW6 A;  1C0U A;  4DSJ A;  4PQU A;  4K8X A;  2YV0 X;  3D45 A;  4FLZ A;  3HP9 A;  1KVC A;  3S3M A;  3EY1 A;  4PWD A;  1S6P A;  4FJN A;  3T19 A;  1IKX A;  4DLE A;  4ELV A;  2HNY A;  3KIO A;  2G8V A;  2Z1G A;  1GOA A;  4FLU A;  3C6U A;  5SZT A;  5J2M A;  2Y1I A;  2PZS A;  3K5N A;  2OPQ A;  3U6F A;  3SCX A;  3NH2 A;  4OGC A;  2HNZ A;  4I2Q A;  4CFC A;  3V1Q A;  1J9A A;  3RMB A;  5K14 A;  4CGF A;  3TAQ A;  4PY5 A;  3WNH A;  3ZT3 A;  3KKS A;  1BI4 B;  3F9K A;  2YNG A;  4CJL A;  5KTQ A;  4DTJ A;  2HHW A;  3KD1 E;  4CIF A;  3SPY A;  1U47 A;  3QEW A;  1Z25 A;  3C94 A;  1S5J A;  3ZT0 A;  3NE6 A;  4BE1 A;  4FJG A;  4EP4 A;  1LV5 A;  1CXQ A;  1RNH A;  4LSL A;  1VSD A;  5D3G A;  2YNI A;  4XIU A;  1EET A;  4DSE A;  3LDS A;  3QEI A;  4B9M A;  3C95 A;  4GW6 A;  2X6S A;  3O4N A;  4HUG A;  5J2P A;  1C1A A;  3NAE A;  4HCB A;  1NJY A;  3HP6 A;  1T03 A;  2PYJ A;  4Z4I A;  3KK1 A;  5HBM A;  1YTA A;  1S1X A;  4BWJ A;  1A5V A;  4CHO A;  4KRE A;  1C0M A;  1WAJ A;  4DSF A;  4CF9 A;  4DU4 A;  4OKJ A;  3WNG A;  4CE9 A;  4CJV A;  3HM9 A;  4KB1 A;  4FJI A;  4O0I A;  4JRP A;  3MEE A;  3PY8 A;  5KGX A;  4FK4 A;  3QIO A;  4F3O A;  2HMI A;  3VQ7 A;  4M3U A;  4KHU A;  1KCF A;  4OKE A;  3RMD A;  4HCC A;  2D0C A;  2QKB A;  2D0B A;  2DFH A;  3S3O A;  1G15 A;  2EX3 A;  3AVH A;  1A5W A;  1VSH A;  3NFA A;  3OYD A;  2KTQ A;  1TKX A;  3U3Y A;  3KJV A;  1VSM A;  4O4G A;  4FZX C;  1EKE A;  1EX4 A;  4F4K A;  1X9S A;  3F73 A;  3AA2 A;  3QIN A;  4GVM A;  4KV8 A;  4ZTJ A;  4KHW A;  1S6Q A;  2DFF A;  3DM2 A;  3QLH A;  2OZS A;  3OY9 A;  1GOB A;  4CJS A;  1CXU A;  3TAE A;  4OKK A;  1DLO A;  4KAZ A;  1KFS A;  1VSJ A;  4FJL A;  3NGI A;  4KRF A;  1U49 A;  3VQQ A;  4I2P A;  4H4O A;  1I39 A;  3OVN A;  4KTW A;  2P51 A;  4BWM A;  2ZD1 A;  4HUE A;  4FLY A;  4HVJ A;  1IKW A;  4CK1 A;  1RDD A;  3O3G A;  3JYT A;  3M8Q A;  3HO1 A;  4FJH A;  4Z4F A;  1MU2 A;  1TKZ A;  3OYN A;  2OA8 A;  2VG5 A;  3A2F A;  5J2Q A;  2OPP A;  2XHB A;  2E4L A;  3QEX A;  3SUN A;  4CJQ A;  4QOZ B;  1HYV A;  4JRQ A;  3AO1 A;  4DSL A;  3LZI A;  1NK5 A;  1QTM A;  3QES A;  4FLW A;  1DTT A;  1S1T A;  4IG3 A;  2LSN A;  1RBV A;  1IKY A;  1BIZ A;  4CJ4 A;  4DF4 A;  4DTP A;  1S1U A;  1KRP A;  3NBP A;  3RTV A;  4CF8 A;  4FM1 A;  4IBN A;  4RG8 A;  2Y1J A;  1IKV A;  2HHV A;  3CM5 A;  1TKD A;  4QAG A;  4MFB A;  1ZBH A;  1X1P A;  3IS9 A;  4F8R A;  2HHX A;  4E1N A;  5C24 A;  3PV8 A;  4MQ3 A;  1VSF A;  1RT4 A;  3AVF A;  4IKF A;  2EHG A;  1S9G A;  3TAB A;  2F8T A;  1W9H A;  3AO4 A;  4DSI A;  3OYA A;  3E01 A;  4OVL A;  3VQ6 A;  4DG1 A;  3NH0 A;  2HHT A;  3ZT4 A;  4E19 A;  2WON A;  4BDY A;  4FK0 A;  2FBX A;  2YKM A;  1O1W A;  5CYQ A;  1IH7 A;  4LH4 A;  4DFP A;  4OPK A;  3PX0 A;  3DLG A;  1WSJ A;  5FDL A;  3ZCM A;  4E1M A;  3OYK A;  3V81 A;  5HLF A;  1T05 A;  1RIL A;  1U45 A;  2RF2 A;  1D9F A;  1BL3 A;  4FJ9 A;  4CJW A;  1XC9 A;  4CJ5 A;  1WSE A;  3ZSQ A;  5KGW A;  4DTU A;  3SUP A;  5DMR A;  4FXD A;  3ASM A;  1NOY A;  1BCO A;  3WNE A;  4H4M A;  3NGY A;  1ZBI A;  5HRO A;  2BE2 A;  4KHQ A;  3OJS A;  4I9Q A;  4PUO A;  3KLE A;  1NJX A;  5KRS A;  4FJ8 A;  4JS5 A;  3AVB A;  3KKR A;  4BDP A;  1BI4 A;  4CIE A;  4DQQ A;  3ZSX A;  3OYI A;  4CGD A;  3CFO A;  4CJR A;  4ELU A;  1HQU A;  1RBT A;  3H08 A;  4AHR A;  2YKN A;  2YNH A;  5SWM A;  4B9U A;  4EZ6 A;  3BDP A;  3MED A;  1C0T A;  3RR8 A;  3SQ4 A;  4KTQ A;  1RT5 A;  1REV A;  4CHP A;  3JSM A;  2P5O A;  3TAR A;  4W5Q A;  3V1R A;  3VA0 A;  2KW4 A;  1WNS A;  3ITH A;  1NK7 A;  3ALY A;  2JGU A;  4OGE A;  2X6N A;  2XO7 A;  3SYZ A;  4F2S A;  2IDO A;  1HMV A;  2RN2 A;  4CEQ A;  4FCY A;  1NK0 A;  1YTU A;  1HNV A;  1NJW A;  1N5Y A;  4BE2 A;  3RWU A;  3NF9 A;  3L2Q A;  1SUQ A;  1U04 A;  1XHX A;  4CJT A;  4ICL A;  4LY7 A;  4W5O A;  2YHA A;  3DOK A;  3QEV A;  4J2D A;  1QQC A;  4M3T A;  3AO3 A;  4CED A;  3KLH A;  1J5O A;  2HHU A;  4FM2 A;  3VQ9 A;  1C6V A;  3AO5 A;  4Z4E A;  3B6P A;  4KKO A;  3TAG A;  4M41 A;  4CHZ A;  2G8I A;  1CLQ A;  4DTO A;  3QNO A;  4FJ7 A;  4DTS A;  1EP4 A;  4B08 A;  4FLT A;  3KLG A;  1BQM A;  4B3O A;  4LD0 A;  3AO2 A;  3L8B A;  4E0D A;  5JS1 A;  2ITG A;  2ZE2 A;  2DY4 A;  3V9W A;  3LAN A;  3NH1 A;  1C1C A;  1JLG A;  3MXJ A;  4AHU A;  1UWB A;  4OLA A;  3DRP A;  2P1J A;  4ID5 A;  1N6Q A;  1RBR A;  3SV4 A;  1ASW A;  4N56 A;  1TK0 A;  4LSN A;  4DTX A;  3PX6 A;  3SPZ A;  4F2R A;  1VSE A;  3CM6 A;  2DFE A;  3C6T A;  4CJK A;  5EU7 A;  5E41 A;  4W5R A;  1JLC A;  3KLF A;  3THV A;  4CEB A;  1WSF A;  4DS4 A;  4CEE A;  4EP5 A;  3DYA A;  5HP1 A;  3MAQ A;  4FW2 A;  3HJF A;  4CEC A;  4RW7 A;  4IFV A;  3DRS A;  4CGG A;  4Q5V A;  4ZTF A;  4B9T A;  4DFM A;  4CER A;  4CIG A;  4CFD A;  3M8S A;  2XY6 A;  2A1R A;  4CF0 A;  3I0R A;  1TV6 A;  3V9X A;  1WAF A;  2IS3 A;  1NK6 A;  4E7I A;  3IAY A;  2RPI A;  1LWF A;  2YHB A;  3I8D A;  5I42 A;  4LH5 A;  5FRN A;  2G8W A;  3SJJ A;  2BGG A;  1VSI A;  4CHN A;  4CCH A;  2VWK A;  3P83 D;  3K57 A;  4CES A;  1NK4 A;  3HVT A;  4JS4 A;  3NF8 A;  4B9S A;  1NKC A;  3B6O A;  1JXE A;  2F8S A;  3O3F A;  4B8C A;  4DU3 A;  3PO5 A;  4K8Z A;  1QE1 A;  4HHT A;  3ULD A;  2HHQ A;  1D5A A;  4YFU A;  1LWC A;  1QSY A;  3HST B;  3AV9 A;  2KZZ A;  3VQA A;  4DTR A;  2OYQ A;  1XHZ A;  1L3S A;  4FM0 A;  4CF1 A;  3VQD A;  4CJE A;  1WSG A;  3VQP A;  3G10 A;  1U48 A;  3LPT A;  3V1O A;  3NHG A;  3ZT2 A;  3OYL A;  4FLX A;  3K59 A;  4KFB A;  4BDZ A;  1D8Y A;  2A1S A;  2I5J A;  3QET A;  3M8P A;  3KK2 A;  1B92 A;  2ATQ A;  3OYB A;  2HVI A;  5FRO A;  1HRH A;  1RBU A;  3AA5 X;  3AVM A;  1RTI A;  3NF7 A;  4FYD A;  1TL3 A;  3TAP A;  4DQR A;  4OLB A;  4FVM A;  1RT3 A;  1HQE A;  1UAX A;  3ZSR A;  3OYE A;  4Z4H A;  1BHL A;  5FRM A;  3SNN A;  4E7L A;  1RTD A;  4O0J A;  3MXM A;  2DTU A;  3RMA A;  1JLF A;  1QSS A;  3P5J A;  4RW4 A;  3L2W A;  4DLG A;  1D9D A;  1S1W A;  4DMN A;  4F3T A;  4DFJ A;  4N47 A;  1JKH A;  4M3Z A;  1W0H A;  3VQB A;  4CHQ A;  3EYZ A;  1IO2 A;  3OS0 A;  3FFI A;  4M42 A;  1Y97 A;  4B9L A;  2KZM A;  2VG7 A;  1SKR A;  4C8L A;  4NCB A;  2ETJ A;  4O5B A;  1UA1 A;  1Q8I A;  2YNF A;  3D0P A;  4C8K A;  4PA1 A;  3CYM A;  3OS1 A;  4QCL A;  4KO0 A;  4M3R A;  1ASV A;  1U4B A;  3DLR A;  3TI0 A;  2XY5 A;  3PO4 A;  3K2P A;  2FBY A;  3TWH A;  3DLH A;  3HYF A;  4DQI A;  4KTZ A;  3K5M A;  3L2R A;  4EZ9 A;  1KVA A;  3IRX A;  4IDK A;  4CJU A;  4ZHR A;  4L8R B;  2FBV A;  1X9M A;  3AVG A;  1NK8 A;  1FXX A;  2B5J A;  4N41 A;  4WE1 A;  3VQ5 A;  4JLH A;  2R7Y A;  4AHT A;  1VRT A;  3PX4 A;  4ID1 A;  2NUB A;  4DQS A;  1T7P A;  2P5G A;  3OJU A;  3IG1 A;  3RRH A;  3SUQ A;  3RR7 A;  4FJK A;  5HRS A;  4B9V A;  4YNQ A;  4DF8 A;  1RT1 A;  4KI6 A;  3ZSY A;  1RTH A;  1A5X A;  1RT2 A;  1VSL A;  4CJF A;  4FLV A;  1XI1 A;  1L3U A;  4Q0B A;  3O4Q A;  5HRR A;  1WN7 A;  3KD5 E;  3SV3 A;  4CEO A;  4Z0U A;  1JLA A;  3O3H A;  2XY7 A;  3QEP A;  3RRG A;  1SV5 A;  1RDB A;  5CZ1 A;  1ASU A;  4FW1 A;  4CGJ A;  4CJP A;  2RKI A;  4C8N A;  4KHY A;  1VSK A;  1BCM A;  4FJX A;  5J2N A;  3SQ0 A;  1NJZ A;  1KLN A;  3L3V A;  1KVB A;  1B9D A;  4N5S A;  2X78 A;  4Z4G A;  1GOC A;  4NYN A;  2QKK A;  1NK9 A;  2WOM A;  3AA4 A;  4GMJ B;  4B8A B;  3V4I A;  1HYS A;  2Z1H A;  4IFY A;  2KQ2 A;  4CF2 A;  2OZM A;  1FKP A;  1BGX T;  2HB5 A;  3ZSW A;  3HPH A;  5C25 A;  1HPZ A;  4IG0 A;  3SQ1 A;  4CGI A;  2D0A A;  4R5P A;  4NCA A;  3HT3 A;  2G8U A;  3AA3 A;  2HW3 A;  3QIP A;  4NYF A;  2GBZ A;  4DFK A;  4M3Y A;  4AIL C;  1ZYQ A;  1S1V A;  1JL1 A;  1TK5 A;  4CEZ A;  4J2E A;  2G8H A;  3LWL A;  1LAV A;  3DRR A;  3V9Z A;  4KB0 A;  3TAF A;  1QS4 A;  3VQE A;  1Q9Y A;  4DU1 A;  3V6D A;  3NGZ A;  1YT3 A;  2KFN A;  3T1A A;  3OYJ A;  1JL2 A;  1HNI A;  3G0Z A;  1TK8 A;  2PY5 A;  3CFP A;  3LP1 A;  3HPG A;  2OPR A;  1KLM A;  1RDC A;  1R0A A;  1L3V A;  1X9W A;  2Q3S A;  3VQC A;  3K5O A;  1I3A A;  1RT7 A;  3WNF A;  1VRU A;  2X74 A;  3DOL A;  5T7B A;  4FJM A;  3L2V A;  4KHN A;  1TL1 A;  4TSX A;  3AVJ A;  1L3T A;  3KTQ A;  1SKS A;  2HND A;  3HVR A;  4DSK A;  2XY8 A;  3NDK A;  1IG9 A;  2QK9 A;  1TKT A;  1LW2 A;  3HL8 A;  3LAL A;  1NKB A;  2GV9 A;  3K58 A;  2OPS A;  4OJR A;  3SZ2 A;  3SUO A;  3OYG A;  1BIU A;  1KSP A;  2PYL A;  4CJ3 A;  4E7H A;  5C42 A;  1TAQ A;  4FK2 A;  1BQN A;  4C8M A;  2BAN A;  3M8R A;  3V9S A;  4Y1D A;  1T8E A;  4B9N A;  1B9F A;  4DS5 A;  3P1G A;  4DWI A;  4N76 A;  2AJQ A;  1UA0 A;  4W5T A;  1BIS A;  1RTJ A;  3VN5 A;  3LZJ A;  3AVI A;  4KPY A;  3LPU A;  4J2B A;  4RW9 A;  2IGI A;  1JLE A;  1LAW A;  4H8K A;  3OS2 A;  3VQ4 A;  3KK3 A;  3ZSZ A;  3MEC A;  4E3S A;  1RT6 A;  4CFB A;  3DI6 A;  3NF6 A;  3DMJ A;  4CFA A;  3KLI A;  2BDP A;  3QO9 A;  4CHY A;  3L3U A;  1J53 A;  4AHS A;  2FC0 A;  4FZY A;  3ISN C;  1HJR A;  4KHS A;  1WSH A;  3L2U A;  2JLE A;  3TAN A;  1WLJ A;  1FKO A;  3AVK A;  4G1Q A;  1ZBL A;  1NOZ A;  1KFD A;  1EXQ A;  4CK3 A;  4E89 A;  2G8F A;  3SQ2 A;  5JS2 A;  4E7J A;  2IOC A;  2VG6 A;  3LAM A;  1RCH A;  1ZBU A;  5DK5 A;  3U3G A;  4M45 A;  4AH9 A;  3AVN A;  4CGH A;  1ZBF A;  4OPJ A;  4BE0 A;  4E7K A;  1SKW A;  2O4I A;  3K5L A;  4I7F A;  3OYC A;  3PUF A;  2F96 A;  1S9E A;  4KI4 A;  1TAU A;  2IAJ A;  1K6Y A;  4BAC A;  4C8O A;  4Z4C A;  2G8K A;  1J54 A;  1F21 A;  5KRT A;  3DLB A;  5HRN A;  4O44 A;  5J1E A;  2HVH A;  1LWE A;  3BGR A;  4W5N A;  3T3F A;  1SL0 A;  2ZQB A;  4FJ5 A;  2IC3 A;  4RW8 A;  2E6M A;  2O4G A;  3OYM A;  3HXM A;  3LP0 A;  1Z26 A;  1JLB A;  1SL2 A;  3AVL A;  5CY4 A;  4AHV A;  1SL1 A;  3HK2 A;  3QER A;  2XRI A;  2D5R A;  1JLQ A;  4CK2 A;  1XWL A;  3LAK A;  1RDA A;  5HRP A;  3CG7 A;  1QHT A;  1TGO A;  3ZT1 A;  3ZSO A;  3VQ8 A;  2B6A A;  1LW0 A;  5CYM A;  4DTM A;  1CZB A;  3RMC A;  1Q9X A;  4FZZ A;  2GUI A;  3LP3 A;  3AVA A;  3MEG A;  4HTU A;  3HPO A;  4J2A A;  1UOC A;  1JXB A;  4HUF A;  3TAM A;  4FJJ A;  3LWM A;  3ZSV A;  1C1B A;  3CFR A;  1KTQ A;  3EZ5 A;  1TVR A;  3AVC A;  4CEF A;  3S9H A;  1QSL A;  3OYF A;  3QNN A;  1RBS A;  4NCG A;  3DLE A;  4CEA A;  1HYZ A;  3I0S A;  3UIQ A;  4M3X A;  2Z1I A;  1NKE A;  2E6L A;  3DLK A;  2B4J A; 
#chains in the Genus database with same CATH topology
 2QXF A;  3D7E O;  3CIP A;  3VA3 A;  3SI6 A;  1L5U A;  3CQ8 A;  2HOE A;  1XUP O;  4DQP A;  2O8C B;  3VEX A;  4BC3 A;  2W42 A;  3MXI A;  3V9U A;  4AHC A;  1YVU A;  1FK9 A;  4CBW A;  1V4S A;  1ITG A;  1HR0 K;  5CZ2 A;  2KFZ A;  4RW6 A;  4DSJ A;  2YV0 X;  3VES A;  3HP9 A;  1OKJ A;  3T19 A;  1IKX A;  4FJN A;  2HNY A;  1VQN N;  4PKI A;  4ISF A;  5KPT A;  3K5N A;  3U6F A;  3SCX A;  3NMU A;  5AR0 A;  1N33 K;  5K14 A;  4CGF A;  4CD1 A;  5CHI A;  4I6M B;  2YNG A;  2HHW A;  2UXB K;  3QEW A;  1Z25 A;  2KKZ A;  3C94 A;  5DM6 L;  4FJG A;  2NRT A;  1RNH A;  5BPL A;  1VSD A;  3KZB A;  4XIU A;  5D3G A;  1YHQ N;  3C95 A;  2WUS A;  4DR2 K;  3J7A P;  4BRN A;  1C1A A;  4ISE A;  3KK1 A;  2QWO A;  4BWJ A;  4DU4 A;  4JKB A;  4OKJ A;  3WNG A;  4BGA A;  1J5E K;  3HM9 A;  4FJI A;  4G9Z A;  4C1N K;  2BH1 A;  1MA9 B;  3ZX0 A;  4KHU A;  1S3X A;  3RMD A;  3OBY A;  2D0B A;  3KWG A;  4YDU A;  3S3O A;  2EX3 A;  3LDO A;  1A5W A;  2KTQ A;  3U3Y A;  4IZ9 A;  3P31 A;  2FLO A;  1GLC G;  1NU0 A;  3DM2 A;  4DV5 K;  2UUB K;  3FZM A;  1KFS A;  4KRF A;  3NGI A;  3KVG A;  1U49 A;  4DUZ K;  3D2E B;  3VQQ A;  4KTW A;  5AZI A;  3JYT A;  5GAG P;  4FJH A;  4Z4F A;  3WQT A;  2VG5 A;  3QEX A;  3SUN A;  4AQY K;  4H0O A;  4JRQ A;  3AO1 A;  4DSL A;  1QTM A;  1S1T A;  4IG3 A;  2LSN A;  4IOA L;  1IKY A;  3DAW A;  4CJ4 A;  4BC2 A;  1Z05 A;  3RTV A;  4CF8 A;  3CJ1 A;  1QVG M;  2HHV A;  3CM5 A;  4QS7 A;  1ZBH A;  3FLC O;  1M90 O;  1G99 A;  3IS9 A;  2HHX A;  5C24 A;  3PV8 A;  3RR8 A;  2UU9 K;  3O5B A;  4IKF A;  5E84 A;  2EHG A;  1S9G A;  3TAB A;  2F8T A;  3VET A;  1BDG A;  1W9H A;  3AO4 A;  4LF7 K;  3OYA A;  3VQ6 A;  4BRM A;  3NH0 A;  4UY8 O;  4JKF A;  4FK0 A;  4JI8 K;  2YKM A;  1O1W A;  4ILG B;  3OW2 M;  1IH7 A;  1HX1 A;  4DFP A;  3PX0 A;  3VEZ A;  4BR9 A;  1BL3 A;  4H5T A;  2QWN A;  3ASM A;  3DXM B;  3NGY A;  5HRO A;  5AZJ B;  3VF2 A;  2YJE A;  1JCF A;  3BZK A;  3OJS A;  4H0T B;  1VHX A;  3A5O C;  4BDP A;  1BI4 A;  3GDQ A;  2NRR A;  4R79 A;  4CGD A;  2E5L K;  4IO8 A;  4GV3 A;  4AHR A;  3BF3 A;  4EZ6 A;  4Z4I A;  3H3O B;  4BVP A;  1C0T A;  2IVO A;  3SQ4 A;  1VQ7 N;  4CW7 B;  1REV A;  4GY2 B;  2D4W A;  2P5O A;  3TAR A;  4W5Q A;  4M7Y A;  3VA0 A;  1WNS A;  3U4L A;  2JGU A;  2XO7 A;  5EVZ A;  1MDU B;  1HMV A;  4CEQ A;  4U67 L;  4OX9 K;  1YTU A;  1HNV A;  3RWU A;  1YVN A;  2A40 A;  4CJT A;  2YHA A;  4M3T A;  3O9Q A;  4CED A;  2HHU A;  3AO5 A;  4Z4E A;  3E9O A;  1K73 O;  4YY3 K;  1Q18 A;  2P9I B;  4H5R A;  3AO2 A;  3L8B A;  3V9W A;  4WFB L;  1C1C A;  3IKM A;  1FW6 A;  1UWB A;  4ID5 A;  1N6Q A;  2E2N A;  1RBR A;  4N56 A;  3EL2 A;  2O8D A;  5EU7 A;  1C0G A;  4CEE A;  3T69 A;  2PFU A;  3HJF A;  4BQL A;  4IFV A;  2VWB A;  1HPM A;  4B9T A;  5BPM A;  4CF0 A;  3CCS N;  3V9X A;  1WAF A;  2IS3 A;  5I42 A;  4E1J A;  2G8W A;  4C23 A;  1KAX A;  5AQQ A;  3VTH A;  4O8U A;  4C1N I;  3LDQ A;  3NF8 A;  4B9S A;  1NKC A;  2F8S A;  3O9S A;  4DU3 A;  3BZC A;  1RFQ A;  1D5A A;  4DTR A;  2OYQ A;  4FM0 A;  5IWA K;  2IVN A;  2VCP A;  1WSG A;  2ASP A;  3G10 A;  3L6Q A;  3NHG A;  3MN9 A;  3VOV A;  3BP8 A;  1D8Y A;  2YHY A;  2I5J A;  1B92 A;  4GVE A;  3OYB A;  5FRO A;  1HRH A;  3AA5 X;  1TUU A;  3TSU A;  4CI6 A;  3THY A;  4OLB A;  3OYE A;  2KHO A;  4H5N A;  2DTU A;  2NRH A;  3P5J A;  2VGN A;  4F3T A;  1M1K O;  1JKH A;  2A3Z A;  4YOT A;  1IO2 A;  3OS0 A;  3VEY A;  3HM8 A;  4FWS A;  1I94 K;  5LMN K;  3EEQ A;  5AQF A;  4O5B A;  1Q8I A;  5AQI A;  1KXP A;  1NNE A;  2XY5 A;  3QML A;  3K9K A;  3BUZ B;  1ZC6 A;  3L2R A;  4EZ9 A;  4X66 K;  5JLH A;  4LF8 K;  2E8A A;  4CZF A;  3C6H A;  4JLH A;  1U2V A;  4CZE A;  5M1N A;  4AHT A;  2QWM A;  1NG9 A;  4DQS A;  1T7P A;  2P5G A;  3RRH A;  4FJK A;  1ZBS A;  5HRS A;  4B9V A;  1RT1 A;  2W6L A;  5AQK A;  1BU6 O;  4CJF A;  3SV3 A;  2QM1 A;  4LFC K;  2JWL A;  1SQK A;  2XY7 A;  5BRE A;  4IEE A;  2RKI A;  4KHY A;  1VSK A;  1BCM A;  4BC5 A;  1YI2 N;  1KLN A;  1B9D A;  5AQT A;  4N5S A;  1GOC A;  3D2F A;  4GMJ B;  1HYS A;  2Z1H A;  3EO3 A;  4IFY A;  4CF2 A;  5LMU K;  3NVK A;  1NGB A;  3ZSW A;  4Z94 A;  4CVN E;  4IG0 A;  4BRF A;  1X3M A;  1T44 A;  4NCA A;  1LOT B;  4NYF A;  2HW3 A;  4V19 S;  1YIJ N;  4H03 B;  4GV9 A;  3TTC A;  3C65 A;  3VQE A;  4NO7 A;  1Q9Y A;  4CZK A;  3QIC A;  3MK6 A;  1HNI A;  3G0Z A;  4KH6 A;  4ISG A;  2OPR A;  2QA4 N;  1DEJ A;  4JK8 A;  2FF6 A;  1X9W A;  2Q3S A;  3QBW A;  5T7B A;  2NRZ A;  3ENO A;  3H45 C;  4KHN A;  4TSX A;  3AVJ A;  1L3T A;  3KTQ A;  3DJC A;  1E3M A;  3K58 A;  1TAQ A;  4PL8 A;  3E9L A;  3MX2 A;  3QB0 A;  3V9S A;  4B9N A;  4YOU A;  1B9F A;  1W7A A;  1OVY A;  3R8E A;  1BIS A;  1EO1 A;  4CZM A;  3AVI A;  4RW9 A;  1OH7 A;  3VQ4 A;  3KK3 A;  3U8X A;  2FSJ A;  3C6A A;  3MEC A;  3EKU A;  3DI6 A;  3Q7B A;  3DLL L;  5BRH A;  2P9S B;  2BDP A;  3QO9 A;  2FC0 A;  3ISN C;  5JIC A;  2OAN A;  4G1Q A;  1ZBL A;  1EXQ A;  4CK3 A;  2IOC A;  2VG6 A;  3E66 A;  4AH9 A;  4CGH A;  4ILH A;  4OPJ A;  3AVN A;  5C0Y A;  2IAJ A;  1K6Y A;  1RDW X;  3ULE A;  4Z4C A;  1J54 A;  1F21 A;  3MMV A;  5KRT A;  2Q0U A;  5EXW A;  4B3S K;  2O4G A;  2ZJP L;  1JLB A;  3J81 O;  3HK2 A;  2D5R A;  1QQO A;  1XWL A;  5HRP A;  4PHT X;  5A2Q O;  3ZT1 A;  4FSV A;  4DB3 A;  5CYM A;  3RMC A;  1OH5 A;  3VTI A;  1RDU A;  4HTU A;  3T1H K;  3HPO A;  4EHT A;  3LWM A;  4WFN L;  1C1B A;  3CFR A;  3EZ5 A;  1QSL A;  3AVC A;  1QHA A;  1RBS A;  3AGR A;  5B8H A;  3J80 O;  1HYZ A;  3FZH A;  3WXI A;  2Z1I A;  1SZ2 A;  4DKW A;  4QS9 A;  4Y1C A;  3S3N A;  4O55 A;  1DTQ A;  3CQY A;  3CJA A;  3NCI A;  3C7N B;  2VWJ A;  3SMP A;  4UQG A;  3WEE A;  4PQU A;  4FLZ A;  4PWD A;  1KVC A;  3S3M A;  4IJN A;  5AFU A;  1R59 O;  4X64 K;  2Z1G A;  5J2M A;  3VEV A;  3R1X A;  2P9P A;  3NH2 A;  2HNZ A;  1J9A A;  3NVM A;  3RMB A;  3THX A;  4DCH A;  3TAQ A;  5JVG L;  1BI4 B;  4BRC A;  1QZ6 A;  1EWR A;  4CIF A;  4JI0 K;  1EET A;  3LDS A;  3QEI A;  1VQ5 N;  2X6S A;  3O4N A;  4HUG A;  4LFB K;  4KRE A;  1YTA A;  1S1X A;  2A41 A;  1WAJ A;  4DSF A;  4CE9 A;  4KB1 A;  1XQS C;  3TTD A;  4FO0 A;  1NMN A;  4FK4 A;  5F0X A;  3QIO A;  4F3O A;  4LF6 K;  1KCF A;  1BO5 O;  2D0C A;  3NFA A;  1TKX A;  3KJV A;  4FZX C;  4FVU A;  1EX4 A;  3VEN A;  1H1V A;  2Q31 A;  1S6Q A;  2AA4 A;  2DFF A;  3OY9 A;  3EZW A;  1CXU A;  1SAZ A;  1DLO A;  1ESV A;  1BG3 A;  2O8D B;  1N8R O;  4H4O A;  3OVN A;  5GIP A;  3CC7 N;  4HUE A;  2AP1 A;  1RDD A;  2FF3 B;  3HO1 A;  3M8Q A;  4OPH A;  4MDA A;  1TKZ A;  4A61 A;  2F9T A;  2E4L A;  3UKU A;  4CJQ A;  1HYV A;  2P9U A;  3M1F A;  3O1W A;  2ZWH A;  1NK5 A;  4FLW A;  1QVF M;  2CGL A;  5F1X A;  1KQS M;  4LC9 B;  3HBT A;  3UE5 A;  5JMV A;  4BRI A;  3QFU A;  4IBN A;  1P90 A;  1IKV A;  4MFB A;  4E1N A;  3G4S N;  2VQE K;  4J8F A;  1LCU A;  1IBL K;  1J6Z A;  4DSI A;  2W40 A;  1K8K A;  3EN9 A;  4OVL A;  4E19 A;  4BDY A;  5ADX A;  5CYQ A;  4OPK A;  3IMX A;  5FDL A;  3ZCM A;  3OYK A;  2QEX N;  5AQH A;  1U45 A;  2RF2 A;  1XNR K;  4FJ9 A;  4CJW A;  1XC9 A;  4CJ5 A;  2J4R A;  4MLE A;  5KGW A;  4DTU A;  5DMR A;  5M1P A;  3CCL N;  3THY B;  1NOY A;  1BCO A;  1ZBI A;  4AM6 A;  3HOS A;  4I9Q A;  4A2B A;  5KRS A;  4FJ8 A;  4JS5 A;  3KKR A;  4CIE A;  5I9E B;  4BRH A;  1V4T A;  1IJJ A;  3WQU A;  3H08 A;  2YKN A;  3BDP A;  3MED A;  1RT5 A;  3JSM A;  3V1R A;  3VGK A;  4OGE A;  3N4P A;  2I7P A;  4KH4 A;  3SYZ A;  4F2S A;  2IDO A;  3MWT A;  2RN2 A;  3S41 A;  4K25 A;  4FCY A;  1HKC A;  4BE2 A;  3SBT A;  3DWL A;  1U04 A;  2D1K A;  1J5O A;  2OCE A;  3B6P A;  4KKO A;  3TAG A;  4DR4 K;  2G8I A;  1XC3 A;  2Q97 A;  3O9U A;  3ZEU B;  1U2V B;  4FJ7 A;  4DTS A;  1EP4 A;  4LD0 A;  5C12 A;  2ZE2 A;  2DY4 A;  1VQP N;  4AHU A;  3MXJ A;  5C2D A;  3DRP A;  2P1J A;  4JEP A;  4YOV A;  4HTL A;  5CR4 A;  3CM6 A;  1JLC A;  5CE3 A;  4AF1 A;  1QZ5 A;  4DV0 K;  4FW2 A;  2FXU A;  4CEC A;  3DRS A;  5AQM A;  3D2F B;  4PKG A;  2E2P A;  4WQ5 A;  4DFM A;  2A1R A;  3M8S A;  3M3Z A;  2FSN A;  3I0R A;  3L4I A;  2YCH A;  2YHB A;  3I8D A;  3UKR A;  3SJJ A;  4OPA A;  4CHN A;  1QQM A;  4CCH A;  3P83 D;  3CI5 A;  3RSE A;  4CES A;  3OTO K;  4DR5 K;  5AQL A;  1NK4 A;  3AAR A;  2O8B A;  1NBW A;  3I33 A;  5FPM A;  3O3F A;  4B8C A;  2HHQ A;  4YFU A;  3HST B;  2A5X A;  4B1W B;  3H46 O;  4MO4 A;  5TKW A;  1GLB G;  1FJG K;  3VQD A;  3VQP A;  3MDQ A;  1ATN A;  4NXM K;  3VER A;  1NM1 A;  3ZT2 A;  4FLX A;  3K59 A;  1W97 L;  3QET A;  4B3T K;  3KK2 A;  1KC8 O;  4MDB A;  5BRD A;  2HMP A;  3NF7 A;  4FWL A;  3TAP A;  1HQE A;  1UAX A;  3ZX2 A;  4Z4H A;  1BHL A;  2WBN A;  3SNN A;  4E7L A;  1GLL O;  3MXM A;  3T7Z A;  3ZET A;  1S72 N;  3L2W A;  1S1W A;  4FWM A;  4M42 A;  5AQZ A;  4B9L A;  1SKR A;  1EWQ A;  2YNF A;  4QCL A;  4PA1 A;  3OS1 A;  1JCG A;  4KO0 A;  1YXQ A;  3CC2 N;  2F7T A;  1U4B A;  3PO4 A;  1GLA G;  4EIA A;  2FBY A;  4A62 A;  4DQI A;  3HYF A;  4JKE A;  4GV6 A;  3IRX A;  4IDK A;  4EHU A;  1X9M A;  3AVG A;  4N41 A;  1X3N A;  3ULE B;  3PX4 A;  1VQ9 N;  4KI6 A;  1VSL A;  1RT2 A;  4IXC A;  1WN7 A;  1NJI O;  3RRG A;  2QXL A;  3CCJ N;  4C8N A;  4BRK A;  2UUC K;  5KPR A;  1W2B M;  2NZT A;  1KVB A;  5KQD A;  3THW B;  4Z4G A;  2QKK A;  4JHD A;  3O6W A;  3V4I A;  2HB5 A;  1IV0 A;  5C25 A;  1HPZ A;  4CGI A;  2D0A A;  1XMO K;  3EE9 A;  1N32 K;  4BRA A;  3CJ9 A;  1JL1 A;  4J2E A;  4DHY A;  1HKB A;  1VQO N;  3V9Z A;  4KB0 A;  3TAF A;  4BY9 C;  3G25 A;  3V6D A;  1YT3 A;  3VPZ A;  4BRP A;  3WEE B;  1L3V A;  3VQC A;  3K5O A;  4XH1 A;  5AQY A;  3WNF A;  1S22 A;  4FJM A;  2P9P B;  1TL1 A;  1SKS A;  3THX B;  1IG9 A;  2Q1N A;  1KSP A;  4OJR A;  3SZ2 A;  3SUO A;  3OYG A;  2PYL A;  4CJ3 A;  4E7H A;  5C42 A;  4FWK A;  4FK2 A;  1BQN A;  1IG8 A;  1T8E A;  3P1G A;  4W5T A;  4PKH A;  1JCE A;  3LPU A;  4BGB A;  3H6E A;  1LAW A;  3OS2 A;  3P38 A;  1DGK N;  1NGE A;  1BUP A;  3AAQ A;  4CHY A;  3N4Q A;  2CH5 A;  3CPW M;  4FZY A;  2BTF A;  3VF4 A;  3TAN A;  1WLJ A;  1FKO A;  3IDH A;  4FWO A;  1NOZ A;  1KFD A;  4NB4 A;  2G8F A;  2NLX A;  5DK5 A;  1SKW A;  4I7F A;  3OYC A;  2F96 A;  1C0F A;  1RGI A;  3HOT A;  4WF9 L;  2UXD K;  4A57 A;  3CME N;  3DLB A;  1TYQ B;  3O8M A;  5J1E A;  1LWE A;  3BGR A;  4W5N A;  4FJ5 A;  2E20 A;  2IC3 A;  5AQN A;  4RTF D;  3LP0 A;  1SL2 A;  1SL1 A;  2ASO A;  3VGL A;  1JLQ A;  3UKU B;  2O8C A;  2P9U B;  1RDA A;  3CG7 A;  3VQ8 A;  3FR0 A;  4FZZ A;  1Q9X A;  3MEG A;  3LP3 A;  4J2A A;  2VQF K;  1UOC A;  2ZF5 O;  4FWN A;  4BRD A;  3SJH A;  2DPN A;  3S9H A;  4CEF A;  3OYF A;  4NCG A;  3UIQ A;  2ASM A;  2PAV A;  4BRO A;  1NKE A;  3DLK A;  1NGC A;  3LM9 A;  3TR8 A;  2FBT A;  2Z1J A;  4Y0W A;  4M3W A;  4I9L A;  3J8A A;  2W6K A;  1CZ9 A;  2HHS A;  1O13 A;  3LP2 A;  5AQG A;  2W41 A;  4WQ4 A;  3D45 A;  4IWV A;  4DUY K;  1BWF O;  1S6P A;  4DLE A;  4ELV A;  3HTV A;  2PZS A;  4JKD A;  4O8K A;  1GOA A;  4NLC A;  4BRL A;  4FLU A;  3A8Y A;  3SAG A;  5TKY A;  2F4V K;  4CZG A;  4CFC A;  3E9P A;  1Q86 O;  4PY5 A;  3WNH A;  3ZT3 A;  3G71 N;  4CJL A;  4DTJ A;  3CCM N;  1GLF O;  3ZT0 A;  3NE6 A;  1WBD A;  4EP4 A;  4LF9 K;  4LSL A;  5GAD P;  3PIO L;  3AGK A;  4GW6 A;  4GKK K;  3HI0 A;  2PYJ A;  3HP6 A;  1T03 A;  3MWP A;  3TSP A;  4BG9 A;  1A5V A;  4CF9 A;  5FPN A;  4CJV A;  3D2E A;  4IEI A;  4JRP A;  3MEE A;  4YOY A;  3LDL A;  3F2K A;  4H0V B;  4OKE A;  5LJV A;  1NGD A;  1G15 A;  3AVH A;  3KWI A;  1VSM A;  4O4G A;  1X9S A;  3AA2 A;  3QIN A;  4GVM A;  3QLH A;  5FPE A;  4OKK A;  2CGK A;  4KAZ A;  4FJL A;  4B1U B;  4I2P A;  2HBM A;  4YOR A;  2GWK A;  4FLY A;  2OTL N;  5C2F A;  3SBG A;  4CK1 A;  4X62 K;  3O3G A;  2OA8 A;  5J2Q A;  4XEI A;  3M6G A;  3SAF A;  3O1B A;  4QOZ B;  5KQ8 A;  3PSF A;  3LZI A;  1GLJ O;  3FFK B;  3UKR B;  4DQ8 A;  5BN8 A;  1BIZ A;  3CCE N;  3NBP A;  2HF3 A;  4RG8 A;  2O8E A;  4QAG A;  5AFU H;  4F8R A;  2O8B B;  5AZI B;  4MQ3 A;  3AVF A;  5AZJ A;  3K0S A;  2GEL A;  2QTD A;  4DG1 A;  3ID6 A;  3CPE A;  3ZT4 A;  4JN4 A;  4LH4 A;  3G6E N;  5HLF A;  1WSJ A;  3V81 A;  1RIL A;  4B9Q A;  1ILY A;  1D9F A;  5BR9 A;  4LF5 K;  3ZSQ A;  1NWK A;  5AQJ A;  4KBO A;  4H4M A;  4WCE L;  2BE2 A;  4KHQ A;  1U6Z A;  4PUO A;  1NGH A;  1E4G T;  3ZET B;  3A0I X;  2Q0R A;  4DQQ A;  3OYI A;  5AQP A;  3CFO A;  2P9I A;  5M1K A;  4ELU A;  1HQU A;  1RBT A;  5SWM A;  3WT0 A;  3MN6 A;  2KW4 A;  4JKC A;  1NK7 A;  3ALY A;  2X6N A;  2GWJ A;  1ATR A;  3VMF B;  1VQ8 N;  1NJW A;  1N5Y A;  1JJ2 M;  3NF9 A;  3L2Q A;  1SUQ A;  4W5O A;  2Q2R A;  4ICL A;  1IBM K;  4J2D A;  3DOK A;  2D0P A;  1QQC A;  3AO3 A;  3KLH A;  2P9K A;  1C6V A;  2QWR A;  4M41 A;  3U9Z A;  4B08 A;  4JK7 A;  4B3O A;  4E0D A;  5JS1 A;  2ITG A;  1NGA A;  3OA9 A;  5AQV A;  1JLG A;  3I8B A;  1XMQ K;  4WQ5 C;  3SV4 A;  1ASW A;  4LSN A;  4DTX A;  3PX6 A;  3FZF A;  3SPZ A;  1VSE A;  3I56 N;  4W5R A;  2DFE A;  5E41 A;  3KLF A;  3THV A;  2I7N A;  3ENH A;  3MX5 A;  4B1V A;  3WXK A;  3MAQ A;  5HOO A;  1BOT O;  4FL9 A;  3PIP L;  2WFB A;  2E1Y A;  4CGG A;  3A5M C;  4JHD B;  4Q5V A;  4ZTF A;  4JAX A;  4CER A;  4CFD A;  2XY6 A;  2Q36 A;  4E7I A;  3IAY A;  4JKG A;  5ADX H;  1HNW K;  5FRN A;  4DR1 K;  3PLA A;  2UUA K;  3R9P A;  3K57 A;  4KHP K;  2NRV A;  4XH5 A;  1OH8 A;  3B6O A;  1JXE A;  4K8Z A;  3PO5 A;  1QE1 A;  3ULD A;  1QSY A;  5LL6 Z;  3AV9 A;  2CH6 A;  1XHZ A;  1L3S A;  4B3R K;  3CCV N;  3LPT A;  4KFB A;  2P9L A;  3IUC A;  4BDZ A;  2ATQ A;  2HVI A;  1RBU A;  3AVM A;  1RTI A;  4H5W A;  1TL3 A;  1NGF A;  5AQO A;  5HL7 L;  1RT3 A;  3H3N O;  3ZSR A;  1T3V A;  1RTD A;  2QWL A;  4DV2 K;  4O0J A;  3LM2 A;  3RMA A;  1JLF A;  2IIR A;  3R3L A;  3CC4 N;  4RW4 A;  2A42 A;  4DLG A;  1D9D A;  4DMN A;  4FOE A;  3A5N C;  2V7Z A;  4CHQ A;  3OHR A;  1YIT N;  1Y97 A;  2KZM A;  2H3G X;  3I55 N;  4NCB A;  3EKS A;  3F9M A;  3D0P A;  3CYM A;  1YJW N;  4L3Q A;  5LJW A;  2GTD A;  3DLR A;  3TI0 A;  5BRF A;  4MO5 A;  4DV4 K;  3K2P A;  3DLH A;  2O8F A;  4KTZ A;  3W0L A;  3T1Y K;  2ZM6 K;  1KAY A;  4L8R B;  3DXK A;  1VQ6 N;  2HHH K;  1NK8 A;  1FXX A;  2B5J A;  3O9T A;  4WE1 A;  4A5B A;  5E26 A;  2R7Y A;  1VRT A;  5KPZ A;  4ID1 A;  3CJC A;  3OJU A;  3RR7 A;  4YNQ A;  4DF8 A;  3O4W A;  1RTH A;  3M5R A;  1A5X A;  1XI1 A;  4Q0B A;  3O4Q A;  3HRG A;  1HJO A;  4CEO A;  3L4Q A;  3QDK A;  3O3H A;  3QEP A;  1SV5 A;  1RDB A;  4CGJ A;  4FW1 A;  1VAZ A;  1YAG A;  4FJX A;  5AQS A;  5J2N A;  3SQ0 A;  4H5V A;  4JKA A;  3WUH A;  5H1S Q;  2X78 A;  4DR6 K;  1NK9 A;  3GBT A;  3CCR N;  2HBL A;  2KQ2 A;  2OZM A;  3HPH A;  4PL7 A;  3E1Y A;  3HT3 A;  4ILJ A;  3QIP A;  2GBZ A;  4DFK A;  4M3Y A;  4AIL C;  1ZYQ A;  4CEZ A;  1GLE G;  3C0B A;  3KK7 A;  3LWL A;  2P9N A;  3DRR A;  5EY4 A;  1QS4 A;  4CBU A;  4DU1 A;  4JK9 A;  3NGZ A;  3T1A A;  4H0X B;  1JL2 A;  3WXM B;  2PY5 A;  4DV1 K;  3CFP A;  3CXC M;  3CJB A;  1KLM A;  1QQN A;  2ITM A;  1NGJ A;  1I3A A;  1RT7 A;  1VRU A;  4DV7 K;  2X74 A;  4DV6 K;  3DOL A;  3L2V A;  4BRE A;  2YJF A;  2HND A;  3HVR A;  2P9S A;  2XY8 A;  5IT9 O;  1TKT A;  1T6D A;  3HL8 A;  3LAL A;  1NKB A;  2GV9 A;  2OPS A;  3AAP A;  4C8M A;  2BAN A;  4H0Y B;  3M8R A;  2GEM A;  5FPD A;  4DS5 A;  2AJQ A;  5GAH P;  4EFH A;  1RTJ A;  3VN5 A;  3LZJ A;  5C10 A;  4J2B A;  2IGI A;  4YOW A;  5JVH L;  1HUX A;  1Q7Y O;  1RT6 A;  1WB9 A;  3DMJ A;  3O9R A;  1J53 A;  4AHS A;  1HJR A;  4KHS A;  2E2Q A;  1WSH A;  2NRW A;  3L2U A;  2JLE A;  2HBJ A;  5C15 A;  2A6A A;  4E7J A;  3U3G A;  3SPY A;  4BE0 A;  1U47 A;  2O4I A;  1TAU A;  3PUF A;  1BA1 A;  1S9E A;  4KI4 A;  4FWQ A;  2EWS A;  4BQZ A;  4C8O A;  2WC9 A;  2G8K A;  1NGG A;  3CD6 N;  2HVH A;  4O44 A;  4NXN K;  3T3F A;  1SL0 A;  5AQU A;  4RW8 A;  2YX6 A;  3JAM O;  3OYM A;  3HXM A;  3VF6 A;  3SMS A;  3H1Q A;  4AHV A;  5BR8 K;  1KAZ A;  1VQ4 N;  2XRI A;  2E2O A;  3LAK A;  5BPN A;  3AY9 A;  1QHT A;  1TGO A;  3ZSO A;  5FLX O;  1WUA A;  3C7N A;  2B6A A;  1CZB A;  3GG4 A;  2GUI A;  3JXU A;  1XNQ K;  1JXB A;  3R6M A;  4IOX A;  3SLC A;  1X9J A;  1Z6R A;  4JD2 A;  1CZA N;  2O8E B;  1TVR A;  3DLE A;  1ZXO A;  2E6L A;  4WQ4 C;  3SAH A;  4M3Z A;  4DTN A;  5BN9 A;  1WSI A;  2F9W A;  2HBK A;  5KI6 A;  4CZI A;  4ELT A;  4BRG A;  3OYH A;  1VK0 A;  5I3U A;  4M63 C;  4BRQ A;  1C0U A;  5M1Q A;  2ZGY A;  4MLH A;  3RVC A;  4K8X A;  3EY1 A;  2PBD A;  3P4I A;  1HLU A;  3KIO A;  3ZYY X;  2G8V A;  3C6U A;  5SZT A;  2ZJR L;  3CQX A;  2Y1I A;  2OPQ A;  4OGC A;  4I2Q A;  3V1Q A;  5AQR A;  3O08 A;  1NMD A;  3KKS A;  3F9K A;  5KTQ A;  1YJN N;  4BR4 A;  4CZL A;  3KD1 E;  4JI5 K;  1S5J A;  4BE1 A;  2YHX A;  1LV5 A;  3CJ7 A;  1CXQ A;  3BY5 A;  2YNI A;  4DSE A;  4B1Z A;  4AM7 A;  4B9M A;  5J2P A;  3TTF A;  4CJ7 A;  3NAE A;  4HCB A;  1NJY A;  1NLV A;  5HBM A;  4CHO A;  1C0M A;  4DR3 K;  2IVP A;  4O0I A;  2P9K B;  3PY8 A;  5KGX A;  2HMI A;  1HKG A;  3VQ7 A;  4M3U A;  1NGI A;  3BF1 A;  2QKB A;  4HCC A;  4JNE A;  2DFH A;  3MCA B;  4B1Y B;  1VSH A;  3OYD A;  1EKE A;  4JKH A;  4F4K A;  1Y64 A;  3J7Y P;  3F73 A;  4ZTJ A;  4KHW A;  4KV8 A;  4GNI A;  4FXD A;  3SK3 A;  1K8A O;  2OZS A;  1GOB A;  4CJS A;  3CMA N;  3TAE A;  5AJ3 K;  1VSJ A;  3A5L C;  1I39 A;  2P51 A;  4BWM A;  2ZD1 A;  4HVJ A;  1IKW A;  3VEO A;  4CZJ A;  1MU2 A;  2HF4 A;  3OYN A;  4JI7 K;  3A2F A;  2BUP A;  2OPP A;  3ID8 A;  2XHB A;  3Q7C A;  4CD3 A;  4DV3 K;  4JKG B;  3QES A;  1DTT A;  1RBV A;  2UXC K;  4DF4 A;  4DTP A;  1S1U A;  1KRP A;  3LL3 A;  4FM1 A;  4K42 A;  3QBX A;  2Y1J A;  1IBK K;  3MCP A;  3JS6 A;  3HZ6 A;  1TKD A;  4LFA K;  1X1P A;  1VSF A;  1RT4 A;  2KLA A;  1YF5 L;  1VQK N;  3E01 A;  2E1Z A;  2HHT A;  4M7X A;  2WON A;  2FBX A;  2QWQ A;  3DLG A;  4E1M A;  2P9L B;  1T05 A;  4FPA A;  1WSE A;  3SUP A;  2V51 B;  3FE1 A;  3WNE A;  4JI4 K;  3KLE A;  1NJX A;  3AVB A;  1K8K B;  4I6M A;  3PSI A;  3ZSX A;  4JI2 K;  4CJR A;  3ZEU A;  5AQX A;  2YNH A;  4B9U A;  5EOY A;  4KTQ A;  4CHP A;  3ITH A;  3OBW A;  4JI6 K;  1NK0 A;  1XHX A;  2BGG A;  4LY7 A;  3QEV A;  2O8F B;  3GE1 A;  3TSQ A;  4FM2 A;  3VQ9 A;  2JWK A;  3DXK B;  1WOQ A;  4CHZ A;  1P8Z A;  1CLQ A;  4DTO A;  3QNO A;  1HNX K;  3H1V X;  4FLT A;  3KLG A;  1BQM A;  3L0Q A;  4BR0 A;  2HST A;  3HSC A;  3W3D A;  2VYP A;  3LAN A;  3NH1 A;  1MWM A;  4IFE A;  1EQY A;  2QI2 A;  2RHK A;  4OLA A;  3WXJ A;  3MN7 A;  1TK0 A;  4F2R A;  4B3M K;  3C6T A;  4CJK A;  4BC4 A;  4CEB A;  1WSF A;  4DS4 A;  4BR5 A;  4EP5 A;  3DYA A;  3LDN A;  5HP1 A;  3GL1 A;  4RW7 A;  4IO9 L;  4CIG A;  3EE8 A;  5GAE P;  1TV6 A;  1NK6 A;  2RPI A;  1LWF A;  3UB5 A;  4JI3 K;  4LH5 A;  2ZGZ A;  5M1O A;  1DKG D;  1YUW A;  1VSI A;  2GUP A;  1VQM N;  4EAH D;  2VWK A;  4O5F A;  5DM7 L;  2P9N B;  1OVQ A;  3HVT A;  4JS4 A;  5M1F A;  1VQL N;  4YOX A;  4NLB A;  4CZH A;  2YI1 A;  4BG8 A;  2E88 A;  4HHT A;  3ZX3 A;  1LWC A;  4FPB A;  2KZZ A;  3VQA A;  4WFA L;  4CF1 A;  4CJE A;  1U48 A;  2GX9 A;  3V1O A;  5GIO A;  4A59 A;  3OYL A;  4DR7 K;  2A1S A;  3ENB A;  3M8P A;  1ATS A;  1KD1 O;  2V7Y A;  3RSE B;  4FWR A;  4FYD A;  4DQR A;  4QS8 A;  1E4F T;  4FVM A;  3DXM A;  5GIN A;  1BA0 A;  3B8A X;  4U7B A;  5FRM A;  4OO1 J;  3VGM A;  1QSS A;  3CCQ N;  4DFJ A;  4N47 A;  1W0H A;  4RCH A;  3VQB A;  3EYZ A;  2NNW A;  3FFI A;  4HWI A;  4WYB A;  2VG7 A;  4C8L A;  3KHY A;  2ETJ A;  1UA1 A;  5JLF A;  4C8K A;  4XH4 A;  4M3R A;  1ASV A;  4A2A A;  1OH6 A;  3TWH A;  3K5M A;  1KVA A;  4ZHR A;  4CJU A;  1DT9 A;  2FBV A;  5AQW A;  4KH5 A;  2QW9 A;  3VQ5 A;  4A5A A;  3THW A;  4FOI A;  3ZLJ A;  2NUB A;  3IG1 A;  3SUQ A;  3CHW A;  3VEW A;  3ZSY A;  4YHH K;  4FLV A;  5ELZ A;  1L3U A;  5HRR A;  3KD5 E;  4RWT A;  3U9D A;  4Z0U A;  1K9M O;  1JLA A;  3FZL A;  5CZ1 A;  1ASU A;  3D6R A;  3CET A;  4CJP A;  3TU5 A;  2WTU A;  2YHW A;  1NJZ A;  3L3V A;  2VGM A;  4NYN A;  2WOM A;  3AA4 A;  4JD2 B;  5EX5 A;  4B8A B;  4CBX A;  5LY3 A;  1FKP A;  1BGX T;  3IFR A;  3SQ1 A;  4R5P A;  2G8U A;  3AA3 A;  1GLD G;  2CGJ A;  2V52 B;  1S1V A;  1TK5 A;  4IJA A;  2G8H A;  4K41 A;  1LAV A;  1N36 K;  3FGU A;  4B1X B;  2KFN A;  1YJ9 N;  3OYJ A;  1TK8 A;  2OTJ N;  2UYT A;  3LP1 A;  5MLC Q;  4IOC L;  3HPG A;  1R0A A;  4LF4 K;  1RDC A;  1TUY A;  4X65 K;  4BR2 A;  2QWP A;  4YDU C;  1Q81 O;  4BR7 A;  1T6C A;  5F2R A;  3P39 A;  3CCU N;  4DSK A;  2QK9 A;  3NDK A;  4JYA K;  1LW2 A;  1BIU A;  1D4X A;  4JI1 K;  4Y1D A;  4DWI A;  1HNZ K;  4N76 A;  1UA0 A;  3LDP A;  4H0P A;  4KPY A;  3F5T A;  3O80 A;  1JLE A;  4IDH A;  4H8K A;  3ZSZ A;  2FSK A;  3J7Z O;  4E3S A;  4CFB A;  4BVO A;  2ZJQ L;  3NF6 A;  3TPQ A;  4CFA A;  1TYQ A;  3KLI A;  3CF5 L;  3L3U A;  1N34 K;  3AVK A;  3K9J A;  3MN5 A;  2NRX A;  4E89 A;  3SQ2 A;  1MWK A;  5JS2 A;  2RE2 A;  4K43 A;  3LAM A;  1RCH A;  1ZBU A;  1SS6 A;  4M45 A;  4E7K A;  1ZBF A;  3K5L A;  4BAC A;  4K0K K;  3WXL A;  1Q82 O;  5HRN A;  1WBB A;  2ZQB A;  3QFP A;  4GKJ K;  2E6M A;  3FZK A;  1Z26 A;  3AVL A;  4FWP A;  5CY4 A;  3QER A;  4CK2 A;  3BEX A;  4F9O A;  3ATV A;  1LW0 A;  4DTM A;  3AVA A;  4HUF A;  3TAM A;  4FJJ A;  3ZSV A;  2D0O A;  1KTQ A;  3QNN A;  3CER A;  4CEA A;  3I0S A;  4M3X A;  4JV5 K;  3GOI A;  3ATU A;  2B4J A; 
#chains in the Genus database with same CATH homology
 2QXF A;  3VA3 A;  3SI6 A;  1L5U A;  4Y1C A;  3TR8 A;  4DTN A;  3S3N A;  3CQ8 A;  2FBT A;  2Z1J A;  4DQP A;  1WSI A;  4O55 A;  1DTQ A;  4I9L A;  2W42 A;  4M3W A;  5KI6 A;  3MXI A;  3NCI A;  3V9U A;  4AHC A;  2VWJ A;  1YVU A;  1FK9 A;  1CZ9 A;  4UQG A;  4ELT A;  2HHS A;  3OYH A;  1VK0 A;  5I3U A;  1ITG A;  5CZ2 A;  2KFZ A;  3LP2 A;  4RW6 A;  1C0U A;  4DSJ A;  4PQU A;  4K8X A;  2YV0 X;  3D45 A;  4FLZ A;  3HP9 A;  1KVC A;  3S3M A;  3EY1 A;  4PWD A;  1S6P A;  4FJN A;  3T19 A;  1IKX A;  4DLE A;  4ELV A;  2HNY A;  3KIO A;  2G8V A;  2Z1G A;  1GOA A;  4FLU A;  3C6U A;  5SZT A;  5J2M A;  2Y1I A;  2PZS A;  3K5N A;  2OPQ A;  3U6F A;  3SCX A;  3NH2 A;  4OGC A;  2HNZ A;  4I2Q A;  4CFC A;  3V1Q A;  1J9A A;  3RMB A;  5K14 A;  4CGF A;  3TAQ A;  4PY5 A;  3WNH A;  3ZT3 A;  3KKS A;  1BI4 B;  3F9K A;  2YNG A;  4CJL A;  5KTQ A;  4DTJ A;  2HHW A;  3KD1 E;  4CIF A;  3SPY A;  1U47 A;  3QEW A;  1Z25 A;  3C94 A;  1S5J A;  3ZT0 A;  3NE6 A;  4BE1 A;  4FJG A;  4EP4 A;  1LV5 A;  1CXQ A;  1RNH A;  4LSL A;  1VSD A;  5D3G A;  2YNI A;  4XIU A;  1EET A;  4DSE A;  3LDS A;  3QEI A;  4B9M A;  3C95 A;  4GW6 A;  2X6S A;  3O4N A;  4HUG A;  5J2P A;  1C1A A;  3NAE A;  4HCB A;  1NJY A;  3HP6 A;  1T03 A;  2PYJ A;  4Z4I A;  3KK1 A;  5HBM A;  1YTA A;  1S1X A;  4BWJ A;  1A5V A;  4CHO A;  4KRE A;  1C0M A;  1WAJ A;  4DSF A;  4CF9 A;  4DU4 A;  4OKJ A;  3WNG A;  4CE9 A;  4CJV A;  3HM9 A;  4KB1 A;  4FJI A;  4O0I A;  4JRP A;  3MEE A;  3PY8 A;  5KGX A;  4FK4 A;  3QIO A;  4F3O A;  2HMI A;  3VQ7 A;  4M3U A;  4KHU A;  1KCF A;  4OKE A;  3RMD A;  4HCC A;  2D0C A;  2QKB A;  2D0B A;  2DFH A;  3S3O A;  1G15 A;  2EX3 A;  3AVH A;  1A5W A;  1VSH A;  3NFA A;  3OYD A;  2KTQ A;  1TKX A;  3U3Y A;  3KJV A;  1VSM A;  4O4G A;  4FZX C;  1EKE A;  1EX4 A;  4F4K A;  1X9S A;  3F73 A;  3AA2 A;  3QIN A;  4GVM A;  4KV8 A;  4ZTJ A;  4KHW A;  1S6Q A;  2DFF A;  3DM2 A;  3QLH A;  2OZS A;  3OY9 A;  1GOB A;  4CJS A;  1CXU A;  3TAE A;  4OKK A;  1DLO A;  4KAZ A;  1KFS A;  1VSJ A;  4FJL A;  3NGI A;  4KRF A;  1U49 A;  3VQQ A;  4I2P A;  4H4O A;  1I39 A;  3OVN A;  4KTW A;  2P51 A;  4BWM A;  2ZD1 A;  4HUE A;  4FLY A;  4HVJ A;  1IKW A;  4CK1 A;  1RDD A;  3O3G A;  3JYT A;  3M8Q A;  3HO1 A;  4FJH A;  4Z4F A;  1MU2 A;  1TKZ A;  3OYN A;  2OA8 A;  2VG5 A;  3A2F A;  5J2Q A;  2OPP A;  2XHB A;  2E4L A;  3QEX A;  3SUN A;  4CJQ A;  4QOZ B;  1HYV A;  4JRQ A;  3AO1 A;  4DSL A;  3LZI A;  1NK5 A;  1QTM A;  3QES A;  4FLW A;  1DTT A;  1S1T A;  4IG3 A;  2LSN A;  1RBV A;  1IKY A;  1BIZ A;  4CJ4 A;  4DF4 A;  4DTP A;  1S1U A;  1KRP A;  3NBP A;  3RTV A;  4CF8 A;  4FM1 A;  4IBN A;  4RG8 A;  2Y1J A;  1IKV A;  2HHV A;  3CM5 A;  1TKD A;  4QAG A;  4MFB A;  1ZBH A;  1X1P A;  3IS9 A;  4F8R A;  2HHX A;  4E1N A;  5C24 A;  3PV8 A;  4MQ3 A;  1VSF A;  1RT4 A;  3AVF A;  4IKF A;  2EHG A;  1S9G A;  3TAB A;  2F8T A;  1W9H A;  3AO4 A;  4DSI A;  3OYA A;  3E01 A;  4OVL A;  3VQ6 A;  4DG1 A;  3NH0 A;  2HHT A;  3ZT4 A;  4E19 A;  2WON A;  4BDY A;  4FK0 A;  2FBX A;  2YKM A;  1O1W A;  5CYQ A;  1IH7 A;  4LH4 A;  4DFP A;  4OPK A;  3PX0 A;  3DLG A;  1WSJ A;  5FDL A;  3ZCM A;  4E1M A;  3OYK A;  3V81 A;  5HLF A;  1T05 A;  1RIL A;  1U45 A;  2RF2 A;  1D9F A;  1BL3 A;  4FJ9 A;  4CJW A;  1XC9 A;  4CJ5 A;  1WSE A;  3ZSQ A;  5KGW A;  4DTU A;  3SUP A;  5DMR A;  4FXD A;  3ASM A;  1NOY A;  1BCO A;  3WNE A;  4H4M A;  3NGY A;  1ZBI A;  5HRO A;  2BE2 A;  4KHQ A;  3OJS A;  4I9Q A;  4PUO A;  3KLE A;  1NJX A;  5KRS A;  4FJ8 A;  4JS5 A;  3AVB A;  3KKR A;  4BDP A;  1BI4 A;  4CIE A;  4DQQ A;  3ZSX A;  3OYI A;  4CGD A;  3CFO A;  4CJR A;  4ELU A;  1HQU A;  1RBT A;  3H08 A;  4AHR A;  2YKN A;  2YNH A;  5SWM A;  4B9U A;  4EZ6 A;  3BDP A;  3MED A;  1C0T A;  3RR8 A;  3SQ4 A;  4KTQ A;  1RT5 A;  1REV A;  4CHP A;  3JSM A;  2P5O A;  3TAR A;  4W5Q A;  3V1R A;  3VA0 A;  2KW4 A;  1WNS A;  3ITH A;  1NK7 A;  3ALY A;  2JGU A;  4OGE A;  2X6N A;  2XO7 A;  3SYZ A;  4F2S A;  2IDO A;  1HMV A;  2RN2 A;  4CEQ A;  4FCY A;  1NK0 A;  1YTU A;  1HNV A;  1NJW A;  1N5Y A;  4BE2 A;  3RWU A;  3NF9 A;  3L2Q A;  1SUQ A;  1U04 A;  1XHX A;  4CJT A;  4ICL A;  4LY7 A;  4W5O A;  2YHA A;  3DOK A;  3QEV A;  4J2D A;  1QQC A;  4M3T A;  3AO3 A;  4CED A;  3KLH A;  1J5O A;  2HHU A;  4FM2 A;  3VQ9 A;  1C6V A;  3AO5 A;  4Z4E A;  3B6P A;  4KKO A;  3TAG A;  4M41 A;  4CHZ A;  2G8I A;  1CLQ A;  4DTO A;  3QNO A;  4FJ7 A;  4DTS A;  1EP4 A;  4B08 A;  4FLT A;  3KLG A;  1BQM A;  4B3O A;  4LD0 A;  3AO2 A;  3L8B A;  4E0D A;  5JS1 A;  2ITG A;  2ZE2 A;  2DY4 A;  3V9W A;  3LAN A;  3NH1 A;  1C1C A;  1JLG A;  3MXJ A;  4AHU A;  1UWB A;  4OLA A;  3DRP A;  2P1J A;  4ID5 A;  1N6Q A;  1RBR A;  3SV4 A;  1ASW A;  4N56 A;  1TK0 A;  4LSN A;  4DTX A;  3PX6 A;  3SPZ A;  4F2R A;  1VSE A;  3CM6 A;  2DFE A;  3C6T A;  4CJK A;  5EU7 A;  5E41 A;  4W5R A;  1JLC A;  3KLF A;  3THV A;  4CEB A;  1WSF A;  4DS4 A;  4CEE A;  4EP5 A;  3DYA A;  5HP1 A;  3MAQ A;  4FW2 A;  3HJF A;  4CEC A;  4RW7 A;  4IFV A;  3DRS A;  4CGG A;  4Q5V A;  4ZTF A;  4B9T A;  4DFM A;  4CER A;  4CIG A;  4CFD A;  3M8S A;  2XY6 A;  2A1R A;  4CF0 A;  3I0R A;  1TV6 A;  3V9X A;  1WAF A;  2IS3 A;  1NK6 A;  4E7I A;  3IAY A;  2RPI A;  1LWF A;  2YHB A;  3I8D A;  5I42 A;  4LH5 A;  5FRN A;  2G8W A;  3SJJ A;  2BGG A;  1VSI A;  4CHN A;  4CCH A;  2VWK A;  3P83 D;  3K57 A;  4CES A;  1NK4 A;  3HVT A;  4JS4 A;  3NF8 A;  4B9S A;  1NKC A;  3B6O A;  1JXE A;  2F8S A;  3O3F A;  4B8C A;  4DU3 A;  3PO5 A;  4K8Z A;  1QE1 A;  4HHT A;  3ULD A;  2HHQ A;  1D5A A;  4YFU A;  1LWC A;  1QSY A;  3HST B;  3AV9 A;  2KZZ A;  3VQA A;  4DTR A;  2OYQ A;  1XHZ A;  1L3S A;  4FM0 A;  4CF1 A;  3VQD A;  4CJE A;  1WSG A;  3VQP A;  3G10 A;  1U48 A;  3LPT A;  3V1O A;  3NHG A;  3ZT2 A;  3OYL A;  4FLX A;  3K59 A;  4KFB A;  4BDZ A;  1D8Y A;  2A1S A;  2I5J A;  3QET A;  3M8P A;  3KK2 A;  1B92 A;  2ATQ A;  3OYB A;  2HVI A;  5FRO A;  1HRH A;  1RBU A;  3AA5 X;  3AVM A;  1RTI A;  3NF7 A;  4FYD A;  1TL3 A;  3TAP A;  4DQR A;  4OLB A;  4FVM A;  1RT3 A;  1HQE A;  1UAX A;  3ZSR A;  3OYE A;  4Z4H A;  1BHL A;  5FRM A;  3SNN A;  4E7L A;  1RTD A;  4O0J A;  3MXM A;  2DTU A;  3RMA A;  1JLF A;  1QSS A;  3P5J A;  4RW4 A;  3L2W A;  4DLG A;  1D9D A;  1S1W A;  4DMN A;  4F3T A;  4DFJ A;  4N47 A;  1JKH A;  4M3Z A;  1W0H A;  3VQB A;  4CHQ A;  3EYZ A;  1IO2 A;  3OS0 A;  3FFI A;  4M42 A;  1Y97 A;  4B9L A;  2KZM A;  2VG7 A;  1SKR A;  4C8L A;  4NCB A;  2ETJ A;  4O5B A;  1UA1 A;  1Q8I A;  2YNF A;  3D0P A;  4C8K A;  4PA1 A;  3CYM A;  3OS1 A;  4QCL A;  4KO0 A;  4M3R A;  1ASV A;  1U4B A;  3DLR A;  3TI0 A;  2XY5 A;  3PO4 A;  3K2P A;  2FBY A;  3TWH A;  3DLH A;  3HYF A;  4DQI A;  4KTZ A;  3K5M A;  3L2R A;  4EZ9 A;  1KVA A;  3IRX A;  4IDK A;  4CJU A;  4ZHR A;  4L8R B;  2FBV A;  1X9M A;  3AVG A;  1NK8 A;  1FXX A;  2B5J A;  4N41 A;  4WE1 A;  3VQ5 A;  4JLH A;  2R7Y A;  4AHT A;  1VRT A;  3PX4 A;  4ID1 A;  2NUB A;  4DQS A;  1T7P A;  2P5G A;  3OJU A;  3IG1 A;  3RRH A;  3SUQ A;  3RR7 A;  4FJK A;  5HRS A;  4B9V A;  4YNQ A;  4DF8 A;  1RT1 A;  4KI6 A;  3ZSY A;  1RTH A;  1A5X A;  1RT2 A;  1VSL A;  4CJF A;  4FLV A;  1XI1 A;  1L3U A;  4Q0B A;  3O4Q A;  5HRR A;  1WN7 A;  3KD5 E;  3SV3 A;  4CEO A;  4Z0U A;  1JLA A;  3O3H A;  2XY7 A;  3QEP A;  3RRG A;  1SV5 A;  1RDB A;  5CZ1 A;  1ASU A;  4FW1 A;  4CGJ A;  4CJP A;  2RKI A;  4C8N A;  4KHY A;  1VSK A;  1BCM A;  4FJX A;  5J2N A;  3SQ0 A;  1NJZ A;  1KLN A;  3L3V A;  1KVB A;  1B9D A;  4N5S A;  2X78 A;  4Z4G A;  1GOC A;  4NYN A;  2QKK A;  1NK9 A;  2WOM A;  3AA4 A;  4GMJ B;  4B8A B;  3V4I A;  1HYS A;  2Z1H A;  4IFY A;  2KQ2 A;  4CF2 A;  2OZM A;  1FKP A;  1BGX T;  2HB5 A;  3ZSW A;  3HPH A;  5C25 A;  1HPZ A;  4IG0 A;  3SQ1 A;  4CGI A;  2D0A A;  4R5P A;  4NCA A;  3HT3 A;  2G8U A;  3AA3 A;  2HW3 A;  3QIP A;  4NYF A;  2GBZ A;  4DFK A;  4M3Y A;  4AIL C;  1ZYQ A;  1S1V A;  1JL1 A;  1TK5 A;  4CEZ A;  4J2E A;  2G8H A;  3LWL A;  1LAV A;  3DRR A;  3V9Z A;  4KB0 A;  3TAF A;  1QS4 A;  3VQE A;  1Q9Y A;  4DU1 A;  3V6D A;  3NGZ A;  1YT3 A;  2KFN A;  3T1A A;  3OYJ A;  1JL2 A;  1HNI A;  3G0Z A;  1TK8 A;  2PY5 A;  3CFP A;  3LP1 A;  3HPG A;  2OPR A;  1KLM A;  1RDC A;  1R0A A;  1L3V A;  1X9W A;  2Q3S A;  3VQC A;  3K5O A;  1I3A A;  1RT7 A;  3WNF A;  1VRU A;  2X74 A;  3DOL A;  5T7B A;  4FJM A;  3L2V A;  4KHN A;  1TL1 A;  4TSX A;  3AVJ A;  1L3T A;  3KTQ A;  1SKS A;  2HND A;  3HVR A;  4DSK A;  2XY8 A;  3NDK A;  1IG9 A;  2QK9 A;  1TKT A;  1LW2 A;  3HL8 A;  3LAL A;  1NKB A;  2GV9 A;  3K58 A;  2OPS A;  4OJR A;  3SZ2 A;  3SUO A;  3OYG A;  1BIU A;  1KSP A;  2PYL A;  4CJ3 A;  4E7H A;  5C42 A;  1TAQ A;  4FK2 A;  1BQN A;  4C8M A;  2BAN A;  3M8R A;  3V9S A;  4Y1D A;  1T8E A;  4B9N A;  1B9F A;  4DS5 A;  3P1G A;  4DWI A;  4N76 A;  2AJQ A;  1UA0 A;  4W5T A;  1BIS A;  1RTJ A;  3VN5 A;  3LZJ A;  3AVI A;  4KPY A;  3LPU A;  4J2B A;  4RW9 A;  2IGI A;  1JLE A;  1LAW A;  4H8K A;  3OS2 A;  3VQ4 A;  3KK3 A;  3ZSZ A;  3MEC A;  4E3S A;  1RT6 A;  4CFB A;  3DI6 A;  3NF6 A;  3DMJ A;  4CFA A;  3KLI A;  2BDP A;  3QO9 A;  4CHY A;  3L3U A;  1J53 A;  4AHS A;  2FC0 A;  4FZY A;  3ISN C;  1HJR A;  4KHS A;  1WSH A;  3L2U A;  2JLE A;  3TAN A;  1WLJ A;  1FKO A;  3AVK A;  4G1Q A;  1ZBL A;  1NOZ A;  1KFD A;  1EXQ A;  4CK3 A;  4E89 A;  2G8F A;  3SQ2 A;  5JS2 A;  4E7J A;  2IOC A;  2VG6 A;  3LAM A;  1RCH A;  1ZBU A;  5DK5 A;  3U3G A;  4M45 A;  4AH9 A;  3AVN A;  4CGH A;  1ZBF A;  4OPJ A;  4BE0 A;  4E7K A;  1SKW A;  2O4I A;  3K5L A;  4I7F A;  3OYC A;  3PUF A;  2F96 A;  1S9E A;  4KI4 A;  1TAU A;  2IAJ A;  1K6Y A;  4BAC A;  4C8O A;  4Z4C A;  2G8K A;  1J54 A;  1F21 A;  5KRT A;  3DLB A;  5HRN A;  4O44 A;  5J1E A;  2HVH A;  1LWE A;  3BGR A;  4W5N A;  3T3F A;  1SL0 A;  2ZQB A;  4FJ5 A;  2IC3 A;  4RW8 A;  2E6M A;  2O4G A;  3OYM A;  3HXM A;  3LP0 A;  1Z26 A;  1JLB A;  1SL2 A;  3AVL A;  5CY4 A;  4AHV A;  1SL1 A;  3HK2 A;  3QER A;  2XRI A;  2D5R A;  1JLQ A;  4CK2 A;  1XWL A;  3LAK A;  1RDA A;  5HRP A;  3CG7 A;  1QHT A;  1TGO A;  3ZT1 A;  3ZSO A;  3VQ8 A;  2B6A A;  1LW0 A;  5CYM A;  4DTM A;  1CZB A;  3RMC A;  1Q9X A;  4FZZ A;  2GUI A;  3LP3 A;  3AVA A;  3MEG A;  4HTU A;  3HPO A;  4J2A A;  1UOC A;  1JXB A;  4HUF A;  3TAM A;  4FJJ A;  3LWM A;  3ZSV A;  1C1B A;  3CFR A;  1KTQ A;  3EZ5 A;  1TVR A;  3AVC A;  4CEF A;  3S9H A;  1QSL A;  3OYF A;  3QNN A;  1RBS A;  4NCG A;  3DLE A;  4CEA A;  1HYZ A;  3I0S A;  3UIQ A;  4M3X A;  2Z1I A;  1NKE A;  2E6L A;  3DLK A;  2B4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...