1HMVA

The structure of unliganded reverse transcriptase from the human immunodeficiency virus type 1
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
554
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of unliganded reverse transcriptase from the human immunodeficiency virus type 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
total genus 139
structure length 536
sequence length 554
chains with identical sequence C, E, G
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1994-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hmvA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hmvA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hmvA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hmvA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hmvA05
1T3NA 2B5JA 4IQXA 3M9OB 3PVXA 2W9BB 4ZVFA 4DL7A 4OGCA 1HNIB 2EHGA 4KKOA 3OSNA 4PWDB 2HNDB 4E7IA 4DSJA 4WFXA 1JL2A 1KTQA 2FBTA 2HHWA 2FVSA 4B9UA 1TAUA 4CEFA 4DL6A 3BSNA 3AVKA 4EZ9A 4CJQA 5D3GB 4Q8FA 1TK5A 4OPJA 3PW7A 3DRRA 4QWDA 1S6PA 4F3OA 3QZ7A 2WONA 2IBKA 1RBTA 1NK6A 3ZSOA 3CDUA 2YHBA 3VQDA 4LQ3A 3M8SA 4FLXA 4ZTJA 3T19A 1ASVA 4AH9A 3QESA 2ZE2A 3LP3A 1TQLA 4ED7A 1ASWA 2W9BA 4KTZA 3OYKA 5F9NA 3H5XA 3CFOA 1S48A 2G8HA 4WZQA 5CZ2A 2G8KA 5KT5A 5DQIA 3FRZA 1TL1B 3IAYA 2R8GA 3K5NA 2ZE2B 3V9WA 3O4QA 3M9MB 1RT5A 4YMEA 5HRPA 1HNIA 2B6AA 4RUAA 2E9TA 3DMJA 4FLUA 3SCXA 3NMAA 5DG7A 1DLOA 4Z4FA 4CJUA 4HCBA 5CYQB 5C5JA 4BACA 4X2BA 2R8HA 2B43A 4HUGA 4TYAA 4RW4A 3KK2A 3OHBA 4H8KA 3H59A 1RAJA 3QIPA 4FK0A 3VA3A 3HXMA 4J9LA 1C2PA 4DL4A 2R2TA 3MR2A 1VK0A 3M8RA 4MK9A 3AVAA 1S6QA 3I0SB 1YVUA 4J2DA 4CFCA 4IDKB 4RZRA 4OKKA 1WSJA 1X9SA 3GIKA 3NHGA 1DTQA 3LWLA 1F21A 3D0PA 1TP7A 4NYNA 4DQPA 5KGWA 2JEFA 1Z4UA 5KFUA 4PUOB 3DRSB 1TKZB 1KFDA 3AVMA 1J53A 1JLGB 3L3VA 2VA2A 2RF2A 2XY5A 4ECYA 3H40A 3PJXA 5KT6A 1JLQA 3K59A 3HVTB 3K5MA 3SFUA 3NH1A 2JEIA 2W8KA 4NRUA 4DG1A 4U7CA 2HNYB 2IAJB 1ZTWA 4YFUA 3EPGA 1QS4A 5J2NB 5C24B 3CVKA 4JUZA 1JIHA 1TV6A 5I42B 3NBPB 3DLKA 4NRTA 1FKPA 1QE1A 1NJYA 3KHHA 2HAIA 4Z4EA 3LDSA 3H2LA 1JLQB 3HT3A 1BI4A 1J54A 3SUOA 3NE6A 3OYMA 1VSJA 5KG2A 2W9CA 3AA3A 2P5OA 2F96A 3T5JA 2WOMA 4J9PA 1X1PA 3OLAA 3KOAA 4RG8A 3UDLA 1BIZA 2UVRA 1HYZA 4H4MA 4R0EA 2XY8A 3V4IA 4KKOB 5HRSA 4ECSA 4QWBA 2F8TA 3ZT4A 1RT1A 3JSMB 4O55A 4YP3A 1Y97A 4ZVHA 4DF8A 3MXIA 5I3UB 1A5VA 2AWZA 3DYAB 2IM0A 4M45A 4M41A 4BE0A 4R5PB 4UQGA 4CJ3A 3OL9A 1S5JA 3T5LA 3OYFA 4FK2A 5KT3A 3VQ4A 1NKCA 2IA6A 2VG5A 3CWJA 3H5YA 2HWHA 4Z0UA 2VWJA 3DLGA 4O3PA 4O3RA 3S9HA 2XGPA 4YNQA 3CJ0A 3LAMA 3AO2A 4F4WA 4K4ZA 3NH2A 5L1KA 4DWIA 1KLMB 3LP0B 3HL8A 4NLGA 1GX5A 4KHUA 1RTHA 4R8UB 4F3TA 3OL6A 5KT4A 3QZ8A 4DL2A 3CFRA 4DTXA 5CYQA 1RYSA 3ISND 2UUTA 3V6KA 1RT2A 2YKMB 3KKSA 2FJWA 1EX4A 3C95A 5JUMA 1RBUA 4KREA 1LW0A 2IDOA 1FK9B 4F4ZA 3MXMA 3OYDA 4FVMA 2BRKA 1RNHA 2W9CB 2R2SA 1TVRA 1S4FA 2XO7A 1C1CA 2E4LA 2FLPA 4HVJA 1JLCA 2FBYA 4DTMA 1SL1A 4QPXA 5KG0A 1U45A 2XC9A 4DU1A 2O4GA 3K58A 4DSLA 3LAKA 1JLBA 2RKIB 3D45A 3RRHA 1GOBA 4FLWA 5CYMA 1SUQB 4ELTA 5D3GA 1RDRA 5KI6A 4Y3CA 3G86A 1SH2A 4RUCA 5SZTA 3KNAA 4FBUA 2ZKUA 4FJ9A 2HVIA 4J2BA 2CJQA 2YNGA 1QE1B 3EZ5A 1WSGA 3SQ0A 1BQMA 2J6UA 4N56A 4TLRA 4KBIA 4ZVEA 3BDPA 2HNDA 5JS2A 2UVWA 3RB0A 3JYTA 3QIDA 4FBTA 4KV8A 4CHZA 4C8LA 3IRXB 4RW7A 3QIPB 3Q8RB 3VQBA 2HMIB 2YNIA 2Q3SA 1LWEB 4CEDA 3PW2A 2PYJA 2UUWA 3I5BA 2JC0A 2RN2A 1ZBUA 4O4GA 2IS3A 1TKDA 4FW1A 1CZ9A 1WSFA 4HTUA 4O3OA 2ILZA 5F8LA 4IRKA 1RCHA 5KGXA 2GV9A 4I2QA 4ECRA 4CEQA 2Y1JA 4C8OA 3CJ3A 5KFVA 3QEPA 1K1QA 4R5PA 1QHTA 4NLDA 4RU9A 4RNHA 1L3UA 4RNNA 2LSNA 3O4NA 3KLEA 4CESA 4IDKA 3SV3A 1IG9A 1RT4B 1TK8A 5KFBA 3WNEA 5DGAA 4DU3A 4H4MB 3H5SA 1WN7A 5HRNA 4CEZA 2FVRA 4K4UA 1CSJA 1ZBHA 3AA4A 4I7FA 1YVFA 4FZYA 4CF0A 2W9AA 2HHXA 4CIGA 4M3XA 3SUNA 3RTVA 3IGVA 3TAFA 3SPZA 5HBMA 4M3TA 2HVHA 3VQ8A 3L2UA 2IGIA 5I3UA 5CY4A 3HYFA 1ZBLA 3I0RB 3OLBA 4KPYA 4W5OA 2ZD1A 3WNHA 2R2UA 1RA6A 3V6DB 4KHSA 5J1EA 1HQEA 3V4IB 4WFYA 4DG1B 4ECZA 3V6DA 1N6QB 2IJNA 1LAVA 4YR0A 3DOKB 4FYDA 3E51A 3M9NB 1RT7B 4Y34A 4ZPAA 1IKWA 1I39A 2HB5A 2PYLA 3QO9A 4NLQA 1J9AA 2RF2B 4DFJA 2AQ4A 3MEDA 1QAIA 4CEBA 4M95A 4KHRA 2ATQA 2I5JA 3VQAA 3VA0A 1TKZA 1BI4B 3EYZA 5KFIA 3AO1A 2OYQA 2D0CA 4DTPA 1NHVA 2X6SA 1JKHB 4EBCA 3GV5B 5EU7A 4DEZA 1HJRA 1FKPB 5KFXA 3KLHA 4CJWA 3NBPA 1FXXA 3K5OA 2XCAA 3GQCA 1QAJA 4FLTA 5KG5A 1I6JA 5KRSA 3EPIA 4IKAA 4KAIA 1VSMA 1KFSA 4NLXA 3N6LA 2XY6A 5KFAA 4ED1A 1GX6A 1XHZA 4E1NA 5KFFA 3PO4A 1XHXA 4DS5A 4CJ4A 4NLPA 3ITHA 2AU0A 3HVRA 3BQ2A 4PWDA 5DG9A 2JEJA 4NZ0A 3TABA 1C6VA 2JLEA 1UOCA 1ZBFA 3VQ7A 4I2PA 3GV7B 4K4YA 4FJHA 4KB7A 3AA5X 3DM2A 3KD1E 3VQQA 3KK2B 3BR9A 4TYBA 5DQGA 4DQIA 1XR5A 1WSEA 1Z26A 2ATLA 4B8AB 4E7JA 1LWEA 5KG4A 1DLOB 4CFAA 4DLEA 2G8VA 3ICLA 4FJIA 4DSIA 1S49A 2RDIA 4OVLA 4HCCA 4WE1B 3KTQA 4RNFA 4BDYA 4DSEA 1NNDA 4YR2A 4C8MA 3JYTB 4G1QB 4GW6A 2XHBA 5KFDA 3TAEA 2XGQA 5FDLB 4ZPCA 1RYRA 4XO0A 3DLHA 1VRTA 3MEEB 3QNNA 1L5UA 3SV4A 4E1MA 3RRGA 1C0MA 1BQNA 1ZYQA 4K4TA 4JV0A 4DFPA 5EWFA 4F4XA 3CG7A 4Q44A 2A1RA 2V0NA 1KHWA 2JC1A 2V9WA 4FW2A 3HPGA 4FXDA 3OVNA 3DMJB 3FFIA 4IOBA 4CGFA 1WAFA 3HO1A 3QEIA 3H98A 3DRRB 3RBDA 3KK1A 2W42A 1VSKA 5DLFA 2YKNB 4Q5VA 4WFZA 1BIUA 3TWHA 1ITGA 1TVRB 2F8SA 4C8NA 3V6HA 4B9TA 3QO9B 5KT2A 1X9MA 2HNZA 2EC0A 3AA2A 3RMCA 1N6QA 3IS9B 3HM9A 1GOCA 5HROA 5KFJA 4FJ8A 1ZETA 2GIQA 4IKFA 4BE2A 5C25A 5KFOA 4MH8A 4XIUA 2AGOA 3GYNA 3RB4A 1RT2B 2VG7B 4U6PA 4KHMA 4E0DA 1JX4A 3CFPA 3KMQA 3M8PB 3KLIA 1BL3A 2F8EX 4DL3A 4B3OB 4QAGA 3KK3A 4DFMA 3PZPA 3RMDA 1VSDA 3Q8PB 1UWBB 1U4BA 3MFHA 4M42A 1S0NA 4CGHA 1UAXA 4KHQA 3Q8QB 4CJ5A 5J2QB 4FJJA 3MTKA 3QEXA 3OYCA 2FVQA 2XI3A 4BWMA 2ALZA 3SUQA 4O5BA 4DF4A 3HK2A 4FM1A 4RW9A 4NYFA 4FLZA 4CJSA 3MECB 1KVBA 2E9ZA 3NKYA 3QINA 3IN5A 4J9KA 1VSIA 3ZSXA 1RT3A 3ZT2A 4URSA 4FLVA 1HMVB 1D9FA 3VQ9A 3CM6A 1TK0A 1VSHA 3ZSWA 1QSSA 2WOMB 4CF8A 3KMSA 3TQ1A 1S1TB 3UIQA 4AHTA 1HQUA 1RILA 4KAZA 4MIAA 4JV1A 2YNIB 4K8XA 1EETA 3KKRA 4CHPA 2WRMA 1RBSA 1R0AA 3HSTB 1NJXA 1UA1A 3KLGA 3I5AA 4ECWA 1Z25A 2YHAA 5KFZA 3AVNA 3N6MA 1SV5A 1CLQA 2R2RA 3PJWA 5J2NA 4F50A 1MU2B 5FDLA 1CXUA 1BQMB 4HUEA 4BDPA 3TAPA 4QOZB 3V1RA 2YNHA 3U3GA 4IH7A 1TGOA 4ZPBA 4J9NA 4O3NA 1NOZA 2KQ2A 3AVHA 1NK4A 4EO6A 3CIZA 3H4BA 3GV8B 2IMWP 1S1XA 1T94A 3NFAA 3SI8A 4OGEA 4ID5A 2OPRB 3I8DA 4IFYA 3KJVB 3IGNA 3L3UA 4E7KA 4FM0A 4Z4CA 4OL8A 4M3RA 1IKXA 4FJKA 1RDAA 3OYIA 3SPYA 3QGIA 4MKAA 1LV5A 4N47A 4OPKA 2IC3B 2OPSA 1S1UB 4QWCA 1RDCA 4ZHRA 4WZMA 2P51A 4DQSA 2QK9A 3WNGA 4H4OB 2R8JA 2XWYA 3FQKA 1WSIA 4W5NA 4DSKA 2KZMA 3T5KA 2OZSA 3DLEB 3WNFA 1LW2B 3C6TA 4E89A 2JGUA 3KK3B 4B9LA 3NF9A 4CECA 3MF5A 2I5JB 2VG6A 5K14A 2E6LA 1D9DA 3PO5A 1NK0A 2FBVA 4F4YA 3DOKA 3E01B 4O4RA 2NUBA 3DOLB 1HYSA 2B4JA 4M3WA 4LSLB 1NHUA 1RA7A 3V1OA 1S1VA 3MEGB 4QW8A 1C0TA 3NGDA 2R8KA 3KHRA 4LQ9A 1HNVA 1TL3B 1RTDB 4JRPA 5KFMA 2DY4A 3DLBA 4FJLA 1S9FA 1RT6B 4LY7A 4OLBA 4JRQA 3C6UA 4CGDA 1HPZB 3PW0A 3NH0A 3TANA 3KK1B 4Y2AA 1DTTB 3VQ5A 1J5OA 4I7FB 5KFGA 1CXQA 4LD0A 4CHYA 2VWKA 3LZJA 3UPFA 5KFYA 4YR3A 3OYJA 3ISNC 3QLHB 2V4QA 4NCGA 2G8FA 1NK9A 3HJFA 1WAJA 3KD5E 4CJTA 3HVAA 4TY8B 1Q8IA 4KFBB 4MIBA 4ECUA 4NLVA 4CGIA 1RTJA 4CF1A 4RW8A 3H08A 4ED0A 1W9HA 3TAGA 4J9OA 1A5XA 4EBEA 2IOCA 3TVKA 5L1JA 4WYLA 1T03A 1N4LA 5L9XA 4Z4GA 4ZHRB 2P1JA 2BR0A 4Y2CA 1S1UA 3DI6B 4O44B 4FK4A 4CJPA 3UQSA 3HP9A 3A2FA 4CGGA 4B08A 3LP1A 4ECTA 2Z1JA 3L2WA 1XC9A 3T1AA 4PUOA 4J2EA 4Q0BA 3VQCA 3SYZA 3AVBA 4BDZA 2ASLA 1YT3A 3QETA 4ZP8A 4TY9A 4K4WA 1LWCB 1TKTA 4FZZA 1EXQA 3AVLA 2VA3A 1NK5A 1IM4A 1JXLA 2QKBA 4EEYA 3MR5A 3EY1A 4CGJA 2C28A 4G3IA 1REVB 3L2VA 5KG1A 5C42A 1N5YB 3O3GA 1XI1A 4Z4IA 3QLHA 1IKYA 3L2RA 1MMLA 1T03B 4DTSA 3SFGA 3SQ4A 4E19A 1JLEA 3FDSA 1JLFA 4NLRA 3D5MA 4RW8B 1U09A 1LWCA 1TKTB 2OA8A 1IH7A 4DTNA 3V1QA 2IM2A 1RT6A 4ZP7A 2W7PA 4M94A 4NCGB 4N5SA 3VQPA 4K4XA 4JS4A 5L1LA 3N6NA 3P1GA 4KHNA 2UVVA 4ICLA 3KHGA 3G10A 4NCAA 5FRNA 2BRLA 3AVFA 2YNHB 4LSLA 1RTIB 4M3YA 4LSNB 5J2PB 3KLFA 4O0JA 4URQU 2GUIA 3LP2B 5KFEA 4NLUA 4AHSA 1HNVB 1TL3A 1RTDA 4K4SA 2OPPB 5J2MB 4ICLB 5HLFB 4ED8A 3AVIA 3I0RA 4NLSA 4E7LA 3MECA 2C22A 1A5WA 4F2SA 3LZIA 4ELUA 1LW2A 5KFLA 4ECXA 1HARA 1RTHB 5KT7A 4ZP6A 1QUVA 1LWFA 4LH4A 1HPZA 1VSEA 3U3YA 2EX3A 5K14B 2Y1IA 4DU4A 1JLEB 3AVJA 1K6YA 1TKXA 1D8YA 1KCFA 5FRMA 2G8IA 2R8IA 3C6TB 1B92A 3PR5B 4XPCA 3P83D 2E6MA 1SL2A 4AHRA 3KLEB 1NK7A 4B9SA 3PR4A 3PX4A 4CK1A 4C8KA 4Q43A 2ASDA 2IJFA 3PW5A 3LANA 2VG7A 4NYZA 4HKQA 3ZSZA 3PHEA 3DOLA 3RBEA 5FROA 1SL0A 3SJJA 5J2QA 2BANA 5F8JA 4CHNA 4Q0BB 3ZT3A 1G15A 4DS4A 1ZTTA 2Z1IA 5F9LA 2RPIA 4RW6A 4FZXC 3VQEA 4KI4A 2HWIA 5E41A 1VSLA 5F8MA 3T5HA 3NAEA 1C1BA 2AJQA 4EBDA 2WCXA 2HMIA 3QEWA 2JEGA 1NKBA 3DRPB 1KSPA 4OLAA 1KVAA 2FVPA 2YKNA 2OZMA 1HYVA 1ZBIA 3AVGA 3HKWA 3KIOA 4I9LA 2WTFA 2PZSA 2QE5A 2Z1HA 1Q9XA 2ETJA 2BE2A 4IG0B 4Z4HA 3AO3A 4HUFA 1SH3A 3OHAA 2HHQA 1B9FA 5DGBA 2IM1A 4N41A 4O3SA 2OPPA 2DFFA 3VN5A 2D7SA 3SI6A 1J5OB 3BREA 3RB6A 1N48A 1JLBB 2RKIA 1EKEA 5KG7A 3DRSA 1RTIA 5DQHA 1S1WB 1SKSA 1S9GB 3OYLA 3M8QB 4IRCA 3CJ4A 3G6YA 1C1BB 3Q8SB 3QEVA 1WSHA 4J9MA 2X74A 3L8BA 2DFEA 3ASMA 2HHSA 2DPIA 1KRPA 3M8QA 4TSXA 5KG3A 2QV6A 3OYNA 3QERA 1U47A 2E9RX 2HW3A 4CIEA 3K57A 1S6QB 3I0SA 4B9VA 4IG3A 4CEAA 1RDDA 4O0IA 1U48A 2D0BA 2YKMA 3AO4A 4ED6A 4J9QA 1BCOA 1NK8A 2BE2B 3RAQA 3NAHA 2D3UA 2D41A 2W8LA 3ZSVA 1TKXB 3CQ8A 1T05B 3DLEA 4RW4B 4ECVA 1W0HA 5DMRA 4NCBA 4CERA 3MAQA 3QGHA 5EWEA 3MR3A 4I9QA 2BGGA 4EO8A 4TXSA 1RT3B 4H54A 2IC3A 1W25A 1BCMA 3ITHB 3CO9A 4RW6B 2HNZB 3G0ZA 1EP4A 3B6OA 3KLIB 3MEDB 2KZZA 2AGPA 3TAMB 5J2MA 4O44A 5HLFA 1RT7A 3K5LA 2YNFB 3GIMA 3KLFB 1XR6A 3RWUA 3NF6A 1HQEB 5J1EB 2A1SA 4HYKA 2Z1GA 1LWFB 2UVUA 4KTQA 3GIIA 4KFBA 1S6PB 1T05A 1IKVA 2C2EA 4MFBB 1B9DA 4ZTFA 3OYEA 1D0EA 3UR0A 2FJVA 1S9GA 1S1WA 3OSPA 2FJXA 3M8PA 1Q9YA 1WNSA 1IKWB 1S0OA 3C6UB 5I42A 4JV2A 4ID1A 1YTAA 3MFIA 1BHLA 5J2PA 4G1QA 1HRHA 4NLWA 2KW4A 3IG1A 4FS2A 5DLGA 3HVTA 2ITGA 2B5JB 3AV9A 1EETB 1L3SA 2KTQA 3GILA 1JLGA 4W5QA 4W5RA 4KI6A 2HHTA 4FJNA 3BSCA 4AHVA 3V9XA 3E01A 3BGRB 4J9SA 4DQRA 1TAQA 3DLRA 4CIFA 2BQUA 4XPEA 2J6TA 4F8RA 4IRDA 4AILC 2VG6B 2DFHA 4NLTA 4CHOA 3LP1B 1D5AA 3RB3A 3T3FA 4CEEA 1T8EA 4TQRA 3RAXA 2FBXA 2GC8A 4IG0A 4FS1A 5C42B 1N5YA 4RNMA 3BSAA 3VQ6A 3LPUA 2OH2A 3V81B 4PQUB 4I2PB 1ASUA 1S97A 4TN2A 4Q45A 3QNOA 3H5UA 4ELVA 5KFHA 3AVCA 1LAWA 1JL1A 4DTUA 1RTJB 3V81A 4PQUA 3S3NA 3ZT1A 5F8HA 3O3HA 3F9KA 3PUFA 2OPSB 4CF9A 3HHKA 2HHUA 4EZ6A 4EP4A 3KHLA 2XRIA 2CKWA 3V9SA 3SNNA 4CFBA 3ZSQA 1JXBA 3OL8A 5KFRA 3TR8A 3BJYA 3DDKA 4IFYB 3KJVA 4IH6A 3KLHB 4RW7B 4CF2A 4EYHB 5KTQA 4CEOA 5HROB 3P5JA 1WNEA 5F8NA 3SQ2A 4B9NA 2W7OA 3CDEA 2G8WA 1T7PA 3CM5A 1TL1A 2XCPA 3SQ1A 1UA0A 5EWGA 4Q8EA 1GOAA 3NGIA 5HBMB 4EP5A 1VRUB 4LSNA 4M3UA 4FJ5A 3LALA 3NF8A 3U6FA 3LWMA 1MU2A 4MQ3A 3V9ZA 1QSLA 2ZD1B 1O1WA 3TARA 4FJXA 2ILYA 3RR8A 3PY8A 3KLGB 4ZVGA 2RDJA 1JKHA 4DMNA 4OJRA 1QQCA 2QXFA 3OJSA 4KE5A 4MFBA 4CJLA 4QWEA 2KFNA 4IR1A 4PY5A 1C1CB 3SZ2A 4R8UA 4B8CA 3OYAA 1BQNB 4KHWA 3QYYA 1C0TB 4CJFA 3BQ1A 1C0UB 4WXOA 2ZQBA 1VRTB 3MEEA 2O4IA 2D3ZA 4DTJA 1JLFB 2WHOA 4WYWA 4J2AA 4NLYA 2C2RA 4FJ7A 5KFQA 1IKYB 4CJKA 2KFZA 2YNFA 3D28A 1VSFA 1XR7A 4J9RA 1RT4A 1S10A 3NCIA 1EP4B 5KFKA 4CJEA 4URGA 1JXEA 2D0AA 2YV0X 5DG8A 4GMJB 3H4DA 4W5TA 3OJUA 1JLAA 2X6NA 1QTMA 3DM2B 4ZP9A 3S3MA 2OPRA 4JLHA 1L3TA 1KLMA 4B9MA 4KRFA 4IFVA 3O3FA 1S1XB 4JS5A 3HPOA 2I1RA 4KB1A 3G6XA 3NDKA 3RMAA 4HHTA 5KG6A 2AGQA 5F8IA 4MK7A 3OS2A 4FCYA 3B6PA 3OYGA 1SKRA 4YQWA 2X78A 3IRXA 4CJRA 4KHYA 2P5GA 4PA1A 3DLKB 3CYMA 3SUPA 1SUQA 2OPQB 1BISA 2C2DA 3MXJA 5C25B 3NL0A 5T14A 4ID5B 5T7BA 1SKWA 4K8ZA 4QWAA 3QIOA 3G6VA 3RMBA 2BDPA 4ECQA 1R0AB 1SH0A 5EDWA 3K2PA 4FLYA 3PX0A 5CYMB 4DTOA 2HHVA 3NAIA 3DI6A 4OKJA 3BGRA 2DTUA 2J6SA 4DQQA 2ASJA 4KO0A 2GIRA 4KV8B 1OS5A 1NKEA 2DPJA 2FVCA 5SWMA 3FFIB 5KFNA 4EYIB 5HP1A 1XWLA 2HNYA 2BQRA 2XY7A 4TY8A 4BWJA 2D5RA 2AX1A 2WK4A 3IG1B 4FJMA 4RW9B 4KB0A 2XI2A 1RDBA 3ZSRA 1HYSB 3ZT0A 4ZPDA 2FLLA 1DTTA 4AHUA 3F73A 4CJVA 5KRTA 1SV5B 3VQSA 3ALYA 4IFVB 3ZSYA 3FSIA 3BSOA 4OKEA 5KFPA 4CE9A 1JLAB 1IKVB 3PW4A 3HPHA 1DTQB 4QW9A 3V9UA 4CK2A 2BQ3A 4M3ZA 1HQUB 1CZBA 3PX6A 1S1VB 3MEGA 1NJWA 4O3QA 5KFSA 4DLGA 2BANB 3I5CA 3EZUA 4H4OA 2FLNA 1RT1B 3JSMA 1LW0B 2GBZA 2R7YA 1RT5B 3FQLA 3CJ5A 3NF7A 4NLOA 3IS9A 3TAMA 3NGZA 3LPTA 4K50A 1IO2A 4O4GB 1C0UA 3L2QA 4FJGA 1UWBA 2WB4A 1K1SA 3BQ0A 3S3OA 3AO5A 4CK3A 3LP0A 4CHQA 2AX0A 1KHVA 3GIJA 2WONB 1KLNA 3KLVA 1TV6B 2B6AB 4IR9A 3MR6A 1KVCA 2IAJA 1L3VA 3DLGB 3C94A 5DK5A 4B3OA 5KFTA 2YNGB 1VRUA 2G8UA 4Y1DA 4FM2A 5F8GA 2QKKA 1S0MA 3HP6A 4DSFA 4MKBA 4IG3B 1IKXB 4KSEB 4F4KA 4CCHA 3LP2A 5HP1B 4DL5A 3THVA 5C24A 3TI0A 5EUHA 3OYBA 3OYHA 2PY5A 1WLJA 1X9WA 1U04A 1RBRA 4ZMMA 4KO0B 4BE1A 1NJZA 4GC7A 1JLCB 5L1IA 1S9EB 4IBNA 1U49A 3OS1A 1FKOB 2V4RA 4KTWA 4GC6A 1S1TA 3ULDA 5KFCA 2IM3A 3PV8A 1FK9A 3RR7A 4WXWA 2FC0A 3OS0A 1RBVA 4IH5A 3CJ2A 2OPQA 4AHCA 1QSYA 4MK8A 4CFDA 4WE1A 4QCLA 4DTRA 4RNOA 1REVA 3V6JA 4LH5A 5HRRA 4TQSA 4DFKA 3ZCMA 1I3AA 3NGYA 2O5DA 1NOYA 4N76A 5CZ1A 3QGGA 3DRPA 4I2QB 1HMVA 3OL7A 1D1UA 5JXSA 4ED2A 4E7HA 1YTUA 5KFWA 2VG5B 3OY9A 4GVMA 1N56A 1BGXT 4Y1CA 4K4VA 1FKOA 3HVWA 4E3SA 4F2RA 4L8RB 3DYAA 1C1AA 4ED3A 3TAQA 1S9EA 5JS1A 3CDWA
chains in the Genus database with same CATH superfamily
4BRDA 4IQXA 2CQ0A 5DDOC 2D74B 1TL4A 1VIOA 4OGCA 3VGTA 3QT7A 2EHGA 4KKOA 3W7BA 2YHWA 2ROEA 3CUNA 2MQOA 3VOVA 2E1ZA 2UP1A 2FBTA 1VYAA 2FVSA 5BR8K 3A1YG 4UOGA 4U7UD 1X5OA 2BE7D 1Z1ZA 5HOOA 3NCRA 2LEPA 4CJ7A 2KKZA 5A8RB 5AQUA 2X7IA 1BWEA 2J8SA 5LXYA 4OYPA 4CZCA 1S6PA 4F3OA 3QZ7A 2AJFE 2IBKA 3VR1A 4M1KA 5EGYA 1GK8A 3M8SA 1GAOA 1MLAA 4FYVB 3T19A 1SPBP 3QESA 4E8UA 2ZE2A 2F9WA 3ENHA 1TQLA 3JAMY 2W9BA 2AEFA 3OYKA 2F40A 3CD6S 5A8WA 1BDGA 2G8KA 3M6UA 2YJFA 5CD4A 5DQIA 1FRXA 1B7FA 5D4NA 1K8KA 1O8BA 4OZNA 4DV0J 2E7VA 1HKCA 2MDAA 3Q83A 3CJ7A 1QZ6A 2ALYB 4EI2A 1HNIA 3D1OA 1S6OA 3MM6A 3K8VA 5DG7A 2XNRA 4CJUA 4CZEA 2E88A 4TYAA 4FWPA 3KK2A 2I0XA 4DR6K 4JI6F 5CH7B 2O8FB 4A46A 1HD0A 1URRA 2H51B 3QFUA 3VA3A 5F0WA 4DL4A 2DISA 1PAUB 1VK0A 5FLXO 3O8WA 4YY3J 3CCJS 3GG4A 3TSQA 1CJKA 4RZRA 2QWMA 4DR2K 4EUVA 1S76D 1H3DA 4BRPA 1X9SA 3TP2A 1VC5A 3NHGA 1DTQA 1F21A 1QAXA 2F5GA 2VV5A 2JEFA 2JLFA 1PG5B 2AZ3A 2B3TB 1VQON 3RZAA 2CQBA 1VC6A 4CQ1A 4W90B 1TKZB 3AQPA 1J5EK 1JLGB 2VA2A 2RF2A 2EFGA 4ZVRB 5D78A 3H40A 1FEEA 5KT6A 4FVUA 1JLQA 1LFPA 2MHNA 3PEHA 4G65A 2JEIA 4KGVB 1SJFA 1QS4A 5CA5A 3TTDA 5JLHA 1NG9A 5J2NB 1TV6A 3ZX0A 2J0WA 2XBPA 1FKPA 4NXMK 4PPDA 3OR2B 5IWAF 1NJYA 1VQNN 2LDIA 3IMXA 3KHHA 2HAIA 2MTLA 4Z4EA 3H2LA 4KGMA 3HT3A 1BI4A 3R8YA 1VSJA 4GKKF 5KG2A 2W9CA 4PPZA 1M1GA 5CAAA 1X1PA 4J9PA 3KOAA 2XEXA 3HDSA 2UVRA 2R9LA 2XY8A 2NCKL 3GYGA 3X3UA 4GMKA 3MM7A 4QWBA 3JSMB 1Y97A 1NRKA 1LFWA 2AWZA 2KO1A 2JDJA 2ZH8A 4M45A 3W66A 2ERRA 3Q7BA 2VQFJ 3OL9A 4FK2A 2GUPA 3M8YA 2IA6A 2V7YA 2HWHA 1V6HA 2JVRA 2UXCF 2R7UA 3E66A 3JXUA 3S9HA 4YNQA 3CJ0A 3AO2A 1RTZA 2HOEA 3NH2A 3RVCA 1KLMB 3AA8A 3I55S 4MO5A 2BABA 1GX5A 2NUHA 1QHAA 4OX9F 2Z2ZA 4RBUA 3OL6A 4DL2A 5B0CA 2DEJA 4DTXA 1U8WA 3DLJA 4JI0K 2AJ4A 2CPFA 2B9XA 1RUSA 1RT2A 2XYHB 2FJWA 1RISA 1BC6A 4RUBA 1RBUA 1ZBTA 4C11A 4DDFA 3E2EA 2VC1A 2CJBA 5M2PA 2BRKA 2AT1B 3QMQA 5A2QY 1TVRA 5BR8J 2XO7A 5HATA 2FSJA 2E4LA 2FBYA 3GFZA 4G1IA 1NDLA 4XH5A 4KHPJ 1WHVA 4DSLA 3IRWP 3GFHA 3O1LA 1JLBA 2VFTA 1SUQB 5L46A 4LRDA 5A8RA 5KI6A 5AXKA 1SH2A 5SZTA 5JVHQ 5H9EK 3J81O 1GMVA 1T9YA 2YNGA 1Q0NA 1QE1B 1APSA 3R5CA 2J6UA 1HKGA 4N56A 1K44A 3IAM9 3J7ZO 3VESA 5JS2A 3CW2C 3JYTA 3C7NA 3QIDA 2ZBRA 5HI7A 1X5TA 4CHZA 5ETOA 4C8LA 2A5XA 4RW7A 2MSSA 3CC2S 3Q8RB 1XN9A 2YNIA 1ZPVA 3MAAB 2RN2A 2AV5A 4B3MK 1I94J 2M7SA 1X9JA 3OTOF 3GIRA 2R7RA 5A6PA 3H8YA 2GV9A 4WF9L 5BYRA 1YXQA 1U1OA 4IOXA 1JCGA 3GR0A 3T41A 1TUUA 2Z56B 4A2BA 1QHTA 4NLDA 1N34K 3MM9A 4RU9A 3RAMA 4RNNA 2LSNA 4RWXA 3O4NA 3Q86A 4UQTA 4IDKA 4CESA 3PNIA 2UUBJ 2MB0B 1WEYA 1WN7A 5AQQA 3QDKA 2W41A 2DGXA 3RBXA 4RO0A 5DDQC 1HLWA 1UFKA 2VGMA 4ID8A 5IM0A 2NR0A 4CF0A 2HHXA 1KEKA 3CCRN 2ZEJA 4BRQA 2BJEA 4CIGA 1NGHA 1O0PA 2CQPA 3H46O 1OY6A 3LTOA 2EWSA 3SPZA 3L2UA 1FESA 5CY4A 3HYFA 5GAHI 3MN5A 3OLBA 2BEFA 2ZD1A 3WNHA 4IOCQ 2DR6A 3LPEA 1HJOA 1N36K 3MPVA 5J1EA 4DG1B 3UCGA 2QC3A 4A8KA 2FF6A 4DV4K 1N6QB 1AXQA 3BKFA 4FWOA 2IJNA 4YR0A 1VQPS 3M9NB 1I39A 2PYLA 1J9AA 2RF2B 2HZAA 1UKUA 1TKZA 2YQ0A 1BI4B 3MMVA 5GAEU 5BRFA 4RKUC 4MIWA 2JRSA 2HS3A 3GPAA 3GV5B 4DR4F 1DKGD 1FKPB 5KFXA 1B0TA 3GQCA 4FLTA 1RADB 1I6JA 3TA0A 5L38A 4CZLA 2MY7A 3ZFVA 3HFZB 1VSMA 3VAHA 4F26A 1KVJA 4KH6A 2B9YA 2DY1A 1RKIA 2W2OP 4WQ5C 3FRYA 1UFLA 3A13A 3IMQJ 3ZZUA 1XHXA 4ZKAA 1XMOK 4CJ4A 3ITHA 1YBTA 3HVRA 4PWDA 4FXVA 1TUGB 2JLEA 3GCWP 1LNQA 4KJIA 2Q1LA 2W7AA 2BW2A 5DQGA 4DQIA 1ZOTA 3ZX2A 2ATLA 2G2YA 3OFFA 1BWFO 4CFAA 4FJIA 4DSIA 3RSEA 4OVLA 1UTAA 2RDIA 2NZTA 4HCCA 2D3O1 4RNFA 4BDYA 2WC9A 4YR2A 3CE8A 1HNXJ 3MEKA 2OEJA 5KPZA 2CJAA 4GW6A 2IYGA 1X31C 1YITS 1HQ2A 3HRGA 3PRVA 2XGQA 4ZPCA 3DLHA 2FJEB 4OX8A 1B0PA 3QNNA 1L5UA 4DR6J 3TZZA 1GMWA 1C0MA 1BQNA 3KUGA 4X4RA 1F2GA 4DFPA 1IBMF 3ZO7A 4IJAA 2Q0UA 1KHWA 2V9WA 1F5AA 1WG4A 3HSJA 2OD6A 3CJRA 3BGFA 3JXOA 3FFIA 4IOBA 3HO1A 3H98A 3CSKA 1I94K 2X3GA 2W42A 1VSKA 5AJ3F 3BBBA 4R0JA 4WFZA 2HLUA 1HWIA 2KT5A 1BIUA 3TWHA 5CHCB 1UL3A 4JI2K 1TVRB 3CCES 4C8NA 5AQZA 3QO9B 2GX8A 3C14A 5M2RA 5KT2A 4JI6J 1TL7A 2XHCA 2YX6A 1VK3A 1N0VC 3MDFA 1IBLJ 2M88A 2DGOA 3D6FB 7AT1B 2ABYA 3GYNA 3RB4A 2AHOB 3VF0B 3TUJC 3M5RA 3ZETB 3J7YI 1Q82T 4HTIA 4Y65A 3KLIA 1SQKA 2VJVA 3CDBA 4E98A 1VQ8N 1VS3A 3HTVA 3J7ZT 1XNRF 1RCOB 4FOIA 1VBXA 2GNKA 2XYGB 3E3XA 2V4JA 5J2QB 3W2VB 4L3KA 2CPYA 2XI3A 1M5KC 3D2FA 4O5BA 4DV7F 4DF4A 3HK2A 2NRWA 1ZC6A 1FX4A 3WZ0A 4CM2A 4S0MA 2E9ZA 1NGBA 1GTHA 3NKYA 4DZDA 3V2UC 1X3NA 2H4WB 2CQ3A 1MMDA 3EZWA 2CPJA 3ZEUB 1N88A 1DJ0A 2QL5B 3VQ9A 3CM6A 2WOMB 1TMJA 3KMSA 4DUZF 4K59A 1RILA 2HSEB 3UD4P 2GGPB 4MIAA 4JV1A 3FUYA 4K8XA 3KKRA 2BUPA 2QG9B 3HSTB 1CG2A 5GAEP 5M2UA 2ZFHA 3JAMO 3J7A1 1D3WA 1D09B 3PJWA 3BF3A 1FCAA 4V19S 4CNZA 5HL7Q 1HBOB 2Z2LA 1YQHA 3OXGA 2E1YA 4QOZB 2JH3A 2Y0SD 1F1BB 1WG1A 4J9NA 1A7GE 4O3NA 1PKUA 1SIWB 1Y10A 4HHJA 3L7PA 4K5SA 1NK4A 4JI7F 3H4BA 3ONQA 2FHOB 1FA0A 3W60A 1TYQA 3WC2A 3DGPB 3NFAA 3SI8A 2OPRB 3I8DA 2UU9J 4IFYA 3IGNA 3THXA 4EHUA 4JYAK 3EX7B 4CBXA 4FM0A 1OYEA 2M0GB 4NMXA 3THTA 3MMCB 5JLFA 4RX6A 2AYEA 4FJKA 3OYIA 4DOZA 1FWPA 1IUJA 1LV5A 1KR4A 2OPSA 2BUNA 1RDCA 2GFFA 4ZHRA 4WZMA 2DXDA 4U8VA 4DQSA 2ZGYA 3W2VA 3QWPA 2XWYA 3BKUA 2KZMA 4OI4A 1W2BR 3FCVA 2EC2A 5I4MA 1QVGR 2U2FA 5ETSA 1LW2B 4JI1J 2JGUA 5LT5A 4OZJA 3ZYYX 4B9LA 5E84A 4TU8A 5FPNA 3RG6A 1D9DA 3VF2A 4YOWA 1OH5A 4QS7A 2GWJA 1IJJA 4ZCLA 2DRAA 1AFJA 4O4RA 2NUBA 4HHUA 1H7WA 1NHUA 3MEGB 3S1TA 4QW8A 5BR8F 3NGDA 2R8KA 3KHRA 2AP1A 2GO9A 4LQ9A 1HNVA 1HL6A 2FUG9 5CCLA 5KFMA 3QAEA 2I7PA 1MWZA 2VPXB 4HI2A 1SC1B 5DETA 2C2MB 3PW0A 4Y2AA 4NLBA 3BN4A 3VQ5A 2FXUA 2J76E 5KFGA 1CXQA 2G2ZA 5KFYA 4CLTA 3CC2N 3ISNC 1MROA 3HJFA 5EVZA 4A8OA 1Q8IA 2XMVA 4WK3A 4HDGA 4KFBB 2HKEA 5F1XA 2UXDF 3AA9A 4NOHA 3H08A 3P45B 4ED0A 2LEBA 4J9OA 4BQZA 3FNNA 4EBEA 4B9QA 2ZH9A 2DNNA 2IRUA 2NXJA 3DXBA 2BR0A 2RS2A 2ZM6J 3H90A 3NS5A 1WC4A 3TWZA 1FD2A 2D9OA 3AARA 4DR6F 4JI6K 4P71A 1XMBA 1KD1O 2DTJA 4O8KA 3CC4S 4CRJA 5AE1A 4IOCL 1YT3A 4UTGA 4OHWA 1FRLA 2CWKA 4K4WA 1V4SA 4FZZA 1EXQA 4CH1A 4P2XA 3C3LA 1QD1A 2QKBA 2UUCK 2JWKA 3KDNA 3EY1A 3UVJB 3NRBA 2HYIB 4EAHD 4CGJA 2QA1A 5HQ8A 4DR2F 3GOIA 2Z2YB 5C42A 4JKFA 4OJ1A 5LMUF 4Z4IA 3L2RA 1M1HA 3AXKA 5IV3A 1U8SA 4EGLA 3SFGA 4PL7A 4E19A 3VAJA 3CCTA 3HSGA 4CO1A 3AAWB 1J5EF 4M94A 5HVFA 3FMWA 2UU9K 4N5SA 3VQPA 3OFEA 2F4VJ 3ZTRA 2HQDA 1JCFA 3P1GA 4KHNA 2G1HA 4ICLA 1S59A 3G10A 4NCAA 3WT0A 3AVFA 4LSLA 1HBNA 1E6YA 2CIMA 1PBUA 4C3LA 5J2PB 5C2CA 2P9IA 3KLFA 3D1QA 5IXUA 1KP6A 3D66A 4DPUA 3LP2B 2Z2MA 4H4KC 1K0TA 5KFEA 4AHSA 1TL3A 1RTDA 2OPPB 4ICLB 1X4BA 2G4BA 4HH1A 1PYTA 4NLSA 4JI4J 5GMKa 3EGZA 1A5WA 2I2YA 4B1XB 3P38A 4YHHF 4CZJA 3CNQP 3TU5A 1JLEB 3AVJA 1P6TA 3BGUA 5F3TA 1D8YA 5FRMA 3DLLQ 1M90T 3C6TB 1OQ3A 2YKAA 4PEOA 3VQTA 4XPCA 2YX4A 2Q1NA 4AHRA 3A12A 5MLCV 3O44A 1EQMA 2IJFA 3LANA 4YB6A 3SQGB 4HKQA 5DJBA 1R0BG 3VWSA 3VZIA 4IXCA 1X3MA 1SL0A 3J7Z5 3SJJA 5J2QA 4NWBA 5F41A 2Z1IA 3SBTA 3VQEA 1B70B 2HWIA 5E41A 3VMFB 5ADXA 1WC6A 4Z7CA 3H3NO 2JEGA 1RB0A 3HHLA 2RHKA 4LRAA 4NEYA 3TEGA 2PZSA 2DRDA 1Q9XA 2PC6A 1NH7A 3EXYA 2GAHC 2Z30B 3MGJA 1UVIA 2XYPB 1RAFB 1VBZA 3QJPA 3CD5A 4X62F 2IM1A 2UV8G 2DBBA 4O3SA 3ID6A 3DXKA 1FHTA 1XNQK 2D7SA 3SI6A 4OZLA 3BREA 1RWWB 3RB6A 2DNKA 4B1ZA 1JLBB 1VOMA 1PC5A 4BR5A 5J1NA 4G9ZA 4PYAA 1RTIA 4FOEA 4I6MA 1S1WB 1SKSA 1EQ0A 2ITMA 4OHYA 3ULHA 4BBYA 3BO3A 4DR5F 4PG8A 2MJUA 3L8BA 5GMEA 1KRPA 4FKYA 5FIIA 3BGOP 1I3OB 2E1MC 4TSXA 4OYAA 4LFAJ 2R7VA 3IO1A 3K57A 1N32J 1S6QB 3I0SA 2HF3A 1EJ7L 2F9JA 3V5RA 3VPZA 1WDDA 1NK8A 4BHQA 2F8MA 1F60B 1G99A 2OSQA 3UFCX 2PE8A 3NAHA 3RAQA 1ZM9A 1S3XA 2JLGA 3ZSVA 4ECVA 3OTOK 4CH7A 4CERA 3MAQA 4LFBF 3QGHA 1WG5A 5EWEA 4YORA 4I9QA 3WXJA 3MOJB 2IHR1 2H54B 2GMLA 2VUGA 3LW5C 1FWLA 4TXSA 2OEKA 2GZOA 3Q22A 5HMWA 3W8PA 4LVNP 3ITHB 3R2CJ 2VQEF 2HNZB 3G0ZA 2NYHA 3D6RA 3TAMB 1L3KA 4P2SA 2YPZA 5EX0A 4JI8J 5LSOA 3M2VB 2MZRA 2JZ5A 4HI1A 3KLFB 3RWUA 3NF6A 4CO4A 5C0YA 1WC1A 4HL9A 1NMNA 4M5KA 4HYKA 2QIFA 2UVUA 1TYQB 3R27A 4NO7A 1HNZK 1T05A 1IKVA 4NI2A 1B9DA 2W01A 2HBMA 2ZNYA 1D0EA 4JBCA 4Z94A 2DH9A 1DBDA 2Q6CA 3ET6B 4FWMA 3LA0A 4CIOA 5D4LA 1S0OA 3C6UB 3EGVA 4N8OA 4JV2A 2FGOA 4DV4F 3MWPA 3NGRA 2B7BB 2ZM6F 4NLWA 4QS9A 4FS2A 2QEXS 3HVTA 1ZAVA 3FZMA 3MZIA 1L3SA 3GILA 2FJAB 4YOYA 3LGHA 3PIPL 2CA9A 2CADA 1QQNA 3J81j 1TFWA 4FJNA 1UW4A 3U1MA 3V9XA 3DNCA 1FFSB 4DQRA 1TAQA 1HHSA 1WOOA 1RKJA 5ETPA 4M5MA 2PFFB 2VG6B 4ANEA 2CNKB 1YHQN 4NLTA 4CHOA 4PKHA 4K7QA 3RB3A 2R4FA 1T8EA 4CEEA 3MURP 2KDOA 1T6CA 5C42B 3FCHA 4RNMA 3KUHA 1S97A 4Q45A 2P9PB 3P3DA 3CCJN 5HMZA 2FPHX 4MDBA 3QNOA 5B0FA 4ELVA 3AVCA 3TNVA 4PKIA 4DV2K 2B4PA 4DTUA 4DMZA 3ZT1A 3O3HA 4C2MA 2Q66A 1PSDA 4BRNA 6FD1A 4DV6J 1UVJA 1HWKA 3OR1A 4J91A 2CGLA 3HHKA 1YKWA 2VFUA 4EP4A 4Q2LA 1QVGM 1P8ZA 2CKWA 3FGUA 4NYOA 2KRRA 1WC3A 2YWEA 4AQYJ 2DNZA 1SCJB 4CD3A 4DL0C 1F0XA 3VAKA 4BRMA 3FSYA 4IH6A 1G1XA 3TA2A 4EYHB 4CEOA 4J9VA 3P5JA 1HW9A 1VQMN 3SQ2A 2Y8YA 2P9SB 2HS0A 3CDEA 2W7OA 3N4PA 3VAIA 2E66A 2PO4A 3D1HA 3SQ1A 1T9TA 1KQFB 5EWGA 4Q8EA 3LDNA 4IYQA 1AUDA 3H3OB 5LSRA 3TJAA 1GNKA 2LFVA 2HZCA 3LALA 3NF8A 2HGMA 4IOAL 1OSDA 5JICA 2Y1RI 3TARA 3EKSA 2A6AA 2RDJA 3KLGB 2QL9B 4WU3A 3M1VA 4DMNA 1QQCA 1DAXA 3BB5A 3CPWM 2NRZA 4KYZA 4PY5A 3FR0A 3TSPA 2ZUGA 3G82B 2Q43A 1BQNB 4OZ2A 2HBZB 4CJFA 3BQ1A 1C0UB 4WXOA 2ZQBA 2O4IA 1ZZNA 2D3ZA 2NXNA 2C2RA 3NCPA 3TZXA 4OI6A 2LXUA 3GLJA 2UXCJ 3AB2B 4WTOB 3UNGC 3EGNA 4M5HA 3VAGA 4QR0A 5KFKA 2BJ9A 2DNLA 3FLCO 1VQKS 2DO0A 2RB7A 2QWRA 4W5TA 3O5BA 3G25A 3MM8A 4H0XB 1HNZJ 1DQAA 3P6YC 1CJVA 2X6NA 4PHTX 4IO9L 3T1YJ 2NRTA 5AT1B 1N0UA 4KT0C 2BOAA 4QR1A 1G3OA 1SI9A 4IFVA 2RUSA 3O3FA 3Q8VA 3HPOA 3KG4A 2I1RA 4JV5F 2J9EA 1NM2A 3WXIA 1SQGA 4DV7K 3AJ1A 1RDWX 2AGQA 2VWBA 4QIVA 2NUUG 3PYFA 1ROFA 2BX6A 3PCOB 4RJVA 1AT1B 1SKRA 2X78A 4WFAQ 3IRXA 4DCPB 2VBXA 5IT9O 1LWXA 1GLBG 2MQNA 3R7NB 1T0TV 3FZKA 5C25B 1VBKA 3FBFA 4DUZK 1WF0A 5D8HB 1SH0A 3OTBA 3K2PA 4B3TF 3PFEA 2QA4G 1HWJA 4DQQA 4KO0A 2GIRA 4WTYA 3DGPA 4I6WA 1OS5A 3R6LB 3ZEUA 2MKJA 3QT8A 1N33F 5H9FJ 5KFNA 1GMWD 2XY7A 4B1YB 4BWJA 5C7PA 2UUAF 2WK4A 3IG1B 1FO1A 5IQQA 4KB0A 2CRLA 2E5LF 1RDBA 3ZSRA 1HYSB 3O2IA 2MXYA 3HHLD 1PBAA 4YB1P 1EO1A 4BVOA 2O66A 2X1GA 2XSFA 3ALYA 4IFVB 4JYAF 3AB4B 1NSKL 3A8KA 4ZPWR 1MA9B 2MMYA 1BMQB 3BSOA 3M2UB 5KFPA 3L7UA 3PW4A 3HPHA 3M32A 2GGPA 3OTDA 3PX6A 1S1VB 1YHQS 1NJWA 5KFSA 2M2BA 4V19J 4H4OA 2FLNA 3DCAA 4OX7A 2CQIA 2R7YA 3CJ5A 4KGXB 4LF5F 2V4JB 2BJDA 4K50A 1T02A 1IO2A 3FEZA 4O4GB 1C0UA 2RHSB 4DV0K 2A0FB 4FJGA 2WB4A 1K1SA 3OT9A 4BREA 4ED4A 3VF4A 4WP8A 3GIJA 2V6AA 2P9UB 1ZBSA 1RXOB 1WHYA 2R7OA 2B6AB 8AT1B 3PYEA 1TR0A 2CAJA 3CMEN 2VD3A 1DRZA 5KFTA 2V68A 2YNGB 4DJBA 2G8UA 2XWXA 2QI2A 2L08A 2VDIA 4F4KA 3MN6A 2LQ8A 5I3PA 4PYDA 4H0VB 2OFGX 1WHXA 2B8QA 1HD1A 1R8HA 2GIFA 3TZYA 2J5AA 4LJMA 1NJZA 4V1Ak 1S9EB 4IBNA 3OS1A 3SCIE 3S7RA 2HWTA 3OFHA 1IBKK 3I56N 4KTWA 2DB1A 4DV7J 2IM3A 3PV8A 2NZ4A 5IT4A 3US5A 2NXUA 4WXWA 1U6ZA 5IC6B 1YJNN 3SSRA 1UJ5A 4LF4F 2JSXA 3OS0A 1QM9A 2EW9A 4IH5A 1HLUA 5LL6d 4HR2A 2DITA 4WE1A 2K7KA 3CJ1A 4DTRA 3MCNA 5HRRA 2QSFA 3NGYA 1TZ0A 4N76A 4NE9C 1VCTA 2NNWA 3DRPA 1FJCA 2APOA 5A0YB 1HMVA 1N36J 2RJZA 5KFWA 2H9ZA 1VJWA 3OY9A 2FHKA 1N56A 1BGXT 4Y1CA 2QX0A 2FIUA 1FKOA 3M2RB 2D0OA 5K5MA 3CDWA 5LMUK 2B5JA 3M9OB 3PVXA 4DL7A 3WBZA 2ZJPL 3OSNA 4PWDB 4DSJA 5AXLA 3DWLA 1SJRA 1FD8A 2NRRA 2HHWA 4CLFA 1TAUA 5A6WA 2GAGC 3IDHA 3LUYA 4WWSA 2J7WA 5D3GB 4UY85 2O3DA 4OPJA 1FJEB 3OR2A 5IT9U 3DRRA 1N5QA 4ALZA 4DV1J 3DDIA 3O6QA 2WONA 4BGBA 1X4CA 1NK6A 3ZSOA 1WKLA 1WHWA 4CH0S 2ZH4A 2ADCA 3NOGA 3FZLA 3D0HE 3I9ZA 4AH9A 3HI0A 3AJ2A 1ASWA 1S48A 3PIOL 4WZQA 2OEMA 3CJTA 5KT5A 3IAYA 2R8GA 2IA0A 2QMWA 2DYAA 3V9WA 1BQXA 3O4QA 4DR3F 1VHFA 3M9MB 5HRPA 5AQVA 2OTJN 4Y6IA 1H0HB 3DMJA 3A5LC 1DLOA 5GAHU 1UVMA 3QNWB 5CYQB 4BACA 4X2BA 3C0BA 2R8HA 2KFYA 3MN7A 3OHBA 2IMOA 4H8KA 4X66J 1VISA 3QIPA 4ETXA 1RI7A 3CJKB 3CERA 3MR2A 1VQSA 3M8RA 2K2PA 4BRLA 1X5PA 2KHCA 1S6QA 3I0SB 2YVSA 4O0NA 1YVUA 2O8CA 2NREA 2N7YA 1E6VB 3MI7X 4OJGA 3PKYA 4IDKB 2B56A 4JI2J 2DGVA 2P8IA 1B64A 1ZA1B 3LWLA 5K20B 2WB1D 5B0EA 1Z4UA 1ILYA 1Q8BA 1WI8A 2VCPA 1ZS6A 1OO0B 1KFDA 1J53A 3L3VA 4WFNQ 4GVBA 5A8WB 3DXKB 5AZJB 3HHLC 2NRXA 3WEEB 3MCSA 3MPDA 3UR3C 3K5MA 4X62K 3P5BP 2Z8QA 4C9DA 4RL1A 1KD1T 4OLPA 4U7CA 4GKJK 3EPGA 4JUZA 2FY8A 3D7EO 2BJ7A 4JN4A 3NBPB 1RQ0A 2CDQA 1U1QA 4LC9B 4I67A 1QE1A 4DR5K 4DCHA 9ATCB 3VEOA 3W1YC 4Y0WA 4U7BA 3QBWA 1FFWB 2VL1A 4WQ4C 3AA3A 2FGCA 1RHJB 1RAOA 3WQUA 2E5GA 2WVCA 4LR9A 1A6LA 3A5MC 4RU2A 3R7SB 3UDLA 4FYXB 5AQLA 5DS7A 1FDAA 4NA3A 2IVYA 3G6ES 3D54A 1BIZA 1R8CA 4R0EA 1DY3A 3V4IA 2BOPA 3M6GA 2R7TA 4CLKA 4KKOB 1JWWA 5AJ3J 2F8TA 3ZT4A 1HHTP 4YP3A 2MY8A 4ZVHA 4DF8A 1K0VA 5I3UB 2E1CA 5I9EB 3DYAB 3JS9A 2WVEA 4A8FA 1LXNA 5EOYA 4ZCKA 3ILOA 5KT3A 2K3IA 1CC7A 5CQGA 4DXLA 4O3PA 4XK8C 3S6EA 4O3RA 2FJDB 4WFBQ 2OKQA 1FRIA 5L1KA 4DWIA 3I56S 1SQEA 4F3QA 3D7SB 3H2UB 4OHXA 3WXKA 1UAWA 2GQCA 2LXIA 3F2KA 1NNEA 2DGQA 1RTHA 4F3TA 5JMVA 1LCUA 2NXCA 3ADAC 1RYSA 1WOPA 3V6KA 2YKMB 3A3NB 4ZDNA 5K8PA 4BG8A 3SBGA 5HO4A 2DCLA 5JUMA 4JV5J 1AA1B 1RWOB 1FK9B 3BYPA 1Y5NB 3TPQA 4FVMA 2Q79A 2GQQA 1WF1A 1X4FA 3LL3A 3VVTA 3GTYX 1S4FA 4DTMA 3THXB 1SL1A 2PA3A 4L72B 1YITN 2UXCK 2Q0RA 4DU1A 3LAKA 4ZA1A 1IBLK 5AQFA 4JKCA 2EK6A 3D45A 5CYMA 5AXNA 5D3GA 4A4JA 3G86A 3CMAN 2XLJA 4FBUA 3BP8A 2ZKUA 2HVIA 4J2BA 1CJKB 4FPRA 4ANCA 3RW7A 4A61A 1IXKA 4JI0F 5K8OA 4A8YA 4F02A 4LMZA 2GQ2A 4KBIA 3LM9A 3BDPA 4FN5A 2UXDJ 4KV8A 3R6GB 4R25A 4IO8A 3G71N 3CCQN 3VQBA 2Q3SA 1LWEB 4C98A 4CEDA 3IBFB 5HQLA 4B3RF 4JKDA 4FW1A 4A2AA 1CZ9A 4ZIWA 1F2HA 3RYLA 2ILZA 4IRKA 5KGXA 3CCVN 3AAQA 2Y1JA 4FWNA 4CEQA 4DV2F 1IQZA 1HFEL 4M7YA 1K1QA 2QLWA 1VQ6N 3ZX3A 2EWHA 3KHYA 4R5PA 2DPNA 4CI6A 1L3UA 3ZZOA 3VTIA 2CVEA 4OZ5A 3SV3A 2GELA 4NXMJ 5C15A 1MDUB 2ZJRQ 2BE9B 2KXNB 1TK8A 5KFBA 4DU3A 2WVFA 5HRNA 3QSIA 2FVRA 2RILA 2H4YB 1ZBHA 3AA4A 4ZVPB 1IV0A 2HURA 2W9AA 1CVJA 4KH5A 2KN4A 5DZ7A 2E20A 1YJ7A 5IS2A 5ETRA 5I3UA 3I0RB 2PA8D 3KK7A 2R2UA 1OY9A 3IBWA 3O08A 3CCWA 5A76A 3A4TA 4WFYA 1VQ7S 3FZFA 4ECZA 3V6DA 5E7OB 1WOSA 1YX2A 1J5EJ 2UV8A 4ZPAA 1QAYA 5M1FA 2J0SD 4GVBB 4DFJA 3MEDA 2E5JA 2J9DA 5FPEA 4M95A 2ATQA 4C97A 1NB7A 4OZ0A 2OYQA 2D0CA 1NHVA 3M1VB 5F0XA 4HACB 2LMIA 1HJRA 2C2KB 3NBPA 2KXHA 1UVKA 1N5VA 1QAJA 1V3RA 5KG5A 3TR5A 3EPIA 2V8HA 3HBTA 2DKOB 1FRKA 2XMAA 1KFSA 3N6LA 3DOMB 2XY6A 4MT1A 4E1NA 4NXNF 3PO4A 1QLNA 1EARA 3O9SA 1R0CB 2AU0A 3IFEA 2IIHA 2M4MA 1N36F 2FHMA 4NZ0A 4YDUC 5CYJA 3TABA 3OW2R 1OWXA 5M1QA 1UOCA 3GV7B 1VMBA 4K2JA 3W9HA 2QL7B 3C16A 1HNWF 1Z26A 1UPMB 5G0RA 4B8AB 1LWEA 5KG4A 1DLOB 3HULA 4CI0B 2KXFA 4RWWA 2B0GA 3M2UA 1EAYC 3KTQA 4DSEA 1NNDA 3I32A 5ETQA 4C8MA 1D9AA 4G1QB 1X4DA 4KQZA 3TAEA 2MSTA 3CCUN 3GE1A 3SV4A 4TKTA 1JK9B 2DNYA 1V5VA 3ET6A 1ZYQA 1B99A 5EWFA 4F4XA 1F9HA 3MMBB 4Q44A 1WD6A 1FDBA 2V0NA 2RHQB 2YXLA 3HPGA 5KOWA 1WDTA 1R27B 2CVIA 1YJRA 1WSRA 3R2DJ 1OH8A 3QATA 3A8IA 1YJ9S 1RAAB 2FD2A 3C46A 2EFPA 3JSRA 5EX3A 2GTDA 3HFVA 1KQSR 4AYBD 3V6HA 3HZGA 1OYDA 2O67A 3TYTA 2EC0A 3D0IE 1N6QA 2AEMA 3IS9B 1KXPA 1VQ9N 1GOCA 4PG6A 2ZVSA 1HI8A 4BE2A 5C25A 1M1KT 3MD1A 2EPIA 4U9RA 3P39A 5D0GA 2VG7B 2CPXA 1M5VC 1JX4A 1N32F 3CFPA 3M8PB 2AKWB 2F8EX 2UUCJ 3E1YA 1M0SA 3NNHA 4DL3A 1S72N 1IBMK 5AE2A 8ATCB 4DFMA 3PZPA 1VSDA 3Q8PB 3IR6B 3MFHA 3W5XA 1S0NA 5A0YA 4BC9A 2VYPA 1RE1B 4Z37A 4CD1A 2A6MA 1XNQJ 4KHQA 4CJ5A 3H45C 1YK9A 3JB9k 4JI2F 2ALZA 2IY5B 2KJVA 4ILGB 4B3MJ 2K1RA 2L48A 4NYPA 2G9OA 4BQLA 3THPA 5KQ8A 2V67A 2C1EB 3BF1A 1R6VA 1AW0A 4J9KA 1RT3A 3GYXB 1UZDA 3F9MA 2P2CB 3TOQA 1DT9A 3DXMA 1QSSA 3ZSWA 1QVFM 4CF8A 2ZOGA 4X4VA 3TQ1A 2VASA 2VIHA 3QB0A 1HQUA 4KAZA 4DX7A 1S22A 3BS9A 3U4LA 3GP9A 1SC4B 3AXMA 4I64A 4Y2KA 4JOUA 2R3VA 1EETA 2P9LA 2WRMA 3MPYA 1UA1A 3KLGA 2COLA 2A1BA 4UUXA 1VR6A 5KFZA 3AVNA 2BKPA 3N6MA 3NGUA 1CLQA 2HVZA 3OTOJ 4F50A 2KVQE 4HUEA 5F3ZA 2GO8A 1SS6A 3TAPA 4IH7A 1RGVA 4ZPBA 1M1KO 3GSIA 2FSNA 4IO9Q 1NOZA 3BO2A 1QQMA 3AVHA 1FDNA 4EO6A 3CIZA 2IMWP 1S1XA 2LCWA 2P9UA 1XK8A 2OCEA 4ANDA 2IIRA 1F9FA 2MZSA 2JVOA 2DIVA 4M5NA 4OL8A 1VQ4S 4G1PA 5F0UA 5CXTA 3SQOP 1HBMB 3F41A 1FVQA 4MKAA 1PIEA 1OPZA 2VC0A 4A48A 3GONA 4OPKA 4OO1J 4LRFA 4J8FA 4H4OB 2VB6A 4CZMA 1Y5LB 2Z57B 4UW2A 2P9PA 2A3ZA 2VJUA 2WZ1A 4YEAA 5AQRA 1YGYA 3T5KA 2OZSA 1XMQJ 1KC8O 2JOQA 4X62J 4IOAQ 3C6TA 4E89A 3KK3B 3BPSP 3W5ZA 4GVEA 3NF9A 4L76A 3IBCB 3MF5A 2VG6A 5E3RA 1OY8A 3B8AX 4BRAA 4DPWA 2FBVA 4F4YA 4LIRA 3LGMA 3DOLB 2LECA 2DVIA 3CGIA 1SQFA 1KQGB 1RA7A 3V1OA 2MZ1A 1F5BA 3MM5B 2RRBA 4C8YA 2BJ3A 2V94A 3CCEN 2V5HG 2O8BB 4P73A 1HPMA 3MM7B 4QJVA 4CP5A 5KAKA 5K8NA 3TX8A 4USHA 4OLBA 1M5HA 1HPZB 3TANA 4X4UA 3KK1B 2KH9A 2KT3A 4LD0A 2VWKA 2C2OB 2EXUA 4YR3A 3OYJA 1V9OA 2O8EB 2G8FA 3HLUA 3HVAA 4TY8B 3SXLA 5THWA 4B3RJ 3UD3P 1RTJA 3IUCA 4DR3K 5ETKA 1JJ4A 4FL9A 1U2RA 3CJ9A 1HI0P 4WYLA 2DRBA 5L9XA 2JWNA 3L3CA 3LDLA 2P1JA 2GJFA 4WK1A 1I5OB 5H9FK 4CJPA 4CGGA 3HI9A 4B08A 3HHDA 1XC9A 3T1AA 1JXVA 3SK3A 5ETTA 4H5NA 4J2EA 1MWMA 4YOVA 4Q0BA 2Z58B 3ENAA 2VZ9A 2GX9A 1KAZA 5E2QA 4R79A 4BDZA 3L6QA 4TY9A 4USJC 2GV1A 4RBVA 1NK5A 4OMFG 4MYUA 1TL5A 2D3OR 1JXLA 3MR5A 4G3IA 1REVB 3L2VA 5KG1A 1N5YB 3O3GA 4LVOP 1FRJA 1XI1A 3SCJE 3QQCD 1HWUA 3KYLA 3DOMA 1MMLA 2GCFA 2C2NA 3FDSA 1JLFA 2BM1A 2QW9A 4WPAA 1EIYB 4DTNA 3NP5A 1CJVB 3GDQA 1RT6A 4AXJA 4ZVUB 2PMWA 4NCGB 1MROB 3FZBA 1H98A 2KG0A 1P1LA 5L1LA 2OTLN 2M70A 3CULA 5FRNA 1BD6A 4M3YA 2HQCA 3DXMB 3TSUA 1U6FA 1UWAA 4URQU 4M8LA 2QGFB 5J1PA 1SJ3P 2UUCF 1HNVB 3AD7C 5J2MB 5HLFB 3R5BA 2RUGA 3AVIA 3NGTA 3I0RA 1KVIA 3PFOA 4M5IA 3G82A 3LZIA 2ZITA 1LW2A 4BC7A 2C42A 2LVWA 1VQ5S 4DPYA 4LH4A 4WYBA 5K14B 2ZBPA 2R7WA 3MX5A 2CJKA 3R8EA 5GADI 1KCFA 4FVCA 3KVGA 3PR5B 1SL2A 3KLEB 4B9SA 3PR4A 4WKYA 3PW5A 4NYZA 3BN7A 3RBEA 2UXBF 1Z05A 5FLXU 5FROA 2GEMA 5TKYA 2YX1A 1KQKA 4Q0BB 3ZT3A 1WOQA 1WELA 4U67L 5F9LA 4O5FA 4RW6A 5ETVA 2KI2A 4CLSA 3T5HA 1C1BA 2AJQA 2CGJA 3QEWA 3HZEA 1H38A 4IWVA 1EZZB 4ZN1A 5BREA 2YKNA 3K0SA 1ZBIA 4JHDB 3KIOA 4I9LA 1FE0A 2Z1HA 1PC4A 2BJ1A 2HQ3A 2ETJA 1YJVA 1Q86O 4DR7J 4CO2A 4IG0B 4Z4HA 3L7OA 3EDRB 2PD1A 2HHQA 5LJVA 1CULA 2DFFA 3VN5A 4CTAB 1VHIA 5DZ6A 2OHDA 4A8QA 3GWCA 1PCAA 2HPUA 3DRSA 1RK8A 1HBNB 1IBLF 3LDPA 3UN3A 5KQDA 5T7LA 2AJ2A 3FBEA 3OYLA 2G1DA 3M8QB 2UUBF 1GEHA 1RZMA 4K43A 3WHIA 1ZAXA 1WSHA 4ES3A 4ZS6A 4USVA 2X74A 2NXEA 7FD1A 2HHSA 4CYUA 5T7LB 2ZH2A 5HJYA 1WTFA 1HBUA 3QERA 1XEZA 1WEXA 2HW3A 5CR4A 1R8BA 4CIEA 4PR6A 3DJCA 3IAS9 3OVAA 4B9VA 4IG3A 2A40A 4CEAA 1NEEA 1RDDA 4O0IA 3EN9A 1U48A 2JFKA 4CDIA 4PXBA 3AO4A 7FDRA 1BCOA 2CG8A 2J0XA 4JI3F 2X1AA 2BE2B 4B3RK 2D3UA 1NGIA 3TUIC 4EK2A 4DN0A 4RW4B 3M7VA 3N5FA 2CH5A 1XNQF 4HVZA 2ZH5A 3GMGA 1U0SA 5AZIA 3MR3A 2A18A 4X4QA 1Q81T 2BVZA 1JMTA 3KNGA 2IC3A 3MDQA 3VEZA 4RW6B 3QRQA 3MEDB 1FEHA 3SSQA 5J2MA 5HLFA 2MZQA 4LBHA 4K25A 1S4EA 4LF7F 3NLCA 3K5LA 3HOSA 4X66K 3J80Y 1HHQA 3HHEA 2A1SA 2FTRA 4KTQA 1R59O 2HFVA 1ACMB 2WFBA 4KFBA 1S6PB 3D68A 2HHPA 4HACA 2H5JB 3HSDA 4MFBB 4ZTFA 2YKPA 2DGWA 4DQ8A 3NMUA 5AQJA 1S1WA 2XMKA 1Y64A 1WNSA 4LFBK 5HAOA 2WVDA 4BRKA 1FKAF 5I42A 2NSCA 3MFIA 3SCLE 2NZCA 8RUCA 1EWRA 1Q53A 3CT9A 1KOOA 2ITGA 2VQEK 3B82A 4W5QA 4F4AA 2AEJA 3ILLA 1YLXA 4LF5J 1XQIA 3E01A 5HSPA 4FDFA 3DLRA 2J6TA 4IRDA 4RWTA 1MW7A 2OTLS 1Z2ZA 4A59A 4CWBA 2DFHA 3BUZB 1HNZF 1S6UA 6FDRA 2E2PA 2DD8S 4EFAC 1D5AA 4I0WA 3T3FA 1ICEB 1N52B 3J7AP 3JSBA 2GC8A 4ILHA 2VONA 5B0BA 1N5YA 1V5IB 1XJWB 3NVKA 3P96A 2OH2A 1ASUA 4I2PB 4TN2A 4QIFA 4NEZA 1FFGB 1UEVA 4XAKA 2RT3A 3MHYA 2VPWB 3S3NA 1SJ4P 2LP4A 3ZTPA 5GAGU 3PUFA 2KU7A 2NS1B 2OPSB 1WKKA 5A2QU 2HHUA 4EZ6A 1P90A 3VGVA 3IKMA 4ZJLA 3V9SA 3HHNB 3WUHA 4IJNA 4CFBA 1W97L 1N34J 3NY0A 3OL8A 2YH1A 3BJYA 3TR8A 3CCLN 4IFYB 5GADP 2OGUA 1GLCG 3VEWA 4C23A 5F8NA 3NNCA 4OI0A 3MCMA 2G8WA 3T1HK 3CM5A 2CJXB 2XCPA 2D1KA 1F9EB 1E4GT 4EP5A 2CZ4A 1LOUA 1WKJA 2QEXN 1VRUB 4DHVA 4OYMA 4PXCA 3UDVA 2KG1A 3CCSN 2QTWA 3U6FA 2ZDOA 3AODA 5LL6Z 1O1WA 2BH1A 3RR8A 1WUAA 3VENA 3SIPB 4ZVGA 3GSDA 4OJRA 1K9MT 1GLLO 2QXFA 3MMBA 5IWAJ 4IR1A 1C1CB 4R8UA 4B8CA 1Q82O 4KHWA 3QYYA 1C0TB 3QJJA 4IFEA 4DTJA 4OLOA 2DHSA 5KFQA 1IKYB 2FJBB 3AQOA 1XR7A 4BC4A 1N32K 1RT4A 2A10A 1CJUA 1JJCB 1NHKL 1EP4B 5BN9A 3F0NA 4C48A 2XG8A 2V8PA 4CJEA 3TX0A 4YOTA 3DHXA 5AQSA 4JI4K 1JXEA 2Y8WA 3R3TA 3H4DA 4GMJB 4B3SJ 1AUSL 5KPTA 1C4CA 1QTMA 3DM2B 1PO6A 3S3MA 2MEWA 1OQ6A 4X64F 1S1XB 4DU8A 4JS5A 4ILMA 4KB1A 3NDKA 3RMAA 5KG6A 5LM7E 3TVYA 3OS2A 4X4OA 3R9PA 3B6PA 1CJTB 4YQWA 1HBMA 2MPUA 4KHYA 2ZNZA 2HFNA 3P8BB 3ZETA 3CYMA 1X0PA 1SUQA 4TU7A 2OPQB 1NH8A 1BISA 1NWKA 2C2DA 4Q2MA 3NL0A 1SXLA 5T41A 5T14A 3QIOA 2QA4S 5L9NA 2L9WA 2ASMA 5EDWA 3L9ZA 4FLYA 2D9PA 1ZH5A 3PX0A 2FQQB 4DTOA 3NAIA 3DI6A 4OJHA 3BGRA 4LF8J 2DTUA 1XMQF 2Z0GA 3I87A 3IM8A 4MLEA 3R5AA 5JVHL 3BY5A 2EEYA 2HNYA 2BQRA 2VKZG 2D5RA 3SEOA 3D9BA 3F5TA 3PEJA 2XI2A 1PJ6A 2NQPA 2OJ3A 2VQEJ 1KAYA 1DTTA 3B78A 4AHUA 1VQKN 1MWQA 2ZH1A 2AZ1A 1JB0C 2QWLA 5KRTA 5MAOA 3VQSA 5M1PA 2IJRA 1JQGA 4K8RA 1KS2A 2E8AA 1H6KX 2C3PA 2XS2A 3CF5Q 3UB5A 3ZTSA 4QW9A 3V9UA 2F63A 2BQ3A 1HQUB 3ZZPA 4AD6A 4GKKJ 3MEGA 1Q79A 1S5ZA 3HFKA 1CJUB 1T9XA 2GBZA 3FQLA 1N33K 2V69A 2BKOA 3NF7A 3IS9A 2DR9A 3NGZA 3LPTA 4YB7A 1ATRA 3CJKA 3I96A 4BR9A 4M7XA 3RUBL 3L2QA 1RAHB 2RNEA 4ZJOA 3BQ0A 2E5LK 3GG1A 3O9RA 4U7UK 1BUXA 3RGIA 3SAHA 3BF4A 3AO5A 4CK3A 3LP0A 2PEHA 1KHVA 4DV2J 1LK7A 1KLNA 1RWVB 3DDNA 5A8KA 1PJ7A 4ETZA 3M3ZA 4IR9A 2IAJA 3DLGB 5DK5A 3BV8A 4B3OA 1O6XA 1VRUA 3PRDA 2F8HA 1S0MA 2IVPA 2KM8C 5BR9A 3DRYA 2AA4A 3J81Y 4GKJJ 1W7WA 3LP2A 2MQMA 5C24A 3TI0A 3O1WA 1Q18A 5G4DA 3UDCA 4XH1A 4K42A 4OX9J 4KO0B 3BH6B 4P7VA 2D69A 4LF5K 2PFDA 1FXRA 5L1IA 4UT4A 3BYRA 4DV0F 1OSCA 5AQOA 1TU0B 3NS6A 4GC6A 5D0EA 4AM7A 2RQ4A 2QWPA 1S1TA 1BHNA 4LSZB 1N8RT 2VKRA 3RR7A 4NXNJ 4H5RA 2FC0A 3R3LA 5C2DA 3VAMA 1VQPN 3LPYA 3CJ2A 2M52A 1YDLA 3FBBA 4FWKA 1HW8A 4AHCA 1QSYA 3QT5A 3BM7A 4CFDA 1VQ4N 2R42A 2DNQA 3V6JA 4TQSA 2AYBA 2YWKA 3M2RA 3MM9B 3R5DA 1C4AA 4C8ZA 3ZCMA 3P4UB 5HMXA 1NOYA 1WACA 4I2QB 3HOTA 3OL7A 1OH7A 2VBWA 1Y9OA 2OANA 1H2UX 1YTUA 2VG5B 3CPEA 1K8KB 4OI2A 1YJ9N 4K4VA 2G2OA 4EMDA 3HVWA 2HMPA 4L8RB 1ESVA 3TAQA 2DNRA 3W8GA 3ZC4A 1T3NA 1NXIA 5HANA 4JNEA 3R1LA 1Q5YA 1DZ5A 2W9BB 2MQ8A 1HNIB 2EFNA 1RU2A 2NPIA 2OSRA 1GXUA 4AE5A 3CIMA 4B9UA 1NU4A 2W6LA 5KOXA 4CEFA 3VVUA 3BSNA 3VALA 3G4SN 5B0AA 1VBYA 5CZXA 4EZ9A 1HUXA 4Q8FA 3CQYA 3HKZD 2YHYA 3PW7A 2QWQA 3BEXA 1RBTA 9RUBA 3CDUA 2YHBA 4FLXA 4ZTJA 1ASVA 1NDCA 1YIJS 5F9NA 3CFOA 4WF9Q 3C65A 1YZ7A 1U02A 3UE5A 1TL1B 4LF8K 4J9UE 4LRBA 2ZE2B 4ZVOB 5HK4A 1BUPA 4YMEA 2VDHA 1JJ2R 2B6AA 4PRFA 4RUAA 4FLUA 3SCXA 3K17A 3NMAA 1S77D 4Z4FA 4HCBA 1DEJA 5C5JA 1VHXA 4RW4A 2AYMA 2DXEA 2V51B 3FKBA 4FK0A 3HXMA 4J9LA 1R8AA 4C7QA 1C2PA 1R3NA 4FXWA 2MGZB 2UXBK 1NSQA 5E3AA 1YF5L 3NS7B 4USTA 4BLGA 3O4WA 2ZWOA 4J2DA 4CFCA 2HQGA 1VQ8S 2CNNB 4OYZA 4CO0A 4OKKA 2O8DA 2VFRA 3O8MA 3GIKA 3MCAB 5HN0A 3M32B 2XLIA 1TP7A 4DQPA 1YUWA 4NYNA 5KGWA 1UFWA 1UEUA 1Q1KA 1T3VA 4ITSA 3J7AN 4FWQA 3DRSB 1FERA 3AVMA 4GO7X 1CZAN 2XY5A 4CTAA 2AYGA 3K59A 3HVTB 3M6VA 2OIHA 3SFUA 3CJAA 3NH1A 3OXLA 2W8KA 4DG1A 2HQIA 1AFIA 2IAJB 4YFUA 5C24B 3CVKA 1R6YA 1JIHA 3VCDA 2MHEA 4NRTA 4CZGA 3CC7S 5LXRA 3NEKA 4ES2A 1JLQB 3A5NC 2W2NP 3SUOA 1SB6A 1H2TZ 3M05A 2JX2A 1NPRA 3CJ8A 2F96A 2J7UA 2WOMA 3OLAA 2MKHA 4PWWA 1HYZA 4H4MA 5HRSA 3BKTA 2A6OA 4O55A 4NX9A 3ENQA 1XBWA 3H7HB 3K89A 1A5VA 4JI3K 2IM0A 3MM5A 3AD9C 3OQ2A 1K73T 4BE0A 4UQGA 2VBYA 4CJ3A 1S5JA 3T5LA 4M5LA 3EE9A 3VQ4A 1B4SA 1NKCA 3CJQA 2OMLA 3CWJA 3H5YA 4Z0UA 5LJ5Y 4O23A 3DLGA 3OW2M 4GKJF 2VGNA 4JK8A 4ER8A 3NXZA 3LAMA 5JVGL 4K4ZA 3N5BA 3LP0B 3HL8A 1IBMJ 4NLGA 2GMHA 5GAGI 5DO2A 2V8VA 1IBCB 2IVFB 5KT4A 4B02A 2DO4A 2I8EA 1NBEB 1T95A 3JQJA 4JD2B 4F0KA 4K0KJ 1EX4A 5HJXA 2B51A 1VRQC 4KREA 2IDOA 2LXFA 2XMWA 1WB9A 2OMOA 5BJRA 1NUEA 4N8NA 3MXMA 3OYDA 1NJIO 1OJ4A 1VLYA 3MR7A 1RNHA 1BLUA 4KPCA 4LF9K 2FLPA 4HVJA 1JLCA 4X4TA 5E3QA 1ZAWA 1U45A 2XC9A 2DY9A 2NYIA 1R31A 2LQJA 3RRHA 3WX4A 1GOBA 2E29A 3JSYA 4ELTA 5JJBA 4AQYF 4RPFA 2E5LJ 3U9DA 4FJ9A 3N01A 1OVYA 3EZ5A 3QRRA 3OR1B 3SQ0A 3QFHA 1RLCL 3T7ZA 2HBLA 3AT1B 1H2VZ 2R7XA 4ZVEA 3PRBA 1U26A 4RR5A 1YSJA 3RB0A 4OZ3A 4FBTA 4DV1F 2CZVC 2FC9A 3QIPB 2CQ4A 3WIVA 1IWAA 5AQYA 1BWVA 2HMIB 2UUWA 3I5BA 3POTA 1NU0A 4O4GA 1TKDA 1X7VA 2B4UA 2W2MP 4O3OA 1YI2N 3GCXP 4H0YB 4I2QA 2ZH7A 1W2IA 5KFVA 3QEPA 5GIPA 4FKXA 1O5JA 4ATNA 5GVQA 2KRBA 4RNHA 4JI7J 4PCQA 5E5NA 1IG9A 3CMAS 3KG0A 2FLOA 1RT4B 2ACYA 3WNEA 5DGAA 1SJ1A 4H4MB 3H5SA 1J27A 2L3MA 4X65J 5CE3A 1FWKA 2P6SA 4FZYA 4ZCIA 1CS4B 4KRWA 4K0KF 3SUNA 3RTVA 2CJYB 1I51B 3AOAA 3IGVA 1DGKN 2ZJPQ 3O80A 4FWSA 2MJNA 3VQ8A 4FWRA 4KPYA 4W5OA 1ZM3A 4BRHA 1QTNB 4B1WB 5BRDA 1HQEA 2GS8A 4P7TA 2P9IB 2H3GX 1E3MA 1E6YB 3EWGA 5C2FA 3UNYA 3E51A 4P10A 4FYDA 4LFBJ 1RT7B 2VHGA 1IKWA 3M1FA 1GXLA 2ZHAA 3PTWA 2AQ4A 2FDNA 1LK5A 3IWLA 4UF4A 5D0HA 5LMNJ 4CEBA 4AM6A 3VQAA 3UE2A 3VA0A 1SBRA 3WDOA 5KFIA 2LEAA 1Y5IB 4J7CA 3WIUA 5EU7A 2RMLA 1FXXA 4LR7A 3K5OA 4L73A 4B3TJ 2RRAA 5KRSA 3MMJA 4TVAB 4KAIA 2VICA 2XM3A 3CCVS 4HWIA 3A5OC 3VGLA 1U2FA 4CT8A 5KFAA 4ED1A 1GX6A 2MKCA 2HBRB 2R7SA 2FSKA 5KFFA 2YBVA 3PDNA 4NLPA 1YBAA 4X4SA 2J4RA 2B9EA 4TU9A 2ZHBA 5DG9A 2JEJA 3TJ8A 1C6VA 4X64K 3VQ7A 1ZBFA 2P6TA 4I2PA 5ETNA 4YDXA 4FO0A 4FJHA 4KB7A 2V52B 3TZWA 3TQEA 4QYZK 3KD1E 3VQQA 3KK2B 3BR9A 4TYBA 4TLQA 4CZFA 1X4HA 1XR5A 1WSEA 2EG1A 4O8UA 4PQAA 2HFUA 3ICLA 2YWFA 3VERA 1S49A 4WE1B 3DAWA 3H20A 4MKYA 3JYTB 3C7NB 3OBIA 1NGJA 5FPDA 2XHBA 5KFDA 4DPTA 4I69A 1VQNS 2BYCA 5FDLB 5B8HA 1RYRA 1VK8A 4X65F 3MEEB 3SMSA 4E1MA 3D6TB 1NDPA 4YB5A 1DQ8A 3ZZZA 3GBTA 3I82A 4JV0A 1UW9A 3CG7A 4DR2J 4NXNK 1FRMA 2JC1A 4FXDA 4OI1A 1VI7A 4M5GA 4OFZA 4ISFA 2ZH6A 2A42A 4E2FB 4WIIA 2CWXA 3QEIA 3A8EA 3W3SA 2FHJA 5DLFA 1Z2LA 4Q5VA 2VPZB 3GFXA 1AROP 4DR7F 1W7AA 4BR0A 1RP5A 3S01A 1HNWK 4LF9J 2F1FA 1X9MA 2F65A 3HM9A 3NG8A 1H72C 2M5YA 1KOHA 5KFJA 4USKA 2GIQA 1ZETA 4IKFA 2ZHOA 5KFOA 1M90O 4MH8A 2YX7A 2AGOA 4JD2A 1JJ2M 4BCAA 3ENBA 3SQGA 1RT2B 3QFPA 1N8RO 2XMTA 1Q8KA 3H25A 3KMQA 4CLYA 2GVZA 2ZKTA 1VQ6S 2HBYB 3U1LA 1U0HA 2YTCA 3RMDA 3W65A 4B1UB 1NSPA 4LF6K 4M42A 3BZQA 3S8SA 1LXJA 4MAKA 4V19X 2GHWA 4CGHA 2AW0A 4BC5A 3CF5L 1JNRB 2XQCA 3Q8QB 1CBKA 2HZVA 1XUPO 2WSFC 3BR8A 1NJIT 3MTKA 3QEXA 2RRNA 4BWMA 1IVZA 3CQXA 2RVJA 1TUVA 4FM1A 4RW9A 1BG3A 4FLZA 2XMJA 4BVPA 3AFGA 3CCUS 5HMYA 1HR0K 2QJ3A 1VSIA 3ZSXA 4URSA 4FLVA 4HLBA 1BU6O 3I4HX 3O9TA 4YUDA 1FNXH 3CMES 1S1TB 3UIQA 1HNXF 1WEZA 2VBZA 1YI2S 2ASOA 5ADZA 5ETMA 3PJ9A 1CULB 4W92B 1R0AA 3I5AA 1Z25A 3K9JA 2YHAA 3KWMA 1B3TA 1SV5A 3OTCA 2XMMA 4QQBA 2QXLA 3CI5A 2R2RA 4LT6A 5J2NA 3GJSB 1MU2B 3D3CJ 3FEXB 3T6BA 4K41A 1CXUA 1BQMB 4BDPA 5K8MA 3B4DA 1UJ4A 4WKRA 2YNHA 4WFBL 4DV3K 1TGOA 2V63A 2XMUA 3VGMA 2XSJA 3BZCA 2NLWA 3CO0P 3I8BA 1URNA 5G0RB 5A8KB 4BRIA 2E2NA 1RHUB 3VTHA 4DV4J 4XDDA 4DX8H 3KJVB 3LOUA 4PKGA 4E7KA 2C3OA 2N3OA 1NMDA 5AQKA 2ZH3A 1ZM4A 4N77A 1RDAA 3PSIA 3SPYA 3P4IA 1RLDA 3QGIA 5CD4H 2LA6A 4LBIA 1PAEX 3W63A 4BRCA 3C15B 4QWCA 5AQPA 2QK9A 1QVFR 2Q31A 5BPLA 1G2EA 1KWMA 1GH8A 4KC5A 3FQKA 1WSIA 4W5NA 4DSKA 1FRHA 1Y00A 4H5WA 3VEXA 2YPYA 4U67Q 3WNFA 3EUNA 2R7QA 5H1SQ 4GO5X 4CECA 2I5JB 4AL6A 5K14A 1HWLA 2E6LA 4I68A 3U7JA 3D4JA 2EBEA 1NPKA 4GV9A 3O9QA 3DOKA 4OYWA 3E01B 2V9KA 4LIWA 4W98A 2B4JA 4M3WA 1VFJA 4MYTA 4BRFA 1PYOB 1UEKA 4OV6A 3ZZRA 3CJCA 4IUFA 1RAGB 3OV7A 3I6PA 1RWXB 3ZNJ1 3ATVA 5IV4A 3FVYA 2DY4A 3N9UC 3QGPA 3QMLA 2DR7A 3DLBA 1S9FA 2JNJA 4C4WA 1RT6B 1PJ5A 1B7YB 4LY7A 4I6MB 3HCXA 2IPOB 2K8GA 4LREA 4DX5A 3EE3A 4CZKA 3NH0A 2MLXA 1DTTB 4I7FB 4CHYA 3LZJA 3UPFA 4JI5J 2YWHA 3R9LA 3TUZC 4NCGA 3FZHA 3B4MA 1WAJA 2L9DA 3WXLA 4CJTA 4KHPF 1WC0A 2DNOA 2CQHA 2W2QP 4ECUA 4NLVA 4CGIA 2B8PA 2HK2A 3G8SA 4CF1A 4RW8A 1W9HA 3TAGA 1A5XA 1TELA 2IOCA 3TVKA 5L1JA 1OMSA 1T03A 1N4LA 3LQVA 3G8QA 4AXIA 4Z4GA 5EXWA 4ZHRB 4YDUA 3DI6B 4O44B 4UZBA 3A2FA 3KFWX 4JEPA 3LP1A 3E9PA 2Z1JA 3L2WA 3T1HJ 4OV1A 1SC6A 4PUOA 4PL8A 2IDEA 2HHHK 3SYZA 4FP9A 5M1OA 3AVBA 3FBCA 2ASLA 3IR5B 2VF3A 2MQLA 1IM4A 1VGYA 3PACA 4EEYA 1P27B 1RABB 3KWIA 2C28A 4GNIA 3G6EN 1N5SA