4O55A

Hiv-1 integrase catalytic core domain complexed with allosteric inhibitor (2s)-tert-butoxy[6-(5-chloro-1h-benzimidazol-2-yl)-2,5-dimethyl-4-phenylpyridin-3-yl]ethanoic acid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
154
structure length
139
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title A New Class of Multimerization Selective Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/inhibitor
total genus 45
structure length 139
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o55A00
4EZ9A 4DTUA 5J2MA 3LP2A 3RMCA 1QSYA 1NKBA 1RT6A 5JS2A 1WAJA 4M41A 3HPHA 2IGIA 3U3YA 2HNYA 4CIEA 2GBZA 4LSNA 4OPJA 3I0RA 4E7JA 3V9WA 1XI1A 2WOMA 4IG0A 3ULDA 2XRIA 4CF0A 3QESA 4GW6A 1ASWA 3FFIA 4BE0A 2XO7A 1CXUA 1SKRA 1L3TA 1X9SA 1NOZA 3MEEA 3WNHA 3VQ9A 3TR8A 4G1QA 3OYAA 4DQPA 2HHQA 3HXMA 3RMAA 1U04A 3KJVA 4KHWA 2WONA 2Z1IA 1LAWA 1LWCA 3VA0A 1NKEA 1WAFA 3HJFA 1WSEA 1RTHA 1RTIA 1JL2A 3ZT4A 4IBNA 2X78A 3CQ8A 1UA1A 4CJ4A 1Q9XA 4E7HA 3AO3A 1FKPA 4CIGA 3SZ2A 2HHVA 4DU1A 1KLNA 2Z1JA 3AVFA 3SYZA 3V81A 1X9WA 1JXBA 2OPSA 3LANA 4KTWA 3CFRA 4OGCA 3S3OA 4DU3A 2D0BA 3U6FA 3MEGA 1U4BA 3HP6A 2G8WA 4Y1DA 3V4IA 3AVCA 3ZSQA 4R5PA 4O4GA 4RW6A 1CLQA 3OS0A 4KKOA 4Z4IA 1RBSA 1WSGA 1C0MA 1U45A 1KCFA 1UA0A 2G8FA 3S3MA 4B9VA 1RTDA 1BQNA 2XHBA 1MU2A 4H4OA 4EP5A 4M3YA 4FJ8A 1VSHA 1TK8A 1BGXT 3KLFA 5HRNA 4DTNA 5C25A 3SJJA 1L5UA 4J2EA 3ZSWA 3ZSRA 3ZSVA 2PZSA 1C0TA 4UQGA 1VSJA 3HPOA 3OJUA 3M8PA 1NJZA 2Y1JA 2PY5A 3AA4A 2F8SA 1C1AA 3LZIA 1ZBHA 4EP4A 1X9MA 1C1CA 3NE6A 4DSEA 4QOZB 2DFEA 3ZSZA 1FXXA 5E41A 4BDPA 3AO1A 3BGRA 4LSLA 3L2VA 4CFDA 4Z4HA 3DMJA 3OYBA 4LD0A 1VSLA 2IDOA 2IAJA 3V9UA 4B8CA 3K5LA 5HP1A 5C24A 3CFOA 3NDKA 3KKRA 3THVA 1ZBLA 1U47A 1LWFA 1UOCA 1BIZA 3QERA 1I3AA 4LH4A 5EU7A 2G8HA 4CGGA 1S6PA 4IG3A 4KHYA 1VSIA 4W5TA 1Y97A 3DRSA 4CEAA 2XY6A 3RMBA 3V1OA 4NCBA 3VQ8A 3PV8A 5HLFA 1WSJA 3CG7A 2ETJA 1JKHA 1W0HA 1SL2A 3IAYA 2DTUA 3F9KA 1N5YA 3ZT3A 1TKDA 1IKYA 1T03A 3ALYA 3M8RA 4AHSA 3LWLA 4N56A 5FRNA 4ZTFA 1SL1A 4HVJA 4FLWA 4FZXC 1NK6A 1XHXA 3QLHA 4Q5VA 4FJMA 4KB1A 2IS3A 4JLHA 3KK3A 1SV5A 1D9DA 3CM6A 1RDDA 2D0CA 1Q9YA 2HHUA 3HSTB 1DTQA 1JL1A 1KTQA 4I7FA 2YHBA 4Q0BA 2HHWA 1KFSA 4BE2A 5JS1A 3C6TA 3NF9A 4DQIA 3A2FA 4AHVA 1TL1A 3L8BA 4IDKA 3KD5E 1YTAA 3MAQA 2BDPA 2FC0A 4CJVA 2GUIA 3I8DA 2HHSA 4HCCA 3ZT2A 5DMRA 4KO0A 4FJGA 4GVMA 3QNNA 3G0ZA 4DFMA 4O5BA 1S1XA 1HQEA 2VWJA 3AVBA 1C1BA 3OVNA 3VN5A 4CHQA 5FROA 4DQRA 3QEWA 4K8ZA 2PYLA 3M8QA 2DY4A 1TKTA 4HCBA 3IRXA 1S1TA 3K2PA 2RKIA 4N76A 1A5WA 2B6AA 2G8VA 4DSLA 3L3VA 4DSIA 4OJRA 5HRSA 4C8OA 1RNHA 3RR7A 4FJIA 3C6UA 3AA3A 3RRGA 2E4LA 4E0DA 3KLEA 5I3UA 1LV5A 2RN2A 2Q3SA 3T3FA 3DLGA 3L2UA 3AVKA 4FJHA 4N41A 1VSMA 3P5JA 4DF4A 4E7KA 3SQ0A 4CEOA 2QK9A 4CGHA 3VQ7A 3MXIA 3NF8A 5KGWA 4KHQA 5HRPA 2KZZA 2VG7A 2BE2A 3KK2A 2R7YA 4AILC 3DOLA 3OYDA 2X6SA 4DS5A 2DFFA 2OPQA 3LPUA 4CEZA 2X74A 1NJYA 4Z4GA 1WNSA 2B5JA 2O4GA 3DOKA 4FW2A 4O44A 4OVLA 3WNFA 2GV9A 3TAEA 2A1RA 1SKWA 4CEDA 4DU4A 1NK0A 1W9HA 3TAGA 3E01A 1FKOA 3LAKA 4CK1A 4CK3A 1KSPA 1VSEA 2O4IA 2ATQA 4FM0A 5CZ2A 3NF7A 4OPKA 4JS4A 1TAUA 4O55A 5T7BA 3LWMA 2KW4A 1BCOA 3TWHA 3QIOA 4M3WA 4CERA 3WNEA 2YNGA 3OYKA 1S1VA 3C95A 4CGIA 4ELVA 4FJXA 3AA2A 1RCHA 2BGGA 4JS5A 1TK0A 4JRPA 1RT5A 1C0UA 1KVAA 4FJNA 3TABA 1RT4A 3JYTA 1U49A 4CFAA 4I9LA 1HMVA 2LSNA 5KGXA 3KIOA 3LP1A 1B9FA 1X1PA 1HYZA 1T8EA 1KLMA 1IKXA 3VQ6A 4FK0A 1KVBA 2HHXA 3TAMA 1NJWA 4E1MA 3AVJA 2OA8A 4ZTJA 5D3GA 2EX3A 4CJ3A 4CEBA 2XY7A 1KRPA 3QIPA 3ZT1A 2RF2A 4CJWA 3OYFA 1JLBA 1KVCA 1LW2A 3L2WA 3V9XA 3SUOA 1TGOA 3AO4A 3DRRA 2FBTA 3K5OA 1XHZA 4W5NA 3HVTA 3HT3A 4CJRA 3VQ4A 4KREA 4KTZA 4CJKA 1RDCA 2Z1GA 2IOCA 4TSXA 4CCHA 4C8NA 3NGIA 4B08A 4DLEA 1B92A 1RBUA 4DTSA 1S6QA 3OY9A 2HHTA 1K6YA 1D9FA 1ASUA 3SPZA 4E3SA 3DLBA 2YNHA 1XC9A 4W5RA 3JSMA 4GMJB 3SNNA 4J2DA 4CJQA 1EETA 3AVMA 2I5JA 2FBVA 4CHYA 3HVRA 4FLZA 4DS4A 4B9MA 2ZE2A 4PQUA 4B9TA 4F2RA 4FLTA 4CHOA 1WSIA 1UWBA 2DFHA 1CZ9A 3DLKA 3DYAA 3LAMA 4DTRA 2VWKA 1R0AA 4J2AA 4E7IA 4CGJA 2Y1IA 3TAFA 4KFBA 1JLEA 3K5MA 1BQMA 3PX0A 1S5JA 2D5RA 3AV9A 3L2QA 1QSSA 1HNIA 3K5NA 2YKMA 3S9HA 3VQPA 4CGFA 4DG1A 4W5QA 3OYNA 3OYGA 4FJLA 3HPGA 3SI6A 4FYDA 1B9DA 1IG9A 1DTTA 1VSKA 3NHGA 5KTQA 4KV8A 1JLGA 3O3HA 4FZZA 1SKSA 4DFPA 4CHNA 4Z4EA 2ZQBA 4AHUA 3VQ5A 1L3SA 1RT7A 3V6DA 2XY5A 4HUEA 4KHUA 3RR8A 1Z26A 4O0IA 3AA5X 4BDYA 3QETA 4RW9A 3D45A 3VQQA 3TAPA 4AHTA 1D8YA 2OZMA 1S9EA 2OPRA 1IO2A 4YFUA 5I42A 3LP0A 4C8LA 4CIFA 4QCLA 3LP3A 4BWMA 2HB5A 3K59A 5SZTA 4DSJA 1C6VA 1A5VA 3IS9A 3NAEA 3HK2A 2XY8A 4IFVA 4W5OA 4ID5A 4KAZA 1ZBIA 1TL3A 2YNFA 4M3UA 5CYMA 1LW0A 4ID1A 4DMNA 1G15A 1KFDA 3QO9A 4FLVA 1VK0A 4OGEA 2IC3A 4CHPA 2VG5A 3NH1A 3V9SA 1O1WA 2E6LA 4CEEA 1YT3A 3VQEA 3VA3A 4DTPA 3LDSA 4KRFA 4OLBA 4FJJA 4KTQA 1IH7A 3PO5A 1T05A 4M3ZA 4AH9A 4N5SA 2ZD1A 4KHNA 1HNVA 4WE1A 4FLUA 1YVUA 4RG8A 4CEQA 4CJSA 3SUNA 4KB0A 1QSLA 1BI4A 3VQBA 2OYQA 4F3TA 4PY5A 3V1QA 1U48A 3I0SA 4DLGA 3LZJA 3OJSA 3DM2A 3EY1A 1NKCA 4FK2A 5FRMA 2QKBA 2HNDA 4DSFA 3TI0A 2YV0X 1J9AA 1F21A 4KI4A 2HW3A 3QNOA 4BWJA 2KQ2A 3OYHA 4HHTA 3DLRA 3V9ZA 4E7LA 2G8KA 4DWIA 4FJKA 3K58A 1TV6A 3NGZA 3F73A 4CF9A 3KLIA 3RTVA 3DI6A 3QEPA 4B9UA 4Y1CA 3ITHA 4J2BA 1QQCA 4OKEA 2G8UA 1RBTA 3DRPA 3EZ5A 1LAVA 1L3VA 3RRHA 3WNGA 2P51A 3SQ1A 1NK5A 4PUOA 3NF6A 3HM9A 3SUPA 3KK1A 1RT3A 4OLAA 5KI6A 4CJFA 3AVAA 4DQQA 2P1JA 4CF1A 4M3XA 4CK2A 1EP4A 4AHRA 4OKJA 4RW8A 1D5AA 5CY4A 3BDPA 3NCIA 2OPPA 4M42A 1REVA 3AO5A 2KTQA 4DQSA 3PX6A 1RDAA 1HRHA 3AO2A 3KLGA 2HNZA 3ZCMA 1NOYA 2F8TA 1DLOA 1BCMA 3CFPA 3AVLA 3ASMA 4M3RA 2FBYA 5J2QA 4HUFA 1GOAA 2Z1HA 2JLEA 1SUQA 4PA1A 1NK7A 2P5OA 4EZ6A 3OYIA 1CXQA 3D0PA 4MFBA 1TAQA 3O3FA 1ZYQA 1QHTA 4H8KA 3VQAA 3P83D 4CJTA 4E19A 5KRTA 4O0JA 4FJ5A 4L8RB 3ZSXA 1S1WA 1L3UA 1WSFA 1VRTA 4CJLA 3VQDA 4E1NA 3L2RA 1NK8A 4FK4A 2D0AA 1S1UA 3HL8A 2KZMA 5HBMA 3HP9A 3PUFA 4I2PA 4IFYA 3K57A 2NUBA 4F8RA 4I2QA 2VG6A 1JLCA 4CF8A 1TK5A 3NH2A 2HVHA 3OYJA 3SV3A 1SL0A 1JLAA 3B6OA 1LWEA 2E6MA 3MXMA 2AJQA 3CYMA 3HYFA 1RBRA 4CECA 1CZBA 1WN7A 3ISNC 1XWLA 4RW7A 3DLHA 4B3OA 2QKKA 1I39A 4DFJA 5KRSA 4CF2A 3QEXA 1QS4A 1IKWA 1YTUA 1BHLA 3QINA 3H08A 5C42A 4FJ9A 3HO1A 4YNQA 1S9GA 3O4QA 1BI4B 4F3OA 5CZ1A 4JRQA 3RWUA 2HMIA 3AVNA 1EKEA 3VQCA 3ZT0A 1ZBUA 1HYSA 4FZYA 1HQUA 3QEVA 3T19A 1QE1A 1VRUA 2HVIA 2RPIA 3LPTA 4FW1A 3NBPA 4LY7A 3PX4A 4XIUA 4HTUA 3TANA 1BIUA 3LALA 2JGUA 4DTXA 1ITGA 5J2PA 4DTOA 4KI6A 2PYJA 1UAXA 4FJ7A 4NCGA 1VSFA 4CJ5A 2ITGA 3NGYA 3EYZA 1RDBA 4NYFA 4ZHRA 4KHSA 5HRRA 1HPZA 4B8AB 4DSKA 4Z4FA 3SCXA 3G10A 4QAGA 4B9LA 4PWDA 2KFNA 2YKNA 4B9SA 5K14A 4FXDA 4CHZA 4RW4A 4F4KA 2KFZA 3UIQA 1ASVA 4I9QA 1WSHA 4E89A 2FBXA 3AVGA 3OYEA 1VSDA 3TARA 1NK4A 1NK9A 1JLQA 5CYQA 4N47A 1NJXA 2P5GA 4CFCA 1T7PA 4ELUA 3ZSOA 4DTJA 1J54A 1GOCA 3SV4A 4BACA 3KD1E 4ELTA 3NH0A 1JXEA 4FM2A 3MECA 1A5XA 1TVRA 3CM5A 4Z0UA 4CJUA 1IKVA 1JLFA 4H4MA 1HJRA 4NCAA 3QEIA 4CFBA 3B6PA 1J5OA 1RTJA 5FDLA 4LH5A 3C94A 3KTQA 3L3UA 3SQ2A 4IKFA 3PY8A 2YHAA 1TKXA 3OYCA 1Q8IA 3U3GA 2A1SA 3RMDA 4BDZA 2B4JA 3NFAA 2F96A 3ZSYA 4AHCA 1QTMA 1RT2A 4BE1A 4ICLA 3OYMA 4FLXA 4NYNA 4DF8A 3OYLA 1TKZA 1WLJA 3MEDA 3S3NA 3O4NA 3PO4A 2OZSA 1HYVA 4CGDA 3TAQA 4M45A 3P1GA 3MXJA 3KLHA 3SUQA 4CEFA 4DTMA 4MQ3A 2YNIA 1Z25A 3AVHA 3OS1A 5J2NA 4F2SA 3V1RA 2W42A 4K8XA 5SWMA 1N6QA 4C8KA 3T1AA 1FK9A 4FVMA 5DK5A 1BISA 2EHGA 1BL3A 4CJPA 4FCYA 4FM1A 3SPYA 1RT1A 3SQ4A 4B9NA 1EXQA 3KKSA 4OKKA 1GOBA 1RBVA 2X6NA 3O3GA 5HROA 4M3TA 2G8IA 2QXFA 1EX4A 1ZBFA 5J1EA 1J53A 4CJEA 3DLEA 4CESA 3IG1A 3OS2A 4Z4CA 4FLYA 4DFKA 4HUGA 4KPYA 4CE9A 3M8SA 2BANA 3AVIA 4C8MA 1RILA
chains in the Genus database with same CATH superfamily
4EZ9A 3RMCA 1RT6A 1NGGA 5JS2A 2VQFK 2IGIA 3VF2A 4JKAA 4LSNA 3V9WA 4K41A 3ULDA 3VEYA 1NGCA 3QESA 2KHOA 4GW6A 2QI2A 3PIOL 4JKCA 4BE0A 1L3TA 3TR8A 2AP1A 2HHQA 2D1KA 3HOSA 1NGEA 3KJVA 2Z1IA 4H03B 1LAWA 3VEWA 5LY3A 2DPNA 5FPDA 3HJFA 3ULEA 2CGKA 3A5LC 1RTHA 1RTIA 1Q9XA 2UXDK 1X3MA 3WXKA 1VQPN 3AO3A 1FKPA 2F9WA 2HHVA 4H0TB 2OPSA 2FF3B 3MEGA 4NXMK 3AVCA 4B1WB 2P9PA 5BPMA 1UA0A 3S3MA 2QWMA 2XHBA 4M3YA 1VSHA 4H5WA 4CZGA 4DTNA 4MLHA 3SJJA 1L5UA 4J2EA 3OBWA 5M1OA 3ZSWA 1IBKK 3M8PA 1NJZA 5C15A 1ZBHA 4BRAA 1TYQB 1C1CA 4DSEA 2DFEA 5CE3A 1FXXA 4BDPA 4CFDA 1VQLN 1E4FT 3O9RA 1VQ7N 1VSLA 4K42A 4IJNA 3K5LA 3NDKA 3CFOA 1XC3A 1WBBA 1ZBSA 2G8HA 4KHYA 2YI1A 1BDGA 4CEAA 3V1OA 3PV8A 5HLFA 3LM2A 2ETJA 1W0HA 1SL2A 3GOIA 3IAYA 1NMDA 4FWPA 1SZ2A 3ALYA 4JKEA 5GAEP 1G99A 4CZFA 5BR9A 1GLJO 4FZXC 3R1XA 3QLHA 2IS3A 4JLHA 2OCEA 1RDDA 2D0CA 1Q9YA 2HHUA 3HSTB 2PBDA 4MO5A 3CQYA 3FR0A 4I7FA 4Q0BA 3NF9A 2WTUA 3C6AA 3L8BA 5GAHP 2O8BA 3ZX3A 3C7NA 3I8DA 3N4QA 4B9QA 5DMRA 1Q7YO 3G0ZA 4H5TA 4BC5A 1S1XA 4DR3K 1C1BA 1RGIA 3KVGA 4OPAA 2NNWA 3K2PA 4YHHK 4N76A 2RE2A 3HI0A 4IO9L 3L3VA 4LFCK 2YJFA 4DSIA 3D7EO 2V51B 2ASMA 3LM9A 4CI6A 1LV5A 4E7KA 3VQ7A 2KZZA 2O8EA 3JS6A 3TU5A 4ILGB 4AILC 3DOLA 3OYDA 2X6SA 5LMNK 4CEZA 3BY5A 1GLDG 1NJYA 2YCHA 4Z4GA 4QS8A 1WNSA 3DXKA 4OVLA 3TAEA 1SKWA 1NK0A 5AQQA 1FKOA 3EL2A 5AQLA 5C2FA 2ATQA 4FM0A 1TAUA 4OPKA 4PKHA 3LWMA 2KW4A 5AQWA 3TWHA 4H0OA 3QIOA 4M3WA 2YNGA 4CW7B 4FJXA 4HWIA 1TK0A 1HKCA 1RT5A 1C0UA 4B3MK 3TABA 4I6MA 5BN9A 3ID6A 2QXLA 4I9LA 1HMVA 2LSNA 3CC2N 2NLXA 1X1PA 3DAWA 4FK0A 2P9NA 3AAQA 3AVJA 2EX3A 3KWGA 2QA4N 3ZLJA 2OTJN 2XY7A 2D4WA 4FSVA 2RF2A 1HKGA 1C0GA 4U67L 1TGOA 4KBOA 1XHZA 4JI4K 4CJRA 2Z1GA 5E84A 3FZLA 4JI3K 2FSKA 1D9FA 2HHTA 3DLBA 4XH5A 1XC9A 3JSMA 3OW2M 4J2DA 3CPEA 4DS4A 1EETA 4DQ8A 3DXMB 2PAVA 2ZE2A 3A0IX 4BR2A 4PQUA 4F2RA 4WQ4C 2VWKA 4E7IA 3H45C 5AR0A 1JLEA 3PX0A 1BQMA 1S5JA 3AV9A 4BG8A 1QSSA 3K5NA 3OYNA 4DG1A 3OYGA 1OH6A 3HPGA 4FYDA 4AQYK 2YHXA 4DR5K 4DFPA 4Z4EA 2ZQBA 3VQ5A 2XY5A 4HUEA 4KHUA 3RR8A 1EWQA 1OVQA 4HTLA 1K8KA 3TAPA 4AHTA 1D8YA 2W41A 4YFUA 1IO2A 5I42A 4BREA 5M1FA 2QTDA 5AQYA 3LP3A 4BWMA 3K59A 5SZTA 1C6VA 5BRHA 3NAEA 4M7YA 4W5OA 1T3VA 1TL3A 4DMNA 1G15A 1NG9A 3KK7A 1IBLK 4CEEA 3O9UA 2QWPA 3LDSA 1DKGD 4OLBA 4KRFA 3ZYYX 4GV3A 1IH7A 3PO5A 4M3ZA 4B3SK 2ZD1A 4B1VA 5C10A 3MCPA 3O9TA 1QSLA 4V19S 3V1QA 3G6EN 2CGLA 3SBGA 4DLGA 1CZAN 5CR4A 3OJSA 4FK2A 3U9DA 1NBWA 3VEXA 1F21A 4KI4A 5AQPA 5AQRA 4LFAK 3OA9A 2KQ2A 4FJKA 2G8KA 1NGFA 1TV6A 3JXUA 2F7TA 4CF9A 4B9UA 4IWVA 3I8BA 2G8UA 2Q0RA 4WFNL 1RBTA 5AZIB 5AQZA 4IOAL 2HHHK 3NF6A 5BPLA 3HM9A 2ZGYA 4JYAK 4CJFA 3AVAA 2P9UA 5F2RA 4M3XA 1EP4A 3DLLL 4RW8A 3WQUA 3VF4A 1D5AA 5CY4A 1I94K 3BDPA 2O8CA 1REVA 3MN5A 4FL9A 4XH4A 4U7BA 3PX6A 2KTQA 3AO2A 2HNZA 1NOYA 4BRDA 2FBYA 5J2QA 1GOAA 2JLEA 1NK7A 1CXQA 1T6CA 1TAQA 5JLFA 1QHTA 4E19A 1HNXK 4H5RA 3PLAA 3VQDA 1S1UA 3HL8A 1QZ6A 5HBMA 4JHDA 5LMUK 3K57A 4YOYA 1JLCA 4K43A 3OYJA 2HVHA 5EY4A 3WT0A 4FWSA 3CYMA 3HYFA 3ISNC 1XWLA 3ZETA 4H0VB 1KAYA 1QS4A 1BHLA 4EFHA 3H08A 3VETA 4F3OA 2PFUA 2HMIA 1EKEA 3O6WA 2ZJRL 5TKYA 4ISGA 4GKJK 3NBPA 3LDLA 3NVKA 3LALA 4DTXA 1ITGA 1HPMA 5HL7L 4FOIA 5AFUA 2PYJA 4IJAA 4FJ7A 3FZHA 4NCGA 5EOYA 2ITGA 2P9SB 3WEEA 1RDBA 4NYFA 5HRRA 1HPZA 4B8AB 2KFNA 3UIQA 4I9QA 4E89A 3OYEA 1N33K 3TPQA 4BY9C 1NJXA 2P5GA 1T7PA 3F5TA 1T6DA 1GLBG 1EQYA 4LF8K 3KD1E 4FM2A 4DV3K 1IKVA 4JI2K 3UKRB 3QEIA 4CFBA 3NMUA 1YJWN 3U3GA 4YY3K 3THYB 1Z6RA 5AZJB 4AHCA 1QTMA 3C65A 3WXMB 1RT2A 3IKMA 4ICLA 4Z94A 4FLXA 5B8HA 4JV5K 4DF8A 1RDWX 2OZSA 1HYVA 3FLCO 4PL8A 4CEFA 4K8XA 2W42A 1GLAG 4BQLA 1BISA 2EHGA 4CJPA 4A59A 3CCQN 1GOBA 4QOZB 5HROA 4GV9A 2HOEA 1BWFO 4A5BA 1VHXA 2BANA 3IDHA 3THWB 1NKBA 3CCEN 1WAJA 4M41A 3HPHA 4CIEA 4E7JA 2WOMA 2XRIA 4CF0A 3W3DA 1ASWA 2HMPA 3FFIA 4A5AA 3OHRA 1E4GT 3OYAA 4DQPA 3RMAA 1O13A 5IWAK 3SBTA 2WONA 3VGKA 4MLEA 5AQUA 1VQ5N 3MDQA 4B3RK 1NKEA 4QS7A 4BR7A 3CQ8A 1UA1A 4CJ4A 2IIRA 2H3GX 4DU1A 3SYZA 3V81A 1JXBA 4KTWA 1U4BA 4OGCA 3S3OA 4DU3A 3U6FA 3AGKA 3HP6A 4Y1DA 3V4IA 4R5PA 4OO1J 4O4GA 4YDUA 1KCFA 4PKGA 5ADXH 1BQNA 4MDBA 5HRNA 3M6GA 2GWKA 2PZSA 3QDKA 1C0TA 2YHYA 4CZHA 4CZEA 1C1AA 3LZIA 5E41A 2P9IB 3AO1A 4LSLA 3L2VA 3SAHA 3DMJA 1ESVA 2E2OA 1GLCG 2IDOA 4BRKA 2NRZA 3V9UA 3THXB 1ZBLA 3KKRA 1U47A 1W97L 4Y0WA 1LWFA 2ZF5O 1I3AA 3PSFA 4BC2A 2IVOA 4JD2B 2O8DB 2HF3A 3CF5L 1VSIA 2XY6A 4NCBA 3VESA 5BPNA 3BZCA 2DTUA 3QFPA 4ILJA 2J4RA 2E20A 3R3LA 3LWLA 4YOXA 3VTHA 1SL1A 1NK6A 1XHXA 3CMEN 1D9DA 1NGHA 4DV1K 1BOTO 1JL1A 2YHBA 4DQIA 4AHVA 1TL1A 4B1XB 3L0QA 1MWKA 2E2QA 3MAQA 4CD1A 5LJVA 2GUIA 3VTIA 4HCCA 1VAZA 4FJGA 4GVMA 1HLUA 1HQEA 2VWJA 3AVBA 3OVNA 5GINA 3H1QA 2RKIA 4DSLA 3KZBA 3O5BA 4OJRA 3DXMA 3RRGA 3TSUA 3P5JA 3SQ0A 2QK9A 1VQ4N 2F4VK 4DS5A 2DFFA 2OPQA 3D2FB 2X74A 2CGJA 5AQFA 2B5JA 4FW2A 5BN8A 3UKUB 4WFBL 4GVEA 3VEZA 4CK3A 1KSPA 2O4IA 3C6HA 5CZ2A 3NF7A 2HBMA 3OTOK 3MN7A 3WNEA 3OYKA 1RCHA 5EX5A 4JS5A 4JRPA 1KVAA 3CJAA 2NRTA 5AQNA 1U49A 3CCLN 3KIOA 1T8EA 1B9FA 1KLMA 1IKXA 5FPMA 3VQ6A 1KVBA 1N8RO 3TAMA 2E5LK 4E1MA 2VCPA 4FWLA 1Z05A 4CEBA 1N36K 3QIPA 3OYFA 4CD3A 3L2WA 5LJWA 4LF4K 3DRRA 3GBTA 5EVZA 4B08A 1XNQK 2QWQA 3H3NO 1N34K 3LL3A 2WBNA 3I56N 2P9LB 3HVRA 2I5JA 5GAGP 4CHYA 4B9MA 4WYBA 3MK6A 3QICA 4B9TA 1IG8A 3HK2A 3DLKA 1N6QA 1CZ9A 4CGJA 2Y1IA 3TAFA 4KFBA 3K5MA 2WUSA 1Q81O 1HNIA 4IXCA 4FJLA 4XH1A 1B9DA 1HUXA 2RHKA 3O3HA 4FZZA 2ZJQL 1L3SA 1RT7A 4H0XB 4DR1K 3V6DA 3G25A 1OH8A 2A40A 1JCEA 1Z26A 3A8YA 4O0IA 4RW9A 3VQQA 2YX6A 4DV5K 3LP0A 3BEXA 2WFBA 4CIFA 4QCLA 1OH5A 1A5VA 4IFVA 1U2VB 4LFBK 2YNFA 1LW0A 4DV0K 3P38A 4PKIA 4OGEA 3NH1A 2VG5A 3V9SA 4FPAA 4EIAA 1XUPO 3VA3A 4DTPA 1X9JA 3I33A 4CBWA 4KTQA 3U8XA 1T05A 4AH9A 4KHNA 4AF1A 1JJ2M 4FLUA 1DGKN 1YITN 1NGIA 5AQHA 2OYQA 1KD1O 3D2EA 1U48A 2ASOA 3DM2A 3HM8A 4NB4A 2FF6A 5FRMA 1J9AA 3GL1A 3QNOA 4BWJA 1S3XA 3W0LA 4UY8O 3OYHA 4BVOA 4A62A 4HHTA 4E7LA 3DJCA 4QS9A 1VQ9N 3F73A 3NGZA 3RTVA 3KLIA 4J2BA 3T1YK 4BC3A 1NWKA 3ITHA 5JVHL 3ATVA 1LAVA 3RRHA 3WNGA 2A41A 5JMVA 3M5RA 3SUPA 3L4QA 5KI6A 3LDNA 5KQDA 4DQQA 3RSEA 4AM7A 2P1JA 2UU9K 1E3MA 4CK2A 4AHRA 2Q36A 3K0SA 3MX5A 1DLOA 5BRFA 2Z1HA 4EHUA 1SUQA 3Q7BA 3EO3A 4YOTA 3THYA 4BGAA 5HOOA 1ZYQA 5AZJA 3P83D 4CJTA 3LDQA 4L8RB 4E1NA 4FK4A 3ID8A 4I2PA 4IFYA 2NUBA 4CF8A 4X65K 1OKJA 3NH2A 4DR7K 3TTDA 1JLAA 3B6OA 2AJQA 3TSQA 1RBRA 2BH1A 1WN7A 3E1YA 4IDHA 3BUZB 4DFJA 5KRSA 1VQNN 1NGDA 4JKHA 3B8AX 4DB3A 3HO1A 5AQIA 1S9GA 3O4QA 4JRQA 3RWUA 3ZT0A 1ZBUA 4F9OA 4FZYA 3EEQA 1QE1A 1VRUA 4BGBA 3P4IA 2A3ZA 4FW1A 3O1WA 3T1HK 1R59O 1UAXA 4CJ5A 4LC9B 2FLOA 3CIPA 3G10A 5AQXA 2YKNA 1ZC6A 4FWNA 1LOTB 5DM6L 1ASVA 1WSHA 2FBXA 4BRIA 1NK4A 1NK9A 4JI7K 5CYQA 4N47A 1NU0A 4CFCA 5GIOA 3FGUA 3LDPA 1J5EK 3NH0A 1TVRA 2CH6A 3H1VX 4NCAA 2VYPA 1S22A 1RTJA 3KTQA 3L3UA 3ENHA 4IKFA 1VQ8N 2UXCK 2YHAA 2GUPA 3WQTA 3E9OA 3ZSYA 1RFQA 3OYMA 4NYNA 1V4SA 1TKZA 3OYLA 1KXPA 3O4NA 4M45A 3VERA 3QBWA 3MN6A 5J2NA 1Z25A 4F2SA 1HYSA 2P9IA 3V1RA 5SWMA 1FK9A 4FVMA 4FCYA 1BL3A 3MMVA 4FWQA 3SPYA 5JVGL 2V7YA 1EXQA 1KAXA 4OKKA 1RBVA 2JWKA 3O3GA 3THXA 2QXFA 1EX4A 1NMNA 3OS2A 4Z4CA 3G4SN 4DFKA 4HUGA 2V7ZA 3MX2A 2O8DA 4CE9A 4O5FA 4ILHA 3QETA 5J2MA 3LP2A 2QWOA 3O1BA 4O8KA 2HNYA 4OPJA 2GBZA 1FJGK 3I0RA 1KAZA 4IG0A 3SK3A 1VQKN 3CCSN 2XO7A 1SKRA 1X9SA 3S41A 4G1QA 5AQTA 1HX1A 1U04A 4KHWA 2GELA 2ZGZA 1JL2A 3ZT4A 4E7HA 3SZ2A 1KLNA 4JI5K 1X9WA 3A5MC 3CC7N 4RW6A 3OS0A 4DR4K 1C0MA 1HNWK 2G8FA 2ZJPL 1MU2A 4EP5A 3VMFB 1BGXT 3KLFA 3HPOA 3OJUA 3HRGA 2Y1JA 1NJIO 2A5XA 1Q82O 4EP4A 3C7NB 3BGRA 1XMOK 5M1QA 1T44A 3OYBA 3A5OC 4LD0A 3BF3A 3P39A 2IAJA 3K9KA 2D0OA 3PSIA 4X64K 1UOCA 3QERA 1DEJA 3UKUA 3H6EA 4CGGA 1S6PA 1Y97A 3DRSA 4DV7K 3AAPA 2QWRA 1GLLO 1TUYA 3VPZA 3KWIA 1JKHA 1N5YA 3ZT3A 4E1JA 1QVGM 3M8RA 4AHSA 4N56A 3WXIA 1N32K 4HVJA 1QQNA 4RCHA 4JEPA 4KB1A 2NZTA 2V52B 3O9SA 1NNEA 2IVPA 4BRLA 1KTQA 2GTDA 2HHWA 4BE2A 4M63C 5JS1A 3C6TA 4IOCL 2OTLN 5C0YA 1YTAA 1VQON 3N4PA 4WQ5A 1TYQA 2BDPA 3NVMA 2UYTA 2ZWHA 2FC0A 4CJVA 4DV6K 4BRQA 2HHSA 1YJNN 4DFMA 2F9TA 4I6MB 5M1KA 3VN5A 3QEWA 4K8ZA 2HF4A 4IZ9A 4A57A 5KPTA 1A5WA 2B6AA 2P9NB 4FJIA 3C6UA 1HJOA 1YUWA 3AA3A 5IT9O 2E4LA 4E0DA 3KLEA 5FPEA 1M1KO 1S72N 2RN2A 2Q3SA 3L2UA 1VSMA 2BTFA 4DF4A 2NRXA 3CC4N 1BA0A 3MXIA 3M1FA 5HRPA 5ADXA 2VG7A 3KK2A 1EWRA 3LPUA 2I7PA 3ATUA 2O4GA 3DOKA 3SAFA 5GIPA 2GV9A 3J7AP 4CEDA 2Q0UA 3CJCA 4DU4A 3TAGA 2YJEA 3E01A 3E9LA 3LAKA 3EKSA 1VSEA 2P9KB 2E2NA 4JS4A 4O55A 3UE5A 5T7BA 1BCOA 4NXNK 4JKBA 2GWJA 4BR9A 1U2VA 1S1VA 3C95A 5AQOA 1ILYA 3AA2A 3HSCA 3F9MA 1RT4A 3RVCA 1WB9A 3CXCM 1K73O 3WUHA 3MN9A 4YOVA 4BRNA 2HHXA 3ZX2A 1IBMK 4IEEA 2W6LA 4ZTJA 5D3GA 4YDUC 3O9QA 3R6MA 3KHYA 4CJWA 3V9XA 1IJJA 4CZMA 3AO4A 4W5NA 4O8UA 3HVTA 4G9ZA 3VQ4A 4DR2K 4KTZA 4CZKA 2IOCA 4CCHA 4C8NA 3NGIA 3CCMN 2KKZA 4DLEA 1RBUA 1SS6A 4YORA 3OY9A 4DTSA 1K6YA 3SPZA 2YNHA 4W5RA 3SNNA 4GMJB 4CJQA 4FLZA 5AJ3K 3EE9A 3JAMO 3CETA 4FLTA 2Q2RA 1WSIA 4CHOA 1R0AA 3DYAA 3LAMA 4J2AA 4BRHA 4BRCA 2D5RA 3D6RA 3HTVA 3S9HA 2YKMA 4W5QA 4CGFA 5H1SQ 1RDUA 1DTTA 3NHGA 5KTQA 1JLGA 5E26A 4CHNA 4FPBA 4RWTA 3J7ZO 4ISEA 2NRVA 1MWMA 4JNEA 2OZMA 1YI2N 2OPRA 2P9UB 3OBYA 4YOWA 4NLCA 2XY8A 4KAZA 1ZBIA 4M3UA 3H3OB 5CYMA 2EWSA 2UXBK 1KFDA 3QO9A 4FLVA 1VK0A 2IC3A 4CHPA 3A5NC 1O1WA 3BF1A 1YT3A 5A2QO 5CHIA 3VQEA 3HBTA 1D4XA 4FJJA 2E88A 1JCFA 4IEIA 4N5SA 1HNVA 4NLBA 4CZJA 1YVUA 4RG8A 4CJSA 3SUNA 4KB0A 3CD6N 3VQBA 3DWLA 4F3TA 4PY5A 2KLAA 4JHDB 1M90O 2QKBA 5BREA 4A61A 2HNDA 3TI0A 4DWIA 3CJ1A 1GLFO 3QEPA 1KQSM 4Y1CA 4OKEA 1K9MO 4ISFA 4X66K 1L3VA 2P51A 3SQ1A 4PUOA 4H0YB 2I7NA 3LDOA 4OKJA 5KPZA 4CZLA 2OPPA 4IOXA 3AO5A 4DQSA 4JAXA 1FW6A 3KLGA 3ZCMA 3PIPL 1BCMA 3CFPA 3AVLA 4M3RA 5BR8K 1X3NA 4PA1A 2P5OA 3WEEB 1XNRK 4EZ6A 3OYIA 4MFBA 3O3FA 4BR5A 4EAHD 5KRTA 4O0JA 4FJ5A 3GE1A 1TUUA 1WSFA 1L3UA 3L2RA 1NK8A 2JWLA 4GKKK 1Q86O 3HP9A 3PUFA 1TK5A 5FLXO 1SL0A 4MO4A 4CBUA 1U6ZA 3SMSA 2VWBA 2O8FB 1LWEA 1C0FA 2E6MA 2E8AA 2A6AA 4CECA 1CZBA 4RW7A 4J8FA 4B3OA 4CZIA 4BRMA 1QQMA 4CF2A 5AZIA 1YTUA 1IKWA 3VF6A 5C42A 4YNQA 1BI4B 3HOTA 5CZ1A 4CVNE 3AVNA 3VQCA 3TTCA 2E2PA 3VEOA 2HVIA 1NM1A 4LY7A 3PX4A 5J2PA 2JGUA 3VEVA 4C1NI 1VSFA 4B3TK 3MWPA 4PWDA 3SCXA 4B9LA 4B9SA 2KFZA 4F4KA 4CJ7A 2NRWA 3TARA 1JLQA 1ATRA 5MLCQ 4ELUA 4DTJA 3QFUA 3SLCA 4B1UB 2QWNA 4BACA 3TSPA 1A5XA 4CJUA 4H4MA 1XMQK 1LCUA 1QHAA 4BRPA 4JKGB 2E1YA 3PY8A 1Q8IA 4DHYA 3RMDA 4BDZA 1P8ZA 2B4JA 2QWLA 3NFAA 4FWOA 2F96A 5JLHA 4KH5A 4BE1A 3S3NA 1WLJA 3MEDA 4CGDA 2Q31A 4A2BA 3KLHA 4JI0K 4DTMA 4MQ3A 2YNIA 4RTFD 3OS1A 4C8KA 1SQKA 4FOEA 1RT1A 5FPNA 3KKSA 4K0KK 2X6NA 4H5VA 5J1EA 1ZBFA 4JK8A 4CJEA 3DLEA 4CESA 2P9SA 2VQEK 4KPYA 3J80O 3M8SA 3U4LA 3AVIA 4C8MA 1RILA 4DTUA 1QSYA 3F2KA 3U3YA 3AARA 1W2BM 5BRDA 1QZ5A 1NGJA 4FWRA 1XI1A 5AQSA 1BA1A 3UKRA 4BG9A 1CXUA 1NOZA 3MEEA 3WNHA 4H5NA 4JN4A 3VQ9A 4DKWA 3HXMA 4IFEA 4A2AA 2FXUA 1LWCA 3VA0A 1VQ6N 1WAFA 1K8AO 1WSEA 4IBNA 2X78A 5DM7L 3FZFA 1YF5L 4CIGA 2Z1JA 3AVFA 3LANA 3CFRA 2D0BA 2G8WA 1NGAA 3ZSQA 4GY2B 2NRHA 1CLQA 4KKOA 4Z4IA 1RBSA 1WSGA 4KH6A 1U45A 4B9VA 1RTDA 3WXLA 4H4OA 4FJ8A 1TK8A 5C25A 1W7AA 1OVYA 3ZSRA 3ZSVA 3THWA 3I55N 4UQGA 1VSJA 1MDUB 3AA4A 2F8SA 3EN9A 5AQJA 1X9MA 3NE6A 3R8EA 5AQKA 1P90A 3ZSZA 1YHQN 3R9PA 1GLEG 4Z4HA 4DUZK 5HP1A 4B8CA 5C24A 3THVA 4WQ4A 1BIZA 4LH4A 5EU7A 4LF9K 4BRGA 4IG3A 3ZEUB 1J6ZA 4W5TA 3RMBA 2P9KA 4JI1K 3VQ8A 1WSJA 3CG7A 1VQMN 3F9KA 1TKDA 1IKYA 4BR0A 2FSNA 1T03A 5KPRA 4L3QA 3L4IA 5FRNA 4KHPK 4ZTFA 4FLWA 4Q5VA 4FJMA 3CCUN 3KK3A 1SV5A 3CM6A 4OPHA 1DTQA 1KFSA 1JCGA 3ULEB 3A2FA 4FO0A 4IDKA 3KD5E 3HZ6A 1DT9A 4JK9A 4DV4K 3BZKA 3ZT2A 4KO0A 3QNNA 2VGNA 4O5BA 4CHQA 5FROA 4DQRA 2PYLA 3M8QA 2DY4A 2P9PB 1TKTA 4HCBA 3IRXA 1S1TA 4CBXA 4JD2A 4NO7A 2G8VA 5HRSA 4C8OA 1RNHA 4AM6A 3RR7A 1QVFM 4H0PA 3CCRN 2W6KA 5I3UA 4BR4A 4GNIA 3T3FA 4FJHA 4K25A 3DLGA 4N41A 3AVKA 4PL7A 4CEOA 4CGHA 1OH7A 4KHQA 3NF8A 5KGWA 2BE2A 2R7YA 3EZWA 3CCJN 2PY5A 4O44A 3SJHA 3WNFA 2A1RA 1W9HA 3IUCA 4CK1A 4LF6K 3VOVA 3M3ZA 4DUYK 4CERA 2YHWA 5C2DA 4CGIA 4ELVA 2UUBK 5JICA 2BGGA 2A42A 4FJNA 5I9EB 3FE1A 1ZXOA 4IO8A 3JYTA 4CFAA 5KGXA 3LP1A 1HYZA 4JI6K 2IVNA 1YAGA 2HBLA 1NJWA 5M1NA 2OA8A 3QBXA 4CJ3A 3CI5A 1KRPA 3ZT1A 2O8BB 1JLBA 1KVCA 1LW2A 2ZM6K 1YJ9N 5F0XA 3SUOA 2FBTA 3K5OA 3CERA 3HT3A 4KREA 3BP8A 3E66A 4CJKA 1RDCA 2Q1NA 2QM1A 3D2FA 2E1ZA 4TSXA 3FZMA 5AQGA 3L6QA 3CPWM 1B92A 5KQ8A 1S6QA 1ASUA 2OANA 4E3SA 4B1ZA 3ENBA 3CJBA 2HBJA 2ASPA 3AVMA 2FBVA 3T69A 4C23A 1YXQA 3ENOA 3D2EB 2DFHA 1UWBA 4DTRA 1ATSA 5M1PA 2O8EB 3L2QA 3VGLA 4JK7A 3VQPA 1YIJN 3SI6A 1IG9A 1VSKA 1XQSC 1EO1A 4KV8A 3DXKB 1SKSA 2FSJA 4AHUA 4FWMA 4MDAA 1BO5O 3AA5X 4BDYA 3D45A 1S9EA 5LL6Z 3RSEB 3G71N 4C8LA 4WCEL 2HB5A 5TKWA 4DSJA 3CQXA 3IS9A 4DR6K 4ID5A 3TTFA 2NRRA 4ID1A 4WFAL 4JKFA 2O8FA 1QQOA 4WQ5C 2E6LA 3K9JA 1ATNA 1V4TA 3O8MA 1SAZA 2GX9A 2P9LA 2VGMA 4WE1A 5AFUH 2UUCK 4CEQA 4FWKA 1BI4A 4PHTX 2D0PA 3I0SA 1HR0K 3LZJA 3EY1A 1NKCA 3CHWA 4DSFA 3MCAB 2YV0X 1HNZK 2WC9A 3MWTA 1KC8O 2HW3A 4BC4A 3V9ZA 4BRFA 3DLRA 2HBKA 3AGRA 2QW9A 3K58A 3J81O 3DI6A 1QQCA 4YOUA 3ZX0A 3DRPA 3EZ5A 3AY9A 3GDQA 1NK5A 3C0BA 3KK1A 1RT3A 4B1YB 4OLAA 1BG3A 3GG4A 4DV2K 4CF1A 1NLVA 3NCIA 4M42A 3SAGA 3O4WA 1RDAA 1HRHA 1IV0A 1HKBA 2F8TA 3ASMA 3O08A 4HUFA 4JKGA 2BUPA 1BU6O 3D0PA 2ITMA 4H8KA 3VQAA 4XEIA 3CJ7A 1K8KB 1S1WA 3ZSXA 2AA4A 4BROA 1VRTA 4BVPA 4CJLA 3SMPA 2D0AA 2KZMA 3VGMA 3H46O 4F8RA 4I2QA 2VG6A 3CJ9A 1WUAA 1Q18A 3SV3A 5C12A 3O80A 4JI8K 3MXMA 2QEXN 4WF9L 3DLHA 4KH4A 2QKKA 1I39A 1WOQA 2Q97A 3J8AA 1H1VA 3QEXA 3QINA 1MA9B 2CH5A 2W40A 4FJ9A 3WXJA 4JKDA 1HQUA 3QEVA 3T19A 4M7XA 3CCVN 2RPIA 4C1NK 3LPTA 5EXWA 1Y64A 3QMLA 3TANA 4XIUA 4HTUA 1BIUA 3T7ZA 4DTOA 4KI6A 4R79A 1NGBA 3NGYA 3EYZA 4ZHRA 4KHSA 2UUAK 4Z4FA 4DSKA 4OX9K 4QAGA 5ELZA 3U9ZA 5K14A 4FXDA 4CHZA 4RW4A 3CMAN 3J7YP 3AVGA 1VSDA 2HSTA 3ZSOA 1J54A 1GOCA 4GV6A 3SV4A 2GEMA 4ELTA 2O8CB 1JXEA 3MECA 3CM5A 4Z0UA 1JLFA 3E9PA 1HJRA 3EE8A 3EKUA 1J5OA 3B6PA 5AQMA 4BQZA 5FDLA 4LH5A 3C94A 5F1XA 3SQ2A 1TKXA 3OYCA 2A1SA 3UB5A 3QB0A 3FZKA 3PO4A 1BUPA 1YVNA 3TAQA 3P1GA 3MXJA 3Q7CA 3SUQA 4LF7K 5AQVA 3AVHA 3T1AA 4DCHA 5DK5A 3IFRA 5GADP 4B9NA 4FM1A 4X62K 3SQ4A 2G8IA 4M3TA 3FFKB 1J53A 1WBDA 3IG1A 4FLYA 4FVUA 3ZETB 3VENA 3P31A 3IMXA 3ZEUA 4LF5K 4EHTA
chains in the Genus database with same CATH topology
4EZ9A 4DTUA 5J2MA 3LP2A 3RMCA 1QSYA 1NKBA 1RT6A 5JS2A 1WAJA 4M41A 3HPHA 2IGIA 3U3YA 2HNYA 4CIEA 2GBZA 4LSNA 4OPJA 3I0RA 4E7JA 3V9WA 1XI1A 2WOMA 4IG0A 3ULDA 2XRIA 4CF0A 3QESA 4GW6A 1ASWA 3FFIA 4BE0A 2XO7A 1CXUA 1SKRA 1L3TA 1X9SA 1NOZA 3MEEA 3WNHA 3VQ9A 3TR8A 4G1QA 3OYAA 4DQPA 2HHQA 3HXMA 3RMAA 1U04A 3KJVA 4KHWA 2WONA 2Z1IA 1LAWA 1LWCA 3VA0A 1NKEA 1WAFA 3HJFA 1WSEA 1RTHA 1RTIA 1JL2A 3ZT4A 4IBNA 2X78A 3CQ8A 1UA1A 4CJ4A 1Q9XA 4E7HA 3AO3A 1FKPA 4CIGA 3SZ2A 2HHVA 4DU1A 1KLNA 2Z1JA 3AVFA 3SYZA 3V81A 1X9WA 1JXBA 2OPSA 3LANA 4KTWA 3CFRA 4OGCA 3S3OA 4DU3A 2D0BA 3U6FA 3MEGA 1U4BA 3HP6A 2G8WA 4Y1DA 3V4IA 3AVCA 3ZSQA 4R5PA 4O4GA 4RW6A 1CLQA 3OS0A 4KKOA 4Z4IA 1RBSA 1WSGA 1C0MA 1U45A 1KCFA 1UA0A 2G8FA 3S3MA 4B9VA 1RTDA 1BQNA 2XHBA 1MU2A 4H4OA 4EP5A 4M3YA 4FJ8A 1VSHA 1TK8A 1BGXT 3KLFA 5HRNA 4DTNA 5C25A 3SJJA 1L5UA 4J2EA 3ZSWA 3ZSRA 3ZSVA 2PZSA 1C0TA 4UQGA 1VSJA 3HPOA 3OJUA 3M8PA 1NJZA 2Y1JA 2PY5A 3AA4A 2F8SA 1C1AA 3LZIA 1ZBHA 4EP4A 1X9MA 1C1CA 3NE6A 4DSEA 4QOZB 2DFEA 3ZSZA 1FXXA 5E41A 4BDPA 3AO1A 3BGRA 4LSLA 3L2VA 4CFDA 4Z4HA 3DMJA 3OYBA 4LD0A 1VSLA 2IDOA 2IAJA 3V9UA 4B8CA 3K5LA 5HP1A 5C24A 3CFOA 3NDKA 3KKRA 3THVA 1ZBLA 1U47A 1LWFA 1UOCA 1BIZA 3QERA 1I3AA 4LH4A 5EU7A 2G8HA 4CGGA 1S6PA 4IG3A 4KHYA 1VSIA 4W5TA 1Y97A 3DRSA 4CEAA 2XY6A 3RMBA 3V1OA 4NCBA 3VQ8A 3PV8A 5HLFA 1WSJA 3CG7A 2ETJA 1JKHA 1W0HA 1SL2A 3IAYA 2DTUA 3F9KA 1N5YA 3ZT3A 1TKDA 1IKYA 1T03A 3ALYA 3M8RA 4AHSA 3LWLA 4N56A 5FRNA 4ZTFA 1SL1A 4HVJA 4FLWA 4FZXC 1NK6A 1XHXA 3QLHA 4Q5VA 4FJMA 4KB1A 2IS3A 4JLHA 3KK3A 1SV5A 1D9DA 3CM6A 1RDDA 2D0CA 1Q9YA 2HHUA 3HSTB 1DTQA 1JL1A 1KTQA 4I7FA 2YHBA 4Q0BA 2HHWA 1KFSA 4BE2A 5JS1A 3C6TA 3NF9A 4DQIA 3A2FA 4AHVA 1TL1A 3L8BA 4IDKA 3KD5E 1YTAA 3MAQA 2BDPA 2FC0A 4CJVA 2GUIA 3I8DA 2HHSA 4HCCA 3ZT2A 5DMRA 4KO0A 4FJGA 4GVMA 3QNNA 3G0ZA 4DFMA 4O5BA 1S1XA 1HQEA 2VWJA 3AVBA 1C1BA 3OVNA 3VN5A 4CHQA 5FROA 4DQRA 3QEWA 4K8ZA 2PYLA 3M8QA 2DY4A 1TKTA 4HCBA 3IRXA 1S1TA 3K2PA 2RKIA 4N76A 1A5WA 2B6AA 2G8VA 4DSLA 3L3VA 4DSIA 4OJRA 5HRSA 4C8OA 1RNHA 3RR7A 4FJIA 3C6UA 3AA3A 3RRGA 2E4LA 4E0DA 3KLEA 5I3UA 1LV5A 2RN2A 2Q3SA 3T3FA 3DLGA 3L2UA 3AVKA 4FJHA 4N41A 1VSMA 3P5JA 4DF4A 4E7KA 3SQ0A 4CEOA 2QK9A 4CGHA 3VQ7A 3MXIA 3NF8A 5KGWA 4KHQA 5HRPA 2KZZA 2VG7A 2BE2A 3KK2A 2R7YA 4AILC 3DOLA 3OYDA 2X6SA 4DS5A 2DFFA 2OPQA 3LPUA 4CEZA 2X74A 1NJYA 4Z4GA 1WNSA 2B5JA 2O4GA 3DOKA 4FW2A 4O44A 4OVLA 3WNFA 2GV9A 3TAEA 2A1RA 1SKWA 4CEDA 4DU4A 1NK0A 1W9HA 3TAGA 3E01A 1FKOA 3LAKA 4CK1A 4CK3A 1KSPA 1VSEA 2O4IA 2ATQA 4FM0A 5CZ2A 3NF7A 4OPKA 4JS4A 1TAUA 4O55A 5T7BA 3LWMA 2KW4A 1BCOA 3TWHA 3QIOA 4M3WA 4CERA 3WNEA 2YNGA 3OYKA 1S1VA 3C95A 4CGIA 4ELVA 4FJXA 3AA2A 1RCHA 2BGGA 4JS5A 1TK0A 4JRPA 1RT5A 1C0UA 1KVAA 4FJNA 3TABA 1RT4A 3JYTA 1U49A 4CFAA 4I9LA 1HMVA 2LSNA 5KGXA 3KIOA 3LP1A 1B9FA 1X1PA 1HYZA 1T8EA 1KLMA 1IKXA 3VQ6A 4FK0A 1KVBA 2HHXA 3TAMA 1NJWA 4E1MA 3AVJA 2OA8A 4ZTJA 5D3GA 2EX3A 4CJ3A 4CEBA 2XY7A 1KRPA 3QIPA 3ZT1A 2RF2A 4CJWA 3OYFA 1JLBA 1KVCA 1LW2A 3L2WA 3V9XA 3SUOA 1TGOA 3AO4A 3DRRA 2FBTA 3K5OA 1XHZA 4W5NA 3HVTA 3HT3A 4CJRA 3VQ4A 4KREA 4KTZA 4CJKA 1RDCA 2Z1GA 2IOCA 4TSXA 4CCHA 4C8NA 3NGIA 4B08A 4DLEA 1B92A 1RBUA 4DTSA 1S6QA 3OY9A 2HHTA 1K6YA 1D9FA 1ASUA 3SPZA 4E3SA 3DLBA 2YNHA 1XC9A 4W5RA 3JSMA 4GMJB 3SNNA 4J2DA 4CJQA 1EETA 3AVMA 2I5JA 2FBVA 4CHYA 3HVRA 4FLZA 4DS4A 4B9MA 2ZE2A 4PQUA 4B9TA 4F2RA 4FLTA 4CHOA 1WSIA 1UWBA 2DFHA 1CZ9A 3DLKA 3DYAA 3LAMA 4DTRA 2VWKA 1R0AA 4J2AA 4E7IA 4CGJA 2Y1IA 3TAFA 4KFBA 1JLEA 3K5MA 1BQMA 3PX0A 1S5JA 2D5RA 3AV9A 3L2QA 1QSSA 1HNIA 3K5NA 2YKMA 3S9HA 3VQPA 4CGFA 4DG1A 4W5QA 3OYNA 3OYGA 4FJLA 3HPGA 3SI6A 4FYDA 1B9DA 1IG9A 1DTTA 1VSKA 3NHGA 5KTQA 4KV8A 1JLGA 3O3HA 4FZZA 1SKSA 4DFPA 4CHNA 4Z4EA 2ZQBA 4AHUA 3VQ5A 1L3SA 1RT7A 3V6DA 2XY5A 4HUEA 4KHUA 3RR8A 1Z26A 4O0IA 3AA5X 4BDYA 3QETA 4RW9A 3D45A 3VQQA 3TAPA 4AHTA 1D8YA 2OZMA 1S9EA 2OPRA 1IO2A 4YFUA 5I42A 3LP0A 4C8LA 4CIFA 4QCLA 3LP3A 4BWMA 2HB5A 3K59A 5SZTA 4DSJA 1C6VA 1A5VA 3IS9A 3NAEA 3HK2A 2XY8A 4IFVA 4W5OA 4ID5A 4KAZA 1ZBIA 1TL3A 2YNFA 4M3UA 5CYMA 1LW0A 4ID1A 4DMNA 1G15A 1KFDA 3QO9A 4FLVA 1VK0A 4OGEA 2IC3A 4CHPA 2VG5A 3NH1A 3V9SA 1O1WA 2E6LA 4CEEA 1YT3A 3VQEA 3VA3A 4DTPA 3LDSA 4KRFA 4OLBA 4FJJA 4KTQA 1IH7A 3PO5A 1T05A 4M3ZA 4AH9A 4N5SA 2ZD1A 4KHNA 1HNVA 4WE1A 4FLUA 1YVUA 4RG8A 4CEQA 4CJSA 3SUNA 4KB0A 1QSLA 1BI4A 3VQBA 2OYQA 4F3TA 4PY5A 3V1QA 1U48A 3I0SA 4DLGA 3LZJA 3OJSA 3DM2A 3EY1A 1NKCA 4FK2A 5FRMA 2QKBA 2HNDA 4DSFA 3TI0A 2YV0X 1J9AA 1F21A 4KI4A 2HW3A 3QNOA 4BWJA 2KQ2A 3OYHA 4HHTA 3DLRA 3V9ZA 4E7LA 2G8KA 4DWIA 4FJKA 3K58A 1TV6A 3NGZA 3F73A 4CF9A 3KLIA 3RTVA 3DI6A 3QEPA 4B9UA 4Y1CA 3ITHA 4J2BA 1QQCA 4OKEA 2G8UA 1RBTA 3DRPA 3EZ5A 1LAVA 1L3VA 3RRHA 3WNGA 2P51A 3SQ1A 1NK5A 4PUOA 3NF6A 3HM9A 3SUPA 3KK1A 1RT3A 4OLAA 5KI6A 4CJFA 3AVAA 4DQQA 2P1JA 4CF1A 4M3XA 4CK2A 1EP4A 4AHRA 4OKJA 4RW8A 1D5AA 5CY4A 3BDPA 3NCIA 2OPPA 4M42A 1REVA 3AO5A 2KTQA 4DQSA 3PX6A 1RDAA 1HRHA 3AO2A 3KLGA 2HNZA 3ZCMA 1NOYA 2F8TA 1DLOA 1BCMA 3CFPA 3AVLA 3ASMA 4M3RA 2FBYA 5J2QA 4HUFA 1GOAA 2Z1HA 2JLEA 1SUQA 4PA1A 1NK7A 2P5OA 4EZ6A 3OYIA 1CXQA 3D0PA 4MFBA 1TAQA 3O3FA 1ZYQA 1QHTA 4H8KA 3VQAA 3P83D 4CJTA 4E19A 5KRTA 4O0JA 4FJ5A 4L8RB 3ZSXA 1S1WA 1L3UA 1WSFA 1VRTA 4CJLA 3VQDA 4E1NA 3L2RA 1NK8A 4FK4A 2D0AA 1S1UA 3HL8A 2KZMA 5HBMA 3HP9A 3PUFA 4I2PA 4IFYA 3K57A 2NUBA 4F8RA 4I2QA 2VG6A 1JLCA 4CF8A 1TK5A 3NH2A 2HVHA 3OYJA 3SV3A 1SL0A 1JLAA 3B6OA 1LWEA 2E6MA 3MXMA 2AJQA 3CYMA 3HYFA 1RBRA 4CECA 1CZBA 1WN7A 3ISNC 1XWLA 4RW7A 3DLHA 4B3OA 2QKKA 1I39A 4DFJA 5KRSA 4CF2A 3QEXA 1QS4A 1IKWA 1YTUA 1BHLA 3QINA 3H08A 5C42A 4FJ9A 3HO1A 4YNQA 1S9GA 3O4QA 1BI4B 4F3OA 5CZ1A 4JRQA 3RWUA 2HMIA 3AVNA 1EKEA 3VQCA 3ZT0A 1ZBUA 1HYSA 4FZYA 1HQUA 3QEVA 3T19A 1QE1A 1VRUA 2HVIA 2RPIA 3LPTA 4FW1A 3NBPA 4LY7A 3PX4A 4XIUA 4HTUA 3TANA 1BIUA 3LALA 2JGUA 4DTXA 1ITGA 5J2PA 4DTOA 4KI6A 2PYJA 1UAXA 4FJ7A 4NCGA 1VSFA 4CJ5A 2ITGA 3NGYA 3EYZA 1RDBA 4NYFA 4ZHRA 4KHSA 5HRRA 1HPZA 4B8AB 4DSKA 4Z4FA 3SCXA 3G10A 4QAGA 4B9LA 4PWDA 2KFNA 2YKNA 4B9SA 5K14A 4FXDA 4CHZA 4RW4A 4F4KA 2KFZA 3UIQA 1ASVA 4I9QA 1WSHA 4E89A 2FBXA 3AVGA 3OYEA 1VSDA 3TARA 1NK4A 1NK9A 1JLQA 5CYQA 4N47A 1NJXA 2P5GA 4CFCA 1T7PA 4ELUA 3ZSOA 4DTJA 1J54A 1GOCA 3SV4A 4BACA 3KD1E 4ELTA 3NH0A 1JXEA 4FM2A 3MECA 1A5XA 1TVRA 3CM5A 4Z0UA 4CJUA 1IKVA 1JLFA 4H4MA 1HJRA 4NCAA 3QEIA 4CFBA 3B6PA 1J5OA 1RTJA 5FDLA 4LH5A 3C94A 3KTQA 3L3UA 3SQ2A 4IKFA 3PY8A 2YHAA 1TKXA 3OYCA 1Q8IA 3U3GA 2A1SA 3RMDA 4BDZA 2B4JA 3NFAA 2F96A 3ZSYA 4AHCA 1QTMA 1RT2A 4BE1A 4ICLA 3OYMA 4FLXA 4NYNA 4DF8A 3OYLA 1TKZA 1WLJA 3MEDA 3S3NA 3O4NA 3PO4A 2OZSA 1HYVA 4CGDA 3TAQA 4M45A 3P1GA 3MXJA 3KLHA 3SUQA 4CEFA 4DTMA 4MQ3A 2YNIA 1Z25A 3AVHA 3OS1A 5J2NA 4F2SA 3V1RA 2W42A 4K8XA 5SWMA 1N6QA 4C8KA 3T1AA 1FK9A 4FVMA 5DK5A 1BISA 2EHGA 1BL3A 4CJPA 4FCYA 4FM1A 3SPYA 1RT1A 3SQ4A 4B9NA 1EXQA 3KKSA 4OKKA 1GOBA 1RBVA 2X6NA 3O3GA 5HROA 4M3TA 2G8IA 2QXFA 1EX4A 1ZBFA 5J1EA 1J53A 4CJEA 3DLEA 4CESA 3IG1A 3OS2A 4Z4CA 4FLYA 4DFKA 4HUGA 4KPYA 4CE9A 3M8SA 2BANA 3AVIA 4C8MA 1RILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZ9 A;  4DTU A;  5J2M A;  3LP2 A;  3RMC A;  1QSY A;  1NKB A;  1RT6 A;  5JS2 A;  1WAJ A;  4M41 A;  3HPH A;  2IGI A;  3U3Y A;  2HNY A;  4CIE A;  2GBZ A;  4LSN A;  4OPJ A;  3I0R A;  4E7J A;  3V9W A;  1XI1 A;  2WOM A;  4IG0 A;  3ULD A;  2XRI A;  4CF0 A;  3QES A;  4GW6 A;  1ASW A;  3FFI A;  4BE0 A;  2XO7 A;  1CXU A;  1SKR A;  1L3T A;  1X9S A;  1NOZ A;  3MEE A;  3WNH A;  3VQ9 A;  3TR8 A;  4G1Q A;  3OYA A;  4DQP A;  2HHQ A;  3HXM A;  3RMA A;  1U04 A;  3KJV A;  4KHW A;  2WON A;  2Z1I A;  1LAW A;  1LWC A;  3VA0 A;  1NKE A;  1WAF A;  3HJF A;  1WSE A;  1RTH A;  1RTI A;  1JL2 A;  3ZT4 A;  4IBN A;  2X78 A;  3CQ8 A;  1UA1 A;  4CJ4 A;  1Q9X A;  4E7H A;  3AO3 A;  1FKP A;  4CIG A;  3SZ2 A;  2HHV A;  4DU1 A;  1KLN A;  2Z1J A;  3AVF A;  3SYZ A;  3V81 A;  1X9W A;  1JXB A;  2OPS A;  3LAN A;  4KTW A;  3CFR A;  4OGC A;  3S3O A;  4DU3 A;  2D0B A;  3U6F A;  3MEG A;  1U4B A;  3HP6 A;  2G8W A;  4Y1D A;  3V4I A;  3AVC A;  3ZSQ A;  4R5P A;  4O4G A;  4RW6 A;  1CLQ A;  3OS0 A;  4KKO A;  4Z4I A;  1RBS A;  1WSG A;  1C0M A;  1U45 A;  1KCF A;  1UA0 A;  2G8F A;  3S3M A;  4B9V A;  1RTD A;  1BQN A;  2XHB A;  1MU2 A;  4H4O A;  4EP5 A;  4M3Y A;  4FJ8 A;  1VSH A;  1TK8 A;  1BGX T;  3KLF A;  5HRN A;  4DTN A;  5C25 A;  3SJJ A;  1L5U A;  4J2E A;  3ZSW A;  3ZSR A;  3ZSV A;  2PZS A;  1C0T A;  4UQG A;  1VSJ A;  3HPO A;  3OJU A;  3M8P A;  1NJZ A;  2Y1J A;  2PY5 A;  3AA4 A;  2F8S A;  1C1A A;  3LZI A;  1ZBH A;  4EP4 A;  1X9M A;  1C1C A;  3NE6 A;  4DSE A;  4QOZ B;  2DFE A;  3ZSZ A;  1FXX A;  5E41 A;  4BDP A;  3AO1 A;  3BGR A;  4LSL A;  3L2V A;  4CFD A;  4Z4H A;  3DMJ A;  3OYB A;  4LD0 A;  1VSL A;  2IDO A;  2IAJ A;  3V9U A;  4B8C A;  3K5L A;  5HP1 A;  5C24 A;  3CFO A;  3NDK A;  3KKR A;  3THV A;  1ZBL A;  1U47 A;  1LWF A;  1UOC A;  1BIZ A;  3QER A;  1I3A A;  4LH4 A;  5EU7 A;  2G8H A;  4CGG A;  1S6P A;  4IG3 A;  4KHY A;  1VSI A;  4W5T A;  1Y97 A;  3DRS A;  4CEA A;  2XY6 A;  3RMB A;  3V1O A;  4NCB A;  3VQ8 A;  3PV8 A;  5HLF A;  1WSJ A;  3CG7 A;  2ETJ A;  1JKH A;  1W0H A;  1SL2 A;  3IAY A;  2DTU A;  3F9K A;  1N5Y A;  3ZT3 A;  1TKD A;  1IKY A;  1T03 A;  3ALY A;  3M8R A;  4AHS A;  3LWL A;  4N56 A;  5FRN A;  4ZTF A;  1SL1 A;  4HVJ A;  4FLW A;  4FZX C;  1NK6 A;  1XHX A;  3QLH A;  4Q5V A;  4FJM A;  4KB1 A;  2IS3 A;  4JLH A;  3KK3 A;  1SV5 A;  1D9D A;  3CM6 A;  1RDD A;  2D0C A;  1Q9Y A;  2HHU A;  3HST B;  1DTQ A;  1JL1 A;  1KTQ A;  4I7F A;  2YHB A;  4Q0B A;  2HHW A;  1KFS A;  4BE2 A;  5JS1 A;  3C6T A;  3NF9 A;  4DQI A;  3A2F A;  4AHV A;  1TL1 A;  3L8B A;  4IDK A;  3KD5 E;  1YTA A;  3MAQ A;  2BDP A;  2FC0 A;  4CJV A;  2GUI A;  3I8D A;  2HHS A;  4HCC A;  3ZT2 A;  5DMR A;  4KO0 A;  4FJG A;  4GVM A;  3QNN A;  3G0Z A;  4DFM A;  4O5B A;  1S1X A;  1HQE A;  2VWJ A;  3AVB A;  1C1B A;  3OVN A;  3VN5 A;  4CHQ A;  5FRO A;  4DQR A;  3QEW A;  4K8Z A;  2PYL A;  3M8Q A;  2DY4 A;  1TKT A;  4HCB A;  3IRX A;  1S1T A;  3K2P A;  2RKI A;  4N76 A;  1A5W A;  2B6A A;  2G8V A;  4DSL A;  3L3V A;  4DSI A;  4OJR A;  5HRS A;  4C8O A;  1RNH A;  3RR7 A;  4FJI A;  3C6U A;  3AA3 A;  3RRG A;  2E4L A;  4E0D A;  3KLE A;  5I3U A;  1LV5 A;  2RN2 A;  2Q3S A;  3T3F A;  3DLG A;  3L2U A;  3AVK A;  4FJH A;  4N41 A;  1VSM A;  3P5J A;  4DF4 A;  4E7K A;  3SQ0 A;  4CEO A;  2QK9 A;  4CGH A;  3VQ7 A;  3MXI A;  3NF8 A;  5KGW A;  4KHQ A;  5HRP A;  2KZZ A;  2VG7 A;  2BE2 A;  3KK2 A;  2R7Y A;  4AIL C;  3DOL A;  3OYD A;  2X6S A;  4DS5 A;  2DFF A;  2OPQ A;  3LPU A;  4CEZ A;  2X74 A;  1NJY A;  4Z4G A;  1WNS A;  2B5J A;  2O4G A;  3DOK A;  4FW2 A;  4O44 A;  4OVL A;  3WNF A;  2GV9 A;  3TAE A;  2A1R A;  1SKW A;  4CED A;  4DU4 A;  1NK0 A;  1W9H A;  3TAG A;  3E01 A;  1FKO A;  3LAK A;  4CK1 A;  4CK3 A;  1KSP A;  1VSE A;  2O4I A;  2ATQ A;  4FM0 A;  5CZ2 A;  3NF7 A;  4OPK A;  4JS4 A;  1TAU A;  4O55 A;  5T7B A;  3LWM A;  2KW4 A;  1BCO A;  3TWH A;  3QIO A;  4M3W A;  4CER A;  3WNE A;  2YNG A;  3OYK A;  1S1V A;  3C95 A;  4CGI A;  4ELV A;  4FJX A;  3AA2 A;  1RCH A;  2BGG A;  4JS5 A;  1TK0 A;  4JRP A;  1RT5 A;  1C0U A;  1KVA A;  4FJN A;  3TAB A;  1RT4 A;  3JYT A;  1U49 A;  4CFA A;  4I9L A;  1HMV A;  2LSN A;  5KGX A;  3KIO A;  3LP1 A;  1B9F A;  1X1P A;  1HYZ A;  1T8E A;  1KLM A;  1IKX A;  3VQ6 A;  4FK0 A;  1KVB A;  2HHX A;  3TAM A;  1NJW A;  4E1M A;  3AVJ A;  2OA8 A;  4ZTJ A;  5D3G A;  2EX3 A;  4CJ3 A;  4CEB A;  2XY7 A;  1KRP A;  3QIP A;  3ZT1 A;  2RF2 A;  4CJW A;  3OYF A;  1JLB A;  1KVC A;  1LW2 A;  3L2W A;  3V9X A;  3SUO A;  1TGO A;  3AO4 A;  3DRR A;  2FBT A;  3K5O A;  1XHZ A;  4W5N A;  3HVT A;  3HT3 A;  4CJR A;  3VQ4 A;  4KRE A;  4KTZ A;  4CJK A;  1RDC A;  2Z1G A;  2IOC A;  4TSX A;  4CCH A;  4C8N A;  3NGI A;  4B08 A;  4DLE A;  1B92 A;  1RBU A;  4DTS A;  1S6Q A;  3OY9 A;  2HHT A;  1K6Y A;  1D9F A;  1ASU A;  3SPZ A;  4E3S A;  3DLB A;  2YNH A;  1XC9 A;  4W5R A;  3JSM A;  4GMJ B;  3SNN A;  4J2D A;  4CJQ A;  1EET A;  3AVM A;  2I5J A;  2FBV A;  4CHY A;  3HVR A;  4FLZ A;  4DS4 A;  4B9M A;  2ZE2 A;  4PQU A;  4B9T A;  4F2R A;  4FLT A;  4CHO A;  1WSI A;  1UWB A;  2DFH A;  1CZ9 A;  3DLK A;  3DYA A;  3LAM A;  4DTR A;  2VWK A;  1R0A A;  4J2A A;  4E7I A;  4CGJ A;  2Y1I A;  3TAF A;  4KFB A;  1JLE A;  3K5M A;  1BQM A;  3PX0 A;  1S5J A;  2D5R A;  3AV9 A;  3L2Q A;  1QSS A;  1HNI A;  3K5N A;  2YKM A;  3S9H A;  3VQP A;  4CGF A;  4DG1 A;  4W5Q A;  3OYN A;  3OYG A;  4FJL A;  3HPG A;  3SI6 A;  4FYD A;  1B9D A;  1IG9 A;  1DTT A;  1VSK A;  3NHG A;  5KTQ A;  4KV8 A;  1JLG A;  3O3H A;  4FZZ A;  1SKS A;  4DFP A;  4CHN A;  4Z4E A;  2ZQB A;  4AHU A;  3VQ5 A;  1L3S A;  1RT7 A;  3V6D A;  2XY5 A;  4HUE A;  4KHU A;  3RR8 A;  1Z26 A;  4O0I A;  3AA5 X;  4BDY A;  3QET A;  4RW9 A;  3D45 A;  3VQQ A;  3TAP A;  4AHT A;  1D8Y A;  2OZM A;  1S9E A;  2OPR A;  1IO2 A;  4YFU A;  5I42 A;  3LP0 A;  4C8L A;  4CIF A;  4QCL A;  3LP3 A;  4BWM A;  2HB5 A;  3K59 A;  5SZT A;  4DSJ A;  1C6V A;  1A5V A;  3IS9 A;  3NAE A;  3HK2 A;  2XY8 A;  4IFV A;  4W5O A;  4ID5 A;  4KAZ A;  1ZBI A;  1TL3 A;  2YNF A;  4M3U A;  5CYM A;  1LW0 A;  4ID1 A;  4DMN A;  1G15 A;  1KFD A;  3QO9 A;  4FLV A;  1VK0 A;  4OGE A;  2IC3 A;  4CHP A;  2VG5 A;  3NH1 A;  3V9S A;  1O1W A;  2E6L A;  4CEE A;  1YT3 A;  3VQE A;  3VA3 A;  4DTP A;  3LDS A;  4KRF A;  4OLB A;  4FJJ A;  4KTQ A;  1IH7 A;  3PO5 A;  1T05 A;  4M3Z A;  4AH9 A;  4N5S A;  2ZD1 A;  4KHN A;  1HNV A;  4WE1 A;  4FLU A;  1YVU A;  4RG8 A;  4CEQ A;  4CJS A;  3SUN A;  4KB0 A;  1QSL A;  1BI4 A;  3VQB A;  2OYQ A;  4F3T A;  4PY5 A;  3V1Q A;  1U48 A;  3I0S A;  4DLG A;  3LZJ A;  3OJS A;  3DM2 A;  3EY1 A;  1NKC A;  4FK2 A;  5FRM A;  2QKB A;  2HND A;  4DSF A;  3TI0 A;  2YV0 X;  1J9A A;  1F21 A;  4KI4 A;  2HW3 A;  3QNO A;  4BWJ A;  2KQ2 A;  3OYH A;  4HHT A;  3DLR A;  3V9Z A;  4E7L A;  2G8K A;  4DWI A;  4FJK A;  3K58 A;  1TV6 A;  3NGZ A;  3F73 A;  4CF9 A;  3KLI A;  3RTV A;  3DI6 A;  3QEP A;  4B9U A;  4Y1C A;  3ITH A;  4J2B A;  1QQC A;  4OKE A;  2G8U A;  1RBT A;  3DRP A;  3EZ5 A;  1LAV A;  1L3V A;  3RRH A;  3WNG A;  2P51 A;  3SQ1 A;  1NK5 A;  4PUO A;  3NF6 A;  3HM9 A;  3SUP A;  3KK1 A;  1RT3 A;  4OLA A;  5KI6 A;  4CJF A;  3AVA A;  4DQQ A;  2P1J A;  4CF1 A;  4M3X A;  4CK2 A;  1EP4 A;  4AHR A;  4OKJ A;  4RW8 A;  1D5A A;  5CY4 A;  3BDP A;  3NCI A;  2OPP A;  4M42 A;  1REV A;  3AO5 A;  2KTQ A;  4DQS A;  3PX6 A;  1RDA A;  1HRH A;  3AO2 A;  3KLG A;  2HNZ A;  3ZCM A;  1NOY A;  2F8T A;  1DLO A;  1BCM A;  3CFP A;  3AVL A;  3ASM A;  4M3R A;  2FBY A;  5J2Q A;  4HUF A;  1GOA A;  2Z1H A;  2JLE A;  1SUQ A;  4PA1 A;  1NK7 A;  2P5O A;  4EZ6 A;  3OYI A;  1CXQ A;  3D0P A;  4MFB A;  1TAQ A;  3O3F A;  1ZYQ A;  1QHT A;  4H8K A;  3VQA A;  3P83 D;  4CJT A;  4E19 A;  5KRT A;  4O0J A;  4FJ5 A;  4L8R B;  3ZSX A;  1S1W A;  1L3U A;  1WSF A;  1VRT A;  4CJL A;  3VQD A;  4E1N A;  3L2R A;  1NK8 A;  4FK4 A;  2D0A A;  1S1U A;  3HL8 A;  2KZM A;  5HBM A;  3HP9 A;  3PUF A;  4I2P A;  4IFY A;  3K57 A;  2NUB A;  4F8R A;  4I2Q A;  2VG6 A;  1JLC A;  4CF8 A;  1TK5 A;  3NH2 A;  2HVH A;  3OYJ A;  3SV3 A;  1SL0 A;  1JLA A;  3B6O A;  1LWE A;  2E6M A;  3MXM A;  2AJQ A;  3CYM A;  3HYF A;  1RBR A;  4CEC A;  1CZB A;  1WN7 A;  3ISN C;  1XWL A;  4RW7 A;  3DLH A;  4B3O A;  2QKK A;  1I39 A;  4DFJ A;  5KRS A;  4CF2 A;  3QEX A;  1QS4 A;  1IKW A;  1YTU A;  1BHL A;  3QIN A;  3H08 A;  5C42 A;  4FJ9 A;  3HO1 A;  4YNQ A;  1S9G A;  3O4Q A;  1BI4 B;  4F3O A;  5CZ1 A;  4JRQ A;  3RWU A;  2HMI A;  3AVN A;  1EKE A;  3VQC A;  3ZT0 A;  1ZBU A;  1HYS A;  4FZY A;  1HQU A;  3QEV A;  3T19 A;  1QE1 A;  1VRU A;  2HVI A;  2RPI A;  3LPT A;  4FW1 A;  3NBP A;  4LY7 A;  3PX4 A;  4XIU A;  4HTU A;  3TAN A;  1BIU A;  3LAL A;  2JGU A;  4DTX A;  1ITG A;  5J2P A;  4DTO A;  4KI6 A;  2PYJ A;  1UAX A;  4FJ7 A;  4NCG A;  1VSF A;  4CJ5 A;  2ITG A;  3NGY A;  3EYZ A;  1RDB A;  4NYF A;  4ZHR A;  4KHS A;  5HRR A;  1HPZ A;  4B8A B;  4DSK A;  4Z4F A;  3SCX A;  3G10 A;  4QAG A;  4B9L A;  4PWD A;  2KFN A;  2YKN A;  4B9S A;  5K14 A;  4FXD A;  4CHZ A;  4RW4 A;  4F4K A;  2KFZ A;  3UIQ A;  1ASV A;  4I9Q A;  1WSH A;  4E89 A;  2FBX A;  3AVG A;  3OYE A;  1VSD A;  3TAR A;  1NK4 A;  1NK9 A;  1JLQ A;  5CYQ A;  4N47 A;  1NJX A;  2P5G A;  4CFC A;  1T7P A;  4ELU A;  3ZSO A;  4DTJ A;  1J54 A;  1GOC A;  3SV4 A;  4BAC A;  3KD1 E;  4ELT A;  3NH0 A;  1JXE A;  4FM2 A;  3MEC A;  1A5X A;  1TVR A;  3CM5 A;  4Z0U A;  4CJU A;  1IKV A;  1JLF A;  4H4M A;  1HJR A;  4NCA A;  3QEI A;  4CFB A;  3B6P A;  1J5O A;  1RTJ A;  5FDL A;  4LH5 A;  3C94 A;  3KTQ A;  3L3U A;  3SQ2 A;  4IKF A;  3PY8 A;  2YHA A;  1TKX A;  3OYC A;  1Q8I A;  3U3G A;  2A1S A;  3RMD A;  4BDZ A;  2B4J A;  3NFA A;  2F96 A;  3ZSY A;  4AHC A;  1QTM A;  1RT2 A;  4BE1 A;  4ICL A;  3OYM A;  4FLX A;  4NYN A;  4DF8 A;  3OYL A;  1TKZ A;  1WLJ A;  3MED A;  3S3N A;  3O4N A;  3PO4 A;  2OZS A;  1HYV A;  4CGD A;  3TAQ A;  4M45 A;  3P1G A;  3MXJ A;  3KLH A;  3SUQ A;  4CEF A;  4DTM A;  4MQ3 A;  2YNI A;  1Z25 A;  3AVH A;  3OS1 A;  5J2N A;  4F2S A;  3V1R A;  2W42 A;  4K8X A;  5SWM A;  1N6Q A;  4C8K A;  3T1A A;  1FK9 A;  4FVM A;  5DK5 A;  1BIS A;  2EHG A;  1BL3 A;  4CJP A;  4FCY A;  4FM1 A;  3SPY A;  1RT1 A;  3SQ4 A;  4B9N A;  1EXQ A;  3KKS A;  4OKK A;  1GOB A;  1RBV A;  2X6N A;  3O3G A;  5HRO A;  4M3T A;  2G8I A;  2QXF A;  1EX4 A;  1ZBF A;  5J1E A;  1J53 A;  4CJE A;  3DLE A;  4CES A;  3IG1 A;  3OS2 A;  4Z4C A;  4FLY A;  4DFK A;  4HUG A;  4KPY A;  4CE9 A;  3M8S A;  2BAN A;  3AVI A;  4C8M A;  1RIL A; 
#chains in the Genus database with same CATH topology
 4EZ9 A;  3RMC A;  1RT6 A;  1NGG A;  5JS2 A;  2VQF K;  2IGI A;  3VF2 A;  4JKA A;  4LSN A;  3V9W A;  4K41 A;  3ULD A;  3VEY A;  1NGC A;  3QES A;  2KHO A;  4GW6 A;  2QI2 A;  3PIO L;  4JKC A;  4BE0 A;  1L3T A;  3TR8 A;  2AP1 A;  2HHQ A;  2D1K A;  3HOS A;  1NGE A;  3KJV A;  2Z1I A;  4H03 B;  1LAW A;  3VEW A;  5LY3 A;  2DPN A;  5FPD A;  3HJF A;  3ULE A;  2CGK A;  3A5L C;  1RTH A;  1RTI A;  1Q9X A;  2UXD K;  1X3M A;  3WXK A;  1VQP N;  3AO3 A;  1FKP A;  2F9W A;  2HHV A;  4H0T B;  2OPS A;  2FF3 B;  3MEG A;  4NXM K;  3AVC A;  4B1W B;  2P9P A;  5BPM A;  1UA0 A;  3S3M A;  2QWM A;  2XHB A;  4M3Y A;  1VSH A;  4H5W A;  4CZG A;  4DTN A;  4MLH A;  3SJJ A;  1L5U A;  4J2E A;  3OBW A;  5M1O A;  3ZSW A;  1IBK K;  3M8P A;  1NJZ A;  5C15 A;  1ZBH A;  4BRA A;  1TYQ B;  1C1C A;  4DSE A;  2DFE A;  5CE3 A;  1FXX A;  4BDP A;  4CFD A;  1VQL N;  1E4F T;  3O9R A;  1VQ7 N;  1VSL A;  4K42 A;  4IJN A;  3K5L A;  3NDK A;  3CFO A;  1XC3 A;  1WBB A;  1ZBS A;  2G8H A;  4KHY A;  2YI1 A;  1BDG A;  4CEA A;  3V1O A;  3PV8 A;  5HLF A;  3LM2 A;  2ETJ A;  1W0H A;  1SL2 A;  3GOI A;  3IAY A;  1NMD A;  4FWP A;  1SZ2 A;  3ALY A;  4JKE A;  5GAE P;  1G99 A;  4CZF A;  5BR9 A;  1GLJ O;  4FZX C;  3R1X A;  3QLH A;  2IS3 A;  4JLH A;  2OCE A;  1RDD A;  2D0C A;  1Q9Y A;  2HHU A;  3HST B;  2PBD A;  4MO5 A;  3CQY A;  3FR0 A;  4I7F A;  4Q0B A;  3NF9 A;  2WTU A;  3C6A A;  3L8B A;  5GAH P;  2O8B A;  3ZX3 A;  3C7N A;  3I8D A;  3N4Q A;  4B9Q A;  5DMR A;  1Q7Y O;  3G0Z A;  4H5T A;  4BC5 A;  1S1X A;  4DR3 K;  1C1B A;  1RGI A;  3KVG A;  4OPA A;  2NNW A;  3K2P A;  4YHH K;  4N76 A;  2RE2 A;  3HI0 A;  4IO9 L;  3L3V A;  4LFC K;  2YJF A;  4DSI A;  3D7E O;  2V51 B;  2ASM A;  3LM9 A;  4CI6 A;  1LV5 A;  4E7K A;  3VQ7 A;  2KZZ A;  2O8E A;  3JS6 A;  3TU5 A;  4ILG B;  4AIL C;  3DOL A;  3OYD A;  2X6S A;  5LMN K;  4CEZ A;  3BY5 A;  1GLD G;  1NJY A;  2YCH A;  4Z4G A;  4QS8 A;  1WNS A;  3DXK A;  4OVL A;  3TAE A;  1SKW A;  1NK0 A;  5AQQ A;  1FKO A;  3EL2 A;  5AQL A;  5C2F A;  2ATQ A;  4FM0 A;  1TAU A;  4OPK A;  4PKH A;  3LWM A;  2KW4 A;  5AQW A;  3TWH A;  4H0O A;  3QIO A;  4M3W A;  2YNG A;  4CW7 B;  4FJX A;  4HWI A;  1TK0 A;  1HKC A;  1RT5 A;  1C0U A;  4B3M K;  3TAB A;  4I6M A;  5BN9 A;  3ID6 A;  2QXL A;  4I9L A;  1HMV A;  2LSN A;  3CC2 N;  2NLX A;  1X1P A;  3DAW A;  4FK0 A;  2P9N A;  3AAQ A;  3AVJ A;  2EX3 A;  3KWG A;  2QA4 N;  3ZLJ A;  2OTJ N;  2XY7 A;  2D4W A;  4FSV A;  2RF2 A;  1HKG A;  1C0G A;  4U67 L;  1TGO A;  4KBO A;  1XHZ A;  4JI4 K;  4CJR A;  2Z1G A;  5E84 A;  3FZL A;  4JI3 K;  2FSK A;  1D9F A;  2HHT A;  3DLB A;  4XH5 A;  1XC9 A;  3JSM A;  3OW2 M;  4J2D A;  3CPE A;  4DS4 A;  1EET A;  4DQ8 A;  3DXM B;  2PAV A;  2ZE2 A;  3A0I X;  4BR2 A;  4PQU A;  4F2R A;  4WQ4 C;  2VWK A;  4E7I A;  3H45 C;  5AR0 A;  1JLE A;  3PX0 A;  1BQM A;  1S5J A;  3AV9 A;  4BG8 A;  1QSS A;  3K5N A;  3OYN A;  4DG1 A;  3OYG A;  1OH6 A;  3HPG A;  4FYD A;  4AQY K;  2YHX A;  4DR5 K;  4DFP A;  4Z4E A;  2ZQB A;  3VQ5 A;  2XY5 A;  4HUE A;  4KHU A;  3RR8 A;  1EWQ A;  1OVQ A;  4HTL A;  1K8K A;  3TAP A;  4AHT A;  1D8Y A;  2W41 A;  4YFU A;  1IO2 A;  5I42 A;  4BRE A;  5M1F A;  2QTD A;  5AQY A;  3LP3 A;  4BWM A;  3K59 A;  5SZT A;  1C6V A;  5BRH A;  3NAE A;  4M7Y A;  4W5O A;  1T3V A;  1TL3 A;  4DMN A;  1G15 A;  1NG9 A;  3KK7 A;  1IBL K;  4CEE A;  3O9U A;  2QWP A;  3LDS A;  1DKG D;  4OLB A;  4KRF A;  3ZYY X;  4GV3 A;  1IH7 A;  3PO5 A;  4M3Z A;  4B3S K;  2ZD1 A;  4B1V A;  5C10 A;  3MCP A;  3O9T A;  1QSL A;  4V19 S;  3V1Q A;  3G6E N;  2CGL A;  3SBG A;  4DLG A;  1CZA N;  5CR4 A;  3OJS A;  4FK2 A;  3U9D A;  1NBW A;  3VEX A;  1F21 A;  4KI4 A;  5AQP A;  5AQR A;  4LFA K;  3OA9 A;  2KQ2 A;  4FJK A;  2G8K A;  1NGF A;  1TV6 A;  3JXU A;  2F7T A;  4CF9 A;  4B9U A;  4IWV A;  3I8B A;  2G8U A;  2Q0R A;  4WFN L;  1RBT A;  5AZI B;  5AQZ A;  4IOA L;  2HHH K;  3NF6 A;  5BPL A;  3HM9 A;  2ZGY A;  4JYA K;  4CJF A;  3AVA A;  2P9U A;  5F2R A;  4M3X A;  1EP4 A;  3DLL L;  4RW8 A;  3WQU A;  3VF4 A;  1D5A A;  5CY4 A;  1I94 K;  3BDP A;  2O8C A;  1REV A;  3MN5 A;  4FL9 A;  4XH4 A;  4U7B A;  3PX6 A;  2KTQ A;  3AO2 A;  2HNZ A;  1NOY A;  4BRD A;  2FBY A;  5J2Q A;  1GOA A;  2JLE A;  1NK7 A;  1CXQ A;  1T6C A;  1TAQ A;  5JLF A;  1QHT A;  4E19 A;  1HNX K;  4H5R A;  3PLA A;  3VQD A;  1S1U A;  3HL8 A;  1QZ6 A;  5HBM A;  4JHD A;  5LMU K;  3K57 A;  4YOY A;  1JLC A;  4K43 A;  3OYJ A;  2HVH A;  5EY4 A;  3WT0 A;  4FWS A;  3CYM A;  3HYF A;  3ISN C;  1XWL A;  3ZET A;  4H0V B;  1KAY A;  1QS4 A;  1BHL A;  4EFH A;  3H08 A;  3VET A;  4F3O A;  2PFU A;  2HMI A;  1EKE A;  3O6W A;  2ZJR L;  5TKY A;  4ISG A;  4GKJ K;  3NBP A;  3LDL A;  3NVK A;  3LAL A;  4DTX A;  1ITG A;  1HPM A;  5HL7 L;  4FOI A;  5AFU A;  2PYJ A;  4IJA A;  4FJ7 A;  3FZH A;  4NCG A;  5EOY A;  2ITG A;  2P9S B;  3WEE A;  1RDB A;  4NYF A;  5HRR A;  1HPZ A;  4B8A B;  2KFN A;  3UIQ A;  4I9Q A;  4E89 A;  3OYE A;  1N33 K;  3TPQ A;  4BY9 C;  1NJX A;  2P5G A;  1T7P A;  3F5T A;  1T6D A;  1GLB G;  1EQY A;  4LF8 K;  3KD1 E;  4FM2 A;  4DV3 K;  1IKV A;  4JI2 K;  3UKR B;  3QEI A;  4CFB A;  3NMU A;  1YJW N;  3U3G A;  4YY3 K;  3THY B;  1Z6R A;  5AZJ B;  4AHC A;  1QTM A;  3C65 A;  3WXM B;  1RT2 A;  3IKM A;  4ICL A;  4Z94 A;  4FLX A;  5B8H A;  4JV5 K;  4DF8 A;  1RDW X;  2OZS A;  1HYV A;  3FLC O;  4PL8 A;  4CEF A;  4K8X A;  2W42 A;  1GLA G;  4BQL A;  1BIS A;  2EHG A;  4CJP A;  4A59 A;  3CCQ N;  1GOB A;  4QOZ B;  5HRO A;  4GV9 A;  2HOE A;  1BWF O;  4A5B A;  1VHX A;  2BAN A;  3IDH A;  3THW B;  1NKB A;  3CCE N;  1WAJ A;  4M41 A;  3HPH A;  4CIE A;  4E7J A;  2WOM A;  2XRI A;  4CF0 A;  3W3D A;  1ASW A;  2HMP A;  3FFI A;  4A5A A;  3OHR A;  1E4G T;  3OYA A;  4DQP A;  3RMA A;  1O13 A;  5IWA K;  3SBT A;  2WON A;  3VGK A;  4MLE A;  5AQU A;  1VQ5 N;  3MDQ A;  4B3R K;  1NKE A;  4QS7 A;  4BR7 A;  3CQ8 A;  1UA1 A;  4CJ4 A;  2IIR A;  2H3G X;  4DU1 A;  3SYZ A;  3V81 A;  1JXB A;  4KTW A;  1U4B A;  4OGC A;  3S3O A;  4DU3 A;  3U6F A;  3AGK A;  3HP6 A;  4Y1D A;  3V4I A;  4R5P A;  4OO1 J;  4O4G A;  4YDU A;  1KCF A;  4PKG A;  5ADX H;  1BQN A;  4MDB A;  5HRN A;  3M6G A;  2GWK A;  2PZS A;  3QDK A;  1C0T A;  2YHY A;  4CZH A;  4CZE A;  1C1A A;  3LZI A;  5E41 A;  2P9I B;  3AO1 A;  4LSL A;  3L2V A;  3SAH A;  3DMJ A;  1ESV A;  2E2O A;  1GLC G;  2IDO A;  4BRK A;  2NRZ A;  3V9U A;  3THX B;  1ZBL A;  3KKR A;  1U47 A;  1W97 L;  4Y0W A;  1LWF A;  2ZF5 O;  1I3A A;  3PSF A;  4BC2 A;  2IVO A;  4JD2 B;  2O8D B;  2HF3 A;  3CF5 L;  1VSI A;  2XY6 A;  4NCB A;  3VES A;  5BPN A;  3BZC A;  2DTU A;  3QFP A;  4ILJ A;  2J4R A;  2E20 A;  3R3L A;  3LWL A;  4YOX A;  3VTH A;  1SL1 A;  1NK6 A;  1XHX A;  3CME N;  1D9D A;  1NGH A;  4DV1 K;  1BOT O;  1JL1 A;  2YHB A;  4DQI A;  4AHV A;  1TL1 A;  4B1X B;  3L0Q A;  1MWK A;  2E2Q A;  3MAQ A;  4CD1 A;  5LJV A;  2GUI A;  3VTI A;  4HCC A;  1VAZ A;  4FJG A;  4GVM A;  1HLU A;  1HQE A;  2VWJ A;  3AVB A;  3OVN A;  5GIN A;  3H1Q A;  2RKI A;  4DSL A;  3KZB A;  3O5B A;  4OJR A;  3DXM A;  3RRG A;  3TSU A;  3P5J A;  3SQ0 A;  2QK9 A;  1VQ4 N;  2F4V K;  4DS5 A;  2DFF A;  2OPQ A;  3D2F B;  2X74 A;  2CGJ A;  5AQF A;  2B5J A;  4FW2 A;  5BN8 A;  3UKU B;  4WFB L;  4GVE A;  3VEZ A;  4CK3 A;  1KSP A;  2O4I A;  3C6H A;  5CZ2 A;  3NF7 A;  2HBM A;  3OTO K;  3MN7 A;  3WNE A;  3OYK A;  1RCH A;  5EX5 A;  4JS5 A;  4JRP A;  1KVA A;  3CJA A;  2NRT A;  5AQN A;  1U49 A;  3CCL N;  3KIO A;  1T8E A;  1B9F A;  1KLM A;  1IKX A;  5FPM A;  3VQ6 A;  1KVB A;  1N8R O;  3TAM A;  2E5L K;  4E1M A;  2VCP A;  4FWL A;  1Z05 A;  4CEB A;  1N36 K;  3QIP A;  3OYF A;  4CD3 A;  3L2W A;  5LJW A;  4LF4 K;  3DRR A;  3GBT A;  5EVZ A;  4B08 A;  1XNQ K;  2QWQ A;  3H3N O;  1N34 K;  3LL3 A;  2WBN A;  3I56 N;  2P9L B;  3HVR A;  2I5J A;  5GAG P;  4CHY A;  4B9M A;  4WYB A;  3MK6 A;  3QIC A;  4B9T A;  1IG8 A;  3HK2 A;  3DLK A;  1N6Q A;  1CZ9 A;  4CGJ A;  2Y1I A;  3TAF A;  4KFB A;  3K5M A;  2WUS A;  1Q81 O;  1HNI A;  4IXC A;  4FJL A;  4XH1 A;  1B9D A;  1HUX A;  2RHK A;  3O3H A;  4FZZ A;  2ZJQ L;  1L3S A;  1RT7 A;  4H0X B;  4DR1 K;  3V6D A;  3G25 A;  1OH8 A;  2A40 A;  1JCE A;  1Z26 A;  3A8Y A;  4O0I A;  4RW9 A;  3VQQ A;  2YX6 A;  4DV5 K;  3LP0 A;  3BEX A;  2WFB A;  4CIF A;  4QCL A;  1OH5 A;  1A5V A;  4IFV A;  1U2V B;  4LFB K;  2YNF A;  1LW0 A;  4DV0 K;  3P38 A;  4PKI A;  4OGE A;  3NH1 A;  2VG5 A;  3V9S A;  4FPA A;  4EIA A;  1XUP O;  3VA3 A;  4DTP A;  1X9J A;  3I33 A;  4CBW A;  4KTQ A;  3U8X A;  1T05 A;  4AH9 A;  4KHN A;  4AF1 A;  1JJ2 M;  4FLU A;  1DGK N;  1YIT N;  1NGI A;  5AQH A;  2OYQ A;  1KD1 O;  3D2E A;  1U48 A;  2ASO A;  3DM2 A;  3HM8 A;  4NB4 A;  2FF6 A;  5FRM A;  1J9A A;  3GL1 A;  3QNO A;  4BWJ A;  1S3X A;  3W0L A;  4UY8 O;  3OYH A;  4BVO A;  4A62 A;  4HHT A;  4E7L A;  3DJC A;  4QS9 A;  1VQ9 N;  3F73 A;  3NGZ A;  3RTV A;  3KLI A;  4J2B A;  3T1Y K;  4BC3 A;  1NWK A;  3ITH A;  5JVH L;  3ATV A;  1LAV A;  3RRH A;  3WNG A;  2A41 A;  5JMV A;  3M5R A;  3SUP A;  3L4Q A;  5KI6 A;  3LDN A;  5KQD A;  4DQQ A;  3RSE A;  4AM7 A;  2P1J A;  2UU9 K;  1E3M A;  4CK2 A;  4AHR A;  2Q36 A;  3K0S A;  3MX5 A;  1DLO A;  5BRF A;  2Z1H A;  4EHU A;  1SUQ A;  3Q7B A;  3EO3 A;  4YOT A;  3THY A;  4BGA A;  5HOO A;  1ZYQ A;  5AZJ A;  3P83 D;  4CJT A;  3LDQ A;  4L8R B;  4E1N A;  4FK4 A;  3ID8 A;  4I2P A;  4IFY A;  2NUB A;  4CF8 A;  4X65 K;  1OKJ A;  3NH2 A;  4DR7 K;  3TTD A;  1JLA A;  3B6O A;  2AJQ A;  3TSQ A;  1RBR A;  2BH1 A;  1WN7 A;  3E1Y A;  4IDH A;  3BUZ B;  4DFJ A;  5KRS A;  1VQN N;  1NGD A;  4JKH A;  3B8A X;  4DB3 A;  3HO1 A;  5AQI A;  1S9G A;  3O4Q A;  4JRQ A;  3RWU A;  3ZT0 A;  1ZBU A;  4F9O A;  4FZY A;  3EEQ A;  1QE1 A;  1VRU A;  4BGB A;  3P4I A;  2A3Z A;  4FW1 A;  3O1W A;  3T1H K;  1R59 O;  1UAX A;  4CJ5 A;  4LC9 B;  2FLO A;  3CIP A;  3G10 A;  5AQX A;  2YKN A;  1ZC6 A;  4FWN A;  1LOT B;  5DM6 L;  1ASV A;  1WSH A;  2FBX A;  4BRI A;  1NK4 A;  1NK9 A;  4JI7 K;  5CYQ A;  4N47 A;  1NU0 A;  4CFC A;  5GIO A;  3FGU A;  3LDP A;  1J5E K;  3NH0 A;  1TVR A;  2CH6 A;  3H1V X;  4NCA A;  2VYP A;  1S22 A;  1RTJ A;  3KTQ A;  3L3U A;  3ENH A;  4IKF A;  1VQ8 N;  2UXC K;  2YHA A;  2GUP A;  3WQT A;  3E9O A;  3ZSY A;  1RFQ A;  3OYM A;  4NYN A;  1V4S A;  1TKZ A;  3OYL A;  1KXP A;  3O4N A;  4M45 A;  3VER A;  3QBW A;  3MN6 A;  5J2N A;  1Z25 A;  4F2S A;  1HYS A;  2P9I A;  3V1R A;  5SWM A;  1FK9 A;  4FVM A;  4FCY A;  1BL3 A;  3MMV A;  4FWQ A;  3SPY A;  5JVG L;  2V7Y A;  1EXQ A;  1KAX A;  4OKK A;  1RBV A;  2JWK A;  3O3G A;  3THX A;  2QXF A;  1EX4 A;  1NMN A;  3OS2 A;  4Z4C A;  3G4S N;  4DFK A;  4HUG A;  2V7Z A;  3MX2 A;  2O8D A;  4CE9 A;  4O5F A;  4ILH A;  3QET A;  5J2M A;  3LP2 A;  2QWO A;  3O1B A;  4O8K A;  2HNY A;  4OPJ A;  2GBZ A;  1FJG K;  3I0R A;  1KAZ A;  4IG0 A;  3SK3 A;  1VQK N;  3CCS N;  2XO7 A;  1SKR A;  1X9S A;  3S41 A;  4G1Q A;  5AQT A;  1HX1 A;  1U04 A;  4KHW A;  2GEL A;  2ZGZ A;  1JL2 A;  3ZT4 A;  4E7H A;  3SZ2 A;  1KLN A;  4JI5 K;  1X9W A;  3A5M C;  3CC7 N;  4RW6 A;  3OS0 A;  4DR4 K;  1C0M A;  1HNW K;  2G8F A;  2ZJP L;  1MU2 A;  4EP5 A;  3VMF B;  1BGX T;  3KLF A;  3HPO A;  3OJU A;  3HRG A;  2Y1J A;  1NJI O;  2A5X A;  1Q82 O;  4EP4 A;  3C7N B;  3BGR A;  1XMO K;  5M1Q A;  1T44 A;  3OYB A;  3A5O C;  4LD0 A;  3BF3 A;  3P39 A;  2IAJ A;  3K9K A;  2D0O A;  3PSI A;  4X64 K;  1UOC A;  3QER A;  1DEJ A;  3UKU A;  3H6E A;  4CGG A;  1S6P A;  1Y97 A;  3DRS A;  4DV7 K;  3AAP A;  2QWR A;  1GLL O;  1TUY A;  3VPZ A;  3KWI A;  1JKH A;  1N5Y A;  3ZT3 A;  4E1J A;  1QVG M;  3M8R A;  4AHS A;  4N56 A;  3WXI A;  1N32 K;  4HVJ A;  1QQN A;  4RCH A;  4JEP A;  4KB1 A;  2NZT A;  2V52 B;  3O9S A;  1NNE A;  2IVP A;  4BRL A;  1KTQ A;  2GTD A;  2HHW A;  4BE2 A;  4M63 C;  5JS1 A;  3C6T A;  4IOC L;  2OTL N;  5C0Y A;  1YTA A;  1VQO N;  3N4P A;  4WQ5 A;  1TYQ A;  2BDP A;  3NVM A;  2UYT A;  2ZWH A;  2FC0 A;  4CJV A;  4DV6 K;  4BRQ A;  2HHS A;  1YJN N;  4DFM A;  2F9T A;  4I6M B;  5M1K A;  3VN5 A;  3QEW A;  4K8Z A;  2HF4 A;  4IZ9 A;  4A57 A;  5KPT A;  1A5W A;  2B6A A;  2P9N B;  4FJI A;  3C6U A;  1HJO A;  1YUW A;  3AA3 A;  5IT9 O;  2E4L A;  4E0D A;  3KLE A;  5FPE A;  1M1K O;  1S72 N;  2RN2 A;  2Q3S A;  3L2U A;  1VSM A;  2BTF A;  4DF4 A;  2NRX A;  3CC4 N;  1BA0 A;  3MXI A;  3M1F A;  5HRP A;  5ADX A;  2VG7 A;  3KK2 A;  1EWR A;  3LPU A;  2I7P A;  3ATU A;  2O4G A;  3DOK A;  3SAF A;  5GIP A;  2GV9 A;  3J7A P;  4CED A;  2Q0U A;  3CJC A;  4DU4 A;  3TAG A;  2YJE A;  3E01 A;  3E9L A;  3LAK A;  3EKS A;  1VSE A;  2P9K B;  2E2N A;  4JS4 A;  4O55 A;  3UE5 A;  5T7B A;  1BCO A;  4NXN K;  4JKB A;  2GWJ A;  4BR9 A;  1U2V A;  1S1V A;  3C95 A;  5AQO A;  1ILY A;  3AA2 A;  3HSC A;  3F9M A;  1RT4 A;  3RVC A;  1WB9 A;  3CXC M;  1K73 O;  3WUH A;  3MN9 A;  4YOV A;  4BRN A;  2HHX A;  3ZX2 A;  1IBM K;  4IEE A;  2W6L A;  4ZTJ A;  5D3G A;  4YDU C;  3O9Q A;  3R6M A;  3KHY A;  4CJW A;  3V9X A;  1IJJ A;  4CZM A;  3AO4 A;  4W5N A;  4O8U A;  3HVT A;  4G9Z A;  3VQ4 A;  4DR2 K;  4KTZ A;  4CZK A;  2IOC A;  4CCH A;  4C8N A;  3NGI A;  3CCM N;  2KKZ A;  4DLE A;  1RBU A;  1SS6 A;  4YOR A;  3OY9 A;  4DTS A;  1K6Y A;  3SPZ A;  2YNH A;  4W5R A;  3SNN A;  4GMJ B;  4CJQ A;  4FLZ A;  5AJ3 K;  3EE9 A;  3JAM O;  3CET A;  4FLT A;  2Q2R A;  1WSI A;  4CHO A;  1R0A A;  3DYA A;  3LAM A;  4J2A A;  4BRH A;  4BRC A;  2D5R A;  3D6R A;  3HTV A;  3S9H A;  2YKM A;  4W5Q A;  4CGF A;  5H1S Q;  1RDU A;  1DTT A;  3NHG A;  5KTQ A;  1JLG A;  5E26 A;  4CHN A;  4FPB A;  4RWT A;  3J7Z O;  4ISE A;  2NRV A;  1MWM A;  4JNE A;  2OZM A;  1YI2 N;  2OPR A;  2P9U B;  3OBY A;  4YOW A;  4NLC A;  2XY8 A;  4KAZ A;  1ZBI A;  4M3U A;  3H3O B;  5CYM A;  2EWS A;  2UXB K;  1KFD A;  3QO9 A;  4FLV A;  1VK0 A;  2IC3 A;  4CHP A;  3A5N C;  1O1W A;  3BF1 A;  1YT3 A;  5A2Q O;  5CHI A;  3VQE A;  3HBT A;  1D4X A;  4FJJ A;  2E88 A;  1JCF A;  4IEI A;  4N5S A;  1HNV A;  4NLB A;  4CZJ A;  1YVU A;  4RG8 A;  4CJS A;  3SUN A;  4KB0 A;  3CD6 N;  3VQB A;  3DWL A;  4F3T A;  4PY5 A;  2KLA A;  4JHD B;  1M90 O;  2QKB A;  5BRE A;  4A61 A;  2HND A;  3TI0 A;  4DWI A;  3CJ1 A;  1GLF O;  3QEP A;  1KQS M;  4Y1C A;  4OKE A;  1K9M O;  4ISF A;  4X66 K;  1L3V A;  2P51 A;  3SQ1 A;  4PUO A;  4H0Y B;  2I7N A;  3LDO A;  4OKJ A;  5KPZ A;  4CZL A;  2OPP A;  4IOX A;  3AO5 A;  4DQS A;  4JAX A;  1FW6 A;  3KLG A;  3ZCM A;  3PIP L;  1BCM A;  3CFP A;  3AVL A;  4M3R A;  5BR8 K;  1X3N A;  4PA1 A;  2P5O A;  3WEE B;  1XNR K;  4EZ6 A;  3OYI A;  4MFB A;  3O3F A;  4BR5 A;  4EAH D;  5KRT A;  4O0J A;  4FJ5 A;  3GE1 A;  1TUU A;  1WSF A;  1L3U A;  3L2R A;  1NK8 A;  2JWL A;  4GKK K;  1Q86 O;  3HP9 A;  3PUF A;  1TK5 A;  5FLX O;  1SL0 A;  4MO4 A;  4CBU A;  1U6Z A;  3SMS A;  2VWB A;  2O8F B;  1LWE A;  1C0F A;  2E6M A;  2E8A A;  2A6A A;  4CEC A;  1CZB A;  4RW7 A;  4J8F A;  4B3O A;  4CZI A;  4BRM A;  1QQM A;  4CF2 A;  5AZI A;  1YTU A;  1IKW A;  3VF6 A;  5C42 A;  4YNQ A;  1BI4 B;  3HOT A;  5CZ1 A;  4CVN E;  3AVN A;  3VQC A;  3TTC A;  2E2P A;  3VEO A;  2HVI A;  1NM1 A;  4LY7 A;  3PX4 A;  5J2P A;  2JGU A;  3VEV A;  4C1N I;  1VSF A;  4B3T K;  3MWP A;  4PWD A;  3SCX A;  4B9L A;  4B9S A;  2KFZ A;  4F4K A;  4CJ7 A;  2NRW A;  3TAR A;  1JLQ A;  1ATR A;  5MLC Q;  4ELU A;  4DTJ A;  3QFU A;  3SLC A;  4B1U B;  2QWN A;  4BAC A;  3TSP A;  1A5X A;  4CJU A;  4H4M A;  1XMQ K;  1LCU A;  1QHA A;  4BRP A;  4JKG B;  2E1Y A;  3PY8 A;  1Q8I A;  4DHY A;  3RMD A;  4BDZ A;  1P8Z A;  2B4J A;  2QWL A;  3NFA A;  4FWO A;  2F96 A;  5JLH A;  4KH5 A;  4BE1 A;  3S3N A;  1WLJ A;  3MED A;  4CGD A;  2Q31 A;  4A2B A;  3KLH A;  4JI0 K;  4DTM A;  4MQ3 A;  2YNI A;  4RTF D;  3OS1 A;  4C8K A;  1SQK A;  4FOE A;  1RT1 A;  5FPN A;  3KKS A;  4K0K K;  2X6N A;  4H5V A;  5J1E A;  1ZBF A;  4JK8 A;  4CJE A;  3DLE A;  4CES A;  2P9S A;  2VQE K;  4KPY A;  3J80 O;  3M8S A;  3U4L A;  3AVI A;  4C8M A;  1RIL A;  4DTU A;  1QSY A;  3F2K A;  3U3Y A;  3AAR A;  1W2B M;  5BRD A;  1QZ5 A;  1NGJ A;  4FWR A;  1XI1 A;  5AQS A;  1BA1 A;  3UKR A;  4BG9 A;  1CXU A;  1NOZ A;  3MEE A;  3WNH A;  4H5N A;  4JN4 A;  3VQ9 A;  4DKW A;  3HXM A;  4IFE A;  4A2A A;  2FXU A;  1LWC A;  3VA0 A;  1VQ6 N;  1WAF A;  1K8A O;  1WSE A;  4IBN A;  2X78 A;  5DM7 L;  3FZF A;  1YF5 L;  4CIG A;  2Z1J A;  3AVF A;  3LAN A;  3CFR A;  2D0B A;  2G8W A;  1NGA A;  3ZSQ A;  4GY2 B;  2NRH A;  1CLQ A;  4KKO A;  4Z4I A;  1RBS A;  1WSG A;  4KH6 A;  1U45 A;  4B9V A;  1RTD A;  3WXL A;  4H4O A;  4FJ8 A;  1TK8 A;  5C25 A;  1W7A A;  1OVY A;  3ZSR A;  3ZSV A;  3THW A;  3I55 N;  4UQG A;  1VSJ A;  1MDU B;  3AA4 A;  2F8S A;  3EN9 A;  5AQJ A;  1X9M A;  3NE6 A;  3R8E A;  5AQK A;  1P90 A;  3ZSZ A;  1YHQ N;  3R9P A;  1GLE G;  4Z4H A;  4DUZ K;  5HP1 A;  4B8C A;  5C24 A;  3THV A;  4WQ4 A;  1BIZ A;  4LH4 A;  5EU7 A;  4LF9 K;  4BRG A;  4IG3 A;  3ZEU B;  1J6Z A;  4W5T A;  3RMB A;  2P9K A;  4JI1 K;  3VQ8 A;  1WSJ A;  3CG7 A;  1VQM N;  3F9K A;  1TKD A;  1IKY A;  4BR0 A;  2FSN A;  1T03 A;  5KPR A;  4L3Q A;  3L4I A;  5FRN A;  4KHP K;  4ZTF A;  4FLW A;  4Q5V A;  4FJM A;  3CCU N;  3KK3 A;  1SV5 A;  3CM6 A;  4OPH A;  1DTQ A;  1KFS A;  1JCG A;  3ULE B;  3A2F A;  4FO0 A;  4IDK A;  3KD5 E;  3HZ6 A;  1DT9 A;  4JK9 A;  4DV4 K;  3BZK A;  3ZT2 A;  4KO0 A;  3QNN A;  2VGN A;  4O5B A;  4CHQ A;  5FRO A;  4DQR A;  2PYL A;  3M8Q A;  2DY4 A;  2P9P B;  1TKT A;  4HCB A;  3IRX A;  1S1T A;  4CBX A;  4JD2 A;  4NO7 A;  2G8V A;  5HRS A;  4C8O A;  1RNH A;  4AM6 A;  3RR7 A;  1QVF M;  4H0P A;  3CCR N;  2W6K A;  5I3U A;  4BR4 A;  4GNI A;  3T3F A;  4FJH A;  4K25 A;  3DLG A;  4N41 A;  3AVK A;  4PL7 A;  4CEO A;  4CGH A;  1OH7 A;  4KHQ A;  3NF8 A;  5KGW A;  2BE2 A;  2R7Y A;  3EZW A;  3CCJ N;  2PY5 A;  4O44 A;  3SJH A;  3WNF A;  2A1R A;  1W9H A;  3IUC A;  4CK1 A;  4LF6 K;  3VOV A;  3M3Z A;  4DUY K;  4CER A;  2YHW A;  5C2D A;  4CGI A;  4ELV A;  2UUB K;  5JIC A;  2BGG A;  2A42 A;  4FJN A;  5I9E B;  3FE1 A;  1ZXO A;  4IO8 A;  3JYT A;  4CFA A;  5KGX A;  3LP1 A;  1HYZ A;  4JI6 K;  2IVN A;  1YAG A;  2HBL A;  1NJW A;  5M1N A;  2OA8 A;  3QBX A;  4CJ3 A;  3CI5 A;  1KRP A;  3ZT1 A;  2O8B B;  1JLB A;  1KVC A;  1LW2 A;  2ZM6 K;  1YJ9 N;  5F0X A;  3SUO A;  2FBT A;  3K5O A;  3CER A;  3HT3 A;  4KRE A;  3BP8 A;  3E66 A;  4CJK A;  1RDC A;  2Q1N A;  2QM1 A;  3D2F A;  2E1Z A;  4TSX A;  3FZM A;  5AQG A;  3L6Q A;  3CPW M;  1B92 A;  5KQ8 A;  1S6Q A;  1ASU A;  2OAN A;  4E3S A;  4B1Z A;  3ENB A;  3CJB A;  2HBJ A;  2ASP A;  3AVM A;  2FBV A;  3T69 A;  4C23 A;  1YXQ A;  3ENO A;  3D2E B;  2DFH A;  1UWB A;  4DTR A;  1ATS A;  5M1P A;  2O8E B;  3L2Q A;  3VGL A;  4JK7 A;  3VQP A;  1YIJ N;  3SI6 A;  1IG9 A;  1VSK A;  1XQS C;  1EO1 A;  4KV8 A;  3DXK B;  1SKS A;  2FSJ A;  4AHU A;  4FWM A;  4MDA A;  1BO5 O;  3AA5 X;  4BDY A;  3D45 A;  1S9E A;  5LL6 Z;  3RSE B;  3G71 N;  4C8L A;  4WCE L;  2HB5 A;  5TKW A;  4DSJ A;  3CQX A;  3IS9 A;  4DR6 K;  4ID5 A;  3TTF A;  2NRR A;  4ID1 A;  4WFA L;  4JKF A;  2O8F A;  1QQO A;  4WQ5 C;  2E6L A;  3K9J A;  1ATN A;  1V4T A;  3O8M A;  1SAZ A;  2GX9 A;  2P9L A;  2VGM A;  4WE1 A;  5AFU H;  2UUC K;  4CEQ A;  4FWK A;  1BI4 A;  4PHT X;  2D0P A;  3I0S A;  1HR0 K;  3LZJ A;  3EY1 A;  1NKC A;  3CHW A;  4DSF A;  3MCA B;  2YV0 X;  1HNZ K;  2WC9 A;  3MWT A;  1KC8 O;  2HW3 A;  4BC4 A;  3V9Z A;  4BRF A;  3DLR A;  2HBK A;  3AGR A;  2QW9 A;  3K58 A;  3J81 O;  3DI6 A;  1QQC A;  4YOU A;  3ZX0 A;  3DRP A;  3EZ5 A;  3AY9 A;  3GDQ A;  1NK5 A;  3C0B A;  3KK1 A;  1RT3 A;  4B1Y B;  4OLA A;  1BG3 A;  3GG4 A;  4DV2 K;  4CF1 A;  1NLV A;  3NCI A;  4M42 A;  3SAG A;  3O4W A;  1RDA A;  1HRH A;  1IV0 A;  1HKB A;  2F8T A;  3ASM A;  3O08 A;  4HUF A;  4JKG A;  2BUP A;  1BU6 O;  3D0P A;  2ITM A;  4H8K A;  3VQA A;  4XEI A;  3CJ7 A;  1K8K B;  1S1W A;  3ZSX A;  2AA4 A;  4BRO A;  1VRT A;  4BVP A;  4CJL A;  3SMP A;  2D0A A;  2KZM A;  3VGM A;  3H46 O;  4F8R A;  4I2Q A;  2VG6 A;  3CJ9 A;  1WUA A;  1Q18 A;  3SV3 A;  5C12 A;  3O80 A;  4JI8 K;  3MXM A;  2QEX N;  4WF9 L;  3DLH A;  4KH4 A;  2QKK A;  1I39 A;  1WOQ A;  2Q97 A;  3J8A A;  1H1V A;  3QEX A;  3QIN A;  1MA9 B;  2CH5 A;  2W40 A;  4FJ9 A;  3WXJ A;  4JKD A;  1HQU A;  3QEV A;  3T19 A;  4M7X A;  3CCV N;  2RPI A;  4C1N K;  3LPT A;  5EXW A;  1Y64 A;  3QML A;  3TAN A;  4XIU A;  4HTU A;  1BIU A;  3T7Z A;  4DTO A;  4KI6 A;  4R79 A;  1NGB A;  3NGY A;  3EYZ A;  4ZHR A;  4KHS A;  2UUA K;  4Z4F A;  4DSK A;  4OX9 K;  4QAG A;  5ELZ A;  3U9Z A;  5K14 A;  4FXD A;  4CHZ A;  4RW4 A;  3CMA N;  3J7Y P;  3AVG A;  1VSD A;  2HST A;  3ZSO A;  1J54 A;  1GOC A;  4GV6 A;  3SV4 A;  2GEM A;  4ELT A;  2O8C B;  1JXE A;  3MEC A;  3CM5 A;  4Z0U A;  1JLF A;  3E9P A;  1HJR A;  3EE8 A;  3EKU A;  1J5O A;  3B6P A;  5AQM A;  4BQZ A;  5FDL A;  4LH5 A;  3C94 A;  5F1X A;  3SQ2 A;  1TKX A;  3OYC A;  2A1S A;  3UB5 A;  3QB0 A;  3FZK A;  3PO4 A;  1BUP A;  1YVN A;  3TAQ A;  3P1G A;  3MXJ A;  3Q7C A;  3SUQ A;  4LF7 K;  5AQV A;  3AVH A;  3T1A A;  4DCH A;  5DK5 A;  3IFR A;  5GAD P;  4B9N A;  4FM1 A;  4X62 K;  3SQ4 A;  2G8I A;  4M3T A;  3FFK B;  1J53 A;  1WBD A;  3IG1 A;  4FLY A;  4FVU A;  3ZET B;  3VEN A;  3P31 A;  3IMX A;  3ZEU A;  4LF5 K;  4EHT A; 
#chains in the Genus database with same CATH homology
 4EZ9 A;  4DTU A;  5J2M A;  3LP2 A;  3RMC A;  1QSY A;  1NKB A;  1RT6 A;  5JS2 A;  1WAJ A;  4M41 A;  3HPH A;  2IGI A;  3U3Y A;  2HNY A;  4CIE A;  2GBZ A;  4LSN A;  4OPJ A;  3I0R A;  4E7J A;  3V9W A;  1XI1 A;  2WOM A;  4IG0 A;  3ULD A;  2XRI A;  4CF0 A;  3QES A;  4GW6 A;  1ASW A;  3FFI A;  4BE0 A;  2XO7 A;  1CXU A;  1SKR A;  1L3T A;  1X9S A;  1NOZ A;  3MEE A;  3WNH A;  3VQ9 A;  3TR8 A;  4G1Q A;  3OYA A;  4DQP A;  2HHQ A;  3HXM A;  3RMA A;  1U04 A;  3KJV A;  4KHW A;  2WON A;  2Z1I A;  1LAW A;  1LWC A;  3VA0 A;  1NKE A;  1WAF A;  3HJF A;  1WSE A;  1RTH A;  1RTI A;  1JL2 A;  3ZT4 A;  4IBN A;  2X78 A;  3CQ8 A;  1UA1 A;  4CJ4 A;  1Q9X A;  4E7H A;  3AO3 A;  1FKP A;  4CIG A;  3SZ2 A;  2HHV A;  4DU1 A;  1KLN A;  2Z1J A;  3AVF A;  3SYZ A;  3V81 A;  1X9W A;  1JXB A;  2OPS A;  3LAN A;  4KTW A;  3CFR A;  4OGC A;  3S3O A;  4DU3 A;  2D0B A;  3U6F A;  3MEG A;  1U4B A;  3HP6 A;  2G8W A;  4Y1D A;  3V4I A;  3AVC A;  3ZSQ A;  4R5P A;  4O4G A;  4RW6 A;  1CLQ A;  3OS0 A;  4KKO A;  4Z4I A;  1RBS A;  1WSG A;  1C0M A;  1U45 A;  1KCF A;  1UA0 A;  2G8F A;  3S3M A;  4B9V A;  1RTD A;  1BQN A;  2XHB A;  1MU2 A;  4H4O A;  4EP5 A;  4M3Y A;  4FJ8 A;  1VSH A;  1TK8 A;  1BGX T;  3KLF A;  5HRN A;  4DTN A;  5C25 A;  3SJJ A;  1L5U A;  4J2E A;  3ZSW A;  3ZSR A;  3ZSV A;  2PZS A;  1C0T A;  4UQG A;  1VSJ A;  3HPO A;  3OJU A;  3M8P A;  1NJZ A;  2Y1J A;  2PY5 A;  3AA4 A;  2F8S A;  1C1A A;  3LZI A;  1ZBH A;  4EP4 A;  1X9M A;  1C1C A;  3NE6 A;  4DSE A;  4QOZ B;  2DFE A;  3ZSZ A;  1FXX A;  5E41 A;  4BDP A;  3AO1 A;  3BGR A;  4LSL A;  3L2V A;  4CFD A;  4Z4H A;  3DMJ A;  3OYB A;  4LD0 A;  1VSL A;  2IDO A;  2IAJ A;  3V9U A;  4B8C A;  3K5L A;  5HP1 A;  5C24 A;  3CFO A;  3NDK A;  3KKR A;  3THV A;  1ZBL A;  1U47 A;  1LWF A;  1UOC A;  1BIZ A;  3QER A;  1I3A A;  4LH4 A;  5EU7 A;  2G8H A;  4CGG A;  1S6P A;  4IG3 A;  4KHY A;  1VSI A;  4W5T A;  1Y97 A;  3DRS A;  4CEA A;  2XY6 A;  3RMB A;  3V1O A;  4NCB A;  3VQ8 A;  3PV8 A;  5HLF A;  1WSJ A;  3CG7 A;  2ETJ A;  1JKH A;  1W0H A;  1SL2 A;  3IAY A;  2DTU A;  3F9K A;  1N5Y A;  3ZT3 A;  1TKD A;  1IKY A;  1T03 A;  3ALY A;  3M8R A;  4AHS A;  3LWL A;  4N56 A;  5FRN A;  4ZTF A;  1SL1 A;  4HVJ A;  4FLW A;  4FZX C;  1NK6 A;  1XHX A;  3QLH A;  4Q5V A;  4FJM A;  4KB1 A;  2IS3 A;  4JLH A;  3KK3 A;  1SV5 A;  1D9D A;  3CM6 A;  1RDD A;  2D0C A;  1Q9Y A;  2HHU A;  3HST B;  1DTQ A;  1JL1 A;  1KTQ A;  4I7F A;  2YHB A;  4Q0B A;  2HHW A;  1KFS A;  4BE2 A;  5JS1 A;  3C6T A;  3NF9 A;  4DQI A;  3A2F A;  4AHV A;  1TL1 A;  3L8B A;  4IDK A;  3KD5 E;  1YTA A;  3MAQ A;  2BDP A;  2FC0 A;  4CJV A;  2GUI A;  3I8D A;  2HHS A;  4HCC A;  3ZT2 A;  5DMR A;  4KO0 A;  4FJG A;  4GVM A;  3QNN A;  3G0Z A;  4DFM A;  4O5B A;  1S1X A;  1HQE A;  2VWJ A;  3AVB A;  1C1B A;  3OVN A;  3VN5 A;  4CHQ A;  5FRO A;  4DQR A;  3QEW A;  4K8Z A;  2PYL A;  3M8Q A;  2DY4 A;  1TKT A;  4HCB A;  3IRX A;  1S1T A;  3K2P A;  2RKI A;  4N76 A;  1A5W A;  2B6A A;  2G8V A;  4DSL A;  3L3V A;  4DSI A;  4OJR A;  5HRS A;  4C8O A;  1RNH A;  3RR7 A;  4FJI A;  3C6U A;  3AA3 A;  3RRG A;  2E4L A;  4E0D A;  3KLE A;  5I3U A;  1LV5 A;  2RN2 A;  2Q3S A;  3T3F A;  3DLG A;  3L2U A;  3AVK A;  4FJH A;  4N41 A;  1VSM A;  3P5J A;  4DF4 A;  4E7K A;  3SQ0 A;  4CEO A;  2QK9 A;  4CGH A;  3VQ7 A;  3MXI A;  3NF8 A;  5KGW A;  4KHQ A;  5HRP A;  2KZZ A;  2VG7 A;  2BE2 A;  3KK2 A;  2R7Y A;  4AIL C;  3DOL A;  3OYD A;  2X6S A;  4DS5 A;  2DFF A;  2OPQ A;  3LPU A;  4CEZ A;  2X74 A;  1NJY A;  4Z4G A;  1WNS A;  2B5J A;  2O4G A;  3DOK A;  4FW2 A;  4O44 A;  4OVL A;  3WNF A;  2GV9 A;  3TAE A;  2A1R A;  1SKW A;  4CED A;  4DU4 A;  1NK0 A;  1W9H A;  3TAG A;  3E01 A;  1FKO A;  3LAK A;  4CK1 A;  4CK3 A;  1KSP A;  1VSE A;  2O4I A;  2ATQ A;  4FM0 A;  5CZ2 A;  3NF7 A;  4OPK A;  4JS4 A;  1TAU A;  4O55 A;  5T7B A;  3LWM A;  2KW4 A;  1BCO A;  3TWH A;  3QIO A;  4M3W A;  4CER A;  3WNE A;  2YNG A;  3OYK A;  1S1V A;  3C95 A;  4CGI A;  4ELV A;  4FJX A;  3AA2 A;  1RCH A;  2BGG A;  4JS5 A;  1TK0 A;  4JRP A;  1RT5 A;  1C0U A;  1KVA A;  4FJN A;  3TAB A;  1RT4 A;  3JYT A;  1U49 A;  4CFA A;  4I9L A;  1HMV A;  2LSN A;  5KGX A;  3KIO A;  3LP1 A;  1B9F A;  1X1P A;  1HYZ A;  1T8E A;  1KLM A;  1IKX A;  3VQ6 A;  4FK0 A;  1KVB A;  2HHX A;  3TAM A;  1NJW A;  4E1M A;  3AVJ A;  2OA8 A;  4ZTJ A;  5D3G A;  2EX3 A;  4CJ3 A;  4CEB A;  2XY7 A;  1KRP A;  3QIP A;  3ZT1 A;  2RF2 A;  4CJW A;  3OYF A;  1JLB A;  1KVC A;  1LW2 A;  3L2W A;  3V9X A;  3SUO A;  1TGO A;  3AO4 A;  3DRR A;  2FBT A;  3K5O A;  1XHZ A;  4W5N A;  3HVT A;  3HT3 A;  4CJR A;  3VQ4 A;  4KRE A;  4KTZ A;  4CJK A;  1RDC A;  2Z1G A;  2IOC A;  4TSX A;  4CCH A;  4C8N A;  3NGI A;  4B08 A;  4DLE A;  1B92 A;  1RBU A;  4DTS A;  1S6Q A;  3OY9 A;  2HHT A;  1K6Y A;  1D9F A;  1ASU A;  3SPZ A;  4E3S A;  3DLB A;  2YNH A;  1XC9 A;  4W5R A;  3JSM A;  4GMJ B;  3SNN A;  4J2D A;  4CJQ A;  1EET A;  3AVM A;  2I5J A;  2FBV A;  4CHY A;  3HVR A;  4FLZ A;  4DS4 A;  4B9M A;  2ZE2 A;  4PQU A;  4B9T A;  4F2R A;  4FLT A;  4CHO A;  1WSI A;  1UWB A;  2DFH A;  1CZ9 A;  3DLK A;  3DYA A;  3LAM A;  4DTR A;  2VWK A;  1R0A A;  4J2A A;  4E7I A;  4CGJ A;  2Y1I A;  3TAF A;  4KFB A;  1JLE A;  3K5M A;  1BQM A;  3PX0 A;  1S5J A;  2D5R A;  3AV9 A;  3L2Q A;  1QSS A;  1HNI A;  3K5N A;  2YKM A;  3S9H A;  3VQP A;  4CGF A;  4DG1 A;  4W5Q A;  3OYN A;  3OYG A;  4FJL A;  3HPG A;  3SI6 A;  4FYD A;  1B9D A;  1IG9 A;  1DTT A;  1VSK A;  3NHG A;  5KTQ A;  4KV8 A;  1JLG A;  3O3H A;  4FZZ A;  1SKS A;  4DFP A;  4CHN A;  4Z4E A;  2ZQB A;  4AHU A;  3VQ5 A;  1L3S A;  1RT7 A;  3V6D A;  2XY5 A;  4HUE A;  4KHU A;  3RR8 A;  1Z26 A;  4O0I A;  3AA5 X;  4BDY A;  3QET A;  4RW9 A;  3D45 A;  3VQQ A;  3TAP A;  4AHT A;  1D8Y A;  2OZM A;  1S9E A;  2OPR A;  1IO2 A;  4YFU A;  5I42 A;  3LP0 A;  4C8L A;  4CIF A;  4QCL A;  3LP3 A;  4BWM A;  2HB5 A;  3K59 A;  5SZT A;  4DSJ A;  1C6V A;  1A5V A;  3IS9 A;  3NAE A;  3HK2 A;  2XY8 A;  4IFV A;  4W5O A;  4ID5 A;  4KAZ A;  1ZBI A;  1TL3 A;  2YNF A;  4M3U A;  5CYM A;  1LW0 A;  4ID1 A;  4DMN A;  1G15 A;  1KFD A;  3QO9 A;  4FLV A;  1VK0 A;  4OGE A;  2IC3 A;  4CHP A;  2VG5 A;  3NH1 A;  3V9S A;  1O1W A;  2E6L A;  4CEE A;  1YT3 A;  3VQE A;  3VA3 A;  4DTP A;  3LDS A;  4KRF A;  4OLB A;  4FJJ A;  4KTQ A;  1IH7 A;  3PO5 A;  1T05 A;  4M3Z A;  4AH9 A;  4N5S A;  2ZD1 A;  4KHN A;  1HNV A;  4WE1 A;  4FLU A;  1YVU A;  4RG8 A;  4CEQ A;  4CJS A;  3SUN A;  4KB0 A;  1QSL A;  1BI4 A;  3VQB A;  2OYQ A;  4F3T A;  4PY5 A;  3V1Q A;  1U48 A;  3I0S A;  4DLG A;  3LZJ A;  3OJS A;  3DM2 A;  3EY1 A;  1NKC A;  4FK2 A;  5FRM A;  2QKB A;  2HND A;  4DSF A;  3TI0 A;  2YV0 X;  1J9A A;  1F21 A;  4KI4 A;  2HW3 A;  3QNO A;  4BWJ A;  2KQ2 A;  3OYH A;  4HHT A;  3DLR A;  3V9Z A;  4E7L A;  2G8K A;  4DWI A;  4FJK A;  3K58 A;  1TV6 A;  3NGZ A;  3F73 A;  4CF9 A;  3KLI A;  3RTV A;  3DI6 A;  3QEP A;  4B9U A;  4Y1C A;  3ITH A;  4J2B A;  1QQC A;  4OKE A;  2G8U A;  1RBT A;  3DRP A;  3EZ5 A;  1LAV A;  1L3V A;  3RRH A;  3WNG A;  2P51 A;  3SQ1 A;  1NK5 A;  4PUO A;  3NF6 A;  3HM9 A;  3SUP A;  3KK1 A;  1RT3 A;  4OLA A;  5KI6 A;  4CJF A;  3AVA A;  4DQQ A;  2P1J A;  4CF1 A;  4M3X A;  4CK2 A;  1EP4 A;  4AHR A;  4OKJ A;  4RW8 A;  1D5A A;  5CY4 A;  3BDP A;  3NCI A;  2OPP A;  4M42 A;  1REV A;  3AO5 A;  2KTQ A;  4DQS A;  3PX6 A;  1RDA A;  1HRH A;  3AO2 A;  3KLG A;  2HNZ A;  3ZCM A;  1NOY A;  2F8T A;  1DLO A;  1BCM A;  3CFP A;  3AVL A;  3ASM A;  4M3R A;  2FBY A;  5J2Q A;  4HUF A;  1GOA A;  2Z1H A;  2JLE A;  1SUQ A;  4PA1 A;  1NK7 A;  2P5O A;  4EZ6 A;  3OYI A;  1CXQ A;  3D0P A;  4MFB A;  1TAQ A;  3O3F A;  1ZYQ A;  1QHT A;  4H8K A;  3VQA A;  3P83 D;  4CJT A;  4E19 A;  5KRT A;  4O0J A;  4FJ5 A;  4L8R B;  3ZSX A;  1S1W A;  1L3U A;  1WSF A;  1VRT A;  4CJL A;  3VQD A;  4E1N A;  3L2R A;  1NK8 A;  4FK4 A;  2D0A A;  1S1U A;  3HL8 A;  2KZM A;  5HBM A;  3HP9 A;  3PUF A;  4I2P A;  4IFY A;  3K57 A;  2NUB A;  4F8R A;  4I2Q A;  2VG6 A;  1JLC A;  4CF8 A;  1TK5 A;  3NH2 A;  2HVH A;  3OYJ A;  3SV3 A;  1SL0 A;  1JLA A;  3B6O A;  1LWE A;  2E6M A;  3MXM A;  2AJQ A;  3CYM A;  3HYF A;  1RBR A;  4CEC A;  1CZB A;  1WN7 A;  3ISN C;  1XWL A;  4RW7 A;  3DLH A;  4B3O A;  2QKK A;  1I39 A;  4DFJ A;  5KRS A;  4CF2 A;  3QEX A;  1QS4 A;  1IKW A;  1YTU A;  1BHL A;  3QIN A;  3H08 A;  5C42 A;  4FJ9 A;  3HO1 A;  4YNQ A;  1S9G A;  3O4Q A;  1BI4 B;  4F3O A;  5CZ1 A;  4JRQ A;  3RWU A;  2HMI A;  3AVN A;  1EKE A;  3VQC A;  3ZT0 A;  1ZBU A;  1HYS A;  4FZY A;  1HQU A;  3QEV A;  3T19 A;  1QE1 A;  1VRU A;  2HVI A;  2RPI A;  3LPT A;  4FW1 A;  3NBP A;  4LY7 A;  3PX4 A;  4XIU A;  4HTU A;  3TAN A;  1BIU A;  3LAL A;  2JGU A;  4DTX A;  1ITG A;  5J2P A;  4DTO A;  4KI6 A;  2PYJ A;  1UAX A;  4FJ7 A;  4NCG A;  1VSF A;  4CJ5 A;  2ITG A;  3NGY A;  3EYZ A;  1RDB A;  4NYF A;  4ZHR A;  4KHS A;  5HRR A;  1HPZ A;  4B8A B;  4DSK A;  4Z4F A;  3SCX A;  3G10 A;  4QAG A;  4B9L A;  4PWD A;  2KFN A;  2YKN A;  4B9S A;  5K14 A;  4FXD A;  4CHZ A;  4RW4 A;  4F4K A;  2KFZ A;  3UIQ A;  1ASV A;  4I9Q A;  1WSH A;  4E89 A;  2FBX A;  3AVG A;  3OYE A;  1VSD A;  3TAR A;  1NK4 A;  1NK9 A;  1JLQ A;  5CYQ A;  4N47 A;  1NJX A;  2P5G A;  4CFC A;  1T7P A;  4ELU A;  3ZSO A;  4DTJ A;  1J54 A;  1GOC A;  3SV4 A;  4BAC A;  3KD1 E;  4ELT A;  3NH0 A;  1JXE A;  4FM2 A;  3MEC A;  1A5X A;  1TVR A;  3CM5 A;  4Z0U A;  4CJU A;  1IKV A;  1JLF A;  4H4M A;  1HJR A;  4NCA A;  3QEI A;  4CFB A;  3B6P A;  1J5O A;  1RTJ A;  5FDL A;  4LH5 A;  3C94 A;  3KTQ A;  3L3U A;  3SQ2 A;  4IKF A;  3PY8 A;  2YHA A;  1TKX A;  3OYC A;  1Q8I A;  3U3G A;  2A1S A;  3RMD A;  4BDZ A;  2B4J A;  3NFA A;  2F96 A;  3ZSY A;  4AHC A;  1QTM A;  1RT2 A;  4BE1 A;  4ICL A;  3OYM A;  4FLX A;  4NYN A;  4DF8 A;  3OYL A;  1TKZ A;  1WLJ A;  3MED A;  3S3N A;  3O4N A;  3PO4 A;  2OZS A;  1HYV A;  4CGD A;  3TAQ A;  4M45 A;  3P1G A;  3MXJ A;  3KLH A;  3SUQ A;  4CEF A;  4DTM A;  4MQ3 A;  2YNI A;  1Z25 A;  3AVH A;  3OS1 A;  5J2N A;  4F2S A;  3V1R A;  2W42 A;  4K8X A;  5SWM A;  1N6Q A;  4C8K A;  3T1A A;  1FK9 A;  4FVM A;  5DK5 A;  1BIS A;  2EHG A;  1BL3 A;  4CJP A;  4FCY A;  4FM1 A;  3SPY A;  1RT1 A;  3SQ4 A;  4B9N A;  1EXQ A;  3KKS A;  4OKK A;  1GOB A;  1RBV A;  2X6N A;  3O3G A;  5HRO A;  4M3T A;  2G8I A;  2QXF A;  1EX4 A;  1ZBF A;  5J1E A;  1J53 A;  4CJE A;  3DLE A;  4CES A;  3IG1 A;  3OS2 A;  4Z4C A;  4FLY A;  4DFK A;  4HUG A;  4KPY A;  4CE9 A;  3M8S A;  2BAN A;  3AVI A;  4C8M A;  1RIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...