4DV7K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g, bound with streptomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 30
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv7K00
5AJ3K 1IBMK 4DV6K 2ZM6K 1HNWK 4DR7K 4DV7K 5LMNK 3T1HK 4DUZK 1HR0K 3JAMO 2UU9K 4B3RK 4X62K 4X65K 4CVNE 4DV3K 5FLXO 5LMUK 1J5EK 4X66K 4DR5K 4GKKK 4LFBK 4LF4K 4OX9K 4K0KK 5LL6Z 2VQFK 4NXNK 4LF6K 1N34K 4JV5K 4GKJK 2UXBK 4DUYK 1N33K 1XMQK 3J7AP 1IBKK 2UXCK 3J7YP 1N36K 4B3MK 4DR4K 4DV5K 5IWAK 4DV4K 4LFAK 4V19S 2UXDK 4DV1K 4JI3K 5A2QO 4DV0K 1N32K 2UUBK 3T1YK 4JI7K 4LF5K 4DR6K 1I94K 1HNZK 4B3TK 3OTOK 4KHPK 2VQEK 1XNQK 4LF7K 2F4VK 5BR8K 4JI2K 4DR3K 4YHHK 2HHHK 4JI1K 2E5LK 4DR1K 4JYAK 1IBLK 4JI8K 4X64K 4LF8K 1FJGK 4LF9K 3J80O 4AQYK 4LFCK 4CW7B 1HNXK 4JI6K 1XNRK 5IT9O 1XMOK 4JI5K 4YY3K 4DV2K 4NXMK 4B3SK 2UUAK 4JI0K 4DR2K 4JI4K 2UUCK 3J81O
chains in the Genus database with same CATH superfamily
2Y1IA 1XHXA 4CZGA 4FJHA 4ID1A 4OJRA 4KTQA 3ISNC 1TL3A 3MECA 1TGOA 4FJIA 4NCGA 2F8TA 1VSLA 3FR0A 4OVLA 1X9WA 2E4LA 3VQQA 3U4LA 1R0AA 4PKHA 1F21A 1SS6A 1TUYA 1X9SA 4X62K 5AZIA 3ZLJA 1SQKA 4RWTA 2FXUA 5H1SQ 1Z05A 1TKDA 2G8VA 1WSIA 3VGKA 5J2MA 4CHNA 2PY5A 1VSJA 4FLVA 4CBUA 2HNYA 2YV0X 3KLIA 2D0CA 2QWNA 3FE1A 4CESA 2OYQA 3O6WA 1EKEA 1CZAN 1VSIA 3BDPA 3DRRA 4DQRA 3O9RA 3OYHA 4H8KA 3DYAA 2BDPA 1BCMA 4F2RA 2DFFA 3NCIA 4MLEA 3UKUB 4H0OA 4CECA 3MN6A 3DXMB 1QQCA 3IRXA 3HBTA 3HL8A 1T7PA 3SV4A 4RW7A 1NOYA 2WONA 2YJEA 3M8PA 1JXEA 2VG7A 2P9KB 4DQSA 1Q7YO 2J4RA 3FZKA 3A0IX 3OS2A 2Q97A 1NJWA 4EAHD 1BU6O 2F7TA 3CPEA 4PL8A 5FROA 2P9LA 1HNIA 4FSVA 4EP5A 4RG8A 1REVA 1TK0A 4AHVA 3NH2A 3U9ZA 3AO1A 1TUUA 2XY5A 3HSTB 4Z4GA 3MN5A 3V6DA 1TYQA 1Z26A 1LWFA 1CLQA 4H4MA 1BQNA 3AGKA 3E9PA 5AQZA 1IO2A 3O80A 3KHYA 1YTAA 4WE1A 3SBTA 3AV9A 1QVGM 1HYSA 3PIOL 1FKPA 3PX6A 4IJNA 3VGLA 4FO0A 4FJKA 2GWJA 4B9MA 3JAMO 2UU9K 4BE0A 3F5TA 4B08A 1KLMA 3ZSOA 4BRPA 2IVNA 3OJUA 1G15A 1JXBA 3AVCA 3RR7A 4KB0A 4MO5A 3D2FB 2PFUA 2VQFK 3AGRA 3CD6N 4CF8A 5AQKA 4FJXA 3UE5A 5EXWA 4CJ5A 1NG9A 3KLHA 4CFAA 5E26A 4JKEA 3ASMA 3O9TA 3J7AP 1RDUA 3QICA 3KK1A 3J7YP 1BIUA 1I3AA 4EP4A 2HHTA 5C12A 4WQ4C 4FCYA 3C6HA 4JKFA 1RTHA 3UKRB 4DTJA 3DLEA 4ELUA 4F2SA 3DLHA 3DLBA 3HOTA 4OKEA 3TU5A 2FSKA 3LDQA 1LW2A 1LWEA 1T6DA 2VCPA 1NGDA 2HMPA 3HI0A 3S9HA 2QWLA 3SK3A 1I94K 2FSNA 4FM2A 1IJJA 4DTXA 3WT0A 3VQBA 1NKCA 1EETA 3C65A 3Q7BA 3V1QA 1DTQA 2FLOA 5T7BA 3O08A 3AVMA 2Q31A 4WYBA 3WQUA 3ULEB 3IDHA 3TI0A 3KD1E 2NNWA 3LZJA 4RW9A 3MXMA 5CYMA 1T05A 1IBLK 1NK6A 2QTDA 4WQ4A 1U47A 4ELTA 4J2AA 1QVFM 1QHTA 4DFMA 5BPLA 3LWMA 2IAJA 4DQPA 4GVMA 3VPZA 1HYZA 4CI6A 3FZHA 3HPGA 3PUFA 3VGMA 1HKGA 1DT9A 3D0PA 4FK0A 1U2VB 1YXQA 5EX5A 4CBXA 1QTMA 1EWQA 3J8AA 4DHYA 4BR5A 3IMXA 3K5MA 2HF3A 4BC5A 4CF0A 4BDZA 3ZSQA 1YITN 3ZX0A 3VEWA 4FM0A 3B6OA 1HQEA 3TSUA 4CK2A 2Z1JA 2P5GA 3CQXA 4GV9A 3VQPA 1NGHA 3U3GA 3TABA 4GKKK 3V9ZA 3KWIA 5LL6Z 3C7NA 2ITMA 4LF6K 1ZBFA 2IC3A 4F3TA 4E7HA 3CJAA 4CHYA 1U48A 1NGJA 1JLCA 3SUPA 1TKTA 3ZT2A 3OJSA 3THVA 1Y64A 5FRNA 1SZ2A 1OVQA 1S22A 1K8KB 2BANA 4IOXA 3UIQA 1C0TA 3H3NO 4N56A 3NHGA 5IWAK 4V19S 3ENBA 2UXDK 4FPBA 4O5FA 4M63C 4BR4A 3C94A 3H45C 2BGGA 3OYFA 2HB5A 5J1EA 2CGJA 3VF6A 3H1QA 3OVNA 3KIOA 4JI7K 5KGWA 4B8AB 5I3UA 2QW9A 3OW2M 3V4IA 3HP6A 1VSHA 4B3TK 1WSGA 3LALA 2VYPA 3I33A 5ADXH 5DM7L 4A5AA 5AQIA 3KJVA 2I5JA 4CIEA 2QWRA 2OPRA 3PO4A 3LPUA 5AQGA 4IEIA 3CF5L 3EO3A 1VSDA 2E1ZA 3HYFA 5HRRA 1NK5A 4EHUA 4JI1K 1TL1A 1U4BA 2P9IB 2EHGA 3MX2A 4KBOA 1TK5A 2HBLA 4CJSA 5ELZA 1KRPA 4FZXC 4KHYA 2H3GX 5EVZA 1BO5O 4BRNA 3AO5A 3ZETA 4WFBL 3RSEB 4JI0K 3C95A 5GAGP 1SUQA 4CF1A 4DQQA 4KHQA 3ZSWA 3SUQA 4HUEA 2Q2RA 3C0BA 4DV7K 4XIUA 1RFQA 4BRLA 3PY8A 1ASUA 1OVYA 2P51A 4H5VA 3ALYA 1S1WA 4RW4A 5SZTA 3FZFA 4BR9A 3VF4A 2E2NA 3L4IA 3CG7A 1DKGD 1T6CA 4FOEA 4RCHA 1ZBUA 4M3RA 5JLHA 3DI6A 4BRFA 3SJHA 4A59A 2V51B 3ZT3A 5I9EB 3O9UA 2O8EA 2VGNA 3V1OA 3LP0A 4OKKA 1IBKK 2W6LA 5AQFA 4KB1A 3G10A 1QQMA 2OA8A 3KTQA 4CJWA 4LFAK 1HLUA 4J2DA 4ICLA 4OGCA 1IKYA 2Q1NA 2D0BA 5AZJA 4BR2A 1QSLA 4K8ZA 3QBXA 2B6AA 4FK4A 1YT3A 3SQ4A 3CCUN 3SI6A 4MDBA 3WXLA 1X3MA 1RT2A 1G99A 3CCEN 5FPEA 3VESA 1UAXA 4BQZA 3BF3A 4CGJA 4JS5A 5C0YA 3ZSYA 3D45A 5D3GA 1RBTA 1ASVA 1DLOA 1WB9A 4F9OA 1HPMA 3BGRA 4OPAA 2YNIA 4W5OA 4KKOA 3TARA 1DEJA 4CJPA 1ASWA 4X64K 1U49A 4BY9C 2V7ZA 4N41A 3ENOA 4O5BA 2JWLA 4CEFA 1VQLN 1TV6A 4I9QA 2FC0A 1VSKA 1GLEG 3R6MA 1S1XA 3HPOA 1YAGA 5C10A 3U6FA 4IJAA 1QQOA 4B1XB 1NMNA 3LP1A 3SNNA 4E1MA 2RHKA 3R9PA 1C6VA 3RMBA 4BC2A 1DGKN 4DTNA 5HRNA 5AZJB 2YX6A 1UA0A 4CZLA 3UKRA 3VERA 1HRHA 4K41A 4HHTA 3ID8A 1LW0A 2D1KA 3L2UA 3DMJA 5I42A 1SL1A 5AQJA 1Y97A 3THYA 2BH1A 4B3RK 5EOYA 4KHSA 3KLEA 3CQYA 1SKSA 1WAFA 3V9WA 2NRTA 1RBSA 4LF4K 2PBDA 4M42A 3AO3A 1RBVA 4IFEA 1JLBA 4I6MB 1M90O 3S3NA 5AQYA 3V9SA 4FK2A 4LC9B 4DUYK 1T03A 3DLLL 3Q7CA 4CJ4A 1JL2A 1QSYA 3GDQA 4DSIA 1N36K 1QE1A 5DMRA 4BACA 1TVRA 3CFOA 2OCEA 4CGDA 3RMCA 4Z4CA 4LSLA 5DK5A 2G8HA 4RW6A 3OYLA 2A3ZA 4FLTA 4CEZA 3ZT1A 4JHDB 5KTQA 4JI3K 4QS8A 1EWRA 4J8FA 4CJEA 3OYKA 1D9FA 3QLHA 2D0OA 2QA4N 4B3OA 1GOAA 4NYFA 4BC3A 3L4QA 5M1KA 3ZYYX 1QZ5A 4R79A 3LPTA 3ZETB 3O5BA 2XY6A 2NRWA 3T7ZA 4DQ8A 4QCLA 4C1NI 1HMVA 3AAPA 2XO7A 1GOCA 4DR1K 3AVIA 3F2KA 4LF8K 1K73O 4UQGA 3RRGA 1RILA 4CZHA 4DWIA 3SQ0A 4JKGB 3BUZB 4EZ6A 4CF2A 3PLAA 4YOWA 2Q0RA 4A2AA 4OLAA 3K9KA 2VG5A 2YNHA 1IKXA 4CJLA 4DR2K 2GV9A 3MN7A 2QKKA 3TAEA 3LP2A 3KKSA 4PA1A 3O3GA 1K9MO 1E4GT 2KFZA 3SAGA 3C6TA 2ZE2A 1RTJA 2QI2A 1RT3A 5CZ2A 4BRAA 2Q36A 4HUFA 4J2EA 3TAGA 4IOCL 3L3UA 3P4IA 3QETA 4WFAL 3OS0A 1SL0A 3PSIA 1N6QA 4KAZA 1YVUA 4KPYA 4JK8A 1Q9YA 1JCEA 3NH1A 4HCBA 2IIRA 3T1AA 3TTDA 4BREA 2CH6A 4BRIA 1XI1A 3O1WA 1BISA 2HW3A 4H0YB 5TKWA 1I39A 4DFJA 1ATNA 3L2RA 4FLXA 3CYMA 4IFYA 5AQUA 3RVCA 4H4OA 2P9UB 3CC4N 3ZSZA 2A6AA 3NGIA 2YNFA 1BCOA 1K6YA 4CJRA 3QFUA 4CZJA 4BG9A 1KQSM 3OYCA 4CHPA 2ZWHA 4W5NA 3CJCA 3QEXA 3AA3A 4KV8A 4AM7A 3E01A 3L2VA 4Q5VA 4CBWA 3GL1A 3LDLA 3HZ6A 3I0SA 3G25A 1BHLA 4DFPA 1KFDA 5ADXA 4M7YA 4JK7A 1LWCA 1BI4B 2KHOA 3O4NA 1IKWA 5AQSA 3ZT4A 1W7AA 3TWHA 2JGUA 2GX9A 3AVNA 4PWDA 5AQQA 3AVLA 3DRPA 1VQPN 1NK8A 2YHBA 3S41A 5AFUA 1X1PA 3DXKB 4H5TA 3U9DA 3MAQA 3TR8A 1TYQB 2ETJA 3O9SA 2NZTA 3RR8A 1ZBLA 1HNWK 4U7BA 4KHNA 2ZD1A 4CGIA 5AQXA 1SKWA 3TAPA 3BF1A 1RCHA 4IKFA 2YCHA 3P31A 4WQ5C 4BRKA 5GAHP 1S1TA 3VEZA 1ZBSA 2HHVA 2F96A 4NLBA 3IG1A 5AQVA 1MDUB 2VWKA 2Q0UA 5HROA 5BPMA 1IKVA 3AA4A 3VTIA 4DTSA 5F0XA 1J9AA 2AP1A 1N34K 1B9FA 3I56N 1SKRA 3L8BA 1S9GA 4CJFA 4IDHA 3QMLA 1JJ2M 3NMUA 2O8FB 3VOVA 5KGXA 3IFRA 1GLAG 4UY8O 3HM9A 4FJLA 3AVAA 3THYB 3P5JA 4JRQA 1NGCA 4M3UA 4CD3A 1HPZA 5J2PA 3DAWA 2HSTA 3WNGA 3CETA 4U67L 3BZKA 4DQIA 3E9LA 5AQWA 3T19A 1SAZA 3K58A 4BWMA 2NRVA 4FWKA 1NJIO 4O0IA 5KI6A 2IVPA 4W5RA 3QEWA 2A5XA 2O4IA 5CYQA 4FZYA 3VQCA 1ESVA 4B1ZA 1NJYA 4CCHA 4BRQA 1XNQK 3O1BA 4C8LA 4C8OA 3QIOA 4KH4A 1C1BA 4DTRA 4NCAA 3LDNA 4YFUA 3CJ7A 1VK0A 1V4TA 3K59A 3LAKA 1BA0A 2XY8A 1KAXA 5CHIA 4BQLA 2Z1IA 5AFUH 4H5RA 1ZXOA 3A5LC 4Y1DA 5AQLA 4A62A 3HXMA 1RDBA 1HNXK 3SBGA 3ZT0A 1EX4A 1T44A 3NVMA 4C8NA 4JNEA 5AQRA 4CHZA 4YY3K 2QKBA 3TPQA 2B4JA 3M5RA 4Z94A 4B9QA 4JI4K 1NK7A 1T3VA 1ILYA 4CGHA 1L3TA 3MEDA 5AJ3K 4DV6K 4FJGA 3CCJN 4FWSA 4CEDA 3QINA 2QXLA 3CJ1A 4DR7K 4C8MA 4JRPA 2G8UA 1OH6A 3NGYA 4KHWA 3KD5E 1IV0A 3QB0A 5DM6L 4IFVA 1WLJA 1KCFA 1X9JA 4Z4FA 4CHOA 4JKAA 4LD0A 4DS4A 3V9UA 1NGGA 3HPHA 1VRTA 3A5NC 2AJQA 3SQ1A 4OGEA 3EY1A 4OX9K 3E66A 4WQ5A 4IEEA 4JV5K 3QEVA 5AQTA 3S3MA 2KW4A 4B1WB 3OYMA 2ASMA 5CE3A 2HF4A 2Z1GA 3O9QA 1WAJA 1HYVA 3AVBA 3RTVA 4DU3A 1GLFO 5F2RA 3G4SN 1ITGA 4Y0WA 2HHUA 4ILJA 3OYGA 2A40A 3RMDA 4JHDA 2VGMA 4JN4A 3PSFA 1BL3A 3H46O 2BTFA 1YHQN 3V9XA 2A41A 5A2QO 3OYJA 4TSXA 1N32K 2QEXN 1W9HA 4FWRA 2IS3A 4H5WA 3T1YK 3QEPA 4AHUA 3HTVA 2QM1A 3TSQA 2P1JA 3R1XA 4F8RA 3DXKA 2WFBA 1VQON 1EXQA 3BZCA 3P39A 4JKCA 3ZX3A 3NH0A 3AVFA 3D6RA 1ZBHA 2D4WA 4RW8A 2FBYA 3K5OA 2ZQBA 1YJ9N 1JCGA 3VQ7A 4JAXA 4CEAA 3BEXA 4MQ3A 2GBZA 1KVCA 2A42A 2YJFA 3O3HA 1GLJO 2DFEA 4PHTX 2QK9A 3MDQA 4L3QA 1S9EA 3OHRA 4MLHA 4NYNA 4B3SK 1BDGA 4FW1A 4KO0A 3IKMA 4BRGA 1YF5L 4FLWA 3HP9A 1N8RO 3THXB 2D0PA 1UWBA 4BGAA 1QQNA 1FXXA 1S6QA 2IVOA 4AF1A 2P9UA 1NGEA 3RWUA 3AVHA 3EN9A 3AO2A 3EKSA 4FWOA 1L3VA 4K8XA 1FKOA 3N4PA 1ATSA 3WNEA 1O13A 3CERA 4K25A 4B1VA 3HK2A 5HRPA 3HM8A 4X65K 4NLCA 3MXJA 4F3OA 3WQTA 3LDSA 4M3TA 3QIPA 4ZTJA 4B9TA 2G8IA 1NGFA 1NK0A 1RT7A 1T8EA 2E2QA 1XC9A 1Q18A 4FJJA 4O55A 3SAHA 3CI5A 1K8AO 4QS7A 3NAEA 5AQPA 2GUIA 3SQ2A 4CJVA 4YOTA 3M8SA 2OPPA 3BY5A 3DLKA 4G9ZA 2XY7A 3MMVA 4M3WA 1FK9A 3F9KA 4B9VA 1NKBA 2PAVA 3HRGA 1R59O 5FDLA 3WEEA 3SYZA 3MWTA 3TAMA 1D4XA 4DV0K 1LAWA 3VQ8A 4BVPA 5C24A 2FSJA 4BRCA 4CEQA 3G0ZA 3GE1A 2HBKA 4H03B 5M1NA 3AA5X 4C23A 1W0HA 4CEBA 2FF6A 3RMAA 1RT6A 1RT1A 4LF7K 3FZMA 2F8SA 3VEOA 1GLBG 4AH9A 2ASPA 4CZMA 4CJTA 1S3XA 2X6SA 3RRHA 4FPAA 4DTPA 1M1KO 3VEVA 3MCPA 1RTIA 3GBTA 5FRMA 1BUPA 4CD1A 4KREA 4WFNL 1RDDA 4LF9K 1YJWN 4DU4A 4IO9L 4OPHA 3I8DA 4MO4A 3EKUA 1XNRK 4DSEA 1XMOK 1KTQA 1NWKA 3AVGA 3VA3A 2UUAK 1Q81O 5M1QA 3VMFB 4AHSA 3ULEA 3ZSVA 3G6EN 3J81O 2I7PA 5TKYA 3K57A 1BA1A 1WUAA 2XHBA 5E41A 1IBMK 3NDKA 5BREA 4HTLA 1MWKA 1P8ZA 5LJWA 3TTCA 3LP3A 4QAGA 5EU7A 2P9IA 4KHUA 4DUZK 2X74A 4CZEA 4H0PA 1SL2A 2Z1HA 1HX1A 5JVHL 3L6QA 1MWMA 1S1VA 2YHYA 4CF9A 2GTDA 2YKMA 3S3OA 3F9MA 5AR0A 3NFAA 3T69A 4FOIA 2ZJRL 2F9TA 3LL3A 1BQMA 3O3FA 1P90A 3MXIA 4FVUA 4ELVA 3VTHA 4XEIA 2E1YA 4E0DA 2PZSA 1XHZA 4DFKA 2JWKA 2E20A 2NUBA 1Q86O 2XRIA 3A5OC 4ZTFA 2UUBK 3LM2A 5HOOA 5M1FA 4GW6A 3WXIA 1RDWX 2W41A 3VENA 4MDAA 4HTUA 1U04A 4FLUA 5HRSA 1VQ7N 1HJOA 4HVJA 3H1VX 2HBMA 1XQSC 1MU2A 4IOAL 2GELA 1JLAA 5GIPA 3LZIA 4GVEA 3SV3A 5C25A 4DS5A 2HVIA 4H0XB 4CFDA 1CXQA 2O8DB 1XC3A 4DF8A 5K14A 4E7JA 1QS4A 4JLHA 4OKJA 4BR7A 4ISFA 4KTZA 3U3YA 3FZLA 1KD1O 2ZF5O 1VQ9N 3A8YA 1S5JA 4GV6A 1RGIA 4JK9A 4LH5A 4CW7B 4ID5A 1YIJN 2A1RA 4EIAA 3TSPA 4NXMK 4C1NK 1BI4A 4YNQA 3H6EA 3D2EA 3PIPL 3ZSXA 4PKIA 3TAFA 4DV3K 3NF7A 4DSJA 1HKBA 2IGIA 4EZ9A 3PV8A 4CERA 1ATRA 4OPKA 3U8XA 4FM1A 2ATQA 2QWMA 3WXJA 1A5XA 4M45A 1SV5A 1WBBA 2HBJA 2EWSA 3VQAA 5BN8A 3W0LA 3MCAB 1VSEA 1YUWA 4DLEA 3CCVN 3THWB 1EO1A 4CVNE 5GIOA 2O8FA 4X66K 3KK2A 3F73A 5LJVA 1L3SA 1JKHA 3OYIA 1VQ8N 5GAEP 1IG8A 1HUXA 2UXBK 3M3ZA 1WOQA 4N76A 3PO5A 4XH5A 5HP1A 4YORA 4DSFA 3CJ9A 2OTJN 2JLEA 4O8UA 2P9PA 3AAQA 4EFHA 1NGAA 4A57A 3E9OA 3K5LA 4KTWA 4Z4HA 3AA2A 5BPNA 4Z4IA 2RF2A 2WBNA 2KQ2A 3CPWM 4G1QA 3VQ4A 1S6PA 3DWLA 1C1AA 4O44A 4DMNA 3QFPA 3SCXA 2P9PB 2O8CB 5M1OA 3CFRA 4BC4A 3DLRA 2NLXA 1B92A 3LANA 2QXFA 1HNZK 1J53A 4M7XA 1J54A 3P38A 2VQEK 5CZ1A 1VQ5N 4E19A 3MEGA 4CEEA 5BR8K 1NJZA 2G8FA 2NRRA 4H5NA 5E84A 1EP4A 2HHHK 2YHWA 4E1JA 1HKCA 3CMAN 2BE2A 2UYTA 3GG4A 4N47A 1WSJA 3UB5A 1TAQA 1VAZA 1NGBA 1NK9A 3M8QA 4YHHK 5HL7L 3OS1A 1Q9XA 4CHQA 4CK1A 3D2EB 2DTUA 4AILC 2FBTA 1TK8A 1BWFO 4NO7A 5KPTA 2YHXA 3OYEA 2E6LA 3T3FA 4DB3A 3SAFA 5AZIB 2HMIA 1K8KA 1KC8O 2KZZA 1HR0K 3SUOA 3HVTA 3OY9A 3TTFA 1MA9B 1NMDA 1VQ6N 4CJUA 4K0KK 4GY2B 3OYDA 5M1PA 2HNZA 1YI2N 4GKJK 3R8EA 4I2QA 2HNDA 3M8RA 4XH1A 5JICA 1LAVA 4BWJA 4FJ7A 1ZBIA 2V7YA 3MWPA 2WUSA 3JYTA 3WEEB 4JEPA 4B3MK 3VF2A 5EY4A 2F9WA 4JD2A 4LH4A 3SLCA 1UA1A 2W40A 5AQHA 3OBWA 3WNHA 1JCFA 4NCBA 4FJMA 2E6MA 4Q0BA 4CK3A 4A2BA 1OH7A 4CGFA 1UOCA 2EX3A 5FPMA 1OH5A 3MN9A 4LF5K 3KK7A 4GV3A 4AHRA 3CM6A 1HQUA 3CM5A 1FW6A 3OTOK 4BE2A 4I9LA 1BIZA 2E2OA 4M3XA 1X3NA 1WSHA 4JI2K 4B1YB 2O8BA 1LOTB 3WXKA 2ZGYA 3FFIA 4O4GA 3OYBA 3ZCMA 3AO4A 4JYAK 4JI8K 3OA9A 2QWQA 3CHWA 1VSMA 4AQYK 4FLZA 3K9JA 3EZ5A 3L2QA 3A2FA 3JS6A 3NF6A 1NM1A 3CCRN 5HLFA 2ASOA 2G8KA 4JI5K 3AY9A 2HOEA 3C6UA 3OBYA 3VA0A 3CC7N 2D0AA 4FYDA 2O8DA 3QERA 4PKGA 3RSEA 4CIGA 3LWLA 1E3MA 2LSNA 4E1NA 3R3LA 4JKHA 1OKJA 1CXUA 4CZIA 2P9NB 2G8WA 3EL2A 3EZWA 4N5SA 5LMNK 3T1HK 4CFCA 1W2BM 5BR9A 3KLFA 3L0QA 3KZBA 2OPSA 4B1UB 4CFBA 5KQ8A 4FXDA 1V4SA 1RDAA 3I55N 1IG9A 1VRUA 2KLAA 2Q3SA 3VQDA 2CGLA 2WC9A 3SMSA 3CC2N 3ULDA 3V1RA 3WNFA 5CR4A 5KPRA 3ZEUA 3O4WA 2OTLN 3VETA 2BUPA 5FPNA 5JVGL 2O8EB 2VWJA 3DXMA 2FBXA 5SWMA 3GOIA 2OZMA 4I2PA 2NRXA 2YKNA 3HT3A 4HUGA 3D2FA 2OPQA 4RTFD 1NNEA 3VQ9A 4CIFA 2P9NA 1D9DA 3TAQA 4IXCA 1YTUA 1JLFA 1ZYQA 3TANA 1WBDA 2Y1JA 2RPIA 2V52B 4PL7A 4QS9A 4B9LA 1TAUA 1NGIA 4DR6K 4E7LA 5JS1A 3QNOA 2E2PA 2YHAA 2HVHA 4R5PA 4BDYA 4AM6A 3FFKB 1S72N 1S1UA 2F4VK 4IG3A 4K42A 3THXA 4IZ9A 4ILGB 1C0MA 3THWA 4H0VB 5KQDA 4O8KA 1WSFA 4CJKA 1TKZA 3C6AA 2KTQA 3EE9A 3FLCO 4DTUA 3BP8A 4Y1CA 2CH5A 4DKWA 2RN2A 2NRZA 4I7FA 4MFBA 2HHWA 5B8HA 3LAMA 3CCQN 4AHTA 4FJ9A 1RBRA 3FGUA 4OPJA 3H3OB 1ZC6A 1J6ZA 4IWVA 2ZJQL 4IDKA 4KRFA 1L3UA 3G71N 4JD2B 2O8CA 1KXPA 3CCSN 4FWLA 3VQEA 3CCMN 4DU1A 2WOMA 3QO9A 3HJFA 3IS9A 1C0FA 3CCLN 1JLQA 1RT4A 3DOKA 1RTDA 1GLDG 4BRHA 1E4FT 4JKDA 3OYAA 1EQYA 3V81A 3LDPA 4IO8A 2HHSA 2DY4A 1N33K 3AVJA 3WXMB 3CMEN 2UXCK 2E88A 3VQ5A 1RT5A 1L5UA 4W5TA 3ITHA 3KK3A 2R7YA 3IAYA 1N5YA 4YDUC 5C2FA 3P83D 2ITGA 4DV4K 4YOYA 3L3VA 3SZ2A 4M3YA 3JSMA 1VHXA 4KI6A 2AA4A 4IBNA 4K43A 2A1SA 1QZ6A 5JS2A 1QHAA 2FF3B 4KI4A 4AHCA 4EHTA 3ZX2A 2B5JA 3CJBA 4GMJB 3NF9A 1KVBA 5BRFA 4LSNA 1X9MA 4KHPK 3ZEUB 2ZJPL 4B9SA 5J2QA 3PX0A 4JKGA 1BG3A 4ZHRA 5FPDA 2DPNA 3VEXA 3OYNA 4BRDA 4ISEA 1TKXA 2GUPA 2CGKA 2GEMA 2YI1A 4IG0A 4Z4EA 4FJ5A 4FJNA 1OH8A 1VQMN 5C42A 4M41A 3AVKA 5HBMA 3D7EO 4FWNA 3VQ6A 3K0SA 2IOCA 3K5NA 2W42A 3DJCA 3ATVA 4GNIA 1LV5A 5JLFA 1KVAA 3MEEA 4CZKA 4BRMA 3NF8A 1BOTO 1JL1A 5C2DA 4CEOA 3DOLA 3H08A 1KAZA 2I7NA 4A5BA 2ZM6K 1QSSA 1XWLA 1JLGA 5GADP 3JXUA 3M6GA 1WSEA 3PX4A 3EE8A 4NB4A 1NK4A 2HHQA 2QWOA 3CXCM 2P5OA 4PUOA 4B8CA 1C0GA 4Z0UA 1BGXT 3MK6A 4B9UA 3CQ8A 3EYZA 4BGBA 4HCCA 3VEYA 1JLEA 5FLXO 5LMUK 5MLCQ 1J5EK 2O4GA 4ILHA 4DR5K 4FZZA 4LFBK 4NXNK 4PY5A 1VQNN 3O4QA 4I6MA 1KAYA 5LY3A 4FW2A 4DLGA 5AQNA 4H0TB 4CGGA 4PQUA 1XMQK 3A5MC 1XUPO 5BRDA 5BRHA 3NBPA 3IUCA 3KKRA 5JMVA 3QEIA 4HWIA 4E7KA 1VQKN 4OLBA 1RBUA 4DV5K 1O1WA 3NVKA 3B6PA 4E89A 4DTMA 4BDPA 1KFSA 1NOZA 5BN9A 3QNNA 3ENHA 4YOVA 1WNSA 3K2PA 3M1FA 4WF9L 4FLYA 3NGZA 4YDUA 1RDCA 4KH6A 4L8RB 2ZGZA 3B8AX 4FWPA 3I0RA 4FL9A 5J2NA 1A5VA 3AARA 2PYJA 2NRHA 4FJ8A 3DLGA 4J2BA 1VSFA 4YOUA 1GOBA 4OO1J 2P9SB 4CJQA 4BE1A 1D8YA 2E5LK 3N4QA 5KRSA 1FJGK 2OZSA 1NKEA 4O0JA 1Z25A 3KLGA 1HJRA 1RNHA 2P9LB 1D5AA 4JI6K 5AQOA 2PYLA 2QWPA 1IH7A 4CZFA 2P9SA 5GINA 4FWMA 1YVNA 3J7ZO 3DRSA 1DTTA 1NJXA 4A61A 3L2WA 1C0UA 3P1GA 1NU0A 3HOSA 4ISGA 1LCUA 3LM9A 4BR0A 5KPZA 3EEQA 3MX5A 4DF4A 1Q82O 1U6ZA 3SPYA 2RKIA 5F1XA 4WCEL 3ATUA 4E3SA 4DSKA 2KKZA 3CIPA 3VN5A 4YOXA 1CZ9A 1NLVA 1CZBA 4DSLA 2DFHA 3HSCA 3QDKA 3NE6A 1W97L 5AQMA 1J5OA 2OANA 5C15A 4FWQA 3E1YA 3KWGA 3SMPA 3CFPA 4JKBA 1Q8IA 4JS4A 5KRTA 1WN7A 4DR4K 1A5WA 4M3ZA 3HO1A 4BROA 4C8KA 2GWKA 2VG6A 2D5RA 4BG8A 2WTUA 2YNGA 4DV1K 1C1CA 3SJJA 3QBWA 4CJ7A 4E7IA 4DG1A 3O8MA 3HVRA 3KVGA 3WUHA 3W3DA 4QOZB 2E8AA 2O8BB 4CE9A 4DTOA 3SUNA 1GLLO 2KFNA 2W6KA 2P9KA 4W5QA 3LDOA 4XH4A 4DCHA 1Z6RA 1HNVA 4KFBA 4CJ3A 3C7NB 4LY7A 1YJNN 1KSPA 4BVOA 4DR3K 1KLNA 1B9DA 3I8BA 1H1VA 3ZSRA 3UKUA 2HHXA 2VWBA 4B9NA 2IDOA 2FBVA 3ID6A 1NBWA 1U45A 1GLCG 4KH5A 3J80O 2X6NA 1VQ4N 2KZMA 3SPZA 4LFCK 5IT9O 4FVMA 5CY4A 2X78A 4DV2K 3DM2A 2RE2A 3QESA 4F4KA 1U2VA 2UUCK
chains in the Genus database with same CATH topology
5AJ3K 1IBMK 4DV6K 2ZM6K 1HNWK 4DR7K 4DV7K 5LMNK 3T1HK 4DUZK 1HR0K 3JAMO 2UU9K 4B3RK 4X62K 4X65K 4CVNE 4DV3K 5FLXO 5LMUK 1J5EK 4X66K 4DR5K 4GKKK 4LFBK 4LF4K 4OX9K 4K0KK 5LL6Z 2VQFK 4NXNK 4LF6K 1N34K 4JV5K 4GKJK 2UXBK 4DUYK 1N33K 1XMQK 3J7AP 1IBKK 2UXCK 3J7YP 1N36K 4B3MK 4DR4K 4DV5K 5IWAK 4DV4K 4LFAK 4V19S 2UXDK 4DV1K 4JI3K 5A2QO 4DV0K 1N32K 2UUBK 3T1YK 4JI7K 4LF5K 4DR6K 1I94K 1HNZK 4B3TK 3OTOK 4KHPK 2VQEK 1XNQK 4LF7K 2F4VK 5BR8K 4JI2K 4DR3K 4YHHK 2HHHK 4JI1K 2E5LK 4DR1K 4JYAK 1IBLK 4JI8K 4X64K 4LF8K 1FJGK 4LF9K 3J80O 4AQYK 4LFCK 4CW7B 1HNXK 4JI6K 1XNRK 5IT9O 1XMOK 4JI5K 4YY3K 4DV2K 4NXMK 4B3SK 2UUAK 4JI0K 4DR2K 4JI4K 2UUCK 3J81O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AJ3 K;  1IBM K;  4DV6 K;  2ZM6 K;  1HNW K;  4DR7 K;  4DV7 K;  5LMN K;  3T1H K;  4DUZ K;  1HR0 K;  3JAM O;  2UU9 K;  4B3R K;  4X62 K;  4X65 K;  4CVN E;  4DV3 K;  5FLX O;  5LMU K;  1J5E K;  4X66 K;  4DR5 K;  4GKK K;  4LFB K;  4LF4 K;  4OX9 K;  4K0K K;  5LL6 Z;  2VQF K;  4NXN K;  4LF6 K;  1N34 K;  4JV5 K;  4GKJ K;  2UXB K;  4DUY K;  1N33 K;  1XMQ K;  3J7A P;  1IBK K;  2UXC K;  3J7Y P;  1N36 K;  4B3M K;  4DR4 K;  4DV5 K;  5IWA K;  4DV4 K;  4LFA K;  4V19 S;  2UXD K;  4DV1 K;  4JI3 K;  5A2Q O;  4DV0 K;  1N32 K;  2UUB K;  3T1Y K;  4JI7 K;  4LF5 K;  4DR6 K;  1I94 K;  1HNZ K;  4B3T K;  3OTO K;  4KHP K;  2VQE K;  1XNQ K;  4LF7 K;  2F4V K;  5BR8 K;  4JI2 K;  4DR3 K;  4YHH K;  2HHH K;  4JI1 K;  2E5L K;  4DR1 K;  4JYA K;  1IBL K;  4JI8 K;  4X64 K;  4LF8 K;  1FJG K;  4LF9 K;  3J80 O;  4AQY K;  4LFC K;  4CW7 B;  1HNX K;  4JI6 K;  1XNR K;  5IT9 O;  1XMO K;  4JI5 K;  4YY3 K;  4DV2 K;  4NXM K;  4B3S K;  2UUA K;  4JI0 K;  4DR2 K;  4JI4 K;  2UUC K;  3J81 O; 
#chains in the Genus database with same CATH topology
 2Y1I A;  1XHX A;  4CZG A;  4FJH A;  4ID1 A;  4OJR A;  4KTQ A;  3ISN C;  1TL3 A;  3MEC A;  1TGO A;  4FJI A;  4NCG A;  2F8T A;  1VSL A;  3FR0 A;  4OVL A;  1X9W A;  2E4L A;  3VQQ A;  3U4L A;  1R0A A;  4PKH A;  1F21 A;  1SS6 A;  1TUY A;  1X9S A;  4X62 K;  5AZI A;  3ZLJ A;  1SQK A;  4RWT A;  2FXU A;  5H1S Q;  1Z05 A;  1TKD A;  2G8V A;  1WSI A;  3VGK A;  5J2M A;  4CHN A;  2PY5 A;  1VSJ A;  4FLV A;  4CBU A;  2HNY A;  2YV0 X;  3KLI A;  2D0C A;  2QWN A;  3FE1 A;  4CES A;  2OYQ A;  3O6W A;  1EKE A;  1CZA N;  1VSI A;  3BDP A;  3DRR A;  4DQR A;  3O9R A;  3OYH A;  4H8K A;  3DYA A;  2BDP A;  1BCM A;  4F2R A;  2DFF A;  3NCI A;  4MLE A;  3UKU B;  4H0O A;  4CEC A;  3MN6 A;  3DXM B;  1QQC A;  3IRX A;  3HBT A;  3HL8 A;  1T7P A;  3SV4 A;  4RW7 A;  1NOY A;  2WON A;  2YJE A;  3M8P A;  1JXE A;  2VG7 A;  2P9K B;  4DQS A;  1Q7Y O;  2J4R A;  3FZK A;  3A0I X;  3OS2 A;  2Q97 A;  1NJW A;  4EAH D;  1BU6 O;  2F7T A;  3CPE A;  4PL8 A;  5FRO A;  2P9L A;  1HNI A;  4FSV A;  4EP5 A;  4RG8 A;  1REV A;  1TK0 A;  4AHV A;  3NH2 A;  3U9Z A;  3AO1 A;  1TUU A;  2XY5 A;  3HST B;  4Z4G A;  3MN5 A;  3V6D A;  1TYQ A;  1Z26 A;  1LWF A;  1CLQ A;  4H4M A;  1BQN A;  3AGK A;  3E9P A;  5AQZ A;  1IO2 A;  3O80 A;  3KHY A;  1YTA A;  4WE1 A;  3SBT A;  3AV9 A;  1QVG M;  1HYS A;  3PIO L;  1FKP A;  3PX6 A;  4IJN A;  3VGL A;  4FO0 A;  4FJK A;  2GWJ A;  4B9M A;  3JAM O;  2UU9 K;  4BE0 A;  3F5T A;  4B08 A;  1KLM A;  3ZSO A;  4BRP A;  2IVN A;  3OJU A;  1G15 A;  1JXB A;  3AVC A;  3RR7 A;  4KB0 A;  4MO5 A;  3D2F B;  2PFU A;  2VQF K;  3AGR A;  3CD6 N;  4CF8 A;  5AQK A;  4FJX A;  3UE5 A;  5EXW A;  4CJ5 A;  1NG9 A;  3KLH A;  4CFA A;  5E26 A;  4JKE A;  3ASM A;  3O9T A;  3J7A P;  1RDU A;  3QIC A;  3KK1 A;  3J7Y P;  1BIU A;  1I3A A;  4EP4 A;  2HHT A;  5C12 A;  4WQ4 C;  4FCY A;  3C6H A;  4JKF A;  1RTH A;  3UKR B;  4DTJ A;  3DLE A;  4ELU A;  4F2S A;  3DLH A;  3DLB A;  3HOT A;  4OKE A;  3TU5 A;  2FSK A;  3LDQ A;  1LW2 A;  1LWE A;  1T6D A;  2VCP A;  1NGD A;  2HMP A;  3HI0 A;  3S9H A;  2QWL A;  3SK3 A;  1I94 K;  2FSN A;  4FM2 A;  1IJJ A;  4DTX A;  3WT0 A;  3VQB A;  1NKC A;  1EET A;  3C65 A;  3Q7B A;  3V1Q A;  1DTQ A;  2FLO A;  5T7B A;  3O08 A;  3AVM A;  2Q31 A;  4WYB A;  3WQU A;  3ULE B;  3IDH A;  3TI0 A;  3KD1 E;  2NNW A;  3LZJ A;  4RW9 A;  3MXM A;  5CYM A;  1T05 A;  1IBL K;  1NK6 A;  2QTD A;  4WQ4 A;  1U47 A;  4ELT A;  4J2A A;  1QVF M;  1QHT A;  4DFM A;  5BPL A;  3LWM A;  2IAJ A;  4DQP A;  4GVM A;  3VPZ A;  1HYZ A;  4CI6 A;  3FZH A;  3HPG A;  3PUF A;  3VGM A;  1HKG A;  1DT9 A;  3D0P A;  4FK0 A;  1U2V B;  1YXQ A;  5EX5 A;  4CBX A;  1QTM A;  1EWQ A;  3J8A A;  4DHY A;  4BR5 A;  3IMX A;  3K5M A;  2HF3 A;  4BC5 A;  4CF0 A;  4BDZ A;  3ZSQ A;  1YIT N;  3ZX0 A;  3VEW A;  4FM0 A;  3B6O A;  1HQE A;  3TSU A;  4CK2 A;  2Z1J A;  2P5G A;  3CQX A;  4GV9 A;  3VQP A;  1NGH A;  3U3G A;  3TAB A;  4GKK K;  3V9Z A;  3KWI A;  5LL6 Z;  3C7N A;  2ITM A;  4LF6 K;  1ZBF A;  2IC3 A;  4F3T A;  4E7H A;  3CJA A;  4CHY A;  1U48 A;  1NGJ A;  1JLC A;  3SUP A;  1TKT A;  3ZT2 A;  3OJS A;  3THV A;  1Y64 A;  5FRN A;  1SZ2 A;  1OVQ A;  1S22 A;  1K8K B;  2BAN A;  4IOX A;  3UIQ A;  1C0T A;  3H3N O;  4N56 A;  3NHG A;  5IWA K;  4V19 S;  3ENB A;  2UXD K;  4FPB A;  4O5F A;  4M63 C;  4BR4 A;  3C94 A;  3H45 C;  2BGG A;  3OYF A;  2HB5 A;  5J1E A;  2CGJ A;  3VF6 A;  3H1Q A;  3OVN A;  3KIO A;  4JI7 K;  5KGW A;  4B8A B;  5I3U A;  2QW9 A;  3OW2 M;  3V4I A;  3HP6 A;  1VSH A;  4B3T K;  1WSG A;  3LAL A;  2VYP A;  3I33 A;  5ADX H;  5DM7 L;  4A5A A;  5AQI A;  3KJV A;  2I5J A;  4CIE A;  2QWR A;  2OPR A;  3PO4 A;  3LPU A;  5AQG A;  4IEI A;  3CF5 L;  3EO3 A;  1VSD A;  2E1Z A;  3HYF A;  5HRR A;  1NK5 A;  4EHU A;  4JI1 K;  1TL1 A;  1U4B A;  2P9I B;  2EHG A;  3MX2 A;  4KBO A;  1TK5 A;  2HBL A;  4CJS A;  5ELZ A;  1KRP A;  4FZX C;  4KHY A;  2H3G X;  5EVZ A;  1BO5 O;  4BRN A;  3AO5 A;  3ZET A;  4WFB L;  3RSE B;  4JI0 K;  3C95 A;  5GAG P;  1SUQ A;  4CF1 A;  4DQQ A;  4KHQ A;  3ZSW A;  3SUQ A;  4HUE A;  2Q2R A;  3C0B A;  4DV7 K;  4XIU A;  1RFQ A;  4BRL A;  3PY8 A;  1ASU A;  1OVY A;  2P51 A;  4H5V A;  3ALY A;  1S1W A;  4RW4 A;  5SZT A;  3FZF A;  4BR9 A;  3VF4 A;  2E2N A;  3L4I A;  3CG7 A;  1DKG D;  1T6C A;  4FOE A;  4RCH A;  1ZBU A;  4M3R A;  5JLH A;  3DI6 A;  4BRF A;  3SJH A;  4A59 A;  2V51 B;  3ZT3 A;  5I9E B;  3O9U A;  2O8E A;  2VGN A;  3V1O A;  3LP0 A;  4OKK A;  1IBK K;  2W6L A;  5AQF A;  4KB1 A;  3G10 A;  1QQM A;  2OA8 A;  3KTQ A;  4CJW A;  4LFA K;  1HLU A;  4J2D A;  4ICL A;  4OGC A;  1IKY A;  2Q1N A;  2D0B A;  5AZJ A;  4BR2 A;  1QSL A;  4K8Z A;  3QBX A;  2B6A A;  4FK4 A;  1YT3 A;  3SQ4 A;  3CCU N;  3SI6 A;  4MDB A;  3WXL A;  1X3M A;  1RT2 A;  1G99 A;  3CCE N;  5FPE A;  3VES A;  1UAX A;  4BQZ A;  3BF3 A;  4CGJ A;  4JS5 A;  5C0Y A;  3ZSY A;  3D45 A;  5D3G A;  1RBT A;  1ASV A;  1DLO A;  1WB9 A;  4F9O A;  1HPM A;  3BGR A;  4OPA A;  2YNI A;  4W5O A;  4KKO A;  3TAR A;  1DEJ A;  4CJP A;  1ASW A;  4X64 K;  1U49 A;  4BY9 C;  2V7Z A;  4N41 A;  3ENO A;  4O5B A;  2JWL A;  4CEF A;  1VQL N;  1TV6 A;  4I9Q A;  2FC0 A;  1VSK A;  1GLE G;  3R6M A;  1S1X A;  3HPO A;  1YAG A;  5C10 A;  3U6F A;  4IJA A;  1QQO A;  4B1X B;  1NMN A;  3LP1 A;  3SNN A;  4E1M A;  2RHK A;  3R9P A;  1C6V A;  3RMB A;  4BC2 A;  1DGK N;  4DTN A;  5HRN A;  5AZJ B;  2YX6 A;  1UA0 A;  4CZL A;  3UKR A;  3VER A;  1HRH A;  4K41 A;  4HHT A;  3ID8 A;  1LW0 A;  2D1K A;  3L2U A;  3DMJ A;  5I42 A;  1SL1 A;  5AQJ A;  1Y97 A;  3THY A;  2BH1 A;  4B3R K;  5EOY A;  4KHS A;  3KLE A;  3CQY A;  1SKS A;  1WAF A;  3V9W A;  2NRT A;  1RBS A;  4LF4 K;  2PBD A;  4M42 A;  3AO3 A;  1RBV A;  4IFE A;  1JLB A;  4I6M B;  1M90 O;  3S3N A;  5AQY A;  3V9S A;  4FK2 A;  4LC9 B;  4DUY K;  1T03 A;  3DLL L;  3Q7C A;  4CJ4 A;  1JL2 A;  1QSY A;  3GDQ A;  4DSI A;  1N36 K;  1QE1 A;  5DMR A;  4BAC A;  1TVR A;  3CFO A;  2OCE A;  4CGD A;  3RMC A;  4Z4C A;  4LSL A;  5DK5 A;  2G8H A;  4RW6 A;  3OYL A;  2A3Z A;  4FLT A;  4CEZ A;  3ZT1 A;  4JHD B;  5KTQ A;  4JI3 K;  4QS8 A;  1EWR A;  4J8F A;  4CJE A;  3OYK A;  1D9F A;  3QLH A;  2D0O A;  2QA4 N;  4B3O A;  1GOA A;  4NYF A;  4BC3 A;  3L4Q A;  5M1K A;  3ZYY X;  1QZ5 A;  4R79 A;  3LPT A;  3ZET B;  3O5B A;  2XY6 A;  2NRW A;  3T7Z A;  4DQ8 A;  4QCL A;  4C1N I;  1HMV A;  3AAP A;  2XO7 A;  1GOC A;  4DR1 K;  3AVI A;  3F2K A;  4LF8 K;  1K73 O;  4UQG A;  3RRG A;  1RIL A;  4CZH A;  4DWI A;  3SQ0 A;  4JKG B;  3BUZ B;  4EZ6 A;  4CF2 A;  3PLA A;  4YOW A;  2Q0R A;  4A2A A;  4OLA A;  3K9K A;  2VG5 A;  2YNH A;  1IKX A;  4CJL A;  4DR2 K;  2GV9 A;  3MN7 A;  2QKK A;  3TAE A;  3LP2 A;  3KKS A;  4PA1 A;  3O3G A;  1K9M O;  1E4G T;  2KFZ A;  3SAG A;  3C6T A;  2ZE2 A;  1RTJ A;  2QI2 A;  1RT3 A;  5CZ2 A;  4BRA A;  2Q36 A;  4HUF A;  4J2E A;  3TAG A;  4IOC L;  3L3U A;  3P4I A;  3QET A;  4WFA L;  3OS0 A;  1SL0 A;  3PSI A;  1N6Q A;  4KAZ A;  1YVU A;  4KPY A;  4JK8 A;  1Q9Y A;  1JCE A;  3NH1 A;  4HCB A;  2IIR A;  3T1A A;  3TTD A;  4BRE A;  2CH6 A;  4BRI A;  1XI1 A;  3O1W A;  1BIS A;  2HW3 A;  4H0Y B;  5TKW A;  1I39 A;  4DFJ A;  1ATN A;  3L2R A;  4FLX A;  3CYM A;  4IFY A;  5AQU A;  3RVC A;  4H4O A;  2P9U B;  3CC4 N;  3ZSZ A;  2A6A A;  3NGI A;  2YNF A;  1BCO A;  1K6Y A;  4CJR A;  3QFU A;  4CZJ A;  4BG9 A;  1KQS M;  3OYC A;  4CHP A;  2ZWH A;  4W5N A;  3CJC A;  3QEX A;  3AA3 A;  4KV8 A;  4AM7 A;  3E01 A;  3L2V A;  4Q5V A;  4CBW A;  3GL1 A;  3LDL A;  3HZ6 A;  3I0S A;  3G25 A;  1BHL A;  4DFP A;  1KFD A;  5ADX A;  4M7Y A;  4JK7 A;  1LWC A;  1BI4 B;  2KHO A;  3O4N A;  1IKW A;  5AQS A;  3ZT4 A;  1W7A A;  3TWH A;  2JGU A;  2GX9 A;  3AVN A;  4PWD A;  5AQQ A;  3AVL A;  3DRP A;  1VQP N;  1NK8 A;  2YHB A;  3S41 A;  5AFU A;  1X1P A;  3DXK B;  4H5T A;  3U9D A;  3MAQ A;  3TR8 A;  1TYQ B;  2ETJ A;  3O9S A;  2NZT A;  3RR8 A;  1ZBL A;  1HNW K;  4U7B A;  4KHN A;  2ZD1 A;  4CGI A;  5AQX A;  1SKW A;  3TAP A;  3BF1 A;  1RCH A;  4IKF A;  2YCH A;  3P31 A;  4WQ5 C;  4BRK A;  5GAH P;  1S1T A;  3VEZ A;  1ZBS A;  2HHV A;  2F96 A;  4NLB A;  3IG1 A;  5AQV A;  1MDU B;  2VWK A;  2Q0U A;  5HRO A;  5BPM A;  1IKV A;  3AA4 A;  3VTI A;  4DTS A;  5F0X A;  1J9A A;  2AP1 A;  1N34 K;  1B9F A;  3I56 N;  1SKR A;  3L8B A;  1S9G A;  4CJF A;  4IDH A;  3QML A;  1JJ2 M;  3NMU A;  2O8F B;  3VOV A;  5KGX A;  3IFR A;  1GLA G;  4UY8 O;  3HM9 A;  4FJL A;  3AVA A;  3THY B;  3P5J A;  4JRQ A;  1NGC A;  4M3U A;  4CD3 A;  1HPZ A;  5J2P A;  3DAW A;  2HST A;  3WNG A;  3CET A;  4U67 L;  3BZK A;  4DQI A;  3E9L A;  5AQW A;  3T19 A;  1SAZ A;  3K58 A;  4BWM A;  2NRV A;  4FWK A;  1NJI O;  4O0I A;  5KI6 A;  2IVP A;  4W5R A;  3QEW A;  2A5X A;  2O4I A;  5CYQ A;  4FZY A;  3VQC A;  1ESV A;  4B1Z A;  1NJY A;  4CCH A;  4BRQ A;  1XNQ K;  3O1B A;  4C8L A;  4C8O A;  3QIO A;  4KH4 A;  1C1B A;  4DTR A;  4NCA A;  3LDN A;  4YFU A;  3CJ7 A;  1VK0 A;  1V4T A;  3K59 A;  3LAK A;  1BA0 A;  2XY8 A;  1KAX A;  5CHI A;  4BQL A;  2Z1I A;  5AFU H;  4H5R A;  1ZXO A;  3A5L C;  4Y1D A;  5AQL A;  4A62 A;  3HXM A;  1RDB A;  1HNX K;  3SBG A;  3ZT0 A;  1EX4 A;  1T44 A;  3NVM A;  4C8N A;  4JNE A;  5AQR A;  4CHZ A;  4YY3 K;  2QKB A;  3TPQ A;  2B4J A;  3M5R A;  4Z94 A;  4B9Q A;  4JI4 K;  1NK7 A;  1T3V A;  1ILY A;  4CGH A;  1L3T A;  3MED A;  5AJ3 K;  4DV6 K;  4FJG A;  3CCJ N;  4FWS A;  4CED A;  3QIN A;  2QXL A;  3CJ1 A;  4DR7 K;  4C8M A;  4JRP A;  2G8U A;  1OH6 A;  3NGY A;  4KHW A;  3KD5 E;  1IV0 A;  3QB0 A;  5DM6 L;  4IFV A;  1WLJ A;  1KCF A;  1X9J A;  4Z4F A;  4CHO A;  4JKA A;  4LD0 A;  4DS4 A;  3V9U A;  1NGG A;  3HPH A;  1VRT A;  3A5N C;  2AJQ A;  3SQ1 A;  4OGE A;  3EY1 A;  4OX9 K;  3E66 A;  4WQ5 A;  4IEE A;  4JV5 K;  3QEV A;  5AQT A;  3S3M A;  2KW4 A;  4B1W B;  3OYM A;  2ASM A;  5CE3 A;  2HF4 A;  2Z1G A;  3O9Q A;  1WAJ A;  1HYV A;  3AVB A;  3RTV A;  4DU3 A;  1GLF O;  5F2R A;  3G4S N;  1ITG A;  4Y0W A;  2HHU A;  4ILJ A;  3OYG A;  2A40 A;  3RMD A;  4JHD A;  2VGM A;  4JN4 A;  3PSF A;  1BL3 A;  3H46 O;  2BTF A;  1YHQ N;  3V9X A;  2A41 A;  5A2Q O;  3OYJ A;  4TSX A;  1N32 K;  2QEX N;  1W9H A;  4FWR A;  2IS3 A;  4H5W A;  3T1Y K;  3QEP A;  4AHU A;  3HTV A;  2QM1 A;  3TSQ A;  2P1J A;  3R1X A;  4F8R A;  3DXK A;  2WFB A;  1VQO N;  1EXQ A;  3BZC A;  3P39 A;  4JKC A;  3ZX3 A;  3NH0 A;  3AVF A;  3D6R A;  1ZBH A;  2D4W A;  4RW8 A;  2FBY A;  3K5O A;  2ZQB A;  1YJ9 N;  1JCG A;  3VQ7 A;  4JAX A;  4CEA A;  3BEX A;  4MQ3 A;  2GBZ A;  1KVC A;  2A42 A;  2YJF A;  3O3H A;  1GLJ O;  2DFE A;  4PHT X;  2QK9 A;  3MDQ A;  4L3Q A;  1S9E A;  3OHR A;  4MLH A;  4NYN A;  4B3S K;  1BDG A;  4FW1 A;  4KO0 A;  3IKM A;  4BRG A;  1YF5 L;  4FLW A;  3HP9 A;  1N8R O;  3THX B;  2D0P A;  1UWB A;  4BGA A;  1QQN A;  1FXX A;  1S6Q A;  2IVO A;  4AF1 A;  2P9U A;  1NGE A;  3RWU A;  3AVH A;  3EN9 A;  3AO2 A;  3EKS A;  4FWO A;  1L3V A;  4K8X A;  1FKO A;  3N4P A;  1ATS A;  3WNE A;  1O13 A;  3CER A;  4K25 A;  4B1V A;  3HK2 A;  5HRP A;  3HM8 A;  4X65 K;  4NLC A;  3MXJ A;  4F3O A;  3WQT A;  3LDS A;  4M3T A;  3QIP A;  4ZTJ A;  4B9T A;  2G8I A;  1NGF A;  1NK0 A;  1RT7 A;  1T8E A;  2E2Q A;  1XC9 A;  1Q18 A;  4FJJ A;  4O55 A;  3SAH A;  3CI5 A;  1K8A O;  4QS7 A;  3NAE A;  5AQP A;  2GUI A;  3SQ2 A;  4CJV A;  4YOT A;  3M8S A;  2OPP A;  3BY5 A;  3DLK A;  4G9Z A;  2XY7 A;  3MMV A;  4M3W A;  1FK9 A;  3F9K A;  4B9V A;  1NKB A;  2PAV A;  3HRG A;  1R59 O;  5FDL A;  3WEE A;  3SYZ A;  3MWT A;  3TAM A;  1D4X A;  4DV0 K;  1LAW A;  3VQ8 A;  4BVP A;  5C24 A;  2FSJ A;  4BRC A;  4CEQ A;  3G0Z A;  3GE1 A;  2HBK A;  4H03 B;  5M1N A;  3AA5 X;  4C23 A;  1W0H A;  4CEB A;  2FF6 A;  3RMA A;  1RT6 A;  1RT1 A;  4LF7 K;  3FZM A;  2F8S A;  3VEO A;  1GLB G;  4AH9 A;  2ASP A;  4CZM A;  4CJT A;  1S3X A;  2X6S A;  3RRH A;  4FPA A;  4DTP A;  1M1K O;  3VEV A;  3MCP A;  1RTI A;  3GBT A;  5FRM A;  1BUP A;  4CD1 A;  4KRE A;  4WFN L;  1RDD A;  4LF9 K;  1YJW N;  4DU4 A;  4IO9 L;  4OPH A;  3I8D A;  4MO4 A;  3EKU A;  1XNR K;  4DSE A;  1XMO K;  1KTQ A;  1NWK A;  3AVG A;  3VA3 A;  2UUA K;  1Q81 O;  5M1Q A;  3VMF B;  4AHS A;  3ULE A;  3ZSV A;  3G6E N;  3J81 O;  2I7P A;  5TKY A;  3K57 A;  1BA1 A;  1WUA A;  2XHB A;  5E41 A;  1IBM K;  3NDK A;  5BRE A;  4HTL A;  1MWK A;  1P8Z A;  5LJW A;  3TTC A;  3LP3 A;  4QAG A;  5EU7 A;  2P9I A;  4KHU A;  4DUZ K;  2X74 A;  4CZE A;  4H0P A;  1SL2 A;  2Z1H A;  1HX1 A;  5JVH L;  3L6Q A;  1MWM A;  1S1V A;  2YHY A;  4CF9 A;  2GTD A;  2YKM A;  3S3O A;  3F9M A;  5AR0 A;  3NFA A;  3T69 A;  4FOI A;  2ZJR L;  2F9T A;  3LL3 A;  1BQM A;  3O3F A;  1P90 A;  3MXI A;  4FVU A;  4ELV A;  3VTH A;  4XEI A;  2E1Y A;  4E0D A;  2PZS A;  1XHZ A;  4DFK A;  2JWK A;  2E20 A;  2NUB A;  1Q86 O;  2XRI A;  3A5O C;  4ZTF A;  2UUB K;  3LM2 A;  5HOO A;  5M1F A;  4GW6 A;  3WXI A;  1RDW X;  2W41 A;  3VEN A;  4MDA A;  4HTU A;  1U04 A;  4FLU A;  5HRS A;  1VQ7 N;  1HJO A;  4HVJ A;  3H1V X;  2HBM A;  1XQS C;  1MU2 A;  4IOA L;  2GEL A;  1JLA A;  5GIP A;  3LZI A;  4GVE A;  3SV3 A;  5C25 A;  4DS5 A;  2HVI A;  4H0X B;  4CFD A;  1CXQ A;  2O8D B;  1XC3 A;  4DF8 A;  5K14 A;  4E7J A;  1QS4 A;  4JLH A;  4OKJ A;  4BR7 A;  4ISF A;  4KTZ A;  3U3Y A;  3FZL A;  1KD1 O;  2ZF5 O;  1VQ9 N;  3A8Y A;  1S5J A;  4GV6 A;  1RGI A;  4JK9 A;  4LH5 A;  4CW7 B;  4ID5 A;  1YIJ N;  2A1R A;  4EIA A;  3TSP A;  4NXM K;  4C1N K;  1BI4 A;  4YNQ A;  3H6E A;  3D2E A;  3PIP L;  3ZSX A;  4PKI A;  3TAF A;  4DV3 K;  3NF7 A;  4DSJ A;  1HKB A;  2IGI A;  4EZ9 A;  3PV8 A;  4CER A;  1ATR A;  4OPK A;  3U8X A;  4FM1 A;  2ATQ A;  2QWM A;  3WXJ A;  1A5X A;  4M45 A;  1SV5 A;  1WBB A;  2HBJ A;  2EWS A;  3VQA A;  5BN8 A;  3W0L A;  3MCA B;  1VSE A;  1YUW A;  4DLE A;  3CCV N;  3THW B;  1EO1 A;  4CVN E;  5GIO A;  2O8F A;  4X66 K;  3KK2 A;  3F73 A;  5LJV A;  1L3S A;  1JKH A;  3OYI A;  1VQ8 N;  5GAE P;  1IG8 A;  1HUX A;  2UXB K;  3M3Z A;  1WOQ A;  4N76 A;  3PO5 A;  4XH5 A;  5HP1 A;  4YOR A;  4DSF A;  3CJ9 A;  2OTJ N;  2JLE A;  4O8U A;  2P9P A;  3AAQ A;  4EFH A;  1NGA A;  4A57 A;  3E9O A;  3K5L A;  4KTW A;  4Z4H A;  3AA2 A;  5BPN A;  4Z4I A;  2RF2 A;  2WBN A;  2KQ2 A;  3CPW M;  4G1Q A;  3VQ4 A;  1S6P A;  3DWL A;  1C1A A;  4O44 A;  4DMN A;  3QFP A;  3SCX A;  2P9P B;  2O8C B;  5M1O A;  3CFR A;  4BC4 A;  3DLR A;  2NLX A;  1B92 A;  3LAN A;  2QXF A;  1HNZ K;  1J53 A;  4M7X A;  1J54 A;  3P38 A;  2VQE K;  5CZ1 A;  1VQ5 N;  4E19 A;  3MEG A;  4CEE A;  5BR8 K;  1NJZ A;  2G8F A;  2NRR A;  4H5N A;  5E84 A;  1EP4 A;  2HHH K;  2YHW A;  4E1J A;  1HKC A;  3CMA N;  2BE2 A;  2UYT A;  3GG4 A;  4N47 A;  1WSJ A;  3UB5 A;  1TAQ A;  1VAZ A;  1NGB A;  1NK9 A;  3M8Q A;  4YHH K;  5HL7 L;  3OS1 A;  1Q9X A;  4CHQ A;  4CK1 A;  3D2E B;  2DTU A;  4AIL C;  2FBT A;  1TK8 A;  1BWF O;  4NO7 A;  5KPT A;  2YHX A;  3OYE A;  2E6L A;  3T3F A;  4DB3 A;  3SAF A;  5AZI B;  2HMI A;  1K8K A;  1KC8 O;  2KZZ A;  1HR0 K;  3SUO A;  3HVT A;  3OY9 A;  3TTF A;  1MA9 B;  1NMD A;  1VQ6 N;  4CJU A;  4K0K K;  4GY2 B;  3OYD A;  5M1P A;  2HNZ A;  1YI2 N;  4GKJ K;  3R8E A;  4I2Q A;  2HND A;  3M8R A;  4XH1 A;  5JIC A;  1LAV A;  4BWJ A;  4FJ7 A;  1ZBI A;  2V7Y A;  3MWP A;  2WUS A;  3JYT A;  3WEE B;  4JEP A;  4B3M K;  3VF2 A;  5EY4 A;  2F9W A;  4JD2 A;  4LH4 A;  3SLC A;  1UA1 A;  2W40 A;  5AQH A;  3OBW A;  3WNH A;  1JCF A;  4NCB A;  4FJM A;  2E6M A;  4Q0B A;  4CK3 A;  4A2B A;  1OH7 A;  4CGF A;  1UOC A;  2EX3 A;  5FPM A;  1OH5 A;  3MN9 A;  4LF5 K;  3KK7 A;  4GV3 A;  4AHR A;  3CM6 A;  1HQU A;  3CM5 A;  1FW6 A;  3OTO K;  4BE2 A;  4I9L A;  1BIZ A;  2E2O A;  4M3X A;  1X3N A;  1WSH A;  4JI2 K;  4B1Y B;  2O8B A;  1LOT B;  3WXK A;  2ZGY A;  3FFI A;  4O4G A;  3OYB A;  3ZCM A;  3AO4 A;  4JYA K;  4JI8 K;  3OA9 A;  2QWQ A;  3CHW A;  1VSM A;  4AQY K;  4FLZ A;  3K9J A;  3EZ5 A;  3L2Q A;  3A2F A;  3JS6 A;  3NF6 A;  1NM1 A;  3CCR N;  5HLF A;  2ASO A;  2G8K A;  4JI5 K;  3AY9 A;  2HOE A;  3C6U A;  3OBY A;  3VA0 A;  3CC7 N;  2D0A A;  4FYD A;  2O8D A;  3QER A;  4PKG A;  3RSE A;  4CIG A;  3LWL A;  1E3M A;  2LSN A;  4E1N A;  3R3L A;  4JKH A;  1OKJ A;  1CXU A;  4CZI A;  2P9N B;  2G8W A;  3EL2 A;  3EZW A;  4N5S A;  5LMN K;  3T1H K;  4CFC A;  1W2B M;  5BR9 A;  3KLF A;  3L0Q A;  3KZB A;  2OPS A;  4B1U B;  4CFB A;  5KQ8 A;  4FXD A;  1V4S A;  1RDA A;  3I55 N;  1IG9 A;  1VRU A;  2KLA A;  2Q3S A;  3VQD A;  2CGL A;  2WC9 A;  3SMS A;  3CC2 N;  3ULD A;  3V1R A;  3WNF A;  5CR4 A;  5KPR A;  3ZEU A;  3O4W A;  2OTL N;  3VET A;  2BUP A;  5FPN A;  5JVG L;  2O8E B;  2VWJ A;  3DXM A;  2FBX A;  5SWM A;  3GOI A;  2OZM A;  4I2P A;  2NRX A;  2YKN A;  3HT3 A;  4HUG A;  3D2F A;  2OPQ A;  4RTF D;  1NNE A;  3VQ9 A;  4CIF A;  2P9N A;  1D9D A;  3TAQ A;  4IXC A;  1YTU A;  1JLF A;  1ZYQ A;  3TAN A;  1WBD A;  2Y1J A;  2RPI A;  2V52 B;  4PL7 A;  4QS9 A;  4B9L A;  1TAU A;  1NGI A;  4DR6 K;  4E7L A;  5JS1 A;  3QNO A;  2E2P A;  2YHA A;  2HVH A;  4R5P A;  4BDY A;  4AM6 A;  3FFK B;  1S72 N;  1S1U A;  2F4V K;  4IG3 A;  4K42 A;  3THX A;  4IZ9 A;  4ILG B;  1C0M A;  3THW A;  4H0V B;  5KQD A;  4O8K A;  1WSF A;  4CJK A;  1TKZ A;  3C6A A;  2KTQ A;  3EE9 A;  3FLC O;  4DTU A;  3BP8 A;  4Y1C A;  2CH5 A;  4DKW A;  2RN2 A;  2NRZ A;  4I7F A;  4MFB A;  2HHW A;  5B8H A;  3LAM A;  3CCQ N;  4AHT A;  4FJ9 A;  1RBR A;  3FGU A;  4OPJ A;  3H3O B;  1ZC6 A;  1J6Z A;  4IWV A;  2ZJQ L;  4IDK A;  4KRF A;  1L3U A;  3G71 N;  4JD2 B;  2O8C A;  1KXP A;  3CCS N;  4FWL A;  3VQE A;  3CCM N;  4DU1 A;  2WOM A;  3QO9 A;  3HJF A;  3IS9 A;  1C0F A;  3CCL N;  1JLQ A;  1RT4 A;  3DOK A;  1RTD A;  1GLD G;  4BRH A;  1E4F T;  4JKD A;  3OYA A;  1EQY A;  3V81 A;  3LDP A;  4IO8 A;  2HHS A;  2DY4 A;  1N33 K;  3AVJ A;  3WXM B;  3CME N;  2UXC K;  2E88 A;  3VQ5 A;  1RT5 A;  1L5U A;  4W5T A;  3ITH A;  3KK3 A;  2R7Y A;  3IAY A;  1N5Y A;  4YDU C;  5C2F A;  3P83 D;  2ITG A;  4DV4 K;  4YOY A;  3L3V A;  3SZ2 A;  4M3Y A;  3JSM A;  1VHX A;  4KI6 A;  2AA4 A;  4IBN A;  4K43 A;  2A1S A;  1QZ6 A;  5JS2 A;  1QHA A;  2FF3 B;  4KI4 A;  4AHC A;  4EHT A;  3ZX2 A;  2B5J A;  3CJB A;  4GMJ B;  3NF9 A;  1KVB A;  5BRF A;  4LSN A;  1X9M A;  4KHP K;  3ZEU B;  2ZJP L;  4B9S A;  5J2Q A;  3PX0 A;  4JKG A;  1BG3 A;  4ZHR A;  5FPD A;  2DPN A;  3VEX A;  3OYN A;  4BRD A;  4ISE A;  1TKX A;  2GUP A;  2CGK A;  2GEM A;  2YI1 A;  4IG0 A;  4Z4E A;  4FJ5 A;  4FJN A;  1OH8 A;  1VQM N;  5C42 A;  4M41 A;  3AVK A;  5HBM A;  3D7E O;  4FWN A;  3VQ6 A;  3K0S A;  2IOC A;  3K5N A;  2W42 A;  3DJC A;  3ATV A;  4GNI A;  1LV5 A;  5JLF A;  1KVA A;  3MEE A;  4CZK A;  4BRM A;  3NF8 A;  1BOT O;  1JL1 A;  5C2D A;  4CEO A;  3DOL A;  3H08 A;  1KAZ A;  2I7N A;  4A5B A;  2ZM6 K;  1QSS A;  1XWL A;  1JLG A;  5GAD P;  3JXU A;  3M6G A;  1WSE A;  3PX4 A;  3EE8 A;  4NB4 A;  1NK4 A;  2HHQ A;  2QWO A;  3CXC M;  2P5O A;  4PUO A;  4B8C A;  1C0G A;  4Z0U A;  1BGX T;  3MK6 A;  4B9U A;  3CQ8 A;  3EYZ A;  4BGB A;  4HCC A;  3VEY A;  1JLE A;  5FLX O;  5LMU K;  5MLC Q;  1J5E K;  2O4G A;  4ILH A;  4DR5 K;  4FZZ A;  4LFB K;  4NXN K;  4PY5 A;  1VQN N;  3O4Q A;  4I6M A;  1KAY A;  5LY3 A;  4FW2 A;  4DLG A;  5AQN A;  4H0T B;  4CGG A;  4PQU A;  1XMQ K;  3A5M C;  1XUP O;  5BRD A;  5BRH A;  3NBP A;  3IUC A;  3KKR A;  5JMV A;  3QEI A;  4HWI A;  4E7K A;  1VQK N;  4OLB A;  1RBU A;  4DV5 K;  1O1W A;  3NVK A;  3B6P A;  4E89 A;  4DTM A;  4BDP A;  1KFS A;  1NOZ A;  5BN9 A;  3QNN A;  3ENH A;  4YOV A;  1WNS A;  3K2P A;  3M1F A;  4WF9 L;  4FLY A;  3NGZ A;  4YDU A;  1RDC A;  4KH6 A;  4L8R B;  2ZGZ A;  3B8A X;  4FWP A;  3I0R A;  4FL9 A;  5J2N A;  1A5V A;  3AAR A;  2PYJ A;  2NRH A;  4FJ8 A;  3DLG A;  4J2B A;  1VSF A;  4YOU A;  1GOB A;  4OO1 J;  2P9S B;  4CJQ A;  4BE1 A;  1D8Y A;  2E5L K;  3N4Q A;  5KRS A;  1FJG K;  2OZS A;  1NKE A;  4O0J A;  1Z25 A;  3KLG A;  1HJR A;  1RNH A;  2P9L B;  1D5A A;  4JI6 K;  5AQO A;  2PYL A;  2QWP A;  1IH7 A;  4CZF A;  2P9S A;  5GIN A;  4FWM A;  1YVN A;  3J7Z O;  3DRS A;  1DTT A;  1NJX A;  4A61 A;  3L2W A;  1C0U A;  3P1G A;  1NU0 A;  3HOS A;  4ISG A;  1LCU A;  3LM9 A;  4BR0 A;  5KPZ A;  3EEQ A;  3MX5 A;  4DF4 A;  1Q82 O;  1U6Z A;  3SPY A;  2RKI A;  5F1X A;  4WCE L;  3ATU A;  4E3S A;  4DSK A;  2KKZ A;  3CIP A;  3VN5 A;  4YOX A;  1CZ9 A;  1NLV A;  1CZB A;  4DSL A;  2DFH A;  3HSC A;  3QDK A;  3NE6 A;  1W97 L;  5AQM A;  1J5O A;  2OAN A;  5C15 A;  4FWQ A;  3E1Y A;  3KWG A;  3SMP A;  3CFP A;  4JKB A;  1Q8I A;  4JS4 A;  5KRT A;  1WN7 A;  4DR4 K;  1A5W A;  4M3Z A;  3HO1 A;  4BRO A;  4C8K A;  2GWK A;  2VG6 A;  2D5R A;  4BG8 A;  2WTU A;  2YNG A;  4DV1 K;  1C1C A;  3SJJ A;  3QBW A;  4CJ7 A;  4E7I A;  4DG1 A;  3O8M A;  3HVR A;  3KVG A;  3WUH A;  3W3D A;  4QOZ B;  2E8A A;  2O8B B;  4CE9 A;  4DTO A;  3SUN A;  1GLL O;  2KFN A;  2W6K A;  2P9K A;  4W5Q A;  3LDO A;  4XH4 A;  4DCH A;  1Z6R A;  1HNV A;  4KFB A;  4CJ3 A;  3C7N B;  4LY7 A;  1YJN N;  1KSP A;  4BVO A;  4DR3 K;  1KLN A;  1B9D A;  3I8B A;  1H1V A;  3ZSR A;  3UKU A;  2HHX A;  2VWB A;  4B9N A;  2IDO A;  2FBV A;  3ID6 A;  1NBW A;  1U45 A;  1GLC G;  4KH5 A;  3J80 O;  2X6N A;  1VQ4 N;  2KZM A;  3SPZ A;  4LFC K;  5IT9 O;  4FVM A;  5CY4 A;  2X78 A;  4DV2 K;  3DM2 A;  2RE2 A;  3QES A;  4F4K A;  1U2V A;  2UUC K; 
#chains in the Genus database with same CATH homology
 5AJ3 K;  1IBM K;  4DV6 K;  2ZM6 K;  1HNW K;  4DR7 K;  4DV7 K;  5LMN K;  3T1H K;  4DUZ K;  1HR0 K;  3JAM O;  2UU9 K;  4B3R K;  4X62 K;  4X65 K;  4CVN E;  4DV3 K;  5FLX O;  5LMU K;  1J5E K;  4X66 K;  4DR5 K;  4GKK K;  4LFB K;  4LF4 K;  4OX9 K;  4K0K K;  5LL6 Z;  2VQF K;  4NXN K;  4LF6 K;  1N34 K;  4JV5 K;  4GKJ K;  2UXB K;  4DUY K;  1N33 K;  1XMQ K;  3J7A P;  1IBK K;  2UXC K;  3J7Y P;  1N36 K;  4B3M K;  4DR4 K;  4DV5 K;  5IWA K;  4DV4 K;  4LFA K;  4V19 S;  2UXD K;  4DV1 K;  4JI3 K;  5A2Q O;  4DV0 K;  1N32 K;  2UUB K;  3T1Y K;  4JI7 K;  4LF5 K;  4DR6 K;  1I94 K;  1HNZ K;  4B3T K;  3OTO K;  4KHP K;  2VQE K;  1XNQ K;  4LF7 K;  2F4V K;  5BR8 K;  4JI2 K;  4DR3 K;  4YHH K;  2HHH K;  4JI1 K;  2E5L K;  4DR1 K;  4JYA K;  1IBL K;  4JI8 K;  4X64 K;  4LF8 K;  1FJG K;  4LF9 K;  3J80 O;  4AQY K;  4LFC K;  4CW7 B;  1HNX K;  4JI6 K;  1XNR K;  5IT9 O;  1XMO K;  4JI5 K;  4YY3 K;  4DV2 K;  4NXM K;  4B3S K;  2UUA K;  4JI0 K;  4DR2 K;  4JI4 K;  2UUC K;  3J81 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...