4O55A

Hiv-1 integrase catalytic core domain complexed with allosteric inhibitor (2s)-tert-butoxy[6-(5-chloro-1h-benzimidazol-2-yl)-2,5-dimethyl-4-phenylpyridin-3-yl]ethanoic acid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
154
structure length
139
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A New Class of Multimerization Selective Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/inhibitor
molecule keywords Integrase
total genus 45
structure length 139
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o55A00
2O4IA 1S5JA 2IS3A 3MEDA 3O4NA 4BE1A 3TAGA 2BDPA 5EU7A 2E6MA 3NF7A 4GMJB 1SKRA 4M3YA 3ASMA 3IRXA 3QEVA 1REVA 1NK4A 1TAUA 4CJLA 2Y1JA 4FJXA 1BI4B 1LW2A 1RT7A 3LP2A 3C95A 1K6YA 5J1EA 3TABA 4FJMA 3VQ6A 5HRRA 1GOCA 3VQQA 4W5RA 4CCHA 5HRSA 2G8VA 3MXIA 4CHQA 1HJRA 2X78A 1U49A 4IG3A 3OYLA 3T19A 3K59A 2HW3A 1RT3A 4IFVA 4I2PA 1KVBA 3DYAA 5CYQA 2KZMA 2R7YA 1HMVA 3P1GA 2A1SA 3RR7A 4KB0A 4CEFA 4CEDA 4CGDA 4ELVA 3G10A 1HNIA 3VQPA 3V4IA 4KRFA 1JLGA 2PYLA 2F8TA 3VA0A 2PY5A 3MECA 1VSLA 3QINA 1SV5A 2WOMA 1LWCA 1QSYA 2DY4A 1SKWA 4B9TA 1QTMA 4DTNA 2HHXA 4CEBA 4Z0UA 4LSNA 1C0UA 3OYCA 3O4QA 4DU4A 4CHZA 2XRIA 2YNFA 4CK1A 1SL1A 4FM1A 2KFZA 1KCFA 4L8RB 4I2QA 1RBUA 5HRNA 4OLAA 4FZZA 2IGIA 4CF9A 1C1AA 1IKWA 1J54A 2D0AA 3OYKA 1Z25A 4RW7A 4F2RA 2ATQA 2E4LA 3SI6A 3AO3A 4KKOA 3OYDA 2A1RA 2YNGA 4CK3A 2WONA 1ZBLA 4EZ9A 4CFDA 1U04A 1C6VA 4CHOA 4YNQA 1S1VA 2ETJA 1Y97A 1JLCA 1FK9A 2Z1HA 3CYMA 5KI6A 2PZSA 3KLEA 4CESA 3S9HA 3M8PA 4CGHA 1IH7A 4CHYA 3NGIA 3KD1E 3QIPA 3OYGA 4R5PA 1BISA 4JRQA 2ZE2A 1NK7A 3RR8A 4F3OA 4KHNA 3WNFA 4HTUA 1NKEA 3FFIA 1CLQA 4AHSA 3NE6A 1TKXA 4OPKA 1DTQA 4DFMA 3LDSA 4NYFA 3HPGA 1NJYA 4Y1DA 3NGYA 4J2BA 4O5BA 1FKOA 3DM2A 1VRUA 1U45A 3KKRA 3NBPA 3SQ0A 4FZXC 4NYNA 4PA1A 3DMJA 4MFBA 3VN5A 3ZSWA 4DU1A 3L2RA 1Q9YA 2OPSA 4DTSA 2D0CA 2Z1GA 3CM6A 3K5LA 3NH2A 3TAQA 4LY7A 4CF2A 2Z1JA 5CZ2A 4DMNA 4ELUA 4N41A 4ZTJA 1NKBA 4DQRA 4J2EA 4RW4A 4J2DA 2QK9A 4E89A 4LH5A 4B9LA 2KFNA 3LP3A 2VWKA 3AVCA 2XY7A 1X9SA 1RTIA 3ITHA 5KRSA 2QKBA 4GW6A 1RTDA 4IBNA 3HPHA 4FJ9A 3LWMA 4E7LA 1VK0A 2W42A 3P5JA 3OYFA 4FW1A 4KPYA 4DSEA 4FJ5A 4CEOA 4BACA 4GVMA 4I9LA 4CJFA 3AVMA 4DFPA 3QIOA 3LP1A 4KFBA 1X9WA 2OA8A 2LSNA 3NH0A 4Z4IA 3SQ2A 1TKDA 1CZBA 3CFOA 4HHTA 2G8HA 1RT2A 1RT1A 3NGZA 4I7FA 4Z4FA 3AA3A 3TWHA 3SUOA 1QE1A 3CG7A 4ZHRA 3L2UA 1L3UA 3THVA 4J2AA 4M3ZA 3O3GA 1B9FA 1IKVA 4H8KA 3ULDA 4CGFA 1J5OA 2QKKA 4B08A 4RW6A 4OGCA 1ASUA 4C8MA 2B6AA 5JS2A 1T03A 1A5XA 3AVBA 3LZJA 2ITGA 3VQ7A 1W9HA 3SZ2A 2IDOA 2P1JA 1EETA 4CJ5A 4F8RA 1KTQA 1VRTA 4FW2A 2XY5A 2XY6A 4DWIA 1Z26A 2VG5A 4FJJA 2BE2A 2PYJA 3KLFA 1JLBA 1ASWA 3AO4A 3KLHA 3EYZA 3TAEA 3V1RA 5FRMA 3KJVA 1U47A 4KAZA 4CFAA 4DTRA 1UOCA 1UA0A 1NJWA 1QHTA 3VQCA 1TK5A 3C6TA 4QCLA 4DG1A 4Z4EA 1WSGA 1NJZA 3D0PA 3QNNA 1WSFA 4CHPA 1C0TA 4BDPA 1D8YA 4EP4A 1HYZA 5K14A 4DLEA 3NDKA 1SL0A 1N6QA 1A5WA 3V9UA 5J2NA 2KTQA 3HT3A 2RKIA 5C42A 4KTQA 1RBRA 3SCXA 2YKNA 3AV9A 1XHZA 5I3UA 2HVHA 1C1CA 4JS5A 3EZ5A 3OYHA 3V9WA 3KIOA 4IFYA 1RTJA 3BDPA 3ISNC 3ZSXA 4G1QA 4M45A 4M3XA 1WSJA 2P51A 3PO4A 3VQ9A 2FBVA 3SV3A 3SPYA 2IC3A 3AVFA 4AHVA 2HHQA 5C24A 3ALYA 1KFDA 4O4GA 4W5NA 3ZSVA 1T7PA 4Z4GA 1YVUA 3PO5A 3ZSZA 1LAWA 1SKSA 3DLGA 3HO1A 4FZYA 1VSEA 3TARA 3DLHA 3AVGA 4C8NA 4LSLA 3T3FA 4F3TA 4HVJA 4M41A 1S1XA 3UIQA 1B9DA 1EP4A 4E7HA 1L3VA 4DFJA 3DRSA 3OS2A 3IS9A 4M3WA 2KQ2A 3L3UA 5FDLA 3HPOA 1UAXA 1L3SA 1VSMA 1VSFA 4FJGA 4HCBA 2X6NA 3SUNA 3MAQA 3RMAA 4KO0A 1TL3A 2F96A 1RILA 3NFAA 4KHUA 4W5TA 3RMCA 4DQPA 4O44A 4Q5VA 3CFRA 1BL3A 4CGJA 3ZSOA 4KB1A 4RW8A 3SUQA 1IO2A 3A2FA 3KK2A 3EY1A 5HP1A 4KHWA 3LZIA 3HP9A 4FCYA 3NF8A 1I3AA 2YNIA 4FJ8A 3QEXA 3AVIA 1DLOA 3HSTB 3AA5X 4KHYA 1BCMA 1JLEA 3MEGA 3OY9A 4AH9A 1SL2A 4CEZA 5SWMA 1BGXT 2RF2A 4OGEA 1QS4A 2VWJA 1WN7A 1C1BA 4E7JA 1TK0A 1FXXA 4CJRA 1NK9A 4C8LA 3K57A 3ZSYA 3WNEA 1L3TA 3RMBA 4ICLA 4KTZA 3L3VA 3V9SA 3TAFA 4FJKA 3NH1A 5HRPA 4CJPA 3RRGA 4BDZA 1WSHA 1XI1A 1KFSA 4FLYA 4E1NA 5SZTA 2YKMA 4FK2A 1G15A 1HPZA 1CZ9A 5FROA 2NUBA 1IKXA 3M8RA 1RT5A 3VQ4A 3ZT1A 2EHGA 1LAVA 4K8XA 4OKEA 2DFFA 4CERA 3OVNA 4OKKA 4DSIA 1ZBHA 4PWDA 4CFCA 2RPIA 2HHVA 1WSIA 2QXFA 3DLRA 3DLEA 1IG9A 1JXEA 3HM9A 1HQUA 3S3OA 1S9EA 5I42A 3E01A 3MEEA 1NK5A 5CYMA 3TAMA 1DTTA 1NK8A 4DQSA 1RNHA 2ZD1A 1LWEA 1B92A 2VG7A 1X1PA 1RBTA 2B4JA 1TKTA 2YHBA 3OYJA 4DU3A 4IKFA 4E7IA 5E41A 4NCBA 3SPZA 2DTUA 4CGIA 2YNHA 3DOKA 4FLXA 1XHXA 2I5JA 4LH4A 1GOAA 3OYEA 1TGOA 2GBZA 3KK1A 2X74A 3F9KA 1LWFA 4CJUA 3L2VA 1Q8IA 3CQ8A 4DTPA 2FBTA 4B9UA 1RDBA 4N76A 3V81A 4E19A 4DS4A 4KHQA 1WSEA 2XY8A 2KW4A 1JXBA 3TAPA 1RT4A 3DLKA 1ZBFA 3H08A 4KTWA 1KSPA 1F21A 1GOBA 1RBVA 3LP0A 4I9QA 1U48A 4CHNA 1EX4A 4LD0A 5J2QA 1BHLA 1JLFA 3KKSA 1KVCA 4AILC 1O1WA 3IG1A 2HNDA 4TSXA 3VQBA 4CEQA 4CJWA 4B9NA 4CJTA 2OZSA 2Z1IA 1JLQA 3I0RA 2OPRA 3QERA 1WAFA 3U3GA 4C8KA 3OYIA 3TANA 2HVIA 4RG8A 3ZSQA 1JL1A 3PX6A 5HBMA 4KHSA 4FM0A 3HP6A 3LWLA 1SUQA 3C94A 4N5SA 3HVRA 1T05A 3VA3A 2HB5A 3NAEA 1J53A 1NK6A 1BI4A 3DOLA 3SQ4A 2D5RA 3RWUA 1BQNA 1S1TA 4Z4CA 3PX4A 4FYDA 3WNHA 3ZCMA 3MXJA 4FXDA 3VQEA 4B9MA 2KZZA 4E1MA 5J2PA 3SNNA 1HYVA 4IDKA 4HCCA 5J2MA 2YHAA 1D5AA 1TVRA 2HMIA 1S1UA 4DSFA 3AA4A 3F73A 1QSSA 3PUFA 3D45A 4ID1A 4O0JA 4AHUA 4CIGA 4CJKA 4N56A 4FJ7A 4QAGA 3LANA 3VQ5A 3L8BA 3CM5A 3TR8A 3V1QA 4CJ4A 4IG0A 1RCHA 1BCOA 5KRTA 3PY8A 1S1WA 3K5NA 1R0AA 4FK4A 2Q3SA 3M8QA 4AHRA 3T1AA 4FVMA 4W5QA 1QQCA 4AHCA 3L2WA 3PX0A 4OVLA 1X9MA 5CZ1A 2G8UA 4KI4A 4MQ3A 4B9VA 2OPPA 1UWBA 3QEWA 4M42A 4EZ6A 2JLEA 4M3UA 1I39A 2VG6A 4PQUA 1TAQA 2JGUA 3OS0A 2G8FA 1VSDA 4FJLA 2HHWA 2F8SA 3OYNA 1XWLA 1N5YA 1YTAA 3HJFA 4CJEA 4W5OA 1HYSA 1KLMA 4CF0A 5CY4A 1JLAA 4B8AB 3TI0A 3L2QA 4O0IA 3I8DA 4BWMA 3K5OA 2GUIA 3O3HA 1QSLA 4B9SA 4CFBA 1JKHA 3AVNA 4XIUA 4BDYA 2P5GA 4N47A 4CE9A 4OLBA 5HLFA 5DMRA 4DTOA 1TKZA 5HROA 4B8CA 4ELTA 3AVJA 4FLUA 1KRPA 1HNVA 2E6LA 4M3TA 4AHTA 1UA1A 1NKCA 3C6UA 2O4GA 4CECA 3KLIA 2Y1IA 5C25A 4EP5A 4O55A 1D9FA 1EXQA 1VSKA 1BQMA 4Z4HA 3SV4A 4DFKA 1U4BA 3KTQA 3HXMA 4FJHA 3V1OA 4HUFA 2AJQA 1ZBUA 2XO7A 3RRHA 4FM2A 2HHTA 1IKYA 3QEIA 3S3MA 2IAJA 1S9GA 4CK2A 4F2SA 4PUOA 4KV8A 1RDAA 3RMDA 1WNSA 3B6OA 2BGGA 4B3OA 3HVTA 1ASVA 4PY5A 1RBSA 1YT3A 1EKEA 3AVAA 1MU2A 2HHSA 4H4MA 3HK2A 3JSMA 4HUEA 4BE0A 1VSHA 3DRPA 2G8IA 2EX3A 1D9DA 3K58A 4DTXA 3K5MA 4HUGA 1A5VA 5T7BA 4OKJA 3OYMA 2IOCA 2X6SA 4FJIA 4DTJA 4FLTA 3G0ZA 4CJVA 3VQ8A 3VQAA 3SUPA 3OYAA 4E0DA 4KREA 4DF4A 4DS5A 3VQDA 3DRRA 5KGXA 2G8KA 4CF1A 4C8OA 4OJRA 3V9XA 4FK0A 4CJQA 3LALA 4JRPA 1S6QA 4H4OA 3CFPA 4JS4A 1HQEA 3ZSRA 4Q0BA 4CIEA 2FBXA 1J9AA 3I0SA 2B5JA 4CGGA 4DSKA 3AO1A 3JYTA 3AVKA 3NF6A 4DSLA 2XHBA 4F4KA 1RDDA 1BIZA 1LW0A 3OYBA 1KLNA 4DSJA 3M8SA 3V6DA 4CEEA 3KLGA 4DF8A 1NK0A 2HNZA 1C0MA 4Y1CA 2OYQA 3AA2A 1RTHA 5D3GA 4E7KA 4UQGA 3OJSA 4JLHA 4DTMA 3S3NA 3RTVA 4DTUA 3ZT2A 3B6PA 4NCGA 4CJ3A 1WLJA 1RT6A 2D0BA 4WE1A 3DLBA 2P5OA 4NCAA 3NCIA 4DLGA 3QNOA 1VSJA 3O3FA 3SYZA 2OZMA 5KTQA 1W0HA 1TK8A 2HNYA 1ITGA 4YFUA 1RDCA 3LPTA 1Q9XA 5JS1A 3LPUA 2GV9A 3QESA 3ZT4A 3U3YA 2DFEA 3KK3A 3ZT3A 1HRHA 2YV0X 3DI6A 1L5UA 4BE2A 3QEPA 1NJXA 1NOYA 1T8EA 3AVHA 3AVLA 4RW9A 1LV5A 3QO9A 3SJJA 3AO5A 4ID5A 4ZTFA 1FKPA 2BANA 4FLZA 3KD5E 4CF8A 5DK5A 4DQQA 3OS1A 3QETA 3LAKA 4CEAA 1JL2A 1S6PA 4K8ZA 3MXMA 1BIUA 4DQIA 4FLVA 1TV6A 2ZQBA 2G8WA 3QLHA 1CXUA 3U6FA 2OPQA 5KGWA 3P83D 1WAJA 1TL1A 3NF9A 3LAMA 3WNGA 3IAYA 4KI6A 3AO2A 3SQ1A 2RN2A 3OJUA 3HYFA 4BWJA 2FC0A 3V9ZA 1XC9A 3K2PA 3NHGA 1ZYQA 5FRNA 3PV8A 1VSIA 3BGRA 1ZBIA 3HL8A 1NOZA 1CXQA 3ZT0A 4FLWA 2DFHA 1YTUA 4OPJA 4CJSA 4QOZB 4FJNA 4CIFA 2HHUA 1KVAA 2FBYA 4M3RA 4E3SA
chains in the Genus database with same CATH superfamily
4AM7A 3TAGA 1XUPO 3IRXA 3JS6A 1OH7A 2HBKA 4LF8K 2HF3A 1LW2A 3KHYA 3ID8A 4B3RK 1XMOK 4CBWA 1HJRA 2X78A 1VQ5N 3OYLA 2QXLA 2HW3A 4IFVA 1ZXOA 3DYAA 2R7YA 4KB0A 2A1SA 1YI2N 4XH4A 4CEFA 5EOYA 1YJNN 1HNIA 2NRWA 3VEWA 2PYLA 3VA0A 2PY5A 1VSLA 3QINA 2ITMA 1SV5A 4B3MK 2YHYA 2Q31A 4LSNA 3O4QA 1YVNA 1SL1A 4FM1A 1KCFA 1VAZA 5ELZA 3I55N 4OLAA 3CPWM 1IKWA 5C2FA 3SI6A 2A1RA 3AO3A 3OYDA 4EZ9A 3TSPA 4CK3A 3MCPA 4DLEA 5KI6A 3S9HA 2UUBK 3KD1E 3QIPA 2CH6A 1NGDA 4F3OA 3C7NB 3U9ZA 1NKEA 3NE6A 2ZWHA 4B3SK 3SQ0A 1BA1A 4PA1A 3MDQA 2FF6A 5M1OA 2QTDA 3L2RA 1Q9YA 1VQ7N 3CJ1A 4WQ4C 5AZIB 2O8FB 2O8FA 1HR0K 4ELUA 3CD6N 4J2EA 3CCEN 4E89A 4H5WA 3VMFB 5GIPA 3JXUA 2QM1A 4BQLA 3A5LC 3AAPA 4BC3A 2WC9A 2QEXN 3LDQA 4MDAA 3T7ZA 5B8HA 4FW1A 2HHVA 4CJFA 2OA8A 4BC2A 1JCEA 4A5AA 1RT2A 1RT1A 2P9UA 4I6MB 4JAXA 3L2UA 5EY4A 4M3ZA 3O3GA 4C23A 4H03B 3AAQA 4CGFA 3G71N 1RDUA 4OGCA 1T03A 5JS2A 3O80A 1A5XA 3LZJA 1W9HA 1EETA 4F8RA 1KTQA 1VRTA 2XY5A 5EX5A 4B3TK 1E4FT 3ZEUB 2HOEA 3EYZA 3V1RA 1Q18A 4DTRA 4OPHA 3O4WA 3VQCA 4AQYK 3D0PA 1WSFA 4NLBA 1C0TA 4CHPA 1D8YA 5K14A 1A5WA 3H1VX 5C42A 2WBNA 4KTQA 3CMAN 1XHZA 3HSCA 3V9WA 3WXIA 4JD2B 2QI2A 3SMSA 4G1QA 4M45A 4M3XA 3VGKA 1O13A 5HOOA 2YI1A 3SV3A 1U2VA 4AHVA 3T69A 4Z4GA 1YVUA 4BR7A 3ZSZA 2HF4A 1IBMK 4HVJA 4JK8A 4A2BA 3DRSA 1ESVA 3OS2A 2NRHA 3HPOA 1UAXA 1L3SA 3RMAA 4KO0A 4O8KA 4KHUA 5TKWA 4W5TA 2E2OA 3QDKA 3O6WA 4U7BA 3SUQA 1IO2A 4KHWA 3KK2A 3EY1A 1I3AA 4FJ8A 5AQWA 5DM7L 1DLOA 2KKZA 4KHYA 3OY9A 2A6AA 1SL2A 2RF2A 4ILGB 4OGEA 3TSUA 4JHDB 3P4IA 4E7JA 1FXXA 5AQQA 3SBTA 3ZSYA 3RMBA 4GV6A 1HNWK 4GVEA 1XI1A 3WUHA 4JKEA 2YHWA 1EQYA 2OTJN 4MLEA 4DV1K 1YF5L 1IKXA 3HM8A 1RT5A 4DV0K 2ASOA 4CERA 1NGHA 2RPIA 3L0QA 2AP1A 3S3OA 4QS8A 2CH5A 1NK8A 1B92A 4KBOA 1J6ZA 2YHBA 4IKFA 3OYJA 1ZC6A 4E7IA 1YHQN 5E41A 3SPZA 2W41A 2YNHA 3DOKA 1M90O 4IJAA 3OYEA 4E0DA 1KSPA 2X74A 3F9KA 1LWFA 4CJUA 1Q8IA 4N76A 3GL1A 1KQSM 3V81A 4FO0A 2XY8A 4K42A 1VQPN 4K0KK 5LJVA 4GY2B 1F21A 1RBVA 4JI6K 1QQOA 2W40A 1EX4A 2QWNA 4TSXA 2OANA 4BC5A 2OCEA 4B9NA 4CJTA 1NLVA 2Z1IA 1JLQA 3I0RA 2OPRA 1KVAA 4GV9A 2HVIA 1JL1A 3PX6A 3HP6A 1X3NA 3HVRA 1T05A 3DOLA 3SQ4A 1S1TA 4CZMA 4FYDA 1WBDA 3NVKA 3VQEA 3SNNA 2YHAA 4BR2A 1TVRA 1HLUA 3O9SA 3D45A 4AHUA 4FJ7A 3VQ5A 3IFRA 4FK4A 3K5NA 5M1NA 3M8QA 4AHRA 4FVMA 1NJIO 4OVLA 1NU0A 4LFAK 5CZ1A 4KI4A 4B9VA 3QEWA 4CBXA 1N32K 4CZKA 5AQLA 4PQUA 4FJLA 3OYNA 3R8EA 1N8RO 1HYSA 5CY4A 5GIOA 3TI0A 1E4GT 4O0IA 2YHXA 4BWMA 2VCPA 4CFBA 4BDYA 2P5GA 5DMRA 4ISEA 4FLUA 1KRPA 4EFHA 1NKCA 1GLCG 4FWKA 4JKDA 5I9EB 2Y1IA 4H5NA 4EP5A 2Q36A 4Z4HA 2QW9A 4KH4A 4BVOA 4CZJA 2GELA 1IKYA 4YOYA 1RDAA 1WNSA 1QQNA 1RBSA 1YT3A 1EKEA 3AVAA 3WEEB 3JSMA 1VSHA 1XC3A 4OKJA 2IOCA 3EO3A 4DTJA 4CJVA 4H0VB 4DF4A 3VQDA 5KGXA 4BRFA 4B1YB 4JRPA 4YHHK 3CFPA 1BU6O 1HQEA 4H5VA 3ZSRA 3JYTA 4F4KA 5IT9O 1RDDA 5LL6Z 2E20A 2UXCK 2PAVA 5JVGL 4ILHA 4LFCK 2VGMA 1NK0A 4Y1CA 3AA2A 1K8KB 4E7KA 1BA0A 3S3NA 4WE1A 4FWLA 3NCIA 3QNOA 3O3FA 3LPTA 5JLFA 2ASPA 2DFEA 4IJNA 1L5UA 4BE2A 5CR4A 3CJBA 3RSEB 3EL2A 3E9LA 4CJ7A 3QO9A 3VERA 3THWB 3THWA 3ATVA 2A40A 4ZTFA 1FKPA 5LJWA 5AQOA 3LL3A 3CCMN 1JCFA 3MXMA 4FLVA 1TV6A 3VPZA 3WT0A 3HI0A 3U6FA 1WAJA 4DR5K 3OHRA 3A5OC 3D2FA 3OJUA 4XEIA 1XC9A 3V9ZA 3M1FA 3NHGA 4OPJA 4I6MA 2HHUA 4M3RA 4E3SA 2O4IA 4QS9A 4BRQA 1Q82O 4BE1A 5M1QA 3DXKA 4H0OA 4CJLA 2Y1JA 4FJXA 3LM2A 5F2RA 1RT7A 3DWLA 3LP2A 1GLLO 1K6YA 3TABA 5HRRA 1GOCA 3FFKB 3MWTA 2QWPA 5AFUH 4CCHA 4YORA 2G8VA 1SAZA 3VF6A 4CHQA 4GV3A 3FLCO 4CZGA 3OW2M 1KVBA 2GEMA 3P1GA 2HBMA 4WCEL 4ELVA 1JLGA 5AQIA 2V7ZA 2F9TA 3B8AX 1LWCA 1QSYA 3U8XA 2DY4A 1SKWA 1QTMA 5AQYA 1C0UA 3OYCA 3IKMA 4NXNK 1VQ9N 1RBUA 5HRNA 4BROA 4FZZA 4CF9A 1Z25A 4F2RA 2ATQA 2E4LA 3OA9A 2P9NA 4WFAL 4CFDA 5DM6L 4CHOA 4FPAA 2ETJA 4B1VA 1JLCA 1FK9A 3AY9A 3M8PA 1IH7A 4CHYA 3NGIA 4A57A 4PL7A 1QHAA 3TTFA 3RVCA 1BISA 1R59O 2D1KA 2ZE2A 3RR8A 3O9TA 2E1YA 4HTUA 2EWSA 3FFIA 1DEJA 2Q2RA 4NYFA 4Y1DA 1H1VA 4J2BA 4O5BA 2A41A 3OTOK 1U2VB 1FKOA 4E1JA 3UB5A 4DV5K 3SMPA 1U45A 4FZXC 4NYNA 5M1FA 4L3QA 3ZSWA 4DU1A 1BUPA 2D0CA 3K5LA 2NRXA 2E2QA 2Z1JA 4DMNA 5E26A 4N41A 3J80O 3KK7A 5BPNA 1M1KO 4J2DA 4LH5A 4B9LA 3C7NA 3VEZA 2XY7A 1X9SA 3M5RA 4GW6A 4IBNA 2J4RA 3PSFA 3LWMA 1VK0A 2W42A 3P5JA 3N4QA 3VF2A 4GVMA 4I9LA 3N4PA 3SQ2A 1TKDA 1CZBA 4M63C 3CJ7A 5MLCQ 1GLJO 3WEEA 4I7FA 5GAHP 3D2EA 3AA3A 2A42A 4NB4A 1IKVA 3ULDA 2QKKA 4B08A 4YDUC 4C8MA 5H1SQ 3QICA 2B6AA 2ITGA 3VQ7A 2HHHK 3VETA 2P1JA 4CJ5A 4FW2A 2XY6A 3DLLL 4DV7K 4FJJA 3KLFA 1JLBA 3FR0A 1EO1A 3KJVA 1P8ZA 2BTFA 1UA0A 1NJWA 4FWOA 4QCLA 4H0YB 4DG1A 1ATNA 1W2BM 1NJZA 1RDWX 3MN9A 3P38A 3QNNA 4BDPA 3NDKA 2UUAK 4EHTA 5J2NA 2KTQA 3HT3A 2RKIA 3ZYYX 3AV9A 2HVHA 2O8DA 1C1CA 4BGAA 2VWBA 3UE5A 3GG4A 3OYHA 4IFYA 1HPMA 4ISFA 3ATUA 1T6DA 3PO4A 3UKUB 3CETA 3ALYA 3FZLA 1N34K 1WUAA 3PO5A 1LAWA 1SKSA 3DLGA 5C0YA 4FWRA 4FZYA 4GNIA 3DLHA 4DR7K 4C8NA 3QBXA 1S1XA 4DFJA 4M3WA 3L3UA 4YDUA 5FDLA 3FZFA 3HTVA 4CI6A 3SUNA 1RILA 5AQUA 1XNQK 4O44A 3CFRA 3ZSOA 3D2EB 4RW8A 5AZIA 1OH8A 3CC2N 2YNIA 3QEXA 3O9RA 4BG9A 3BP8A 1IG8A 1BCMA 1JLEA 3PLAA 1HNXK 4IWVA 3DJCA 4JN4A 1EWRA 4CEZA 1BGXT 1C1BA 1TK0A 3O9QA 4C8LA 4NXMK 4J8FA 3TAFA 2NZTA 2GUPA 4X66K 1GLEG 4XH5A 4CJPA 3RRGA 4BDZA 1WSHA 1K8KA 1JJ2M 4DR2K 3GDQA 2YKMA 4FK2A 2NRVA 1HPZA 1CZ9A 2NUBA 3M8RA 4JKBA 5BRDA 1LCUA 4OKKA 3VEYA 4GKKK 1WSIA 3CJ9A 4DR6K 5AQXA 1IG9A 1S9EA 5I42A 1QZ6A 4FWNA 5F1XA 4DQSA 1LWEA 2ZD1A 5BRFA 2B4JA 4BR5A 3CI5A 5AFUA 4NCBA 4CGIA 2E88A 4WQ5C 2I5JA 4LH4A 3CQ8A 4DTPA 4FWMA 2FF3B 2FBTA 1TYQB 4JK9A 4DS4A 4KHQA 2KW4A 1RT4A 4KTWA 4H0TB 4LD0A 5J2QA 1VQ6N 4AILC 3L4QA 4EAHD 3IG1A 4MO4A 4CEQA 4BVPA 3QERA 4C8KA 3J8AA 3QBWA 1S3XA 3TANA 3D2FB 3ZSQA 4H5RA 4KHSA 3VGMA 3JAMO 1X9JA 4XH1A 1SUQA 3LWLA 3C94A 4N5SA 3VA3A 2HB5A 1NBWA 1J53A 2JWLA 2WTUA 1KAZA 3R1XA 3MN7A 4Z4CA 3PX4A 2QWLA 3WNHA 3ZCMA 2KZZA 2V52B 4B9MA 3R6MA 1WBBA 3P31A 3H45C 5J2PA 5J2MA 3O8MA 4BR9A 3AA4A 3F73A 4CIGA 4CJKA 3AGKA 1OKJA 4MO5A 4K25A 3V1QA 4IG0A 1BCOA 1S1WA 3T1AA 4DR3K 1QQCA 3L2WA 3CCVN 5BPLA 2HBJA 1X9MA 1NMNA 4JKGA 4EZ6A 2JLEA 3E9OA 2VG6A 2JGUA 2G8FA 1YTAA 3HJFA 4CJEA 3L2QA 3ENOA 1QSLA 4B9SA 2ZJRL 4IO8A 1OH5A 1JKHA 4DCHA 5ADXH 4XIUA 5M1KA 4KH5A 3THXB 4N47A 4CE9A 5HLFA 4YOUA 3H46O 4DTOA 1TKZA 1S72N 1Z6RA 1HNVA 2E6LA 5AQVA 3T1YK 1UA1A 3VENA 3C6UA 4JI1K 2Q0RA 3G6EN 1D9FA 2FSKA 3LM9A 1N36K 5FPMA 4DFKA 1NWKA 3SLCA 4HUFA 1ZBUA 2XO7A 2HBLA 3RRHA 2HHTA 3RMDA 3B6OA 2BGGA 2P9UB 1MU2A 4H4MA 3HK2A 4BE0A 1HNZK 4WQ4A 4HUGA 4Y0WA 2FSNA 5T7BA 4JEPA 4AM6A 3VTHA 3A5NC 3G0ZA 3VQ8A 3VQAA 3SUPA 1VQKN 3OYAA 4CF1A 4FK0A 3HOSA 3LALA 4IFEA 1YUWA 4H4OA 3G25A 4CIEA 3FZKA 3I0SA 1SS6A 3DXMB 4DSKA 3CC7N 5BN9A 2F7TA 3AVKA 3NF6A 2XHBA 1W7AA 4A59A 3V6DA 2IIRA 1E3MA 4CEEA 4BRPA 3W3DA 1K8AO 2HNZA 1C0MA 2OYQA 1K9MO 1RTHA 1Q86O 4FXDA 4NCGA 3EZWA 5EXWA 4EHUA 4OPAA 3CCJN 5KTQA 2HNYA 1ITGA 5JS1A 1Q9XA 2I7PA 3QESA 3WQUA 1HRHA 2YV0X 3DI6A 3AVHA 3AVLA 4RW9A 5ADXA 1LV5A 5FLXO 2BANA 4CF8A 4DQQA 3QETA 3LAKA 1MA9B 4B1WB 4CEAA 2O8DB 1BDGA 3ID6A 3MWPA 1NGIA 3A0IX 3QLHA 5KGWA 4AF1A 1TL1A 3UKRA 3LAMA 2P9LA 3IAYA 2P9LB 3AO2A 3R3LA 2RN2A 4DV6K 3K2PA 1DGKN 3BGRA 4FOEA 4JYAK 1ATRA 4CIFA 1KAXA 1NKBA 2HMPA 3O4NA 2BDPA 2E6MA 3NF7A 4GMJB 3VEXA 3QEVA 5AQTA 5CE3A 1REVA 4BREA 1TAUA 1NGCA 1BI4B 5JLHA 3VQ6A 4W5RA 4IEIA 5HRSA 4H0XB 5KQ8A 4IG3A 3T19A 4I2PA 3C0BA 2KZMA 5CYQA 5C15A 3RR7A 4CGDA 3IMXA 3CQXA 2UU9K 2F8TA 3MECA 5HL7L 4QS7A 4DTNA 2O8EA 4Z0UA 3BY5A 4CZEA 4CK1A 3IUCA 4IZ9A 4L8RB 4I2QA 4O5FA 1C1AA 1J54A 2D0AA 3OYKA 4RW7A 4M7XA 3OBWA 1NK9A 4KKOA 1JCGA 1U04A 3BF1A 4DSIA 1S1VA 5AQHA 1Y97A 4IOXA 4WQ5A 3CYMA 2PZSA 3OBYA 4CESA 4CGHA 1DT9A 4BRIA 4OO1J 4DR1K 2GWKA 5AZJA 3D7EO 3WNFA 3CCQN 2UXBK 1K73O 2PBDA 1TKXA 1WOQA 1DTQA 5AQFA 4BC4A 4DFMA 3WXLA 3NGYA 3ZX3A 4M7YA 1VRUA 3KKRA 3MN6A 3VN5A 1TUUA 2H3GX 2OPSA 4K41A 3VEOA 1TYQA 2Z1GA 3NH2A 3TAQA 4CF2A 4ZTJA 1KC8O 4X64K 4YOWA 4DQRA 4RW4A 3LDNA 3LP3A 2GWJA 2VWKA 1RTIA 3ITHA 4EIAA 4DV4K 1RTDA 3OYFA 4DSEA 4FJ5A 1QVFM 4CEOA 4PKIA 4OX9K 4MLHA 4DFPA 4Z4IA 1X9WA 2LSNA 3NH0A 3AARA 2G8HA 3BZCA 1BO5O 4Z4FA 3TWHA 4B1UB 3SUOA 3CG7A 4J2AA 1B9FA 3H6EA 4H8KA 3MX5A 5KPRA 1ASUA 1VQNN 3AVBA 2V7YA 3SZ2A 1TUYA 1D4XA 3RSEA 2VG5A 4HWIA 3CF5L 4LF7K 3AO4A 3KLHA 3TAEA 2UYTA 5EVZA 4KAZA 2P9PB 4CFAA 3DXMA 1QHTA 3C6TA 1WSGA 3EE9A 2D0PA 3D6RA 4FWPA 3ZETA 4EP4A 1SL0A 1N6QA 1YXQA 3C6HA 5GAGP 3V9UA 1VQMN 3SCXA 2YKNA 1OVQA 4BRLA 3HOTA 4JS5A 4BRDA 3EZ5A 1QVGM 3KIOA 1RTJA 3ISNC 1MWMA 2BH1A 2FLOA 3P39A 3VQ9A 2FBVA 1KAYA 3SAHA 2IC3A 2VGNA 1ZBSA 2HHQA 4BY9C 4LF6K 1EWQA 3EKUA 2FXUA 3ZSVA 1T7PA 4U67L 3SAGA 3TARA 3AVGA 1KXPA 4LSLA 3T3FA 4F3TA 4LF5K 5KPZA 3IS9A 2CGKA 4HCBA 2X6NA 5BRHA 4JKCA 1DKGD 1TL3A 2F96A 1VQ8N 5JICA 1BL3A 4IDHA 2E5LK 4CGJA 4JK7A 4KB1A 2IVPA 2D4WA 4FCYA 4BRMA 4JI4K 2P9KB 3MX2A 5TKYA 4IOCL 5SWMA 4RCHA 1Q81O 2VWJA 4CJRA 3K57A 1Y64A 4PKGA 1L3TA 4ICLA 4KTZA 3L3VA 3V9SA 4FJKA 1YJ9N 3HZ6A 4DKWA 1KFSA 4FLYA 3BZKA 4YY3K 4E1NA 3J81O 5SZTA 3QMLA 5FROA 1NGJA 3ZT1A 1LAVA 4OKEA 4PWDA 4BRAA 3EN9A 3DLEA 3DLRA 5AR0A 3CHWA 1JXEA 3CJCA 3HM9A 4JI7K 1NK5A 4NLCA 1DTTA 2ZGZA 1YIJN 5GADP 4CZLA 1Q7YO 1RBTA 1TKTA 2ZGYA 2DTUA 4FLXA 3J7AP 3VOVA 1XHXA 3ENBA 1TGOA 3L2VA 4B9UA 1RDBA 3FZHA 4E19A 1WSEA 4DHYA 1ZBFA 3H08A 2W6LA 3TSQA 5AZJB 2QWOA 1BHLA 1JLFA 3VEVA 5FPEA 3ULEA 3KKSA 1KVCA 4FL9A 3CC4N 1HKGA 4KH6A 3UKUA 3OYIA 4RG8A 4A2AA 5AQKA 2P9IB 3NAEA 1NK6A 1BI4A 3ENHA 2KLAA 1BQNA 1HJOA 1FW6A 2Q1NA 4E1MA 3CXCM 4HCCA 1D5AA 1IBKK 4DSFA 1QSSA 3BEXA 4ID1A 4O0JA 2PFUA 4X65K 3LANA 3TR8A 2HHXA 3PY8A 1RCHA 1R0AA 2Q3SA 1W97L 2WFBA 3A5MC 4MQ3A 2HSTA 4M42A 3O9UA 4WYBA 2NNWA 3QFUA 3OS0A 2HHWA 2Q0UA 4W5OA 1KLMA 3E9PA 4B8AB 3I8DA 3TU5A 4MDBA 1XQSC 3GBTA 4JKAA 4BRHA 3AVNA 2JWKA 4JI5K 4OLBA 4X62K 5HROA 4ELTA 3AVJA 1XMQK 1CZAN 2UXDK 1I94K 2O4GA 5IWAK 4CECA 3KLIA 5C25A 2E8AA 1EXQA 1BQMA 4A5BA 2AJQA 4FJHA 2CGJA 4FM2A 3KVGA 4PUOA 2IAJA 4F2SA 3CCRN 4B3OA 4PY5A 3LDPA 4HUEA 3F5TA 2G8IA 2NRRA 3DAWA 1A5VA 2DPNA 3OYMA 2NLXA 2P9IA 4JI2K 3BF3A 4JI0K 4KREA 1NGFA 4DS5A 3DRRA 2GTDA 2G8KA 4C8OA 4OJRA 3THYB 4CJQA 4CZHA 4JKHA 1GLBG 5AQMA 4Q0BA 4CGGA 3AO1A 3PIOL 4DSLA 1BIZA 3OYBA 1KLNA 4DSJA 3M8SA 4A62A 1IBLK 2F9WA 3K9JA 3H3NO 5D3GA 4FWSA 4DTMA 4DTUA 3B6PA 4CJ3A 1WLJA 2D0BA 4NCAA 3DLBA 2P9KA 4DLGA 1VSJA 2O8BB 3UKRB 1W0HA 2O8BA 2GV9A 3KK3A 3ZT3A 1BOTO 3QEPA 5BN8A 1NJXA 4DV2K 1T8EA 3ZETB 1RGIA 1T3VA 3SJJA 5JVHL 2UUCK 2P9PA 3R9PA 3KD5E 4DV3K 5LMNK 1SQKA 1JL2A 4C1NK 1HUXA 4JD2A 4CZIA 5BPMA 3NF9A 3F2KA 3MK6A 4KI6A 3SQ1A 1ZYQA 5FRNA 3PV8A 1VSIA 3TTCA 3HL8A 1S22A 3THXA 4Z94A 4QOZB 4FLWA 2KHOA 2FBYA 3CCUN 4NO7A 1S5JA 2IS3A 3MEDA 3CQYA 4PKHA 5EU7A 1SKRA 4M3YA 3ASMA 3DXKB 1NK4A 4FVUA 2O8EB 5AQRA 3SJHA 4C1NI 3C95A 5J1EA 4FJMA 3VQQA 3EE8A 5GINA 3MXIA 4O8UA 1U49A 3FE1A 3K59A 1RT3A 4BRKA 1ATSA 1NNEA 1HMVA 5M1PA 4CEDA 3SK3A 3G10A 3VQPA 3V4IA 4KRFA 4RWTA 2FSJA 4KHPK 3EKSA 1BG3A 2WOMA 4JHDA 4B9TA 4CEBA 5FPDA 3VTIA 2ZJPL 4DU4A 4CHZA 2XRIA 2YNFA 1NMDA 2KFZA 5AQGA 2IGIA 4JI3K 1YJWN 4W5NA 2P9NB 1ZBLA 1GLAG 2YNGA 4LC9B 2WONA 1WB9A 3WXMB 1C6VA 4YNQA 3PIPL 2Z1HA 4LF4K 3KLEA 2ZF5O 2OTLN 4IEEA 3OYGA 2WUSA 4R5PA 4JRQA 5A2QO 1NK7A 3VGLA 4KHNA 1QZ5A 1CLQA 4AHSA 3U4LA 4CD1A 4CVNE 4OPKA 3LDSA 3HPGA 5KQDA 3C65A 1NJYA 1N33K 3DM2A 5AQPA 3NBPA 4H0PA 2RHKA 3DMJA 4MFBA 2A3ZA 4DTSA 1NGAA 3CM6A 2P9SB 4LY7A 4PHTX 5CZ2A 3K0SA 4JNEA 2QK9A 2KFNA 5LY3A 3AVCA 3T1HK 5KRSA 2QKBA 4FJ9A 3HPHA 3Q7BA 1V4SA 5BR9A 4E7LA 1NM1A 4KPYA 3BUZB 5GAEP 4BACA 3AVMA 1C0GA 3LP1A 3QIOA 4KFBA 3CFOA 4HHTA 4IXCA 1YAGA 3NGZA 4YOXA 2E2PA 1QE1A 4ZHRA 1L3UA 3THVA 2NRTA 4JV5K 1G99A 4DQ8A 1J5OA 1IJJA 4CBUA 4RW6A 4BQZA 1VQ4N 4DUYK 1VHXA 2IDOA 5KPTA 4DWIA 1Z26A 4BRCA 2BE2A 3QB0A 1BWFO 2PYJA 3MMVA 1ASWA 5FRMA 1U47A 4WF9L 1UOCA 3FGUA 1TK5A 4Z4EA 3PSIA 1FJGK 1HYZA 2ZM6K 4WFNL 2A5XA 3KWGA 1RBRA 3ULEB 3TTDA 5I3UA 3BDPA 3ZSXA 3K9KA 1WSJA 2P51A 3SPYA 3AVFA 4FOIA 5C24A 1KFDA 4O4GA 5C12A 4B1XB 5BR8K 1P90A 3HO1A 1VSEA 2GX9A 4M41A 3VF4A 3UIQA 1B9DA 1EP4A 3H3OB 4E7HA 1L3VA 1RFQA 1VQON 2KQ2A 4A61A 3E1YA 1VSMA 1VSFA 4FJGA 3F9MA 3W0LA 3WXKA 3MAQA 2VQEK 3NFAA 4ISGA 3RMCA 3C6AA 4DQPA 4JI8K 3L6QA 4Q5VA 5AQSA 1KD1O 5HP1A 3A2FA 3WQTA 2IVNA 4BRGA 5AQZA 5C10A 3I56N 3HP9A 3LZIA 3NF8A 3S41A 3A8YA 3HRGA 3AVIA 3HSTB 3AA5X 2E1ZA 2BUPA 3MEGA 4AH9A 1QS4A 3IDHA 4WFBL 1WN7A 3TPQA 4BRNA 5FPNA 3THYA 4YOTA 2RE2A 3WNEA 3NH1A 5HRPA 1NGEA 3H1QA 3J7YP 1IV0A 1G15A 3G4SN 4V19S 2ASMA 5AQJA 2I7NA 1T44A 3VQ4A 2EHGA 4K8XA 2DFFA 1VQLN 4ILJA 3GOIA 1GLDG 3OVNA 1ZBHA 4CFCA 2QXFA 1HX1A 1HQUA 3E01A 3MEEA 5CYMA 3TAMA 1GLFO 3I33A 1RNHA 2VG7A 1SZ2A 1X1PA 2YX6A 4DU3A 2QA4N 2O8CB 5E84A 1GOAA 2GBZA 3KK1A 4G9ZA 3M3ZA 1JXBA 3TAPA 3DLKA 1GOBA 3LP0A 4I9QA 1U48A 3CCLN 4CHNA 3GE1A 3CIPA 2YJFA 3E66A 1O1WA 2HNDA 3VQBA 4CJWA 2V51B 2OZSA 3CJAA 1WAFA 3QFPA 5AQNA 3U3GA 3MN5A 1XNRK 1J5EK 5HBMA 4FM0A 3NVMA 3CPEA 2QWRA 1NG9A 2D5RA 3RWUA 4DUZK 5C2DA 3ZLJA 3M6GA 1OVYA 4FSVA 3MXJA 2QWMA 3HBTA 1V4TA 4LFBK 1HYVA 4FWQA 4IDKA 3ZEUA 4R79A 2HMIA 1S1UA 3SBGA 3PUFA 4N56A 5LMUK 4QAGA 2F4VK 3L8BA 1U6ZA 3CM5A 4CJ4A 5KRTA 4CD3A 1YITN 4W5QA 3KZBA 4AHCA 3PX0A 2G8UA 1OH6A 3CMEN 2OPPA 1UWBA 4IOAL 1HKBA 4JKGB 4M3UA 1I39A 1TAQA 3ZX2A 1VSDA 3LDOA 2F8SA 1XWLA 1N5YA 4CF0A 2E2NA 1JLAA 3MCAB 1ILYA 4F9OA 3K5OA 5BREA 4DB3A 2GUIA 3O3HA 4RTFD 2QWQA 5F0XA 2CGLA 3NMUA 2O8CA 4B8CA 3EEQA 4M3TA 4AHTA 3O08A 3O5BA 4GKJK 4O55A 1VSKA 3SV4A 1U4BA 2ZJQL 3KTQA 3HXMA 4JKFA 3V1OA 1T6CA 3QEIA 3S3MA 4CK2A 1S9GA 4KV8A 3I8BA 3HVTA 1ASVA 3CCSN 4K43A 2HHSA 1NGGA 1MWKA 3DRPA 3U9DA 2EX3A 1D9DA 4DR4K 3K58A 4DTXA 3K5MA 4FJIA 2X6SA 3FZMA 2YCHA 4BR0A 4FLTA 4HTLA 5CHIA 4H5TA 1MDUB 4BR4A 2W6KA 3V9XA 4B1ZA 3KWIA 4BGBA 3LDLA 1S6QA 2Q97A 4UY8O 4JS4A 3CERA 1LOTB 2FBXA 3O1BA 1J9AA 2B5JA 4YOVA 1LW0A 3VESA 2VQFK 3KLGA 4DF8A 3WXJA 1C0FA 3J7ZO 3Q7CA 4UQGA 3OJSA 4BG8A 4JLHA 2IVOA 3RTVA 3ZT2A 1RT6A 2P5OA 2AA4A 2OZMA 3SYZA 1TK8A 4YFUA 1RDCA 4FPBA 3LPUA 1HKCA 3ZT4A 3U3YA 3O1WA 4IO9L 3ZX0A 1NOYA 4LF9K 3AO5A 4ID5A 5AJ3K 4FLZA 2YJEA 5DK5A 1X3MA 3OS1A 1S6PA 4K8ZA 1BIUA 4DQIA 2NRZA 2ZQBA 2VYPA 4CW7B 2G8WA 1NGBA 1CXUA 2OPQA 3AGRA 3L4IA 3P83D 4PL8A 3WNGA 3HYFA 4BWJA 2FC0A 4CZFA 3SAFA 2P9SA 1Z05A 4B9QA 1NOZA 1CXQA 3ZT0A 2DFHA 1YTUA 4CJSA 4FJNA 5JMVA 1QQMA 1ZBIA 2D0OA
chains in the Genus database with same CATH topology
2O4IA 1S5JA 2IS3A 3MEDA 3O4NA 4BE1A 3TAGA 2BDPA 5EU7A 2E6MA 3NF7A 4GMJB 1SKRA 4M3YA 3ASMA 3IRXA 3QEVA 1REVA 1NK4A 1TAUA 4CJLA 2Y1JA 4FJXA 1BI4B 1LW2A 1RT7A 3LP2A 3C95A 1K6YA 5J1EA 3TABA 4FJMA 3VQ6A 5HRRA 1GOCA 3VQQA 4W5RA 4CCHA 5HRSA 2G8VA 3MXIA 4CHQA 1HJRA 2X78A 1U49A 4IG3A 3OYLA 3T19A 3K59A 2HW3A 1RT3A 4IFVA 4I2PA 1KVBA 3DYAA 5CYQA 2KZMA 2R7YA 1HMVA 3P1GA 2A1SA 3RR7A 4KB0A 4CEFA 4CEDA 4CGDA 4ELVA 3G10A 1HNIA 3VQPA 3V4IA 4KRFA 1JLGA 2PYLA 2F8TA 3VA0A 2PY5A 3MECA 1VSLA 3QINA 1SV5A 2WOMA 1LWCA 1QSYA 2DY4A 1SKWA 4B9TA 1QTMA 4DTNA 2HHXA 4CEBA 4Z0UA 4LSNA 1C0UA 3OYCA 3O4QA 4DU4A 4CHZA 2XRIA 2YNFA 4CK1A 1SL1A 4FM1A 2KFZA 1KCFA 4L8RB 4I2QA 1RBUA 5HRNA 4OLAA 4FZZA 2IGIA 4CF9A 1C1AA 1IKWA 1J54A 2D0AA 3OYKA 1Z25A 4RW7A 4F2RA 2ATQA 2E4LA 3SI6A 3AO3A 4KKOA 3OYDA 2A1RA 2YNGA 4CK3A 2WONA 1ZBLA 4EZ9A 4CFDA 1U04A 1C6VA 4CHOA 4YNQA 1S1VA 2ETJA 1Y97A 1JLCA 1FK9A 2Z1HA 3CYMA 5KI6A 2PZSA 3KLEA 4CESA 3S9HA 3M8PA 4CGHA 1IH7A 4CHYA 3NGIA 3KD1E 3QIPA 3OYGA 4R5PA 1BISA 4JRQA 2ZE2A 1NK7A 3RR8A 4F3OA 4KHNA 3WNFA 4HTUA 1NKEA 3FFIA 1CLQA 4AHSA 3NE6A 1TKXA 4OPKA 1DTQA 4DFMA 3LDSA 4NYFA 3HPGA 1NJYA 4Y1DA 3NGYA 4J2BA 4O5BA 1FKOA 3DM2A 1VRUA 1U45A 3KKRA 3NBPA 3SQ0A 4FZXC 4NYNA 4PA1A 3DMJA 4MFBA 3VN5A 3ZSWA 4DU1A 3L2RA 1Q9YA 2OPSA 4DTSA 2D0CA 2Z1GA 3CM6A 3K5LA 3NH2A 3TAQA 4LY7A 4CF2A 2Z1JA 5CZ2A 4DMNA 4ELUA 4N41A 4ZTJA 1NKBA 4DQRA 4J2EA 4RW4A 4J2DA 2QK9A 4E89A 4LH5A 4B9LA 2KFNA 3LP3A 2VWKA 3AVCA 2XY7A 1X9SA 1RTIA 3ITHA 5KRSA 2QKBA 4GW6A 1RTDA 4IBNA 3HPHA 4FJ9A 3LWMA 4E7LA 1VK0A 2W42A 3P5JA 3OYFA 4FW1A 4KPYA 4DSEA 4FJ5A 4CEOA 4BACA 4GVMA 4I9LA 4CJFA 3AVMA 4DFPA 3QIOA 3LP1A 4KFBA 1X9WA 2OA8A 2LSNA 3NH0A 4Z4IA 3SQ2A 1TKDA 1CZBA 3CFOA 4HHTA 2G8HA 1RT2A 1RT1A 3NGZA 4I7FA 4Z4FA 3AA3A 3TWHA 3SUOA 1QE1A 3CG7A 4ZHRA 3L2UA 1L3UA 3THVA 4J2AA 4M3ZA 3O3GA 1B9FA 1IKVA 4H8KA 3ULDA 4CGFA 1J5OA 2QKKA 4B08A 4RW6A 4OGCA 1ASUA 4C8MA 2B6AA 5JS2A 1T03A 1A5XA 3AVBA 3LZJA 2ITGA 3VQ7A 1W9HA 3SZ2A 2IDOA 2P1JA 1EETA 4CJ5A 4F8RA 1KTQA 1VRTA 4FW2A 2XY5A 2XY6A 4DWIA 1Z26A 2VG5A 4FJJA 2BE2A 2PYJA 3KLFA 1JLBA 1ASWA 3AO4A 3KLHA 3EYZA 3TAEA 3V1RA 5FRMA 3KJVA 1U47A 4KAZA 4CFAA 4DTRA 1UOCA 1UA0A 1NJWA 1QHTA 3VQCA 1TK5A 3C6TA 4QCLA 4DG1A 4Z4EA 1WSGA 1NJZA 3D0PA 3QNNA 1WSFA 4CHPA 1C0TA 4BDPA 1D8YA 4EP4A 1HYZA 5K14A 4DLEA 3NDKA 1SL0A 1N6QA 1A5WA 3V9UA 5J2NA 2KTQA 3HT3A 2RKIA 5C42A 4KTQA 1RBRA 3SCXA 2YKNA 3AV9A 1XHZA 5I3UA 2HVHA 1C1CA 4JS5A 3EZ5A 3OYHA 3V9WA 3KIOA 4IFYA 1RTJA 3BDPA 3ISNC 3ZSXA 4G1QA 4M45A 4M3XA 1WSJA 2P51A 3PO4A 3VQ9A 2FBVA 3SV3A 3SPYA 2IC3A 3AVFA 4AHVA 2HHQA 5C24A 3ALYA 1KFDA 4O4GA 4W5NA 3ZSVA 1T7PA 4Z4GA 1YVUA 3PO5A 3ZSZA 1LAWA 1SKSA 3DLGA 3HO1A 4FZYA 1VSEA 3TARA 3DLHA 3AVGA 4C8NA 4LSLA 3T3FA 4F3TA 4HVJA 4M41A 1S1XA 3UIQA 1B9DA 1EP4A 4E7HA 1L3VA 4DFJA 3DRSA 3OS2A 3IS9A 4M3WA 2KQ2A 3L3UA 5FDLA 3HPOA 1UAXA 1L3SA 1VSMA 1VSFA 4FJGA 4HCBA 2X6NA 3SUNA 3MAQA 3RMAA 4KO0A 1TL3A 2F96A 1RILA 3NFAA 4KHUA 4W5TA 3RMCA 4DQPA 4O44A 4Q5VA 3CFRA 1BL3A 4CGJA 3ZSOA 4KB1A 4RW8A 3SUQA 1IO2A 3A2FA 3KK2A 3EY1A 5HP1A 4KHWA 3LZIA 3HP9A 4FCYA 3NF8A 1I3AA 2YNIA 4FJ8A 3QEXA 3AVIA 1DLOA 3HSTB 3AA5X 4KHYA 1BCMA 1JLEA 3MEGA 3OY9A 4AH9A 1SL2A 4CEZA 5SWMA 1BGXT 2RF2A 4OGEA 1QS4A 2VWJA 1WN7A 1C1BA 4E7JA 1TK0A 1FXXA 4CJRA 1NK9A 4C8LA 3K57A 3ZSYA 3WNEA 1L3TA 3RMBA 4ICLA 4KTZA 3L3VA 3V9SA 3TAFA 4FJKA 3NH1A 5HRPA 4CJPA 3RRGA 4BDZA 1WSHA 1XI1A 1KFSA 4FLYA 4E1NA 5SZTA 2YKMA 4FK2A 1G15A 1HPZA 1CZ9A 5FROA 2NUBA 1IKXA 3M8RA 1RT5A 3VQ4A 3ZT1A 2EHGA 1LAVA 4K8XA 4OKEA 2DFFA 4CERA 3OVNA 4OKKA 4DSIA 1ZBHA 4PWDA 4CFCA 2RPIA 2HHVA 1WSIA 2QXFA 3DLRA 3DLEA 1IG9A 1JXEA 3HM9A 1HQUA 3S3OA 1S9EA 5I42A 3E01A 3MEEA 1NK5A 5CYMA 3TAMA 1DTTA 1NK8A 4DQSA 1RNHA 2ZD1A 1LWEA 1B92A 2VG7A 1X1PA 1RBTA 2B4JA 1TKTA 2YHBA 3OYJA 4DU3A 4IKFA 4E7IA 5E41A 4NCBA 3SPZA 2DTUA 4CGIA 2YNHA 3DOKA 4FLXA 1XHXA 2I5JA 4LH4A 1GOAA 3OYEA 1TGOA 2GBZA 3KK1A 2X74A 3F9KA 1LWFA 4CJUA 3L2VA 1Q8IA 3CQ8A 4DTPA 2FBTA 4B9UA 1RDBA 4N76A 3V81A 4E19A 4DS4A 4KHQA 1WSEA 2XY8A 2KW4A 1JXBA 3TAPA 1RT4A 3DLKA 1ZBFA 3H08A 4KTWA 1KSPA 1F21A 1GOBA 1RBVA 3LP0A 4I9QA 1U48A 4CHNA 1EX4A 4LD0A 5J2QA 1BHLA 1JLFA 3KKSA 1KVCA 4AILC 1O1WA 3IG1A 2HNDA 4TSXA 3VQBA 4CEQA 4CJWA 4B9NA 4CJTA 2OZSA 2Z1IA 1JLQA 3I0RA 2OPRA 3QERA 1WAFA 3U3GA 4C8KA 3OYIA 3TANA 2HVIA 4RG8A 3ZSQA 1JL1A 3PX6A 5HBMA 4KHSA 4FM0A 3HP6A 3LWLA 1SUQA 3C94A 4N5SA 3HVRA 1T05A 3VA3A 2HB5A 3NAEA 1J53A 1NK6A 1BI4A 3DOLA 3SQ4A 2D5RA 3RWUA 1BQNA 1S1TA 4Z4CA 3PX4A 4FYDA 3WNHA 3ZCMA 3MXJA 4FXDA 3VQEA 4B9MA 2KZZA 4E1MA 5J2PA 3SNNA 1HYVA 4IDKA 4HCCA 5J2MA 2YHAA 1D5AA 1TVRA 2HMIA 1S1UA 4DSFA 3AA4A 3F73A 1QSSA 3PUFA 3D45A 4ID1A 4O0JA 4AHUA 4CIGA 4CJKA 4N56A 4FJ7A 4QAGA 3LANA 3VQ5A 3L8BA 3CM5A 3TR8A 3V1QA 4CJ4A 4IG0A 1RCHA 1BCOA 5KRTA 3PY8A 1S1WA 3K5NA 1R0AA 4FK4A 2Q3SA 3M8QA 4AHRA 3T1AA 4FVMA 4W5QA 1QQCA 4AHCA 3L2WA 3PX0A 4OVLA 1X9MA 5CZ1A 2G8UA 4KI4A 4MQ3A 4B9VA 2OPPA 1UWBA 3QEWA 4M42A 4EZ6A 2JLEA 4M3UA 1I39A 2VG6A 4PQUA 1TAQA 2JGUA 3OS0A 2G8FA 1VSDA 4FJLA 2HHWA 2F8SA 3OYNA 1XWLA 1N5YA 1YTAA 3HJFA 4CJEA 4W5OA 1HYSA 1KLMA 4CF0A 5CY4A 1JLAA 4B8AB 3TI0A 3L2QA 4O0IA 3I8DA 4BWMA 3K5OA 2GUIA 3O3HA 1QSLA 4B9SA 4CFBA 1JKHA 3AVNA 4XIUA 4BDYA 2P5GA 4N47A 4CE9A 4OLBA 5HLFA 5DMRA 4DTOA 1TKZA 5HROA 4B8CA 4ELTA 3AVJA 4FLUA 1KRPA 1HNVA 2E6LA 4M3TA 4AHTA 1UA1A 1NKCA 3C6UA 2O4GA 4CECA 3KLIA 2Y1IA 5C25A 4EP5A 4O55A 1D9FA 1EXQA 1VSKA 1BQMA 4Z4HA 3SV4A 4DFKA 1U4BA 3KTQA 3HXMA 4FJHA 3V1OA 4HUFA 2AJQA 1ZBUA 2XO7A 3RRHA 4FM2A 2HHTA 1IKYA 3QEIA 3S3MA 2IAJA 1S9GA 4CK2A 4F2SA 4PUOA 4KV8A 1RDAA 3RMDA 1WNSA 3B6OA 2BGGA 4B3OA 3HVTA 1ASVA 4PY5A 1RBSA 1YT3A 1EKEA 3AVAA 1MU2A 2HHSA 4H4MA 3HK2A 3JSMA 4HUEA 4BE0A 1VSHA 3DRPA 2G8IA 2EX3A 1D9DA 3K58A 4DTXA 3K5MA 4HUGA 1A5VA 5T7BA 4OKJA 3OYMA 2IOCA 2X6SA 4FJIA 4DTJA 4FLTA 3G0ZA 4CJVA 3VQ8A 3VQAA 3SUPA 3OYAA 4E0DA 4KREA 4DF4A 4DS5A 3VQDA 3DRRA 5KGXA 2G8KA 4CF1A 4C8OA 4OJRA 3V9XA 4FK0A 4CJQA 3LALA 4JRPA 1S6QA 4H4OA 3CFPA 4JS4A 1HQEA 3ZSRA 4Q0BA 4CIEA 2FBXA 1J9AA 3I0SA 2B5JA 4CGGA 4DSKA 3AO1A 3JYTA 3AVKA 3NF6A 4DSLA 2XHBA 4F4KA 1RDDA 1BIZA 1LW0A 3OYBA 1KLNA 4DSJA 3M8SA 3V6DA 4CEEA 3KLGA 4DF8A 1NK0A 2HNZA 1C0MA 4Y1CA 2OYQA 3AA2A 1RTHA 5D3GA 4E7KA 4UQGA 3OJSA 4JLHA 4DTMA 3S3NA 3RTVA 4DTUA 3ZT2A 3B6PA 4NCGA 4CJ3A 1WLJA 1RT6A 2D0BA 4WE1A 3DLBA 2P5OA 4NCAA 3NCIA 4DLGA 3QNOA 1VSJA 3O3FA 3SYZA 2OZMA 5KTQA 1W0HA 1TK8A 2HNYA 1ITGA 4YFUA 1RDCA 3LPTA 1Q9XA 5JS1A 3LPUA 2GV9A 3QESA 3ZT4A 3U3YA 2DFEA 3KK3A 3ZT3A 1HRHA 2YV0X 3DI6A 1L5UA 4BE2A 3QEPA 1NJXA 1NOYA 1T8EA 3AVHA 3AVLA 4RW9A 1LV5A 3QO9A 3SJJA 3AO5A 4ID5A 4ZTFA 1FKPA 2BANA 4FLZA 3KD5E 4CF8A 5DK5A 4DQQA 3OS1A 3QETA 3LAKA 4CEAA 1JL2A 1S6PA 4K8ZA 3MXMA 1BIUA 4DQIA 4FLVA 1TV6A 2ZQBA 2G8WA 3QLHA 1CXUA 3U6FA 2OPQA 5KGWA 3P83D 1WAJA 1TL1A 3NF9A 3LAMA 3WNGA 3IAYA 4KI6A 3AO2A 3SQ1A 2RN2A 3OJUA 3HYFA 4BWJA 2FC0A 3V9ZA 1XC9A 3K2PA 3NHGA 1ZYQA 5FRNA 3PV8A 1VSIA 3BGRA 1ZBIA 3HL8A 1NOZA 1CXQA 3ZT0A 4FLWA 2DFHA 1YTUA 4OPJA 4CJSA 4QOZB 4FJNA 4CIFA 2HHUA 1KVAA 2FBYA 4M3RA 4E3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O4I A;  1S5J A;  2IS3 A;  3MED A;  3O4N A;  4BE1 A;  3TAG A;  2BDP A;  5EU7 A;  2E6M A;  3NF7 A;  4GMJ B;  1SKR A;  4M3Y A;  3ASM A;  3IRX A;  3QEV A;  1REV A;  1NK4 A;  1TAU A;  4CJL A;  2Y1J A;  4FJX A;  1BI4 B;  1LW2 A;  1RT7 A;  3LP2 A;  3C95 A;  1K6Y A;  5J1E A;  3TAB A;  4FJM A;  3VQ6 A;  5HRR A;  1GOC A;  3VQQ A;  4W5R A;  4CCH A;  5HRS A;  2G8V A;  3MXI A;  4CHQ A;  1HJR A;  2X78 A;  1U49 A;  4IG3 A;  3OYL A;  3T19 A;  3K59 A;  2HW3 A;  1RT3 A;  4IFV A;  4I2P A;  1KVB A;  3DYA A;  5CYQ A;  2KZM A;  2R7Y A;  1HMV A;  3P1G A;  2A1S A;  3RR7 A;  4KB0 A;  4CEF A;  4CED A;  4CGD A;  4ELV A;  3G10 A;  1HNI A;  3VQP A;  3V4I A;  4KRF A;  1JLG A;  2PYL A;  2F8T A;  3VA0 A;  2PY5 A;  3MEC A;  1VSL A;  3QIN A;  1SV5 A;  2WOM A;  1LWC A;  1QSY A;  2DY4 A;  1SKW A;  4B9T A;  1QTM A;  4DTN A;  2HHX A;  4CEB A;  4Z0U A;  4LSN A;  1C0U A;  3OYC A;  3O4Q A;  4DU4 A;  4CHZ A;  2XRI A;  2YNF A;  4CK1 A;  1SL1 A;  4FM1 A;  2KFZ A;  1KCF A;  4L8R B;  4I2Q A;  1RBU A;  5HRN A;  4OLA A;  4FZZ A;  2IGI A;  4CF9 A;  1C1A A;  1IKW A;  1J54 A;  2D0A A;  3OYK A;  1Z25 A;  4RW7 A;  4F2R A;  2ATQ A;  2E4L A;  3SI6 A;  3AO3 A;  4KKO A;  3OYD A;  2A1R A;  2YNG A;  4CK3 A;  2WON A;  1ZBL A;  4EZ9 A;  4CFD A;  1U04 A;  1C6V A;  4CHO A;  4YNQ A;  1S1V A;  2ETJ A;  1Y97 A;  1JLC A;  1FK9 A;  2Z1H A;  3CYM A;  5KI6 A;  2PZS A;  3KLE A;  4CES A;  3S9H A;  3M8P A;  4CGH A;  1IH7 A;  4CHY A;  3NGI A;  3KD1 E;  3QIP A;  3OYG A;  4R5P A;  1BIS A;  4JRQ A;  2ZE2 A;  1NK7 A;  3RR8 A;  4F3O A;  4KHN A;  3WNF A;  4HTU A;  1NKE A;  3FFI A;  1CLQ A;  4AHS A;  3NE6 A;  1TKX A;  4OPK A;  1DTQ A;  4DFM A;  3LDS A;  4NYF A;  3HPG A;  1NJY A;  4Y1D A;  3NGY A;  4J2B A;  4O5B A;  1FKO A;  3DM2 A;  1VRU A;  1U45 A;  3KKR A;  3NBP A;  3SQ0 A;  4FZX C;  4NYN A;  4PA1 A;  3DMJ A;  4MFB A;  3VN5 A;  3ZSW A;  4DU1 A;  3L2R A;  1Q9Y A;  2OPS A;  4DTS A;  2D0C A;  2Z1G A;  3CM6 A;  3K5L A;  3NH2 A;  3TAQ A;  4LY7 A;  4CF2 A;  2Z1J A;  5CZ2 A;  4DMN A;  4ELU A;  4N41 A;  4ZTJ A;  1NKB A;  4DQR A;  4J2E A;  4RW4 A;  4J2D A;  2QK9 A;  4E89 A;  4LH5 A;  4B9L A;  2KFN A;  3LP3 A;  2VWK A;  3AVC A;  2XY7 A;  1X9S A;  1RTI A;  3ITH A;  5KRS A;  2QKB A;  4GW6 A;  1RTD A;  4IBN A;  3HPH A;  4FJ9 A;  3LWM A;  4E7L A;  1VK0 A;  2W42 A;  3P5J A;  3OYF A;  4FW1 A;  4KPY A;  4DSE A;  4FJ5 A;  4CEO A;  4BAC A;  4GVM A;  4I9L A;  4CJF A;  3AVM A;  4DFP A;  3QIO A;  3LP1 A;  4KFB A;  1X9W A;  2OA8 A;  2LSN A;  3NH0 A;  4Z4I A;  3SQ2 A;  1TKD A;  1CZB A;  3CFO A;  4HHT A;  2G8H A;  1RT2 A;  1RT1 A;  3NGZ A;  4I7F A;  4Z4F A;  3AA3 A;  3TWH A;  3SUO A;  1QE1 A;  3CG7 A;  4ZHR A;  3L2U A;  1L3U A;  3THV A;  4J2A A;  4M3Z A;  3O3G A;  1B9F A;  1IKV A;  4H8K A;  3ULD A;  4CGF A;  1J5O A;  2QKK A;  4B08 A;  4RW6 A;  4OGC A;  1ASU A;  4C8M A;  2B6A A;  5JS2 A;  1T03 A;  1A5X A;  3AVB A;  3LZJ A;  2ITG A;  3VQ7 A;  1W9H A;  3SZ2 A;  2IDO A;  2P1J A;  1EET A;  4CJ5 A;  4F8R A;  1KTQ A;  1VRT A;  4FW2 A;  2XY5 A;  2XY6 A;  4DWI A;  1Z26 A;  2VG5 A;  4FJJ A;  2BE2 A;  2PYJ A;  3KLF A;  1JLB A;  1ASW A;  3AO4 A;  3KLH A;  3EYZ A;  3TAE A;  3V1R A;  5FRM A;  3KJV A;  1U47 A;  4KAZ A;  4CFA A;  4DTR A;  1UOC A;  1UA0 A;  1NJW A;  1QHT A;  3VQC A;  1TK5 A;  3C6T A;  4QCL A;  4DG1 A;  4Z4E A;  1WSG A;  1NJZ A;  3D0P A;  3QNN A;  1WSF A;  4CHP A;  1C0T A;  4BDP A;  1D8Y A;  4EP4 A;  1HYZ A;  5K14 A;  4DLE A;  3NDK A;  1SL0 A;  1N6Q A;  1A5W A;  3V9U A;  5J2N A;  2KTQ A;  3HT3 A;  2RKI A;  5C42 A;  4KTQ A;  1RBR A;  3SCX A;  2YKN A;  3AV9 A;  1XHZ A;  5I3U A;  2HVH A;  1C1C A;  4JS5 A;  3EZ5 A;  3OYH A;  3V9W A;  3KIO A;  4IFY A;  1RTJ A;  3BDP A;  3ISN C;  3ZSX A;  4G1Q A;  4M45 A;  4M3X A;  1WSJ A;  2P51 A;  3PO4 A;  3VQ9 A;  2FBV A;  3SV3 A;  3SPY A;  2IC3 A;  3AVF A;  4AHV A;  2HHQ A;  5C24 A;  3ALY A;  1KFD A;  4O4G A;  4W5N A;  3ZSV A;  1T7P A;  4Z4G A;  1YVU A;  3PO5 A;  3ZSZ A;  1LAW A;  1SKS A;  3DLG A;  3HO1 A;  4FZY A;  1VSE A;  3TAR A;  3DLH A;  3AVG A;  4C8N A;  4LSL A;  3T3F A;  4F3T A;  4HVJ A;  4M41 A;  1S1X A;  3UIQ A;  1B9D A;  1EP4 A;  4E7H A;  1L3V A;  4DFJ A;  3DRS A;  3OS2 A;  3IS9 A;  4M3W A;  2KQ2 A;  3L3U A;  5FDL A;  3HPO A;  1UAX A;  1L3S A;  1VSM A;  1VSF A;  4FJG A;  4HCB A;  2X6N A;  3SUN A;  3MAQ A;  3RMA A;  4KO0 A;  1TL3 A;  2F96 A;  1RIL A;  3NFA A;  4KHU A;  4W5T A;  3RMC A;  4DQP A;  4O44 A;  4Q5V A;  3CFR A;  1BL3 A;  4CGJ A;  3ZSO A;  4KB1 A;  4RW8 A;  3SUQ A;  1IO2 A;  3A2F A;  3KK2 A;  3EY1 A;  5HP1 A;  4KHW A;  3LZI A;  3HP9 A;  4FCY A;  3NF8 A;  1I3A A;  2YNI A;  4FJ8 A;  3QEX A;  3AVI A;  1DLO A;  3HST B;  3AA5 X;  4KHY A;  1BCM A;  1JLE A;  3MEG A;  3OY9 A;  4AH9 A;  1SL2 A;  4CEZ A;  5SWM A;  1BGX T;  2RF2 A;  4OGE A;  1QS4 A;  2VWJ A;  1WN7 A;  1C1B A;  4E7J A;  1TK0 A;  1FXX A;  4CJR A;  1NK9 A;  4C8L A;  3K57 A;  3ZSY A;  3WNE A;  1L3T A;  3RMB A;  4ICL A;  4KTZ A;  3L3V A;  3V9S A;  3TAF A;  4FJK A;  3NH1 A;  5HRP A;  4CJP A;  3RRG A;  4BDZ A;  1WSH A;  1XI1 A;  1KFS A;  4FLY A;  4E1N A;  5SZT A;  2YKM A;  4FK2 A;  1G15 A;  1HPZ A;  1CZ9 A;  5FRO A;  2NUB A;  1IKX A;  3M8R A;  1RT5 A;  3VQ4 A;  3ZT1 A;  2EHG A;  1LAV A;  4K8X A;  4OKE A;  2DFF A;  4CER A;  3OVN A;  4OKK A;  4DSI A;  1ZBH A;  4PWD A;  4CFC A;  2RPI A;  2HHV A;  1WSI A;  2QXF A;  3DLR A;  3DLE A;  1IG9 A;  1JXE A;  3HM9 A;  1HQU A;  3S3O A;  1S9E A;  5I42 A;  3E01 A;  3MEE A;  1NK5 A;  5CYM A;  3TAM A;  1DTT A;  1NK8 A;  4DQS A;  1RNH A;  2ZD1 A;  1LWE A;  1B92 A;  2VG7 A;  1X1P A;  1RBT A;  2B4J A;  1TKT A;  2YHB A;  3OYJ A;  4DU3 A;  4IKF A;  4E7I A;  5E41 A;  4NCB A;  3SPZ A;  2DTU A;  4CGI A;  2YNH A;  3DOK A;  4FLX A;  1XHX A;  2I5J A;  4LH4 A;  1GOA A;  3OYE A;  1TGO A;  2GBZ A;  3KK1 A;  2X74 A;  3F9K A;  1LWF A;  4CJU A;  3L2V A;  1Q8I A;  3CQ8 A;  4DTP A;  2FBT A;  4B9U A;  1RDB A;  4N76 A;  3V81 A;  4E19 A;  4DS4 A;  4KHQ A;  1WSE A;  2XY8 A;  2KW4 A;  1JXB A;  3TAP A;  1RT4 A;  3DLK A;  1ZBF A;  3H08 A;  4KTW A;  1KSP A;  1F21 A;  1GOB A;  1RBV A;  3LP0 A;  4I9Q A;  1U48 A;  4CHN A;  1EX4 A;  4LD0 A;  5J2Q A;  1BHL A;  1JLF A;  3KKS A;  1KVC A;  4AIL C;  1O1W A;  3IG1 A;  2HND A;  4TSX A;  3VQB A;  4CEQ A;  4CJW A;  4B9N A;  4CJT A;  2OZS A;  2Z1I A;  1JLQ A;  3I0R A;  2OPR A;  3QER A;  1WAF A;  3U3G A;  4C8K A;  3OYI A;  3TAN A;  2HVI A;  4RG8 A;  3ZSQ A;  1JL1 A;  3PX6 A;  5HBM A;  4KHS A;  4FM0 A;  3HP6 A;  3LWL A;  1SUQ A;  3C94 A;  4N5S A;  3HVR A;  1T05 A;  3VA3 A;  2HB5 A;  3NAE A;  1J53 A;  1NK6 A;  1BI4 A;  3DOL A;  3SQ4 A;  2D5R A;  3RWU A;  1BQN A;  1S1T A;  4Z4C A;  3PX4 A;  4FYD A;  3WNH A;  3ZCM A;  3MXJ A;  4FXD A;  3VQE A;  4B9M A;  2KZZ A;  4E1M A;  5J2P A;  3SNN A;  1HYV A;  4IDK A;  4HCC A;  5J2M A;  2YHA A;  1D5A A;  1TVR A;  2HMI A;  1S1U A;  4DSF A;  3AA4 A;  3F73 A;  1QSS A;  3PUF A;  3D45 A;  4ID1 A;  4O0J A;  4AHU A;  4CIG A;  4CJK A;  4N56 A;  4FJ7 A;  4QAG A;  3LAN A;  3VQ5 A;  3L8B A;  3CM5 A;  3TR8 A;  3V1Q A;  4CJ4 A;  4IG0 A;  1RCH A;  1BCO A;  5KRT A;  3PY8 A;  1S1W A;  3K5N A;  1R0A A;  4FK4 A;  2Q3S A;  3M8Q A;  4AHR A;  3T1A A;  4FVM A;  4W5Q A;  1QQC A;  4AHC A;  3L2W A;  3PX0 A;  4OVL A;  1X9M A;  5CZ1 A;  2G8U A;  4KI4 A;  4MQ3 A;  4B9V A;  2OPP A;  1UWB A;  3QEW A;  4M42 A;  4EZ6 A;  2JLE A;  4M3U A;  1I39 A;  2VG6 A;  4PQU A;  1TAQ A;  2JGU A;  3OS0 A;  2G8F A;  1VSD A;  4FJL A;  2HHW A;  2F8S A;  3OYN A;  1XWL A;  1N5Y A;  1YTA A;  3HJF A;  4CJE A;  4W5O A;  1HYS A;  1KLM A;  4CF0 A;  5CY4 A;  1JLA A;  4B8A B;  3TI0 A;  3L2Q A;  4O0I A;  3I8D A;  4BWM A;  3K5O A;  2GUI A;  3O3H A;  1QSL A;  4B9S A;  4CFB A;  1JKH A;  3AVN A;  4XIU A;  4BDY A;  2P5G A;  4N47 A;  4CE9 A;  4OLB A;  5HLF A;  5DMR A;  4DTO A;  1TKZ A;  5HRO A;  4B8C A;  4ELT A;  3AVJ A;  4FLU A;  1KRP A;  1HNV A;  2E6L A;  4M3T A;  4AHT A;  1UA1 A;  1NKC A;  3C6U A;  2O4G A;  4CEC A;  3KLI A;  2Y1I A;  5C25 A;  4EP5 A;  4O55 A;  1D9F A;  1EXQ A;  1VSK A;  1BQM A;  4Z4H A;  3SV4 A;  4DFK A;  1U4B A;  3KTQ A;  3HXM A;  4FJH A;  3V1O A;  4HUF A;  2AJQ A;  1ZBU A;  2XO7 A;  3RRH A;  4FM2 A;  2HHT A;  1IKY A;  3QEI A;  3S3M A;  2IAJ A;  1S9G A;  4CK2 A;  4F2S A;  4PUO A;  4KV8 A;  1RDA A;  3RMD A;  1WNS A;  3B6O A;  2BGG A;  4B3O A;  3HVT A;  1ASV A;  4PY5 A;  1RBS A;  1YT3 A;  1EKE A;  3AVA A;  1MU2 A;  2HHS A;  4H4M A;  3HK2 A;  3JSM A;  4HUE A;  4BE0 A;  1VSH A;  3DRP A;  2G8I A;  2EX3 A;  1D9D A;  3K58 A;  4DTX A;  3K5M A;  4HUG A;  1A5V A;  5T7B A;  4OKJ A;  3OYM A;  2IOC A;  2X6S A;  4FJI A;  4DTJ A;  4FLT A;  3G0Z A;  4CJV A;  3VQ8 A;  3VQA A;  3SUP A;  3OYA A;  4E0D A;  4KRE A;  4DF4 A;  4DS5 A;  3VQD A;  3DRR A;  5KGX A;  2G8K A;  4CF1 A;  4C8O A;  4OJR A;  3V9X A;  4FK0 A;  4CJQ A;  3LAL A;  4JRP A;  1S6Q A;  4H4O A;  3CFP A;  4JS4 A;  1HQE A;  3ZSR A;  4Q0B A;  4CIE A;  2FBX A;  1J9A A;  3I0S A;  2B5J A;  4CGG A;  4DSK A;  3AO1 A;  3JYT A;  3AVK A;  3NF6 A;  4DSL A;  2XHB A;  4F4K A;  1RDD A;  1BIZ A;  1LW0 A;  3OYB A;  1KLN A;  4DSJ A;  3M8S A;  3V6D A;  4CEE A;  3KLG A;  4DF8 A;  1NK0 A;  2HNZ A;  1C0M A;  4Y1C A;  2OYQ A;  3AA2 A;  1RTH A;  5D3G A;  4E7K A;  4UQG A;  3OJS A;  4JLH A;  4DTM A;  3S3N A;  3RTV A;  4DTU A;  3ZT2 A;  3B6P A;  4NCG A;  4CJ3 A;  1WLJ A;  1RT6 A;  2D0B A;  4WE1 A;  3DLB A;  2P5O A;  4NCA A;  3NCI A;  4DLG A;  3QNO A;  1VSJ A;  3O3F A;  3SYZ A;  2OZM A;  5KTQ A;  1W0H A;  1TK8 A;  2HNY A;  1ITG A;  4YFU A;  1RDC A;  3LPT A;  1Q9X A;  5JS1 A;  3LPU A;  2GV9 A;  3QES A;  3ZT4 A;  3U3Y A;  2DFE A;  3KK3 A;  3ZT3 A;  1HRH A;  2YV0 X;  3DI6 A;  1L5U A;  4BE2 A;  3QEP A;  1NJX A;  1NOY A;  1T8E A;  3AVH A;  3AVL A;  4RW9 A;  1LV5 A;  3QO9 A;  3SJJ A;  3AO5 A;  4ID5 A;  4ZTF A;  1FKP A;  2BAN A;  4FLZ A;  3KD5 E;  4CF8 A;  5DK5 A;  4DQQ A;  3OS1 A;  3QET A;  3LAK A;  4CEA A;  1JL2 A;  1S6P A;  4K8Z A;  3MXM A;  1BIU A;  4DQI A;  4FLV A;  1TV6 A;  2ZQB A;  2G8W A;  3QLH A;  1CXU A;  3U6F A;  2OPQ A;  5KGW A;  3P83 D;  1WAJ A;  1TL1 A;  3NF9 A;  3LAM A;  3WNG A;  3IAY A;  4KI6 A;  3AO2 A;  3SQ1 A;  2RN2 A;  3OJU A;  3HYF A;  4BWJ A;  2FC0 A;  3V9Z A;  1XC9 A;  3K2P A;  3NHG A;  1ZYQ A;  5FRN A;  3PV8 A;  1VSI A;  3BGR A;  1ZBI A;  3HL8 A;  1NOZ A;  1CXQ A;  3ZT0 A;  4FLW A;  2DFH A;  1YTU A;  4OPJ A;  4CJS A;  4QOZ B;  4FJN A;  4CIF A;  2HHU A;  1KVA A;  2FBY A;  4M3R A;  4E3S A; 
#chains in the Genus database with same CATH topology
 4AM7 A;  3TAG A;  1XUP O;  3IRX A;  3JS6 A;  1OH7 A;  2HBK A;  4LF8 K;  2HF3 A;  1LW2 A;  3KHY A;  3ID8 A;  4B3R K;  1XMO K;  4CBW A;  1HJR A;  2X78 A;  1VQ5 N;  3OYL A;  2QXL A;  2HW3 A;  4IFV A;  1ZXO A;  3DYA A;  2R7Y A;  4KB0 A;  2A1S A;  1YI2 N;  4XH4 A;  4CEF A;  5EOY A;  1YJN N;  1HNI A;  2NRW A;  3VEW A;  2PYL A;  3VA0 A;  2PY5 A;  1VSL A;  3QIN A;  2ITM A;  1SV5 A;  4B3M K;  2YHY A;  2Q31 A;  4LSN A;  3O4Q A;  1YVN A;  1SL1 A;  4FM1 A;  1KCF A;  1VAZ A;  5ELZ A;  3I55 N;  4OLA A;  3CPW M;  1IKW A;  5C2F A;  3SI6 A;  2A1R A;  3AO3 A;  3OYD A;  4EZ9 A;  3TSP A;  4CK3 A;  3MCP A;  4DLE A;  5KI6 A;  3S9H A;  2UUB K;  3KD1 E;  3QIP A;  2CH6 A;  1NGD A;  4F3O A;  3C7N B;  3U9Z A;  1NKE A;  3NE6 A;  2ZWH A;  4B3S K;  3SQ0 A;  1BA1 A;  4PA1 A;  3MDQ A;  2FF6 A;  5M1O A;  2QTD A;  3L2R A;  1Q9Y A;  1VQ7 N;  3CJ1 A;  4WQ4 C;  5AZI B;  2O8F B;  2O8F A;  1HR0 K;  4ELU A;  3CD6 N;  4J2E A;  3CCE N;  4E89 A;  4H5W A;  3VMF B;  5GIP A;  3JXU A;  2QM1 A;  4BQL A;  3A5L C;  3AAP A;  4BC3 A;  2WC9 A;  2QEX N;  3LDQ A;  4MDA A;  3T7Z A;  5B8H A;  4FW1 A;  2HHV A;  4CJF A;  2OA8 A;  4BC2 A;  1JCE A;  4A5A A;  1RT2 A;  1RT1 A;  2P9U A;  4I6M B;  4JAX A;  3L2U A;  5EY4 A;  4M3Z A;  3O3G A;  4C23 A;  4H03 B;  3AAQ A;  4CGF A;  3G71 N;  1RDU A;  4OGC A;  1T03 A;  5JS2 A;  3O80 A;  1A5X A;  3LZJ A;  1W9H A;  1EET A;  4F8R A;  1KTQ A;  1VRT A;  2XY5 A;  5EX5 A;  4B3T K;  1E4F T;  3ZEU B;  2HOE A;  3EYZ A;  3V1R A;  1Q18 A;  4DTR A;  4OPH A;  3O4W A;  3VQC A;  4AQY K;  3D0P A;  1WSF A;  4NLB A;  1C0T A;  4CHP A;  1D8Y A;  5K14 A;  1A5W A;  3H1V X;  5C42 A;  2WBN A;  4KTQ A;  3CMA N;  1XHZ A;  3HSC A;  3V9W A;  3WXI A;  4JD2 B;  2QI2 A;  3SMS A;  4G1Q A;  4M45 A;  4M3X A;  3VGK A;  1O13 A;  5HOO A;  2YI1 A;  3SV3 A;  1U2V A;  4AHV A;  3T69 A;  4Z4G A;  1YVU A;  4BR7 A;  3ZSZ A;  2HF4 A;  1IBM K;  4HVJ A;  4JK8 A;  4A2B A;  3DRS A;  1ESV A;  3OS2 A;  2NRH A;  3HPO A;  1UAX A;  1L3S A;  3RMA A;  4KO0 A;  4O8K A;  4KHU A;  5TKW A;  4W5T A;  2E2O A;  3QDK A;  3O6W A;  4U7B A;  3SUQ A;  1IO2 A;  4KHW A;  3KK2 A;  3EY1 A;  1I3A A;  4FJ8 A;  5AQW A;  5DM7 L;  1DLO A;  2KKZ A;  4KHY A;  3OY9 A;  2A6A A;  1SL2 A;  2RF2 A;  4ILG B;  4OGE A;  3TSU A;  4JHD B;  3P4I A;  4E7J A;  1FXX A;  5AQQ A;  3SBT A;  3ZSY A;  3RMB A;  4GV6 A;  1HNW K;  4GVE A;  1XI1 A;  3WUH A;  4JKE A;  2YHW A;  1EQY A;  2OTJ N;  4MLE A;  4DV1 K;  1YF5 L;  1IKX A;  3HM8 A;  1RT5 A;  4DV0 K;  2ASO A;  4CER A;  1NGH A;  2RPI A;  3L0Q A;  2AP1 A;  3S3O A;  4QS8 A;  2CH5 A;  1NK8 A;  1B92 A;  4KBO A;  1J6Z A;  2YHB A;  4IKF A;  3OYJ A;  1ZC6 A;  4E7I A;  1YHQ N;  5E41 A;  3SPZ A;  2W41 A;  2YNH A;  3DOK A;  1M90 O;  4IJA A;  3OYE A;  4E0D A;  1KSP A;  2X74 A;  3F9K A;  1LWF A;  4CJU A;  1Q8I A;  4N76 A;  3GL1 A;  1KQS M;  3V81 A;  4FO0 A;  2XY8 A;  4K42 A;  1VQP N;  4K0K K;  5LJV A;  4GY2 B;  1F21 A;  1RBV A;  4JI6 K;  1QQO A;  2W40 A;  1EX4 A;  2QWN A;  4TSX A;  2OAN A;  4BC5 A;  2OCE A;  4B9N A;  4CJT A;  1NLV A;  2Z1I A;  1JLQ A;  3I0R A;  2OPR A;  1KVA A;  4GV9 A;  2HVI A;  1JL1 A;  3PX6 A;  3HP6 A;  1X3N A;  3HVR A;  1T05 A;  3DOL A;  3SQ4 A;  1S1T A;  4CZM A;  4FYD A;  1WBD A;  3NVK A;  3VQE A;  3SNN A;  2YHA A;  4BR2 A;  1TVR A;  1HLU A;  3O9S A;  3D45 A;  4AHU A;  4FJ7 A;  3VQ5 A;  3IFR A;  4FK4 A;  3K5N A;  5M1N A;  3M8Q A;  4AHR A;  4FVM A;  1NJI O;  4OVL A;  1NU0 A;  4LFA K;  5CZ1 A;  4KI4 A;  4B9V A;  3QEW A;  4CBX A;  1N32 K;  4CZK A;  5AQL A;  4PQU A;  4FJL A;  3OYN A;  3R8E A;  1N8R O;  1HYS A;  5CY4 A;  5GIO A;  3TI0 A;  1E4G T;  4O0I A;  2YHX A;  4BWM A;  2VCP A;  4CFB A;  4BDY A;  2P5G A;  5DMR A;  4ISE A;  4FLU A;  1KRP A;  4EFH A;  1NKC A;  1GLC G;  4FWK A;  4JKD A;  5I9E B;  2Y1I A;  4H5N A;  4EP5 A;  2Q36 A;  4Z4H A;  2QW9 A;  4KH4 A;  4BVO A;  4CZJ A;  2GEL A;  1IKY A;  4YOY A;  1RDA A;  1WNS A;  1QQN A;  1RBS A;  1YT3 A;  1EKE A;  3AVA A;  3WEE B;  3JSM A;  1VSH A;  1XC3 A;  4OKJ A;  2IOC A;  3EO3 A;  4DTJ A;  4CJV A;  4H0V B;  4DF4 A;  3VQD A;  5KGX A;  4BRF A;  4B1Y B;  4JRP A;  4YHH K;  3CFP A;  1BU6 O;  1HQE A;  4H5V A;  3ZSR A;  3JYT A;  4F4K A;  5IT9 O;  1RDD A;  5LL6 Z;  2E20 A;  2UXC K;  2PAV A;  5JVG L;  4ILH A;  4LFC K;  2VGM A;  1NK0 A;  4Y1C A;  3AA2 A;  1K8K B;  4E7K A;  1BA0 A;  3S3N A;  4WE1 A;  4FWL A;  3NCI A;  3QNO A;  3O3F A;  3LPT A;  5JLF A;  2ASP A;  2DFE A;  4IJN A;  1L5U A;  4BE2 A;  5CR4 A;  3CJB A;  3RSE B;  3EL2 A;  3E9L A;  4CJ7 A;  3QO9 A;  3VER A;  3THW B;  3THW A;  3ATV A;  2A40 A;  4ZTF A;  1FKP A;  5LJW A;  5AQO A;  3LL3 A;  3CCM N;  1JCF A;  3MXM A;  4FLV A;  1TV6 A;  3VPZ A;  3WT0 A;  3HI0 A;  3U6F A;  1WAJ A;  4DR5 K;  3OHR A;  3A5O C;  3D2F A;  3OJU A;  4XEI A;  1XC9 A;  3V9Z A;  3M1F A;  3NHG A;  4OPJ A;  4I6M A;  2HHU A;  4M3R A;  4E3S A;  2O4I A;  4QS9 A;  4BRQ A;  1Q82 O;  4BE1 A;  5M1Q A;  3DXK A;  4H0O A;  4CJL A;  2Y1J A;  4FJX A;  3LM2 A;  5F2R A;  1RT7 A;  3DWL A;  3LP2 A;  1GLL O;  1K6Y A;  3TAB A;  5HRR A;  1GOC A;  3FFK B;  3MWT A;  2QWP A;  5AFU H;  4CCH A;  4YOR A;  2G8V A;  1SAZ A;  3VF6 A;  4CHQ A;  4GV3 A;  3FLC O;  4CZG A;  3OW2 M;  1KVB A;  2GEM A;  3P1G A;  2HBM A;  4WCE L;  4ELV A;  1JLG A;  5AQI A;  2V7Z A;  2F9T A;  3B8A X;  1LWC A;  1QSY A;  3U8X A;  2DY4 A;  1SKW A;  1QTM A;  5AQY A;  1C0U A;  3OYC A;  3IKM A;  4NXN K;  1VQ9 N;  1RBU A;  5HRN A;  4BRO A;  4FZZ A;  4CF9 A;  1Z25 A;  4F2R A;  2ATQ A;  2E4L A;  3OA9 A;  2P9N A;  4WFA L;  4CFD A;  5DM6 L;  4CHO A;  4FPA A;  2ETJ A;  4B1V A;  1JLC A;  1FK9 A;  3AY9 A;  3M8P A;  1IH7 A;  4CHY A;  3NGI A;  4A57 A;  4PL7 A;  1QHA A;  3TTF A;  3RVC A;  1BIS A;  1R59 O;  2D1K A;  2ZE2 A;  3RR8 A;  3O9T A;  2E1Y A;  4HTU A;  2EWS A;  3FFI A;  1DEJ A;  2Q2R A;  4NYF A;  4Y1D A;  1H1V A;  4J2B A;  4O5B A;  2A41 A;  3OTO K;  1U2V B;  1FKO A;  4E1J A;  3UB5 A;  4DV5 K;  3SMP A;  1U45 A;  4FZX C;  4NYN A;  5M1F A;  4L3Q A;  3ZSW A;  4DU1 A;  1BUP A;  2D0C A;  3K5L A;  2NRX A;  2E2Q A;  2Z1J A;  4DMN A;  5E26 A;  4N41 A;  3J80 O;  3KK7 A;  5BPN A;  1M1K O;  4J2D A;  4LH5 A;  4B9L A;  3C7N A;  3VEZ A;  2XY7 A;  1X9S A;  3M5R A;  4GW6 A;  4IBN A;  2J4R A;  3PSF A;  3LWM A;  1VK0 A;  2W42 A;  3P5J A;  3N4Q A;  3VF2 A;  4GVM A;  4I9L A;  3N4P A;  3SQ2 A;  1TKD A;  1CZB A;  4M63 C;  3CJ7 A;  5MLC Q;  1GLJ O;  3WEE A;  4I7F A;  5GAH P;  3D2E A;  3AA3 A;  2A42 A;  4NB4 A;  1IKV A;  3ULD A;  2QKK A;  4B08 A;  4YDU C;  4C8M A;  5H1S Q;  3QIC A;  2B6A A;  2ITG A;  3VQ7 A;  2HHH K;  3VET A;  2P1J A;  4CJ5 A;  4FW2 A;  2XY6 A;  3DLL L;  4DV7 K;  4FJJ A;  3KLF A;  1JLB A;  3FR0 A;  1EO1 A;  3KJV A;  1P8Z A;  2BTF A;  1UA0 A;  1NJW A;  4FWO A;  4QCL A;  4H0Y B;  4DG1 A;  1ATN A;  1W2B M;  1NJZ A;  1RDW X;  3MN9 A;  3P38 A;  3QNN A;  4BDP A;  3NDK A;  2UUA K;  4EHT A;  5J2N A;  2KTQ A;  3HT3 A;  2RKI A;  3ZYY X;  3AV9 A;  2HVH A;  2O8D A;  1C1C A;  4BGA A;  2VWB A;  3UE5 A;  3GG4 A;  3OYH A;  4IFY A;  1HPM A;  4ISF A;  3ATU A;  1T6D A;  3PO4 A;  3UKU B;  3CET A;  3ALY A;  3FZL A;  1N34 K;  1WUA A;  3PO5 A;  1LAW A;  1SKS A;  3DLG A;  5C0Y A;  4FWR A;  4FZY A;  4GNI A;  3DLH A;  4DR7 K;  4C8N A;  3QBX A;  1S1X A;  4DFJ A;  4M3W A;  3L3U A;  4YDU A;  5FDL A;  3FZF A;  3HTV A;  4CI6 A;  3SUN A;  1RIL A;  5AQU A;  1XNQ K;  4O44 A;  3CFR A;  3ZSO A;  3D2E B;  4RW8 A;  5AZI A;  1OH8 A;  3CC2 N;  2YNI A;  3QEX A;  3O9R A;  4BG9 A;  3BP8 A;  1IG8 A;  1BCM A;  1JLE A;  3PLA A;  1HNX K;  4IWV A;  3DJC A;  4JN4 A;  1EWR A;  4CEZ A;  1BGX T;  1C1B A;  1TK0 A;  3O9Q A;  4C8L A;  4NXM K;  4J8F A;  3TAF A;  2NZT A;  2GUP A;  4X66 K;  1GLE G;  4XH5 A;  4CJP A;  3RRG A;  4BDZ A;  1WSH A;  1K8K A;  1JJ2 M;  4DR2 K;  3GDQ A;  2YKM A;  4FK2 A;  2NRV A;  1HPZ A;  1CZ9 A;  2NUB A;  3M8R A;  4JKB A;  5BRD A;  1LCU A;  4OKK A;  3VEY A;  4GKK K;  1WSI A;  3CJ9 A;  4DR6 K;  5AQX A;  1IG9 A;  1S9E A;  5I42 A;  1QZ6 A;  4FWN A;  5F1X A;  4DQS A;  1LWE A;  2ZD1 A;  5BRF A;  2B4J A;  4BR5 A;  3CI5 A;  5AFU A;  4NCB A;  4CGI A;  2E88 A;  4WQ5 C;  2I5J A;  4LH4 A;  3CQ8 A;  4DTP A;  4FWM A;  2FF3 B;  2FBT A;  1TYQ B;  4JK9 A;  4DS4 A;  4KHQ A;  2KW4 A;  1RT4 A;  4KTW A;  4H0T B;  4LD0 A;  5J2Q A;  1VQ6 N;  4AIL C;  3L4Q A;  4EAH D;  3IG1 A;  4MO4 A;  4CEQ A;  4BVP A;  3QER A;  4C8K A;  3J8A A;  3QBW A;  1S3X A;  3TAN A;  3D2F B;  3ZSQ A;  4H5R A;  4KHS A;  3VGM A;  3JAM O;  1X9J A;  4XH1 A;  1SUQ A;  3LWL A;  3C94 A;  4N5S A;  3VA3 A;  2HB5 A;  1NBW A;  1J53 A;  2JWL A;  2WTU A;  1KAZ A;  3R1X A;  3MN7 A;  4Z4C A;  3PX4 A;  2QWL A;  3WNH A;  3ZCM A;  2KZZ A;  2V52 B;  4B9M A;  3R6M A;  1WBB A;  3P31 A;  3H45 C;  5J2P A;  5J2M A;  3O8M A;  4BR9 A;  3AA4 A;  3F73 A;  4CIG A;  4CJK A;  3AGK A;  1OKJ A;  4MO5 A;  4K25 A;  3V1Q A;  4IG0 A;  1BCO A;  1S1W A;  3T1A A;  4DR3 K;  1QQC A;  3L2W A;  3CCV N;  5BPL A;  2HBJ A;  1X9M A;  1NMN A;  4JKG A;  4EZ6 A;  2JLE A;  3E9O A;  2VG6 A;  2JGU A;  2G8F A;  1YTA A;  3HJF A;  4CJE A;  3L2Q A;  3ENO A;  1QSL A;  4B9S A;  2ZJR L;  4IO8 A;  1OH5 A;  1JKH A;  4DCH A;  5ADX H;  4XIU A;  5M1K A;  4KH5 A;  3THX B;  4N47 A;  4CE9 A;  5HLF A;  4YOU A;  3H46 O;  4DTO A;  1TKZ A;  1S72 N;  1Z6R A;  1HNV A;  2E6L A;  5AQV A;  3T1Y K;  1UA1 A;  3VEN A;  3C6U A;  4JI1 K;  2Q0R A;  3G6E N;  1D9F A;  2FSK A;  3LM9 A;  1N36 K;  5FPM A;  4DFK A;  1NWK A;  3SLC A;  4HUF A;  1ZBU A;  2XO7 A;  2HBL A;  3RRH A;  2HHT A;  3RMD A;  3B6O A;  2BGG A;  2P9U B;  1MU2 A;  4H4M A;  3HK2 A;  4BE0 A;  1HNZ K;  4WQ4 A;  4HUG A;  4Y0W A;  2FSN A;  5T7B A;  4JEP A;  4AM6 A;  3VTH A;  3A5N C;  3G0Z A;  3VQ8 A;  3VQA A;  3SUP A;  1VQK N;  3OYA A;  4CF1 A;  4FK0 A;  3HOS A;  3LAL A;  4IFE A;  1YUW A;  4H4O A;  3G25 A;  4CIE A;  3FZK A;  3I0S A;  1SS6 A;  3DXM B;  4DSK A;  3CC7 N;  5BN9 A;  2F7T A;  3AVK A;  3NF6 A;  2XHB A;  1W7A A;  4A59 A;  3V6D A;  2IIR A;  1E3M A;  4CEE A;  4BRP A;  3W3D A;  1K8A O;  2HNZ A;  1C0M A;  2OYQ A;  1K9M O;  1RTH A;  1Q86 O;  4FXD A;  4NCG A;  3EZW A;  5EXW A;  4EHU A;  4OPA A;  3CCJ N;  5KTQ A;  2HNY A;  1ITG A;  5JS1 A;  1Q9X A;  2I7P A;  3QES A;  3WQU A;  1HRH A;  2YV0 X;  3DI6 A;  3AVH A;  3AVL A;  4RW9 A;  5ADX A;  1LV5 A;  5FLX O;  2BAN A;  4CF8 A;  4DQQ A;  3QET A;  3LAK A;  1MA9 B;  4B1W B;  4CEA A;  2O8D B;  1BDG A;  3ID6 A;  3MWP A;  1NGI A;  3A0I X;  3QLH A;  5KGW A;  4AF1 A;  1TL1 A;  3UKR A;  3LAM A;  2P9L A;  3IAY A;  2P9L B;  3AO2 A;  3R3L A;  2RN2 A;  4DV6 K;  3K2P A;  1DGK N;  3BGR A;  4FOE A;  4JYA K;  1ATR A;  4CIF A;  1KAX A;  1NKB A;  2HMP A;  3O4N A;  2BDP A;  2E6M A;  3NF7 A;  4GMJ B;  3VEX A;  3QEV A;  5AQT A;  5CE3 A;  1REV A;  4BRE A;  1TAU A;  1NGC A;  1BI4 B;  5JLH A;  3VQ6 A;  4W5R A;  4IEI A;  5HRS A;  4H0X B;  5KQ8 A;  4IG3 A;  3T19 A;  4I2P A;  3C0B A;  2KZM A;  5CYQ A;  5C15 A;  3RR7 A;  4CGD A;  3IMX A;  3CQX A;  2UU9 K;  2F8T A;  3MEC A;  5HL7 L;  4QS7 A;  4DTN A;  2O8E A;  4Z0U A;  3BY5 A;  4CZE A;  4CK1 A;  3IUC A;  4IZ9 A;  4L8R B;  4I2Q A;  4O5F A;  1C1A A;  1J54 A;  2D0A A;  3OYK A;  4RW7 A;  4M7X A;  3OBW A;  1NK9 A;  4KKO A;  1JCG A;  1U04 A;  3BF1 A;  4DSI A;  1S1V A;  5AQH A;  1Y97 A;  4IOX A;  4WQ5 A;  3CYM A;  2PZS A;  3OBY A;  4CES A;  4CGH A;  1DT9 A;  4BRI A;  4OO1 J;  4DR1 K;  2GWK A;  5AZJ A;  3D7E O;  3WNF A;  3CCQ N;  2UXB K;  1K73 O;  2PBD A;  1TKX A;  1WOQ A;  1DTQ A;  5AQF A;  4BC4 A;  4DFM A;  3WXL A;  3NGY A;  3ZX3 A;  4M7Y A;  1VRU A;  3KKR A;  3MN6 A;  3VN5 A;  1TUU A;  2H3G X;  2OPS A;  4K41 A;  3VEO A;  1TYQ A;  2Z1G A;  3NH2 A;  3TAQ A;  4CF2 A;  4ZTJ A;  1KC8 O;  4X64 K;  4YOW A;  4DQR A;  4RW4 A;  3LDN A;  3LP3 A;  2GWJ A;  2VWK A;  1RTI A;  3ITH A;  4EIA A;  4DV4 K;  1RTD A;  3OYF A;  4DSE A;  4FJ5 A;  1QVF M;  4CEO A;  4PKI A;  4OX9 K;  4MLH A;  4DFP A;  4Z4I A;  1X9W A;  2LSN A;  3NH0 A;  3AAR A;  2G8H A;  3BZC A;  1BO5 O;  4Z4F A;  3TWH A;  4B1U B;  3SUO A;  3CG7 A;  4J2A A;  1B9F A;  3H6E A;  4H8K A;  3MX5 A;  5KPR A;  1ASU A;  1VQN N;  3AVB A;  2V7Y A;  3SZ2 A;  1TUY A;  1D4X A;  3RSE A;  2VG5 A;  4HWI A;  3CF5 L;  4LF7 K;  3AO4 A;  3KLH A;  3TAE A;  2UYT A;  5EVZ A;  4KAZ A;  2P9P B;  4CFA A;  3DXM A;  1QHT A;  3C6T A;  1WSG A;  3EE9 A;  2D0P A;  3D6R A;  4FWP A;  3ZET A;  4EP4 A;  1SL0 A;  1N6Q A;  1YXQ A;  3C6H A;  5GAG P;  3V9U A;  1VQM N;  3SCX A;  2YKN A;  1OVQ A;  4BRL A;  3HOT A;  4JS5 A;  4BRD A;  3EZ5 A;  1QVG M;  3KIO A;  1RTJ A;  3ISN C;  1MWM A;  2BH1 A;  2FLO A;  3P39 A;  3VQ9 A;  2FBV A;  1KAY A;  3SAH A;  2IC3 A;  2VGN A;  1ZBS A;  2HHQ A;  4BY9 C;  4LF6 K;  1EWQ A;  3EKU A;  2FXU A;  3ZSV A;  1T7P A;  4U67 L;  3SAG A;  3TAR A;  3AVG A;  1KXP A;  4LSL A;  3T3F A;  4F3T A;  4LF5 K;  5KPZ A;  3IS9 A;  2CGK A;  4HCB A;  2X6N A;  5BRH A;  4JKC A;  1DKG D;  1TL3 A;  2F96 A;  1VQ8 N;  5JIC A;  1BL3 A;  4IDH A;  2E5L K;  4CGJ A;  4JK7 A;  4KB1 A;  2IVP A;  2D4W A;  4FCY A;  4BRM A;  4JI4 K;  2P9K B;  3MX2 A;  5TKY A;  4IOC L;  5SWM A;  4RCH A;  1Q81 O;  2VWJ A;  4CJR A;  3K57 A;  1Y64 A;  4PKG A;  1L3T A;  4ICL A;  4KTZ A;  3L3V A;  3V9S A;  4FJK A;  1YJ9 N;  3HZ6 A;  4DKW A;  1KFS A;  4FLY A;  3BZK A;  4YY3 K;  4E1N A;  3J81 O;  5SZT A;  3QML A;  5FRO A;  1NGJ A;  3ZT1 A;  1LAV A;  4OKE A;  4PWD A;  4BRA A;  3EN9 A;  3DLE A;  3DLR A;  5AR0 A;  3CHW A;  1JXE A;  3CJC A;  3HM9 A;  4JI7 K;  1NK5 A;  4NLC A;  1DTT A;  2ZGZ A;  1YIJ N;  5GAD P;  4CZL A;  1Q7Y O;  1RBT A;  1TKT A;  2ZGY A;  2DTU A;  4FLX A;  3J7A P;  3VOV A;  1XHX A;  3ENB A;  1TGO A;  3L2V A;  4B9U A;  1RDB A;  3FZH A;  4E19 A;  1WSE A;  4DHY A;  1ZBF A;  3H08 A;  2W6L A;  3TSQ A;  5AZJ B;  2QWO A;  1BHL A;  1JLF A;  3VEV A;  5FPE A;  3ULE A;  3KKS A;  1KVC A;  4FL9 A;  3CC4 N;  1HKG A;  4KH6 A;  3UKU A;  3OYI A;  4RG8 A;  4A2A A;  5AQK A;  2P9I B;  3NAE A;  1NK6 A;  1BI4 A;  3ENH A;  2KLA A;  1BQN A;  1HJO A;  1FW6 A;  2Q1N A;  4E1M A;  3CXC M;  4HCC A;  1D5A A;  1IBK K;  4DSF A;  1QSS A;  3BEX A;  4ID1 A;  4O0J A;  2PFU A;  4X65 K;  3LAN A;  3TR8 A;  2HHX A;  3PY8 A;  1RCH A;  1R0A A;  2Q3S A;  1W97 L;  2WFB A;  3A5M C;  4MQ3 A;  2HST A;  4M42 A;  3O9U A;  4WYB A;  2NNW A;  3QFU A;  3OS0 A;  2HHW A;  2Q0U A;  4W5O A;  1KLM A;  3E9P A;  4B8A B;  3I8D A;  3TU5 A;  4MDB A;  1XQS C;  3GBT A;  4JKA A;  4BRH A;  3AVN A;  2JWK A;  4JI5 K;  4OLB A;  4X62 K;  5HRO A;  4ELT A;  3AVJ A;  1XMQ K;  1CZA N;  2UXD K;  1I94 K;  2O4G A;  5IWA K;  4CEC A;  3KLI A;  5C25 A;  2E8A A;  1EXQ A;  1BQM A;  4A5B A;  2AJQ A;  4FJH A;  2CGJ A;  4FM2 A;  3KVG A;  4PUO A;  2IAJ A;  4F2S A;  3CCR N;  4B3O A;  4PY5 A;  3LDP A;  4HUE A;  3F5T A;  2G8I A;  2NRR A;  3DAW A;  1A5V A;  2DPN A;  3OYM A;  2NLX A;  2P9I A;  4JI2 K;  3BF3 A;  4JI0 K;  4KRE A;  1NGF A;  4DS5 A;  3DRR A;  2GTD A;  2G8K A;  4C8O A;  4OJR A;  3THY B;  4CJQ A;  4CZH A;  4JKH A;  1GLB G;  5AQM A;  4Q0B A;  4CGG A;  3AO1 A;  3PIO L;  4DSL A;  1BIZ A;  3OYB A;  1KLN A;  4DSJ A;  3M8S A;  4A62 A;  1IBL K;  2F9W A;  3K9J A;  3H3N O;  5D3G A;  4FWS A;  4DTM A;  4DTU A;  3B6P A;  4CJ3 A;  1WLJ A;  2D0B A;  4NCA A;  3DLB A;  2P9K A;  4DLG A;  1VSJ A;  2O8B B;  3UKR B;  1W0H A;  2O8B A;  2GV9 A;  3KK3 A;  3ZT3 A;  1BOT O;  3QEP A;  5BN8 A;  1NJX A;  4DV2 K;  1T8E A;  3ZET B;  1RGI A;  1T3V A;  3SJJ A;  5JVH L;  2UUC K;  2P9P A;  3R9P A;  3KD5 E;  4DV3 K;  5LMN K;  1SQK A;  1JL2 A;  4C1N K;  1HUX A;  4JD2 A;  4CZI A;  5BPM A;  3NF9 A;  3F2K A;  3MK6 A;  4KI6 A;  3SQ1 A;  1ZYQ A;  5FRN A;  3PV8 A;  1VSI A;  3TTC A;  3HL8 A;  1S22 A;  3THX A;  4Z94 A;  4QOZ B;  4FLW A;  2KHO A;  2FBY A;  3CCU N;  4NO7 A;  1S5J A;  2IS3 A;  3MED A;  3CQY A;  4PKH A;  5EU7 A;  1SKR A;  4M3Y A;  3ASM A;  3DXK B;  1NK4 A;  4FVU A;  2O8E B;  5AQR A;  3SJH A;  4C1N I;  3C95 A;  5J1E A;  4FJM A;  3VQQ A;  3EE8 A;  5GIN A;  3MXI A;  4O8U A;  1U49 A;  3FE1 A;  3K59 A;  1RT3 A;  4BRK A;  1ATS A;  1NNE A;  1HMV A;  5M1P A;  4CED A;  3SK3 A;  3G10 A;  3VQP A;  3V4I A;  4KRF A;  4RWT A;  2FSJ A;  4KHP K;  3EKS A;  1BG3 A;  2WOM A;  4JHD A;  4B9T A;  4CEB A;  5FPD A;  3VTI A;  2ZJP L;  4DU4 A;  4CHZ A;  2XRI A;  2YNF A;  1NMD A;  2KFZ A;  5AQG A;  2IGI A;  4JI3 K;  1YJW N;  4W5N A;  2P9N B;  1ZBL A;  1GLA G;  2YNG A;  4LC9 B;  2WON A;  1WB9 A;  3WXM B;  1C6V A;  4YNQ A;  3PIP L;  2Z1H A;  4LF4 K;  3KLE A;  2ZF5 O;  2OTL N;  4IEE A;  3OYG A;  2WUS A;  4R5P A;  4JRQ A;  5A2Q O;  1NK7 A;  3VGL A;  4KHN A;  1QZ5 A;  1CLQ A;  4AHS A;  3U4L A;  4CD1 A;  4CVN E;  4OPK A;  3LDS A;  3HPG A;  5KQD A;  3C65 A;  1NJY A;  1N33 K;  3DM2 A;  5AQP A;  3NBP A;  4H0P A;  2RHK A;  3DMJ A;  4MFB A;  2A3Z A;  4DTS A;  1NGA A;  3CM6 A;  2P9S B;  4LY7 A;  4PHT X;  5CZ2 A;  3K0S A;  4JNE A;  2QK9 A;  2KFN A;  5LY3 A;  3AVC A;  3T1H K;  5KRS A;  2QKB A;  4FJ9 A;  3HPH A;  3Q7B A;  1V4S A;  5BR9 A;  4E7L A;  1NM1 A;  4KPY A;  3BUZ B;  5GAE P;  4BAC A;  3AVM A;  1C0G A;  3LP1 A;  3QIO A;  4KFB A;  3CFO A;  4HHT A;  4IXC A;  1YAG A;  3NGZ A;  4YOX A;  2E2P A;  1QE1 A;  4ZHR A;  1L3U A;  3THV A;  2NRT A;  4JV5 K;  1G99 A;  4DQ8 A;  1J5O A;  1IJJ A;  4CBU A;  4RW6 A;  4BQZ A;  1VQ4 N;  4DUY K;  1VHX A;  2IDO A;  5KPT A;  4DWI A;  1Z26 A;  4BRC A;  2BE2 A;  3QB0 A;  1BWF O;  2PYJ A;  3MMV A;  1ASW A;  5FRM A;  1U47 A;  4WF9 L;  1UOC A;  3FGU A;  1TK5 A;  4Z4E A;  3PSI A;  1FJG K;  1HYZ A;  2ZM6 K;  4WFN L;  2A5X A;  3KWG A;  1RBR A;  3ULE B;  3TTD A;  5I3U A;  3BDP A;  3ZSX A;  3K9K A;  1WSJ A;  2P51 A;  3SPY A;  3AVF A;  4FOI A;  5C24 A;  1KFD A;  4O4G A;  5C12 A;  4B1X B;  5BR8 K;  1P90 A;  3HO1 A;  1VSE A;  2GX9 A;  4M41 A;  3VF4 A;  3UIQ A;  1B9D A;  1EP4 A;  3H3O B;  4E7H A;  1L3V A;  1RFQ A;  1VQO N;  2KQ2 A;  4A61 A;  3E1Y A;  1VSM A;  1VSF A;  4FJG A;  3F9M A;  3W0L A;  3WXK A;  3MAQ A;  2VQE K;  3NFA A;  4ISG A;  3RMC A;  3C6A A;  4DQP A;  4JI8 K;  3L6Q A;  4Q5V A;  5AQS A;  1KD1 O;  5HP1 A;  3A2F A;  3WQT A;  2IVN A;  4BRG A;  5AQZ A;  5C10 A;  3I56 N;  3HP9 A;  3LZI A;  3NF8 A;  3S41 A;  3A8Y A;  3HRG A;  3AVI A;  3HST B;  3AA5 X;  2E1Z A;  2BUP A;  3MEG A;  4AH9 A;  1QS4 A;  3IDH A;  4WFB L;  1WN7 A;  3TPQ A;  4BRN A;  5FPN A;  3THY A;  4YOT A;  2RE2 A;  3WNE A;  3NH1 A;  5HRP A;  1NGE A;  3H1Q A;  3J7Y P;  1IV0 A;  1G15 A;  3G4S N;  4V19 S;  2ASM A;  5AQJ A;  2I7N A;  1T44 A;  3VQ4 A;  2EHG A;  4K8X A;  2DFF A;  1VQL N;  4ILJ A;  3GOI A;  1GLD G;  3OVN A;  1ZBH A;  4CFC A;  2QXF A;  1HX1 A;  1HQU A;  3E01 A;  3MEE A;  5CYM A;  3TAM A;  1GLF O;  3I33 A;  1RNH A;  2VG7 A;  1SZ2 A;  1X1P A;  2YX6 A;  4DU3 A;  2QA4 N;  2O8C B;  5E84 A;  1GOA A;  2GBZ A;  3KK1 A;  4G9Z A;  3M3Z A;  1JXB A;  3TAP A;  3DLK A;  1GOB A;  3LP0 A;  4I9Q A;  1U48 A;  3CCL N;  4CHN A;  3GE1 A;  3CIP A;  2YJF A;  3E66 A;  1O1W A;  2HND A;  3VQB A;  4CJW A;  2V51 B;  2OZS A;  3CJA A;  1WAF A;  3QFP A;  5AQN A;  3U3G A;  3MN5 A;  1XNR K;  1J5E K;  5HBM A;  4FM0 A;  3NVM A;  3CPE A;  2QWR A;  1NG9 A;  2D5R A;  3RWU A;  4DUZ K;  5C2D A;  3ZLJ A;  3M6G A;  1OVY A;  4FSV A;  3MXJ A;  2QWM A;  3HBT A;  1V4T A;  4LFB K;  1HYV A;  4FWQ A;  4IDK A;  3ZEU A;  4R79 A;  2HMI A;  1S1U A;  3SBG A;  3PUF A;  4N56 A;  5LMU K;  4QAG A;  2F4V K;  3L8B A;  1U6Z A;  3CM5 A;  4CJ4 A;  5KRT A;  4CD3 A;  1YIT N;  4W5Q A;  3KZB A;  4AHC A;  3PX0 A;  2G8U A;  1OH6 A;  3CME N;  2OPP A;  1UWB A;  4IOA L;  1HKB A;  4JKG B;  4M3U A;  1I39 A;  1TAQ A;  3ZX2 A;  1VSD A;  3LDO A;  2F8S A;  1XWL A;  1N5Y A;  4CF0 A;  2E2N A;  1JLA A;  3MCA B;  1ILY A;  4F9O A;  3K5O A;  5BRE A;  4DB3 A;  2GUI A;  3O3H A;  4RTF D;  2QWQ A;  5F0X A;  2CGL A;  3NMU A;  2O8C A;  4B8C A;  3EEQ A;  4M3T A;  4AHT A;  3O08 A;  3O5B A;  4GKJ K;  4O55 A;  1VSK A;  3SV4 A;  1U4B A;  2ZJQ L;  3KTQ A;  3HXM A;  4JKF A;  3V1O A;  1T6C A;  3QEI A;  3S3M A;  4CK2 A;  1S9G A;  4KV8 A;  3I8B A;  3HVT A;  1ASV A;  3CCS N;  4K43 A;  2HHS A;  1NGG A;  1MWK A;  3DRP A;  3U9D A;  2EX3 A;  1D9D A;  4DR4 K;  3K58 A;  4DTX A;  3K5M A;  4FJI A;  2X6S A;  3FZM A;  2YCH A;  4BR0 A;  4FLT A;  4HTL A;  5CHI A;  4H5T A;  1MDU B;  4BR4 A;  2W6K A;  3V9X A;  4B1Z A;  3KWI A;  4BGB A;  3LDL A;  1S6Q A;  2Q97 A;  4UY8 O;  4JS4 A;  3CER A;  1LOT B;  2FBX A;  3O1B A;  1J9A A;  2B5J A;  4YOV A;  1LW0 A;  3VES A;  2VQF K;  3KLG A;  4DF8 A;  3WXJ A;  1C0F A;  3J7Z O;  3Q7C A;  4UQG A;  3OJS A;  4BG8 A;  4JLH A;  2IVO A;  3RTV A;  3ZT2 A;  1RT6 A;  2P5O A;  2AA4 A;  2OZM A;  3SYZ A;  1TK8 A;  4YFU A;  1RDC A;  4FPB A;  3LPU A;  1HKC A;  3ZT4 A;  3U3Y A;  3O1W A;  4IO9 L;  3ZX0 A;  1NOY A;  4LF9 K;  3AO5 A;  4ID5 A;  5AJ3 K;  4FLZ A;  2YJE A;  5DK5 A;  1X3M A;  3OS1 A;  1S6P A;  4K8Z A;  1BIU A;  4DQI A;  2NRZ A;  2ZQB A;  2VYP A;  4CW7 B;  2G8W A;  1NGB A;  1CXU A;  2OPQ A;  3AGR A;  3L4I A;  3P83 D;  4PL8 A;  3WNG A;  3HYF A;  4BWJ A;  2FC0 A;  4CZF A;  3SAF A;  2P9S A;  1Z05 A;  4B9Q A;  1NOZ A;  1CXQ A;  3ZT0 A;  2DFH A;  1YTU A;  4CJS A;  4FJN A;  5JMV A;  1QQM A;  1ZBI A;  2D0O A; 
#chains in the Genus database with same CATH homology
 2O4I A;  1S5J A;  2IS3 A;  3MED A;  3O4N A;  4BE1 A;  3TAG A;  2BDP A;  5EU7 A;  2E6M A;  3NF7 A;  4GMJ B;  1SKR A;  4M3Y A;  3ASM A;  3IRX A;  3QEV A;  1REV A;  1NK4 A;  1TAU A;  4CJL A;  2Y1J A;  4FJX A;  1BI4 B;  1LW2 A;  1RT7 A;  3LP2 A;  3C95 A;  1K6Y A;  5J1E A;  3TAB A;  4FJM A;  3VQ6 A;  5HRR A;  1GOC A;  3VQQ A;  4W5R A;  4CCH A;  5HRS A;  2G8V A;  3MXI A;  4CHQ A;  1HJR A;  2X78 A;  1U49 A;  4IG3 A;  3OYL A;  3T19 A;  3K59 A;  2HW3 A;  1RT3 A;  4IFV A;  4I2P A;  1KVB A;  3DYA A;  5CYQ A;  2KZM A;  2R7Y A;  1HMV A;  3P1G A;  2A1S A;  3RR7 A;  4KB0 A;  4CEF A;  4CED A;  4CGD A;  4ELV A;  3G10 A;  1HNI A;  3VQP A;  3V4I A;  4KRF A;  1JLG A;  2PYL A;  2F8T A;  3VA0 A;  2PY5 A;  3MEC A;  1VSL A;  3QIN A;  1SV5 A;  2WOM A;  1LWC A;  1QSY A;  2DY4 A;  1SKW A;  4B9T A;  1QTM A;  4DTN A;  2HHX A;  4CEB A;  4Z0U A;  4LSN A;  1C0U A;  3OYC A;  3O4Q A;  4DU4 A;  4CHZ A;  2XRI A;  2YNF A;  4CK1 A;  1SL1 A;  4FM1 A;  2KFZ A;  1KCF A;  4L8R B;  4I2Q A;  1RBU A;  5HRN A;  4OLA A;  4FZZ A;  2IGI A;  4CF9 A;  1C1A A;  1IKW A;  1J54 A;  2D0A A;  3OYK A;  1Z25 A;  4RW7 A;  4F2R A;  2ATQ A;  2E4L A;  3SI6 A;  3AO3 A;  4KKO A;  3OYD A;  2A1R A;  2YNG A;  4CK3 A;  2WON A;  1ZBL A;  4EZ9 A;  4CFD A;  1U04 A;  1C6V A;  4CHO A;  4YNQ A;  1S1V A;  2ETJ A;  1Y97 A;  1JLC A;  1FK9 A;  2Z1H A;  3CYM A;  5KI6 A;  2PZS A;  3KLE A;  4CES A;  3S9H A;  3M8P A;  4CGH A;  1IH7 A;  4CHY A;  3NGI A;  3KD1 E;  3QIP A;  3OYG A;  4R5P A;  1BIS A;  4JRQ A;  2ZE2 A;  1NK7 A;  3RR8 A;  4F3O A;  4KHN A;  3WNF A;  4HTU A;  1NKE A;  3FFI A;  1CLQ A;  4AHS A;  3NE6 A;  1TKX A;  4OPK A;  1DTQ A;  4DFM A;  3LDS A;  4NYF A;  3HPG A;  1NJY A;  4Y1D A;  3NGY A;  4J2B A;  4O5B A;  1FKO A;  3DM2 A;  1VRU A;  1U45 A;  3KKR A;  3NBP A;  3SQ0 A;  4FZX C;  4NYN A;  4PA1 A;  3DMJ A;  4MFB A;  3VN5 A;  3ZSW A;  4DU1 A;  3L2R A;  1Q9Y A;  2OPS A;  4DTS A;  2D0C A;  2Z1G A;  3CM6 A;  3K5L A;  3NH2 A;  3TAQ A;  4LY7 A;  4CF2 A;  2Z1J A;  5CZ2 A;  4DMN A;  4ELU A;  4N41 A;  4ZTJ A;  1NKB A;  4DQR A;  4J2E A;  4RW4 A;  4J2D A;  2QK9 A;  4E89 A;  4LH5 A;  4B9L A;  2KFN A;  3LP3 A;  2VWK A;  3AVC A;  2XY7 A;  1X9S A;  1RTI A;  3ITH A;  5KRS A;  2QKB A;  4GW6 A;  1RTD A;  4IBN A;  3HPH A;  4FJ9 A;  3LWM A;  4E7L A;  1VK0 A;  2W42 A;  3P5J A;  3OYF A;  4FW1 A;  4KPY A;  4DSE A;  4FJ5 A;  4CEO A;  4BAC A;  4GVM A;  4I9L A;  4CJF A;  3AVM A;  4DFP A;  3QIO A;  3LP1 A;  4KFB A;  1X9W A;  2OA8 A;  2LSN A;  3NH0 A;  4Z4I A;  3SQ2 A;  1TKD A;  1CZB A;  3CFO A;  4HHT A;  2G8H A;  1RT2 A;  1RT1 A;  3NGZ A;  4I7F A;  4Z4F A;  3AA3 A;  3TWH A;  3SUO A;  1QE1 A;  3CG7 A;  4ZHR A;  3L2U A;  1L3U A;  3THV A;  4J2A A;  4M3Z A;  3O3G A;  1B9F A;  1IKV A;  4H8K A;  3ULD A;  4CGF A;  1J5O A;  2QKK A;  4B08 A;  4RW6 A;  4OGC A;  1ASU A;  4C8M A;  2B6A A;  5JS2 A;  1T03 A;  1A5X A;  3AVB A;  3LZJ A;  2ITG A;  3VQ7 A;  1W9H A;  3SZ2 A;  2IDO A;  2P1J A;  1EET A;  4CJ5 A;  4F8R A;  1KTQ A;  1VRT A;  4FW2 A;  2XY5 A;  2XY6 A;  4DWI A;  1Z26 A;  2VG5 A;  4FJJ A;  2BE2 A;  2PYJ A;  3KLF A;  1JLB A;  1ASW A;  3AO4 A;  3KLH A;  3EYZ A;  3TAE A;  3V1R A;  5FRM A;  3KJV A;  1U47 A;  4KAZ A;  4CFA A;  4DTR A;  1UOC A;  1UA0 A;  1NJW A;  1QHT A;  3VQC A;  1TK5 A;  3C6T A;  4QCL A;  4DG1 A;  4Z4E A;  1WSG A;  1NJZ A;  3D0P A;  3QNN A;  1WSF A;  4CHP A;  1C0T A;  4BDP A;  1D8Y A;  4EP4 A;  1HYZ A;  5K14 A;  4DLE A;  3NDK A;  1SL0 A;  1N6Q A;  1A5W A;  3V9U A;  5J2N A;  2KTQ A;  3HT3 A;  2RKI A;  5C42 A;  4KTQ A;  1RBR A;  3SCX A;  2YKN A;  3AV9 A;  1XHZ A;  5I3U A;  2HVH A;  1C1C A;  4JS5 A;  3EZ5 A;  3OYH A;  3V9W A;  3KIO A;  4IFY A;  1RTJ A;  3BDP A;  3ISN C;  3ZSX A;  4G1Q A;  4M45 A;  4M3X A;  1WSJ A;  2P51 A;  3PO4 A;  3VQ9 A;  2FBV A;  3SV3 A;  3SPY A;  2IC3 A;  3AVF A;  4AHV A;  2HHQ A;  5C24 A;  3ALY A;  1KFD A;  4O4G A;  4W5N A;  3ZSV A;  1T7P A;  4Z4G A;  1YVU A;  3PO5 A;  3ZSZ A;  1LAW A;  1SKS A;  3DLG A;  3HO1 A;  4FZY A;  1VSE A;  3TAR A;  3DLH A;  3AVG A;  4C8N A;  4LSL A;  3T3F A;  4F3T A;  4HVJ A;  4M41 A;  1S1X A;  3UIQ A;  1B9D A;  1EP4 A;  4E7H A;  1L3V A;  4DFJ A;  3DRS A;  3OS2 A;  3IS9 A;  4M3W A;  2KQ2 A;  3L3U A;  5FDL A;  3HPO A;  1UAX A;  1L3S A;  1VSM A;  1VSF A;  4FJG A;  4HCB A;  2X6N A;  3SUN A;  3MAQ A;  3RMA A;  4KO0 A;  1TL3 A;  2F96 A;  1RIL A;  3NFA A;  4KHU A;  4W5T A;  3RMC A;  4DQP A;  4O44 A;  4Q5V A;  3CFR A;  1BL3 A;  4CGJ A;  3ZSO A;  4KB1 A;  4RW8 A;  3SUQ A;  1IO2 A;  3A2F A;  3KK2 A;  3EY1 A;  5HP1 A;  4KHW A;  3LZI A;  3HP9 A;  4FCY A;  3NF8 A;  1I3A A;  2YNI A;  4FJ8 A;  3QEX A;  3AVI A;  1DLO A;  3HST B;  3AA5 X;  4KHY A;  1BCM A;  1JLE A;  3MEG A;  3OY9 A;  4AH9 A;  1SL2 A;  4CEZ A;  5SWM A;  1BGX T;  2RF2 A;  4OGE A;  1QS4 A;  2VWJ A;  1WN7 A;  1C1B A;  4E7J A;  1TK0 A;  1FXX A;  4CJR A;  1NK9 A;  4C8L A;  3K57 A;  3ZSY A;  3WNE A;  1L3T A;  3RMB A;  4ICL A;  4KTZ A;  3L3V A;  3V9S A;  3TAF A;  4FJK A;  3NH1 A;  5HRP A;  4CJP A;  3RRG A;  4BDZ A;  1WSH A;  1XI1 A;  1KFS A;  4FLY A;  4E1N A;  5SZT A;  2YKM A;  4FK2 A;  1G15 A;  1HPZ A;  1CZ9 A;  5FRO A;  2NUB A;  1IKX A;  3M8R A;  1RT5 A;  3VQ4 A;  3ZT1 A;  2EHG A;  1LAV A;  4K8X A;  4OKE A;  2DFF A;  4CER A;  3OVN A;  4OKK A;  4DSI A;  1ZBH A;  4PWD A;  4CFC A;  2RPI A;  2HHV A;  1WSI A;  2QXF A;  3DLR A;  3DLE A;  1IG9 A;  1JXE A;  3HM9 A;  1HQU A;  3S3O A;  1S9E A;  5I42 A;  3E01 A;  3MEE A;  1NK5 A;  5CYM A;  3TAM A;  1DTT A;  1NK8 A;  4DQS A;  1RNH A;  2ZD1 A;  1LWE A;  1B92 A;  2VG7 A;  1X1P A;  1RBT A;  2B4J A;  1TKT A;  2YHB A;  3OYJ A;  4DU3 A;  4IKF A;  4E7I A;  5E41 A;  4NCB A;  3SPZ A;  2DTU A;  4CGI A;  2YNH A;  3DOK A;  4FLX A;  1XHX A;  2I5J A;  4LH4 A;  1GOA A;  3OYE A;  1TGO A;  2GBZ A;  3KK1 A;  2X74 A;  3F9K A;  1LWF A;  4CJU A;  3L2V A;  1Q8I A;  3CQ8 A;  4DTP A;  2FBT A;  4B9U A;  1RDB A;  4N76 A;  3V81 A;  4E19 A;  4DS4 A;  4KHQ A;  1WSE A;  2XY8 A;  2KW4 A;  1JXB A;  3TAP A;  1RT4 A;  3DLK A;  1ZBF A;  3H08 A;  4KTW A;  1KSP A;  1F21 A;  1GOB A;  1RBV A;  3LP0 A;  4I9Q A;  1U48 A;  4CHN A;  1EX4 A;  4LD0 A;  5J2Q A;  1BHL A;  1JLF A;  3KKS A;  1KVC A;  4AIL C;  1O1W A;  3IG1 A;  2HND A;  4TSX A;  3VQB A;  4CEQ A;  4CJW A;  4B9N A;  4CJT A;  2OZS A;  2Z1I A;  1JLQ A;  3I0R A;  2OPR A;  3QER A;  1WAF A;  3U3G A;  4C8K A;  3OYI A;  3TAN A;  2HVI A;  4RG8 A;  3ZSQ A;  1JL1 A;  3PX6 A;  5HBM A;  4KHS A;  4FM0 A;  3HP6 A;  3LWL A;  1SUQ A;  3C94 A;  4N5S A;  3HVR A;  1T05 A;  3VA3 A;  2HB5 A;  3NAE A;  1J53 A;  1NK6 A;  1BI4 A;  3DOL A;  3SQ4 A;  2D5R A;  3RWU A;  1BQN A;  1S1T A;  4Z4C A;  3PX4 A;  4FYD A;  3WNH A;  3ZCM A;  3MXJ A;  4FXD A;  3VQE A;  4B9M A;  2KZZ A;  4E1M A;  5J2P A;  3SNN A;  1HYV A;  4IDK A;  4HCC A;  5J2M A;  2YHA A;  1D5A A;  1TVR A;  2HMI A;  1S1U A;  4DSF A;  3AA4 A;  3F73 A;  1QSS A;  3PUF A;  3D45 A;  4ID1 A;  4O0J A;  4AHU A;  4CIG A;  4CJK A;  4N56 A;  4FJ7 A;  4QAG A;  3LAN A;  3VQ5 A;  3L8B A;  3CM5 A;  3TR8 A;  3V1Q A;  4CJ4 A;  4IG0 A;  1RCH A;  1BCO A;  5KRT A;  3PY8 A;  1S1W A;  3K5N A;  1R0A A;  4FK4 A;  2Q3S A;  3M8Q A;  4AHR A;  3T1A A;  4FVM A;  4W5Q A;  1QQC A;  4AHC A;  3L2W A;  3PX0 A;  4OVL A;  1X9M A;  5CZ1 A;  2G8U A;  4KI4 A;  4MQ3 A;  4B9V A;  2OPP A;  1UWB A;  3QEW A;  4M42 A;  4EZ6 A;  2JLE A;  4M3U A;  1I39 A;  2VG6 A;  4PQU A;  1TAQ A;  2JGU A;  3OS0 A;  2G8F A;  1VSD A;  4FJL A;  2HHW A;  2F8S A;  3OYN A;  1XWL A;  1N5Y A;  1YTA A;  3HJF A;  4CJE A;  4W5O A;  1HYS A;  1KLM A;  4CF0 A;  5CY4 A;  1JLA A;  4B8A B;  3TI0 A;  3L2Q A;  4O0I A;  3I8D A;  4BWM A;  3K5O A;  2GUI A;  3O3H A;  1QSL A;  4B9S A;  4CFB A;  1JKH A;  3AVN A;  4XIU A;  4BDY A;  2P5G A;  4N47 A;  4CE9 A;  4OLB A;  5HLF A;  5DMR A;  4DTO A;  1TKZ A;  5HRO A;  4B8C A;  4ELT A;  3AVJ A;  4FLU A;  1KRP A;  1HNV A;  2E6L A;  4M3T A;  4AHT A;  1UA1 A;  1NKC A;  3C6U A;  2O4G A;  4CEC A;  3KLI A;  2Y1I A;  5C25 A;  4EP5 A;  4O55 A;  1D9F A;  1EXQ A;  1VSK A;  1BQM A;  4Z4H A;  3SV4 A;  4DFK A;  1U4B A;  3KTQ A;  3HXM A;  4FJH A;  3V1O A;  4HUF A;  2AJQ A;  1ZBU A;  2XO7 A;  3RRH A;  4FM2 A;  2HHT A;  1IKY A;  3QEI A;  3S3M A;  2IAJ A;  1S9G A;  4CK2 A;  4F2S A;  4PUO A;  4KV8 A;  1RDA A;  3RMD A;  1WNS A;  3B6O A;  2BGG A;  4B3O A;  3HVT A;  1ASV A;  4PY5 A;  1RBS A;  1YT3 A;  1EKE A;  3AVA A;  1MU2 A;  2HHS A;  4H4M A;  3HK2 A;  3JSM A;  4HUE A;  4BE0 A;  1VSH A;  3DRP A;  2G8I A;  2EX3 A;  1D9D A;  3K58 A;  4DTX A;  3K5M A;  4HUG A;  1A5V A;  5T7B A;  4OKJ A;  3OYM A;  2IOC A;  2X6S A;  4FJI A;  4DTJ A;  4FLT A;  3G0Z A;  4CJV A;  3VQ8 A;  3VQA A;  3SUP A;  3OYA A;  4E0D A;  4KRE A;  4DF4 A;  4DS5 A;  3VQD A;  3DRR A;  5KGX A;  2G8K A;  4CF1 A;  4C8O A;  4OJR A;  3V9X A;  4FK0 A;  4CJQ A;  3LAL A;  4JRP A;  1S6Q A;  4H4O A;  3CFP A;  4JS4 A;  1HQE A;  3ZSR A;  4Q0B A;  4CIE A;  2FBX A;  1J9A A;  3I0S A;  2B5J A;  4CGG A;  4DSK A;  3AO1 A;  3JYT A;  3AVK A;  3NF6 A;  4DSL A;  2XHB A;  4F4K A;  1RDD A;  1BIZ A;  1LW0 A;  3OYB A;  1KLN A;  4DSJ A;  3M8S A;  3V6D A;  4CEE A;  3KLG A;  4DF8 A;  1NK0 A;  2HNZ A;  1C0M A;  4Y1C A;  2OYQ A;  3AA2 A;  1RTH A;  5D3G A;  4E7K A;  4UQG A;  3OJS A;  4JLH A;  4DTM A;  3S3N A;  3RTV A;  4DTU A;  3ZT2 A;  3B6P A;  4NCG A;  4CJ3 A;  1WLJ A;  1RT6 A;  2D0B A;  4WE1 A;  3DLB A;  2P5O A;  4NCA A;  3NCI A;  4DLG A;  3QNO A;  1VSJ A;  3O3F A;  3SYZ A;  2OZM A;  5KTQ A;  1W0H A;  1TK8 A;  2HNY A;  1ITG A;  4YFU A;  1RDC A;  3LPT A;  1Q9X A;  5JS1 A;  3LPU A;  2GV9 A;  3QES A;  3ZT4 A;  3U3Y A;  2DFE A;  3KK3 A;  3ZT3 A;  1HRH A;  2YV0 X;  3DI6 A;  1L5U A;  4BE2 A;  3QEP A;  1NJX A;  1NOY A;  1T8E A;  3AVH A;  3AVL A;  4RW9 A;  1LV5 A;  3QO9 A;  3SJJ A;  3AO5 A;  4ID5 A;  4ZTF A;  1FKP A;  2BAN A;  4FLZ A;  3KD5 E;  4CF8 A;  5DK5 A;  4DQQ A;  3OS1 A;  3QET A;  3LAK A;  4CEA A;  1JL2 A;  1S6P A;  4K8Z A;  3MXM A;  1BIU A;  4DQI A;  4FLV A;  1TV6 A;  2ZQB A;  2G8W A;  3QLH A;  1CXU A;  3U6F A;  2OPQ A;  5KGW A;  3P83 D;  1WAJ A;  1TL1 A;  3NF9 A;  3LAM A;  3WNG A;  3IAY A;  4KI6 A;  3AO2 A;  3SQ1 A;  2RN2 A;  3OJU A;  3HYF A;  4BWJ A;  2FC0 A;  3V9Z A;  1XC9 A;  3K2P A;  3NHG A;  1ZYQ A;  5FRN A;  3PV8 A;  1VSI A;  3BGR A;  1ZBI A;  3HL8 A;  1NOZ A;  1CXQ A;  3ZT0 A;  4FLW A;  2DFH A;  1YTU A;  4OPJ A;  4CJS A;  4QOZ B;  4FJN A;  4CIF A;  2HHU A;  1KVA A;  2FBY A;  4M3R A;  4E3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...