4O55A

Hiv-1 integrase catalytic core domain complexed with allosteric inhibitor (2s)-tert-butoxy[6-(5-chloro-1h-benzimidazol-2-yl)-2,5-dimethyl-4-phenylpyridin-3-yl]ethanoic acid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
154
structure length
139
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/inhibitor
molecule keywords Integrase
publication title A New Class of Multimerization Selective Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 45
structure length 139
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o55A00
3SUOA 5FRMA 1DLOA 4CFDA 2QKKA 3V9XA 3QERA 4C8OA 4Z4GA 1C0MA 3SQ2A 3K58A 2KTQA 2QKBA 1EXQA 3RR8A 2IC3A 1J9AA 3QNNA 4K8ZA 1VSIA 1ZBFA 4AHCA 4DU4A 1RTHA 1NK8A 4HUEA 4FK0A 4H4OA 4F2RA 3HSTB 3AVHA 4FJ9A 4J2DA 1QS4A 4E3SA 3LP2A 3OYLA 2BDPA 1WSEA 4JLHA 4JRQA 3ZT4A 3AVBA 5CY4A 4CJWA 3B6OA 1QHTA 1W0HA 2IDOA 1NJXA 1QTMA 2Z1JA 3DOLA 4ID5A 3S3OA 3MEDA 2GUIA 1JL2A 3MXJA 3OYEA 1TKZA 1Q9XA 5J1EA 4M3XA 4DQSA 4F4KA 1IH7A 1TL1A 3LP3A 2DFHA 3ZSZA 3OS0A 1VSFA 3AA3A 4E19A 3KLHA 4DU1A 3S9HA 4CK1A 3K5NA 1RTIA 4I7FA 3ZSYA 3HPOA 1KRPA 4GW6A 4XIUA 3JYTA 4AHUA 3IG1A 4DQRA 2Y1IA 4CHNA 1L3UA 2VG6A 3VQ8A 4AHSA 3QEWA 3LP1A 4BE0A 1RDDA 2KZZA 1DTTA 1C6VA 3OS1A 3NF9A 1XWLA 4FW2A 4KV8A 3AA2A 3OY9A 3OYJA 3KJVA 4Z4CA 4DSKA 4ELTA 4CEZA 3OYAA 3DM2A 2HHUA 2HB5A 3AVJA 4FCYA 3LAKA 1NK5A 4DTJA 4EZ9A 1BIUA 4Q5VA 1SL2A 3V81A 1J5OA 4I2QA 2R7YA 4DTPA 3SV3A 3LP0A 1YT3A 4DSLA 1BCMA 1LWCA 2WONA 3RMBA 4DQIA 4OKJA 2VWJA 1YVUA 2LSNA 4CF1A 2RN2A 3L2RA 4RW9A 1FKPA 2O4GA 2Y1JA 1K6YA 3P1GA 4C8LA 1REVA 1UA1A 3PX6A 3CQ8A 1GOCA 4ZHRA 4EZ6A 1GOBA 4HCBA 3S3NA 1LW2A 4LY7A 1LAVA 1VK0A 3O4NA 2W42A 5HROA 3KKSA 3TABA 1C1AA 2GV9A 3CM6A 3AVAA 1RCHA 1RDAA 3KKRA 1C0UA 3C6TA 3LPUA 4H8KA 4DTOA 1ASUA 1QSYA 3ITHA 2A1RA 2X78A 3ISNC 4FZZA 3OYHA 2X6SA 1RT1A 1JXEA 3I0RA 3HT3A 4PUOA 3OYCA 4E0DA 4R5PA 1UAXA 3OYFA 1KSPA 4FM2A 2ZQBA 3V9ZA 1RTJA 3VQ6A 3F9KA 5FRNA 2KZMA 4JRPA 1LW0A 2ATQA 4CGHA 3TAEA 1WSHA 2QK9A 3ZSQA 3AVMA 3VA3A 1U47A 1KLNA 4CCHA 4FJXA 3DMJA 5JS2A 4IG0A 4CJFA 1KFSA 4RW6A 4O44A 2G8UA 4PWDA 1JLEA 4KHUA 3HK2A 1I3AA 4TSXA 2F8TA 2DTUA 1D5AA 1JKHA 3EYZA 4DMNA 3PV8A 4IG3A 4Z0UA 1JLQA 4DTRA 3V1OA 1X9MA 3VN5A 2YHAA 1KCFA 1QQCA 3K5OA 4W5QA 3TAPA 4KAZA 4FK4A 4BDZA 4DG1A 3NF7A 4N5SA 3RWUA 1SL1A 3KLIA 1U04A 1RT3A 1ZBLA 2HW3A 5KTQA 3AO5A 1WSJA 4CJSA 1KFDA 4DLEA 2PZSA 4CFBA 4KI4A 4KB1A 2OPRA 5KGXA 4B9MA 3D0PA 3TAGA 1NJZA 1A5WA 1S1UA 3QO9A 2O4IA 5K14A 3WNFA 1TAUA 1S9EA 3HVTA 1X9SA 4F2SA 5I42A 3SZ2A 1BISA 4O4GA 4N41A 1T05A 3VQ4A 3VQ7A 3ZT3A 4CJVA 2OPSA 1BQNA 4QAGA 4CIEA 4EP4A 2DY4A 4KHSA 3P83D 1RT6A 3ALYA 2KW4A 3V1RA 2XY7A 3T3FA 3OJUA 1TAQA 3SCXA 1BI4A 4RW4A 1RBSA 4CHOA 3QEXA 4E7IA 1FK9A 3RRHA 4CJQA 1ASWA 3M8SA 3OYNA 4DFKA 3AO4A 3NF8A 1ASVA 3M8RA 3VQBA 4CJRA 3DLKA 4B08A 4EP5A 2OZSA 4CFAA 4E7LA 1ZBUA 4DFPA 5FROA 4KPYA 2XHBA 1BQMA 4O0JA 5J2QA 4FZXC 3K57A 1JL1A 3ZSXA 3ZT1A 2IGIA 3VA0A 1SL0A 2Z1GA 2DFEA 4GVMA 4C8MA 3NE6A 3NCIA 4KHYA 4UQGA 4B9SA 2HHQA 4WE1A 2EHGA 2YKNA 1RTDA 4AILC 1C1CA 1J54A 4B8AB 3TANA 2BGGA 1NK9A 1X1PA 1S6PA 3EZ5A 4FM1A 3U3YA 4FJ5A 4KRFA 3VQQA 3I8DA 4DTXA 4O0IA 4NCGA 4DLGA 3SUPA 4ELUA 1A5XA 1F21A 5J2PA 4FJMA 3NAEA 5DMRA 3NGYA 4OGCA 4NCBA 4Z4IA 3QESA 1J53A 5D3GA 3HO1A 1BGXT 3AVKA 3SI6A 3OYMA 2XO7A 3QNOA 4DS4A 3QEVA 5HRSA 3L2VA 1NKBA 1NKEA 1RBTA 4FJJA 1T03A 1T8EA 3MECA 1SV5A 4M42A 3LWLA 4FW1A 2OYQA 4W5NA 3QLHA 1QSLA 3C94A 4DQPA 4FYDA 4CGFA 4B3OA 2X74A 2KFZA 3K2PA 4N56A 3L2QA 4BACA 4CESA 1CZ9A 2XRIA 3NHGA 3DLBA 2VG7A 4F8RA 1BL3A 1RDCA 3SJJA 2F96A 4N76A 2IAJA 1WAFA 3KD1E 3HYFA 4CECA 3SPYA 1IO2A 4LD0A 4QOZB 5FDLA 3AVCA 4FVMA 4BWMA 1U49A 1G15A 2A1SA 1S9GA 4DQQA 3NGIA 3TARA 5KI6A 1R0AA 1ZYQA 4I9QA 1Q8IA 2BANA 4CJ5A 3CFPA 4KKOA 3QETA 3L3UA 1NJYA 3TAFA 2PYLA 4KHNA 2X6NA 4DU3A 4I2PA 3PO5A 1VSMA 4FJLA 4F3OA 1SUQA 2D0AA 3TR8A 1RNHA 4B8CA 4KHWA 3DLGA 4IDKA 1YTUA 1SKRA 1NKCA 2OZMA 4CIFA 4CEOA 4CEFA 1JXBA 3NGZA 3RTVA 2YKMA 2IS3A 3AVLA 4LSNA 4DF4A 4FLVA 4FZYA 1C0TA 2FBYA 4QCLA 4B9NA 3AA4A 5SWMA 1KVCA 3OJSA 2B4JA 3DLRA 4RW7A 4HTUA 3ZSRA 1FXXA 3THVA 1ITGA 5HRRA 4FLWA 4M3WA 3ASMA 4MFBA 1HRHA 3VQAA 4PQUA 2HHXA 3O4QA 1RT2A 3AVNA 3DI6A 4KO0A 5KGWA 5HLFA 4OPKA 4ICLA 2FBTA 3DYAA 5DK5A 4CFCA 3EY1A 4KTZA 3CYMA 4Y1DA 3SPZA 4IFVA 4DFMA 2P51A 3V9WA 2EX3A 3T19A 2HVIA 4CGGA 3RRGA 2XY5A 1LWFA 1VSJA 2FC0A 2YNHA 3BGRA 4H4MA 4LSLA 4CF0A 4CHQA 4DTUA 1UOCA 2HMIA 5EU7A 4B9TA 2NUBA 1IKXA 1VSDA 1VRUA 2YV0X 4LH5A 1XHXA 4CF8A 5SZTA 5T7BA 4CJEA 1HQEA 4CK3A 1SKSA 3OYDA 3VQDA 3RR7A 3JSMA 4DSFA 3O3HA 3V6DA 3TI0A 4IFYA 3UIQA 4M41A 5HBMA 4YNQA 4B9VA 3L8BA 3A2FA 1SKWA 2P5OA 4B9LA 1TKDA 2PYJA 4FJ8A 3AVGA 3L2WA 2HHVA 3F73A 2ZD1A 3TAMA 4W5TA 2RKIA 3MAQA 1C1BA 3VQCA 3KLEA 1XHZA 3KD5E 3HP9A 2G8WA 3PX4A 3VQ5A 3G0ZA 3ZT2A 3C6UA 3KK1A 1WSFA 3NDKA 4ID1A 4FJNA 3FFIA 1BHLA 4CEDA 4NYFA 4CHYA 4M3RA 4OPJA 4CEQA 1EP4A 1WN7A 4CIGA 3G10A 1S1WA 3QIOA 1NK0A 2D0BA 4BWJA 2KFNA 3VQ9A 3DLEA 1HJRA 4KI6A 3OYKA 2FBVA 4G1QA 1D9DA 4O5BA 2G8VA 4YFUA 2B6AA 3BDPA 3DOKA 1HYZA 3C95A 2OPQA 2KQ2A 2HHTA 2B5JA 1KVAA 4B9UA 3U6FA 4O55A 3AO1A 4W5OA 3OYBA 1HNVA 4J2AA 2RF2A 5E41A 4FJGA 3V4IA 1JLGA 2E6MA 1CZBA 1S1TA 1L3VA 1JLCA 4DSIA 4FM0A 1VRTA 3SQ1A 4DTSA 4CGDA 3SQ0A 3NH1A 4W5RA 5C25A 1VSLA 1TK8A 1T7PA 4FXDA 2RPIA 2Z1HA 4DWIA 2XY8A 4HVJA 4CGIA 4DSJA 3LALA 1JLAA 1HYVA 4CJ4A 3KK3A 4Z4FA 3LANA 5C24A 2VG5A 4FLTA 4OLBA 3NF6A 3SNNA 1HMVA 2I5JA 3U3GA 1NOYA 4CF9A 3DRPA 1A5VA 2G8HA 3O3FA 4DS5A 3HJFA 3K59A 4FJHA 5CYMA 3CG7A 3CFOA 5J2NA 1S5JA 4OVLA 1Y97A 1RBUA 1B9DA 3IAYA 5CZ2A 4CHZA 4OLAA 1RT5A 5HRPA 1WSIA 3T1AA 4CF2A 4Z4EA 1GOAA 1RT7A 1IKVA 3HPGA 3QEPA 2G8FA 4J2EA 2QXFA 2OPPA 4BDYA 3RMDA 5I3UA 3D45A 2BE2A 5JS1A 1B92A 1Z25A 3V1QA 1KLMA 1TL3A 3MXMA 4FK2A 2IOCA 2JGUA 4AHTA 1U45A 3QINA 2G8IA 1NK4A 1IKWA 1TGOA 1N6QA 3HXMA 3ZCMA 4CJUA 4E1MA 3CM5A 3L2UA 1O1WA 3HL8A 3V9UA 1YTAA 3HVRA 3OYIA 3SUNA 4N47A 1KTQA 3K5MA 2P1JA 1WNSA 3LPTA 1I39A 2YHBA 3K5LA 4BDPA 3HPHA 1EKEA 1L5UA 4CGJA 3S3MA 1LWEA 5CYQA 4FLUA 1CXUA 4E7HA 2YNIA 2P5GA 1BCOA 2E6LA 1S6QA 4RG8A 1VSKA 4Z4HA 2YNFA 3AO3A 4M3YA 2HNZA 4IBNA 3O3GA 3M8PA 1QE1A 2ZE2A 4OKKA 1L3TA 3ZSOA 1HQUA 4NCAA 1UA0A 1NK7A 4CJTA 4E1NA 4M3ZA 5C42A 1W9HA 3IS9A 1CXQA 4RW8A 1ZBHA 2VWKA 3VQPA 3ZSWA 3ZT0A 4CK2A 3KK2A 1S1XA 3M8QA 3LWMA 4OJRA 3SQ4A 1VSEA 3LAMA 2JLEA 4KFBA 1HYSA 3MEGA 4I9LA 3DRSA 1RDBA 2FBXA 1B9FA 5J2MA 3E01A 3OS2A 1LV5A 4FLXA 2DFFA 4C8KA 4FLZA 4JS5A 1D8YA 1MU2A 3PO4A 4FJKA 4F3TA 4AHRA 1XC9A 4M3UA 3WNGA 4CERA 1NK6A 1RILA 1TV6A 3NFAA 5CZ1A 3KLFA 5KRTA 3LZIA 1XI1A 2XY6A 4E7JA 2D0CA 5KRSA 2HNDA 2Q3SA 4CEBA 1Q9YA 1KVBA 1BI4B 1D9FA 1JLFA 1WAJA 1BIZA 4HUGA 4HUFA 1L3SA 2HNYA 3VQEA 4NYNA 1HNIA 4CJLA 2ETJA 1TKXA 4L8RB 2AJQA 4IKFA 4PY5A 4ZTFA 3KLGA 4ZTJA 3V9SA 4HCCA 3DRRA 2HHWA 3PUFA 3AV9A 3ZSVA 1FKOA 2E4LA 4Q0BA 3MXIA 1NOZA 2Z1IA 1VSHA 1WLJA 3AVFA 3H08A 3WNEA 4OKEA 4CHPA 4DSEA 1HPZA 4J2BA 2ITGA 3QIPA 3LZJA 4M45A 1X9WA 1UWBA 2GBZA 4K8XA 4AH9A 4FLYA 3SYZA 2D5RA 3NBPA 3CFRA 4KREA 1TVRA 1IKYA 3I0SA 1N5YA 3LDSA 4DTNA 2PY5A 3DLHA 3AVIA 3OYGA 1TKTA 2G8KA 4M3TA 1TK0A 4Y1CA 1CLQA 3SUQA 3RMAA 1TK5A 3SV4A 3PY8A 1RBVA 4C8NA 2HHSA 3IRXA 4E89A 1ZBIA 1RT4A 4E7KA 4DF8A 3HP6A 3PX0A 1S1VA 4KHQA 3NH2A 4CJ3A 1U4BA 1QSSA 4ELVA 1U48A 4OGEA 4CEAA 4CEEA 4BE1A 1JLBA 4MQ3A 4BE2A 4AHVA 4CJKA 4KB0A 2F8SA 1NJWA 3WNHA 1EETA 4CJPA 4HHTA 3RMCA 1IG9A 5HP1A 1Z26A 2YNGA 3QEIA 1WSGA 3KIOA 3L3VA 4KTWA 3KTQA 4KTQA 3NH0A 5HRNA 3MEEA 3B6PA 2HVHA 3TWHA 3AA5X 4GMJB 4DTMA 1EX4A 1DTQA 4CE9A 4FJIA 4JS4A 4FJ7A 2WOMA 3AO2A 1LAWA 3P5JA 4LH4A 3HM9A 3ULDA 4PA1A 3TAQA 2OA8A 4DFJA 1RBRA 3OVNA
chains in the Genus database with same CATH superfamily
1DLOA 3ATUA 1EWRA 2P9NB 3ZETA 1X3NA 2IIRA 3FZKA 3WQTA 3RR8A 4IDHA 2IC3A 4FK0A 1RTHA 5AQMA 2P9IA 5BREA 4FJ9A 3CI5A 4J2DA 4E3SA 1N34K 1WUAA 3LP2A 3VGKA 1SZ2A 3ZT4A 1P8ZA 1K8AO 3MEDA 4CW7B 1TKZA 5AQYA 5J1EA 1W2BM 3T1YK 3LP3A 3ZSZA 3K9KA 3TPQA 3WUHA 3ZSYA 1OH7A 3HPOA 3THXA 3VQ8A 4AHSA 3QEWA 4A2AA 5KQDA 1XWLA 4FW2A 3AA2A 4Z4CA 4PHTX 3AY9A 3DM2A 2HHUA 3RVCA 3ZEUA 4FVUA 1NK5A 1BU6O 1VQ4N 1BIUA 3V81A 1KXPA 1WBBA 4WQ4C 2WONA 5AQGA 3AGRA 3SK3A 4CF1A 4JN4A 2A42A 1HNXK 1K6YA 4WYBA 4C8LA 2GWKA 1UA1A 4XEIA 4B3SK 3CQ8A 3S3NA 1LW2A 4LY7A 4BRPA 5EX5A 4BGBA 4JHDA 2W42A 3R6MA 1EQYA 4JKBA 3TABA 1C1AA 2GV9A 3C6TA 2O8EA 1BWFO 1W97L 4H8KA 3NVKA 4XH1A 3ITHA 3O5BA 2X78A 2X6SA 3FFKB 1BA1A 3I0RA 1VQ7N 3OYCA 4WFAL 4E0DA 1DGKN 1KSPA 3V9ZA 3TAEA 5H1SQ 4CJFA 1KFSA 4U7BA 2G8UA 1JLEA 4JI1K 2DTUA 4DV5K 4DTRA 2E2OA 1NWKA 4CD3A 4KAZA 4FK4A 4BDZA 4JD2A 3RWUA 1U04A 1ZBLA 1GLAG 2HW3A 2FF3B 2O8BA 1I94K 2W6LA 1KFDA 4JNEA 4LF4K 4LFBK 1S9EA 1X9SA 4CZEA 4O4GA 3ZT3A 4WCEL 2DY4A 1RT6A 3OJUA 1BI4A 4E7IA 4CJQA 1IBKK 2HHHK 1ASVA 3CC4N 3VENA 4CJRA 4B08A 3EKSA 4H0XB 2OZSA 2HVHA 4CZKA 4KPYA 4DFPA 2YI1A 3Q7CA 4FZXC 3K57A 3ZSXA 2IGIA 4M63C 3FGUA 5KPRA 2DFEA 2CGKA 4KHYA 2NNWA 4BREA 2EHGA 2E88A 3WXIA 4AILC 4JI5K 3EZ5A 5FLXO 4FJ5A 3VQQA 4DLGA 2YJEA 1WB9A 5J2PA 3QESA 5D3GA 1YJWN 3HO1A 1BGXT 3FZLA 5BPNA 4FJJA 1T8EA 1SV5A 4JK8A 1OKJA 5AQPA 2JWKA 2KLAA 4ILGB 2IVPA 2XRIA 3DLBA 5AFUA 4N76A 1RDCA 3KD1E 3LL3A 1IO2A 4LD0A 4QOZB 3AVCA 4BRFA 1U49A 1G15A 2A6AA 4I9QA 2HF3A 3TARA 5KI6A 2UXCK 3CFPA 1NJYA 3L3UA 2IVOA 2X6NA 1W7AA 5JMVA 1RNHA 4IOXA 5JVHL 4IDKA 1SKRA 5AQUA 3I8BA 5JVGL 3ENOA 3CCQN 3NGZA 3RTVA 2IS3A 3VEWA 4I6MB 1C0TA 2B4JA 4HTUA 4RW7A 4M3WA 4ILHA 4FLWA 1Z05A 5AJ3K 3AVNA 1VQ6N 1BO5O 4LF5K 4KO0A 1NJIO 5HLFA 4OPKA 2FBTA 2F7TA 5GINA 4Y1DA 2HVIA 3O1BA 3CCLN 2XY5A 1VSJA 2Q36A 4CHQA 2HMIA 5EU7A 1VRUA 1VSDA 4CF8A 1NU0A 3OYFA 3VERA 4DV0K 3KVGA 4CK3A 1YHQN 2JWLA 3OYDA 1ATNA 5GAGP 3O3HA 3F5TA 4JEPA 3UIQA 4FJ8A 3L8BA 4FWNA 3AVGA 4C23A 2NRVA 2HOEA 4JK7A 3TAMA 2RKIA 1C1BA 3KD5E 3ZT2A 3WXMB 3KK1A 3CMAN 1ESVA 1BHLA 4KH4A 3P39A 2UU9K 1WN7A 2YHWA 1YJNN 2CGJA 3VQ9A 2G8VA 2B6AA 2CGLA 3DOKA 1HYZA 3C95A 2GELA 2OPQA 3MX2A 2OTJN 2F4VK 1NGBA 3H6EA 4J2AA 4CI6A 2FLOA 5EXWA 3CXCM 1JLGA 2E6MA 4DSIA 1S1TA 3TSPA 4IJNA 4CGDA 1TK8A 1VSLA 4FXDA 2VGMA 3G4SN 2RPIA 2Z1HA 3LALA 2QWNA 3KK3A 4WF9L 1K9MO 1T6DA 3E9OA 3ID8A 4QS9A 3ULEB 4H0VB 2F9TA 2UXBK 2OTLN 3MN6A 4L3QA 3O3FA 3TSUA 3K59A 5AZJB 1Y97A 1RBUA 4JKFA 2QWOA 1B9DA 1SQKA 1RT5A 1WSIA 4CF2A 3DAWA 4YORA 1IKVA 2G8FA 3QEPA 4AQYK 2RE2A 2OPPA 4BDYA 3D45A 4JK9A 3V1QA 1Z25A 4FK2A 2IOCA 3VGMA 4AHTA 1NK4A 1N6QA 3LDOA 2GUPA 3ZCMA 4CJUA 3L2UA 1O1WA 3HL8A 3V9UA 4BRNA 4CBXA 2YHBA 4A2BA 3K5LA 1EKEA 1JCGA 4FLUA 4E7HA 1TUYA 5GIPA 1BCOA 2P5GA 3FE1A 4GV3A 4M3YA 4FWPA 1QE1A 1GLEG 1K8KB 4OLBA 5BPLA 4M3ZA 2D0PA 4H5VA 2VYPA 1WBDA 3IS9A 4A59A 1TYQA 1ZBHA 3LWMA 3VQPA 1YITN 1S1XA 4BRMA 1VSEA 3T1HK 5C10A 2AA4A 4I9LA 3DRSA 5AQHA 3E01A 4BRGA 4FLXA 5F0XA 5GIOA 1MU2A 3SJHA 1XC9A 4M3UA 4CERA 3E9PA 3GBTA 5CZ1A 5KRTA 3LZIA 4E7JA 5KRSA 2Q3SA 4CZLA 1KVBA 1BIZA 4M7XA 3VQEA 5HOOA 4KBOA 4PKHA 4L8RB 4DCHA 4ZTJA 5C2DA 3ZSVA 3AV9A 2Z1IA 3CJCA 3HRGA 3SMSA 1VSHA 2GEMA 1OH8A 4BR7A 3SAHA 4NO7A 4DSEA 2FSNA 1HUXA 3LZJA 4FSVA 1G99A 1QQOA 4CZIA 4AH9A 3SYZA 3CFRA 1TVRA 3VF4A 4DTNA 2RHKA 4B1WB 1CLQA 3RMAA 1TK5A 1RBVA 3IMXA 1JCEA 4C8NA 3PSIA 1N32K 1YJ9N 1ZBIA 1RT4A 3CMEN 4A57A 4DF8A 4CJ3A 4CEAA 3RMCA 2YNGA 4K43A 4YOUA 5M1FA 2NRXA 3KTQA 3B6PA 1C0FA 2CH6A 1NG9A 3AO2A 3I55N 1LAWA 4LH4A 3ULDA 4DFJA 1RBRA 3GG4A 1C0MA 2QKBA 3BZKA 5KPTA 3QDKA 4K8ZA 1VSIA 4AHCA 4DU4A 4KH5A 1NGGA 4H4OA 4F2RA 3DXKA 5BRFA 3MMVA 2J4RA 1WSEA 3J7AP 4CJWA 1W0HA 3EE9A 1IJJA 1NJXA 1QTMA 4DV4K 3AAPA 4ID5A 2QXLA 4BRHA 3S3OA 1S22A 1JL2A 1Q9XA 4LF8K 4M3XA 2HBKA 3CJ7A 1TL1A 2WFBA 3KLHA 1VSFA 4LF9K 3TSQA 4B1ZA 4JI3K 1KRPA 4GW6A 4AHUA 3IG1A 1K73O 1T3VA 2Q0UA 4KV8A 3OYJA 3SAFA 5BPMA 4ELTA 3QBXA 3OYAA 2HB5A 1HKCA 4BGAA 4EZ9A 3EN9A 3FZHA 4Q5VA 1J5OA 1YT3A 4DSLA 1BCMA 3GOIA 2VWJA 2LSNA 5M1OA 3D2FB 4JKDA 5AQIA 1Q7YO 4B1XB 4ZHRA 1GOBA 3QICA 3U4LA 1U6ZA 4RTFD 2E2NA 3KKSA 2UXDK 1RCHA 1RDAA 2UUAK 5CE3A 1VQMN 5M1KA 3LPUA 3J80O 1ASUA 3U9ZA 2A1RA 1RT1A 4QS7A 1IBMK 3HT3A 4BVPA 3VQ6A 3F9KA 2ATQA 2P9KB 3AVMA 1KLNA 4CCHA 5JS2A 5JICA 4O44A 4PWDA 4PL8A 4KHUA 3HK2A 1GLFO 1V4SA 1D5AA 3EYZA 4YOVA 3CJBA 4OX9K 2Q31A 1JLQA 3H3NO 3V1OA 3TTCA 3CCUN 2YHAA 1KCFA 1QQCA 4DG1A 3NF7A 4MLEA 1RT3A 1VQLN 3WEEB 5KTQA 4CJSA 4X66K 4CFBA 3M6GA 3AARA 3KWGA 1NBWA 2HBJA 4B9MA 3DXMA 2O4IA 3K9JA 5K14A 3WNFA 3MN5A 3VQ4A 1T05A 4QAGA 4CIEA 4KHSA 3ALYA 3V1RA 4JV5K 4JKGB 3T3FA 3SCXA 3C7NB 1RBSA 3WT0A 1FK9A 4DR1K 4K42A 1ASWA 1BOTO 5AZIA 4DHYA 3AO4A 3P31A 3VQBA 3C6AA 4BC3A 3DLKA 3ZEUB 4DV6K 2KTQA 3W0LA 1RDWX 4O0JA 5LMUK 1Y64A 2Z1GA 4CZMA 4FPBA 3MWPA 4IZ9A 1KAXA 3ZX0A 2YKNA 1C1CA 1ZC6A 4RCHA 4BRIA 3TANA 1X1PA 4GKJK 3I8DA 3SUPA 3L4QA 4JHDB 1A5XA 1F21A 2P9SA 3E9LA 5DMRA 4Z4IA 4OGCA 3SMPA 2H3GX 2O8EB 4FO0A 4FWKA 3OYMA 3CERA 4DS4A 5HRSA 3L2VA 2Q1NA 1NKBA 3K0SA 4M42A 4FW1A 4W5NA 2WBNA 1BA0A 1JJ2M 4DQPA 4YDUC 4CGFA 4B3OA 3R1XA 5AQKA 5FPMA 5AQVA 4CESA 3NHGA 2VG7A 3CCEN 1BL3A 3SLCA 4H5NA 4CECA 3SPYA 5FDLA 4BWMA 2A1SA 1S9GA 1ZYQA 3NGIA 3QETA 4CJ5A 2P9NA 4IO8A 4KKOA 2PYLA 3TAFA 3CF5L 1NGAA 1R59O 4LC9B 3TR8A 3DLGA 3KWIA 1YTUA 1ATRA 4EHTA 1Q86O 4F9OA 2P9UA 2O8BB 3P4IA 2HMPA 4WQ5C 3CJ1A 2YKMA 3VMFB 2FBYA 5E84A 1FXXA 1ITGA 5BRHA 4LF6K 3O4QA 4ICLA 5DK5A 4CFCA 4JKHA 4V19S 4DFMA 1XNRK 2QM1A 3A5NC 5AQNA 2EX3A 3T19A 4DR7K 4H4MA 3H46O 5T7BA 4CJEA 2FSJA 3LDPA 1VQON 3V6DA 1JCFA 4B9VA 3P38A 4B9LA 2P5OA 2E2QA 3L2WA 1YAGA 3HP9A 3PX4A 1WSFA 3NDKA 2FF6A 4FJNA 4CEDA 2ASOA 3DLLL 5GAHP 3QBWA 3LDQA 4CHYA 4X62K 5B8HA 4CEQA 2WUSA 1S1WA 3QIOA 5AR0A 3EEQA 3DLEA 4G1QA 1QVGM 3BDPA 4ISEA 2E5LK 2HHTA 4HTLA 2KQ2A 2WTUA 1KVAA 4B9UA 3SAGA 4MDBA 3TTDA 5I9EB 1L3VA 1JLCA 3WXKA 3FZFA 3CPEA 4DTSA 3NH1A 4AM7A 4DWIA 3JAMO 5F1XA 1OH6A 4CJ4A 3BY5A 4Z4FA 3LANA 2A41A 3VPZA 4FLTA 3NF6A 1YI2N 3SNNA 1NOYA 1GLCG 3VEYA 3DRPA 1GLBG 3I56N 1NM1A 4IOCL 2E8AA 3PSFA 4M7YA 1S5JA 2HBMA 4OVLA 2O8CB 3D2EB 4BRKA 3HOTA 1Q18A 5HRPA 4IEEA 4FOIA 4J2EA 3MK6A 5AQQA 2NZTA 3RMDA 3C0BA 2BE2A 1NMNA 3MXMA 1J5EK 4AM6A 2G8IA 4MLHA 1IKWA 1TUUA 1E3MA 1YTAA 3G71N 3OYIA 4N47A 5LMNK 3VEXA 1SS6A 3CD6N 4BC5A 3HPHA 4CGJA 3S3MA 5CYQA 3VESA 1KAZA 4OO1J 3KHYA 1VSKA 4Z4HA 2YNFA 4BY9C 2HNZA 3O3GA 2ASMA 3BF1A 3M8PA 2KZZA 4NCAA 2NRWA 3IDHA 4E1NA 3G6EN 1W9HA 4NLBA 3PIPL 1H1VA 1VQ9N 2VWKA 4CK2A 2ASPA 3WQUA 4BQZA 1S72N 1RDBA 1X9JA 3ZX3A 3QFPA 5LJWA 2ZJRL 4O8UA 1YIJN 4FLZA 3WNGA 1LCUA 4DV1K 1RILA 2O8FB 3CCRN 2HNDA 4DUYK 2HF4A 3J81O 4RWTA 1WAJA 1L3SA 2AJQA 3KLGA 3V9SA 4HCCA 3DRRA 3PUFA 2E4LA 3MXIA 3S41A 1NOZA 1QVFM 4H5RA 1YXQA 3H08A 4JI4K 1HKBA 4JI6K 4CHPA 4AF1A 1NGDA 4DUZK 2E1ZA 1X9WA 2GBZA 4K8XA 3NBPA 1IKYA 2Q2RA 2P9LB 4CZFA 3OYGA 1TKTA 3SUQA 3RSEA 1FJGK 3HP6A 1U4BA 4BRLA 4BE1A 4MQ3A 1DT9A 1O13A 4AHVA 4KB0A 1NJWA 2FSKA 2OANA 4HHTA 1RFQA 3WXJA 3L3VA 4I6MA 4KTWA 4KTQA 2O8DB 2VGNA 5HRNA 3MEEA 4GMJB 1EX4A 2P9PA 1DTQA 5BN9A 4FJ7A 4JS4A 2WOMA 3P5JA 1N8RO 3HM9A 5M1NA 1WOQA 3ZSOA 3SUOA 5FRMA 5JLFA 4CFDA 2QKKA 3V9XA 1DEJA 4C8OA 3CJ9A 1RDUA 4Z4GA 3SQ2A 4BRQA 3A8YA 3K58A 1BUPA 3QNNA 3JS6A 1ZBFA 2KKZA 4HUEA 4JI0K 2IVNA 3L0QA 1KQSM 3HSTB 3BEXA 4ILJA 4A5BA 2BDPA 4JLHA 4EFHA 4JRQA 4IO9L 4CBUA 3AVBA 3B6OA 1QHTA 2IDOA 4MDAA 4O5FA 3EL2A 2Z1JA 3DOLA 5EY4A 3CCMN 2GUIA 3MXJA 4U67L 1M90O 3UKRB 4DQSA 2DFHA 3OS0A 4DU1A 3S9HA 4CK1A 4PL7A 2QTDA 4BR0A 1EO1A 4XIUA 3JYTA 4DQRA 1L3UA 2VG6A 1NGFA 1U2VB 4BE0A 1RDDA 2QI2A 1C6VA 3OS1A 3NF9A 3OY9A 1HX1A 4IJAA 2QWRA 3AVJA 4FPAA 4NXNK 3VTHA 1BDGA 4FCYA 3D7EO 4DTJA 3CCSN 3O9TA 4CD1A 4DTPA 3SV3A 3LP0A 1IV0A 3U8XA 1LWCA 4DQIA 3C6HA 1YVUA 3UKUB 2D0OA 1VQPN 4RW9A 1FKPA 2O4GA 2Y1JA 3P1GA 2HSTA 1REVA 3PX6A 1GOCA 4HCBA 5FPNA 1LAVA 2ZWHA 5HROA 5JLHA 3CM6A 3AVAA 5AZJA 5AQSA 1GLDG 1C0UA 3KKRA 5AQXA 3THWB 3THYB 4GKKK 4GV9A 5FPDA 3ISNC 2OCEA 4FZZA 2V52B 3OYHA 1E4FT 4R5PA 3R9PA 5C12A 2ZQBA 1RTJA 5FRNA 4WQ4A 1WSHA 3ZSQA 4ISGA 1U47A 3DMJA 2ZJPL 3L6QA 2EWSA 4TSXA 3CHWA 4JI8K 1JKHA 4DMNA 1VHXA 3D6RA 4IG3A 3DJCA 1X9MA 1NGCA 3VN5A 4X65K 3OA9A 3TAPA 2UUCK 4N5SA 1SL1A 3I33A 3KLIA 5BR9A 1NMDA 4DR6K 2VCPA 4YHHK 4DLEA 2PZSA 1EWQA 1Q82O 4KB1A 3D0PA 3TAGA 3QO9A 5GAEP 1TAUA 3HVTA 4F2SA 3OW2M 5I42A 3SZ2A 1BISA 2V51B 4N41A 3VQ7A 4EP4A 4CZHA 3P83D 2XY7A 2KW4A 2W6KA 2GWJA 3FZMA 4CHOA 3QEXA 4KH6A 3RRHA 3M8SA 1Z6RA 4DQ8A 2YCHA 4JI7K 4DFKA 3NF8A 3BZCA 4EP5A 5KPZA 4CFAA 4E7LA 1BQMA 1JL1A 3QMLA 3VA0A 4H0OA 3NE6A 3NCIA 4UQGA 4B9SA 3IKMA 2HHQA 4WE1A 1RTDA 1J54A 4B8AB 1NGIA 1S6PA 3U3YA 4KRFA 4DTXA 4O0IA 4NCGA 2NRRA 2WC9A 4ELUA 3GDQA 4FJMA 3NAEA 3VOVA 4JYAK 4NCBA 3AVKA 2XO7A 4DR3K 3QNOA 2ZGZA 1NKEA 1RBTA 1VQNN 1T03A 3N4QA 5DM7L 3MECA 2YHXA 3ZX2A 1HNZK 2OYQA 3QLHA 2KFZA 4N56A 2V7ZA 1QHAA 3CPWM 4BACA 3SJJA 2F96A 2IAJA 3EE8A 3HYFA 3ENHA 4JI2K 1Q8IA 2BANA 4Z94A 2AP1A 3J7YP 2ITMA 4DU3A 4FJLA 2D0AA 4KHWA 4FWMA 4YOYA 4YY3K 4KHPK 1NKCA 4XH5A 2OZMA 4CIFA 4JAXA 4BR4A 5AQJA 3LDNA 3AVLA 4DF4A 4FLVA 4BRDA 3AA4A 5SWMA 1KVCA 3OJSA 3HI0A 1HPMA 3LM9A 4JKCA 4BVOA 3ASMA 3MN7A 1HRHA 3VQAA 3CETA 2HHXA 3O9UA 1RT2A 3EZWA 3DI6A 5KGWA 1P90A 4LFAK 3A0IX 3DYAA 3EY1A 4KTZA 3SPZA 4IFVA 2QW9A 2P51A 3ZETB 3V9WA 1IBLK 3RRGA 1LWFA 3BGRA 4CF0A 5GADP 1UOCA 2HHWA 1IKXA 2YV0X 4BR5A 3HTVA 2A5XA 1XHXA 2QWPA 1OVYA 3RR7A 2P9IB 4JKAA 4IOAL 3JSMA 3CC7N 5AQLA 3HM8A 1HLUA 3TI0A 1BG3A 4M41A 1SKWA 2PYJA 1NLVA 2YX6A 2HHVA 3F73A 3MAQA 3KLEA 4ID1A 3FFIA 3D2FA 3HBTA 4NYFA 4HWIA 5AQWA 2PAVA 4OPJA 5CHIA 4CIGA 3G10A 3BUZB 3THXB 2D0BA 4BWJA 2FBVA 4CVNE 1DKGD 4O5BA 2VWBA 2B5JA 4W5OA 3OYBA 2RF2A 4FJGA 3LDLA 5C15A 5EVZA 1V4TA 3SQ1A 1MWKA 5C25A 1XC3A 2P9KA 4HVJA 1JLAA 2VG5A 2VQEK 3U3GA 2G8HA 3HJFA 5CYMA 5J2NA 4DKWA 2P9UB 3IAYA 1ILYA 3FLCO 3WEEA 4Z4EA 1RT7A 3HPGA 5AQFA 2QXFA 3R8EA 1KLMA 2A40A 1YVNA 2JGUA 4NB4A 4E1JA 4C1NI 4E1MA 4LF7K 1T6CA 3HVRA 3J8AA 3K5MA 1KTQA 1VAZA 3CQYA 4JKGA 3C7NA 1WNSA 2ZM6K 3ENBA 1XUPO 4BDPA 3T7ZA 1LWEA 1CXUA 2E6LA 4K0KK 1S6QA 4RG8A 4JD2B 3AO3A 4IBNA 3ID6A 4OKKA 2D1KA 1HKGA 3GL1A 1HQUA 1L3TA 4O8KA 1NK7A 4CJTA 5C42A 5LL6Z 4RW8A 1CXQA 3KK2A 3SQ4A 4KFBA 3CC2N 2FBXA 3GE1A 5BN8A 3CJAA 1CZAN 4C8KA 1D8YA 4AHRA 5LJVA 1XQSC 1TV6A 1Q9YA 1BI4B 2V7YA 1JLFA 3N4PA 4HUFA 4HUGA 5C0YA 2HNYA 2E1YA 4FOEA 2F9WA 1HNIA 1TKXA 1XNQK 5IT9O 4IKFA 4PY5A 3VTIA 4DR5K 1X3MA 4OKEA 2QA4N 3ZYYX 1HPZA 2ITGA 2FXUA 3E1YA 3F2KA 1UWBA 3O9RA 3MX5A 2D5RA 4KREA 5AQZA 4BG8A 3PY8A 2BH1A 3IRXA 4KHQA 4EHUA 3CIPA 4BE2A 3WNHA 4CJPA 1IG9A 1Z26A 1WSGA 5IWAK 1VQ5N 3TWHA 4DTMA 4CE9A 2YHYA 4EIAA 3M3ZA 4PA1A 3OVNA 4CGHA 3VEVA 3QERA 4A61A 4B3RK 1EXQA 1J9AA 2VQFK 2PFUA 2UUBK 1NK8A 3W3DA 3O1WA 3C65A 3AVHA 3VETA 1QS4A 3A5OC 1HNWK 3OYLA 5ADXH 4GNIA 5CY4A 3A5MC 3VEZA 3VGLA 3OYEA 4F4KA 1IH7A 4WFBL 3PO4A 2HHSA 3AA3A 4E19A 3WXLA 3K5NA 1RTIA 4I7FA 2Q97A 5DM6L 4BRAA 2Y1IA 5TKYA 5KQ8A 4CHNA 3LP1A 1NGEA 1DTTA 1XMQK 3KJVA 4K25A 4DSKA 4GY2B 3LM2A 4CEZA 4OPAA 1ZBSA 4FWOA 2QEXN 3LAKA 3G25A 1SL2A 3CQXA 1N33K 5CR4A 4I2QA 2R7YA 2NRHA 1D4XA 3RMBA 4OKJA 2RN2A 3L2RA 2BUPA 3CCJN 3MWTA 1ZXOA 4NLCA 3RSEB 4EZ6A 4LFCK 1VK0A 3O4NA 1VQKN 4H03B 4A5AA 4BROA 4GV6A 2O8CA 3D2EA 3AAQA 4DTOA 1QSYA 4J8FA 1GLJO 3IFRA 2P9PB 1JXEA 4PUOA 1UAXA 4FM2A 2KZMA 2W41A 1LW0A 4JRPA 3NMUA 2QK9A 3VA3A 4FJXA 2D4WA 4IG0A 4RW6A 3OBYA 1I3AA 2F8TA 3HOSA 3PV8A 3QB0A 4Z0UA 2DPNA 4BC2A 1FW6A 3K5OA 4W5QA 1YF5L 3AO5A 1WSJA 4KI4A 4PKGA 3MDQA 2OPRA 5KGXA 4B3TK 1NJZA 1A5WA 1S1UA 3VEOA 1KC8O 5MLCQ 4CJVA 2OPSA 4YOTA 1BQNA 1NGJA 2O8FA 4BC4A 1TAQA 3Q7BA 2Q0RA 4RW4A 4H0TB 3OYNA 3M8RA 1RGIA 2NLXA 3ZLJA 3OTOK 1ZBUA 5FROA 2XHBA 5J2QA 2E2PA 4CJ7A 3ZT1A 2YJFA 1SL0A 4GVMA 1TYQB 4C8MA 5HL7L 4X64K 4QS8A 4A62A 2E20A 4FWRA 2BGGA 1NK9A 4FM1A 2P9LA 1S3XA 1NGHA 3OBWA 5M1QA 3NGYA 1J53A 3SI6A 3QEVA 4R79A 3KZBA 1MDUB 2HBLA 3LWLA 1QSLA 3C94A 1QZ6A 4FYDA 2O8DA 2X74A 3K2PA 1NNEA 4CZJA 3L2QA 4F8RA 1CZ9A 1WAFA 5LY3A 3EO3A 5FPEA 3MN9A 4FVMA 1R0AA 4DQQA 3U9DA 4IFEA 4CZGA 4KHNA 3M5RA 3MCPA 4YOWA 2PBDA 2I7PA 3ULEA 4I2PA 3PO5A 1VSMA 4UY8O 4JKEA 4F3OA 1SUQA 4B8CA 4BRCA 3TU5A 1OVQA 4CEOA 4CEFA 1JXBA 4BG9A 4LSNA 4FZYA 4QCLA 1QZ5A 4B9QA 4YDUA 4B9NA 3DLRA 3THVA 3ZSRA 1LOTB 5HRRA 4PQUA 4MFBA 3UKRA 4B1YB 5AQOA 1YUWA 3ATVA 3CYMA 4DV2K 1J6ZA 4DV7K 4CGGA 4LSLA 2FC0A 2YNHA 3H45C 4K41A 4DTUA 1QQMA 1U2VA 2ZJQL 4B9TA 2NUBA 4LH5A 5SZTA 1SKSA 1HQEA 4MO5A 3VQDA 4H0YB 3DXKB 4DSFA 4H0PA 4WQ5A 3NVMA 4FWLA 4IFYA 5HBMA 4YNQA 3A2FA 1K8KA 2BTFA 1TKDA 2W40A 2ZGYA 2ZF5O 2QWLA 2ZD1A 4W5TA 3VF2A 1C0GA 3PIOL 3VQCA 1XHZA 5F2RA 2G8WA 3VQ5A 3G0ZA 3C6UA 3JXUA 3UE5A 3UKUA 3A5LC 4M3RA 1EP4A 1NK0A 3O9SA 4EAHD 1XMOK 2KFNA 1MA9B 4KI6A 1HJRA 3OYKA 2I7NA 1HJOA 4XH4A 4C1NK 1D9DA 4G9ZA 4YFUA 3H1QA 3O80A 3O9QA 3KK7A 4B1VA 3UB5A 5BR8K 3B8AX 3U6FA 3THWA 4O55A 3AO1A 3THYA 1HNVA 1KD1O 5E41A 3V4IA 1QQNA 4FWSA 1CZBA 1MWMA 4FM0A 1VRTA 1N36K 3SQ0A 4GVEA 3O6WA 4W5RA 1T7PA 1Q81O 3O4WA 2XY8A 4DSJA 4CGIA 4YOXA 1HYVA 5C24A 4DV3K 5AQTA 4WFNL 2GTDA 1HMVA 4OPHA 2I5JA 5M1PA 1KAYA 4CF9A 3VF6A 1A5VA 4DS5A 5ADXA 4BR9A 3EKUA 4FJHA 4H5WA 3CG7A 4DR4K 3CFOA 1M1KO 3IUCA 4IWVA 5ELZA 5CZ2A 4CHZA 1GLLO 4OLAA 3MCAB 3T1AA 4FL9A 1GOAA 3CCVN 5I3UA 5JS1A 1B92A 4CBWA 1TL3A 4NXMK 1U45A 3QINA 4B3MK 4IXCA 1TGOA 3HXMA 2QWQA 3CM5A 3SUNA 2P1JA 5AFUH 3LPTA 1I39A 2GX9A 3H3OB 3O08A 1L5UA 2YNIA 3J7ZO 3OHRA 3BF3A 3FR0A 1HR0K 3SBTA 1T44A 2ZE2A 4FWQA 1UA0A 2NRZA 3O8MA 3ZT0A 3ZSWA 2QWMA 4H5TA 2A3ZA 3M8QA 4OJRA 3LAMA 5AQRA 2UYTA 2JLEA 1HYSA 4Y0WA 1ATSA 3DXMB 3MEGA 5J2MA 5EOYA 3F9MA 1B9FA 2NRTA 3OS2A 1LV5A 2DFFA 4JS5A 5BRDA 4FJKA 4F3TA 3DWLA 1NK6A 3T69A 3NFAA 3KLFA 1XI1A 4BQLA 2XY6A 2D0CA 4PKIA 4CEBA 1D9FA 3HZ6A 5AZIB 4NYNA 1VQ8N 4CJLA 2ETJA 5C2FA 3TTFA 2KHOA 4ZTFA 3SBGA 3R3LA 1FKOA 4Q0BA 4MO4A 1WLJA 3AVFA 3WNEA 4DR2K 4J2BA 3QIPA 3E66A 4M45A 3L4IA 4B1UB 3PLAA 5E26A 4FLYA 3M1FA 4ISFA 1SAZA 3I0SA 1N5YA 3LDSA 2PY5A 3DLHA 3AVIA 2G8KA 4M3TA 1TK0A 4Y1CA 3QFUA 2P9SB 3SV4A 4E89A 1IG8A 4E7KA 3PX0A 1S1VA 3NH2A 1QSSA 4ELVA 1U48A 3AGKA 4OGEA 3BP8A 3HSCA 1JLBA 4CEEA 2F8SA 4IEIA 4CJKA 1EETA 5HP1A 2CH5A 3QEIA 4BR2A 3KIOA 5A2QO 3NH0A 4DB3A 3H1VX 3AA5X 4FJIA 1OH5A 5TKWA 3TAQA 2OA8A 1E4GT
chains in the Genus database with same CATH topology
3SUOA 5FRMA 1DLOA 4CFDA 2QKKA 3V9XA 3QERA 4C8OA 4Z4GA 1C0MA 3SQ2A 3K58A 2KTQA 2QKBA 1EXQA 3RR8A 2IC3A 1J9AA 3QNNA 4K8ZA 1VSIA 1ZBFA 4AHCA 4DU4A 1RTHA 1NK8A 4HUEA 4FK0A 4H4OA 4F2RA 3HSTB 3AVHA 4FJ9A 4J2DA 1QS4A 4E3SA 3LP2A 3OYLA 2BDPA 1WSEA 4JLHA 4JRQA 3ZT4A 3AVBA 5CY4A 4CJWA 3B6OA 1QHTA 1W0HA 2IDOA 1NJXA 1QTMA 2Z1JA 3DOLA 4ID5A 3S3OA 3MEDA 2GUIA 1JL2A 3MXJA 3OYEA 1TKZA 1Q9XA 5J1EA 4M3XA 4DQSA 4F4KA 1IH7A 1TL1A 3LP3A 2DFHA 3ZSZA 3OS0A 1VSFA 3AA3A 4E19A 3KLHA 4DU1A 3S9HA 4CK1A 3K5NA 1RTIA 4I7FA 3ZSYA 3HPOA 1KRPA 4GW6A 4XIUA 3JYTA 4AHUA 3IG1A 4DQRA 2Y1IA 4CHNA 1L3UA 2VG6A 3VQ8A 4AHSA 3QEWA 3LP1A 4BE0A 1RDDA 2KZZA 1DTTA 1C6VA 3OS1A 3NF9A 1XWLA 4FW2A 4KV8A 3AA2A 3OY9A 3OYJA 3KJVA 4Z4CA 4DSKA 4ELTA 4CEZA 3OYAA 3DM2A 2HHUA 2HB5A 3AVJA 4FCYA 3LAKA 1NK5A 4DTJA 4EZ9A 1BIUA 4Q5VA 1SL2A 3V81A 1J5OA 4I2QA 2R7YA 4DTPA 3SV3A 3LP0A 1YT3A 4DSLA 1BCMA 1LWCA 2WONA 3RMBA 4DQIA 4OKJA 2VWJA 1YVUA 2LSNA 4CF1A 2RN2A 3L2RA 4RW9A 1FKPA 2O4GA 2Y1JA 1K6YA 3P1GA 4C8LA 1REVA 1UA1A 3PX6A 3CQ8A 1GOCA 4ZHRA 4EZ6A 1GOBA 4HCBA 3S3NA 1LW2A 4LY7A 1LAVA 1VK0A 3O4NA 2W42A 5HROA 3KKSA 3TABA 1C1AA 2GV9A 3CM6A 3AVAA 1RCHA 1RDAA 3KKRA 1C0UA 3C6TA 3LPUA 4H8KA 4DTOA 1ASUA 1QSYA 3ITHA 2A1RA 2X78A 3ISNC 4FZZA 3OYHA 2X6SA 1RT1A 1JXEA 3I0RA 3HT3A 4PUOA 3OYCA 4E0DA 4R5PA 1UAXA 3OYFA 1KSPA 4FM2A 2ZQBA 3V9ZA 1RTJA 3VQ6A 3F9KA 5FRNA 2KZMA 4JRPA 1LW0A 2ATQA 4CGHA 3TAEA 1WSHA 2QK9A 3ZSQA 3AVMA 3VA3A 1U47A 1KLNA 4CCHA 4FJXA 3DMJA 5JS2A 4IG0A 4CJFA 1KFSA 4RW6A 4O44A 2G8UA 4PWDA 1JLEA 4KHUA 3HK2A 1I3AA 4TSXA 2F8TA 2DTUA 1D5AA 1JKHA 3EYZA 4DMNA 3PV8A 4IG3A 4Z0UA 1JLQA 4DTRA 3V1OA 1X9MA 3VN5A 2YHAA 1KCFA 1QQCA 3K5OA 4W5QA 3TAPA 4KAZA 4FK4A 4BDZA 4DG1A 3NF7A 4N5SA 3RWUA 1SL1A 3KLIA 1U04A 1RT3A 1ZBLA 2HW3A 5KTQA 3AO5A 1WSJA 4CJSA 1KFDA 4DLEA 2PZSA 4CFBA 4KI4A 4KB1A 2OPRA 5KGXA 4B9MA 3D0PA 3TAGA 1NJZA 1A5WA 1S1UA 3QO9A 2O4IA 5K14A 3WNFA 1TAUA 1S9EA 3HVTA 1X9SA 4F2SA 5I42A 3SZ2A 1BISA 4O4GA 4N41A 1T05A 3VQ4A 3VQ7A 3ZT3A 4CJVA 2OPSA 1BQNA 4QAGA 4CIEA 4EP4A 2DY4A 4KHSA 3P83D 1RT6A 3ALYA 2KW4A 3V1RA 2XY7A 3T3FA 3OJUA 1TAQA 3SCXA 1BI4A 4RW4A 1RBSA 4CHOA 3QEXA 4E7IA 1FK9A 3RRHA 4CJQA 1ASWA 3M8SA 3OYNA 4DFKA 3AO4A 3NF8A 1ASVA 3M8RA 3VQBA 4CJRA 3DLKA 4B08A 4EP5A 2OZSA 4CFAA 4E7LA 1ZBUA 4DFPA 5FROA 4KPYA 2XHBA 1BQMA 4O0JA 5J2QA 4FZXC 3K57A 1JL1A 3ZSXA 3ZT1A 2IGIA 3VA0A 1SL0A 2Z1GA 2DFEA 4GVMA 4C8MA 3NE6A 3NCIA 4KHYA 4UQGA 4B9SA 2HHQA 4WE1A 2EHGA 2YKNA 1RTDA 4AILC 1C1CA 1J54A 4B8AB 3TANA 2BGGA 1NK9A 1X1PA 1S6PA 3EZ5A 4FM1A 3U3YA 4FJ5A 4KRFA 3VQQA 3I8DA 4DTXA 4O0IA 4NCGA 4DLGA 3SUPA 4ELUA 1A5XA 1F21A 5J2PA 4FJMA 3NAEA 5DMRA 3NGYA 4OGCA 4NCBA 4Z4IA 3QESA 1J53A 5D3GA 3HO1A 1BGXT 3AVKA 3SI6A 3OYMA 2XO7A 3QNOA 4DS4A 3QEVA 5HRSA 3L2VA 1NKBA 1NKEA 1RBTA 4FJJA 1T03A 1T8EA 3MECA 1SV5A 4M42A 3LWLA 4FW1A 2OYQA 4W5NA 3QLHA 1QSLA 3C94A 4DQPA 4FYDA 4CGFA 4B3OA 2X74A 2KFZA 3K2PA 4N56A 3L2QA 4BACA 4CESA 1CZ9A 2XRIA 3NHGA 3DLBA 2VG7A 4F8RA 1BL3A 1RDCA 3SJJA 2F96A 4N76A 2IAJA 1WAFA 3KD1E 3HYFA 4CECA 3SPYA 1IO2A 4LD0A 4QOZB 5FDLA 3AVCA 4FVMA 4BWMA 1U49A 1G15A 2A1SA 1S9GA 4DQQA 3NGIA 3TARA 5KI6A 1R0AA 1ZYQA 4I9QA 1Q8IA 2BANA 4CJ5A 3CFPA 4KKOA 3QETA 3L3UA 1NJYA 3TAFA 2PYLA 4KHNA 2X6NA 4DU3A 4I2PA 3PO5A 1VSMA 4FJLA 4F3OA 1SUQA 2D0AA 3TR8A 1RNHA 4B8CA 4KHWA 3DLGA 4IDKA 1YTUA 1SKRA 1NKCA 2OZMA 4CIFA 4CEOA 4CEFA 1JXBA 3NGZA 3RTVA 2YKMA 2IS3A 3AVLA 4LSNA 4DF4A 4FLVA 4FZYA 1C0TA 2FBYA 4QCLA 4B9NA 3AA4A 5SWMA 1KVCA 3OJSA 2B4JA 3DLRA 4RW7A 4HTUA 3ZSRA 1FXXA 3THVA 1ITGA 5HRRA 4FLWA 4M3WA 3ASMA 4MFBA 1HRHA 3VQAA 4PQUA 2HHXA 3O4QA 1RT2A 3AVNA 3DI6A 4KO0A 5KGWA 5HLFA 4OPKA 4ICLA 2FBTA 3DYAA 5DK5A 4CFCA 3EY1A 4KTZA 3CYMA 4Y1DA 3SPZA 4IFVA 4DFMA 2P51A 3V9WA 2EX3A 3T19A 2HVIA 4CGGA 3RRGA 2XY5A 1LWFA 1VSJA 2FC0A 2YNHA 3BGRA 4H4MA 4LSLA 4CF0A 4CHQA 4DTUA 1UOCA 2HMIA 5EU7A 4B9TA 2NUBA 1IKXA 1VSDA 1VRUA 2YV0X 4LH5A 1XHXA 4CF8A 5SZTA 5T7BA 4CJEA 1HQEA 4CK3A 1SKSA 3OYDA 3VQDA 3RR7A 3JSMA 4DSFA 3O3HA 3V6DA 3TI0A 4IFYA 3UIQA 4M41A 5HBMA 4YNQA 4B9VA 3L8BA 3A2FA 1SKWA 2P5OA 4B9LA 1TKDA 2PYJA 4FJ8A 3AVGA 3L2WA 2HHVA 3F73A 2ZD1A 3TAMA 4W5TA 2RKIA 3MAQA 1C1BA 3VQCA 3KLEA 1XHZA 3KD5E 3HP9A 2G8WA 3PX4A 3VQ5A 3G0ZA 3ZT2A 3C6UA 3KK1A 1WSFA 3NDKA 4ID1A 4FJNA 3FFIA 1BHLA 4CEDA 4NYFA 4CHYA 4M3RA 4OPJA 4CEQA 1EP4A 1WN7A 4CIGA 3G10A 1S1WA 3QIOA 1NK0A 2D0BA 4BWJA 2KFNA 3VQ9A 3DLEA 1HJRA 4KI6A 3OYKA 2FBVA 4G1QA 1D9DA 4O5BA 2G8VA 4YFUA 2B6AA 3BDPA 3DOKA 1HYZA 3C95A 2OPQA 2KQ2A 2HHTA 2B5JA 1KVAA 4B9UA 3U6FA 4O55A 3AO1A 4W5OA 3OYBA 1HNVA 4J2AA 2RF2A 5E41A 4FJGA 3V4IA 1JLGA 2E6MA 1CZBA 1S1TA 1L3VA 1JLCA 4DSIA 4FM0A 1VRTA 3SQ1A 4DTSA 4CGDA 3SQ0A 3NH1A 4W5RA 5C25A 1VSLA 1TK8A 1T7PA 4FXDA 2RPIA 2Z1HA 4DWIA 2XY8A 4HVJA 4CGIA 4DSJA 3LALA 1JLAA 1HYVA 4CJ4A 3KK3A 4Z4FA 3LANA 5C24A 2VG5A 4FLTA 4OLBA 3NF6A 3SNNA 1HMVA 2I5JA 3U3GA 1NOYA 4CF9A 3DRPA 1A5VA 2G8HA 3O3FA 4DS5A 3HJFA 3K59A 4FJHA 5CYMA 3CG7A 3CFOA 5J2NA 1S5JA 4OVLA 1Y97A 1RBUA 1B9DA 3IAYA 5CZ2A 4CHZA 4OLAA 1RT5A 5HRPA 1WSIA 3T1AA 4CF2A 4Z4EA 1GOAA 1RT7A 1IKVA 3HPGA 3QEPA 2G8FA 4J2EA 2QXFA 2OPPA 4BDYA 3RMDA 5I3UA 3D45A 2BE2A 5JS1A 1B92A 1Z25A 3V1QA 1KLMA 1TL3A 3MXMA 4FK2A 2IOCA 2JGUA 4AHTA 1U45A 3QINA 2G8IA 1NK4A 1IKWA 1TGOA 1N6QA 3HXMA 3ZCMA 4CJUA 4E1MA 3CM5A 3L2UA 1O1WA 3HL8A 3V9UA 1YTAA 3HVRA 3OYIA 3SUNA 4N47A 1KTQA 3K5MA 2P1JA 1WNSA 3LPTA 1I39A 2YHBA 3K5LA 4BDPA 3HPHA 1EKEA 1L5UA 4CGJA 3S3MA 1LWEA 5CYQA 4FLUA 1CXUA 4E7HA 2YNIA 2P5GA 1BCOA 2E6LA 1S6QA 4RG8A 1VSKA 4Z4HA 2YNFA 3AO3A 4M3YA 2HNZA 4IBNA 3O3GA 3M8PA 1QE1A 2ZE2A 4OKKA 1L3TA 3ZSOA 1HQUA 4NCAA 1UA0A 1NK7A 4CJTA 4E1NA 4M3ZA 5C42A 1W9HA 3IS9A 1CXQA 4RW8A 1ZBHA 2VWKA 3VQPA 3ZSWA 3ZT0A 4CK2A 3KK2A 1S1XA 3M8QA 3LWMA 4OJRA 3SQ4A 1VSEA 3LAMA 2JLEA 4KFBA 1HYSA 3MEGA 4I9LA 3DRSA 1RDBA 2FBXA 1B9FA 5J2MA 3E01A 3OS2A 1LV5A 4FLXA 2DFFA 4C8KA 4FLZA 4JS5A 1D8YA 1MU2A 3PO4A 4FJKA 4F3TA 4AHRA 1XC9A 4M3UA 3WNGA 4CERA 1NK6A 1RILA 1TV6A 3NFAA 5CZ1A 3KLFA 5KRTA 3LZIA 1XI1A 2XY6A 4E7JA 2D0CA 5KRSA 2HNDA 2Q3SA 4CEBA 1Q9YA 1KVBA 1BI4B 1D9FA 1JLFA 1WAJA 1BIZA 4HUGA 4HUFA 1L3SA 2HNYA 3VQEA 4NYNA 1HNIA 4CJLA 2ETJA 1TKXA 4L8RB 2AJQA 4IKFA 4PY5A 4ZTFA 3KLGA 4ZTJA 3V9SA 4HCCA 3DRRA 2HHWA 3PUFA 3AV9A 3ZSVA 1FKOA 2E4LA 4Q0BA 3MXIA 1NOZA 2Z1IA 1VSHA 1WLJA 3AVFA 3H08A 3WNEA 4OKEA 4CHPA 4DSEA 1HPZA 4J2BA 2ITGA 3QIPA 3LZJA 4M45A 1X9WA 1UWBA 2GBZA 4K8XA 4AH9A 4FLYA 3SYZA 2D5RA 3NBPA 3CFRA 4KREA 1TVRA 1IKYA 3I0SA 1N5YA 3LDSA 4DTNA 2PY5A 3DLHA 3AVIA 3OYGA 1TKTA 2G8KA 4M3TA 1TK0A 4Y1CA 1CLQA 3SUQA 3RMAA 1TK5A 3SV4A 3PY8A 1RBVA 4C8NA 2HHSA 3IRXA 4E89A 1ZBIA 1RT4A 4E7KA 4DF8A 3HP6A 3PX0A 1S1VA 4KHQA 3NH2A 4CJ3A 1U4BA 1QSSA 4ELVA 1U48A 4OGEA 4CEAA 4CEEA 4BE1A 1JLBA 4MQ3A 4BE2A 4AHVA 4CJKA 4KB0A 2F8SA 1NJWA 3WNHA 1EETA 4CJPA 4HHTA 3RMCA 1IG9A 5HP1A 1Z26A 2YNGA 3QEIA 1WSGA 3KIOA 3L3VA 4KTWA 3KTQA 4KTQA 3NH0A 5HRNA 3MEEA 3B6PA 2HVHA 3TWHA 3AA5X 4GMJB 4DTMA 1EX4A 1DTQA 4CE9A 4FJIA 4JS4A 4FJ7A 2WOMA 3AO2A 1LAWA 3P5JA 4LH4A 3HM9A 3ULDA 4PA1A 3TAQA 2OA8A 4DFJA 1RBRA 3OVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SUO A;  5FRM A;  1DLO A;  4CFD A;  2QKK A;  3V9X A;  3QER A;  4C8O A;  4Z4G A;  1C0M A;  3SQ2 A;  3K58 A;  2KTQ A;  2QKB A;  1EXQ A;  3RR8 A;  2IC3 A;  1J9A A;  3QNN A;  4K8Z A;  1VSI A;  1ZBF A;  4AHC A;  4DU4 A;  1RTH A;  1NK8 A;  4HUE A;  4FK0 A;  4H4O A;  4F2R A;  3HST B;  3AVH A;  4FJ9 A;  4J2D A;  1QS4 A;  4E3S A;  3LP2 A;  3OYL A;  2BDP A;  1WSE A;  4JLH A;  4JRQ A;  3ZT4 A;  3AVB A;  5CY4 A;  4CJW A;  3B6O A;  1QHT A;  1W0H A;  2IDO A;  1NJX A;  1QTM A;  2Z1J A;  3DOL A;  4ID5 A;  3S3O A;  3MED A;  2GUI A;  1JL2 A;  3MXJ A;  3OYE A;  1TKZ A;  1Q9X A;  5J1E A;  4M3X A;  4DQS A;  4F4K A;  1IH7 A;  1TL1 A;  3LP3 A;  2DFH A;  3ZSZ A;  3OS0 A;  1VSF A;  3AA3 A;  4E19 A;  3KLH A;  4DU1 A;  3S9H A;  4CK1 A;  3K5N A;  1RTI A;  4I7F A;  3ZSY A;  3HPO A;  1KRP A;  4GW6 A;  4XIU A;  3JYT A;  4AHU A;  3IG1 A;  4DQR A;  2Y1I A;  4CHN A;  1L3U A;  2VG6 A;  3VQ8 A;  4AHS A;  3QEW A;  3LP1 A;  4BE0 A;  1RDD A;  2KZZ A;  1DTT A;  1C6V A;  3OS1 A;  3NF9 A;  1XWL A;  4FW2 A;  4KV8 A;  3AA2 A;  3OY9 A;  3OYJ A;  3KJV A;  4Z4C A;  4DSK A;  4ELT A;  4CEZ A;  3OYA A;  3DM2 A;  2HHU A;  2HB5 A;  3AVJ A;  4FCY A;  3LAK A;  1NK5 A;  4DTJ A;  4EZ9 A;  1BIU A;  4Q5V A;  1SL2 A;  3V81 A;  1J5O A;  4I2Q A;  2R7Y A;  4DTP A;  3SV3 A;  3LP0 A;  1YT3 A;  4DSL A;  1BCM A;  1LWC A;  2WON A;  3RMB A;  4DQI A;  4OKJ A;  2VWJ A;  1YVU A;  2LSN A;  4CF1 A;  2RN2 A;  3L2R A;  4RW9 A;  1FKP A;  2O4G A;  2Y1J A;  1K6Y A;  3P1G A;  4C8L A;  1REV A;  1UA1 A;  3PX6 A;  3CQ8 A;  1GOC A;  4ZHR A;  4EZ6 A;  1GOB A;  4HCB A;  3S3N A;  1LW2 A;  4LY7 A;  1LAV A;  1VK0 A;  3O4N A;  2W42 A;  5HRO A;  3KKS A;  3TAB A;  1C1A A;  2GV9 A;  3CM6 A;  3AVA A;  1RCH A;  1RDA A;  3KKR A;  1C0U A;  3C6T A;  3LPU A;  4H8K A;  4DTO A;  1ASU A;  1QSY A;  3ITH A;  2A1R A;  2X78 A;  3ISN C;  4FZZ A;  3OYH A;  2X6S A;  1RT1 A;  1JXE A;  3I0R A;  3HT3 A;  4PUO A;  3OYC A;  4E0D A;  4R5P A;  1UAX A;  3OYF A;  1KSP A;  4FM2 A;  2ZQB A;  3V9Z A;  1RTJ A;  3VQ6 A;  3F9K A;  5FRN A;  2KZM A;  4JRP A;  1LW0 A;  2ATQ A;  4CGH A;  3TAE A;  1WSH A;  2QK9 A;  3ZSQ A;  3AVM A;  3VA3 A;  1U47 A;  1KLN A;  4CCH A;  4FJX A;  3DMJ A;  5JS2 A;  4IG0 A;  4CJF A;  1KFS A;  4RW6 A;  4O44 A;  2G8U A;  4PWD A;  1JLE A;  4KHU A;  3HK2 A;  1I3A A;  4TSX A;  2F8T A;  2DTU A;  1D5A A;  1JKH A;  3EYZ A;  4DMN A;  3PV8 A;  4IG3 A;  4Z0U A;  1JLQ A;  4DTR A;  3V1O A;  1X9M A;  3VN5 A;  2YHA A;  1KCF A;  1QQC A;  3K5O A;  4W5Q A;  3TAP A;  4KAZ A;  4FK4 A;  4BDZ A;  4DG1 A;  3NF7 A;  4N5S A;  3RWU A;  1SL1 A;  3KLI A;  1U04 A;  1RT3 A;  1ZBL A;  2HW3 A;  5KTQ A;  3AO5 A;  1WSJ A;  4CJS A;  1KFD A;  4DLE A;  2PZS A;  4CFB A;  4KI4 A;  4KB1 A;  2OPR A;  5KGX A;  4B9M A;  3D0P A;  3TAG A;  1NJZ A;  1A5W A;  1S1U A;  3QO9 A;  2O4I A;  5K14 A;  3WNF A;  1TAU A;  1S9E A;  3HVT A;  1X9S A;  4F2S A;  5I42 A;  3SZ2 A;  1BIS A;  4O4G A;  4N41 A;  1T05 A;  3VQ4 A;  3VQ7 A;  3ZT3 A;  4CJV A;  2OPS A;  1BQN A;  4QAG A;  4CIE A;  4EP4 A;  2DY4 A;  4KHS A;  3P83 D;  1RT6 A;  3ALY A;  2KW4 A;  3V1R A;  2XY7 A;  3T3F A;  3OJU A;  1TAQ A;  3SCX A;  1BI4 A;  4RW4 A;  1RBS A;  4CHO A;  3QEX A;  4E7I A;  1FK9 A;  3RRH A;  4CJQ A;  1ASW A;  3M8S A;  3OYN A;  4DFK A;  3AO4 A;  3NF8 A;  1ASV A;  3M8R A;  3VQB A;  4CJR A;  3DLK A;  4B08 A;  4EP5 A;  2OZS A;  4CFA A;  4E7L A;  1ZBU A;  4DFP A;  5FRO A;  4KPY A;  2XHB A;  1BQM A;  4O0J A;  5J2Q A;  4FZX C;  3K57 A;  1JL1 A;  3ZSX A;  3ZT1 A;  2IGI A;  3VA0 A;  1SL0 A;  2Z1G A;  2DFE A;  4GVM A;  4C8M A;  3NE6 A;  3NCI A;  4KHY A;  4UQG A;  4B9S A;  2HHQ A;  4WE1 A;  2EHG A;  2YKN A;  1RTD A;  4AIL C;  1C1C A;  1J54 A;  4B8A B;  3TAN A;  2BGG A;  1NK9 A;  1X1P A;  1S6P A;  3EZ5 A;  4FM1 A;  3U3Y A;  4FJ5 A;  4KRF A;  3VQQ A;  3I8D A;  4DTX A;  4O0I A;  4NCG A;  4DLG A;  3SUP A;  4ELU A;  1A5X A;  1F21 A;  5J2P A;  4FJM A;  3NAE A;  5DMR A;  3NGY A;  4OGC A;  4NCB A;  4Z4I A;  3QES A;  1J53 A;  5D3G A;  3HO1 A;  1BGX T;  3AVK A;  3SI6 A;  3OYM A;  2XO7 A;  3QNO A;  4DS4 A;  3QEV A;  5HRS A;  3L2V A;  1NKB A;  1NKE A;  1RBT A;  4FJJ A;  1T03 A;  1T8E A;  3MEC A;  1SV5 A;  4M42 A;  3LWL A;  4FW1 A;  2OYQ A;  4W5N A;  3QLH A;  1QSL A;  3C94 A;  4DQP A;  4FYD A;  4CGF A;  4B3O A;  2X74 A;  2KFZ A;  3K2P A;  4N56 A;  3L2Q A;  4BAC A;  4CES A;  1CZ9 A;  2XRI A;  3NHG A;  3DLB A;  2VG7 A;  4F8R A;  1BL3 A;  1RDC A;  3SJJ A;  2F96 A;  4N76 A;  2IAJ A;  1WAF A;  3KD1 E;  3HYF A;  4CEC A;  3SPY A;  1IO2 A;  4LD0 A;  4QOZ B;  5FDL A;  3AVC A;  4FVM A;  4BWM A;  1U49 A;  1G15 A;  2A1S A;  1S9G A;  4DQQ A;  3NGI A;  3TAR A;  5KI6 A;  1R0A A;  1ZYQ A;  4I9Q A;  1Q8I A;  2BAN A;  4CJ5 A;  3CFP A;  4KKO A;  3QET A;  3L3U A;  1NJY A;  3TAF A;  2PYL A;  4KHN A;  2X6N A;  4DU3 A;  4I2P A;  3PO5 A;  1VSM A;  4FJL A;  4F3O A;  1SUQ A;  2D0A A;  3TR8 A;  1RNH A;  4B8C A;  4KHW A;  3DLG A;  4IDK A;  1YTU A;  1SKR A;  1NKC A;  2OZM A;  4CIF A;  4CEO A;  4CEF A;  1JXB A;  3NGZ A;  3RTV A;  2YKM A;  2IS3 A;  3AVL A;  4LSN A;  4DF4 A;  4FLV A;  4FZY A;  1C0T A;  2FBY A;  4QCL A;  4B9N A;  3AA4 A;  5SWM A;  1KVC A;  3OJS A;  2B4J A;  3DLR A;  4RW7 A;  4HTU A;  3ZSR A;  1FXX A;  3THV A;  1ITG A;  5HRR A;  4FLW A;  4M3W A;  3ASM A;  4MFB A;  1HRH A;  3VQA A;  4PQU A;  2HHX A;  3O4Q A;  1RT2 A;  3AVN A;  3DI6 A;  4KO0 A;  5KGW A;  5HLF A;  4OPK A;  4ICL A;  2FBT A;  3DYA A;  5DK5 A;  4CFC A;  3EY1 A;  4KTZ A;  3CYM A;  4Y1D A;  3SPZ A;  4IFV A;  4DFM A;  2P51 A;  3V9W A;  2EX3 A;  3T19 A;  2HVI A;  4CGG A;  3RRG A;  2XY5 A;  1LWF A;  1VSJ A;  2FC0 A;  2YNH A;  3BGR A;  4H4M A;  4LSL A;  4CF0 A;  4CHQ A;  4DTU A;  1UOC A;  2HMI A;  5EU7 A;  4B9T A;  2NUB A;  1IKX A;  1VSD A;  1VRU A;  2YV0 X;  4LH5 A;  1XHX A;  4CF8 A;  5SZT A;  5T7B A;  4CJE A;  1HQE A;  4CK3 A;  1SKS A;  3OYD A;  3VQD A;  3RR7 A;  3JSM A;  4DSF A;  3O3H A;  3V6D A;  3TI0 A;  4IFY A;  3UIQ A;  4M41 A;  5HBM A;  4YNQ A;  4B9V A;  3L8B A;  3A2F A;  1SKW A;  2P5O A;  4B9L A;  1TKD A;  2PYJ A;  4FJ8 A;  3AVG A;  3L2W A;  2HHV A;  3F73 A;  2ZD1 A;  3TAM A;  4W5T A;  2RKI A;  3MAQ A;  1C1B A;  3VQC A;  3KLE A;  1XHZ A;  3KD5 E;  3HP9 A;  2G8W A;  3PX4 A;  3VQ5 A;  3G0Z A;  3ZT2 A;  3C6U A;  3KK1 A;  1WSF A;  3NDK A;  4ID1 A;  4FJN A;  3FFI A;  1BHL A;  4CED A;  4NYF A;  4CHY A;  4M3R A;  4OPJ A;  4CEQ A;  1EP4 A;  1WN7 A;  4CIG A;  3G10 A;  1S1W A;  3QIO A;  1NK0 A;  2D0B A;  4BWJ A;  2KFN A;  3VQ9 A;  3DLE A;  1HJR A;  4KI6 A;  3OYK A;  2FBV A;  4G1Q A;  1D9D A;  4O5B A;  2G8V A;  4YFU A;  2B6A A;  3BDP A;  3DOK A;  1HYZ A;  3C95 A;  2OPQ A;  2KQ2 A;  2HHT A;  2B5J A;  1KVA A;  4B9U A;  3U6F A;  4O55 A;  3AO1 A;  4W5O A;  3OYB A;  1HNV A;  4J2A A;  2RF2 A;  5E41 A;  4FJG A;  3V4I A;  1JLG A;  2E6M A;  1CZB A;  1S1T A;  1L3V A;  1JLC A;  4DSI A;  4FM0 A;  1VRT A;  3SQ1 A;  4DTS A;  4CGD A;  3SQ0 A;  3NH1 A;  4W5R A;  5C25 A;  1VSL A;  1TK8 A;  1T7P A;  4FXD A;  2RPI A;  2Z1H A;  4DWI A;  2XY8 A;  4HVJ A;  4CGI A;  4DSJ A;  3LAL A;  1JLA A;  1HYV A;  4CJ4 A;  3KK3 A;  4Z4F A;  3LAN A;  5C24 A;  2VG5 A;  4FLT A;  4OLB A;  3NF6 A;  3SNN A;  1HMV A;  2I5J A;  3U3G A;  1NOY A;  4CF9 A;  3DRP A;  1A5V A;  2G8H A;  3O3F A;  4DS5 A;  3HJF A;  3K59 A;  4FJH A;  5CYM A;  3CG7 A;  3CFO A;  5J2N A;  1S5J A;  4OVL A;  1Y97 A;  1RBU A;  1B9D A;  3IAY A;  5CZ2 A;  4CHZ A;  4OLA A;  1RT5 A;  5HRP A;  1WSI A;  3T1A A;  4CF2 A;  4Z4E A;  1GOA A;  1RT7 A;  1IKV A;  3HPG A;  3QEP A;  2G8F A;  4J2E A;  2QXF A;  2OPP A;  4BDY A;  3RMD A;  5I3U A;  3D45 A;  2BE2 A;  5JS1 A;  1B92 A;  1Z25 A;  3V1Q A;  1KLM A;  1TL3 A;  3MXM A;  4FK2 A;  2IOC A;  2JGU A;  4AHT A;  1U45 A;  3QIN A;  2G8I A;  1NK4 A;  1IKW A;  1TGO A;  1N6Q A;  3HXM A;  3ZCM A;  4CJU A;  4E1M A;  3CM5 A;  3L2U A;  1O1W A;  3HL8 A;  3V9U A;  1YTA A;  3HVR A;  3OYI A;  3SUN A;  4N47 A;  1KTQ A;  3K5M A;  2P1J A;  1WNS A;  3LPT A;  1I39 A;  2YHB A;  3K5L A;  4BDP A;  3HPH A;  1EKE A;  1L5U A;  4CGJ A;  3S3M A;  1LWE A;  5CYQ A;  4FLU A;  1CXU A;  4E7H A;  2YNI A;  2P5G A;  1BCO A;  2E6L A;  1S6Q A;  4RG8 A;  1VSK A;  4Z4H A;  2YNF A;  3AO3 A;  4M3Y A;  2HNZ A;  4IBN A;  3O3G A;  3M8P A;  1QE1 A;  2ZE2 A;  4OKK A;  1L3T A;  3ZSO A;  1HQU A;  4NCA A;  1UA0 A;  1NK7 A;  4CJT A;  4E1N A;  4M3Z A;  5C42 A;  1W9H A;  3IS9 A;  1CXQ A;  4RW8 A;  1ZBH A;  2VWK A;  3VQP A;  3ZSW A;  3ZT0 A;  4CK2 A;  3KK2 A;  1S1X A;  3M8Q A;  3LWM A;  4OJR A;  3SQ4 A;  1VSE A;  3LAM A;  2JLE A;  4KFB A;  1HYS A;  3MEG A;  4I9L A;  3DRS A;  1RDB A;  2FBX A;  1B9F A;  5J2M A;  3E01 A;  3OS2 A;  1LV5 A;  4FLX A;  2DFF A;  4C8K A;  4FLZ A;  4JS5 A;  1D8Y A;  1MU2 A;  3PO4 A;  4FJK A;  4F3T A;  4AHR A;  1XC9 A;  4M3U A;  3WNG A;  4CER A;  1NK6 A;  1RIL A;  1TV6 A;  3NFA A;  5CZ1 A;  3KLF A;  5KRT A;  3LZI A;  1XI1 A;  2XY6 A;  4E7J A;  2D0C A;  5KRS A;  2HND A;  2Q3S A;  4CEB A;  1Q9Y A;  1KVB A;  1BI4 B;  1D9F A;  1JLF A;  1WAJ A;  1BIZ A;  4HUG A;  4HUF A;  1L3S A;  2HNY A;  3VQE A;  4NYN A;  1HNI A;  4CJL A;  2ETJ A;  1TKX A;  4L8R B;  2AJQ A;  4IKF A;  4PY5 A;  4ZTF A;  3KLG A;  4ZTJ A;  3V9S A;  4HCC A;  3DRR A;  2HHW A;  3PUF A;  3AV9 A;  3ZSV A;  1FKO A;  2E4L A;  4Q0B A;  3MXI A;  1NOZ A;  2Z1I A;  1VSH A;  1WLJ A;  3AVF A;  3H08 A;  3WNE A;  4OKE A;  4CHP A;  4DSE A;  1HPZ A;  4J2B A;  2ITG A;  3QIP A;  3LZJ A;  4M45 A;  1X9W A;  1UWB A;  2GBZ A;  4K8X A;  4AH9 A;  4FLY A;  3SYZ A;  2D5R A;  3NBP A;  3CFR A;  4KRE A;  1TVR A;  1IKY A;  3I0S A;  1N5Y A;  3LDS A;  4DTN A;  2PY5 A;  3DLH A;  3AVI A;  3OYG A;  1TKT A;  2G8K A;  4M3T A;  1TK0 A;  4Y1C A;  1CLQ A;  3SUQ A;  3RMA A;  1TK5 A;  3SV4 A;  3PY8 A;  1RBV A;  4C8N A;  2HHS A;  3IRX A;  4E89 A;  1ZBI A;  1RT4 A;  4E7K A;  4DF8 A;  3HP6 A;  3PX0 A;  1S1V A;  4KHQ A;  3NH2 A;  4CJ3 A;  1U4B A;  1QSS A;  4ELV A;  1U48 A;  4OGE A;  4CEA A;  4CEE A;  4BE1 A;  1JLB A;  4MQ3 A;  4BE2 A;  4AHV A;  4CJK A;  4KB0 A;  2F8S A;  1NJW A;  3WNH A;  1EET A;  4CJP A;  4HHT A;  3RMC A;  1IG9 A;  5HP1 A;  1Z26 A;  2YNG A;  3QEI A;  1WSG A;  3KIO A;  3L3V A;  4KTW A;  3KTQ A;  4KTQ A;  3NH0 A;  5HRN A;  3MEE A;  3B6P A;  2HVH A;  3TWH A;  3AA5 X;  4GMJ B;  4DTM A;  1EX4 A;  1DTQ A;  4CE9 A;  4FJI A;  4JS4 A;  4FJ7 A;  2WOM A;  3AO2 A;  1LAW A;  3P5J A;  4LH4 A;  3HM9 A;  3ULD A;  4PA1 A;  3TAQ A;  2OA8 A;  4DFJ A;  1RBR A;  3OVN A; 
#chains in the Genus database with same CATH topology
 1DLO A;  3ATU A;  1EWR A;  2P9N B;  3ZET A;  1X3N A;  2IIR A;  3FZK A;  3WQT A;  3RR8 A;  4IDH A;  2IC3 A;  4FK0 A;  1RTH A;  5AQM A;  2P9I A;  5BRE A;  4FJ9 A;  3CI5 A;  4J2D A;  4E3S A;  1N34 K;  1WUA A;  3LP2 A;  3VGK A;  1SZ2 A;  3ZT4 A;  1P8Z A;  1K8A O;  3MED A;  4CW7 B;  1TKZ A;  5AQY A;  5J1E A;  1W2B M;  3T1Y K;  3LP3 A;  3ZSZ A;  3K9K A;  3TPQ A;  3WUH A;  3ZSY A;  1OH7 A;  3HPO A;  3THX A;  3VQ8 A;  4AHS A;  3QEW A;  4A2A A;  5KQD A;  1XWL A;  4FW2 A;  3AA2 A;  4Z4C A;  4PHT X;  3AY9 A;  3DM2 A;  2HHU A;  3RVC A;  3ZEU A;  4FVU A;  1NK5 A;  1BU6 O;  1VQ4 N;  1BIU A;  3V81 A;  1KXP A;  1WBB A;  4WQ4 C;  2WON A;  5AQG A;  3AGR A;  3SK3 A;  4CF1 A;  4JN4 A;  2A42 A;  1HNX K;  1K6Y A;  4WYB A;  4C8L A;  2GWK A;  1UA1 A;  4XEI A;  4B3S K;  3CQ8 A;  3S3N A;  1LW2 A;  4LY7 A;  4BRP A;  5EX5 A;  4BGB A;  4JHD A;  2W42 A;  3R6M A;  1EQY A;  4JKB A;  3TAB A;  1C1A A;  2GV9 A;  3C6T A;  2O8E A;  1BWF O;  1W97 L;  4H8K A;  3NVK A;  4XH1 A;  3ITH A;  3O5B A;  2X78 A;  2X6S A;  3FFK B;  1BA1 A;  3I0R A;  1VQ7 N;  3OYC A;  4WFA L;  4E0D A;  1DGK N;  1KSP A;  3V9Z A;  3TAE A;  5H1S Q;  4CJF A;  1KFS A;  4U7B A;  2G8U A;  1JLE A;  4JI1 K;  2DTU A;  4DV5 K;  4DTR A;  2E2O A;  1NWK A;  4CD3 A;  4KAZ A;  4FK4 A;  4BDZ A;  4JD2 A;  3RWU A;  1U04 A;  1ZBL A;  1GLA G;  2HW3 A;  2FF3 B;  2O8B A;  1I94 K;  2W6L A;  1KFD A;  4JNE A;  4LF4 K;  4LFB K;  1S9E A;  1X9S A;  4CZE A;  4O4G A;  3ZT3 A;  4WCE L;  2DY4 A;  1RT6 A;  3OJU A;  1BI4 A;  4E7I A;  4CJQ A;  1IBK K;  2HHH K;  1ASV A;  3CC4 N;  3VEN A;  4CJR A;  4B08 A;  3EKS A;  4H0X B;  2OZS A;  2HVH A;  4CZK A;  4KPY A;  4DFP A;  2YI1 A;  3Q7C A;  4FZX C;  3K57 A;  3ZSX A;  2IGI A;  4M63 C;  3FGU A;  5KPR A;  2DFE A;  2CGK A;  4KHY A;  2NNW A;  4BRE A;  2EHG A;  2E88 A;  3WXI A;  4AIL C;  4JI5 K;  3EZ5 A;  5FLX O;  4FJ5 A;  3VQQ A;  4DLG A;  2YJE A;  1WB9 A;  5J2P A;  3QES A;  5D3G A;  1YJW N;  3HO1 A;  1BGX T;  3FZL A;  5BPN A;  4FJJ A;  1T8E A;  1SV5 A;  4JK8 A;  1OKJ A;  5AQP A;  2JWK A;  2KLA A;  4ILG B;  2IVP A;  2XRI A;  3DLB A;  5AFU A;  4N76 A;  1RDC A;  3KD1 E;  3LL3 A;  1IO2 A;  4LD0 A;  4QOZ B;  3AVC A;  4BRF A;  1U49 A;  1G15 A;  2A6A A;  4I9Q A;  2HF3 A;  3TAR A;  5KI6 A;  2UXC K;  3CFP A;  1NJY A;  3L3U A;  2IVO A;  2X6N A;  1W7A A;  5JMV A;  1RNH A;  4IOX A;  5JVH L;  4IDK A;  1SKR A;  5AQU A;  3I8B A;  5JVG L;  3ENO A;  3CCQ N;  3NGZ A;  3RTV A;  2IS3 A;  3VEW A;  4I6M B;  1C0T A;  2B4J A;  4HTU A;  4RW7 A;  4M3W A;  4ILH A;  4FLW A;  1Z05 A;  5AJ3 K;  3AVN A;  1VQ6 N;  1BO5 O;  4LF5 K;  4KO0 A;  1NJI O;  5HLF A;  4OPK A;  2FBT A;  2F7T A;  5GIN A;  4Y1D A;  2HVI A;  3O1B A;  3CCL N;  2XY5 A;  1VSJ A;  2Q36 A;  4CHQ A;  2HMI A;  5EU7 A;  1VRU A;  1VSD A;  4CF8 A;  1NU0 A;  3OYF A;  3VER A;  4DV0 K;  3KVG A;  4CK3 A;  1YHQ N;  2JWL A;  3OYD A;  1ATN A;  5GAG P;  3O3H A;  3F5T A;  4JEP A;  3UIQ A;  4FJ8 A;  3L8B A;  4FWN A;  3AVG A;  4C23 A;  2NRV A;  2HOE A;  4JK7 A;  3TAM A;  2RKI A;  1C1B A;  3KD5 E;  3ZT2 A;  3WXM B;  3KK1 A;  3CMA N;  1ESV A;  1BHL A;  4KH4 A;  3P39 A;  2UU9 K;  1WN7 A;  2YHW A;  1YJN N;  2CGJ A;  3VQ9 A;  2G8V A;  2B6A A;  2CGL A;  3DOK A;  1HYZ A;  3C95 A;  2GEL A;  2OPQ A;  3MX2 A;  2OTJ N;  2F4V K;  1NGB A;  3H6E A;  4J2A A;  4CI6 A;  2FLO A;  5EXW A;  3CXC M;  1JLG A;  2E6M A;  4DSI A;  1S1T A;  3TSP A;  4IJN A;  4CGD A;  1TK8 A;  1VSL A;  4FXD A;  2VGM A;  3G4S N;  2RPI A;  2Z1H A;  3LAL A;  2QWN A;  3KK3 A;  4WF9 L;  1K9M O;  1T6D A;  3E9O A;  3ID8 A;  4QS9 A;  3ULE B;  4H0V B;  2F9T A;  2UXB K;  2OTL N;  3MN6 A;  4L3Q A;  3O3F A;  3TSU A;  3K59 A;  5AZJ B;  1Y97 A;  1RBU A;  4JKF A;  2QWO A;  1B9D A;  1SQK A;  1RT5 A;  1WSI A;  4CF2 A;  3DAW A;  4YOR A;  1IKV A;  2G8F A;  3QEP A;  4AQY K;  2RE2 A;  2OPP A;  4BDY A;  3D45 A;  4JK9 A;  3V1Q A;  1Z25 A;  4FK2 A;  2IOC A;  3VGM A;  4AHT A;  1NK4 A;  1N6Q A;  3LDO A;  2GUP A;  3ZCM A;  4CJU A;  3L2U A;  1O1W A;  3HL8 A;  3V9U A;  4BRN A;  4CBX A;  2YHB A;  4A2B A;  3K5L A;  1EKE A;  1JCG A;  4FLU A;  4E7H A;  1TUY A;  5GIP A;  1BCO A;  2P5G A;  3FE1 A;  4GV3 A;  4M3Y A;  4FWP A;  1QE1 A;  1GLE G;  1K8K B;  4OLB A;  5BPL A;  4M3Z A;  2D0P A;  4H5V A;  2VYP A;  1WBD A;  3IS9 A;  4A59 A;  1TYQ A;  1ZBH A;  3LWM A;  3VQP A;  1YIT N;  1S1X A;  4BRM A;  1VSE A;  3T1H K;  5C10 A;  2AA4 A;  4I9L A;  3DRS A;  5AQH A;  3E01 A;  4BRG A;  4FLX A;  5F0X A;  5GIO A;  1MU2 A;  3SJH A;  1XC9 A;  4M3U A;  4CER A;  3E9P A;  3GBT A;  5CZ1 A;  5KRT A;  3LZI A;  4E7J A;  5KRS A;  2Q3S A;  4CZL A;  1KVB A;  1BIZ A;  4M7X A;  3VQE A;  5HOO A;  4KBO A;  4PKH A;  4L8R B;  4DCH A;  4ZTJ A;  5C2D A;  3ZSV A;  3AV9 A;  2Z1I A;  3CJC A;  3HRG A;  3SMS A;  1VSH A;  2GEM A;  1OH8 A;  4BR7 A;  3SAH A;  4NO7 A;  4DSE A;  2FSN A;  1HUX A;  3LZJ A;  4FSV A;  1G99 A;  1QQO A;  4CZI A;  4AH9 A;  3SYZ A;  3CFR A;  1TVR A;  3VF4 A;  4DTN A;  2RHK A;  4B1W B;  1CLQ A;  3RMA A;  1TK5 A;  1RBV A;  3IMX A;  1JCE A;  4C8N A;  3PSI A;  1N32 K;  1YJ9 N;  1ZBI A;  1RT4 A;  3CME N;  4A57 A;  4DF8 A;  4CJ3 A;  4CEA A;  3RMC A;  2YNG A;  4K43 A;  4YOU A;  5M1F A;  2NRX A;  3KTQ A;  3B6P A;  1C0F A;  2CH6 A;  1NG9 A;  3AO2 A;  3I55 N;  1LAW A;  4LH4 A;  3ULD A;  4DFJ A;  1RBR A;  3GG4 A;  1C0M A;  2QKB A;  3BZK A;  5KPT A;  3QDK A;  4K8Z A;  1VSI A;  4AHC A;  4DU4 A;  4KH5 A;  1NGG A;  4H4O A;  4F2R A;  3DXK A;  5BRF A;  3MMV A;  2J4R A;  1WSE A;  3J7A P;  4CJW A;  1W0H A;  3EE9 A;  1IJJ A;  1NJX A;  1QTM A;  4DV4 K;  3AAP A;  4ID5 A;  2QXL A;  4BRH A;  3S3O A;  1S22 A;  1JL2 A;  1Q9X A;  4LF8 K;  4M3X A;  2HBK A;  3CJ7 A;  1TL1 A;  2WFB A;  3KLH A;  1VSF A;  4LF9 K;  3TSQ A;  4B1Z A;  4JI3 K;  1KRP A;  4GW6 A;  4AHU A;  3IG1 A;  1K73 O;  1T3V A;  2Q0U A;  4KV8 A;  3OYJ A;  3SAF A;  5BPM A;  4ELT A;  3QBX A;  3OYA A;  2HB5 A;  1HKC A;  4BGA A;  4EZ9 A;  3EN9 A;  3FZH A;  4Q5V A;  1J5O A;  1YT3 A;  4DSL A;  1BCM A;  3GOI A;  2VWJ A;  2LSN A;  5M1O A;  3D2F B;  4JKD A;  5AQI A;  1Q7Y O;  4B1X B;  4ZHR A;  1GOB A;  3QIC A;  3U4L A;  1U6Z A;  4RTF D;  2E2N A;  3KKS A;  2UXD K;  1RCH A;  1RDA A;  2UUA K;  5CE3 A;  1VQM N;  5M1K A;  3LPU A;  3J80 O;  1ASU A;  3U9Z A;  2A1R A;  1RT1 A;  4QS7 A;  1IBM K;  3HT3 A;  4BVP A;  3VQ6 A;  3F9K A;  2ATQ A;  2P9K B;  3AVM A;  1KLN A;  4CCH A;  5JS2 A;  5JIC A;  4O44 A;  4PWD A;  4PL8 A;  4KHU A;  3HK2 A;  1GLF O;  1V4S A;  1D5A A;  3EYZ A;  4YOV A;  3CJB A;  4OX9 K;  2Q31 A;  1JLQ A;  3H3N O;  3V1O A;  3TTC A;  3CCU N;  2YHA A;  1KCF A;  1QQC A;  4DG1 A;  3NF7 A;  4MLE A;  1RT3 A;  1VQL N;  3WEE B;  5KTQ A;  4CJS A;  4X66 K;  4CFB A;  3M6G A;  3AAR A;  3KWG A;  1NBW A;  2HBJ A;  4B9M A;  3DXM A;  2O4I A;  3K9J A;  5K14 A;  3WNF A;  3MN5 A;  3VQ4 A;  1T05 A;  4QAG A;  4CIE A;  4KHS A;  3ALY A;  3V1R A;  4JV5 K;  4JKG B;  3T3F A;  3SCX A;  3C7N B;  1RBS A;  3WT0 A;  1FK9 A;  4DR1 K;  4K42 A;  1ASW A;  1BOT O;  5AZI A;  4DHY A;  3AO4 A;  3P31 A;  3VQB A;  3C6A A;  4BC3 A;  3DLK A;  3ZEU B;  4DV6 K;  2KTQ A;  3W0L A;  1RDW X;  4O0J A;  5LMU K;  1Y64 A;  2Z1G A;  4CZM A;  4FPB A;  3MWP A;  4IZ9 A;  1KAX A;  3ZX0 A;  2YKN A;  1C1C A;  1ZC6 A;  4RCH A;  4BRI A;  3TAN A;  1X1P A;  4GKJ K;  3I8D A;  3SUP A;  3L4Q A;  4JHD B;  1A5X A;  1F21 A;  2P9S A;  3E9L A;  5DMR A;  4Z4I A;  4OGC A;  3SMP A;  2H3G X;  2O8E B;  4FO0 A;  4FWK A;  3OYM A;  3CER A;  4DS4 A;  5HRS A;  3L2V A;  2Q1N A;  1NKB A;  3K0S A;  4M42 A;  4FW1 A;  4W5N A;  2WBN A;  1BA0 A;  1JJ2 M;  4DQP A;  4YDU C;  4CGF A;  4B3O A;  3R1X A;  5AQK A;  5FPM A;  5AQV A;  4CES A;  3NHG A;  2VG7 A;  3CCE N;  1BL3 A;  3SLC A;  4H5N A;  4CEC A;  3SPY A;  5FDL A;  4BWM A;  2A1S A;  1S9G A;  1ZYQ A;  3NGI A;  3QET A;  4CJ5 A;  2P9N A;  4IO8 A;  4KKO A;  2PYL A;  3TAF A;  3CF5 L;  1NGA A;  1R59 O;  4LC9 B;  3TR8 A;  3DLG A;  3KWI A;  1YTU A;  1ATR A;  4EHT A;  1Q86 O;  4F9O A;  2P9U A;  2O8B B;  3P4I A;  2HMP A;  4WQ5 C;  3CJ1 A;  2YKM A;  3VMF B;  2FBY A;  5E84 A;  1FXX A;  1ITG A;  5BRH A;  4LF6 K;  3O4Q A;  4ICL A;  5DK5 A;  4CFC A;  4JKH A;  4V19 S;  4DFM A;  1XNR K;  2QM1 A;  3A5N C;  5AQN A;  2EX3 A;  3T19 A;  4DR7 K;  4H4M A;  3H46 O;  5T7B A;  4CJE A;  2FSJ A;  3LDP A;  1VQO N;  3V6D A;  1JCF A;  4B9V A;  3P38 A;  4B9L A;  2P5O A;  2E2Q A;  3L2W A;  1YAG A;  3HP9 A;  3PX4 A;  1WSF A;  3NDK A;  2FF6 A;  4FJN A;  4CED A;  2ASO A;  3DLL L;  5GAH P;  3QBW A;  3LDQ A;  4CHY A;  4X62 K;  5B8H A;  4CEQ A;  2WUS A;  1S1W A;  3QIO A;  5AR0 A;  3EEQ A;  3DLE A;  4G1Q A;  1QVG M;  3BDP A;  4ISE A;  2E5L K;  2HHT A;  4HTL A;  2KQ2 A;  2WTU A;  1KVA A;  4B9U A;  3SAG A;  4MDB A;  3TTD A;  5I9E B;  1L3V A;  1JLC A;  3WXK A;  3FZF A;  3CPE A;  4DTS A;  3NH1 A;  4AM7 A;  4DWI A;  3JAM O;  5F1X A;  1OH6 A;  4CJ4 A;  3BY5 A;  4Z4F A;  3LAN A;  2A41 A;  3VPZ A;  4FLT A;  3NF6 A;  1YI2 N;  3SNN A;  1NOY A;  1GLC G;  3VEY A;  3DRP A;  1GLB G;  3I56 N;  1NM1 A;  4IOC L;  2E8A A;  3PSF A;  4M7Y A;  1S5J A;  2HBM A;  4OVL A;  2O8C B;  3D2E B;  4BRK A;  3HOT A;  1Q18 A;  5HRP A;  4IEE A;  4FOI A;  4J2E A;  3MK6 A;  5AQQ A;  2NZT A;  3RMD A;  3C0B A;  2BE2 A;  1NMN A;  3MXM A;  1J5E K;  4AM6 A;  2G8I A;  4MLH A;  1IKW A;  1TUU A;  1E3M A;  1YTA A;  3G71 N;  3OYI A;  4N47 A;  5LMN K;  3VEX A;  1SS6 A;  3CD6 N;  4BC5 A;  3HPH A;  4CGJ A;  3S3M A;  5CYQ A;  3VES A;  1KAZ A;  4OO1 J;  3KHY A;  1VSK A;  4Z4H A;  2YNF A;  4BY9 C;  2HNZ A;  3O3G A;  2ASM A;  3BF1 A;  3M8P A;  2KZZ A;  4NCA A;  2NRW A;  3IDH A;  4E1N A;  3G6E N;  1W9H A;  4NLB A;  3PIP L;  1H1V A;  1VQ9 N;  2VWK A;  4CK2 A;  2ASP A;  3WQU A;  4BQZ A;  1S72 N;  1RDB A;  1X9J A;  3ZX3 A;  3QFP A;  5LJW A;  2ZJR L;  4O8U A;  1YIJ N;  4FLZ A;  3WNG A;  1LCU A;  4DV1 K;  1RIL A;  2O8F B;  3CCR N;  2HND A;  4DUY K;  2HF4 A;  3J81 O;  4RWT A;  1WAJ A;  1L3S A;  2AJQ A;  3KLG A;  3V9S A;  4HCC A;  3DRR A;  3PUF A;  2E4L A;  3MXI A;  3S41 A;  1NOZ A;  1QVF M;  4H5R A;  1YXQ A;  3H08 A;  4JI4 K;  1HKB A;  4JI6 K;  4CHP A;  4AF1 A;  1NGD A;  4DUZ K;  2E1Z A;  1X9W A;  2GBZ A;  4K8X A;  3NBP A;  1IKY A;  2Q2R A;  2P9L B;  4CZF A;  3OYG A;  1TKT A;  3SUQ A;  3RSE A;  1FJG K;  3HP6 A;  1U4B A;  4BRL A;  4BE1 A;  4MQ3 A;  1DT9 A;  1O13 A;  4AHV A;  4KB0 A;  1NJW A;  2FSK A;  2OAN A;  4HHT A;  1RFQ A;  3WXJ A;  3L3V A;  4I6M A;  4KTW A;  4KTQ A;  2O8D B;  2VGN A;  5HRN A;  3MEE A;  4GMJ B;  1EX4 A;  2P9P A;  1DTQ A;  5BN9 A;  4FJ7 A;  4JS4 A;  2WOM A;  3P5J A;  1N8R O;  3HM9 A;  5M1N A;  1WOQ A;  3ZSO A;  3SUO A;  5FRM A;  5JLF A;  4CFD A;  2QKK A;  3V9X A;  1DEJ A;  4C8O A;  3CJ9 A;  1RDU A;  4Z4G A;  3SQ2 A;  4BRQ A;  3A8Y A;  3K58 A;  1BUP A;  3QNN A;  3JS6 A;  1ZBF A;  2KKZ A;  4HUE A;  4JI0 K;  2IVN A;  3L0Q A;  1KQS M;  3HST B;  3BEX A;  4ILJ A;  4A5B A;  2BDP A;  4JLH A;  4EFH A;  4JRQ A;  4IO9 L;  4CBU A;  3AVB A;  3B6O A;  1QHT A;  2IDO A;  4MDA A;  4O5F A;  3EL2 A;  2Z1J A;  3DOL A;  5EY4 A;  3CCM N;  2GUI A;  3MXJ A;  4U67 L;  1M90 O;  3UKR B;  4DQS A;  2DFH A;  3OS0 A;  4DU1 A;  3S9H A;  4CK1 A;  4PL7 A;  2QTD A;  4BR0 A;  1EO1 A;  4XIU A;  3JYT A;  4DQR A;  1L3U A;  2VG6 A;  1NGF A;  1U2V B;  4BE0 A;  1RDD A;  2QI2 A;  1C6V A;  3OS1 A;  3NF9 A;  3OY9 A;  1HX1 A;  4IJA A;  2QWR A;  3AVJ A;  4FPA A;  4NXN K;  3VTH A;  1BDG A;  4FCY A;  3D7E O;  4DTJ A;  3CCS N;  3O9T A;  4CD1 A;  4DTP A;  3SV3 A;  3LP0 A;  1IV0 A;  3U8X A;  1LWC A;  4DQI A;  3C6H A;  1YVU A;  3UKU B;  2D0O A;  1VQP N;  4RW9 A;  1FKP A;  2O4G A;  2Y1J A;  3P1G A;  2HST A;  1REV A;  3PX6 A;  1GOC A;  4HCB A;  5FPN A;  1LAV A;  2ZWH A;  5HRO A;  5JLH A;  3CM6 A;  3AVA A;  5AZJ A;  5AQS A;  1GLD G;  1C0U A;  3KKR A;  5AQX A;  3THW B;  3THY B;  4GKK K;  4GV9 A;  5FPD A;  3ISN C;  2OCE A;  4FZZ A;  2V52 B;  3OYH A;  1E4F T;  4R5P A;  3R9P A;  5C12 A;  2ZQB A;  1RTJ A;  5FRN A;  4WQ4 A;  1WSH A;  3ZSQ A;  4ISG A;  1U47 A;  3DMJ A;  2ZJP L;  3L6Q A;  2EWS A;  4TSX A;  3CHW A;  4JI8 K;  1JKH A;  4DMN A;  1VHX A;  3D6R A;  4IG3 A;  3DJC A;  1X9M A;  1NGC A;  3VN5 A;  4X65 K;  3OA9 A;  3TAP A;  2UUC K;  4N5S A;  1SL1 A;  3I33 A;  3KLI A;  5BR9 A;  1NMD A;  4DR6 K;  2VCP A;  4YHH K;  4DLE A;  2PZS A;  1EWQ A;  1Q82 O;  4KB1 A;  3D0P A;  3TAG A;  3QO9 A;  5GAE P;  1TAU A;  3HVT A;  4F2S A;  3OW2 M;  5I42 A;  3SZ2 A;  1BIS A;  2V51 B;  4N41 A;  3VQ7 A;  4EP4 A;  4CZH A;  3P83 D;  2XY7 A;  2KW4 A;  2W6K A;  2GWJ A;  3FZM A;  4CHO A;  3QEX A;  4KH6 A;  3RRH A;  3M8S A;  1Z6R A;  4DQ8 A;  2YCH A;  4JI7 K;  4DFK A;  3NF8 A;  3BZC A;  4EP5 A;  5KPZ A;  4CFA A;  4E7L A;  1BQM A;  1JL1 A;  3QML A;  3VA0 A;  4H0O A;  3NE6 A;  3NCI A;  4UQG A;  4B9S A;  3IKM A;  2HHQ A;  4WE1 A;  1RTD A;  1J54 A;  4B8A B;  1NGI A;  1S6P A;  3U3Y A;  4KRF A;  4DTX A;  4O0I A;  4NCG A;  2NRR A;  2WC9 A;  4ELU A;  3GDQ A;  4FJM A;  3NAE A;  3VOV A;  4JYA K;  4NCB A;  3AVK A;  2XO7 A;  4DR3 K;  3QNO A;  2ZGZ A;  1NKE A;  1RBT A;  1VQN N;  1T03 A;  3N4Q A;  5DM7 L;  3MEC A;  2YHX A;  3ZX2 A;  1HNZ K;  2OYQ A;  3QLH A;  2KFZ A;  4N56 A;  2V7Z A;  1QHA A;  3CPW M;  4BAC A;  3SJJ A;  2F96 A;  2IAJ A;  3EE8 A;  3HYF A;  3ENH A;  4JI2 K;  1Q8I A;  2BAN A;  4Z94 A;  2AP1 A;  3J7Y P;  2ITM A;  4DU3 A;  4FJL A;  2D0A A;  4KHW A;  4FWM A;  4YOY A;  4YY3 K;  4KHP K;  1NKC A;  4XH5 A;  2OZM A;  4CIF A;  4JAX A;  4BR4 A;  5AQJ A;  3LDN A;  3AVL A;  4DF4 A;  4FLV A;  4BRD A;  3AA4 A;  5SWM A;  1KVC A;  3OJS A;  3HI0 A;  1HPM A;  3LM9 A;  4JKC A;  4BVO A;  3ASM A;  3MN7 A;  1HRH A;  3VQA A;  3CET A;  2HHX A;  3O9U A;  1RT2 A;  3EZW A;  3DI6 A;  5KGW A;  1P90 A;  4LFA K;  3A0I X;  3DYA A;  3EY1 A;  4KTZ A;  3SPZ A;  4IFV A;  2QW9 A;  2P51 A;  3ZET B;  3V9W A;  1IBL K;  3RRG A;  1LWF A;  3BGR A;  4CF0 A;  5GAD P;  1UOC A;  2HHW A;  1IKX A;  2YV0 X;  4BR5 A;  3HTV A;  2A5X A;  1XHX A;  2QWP A;  1OVY A;  3RR7 A;  2P9I B;  4JKA A;  4IOA L;  3JSM A;  3CC7 N;  5AQL A;  3HM8 A;  1HLU A;  3TI0 A;  1BG3 A;  4M41 A;  1SKW A;  2PYJ A;  1NLV A;  2YX6 A;  2HHV A;  3F73 A;  3MAQ A;  3KLE A;  4ID1 A;  3FFI A;  3D2F A;  3HBT A;  4NYF A;  4HWI A;  5AQW A;  2PAV A;  4OPJ A;  5CHI A;  4CIG A;  3G10 A;  3BUZ B;  3THX B;  2D0B A;  4BWJ A;  2FBV A;  4CVN E;  1DKG D;  4O5B A;  2VWB A;  2B5J A;  4W5O A;  3OYB A;  2RF2 A;  4FJG A;  3LDL A;  5C15 A;  5EVZ A;  1V4T A;  3SQ1 A;  1MWK A;  5C25 A;  1XC3 A;  2P9K A;  4HVJ A;  1JLA A;  2VG5 A;  2VQE K;  3U3G A;  2G8H A;  3HJF A;  5CYM A;  5J2N A;  4DKW A;  2P9U B;  3IAY A;  1ILY A;  3FLC O;  3WEE A;  4Z4E A;  1RT7 A;  3HPG A;  5AQF A;  2QXF A;  3R8E A;  1KLM A;  2A40 A;  1YVN A;  2JGU A;  4NB4 A;  4E1J A;  4C1N I;  4E1M A;  4LF7 K;  1T6C A;  3HVR A;  3J8A A;  3K5M A;  1KTQ A;  1VAZ A;  3CQY A;  4JKG A;  3C7N A;  1WNS A;  2ZM6 K;  3ENB A;  1XUP O;  4BDP A;  3T7Z A;  1LWE A;  1CXU A;  2E6L A;  4K0K K;  1S6Q A;  4RG8 A;  4JD2 B;  3AO3 A;  4IBN A;  3ID6 A;  4OKK A;  2D1K A;  1HKG A;  3GL1 A;  1HQU A;  1L3T A;  4O8K A;  1NK7 A;  4CJT A;  5C42 A;  5LL6 Z;  4RW8 A;  1CXQ A;  3KK2 A;  3SQ4 A;  4KFB A;  3CC2 N;  2FBX A;  3GE1 A;  5BN8 A;  3CJA A;  1CZA N;  4C8K A;  1D8Y A;  4AHR A;  5LJV A;  1XQS C;  1TV6 A;  1Q9Y A;  1BI4 B;  2V7Y A;  1JLF A;  3N4P A;  4HUF A;  4HUG A;  5C0Y A;  2HNY A;  2E1Y A;  4FOE A;  2F9W A;  1HNI A;  1TKX A;  1XNQ K;  5IT9 O;  4IKF A;  4PY5 A;  3VTI A;  4DR5 K;  1X3M A;  4OKE A;  2QA4 N;  3ZYY X;  1HPZ A;  2ITG A;  2FXU A;  3E1Y A;  3F2K A;  1UWB A;  3O9R A;  3MX5 A;  2D5R A;  4KRE A;  5AQZ A;  4BG8 A;  3PY8 A;  2BH1 A;  3IRX A;  4KHQ A;  4EHU A;  3CIP A;  4BE2 A;  3WNH A;  4CJP A;  1IG9 A;  1Z26 A;  1WSG A;  5IWA K;  1VQ5 N;  3TWH A;  4DTM A;  4CE9 A;  2YHY A;  4EIA A;  3M3Z A;  4PA1 A;  3OVN A;  4CGH A;  3VEV A;  3QER A;  4A61 A;  4B3R K;  1EXQ A;  1J9A A;  2VQF K;  2PFU A;  2UUB K;  1NK8 A;  3W3D A;  3O1W A;  3C65 A;  3AVH A;  3VET A;  1QS4 A;  3A5O C;  1HNW K;  3OYL A;  5ADX H;  4GNI A;  5CY4 A;  3A5M C;  3VEZ A;  3VGL A;  3OYE A;  4F4K A;  1IH7 A;  4WFB L;  3PO4 A;  2HHS A;  3AA3 A;  4E19 A;  3WXL A;  3K5N A;  1RTI A;  4I7F A;  2Q97 A;  5DM6 L;  4BRA A;  2Y1I A;  5TKY A;  5KQ8 A;  4CHN A;  3LP1 A;  1NGE A;  1DTT A;  1XMQ K;  3KJV A;  4K25 A;  4DSK A;  4GY2 B;  3LM2 A;  4CEZ A;  4OPA A;  1ZBS A;  4FWO A;  2QEX N;  3LAK A;  3G25 A;  1SL2 A;  3CQX A;  1N33 K;  5CR4 A;  4I2Q A;  2R7Y A;  2NRH A;  1D4X A;  3RMB A;  4OKJ A;  2RN2 A;  3L2R A;  2BUP A;  3CCJ N;  3MWT A;  1ZXO A;  4NLC A;  3RSE B;  4EZ6 A;  4LFC K;  1VK0 A;  3O4N A;  1VQK N;  4H03 B;  4A5A A;  4BRO A;  4GV6 A;  2O8C A;  3D2E A;  3AAQ A;  4DTO A;  1QSY A;  4J8F A;  1GLJ O;  3IFR A;  2P9P B;  1JXE A;  4PUO A;  1UAX A;  4FM2 A;  2KZM A;  2W41 A;  1LW0 A;  4JRP A;  3NMU A;  2QK9 A;  3VA3 A;  4FJX A;  2D4W A;  4IG0 A;  4RW6 A;  3OBY A;  1I3A A;  2F8T A;  3HOS A;  3PV8 A;  3QB0 A;  4Z0U A;  2DPN A;  4BC2 A;  1FW6 A;  3K5O A;  4W5Q A;  1YF5 L;  3AO5 A;  1WSJ A;  4KI4 A;  4PKG A;  3MDQ A;  2OPR A;  5KGX A;  4B3T K;  1NJZ A;  1A5W A;  1S1U A;  3VEO A;  1KC8 O;  5MLC Q;  4CJV A;  2OPS A;  4YOT A;  1BQN A;  1NGJ A;  2O8F A;  4BC4 A;  1TAQ A;  3Q7B A;  2Q0R A;  4RW4 A;  4H0T B;  3OYN A;  3M8R A;  1RGI A;  2NLX A;  3ZLJ A;  3OTO K;  1ZBU A;  5FRO A;  2XHB A;  5J2Q A;  2E2P A;  4CJ7 A;  3ZT1 A;  2YJF A;  1SL0 A;  4GVM A;  1TYQ B;  4C8M A;  5HL7 L;  4X64 K;  4QS8 A;  4A62 A;  2E20 A;  4FWR A;  2BGG A;  1NK9 A;  4FM1 A;  2P9L A;  1S3X A;  1NGH A;  3OBW A;  5M1Q A;  3NGY A;  1J53 A;  3SI6 A;  3QEV A;  4R79 A;  3KZB A;  1MDU B;  2HBL A;  3LWL A;  1QSL A;  3C94 A;  1QZ6 A;  4FYD A;  2O8D A;  2X74 A;  3K2P A;  1NNE A;  4CZJ A;  3L2Q A;  4F8R A;  1CZ9 A;  1WAF A;  5LY3 A;  3EO3 A;  5FPE A;  3MN9 A;  4FVM A;  1R0A A;  4DQQ A;  3U9D A;  4IFE A;  4CZG A;  4KHN A;  3M5R A;  3MCP A;  4YOW A;  2PBD A;  2I7P A;  3ULE A;  4I2P A;  3PO5 A;  1VSM A;  4UY8 O;  4JKE A;  4F3O A;  1SUQ A;  4B8C A;  4BRC A;  3TU5 A;  1OVQ A;  4CEO A;  4CEF A;  1JXB A;  4BG9 A;  4LSN A;  4FZY A;  4QCL A;  1QZ5 A;  4B9Q A;  4YDU A;  4B9N A;  3DLR A;  3THV A;  3ZSR A;  1LOT B;  5HRR A;  4PQU A;  4MFB A;  3UKR A;  4B1Y B;  5AQO A;  1YUW A;  3ATV A;  3CYM A;  4DV2 K;  1J6Z A;  4DV7 K;  4CGG A;  4LSL A;  2FC0 A;  2YNH A;  3H45 C;  4K41 A;  4DTU A;  1QQM A;  1U2V A;  2ZJQ L;  4B9T A;  2NUB A;  4LH5 A;  5SZT A;  1SKS A;  1HQE A;  4MO5 A;  3VQD A;  4H0Y B;  3DXK B;  4DSF A;  4H0P A;  4WQ5 A;  3NVM A;  4FWL A;  4IFY A;  5HBM A;  4YNQ A;  3A2F A;  1K8K A;  2BTF A;  1TKD A;  2W40 A;  2ZGY A;  2ZF5 O;  2QWL A;  2ZD1 A;  4W5T A;  3VF2 A;  1C0G A;  3PIO L;  3VQC A;  1XHZ A;  5F2R A;  2G8W A;  3VQ5 A;  3G0Z A;  3C6U A;  3JXU A;  3UE5 A;  3UKU A;  3A5L C;  4M3R A;  1EP4 A;  1NK0 A;  3O9S A;  4EAH D;  1XMO K;  2KFN A;  1MA9 B;  4KI6 A;  1HJR A;  3OYK A;  2I7N A;  1HJO A;  4XH4 A;  4C1N K;  1D9D A;  4G9Z A;  4YFU A;  3H1Q A;  3O80 A;  3O9Q A;  3KK7 A;  4B1V A;  3UB5 A;  5BR8 K;  3B8A X;  3U6F A;  3THW A;  4O55 A;  3AO1 A;  3THY A;  1HNV A;  1KD1 O;  5E41 A;  3V4I A;  1QQN A;  4FWS A;  1CZB A;  1MWM A;  4FM0 A;  1VRT A;  1N36 K;  3SQ0 A;  4GVE A;  3O6W A;  4W5R A;  1T7P A;  1Q81 O;  3O4W A;  2XY8 A;  4DSJ A;  4CGI A;  4YOX A;  1HYV A;  5C24 A;  4DV3 K;  5AQT A;  4WFN L;  2GTD A;  1HMV A;  4OPH A;  2I5J A;  5M1P A;  1KAY A;  4CF9 A;  3VF6 A;  1A5V A;  4DS5 A;  5ADX A;  4BR9 A;  3EKU A;  4FJH A;  4H5W A;  3CG7 A;  4DR4 K;  3CFO A;  1M1K O;  3IUC A;  4IWV A;  5ELZ A;  5CZ2 A;  4CHZ A;  1GLL O;  4OLA A;  3MCA B;  3T1A A;  4FL9 A;  1GOA A;  3CCV N;  5I3U A;  5JS1 A;  1B92 A;  4CBW A;  1TL3 A;  4NXM K;  1U45 A;  3QIN A;  4B3M K;  4IXC A;  1TGO A;  3HXM A;  2QWQ A;  3CM5 A;  3SUN A;  2P1J A;  5AFU H;  3LPT A;  1I39 A;  2GX9 A;  3H3O B;  3O08 A;  1L5U A;  2YNI A;  3J7Z O;  3OHR A;  3BF3 A;  3FR0 A;  1HR0 K;  3SBT A;  1T44 A;  2ZE2 A;  4FWQ A;  1UA0 A;  2NRZ A;  3O8M A;  3ZT0 A;  3ZSW A;  2QWM A;  4H5T A;  2A3Z A;  3M8Q A;  4OJR A;  3LAM A;  5AQR A;  2UYT A;  2JLE A;  1HYS A;  4Y0W A;  1ATS A;  3DXM B;  3MEG A;  5J2M A;  5EOY A;  3F9M A;  1B9F A;  2NRT A;  3OS2 A;  1LV5 A;  2DFF A;  4JS5 A;  5BRD A;  4FJK A;  4F3T A;  3DWL A;  1NK6 A;  3T69 A;  3NFA A;  3KLF A;  1XI1 A;  4BQL A;  2XY6 A;  2D0C A;  4PKI A;  4CEB A;  1D9F A;  3HZ6 A;  5AZI B;  4NYN A;  1VQ8 N;  4CJL A;  2ETJ A;  5C2F A;  3TTF A;  2KHO A;  4ZTF A;  3SBG A;  3R3L A;  1FKO A;  4Q0B A;  4MO4 A;  1WLJ A;  3AVF A;  3WNE A;  4DR2 K;  4J2B A;  3QIP A;  3E66 A;  4M45 A;  3L4I A;  4B1U B;  3PLA A;  5E26 A;  4FLY A;  3M1F A;  4ISF A;  1SAZ A;  3I0S A;  1N5Y A;  3LDS A;  2PY5 A;  3DLH A;  3AVI A;  2G8K A;  4M3T A;  1TK0 A;  4Y1C A;  3QFU A;  2P9S B;  3SV4 A;  4E89 A;  1IG8 A;  4E7K A;  3PX0 A;  1S1V A;  3NH2 A;  1QSS A;  4ELV A;  1U48 A;  3AGK A;  4OGE A;  3BP8 A;  3HSC A;  1JLB A;  4CEE A;  2F8S A;  4IEI A;  4CJK A;  1EET A;  5HP1 A;  2CH5 A;  3QEI A;  4BR2 A;  3KIO A;  5A2Q O;  3NH0 A;  4DB3 A;  3H1V X;  3AA5 X;  4FJI A;  1OH5 A;  5TKW A;  3TAQ A;  2OA8 A;  1E4G T; 
#chains in the Genus database with same CATH homology
 3SUO A;  5FRM A;  1DLO A;  4CFD A;  2QKK A;  3V9X A;  3QER A;  4C8O A;  4Z4G A;  1C0M A;  3SQ2 A;  3K58 A;  2KTQ A;  2QKB A;  1EXQ A;  3RR8 A;  2IC3 A;  1J9A A;  3QNN A;  4K8Z A;  1VSI A;  1ZBF A;  4AHC A;  4DU4 A;  1RTH A;  1NK8 A;  4HUE A;  4FK0 A;  4H4O A;  4F2R A;  3HST B;  3AVH A;  4FJ9 A;  4J2D A;  1QS4 A;  4E3S A;  3LP2 A;  3OYL A;  2BDP A;  1WSE A;  4JLH A;  4JRQ A;  3ZT4 A;  3AVB A;  5CY4 A;  4CJW A;  3B6O A;  1QHT A;  1W0H A;  2IDO A;  1NJX A;  1QTM A;  2Z1J A;  3DOL A;  4ID5 A;  3S3O A;  3MED A;  2GUI A;  1JL2 A;  3MXJ A;  3OYE A;  1TKZ A;  1Q9X A;  5J1E A;  4M3X A;  4DQS A;  4F4K A;  1IH7 A;  1TL1 A;  3LP3 A;  2DFH A;  3ZSZ A;  3OS0 A;  1VSF A;  3AA3 A;  4E19 A;  3KLH A;  4DU1 A;  3S9H A;  4CK1 A;  3K5N A;  1RTI A;  4I7F A;  3ZSY A;  3HPO A;  1KRP A;  4GW6 A;  4XIU A;  3JYT A;  4AHU A;  3IG1 A;  4DQR A;  2Y1I A;  4CHN A;  1L3U A;  2VG6 A;  3VQ8 A;  4AHS A;  3QEW A;  3LP1 A;  4BE0 A;  1RDD A;  2KZZ A;  1DTT A;  1C6V A;  3OS1 A;  3NF9 A;  1XWL A;  4FW2 A;  4KV8 A;  3AA2 A;  3OY9 A;  3OYJ A;  3KJV A;  4Z4C A;  4DSK A;  4ELT A;  4CEZ A;  3OYA A;  3DM2 A;  2HHU A;  2HB5 A;  3AVJ A;  4FCY A;  3LAK A;  1NK5 A;  4DTJ A;  4EZ9 A;  1BIU A;  4Q5V A;  1SL2 A;  3V81 A;  1J5O A;  4I2Q A;  2R7Y A;  4DTP A;  3SV3 A;  3LP0 A;  1YT3 A;  4DSL A;  1BCM A;  1LWC A;  2WON A;  3RMB A;  4DQI A;  4OKJ A;  2VWJ A;  1YVU A;  2LSN A;  4CF1 A;  2RN2 A;  3L2R A;  4RW9 A;  1FKP A;  2O4G A;  2Y1J A;  1K6Y A;  3P1G A;  4C8L A;  1REV A;  1UA1 A;  3PX6 A;  3CQ8 A;  1GOC A;  4ZHR A;  4EZ6 A;  1GOB A;  4HCB A;  3S3N A;  1LW2 A;  4LY7 A;  1LAV A;  1VK0 A;  3O4N A;  2W42 A;  5HRO A;  3KKS A;  3TAB A;  1C1A A;  2GV9 A;  3CM6 A;  3AVA A;  1RCH A;  1RDA A;  3KKR A;  1C0U A;  3C6T A;  3LPU A;  4H8K A;  4DTO A;  1ASU A;  1QSY A;  3ITH A;  2A1R A;  2X78 A;  3ISN C;  4FZZ A;  3OYH A;  2X6S A;  1RT1 A;  1JXE A;  3I0R A;  3HT3 A;  4PUO A;  3OYC A;  4E0D A;  4R5P A;  1UAX A;  3OYF A;  1KSP A;  4FM2 A;  2ZQB A;  3V9Z A;  1RTJ A;  3VQ6 A;  3F9K A;  5FRN A;  2KZM A;  4JRP A;  1LW0 A;  2ATQ A;  4CGH A;  3TAE A;  1WSH A;  2QK9 A;  3ZSQ A;  3AVM A;  3VA3 A;  1U47 A;  1KLN A;  4CCH A;  4FJX A;  3DMJ A;  5JS2 A;  4IG0 A;  4CJF A;  1KFS A;  4RW6 A;  4O44 A;  2G8U A;  4PWD A;  1JLE A;  4KHU A;  3HK2 A;  1I3A A;  4TSX A;  2F8T A;  2DTU A;  1D5A A;  1JKH A;  3EYZ A;  4DMN A;  3PV8 A;  4IG3 A;  4Z0U A;  1JLQ A;  4DTR A;  3V1O A;  1X9M A;  3VN5 A;  2YHA A;  1KCF A;  1QQC A;  3K5O A;  4W5Q A;  3TAP A;  4KAZ A;  4FK4 A;  4BDZ A;  4DG1 A;  3NF7 A;  4N5S A;  3RWU A;  1SL1 A;  3KLI A;  1U04 A;  1RT3 A;  1ZBL A;  2HW3 A;  5KTQ A;  3AO5 A;  1WSJ A;  4CJS A;  1KFD A;  4DLE A;  2PZS A;  4CFB A;  4KI4 A;  4KB1 A;  2OPR A;  5KGX A;  4B9M A;  3D0P A;  3TAG A;  1NJZ A;  1A5W A;  1S1U A;  3QO9 A;  2O4I A;  5K14 A;  3WNF A;  1TAU A;  1S9E A;  3HVT A;  1X9S A;  4F2S A;  5I42 A;  3SZ2 A;  1BIS A;  4O4G A;  4N41 A;  1T05 A;  3VQ4 A;  3VQ7 A;  3ZT3 A;  4CJV A;  2OPS A;  1BQN A;  4QAG A;  4CIE A;  4EP4 A;  2DY4 A;  4KHS A;  3P83 D;  1RT6 A;  3ALY A;  2KW4 A;  3V1R A;  2XY7 A;  3T3F A;  3OJU A;  1TAQ A;  3SCX A;  1BI4 A;  4RW4 A;  1RBS A;  4CHO A;  3QEX A;  4E7I A;  1FK9 A;  3RRH A;  4CJQ A;  1ASW A;  3M8S A;  3OYN A;  4DFK A;  3AO4 A;  3NF8 A;  1ASV A;  3M8R A;  3VQB A;  4CJR A;  3DLK A;  4B08 A;  4EP5 A;  2OZS A;  4CFA A;  4E7L A;  1ZBU A;  4DFP A;  5FRO A;  4KPY A;  2XHB A;  1BQM A;  4O0J A;  5J2Q A;  4FZX C;  3K57 A;  1JL1 A;  3ZSX A;  3ZT1 A;  2IGI A;  3VA0 A;  1SL0 A;  2Z1G A;  2DFE A;  4GVM A;  4C8M A;  3NE6 A;  3NCI A;  4KHY A;  4UQG A;  4B9S A;  2HHQ A;  4WE1 A;  2EHG A;  2YKN A;  1RTD A;  4AIL C;  1C1C A;  1J54 A;  4B8A B;  3TAN A;  2BGG A;  1NK9 A;  1X1P A;  1S6P A;  3EZ5 A;  4FM1 A;  3U3Y A;  4FJ5 A;  4KRF A;  3VQQ A;  3I8D A;  4DTX A;  4O0I A;  4NCG A;  4DLG A;  3SUP A;  4ELU A;  1A5X A;  1F21 A;  5J2P A;  4FJM A;  3NAE A;  5DMR A;  3NGY A;  4OGC A;  4NCB A;  4Z4I A;  3QES A;  1J53 A;  5D3G A;  3HO1 A;  1BGX T;  3AVK A;  3SI6 A;  3OYM A;  2XO7 A;  3QNO A;  4DS4 A;  3QEV A;  5HRS A;  3L2V A;  1NKB A;  1NKE A;  1RBT A;  4FJJ A;  1T03 A;  1T8E A;  3MEC A;  1SV5 A;  4M42 A;  3LWL A;  4FW1 A;  2OYQ A;  4W5N A;  3QLH A;  1QSL A;  3C94 A;  4DQP A;  4FYD A;  4CGF A;  4B3O A;  2X74 A;  2KFZ A;  3K2P A;  4N56 A;  3L2Q A;  4BAC A;  4CES A;  1CZ9 A;  2XRI A;  3NHG A;  3DLB A;  2VG7 A;  4F8R A;  1BL3 A;  1RDC A;  3SJJ A;  2F96 A;  4N76 A;  2IAJ A;  1WAF A;  3KD1 E;  3HYF A;  4CEC A;  3SPY A;  1IO2 A;  4LD0 A;  4QOZ B;  5FDL A;  3AVC A;  4FVM A;  4BWM A;  1U49 A;  1G15 A;  2A1S A;  1S9G A;  4DQQ A;  3NGI A;  3TAR A;  5KI6 A;  1R0A A;  1ZYQ A;  4I9Q A;  1Q8I A;  2BAN A;  4CJ5 A;  3CFP A;  4KKO A;  3QET A;  3L3U A;  1NJY A;  3TAF A;  2PYL A;  4KHN A;  2X6N A;  4DU3 A;  4I2P A;  3PO5 A;  1VSM A;  4FJL A;  4F3O A;  1SUQ A;  2D0A A;  3TR8 A;  1RNH A;  4B8C A;  4KHW A;  3DLG A;  4IDK A;  1YTU A;  1SKR A;  1NKC A;  2OZM A;  4CIF A;  4CEO A;  4CEF A;  1JXB A;  3NGZ A;  3RTV A;  2YKM A;  2IS3 A;  3AVL A;  4LSN A;  4DF4 A;  4FLV A;  4FZY A;  1C0T A;  2FBY A;  4QCL A;  4B9N A;  3AA4 A;  5SWM A;  1KVC A;  3OJS A;  2B4J A;  3DLR A;  4RW7 A;  4HTU A;  3ZSR A;  1FXX A;  3THV A;  1ITG A;  5HRR A;  4FLW A;  4M3W A;  3ASM A;  4MFB A;  1HRH A;  3VQA A;  4PQU A;  2HHX A;  3O4Q A;  1RT2 A;  3AVN A;  3DI6 A;  4KO0 A;  5KGW A;  5HLF A;  4OPK A;  4ICL A;  2FBT A;  3DYA A;  5DK5 A;  4CFC A;  3EY1 A;  4KTZ A;  3CYM A;  4Y1D A;  3SPZ A;  4IFV A;  4DFM A;  2P51 A;  3V9W A;  2EX3 A;  3T19 A;  2HVI A;  4CGG A;  3RRG A;  2XY5 A;  1LWF A;  1VSJ A;  2FC0 A;  2YNH A;  3BGR A;  4H4M A;  4LSL A;  4CF0 A;  4CHQ A;  4DTU A;  1UOC A;  2HMI A;  5EU7 A;  4B9T A;  2NUB A;  1IKX A;  1VSD A;  1VRU A;  2YV0 X;  4LH5 A;  1XHX A;  4CF8 A;  5SZT A;  5T7B A;  4CJE A;  1HQE A;  4CK3 A;  1SKS A;  3OYD A;  3VQD A;  3RR7 A;  3JSM A;  4DSF A;  3O3H A;  3V6D A;  3TI0 A;  4IFY A;  3UIQ A;  4M41 A;  5HBM A;  4YNQ A;  4B9V A;  3L8B A;  3A2F A;  1SKW A;  2P5O A;  4B9L A;  1TKD A;  2PYJ A;  4FJ8 A;  3AVG A;  3L2W A;  2HHV A;  3F73 A;  2ZD1 A;  3TAM A;  4W5T A;  2RKI A;  3MAQ A;  1C1B A;  3VQC A;  3KLE A;  1XHZ A;  3KD5 E;  3HP9 A;  2G8W A;  3PX4 A;  3VQ5 A;  3G0Z A;  3ZT2 A;  3C6U A;  3KK1 A;  1WSF A;  3NDK A;  4ID1 A;  4FJN A;  3FFI A;  1BHL A;  4CED A;  4NYF A;  4CHY A;  4M3R A;  4OPJ A;  4CEQ A;  1EP4 A;  1WN7 A;  4CIG A;  3G10 A;  1S1W A;  3QIO A;  1NK0 A;  2D0B A;  4BWJ A;  2KFN A;  3VQ9 A;  3DLE A;  1HJR A;  4KI6 A;  3OYK A;  2FBV A;  4G1Q A;  1D9D A;  4O5B A;  2G8V A;  4YFU A;  2B6A A;  3BDP A;  3DOK A;  1HYZ A;  3C95 A;  2OPQ A;  2KQ2 A;  2HHT A;  2B5J A;  1KVA A;  4B9U A;  3U6F A;  4O55 A;  3AO1 A;  4W5O A;  3OYB A;  1HNV A;  4J2A A;  2RF2 A;  5E41 A;  4FJG A;  3V4I A;  1JLG A;  2E6M A;  1CZB A;  1S1T A;  1L3V A;  1JLC A;  4DSI A;  4FM0 A;  1VRT A;  3SQ1 A;  4DTS A;  4CGD A;  3SQ0 A;  3NH1 A;  4W5R A;  5C25 A;  1VSL A;  1TK8 A;  1T7P A;  4FXD A;  2RPI A;  2Z1H A;  4DWI A;  2XY8 A;  4HVJ A;  4CGI A;  4DSJ A;  3LAL A;  1JLA A;  1HYV A;  4CJ4 A;  3KK3 A;  4Z4F A;  3LAN A;  5C24 A;  2VG5 A;  4FLT A;  4OLB A;  3NF6 A;  3SNN A;  1HMV A;  2I5J A;  3U3G A;  1NOY A;  4CF9 A;  3DRP A;  1A5V A;  2G8H A;  3O3F A;  4DS5 A;  3HJF A;  3K59 A;  4FJH A;  5CYM A;  3CG7 A;  3CFO A;  5J2N A;  1S5J A;  4OVL A;  1Y97 A;  1RBU A;  1B9D A;  3IAY A;  5CZ2 A;  4CHZ A;  4OLA A;  1RT5 A;  5HRP A;  1WSI A;  3T1A A;  4CF2 A;  4Z4E A;  1GOA A;  1RT7 A;  1IKV A;  3HPG A;  3QEP A;  2G8F A;  4J2E A;  2QXF A;  2OPP A;  4BDY A;  3RMD A;  5I3U A;  3D45 A;  2BE2 A;  5JS1 A;  1B92 A;  1Z25 A;  3V1Q A;  1KLM A;  1TL3 A;  3MXM A;  4FK2 A;  2IOC A;  2JGU A;  4AHT A;  1U45 A;  3QIN A;  2G8I A;  1NK4 A;  1IKW A;  1TGO A;  1N6Q A;  3HXM A;  3ZCM A;  4CJU A;  4E1M A;  3CM5 A;  3L2U A;  1O1W A;  3HL8 A;  3V9U A;  1YTA A;  3HVR A;  3OYI A;  3SUN A;  4N47 A;  1KTQ A;  3K5M A;  2P1J A;  1WNS A;  3LPT A;  1I39 A;  2YHB A;  3K5L A;  4BDP A;  3HPH A;  1EKE A;  1L5U A;  4CGJ A;  3S3M A;  1LWE A;  5CYQ A;  4FLU A;  1CXU A;  4E7H A;  2YNI A;  2P5G A;  1BCO A;  2E6L A;  1S6Q A;  4RG8 A;  1VSK A;  4Z4H A;  2YNF A;  3AO3 A;  4M3Y A;  2HNZ A;  4IBN A;  3O3G A;  3M8P A;  1QE1 A;  2ZE2 A;  4OKK A;  1L3T A;  3ZSO A;  1HQU A;  4NCA A;  1UA0 A;  1NK7 A;  4CJT A;  4E1N A;  4M3Z A;  5C42 A;  1W9H A;  3IS9 A;  1CXQ A;  4RW8 A;  1ZBH A;  2VWK A;  3VQP A;  3ZSW A;  3ZT0 A;  4CK2 A;  3KK2 A;  1S1X A;  3M8Q A;  3LWM A;  4OJR A;  3SQ4 A;  1VSE A;  3LAM A;  2JLE A;  4KFB A;  1HYS A;  3MEG A;  4I9L A;  3DRS A;  1RDB A;  2FBX A;  1B9F A;  5J2M A;  3E01 A;  3OS2 A;  1LV5 A;  4FLX A;  2DFF A;  4C8K A;  4FLZ A;  4JS5 A;  1D8Y A;  1MU2 A;  3PO4 A;  4FJK A;  4F3T A;  4AHR A;  1XC9 A;  4M3U A;  3WNG A;  4CER A;  1NK6 A;  1RIL A;  1TV6 A;  3NFA A;  5CZ1 A;  3KLF A;  5KRT A;  3LZI A;  1XI1 A;  2XY6 A;  4E7J A;  2D0C A;  5KRS A;  2HND A;  2Q3S A;  4CEB A;  1Q9Y A;  1KVB A;  1BI4 B;  1D9F A;  1JLF A;  1WAJ A;  1BIZ A;  4HUG A;  4HUF A;  1L3S A;  2HNY A;  3VQE A;  4NYN A;  1HNI A;  4CJL A;  2ETJ A;  1TKX A;  4L8R B;  2AJQ A;  4IKF A;  4PY5 A;  4ZTF A;  3KLG A;  4ZTJ A;  3V9S A;  4HCC A;  3DRR A;  2HHW A;  3PUF A;  3AV9 A;  3ZSV A;  1FKO A;  2E4L A;  4Q0B A;  3MXI A;  1NOZ A;  2Z1I A;  1VSH A;  1WLJ A;  3AVF A;  3H08 A;  3WNE A;  4OKE A;  4CHP A;  4DSE A;  1HPZ A;  4J2B A;  2ITG A;  3QIP A;  3LZJ A;  4M45 A;  1X9W A;  1UWB A;  2GBZ A;  4K8X A;  4AH9 A;  4FLY A;  3SYZ A;  2D5R A;  3NBP A;  3CFR A;  4KRE A;  1TVR A;  1IKY A;  3I0S A;  1N5Y A;  3LDS A;  4DTN A;  2PY5 A;  3DLH A;  3AVI A;  3OYG A;  1TKT A;  2G8K A;  4M3T A;  1TK0 A;  4Y1C A;  1CLQ A;  3SUQ A;  3RMA A;  1TK5 A;  3SV4 A;  3PY8 A;  1RBV A;  4C8N A;  2HHS A;  3IRX A;  4E89 A;  1ZBI A;  1RT4 A;  4E7K A;  4DF8 A;  3HP6 A;  3PX0 A;  1S1V A;  4KHQ A;  3NH2 A;  4CJ3 A;  1U4B A;  1QSS A;  4ELV A;  1U48 A;  4OGE A;  4CEA A;  4CEE A;  4BE1 A;  1JLB A;  4MQ3 A;  4BE2 A;  4AHV A;  4CJK A;  4KB0 A;  2F8S A;  1NJW A;  3WNH A;  1EET A;  4CJP A;  4HHT A;  3RMC A;  1IG9 A;  5HP1 A;  1Z26 A;  2YNG A;  3QEI A;  1WSG A;  3KIO A;  3L3V A;  4KTW A;  3KTQ A;  4KTQ A;  3NH0 A;  5HRN A;  3MEE A;  3B6P A;  2HVH A;  3TWH A;  3AA5 X;  4GMJ B;  4DTM A;  1EX4 A;  1DTQ A;  4CE9 A;  4FJI A;  4JS4 A;  4FJ7 A;  2WOM A;  3AO2 A;  1LAW A;  3P5J A;  4LH4 A;  3HM9 A;  3ULD A;  4PA1 A;  3TAQ A;  2OA8 A;  4DFJ A;  1RBR A;  3OVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...