1GOBA

Cooperative stabilization of escherichia coli ribonuclease hi by insertion of gly-80b and gly-77-> ala substitution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQAITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cooperative stabilization of Escherichia coli ribonuclease HI by insertion of Gly-80b and Gly-77-->Ala substitution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE H
total genus 50
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1gobA00
1TL1A 4QAGA 4F2SA 2HHVA 3VQCA 3P1GA 1ZBIA 5CZ2A 3KKRA 1KVCA 1S5JA 3OYJA 4DU1A 1JLEA 3NF9A 1YTAA 2I5JA 1KSPA 3E01A 1TKZA 2YKNA 3AO3A 4BE0A 2HNDA 5J2PA 3PV8A 3LANA 3NDKA 1CZBA 4CFBA 3O3FA 4IG3A 4KV8A 4BE1A 4ID1A 4DF8A 4HHTA 4HVJA 3TANA 3KK2A 3SCXA 3L2WA 3VQQA 1RT1A 4E1NA 2YHBA 4M3TA 4CJTA 2YKMA 3OS1A 3NF8A 2Z1GA 2EX3A 3OJSA 1SKWA 2ZD1A 3RRHA 1WNSA 3AA5X 3NGZA 3TABA 1X9MA 3P5JA 4JRPA 1HYSA 1VSKA 4QCLA 1S1VA 1JLQA 4Z4IA 1F21A 3TR8A 2X6NA 3ZSRA 4N56A 2XY6A 4OGCA 1ZYQA 1YTUA 1IKVA 4M3WA 4B9SA 1RBRA 1G15A 2X6SA 1IH7A 1WSJA 4XIUA 3TI0A 3LALA 4KHWA 3B6PA 3L8BA 1TKXA 3D0PA 4DQQA 4DU3A 1LWFA 3LPTA 2XY5A 4CGFA 3K5MA 1CXQA 4N76A 3NH2A 2HB5A 4FM0A 4FLWA 1EKEA 2Z1IA 1RDAA 4CJUA 3TAPA 4FM1A 2D0BA 4CJPA 3D45A 4CCHA 4FJLA 1IKYA 4H8KA 4BWMA 3VQ7A 3NAEA 3AO2A 1Q9YA 4CEOA 1A5VA 4F3TA 2RKIA 3PUFA 2KQ2A 1JLCA 2OPPA 4LH4A 4FLYA 2VG6A 3C94A 3DLBA 4I2PA 1B92A 1CZ9A 2YV0X 2HHUA 1W0HA 1TVRA 2G8HA 4FYDA 2D5RA 4FJGA 1FKPA 3HYFA 1I3AA 2HNYA 3LDSA 3QEIA 3AO5A 4CE9A 3MAQA 3K58A 4FCYA 2P1JA 4W5QA 3HPGA 4B9MA 3DYAA 3AVNA 1Y97A 3BDPA 3KLGA 3DOKA 5FRNA 1EX4A 3CFPA 4KHUA 3AA2A 4OKKA 3KJVA 1SV5A 3SPYA 4B8CA 4CJLA 4IFYA 3EYZA 5T7BA 4KREA 3ALYA 4CEAA 4FW1A 4DSEA 2HHTA 1REVA 4GW6A 3O4NA 4FJMA 2QKBA 1TK5A 4AHUA 4FJJA 4Z4GA 3O4QA 3LWMA 5HP1A 2FBTA 3HVRA 4G1QA 4DLEA 3V9UA 1U45A 4KHQA 4DQRA 2AJQA 4Y1CA 4DQSA 1T7PA 1S9GA 2JGUA 3KLEA 4OJRA 4Q5VA 1QTMA 4B9LA 4HUEA 5CY4A 3OYLA 1VSMA 1GOCA 3RMAA 1VSDA 4NYFA 4EZ9A 3HP9A 4Q0BA 4KFBA 5HLFA 2IGIA 3VN5A 3RWUA 3PO5A 1UOCA 4N5SA 3K5LA 1RBVA 2D0AA 2HHSA 5KRTA 3SUOA 1X9WA 3VA3A 3NF6A 1UAXA 3PX0A 1N6QA 3JSMA 4CIFA 3L3UA 4IG0A 1KLNA 1QSLA 2KZMA 3QERA 3QLHA 4CEFA 4KTWA 1WSFA 3HP6A 3BGRA 4CGJA 3SQ1A 4HCCA 3AO4A 4W5RA 4CFAA 2OA8A 2Y1IA 3K57A 2PYJA 2RPIA 2F96A 3ZCMA 2PYLA 2Y1JA 3QO9A 2VG7A 4EP5A 3SYZA 4E7LA 1SUQA 3OYMA 1RT5A 2E6LA 1J53A 1B9FA 1EXQA 1C1BA 3CG7A 4C8NA 2WONA 3M8RA 3SPZA 3SQ0A 1LV5A 3RR8A 4ELUA 4MQ3A 3SQ4A 3SV3A 1HJRA 2WOMA 4IDKA 3VQ4A 1R0AA 3ZSOA 3NGYA 1JLFA 1RBSA 4KAZA 1MU2A 1VSLA 4LH5A 5HRNA 5E41A 4FK0A 3OS2A 1NJYA 4N41A 2QK9A 3LP3A 1SKSA 1TK0A 2E6MA 4CF1A 3CFOA 1GOBA 4LSNA 3OYCA 1IO2A 3O3HA 3EY1A 1T8EA 1J5OA 4CGGA 2OZMA 1WLJA 4K8XA 4E3SA 4PWDA 4KHYA 1C0UA 2A1SA 3ASMA 1Z26A 3DI6A 4FLUA 1HYVA 4CESA 3MEEA 2YHAA 4OPKA 2PZSA 3KD1E 4J2BA 4CF0A 1W9HA 3HXMA 4ZTJA 4FZZA 3G10A 2P51A 2IDOA 4B8AB 3OY9A 4B9VA 2KFZA 2FC0A 3OYIA 1SL1A 2GBZA 3VQEA 3CM5A 4FLXA 1JXEA 1WAFA 4FLZA 2DFHA 1BI4A 1JL1A 1WAJA 3F9KA 1RT7A 2QXFA 3LWLA 1DTTA 3AVCA 4DLGA 4BDPA 1BCOA 1FK9A 1TGOA 3LAKA 5J1EA 4DFPA 5D3GA 4RW6A 1C1AA 4KB1A 5DK5A 4WE1A 4O4GA 1RILA 3LAMA 3WNGA 1RT6A 3M8QA 4FW2A 4PUOA 4DMNA 1S1WA 4O0JA 5SZTA 1U47A 4CGHA 3V1OA 4KI4A 4OPJA 4DWIA 1A5XA 3DLRA 1WSHA 1WN7A 4I9LA 1UWBA 3OVNA 4DQIA 1RBUA 3MEGA 4CJFA 3AVKA 1BIZA 2G8UA 3MEDA 4NCAA 1RCHA 2GV9A 3TAMA 3DLGA 3PX6A 1BHLA 4OVLA 3SJJA 4LSLA 4KHNA 3DRPA 4E89A 1S6QA 1Q8IA 1RTJA 5HRPA 4CK1A 3T3FA 4OGEA 4DFMA 2ZE2A 4N47A 3NHGA 4FJIA 1VSEA 2FBXA 5KI6A 4FJNA 3V9XA 1BQMA 1XWLA 3ZT4A 4RW8A 4UQGA 4DTOA 1HRHA 3ZSQA 3NGIA 1RT4A 4RW4A 2B4JA 3ZSZA 4DS5A 4OKEA 3VA0A 4J2EA 4LD0A 3S9HA 3OYHA 4JRQA 3QIPA 2ATQA 4FJXA 3LZIA 1BL3A 2YNFA 2YNIA 3C95A 4CJEA 3KTQA 5HBMA 2KTQA 2HHXA 2DTUA 3RR7A 4FZXC 1HNVA 3QNOA 2G8IA 1CLQA 3OYKA 5JS1A 3MXJA 3VQ5A 4CIGA 4DSJA 1CXUA 1D5AA 4DG1A 4FM2A 5J2MA 3L2UA 2IS3A 2VWKA 2OPSA 3EZ5A 4Z4HA 2R7YA 1RBTA 1KRPA 4B9TA 1J9AA 2IAJA 1JLBA 2LSNA 4AHSA 3SV4A 3AVIA 1HQEA 4F3OA 1J54A 2HHWA 3KLIA 4GMJB 4JLHA 4CJVA 3IG1A 3K5OA 3NFAA 4CEZA 1HQUA 3NH1A 3DMJA 1ZBUA 1VRTA 3ULDA 4B9NA 4KPYA 4CECA 3HSTB 3QETA 3DM2A 4AHCA 3SNNA 4RG8A 4BDYA 2XY7A 3U6FA 3THVA 5I42A 3KLHA 3ITHA 3V81A 1U49A 4DSIA 1VSJA 2ITGA 3O3GA 3M8PA 3SI6A 3IS9A 1L3VA 4OLBA 2ETJA 4CJWA 2KW4A 1RNHA 3DRSA 3T19A 4QOZB 3JYTA 1Z25A 4E1MA 1K6YA 4ICLA 1RTHA 3ZT0A 1TKDA 3RTVA 2HNZA 4DQPA 3AVHA 3K2PA 2E4LA 3SQ2A 4RW7A 1S1TA 1FKOA 1RDDA 5C25A 4RW9A 4CIEA 1NOZA 3QEXA 1IKXA 3CYMA 1U4BA 3L2QA 2BDPA 4CERA 4M3YA 1ASVA 4YFUA 1NKEA 4DFJA 3S3MA 3DLHA 1T03A 3CFRA 1D8YA 2XO7A 3K5NA 3OYGA 3IRXA 4IBNA 3OYDA 1ASWA 3S3NA 4CEDA 1EETA 1RDBA 3DLEA 5K14A 4C8OA 1JKHA 3NBPA 4PQUA 1RT3A 4CFDA 4KHSA 1LAVA 1S6PA 2D0CA 1QHTA 3OYAA 1NK8A 1ITGA 2B6AA 3P83D 4CHNA 3QEWA 1N5YA 2O4IA 3I0RA 4FJ8A 1XHXA 4GVMA 4E7KA 2HHQA 1ZBLA 4I9QA 2W42A 3VQ8A 1C0TA 4ID5A 1KVAA 3KLFA 1QS4A 4CHZA 4FJ9A 3AV9A 2HVHA 3VQ6A 4CHQA 1C0MA 4DTMA 1L3SA 4FZYA 4K8ZA 1XI1A 1NK5A 4ZTFA 4E7HA 2HW3A 4DTXA 4DFKA 2B5JA 3TAFA 4C8LA 4Z0UA 4ZHRA 1NK0A 1HMVA 4DTNA 4DF4A 2XHBA 3V4IA 3AVJA 1XHZA 1KCFA 4DU4A 1X1PA 2IOCA 5CYMA 1ZBFA 4DTPA 4Z4CA 2YNHA 3OYEA 3PO4A 1O1WA 5FRMA 4CGDA 3HL8A 3I8DA 4CJ5A 3L2VA 3HM9A 1QQCA 1S1XA 3AVBA 3V9ZA 1BI4B 4B08A 3A2FA 1YVUA 2DY4A 2BANA 1U04A 4M3XA 3AO1A 3HPHA 2Q3SA 5DMRA 5KGXA 3I0SA 2EHGA 4DSFA 5JS2A 4NCBA 1DTQA 2G8KA 2G8WA 4M42A 1TAQA 4CJ4A 3OYNA 3AA4A 1SKRA 3AA3A 3SUPA 1IKWA 3G0ZA 1X9SA 4DTJA 1QSSA 1ZBHA 2VG5A 3CM6A 2F8TA 4CJSA 4CF2A 1NKCA 3VQDA 1Q9XA 1S9EA 4DSLA 3HT3A 3UIQA 1UA0A 3ISNC 3OYFA 4I2QA 5J2NA 2G8FA 4HUFA 4J2AA 3QEPA 3AVFA 1L3UA 1TL3A 4C8MA 4M45A 3AVLA 4O5BA 4BWJA 1NK6A 3KD5E 4Z4FA 3QEVA 4CJ3A 4H4OA 5C42A 3T1AA 3QNNA 4CEQA 2HMIA 4JS4A 2RF2A 3MECA 1TKTA 3OS0A 4CJRA 3RMBA 1YT3A 4KTZA 1L3TA 4LY7A 1KLMA 1BIUA 4CEEA 1LW2A 4F2RA 4HTUA 3LP1A 3F73A 4FJ5A 3M8SA 4TSXA 4W5OA 4FJHA 4C8KA 3ZT2A 4OKJA 4F4KA 4PY5A 1QE1A 2OPRA 4PA1A 1C6VA 4CHYA 1TAUA 1L5UA 2QKKA 3FFIA 3AVAA 3WNEA 4E0DA 3AVGA 4HCBA 2XY8A 3VQPA 1RDCA 1NJWA 1EP4A 3ZT1A 4KTQA 3HO1A 2A1RA 4I7FA 3DOLA 4FLVA 3K59A 4DTRA 1NJZA 3HPOA 4KB0A 4NYNA 1KVBA 1TV6A 2XRIA 3TAGA 3HJFA 3LP0A 1TK8A 3OJUA 2DFFA 3RMDA 4CF8A 4M3ZA 1A5WA 4Y1DA 3VQ9A 5CYQA 3SUQA 4AILC 4FXDA 1VK0A 2KZZA 5HROA 4CJKA 1NKBA 4L8RB 5FDLA 3WNFA 3QIOA 1VSIA 1FXXA 4CHPA 1RT2A 3QINA 3L2RA 1NK4A 2IC3A 2Z1HA 4B9UA 3WNHA 2P5OA 5HRSA 3DRRA 1WSGA 1B9DA 4DTSA 4IKFA 3C6UA 4B3OA 2OYQA 1JLAA 2F8SA 2OZSA 1HYZA 1KFDA 3V1QA 4M3RA 4BDZA 4OLAA 4BE2A 4E7JA 4R5PA 4FVMA 3VQBA 1JXBA 4O0IA 3V6DA 1RTIA 3MXIA 1I39A 4O44A 2BE2A 2ZQBA 1JL2A 1BQNA 3LZJA 4FLTA 4EZ6A 5KTQA 4BACA 3S3OA 2X78A 3H08A 5C24A 1NK7A 3SZ2A 3PX4A 3NE6A 4CK3A 3DLKA 2P5GA 1KTQA 4DS4A 2OPQA 4CJQA 4FJ7A 3RRGA 2GUIA 3KIOA 1SL0A 3V9WA 3U3YA 1HNIA 3B6OA 3PY8A 4FK4A 4AHVA 4H4MA 3MXMA 3SUNA 3LP2A 4M41A 4AH9A 4EP4A 4M3UA 4KKOA 3L3VA 3HVTA 2YNGA 4W5TA 5I3UA 4O55A 5J2QA 2O4GA 3RMCA 4AHTA 5CZ1A 3QESA 5EU7A 4DSKA 4FK2A 2RN2A 2HVIA 5KGWA 1NK9A 1SL2A 5SWMA 2PY5A 1IG9A 2FBYA 3ZT3A 4ELTA 1S1UA 1NOYA 4CEBA 1C1CA 4E19A 3KK1A 1LAWA 1BCMA 5HRRA 1U48A 3TAEA 4KRFA 4F8RA 3IAYA 2JLEA 3ZSXA 3TAQA 3KK3A 3HK2A 1LWCA 1WSEA 2NUBA 1BGXT 4CFCA 4CK2A 1VSHA 2FBVA 1VRUA 2KFNA 3TARA 1ASUA 5FROA 4DTUA 1LW0A 4CHOA 4HUGA 1D9FA 3TWHA 3OYBA 2VWJA 3V1RA 3V9SA 4J2DA 3ZSVA 3NCIA 1RTDA 1UA1A 1WSIA 4E7IA 2BGGA 1QSYA 4FJKA 2DFEA 3KKSA 4ELVA 1GOAA 4AHRA 1NJXA 1LWEA 2Z1JA 3LPUA 3VQAA 4KI6A 1DLOA 1HPZA 4CGIA 3U3GA 3CQ8A 2X74A 1XC9A 1T05A 1BISA 4KO0A 4CF9A 5KRSA 4YNQA 3NF7A 4W5NA 4MFBA 3NH0A 4NCGA 4Z4EA 1D9DA 1KFSA 2G8VA 1JLGA 1VSFA 3AVMA 3ZSWA 4JS5A 3C6TA 3ZSYA 4IFVA
chains in the Genus database with same CATH superfamily
4F2SA 3VQCA 4K42A 1S5JA 4YHHK 1YTAA 4JD2B 2YKNA 3O9SA 5J2PA 3NVKA 4CZJA 3J80O 4ISGA 3KK2A 3L2WA 4BQZA 5IT9O 1GLCG 2ZD1A 1X9MA 3TABA 4LF7K 1HYSA 3CCQN 4CD3A 3TR8A 3ZSRA 2XY6A 1BA1A 1ZYQA 2PFUA 2QWPA 2UXCK 1G15A 1WSJA 3PIOL 4K25A 4BR5A 5ADXA 4O8KA 5AFUH 2XY5A 1CXQA 2CGLA 3NH2A 2HB5A 4K41A 2Z1IA 4IXCA 3TAPA 4FM1A 1BO5O 4CJPA 3AAQA 4H8KA 4YOTA 3AO2A 4JAXA 3PUFA 4FLYA 1JLCA 3C94A 4E1JA 1CZ9A 1TVRA 4FYDA 3J7AP 2HNYA 3AO5A 4CE9A 4PKGA 4W5QA 3DYAA 1K73O 3R3LA 1IBLK 1EX4A 2D0OA 3B8AX 2W41A 3O9RA 4IFYA 4FW1A 1YAGA 2QWLA 3LWMA 5HP1A 1K8KB 2FBTA 3V9UA 4DLEA 4J8FA 3FLCO 2E2OA 3SJHA 4DQSA 2PBDA 1S9GA 2F7TA 1T6DA 5EXWA 5AJ3K 4B9LA 5CY4A 1GOCA 3QB0A 4NYFA 4EZ9A 4Q0BA 2IGIA 3PO5A 4N5SA 3D2FB 1HJOA 5KRTA 3WXMB 5EY4A 3PX0A 3L3UA 4IG0A 1ESVA 3QLHA 3SQ1A 3FZLA 2Q97A 4W5RA 4CFAA 4BREA 2RPIA 2PYLA 2Y1JA 4K43A 1CZAN 3BZCA 1GLAG 1RT5A 1J53A 1B9FA 3T7ZA 4C8NA 2O8BB 3SQ0A 5F2RA 4MQ3A 3SQ4A 3KHYA 4ILJA 1HJRA 3SV3A 3VQ4A 1QVFM 4MO5A 2A40A 3ZSOA 3NGYA 4KAZA 1ZBIA 1VSLA 4LH5A 5E41A 1NJYA 3LP3A 1SKSA 1VQ8N 1GOBA 4LSNA 4MDAA 2QWMA 3AGKA 4CGGA 2YX6A 1C0UA 1Z26A 1YIJN 2KKZA 1GLJO 1HYVA 4CESA 2PZSA 3KD1E 3I56N 4DV6K 4B8AB 2P51A 4IO9L 1K8KA 4IZ9A 4BG9A 2QW9A 3VQEA 2OTLN 1JXEA 1WAFA 5AQIA 3TTCA 2P9IB 2P9LA 2DFHA 1WAJA 3VGKA 4BDPA 2V52B 3AVCA 1BCOA 1FK9A 1TGOA 5J1EA 4I6MA 4RW6A 3L4QA 4C23A 3WNGA 1RT6A 4H0YB 4DMNA 4ISFA 4IJAA 1U47A 2UXDK 4XH5A 3V1OA 5I9EB 1WN7A 3H6EA 3OVNA 5KQ8A 1BIZA 3AGRA 5BN9A 3MEDA 4NO7A 4CZGA 4O5FA 4CVNE 3AAPA 2GV9A 3PX6A 1DT9A 4KHNA 1R59O 3T3FA 4DFMA 3IKMA 3LDPA 4B1YB 1HNZK 5KI6A 1XC3A 1BQMA 1XWLA 3ZT4A 4UQGA 3H1VX 2B4JA 3ZETA 4CW7B 4LD0A 3OYHA 3SBTA 3KTQA 4BRIA 5HBMA 1XMOK 3QNOA 1CLQA 4CIGA 2G8HA 5J2MA 3L2UA 1J5EK 1SQKA 2QWRA 1YITN 4AHSA 3SV4A 4XH4A 4JEPA 2IVNA 3NH1A 3DMJA 3CJ7A 4CECA 3QETA 3SNNA 2XY7A 4JKGA 4JK7A 5I42A 4DV3K 3V81A 3FFKB 3T19A 4QOZB 4BR0A 3O1BA 3F9MA 1KD1O 2HNZA 3K2PA 3SQ2A 1S1TA 2GWJA 4CIEA 1NOZA 1YI2N 1ZBSA 1GLBG 4JKAA 4B1VA 4H5WA 3CFRA 3K5NA 4CZHA 3OYGA 2VGMA 1ASWA 3S3NA 4PHTX 4CEDA 3WEEA 4MDBA 4PQUA 4BR4A 1S6PA 4R79A 1QHTA 3OYAA 2I7PA 3T1HK 4JYAK 4FJ8A 4GVMA 1ZBLA 1C0TA 3KLFA 1QS4A 2UYTA 3HZ6A 3AV9A 4CHQA 4FZYA 4E7HA 4DTXA 4H5VA 3A5LC 2B5JA 4JK8A 4A5AA 1NK0A 1HMVA 1JCEA 1NG9A 1XHZA 4DU4A 3CQYA 2IOCA 4H5TA 5FPEA 5JLFA 5FRMA 4CGDA 3HL8A 5LMUK 4CJ5A 3L2VA 1QQCA 3AVBA 4FO0A 5BRFA 2YHXA 3SMSA 3MWPA 3HPHA 2Q3SA 5DMRA 2O8DA 2EHGA 4IO8A 4DSFA 2G8KA 3H3OB 1IKWA 2Q0RA 1VQ4N 2VG5A 3CM6A 4CJSA 4QS7A 4DV7K 4X65K 3VQDA 1Q9XA 3GG4A 1S9EA 4DSLA 3UIQA 3ISNC 4I2QA 1RGIA 3KD5E 1H1VA 4M45A 3AVLA 4C8MA 4BWJA 4CZEA 3EKSA 5C42A 3MECA 4KTZA 1BIUA 5C10A 1LW2A 4F2RA 3G4SN 4HTUA 3CJ9A 4FJ5A 3WQTA 3ZT2A 3VESA 2NNWA 4JHDA 4OKJA 4PY5A 3CCRN 2WUSA 2QKKA 3C65A 4HCBA 3F2KA 4JI7K 3CI5A 1EP4A 1KQSM 1QZ5A 3HO1A 3DOLA 5AQUA 4BRCA 3HPOA 4YOXA 1SS6A 5TKWA 4BRGA 3HJFA 2DFFA 1EWQA 1N32K 3ZEUA 4M3ZA 1A5WA 4FXDA 1NKBA 4L8RB 3O9QA 2P5OA 1WSGA 4YORA 3C6UA 2F8SA 3THXB 1VQON 4WYBA 1HYZA 1P8ZA 2VCPA 4BE2A 2ZF5O 1BQNA 1GLDG 3VEWA 5KTQA 4BACA 2X78A 3WUHA 4CK3A 4IEIA 4JNEA 4BY9C 4FJ7A 2GUIA 3EN9A 4B3RK 1GLFO 3KIOA 3TTDA 4FK4A 3VF4A 4NB4A 4GV6A 3MXMA 3LP2A 2IVPA 1YJ9N 1HKCA 2FLOA 2YNGA 3HVTA 5J2QA 3RMCA 4FK2A 3CC4N 3PSIA 3DXMB 1NLVA 3QBXA 1IG9A 1LCUA 3DLLL 4ELTA 1NOYA 4CEBA 3W3DA 4BVPA 3KK1A 1LAWA 4FWPA 3TAEA 4F8RA 3IAYA 2JLEA 3TAQA 4JN4A 3KK3A 4CK2A 1WSEA 1D9FA 3CPEA 5AQZA 3LM9A 3ZYYX 3M5RA 1HLUA 4ELVA 1GOAA 2V7ZA 3LPUA 5BR8K 4KI6A 4CGIA 3CQ8A 1T05A 2X74A 4KO0A 4YNQA 4BRDA 4W5NA 4NCGA 5EVZA 1KFSA 3C6TA 3ZSYA 2UUCK 1TL1A 3LL3A 1YHQN 3U4LA 3OTOK 5CZ2A 3WT0A 1DKGD 1KVCA 3NVMA 3OYJA 4EAHD 2ASMA 4BGAA 2I5JA 3LANA 1CZBA 3O3FA 4IG3A 4HVJA 4EFHA 3SCXA 4M3TA 3WQUA 3NF8A 2Z1GA 3OJSA 1SKWA 3RRHA 1MDUB 1S1VA 5H1SQ 4PKIA 2X6NA 3BP8A 4M3WA 3FZMA 4BR9A 5CHIA 3GDQA 4KHWA 3B6PA 3D0PA 1G99A 1LWFA 4CGFA 3I8BA 3K5MA 4FM0A 1EKEA 1DEJA 2D0BA 4DB3A 3D45A 4FJLA 3O6WA 2Q31A 4DKWA 1KAXA 4JKFA 2VG6A 2WTUA 2ZJQL 2OCEA 1B92A 4B3MK 1W0HA 5C2DA 3HYFA 3UKRB 2ZJRL 3D2EA 4CBXA 3MAQA 3L0QA 3AVNA 1Y97A 3DOKA 4KHUA 4EHUA 3IMXA 4OKKA 4DR2K 3EYZA 1EQYA 2HHTA 2HSTA 4LFBK 1BOTO 2FF3B 4GW6A 2QKBA 4A2AA 4Z4GA 4O8UA 2P9PB 2ASOA 3EL2A 4KHQA 3J7YP 2JGUA 2CH5A 3KLEA 1QTMA 1FW6A 5AQOA 3OYLA 3RMAA 3GOIA 1OH6A 3RWUA 5FPNA 3VN5A 3H3NO 3HI0A 4B3TK 2D0AA 2HHSA 3NF6A 5AQHA 5KPZA 2CGJA 5LL6Z 4HTLA 3VOVA 3BGRA 4FWQA 1MWKA 4H0VB 2Y1IA 3K57A 4BRQA 4NLBA 4EP5A 1SUQA 2AP1A 2E6LA 2VWBA 3VEOA 3CERA 1C1BA 4DR5K 3SPZA 3RR8A 4ELUA 3VF6A 2ZJPL 5KQDA 4N41A 4FK0A 2QK9A 3OS2A 1TK0A 2E6MA 1KC8O 3CFOA 4BRHA 2OANA 3OYCA 1IO2A 1T8EA 1VQ6N 1KAYA 1WLJA 4E3SA 4KHYA 3ASMA 4A57A 4FLUA 3MEEA 4PKHA 1JCFA 1W9HA 4FWKA 3KWGA 2KFZA 3G10A 5M1FA 2P9PA 2FC0A 4DHYA 4XEIA 1SL1A 2V51B 4JKBA 5JVHL 4CBWA 4DR7K 4FLXA 4FLZA 3SAGA 3QFUA 3LWLA 3R6MA 3LAKA 4H5NA 1C1AA 4BQLA 4CZKA 5DK5A 4WE1A 1RILA 2UUBK 3UE5A 4FW2A 3L6QA 4LF8K 4O0JA 5SZTA 3CMAN 3LDNA 4G9ZA 3DLRA 4IFEA 4AM6A 1WSHA 2W40A 4I9LA 1UWBA 3C7NB 4DQIA 4CJFA 2G8UA 1RCHA 3DLGA 4OVLA 5AQMA 3SJJA 4LSLA 4C1NK 3O5BA 1S6QA 1RTJA 1X9JA 5HRPA 3UKUB 4OGEA 2ZE2A 4ILHA 1VSEA 2FBXA 4FJNA 3V9XA 5LJWA 3G6EN 2QWQA 4DTOA 3CETA 3N4QA 3NGIA 1RDUA 4DS5A 4OKEA 5M1PA 2I7NA 3QIPA 1BL3A 2YNIA 3AARA 5KPRA 3RR7A 4FZXC 1HNVA 1ATRA 3VQ5A 4DSJA 1CXUA 4DG1A 2OPSA 1RBTA 1JLBA 3DAWA 4F3OA 3J81O 3KLIA 4CJVA 3NFAA 4CEZA 4CZIA 3ULDA 4KPYA 1IBKK 4RG8A 4BC2A 3THVA 3KLHA 3ITHA 3FZKA 4DSIA 5AQKA 2ITGA 4OLBA 3SI6A 4BVOA 4YOUA 3JYTA 5JLHA 1NJIO 1Z25A 2YI1A 4Y0WA 3GBTA 3CJAA 1TKDA 5GAEP 5FPMA 4BC4A 4DQPA 3ZETB 3AVHA 4RW7A 1RDDA 3CF5L 4RW9A 4DV5K 3QEXA 4KH4A 1U4BA 5LY3A 3L2QA 4CERA 1N34K 4M7XA 4M3YA 1IG8A 3P38A 5BN8A 1NKEA 4DFJA 4H03B 4YOWA 1D8YA 4IBNA 1U2VB 3OYDA 2YHYA 1JKHA 3NBPA 3O9TA 1W2BM 1LAVA 3I55N 1GLLO 2VQEK 2D0CA 2ZWHA 4FWRA 5BPMA 3TU5A 1ITGA 2YCHA 3D2FA 3P83D 3T69A 3VGMA 2O4IA 5BRDA 1XHXA 3CCJN 3VQ8A 4ID5A 1KVAA 4RCHA 4CHZA 3TTFA 4FJ9A 3SAHA 4K8ZA 4ZTFA 4QS8A 3TAFA 3VF2A 4Z0UA 4ZHRA 3L4IA 5BRHA 3V4IA 4WFNL 1X1PA 1ZBFA 4Z4CA 2YNHA 5F1XA 1O1WA 3A5NC 3ZX2A 3HM9A 1S1XA 3EO3A 1BI4B 4B08A 1NNEA 3CQXA 2NRTA 2BANA 4M3XA 3AO1A 2UUAK 5JS2A 5AZJA 4M42A 4CJ4A 3OYNA 3AA4A 1SKRA 1X3NA 1X9SA 1QSSA 2HBLA 1XMQK 3QFPA 4CF2A 3IDHA 4YOYA 3LM2A 5LMNK 1NM1A 2FSNA 5AQLA 1L3UA 1TL3A 3HBTA 4Z4FA 3QEVA 4H4OA 3QMLA 4QS9A 2HMIA 4DV2K 1TKTA 3OS0A 3CCSN 5CE3A 3TSUA 4CJRA 4CEEA 3LP1A 3H46O 3F73A 1BA0A 5KPTA 3J7ZO 3M6GA 4F4KA 1NGBA 1C6VA 3PIPL 4BG8A 1L5UA 3FFIA 3AVAA 1ATSA 4E0DA 4B3SK 1WB9A 2BUPA 1NJWA 3ZT1A 1YJWN 4KTQA 4KB0A 4DTRA 4WF9L 1NJZA 4JKEA 1KVBA 4NYNA 3TAGA 4ILGB 3CC2N 1TK8A 3U9ZA 1Y64A 4Y1DA 3VQ9A 3SUQA 2KZZA 4CHPA 1VSIA 4L3QA 1RT2A 3MCAB 3QINA 3L2RA 2D4WA 2IC3A 2Z1HA 1HKBA 5ADXH 1B9DA 4H0TB 4DTSA 4IKFA 1JLAA 2P9KA 3MX5A 4E7JA 4FVMA 1S3XA 1I39A 4IEEA 2E2PA 2ZQBA 1JL2A 3LZJA 5BPNA 4EZ6A 3PX4A 5DM7L 2P5GA 1KTQA 4UY8O 2D1KA 1OKJA 4DS4A 4IJNA 5GAGP 3E66A 3V9WA 4NLCA 3B6OA 5BREA 4AHVA 1MWMA 4M41A 3DXKB 3VETA 1VQNN 4M3UA 4KKOA 3L3VA 3LDLA 2HVIA 1VQ7N 5B8HA 1SL2A 1K8AO 3R1XA 5SWMA 5AR0A 1S1UA 1C1CA 4BR2A 4CZFA 4E19A 1U48A 5HRRA 3SBGA 4FVUA 3FZFA 4RTFD 4EHTA 3O1WA 3MN6A 5C12A 3D6RA 1BGXT 4CFCA 1VRUA 5TKYA 1LW0A 3MN7A 4BRKA 3UKUA 1NGCA 3V9SA 3BF1A 3NCIA 1RTDA 5EOYA 1WSIA 4E7IA 1QSYA 3KKSA 1NJXA 1LWEA 3VQAA 1HPZA 3CCEN 4KH5A 1VHXA 4CF9A 3NF7A 1JLGA 4JS5A 5DM6L 3C6HA 4IFVA 4QAGA 3KKRA 5AQGA 1NGFA 4BRLA 4DU1A 4FOEA 3NF9A 3E01A 3AO3A 4BE0A 2HNDA 4CFBA 2P9UB 4DF8A 4ID1A 4HHTA 5BR9A 1RT1A 2YHBA 4I6MB 5MLCQ 4OO1J 1W97L 1WNSA 3AA5X 3NGZA 4FOIA 4Z4IA 4PL8A 2KHOA 3T1YK 4N56A 1K9MO 4OGCA 1YTUA 1IKVA 3OA9A 4B9SA 1RBRA 3TI0A 3L8BA 1TKXA 2QTDA 4DU3A 4CCHA 1IKYA 1U2VA 2QI2A 3VQ7A 4H0OA 4F3TA 2RKIA 4LH4A 4JI5K 3IUCA 4I2PA 2YV0X 3MX2A 2D5RA 4BRPA 1I3AA 1NGJA 3K58A 2NRXA 5C2FA 2P1JA 3BDPA 2O8DB 4OPAA 5FRNA 4AM7A 3AA2A 4DCHA 3KJVA 1SV5A 4X66K 4B8CA 4CJLA 3SPYA 4DV4K 2IVOA 4B1XB 5T7BA 1NBWA 3CMEN 4CEAA 4DSEA 1IBMK 1REVA 3O4NA 4FJJA 4NXNK 3O4QA 5AQWA 4GV3A 3BF3A 3HVRA 1U45A 1ZXOA 2ZM6K 4OJRA 4HUEA 3C0BA 3HP9A 5BPLA 1UOCA 3K5LA 3VEXA 3SUOA 1X9WA 3VA3A 1UAXA 1N6QA 4CIFA 2RHKA 5AQXA 5AZJB 3WXLA 1NGDA 2KZMA 3QERA 4CEFA 4KTWA 2HBKA 3HP6A 4CGJA 5HL7L 3AO4A 1BWFO 3ZCMA 2F96A 5AQRA 3QO9A 5C15A 3SK3A 4A61A 4BROA 1Z05A 3RSEB 3ATUA 3CCLN 1EXQA 3M8RA 2H3GX 4IDKA 4LC9B 2FSJA 2NZTA 1MU2A 5HRNA 3K0SA 2GX9A 3Q7BA 4CF1A 2QXLA 5E84A 3EY1A 1J5OA 4GVEA 3DI6A 4BRAA 4OPKA 3HXMA 3A0IX 4FZZA 2IDOA 5AQJA 4KHPK 1YUWA 4JKGB 1JL1A 1NGAA 1RT7A 2QXFA 4DFPA 1NMNA 4YOVA 4KB1A 2O8FB 1NGEA 3A5OC 3CJ1A 2HOEA 4PUOA 1S1WA 1BDGA 4CGHA 3QBWA 1RBUA 2JWKA 3MEGA 3O9UA 3AVKA 3EZWA 4NCAA 4BRMA 4KH6A 3BEXA 3TAMA 3D7EO 1BHLA 4H0XB 3DRPA 5AQVA 4N47A 3WXJA 3C6AA 3ZSQA 4RW4A 3D2EB 3MN5A 3ZSZA 3ULEB 4J2EA 3S9HA 4JRQA 1YXQA 2ATQA 4XH1A 2NRHA 4CJEA 2HHXA 3THWB 1E3MA 2PAVA 3OYKA 3TARA 2IS3A 1TUYA 4Z4HA 2R7YA 3QICA 2IAJA 3IFRA 3THYB 2LSNA 3AVIA 1HQEA 4FL9A 2GELA 2ASPA 4JLHA 1VQLN 1I94K 1VRTA 3HSTB 2O8CA 1T6CA 4BDYA 3U6FA 4Z94A 2HF3A 3O3GA 3M8PA 3WXIA 2O8FA 2ETJA 2P9NA 4AF1A 3JXUA 1XQSC 2YJEA 3S41A 1MA9B 4E1MA 4CBUA 1ILYA 3R9PA 3DWLA 3ATVA 1Q86O 1O13A 2O8EB 1VAZA 1W7AA 1OVQA 4CZLA 2WC9A 3VEZA 1IKXA 1J6ZA 3CYMA 1BU6O 2BH1A 3EE9A 4LFCK 1ASVA 3P39A 3S3MA 3A5MC 3DLHA 3LDOA 3OBYA 1NGHA 3Q7CA 2VGNA 2WFBA 3GL1A 2B6AA 4CHNA 3QEWA 3I0RA 4BRFA 4JHDB 4E7KA 1LOTB 3U8XA 2HVHA 1S22A 4DTMA 1L3SA 2HBJA 4WQ4A 3LDQA 1XI1A 1NK5A 2A6AA 4DFKA 1X3MA 4DTNA 1D4XA 4DF4A 4IOAL 1OH5A 3VTIA 1Q81O 4H5RA 3PO4A 2E2NA 2HF4A 5CYMA 4DTPA 2Q1NA 3I8DA 5AQYA 5AQSA 3V9ZA 2DY4A 1U04A 5M1OA 4NCBA 2W6LA 3SMPA 1TAQA 3AA3A 2O8EA 4M63C 4DTJA 4JI3K 1ZBHA 2F8TA 2A42A 2QEXN 1JJ2M 1NMDA 5EX5A 1UA0A 2UU9K 5J2NA 3OYFA 2NLXA 4J2AA 5AQPA 2ZGYA 4OX9K 4O5BA 1QQOA 1NK6A 4GV9A 3GE1A 4CJ3A 2GWKA 4JI8K 4JS4A 4MLHA 3TSPA 2RF2A 3FZHA 5JMVA 2F4VK 1QVGM 2DPNA 3HTVA 4LY7A 1KLMA 4FWOA 3QDKA 3ID8A 4IWVA 3EEQA 4W5OA 3VERA 1HX1A 4BR7A 1TAUA 3AVGA 1RDCA 1XNQK 2A1RA 3ENOA 4FLVA 4IDHA 3K59A 1TV6A 3AY9A 3LP0A 3OJUA 3RMDA 3K9JA 4CF8A 3CCVN 4MO4A 5CYQA 3FGUA 4C1NI 4AILC 5HROA 3WNFA 3ID6A 3QIOA 4C8OA 1FXXA 4B9UA 5HRSA 3DRRA 1E4GT 3BZKA 3H45C 3O08A 2W6KA 4BDZA 3V1QA 4OLAA 3VQBA 1JXBA 3V6DA 1RTIA 2BE2A 2HHHK 3H08A 5C24A 4X64K 1NK7A 3I33A 3MWTA 1OH7A 3H1QA 4FPAA 1SL0A 3U3YA 4K0KK 3SUNA 1Q7YO 5I3UA 4O55A 2RN2A 1NK9A 2PY5A 4B9QA 4DR4K 1SAZA 2FBYA 4WFBL 5IWAK 4DUYK 4X62K 3VTHA 3CCMN 2P9SB 1BCMA 5AFUA 1XNRK 4KRFA 1NGIA 3K9KA 2NRZA 3HK2A 2YHWA 2NUBA 3CJBA 2KFNA 4CHOA 1HNWK 3TWHA 3OYBA 2VWJA 3ZSVA 1VQKN 1HNXK 3ENBA 4IOXA 5AQFA 2DFEA 3SAFA 1OH8A 4IOCL 4AHRA 4GKKK 2AA4A 1BISA 3VENA 5KRSA 3NH0A 1D9DA 1VSFA 3ZSWA 1JCGA 4EIAA 3N4PA 2HHVA 3P1GA 3PSFA 1JLEA 1KSPA 3NMUA 1TKZA 3O8MA 4U67L 3PV8A 4DQ8A 1YVNA 4U7BA 3NDKA 1HR0K 4BE1A 4KV8A 4CJ7A 3TANA 3VQQA 4E1NA 3CCUN 4CJTA 2YKMA 3OS1A 2EX3A 3ULEA 1QZ6A 3P4IA 2GTDA 3P5JA 4JRPA 1VSKA 4JK9A 1GLEG 3TPQA 2F9WA 5M1KA 4QCLA 1V4TA 1ATNA 1JLQA 1F21A 3C7NA 2X6SA 4XIUA 1IH7A 3LALA 3PLAA 3M1FA 4DQQA 3THXA 2QA4N 3E1YA 3LPTA 1QHAA 4H0PA 4N76A 2E88A 4FLWA 4CJUA 1RDAA 4WCEL 4A62A 3THYA 1KAZA 5FPDA 2JWLA 4BWMA 4JI6K 3HRGA 1WOQA 3NAEA 2P9NB 1Q9YA 4CEOA 1A5VA 3HOTA 2KQ2A 2OPPA 3DLBA 2HHUA 1NGGA 4BGBA 4FJGA 1FKPA 3LDSA 3QEIA 3BY5A 4FCYA 3CJCA 3HPGA 4DUZK 4B9MA 3KLGA 4BC3A 3CFPA 4FWSA 2P9SA 2E20A 1FJGK 3SLCA 4DV0K 3ALYA 4FJMA 1TK5A 4AHUA 2A41A 3EKUA 4G1QA 3KWIA 5LJVA 4DQRA 2O8BA 2AJQA 4Y1CA 1YJNN 4HWIA 1WBDA 1T7PA 3JAMO 4A2BA 4Q5VA 4JKDA 1TUUA 1VSMA 3CIPA 3WEEB 1VSDA 2NRVA 4KFBA 5HLFA 2VYPA 4LF6K 4JI1K 1RBVA 3JSMA 1KLNA 4JI2K 1QSLA 1V4SA 1WSFA 4HCCA 2E1ZA 3J8AA 2OA8A 2PYJA 2V7YA 3EE8A 4YY3K 2VG7A 1TYQA 3SYZA 4E7LA 3OYMA 1WBBA 1VQPN 3CG7A 2WONA 3KK7A 4CD1A 1LV5A 2WOMA 2Q36A 1R0AA 1JLFA 1RBSA 3E9LA 2D0PA 3O3HA 2OZMA 4K8XA 4PWDA 3CXCM 2A1SA 5C0YA 2YHAA 4J2BA 4CF0A 4ZTJA 3OY9A 4B9VA 4JV5K 3OYIA 2GBZA 3CM5A 2P9LB 2P9IA 3ZX0A 1BI4A 3F9KA 1DTTA 4DLGA 1XUPO 2FXUA 2E1YA 5D3GA 4OPHA 4WQ5A 1EO1A 1T44A 4O4GA 3LAMA 5GIPA 3CPWM 3CC7N 3M8QA 4B1ZA 3KVGA 4KI4A 4OPJA 1NU0A 1A5XA 4DWIA 4V19S 5JICA 1BG3A 3RVCA 2J4RA 4DV1K 3MMVA 4E89A 4A59A 1Q8IA 4FJIA 2OTJN 4CK1A 5AQNA 3NHGA 2O8CB 2QWNA 4RW8A 1HRHA 3DXMA 4JI0K 1RT4A 5AZIB 3F5TA 3VA0A 3UB5A 1YF5L 4BC5A 4FJXA 4DR3K 3LZIA 2YNFA 3C95A 4JD2A 2KTQA 4BRNA 2DTUA 3ZX3A 2G8IA 2BTFA 5JS1A 2CGKA 3MXJA 4AQYK 1D5AA 4FM2A 1RDWX 3EZ5A 2VWKA 1KRPA 4M7YA 1J9AA 4B9TA 1J54A 4GMJB 4JKCA 3IG1A 3K5OA 1VQ5N 1HQUA 1ZBUA 5HOOA 4B9NA 3W0LA 3DM2A 4AHCA 5F0XA 4NXMK 4A5BA 1U49A 3A8YA 1VSJA 3BUZB 3MDQA 1L3VA 3IS9A 2GUPA 1P90A 4CJWA 2KW4A 1RNHA 3ENHA 3DRSA 3O4WA 1Q82O 1DGKN 4YDUC 1K6YA 5FLXO 4ICLA 1RTHA 3ZT0A 4MLEA 3RTVA 2E4LA 1FKOA 5C25A 1C0GA 2BDPA 4YFUA 5A2QO 4FSVA 1T03A 2XO7A 1HPMA 4LF9K 4LFAK 3IRXA 1EETA 1RDBA 3DLEA 1NWKA 5K14A 1ZC6A 5AZIA 1RT3A 4CFDA 4KHSA 2EWSA 1NK8A 1HUXA 1N5YA 2HHQA 4I9QA 2W42A 3FE1A 3VQ6A 1C0MA 4FWMA 2HMPA 3M3ZA 3VPZA 3HSCA 2HW3A 1HKGA 4C8LA 1KXPA 3DXKA 5GAHP 2XHBA 3OBWA 3AVJA 3RSEA 1KCFA 4F9OA 4KREA 3OYEA 3WXKA 3A2FA 4DR6K 1YVUA 2NRWA 4ISEA 5KGXA 3I0SA 3HM8A 1Q18A 1DTQA 5ELZA 2G8WA 1BUPA 3MK6A 1EWRA 3SUPA 3G0ZA 2F9TA 2FSKA 2VQFK 1NKCA 3CD6N 4GY2B 3VMFB 3HT3A 3ZEUB 2G8FA 4GNIA 4HUFA 3QEPA 5AQQA 3AVFA 4PL7A 2A3ZA 4JKHA 4KBOA 4WQ5C 3HOSA 3QNNA 3T1AA 1T3VA 3G25A 4CEQA 1M1KO 1S72N 1C0FA 3FR0A 3RMBA 1YT3A 1L3TA 2ZGZA 3VGLA 2NRRA 2CH6A 3M8SA 4TSXA 3G71N 4FJHA 4WQ4C 5E26A 1QE1A 2OPRA 4PA1A 4CHYA 2A5XA 1IJJA 3WNEA 3OW2M 2XY8A 3VQPA 1U6ZA 4I7FA 3TSQA 2XRIA 3E9OA 2E5LK 1Z6RA 2Q0UA 2P9UA 2HBMA 4JI4K 1VK0A 4B1UB 2WBNA 4CJKA 4B1WB 1SZ2A 2QM1A 5FDLA 1NK4A 5M1QA 3R8EA 3KZBA 3WNHA 3MCPA 3DJCA 3E9PA 4B3OA 4FWNA 1WUAA 3UKRA 2OYQA 3VEVA 3CHWA 3THWA 1VQMN 2OZSA 1KFDA 2E2QA 4M3RA 3O80A 4R5PA 4LF4K 5CR4A 4O0IA 1N33K 3MXIA 4GKJK 4CI6A 4O44A 1RFQA 4LF5K 4FLTA 3S3OA 1N36K 1TYQB 3SZ2A 4DR1K 3NE6A 3DLKA 1E4FT 2GEMA 2OPQA 4CJQA 1M90O 3RRGA 2YJFA 1HNIA 3PY8A 1QQMA 1N8RO 4H4MA 5M1NA 4EP4A 1OVYA 4YDUA 4AH9A 5AQTA 4W5TA 1IV0A 4C8KA 3P31A 2O4GA 4AHTA 5CZ1A 3QESA 5EU7A 4DSKA 5KGWA 3MN9A 2UXBK 5GINA 3ZT3A 2KLAA 3VEYA 5GADP 3JS6A 2RE2A 3ZSXA 3ZLJA 4RWTA 4FPBA 4WFAL 1LWCA 2IIRA 1VSHA 2FBVA 5GIOA 1ASUA 5FROA 4DTUA 4HUGA 4FWLA 4J2DA 3V1RA 2E8AA 2ITMA 1UA1A 1QQNA 2QWOA 2BGGA 4FJKA 2Q2RA 3OHRA 1VQ9N 2HHWA 2Z1JA 1DLOA 1XC9A 3U3GA 3U9DA 4CZMA 4MFBA 2FF6A 4Z4EA 5JVGL 2G8VA 3AVMA 2P9KB
chains in the Genus database with same CATH topology
1TL1A 4QAGA 4F2SA 2HHVA 3VQCA 3P1GA 1ZBIA 5CZ2A 3KKRA 1KVCA 1S5JA 3OYJA 4DU1A 1JLEA 3NF9A 1YTAA 2I5JA 1KSPA 3E01A 1TKZA 2YKNA 3AO3A 4BE0A 2HNDA 5J2PA 3PV8A 3LANA 3NDKA 1CZBA 4CFBA 3O3FA 4IG3A 4KV8A 4BE1A 4ID1A 4DF8A 4HHTA 4HVJA 3TANA 3KK2A 3SCXA 3L2WA 3VQQA 1RT1A 4E1NA 2YHBA 4M3TA 4CJTA 2YKMA 3OS1A 3NF8A 2Z1GA 2EX3A 3OJSA 1SKWA 2ZD1A 3RRHA 1WNSA 3AA5X 3NGZA 3TABA 1X9MA 3P5JA 4JRPA 1HYSA 1VSKA 4QCLA 1S1VA 1JLQA 4Z4IA 1F21A 3TR8A 2X6NA 3ZSRA 4N56A 2XY6A 4OGCA 1ZYQA 1YTUA 1IKVA 4M3WA 4B9SA 1RBRA 1G15A 2X6SA 1IH7A 1WSJA 4XIUA 3TI0A 3LALA 4KHWA 3B6PA 3L8BA 1TKXA 3D0PA 4DQQA 4DU3A 1LWFA 3LPTA 2XY5A 4CGFA 3K5MA 1CXQA 4N76A 3NH2A 2HB5A 4FM0A 4FLWA 1EKEA 2Z1IA 1RDAA 4CJUA 3TAPA 4FM1A 2D0BA 4CJPA 3D45A 4CCHA 4FJLA 1IKYA 4H8KA 4BWMA 3VQ7A 3NAEA 3AO2A 1Q9YA 4CEOA 1A5VA 4F3TA 2RKIA 3PUFA 2KQ2A 1JLCA 2OPPA 4LH4A 4FLYA 2VG6A 3C94A 3DLBA 4I2PA 1B92A 1CZ9A 2YV0X 2HHUA 1W0HA 1TVRA 2G8HA 4FYDA 2D5RA 4FJGA 1FKPA 3HYFA 1I3AA 2HNYA 3LDSA 3QEIA 3AO5A 4CE9A 3MAQA 3K58A 4FCYA 2P1JA 4W5QA 3HPGA 4B9MA 3DYAA 3AVNA 1Y97A 3BDPA 3KLGA 3DOKA 5FRNA 1EX4A 3CFPA 4KHUA 3AA2A 4OKKA 3KJVA 1SV5A 3SPYA 4B8CA 4CJLA 4IFYA 3EYZA 5T7BA 4KREA 3ALYA 4CEAA 4FW1A 4DSEA 2HHTA 1REVA 4GW6A 3O4NA 4FJMA 2QKBA 1TK5A 4AHUA 4FJJA 4Z4GA 3O4QA 3LWMA 5HP1A 2FBTA 3HVRA 4G1QA 4DLEA 3V9UA 1U45A 4KHQA 4DQRA 2AJQA 4Y1CA 4DQSA 1T7PA 1S9GA 2JGUA 3KLEA 4OJRA 4Q5VA 1QTMA 4B9LA 4HUEA 5CY4A 3OYLA 1VSMA 1GOCA 3RMAA 1VSDA 4NYFA 4EZ9A 3HP9A 4Q0BA 4KFBA 5HLFA 2IGIA 3VN5A 3RWUA 3PO5A 1UOCA 4N5SA 3K5LA 1RBVA 2D0AA 2HHSA 5KRTA 3SUOA 1X9WA 3VA3A 3NF6A 1UAXA 3PX0A 1N6QA 3JSMA 4CIFA 3L3UA 4IG0A 1KLNA 1QSLA 2KZMA 3QERA 3QLHA 4CEFA 4KTWA 1WSFA 3HP6A 3BGRA 4CGJA 3SQ1A 4HCCA 3AO4A 4W5RA 4CFAA 2OA8A 2Y1IA 3K57A 2PYJA 2RPIA 2F96A 3ZCMA 2PYLA 2Y1JA 3QO9A 2VG7A 4EP5A 3SYZA 4E7LA 1SUQA 3OYMA 1RT5A 2E6LA 1J53A 1B9FA 1EXQA 1C1BA 3CG7A 4C8NA 2WONA 3M8RA 3SPZA 3SQ0A 1LV5A 3RR8A 4ELUA 4MQ3A 3SQ4A 3SV3A 1HJRA 2WOMA 4IDKA 3VQ4A 1R0AA 3ZSOA 3NGYA 1JLFA 1RBSA 4KAZA 1MU2A 1VSLA 4LH5A 5HRNA 5E41A 4FK0A 3OS2A 1NJYA 4N41A 2QK9A 3LP3A 1SKSA 1TK0A 2E6MA 4CF1A 3CFOA 1GOBA 4LSNA 3OYCA 1IO2A 3O3HA 3EY1A 1T8EA 1J5OA 4CGGA 2OZMA 1WLJA 4K8XA 4E3SA 4PWDA 4KHYA 1C0UA 2A1SA 3ASMA 1Z26A 3DI6A 4FLUA 1HYVA 4CESA 3MEEA 2YHAA 4OPKA 2PZSA 3KD1E 4J2BA 4CF0A 1W9HA 3HXMA 4ZTJA 4FZZA 3G10A 2P51A 2IDOA 4B8AB 3OY9A 4B9VA 2KFZA 2FC0A 3OYIA 1SL1A 2GBZA 3VQEA 3CM5A 4FLXA 1JXEA 1WAFA 4FLZA 2DFHA 1BI4A 1JL1A 1WAJA 3F9KA 1RT7A 2QXFA 3LWLA 1DTTA 3AVCA 4DLGA 4BDPA 1BCOA 1FK9A 1TGOA 3LAKA 5J1EA 4DFPA 5D3GA 4RW6A 1C1AA 4KB1A 5DK5A 4WE1A 4O4GA 1RILA 3LAMA 3WNGA 1RT6A 3M8QA 4FW2A 4PUOA 4DMNA 1S1WA 4O0JA 5SZTA 1U47A 4CGHA 3V1OA 4KI4A 4OPJA 4DWIA 1A5XA 3DLRA 1WSHA 1WN7A 4I9LA 1UWBA 3OVNA 4DQIA 1RBUA 3MEGA 4CJFA 3AVKA 1BIZA 2G8UA 3MEDA 4NCAA 1RCHA 2GV9A 3TAMA 3DLGA 3PX6A 1BHLA 4OVLA 3SJJA 4LSLA 4KHNA 3DRPA 4E89A 1S6QA 1Q8IA 1RTJA 5HRPA 4CK1A 3T3FA 4OGEA 4DFMA 2ZE2A 4N47A 3NHGA 4FJIA 1VSEA 2FBXA 5KI6A 4FJNA 3V9XA 1BQMA 1XWLA 3ZT4A 4RW8A 4UQGA 4DTOA 1HRHA 3ZSQA 3NGIA 1RT4A 4RW4A 2B4JA 3ZSZA 4DS5A 4OKEA 3VA0A 4J2EA 4LD0A 3S9HA 3OYHA 4JRQA 3QIPA 2ATQA 4FJXA 3LZIA 1BL3A 2YNFA 2YNIA 3C95A 4CJEA 3KTQA 5HBMA 2KTQA 2HHXA 2DTUA 3RR7A 4FZXC 1HNVA 3QNOA 2G8IA 1CLQA 3OYKA 5JS1A 3MXJA 3VQ5A 4CIGA 4DSJA 1CXUA 1D5AA 4DG1A 4FM2A 5J2MA 3L2UA 2IS3A 2VWKA 2OPSA 3EZ5A 4Z4HA 2R7YA 1RBTA 1KRPA 4B9TA 1J9AA 2IAJA 1JLBA 2LSNA 4AHSA 3SV4A 3AVIA 1HQEA 4F3OA 1J54A 2HHWA 3KLIA 4GMJB 4JLHA 4CJVA 3IG1A 3K5OA 3NFAA 4CEZA 1HQUA 3NH1A 3DMJA 1ZBUA 1VRTA 3ULDA 4B9NA 4KPYA 4CECA 3HSTB 3QETA 3DM2A 4AHCA 3SNNA 4RG8A 4BDYA 2XY7A 3U6FA 3THVA 5I42A 3KLHA 3ITHA 3V81A 1U49A 4DSIA 1VSJA 2ITGA 3O3GA 3M8PA 3SI6A 3IS9A 1L3VA 4OLBA 2ETJA 4CJWA 2KW4A 1RNHA 3DRSA 3T19A 4QOZB 3JYTA 1Z25A 4E1MA 1K6YA 4ICLA 1RTHA 3ZT0A 1TKDA 3RTVA 2HNZA 4DQPA 3AVHA 3K2PA 2E4LA 3SQ2A 4RW7A 1S1TA 1FKOA 1RDDA 5C25A 4RW9A 4CIEA 1NOZA 3QEXA 1IKXA 3CYMA 1U4BA 3L2QA 2BDPA 4CERA 4M3YA 1ASVA 4YFUA 1NKEA 4DFJA 3S3MA 3DLHA 1T03A 3CFRA 1D8YA 2XO7A 3K5NA 3OYGA 3IRXA 4IBNA 3OYDA 1ASWA 3S3NA 4CEDA 1EETA 1RDBA 3DLEA 5K14A 4C8OA 1JKHA 3NBPA 4PQUA 1RT3A 4CFDA 4KHSA 1LAVA 1S6PA 2D0CA 1QHTA 3OYAA 1NK8A 1ITGA 2B6AA 3P83D 4CHNA 3QEWA 1N5YA 2O4IA 3I0RA 4FJ8A 1XHXA 4GVMA 4E7KA 2HHQA 1ZBLA 4I9QA 2W42A 3VQ8A 1C0TA 4ID5A 1KVAA 3KLFA 1QS4A 4CHZA 4FJ9A 3AV9A 2HVHA 3VQ6A 4CHQA 1C0MA 4DTMA 1L3SA 4FZYA 4K8ZA 1XI1A 1NK5A 4ZTFA 4E7HA 2HW3A 4DTXA 4DFKA 2B5JA 3TAFA 4C8LA 4Z0UA 4ZHRA 1NK0A 1HMVA 4DTNA 4DF4A 2XHBA 3V4IA 3AVJA 1XHZA 1KCFA 4DU4A 1X1PA 2IOCA 5CYMA 1ZBFA 4DTPA 4Z4CA 2YNHA 3OYEA 3PO4A 1O1WA 5FRMA 4CGDA 3HL8A 3I8DA 4CJ5A 3L2VA 3HM9A 1QQCA 1S1XA 3AVBA 3V9ZA 1BI4B 4B08A 3A2FA 1YVUA 2DY4A 2BANA 1U04A 4M3XA 3AO1A 3HPHA 2Q3SA 5DMRA 5KGXA 3I0SA 2EHGA 4DSFA 5JS2A 4NCBA 1DTQA 2G8KA 2G8WA 4M42A 1TAQA 4CJ4A 3OYNA 3AA4A 1SKRA 3AA3A 3SUPA 1IKWA 3G0ZA 1X9SA 4DTJA 1QSSA 1ZBHA 2VG5A 3CM6A 2F8TA 4CJSA 4CF2A 1NKCA 3VQDA 1Q9XA 1S9EA 4DSLA 3HT3A 3UIQA 1UA0A 3ISNC 3OYFA 4I2QA 5J2NA 2G8FA 4HUFA 4J2AA 3QEPA 3AVFA 1L3UA 1TL3A 4C8MA 4M45A 3AVLA 4O5BA 4BWJA 1NK6A 3KD5E 4Z4FA 3QEVA 4CJ3A 4H4OA 5C42A 3T1AA 3QNNA 4CEQA 2HMIA 4JS4A 2RF2A 3MECA 1TKTA 3OS0A 4CJRA 3RMBA 1YT3A 4KTZA 1L3TA 4LY7A 1KLMA 1BIUA 4CEEA 1LW2A 4F2RA 4HTUA 3LP1A 3F73A 4FJ5A 3M8SA 4TSXA 4W5OA 4FJHA 4C8KA 3ZT2A 4OKJA 4F4KA 4PY5A 1QE1A 2OPRA 4PA1A 1C6VA 4CHYA 1TAUA 1L5UA 2QKKA 3FFIA 3AVAA 3WNEA 4E0DA 3AVGA 4HCBA 2XY8A 3VQPA 1RDCA 1NJWA 1EP4A 3ZT1A 4KTQA 3HO1A 2A1RA 4I7FA 3DOLA 4FLVA 3K59A 4DTRA 1NJZA 3HPOA 4KB0A 4NYNA 1KVBA 1TV6A 2XRIA 3TAGA 3HJFA 3LP0A 1TK8A 3OJUA 2DFFA 3RMDA 4CF8A 4M3ZA 1A5WA 4Y1DA 3VQ9A 5CYQA 3SUQA 4AILC 4FXDA 1VK0A 2KZZA 5HROA 4CJKA 1NKBA 4L8RB 5FDLA 3WNFA 3QIOA 1VSIA 1FXXA 4CHPA 1RT2A 3QINA 3L2RA 1NK4A 2IC3A 2Z1HA 4B9UA 3WNHA 2P5OA 5HRSA 3DRRA 1WSGA 1B9DA 4DTSA 4IKFA 3C6UA 4B3OA 2OYQA 1JLAA 2F8SA 2OZSA 1HYZA 1KFDA 3V1QA 4M3RA 4BDZA 4OLAA 4BE2A 4E7JA 4R5PA 4FVMA 3VQBA 1JXBA 4O0IA 3V6DA 1RTIA 3MXIA 1I39A 4O44A 2BE2A 2ZQBA 1JL2A 1BQNA 3LZJA 4FLTA 4EZ6A 5KTQA 4BACA 3S3OA 2X78A 3H08A 5C24A 1NK7A 3SZ2A 3PX4A 3NE6A 4CK3A 3DLKA 2P5GA 1KTQA 4DS4A 2OPQA 4CJQA 4FJ7A 3RRGA 2GUIA 3KIOA 1SL0A 3V9WA 3U3YA 1HNIA 3B6OA 3PY8A 4FK4A 4AHVA 4H4MA 3MXMA 3SUNA 3LP2A 4M41A 4AH9A 4EP4A 4M3UA 4KKOA 3L3VA 3HVTA 2YNGA 4W5TA 5I3UA 4O55A 5J2QA 2O4GA 3RMCA 4AHTA 5CZ1A 3QESA 5EU7A 4DSKA 4FK2A 2RN2A 2HVIA 5KGWA 1NK9A 1SL2A 5SWMA 2PY5A 1IG9A 2FBYA 3ZT3A 4ELTA 1S1UA 1NOYA 4CEBA 1C1CA 4E19A 3KK1A 1LAWA 1BCMA 5HRRA 1U48A 3TAEA 4KRFA 4F8RA 3IAYA 2JLEA 3ZSXA 3TAQA 3KK3A 3HK2A 1LWCA 1WSEA 2NUBA 1BGXT 4CFCA 4CK2A 1VSHA 2FBVA 1VRUA 2KFNA 3TARA 1ASUA 5FROA 4DTUA 1LW0A 4CHOA 4HUGA 1D9FA 3TWHA 3OYBA 2VWJA 3V1RA 3V9SA 4J2DA 3ZSVA 3NCIA 1RTDA 1UA1A 1WSIA 4E7IA 2BGGA 1QSYA 4FJKA 2DFEA 3KKSA 4ELVA 1GOAA 4AHRA 1NJXA 1LWEA 2Z1JA 3LPUA 3VQAA 4KI6A 1DLOA 1HPZA 4CGIA 3U3GA 3CQ8A 2X74A 1XC9A 1T05A 1BISA 4KO0A 4CF9A 5KRSA 4YNQA 3NF7A 4W5NA 4MFBA 3NH0A 4NCGA 4Z4EA 1D9DA 1KFSA 2G8VA 1JLGA 1VSFA 3AVMA 3ZSWA 4JS5A 3C6TA 3ZSYA 4IFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TL1 A;  4QAG A;  4F2S A;  2HHV A;  3VQC A;  3P1G A;  1ZBI A;  5CZ2 A;  3KKR A;  1KVC A;  1S5J A;  3OYJ A;  4DU1 A;  1JLE A;  3NF9 A;  1YTA A;  2I5J A;  1KSP A;  3E01 A;  1TKZ A;  2YKN A;  3AO3 A;  4BE0 A;  2HND A;  5J2P A;  3PV8 A;  3LAN A;  3NDK A;  1CZB A;  4CFB A;  3O3F A;  4IG3 A;  4KV8 A;  4BE1 A;  4ID1 A;  4DF8 A;  4HHT A;  4HVJ A;  3TAN A;  3KK2 A;  3SCX A;  3L2W A;  3VQQ A;  1RT1 A;  4E1N A;  2YHB A;  4M3T A;  4CJT A;  2YKM A;  3OS1 A;  3NF8 A;  2Z1G A;  2EX3 A;  3OJS A;  1SKW A;  2ZD1 A;  3RRH A;  1WNS A;  3AA5 X;  3NGZ A;  3TAB A;  1X9M A;  3P5J A;  4JRP A;  1HYS A;  1VSK A;  4QCL A;  1S1V A;  1JLQ A;  4Z4I A;  1F21 A;  3TR8 A;  2X6N A;  3ZSR A;  4N56 A;  2XY6 A;  4OGC A;  1ZYQ A;  1YTU A;  1IKV A;  4M3W A;  4B9S A;  1RBR A;  1G15 A;  2X6S A;  1IH7 A;  1WSJ A;  4XIU A;  3TI0 A;  3LAL A;  4KHW A;  3B6P A;  3L8B A;  1TKX A;  3D0P A;  4DQQ A;  4DU3 A;  1LWF A;  3LPT A;  2XY5 A;  4CGF A;  3K5M A;  1CXQ A;  4N76 A;  3NH2 A;  2HB5 A;  4FM0 A;  4FLW A;  1EKE A;  2Z1I A;  1RDA A;  4CJU A;  3TAP A;  4FM1 A;  2D0B A;  4CJP A;  3D45 A;  4CCH A;  4FJL A;  1IKY A;  4H8K A;  4BWM A;  3VQ7 A;  3NAE A;  3AO2 A;  1Q9Y A;  4CEO A;  1A5V A;  4F3T A;  2RKI A;  3PUF A;  2KQ2 A;  1JLC A;  2OPP A;  4LH4 A;  4FLY A;  2VG6 A;  3C94 A;  3DLB A;  4I2P A;  1B92 A;  1CZ9 A;  2YV0 X;  2HHU A;  1W0H A;  1TVR A;  2G8H A;  4FYD A;  2D5R A;  4FJG A;  1FKP A;  3HYF A;  1I3A A;  2HNY A;  3LDS A;  3QEI A;  3AO5 A;  4CE9 A;  3MAQ A;  3K58 A;  4FCY A;  2P1J A;  4W5Q A;  3HPG A;  4B9M A;  3DYA A;  3AVN A;  1Y97 A;  3BDP A;  3KLG A;  3DOK A;  5FRN A;  1EX4 A;  3CFP A;  4KHU A;  3AA2 A;  4OKK A;  3KJV A;  1SV5 A;  3SPY A;  4B8C A;  4CJL A;  4IFY A;  3EYZ A;  5T7B A;  4KRE A;  3ALY A;  4CEA A;  4FW1 A;  4DSE A;  2HHT A;  1REV A;  4GW6 A;  3O4N A;  4FJM A;  2QKB A;  1TK5 A;  4AHU A;  4FJJ A;  4Z4G A;  3O4Q A;  3LWM A;  5HP1 A;  2FBT A;  3HVR A;  4G1Q A;  4DLE A;  3V9U A;  1U45 A;  4KHQ A;  4DQR A;  2AJQ A;  4Y1C A;  4DQS A;  1T7P A;  1S9G A;  2JGU A;  3KLE A;  4OJR A;  4Q5V A;  1QTM A;  4B9L A;  4HUE A;  5CY4 A;  3OYL A;  1VSM A;  1GOC A;  3RMA A;  1VSD A;  4NYF A;  4EZ9 A;  3HP9 A;  4Q0B A;  4KFB A;  5HLF A;  2IGI A;  3VN5 A;  3RWU A;  3PO5 A;  1UOC A;  4N5S A;  3K5L A;  1RBV A;  2D0A A;  2HHS A;  5KRT A;  3SUO A;  1X9W A;  3VA3 A;  3NF6 A;  1UAX A;  3PX0 A;  1N6Q A;  3JSM A;  4CIF A;  3L3U A;  4IG0 A;  1KLN A;  1QSL A;  2KZM A;  3QER A;  3QLH A;  4CEF A;  4KTW A;  1WSF A;  3HP6 A;  3BGR A;  4CGJ A;  3SQ1 A;  4HCC A;  3AO4 A;  4W5R A;  4CFA A;  2OA8 A;  2Y1I A;  3K57 A;  2PYJ A;  2RPI A;  2F96 A;  3ZCM A;  2PYL A;  2Y1J A;  3QO9 A;  2VG7 A;  4EP5 A;  3SYZ A;  4E7L A;  1SUQ A;  3OYM A;  1RT5 A;  2E6L A;  1J53 A;  1B9F A;  1EXQ A;  1C1B A;  3CG7 A;  4C8N A;  2WON A;  3M8R A;  3SPZ A;  3SQ0 A;  1LV5 A;  3RR8 A;  4ELU A;  4MQ3 A;  3SQ4 A;  3SV3 A;  1HJR A;  2WOM A;  4IDK A;  3VQ4 A;  1R0A A;  3ZSO A;  3NGY A;  1JLF A;  1RBS A;  4KAZ A;  1MU2 A;  1VSL A;  4LH5 A;  5HRN A;  5E41 A;  4FK0 A;  3OS2 A;  1NJY A;  4N41 A;  2QK9 A;  3LP3 A;  1SKS A;  1TK0 A;  2E6M A;  4CF1 A;  3CFO A;  1GOB A;  4LSN A;  3OYC A;  1IO2 A;  3O3H A;  3EY1 A;  1T8E A;  1J5O A;  4CGG A;  2OZM A;  1WLJ A;  4K8X A;  4E3S A;  4PWD A;  4KHY A;  1C0U A;  2A1S A;  3ASM A;  1Z26 A;  3DI6 A;  4FLU A;  1HYV A;  4CES A;  3MEE A;  2YHA A;  4OPK A;  2PZS A;  3KD1 E;  4J2B A;  4CF0 A;  1W9H A;  3HXM A;  4ZTJ A;  4FZZ A;  3G10 A;  2P51 A;  2IDO A;  4B8A B;  3OY9 A;  4B9V A;  2KFZ A;  2FC0 A;  3OYI A;  1SL1 A;  2GBZ A;  3VQE A;  3CM5 A;  4FLX A;  1JXE A;  1WAF A;  4FLZ A;  2DFH A;  1BI4 A;  1JL1 A;  1WAJ A;  3F9K A;  1RT7 A;  2QXF A;  3LWL A;  1DTT A;  3AVC A;  4DLG A;  4BDP A;  1BCO A;  1FK9 A;  1TGO A;  3LAK A;  5J1E A;  4DFP A;  5D3G A;  4RW6 A;  1C1A A;  4KB1 A;  5DK5 A;  4WE1 A;  4O4G A;  1RIL A;  3LAM A;  3WNG A;  1RT6 A;  3M8Q A;  4FW2 A;  4PUO A;  4DMN A;  1S1W A;  4O0J A;  5SZT A;  1U47 A;  4CGH A;  3V1O A;  4KI4 A;  4OPJ A;  4DWI A;  1A5X A;  3DLR A;  1WSH A;  1WN7 A;  4I9L A;  1UWB A;  3OVN A;  4DQI A;  1RBU A;  3MEG A;  4CJF A;  3AVK A;  1BIZ A;  2G8U A;  3MED A;  4NCA A;  1RCH A;  2GV9 A;  3TAM A;  3DLG A;  3PX6 A;  1BHL A;  4OVL A;  3SJJ A;  4LSL A;  4KHN A;  3DRP A;  4E89 A;  1S6Q A;  1Q8I A;  1RTJ A;  5HRP A;  4CK1 A;  3T3F A;  4OGE A;  4DFM A;  2ZE2 A;  4N47 A;  3NHG A;  4FJI A;  1VSE A;  2FBX A;  5KI6 A;  4FJN A;  3V9X A;  1BQM A;  1XWL A;  3ZT4 A;  4RW8 A;  4UQG A;  4DTO A;  1HRH A;  3ZSQ A;  3NGI A;  1RT4 A;  4RW4 A;  2B4J A;  3ZSZ A;  4DS5 A;  4OKE A;  3VA0 A;  4J2E A;  4LD0 A;  3S9H A;  3OYH A;  4JRQ A;  3QIP A;  2ATQ A;  4FJX A;  3LZI A;  1BL3 A;  2YNF A;  2YNI A;  3C95 A;  4CJE A;  3KTQ A;  5HBM A;  2KTQ A;  2HHX A;  2DTU A;  3RR7 A;  4FZX C;  1HNV A;  3QNO A;  2G8I A;  1CLQ A;  3OYK A;  5JS1 A;  3MXJ A;  3VQ5 A;  4CIG A;  4DSJ A;  1CXU A;  1D5A A;  4DG1 A;  4FM2 A;  5J2M A;  3L2U A;  2IS3 A;  2VWK A;  2OPS A;  3EZ5 A;  4Z4H A;  2R7Y A;  1RBT A;  1KRP A;  4B9T A;  1J9A A;  2IAJ A;  1JLB A;  2LSN A;  4AHS A;  3SV4 A;  3AVI A;  1HQE A;  4F3O A;  1J54 A;  2HHW A;  3KLI A;  4GMJ B;  4JLH A;  4CJV A;  3IG1 A;  3K5O A;  3NFA A;  4CEZ A;  1HQU A;  3NH1 A;  3DMJ A;  1ZBU A;  1VRT A;  3ULD A;  4B9N A;  4KPY A;  4CEC A;  3HST B;  3QET A;  3DM2 A;  4AHC A;  3SNN A;  4RG8 A;  4BDY A;  2XY7 A;  3U6F A;  3THV A;  5I42 A;  3KLH A;  3ITH A;  3V81 A;  1U49 A;  4DSI A;  1VSJ A;  2ITG A;  3O3G A;  3M8P A;  3SI6 A;  3IS9 A;  1L3V A;  4OLB A;  2ETJ A;  4CJW A;  2KW4 A;  1RNH A;  3DRS A;  3T19 A;  4QOZ B;  3JYT A;  1Z25 A;  4E1M A;  1K6Y A;  4ICL A;  1RTH A;  3ZT0 A;  1TKD A;  3RTV A;  2HNZ A;  4DQP A;  3AVH A;  3K2P A;  2E4L A;  3SQ2 A;  4RW7 A;  1S1T A;  1FKO A;  1RDD A;  5C25 A;  4RW9 A;  4CIE A;  1NOZ A;  3QEX A;  1IKX A;  3CYM A;  1U4B A;  3L2Q A;  2BDP A;  4CER A;  4M3Y A;  1ASV A;  4YFU A;  1NKE A;  4DFJ A;  3S3M A;  3DLH A;  1T03 A;  3CFR A;  1D8Y A;  2XO7 A;  3K5N A;  3OYG A;  3IRX A;  4IBN A;  3OYD A;  1ASW A;  3S3N A;  4CED A;  1EET A;  1RDB A;  3DLE A;  5K14 A;  4C8O A;  1JKH A;  3NBP A;  4PQU A;  1RT3 A;  4CFD A;  4KHS A;  1LAV A;  1S6P A;  2D0C A;  1QHT A;  3OYA A;  1NK8 A;  1ITG A;  2B6A A;  3P83 D;  4CHN A;  3QEW A;  1N5Y A;  2O4I A;  3I0R A;  4FJ8 A;  1XHX A;  4GVM A;  4E7K A;  2HHQ A;  1ZBL A;  4I9Q A;  2W42 A;  3VQ8 A;  1C0T A;  4ID5 A;  1KVA A;  3KLF A;  1QS4 A;  4CHZ A;  4FJ9 A;  3AV9 A;  2HVH A;  3VQ6 A;  4CHQ A;  1C0M A;  4DTM A;  1L3S A;  4FZY A;  4K8Z A;  1XI1 A;  1NK5 A;  4ZTF A;  4E7H A;  2HW3 A;  4DTX A;  4DFK A;  2B5J A;  3TAF A;  4C8L A;  4Z0U A;  4ZHR A;  1NK0 A;  1HMV A;  4DTN A;  4DF4 A;  2XHB A;  3V4I A;  3AVJ A;  1XHZ A;  1KCF A;  4DU4 A;  1X1P A;  2IOC A;  5CYM A;  1ZBF A;  4DTP A;  4Z4C A;  2YNH A;  3OYE A;  3PO4 A;  1O1W A;  5FRM A;  4CGD A;  3HL8 A;  3I8D A;  4CJ5 A;  3L2V A;  3HM9 A;  1QQC A;  1S1X A;  3AVB A;  3V9Z A;  1BI4 B;  4B08 A;  3A2F A;  1YVU A;  2DY4 A;  2BAN A;  1U04 A;  4M3X A;  3AO1 A;  3HPH A;  2Q3S A;  5DMR A;  5KGX A;  3I0S A;  2EHG A;  4DSF A;  5JS2 A;  4NCB A;  1DTQ A;  2G8K A;  2G8W A;  4M42 A;  1TAQ A;  4CJ4 A;  3OYN A;  3AA4 A;  1SKR A;  3AA3 A;  3SUP A;  1IKW A;  3G0Z A;  1X9S A;  4DTJ A;  1QSS A;  1ZBH A;  2VG5 A;  3CM6 A;  2F8T A;  4CJS A;  4CF2 A;  1NKC A;  3VQD A;  1Q9X A;  1S9E A;  4DSL A;  3HT3 A;  3UIQ A;  1UA0 A;  3ISN C;  3OYF A;  4I2Q A;  5J2N A;  2G8F A;  4HUF A;  4J2A A;  3QEP A;  3AVF A;  1L3U A;  1TL3 A;  4C8M A;  4M45 A;  3AVL A;  4O5B A;  4BWJ A;  1NK6 A;  3KD5 E;  4Z4F A;  3QEV A;  4CJ3 A;  4H4O A;  5C42 A;  3T1A A;  3QNN A;  4CEQ A;  2HMI A;  4JS4 A;  2RF2 A;  3MEC A;  1TKT A;  3OS0 A;  4CJR A;  3RMB A;  1YT3 A;  4KTZ A;  1L3T A;  4LY7 A;  1KLM A;  1BIU A;  4CEE A;  1LW2 A;  4F2R A;  4HTU A;  3LP1 A;  3F73 A;  4FJ5 A;  3M8S A;  4TSX A;  4W5O A;  4FJH A;  4C8K A;  3ZT2 A;  4OKJ A;  4F4K A;  4PY5 A;  1QE1 A;  2OPR A;  4PA1 A;  1C6V A;  4CHY A;  1TAU A;  1L5U A;  2QKK A;  3FFI A;  3AVA A;  3WNE A;  4E0D A;  3AVG A;  4HCB A;  2XY8 A;  3VQP A;  1RDC A;  1NJW A;  1EP4 A;  3ZT1 A;  4KTQ A;  3HO1 A;  2A1R A;  4I7F A;  3DOL A;  4FLV A;  3K59 A;  4DTR A;  1NJZ A;  3HPO A;  4KB0 A;  4NYN A;  1KVB A;  1TV6 A;  2XRI A;  3TAG A;  3HJF A;  3LP0 A;  1TK8 A;  3OJU A;  2DFF A;  3RMD A;  4CF8 A;  4M3Z A;  1A5W A;  4Y1D A;  3VQ9 A;  5CYQ A;  3SUQ A;  4AIL C;  4FXD A;  1VK0 A;  2KZZ A;  5HRO A;  4CJK A;  1NKB A;  4L8R B;  5FDL A;  3WNF A;  3QIO A;  1VSI A;  1FXX A;  4CHP A;  1RT2 A;  3QIN A;  3L2R A;  1NK4 A;  2IC3 A;  2Z1H A;  4B9U A;  3WNH A;  2P5O A;  5HRS A;  3DRR A;  1WSG A;  1B9D A;  4DTS A;  4IKF A;  3C6U A;  4B3O A;  2OYQ A;  1JLA A;  2F8S A;  2OZS A;  1HYZ A;  1KFD A;  3V1Q A;  4M3R A;  4BDZ A;  4OLA A;  4BE2 A;  4E7J A;  4R5P A;  4FVM A;  3VQB A;  1JXB A;  4O0I A;  3V6D A;  1RTI A;  3MXI A;  1I39 A;  4O44 A;  2BE2 A;  2ZQB A;  1JL2 A;  1BQN A;  3LZJ A;  4FLT A;  4EZ6 A;  5KTQ A;  4BAC A;  3S3O A;  2X78 A;  3H08 A;  5C24 A;  1NK7 A;  3SZ2 A;  3PX4 A;  3NE6 A;  4CK3 A;  3DLK A;  2P5G A;  1KTQ A;  4DS4 A;  2OPQ A;  4CJQ A;  4FJ7 A;  3RRG A;  2GUI A;  3KIO A;  1SL0 A;  3V9W A;  3U3Y A;  1HNI A;  3B6O A;  3PY8 A;  4FK4 A;  4AHV A;  4H4M A;  3MXM A;  3SUN A;  3LP2 A;  4M41 A;  4AH9 A;  4EP4 A;  4M3U A;  4KKO A;  3L3V A;  3HVT A;  2YNG A;  4W5T A;  5I3U A;  4O55 A;  5J2Q A;  2O4G A;  3RMC A;  4AHT A;  5CZ1 A;  3QES A;  5EU7 A;  4DSK A;  4FK2 A;  2RN2 A;  2HVI A;  5KGW A;  1NK9 A;  1SL2 A;  5SWM A;  2PY5 A;  1IG9 A;  2FBY A;  3ZT3 A;  4ELT A;  1S1U A;  1NOY A;  4CEB A;  1C1C A;  4E19 A;  3KK1 A;  1LAW A;  1BCM A;  5HRR A;  1U48 A;  3TAE A;  4KRF A;  4F8R A;  3IAY A;  2JLE A;  3ZSX A;  3TAQ A;  3KK3 A;  3HK2 A;  1LWC A;  1WSE A;  2NUB A;  1BGX T;  4CFC A;  4CK2 A;  1VSH A;  2FBV A;  1VRU A;  2KFN A;  3TAR A;  1ASU A;  5FRO A;  4DTU A;  1LW0 A;  4CHO A;  4HUG A;  1D9F A;  3TWH A;  3OYB A;  2VWJ A;  3V1R A;  3V9S A;  4J2D A;  3ZSV A;  3NCI A;  1RTD A;  1UA1 A;  1WSI A;  4E7I A;  2BGG A;  1QSY A;  4FJK A;  2DFE A;  3KKS A;  4ELV A;  1GOA A;  4AHR A;  1NJX A;  1LWE A;  2Z1J A;  3LPU A;  3VQA A;  4KI6 A;  1DLO A;  1HPZ A;  4CGI A;  3U3G A;  3CQ8 A;  2X74 A;  1XC9 A;  1T05 A;  1BIS A;  4KO0 A;  4CF9 A;  5KRS A;  4YNQ A;  3NF7 A;  4W5N A;  4MFB A;  3NH0 A;  4NCG A;  4Z4E A;  1D9D A;  1KFS A;  2G8V A;  1JLG A;  1VSF A;  3AVM A;  3ZSW A;  4JS5 A;  3C6T A;  3ZSY A;  4IFV A; 
#chains in the Genus database with same CATH topology
 4F2S A;  3VQC A;  4K42 A;  1S5J A;  4YHH K;  1YTA A;  4JD2 B;  2YKN A;  3O9S A;  5J2P A;  3NVK A;  4CZJ A;  3J80 O;  4ISG A;  3KK2 A;  3L2W A;  4BQZ A;  5IT9 O;  1GLC G;  2ZD1 A;  1X9M A;  3TAB A;  4LF7 K;  1HYS A;  3CCQ N;  4CD3 A;  3TR8 A;  3ZSR A;  2XY6 A;  1BA1 A;  1ZYQ A;  2PFU A;  2QWP A;  2UXC K;  1G15 A;  1WSJ A;  3PIO L;  4K25 A;  4BR5 A;  5ADX A;  4O8K A;  5AFU H;  2XY5 A;  1CXQ A;  2CGL A;  3NH2 A;  2HB5 A;  4K41 A;  2Z1I A;  4IXC A;  3TAP A;  4FM1 A;  1BO5 O;  4CJP A;  3AAQ A;  4H8K A;  4YOT A;  3AO2 A;  4JAX A;  3PUF A;  4FLY A;  1JLC A;  3C94 A;  4E1J A;  1CZ9 A;  1TVR A;  4FYD A;  3J7A P;  2HNY A;  3AO5 A;  4CE9 A;  4PKG A;  4W5Q A;  3DYA A;  1K73 O;  3R3L A;  1IBL K;  1EX4 A;  2D0O A;  3B8A X;  2W41 A;  3O9R A;  4IFY A;  4FW1 A;  1YAG A;  2QWL A;  3LWM A;  5HP1 A;  1K8K B;  2FBT A;  3V9U A;  4DLE A;  4J8F A;  3FLC O;  2E2O A;  3SJH A;  4DQS A;  2PBD A;  1S9G A;  2F7T A;  1T6D A;  5EXW A;  5AJ3 K;  4B9L A;  5CY4 A;  1GOC A;  3QB0 A;  4NYF A;  4EZ9 A;  4Q0B A;  2IGI A;  3PO5 A;  4N5S A;  3D2F B;  1HJO A;  5KRT A;  3WXM B;  5EY4 A;  3PX0 A;  3L3U A;  4IG0 A;  1ESV A;  3QLH A;  3SQ1 A;  3FZL A;  2Q97 A;  4W5R A;  4CFA A;  4BRE A;  2RPI A;  2PYL A;  2Y1J A;  4K43 A;  1CZA N;  3BZC A;  1GLA G;  1RT5 A;  1J53 A;  1B9F A;  3T7Z A;  4C8N A;  2O8B B;  3SQ0 A;  5F2R A;  4MQ3 A;  3SQ4 A;  3KHY A;  4ILJ A;  1HJR A;  3SV3 A;  3VQ4 A;  1QVF M;  4MO5 A;  2A40 A;  3ZSO A;  3NGY A;  4KAZ A;  1ZBI A;  1VSL A;  4LH5 A;  5E41 A;  1NJY A;  3LP3 A;  1SKS A;  1VQ8 N;  1GOB A;  4LSN A;  4MDA A;  2QWM A;  3AGK A;  4CGG A;  2YX6 A;  1C0U A;  1Z26 A;  1YIJ N;  2KKZ A;  1GLJ O;  1HYV A;  4CES A;  2PZS A;  3KD1 E;  3I56 N;  4DV6 K;  4B8A B;  2P51 A;  4IO9 L;  1K8K A;  4IZ9 A;  4BG9 A;  2QW9 A;  3VQE A;  2OTL N;  1JXE A;  1WAF A;  5AQI A;  3TTC A;  2P9I B;  2P9L A;  2DFH A;  1WAJ A;  3VGK A;  4BDP A;  2V52 B;  3AVC A;  1BCO A;  1FK9 A;  1TGO A;  5J1E A;  4I6M A;  4RW6 A;  3L4Q A;  4C23 A;  3WNG A;  1RT6 A;  4H0Y B;  4DMN A;  4ISF A;  4IJA A;  1U47 A;  2UXD K;  4XH5 A;  3V1O A;  5I9E B;  1WN7 A;  3H6E A;  3OVN A;  5KQ8 A;  1BIZ A;  3AGR A;  5BN9 A;  3MED A;  4NO7 A;  4CZG A;  4O5F A;  4CVN E;  3AAP A;  2GV9 A;  3PX6 A;  1DT9 A;  4KHN A;  1R59 O;  3T3F A;  4DFM A;  3IKM A;  3LDP A;  4B1Y B;  1HNZ K;  5KI6 A;  1XC3 A;  1BQM A;  1XWL A;  3ZT4 A;  4UQG A;  3H1V X;  2B4J A;  3ZET A;  4CW7 B;  4LD0 A;  3OYH A;  3SBT A;  3KTQ A;  4BRI A;  5HBM A;  1XMO K;  3QNO A;  1CLQ A;  4CIG A;  2G8H A;  5J2M A;  3L2U A;  1J5E K;  1SQK A;  2QWR A;  1YIT N;  4AHS A;  3SV4 A;  4XH4 A;  4JEP A;  2IVN A;  3NH1 A;  3DMJ A;  3CJ7 A;  4CEC A;  3QET A;  3SNN A;  2XY7 A;  4JKG A;  4JK7 A;  5I42 A;  4DV3 K;  3V81 A;  3FFK B;  3T19 A;  4QOZ B;  4BR0 A;  3O1B A;  3F9M A;  1KD1 O;  2HNZ A;  3K2P A;  3SQ2 A;  1S1T A;  2GWJ A;  4CIE A;  1NOZ A;  1YI2 N;  1ZBS A;  1GLB G;  4JKA A;  4B1V A;  4H5W A;  3CFR A;  3K5N A;  4CZH A;  3OYG A;  2VGM A;  1ASW A;  3S3N A;  4PHT X;  4CED A;  3WEE A;  4MDB A;  4PQU A;  4BR4 A;  1S6P A;  4R79 A;  1QHT A;  3OYA A;  2I7P A;  3T1H K;  4JYA K;  4FJ8 A;  4GVM A;  1ZBL A;  1C0T A;  3KLF A;  1QS4 A;  2UYT A;  3HZ6 A;  3AV9 A;  4CHQ A;  4FZY A;  4E7H A;  4DTX A;  4H5V A;  3A5L C;  2B5J A;  4JK8 A;  4A5A A;  1NK0 A;  1HMV A;  1JCE A;  1NG9 A;  1XHZ A;  4DU4 A;  3CQY A;  2IOC A;  4H5T A;  5FPE A;  5JLF A;  5FRM A;  4CGD A;  3HL8 A;  5LMU K;  4CJ5 A;  3L2V A;  1QQC A;  3AVB A;  4FO0 A;  5BRF A;  2YHX A;  3SMS A;  3MWP A;  3HPH A;  2Q3S A;  5DMR A;  2O8D A;  2EHG A;  4IO8 A;  4DSF A;  2G8K A;  3H3O B;  1IKW A;  2Q0R A;  1VQ4 N;  2VG5 A;  3CM6 A;  4CJS A;  4QS7 A;  4DV7 K;  4X65 K;  3VQD A;  1Q9X A;  3GG4 A;  1S9E A;  4DSL A;  3UIQ A;  3ISN C;  4I2Q A;  1RGI A;  3KD5 E;  1H1V A;  4M45 A;  3AVL A;  4C8M A;  4BWJ A;  4CZE A;  3EKS A;  5C42 A;  3MEC A;  4KTZ A;  1BIU A;  5C10 A;  1LW2 A;  4F2R A;  3G4S N;  4HTU A;  3CJ9 A;  4FJ5 A;  3WQT A;  3ZT2 A;  3VES A;  2NNW A;  4JHD A;  4OKJ A;  4PY5 A;  3CCR N;  2WUS A;  2QKK A;  3C65 A;  4HCB A;  3F2K A;  4JI7 K;  3CI5 A;  1EP4 A;  1KQS M;  1QZ5 A;  3HO1 A;  3DOL A;  5AQU A;  4BRC A;  3HPO A;  4YOX A;  1SS6 A;  5TKW A;  4BRG A;  3HJF A;  2DFF A;  1EWQ A;  1N32 K;  3ZEU A;  4M3Z A;  1A5W A;  4FXD A;  1NKB A;  4L8R B;  3O9Q A;  2P5O A;  1WSG A;  4YOR A;  3C6U A;  2F8S A;  3THX B;  1VQO N;  4WYB A;  1HYZ A;  1P8Z A;  2VCP A;  4BE2 A;  2ZF5 O;  1BQN A;  1GLD G;  3VEW A;  5KTQ A;  4BAC A;  2X78 A;  3WUH A;  4CK3 A;  4IEI A;  4JNE A;  4BY9 C;  4FJ7 A;  2GUI A;  3EN9 A;  4B3R K;  1GLF O;  3KIO A;  3TTD A;  4FK4 A;  3VF4 A;  4NB4 A;  4GV6 A;  3MXM A;  3LP2 A;  2IVP A;  1YJ9 N;  1HKC A;  2FLO A;  2YNG A;  3HVT A;  5J2Q A;  3RMC A;  4FK2 A;  3CC4 N;  3PSI A;  3DXM B;  1NLV A;  3QBX A;  1IG9 A;  1LCU A;  3DLL L;  4ELT A;  1NOY A;  4CEB A;  3W3D A;  4BVP A;  3KK1 A;  1LAW A;  4FWP A;  3TAE A;  4F8R A;  3IAY A;  2JLE A;  3TAQ A;  4JN4 A;  3KK3 A;  4CK2 A;  1WSE A;  1D9F A;  3CPE A;  5AQZ A;  3LM9 A;  3ZYY X;  3M5R A;  1HLU A;  4ELV A;  1GOA A;  2V7Z A;  3LPU A;  5BR8 K;  4KI6 A;  4CGI A;  3CQ8 A;  1T05 A;  2X74 A;  4KO0 A;  4YNQ A;  4BRD A;  4W5N A;  4NCG A;  5EVZ A;  1KFS A;  3C6T A;  3ZSY A;  2UUC K;  1TL1 A;  3LL3 A;  1YHQ N;  3U4L A;  3OTO K;  5CZ2 A;  3WT0 A;  1DKG D;  1KVC A;  3NVM A;  3OYJ A;  4EAH D;  2ASM A;  4BGA A;  2I5J A;  3LAN A;  1CZB A;  3O3F A;  4IG3 A;  4HVJ A;  4EFH A;  3SCX A;  4M3T A;  3WQU A;  3NF8 A;  2Z1G A;  3OJS A;  1SKW A;  3RRH A;  1MDU B;  1S1V A;  5H1S Q;  4PKI A;  2X6N A;  3BP8 A;  4M3W A;  3FZM A;  4BR9 A;  5CHI A;  3GDQ A;  4KHW A;  3B6P A;  3D0P A;  1G99 A;  1LWF A;  4CGF A;  3I8B A;  3K5M A;  4FM0 A;  1EKE A;  1DEJ A;  2D0B A;  4DB3 A;  3D45 A;  4FJL A;  3O6W A;  2Q31 A;  4DKW A;  1KAX A;  4JKF A;  2VG6 A;  2WTU A;  2ZJQ L;  2OCE A;  1B92 A;  4B3M K;  1W0H A;  5C2D A;  3HYF A;  3UKR B;  2ZJR L;  3D2E A;  4CBX A;  3MAQ A;  3L0Q A;  3AVN A;  1Y97 A;  3DOK A;  4KHU A;  4EHU A;  3IMX A;  4OKK A;  4DR2 K;  3EYZ A;  1EQY A;  2HHT A;  2HST A;  4LFB K;  1BOT O;  2FF3 B;  4GW6 A;  2QKB A;  4A2A A;  4Z4G A;  4O8U A;  2P9P B;  2ASO A;  3EL2 A;  4KHQ A;  3J7Y P;  2JGU A;  2CH5 A;  3KLE A;  1QTM A;  1FW6 A;  5AQO A;  3OYL A;  3RMA A;  3GOI A;  1OH6 A;  3RWU A;  5FPN A;  3VN5 A;  3H3N O;  3HI0 A;  4B3T K;  2D0A A;  2HHS A;  3NF6 A;  5AQH A;  5KPZ A;  2CGJ A;  5LL6 Z;  4HTL A;  3VOV A;  3BGR A;  4FWQ A;  1MWK A;  4H0V B;  2Y1I A;  3K57 A;  4BRQ A;  4NLB A;  4EP5 A;  1SUQ A;  2AP1 A;  2E6L A;  2VWB A;  3VEO A;  3CER A;  1C1B A;  4DR5 K;  3SPZ A;  3RR8 A;  4ELU A;  3VF6 A;  2ZJP L;  5KQD A;  4N41 A;  4FK0 A;  2QK9 A;  3OS2 A;  1TK0 A;  2E6M A;  1KC8 O;  3CFO A;  4BRH A;  2OAN A;  3OYC A;  1IO2 A;  1T8E A;  1VQ6 N;  1KAY A;  1WLJ A;  4E3S A;  4KHY A;  3ASM A;  4A57 A;  4FLU A;  3MEE A;  4PKH A;  1JCF A;  1W9H A;  4FWK A;  3KWG A;  2KFZ A;  3G10 A;  5M1F A;  2P9P A;  2FC0 A;  4DHY A;  4XEI A;  1SL1 A;  2V51 B;  4JKB A;  5JVH L;  4CBW A;  4DR7 K;  4FLX A;  4FLZ A;  3SAG A;  3QFU A;  3LWL A;  3R6M A;  3LAK A;  4H5N A;  1C1A A;  4BQL A;  4CZK A;  5DK5 A;  4WE1 A;  1RIL A;  2UUB K;  3UE5 A;  4FW2 A;  3L6Q A;  4LF8 K;  4O0J A;  5SZT A;  3CMA N;  3LDN A;  4G9Z A;  3DLR A;  4IFE A;  4AM6 A;  1WSH A;  2W40 A;  4I9L A;  1UWB A;  3C7N B;  4DQI A;  4CJF A;  2G8U A;  1RCH A;  3DLG A;  4OVL A;  5AQM A;  3SJJ A;  4LSL A;  4C1N K;  3O5B A;  1S6Q A;  1RTJ A;  1X9J A;  5HRP A;  3UKU B;  4OGE A;  2ZE2 A;  4ILH A;  1VSE A;  2FBX A;  4FJN A;  3V9X A;  5LJW A;  3G6E N;  2QWQ A;  4DTO A;  3CET A;  3N4Q A;  3NGI A;  1RDU A;  4DS5 A;  4OKE A;  5M1P A;  2I7N A;  3QIP A;  1BL3 A;  2YNI A;  3AAR A;  5KPR A;  3RR7 A;  4FZX C;  1HNV A;  1ATR A;  3VQ5 A;  4DSJ A;  1CXU A;  4DG1 A;  2OPS A;  1RBT A;  1JLB A;  3DAW A;  4F3O A;  3J81 O;  3KLI A;  4CJV A;  3NFA A;  4CEZ A;  4CZI A;  3ULD A;  4KPY A;  1IBK K;  4RG8 A;  4BC2 A;  3THV A;  3KLH A;  3ITH A;  3FZK A;  4DSI A;  5AQK A;  2ITG A;  4OLB A;  3SI6 A;  4BVO A;  4YOU A;  3JYT A;  5JLH A;  1NJI O;  1Z25 A;  2YI1 A;  4Y0W A;  3GBT A;  3CJA A;  1TKD A;  5GAE P;  5FPM A;  4BC4 A;  4DQP A;  3ZET B;  3AVH A;  4RW7 A;  1RDD A;  3CF5 L;  4RW9 A;  4DV5 K;  3QEX A;  4KH4 A;  1U4B A;  5LY3 A;  3L2Q A;  4CER A;  1N34 K;  4M7X A;  4M3Y A;  1IG8 A;  3P38 A;  5BN8 A;  1NKE A;  4DFJ A;  4H03 B;  4YOW A;  1D8Y A;  4IBN A;  1U2V B;  3OYD A;  2YHY A;  1JKH A;  3NBP A;  3O9T A;  1W2B M;  1LAV A;  3I55 N;  1GLL O;  2VQE K;  2D0C A;  2ZWH A;  4FWR A;  5BPM A;  3TU5 A;  1ITG A;  2YCH A;  3D2F A;  3P83 D;  3T69 A;  3VGM A;  2O4I A;  5BRD A;  1XHX A;  3CCJ N;  3VQ8 A;  4ID5 A;  1KVA A;  4RCH A;  4CHZ A;  3TTF A;  4FJ9 A;  3SAH A;  4K8Z A;  4ZTF A;  4QS8 A;  3TAF A;  3VF2 A;  4Z0U A;  4ZHR A;  3L4I A;  5BRH A;  3V4I A;  4WFN L;  1X1P A;  1ZBF A;  4Z4C A;  2YNH A;  5F1X A;  1O1W A;  3A5N C;  3ZX2 A;  3HM9 A;  1S1X A;  3EO3 A;  1BI4 B;  4B08 A;  1NNE A;  3CQX A;  2NRT A;  2BAN A;  4M3X A;  3AO1 A;  2UUA K;  5JS2 A;  5AZJ A;  4M42 A;  4CJ4 A;  3OYN A;  3AA4 A;  1SKR A;  1X3N A;  1X9S A;  1QSS A;  2HBL A;  1XMQ K;  3QFP A;  4CF2 A;  3IDH A;  4YOY A;  3LM2 A;  5LMN K;  1NM1 A;  2FSN A;  5AQL A;  1L3U A;  1TL3 A;  3HBT A;  4Z4F A;  3QEV A;  4H4O A;  3QML A;  4QS9 A;  2HMI A;  4DV2 K;  1TKT A;  3OS0 A;  3CCS N;  5CE3 A;  3TSU A;  4CJR A;  4CEE A;  3LP1 A;  3H46 O;  3F73 A;  1BA0 A;  5KPT A;  3J7Z O;  3M6G A;  4F4K A;  1NGB A;  1C6V A;  3PIP L;  4BG8 A;  1L5U A;  3FFI A;  3AVA A;  1ATS A;  4E0D A;  4B3S K;  1WB9 A;  2BUP A;  1NJW A;  3ZT1 A;  1YJW N;  4KTQ A;  4KB0 A;  4DTR A;  4WF9 L;  1NJZ A;  4JKE A;  1KVB A;  4NYN A;  3TAG A;  4ILG B;  3CC2 N;  1TK8 A;  3U9Z A;  1Y64 A;  4Y1D A;  3VQ9 A;  3SUQ A;  2KZZ A;  4CHP A;  1VSI A;  4L3Q A;  1RT2 A;  3MCA B;  3QIN A;  3L2R A;  2D4W A;  2IC3 A;  2Z1H A;  1HKB A;  5ADX H;  1B9D A;  4H0T B;  4DTS A;  4IKF A;  1JLA A;  2P9K A;  3MX5 A;  4E7J A;  4FVM A;  1S3X A;  1I39 A;  4IEE A;  2E2P A;  2ZQB A;  1JL2 A;  3LZJ A;  5BPN A;  4EZ6 A;  3PX4 A;  5DM7 L;  2P5G A;  1KTQ A;  4UY8 O;  2D1K A;  1OKJ A;  4DS4 A;  4IJN A;  5GAG P;  3E66 A;  3V9W A;  4NLC A;  3B6O A;  5BRE A;  4AHV A;  1MWM A;  4M41 A;  3DXK B;  3VET A;  1VQN N;  4M3U A;  4KKO A;  3L3V A;  3LDL A;  2HVI A;  1VQ7 N;  5B8H A;  1SL2 A;  1K8A O;  3R1X A;  5SWM A;  5AR0 A;  1S1U A;  1C1C A;  4BR2 A;  4CZF A;  4E19 A;  1U48 A;  5HRR A;  3SBG A;  4FVU A;  3FZF A;  4RTF D;  4EHT A;  3O1W A;  3MN6 A;  5C12 A;  3D6R A;  1BGX T;  4CFC A;  1VRU A;  5TKY A;  1LW0 A;  3MN7 A;  4BRK A;  3UKU A;  1NGC A;  3V9S A;  3BF1 A;  3NCI A;  1RTD A;  5EOY A;  1WSI A;  4E7I A;  1QSY A;  3KKS A;  1NJX A;  1LWE A;  3VQA A;  1HPZ A;  3CCE N;  4KH5 A;  1VHX A;  4CF9 A;  3NF7 A;  1JLG A;  4JS5 A;  5DM6 L;  3C6H A;  4IFV A;  4QAG A;  3KKR A;  5AQG A;  1NGF A;  4BRL A;  4DU1 A;  4FOE A;  3NF9 A;  3E01 A;  3AO3 A;  4BE0 A;  2HND A;  4CFB A;  2P9U B;  4DF8 A;  4ID1 A;  4HHT A;  5BR9 A;  1RT1 A;  2YHB A;  4I6M B;  5MLC Q;  4OO1 J;  1W97 L;  1WNS A;  3AA5 X;  3NGZ A;  4FOI A;  4Z4I A;  4PL8 A;  2KHO A;  3T1Y K;  4N56 A;  1K9M O;  4OGC A;  1YTU A;  1IKV A;  3OA9 A;  4B9S A;  1RBR A;  3TI0 A;  3L8B A;  1TKX A;  2QTD A;  4DU3 A;  4CCH A;  1IKY A;  1U2V A;  2QI2 A;  3VQ7 A;  4H0O A;  4F3T A;  2RKI A;  4LH4 A;  4JI5 K;  3IUC A;  4I2P A;  2YV0 X;  3MX2 A;  2D5R A;  4BRP A;  1I3A A;  1NGJ A;  3K58 A;  2NRX A;  5C2F A;  2P1J A;  3BDP A;  2O8D B;  4OPA A;  5FRN A;  4AM7 A;  3AA2 A;  4DCH A;  3KJV A;  1SV5 A;  4X66 K;  4B8C A;  4CJL A;  3SPY A;  4DV4 K;  2IVO A;  4B1X B;  5T7B A;  1NBW A;  3CME N;  4CEA A;  4DSE A;  1IBM K;  1REV A;  3O4N A;  4FJJ A;  4NXN K;  3O4Q A;  5AQW A;  4GV3 A;  3BF3 A;  3HVR A;  1U45 A;  1ZXO A;  2ZM6 K;  4OJR A;  4HUE A;  3C0B A;  3HP9 A;  5BPL A;  1UOC A;  3K5L A;  3VEX A;  3SUO A;  1X9W A;  3VA3 A;  1UAX A;  1N6Q A;  4CIF A;  2RHK A;  5AQX A;  5AZJ B;  3WXL A;  1NGD A;  2KZM A;  3QER A;  4CEF A;  4KTW A;  2HBK A;  3HP6 A;  4CGJ A;  5HL7 L;  3AO4 A;  1BWF O;  3ZCM A;  2F96 A;  5AQR A;  3QO9 A;  5C15 A;  3SK3 A;  4A61 A;  4BRO A;  1Z05 A;  3RSE B;  3ATU A;  3CCL N;  1EXQ A;  3M8R A;  2H3G X;  4IDK A;  4LC9 B;  2FSJ A;  2NZT A;  1MU2 A;  5HRN A;  3K0S A;  2GX9 A;  3Q7B A;  4CF1 A;  2QXL A;  5E84 A;  3EY1 A;  1J5O A;  4GVE A;  3DI6 A;  4BRA A;  4OPK A;  3HXM A;  3A0I X;  4FZZ A;  2IDO A;  5AQJ A;  4KHP K;  1YUW A;  4JKG B;  1JL1 A;  1NGA A;  1RT7 A;  2QXF A;  4DFP A;  1NMN A;  4YOV A;  4KB1 A;  2O8F B;  1NGE A;  3A5O C;  3CJ1 A;  2HOE A;  4PUO A;  1S1W A;  1BDG A;  4CGH A;  3QBW A;  1RBU A;  2JWK A;  3MEG A;  3O9U A;  3AVK A;  3EZW A;  4NCA A;  4BRM A;  4KH6 A;  3BEX A;  3TAM A;  3D7E O;  1BHL A;  4H0X B;  3DRP A;  5AQV A;  4N47 A;  3WXJ A;  3C6A A;  3ZSQ A;  4RW4 A;  3D2E B;  3MN5 A;  3ZSZ A;  3ULE B;  4J2E A;  3S9H A;  4JRQ A;  1YXQ A;  2ATQ A;  4XH1 A;  2NRH A;  4CJE A;  2HHX A;  3THW B;  1E3M A;  2PAV A;  3OYK A;  3TAR A;  2IS3 A;  1TUY A;  4Z4H A;  2R7Y A;  3QIC A;  2IAJ A;  3IFR A;  3THY B;  2LSN A;  3AVI A;  1HQE A;  4FL9 A;  2GEL A;  2ASP A;  4JLH A;  1VQL N;  1I94 K;  1VRT A;  3HST B;  2O8C A;  1T6C A;  4BDY A;  3U6F A;  4Z94 A;  2HF3 A;  3O3G A;  3M8P A;  3WXI A;  2O8F A;  2ETJ A;  2P9N A;  4AF1 A;  3JXU A;  1XQS C;  2YJE A;  3S41 A;  1MA9 B;  4E1M A;  4CBU A;  1ILY A;  3R9P A;  3DWL A;  3ATV A;  1Q86 O;  1O13 A;  2O8E B;  1VAZ A;  1W7A A;  1OVQ A;  4CZL A;  2WC9 A;  3VEZ A;  1IKX A;  1J6Z A;  3CYM A;  1BU6 O;  2BH1 A;  3EE9 A;  4LFC K;  1ASV A;  3P39 A;  3S3M A;  3A5M C;  3DLH A;  3LDO A;  3OBY A;  1NGH A;  3Q7C A;  2VGN A;  2WFB A;  3GL1 A;  2B6A A;  4CHN A;  3QEW A;  3I0R A;  4BRF A;  4JHD B;  4E7K A;  1LOT B;  3U8X A;  2HVH A;  1S22 A;  4DTM A;  1L3S A;  2HBJ A;  4WQ4 A;  3LDQ A;  1XI1 A;  1NK5 A;  2A6A A;  4DFK A;  1X3M A;  4DTN A;  1D4X A;  4DF4 A;  4IOA L;  1OH5 A;  3VTI A;  1Q81 O;  4H5R A;  3PO4 A;  2E2N A;  2HF4 A;  5CYM A;  4DTP A;  2Q1N A;  3I8D A;  5AQY A;  5AQS A;  3V9Z A;  2DY4 A;  1U04 A;  5M1O A;  4NCB A;  2W6L A;  3SMP A;  1TAQ A;  3AA3 A;  2O8E A;  4M63 C;  4DTJ A;  4JI3 K;  1ZBH A;  2F8T A;  2A42 A;  2QEX N;  1JJ2 M;  1NMD A;  5EX5 A;  1UA0 A;  2UU9 K;  5J2N A;  3OYF A;  2NLX A;  4J2A A;  5AQP A;  2ZGY A;  4OX9 K;  4O5B A;  1QQO A;  1NK6 A;  4GV9 A;  3GE1 A;  4CJ3 A;  2GWK A;  4JI8 K;  4JS4 A;  4MLH A;  3TSP A;  2RF2 A;  3FZH A;  5JMV A;  2F4V K;  1QVG M;  2DPN A;  3HTV A;  4LY7 A;  1KLM A;  4FWO A;  3QDK A;  3ID8 A;  4IWV A;  3EEQ A;  4W5O A;  3VER A;  1HX1 A;  4BR7 A;  1TAU A;  3AVG A;  1RDC A;  1XNQ K;  2A1R A;  3ENO A;  4FLV A;  4IDH A;  3K59 A;  1TV6 A;  3AY9 A;  3LP0 A;  3OJU A;  3RMD A;  3K9J A;  4CF8 A;  3CCV N;  4MO4 A;  5CYQ A;  3FGU A;  4C1N I;  4AIL C;  5HRO A;  3WNF A;  3ID6 A;  3QIO A;  4C8O A;  1FXX A;  4B9U A;  5HRS A;  3DRR A;  1E4G T;  3BZK A;  3H45 C;  3O08 A;  2W6K A;  4BDZ A;  3V1Q A;  4OLA A;  3VQB A;  1JXB A;  3V6D A;  1RTI A;  2BE2 A;  2HHH K;  3H08 A;  5C24 A;  4X64 K;  1NK7 A;  3I33 A;  3MWT A;  1OH7 A;  3H1Q A;  4FPA A;  1SL0 A;  3U3Y A;  4K0K K;  3SUN A;  1Q7Y O;  5I3U A;  4O55 A;  2RN2 A;  1NK9 A;  2PY5 A;  4B9Q A;  4DR4 K;  1SAZ A;  2FBY A;  4WFB L;  5IWA K;  4DUY K;  4X62 K;  3VTH A;  3CCM N;  2P9S B;  1BCM A;  5AFU A;  1XNR K;  4KRF A;  1NGI A;  3K9K A;  2NRZ A;  3HK2 A;  2YHW A;  2NUB A;  3CJB A;  2KFN A;  4CHO A;  1HNW K;  3TWH A;  3OYB A;  2VWJ A;  3ZSV A;  1VQK N;  1HNX K;  3ENB A;  4IOX A;  5AQF A;  2DFE A;  3SAF A;  1OH8 A;  4IOC L;  4AHR A;  4GKK K;  2AA4 A;  1BIS A;  3VEN A;  5KRS A;  3NH0 A;  1D9D A;  1VSF A;  3ZSW A;  1JCG A;  4EIA A;  3N4P A;  2HHV A;  3P1G A;  3PSF A;  1JLE A;  1KSP A;  3NMU A;  1TKZ A;  3O8M A;  4U67 L;  3PV8 A;  4DQ8 A;  1YVN A;  4U7B A;  3NDK A;  1HR0 K;  4BE1 A;  4KV8 A;  4CJ7 A;  3TAN A;  3VQQ A;  4E1N A;  3CCU N;  4CJT A;  2YKM A;  3OS1 A;  2EX3 A;  3ULE A;  1QZ6 A;  3P4I A;  2GTD A;  3P5J A;  4JRP A;  1VSK A;  4JK9 A;  1GLE G;  3TPQ A;  2F9W A;  5M1K A;  4QCL A;  1V4T A;  1ATN A;  1JLQ A;  1F21 A;  3C7N A;  2X6S A;  4XIU A;  1IH7 A;  3LAL A;  3PLA A;  3M1F A;  4DQQ A;  3THX A;  2QA4 N;  3E1Y A;  3LPT A;  1QHA A;  4H0P A;  4N76 A;  2E88 A;  4FLW A;  4CJU A;  1RDA A;  4WCE L;  4A62 A;  3THY A;  1KAZ A;  5FPD A;  2JWL A;  4BWM A;  4JI6 K;  3HRG A;  1WOQ A;  3NAE A;  2P9N B;  1Q9Y A;  4CEO A;  1A5V A;  3HOT A;  2KQ2 A;  2OPP A;  3DLB A;  2HHU A;  1NGG A;  4BGB A;  4FJG A;  1FKP A;  3LDS A;  3QEI A;  3BY5 A;  4FCY A;  3CJC A;  3HPG A;  4DUZ K;  4B9M A;  3KLG A;  4BC3 A;  3CFP A;  4FWS A;  2P9S A;  2E20 A;  1FJG K;  3SLC A;  4DV0 K;  3ALY A;  4FJM A;  1TK5 A;  4AHU A;  2A41 A;  3EKU A;  4G1Q A;  3KWI A;  5LJV A;  4DQR A;  2O8B A;  2AJQ A;  4Y1C A;  1YJN N;  4HWI A;  1WBD A;  1T7P A;  3JAM O;  4A2B A;  4Q5V A;  4JKD A;  1TUU A;  1VSM A;  3CIP A;  3WEE B;  1VSD A;  2NRV A;  4KFB A;  5HLF A;  2VYP A;  4LF6 K;  4JI1 K;  1RBV A;  3JSM A;  1KLN A;  4JI2 K;  1QSL A;  1V4S A;  1WSF A;  4HCC A;  2E1Z A;  3J8A A;  2OA8 A;  2PYJ A;  2V7Y A;  3EE8 A;  4YY3 K;  2VG7 A;  1TYQ A;  3SYZ A;  4E7L A;  3OYM A;  1WBB A;  1VQP N;  3CG7 A;  2WON A;  3KK7 A;  4CD1 A;  1LV5 A;  2WOM A;  2Q36 A;  1R0A A;  1JLF A;  1RBS A;  3E9L A;  2D0P A;  3O3H A;  2OZM A;  4K8X A;  4PWD A;  3CXC M;  2A1S A;  5C0Y A;  2YHA A;  4J2B A;  4CF0 A;  4ZTJ A;  3OY9 A;  4B9V A;  4JV5 K;  3OYI A;  2GBZ A;  3CM5 A;  2P9L B;  2P9I A;  3ZX0 A;  1BI4 A;  3F9K A;  1DTT A;  4DLG A;  1XUP O;  2FXU A;  2E1Y A;  5D3G A;  4OPH A;  4WQ5 A;  1EO1 A;  1T44 A;  4O4G A;  3LAM A;  5GIP A;  3CPW M;  3CC7 N;  3M8Q A;  4B1Z A;  3KVG A;  4KI4 A;  4OPJ A;  1NU0 A;  1A5X A;  4DWI A;  4V19 S;  5JIC A;  1BG3 A;  3RVC A;  2J4R A;  4DV1 K;  3MMV A;  4E89 A;  4A59 A;  1Q8I A;  4FJI A;  2OTJ N;  4CK1 A;  5AQN A;  3NHG A;  2O8C B;  2QWN A;  4RW8 A;  1HRH A;  3DXM A;  4JI0 K;  1RT4 A;  5AZI B;  3F5T A;  3VA0 A;  3UB5 A;  1YF5 L;  4BC5 A;  4FJX A;  4DR3 K;  3LZI A;  2YNF A;  3C95 A;  4JD2 A;  2KTQ A;  4BRN A;  2DTU A;  3ZX3 A;  2G8I A;  2BTF A;  5JS1 A;  2CGK A;  3MXJ A;  4AQY K;  1D5A A;  4FM2 A;  1RDW X;  3EZ5 A;  2VWK A;  1KRP A;  4M7Y A;  1J9A A;  4B9T A;  1J54 A;  4GMJ B;  4JKC A;  3IG1 A;  3K5O A;  1VQ5 N;  1HQU A;  1ZBU A;  5HOO A;  4B9N A;  3W0L A;  3DM2 A;  4AHC A;  5F0X A;  4NXM K;  4A5B A;  1U49 A;  3A8Y A;  1VSJ A;  3BUZ B;  3MDQ A;  1L3V A;  3IS9 A;  2GUP A;  1P90 A;  4CJW A;  2KW4 A;  1RNH A;  3ENH A;  3DRS A;  3O4W A;  1Q82 O;  1DGK N;  4YDU C;  1K6Y A;  5FLX O;  4ICL A;  1RTH A;  3ZT0 A;  4MLE A;  3RTV A;  2E4L A;  1FKO A;  5C25 A;  1C0G A;  2BDP A;  4YFU A;  5A2Q O;  4FSV A;  1T03 A;  2XO7 A;  1HPM A;  4LF9 K;  4LFA K;  3IRX A;  1EET A;  1RDB A;  3DLE A;  1NWK A;  5K14 A;  1ZC6 A;  5AZI A;  1RT3 A;  4CFD A;  4KHS A;  2EWS A;  1NK8 A;  1HUX A;  1N5Y A;  2HHQ A;  4I9Q A;  2W42 A;  3FE1 A;  3VQ6 A;  1C0M A;  4FWM A;  2HMP A;  3M3Z A;  3VPZ A;  3HSC A;  2HW3 A;  1HKG A;  4C8L A;  1KXP A;  3DXK A;  5GAH P;  2XHB A;  3OBW A;  3AVJ A;  3RSE A;  1KCF A;  4F9O A;  4KRE A;  3OYE A;  3WXK A;  3A2F A;  4DR6 K;  1YVU A;  2NRW A;  4ISE A;  5KGX A;  3I0S A;  3HM8 A;  1Q18 A;  1DTQ A;  5ELZ A;  2G8W A;  1BUP A;  3MK6 A;  1EWR A;  3SUP A;  3G0Z A;  2F9T A;  2FSK A;  2VQF K;  1NKC A;  3CD6 N;  4GY2 B;  3VMF B;  3HT3 A;  3ZEU B;  2G8F A;  4GNI A;  4HUF A;  3QEP A;  5AQQ A;  3AVF A;  4PL7 A;  2A3Z A;  4JKH A;  4KBO A;  4WQ5 C;  3HOS A;  3QNN A;  3T1A A;  1T3V A;  3G25 A;  4CEQ A;  1M1K O;  1S72 N;  1C0F A;  3FR0 A;  3RMB A;  1YT3 A;  1L3T A;  2ZGZ A;  3VGL A;  2NRR A;  2CH6 A;  3M8S A;  4TSX A;  3G71 N;  4FJH A;  4WQ4 C;  5E26 A;  1QE1 A;  2OPR A;  4PA1 A;  4CHY A;  2A5X A;  1IJJ A;  3WNE A;  3OW2 M;  2XY8 A;  3VQP A;  1U6Z A;  4I7F A;  3TSQ A;  2XRI A;  3E9O A;  2E5L K;  1Z6R A;  2Q0U A;  2P9U A;  2HBM A;  4JI4 K;  1VK0 A;  4B1U B;  2WBN A;  4CJK A;  4B1W B;  1SZ2 A;  2QM1 A;  5FDL A;  1NK4 A;  5M1Q A;  3R8E A;  3KZB A;  3WNH A;  3MCP A;  3DJC A;  3E9P A;  4B3O A;  4FWN A;  1WUA A;  3UKR A;  2OYQ A;  3VEV A;  3CHW A;  3THW A;  1VQM N;  2OZS A;  1KFD A;  2E2Q A;  4M3R A;  3O80 A;  4R5P A;  4LF4 K;  5CR4 A;  4O0I A;  1N33 K;  3MXI A;  4GKJ K;  4CI6 A;  4O44 A;  1RFQ A;  4LF5 K;  4FLT A;  3S3O A;  1N36 K;  1TYQ B;  3SZ2 A;  4DR1 K;  3NE6 A;  3DLK A;  1E4F T;  2GEM A;  2OPQ A;  4CJQ A;  1M90 O;  3RRG A;  2YJF A;  1HNI A;  3PY8 A;  1QQM A;  1N8R O;  4H4M A;  5M1N A;  4EP4 A;  1OVY A;  4YDU A;  4AH9 A;  5AQT A;  4W5T A;  1IV0 A;  4C8K A;  3P31 A;  2O4G A;  4AHT A;  5CZ1 A;  3QES A;  5EU7 A;  4DSK A;  5KGW A;  3MN9 A;  2UXB K;  5GIN A;  3ZT3 A;  2KLA A;  3VEY A;  5GAD P;  3JS6 A;  2RE2 A;  3ZSX A;  3ZLJ A;  4RWT A;  4FPB A;  4WFA L;  1LWC A;  2IIR A;  1VSH A;  2FBV A;  5GIO A;  1ASU A;  5FRO A;  4DTU A;  4HUG A;  4FWL A;  4J2D A;  3V1R A;  2E8A A;  2ITM A;  1UA1 A;  1QQN A;  2QWO A;  2BGG A;  4FJK A;  2Q2R A;  3OHR A;  1VQ9 N;  2HHW A;  2Z1J A;  1DLO A;  1XC9 A;  3U3G A;  3U9D A;  4CZM A;  4MFB A;  2FF6 A;  4Z4E A;  5JVG L;  2G8V A;  3AVM A;  2P9K B; 
#chains in the Genus database with same CATH homology
 1TL1 A;  4QAG A;  4F2S A;  2HHV A;  3VQC A;  3P1G A;  1ZBI A;  5CZ2 A;  3KKR A;  1KVC A;  1S5J A;  3OYJ A;  4DU1 A;  1JLE A;  3NF9 A;  1YTA A;  2I5J A;  1KSP A;  3E01 A;  1TKZ A;  2YKN A;  3AO3 A;  4BE0 A;  2HND A;  5J2P A;  3PV8 A;  3LAN A;  3NDK A;  1CZB A;  4CFB A;  3O3F A;  4IG3 A;  4KV8 A;  4BE1 A;  4ID1 A;  4DF8 A;  4HHT A;  4HVJ A;  3TAN A;  3KK2 A;  3SCX A;  3L2W A;  3VQQ A;  1RT1 A;  4E1N A;  2YHB A;  4M3T A;  4CJT A;  2YKM A;  3OS1 A;  3NF8 A;  2Z1G A;  2EX3 A;  3OJS A;  1SKW A;  2ZD1 A;  3RRH A;  1WNS A;  3AA5 X;  3NGZ A;  3TAB A;  1X9M A;  3P5J A;  4JRP A;  1HYS A;  1VSK A;  4QCL A;  1S1V A;  1JLQ A;  4Z4I A;  1F21 A;  3TR8 A;  2X6N A;  3ZSR A;  4N56 A;  2XY6 A;  4OGC A;  1ZYQ A;  1YTU A;  1IKV A;  4M3W A;  4B9S A;  1RBR A;  1G15 A;  2X6S A;  1IH7 A;  1WSJ A;  4XIU A;  3TI0 A;  3LAL A;  4KHW A;  3B6P A;  3L8B A;  1TKX A;  3D0P A;  4DQQ A;  4DU3 A;  1LWF A;  3LPT A;  2XY5 A;  4CGF A;  3K5M A;  1CXQ A;  4N76 A;  3NH2 A;  2HB5 A;  4FM0 A;  4FLW A;  1EKE A;  2Z1I A;  1RDA A;  4CJU A;  3TAP A;  4FM1 A;  2D0B A;  4CJP A;  3D45 A;  4CCH A;  4FJL A;  1IKY A;  4H8K A;  4BWM A;  3VQ7 A;  3NAE A;  3AO2 A;  1Q9Y A;  4CEO A;  1A5V A;  4F3T A;  2RKI A;  3PUF A;  2KQ2 A;  1JLC A;  2OPP A;  4LH4 A;  4FLY A;  2VG6 A;  3C94 A;  3DLB A;  4I2P A;  1B92 A;  1CZ9 A;  2YV0 X;  2HHU A;  1W0H A;  1TVR A;  2G8H A;  4FYD A;  2D5R A;  4FJG A;  1FKP A;  3HYF A;  1I3A A;  2HNY A;  3LDS A;  3QEI A;  3AO5 A;  4CE9 A;  3MAQ A;  3K58 A;  4FCY A;  2P1J A;  4W5Q A;  3HPG A;  4B9M A;  3DYA A;  3AVN A;  1Y97 A;  3BDP A;  3KLG A;  3DOK A;  5FRN A;  1EX4 A;  3CFP A;  4KHU A;  3AA2 A;  4OKK A;  3KJV A;  1SV5 A;  3SPY A;  4B8C A;  4CJL A;  4IFY A;  3EYZ A;  5T7B A;  4KRE A;  3ALY A;  4CEA A;  4FW1 A;  4DSE A;  2HHT A;  1REV A;  4GW6 A;  3O4N A;  4FJM A;  2QKB A;  1TK5 A;  4AHU A;  4FJJ A;  4Z4G A;  3O4Q A;  3LWM A;  5HP1 A;  2FBT A;  3HVR A;  4G1Q A;  4DLE A;  3V9U A;  1U45 A;  4KHQ A;  4DQR A;  2AJQ A;  4Y1C A;  4DQS A;  1T7P A;  1S9G A;  2JGU A;  3KLE A;  4OJR A;  4Q5V A;  1QTM A;  4B9L A;  4HUE A;  5CY4 A;  3OYL A;  1VSM A;  1GOC A;  3RMA A;  1VSD A;  4NYF A;  4EZ9 A;  3HP9 A;  4Q0B A;  4KFB A;  5HLF A;  2IGI A;  3VN5 A;  3RWU A;  3PO5 A;  1UOC A;  4N5S A;  3K5L A;  1RBV A;  2D0A A;  2HHS A;  5KRT A;  3SUO A;  1X9W A;  3VA3 A;  3NF6 A;  1UAX A;  3PX0 A;  1N6Q A;  3JSM A;  4CIF A;  3L3U A;  4IG0 A;  1KLN A;  1QSL A;  2KZM A;  3QER A;  3QLH A;  4CEF A;  4KTW A;  1WSF A;  3HP6 A;  3BGR A;  4CGJ A;  3SQ1 A;  4HCC A;  3AO4 A;  4W5R A;  4CFA A;  2OA8 A;  2Y1I A;  3K57 A;  2PYJ A;  2RPI A;  2F96 A;  3ZCM A;  2PYL A;  2Y1J A;  3QO9 A;  2VG7 A;  4EP5 A;  3SYZ A;  4E7L A;  1SUQ A;  3OYM A;  1RT5 A;  2E6L A;  1J53 A;  1B9F A;  1EXQ A;  1C1B A;  3CG7 A;  4C8N A;  2WON A;  3M8R A;  3SPZ A;  3SQ0 A;  1LV5 A;  3RR8 A;  4ELU A;  4MQ3 A;  3SQ4 A;  3SV3 A;  1HJR A;  2WOM A;  4IDK A;  3VQ4 A;  1R0A A;  3ZSO A;  3NGY A;  1JLF A;  1RBS A;  4KAZ A;  1MU2 A;  1VSL A;  4LH5 A;  5HRN A;  5E41 A;  4FK0 A;  3OS2 A;  1NJY A;  4N41 A;  2QK9 A;  3LP3 A;  1SKS A;  1TK0 A;  2E6M A;  4CF1 A;  3CFO A;  1GOB A;  4LSN A;  3OYC A;  1IO2 A;  3O3H A;  3EY1 A;  1T8E A;  1J5O A;  4CGG A;  2OZM A;  1WLJ A;  4K8X A;  4E3S A;  4PWD A;  4KHY A;  1C0U A;  2A1S A;  3ASM A;  1Z26 A;  3DI6 A;  4FLU A;  1HYV A;  4CES A;  3MEE A;  2YHA A;  4OPK A;  2PZS A;  3KD1 E;  4J2B A;  4CF0 A;  1W9H A;  3HXM A;  4ZTJ A;  4FZZ A;  3G10 A;  2P51 A;  2IDO A;  4B8A B;  3OY9 A;  4B9V A;  2KFZ A;  2FC0 A;  3OYI A;  1SL1 A;  2GBZ A;  3VQE A;  3CM5 A;  4FLX A;  1JXE A;  1WAF A;  4FLZ A;  2DFH A;  1BI4 A;  1JL1 A;  1WAJ A;  3F9K A;  1RT7 A;  2QXF A;  3LWL A;  1DTT A;  3AVC A;  4DLG A;  4BDP A;  1BCO A;  1FK9 A;  1TGO A;  3LAK A;  5J1E A;  4DFP A;  5D3G A;  4RW6 A;  1C1A A;  4KB1 A;  5DK5 A;  4WE1 A;  4O4G A;  1RIL A;  3LAM A;  3WNG A;  1RT6 A;  3M8Q A;  4FW2 A;  4PUO A;  4DMN A;  1S1W A;  4O0J A;  5SZT A;  1U47 A;  4CGH A;  3V1O A;  4KI4 A;  4OPJ A;  4DWI A;  1A5X A;  3DLR A;  1WSH A;  1WN7 A;  4I9L A;  1UWB A;  3OVN A;  4DQI A;  1RBU A;  3MEG A;  4CJF A;  3AVK A;  1BIZ A;  2G8U A;  3MED A;  4NCA A;  1RCH A;  2GV9 A;  3TAM A;  3DLG A;  3PX6 A;  1BHL A;  4OVL A;  3SJJ A;  4LSL A;  4KHN A;  3DRP A;  4E89 A;  1S6Q A;  1Q8I A;  1RTJ A;  5HRP A;  4CK1 A;  3T3F A;  4OGE A;  4DFM A;  2ZE2 A;  4N47 A;  3NHG A;  4FJI A;  1VSE A;  2FBX A;  5KI6 A;  4FJN A;  3V9X A;  1BQM A;  1XWL A;  3ZT4 A;  4RW8 A;  4UQG A;  4DTO A;  1HRH A;  3ZSQ A;  3NGI A;  1RT4 A;  4RW4 A;  2B4J A;  3ZSZ A;  4DS5 A;  4OKE A;  3VA0 A;  4J2E A;  4LD0 A;  3S9H A;  3OYH A;  4JRQ A;  3QIP A;  2ATQ A;  4FJX A;  3LZI A;  1BL3 A;  2YNF A;  2YNI A;  3C95 A;  4CJE A;  3KTQ A;  5HBM A;  2KTQ A;  2HHX A;  2DTU A;  3RR7 A;  4FZX C;  1HNV A;  3QNO A;  2G8I A;  1CLQ A;  3OYK A;  5JS1 A;  3MXJ A;  3VQ5 A;  4CIG A;  4DSJ A;  1CXU A;  1D5A A;  4DG1 A;  4FM2 A;  5J2M A;  3L2U A;  2IS3 A;  2VWK A;  2OPS A;  3EZ5 A;  4Z4H A;  2R7Y A;  1RBT A;  1KRP A;  4B9T A;  1J9A A;  2IAJ A;  1JLB A;  2LSN A;  4AHS A;  3SV4 A;  3AVI A;  1HQE A;  4F3O A;  1J54 A;  2HHW A;  3KLI A;  4GMJ B;  4JLH A;  4CJV A;  3IG1 A;  3K5O A;  3NFA A;  4CEZ A;  1HQU A;  3NH1 A;  3DMJ A;  1ZBU A;  1VRT A;  3ULD A;  4B9N A;  4KPY A;  4CEC A;  3HST B;  3QET A;  3DM2 A;  4AHC A;  3SNN A;  4RG8 A;  4BDY A;  2XY7 A;  3U6F A;  3THV A;  5I42 A;  3KLH A;  3ITH A;  3V81 A;  1U49 A;  4DSI A;  1VSJ A;  2ITG A;  3O3G A;  3M8P A;  3SI6 A;  3IS9 A;  1L3V A;  4OLB A;  2ETJ A;  4CJW A;  2KW4 A;  1RNH A;  3DRS A;  3T19 A;  4QOZ B;  3JYT A;  1Z25 A;  4E1M A;  1K6Y A;  4ICL A;  1RTH A;  3ZT0 A;  1TKD A;  3RTV A;  2HNZ A;  4DQP A;  3AVH A;  3K2P A;  2E4L A;  3SQ2 A;  4RW7 A;  1S1T A;  1FKO A;  1RDD A;  5C25 A;  4RW9 A;  4CIE A;  1NOZ A;  3QEX A;  1IKX A;  3CYM A;  1U4B A;  3L2Q A;  2BDP A;  4CER A;  4M3Y A;  1ASV A;  4YFU A;  1NKE A;  4DFJ A;  3S3M A;  3DLH A;  1T03 A;  3CFR A;  1D8Y A;  2XO7 A;  3K5N A;  3OYG A;  3IRX A;  4IBN A;  3OYD A;  1ASW A;  3S3N A;  4CED A;  1EET A;  1RDB A;  3DLE A;  5K14 A;  4C8O A;  1JKH A;  3NBP A;  4PQU A;  1RT3 A;  4CFD A;  4KHS A;  1LAV A;  1S6P A;  2D0C A;  1QHT A;  3OYA A;  1NK8 A;  1ITG A;  2B6A A;  3P83 D;  4CHN A;  3QEW A;  1N5Y A;  2O4I A;  3I0R A;  4FJ8 A;  1XHX A;  4GVM A;  4E7K A;  2HHQ A;  1ZBL A;  4I9Q A;  2W42 A;  3VQ8 A;  1C0T A;  4ID5 A;  1KVA A;  3KLF A;  1QS4 A;  4CHZ A;  4FJ9 A;  3AV9 A;  2HVH A;  3VQ6 A;  4CHQ A;  1C0M A;  4DTM A;  1L3S A;  4FZY A;  4K8Z A;  1XI1 A;  1NK5 A;  4ZTF A;  4E7H A;  2HW3 A;  4DTX A;  4DFK A;  2B5J A;  3TAF A;  4C8L A;  4Z0U A;  4ZHR A;  1NK0 A;  1HMV A;  4DTN A;  4DF4 A;  2XHB A;  3V4I A;  3AVJ A;  1XHZ A;  1KCF A;  4DU4 A;  1X1P A;  2IOC A;  5CYM A;  1ZBF A;  4DTP A;  4Z4C A;  2YNH A;  3OYE A;  3PO4 A;  1O1W A;  5FRM A;  4CGD A;  3HL8 A;  3I8D A;  4CJ5 A;  3L2V A;  3HM9 A;  1QQC A;  1S1X A;  3AVB A;  3V9Z A;  1BI4 B;  4B08 A;  3A2F A;  1YVU A;  2DY4 A;  2BAN A;  1U04 A;  4M3X A;  3AO1 A;  3HPH A;  2Q3S A;  5DMR A;  5KGX A;  3I0S A;  2EHG A;  4DSF A;  5JS2 A;  4NCB A;  1DTQ A;  2G8K A;  2G8W A;  4M42 A;  1TAQ A;  4CJ4 A;  3OYN A;  3AA4 A;  1SKR A;  3AA3 A;  3SUP A;  1IKW A;  3G0Z A;  1X9S A;  4DTJ A;  1QSS A;  1ZBH A;  2VG5 A;  3CM6 A;  2F8T A;  4CJS A;  4CF2 A;  1NKC A;  3VQD A;  1Q9X A;  1S9E A;  4DSL A;  3HT3 A;  3UIQ A;  1UA0 A;  3ISN C;  3OYF A;  4I2Q A;  5J2N A;  2G8F A;  4HUF A;  4J2A A;  3QEP A;  3AVF A;  1L3U A;  1TL3 A;  4C8M A;  4M45 A;  3AVL A;  4O5B A;  4BWJ A;  1NK6 A;  3KD5 E;  4Z4F A;  3QEV A;  4CJ3 A;  4H4O A;  5C42 A;  3T1A A;  3QNN A;  4CEQ A;  2HMI A;  4JS4 A;  2RF2 A;  3MEC A;  1TKT A;  3OS0 A;  4CJR A;  3RMB A;  1YT3 A;  4KTZ A;  1L3T A;  4LY7 A;  1KLM A;  1BIU A;  4CEE A;  1LW2 A;  4F2R A;  4HTU A;  3LP1 A;  3F73 A;  4FJ5 A;  3M8S A;  4TSX A;  4W5O A;  4FJH A;  4C8K A;  3ZT2 A;  4OKJ A;  4F4K A;  4PY5 A;  1QE1 A;  2OPR A;  4PA1 A;  1C6V A;  4CHY A;  1TAU A;  1L5U A;  2QKK A;  3FFI A;  3AVA A;  3WNE A;  4E0D A;  3AVG A;  4HCB A;  2XY8 A;  3VQP A;  1RDC A;  1NJW A;  1EP4 A;  3ZT1 A;  4KTQ A;  3HO1 A;  2A1R A;  4I7F A;  3DOL A;  4FLV A;  3K59 A;  4DTR A;  1NJZ A;  3HPO A;  4KB0 A;  4NYN A;  1KVB A;  1TV6 A;  2XRI A;  3TAG A;  3HJF A;  3LP0 A;  1TK8 A;  3OJU A;  2DFF A;  3RMD A;  4CF8 A;  4M3Z A;  1A5W A;  4Y1D A;  3VQ9 A;  5CYQ A;  3SUQ A;  4AIL C;  4FXD A;  1VK0 A;  2KZZ A;  5HRO A;  4CJK A;  1NKB A;  4L8R B;  5FDL A;  3WNF A;  3QIO A;  1VSI A;  1FXX A;  4CHP A;  1RT2 A;  3QIN A;  3L2R A;  1NK4 A;  2IC3 A;  2Z1H A;  4B9U A;  3WNH A;  2P5O A;  5HRS A;  3DRR A;  1WSG A;  1B9D A;  4DTS A;  4IKF A;  3C6U A;  4B3O A;  2OYQ A;  1JLA A;  2F8S A;  2OZS A;  1HYZ A;  1KFD A;  3V1Q A;  4M3R A;  4BDZ A;  4OLA A;  4BE2 A;  4E7J A;  4R5P A;  4FVM A;  3VQB A;  1JXB A;  4O0I A;  3V6D A;  1RTI A;  3MXI A;  1I39 A;  4O44 A;  2BE2 A;  2ZQB A;  1JL2 A;  1BQN A;  3LZJ A;  4FLT A;  4EZ6 A;  5KTQ A;  4BAC A;  3S3O A;  2X78 A;  3H08 A;  5C24 A;  1NK7 A;  3SZ2 A;  3PX4 A;  3NE6 A;  4CK3 A;  3DLK A;  2P5G A;  1KTQ A;  4DS4 A;  2OPQ A;  4CJQ A;  4FJ7 A;  3RRG A;  2GUI A;  3KIO A;  1SL0 A;  3V9W A;  3U3Y A;  1HNI A;  3B6O A;  3PY8 A;  4FK4 A;  4AHV A;  4H4M A;  3MXM A;  3SUN A;  3LP2 A;  4M41 A;  4AH9 A;  4EP4 A;  4M3U A;  4KKO A;  3L3V A;  3HVT A;  2YNG A;  4W5T A;  5I3U A;  4O55 A;  5J2Q A;  2O4G A;  3RMC A;  4AHT A;  5CZ1 A;  3QES A;  5EU7 A;  4DSK A;  4FK2 A;  2RN2 A;  2HVI A;  5KGW A;  1NK9 A;  1SL2 A;  5SWM A;  2PY5 A;  1IG9 A;  2FBY A;  3ZT3 A;  4ELT A;  1S1U A;  1NOY A;  4CEB A;  1C1C A;  4E19 A;  3KK1 A;  1LAW A;  1BCM A;  5HRR A;  1U48 A;  3TAE A;  4KRF A;  4F8R A;  3IAY A;  2JLE A;  3ZSX A;  3TAQ A;  3KK3 A;  3HK2 A;  1LWC A;  1WSE A;  2NUB A;  1BGX T;  4CFC A;  4CK2 A;  1VSH A;  2FBV A;  1VRU A;  2KFN A;  3TAR A;  1ASU A;  5FRO A;  4DTU A;  1LW0 A;  4CHO A;  4HUG A;  1D9F A;  3TWH A;  3OYB A;  2VWJ A;  3V1R A;  3V9S A;  4J2D A;  3ZSV A;  3NCI A;  1RTD A;  1UA1 A;  1WSI A;  4E7I A;  2BGG A;  1QSY A;  4FJK A;  2DFE A;  3KKS A;  4ELV A;  1GOA A;  4AHR A;  1NJX A;  1LWE A;  2Z1J A;  3LPU A;  3VQA A;  4KI6 A;  1DLO A;  1HPZ A;  4CGI A;  3U3G A;  3CQ8 A;  2X74 A;  1XC9 A;  1T05 A;  1BIS A;  4KO0 A;  4CF9 A;  5KRS A;  4YNQ A;  3NF7 A;  4W5N A;  4MFB A;  3NH0 A;  4NCG A;  4Z4E A;  1D9D A;  1KFS A;  2G8V A;  1JLG A;  1VSF A;  3AVM A;  3ZSW A;  4JS5 A;  3C6T A;  3ZSY A;  4IFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...