1HMVA

The structure of unliganded reverse transcriptase from the human immunodeficiency virus type 1
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
554
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
publication title The structure of unliganded reverse transcriptase from the human immunodeficiency virus type 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 139
structure length 536
sequence length 554
chains with identical sequence C, E, G
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1994-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hmvA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hmvA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hmvA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hmvA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hmvA05
2W8KA 2NUBA 2ATQA 1F21A 4QOZB 3OLBA 2J6TA 1JLGA 4CF1A 2VA2A 5DG8A 1TK0A 2IOCA 3IS9B 3CO9A 1IKWA 5F8HA 4DL5A 1I6JA 2RN2A 4EBCA 4DTUA 1SKWA 4DMNA 4H4MA 1L3VA 3IRXB 4KFBA 1RT7B 3QESA 4RU9A 3TQ1A 1BGXT 1WAFA 5CYMA 2XC9A 1GOBA 4FK2A 5J2MB 4CCHA 1RTJA 1LWCB 1SH3A 3QNOA 3IGNA 4FJHA 1ZBUA 3ALYA 1TKZB 1NOZA 4K4WA 1HARA 2OPQB 1SV5B 2XGPA 5F9LA 3GV5B 4Z0UA 3GYNA 4DSLA 3SQ2A 4K8XA 3TANA 4NRUA 3QEIA 1HQEB 4DFKA 3MR5A 4ID1A 5EWEA 1JLCA 2C2DA 3T5LA 3BSOA 1RYSA 3JSMA 5KGXA 4LH5A 1RDAA 1S9EA 1VK0A 4NCBA 3QZ7A 1KVAA 3OVNA 4CGGA 1EETA 5J2QB 4ECVA 2O4GA 1U45A 4CE9A 3OHAA 3H5YA 1X1PA 5F8IA 1BIUA 2R8IA 4WYWA 4F3OA 3B6OA 4CESA 4KAZA 4B08A 4PQUA 4CJSA 2P51A 3NF7A 3NGIA 1N4LA 1IM4A 3G10A 1NK4A 1JLEA 1DTTB 2FVQA 3C6UA 4TLRA 4BWJA 4CHZA 4EO8A 4F50A 2YNFB 2WOMA 3VQAA 4FZYA 3IG1A 2AU0A 4G1QA 1IKXB 3DMJA 4O44A 3U3GA 2D41A 2JEGA 4AHSA 1S1WA 4JS4A 1JKHB 4ZTFA 3L2VA 3BQ2A 1FXXA 4WZMA 3KLGA 1UWBB 4R8UB 3PW7A 4M3TA 1JLBA 2FBVA 3D45A 3OS0A 2G8KA 2FVSA 3OYMA 3F73A 1X9MA 2HHVA 4X2BA 1IKYA 2FLPA 4CGHA 1Y97A 3ZSWA 3KK3B 3K5MA 4PWDA 1SUQA 5KFKA 1NK6A 4IFYB 3LWMA 4RW4B 4FJLA 5DK5A 4BDZA 4Z4IA 4E3SA 4NLXA 1BQMB 2XGQA 2R2SA 3ZT2A 1NK7A 4FJJA 4W5NA 3UQSA 3HSTB 4CGJA 1C6VA 1VSEA 1RT3B 4HTUA 4C8LA 3V6JA 4YP3A 3U6FA 3FSIA 3QLHA 1VSHA 3AA4A 1RT5B 5DGBA 3PJWA 4QWCA 1EKEA 3V6DB 3TAMA 4ZVHA 2BE2B 3AA2A 1K6YA 1C2PA 3VQPA 4CJRA 2YHAA 4C8OA 3LP0B 1Q9YA 3AVNA 3VQQA 5KFUA 3DYAA 2W7OA 1KFDA 1RYRA 3UR0A 4ZPAA 5KT5A 4AILC 2CKWA 4Y3CA 4CJQA 3HP9A 5FROA 2IJNA 3N6NA 3GIKA 5C5JA 4B9TA 4KHYA 3HYFA 1BQNB 4I2QA 3OYHA 4IQXA 3KMQA 3JYTA 1N48A 3DRSA 3O3HA 4KHMA 4DG1A 3S3OA 2YKMA 4NLGA 1S9GA 4PY5A 4RW9A 1WSIA 1FKPA 2KZMA 3RRHA 1S1TA 2BRKA 5KFMA 3MFIA 2OA8A 3Q8QB 3NCIA 3V81A 3QO9B 2AWZA 1N6QA 4K4VA 4OKEA 4DL4A 1C0TB 3K58A 1NK9A 3TR8A 3OYJA 1RT4A 4K4YA 3DRPB 1ZYQA 4K8ZA 3WNFA 3O4QA 3BSNA 3KNAA 1G15A 1C1AA 5KG1A 5KFZA 2ITGA 4J9KA 4O3RA 3SNNA 1RT2B 4TSXA 4AHTA 1JLAA 4ZVGA 4F4ZA 2E6MA 1S6QB 3K59A 4NLPA 3LP1B 3OL6A 3UDLA 4ED7A 2IC3B 3MF5A 4ED6A 5DG9A 1S1VA 1BI4B 4CEOA 3Q8PB 3OYFA 4WE1A 4B3OB 3ZT1A 4CHPA 2WONA 3RBEA 4AHVA 2OPRA 1XR5A 3QIPB 4HUGA 4DU4A 3FDSA 4QWBA 1RTHB 2G8WA 1HJRA 3KKSA 5J2NB 4U7CA 2V4RA 2FLNA 3V6HA 4ECQA 2AGPA 1T94A 1NJXA 4IG3B 5K14B 3V1QA 2DFEA 3ISND 4J9SA 1WLJA 3I8DA 1LV5A 1VSIA 5HLFA 1KFSA 1IKWB 3GIMA 1WSEA 3L2WA 5KRSA 4H4MB 5KFFA 4ZPBA 4KFBB 4O5BA 4IRDA 2FVPA 4FZZA 4KHUA 4J2AA 3PW2A 1RTJB 1QUVA 3TAEA 4Z4HA 3VA3A 4FCYA 4FK0A 4FK4A 2F96A 2P5GA 3OJUA 1N56A 3PW4A 3VQ9A 5F9NA 4CHOA 4CJLA 2E6LA 3P5JA 3ZCMA 1YTAA 4KI6A 1LWEA 3MR2A 2CJQA 1TVRA 1S1XA 3KLHA 2WHOA 3NFAA 2BDPA 3JSMB 3DDKA 1L3TA 3M9NB 1ASVA 3V4IA 2OPPA 4KSEB 4DEZA 1SL2A 4FBTA 1S9EB 4EBEA 2XY8A 1D1UA 2FBTA 2ZE2A 1EETB 1KRPA 3H4BA 1OS5A 3DLBA 4JV2A 3M8PB 3EY1A 1U09A 4IKAA 3MEEA 1W0HA 1ASWA 5T14A 5L9XA 4RNHA 3OHBA 3WNHA 4DLEA 4YR3A 3PHEA 1DTTA 4PQUB 1VSMA 3V1OA 3ULDA 1ZBFA 4TY9A 1RA6A 5EUHA 4FBUA 4DL3A 3HJFA 1YT3A 3QGHA 5HBMA 4Y2AA 1IO2A 3OYCA 1RBRA 1RT1A 4CFCA 1WAJA 3SPZA 5KFHA 1JLEB 2IA6A 3DI6A 3SFUA 4EYHB 1MU2B 3C6UB 1VSDA 1I3AA 4E7LA 4TQSA 1QE1B 3VA0A 2WOMB 4B9LA 1T05A 3IG1B 1UOCA 4J9PA 4G1QB 4O44B 4FXDA 5HRRA 4XIUA 3RRGA 1C0MA 1S1WB 5DGAA 3MXMA 1J54A 1JLFA 3KLGB 4E1MA 1JXEA 1RTDA 2IM1A 3GQCA 1JLBB 2BQUA 3H5XA 4QPXA 1KTQA 2R8HA 4Z4FA 1CXQA 2ATLA 1IKYB 4K4TA 4FLZA 4E7JA 4CJ5A 3IGVA 4DS5A 3NH1A 4PWDB 1SUQB 4F4XA 3ISNC 4DQPA 4ZMMA 2E4LA 3ZT3A 4ELTA 2DFFA 4KTQA 3MEDA 4Q45A 5DLGA 5KI6A 4CIFA 4E89A 4OGCA 3EZUA 4CEZA 4URSA 3TAMB 1C1BA 1U48A 3G6XA 4TY8A 4FYDA 3DYAB 4ZVFA 3BQ1A 1UA1A 3RTVA 2ETJA 5HP1A 3PY8A 5L1IA 4KB1A 4DSFA 3H4DA 3OYNA 4O4RA 3DM2B 1XI1A 5L1LA 2ZKUA 5C25B 4OJRA 3RMDA 3GILA 3CJ3A 4I2QB 3JYTB 3KMSA 4NLSA 4NYZA 3DRSB 4KHRA 3QO9A 2YKMB 4CIEA 2YNHA 1S9GB 4M94A 3RB3A 4DQIA 1RCHA 4CK3A 4HUEA 4MK9A 1C0TA 4RW9B 3AA5X 1FKPB 4NLOA 4TQRA 1XWLA 4H54A 4Q44A 4R0EA 1S1TB 4BDYA 2HHUA 3V81B 1TKXA 3OY9A 1N6QB 1HYVA 3SI8A 3HT3A 4M3UA 1GOCA 3H08A 2BANA 4RG8A 1RT4B 4FW2A 3VQ6A 4KB7A 2FBXA 5KT6A 3SV3A 2I5JA 2IC3A 1EP4A 3M8QA 1U4BA 1QAIA 2W8LA 3AA3A 3L8BA 1JLAB 4CJEA 4AHCA 4O3QA 3WNEA 4DSJA 4J9NA 4CHQA 4CEAA 2ZQBA 3KD5E 1S1VB 3PX4A 4B8AB 4H8KA 4J2DA 3HPHA 4J2BA 3TAQA 1J53A 3QEPA 4WE1B 2BRLA 2ASDA 3PO4A 2FVRA 4K4XA 4XO0A 4YFUA 3ZSXA 2WONB 3G0ZA 2OPRB 1ZETA 4DL6A 2AGQA 4IG3A 4O3PA 5FDLA 3SCXA 3LAMA 3H5SA 2Y1JA 2D3UA 5J1EA 5CZ2A 4ZP7A 2VG6A 3CVKA 5JS1A 1JLQB 1U49A 4ZP8A 4DWIA 4KV8A 4B9UA 3NF6A 3UPFA 4IR1A 5HLFB 4F2RA 3T19A 3RBDA 2RKIA 2ZD1A 4IRCA 3NGZA 1HYSA 3K2PA 4EP5A 4Z4CA 4ZPDA 5DMRA 2VA3A 1TV6A 1CXUA 2B4JA 4KBIA 3HPOA 4CEQA 2RPIA 1GX6A 1S0NA 2IAJA 2HHXA 3H59A 4KHNA 1C0UA 2PYLA 1REVA 1WSFA 4GW6A 3MTKA 3DOLA 3OS2A 4IH7A 4G3IA 5EWGA 3CDUA 4ED1A 4FJKA 2C22A 3QERA 4RZRA 3ZSRA 4ECUA 1W9HA 1GX5A 2AJQA 3LZIA 3KTQA 4KI4A 2FJVA 3GV8B 3PZPA 1LAVA 1LWEB 4CF0A 4F2SA 4DF4A 1TVRB 1S1XB 3KLHB 1TL3A 1NHUA 5KFCA 4DSEA 4ZVEA 4DFMA 1RT6A 4DFJA 5KGWA 3M8PA 3V4IB 2OPPB 2D5RA 4N5SA 4RW6A 5KFNA 4WFXA 2ZE2B 3BSCA 4IRKA 2JC0A 3NE6A 1D8YA 2DTUA 3MEEB 4MK8A 3OYKA 3CDWA 4LSLA 2QV6A 1YVFA 4HHTA 4CGFA 2C2RA 2XI3A 4J9RA 1MU2A 4KE5A 1QE1A 3PX0A 2XY7A 4QCLA 5KG0A 5F8MA 4CF2A 5HBMB 1RT1B 2AGOA 2OYQA 3DI6B 3SYZA 4DF8A 3CFPA 1T05B 3PO5A 3CWJA 3HHKA 4CEEA 2JEJA 4E7KA 2I1RA 4CJ4A 2RDJA 4HUFA 3TARA 3QZ8A 1ZTWA 2KFZA 1N5YA 4FLWA 4RNFA 4FM1A 1JLFB 1RTDB 2ILZA 2GV9A 2RDIA 3AO3A 1JXBA 4O3NA 1CZBA 3CJ4A 2JLEA 3DOKA 1D9FA 3SI6A 2BGGA 3AVLA 5KTQA 3BGRA 4FJNA 4YQWA 2HAIA 4NZ0A 3ASMA 1JXLA 4N47A 4N41A 1VSJA 5JUMA 3NH2A 3I5CA 1SL1A 4CFAA 3MEDB 2OH2A 3QGGA 1KSPA 3AVIA 2BQRA 4OGEA 4H4OA 3LP3A 1C1BB 2JGUA 5F8LA 4ZHRA 3BREA 4YR0A 4Z4EA 4RNMA 1LWFA 3DM2A 4TY8B 5C25A 3A2FA 3CFRA 3OL7A 1KVCA 1WN7A 3AVMA 4Y1DA 4ECXA 1KHVA 5HP1B 2LSNA 3NBPA 3L2QA 3DLRA 1S10A 2OZSA 3Q8SB 4ECSA 2X6NA 4IKFA 3AV9A 2EC0A 2YNIA 2VG7A 4CGIA 4DQQA 4DTMA 2AX1A 4Q0BA 1ZBIA 3AO2A 1S48A 2HVHA 2YNHB 4DL2A 4BE2A 4IBNA 2E9RX 2Q3SA 2A1SA 3TAFA 3M8SA 1BIZA 1VRUA 1UA0A 1TKXB 4F4YA 3PX6A 3I0SA 4O0IA 5I42B 3S3NA 1KLMA 1HQUA 2BANB 2XRIA 3MXJA 1SKSA 4NLRA 5KT7A 1TKDA 2F8TA 2XCPA 4CFDA 2FLLA 2Z1IA 4EYIB 5HRNA 2I5JB 2ASJA 3ZSVA 3RMCA 3FRZA 3NMAA 2R8JA 4CJUA 2C28A 1EP4B 3RR7A 1YTUA 3M8QB 4B9VA 5L1KA 3T1AA 4O0JA 4M41A 2DFHA 3EZ5A 4RUAA 4LY7A 3L2UA 2XHBA 4ED3A 5KFOA 2R8KA 3SQ1A 3VQ7A 2FJWA 4Q8FA 4J9LA 3OYGA 1R0AA 5DQIA 3AVAA 4ECRA 5HROA 1JLQA 4FJ5A 4FW1A 2YV0X 5FDLB 4DTOA 1JL2A 4BE0A 3LALA 5KT2A 5J1EB 2R7YA 3D0PA 4F8RA 2IDOA 3DLGA 2VG6B 3SFGA 2PZSA 4KV8B 3N6MA 2IM2A 1A5VA 3KHRA 4MQ3A 2X78A 4L8RB 1JX4A 4EEYA 1L3UA 4RNOA 3Q8RB 5F8NA 4MFBA 3CM6A 3BQ0A 5CYQA 1NK0A 2RKIB 2ZD1B 1YVUA 4TN2A 1HYSB 4LD0A 1DLOA 1Z25A 1TV6B 2Z1JA 4EZ9A 3UIQA 2IAJB 2W9CA 1C0UB 5KFQA 1REVB 3CDEA 4FM2A 4Q5VA 1IKVA 1VSKA 3DOLB 4DTPA 4KAIA 3OYIA 2Z1GA 3QEVA 1LW0A 3AO1A 5KG7A 5T7BA 3QIDA 1RDBA 4WXWA 3NF8A 4U6PA 3ZSZA 4NLDA 4LQ9A 2XCAA 3HXMA 1HYZA 4OVLA 3V9WA 4YMEA 4M45A 3OYEA 3H98A 3I0RA 4HKQA 3LPTA 1QSLA 4I2PA 4DFPA 4NLUA 4B9NA 4DTJA 1TL3B 2HNZA 4BDPA 4ZPCA 1RT6B 3DLEA 3KJVA 1RDRA 4QW8A 3FQLA 3FFIB 4RW6B 2BQ3A 2WCXA 2Z1HA 1KHWA 4BWMA 4BE1A 1I39A 3C6TA 3G6YA 4AHUA 2XI2A 4MIBA 3T5KA 2FJXA 4NCGA 2E9ZA 4LSLB 4ELVA 1K1QA 4CJWA 3AVBA 4CF9A 2WB4A 3QETA 3H40A 2R2UA 4B9MA 3DRRA 1RBTA 4C8KA 2P5OA 3GV7B 5FRMA 3PJXA 1TKTA 4OL8A 1ASUA 5D3GA 4ECTA 3HL8A 1WNSA 1S49A 5JS2A 1N5YB 3SV4A 3B6PA 4XPCA 5KFTA 4K4ZA 4IG0B 4KHSA 4DL7A 2JEFA 4M42A 2JEIA 2QKKA 3KLIA 3KLFA 1C1CB 3DOKB 3OSNA 4CEDA 3BGRB 1Z26A 3V6KA 3VQCA 3SUOA 1RDCA 2WK4A 5KFPA 3V9UA 4ID5B 3QGIA 4TYBA 5JXSA 4CERA 1TL1A 2IBKA 2Y1IA 2HMIA 4WYLA 3MXIA 3WNGA 4NYNA 4WXOA 4E0DA 5KFRA 4H4OB 5SWMA 4FZXC 2DPIA 4ZHRB 1IH7A 5J2PA 4LSNA 2KFNA 4OPJA 4KKOA 2GIQA 3CJ0A 1LWFB 3N6LA 3BR9A 4J9MA 4DU1A 2IGIA 3TWHA 3ZT4A 2B6AB 4ECZA 3VQ8A 3BJYA 4ED0A 4JLHA 4IR9A 3NBPB 3NGYA 5KFDA 4W5RA 2YKNA 1IG9A 4WZQA 4N56A 1HMVA 3HPGA 1BL3A 4MKBA 2YNIB 2VG7B 3H5UA 1EX4A 3V9XA 4Q0BB 4DQRA 3HVTA 3QYYA 1XHXA 4DSKA 3V1RA 3RR8A 1NK5A 5I42A 5CZ1A 4IFVA 4MH8A 1HNIA 1FK9A 4ED2A 3ITHA 2DY4A 1VRUB 3TVKA 1SKRA 2FC0A 2O4IA 3I0SB 4E1NA 2YNGA 1KLMB 1S5JA 1HQUB 4CK2A 4O3SA 4O3OA 2HNYA 4CJ3A 1TAQA 1B9FA 1KCFA 1HNVA 5KG5A 5DG7A 3DLKA 1L5UA 2GUIA 5KFJA 1T03A 1D5AA 3THVA 3E01A 3CIZA 5C42A 2UUTA 5KFYA 4HCBA 2AX0A 3KHHA 1RDDA 1MMLA 1NJWA 4J9OA 3QEWA 2RF2B 4MK7A 4RW8A 2YHBA 4CF8A 1R0AB 3LP2A 4B8CA 5HROB 5EDWA 2HWHA 4QWEA 4M95A 5DQHA 1VRTA 2W9BB 3K5NA 2UVVA 3DLGB 4KRFA 4JRQA 1RILA 3HK2A 3O4NA 3MR6A 2HHTA 4MFBB 1ITGA 4IOBA 1NJZA 3KK2A 3KHGA 5CYQB 3RB0A 4ZP9A 4ECYA 2VG5A 1DLOB 4Q8EA 3AO5A 5KFEA 1EXQA 4B9SA 3H2LA 3ICLA 1S4FA 3CJ2A 2JC1A 2W9CB 3MAQA 1TK8A 4CHYA 4I9LA 1IKVB 2C2EA 3BSAA 4OLBA 3L2RA 1LW0B 3OL9A 2EX3A 4ZTJA 4C8NA 3ZSQA 2B5JB 3MEGA 4HVJA 4GMJB 3OJSA 4IDKA 1FKOA 3GIIA 3TI0A 3RAQA 4QW9A 4DTXA 4LQ3A 3KOAA 1TAUA 1QQCA 1BHLA 1U47A 4FS2A 2IJFA 4FLVA 3I0RB 3CYMA 3FFIA 4I2PB 4YR2A 1T7PA 1QSSA 4F4WA 2HNZB 1NK8A 5KT3A 1NKEA 3DLEB 3KJVB 3CJ5A 2UVRA 1VSFA 4FM0A 2OPSA 2VWKA 5KFAA 3EYZA 1TGOA 4F4KA 2BR0A 3NAEA 2KZZA 3C6TB 2ILYA 5KG2A 3NH0A 4Y1CA 1A5XA 5EWFA 4NCGB 3E51A 4TXSA 1Q8IA 3SJJA 3LWLA 5KG3A 3VQEA 4NLTA 4CECA 4F3TA 3L3VA 4OKJA 4GC6A 1S0MA 1U04A 3I5AA 2ASLA 3DRRB 3T5HA 4PUOA 4FJXA 2XY5A 2X6SA 3LAKA 4C8MA 1Q9XA 1TKTB 4QWDA 5D3GB 2A1RA 3OYBA 4IG0A 3KIOA 4DTNA 1SH2A 4JS5A 3OS1A 1C1CA 4DS4A 4E19A 1KVBA 3M9MB 1RAJA 5CY4A 3QEXA 4JV0A 1WSGA 4ICLA 4EZ6A 1UAXA 3RWUA 3CG7A 4EBDA 5HRPA 3KLIB 3KLFB 4ECWA 4NCAA 2IM3A 4ID5A 4KHWA 3K5LA 1TQLA 3TABA 3AVKA 1NOYA 4M3ZA 2DPJA 4CFBA 2W7PA 1D9DA 5KFVA 3KHLA 4FJ9A 1NKCA 4KO0A 4QWAA 3OYLA 1TL1B 1A5WA 2HMIB 4QAGA 4CJPA 4EP4A 3ZT0A 3S3MA 1QSYA 3M8RA 2QK9A 2WRMA 2KQ2A 1DTQB 2V9WA 4TYAA 3VN5A 4RW7B 4ZP6A 3OLAA 3NGDA 2D0BA 2B6AA 3D5MA 1RTIA 5J2PB 3KK1A 1CSJA 4FJ7A 4LSNB 4KKOB 3I5BA 3NL0A 3AVFA 4GVMA 1K1SA 2QKBA 4CEBA 3NF9A 1XR7A 3VQDA 5C24A 3DLHA 2UVUA 1NHVA 2V0NA 3L3UA 2KW4A 4ED8A 3OYAA 3P1GA 2YKNB 1HMVB 2UUWA 2R2TA 3NAIA 1LW2A 2IMWP 2IS3A 5I3UA 3TAPA 3HVTB 5SZTA 4NLQA 2XWYA 1BCMA 3P83D 1T3NA 1SL0A 4O4GB 3SZ2A 4IFVB 2V4QA 1HNIB 1FK9B 4R5PA 3CM5A 1J5OB 1NNDA 3ITHB 5KFGA 2FBYA 4AHRA 3QIOA 1JIHA 1CZ9A 3RMBA 4BACA 4I7FB 3NKYA 4FJ8A 1XR6A 4DTRA 2YNGB 2F8EX 4UQGA 4FLYA 2HNDA 2HNYB 1XHZA 3AVCA 1HNVB 5L1JA 3HVRA 4K4SA 3DLKB 1S1UA 3K57A 5F8JA 3SQ0A 4XPEA 4M3RA 3M9OB 1O1WA 1TK5A 3V9ZA 2PY5A 1T03B 2RF2A 4K4UA 4KPYA 5DLFA 3E01B 4DSIA 5C42B 4HCCA 3MECA 1W25A 5KFXA 1S6PA 2HHQA 1WSJA 1WNEA 4KHQA 3KLEA 4JRPA 1QAJA 4DLGA 3FQKA 3T3FA 2R8GA 2G8UA 4FS1A 2W9AA 4RW8B 4K50A 4JUZA 2W9BA 4Y34A 1S9FA 1RBVA 1HPZA 4W5OA 3SQ4A 4N76A 3OSPA 3LP2B 2UVWA 3T5JA 2GBZA 3LZJA 1VRTB 3IS9A 2IM0A 1QHTA 2HB5A 2WTFA 3KD1E 1CLQA 3IRXA 5F8GA 1RT7A 2HHSA 1JLGB 4M3XA 4WFZA 4NLWA 1ZBHA 5KFLA 5KG4A 3IAYA 3KK2B 5J2MA 4CJFA 4Q43A 1LWCA 2VG5B 5DQGA 3VQBA 5KRTA 1TKZA 4CIGA 5KG6A 1NKBA 2B5JA 1J9AA 3SUPA 5CYMB 4DTSA 2OPQA 1S97A 3RB4A 1SV5A 2HHWA 4E7HA 5KFWA 3PVXA 3CQ8A 2D0CA 5E41A 3MEGB 4LH4A 1HQEA 4GC7A 4IDKB 1FKOB 2P1JA 2O5DA 4NLVA 4Z4GA 2XY6A 1RNHA 2EHGA 3IN5A 5J2QA 1JLCB 3VQSA 4DQSA 4I9QA 3ZSYA 4YNQA 2VWJA 3OYDA 1BISA 1RBSA 2G8IA 2OPSB 3HP6A 4J2EA 4J9QA 2OZMA 1ZTTA 1QS4A 4FJIA 3PUFA 2PYJA 2D3ZA 3SPYA 3TAGA 3PR5B 2D0AA 3AVJA 3HM9A 3HO1A 4OKKA 3OL8A 3AO4A 2YNFA 4CJKA 4NRTA 1S0OA 3NDKA 1X9WA 3SUNA 1TP7A 1IKXA 3D28A 3NHGA 1KLNA 3K5OA 5FRNA 1JKHA 4CJTA 4CHNA 4PUOB 3VQ5A 4NYFA 3DMJB 1UWBA 3KKRA 4R8UA 3MR3A 1WSHA 4M3YA 4IH5A 1QTMA 3C94A 3VQ4A 1L3SA 3G6VA 2B43A 2G8FA 3KK3A 1HRHA 2FVCA 4IFYA 3C95A 4RW4A 1D0EA 4JV1A 1JL1A 4E7IA 2E9TA 3MFHA 4ICLB 1BQMA 4OPKA 4WFYA 3EPGA 4W5TA 4DU3A 1RT3A 4CJVA 3PR4A 3G86A 2XO7A 2R2RA 4W5QA 3V9SA 1RT5A 3S9HA 3V6DA 2AQ4A 1GOAA 2BE2A 4M3WA 1DTQA 1VSLA 4RW7A 4AH9A 4KO0B 1ZBLA 1NJYA 3QLHB 2GIRA 3LP0A 3QINA 1XC9A 3O3FA 4FLXA 2HVIA 4FLUA 2X74A 3KLVA 3HVAA 2W42A 1RTIB 3KK1B 4URQU 3RB6A 2F8SA 2ALZA 1LAWA 5EU7A 1BQNA 4ELUA 2G8VA 4HYKA 3AVGA 1RBUA 4RUCA 4KB0A 1Z4UA 1X9SA 5KFBA 4KTZA 5C24B 5KT4A 3PW5A 4EO6A 4CK1A 4CEFA 5KFSA 1T8EA 4O4GA 3PV8A 2QXFA 4FJMA 1B92A 1LW2B 1J5OA 3GIJA 3O3GA 4DG1B 5I3UB 3BDPA 3HVWA 2J6UA 4I7FA 4MKAA 3DRPA 1RA7A 3F9KA 4R5PB 4RNNA 4FLTA 4IH6A 4MIAA 1RT2A 1B9DA 3LPUA 2HWIA 3SUQA 4Y2CA 1S6QA 3LP1A 2HNDB 3RMAA 2G8HA 3EPIA 1BI4A 2HW3A 1S1UB 4FJGA 4KTWA 4PA1A 2D7SA 3RAXA 4OLAA 4B3OA 4KREA 3HKWA 2J6SA 4CGDA 4O55A 4FVMA 3PW0A 3QIPA 5HRSA 3MECB 1S6PB 3QNNA 1RTHA 3ZSOA 3CFOA 2GC8A 3KLEB 2KTQA 3NAHA 3LDSA 1SH0A 3LANA 5J2NA 4URGA 3U3YA 1BCOA 1HPZB 2QE5A 3AVHA 5K14A 5KFIA 4NLYA
chains in the Genus database with same CATH superfamily
2ATQA 1F21A 4U9RA 2J6TA 4LF4J 2YX6A 2IOCA 1NG9A 4BG8A 1IBLK 1I6JA 4KQZA 1G2EA 1N34F 3E66A 3T1YF 3IRXB 4KFBA 3QESA 4YORA 5AJ3J 5D4PA 2FJEB 2VKRA 2HRTA 1DQAA 1TMMA 4WFBQ 1VHIA 2KXNB 5J2MB 5LMNF 1RTJA 4NXMF 3IGNA 3LPEA 4JB8B 2KLAA 2W41A 1RCOB 2ZWHA 4CJ7A 2ZGZA 1MN9A 4KH6A 3MM7B 1NOZA 1RAGB 5DJBA 2OPQB 3NCQA 5F9LA 3GV5B 2VQFK 4K8XA 2FZKB 2V4JB 4NRUA 4BR0A 3D6RA 1YJUA 5HN0A 2NUUG 3MR5A 3BGFA 1JLCA 3UI3A 2C2DA 3MOZA 3JSMA 5KGXA 4V19J 2HF3A 1RDAA 3W3SA 2AJ2A 4LFBJ 3EICA 1VK0A 1EETA 3EXCX 4TU7A 3A5OC 4ECVA 2O4GA 4E2FB 4BRFA 3OHAA 2DR6A 3S1TA 5F8IA 4WYWA 2XNRA 1KS2A 4CESA 4KAZA 4CLPA 4CJSA 3CJKA 2P51A 2A2CA 5E5NA 2MZSA 4DPOA 3GONA 3NGIA 1NK4A 1K9MT 2FVQA 3C6UA 1W97L 1Q81O 1KEKA 1UVMA 3SMZA 4F50A 4I67A 3VQAA 3OT9A 1IKXB 1RWOB 4C1NI 5HVGA 1FX2A 4AHSA 2XZWA 4FNIA 4JS4A 2YH1A 5MAOA 4UZBA 1U6BA 2ZNZA 3KKFA 3PW7A 1PBAA 3OS0A 4NL5A 2HURA 2FVSA 2UXCF 1Q5YA 1Q7YT 4GKJK 3VGKA 4GVBA 1IKYA 5AQUA 4CWBA 3KK3B 3NXZA 5KFKA 3QJPA 2UU9F 1BLUA 2CQPA 3P5BP 5M1OA 4E3SA 3ZT2A 4W5NA 3R5DA 4OYWA 2ASYA 2XEXA 1RT3B 2FHJD 2F4VJ 1UAWA 3I82A 3U6FA 3CPWM 4BG9A 4ZVRB 1RT5B 4QJVA 2GV1A 1EKEA 3DXKA 4C3MA 4KGVB 4DV0J 1Q9YA 3G2XA 1NH8A 1RYRA 1RGIA 4JI5K 2QLFB 4ZCMA 3R6GB 4CJQA 3A13A 3HP9A 3TJ8A 2RU3A 4JK7A 2IJNA 3CCJN 4AL5A 5IWAJ 4B9TA 5DS7A 4KHYA 3KUHA 3T1HF 5A2QY 3DRSA 1DBDA 4CT8A 3H25A 5D6GA 4KHMA 4DDFA 2MGZA 2V94A 3Q2SC 3AOBA 1FKPA 4K0KJ 2XSJB 4BVOA 3MFIA 2G13A 1JJ2R 1S72N 1DARA 4L6V3 3C3LA 1N6QA 4KHPF 1ZPVA 3S7RA 4OKEA 1C0TB 3K58A 3FZHA 4ZCKA 4K8ZA 5H9EK 1OMSA 4IQMA 2BJ1A 3O4QA 5KG1A 1IBKJ 4RTFD 1GTEA 1T9WA 1SQKA 4XK8C 1FNOA 2E44A 3HZGA 1JLAA 3W9JA 4M1KA 1S6QB 5IT9U 4OJ3A 1E4FT 2DNKA 3I4HX 4ED7A 2KDOA 5DG9A 2L41A 1HNZK 1BI4B 4LREA 2QSFA 1N0VC 3AH6A 5AQFA 3RBEA 3QIPB 4QWBA 1IBMK 1RTHB 1P90A 1EKRA 3MD1A 4U7CA 3RVCA 2FLNA 3B54A 3ET6A 3A4TA 5KOWA 3CJAA 2ZH3A 5LOQA 4J9SA 4RWWA 4WK3A 1LV5A 2NREA 5HLFA 1E4GT 2CG4A 2V2VA 4WBFA 3T1YK 1YKWA 4DUTA 3GIMA 3AXKA 1YF5L 1FX4A 1HNXJ 1LXJA 4ZPBA 4KFBB 1WUUA 5EGYA 4FZZA 1VISA 2OO4A 3PW2A 2VPXB 3HFVA 1RTJB 4FVUA 3THYA 3TAEA 4JV5K 3VA3A 2A41A 3NMUA 2E1YA 3D1HA 1N56A 1HPMA 2ZWPA 3OFEA 1Q53A 2KRBA 1YTAA 4KI6A 2PO4A 2CWXA 4FPIA 1TU0B 2ZJRQ 1HL6A 3JSMB 3DDKA 3M9NB 3DNCA 4KSEB 1SL2A 4EBEA 3F41A 2XY8A 1N54B 2V63A 2P6SA 3FZLA 1EETB 1HKBA 5FPNA 1S79A 3CSKA 1OS5A 2V7ZA 3MEEA 5HATA 3TJAA 3F0NA 2KYXA 2KH9A 4YR3A 1Q1KA 3PHEA 4K8RA 2FUG9 1DTTA 3ULDA 3CJKB 1HKCA 5EUHA 3HT0A 3HJFA 2KB2A 3IA0A 4Y2AA 1IO2A 3SPZA 3AFGA 2IA6A 1H7WA 3DI6A 3SFUA 1MU2B 3C6UB 4C97A 4D3HA 3O6WA 3VA0A 2KKHA 2XYGB 1SQFA 3AODA 1UOCA 2JDJA 3FJ2A 1ICEB 4FXDA 4CVNE 3TTFA 5DGAA 3MXMA 5GMEA 1Y0HA 4E1MA 3EO3A 2BQUA 3JS6A 2Z2YB 1KTQA 2MPUA 2F9JA 3PRVA 1CXQA 1JQGA 2LCWA 3N79A 2ATLA 4GVBB 1AROP 1IKYB 2VH7A 4K4TA 4FLZA 3RBZA 2LXUA 3IGVA 1T6DA 4F4XA 3ISNC 1YJNN 3S01A 2ASOA 1BHNA 1D9AA 2VB6A 2Z2LA 4ELTA 1MA9B 1IJEB 4KTQA 3OBYA 5AQPA 2RQCA 1E3MA 4A62A 2YJFA 4PAAA 1SI9A 4OGCA 2BYCA 4CEZA 3DXKB 3T9NA 1AA1B 2RHQB 4GO7X 2KJWA 1H7XA 2DR5A 3CCUS 4FYDA 4OI1A 1J2VA 3MM9A 2ETJA 5HP1A 2U2FA 2IVFB 3PY8A 4P2SA 3K9JA 3UFCX 4OV1A 4OZ1A 1W7WA 2XYPB 4ES2A 5L1LA 2ZKUA 4CYUA 2GMJA 3JAMY 3GILA 1ULRA 4P7VA 3DRSB 4V1Ak 2HFZA 1B7FA 4CK3A 1A0OB 4HUEA 4USMA 3AD9C 4GKKK 1FKPB 4NLOA 3AB4B 1XWLA 3GG0A 4TQRA 2LQ8A 3CJ8A 1TKXA 2HHHJ 3TU5A 2QLXA 5ETTA 1N6QB 1VOMA 4C8YA 3VEOA 3SI8A 1RZMA 3H08A 4DPXA 2E1PA 2FBXA 4H03B 2I5JA 1O51A 1QAYA 3LH2S 1JLAB 4LFCF 1PG5B 2ZQBA 2EFVA 3GOIA 4PKHA 3GYXB 4H8KA 4J2DA 2D3O1 1MN7A 4WCEQ 5H9FK 3RZAA 1N36F 4OPHA 2OTJS 3D7EO 2AGQA 4ISGA 4IG3A 1M1GA 1N33J 4DV1F 5FDLA 3WZ0A 3QFHA 4P74A 4X62F 3KJQB 2Y1JA 2HBKA 2D3UA 2I7NA 5J1EA 4JI2K 1KD1O 3CE8A 3CVKA 5JS1A 1JLQB 1U49A 3EL2A 1FVQA 4KV8A 5ADXH 2DISA 4JI7F 3QMLA 4IR1A 5HLFB 2XMMA 2J76E 3RBDA 2ZD1A 2WW4A 2AW0A 4IRCA 4Z4CA 5B0DA 2B4JA 3QB0A 2YBVA 4CEQA 1GX6A 1S0NA 2IAJA 3H59A 4MDAA 4DR1J 1WSFA 4DV4K 3J7YI 3MTKA 4RKUC 3OS2A 2IMOA 2J0SD 5EWGA 4MMOA 3CJ9A 3AGRA 3V2UC 2C22A 3THYB 2E29A 1FWLA 4Y2MA 2ZH4A 1BY9A 3KTQA 3LZIA 3TA1A 1K0VA 2N3OA 3EUNA 3ENVA 3PZPA 1YI2S 3MOJB 4AT1B 1SPBP 4K43A 4CF0A 4F2SA 4DFJA 3HHEA 3CUNA 1VQ8S 2GTDA 5EVZA 1PJ7A 2DNQA 4ITSA 4N5SA 2D9PA 5KFNA 4DI6A 5LT5A 3KFWX 4FKXA 3HRGA 2DTUA 3MEEB 5AQOA 2DEIA 3OYKA 4ZVSB 2I7PA 2DB1A 5C2CA 3SMSA 4JI6F 2XI3A 3O9SA 3GR0A 3CW2C 4KE5A 2OKQA 1ZM3A 1XMQK 1VQ7S 5F8MA 4CF2A 5D0GA 4CLUA 4DR4J 2HPUA 3DI6B 5BRHA 1FEEA 4P6QA 5GAGU 2GIFA 1EO1A 4F36A 2RDJA 2OFGX 3PACA 2CQGA 2HK3A 4PZVA 2KFZA 3LL3A 3W64A 5ETOA 4AL6A 1VQNN 2V34A 2WBRA 3RBXA 2GV9A 5LM7E 1ELOA 3TOQA 3HJVA 4XEIA 1JXBA 2ZITA 4B1YB 4JEPA 4E98A 2JLEA 1AXQA 1HLUA 5KTQA 4DL0C 5CD4A 1N8RO 3NP5A 2DBBA 3ASMA 1QQOA 3D0GE 1UTAA 3GTYX 1RWUA 4DUZJ 2OH2A 2YQ0A 4OZNA 2W24A 3L09A 4UW2A 3CPWR 1Q4RA 2BABA 3AVIA 1UVNA 3ILOA 2G2YA 1HD1A 3D67A 2YKOA 1CC7A 4M5JA 3QBCA 1NPRA 1UFWA 2PFUA 1WI8A 1MMNA 1QZ5A 2HGNA 1WN7A 4Y1DA 2V8HA 1WUAA 2BM1A 4ILMA 3MM9B 5HP1B 2QL5B 4F4AA 5HQMA 2LSNA 1Q8KA 1IR2A 3CCTA 4BHQA 1OH8A 4TVAB 1LEOA 4UOGA 1RHQB 1J5EF 4GV3A 4CYUB 3Q8SB 3MN6A 2X6NA 1ZH5A 4IKFA 2EC2A 3AV9A 2EC0A 2YNIA 2VG7A 4DQQA 4QBUA 2AX1A 5E0OA 5KOXA 3WQPA 4DL2A 1HI8A 2E9RX 1MG7A 2Q3SA 1YWXA 1TKXB 3A8KA 2H4YB 5SUHA 2MQQA 4F4YA 3PX6A 3CC4N 3I0SA 4CBWA 3S3NA 4YB5A 1HQUA 3MXJA 2HZAA 4K41A 1TL5A 2ALYB 4CIOA 3SCIE 1NJIO 5HRNA 2I5JB 2ASJA 2J7UA 3FRZA 1T9TA 3RR7A 5D4LA 4B9VA 2A18A 1TUGB 4O0JA 1Q86O 3EZ5A 3VGTA 4QU7A 2XHBA 3LQVA 4ED3A 3SBTA 2R8KA 2P9SA 3VQ7A 1S57A 4LF9F 2AEJA 2HG4A 2CH5A 1WOPA 1ATRA 2YV0X 5FDLB 2Z2MA 2VUGA 2FY1A 3FSYA 3H1VX 5KT2A 3D7SB 5J1EB 2JWKA 2VWBA 2HZCA 4JI1K 4KV8B 1A5VA 3KHRA 2EXUA 2X78A 4AFFA 4RNOA 5TKWA 1ZA2B 1NK0A 2ZD1B 1VJWA 2OEMA 5IM0A 4OYXA 5LJWA 2Z1JA 3GLJA 5M2PA 2IAJB 2JHEA 1NGGA 4BR4A 2PMWA 1JCEA 1WF0A 3VEYA 2QA4N 1FVSA 4DTPA 2DNYA 3CCSS 2APOA 1XNQK 1X4EA 3GDQA 2ZUGA 3QIDA 3PYDA 3DC2A 4WXWA 1UKUA 4DQ8A 3BZQA 4NLDA 4DV6J 2DGSA 3P38A 1REGX 3N0VA 3MK6A 3LPTA 2DNZA 4GY2B 4I2PA 1HHSA 4B9NA 4DTJA 4A61A 1RDRA 4M5HA 3N4WA 4LR7A 1C4CA 4QW8A 1F9HA 3FFIB 2HSTA 3MZIA 4ETXA 4KY3A 4JI6K 2XI2A 3ZZ0A 2W4DA 4JHDA 2HBYB 2E9ZA 3MDQA 1H2VZ 2G0JA 3I6PA 3AVBA 1R0CB 1BWVA 1MROA 1EQMA 3KYLA 3PIPQ 2EBEA 5BPMA 1NSKL 3U27A 2X1GA 3TSPA 1GTHA 3THWA 3PJXA 3FFKB 2FSJA 2KG1A 1F3VA 2GS8A 4OL8A 4Z7YA 5D3GA 2DO4A 3P6YC 2JLGA 1WOSA 1S49A 4B3MK 2B8QA 3G87A 3CCQN 2CIMA 3UB5A 4XPCA 4K4ZA 4PKDB 5L46A 2JEFA 4M42A 2LLZA 4A2AA 2CVEA 4DR7K 2KHCA 4ZOSA 3TUPA 1UMJA 1FDNA 1M90T 1RDCA 3PYGA 3TPQA 3QGIA 2QLWA 2XNQA 2DY9A 1PIEA 1TL1A 3HSZA 2HMIA 4WYLA 1K44A 2AYEA 3J81Y 4NYNA 2DNPA 3PM9A 1EHWA 2D9OA 3AOAA 4LFAK 4CZKA 5SWMA 2CXEA 3I55N 2R7XA 2A3JA 3VESA 4CZLA 2GJ2A 2Q1LA 3CJ0A 3N6LA 3ZLJA 4J9MA 4DU1A 3TWHA 1J5EK 2HBJA 3W63A 4ECZA 3NWRA 3O9QA 4ED0A 4IR9A 2VPZB 4ZJOA 3NGYA 2DGVA 2RE2A 3R5AA 4KR0B 3FUYA 4WZQA 2K8GA 4MKBA 3EKUA 2YNIB 2VG7B 1U1OA 2W6KA 5DM7Q 4DQRA 4AD6A 2P9LA 4TNOA 1X5SA 1UVIA 1SKUB 5I42A 1S6OA 1SIZA 3C8YA 4DV7K 3UKUB 3ITHA 3FEZA 2DRAA 2FC0A 3L6QA 3I0SB 2SXLA 4X65K 3BF3A 1HQUB 1SVDA 4LMZA 4BRMA 2MJUA 1TAQA 1B9FA 1HNVA 3MN7A 3EGVA 3VV2B 2MKKA 5KFJA 4WFNL 5T41A 2V5HG 5AXNA 3E01A 3CIZA 3TA0A 5BXIA 3R6LB 2AX0A 3VVTA 4HCBA 4LF9K 2MY7A 1MMLA 4RBUA 3NNCA 4J9OA 1VK3A 2P9SB 4RW8A 4CLZA 4CF8A 3HKZD 1LXNA 3KNGA 1UFKA 3SJHA 3LP2A 5IOLA 2HWHA 4XDDA 5LJ5Y 4FWOA 4CD3A 1VRTA 2PAVA 2W9BB 1S12A 4FN5A 5AQMA 3K5NA 1P6TA 2DY1A 3CCRN 5G4DA 3KJFB 4H0OA 3HOTA 4NZ7A 3KK2A 3RB0A 4MKYA 1B64A 3PIOQ 2VZ9A 4ECYA 3CIPA 4FOEA 2HFSA 1VK8A 5KFEA 5IM0B 3AO5A 3PEHA 4BROA 3MAQA 4CHYA 4I9LA 2UUBJ 2KT2A 3NRBA 1EWQA 4FDFA 2JFDA 4NX9A 3L2RA 4HVJA 4C0BA 2FXUA 3KOAA 3OTBA 3C16B 3R1LA 2XYHB 3KJNB 2NRHA 3CYMA 2BKPA 1X4HA 1N32J 4I2PB 4BR2A 3QSIA 3CT9A 4H5RA 1OIAA 5KT3A 5IC6B 4FM0A 1EAYC 2MQMA 3OTEA 4USKA 3NAEA 1KOOA 2HBRB 5KG2A 3T6JA 2RHSB 4DN9A 5IT4A 1PC5A 1FJGF 3JTOA 1G7CB 3ID6A 5EWFA 4JHDB 4KGXB 3C7NA 4TXSA 4G1IA 1K8AT 3A1YG 1MROB 1JMTA 8RUCA 4YDXA 2MKSA 1U04A 2O67A 3EZWA 1IBLJ 3G8QA 2XY5A 2MKJA 3CJBA 1B0VA 3THWB 2DYAA 2NPIA 1C0GA 2BW2A 5D3GB 3BF4A 2ZGYA 3AAQA 5F3ZA 2VBZA 3PSFA 2QJ3A 1C1CA 2DNNA 3QEXA 3C65A 4LIRA 4EZ6A 4FP9A 1UAXA 3R5JB 3D6FB 3NGSA 5E3CA 2DHSA 2L3MA 3SDEB 2IM3A 2IVOA 4NYPA 4HHHA 2NPFA 4CFBA 1VQON 4CO5A 2X1FA 1U0HA 1KNZA 1NKCA 4KO0A 4QWAA 3GJQB 3OYLA 1TL1B 2Y9HA 4EP4A 2HMIB 1UW9A 1QSYA 3M8RA 2QK9A 1X7VA 2KQ2A 4IOAL 3OLAA 3NGDA 2B6AA 2DGXA 3KK1A 1CSJA 3R5GA 4PG8A 3PNIA 3AVFA 2VF3A 2EKNA 3J7YU 3NF9A 4QS9A 4JYAK 2HQGA 1N0UA 1FRMA 4KT0C 3L3UA 5JLHA 4ED8A 5CE3A 1YLXA 2D74B 2F63A 2ZZNA 5AJ3F 5E3PA 1ZZNA 3E2EA 2QW9A 1MWQA 1BCMA 2V4QA 4B1UB 1QDUB 1NNDA 3ITHB 2V68A 2KVQE 4AHRA 1XNRK 3GFYA 1NCLA 3RMBA 1GT8A 4HR2A 2QFIA 4I7FB 3DGPA 3HULA 5C0YA 4GKJJ 2CPXA 1OYEA 2JSXA 2HNDA 1XHZA 2OGUA 1HNVB 2AZ1A 2ZBQA 2H3GX 2ZH2A 2H51B 4O5FA 1HHTP 1O1WA 1TK5A 4DR3J 3H2UB 4KPYA 4K4UA 1YTYA 3E01B 4KC5A 3B78A 1EX8A 3MECA 3AXMA 4KHQA 3L7UA 4C0OC 3KLEA 1QAJA 1D4XA 4DLGA 2DNRA 2G8UA 1V6HA 3FC9A 4RW8B 4NLCA 4JUZA 1S9FA 1RBVA 1HPZA 4N76A 1AB8A 2VDIA 3LP2B 1SJ3P 3NCPA 1LOTB 3T5JA 1GH8A 3LZJA 4C23A 1VRTB 1X4GA 2IJRA 4FYXB 3OA9A 4FF3A 3FZFA 1FRJA 3WXKA 1VQSA 3N5BA 2CPEA 3OR2B 2HHSA 5F8GA 4M3XA 3GIRA 2ZDPA 3GE1A 3J80Y 2OI2A 5KFLA 2OTLS 3KK2B 5I4MA 2V6AA 1NEEA 2DITA 5F0XA 1PYTA 4OYOA 1NKBA 4X66J 3SUPA 1E6VA 3CJQA 5LY3A 2F7TA 1S97A 2L08A 3WXJA 4E7HA 4WP8A 5D4NA 3CQ8A 3CJRA 4GC7A 4QQBA 2P1JA 1YBTA 1CG2A 1VIOA 4OFZA 4FWMA 4P75A 4Z4GA 5AZIA 2Q31A 3ZX3A 2CQ2A 3IMQJ 4DQSA 3ZSYA 1HNZJ 3Q89A 2VWJA 3IAM9 2NSBA 1W2BM 1RBSA 2DH8A 3RG6A 3HHNB 2EWSA 3HP6A 4J9QA 2OZMA 5D0HA 4DV0F 1PO6A 3PUFA 2D3ZA 1IBMJ 3SPYA 1RU1A 1FNMA 4OX9F 4B1XB 3C7NB 1P9YA 4HVZA 1RB0A 4WPAA 2HFVA 2YNFA 4CJKA 1S0OA 1S77D 2BM0A 3H3NO 1DHMA 1KLNA 3S6EA 2ZZMA 3TO8A 3MAAB 1N34J 4CH1A 4WU2A 3T1YJ 4CHNA 3DXSX 4NYFA 1LWXA 2Q1NA 2XBPA 4M3YA 1UETA 1QTMA 4EU0A 3VQ4A 1RAOA 2NUHA 3G6VA 2YI1A 1ZA1B 2HAFA 2XMTA 1ZBTA 3IM8A 3E3XA 5BPNA 1YJWS 2DD8S 4JV5J 3M6WA 4M63C 3E8OA 4RW4A 4ZLJA 3RW6A 1DKGD 2CNNB 2Q6BA 1UL3A 4WFYA 2NRXA 5L38A 5CZVA 5BR8F 4IJAA 2VHGA 1NGEA 3QBWA 4FF4A 3PR4A 3FCWA 3CGIA 2HGMA 3V9SA 1IG8A 3V6DA 2AQ4A 1U0HB 1XK8A 4KO0B 3M30A 1NJYA 3QLHB 2GIRA 4CO0A 3LP0A 2HVIA 2X74A 2V8VA 3KLVA 2X3GA 1UEKA 1YJVA 2A6OA 2W2OP 3I4PA 4ZPVR 3KK1B 2D1KA 4URQU 5GINA 2F8SA 2DGQA 1XQSC 4ILJA 4XDCA 5H1SV 1KN6A 2M70A 1BQNA 1LAWA 2W40A 4I56A 4RUCA 3WX8A 4KB0A 5KFBA 4AXJA 3PW5A 4CK1A 1NGBA 3OVSA 3A5NC 3PV8A 3QFUA 1HNXF 4FJMA 1B92A 3R8EA 3O3GA 2VODA 1R6VA 2J6UA 1QM9A 1IQTA 3VALA 3DRPA 2NRVA 2C2KB 4RNNA 2UXCJ 3CJTA 4FLTA 1T11A 4MIAA 1RT2A 2HWIA 2HQFA 3SUQA 2QLJB 2HNDB 1HWKA 3RMAA 5A76A 2VGMA 2D7SA 3RAXA 1IVZA 4OLAA 4B3OA 2MQNA 3HKWA 4OIXA 3PW0A 2R9LA 4J9UE 1KR4A 5F0UA 3MECB 3QNNA 1RAHB 2GC8A 4LF2A 3KLEB 2QI2A 4W90B 3OTOK 2V67A 5J2NA 2EFQA 2RVJA 3JQKA 4JI4F 3AHPA 3QWUA 2Q66A 1HPZB 1MLAA 3AVHA 5HMXA 3ILIA 1NPKA 4HWIA 2GJFA 3RAMA 2VBXA 1JLGA 4ZS6A 2VA2A 5DG8A 1TK0A 4C1NK 4EBCA 4DTUA 2OTJN 3N28A 2DH7A 2VD3A 3MHYA 3CD7A 3BY5A 2QA2A 3W8PA 4NA1A 1FDAA 2ZH9A 4DB3A 1SH3A 4HL9A 3Q86A 4FJHA 2PN6A 3PXGa 2PFDA 3ALYA 4KHPJ 4GKKJ 1U1MA 1E6VB 3EDRB 2NXCA 1C0FA 1RADB 3CULA 1HQ2A 1HARA 4L72B 2EI5A 2COLA 4ZVPB 4Z0UA 1XIQA 3GYNA 4I6MA 3B6BA 2W01A 2Q0UA 2ACMA 3QEIA 3L4IA 5EWEA 5IC4B 3T5LA 3LDOA 1RYSA 2QMUB 2CADA 1OH5A 3PLAA 1S9EA 5AZIB 4WKYA 3C46A 4UUWA 3OTDA 2NYIA 4CGGA 2F1FA 1X1PA 3M4XA 5BRDA 4F3OA 1BUPA 3MX2A 4DV2K 3B6OA 3CB4A 1RK8A 1YI2N 4J9VA 5H9FJ 2ZFHA 4USVA 2CJAA 1VQ8N 4C7QA 3NF7A 1N4LA 1IM4A 2FLOA 9RUBA 2D4WA 1JLEA 2B0GA 4WQ5A 4BWJA 1H98A 4CHZA 2YNFB 4CRJA 2R7VA 3PIOL 1TL7A 3DMJA 1VBYA 1FFGB 2D41A 3D6HB 3CTRA 4RUHA 1FD8A 2DNGA 3L2VA 1F3FA 2N7YA 4WZMA 1FXXA 3G96A 1VQ7N 1RQ0A 1JLBA 3D45A 2KL8A 4OYBA 3H90A 4DV4J 2YWEA 2ASPA 1YRTA 1X9MA 4OPAA 5FIIA 3CF5L 3HZEA 2XZDB 3K5MA 1SUQA 3LWMA 4RW4B 1RE1B 1NGAA 3DN9A 5DK5A 2XGQA 1NK7A 4FJJA 3UQSA 1IJFB 2XO6A 5HANA 2DHAA 4CO1A 4YP3A 4ENOA 2CH6A 3BZCA 2ZOFA 4USTA 4EK2A 5F41A 3V6DB 4BLGA 3G71S 3P4UB 2V2QA 3AA2A 4OI3A 3M30B 4HI1A 3O8MA 3LP0B 3AVNA 3WHIA 2GHVC 3DYAA 4N7TA 2W7OA 3UR0A 4WFAQ 2J5AA 1N33F 3MCSA 4U67Q 4JI3F 4ZPAA 2CKWA 4LF6K 4C6AA 5FROA 1SJ1A 4AQYK 3GIKA 5C5JA 1BQNB 3DU6A 3KMQA 5M1FA 1N48A 1WF2A 1RFQA 3O3HA 4BRPA 2UXDK 3S3OA 1JWWA 4PY5A 2KZMA 2JWNA 4JI0F 2MQOA 3RRHA 2KXFA 2OA8A 4B1VA 4DR1F 3QO9B 5IT0A 1BQXA 3FBEA 5ETVA 1ZYQA 3DRPB 1N5TA 3LUYA 3BSNA 5AQZA 1KDNA 4J9KA 4O3RA 5DZ6A 1RT2B 1IN0A 4TSXA 4AHTA 2DIUA 3GU0A 4AE5A 1QAXA 1NMEB 3K59A 5M2UA 2B3TB 3UDLA 2DRDA 2IC3B 3VQTA 1GMWD 5H1SQ 2YVSA 4CEOA 1YJ7A 5THWA 3Q8PB 3OYFA 3O2IA 2B9EA 4WE1A 4B3OB 3THXA 4AHVA 4DU4A 4WKRA 3M1FA 5KPRA 4X64F 4USJC 1VQ4N 1NNEA 4JK8A 1R8BA 3D2FA 2YWWA 4H5VA 3KKSA 5J2NB 3MMVA 4H0PA 1YGYA 2V4RA 1Y9OA 2PE8A 3X1LB 3IWXA 3V1QA 4HACA 4CZCA 1MNEA 3ISND 3GG4A 3G8SA 3I8DA 1FWKA 1I94F 1RJJA 5AE2A 1FJEB 3L2WA 2L9WA 4DHYA 5KFFA 2AKWB 3DGVA 1TUWA 3RRKA 4IRDA 3I31A 2W2MP 2FVPA 2C42A 4KHUA 1JK9B 4J2AA 2VPYB 3G4SS 4YDUC 4OJHA 1QUVA 3SQOP 4Z4HA 4FCYA 2F96A 3CDAA 3IR7B 5LSOA 3OJUA 2RS8A 1HWJA 3D0HE 3POTA 2RDDA 5AE3A 4I6MB 3P5JA 3ZCMA 2ZBCA 4FWNA 4BQLA 2WTUA 2VQEK 4H5WA 2WHOA 2BDPA 1L3TA 2E5LK 4I1TA 1VBKA 4ERDA 1ASVA 4JKDA 2OPPA 3CCSN 4FBTA 1S9EB 3HHLC 4L3NA 2C2MB 3R7BB 1OWXA 1Y4ZB 4JV2A 3M8PB 4RJVA 1U09A 2KI2A 1W2BR 1FCAA 1N36J 5T14A 3OHBA 1CEZA 3WNHA 3E1YA 2PFFB 4H5TA 1VSMA 4X62J 2FJDB 4TY9A 1RA6A 3W60A 1GXTA 4Y65A 4JAXA 3QGHA 3OYCA 4G65A 3CJSA 4CFCA 4DZDA 3MUMP 5KFHA 1JLEB 2MEWA 1HI1A 4JI7J 1K8KA 1I3AA 4E7LA 2E1CA 1T05A 1VRQC 3HI9A 1TL7B 2IDLA 4CNZA 3RRGA 4NOHA 3FMWA 3L0QA 3QBXA 2N82B 4FWSA 4FPAA 3R8YA 1X4AA 1WOQA 3M8WA 1RTDA 2IM1A 1JLBB 2ZVIA 3SCLE 1F2GA 2CFXA 1ZAWA 4H0VB 4YOEA 3KDNA 4C2MA 3W7BA 2C2ZB 2RNEA 3L9ZA 1SUQB 1PGZA 4DQPA 2E4LA 4NXNF 2WBMA 2DXFA 2DFFA 4Q45A 1H72C 5KI6A 2CPIA 1FA0A 5AQNA 2IYGA 4E89A 2H3EB 3EZUA 3D6TB 2GEMA 4FKYA 4YOUA 4JI3K 3G6XA 4TY8A 2XWXA 3TEGA 3DYAB 4ZVFA 2CJBA 3C2PA 4JI6J 1UA1A 3RTVA 4WP3A 4AM6A 5L1IA 3OYNA 4O4RA 1XI1A 2LEBA 4OJRA 1FTRA 3S41A 1R8HA 1VDHA 2JVOA 4HI2A 1WHXA 2R7TA 4F0KA 4KHRA 4CIEA 3O5TB 4M94A 5JVHL 1RCHA 2J8AA 4MK9A 2YHXA 4BC3A 2DNLA 2ZVSA 2WVFA 4OYZA 2VFVA 4R0EA 3D3BJ 2HHUA 4BDYA 5EHHA 4KGZB 4F3QA 3VAHA 3LO3A 2GHWA 3HT3A 4RG8A 4B3MJ 1N5SA 3EGWB 3I9ZA 4DKWA 3VAJA 4KB7A 3BH6B 4PCQA 2NZ4A 3KUGA 5KT6A 2JRSA 4Y6IA 1K0TA 1EP4A 3FZKA 3M8QA 1U4BA 3N5FA 1QAIA 3M7VA 3O4WA 3AA3A 3L8BA 1M1KO 4AHCA 4O3QA 2CGKA 1RGVA 4DSJA 4J9NA 5LL6Z 1IR0A 4C8ZA 4CEAA 5A0YA 5HOOA 3KD5E 4ZA1A 3OV7A 5F1XA 3LW5C 4ZKAA 4B8AB 1WG1A 3US5A 2BZ2A 2Y0BB 3TAQA 4WE1B 4DOZA 4RO0A 3PO4A 3SAGA 2GGPA 2W2PP 3THXB 3TWZA 4DL6A 2CDRB 2R7SA 1LNQA 3H5SA 5GVQA 1WEXA 4LFAJ 2VG6A 4RBVA 3SCJE 2F40A 2WVEA 4DWIA 3M2UA 1FW6A 4UZCA 4F2RA 2HMPA 1YDLA 2Y1LB 1J5EJ 1XTZA 2XHCA 1EZZB 3D1QA 1HYSA 2MZRA 5E3RA 4GO5X 3PDNA 1TV6A 1Y00A 3HPOA 3JQMA 2RPIA 3JAMO 3TSQA 2HHXA 3R2CJ 2QL9B 3ZEUA 1U1LA 3DXMA 3DOLA 2MSTA 3CETA 5AQRA 4G3IA 1TR0A 1UZDA 1RWXB 1YIJS 1CJKA 2Y3YA 2YX4A 4BC5A 1CQNA 2VBYA 3VR1A 4WTYA 3JB9k 3F5TA 4EHUA 2AJQA 3LPYA 3POTB 4KI4A 2FJVA 3GV8B 1U6ZA 1X5OA 4CDIA 3NS5A 1X3NA 1GLDG 1WKKA 1NHUA 5KFCA 1RT6A 3CO0P 4LF8K 2BMBA 2OPPB 1EWRA 5LMUK 2DGWA 1S5ZA 4RW6A 2V9KA 3MM5A 4GV6A 5HQ8A 2AEMA 2XMWA 4ANDA 4K42A 1D8YA 1WEYA 2IRUA 4JKAA 4LF9J 2FF6A 4DR6F 3CDWA 1YG0A 1Z1ZA 4OX6A 2KM8B 4CGFA 3DLJA 2C2RA 4QR0A 1QE1A 3PX0A 4LRBA 5KG0A 2EVZA 1KQKA 3M6GA 5HAOA 3BS9A 1FRIA 2DVIA 4YHHK 2CQIA 1K8KB 1Y5IB 4DF8A 2DGTA 2QRRA 1T05B 4D3GA 3CWJA 3HHKA 1PAUB 4CO4A 4LRDA 3CC7S 4F04B 4CJ4A 2RQMA 4HUFA 1ZTWA 3C6HA 4W92B 3VAFA 3MM8A 4S0MA 4RNFA 3CCLS 1AUDA 1RTDB 2RSQA 3H1QA 2BV3A 5K8MA 1GNKA 2VU5A 1CZBA 1ZBSA 3ISZA 3ZTPA 3OW2M 3SI6A 3AVLA 2V2ZA 4FJNA 4YQWA 3W61A 3W0LA 1VSJA 2E2NA 4QIFA 3I5CA 1IM6A 3TQEA 4CFAA 3EVMA 2CQ4A 2HIYA 2CZ9A 3VMFB 2ZEJA 2ZF5O 1HR0F 5ETQA 3MGJA 4OGEA 4BC4A 4A8WA 2JGUA 1NZAA 4ZHRA 3GCWP 5BN8A 3H20A 4Z4EA 4RNMA 1LWFA 3DM2A 4TY8B 4HHJA 5C25A 3CFRA 5D0EA 1SZ2A 4ECXA 1KHVA 3MDFA 3D54A 1H74A 2CPHA 3L2QA 3WXMB 3M5RA 1JXVA 1Y5LB 4CGIA 3IR5B 1WG4A 4YOWA 1AYEA 4MIWA 3AO2A 4M5KA 3MCOA 1PBUA 4BE2A 4L74A 3VTHA 1KBRA 3TAFA 2BBEA 1A6LA 1VRUA 1WC3A 1UA0A 4O0IA 4QIEA 1T9VA 1JJCB 3DCAA 2QG9B 1F6TA 2LYVA 5JLFA 4CFDA 5GMDA 1WORA 2GQCA 3VGSA 4EYIB 3ZSVA 1KAYA 4XH4A 5C2GA 2OD6A 3J7AP 1EP4B 3C6AA 4K25A 3M8QB 4DV3K 4PRFA 4M41A 3KUEA 1G6BA 4RUAA 4IOXA 2QEXS 3L2UA 1NPPA 5EY4A 1IV0A 2JJ4D 3SQ1A 2FJWA 4J9LA 1R0AA 2GGPB 2G1HA 1BA0A 2M8DB 3AVAA 1T0TV 1S6UA 4BRCA 3AQOA 4FPRA 3A3PB 2FPHX 3NS7B 3QGPA 1PILA 4A8KA 2GWJA 4J90A 1LFPA 3MEKA 1OVQA 3D0PA 2VG6B 3R9PA 3SFGA 3BYRA 1H0HB 4OZ2A 3N6MA 3M2UB 1JX4A 1L3UA 2P9IB 3A5LC 4MFBA 2NRRA 2ZKTA 5CYQA 3VF0B 4JYAJ 1SB6A 1NGIA 4TN2A 1HYSB 1Z25A 1TV6B 1IBLF 1NHKL 3UIQA 2W9CA 1B0PA 5GAHU 1XERA 3EGNA 3ZEUB 5MLCV 3DXMB 3DOLB 1T3OA 3N4QA 2IHR1 3MURP 2HZVA 1LW0A 1Q7LB 3ZXWA 2PIIA 2FY8A 1YZ7A 1CJKB 1RDBA 2VGNA 6FDRA 4U6PA 2OTLN 1DZ5A 4LQ9A 2BKOA 4AL7A 5AQIA 2UV8G 3LDQA 1J27A 1F9EB 1QSLA 4DFPA 1VMBA 4NLUA 2PEBA 2VQFF 2OAUA 4YOXA 2HNZA 4BDPA 3VEWA 1RT6B 1XJWB 2AT1B 4X4UA 4P71A 3ZTOA 1NLVA 1Y64A 5CAAA 4RW6B 3MM5B 2AMCB 1PJ6A 2BQ3A 4CW7B 4DR6K 1KHWA 3C6TA 3G6YA 1VQLN 2O8FA 4DCOB 3T5KA 4XH5A 4ZVUB 2XS2A 2D69A 5M2RA 4CZEA 2AZ3A 3FE1A 4MO5A 4CF9A 3VAMA 4H0YB 2WB4A 2AJ4A 4LT6A 2OHDA 1RBAA 1JJHA 2JX2A 1QQMA 1HKGA 1RBTA 3A3OB 2EW9A 4C8KA 5RUBA 2F9TA 2RD5C 3B4MA 2X51A 3GV7B 3HOSA 1ASUA 4P73A 2AD9A 1BC6A 3IP0A 2DGOA 1WNSA 5JS2A 1H3DA 3FZMA 5AQQA 3MM8B 2UYTA 3MUTP 2RS2A 3B6PA 2ZM6F 3CC2S 5LJ3Y 1IWAA 1U25A 1RWNB 4CLFA 4DL7A 2JEIA 2QKKA 5T7LA 2WSFC 1VQYA 1KQSM 4CEDA 1WC1A 1P8ZA 1NO8A 3V6KA 2RRAA 1X4FA 3SUOA 3G9CA 2WK4A 4KYZA 3L7OA 1HR0K 4ID5B 3OFHA 4CERA 3WXLA 3I96A 3UWTA 2E2QA 2RB7A 1YJWN 4QR1A 2LQBA 3MXHP 1R7IA 3IO1A 4LF4K 4FZXC 2DPIA 4ZHRB 3ATUA 1FJGJ 5J2PA 4OPJA 3DKDA 1LWFB 2RUSA 1M5SA 3CQXA 3PKMA 3M2RA 4JKBA 3R1XA 3VQ8A 3BJYA 3BEGB 1ZPWX 4JI5F 4DXLA 3MWPA 5KFDA 4W5RA 4ZN3A 3JTNA 1HMVA 3HPGA 1BL3A 4PR6A 1EX4A 4EUVA 3V9XA 3HVTA 2YHYA 4X4RA 3RR8A 3EN9A 3MD3A 1HNIA 1FK9A 2EFNA 4GV9A 4ED2A 2CVIA 1U1NA 1VRUB 3C66A 1BA1A 3TVKA 2J0XA 1SKRA 1OY8A 2QWOA 3SXLA 2QWQA 4LFBK 3D2WA 3KK7A 2HNYA 4QS7A 1HFEL 2KHDA 3GWCA 3TP2A 3DLKA 2P9GA 3H0PA 2VCPA 2RMLA 2XZTB 4CLWA 2ZH1A 2ZZTA 1HBOA 4NO7A 1U1QA 1D5AA 2R7WA 2K1RA 2O66A 3THVA 5BR9A 5C42A 4KBOA 1QUPA 2MXYA 1NJWA 1RCXB 3TNVA 1HNZF 2VOPA 2RF2B 4C0HA 4BS2A 1R0AB 3L7PA 2QC3A 2C3YA 2A42A 3Q2TC 4C3LA 1F60B 1IBMF 2VPWB 1R59O 3CD6S 2UVVA 1Z05A 2WZ1A 4JRQA 2Z8QA 1ZC6A 3HK2A 1BXNA 2B9YA 3CMAS 4M5NA 4MFBB 2LA4A 1NJZA 3KG4A 5CYQB 1U2CA 4ZP9A 1OPIA 5E7OB 1GXUA 4B9SA 3H2LA 2PI4A 2JC1A 2W9CB 1TK8A 3CJCA 3AAPA 3BSAA 3UVJA 3VEXA 4U95A 1BWFO 1H2TZ 4Q2MA 3SSRA 1LW0B 2EX3A 3VTIA 2B5JB 2YXLA 3HD1A 1R27B 4GMJB 4DU8A 1MSWD 3GIIA 3TI0A 4JV5F 4LQ3A 2ZJPL 1TAUA 1R89A 2MZ1A 1U47A 2IJFA 4BRDA 4FLVA 2H1YA 2C2NA 4I0WA 2PI5A 3HMJG 2CDQA 3IFEA 4F4WA 2HNZB 3AB2B 2P6TA 4Y0WA 1PAEX 2OPSA 3TTCA 3IWNC 3EYZA 1WOOA 5IWAK 3C6TB 2MQ8A 2ILYA 2N4DA 3EVOA 3EVWA 1CPZA 3NH0A 2AJ0A 3QFPA 5BRFA 4OJ1A 4U96A 3ID8A 2UZAA 1NBEB 2IIHA 5MLCQ 3ATVA 3MCPA 5CA5A 1DQ8A 2OCEA 1SC3B 1D3WA 3UD5A 3LWLA 2LQJA 2XB2D 1HBUA 2PBDA 4CECA 4K0KK 4OKJA 3JXOA 1X8DA 1S0MA 4FYYB 3W62A 1UW4A 3TSUA 4USHA 3JAMU 1B7YB 3GB0A 1OO0B 5ETSA 4C8MA 4L73A 1Q9XA 1IBKK 2W4PA 3M2VA 3FK4A 4CNYA 4IG0A 2ZM6K 1AZSA 3KIOA 1IWGA 3OS1A 3DRXA 5B8HA 1NSPA 3M9MB 5CY4A 1WSGA 4IYQA 3RWUA 5K8NA 3IR6B 1DRZA 4BC9A 4AYBD 5T7LB 3TZXA 3OW2R 2Q36A 5HL7Q 4NCAA 3VWSA 4KHWA 2VASA 3S8SA 2DPJA 1PC4A 3QT7A 4A48A 4HT7A 2P9EA 3KHLA 4FJ9A 1FERA 1XMBA 4CJPA 1WKJA 2R7QA 2PD1A 4YOVA 2DNOA 2V9WA 4A5BA 4NMXA 3M6XA 4QS8A 4LF5K 2D0BA 5ETRA 5AZJA 3D5MA 1YK9A 5J2PB 4OX9J 2QT7A 3I5BA 4GVMA 1G4CA 1XR7A 2H5IB 4Z37A 3G71N 2MB0B 3M2RB 4GVLA 3J7AN 3UCZP 1DQ9A 3P1GA 1HMVB 2UUWA 2R2TA 1LW2A 4MO4A 4B3RK 4K7QA 1CQMA 3HVTB 5SZTA 1SL0A 1T3NA 3E9LA 2N4CA 4DUYK 1HNIB 1FK9B 1ZAXA 2BJ9A 3F9MA 4OZ5A 1H6KX 4GKKF 2FTRA 1CZ9A 4PG6A 5F3TA 2EK6A 2DGUA 2M7SA 1P1LA 4UQGA 5E84A 2HNYB 2DH9A 4OHYA 3M6UA 1NUEA 5L1JA 1Q18A 3K57A 3DLKB 4K4SA 1NAQA 2NR0A 5F8JA 3SQ0A 4A8SA 4M3RA 5BR8J 1HBOB 4WF9L 5DLFA 1XMOF 2K1RB 4P52A 5C42B 4HCCA 2Y0SD 2ATCB 2NNWA 2XS7A 4LJMA 3AGKA 4BRNA 2C3MA 3FQKA 3DU5A 3VGVA 4ISEA 4IWVA 1EB0A 2IVMA 1WACA 2W9AA 3GBTA 4WP9A 4K50A 4W5OA 3SQ4A 2UVWA 2YQ3A 2YWKA 2GBZA 3IS9A 1X60A 3DHWC 4LF6J 2ZHOA 2WTFA 1ZS6A 4F0HA 4USWA 2C3PA 3D4JA 1TYQA 2AP1A 3BN4A 4JI2F 3ZNUA 3TUIC 1YJTA 3IAYA 2R7UA 3JSBA 1PCAA 3VQBA 2ZNYA 1YVNA 2NRTA 3L95X 3NEKA 2NYHA 5JVGL 3RB4A 1V5IB 3M05A 5GAGP 2HHWA 1OKJA 2DXDA 2XS5A 4DV4F 3PVXA 5E41A 2MDAA 1HQEA 2ZHAA 2BJEA 2CPFA 3RSEA 2PMHA 4DX8H 4CO3A 2R3VA 3TUZC 1RBLA 3G4SN 1FEHA 3FVYA 1RNHA 3VCDA 2EHGA 5J2QA 1JLCB 2ROEA 1F1BB 2FQQB 1G99A 4RWTA 4YNQA 4I6WA 5HMYA 1DAXA 1BISA 2OPSB 2XHWA 4LRAA 4JI4J 5C2DA 3PR5B 3HM9A 3HO1A 4ILHA 4IO9L 2C3OA 4ZLNA 1HBUB 2X1AA 1TP7A 2HHHK 1XMQF 1YRXA 4CH0S 3ZZUA 2JH3A 1UWBA 1LFWA 3KKRA 3ENQA 5E3QA 4IH5A 3M2VB 3J80O 5EN1A 1AZSB 3VGLA 2WAQD 1FESA 1MWMA 2G8FA 1HRHA 3FMBA 3P3DA 4IFYA 4E7IA 1TMJA 4OPKA 3EPGA 4BCAA 1HNWK 4JKCA 1KQSR 2R4FA 4CBUA 5JMNA 3I33A 3G86A 2VQEJ 3I9V9 2E5LJ 4OYMA 1U24A 5J1PA 4M3WA 1DTQA 1VSLA 4WFNQ 4RW7A 4AH9A 2BW7A 5L39A 1VIXA 2W2NP 4G9ZA 2N3LA 1CLFA 1XC9A 3ULEA 1GLJO 4AM7A 1GMUA 1ROFA 3ENAA 4MAKA 2GW8A 2H54B 1NBWA 5FPMA 5ETLA 2IVYA 3IXQA 2XTJP 4HYKA 2G8VA 3PFOA 3CMQA 1IBCB 3EWGA 3R97A 4CEFA 2E7VA 1T8EA 4O4GA 2ZH7A 2QXFA 1YSJA 1LW2B 1J5OA 3GIJA 3NVMA 2MGZB 3ZO7A 1WBDA 3HVWA 3MPYA 1RA7A 2QWNA 1YHQS 3NOGA 1OH6A 3HFKA 1WKLA 1BO5O 2BJ3A 1UJ5A 4Y2CA 2RRBA 3NG8A 4MLHA 2LMIA 2D0PA 3EPIA 4B17A 1XMOK 4DX7A 4KTWA 1QVGM 3MX5A 1N52B 1RHJB 2J6SA 2Y8YA 2XLJA 1ITPA 3EE8A 3CFOA 2E1ZA 4UF4A 3UNYA 2KTQA 1SH0A 3FLCO 3LANA 3TA2A 4DR4K 3GE9A 2FF3B 2EEYA 1BCOA 4F0MA 5LXYA 3D66A 4JI3J 5GAEI 1YX2A 5HMWA 1Y5NB 4QOZB 3OLBA 1V9OA 3IS9B 3ET6B 1IKWA 5F8HA 2CGJA 2Q0RA 2HK2A 3CCES 1VC6A 1SQEA 1EIYB 4BY9C 6AT1B 1SKWA 2PEHA 1TYQB 4H4MA 5BYSA 4FWKA 4JI1F 5G0RA 3C15A 3TQ1A 1JB0C 2DHHA 4GRSA 5CYMA 4JI0J 4CCHA 3BKFA 5CYJA 3QNOA 1YXQA 5M1KA 1TZ0A 4OJGA 5ELZA 4K4WA 3SCKE 5HVFA 1RDUA 2LEAA 4DUZK 1KAZA 3SQ2A 1HLWA 3TANA 1HQEB 4CLSA 1VFJA 1XNQF 3BSOA 3WT0A 4NLBA 3RSEB 2ZH6A 1RHMB 1KVAA 3OVNA 5J2QB 1V5VA 1T02A 1U45A 1F9FA 3H5YA 3SBGA 4H5NA 2R8IA 2O1PA 2RE1A 4X64J 4OYPA 2DR8A 1O0PA 3MPWA 3WBZA 2ZUAA 4I68A 2HQCA 2RAQA 2D1CA 1RWVB 3UDCA 1VQNS 3RU0A 1WC0A 3WIVA 4FWPA 3U1MA 1DTTB 2F7VA 4IOAQ 1I94J 4EO8A 2OEKA 1T9XA 4FZYA 2CAJA 3IG1A 2DK2A 2AU0A 4G1QA 4O44A 3GG1A 1U2FA 3VAIA 3U3GA 1W7AA 3UD4P 4ISFA 2JEGA 1S1WA 4TU9A 2CPJA 1RLCL 4ZTFA 1NH7A 1X4BA 3BQ2A 2CQDA 3KLGA 1YITS 1UWBB 4C98A 1KWMA 3K5PA 4A46A 4M3TA 2FBVA 4J5OA 1FXLA 2HS4A 5EOYA 4KH0B 4K2XA 1R43A 2XMJA 3F56A 3OYMA 3AD8C 3F73A 3VAGA 2B4OA 2BE7D 4X2BA 2F9WA 4ZJLA 4G6VB 4LF7K 2GWKA 3ZSWA 4B3MF 4LBIA 4PWDA 3CC7N 4IFYB 4NZ6A 4FJLA 4RWXA 4Z4IA 4HH1A 4NPOA 3HSTB 4CGJA 2AJ1A 2Q43A 1TFWA 1VSEA 3FGUA 2PSZA 3CCLN 4C8LA 4HTUA 2YHWA 4XAKA 2LDYA 1KQFB 2KYZA 4DR7F 5DGBA 4QWCA 3LTOA 4LF8J 2MKHA 4BREA 2BACA 2GHPA 3O1LA 5LMUJ 1GFWB 3HCXA 4C8OA 4FWQA 2QWPA 1KFDA 5A8WA 4LBPA 5KT5A 4AILC 1XBWA 2B4PA 3UO0A 2NZTA 1HI0P 1X0PA 4LFAF 3T6BA 1YQHA 3HYFA 3ETOA 4IQXA 3JYTA 4RX6A 3MMJA 4JI8K 3HHLD 1RXOB 4P72A 4DG1A 3BGOP 3TVZA 4RW9A 3IFRA 4DR5F 1F2HA 1S1TA 4G1PA 5KFMA 3J81j 3Q8QB 3NCIA 1M90O 4MT1A 3UCGA 4DV6K 3TR8A 3OYJA 1RT4A 4K4YA 3IBFB 2KKZA 3C14A 2RT3A 3KNAA 1G15A 5HL7L 1HA1A 4EIAA 2ITGA 3SNNA 1FWPA 4DV7F 2NXJA 4BRAA 4ZVGA 4F4ZA 1HX1A 2JNJA 4FOIA 2MZJA 4NXNJ 4X65F 3MF5A 1G3OA 3O6QA 3PEJA 2JOQA 5ADXA 4RLEA 1VBXA 4UOFA 4JK9A 3ZT1A 2HVZA 4CHPA 4JKGA 4MLEA 1XR5A 3D3CJ 4HUGA 1VR6A 3AD7C 4A8QA 2FHOB 3Q22A 3FCVA 3B8AX 4ECQA 2AGPA 1NSQA 1T94A 4IG3B 2QEXN 3BB5A 1VSIA 4J37A 1KFSA 2OANA 4JOUA 1IKWB 4HTJA 3UW1A 2J4RA 1RAIB 3FEYB 4NA2A 3NGTA 2F5GA 1H2UX 4H4MB 1AW0A 3KG1A 5G0RB 2Z30B 3C15B 1NB2A 4GNIA 1D8ZA 3CCMS 1F5BA 2ROPA 5E2QA 1OPZA 2W25A 1M5VC 3I56S 2KJVA 1JNRB 1U6FA 4FXWA 4OI0A 4UY8O 2V4JA 2P5GA 2IBOA 3VQ9A 1UJ6A 1B70B 2E6LA 4A8OA 1LWEA 2CJQA 3Q8UA 1X4DA 3DDIA 4P2FA 1TVRA 3KLHA 2OSQA 3NFAA 5K20B 4MYTA 1APSA 4R25A 3P45B 4PKIA 1FFSB 4DEZA 1BOTO 2FBTA 4U7UK 2IRXA 2ZE2A 3SEOA 3H4BA 2R7OA 4UY85 3PRDA 3EY1A 4XTTA 2PA3A 1ASWA 4RNHA 2ZJQL 3A3NB 2I38A 4FXVA 1OH7A 4FBUA 1RBRA 1RT1A 3DWLA 1WAJA 5AXKA 4DU7A 2NXNA 3P5TL 1VSDA 4TQSA 3K9KA 3AJDA 4B9LA 3IG1B 3OXLA 4G1QB 1QZ6A 4IOCL 4O44B 2KU7A 2J0WA 4K5RA 1C0MA 3FRYA 1S1WB 1CZAN 3J7YP 4OO1J 3MN9A 3AA9A 1J54A 1JLFA 3KLGB 1JXEA 3H5XA 3H7HB 2FHMA 5IXUA 3TRGA 2R8HA 3R9LA 3QPIA 4CJ5A 4RBTA 5M1PA 3VENA 4DS5A 4PWDB 4JKFA 3I55S 2MZQA 4CM2A 4ZMMA 5B0GA 3ZTRA 5FLXY 1XC3A 3MEDA 1M0SA 3THPA 3G6ES 4CIFA 5AE1A 1K8AO 3CC2N 5K8PA 2C1EB 1VQ5S 3LDLA 3UDEA 4B3SF 4DZ6A 2MJNA 4RR5A 2LVWA 2CWKA 1C1BA 3WXIA 4U8YA 5KQDA 5A8RA 4DR6J 4A8MP 5A8WB 2HBQB 2AHOB 2GO9A 1VQ9S 1X5TA 4KRWA 4KB1A 3BBCA 3RMDA 3W9IA 2J8SA 4NI2A 2E5IA 3JYTB 2XSJA 4CTAA 4LSZB 4DR5K 2UUBK 3GYGA 4J91A 1NLKL 4JYAF 1C0TA 2BJDA 4RW9B 4USIA 1HWLA 1AFJA 3J80U 4H54A 4Q44A 3WX4A 1S1TB 3I87A 4M63A 3SAFA 4M3UA 5A6WA 1IUJA 2P9PA 2BANA 1RT4B 1TL4A 4BBYA 4FW2A 4ZVOB 3C14B 4PG5A 3VQ6A 3H6EA 1N32K 2B4VA 5EXWA 1XNRF 3WNEA 3O1BA 2QLBB 4CHQA 2NXUA 2BH1A 3O5BA 1NWKA 1SJFA 1QVGR 3HPHA 3TZYA 2G0CA 1J53A 5LSRA 2ASDA 1HR0J 2E8AA 4XO0A 4RCHA 4UY8T 3ZSXA 4JKGB 1ZETA 1P9QC 3PHTA 1OSCA 1BD6A 3MPUB 2HVEA 3LAMA 1URRA 4ZP7A 4B3TK 4ZP8A 3OFGA 4A8XA 4B9UA 3T7ZA 4USUA 2UUAF 1EJ7L 4JN4A 3NGZA 4EP5A 2VA3A 1CXUA 4KBIA 3MCNA 4KHNA 2PYLA 2HQ3A 1JJ4A 3CD6N 1GQEA 3CDUA 3BH7B 2YQ1A 2ZOMA 4ED1A 4FJKA 3JQJA 2MSSA 3R6MA 2H4WB 5AQYA 4RZRA 3CMAN 1XUPO 2W1BA 1W9HA 2ZC3A 1GX5A 4XH1A 2M3DA 1LWEB 3W2VA 2HRUA 1CJVA 3CF5Q 1TVRB 2LA6A 5LJVA 3KLHB 1TL3A 4JKEA 4DSEA 4ZVEA 3UNGC 4DFMA 2YWHA 3QRRA 5KGWA 2O01C 2D5RA 4OZLA 2DIVA 3CD0A 4WFXA 5HQLA 2ZE2B 4IRKA 2JC0A 3HSJA 4M7XA 2D0OA 3NE6A 5K9FA 3LA0A 2B8PA 2UXBF 5KAKA 3VGUA 2QV6A 2A6MA 3H46O 4HHTA 1FFWB 2YX7A 1MU2A 5A8KA 3ZZPA 2QA4G 3BO2A 2LECA 1RT1B 2E1MC 1SC4B 2KFYA 4ZPWR 4H4KC 3CFPA 3PO5A 3MMBA 4E7KA 2V52B 1SIWB 2I1RA 1FI4A 5AFUH 3QZ8A 6FD1A 1ESVA 1VQOS 3OPKA 4DR2K 1Y7PA 4Y28C 1JLFB 2OMOA 1N5VA 2ILZA 3SIPB 2Q97A 2WC9A 2RDIA 2I8EA 3GFHA 1F5AA 3AO3A 4Y0FA 2VFSA 2RH3A 4DR3K 3DOKA 1KVKA 2BGGA 2XLKA 3CMES 1CS4A 2HAIA 1ZM9A 2JFKA 4NZ0A 1RHUB 4WIQA 4N47A 5JUMA 2Z2ZA 1BG3A 5B09A 1TTHB 4B3SK 2VQFJ 4A57A 3MEDB 5AQSA 5GAEU 3WC0A 2YH0A 4W4MA 3AY0A 3QQCD 3W5ZA 4H4OA 3DLLL 1C1BB 3NS6A 2K06A 3BREA 2HBLA 2NLWA 5A8RB 4LUBA 3DOMA 4OI2A 3A2FA 3OL7A 1R0BG 4PWWA 1FF2A 1KVCA 3AVMA 3GL1A 1NRKA 3PKYA 1SC6A 4FNHA 1KVIA 1SJRA 3TX0A 5B7WA 3DLRA 1S10A 3JXUA 1NGHA 4ECSA 1XQIA 4NI2B 4X66K 4LC9B 4DTMA 4CTAB 1ZBIA 3DHXA 1HWUA 3ZETA 1NGCA 2ZBPA 2A3ZA 3TJ9A 3HDSA 2G2OA 2A1SA 2FJAB 3M8SA 1BIZA 4UT4A 4CZIA 2P9LB 1S0VA 3TW0A 5I42B 1P1TA 3PYEA 2ZM6J 2QTDA 5J1NA 2P9PB 2BANB 2XRIA 1SKSA 3MWTA 2K3KA 4C48A 2NZCA 2GMLA 5D77A 4O8KA 3RMCA 3VGMA 2R8JA 3ZZOA 5L1KA 1U26A 2X7IA 3T1AA 1B99A 2DFHA 3ILJA 1EARA 2QA1A 3MCAB 1SBRA 5KFOA 4Q8FA 3A8IA 2C2OB 4O0NA 2HSEB 3U02A 3Q8YA 3N4PA 3QMQA 1JLQA 4FJ5A 4FW1A 5HVHA 4DCPB 3BF1A 3V5RA 1JL2A 4PXDA 3WQTA 5CR4A 1N34K 3GCXP 3OTOF 4QIWD 2R7YA 3HI0A 4F8RA 2IDOA 4LF5J 2UUAK 2PZSA 1I51B 1DGKN 2IM2A 4MQ3A 4L8RB 1QD1A 4JI5J 1FRHA 5LMNK 4NXMK 5F8NA 3AQPA 3W2WA 3BQ0A 1VI7A 4DX5A 1FDDA 4BQZA 4X4VA 3U1LA 5KFQA 5BJRA 3CDEA 4FM2A 3BM7A 4Q5VA 5BREA 1IKVA 1CJTA 2DNHA 4KAIA 1UFLA 4B3RJ 2Z1GA 3QEVA 1Q81T 5KG7A 3MMCA 5T7BA 3MR7A 4DUYJ 2GELA 4CQ1A 3ZSZA 2XCAA 3HXMA 1HYZA 4OVLA 4ZCLA 3V9WA 3DDNA 3OYEA 2VBWA 3H98A 1R8CA 5H9EJ 3I0RA 4HKQA 1FNXH 3W2VB 1CJVB 1TL3B 4ZPCA 4EAHD 3DLEA 2E5HA 1OSDA 1GLFO 2UXBK 3NLCA 2RRNA 3Q7CA 3UR3C 2Z1HA 4AF1A 1UPMB 4BE1A 5AFUA 4AHUA 2I9SA 4MIBA 1VHFA 2A10A 1AFIA 5AQXA 1S99A 2AV5A 4ELVA 3FNNA 4ED5A 2H9ZA 4DV2F 3VF4A 2DNMA 2BKNA 5A8KB 3MCMA 5KPZA 2CJXB 3H40A 4B9MA 4N77A 1DT9A 5F0WA 2P5OA 2WSCC 3MMBB 2UXCK 4PWUA 2DXEA 4YDUA 1TKTA 1RKIA 4ECTA 3HSGA 3HL8A 2FSNA 2FGCA 3BBFA 5IZHA 2UU9K 2E7WA 5JVHQ 4CI0B 5KFTA 2VIHA 1G1XA 4P10A 1OQ3A 1KONA 3KLFA 4WU3A 1C1CB 3DOKB 4YY3F 1U7LA 2CPYA 3OSNA 1V3SA 4P9SA 3HHLA 1CS4B