4O55A

Hiv-1 integrase catalytic core domain complexed with allosteric inhibitor (2s)-tert-butoxy[6-(5-chloro-1h-benzimidazol-2-yl)-2,5-dimethyl-4-phenylpyridin-3-yl]ethanoic acid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
154
structure length
139
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title A New Class of Multimerization Selective Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/inhibitor
total genus 45
structure length 139
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o55A00
1L3UA 1HJRA 3AO3A 4CFDA 4FZYA 2ETJA 2D0CA 1IKWA 3MECA 3P1GA 3T1AA 5K14A 4BWMA 3F73A 1L3VA 3SQ0A 4G1QA 3HVTA 2R7YA 1KCFA 1VSKA 3LWMA 3ZSZA 4CJ3A 3HVRA 2Z1GA 1KLNA 3I0SA 1ASWA 1RBRA 4AHCA 3LP3A 2X78A 4CECA 3CFOA 4DU4A 3S3OA 3FFIA 1EXQA 4KI4A 5HRPA 4IG3A 1YTUA 1ASUA 4FM2A 3ZSWA 3K59A 1LW2A 3S9HA 3VQ5A 1KFDA 1Y97A 2DY4A 2KFNA 3QEWA 4E7HA 3SUNA 2EX3A 3SPZA 4OVLA 1KTQA 4KO0A 1TV6A 2G8KA 1KSPA 3DLRA 1WLJA 1QS4A 3DLEA 3NGYA 4Y1DA 1SKSA 3DLBA 4CEDA 1XWLA 4CGJA 2QKBA 4L8RB 5KTQA 1BCOA 4FLXA 3TAGA 3OY9A 3TARA 3PX4A 4F2RA 4N56A 3DOKA 1LV5A 3RR8A 4J2AA 1BQMA 2IOCA 3VQDA 4ICLA 1C0UA 3NBPA 5J2MA 1IKVA 2DFHA 4FJIA 1ZBLA 3AVMA 4Q5VA 1F21A 1FKPA 3ZSOA 4PQUA 4Z4CA 1RBUA 4OKJA 3K5LA 4DQQA 3THVA 4XIUA 1WAJA 1NJWA 2G8WA 1IKXA 3NE6A 3NGIA 3MEEA 1EX4A 4RW6A 4O0IA 4CEBA 3M8QA 4DSIA 1T05A 2HMIA 3WNFA 1KVBA 4FJ7A 4KRFA 3V9SA 3V9ZA 3U3YA 3T19A 4BACA 4C8MA 2OZSA 1TKTA 1VSJA 4Y1CA 3MAQA 4E7LA 2DFFA 4KFBA 5HROA 1FK9A 3TAPA 1SKRA 4RW7A 4KI6A 1A5WA 3CG7A 3LAKA 4ZTJA 2FBTA 1ZBIA 3K5OA 1Q9YA 3AA5X 2P5GA 4FLTA 3RMCA 3HM9A 4CIFA 4KTZA 3C6TA 3M8SA 3QIPA 1NK0A 3EZ5A 4FJMA 4CK1A 1LWCA 3QETA 4CHPA 4M3TA 3VQBA 5KGXA 1NK5A 2FBYA 3NAEA 4B9TA 2GUIA 1ZBHA 3NH2A 2HVIA 3B6OA 4CJ4A 4M3WA 2YKNA 3CM5A 4CGFA 3KLHA 4FJXA 3AVGA 1NOZA 3ITHA 4CF9A 3KTQA 1T7PA 1BHLA 3OVNA 1WSGA 2XY7A 3KLIA 2D0BA 4BE2A 1EETA 1NK6A 1U48A 1Q9XA 2HW3A 1J54A 2O4GA 2ATQA 3TAEA 5FRMA 4FVMA 3RRGA 1HYSA 1NKEA 4CE9A 3QIOA 3OYLA 3AVCA 3AVAA 4EZ9A 2YNFA 3V1RA 2DTUA 1UA1A 1GOCA 4DTJA 3SCXA 1KVCA 1UAXA 3VQ6A 4FLYA 4CEOA 1TAQA 4CJ5A 3E01A 1BISA 4DS5A 1S1WA 4B9VA 4FJKA 1SL0A 5HRRA 4CJQA 4CIGA 4DF4A 3QESA 5J2PA 4DG1A 3L2RA 3WNEA 4LD0A 4CJRA 1RBVA 5HRNA 3KKSA 3LDSA 4DQSA 4KHUA 2F8TA 3AO2A 1KRPA 3SPYA 2X6NA 4ID5A 2Q3SA 4HUGA 3HPGA 3TR8A 2A1SA 4FCYA 4CEFA 3HXMA 3SQ4A 4F3TA 4OJRA 4KAZA 1RCHA 4N5SA 1D8YA 3V9XA 4FZZA 1S6QA 4FLZA 2ZE2A 3B6PA 1BI4A 1RBSA 2YV0X 3OYKA 1VRUA 5HLFA 1TKDA 1BI4B 2F8SA 2OZMA 1W0HA 1BIZA 1C1BA 1DTTA 5HRSA 2PZSA 1WSFA 1QSLA 1SUQA 4YNQA 3HSTB 4N76A 2KTQA 4UQGA 3IRXA 2E4LA 2OPPA 2VG7A 4KTWA 3KK1A 4CK3A 1BIUA 1KVAA 2IGIA 3DMJA 1HYZA 1FKOA 1K6YA 2XHBA 1RT5A 3CYMA 2HVHA 4I2PA 1GOAA 3NH0A 3OYNA 1U45A 2VWKA 1NKBA 4F4KA 3DLHA 3BDPA 3L2UA 1BCMA 3LWLA 4DTNA 4FJJA 3U6FA 2VG6A 4E0DA 3L2WA 3HJFA 4J2BA 3OYDA 2FC0A 3K58A 2PYLA 3TABA 4MQ3A 3AVKA 4CESA 1JKHA 3CQ8A 3CM6A 3IS9A 1T03A 5JS1A 3KLEA 1JLAA 1B9FA 3QERA 5I3UA 4NCBA 5FDLA 4C8NA 4KHWA 3ZT0A 4I2QA 5E41A 1RDAA 1C0TA 3DLGA 4AHUA 4CJUA 3DM2A 3OYEA 3QNNA 3SQ1A 4ELTA 4QOZB 3WNGA 3HT3A 4E1MA 1VK0A 4OKEA 5CZ2A 3K5NA 1NK7A 5KI6A 1RDBA 1RTHA 4E1NA 3AVJA 3ZT1A 3DYAA 4DSFA 3MXIA 2HHSA 1O1WA 1JL2A 1NKCA 2YNHA 4DQRA 2G8FA 4DFPA 4FZXC 4FJ5A 1LAVA 3CFPA 1X1PA 4ELVA 4J2DA 4PY5A 3CFRA 3K2PA 3L2VA 4BE1A 1RT2A 1D9FA 3PUFA 2RF2A 3MEDA 3V6DA 1A5XA 1WAFA 3VQEA 4CJKA 4F3OA 1RT3A 1EP4A 1WSEA 4B9UA 1HRHA 1SL1A 1ZBUA 4NCGA 4C8KA 1WSJA 3RMDA 3QEXA 1WSIA 4KB0A 4HUEA 5I42A 3TI0A 2HHXA 1YT3A 5C42A 4GW6A 5T7BA 5CYQA 1REVA 5DMRA 3OYGA 3QINA 3KK3A 3K57A 4DS4A 4E7IA 1NK4A 1B9DA 2OPQA 1VSFA 3G10A 3IG1A 4CEAA 2YNGA 3LANA 3VQPA 3OYIA 3JYTA 4AHTA 5C25A 4W5RA 1LWFA 3PY8A 4BDZA 3AA3A 3P5JA 3VQ8A 2HB5A 3HP9A 1VSHA 3QLHA 4LH5A 4E3SA 2O4IA 1RT6A 4CHOA 4K8XA 4FYDA 1X9SA 4KPYA 1C1CA 2BDPA 1WSHA 2ZD1A 4I9LA 5DK5A 3ZT4A 4B8AB 1FXXA 1RT1A 2GBZA 3KIOA 5JS2A 2B5JA 1QSSA 2HHWA 2B4JA 4PUOA 3VQCA 2X74A 3D45A 4W5QA 1NOYA 3OYHA 3VA3A 4IKFA 2KFZA 4OGEA 4CHNA 1ITGA 3KD5E 4LH4A 4BDYA 4OLAA 4CJPA 3C94A 4N47A 3BGRA 4LSNA 3O3FA 4HHTA 3S3MA 4FW2A 2B6AA 3AO5A 1JLBA 1TK5A 2LSNA 4W5TA 4CJTA 4ELUA 1XHXA 4FJGA 1IH7A 3HO1A 1RT7A 1RDDA 3DOLA 3NF9A 5FROA 2VG5A 4DFKA 4CJWA 2I5JA 2RN2A 1VSLA 1JLEA 4KHQA 4FM1A 4FK0A 1HYVA 4AHVA 4LY7A 3NGZA 3MXMA 2OPSA 2WOMA 4RW4A 1NJZA 4IFYA 4O44A 4RW8A 4DLGA 1L5UA 3AVIA 1XHZA 3OS0A 1JL1A 3VQAA 4E7KA 3PO4A 4W5OA 1D5AA 3RTVA 2G8VA 3AO1A 4M3XA 1CXUA 3HK2A 4EP4A 4DQPA 3EY1A 4OPJA 3NCIA 1J53A 3RMBA 4I7FA 3NF7A 1S1TA 4HVJA 2NUBA 2YNIA 3AVLA 1RT4A 3M8RA 1ZYQA 5SWMA 3NDKA 1QTMA 4FJHA 3NH1A 2KQ2A 2HHUA 4AH9A 4CF2A 4DFJA 4IG0A 1I39A 2HHVA 1DLOA 3UIQA 4ZTFA 1TL3A 4OGCA 4FLVA 1EKEA 1JXBA 2FBVA 3QEPA 2E6LA 2OA8A 4KHNA 4ID1A 3OS2A 4B9MA 3MXJA 4O55A 2P1JA 4B9NA 1HNVA 2BGGA 4F2SA 4DTXA 2OYQA 4FLWA 1UA0A 3LP1A 5CZ1A 3H08A 3QEVA 3SYZA 1SKWA 3V9WA 4CERA 4CF1A 2ZQBA 3OYCA 4M3YA 4JLHA 3O3HA 4DLEA 4W5NA 4OPKA 1N6QA 4DTSA 2FBXA 4M3RA 4CJVA 4HUFA 2A1RA 4KREA 1RTJA 4IFVA 5KRTA 3OJUA 1S1XA 4KHYA 1QHTA 3ZSXA 3D0PA 2Y1IA 4Q0BA 1TKZA 2W42A 2QXFA 3ZSRA 1UWBA 4HTUA 3I8DA 1NK8A 2G8IA 1BQNA 4DFMA 5FRNA 3KJVA 3KK2A 4JRQA 1NJYA 3AV9A 3G0ZA 4CF8A 3KLFA 3LZJA 3TWHA 4CEZA 1JXEA 1NJXA 5SZTA 1S9EA 4DMNA 4FXDA 1S5JA 1VSEA 4LSLA 4O5BA 2JGUA 3LP2A 3V81A 4EZ6A 1NK9A 1A5VA 3EYZA 3SQ2A 4Z4IA 4FJNA 2YHAA 4M3ZA 1QE1A 2OPRA 3TANA 4CGIA 3VN5A 4DSEA 1R0AA 4N41A 1JLFA 4CFCA 4FK4A 4CEEA 1L3SA 2Z1IA 1VSDA 2RKIA 4DU3A 4DTPA 4FJ8A 4DQIA 4H8KA 4KHSA 3KLGA 2QK9A 4RW9A 4JS4A 3HPHA 1CXQA 4OKKA 1C1AA 4M3UA 2AJQA 3VQQA 4B9SA 5KRSA 3I0RA 3MEGA 4CIEA 1YTAA 1ZBFA 3AVHA 4DSLA 4H4MA 4Z4FA 1DTQA 2ITGA 2HNDA 1TK8A 3HPOA 3IAYA 2DFEA 3VQ9A 4O0JA 4AHSA 2XY6A 1T8EA 1LAWA 4BDPA 4KB1A 1BGXT 3OS1A 3HP6A 1JLCA 3DRSA 3ZSVA 3SI6A 3SJJA 3TAMA 2G8UA 2G8HA 1Q8IA 3OYFA 3SUPA 3V9UA 3S3NA 4CGHA 3PX6A 1B92A 2GV9A 3VQ4A 1TGOA 1RBTA 1SL2A 4EP5A 1C0MA 2IC3A 3KKRA 3AVBA 1HQUA 3QNOA 4BE0A 3RMAA 5EU7A 2XY5A 4NYNA 3ISNC 1MU2A 1HMVA 1TL1A 3DI6A 1HQEA 2BANA 3OYJA 4QCLA 1TK0A 4DF8A 4KTQA 1TKXA 3LP0A 3TAFA 2IAJA 4CGDA 4YFUA 2D5RA 1J5OA 4Z4GA 2HHQA 3AVFA 1VSIA 4O4GA 1JLQA 4RG8A 3SV4A 1X9MA 1L3TA 1IKYA 2PYJA 2D0AA 4CEQA 4CJEA 4Z4HA 3DLKA 3O4QA 4AHRA 1CZ9A 3QO9A 4WE1A 1QQCA 2P5OA 1S6PA 1CZBA 4CCHA 3ZSYA 4PWDA 3SUQA 4DTRA 1D9DA 4H4OA 4JS5A 2RPIA 3AA4A 3SZ2A 1HPZA 3LPUA 3HL8A 2Z1JA 2HHTA 2KZZA 1U4BA 1RDCA 2JLEA 4M45A 3VA0A 4BWJA 1RTDA 4DSKA 5HBMA 1KLMA 2IDOA 3U3GA 3ZSQA 4CF0A 3RR7A 2HNZA 1W9HA 3O4NA 3ZT2A 4K8ZA 1WN7A 2KZMA 1U04A 4Z0UA 4R5PA 3DRRA 1J9AA 3V1OA 1X9WA 4FM0A 3A2FA 4FJ9A 1TAUA 3JSMA 4OLBA 3O3GA 2XY8A 2X6SA 4JRPA 4AILC 5C24A 3P83D 1Z25A 3VQ7A 1U49A 3TAQA 3K5MA 3RRHA 1LW0A 1JLGA 4CFAA 1XI1A 1CLQA 4HCCA 1RILA 4NYFA 4CFBA 4DSJA 3DRPA 1UOCA 3NFAA 3L2QA 3L3UA 4CJLA 2XO7A 3NHGA 1VRTA 3AVNA 3F9KA 3NF8A 5J1EA 2QKKA 4C8OA 4HCBA 4B3OA 3L3VA 3V4IA 1GOBA 2PY5A 3PO5A 4CHYA 2YKMA 2XRIA 3PV8A 2HNYA 3OYBA 4B08A 5CY4A 2Y1JA 4B8CA 5HP1A 4DTMA 3OJSA 1RNHA 3AA2A 3LALA 1IG9A 1SV5A 5CYMA 1I3AA 3C95A 2EHGA 3RWUA 4E89A 3LZIA 4J2EA 1TVRA 2E6MA 4F8RA 4FK2A 1VSMA 4CHQA 5J2QA 1S9GA 3ZCMA 4CGGA 2IS3A 3ZT3A 1BL3A 3L8BA 4CJFA 1IO2A 1WNSA 3ASMA 2VWJA 1S1UA 3M8PA 4E19A 3OYMA 3SNNA 2F96A 2KW4A 4GMJB 2Z1HA 1ASVA 4CHZA 4FW1A 3T3FA 4FJLA 2P51A 3ULDA 4Z4EA 3ALYA 4MFBA 5D3GA 1U47A 1YVUA 1S1VA 4E7JA 4DWIA 3WNHA 1G15A 1RTIA 4M42A 3SV3A 4M41A 1Z26A 4FLUA 2WONA 3LAMA 4IBNA 4KKOA 1KFSA 4GVMA 4IDKA 2YHBA 5J2NA 3C6UA 1LWEA 4I9QA 4CK2A 4PA1A 4DU1A 3LPTA 4TSXA 3NF6A 4DTOA 3SUOA 1QSYA 4DTUA 4C8LA 4ZHRA 2BE2A 3OYAA 5KGWA 1C6VA 3V1QA 4KV8A 4NCAA 1N5YA 4CJSA 1XC9A 1HNIA 4B9LA 3KD1E 3PX0A 4QAGA 3QEIA 3HYFA 3AO4A
chains in the Genus database with same CATH superfamily
4WFNL 4CFDA 5C15A 2ETJA 2D0CA 4LF7K 3F73A 1L3VA 4X64K 2R7YA 1KCFA 1VSKA 3VGLA 1X3NA 3I0SA 1ASWA 3LP3A 2X78A 3CFOA 3FZMA 1ILYA 1ASUA 1LW2A 2OTJN 4IOCL 4DV0K 2KFNA 1MDUB 4OVLA 1KTQA 4KO0A 4QS9A 2HBKA 2WUSA 4CEDA 3TAGA 3CETA 1OH6A 3RR8A 4J2AA 3VEXA 4NLBA 3S41A 1ZBLA 1F21A 2YJFA 4DQQA 1WAJA 1IKXA 3NE6A 3NGIA 1EX4A 1T3VA 4RW6A 4O0IA 1T05A 3U3YA 3T19A 2OZSA 4PWDA 1VSJA 3KWGA 5M1FA 3QBWA 1A5WA 3CG7A 4ZTJA 3K5OA 3AA5X 1YUWA 2D1KA 4CZKA 3QIPA 3NVMA 5F1XA 4FJMA 4BR7A 2EWSA 5KGXA 1NK5A 1QVFM 4DR1K 4L3QA 3B6OA 3DXKB 1K8KB 2YKNA 3KLHA 1NOZA 3BEXA 3J7YP 1BHLA 3U8XA 3OVNA 1T7PA 1WSGA 4BE2A 1NK6A 3EE8A 4JK9A 4A2AA 2O8DA 4IWVA 4LF5K 2O4GA 4FVMA 3RRGA 2CGJA 4CE9A 3OYLA 5M1NA 4JYAK 5AQXA 1UA1A 5BRFA 4FLYA 1TAQA 4CJ5A 1ZBSA 4DS5A 1S1WA 2Q0RA 2NRHA 2E1ZA 5HRRA 3QESA 5C0YA 2YJEA 2F8TA 1TYQB 5LY3A 3LDSA 2D4WA 1KRPA 1BA0A 3CXCM 4HUGA 1YHQN 3TR8A 4F3TA 2YCHA 1KAXA 1Q18A 4OJRA 1HR0K 4N5SA 4H5TA 3V9XA 2DPNA 4FZZA 5AQRA 1S6QA 4FLZA 2ZE2A 1TKDA 1RBSA 3OYKA 2F8SA 4IEIA 2NZTA 4FWSA 3T1HK 1DTTA 2O8CA 1QSLA 4YNQA 3FE1A 3IRXA 2E4LA 4LFBK 4KTWA 3WXKA 5KQDA 1BIUA 5EX5A 1K6YA 5KPRA 4NXMK 1U45A 3PIOL 1BCMA 3KHYA 3O08A 3HJFA 4J2BA 2PYLA 2IVNA 4JKAA 3MN7A 3CCSN 3CM6A 5F2RA 3IS9A 5JS1A 3VERA 4DV1K 5GIOA 5FDLA 3AAQA 1RDAA 3CQXA 4CJUA 3DM2A 3OYEA 1NG9A 3HT3A 1VK0A 1ZXOA 4OKEA 2GEMA 2QWLA 5CZ2A 3AVJA 4DSFA 1O1WA 3ZX2A 4FZXC 2G8FA 4KH6A 4J2DA 4PY5A 3VMFB 3L2VA 1VQ6N 2RF2A 2P9LB 4JI3K 4CJKA 1E4FT 2QWQA 4B9UA 3ATVA 4KB0A 2HHXA 3OYGA 5CYQA 1REVA 5DMRA 3KK3A 3K57A 1VSFA 3RSEA 3JYTA 3CCRN 3VQ8A 2HB5A 3HP9A 2P9PA 3QLHA 4LH5A 2O4IA 1X3MA 1C1CA 5I9EB 3SMPA 2GWJA 2W41A 2GBZA 2GUPA 1QSSA 2HHWA 5BPLA 2JWKA 4OGEA 4RWTA 4U67L 4CJPA 4HHTA 4LSNA 4JKDA 4FW2A 2B6AA 4CJTA 4IOAL 1DGKN 1RT7A 3DOLA 3NF9A 2HBLA 3M5RA 4BQLA 4FK0A 1HYVA 4B1VA 3MXMA 4RW4A 4O44A 4A5AA 4RW8A 4DLGA 3J7ZO 3OS0A 3PO4A 1NLVA 3RTVA 4M3XA 4WFAL 3AO1A 1IV0A 3AGKA 3NF7A 3AVLA 3M8RA 4FJHA 1TUYA 2HHVA 4PL8A 3G4SN 4ZTFA 1TL3A 1JXBA 3EKSA 5BREA 2E6LA 3OS2A 1S3XA 4CD3A 2A41A 4B9NA 3ZETB 2BGGA 5AQLA 1SKWA 4CF1A 3OYCA 3WEEA 4DLEA 1N6QA 4HUFA 2O8BB 5C2DA 3OJUA 1S1XA 5DM6L 4B1UB 4Q0BA 5M1QA 1TKZA 1YXQA 3ZSRA 4HTUA 4OX9K 2O8EA 1BQNA 3KK2A 3M3ZA 4JRQA 3G0ZA 3BF1A 4CF8A 1JXEA 2Q1NA 4CVNE 2W40A 1ATSA 3THXB 1NK9A 3PSIA 4Z4IA 4FJNA 3AARA 2YHAA 4DSEA 3VOVA 2ZJQL 3T69A 4CEEA 1L3SA 3EO3A 4DQIA 4H8KA 3VF6A 4RW9A 4C23A 4JS4A 5AQTA 1C1AA 3MEGA 3AVHA 3OW2M 3GE1A 4H4MA 2HNDA 5LJWA 1X9JA 1LAWA 4KB1A 3HP6A 2W6LA 3DRSA 3ZSVA 3CIPA 5AQQA 1Q8IA 4A5BA 3OYFA 5JVHL 5E26A 1SL2A 4CZGA 4JI7K 4JI6K 3IMXA 5EU7A 2I7PA 3CMAN 3OA9A 2Q0UA 3DI6A 4IDHA 1K9MO 4QCLA 4KTQA 3LP0A 3TAFA 4CGDA 4BR2A 4Z4GA 4GKKK 5AQYA 4IJNA 1VSIA 4O4GA 4RG8A 3SV4A 1FW6A 3LDPA 4JKFA 3DLKA 4AHRA 2QA4N 3TU5A 3VTHA 2QEXN 2YHXA 3ENOA 3ZSYA 3BUZB 3SUQA 4DTRA 3ENHA 3O1WA 2RPIA 4FWOA 3SZ2A 3LPUA 3HL8A 4EIAA 1RDCA 1U4BA 3M6GA 2PFUA 4WYBA 4DQ8A 1RTDA 4DSKA 4JV5K 4FPAA 3U3GA 5BPMA 3O4NA 4O5FA 1U04A 5TKWA 1J9AA 3V1OA 1TAUA 3VEZA 2AP1A 1N34K 4OLBA 3O3GA 2X6SA 4JKGA 1SAZA 1NGAA 4EHTA 4CFAA 2VCPA 5C12A 1CLQA 1RILA 4JK8A 3NFAA 4B3TK 3L2QA 3L3UA 2O8DB 2P9NA 4FWRA 1VRTA 3F9KA 5J1EA 4C8OA 4B3OA 3WXLA 5C2FA 3L3VA 1K73O 2PY5A 3PV8A 1V4TA 5CY4A 4U7BA 4R79A 1DKGD 1RNHA 3LALA 1HNWK 3C95A 1NMNA 3LZIA 4J2EA 2F9TA 1VSMA 4WQ5A 3AAPA 3O9QA 4CZMA 2NRZA 3VF4A 3ZT3A 1GLFO 5AFUA 3VF2A 1WNSA 1GLJO 1GLLO 4FW1A 2P51A 3HRGA 3OBWA 3BY5A 4FOIA 3WNHA 3SV3A 1Z26A 2Q97A 4FLUA 2WONA 4KKOA 1KFSA 4GVMA 5J2NA 4CK2A 4DU1A 4BRAA 3CC7N 2E2QA 4YOXA 1C6VA 4DHYA 4NCAA 1N5YA 4CJSA 3O9RA 1W7AA 3QFPA 4H5NA 4QAGA 5HLFA 3LDOA 1L3UA 5GADP 3MECA 1IKWA 2A3ZA 5K14A 2E5LK 4G1QA 3HVTA 2P9SA 4ILJA 3ZSZA 2HHQA 3N4QA 1RBRA 4DU4A 4CECA 4H0VB 3FZKA 4KI4A 2WFBA 4IG3A 2Q2RA 4M63C 3K59A 2DY4A 3S9HA 1Y97A 3D2EA 4FWLA 3J80O 4E7HA 2EX3A 1HJOA 4KBOA 2F9WA 1KSPA 3DLRA 3CCLN 3DLEA 4JI5K 1SKSA 2QKBA 1BCOA 4FLXA 4N56A 2YI1A 1BQMA 4ICLA 5J2MA 1R59O 1RDUA 4IZ9A 5JICA 3ZX0A 4JI4K 4FJIA 4JD2A 3ZSOA 3WQUA 4F9OA 5BR8K 5AQPA 1NJWA 2G8WA 1HKBA 4CEBA 3M8QA 3RSEB 4E1JA 4DSIA 3D6RA 3WNFA 4FJ7A 1Q82O 3VPZA 3CMEN 5FLXO 2DFFA 2P9PB 1OH8A 4KI6A 3LAKA 2P5GA 3RMCA 4JNEA 4KTZA 4IO8A 3EZ5A 1LWCA 3QETA 2FBYA 2H3GX 3NAEA 4DKWA 2A5XA 1QQOA 3NH2A 4CJ4A 1YJWN 3CM5A 1YITN 2HHHK 3ITHA 4A62A 3KLIA 3WT0A 1VQ5N 5KQ8A 1Q9XA 3QIOA 3AVAA 4EZ9A 2YNFA 3V1RA 2DTUA 4B1ZA 1GOCA 4K42A 3CJ7A 4DTJA 1BO5O 1UAXA 1KVCA 3VQ6A 3VEOA 3E9PA 4BGBA 4FJKA 1SL0A 4CJ7A 4CIGA 4DF4A 2BH1A 2FSNA 4DG1A 1Q81O 4DV6K 4H5VA 3PIPL 4LD0A 1T6CA 4CJRA 3KKSA 1W97L 4AM7A 5LMNK 2Q3SA 4BY9C 1HNXK 3BZKA 1EWQA 2A1SA 4O8UA 3SQ4A 3MX2A 4KAZA 4YOWA 3MN6A 5M1KA 3DWLA 1BI4A 3IKMA 3TSQA 3NMUA 1VRUA 3WEEB 3CPEA 1JCFA 3E9LA 1C1BA 5HRSA 2PZSA 3HSTB 3WXIA 2OPPA 3B8AX 4CK3A 2IGIA 3DMJA 3CJ1A 2UUBK 2O8EB 1RT5A 3CYMA 4DV2K 4I2PA 1GOAA 2QWMA 2VWKA 4BR5A 2E2NA 3L2UA 4JHDA 3LWLA 4FJJA 3U6FA 2QWRA 3BF3A 3MDQA 1VAZA 3OYDA 3P38A 3TABA 4MQ3A 2KHOA 4BRDA 4I6MA 1B9FA 2QWOA 2V52B 4I2QA 2V51B 5KPZA 2F7TA 3DLGA 4AHUA 2OTLN 4ELTA 3MX5A 4E1MA 4X65K 4E1NA 2P9KA 4DV3K 1OH7A 3DYAA 3MXIA 4KH4A 4H03B 2YNHA 2ZWHA 1YAGA 4LFCK 3CFPA 5JVGL 1D4XA 3SBTA 4HWIA 4CZEA 4ELVA 5F0XA 3C6AA 5ADXH 5CE3A 1W2BM 3SK3A 3V6DA 1WSEA 1NGCA 1HRHA 1SL1A 1ZBUA 3K9KA 3VETA 1WSJA 4A2BA 1WSIA 1V4SA 1YT3A 4MDAA 3QINA 1NK4A 4DS4A 3G10A 2VGNA 1OVQA 2YNGA 3VQPA 4FOEA 1LWFA 4BDZA 1QQNA 4LFAK 4CHOA 4GVEA 4KPYA 4BRMA 1WSHA 4I9LA 4B8AB 1RT1A 3C0BA 2B4JA 3H3OB 4B3SK 3CCUN 4IKFA 4CHNA 3QBXA 1ITGA 3KD5E 1VQKN 5JLHA 3C94A 4BVOA 3BGRA 3S3MA 4B1XB 3AO5A 1JJ2M 3ULEA 2VQEK 1XHXA 1YIJN 2D0OA 4DR6K 4AQYK 3JS6A 2E1YA 2GWKA 3VGMA 4LY7A 1GLAG 2OPSA 2WOMA 1NJZA 3K0SA 4IFYA 3G71N 1XHZA 4E7KA 1MA9B 4IFEA 2IVPA 1CXUA 1VHXA 4JKGB 3CCMN 3EY1A 4DQPA 4BR0A 1J53A 3RMBA 4I7FA 3O9TA 3I8BA 2YNIA 3NH1A 4AH9A 4DFJA 1H1VA 2E2PA 4IG0A 1DLOA 4OGCA 3QEPA 4ID1A 2P9NB 4FVUA 4F2SA 2OYQA 3CD6N 3QEVA 1VQ7N 4OPKA 3UKRA 4MLEA 4YHHK 1RTJA 1OKJA 4IFVA 4BRGA 4KHYA 3EE9A 3HBTA 3ZSXA 2Y1IA 2W42A 5FPMA 1NK8A 4DFMA 5CR4A 3WXMB 5FRNA 3KLFA 2UUAK 1GLEG 4CEZA 2F4VK 5GINA 1S9EA 1U6ZA 5SZTA 3EN9A 4BG8A 1S5JA 1HKGA 4EHUA 3LP2A 3V81A 1I94K 2BUPA 2P9UA 4H0OA 3TANA 4DV4K 4N41A 1R0AA 4FK4A 3W0LA 1VSDA 3ZEUA 1J6ZA 4JK7A 1CZAN 1N8RO 1CXQA 2AJQA 4B9SA 3I0RA 3F9MA 4CZHA 1DTQA 3HPOA 5BPNA 2DFEA 3VQ9A 4O0JA 4AHSA 3R1XA 1BGXT 3OS1A 2P9SB 3MWTA 3DXMA 3TAMA 2G8UA 3SUPA 1WBDA 4CGHA 4FO0A 3VQ4A 1TGOA 2GX9A 1RBTA 3HOTA 3THYA 3J7AP 4EP5A 3D2EB 3AVBA 3QNOA 1XMQK 4JN4A 5AZIA 4NYNA 1Z6RA 1MU2A 3FZLA 1Z05A 4PL7A 1KXPA 1T6DA 1EQYA 2IAJA 2D5RA 3KWIA 3U9DA 3G6EN 2O8FA 5BRDA 2PYJA 4O8KA 4M7XA 4CEQA 1NNEA 3O4QA 5EXWA 2FSKA 5GAEP 2QW9A 1CZBA 5GAHP 4JD2B 1D9DA 3CCEN 4JS5A 4AF1A 4OPHA 3R6MA 2KZZA 3W3DA 3UE5A 3J81O 2WBNA 1KLMA 3HZ6A 1VQ8N 3HSCA 3RR7A 3ZT2A 4Z0UA 4JKBA 4JRPA 4AILC 1U49A 1LW0A 3PLAA 4DSJA 2UXDK 2A40A 1UOCA 3IFRA 2XO7A 3NHGA 3AVNA 3NF8A 5M1OA 2ZJRL 1GOBA 2YKMA 4LF9K 2XRIA 3OJSA 3SJHA 3AA2A 2EHGA 1TVRA 4A59A 2ASMA 4CGGA 1WUAA 3ASMA 3MK6A 4E19A 3M8PA 3BDPA 2F96A 4MO5A 4MFBA 5D3GA 1U47A 4BC5A 4CI6A 1G15A 4M42A 2JWLA 3LAMA 4XH1A 4DTOA 3C7NA 4C8LA 2NRTA 2P9IA 3OHRA 2YX6A 2BTFA 3PX0A 4CD1A 3ZX3A 3QEIA 3GBTA 1E3MA 1Q7YO 4BRCA 4PKHA 3AO3A 4FZYA 3OTOK 2FF3B 4JHDB 3P31A 3SAFA 3SQ0A 4B3RK 1XC3A 3LWMA 3HVRA 4CJ3A 2Z1GA 2UUCK 4HTLA 3S3OA 2ZGZA 1EXQA 4I6MB 2NRXA 3ID6A 4FM2A 4EFHA 3AGRA 3VQ5A 1KFDA 3QEWA 4BRQA 3KK7A 2G8KA 1TV6A 1WLJA 3FZHA 4Y1DA 5JLFA 3JAMO 2P9KB 1XWLA 4CGJA 1QZ6A 5KTQA 4L8RB 4F2RA 3TARA 1NGEA 3PX4A 3CPWM 3DOKA 1SZ2A 5ADXA 1KAYA 3GG4A 2IOCA 3H1QA 3VQDA 2ZJPL 4LF8K 1C0UA 4XEIA 3A5OC 3H45C 2AA4A 1ATRA 4YOTA 1NWKA 3AVMA 1FKPA 3PSFA 3O9SA 1Q86O 3THVA 3MEEA 4G9ZA 4MDBA 4YY3K 2HMIA 3V9SA 3V9ZA 4BACA 4IO9L 1RGIA 4Y1CA 4KFBA 3TAPA 1SKRA 3I55N 1ZBIA 2FF6A 4RW7A 4H0XB 3HM9A 1NK0A 4DCHA 4CHPA 4DR7K 4B9TA 5AQUA 4CW7B 1K8KA 1ZBHA 2QWPA 2UU9K 2HVIA 3VENA 4M3WA 1VQ9N 3TTFA 3AVGA 2E88A 3KTQA 3QMLA 1ATNA 4ISFA 2XY7A 1BG3A 2D0BA 1U48A 1QVGM 1J54A 3VESA 3TAEA 4PKIA 1HYSA 4XH5A 3SCXA 1QHAA 1BISA 4B9VA 2QI2A 4CZIA 5J2PA 3L4IA 5LMUK 5BN8A 1RBVA 5HRNA 4WFBL 4KHUA 4DQSA 4Y0WA 3VTIA 3AO2A 3ENBA 4ID5A 1LCUA 3CC2N 3HXMA 1ZC6A 4K25A 1WOQA 1T44A 1HPMA 1D8YA 5MLCQ 3B6PA 3TPQA 4LF4K 1BIZA 1SUQA 4N76A 2O8CB 4UQGA 1N32K 1KVAA 5GIPA 1HYZA 1HLUA 3CJ9A 2XHBA 2HVHA 3OYNA 1E4GT 4C1NI 4H0YB 3H3NO 3TTCA 4E0DA 3K58A 2CH6A 2P9UB 1JKHA 1BWFO 3EZWA 1T03A 3KLEA 4NCBA 3QERA 4C8NA 3ZT0A 3WXJA 3GL1A 3ZEUB 3TSPA 3SQ1A 4X66K 2FLOA 5KI6A 1RDBA 1RTHA 5KPTA 3CJBA 3SLCA 3ZT1A 2HHSA 1JL2A 4BGAA 1NKCA 4FJ5A 2QM1A 4WQ4C 1X1PA 5IT9O 5M1PA 4PHTX 3CFRA 4BE1A 3NVKA 1D9FA 3PUFA 3MEDA 3DXMB 4JAXA 1WAFA 4F3OA 5AQHA 5AQIA 2YHWA 1EP4A 3U4LA 4C8KA 5I42A 4BRIA 3TI0A 5C42A 1RDWX 1B9DA 1BU6O 2OPQA 2VWBA 3IG1A 4CEAA 3H6EA 3LANA 5C25A 5AZIB 3AA3A 3P5JA 5BRHA 5AZJA 1NGFA 3M1FA 4E3SA 1QZ5A 4FYDA 1X9SA 2ZD1A 5DK5A 4DB3A 2O8FB 1JCGA 1FXXA 2HBJA 5JS2A 4PUOA 3VQCA 2X74A 3D45A 4BRKA 4W5QA 1NOYA 4BC4A 1IBMK 4LH4A 4BDYA 4N47A 3AY9A 1TK5A 1XNQK 2LSNA 4ELUA 4A61A 4FJGA 1IH7A 4ISEA 4ILGB 3O1BA 3EEQA 4CJWA 2I5JA 4ILHA 4KHQA 4FM1A 3QICA 2HOEA 3OBYA 1L5UA 3AVIA 1JL1A 2UXBK 2G8VA 4RTFD 1BA1A 3HK2A 1WB9A 4FL9A 1XUPO 4HVJA 1RT4A 5SWMA 2ASOA 4CF2A 1FJGK 4BC2A 4FLVA 4IXCA 2OA8A 4B9MA 3ZETA 2UYTA 4O55A 4DTXA 2HSTA 1UA0A 3LP1A 3H08A 1YJNN 2HBMA 4CERA 3V9WA 3E9OA 4M3YA 3T7ZA 4K43A 3A8YA 2FBXA 4M3RA 5KRTA 1S22A 3QDKA 2D0PA 2HF3A 2KKZA 2WC9A 4BRFA 5DM7L 4B3MK 1QHTA 3LM2A 4KH5A 4BRLA 3JXUA 1KD1O 4BR4A 3AV9A 3LZJA 1NJXA 4FXDA 3CC4N 1VSEA 4LSLA 3THXA 1IBKK 3FZFA 1M1KO 4EZ6A 1A5VA 3SQ2A 4M3ZA 3VGKA 3VN5A 3C7NB 2NNWA 2P9IB 4FJ8A 4DTPA 4DU3A 5AR0A 3KLGA 4H0TB 3MN9A 3HPHA 4M3UA 1MWMA 4CIEA 1YTAA 1ZBFA 4A57A 4DSLA 3KVGA 2ITGA 3IAYA 4YDUC 1DT9A 2QXLA 4XH4A 4BRNA 1T8EA 3O4WA 4BVPA 1NGGA 3SJJA 1JCEA 3RVCA 1EO1A 5BR9A 3S3NA 4PKGA 2FXUA 1C0MA 3O9UA 1U2VA 2PBDA 3KKRA 3SMSA 1WBBA 4BG9A 2XY5A 1NGIA 5LL6Z 3BP8A 2BANA 3O8MA 1VQPN 4DF8A 1TKXA 2VGMA 1X9MA 4CJEA 4Z4HA 3QO9A 1QQCA 2P5OA 1S6PA 3FFKB 4NO7A 4CCHA 3MWPA 4J8FA 4H4OA 1ESVA 3AA4A 5LJVA 1HPZA 2Z1JA 2HHTA 2JLEA 4M45A 3VA0A 5HBMA 2IDOA 3R9PA 4CF0A 1W9HA 4FWNA 2VQFK 4R5PA 5EY4A 3DRRA 4ISGA 3VEVA 3A2FA 4FJ9A 3MCAB 3JSMA 1KC8O 3F2KA 4K0KK 2XY8A 1K8AO 5C24A 3P83D 3GOIA 3TAQA 2VYPA 3K5MA 3RRHA 1NGHA 3THWA 4HCCA 4CFBA 2ITMA 3DRPA 4OO1J 5TKYA 4CJLA 3ZLJA 1N36K 4HCBA 2A6AA 2QKKA 1P8ZA 3V4IA 4CHYA 3UKUA 3CJAA 4H5WA 2HNYA 3OYBA 5HP1A 5BN9A 1IG9A 1SV5A 5CYMA 2E8AA 3RWUA 4E89A 3FLCO 4F8RA 4FK2A 3J8AA 5AQKA 1GLDG 1NM1A 4CHQA 5AFUH 4X62K 3ZCMA 2IS3A 4CBWA 1VQMN 4W5NA 1IO2A 4UY8O 4KHWA 1S1UA 3T3FA 4CHZA 2ZGYA 1YVNA 4EAHD 4FJLA 3ULDA 3HTVA 1EWRA 3SAGA 3O80A 4DWIA 1RTIA 1DEJA 4GNIA 4IBNA 2YHBA 3SAHA 4PA1A 4TSXA 1VQLN 4GKJK 4DTUA 4ZHRA 2BE2A 4JKCA 5KGWA 3V1QA 5H1SQ 1S72N 4WCEL 1HNIA 4JI0K 3DJCA 4BR9A 2NRVA 5ELZA 1HJRA 3P1GA 3T1AA 1HX1A 4BWMA 1GLBG 3KZBA 1KLNA 4AHCA 4JI1K 4OPAA 3FFIA 3VEWA 2HF4A 5AQMA 5HRPA 3ATUA 3D2FA 1YTUA 1YF5L 3ZSWA 3SUNA 3SPZA 1QS4A 3NGYA 3DLBA 4BC3A 3OY9A 4FPBA 2RE2A 1LV5A 4NXNK 3R3LA 3NBPA 1IKVA 4JEPA 1BDGA 2DFHA 4Q5VA 3ZYYX 4BRPA 4PQUA 4Z4CA 1RBUA 4OKJA 3K5LA 4XIUA 3LDNA 3FGUA 1MWKA 5EVZA 4DUZK 1KVBA 4KRFA 5IWAK 1SS6A 5AZJB 4C8MA 1TKTA 3MAQA 4E7LA 5HROA 1FK9A 1LOTB 3LM9A 2FBTA 1Q9YA 3R8EA 4FLTA 2PAVA 4CIFA 3M8SA 3C6TA 4DR2K 3VEYA 5JMVA 4FSVA 4CK1A 4M3TA 3VQBA 3O6WA 4WF9L 2GUIA 2V7YA 3L4QA 4CGFA 4CZJA 2ASPA 4FJXA 4CF9A 5FPEA 3G25A 5CHIA 1EETA 3LDLA 3L6QA 2HW3A 3UB5A 2ATQA 1G99A 5FRMA 1NKEA 2NRWA 3AVCA 5A2QO 3DLLL 4CEOA 3E01A 4CJQA 3L2RA 3WNEA 4GY2B 4B1WB 5HL7L 3SPYA 2X6NA 3LL3A 3O5BA 3HPGA 4FCYA 4CEFA 2KLAA 2OCEA 3CCQN 1RCHA 4MLHA 2YV0X 1BI4B 3LDQA 3CQYA 2OZMA 1NMDA 1W0HA 1WSFA 2KTQA 4IJAA 1O13A 2VG7A 3KK1A 1Y64A 4QS7A 1N33K 1YJ9N 3E1YA 1FKOA 3H46O 4LF6K 3NH0A 4NLCA 1NKBA 4F4KA 3DLHA 3EKUA 4DTNA 3CHWA 1OH5A 1VQNN 2VG6A 3HI0A 3L2WA 4K41A 2FC0A 4CBUA 1GLCG 3IUCA 3AVKA 4CESA 3CQ8A 4B1YB 5I3UA 1JLAA 1TUUA 4FWMA 5E41A 1C0TA 4CZLA 3QNNA 4DV7K 4QOZB 3WNGA 3K5NA 1NK7A 2E2OA 4C1NK 4DQRA 4DFPA 1LAVA 3TTDA 3K2PA 1IJJA 1RT2A 1VQON 1A5XA 3VQEA 1RT3A 4BROA 3TSUA 4NCGA 3RMDA 3QEXA 2UXCK 4HUEA 3C6HA 4GW6A 5T7BA 3A0IX 1U2VB 4E7IA 3OYIA 4AHTA 4W5RA 4YOUA 3PY8A 3FR0A 2J4RA 1VSHA 1RT6A 4K8XA 1M90O 2BDPA 2Q36A 3MN5A 3ZT4A 1QQMA 3KIOA 2B5JA 2ZF5O 1IBLK 5AQOA 3OYHA 4DV5K 3VA3A 2KFZA 3DXKA 2HMPA 4OLAA 3A5LC 3O3FA 1JLBA 4QS8A 4W5TA 3ULEB 3HO1A 5FROA 1RDDA 4DFKA 2VG5A 3MMVA 2RN2A 3P39A 1VSLA 1JLEA 3HOSA 4AHVA 3NGZA 4DR5K 3VQAA 2NRRA 4W5OA 1D5AA 4BRHA 2A42A 4EP4A 1HUXA 4OPJA 3NCIA 1S1TA 2NUBA 1ZYQA 1QTMA 4V19S 1TYQA 3NDKA 2KQ2A 2HHUA 3THWB 1I39A 3UIQA 4IEEA 3HM8A 1EKEA 2FBVA 4NB4A 4KHNA 3MXJA 2P1JA 1HNVA 3UKUB 4FLWA 4GV9A 5CZ1A 1NGDA 2QWNA 3SYZA 1YI2N 2W6KA 1XNRK 2ZQBA 1P90A 1BUPA 4JLHA 3O3HA 5AJ3K 3EL2A 4DTSA 4CJVA 2A1RA 4KREA 3UKRB 5FPDA 3WQTA 3D0PA 1HKCA 2QXFA 4JKHA 1NGJA 1UWBA 4Z94A 4FWPA 3I8DA 1KQSM 4WQ5C 2G8IA 1RFQA 3KJVA 1NBWA 1NJYA 2I7NA 3TWHA 1BOTO 1NU0A 3A5MC 2GTDA 2Q31A 4DMNA 4O5BA 2JGUA 4IOXA 5AQSA 3IDHA 3EYZA 1QE1A 2OPRA 5AQNA 4RCHA 4CGIA 4H5RA 5GAGP 1JLFA 5AQZA 4CFCA 1SQKA 2Z1IA 2RKIA 4KHSA 2RHKA 2QK9A 5B8HA 2IVOA 4OKKA 2E20A 4WQ4A 2IIRA 3VQQA 5KRSA 3T1YK 5EOYA 4Z4FA 1J5EK 2NLXA 5AQFA 1IG8A 1TK8A 1C0FA 3WUHA 3F5TA 4BDPA 2XY6A 1NGBA 5FPNA 5AQWA 3GDQA 1JLCA 3BZCA 3SI6A 2P9LA 3MCPA 1C0GA 2G8HA 3V9UA 4FWKA 3PX6A 1B92A 2GV9A 3D2FB 2IC3A 3THYB 1HQUA 4BE0A 2CGLA 3RMAA 2YHYA 3ISNC 1HMVA 1TL1A 3A5NC 4LC9B 1HQEA 4B9QA 2V7ZA 4JI2K 4H0PA 3OYJA 4DUYK 5AQVA 1TK0A 1OVYA 4YFUA 1J5OA 3AVFA 1L3TA 1JLQA 4M7YA 1IKYA 2D0AA 3CJCA 1CZ9A 4WE1A 4GV3A 3CERA 3CCVN 3DAWA 4CBXA 5AQGA 4AM6A 4BWJA 3Q7BA 3ZSQA 2HNZA 2FSJA 4K8ZA 1WN7A 2KZMA 2ZM6K 5HOOA 5C10A 3Q7CA 1X9WA 4FM0A 3N4PA 3P4IA 3QFUA 1KAZA 4JKEA 3L0QA 4BREA 1HNZK 1Z25A 3VQ7A 3E66A 4CZFA 2GELA 1JLGA 1XI1A 4GV6A 4NYFA 5AQJA 3H1VX 2QTDA 3PO5A 2OANA 4B08A 4DR4K 2Y1JA 4B8CA 2CGKA 4DTMA 3QB0A 4FWQA 4YOVA 2WTUA 3D7EO 1I3AA 4DR3K 3I56N 5E84A 2E6MA 2O8BA 4MO4A 3ID8A 5J2QA 1S9GA 4YORA 3C65A 1BL3A 3CCJN 3L8BA 4CJFA 2VWJA 3SNNA 4KHPK 3OYMA 2KW4A 4GMJB 2Z1HA 1ASVA 1XQSC 4Z4EA 3ALYA 3K9JA 3U9ZA 1YVUA 1S1VA 4BQZA 4E7JA 1VQ4N 4M41A 4IDKA 3C6UA 1LWEA 4JI8K 4I9QA 3LPTA 3CF5L 3NF6A 3SUOA 1QSYA 3OYAA 2CH5A 4KV8A 1XC9A 4B9LA 3KD1E 4YDUA 3CI5A 1XMOK 3SBGA 1NJIO 3I33A 4YOYA 3HYFA 3AO4A
chains in the Genus database with same CATH topology
1L3UA 1HJRA 3AO3A 4CFDA 4FZYA 2ETJA 2D0CA 1IKWA 3MECA 3P1GA 3T1AA 5K14A 4BWMA 3F73A 1L3VA 3SQ0A 4G1QA 3HVTA 2R7YA 1KCFA 1VSKA 3LWMA 3ZSZA 4CJ3A 3HVRA 2Z1GA 1KLNA 3I0SA 1ASWA 1RBRA 4AHCA 3LP3A 2X78A 4CECA 3CFOA 4DU4A 3S3OA 3FFIA 1EXQA 4KI4A 5HRPA 4IG3A 1YTUA 1ASUA 4FM2A 3ZSWA 3K59A 1LW2A 3S9HA 3VQ5A 1KFDA 1Y97A 2DY4A 2KFNA 3QEWA 4E7HA 3SUNA 2EX3A 3SPZA 4OVLA 1KTQA 4KO0A 1TV6A 2G8KA 1KSPA 3DLRA 1WLJA 1QS4A 3DLEA 3NGYA 4Y1DA 1SKSA 3DLBA 4CEDA 1XWLA 4CGJA 2QKBA 4L8RB 5KTQA 1BCOA 4FLXA 3TAGA 3OY9A 3TARA 3PX4A 4F2RA 4N56A 3DOKA 1LV5A 3RR8A 4J2AA 1BQMA 2IOCA 3VQDA 4ICLA 1C0UA 3NBPA 5J2MA 1IKVA 2DFHA 4FJIA 1ZBLA 3AVMA 4Q5VA 1F21A 1FKPA 3ZSOA 4PQUA 4Z4CA 1RBUA 4OKJA 3K5LA 4DQQA 3THVA 4XIUA 1WAJA 1NJWA 2G8WA 1IKXA 3NE6A 3NGIA 3MEEA 1EX4A 4RW6A 4O0IA 4CEBA 3M8QA 4DSIA 1T05A 2HMIA 3WNFA 1KVBA 4FJ7A 4KRFA 3V9SA 3V9ZA 3U3YA 3T19A 4BACA 4C8MA 2OZSA 1TKTA 1VSJA 4Y1CA 3MAQA 4E7LA 2DFFA 4KFBA 5HROA 1FK9A 3TAPA 1SKRA 4RW7A 4KI6A 1A5WA 3CG7A 3LAKA 4ZTJA 2FBTA 1ZBIA 3K5OA 1Q9YA 3AA5X 2P5GA 4FLTA 3RMCA 3HM9A 4CIFA 4KTZA 3C6TA 3M8SA 3QIPA 1NK0A 3EZ5A 4FJMA 4CK1A 1LWCA 3QETA 4CHPA 4M3TA 3VQBA 5KGXA 1NK5A 2FBYA 3NAEA 4B9TA 2GUIA 1ZBHA 3NH2A 2HVIA 3B6OA 4CJ4A 4M3WA 2YKNA 3CM5A 4CGFA 3KLHA 4FJXA 3AVGA 1NOZA 3ITHA 4CF9A 3KTQA 1T7PA 1BHLA 3OVNA 1WSGA 2XY7A 3KLIA 2D0BA 4BE2A 1EETA 1NK6A 1U48A 1Q9XA 2HW3A 1J54A 2O4GA 2ATQA 3TAEA 5FRMA 4FVMA 3RRGA 1HYSA 1NKEA 4CE9A 3QIOA 3OYLA 3AVCA 3AVAA 4EZ9A 2YNFA 3V1RA 2DTUA 1UA1A 1GOCA 4DTJA 3SCXA 1KVCA 1UAXA 3VQ6A 4FLYA 4CEOA 1TAQA 4CJ5A 3E01A 1BISA 4DS5A 1S1WA 4B9VA 4FJKA 1SL0A 5HRRA 4CJQA 4CIGA 4DF4A 3QESA 5J2PA 4DG1A 3L2RA 3WNEA 4LD0A 4CJRA 1RBVA 5HRNA 3KKSA 3LDSA 4DQSA 4KHUA 2F8TA 3AO2A 1KRPA 3SPYA 2X6NA 4ID5A 2Q3SA 4HUGA 3HPGA 3TR8A 2A1SA 4FCYA 4CEFA 3HXMA 3SQ4A 4F3TA 4OJRA 4KAZA 1RCHA 4N5SA 1D8YA 3V9XA 4FZZA 1S6QA 4FLZA 2ZE2A 3B6PA 1BI4A 1RBSA 2YV0X 3OYKA 1VRUA 5HLFA 1TKDA 1BI4B 2F8SA 2OZMA 1W0HA 1BIZA 1C1BA 1DTTA 5HRSA 2PZSA 1WSFA 1QSLA 1SUQA 4YNQA 3HSTB 4N76A 2KTQA 4UQGA 3IRXA 2E4LA 2OPPA 2VG7A 4KTWA 3KK1A 4CK3A 1BIUA 1KVAA 2IGIA 3DMJA 1HYZA 1FKOA 1K6YA 2XHBA 1RT5A 3CYMA 2HVHA 4I2PA 1GOAA 3NH0A 3OYNA 1U45A 2VWKA 1NKBA 4F4KA 3DLHA 3BDPA 3L2UA 1BCMA 3LWLA 4DTNA 4FJJA 3U6FA 2VG6A 4E0DA 3L2WA 3HJFA 4J2BA 3OYDA 2FC0A 3K58A 2PYLA 3TABA 4MQ3A 3AVKA 4CESA 1JKHA 3CQ8A 3CM6A 3IS9A 1T03A 5JS1A 3KLEA 1JLAA 1B9FA 3QERA 5I3UA 4NCBA 5FDLA 4C8NA 4KHWA 3ZT0A 4I2QA 5E41A 1RDAA 1C0TA 3DLGA 4AHUA 4CJUA 3DM2A 3OYEA 3QNNA 3SQ1A 4ELTA 4QOZB 3WNGA 3HT3A 4E1MA 1VK0A 4OKEA 5CZ2A 3K5NA 1NK7A 5KI6A 1RDBA 1RTHA 4E1NA 3AVJA 3ZT1A 3DYAA 4DSFA 3MXIA 2HHSA 1O1WA 1JL2A 1NKCA 2YNHA 4DQRA 2G8FA 4DFPA 4FZXC 4FJ5A 1LAVA 3CFPA 1X1PA 4ELVA 4J2DA 4PY5A 3CFRA 3K2PA 3L2VA 4BE1A 1RT2A 1D9FA 3PUFA 2RF2A 3MEDA 3V6DA 1A5XA 1WAFA 3VQEA 4CJKA 4F3OA 1RT3A 1EP4A 1WSEA 4B9UA 1HRHA 1SL1A 1ZBUA 4NCGA 4C8KA 1WSJA 3RMDA 3QEXA 1WSIA 4KB0A 4HUEA 5I42A 3TI0A 2HHXA 1YT3A 5C42A 4GW6A 5T7BA 5CYQA 1REVA 5DMRA 3OYGA 3QINA 3KK3A 3K57A 4DS4A 4E7IA 1NK4A 1B9DA 2OPQA 1VSFA 3G10A 3IG1A 4CEAA 2YNGA 3LANA 3VQPA 3OYIA 3JYTA 4AHTA 5C25A 4W5RA 1LWFA 3PY8A 4BDZA 3AA3A 3P5JA 3VQ8A 2HB5A 3HP9A 1VSHA 3QLHA 4LH5A 4E3SA 2O4IA 1RT6A 4CHOA 4K8XA 4FYDA 1X9SA 4KPYA 1C1CA 2BDPA 1WSHA 2ZD1A 4I9LA 5DK5A 3ZT4A 4B8AB 1FXXA 1RT1A 2GBZA 3KIOA 5JS2A 2B5JA 1QSSA 2HHWA 2B4JA 4PUOA 3VQCA 2X74A 3D45A 4W5QA 1NOYA 3OYHA 3VA3A 4IKFA 2KFZA 4OGEA 4CHNA 1ITGA 3KD5E 4LH4A 4BDYA 4OLAA 4CJPA 3C94A 4N47A 3BGRA 4LSNA 3O3FA 4HHTA 3S3MA 4FW2A 2B6AA 3AO5A 1JLBA 1TK5A 2LSNA 4W5TA 4CJTA 4ELUA 1XHXA 4FJGA 1IH7A 3HO1A 1RT7A 1RDDA 3DOLA 3NF9A 5FROA 2VG5A 4DFKA 4CJWA 2I5JA 2RN2A 1VSLA 1JLEA 4KHQA 4FM1A 4FK0A 1HYVA 4AHVA 4LY7A 3NGZA 3MXMA 2OPSA 2WOMA 4RW4A 1NJZA 4IFYA 4O44A 4RW8A 4DLGA 1L5UA 3AVIA 1XHZA 3OS0A 1JL1A 3VQAA 4E7KA 3PO4A 4W5OA 1D5AA 3RTVA 2G8VA 3AO1A 4M3XA 1CXUA 3HK2A 4EP4A 4DQPA 3EY1A 4OPJA 3NCIA 1J53A 3RMBA 4I7FA 3NF7A 1S1TA 4HVJA 2NUBA 2YNIA 3AVLA 1RT4A 3M8RA 1ZYQA 5SWMA 3NDKA 1QTMA 4FJHA 3NH1A 2KQ2A 2HHUA 4AH9A 4CF2A 4DFJA 4IG0A 1I39A 2HHVA 1DLOA 3UIQA 4ZTFA 1TL3A 4OGCA 4FLVA 1EKEA 1JXBA 2FBVA 3QEPA 2E6LA 2OA8A 4KHNA 4ID1A 3OS2A 4B9MA 3MXJA 4O55A 2P1JA 4B9NA 1HNVA 2BGGA 4F2SA 4DTXA 2OYQA 4FLWA 1UA0A 3LP1A 5CZ1A 3H08A 3QEVA 3SYZA 1SKWA 3V9WA 4CERA 4CF1A 2ZQBA 3OYCA 4M3YA 4JLHA 3O3HA 4DLEA 4W5NA 4OPKA 1N6QA 4DTSA 2FBXA 4M3RA 4CJVA 4HUFA 2A1RA 4KREA 1RTJA 4IFVA 5KRTA 3OJUA 1S1XA 4KHYA 1QHTA 3ZSXA 3D0PA 2Y1IA 4Q0BA 1TKZA 2W42A 2QXFA 3ZSRA 1UWBA 4HTUA 3I8DA 1NK8A 2G8IA 1BQNA 4DFMA 5FRNA 3KJVA 3KK2A 4JRQA 1NJYA 3AV9A 3G0ZA 4CF8A 3KLFA 3LZJA 3TWHA 4CEZA 1JXEA 1NJXA 5SZTA 1S9EA 4DMNA 4FXDA 1S5JA 1VSEA 4LSLA 4O5BA 2JGUA 3LP2A 3V81A 4EZ6A 1NK9A 1A5VA 3EYZA 3SQ2A 4Z4IA 4FJNA 2YHAA 4M3ZA 1QE1A 2OPRA 3TANA 4CGIA 3VN5A 4DSEA 1R0AA 4N41A 1JLFA 4CFCA 4FK4A 4CEEA 1L3SA 2Z1IA 1VSDA 2RKIA 4DU3A 4DTPA 4FJ8A 4DQIA 4H8KA 4KHSA 3KLGA 2QK9A 4RW9A 4JS4A 3HPHA 1CXQA 4OKKA 1C1AA 4M3UA 2AJQA 3VQQA 4B9SA 5KRSA 3I0RA 3MEGA 4CIEA 1YTAA 1ZBFA 3AVHA 4DSLA 4H4MA 4Z4FA 1DTQA 2ITGA 2HNDA 1TK8A 3HPOA 3IAYA 2DFEA 3VQ9A 4O0JA 4AHSA 2XY6A 1T8EA 1LAWA 4BDPA 4KB1A 1BGXT 3OS1A 3HP6A 1JLCA 3DRSA 3ZSVA 3SI6A 3SJJA 3TAMA 2G8UA 2G8HA 1Q8IA 3OYFA 3SUPA 3V9UA 3S3NA 4CGHA 3PX6A 1B92A 2GV9A 3VQ4A 1TGOA 1RBTA 1SL2A 4EP5A 1C0MA 2IC3A 3KKRA 3AVBA 1HQUA 3QNOA 4BE0A 3RMAA 5EU7A 2XY5A 4NYNA 3ISNC 1MU2A 1HMVA 1TL1A 3DI6A 1HQEA 2BANA 3OYJA 4QCLA 1TK0A 4DF8A 4KTQA 1TKXA 3LP0A 3TAFA 2IAJA 4CGDA 4YFUA 2D5RA 1J5OA 4Z4GA 2HHQA 3AVFA 1VSIA 4O4GA 1JLQA 4RG8A 3SV4A 1X9MA 1L3TA 1IKYA 2PYJA 2D0AA 4CEQA 4CJEA 4Z4HA 3DLKA 3O4QA 4AHRA 1CZ9A 3QO9A 4WE1A 1QQCA 2P5OA 1S6PA 1CZBA 4CCHA 3ZSYA 4PWDA 3SUQA 4DTRA 1D9DA 4H4OA 4JS5A 2RPIA 3AA4A 3SZ2A 1HPZA 3LPUA 3HL8A 2Z1JA 2HHTA 2KZZA 1U4BA 1RDCA 2JLEA 4M45A 3VA0A 4BWJA 1RTDA 4DSKA 5HBMA 1KLMA 2IDOA 3U3GA 3ZSQA 4CF0A 3RR7A 2HNZA 1W9HA 3O4NA 3ZT2A 4K8ZA 1WN7A 2KZMA 1U04A 4Z0UA 4R5PA 3DRRA 1J9AA 3V1OA 1X9WA 4FM0A 3A2FA 4FJ9A 1TAUA 3JSMA 4OLBA 3O3GA 2XY8A 2X6SA 4JRPA 4AILC 5C24A 3P83D 1Z25A 3VQ7A 1U49A 3TAQA 3K5MA 3RRHA 1LW0A 1JLGA 4CFAA 1XI1A 1CLQA 4HCCA 1RILA 4NYFA 4CFBA 4DSJA 3DRPA 1UOCA 3NFAA 3L2QA 3L3UA 4CJLA 2XO7A 3NHGA 1VRTA 3AVNA 3F9KA 3NF8A 5J1EA 2QKKA 4C8OA 4HCBA 4B3OA 3L3VA 3V4IA 1GOBA 2PY5A 3PO5A 4CHYA 2YKMA 2XRIA 3PV8A 2HNYA 3OYBA 4B08A 5CY4A 2Y1JA 4B8CA 5HP1A 4DTMA 3OJSA 1RNHA 3AA2A 3LALA 1IG9A 1SV5A 5CYMA 1I3AA 3C95A 2EHGA 3RWUA 4E89A 3LZIA 4J2EA 1TVRA 2E6MA 4F8RA 4FK2A 1VSMA 4CHQA 5J2QA 1S9GA 3ZCMA 4CGGA 2IS3A 3ZT3A 1BL3A 3L8BA 4CJFA 1IO2A 1WNSA 3ASMA 2VWJA 1S1UA 3M8PA 4E19A 3OYMA 3SNNA 2F96A 2KW4A 4GMJB 2Z1HA 1ASVA 4CHZA 4FW1A 3T3FA 4FJLA 2P51A 3ULDA 4Z4EA 3ALYA 4MFBA 5D3GA 1U47A 1YVUA 1S1VA 4E7JA 4DWIA 3WNHA 1G15A 1RTIA 4M42A 3SV3A 4M41A 1Z26A 4FLUA 2WONA 3LAMA 4IBNA 4KKOA 1KFSA 4GVMA 4IDKA 2YHBA 5J2NA 3C6UA 1LWEA 4I9QA 4CK2A 4PA1A 4DU1A 3LPTA 4TSXA 3NF6A 4DTOA 3SUOA 1QSYA 4DTUA 4C8LA 4ZHRA 2BE2A 3OYAA 5KGWA 1C6VA 3V1QA 4KV8A 4NCAA 1N5YA 4CJSA 1XC9A 1HNIA 4B9LA 3KD1E 3PX0A 4QAGA 3QEIA 3HYFA 3AO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L3U A;  1HJR A;  3AO3 A;  4CFD A;  4FZY A;  2ETJ A;  2D0C A;  1IKW A;  3MEC A;  3P1G A;  3T1A A;  5K14 A;  4BWM A;  3F73 A;  1L3V A;  3SQ0 A;  4G1Q A;  3HVT A;  2R7Y A;  1KCF A;  1VSK A;  3LWM A;  3ZSZ A;  4CJ3 A;  3HVR A;  2Z1G A;  1KLN A;  3I0S A;  1ASW A;  1RBR A;  4AHC A;  3LP3 A;  2X78 A;  4CEC A;  3CFO A;  4DU4 A;  3S3O A;  3FFI A;  1EXQ A;  4KI4 A;  5HRP A;  4IG3 A;  1YTU A;  1ASU A;  4FM2 A;  3ZSW A;  3K59 A;  1LW2 A;  3S9H A;  3VQ5 A;  1KFD A;  1Y97 A;  2DY4 A;  2KFN A;  3QEW A;  4E7H A;  3SUN A;  2EX3 A;  3SPZ A;  4OVL A;  1KTQ A;  4KO0 A;  1TV6 A;  2G8K A;  1KSP A;  3DLR A;  1WLJ A;  1QS4 A;  3DLE A;  3NGY A;  4Y1D A;  1SKS A;  3DLB A;  4CED A;  1XWL A;  4CGJ A;  2QKB A;  4L8R B;  5KTQ A;  1BCO A;  4FLX A;  3TAG A;  3OY9 A;  3TAR A;  3PX4 A;  4F2R A;  4N56 A;  3DOK A;  1LV5 A;  3RR8 A;  4J2A A;  1BQM A;  2IOC A;  3VQD A;  4ICL A;  1C0U A;  3NBP A;  5J2M A;  1IKV A;  2DFH A;  4FJI A;  1ZBL A;  3AVM A;  4Q5V A;  1F21 A;  1FKP A;  3ZSO A;  4PQU A;  4Z4C A;  1RBU A;  4OKJ A;  3K5L A;  4DQQ A;  3THV A;  4XIU A;  1WAJ A;  1NJW A;  2G8W A;  1IKX A;  3NE6 A;  3NGI A;  3MEE A;  1EX4 A;  4RW6 A;  4O0I A;  4CEB A;  3M8Q A;  4DSI A;  1T05 A;  2HMI A;  3WNF A;  1KVB A;  4FJ7 A;  4KRF A;  3V9S A;  3V9Z A;  3U3Y A;  3T19 A;  4BAC A;  4C8M A;  2OZS A;  1TKT A;  1VSJ A;  4Y1C A;  3MAQ A;  4E7L A;  2DFF A;  4KFB A;  5HRO A;  1FK9 A;  3TAP A;  1SKR A;  4RW7 A;  4KI6 A;  1A5W A;  3CG7 A;  3LAK A;  4ZTJ A;  2FBT A;  1ZBI A;  3K5O A;  1Q9Y A;  3AA5 X;  2P5G A;  4FLT A;  3RMC A;  3HM9 A;  4CIF A;  4KTZ A;  3C6T A;  3M8S A;  3QIP A;  1NK0 A;  3EZ5 A;  4FJM A;  4CK1 A;  1LWC A;  3QET A;  4CHP A;  4M3T A;  3VQB A;  5KGX A;  1NK5 A;  2FBY A;  3NAE A;  4B9T A;  2GUI A;  1ZBH A;  3NH2 A;  2HVI A;  3B6O A;  4CJ4 A;  4M3W A;  2YKN A;  3CM5 A;  4CGF A;  3KLH A;  4FJX A;  3AVG A;  1NOZ A;  3ITH A;  4CF9 A;  3KTQ A;  1T7P A;  1BHL A;  3OVN A;  1WSG A;  2XY7 A;  3KLI A;  2D0B A;  4BE2 A;  1EET A;  1NK6 A;  1U48 A;  1Q9X A;  2HW3 A;  1J54 A;  2O4G A;  2ATQ A;  3TAE A;  5FRM A;  4FVM A;  3RRG A;  1HYS A;  1NKE A;  4CE9 A;  3QIO A;  3OYL A;  3AVC A;  3AVA A;  4EZ9 A;  2YNF A;  3V1R A;  2DTU A;  1UA1 A;  1GOC A;  4DTJ A;  3SCX A;  1KVC A;  1UAX A;  3VQ6 A;  4FLY A;  4CEO A;  1TAQ A;  4CJ5 A;  3E01 A;  1BIS A;  4DS5 A;  1S1W A;  4B9V A;  4FJK A;  1SL0 A;  5HRR A;  4CJQ A;  4CIG A;  4DF4 A;  3QES A;  5J2P A;  4DG1 A;  3L2R A;  3WNE A;  4LD0 A;  4CJR A;  1RBV A;  5HRN A;  3KKS A;  3LDS A;  4DQS A;  4KHU A;  2F8T A;  3AO2 A;  1KRP A;  3SPY A;  2X6N A;  4ID5 A;  2Q3S A;  4HUG A;  3HPG A;  3TR8 A;  2A1S A;  4FCY A;  4CEF A;  3HXM A;  3SQ4 A;  4F3T A;  4OJR A;  4KAZ A;  1RCH A;  4N5S A;  1D8Y A;  3V9X A;  4FZZ A;  1S6Q A;  4FLZ A;  2ZE2 A;  3B6P A;  1BI4 A;  1RBS A;  2YV0 X;  3OYK A;  1VRU A;  5HLF A;  1TKD A;  1BI4 B;  2F8S A;  2OZM A;  1W0H A;  1BIZ A;  1C1B A;  1DTT A;  5HRS A;  2PZS A;  1WSF A;  1QSL A;  1SUQ A;  4YNQ A;  3HST B;  4N76 A;  2KTQ A;  4UQG A;  3IRX A;  2E4L A;  2OPP A;  2VG7 A;  4KTW A;  3KK1 A;  4CK3 A;  1BIU A;  1KVA A;  2IGI A;  3DMJ A;  1HYZ A;  1FKO A;  1K6Y A;  2XHB A;  1RT5 A;  3CYM A;  2HVH A;  4I2P A;  1GOA A;  3NH0 A;  3OYN A;  1U45 A;  2VWK A;  1NKB A;  4F4K A;  3DLH A;  3BDP A;  3L2U A;  1BCM A;  3LWL A;  4DTN A;  4FJJ A;  3U6F A;  2VG6 A;  4E0D A;  3L2W A;  3HJF A;  4J2B A;  3OYD A;  2FC0 A;  3K58 A;  2PYL A;  3TAB A;  4MQ3 A;  3AVK A;  4CES A;  1JKH A;  3CQ8 A;  3CM6 A;  3IS9 A;  1T03 A;  5JS1 A;  3KLE A;  1JLA A;  1B9F A;  3QER A;  5I3U A;  4NCB A;  5FDL A;  4C8N A;  4KHW A;  3ZT0 A;  4I2Q A;  5E41 A;  1RDA A;  1C0T A;  3DLG A;  4AHU A;  4CJU A;  3DM2 A;  3OYE A;  3QNN A;  3SQ1 A;  4ELT A;  4QOZ B;  3WNG A;  3HT3 A;  4E1M A;  1VK0 A;  4OKE A;  5CZ2 A;  3K5N A;  1NK7 A;  5KI6 A;  1RDB A;  1RTH A;  4E1N A;  3AVJ A;  3ZT1 A;  3DYA A;  4DSF A;  3MXI A;  2HHS A;  1O1W A;  1JL2 A;  1NKC A;  2YNH A;  4DQR A;  2G8F A;  4DFP A;  4FZX C;  4FJ5 A;  1LAV A;  3CFP A;  1X1P A;  4ELV A;  4J2D A;  4PY5 A;  3CFR A;  3K2P A;  3L2V A;  4BE1 A;  1RT2 A;  1D9F A;  3PUF A;  2RF2 A;  3MED A;  3V6D A;  1A5X A;  1WAF A;  3VQE A;  4CJK A;  4F3O A;  1RT3 A;  1EP4 A;  1WSE A;  4B9U A;  1HRH A;  1SL1 A;  1ZBU A;  4NCG A;  4C8K A;  1WSJ A;  3RMD A;  3QEX A;  1WSI A;  4KB0 A;  4HUE A;  5I42 A;  3TI0 A;  2HHX A;  1YT3 A;  5C42 A;  4GW6 A;  5T7B A;  5CYQ A;  1REV A;  5DMR A;  3OYG A;  3QIN A;  3KK3 A;  3K57 A;  4DS4 A;  4E7I A;  1NK4 A;  1B9D A;  2OPQ A;  1VSF A;  3G10 A;  3IG1 A;  4CEA A;  2YNG A;  3LAN A;  3VQP A;  3OYI A;  3JYT A;  4AHT A;  5C25 A;  4W5R A;  1LWF A;  3PY8 A;  4BDZ A;  3AA3 A;  3P5J A;  3VQ8 A;  2HB5 A;  3HP9 A;  1VSH A;  3QLH A;  4LH5 A;  4E3S A;  2O4I A;  1RT6 A;  4CHO A;  4K8X A;  4FYD A;  1X9S A;  4KPY A;  1C1C A;  2BDP A;  1WSH A;  2ZD1 A;  4I9L A;  5DK5 A;  3ZT4 A;  4B8A B;  1FXX A;  1RT1 A;  2GBZ A;  3KIO A;  5JS2 A;  2B5J A;  1QSS A;  2HHW A;  2B4J A;  4PUO A;  3VQC A;  2X74 A;  3D45 A;  4W5Q A;  1NOY A;  3OYH A;  3VA3 A;  4IKF A;  2KFZ A;  4OGE A;  4CHN A;  1ITG A;  3KD5 E;  4LH4 A;  4BDY A;  4OLA A;  4CJP A;  3C94 A;  4N47 A;  3BGR A;  4LSN A;  3O3F A;  4HHT A;  3S3M A;  4FW2 A;  2B6A A;  3AO5 A;  1JLB A;  1TK5 A;  2LSN A;  4W5T A;  4CJT A;  4ELU A;  1XHX A;  4FJG A;  1IH7 A;  3HO1 A;  1RT7 A;  1RDD A;  3DOL A;  3NF9 A;  5FRO A;  2VG5 A;  4DFK A;  4CJW A;  2I5J A;  2RN2 A;  1VSL A;  1JLE A;  4KHQ A;  4FM1 A;  4FK0 A;  1HYV A;  4AHV A;  4LY7 A;  3NGZ A;  3MXM A;  2OPS A;  2WOM A;  4RW4 A;  1NJZ A;  4IFY A;  4O44 A;  4RW8 A;  4DLG A;  1L5U A;  3AVI A;  1XHZ A;  3OS0 A;  1JL1 A;  3VQA A;  4E7K A;  3PO4 A;  4W5O A;  1D5A A;  3RTV A;  2G8V A;  3AO1 A;  4M3X A;  1CXU A;  3HK2 A;  4EP4 A;  4DQP A;  3EY1 A;  4OPJ A;  3NCI A;  1J53 A;  3RMB A;  4I7F A;  3NF7 A;  1S1T A;  4HVJ A;  2NUB A;  2YNI A;  3AVL A;  1RT4 A;  3M8R A;  1ZYQ A;  5SWM A;  3NDK A;  1QTM A;  4FJH A;  3NH1 A;  2KQ2 A;  2HHU A;  4AH9 A;  4CF2 A;  4DFJ A;  4IG0 A;  1I39 A;  2HHV A;  1DLO A;  3UIQ A;  4ZTF A;  1TL3 A;  4OGC A;  4FLV A;  1EKE A;  1JXB A;  2FBV A;  3QEP A;  2E6L A;  2OA8 A;  4KHN A;  4ID1 A;  3OS2 A;  4B9M A;  3MXJ A;  4O55 A;  2P1J A;  4B9N A;  1HNV A;  2BGG A;  4F2S A;  4DTX A;  2OYQ A;  4FLW A;  1UA0 A;  3LP1 A;  5CZ1 A;  3H08 A;  3QEV A;  3SYZ A;  1SKW A;  3V9W A;  4CER A;  4CF1 A;  2ZQB A;  3OYC A;  4M3Y A;  4JLH A;  3O3H A;  4DLE A;  4W5N A;  4OPK A;  1N6Q A;  4DTS A;  2FBX A;  4M3R A;  4CJV A;  4HUF A;  2A1R A;  4KRE A;  1RTJ A;  4IFV A;  5KRT A;  3OJU A;  1S1X A;  4KHY A;  1QHT A;  3ZSX A;  3D0P A;  2Y1I A;  4Q0B A;  1TKZ A;  2W42 A;  2QXF A;  3ZSR A;  1UWB A;  4HTU A;  3I8D A;  1NK8 A;  2G8I A;  1BQN A;  4DFM A;  5FRN A;  3KJV A;  3KK2 A;  4JRQ A;  1NJY A;  3AV9 A;  3G0Z A;  4CF8 A;  3KLF A;  3LZJ A;  3TWH A;  4CEZ A;  1JXE A;  1NJX A;  5SZT A;  1S9E A;  4DMN A;  4FXD A;  1S5J A;  1VSE A;  4LSL A;  4O5B A;  2JGU A;  3LP2 A;  3V81 A;  4EZ6 A;  1NK9 A;  1A5V A;  3EYZ A;  3SQ2 A;  4Z4I A;  4FJN A;  2YHA A;  4M3Z A;  1QE1 A;  2OPR A;  3TAN A;  4CGI A;  3VN5 A;  4DSE A;  1R0A A;  4N41 A;  1JLF A;  4CFC A;  4FK4 A;  4CEE A;  1L3S A;  2Z1I A;  1VSD A;  2RKI A;  4DU3 A;  4DTP A;  4FJ8 A;  4DQI A;  4H8K A;  4KHS A;  3KLG A;  2QK9 A;  4RW9 A;  4JS4 A;  3HPH A;  1CXQ A;  4OKK A;  1C1A A;  4M3U A;  2AJQ A;  3VQQ A;  4B9S A;  5KRS A;  3I0R A;  3MEG A;  4CIE A;  1YTA A;  1ZBF A;  3AVH A;  4DSL A;  4H4M A;  4Z4F A;  1DTQ A;  2ITG A;  2HND A;  1TK8 A;  3HPO A;  3IAY A;  2DFE A;  3VQ9 A;  4O0J A;  4AHS A;  2XY6 A;  1T8E A;  1LAW A;  4BDP A;  4KB1 A;  1BGX T;  3OS1 A;  3HP6 A;  1JLC A;  3DRS A;  3ZSV A;  3SI6 A;  3SJJ A;  3TAM A;  2G8U A;  2G8H A;  1Q8I A;  3OYF A;  3SUP A;  3V9U A;  3S3N A;  4CGH A;  3PX6 A;  1B92 A;  2GV9 A;  3VQ4 A;  1TGO A;  1RBT A;  1SL2 A;  4EP5 A;  1C0M A;  2IC3 A;  3KKR A;  3AVB A;  1HQU A;  3QNO A;  4BE0 A;  3RMA A;  5EU7 A;  2XY5 A;  4NYN A;  3ISN C;  1MU2 A;  1HMV A;  1TL1 A;  3DI6 A;  1HQE A;  2BAN A;  3OYJ A;  4QCL A;  1TK0 A;  4DF8 A;  4KTQ A;  1TKX A;  3LP0 A;  3TAF A;  2IAJ A;  4CGD A;  4YFU A;  2D5R A;  1J5O A;  4Z4G A;  2HHQ A;  3AVF A;  1VSI A;  4O4G A;  1JLQ A;  4RG8 A;  3SV4 A;  1X9M A;  1L3T A;  1IKY A;  2PYJ A;  2D0A A;  4CEQ A;  4CJE A;  4Z4H A;  3DLK A;  3O4Q A;  4AHR A;  1CZ9 A;  3QO9 A;  4WE1 A;  1QQC A;  2P5O A;  1S6P A;  1CZB A;  4CCH A;  3ZSY A;  4PWD A;  3SUQ A;  4DTR A;  1D9D A;  4H4O A;  4JS5 A;  2RPI A;  3AA4 A;  3SZ2 A;  1HPZ A;  3LPU A;  3HL8 A;  2Z1J A;  2HHT A;  2KZZ A;  1U4B A;  1RDC A;  2JLE A;  4M45 A;  3VA0 A;  4BWJ A;  1RTD A;  4DSK A;  5HBM A;  1KLM A;  2IDO A;  3U3G A;  3ZSQ A;  4CF0 A;  3RR7 A;  2HNZ A;  1W9H A;  3O4N A;  3ZT2 A;  4K8Z A;  1WN7 A;  2KZM A;  1U04 A;  4Z0U A;  4R5P A;  3DRR A;  1J9A A;  3V1O A;  1X9W A;  4FM0 A;  3A2F A;  4FJ9 A;  1TAU A;  3JSM A;  4OLB A;  3O3G A;  2XY8 A;  2X6S A;  4JRP A;  4AIL C;  5C24 A;  3P83 D;  1Z25 A;  3VQ7 A;  1U49 A;  3TAQ A;  3K5M A;  3RRH A;  1LW0 A;  1JLG A;  4CFA A;  1XI1 A;  1CLQ A;  4HCC A;  1RIL A;  4NYF A;  4CFB A;  4DSJ A;  3DRP A;  1UOC A;  3NFA A;  3L2Q A;  3L3U A;  4CJL A;  2XO7 A;  3NHG A;  1VRT A;  3AVN A;  3F9K A;  3NF8 A;  5J1E A;  2QKK A;  4C8O A;  4HCB A;  4B3O A;  3L3V A;  3V4I A;  1GOB A;  2PY5 A;  3PO5 A;  4CHY A;  2YKM A;  2XRI A;  3PV8 A;  2HNY A;  3OYB A;  4B08 A;  5CY4 A;  2Y1J A;  4B8C A;  5HP1 A;  4DTM A;  3OJS A;  1RNH A;  3AA2 A;  3LAL A;  1IG9 A;  1SV5 A;  5CYM A;  1I3A A;  3C95 A;  2EHG A;  3RWU A;  4E89 A;  3LZI A;  4J2E A;  1TVR A;  2E6M A;  4F8R A;  4FK2 A;  1VSM A;  4CHQ A;  5J2Q A;  1S9G A;  3ZCM A;  4CGG A;  2IS3 A;  3ZT3 A;  1BL3 A;  3L8B A;  4CJF A;  1IO2 A;  1WNS A;  3ASM A;  2VWJ A;  1S1U A;  3M8P A;  4E19 A;  3OYM A;  3SNN A;  2F96 A;  2KW4 A;  4GMJ B;  2Z1H A;  1ASV A;  4CHZ A;  4FW1 A;  3T3F A;  4FJL A;  2P51 A;  3ULD A;  4Z4E A;  3ALY A;  4MFB A;  5D3G A;  1U47 A;  1YVU A;  1S1V A;  4E7J A;  4DWI A;  3WNH A;  1G15 A;  1RTI A;  4M42 A;  3SV3 A;  4M41 A;  1Z26 A;  4FLU A;  2WON A;  3LAM A;  4IBN A;  4KKO A;  1KFS A;  4GVM A;  4IDK A;  2YHB A;  5J2N A;  3C6U A;  1LWE A;  4I9Q A;  4CK2 A;  4PA1 A;  4DU1 A;  3LPT A;  4TSX A;  3NF6 A;  4DTO A;  3SUO A;  1QSY A;  4DTU A;  4C8L A;  4ZHR A;  2BE2 A;  3OYA A;  5KGW A;  1C6V A;  3V1Q A;  4KV8 A;  4NCA A;  1N5Y A;  4CJS A;  1XC9 A;  1HNI A;  4B9L A;  3KD1 E;  3PX0 A;  4QAG A;  3QEI A;  3HYF A;  3AO4 A; 
#chains in the Genus database with same CATH topology
 4WFN L;  4CFD A;  5C15 A;  2ETJ A;  2D0C A;  4LF7 K;  3F73 A;  1L3V A;  4X64 K;  2R7Y A;  1KCF A;  1VSK A;  3VGL A;  1X3N A;  3I0S A;  1ASW A;  3LP3 A;  2X78 A;  3CFO A;  3FZM A;  1ILY A;  1ASU A;  1LW2 A;  2OTJ N;  4IOC L;  4DV0 K;  2KFN A;  1MDU B;  4OVL A;  1KTQ A;  4KO0 A;  4QS9 A;  2HBK A;  2WUS A;  4CED A;  3TAG A;  3CET A;  1OH6 A;  3RR8 A;  4J2A A;  3VEX A;  4NLB A;  3S41 A;  1ZBL A;  1F21 A;  2YJF A;  4DQQ A;  1WAJ A;  1IKX A;  3NE6 A;  3NGI A;  1EX4 A;  1T3V A;  4RW6 A;  4O0I A;  1T05 A;  3U3Y A;  3T19 A;  2OZS A;  4PWD A;  1VSJ A;  3KWG A;  5M1F A;  3QBW A;  1A5W A;  3CG7 A;  4ZTJ A;  3K5O A;  3AA5 X;  1YUW A;  2D1K A;  4CZK A;  3QIP A;  3NVM A;  5F1X A;  4FJM A;  4BR7 A;  2EWS A;  5KGX A;  1NK5 A;  1QVF M;  4DR1 K;  4L3Q A;  3B6O A;  3DXK B;  1K8K B;  2YKN A;  3KLH A;  1NOZ A;  3BEX A;  3J7Y P;  1BHL A;  3U8X A;  3OVN A;  1T7P A;  1WSG A;  4BE2 A;  1NK6 A;  3EE8 A;  4JK9 A;  4A2A A;  2O8D A;  4IWV A;  4LF5 K;  2O4G A;  4FVM A;  3RRG A;  2CGJ A;  4CE9 A;  3OYL A;  5M1N A;  4JYA K;  5AQX A;  1UA1 A;  5BRF A;  4FLY A;  1TAQ A;  4CJ5 A;  1ZBS A;  4DS5 A;  1S1W A;  2Q0R A;  2NRH A;  2E1Z A;  5HRR A;  3QES A;  5C0Y A;  2YJE A;  2F8T A;  1TYQ B;  5LY3 A;  3LDS A;  2D4W A;  1KRP A;  1BA0 A;  3CXC M;  4HUG A;  1YHQ N;  3TR8 A;  4F3T A;  2YCH A;  1KAX A;  1Q18 A;  4OJR A;  1HR0 K;  4N5S A;  4H5T A;  3V9X A;  2DPN A;  4FZZ A;  5AQR A;  1S6Q A;  4FLZ A;  2ZE2 A;  1TKD A;  1RBS A;  3OYK A;  2F8S A;  4IEI A;  2NZT A;  4FWS A;  3T1H K;  1DTT A;  2O8C A;  1QSL A;  4YNQ A;  3FE1 A;  3IRX A;  2E4L A;  4LFB K;  4KTW A;  3WXK A;  5KQD A;  1BIU A;  5EX5 A;  1K6Y A;  5KPR A;  4NXM K;  1U45 A;  3PIO L;  1BCM A;  3KHY A;  3O08 A;  3HJF A;  4J2B A;  2PYL A;  2IVN A;  4JKA A;  3MN7 A;  3CCS N;  3CM6 A;  5F2R A;  3IS9 A;  5JS1 A;  3VER A;  4DV1 K;  5GIO A;  5FDL A;  3AAQ A;  1RDA A;  3CQX A;  4CJU A;  3DM2 A;  3OYE A;  1NG9 A;  3HT3 A;  1VK0 A;  1ZXO A;  4OKE A;  2GEM A;  2QWL A;  5CZ2 A;  3AVJ A;  4DSF A;  1O1W A;  3ZX2 A;  4FZX C;  2G8F A;  4KH6 A;  4J2D A;  4PY5 A;  3VMF B;  3L2V A;  1VQ6 N;  2RF2 A;  2P9L B;  4JI3 K;  4CJK A;  1E4F T;  2QWQ A;  4B9U A;  3ATV A;  4KB0 A;  2HHX A;  3OYG A;  5CYQ A;  1REV A;  5DMR A;  3KK3 A;  3K57 A;  1VSF A;  3RSE A;  3JYT A;  3CCR N;  3VQ8 A;  2HB5 A;  3HP9 A;  2P9P A;  3QLH A;  4LH5 A;  2O4I A;  1X3M A;  1C1C A;  5I9E B;  3SMP A;  2GWJ A;  2W41 A;  2GBZ A;  2GUP A;  1QSS A;  2HHW A;  5BPL A;  2JWK A;  4OGE A;  4RWT A;  4U67 L;  4CJP A;  4HHT A;  4LSN A;  4JKD A;  4FW2 A;  2B6A A;  4CJT A;  4IOA L;  1DGK N;  1RT7 A;  3DOL A;  3NF9 A;  2HBL A;  3M5R A;  4BQL A;  4FK0 A;  1HYV A;  4B1V A;  3MXM A;  4RW4 A;  4O44 A;  4A5A A;  4RW8 A;  4DLG A;  3J7Z O;  3OS0 A;  3PO4 A;  1NLV A;  3RTV A;  4M3X A;  4WFA L;  3AO1 A;  1IV0 A;  3AGK A;  3NF7 A;  3AVL A;  3M8R A;  4FJH A;  1TUY A;  2HHV A;  4PL8 A;  3G4S N;  4ZTF A;  1TL3 A;  1JXB A;  3EKS A;  5BRE A;  2E6L A;  3OS2 A;  1S3X A;  4CD3 A;  2A41 A;  4B9N A;  3ZET B;  2BGG A;  5AQL A;  1SKW A;  4CF1 A;  3OYC A;  3WEE A;  4DLE A;  1N6Q A;  4HUF A;  2O8B B;  5C2D A;  3OJU A;  1S1X A;  5DM6 L;  4B1U B;  4Q0B A;  5M1Q A;  1TKZ A;  1YXQ A;  3ZSR A;  4HTU A;  4OX9 K;  2O8E A;  1BQN A;  3KK2 A;  3M3Z A;  4JRQ A;  3G0Z A;  3BF1 A;  4CF8 A;  1JXE A;  2Q1N A;  4CVN E;  2W40 A;  1ATS A;  3THX B;  1NK9 A;  3PSI A;  4Z4I A;  4FJN A;  3AAR A;  2YHA A;  4DSE A;  3VOV A;  2ZJQ L;  3T69 A;  4CEE A;  1L3S A;  3EO3 A;  4DQI A;  4H8K A;  3VF6 A;  4RW9 A;  4C23 A;  4JS4 A;  5AQT A;  1C1A A;  3MEG A;  3AVH A;  3OW2 M;  3GE1 A;  4H4M A;  2HND A;  5LJW A;  1X9J A;  1LAW A;  4KB1 A;  3HP6 A;  2W6L A;  3DRS A;  3ZSV A;  3CIP A;  5AQQ A;  1Q8I A;  4A5B A;  3OYF A;  5JVH L;  5E26 A;  1SL2 A;  4CZG A;  4JI7 K;  4JI6 K;  3IMX A;  5EU7 A;  2I7P A;  3CMA N;  3OA9 A;  2Q0U A;  3DI6 A;  4IDH A;  1K9M O;  4QCL A;  4KTQ A;  3LP0 A;  3TAF A;  4CGD A;  4BR2 A;  4Z4G A;  4GKK K;  5AQY A;  4IJN A;  1VSI A;  4O4G A;  4RG8 A;  3SV4 A;  1FW6 A;  3LDP A;  4JKF A;  3DLK A;  4AHR A;  2QA4 N;  3TU5 A;  3VTH A;  2QEX N;  2YHX A;  3ENO A;  3ZSY A;  3BUZ B;  3SUQ A;  4DTR A;  3ENH A;  3O1W A;  2RPI A;  4FWO A;  3SZ2 A;  3LPU A;  3HL8 A;  4EIA A;  1RDC A;  1U4B A;  3M6G A;  2PFU A;  4WYB A;  4DQ8 A;  1RTD A;  4DSK A;  4JV5 K;  4FPA A;  3U3G A;  5BPM A;  3O4N A;  4O5F A;  1U04 A;  5TKW A;  1J9A A;  3V1O A;  1TAU A;  3VEZ A;  2AP1 A;  1N34 K;  4OLB A;  3O3G A;  2X6S A;  4JKG A;  1SAZ A;  1NGA A;  4EHT A;  4CFA A;  2VCP A;  5C12 A;  1CLQ A;  1RIL A;  4JK8 A;  3NFA A;  4B3T K;  3L2Q A;  3L3U A;  2O8D B;  2P9N A;  4FWR A;  1VRT A;  3F9K A;  5J1E A;  4C8O A;  4B3O A;  3WXL A;  5C2F A;  3L3V A;  1K73 O;  2PY5 A;  3PV8 A;  1V4T A;  5CY4 A;  4U7B A;  4R79 A;  1DKG D;  1RNH A;  3LAL A;  1HNW K;  3C95 A;  1NMN A;  3LZI A;  4J2E A;  2F9T A;  1VSM A;  4WQ5 A;  3AAP A;  3O9Q A;  4CZM A;  2NRZ A;  3VF4 A;  3ZT3 A;  1GLF O;  5AFU A;  3VF2 A;  1WNS A;  1GLJ O;  1GLL O;  4FW1 A;  2P51 A;  3HRG A;  3OBW A;  3BY5 A;  4FOI A;  3WNH A;  3SV3 A;  1Z26 A;  2Q97 A;  4FLU A;  2WON A;  4KKO A;  1KFS A;  4GVM A;  5J2N A;  4CK2 A;  4DU1 A;  4BRA A;  3CC7 N;  2E2Q A;  4YOX A;  1C6V A;  4DHY A;  4NCA A;  1N5Y A;  4CJS A;  3O9R A;  1W7A A;  3QFP A;  4H5N A;  4QAG A;  5HLF A;  3LDO A;  1L3U A;  5GAD P;  3MEC A;  1IKW A;  2A3Z A;  5K14 A;  2E5L K;  4G1Q A;  3HVT A;  2P9S A;  4ILJ A;  3ZSZ A;  2HHQ A;  3N4Q A;  1RBR A;  4DU4 A;  4CEC A;  4H0V B;  3FZK A;  4KI4 A;  2WFB A;  4IG3 A;  2Q2R A;  4M63 C;  3K59 A;  2DY4 A;  3S9H A;  1Y97 A;  3D2E A;  4FWL A;  3J80 O;  4E7H A;  2EX3 A;  1HJO A;  4KBO A;  2F9W A;  1KSP A;  3DLR A;  3CCL N;  3DLE A;  4JI5 K;  1SKS A;  2QKB A;  1BCO A;  4FLX A;  4N56 A;  2YI1 A;  1BQM A;  4ICL A;  5J2M A;  1R59 O;  1RDU A;  4IZ9 A;  5JIC A;  3ZX0 A;  4JI4 K;  4FJI A;  4JD2 A;  3ZSO A;  3WQU A;  4F9O A;  5BR8 K;  5AQP A;  1NJW A;  2G8W A;  1HKB A;  4CEB A;  3M8Q A;  3RSE B;  4E1J A;  4DSI A;  3D6R A;  3WNF A;  4FJ7 A;  1Q82 O;  3VPZ A;  3CME N;  5FLX O;  2DFF A;  2P9P B;  1OH8 A;  4KI6 A;  3LAK A;  2P5G A;  3RMC A;  4JNE A;  4KTZ A;  4IO8 A;  3EZ5 A;  1LWC A;  3QET A;  2FBY A;  2H3G X;  3NAE A;  4DKW A;  2A5X A;  1QQO A;  3NH2 A;  4CJ4 A;  1YJW N;  3CM5 A;  1YIT N;  2HHH K;  3ITH A;  4A62 A;  3KLI A;  3WT0 A;  1VQ5 N;  5KQ8 A;  1Q9X A;  3QIO A;  3AVA A;  4EZ9 A;  2YNF A;  3V1R A;  2DTU A;  4B1Z A;  1GOC A;  4K42 A;  3CJ7 A;  4DTJ A;  1BO5 O;  1UAX A;  1KVC A;  3VQ6 A;  3VEO A;  3E9P A;  4BGB A;  4FJK A;  1SL0 A;  4CJ7 A;  4CIG A;  4DF4 A;  2BH1 A;  2FSN A;  4DG1 A;  1Q81 O;  4DV6 K;  4H5V A;  3PIP L;  4LD0 A;  1T6C A;  4CJR A;  3KKS A;  1W97 L;  4AM7 A;  5LMN K;  2Q3S A;  4BY9 C;  1HNX K;  3BZK A;  1EWQ A;  2A1S A;  4O8U A;  3SQ4 A;  3MX2 A;  4KAZ A;  4YOW A;  3MN6 A;  5M1K A;  3DWL A;  1BI4 A;  3IKM A;  3TSQ A;  3NMU A;  1VRU A;  3WEE B;  3CPE A;  1JCF A;  3E9L A;  1C1B A;  5HRS A;  2PZS A;  3HST B;  3WXI A;  2OPP A;  3B8A X;  4CK3 A;  2IGI A;  3DMJ A;  3CJ1 A;  2UUB K;  2O8E B;  1RT5 A;  3CYM A;  4DV2 K;  4I2P A;  1GOA A;  2QWM A;  2VWK A;  4BR5 A;  2E2N A;  3L2U A;  4JHD A;  3LWL A;  4FJJ A;  3U6F A;  2QWR A;  3BF3 A;  3MDQ A;  1VAZ A;  3OYD A;  3P38 A;  3TAB A;  4MQ3 A;  2KHO A;  4BRD A;  4I6M A;  1B9F A;  2QWO A;  2V52 B;  4I2Q A;  2V51 B;  5KPZ A;  2F7T A;  3DLG A;  4AHU A;  2OTL N;  4ELT A;  3MX5 A;  4E1M A;  4X65 K;  4E1N A;  2P9K A;  4DV3 K;  1OH7 A;  3DYA A;  3MXI A;  4KH4 A;  4H03 B;  2YNH A;  2ZWH A;  1YAG A;  4LFC K;  3CFP A;  5JVG L;  1D4X A;  3SBT A;  4HWI A;  4CZE A;  4ELV A;  5F0X A;  3C6A A;  5ADX H;  5CE3 A;  1W2B M;  3SK3 A;  3V6D A;  1WSE A;  1NGC A;  1HRH A;  1SL1 A;  1ZBU A;  3K9K A;  3VET A;  1WSJ A;  4A2B A;  1WSI A;  1V4S A;  1YT3 A;  4MDA A;  3QIN A;  1NK4 A;  4DS4 A;  3G10 A;  2VGN A;  1OVQ A;  2YNG A;  3VQP A;  4FOE A;  1LWF A;  4BDZ A;  1QQN A;  4LFA K;  4CHO A;  4GVE A;  4KPY A;  4BRM A;  1WSH A;  4I9L A;  4B8A B;  1RT1 A;  3C0B A;  2B4J A;  3H3O B;  4B3S K;  3CCU N;  4IKF A;  4CHN A;  3QBX A;  1ITG A;  3KD5 E;  1VQK N;  5JLH A;  3C94 A;  4BVO A;  3BGR A;  3S3M A;  4B1X B;  3AO5 A;  1JJ2 M;  3ULE A;  2VQE K;  1XHX A;  1YIJ N;  2D0O A;  4DR6 K;  4AQY K;  3JS6 A;  2E1Y A;  2GWK A;  3VGM A;  4LY7 A;  1GLA G;  2OPS A;  2WOM A;  1NJZ A;  3K0S A;  4IFY A;  3G71 N;  1XHZ A;  4E7K A;  1MA9 B;  4IFE A;  2IVP A;  1CXU A;  1VHX A;  4JKG B;  3CCM N;  3EY1 A;  4DQP A;  4BR0 A;  1J53 A;  3RMB A;  4I7F A;  3O9T A;  3I8B A;  2YNI A;  3NH1 A;  4AH9 A;  4DFJ A;  1H1V A;  2E2P A;  4IG0 A;  1DLO A;  4OGC A;  3QEP A;  4ID1 A;  2P9N B;  4FVU A;  4F2S A;  2OYQ A;  3CD6 N;  3QEV A;  1VQ7 N;  4OPK A;  3UKR A;  4MLE A;  4YHH K;  1RTJ A;  1OKJ A;  4IFV A;  4BRG A;  4KHY A;  3EE9 A;  3HBT A;  3ZSX A;  2Y1I A;  2W42 A;  5FPM A;  1NK8 A;  4DFM A;  5CR4 A;  3WXM B;  5FRN A;  3KLF A;  2UUA K;  1GLE G;  4CEZ A;  2F4V K;  5GIN A;  1S9E A;  1U6Z A;  5SZT A;  3EN9 A;  4BG8 A;  1S5J A;  1HKG A;  4EHU A;  3LP2 A;  3V81 A;  1I94 K;  2BUP A;  2P9U A;  4H0O A;  3TAN A;  4DV4 K;  4N41 A;  1R0A A;  4FK4 A;  3W0L A;  1VSD A;  3ZEU A;  1J6Z A;  4JK7 A;  1CZA N;  1N8R O;  1CXQ A;  2AJQ A;  4B9S A;  3I0R A;  3F9M A;  4CZH A;  1DTQ A;  3HPO A;  5BPN A;  2DFE A;  3VQ9 A;  4O0J A;  4AHS A;  3R1X A;  1BGX T;  3OS1 A;  2P9S B;  3MWT A;  3DXM A;  3TAM A;  2G8U A;  3SUP A;  1WBD A;  4CGH A;  4FO0 A;  3VQ4 A;  1TGO A;  2GX9 A;  1RBT A;  3HOT A;  3THY A;  3J7A P;  4EP5 A;  3D2E B;  3AVB A;  3QNO A;  1XMQ K;  4JN4 A;  5AZI A;  4NYN A;  1Z6R A;  1MU2 A;  3FZL A;  1Z05 A;  4PL7 A;  1KXP A;  1T6D A;  1EQY A;  2IAJ A;  2D5R A;  3KWI A;  3U9D A;  3G6E N;  2O8F A;  5BRD A;  2PYJ A;  4O8K A;  4M7X A;  4CEQ A;  1NNE A;  3O4Q A;  5EXW A;  2FSK A;  5GAE P;  2QW9 A;  1CZB A;  5GAH P;  4JD2 B;  1D9D A;  3CCE N;  4JS5 A;  4AF1 A;  4OPH A;  3R6M A;  2KZZ A;  3W3D A;  3UE5 A;  3J81 O;  2WBN A;  1KLM A;  3HZ6 A;  1VQ8 N;  3HSC A;  3RR7 A;  3ZT2 A;  4Z0U A;  4JKB A;  4JRP A;  4AIL C;  1U49 A;  1LW0 A;  3PLA A;  4DSJ A;  2UXD K;  2A40 A;  1UOC A;  3IFR A;  2XO7 A;  3NHG A;  3AVN A;  3NF8 A;  5M1O A;  2ZJR L;  1GOB A;  2YKM A;  4LF9 K;  2XRI A;  3OJS A;  3SJH A;  3AA2 A;  2EHG A;  1TVR A;  4A59 A;  2ASM A;  4CGG A;  1WUA A;  3ASM A;  3MK6 A;  4E19 A;  3M8P A;  3BDP A;  2F96 A;  4MO5 A;  4MFB A;  5D3G A;  1U47 A;  4BC5 A;  4CI6 A;  1G15 A;  4M42 A;  2JWL A;  3LAM A;  4XH1 A;  4DTO A;  3C7N A;  4C8L A;  2NRT A;  2P9I A;  3OHR A;  2YX6 A;  2BTF A;  3PX0 A;  4CD1 A;  3ZX3 A;  3QEI A;  3GBT A;  1E3M A;  1Q7Y O;  4BRC A;  4PKH A;  3AO3 A;  4FZY A;  3OTO K;  2FF3 B;  4JHD B;  3P31 A;  3SAF A;  3SQ0 A;  4B3R K;  1XC3 A;  3LWM A;  3HVR A;  4CJ3 A;  2Z1G A;  2UUC K;  4HTL A;  3S3O A;  2ZGZ A;  1EXQ A;  4I6M B;  2NRX A;  3ID6 A;  4FM2 A;  4EFH A;  3AGR A;  3VQ5 A;  1KFD A;  3QEW A;  4BRQ A;  3KK7 A;  2G8K A;  1TV6 A;  1WLJ A;  3FZH A;  4Y1D A;  5JLF A;  3JAM O;  2P9K B;  1XWL A;  4CGJ A;  1QZ6 A;  5KTQ A;  4L8R B;  4F2R A;  3TAR A;  1NGE A;  3PX4 A;  3CPW M;  3DOK A;  1SZ2 A;  5ADX A;  1KAY A;  3GG4 A;  2IOC A;  3H1Q A;  3VQD A;  2ZJP L;  4LF8 K;  1C0U A;  4XEI A;  3A5O C;  3H45 C;  2AA4 A;  1ATR A;  4YOT A;  1NWK A;  3AVM A;  1FKP A;  3PSF A;  3O9S A;  1Q86 O;  3THV A;  3MEE A;  4G9Z A;  4MDB A;  4YY3 K;  2HMI A;  3V9S A;  3V9Z A;  4BAC A;  4IO9 L;  1RGI A;  4Y1C A;  4KFB A;  3TAP A;  1SKR A;  3I55 N;  1ZBI A;  2FF6 A;  4RW7 A;  4H0X B;  3HM9 A;  1NK0 A;  4DCH A;  4CHP A;  4DR7 K;  4B9T A;  5AQU A;  4CW7 B;  1K8K A;  1ZBH A;  2QWP A;  2UU9 K;  2HVI A;  3VEN A;  4M3W A;  1VQ9 N;  3TTF A;  3AVG A;  2E88 A;  3KTQ A;  3QML A;  1ATN A;  4ISF A;  2XY7 A;  1BG3 A;  2D0B A;  1U48 A;  1QVG M;  1J54 A;  3VES A;  3TAE A;  4PKI A;  1HYS A;  4XH5 A;  3SCX A;  1QHA A;  1BIS A;  4B9V A;  2QI2 A;  4CZI A;  5J2P A;  3L4I A;  5LMU K;  5BN8 A;  1RBV A;  5HRN A;  4WFB L;  4KHU A;  4DQS A;  4Y0W A;  3VTI A;  3AO2 A;  3ENB A;  4ID5 A;  1LCU A;  3CC2 N;  3HXM A;  1ZC6 A;  4K25 A;  1WOQ A;  1T44 A;  1HPM A;  1D8Y A;  5MLC Q;  3B6P A;  3TPQ A;  4LF4 K;  1BIZ A;  1SUQ A;  4N76 A;  2O8C B;  4UQG A;  1N32 K;  1KVA A;  5GIP A;  1HYZ A;  1HLU A;  3CJ9 A;  2XHB A;  2HVH A;  3OYN A;  1E4G T;  4C1N I;  4H0Y B;  3H3N O;  3TTC A;  4E0D A;  3K58 A;  2CH6 A;  2P9U B;  1JKH A;  1BWF O;  3EZW A;  1T03 A;  3KLE A;  4NCB A;  3QER A;  4C8N A;  3ZT0 A;  3WXJ A;  3GL1 A;  3ZEU B;  3TSP A;  3SQ1 A;  4X66 K;  2FLO A;  5KI6 A;  1RDB A;  1RTH A;  5KPT A;  3CJB A;  3SLC A;  3ZT1 A;  2HHS A;  1JL2 A;  4BGA A;  1NKC A;  4FJ5 A;  2QM1 A;  4WQ4 C;  1X1P A;  5IT9 O;  5M1P A;  4PHT X;  3CFR A;  4BE1 A;  3NVK A;  1D9F A;  3PUF A;  3MED A;  3DXM B;  4JAX A;  1WAF A;  4F3O A;  5AQH A;  5AQI A;  2YHW A;  1EP4 A;  3U4L A;  4C8K A;  5I42 A;  4BRI A;  3TI0 A;  5C42 A;  1RDW X;  1B9D A;  1BU6 O;  2OPQ A;  2VWB A;  3IG1 A;  4CEA A;  3H6E A;  3LAN A;  5C25 A;  5AZI B;  3AA3 A;  3P5J A;  5BRH A;  5AZJ A;  1NGF A;  3M1F A;  4E3S A;  1QZ5 A;  4FYD A;  1X9S A;  2ZD1 A;  5DK5 A;  4DB3 A;  2O8F B;  1JCG A;  1FXX A;  2HBJ A;  5JS2 A;  4PUO A;  3VQC A;  2X74 A;  3D45 A;  4BRK A;  4W5Q A;  1NOY A;  4BC4 A;  1IBM K;  4LH4 A;  4BDY A;  4N47 A;  3AY9 A;  1TK5 A;  1XNQ K;  2LSN A;  4ELU A;  4A61 A;  4FJG A;  1IH7 A;  4ISE A;  4ILG B;  3O1B A;  3EEQ A;  4CJW A;  2I5J A;  4ILH A;  4KHQ A;  4FM1 A;  3QIC A;  2HOE A;  3OBY A;  1L5U A;  3AVI A;  1JL1 A;  2UXB K;  2G8V A;  4RTF D;  1BA1 A;  3HK2 A;  1WB9 A;  4FL9 A;  1XUP O;  4HVJ A;  1RT4 A;  5SWM A;  2ASO A;  4CF2 A;  1FJG K;  4BC2 A;  4FLV A;  4IXC A;  2OA8 A;  4B9M A;  3ZET A;  2UYT A;  4O55 A;  4DTX A;  2HST A;  1UA0 A;  3LP1 A;  3H08 A;  1YJN N;  2HBM A;  4CER A;  3V9W A;  3E9O A;  4M3Y A;  3T7Z A;  4K43 A;  3A8Y A;  2FBX A;  4M3R A;  5KRT A;  1S22 A;  3QDK A;  2D0P A;  2HF3 A;  2KKZ A;  2WC9 A;  4BRF A;  5DM7 L;  4B3M K;  1QHT A;  3LM2 A;  4KH5 A;  4BRL A;  3JXU A;  1KD1 O;  4BR4 A;  3AV9 A;  3LZJ A;  1NJX A;  4FXD A;  3CC4 N;  1VSE A;  4LSL A;  3THX A;  1IBK K;  3FZF A;  1M1K O;  4EZ6 A;  1A5V A;  3SQ2 A;  4M3Z A;  3VGK A;  3VN5 A;  3C7N B;  2NNW A;  2P9I B;  4FJ8 A;  4DTP A;  4DU3 A;  5AR0 A;  3KLG A;  4H0T B;  3MN9 A;  3HPH A;  4M3U A;  1MWM A;  4CIE A;  1YTA A;  1ZBF A;  4A57 A;  4DSL A;  3KVG A;  2ITG A;  3IAY A;  4YDU C;  1DT9 A;  2QXL A;  4XH4 A;  4BRN A;  1T8E A;  3O4W A;  4BVP A;  1NGG A;  3SJJ A;  1JCE A;  3RVC A;  1EO1 A;  5BR9 A;  3S3N A;  4PKG A;  2FXU A;  1C0M A;  3O9U A;  1U2V A;  2PBD A;  3KKR A;  3SMS A;  1WBB A;  4BG9 A;  2XY5 A;  1NGI A;  5LL6 Z;  3BP8 A;  2BAN A;  3O8M A;  1VQP N;  4DF8 A;  1TKX A;  2VGM A;  1X9M A;  4CJE A;  4Z4H A;  3QO9 A;  1QQC A;  2P5O A;  1S6P A;  3FFK B;  4NO7 A;  4CCH A;  3MWP A;  4J8F A;  4H4O A;  1ESV A;  3AA4 A;  5LJV A;  1HPZ A;  2Z1J A;  2HHT A;  2JLE A;  4M45 A;  3VA0 A;  5HBM A;  2IDO A;  3R9P A;  4CF0 A;  1W9H A;  4FWN A;  2VQF K;  4R5P A;  5EY4 A;  3DRR A;  4ISG A;  3VEV A;  3A2F A;  4FJ9 A;  3MCA B;  3JSM A;  1KC8 O;  3F2K A;  4K0K K;  2XY8 A;  1K8A O;  5C24 A;  3P83 D;  3GOI A;  3TAQ A;  2VYP A;  3K5M A;  3RRH A;  1NGH A;  3THW A;  4HCC A;  4CFB A;  2ITM A;  3DRP A;  4OO1 J;  5TKY A;  4CJL A;  3ZLJ A;  1N36 K;  4HCB A;  2A6A A;  2QKK A;  1P8Z A;  3V4I A;  4CHY A;  3UKU A;  3CJA A;  4H5W A;  2HNY A;  3OYB A;  5HP1 A;  5BN9 A;  1IG9 A;  1SV5 A;  5CYM A;  2E8A A;  3RWU A;  4E89 A;  3FLC O;  4F8R A;  4FK2 A;  3J8A A;  5AQK A;  1GLD G;  1NM1 A;  4CHQ A;  5AFU H;  4X62 K;  3ZCM A;  2IS3 A;  4CBW A;  1VQM N;  4W5N A;  1IO2 A;  4UY8 O;  4KHW A;  1S1U A;  3T3F A;  4CHZ A;  2ZGY A;  1YVN A;  4EAH D;  4FJL A;  3ULD A;  3HTV A;  1EWR A;  3SAG A;  3O80 A;  4DWI A;  1RTI A;  1DEJ A;  4GNI A;  4IBN A;  2YHB A;  3SAH A;  4PA1 A;  4TSX A;  1VQL N;  4GKJ K;  4DTU A;  4ZHR A;  2BE2 A;  4JKC A;  5KGW A;  3V1Q A;  5H1S Q;  1S72 N;  4WCE L;  1HNI A;  4JI0 K;  3DJC A;  4BR9 A;  2NRV A;  5ELZ A;  1HJR A;  3P1G A;  3T1A A;  1HX1 A;  4BWM A;  1GLB G;  3KZB A;  1KLN A;  4AHC A;  4JI1 K;  4OPA A;  3FFI A;  3VEW A;  2HF4 A;  5AQM A;  5HRP A;  3ATU A;  3D2F A;  1YTU A;  1YF5 L;  3ZSW A;  3SUN A;  3SPZ A;  1QS4 A;  3NGY A;  3DLB A;  4BC3 A;  3OY9 A;  4FPB A;  2RE2 A;  1LV5 A;  4NXN K;  3R3L A;  3NBP A;  1IKV A;  4JEP A;  1BDG A;  2DFH A;  4Q5V A;  3ZYY X;  4BRP A;  4PQU A;  4Z4C A;  1RBU A;  4OKJ A;  3K5L A;  4XIU A;  3LDN A;  3FGU A;  1MWK A;  5EVZ A;  4DUZ K;  1KVB A;  4KRF A;  5IWA K;  1SS6 A;  5AZJ B;  4C8M A;  1TKT A;  3MAQ A;  4E7L A;  5HRO A;  1FK9 A;  1LOT B;  3LM9 A;  2FBT A;  1Q9Y A;  3R8E A;  4FLT A;  2PAV A;  4CIF A;  3M8S A;  3C6T A;  4DR2 K;  3VEY A;  5JMV A;  4FSV A;  4CK1 A;  4M3T A;  3VQB A;  3O6W A;  4WF9 L;  2GUI A;  2V7Y A;  3L4Q A;  4CGF A;  4CZJ A;  2ASP A;  4FJX A;  4CF9 A;  5FPE A;  3G25 A;  5CHI A;  1EET A;  3LDL A;  3L6Q A;  2HW3 A;  3UB5 A;  2ATQ A;  1G99 A;  5FRM A;  1NKE A;  2NRW A;  3AVC A;  5A2Q O;  3DLL L;  4CEO A;  3E01 A;  4CJQ A;  3L2R A;  3WNE A;  4GY2 B;  4B1W B;  5HL7 L;  3SPY A;  2X6N A;  3LL3 A;  3O5B A;  3HPG A;  4FCY A;  4CEF A;  2KLA A;  2OCE A;  3CCQ N;  1RCH A;  4MLH A;  2YV0 X;  1BI4 B;  3LDQ A;  3CQY A;  2OZM A;  1NMD A;  1W0H A;  1WSF A;  2KTQ A;  4IJA A;  1O13 A;  2VG7 A;  3KK1 A;  1Y64 A;  4QS7 A;  1N33 K;  1YJ9 N;  3E1Y A;  1FKO A;  3H46 O;  4LF6 K;  3NH0 A;  4NLC A;  1NKB A;  4F4K A;  3DLH A;  3EKU A;  4DTN A;  3CHW A;  1OH5 A;  1VQN N;  2VG6 A;  3HI0 A;  3L2W A;  4K41 A;  2FC0 A;  4CBU A;  1GLC G;  3IUC A;  3AVK A;  4CES A;  3CQ8 A;  4B1Y B;  5I3U A;  1JLA A;  1TUU A;  4FWM A;  5E41 A;  1C0T A;  4CZL A;  3QNN A;  4DV7 K;  4QOZ B;  3WNG A;  3K5N A;  1NK7 A;  2E2O A;  4C1N K;  4DQR A;  4DFP A;  1LAV A;  3TTD A;  3K2P A;  1IJJ A;  1RT2 A;  1VQO N;  1A5X A;  3VQE A;  1RT3 A;  4BRO A;  3TSU A;  4NCG A;  3RMD A;  3QEX A;  2UXC K;  4HUE A;  3C6H A;  4GW6 A;  5T7B A;  3A0I X;  1U2V B;  4E7I A;  3OYI A;  4AHT A;  4W5R A;  4YOU A;  3PY8 A;  3FR0 A;  2J4R A;  1VSH A;  1RT6 A;  4K8X A;  1M90 O;  2BDP A;  2Q36 A;  3MN5 A;  3ZT4 A;  1QQM A;  3KIO A;  2B5J A;  2ZF5 O;  1IBL K;  5AQO A;  3OYH A;  4DV5 K;  3VA3 A;  2KFZ A;  3DXK A;  2HMP A;  4OLA A;  3A5L C;  3O3F A;  1JLB A;  4QS8 A;  4W5T A;  3ULE B;  3HO1 A;  5FRO A;  1RDD A;  4DFK A;  2VG5 A;  3MMV A;  2RN2 A;  3P39 A;  1VSL A;  1JLE A;  3HOS A;  4AHV A;  3NGZ A;  4DR5 K;  3VQA A;  2NRR A;  4W5O A;  1D5A A;  4BRH A;  2A42 A;  4EP4 A;  1HUX A;  4OPJ A;  3NCI A;  1S1T A;  2NUB A;  1ZYQ A;  1QTM A;  4V19 S;  1TYQ A;  3NDK A;  2KQ2 A;  2HHU A;  3THW B;  1I39 A;  3UIQ A;  4IEE A;  3HM8 A;  1EKE A;  2FBV A;  4NB4 A;  4KHN A;  3MXJ A;  2P1J A;  1HNV A;  3UKU B;  4FLW A;  4GV9 A;  5CZ1 A;  1NGD A;  2QWN A;  3SYZ A;  1YI2 N;  2W6K A;  1XNR K;  2ZQB A;  1P90 A;  1BUP A;  4JLH A;  3O3H A;  5AJ3 K;  3EL2 A;  4DTS A;  4CJV A;  2A1R A;  4KRE A;  3UKR B;  5FPD A;  3WQT A;  3D0P A;  1HKC A;  2QXF A;  4JKH A;  1NGJ A;  1UWB A;  4Z94 A;  4FWP A;  3I8D A;  1KQS M;  4WQ5 C;  2G8I A;  1RFQ A;  3KJV A;  1NBW A;  1NJY A;  2I7N A;  3TWH A;  1BOT O;  1NU0 A;  3A5M C;  2GTD A;  2Q31 A;  4DMN A;  4O5B A;  2JGU A;  4IOX A;  5AQS A;  3IDH A;  3EYZ A;  1QE1 A;  2OPR A;  5AQN A;  4RCH A;  4CGI A;  4H5R A;  5GAG P;  1JLF A;  5AQZ A;  4CFC A;  1SQK A;  2Z1I A;  2RKI A;  4KHS A;  2RHK A;  2QK9 A;  5B8H A;  2IVO A;  4OKK A;  2E20 A;  4WQ4 A;  2IIR A;  3VQQ A;  5KRS A;  3T1Y K;  5EOY A;  4Z4F A;  1J5E K;  2NLX A;  5AQF A;  1IG8 A;  1TK8 A;  1C0F A;  3WUH A;  3F5T A;  4BDP A;  2XY6 A;  1NGB A;  5FPN A;  5AQW A;  3GDQ A;  1JLC A;  3BZC A;  3SI6 A;  2P9L A;  3MCP A;  1C0G A;  2G8H A;  3V9U A;  4FWK A;  3PX6 A;  1B92 A;  2GV9 A;  3D2F B;  2IC3 A;  3THY B;  1HQU A;  4BE0 A;  2CGL A;  3RMA A;  2YHY A;  3ISN C;  1HMV A;  1TL1 A;  3A5N C;  4LC9 B;  1HQE A;  4B9Q A;  2V7Z A;  4JI2 K;  4H0P A;  3OYJ A;  4DUY K;  5AQV A;  1TK0 A;  1OVY A;  4YFU A;  1J5O A;  3AVF A;  1L3T A;  1JLQ A;  4M7Y A;  1IKY A;  2D0A A;  3CJC A;  1CZ9 A;  4WE1 A;  4GV3 A;  3CER A;  3CCV N;  3DAW A;  4CBX A;  5AQG A;  4AM6 A;  4BWJ A;  3Q7B A;  3ZSQ A;  2HNZ A;  2FSJ A;  4K8Z A;  1WN7 A;  2KZM A;  2ZM6 K;  5HOO A;  5C10 A;  3Q7C A;  1X9W A;  4FM0 A;  3N4P A;  3P4I A;  3QFU A;  1KAZ A;  4JKE A;  3L0Q A;  4BRE A;  1HNZ K;  1Z25 A;  3VQ7 A;  3E66 A;  4CZF A;  2GEL A;  1JLG A;  1XI1 A;  4GV6 A;  4NYF A;  5AQJ A;  3H1V X;  2QTD A;  3PO5 A;  2OAN A;  4B08 A;  4DR4 K;  2Y1J A;  4B8C A;  2CGK A;  4DTM A;  3QB0 A;  4FWQ A;  4YOV A;  2WTU A;  3D7E O;  1I3A A;  4DR3 K;  3I56 N;  5E84 A;  2E6M A;  2O8B A;  4MO4 A;  3ID8 A;  5J2Q A;  1S9G A;  4YOR A;  3C65 A;  1BL3 A;  3CCJ N;  3L8B A;  4CJF A;  2VWJ A;  3SNN A;  4KHP K;  3OYM A;  2KW4 A;  4GMJ B;  2Z1H A;  1ASV A;  1XQS C;  4Z4E A;  3ALY A;  3K9J A;  3U9Z A;  1YVU A;  1S1V A;  4BQZ A;  4E7J A;  1VQ4 N;  4M41 A;  4IDK A;  3C6U A;  1LWE A;  4JI8 K;  4I9Q A;  3LPT A;  3CF5 L;  3NF6 A;  3SUO A;  1QSY A;  3OYA A;  2CH5 A;  4KV8 A;  1XC9 A;  4B9L A;  3KD1 E;  4YDU A;  3CI5 A;  1XMO K;  3SBG A;  1NJI O;  3I33 A;  4YOY A;  3HYF A;  3AO4 A; 
#chains in the Genus database with same CATH homology
 1L3U A;  1HJR A;  3AO3 A;  4CFD A;  4FZY A;  2ETJ A;  2D0C A;  1IKW A;  3MEC A;  3P1G A;  3T1A A;  5K14 A;  4BWM A;  3F73 A;  1L3V A;  3SQ0 A;  4G1Q A;  3HVT A;  2R7Y A;  1KCF A;  1VSK A;  3LWM A;  3ZSZ A;  4CJ3 A;  3HVR A;  2Z1G A;  1KLN A;  3I0S A;  1ASW A;  1RBR A;  4AHC A;  3LP3 A;  2X78 A;  4CEC A;  3CFO A;  4DU4 A;  3S3O A;  3FFI A;  1EXQ A;  4KI4 A;  5HRP A;  4IG3 A;  1YTU A;  1ASU A;  4FM2 A;  3ZSW A;  3K59 A;  1LW2 A;  3S9H A;  3VQ5 A;  1KFD A;  1Y97 A;  2DY4 A;  2KFN A;  3QEW A;  4E7H A;  3SUN A;  2EX3 A;  3SPZ A;  4OVL A;  1KTQ A;  4KO0 A;  1TV6 A;  2G8K A;  1KSP A;  3DLR A;  1WLJ A;  1QS4 A;  3DLE A;  3NGY A;  4Y1D A;  1SKS A;  3DLB A;  4CED A;  1XWL A;  4CGJ A;  2QKB A;  4L8R B;  5KTQ A;  1BCO A;  4FLX A;  3TAG A;  3OY9 A;  3TAR A;  3PX4 A;  4F2R A;  4N56 A;  3DOK A;  1LV5 A;  3RR8 A;  4J2A A;  1BQM A;  2IOC A;  3VQD A;  4ICL A;  1C0U A;  3NBP A;  5J2M A;  1IKV A;  2DFH A;  4FJI A;  1ZBL A;  3AVM A;  4Q5V A;  1F21 A;  1FKP A;  3ZSO A;  4PQU A;  4Z4C A;  1RBU A;  4OKJ A;  3K5L A;  4DQQ A;  3THV A;  4XIU A;  1WAJ A;  1NJW A;  2G8W A;  1IKX A;  3NE6 A;  3NGI A;  3MEE A;  1EX4 A;  4RW6 A;  4O0I A;  4CEB A;  3M8Q A;  4DSI A;  1T05 A;  2HMI A;  3WNF A;  1KVB A;  4FJ7 A;  4KRF A;  3V9S A;  3V9Z A;  3U3Y A;  3T19 A;  4BAC A;  4C8M A;  2OZS A;  1TKT A;  1VSJ A;  4Y1C A;  3MAQ A;  4E7L A;  2DFF A;  4KFB A;  5HRO A;  1FK9 A;  3TAP A;  1SKR A;  4RW7 A;  4KI6 A;  1A5W A;  3CG7 A;  3LAK A;  4ZTJ A;  2FBT A;  1ZBI A;  3K5O A;  1Q9Y A;  3AA5 X;  2P5G A;  4FLT A;  3RMC A;  3HM9 A;  4CIF A;  4KTZ A;  3C6T A;  3M8S A;  3QIP A;  1NK0 A;  3EZ5 A;  4FJM A;  4CK1 A;  1LWC A;  3QET A;  4CHP A;  4M3T A;  3VQB A;  5KGX A;  1NK5 A;  2FBY A;  3NAE A;  4B9T A;  2GUI A;  1ZBH A;  3NH2 A;  2HVI A;  3B6O A;  4CJ4 A;  4M3W A;  2YKN A;  3CM5 A;  4CGF A;  3KLH A;  4FJX A;  3AVG A;  1NOZ A;  3ITH A;  4CF9 A;  3KTQ A;  1T7P A;  1BHL A;  3OVN A;  1WSG A;  2XY7 A;  3KLI A;  2D0B A;  4BE2 A;  1EET A;  1NK6 A;  1U48 A;  1Q9X A;  2HW3 A;  1J54 A;  2O4G A;  2ATQ A;  3TAE A;  5FRM A;  4FVM A;  3RRG A;  1HYS A;  1NKE A;  4CE9 A;  3QIO A;  3OYL A;  3AVC A;  3AVA A;  4EZ9 A;  2YNF A;  3V1R A;  2DTU A;  1UA1 A;  1GOC A;  4DTJ A;  3SCX A;  1KVC A;  1UAX A;  3VQ6 A;  4FLY A;  4CEO A;  1TAQ A;  4CJ5 A;  3E01 A;  1BIS A;  4DS5 A;  1S1W A;  4B9V A;  4FJK A;  1SL0 A;  5HRR A;  4CJQ A;  4CIG A;  4DF4 A;  3QES A;  5J2P A;  4DG1 A;  3L2R A;  3WNE A;  4LD0 A;  4CJR A;  1RBV A;  5HRN A;  3KKS A;  3LDS A;  4DQS A;  4KHU A;  2F8T A;  3AO2 A;  1KRP A;  3SPY A;  2X6N A;  4ID5 A;  2Q3S A;  4HUG A;  3HPG A;  3TR8 A;  2A1S A;  4FCY A;  4CEF A;  3HXM A;  3SQ4 A;  4F3T A;  4OJR A;  4KAZ A;  1RCH A;  4N5S A;  1D8Y A;  3V9X A;  4FZZ A;  1S6Q A;  4FLZ A;  2ZE2 A;  3B6P A;  1BI4 A;  1RBS A;  2YV0 X;  3OYK A;  1VRU A;  5HLF A;  1TKD A;  1BI4 B;  2F8S A;  2OZM A;  1W0H A;  1BIZ A;  1C1B A;  1DTT A;  5HRS A;  2PZS A;  1WSF A;  1QSL A;  1SUQ A;  4YNQ A;  3HST B;  4N76 A;  2KTQ A;  4UQG A;  3IRX A;  2E4L A;  2OPP A;  2VG7 A;  4KTW A;  3KK1 A;  4CK3 A;  1BIU A;  1KVA A;  2IGI A;  3DMJ A;  1HYZ A;  1FKO A;  1K6Y A;  2XHB A;  1RT5 A;  3CYM A;  2HVH A;  4I2P A;  1GOA A;  3NH0 A;  3OYN A;  1U45 A;  2VWK A;  1NKB A;  4F4K A;  3DLH A;  3BDP A;  3L2U A;  1BCM A;  3LWL A;  4DTN A;  4FJJ A;  3U6F A;  2VG6 A;  4E0D A;  3L2W A;  3HJF A;  4J2B A;  3OYD A;  2FC0 A;  3K58 A;  2PYL A;  3TAB A;  4MQ3 A;  3AVK A;  4CES A;  1JKH A;  3CQ8 A;  3CM6 A;  3IS9 A;  1T03 A;  5JS1 A;  3KLE A;  1JLA A;  1B9F A;  3QER A;  5I3U A;  4NCB A;  5FDL A;  4C8N A;  4KHW A;  3ZT0 A;  4I2Q A;  5E41 A;  1RDA A;  1C0T A;  3DLG A;  4AHU A;  4CJU A;  3DM2 A;  3OYE A;  3QNN A;  3SQ1 A;  4ELT A;  4QOZ B;  3WNG A;  3HT3 A;  4E1M A;  1VK0 A;  4OKE A;  5CZ2 A;  3K5N A;  1NK7 A;  5KI6 A;  1RDB A;  1RTH A;  4E1N A;  3AVJ A;  3ZT1 A;  3DYA A;  4DSF A;  3MXI A;  2HHS A;  1O1W A;  1JL2 A;  1NKC A;  2YNH A;  4DQR A;  2G8F A;  4DFP A;  4FZX C;  4FJ5 A;  1LAV A;  3CFP A;  1X1P A;  4ELV A;  4J2D A;  4PY5 A;  3CFR A;  3K2P A;  3L2V A;  4BE1 A;  1RT2 A;  1D9F A;  3PUF A;  2RF2 A;  3MED A;  3V6D A;  1A5X A;  1WAF A;  3VQE A;  4CJK A;  4F3O A;  1RT3 A;  1EP4 A;  1WSE A;  4B9U A;  1HRH A;  1SL1 A;  1ZBU A;  4NCG A;  4C8K A;  1WSJ A;  3RMD A;  3QEX A;  1WSI A;  4KB0 A;  4HUE A;  5I42 A;  3TI0 A;  2HHX A;  1YT3 A;  5C42 A;  4GW6 A;  5T7B A;  5CYQ A;  1REV A;  5DMR A;  3OYG A;  3QIN A;  3KK3 A;  3K57 A;  4DS4 A;  4E7I A;  1NK4 A;  1B9D A;  2OPQ A;  1VSF A;  3G10 A;  3IG1 A;  4CEA A;  2YNG A;  3LAN A;  3VQP A;  3OYI A;  3JYT A;  4AHT A;  5C25 A;  4W5R A;  1LWF A;  3PY8 A;  4BDZ A;  3AA3 A;  3P5J A;  3VQ8 A;  2HB5 A;  3HP9 A;  1VSH A;  3QLH A;  4LH5 A;  4E3S A;  2O4I A;  1RT6 A;  4CHO A;  4K8X A;  4FYD A;  1X9S A;  4KPY A;  1C1C A;  2BDP A;  1WSH A;  2ZD1 A;  4I9L A;  5DK5 A;  3ZT4 A;  4B8A B;  1FXX A;  1RT1 A;  2GBZ A;  3KIO A;  5JS2 A;  2B5J A;  1QSS A;  2HHW A;  2B4J A;  4PUO A;  3VQC A;  2X74 A;  3D45 A;  4W5Q A;  1NOY A;  3OYH A;  3VA3 A;  4IKF A;  2KFZ A;  4OGE A;  4CHN A;  1ITG A;  3KD5 E;  4LH4 A;  4BDY A;  4OLA A;  4CJP A;  3C94 A;  4N47 A;  3BGR A;  4LSN A;  3O3F A;  4HHT A;  3S3M A;  4FW2 A;  2B6A A;  3AO5 A;  1JLB A;  1TK5 A;  2LSN A;  4W5T A;  4CJT A;  4ELU A;  1XHX A;  4FJG A;  1IH7 A;  3HO1 A;  1RT7 A;  1RDD A;  3DOL A;  3NF9 A;  5FRO A;  2VG5 A;  4DFK A;  4CJW A;  2I5J A;  2RN2 A;  1VSL A;  1JLE A;  4KHQ A;  4FM1 A;  4FK0 A;  1HYV A;  4AHV A;  4LY7 A;  3NGZ A;  3MXM A;  2OPS A;  2WOM A;  4RW4 A;  1NJZ A;  4IFY A;  4O44 A;  4RW8 A;  4DLG A;  1L5U A;  3AVI A;  1XHZ A;  3OS0 A;  1JL1 A;  3VQA A;  4E7K A;  3PO4 A;  4W5O A;  1D5A A;  3RTV A;  2G8V A;  3AO1 A;  4M3X A;  1CXU A;  3HK2 A;  4EP4 A;  4DQP A;  3EY1 A;  4OPJ A;  3NCI A;  1J53 A;  3RMB A;  4I7F A;  3NF7 A;  1S1T A;  4HVJ A;  2NUB A;  2YNI A;  3AVL A;  1RT4 A;  3M8R A;  1ZYQ A;  5SWM A;  3NDK A;  1QTM A;  4FJH A;  3NH1 A;  2KQ2 A;  2HHU A;  4AH9 A;  4CF2 A;  4DFJ A;  4IG0 A;  1I39 A;  2HHV A;  1DLO A;  3UIQ A;  4ZTF A;  1TL3 A;  4OGC A;  4FLV A;  1EKE A;  1JXB A;  2FBV A;  3QEP A;  2E6L A;  2OA8 A;  4KHN A;  4ID1 A;  3OS2 A;  4B9M A;  3MXJ A;  4O55 A;  2P1J A;  4B9N A;  1HNV A;  2BGG A;  4F2S A;  4DTX A;  2OYQ A;  4FLW A;  1UA0 A;  3LP1 A;  5CZ1 A;  3H08 A;  3QEV A;  3SYZ A;  1SKW A;  3V9W A;  4CER A;  4CF1 A;  2ZQB A;  3OYC A;  4M3Y A;  4JLH A;  3O3H A;  4DLE A;  4W5N A;  4OPK A;  1N6Q A;  4DTS A;  2FBX A;  4M3R A;  4CJV A;  4HUF A;  2A1R A;  4KRE A;  1RTJ A;  4IFV A;  5KRT A;  3OJU A;  1S1X A;  4KHY A;  1QHT A;  3ZSX A;  3D0P A;  2Y1I A;  4Q0B A;  1TKZ A;  2W42 A;  2QXF A;  3ZSR A;  1UWB A;  4HTU A;  3I8D A;  1NK8 A;  2G8I A;  1BQN A;  4DFM A;  5FRN A;  3KJV A;  3KK2 A;  4JRQ A;  1NJY A;  3AV9 A;  3G0Z A;  4CF8 A;  3KLF A;  3LZJ A;  3TWH A;  4CEZ A;  1JXE A;  1NJX A;  5SZT A;  1S9E A;  4DMN A;  4FXD A;  1S5J A;  1VSE A;  4LSL A;  4O5B A;  2JGU A;  3LP2 A;  3V81 A;  4EZ6 A;  1NK9 A;  1A5V A;  3EYZ A;  3SQ2 A;  4Z4I A;  4FJN A;  2YHA A;  4M3Z A;  1QE1 A;  2OPR A;  3TAN A;  4CGI A;  3VN5 A;  4DSE A;  1R0A A;  4N41 A;  1JLF A;  4CFC A;  4FK4 A;  4CEE A;  1L3S A;  2Z1I A;  1VSD A;  2RKI A;  4DU3 A;  4DTP A;  4FJ8 A;  4DQI A;  4H8K A;  4KHS A;  3KLG A;  2QK9 A;  4RW9 A;  4JS4 A;  3HPH A;  1CXQ A;  4OKK A;  1C1A A;  4M3U A;  2AJQ A;  3VQQ A;  4B9S A;  5KRS A;  3I0R A;  3MEG A;  4CIE A;  1YTA A;  1ZBF A;  3AVH A;  4DSL A;  4H4M A;  4Z4F A;  1DTQ A;  2ITG A;  2HND A;  1TK8 A;  3HPO A;  3IAY A;  2DFE A;  3VQ9 A;  4O0J A;  4AHS A;  2XY6 A;  1T8E A;  1LAW A;  4BDP A;  4KB1 A;  1BGX T;  3OS1 A;  3HP6 A;  1JLC A;  3DRS A;  3ZSV A;  3SI6 A;  3SJJ A;  3TAM A;  2G8U A;  2G8H A;  1Q8I A;  3OYF A;  3SUP A;  3V9U A;  3S3N A;  4CGH A;  3PX6 A;  1B92 A;  2GV9 A;  3VQ4 A;  1TGO A;  1RBT A;  1SL2 A;  4EP5 A;  1C0M A;  2IC3 A;  3KKR A;  3AVB A;  1HQU A;  3QNO A;  4BE0 A;  3RMA A;  5EU7 A;  2XY5 A;  4NYN A;  3ISN C;  1MU2 A;  1HMV A;  1TL1 A;  3DI6 A;  1HQE A;  2BAN A;  3OYJ A;  4QCL A;  1TK0 A;  4DF8 A;  4KTQ A;  1TKX A;  3LP0 A;  3TAF A;  2IAJ A;  4CGD A;  4YFU A;  2D5R A;  1J5O A;  4Z4G A;  2HHQ A;  3AVF A;  1VSI A;  4O4G A;  1JLQ A;  4RG8 A;  3SV4 A;  1X9M A;  1L3T A;  1IKY A;  2PYJ A;  2D0A A;  4CEQ A;  4CJE A;  4Z4H A;  3DLK A;  3O4Q A;  4AHR A;  1CZ9 A;  3QO9 A;  4WE1 A;  1QQC A;  2P5O A;  1S6P A;  1CZB A;  4CCH A;  3ZSY A;  4PWD A;  3SUQ A;  4DTR A;  1D9D A;  4H4O A;  4JS5 A;  2RPI A;  3AA4 A;  3SZ2 A;  1HPZ A;  3LPU A;  3HL8 A;  2Z1J A;  2HHT A;  2KZZ A;  1U4B A;  1RDC A;  2JLE A;  4M45 A;  3VA0 A;  4BWJ A;  1RTD A;  4DSK A;  5HBM A;  1KLM A;  2IDO A;  3U3G A;  3ZSQ A;  4CF0 A;  3RR7 A;  2HNZ A;  1W9H A;  3O4N A;  3ZT2 A;  4K8Z A;  1WN7 A;  2KZM A;  1U04 A;  4Z0U A;  4R5P A;  3DRR A;  1J9A A;  3V1O A;  1X9W A;  4FM0 A;  3A2F A;  4FJ9 A;  1TAU A;  3JSM A;  4OLB A;  3O3G A;  2XY8 A;  2X6S A;  4JRP A;  4AIL C;  5C24 A;  3P83 D;  1Z25 A;  3VQ7 A;  1U49 A;  3TAQ A;  3K5M A;  3RRH A;  1LW0 A;  1JLG A;  4CFA A;  1XI1 A;  1CLQ A;  4HCC A;  1RIL A;  4NYF A;  4CFB A;  4DSJ A;  3DRP A;  1UOC A;  3NFA A;  3L2Q A;  3L3U A;  4CJL A;  2XO7 A;  3NHG A;  1VRT A;  3AVN A;  3F9K A;  3NF8 A;  5J1E A;  2QKK A;  4C8O A;  4HCB A;  4B3O A;  3L3V A;  3V4I A;  1GOB A;  2PY5 A;  3PO5 A;  4CHY A;  2YKM A;  2XRI A;  3PV8 A;  2HNY A;  3OYB A;  4B08 A;  5CY4 A;  2Y1J A;  4B8C A;  5HP1 A;  4DTM A;  3OJS A;  1RNH A;  3AA2 A;  3LAL A;  1IG9 A;  1SV5 A;  5CYM A;  1I3A A;  3C95 A;  2EHG A;  3RWU A;  4E89 A;  3LZI A;  4J2E A;  1TVR A;  2E6M A;  4F8R A;  4FK2 A;  1VSM A;  4CHQ A;  5J2Q A;  1S9G A;  3ZCM A;  4CGG A;  2IS3 A;  3ZT3 A;  1BL3 A;  3L8B A;  4CJF A;  1IO2 A;  1WNS A;  3ASM A;  2VWJ A;  1S1U A;  3M8P A;  4E19 A;  3OYM A;  3SNN A;  2F96 A;  2KW4 A;  4GMJ B;  2Z1H A;  1ASV A;  4CHZ A;  4FW1 A;  3T3F A;  4FJL A;  2P51 A;  3ULD A;  4Z4E A;  3ALY A;  4MFB A;  5D3G A;  1U47 A;  1YVU A;  1S1V A;  4E7J A;  4DWI A;  3WNH A;  1G15 A;  1RTI A;  4M42 A;  3SV3 A;  4M41 A;  1Z26 A;  4FLU A;  2WON A;  3LAM A;  4IBN A;  4KKO A;  1KFS A;  4GVM A;  4IDK A;  2YHB A;  5J2N A;  3C6U A;  1LWE A;  4I9Q A;  4CK2 A;  4PA1 A;  4DU1 A;  3LPT A;  4TSX A;  3NF6 A;  4DTO A;  3SUO A;  1QSY A;  4DTU A;  4C8L A;  4ZHR A;  2BE2 A;  3OYA A;  5KGW A;  1C6V A;  3V1Q A;  4KV8 A;  4NCA A;  1N5Y A;  4CJS A;  1XC9 A;  1HNI A;  4B9L A;  3KD1 E;  3PX0 A;  4QAG A;  3QEI A;  3HYF A;  3AO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...