4DV7K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g, bound with streptomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 30
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv7K00
1HNXK 4X65K 1IBKK 4LFBK 3J7YP 3JAMO 4X66K 1XMQK 4DUYK 5LMUK 4DUZK 4LFCK 2F4VK 4DV2K 4JI7K 1N32K 2UXBK 4AQYK 4LF9K 1IBMK 4LF4K 4X64K 2UU9K 5LL6Z 1XNQK 4DV1K 4DR4K 4KHPK 5AJ3K 5LMNK 1XNRK 4V19S 3J7AP 1FJGK 2HHHK 4JI1K 2UXDK 3J81O 3T1YK 1N33K 1N34K 1I94K 4DR2K 4B3TK 4NXNK 1HR0K 5IWAK 4DR5K 4DV7K 4CVNE 4DV5K 4JI6K 4YHHK 1IBLK 4B3SK 2E5LK 4OX9K 4DV0K 4DV6K 2UUBK 4JI8K 1HNZK 2ZM6K 2UUCK 1XMOK 5A2QO 4JI2K 5IT9O 4DR1K 4CW7B 4LF8K 2UXCK 3OTOK 4YY3K 4LF7K 4B3MK 4JI4K 4JV5K 4DR3K 2VQFK 1J5EK 4JI5K 4DR6K 4GKJK 2VQEK 1N36K 4GKKK 4X62K 3T1HK 4JI3K 4DR7K 1HNWK 3J80O 4NXMK 5FLXO 4JI0K 2UUAK 4LFAK 4DV4K 4LF6K 4B3RK 4DV3K 4LF5K 4JYAK 4K0KK 5BR8K
chains in the Genus database with same CATH superfamily
1LV5A 1W9HA 4FW1A 2V52B 5FPNA 1NGEA 4UQGA 1WBDA 4K8XA 4J2DA 4GNIA 2JWKA 3BGRA 2OTLN 3W0LA 1DKGD 4BGBA 4E1JA 3HVRA 1VQPN 2UU9K 4WQ5A 3S3OA 1KRPA 2E1ZA 2QWPA 4CHPA 4XIUA 1ASUA 1NGAA 1HYZA 2PZSA 2RKIA 2X6NA 4NLCA 4M7YA 4MDBA 4DTXA 5AQSA 3J7ZO 4BRCA 1G15A 3ZSQA 2D4WA 4F2RA 3SZ2A 2XRIA 1YUWA 2HB5A 1Z25A 1IKXA 1LOTB 3DLGA 4O4GA 4YDUC 3V9SA 4WYBA 1CLQA 4W5TA 3DYAA 3V1OA 2X78A 3SNNA 1RT3A 1TYQA 1S1WA 4PL7A 4CGFA 4FWOA 4G1QA 4YHHK 4K25A 4XH5A 2NRWA 2F8TA 2ZJRL 3CC4N 4CERA 3HI0A 5BRHA 1L5UA 4MO5A 4IKFA 1DTQA 2HVHA 4MDAA 4FM2A 3SUPA 1RT6A 3AVIA 3DXKA 5CZ1A 3QEWA 4M3RA 1RTJA 2YJEA 4JLHA 3F73A 1WAFA 4DR3K 1D9DA 3RR8A 4CCHA 2AP1A 1VRTA 1L3VA 4IOXA 3NDKA 2PAVA 1KTQA 4CF2A 5AQMA 4ZTJA 4N76A 4B8CA 2KW4A 1VSHA 3JXUA 4FOEA 4QOZB 4EFHA 5ADXA 2D0OA 3LDNA 2QWLA 5KRSA 3O9TA 2NRVA 4DSIA 4K8ZA 1ESVA 3ZX3A 3CJ1A 4FJHA 3F5TA 5LJWA 2BUPA 1S1VA 1RBSA 3ZSVA 4DG1A 4KV8A 2A40A 5EX5A 2ZJPL 4X65K 1Y64A 4YOWA 3NGYA 3ZSYA 5GINA 3SYZA 1N32K 2BDPA 5GAGP 3D2FB 4IFEA 4DQRA 4IDHA 2P9PA 1W0HA 4KBOA 4CZGA 5AR0A 2OPPA 5LL6Z 2A1RA 3DLKA 1QHTA 4CEBA 2PYJA 4JKAA 4JKBA 3LANA 4O0IA 2GBZA 1IG8A 2WONA 4JHDA 2FBVA 1RDUA 3BY5A 3ENHA 4LH5A 4DSKA 2AA4A 3WEEA 3MMVA 4CEQA 3SAGA 4ZHRA 4F2SA 4CFAA 4CK1A 3N4QA 4FWPA 1N33K 5C24A 3KIOA 3O08A 3CYMA 5SZTA 1LWCA 4FO0A 3L4IA 3E01A 4DV7K 5BPMA 5JVHL 1GLCG 4BG9A 3MXJA 3OYHA 4B9VA 4KPYA 4BDPA 2E2NA 3H3NO 3V1QA 3H08A 3IUCA 1HUXA 3QICA 4AILC 3SQ1A 3MEGA 4GMJB 4C8NA 3LM9A 5GAHP 3D45A 3R9PA 2KFZA 3LPTA 3T1AA 1XI1A 4EHTA 1ZC6A 3KWIA 3OYIA 4CHYA 1CZ9A 3RMDA 3C6UA 1KXPA 1BISA 1UA1A 4CEEA 5AQYA 3P39A 4Z0UA 1NK8A 3OYFA 3C7NA 4CJKA 4JEPA 4DTNA 1JLGA 2Z1IA 4X62K 3OYBA 3RTVA 4O55A 3C6HA 3QIOA 1G99A 5I3UA 4J2AA 1Q82O 1KVAA 4DS5A 4JI3K 5FRNA 1BA1A 4CZJA 3KWGA 3FLCO 1KD1O 1C1AA 3U9DA 3VEVA 4JKEA 3CM5A 3DXMA 1ZBSA 2YHBA 1I39A 5AQLA 4XH4A 3TR8A 4EZ6A 4H5VA 3LP3A 3VGLA 3THYB 4QCLA 4K0KK 2O8DA 1QVGM 2A42A 2G8IA 2F4VK 4DWIA 2GUIA 3AA5X 1IBMK 3H46O 1TKDA 2B6AA 4ZTFA 4FVUA 4O8KA 4B1WB 1SUQA 1XNQK 1SL1A 3NHGA 4H0OA 4BY9C 1Z05A 2YHWA 2X6SA 5LMNK 1RBTA 2EWSA 1M90O 1EXQA 4MO4A 3SAFA 4RW4A 3V4IA 4BC5A 5CR4A 4JI1K 4RW7A 5AQHA 1J54A 3A5OC 4BWJA 2QWOA 1HPZA 1UOCA 2FBTA 3ZT3A 3VQ4A 3TAEA 3I8DA 1KAXA 4DS4A 2YHAA 1JCGA 4OLAA 2R7YA 3AVAA 1VSJA 4BQLA 4CJWA 2A3ZA 1ZBLA 4DV6K 3LPUA 3VF6A 4K42A 1MDUB 4BRFA 3RRHA 2UXCK 3KKSA 3B6PA 4FLVA 2DPNA 3NGIA 2XO7A 2Y1IA 4YOXA 1R59O 1S6PA 4FWNA 4B08A 5EXWA 3HP9A 4O8UA 1U48A 3IFRA 5DM7L 5CE3A 4CJVA 1NNEA 3U6FA 4RTFD 1NK9A 3CJ7A 3M6GA 3CMEN 3KJVA 3DWLA 2IC3A 4HTUA 3FZLA 3T69A 3VQEA 4DMNA 4PL8A 3OYMA 3I0RA 3MEEA 1J53A 3CETA 4F3OA 1SV5A 4DSFA 2DFFA 1HX1A 3P1GA 4H5RA 2Q3SA 1BOTO 1V4SA 4LF5K 4JYAK 5T7BA 1J6ZA 5JLHA 1S1XA 1S5JA 4NYFA 3DLHA 1NGDA 3KK1A 1T03A 4CJRA 3ZX0A 1RT5A 2NRXA 5M1QA 4LF9K 3DI6A 3OS1A 3AVKA 4FJJA 4DTSA 1BQMA 3ZCMA 1BWFO 1HMVA 1C1CA 3F2KA 4JN4A 4V19S 4DTJA 1QS4A 1D9FA 2HOEA 4FJ8A 3UKRB 2P9SB 3K0SA 3AGRA 4A62A 3VENA 3CHWA 3J81O 4JK7A 1B9DA 3DOKA 3AV9A 3D2FA 2E2PA 3E66A 1K73O 4I9QA 4DR5K 3PV8A 4H03B 2XY6A 5AQQA 4EHUA 5AQGA 1RT7A 3G10A 2RN2A 2PBDA 1ATRA 3AAQA 5M1NA 3MN9A 1YT3A 1VSFA 1GLFO 1I3AA 2WBNA 3D7EO 3LP1A 2QA4N 2O8CB 5BN9A 2ITMA 3O3GA 3DMJA 3VEXA 4FWQA 4CF8A 1J9AA 4CECA 4CIGA 3TTCA 4NCAA 4AHCA 4JI5K 1W2BM 1Q9YA 2GV9A 4N41A 3RSEB 3VETA 3VEWA 4E3SA 3AVFA 3FZFA 4BRPA 4DLEA 3BF1A 4AHSA 4N47A 3VQAA 1VK0A 5HLFA 4KFBA 5C15A 3AY9A 3SLCA 2HBJA 4AHRA 3SUNA 1U47A 4CHQA 1JLBA 2ZJQL 3PY8A 3UIQA 4BR2A 3E1YA 1C0GA 4O0JA 4M3WA 4CGIA 3THWB 3J80O 3GDQA 4HUEA 4EP5A 1TAQA 3ASMA 3VF4A 3AVHA 1NGHA 5HRSA 5SWMA 1VSKA 3VQPA 4PHTX 3PSFA 4B1ZA 4FJMA 2HF3A 1IBKK 5AQNA 5HROA 1L3TA 4CJEA 3J7YP 3MCAB 3JAMO 3LZIA 1SAZA 3R8EA 3CCVN 4JS4A 2QKKA 4BR7A 4FCYA 4FVMA 1NG9A 1A5XA 2O8BB 5EVZA 1KLMA 2YNHA 4FLTA 1RDAA 5AQRA 1BCOA 1TKXA 1RCHA 3QFUA 4WQ4C 1NGJA 3SUQA 3B6OA 4JD2B 2O4IA 1C0MA 1NMDA 1NJZA 2RPIA 2GX9A 3M8PA 3THYA 5D3GA 1Z6RA 3TPQA 3EZ5A 1S72N 4WQ4A 3LAMA 3BZCA 3OA9A 3WXMB 4FWMA 4EAHD 1VHXA 2HHHK 1JLQA 4F4KA 4IOAL 3GE1A 3L0QA 3BUZB 3U8XA 3EKUA 4CBWA 4GV6A 3TARA 2PYLA 1YI2N 4FLXA 4BVPA 1GOBA 1EX4A 2P1JA 3DRRA 4FPAA 4QS9A 3WXKA 4KHYA 5GIOA 1ATSA 2RF2A 3Q7CA 3QINA 5M1OA 1U6ZA 3D0PA 4Z4FA 4FJGA 1DGKN 4CW7B 3MWPA 4RW6A 1Q9XA 4AH9A 4BG8A 1NLVA 3PX6A 2QKBA 3CQ8A 1ILYA 2NRZA 4PKIA 3OYKA 3VMFB 1R0AA 5C0YA 1QQNA 1QQMA 4YOTA 4B1XB 1BIUA 3HPHA 1RGIA 4KREA 3NFAA 4KHWA 3RR7A 1NK7A 2HHWA 4I6MB 1JL1A 4LH4A 3QMLA 4LSLA 5BN8A 4JNEA 4N5SA 3LM2A 1NK5A 4BQZA 4KHQA 4ISGA 4DTOA 2AJQA 1JKHA 3OJUA 2IVPA 2OTJN 2FF3B 4O5FA 3EEQA 4KH4A 1VQLN 4WFBL 2G8VA 1Q18A 4FWSA 5KQDA 2F8SA 3NF9A 4X66K 5AQKA 2DFEA 2QI2A 1WSIA 3DM2A 1QSLA 1RBVA 4FWLA 5DM6L 3CC7N 3L2WA 3L4QA 5ADXH 3KLHA 2GTDA 1T6CA 4KHPK 4BRNA 4KKOA 2HMIA 3KHYA 2ZGZA 3FR0A 3QLHA 4CEAA 3H1QA 4IBNA 3VQCA 3O9UA 3G6EN 4LSNA 4CIFA 1ZBUA 4WQ5C 4IJNA 4DFJA 1BQNA 2D0AA 3SBGA 1MWMA 1YTAA 3C6TA 2P51A 1O13A 4NLBA 4YOVA 1WSHA 4DQIA 2EX3A 3IKMA 5C2DA 3DOLA 4ID1A 3MXIA 4HVJA 3M3ZA 3UKRA 4CJFA 2P9SA 5AQTA 4JI2K 1KSPA 4GY2B 4DF4A 1WSEA 5KTQA 3KK2A 4JV5K 4FJXA 2JGUA 4GV3A 3OYDA 5H1SQ 1BCMA 2YJFA 2IDOA 4CJ7A 3P31A 1RDCA 3TSQA 1HNVA 3GG4A 2YHYA 2Z1JA 4GVEA 3HSTB 3CJBA 4FWRA 3O9RA 1S3XA 4OLBA 3HO1A 3CG7A 5KI6A 4DHYA 2O8CA 3VN5A 1D4XA 3AO2A 4GV9A 1HJOA 2IGIA 3T19A 3VERA 2E4LA 4JKDA 2HNDA 1NK0A 1WN7A 3LZJA 4KH6A 1NOYA 1NK4A 1HPMA 1N5YA 3NH0A 3RSEA 2UUAK 1QQOA 1FXXA 2HMPA 1LCUA 2CGKA 2X74A 3KLEA 2CGLA 4B1VA 1ASVA 4FL9A 3QEIA 3KZBA 4C23A 1IKVA 2E88A 3MX5A 4PA1A 5CY4A 4KB1A 4LFBK 4KI6A 1JXBA 2W41A 2D0CA 4LFCK 3O9SA 4BDYA 2HBMA 4DV2K 1NKEA 2ATQA 3TU5A 3THWA 1YAGA 5FPMA 4CZIA 1WNSA 1VQON 4HCCA 4E7LA 2A6AA 3AVMA 1BL3A 5LY3A 3CJCA 1TK0A 2OZSA 1E4FT 4C8KA 3SMSA 3L2VA 2A1SA 3A5MC 3O4QA 3L2RA 1W7AA 2W42A 1FJGK 3TSPA 1HYVA 3GL1A 3CCUN 3T1YK 2O8BA 2VG7A 1YJWN 1ZBHA 3PLAA 4DR2K 5C10A 4BWMA 4FJ9A 2KKZA 2W6KA 5CHIA 1F21A 4JD2A 4FJ5A 1HQUA 3V9WA 4FK0A 2E5LK 3VQBA 1XHZA 4Q0BA 1LAVA 5AQFA 2NUBA 5F1XA 1LWFA 3FGUA 3O8MA 3BEXA 1NMNA 2BGGA 4DFPA 1QE1A 3OTOK 3ZSWA 4CZKA 5AFUA 4LF7K 1C0FA 1KC8O 5JMVA 4JKHA 4CK2A 3OBWA 2VQFK 5J2NA 4BRHA 4AF1A 3K5MA 3O5BA 3M5RA 5EOYA 3OS2A 5JS2A 1IG9A 3VTIA 2P9UB 4E7KA 3HRGA 1HQEA 3I56N 4M3UA 3OS0A 2IAJA 3VEOA 3M8SA 4Z4CA 2P9LB 5LJVA 2NNWA 5FRMA 5AQUA 5EU7A 2Q1NA 2F9TA 4ELUA 1BDGA 4YOYA 3U3YA 2WFBA 2YNIA 3EL2A 1HNWK 1X9WA 1RTDA 4LFAK 3A5LC 1TV6A 2F7TA 4DQPA 2YCHA 4QAGA 1OVQA 3N4PA 4BDZA 3QIPA 3JS6A 4H5NA 4JRPA 3I8BA 2Q0RA 4DTMA 1HJRA 4I6MA 4FK2A 4B9TA 1JJ2M 2KTQA 3CCMN 4FJ7A 3EZWA 3QDKA 3HXMA 1JCEA 1Q81O 4JAXA 4DFMA 2HHTA 4MFBA 2CGJA 4BRGA 5AQXA 4CESA 3DRSA 1C0UA 4JS5A 5J2MA 4DR4K 3SQ4A 4RWTA 2HNYA 3LDPA 4DCHA 1U2VB 3VF2A 2NRTA 4OGCA 3ZSOA 1M1KO 5KRTA 4FSVA 3H3OB 3IAYA 1ITGA 1Q8IA 3K59A 4OPHA 4BREA 4B3SK 3LDQA 1D5AA 4M3YA 1O1WA 1NJXA 4CZFA 2ZM6K 4BR5A 2J4RA 1BU6O 1S1UA 2HSTA 1NGCA 3TANA 3QETA 4I9LA 4BRMA 1UAXA 3CPEA 4FPBA 1J5EK 1QVFM 5F0XA 1T6DA 2E6MA 1WSJA 4W5OA 4DR6K 1OH7A 3WNFA 2ZGYA 4OKJA 5AQIA 3SK3A 4N56A 3CQYA 3A5NC 3HPOA 3HZ6A 2XY7A 3A2FA 1JCFA 3OYGA 3ZSXA 4Q5VA 3KD5E 1NKCA 3HSCA 3CF5L 2YX6A 2HBLA 5HOOA 2BH1A 3ZT2A 1NJIO 1VSEA 3K2PA 3HJFA 2D0BA 2HVIA 1GLDG 5E84A 4B9SA 4KHNA 1HLUA 4AHUA 3THVA 2FXUA 3ULDA 5BRFA 1VRUA 2E6LA 3EO3A 4NCBA 4BRAA 1Q86O 1N6QA 1FKOA 3VTHA 4UY8O 2FLOA 5AQJA 2Q2RA 4M45A 3HPGA 3DLBA 4F8RA 4M3TA 3RVCA 4DTPA 2HW3A 3OHRA 4B1UB 4CJUA 5AJ3K 1HRHA 3ALYA 1S22A 4FW2A 3ATVA 4ILJA 5BPNA 3VEYA 2Y1JA 4BC4A 4RCHA 3TAPA 1SKSA 3EKSA 4MQ3A 3VQ7A 3LAKA 5GIPA 5JLFA 3WQTA 5TKYA 1VSDA 4M63C 1NOZA 1NWKA 2BTFA 4CK3A 2P9IB 1YIJN 1WUAA 3DRPA 5C2FA 4DLGA 4IFYA 3MK6A 1X9JA 1WAJA 4B3OA 4CEZA 1TUYA 3LALA 2KQ2A 4CFCA 2P5GA 3WXIA 1RNHA 3O3FA 4E7HA 3D6RA 1HKBA 2QWRA 1UA0A 2PY5A 3SI6A 4BRIA 3VPZA 4OJRA 3J8AA 4CFDA 3JYTA 2E1YA 3AVCA 3OY9A 3THXB 4OGEA 4H0VB 4PUOA 4GKKK 5TKWA 3CC2N 3C95A 3QBXA 3H45C 2GWKA 4YOUA 4OPKA 4IEIA 1NGIA 3CJAA 3O1BA 4BC3A 4KH5A 4AM6A 4I2QA 1QQCA 3NE6A 3FFKB 2P9UA 1S6QA 3LL3A 1BIZA 3P83D 3NBPA 4DV3K 3OYCA 4FM1A 2B4JA 1BO5O 3L3VA 4H0YB 4JKGB 1T3VA 3NF6A 3KD1E 3AVNA 1SS6A 2OPQA 2GELA 2HNZA 2P9LA 3DJCA 5BREA 3IRXA 4IZ9A 1EQYA 4CD1A 4C1NI 4AQYK 1RBRA 1RBUA 4B9NA 4X64K 2FBXA 4W5NA 1JL2A 4ILHA 4KHSA 4CF1A 2P9NB 2Q97A 5C25A 1QSYA 1VQ7N 3PIOL 1JLCA 1RDWX 1UWBA 3I55N 4H5WA 3CCQN 1RTIA 1GOAA 3OYEA 4IEEA 4A61A 2XY5A 3NH2A 3DLLL 1WB9A 3AA3A 4FLZA 4Z94A 3BP8A 4XEIA 1RDBA 4AHTA 3HL8A 3NCIA 1CXQA 2HHQA 2ITGA 1JLAA 3AO4A 3CD6N 1CZBA 3V6DA 4A2AA 3UB5A 2ZD1A 1IBLK 4CE9A 1X3MA 3AO3A 1WSGA 1DEJA 4MLEA 3VEZA 2UUBK 3SUOA 3MXMA 1T7PA 1K8KB 4KRFA 5A2QO 1U2VA 1VQ8N 5J1EA 3O3HA 4DR1K 4HWIA 2A5XA 3VQQA 3RRGA 3UE5A 4ELTA 2VWBA 1KVBA 2IVNA 3KVGA 4PWDA 3NVKA 4C1NK 5J2PA 3W3DA 2HBKA 2LSNA 4CJPA 4YNQA 1VQ4N 3MN7A 4FZZA 3L3UA 3QB0A 5J2QA 1N36K 3K58A 2ASOA 1U45A 3SV4A 3PX0A 3T1HK 1GLLO 3MN6A 3ZT4A 5FROA 2G8HA 3TTDA 2JLEA 3U3GA 3HBTA 3CFOA 2IS3A 1IH7A 4E1NA 1K8AO 5JICA 5BRDA 1ZYQA 3QNOA 1ZXOA 4CHOA 4BRKA 1S9GA 4CBUA 5ELZA 3O4NA 2P9KB 4LF6K 5GAEP 1QHAA 4GW6A 2Z1GA 3CMAN 4Z4IA 4ILGB 1SL2A 5BR8K 1BGXT 1BI4B 3VQDA 3EE8A 3CI5A 1ATNA 4FZXC 3SQ2A 1DTTA 4CD3A 5CZ2A 3VA0A 1Z26A 4LF4K 3HM8A 1JLEA 3AAPA 1TL1A 3FZMA 3V1RA 1EO1A 4FYDA 4DV1K 1N8RO 1BUPA 4R79A 2HHVA 4H8KA 3FZHA 2G8FA 4KO0A 1QZ5A 1W97L 3A8YA 1VQ6N 1KAYA 4B9UA 2FF6A 3J7AP 4EP4A 2VGNA 4CJSA 3PX4A 3FE1A 4K43A 2FBYA 4YFUA 5BPLA 1NKBA 3L6QA 1HYSA 4IXCA 3CFPA 3CCRN 1FW6A 1GOCA 1KVCA 3ZEUB 4E19A 5IWAK 3ZLJA 4ELVA 3PO4A 1XC3A 2NZTA 4CZLA 1C1BA 3FFIA 1VQKN 1WOQA 3L2UA 4DU3A 1BA0A 3CCEN 1S9EA 4EIAA 2QEXN 3ZSZA 1HNZK 3WNEA 2UUCK 4JRQA 3H6EA 3OYNA 3RMAA 3G71N 5AZJB 4CJLA 3U9ZA 1A5VA 2QWMA 3C6AA 4FJLA 4FM0A 1OH6A 1BG3A 3WXLA 4CGHA 3OW2M 2P9IA 4ISEA 4H0PA 1DT9A 1VQ5N 1XC9A 3SJJA 3TWHA 1YJ9N 4H4OA 4Z4GA 4CHZA 4I2PA 4BR4A 4U7BA 1LW2A 3MDQA 3ITHA 1TK8A 4BRDA 4KI4A 1T44A 3C65A 3MX2A 5CYQA 1B9FA 4L3QA 3ENOA 5AFUH 3HOTA 3VOVA 4NXMK 3CM6A 3QO9A 3EY1A 4KTZA 1QSSA 4NCGA 1RTHA 1OH8A 3THXA 4CGDA 2BE2A 4BE2A 4OPJA 1WBBA 4CHNA 2O8EB 5KGXA 5KPRA 4B9QA 4DUZK 4CBXA 1VQ9N 2UXBK 3SCXA 2E20A 5DMRA 4YDUA 5HP1A 3WQUA 3SJHA 3L2QA 4BE1A 3CXCM 1CZAN 1GLEG 3D2EB 4JKGA 1IV0A 1XWLA 3QERA 3ZT1A 3WUHA 4I7FA 4QS7A 1HKGA 2ASPA 3OYAA 2A41A 3ULEB 3KLGA 3P38A 2D0PA 1IJJA 4YORA 2O8FB 2P9NA 5AZIB 1RILA 4BACA 4BC2A 4CVNE 4JI6K 4PKGA 3BZKA 3Q7BA 3VESA 4C8LA 5KPZA 4JI8K 3ID6A 4L8RB 4BR9A 1KLNA 3QNNA 1S1TA 5IT9O 1OVYA 2ZF5O 3K5NA 3SQ0A 4U67L 2EHGA 1L3SA 4BR0A 3RWUA 1WLJA 1NJYA 3V9ZA 3KLFA 2XY8A 1TL3A 2KZMA 3VQ6A 2F96A 1TAUA 1VQMN 4NO7A 4F3TA 3AVBA 2OZMA 1K8KA 2DFHA 3VQ8A 4IWVA 3AO1A 3AVGA 3P4IA 4A59A 3O4WA 3P5JA 2WC9A 4PQUA 4J2BA 3TI0A 5KGWA 2CH5A 2HF4A 1QZ6A 1NU0A 4J2EA 4LC9B 4M42A 4RW9A 5FLXO 2V51B 1Y97A 3MAQA 3AARA 4HUFA 3K57A 1CXUA 2VYPA 3NMUA 4B3RK 2DTUA 4DKWA 3HK2A 2YV0X 1K6YA 3ATUA 3R6MA 4FLUA 2HHUA 5I9EB 3WT0A 2NRRA 4IDKA 2BANA 4Y1DA 3M8QA 1EP4A 1L3UA 1SL0A 2VG6A 3O9QA 3KK7A 4K41A 4CF0A 3MECA 2OA8A 2NRHA 3OBYA 3OJSA 2V7ZA 3GBTA 4IOCL 1TUUA 2P9KA 4H5TA 4DB3A 1C0TA 1LWEA 4W5QA 5HRNA 4Y1CA 4DQ8A 1YF5L 5B8HA 2G8KA 4R5PA 4CZMA 3CPWM 3V81A 4LY7A 1B92A 1EWRA 1BI4A 1YVNA 5FPDA 3ZT0A 1RFQA 2HHSA 1SQKA 3PIPL 4CI6A 3HOSA 3E9LA 1X3NA 4FOIA 4KTQA 1SKWA 4IJAA 4CIEA 1X1PA 4DSLA 2IIRA 2YNFA 4BRLA 4DQQA 1C6VA 4E7JA 3ZETB 3ZYYX 4FXDA 4CZEA 4OX9K 3SV3A 3IS9A 3SPYA 3ID8A 3OYLA 3AVJA 4Y0WA 5AQOA 4NB4A 3V9XA 2KFNA 5FDLA 1TKTA 3QEVA 4AHVA 2NLXA 4YY3K 3JSMA 2QWNA 3EYZA 3ZEUA 2O4GA 3CIPA 5E41A 2QXLA 4E7IA 1DLOA 4DTUA 2VCPA 4G9ZA 3U4LA 2ASMA 5JVGL 2OPRA 4FLYA 4IFVA 3AO5A 3NGZA 3VGMA 2VQEK 3AA2A 1E3MA 4JKFA 2ZQBA 5AZJA 4W5RA 3S41A 4E0DA 4B9MA 4CGJA 4FLWA 2IVOA 2QWQA 1VSLA 4CGGA 2FSJA 1ZBIA 3M1FA 3AA4A 5AQWA 2B5JA 4B9LA 4DTRA 1GLJO 1XQSC 2QTDA 3VQ5A 4WFAL 4ISFA 1NJWA 4KAZA 1YTUA 1RT1A 4JK8A 3CCSN 3IG1A 4NYNA 5AQVA 3DAWA 1XMQK 4DUYK 5LMUK 3A0IX 2QXFA 4A5BA 1A5WA 2H3GX 3UKUB 5C12A 3RMBA 1IKYA 3S3NA 3E9OA 1EETA 3DLRA 1ZBFA 2VWKA 5K14A 3CQXA 1IKWA 3NF8A 3EE9A 2O8EA 1ASWA 2ETJA 2KZZA 1TK5A 2UXDK 2GEMA 1U04A 1V4TA 1KAZA 2YNGA 2I5JA 3HTVA 4HHTA 1YJNN 4NXNK 3LWMA 3G25A 1LAWA 3T7ZA 1X9SA 2RE2A 3MEDA 2GWJA 4RG8A 3VQ9A 4IO9L 1IO2A 5FPEA 3D2EA 1WSFA 4O44A 3H1VX 4H0XB 1J5OA 2YHXA 2YI1A 2F9WA 4CEFA 3G0ZA 2Q31A 4LF8K 3ULEA 3WNGA 2O8FA 5GADP 5M1KA 1OH5A 4PY5A 3F9KA 4MLHA 5AZIA 3O80A 4E89A 2PFUA 3NVMA 1H1VA 2QW9A 2KLAA 4H4MA 5MLCQ 5I42A 3T3FA 1KQSM 4C8MA 5F2RA 5AQPA 3CFRA 3HT3A 3S3MA 1XHXA 3TAMA 3SPZA 2Q0UA 1K9MO 3NF7A 4AM7A 5EY4A 5KPTA 4WF9L 3NH1A 1HNXK 3TSUA 1YVUA 4CJ3A 1RT4A 1RDDA 2I7NA 2E2QA 2OPSA 1NGBA 3K9KA 4JI7K 1KFDA 4XH1A 3QEPA 3IDHA 2ZWHA 2OANA 3BF3A 1TYQB 2G8WA 1U4BA 1MWKA 3WXJA 1T8EA 2Z1HA 4JKCA 2XHBA 3LDOA 3HYFA 4OVLA 1NM1A 1VSIA 3KK3A 3ZSRA 3F9MA 4KTWA 1FKPA 2QM1A 3KLIA 4DFKA 1EWQA 3CJ9A 1KCFA 2E8AA 3PUFA 1HNIA 3HP6A 3LDSA 4WFNL 1N34K 4RW8A 4BE0A 1XUPO 1I94K 4FK4A 3DXKB 3G4SN 1E4GT 2WOMA 4DV5K 1QTMA 2ZE2A 3L8BA 4OKKA 3R1XA 4Z4HA 3QESA 1TGOA 1U49A 3WNHA 1TVRA 2FC0A 4JI4K 1SKRA 3HVTA 4IG3A 4JK9A 1T05A 3TAFA 4A57A 3ZETA 3LWLA 3OVNA 1NGFA 3SMPA 4CJ5A 1BHLA 3TABA 3B8AX 3BDPA 5HRRA 2QK9A 4HUGA 4GKJK 4OO1J 4J8FA 3OYJA 2V7YA 2VGMA 3LP0A 2JWLA 3PO5A 2IOCA 3K5OA 3CERA 4CFBA 3C94A 4GVMA 5KQ8A 4FZYA 1SZ2A 4QS8A 3VA3A 2CH6A 2E2OA 5AQZA 4LD0A 3CCJN 2OCEA 4IG0A 4Z4EA 2I7PA 4M7XA 4JI0K 2P9PB 3AVLA 3MCPA 4PKHA 4CZHA 2VWJA 4FJKA 2KHOA 2WTUA 1Q7YO 4OKEA 4FWKA 3C0BA 1P8ZA 2UYTA 4JHDB 4M41A 1TKZA 4BGAA 3KKRA 1VAZA 3WEEB 1VSMA 2Q36A 4A5AA 3QBWA 3EN9A 3LP2A 1RT2A 4DSEA 3VGKA 3HM9A 2WUSA 5DK5A 4F9OA 4DQSA 1JLFA 2YKNA 1REVA 4CJQA 3NAEA 3DLEA 5JS1A 1D8YA 3QEXA 3I0SA 5HBMA 4HTLA 2W40A 2GUPA 3K5LA 1XNRK 3FZKA 5C42A 3IMXA 1EKEA 3MWTA 2P5OA 3M8RA 3GOIA 1VQNN 3TAGA 4FJIA 5CYMA 1YHQN 1NK6A 3UKUA 3ZX2A 5M1PA 3KTQA 3SBTA 4B3TK 4DSJA 1HR0K 4BROA 1HKCA 4IO8A 2OYQA 3CCLN 3V9UA 4CJTA 3E9PA 3MN5A 4DV0K 1P90A 4CF9A 1KFSA 4CJ4A 3PSIA 3C7NB 1XMOK 4EZ9A 4KB0A 4WE1A 1LW0A 1GLBG 1YXQA 4B8AB 1YITN 1NGGA 4BVOA 1FK9A 4CEDA 4FJNA 5HRPA 4B3MK 1GLAG 5M1FA 3O1WA 2D5RA 2DY4A 3LDLA 4BRQA 4DU4A 2FSNA 1OKJA 2FSKA 4KHUA 2VG5A 3TTFA 4M3ZA 3RMCA 4O5BA 3O6WA 3I33A 3DXMB 3ENBA 4WCEL 5HL7L 3S9HA 4H0TB 1X9MA 4E1MA 1JXEA 4A2BA 5E26A 2RHKA 2O8DB 4DU1A 3SAHA 1MU2A 2YKMA 3TAQA 2HHXA 4ICLA 3AGKA 2W6LA 2D1KA 4DR7K 1NBWA 4TSXA 3QFPA 5BR9A 3R3LA 4M3XA 1MA9B 3ISNC 4HCBA 3K9JA 4DV4K 4DF8A 2G8UA 4CEOA 4ID5A 4B1YB 4OPAA 4C8OA
chains in the Genus database with same CATH topology
1HNXK 4X65K 1IBKK 4LFBK 3J7YP 3JAMO 4X66K 1XMQK 4DUYK 5LMUK 4DUZK 4LFCK 2F4VK 4DV2K 4JI7K 1N32K 2UXBK 4AQYK 4LF9K 1IBMK 4LF4K 4X64K 2UU9K 5LL6Z 1XNQK 4DV1K 4DR4K 4KHPK 5AJ3K 5LMNK 1XNRK 4V19S 3J7AP 1FJGK 2HHHK 4JI1K 2UXDK 3J81O 3T1YK 1N33K 1N34K 1I94K 4DR2K 4B3TK 4NXNK 1HR0K 5IWAK 4DR5K 4DV7K 4CVNE 4DV5K 4JI6K 4YHHK 1IBLK 4B3SK 2E5LK 4OX9K 4DV0K 4DV6K 2UUBK 4JI8K 1HNZK 2ZM6K 2UUCK 1XMOK 5A2QO 4JI2K 5IT9O 4DR1K 4CW7B 4LF8K 2UXCK 3OTOK 4YY3K 4LF7K 4B3MK 4JI4K 4JV5K 4DR3K 2VQFK 1J5EK 4JI5K 4DR6K 4GKJK 2VQEK 1N36K 4GKKK 4X62K 3T1HK 4JI3K 4DR7K 1HNWK 3J80O 4NXMK 5FLXO 4JI0K 2UUAK 4LFAK 4DV4K 4LF6K 4B3RK 4DV3K 4LF5K 4JYAK 4K0KK 5BR8K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNX K;  4X65 K;  1IBK K;  4LFB K;  3J7Y P;  3JAM O;  4X66 K;  1XMQ K;  4DUY K;  5LMU K;  4DUZ K;  4LFC K;  2F4V K;  4DV2 K;  4JI7 K;  1N32 K;  2UXB K;  4AQY K;  4LF9 K;  1IBM K;  4LF4 K;  4X64 K;  2UU9 K;  5LL6 Z;  1XNQ K;  4DV1 K;  4DR4 K;  4KHP K;  5AJ3 K;  5LMN K;  1XNR K;  4V19 S;  3J7A P;  1FJG K;  2HHH K;  4JI1 K;  2UXD K;  3J81 O;  3T1Y K;  1N33 K;  1N34 K;  1I94 K;  4DR2 K;  4B3T K;  4NXN K;  1HR0 K;  5IWA K;  4DR5 K;  4DV7 K;  4CVN E;  4DV5 K;  4JI6 K;  4YHH K;  1IBL K;  4B3S K;  2E5L K;  4OX9 K;  4DV0 K;  4DV6 K;  2UUB K;  4JI8 K;  1HNZ K;  2ZM6 K;  2UUC K;  1XMO K;  5A2Q O;  4JI2 K;  5IT9 O;  4DR1 K;  4CW7 B;  4LF8 K;  2UXC K;  3OTO K;  4YY3 K;  4LF7 K;  4B3M K;  4JI4 K;  4JV5 K;  4DR3 K;  2VQF K;  1J5E K;  4JI5 K;  4DR6 K;  4GKJ K;  2VQE K;  1N36 K;  4GKK K;  4X62 K;  3T1H K;  4JI3 K;  4DR7 K;  1HNW K;  3J80 O;  4NXM K;  5FLX O;  4JI0 K;  2UUA K;  4LFA K;  4DV4 K;  4LF6 K;  4B3R K;  4DV3 K;  4LF5 K;  4JYA K;  4K0K K;  5BR8 K; 
#chains in the Genus database with same CATH topology
 1LV5 A;  1W9H A;  4FW1 A;  2V52 B;  5FPN A;  1NGE A;  4UQG A;  1WBD A;  4K8X A;  4J2D A;  4GNI A;  2JWK A;  3BGR A;  2OTL N;  3W0L A;  1DKG D;  4BGB A;  4E1J A;  3HVR A;  1VQP N;  2UU9 K;  4WQ5 A;  3S3O A;  1KRP A;  2E1Z A;  2QWP A;  4CHP A;  4XIU A;  1ASU A;  1NGA A;  1HYZ A;  2PZS A;  2RKI A;  2X6N A;  4NLC A;  4M7Y A;  4MDB A;  4DTX A;  5AQS A;  3J7Z O;  4BRC A;  1G15 A;  3ZSQ A;  2D4W A;  4F2R A;  3SZ2 A;  2XRI A;  1YUW A;  2HB5 A;  1Z25 A;  1IKX A;  1LOT B;  3DLG A;  4O4G A;  4YDU C;  3V9S A;  4WYB A;  1CLQ A;  4W5T A;  3DYA A;  3V1O A;  2X78 A;  3SNN A;  1RT3 A;  1TYQ A;  1S1W A;  4PL7 A;  4CGF A;  4FWO A;  4G1Q A;  4YHH K;  4K25 A;  4XH5 A;  2NRW A;  2F8T A;  2ZJR L;  3CC4 N;  4CER A;  3HI0 A;  5BRH A;  1L5U A;  4MO5 A;  4IKF A;  1DTQ A;  2HVH A;  4MDA A;  4FM2 A;  3SUP A;  1RT6 A;  3AVI A;  3DXK A;  5CZ1 A;  3QEW A;  4M3R A;  1RTJ A;  2YJE A;  4JLH A;  3F73 A;  1WAF A;  4DR3 K;  1D9D A;  3RR8 A;  4CCH A;  2AP1 A;  1VRT A;  1L3V A;  4IOX A;  3NDK A;  2PAV A;  1KTQ A;  4CF2 A;  5AQM A;  4ZTJ A;  4N76 A;  4B8C A;  2KW4 A;  1VSH A;  3JXU A;  4FOE A;  4QOZ B;  4EFH A;  5ADX A;  2D0O A;  3LDN A;  2QWL A;  5KRS A;  3O9T A;  2NRV A;  4DSI A;  4K8Z A;  1ESV A;  3ZX3 A;  3CJ1 A;  4FJH A;  3F5T A;  5LJW A;  2BUP A;  1S1V A;  1RBS A;  3ZSV A;  4DG1 A;  4KV8 A;  2A40 A;  5EX5 A;  2ZJP L;  4X65 K;  1Y64 A;  4YOW A;  3NGY A;  3ZSY A;  5GIN A;  3SYZ A;  1N32 K;  2BDP A;  5GAG P;  3D2F B;  4IFE A;  4DQR A;  4IDH A;  2P9P A;  1W0H A;  4KBO A;  4CZG A;  5AR0 A;  2OPP A;  5LL6 Z;  2A1R A;  3DLK A;  1QHT A;  4CEB A;  2PYJ A;  4JKA A;  4JKB A;  3LAN A;  4O0I A;  2GBZ A;  1IG8 A;  2WON A;  4JHD A;  2FBV A;  1RDU A;  3BY5 A;  3ENH A;  4LH5 A;  4DSK A;  2AA4 A;  3WEE A;  3MMV A;  4CEQ A;  3SAG A;  4ZHR A;  4F2S A;  4CFA A;  4CK1 A;  3N4Q A;  4FWP A;  1N33 K;  5C24 A;  3KIO A;  3O08 A;  3CYM A;  5SZT A;  1LWC A;  4FO0 A;  3L4I A;  3E01 A;  4DV7 K;  5BPM A;  5JVH L;  1GLC G;  4BG9 A;  3MXJ A;  3OYH A;  4B9V A;  4KPY A;  4BDP A;  2E2N A;  3H3N O;  3V1Q A;  3H08 A;  3IUC A;  1HUX A;  3QIC A;  4AIL C;  3SQ1 A;  3MEG A;  4GMJ B;  4C8N A;  3LM9 A;  5GAH P;  3D45 A;  3R9P A;  2KFZ A;  3LPT A;  3T1A A;  1XI1 A;  4EHT A;  1ZC6 A;  3KWI A;  3OYI A;  4CHY A;  1CZ9 A;  3RMD A;  3C6U A;  1KXP A;  1BIS A;  1UA1 A;  4CEE A;  5AQY A;  3P39 A;  4Z0U A;  1NK8 A;  3OYF A;  3C7N A;  4CJK A;  4JEP A;  4DTN A;  1JLG A;  2Z1I A;  4X62 K;  3OYB A;  3RTV A;  4O55 A;  3C6H A;  3QIO A;  1G99 A;  5I3U A;  4J2A A;  1Q82 O;  1KVA A;  4DS5 A;  4JI3 K;  5FRN A;  1BA1 A;  4CZJ A;  3KWG A;  3FLC O;  1KD1 O;  1C1A A;  3U9D A;  3VEV A;  4JKE A;  3CM5 A;  3DXM A;  1ZBS A;  2YHB A;  1I39 A;  5AQL A;  4XH4 A;  3TR8 A;  4EZ6 A;  4H5V A;  3LP3 A;  3VGL A;  3THY B;  4QCL A;  4K0K K;  2O8D A;  1QVG M;  2A42 A;  2G8I A;  2F4V K;  4DWI A;  2GUI A;  3AA5 X;  1IBM K;  3H46 O;  1TKD A;  2B6A A;  4ZTF A;  4FVU A;  4O8K A;  4B1W B;  1SUQ A;  1XNQ K;  1SL1 A;  3NHG A;  4H0O A;  4BY9 C;  1Z05 A;  2YHW A;  2X6S A;  5LMN K;  1RBT A;  2EWS A;  1M90 O;  1EXQ A;  4MO4 A;  3SAF A;  4RW4 A;  3V4I A;  4BC5 A;  5CR4 A;  4JI1 K;  4RW7 A;  5AQH A;  1J54 A;  3A5O C;  4BWJ A;  2QWO A;  1HPZ A;  1UOC A;  2FBT A;  3ZT3 A;  3VQ4 A;  3TAE A;  3I8D A;  1KAX A;  4DS4 A;  2YHA A;  1JCG A;  4OLA A;  2R7Y A;  3AVA A;  1VSJ A;  4BQL A;  4CJW A;  2A3Z A;  1ZBL A;  4DV6 K;  3LPU A;  3VF6 A;  4K42 A;  1MDU B;  4BRF A;  3RRH A;  2UXC K;  3KKS A;  3B6P A;  4FLV A;  2DPN A;  3NGI A;  2XO7 A;  2Y1I A;  4YOX A;  1R59 O;  1S6P A;  4FWN A;  4B08 A;  5EXW A;  3HP9 A;  4O8U A;  1U48 A;  3IFR A;  5DM7 L;  5CE3 A;  4CJV A;  1NNE A;  3U6F A;  4RTF D;  1NK9 A;  3CJ7 A;  3M6G A;  3CME N;  3KJV A;  3DWL A;  2IC3 A;  4HTU A;  3FZL A;  3T69 A;  3VQE A;  4DMN A;  4PL8 A;  3OYM A;  3I0R A;  3MEE A;  1J53 A;  3CET A;  4F3O A;  1SV5 A;  4DSF A;  2DFF A;  1HX1 A;  3P1G A;  4H5R A;  2Q3S A;  1BOT O;  1V4S A;  4LF5 K;  4JYA K;  5T7B A;  1J6Z A;  5JLH A;  1S1X A;  1S5J A;  4NYF A;  3DLH A;  1NGD A;  3KK1 A;  1T03 A;  4CJR A;  3ZX0 A;  1RT5 A;  2NRX A;  5M1Q A;  4LF9 K;  3DI6 A;  3OS1 A;  3AVK A;  4FJJ A;  4DTS A;  1BQM A;  3ZCM A;  1BWF O;  1HMV A;  1C1C A;  3F2K A;  4JN4 A;  4V19 S;  4DTJ A;  1QS4 A;  1D9F A;  2HOE A;  4FJ8 A;  3UKR B;  2P9S B;  3K0S A;  3AGR A;  4A62 A;  3VEN A;  3CHW A;  3J81 O;  4JK7 A;  1B9D A;  3DOK A;  3AV9 A;  3D2F A;  2E2P A;  3E66 A;  1K73 O;  4I9Q A;  4DR5 K;  3PV8 A;  4H03 B;  2XY6 A;  5AQQ A;  4EHU A;  5AQG A;  1RT7 A;  3G10 A;  2RN2 A;  2PBD A;  1ATR A;  3AAQ A;  5M1N A;  3MN9 A;  1YT3 A;  1VSF A;  1GLF O;  1I3A A;  2WBN A;  3D7E O;  3LP1 A;  2QA4 N;  2O8C B;  5BN9 A;  2ITM A;  3O3G A;  3DMJ A;  3VEX A;  4FWQ A;  4CF8 A;  1J9A A;  4CEC A;  4CIG A;  3TTC A;  4NCA A;  4AHC A;  4JI5 K;  1W2B M;  1Q9Y A;  2GV9 A;  4N41 A;  3RSE B;  3VET A;  3VEW A;  4E3S A;  3AVF A;  3FZF A;  4BRP A;  4DLE A;  3BF1 A;  4AHS A;  4N47 A;  3VQA A;  1VK0 A;  5HLF A;  4KFB A;  5C15 A;  3AY9 A;  3SLC A;  2HBJ A;  4AHR A;  3SUN A;  1U47 A;  4CHQ A;  1JLB A;  2ZJQ L;  3PY8 A;  3UIQ A;  4BR2 A;  3E1Y A;  1C0G A;  4O0J A;  4M3W A;  4CGI A;  3THW B;  3J80 O;  3GDQ A;  4HUE A;  4EP5 A;  1TAQ A;  3ASM A;  3VF4 A;  3AVH A;  1NGH A;  5HRS A;  5SWM A;  1VSK A;  3VQP A;  4PHT X;  3PSF A;  4B1Z A;  4FJM A;  2HF3 A;  1IBK K;  5AQN A;  5HRO A;  1L3T A;  4CJE A;  3J7Y P;  3MCA B;  3JAM O;  3LZI A;  1SAZ A;  3R8E A;  3CCV N;  4JS4 A;  2QKK A;  4BR7 A;  4FCY A;  4FVM A;  1NG9 A;  1A5X A;  2O8B B;  5EVZ A;  1KLM A;  2YNH A;  4FLT A;  1RDA A;  5AQR A;  1BCO A;  1TKX A;  1RCH A;  3QFU A;  4WQ4 C;  1NGJ A;  3SUQ A;  3B6O A;  4JD2 B;  2O4I A;  1C0M A;  1NMD A;  1NJZ A;  2RPI A;  2GX9 A;  3M8P A;  3THY A;  5D3G A;  1Z6R A;  3TPQ A;  3EZ5 A;  1S72 N;  4WQ4 A;  3LAM A;  3BZC A;  3OA9 A;  3WXM B;  4FWM A;  4EAH D;  1VHX A;  2HHH K;  1JLQ A;  4F4K A;  4IOA L;  3GE1 A;  3L0Q A;  3BUZ B;  3U8X A;  3EKU A;  4CBW A;  4GV6 A;  3TAR A;  2PYL A;  1YI2 N;  4FLX A;  4BVP A;  1GOB A;  1EX4 A;  2P1J A;  3DRR A;  4FPA A;  4QS9 A;  3WXK A;  4KHY A;  5GIO A;  1ATS A;  2RF2 A;  3Q7C A;  3QIN A;  5M1O A;  1U6Z A;  3D0P A;  4Z4F A;  4FJG A;  1DGK N;  4CW7 B;  3MWP A;  4RW6 A;  1Q9X A;  4AH9 A;  4BG8 A;  1NLV A;  3PX6 A;  2QKB A;  3CQ8 A;  1ILY A;  2NRZ A;  4PKI A;  3OYK A;  3VMF B;  1R0A A;  5C0Y A;  1QQN A;  1QQM A;  4YOT A;  4B1X B;  1BIU A;  3HPH A;  1RGI A;  4KRE A;  3NFA A;  4KHW A;  3RR7 A;  1NK7 A;  2HHW A;  4I6M B;  1JL1 A;  4LH4 A;  3QML A;  4LSL A;  5BN8 A;  4JNE A;  4N5S A;  3LM2 A;  1NK5 A;  4BQZ A;  4KHQ A;  4ISG A;  4DTO A;  2AJQ A;  1JKH A;  3OJU A;  2IVP A;  2OTJ N;  2FF3 B;  4O5F A;  3EEQ A;  4KH4 A;  1VQL N;  4WFB L;  2G8V A;  1Q18 A;  4FWS A;  5KQD A;  2F8S A;  3NF9 A;  4X66 K;  5AQK A;  2DFE A;  2QI2 A;  1WSI A;  3DM2 A;  1QSL A;  1RBV A;  4FWL A;  5DM6 L;  3CC7 N;  3L2W A;  3L4Q A;  5ADX H;  3KLH A;  2GTD A;  1T6C A;  4KHP K;  4BRN A;  4KKO A;  2HMI A;  3KHY A;  2ZGZ A;  3FR0 A;  3QLH A;  4CEA A;  3H1Q A;  4IBN A;  3VQC A;  3O9U A;  3G6E N;  4LSN A;  4CIF A;  1ZBU A;  4WQ5 C;  4IJN A;  4DFJ A;  1BQN A;  2D0A A;  3SBG A;  1MWM A;  1YTA A;  3C6T A;  2P51 A;  1O13 A;  4NLB A;  4YOV A;  1WSH A;  4DQI A;  2EX3 A;  3IKM A;  5C2D A;  3DOL A;  4ID1 A;  3MXI A;  4HVJ A;  3M3Z A;  3UKR A;  4CJF A;  2P9S A;  5AQT A;  4JI2 K;  1KSP A;  4GY2 B;  4DF4 A;  1WSE A;  5KTQ A;  3KK2 A;  4JV5 K;  4FJX A;  2JGU A;  4GV3 A;  3OYD A;  5H1S Q;  1BCM A;  2YJF A;  2IDO A;  4CJ7 A;  3P31 A;  1RDC A;  3TSQ A;  1HNV A;  3GG4 A;  2YHY A;  2Z1J A;  4GVE A;  3HST B;  3CJB A;  4FWR A;  3O9R A;  1S3X A;  4OLB A;  3HO1 A;  3CG7 A;  5KI6 A;  4DHY A;  2O8C A;  3VN5 A;  1D4X A;  3AO2 A;  4GV9 A;  1HJO A;  2IGI A;  3T19 A;  3VER A;  2E4L A;  4JKD A;  2HND A;  1NK0 A;  1WN7 A;  3LZJ A;  4KH6 A;  1NOY A;  1NK4 A;  1HPM A;  1N5Y A;  3NH0 A;  3RSE A;  2UUA K;  1QQO A;  1FXX A;  2HMP A;  1LCU A;  2CGK A;  2X74 A;  3KLE A;  2CGL A;  4B1V A;  1ASV A;  4FL9 A;  3QEI A;  3KZB A;  4C23 A;  1IKV A;  2E88 A;  3MX5 A;  4PA1 A;  5CY4 A;  4KB1 A;  4LFB K;  4KI6 A;  1JXB A;  2W41 A;  2D0C A;  4LFC K;  3O9S A;  4BDY A;  2HBM A;  4DV2 K;  1NKE A;  2ATQ A;  3TU5 A;  3THW A;  1YAG A;  5FPM A;  4CZI A;  1WNS A;  1VQO N;  4HCC A;  4E7L A;  2A6A A;  3AVM A;  1BL3 A;  5LY3 A;  3CJC A;  1TK0 A;  2OZS A;  1E4F T;  4C8K A;  3SMS A;  3L2V A;  2A1S A;  3A5M C;  3O4Q A;  3L2R A;  1W7A A;  2W42 A;  1FJG K;  3TSP A;  1HYV A;  3GL1 A;  3CCU N;  3T1Y K;  2O8B A;  2VG7 A;  1YJW N;  1ZBH A;  3PLA A;  4DR2 K;  5C10 A;  4BWM A;  4FJ9 A;  2KKZ A;  2W6K A;  5CHI A;  1F21 A;  4JD2 A;  4FJ5 A;  1HQU A;  3V9W A;  4FK0 A;  2E5L K;  3VQB A;  1XHZ A;  4Q0B A;  1LAV A;  5AQF A;  2NUB A;  5F1X A;  1LWF A;  3FGU A;  3O8M A;  3BEX A;  1NMN A;  2BGG A;  4DFP A;  1QE1 A;  3OTO K;  3ZSW A;  4CZK A;  5AFU A;  4LF7 K;  1C0F A;  1KC8 O;  5JMV A;  4JKH A;  4CK2 A;  3OBW A;  2VQF K;  5J2N A;  4BRH A;  4AF1 A;  3K5M A;  3O5B A;  3M5R A;  5EOY A;  3OS2 A;  5JS2 A;  1IG9 A;  3VTI A;  2P9U B;  4E7K A;  3HRG A;  1HQE A;  3I56 N;  4M3U A;  3OS0 A;  2IAJ A;  3VEO A;  3M8S A;  4Z4C A;  2P9L B;  5LJV A;  2NNW A;  5FRM A;  5AQU A;  5EU7 A;  2Q1N A;  2F9T A;  4ELU A;  1BDG A;  4YOY A;  3U3Y A;  2WFB A;  2YNI A;  3EL2 A;  1HNW K;  1X9W A;  1RTD A;  4LFA K;  3A5L C;  1TV6 A;  2F7T A;  4DQP A;  2YCH A;  4QAG A;  1OVQ A;  3N4P A;  4BDZ A;  3QIP A;  3JS6 A;  4H5N A;  4JRP A;  3I8B A;  2Q0R A;  4DTM A;  1HJR A;  4I6M A;  4FK2 A;  4B9T A;  1JJ2 M;  2KTQ A;  3CCM N;  4FJ7 A;  3EZW A;  3QDK A;  3HXM A;  1JCE A;  1Q81 O;  4JAX A;  4DFM A;  2HHT A;  4MFB A;  2CGJ A;  4BRG A;  5AQX A;  4CES A;  3DRS A;  1C0U A;  4JS5 A;  5J2M A;  4DR4 K;  3SQ4 A;  4RWT A;  2HNY A;  3LDP A;  4DCH A;  1U2V B;  3VF2 A;  2NRT A;  4OGC A;  3ZSO A;  1M1K O;  5KRT A;  4FSV A;  3H3O B;  3IAY A;  1ITG A;  1Q8I A;  3K59 A;  4OPH A;  4BRE A;  4B3S K;  3LDQ A;  1D5A A;  4M3Y A;  1O1W A;  1NJX A;  4CZF A;  2ZM6 K;  4BR5 A;  2J4R A;  1BU6 O;  1S1U A;  2HST A;  1NGC A;  3TAN A;  3QET A;  4I9L A;  4BRM A;  1UAX A;  3CPE A;  4FPB A;  1J5E K;  1QVF M;  5F0X A;  1T6D A;  2E6M A;  1WSJ A;  4W5O A;  4DR6 K;  1OH7 A;  3WNF A;  2ZGY A;  4OKJ A;  5AQI A;  3SK3 A;  4N56 A;  3CQY A;  3A5N C;  3HPO A;  3HZ6 A;  2XY7 A;  3A2F A;  1JCF A;  3OYG A;  3ZSX A;  4Q5V A;  3KD5 E;  1NKC A;  3HSC A;  3CF5 L;  2YX6 A;  2HBL A;  5HOO A;  2BH1 A;  3ZT2 A;  1NJI O;  1VSE A;  3K2P A;  3HJF A;  2D0B A;  2HVI A;  1GLD G;  5E84 A;  4B9S A;  4KHN A;  1HLU A;  4AHU A;  3THV A;  2FXU A;  3ULD A;  5BRF A;  1VRU A;  2E6L A;  3EO3 A;  4NCB A;  4BRA A;  1Q86 O;  1N6Q A;  1FKO A;  3VTH A;  4UY8 O;  2FLO A;  5AQJ A;  2Q2R A;  4M45 A;  3HPG A;  3DLB A;  4F8R A;  4M3T A;  3RVC A;  4DTP A;  2HW3 A;  3OHR A;  4B1U B;  4CJU A;  5AJ3 K;  1HRH A;  3ALY A;  1S22 A;  4FW2 A;  3ATV A;  4ILJ A;  5BPN A;  3VEY A;  2Y1J A;  4BC4 A;  4RCH A;  3TAP A;  1SKS A;  3EKS A;  4MQ3 A;  3VQ7 A;  3LAK A;  5GIP A;  5JLF A;  3WQT A;  5TKY A;  1VSD A;  4M63 C;  1NOZ A;  1NWK A;  2BTF A;  4CK3 A;  2P9I B;  1YIJ N;  1WUA A;  3DRP A;  5C2F A;  4DLG A;  4IFY A;  3MK6 A;  1X9J A;  1WAJ A;  4B3O A;  4CEZ A;  1TUY A;  3LAL A;  2KQ2 A;  4CFC A;  2P5G A;  3WXI A;  1RNH A;  3O3F A;  4E7H A;  3D6R A;  1HKB A;  2QWR A;  1UA0 A;  2PY5 A;  3SI6 A;  4BRI A;  3VPZ A;  4OJR A;  3J8A A;  4CFD A;  3JYT A;  2E1Y A;  3AVC A;  3OY9 A;  3THX B;  4OGE A;  4H0V B;  4PUO A;  4GKK K;  5TKW A;  3CC2 N;  3C95 A;  3QBX A;  3H45 C;  2GWK A;  4YOU A;  4OPK A;  4IEI A;  1NGI A;  3CJA A;  3O1B A;  4BC3 A;  4KH5 A;  4AM6 A;  4I2Q A;  1QQC A;  3NE6 A;  3FFK B;  2P9U A;  1S6Q A;  3LL3 A;  1BIZ A;  3P83 D;  3NBP A;  4DV3 K;  3OYC A;  4FM1 A;  2B4J A;  1BO5 O;  3L3V A;  4H0Y B;  4JKG B;  1T3V A;  3NF6 A;  3KD1 E;  3AVN A;  1SS6 A;  2OPQ A;  2GEL A;  2HNZ A;  2P9L A;  3DJC A;  5BRE A;  3IRX A;  4IZ9 A;  1EQY A;  4CD1 A;  4C1N I;  4AQY K;  1RBR A;  1RBU A;  4B9N A;  4X64 K;  2FBX A;  4W5N A;  1JL2 A;  4ILH A;  4KHS A;  4CF1 A;  2P9N B;  2Q97 A;  5C25 A;  1QSY A;  1VQ7 N;  3PIO L;  1JLC A;  1RDW X;  1UWB A;  3I55 N;  4H5W A;  3CCQ N;  1RTI A;  1GOA A;  3OYE A;  4IEE A;  4A61 A;  2XY5 A;  3NH2 A;  3DLL L;  1WB9 A;  3AA3 A;  4FLZ A;  4Z94 A;  3BP8 A;  4XEI A;  1RDB A;  4AHT A;  3HL8 A;  3NCI A;  1CXQ A;  2HHQ A;  2ITG A;  1JLA A;  3AO4 A;  3CD6 N;  1CZB A;  3V6D A;  4A2A A;  3UB5 A;  2ZD1 A;  1IBL K;  4CE9 A;  1X3M A;  3AO3 A;  1WSG A;  1DEJ A;  4MLE A;  3VEZ A;  2UUB K;  3SUO A;  3MXM A;  1T7P A;  1K8K B;  4KRF A;  5A2Q O;  1U2V A;  1VQ8 N;  5J1E A;  3O3H A;  4DR1 K;  4HWI A;  2A5X A;  3VQQ A;  3RRG A;  3UE5 A;  4ELT A;  2VWB A;  1KVB A;  2IVN A;  3KVG A;  4PWD A;  3NVK A;  4C1N K;  5J2P A;  3W3D A;  2HBK A;  2LSN A;  4CJP A;  4YNQ A;  1VQ4 N;  3MN7 A;  4FZZ A;  3L3U A;  3QB0 A;  5J2Q A;  1N36 K;  3K58 A;  2ASO A;  1U45 A;  3SV4 A;  3PX0 A;  3T1H K;  1GLL O;  3MN6 A;  3ZT4 A;  5FRO A;  2G8H A;  3TTD A;  2JLE A;  3U3G A;  3HBT A;  3CFO A;  2IS3 A;  1IH7 A;  4E1N A;  1K8A O;  5JIC A;  5BRD A;  1ZYQ A;  3QNO A;  1ZXO A;  4CHO A;  4BRK A;  1S9G A;  4CBU A;  5ELZ A;  3O4N A;  2P9K B;  4LF6 K;  5GAE P;  1QHA A;  4GW6 A;  2Z1G A;  3CMA N;  4Z4I A;  4ILG B;  1SL2 A;  5BR8 K;  1BGX T;  1BI4 B;  3VQD A;  3EE8 A;  3CI5 A;  1ATN A;  4FZX C;  3SQ2 A;  1DTT A;  4CD3 A;  5CZ2 A;  3VA0 A;  1Z26 A;  4LF4 K;  3HM8 A;  1JLE A;  3AAP A;  1TL1 A;  3FZM A;  3V1R A;  1EO1 A;  4FYD A;  4DV1 K;  1N8R O;  1BUP A;  4R79 A;  2HHV A;  4H8K A;  3FZH A;  2G8F A;  4KO0 A;  1QZ5 A;  1W97 L;  3A8Y A;  1VQ6 N;  1KAY A;  4B9U A;  2FF6 A;  3J7A P;  4EP4 A;  2VGN A;  4CJS A;  3PX4 A;  3FE1 A;  4K43 A;  2FBY A;  4YFU A;  5BPL A;  1NKB A;  3L6Q A;  1HYS A;  4IXC A;  3CFP A;  3CCR N;  1FW6 A;  1GOC A;  1KVC A;  3ZEU B;  4E19 A;  5IWA K;  3ZLJ A;  4ELV A;  3PO4 A;  1XC3 A;  2NZT A;  4CZL A;  1C1B A;  3FFI A;  1VQK N;  1WOQ A;  3L2U A;  4DU3 A;  1BA0 A;  3CCE N;  1S9E A;  4EIA A;  2QEX N;  3ZSZ A;  1HNZ K;  3WNE A;  2UUC K;  4JRQ A;  3H6E A;  3OYN A;  3RMA A;  3G71 N;  5AZJ B;  4CJL A;  3U9Z A;  1A5V A;  2QWM A;  3C6A A;  4FJL A;  4FM0 A;  1OH6 A;  1BG3 A;  3WXL A;  4CGH A;  3OW2 M;  2P9I A;  4ISE A;  4H0P A;  1DT9 A;  1VQ5 N;  1XC9 A;  3SJJ A;  3TWH A;  1YJ9 N;  4H4O A;  4Z4G A;  4CHZ A;  4I2P A;  4BR4 A;  4U7B A;  1LW2 A;  3MDQ A;  3ITH A;  1TK8 A;  4BRD A;  4KI4 A;  1T44 A;  3C65 A;  3MX2 A;  5CYQ A;  1B9F A;  4L3Q A;  3ENO A;  5AFU H;  3HOT A;  3VOV A;  4NXM K;  3CM6 A;  3QO9 A;  3EY1 A;  4KTZ A;  1QSS A;  4NCG A;  1RTH A;  1OH8 A;  3THX A;  4CGD A;  2BE2 A;  4BE2 A;  4OPJ A;  1WBB A;  4CHN A;  2O8E B;  5KGX A;  5KPR A;  4B9Q A;  4DUZ K;  4CBX A;  1VQ9 N;  2UXB K;  3SCX A;  2E20 A;  5DMR A;  4YDU A;  5HP1 A;  3WQU A;  3SJH A;  3L2Q A;  4BE1 A;  3CXC M;  1CZA N;  1GLE G;  3D2E B;  4JKG A;  1IV0 A;  1XWL A;  3QER A;  3ZT1 A;  3WUH A;  4I7F A;  4QS7 A;  1HKG A;  2ASP A;  3OYA A;  2A41 A;  3ULE B;  3KLG A;  3P38 A;  2D0P A;  1IJJ A;  4YOR A;  2O8F B;  2P9N A;  5AZI B;  1RIL A;  4BAC A;  4BC2 A;  4CVN E;  4JI6 K;  4PKG A;  3BZK A;  3Q7B A;  3VES A;  4C8L A;  5KPZ A;  4JI8 K;  3ID6 A;  4L8R B;  4BR9 A;  1KLN A;  3QNN A;  1S1T A;  5IT9 O;  1OVY A;  2ZF5 O;  3K5N A;  3SQ0 A;  4U67 L;  2EHG A;  1L3S A;  4BR0 A;  3RWU A;  1WLJ A;  1NJY A;  3V9Z A;  3KLF A;  2XY8 A;  1TL3 A;  2KZM A;  3VQ6 A;  2F96 A;  1TAU A;  1VQM N;  4NO7 A;  4F3T A;  3AVB A;  2OZM A;  1K8K A;  2DFH A;  3VQ8 A;  4IWV A;  3AO1 A;  3AVG A;  3P4I A;  4A59 A;  3O4W A;  3P5J A;  2WC9 A;  4PQU A;  4J2B A;  3TI0 A;  5KGW A;  2CH5 A;  2HF4 A;  1QZ6 A;  1NU0 A;  4J2E A;  4LC9 B;  4M42 A;  4RW9 A;  5FLX O;  2V51 B;  1Y97 A;  3MAQ A;  3AAR A;  4HUF A;  3K57 A;  1CXU A;  2VYP A;  3NMU A;  4B3R K;  2DTU A;  4DKW A;  3HK2 A;  2YV0 X;  1K6Y A;  3ATU A;  3R6M A;  4FLU A;  2HHU A;  5I9E B;  3WT0 A;  2NRR A;  4IDK A;  2BAN A;  4Y1D A;  3M8Q A;  1EP4 A;  1L3U A;  1SL0 A;  2VG6 A;  3O9Q A;  3KK7 A;  4K41 A;  4CF0 A;  3MEC A;  2OA8 A;  2NRH A;  3OBY A;  3OJS A;  2V7Z A;  3GBT A;  4IOC L;  1TUU A;  2P9K A;  4H5T A;  4DB3 A;  1C0T A;  1LWE A;  4W5Q A;  5HRN A;  4Y1C A;  4DQ8 A;  1YF5 L;  5B8H A;  2G8K A;  4R5P A;  4CZM A;  3CPW M;  3V81 A;  4LY7 A;  1B92 A;  1EWR A;  1BI4 A;  1YVN A;  5FPD A;  3ZT0 A;  1RFQ A;  2HHS A;  1SQK A;  3PIP L;  4CI6 A;  3HOS A;  3E9L A;  1X3N A;  4FOI A;  4KTQ A;  1SKW A;  4IJA A;  4CIE A;  1X1P A;  4DSL A;  2IIR A;  2YNF A;  4BRL A;  4DQQ A;  1C6V A;  4E7J A;  3ZET B;  3ZYY X;  4FXD A;  4CZE A;  4OX9 K;  3SV3 A;  3IS9 A;  3SPY A;  3ID8 A;  3OYL A;  3AVJ A;  4Y0W A;  5AQO A;  4NB4 A;  3V9X A;  2KFN A;  5FDL A;  1TKT A;  3QEV A;  4AHV A;  2NLX A;  4YY3 K;  3JSM A;  2QWN A;  3EYZ A;  3ZEU A;  2O4G A;  3CIP A;  5E41 A;  2QXL A;  4E7I A;  1DLO A;  4DTU A;  2VCP A;  4G9Z A;  3U4L A;  2ASM A;  5JVG L;  2OPR A;  4FLY A;  4IFV A;  3AO5 A;  3NGZ A;  3VGM A;  2VQE K;  3AA2 A;  1E3M A;  4JKF A;  2ZQB A;  5AZJ A;  4W5R A;  3S41 A;  4E0D A;  4B9M A;  4CGJ A;  4FLW A;  2IVO A;  2QWQ A;  1VSL A;  4CGG A;  2FSJ A;  1ZBI A;  3M1F A;  3AA4 A;  5AQW A;  2B5J A;  4B9L A;  4DTR A;  1GLJ O;  1XQS C;  2QTD A;  3VQ5 A;  4WFA L;  4ISF A;  1NJW A;  4KAZ A;  1YTU A;  1RT1 A;  4JK8 A;  3CCS N;  3IG1 A;  4NYN A;  5AQV A;  3DAW A;  1XMQ K;  4DUY K;  5LMU K;  3A0I X;  2QXF A;  4A5B A;  1A5W A;  2H3G X;  3UKU B;  5C12 A;  3RMB A;  1IKY A;  3S3N A;  3E9O A;  1EET A;  3DLR A;  1ZBF A;  2VWK A;  5K14 A;  3CQX A;  1IKW A;  3NF8 A;  3EE9 A;  2O8E A;  1ASW A;  2ETJ A;  2KZZ A;  1TK5 A;  2UXD K;  2GEM A;  1U04 A;  1V4T A;  1KAZ A;  2YNG A;  2I5J A;  3HTV A;  4HHT A;  1YJN N;  4NXN K;  3LWM A;  3G25 A;  1LAW A;  3T7Z A;  1X9S A;  2RE2 A;  3MED A;  2GWJ A;  4RG8 A;  3VQ9 A;  4IO9 L;  1IO2 A;  5FPE A;  3D2E A;  1WSF A;  4O44 A;  3H1V X;  4H0X B;  1J5O A;  2YHX A;  2YI1 A;  2F9W A;  4CEF A;  3G0Z A;  2Q31 A;  4LF8 K;  3ULE A;  3WNG A;  2O8F A;  5GAD P;  5M1K A;  1OH5 A;  4PY5 A;  3F9K A;  4MLH A;  5AZI A;  3O80 A;  4E89 A;  2PFU A;  3NVM A;  1H1V A;  2QW9 A;  2KLA A;  4H4M A;  5MLC Q;  5I42 A;  3T3F A;  1KQS M;  4C8M A;  5F2R A;  5AQP A;  3CFR A;  3HT3 A;  3S3M A;  1XHX A;  3TAM A;  3SPZ A;  2Q0U A;  1K9M O;  3NF7 A;  4AM7 A;  5EY4 A;  5KPT A;  4WF9 L;  3NH1 A;  1HNX K;  3TSU A;  1YVU A;  4CJ3 A;  1RT4 A;  1RDD A;  2I7N A;  2E2Q A;  2OPS A;  1NGB A;  3K9K A;  4JI7 K;  1KFD A;  4XH1 A;  3QEP A;  3IDH A;  2ZWH A;  2OAN A;  3BF3 A;  1TYQ B;  2G8W A;  1U4B A;  1MWK A;  3WXJ A;  1T8E A;  2Z1H A;  4JKC A;  2XHB A;  3LDO A;  3HYF A;  4OVL A;  1NM1 A;  1VSI A;  3KK3 A;  3ZSR A;  3F9M A;  4KTW A;  1FKP A;  2QM1 A;  3KLI A;  4DFK A;  1EWQ A;  3CJ9 A;  1KCF A;  2E8A A;  3PUF A;  1HNI A;  3HP6 A;  3LDS A;  4WFN L;  1N34 K;  4RW8 A;  4BE0 A;  1XUP O;  1I94 K;  4FK4 A;  3DXK B;  3G4S N;  1E4G T;  2WOM A;  4DV5 K;  1QTM A;  2ZE2 A;  3L8B A;  4OKK A;  3R1X A;  4Z4H A;  3QES A;  1TGO A;  1U49 A;  3WNH A;  1TVR A;  2FC0 A;  4JI4 K;  1SKR A;  3HVT A;  4IG3 A;  4JK9 A;  1T05 A;  3TAF A;  4A57 A;  3ZET A;  3LWL A;  3OVN A;  1NGF A;  3SMP A;  4CJ5 A;  1BHL A;  3TAB A;  3B8A X;  3BDP A;  5HRR A;  2QK9 A;  4HUG A;  4GKJ K;  4OO1 J;  4J8F A;  3OYJ A;  2V7Y A;  2VGM A;  3LP0 A;  2JWL A;  3PO5 A;  2IOC A;  3K5O A;  3CER A;  4CFB A;  3C94 A;  4GVM A;  5KQ8 A;  4FZY A;  1SZ2 A;  4QS8 A;  3VA3 A;  2CH6 A;  2E2O A;  5AQZ A;  4LD0 A;  3CCJ N;  2OCE A;  4IG0 A;  4Z4E A;  2I7P A;  4M7X A;  4JI0 K;  2P9P B;  3AVL A;  3MCP A;  4PKH A;  4CZH A;  2VWJ A;  4FJK A;  2KHO A;  2WTU A;  1Q7Y O;  4OKE A;  4FWK A;  3C0B A;  1P8Z A;  2UYT A;  4JHD B;  4M41 A;  1TKZ A;  4BGA A;  3KKR A;  1VAZ A;  3WEE B;  1VSM A;  2Q36 A;  4A5A A;  3QBW A;  3EN9 A;  3LP2 A;  1RT2 A;  4DSE A;  3VGK A;  3HM9 A;  2WUS A;  5DK5 A;  4F9O A;  4DQS A;  1JLF A;  2YKN A;  1REV A;  4CJQ A;  3NAE A;  3DLE A;  5JS1 A;  1D8Y A;  3QEX A;  3I0S A;  5HBM A;  4HTL A;  2W40 A;  2GUP A;  3K5L A;  1XNR K;  3FZK A;  5C42 A;  3IMX A;  1EKE A;  3MWT A;  2P5O A;  3M8R A;  3GOI A;  1VQN N;  3TAG A;  4FJI A;  5CYM A;  1YHQ N;  1NK6 A;  3UKU A;  3ZX2 A;  5M1P A;  3KTQ A;  3SBT A;  4B3T K;  4DSJ A;  1HR0 K;  4BRO A;  1HKC A;  4IO8 A;  2OYQ A;  3CCL N;  3V9U A;  4CJT A;  3E9P A;  3MN5 A;  4DV0 K;  1P90 A;  4CF9 A;  1KFS A;  4CJ4 A;  3PSI A;  3C7N B;  1XMO K;  4EZ9 A;  4KB0 A;  4WE1 A;  1LW0 A;  1GLB G;  1YXQ A;  4B8A B;  1YIT N;  1NGG A;  4BVO A;  1FK9 A;  4CED A;  4FJN A;  5HRP A;  4B3M K;  1GLA G;  5M1F A;  3O1W A;  2D5R A;  2DY4 A;  3LDL A;  4BRQ A;  4DU4 A;  2FSN A;  1OKJ A;  2FSK A;  4KHU A;  2VG5 A;  3TTF A;  4M3Z A;  3RMC A;  4O5B A;  3O6W A;  3I33 A;  3DXM B;  3ENB A;  4WCE L;  5HL7 L;  3S9H A;  4H0T B;  1X9M A;  4E1M A;  1JXE A;  4A2B A;  5E26 A;  2RHK A;  2O8D B;  4DU1 A;  3SAH A;  1MU2 A;  2YKM A;  3TAQ A;  2HHX A;  4ICL A;  3AGK A;  2W6L A;  2D1K A;  4DR7 K;  1NBW A;  4TSX A;  3QFP A;  5BR9 A;  3R3L A;  4M3X A;  1MA9 B;  3ISN C;  4HCB A;  3K9J A;  4DV4 K;  4DF8 A;  2G8U A;  4CEO A;  4ID5 A;  4B1Y B;  4OPA A;  4C8O A; 
#chains in the Genus database with same CATH homology
 1HNX K;  4X65 K;  1IBK K;  4LFB K;  3J7Y P;  3JAM O;  4X66 K;  1XMQ K;  4DUY K;  5LMU K;  4DUZ K;  4LFC K;  2F4V K;  4DV2 K;  4JI7 K;  1N32 K;  2UXB K;  4AQY K;  4LF9 K;  1IBM K;  4LF4 K;  4X64 K;  2UU9 K;  5LL6 Z;  1XNQ K;  4DV1 K;  4DR4 K;  4KHP K;  5AJ3 K;  5LMN K;  1XNR K;  4V19 S;  3J7A P;  1FJG K;  2HHH K;  4JI1 K;  2UXD K;  3J81 O;  3T1Y K;  1N33 K;  1N34 K;  1I94 K;  4DR2 K;  4B3T K;  4NXN K;  1HR0 K;  5IWA K;  4DR5 K;  4DV7 K;  4CVN E;  4DV5 K;  4JI6 K;  4YHH K;  1IBL K;  4B3S K;  2E5L K;  4OX9 K;  4DV0 K;  4DV6 K;  2UUB K;  4JI8 K;  1HNZ K;  2ZM6 K;  2UUC K;  1XMO K;  5A2Q O;  4JI2 K;  5IT9 O;  4DR1 K;  4CW7 B;  4LF8 K;  2UXC K;  3OTO K;  4YY3 K;  4LF7 K;  4B3M K;  4JI4 K;  4JV5 K;  4DR3 K;  2VQF K;  1J5E K;  4JI5 K;  4DR6 K;  4GKJ K;  2VQE K;  1N36 K;  4GKK K;  4X62 K;  3T1H K;  4JI3 K;  4DR7 K;  1HNW K;  3J80 O;  4NXM K;  5FLX O;  4JI0 K;  2UUA K;  4LFA K;  4DV4 K;  4LF6 K;  4B3R K;  4DV3 K;  4LF5 K;  4JYA K;  4K0K K;  5BR8 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...