1ZBUA

Crystal structure of full-length 3'-exonuclease
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
225
structure length
225
Chain Sequence
b'SYYDYICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYVRPEINTQLSDFCISLTGITQDQVDRADTFPQVLKKVIDLMKLKELGTKYKYSLLTDGSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPHCGLDDSKNIARIAVRMLQDGCELRINEKMHAGQLMSVSSSLPIEGTPPPQMPHFRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3'-5' exonuclease ERI1
molecule tags Hydrolase
source organism Homo sapiens
publication title Structural basis for 3'-end specific recognition of histone mRNA stem-loop by 3'-exonuclease, a human nuclease that also targets siRNA
rcsb
total genus 62
structure length 225
sequence length 225
chains with identical sequence B, C, D
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
A PF02037 SAP SAP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1zbuA01
4F4KA 3V1RA 1VSDA 1ASVA 3K59A 2P1JA 2VG5A 4AHRA 4CERA 1J54A 3WNEA 3QNOA 3VA0A 1NK9A 1WSGA 4DTJA 4FLVA 1S9EA 1JL2A 2BANA 4KI6A 3M8SA 3SI6A 3SJJA 1IKVA 4JS5A 4F2RA 4DLEA 3M8QA 2D0AA 3ZT2A 4CGJA 1T8EA 4FJ9A 4DQRA 2RF2A 2QKBA 3MECA 3SV4A 3QIOA 4NCAA 1U47A 4CJEA 4B08A 3SV3A 4F3OA 4OPKA 3OYHA 3AA2A 2RKIA 1HNVA 4DS5A 1ZBLA 2P51A 4ELVA 3HYFA 1TAUA 4MFBA 4B9TA 4W5TA 1UA0A 4H8KA 4DU4A 1L3UA 1RILA 2F8SA 4E7IA 4DQQA 2GUIA 4HCCA 4C8KA 4EP5A 1U48A 2FBVA 1GOBA 3IG1A 2OPQA 4CJQA 4XIUA 1TK8A 1Q9YA 1GOAA 2FBXA 4KTZA 4CJLA 3SUNA 4CIEA 4CHNA 1X9MA 1S1XA 4DTRA 2G8IA 1BQNA 4CK2A 1T7PA 3VQ6A 3U6FA 3OYIA 1X9WA 1W9HA 4B9SA 4FJNA 3HM9A 1ZBIA 3ZSQA 4K8XA 3LWMA 1LW0A 1RTIA 3VQ9A 1NJZA 3KTQA 1S1WA 3NGZA 2P5GA 4FLZA 4KB1A 4N76A 2HHWA 1RT3A 2Y1JA 1SL0A 2E6MA 4OKJA 3OYCA 3KK3A 3O3GA 4KHWA 3OYNA 2QKKA 1LWCA 1U45A 4ZTFA 4ID5A 1NK4A 5HP1A 3NCIA 1FK9A 4CJVA 1VSFA 1JLAA 4C8MA 2G8KA 1RDCA 4PA1A 3PV8A 2OZSA 4FM1A 3OVNA 4FJXA 3RRHA 1D8YA 1LAWA 3ZSYA 4CE9A 4CJUA 3K57A 3RWUA 5J2PA 3V4IA 2D0BA 4HHTA 3CG7A 2VWJA 3DLHA 4Z4FA 1Q8IA 4CGFA 1G15A 5J2QA 4Y1DA 2YKNA 3LAMA 4LY7A 4M45A 3A2FA 5HRRA 4CJWA 1K6YA 3H08A 3S3OA 3HO1A 5KGXA 4H4MA 3KLGA 1VSHA 3L8BA 1MU2A 2BE2A 3AA5X 5CZ1A 1ZBUA 3QEXA 4I9LA 4MQ3A 1KSPA 5CY4A 2JGUA 4E7JA 2OPPA 3VQ5A 3ZSXA 1UA1A 4F3TA 5K14A 2G8UA 2HNZA 2Z1HA 2ZE2A 3O4NA 2PY5A 1WSIA 4IG0A 3V9SA 1LWEA 5I3UA 3TARA 1SV5A 4L8RB 4RW7A 4RW8A 1XHXA 4IBNA 3LPTA 3DMJA 5I42A 1C1BA 4FW1A 4H4OA 1RDDA 1NK7A 1L3VA 4KHSA 4DTNA 3DLKA 3AVMA 1NOYA 2HHTA 3PO5A 4BWJA 2HHUA 4E7HA 1CZBA 1NKEA 3G10A 1FKPA 4DF4A 3SUQA 3TANA 4FJMA 1TV6A 1TGOA 2IDOA 3TAMA 3OJUA 1IKWA 4FJHA 2KQ2A 4OKEA 4CHOA 3AA4A 3FFIA 4WE1A 3DLBA 3SQ4A 3SCXA 3OYAA 1BI4B 4HVJA 4DU3A 2XY7A 1NK8A 3IS9A 3LPUA 3VQ4A 3QO9A 4GW6A 4FJJA 4DFJA 1N5YA 5SZTA 1DTQA 3ZSZA 4N41A 3TAFA 4OLAA 4BDYA 1S6QA 1EX4A 3NE6A 1KLMA 1JLCA 1QE1A 4DFPA 4FJKA 2VG6A 4O5BA 1XI1A 3CQ8A 3NFAA 3NF7A 3NGIA 3AVHA 2W42A 1BL3A 4E1MA 1IO2A 4LSNA 4W5NA 3MAQA 4CIFA 3M8RA 3S3NA 3MXJA 3U3YA 4KHQA 1UOCA 4M3TA 1EKEA 4CHPA 1BISA 1QHTA 3NH2A 1N6QA 2I5JA 1BI4A 4CHYA 2YNIA 2E6LA 4RW6A 3ZCMA 4E19A 1BGXT 3K5NA 3ULDA 2RPIA 3AVKA 3SUOA 4K8ZA 4DU1A 4QCLA 3AO5A 3AVFA 3HL8A 3RMCA 4FXDA 2QXFA 4J2DA 1A5WA 2F96A 3TR8A 3OYMA 1NJYA 4KB0A 3AVIA 5HRSA 4J2AA 1UWBA 1VSKA 3I0SA 2O4IA 3L2UA 1RBRA 1RT6A 5HLFA 5KRTA 2F8TA 3KK2A 1WSJA 3QEWA 3DOLA 4FZXC 4CJPA 4IFVA 1RBTA 3OYGA 2O4GA 3P1GA 3OS1A 4DSEA 4DTXA 1D9FA 3KD1E 2DFFA 3HP6A 1RT2A 2XY8A 5DK5A 1WLJA 4J2BA 3AVNA 3V9WA 1KCFA 4RW9A 4CESA 5FDLA 5HRNA 3SZ2A 4Y1CA 1IKXA 3B6OA 2IS3A 4C8NA 4M42A 3F73A 5D3GA 2HHQA 5FRMA 5J2MA 1SKWA 1NK6A 4Z4GA 4CF8A 2IC3A 1D9DA 1KVBA 4O55A 3SQ0A 3QEVA 1LAVA 4CF2A 3SYZA 3JYTA 4IKFA 4KREA 3K58A 1L3SA 5HBMA 2Q3SA 1GOCA 2XRIA 4DTMA 1QTMA 2HNDA 4DQPA 4YNQA 1RT5A 1HQEA 2OPSA 3CFRA 3PY8A 1EETA 3M8PA 4F8RA 3ISNC 3ZSVA 2G8WA 1QS4A 3L3VA 4BWMA 2RN2A 1F21A 2X6SA 2P5OA 3DOKA 2KTQA 4NCGA 3HXMA 3VQPA 2KFZA 3HVTA 3QETA 2HMIA 1VRUA 3L2QA 3HT3A 1IG9A 1TKXA 1VRTA 1CXQA 1WSFA 2YNGA 4CEFA 3OYJA 4FZZA 1BIZA 3CFPA 4G1QA 4KFBA 3EZ5A 4DSFA 3T1AA 1WAFA 3VQ7A 5C25A 4OGCA 1NJWA 2BGGA 2YNHA 1B9DA 4IG3A 3TAQA 5JS1A 4FW2A 4GMJB 4DFKA 3TAGA 3L3UA 1Z26A 4CJ5A 3HPGA 1D5AA 4DMNA 2HNYA 3TAEA 3AVGA 3CM6A 3PUFA 4KTWA 5DMRA 1RNHA 1VSJA 2LSNA 2IAJA 1DTTA 3JSMA 1IH7A 4CF0A 3AO4A 3U3GA 4HUGA 4F2SA 1HYZA 1KTQA 1O1WA 3QINA 1SL1A 4HCBA 1U4BA 1I39A 4EP4A 1FXXA 3K5OA 1SKRA 4FM0A 4O4GA 1RTDA 1BCOA 1I3AA 1JXBA 3C6TA 2YNFA 1J9AA 3OYFA 2OPRA 3AO2A 3IRXA 4CJRA 3KKRA 2WOMA 2EHGA 4C8LA 2GBZA 4KPYA 4M3RA 4Z0UA 4LH5A 1TL3A 3EYZA 1J5OA 3HK2A 3I8DA 4GVMA 3OYEA 3KLFA 3D0PA 2IOCA 3VN5A 3ZSOA 3VQDA 4B8AB 3ZT1A 4Q5VA 1SUQA 2R7YA 4E7LA 2DTUA 4CEQA 4W5OA 4AHCA 4CJKA 2D0CA 3DRRA 3QIPA 1WSHA 2E4LA 4KTQA 2HVIA 3QERA 5KTQA 2OZMA 4FK4A 4DQIA 3S3MA 1JLFA 3OYLA 1JLQA 1CLQA 2HHVA 4N5SA 3KJVA 4IFYA 2KW4A 2GV9A 3KLHA 4FLXA 1TAQA 2X6NA 5J2NA 1B9FA 4NCBA 4B3OA 3PO4A 4HTUA 3K2PA 1RT4A 2Z1GA 3CFOA 3NDKA 4M3ZA 3KLIA 4CEBA 3VQCA 3OS2A 5FROA 4M3YA 3QEIA 1KVCA 4DG1A 4LD0A 4FJGA 4PWDA 4AHTA 1C0UA 2WONA 4LH4A 3SPZA 2NUBA 2PYJA 1VSLA 4YFUA 4E1NA 4EZ6A 4PUOA 1EP4A 2ZD1A 4CGGA 4DQSA 3V6DA 1RBSA 3DRSA 4FJ8A 3DLRA 1TK5A 4OLBA 4DFMA 4CF1A 1C6VA 1L3TA 5J1EA 4ID1A 3E01A 4CJFA 1YVUA 4DLGA 1Z25A 4OGEA 4W5QA 4HUFA 4CEZA 5C42A 4FLWA 3ZT4A 1WSEA 5T7BA 4W5RA 2XY6A 4FLTA 3C6UA 1TKDA 1QSLA 3TWHA 1RTHA 3CYMA 5FRNA 1CZ9A 3NF8A 4FK2A 1RDBA 3ALYA 3MEEA 4M41A 4BE2A 3HJFA 5SWMA 1XHZA 4ZHRA 1U49A 1ITGA 2YKMA 4EZ9A 5HRPA 4CFBA 4FK0A 1NJXA 1S5JA 2G8VA 4IDKA 4CEDA 1ASUA 3PX4A 2KZMA 1KVAA 4AHUA 3AVJA 2OYQA 2JLEA 1DLOA 2G8HA 1X1PA 3ITHA 3AO3A 1T05A 4KRFA 3MEDA 4BE0A 2PZSA 4Z4EA 5CYMA 2KFNA 1SL2A 2FC0A 3QEPA 3RMDA 3L2RA 1KFDA 5KI6A 1KLNA 4DTPA 4JS4A 3HPHA 3L2WA 3K5LA 4B8CA 1HNIA 3TI0A 3TAPA 2XY5A 3DI6A 4JRQA 1NK5A 4PY5A 1RTJA 3KLEA 2B4JA 4B9LA 3SUPA 3NHGA 2DFEA 5KRSA 3MXMA 2ATQA 2HB5A 1JLEA 3AVBA 3DRPA 4QOZB 1T03A 1HRHA 4FLUA 3LP0A 3RTVA 3P5JA 4N47A 4CJSA 2DY4A 4FCYA 2Y1IA 5EU7A 2X74A 1UAXA 2A1SA 4FLYA 4M3XA 3LAKA 3SNNA 3LP3A 3ZSRA 1RT7A 4FM2A 1S1VA 1TKTA 3OJSA 1R0AA 1REVA 2HW3A 1RBVA 4JRPA 1W0HA 4UQGA 4FJ5A 3AVAA 4E7KA 1A5XA 4NYNA 4I9QA 1X9SA 4LSLA 5KGWA 4FJ7A 4OKKA 1JXEA 4B9UA 3C95A 4FJIA 3ZT3A 1HMVA 4HUEA 3NH1A 1CXUA 4CGDA 4ICLA 4DSKA 4Z4IA 2ZQBA 1HYVA 1QQCA 3V1QA 1XC9A 4BACA 3NGYA 1J53A 2KZZA 3LALA 4O44A 4TSXA 1TVRA 2YHAA 1C1AA 1WNSA 1BIUA 5CYQA 4DSLA 1L5UA 4DTSA 3AA3A 4CIGA 1LWFA 3THVA 4KO0A 3IAYA 5JS2A 4DSIA 2AJQA 2YV0X 4FYDA 4C8OA 3WNGA 2VG7A 1VSEA 4BDPA 4BDZA 1C0MA 4AHVA 3LP1A 3T3FA 1HJRA 4CJTA 1TK0A 1VSIA 4I7FA 1S6PA 4CJ3A 4FZYA 3SPYA 4KHYA 3SQ1A 3BGRA 4RW4A 2IGIA 4QAGA 4Q0BA 3NF6A 4CEOA 4O0IA 3F9KA 2G8FA 4J2EA 3OYDA 4Z4HA 1B92A 4KHNA 1BHLA 2ITGA 1NKCA 4CECA 3LDSA 1RCHA 3K5MA 1RBUA 4CFCA 4B9NA 1HYSA 2HVHA 1XWLA 1WAJA 4E0DA 3HP9A 2D5RA 1Y97A 3LWLA 3VA3A 4Z4CA 4ELUA 3DLEA 4M3WA 4NYFA 3KIOA 3RR8A 2DFHA 3RR7A 1JLGA 5CZ2A 1Q9XA 4KI4A 4CK3A 4KV8A 1YT3A 3G0ZA 2BDPA 1RT1A 4N56A 3UIQA 1JLBA 3OS0A 3VQEA 3QESA 5HROA 1BCMA 2A1RA 3RRGA 3AVCA 1RDAA 1IKYA 3B6PA 4CHQA 3V1OA 3WNFA 4JLHA 5E41A 4E89A 3OYBA 4FJLA 1ZYQA 2XO7A 3OY9A 3O3HA 4PQUA 3MEGA 3D45A 3NAEA 2HHSA 4CFAA 1ZBFA 2X78A 3KD5E 4OPJA 3RMBA 1LW2A 4BE1A 5C24A 4DWIA 1ZBHA 4ELTA 1VSMA 3HPOA 3QNNA 1BQMA 4CFDA 4B9MA 1HQUA 3HVRA 2HHXA 1VK0A 2B5JA 2Z1IA 4DTOA 1A5VA 4FVMA 2VWKA 4OVLA 3OYKA 3SQ2A 1NK0A 2YHBA 2FBYA 3MXIA 3BDPA 3RMAA 1TKZA 3AO1A 4RG8A 4CJ4A 1ASWA 1C0TA 1QSYA 4E3SA 4CGIA 3AV9A 3PX0A 4O0JA 4CEEA 3V9XA 3DLGA 1U04A 3NBPA 3LZJA 3CM5A 3V9UA 3P83D 4OJRA 4M3UA 4CCHA 4CK1A 1S9GA 3LZIA 4KHUA 4CEAA 4DF8A 1NKBA 3HSTB 1FKOA 3QLHA 3VQAA 3VQQA 3ZSWA 3NH0A 2EX3A 2FBTA 3PX6A 2PYLA 4AHSA 2OA8A 3T19A 3TABA 1C1CA 1LV5A 1EXQA 3VQBA 1YTAA 4R5PA 1WN7A 2XHBA 4CGHA 1JL1A 3EY1A 3ZT0A 1KFSA 1S1UA 1YTUA 3AVLA 2Z1JA 3V81A 1HPZA 1SKSA 3S9HA 1QSSA 1NOZA 2B6AA 3KK1A 1KRPA 3ASMA 1TL1A 1JKHA 3LP2A 2ETJA 3LANA 4KKOA 4B9VA 4ZTJA 3DYAA 3O4QA 4DSJA 3C94A 4KAZA 4I2PA 4CF9A 3NF9A 4AH9A 4DTUA 3WNHA 3KKSA 4CHZA 3VQ8A 2QK9A 3DM2A 4AILC 3V9ZA 4I2QA 3L2VA 3O3FA 3I0RA 1S1TA 4DS4A
chains in the Genus database with same CATH superfamily
2P9PB 2A42A 1P8ZA 3CERA 3UKUB 4NXNK 4DTJA 1S9EA 1IKVA 1JCFA 3ZT2A 1T8EA 3VEVA 4DQRA 2QKBA 1VQPN 2QWPA 4NCAA 4MDBA 1OH7A 3SV3A 4F3OA 2QWNA 3GDQA 3AA2A 4BRFA 2F7TA 4B9TA 1YF5L 5EXWA 3GE1A 4E7IA 4DQQA 4C8KA 1U6ZA 1GOBA 4IO9L 4A2BA 3E9LA 1OVQA 1S1XA 1RDUA 3U6FA 3VMFB 1W9HA 4YORA 3AAPA 3HM9A 3ZSQA 4K8XA 4LF9K 2H3GX 5C0YA 1RTIA 3KTQA 3SAHA 1S1WA 3AARA 2P5GA 4FLZA 4AF1A 4L3QA 4XEIA 5DM7L 5BN9A 3O3GA 3OYNA 2QKKA 4PA1A 3RRHA 1LAWA 3ZSYA 4CE9A 1MA9B 5AJ3K 5J2PA 3CG7A 3DLHA 1MWMA 1Q8IA 4BQZA 1G15A 2AP1A 4Y1DA 4LY7A 1K6YA 3O9RA 5AQUA 4H4MA 1VSHA 3BF3A 2OPPA 1UA1A 1OH6A 2Z1HA 5LJVA 4DQ8A 4IG0A 3V9SA 1LWEA 4OPHA 3J80O 3UB5A 2E5LK 4IBNA 1C1BA 3HTVA 3O9QA 4H4OA 1IG8A 1NJIO 1XNQK 5AQIA 4A59A 4BR5A 1NOYA 3H6EA 3J7ZO 4Z94A 1NGFA 3W3DA 1FKPA 2QWMA 2HW3A 3TAMA 3FLCO 4CHOA 3FFIA 3VQ4A 3QO9A 3FFKB 3H3OB 3ZSZA 4A5BA 1QZ6A 5JVHL 1S22A 4FPAA 2F9TA 4BDYA 1JLCA 3HRGA 4WFNL 4FJKA 1XI1A 3NFAA 4X66K 3E9OA 4LSNA 3CJCA 3MXJA 3ZETA 1BA1A 1QQOA 1QHTA 4CHPA 1GLCG 1N6QA 5AZJB 4RW6A 2YJFA 3K5NA 4JD2B 3HL8A 3OYMA 3EKUA 3AVIA 3QICA 1UWBA 3I0SA 4DR4K 2O4GA 3P1GA 3SAGA 2KKZA 1D9FA 2DFFA 3KD1E 4CZGA 3AVNA 4PKGA 4BG9A 5FDLA 4C8NA 5D3GA 2HHQA 1SKWA 4CBUA 4CF8A 4FWMA 1KVBA 4O55A 1OH5A 5AQPA 3QB0A 4B3SK 4RTFD 3SYZA 4IKFA 5AQWA 3K58A 3BP8A 2QXLA 4BRDA 4DQPA 1HQEA 1Z05A 3C65A 2X6SA 5C2FA 3HXMA 1SS6A 1NGCA 2FXUA 3HT3A 4A2AA 4FZZA 4M63C 5EX5A 1WAFA 4ILGB 4CJ7A 5C25A 4OGCA 1B9DA 3O5BA 4DFKA 3L3UA 1Z26A 4CJ5A 3HPGA 4DMNA 3CM6A 4KTWA 5DMRA 2A40A 1IH7A 5AQLA 4F2SA 4BRAA 1O1WA 5AQZA 1I39A 3VF6A 1Q86O 1SKRA 1BCOA 1I3AA 4B1VA 1J9AA 3AO2A 5GINA 1ILYA 4KPYA 2E2NA 3HK2A 2HMPA 3OYEA 3D0PA 2R7YA 2DTUA 4FOEA 2VWBA 4AHCA 1NGBA 3A0IX 5M1NA 5BN8A 3IKMA 1C0GA 4O5FA 1CLQA 3AGRA 2E2PA 5GAEP 3UKUA 4LF7K 4CZJA 1TAQA 2P9LB 2NRRA 2Z1GA 3CFOA 3NDKA 4CEBA 4NB4A 5LL6Z 3KVGA 2ASOA 1SAZA 5AFUH 1C0UA 4OX9K 2NUBA 1T44A 3V6DA 4FJ8A 3DLRA 1TK5A 4DFMA 4CF1A 1L3TA 3E01A 2OCEA 3QMLA 1XC3A 4HUFA 1NGHA 2XY6A 1QSLA 5BRHA 1N34K 1RTHA 3RVCA 1CZ9A 2E88A 4FK2A 4MO5A 1IBMK 1XHZA 4ZHRA 4EZ9A 2UUCK 1WBDA 1S5JA 3PX4A 2KZMA 3KWGA 1T05A 3MEDA 4BE0A 5I9EB 2UXCK 1SL2A 2NRTA 1W97L 4FL9A 1QZ5A 3TI0A 2XY5A 4PY5A 3NHGA 1JLEA 1HRHA 2WUSA 3J81O 4FLUA 3RTVA 1NGDA 4DR6K 2A1SA 4NXMK 3SNNA 3PLAA 2YCHA 4FM2A 2CGLA 3FE1A 4JRPA 3E66A 3FZMA 1X9SA 3ZEUA 2OTJN 3ZT3A 4X65K 1CXUA 4CGDA 3VEWA 1HYVA 2ZJQL 3V1QA 5BPLA 3L4QA 2KZZA 5E26A 1O13A 4FPBA 4KBOA 3KZBA 1WNSA 1BIUA 4BVPA 4PHTX 2AA4A 2Q36A 4DTSA 1NNEA 3AA3A 4DUYK 4FYDA 4BDPA 4DCHA 4BRCA 1C0MA 3T3FA 1HJRA 1YXQA 1VSIA 4B1WB 3SPYA 4KHYA 3T69A 3C6HA 4BC2A 2IGIA 3PIPL 3AAQA 1X3NA 3NF6A 4O0IA 3CC7N 1B92A 4JI3K 2ITGA 2ZWHA 1NGAA 3VOVA 5AQSA 1KAYA 2D5RA 3CCLN 4JKAA 2P9KB 1DEJA 4O8UA 1X3MA 4BREA 2A1RA 2F9WA 3AVCA 3JS6A 1IKYA 3V1OA 2CGJA 5FPMA 3D45A 4CFAA 3HM8A 3W0LA 3KD5E 1V4TA 3RMBA 1VQLN 1ZBHA 3HPOA 3R3LA 1XMOK 3HVRA 4FVMA 4RCHA 4OVLA 1YVNA 5AQTA 3MXIA 1Q82O 3BDPA 2YI1A 2VQFK 1QSYA 2I7NA 4CGIA 3CI5A 3EKSA 5M1OA 2D4WA 3V9XA 3DLGA 1BDGA 3C7NB 1GLEG 3P83D 4M3UA 4CCHA 2D1KA 1S9GA 5EVZA 3ZSWA 3NH0A 2FBTA 1G99A 2XHBA 3S41A 4BRLA 4CGHA 3ENHA 1JL1A 1KFSA 4AM7A 2Z1JA 2ASPA 4PL7A 1SKSA 3LANA 4BG8A 4I2PA 5EY4A 4CD3A 3WNHA 2O8BB 2KHOA 4ISGA 3WEEA 3DM2A 2QK9A 4I2QA 3G25A 2HOEA 5LY3A 3I56N 4DS4A 4M7YA 3V1RA 3PSFA 3Q7BA 3K59A 1Q9YA 1J54A 3VA0A 4FLVA 4H5VA 1JL2A 3L4IA 3WXKA 4KI6A 3M8SA 4U67L 5JLFA 4F2RA 3M8QA 3VGMA 3SV4A 1U47A 4CJEA 3ENOA 2CH6A 4B08A 2Q1NA 3ZEUB 5BRFA 1TAUA 3BZKA 3T1YK 4MFBA 4JI4K 1BG3A 5F2RA 1UA0A 4YOWA 1FJGK 1RILA 1S72N 4BQLA 1TK8A 3PSIA 1KXPA 4CJQA 5HL7L 2FBXA 3GL1A 4KTZA 3SUNA 4CIEA 1KQSM 5AR0A 3G71N 1T7PA 3OYIA 1X9WA 1ZBIA 3WXMB 4MO4A 1QQNA 1NJZA 3VENA 3A5OC 3NGZA 4KB1A 2HHWA 4N76A 4JEPA 1RT3A 3CJBA 4K41A 1SL0A 4OKJA 1LWCA 4ID5A 3NCIA 2GWJA 2G8KA 1RDCA 3PV8A 3OBYA 3FR0A 4IDHA 2FSKA 4H0TB 3JAMO 3EN9A 3K57A 4CJUA 3RWUA 4HHTA 4Z4FA 2P9IA 2QEXN 4B3TK 3ID8A 5J2QA 3EO3A 4WQ4C 3LAMA 3S3OA 3QEXA 1MU2A 4MQ3A 1KAXA 4E7JA 3VQ5A 3THXA 3VESA 4JKEA 2HNZA 4YOYA 1HUXA 5AQVA 1WSIA 5I3UA 3TARA 1V4SA 3LPTA 3DMJA 4FW1A 4KHSA 1VQ8N 4H0OA 3AVMA 3PO5A 4BWJA 3G10A 3TANA 1TV6A 1BUPA 3AA4A 4OO1J 3GBTA 3IS9A 4DV5K 1Q81O 3J8AA 3E1YA 4FJJA 3DXMA 1N5YA 3L6QA 4H5TA 2IIRA 3CCEN 1QE1A 4H0VB 2VG6A 4O5BA 5JMVA 2CH5A 3NF7A 3AVHA 4E1MA 1N32K 1IO2A 4W5NA 2GUPA 3S3NA 1QQMA 4CZLA 3KWIA 3BZCA 3NH2A 3FGUA 4CHYA 2E6LA 3CCMN 3ZCMA 4GV6A 2RPIA 4K8ZA 4QCLA 3AO5A 5CHIA 1I94K 4FXDA 2WTUA 4DV6K 3THWA 1C0FA 4J2AA 1K9MO 1RBRA 5HLFA 3UKRB 2QI2A 2F8TA 4JKDA 1NGJA 3BY5A 3AY9A 3D7EO 3OYGA 4DR2K 4K42A 3HP6A 1RT2A 2WFBA 2XY8A 1WLJA 4IOCL 2V7ZA 3MDQA 5HRNA 1NGIA 4I6MB 1T6CA 1NK6A 1YIJN 4JD2A 3QEVA 1LAVA 3JYTA 4KREA 4FOIA 5HBMA 1MWKA 1GOCA 3THWB 4LFBK 1QTMA 2HNDA 4YNQA 1RT5A 5H1SQ 1EETA 1Y64A 3M8PA 1X9JA 3I33A 1VQNN 2G8WA 4E1JA 1QS4A 3L3VA 2RN2A 3DOKA 1NLVA 3TSPA 3VQPA 2KFZA 1DKGD 3L2QA 3CPWM 1TKXA 4G9ZA 1WSFA 4JNEA 2YNGA 4EAHD 3DAWA 4KFBA 3EZ5A 3T1AA 2P9UB 3P31A 4DV3K 5JS1A 3A5MC 2VQEK 4GMJB 3TAGA 3AVGA 1RGIA 3JSMA 1DTTA 4H0XB 3AO4A 4WQ4A 1OKJA 3D6RA 3QINA 1SL1A 1U4BA 4EP4A 3K5OA 3CHWA 4FM0A 5AQGA 2HHHK 4KHPK 4WYBA 2YNFA 4KH6A 3LDQA 2OPRA 2EHGA 2HBMA 2WOMA 2GBZA 2E8AA 4M3RA 4Z0UA 3CJ1A 1TL3A 3EYZA 1J5OA 4DUZK 4CBWA 2IOCA 3ZSOA 4Q5VA 1SUQA 1E4GT 5AQJA 3DRRA 3QIPA 1WSHA 4KTQA 5KTQA 4FVUA 4LF5K 3OYLA 2UU9K 5FLXO 4DV2K 1ATRA 3CQXA 4FLXA 4EFHA 1BU6O 1NG9A 4JAXA 4B3RK 2KLAA 4M3ZA 1IJJA 5FROA 4DG1A 4PWDA 4AHTA 1XNRK 2WONA 4LH4A 3SPZA 4CGGA 4DQSA 2W6KA 3DRSA 5F0XA 2E2OA 4ID1A 4CJFA 5BR8K 1Z25A 4OGEA 4FLWA 5C42A 5T7BA 1XQSC 3LM2A 4FLTA 3H45C 3C6UA 1TKDA 3CC4N 2P9PA 3HJFA 1VQ4N 1U49A 1ITGA 2YKMA 4CFBA 3UE5A 1NJXA 2G8VA 4IDKA 5AQFA 2BH1A 4CI6A 2ITMA 2G8HA 3ITHA 2PZSA 5CYMA 4EHUA 1KLNA 4DTPA 3L2WA 4B8CA 1HNIA 3TAPA 4JRQA 4R79A 2V7YA 4B9LA 3SUPA 3HOSA 5KRSA 4DV7K 4XH4A 4YDUC 4PKIA 4QOZB 3L0QA 3C0BA 3P5JA 5KPRA 1NMDA 2HF3A 4N47A 4BR0A 2DY4A 4FCYA 4M3XA 4B9QA 3VEZA 1S1VA 3OJSA 1REVA 2E1YA 4UQGA 4EHTA 3AVAA 1HLUA 3BF1A 4I9QA 1ZBSA 4FJ7A 4OKKA 1JXEA 4JKGA 3C95A 4FJIA 3SBTA 1HMVA 3M1FA 4DSKA 4ICLA 3M6GA 3CXCM 2ZQBA 1J53A 4TSXA 3LALA 1TVRA 4YOTA 2O8CA 1C1AA 3QBXA 4BY9C 2GX9A 4JI7K 4CIGA 4DSIA 2ZJPL 3J7YP 1JJ2M 1VSEA 4AHVA 2NRWA 3R8EA 4CJTA 2QWQA 3BGRA 3T1HK 5C15A 4RW4A 4C23A 3QBWA 4Z4HA 5M1FA 2HVHA 4CECA 1HYSA 1KC8O 4B9NA 1Y97A 3LWLA 1VQ9N 4M3WA 3RR8A 3RR7A 5CZ2A 1Q9XA 2HF4A 2JWLA 4CK3A 1YT3A 3M5RA 4DKWA 2BDPA 3UIQA 4N56A 3OS0A 2YHYA 4FJLA 3WNFA 5E41A 3N4QA 1ZYQA 4WFBL 3OY9A 4PQUA 5M1KA 1VQON 1NGEA 4JK8A 3SAFA 4BE1A 4ISFA 2ZF5O 3QNNA 1BQMA 1WBBA 2HHXA 3OYKA 2VWKA 2YHBA 2VGNA 4DR3K 1C0TA 3NBPA 3LZJA 1GLBG 3CM5A 2HBKA 3G4SN 4CK1A 4EIAA 3LZIA 1S3XA 4DF8A 4GV9A 3VQAA 3QLHA 5C2DA 3QDKA 4AHSA 1HNXK 1U2VB 3VQBA 1YTAA 3IMXA 3UKRA 4BR2A 3AVLA 1LCUA 3V81A 4QS7A 3WXJA 1HPZA 3SLCA 3S9HA 1NOZA 2B6AA 3KK1A 3LP2A 1JKHA 5M1QA 3NF9A 4DTUA 4U7BA 1P90A 5LMUK 1VQKN 2QWRA 3L2VA 3O3FA 3VTIA 4B1UB 1VAZA 1VSDA 2P1JA 2VG5A 4A57A 3QNOA 3H3NO 1NK9A 1WSGA 2BANA 3DLLL 3SJJA 4DLEA 1K8KA 4MLEA 2D0AA 4CGJA 3CCJN 4UY8O 3SMSA 3QIOA 3DWLA 4BVOA 1EQYA 3HOTA 4JKGB 3SMPA 4DS5A 1ZBLA 3B8AX 3HYFA 3CCSN 4NLBA 2P9SA 4IJAA 4H8KA 1L3UA 2F8SA 1T6DA 3SJHA 1W7AA 1GLFO 4XIUA 2OPQA 4CJLA 4BR9A 1VHXA 4CHNA 3CCUN 3FZFA 1BQNA 3K9JA 4CK2A 3VQ6A 4WF9L 3H46O 2P9NB 5AQOA 3EE9A 4FJNA 3O8MA 4B3MK 1K8KB 3LWMA 3GOIA 3E9PA 1LW0A 3VQ9A 4JI5K 4K43A 3O1WA 3CMAN 1QVGM 2Y1JA 2E6MA 4JK7A 3KK3A 1U45A 4ZTFA 5HP1A 1JLAA 3HBTA 5AQMA 4FM1A 2QWOA 2BUPA 4FO0A 2D0BA 2PAVA 2VWJA 3O80A 4CGFA 3K9KA 3QFUA 2Q97A 2YKNA 4PKHA 3HO1A 5HRRA 5KGXA 3L8BA 3ULEB 3KLGA 2BE2A 3AA5X 1QHAA 5CZ1A 3ZX3A 3EEQA 2JGUA 3DXKB 4F3TA 2ZE2A 4YOVA 4A62A 2HBLA 2P9LA 4L8RB 4RW7A 4BRKA 3VERA 5I42A 1L3VA 1RDDA 1W2BM 2NLXA 2HHTA 2HHUA 1Z6RA 3ZX2A 1CZBA 1NKEA 4FJMA 3OJUA 1IKWA 2KQ2A 4OKEA 3Q7CA 3WEEB 3SQ4A 3OYAA 1BI4B 3HSCA 4DU3A 1NK8A 4HWIA 4WQ5C 4GW6A 2QW9A 4LFAK 5SZTA 3OBWA 4FWLA 1DTQA 4JKFA 4GKKK 4J8FA 4IEIA 3TAFA 2O8FA 1S6QA 1EX4A 1KLMA 4FWRA 4DFPA 4DB3A 5MLCQ 3CQ8A 3JXUA 1HR0K 3MN5A 5HOOA 4GV3A 1BL3A 1R59O 3MAQA 5FPNA 2OTLN 3VGKA 3FZHA 2FLOA 1EKEA 2PBDA 5LMNK 1GLJO 5IWAK 1YJWN 2I5JA 4E19A 1BGXT 3ULDA 1N36K 3AVKA 4DU1A 1TYQB 1NJYA 3TR8A 4KB0A 5HRSA 3CIPA 3PIOL 1VSKA 4H5RA 2O4IA 4Y0WA 4BRNA 3L2UA 3DOLA 3O08A 4CJPA 4IFVA 1RBTA 3TU5A 4DSEA 3TSQA 4LC9B 1YHQN 4RW9A 3SZ2A 4Y1CA 3B6OA 2QWLA 3F73A 5FRMA 4Z4GA 5F1XA 2IC3A 3SQ0A 4CF2A 4FWOA 4IJNA 2Q3SA 3LDNA 5EOYA 4DTMA 3NVKA 2E2QA 3MMVA 3OHRA 3PY8A 3ISNC 2UXDK 5KPZA 2ZGZA 3MWPA 4BWMA 5AQXA 5AZIA 2KTQA 1VRUA 2RHKA 1IG9A 4HTLA 4CEFA 3ZX0A 1Q18A 4CZHA 1BIZA 3D2EB 4G1QA 4X64K 1T3VA 1NJWA 2BGGA 2YNHA 3TAQA 4IG3A 4FW2A 1D5AA 1N8RO 3PUFA 1VSJA 2IAJA 1K73O 4HUGA 1HYZA 1KTQA 3C6AA 4CVNE 1RDWX 4O4GA 3A5NC 4MLHA 4O8KA 3C6TA 1JXBA 4DR5K 3F2KA 3KK7A 5JVGL 3P39A 3EE8A 4LH5A 3I8DA 4GVMA 4YOUA 3O4WA 3KLFA 3VQDA 3ZT1A 4E7LA 3TPQA 4CEQA 4W5OA 3A8YA 4CJKA 3MN6A 4XH1A 3D2FA 2HVIA 1XMQK 4FK4A 2P9IB 4DQIA 3S3MA 5GADP 1JLQA 2IVNA 2HHVA 2J4RA 2KW4A 2P9NA 3ATVA 2X6NA 2NZTA 5ADXH 4NCBA 1BWFO 1NM1A 3PO4A 3K2PA 2ZGYA 1EWRA 4CZMA 3KLIA 5BREA 3OS2A 4M3YA 3QEIA 1KVCA 4B1YB 4IXCA 4LD0A 4FJGA 3OTOK 2PYJA 1VSLA 4JKHA 4E1NA 1EP4A 4NO7A 4OLBA 1CZAN 4B1XB 5J1EA 1YVUA 3VF2A 3VTHA 4W5QA 4CEZA 3ZT4A 4QS8A 5GAHP 3TWHA 4X62K 5FRNA 3NF8A 1RDBA 3ALYA 4M41A 5SWMA 4FSVA 4FK0A 3CQYA 2WBNA 2IVOA 2NRHA 1ASUA 1KVAA 3AVJA 4LF4K 4H5WA 2OYQA 3T7ZA 4Z4EA 1HX1A 4CW7B 2KFNA 3K0SA 4IO8A 1GLAG 3L2RA 1KFDA 3VEOA 2F4VK 5KI6A 3K5LA 1HKGA 1NK5A 3KLEA 2W6LA 3G6EN 1GLDG 2DFEA 3MXMA 2I7PA 2HB5A 3LDOA 5AQRA 3DRPA 1T03A 1M1KO 3LP0A 3BEXA 4JHDA 5AQYA 2OANA 2QA4N 4FLYA 3LAKA 4IEEA 4FWNA 1RT7A 5E84A 1TKTA 4CZKA 2RE2A 3CD6N 3VEXA 1MDUB 4H0PA 4E7KA 4NYNA 5KGWA 4HUEA 3NH1A 1IBKK 1XC9A 3MN9A 3NGYA 4BACA 3J7AP 4O44A 5CYQA 4JKBA 4DSLA 3MX5A 3THVA 3IAYA 2AJQA 2YV0X 4MDAA 3WNGA 2VG7A 2VGMA 5AQQA 4IZ9A 4PL8A 4YOXA 4JI6K 1TK0A 1J6ZA 4CJ3A 1S6PA 3WXLA 2FF6A 5AQHA 4CD1A 3GG4A 4CEOA 3F9KA 3LDLA 2G8FA 3TTCA 3OYDA 4FWKA 1VQMN 5CR4A 3LDSA 3CCVN 5GIOA 3K5MA 1RBUA 4CFCA 1VQ7N 1XWLA 3HP9A 2FSNA 3VA3A 4ELUA 3DLEA 5TKYA 3QFPA 3D2FB 3KIOA 4NYFA 2DFHA 1JLGA 1YITN 1JLBA 4BR7A 3QESA 3TSUA 5HROA 2HSTA 1RDAA 4JLHA 3RSEB 4AM6A 1NBWA 2YHWA 2UUAK 2HHSA 2V51B 3MCPA 1ZBFA 2X78A 4JI1K 5C24A 4ELTA 3U9DA 3ZLJA 2PFUA 1VK0A 2A41A 1NK0A 2GWKA 2FBYA 1DGKN 4JK9A 2VCPA 3R9PA 4CJ4A 1ASWA 3WUHA 4XH5A 3PX0A 4CEEA 3VGLA 1U04A 3C7NA 3V9UA 1BO5O 1KD1O 1FKOA 3VQQA 2EX3A 2PYLA 4YDUA 2OA8A 3TABA 1LV5A 4JKCA 1EXQA 3SBGA 3BUZB 1S1UA 2JWKA 4ILJA 3NMUA 1KRPA 4KKOA 1TL1A 2ETJA 4JI8K 4B9VA 3O6WA 4ZTJA 4KAZA 2P9SB 3N4PA 4AH9A 5A2QO 4JV5K 3KKSA 4CHZA 3VQ8A 3NVMA 2Q31A 1VQ5N 3I0RA 1S1TA 1HNZK 4DTRA 1J5EK 4F4KA 2A5XA 1ASVA 4AHRA 4CERA 5BRDA 3WNEA 3SI6A 4JS5A 3M3ZA 3LDPA 1OH8A 4FJ9A 1VQ6N 2RF2A 1HJOA 4YHHK 3MECA 1HKBA 4KH5A 1ATNA 5GAGP 5AFUA 3IFRA 3ZYYX 2BTFA 4OPKA 3OYHA 2RKIA 1HNVA 2P51A 4ELVA 4AQYK 1BOTO 4W5TA 4DU4A 4JI0K 1YI2N 2GUIA 5AZJA 4B1ZA 4HCCA 1QVFM 3CJ7A 4EP5A 2FBVA 5BR9A 1U48A 3IG1A 3MWTA 1GOAA 2HBJA 1X9MA 3WQTA 4A61A 4BR4A 2G8IA 2D0OA 4B9SA 4JYAK 5C12A 3AGKA 4RWTA 3OYCA 4KHWA 3THYB 4C1NK 1NK4A 1YJNN 1FK9A 4CJVA 1VSFA 4C8MA 2OZSA 1HPMA 2YHXA 3OVNA 4FJXA 1D8YA 2O8CB 3V4IA 3I8BA 4M45A 4CJWA 3A2FA 3H08A 4WQ5A 4LFCK 1ZBUA 4I9LA 1KSPA 2YX6A 5CY4A 3ZSXA 5K14A 2G8UA 1HKCA 3O4NA 2PY5A 2UYTA 1JCGA 1SV5A 4RW8A 1XHXA 1NK7A 4DTNA 2P9UA 4DV1K 4DR1K 3DLKA 4E7HA 2VYPA 1YAGA 2A6AA 1ESVA 4DF4A 1TGOA 2IDOA 3SUQA 4FJHA 2IVPA 3LL3A 4WE1A 3DLBA 1DT9A 3SCXA 4HVJA 3ULEA 2QM1A 2XY7A 3LPUA 4DFJA 4JHDB 1OVYA 4N41A 4OLAA 3NE6A 3HZ6A 3VETA 3CJ9A 4H5NA 4NLCA 5KQDA 3NGIA 2W42A 2D0PA 4F9OA 3WXIA 4BRIA 4CIFA 3M8RA 3U3YA 4KHQA 1UOCA 4M3TA 1BISA 3P38A 5ELZA 1BI4A 1NMNA 2YNIA 3LM9A 1WUAA 3CCRN 2Q2RA 5C10A 3SUOA 4DV4K 3AVFA 2E1ZA 3WT0A 3TTDA 4BRGA 4DHYA 3RMCA 2QXFA 3CC2N 4J2DA 1A5WA 2F96A 1RT6A 5KRTA 3KK2A 1WSJA 3QEWA 4FZXC 1EWQA 4BC5A 2NRZA 3OS1A 4DTXA 2NRXA 3H1VX 1SZ2A 5DK5A 3CCQN 4J2BA 3V9WA 1KCFA 4CESA 2WC9A 1WB9A 1IKXA 2IS3A 4M42A 1YUWA 2Q0RA 5J2MA 2V52B 2ZJRL 1WOQA 4K0KK 3IDHA 1L3SA 4H03B 2XRIA 2Q0UA 2OPSA 3CFRA 2ASMA 4F8RA 3ZSVA 3U4LA 3R1XA 1SQKA 1F21A 2P5OA 4K25A 4NCGA 4IOXA 2GEMA 5B8HA 3HVTA 3QETA 2HMIA 2YJEA 5LJWA 1VRTA 1TUYA 1CXQA 4BRMA 4WFAL 3OYJA 4GKJK 3CFPA 3D2EA 4LF6K 4DSFA 3VQ7A 2UXBK 1D9DA 1ZC6A 5FPEA 3TAEA 2HNYA 4JI2K 3TTFA 2P9KA 1RNHA 2LSNA 5ADXA 4CF0A 3U3GA 3EL2A 4HCBA 4DV0K 4LF8K 1FXXA 1E3MA 1RTDA 3H1QA 2FF3B 5AZIB 3O1BA 4JN4A 3OYFA 4CJRA 3IRXA 3KKRA 4C8LA 4H0YB 3VN5A 4B8AB 4FWSA 5KQ8A 3A5LC 2O8EB 2D0CA 1LOTB 2E4LA 3QERA 1Q7YO 2OZMA 4KH4A 1JLFA 4N5SA 3KJVA 4IFYA 2GV9A 4ILHA 3KLHA 1TYQA 5J2NA 1B9FA 3CMEN 4B3OA 4HTUA 1RT4A 5BPMA 3VQCA 3FZLA 1YJ9N 4EZ6A 4PUOA 4YFUA 5AQNA 2ZD1A 1RBSA 3DJCA 1N33K 1C6VA 4CZIA 4DLGA 5TKWA 1WSEA 3U9ZA 4W5RA 3ATUA 3CYMA 5CE3A 3MEEA 4BE2A 1D4XA 1RFQA 5HRPA 1XUPO 4CEDA 4BRQA 4AHUA 2O8FB 5JICA 2JLEA 1DLOA 1X1PA 4KRFA 3AO3A 5M1PA 2FC0A 3QEPA 3RMDA 3WQUA 4JS4A 3HPHA 4M7XA 4BROA 3DI6A 1RTJA 2B4JA 5KPTA 2GELA 1E4FT 2ATQA 1TUUA 4IOAL 3AVBA 2O8DB 3ID6A 4CJSA 1H1VA 2Y1IA 4BGAA 5EU7A 2X74A 1UAXA 1IBLK 3LP3A 3ZSRA 1IV0A 2NRVA 1R0AA 3MK6A 3CPEA 1RBVA 1KAZA 3HI0A 1W0HA 4FJ5A 1M90O 1K8AO 1A5XA 4LSLA 4B9UA 4BRHA 3OA9A 4BRPA 4Z4IA 1QQCA 3THYA 3ENBA 2O8DA 2YHAA 5FPDA 3EZWA 1L5UA 3VPZA 5DM6L 1LWFA 4KO0A 4CZEA 2W41A 5JS2A 3OW2M 4C8OA 2A3ZA 4BDZA 3VEYA 1NGGA 3LP1A 3THXB 3SK3A 4A5AA 4I7FA 4FZYA 3O9SA 3SQ1A 3DXKA 4QAGA 4Q0BA 2EWSA 4J2EA 4KHNA 1BHLA 3CJAA 1NKCA 1RCHA 5JLHA 1WAJA 4C1NI 4E0DA 2QTDA 5IT9O 1NWKA 4GNIA 4Z4CA 4IFEA 3ZETB 4BC4A 4KI4A 3CETA 4KV8A 3G0ZA 1RT1A 4FWQA 4V19S 3VQEA 1JCEA 3DXMB 1HNWK 3IUCA 1BCMA 3RRGA 4FWPA 3B6PA 4CHQA 3I55N 1FW6A 2W40A 3O9UA 4E89A 3OYBA 2XO7A 3MX2A 3RSEA 3O3HA 5GIPA 3MEGA 4IWVA 3NAEA 3MCAB 4OPJA 3CF5L 4BC3A 2NNWA 1LW2A 4DWIA 4OPAA 4CBXA 1VSMA 5AQKA 4CFDA 4B9MA 1HQUA 2E20A 2B5JA 2Z1IA 4DTOA 1A5VA 3SQ2A 4BGBA 1BA0A 3RMAA 1TKZA 3AO1A 4RG8A 2ZM6K 3VF4A 4E3SA 1NU0A 3AV9A 4O0JA 2UUBK 4OJRA 3FZKA 4KHUA 3U8XA 4CEAA 1NKBA 3HSTB 3KHYA 3PX6A 3T19A 4WCEL 1C1CA 4DR7K 1U2VA 4CZFA 3F5TA 4R5PA 1WN7A 1ATSA 4GVEA 3R6MA 4QS9A 3EY1A 2CGKA 3ZT0A 1YTUA 1QSSA 1ZXOA 4YY3K 3ASMA 5BPNA 2GTDA 1EO1A 4DSJA 4GY2B 1GLLO 3DYAA 3F9MA 3C94A 3O4QA 4CF9A 2O8EA 4I6MA 4ISEA 2O8BA 2FSJA 3MN7A 4AILC 3V9ZA 3P4IA 2DPNA 3O9TA
chains in the Genus database with same CATH topology
4F4KA 3V1RA 1VSDA 1ASVA 3K59A 2P1JA 2VG5A 4AHRA 4CERA 1J54A 3WNEA 3QNOA 3VA0A 1NK9A 1WSGA 4DTJA 4FLVA 1S9EA 1JL2A 2BANA 4KI6A 3M8SA 3SI6A 3SJJA 1IKVA 4JS5A 4F2RA 4DLEA 3M8QA 2D0AA 3ZT2A 4CGJA 1T8EA 4FJ9A 4DQRA 2RF2A 2QKBA 3MECA 3SV4A 3QIOA 4NCAA 1U47A 4CJEA 4B08A 3SV3A 4F3OA 4OPKA 3OYHA 3AA2A 2RKIA 1HNVA 4DS5A 1ZBLA 2P51A 4ELVA 3HYFA 1TAUA 4MFBA 4B9TA 4W5TA 1UA0A 4H8KA 4DU4A 1L3UA 1RILA 2F8SA 4E7IA 4DQQA 2GUIA 4HCCA 4C8KA 4EP5A 1U48A 2FBVA 1GOBA 3IG1A 2OPQA 4CJQA 4XIUA 1TK8A 1Q9YA 1GOAA 2FBXA 4KTZA 4CJLA 3SUNA 4CIEA 4CHNA 1X9MA 1S1XA 4DTRA 2G8IA 1BQNA 4CK2A 1T7PA 3VQ6A 3U6FA 3OYIA 1X9WA 1W9HA 4B9SA 4FJNA 3HM9A 1ZBIA 3ZSQA 4K8XA 3LWMA 1LW0A 1RTIA 3VQ9A 1NJZA 3KTQA 1S1WA 3NGZA 2P5GA 4FLZA 4KB1A 4N76A 2HHWA 1RT3A 2Y1JA 1SL0A 2E6MA 4OKJA 3OYCA 3KK3A 3O3GA 4KHWA 3OYNA 2QKKA 1LWCA 1U45A 4ZTFA 4ID5A 1NK4A 5HP1A 3NCIA 1FK9A 4CJVA 1VSFA 1JLAA 4C8MA 2G8KA 1RDCA 4PA1A 3PV8A 2OZSA 4FM1A 3OVNA 4FJXA 3RRHA 1D8YA 1LAWA 3ZSYA 4CE9A 4CJUA 3K57A 3RWUA 5J2PA 3V4IA 2D0BA 4HHTA 3CG7A 2VWJA 3DLHA 4Z4FA 1Q8IA 4CGFA 1G15A 5J2QA 4Y1DA 2YKNA 3LAMA 4LY7A 4M45A 3A2FA 5HRRA 4CJWA 1K6YA 3H08A 3S3OA 3HO1A 5KGXA 4H4MA 3KLGA 1VSHA 3L8BA 1MU2A 2BE2A 3AA5X 5CZ1A 1ZBUA 3QEXA 4I9LA 4MQ3A 1KSPA 5CY4A 2JGUA 4E7JA 2OPPA 3VQ5A 3ZSXA 1UA1A 4F3TA 5K14A 2G8UA 2HNZA 2Z1HA 2ZE2A 3O4NA 2PY5A 1WSIA 4IG0A 3V9SA 1LWEA 5I3UA 3TARA 1SV5A 4L8RB 4RW7A 4RW8A 1XHXA 4IBNA 3LPTA 3DMJA 5I42A 1C1BA 4FW1A 4H4OA 1RDDA 1NK7A 1L3VA 4KHSA 4DTNA 3DLKA 3AVMA 1NOYA 2HHTA 3PO5A 4BWJA 2HHUA 4E7HA 1CZBA 1NKEA 3G10A 1FKPA 4DF4A 3SUQA 3TANA 4FJMA 1TV6A 1TGOA 2IDOA 3TAMA 3OJUA 1IKWA 4FJHA 2KQ2A 4OKEA 4CHOA 3AA4A 3FFIA 4WE1A 3DLBA 3SQ4A 3SCXA 3OYAA 1BI4B 4HVJA 4DU3A 2XY7A 1NK8A 3IS9A 3LPUA 3VQ4A 3QO9A 4GW6A 4FJJA 4DFJA 1N5YA 5SZTA 1DTQA 3ZSZA 4N41A 3TAFA 4OLAA 4BDYA 1S6QA 1EX4A 3NE6A 1KLMA 1JLCA 1QE1A 4DFPA 4FJKA 2VG6A 4O5BA 1XI1A 3CQ8A 3NFAA 3NF7A 3NGIA 3AVHA 2W42A 1BL3A 4E1MA 1IO2A 4LSNA 4W5NA 3MAQA 4CIFA 3M8RA 3S3NA 3MXJA 3U3YA 4KHQA 1UOCA 4M3TA 1EKEA 4CHPA 1BISA 1QHTA 3NH2A 1N6QA 2I5JA 1BI4A 4CHYA 2YNIA 2E6LA 4RW6A 3ZCMA 4E19A 1BGXT 3K5NA 3ULDA 2RPIA 3AVKA 3SUOA 4K8ZA 4DU1A 4QCLA 3AO5A 3AVFA 3HL8A 3RMCA 4FXDA 2QXFA 4J2DA 1A5WA 2F96A 3TR8A 3OYMA 1NJYA 4KB0A 3AVIA 5HRSA 4J2AA 1UWBA 1VSKA 3I0SA 2O4IA 3L2UA 1RBRA 1RT6A 5HLFA 5KRTA 2F8TA 3KK2A 1WSJA 3QEWA 3DOLA 4FZXC 4CJPA 4IFVA 1RBTA 3OYGA 2O4GA 3P1GA 3OS1A 4DSEA 4DTXA 1D9FA 3KD1E 2DFFA 3HP6A 1RT2A 2XY8A 5DK5A 1WLJA 4J2BA 3AVNA 3V9WA 1KCFA 4RW9A 4CESA 5FDLA 5HRNA 3SZ2A 4Y1CA 1IKXA 3B6OA 2IS3A 4C8NA 4M42A 3F73A 5D3GA 2HHQA 5FRMA 5J2MA 1SKWA 1NK6A 4Z4GA 4CF8A 2IC3A 1D9DA 1KVBA 4O55A 3SQ0A 3QEVA 1LAVA 4CF2A 3SYZA 3JYTA 4IKFA 4KREA 3K58A 1L3SA 5HBMA 2Q3SA 1GOCA 2XRIA 4DTMA 1QTMA 2HNDA 4DQPA 4YNQA 1RT5A 1HQEA 2OPSA 3CFRA 3PY8A 1EETA 3M8PA 4F8RA 3ISNC 3ZSVA 2G8WA 1QS4A 3L3VA 4BWMA 2RN2A 1F21A 2X6SA 2P5OA 3DOKA 2KTQA 4NCGA 3HXMA 3VQPA 2KFZA 3HVTA 3QETA 2HMIA 1VRUA 3L2QA 3HT3A 1IG9A 1TKXA 1VRTA 1CXQA 1WSFA 2YNGA 4CEFA 3OYJA 4FZZA 1BIZA 3CFPA 4G1QA 4KFBA 3EZ5A 4DSFA 3T1AA 1WAFA 3VQ7A 5C25A 4OGCA 1NJWA 2BGGA 2YNHA 1B9DA 4IG3A 3TAQA 5JS1A 4FW2A 4GMJB 4DFKA 3TAGA 3L3UA 1Z26A 4CJ5A 3HPGA 1D5AA 4DMNA 2HNYA 3TAEA 3AVGA 3CM6A 3PUFA 4KTWA 5DMRA 1RNHA 1VSJA 2LSNA 2IAJA 1DTTA 3JSMA 1IH7A 4CF0A 3AO4A 3U3GA 4HUGA 4F2SA 1HYZA 1KTQA 1O1WA 3QINA 1SL1A 4HCBA 1U4BA 1I39A 4EP4A 1FXXA 3K5OA 1SKRA 4FM0A 4O4GA 1RTDA 1BCOA 1I3AA 1JXBA 3C6TA 2YNFA 1J9AA 3OYFA 2OPRA 3AO2A 3IRXA 4CJRA 3KKRA 2WOMA 2EHGA 4C8LA 2GBZA 4KPYA 4M3RA 4Z0UA 4LH5A 1TL3A 3EYZA 1J5OA 3HK2A 3I8DA 4GVMA 3OYEA 3KLFA 3D0PA 2IOCA 3VN5A 3ZSOA 3VQDA 4B8AB 3ZT1A 4Q5VA 1SUQA 2R7YA 4E7LA 2DTUA 4CEQA 4W5OA 4AHCA 4CJKA 2D0CA 3DRRA 3QIPA 1WSHA 2E4LA 4KTQA 2HVIA 3QERA 5KTQA 2OZMA 4FK4A 4DQIA 3S3MA 1JLFA 3OYLA 1JLQA 1CLQA 2HHVA 4N5SA 3KJVA 4IFYA 2KW4A 2GV9A 3KLHA 4FLXA 1TAQA 2X6NA 5J2NA 1B9FA 4NCBA 4B3OA 3PO4A 4HTUA 3K2PA 1RT4A 2Z1GA 3CFOA 3NDKA 4M3ZA 3KLIA 4CEBA 3VQCA 3OS2A 5FROA 4M3YA 3QEIA 1KVCA 4DG1A 4LD0A 4FJGA 4PWDA 4AHTA 1C0UA 2WONA 4LH4A 3SPZA 2NUBA 2PYJA 1VSLA 4YFUA 4E1NA 4EZ6A 4PUOA 1EP4A 2ZD1A 4CGGA 4DQSA 3V6DA 1RBSA 3DRSA 4FJ8A 3DLRA 1TK5A 4OLBA 4DFMA 4CF1A 1C6VA 1L3TA 5J1EA 4ID1A 3E01A 4CJFA 1YVUA 4DLGA 1Z25A 4OGEA 4W5QA 4HUFA 4CEZA 5C42A 4FLWA 3ZT4A 1WSEA 5T7BA 4W5RA 2XY6A 4FLTA 3C6UA 1TKDA 1QSLA 3TWHA 1RTHA 3CYMA 5FRNA 1CZ9A 3NF8A 4FK2A 1RDBA 3ALYA 3MEEA 4M41A 4BE2A 3HJFA 5SWMA 1XHZA 4ZHRA 1U49A 1ITGA 2YKMA 4EZ9A 5HRPA 4CFBA 4FK0A 1NJXA 1S5JA 2G8VA 4IDKA 4CEDA 1ASUA 3PX4A 2KZMA 1KVAA 4AHUA 3AVJA 2OYQA 2JLEA 1DLOA 2G8HA 1X1PA 3ITHA 3AO3A 1T05A 4KRFA 3MEDA 4BE0A 2PZSA 4Z4EA 5CYMA 2KFNA 1SL2A 2FC0A 3QEPA 3RMDA 3L2RA 1KFDA 5KI6A 1KLNA 4DTPA 4JS4A 3HPHA 3L2WA 3K5LA 4B8CA 1HNIA 3TI0A 3TAPA 2XY5A 3DI6A 4JRQA 1NK5A 4PY5A 1RTJA 3KLEA 2B4JA 4B9LA 3SUPA 3NHGA 2DFEA 5KRSA 3MXMA 2ATQA 2HB5A 1JLEA 3AVBA 3DRPA 4QOZB 1T03A 1HRHA 4FLUA 3LP0A 3RTVA 3P5JA 4N47A 4CJSA 2DY4A 4FCYA 2Y1IA 5EU7A 2X74A 1UAXA 2A1SA 4FLYA 4M3XA 3LAKA 3SNNA 3LP3A 3ZSRA 1RT7A 4FM2A 1S1VA 1TKTA 3OJSA 1R0AA 1REVA 2HW3A 1RBVA 4JRPA 1W0HA 4UQGA 4FJ5A 3AVAA 4E7KA 1A5XA 4NYNA 4I9QA 1X9SA 4LSLA 5KGWA 4FJ7A 4OKKA 1JXEA 4B9UA 3C95A 4FJIA 3ZT3A 1HMVA 4HUEA 3NH1A 1CXUA 4CGDA 4ICLA 4DSKA 4Z4IA 2ZQBA 1HYVA 1QQCA 3V1QA 1XC9A 4BACA 3NGYA 1J53A 2KZZA 3LALA 4O44A 4TSXA 1TVRA 2YHAA 1C1AA 1WNSA 1BIUA 5CYQA 4DSLA 1L5UA 4DTSA 3AA3A 4CIGA 1LWFA 3THVA 4KO0A 3IAYA 5JS2A 4DSIA 2AJQA 2YV0X 4FYDA 4C8OA 3WNGA 2VG7A 1VSEA 4BDPA 4BDZA 1C0MA 4AHVA 3LP1A 3T3FA 1HJRA 4CJTA 1TK0A 1VSIA 4I7FA 1S6PA 4CJ3A 4FZYA 3SPYA 4KHYA 3SQ1A 3BGRA 4RW4A 2IGIA 4QAGA 4Q0BA 3NF6A 4CEOA 4O0IA 3F9KA 2G8FA 4J2EA 3OYDA 4Z4HA 1B92A 4KHNA 1BHLA 2ITGA 1NKCA 4CECA 3LDSA 1RCHA 3K5MA 1RBUA 4CFCA 4B9NA 1HYSA 2HVHA 1XWLA 1WAJA 4E0DA 3HP9A 2D5RA 1Y97A 3LWLA 3VA3A 4Z4CA 4ELUA 3DLEA 4M3WA 4NYFA 3KIOA 3RR8A 2DFHA 3RR7A 1JLGA 5CZ2A 1Q9XA 4KI4A 4CK3A 4KV8A 1YT3A 3G0ZA 2BDPA 1RT1A 4N56A 3UIQA 1JLBA 3OS0A 3VQEA 3QESA 5HROA 1BCMA 2A1RA 3RRGA 3AVCA 1RDAA 1IKYA 3B6PA 4CHQA 3V1OA 3WNFA 4JLHA 5E41A 4E89A 3OYBA 4FJLA 1ZYQA 2XO7A 3OY9A 3O3HA 4PQUA 3MEGA 3D45A 3NAEA 2HHSA 4CFAA 1ZBFA 2X78A 3KD5E 4OPJA 3RMBA 1LW2A 4BE1A 5C24A 4DWIA 1ZBHA 4ELTA 1VSMA 3HPOA 3QNNA 1BQMA 4CFDA 4B9MA 1HQUA 3HVRA 2HHXA 1VK0A 2B5JA 2Z1IA 4DTOA 1A5VA 4FVMA 2VWKA 4OVLA 3OYKA 3SQ2A 1NK0A 2YHBA 2FBYA 3MXIA 3BDPA 3RMAA 1TKZA 3AO1A 4RG8A 4CJ4A 1ASWA 1C0TA 1QSYA 4E3SA 4CGIA 3AV9A 3PX0A 4O0JA 4CEEA 3V9XA 3DLGA 1U04A 3NBPA 3LZJA 3CM5A 3V9UA 3P83D 4OJRA 4M3UA 4CCHA 4CK1A 1S9GA 3LZIA 4KHUA 4CEAA 4DF8A 1NKBA 3HSTB 1FKOA 3QLHA 3VQAA 3VQQA 3ZSWA 3NH0A 2EX3A 2FBTA 3PX6A 2PYLA 4AHSA 2OA8A 3T19A 3TABA 1C1CA 1LV5A 1EXQA 3VQBA 1YTAA 4R5PA 1WN7A 2XHBA 4CGHA 1JL1A 3EY1A 3ZT0A 1KFSA 1S1UA 1YTUA 3AVLA 2Z1JA 3V81A 1HPZA 1SKSA 3S9HA 1QSSA 1NOZA 2B6AA 3KK1A 1KRPA 3ASMA 1TL1A 1JKHA 3LP2A 2ETJA 3LANA 4KKOA 4B9VA 4ZTJA 3DYAA 3O4QA 4DSJA 3C94A 4KAZA 4I2PA 4CF9A 3NF9A 4AH9A 4DTUA 3WNHA 3KKSA 4CHZA 3VQ8A 2QK9A 3DM2A 4AILC 3V9ZA 4I2QA 3L2VA 3O3FA 3I0RA 1S1TA 4DS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F4K A;  3V1R A;  1VSD A;  1ASV A;  3K59 A;  2P1J A;  2VG5 A;  4AHR A;  4CER A;  1J54 A;  3WNE A;  3QNO A;  3VA0 A;  1NK9 A;  1WSG A;  4DTJ A;  4FLV A;  1S9E A;  1JL2 A;  2BAN A;  4KI6 A;  3M8S A;  3SI6 A;  3SJJ A;  1IKV A;  4JS5 A;  4F2R A;  4DLE A;  3M8Q A;  2D0A A;  3ZT2 A;  4CGJ A;  1T8E A;  4FJ9 A;  4DQR A;  2RF2 A;  2QKB A;  3MEC A;  3SV4 A;  3QIO A;  4NCA A;  1U47 A;  4CJE A;  4B08 A;  3SV3 A;  4F3O A;  4OPK A;  3OYH A;  3AA2 A;  2RKI A;  1HNV A;  4DS5 A;  1ZBL A;  2P51 A;  4ELV A;  3HYF A;  1TAU A;  4MFB A;  4B9T A;  4W5T A;  1UA0 A;  4H8K A;  4DU4 A;  1L3U A;  1RIL A;  2F8S A;  4E7I A;  4DQQ A;  2GUI A;  4HCC A;  4C8K A;  4EP5 A;  1U48 A;  2FBV A;  1GOB A;  3IG1 A;  2OPQ A;  4CJQ A;  4XIU A;  1TK8 A;  1Q9Y A;  1GOA A;  2FBX A;  4KTZ A;  4CJL A;  3SUN A;  4CIE A;  4CHN A;  1X9M A;  1S1X A;  4DTR A;  2G8I A;  1BQN A;  4CK2 A;  1T7P A;  3VQ6 A;  3U6F A;  3OYI A;  1X9W A;  1W9H A;  4B9S A;  4FJN A;  3HM9 A;  1ZBI A;  3ZSQ A;  4K8X A;  3LWM A;  1LW0 A;  1RTI A;  3VQ9 A;  1NJZ A;  3KTQ A;  1S1W A;  3NGZ A;  2P5G A;  4FLZ A;  4KB1 A;  4N76 A;  2HHW A;  1RT3 A;  2Y1J A;  1SL0 A;  2E6M A;  4OKJ A;  3OYC A;  3KK3 A;  3O3G A;  4KHW A;  3OYN A;  2QKK A;  1LWC A;  1U45 A;  4ZTF A;  4ID5 A;  1NK4 A;  5HP1 A;  3NCI A;  1FK9 A;  4CJV A;  1VSF A;  1JLA A;  4C8M A;  2G8K A;  1RDC A;  4PA1 A;  3PV8 A;  2OZS A;  4FM1 A;  3OVN A;  4FJX A;  3RRH A;  1D8Y A;  1LAW A;  3ZSY A;  4CE9 A;  4CJU A;  3K57 A;  3RWU A;  5J2P A;  3V4I A;  2D0B A;  4HHT A;  3CG7 A;  2VWJ A;  3DLH A;  4Z4F A;  1Q8I A;  4CGF A;  1G15 A;  5J2Q A;  4Y1D A;  2YKN A;  3LAM A;  4LY7 A;  4M45 A;  3A2F A;  5HRR A;  4CJW A;  1K6Y A;  3H08 A;  3S3O A;  3HO1 A;  5KGX A;  4H4M A;  3KLG A;  1VSH A;  3L8B A;  1MU2 A;  2BE2 A;  3AA5 X;  5CZ1 A;  1ZBU A;  3QEX A;  4I9L A;  4MQ3 A;  1KSP A;  5CY4 A;  2JGU A;  4E7J A;  2OPP A;  3VQ5 A;  3ZSX A;  1UA1 A;  4F3T A;  5K14 A;  2G8U A;  2HNZ A;  2Z1H A;  2ZE2 A;  3O4N A;  2PY5 A;  1WSI A;  4IG0 A;  3V9S A;  1LWE A;  5I3U A;  3TAR A;  1SV5 A;  4L8R B;  4RW7 A;  4RW8 A;  1XHX A;  4IBN A;  3LPT A;  3DMJ A;  5I42 A;  1C1B A;  4FW1 A;  4H4O A;  1RDD A;  1NK7 A;  1L3V A;  4KHS A;  4DTN A;  3DLK A;  3AVM A;  1NOY A;  2HHT A;  3PO5 A;  4BWJ A;  2HHU A;  4E7H A;  1CZB A;  1NKE A;  3G10 A;  1FKP A;  4DF4 A;  3SUQ A;  3TAN A;  4FJM A;  1TV6 A;  1TGO A;  2IDO A;  3TAM A;  3OJU A;  1IKW A;  4FJH A;  2KQ2 A;  4OKE A;  4CHO A;  3AA4 A;  3FFI A;  4WE1 A;  3DLB A;  3SQ4 A;  3SCX A;  3OYA A;  1BI4 B;  4HVJ A;  4DU3 A;  2XY7 A;  1NK8 A;  3IS9 A;  3LPU A;  3VQ4 A;  3QO9 A;  4GW6 A;  4FJJ A;  4DFJ A;  1N5Y A;  5SZT A;  1DTQ A;  3ZSZ A;  4N41 A;  3TAF A;  4OLA A;  4BDY A;  1S6Q A;  1EX4 A;  3NE6 A;  1KLM A;  1JLC A;  1QE1 A;  4DFP A;  4FJK A;  2VG6 A;  4O5B A;  1XI1 A;  3CQ8 A;  3NFA A;  3NF7 A;  3NGI A;  3AVH A;  2W42 A;  1BL3 A;  4E1M A;  1IO2 A;  4LSN A;  4W5N A;  3MAQ A;  4CIF A;  3M8R A;  3S3N A;  3MXJ A;  3U3Y A;  4KHQ A;  1UOC A;  4M3T A;  1EKE A;  4CHP A;  1BIS A;  1QHT A;  3NH2 A;  1N6Q A;  2I5J A;  1BI4 A;  4CHY A;  2YNI A;  2E6L A;  4RW6 A;  3ZCM A;  4E19 A;  1BGX T;  3K5N A;  3ULD A;  2RPI A;  3AVK A;  3SUO A;  4K8Z A;  4DU1 A;  4QCL A;  3AO5 A;  3AVF A;  3HL8 A;  3RMC A;  4FXD A;  2QXF A;  4J2D A;  1A5W A;  2F96 A;  3TR8 A;  3OYM A;  1NJY A;  4KB0 A;  3AVI A;  5HRS A;  4J2A A;  1UWB A;  1VSK A;  3I0S A;  2O4I A;  3L2U A;  1RBR A;  1RT6 A;  5HLF A;  5KRT A;  2F8T A;  3KK2 A;  1WSJ A;  3QEW A;  3DOL A;  4FZX C;  4CJP A;  4IFV A;  1RBT A;  3OYG A;  2O4G A;  3P1G A;  3OS1 A;  4DSE A;  4DTX A;  1D9F A;  3KD1 E;  2DFF A;  3HP6 A;  1RT2 A;  2XY8 A;  5DK5 A;  1WLJ A;  4J2B A;  3AVN A;  3V9W A;  1KCF A;  4RW9 A;  4CES A;  5FDL A;  5HRN A;  3SZ2 A;  4Y1C A;  1IKX A;  3B6O A;  2IS3 A;  4C8N A;  4M42 A;  3F73 A;  5D3G A;  2HHQ A;  5FRM A;  5J2M A;  1SKW A;  1NK6 A;  4Z4G A;  4CF8 A;  2IC3 A;  1D9D A;  1KVB A;  4O55 A;  3SQ0 A;  3QEV A;  1LAV A;  4CF2 A;  3SYZ A;  3JYT A;  4IKF A;  4KRE A;  3K58 A;  1L3S A;  5HBM A;  2Q3S A;  1GOC A;  2XRI A;  4DTM A;  1QTM A;  2HND A;  4DQP A;  4YNQ A;  1RT5 A;  1HQE A;  2OPS A;  3CFR A;  3PY8 A;  1EET A;  3M8P A;  4F8R A;  3ISN C;  3ZSV A;  2G8W A;  1QS4 A;  3L3V A;  4BWM A;  2RN2 A;  1F21 A;  2X6S A;  2P5O A;  3DOK A;  2KTQ A;  4NCG A;  3HXM A;  3VQP A;  2KFZ A;  3HVT A;  3QET A;  2HMI A;  1VRU A;  3L2Q A;  3HT3 A;  1IG9 A;  1TKX A;  1VRT A;  1CXQ A;  1WSF A;  2YNG A;  4CEF A;  3OYJ A;  4FZZ A;  1BIZ A;  3CFP A;  4G1Q A;  4KFB A;  3EZ5 A;  4DSF A;  3T1A A;  1WAF A;  3VQ7 A;  5C25 A;  4OGC A;  1NJW A;  2BGG A;  2YNH A;  1B9D A;  4IG3 A;  3TAQ A;  5JS1 A;  4FW2 A;  4GMJ B;  4DFK A;  3TAG A;  3L3U A;  1Z26 A;  4CJ5 A;  3HPG A;  1D5A A;  4DMN A;  2HNY A;  3TAE A;  3AVG A;  3CM6 A;  3PUF A;  4KTW A;  5DMR A;  1RNH A;  1VSJ A;  2LSN A;  2IAJ A;  1DTT A;  3JSM A;  1IH7 A;  4CF0 A;  3AO4 A;  3U3G A;  4HUG A;  4F2S A;  1HYZ A;  1KTQ A;  1O1W A;  3QIN A;  1SL1 A;  4HCB A;  1U4B A;  1I39 A;  4EP4 A;  1FXX A;  3K5O A;  1SKR A;  4FM0 A;  4O4G A;  1RTD A;  1BCO A;  1I3A A;  1JXB A;  3C6T A;  2YNF A;  1J9A A;  3OYF A;  2OPR A;  3AO2 A;  3IRX A;  4CJR A;  3KKR A;  2WOM A;  2EHG A;  4C8L A;  2GBZ A;  4KPY A;  4M3R A;  4Z0U A;  4LH5 A;  1TL3 A;  3EYZ A;  1J5O A;  3HK2 A;  3I8D A;  4GVM A;  3OYE A;  3KLF A;  3D0P A;  2IOC A;  3VN5 A;  3ZSO A;  3VQD A;  4B8A B;  3ZT1 A;  4Q5V A;  1SUQ A;  2R7Y A;  4E7L A;  2DTU A;  4CEQ A;  4W5O A;  4AHC A;  4CJK A;  2D0C A;  3DRR A;  3QIP A;  1WSH A;  2E4L A;  4KTQ A;  2HVI A;  3QER A;  5KTQ A;  2OZM A;  4FK4 A;  4DQI A;  3S3M A;  1JLF A;  3OYL A;  1JLQ A;  1CLQ A;  2HHV A;  4N5S A;  3KJV A;  4IFY A;  2KW4 A;  2GV9 A;  3KLH A;  4FLX A;  1TAQ A;  2X6N A;  5J2N A;  1B9F A;  4NCB A;  4B3O A;  3PO4 A;  4HTU A;  3K2P A;  1RT4 A;  2Z1G A;  3CFO A;  3NDK A;  4M3Z A;  3KLI A;  4CEB A;  3VQC A;  3OS2 A;  5FRO A;  4M3Y A;  3QEI A;  1KVC A;  4DG1 A;  4LD0 A;  4FJG A;  4PWD A;  4AHT A;  1C0U A;  2WON A;  4LH4 A;  3SPZ A;  2NUB A;  2PYJ A;  1VSL A;  4YFU A;  4E1N A;  4EZ6 A;  4PUO A;  1EP4 A;  2ZD1 A;  4CGG A;  4DQS A;  3V6D A;  1RBS A;  3DRS A;  4FJ8 A;  3DLR A;  1TK5 A;  4OLB A;  4DFM A;  4CF1 A;  1C6V A;  1L3T A;  5J1E A;  4ID1 A;  3E01 A;  4CJF A;  1YVU A;  4DLG A;  1Z25 A;  4OGE A;  4W5Q A;  4HUF A;  4CEZ A;  5C42 A;  4FLW A;  3ZT4 A;  1WSE A;  5T7B A;  4W5R A;  2XY6 A;  4FLT A;  3C6U A;  1TKD A;  1QSL A;  3TWH A;  1RTH A;  3CYM A;  5FRN A;  1CZ9 A;  3NF8 A;  4FK2 A;  1RDB A;  3ALY A;  3MEE A;  4M41 A;  4BE2 A;  3HJF A;  5SWM A;  1XHZ A;  4ZHR A;  1U49 A;  1ITG A;  2YKM A;  4EZ9 A;  5HRP A;  4CFB A;  4FK0 A;  1NJX A;  1S5J A;  2G8V A;  4IDK A;  4CED A;  1ASU A;  3PX4 A;  2KZM A;  1KVA A;  4AHU A;  3AVJ A;  2OYQ A;  2JLE A;  1DLO A;  2G8H A;  1X1P A;  3ITH A;  3AO3 A;  1T05 A;  4KRF A;  3MED A;  4BE0 A;  2PZS A;  4Z4E A;  5CYM A;  2KFN A;  1SL2 A;  2FC0 A;  3QEP A;  3RMD A;  3L2R A;  1KFD A;  5KI6 A;  1KLN A;  4DTP A;  4JS4 A;  3HPH A;  3L2W A;  3K5L A;  4B8C A;  1HNI A;  3TI0 A;  3TAP A;  2XY5 A;  3DI6 A;  4JRQ A;  1NK5 A;  4PY5 A;  1RTJ A;  3KLE A;  2B4J A;  4B9L A;  3SUP A;  3NHG A;  2DFE A;  5KRS A;  3MXM A;  2ATQ A;  2HB5 A;  1JLE A;  3AVB A;  3DRP A;  4QOZ B;  1T03 A;  1HRH A;  4FLU A;  3LP0 A;  3RTV A;  3P5J A;  4N47 A;  4CJS A;  2DY4 A;  4FCY A;  2Y1I A;  5EU7 A;  2X74 A;  1UAX A;  2A1S A;  4FLY A;  4M3X A;  3LAK A;  3SNN A;  3LP3 A;  3ZSR A;  1RT7 A;  4FM2 A;  1S1V A;  1TKT A;  3OJS A;  1R0A A;  1REV A;  2HW3 A;  1RBV A;  4JRP A;  1W0H A;  4UQG A;  4FJ5 A;  3AVA A;  4E7K A;  1A5X A;  4NYN A;  4I9Q A;  1X9S A;  4LSL A;  5KGW A;  4FJ7 A;  4OKK A;  1JXE A;  4B9U A;  3C95 A;  4FJI A;  3ZT3 A;  1HMV A;  4HUE A;  3NH1 A;  1CXU A;  4CGD A;  4ICL A;  4DSK A;  4Z4I A;  2ZQB A;  1HYV A;  1QQC A;  3V1Q A;  1XC9 A;  4BAC A;  3NGY A;  1J53 A;  2KZZ A;  3LAL A;  4O44 A;  4TSX A;  1TVR A;  2YHA A;  1C1A A;  1WNS A;  1BIU A;  5CYQ A;  4DSL A;  1L5U A;  4DTS A;  3AA3 A;  4CIG A;  1LWF A;  3THV A;  4KO0 A;  3IAY A;  5JS2 A;  4DSI A;  2AJQ A;  2YV0 X;  4FYD A;  4C8O A;  3WNG A;  2VG7 A;  1VSE A;  4BDP A;  4BDZ A;  1C0M A;  4AHV A;  3LP1 A;  3T3F A;  1HJR A;  4CJT A;  1TK0 A;  1VSI A;  4I7F A;  1S6P A;  4CJ3 A;  4FZY A;  3SPY A;  4KHY A;  3SQ1 A;  3BGR A;  4RW4 A;  2IGI A;  4QAG A;  4Q0B A;  3NF6 A;  4CEO A;  4O0I A;  3F9K A;  2G8F A;  4J2E A;  3OYD A;  4Z4H A;  1B92 A;  4KHN A;  1BHL A;  2ITG A;  1NKC A;  4CEC A;  3LDS A;  1RCH A;  3K5M A;  1RBU A;  4CFC A;  4B9N A;  1HYS A;  2HVH A;  1XWL A;  1WAJ A;  4E0D A;  3HP9 A;  2D5R A;  1Y97 A;  3LWL A;  3VA3 A;  4Z4C A;  4ELU A;  3DLE A;  4M3W A;  4NYF A;  3KIO A;  3RR8 A;  2DFH A;  3RR7 A;  1JLG A;  5CZ2 A;  1Q9X A;  4KI4 A;  4CK3 A;  4KV8 A;  1YT3 A;  3G0Z A;  2BDP A;  1RT1 A;  4N56 A;  3UIQ A;  1JLB A;  3OS0 A;  3VQE A;  3QES A;  5HRO A;  1BCM A;  2A1R A;  3RRG A;  3AVC A;  1RDA A;  1IKY A;  3B6P A;  4CHQ A;  3V1O A;  3WNF A;  4JLH A;  5E41 A;  4E89 A;  3OYB A;  4FJL A;  1ZYQ A;  2XO7 A;  3OY9 A;  3O3H A;  4PQU A;  3MEG A;  3D45 A;  3NAE A;  2HHS A;  4CFA A;  1ZBF A;  2X78 A;  3KD5 E;  4OPJ A;  3RMB A;  1LW2 A;  4BE1 A;  5C24 A;  4DWI A;  1ZBH A;  4ELT A;  1VSM A;  3HPO A;  3QNN A;  1BQM A;  4CFD A;  4B9M A;  1HQU A;  3HVR A;  2HHX A;  1VK0 A;  2B5J A;  2Z1I A;  4DTO A;  1A5V A;  4FVM A;  2VWK A;  4OVL A;  3OYK A;  3SQ2 A;  1NK0 A;  2YHB A;  2FBY A;  3MXI A;  3BDP A;  3RMA A;  1TKZ A;  3AO1 A;  4RG8 A;  4CJ4 A;  1ASW A;  1C0T A;  1QSY A;  4E3S A;  4CGI A;  3AV9 A;  3PX0 A;  4O0J A;  4CEE A;  3V9X A;  3DLG A;  1U04 A;  3NBP A;  3LZJ A;  3CM5 A;  3V9U A;  3P83 D;  4OJR A;  4M3U A;  4CCH A;  4CK1 A;  1S9G A;  3LZI A;  4KHU A;  4CEA A;  4DF8 A;  1NKB A;  3HST B;  1FKO A;  3QLH A;  3VQA A;  3VQQ A;  3ZSW A;  3NH0 A;  2EX3 A;  2FBT A;  3PX6 A;  2PYL A;  4AHS A;  2OA8 A;  3T19 A;  3TAB A;  1C1C A;  1LV5 A;  1EXQ A;  3VQB A;  1YTA A;  4R5P A;  1WN7 A;  2XHB A;  4CGH A;  1JL1 A;  3EY1 A;  3ZT0 A;  1KFS A;  1S1U A;  1YTU A;  3AVL A;  2Z1J A;  3V81 A;  1HPZ A;  1SKS A;  3S9H A;  1QSS A;  1NOZ A;  2B6A A;  3KK1 A;  1KRP A;  3ASM A;  1TL1 A;  1JKH A;  3LP2 A;  2ETJ A;  3LAN A;  4KKO A;  4B9V A;  4ZTJ A;  3DYA A;  3O4Q A;  4DSJ A;  3C94 A;  4KAZ A;  4I2P A;  4CF9 A;  3NF9 A;  4AH9 A;  4DTU A;  3WNH A;  3KKS A;  4CHZ A;  3VQ8 A;  2QK9 A;  3DM2 A;  4AIL C;  3V9Z A;  4I2Q A;  3L2V A;  3O3F A;  3I0R A;  1S1T A;  4DS4 A; 
#chains in the Genus database with same CATH topology
 2P9P B;  2A42 A;  1P8Z A;  3CER A;  3UKU B;  4NXN K;  4DTJ A;  1S9E A;  1IKV A;  1JCF A;  3ZT2 A;  1T8E A;  3VEV A;  4DQR A;  2QKB A;  1VQP N;  2QWP A;  4NCA A;  4MDB A;  1OH7 A;  3SV3 A;  4F3O A;  2QWN A;  3GDQ A;  3AA2 A;  4BRF A;  2F7T A;  4B9T A;  1YF5 L;  5EXW A;  3GE1 A;  4E7I A;  4DQQ A;  4C8K A;  1U6Z A;  1GOB A;  4IO9 L;  4A2B A;  3E9L A;  1OVQ A;  1S1X A;  1RDU A;  3U6F A;  3VMF B;  1W9H A;  4YOR A;  3AAP A;  3HM9 A;  3ZSQ A;  4K8X A;  4LF9 K;  2H3G X;  5C0Y A;  1RTI A;  3KTQ A;  3SAH A;  1S1W A;  3AAR A;  2P5G A;  4FLZ A;  4AF1 A;  4L3Q A;  4XEI A;  5DM7 L;  5BN9 A;  3O3G A;  3OYN A;  2QKK A;  4PA1 A;  3RRH A;  1LAW A;  3ZSY A;  4CE9 A;  1MA9 B;  5AJ3 K;  5J2P A;  3CG7 A;  3DLH A;  1MWM A;  1Q8I A;  4BQZ A;  1G15 A;  2AP1 A;  4Y1D A;  4LY7 A;  1K6Y A;  3O9R A;  5AQU A;  4H4M A;  1VSH A;  3BF3 A;  2OPP A;  1UA1 A;  1OH6 A;  2Z1H A;  5LJV A;  4DQ8 A;  4IG0 A;  3V9S A;  1LWE A;  4OPH A;  3J80 O;  3UB5 A;  2E5L K;  4IBN A;  1C1B A;  3HTV A;  3O9Q A;  4H4O A;  1IG8 A;  1NJI O;  1XNQ K;  5AQI A;  4A59 A;  4BR5 A;  1NOY A;  3H6E A;  3J7Z O;  4Z94 A;  1NGF A;  3W3D A;  1FKP A;  2QWM A;  2HW3 A;  3TAM A;  3FLC O;  4CHO A;  3FFI A;  3VQ4 A;  3QO9 A;  3FFK B;  3H3O B;  3ZSZ A;  4A5B A;  1QZ6 A;  5JVH L;  1S22 A;  4FPA A;  2F9T A;  4BDY A;  1JLC A;  3HRG A;  4WFN L;  4FJK A;  1XI1 A;  3NFA A;  4X66 K;  3E9O A;  4LSN A;  3CJC A;  3MXJ A;  3ZET A;  1BA1 A;  1QQO A;  1QHT A;  4CHP A;  1GLC G;  1N6Q A;  5AZJ B;  4RW6 A;  2YJF A;  3K5N A;  4JD2 B;  3HL8 A;  3OYM A;  3EKU A;  3AVI A;  3QIC A;  1UWB A;  3I0S A;  4DR4 K;  2O4G A;  3P1G A;  3SAG A;  2KKZ A;  1D9F A;  2DFF A;  3KD1 E;  4CZG A;  3AVN A;  4PKG A;  4BG9 A;  5FDL A;  4C8N A;  5D3G A;  2HHQ A;  1SKW A;  4CBU A;  4CF8 A;  4FWM A;  1KVB A;  4O55 A;  1OH5 A;  5AQP A;  3QB0 A;  4B3S K;  4RTF D;  3SYZ A;  4IKF A;  5AQW A;  3K58 A;  3BP8 A;  2QXL A;  4BRD A;  4DQP A;  1HQE A;  1Z05 A;  3C65 A;  2X6S A;  5C2F A;  3HXM A;  1SS6 A;  1NGC A;  2FXU A;  3HT3 A;  4A2A A;  4FZZ A;  4M63 C;  5EX5 A;  1WAF A;  4ILG B;  4CJ7 A;  5C25 A;  4OGC A;  1B9D A;  3O5B A;  4DFK A;  3L3U A;  1Z26 A;  4CJ5 A;  3HPG A;  4DMN A;  3CM6 A;  4KTW A;  5DMR A;  2A40 A;  1IH7 A;  5AQL A;  4F2S A;  4BRA A;  1O1W A;  5AQZ A;  1I39 A;  3VF6 A;  1Q86 O;  1SKR A;  1BCO A;  1I3A A;  4B1V A;  1J9A A;  3AO2 A;  5GIN A;  1ILY A;  4KPY A;  2E2N A;  3HK2 A;  2HMP A;  3OYE A;  3D0P A;  2R7Y A;  2DTU A;  4FOE A;  2VWB A;  4AHC A;  1NGB A;  3A0I X;  5M1N A;  5BN8 A;  3IKM A;  1C0G A;  4O5F A;  1CLQ A;  3AGR A;  2E2P A;  5GAE P;  3UKU A;  4LF7 K;  4CZJ A;  1TAQ A;  2P9L B;  2NRR A;  2Z1G A;  3CFO A;  3NDK A;  4CEB A;  4NB4 A;  5LL6 Z;  3KVG A;  2ASO A;  1SAZ A;  5AFU H;  1C0U A;  4OX9 K;  2NUB A;  1T44 A;  3V6D A;  4FJ8 A;  3DLR A;  1TK5 A;  4DFM A;  4CF1 A;  1L3T A;  3E01 A;  2OCE A;  3QML A;  1XC3 A;  4HUF A;  1NGH A;  2XY6 A;  1QSL A;  5BRH A;  1N34 K;  1RTH A;  3RVC A;  1CZ9 A;  2E88 A;  4FK2 A;  4MO5 A;  1IBM K;  1XHZ A;  4ZHR A;  4EZ9 A;  2UUC K;  1WBD A;  1S5J A;  3PX4 A;  2KZM A;  3KWG A;  1T05 A;  3MED A;  4BE0 A;  5I9E B;  2UXC K;  1SL2 A;  2NRT A;  1W97 L;  4FL9 A;  1QZ5 A;  3TI0 A;  2XY5 A;  4PY5 A;  3NHG A;  1JLE A;  1HRH A;  2WUS A;  3J81 O;  4FLU A;  3RTV A;  1NGD A;  4DR6 K;  2A1S A;  4NXM K;  3SNN A;  3PLA A;  2YCH A;  4FM2 A;  2CGL A;  3FE1 A;  4JRP A;  3E66 A;  3FZM A;  1X9S A;  3ZEU A;  2OTJ N;  3ZT3 A;  4X65 K;  1CXU A;  4CGD A;  3VEW A;  1HYV A;  2ZJQ L;  3V1Q A;  5BPL A;  3L4Q A;  2KZZ A;  5E26 A;  1O13 A;  4FPB A;  4KBO A;  3KZB A;  1WNS A;  1BIU A;  4BVP A;  4PHT X;  2AA4 A;  2Q36 A;  4DTS A;  1NNE A;  3AA3 A;  4DUY K;  4FYD A;  4BDP A;  4DCH A;  4BRC A;  1C0M A;  3T3F A;  1HJR A;  1YXQ A;  1VSI A;  4B1W B;  3SPY A;  4KHY A;  3T69 A;  3C6H A;  4BC2 A;  2IGI A;  3PIP L;  3AAQ A;  1X3N A;  3NF6 A;  4O0I A;  3CC7 N;  1B92 A;  4JI3 K;  2ITG A;  2ZWH A;  1NGA A;  3VOV A;  5AQS A;  1KAY A;  2D5R A;  3CCL N;  4JKA A;  2P9K B;  1DEJ A;  4O8U A;  1X3M A;  4BRE A;  2A1R A;  2F9W A;  3AVC A;  3JS6 A;  1IKY A;  3V1O A;  2CGJ A;  5FPM A;  3D45 A;  4CFA A;  3HM8 A;  3W0L A;  3KD5 E;  1V4T A;  3RMB A;  1VQL N;  1ZBH A;  3HPO A;  3R3L A;  1XMO K;  3HVR A;  4FVM A;  4RCH A;  4OVL A;  1YVN A;  5AQT A;  3MXI A;  1Q82 O;  3BDP A;  2YI1 A;  2VQF K;  1QSY A;  2I7N A;  4CGI A;  3CI5 A;  3EKS A;  5M1O A;  2D4W A;  3V9X A;  3DLG A;  1BDG A;  3C7N B;  1GLE G;  3P83 D;  4M3U A;  4CCH A;  2D1K A;  1S9G A;  5EVZ A;  3ZSW A;  3NH0 A;  2FBT A;  1G99 A;  2XHB A;  3S41 A;  4BRL A;  4CGH A;  3ENH A;  1JL1 A;  1KFS A;  4AM7 A;  2Z1J A;  2ASP A;  4PL7 A;  1SKS A;  3LAN A;  4BG8 A;  4I2P A;  5EY4 A;  4CD3 A;  3WNH A;  2O8B B;  2KHO A;  4ISG A;  3WEE A;  3DM2 A;  2QK9 A;  4I2Q A;  3G25 A;  2HOE A;  5LY3 A;  3I56 N;  4DS4 A;  4M7Y A;  3V1R A;  3PSF A;  3Q7B A;  3K59 A;  1Q9Y A;  1J54 A;  3VA0 A;  4FLV A;  4H5V A;  1JL2 A;  3L4I A;  3WXK A;  4KI6 A;  3M8S A;  4U67 L;  5JLF A;  4F2R A;  3M8Q A;  3VGM A;  3SV4 A;  1U47 A;  4CJE A;  3ENO A;  2CH6 A;  4B08 A;  2Q1N A;  3ZEU B;  5BRF A;  1TAU A;  3BZK A;  3T1Y K;  4MFB A;  4JI4 K;  1BG3 A;  5F2R A;  1UA0 A;  4YOW A;  1FJG K;  1RIL A;  1S72 N;  4BQL A;  1TK8 A;  3PSI A;  1KXP A;  4CJQ A;  5HL7 L;  2FBX A;  3GL1 A;  4KTZ A;  3SUN A;  4CIE A;  1KQS M;  5AR0 A;  3G71 N;  1T7P A;  3OYI A;  1X9W A;  1ZBI A;  3WXM B;  4MO4 A;  1QQN A;  1NJZ A;  3VEN A;  3A5O C;  3NGZ A;  4KB1 A;  2HHW A;  4N76 A;  4JEP A;  1RT3 A;  3CJB A;  4K41 A;  1SL0 A;  4OKJ A;  1LWC A;  4ID5 A;  3NCI A;  2GWJ A;  2G8K A;  1RDC A;  3PV8 A;  3OBY A;  3FR0 A;  4IDH A;  2FSK A;  4H0T B;  3JAM O;  3EN9 A;  3K57 A;  4CJU A;  3RWU A;  4HHT A;  4Z4F A;  2P9I A;  2QEX N;  4B3T K;  3ID8 A;  5J2Q A;  3EO3 A;  4WQ4 C;  3LAM A;  3S3O A;  3QEX A;  1MU2 A;  4MQ3 A;  1KAX A;  4E7J A;  3VQ5 A;  3THX A;  3VES A;  4JKE A;  2HNZ A;  4YOY A;  1HUX A;  5AQV A;  1WSI A;  5I3U A;  3TAR A;  1V4S A;  3LPT A;  3DMJ A;  4FW1 A;  4KHS A;  1VQ8 N;  4H0O A;  3AVM A;  3PO5 A;  4BWJ A;  3G10 A;  3TAN A;  1TV6 A;  1BUP A;  3AA4 A;  4OO1 J;  3GBT A;  3IS9 A;  4DV5 K;  1Q81 O;  3J8A A;  3E1Y A;  4FJJ A;  3DXM A;  1N5Y A;  3L6Q A;  4H5T A;  2IIR A;  3CCE N;  1QE1 A;  4H0V B;  2VG6 A;  4O5B A;  5JMV A;  2CH5 A;  3NF7 A;  3AVH A;  4E1M A;  1N32 K;  1IO2 A;  4W5N A;  2GUP A;  3S3N A;  1QQM A;  4CZL A;  3KWI A;  3BZC A;  3NH2 A;  3FGU A;  4CHY A;  2E6L A;  3CCM N;  3ZCM A;  4GV6 A;  2RPI A;  4K8Z A;  4QCL A;  3AO5 A;  5CHI A;  1I94 K;  4FXD A;  2WTU A;  4DV6 K;  3THW A;  1C0F A;  4J2A A;  1K9M O;  1RBR A;  5HLF A;  3UKR B;  2QI2 A;  2F8T A;  4JKD A;  1NGJ A;  3BY5 A;  3AY9 A;  3D7E O;  3OYG A;  4DR2 K;  4K42 A;  3HP6 A;  1RT2 A;  2WFB A;  2XY8 A;  1WLJ A;  4IOC L;  2V7Z A;  3MDQ A;  5HRN A;  1NGI A;  4I6M B;  1T6C A;  1NK6 A;  1YIJ N;  4JD2 A;  3QEV A;  1LAV A;  3JYT A;  4KRE A;  4FOI A;  5HBM A;  1MWK A;  1GOC A;  3THW B;  4LFB K;  1QTM A;  2HND A;  4YNQ A;  1RT5 A;  5H1S Q;  1EET A;  1Y64 A;  3M8P A;  1X9J A;  3I33 A;  1VQN N;  2G8W A;  4E1J A;  1QS4 A;  3L3V A;  2RN2 A;  3DOK A;  1NLV A;  3TSP A;  3VQP A;  2KFZ A;  1DKG D;  3L2Q A;  3CPW M;  1TKX A;  4G9Z A;  1WSF A;  4JNE A;  2YNG A;  4EAH D;  3DAW A;  4KFB A;  3EZ5 A;  3T1A A;  2P9U B;  3P31 A;  4DV3 K;  5JS1 A;  3A5M C;  2VQE K;  4GMJ B;  3TAG A;  3AVG A;  1RGI A;  3JSM A;  1DTT A;  4H0X B;  3AO4 A;  4WQ4 A;  1OKJ A;  3D6R A;  3QIN A;  1SL1 A;  1U4B A;  4EP4 A;  3K5O A;  3CHW A;  4FM0 A;  5AQG A;  2HHH K;  4KHP K;  4WYB A;  2YNF A;  4KH6 A;  3LDQ A;  2OPR A;  2EHG A;  2HBM A;  2WOM A;  2GBZ A;  2E8A A;  4M3R A;  4Z0U A;  3CJ1 A;  1TL3 A;  3EYZ A;  1J5O A;  4DUZ K;  4CBW A;  2IOC A;  3ZSO A;  4Q5V A;  1SUQ A;  1E4G T;  5AQJ A;  3DRR A;  3QIP A;  1WSH A;  4KTQ A;  5KTQ A;  4FVU A;  4LF5 K;  3OYL A;  2UU9 K;  5FLX O;  4DV2 K;  1ATR A;  3CQX A;  4FLX A;  4EFH A;  1BU6 O;  1NG9 A;  4JAX A;  4B3R K;  2KLA A;  4M3Z A;  1IJJ A;  5FRO A;  4DG1 A;  4PWD A;  4AHT A;  1XNR K;  2WON A;  4LH4 A;  3SPZ A;  4CGG A;  4DQS A;  2W6K A;  3DRS A;  5F0X A;  2E2O A;  4ID1 A;  4CJF A;  5BR8 K;  1Z25 A;  4OGE A;  4FLW A;  5C42 A;  5T7B A;  1XQS C;  3LM2 A;  4FLT A;  3H45 C;  3C6U A;  1TKD A;  3CC4 N;  2P9P A;  3HJF A;  1VQ4 N;  1U49 A;  1ITG A;  2YKM A;  4CFB A;  3UE5 A;  1NJX A;  2G8V A;  4IDK A;  5AQF A;  2BH1 A;  4CI6 A;  2ITM A;  2G8H A;  3ITH A;  2PZS A;  5CYM A;  4EHU A;  1KLN A;  4DTP A;  3L2W A;  4B8C A;  1HNI A;  3TAP A;  4JRQ A;  4R79 A;  2V7Y A;  4B9L A;  3SUP A;  3HOS A;  5KRS A;  4DV7 K;  4XH4 A;  4YDU C;  4PKI A;  4QOZ B;  3L0Q A;  3C0B A;  3P5J A;  5KPR A;  1NMD A;  2HF3 A;  4N47 A;  4BR0 A;  2DY4 A;  4FCY A;  4M3X A;  4B9Q A;  3VEZ A;  1S1V A;  3OJS A;  1REV A;  2E1Y A;  4UQG A;  4EHT A;  3AVA A;  1HLU A;  3BF1 A;  4I9Q A;  1ZBS A;  4FJ7 A;  4OKK A;  1JXE A;  4JKG A;  3C95 A;  4FJI A;  3SBT A;  1HMV A;  3M1F A;  4DSK A;  4ICL A;  3M6G A;  3CXC M;  2ZQB A;  1J53 A;  4TSX A;  3LAL A;  1TVR A;  4YOT A;  2O8C A;  1C1A A;  3QBX A;  4BY9 C;  2GX9 A;  4JI7 K;  4CIG A;  4DSI A;  2ZJP L;  3J7Y P;  1JJ2 M;  1VSE A;  4AHV A;  2NRW A;  3R8E A;  4CJT A;  2QWQ A;  3BGR A;  3T1H K;  5C15 A;  4RW4 A;  4C23 A;  3QBW A;  4Z4H A;  5M1F A;  2HVH A;  4CEC A;  1HYS A;  1KC8 O;  4B9N A;  1Y97 A;  3LWL A;  1VQ9 N;  4M3W A;  3RR8 A;  3RR7 A;  5CZ2 A;  1Q9X A;  2HF4 A;  2JWL A;  4CK3 A;  1YT3 A;  3M5R A;  4DKW A;  2BDP A;  3UIQ A;  4N56 A;  3OS0 A;  2YHY A;  4FJL A;  3WNF A;  5E41 A;  3N4Q A;  1ZYQ A;  4WFB L;  3OY9 A;  4PQU A;  5M1K A;  1VQO N;  1NGE A;  4JK8 A;  3SAF A;  4BE1 A;  4ISF A;  2ZF5 O;  3QNN A;  1BQM A;  1WBB A;  2HHX A;  3OYK A;  2VWK A;  2YHB A;  2VGN A;  4DR3 K;  1C0T A;  3NBP A;  3LZJ A;  1GLB G;  3CM5 A;  2HBK A;  3G4S N;  4CK1 A;  4EIA A;  3LZI A;  1S3X A;  4DF8 A;  4GV9 A;  3VQA A;  3QLH A;  5C2D A;  3QDK A;  4AHS A;  1HNX K;  1U2V B;  3VQB A;  1YTA A;  3IMX A;  3UKR A;  4BR2 A;  3AVL A;  1LCU A;  3V81 A;  4QS7 A;  3WXJ A;  1HPZ A;  3SLC A;  3S9H A;  1NOZ A;  2B6A A;  3KK1 A;  3LP2 A;  1JKH A;  5M1Q A;  3NF9 A;  4DTU A;  4U7B A;  1P90 A;  5LMU K;  1VQK N;  2QWR A;  3L2V A;  3O3F A;  3VTI A;  4B1U B;  1VAZ A;  1VSD A;  2P1J A;  2VG5 A;  4A57 A;  3QNO A;  3H3N O;  1NK9 A;  1WSG A;  2BAN A;  3DLL L;  3SJJ A;  4DLE A;  1K8K A;  4MLE A;  2D0A A;  4CGJ A;  3CCJ N;  4UY8 O;  3SMS A;  3QIO A;  3DWL A;  4BVO A;  1EQY A;  3HOT A;  4JKG B;  3SMP A;  4DS5 A;  1ZBL A;  3B8A X;  3HYF A;  3CCS N;  4NLB A;  2P9S A;  4IJA A;  4H8K A;  1L3U A;  2F8S A;  1T6D A;  3SJH A;  1W7A A;  1GLF O;  4XIU A;  2OPQ A;  4CJL A;  4BR9 A;  1VHX A;  4CHN A;  3CCU N;  3FZF A;  1BQN A;  3K9J A;  4CK2 A;  3VQ6 A;  4WF9 L;  3H46 O;  2P9N B;  5AQO A;  3EE9 A;  4FJN A;  3O8M A;  4B3M K;  1K8K B;  3LWM A;  3GOI A;  3E9P A;  1LW0 A;  3VQ9 A;  4JI5 K;  4K43 A;  3O1W A;  3CMA N;  1QVG M;  2Y1J A;  2E6M A;  4JK7 A;  3KK3 A;  1U45 A;  4ZTF A;  5HP1 A;  1JLA A;  3HBT A;  5AQM A;  4FM1 A;  2QWO A;  2BUP A;  4FO0 A;  2D0B A;  2PAV A;  2VWJ A;  3O80 A;  4CGF A;  3K9K A;  3QFU A;  2Q97 A;  2YKN A;  4PKH A;  3HO1 A;  5HRR A;  5KGX A;  3L8B A;  3ULE B;  3KLG A;  2BE2 A;  3AA5 X;  1QHA A;  5CZ1 A;  3ZX3 A;  3EEQ A;  2JGU A;  3DXK B;  4F3T A;  2ZE2 A;  4YOV A;  4A62 A;  2HBL A;  2P9L A;  4L8R B;  4RW7 A;  4BRK A;  3VER A;  5I42 A;  1L3V A;  1RDD A;  1W2B M;  2NLX A;  2HHT A;  2HHU A;  1Z6R A;  3ZX2 A;  1CZB A;  1NKE A;  4FJM A;  3OJU A;  1IKW A;  2KQ2 A;  4OKE A;  3Q7C A;  3WEE B;  3SQ4 A;  3OYA A;  1BI4 B;  3HSC A;  4DU3 A;  1NK8 A;  4HWI A;  4WQ5 C;  4GW6 A;  2QW9 A;  4LFA K;  5SZT A;  3OBW A;  4FWL A;  1DTQ A;  4JKF A;  4GKK K;  4J8F A;  4IEI A;  3TAF A;  2O8F A;  1S6Q A;  1EX4 A;  1KLM A;  4FWR A;  4DFP A;  4DB3 A;  5MLC Q;  3CQ8 A;  3JXU A;  1HR0 K;  3MN5 A;  5HOO A;  4GV3 A;  1BL3 A;  1R59 O;  3MAQ A;  5FPN A;  2OTL N;  3VGK A;  3FZH A;  2FLO A;  1EKE A;  2PBD A;  5LMN K;  1GLJ O;  5IWA K;  1YJW N;  2I5J A;  4E19 A;  1BGX T;  3ULD A;  1N36 K;  3AVK A;  4DU1 A;  1TYQ B;  1NJY A;  3TR8 A;  4KB0 A;  5HRS A;  3CIP A;  3PIO L;  1VSK A;  4H5R A;  2O4I A;  4Y0W A;  4BRN A;  3L2U A;  3DOL A;  3O08 A;  4CJP A;  4IFV A;  1RBT A;  3TU5 A;  4DSE A;  3TSQ A;  4LC9 B;  1YHQ N;  4RW9 A;  3SZ2 A;  4Y1C A;  3B6O A;  2QWL A;  3F73 A;  5FRM A;  4Z4G A;  5F1X A;  2IC3 A;  3SQ0 A;  4CF2 A;  4FWO A;  4IJN A;  2Q3S A;  3LDN A;  5EOY A;  4DTM A;  3NVK A;  2E2Q A;  3MMV A;  3OHR A;  3PY8 A;  3ISN C;  2UXD K;  5KPZ A;  2ZGZ A;  3MWP A;  4BWM A;  5AQX A;  5AZI A;  2KTQ A;  1VRU A;  2RHK A;  1IG9 A;  4HTL A;  4CEF A;  3ZX0 A;  1Q18 A;  4CZH A;  1BIZ A;  3D2E B;  4G1Q A;  4X64 K;  1T3V A;  1NJW A;  2BGG A;  2YNH A;  3TAQ A;  4IG3 A;  4FW2 A;  1D5A A;  1N8R O;  3PUF A;  1VSJ A;  2IAJ A;  1K73 O;  4HUG A;  1HYZ A;  1KTQ A;  3C6A A;  4CVN E;  1RDW X;  4O4G A;  3A5N C;  4MLH A;  4O8K A;  3C6T A;  1JXB A;  4DR5 K;  3F2K A;  3KK7 A;  5JVG L;  3P39 A;  3EE8 A;  4LH5 A;  3I8D A;  4GVM A;  4YOU A;  3O4W A;  3KLF A;  3VQD A;  3ZT1 A;  4E7L A;  3TPQ A;  4CEQ A;  4W5O A;  3A8Y A;  4CJK A;  3MN6 A;  4XH1 A;  3D2F A;  2HVI A;  1XMQ K;  4FK4 A;  2P9I B;  4DQI A;  3S3M A;  5GAD P;  1JLQ A;  2IVN A;  2HHV A;  2J4R A;  2KW4 A;  2P9N A;  3ATV A;  2X6N A;  2NZT A;  5ADX H;  4NCB A;  1BWF O;  1NM1 A;  3PO4 A;  3K2P A;  2ZGY A;  1EWR A;  4CZM A;  3KLI A;  5BRE A;  3OS2 A;  4M3Y A;  3QEI A;  1KVC A;  4B1Y B;  4IXC A;  4LD0 A;  4FJG A;  3OTO K;  2PYJ A;  1VSL A;  4JKH A;  4E1N A;  1EP4 A;  4NO7 A;  4OLB A;  1CZA N;  4B1X B;  5J1E A;  1YVU A;  3VF2 A;  3VTH A;  4W5Q A;  4CEZ A;  3ZT4 A;  4QS8 A;  5GAH P;  3TWH A;  4X62 K;  5FRN A;  3NF8 A;  1RDB A;  3ALY A;  4M41 A;  5SWM A;  4FSV A;  4FK0 A;  3CQY A;  2WBN A;  2IVO A;  2NRH A;  1ASU A;  1KVA A;  3AVJ A;  4LF4 K;  4H5W A;  2OYQ A;  3T7Z A;  4Z4E A;  1HX1 A;  4CW7 B;  2KFN A;  3K0S A;  4IO8 A;  1GLA G;  3L2R A;  1KFD A;  3VEO A;  2F4V K;  5KI6 A;  3K5L A;  1HKG A;  1NK5 A;  3KLE A;  2W6L A;  3G6E N;  1GLD G;  2DFE A;  3MXM A;  2I7P A;  2HB5 A;  3LDO A;  5AQR A;  3DRP A;  1T03 A;  1M1K O;  3LP0 A;  3BEX A;  4JHD A;  5AQY A;  2OAN A;  2QA4 N;  4FLY A;  3LAK A;  4IEE A;  4FWN A;  1RT7 A;  5E84 A;  1TKT A;  4CZK A;  2RE2 A;  3CD6 N;  3VEX A;  1MDU B;  4H0P A;  4E7K A;  4NYN A;  5KGW A;  4HUE A;  3NH1 A;  1IBK K;  1XC9 A;  3MN9 A;  3NGY A;  4BAC A;  3J7A P;  4O44 A;  5CYQ A;  4JKB A;  4DSL A;  3MX5 A;  3THV A;  3IAY A;  2AJQ A;  2YV0 X;  4MDA A;  3WNG A;  2VG7 A;  2VGM A;  5AQQ A;  4IZ9 A;  4PL8 A;  4YOX A;  4JI6 K;  1TK0 A;  1J6Z A;  4CJ3 A;  1S6P A;  3WXL A;  2FF6 A;  5AQH A;  4CD1 A;  3GG4 A;  4CEO A;  3F9K A;  3LDL A;  2G8F A;  3TTC A;  3OYD A;  4FWK A;  1VQM N;  5CR4 A;  3LDS A;  3CCV N;  5GIO A;  3K5M A;  1RBU A;  4CFC A;  1VQ7 N;  1XWL A;  3HP9 A;  2FSN A;  3VA3 A;  4ELU A;  3DLE A;  5TKY A;  3QFP A;  3D2F B;  3KIO A;  4NYF A;  2DFH A;  1JLG A;  1YIT N;  1JLB A;  4BR7 A;  3QES A;  3TSU A;  5HRO A;  2HST A;  1RDA A;  4JLH A;  3RSE B;  4AM6 A;  1NBW A;  2YHW A;  2UUA K;  2HHS A;  2V51 B;  3MCP A;  1ZBF A;  2X78 A;  4JI1 K;  5C24 A;  4ELT A;  3U9D A;  3ZLJ A;  2PFU A;  1VK0 A;  2A41 A;  1NK0 A;  2GWK A;  2FBY A;  1DGK N;  4JK9 A;  2VCP A;  3R9P A;  4CJ4 A;  1ASW A;  3WUH A;  4XH5 A;  3PX0 A;  4CEE A;  3VGL A;  1U04 A;  3C7N A;  3V9U A;  1BO5 O;  1KD1 O;  1FKO A;  3VQQ A;  2EX3 A;  2PYL A;  4YDU A;  2OA8 A;  3TAB A;  1LV5 A;  4JKC A;  1EXQ A;  3SBG A;  3BUZ B;  1S1U A;  2JWK A;  4ILJ A;  3NMU A;  1KRP A;  4KKO A;  1TL1 A;  2ETJ A;  4JI8 K;  4B9V A;  3O6W A;  4ZTJ A;  4KAZ A;  2P9S B;  3N4P A;  4AH9 A;  5A2Q O;  4JV5 K;  3KKS A;  4CHZ A;  3VQ8 A;  3NVM A;  2Q31 A;  1VQ5 N;  3I0R A;  1S1T A;  1HNZ K;  4DTR A;  1J5E K;  4F4K A;  2A5X A;  1ASV A;  4AHR A;  4CER A;  5BRD A;  3WNE A;  3SI6 A;  4JS5 A;  3M3Z A;  3LDP A;  1OH8 A;  4FJ9 A;  1VQ6 N;  2RF2 A;  1HJO A;  4YHH K;  3MEC A;  1HKB A;  4KH5 A;  1ATN A;  5GAG P;  5AFU A;  3IFR A;  3ZYY X;  2BTF A;  4OPK A;  3OYH A;  2RKI A;  1HNV A;  2P51 A;  4ELV A;  4AQY K;  1BOT O;  4W5T A;  4DU4 A;  4JI0 K;  1YI2 N;  2GUI A;  5AZJ A;  4B1Z A;  4HCC A;  1QVF M;  3CJ7 A;  4EP5 A;  2FBV A;  5BR9 A;  1U48 A;  3IG1 A;  3MWT A;  1GOA A;  2HBJ A;  1X9M A;  3WQT A;  4A61 A;  4BR4 A;  2G8I A;  2D0O A;  4B9S A;  4JYA K;  5C12 A;  3AGK A;  4RWT A;  3OYC A;  4KHW A;  3THY B;  4C1N K;  1NK4 A;  1YJN N;  1FK9 A;  4CJV A;  1VSF A;  4C8M A;  2OZS A;  1HPM A;  2YHX A;  3OVN A;  4FJX A;  1D8Y A;  2O8C B;  3V4I A;  3I8B A;  4M45 A;  4CJW A;  3A2F A;  3H08 A;  4WQ5 A;  4LFC K;  1ZBU A;  4I9L A;  1KSP A;  2YX6 A;  5CY4 A;  3ZSX A;  5K14 A;  2G8U A;  1HKC A;  3O4N A;  2PY5 A;  2UYT A;  1JCG A;  1SV5 A;  4RW8 A;  1XHX A;  1NK7 A;  4DTN A;  2P9U A;  4DV1 K;  4DR1 K;  3DLK A;  4E7H A;  2VYP A;  1YAG A;  2A6A A;  1ESV A;  4DF4 A;  1TGO A;  2IDO A;  3SUQ A;  4FJH A;  2IVP A;  3LL3 A;  4WE1 A;  3DLB A;  1DT9 A;  3SCX A;  4HVJ A;  3ULE A;  2QM1 A;  2XY7 A;  3LPU A;  4DFJ A;  4JHD B;  1OVY A;  4N41 A;  4OLA A;  3NE6 A;  3HZ6 A;  3VET A;  3CJ9 A;  4H5N A;  4NLC A;  5KQD A;  3NGI A;  2W42 A;  2D0P A;  4F9O A;  3WXI A;  4BRI A;  4CIF A;  3M8R A;  3U3Y A;  4KHQ A;  1UOC A;  4M3T A;  1BIS A;  3P38 A;  5ELZ A;  1BI4 A;  1NMN A;  2YNI A;  3LM9 A;  1WUA A;  3CCR N;  2Q2R A;  5C10 A;  3SUO A;  4DV4 K;  3AVF A;  2E1Z A;  3WT0 A;  3TTD A;  4BRG A;  4DHY A;  3RMC A;  2QXF A;  3CC2 N;  4J2D A;  1A5W A;  2F96 A;  1RT6 A;  5KRT A;  3KK2 A;  1WSJ A;  3QEW A;  4FZX C;  1EWQ A;  4BC5 A;  2NRZ A;  3OS1 A;  4DTX A;  2NRX A;  3H1V X;  1SZ2 A;  5DK5 A;  3CCQ N;  4J2B A;  3V9W A;  1KCF A;  4CES A;  2WC9 A;  1WB9 A;  1IKX A;  2IS3 A;  4M42 A;  1YUW A;  2Q0R A;  5J2M A;  2V52 B;  2ZJR L;  1WOQ A;  4K0K K;  3IDH A;  1L3S A;  4H03 B;  2XRI A;  2Q0U A;  2OPS A;  3CFR A;  2ASM A;  4F8R A;  3ZSV A;  3U4L A;  3R1X A;  1SQK A;  1F21 A;  2P5O A;  4K25 A;  4NCG A;  4IOX A;  2GEM A;  5B8H A;  3HVT A;  3QET A;  2HMI A;  2YJE A;  5LJW A;  1VRT A;  1TUY A;  1CXQ A;  4BRM A;  4WFA L;  3OYJ A;  4GKJ K;  3CFP A;  3D2E A;  4LF6 K;  4DSF A;  3VQ7 A;  2UXB K;  1D9D A;  1ZC6 A;  5FPE A;  3TAE A;  2HNY A;  4JI2 K;  3TTF A;  2P9K A;  1RNH A;  2LSN A;  5ADX A;  4CF0 A;  3U3G A;  3EL2 A;  4HCB A;  4DV0 K;  4LF8 K;  1FXX A;  1E3M A;  1RTD A;  3H1Q A;  2FF3 B;  5AZI B;  3O1B A;  4JN4 A;  3OYF A;  4CJR A;  3IRX A;  3KKR A;  4C8L A;  4H0Y B;  3VN5 A;  4B8A B;  4FWS A;  5KQ8 A;  3A5L C;  2O8E B;  2D0C A;  1LOT B;  2E4L A;  3QER A;  1Q7Y O;  2OZM A;  4KH4 A;  1JLF A;  4N5S A;  3KJV A;  4IFY A;  2GV9 A;  4ILH A;  3KLH A;  1TYQ A;  5J2N A;  1B9F A;  3CME N;  4B3O A;  4HTU A;  1RT4 A;  5BPM A;  3VQC A;  3FZL A;  1YJ9 N;  4EZ6 A;  4PUO A;  4YFU A;  5AQN A;  2ZD1 A;  1RBS A;  3DJC A;  1N33 K;  1C6V A;  4CZI A;  4DLG A;  5TKW A;  1WSE A;  3U9Z A;  4W5R A;  3ATU A;  3CYM A;  5CE3 A;  3MEE A;  4BE2 A;  1D4X A;  1RFQ A;  5HRP A;  1XUP O;  4CED A;  4BRQ A;  4AHU A;  2O8F B;  5JIC A;  2JLE A;  1DLO A;  1X1P A;  4KRF A;  3AO3 A;  5M1P A;  2FC0 A;  3QEP A;  3RMD A;  3WQU A;  4JS4 A;  3HPH A;  4M7X A;  4BRO A;  3DI6 A;  1RTJ A;  2B4J A;  5KPT A;  2GEL A;  1E4F T;  2ATQ A;  1TUU A;  4IOA L;  3AVB A;  2O8D B;  3ID6 A;  4CJS A;  1H1V A;  2Y1I A;  4BGA A;  5EU7 A;  2X74 A;  1UAX A;  1IBL K;  3LP3 A;  3ZSR A;  1IV0 A;  2NRV A;  1R0A A;  3MK6 A;  3CPE A;  1RBV A;  1KAZ A;  3HI0 A;  1W0H A;  4FJ5 A;  1M90 O;  1K8A O;  1A5X A;  4LSL A;  4B9U A;  4BRH A;  3OA9 A;  4BRP A;  4Z4I A;  1QQC A;  3THY A;  3ENB A;  2O8D A;  2YHA A;  5FPD A;  3EZW A;  1L5U A;  3VPZ A;  5DM6 L;  1LWF A;  4KO0 A;  4CZE A;  2W41 A;  5JS2 A;  3OW2 M;  4C8O A;  2A3Z A;  4BDZ A;  3VEY A;  1NGG A;  3LP1 A;  3THX B;  3SK3 A;  4A5A A;  4I7F A;  4FZY A;  3O9S A;  3SQ1 A;  3DXK A;  4QAG A;  4Q0B A;  2EWS A;  4J2E A;  4KHN A;  1BHL A;  3CJA A;  1NKC A;  1RCH A;  5JLH A;  1WAJ A;  4C1N I;  4E0D A;  2QTD A;  5IT9 O;  1NWK A;  4GNI A;  4Z4C A;  4IFE A;  3ZET B;  4BC4 A;  4KI4 A;  3CET A;  4KV8 A;  3G0Z A;  1RT1 A;  4FWQ A;  4V19 S;  3VQE A;  1JCE A;  3DXM B;  1HNW K;  3IUC A;  1BCM A;  3RRG A;  4FWP A;  3B6P A;  4CHQ A;  3I55 N;  1FW6 A;  2W40 A;  3O9U A;  4E89 A;  3OYB A;  2XO7 A;  3MX2 A;  3RSE A;  3O3H A;  5GIP A;  3MEG A;  4IWV A;  3NAE A;  3MCA B;  4OPJ A;  3CF5 L;  4BC3 A;  2NNW A;  1LW2 A;  4DWI A;  4OPA A;  4CBX A;  1VSM A;  5AQK A;  4CFD A;  4B9M A;  1HQU A;  2E20 A;  2B5J A;  2Z1I A;  4DTO A;  1A5V A;  3SQ2 A;  4BGB A;  1BA0 A;  3RMA A;  1TKZ A;  3AO1 A;  4RG8 A;  2ZM6 K;  3VF4 A;  4E3S A;  1NU0 A;  3AV9 A;  4O0J A;  2UUB K;  4OJR A;  3FZK A;  4KHU A;  3U8X A;  4CEA A;  1NKB A;  3HST B;  3KHY A;  3PX6 A;  3T19 A;  4WCE L;  1C1C A;  4DR7 K;  1U2V A;  4CZF A;  3F5T A;  4R5P A;  1WN7 A;  1ATS A;  4GVE A;  3R6M A;  4QS9 A;  3EY1 A;  2CGK A;  3ZT0 A;  1YTU A;  1QSS A;  1ZXO A;  4YY3 K;  3ASM A;  5BPN A;  2GTD A;  1EO1 A;  4DSJ A;  4GY2 B;  1GLL O;  3DYA A;  3F9M A;  3C94 A;  3O4Q A;  4CF9 A;  2O8E A;  4I6M A;  4ISE A;  2O8B A;  2FSJ A;  3MN7 A;  4AIL C;  3V9Z A;  3P4I A;  2DPN A;  3O9T A; 
#chains in the Genus database with same CATH homology
 4F4K A;  3V1R A;  1VSD A;  1ASV A;  3K59 A;  2P1J A;  2VG5 A;  4AHR A;  4CER A;  1J54 A;  3WNE A;  3QNO A;  3VA0 A;  1NK9 A;  1WSG A;  4DTJ A;  4FLV A;  1S9E A;  1JL2 A;  2BAN A;  4KI6 A;  3M8S A;  3SI6 A;  3SJJ A;  1IKV A;  4JS5 A;  4F2R A;  4DLE A;  3M8Q A;  2D0A A;  3ZT2 A;  4CGJ A;  1T8E A;  4FJ9 A;  4DQR A;  2RF2 A;  2QKB A;  3MEC A;  3SV4 A;  3QIO A;  4NCA A;  1U47 A;  4CJE A;  4B08 A;  3SV3 A;  4F3O A;  4OPK A;  3OYH A;  3AA2 A;  2RKI A;  1HNV A;  4DS5 A;  1ZBL A;  2P51 A;  4ELV A;  3HYF A;  1TAU A;  4MFB A;  4B9T A;  4W5T A;  1UA0 A;  4H8K A;  4DU4 A;  1L3U A;  1RIL A;  2F8S A;  4E7I A;  4DQQ A;  2GUI A;  4HCC A;  4C8K A;  4EP5 A;  1U48 A;  2FBV A;  1GOB A;  3IG1 A;  2OPQ A;  4CJQ A;  4XIU A;  1TK8 A;  1Q9Y A;  1GOA A;  2FBX A;  4KTZ A;  4CJL A;  3SUN A;  4CIE A;  4CHN A;  1X9M A;  1S1X A;  4DTR A;  2G8I A;  1BQN A;  4CK2 A;  1T7P A;  3VQ6 A;  3U6F A;  3OYI A;  1X9W A;  1W9H A;  4B9S A;  4FJN A;  3HM9 A;  1ZBI A;  3ZSQ A;  4K8X A;  3LWM A;  1LW0 A;  1RTI A;  3VQ9 A;  1NJZ A;  3KTQ A;  1S1W A;  3NGZ A;  2P5G A;  4FLZ A;  4KB1 A;  4N76 A;  2HHW A;  1RT3 A;  2Y1J A;  1SL0 A;  2E6M A;  4OKJ A;  3OYC A;  3KK3 A;  3O3G A;  4KHW A;  3OYN A;  2QKK A;  1LWC A;  1U45 A;  4ZTF A;  4ID5 A;  1NK4 A;  5HP1 A;  3NCI A;  1FK9 A;  4CJV A;  1VSF A;  1JLA A;  4C8M A;  2G8K A;  1RDC A;  4PA1 A;  3PV8 A;  2OZS A;  4FM1 A;  3OVN A;  4FJX A;  3RRH A;  1D8Y A;  1LAW A;  3ZSY A;  4CE9 A;  4CJU A;  3K57 A;  3RWU A;  5J2P A;  3V4I A;  2D0B A;  4HHT A;  3CG7 A;  2VWJ A;  3DLH A;  4Z4F A;  1Q8I A;  4CGF A;  1G15 A;  5J2Q A;  4Y1D A;  2YKN A;  3LAM A;  4LY7 A;  4M45 A;  3A2F A;  5HRR A;  4CJW A;  1K6Y A;  3H08 A;  3S3O A;  3HO1 A;  5KGX A;  4H4M A;  3KLG A;  1VSH A;  3L8B A;  1MU2 A;  2BE2 A;  3AA5 X;  5CZ1 A;  1ZBU A;  3QEX A;  4I9L A;  4MQ3 A;  1KSP A;  5CY4 A;  2JGU A;  4E7J A;  2OPP A;  3VQ5 A;  3ZSX A;  1UA1 A;  4F3T A;  5K14 A;  2G8U A;  2HNZ A;  2Z1H A;  2ZE2 A;  3O4N A;  2PY5 A;  1WSI A;  4IG0 A;  3V9S A;  1LWE A;  5I3U A;  3TAR A;  1SV5 A;  4L8R B;  4RW7 A;  4RW8 A;  1XHX A;  4IBN A;  3LPT A;  3DMJ A;  5I42 A;  1C1B A;  4FW1 A;  4H4O A;  1RDD A;  1NK7 A;  1L3V A;  4KHS A;  4DTN A;  3DLK A;  3AVM A;  1NOY A;  2HHT A;  3PO5 A;  4BWJ A;  2HHU A;  4E7H A;  1CZB A;  1NKE A;  3G10 A;  1FKP A;  4DF4 A;  3SUQ A;  3TAN A;  4FJM A;  1TV6 A;  1TGO A;  2IDO A;  3TAM A;  3OJU A;  1IKW A;  4FJH A;  2KQ2 A;  4OKE A;  4CHO A;  3AA4 A;  3FFI A;  4WE1 A;  3DLB A;  3SQ4 A;  3SCX A;  3OYA A;  1BI4 B;  4HVJ A;  4DU3 A;  2XY7 A;  1NK8 A;  3IS9 A;  3LPU A;  3VQ4 A;  3QO9 A;  4GW6 A;  4FJJ A;  4DFJ A;  1N5Y A;  5SZT A;  1DTQ A;  3ZSZ A;  4N41 A;  3TAF A;  4OLA A;  4BDY A;  1S6Q A;  1EX4 A;  3NE6 A;  1KLM A;  1JLC A;  1QE1 A;  4DFP A;  4FJK A;  2VG6 A;  4O5B A;  1XI1 A;  3CQ8 A;  3NFA A;  3NF7 A;  3NGI A;  3AVH A;  2W42 A;  1BL3 A;  4E1M A;  1IO2 A;  4LSN A;  4W5N A;  3MAQ A;  4CIF A;  3M8R A;  3S3N A;  3MXJ A;  3U3Y A;  4KHQ A;  1UOC A;  4M3T A;  1EKE A;  4CHP A;  1BIS A;  1QHT A;  3NH2 A;  1N6Q A;  2I5J A;  1BI4 A;  4CHY A;  2YNI A;  2E6L A;  4RW6 A;  3ZCM A;  4E19 A;  1BGX T;  3K5N A;  3ULD A;  2RPI A;  3AVK A;  3SUO A;  4K8Z A;  4DU1 A;  4QCL A;  3AO5 A;  3AVF A;  3HL8 A;  3RMC A;  4FXD A;  2QXF A;  4J2D A;  1A5W A;  2F96 A;  3TR8 A;  3OYM A;  1NJY A;  4KB0 A;  3AVI A;  5HRS A;  4J2A A;  1UWB A;  1VSK A;  3I0S A;  2O4I A;  3L2U A;  1RBR A;  1RT6 A;  5HLF A;  5KRT A;  2F8T A;  3KK2 A;  1WSJ A;  3QEW A;  3DOL A;  4FZX C;  4CJP A;  4IFV A;  1RBT A;  3OYG A;  2O4G A;  3P1G A;  3OS1 A;  4DSE A;  4DTX A;  1D9F A;  3KD1 E;  2DFF A;  3HP6 A;  1RT2 A;  2XY8 A;  5DK5 A;  1WLJ A;  4J2B A;  3AVN A;  3V9W A;  1KCF A;  4RW9 A;  4CES A;  5FDL A;  5HRN A;  3SZ2 A;  4Y1C A;  1IKX A;  3B6O A;  2IS3 A;  4C8N A;  4M42 A;  3F73 A;  5D3G A;  2HHQ A;  5FRM A;  5J2M A;  1SKW A;  1NK6 A;  4Z4G A;  4CF8 A;  2IC3 A;  1D9D A;  1KVB A;  4O55 A;  3SQ0 A;  3QEV A;  1LAV A;  4CF2 A;  3SYZ A;  3JYT A;  4IKF A;  4KRE A;  3K58 A;  1L3S A;  5HBM A;  2Q3S A;  1GOC A;  2XRI A;  4DTM A;  1QTM A;  2HND A;  4DQP A;  4YNQ A;  1RT5 A;  1HQE A;  2OPS A;  3CFR A;  3PY8 A;  1EET A;  3M8P A;  4F8R A;  3ISN C;  3ZSV A;  2G8W A;  1QS4 A;  3L3V A;  4BWM A;  2RN2 A;  1F21 A;  2X6S A;  2P5O A;  3DOK A;  2KTQ A;  4NCG A;  3HXM A;  3VQP A;  2KFZ A;  3HVT A;  3QET A;  2HMI A;  1VRU A;  3L2Q A;  3HT3 A;  1IG9 A;  1TKX A;  1VRT A;  1CXQ A;  1WSF A;  2YNG A;  4CEF A;  3OYJ A;  4FZZ A;  1BIZ A;  3CFP A;  4G1Q A;  4KFB A;  3EZ5 A;  4DSF A;  3T1A A;  1WAF A;  3VQ7 A;  5C25 A;  4OGC A;  1NJW A;  2BGG A;  2YNH A;  1B9D A;  4IG3 A;  3TAQ A;  5JS1 A;  4FW2 A;  4GMJ B;  4DFK A;  3TAG A;  3L3U A;  1Z26 A;  4CJ5 A;  3HPG A;  1D5A A;  4DMN A;  2HNY A;  3TAE A;  3AVG A;  3CM6 A;  3PUF A;  4KTW A;  5DMR A;  1RNH A;  1VSJ A;  2LSN A;  2IAJ A;  1DTT A;  3JSM A;  1IH7 A;  4CF0 A;  3AO4 A;  3U3G A;  4HUG A;  4F2S A;  1HYZ A;  1KTQ A;  1O1W A;  3QIN A;  1SL1 A;  4HCB A;  1U4B A;  1I39 A;  4EP4 A;  1FXX A;  3K5O A;  1SKR A;  4FM0 A;  4O4G A;  1RTD A;  1BCO A;  1I3A A;  1JXB A;  3C6T A;  2YNF A;  1J9A A;  3OYF A;  2OPR A;  3AO2 A;  3IRX A;  4CJR A;  3KKR A;  2WOM A;  2EHG A;  4C8L A;  2GBZ A;  4KPY A;  4M3R A;  4Z0U A;  4LH5 A;  1TL3 A;  3EYZ A;  1J5O A;  3HK2 A;  3I8D A;  4GVM A;  3OYE A;  3KLF A;  3D0P A;  2IOC A;  3VN5 A;  3ZSO A;  3VQD A;  4B8A B;  3ZT1 A;  4Q5V A;  1SUQ A;  2R7Y A;  4E7L A;  2DTU A;  4CEQ A;  4W5O A;  4AHC A;  4CJK A;  2D0C A;  3DRR A;  3QIP A;  1WSH A;  2E4L A;  4KTQ A;  2HVI A;  3QER A;  5KTQ A;  2OZM A;  4FK4 A;  4DQI A;  3S3M A;  1JLF A;  3OYL A;  1JLQ A;  1CLQ A;  2HHV A;  4N5S A;  3KJV A;  4IFY A;  2KW4 A;  2GV9 A;  3KLH A;  4FLX A;  1TAQ A;  2X6N A;  5J2N A;  1B9F A;  4NCB A;  4B3O A;  3PO4 A;  4HTU A;  3K2P A;  1RT4 A;  2Z1G A;  3CFO A;  3NDK A;  4M3Z A;  3KLI A;  4CEB A;  3VQC A;  3OS2 A;  5FRO A;  4M3Y A;  3QEI A;  1KVC A;  4DG1 A;  4LD0 A;  4FJG A;  4PWD A;  4AHT A;  1C0U A;  2WON A;  4LH4 A;  3SPZ A;  2NUB A;  2PYJ A;  1VSL A;  4YFU A;  4E1N A;  4EZ6 A;  4PUO A;  1EP4 A;  2ZD1 A;  4CGG A;  4DQS A;  3V6D A;  1RBS A;  3DRS A;  4FJ8 A;  3DLR A;  1TK5 A;  4OLB A;  4DFM A;  4CF1 A;  1C6V A;  1L3T A;  5J1E A;  4ID1 A;  3E01 A;  4CJF A;  1YVU A;  4DLG A;  1Z25 A;  4OGE A;  4W5Q A;  4HUF A;  4CEZ A;  5C42 A;  4FLW A;  3ZT4 A;  1WSE A;  5T7B A;  4W5R A;  2XY6 A;  4FLT A;  3C6U A;  1TKD A;  1QSL A;  3TWH A;  1RTH A;  3CYM A;  5FRN A;  1CZ9 A;  3NF8 A;  4FK2 A;  1RDB A;  3ALY A;  3MEE A;  4M41 A;  4BE2 A;  3HJF A;  5SWM A;  1XHZ A;  4ZHR A;  1U49 A;  1ITG A;  2YKM A;  4EZ9 A;  5HRP A;  4CFB A;  4FK0 A;  1NJX A;  1S5J A;  2G8V A;  4IDK A;  4CED A;  1ASU A;  3PX4 A;  2KZM A;  1KVA A;  4AHU A;  3AVJ A;  2OYQ A;  2JLE A;  1DLO A;  2G8H A;  1X1P A;  3ITH A;  3AO3 A;  1T05 A;  4KRF A;  3MED A;  4BE0 A;  2PZS A;  4Z4E A;  5CYM A;  2KFN A;  1SL2 A;  2FC0 A;  3QEP A;  3RMD A;  3L2R A;  1KFD A;  5KI6 A;  1KLN A;  4DTP A;  4JS4 A;  3HPH A;  3L2W A;  3K5L A;  4B8C A;  1HNI A;  3TI0 A;  3TAP A;  2XY5 A;  3DI6 A;  4JRQ A;  1NK5 A;  4PY5 A;  1RTJ A;  3KLE A;  2B4J A;  4B9L A;  3SUP A;  3NHG A;  2DFE A;  5KRS A;  3MXM A;  2ATQ A;  2HB5 A;  1JLE A;  3AVB A;  3DRP A;  4QOZ B;  1T03 A;  1HRH A;  4FLU A;  3LP0 A;  3RTV A;  3P5J A;  4N47 A;  4CJS A;  2DY4 A;  4FCY A;  2Y1I A;  5EU7 A;  2X74 A;  1UAX A;  2A1S A;  4FLY A;  4M3X A;  3LAK A;  3SNN A;  3LP3 A;  3ZSR A;  1RT7 A;  4FM2 A;  1S1V A;  1TKT A;  3OJS A;  1R0A A;  1REV A;  2HW3 A;  1RBV A;  4JRP A;  1W0H A;  4UQG A;  4FJ5 A;  3AVA A;  4E7K A;  1A5X A;  4NYN A;  4I9Q A;  1X9S A;  4LSL A;  5KGW A;  4FJ7 A;  4OKK A;  1JXE A;  4B9U A;  3C95 A;  4FJI A;  3ZT3 A;  1HMV A;  4HUE A;  3NH1 A;  1CXU A;  4CGD A;  4ICL A;  4DSK A;  4Z4I A;  2ZQB A;  1HYV A;  1QQC A;  3V1Q A;  1XC9 A;  4BAC A;  3NGY A;  1J53 A;  2KZZ A;  3LAL A;  4O44 A;  4TSX A;  1TVR A;  2YHA A;  1C1A A;  1WNS A;  1BIU A;  5CYQ A;  4DSL A;  1L5U A;  4DTS A;  3AA3 A;  4CIG A;  1LWF A;  3THV A;  4KO0 A;  3IAY A;  5JS2 A;  4DSI A;  2AJQ A;  2YV0 X;  4FYD A;  4C8O A;  3WNG A;  2VG7 A;  1VSE A;  4BDP A;  4BDZ A;  1C0M A;  4AHV A;  3LP1 A;  3T3F A;  1HJR A;  4CJT A;  1TK0 A;  1VSI A;  4I7F A;  1S6P A;  4CJ3 A;  4FZY A;  3SPY A;  4KHY A;  3SQ1 A;  3BGR A;  4RW4 A;  2IGI A;  4QAG A;  4Q0B A;  3NF6 A;  4CEO A;  4O0I A;  3F9K A;  2G8F A;  4J2E A;  3OYD A;  4Z4H A;  1B92 A;  4KHN A;  1BHL A;  2ITG A;  1NKC A;  4CEC A;  3LDS A;  1RCH A;  3K5M A;  1RBU A;  4CFC A;  4B9N A;  1HYS A;  2HVH A;  1XWL A;  1WAJ A;  4E0D A;  3HP9 A;  2D5R A;  1Y97 A;  3LWL A;  3VA3 A;  4Z4C A;  4ELU A;  3DLE A;  4M3W A;  4NYF A;  3KIO A;  3RR8 A;  2DFH A;  3RR7 A;  1JLG A;  5CZ2 A;  1Q9X A;  4KI4 A;  4CK3 A;  4KV8 A;  1YT3 A;  3G0Z A;  2BDP A;  1RT1 A;  4N56 A;  3UIQ A;  1JLB A;  3OS0 A;  3VQE A;  3QES A;  5HRO A;  1BCM A;  2A1R A;  3RRG A;  3AVC A;  1RDA A;  1IKY A;  3B6P A;  4CHQ A;  3V1O A;  3WNF A;  4JLH A;  5E41 A;  4E89 A;  3OYB A;  4FJL A;  1ZYQ A;  2XO7 A;  3OY9 A;  3O3H A;  4PQU A;  3MEG A;  3D45 A;  3NAE A;  2HHS A;  4CFA A;  1ZBF A;  2X78 A;  3KD5 E;  4OPJ A;  3RMB A;  1LW2 A;  4BE1 A;  5C24 A;  4DWI A;  1ZBH A;  4ELT A;  1VSM A;  3HPO A;  3QNN A;  1BQM A;  4CFD A;  4B9M A;  1HQU A;  3HVR A;  2HHX A;  1VK0 A;  2B5J A;  2Z1I A;  4DTO A;  1A5V A;  4FVM A;  2VWK A;  4OVL A;  3OYK A;  3SQ2 A;  1NK0 A;  2YHB A;  2FBY A;  3MXI A;  3BDP A;  3RMA A;  1TKZ A;  3AO1 A;  4RG8 A;  4CJ4 A;  1ASW A;  1C0T A;  1QSY A;  4E3S A;  4CGI A;  3AV9 A;  3PX0 A;  4O0J A;  4CEE A;  3V9X A;  3DLG A;  1U04 A;  3NBP A;  3LZJ A;  3CM5 A;  3V9U A;  3P83 D;  4OJR A;  4M3U A;  4CCH A;  4CK1 A;  1S9G A;  3LZI A;  4KHU A;  4CEA A;  4DF8 A;  1NKB A;  3HST B;  1FKO A;  3QLH A;  3VQA A;  3VQQ A;  3ZSW A;  3NH0 A;  2EX3 A;  2FBT A;  3PX6 A;  2PYL A;  4AHS A;  2OA8 A;  3T19 A;  3TAB A;  1C1C A;  1LV5 A;  1EXQ A;  3VQB A;  1YTA A;  4R5P A;  1WN7 A;  2XHB A;  4CGH A;  1JL1 A;  3EY1 A;  3ZT0 A;  1KFS A;  1S1U A;  1YTU A;  3AVL A;  2Z1J A;  3V81 A;  1HPZ A;  1SKS A;  3S9H A;  1QSS A;  1NOZ A;  2B6A A;  3KK1 A;  1KRP A;  3ASM A;  1TL1 A;  1JKH A;  3LP2 A;  2ETJ A;  3LAN A;  4KKO A;  4B9V A;  4ZTJ A;  3DYA A;  3O4Q A;  4DSJ A;  3C94 A;  4KAZ A;  4I2P A;  4CF9 A;  3NF9 A;  4AH9 A;  4DTU A;  3WNH A;  3KKS A;  4CHZ A;  3VQ8 A;  2QK9 A;  3DM2 A;  4AIL C;  3V9Z A;  4I2Q A;  3L2V A;  3O3F A;  3I0R A;  1S1T A;  4DS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...