1HMVA

The structure of unliganded reverse transcriptase from the human immunodeficiency virus type 1
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
554
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of unliganded reverse transcriptase from the human immunodeficiency virus type 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
total genus 139
structure length 536
sequence length 554
chains with identical sequence C, E, G
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1994-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hmvA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hmvA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hmvA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hmvA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hmvA05
4MFBA 4CHZA 1RBUA 3QEVA 4DU4A 4KFBA 5CY4A 1YT3A 5I42B 3DRRA 4YFUA 2WK4A 2DPIA 1TP7A 4FJ7A 1S1VA 4AHSA 4FLVA 4HHTA 4KV8A 2HHQA 3CQ8A 4B9SA 1HPZB 4ZMMA 2DPJA 3E01B 3OL9A 5FROA 2XO7A 2IA6A 3QIDA 4KHUA 4IG0A 2XC9A 4MH8A 4IFYA 3HP6A 2KTQA 1SV5B 2HVIA 3OS1A 5DMRA 2WHOA 2PYJA 4DG1B 2IBKA 5F9NA 4HYKA 4ED3A 4M45A 1VSHA 3KK3A 4Q43A 4B9LA 5EU7A 3H4BA 3LZIA 4F4ZA 4CFBA 4NYNA 1GOCA 4QWCA 4DMNA 1IH7A 2R8IA 5KTQA 3DMJB 4RNFA 3GYNA 4ECRA 1B9DA 4TSXA 3SJJA 4U7CA 4BDZA 2JEJA 1RDAA 4AHCA 3VN5A 3VQEA 4ZHRB 3QLHA 1T05A 1S6QB 2JEIA 3SUNA 2FBTA 5KFQA 3K5OA 4G1QB 4CJEA 2XY5A 4EYIB 4QW9A 1VSIA 3NKYA 2XI3A 5JS1A 4CEZA 4DEZA 4LH5A 1LWEB 4EP4A 3NH1A 1BL3A 4HVJA 3VQ4A 3QGGA 5J2MB 3ULDA 1HQUA 3MECB 4KI4A 3DYAA 1S5JA 4IBNA 4NLQA 4LQ9A 4N47A 1KRPA 3BR9A 3V1RA 5F8MA 3Q8PB 3RB3A 1TKZB 1LV5A 4B9NA 1S1WB 3H5YA 4XIUA 5F8LA 2BQUA 2VG7A 5KFWA 3QESA 3PO5A 2HHXA 4ECSA 4KHRA 3AVHA 4DTUA 4CJ3A 3TAMA 1JXEA 2YNFA 2OPRA 3DI6B 3DLBA 5F8NA 1IKYA 3C6TB 1ZBUA 3QNOA 4H8KA 4CF1A 2YKNA 1Q8IA 4FS2A 3M8SA 1IKWA 2HNYB 3OJSA 2FLLA 4MKAA 4JLHA 3F73A 4M3RA 4B9TA 3VQ7A 4M3YA 4NLWA 2C22A 1A5VA 1HQEB 4DG1A 4M42A 1IKXB 1S1TA 3BDPA 4ZTJA 3LWMA 4N56A 3AA2A 2KFNA 1JLBB 3DRPB 2UVRA 3CFPA 4J2EA 3CFRA 2R2SA 1VSEA 2YHAA 4Y1DA 3DOKA 4CF8A 2G8UA 2HNDA 1JLCB 2FLNA 2P1JA 4FLUA 3DLGB 4M41A 4EP5A 3FSIA 3D0PA 4FJMA 3DRRB 4ZVGA 4JUZA 4FJ5A 3AVAA 4KFBB 4ZPDA 4EBCA 4N5SA 1XR5A 4EZ6A 1QS4A 1RT4B 1HYVA 3QIPB 1JLBA 2YV0X 1HMVA 1HNIB 2W42A 1X1PA 2QXFA 4HUGA 4Z0UA 4E19A 2FVCA 1WSJA 3TAFA 2IAJB 5KT5A 1XHZA 5FRMA 4CJSA 1S9GB 3T1AA 4NCGA 2WOMA 4R5PA 4K4TA 1XR6A 2J6UA 3MAQA 1IKWB 4I2PB 4PUOB 5HRNA 5KFAA 4Q5VA 3K2PA 1NKCA 1UWBB 3NMAA 4Z4GA 4F2RA 1LAVA 2J6TA 4DQSA 4BWMA 3LAMA 4FJIA 5KRSA 3ALYA 4CFCA 1KLMA 3GIKA 4YR2A 4DS4A 2YKMB 3CFOA 4ZVHA 2E4LA 2AU0A 4WFYA 5KFHA 4Y3CA 4AHTA 1WNSA 3MF5A 4LSNA 2F96A 3MEDB 3AO3A 2R8KA 1EX4A 3DLEB 4CJWA 1WAFA 4DSIA 2W9CB 3OYAA 4OLBA 4M3TA 3SQ4A 4CGDA 3TAGA 3SV3A 4FZZA 3OYNA 4CE9A 1QE1A 2AX1A 3ICLA 4DL4A 3QO9B 4RU9A 2G8WA 2X6NA 1NK9A 3FDSA 3PW0A 2W7PA 1JL1A 4H4OB 2A1SA 5J1EB 4ZPAA 3MR6A 4FM1A 2ASJA 2HNZB 4OLAA 2IJFA 2WONB 3LPUA 3OS2A 3VQBA 2RN2A 1KHVA 3BSOA 3GILA 4E89A 5J1EA 4CJPA 3TI0A 1J53A 3ZT1A 2BQRA 2FVQA 2VG6B 4FK2A 2ASDA 4ECZA 2F8TA 5E41A 4QWEA 4YQWA 2ZQBA 4YR0A 3L2VA 4TLRA 4DFPA 2Z1IA 4KHSA 3DLHA 5KT3A 3L3VA 2W8KA 4BWJA 1C6VA 2E9ZA 3M8QB 2CKWA 1N56A 4CHQA 2W9CA 4QAGA 5J2QB 3L3UA 3SUOA 3KIOA 3DLEA 1DTQB 3N6NA 1DLOA 4ZVFA 3NCIA 3MEDA 2Z1GA 3LALA 3I0SA 1BCOA 4L8RB 5DLGA 1BHLA 5DGAA 2C28A 3PO4A 1RT7B 4ICLA 4FBTA 3HP9A 3KK1A 2YNHB 3HYFA 4Q8FA 4ED2A 2UVUA 2E6MA 2ILZA 3N6LA 3H98A 3KLIA 3UQSA 1VSKA 5L1LA 4IRCA 2FJVA 2IM0A 3NH0A 3UR0A 5KFEA 4MK9A 4CEBA 4KV8B 3RMBA 1S10A 4KRFA 4E7HA 1BI4B 2UVWA 4IH6A 5I42A 4FW1A 4CERA 5K14B 3OHBA 1QSSA 5F9LA 4J9OA 4RNNA 3ZT0A 1L3UA 1HMVB 3D45A 4NLSA 3QIPA 4TXSA 3U6FA 3RR8A 3RB4A 1HRHA 4DLGA 4IDKA 3NAHA 1NJWA 3L2UA 3BGRB 4FVMA 4NLUA 3KJVA 4DL2A 4FM0A 4CGJA 4Y2AA 1XI1A 2GIQA 4NLOA 1J5OB 2LSNA 4GC6A 4DQIA 1WSEA 1QSYA 4RW6A 3T3FA 3NF6A 3NH2A 3DLRA 3TWHA 4GC7A 3AO1A 4DTOA 4CJ4A 3PX4A 5T7BA 4IFVA 1RBTA 2DFEA 2HHUA 4K4SA 3O3GA 1BQMB 4F8RA 2HNYA 3PX0A 3DOLB 1RBVA 1UOCA 1ZETA 4CEOA 2D0CA 2ITGA 4CJKA 1T03A 1DTTA 4CGFA 4ZPCA 4J9LA 3QGHA 4O0IA 2FJWA 2YNIA 4IH7A 1GOBA 4WFZA 3RTVA 4B3OB 1JXLA 4CF2A 4EBEA 3PR5B 1RNHA 4PQUB 1U48A 3IGNA 4NLYA 2B4JA 4DTNA 2NUBA 1CZBA 2D0AA 4JRPA 3CG7A 1KVCA 4KE5A 3T5KA 2YNIB 4CESA 2OPPA 1RT6A 2HWIA 4NZ0A 4DTXA 1YVUA 3PW4A 2OPQA 3SQ2A 5KFSA 4ZVEA 3H4DA 1GX5A 2HHTA 4OPKA 2XY7A 3LANA 1JLAB 2JC0A 4CJLA 3LP2A 2DTUA 4FW2A 3ZT4A 3IS9B 3QINA 4O3PA 3TR8A 3AO4A 3PJWA 1WSIA 2P5OA 1YVFA 5L9XA 4IOBA 3K5LA 4BE1A 4EEYA 1N48A 1BIZA 4QWAA 3OS0A 4F2SA 1RTIA 3BJYA 3DLKB 4OKEA 2OH2A 5DLFA 2IMWP 4ZP7A 1N6QB 3F9KA 3V1QA 3T5LA 2W9BB 3K57A 4KREA 1S97A 5KT6A 4HUEA 3RRGA 3ITHA 1XHXA 3G86A 4ELVA 4Z4IA 5KFYA 4I9QA 3BGRA 3BSNA 4Z4EA 2UVVA 1TKTB 2XCAA 4FM2A 2VG5B 2DFFA 3ZSZA 1BQMA 1TKXB 2GIRA 2R8HA 3I0RB 3Q8SB 4YR3A 4CECA 5DG8A 1L3TA 1VRTB 2P5GA 3CJ5A 2B5JB 3DRSB 3HJFA 1BI4A 3SZ2A 3MR5A 3QNNA 4J2AA 2Z1JA 3BSAA 1CZ9A 3G0ZA 2HMIB 4ED0A 1SH3A 3CJ4A 2JEGA 3WNGA 3AVJA 2B43A 1WSHA 2BDPA 2XHBA 5HROA 3M9NB 4K4VA 5D3GA 3V4IA 2QKKA 1ZBFA 4MK8A 4I7FB 1L5UA 4QW8A 4QWBA 4J9QA 3TAQA 4FZXC 4AH9A 4ICLB 2IGIA 4DFJA 2BE2A 4R8UA 3I0SB 4XPEA 4ID1A 1EKEA 3OHAA 3I8DA 3SV4A 4B8AB 4WE1A 1U49A 5CYMA 3NAIA 1QQCA 3C94A 1TK8A 1T94A 5EWEA 4LH4A 5K14A 4URSA 2C2RA 3GIIA 3ZSRA 4CJFA 3VQ8A 2XWYA 1JLEB 1NKEA 3RBDA 2G8HA 1RTDA 1S48A 2HHWA 3SPZA 5KG2A 1HJRA 1SKWA 4CEEA 4J9RA 4Q8EA 4F3TA 1S49A 5DG9A 4F4XA 2RKIA 3O4NA 3PJXA 3CO9A 5HP1A 5KFOA 4DSFA 1KHWA 3NHGA 4ZTFA 2BGGA 1RT1A 4ED6A 5EDWA 1RT7A 3M8PB 3VQ9A 2AGPA 4HTUA 4DL7A 1U09A 4H54A 1U47A 4DFMA 4FBUA 1C1AA 3ZCMA 5FDLB 2Z1HA 5HRRA 3AVBA 1S1XB 3SNNA 3MXJA 2F8EX 1ZBIA 3ZT2A 3EY1A 4O3NA 1Z4UA 4FS1A 4MQ3A 4DF4A 3OSNA 4DTSA 1S0MA 2HWHA 5KFBA 4EZ9A 4RW7A 1Z25A 4Q0BA 1UA0A 1RTJA 2I1RA 3GV7B 1R0AA 3CM5A 2WONA 3ZSWA 4OKJA 1KLMB 2KZMA 4H4OA 1L3VA 3NGIA 3OLAA 2JGUA 4ZPBA 1NK0A 4WZMA 4JV2A 4RW8B 3OYHA 5KG4A 2O4GA 3TAPA 1S4FA 4AILC 3DM2B 3AVLA 5J2NB 3IAYA 4B9MA 5FDLA 2BQ3A 2KFZA 2FBYA 3V6JA 2C2DA 1HNIA 5KFGA 4CEDA 2OZMA 3KKRA 4LSNB 3CDUA 3C6UA 3HXMA 1RBSA 2BE2B 4OGCA 2F8SA 4URQU 1RT1B 4DQQA 2A1RA 4I7FA 1RA6A 2D5RA 2GBZA 2HAIA 5C24A 3LAKA 1C1CB 2KZZA 4CGHA 3V4IB 2BANA 1NOYA 3ISNC 5KFDA 1SUQB 3VA3A 3N6MA 1UA1A 1UWBA 3NDKA 3V6DA 3CJ3A 4OKKA 1TAQA 3V9WA 3SI6A 2QV6A 1B92A 4E3SA 3KLVA 3V81B 3KMSA 3PVXA 3GIJA 3KLFB 4GMJB 4O0JA 4CJTA 3V9SA 1RT4A 4I9LA 3KHLA 4KHMA 3V9ZA 1TKTA 3IRXA 3KHGA 3C6TA 1TK0A 4FJJA 3T19A 1RT2B 3TAMB 1VSDA 2QKBA 4DQPA 2HNDB 4F3OA 1NK4A 3MXMA 3DOKB 4K4UA 3AVIA 4KBIA 1JLFB 2X74A 2HMIA 1A5XA 4CCHA 1RTIB 4TY8A 3T5JA 3ZSYA 4KKOA 4KAIA 4EBDA 5KFLA 1SL1A 2W9AA 2E9RX 1BQNB 2R7YA 3QEXA 2B5JA 2FLPA 1S1TB 2ILYA 4FXDA 1VRTA 2IC3A 3KKSA 5KT4A 3KTQA 4E7LA 3HVTA 1SH0A 1JLAA 5KFCA 2YKNB 3K5NA 1Q9YA 2KW4A 3OYEA 3OJUA 3L2QA 2XY6A 1N5YB 4K4XA 2WTFA 1C0TB 3RB0A 3I5CA 2OPRB 4OGEA 3FFIB 1RT6B 1TL1A 1D1UA 2D41A 4ECYA 3QZ7A 2W9BA 1HNVA 4M3ZA 4PQUA 3D28A 1N6QA 3H59A 1TQLA 4F4WA 4Q44A 4FJLA 4RZRA 1S1WA 1BIUA 1TKZA 1NOZA 4B3OA 2O5DA 1S6QA 1RILA 3FRZA 1T05B 1RTHA 2WCXA 3MTKA 5CYQB 4Q45A 4YP3A 1WSGA 4CK3A 5KFJA 1DTTB 1N5YA 3QERA 1C2PA 2R8JA 3AVFA 2RPIA 3LPTA 1YTUA 3DOLA 4NLDA 5HRPA 5DG7A 5C42B 3OYLA 1C1BA 4TY9A 3SUQA 4NLTA 4NLRA 4IFYB 2AWZA 2FBXA 4B8CA 3HK2A 3V6KA 1JLFA 3RAQA 4K4YA 1ZBLA 1HPZA 4IRKA 1J5OA 1SL0A 3BQ1A 3G6VA 2E6LA 3QLHB 5EWGA 2P51A 4C8OA 1F21A 1FKOB 4H4MB 3MR2A 3HPGA 4CJRA 3ZT3A 4E7KA 3CDWA 1T03B 3HVRA 1NJYA 5KG7A 2RDJA 2ZD1B 3O3HA 3OYFA 2RF2B 4MFBB 4C8KA 3CJ0A 4FJ8A 1EP4B 3KLGB 3H08A 1S1UB 3KLFA 4CFDA 4M3XA 1JLQA 3V81A 3KK3B 3AVNA 3ZSQA 5L1JA 4KSEB 1S0OA 2GUIA 4RW9B 3EPGA 4BE0A 4G3IA 2PY5A 2AQ4A 1J9AA 4K50A 2UUTA 2IM2A 3KLEB 1S0NA 5KGWA 3V6DB 5C5JA 1RCHA 1U45A 5EWFA 2RDIA 3QYYA 1BCMA 3LP1A 1U4BA 1VSJA 1XWLA 4DSLA 3AA5X 4C8MA 4K4WA 1RT3B 4CF0A 1GX6A 2OA8A 4FLTA 3NBPB 5KFIA 3E01A 1WAJA 3TVKA 3M9MB 3NBPA 2R2RA 4EO6A 4HCCA 1RT3A 4J2BA 4ED1A 3WNEA 1C1CA 2FVPA 4CFAA 4DL5A 1QTMA 4CK1A 1VRUB 2VA2A 4MKBA 4ED7A 3OYMA 1SKRA 1LWCB 1LW0A 3CWJA 4DTJA 4CJUA 4KPYA 1DTQA 2OPSB 4ECXA 1XR7A 4NCBA 5F8JA 3I5AA 2RF2A 4ZP9A 3M8QA 3G6YA 1S6PA 3VQ5A 3P5JA 3OVNA 1KVBA 1C0UB 1JL2A 4HKQA 1RDDA 4RNHA 4W5QA 3NAEA 4OPJA 1MU2A 3QGIA 4RUAA 2CJQA 5KG1A 3BQ2A 1HYSA 4FJKA 4J9SA 3L2RA 3O3FA 3PW5A 3KLIB 4O44B 3HSTB 1BGXT 4O55A 4DTRA 4DTPA 3OYCA 1D0EA 2YNGA 1TL3A 2YNHA 4QCLA 1R0AB 4LQ3A 2HNZA 3PZPA 1RTJB 4B08A 1G15A 1C1BB 4Q0BB 1NJXA 1GOAA 4TN2A 4RW7B 1J54A 3UPFA 1SH2A 4KB7A 1DLOB 5J2QA 1VK0A 3HO1A 1S1XA 3K58A 2ATQA 3HL8A 3CYMA 3MFHA 5CYQA 4ECUA 1RTHB 3G6XA 2YHBA 3P83D 4IQXA 4IG3A 3M8PA 4FLWA 3CJ2A 2YNGB 4IH5A 1ZBHA 4CK2A 1WN7A 4RNOA 2DY4A 4GW6A 4M3UA 1JIHA 4B9UA 4O44A 3Q8QB 1C0TA 1D9FA 4FJGA 1LW2B 3V1OA 1UAXA 3DDKA 1HYSB 3OSPA 2UUWA 3O4QA 2BRKA 4ELTA 1NKBA 1FKPA 5I3UB 1ZYQA 2IM3A 1NJZA 1JLEA 3S3MA 1JKHA 3LWLA 3LZJA 2I5JA 3SUPA 3RAXA 3PX6A 4TYBA 3MXIA 1BQNA 3JYTA 4NCAA 4KKOB 4FYDA 4JV1A 1LWCA 3RRHA 4R8UB 1OS5A 4NRTA 4C8NA 3PUFA 1RDRA 2KQ2A 3KLHA 3EZ5A 3SCXA 4W5RA 4Z4CA 3H2LA 4I2QB 4J9MA 5D3GB 2W7OA 3OL6A 3TARA 1JLCA 1HARA 3BREA 3NL0A 3IRXB 2B6AA 3QETA 4CGIA 2AGQA 1D9DA 2X78A 4O3OA 4NYZA 3DRPA 3LP1B 3RR7A 2WB4A 4F4YA 2WOMB 4PY5A 3KK2A 4NCGB 1TVRA 3I5BA 4DU1A 1IKXA 2IAJA 1HQEA 3A2FA 5FRNA 1Q9XA 3I0RA 3H5UA 2DFHA 4JRQA 1EP4A 3BQ0A 5KG0A 2D0BA 4CGGA 4QWDA 2B6AB 2ZD1A 4TQRA 4URGA 4DL6A 1S9EB 3JSMA 3ITHB 4Z4HA 4FK4A 5KRTA 4H4MA 1FKOA 4HUFA 1X9WA 2GV9A 4E0DA 3MEEA 3DLGA 2HHSA 1EXQA 3PR4A 3NFAA 5KGXA 4O3RA 1HYZA 3VQCA 3NF8A 2XGPA 4O3QA 3C6UB 1KVAA 1KCFA 5J2PA 4O4GA 4CEQA 3JYTB 2IM1A 3KD5E 4IR9A 2IOCA 1LWFA 1I39A 1TAUA 2Y1JA 5J2NA 3DM2A 5EUHA 3MECA 3VQ6A 5C42A 3TABA 5F8HA 1QUVA 3EZUA 3LP2B 5J2MA 3U3YA 2IJNA 5KG6A 3OYKA 4Z4FA 4N76A 4RW8A 5SZTA 3KNAA 1VSMA 3SFGA 5CZ1A 4Y2CA 2IS3A 3E51A 4O5BA 4CEAA 4ID5B 4N41A 2G8KA 3PY8A 4OJRA 3B6OA 1NK7A 4O3SA 2R8GA 3WNHA 4WZQA 5KFMA 2W8LA 2VG7B 2AJQA 2FJXA 2FVSA 4W5OA 4W5NA 5JUMA 1HNVB 2R2UA 4IG3B 5CZ2A 3OL8A 4ZHRA 4CHOA 4E7IA 3MEGB 4MIAA 3GQCA 4FJ9A 1JX4A 4DTMA 3H5XA 4PWDB 3NE6A 3RMAA 2BRLA 5HBMA 5JXSA 3VQAA 1TK5A 1TV6B 1HQUB 4LD0A 4RW4B 3OYBA 3LP3A 2AX0A 5KFXA 4IKFA 1WLJA 1YTAA 3HVTB 4F50A 1LWEA 2ETJA 3CVKA 4M95A 4QOZB 3NGDA 2IC3B 1NHUA 2XY8A 1K1SA 1JLGA 1TL3B 2ZE2B 4KO0A 1CLQA 3QIOA 1NK8A 2QK9A 2RKIB 4CHPA 2JEFA 3SPYA 3VQDA 4TY8B 4IG0B 5KFUA 2HVHA 3ZSVA 4RW6B 1W25A 4G1QA 4CHYA 4Y34A 1RTDB 3UDLA 4ELUA 3RMCA 1C0UA 4DWIA 1L3SA 4KHYA 3QEPA 4J9PA 2AGOA 4K8XA 3MR3A 2OPSA 2HW3A 2XRIA 2EC0A 5HRSA 2XCPA 4CIEA 1MMLA 1C0MA 3AO5A 2ALZA 1WNEA 4FLYA 3THVA 3OYDA 1SV5A 3AVGA 1T8EA 3AVKA 1RYSA 2JC1A 4DSKA 4XPCA 4RUCA 5KG3A 3SQ1A 1RDBA 3AA3A 4DFKA 4E1NA 3RMDA 2BANB 4M94A 3S3NA 1S1VB 5C24B 2G8VA 4KO0B 3DRSA 2G8IA 2ZE2A 4J2DA 3KLEA 1FK9A 3PHEA 1JLGB 5L1IA 4F4KA 1ZTWA 4PA1A 1NNDA 3AVMA 5DK5A 1JLQB 4NLGA 5F8IA 4OVLA 2VG5A 2FVRA 1RA7A 3QEIA 3KLGA 3HPHA 2VWKA 4CJ5A 5KT2A 1TV6A 1Y97A 2EHGA 1I6JA 1JXBA 3V9XA 4PWDA 3B6PA 3NGZA 2VWJA 3RWUA 4FJXA 3IN5A 1X9MA 1KFSA 1ASVA 2EX3A 1O1WA 2PYLA 3S3OA 5KFKA 1CXQA 3TAEA 5KT7A 1ASWA 2VG6A 1CXUA 4MIBA 5SWMA 5C25B 4KI6A 4HCBA 3DLKA 3H5SA 1K6YA 4KTQA 2R2TA 4AHRA 4DU3A 3EYZA 4RG8A 4CJQA 1RBRA 4NLXA 4ECQA 3SI8A 4KAZA 2JLEA 4DLEA 4YNQA 4R0EA 2GC8A 4RW4A 3EPIA 4IKAA 3AV9A 4AHVA 4YMEA 4XO0A 5HBMB 3HHKA 3M9OB 4Y1CA 1LWFB 2OPPB 3SQ0A 1NK5A 4RNMA 3MEGA 2WRMA 1SL2A 3PW7A 3KD1E 5KFZA 3AA4A 4CF9A 1RT5B 5DGBA 1ITGA 4O4GB 4ED8A 3VQPA 1QAIA 1D5AA 4KTWA 3NGYA 5DQGA 3HPOA 5KFFA 3KHHA 4ECVA 5HLFB 3V9UA 1TL1B 3MEEB 5KG5A 3IG1A 1FXXA 3FFIA 1QHTA 3M8RA 3JSMB 1IO2A 1S9EA 4ID5A 2IDOA 4JS4A 3VA0A 2D7SA 4GVMA 4JS5A 2QE5A 3K5MA 4LSLB 2HB5A 4FJNA 1VSFA 2E9TA 2Q3SA 4PUOA 5DQHA 5L1KA 4BACA 1KSPA 4R5PB 5F8GA 4WYWA 3S9HA 2ZKUA 1S9GA 1X9SA 2J6SA 1QSLA 2XI2A 4IFVB 3T5HA 1K1QA 1TVRB 3KK2B 3LP0A 4CEFA 5J2PB 4FLZA 1D8YA 4MK7A 1REVB 3K59A 4KTZA 4FCYA 5KFNA 3SFUA 4FK0A 5KI6A 3MFIA 3TQ1A 1W9HA 1T7PA 4DS5A 1RT2A 3Q8RB 4I2QA 3AVCA 3ASMA 5HROB 1B9FA 2X6SA 1NHVA 1IG9A 4DSJA 1IM4A 1Z26A 4TQSA 1REVA 5KFTA 1IKVB 2BR0A 3LP0B 2D3UA 1EETA 3VQSA 3TANA 3BSCA 2OYQA 5T14A 4DQRA 1EETB 4IR1A 2I5JB 3HVAA 3P1GA 1TKXA 1JKHB 3HKWA 4EO8A 3IGVA 4NLPA 1IKVA 3SYZA 1RYRA 2OZSA 1FKPB 3OYIA 4CIFA 1N4LA 4O4RA 1SUQA 4KHWA 3ZSOA 1CSJA 4KHQA 3QEWA 1LW2A 1IKYB 4W5TA 4WXOA 3DI6A 3CM6A 4LY7A 2YNFB 4ECTA 3IG1B 3RB6A 3V6HA 3G10A 4DL3A 2ATLA 3QZ8A 3KLHB 3KK1B 1TKDA 5KFRA 4IRDA 2Y1IA 4KHNA 4U6PA 3NF7A 3U3GA 4K8ZA 2V4QA 1I3AA 1A5WA 4J9KA 3DYAB 1XC9A 3OYGA 3IS9A 4NYFA 3CIZA 3D5MA 2XGQA 2VA3A 3H40A 1BISA 3ZSXA 5I3UA 5DQIA 4LSLA 4AHUA 1WSFA 3GIMA 1KTQA 4JV0A 4WYLA 1RDCA 2OPQB 3PV8A 3CDEA 4WFXA 3KMQA 1U04A 3GV8B 5HLFA 4BE2A 4E7JA 3L8BA 1TGOA 3VQQA 1ASUA 5JS2A 5C25A 1ZTTA 1RT5A 5KFPA 4KB0A 4M3WA 2G8FA 3QO9A 2D3ZA 1T3NA 2V0NA 3LDSA 2V4RA 4FLXA 4BDPA 1QE1B 3DMJA 3FQLA 3OLBA 4K4ZA 4BDYA 4CHNA 1W0HA 2HHVA 4J9NA 3WNFA 1SKSA 5KFVA 3HVWA 3KOAA 1KFDA 2V9WA 1RAJA 3C95A 4NRUA 4CIGA 3NF9A 3HT3A 2ASLA 4OL8A 3FQKA 3PW2A 4ZP6A 1FK9B 3AO2A 1VRUA 1S9FA 2YKMA 5HP1B 3KHRA 4ZP8A 4FZYA 4E1MA 1NK6A 4DSEA 2O4IA 4NLVA 3GV5B 4C8LA 1LAWA 2C2EA 1MU2B 3OL7A 2FBVA 4I2PA 3KJVB 4EYHB 2PZSA 4B9VA 4UQGA 4QPXA 1VSLA 1S6PB 4FJHA 4IDKB 3OYJA 2FC0A 4KB1A 4RW9A 3HM9A 4DF8A 4TYAA 1QAJA 1KLNA 4WXWA 5CYMB 4WE1B 3ISND 3UIQA 3RBEA 3OY9A 4ECWA 1LW0B 1S1UA 3L2WA 4CJVA 4X2BA
chains in the Genus database with same CATH superfamily
2A3ZA 1RBUA 1TYQB 5HQLA 4DU4A 5I42B 3MX2A 2O8CB 3FSXA 5BPNA 4JYAJ 1FJGF 2WK4A 4AHSA 4KV8A 1CEZA 3FCVA 5B0FA 1HPZB 2DPJA 3OL9A 3D4JA 4WFAQ 2QI2A 3AGKA 4KHUA 4LRCA 1IBCB 3MMAB 4A57A 1N36J 4IFYA 4KGVB 4CZJA 1VRQC 1YRUA 2WBNA 3T1HF 4GV9A 4QU6A 4V19X 2F5GA 4V19S 5F9NA 3WXLA 4ED3A 4CBXA 2YJFA 2P9NA 3PFEA 4J7CA 4B9LA 4WWSA 3H4BA 3LZIA 1H2UX 3KJFB 2IRXA 1F5BA 3J7AN 4IJNA 1IH7A 4ISFA 3GYNA 3MWTA 4ECRA 1NGEA 3MMBB 4FWKA 3SJJA 2E2QA 4BY9C 4AHCA 2BUPA 1XNRF 3IAS9 1T05A 2ROGA 1NSPA 2FBTA 4WU3A 1VQON 1T9UA 4DUYJ 2XY5A 2DHGA 4IZ9A 3CPWM 4RCHA 1KDNA 3RUBL 3FGUA 4WF9Q 1K44A 3MHYA 1YJWN 2P9IB 2I6WA 4FKXA 1OKJA 5FPMA 4DU8A 3C14A 4JK7A 3A8YA 5IM0B 3ZZZA 3ULDA 1NHKL 2HRYA 4P7TA 2MZTA 3UCGA 3VF6A 3MAAA 3SJHA 1S5JA 4NLQA 1WC3A 1GMWA 3BR9A 3OTOF 5L39A 2HRTA 1U6BA 3V1RA 5F8MA 3LGNA 4EFHA 3BGFA 4A61A 4XIUA 3H5YA 1XMQK 4QS8A 4UZBA 2CPDA 2RS8A 5HJYA 3NGRA 2HHXA 3OFEA 4KHRA 4DTUA 2MZQA 4AE5A 3TAMA 3ZZYA 1JXEA 2QWMA 1PJ5A 4CJ3A 2C3OA 1WI8A 4NYPA 4QQBA 4ZJLA 4CZHA 3QNOA 1Q86T 4H8KA 4LFCF 4FL9A 2CNNB 3KDOA 1PIEA 4XTTA 4FF4A 1Q8IA 1UVIA 2DKOB 1IN0A 4FOEA 4TU9A 4ES3A 2FLLA 5BYSA 4MKAA 3RU0A 3R97A 4M3RA 2XTJP 4OIXA 1RXOB 4M3YA 4NLWA 2C22A 3DJCA 4DG1A 4M42A 1IKXB 1P1LA 3BDPA 5A8KB 3FK4A 8RUCA 3DRPB 1FTRA 1K9MT 4KH6A 4FPIA 2G8UA 1EHWA 3HZGA 2FLNA 2P1JA 3SSSA 3DLGB 4GRSA 2IRYA 2D9OA 3AY9A 3D6TB 3J80O 3CE8A 2J8AA 2CPXA 3WQUA 4Y2MA 1Q82O 5GADP 4N5SA 2ZBIA 1XR5A 2O8FA 4BLGA 4EZ6A 1QS4A 2XMWA 1Z6RA 3QIPB 2JHEA 4FXVA 1IM6A 4KJIA 1X1PA 3CC4N 4Z0UA 2WZ1A 2JJ4D 5KT5A 2RU9A 5FRMA 2A40A 3T1AA 1Q4RA 2X3DA 2WOMA 1T9WA 1G1XA 1VQPN 3K2PA 2VDIA 1X4GA 1UWBB 3NMAA 4F2RA 2OO4A 1X8DA 4BWMA 3MN9A 4FO0A 5KRSA 4FJIA 1KLMA 2HOEA 4YR2A 3GZ7A 3GCWP 4YB7A 2D4WA 3U1NA 3EMTA 1YF5L 2NZTA 2AU0A 3JXUA 5KFHA 4DV1J 3JXOA 4Y3CA 4AHTA 4BGBA 1P6TA 3CUNA 4BRGA 2QTWA 3K17A 4LSNA 3SXLA 3AO3A 2R8KA 1V3RA 1X4FA 3PIOQ 2W41A 4DR5F 2QGFB 2HFUA 1RKIA 4DSIA 1WEXA 3GJQB 4CGDA 5D4PA 3OYNA 2AV5A 4CE9A 3A4TA 3ICLA 4H4KC 2CAJA 4F3QA 3KUGA 2VH7A 4JI6K 3W2VA 4LT6A 3FDSA 2A1SA 2ASJA 4OLAA 4CDIA 1NPKA 3DU5A 3LPUA 4C3MA 1VLOA 2MLYA 1YQHA 2FHMA 1H0HB 2BQRA 2FVQA 2VG6B 2JSXA 3VWSA 4WIQA 1WC5A 4ECZA 4USJC 3W2VB 3IKMA 3DLHA 5KT3A 3ZTRA 5HK4A 1F9HA 3W5YA 1X9JA 1JJ4A 3SUOA 1TZ0A 5L38A 2GQCA 4OYAA 5GAEP 2Z1GA 1DARA 3I0SA 5CHCB 1QQNA 1BHLA 4ICLA 4FBTA 1U24A 3KK1A 1DQ8A 3HYFA 4GNIA 3RGIA 2XYPB 2UVUA 4IO9L 1IJJA 2E6MA 1BWVA 3H98A 2OD4A 2R7QA 4CEBA 4IO9Q 4KV8B 4QIVA 5A8RB 5AE1A 2R7UA 4KRFA 1RHRB 4EI2A 1BI4B 2UVWA 1SB6A 2DIUA 1OO0B 4NXNK 3QSYB 3IFRA 2A1BA 4J9OA 5DDOC 4JI7J 3S7RA 2EFQA 3QIPA 3CJSA 2IYIA 1HRHA 3FCWA 4CP5A 2VGMA 3L2UA 3BGRB 1A6LA 4BG9A 4FM0A 4YOYA 4FP9A 4ZVSB 3C7NA 4LF4K 4MT1A 1XI1A 2GIQA 4NLOA 2CG4A 2IIHA 4Y28C 5KOXA 4DQIA 2HBJA 2I38A 2BJ3A 3EEQA 3T3FA 3NF6A 3TWHA 4GC7A 4USVA 2B8PA 2DNHA 5BXIA 4CJ4A 1UEUA 5HSPA 4UUXA 4OZ1A 5LJWA 1OWXA 4K4SA 2HNYA 1YHQS 1UOCA 1ZETA 1OH6A 4DR2F 1YSJA 1T03A 1DTTA 2DR9A 4PL7A 4DV6J 4O0IA 4OX9J 2DR6A 3M32B 4YB1P 1GOBA 4WFZA 3CC4S 3HMJG 4ZPVR 1WI6A 5E3AA 1FW6A 2ADCA 3O8MA 2YWHA 3T6JA 2D0AA 4JRPA 3M7VA 3D6HB 1M5KC 3M32A 3W9IA 4CESA 3UD3P 4DTXA 4NZ0A 2UP1A 2OPQA 3UFCX 5T7LB 2YCHA 2DXDA 2FC8A 6AT1B 1GX5A 5BJRA 3H6EA 2OSRA 4CYUB 2XY7A 3EKUA 3UE2A 1JLAB 3WXMB 2VFSA 2V2KA 4CJLA 4JI0K 2DTUA 4FW2A 3ZT4A 1GMWD 5A2QU 2BKOA 1X4CA 5L9XA 2IJRA 1WC4A 3D3BJ 4EEYA 1FJGJ 3LW5C 2JFKA 3TX8A 1BIZA 2WUSA 5E5NA 2OHDA 1C0FA 3JQMA 4DR7J 4LF8J 4TLQA 5D77A 1HBNB 2FY1A 3K57A 4Z37A 3ATUA 3VAHA 4Y0FA 2VOPA 4ELVA 2NCKL 1T95A 1OIAA 1RAHB 3BSNA 1TKTB 2XCAA 4X65F 2POKA 2QYCA 4QBUA 2VG5B 2DFFA 1TKXB 2GIRA 4KYZA 1HWLA 2P9NB 3T1YJ 5DG8A 1R8CA 1IWAA 2P5GA 3MM6A 1UFKA 3MR5A 3M30A 2P9EA 1CZ9A 3G0ZA 4Y6IA 1NJIT 2HMIB 3WNGA 2K06A 4O5FA 3N5FA 1KTVA 1HJOA 3M9NB 4K4VA 5D3GA 1N36K 1PBUA 1ZBFA 2UZAA 5IT4A 4B1XB 4I7FB 1L5UA 4J9QA 4QWBA 3RW7A 4ICLB 2MQQA 2BE2A 5M1QA 3OHAA 1SC6A 4WE1A 1NEEA 1RJJA 5CYMA 4GKKJ 1TK8A 4OV1A 3OR2A 3DXMA 5K14A 4ILJA 2V4JB 1BWEA 3ZSRA 2L9WA 4J37A 3RBDA 1UETA 1MG7A 1S48A 1FNMA 1CS4B 3C19A 3L7PA 3ZFVA 4CEEA 4LIRA 1NWKA 3GIRA 2LQ5A 3KDNA 4YUDA 3PJXA 4DSFA 2A2CA 3WBZA 3NHGA 4DHYA 1RWKB 2C3PA 3M8PB 4W4MA 4DL7A 1PG5B 1WHYA 3LQVA 3LDNA 3VVTA 1X31C 1IBMF 2CA9A 2GS8A 2W2QP 3FGVA 1VJWA 1ZBIA 3ZT2A 4NXNF 1Z4UA 4NWBA 5JVHL 5H9FJ 2ACYA 3CCMS 3CXCM 4OX8A 3BGOP 4KH0B 3CM5A 1WSVA 2GGPA 2UU9K 4MJKA 1PYSB 3DLJA 4ILHA 2GJFA 3J7A1 4YDUC 3BF1A 4WIIA 4ZDNA 1HBOA 1HHTP 1VQLN 1PAUB 4ZPBA 3WIUA 3M6UA 1UVLA 4RW8B 3OYHA 2XEXA 5KG4A 2YX1A 3TAPA 1B3TA 5JVGQ 4LFAF 3DM2B 5J2NB 4B9MA 2F4FA 3TUIC 2F65A 3UKRB 2ALYB 1I3OB 1RHUB 5G0RB 3CJKA 3M2VA 4PL8A 4DV0F 2VC1A 4DQQA 3R8EA 2OTJS 2HAIA 5CYJA 2BVZA 1WSRA 2M2BA 3W5XA 4JI4F 3V4IB 3CGIA 1NOYA 4P6QA 2ZJQQ 1U0HB 4M5NA 1TR0A 3KWMA 1YAGA 2H5IB 2NXUA 2MQPA 3D9BA 5MAOA 4WFBL 4P73A 5LL6d 3ZETB 3IXQA 4DR4K 3GFYA 1Y64A 4U8YA 3V9WA 1N33J 3KZBA 3V81B 3ZX2A 3OT9A 3W8GA 3KLFB 2D3OR 4KQZA 4GKJK 2IRUA 3KHLA 3A8KA 4KHMA 1MWYA 1C4AA 5L9NA 5HVFA 1RT2B 3TAMB 1EARA 3NVKA 3UD5A 2HNDB 2B8QA 4ZLJA 3CCVN 1SIZA 4KBIA 4IYQA 2HKEA 2IVYA 2HMIA 4ZS6A 4TY8A 5KFLA 2W9AA 3QAEA 2R7YA 1W97L 4WKRA 5IT9O 1S1TB 4FXDA 3W7BA 3IUCA 4LREA 3EZWA 3VGKA 1U1PA 4JKDA 1RBAA 4ZIVA 4K4XA 1XMOK 2KG1A 3ILJA 2UXDJ 1QAYA 4HT5A 5JLHA 1TL1A 3QATA 4KGXB 1D1UA 2MGZA 1HBNA 4PQUA 1NRKA 3B54A 2XS5A 4Q44A 2E1PA 2MKYA 4WTOB 4K8RA 2GWKA 3AD7C 1EQMA 1VQ5S 3MTKA 4DJBA 1ZXOA 2E7VA 4TNOA 4JI7F 5HAOA 1VQOS 4YS2A 5C42B 3FZBA 4C0OC 2H4YB 4NYOA 3W61A 2BTFA 3MPDA 4IFYB 4QZVB 2FYXA 5DDQC 2AEMA 3GR1A 5D78A 1ZBLA 1HPZA 4IRKA 1UVMA 3G6VA 2E6LA 2P51A 4H4MB 4DUZK 4B1YB 2MKJA 3CCMN 1BG3A 3J7AP 4CJRA 1NJYA 3HVRA 2FIUA 3I33A 4MFBB 3CD5A 3CJAA 4P10A 3P6YC 1LFPA 4CFDA 3V81A 3A5LC 4A8KA 4QIWD 2HGMA 1S0OA 4RW9B 4BE0A 1J9AA 2RU3A 2ZM6K 1RCHA 1U45A 2O8BA 4ED5A 2RDIA 3QYYA 2ZUGA 3U9DA 3LP1A 3FLCO 1XWLA 3LDQA 4K4WA 3LPYA 2JWLA 2MZRA 4OYZA 1NM1A 1EO1A 3NBPB 5KFIA 4ETZA 1WAJA 3TVKA 8ATCB 1KD1O 3NBPA 2R2RA 4HCCA 4ED1A 1CJVA 1WF1A 5GADU 4DL5A 1CQMA 5K8MA 5CCMA 2PEHA 3QT8A 4C8YA 3BH7B 3TJAA 1RDWX 4ED7A 5ETTA 4E98A 4P2FA 3CJKB 4DTJA 2FD2A 4KPYA 1DTQA 3ETMA 4BR4A 3ZZRA 2V8VA 4DUYK 2F9JA 3QJJA 1NGFA 5F8JA 5AQSA 4X84A 4ZP9A 4D3GA 3M8QA 4AL5A 3P5JA 3A5OC 1QTNB 1KVBA 3NCRA 1RDDA 5AQGA 3HSGA 4W5QA 3NAEA 4NL5A 4ALZA 1RBOB 1FRJA 1GXTA 2BJ9A 2Q43A 3BQ2A 3R2CJ 3FMBA 4B3TK 1UP1A 3KLIB 3IBCB 2CG8A 1WF2A 4EK2A 4DMZA 1YRXA 1M5OC 2YNHA 4LQ3A 2HNZA 1RTJB 1FTCA 1FCAA 4RW7B 3NOGA 4P2SA 1RGIA 2CPHA 4XH5A 4CZCA 5J2QA 2E5HA 2FZKB 2HHHJ 4CW7B 3K58A 3CYMA 3EVMA 1LNQA 3JQKA 3CMAS 4PABA 1RTHB 1DURA 2FLOA 3P83D 4IQXA 4IG3A 4I6MA 2E1YA 3M8PA 4DPTA 2Q36A 3GCXP 2QA4N 2YNGB 4AFFA 4JP8A 4RNOA 4GW6A 1WACA 3OTDA 3K8WA 1LW2B 3OTEA 1HYSB 2UUWA 2YWKA 2VZ9A 2BRKA 1FKPA 5I3UB 4USHA 4H5RA 1RTZA 2K1RB 2RILA 4JI5J 2Y1LB 3SUPA 3ELHA 2XMMA 3TA1A 1YWXA 2VD3A 3MXIA 3CIMA 4O8UA 4KKOB 1RFQA 4NRTA 4C8NA 3PUFA 3FCHA 2DNKA 4A8QA 4ID8A 1R0CB 4X62F 4K0KJ 3CCQS 3FZLA 3H2LA 3UN2A 4I2QB 3QFPA 4YHHK 4DR5K 5D3GB 2NZ4A 1U1RA 3BREA 4BRAA 3TUJC 4C11A 1D9DA 4K43A 3VOVA 3G4SS 3IR6B 2CQCA 2QLXA 1S7IA 1N54B 1TVRA 3CD7A 3I5BA 2ZBCA 2IAJA 1S6UA 3GJSB 3DAWA 2YI1A 4X4UA 3H5UA 2NXJA 3Q7BA 2C2OB 2XO6A 1NZAA 1KD1T 1VQKS 2VF3A 4K25A 2WBRA 3UCUP 1QVFM 2F8MA 3GE1A 5AQHA 1VIOA 3JSMA 3P4UB 3QICA 4FK4A 5KRTA 4E0DA 3MEEA 1OH7A 4NB4A 2MKSA 1HYZA 3NGSA 1NGAA 4QYZK 3HI9A 2G0CA 3C6UB 3PYDA 1KVAA 2G2YA 3JYTB 2ZOFA 5AT1B 1T6CA 1LWFA 2CPIA 4USMA 4EHTA 1I39A 4F25A 5AFUH 3R6LB 4NXMF 5EX5A 3DM2A 5EUHA 3MECA 1QUVA 3R7SB 1HW8A 2IJNA 3SQOP 5KG6A 3GTYX 3CCTA 5H9FK 4RW8A 3KNAA 3IC1A 1VSMA 1VQ9S 2OUGA 3WC0A 5CZ1A 2IS3A 4ZOSA 4O5BA 4CEAA 4ID5B 4U7UD 4OJRA 4IEIA 5FPDA 2GVDB 1IR2A 1X3MA 4F4AA 5KFMA 2W8LA 4NO7A 2FJXA 2FVSA 2MQMA 3TX0A 3OTCA 2DNZA 2R2UA 5CZ2A 2ZWPA 3BEXA 1TL7A 4DV7F 2H5JB 3C3LA 2Z2YB 3C6HA 4BR2A 4FJ9A 4DTMA 1RAOA 3RMAA 3VQAA 2ROPA 3CMES 1TV6B 2AJ2A 4DL0C 3O9QA 1JJHA 3OYBA 3FBFA 3VVUA 5KFXA 3ULEB 1KONA 4F50A 2ETJA 4OZJA 3TVZA 4M95A 2YHXA 2IC3B 2QEXN 3EXCX 1K1SA 1NSQA 1MROA 3R5DA 2ZBPA 1TL3B 2H5EA 2DGQA 3DHWC 3P49B 4KO0A 3MDFA 1CLQA 2QK9A 4IQMA 4G1QA 4JI7K 2V8DA 2CXEA 4CHYA 2AD9A 4H0YB 2HFZA 3UDLA 5KPZA 1ZA2B 2HBQB 3LUYA 2LKZA 5KPRA 2W1BA 4J9PA 5IV3A 4DR4J 4N8NA 2OPSA 1HFEL 2VQFF 2EC0A 4CWBA 2JVRA 3CQYA 3AO5A 2ALZA 5EX3A 3THVA 1XQIA 4USWA 3ZEUB 3AVGA 4ZN1A 5LL6Z 3NS5A 3DN9A 4DSKA 4LF8F 4MDAA 1RDBA 4Z7CA 1HA1A 3AA3A 3ID8A 4YOVA 4YDXA 5C2FA 4DFKA 2BANB 3MURP 1S1VB 5C24B 3M30B 3NY0A 3I32A 2XSFA 5E0OA 1XJWB 3DRSA 4N8OA 2ZE2A 2EKYA 3MM6B 2ASOA 1FK9A 1JLGB 1ZTWA 4H0TB 2CNLB 3AVMA 1KXPA 4NLGA 1R8BA 3NLCA 1UVNA 3VCDA 1M1GA 1U1QA 3CJTA 2VWKA 3M6WA 3CERA 5BPLA 2EHGA 3D0HE 5F0UA 1U2RA 2HYIB 1CJKB 2IA0A 3IN5A 2XZTB 1KFSA 4ZLLA 1X9MA 1ASVA 2D0PA 4EWTA 2PYLA 3TTCA 2ZVSA 2VG6A 2BOAA 2RRBA 3NCQA 5SWMA 1BUXA 3H5SA 2VJVA 1K6YA 4DU3A 2JL9A 3WEEA 4LF1A 2GW8A 4LRFA 4P74A 5CHIA 4KAZA 2LQ8A 1KC8O 1Q7YO 3U4LA 2FJBB 1ZAVA 4KY3A 1YG0A 2VIHA 5AQLA 1UEVA 4USIA 2DR7A 4S0MA 4OI2A 1B0PA 4XO0A 3TYTA 1JCGA 1JJ2M 3SQ0A 4RNMA 1SL2A 4DPYA 2HSTA 3AA4A 3KJQB 5DGBA 1QAIA 4KR0B 3T41A 2HRUA 1D5AA 3ET6B 1Y7PA 4ECVA 2RRAA 5HLFB 4CLYA 5IZHA 2KDOA 3IG1A 4M63A 3G2XA 1SQGA 2LXFA 4ID5A 5HMZA 3K5MA 3MPWA 3I4HX 4ILMA 3MD1A 4FJNA 3MM7A 2E9TA 3H42A 2DGXA 2YQ1A 1GLBG 2DK2A 5F8GA 4WYWA 3W3DA 2YH0A 2OEMA 3AD8C 3BPDA 3N9UC 3T5HA 1U7LA 2KLAA 1ELOA 2ZH1A 4QIEA 3LP0A 3THPA 4QU7A 2IYGA 1N88A 4MK7A 1ZC6A 1E6YB 3KVGA 3SFUA 2DNQA 3HM8A 4FK0A 4JI0J 2VPWB 1VHIA 2CZ4A 2DNPA 4DS5A 1T7PA 3Q8RB 1KEKA 5CH7B 3CPEA 3QGPA 3UO0A 5B0DA 2X6SA 1B9FA 5E3RA 1E6YA 4I6WA 4B9QA 1Z26A 4JHDB 1V5IB 2GHVC 3MGJA 1IKVB 3M05A 3LP0B 2ADBA 2O66A 1EETA 3TANA 2XHCA 4WU2A 1QVGR 4DQRA 3PYFA 4QIFA 4F26A 1LXNA 3P1GA 3HKWA 4NLPA 4D3HA 1B70B 2OZSA 2OTLN 3PEHA 3GFXA 3QB0A 2HG4A 4CIFA 3ZSOA 2BACA 1IKYB 4B3TJ 4W5TA 1Y3JA 2M70A 1M0SA 3ILOA 3IG1B 2UUBJ 1NGGA 4JI3K 1HBUA 3RB6A 2XMAA 3QZ8A 5CXTA 2EBEA 3JAMY 2F4VJ 5KFRA 4IRDA 3D2EA 4M8LA 2E7WA 2FGCA 3HZEA 3CC7N 3GPAA 1YXQA 3CJ8A 4K8ZA 4LSZB 4ZPTR 3KKFA 4J9KA 1RAGB 3UI3A 1YBTA 1XC9A 4DCOB 4X65J 5D4LA 3IS9A 4NYFA 1ACMB 3CIZA 3KUHA 2FTRA 5I3UA 5AQVA 1M5SA 1RHKB 2RMLA 1WHWA 3B8HA 4B3SJ 3S6EA 2WAQD 3PYGA 1CPZA 4UY8O 3L8BA 2Q79A 2E20A 1BY9A 2KHDA 3THWB 5C12A 1BE4A 2CGKA 1ZTTA 1SS6A 1R8AA 4KB0A 1IBLF 1BOTO 2AA4A 1CJKA 1X60A 4EUVA 1MWKA 4ER8A 4FPBA 2V0NA 3W62A 4P72A 3MMBA 3DMJA 4BDYA 3OLBA 2VQEK 4PPDA 5KFVA 2FZGB 1T3VA 1H38A 2V9WA 2LA6A 1CJTB 3C95A 4CIGA 3HT3A 2EFPA 2UXCK 1PSDA 3KHRA 4ZP8A 3FJ2A 4FZYA 1NK6A 1U02A 4DSEA 1FI4A 4JI6J 4C8LA 1LAWA 1F3VA 2KXFA 4AYBD 1T9YA 1OYEA 4EYHB 3B8AX 4C98A 2Q0UA 3FBEA 4QPXA 5FLXO 4IDKB 4CNZA 1F60B 1XK8A 1VK8A 2DRAA 4LF5F 3VZIA 2ASPA 4MLHA 1S1UA 3OBIA 1IBMJ 4CJVA 2CQIA 1UVJA 5C7PA 3QEVA 4Z2XA 1YT3A 2HFNA 2V2ZA 2QO3A 1NH7A 2XSJB 4FJ7A 4FLVA 3J81O 4HHTA 2HHQA 4ZVQB 4Y2KA 2P9PB 1VQ8S 1GXUA 3E01B 1ATRA 4OV6A 2FF3B 2PT0A 4KGKA 3QFWA 3QIDA 3AAPA 4MH8A 2L48A 4K59A 3HP6A 2KU7A 3JAMU 1SV5B 2HVIA 3OS1A 2WHOA 1UMJA 5BREA 4DG1B 5ADZA 1RDUA 4WFNQ 4LRBA 2ZOGA 1ZA1B 2CJYB 1R3NA 3KG4A 3OFGA 2CQ4A 1IVZA 3D2FB 4LJMA 4I64A 1TUYA 4YOEA 1B9DA 3PCOB 2OMLA 2JEJA 3VQEA 3VEWA 4LF9F 1VR6A 1S0VA 4FWLA 1U25A 1MN7A 3QJPA 1S6QB 3SUNA 3QBCA 5CZVA 2VKRA 4AXIA 4CJEA 4EYIB 3LF0A 3C15B 1UAWA 2HLUA 1Z2LA 1VSIA 3D6RA 4C1NI 1B7YB 4M5KA 5JS1A 2OANA 4BRFA 4DEZA 5CD4A 1LWEB 1UWAA 1BL3A 1WKKA 3FZMA 3QGGA 2PA3A 1MA9B 5AQTA 4JI5F 3N0VA 4YHHJ 3DCAA 3DYAA 4DV5J 4JV5F 3VENA 1FRIA 3QNWB 1V5VA 3MWBA 3QT7A 4LQ9A 5AJ3K 1T3OA 2V67A 2KO1A 4IJAA 1KRPA 2PSZA 4DR1F 3Q8PB 4PR6A 2RIJA 1LV5A 5LXRA 2VG7A 1U8SA 5KFWA 2YNFA 3C6TB 5IWAK 1FDBA 2FJEB 5HMYA 2YKNA 1CBKA 1IKWA 5HATA 4OZ5A 4I68A 4AM7A 2A6MA 4QR1A 4MLEA 1A5VA 5CE3A 1B7FA 2NXCA 3HRGA 3LWMA 3PDNA 3PTWA 5GAHU 3AA2A 1X0FA 1DZ5A 2F40A 1Q16B 3NMRA 2NS1B 3CFPA 4DV3K 4J2EA 2R2SA 1Y00A 5B7WA 2YHAA 3CXCR 2HNDA 2UXDF 2CPEA 1FEEA 4EHUA 4Z94A 4OYIA 4FJMA 4ZVPB 3DRRB 4ZVGA 2DH9A 1KQSM 5A76A 4JD2A 4FJ5A 4KFBB 6FD1A 1HYVA 1JLBA 3OA9A 1HNIB 3BPSP 4PG6A 4U7UK 2LQBA 3W2WB 2OKQA 3C16B 3R9PA 1WOOA 1M5HA 3HJVA 3A5MC 1DFDA 4A48A 4CJSA 1IXKA 2EG2A 1UW9A 1UFWA 4NI2A 3EICA 3BN4A 5KQDA 4PUOB 4RLEA 5HRNA 3GJTB 3PKMA 3PACA 1KVKA 3VEXA 3LAMA 4EIAA 1NU4A 1SJ4P 4CFCA 3VAFA 1X5SA 1ZPWX 3I4PA 4DS4A 5M1KA 2H9ZA 3BM7A 2HLTA 2MJNA 2CJAA 5ETLA 1I51B 1U1KA 2E4LA 3CJBA 3M6GA 2DGVA 3M2VB 1WBBA 2AYEA 3DU6A 2D1CA 3I55S 1B0TA 3MF5A 3ZXWA 1EX4A 3DLEB 4LF5K 1KN6A 3OYAA 3TAGA 3SV3A 2KM8C 1AZSA 5JLFA 2WVDA 3VR1A 4KT0C 4WF9L 2OEJA 4CD3A 5E26A 1LOTB 1GMVA 1H3DA 4LVNP 1YJRA 2X6NA 3DC2A 4ZPAA 3PHTA 4FM1A 3ENWA 4NEYA 3N4WA 3VQBA 1KHVA 3BSOA 3GILA 3UWTA 2JH3A 4LFBJ 1YJ7A 5J1EA 3G8SA 3AARA 3IWXA 1J53A 3ZT1A 3P4IA 2XHWA 3PRBA 2F9TA 2ASDA 3TZYA 3BZCA 3JS9A 2F8TA 3GFHA 5E41A 4YR0A 4TLRA 3QAUA 1B4SA 1Q82T 2DNNA 2DT9A 1RAAB 4BWJA 2W8KA 2CKWA 3KXDA 1LK5A 1UL3A 2W9CA 5AFUA 1MWQA 2BE9B 3N6NA 2HF4A 3GWCA 5A2QY 3MEDA 2B7CB 4L8RB 5DGAA 3CW2C 3HP9A 2Y1RI 3ILIA 3MAHA 4A5AA 2KKZA 4C1NK 4ED2A 3C6AA 4ERDA 2FB0A 2KJVA 5AXKA 5TKYA 2ILZA 1OQ6A 3MM9A 2NXNA 5L1LA 3SQGB 2IM0A 2IVNA 4IXCA 4NPOA 3RMBA 2UXBF 2HSEB 2ZUAA 4KPCA 4IH6A 3VMFB 2YHWA 3OHBA 1ULRA 1Y5NB 5LSRA 3BO2A 3D45A 1VQ4N 2EPIA 3TO8A 1B64A 2HWTA 4QYZJ 3U6FA 1XERA 2ROEA 2CNKB 2XLIA 2P9KB 3MMCA 5D8HB 4DUZF 4DLGA 4IDKA 2VFRA 2G1DA 4DV6K 4LR8A 1NJWA 1HNXF 2IPOB 3VAIA 4DL2A 2W4PA 3PFOA 1XQSC 1WG1A 1HQ2A 3GFZA 1J5OB 4GC6A 3AHPA 4RW6A 3DLRA 1Y3KA 3DNCA 2V9KA 1EB0A 3ZZUA 2ZJPQ 1RACB 1FDAA 3PM9A 4DTOA 3PX4A 1P9YA 4IFVA 1YJUA 1DBDA 3SBTA 4OJHA 4JKHA 1H98A 4Y65A 5RUBA 4OI3A 5JICA 3PX0A 3DOLB 4CEOA 2VUGA 2ZJRL 2V2QA 1VC0A 4M5HA 3MI7X 2D0CA 3H46O 2ITGA 4CJKA 4CGFA 2VFVA 4Y00A 3D66A 1W2IA 2MSTA 4KC5A 2FJWA 3RTVA 4BRNA 4BRIA 3AAQA 1R31A 2O8EB 4X62J 4K0KF 4PQUB 1TUGB 2IVFB 2CPFA 2B4JA 3DLLL 3T5KA 2YNIB 4AQYF 3SQ2A 4LC9B 4JEPA 2KRRA 1SIWB 2XZDB 4UF4A 3CI5A 2YJEA 4A59A 1UPMB 3LP2A 3IS9B 3DDNA 4O3PA 3TR8A 1XIQA 2GX8A 3PJWA 4IOBA 3CCRS 1OJ4A 4H5NA 1I94K 1S7HA 2MMYA 1YZ6A 2W40A 4QWAA 3L0QA 2R7SA 3DLKB 1X5OA 2OH2A 4CO1A 4ZP7A 4BG8A 1N6QB 3P8BB 1HI1A 3F9KA 2NPIA 2DTJA 1S97A 5KT6A 4PXEA 2YH1A 1SXLA 5ETPA 3RRGA 4LFBF 1CULB 4OYPA 1I1GA 1XHXA 3G86A 3ZTOA 3NVMA 3W0LA 2ZC4A 1N32J 5GVQA 2VWBA 2RJZA 3D1HA 4CM0A 2ZWOA 3I96A 3THXA 3SDEB 3I0RB 3SMSA 4CECA 1VRTB 4CZGA 5GMDA 4CLKA 1Q95G 4ITSA 4X64J 2BKNA 4DR3F 4FWSA 4C2MA 3CJ4A 4Y2IA 3AVJA 2PDAA 2UUAJ 2B43A 3PKYA 3SAGA 2XHBA 2HFVA 3V4IA 4F7VA 1XNRK 1VDHA 2O1PA 4FZXC 4FOIA 1S72S 2IGIA 5BR8J 4R8UA 3FEYB 4DV7K 3SV4A 3H25A 1U49A 2XLKA 4B3SK 4U67L 1X4HA 4ILRA 1S76D 3C94A 3LL3A 1EKSA 3UKRA 4LH4A 2MLZA 4R25A 3RYLA 3D1QA 2FJDB 3GIIA 1HX1A 5DETA 4CJFA 5K20B 2IDLA 2LMIA 1VBZA 2E7XA 2VDHA 1YLXA 3O9TA 2R3VA 2G8HA 4OI6A 3HHNB 2HHWA 3SPZA 4HR2A 3MCAB 3SCLE 4J9RA 4Q8EA 2UXCF 1S49A 5DG9A 4F3TA 4OLOA 4F4XA 2RKIA 4CQ1A 3CO9A 4ZTFA 3E9OA 3VGVA 2DNLA 1H6KX 1RT7A 1S57A 4B3TF 2QC3A 4M7XA 4HDGA 2O8DB 1S72N 1WELA 2AGPA 2W2MP 3RSEB 5LY3A 4CZIA 2AEJA 2PC6A 4H54A 4DFMA 1VQ8N 2Z1HA 5HRRA 5GMKa 1D3WA 3EVOA 1TELA 4DV5K 3MXJA 4JAXA 4UY85 2LFVA 2VQFJ 1PBAA 4FS1A 4DTSA 4R0JA 2QA2A 1ZZFA 1AUSL 4EZ9A 5E33A 4UZCA 4Q0BA 4OYMA 1UA0A 2I1RA 4DV2K 3OBWA 1GNKA 2WONA 4WFNL 3ZSWA 4KHPF 3MOZA 4X66F 1YVNA 5MLCQ 2KZMA 4H4OA 4NX9A 3OLAA 4QOTA 2JGUA 2W01A 1NK0A 5HQ8A 5GADI 4JV2A 3BBCA 2CQ3A 1S4FA 4AILC 3DXSX 2D9PA 3GR0A 3AVLA 3IAYA 4WYBA 3R3TA 4HACA 5FDLA 3BDEA 3W64A 5A0YA 3P5BP 1VFJA 3RSEA 1UW4A 2VL1A 3KKRA 2MKIA 5AQFA 3CDUA 1RCOB 2CQPA 4OGCA 2OIHA 1FESA 1FKAF 3OW2M 4JD2B 2Q3PA 1NMDA 4I7FA 4HEA9 1RA6A 3K89A 2GBZA 5C24A 3THTA 2KZZA 3FFKB 3H1QA 1FFSB 2P5VA 1GMUA 1PJ7A 4GKJF 4KRWA 4ZCKA 1JCFA 1UWBA 1UVKA 4DXLA 3NDKA 1K8AT 4TKTA 5BN9A 2OMOA 1ICEB 3BV8A 3IRWP 1DQAA 3TSUA 3QMLA 1TAQA 1KKHA 1E3MA 2P6SA 2KH9A 1OQ3A 4GO5X 2ZF5O 3KLVA 3PVXA 3GIJA 4WJBA 4CJTA 2I0XA 1M1KT 3V9SA 1JMTA 3CPWR 4B02A 2V8HA 5MLCV 3EJMA 1TKTA 3UB5A 3C6TA 4FJJA 2X51A 2EK1A 4WBFA 3T19A 4IOAQ 5AJ3F 2VODA 1VSDA 3O80A 4QPTA 4P71A 3RZAA 3T69A 4ZVTB 3DOKB 1R7IA 4K4UA 2HGLA 3SCKE 1TFWA 4BC9A 1JLFB 4HHHA 5E3QA 4CH0S 3SAFA 4CCHA 1A5XA 1RTIB 1WKJA 2HGNA 4USUA 4F04B 5DS7A 1BQNB 3QEXA 2FLPA 2KYXA 1VRTA 3MEKA 1X7VA 2IC3A 3KKSA 2JNJA 4E7LA 1X4AA 3HVTA 3O6QA 3K5NA 1Q9YA 2KW4A 4U96A 2XG8A 3NWRA 3L2QA 1N33F 2XY6A 1N5YB 2EFOA 1O51A 5B08A 1W2BR 5T7LA 3I5CA 1OY9A 1RABB 2BKPA 2DNOA 4B1WB 3Q8VA 4N7TA 4ZKAA 1AW0A 2D41A 1VQNS 1N6QA 3VGLA 3H59A 3F5TA 4RTFD 4F4WA 3C8YA 3L4BC 1S1WA 2R42A 2V2VA 1BIUA 3FEZA 4B3OA 1S6QA 1RILA 3FRZA 5CYQB 4BREA 4YP3A 3GOIA 4CK3A 1HUXA 4LMZA 1NGHA 2FHKA 1C2PA 2RPIA 3LPTA 4DPXA 1SQEA 2ZGZA 4BC5A 1Q81O 3HLUA 1M90O 4NLDA 1LK7A 2PN6A 2MZJA 3PIOL 5DG7A 3SMZA 3G6EN 1A7GE 1RCXB 1XMBA 2Z0GA 3CCWA 1R89A 3IMXA 1WTFA 2Q66A 1IUJA 3NNHA 1VHXA 3V6KA 1JLFA 3CJCA 2XBPA 2V7ZA 3F9MA 1FRLA 4NXMK 2N3OA 2P9PA 2MY8A 5ELZA 3CD6N 3W3SA 1FE4A 3C2PA 2XSJA 3MR2A 2MQNA 3ZT3A 3CDWA 2FJAB 2RDJA 5IQQA 2RF2B 4C8KA 3CJ0A 3DXKB 3KLGB 2B56A 1WC6A 4JI5K 1H7WA 2BW2A 4DHVA 2VJUA 1JLQA 4CZFA 4KSEB 2W2OP 4GMKA 5AZJA 1VQMN 2PY5A 4WCEQ 2UUTA 3KLEB 3MM5A 2PD1A 2OELA 3GP9A 5EWFA 4A8YA 3AA5X 3WQPA 3OXLA 1RT3B 4CF0A 4FLTA 1UKUA 3M9MB 2K7KA 5ADXH 5E3PA 3WNEA 2FVPA 4H0XB 2QWNA 2AYBA 1KQKA 1X4BA 2VHGA 2ZH7A 1HHSA 3OYMA 2H51B 4CI6A 3CMAN 3RRKA 3N4PA 3PXGa 3KK7A 2RQ4A 3PIPQ 5A0YB 3GL1A 3H8YA 3EDRB 5I9EB 1HD1A 2FQQB 2RF2A 2OLWA 3OXGA 1KQGB 2N7YA 1JNRB 3VQ5A 3OVNA 1SPBP 4W92B 4RNHA 4OO1J 2DNMA 2CJQA 2BABA 4J9SA 2Q0RA 3L2RA 3CF5Q 2BJ7A 3PW5A 4CLUA 2BA9A 5AXNA 1YUWA 2CWXA 2J76E 4WQ4C 4JI3J 3OYCA 1D0EA 1Q7LB 1BU6O 2YNGA 2HBZB 4QCLA 1YJWS 4B08A 1C1BB 4Q0BB 1IBKK 1NJXA 4I67A 4PYDA 1J54A 1RWNB 4JI6F 2U1AA 1Q18A 4KB7A 1DLOB 2MTLA 4C0HA 5AZIB 4JKGA 1S1XA 5B0BA 4AL7A 2R7RA 3I9ZA 4UW2A 4DUTA 2X7IA 2V68A 1KS2A 3PSFA 3HZ6A 2NPFA 3PRVA 2KRBA 3G6XA 2A42A 3OPKA 3I56S 1BQXA 3A1YG 4FLWA 3CJ2A 1P8GA 2DYAA 4YORA 2A2DA 3HHLA 4WCEL 4BQZA 2GMJA 2RHKA 3WC2A 1WN7A 2DY4A 1SJFA 4AM6A 1NBEB 2QZ8A 1RK8A 3OSPA 3CCJN 4JB8B 2IM3A 4FNHA 1Q8LA 4RBUA 2VFUA 3S3MA 3LZJA 2BUNA 2I5JA 2XMTA 1M5VC 2G13A 2QRRA 2QSWA 5D15A 3I6PA 3RAXA 3PX6A 4JI1K 4TYBA 2VASA 3JYTA 1T9XA 5U47A 3DLLQ 1IBLK 2ZGYA 1N5VA 3EKSA 2UUAK 3UNGC 3KLHA 3EZOA 2UXCJ 2GELA 4FF2A 4Z4CA 3J7YI 2M88A 2W2NP 2APOA 4J9MA 3VAMA 1GK8A 2UUAF 2W7OA 4RJVA 3WXJA 3O44A 3IRXB 4JI4J 2VBXA 3QETA 4CGIA 2ACMA 1GXLA 2X78A 4O3OA 3HDSA 4BBYA 4NYZA 4CH1A 1GTHA 3DRPA 3LP1B 4F4YA 5BR8F 4PY5A 4NCGB 4DU1A 1IKXA 1R0BG 2F8HA 3A2FA 2KXNB 2HQFA 3D67A 3I0RA 3GYXB 2D74B 1E4GT 1H73A 3HOSA 1VQ9N 1M1KO 2HZAA 5KG0A 2D0BA 4CGGA 1HNWJ 1XMOJ 3ZNUA 3PNIA 4URGA 1RISA 1S9EB 3J7Z5 1VYAA 2AP1A 4UUWA 1FKOA 4HUFA 3CQXA 4PG8A 2HHSA 1Z2ZA 3NFAA 3HFZB 2HURA 4DBQA 2BMBA 1BDGA 1YRTA 1HNXJ 1LQ9A 5EX0A 2CZ9A 5J2PA 4MO5A 4CEQA 4MYUA 4P2MA 2IM1A 2MKHA 1VOMA 4DU7A 2IOCA 4FF3A 2G1HA 1TAUA 4A2AA 1S3XA 3NG8A 5F8HA 3EZUA 2ITMA 3U3YA 5LSLA 3I8BA 2CADA 1NGIA 3E51A 1RU2A 4LF4F 2LU2A 1BMQB 3WNHA 2VG7B 4WFBQ 4W5NA 4WQ4A 2GMHA 4YB6A 2FY8A 2B0GA 3OL8A 4CHOA 3MEGB 4MIAA 2IIRA 1ZPVA 1JX4A 4ZVRB 1HKGA 1FHTA 4PWDB 3NE6A 5HBMA 5JXSA 3VETA 3CULA 4G1IA 2RQCA 4LD0A 3OV7A 1NCLA 1G4CA 2AX0A 2F9DA 4ES1A 3ADAC 3ZX0A 1YTAA 1LWEA 3I31A 3CVKA 3CMEN 2XY8A 5AJ3J 2CDQA 1NK8A 5GAEI 2RKIB 2NSCA 3SPYA 2B3TB 3VQDA 1RBLA 4TY8B 4PQAA 3ZSVA 4RW6B 3VGUA 2ZBQA 5GAHI 1XNQK 3HKZD 2YBVA 2CFXA 2OCEA 4ELUA 3S1TA 3RMCA 1C0UA 4DWIA 1UJ5A 4IO8A 3K9JA 5C10A 2DHHA 1HWJA 1TYQA 3MR3A 1SJRA 3JSYA 2NXEA 3MMJA 2EWSA 2IVOA 3EO3A 2XCPA 2ERRA 3TUPA 5AQMA 5HRSA 3J80U 1MMLA 1OVYA 1R8PA 4CT9A 3AQOA 3A8IA 1WHXA 1SV5A 4CZMA 1RYSA 3VALA 4RUCA 3CCRN 1NGCA 3SQ1A 2AT1B 2WSEC 4F02A 4AUKA 2DGWA 1U0HA 5FPNA 2ZC3A 3BZKA 2E5LK 1WTBA 2C42A 3S3NA 3R6MA 3DXBA 2QL5B 2B9WA 1URRA 3S01A 4J2DA 1WDTA 5L1IA 3X3UA 3G6ES 3GSIA 1NLKL 3ENAA 1FE0A 4XEIA 3SDEA 4BQLA 3WXKA 4OVLA 2KVQE 4H03B 1TU0B 1J27A 1VQ6N 1IV0A 2EKNA 1Y4ZB 1J5EK 4JI2F 3B6PA 2VWJA 4JV5K 3RWUA 4FJXA 1VQKN 2JX2A 2DB1A 3POTA 4C8ZA 5IT9U 4JI8F 4DV4F 5KFKA 1HNWF 1CXQA 3TAEA 5KT7A 1HBOB 5C25B 3SSQA 1SJQA 4HCBA 2QWOA 4PHTX 3KJNB 2R2TA 4WK1A 4AHRA 2E2PA 1G7CB 4A8OA 4FNIA 2QFIA 3IP0A 4NA1A 2KJWA 4R0EA 4OJ3A 3VGSA 3GMGA 4RW4A 3NEKA 3EPIA 2LU1A 1E6VB 4IKAA 2EEYA 3AV9A 1WG5A 4X65K 5HBMB 4ZK7M 3O8WA 1LWFB 1QJHA 1OPZA 2OPPB 2AJ1A 3MEGA 2NQPA 2P6TA 5KFZA 1RT5B 3O9SA 4FYYB 4O4GB 3KG1A 4OHXA 1SAZA 3UKUA 3G71N 5DQGA 1RSCA 2G2OA 3HPOA 5KFFA 3DKDA 2WC9A 2DJWA 3ZX3A 3VHQA 3MEEB 1RI7A 1HPMA 2I9SA 3FFIA 3M8RA 2HFSA 3W5ZA 1KBRA 4JS4A 3VA0A 3CNQP 1TMJA 4GVMA 2FHJA 2HB5A 4LIWA 3KUEA 2FC9A 4PUOA 4AXJA 2QJ3A 4CH7A 3N79A 3P31A 1MNEA 2J6SA 4IFVB 3M1VA 4I6AA 1K1QA 3KK2B 2OTLS 3TR5A 4FLZA 5AE3A 3LO3A 3K59A 4KTZA 4FCYA 1PGZA 4XH4A 3OTOK 1H72C 3PLAA 3QFUA 1W9HA 4E8UA 1RT2A 1LWXA 3QRRA 3AVCA 4I2QA 5H1SQ 4CTAA 1NHVA 2KT5A 1UPPA 1PILA 2XZWA 2P9KA 4TQSA 2YKQA 5GAHP 4OPAA 2J9EA 3CCJS 3X1LB 1GLLO 2BR0A 2D3UA 2FGOA 5DDPC 3BSCA 3IWNC 2RAQA 5FLXU 3HVAA 1TKXA 1JKHB 2G2ZA 4EO8A 2L08A 1F9FA 1IKVA 3LGMA 1HWIA 4JHDA 4FWMA 1WHVA 2W7AA 2EC2A 5EY4A 1N4LA 4DQ8A 1SUQA 2GVZB 3OFFA 1LW2A 4ATNA 3EDQB 1U2FA 3CM6A 3MWPA 4LY7A 2UUCK 2PFFB 2ZJRQ 2ATLA 4BRMA 1SJ1A 1TKDA 4IOAL 2VQFK 2RH3A 1O0PA 5G0RA 3TPQA 3M8WA 1BA0A 1GLEG 4NA2A 1A5WA 2HIQA 1VQMS 3E66A 2R7OA 3HSDA 1E6VA 4RPFA 4H0OA 3ZSXA 2DY1A 4CYUA 4LSLA 2P9UA 3OFHA 3J7ZT 4DV7J 4FVUA 4LF6K 5DJBA 2ZVIA 1RDCA 2E66A 3CCSS 1M90T 3KMQA 4OJ1A 2GGPB 2DHXA 3GV8B 1UEKA 4E7JA 2J5AA 1H2TZ 4JI1J 2OFGX 2NRXA 5C25A 2M52A 2CQ2A 4X62K 5KFPA 3G9CA 3POTB 5EN1A 4M3WA 2G8FA 3L4QA 1NB2A 4UQTA 1R6YA 2Q31A 3LDSA 4FLXA 3F56A 3FQLA 4BRKA 1RWUA 3AQPA 4J9NA 3FR0A 3WNFA 1SKSA 5AQRA 1YJVA 2VBWA 4ED4A 3FQKA 3MR7A 5KPTA 2YKMA 2XMVA 4DR4F 4E1MA 5AQUA 3D7SB 2Q97A 2B9XA 3OL7A 4GO7X 2NSBA 4X66K 2YWEA 2PZSA 4MYTA 2LXUA 1F2HA 4UQGA 2UUBF 1AROP 1VSLA 1S6PB 3ENOA 3VTHA 2FC0A 3DXMB 4IWVA 1KLNA 2WFBA 1FX2A 5BPMA 4LF2A 2XS2A 3RBEA 3NXZA 5IS2A 1NZ8A 1NDLA 4MFBA 4CHZA 3TTFA 4KFBA 2C2KB 2Z2ZA 7AT1B 2V34A 4G9ZA 3DRRA 5D0HA 2CQBA 4YFUA 2DPIA 1S1VA 2F9WA 2J4RA 2DR8A 5M1NA 4WP3A 3CQ8A 1TUUA 4ZMMA 1VQ7S 2LECA 2RUSA 3BZQA 2XO7A 3ULHA 5M1PA 1PAEX 1U8WA 4IG0A 1GQEA 1ZM4A 4X66J 2HFOA 3IMQJ 2PYJA 2QXLA 2MQLA 4JYAF 4M45A 2YPYA 4Q43A 4DUYF 1HHQA 2PE8A 1YTYA 1H7XA 1AB8A 5EU7A 2DPNA 3EE9A 4F4ZA 1IQZA 4CFBA 2YWFA 4QWCA 4DMNA 1ZM2A 5KTQA 3DMJB 4RNFA 2ZHAA 1JWWA 4LF7K 4TSXA 3K0JA 4U7CA 1KOHA 3VN5A 1ZBTA 3HHLD 3BR8A 2AJFE 3M4XA 3CD6S 2JEIA 4GY2B 5KFQA 1WWHA 3K5OA 4G1QB 3H7HB 4NE9C 2MGZB 1F2GA 2ZH3A 1VLYA 3FZKA 3DFEA 3P5TL 2QWPA 2XI3A 3SAHA 2PGCA 4NMLA 4CEZA 1VQ5N 4EP4A 3NH1A 1NNEA 3DRYA 1Y11A 1HQUA 1QVFR 2C2ZB 1S22A 1WD6A 3I82A 4IBNA 4NLBA 1QZ6A 4N47A 3IM9A 2VKZG 2M7SA 1TL7B 5D0GA 4DV3J 3R9LA 4LBIA 1TKZB 2YKAA 1S1WB 5F8LA 4J5OA 4FWRA 2BQUA 4OPHA 2DH7A 2KB2A 1YIJN 4ECSA 3AVHA 4LFBK 4DR2K 1QLNA 3UN5A 5F8NA 1IKYA 2VPZB 3R8YA 1ZBUA 5TKWA 3D2FA 4ETXA 3M8SA 2HNYB 1Q79A 2RQMA 4B9TA 1HQEB 1AT1B 5C2DA 4N56A 2KFNA 4H5TA 2NRWA 3QJLA 5LJVA 3VESA 2ZBRA 3TZXA 1QZ5A 5T41A 2LDIA 3GLJA 4Y1DA 3DOKA 4CF8A 2G0IA 1JLCB 4FLUA 3CCUN 3QFHA 2FUG9 4EP5A 2AJ4A 3D0PA 3IR5B 5LSOA 4HH0A 5LXYA 4ZPDA 2PFDA 2AW0A 1RT4B 5M1OA 2QTDA 2YV0X 1HKCA 1LEOA 5I4MA 4HUGA 2MPUA 5CCLA 4E19A 2FVCA 1WSJA 3U27A 3T1YK 2IAJB 3PEJA 1S9GB 3CC2N 1U1NA 4J9UE 2J6UA 3MAQA 5A8RA 5KFAA 2J9DA 3MM7B 2ZFHA 3UNYA 4Z4GA 4W98A 2J6TA 2CVIA 5A8WA 4L74A 3QWPA 3GIKA 4KGMA 3G8QA 5B09A 1P8ZA 4PXCA 5EGYA 4M5GA 3CFOA 4ZVHA 5IT0A 3BEGB 1NH8A 2BX6A 4YOXA 3K2YA 4V1Ak 2HS0A 1C0GA 3TRGA 4BRCA 5CAAA 4CJWA 3BGLA 5AQOA 5BN8A 1Y9OA 3SQ4A 4FZZA 1VQ7N 1XNRJ 1LCUA 3L95X 3CB4A 2EFGA 1SJ3P 4DL4A 3SK3A 1JQGA 4OZNA 5AZIA 1GLJO 1KAZA 4FPRA 1XMOF 3U1MA 1NK9A 4K41A 5DZ7A 1XMQJ 1FRKA 2W7PA 2Z4PA 4H4OB 4GVLA 1NPPA 3P38A 3MR6A 4PZVA 4DDFA 2NUUG 4OX9K 2IJFA 6FDRA 2WONB 1GT8A 1RWXB 3OS2A 1Y0HA 2MY7A 2RN2A 2PBDA 4M5JA 4CJPA 1NXIA 4I6MB 4FK2A 1RB0A 3R6GB 3DOMA 1K9MO 4QWEA 2ZQBA 4DFPA 4X4SA 2Z1IA 4KHSA 4U95A 4B1UB 9RUBA 3OTOJ 1FA0A 1C6VA 2E9ZA 3R3LA 3Q89A 2DCLA 1N56A 4CHQA 4QAGA 1NGJA 5J2QB 1N36F 2RHQB 3NCIA 4BVPA 4HVZA 3PO4A 1RT7B 2RD5C 5BRFA 2YNHB 4Q8FA 1YJ9N 3KLIA 2P2CB 2FJVA 4IRCA 3CJ7A 4M63C 3EGWB 2MKCA 4YY3K 3B4DA 2CQGA 3NH0A 3UR0A 3A5NC 3MDQA 4MK9A 1ATSA 1S10A 1HNWK 4CT8A 4E7HA 4H5WA 5IC6B 5I42A 1ZS6A 4FW1A 4CERA 4C7QA 1QSSA 5F9LA 2QWRA 4RNNA 2DGUA 1L3UA 4YEAA 3BF3A 4TXSA 4LF9K 4DV0K 2GAGC 1S59A 3DGVA 3NAHA 1DEJA 4C0BA 3P3DA 4NLUA 1WJ9A 5GAGP 4I0WA 5AQWA 5AR0A 4CGJA 2D1KA 4FYXB 1VAZA 2XULA 2XS7A 1YDLA 4CLFA 4LFAK 3OXFA 4C6AA 3NH2A 4PXDA 3AO1A 2BE7D 5JMNA 1IWGA 4OX9F 3K0SA 1N8RO 3UDCA 5HJXA 5AQKA 2DFEA 2Z8QA 2HHUA 3THXB 3R5BA 1BQMB 4F8RA 4E1JA 4DX7A 1E4FT 5CD4H 4JI4K 2ZH9A 5DM6L 2FSJA 4X4VA 3HCXA 3QMQA 3I56N 4ZPCA 4J9LA 2K3KA 2ASMA 3TSQA 1CULA 1S4EA 4B3OB 1JXLA 4CF2A 1ZAWA 4KIAA 2WSCC 4EBEA 1K73O 1RNHA 3NS7B 4OJGA 4NLYA 2AHOB 2QM1A 2NUBA 1RHMB 1KVCA 2RE1A 1RT6A 1YVUA 3PW4A 2LQJA 4ZVEA 5KFSA 3H4DA 2HHTA 2XYGB 4P9SA 4A8XA 3KFWX 2PEBA 4FDFA 2BW7A 3TUZC 1IBKF 4PG4A 1IR0A 3VAJA 2P9IA 1WSIA 2P5OA 5D4NA 3HULA 1FXLA 3CDBA 3EE3A 1N48A 1HI0P 4KBOA 5AQYA 4A8WA 3OS0A 4ZVOB 1RTIA 2E1ZA 1BXNA 5DLFA 3V1QA 2W9BB 3KHYA 4OFZA 2LVWA 3MCSA 3LDLA 3ITHA 2HS3A 3MMVA 4X4TA 4Z4IA 4I9QA 1TMMA 3BGRA 2P9GA 5BYRA 2ZH4A 2UVVA 1SQFA 4FN5A 4HI1A 1V3SA 4JNEA 3ZSZA 2DO0A 3OVAA 2E5LJ 2R8HA 5K8PA 2VFTA 4YR3A 1P90A 1R6VA 2VICA 1L3TA 3R1HA 4YB5A 1DY3A 3CJ5A 2B5JB 3DRSB 3HJFA 5CA5A 1BI4A 4CIOA 5E7OB 3O4WA 1UTAA 1BD6A 2C3YA 2ZZNA 2GHWA 5HANA 1SH3A 7FD1A 3D68A 4IEEA 3OQ2A 4IOCQ 3UDVA 5HROA 2Y0BB 2UU9F 3T1YF 3CTRA 2O8CA 1MLAA 2GNKA 4QW8A 3TAQA 5D0RA 4AH9A 2FSNA 4DFJA 3I0SB 1OY6A 4ID1A 1ZOTA 5C15A 3I8DA 4B8AB 3KYLA 3RBXA 4LF6J 3V4MA 3NAIA 4PKDB 1KVIA 5EWEA 4URSA 4CO0A 5D0EA 2HVEA 1N33K 3P96A 2YWGA 1BUPA 3VQ8A 3R1LA 1JLEB 4M1KA 4J90A 4RUHA 5DO2A 5F0WA 2Q6BA 1RTDA 4OZLA 1HJRA 3FNNA 2AIRB 5HI7A 1O5JA 2YPZA 2YVSA 3O4NA 2NYIA 3IAM9 1KHWA 3H2UB 2P8IA 2ZNYA 4UT4A 2Y9HA 3VQ9A 3CCEN 4HTUA 3S41A 2LXIA 4IOCL 1U09A 5M1FA 3BKTA 4FBUA 3VF4A 3ZCMA 1VISA 2KHOA 3AVBA 3SNNA 3R7BB 2F8EX 1EIYB 3EY1A 4O3NA 3CSKA 2R9LA 1T02A 2YKOA 4MQ3A 3EN9A 4GV3A 1SC3B 4RW7A 3T9NA 4RBVA 3JSRA 3WT0A 4DV3F 1YIJS 2R7VA 1RTJA 3GV7B 3AD9C 1R0AA 4CM2A 2QA4G 4OKJA 3VERA 4Q2LA 1KLMB 4A2BA 1L3VA 1WUUA 2F7TA 3Q86A 4WZMA 3TTDA 3LM9A 1SQKA 1W2BM 3TQEA 2O4GA 2D0OA 4G65A 3PG9A 2XM3A 1AZSB 1AUDA 3US5A 4L3KA 5FJ4A 3EXYA 3V6JA 1YJ9S 1IBKJ 5KFGA 1X4EA 1HR0J 3C6UA 1RBSA 2XNRA 2ASYA 4URQU 4IO1A 3P45B 2QA1A 2A1RA 5LMUJ 2D5RA 4A5BA 3LAKA 4JI1F 1C1CB 3ISNC 5KFDA 1SUQB 1FJCA 3SMPA 2JWNA 2E1CA 3QDKA 3G82A 3FC9A 2F1FA 4DUZJ 2M0GB 2YTCA 3V6DA 5EVZA 3CJ3A 2V4JA 3K7RA 4O0NA 4OKKA 5LMNJ 3T1HK 1LFWA 3SI6A 4CO5A 1B92A 4BR9A 4E3SA 3VEZA 5BRHA 5LT5A 3EVWA 4I9LA 4B3MK 4DX6A 3V9ZA 2HBMA 1FDDA 3AOAA 2V51B 3GE9A 2MQ8A 4DQPA 4WKYA 4F3OA 5JVGL 2EW9A 1FXRA 3AVIA 2FF6A 3LGHA 3K8VA 3T5JA 4KKOA 4KAIA 4MMOA 4EBDA 3CEDA 1TL4A 2B5JA 1RLCL 2QT7A 2ILYA 4L75A 4JK8A 3H1VX 2IHR1 5KT4A 3KTQA 1SH0A 1UZHA 3Q83A 4ZCMA 4LF6F 3DGPB 2OFHX 1REGX 5KFCA 2YKNB 5LJ5Y 2UXBJ 3MOJB 2B4VA 2KXHA 1PKUA 2WTFA 2GO8A 1JB0C 1C0TB 5AXLA 2OPRB 3AFGA 1YX2A 3FFIB 1WC1A 5HQMA 1K8KA 5CQGA 2VQEJ 1NDCA 2W9BA 4M3ZA 2I7PA 2LEPA 1EWQA 4U9RA 4FJLA 1NOZA 1CC7A 2OSQA 1T05B 4F0KA 1K8KB 1RTHA 3D3CJ 2WCXA 4TVAB 2YKPA 4Q45A 3SEOA 1NO8A 4H0VB 3QERA 2BEFA 3AVFA 2O67A 1XC3A 1YTUA 1DGKN 5E84A 1R8HA 4PKGA 3DOLA 4K2XA 3BKUA 2J7WA 2L41A 1NGDA 1Q86O 4FWNA 2Z30B 3LH2S 2R4FA 3SUQA 3RW6A 1Q8BA 1V4SA 2M8HA 4OYWA 4NLTA 4NLRA 2W25A 2FBXA 3HK2A 1N5QA 4B8CA 3RAQA 5B0AA 3OUYA 4K4YA 1J5OA 4P7VA 3QLHB 3L7OA 4C8OA 3N01A 1FKOB 5AQNA 1FNOA 2JFDA 2GA7A 1T03B 5KG7A 2ZD1B 5M2RA 1VK3A 4M5DA 1EP4B 3KLFA 1SVDA 4M3XA 4FPAA 5HL7L 3QPIA 3KK3B 3Q2SC 4DB3A 3AVNA 3ZSQA 5L1JA 3FRYA 2XB2D 1VJQA 4K50A 1S0NA 2IM2A 1NMEB 5KGWA 3V6DB 2GX9A 4CVNE 2A6OA 1VSJA 2I8EA 2IMOA 2P9LB 4C8MA 3NCPA 2ZDPA 1GX6A 2OA8A 2A0FB 2QN6B 3CT9A 2V7YA 3E01A 4DR3J 3JAMO 4LR9A 2ZKTA 4J2BA 3HOTA 1C1CA 4HT7A 1QTMA 4CK1A 1EAYC 4IFEA 2JLFA 2LP4A 4OI4A 2H65B 4GV6A 4M5IA 4LF7F 1LWCB 1LW0A 2DIVA 1FRHA 3CWJA 4QIGA 4CJUA 5K5MA 4U67Q 2OGUA 1XR7A 1BO5O 1QD1A 4NCBA 3I5AA 2DNYA 4E2FB 4PCQA 3HF5A 1NUEA 3GG1A 1C0UB 2CGLA