1GOBA

Cooperative stabilization of escherichia coli ribonuclease hi by insertion of gly-80b and gly-77-> ala substitution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQAITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Cooperative stabilization of Escherichia coli ribonuclease HI by insertion of Gly-80b and Gly-77-->Ala substitution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
total genus 50
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1gobA00
3HP9A 1TK8A 4DF4A 4C8KA 1S9EA 2OPQA 1BGXT 2B4JA 3I0SA 5HRSA 3ZSXA 2G8WA 3HM9A 1IH7A 1NKBA 3NGZA 1JLBA 5JS1A 4B3OA 2XRIA 4OGEA 3HK2A 4CJUA 2XY8A 4EZ6A 4MFBA 1T8EA 2WONA 2IAJA 4Z4GA 4EP4A 5D3GA 4HUFA 2Z1GA 4FJNA 3KD1E 3AVIA 4I2QA 3K2PA 4JRQA 2X6NA 4BACA 1NK4A 1YT3A 2YHBA 3CM5A 2JGUA 4IBNA 4DTXA 4NCAA 4Y1DA 2D0CA 4CGIA 1VSDA 4KV8A 1U45A 3RRGA 1S1WA 5FRNA 4KKOA 3VQ7A 3QNNA 2DFFA 2FBVA 4DFKA 1KCFA 3S9HA 1LV5A 1U04A 1SUQA 3VQPA 4R5PA 1VSLA 1L5UA 4L8RB 4KTZA 1RTJA 4CESA 4FJMA 5C24A 2D0AA 3E01A 1TKDA 4QAGA 3SPZA 5CYMA 4BE2A 3U3GA 4IFVA 4CJ5A 2D0BA 3KKSA 3IS9A 4H4OA 3JSMA 5HLFA 4K8ZA 4M42A 4QOZB 4C8NA 1NJYA 4WE1A 1SL2A 4O55A 4CHNA 1U48A 4ID5A 4I9QA 1QSYA 4OVLA 4PQUA 2HHWA 1VK0A 4DTRA 4CJLA 4NCBA 3OYNA 1U49A 5FDLA 1RBRA 3KJVA 3OYKA 4Z4HA 1ZYQA 1JLFA 4CEBA 4CK1A 3OYHA 2XHBA 3AVLA 4M3WA 3V1QA 1HPZA 1S1VA 4IFYA 4CE9A 1WLJA 4BE0A 4E7LA 1QTMA 1RTIA 1C1CA 3NF9A 1HQUA 3DM2A 1A5XA 3CFPA 4AILC 1G15A 2Q3SA 3SUNA 4XIUA 1N5YA 3SNNA 1RTDA 2FBYA 5HROA 4FK2A 4K8XA 1KTQA 4Q0BA 4FJ5A 1RT1A 4DSJA 1LAWA 3PX4A 2YNGA 3QNOA 2DTUA 1T03A 4ICLA 4BE1A 4M3UA 3LZJA 1MU2A 1HQEA 1B9DA 1TKXA 2JLEA 5CZ2A 3HVTA 3WNHA 4CJSA 3HP6A 3V9WA 3PO4A 1LWEA 3LPUA 1IKWA 2BANA 4CEZA 3RR8A 4FJXA 3S3NA 2GUIA 1A5WA 1FKPA 1JLQA 2A1SA 1HRHA 4FM2A 3SV3A 1L3VA 1Z26A 1UAXA 3P83D 3KK3A 1ASVA 3A2FA 3V9SA 3VQ9A 1JL1A 5KRTA 4CGFA 4O5BA 1CXUA 4CFDA 2P51A 1KFDA 3QIPA 3OYAA 3ZT3A 4KB0A 3I8DA 4E1MA 5CYQA 5J2NA 3TAPA 3OS0A 1X9MA 3LP1A 3L8BA 4LH4A 2HB5A 1UA1A 3SUQA 3V1RA 4RW7A 3L3UA 3MXJA 1HYVA 5HBMA 4M3RA 3SZ2A 1IO2A 1TL3A 3HT3A 3CM6A 2I5JA 5E41A 3LANA 2YNIA 4BWJA 3RMAA 3M8RA 1CZBA 3KLFA 3SCXA 1DTQA 3HXMA 3C94A 3DRRA 5SWMA 3NHGA 1RDBA 3ALYA 1ZBLA 1WSFA 3AA5X 3O3FA 3HPOA 4DQSA 3AO3A 4EP5A 3RMBA 1UA0A 3PO5A 1JXBA 3JYTA 3LP0A 3V6DA 4ELTA 4OGCA 2ZD1A 4ELVA 3C95A 3D45A 4CJTA 2G8HA 4DG1A 4KHNA 4B8AB 4FJLA 4FM0A 3ZSWA 1D5AA 1RNHA 3SQ0A 4FCYA 3QETA 3O4NA 2ATQA 1UWBA 4KHQA 4H4MA 5KGXA 4DFJA 3SQ2A 2VG5A 5K14A 4Z4CA 3L3VA 4IG0A 3G10A 1S1UA 3DLGA 4E7IA 1NOZA 3U6FA 2RKIA 2IDOA 4KRFA 3OYLA 1IKXA 4OKEA 4J2AA 4CIFA 2GV9A 4CEFA 4LSNA 1NJWA 5KRSA 1D8YA 1BISA 2PZSA 3OVNA 2KZMA 3T19A 1TVRA 2HMIA 4GW6A 2OYQA 3D0PA 1X9WA 4KREA 3DOLA 1TGOA 5JS2A 4JLHA 4CFAA 3V9XA 3DLHA 4O0IA 1VSKA 1RBSA 3AO1A 4J2BA 3AVFA 1C0UA 2OZSA 4KB1A 1XI1A 1Q9YA 4F3TA 1C0MA 3NF7A 3HL8A 3QERA 1B9FA 3KIOA 1WSJA 4JS5A 1SKWA 2VWJA 4FJKA 2F96A 4FW2A 3EZ5A 1KFSA 4FJIA 2BGGA 1C6VA 3CYMA 4AH9A 4B9TA 2HVIA 1J9AA 4CECA 3C6TA 3OYFA 5J2MA 1HNIA 3ULDA 2VWKA 3LZIA 3UIQA 4KHSA 3SPYA 2IGIA 3SI6A 4KI6A 3H08A 4KHWA 3AA4A 1A5VA 2P1JA 3SUPA 1NK7A 4EZ9A 2WOMA 3TANA 1X9SA 3TAEA 1L3UA 3KLGA 3ISNC 4CIGA 5FRMA 1C1BA 2OZMA 3AO5A 1UOCA 4PWDA 3OYGA 3RMCA 1JLCA 4AHUA 3OYCA 1JLEA 3HPGA 1EKEA 3RR7A 4KAZA 2O4IA 1RBTA 3NF8A 2AJQA 1BI4B 3KLIA 4FJGA 4Z4IA 4DFMA 3OJUA 4Z4EA 1KLNA 4NYNA 4N47A 1NJXA 4FJJA 5I42A 4C8MA 2ZE2A 1QS4A 1J53A 3K5MA 4MQ3A 3VQ6A 1C1AA 3AV9A 1U47A 3DRSA 3K5OA 1CXQA 1VSEA 2B6AA 4FK0A 2HHSA 4CJPA 4HTUA 1SV5A 1JXEA 4IG3A 3DLEA 1QSSA 1TKZA 3CFOA 5J1EA 3P5JA 1NJZA 2KZZA 4C8LA 5CZ1A 3RMDA 4CF9A 2G8VA 1U4BA 4AHRA 4NCGA 5EU7A 2HHUA 4I2PA 2PYJA 2Z1HA 3QESA 3M8PA 4DSIA 1DTTA 3P1GA 1SKSA 1QSLA 4OLAA 3QEVA 2G8IA 1Y97A 1JLGA 3B6PA 4I7FA 5HRRA 1VRUA 1WSHA 3QEIA 4DU1A 3SQ1A 3AVAA 3VQ8A 4E7HA 3HO1A 1S9GA 1YTAA 4CEAA 3NH0A 4DS5A 3AVCA 3V4IA 4HHTA 1BIUA 4Z4FA 4N41A 4CF2A 4CHPA 1TV6A 1B92A 1WSGA 1K6YA 1HYZA 2Y1JA 3M8QA 4N76A 1RBUA 1S1XA 3SQ4A 4CGDA 3KLHA 1WSIA 4FJ7A 3I0RA 4CJ4A 1RILA 2F8SA 2HHQA 4CJKA 1ASWA 4HCBA 3QEWA 4RW6A 4HUGA 5J2PA 1NK6A 3SYZA 1N6QA 4JS4A 1IKYA 4FLVA 4OJRA 3VQ4A 3LAMA 3C6UA 4AHVA 2OPRA 4B9SA 4Z0UA 2DY4A 1GOBA 1W9HA 2D5RA 1I39A 3VQCA 4DSFA 4LH5A 4ZTJA 1Q8IA 1S6QA 4KO0A 1YTUA 1CLQA 4DTJA 2B5JA 2W42A 3PUFA 4IDKA 3TAMA 1EXQA 4DFPA 1SL1A 2YKMA 3ASMA 1QHTA 1YVUA 4FLTA 4HCCA 4KPYA 2P5GA 4FZZA 3NF6A 4CGJA 1TKTA 3OY9A 4CK2A 3AVHA 1J54A 4B9UA 1LAVA 4BDPA 4W5RA 3AVMA 3ZT4A 4AHTA 3VA0A 4FXDA 1S5JA 1EETA 2HHVA 2EHGA 3NCIA 4CJQA 3T3FA 2XO7A 2R7YA 1LWCA 1RDCA 3OJSA 5J2QA 2PYLA 1NOYA 5HRPA 4W5NA 1EP4A 1R0AA 4E89A 1ZBIA 3LPTA 4RW8A 1J5OA 3S3MA 4M3ZA 2XY7A 3BGRA 3LP2A 4B9MA 3F9KA 1C0TA 2VG6A 4ZTFA 1LWFA 4B8CA 1IKVA 3PY8A 1TK0A 2QXFA 4DU3A 2G8KA 4RW4A 3RTVA 3DLRA 2X6SA 2YHAA 3KK2A 4B9LA 3VQDA 3LAKA 4C8OA 1HYSA 4B9NA 4IKFA 1BL3A 4FM1A 4FVMA 3TI0A 3OYMA 3VQ5A 3U3YA 3VA3A 4KTWA 5DK5A 3WNEA 1RCHA 1Z25A 3F73A 1T7PA 2BDPA 1F21A 4AHSA 3VN5A 2G8FA 4DTUA 4DSKA 2KTQA 1WSEA 4N56A 2GBZA 2Z1JA 3VQEA 1BIZA 2EX3A 2RPIA 1SL0A 5CY4A 4FLZA 3SUOA 4CEQA 4J2EA 1RT2A 4DQPA 2QKKA 1XWLA 4O4GA 3K57A 3TARA 2KQ2A 4FJ8A 4Q5VA 4FZXC 4PUOA 4G1QA 5HRNA 2Z1IA 4AHCA 4FLWA 3L2WA 4OKJA 1NKEA 1HJRA 4JRPA 3TWHA 4DTMA 2KFNA 3DOKA 4PA1A 4CHZA 4CJVA 3K5LA 4M3XA 1D9DA 1HNVA 2F8TA 2NUBA 1XHXA 4CJRA 4YNQA 3NGIA 4NYFA 4DQRA 4O0JA 4DWIA 4FZYA 3K5NA 2IC3A 1WAJA 4DLEA 3RRHA 2XY6A 1NK8A 3KD5E 1ZBHA 4YFUA 3OYIA 2KW4A 4E7JA 4M3TA 3NDKA 1REVA 4CJ3A 3OYJA 1KSPA 4F4KA 1ITGA 4DLGA 4QCLA 4KFBA 3ZSZA 4I9LA 3HSTB 3QEPA 4HVJA 1KVBA 1TAUA 3T1AA 4UQGA 3ZSQA 2RF2A 1FKOA 5C25A 3HVRA 3TAGA 1ASUA 1WAFA 4E19A 3SJJA 4ZHRA 4CHYA 2IS3A 2BE2A 3MXMA 3HYFA 4FJHA 3LWMA 3HJFA 4CFBA 2X78A 3O3GA 3ZT2A 2FBXA 3AO2A 3OS2A 3B6OA 1BHLA 3LALA 1BQMA 3FFIA 1VRTA 4CJFA 3DRPA 3THVA 4FLYA 3IG1A 1X1PA 1BCOA 1RDAA 3NGYA 4ID1A 4CF1A 3NH2A 1L3SA 2G8UA 3V1OA 2DFEA 4M3YA 5SZTA 3NFAA 1D9FA 3O3HA 4DMNA 4KHYA 4CHQA 1NK0A 2X74A 1SKRA 4FW1A 5T7BA 4CJEA 3OYEA 1T05A 1EX4A 4ELUA 1LW0A 1JLAA 3ZSYA 4DSEA 4KTQA 2HVHA 1NKCA 1L3TA 1O1WA 3DLBA 3L2UA 2HHTA 4FK4A 3QO9A 1VSMA 3QEXA 3K58A 2XY5A 2HNZA 2E6LA 3MECA 4CK3A 3KKRA 4GMJB 4CF0A 3IRXA 4PY5A 1JKHA 4B08A 4CEEA 3WNFA 3AVNA 4CERA 3TABA 3AVKA 1GOAA 1KVCA 5KGWA 4CF8A 1XC9A 4TSXA 3ZSRA 1I3AA 4LSLA 3IAYA 3CFRA 1IG9A 2OA8A 5KTQA 3MAQA 4DTNA 1RT3A 4CFCA 3BDPA 4F8RA 3AA3A 4DS4A 5FROA 4OLBA 4CJWA 3L2RA 4CCHA 4O44A 3OYDA 1RT6A 3PX0A 4M45A 3EY1A 3K59A 2E6MA 3NAEA 4DF8A 3AVJA 3KLEA 4BDZA 4DTOA 3TAFA 1LW2A 2Y1IA 4E1NA 3DI6A 1BQNA 3PV8A 4E3SA 3ZCMA 2A1RA 4F2RA 4J2DA 4CEDA 3AVBA 5C42A 1S6PA 1TK5A 3ZSVA 2ETJA 2OPSA 1RT5A 1XHZA 5HP1A 2PY5A 3G0ZA 3NE6A 1KRPA 4DTSA 5KI6A 1NK5A 3HPHA 1KLMA 1QE1A 2OPPA 1WNSA 2DFHA 3ZT0A 3KK1A 1S1TA 3EYZA 3V9ZA 4DU4A 4Y1CA 3LWLA 3V81A 3TAQA 4W5OA 1VSFA 4H8KA 3RWUA 2HW3A 3VQAA 1KVAA 2VG7A 4B9VA 1CZ9A 4CGGA 1WN7A 3QIOA 3ZT1A 3LDSA 4M41A 1RDDA 4FJ9A 2KFZA 2YNHA 1FK9A 4FLUA 4FYDA 1BI4A 4W5QA 2HHXA 4DQQA 3CG7A 3M8SA 4RG8A 3O4QA 4F3OA 3L2VA 1TL1A 4DQIA 4LY7A 4DTPA 4OPJA 1DLOA 3VQBA 1RBVA 2YNFA 5I3UA 2QK9A 2FBTA 1RT7A 3MEDA 3VQQA 1ZBUA 1JL2A 4RW9A 1NK9A 1FXXA 4F2SA 3NBPA 3KTQA 1VSIA 3SV4A 1W0HA 3LP3A 1RTHA 4BWMA 4N5SA 3MXIA 3AVGA 1HMVA 3TR8A 4OPKA 3OS1A 2YKNA 4E0DA 4LD0A 4CHOA 3QINA 1TAQA 3ZSOA 2RN2A 2ZQBA 2IOCA 2YV0X 2O4GA 3QLHA 4CEOA 3CQ8A 2FC0A 4E7KA 3MEGA 4CGHA 4FLXA 1VSHA 3AO4A 1RT4A 3DLKA 4OKKA 4GVMA 4CIEA 3L2QA 4DSLA 4BDYA 4KI4A 3OYBA 3PX6A 3AA2A 1ZBFA 1GOCA 3WNGA 1Q9XA 4W5TA 3DYAA 4HUEA 2LSNA 2P5OA 2HNDA 3ITHA 3V9UA 2QKBA 1VSJA 3NH1A 2ITGA 2HNYA 3DMJA 3MEEA 5DMRA 4KHUA 1QQCA 3S3OA 1BCMA 2E4LA
chains in the Genus database with same CATH superfamily
2OANA 3HP9A 1VQNN 4JI5K 2OPQA 4BRPA 1VQMN 4BVOA 3ZSXA 5EX5A 1JLBA 5JS1A 2GUPA 4FWNA 2XRIA 3SAFA 4B3OA 3U8XA 4YOVA 4MFBA 4BR9A 1RGIA 5KPZA 4HUFA 2Z1GA 3KHYA 3UKUA 3CM5A 4DTXA 2FSJA 4H0VB 4JI6K 1XNQK 1S1WA 4KKOA 2DFFA 3FE1A 3P39A 3S9HA 3ATUA 2E20A 2BTFA 4KTZA 5HOOA 1KAZA 1HKCA 5AZJA 5LY3A 4CZJA 4BE2A 2D0BA 2A6AA 4B1UB 4H4OA 5HLFA 1Y64A 2KKZA 3A0IX 4WE1A 4CHNA 4I9QA 2HHWA 4OVLA 3OYNA 2A41A 4I6MB 3KJVA 4DQ8A 3HM8A 2ZF5O 3O80A 4BRGA 1HPZA 4IFYA 4E7LA 4HWIA 4B3TK 1RTDA 1RT1A 4KH4A 3MX5A 1T6DA 3PO4A 4RTFD 3HVTA 2NRWA 2V7ZA 3LPUA 4CEZA 2QI2A 1A5WA 1FKPA 1L3VA 3P83D 4H5NA 3LM2A 4EFHA 1KFDA 3QIPA 3QDKA 3D2FA 3DXMB 3LDOA 3LP1A 1S3XA 3MN6A 4LH4A 2YJFA 3V1RA 1OH6A 3CETA 1HYVA 1IO2A 1TL3A 4CZGA 2QWPA 3SCXA 1XC3A 2NRHA 3HXMA 3OA9A 1GLBG 3NHGA 3ALYA 1ZBLA 2Q1NA 1WSFA 4JNEA 2P9PA 3BY5A 4DQSA 2V51B 3AO3A 3RMBA 4A2AA 3LP0A 2P9NA 4ELVA 3C95A 2ZGYA 4LF6K 4DG1A 4H0YB 1RNHA 4LF7K 2HOEA 4KHQA 3G71N 4A59A 3O9QA 3LL3A 3DLGA 1NOZA 1OVYA 4CIFA 2GV9A 3J7ZO 3QB0A 1BISA 2D0PA 3AGKA 4JK8A 1GLFO 3DOLA 1TGOA 3GL1A 5JS2A 3V9XA 2F9TA 4O0IA 3AVFA 1IJJA 3H1VX 3MWPA 4BRMA 4CZEA 3ZEUA 4FWLA 4NLBA 3A5MC 2HVIA 3C6TA 1X9JA 1X3NA 2IVPA 3K0SA 1C0FA 3LZIA 2IGIA 2P9UB 4KHWA 3AA4A 3HRGA 1X9SA 1TYQA 4FWRA 3S41A 3KLGA 3ISNC 3AGRA 1RDUA 3RMCA 3OYCA 4RWTA 3KLIA 4DFMA 1HKGA 4NYNA 1CZAN 4FJJA 5I42A 3K5MA 1IG8A 3C7NA 3M1FA 4MQ3A 3VQ6A 1C1AA 4BR0A 2HHSA 1JCEA 3DRSA 5B8HA 4CJPA 3KWGA 4HTUA 1JXEA 4IG3A 4B3RK 3P5JA 2W6LA 4NXMK 5E84A 1U4BA 1U2VA 1DTTA 3P1GA 1WOQA 3CJCA 3QEVA 3KK7A 2G8IA 1VRUA 2KLAA 4H0TB 3SQ1A 4K43A 3BUZB 1S9GA 4YOTA 4DS5A 1Z05A 5GAGP 4HHTA 4H5VA 5AQRA 4WFBL 4A5BA 1M90O 4DV2K 2Y1JA 2Q31A 4FOIA 5AQXA 1RBUA 1C0GA 3SQ4A 4FJ7A 4U67L 2HSTA 3I0RA 4CJ4A 4DUYK 4AM7A 4CJKA 1ASWA 3N4QA 4RW6A 3NMUA 3AARA 3R1XA 1NK6A 4JS4A 5AQMA 5DM6L 2D4WA 4B9SA 2OPRA 4YOUA 1GOBA 1I39A 4IEEA 4LH5A 1S6QA 4KO0A 1YTUA 1CLQA 1YI2N 4FJ5A 1SL1A 3LDNA 4KPYA 3EO3A 3NF6A 4CGJA 3UKUB 4W5RA 1EETA 3CCSN 4CJQA 3T3FA 2R7YA 1LWCA 3O4WA 2CH5A 1RDCA 3HI0A 5J2QA 4LC9B 5HRPA 1EP4A 3VF4A 2GELA 5AZJB 4E89A 2ITMA 4RW8A 3S3MA 3FZFA 4C1NK 1LOTB 2XY7A 3LP2A 4B8CA 1IKVA 4JI4K 4DU3A 4GKJK 2G8KA 3O9RA 2OTLN 5GIOA 3CF5L 2CGLA 4B9LA 2E2QA 3VMFB 2QWMA 4C8OA 1DT9A 2BH1A 1DKGD 3TI0A 3VQ5A 3BZCA 3U3YA 5GIPA 5DK5A 1T7PA 1Z25A 5JLHA 3F73A 4LF9K 4AHSA 2G8FA 4DUZK 2E2OA 2GBZA 2Z1JA 1BIZA 2EX3A 4CD1A 4J2EA 4DQPA 2QKKA 2A5XA 5BPNA 3CCUN 4Q5VA 4FZXC 3TTDA 1HJRA 4JRPA 4GNIA 1P90A 4H0XB 1BU6O 1D9DA 1HNVA 4CJRA 4YNQA 3NGIA 4NYFA 5FPEA 4X62K 4O0JA 1ZBHA 2UUCK 1GLEG 3TSQA 2QTDA 3D2FB 4YFUA 3NDKA 1REVA 2O8CA 4BGBA 4OPAA 2QEXN 3HSTB 4HVJA 4MDBA 1KVBA 1QZ5A 3ZSQA 5C25A 1H1VA 3SAHA 3TAGA 1WAFA 4GV6A 4E19A 2O8FA 4O8UA 2P9PB 3VPZA 3J7YP 3DWLA 4Y0WA 4ID1A 2P9NB 5SZTA 1VQ4N 3O3HA 2E1ZA 2NNWA 4KTQA 3DLBA 3L2UA 2JWKA 2NRXA 3QEXA 2HNZA 4CK3A 4CF0A 1WBDA 1JCFA 4CERA 1N32K 3AVKA 4YDUA 1KVCA 3PIPL 3W0LA 4DR2K 5M1OA 5KTQA 1RT3A 4CFCA 3BDPA 4DS4A 1HR0K 3EE8A 3QFPA 3OYDA 3K59A 4WYBA 4IOAL 4GKKK 3ZEUB 3TAFA 1E4GT 1LW2A 4E1NA 4CZFA 5TKWA 4E3SA 4JI3K 4BC4A 1HPMA 4CEDA 3TPQA 4BC3A 5AQLA 3O08A 1RT5A 3C65A 1T44A 5HP1A 2PY5A 5LJWA 1DEJA 1NMDA 1KLMA 1TYQB 3ZT0A 4YDUC 2DFHA 4FJGA 3TAQA 4Y1CA 4CZHA 4W5OA 3RWUA 2YHWA 1J5EK 3SAGA 3F9MA 3QMLA 3QBXA 4M41A 4DV1K 2PBDA 4FJ9A 2YNHA 4FLUA 4FYDA 4W5QA 3C7NB 4RG8A 4F3OA 3L2VA 1TL1A 5I3UA 1Q18A 2YNFA 5AQFA 1EO1A 2FBTA 3CJAA 1X3MA 3D2EA 1ZBUA 1FXXA 3EKUA 4DR7K 1RTHA 4BWMA 1U2VB 4JHDA 3WT0A 3OS1A 4CHOA 1TAQA 1ATRA 2ZQBA 3QLHA 3VEWA 2FC0A 2ASMA 1VSHA 4CIEA 2FSKA 4GVMA 3CMAN 4FWMA 1ZBFA 3IKMA 3DYAA 2P5OA 2HNDA 4MLHA 2GWKA 2HHTA 4XH1A 4GV9A 4C8KA 1BGXT 3K9JA 5HRSA 3CC2N 3EL2A 1WUAA 3NGZA 5EY4A 3N4PA 1YIJN 3OBYA 5ELZA 1T8EA 5FPNA 4Z4GA 1SAZA 3FZMA 3K2PA 2X6NA 3P4IA 4IBNA 2JGUA 3CCVN 4NCAA 2D0CA 2FF3B 1VSDA 1GLJO 3QNNA 4CZMA 2FBVA 1KCFA 1SUQA 1VSLA 4AF1A 4BG8A 1VQON 4CESA 4JI2K 1TKDA 2GX9A 5M1PA 4XH4A 3U3GA 4IFVA 4CJ5A 4B9QA 3JSMA 4M42A 4QOZB 4C8NA 2W40A 1SL2A 2HHHK 1U48A 3CXCM 4B1XB 4BRDA 1HKBA 4WFNL 5I9EB 4CBXA 1ZYQA 2WFBA 4CEBA 4CZLA 2XHBA 3U4LA 4M3WA 3QICA 4BE0A 1S1VA 3VTIA 4CE9A 3ENHA 1RTIA 1C1CA 1NBWA 1HQUA 3DM2A 3CFPA 4EHUA 2Q3SA 3WXKA 3ZETA 3SNNA 2FBYA 2UUAK 4ISGA 4FK2A 4Q0BA 1LAWA 2YNGA 3QNOA 1VQLN 1T03A 4BE1A 3SMSA 2JLEA 3MX2A 1IKWA 4DV0K 4FJXA 4B1VA 3S3NA 1HRHA 2HF4A 1UAXA 3KK3A 3A2FA 4DR5K 4CBWA 3WQUA 3WXLA 1JL1A 4BR5A 1QHAA 1NU0A 2O8CB 4CFDA 4IJAA 1MA9B 4E1MA 1IBLK 5CYQA 3TAPA 3L8BA 1M1KO 2HB5A 2IVOA 3SUQA 4H5RA 3L3UA 2WC9A 3MXJA 2O8FB 3OW2M 2I5JA 3KZBA 3H3OB 4BWJA 4DV4K 1DTQA 4YOYA 3DRRA 3OHRA 1RDBA 3CJBA 4DKWA 3HPOA 1UA0A 3WQTA 1JXBA 3V6DA 4OGCA 2ZD1A 3L4IA 4CJTA 2GTDA 2H3GX 2P9IB 4FM0A 4QS9A 3ZSWA 3PIOL 2ATQA 5GADP 1UWBA 4H4MA 4GV3A 4DFJA 1VAZA 3SQ2A 5K14A 1YAGA 4JI8K 4YOWA 3U9DA 4E7IA 2QWQA 2QWNA 2RKIA 4KRFA 1IKXA 4J2AA 1EWQA 3JXUA 4LSNA 3OVNA 3LM9A 3PSFA 4GW6A 2OYQA 3D0PA 1X9WA 4KREA 5JVGL 4FOEA 3WUHA 1K8KA 1VSKA 5KPTA 1C0UA 4KB1A 1XI1A 1C0MA 1SKWA 2DPNA 4H0OA 1J9AA 3DJCA 4BR2A 3UIQA 2VWKA 2E2NA 4DV5K 1NK7A 1A5VA 2P1JA 3SUPA 4JYAK 2KFNA 3TANA 4BGAA 3ENBA 5FRMA 1UOCA 1JLCA 1K73O 3OJUA 1FJGK 1R59O 4N47A 5JMVA 3D2EB 3THYA 2VGNA 1GLAG 4BRFA 4FK0A 1V4TA 1TKZA 3CFOA 5J1EA 1NJZA 4JHDB 5AFUA 3SLCA 5CZ1A 4C8LA 5EU7A 2HHUA 4I2PA 5TKYA 2Z1HA 3QESA 5C12A 4DSIA 1SKSA 4OLAA 4A57A 1OH5A 5BRHA 1Q7YO 1Y97A 4I7FA 3VF2A 4DU1A 3AVAA 3VQ8A 1N33K 4JKEA 3HO1A 1YTAA 1BWFO 3V4IA 1YXQA 1BIUA 3CHWA 3O9UA 4CHPA 1TV6A 1QQNA 3O1BA 3M8QA 4N76A 1S1XA 1WSIA 1RILA 5BREA 3P31A 3QEWA 4BRLA 4HUGA 3SYZA 1Q81O 1IKYA 4HTLA 3VQ4A 4AHVA 4Z0UA 2DY4A 4DSFA 4ZTJA 2HBLA 3VGMA 4DTJA 4DFPA 3ASMA 1YVUA 4PL7A 3BEXA 2P5GA 4CK2A 1LAVA 4CZKA 3CJ9A 3ZT4A 4FXDA 1S5JA 4AQYK 5IT9O 2J4RA 1SQKA 1W7AA 4JK7A 3LPTA 2OCEA 2W6KA 3BGRA 3RSEA 1LWFA 1Z6RA 5AQIA 1BUPA 2QXFA 2E1YA 1WBBA 3RTVA 3DLRA 2X6SA 2HMPA 3KK2A 1VHXA 4MDAA 4MO4A 4IKFA 1BL3A 3IDHA 1QQOA 3R3LA 1NGDA 1NJIO 3VA3A 1VQ8N 4KTWA 4BC5A 1F21A 5JLFA 2ASOA 1WSEA 3ZETB 1SL0A 2RPIA 5CY4A 2ZJRL 3SUOA 4FJ8A 4G1QA 5HRNA 1QVGM 4OX9K 1NKEA 3TWHA 5EXWA 5C0YA 2NUBA 4PKIA 1XHXA 4DQRA 4DWIA 4FZYA 4C1NI 3K5NA 2IC3A 1WAJA 2JWLA 1TUYA 3OYIA 2KW4A 4JN4A 3CIPA 3ZSZA 3QEPA 1YVNA 3T1AA 1FKOA 1GLDG 3R6MA 4CHYA 3MXMA 3ID8A 1KAXA 4FJHA 4CFBA 2D1KA 1KAYA 3B6OA 3LALA 1BQMA 3NVKA 3DRPA 3THVA 4FLYA 3IG1A 1BCOA 1RDAA 2G8UA 5BRFA 3NFAA 5BN8A 2ZGZA 4KHYA 4DMNA 1KXPA 4JKDA 1NGFA 1SKRA 4CJEA 3OYEA 1T05A 3ZSYA 4DSEA 1NKCA 1L3TA 5C2DA 3T7ZA 2WBNA 1VSMA 3MDQA 3QO9A 2XY5A 4B1WB 3MECA 2E6LA 4WQ5A 4PY5A 4B08A 3AVNA 3TABA 1GOAA 2YHYA 1I3AA 4KH5A 3MWTA 4DTNA 4AM6A 5FROA 4OLBA 1K8KB 4CJWA 3L2RA 2NRRA 5HL7L 1ILYA 4JAXA 3KLEA 2Y1IA 1BQNA 3PV8A 3ZCMA 2HBKA 1U6ZA 3O9SA 3AVBA 4BC2A 2UU9K 1TK5A 4WQ5C 4CI6A 3P38A 2W41A 3G0ZA 4ILJA 2EWSA 3HPHA 4BDPA 4DR4K 1N8RO 2UUBK 3LWLA 1BDGA 1DGKN 1KVAA 3A5LC 4IJNA 5JVHL 4YORA 1G99A 1ZC6A 3G4SN 1FK9A 1BI4A 3THYB 3MN7A 3M8SA 4FWOA 4BRQA 1IV0A 5JICA 4DTPA 3H46O 1DLOA 4BRAA 2QK9A 4K41A 2VGMA 3SMPA 4BRIA 4PHTX 4RW9A 1NK9A 4F2SA 5EOYA 1VSIA 3SV4A 3LP3A 4O8KA 3MXIA 5A2QO 2YKNA 4PL8A 4LD0A 1BG3A 2RN2A 4YY3K 3F2KA 1KFSA 3MEGA 4FLXA 3DLKA 4BRNA 3C6AA 3PX6A 4W5TA 4FO0A 5GINA 2LSNA 4LF8K 2QKBA 3O8MA 3NH1A 2YCHA 1JJ2M 2HNYA 3DMJA 4KHUA 4NB4A 3S3OA 5BN9A 3BF3A 1TK8A 4DF4A 2E88A 3FR0A 1BA0A 4EHTA 3I0SA 4QS7A 1IH7A 1NKBA 1KQSM 3WXIA 4BG9A 3HK2A 2XY8A 5AJ3K 4EZ6A 3IFRA 2CGJA 5KQDA 5D3GA 5CE3A 3CC4N 3KD1E 3AVIA 4JRQA 4B1ZA 1YT3A 4Y1DA 2CGKA 4KV8A 5KPRA 1U45A 3RRGA 5FRNA 3VQ7A 1T6CA 2AP1A 4PKGA 4DFKA 1ATSA 1U04A 4R5PA 3IMXA 2V52B 4FJMA 2P9KA 1JCGA 2D0AA 3E01A 3RSEB 4QAGA 3SPZA 3E9PA 5AQZA 3IS9A 3FGUA 5AFUH 5BPLA 1NJYA 4O55A 4BY9C 1KD1O 4ID5A 1QSYA 4PQUA 3AAQA 4DTRA 4CJLA 4NCBA 1RDWX 1NGAA 3DAWA 1U49A 5FDLA 2PFUA 1JLFA 3OYHA 4DR3K 3H6EA 2FSNA 1YUWA 3V1QA 1WLJA 3NF9A 5F2RA 4AILC 1G15A 3A5OC 3THWA 5HROA 4K8XA 4DSJA 2WTUA 2AA4A 2VWBA 3VERA 3CERA 4FWKA 4M3UA 4IO9L 1MU2A 3WNHA 4CJSA 3V9WA 2OZMA 3HP6A 5EVZA 1LWEA 2GUIA 3SV3A 1JLQA 1Z26A 1ASVA 4IXCA 2NRVA 5KRTA 4O5BA 1CXUA 2F7TA 1X9MA 4BROA 1YHQN 1RFQA 4RW7A 4M3RA 3PX4A 2YJEA 3HT3A 3CM6A 3RMAA 2UYTA 3DXKA 3LANA 5E41A 3M8RA 1CZBA 3KLFA 4LF4K 5SWMA 2QWOA 4DR1K 4EAHD 4KH6A 1OVQA 4MO5A 4EP5A 3PO5A 3JYTA 2RE2A 1O13A 3JS6A 2G8HA 4KHNA 4FJLA 3UKRA 1D5AA 3IUCA 2Q2RA 3QETA 3O4NA 2NLXA 4O5FA 4JD2A 4H03B 5KGXA 1S22A 2VG5A 4Z4CA 1MWMA 4BQLA 4IG0A 1QZ6A 1S1UA 3CCQN 3U6FA 4ISFA 3OYLA 4OKEA 3CMEN 5KRSA 2KZMA 1TVRA 5ADXA 2HMIA 3WXMB 4CFAA 3VESA 5M1KA 4J2BA 2OZSA 1Q9YA 4F3TA 3R9PA 3HL8A 3KIOA 1WSJA 3O9TA 4JS5A 4FJKA 2VCPA 4ILGB 3EZ5A 5C15A 2QW9A 1C6VA 3CYMA 4A62A 4AH9A 4B9TA 2BGGA 4FVUA 1YITN 4CECA 5J2MA 3HOSA 2Q0UA 3EZWA 4KHSA 3SI6A 2P9LA 4KI6A 3GBTA 3TAEA 3Q7CA 5LJVA 2VYPA 4FWQA 3BF1A 4CIGA 4DR6K 4IOCL 4AHUA 3RR7A 2O4IA 2AJQA 1RBTA 3NF8A 1BI4B 4Z4IA 1QQMA 4FSVA 3R8EA 1VQ6N 1HNXK 2A3ZA 4C8MA 2ZE2A 4C23A 1U47A 3K5OA 3E66A 2QM1A 2DTUA 1ATNA 1SV5A 3DLEA 1HNZK 2KZZA 4NCGA 2FF6A 3W3DA 5H1SQ 2YX6A 1XMQK 1QSLA 3A5NC 3B6PA 5HRRA 4JK9A 1WSHA 3QEIA 2KHOA 5AQGA 3J80O 4LF5K 3PSIA 4Z4FA 4KHPK 1Q82O 1K6YA 2E5LK 4JKBA 3GOIA 4IOXA 4BREA 3MN9A 4FLVA 2Q36A 3KWIA 3C6UA 2D5RA 3VQCA 2B5JA 4BQZA 3PUFA 2W42A 4DSLA 2YKMA 1QHTA 4FZZA 3VEZA 5F0XA 1TKTA 4M7XA 3THXA 3AVHA 2E2PA 3ATVA 4B9UA 1YJWN 1NGGA 1NGJA 3AVMA 3VA0A 4IWVA 1ZBSA 5AQUA 3NCIA 3T1YK 3OJSA 3TU5A 3ZYYX 1E4FT 5MLCQ 2P9KB 1R0AA 1ZBIA 3VEVA 1TUUA 3A8YA 4GY2B 4M3ZA 1C0TA 2FLOA 2VG6A 2ZJQL 3QFUA 4DV3K 4ZTFA 3PY8A 3E1YA 3ENOA 4RW4A 4LFCK 2YHAA 5M1FA 3B8AX 4B9NA 3K9KA 3VGLA 4FVMA 5AQJA 3UB5A 1W2BM 3U9ZA 5LMNK 4A5AA 4FL9A 4NLCA 3THWB 2KTQA 4DTUA 2HF3A 2UXCK 4N56A 4GVEA 2ASPA 4FLZA 3EEQA 4CEQA 3VETA 1XWLA 3K57A 3TARA 2YHXA 4FLWA 2Z1IA 4AHCA 4OKJA 4DTMA 4CHZA 3K5LA 4M3XA 2F8TA 4JKAA 3ZX2A 2O8EA 3RRHA 1HX1A 2XY6A 3KD5E 2D0OA 3D6RA 4WF9L 1KSPA 4DLGA 4KFBA 4CJ7A 3I8BA 4CVNE 4B3MK 3CPWM 4JV5K 2RF2A 3HVRA 2GWJA 3DXKB 1ASUA 3VF6A 4CBUA 5LL6Z 2BE2A 2VQFK 3HYFA 3HBTA 2FBXA 3OS2A 1HJOA 5C2FA 3FFIA 5AQKA 4B3SK 1X1PA 3NGYA 3NH2A 4CF1A 1L3SA 3V1OA 2DFEA 4IZ9A 3T69A 3H1QA 2IIRA 2X74A 3UKRB 1MWKA 4FW1A 5T7BA 3RVCA 1LW0A 1JLAA 3CI5A 4JD2B 1O1WA 3BZKA 1MDUB 4JI0K 3K58A 3KKRA 3EKSA 3MN5A 3VEOA 4CEEA 1XC9A 4CF8A 1XQSC 4LSLA 3VOVA 1IG9A 5BR9A 4OPHA 2OA8A 1ZXOA 3AA3A 1J6ZA 3SJHA 2UXBK 3HOTA 4CCHA 5KQ8A 4O44A 2O8BA 2A40A 1RT6A 3PX0A 4M45A 2E6MA 3LDQA 4BDZA 4HCCA 3OBWA 5DM7L 3DI6A 2A1RA 2BUPA 2P9SA 5C42A 1ESVA 3ZSVA 2OPSA 1KC8O 4UY8O 2P9LB 3NE6A 1KRPA 5KI6A 1NK5A 1OKJA 3EYZA 1QE1A 1W97L 3V81A 4DU4A 1S1TA 4IFEA 1VQ7N 1VSFA 3VQAA 3F5TA 2VG7A 4B9VA 1WN7A 3QIOA 3ZX0A 1NGHA 3VEYA 2HHXA 4X66K 4DQQA 3CG7A 2E8AA 1D4XA 2IVNA 4DQIA 1GLCG 4OPJA 3VQBA 1RBVA 4FWSA 3MEDA 3VQQA 1EWRA 3G6EN 3O1WA 2Q97A 3NBPA 3PLAA 3KTQA 1W0HA 2NRTA 4H0PA 3AVGA 1HMVA 3GE1A 3ZSOA 1NGIA 2O4GA 3ZLJA 3AO4A 3FZKA 3CJ7A 4BDYA 4KI4A 3NVMA 3OYBA 5ADXH 1NG9A 3WNGA 3EN9A 1OH8A 4HUEA 3ITHA 4DV6K 2ITGA 5BRDA 1QQCA 1BCMA 3TTFA 2E4LA 1S9EA 3FZHA 2B4JA 2I7NA 2G8WA 3HM9A 4M7YA 1NGCA 4M63C 4OGEA 4CJUA 3THXB 3VGKA 2WONA 4BRCA 4JI7K 2IAJA 4EP4A 3GG4A 4FJNA 3E9LA 4I2QA 4BACA 1NK4A 2YHBA 4CGIA 4FPAA 4BVPA 3LDPA 4QS8A 1LV5A 3VQPA 1EQYA 4L8RB 1L5UA 1RTJA 1WB9A 5C24A 4E1JA 3FZLA 2Q0RA 5CYMA 4CW7B 3G25A 3KKSA 4K8ZA 4X65K 4WQ4A 3ID6A 1VK0A 2V7YA 5LMUK 1RBRA 3OYKA 4Z4HA 4CK1A 3MK6A 3AVLA 4DCHA 4L3QA 1QTMA 1A5XA 1N5YA 3SUNA 4XIUA 3ZX3A 5AQOA 1KTQA 4YOXA 1YJ9N 4IO8A 1SS6A 2VQEK 4LFAK 4ICLA 3LZJA 2PAVA 1HQEA 1B9DA 1TKXA 5CZ2A 4F9OA 1QVFM 2A42A 2BANA 2A1SA 4FM2A 4WQ4C 2O8EB 3V9SA 5FLXO 3MCPA 3VQ9A 4B1YB 1T3VA 4CGFA 2P51A 3OYAA 3CPEA 3ZT3A 4KB0A 3I8DA 5J2NA 1XUPO 3OS0A 1UA1A 4KBOA 5HBMA 3SZ2A 4E0DA 2YNIA 5CR4A 2GEMA 3AY9A 3C94A 3M5RA 3AA5X 3O3FA 3TSPA 4BRHA 3FLCO 3MCAB 2HBMA 4ELTA 3D45A 2NZTA 1K9MO 4B8AB 4DHYA 4PKHA 1GLLO 4V19S 3SQ0A 3CC7N 4FCYA 3ULEA 4XH5A 3SBGA 5IWAK 3L3VA 3G10A 3O5BA 2IDOA 1NM1A 4FPBA 3O6WA 4CEFA 1NJWA 2PZSA 1D8YA 4ILHA 3T19A 5AQWA 2O8DA 3FFKB 3EE9A 2O8BB 4JLHA 3DLHA 1RBSA 3AO1A 3L0QA 4IDHA 3OTOK 3HSCA 4BR4A 2P9SB 3NF7A 3QERA 4LFBK 1B9FA 2VWJA 2F96A 3J7AP 3CCJN 4FW2A 4FJIA 4YHHK 3C0BA 1FW6A 4G9ZA 3OYFA 1HNIA 3ULDA 3SPYA 3H08A 4F2RA 5E26A 4EZ9A 2WOMA 1L3UA 3CCEN 1C1BA 3AO5A 4PWDA 2YI1A 1SZ2A 3OYGA 5AQVA 1JLEA 3HPGA 1EKEA 5AZIA 3SK3A 4KAZA 3SBTA 3CJ1A 5F1XA 4Z4EA 1KLNA 2QWRA 3CQYA 1NJXA 4K25A 3HZ6A 1QS4A 1J53A 3C6HA 4XEIA 3AV9A 1CXQA 1VSEA 2B6AA 1NGBA 1QSSA 1V4SA 2F4VK 4NXNK 2CH6A 3RMDA 4CF9A 2G8VA 4AHRA 3CQXA 2PYJA 3H3NO 3M8PA 4JKGA 4ISEA 3H45C 1JLGA 2P9IA 3LDLA 4E7HA 3TTCA 4CEAA 3NH0A 3AVCA 3VEXA 4N41A 4CF2A 1B92A 1WSGA 4DB3A 1HYZA 4CGDA 3KLHA 2HBJA 5BPMA 2F8SA 2HHQA 4HCBA 3WEEA 3J8AA 5J2PA 1N6QA 3L6QA 4OJRA 3LAMA 3WXJA 2FXUA 1W9HA 5FPDA 3I56N 1XNRK 1Q8IA 4IDKA 3TAMA 1EXQA 4FLTA 3GDQA 3CCLN 3Q7BA 3OY9A 1J54A 5AQHA 3T1HK 2F9WA 4AHTA 1VQ5N 4JI1K 4WCEL 2EHGA 2HHVA 2XO7A 2PYLA 3CCRN 1NOYA 1LCUA 5AQNA 4W5NA 1K8AO 4K42A 3CD6N 3DLLL 3I33A 1J5OA 4B9MA 3F9KA 4H5WA 1TK0A 3BP8A 4IEIA 3VQDA 1VQKN 3LAKA 1HYSA 4FM1A 4U7BA 3OYMA 4I6MA 5BR8K 1NWKA 3WNEA 1RCHA 2BDPA 2UXDK 1BO5O 3VN5A 4DSKA 3VQEA 1RT2A 2I7PA 2WUSA 4O4GA 2KQ2A 5AQYA 4PUOA 3L2WA 3DOKA 4PA1A 3QBWA 4A2BA 4CJVA 1BOTO 4JKFA 4DLEA 1NK8A 1NMNA 4X64K 4M3TA 4E7JA 5C10A 1NNEA 2NRZA 4CJ3A 3OYJA 1N34K 4F4KA 1ITGA 4QCLA 5M1QA 3E9OA 4I9LA 4BRKA 3DXMA 1TAUA 4K0KK 4UQGA 2QA4N 5AQSA 2QWLA 3SJJA 3M3ZA 4ZHRA 4BR7A 2IS3A 3L4QA 4WFAL 3LWMA 3HJFA 2X78A 3O3GA 3ZT2A 4MLEA 3AO2A 1BHLA 1VRTA 4CJFA 3JAMO 1S72N 5AQTA 1XMOK 4M3YA 1D9FA 4CHQA 1NK0A 4CD3A 4ELUA 1N36K 1EX4A 3VTHA 1E3MA 3ULEB 2HVHA 1HLUA 3D7EO 4FK4A 1Q86O 5GAHP 4GMJB 3IRXA 1JKHA 1YF5L 3WNFA 1HUXA 3VENA 5KGWA 4TSXA 3ZSRA 3IAYA 2O8DB 3CFRA 3MAQA 4F8RA 1P8ZA 5CHIA 3MMVA 1OH7A 4H5TA 3EY1A 3NAEA 4NO7A 4DF8A 5AQQA 3AVJA 2OTJN 4DTOA 2QXLA 4J2DA 3TSUA 2ZM6K 1S6PA 4FWPA 1IBKK 5FPMA 2ETJA 1XHZA 3KVGA 1NLVA 4DTSA 1I94K 2OPPA 4Z94A 1WNSA 3KK1A 5AQPA 3V9ZA 2P9UA 4DV7K 4H8KA 2HW3A 5AZIB 1CZ9A 4CGGA 2RHKA 1NGEA 3ZT1A 3LDSA 1RDDA 5M1NA 2ZJPL 4CZIA 2KFZA 4R79A 3HTVA 3O4QA 3M6GA 4J8FA 4EIAA 4LY7A 3J81O 1RT7A 4JKHA 3AAPA 1JL2A 1VQPN 4JKCA 1YJNN 3I55N 4A61A 4N5SA 4RCHA 1BA1A 3TR8A 4JKGB 3UE5A 5AR0A 4OPKA 1IBMK 3QINA 2YV0X 2IOCA 4CEOA 3CQ8A 4E7KA 4CGHA 3RR8A 1RT4A 4OKKA 3L2QA 3CCMN 3AA2A 2ZWHA 1GOCA 1Q9XA 1HNWK 4OO1J 1VQ9N 3V9UA 1VSJA 3MEEA 5DMRA 3WEEB 4JEPA 5GAEP
chains in the Genus database with same CATH topology
3HP9A 1TK8A 4DF4A 4C8KA 1S9EA 2OPQA 1BGXT 2B4JA 3I0SA 5HRSA 3ZSXA 2G8WA 3HM9A 1IH7A 1NKBA 3NGZA 1JLBA 5JS1A 4B3OA 2XRIA 4OGEA 3HK2A 4CJUA 2XY8A 4EZ6A 4MFBA 1T8EA 2WONA 2IAJA 4Z4GA 4EP4A 5D3GA 4HUFA 2Z1GA 4FJNA 3KD1E 3AVIA 4I2QA 3K2PA 4JRQA 2X6NA 4BACA 1NK4A 1YT3A 2YHBA 3CM5A 2JGUA 4IBNA 4DTXA 4NCAA 4Y1DA 2D0CA 4CGIA 1VSDA 4KV8A 1U45A 3RRGA 1S1WA 5FRNA 4KKOA 3VQ7A 3QNNA 2DFFA 2FBVA 4DFKA 1KCFA 3S9HA 1LV5A 1U04A 1SUQA 3VQPA 4R5PA 1VSLA 1L5UA 4L8RB 4KTZA 1RTJA 4CESA 4FJMA 5C24A 2D0AA 3E01A 1TKDA 4QAGA 3SPZA 5CYMA 4BE2A 3U3GA 4IFVA 4CJ5A 2D0BA 3KKSA 3IS9A 4H4OA 3JSMA 5HLFA 4K8ZA 4M42A 4QOZB 4C8NA 1NJYA 4WE1A 1SL2A 4O55A 4CHNA 1U48A 4ID5A 4I9QA 1QSYA 4OVLA 4PQUA 2HHWA 1VK0A 4DTRA 4CJLA 4NCBA 3OYNA 1U49A 5FDLA 1RBRA 3KJVA 3OYKA 4Z4HA 1ZYQA 1JLFA 4CEBA 4CK1A 3OYHA 2XHBA 3AVLA 4M3WA 3V1QA 1HPZA 1S1VA 4IFYA 4CE9A 1WLJA 4BE0A 4E7LA 1QTMA 1RTIA 1C1CA 3NF9A 1HQUA 3DM2A 1A5XA 3CFPA 4AILC 1G15A 2Q3SA 3SUNA 4XIUA 1N5YA 3SNNA 1RTDA 2FBYA 5HROA 4FK2A 4K8XA 1KTQA 4Q0BA 4FJ5A 1RT1A 4DSJA 1LAWA 3PX4A 2YNGA 3QNOA 2DTUA 1T03A 4ICLA 4BE1A 4M3UA 3LZJA 1MU2A 1HQEA 1B9DA 1TKXA 2JLEA 5CZ2A 3HVTA 3WNHA 4CJSA 3HP6A 3V9WA 3PO4A 1LWEA 3LPUA 1IKWA 2BANA 4CEZA 3RR8A 4FJXA 3S3NA 2GUIA 1A5WA 1FKPA 1JLQA 2A1SA 1HRHA 4FM2A 3SV3A 1L3VA 1Z26A 1UAXA 3P83D 3KK3A 1ASVA 3A2FA 3V9SA 3VQ9A 1JL1A 5KRTA 4CGFA 4O5BA 1CXUA 4CFDA 2P51A 1KFDA 3QIPA 3OYAA 3ZT3A 4KB0A 3I8DA 4E1MA 5CYQA 5J2NA 3TAPA 3OS0A 1X9MA 3LP1A 3L8BA 4LH4A 2HB5A 1UA1A 3SUQA 3V1RA 4RW7A 3L3UA 3MXJA 1HYVA 5HBMA 4M3RA 3SZ2A 1IO2A 1TL3A 3HT3A 3CM6A 2I5JA 5E41A 3LANA 2YNIA 4BWJA 3RMAA 3M8RA 1CZBA 3KLFA 3SCXA 1DTQA 3HXMA 3C94A 3DRRA 5SWMA 3NHGA 1RDBA 3ALYA 1ZBLA 1WSFA 3AA5X 3O3FA 3HPOA 4DQSA 3AO3A 4EP5A 3RMBA 1UA0A 3PO5A 1JXBA 3JYTA 3LP0A 3V6DA 4ELTA 4OGCA 2ZD1A 4ELVA 3C95A 3D45A 4CJTA 2G8HA 4DG1A 4KHNA 4B8AB 4FJLA 4FM0A 3ZSWA 1D5AA 1RNHA 3SQ0A 4FCYA 3QETA 3O4NA 2ATQA 1UWBA 4KHQA 4H4MA 5KGXA 4DFJA 3SQ2A 2VG5A 5K14A 4Z4CA 3L3VA 4IG0A 3G10A 1S1UA 3DLGA 4E7IA 1NOZA 3U6FA 2RKIA 2IDOA 4KRFA 3OYLA 1IKXA 4OKEA 4J2AA 4CIFA 2GV9A 4CEFA 4LSNA 1NJWA 5KRSA 1D8YA 1BISA 2PZSA 3OVNA 2KZMA 3T19A 1TVRA 2HMIA 4GW6A 2OYQA 3D0PA 1X9WA 4KREA 3DOLA 1TGOA 5JS2A 4JLHA 4CFAA 3V9XA 3DLHA 4O0IA 1VSKA 1RBSA 3AO1A 4J2BA 3AVFA 1C0UA 2OZSA 4KB1A 1XI1A 1Q9YA 4F3TA 1C0MA 3NF7A 3HL8A 3QERA 1B9FA 3KIOA 1WSJA 4JS5A 1SKWA 2VWJA 4FJKA 2F96A 4FW2A 3EZ5A 1KFSA 4FJIA 2BGGA 1C6VA 3CYMA 4AH9A 4B9TA 2HVIA 1J9AA 4CECA 3C6TA 3OYFA 5J2MA 1HNIA 3ULDA 2VWKA 3LZIA 3UIQA 4KHSA 3SPYA 2IGIA 3SI6A 4KI6A 3H08A 4KHWA 3AA4A 1A5VA 2P1JA 3SUPA 1NK7A 4EZ9A 2WOMA 3TANA 1X9SA 3TAEA 1L3UA 3KLGA 3ISNC 4CIGA 5FRMA 1C1BA 2OZMA 3AO5A 1UOCA 4PWDA 3OYGA 3RMCA 1JLCA 4AHUA 3OYCA 1JLEA 3HPGA 1EKEA 3RR7A 4KAZA 2O4IA 1RBTA 3NF8A 2AJQA 1BI4B 3KLIA 4FJGA 4Z4IA 4DFMA 3OJUA 4Z4EA 1KLNA 4NYNA 4N47A 1NJXA 4FJJA 5I42A 4C8MA 2ZE2A 1QS4A 1J53A 3K5MA 4MQ3A 3VQ6A 1C1AA 3AV9A 1U47A 3DRSA 3K5OA 1CXQA 1VSEA 2B6AA 4FK0A 2HHSA 4CJPA 4HTUA 1SV5A 1JXEA 4IG3A 3DLEA 1QSSA 1TKZA 3CFOA 5J1EA 3P5JA 1NJZA 2KZZA 4C8LA 5CZ1A 3RMDA 4CF9A 2G8VA 1U4BA 4AHRA 4NCGA 5EU7A 2HHUA 4I2PA 2PYJA 2Z1HA 3QESA 3M8PA 4DSIA 1DTTA 3P1GA 1SKSA 1QSLA 4OLAA 3QEVA 2G8IA 1Y97A 1JLGA 3B6PA 4I7FA 5HRRA 1VRUA 1WSHA 3QEIA 4DU1A 3SQ1A 3AVAA 3VQ8A 4E7HA 3HO1A 1S9GA 1YTAA 4CEAA 3NH0A 4DS5A 3AVCA 3V4IA 4HHTA 1BIUA 4Z4FA 4N41A 4CF2A 4CHPA 1TV6A 1B92A 1WSGA 1K6YA 1HYZA 2Y1JA 3M8QA 4N76A 1RBUA 1S1XA 3SQ4A 4CGDA 3KLHA 1WSIA 4FJ7A 3I0RA 4CJ4A 1RILA 2F8SA 2HHQA 4CJKA 1ASWA 4HCBA 3QEWA 4RW6A 4HUGA 5J2PA 1NK6A 3SYZA 1N6QA 4JS4A 1IKYA 4FLVA 4OJRA 3VQ4A 3LAMA 3C6UA 4AHVA 2OPRA 4B9SA 4Z0UA 2DY4A 1GOBA 1W9HA 2D5RA 1I39A 3VQCA 4DSFA 4LH5A 4ZTJA 1Q8IA 1S6QA 4KO0A 1YTUA 1CLQA 4DTJA 2B5JA 2W42A 3PUFA 4IDKA 3TAMA 1EXQA 4DFPA 1SL1A 2YKMA 3ASMA 1QHTA 1YVUA 4FLTA 4HCCA 4KPYA 2P5GA 4FZZA 3NF6A 4CGJA 1TKTA 3OY9A 4CK2A 3AVHA 1J54A 4B9UA 1LAVA 4BDPA 4W5RA 3AVMA 3ZT4A 4AHTA 3VA0A 4FXDA 1S5JA 1EETA 2HHVA 2EHGA 3NCIA 4CJQA 3T3FA 2XO7A 2R7YA 1LWCA 1RDCA 3OJSA 5J2QA 2PYLA 1NOYA 5HRPA 4W5NA 1EP4A 1R0AA 4E89A 1ZBIA 3LPTA 4RW8A 1J5OA 3S3MA 4M3ZA 2XY7A 3BGRA 3LP2A 4B9MA 3F9KA 1C0TA 2VG6A 4ZTFA 1LWFA 4B8CA 1IKVA 3PY8A 1TK0A 2QXFA 4DU3A 2G8KA 4RW4A 3RTVA 3DLRA 2X6SA 2YHAA 3KK2A 4B9LA 3VQDA 3LAKA 4C8OA 1HYSA 4B9NA 4IKFA 1BL3A 4FM1A 4FVMA 3TI0A 3OYMA 3VQ5A 3U3YA 3VA3A 4KTWA 5DK5A 3WNEA 1RCHA 1Z25A 3F73A 1T7PA 2BDPA 1F21A 4AHSA 3VN5A 2G8FA 4DTUA 4DSKA 2KTQA 1WSEA 4N56A 2GBZA 2Z1JA 3VQEA 1BIZA 2EX3A 2RPIA 1SL0A 5CY4A 4FLZA 3SUOA 4CEQA 4J2EA 1RT2A 4DQPA 2QKKA 1XWLA 4O4GA 3K57A 3TARA 2KQ2A 4FJ8A 4Q5VA 4FZXC 4PUOA 4G1QA 5HRNA 2Z1IA 4AHCA 4FLWA 3L2WA 4OKJA 1NKEA 1HJRA 4JRPA 3TWHA 4DTMA 2KFNA 3DOKA 4PA1A 4CHZA 4CJVA 3K5LA 4M3XA 1D9DA 1HNVA 2F8TA 2NUBA 1XHXA 4CJRA 4YNQA 3NGIA 4NYFA 4DQRA 4O0JA 4DWIA 4FZYA 3K5NA 2IC3A 1WAJA 4DLEA 3RRHA 2XY6A 1NK8A 3KD5E 1ZBHA 4YFUA 3OYIA 2KW4A 4E7JA 4M3TA 3NDKA 1REVA 4CJ3A 3OYJA 1KSPA 4F4KA 1ITGA 4DLGA 4QCLA 4KFBA 3ZSZA 4I9LA 3HSTB 3QEPA 4HVJA 1KVBA 1TAUA 3T1AA 4UQGA 3ZSQA 2RF2A 1FKOA 5C25A 3HVRA 3TAGA 1ASUA 1WAFA 4E19A 3SJJA 4ZHRA 4CHYA 2IS3A 2BE2A 3MXMA 3HYFA 4FJHA 3LWMA 3HJFA 4CFBA 2X78A 3O3GA 3ZT2A 2FBXA 3AO2A 3OS2A 3B6OA 1BHLA 3LALA 1BQMA 3FFIA 1VRTA 4CJFA 3DRPA 3THVA 4FLYA 3IG1A 1X1PA 1BCOA 1RDAA 3NGYA 4ID1A 4CF1A 3NH2A 1L3SA 2G8UA 3V1OA 2DFEA 4M3YA 5SZTA 3NFAA 1D9FA 3O3HA 4DMNA 4KHYA 4CHQA 1NK0A 2X74A 1SKRA 4FW1A 5T7BA 4CJEA 3OYEA 1T05A 1EX4A 4ELUA 1LW0A 1JLAA 3ZSYA 4DSEA 4KTQA 2HVHA 1NKCA 1L3TA 1O1WA 3DLBA 3L2UA 2HHTA 4FK4A 3QO9A 1VSMA 3QEXA 3K58A 2XY5A 2HNZA 2E6LA 3MECA 4CK3A 3KKRA 4GMJB 4CF0A 3IRXA 4PY5A 1JKHA 4B08A 4CEEA 3WNFA 3AVNA 4CERA 3TABA 3AVKA 1GOAA 1KVCA 5KGWA 4CF8A 1XC9A 4TSXA 3ZSRA 1I3AA 4LSLA 3IAYA 3CFRA 1IG9A 2OA8A 5KTQA 3MAQA 4DTNA 1RT3A 4CFCA 3BDPA 4F8RA 3AA3A 4DS4A 5FROA 4OLBA 4CJWA 3L2RA 4CCHA 4O44A 3OYDA 1RT6A 3PX0A 4M45A 3EY1A 3K59A 2E6MA 3NAEA 4DF8A 3AVJA 3KLEA 4BDZA 4DTOA 3TAFA 1LW2A 2Y1IA 4E1NA 3DI6A 1BQNA 3PV8A 4E3SA 3ZCMA 2A1RA 4F2RA 4J2DA 4CEDA 3AVBA 5C42A 1S6PA 1TK5A 3ZSVA 2ETJA 2OPSA 1RT5A 1XHZA 5HP1A 2PY5A 3G0ZA 3NE6A 1KRPA 4DTSA 5KI6A 1NK5A 3HPHA 1KLMA 1QE1A 2OPPA 1WNSA 2DFHA 3ZT0A 3KK1A 1S1TA 3EYZA 3V9ZA 4DU4A 4Y1CA 3LWLA 3V81A 3TAQA 4W5OA 1VSFA 4H8KA 3RWUA 2HW3A 3VQAA 1KVAA 2VG7A 4B9VA 1CZ9A 4CGGA 1WN7A 3QIOA 3ZT1A 3LDSA 4M41A 1RDDA 4FJ9A 2KFZA 2YNHA 1FK9A 4FLUA 4FYDA 1BI4A 4W5QA 2HHXA 4DQQA 3CG7A 3M8SA 4RG8A 3O4QA 4F3OA 3L2VA 1TL1A 4DQIA 4LY7A 4DTPA 4OPJA 1DLOA 3VQBA 1RBVA 2YNFA 5I3UA 2QK9A 2FBTA 1RT7A 3MEDA 3VQQA 1ZBUA 1JL2A 4RW9A 1NK9A 1FXXA 4F2SA 3NBPA 3KTQA 1VSIA 3SV4A 1W0HA 3LP3A 1RTHA 4BWMA 4N5SA 3MXIA 3AVGA 1HMVA 3TR8A 4OPKA 3OS1A 2YKNA 4E0DA 4LD0A 4CHOA 3QINA 1TAQA 3ZSOA 2RN2A 2ZQBA 2IOCA 2YV0X 2O4GA 3QLHA 4CEOA 3CQ8A 2FC0A 4E7KA 3MEGA 4CGHA 4FLXA 1VSHA 3AO4A 1RT4A 3DLKA 4OKKA 4GVMA 4CIEA 3L2QA 4DSLA 4BDYA 4KI4A 3OYBA 3PX6A 3AA2A 1ZBFA 1GOCA 3WNGA 1Q9XA 4W5TA 3DYAA 4HUEA 2LSNA 2P5OA 2HNDA 3ITHA 3V9UA 2QKBA 1VSJA 3NH1A 2ITGA 2HNYA 3DMJA 3MEEA 5DMRA 4KHUA 1QQCA 3S3OA 1BCMA 2E4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HP9 A;  1TK8 A;  4DF4 A;  4C8K A;  1S9E A;  2OPQ A;  1BGX T;  2B4J A;  3I0S A;  5HRS A;  3ZSX A;  2G8W A;  3HM9 A;  1IH7 A;  1NKB A;  3NGZ A;  1JLB A;  5JS1 A;  4B3O A;  2XRI A;  4OGE A;  3HK2 A;  4CJU A;  2XY8 A;  4EZ6 A;  4MFB A;  1T8E A;  2WON A;  2IAJ A;  4Z4G A;  4EP4 A;  5D3G A;  4HUF A;  2Z1G A;  4FJN A;  3KD1 E;  3AVI A;  4I2Q A;  3K2P A;  4JRQ A;  2X6N A;  4BAC A;  1NK4 A;  1YT3 A;  2YHB A;  3CM5 A;  2JGU A;  4IBN A;  4DTX A;  4NCA A;  4Y1D A;  2D0C A;  4CGI A;  1VSD A;  4KV8 A;  1U45 A;  3RRG A;  1S1W A;  5FRN A;  4KKO A;  3VQ7 A;  3QNN A;  2DFF A;  2FBV A;  4DFK A;  1KCF A;  3S9H A;  1LV5 A;  1U04 A;  1SUQ A;  3VQP A;  4R5P A;  1VSL A;  1L5U A;  4L8R B;  4KTZ A;  1RTJ A;  4CES A;  4FJM A;  5C24 A;  2D0A A;  3E01 A;  1TKD A;  4QAG A;  3SPZ A;  5CYM A;  4BE2 A;  3U3G A;  4IFV A;  4CJ5 A;  2D0B A;  3KKS A;  3IS9 A;  4H4O A;  3JSM A;  5HLF A;  4K8Z A;  4M42 A;  4QOZ B;  4C8N A;  1NJY A;  4WE1 A;  1SL2 A;  4O55 A;  4CHN A;  1U48 A;  4ID5 A;  4I9Q A;  1QSY A;  4OVL A;  4PQU A;  2HHW A;  1VK0 A;  4DTR A;  4CJL A;  4NCB A;  3OYN A;  1U49 A;  5FDL A;  1RBR A;  3KJV A;  3OYK A;  4Z4H A;  1ZYQ A;  1JLF A;  4CEB A;  4CK1 A;  3OYH A;  2XHB A;  3AVL A;  4M3W A;  3V1Q A;  1HPZ A;  1S1V A;  4IFY A;  4CE9 A;  1WLJ A;  4BE0 A;  4E7L A;  1QTM A;  1RTI A;  1C1C A;  3NF9 A;  1HQU A;  3DM2 A;  1A5X A;  3CFP A;  4AIL C;  1G15 A;  2Q3S A;  3SUN A;  4XIU A;  1N5Y A;  3SNN A;  1RTD A;  2FBY A;  5HRO A;  4FK2 A;  4K8X A;  1KTQ A;  4Q0B A;  4FJ5 A;  1RT1 A;  4DSJ A;  1LAW A;  3PX4 A;  2YNG A;  3QNO A;  2DTU A;  1T03 A;  4ICL A;  4BE1 A;  4M3U A;  3LZJ A;  1MU2 A;  1HQE A;  1B9D A;  1TKX A;  2JLE A;  5CZ2 A;  3HVT A;  3WNH A;  4CJS A;  3HP6 A;  3V9W A;  3PO4 A;  1LWE A;  3LPU A;  1IKW A;  2BAN A;  4CEZ A;  3RR8 A;  4FJX A;  3S3N A;  2GUI A;  1A5W A;  1FKP A;  1JLQ A;  2A1S A;  1HRH A;  4FM2 A;  3SV3 A;  1L3V A;  1Z26 A;  1UAX A;  3P83 D;  3KK3 A;  1ASV A;  3A2F A;  3V9S A;  3VQ9 A;  1JL1 A;  5KRT A;  4CGF A;  4O5B A;  1CXU A;  4CFD A;  2P51 A;  1KFD A;  3QIP A;  3OYA A;  3ZT3 A;  4KB0 A;  3I8D A;  4E1M A;  5CYQ A;  5J2N A;  3TAP A;  3OS0 A;  1X9M A;  3LP1 A;  3L8B A;  4LH4 A;  2HB5 A;  1UA1 A;  3SUQ A;  3V1R A;  4RW7 A;  3L3U A;  3MXJ A;  1HYV A;  5HBM A;  4M3R A;  3SZ2 A;  1IO2 A;  1TL3 A;  3HT3 A;  3CM6 A;  2I5J A;  5E41 A;  3LAN A;  2YNI A;  4BWJ A;  3RMA A;  3M8R A;  1CZB A;  3KLF A;  3SCX A;  1DTQ A;  3HXM A;  3C94 A;  3DRR A;  5SWM A;  3NHG A;  1RDB A;  3ALY A;  1ZBL A;  1WSF A;  3AA5 X;  3O3F A;  3HPO A;  4DQS A;  3AO3 A;  4EP5 A;  3RMB A;  1UA0 A;  3PO5 A;  1JXB A;  3JYT A;  3LP0 A;  3V6D A;  4ELT A;  4OGC A;  2ZD1 A;  4ELV A;  3C95 A;  3D45 A;  4CJT A;  2G8H A;  4DG1 A;  4KHN A;  4B8A B;  4FJL A;  4FM0 A;  3ZSW A;  1D5A A;  1RNH A;  3SQ0 A;  4FCY A;  3QET A;  3O4N A;  2ATQ A;  1UWB A;  4KHQ A;  4H4M A;  5KGX A;  4DFJ A;  3SQ2 A;  2VG5 A;  5K14 A;  4Z4C A;  3L3V A;  4IG0 A;  3G10 A;  1S1U A;  3DLG A;  4E7I A;  1NOZ A;  3U6F A;  2RKI A;  2IDO A;  4KRF A;  3OYL A;  1IKX A;  4OKE A;  4J2A A;  4CIF A;  2GV9 A;  4CEF A;  4LSN A;  1NJW A;  5KRS A;  1D8Y A;  1BIS A;  2PZS A;  3OVN A;  2KZM A;  3T19 A;  1TVR A;  2HMI A;  4GW6 A;  2OYQ A;  3D0P A;  1X9W A;  4KRE A;  3DOL A;  1TGO A;  5JS2 A;  4JLH A;  4CFA A;  3V9X A;  3DLH A;  4O0I A;  1VSK A;  1RBS A;  3AO1 A;  4J2B A;  3AVF A;  1C0U A;  2OZS A;  4KB1 A;  1XI1 A;  1Q9Y A;  4F3T A;  1C0M A;  3NF7 A;  3HL8 A;  3QER A;  1B9F A;  3KIO A;  1WSJ A;  4JS5 A;  1SKW A;  2VWJ A;  4FJK A;  2F96 A;  4FW2 A;  3EZ5 A;  1KFS A;  4FJI A;  2BGG A;  1C6V A;  3CYM A;  4AH9 A;  4B9T A;  2HVI A;  1J9A A;  4CEC A;  3C6T A;  3OYF A;  5J2M A;  1HNI A;  3ULD A;  2VWK A;  3LZI A;  3UIQ A;  4KHS A;  3SPY A;  2IGI A;  3SI6 A;  4KI6 A;  3H08 A;  4KHW A;  3AA4 A;  1A5V A;  2P1J A;  3SUP A;  1NK7 A;  4EZ9 A;  2WOM A;  3TAN A;  1X9S A;  3TAE A;  1L3U A;  3KLG A;  3ISN C;  4CIG A;  5FRM A;  1C1B A;  2OZM A;  3AO5 A;  1UOC A;  4PWD A;  3OYG A;  3RMC A;  1JLC A;  4AHU A;  3OYC A;  1JLE A;  3HPG A;  1EKE A;  3RR7 A;  4KAZ A;  2O4I A;  1RBT A;  3NF8 A;  2AJQ A;  1BI4 B;  3KLI A;  4FJG A;  4Z4I A;  4DFM A;  3OJU A;  4Z4E A;  1KLN A;  4NYN A;  4N47 A;  1NJX A;  4FJJ A;  5I42 A;  4C8M A;  2ZE2 A;  1QS4 A;  1J53 A;  3K5M A;  4MQ3 A;  3VQ6 A;  1C1A A;  3AV9 A;  1U47 A;  3DRS A;  3K5O A;  1CXQ A;  1VSE A;  2B6A A;  4FK0 A;  2HHS A;  4CJP A;  4HTU A;  1SV5 A;  1JXE A;  4IG3 A;  3DLE A;  1QSS A;  1TKZ A;  3CFO A;  5J1E A;  3P5J A;  1NJZ A;  2KZZ A;  4C8L A;  5CZ1 A;  3RMD A;  4CF9 A;  2G8V A;  1U4B A;  4AHR A;  4NCG A;  5EU7 A;  2HHU A;  4I2P A;  2PYJ A;  2Z1H A;  3QES A;  3M8P A;  4DSI A;  1DTT A;  3P1G A;  1SKS A;  1QSL A;  4OLA A;  3QEV A;  2G8I A;  1Y97 A;  1JLG A;  3B6P A;  4I7F A;  5HRR A;  1VRU A;  1WSH A;  3QEI A;  4DU1 A;  3SQ1 A;  3AVA A;  3VQ8 A;  4E7H A;  3HO1 A;  1S9G A;  1YTA A;  4CEA A;  3NH0 A;  4DS5 A;  3AVC A;  3V4I A;  4HHT A;  1BIU A;  4Z4F A;  4N41 A;  4CF2 A;  4CHP A;  1TV6 A;  1B92 A;  1WSG A;  1K6Y A;  1HYZ A;  2Y1J A;  3M8Q A;  4N76 A;  1RBU A;  1S1X A;  3SQ4 A;  4CGD A;  3KLH A;  1WSI A;  4FJ7 A;  3I0R A;  4CJ4 A;  1RIL A;  2F8S A;  2HHQ A;  4CJK A;  1ASW A;  4HCB A;  3QEW A;  4RW6 A;  4HUG A;  5J2P A;  1NK6 A;  3SYZ A;  1N6Q A;  4JS4 A;  1IKY A;  4FLV A;  4OJR A;  3VQ4 A;  3LAM A;  3C6U A;  4AHV A;  2OPR A;  4B9S A;  4Z0U A;  2DY4 A;  1GOB A;  1W9H A;  2D5R A;  1I39 A;  3VQC A;  4DSF A;  4LH5 A;  4ZTJ A;  1Q8I A;  1S6Q A;  4KO0 A;  1YTU A;  1CLQ A;  4DTJ A;  2B5J A;  2W42 A;  3PUF A;  4IDK A;  3TAM A;  1EXQ A;  4DFP A;  1SL1 A;  2YKM A;  3ASM A;  1QHT A;  1YVU A;  4FLT A;  4HCC A;  4KPY A;  2P5G A;  4FZZ A;  3NF6 A;  4CGJ A;  1TKT A;  3OY9 A;  4CK2 A;  3AVH A;  1J54 A;  4B9U A;  1LAV A;  4BDP A;  4W5R A;  3AVM A;  3ZT4 A;  4AHT A;  3VA0 A;  4FXD A;  1S5J A;  1EET A;  2HHV A;  2EHG A;  3NCI A;  4CJQ A;  3T3F A;  2XO7 A;  2R7Y A;  1LWC A;  1RDC A;  3OJS A;  5J2Q A;  2PYL A;  1NOY A;  5HRP A;  4W5N A;  1EP4 A;  1R0A A;  4E89 A;  1ZBI A;  3LPT A;  4RW8 A;  1J5O A;  3S3M A;  4M3Z A;  2XY7 A;  3BGR A;  3LP2 A;  4B9M A;  3F9K A;  1C0T A;  2VG6 A;  4ZTF A;  1LWF A;  4B8C A;  1IKV A;  3PY8 A;  1TK0 A;  2QXF A;  4DU3 A;  2G8K A;  4RW4 A;  3RTV A;  3DLR A;  2X6S A;  2YHA A;  3KK2 A;  4B9L A;  3VQD A;  3LAK A;  4C8O A;  1HYS A;  4B9N A;  4IKF A;  1BL3 A;  4FM1 A;  4FVM A;  3TI0 A;  3OYM A;  3VQ5 A;  3U3Y A;  3VA3 A;  4KTW A;  5DK5 A;  3WNE A;  1RCH A;  1Z25 A;  3F73 A;  1T7P A;  2BDP A;  1F21 A;  4AHS A;  3VN5 A;  2G8F A;  4DTU A;  4DSK A;  2KTQ A;  1WSE A;  4N56 A;  2GBZ A;  2Z1J A;  3VQE A;  1BIZ A;  2EX3 A;  2RPI A;  1SL0 A;  5CY4 A;  4FLZ A;  3SUO A;  4CEQ A;  4J2E A;  1RT2 A;  4DQP A;  2QKK A;  1XWL A;  4O4G A;  3K57 A;  3TAR A;  2KQ2 A;  4FJ8 A;  4Q5V A;  4FZX C;  4PUO A;  4G1Q A;  5HRN A;  2Z1I A;  4AHC A;  4FLW A;  3L2W A;  4OKJ A;  1NKE A;  1HJR A;  4JRP A;  3TWH A;  4DTM A;  2KFN A;  3DOK A;  4PA1 A;  4CHZ A;  4CJV A;  3K5L A;  4M3X A;  1D9D A;  1HNV A;  2F8T A;  2NUB A;  1XHX A;  4CJR A;  4YNQ A;  3NGI A;  4NYF A;  4DQR A;  4O0J A;  4DWI A;  4FZY A;  3K5N A;  2IC3 A;  1WAJ A;  4DLE A;  3RRH A;  2XY6 A;  1NK8 A;  3KD5 E;  1ZBH A;  4YFU A;  3OYI A;  2KW4 A;  4E7J A;  4M3T A;  3NDK A;  1REV A;  4CJ3 A;  3OYJ A;  1KSP A;  4F4K A;  1ITG A;  4DLG A;  4QCL A;  4KFB A;  3ZSZ A;  4I9L A;  3HST B;  3QEP A;  4HVJ A;  1KVB A;  1TAU A;  3T1A A;  4UQG A;  3ZSQ A;  2RF2 A;  1FKO A;  5C25 A;  3HVR A;  3TAG A;  1ASU A;  1WAF A;  4E19 A;  3SJJ A;  4ZHR A;  4CHY A;  2IS3 A;  2BE2 A;  3MXM A;  3HYF A;  4FJH A;  3LWM A;  3HJF A;  4CFB A;  2X78 A;  3O3G A;  3ZT2 A;  2FBX A;  3AO2 A;  3OS2 A;  3B6O A;  1BHL A;  3LAL A;  1BQM A;  3FFI A;  1VRT A;  4CJF A;  3DRP A;  3THV A;  4FLY A;  3IG1 A;  1X1P A;  1BCO A;  1RDA A;  3NGY A;  4ID1 A;  4CF1 A;  3NH2 A;  1L3S A;  2G8U A;  3V1O A;  2DFE A;  4M3Y A;  5SZT A;  3NFA A;  1D9F A;  3O3H A;  4DMN A;  4KHY A;  4CHQ A;  1NK0 A;  2X74 A;  1SKR A;  4FW1 A;  5T7B A;  4CJE A;  3OYE A;  1T05 A;  1EX4 A;  4ELU A;  1LW0 A;  1JLA A;  3ZSY A;  4DSE A;  4KTQ A;  2HVH A;  1NKC A;  1L3T A;  1O1W A;  3DLB A;  3L2U A;  2HHT A;  4FK4 A;  3QO9 A;  1VSM A;  3QEX A;  3K58 A;  2XY5 A;  2HNZ A;  2E6L A;  3MEC A;  4CK3 A;  3KKR A;  4GMJ B;  4CF0 A;  3IRX A;  4PY5 A;  1JKH A;  4B08 A;  4CEE A;  3WNF A;  3AVN A;  4CER A;  3TAB A;  3AVK A;  1GOA A;  1KVC A;  5KGW A;  4CF8 A;  1XC9 A;  4TSX A;  3ZSR A;  1I3A A;  4LSL A;  3IAY A;  3CFR A;  1IG9 A;  2OA8 A;  5KTQ A;  3MAQ A;  4DTN A;  1RT3 A;  4CFC A;  3BDP A;  4F8R A;  3AA3 A;  4DS4 A;  5FRO A;  4OLB A;  4CJW A;  3L2R A;  4CCH A;  4O44 A;  3OYD A;  1RT6 A;  3PX0 A;  4M45 A;  3EY1 A;  3K59 A;  2E6M A;  3NAE A;  4DF8 A;  3AVJ A;  3KLE A;  4BDZ A;  4DTO A;  3TAF A;  1LW2 A;  2Y1I A;  4E1N A;  3DI6 A;  1BQN A;  3PV8 A;  4E3S A;  3ZCM A;  2A1R A;  4F2R A;  4J2D A;  4CED A;  3AVB A;  5C42 A;  1S6P A;  1TK5 A;  3ZSV A;  2ETJ A;  2OPS A;  1RT5 A;  1XHZ A;  5HP1 A;  2PY5 A;  3G0Z A;  3NE6 A;  1KRP A;  4DTS A;  5KI6 A;  1NK5 A;  3HPH A;  1KLM A;  1QE1 A;  2OPP A;  1WNS A;  2DFH A;  3ZT0 A;  3KK1 A;  1S1T A;  3EYZ A;  3V9Z A;  4DU4 A;  4Y1C A;  3LWL A;  3V81 A;  3TAQ A;  4W5O A;  1VSF A;  4H8K A;  3RWU A;  2HW3 A;  3VQA A;  1KVA A;  2VG7 A;  4B9V A;  1CZ9 A;  4CGG A;  1WN7 A;  3QIO A;  3ZT1 A;  3LDS A;  4M41 A;  1RDD A;  4FJ9 A;  2KFZ A;  2YNH A;  1FK9 A;  4FLU A;  4FYD A;  1BI4 A;  4W5Q A;  2HHX A;  4DQQ A;  3CG7 A;  3M8S A;  4RG8 A;  3O4Q A;  4F3O A;  3L2V A;  1TL1 A;  4DQI A;  4LY7 A;  4DTP A;  4OPJ A;  1DLO A;  3VQB A;  1RBV A;  2YNF A;  5I3U A;  2QK9 A;  2FBT A;  1RT7 A;  3MED A;  3VQQ A;  1ZBU A;  1JL2 A;  4RW9 A;  1NK9 A;  1FXX A;  4F2S A;  3NBP A;  3KTQ A;  1VSI A;  3SV4 A;  1W0H A;  3LP3 A;  1RTH A;  4BWM A;  4N5S A;  3MXI A;  3AVG A;  1HMV A;  3TR8 A;  4OPK A;  3OS1 A;  2YKN A;  4E0D A;  4LD0 A;  4CHO A;  3QIN A;  1TAQ A;  3ZSO A;  2RN2 A;  2ZQB A;  2IOC A;  2YV0 X;  2O4G A;  3QLH A;  4CEO A;  3CQ8 A;  2FC0 A;  4E7K A;  3MEG A;  4CGH A;  4FLX A;  1VSH A;  3AO4 A;  1RT4 A;  3DLK A;  4OKK A;  4GVM A;  4CIE A;  3L2Q A;  4DSL A;  4BDY A;  4KI4 A;  3OYB A;  3PX6 A;  3AA2 A;  1ZBF A;  1GOC A;  3WNG A;  1Q9X A;  4W5T A;  3DYA A;  4HUE A;  2LSN A;  2P5O A;  2HND A;  3ITH A;  3V9U A;  2QKB A;  1VSJ A;  3NH1 A;  2ITG A;  2HNY A;  3DMJ A;  3MEE A;  5DMR A;  4KHU A;  1QQC A;  3S3O A;  1BCM A;  2E4L A; 
#chains in the Genus database with same CATH topology
 2OAN A;  3HP9 A;  1VQN N;  4JI5 K;  2OPQ A;  4BRP A;  1VQM N;  4BVO A;  3ZSX A;  5EX5 A;  1JLB A;  5JS1 A;  2GUP A;  4FWN A;  2XRI A;  3SAF A;  4B3O A;  3U8X A;  4YOV A;  4MFB A;  4BR9 A;  1RGI A;  5KPZ A;  4HUF A;  2Z1G A;  3KHY A;  3UKU A;  3CM5 A;  4DTX A;  2FSJ A;  4H0V B;  4JI6 K;  1XNQ K;  1S1W A;  4KKO A;  2DFF A;  3FE1 A;  3P39 A;  3S9H A;  3ATU A;  2E20 A;  2BTF A;  4KTZ A;  5HOO A;  1KAZ A;  1HKC A;  5AZJ A;  5LY3 A;  4CZJ A;  4BE2 A;  2D0B A;  2A6A A;  4B1U B;  4H4O A;  5HLF A;  1Y64 A;  2KKZ A;  3A0I X;  4WE1 A;  4CHN A;  4I9Q A;  2HHW A;  4OVL A;  3OYN A;  2A41 A;  4I6M B;  3KJV A;  4DQ8 A;  3HM8 A;  2ZF5 O;  3O80 A;  4BRG A;  1HPZ A;  4IFY A;  4E7L A;  4HWI A;  4B3T K;  1RTD A;  1RT1 A;  4KH4 A;  3MX5 A;  1T6D A;  3PO4 A;  4RTF D;  3HVT A;  2NRW A;  2V7Z A;  3LPU A;  4CEZ A;  2QI2 A;  1A5W A;  1FKP A;  1L3V A;  3P83 D;  4H5N A;  3LM2 A;  4EFH A;  1KFD A;  3QIP A;  3QDK A;  3D2F A;  3DXM B;  3LDO A;  3LP1 A;  1S3X A;  3MN6 A;  4LH4 A;  2YJF A;  3V1R A;  1OH6 A;  3CET A;  1HYV A;  1IO2 A;  1TL3 A;  4CZG A;  2QWP A;  3SCX A;  1XC3 A;  2NRH A;  3HXM A;  3OA9 A;  1GLB G;  3NHG A;  3ALY A;  1ZBL A;  2Q1N A;  1WSF A;  4JNE A;  2P9P A;  3BY5 A;  4DQS A;  2V51 B;  3AO3 A;  3RMB A;  4A2A A;  3LP0 A;  2P9N A;  4ELV A;  3C95 A;  2ZGY A;  4LF6 K;  4DG1 A;  4H0Y B;  1RNH A;  4LF7 K;  2HOE A;  4KHQ A;  3G71 N;  4A59 A;  3O9Q A;  3LL3 A;  3DLG A;  1NOZ A;  1OVY A;  4CIF A;  2GV9 A;  3J7Z O;  3QB0 A;  1BIS A;  2D0P A;  3AGK A;  4JK8 A;  1GLF O;  3DOL A;  1TGO A;  3GL1 A;  5JS2 A;  3V9X A;  2F9T A;  4O0I A;  3AVF A;  1IJJ A;  3H1V X;  3MWP A;  4BRM A;  4CZE A;  3ZEU A;  4FWL A;  4NLB A;  3A5M C;  2HVI A;  3C6T A;  1X9J A;  1X3N A;  2IVP A;  3K0S A;  1C0F A;  3LZI A;  2IGI A;  2P9U B;  4KHW A;  3AA4 A;  3HRG A;  1X9S A;  1TYQ A;  4FWR A;  3S41 A;  3KLG A;  3ISN C;  3AGR A;  1RDU A;  3RMC A;  3OYC A;  4RWT A;  3KLI A;  4DFM A;  1HKG A;  4NYN A;  1CZA N;  4FJJ A;  5I42 A;  3K5M A;  1IG8 A;  3C7N A;  3M1F A;  4MQ3 A;  3VQ6 A;  1C1A A;  4BR0 A;  2HHS A;  1JCE A;  3DRS A;  5B8H A;  4CJP A;  3KWG A;  4HTU A;  1JXE A;  4IG3 A;  4B3R K;  3P5J A;  2W6L A;  4NXM K;  5E84 A;  1U4B A;  1U2V A;  1DTT A;  3P1G A;  1WOQ A;  3CJC A;  3QEV A;  3KK7 A;  2G8I A;  1VRU A;  2KLA A;  4H0T B;  3SQ1 A;  4K43 A;  3BUZ B;  1S9G A;  4YOT A;  4DS5 A;  1Z05 A;  5GAG P;  4HHT A;  4H5V A;  5AQR A;  4WFB L;  4A5B A;  1M90 O;  4DV2 K;  2Y1J A;  2Q31 A;  4FOI A;  5AQX A;  1RBU A;  1C0G A;  3SQ4 A;  4FJ7 A;  4U67 L;  2HST A;  3I0R A;  4CJ4 A;  4DUY K;  4AM7 A;  4CJK A;  1ASW A;  3N4Q A;  4RW6 A;  3NMU A;  3AAR A;  3R1X A;  1NK6 A;  4JS4 A;  5AQM A;  5DM6 L;  2D4W A;  4B9S A;  2OPR A;  4YOU A;  1GOB A;  1I39 A;  4IEE A;  4LH5 A;  1S6Q A;  4KO0 A;  1YTU A;  1CLQ A;  1YI2 N;  4FJ5 A;  1SL1 A;  3LDN A;  4KPY A;  3EO3 A;  3NF6 A;  4CGJ A;  3UKU B;  4W5R A;  1EET A;  3CCS N;  4CJQ A;  3T3F A;  2R7Y A;  1LWC A;  3O4W A;  2CH5 A;  1RDC A;  3HI0 A;  5J2Q A;  4LC9 B;  5HRP A;  1EP4 A;  3VF4 A;  2GEL A;  5AZJ B;  4E89 A;  2ITM A;  4RW8 A;  3S3M A;  3FZF A;  4C1N K;  1LOT B;  2XY7 A;  3LP2 A;  4B8C A;  1IKV A;  4JI4 K;  4DU3 A;  4GKJ K;  2G8K A;  3O9R A;  2OTL N;  5GIO A;  3CF5 L;  2CGL A;  4B9L A;  2E2Q A;  3VMF B;  2QWM A;  4C8O A;  1DT9 A;  2BH1 A;  1DKG D;  3TI0 A;  3VQ5 A;  3BZC A;  3U3Y A;  5GIP A;  5DK5 A;  1T7P A;  1Z25 A;  5JLH A;  3F73 A;  4LF9 K;  4AHS A;  2G8F A;  4DUZ K;  2E2O A;  2GBZ A;  2Z1J A;  1BIZ A;  2EX3 A;  4CD1 A;  4J2E A;  4DQP A;  2QKK A;  2A5X A;  5BPN A;  3CCU N;  4Q5V A;  4FZX C;  3TTD A;  1HJR A;  4JRP A;  4GNI A;  1P90 A;  4H0X B;  1BU6 O;  1D9D A;  1HNV A;  4CJR A;  4YNQ A;  3NGI A;  4NYF A;  5FPE A;  4X62 K;  4O0J A;  1ZBH A;  2UUC K;  1GLE G;  3TSQ A;  2QTD A;  3D2F B;  4YFU A;  3NDK A;  1REV A;  2O8C A;  4BGB A;  4OPA A;  2QEX N;  3HST B;  4HVJ A;  4MDB A;  1KVB A;  1QZ5 A;  3ZSQ A;  5C25 A;  1H1V A;  3SAH A;  3TAG A;  1WAF A;  4GV6 A;  4E19 A;  2O8F A;  4O8U A;  2P9P B;  3VPZ A;  3J7Y P;  3DWL A;  4Y0W A;  4ID1 A;  2P9N B;  5SZT A;  1VQ4 N;  3O3H A;  2E1Z A;  2NNW A;  4KTQ A;  3DLB A;  3L2U A;  2JWK A;  2NRX A;  3QEX A;  2HNZ A;  4CK3 A;  4CF0 A;  1WBD A;  1JCF A;  4CER A;  1N32 K;  3AVK A;  4YDU A;  1KVC A;  3PIP L;  3W0L A;  4DR2 K;  5M1O A;  5KTQ A;  1RT3 A;  4CFC A;  3BDP A;  4DS4 A;  1HR0 K;  3EE8 A;  3QFP A;  3OYD A;  3K59 A;  4WYB A;  4IOA L;  4GKK K;  3ZEU B;  3TAF A;  1E4G T;  1LW2 A;  4E1N A;  4CZF A;  5TKW A;  4E3S A;  4JI3 K;  4BC4 A;  1HPM A;  4CED A;  3TPQ A;  4BC3 A;  5AQL A;  3O08 A;  1RT5 A;  3C65 A;  1T44 A;  5HP1 A;  2PY5 A;  5LJW A;  1DEJ A;  1NMD A;  1KLM A;  1TYQ B;  3ZT0 A;  4YDU C;  2DFH A;  4FJG A;  3TAQ A;  4Y1C A;  4CZH A;  4W5O A;  3RWU A;  2YHW A;  1J5E K;  3SAG A;  3F9M A;  3QML A;  3QBX A;  4M41 A;  4DV1 K;  2PBD A;  4FJ9 A;  2YNH A;  4FLU A;  4FYD A;  4W5Q A;  3C7N B;  4RG8 A;  4F3O A;  3L2V A;  1TL1 A;  5I3U A;  1Q18 A;  2YNF A;  5AQF A;  1EO1 A;  2FBT A;  3CJA A;  1X3M A;  3D2E A;  1ZBU A;  1FXX A;  3EKU A;  4DR7 K;  1RTH A;  4BWM A;  1U2V B;  4JHD A;  3WT0 A;  3OS1 A;  4CHO A;  1TAQ A;  1ATR A;  2ZQB A;  3QLH A;  3VEW A;  2FC0 A;  2ASM A;  1VSH A;  4CIE A;  2FSK A;  4GVM A;  3CMA N;  4FWM A;  1ZBF A;  3IKM A;  3DYA A;  2P5O A;  2HND A;  4MLH A;  2GWK A;  2HHT A;  4XH1 A;  4GV9 A;  4C8K A;  1BGX T;  3K9J A;  5HRS A;  3CC2 N;  3EL2 A;  1WUA A;  3NGZ A;  5EY4 A;  3N4P A;  1YIJ N;  3OBY A;  5ELZ A;  1T8E A;  5FPN A;  4Z4G A;  1SAZ A;  3FZM A;  3K2P A;  2X6N A;  3P4I A;  4IBN A;  2JGU A;  3CCV N;  4NCA A;  2D0C A;  2FF3 B;  1VSD A;  1GLJ O;  3QNN A;  4CZM A;  2FBV A;  1KCF A;  1SUQ A;  1VSL A;  4AF1 A;  4BG8 A;  1VQO N;  4CES A;  4JI2 K;  1TKD A;  2GX9 A;  5M1P A;  4XH4 A;  3U3G A;  4IFV A;  4CJ5 A;  4B9Q A;  3JSM A;  4M42 A;  4QOZ B;  4C8N A;  2W40 A;  1SL2 A;  2HHH K;  1U48 A;  3CXC M;  4B1X B;  4BRD A;  1HKB A;  4WFN L;  5I9E B;  4CBX A;  1ZYQ A;  2WFB A;  4CEB A;  4CZL A;  2XHB A;  3U4L A;  4M3W A;  3QIC A;  4BE0 A;  1S1V A;  3VTI A;  4CE9 A;  3ENH A;  1RTI A;  1C1C A;  1NBW A;  1HQU A;  3DM2 A;  3CFP A;  4EHU A;  2Q3S A;  3WXK A;  3ZET A;  3SNN A;  2FBY A;  2UUA K;  4ISG A;  4FK2 A;  4Q0B A;  1LAW A;  2YNG A;  3QNO A;  1VQL N;  1T03 A;  4BE1 A;  3SMS A;  2JLE A;  3MX2 A;  1IKW A;  4DV0 K;  4FJX A;  4B1V A;  3S3N A;  1HRH A;  2HF4 A;  1UAX A;  3KK3 A;  3A2F A;  4DR5 K;  4CBW A;  3WQU A;  3WXL A;  1JL1 A;  4BR5 A;  1QHA A;  1NU0 A;  2O8C B;  4CFD A;  4IJA A;  1MA9 B;  4E1M A;  1IBL K;  5CYQ A;  3TAP A;  3L8B A;  1M1K O;  2HB5 A;  2IVO A;  3SUQ A;  4H5R A;  3L3U A;  2WC9 A;  3MXJ A;  2O8F B;  3OW2 M;  2I5J A;  3KZB A;  3H3O B;  4BWJ A;  4DV4 K;  1DTQ A;  4YOY A;  3DRR A;  3OHR A;  1RDB A;  3CJB A;  4DKW A;  3HPO A;  1UA0 A;  3WQT A;  1JXB A;  3V6D A;  4OGC A;  2ZD1 A;  3L4I A;  4CJT A;  2GTD A;  2H3G X;  2P9I B;  4FM0 A;  4QS9 A;  3ZSW A;  3PIO L;  2ATQ A;  5GAD P;  1UWB A;  4H4M A;  4GV3 A;  4DFJ A;  1VAZ A;  3SQ2 A;  5K14 A;  1YAG A;  4JI8 K;  4YOW A;  3U9D A;  4E7I A;  2QWQ A;  2QWN A;  2RKI A;  4KRF A;  1IKX A;  4J2A A;  1EWQ A;  3JXU A;  4LSN A;  3OVN A;  3LM9 A;  3PSF A;  4GW6 A;  2OYQ A;  3D0P A;  1X9W A;  4KRE A;  5JVG L;  4FOE A;  3WUH A;  1K8K A;  1VSK A;  5KPT A;  1C0U A;  4KB1 A;  1XI1 A;  1C0M A;  1SKW A;  2DPN A;  4H0O A;  1J9A A;  3DJC A;  4BR2 A;  3UIQ A;  2VWK A;  2E2N A;  4DV5 K;  1NK7 A;  1A5V A;  2P1J A;  3SUP A;  4JYA K;  2KFN A;  3TAN A;  4BGA A;  3ENB A;  5FRM A;  1UOC A;  1JLC A;  1K73 O;  3OJU A;  1FJG K;  1R59 O;  4N47 A;  5JMV A;  3D2E B;  3THY A;  2VGN A;  1GLA G;  4BRF A;  4FK0 A;  1V4T A;  1TKZ A;  3CFO A;  5J1E A;  1NJZ A;  4JHD B;  5AFU A;  3SLC A;  5CZ1 A;  4C8L A;  5EU7 A;  2HHU A;  4I2P A;  5TKY A;  2Z1H A;  3QES A;  5C12 A;  4DSI A;  1SKS A;  4OLA A;  4A57 A;  1OH5 A;  5BRH A;  1Q7Y O;  1Y97 A;  4I7F A;  3VF2 A;  4DU1 A;  3AVA A;  3VQ8 A;  1N33 K;  4JKE A;  3HO1 A;  1YTA A;  1BWF O;  3V4I A;  1YXQ A;  1BIU A;  3CHW A;  3O9U A;  4CHP A;  1TV6 A;  1QQN A;  3O1B A;  3M8Q A;  4N76 A;  1S1X A;  1WSI A;  1RIL A;  5BRE A;  3P31 A;  3QEW A;  4BRL A;  4HUG A;  3SYZ A;  1Q81 O;  1IKY A;  4HTL A;  3VQ4 A;  4AHV A;  4Z0U A;  2DY4 A;  4DSF A;  4ZTJ A;  2HBL A;  3VGM A;  4DTJ A;  4DFP A;  3ASM A;  1YVU A;  4PL7 A;  3BEX A;  2P5G A;  4CK2 A;  1LAV A;  4CZK A;  3CJ9 A;  3ZT4 A;  4FXD A;  1S5J A;  4AQY K;  5IT9 O;  2J4R A;  1SQK A;  1W7A A;  4JK7 A;  3LPT A;  2OCE A;  2W6K A;  3BGR A;  3RSE A;  1LWF A;  1Z6R A;  5AQI A;  1BUP A;  2QXF A;  2E1Y A;  1WBB A;  3RTV A;  3DLR A;  2X6S A;  2HMP A;  3KK2 A;  1VHX A;  4MDA A;  4MO4 A;  4IKF A;  1BL3 A;  3IDH A;  1QQO A;  3R3L A;  1NGD A;  1NJI O;  3VA3 A;  1VQ8 N;  4KTW A;  4BC5 A;  1F21 A;  5JLF A;  2ASO A;  1WSE A;  3ZET B;  1SL0 A;  2RPI A;  5CY4 A;  2ZJR L;  3SUO A;  4FJ8 A;  4G1Q A;  5HRN A;  1QVG M;  4OX9 K;  1NKE A;  3TWH A;  5EXW A;  5C0Y A;  2NUB A;  4PKI A;  1XHX A;  4DQR A;  4DWI A;  4FZY A;  4C1N I;  3K5N A;  2IC3 A;  1WAJ A;  2JWL A;  1TUY A;  3OYI A;  2KW4 A;  4JN4 A;  3CIP A;  3ZSZ A;  3QEP A;  1YVN A;  3T1A A;  1FKO A;  1GLD G;  3R6M A;  4CHY A;  3MXM A;  3ID8 A;  1KAX A;  4FJH A;  4CFB A;  2D1K A;  1KAY A;  3B6O A;  3LAL A;  1BQM A;  3NVK A;  3DRP A;  3THV A;  4FLY A;  3IG1 A;  1BCO A;  1RDA A;  2G8U A;  5BRF A;  3NFA A;  5BN8 A;  2ZGZ A;  4KHY A;  4DMN A;  1KXP A;  4JKD A;  1NGF A;  1SKR A;  4CJE A;  3OYE A;  1T05 A;  3ZSY A;  4DSE A;  1NKC A;  1L3T A;  5C2D A;  3T7Z A;  2WBN A;  1VSM A;  3MDQ A;  3QO9 A;  2XY5 A;  4B1W B;  3MEC A;  2E6L A;  4WQ5 A;  4PY5 A;  4B08 A;  3AVN A;  3TAB A;  1GOA A;  2YHY A;  1I3A A;  4KH5 A;  3MWT A;  4DTN A;  4AM6 A;  5FRO A;  4OLB A;  1K8K B;  4CJW A;  3L2R A;  2NRR A;  5HL7 L;  1ILY A;  4JAX A;  3KLE A;  2Y1I A;  1BQN A;  3PV8 A;  3ZCM A;  2HBK A;  1U6Z A;  3O9S A;  3AVB A;  4BC2 A;  2UU9 K;  1TK5 A;  4WQ5 C;  4CI6 A;  3P38 A;  2W41 A;  3G0Z A;  4ILJ A;  2EWS A;  3HPH A;  4BDP A;  4DR4 K;  1N8R O;  2UUB K;  3LWL A;  1BDG A;  1DGK N;  1KVA A;  3A5L C;  4IJN A;  5JVH L;  4YOR A;  1G99 A;  1ZC6 A;  3G4S N;  1FK9 A;  1BI4 A;  3THY B;  3MN7 A;  3M8S A;  4FWO A;  4BRQ A;  1IV0 A;  5JIC A;  4DTP A;  3H46 O;  1DLO A;  4BRA A;  2QK9 A;  4K41 A;  2VGM A;  3SMP A;  4BRI A;  4PHT X;  4RW9 A;  1NK9 A;  4F2S A;  5EOY A;  1VSI A;  3SV4 A;  3LP3 A;  4O8K A;  3MXI A;  5A2Q O;  2YKN A;  4PL8 A;  4LD0 A;  1BG3 A;  2RN2 A;  4YY3 K;  3F2K A;  1KFS A;  3MEG A;  4FLX A;  3DLK A;  4BRN A;  3C6A A;  3PX6 A;  4W5T A;  4FO0 A;  5GIN A;  2LSN A;  4LF8 K;  2QKB A;  3O8M A;  3NH1 A;  2YCH A;  1JJ2 M;  2HNY A;  3DMJ A;  4KHU A;  4NB4 A;  3S3O A;  5BN9 A;  3BF3 A;  1TK8 A;  4DF4 A;  2E88 A;  3FR0 A;  1BA0 A;  4EHT A;  3I0S A;  4QS7 A;  1IH7 A;  1NKB A;  1KQS M;  3WXI A;  4BG9 A;  3HK2 A;  2XY8 A;  5AJ3 K;  4EZ6 A;  3IFR A;  2CGJ A;  5KQD A;  5D3G A;  5CE3 A;  3CC4 N;  3KD1 E;  3AVI A;  4JRQ A;  4B1Z A;  1YT3 A;  4Y1D A;  2CGK A;  4KV8 A;  5KPR A;  1U45 A;  3RRG A;  5FRN A;  3VQ7 A;  1T6C A;  2AP1 A;  4PKG A;  4DFK A;  1ATS A;  1U04 A;  4R5P A;  3IMX A;  2V52 B;  4FJM A;  2P9K A;  1JCG A;  2D0A A;  3E01 A;  3RSE B;  4QAG A;  3SPZ A;  3E9P A;  5AQZ A;  3IS9 A;  3FGU A;  5AFU H;  5BPL A;  1NJY A;  4O55 A;  4BY9 C;  1KD1 O;  4ID5 A;  1QSY A;  4PQU A;  3AAQ A;  4DTR A;  4CJL A;  4NCB A;  1RDW X;  1NGA A;  3DAW A;  1U49 A;  5FDL A;  2PFU A;  1JLF A;  3OYH A;  4DR3 K;  3H6E A;  2FSN A;  1YUW A;  3V1Q A;  1WLJ A;  3NF9 A;  5F2R A;  4AIL C;  1G15 A;  3A5O C;  3THW A;  5HRO A;  4K8X A;  4DSJ A;  2WTU A;  2AA4 A;  2VWB A;  3VER A;  3CER A;  4FWK A;  4M3U A;  4IO9 L;  1MU2 A;  3WNH A;  4CJS A;  3V9W A;  2OZM A;  3HP6 A;  5EVZ A;  1LWE A;  2GUI A;  3SV3 A;  1JLQ A;  1Z26 A;  1ASV A;  4IXC A;  2NRV A;  5KRT A;  4O5B A;  1CXU A;  2F7T A;  1X9M A;  4BRO A;  1YHQ N;  1RFQ A;  4RW7 A;  4M3R A;  3PX4 A;  2YJE A;  3HT3 A;  3CM6 A;  3RMA A;  2UYT A;  3DXK A;  3LAN A;  5E41 A;  3M8R A;  1CZB A;  3KLF A;  4LF4 K;  5SWM A;  2QWO A;  4DR1 K;  4EAH D;  4KH6 A;  1OVQ A;  4MO5 A;  4EP5 A;  3PO5 A;  3JYT A;  2RE2 A;  1O13 A;  3JS6 A;  2G8H A;  4KHN A;  4FJL A;  3UKR A;  1D5A A;  3IUC A;  2Q2R A;  3QET A;  3O4N A;  2NLX A;  4O5F A;  4JD2 A;  4H03 B;  5KGX A;  1S22 A;  2VG5 A;  4Z4C A;  1MWM A;  4BQL A;  4IG0 A;  1QZ6 A;  1S1U A;  3CCQ N;  3U6F A;  4ISF A;  3OYL A;  4OKE A;  3CME N;  5KRS A;  2KZM A;  1TVR A;  5ADX A;  2HMI A;  3WXM B;  4CFA A;  3VES A;  5M1K A;  4J2B A;  2OZS A;  1Q9Y A;  4F3T A;  3R9P A;  3HL8 A;  3KIO A;  1WSJ A;  3O9T A;  4JS5 A;  4FJK A;  2VCP A;  4ILG B;  3EZ5 A;  5C15 A;  2QW9 A;  1C6V A;  3CYM A;  4A62 A;  4AH9 A;  4B9T A;  2BGG A;  4FVU A;  1YIT N;  4CEC A;  5J2M A;  3HOS A;  2Q0U A;  3EZW A;  4KHS A;  3SI6 A;  2P9L A;  4KI6 A;  3GBT A;  3TAE A;  3Q7C A;  5LJV A;  2VYP A;  4FWQ A;  3BF1 A;  4CIG A;  4DR6 K;  4IOC L;  4AHU A;  3RR7 A;  2O4I A;  2AJQ A;  1RBT A;  3NF8 A;  1BI4 B;  4Z4I A;  1QQM A;  4FSV A;  3R8E A;  1VQ6 N;  1HNX K;  2A3Z A;  4C8M A;  2ZE2 A;  4C23 A;  1U47 A;  3K5O A;  3E66 A;  2QM1 A;  2DTU A;  1ATN A;  1SV5 A;  3DLE A;  1HNZ K;  2KZZ A;  4NCG A;  2FF6 A;  3W3D A;  5H1S Q;  2YX6 A;  1XMQ K;  1QSL A;  3A5N C;  3B6P A;  5HRR A;  4JK9 A;  1WSH A;  3QEI A;  2KHO A;  5AQG A;  3J80 O;  4LF5 K;  3PSI A;  4Z4F A;  4KHP K;  1Q82 O;  1K6Y A;  2E5L K;  4JKB A;  3GOI A;  4IOX A;  4BRE A;  3MN9 A;  4FLV A;  2Q36 A;  3KWI A;  3C6U A;  2D5R A;  3VQC A;  2B5J A;  4BQZ A;  3PUF A;  2W42 A;  4DSL A;  2YKM A;  1QHT A;  4FZZ A;  3VEZ A;  5F0X A;  1TKT A;  4M7X A;  3THX A;  3AVH A;  2E2P A;  3ATV A;  4B9U A;  1YJW N;  1NGG A;  1NGJ A;  3AVM A;  3VA0 A;  4IWV A;  1ZBS A;  5AQU A;  3NCI A;  3T1Y K;  3OJS A;  3TU5 A;  3ZYY X;  1E4F T;  5MLC Q;  2P9K B;  1R0A A;  1ZBI A;  3VEV A;  1TUU A;  3A8Y A;  4GY2 B;  4M3Z A;  1C0T A;  2FLO A;  2VG6 A;  2ZJQ L;  3QFU A;  4DV3 K;  4ZTF A;  3PY8 A;  3E1Y A;  3ENO A;  4RW4 A;  4LFC K;  2YHA A;  5M1F A;  3B8A X;  4B9N A;  3K9K A;  3VGL A;  4FVM A;  5AQJ A;  3UB5 A;  1W2B M;  3U9Z A;  5LMN K;  4A5A A;  4FL9 A;  4NLC A;  3THW B;  2KTQ A;  4DTU A;  2HF3 A;  2UXC K;  4N56 A;  4GVE A;  2ASP A;  4FLZ A;  3EEQ A;  4CEQ A;  3VET A;  1XWL A;  3K57 A;  3TAR A;  2YHX A;  4FLW A;  2Z1I A;  4AHC A;  4OKJ A;  4DTM A;  4CHZ A;  3K5L A;  4M3X A;  2F8T A;  4JKA A;  3ZX2 A;  2O8E A;  3RRH A;  1HX1 A;  2XY6 A;  3KD5 E;  2D0O A;  3D6R A;  4WF9 L;  1KSP A;  4DLG A;  4KFB A;  4CJ7 A;  3I8B A;  4CVN E;  4B3M K;  3CPW M;  4JV5 K;  2RF2 A;  3HVR A;  2GWJ A;  3DXK B;  1ASU A;  3VF6 A;  4CBU A;  5LL6 Z;  2BE2 A;  2VQF K;  3HYF A;  3HBT A;  2FBX A;  3OS2 A;  1HJO A;  5C2F A;  3FFI A;  5AQK A;  4B3S K;  1X1P A;  3NGY A;  3NH2 A;  4CF1 A;  1L3S A;  3V1O A;  2DFE A;  4IZ9 A;  3T69 A;  3H1Q A;  2IIR A;  2X74 A;  3UKR B;  1MWK A;  4FW1 A;  5T7B A;  3RVC A;  1LW0 A;  1JLA A;  3CI5 A;  4JD2 B;  1O1W A;  3BZK A;  1MDU B;  4JI0 K;  3K58 A;  3KKR A;  3EKS A;  3MN5 A;  3VEO A;  4CEE A;  1XC9 A;  4CF8 A;  1XQS C;  4LSL A;  3VOV A;  1IG9 A;  5BR9 A;  4OPH A;  2OA8 A;  1ZXO A;  3AA3 A;  1J6Z A;  3SJH A;  2UXB K;  3HOT A;  4CCH A;  5KQ8 A;  4O44 A;  2O8B A;  2A40 A;  1RT6 A;  3PX0 A;  4M45 A;  2E6M A;  3LDQ A;  4BDZ A;  4HCC A;  3OBW A;  5DM7 L;  3DI6 A;  2A1R A;  2BUP A;  2P9S A;  5C42 A;  1ESV A;  3ZSV A;  2OPS A;  1KC8 O;  4UY8 O;  2P9L B;  3NE6 A;  1KRP A;  5KI6 A;  1NK5 A;  1OKJ A;  3EYZ A;  1QE1 A;  1W97 L;  3V81 A;  4DU4 A;  1S1T A;  4IFE A;  1VQ7 N;  1VSF A;  3VQA A;  3F5T A;  2VG7 A;  4B9V A;  1WN7 A;  3QIO A;  3ZX0 A;  1NGH A;  3VEY A;  2HHX A;  4X66 K;  4DQQ A;  3CG7 A;  2E8A A;  1D4X A;  2IVN A;  4DQI A;  1GLC G;  4OPJ A;  3VQB A;  1RBV A;  4FWS A;  3MED A;  3VQQ A;  1EWR A;  3G6E N;  3O1W A;  2Q97 A;  3NBP A;  3PLA A;  3KTQ A;  1W0H A;  2NRT A;  4H0P A;  3AVG A;  1HMV A;  3GE1 A;  3ZSO A;  1NGI A;  2O4G A;  3ZLJ A;  3AO4 A;  3FZK A;  3CJ7 A;  4BDY A;  4KI4 A;  3NVM A;  3OYB A;  5ADX H;  1NG9 A;  3WNG A;  3EN9 A;  1OH8 A;  4HUE A;  3ITH A;  4DV6 K;  2ITG A;  5BRD A;  1QQC A;  1BCM A;  3TTF A;  2E4L A;  1S9E A;  3FZH A;  2B4J A;  2I7N A;  2G8W A;  3HM9 A;  4M7Y A;  1NGC A;  4M63 C;  4OGE A;  4CJU A;  3THX B;  3VGK A;  2WON A;  4BRC A;  4JI7 K;  2IAJ A;  4EP4 A;  3GG4 A;  4FJN A;  3E9L A;  4I2Q A;  4BAC A;  1NK4 A;  2YHB A;  4CGI A;  4FPA A;  4BVP A;  3LDP A;  4QS8 A;  1LV5 A;  3VQP A;  1EQY A;  4L8R B;  1L5U A;  1RTJ A;  1WB9 A;  5C24 A;  4E1J A;  3FZL A;  2Q0R A;  5CYM A;  4CW7 B;  3G25 A;  3KKS A;  4K8Z A;  4X65 K;  4WQ4 A;  3ID6 A;  1VK0 A;  2V7Y A;  5LMU K;  1RBR A;  3OYK A;  4Z4H A;  4CK1 A;  3MK6 A;  3AVL A;  4DCH A;  4L3Q A;  1QTM A;  1A5X A;  1N5Y A;  3SUN A;  4XIU A;  3ZX3 A;  5AQO A;  1KTQ A;  4YOX A;  1YJ9 N;  4IO8 A;  1SS6 A;  2VQE K;  4LFA K;  4ICL A;  3LZJ A;  2PAV A;  1HQE A;  1B9D A;  1TKX A;  5CZ2 A;  4F9O A;  1QVF M;  2A42 A;  2BAN A;  2A1S A;  4FM2 A;  4WQ4 C;  2O8E B;  3V9S A;  5FLX O;  3MCP A;  3VQ9 A;  4B1Y B;  1T3V A;  4CGF A;  2P51 A;  3OYA A;  3CPE A;  3ZT3 A;  4KB0 A;  3I8D A;  5J2N A;  1XUP O;  3OS0 A;  1UA1 A;  4KBO A;  5HBM A;  3SZ2 A;  4E0D A;  2YNI A;  5CR4 A;  2GEM A;  3AY9 A;  3C94 A;  3M5R A;  3AA5 X;  3O3F A;  3TSP A;  4BRH A;  3FLC O;  3MCA B;  2HBM A;  4ELT A;  3D45 A;  2NZT A;  1K9M O;  4B8A B;  4DHY A;  4PKH A;  1GLL O;  4V19 S;  3SQ0 A;  3CC7 N;  4FCY A;  3ULE A;  4XH5 A;  3SBG A;  5IWA K;  3L3V A;  3G10 A;  3O5B A;  2IDO A;  1NM1 A;  4FPB A;  3O6W A;  4CEF A;  1NJW A;  2PZS A;  1D8Y A;  4ILH A;  3T19 A;  5AQW A;  2O8D A;  3FFK B;  3EE9 A;  2O8B B;  4JLH A;  3DLH A;  1RBS A;  3AO1 A;  3L0Q A;  4IDH A;  3OTO K;  3HSC A;  4BR4 A;  2P9S B;  3NF7 A;  3QER A;  4LFB K;  1B9F A;  2VWJ A;  2F96 A;  3J7A P;  3CCJ N;  4FW2 A;  4FJI A;  4YHH K;  3C0B A;  1FW6 A;  4G9Z A;  3OYF A;  1HNI A;  3ULD A;  3SPY A;  3H08 A;  4F2R A;  5E26 A;  4EZ9 A;  2WOM A;  1L3U A;  3CCE N;  1C1B A;  3AO5 A;  4PWD A;  2YI1 A;  1SZ2 A;  3OYG A;  5AQV A;  1JLE A;  3HPG A;  1EKE A;  5AZI A;  3SK3 A;  4KAZ A;  3SBT A;  3CJ1 A;  5F1X A;  4Z4E A;  1KLN A;  2QWR A;  3CQY A;  1NJX A;  4K25 A;  3HZ6 A;  1QS4 A;  1J53 A;  3C6H A;  4XEI A;  3AV9 A;  1CXQ A;  1VSE A;  2B6A A;  1NGB A;  1QSS A;  1V4S A;  2F4V K;  4NXN K;  2CH6 A;  3RMD A;  4CF9 A;  2G8V A;  4AHR A;  3CQX A;  2PYJ A;  3H3N O;  3M8P A;  4JKG A;  4ISE A;  3H45 C;  1JLG A;  2P9I A;  3LDL A;  4E7H A;  3TTC A;  4CEA A;  3NH0 A;  3AVC A;  3VEX A;  4N41 A;  4CF2 A;  1B92 A;  1WSG A;  4DB3 A;  1HYZ A;  4CGD A;  3KLH A;  2HBJ A;  5BPM A;  2F8S A;  2HHQ A;  4HCB A;  3WEE A;  3J8A A;  5J2P A;  1N6Q A;  3L6Q A;  4OJR A;  3LAM A;  3WXJ A;  2FXU A;  1W9H A;  5FPD A;  3I56 N;  1XNR K;  1Q8I A;  4IDK A;  3TAM A;  1EXQ A;  4FLT A;  3GDQ A;  3CCL N;  3Q7B A;  3OY9 A;  1J54 A;  5AQH A;  3T1H K;  2F9W A;  4AHT A;  1VQ5 N;  4JI1 K;  4WCE L;  2EHG A;  2HHV A;  2XO7 A;  2PYL A;  3CCR N;  1NOY A;  1LCU A;  5AQN A;  4W5N A;  1K8A O;  4K42 A;  3CD6 N;  3DLL L;  3I33 A;  1J5O A;  4B9M A;  3F9K A;  4H5W A;  1TK0 A;  3BP8 A;  4IEI A;  3VQD A;  1VQK N;  3LAK A;  1HYS A;  4FM1 A;  4U7B A;  3OYM A;  4I6M A;  5BR8 K;  1NWK A;  3WNE A;  1RCH A;  2BDP A;  2UXD K;  1BO5 O;  3VN5 A;  4DSK A;  3VQE A;  1RT2 A;  2I7P A;  2WUS A;  4O4G A;  2KQ2 A;  5AQY A;  4PUO A;  3L2W A;  3DOK A;  4PA1 A;  3QBW A;  4A2B A;  4CJV A;  1BOT O;  4JKF A;  4DLE A;  1NK8 A;  1NMN A;  4X64 K;  4M3T A;  4E7J A;  5C10 A;  1NNE A;  2NRZ A;  4CJ3 A;  3OYJ A;  1N34 K;  4F4K A;  1ITG A;  4QCL A;  5M1Q A;  3E9O A;  4I9L A;  4BRK A;  3DXM A;  1TAU A;  4K0K K;  4UQG A;  2QA4 N;  5AQS A;  2QWL A;  3SJJ A;  3M3Z A;  4ZHR A;  4BR7 A;  2IS3 A;  3L4Q A;  4WFA L;  3LWM A;  3HJF A;  2X78 A;  3O3G A;  3ZT2 A;  4MLE A;  3AO2 A;  1BHL A;  1VRT A;  4CJF A;  3JAM O;  1S72 N;  5AQT A;  1XMO K;  4M3Y A;  1D9F A;  4CHQ A;  1NK0 A;  4CD3 A;  4ELU A;  1N36 K;  1EX4 A;  3VTH A;  1E3M A;  3ULE B;  2HVH A;  1HLU A;  3D7E O;  4FK4 A;  1Q86 O;  5GAH P;  4GMJ B;  3IRX A;  1JKH A;  1YF5 L;  3WNF A;  1HUX A;  3VEN A;  5KGW A;  4TSX A;  3ZSR A;  3IAY A;  2O8D B;  3CFR A;  3MAQ A;  4F8R A;  1P8Z A;  5CHI A;  3MMV A;  1OH7 A;  4H5T A;  3EY1 A;  3NAE A;  4NO7 A;  4DF8 A;  5AQQ A;  3AVJ A;  2OTJ N;  4DTO A;  2QXL A;  4J2D A;  3TSU A;  2ZM6 K;  1S6P A;  4FWP A;  1IBK K;  5FPM A;  2ETJ A;  1XHZ A;  3KVG A;  1NLV A;  4DTS A;  1I94 K;  2OPP A;  4Z94 A;  1WNS A;  3KK1 A;  5AQP A;  3V9Z A;  2P9U A;  4DV7 K;  4H8K A;  2HW3 A;  5AZI B;  1CZ9 A;  4CGG A;  2RHK A;  1NGE A;  3ZT1 A;  3LDS A;  1RDD A;  5M1N A;  2ZJP L;  4CZI A;  2KFZ A;  4R79 A;  3HTV A;  3O4Q A;  3M6G A;  4J8F A;  4EIA A;  4LY7 A;  3J81 O;  1RT7 A;  4JKH A;  3AAP A;  1JL2 A;  1VQP N;  4JKC A;  1YJN N;  3I55 N;  4A61 A;  4N5S A;  4RCH A;  1BA1 A;  3TR8 A;  4JKG B;  3UE5 A;  5AR0 A;  4OPK A;  1IBM K;  3QIN A;  2YV0 X;  2IOC A;  4CEO A;  3CQ8 A;  4E7K A;  4CGH A;  3RR8 A;  1RT4 A;  4OKK A;  3L2Q A;  3CCM N;  3AA2 A;  2ZWH A;  1GOC A;  1Q9X A;  1HNW K;  4OO1 J;  1VQ9 N;  3V9U A;  1VSJ A;  3MEE A;  5DMR A;  3WEE B;  4JEP A;  5GAE P; 
#chains in the Genus database with same CATH homology
 3HP9 A;  1TK8 A;  4DF4 A;  4C8K A;  1S9E A;  2OPQ A;  1BGX T;  2B4J A;  3I0S A;  5HRS A;  3ZSX A;  2G8W A;  3HM9 A;  1IH7 A;  1NKB A;  3NGZ A;  1JLB A;  5JS1 A;  4B3O A;  2XRI A;  4OGE A;  3HK2 A;  4CJU A;  2XY8 A;  4EZ6 A;  4MFB A;  1T8E A;  2WON A;  2IAJ A;  4Z4G A;  4EP4 A;  5D3G A;  4HUF A;  2Z1G A;  4FJN A;  3KD1 E;  3AVI A;  4I2Q A;  3K2P A;  4JRQ A;  2X6N A;  4BAC A;  1NK4 A;  1YT3 A;  2YHB A;  3CM5 A;  2JGU A;  4IBN A;  4DTX A;  4NCA A;  4Y1D A;  2D0C A;  4CGI A;  1VSD A;  4KV8 A;  1U45 A;  3RRG A;  1S1W A;  5FRN A;  4KKO A;  3VQ7 A;  3QNN A;  2DFF A;  2FBV A;  4DFK A;  1KCF A;  3S9H A;  1LV5 A;  1U04 A;  1SUQ A;  3VQP A;  4R5P A;  1VSL A;  1L5U A;  4L8R B;  4KTZ A;  1RTJ A;  4CES A;  4FJM A;  5C24 A;  2D0A A;  3E01 A;  1TKD A;  4QAG A;  3SPZ A;  5CYM A;  4BE2 A;  3U3G A;  4IFV A;  4CJ5 A;  2D0B A;  3KKS A;  3IS9 A;  4H4O A;  3JSM A;  5HLF A;  4K8Z A;  4M42 A;  4QOZ B;  4C8N A;  1NJY A;  4WE1 A;  1SL2 A;  4O55 A;  4CHN A;  1U48 A;  4ID5 A;  4I9Q A;  1QSY A;  4OVL A;  4PQU A;  2HHW A;  1VK0 A;  4DTR A;  4CJL A;  4NCB A;  3OYN A;  1U49 A;  5FDL A;  1RBR A;  3KJV A;  3OYK A;  4Z4H A;  1ZYQ A;  1JLF A;  4CEB A;  4CK1 A;  3OYH A;  2XHB A;  3AVL A;  4M3W A;  3V1Q A;  1HPZ A;  1S1V A;  4IFY A;  4CE9 A;  1WLJ A;  4BE0 A;  4E7L A;  1QTM A;  1RTI A;  1C1C A;  3NF9 A;  1HQU A;  3DM2 A;  1A5X A;  3CFP A;  4AIL C;  1G15 A;  2Q3S A;  3SUN A;  4XIU A;  1N5Y A;  3SNN A;  1RTD A;  2FBY A;  5HRO A;  4FK2 A;  4K8X A;  1KTQ A;  4Q0B A;  4FJ5 A;  1RT1 A;  4DSJ A;  1LAW A;  3PX4 A;  2YNG A;  3QNO A;  2DTU A;  1T03 A;  4ICL A;  4BE1 A;  4M3U A;  3LZJ A;  1MU2 A;  1HQE A;  1B9D A;  1TKX A;  2JLE A;  5CZ2 A;  3HVT A;  3WNH A;  4CJS A;  3HP6 A;  3V9W A;  3PO4 A;  1LWE A;  3LPU A;  1IKW A;  2BAN A;  4CEZ A;  3RR8 A;  4FJX A;  3S3N A;  2GUI A;  1A5W A;  1FKP A;  1JLQ A;  2A1S A;  1HRH A;  4FM2 A;  3SV3 A;  1L3V A;  1Z26 A;  1UAX A;  3P83 D;  3KK3 A;  1ASV A;  3A2F A;  3V9S A;  3VQ9 A;  1JL1 A;  5KRT A;  4CGF A;  4O5B A;  1CXU A;  4CFD A;  2P51 A;  1KFD A;  3QIP A;  3OYA A;  3ZT3 A;  4KB0 A;  3I8D A;  4E1M A;  5CYQ A;  5J2N A;  3TAP A;  3OS0 A;  1X9M A;  3LP1 A;  3L8B A;  4LH4 A;  2HB5 A;  1UA1 A;  3SUQ A;  3V1R A;  4RW7 A;  3L3U A;  3MXJ A;  1HYV A;  5HBM A;  4M3R A;  3SZ2 A;  1IO2 A;  1TL3 A;  3HT3 A;  3CM6 A;  2I5J A;  5E41 A;  3LAN A;  2YNI A;  4BWJ A;  3RMA A;  3M8R A;  1CZB A;  3KLF A;  3SCX A;  1DTQ A;  3HXM A;  3C94 A;  3DRR A;  5SWM A;  3NHG A;  1RDB A;  3ALY A;  1ZBL A;  1WSF A;  3AA5 X;  3O3F A;  3HPO A;  4DQS A;  3AO3 A;  4EP5 A;  3RMB A;  1UA0 A;  3PO5 A;  1JXB A;  3JYT A;  3LP0 A;  3V6D A;  4ELT A;  4OGC A;  2ZD1 A;  4ELV A;  3C95 A;  3D45 A;  4CJT A;  2G8H A;  4DG1 A;  4KHN A;  4B8A B;  4FJL A;  4FM0 A;  3ZSW A;  1D5A A;  1RNH A;  3SQ0 A;  4FCY A;  3QET A;  3O4N A;  2ATQ A;  1UWB A;  4KHQ A;  4H4M A;  5KGX A;  4DFJ A;  3SQ2 A;  2VG5 A;  5K14 A;  4Z4C A;  3L3V A;  4IG0 A;  3G10 A;  1S1U A;  3DLG A;  4E7I A;  1NOZ A;  3U6F A;  2RKI A;  2IDO A;  4KRF A;  3OYL A;  1IKX A;  4OKE A;  4J2A A;  4CIF A;  2GV9 A;  4CEF A;  4LSN A;  1NJW A;  5KRS A;  1D8Y A;  1BIS A;  2PZS A;  3OVN A;  2KZM A;  3T19 A;  1TVR A;  2HMI A;  4GW6 A;  2OYQ A;  3D0P A;  1X9W A;  4KRE A;  3DOL A;  1TGO A;  5JS2 A;  4JLH A;  4CFA A;  3V9X A;  3DLH A;  4O0I A;  1VSK A;  1RBS A;  3AO1 A;  4J2B A;  3AVF A;  1C0U A;  2OZS A;  4KB1 A;  1XI1 A;  1Q9Y A;  4F3T A;  1C0M A;  3NF7 A;  3HL8 A;  3QER A;  1B9F A;  3KIO A;  1WSJ A;  4JS5 A;  1SKW A;  2VWJ A;  4FJK A;  2F96 A;  4FW2 A;  3EZ5 A;  1KFS A;  4FJI A;  2BGG A;  1C6V A;  3CYM A;  4AH9 A;  4B9T A;  2HVI A;  1J9A A;  4CEC A;  3C6T A;  3OYF A;  5J2M A;  1HNI A;  3ULD A;  2VWK A;  3LZI A;  3UIQ A;  4KHS A;  3SPY A;  2IGI A;  3SI6 A;  4KI6 A;  3H08 A;  4KHW A;  3AA4 A;  1A5V A;  2P1J A;  3SUP A;  1NK7 A;  4EZ9 A;  2WOM A;  3TAN A;  1X9S A;  3TAE A;  1L3U A;  3KLG A;  3ISN C;  4CIG A;  5FRM A;  1C1B A;  2OZM A;  3AO5 A;  1UOC A;  4PWD A;  3OYG A;  3RMC A;  1JLC A;  4AHU A;  3OYC A;  1JLE A;  3HPG A;  1EKE A;  3RR7 A;  4KAZ A;  2O4I A;  1RBT A;  3NF8 A;  2AJQ A;  1BI4 B;  3KLI A;  4FJG A;  4Z4I A;  4DFM A;  3OJU A;  4Z4E A;  1KLN A;  4NYN A;  4N47 A;  1NJX A;  4FJJ A;  5I42 A;  4C8M A;  2ZE2 A;  1QS4 A;  1J53 A;  3K5M A;  4MQ3 A;  3VQ6 A;  1C1A A;  3AV9 A;  1U47 A;  3DRS A;  3K5O A;  1CXQ A;  1VSE A;  2B6A A;  4FK0 A;  2HHS A;  4CJP A;  4HTU A;  1SV5 A;  1JXE A;  4IG3 A;  3DLE A;  1QSS A;  1TKZ A;  3CFO A;  5J1E A;  3P5J A;  1NJZ A;  2KZZ A;  4C8L A;  5CZ1 A;  3RMD A;  4CF9 A;  2G8V A;  1U4B A;  4AHR A;  4NCG A;  5EU7 A;  2HHU A;  4I2P A;  2PYJ A;  2Z1H A;  3QES A;  3M8P A;  4DSI A;  1DTT A;  3P1G A;  1SKS A;  1QSL A;  4OLA A;  3QEV A;  2G8I A;  1Y97 A;  1JLG A;  3B6P A;  4I7F A;  5HRR A;  1VRU A;  1WSH A;  3QEI A;  4DU1 A;  3SQ1 A;  3AVA A;  3VQ8 A;  4E7H A;  3HO1 A;  1S9G A;  1YTA A;  4CEA A;  3NH0 A;  4DS5 A;  3AVC A;  3V4I A;  4HHT A;  1BIU A;  4Z4F A;  4N41 A;  4CF2 A;  4CHP A;  1TV6 A;  1B92 A;  1WSG A;  1K6Y A;  1HYZ A;  2Y1J A;  3M8Q A;  4N76 A;  1RBU A;  1S1X A;  3SQ4 A;  4CGD A;  3KLH A;  1WSI A;  4FJ7 A;  3I0R A;  4CJ4 A;  1RIL A;  2F8S A;  2HHQ A;  4CJK A;  1ASW A;  4HCB A;  3QEW A;  4RW6 A;  4HUG A;  5J2P A;  1NK6 A;  3SYZ A;  1N6Q A;  4JS4 A;  1IKY A;  4FLV A;  4OJR A;  3VQ4 A;  3LAM A;  3C6U A;  4AHV A;  2OPR A;  4B9S A;  4Z0U A;  2DY4 A;  1GOB A;  1W9H A;  2D5R A;  1I39 A;  3VQC A;  4DSF A;  4LH5 A;  4ZTJ A;  1Q8I A;  1S6Q A;  4KO0 A;  1YTU A;  1CLQ A;  4DTJ A;  2B5J A;  2W42 A;  3PUF A;  4IDK A;  3TAM A;  1EXQ A;  4DFP A;  1SL1 A;  2YKM A;  3ASM A;  1QHT A;  1YVU A;  4FLT A;  4HCC A;  4KPY A;  2P5G A;  4FZZ A;  3NF6 A;  4CGJ A;  1TKT A;  3OY9 A;  4CK2 A;  3AVH A;  1J54 A;  4B9U A;  1LAV A;  4BDP A;  4W5R A;  3AVM A;  3ZT4 A;  4AHT A;  3VA0 A;  4FXD A;  1S5J A;  1EET A;  2HHV A;  2EHG A;  3NCI A;  4CJQ A;  3T3F A;  2XO7 A;  2R7Y A;  1LWC A;  1RDC A;  3OJS A;  5J2Q A;  2PYL A;  1NOY A;  5HRP A;  4W5N A;  1EP4 A;  1R0A A;  4E89 A;  1ZBI A;  3LPT A;  4RW8 A;  1J5O A;  3S3M A;  4M3Z A;  2XY7 A;  3BGR A;  3LP2 A;  4B9M A;  3F9K A;  1C0T A;  2VG6 A;  4ZTF A;  1LWF A;  4B8C A;  1IKV A;  3PY8 A;  1TK0 A;  2QXF A;  4DU3 A;  2G8K A;  4RW4 A;  3RTV A;  3DLR A;  2X6S A;  2YHA A;  3KK2 A;  4B9L A;  3VQD A;  3LAK A;  4C8O A;  1HYS A;  4B9N A;  4IKF A;  1BL3 A;  4FM1 A;  4FVM A;  3TI0 A;  3OYM A;  3VQ5 A;  3U3Y A;  3VA3 A;  4KTW A;  5DK5 A;  3WNE A;  1RCH A;  1Z25 A;  3F73 A;  1T7P A;  2BDP A;  1F21 A;  4AHS A;  3VN5 A;  2G8F A;  4DTU A;  4DSK A;  2KTQ A;  1WSE A;  4N56 A;  2GBZ A;  2Z1J A;  3VQE A;  1BIZ A;  2EX3 A;  2RPI A;  1SL0 A;  5CY4 A;  4FLZ A;  3SUO A;  4CEQ A;  4J2E A;  1RT2 A;  4DQP A;  2QKK A;  1XWL A;  4O4G A;  3K57 A;  3TAR A;  2KQ2 A;  4FJ8 A;  4Q5V A;  4FZX C;  4PUO A;  4G1Q A;  5HRN A;  2Z1I A;  4AHC A;  4FLW A;  3L2W A;  4OKJ A;  1NKE A;  1HJR A;  4JRP A;  3TWH A;  4DTM A;  2KFN A;  3DOK A;  4PA1 A;  4CHZ A;  4CJV A;  3K5L A;  4M3X A;  1D9D A;  1HNV A;  2F8T A;  2NUB A;  1XHX A;  4CJR A;  4YNQ A;  3NGI A;  4NYF A;  4DQR A;  4O0J A;  4DWI A;  4FZY A;  3K5N A;  2IC3 A;  1WAJ A;  4DLE A;  3RRH A;  2XY6 A;  1NK8 A;  3KD5 E;  1ZBH A;  4YFU A;  3OYI A;  2KW4 A;  4E7J A;  4M3T A;  3NDK A;  1REV A;  4CJ3 A;  3OYJ A;  1KSP A;  4F4K A;  1ITG A;  4DLG A;  4QCL A;  4KFB A;  3ZSZ A;  4I9L A;  3HST B;  3QEP A;  4HVJ A;  1KVB A;  1TAU A;  3T1A A;  4UQG A;  3ZSQ A;  2RF2 A;  1FKO A;  5C25 A;  3HVR A;  3TAG A;  1ASU A;  1WAF A;  4E19 A;  3SJJ A;  4ZHR A;  4CHY A;  2IS3 A;  2BE2 A;  3MXM A;  3HYF A;  4FJH A;  3LWM A;  3HJF A;  4CFB A;  2X78 A;  3O3G A;  3ZT2 A;  2FBX A;  3AO2 A;  3OS2 A;  3B6O A;  1BHL A;  3LAL A;  1BQM A;  3FFI A;  1VRT A;  4CJF A;  3DRP A;  3THV A;  4FLY A;  3IG1 A;  1X1P A;  1BCO A;  1RDA A;  3NGY A;  4ID1 A;  4CF1 A;  3NH2 A;  1L3S A;  2G8U A;  3V1O A;  2DFE A;  4M3Y A;  5SZT A;  3NFA A;  1D9F A;  3O3H A;  4DMN A;  4KHY A;  4CHQ A;  1NK0 A;  2X74 A;  1SKR A;  4FW1 A;  5T7B A;  4CJE A;  3OYE A;  1T05 A;  1EX4 A;  4ELU A;  1LW0 A;  1JLA A;  3ZSY A;  4DSE A;  4KTQ A;  2HVH A;  1NKC A;  1L3T A;  1O1W A;  3DLB A;  3L2U A;  2HHT A;  4FK4 A;  3QO9 A;  1VSM A;  3QEX A;  3K58 A;  2XY5 A;  2HNZ A;  2E6L A;  3MEC A;  4CK3 A;  3KKR A;  4GMJ B;  4CF0 A;  3IRX A;  4PY5 A;  1JKH A;  4B08 A;  4CEE A;  3WNF A;  3AVN A;  4CER A;  3TAB A;  3AVK A;  1GOA A;  1KVC A;  5KGW A;  4CF8 A;  1XC9 A;  4TSX A;  3ZSR A;  1I3A A;  4LSL A;  3IAY A;  3CFR A;  1IG9 A;  2OA8 A;  5KTQ A;  3MAQ A;  4DTN A;  1RT3 A;  4CFC A;  3BDP A;  4F8R A;  3AA3 A;  4DS4 A;  5FRO A;  4OLB A;  4CJW A;  3L2R A;  4CCH A;  4O44 A;  3OYD A;  1RT6 A;  3PX0 A;  4M45 A;  3EY1 A;  3K59 A;  2E6M A;  3NAE A;  4DF8 A;  3AVJ A;  3KLE A;  4BDZ A;  4DTO A;  3TAF A;  1LW2 A;  2Y1I A;  4E1N A;  3DI6 A;  1BQN A;  3PV8 A;  4E3S A;  3ZCM A;  2A1R A;  4F2R A;  4J2D A;  4CED A;  3AVB A;  5C42 A;  1S6P A;  1TK5 A;  3ZSV A;  2ETJ A;  2OPS A;  1RT5 A;  1XHZ A;  5HP1 A;  2PY5 A;  3G0Z A;  3NE6 A;  1KRP A;  4DTS A;  5KI6 A;  1NK5 A;  3HPH A;  1KLM A;  1QE1 A;  2OPP A;  1WNS A;  2DFH A;  3ZT0 A;  3KK1 A;  1S1T A;  3EYZ A;  3V9Z A;  4DU4 A;  4Y1C A;  3LWL A;  3V81 A;  3TAQ A;  4W5O A;  1VSF A;  4H8K A;  3RWU A;  2HW3 A;  3VQA A;  1KVA A;  2VG7 A;  4B9V A;  1CZ9 A;  4CGG A;  1WN7 A;  3QIO A;  3ZT1 A;  3LDS A;  4M41 A;  1RDD A;  4FJ9 A;  2KFZ A;  2YNH A;  1FK9 A;  4FLU A;  4FYD A;  1BI4 A;  4W5Q A;  2HHX A;  4DQQ A;  3CG7 A;  3M8S A;  4RG8 A;  3O4Q A;  4F3O A;  3L2V A;  1TL1 A;  4DQI A;  4LY7 A;  4DTP A;  4OPJ A;  1DLO A;  3VQB A;  1RBV A;  2YNF A;  5I3U A;  2QK9 A;  2FBT A;  1RT7 A;  3MED A;  3VQQ A;  1ZBU A;  1JL2 A;  4RW9 A;  1NK9 A;  1FXX A;  4F2S A;  3NBP A;  3KTQ A;  1VSI A;  3SV4 A;  1W0H A;  3LP3 A;  1RTH A;  4BWM A;  4N5S A;  3MXI A;  3AVG A;  1HMV A;  3TR8 A;  4OPK A;  3OS1 A;  2YKN A;  4E0D A;  4LD0 A;  4CHO A;  3QIN A;  1TAQ A;  3ZSO A;  2RN2 A;  2ZQB A;  2IOC A;  2YV0 X;  2O4G A;  3QLH A;  4CEO A;  3CQ8 A;  2FC0 A;  4E7K A;  3MEG A;  4CGH A;  4FLX A;  1VSH A;  3AO4 A;  1RT4 A;  3DLK A;  4OKK A;  4GVM A;  4CIE A;  3L2Q A;  4DSL A;  4BDY A;  4KI4 A;  3OYB A;  3PX6 A;  3AA2 A;  1ZBF A;  1GOC A;  3WNG A;  1Q9X A;  4W5T A;  3DYA A;  4HUE A;  2LSN A;  2P5O A;  2HND A;  3ITH A;  3V9U A;  2QKB A;  1VSJ A;  3NH1 A;  2ITG A;  2HNY A;  3DMJ A;  3MEE A;  5DMR A;  4KHU A;  1QQC A;  3S3O A;  1BCM A;  2E4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...