1HMVA

The structure of unliganded reverse transcriptase from the human immunodeficiency virus type 1
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
554
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
publication title The structure of unliganded reverse transcriptase from the human immunodeficiency virus type 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 139
structure length 536
sequence length 554
chains with identical sequence C, E, G
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1994-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hmvA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hmvA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hmvA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hmvA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hmvA05
4DS4A 1S1XA 3RR7A 3ZSYA 4FZXC 4M3WA 1C0MA 1JIHA 5KFGA 4FJKA 4KB1A 4J9KA 1WSJA 1IKVA 1YVUA 5C42A 3FFIB 4CGIA 1RBTA 1RT3B 1RDAA 1SL1A 4HTUA 1W0HA 4Q45A 2QV6A 4KE5A 3DLRA 2XRIA 2AQ4A 4DSLA 4PUOB 1TKDA 4I7FA 3E01A 2YV0X 4G1QA 1RBRA 1T94A 3NKYA 1RTJB 3G86A 2IJFA 1TL1B 4FJGA 3QGHA 2R8IA 3V6DA 4CJVA 3QNOA 1UAXA 4CEEA 1NJWA 3OSNA 3I0RA 3ULDA 4J9NA 3SNNA 3WNEA 4IR1A 3LZIA 1N6QA 1Q9YA 2ASJA 4GW6A 3F9KA 1UA1A 5EWEA 4U6PA 3SCXA 4L8RB 3QEPA 1SL0A 4ICLA 5KG2A 4OLAA 4CJSA 4B9LA 2YNFA 1JKHA 4DLGA 4CEDA 3IGVA 4MFBA 2WRMA 3OL9A 5C24A 3OHBA 4WXWA 2ASLA 5KGXA 4IH7A 2PYJA 3H5SA 2BE2A 2AJQA 3AO2A 4CHPA 4FVMA 3IS9A 3S3OA 3H5XA 2WONB 3T5LA 1HMVB 3NH0A 4XO0A 3TI0A 2VG7B 5KFAA 2AX0A 4KO0B 4Q8EA 3OYNA 4CF0A 4MK9A 3U3GA 4FJJA 4WE1A 1VSJA 3SQ4A 4N76A 1LWFB 3M9MB 5DLGA 2IJNA 2HB5A 3O4NA 4FLTA 3MR3A 1HYSA 3LDSA 3QNNA 4AH9A 3QIOA 2D3UA 3PJWA 3NMAA 2ASDA 4O3OA 2WB4A 3V6KA 2VG6B 1SH3A 2R8JA 4CEAA 1TK0A 4M3RA 1S97A 4FJ7A 3HJFA 5J1EA 3VQ9A 2BANB 5F9LA 1JLCB 4J2BA 3VQDA 3PX4A 4CF2A 1KLMA 1VSMA 2G8UA 2GIRA 5KFNA 3MR6A 1HNIB 3DRSB 2JEFA 4CGFA 3OVNA 4K4WA 4PA1A 4NLXA 3QYYA 5KGWA 4KHNA 1S1UB 5D3GB 2B4JA 1HARA 2XGPA 3AVLA 3LANA 3BR9A 1S1TA 4M42A 1RT6A 3B6PA 4OKEA 3H2LA 4R5PB 1G15A 4E0DA 4E7KA 1JLGB 4XPCA 4C8KA 3O3FA 2FJXA 2C2DA 3DOLA 1IG9A 4J9QA 2PY5A 3THVA 2HNYB 3TWHA 2KFNA 4LSNB 4NZ0A 3RTVA 2ALZA 4O3PA 1RDRA 3PR5B 3OS0A 3V6HA 4KAZA 1C0UA 3I5AA 3HSTB 3TABA 4FZZA 5DQGA 3L3UA 3V9UA 4GC6A 2C2EA 5SZTA 4NLDA 2RN2A 3VA0A 4KHUA 1BHLA 4LH4A 1TV6A 3MEDB 4ZVGA 5KFDA 4CHOA 2WHOA 2F96A 3HPOA 3TANA 5I3UB 1YVFA 4RNHA 1IM4A 2HNDB 4CJ4A 3VQSA 2R2UA 4KHSA 3OL6A 3D5MA 1CLQA 4Z4FA 3KTQA 1OS5A 1VSHA 3V4IA 4DFMA 1FKOB 4N5SA 4HUEA 4KV8A 1U09A 1WNEA 2OA8A 3DMJB 1KHVA 4HYKA 4LQ9A 3PZPA 3CM6A 4DL6A 3HPGA 4DL7A 4O4GB 4TYAA 1QTMA 4Y2AA 4RNFA 5K14A 3ITHB 4ZP7A 1HYVA 4EO6A 1C2PA 4ELVA 1KHWA 4NCGB 1WSEA 4TY8B 1T05B 3OYIA 1HQEA 1NJZA 4GMJB 4E3SA 1EETA 4UQGA 2OZMA 4DS5A 3H59A 3H98A 1BI4B 1NK8A 4CJRA 4J9PA 2FVPA 3OYBA 1NHVA 5F8MA 3T5JA 4FM2A 4NLQA 3VQAA 4J2EA 2FBVA 3CFRA 4F2SA 4QWCA 1JXBA 2UVVA 4DSJA 3CJ5A 1S9GB 4CECA 5FRNA 1S9FA 4RW4A 2W8LA 4DTUA 3FQLA 4ZHRB 3IRXB 4AHVA 4CHNA 5DK5A 4CK2A 2BQ3A 1RTDA 1WSFA 2YNHA 3VA3A 1T7PA 3OSPA 4CHQA 2OZSA 2AX1A 1NJXA 1QAIA 3MECB 2KQ2A 2HHVA 4N47A 4FM0A 4FLZA 3MXIA 4CEBA 2ILYA 4RW7B 1WAFA 3ZSQA 1JLBB 3GYNA 3C94A 1TL3A 4BE0A 5DG9A 2R2RA 4CERA 2KFZA 3CQ8A 3KD1E 3JSMB 3UQSA 3RWUA 4DTNA 2E9TA 3DI6B 3ZT4A 2RDIA 3ZSVA 1EXQA 3H5UA 4B9MA 2GBZA 5KT3A 1ZTWA 2W9CB 1BL3A 1BIZA 5KG6A 1LW2B 2F8TA 3HT3A 3T19A 4OLBA 3AO1A 2R8HA 1C1BB 2YKNA 1KLNA 2HHUA 2YKMB 4E7IA 3VQQA 4BE2A 1KVAA 3DLEB 3NE6A 5DQHA 4TY9A 4C8NA 4IOBA 1U04A 3CDUA 4KFBA 3M8QB 4E7LA 4RUCA 3VN5A 2P5OA 3MEEB 4Z4GA 3TAMA 2EX3A 4JS4A 1SKWA 4FJXA 4TN2A 1JLAB 4JRQA 5JS1A 3DRPA 3OL7A 3KKSA 4TXSA 3PVXA 4FK0A 3RB3A 4IRCA 4WFXA 3RB0A 5CYMB 5J2MA 4JRPA 4OKKA 2ATLA 3PO5A 3HHKA 4YMEA 5KFSA 4CJ5A 5KFPA 3V81B 3RMAA 3LP2A 4ZPBA 4IRDA 4YR3A 1TKZA 3SV4A 1SV5B 4Q8FA 1Q8IA 3AVHA 1FKPA 5KI6A 4URGA 2EHGA 1C0TB 1NK5A 2B5JB 4DL3A 3EZ5A 4TSXA 4YQWA 4CK3A 4EBEA 1NK6A 4CJUA 2V0NA 5CYQB 5KFJA 3HK2A 3NGIA 3RBEA 4DQRA 4RW6A 2WCXA 1S6QB 4OPJA 3OS1A 1FK9B 3NBPA 1K1QA 4DQQA 4LSLA 3KK3B 4ID5B 5L1IA 5F8NA 3QIPA 4ECTA 4DSEA 1RAJA 1BGXT 4F2RA 2F8EX 1N5YB 1RT7A 1YT3A 4CF8A 3HL8A 3GV8B 3RMBA 2YNGB 5HP1B 3M9OB 3Q8SB 1D9DA 1Y97A 3G10A 1VK0A 1CXQA 3KK1B 2R7YA 3IGNA 4ED0A 3WNGA 4KKOB 2Q3SA 3K57A 1RTJA 1TL1A 4FJ8A 3EZUA 5KG7A 2B6AB 3DYAB 3I0SA 4F4ZA 4K8XA 3DOKA 4H4OB 3L2UA 2WOMB 2FBYA 4FLYA 3SQ0A 2RF2A 3I8DA 1QE1A 3OLAA 3NFAA 3IG1A 3BSOA 2ITGA 1QSSA 5HLFB 2I1RA 2ZKUA 3LP3A 1XC9A 1WSIA 1T3NA 4ZP9A 3OYLA 4QOZB 1C1CA 4OL8A 1EX4A 1J5OB 2DPJA 2HHQA 2YHAA 4URQU 3V1RA 4YNQA 5EWFA 2W42A 5FROA 3EPIA 4I9LA 3DRRB 2DPIA 3BGRA 2XC9A 1JLQA 5J2NA 4CCHA 4FZYA 1BQNA 3SQ2A 3KIOA 1HQUB 5F8IA 2IA6A 1RDDA 3HVRA 4DU3A 1TK5A 2P51A 4ZMMA 2UVUA 1LW0B 4TLRA 1X9SA 4FCYA 2WONA 4KB7A 5KFTA 3ZT3A 3OYMA 3OYCA 1LWEB 2VG7A 2HHWA 1JL1A 4KO0A 3AVNA 4MKBA 3TQ1A 1VSKA 3AVJA 3ZT0A 3LP1A 4BWJA 3MEGA 4ED7A 4O3RA 3P83D 3QO9B 4HHTA 4IFYA 3PX6A 4AHTA 3AA3A 4KAIA 3PHEA 2X78A 2OPQB 3O4QA 4ZVHA 3KNAA 3SUNA 2JLEA 3SFUA 1SUQA 1WSHA 3CFPA 1IKXB 2RKIB 2XCAA 3QERA 5HBMA 4CFBA 4PQUA 3QZ8A 1ITGA 1QS4A 4M94A 1VSLA 3OYFA 4FW2A 5C25B 2QKKA 2BANA 3TAFA 5JS2A 3SPZA 1T03B 1S1VA 5DGAA 4O4RA 4WYLA 3DM2B 5KFUA 4ECWA 1TAUA 3KJVB 1B9DA 3FRZA 2D0CA 1S1UA 2HMIB 3OHAA 5D3GA 5KFVA 3G0ZA 4IFVB 1QAJA 4GVMA 1NOZA 3H4BA 4ZPCA 4CIGA 4XIUA 3RBDA 3OYKA 4RW9A 5KFZA 4IRKA 1IKYB 3NCIA 5KTQA 1VRUA 4DTSA 2CJQA 4JV2A 3NAIA 3EY1A 1L5UA 3SQ1A 3KLEB 3TVKA 2IDOA 3RMDA 4HKQA 1U47A 1RTHB 3CFOA 3JYTB 1GX6A 1GX5A 3KLIA 3EPGA 3OYGA 3AA5X 4FJLA 3S9HA 3NH2A 3OY9A 4O0IA 3H08A 2E9ZA 1VSEA 4QPXA 5J2QB 1S9EB 2E4LA 3HVTB 3PR4A 3NDKA 4B8CA 1MU2B 1QHTA 3PX0A 4KB0A 3K5NA 4IG0A 1ZBLA 4JUZA 5I3UA 3IAYA 2FLLA 1GOCA 4K50A 3KLFA 1D9FA 1RT4A 3VQCA 1RT1B 3CDEA 4DMNA 3DLGA 1RA7A 3SPYA 3KLGB 4OJRA 5FRMA 3C6TA 1JLFA 1S48A 4I2PB 4CIFA 3AVGA 4JV0A 4DTPA 3QGIA 3KD5E 2G8WA 3AVBA 4MQ3A 2X6SA 1X1PA 1K6YA 5HRPA 4E7JA 5KFFA 4M3ZA 4F50A 5DQIA 2XO7A 1NKEA 1S10A 4IG3A 1KTQA 2OPPA 1O1WA 4FBTA 2JEIA 2FVQA 4E1NA 1TGOA 1R0AB 3CG7A 4DL2A 1NNDA 4B9NA 4Y3CA 2IM2A 4CJWA 1TKTB 2OPSB 5DLFA 4J9RA 2ZD1B 4KTZA 3AO5A 1HNVA 1RCHA 4K4TA 5KFIA 1A5VA 2FLNA 1J9AA 4J2DA 2V9WA 1S1WA 4Q5VA 3ZCMA 4TQRA 3OL8A 4FBUA 1TP7A 5KFOA 5HRNA 3PV8A 4IH6A 3I5CA 4I7FB 4B8AB 1Z26A 4H8KA 2QKBA 1XHZA 3E01B 2HVHA 4G1QB 2BGGA 4NLYA 4Y34A 4J9MA 2A1SA 4I2QA 1U49A 4N56A 3C6UA 3MR5A 3V6DB 1TQLA 3M8PA 3FQKA 1ASVA 3I0RB 4CJLA 4NLGA 4WYWA 1N4LA 1TKXA 3HVAA 1RILA 4CFDA 3CJ3A 4R8UA 4K8ZA 1N6QB 1JLEA 1KRPA 3MXJA 1D1UA 3JSMA 5KT2A 1TVRB 5KT4A 4ICLB 3SJJA 5CZ1A 4CFAA 3B6OA 2YNFB 1JKHB 4Z4EA 3UR0A 4FM1A 4MFBB 2YHBA 5C24B 3TAQA 5DGBA 3H5YA 1SH2A 5FDLB 3HP9A 2XWYA 3AVFA 5F8LA 2BE2B 1L3VA 3WNHA 2XY7A 3L2VA 3IS9B 2W9BA 2OYQA 5F8GA 1IKWA 1C1BA 2JC1A 3GIJA 2F8SA 4AHUA 2IBKA 2XY6A 3DLEA 4IH5A 1DTTB 3LP0A 2G8FA 2VG5A 3HYFA 3H40A 1DLOB 4CJEA 3MEEA 2Y1JA 3KLVA 4DU1A 3ISND 4BDPA 4W5TA 3SUQA 3K59A 5KFEA 4YFUA 2JEGA 4WZMA 1LV5A 3L8BA 2XCPA 4CGGA 3N6MA 3QLHA 1EKEA 4QAGA 2ETJA 3H4DA 1C6VA 3L2WA 4TQSA 3K5LA 2AGQA 4DQSA 5HROB 4HCBA 2VA3A 3V9SA 5KG0A 2R8GA 2BQUA 1RNHA 4Z0UA 2FJVA 3KHLA 2X74A 3RAQA 4IQXA 1ZBHA 1BCMA 2IC3B 4RW8B 2XI2A 3Q8QB 4BE1A 3I5BA 3RRGA 5I42A 4LH5A 5CYQA 4NLSA 1KFDA 4ED3A 4NCAA 2J6UA 2IGIA 4J9LA 1EP4B 4DEZA 1KVCA 4X2BA 4HUFA 4DSKA 2C22A 3VQ6A 1RT6B 2J6TA 1S49A 1A5WA 1FK9A 4DTMA 1WSGA 4YR0A 2DFHA 4ID5A 1X9MA 4B3OB 3DOLB 1DTQA 3ZSRA 4E89A 4O55A 1L3UA 3AA2A 3MF5A 3RMCA 1BQMA 3S3MA 1D5AA 4KHWA 2HWIA 5KG5A 3ISNC 4URSA 4IDKA 1BIUA 3MTKA 3G6XA 1RYRA 4FK4A 2R2SA 1TV6B 4ZP8A 4FW1A 4CJTA 4H4MA 4JS5A 2XY8A 3Q8PB 1RTIB 2B6AA 1S6PA 1MMLA 5J2PA 3HVWA 5KFWA 4QW9A 4C8LA 4E19A 2I5JA 2P1JA 3V4IB 3ICLA 5L1LA 4DFJA 4CEOA 3HP6A 4KV8B 3QZ7A 3NH1A 2HAIA 2IM0A 1J54A 4TYBA 1Z25A 4ECRA 2YNIA 3D28A 4ECSA 4Y1DA 1JXLA 1HPZA 2JEJA 3QEVA 4LD0A 3BQ2A 4U7CA 4PWDB 4B08A 3GIIA 4LY7A 4OVLA 4K4UA 2W7PA 4B9TA 4RZRA 1D0EA 2Z1IA 4KHRA 3BQ0A 5E41A 4KHYA 2AGPA 1LWCA 4CF9A 4CE9A 3CIZA 1EETB 2Z1GA 2NUBA 2OPRA 4Q0BB 4BACA 5KT5A 3MFIA 3SZ2A 3VQ4A 4CJKA 4EBCA 4IR9A 1WNSA 4EZ6A 4KRFA 3KLHB 2LSNA 2UVWA 5HRRA 4O44A 3NAEA 4RW4B 1RDCA 2VWKA 2D0BA 2HNZB 1RTDB 5JUMA 1IKXA 2RKIA 3OLBA 3DLBA 3AO4A 4OGEA 3SI8A 3N6LA 1ASUA 3FFIA 1RT5B 4NLWA 4KTWA 1RT3A 3CM5A 2FC0A 3CDWA 4CJPA 4M45A 3T3FA 3BJYA 3V1QA 3TAPA 4M3YA 4QW8A 4DWIA 4PUOA 1T03A 2PYLA 1QSYA 4HUGA 3SUPA 4RUAA 2AGOA 3KJVA 4DFKA 2HMIA 5F8JA 3NHGA 2W9AA 2ZE2B 3T5HA 4ELUA 1RBUA 4NLRA 3QESA 1B92A 3SI6A 4CK1A 1UWBB 3AVCA 2YKNB 4ZPDA 3HPHA 4E7HA 4O3SA 4FLVA 4GC7A 1RTHA 3DLKB 2E6LA 4KFBB 1REVB 3L3VA 3CJ0A 3K2PA 3D45A 1KFSA 1QQCA 2ILZA 4CGDA 4HVJA 3KKRA 1FXXA 3TAMB 4K4ZA 2UUTA 1WN7A 1RT2B 1S0NA 4M41A 2ZQBA 3P5JA 3DRPB 4CF1A 1MU2A 5KG1A 1N56A 4CJ3A 1HMVA 4WFZA 5J2MB 3SYZA 4M3XA 5EWGA 1RT1A 4DQPA 4F4KA 1LWFA 3LP2B 2O4IA 1I6JA 1TKZB 1FKPB 4DL5A 2X6NA 2E6MA 5KFRA 3MFHA 2QE5A 4F4XA 3QEIA 4QWAA 2RDJA 1IH7A 2JC0A 2E9RX 1CXUA 1U4BA 4NCBA 4AHSA 3DLHA 3NAHA 2VG6A 5T7BA 1KVBA 3C95A 3L2QA 1VSIA 3QINA 4KPYA 5CZ2A 4NLUA 4WZQA 4RW6B 4RNMA 3BSNA 2GUIA 3NBPB 3PW2A 1JLCA 4DU4A 2OPSA 1SH0A 1TK8A 4NYZA 3QIPB 3NF8A 2ZD1A 1HNIA 3DRSA 1JL2A 2J6SA 4FJHA 2DTUA 3GIKA 5KG3A 4DG1B 2AWZA 2W8KA 4FXDA 4I9QA 4EBDA 1RT7B 4EYIB 3FDSA 3S3NA 4F3OA 2KW4A 1L3SA 4FJ9A 3KMQA 3AVKA 2XGQA 3ALYA 3OJSA 3AV9A 4CFCA 4R5PA 2EC0A 2DFEA 3IN5A 1JLGA 1ZBIA 2V4QA 2P5GA 5F9NA 3I0SB 1ASWA 3DOKB 1S5JA 3VQPA 3NF9A 2HNYA 4CESA 4ECVA 4LSNA 2RF2B 1QE1B 3LAKA 4FJMA 4K4VA 3IG1B 4MIBA 2QXFA 3KK2B 3ZSOA 3CWJA 4FJ5A 2C2RA 1C1CB 1RA6A 1XWLA 3PY8A 4WXOA 1TVRA 4DSIA 1NK7A 2G8VA 3MEDA 3Q8RB 2C28A 1JXEA 2IAJB 4N41A 3KHGA 3BGRB 1JLQB 5J2NB 2HNDA 2D5RA 4DQIA 1J53A 1BQNB 5KRSA 3O3HA 2Y1IA 4CJQA 5FDLA 1S0OA 2HW3A 3GIMA 3G6YA 3K5OA 4OPKA 3CYMA 4W5RA 5KFLA 1WAJA 4PY5A 3AO3A 1FKOA 1VSDA 4OGCA 4FK2A 3CJ2A 1B9FA 3DMJA 2DY4A 3A2FA 3GILA 1T8EA 3LP1B 3K5MA 1DTTA 3LWLA 3MEGB 4O4GA 4LQ3A 4KI4A 3ITHA 4IFYB 3LWMA 3LPUA 1U48A 1DLOA 4NCGA 1VRTB 4W5NA 4TY8A 1T05A 4IKAA 2D41A 2PZSA 1SUQB 1ZETA 3AA4A 2KZZA 4ZP6A 1S1XB 1LAVA 5KRTA 5HBMB 4PQUB 1BI4A 1IKVB 5C42B 3CJ4A 2Z1JA 3VQEA 1CZBA 4R0EA 4XPEA 5HROA 4CEQA 1L3TA 3HXMA 3TAEA 3QETA 1S9GA 3HO1A 3QEWA 2HWHA 3F73A 3ASMA 5DMRA 4ZTFA 3U3YA 3VQBA 1S1VB 3PJXA 4ZHRA 1NK9A 3OYDA 3IRXA 2IC3A 4RW8A 4EP4A 3MXMA 3MECA 3LPTA 4M95A 2JGUA 1RBSA 4RW7A 3OYAA 1JLBA 3O3GA 3GQCA 4RW9B 1EP4A 1RDBA 3CVKA 3V6JA 2WTFA 4DTJA 1SKRA 3UIQA 4QWEA 1VRUB 4C8OA 2DFFA 4B3OA 2FLPA 3AVMA 5JXSA 1NHUA 4DFPA 3DI6A 1ZBFA 3KLIB 1W25A 1HYZA 4QCLA 2HHTA 2W9CA 3QGGA 1LW2A 4NYNA 3ZSWA 3M8RA 4ZPAA 3NGZA 3TAGA 4ECUA 5KFHA 2ATQA 3MR2A 4IG0B 3SUOA 2YKMA 1S4FA 1RTIA 2O5DA 3KLFB 4NRUA 4Y1CA 3KOAA 1X9WA 1RT4B 3RR8A 3NF6A 4WE1B 3DLGB 3M8QA 4Z4IA 3QIDA 3TR8A 3WNFA 3V9ZA 3OS2A 3OYEA 3V9WA 2GIQA 4JLHA 3C6TB 1JLFB 1QUVA 2BRKA 2UVRA 4FLXA 2IOCA 1C1AA 2GV9A 1JLAA 2V4RA 4EO8A 4BWMA 3BQ1A 1HYSB 3KHHA 1NKBA 5EDWA 1UA0A 5CYMA 5KFMA 4KHQA 4IG3B 3GV5B 2OPPB 4PWDA 4O5BA 2KZMA 1ZYQA 4NRTA 3OYJA 4RNNA 1NK4A 4MK7A 4Q44A 4CGJA 3PW5A 4IBNA 3V81A 5J1EB 4E1MA 2D7SA 2XY5A 1SV5A 1WLJA 4H54A 1KLMB 4ZVEA 4Q0BA 4Z4CA 5KFXA 1C0TA 1HNVB 4QWDA 2B5JA 3N6NA 1S1WB 5F8HA 4J2AA 3KLHA 4EZ9A 4AILC 2WK4A 3BSCA 3AVIA 2Z1HA 5SWMA 1S1TB 5KFYA 2HNZA 1S6QA 4AHRA 3NL0A 2BR0A 4I2QB 3KK3A 1CZ9A 3C6UB 2D3ZA 3M8PB 4KTQA 1ZTTA 2BRLA 1RT5A 1TKXB 1N5YA 1N48A 4W5OA 4FLWA 4NLVA 1C0UB 1HJRA 4F8RA 1LAWA 4R8UB 4ED8A 1JLEB 2YNGA 5HP1A 3K58A 3PO4A 2G8HA 2R8KA 1KSPA 4M3UA 5KFKA 4M3TA 2OH2A 3KK1A 4F3TA 1GOBA 4KKOA 4O3NA 3HM9A 4EP5A 4ED2A 1SKSA 5T14A 2BQRA 4RNOA 3DYAA 4YR2A 3NF7A 1F21A 4C8MA 4H4OA 5DG8A 2WOMA 1NKCA 2A1RA 2ZE2A 2FVCA 3M9NB 1IO2A 3M8SA 2W9BB 5HLFA 3LAMA 3NGDA 5L9XA 1IKWB 1UWBA 4DF8A 1ZBUA 5KG4A 4ELTA 1J5OA 1KCFA 3LALA 2QK9A 2G8IA 1K1SA 4G3IA 2FBXA 3LP0B 5C5JA 3DLKA 1NK0A 5L1JA 5K14B 4DTRA 3P1GA 1REVA 2VG5B 3DRRA 5EUHA 4QWBA 1A5XA 4ID1A 4KI6A 1I3AA 1CSJA 3HKWA 1BISA 3E51A 3DDKA 4CJFA 4NLOA 1HQUA 3OYHA 3BREA 2XI3A 4ECXA 1RT2A 5KFBA 1LW0A 3PW4A 4ED1A 1HQEB 1QSLA 3D0PA 5KFQA 3VQ5A 3KMSA 2FJWA 4CEFA 3QLHB 4MH8A 4CIEA 5L1KA 1LWEA 1XI1A 4K4XA 4YP3A 3PW7A 2G8KA 1UOCA 3T1AA 3LZJA 4ED6A 4FJNA 3QO9A 2HHSA 1XR7A 4KSEB 4EYHB 2UUWA 4W5QA 3V9XA 3MAQA 3G6VA 4DLEA 4FS1A 4Y2CA 2OPQA 4ZVFA 1NJYA 1U45A 1XR5A 1YTAA 2VWJA 2YNHB 3BDPA 4RG8A 4MKAA 4DL4A 2RPIA 4Z4HA 3ZT1A 4CHYA 5I42B 1D8YA 4DTXA 4HCCA 2IS3A 3ZT2A 4ECQA 4IKFA 3RB4A 4DTOA 1VSFA 1TL3B 1I39A 5KT6A 4KBIA 2D0AA 4MK8A 5C25A 2FVRA 4F4YA 1TAQA 3SFGA 3TARA 1DTQB 1XR6A 4FJIA 3DM2A 1HRHA 1Q9XA 4KHMA 4K4SA 3KHRA 2IM3A 4DG1A 2GC8A 1BQMB 3FSIA 4ECZA 1Z4UA 2FVSA 3U6FA 3OJUA 3ZSZA 4IFVA 4O3QA 4IDKB 1RBVA 1XHXA 1IKYA 3ZSXA 5HRSA 5CY4A 2O4GA 4H4MB 3KLEA 2CKWA 3UDLA 1S6PB 2VA2A 4KREA 2IM1A 5KT7A 1W9HA 4CEZA 3JYTA 5J2PB 3VQ8A 2FBTA 2I5JB 5KFCA 3KK2A 2XHBA 4B9VA 2KTQA 3RAXA 4OKJA 5J2QA 3PUFA 1S9EA 3HVTA 4FLUA 2YNIB 4FS2A 4JV1A 4ZTJA 1YTUA 3L2RA 2HHXA 1HPZB 3NGYA 2IAJA 3T5KA 2W7OA 2IMWP 4MIAA 1S0MA 4B9SA 2B43A 3BSAA 4K4YA 4F4WA 2HVIA 4FYDA 4ECYA 1JX4A 5EU7A 3KLGA 3V1OA 4Q43A 4AHCA 1LWCB 3CO9A 3UPFA 1NOYA 4I2PA 4DF4A 2OPRB 4NLTA 3GV7B 2BDPA 3VQ7A 1GOAA 4J9SA 4O0JA 4DSFA 1BCOA 3RRHA 5DG7A 1VRTA 4O44B 4CGHA 2R2TA 4CHZA 1R0AA 1RYSA 3EYZA 4BDYA 4B9UA 3RB6A 4NYFA 1SL2A 3SV3A 4RU9A 4NLPA 4J9OA 2AU0A 3QEXA 4BDZA 3AVAA 4LSLB 4EEYA 4WFYA 1TKTA 3PW0A
chains in the Genus database with same CATH superfamily
3R9PA 1VQNS 1S1XA 2CXEA 3OA9A 3ZSYA 4FZXC 1C0MA 1JIHA 4CNZA 1OH7A 4FJKA 4BRFA 2YQ1A 3EN9A 1YVUA 3P39A 1NH7A 1RBTA 3K0JA 2W4DA 1RDAA 2LEBA 2QV6A 4WYBA 3HZ6A 3D6MB 3DLRA 2JLGA 1TKDA 1OQ6A 4D3HA 2VU5A 3GP9A 1RBRA 1T94A 1PGZA 2RQ4A 2ZUGA 1TL1B 3MM9B 3QGHA 1LXNA 3QNOA 3N79A 3UCUP 1UAXA 3I0RA 4OPHA 1RQ0A 4J9NA 4H4KC 2EFPA 3WUHA 3WNEA 3EXCX 2BJ3A 2JHEA 4JI7F 3F9KA 2IY5B 2OKQA 1X4DA 4ICLA 1JJ4A 5KG2A 1X4FA 1S7IA 1ROFA 3OL9A 2H51B 5A6WA 3BKFA 1VQKN 1W7AA 1VMBA 3TX0A 3NOCA 2YWGA 2PYJA 1REGX 3ZTOA 1ZAVA 4CHPA 3O9SA 2WONB 5CZVA 3M6VA 3KHYA 2YY3A 2OO4A 4BRCA 3IKMA 1HMVB 2HIQA 4JKFA 4WFBL 3CMAS 4XO0A 4I68A 3TI0A 5KFAA 2AX0A 4Q8EA 1BDGA 2CH5A 4CF0A 3P5BP 3K9KA 5AQRA 4WE1A 5K8NA 3LM9A 4JD2B 1LWFB 2VOOA 3PIOQ 3R5CA 2P9KA 2HQGA 2CPFA 4NMXA 5DLGA 2IJNA 4RWTA 2YBVA 4FLTA 2BKPA 4AH9A 4ALZA 3PJWA 2ASDA 3FLCO 2L9WA 2WB1D 2ZBCA 1SH3A 1E4GT 3O4WA 3O6QA 1TK0A 3Q23A 5A2QO 1RISA 3D0GE 1R89A 2CG4A 4M3RA 1Q86O 2X1GA 4FJ7A 5J1EA 4A8XA 3M30A 3CCZA 5MLCV 1VSMA 4C11B 5BJRA 2W2QP 3AGKA 2GO8A 2JEFA 3C16A 4YDDB 3UN2A 2HRTA 4KHNA 1S1UB 2EFOA 3J7YP 2WVBA 5D3GB 4MDBA 3RW7A 2CPJA 3CD0A 2QYGA 2CQGA 2G4BA 4BR5A 2NLWA 3BR9A 1VQ6N 1G15A 4E0DA 2OEMA 1JLGB 4XPCA 2C2DA 1FRIA 3R5AA 3JSYA 4WCEL 2PY5A 3THVA 4J9UE 3WC2A 4OIXA 2KFNA 4LSNB 1X4HA 3CC2N 3RTVA 1V3ZA 1B99A 4G1IA 3HSTB 4A57A 3TABA 1Y0HA 3L3UA 1NPRA 7FD1A 4OHZA 3VA0A 2ZVIA 5H1SV 3MI7X 2HRYA 1BA0A 3MEDB 3QSIA 3C15B 3HPOA 2V5HG 3TANA 1IM4A 1VS3A 2N7YA 3OL6A 1OS5A 3LTOA 3V4IA 2XULA 3SIPB 2MKHA 3KUHA 1YVNA 4KV8A 3UKUB 1PJ6A 5AQGA 3LDNA 1MA9B 5HSPA 5DM6L 1KHVA 3PZPA 2H65B 4DL6A 4DL7A 4O4GB 4RNFA 1C2PA 3GU0A 5LJ5Y 1HBUA 1UZDA 2VHGA 3UE2A 3QNWB 3D7SB 3CJCA 3J81O 2M4MA 2EFNA 2DHAA 1HQEA 2OIHA 3W63A 4RUBA 1NK8A 2UXBJ 2FVPA 2YXLA 3OYBA 1IBMK 4FM2A 5IWAK 1I94K 4NLQA 1QQMA 1IR1A 1JXBA 1IBKJ 4FF1A 1S9FA 4DTUA 3FQLA 3IRXB 3HSDA 3ET6B 2D74B 1ZM2A 2AX1A 1QAIA 3CULA 1JXVA 2HHVA 2E1YA 1M5OC 4LF6K 4CEBA 2HAFA 4BRLA 4RW7B 2RUGA 5AFUH 4ZVOB 1TL3A 4KH4A 3L09A 2MKSA 1UEUA 3D68A 1QTNB 2DGUA 4AUKA 2QLFB 2AD9A 5DG9A 2V7ZA 2KFZA 2QWMA 3CJKA 3KD1E 2ZC4A 1CULB 3JSMB 4J9VA 4DTNA 1I1GA 2E1RA 1PAEX 2MZTA 5FIIA 3ZSVA 3ZETB 1F1BB 2GBZA 5KT3A 1KAXA 4PXEA 4DR6K 2GELA 1MWYA 2XZTB 1WOOA 2F40A 2B9EA 2J0WA 4RBVA 3TEHB 3HT3A 3SDEB 1U8SA 2R8HA 3AHPA 2VBWA 1C1BB 3SXLA 2KRRA 3QMLA 2YKNA 1FRJA 3H90A 2HHUA 2VZ9A 3OW2R 3CCVN 2ZOGA 1X3NA 1ULRA 1RWUA 5F0WA 4C8NA 1WF1A 4K43A 1FFSB 1XTZA 4E7LA 4RUCA 2A6AA 2NS1B 3CPEA 3TAMA 4R25A 4DMZA 1N36K 5JS1A 3P96A 1OO0B 4TXSA 3PVXA 1U25A 3BO3A 4CZEA 4CO4A 4PKIA 4BC7A 5J2MA 4OKKA 2V8DA 2PD1A 4YMEA 4A5AA 5KFPA 2V9KA 2E44A 1VQLS 3FUYA 1S7HA 2ZH7A 5HL7L 1RLDA 3AB4B 4XTTA 3HSJA 3UDCA 2EHGA 3CO0P 1JCEA 3EZ5A 4DL3A 4TSXA 4YQWA 2UUAK 4DZ6A 4OV6A 1Q81O 4CJUA 4A5BA 3R7NB 3H45C 3UD5A 2C2KB 2WCXA 3OS1A 4ZJQA 1K1QA 4PXDA 4ID5B 4ECTA 1RAJA 1BGXT 2C2OB 2FHKA 4F2RA 1VLOA 2VONA 3FZLA 4ANCA 4DOZA 1S6OA 3AA8A 3M6WA 1FFWB 4CF8A 3BYPA 3GV8B 2HIYA 3M9OB 1D9DA 1Y97A 1R43A 4XH5A 3G4SN 4DPWA 2R7YA 4BRQA 4ED0A 4DPUA 2UZAA 2Q3SA 2EFQA 1IBLK 4F7VA 1NGGA 1E4FT 1TL1A 4FJ8A 5KG7A 3OFGA 3US5A 4WQ5A 1BG3A 2FBYA 4QS7A 2JWNA 2RF2A 5H9EK 4C1NK 5LXYA 3IG1A 1QSSA 4HACA 3T1YF 1VDHA 2I1RA 3JAMU 2ZHAA 3OYLA 1C1CA 2MY8A 4OL8A 3TO8A 2DPJA 1NGJA 4URQU 3V1RA 1Q86T 2W42A 1EQYA 4HT5A 5FROA 3U4LA 4ZN3A 4A46A 1RKJA 1GLEG 2DPIA 1KXPA 3MX5A 5J2NA 4CCHA 1HNWK 3NMRA 2HHHK 2IA6A 1RDDA 5SUHA 3R2CJ 1UW4A 4TLRA 1X9SA 2EFVA 4FCYA 2WONA 2J5AA 2ZFHA 3C65A 5ETLA 1VQSA 3V2UC 2MZSA 3CMAN 3TQ1A 1VSKA 3H20A 2HFUA 1TZ0A 1SJ3P 4DR5F 3H8YA 4JD2A 3QO9B 1B4SA 3PX6A 5J1NA 1OVQA 2I7PA 4KAIA 2OPQB 3RAMA 3KNAA 5LSOA 2JLEA 3SFUA 3UN3A 2P8IA 4F25A 5AQTA 3UCGA 2RKIB 2XCAA 3TW0A 4PQUA 4JI4F 5F2RA 4M94A 1VSLA 2B7BB 2OMLA 4Y00A 3OYFA 2HS3A 2RUSA 3BY5A 4JI7K 1HWIA 5JS2A 3BDEA 3UNGC 1Q95G 2IJRA 1Q8KA 4H0VB 5HANA 1BO5O 4CZKA 3VCDA 4I4BA 4BR9A 3FRZA 1S1UA 3OHAA 5D3GA 3G0ZA 1QAJA 2O8BB 2OMOA 2Q3PA 1NOZA 3CW2C 2AJFE 5GMDA 3ID8A 1BC6A 1IKYB 3CC4N 2YWKA 1L5UA 3KLEB 2QWLA 2HGLA 2XMWA 2KB2A 2V8PA 4HKQA 5M2PA 4NYPA 3CDAA 1NSPA 3JYTB 4DPOA 2KJWA 2NXCA 4C6AA 1TUYA 3SK3A 3NH2A 3OY9A 4O0IA 2ZH5A 5IT9U 4QPXA 1Q82T 1D8ZA 1FERA 2E4LA 4PCQA 3PR4A 4HHJA 5B0EA 2V6AA 4NB4A 1IJEB 3PX0A 2GQQA 2NSBA 1VQ4N 4IG0A 3RYLA 4JUZA 2QMXA 3NRBA 4K50A 3R5GA 4JKCA 3LGHA 1RT4A 5J1PA 3DLGA 1H73A 2D9PA 1X5OA 1TFWA 5FRMA 2FTRA 1SC3B 4OZ3A 4DTPA 3LM2A 3E9PA 3AVBA 3O5BA 4MQ3A 4DPYA 5H9FK 4E7JA 2NZCA 1PO6A 1HA1A 4X4VA 3NS5A 4JNEA 3LDPA 3B82A 4M5GA 2OPPA 1CEZA 4FWNA 4YS2A 3ZX0A 4JK9A 2FVQA 1TGOA 1K8KB 2Z30B 4CNYA 1TR0A 3R6GB 4Y3CA 4CJWA 3D6RA 1HNVA 1RCHA 5JVHL 4KYZA 2XYPB 2HFZA 5KFIA 3L95X 2FLNA 1J9AA 2V9WA 5JICA 2GQ2A 2OUGA 3BBBA 2XMKA 1TTHB 3H3NO 2NRTA 2F8HA 5M1OA 4TQRA 1NSKL 4P2MA 5HRNA 4IH6A 4MLEA 2IBOA 1YRUA 3E01B 2NRZA 3GFXA 4G1QB 3ZC4A 2ZEJA 2MZ1A 4OI1A 2A1SA 4NA3A 3GWCA 5BR8F 4N56A 2F4VK 1TQLA 4LIWA 1NZAA 4OMFG 1F9EB 3JSBA 4JI2F 1N4LA 4BRAA 5ETNA 1RILA 4LRFA 3CJ3A 3HF5A 3JQKA 3VTIA 4K8ZA 2PFUA 1N6QB 1JLEA 1NGBA 5A0YA 3JSMA 1YDLA 1JKHB 3M5RA 4UQTA 1UFLA 2PFDA 3CNQP 2YHBA 5C24B 3ZETA 4YOUA 4PKDB 1MW7A 3TAQA 3C14A 4AL6A 3OT9A 2GAHC 1L3VA 2AA4A 1Z05A 2YCHA 3IS9B 2W9BA 3WIVA 1Q81T 3M05A 1C1BA 2CQIA 2Q66A 4AHUA 1R27B 3AD9C 1DTTB 3LP0A 2YH1A 4AFFA 2G8FA 3CCLN 2VG5A 1SJ1A 3H40A 3GJQB 2Y1JA 2FUG9 3ISND 1OJ4A 3SUQA 5F3TA 3K59A 4A8QA 3T1YJ 2JEGA 1H0HB 3L8BA 2CZ4A 1YIJN 1P9QC 1EKEA 1GAOA 3FBCA 2MY7A 3IR7B 1RAEB 2F7VA 4OJHA 4HCBA 1VQLN 4H5RA 1HI0P 2DY1A 4Z0UA 1NRKA 2GFFA 4U9RA 2X74A 3D67A 5EX0A 4MDAA 2MKJA 1K9MO 2XI2A 2J7UA 5JLFA 5ITHA 4X62F 2DD8S 2UUCF 2M8DB 1EP4B 1FRMA 3MURP 4PR6A 4X2BA 1KVCA 2C22A 1RT6B 5K8OA 2J6TA 1T6CA 2VV5A 4DTMA 1JCGA 3QATA 4YR0A 1OSCA 3BUZB 2DFHA 4ID5A 4C7QA 1MLAA 4B3OB 3DOLB 3VESA 3WIUA 1T9UA 3ZSRA 3CB4A 1Y5LB 4O55A 1UW9A 1WDDA 3EE3A 4UW2A 1BQMA 4FVUA 1X0FA 4DUZK 1BIUA 3G6XA 1WF2A 2YHXA 2ZZNA 1R31A 5TKYA 2XSJA 4H4MA 3A3NB 1RTIB 5BRDA 3HT0A 2AHOB 2J9DE 4C8LA 5IS2A 3G8TA 4DFJA 2LQBA 3HP6A 3R9LA 1CG2A 2QL7B 3FE1A 2HAIA 1J54A 1Z25A 4QS9A 3D28A 2O01C 3K7RA 3FEYB 4LY7A 1WJ9A 1RUSA 3O5TB 4B9TA 1D0EA 2ZF5O 3M6UA 1P9YA 2NRRA 4USVA 2B4UA 2Z1GA 1N54B 2FSNA 1GK8A 4BACA 4YY3J 3VALA 3VQ4A 1GT8A 1VC0A 4CJKA 1U7LA 4HHUA 1WNSA 4EZ6A 2G1HA 1LCUA 3A12A 2E2QA 5IFMA 4RW4B 3W7BA 4KPCA 4EHTA 5CXTA 2HNZB 4FPRA 5E7OB 1FF2A 5LMUJ 4JI8F 5M1NA 4JI6F 3SBTA 2RKIA 3OLBA 3MR7A 3AO4A 3SI8A 2CWKA 2DNQA 3CCJN 5E84A 3N6LA 1ASUA 4NLWA 3T7ZA 2EK1A 5GVQA 4L3NA 4BBYA 3CDWA 4M45A 3TAPA 2NXJA 4BC5A 4DWIA 4NYOA 4PUOA 2PYLA 4Y65A 1N5VA 2D3OR 1CC7A 1VBYA 2CJAA 4P7VA 1FDNA 1GXUA 3SUPA 5GMKa 4WP9A 2AGOA 4QS8A 4F4AA 4DFKA 5F8JA 3NHGA 3J7Z5 4I6AA 3IA0A 1RBUA 1BMQB 3PYDA 4IOAQ 5BPMA 4NE9C 4TU9A 1B92A 4Y28C 6FDRA 4QIGA 1B0VA 3AVCA 3E9OA 1L3KA 3HPHA 2IDEA 4O3SA 2X7IA 5AQFA 2E6LA 4YUDA 2QXLA 2FGCA 3L3VA 4DR5K 5BR8J 1KFSA 3MCMA 3GSIA 2AYEA 3J80U 2UUTA 1WN7A 3IBWA 4M41A 3M2UB 2W6KA 4WFZA 2FIUA 2L9DA 2VD3A 1SJFA 3D1OA 1LKZA 4JI4K 1W97L 4FZVA 4DQ8A 4MJKA 4DQPA 1MROB 2O4IA 1I6JA 2P9CA 4F9OA 3VWSA 5CH7B 2GUPA 3THWA 5KFRA 1SIZA 3VVTA 5HVHA 1BWFO 3OD2A 3QEIA 3PACA 4P10A 4J8FA 4YOWA 4YEAA 2RDJA 1IH7A 4UY8O 2E9RX 2VG6A 5T7BA 1F9FA 4K42A 3JXUA 1BU6O 1K8KA 2GUIA 3NBPB 5ELZA 4OFZA 1Y00A 5A8WA 3PW2A 5AQIA 4X65J 1HNIA 4GVEA 2V69A 4U67L 1JL2A 2J6SA 4FJHA 5AQQA 4DG1B 4EBDA 5LT5A 4RL1A 3IAM9 4EYIB 3D2FB 1VK3A 1IWGA 1B64A 3K9JA 5D0RA 4MYUA 1L3SA 3SCJE 2Z58B 1SXLA 3I6PA 1Q8LA 3AV9A 1DY3A 2ZBPA 3VEWA 4OJGA 3P4IA 1K0TA 2Y0SD 2CJYB 2P2CB 1RJJA 2V4QA 2HF4A 2P5GA 2RB7A 3DOKB 1WKLA 4ECVA 1QE1B 4LF8J 2MZRA 3PSIA 5FLXY 3N0VA 4ZPWR 1DHMA 2C2RA 4X62J 1RA6A 3W2VB 1RHJB 2HWTA 4WXOA 1D3WA 2HVZA 3CPWR 2G8VA 5HJXA 4DV1F 3M2VB 3Q8RB 3H25A 1ELOA 3BGRB 1JLQB 1WG5A 2EXUA 3CQXA 2EBEA 2HNDA 2V4JB 2Y1IA 1SQKA 1CJTB 2O3DA 1S0OA 2HW3A 3KJQB 3ZZZA 4IOAL 2ZH1A 3CYMA 4W5RA 1NUEA 5KFLA 3CJ8A 2E7XA 1FKOA 3GBTA 3PM9A 3PCOB 4H5TA 5EX5A 1T8EA 1DTTA 3LWLA 1RWKB 3MEGB 4OYXA 2BABA 4IFYB 8AT1B 3LWMA 4FN5A 1U48A 3I4HX 2Q97A 4DX7A 2KVQE 2EWHA 4OZ1A 2H5JB 2VKRA 4MTPA 1T05A 4IKAA 3RBZA 5CD4H 4X66K 4DV6J 3CT9A 2PZSA 1ZC6A 3UN5A 2KZZA 3AA4A 2D0PA 4LVNP 4O8KA 4JAXA 3CD6S 3M8WA 5KRTA 1E3MA 2KFYA 4K59A 4DJBA 1BI4A 1DT9A 1JCFA 1WTFA 3BEXA 1ZBTA 2CZVC 5T7LA 1SJ4P 1CZBA 4JI2K 4XDDA 2DO0A 4R0EA 3T41A 5I3QA 4NPOA 4GKKF 3QEWA 1PJ7A 3U3YA 2LVWA 1S1VB 2HFNA 4ZHRA 1NK9A 4C8YA 3ZZPA 3WXIA 1VR6A 3PKMA 2B0GA 3MXMA 5F3ZA 2DJWA 4BVOA 2V2KA 3OYAA 1JLBA 4CZJA 1EP4A 1RDBA 3V6JA 4BLGA 3P6YC 2WTFA 5M2RA 3UIQA 4QWEA 2DBBA 4EMDA 2K3IA 1ZA1B 1U0HB 4B3OA 2GWKA 2I38A 3RG6A 1ZBFA 3KLIB 3SMZA 4CM2A 1LOTB 3C6AA 1ATNA 1W25A 1HYZA 1BWVA 2YWWA 2W9CA 4PG6A 4K5SA 5C2GA 5IQ6A 3A8EA 1HD1A 3M8RA 4ZPAA 4FWRA 2GHPA 1T3OA 3CCUS 3QDKA 3SUOA 4JI3K 2EKYA 3ENQA 1RTIA 4NWBA 3M4XA 1FI4A 2HBQB 4WQ5C 5BPLA 4Z4IA 5KPZA 5EVZA 3V9ZA 3OS2A 3V9WA 2DIUA 3C6TB 2BRKA 2UVRA 1U2RA 2AJ4A 2DHXA 1RBLA 1WKJA 3DFEA 1UA0A 2CVIA 5CYMA 3VF4A 2CJKA 4P6QA 4IG3B 3GV5B 2ZH6A 3ULHA 1SJQA 3BN4A 2UUCK 2XB2D 3OYJA 5DDQC 4AXJA 1Q0NA 4CGJA 1FJGF 4ZITA 4IBNA 2G2ZA 3OBWA 3M8ZA 2XY5A 1RTZA 4H54A 2GNKA 4QWDA 2B5JA 5CA5A 2W2OP 2HLUA 1S1WB 3DXKB 1Y4ZB 4A8SA 1R8BA 3AY0A 3EGVA 2ACMA 5SWMA 3HULA 2QC3A 1KQKA 1K8AO 1S1TB 2HNZA 4AHRA 3TPQA 3KK3A 1UP1A 4BRHA 2D3ZA 4ZN1A 2LEPA 1GMVA 1R8AA 4X84A 5CE3A 3FRYA 1YJ9N 1ZTTA 5GAEU 5JVGL 1QZ5A 3FCWA 2BRLA 1NZ8A 4BC3A 1TKXB 4JYAJ 3VAJA 1C0UB 3MMBA 4F8RA 5L9NA 4JKGB 3SJHA 5HP1A 1RACB 4M3UA 4DUYF 3KK1A 2DR9A 2OTLN 2OANA 3VAIA 4KKOA 1N5TA 3HM9A 2RAQA 4O8UA 4GNIA 5T14A 3DYAA 3NF7A 1F21A 2E5LJ 2WOMA 4DUTA 1GNKA 4OX9F 3M8SA 5HLFA 2WFBA 3NGDA 5L9XA 4P2FA 1IKWB 4DF8A 1PBUA 1R0BG 4ELTA 1NMNA 1AZSB 3LALA 2G8IA 2Q6BA 3GSDA 1ITPA 3EKUA 6AT1B 1EHWA 5K14B 4DTRA 4ID1A 2DGWA 4KI6A 4I56A 1XN9A 2RT3A 1BISA 2XI3A 4OI3A 3QBXA 5KFBA 4UUWA 2EI5A 3VQ5A 3WXJA 1QLNA 3KMSA 1VLYA 2FJWA 4CEFA 3QLHB 4MH8A 4CIEA 1LWEA 5DZ7A 4K4XA 2Q2RA 4YP3A 4NI2B 1TU0B 3BH7B 1VC5A 1CLFA 4FWOA 4L6V3 3H1VX 1HBNB 4EYHB 3R1HA 3G82B 3P3DA 3V9XA 1YKWA 2YVSA 4FS1A 2CGLA 1FEEA 1NJYA 1U45A 3BGOP 2I8EA 4LJMA 2C42A 4LR8A 3AD7C 3BB5A 5IQQA 1QDUB 4Z4HA 1W2BR 2W25A 4LVOP 3IR5B 5I42B 2K1RB 1D8YA 1M5SA 3BGUA 4DTXA 4RO0A 2KM8B 2IS3A 3ZT2A 4MAKA 4IKFA 4DTOA 4C98A 4BRPA 4IO9Q 3IWLA 1XMBA 5KT6A 1NCLA 1JNZB 2FVRA 3GYGA 2LP4A 4HR2A 1HFEL 4WQ4A 3TARA 3I56N 1GLJO 3DM2A 1U24A 1NPKA 3W62A 2KT2A 1Q9XA 4KHMA 3KHRA 4DG1A 3FSXA 2PAVA 2V2VA 4DR3J 1Z4UA 2FVSA 3RRKA 3OJUA 3ZSZA 4IFVA 3QT7A 5AQJA 4LRCA 4IDKB 1Y64A 3P38A 2FY1A 1RBVA 1XHXA 4F67A 5A76A 1X5SA 5AXLA 2WVFA 5HRSA 2D69A 2DB1A 5AJ3F 2VQFJ 3UDLA 4MMOA 1TYQB 1J5EJ 1W9HA 4CEZA 5L46A 2XSFA 2P9UA 1RAGB 2FBTA 1A0OB 1LWXA 5FD1A 3RAXA 1Y10A 5J2QA 4OKJA 1S9EA 3W2VA 3PLAA 4DV7J 4FLUA 3TTCA 3C7NB 4K2JA 4ZTJA 3KJNB 3L2RA 4K25A 1U1KA 2DR7A 2IMWP 1FRHA 3OTDA 3I82A 2V4JA 3BSAA 1X4AA 5HOOA 4X64K 2HK2A 2HVIA 1LFWA 1SI9A 2QN6B 1LWCB 3T1HF 4P9SA 1SQFA 2CPEA 4WF9L 3JTPA 4J9SA 3VEXA 5M1KA 1S79A 2VFRA 2VPWB 4JN4A 1U0SA 2NXNA 2P9NB 2DRDA 5DG7A 5E3CA 5F41A 1I3OB 4JI1J 4H0OA 1HX1A 1RYSA 3R8EA 4NYFA 4JI5F 4CLYA 3AVAA 1RBAA 3MOJB 2NRHA 3W60A 4DS4A 3GE1A 2P9EA 2V2QA 4M3WA 5KFGA 1YBTA 4KB1A 2Z57B 4Y2IA 3L9ZA 1SL1A 4Q45A 3ILOA 3F44A 4NXMF 4KE5A 1UCNA 1DEJA 2I9SA 2VQEK 2AQ4A 1UKUA 4BG9A 2KDOA 2YV0X 4OX6A 2G13A 3BGLA 4I6MA 3NKYA 4DV1K 4DR2F 1XMQF 1RTJB 3O1WA 2CQBA 3KG1A 2R8IA 2BW7A 2RU3A 4LRDA 1NJWA 2XMTA 3ULDA 1HNZF 3AT1B 2CNNB 1YJVA 4X4TA 4IR1A 1RDUA 4MKYA 3J81U 3LZIA 2HGNA 1Q9YA 1UVNA 4GW6A 5EWEA 2O8FA 2ZWOA 3QEPA 1SL0A 2YPYA 4OLAA 4USUA 1VHIA 2YNFA 4DLGA 4MFBA 3GDQA 4KH0B 1EX8A 5KGXA 4IH7A 3H5SA 2BE2A 5CYJA 2ZM6F 2AJQA 3AAWB 4YB1P 3H5XA 4WIIA 4KHPJ 4UZCA 1GLDG 2FF6A 1O13A 3S7RA 1K8AT 4PQAA 5LMNF 1LK7A 2AW0A 5CHCB 3PG9A 2QWOA 5AXNA 4FJJA 4KR0B 2VJVA 2N4CA 2Q1LA 4AYBD 4GKKK 4HI1A 2MQQA 3ZX2A 2HB5A 2BJDA 1YJ7A 2BJ8A 4DR4J 3MEKA 3LDSA 3BZQA 3QIOA 3U9ZA 2D3UA 5K20B 2Y3YA 3NMAA 4ZJOA 2EFGA 2WB4A 5C2FA 1WC3A 4M63C 1HNXK 2R8JA 4CEAA 3TTDA 4FKYA 3CTRA 4PZVA 3W5YA 1S97A 4BY9C 3BM7A 5B0GA 3QPIA 3VQ9A 1JLCB 4J2BA 2VICA 3A5NC 3PDNA 1OMSA 5KFNA 4EWTA 3DRSB 4NLXA 2DGQA 3QYYA 2J4RA 2R7QA 3DLLL 3DXKA 2A3ZA 4S0MA 5FPNA 2YWFA 3AVLA 4JK8A 3MM6B 4FYWB 1YRTA 4WKRA 2JZ5A 4CLFA 2E5IA 4NXNF 1S1TA 4M42A 4QYZK 1T0TV 1C4AA 4R5PB 4B3SK 3HFKA 4C8KA 2UXDF 3O3FA 4OZ0A 1O0PA 3GMGA 2XM3A 3KUGA 2CJ9A 4U8YA 1I5OB 4RUHA 3UNYA 4NZ0A 2QL5B 4O3PA 4WFNQ 1SQGA 3OS0A 1C0UA 3DC2A 3I5AA 5DM7Q 2F9DA 3O8MA 2KL8A 1J6ZA 3V9UA 2ZJQL 2RN2A 3ONQA 4LIRA 1IWAA 3U9DA 2M88A 4CH1A 3FGVA 2CGJA 2U1AA 3L0QA 1YZ7A 2WHOA 2F96A 4DV3F 1U6BA 2NUUG 4CJ4A 4UTGA 2WVDA 5AQPA 3NNAA 1FJGK 3KTQA 1VSHA 2QFJA 4E2FB 4DFMA 5E3RA 5CR4A 4N5SA 2AZ1A 2O8DB 2OA8A 3DMJB 5GIOA 3ELHA 3O2IA 3FZ2A 1VOMA 2E5GA 1F5BA 5K14A 3U7JA 3ITHB 4EO6A 5AJ3J 5D15A 1KHWA 3CJ7A 1UVKA 4C3LA 5GAGI 4TY8B 1IN0A 5HK4A 2ZDOA 1O8BA 2ZNYA 1NJZA 4GMJB 4E3SA 1EETA 5ETPA 2OZMA 4TVAB 2KYZA 3H59A 3PYGA 3H98A 4CJRA 4EGLA 1NHVA 2ADBA 3HHDA 4LF5K 4LF4K 1A6LA 2FBVA 4F2SA 1HBNA 4DSJA 4CECA 1WSVA 1GTHA 2W8LA 5G0RA 4AE5A 4DUYK 5DK5A 2BQ3A 5A2QY 1RTDA 2CJXB 3VA3A 4CHQA 3M1VA 3LDLA 1M90T 2K2PA 1NJXA 3MECB 2KQ2A 4FM0A 3MXIA 5F0XA 4R0JA 3GYNA 4WK1A 4BE0A 5FPMA 3R6MA 1HWUA 3Q8UA 1RAHB 3O9RA 4H0XB 3OV7A 1YX2A 3HHLD 1T9XA 3B4DA 2GVDB 2E9TA 1WB9A 3GTYX 4MYTA 4F0HA 2DXDA 4DV2K 4RR5A 2W40A 5B0AA 3HD2A 1N33F 5KG6A 1LW2B 2F8TA 3CUNA 3UKRB 2RS8A 2PFFB 3GFHA 1JNRB 2UP1A 5ETTA 2GMLA 2DIVA 1UPPA 1U04A 4B3RF 4KFBA 5E26A 2HQCA 4WFNL 3M8QB 4PXBA 2P5OA 3Q24A 3MEEB 3K17A 1HKBA 1U26A 2EBGA 1KTVA 2HBKA 2EX3A 2ZGYA 3OTCA 1UWAA 1JLAB 2DISA 3DRPA 3KKSA 4FK0A 3LDQA 3ZZ0A 2IYGA 4QOTA 3RB0A 4YDXA 1VHFA 5I9EB 2P9SB 1PKUA 2HSEB 4J5OA 3HSZA 3IWXA 2YJFA 3LW5C 2W2MP 4Z94A 4YR3A 3SV4A 1SV5B 2DK2A 3OBIA 1Q8IA 3AOCA 2ZM6J 3AVHA 1FKPA 4URGA 2HS4A 3CJTA 1C0TB 5MLCQ 4AT1B 3E1YA 3ZEUB 5K5MA 4DV5F 1RBOB 1Q18A 2A5XA 4CK3A 5KAKA 5LMNJ 3M32B 1NK6A 3TZXA 1TUVA 3SQOP 3FCHA 2NCKL 3RBEA 2RSQA 3CCQN 1KVKA 2FSJA 1S6QB 4ZPVR 1VQMS 1FK9B 1NU4A 5EOYA 2LFVA 2E7VA 2ZJRL 5L1IA 5F8NA 3QIPA 4LBHA 2BACA 1MWZA 2I0XA 1K73T 1RT7A 1KC8O 3HDSA 5LSRA 3RMBA 3QT5A 1UAWA 4HI2A 2KHOA 3W64A 2YNGB 2BVZA 3GIRA 5M1QA 3Q8SB 1VIOA 2CDQA 2FZKB 2JNJA 5K9FA 5H1SQ 1RHMB 3BN7A 5FLXO 1SQEA 2D1CA 1RTJA 2XQCA 1U1NA 1RZMA 1PYSB 2MJNA 1JK9B 3TUJC 3AJ2A 3OLAA 4BRDA 3PEJA 1DRZA 2ZKUA 1XC9A 3LP3A 3ENBA 4ZP9A 4BRIA 2ACYA 3K0SA 2DITA 3T1HK 4YNQA 3WHIA 5EWFA 2BTFA 4OI6A 4G65A 2ZH9A 4I9LA 2IIHA 1OIAA 3AH6A 1BQNA 2ZDPA 4M1KA 3S41A 1HQUB 3HVRA 2NPIA 2ERRA 1TK5A 2I2YA 1N8RO 2P51A 1HW8A 2ZHOA 1EZZB 4PAAA 4OI2A 4JI5K 3OYCA 4P71A 2HHWA 1JL1A 4NZ6A 2DNZA 4AQYJ 3AVJA 3LP1A 2QTWA 1NMEB 2N3OA 4O3RA 4NO7A 2F4FA 2J76E 4HHTA 1KAZA 3VEYA 1H2VZ 3PHEA 2X78A 3O4QA 3SUNA 5D4PA 1T02A 2V52B 1M5KC 4YOTA 3CFPA 1IKXB 4NLCA 4IJAA 2O8CB 4DBQA 1UPMB 4CFBA 4DR7K 5GAGU 1NMDA 2RRNA 2IHR1 5M2UA 1HNZK 2OEKA 2IIRA 1QS4A 4RBUA 3HHEA 4FW2A 5C25B 2VKZG 3TAFA 2L41A 3B54A 1T03B 4O4RA 4OQJA 3LOUA 3LPYA 1K44A 1HKGA 4F04B 3Q2TC 1B9DA 4YOVA 4IEEA 3L7PA 5KFVA 4FWKA 4GVMA 3KWGA 2DNLA 4QIWD 3QSYB 3L3CA 3MM6A 3I8BA 3RBDA 2PA8D 4RW9A 4M5IA 3OYKA 4IO1A 3NCIA 3HI0A 5IT4A 2GO9A 1VRUA 3MN7A 1FFGB 1NH8A 3RMDA 4L3QA 3N5FA 2YH0A 1GX6A 2CQ3A 4MO5A 5B7WA 1Q79A 3A1YG 4FJLA 4H5VA 1E6YB 4BRNA 1M1KO 1VSEA 5GIPA 3NS7B 3NDKA 1F2HA 5BN8A 1QHTA 5IC6B 3IAYA 4K0KJ 2YTCA 4HEA9 4B3MJ 2IYIA 3KLFA 2FHMA 3BS9A 5AQYA 3CCRN 1RT1B 3CDEA 4DMNA 1RA7A 3UVJB 1F5CA 5DDOC 1BQXA 1JLFA 1KDNA 4CIFA 1YHQS 4JV0A 2G8WA 1M1GA 5U47A 1DAXA 1K6YA 4OYWA 4M3ZA 4F50A 1NKEA 2DNGA 2FJEB 3LF0A 3MMAB 3TUPA 1UFWA 2GJIA 1FWKA 1O1WA 1ZH5A 4E1NA 4ETZA 3BZCA 3CG7A 4WK3A 1NNDA 4DZDA 3HZGA 4NXNK 1LXJA 1TKTB 3MCSA 2UXDK 2QMUB 2ZD1B 3FZBA 3K5PA 1VK8A 2ZVSA 1A5VA 2MQNA 2W7AA 2R3VA 2E1CA 3GZ7A 4Q5VA 3OL8A 2XMJA 4FVCA 5BYRA 1Z26A 4H8KA 2QKBA 1JJHA 1WG1A 3DDIA 1XNRJ 4FOEA 4I2QA 4ZLJA 1U49A 4DV3K 4KC5A 3M8PA 2W1BA 3FQKA 1ASVA 2OHDA 1Y5IB 3I0RB 4DV5J 4CJLA 1CQMA 4WYWA 3HVAA 2D9OA 4CFDA 3VEOA 4N8NA 4OZLA 4R8UA 3CD5A 2NNWA 1V9OA 4CZHA 4FNHA 5KT2A 4H5WA 4X65K 4X4NA 4ICLB 4CW7B 3SJJA 5CZ1A 4ED5A 4Z4EA 3UR0A 1NLVA 3SBGA 5D78A 1VQKS 1SH2A 3HP9A 3UDVA 5F8LA 1RU1A 3L2VA 2HGMA 1B3TA 1VCTA 3LL3A 3SMSA 3OR1A 5F8GA 4ILMA 3UKRA 2JC1A 3GIJA 2P9PA 4A8WA 3SEOA 3HYFA 1BA1A 3MEEA 2P9KB 2JFDA 3EM1A 3W9HA 4DCHA 4BDPA 3W9JA 1KC8T 4OI0A 4WZMA 3UCZP 2XCPA 4X4UA 4QAGA 1SVDA 1YBAA 3NVKA 2J9CA 2P9SA 2A2DA 1C6VA 2QGFB 1AA1B 4ZDNA 1FVQA 2RH3A 5IM0A 3V9SA 3D1HA 4V19S 3OQ2A 3LA0A 2IVMA 4JHDA 1ZBHA 3EE8A 4NASA 3D9BA 1BCMA 2IC3B 3C16B 3Q8QB 5AQVA 2ZOFA 5HQMA 3JB9k 1YAGA 2RILA 3M32A 1JB0C 2DNRA 4NLSA 4ED3A 4NX9A 4NCAA 2IGIA 1VQ6S 1N33K 4J9LA 4HUFA 3PIPQ 1S49A 3NCPA 1FK9A 4HVZA 4WP3A 1LOUA 1LNQA 1X9MA 5CCMA 1NNEA 3B4MA 3D3BJ 3CC2S 3ULEB 2W6LA 1HLUA 2HK3A 2HQIA 2JRSA 5IWAF 1I94F 1LEOA 3RMCA 1GMWD 3TJ9A 3HJVA 1PC5A 3TUZC 3W0LA 1D5AA 2DRAA 3PXGa 3KWIA 5BRHA 4UY85 5KG5A 3ISNC 4URSA 5HATA 3DN9A 1RYRA 2CWXA 3A0IX 1RFQA 4ZP8A 4C2MA 3FBBA 2XY8A 1S6PA 4UOFA 3WDOA 1GLFO 1H2TZ 1Q4RA 1BOTO 5KFWA 4J91A 3V4IB 2P1JA 1WC5A 1CBKA 1P8GA 4KV8B 3EGNA 2IM0A 1XNQJ 4TYBA 3G6ES 3E2EA 4C0OC 1IBCB 4PL8A 4ECSA 2KU7A 1RHRB 1C0GA 1X4BA 1JXLA 1HPZA 4CZMA 4N8OA 2GS8A 1S57A 4LD0A 4HTIA 3F2KA 1HBUB 4B08A 1P27B 3GIIA 3HMJG 4DR6F 2NUHA 2O1PA 4Y0FA 4RZRA 3MZIA 3Q86A 5E41A 1HJOA 1TL7A 3NGTA 5AZIA 4JV5K 2LA6A 3SZ2A 1WC4A 3BKTA 1R7IA 3NXZA 2LSNA 2UVWA 2W01A 5HRRA 4YOYA 4O44A 3NAEA 2BBEA 1WF0A 1RDCA 1N36F 2VWKA 2D0BA 1M1KT 2BE9B 3R5BA 3GB0A 5JUMA 4BQZA 1IKXA 4HHHA 4CWBA 4QQBA 1J27A 2XMUA 2D0OA 3ATUA 2DR6A 2PDAA 3CJ1A 1H38A 4DV0F 4F02A 3FFIA 2VFUA 1RT3A 1U1OA 2FC0A 4CJPA 1NBEB 2J8AA 3V1QA 1VBXA 2C3YA 3CJKB 2VJUA 2JVRA 3T6BA 4CBUA 1T03A 3RU0A 3TRGA 4F3MA 1VAZA 5JLHA 2MJUA 4A59A 2AEJA 4RUAA 4HLBA 4J37A 4OHVA 2UUAF 4D3GA 4DX8H 4C48A 5D8HB 2CNOB 3ZXWA 5A8RA 4XK8C 2GHVC 2HHPA 4YB7A 2FLOA 1FT8A 2Z2YB 3VGVA 3SI6A 2M5YA 4CK1A 4DB3A 2YKNB 4ZPDA 4RX6A 4WFBQ 1WC0A 3CCVS 2BJ9A 1YITN 3G8SA 1KVIA 3K2PA 2J9DA 3ISZA 1QQCA 3J7ZT 2ILZA 1E6YA 4ID8A 2WBNA 3TAMB 3D1QA 2FYXA 3DGPA 4W90B 4WU3A 2ZQBA 3P5JA 2LQ9A 2XHCA 4CF1A 3IBFB 1IBLF 5KG1A 1N56A 2PEBA 4DPXA 3HM8A 5J2MB 3SYZA 4OHYA 2BUPA 2C3OA 1R8CA 1RT1A 4Y0WA 4KRWA 4A48A 3AAQA 2X3DA 2LXUA 2IRYA 4ZIWA 1E6VA 1ATRA 1GLAG 1XMOF 2JFKA 4PABA 4DL5A 3F9MA 3MFHA 2I6WA 2QE5A 4ILLA 2AEMA 5LJ3Y 3KG0A 5IZHA 2KH9A 1IQZA 4UOCA 2JC0A 1U4BA 1CXUA 1HNWF 3T69A 2CQDA 4AHSA 3NAHA 2HHHF 2E1AA 3C95A 3L2QA 1VRQC 4CZGA 4ED4A 4ZPTR 1S3XA 3Q0AA 5CZ2A 4RNMA 3T9NA 2GHWA 4LF9K 1H3DA 2ZD1A 2B3TB 4WCEQ 3MK6A 4X4PA 3GIKA 5KG3A 4I9QA 5A8KA 3FDSA 2YX4A 3S3NA 4F3OA 2X1AA 2KW4A 3KMQA 3G4SS 3BPDA 2GJFA 4DR1K 1WDTA 2QA4N 4CLLA 1FD2A 2QSWA 3MXHP 3IN5A 5EXWA 1S5ZA 1VQ5S 1V3RA 1QD1A 1ASWA 3D0HE 3NF9A 3S1TA 4ZCIA 2HNYA 1FJEB 2RF2B 2KM8C 2B4PA 3IG1B 4HACB 4MIBA 3KK2B 2VFSA 4FJ5A 3POTB 3EDRB 1C1CB 5HMWA 2ZH8A 3QFPA 3PY8A 3R2DJ 2FHOB 2PSZA 5DM6Q 2WBRA 4PHTX 4NEYA 4OYZA 3R7SB 1Q7YO 2IAJB 4M5HA 2OI2A 5J2NB 2PGCA 3W1YC 2QI2A 3W8PA 2P9LA 1J53A 1NDPA 1IBMJ 4AL7A 3GIMA 5IWAJ 1I94J 2CQ0A 3FR0A 3HOTA 4OX8A 4OGCA 1H72C 1ICEB 2NXEA 3CJ2A 3HHLA 2M3DA 4OYIA 1WACA 4PYDA 4LQ3A 4LF6J 4DXLA 2CYYA 3LPUA 2KYXA 4NCGA 1VRTB 2MLXA 4W5NA 4HTLA 1URRA 4DV7K 4CO2A 3AODA 5DJBA 3PSFA 2H5IB 1JMTA 4PQUB 3PTWA 1NLKL 5C42B 3G71N 2Z1JA 3VQEA 1KD1O 5L38A 4DN9A 5B08A 2HFSA 4FXVA 4CVNE 2DHHA 1L3TA 3C19A 4DR6J 1S9GA 5F0UA 5DMRA 4ZTFA 3VQBA 2NXUA 3RGIA 3IFEA 2LQJA 2IC3A 1G99A 2A18A 1GTEA 3PEHA 2E66A 1F3FA 1Q1KA 5D4LA 2QTDA 3IC1A 1BHNA 3RW6A 4KY3A 4OZ2A 3HTVA 4P52A 3R7BB 3GQCA 1CJKB 5THWA 3CC4S 4QBUA 3A3OB 3CVKA 1N32K 4DTJA 3IM8A 1KAYA 1BUPA 4C8OA 2DFFA 3ATVA 2R9LA 1N36J 1FO1A 4U8VA 2FLPA 3QQCD 1NHUA 3ULEA 3DI6A 3FZHA 3VETA 4KBOA 4QCLA 4CH7A 2HHTA 3VV2B 5KOWA 2PIIA 1HWKA 3GR0A 5B0BA 4MKVA 5KFHA 3HFZB 1KQSR 1VQ4S 4LC9B 4IG0B 2YKMA 3BYRA 2F4VF 1S4FA 2YI1A 2H4WB 3D66A 1NWKA 1X9WA 3KOAA 4KT0C 1RT4B 3RR8A 3NF6A 3DLGB 2UUAJ 2M7SA 3TR8A 5C15A 3WNFA 3OYEA 4JLHA 1R8HA 5HL7Q 4FLXA 1EO1A 4FYXB 2GV9A 2V4RA 2KXNB 4I67A 3H3OB 3G6EN 1HYSB 2M52A 2HQDA 1NKBA 5EDWA 2FQQB 1HR0J 2OPPB 4Q7AA 3MM5B 4NRTA 4OYOA 2VPXB 3P31A 3PW5A 1YXQA 2E1MC 3V81A 3NP5A 4E1MA 2D7SA 1Q8BA 3LGNA 1KLMB 1ACMB 4RBTA 2VGMA 5KFXA 1HNVB 1UJ5A 2QEXS 1FEHA 2CPZA 2VCPA 1IBLJ 1XEZA 4PXCA 5LM7E 2XS5A 3ENOA 4AILC 2DR8A 2OTJN 1IUJA 3AVIA 5H9EJ 2Z1HA 3TVYA 3S6EA 5TKWA 3VF2A 4G9ZA 4KTQA 3MD1A 3O08A 2ZGZA 2VODA 3JQMA 2VB6A 1N5YA 3AY9A 2FD2A 5ETKA 1HJRA 1HNWJ 2DGSA 1JLEB 2HHHJ 3MPUB 5A0YB 4KGZB 4LFAK 2QL9B 4B1XB 5KFKA 5JMNA 3TZWA 4O3NA 3OHRA 3QBWA 2DNPA 3ADAC 4EP5A 1SKSA 3D3CJ 2BQRA 2YPZA 4YR2A 3C14B 4H4OA 4C8MA 5DG8A 1U1PA 2NRXA 1RHQB 2LKZA 4U95A 3A3PB 2W9BB 4CZCA 3NMUA 2DT9A 2N4DA 1J5OA 1KCFA 4CI0B 2ZWPA 2NSCA 2AEFA 4BR0A 3LP0B 1DBDA 4CD3A 3K8WA 3CCLS 1DZ5A 2VG5B 3DRRA 3ENWA 4CRJA 4DUZF 3HKWA 1Z1ZA 2GA7A 4O0NA 4ECXA 1NGIA 1RAOA 1LW0A 3BF4A 4WPAA 3D0PA 4JI7J 1SKUB 2CUYA 1YIJS 1NG9A 1XI1A 3G25A 1T95A 2G8KA 1UOCA 3LZJA 4DV0K 3OW2M 2HHSA 4CT9A 5DZ6A 2MGZA 1ZPWX 2UUWA 3MCOA 4BRKA 3MAQA 2P5VA 2DXFA 1DGKN 2RRBA 1XR5A 3BDPA 1YTAA 2YNHB 2VH7A 4RG8A 4MKAA 4EI2A 2RPIA 2JH3A 1IG8A 4Z2XA 3R1LA 2NLXA 4HCCA 1OH6A 2BOPA 1GQEA 1FE4A 2K8GA 2ZBQA 1J2VA 1QVGR 1N34F 2E5JA 2EKNA 1YQHA 3MHYA 1XR6A 4M5NA 4NA2A 1HRHA 2A6MA 4K4SA 5AQWA 4IEIA 3WT0A 1BQMB 4ECZA 5E3QA 4PG7A 1VQ7S 2RHSB 5BREA 1Y3JA 2SXLA 3ZSXA 4E98A 4M5DB 5CY4A 1YI2N 2XSJB 2O4GA 4H4MB 4DX5A 2L08A 2QG9B 1RLCL 2QLXA 4GVBA 5H9FJ 1VQ5N 5KT7A 5T41A 3BF3A 3CJBA 5KFCA 3KK2A 2KT5A 1X5PA 3POTA 1YJWN 1NPPA 1FE0A 2CQCA 1XMOK 1KD1T 3HVTA 4M7XA 3HHNB 1SC1B 4JV1A 1YTUA 3MPYA 2HQ3A 2HHXA 2QT7A 3GOIA 1QVFR 3NGYA 2IAJA 4O5FA 4MIAA 3ZX3A 4B9SA 3F56A 1X4CA 1FDBA 4F4WA 4WTOB 3U02A 3FJ2A 5BN9A 3KLGA 1AROP 2HFOA 2XYGB 3UDEA 4I2PA 4DF4A 4C8ZA 4NLTA 3BBCA 3VGLA 5JVHQ 3IO1A 4ANDA 4PRFA 1XIQA 2F4VJ 4DSFA 1BCOA 1G4CA 1VRTA 3I87A 4QJVA 1R0AA 2HZVA 4L73A 2OGUA 3RB6A 3VMFB 1YJNS 1KEKA 2DNHA 1UMJA 4USTA 1RWVB 4LSLB 2VBZA 2WBMA 2DH9A 3PW0A 4IUFA 4QIVA 3CCJS 1HHQA 5C42A 3MM7A 3HD1A 4HTUA 4ZCKA 1MN7A 2LU2A 2CNLB 2KO1A 1Q16B 4BC4A 4LRAA 2XRIA 5CCLA 4PUOB 5K8PA 4I7FA 1VI7A 4F0MA 4LFBF 5C12A 1NHKL 3VAFA 2IJFA 4FJGA 3W66A 3V6DA 1RHUB 3MPWA 4CEEA 3L4QA 4PL7A 1CJKA 1WHWA 1CS4A 1B0PA 1U1MA 2ASJA 2RHQB 1UA1A 4U6PA 2H3GX 3SCXA 1HKAA 1CJVB 3M6XA 2CA9A 1N5SA 4CJSA 2V8HA 5ADZA 4CEDA 4RU2A 3IGVA 2WRMA 3OHBA 1FHTA 4A8MP 1MWQA 1UJ6A 4JI0F 1OKJA 5DO2A 2KLAA 2VF3A 3AO2A 4ILJA 1IVZA 4FVMA 2HPUA 3QJPA 2NZTA 2E5HA 2Z2LA 3T5LA 1VBZA 2FJBB 3NH0A 3VGUA 1WOPA 3R1XA 3OYNA 1FNMA 1RWMB 1GMWA 2BJ7A 5HO4A 1FNXH 3FEZA 2A6OA 3U3GA 2WZ1A 4A2AA 3SQ4A 3LPEA 4N76A 4LUBA 4LF7K 3M9MB 4Z37A 5DRKA 1S12A 3AOBA 1GH8A 3QJJA 4DHVA 3THWB 1OPZA 4KH6A 3X3UA 4QR2A 3MR3A 1W2IA 1HYSA 2GW8A 1EIYB 4A8KA 2G0IA 5HAOA 2J7WA 4BRGA 4O3OA 2LECA 3MM5A 1SB6A 2VG6B 3B8AX 2UUBF 2YKAA 5BRFA 3EZOA 5AQKA 1S0VA 1KWMA 4DUZJ 5MAOA 1FXLA 3M1FA 4WWSA 3DHWC 5A8WB 3JXOA 3OXGA 4QU6A 5AQNA 3VQDA 4CF2A 1KLMA 2G8UA 1WUAA 1JJ2R 2GIRA 2GV1A 3MR6A 1HNIB 4ANEA 5HMZA 3OVNA 1NO8A 4K4WA 2QEXN 3ID6A 4PA1A 4H5NA 2OAUA 2GEMA 4WP8A 1YG0A 2MQPA 1HARA 5IT0A 4K2XA 4X66F 1HLWA 2E7WA 3H2LA 5GADU 3PKYA 1HKCA 2KT3A 3KKFA 3UD4P 2ZJPL 3MD3A 2AP6A 3CIPA 5E2QA 5DS7A 3OTBA 1PYTA 3N01A 2UV8G 3OTOK 3PR5B 2ZH4A 2GZOA 3V6HA 4DV4K 4KAZA 1N52B 3BKUA 4FZZA 2MHNA 4GC6A 5SZTA 2POKA 4KHUA 4LH4A 3MX2A 1S72N 1TV6A 3DHXA 5KFDA 1FKAF 4KH1B 4CHOA 4C9DA 1UJ4A 5I3UB 4Y6IA 1KN6A 2HNDB 3R3TA 4CTAA 2OJ3A 1IJJA 2EK6A 2R2UA 1TMJA 3VQSA 3K89A 4KHSA 3P4UB 2Y9HA 4Z4FA 3C2PA 5FPEA 1FKOB 2AP1A 1UEKA 4HUEA 4B3TK 3CF5L 3N9UC 1U09A 3MDQA 3IXQA 1Q5YA 3SLCA 2QIFA 4HYKA 3EE9A 2DKOB 4TYAA 3DOMB 1QTMA 1NAQA 4Y2AA 4YORA 1HYVA 1X5TA 2NRVA 4ELVA 1NGEA 2ZH3A 3D6TB 1WSEA 1T05B 3RSEA 5LJWA 3EEQA 2WSCC 3CJAA 3UO0A 4JI3F 4UQGA 3TX8A 5FLXU 4K0KK 1BI4B 3CCMN 4B3MK 2WVEA 3NEKA 5T7LB 2DGXA 3MPDA 3T5JA 3E66A 4PWUA 2VWBA 3A8YA 4KGVB 2FPHX 4OPAA 4J2EA 4QWCA 5AXMA 3MGJA 2UVVA 3VERA 4CDIA 3CIMA 4OJ3A 5FRNA 4ZHRB 4CK2A 1WSFA 2YNHA 4L72B 2OZSA 3AJDA 2DO4A 2R7WA 5ETQA 4FWMA 4FLZA 2OD4A 4UUXA 1R8PA 1WAFA 1NGCA 3ZSQA 1JLBB 3W2WA 2KKZA 1HHSA 3C94A 4DR5J 2YKQA 3C6HA 2R2RA 4CERA 3CQ8A 3JTNA 1RCXB 3UQSA 1JWWA 1KR4A 3DAWA 2LXFA 2RDIA 1MMNA 4FP9A 1D4XA 4L3KA 2AJ2A 3E9LA 4B9MA 3QRPA 2W9CB 4JI4J 3AA9A 1BL3A 1VQ7N 2BUNA 2BOAA 1U1LA 3QRQA 3T19A 1B7YB 3AO1A 4M5DA 1QM9A 2Y0BB 4AF1A 1XNRK 3VEVA 4BE2A 1KVAA 3DLEB 1B0TA 3HKZD 3J8AA 4TY9A 2G0JA 2YQ3A 3CDUA 2RQMA 2QA2A 4FKXA 4IJNA 3KDOA 2AF6A 1FX4A 2Q79A 3SBMA 1OPIA 2FY8A 4X4QA 3CXCR 5AT1B 2F9TA 1APSA 4TN2A 1RSCA 3L6QA 3OL7A 3GL1A 4FPAA 4IRCA 1PYOB 4BG8A 5CYMB 2XBPA 3IWNC 4JRPA 4ER8A 4FSVA 1VC6A 5HVFA 3CCSN 2PO4A 3FCVA 4CJ5A 3SMPA 2GMHA 3RMAA 3LP2A 3ZTPA 1G7CB 5IV3A 1C0FA 3CJRA 1TKZA 5C7PA 1N34K 4Q8FA 5KI6A 3HHLC 4JK7A 2B5JB 4U67Q 1VQON 2BKNA 4J7CA 4QIEA 3TOQA 4XH1A 2V0NA 5CYQB 3NWGA 5KFJA 4PEOA 1F0XA 3NGKA 4RW6A 5HVGA 1YJNN 3O1LA 1VQ8N 4OPJA 4LSLA 2WAQD 3KK3B 4MIWA 2AZ3A 2XWXA 1YJ9S 2P6TA 4ILRA 1XQSC 1WBBA 2F8EX 4F3QA 3FZKA 3MMBB 1SZ2A 1WELA 3HL8A 1PSDA 5HP1B 2OD6A 2OTLS 1CXQA 3KK1B 4CLSA 4CBXA 4ZCLA 4ZS6A 1NSAA 4KKOB 2KG1A 4BCAA 1MNEA 2KXHA 1OSDA 1SC6A 2XYHB 3OXLA 4FL9A 4PPZA 3DYAB 1GFWB 3I0SA 4F4ZA 4K8XA 3L2UA 2WOMB 3J7YI 1LQ9A 3NFAA 3BSOA 4KIAA 4C4WA 5HLFB 2UU9K 1YUWA 3PHTA 1T3NA 4DCOB 1RDWX 2V50A 2QLJB 2XNQA 1OYDA 2YHAA 4K41A 4BROA 1CJVA 3BH6B 4E8UA 1NM1A 3I55N 1AFJA 2UXBF 3EPIA 4ES2A 3VVUA 1DQ9A 1OH8A 3BGFA 2GQCA 4FZYA 1GXLA 3MN5A 1PIEA 2G9OA 2MQLA 3SQ2A 3KIOA 5F8IA 2R7XA 4DU3A 4JI2J 1PJ5A 2IVYA 2APOA 4ZMMA 2UVUA 1M0SA 1ZM9A 5KFTA 1T3VA 3ZT3A 4A62A 3OYMA 4DI6A 1LWEB 2YHWA 3C66A 3AVNA 4MKBA 4JKHA 4ES3A 2UYTA 3ZT0A 4TNOA 4BWJA 3PRDA 4ED7A 3GONA 3P83D 1SBRA 3N4PA 4ZVPB 2KHDA 4UOHA 4YHHK 4AHTA 2K06A 4ZVHA 4JKBA 4LSZB 2VFTA 4B1WB 1VBKA 1MWKA 3K8VA 3TU5A 1SUQA 2M0GB 3ENHA 4IO8A 4LFBK 4H0TB 1TMMA 3ZZTA 1WC6A 2HBLA 2Z2ZA 4B17A 5HBMA 1M1HA 3QZ8A 5GAEI 4X64F 3FVYA 3W5XA 2ATCB 1ITGA 2QSFA 3JSRA 2Y1RI 4BQLA 2HKEA 4CO0A 3J7AN 2ZKTA 3SPZA 2RQCA 3KXDA 3I56S 5DGAA 4BGBA 4BR4A 2Q1NA 4WYLA 3DM2B 4LT6A 5KFUA 3QFHA 2BW2A 3TEGA 1TAUA 4LFCK 4JI3J 4RPFA 4ISFA 2HMIB 1S76D 4IFVB 2UXCK 4XIUA 5LY3A 4JI0K 4YOEA 5KFZA 3BZKA 4ISEA 2M2BA 3QAUA 2RD5C 5KTQA 1R3NA 5KQ8A 3U8XA 1R6YA 4DTSA 4JV2A 3NAIA 3SQ1A 2Z0GA 2LDYA 2IDOA 1U47A 2RMLA 5KPRA 2J9EA 3VAHA 2IVOA 1RTHB 2P9UB 1YJRA 3OYGA 3L7OA 4DU8A 3S9HA 2UUCJ 3KZBA 3O9TA 2E9ZA 2VQEF 5J2QB 1S9EB 3HZEA 2PT0A 3SSQA 1MU2B 4KB0A 2V2ZA 3K5NA 2L3MA 4FOIA 5I3UA 1WHVA 1HD0A 1GOCA 3ETOA 1K9MT 2NZ4A 2UUBK 2FHJA 2B4VA 4OJRA 4ZLNA 2FC9A 3H46O 2DNOA 3F41A 5LL6Z 1OYEA 3O44A 3DOMA 5DQIA 2XO7A 3MWTA 1RAIB 1KTQA 4FBTA 2HRUA 3CPWM 1FA0A 3ZO7A 3FMBA 4GKJK 4B9NA 1H74A 3ZNUA 1VHXA 4C97A 1NDCA 4KTZA 3AO5A 4K4TA 1KBRA 5JVGQ 3OVSA 3ZCMA 4LRBA 3FZMA 2VBXA 4ZVUB 3WBZA 1TP7A 3PJ9A 2HFVA 5KFOA 3PV8A 5ADXA 3I5CA 3U1MA 2DEJA 2VUGA 5HQ8A 2BGGA 3K2YA 5D0GA 4I6MB 2C2MB 5AQHA 3C6UA 1FVSA 3MR5A 1HNXF 2LCWA 4DPTA 1VQPN 1T9VA 1RE1B 3BPSP 1SC4B 2MZQA 1D1UA 4OI4A 2O8FB 3D2EB 2XEXA 1TVRB 5KT4A 1RGIA 4H0YB 4CD1A 4CFAA 2YNFB 2IDLA 4JI8J 4JI6J 4FM1A 4MFBB 2ZWHA 2BEFA 4MO4A 1T9YA 4U96A 2QW9A 5FDLB 3TQEA 3Q22A 3AVFA 2BE2B 2XY7A 1EKRA 5ETOA 2J7KA 3PFOA 2FF3B 3VAMA 4B3SF 2OYQA 3EVWA 1UFKA 2IRUA 4H03B 3PRVA 2IBKA 2XY6A 3DLEA 3J7YU 4IOXA 5GAEP 4NA1A 5BPNA 4IYQA 1T9WA 1WI6A 2MLYA 4YOXA 5GINA 2KRBA 1LK5A 4YFUA 2NR0A 1EAYC 4WKYA 2RNEA 3G8QA 3FC9A 4FWSA 4CGGA 3N6MA 1QQNA 1QY7A 2ETJA 3R8YA 3L2WA 1Q82O 4NL5A 3K5LA 1SPBP 2AGQA 2R4FA 5HROB 3BEGB 2Z2MA 2VA3A 3EDQB 3PIOL 2E1PA 3CE8A 2R8GA 2Q31A 2ROPA 3GJTB 2FJVA 2IRXA 3RRGA 4QR0A 3A13A 4LH5A 5CYQA 1KS2A 1KFDA 1WI8A 1BY9A 2G2YA 2H1YA 1AUSL 3OVAA 2CZ9A 2WVCA 5M1PA 3D2WA 4M5LA 1A5WA 1WSGA 1YWXA 4YDUA 4YN3B 3M2RA 3DRXA 1N5QA 2DNMA 1DTQA 2MEWA 4I0WA 3HCXA 5BXIA 1L3UA 1S6UA 4LF5F 4LF4F 3GR1A 1DQ8A 1P1TA 3EICA 4X4SA 4X64J 3NNHA 2RE1A 4FK4A 3CCEN 2IA0A 2R2SA 4FW1A 2XLJA 3NS6A 1O51A 2V34A 1NU0A 2RQKA 3NCRA 4V19X 2OFHX 4JS5A 4NZ7A 3Q8PB 3N4WA 3GJRB 5J2PA 3HVWA 3IDHA 3JS9A 1R59O 2I5JA 3WQPA 4UY8T 3ICLA 5L1LA 2GIFA 3WX8A 4CEOA 3TJ8A 4MLHA 3QZ7A 4DCJB 4W92B 4CZLA 1RKIA 1RP5A 5AXKA 4ECRA