4BR7A

Legionella pneumophila ntpdase1 crystal form i, open, ampnp complex
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
356
structure length
356
Chain Sequence
PCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
total genus 116
structure length 356
sequence length 356
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4br7A01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4br7A02
3H3NO 4FSVA 5AQMA 2QW9A 4IXCA 2YHXA 4XH5A 2ZGYA 5LY3A 1NWKA 5EOYA 4BR0A 4MO5A 3FZKA 3VF2A 3MCPA 2V51B 3O1BA 4B1UB 2P9PB 4O8KA 5AQPA 5AFUA 5BPNA 5KPTA 5KPRA 1QZ5A 3S41A 2I7NA 1ATSA 4H03B 4FO0A 5AQWA 3J8AA 4BGBA 5JICA 3EZWA 3L6QA 4JHDA 3D7EO 1Z6RA 1T44A 3M6GA 3ZEUA 2Q2RA 2QXLA 4FWKA 2VYPA 4GNIA 5JMVA 1XQSC 2A3ZA 2YCHA 1TYQB 5BREA 5E26A 1TUYA 2ZF5O 3MN9A 4IO8A 3RSEA 1CZAN 3EL2A 4B1ZA 3O08A 1NGFA 1GLEG 1T6DA 4XEIA 3C7NB 5AQNA 3FZHA 3VETA 1LCUA 1P8ZA 1E4GT 4H0YB 3CQXA 4BQLA 3MDQA 1GLFO 5BRFA 5AQSA 1NGJA 3WXKA 5E84A 4EHTA 3LDLA 3LM9A 2EWSA 4CZGA 4YDUA 4B1VA 3ZEUB 3WQUA 3IDHA 3FE1A 3ZETB 2QWOA 2ZGZA 3VEXA 3LM2A 3CJAA 4L3QA 5F2RA 4H5NA 3CJBA 1BWFO 2P9UB 3MMVA 4BC2A 1RDWX 5AQLA 4B9QA 3C7NA 3A5NC 2E8AA 3CJ9A 5AQXA 4RTFD 4BREA 1WOQA 3CJ1A 3LDPA 5FPMA 4BGAA 3IMXA 5AZJA 5KQDA 3EKSA 4CD3A 4NO7A 4FL9A 2IVPA 4JD2A 1BU6O 3ZX3A 3QICA 4QS9A 2FSNA 3DJCA 4KBOA 3LL3A 1WUAA 5AQZA 3L0QA 4H5VA 3M3ZA 3A5OC 3HZ6A 2QWMA 3RSEB 3WEEA 3FLCO 1XUPO 3O5BA 2A5XA 4MLHA 4O5FA 3GG4A 5AQIA 3WQTA 3VEYA 3BUZB 1YVNA 4LC9B 2E1YA 1HX1A 5BPMA 4FOEA 3VEWA 3F9MA 1GLBG 4HTLA 1GLLO 1KAXA 3U4LA 5AQYA 4M7XA 5AQUA 1ZBSA 2DPNA 4E1JA 1E4FT 3QFUA 4RCHA 1EQYA 2ASPA 2I7PA 4IJNA 2PBDA 1BG3A 3CHWA 3D2FB 4BRMA 4CBWA 2FF6A 2D1KA 3HI0A 3ID8A 5ELZA 1BO5O 2ITMA 3UKRB 5KPZA 3A5LC 1NGDA 3TU5A 4A2AA 3FZFA 1HUXA 3UKUA 3M1FA 4PKGA 2HMPA 4BR4A 2IIRA 3FZLA 1JCFA 5BPLA 1T6CA 3QMLA 2GEMA 3QDKA 3O6WA 4BRDA 3VPZA 2V7ZA 4QS7A 3VF6A 3KHYA 1NGCA 3VENA 4H0VB 3HBTA 5CE3A 2P9NA 1Z05A 2Q1NA 3FR0A 2A41A 2IVOA 4A2BA 2NRHA 5AFUH 4DCHA 3IFRA 3BP8A 4EIAA 3MK6A 1SZ2A 3OHRA 1GLJO 1HPMA 4BVOA 4JNEA 3UE5A 2NLXA 3UKUB 3SMPA 4NB4A 5EVZA 4BR7A 1NM1A 2V7YA 3IUCA 4CJ7A 2CH6A 4FWSA 1HKCA 2YJFA 3WXJA 4I6MA 2E88A 1DKGD 4H0XB 1YXQA 3DXMA 4JN4A 2FF3B 3BF1A 1S22A 4IWVA 1ZXOA 2Q0RA 3GOIA 5EY4A 1GLAG 4FOIA 3ZX0A 1BDGA 4B1WB 3A8YA 4DHYA 2VCPA 3MN5A 5EXWA 4AM7A 2P9SB 1X3MA 3H45C 1G99A 3H46O 1JCEA 3VOVA 4Y0WA 3GDQA 2P9NB 4B1YB 3EKUA 2FSJA 5FPNA 5AZIB 5BR9A 1TUUA 3KZBA 3QBXA 1NGAA 2E2PA 4BC5A 4CZKA 4K43A 5BN9A 2P9IA 4YDUC 3D2EA 5LJWA 3R6MA 1TYQA 1YAGA 1GLCG 5AZJB 1SAZA 2AA4A 4ISFA 4BG8A 4CI6A 3VGMA 4MLEA 5AQFA 3U9DA 4PL8A 1K8KA 2ASOA 4FWMA 1QQNA 1KXPA 4PKHA 4CZHA 2E2NA 4XH4A 4BRQA 1MWKA 3ENOA 2A42A 3R9PA 1BOTO 1H1VA 1V4TA 4A61A 4ISGA 4PKIA 2OANA 1YUWA 2UYTA 4H5WA 2QWLA 2P9UA 4DQ8A 3WT0A 4BRAA 5KQ8A 1QZ6A 3D2FA 3QB0A 2P9LB 4K25A 3AARA 2Q97A 4I6MB 3ZX2A 5AQHA 2NZTA 3AAQA 3AAPA 2CGJA 2E1ZA 3ZETA 2Q0UA 1R59O 4FWRA 1C0FA 4GY2B 2VWBA 1RFQA 2Q31A 1X3NA 2IVNA 3WEEB 3CQYA 5BRDA 4K41A 3DXKB 3G25A 3O1WA 5FPEA 4BRLA 4H0TB 3I8BA 3L4IA 4EAHD 5AR0A 1C0GA 2YHYA 4Z94A 2HF4A 3U9ZA 2GELA 1S3XA 4WQ4C 3W3DA 3VGKA 4CD1A 4MO4A 3O8MA 4DB3A 2AP1A 2GUPA 3HM8A 2F9WA 2W41A 5TKYA 3UB5A 1NGHA 2CGKA 1NGEA 2QWPA 3GBTA 2FSKA 3SMSA 4WQ5C 3UKRA 3VEVA 4BR2A 3CIPA 4CZEA 5LJVA 3WUHA 1MWMA 2P9LA 3FFKB 4CZIA 4BRHA 1HLUA 4WYBA 3B8AX 4CBUA 3WXLA 1BA0A 3W0LA 1BUPA 4F9OA 3H3OB 2D0OA 1IG8A 3ATVA 3ENHA 4EHUA 5I9EB 3HTVA 5AQJA 3C0BA 4CBXA 2KHOA 3KVGA 5AQVA 3QFPA 3DAWA 4BR9A 2CGLA 1D4XA 3A0IX 2ZWHA 2CH5A 5AQRA 2E20A 4FWQA 4BRKA 3GL1A 2FXUA 1DEJA 2W40A 1HKBA 4ISEA 4BRFA 3VEZA 2HF3A 3D2EB 3SK3A 4BC4A 3P4IA 2HOEA 4BQZA 1NGBA 1Y64A 2P9PA 3H6EA 3VGLA 1GLDG 2E2OA 2BUPA 3I33A 2QWRA 5F1XA 4BRGA 1U2VA 4H5RA 1RGIA 1NGIA 4BROA 5B8HA 3VERA 3GE1A 5AQGA 4B1XB 4BRNA 3H1QA 3AY9A 4AM6A 5ADXA 3ULEB 3EN9A 4IJAA 4WQ4A 4FPAA 3WXIA 1JCGA 4BRPA 4CZLA 3JXUA 5JLHA 2P9KA 3MN6A 1BA1A 1IJJA 4BVPA 1DGKN 4QS8A 2QM1A 4H0PA 2ASMA 2YJEA 3VF4A 2Q36A 5BN8A 3SJHA 4CZMA 4FWPA 1X9JA 1QHAA 1MDUB 1ATNA 4RWTA 3ATUA 4FPBA 2BTFA 3BEXA 2D4WA 3DXKA 1NMDA 4J8FA 5EX5A 1ATRA 1XC3A 1ESVA 3SLCA 2GWKA 5AQKA 4JAXA 3VEOA 4BR5A 3O4WA 4CZFA 5JLFA 1KAZA 3U8XA 3H1VX 3CETA 3O80A 4CZJA 1HJOA 4XH1A 3VESA 2QWNA 4JHDB 2P9SA 1NLVA 3LDQA 4K42A 4JD2B 1ZC6A 4BRCA 2F9TA 1NGGA 2P9KB 1J6ZA 4M7YA 3R8EA 1OKJA 3LDNA 4BC3A 2GWJA 2FLOA 4C23A 3CJCA 2E2QA 4H0OA 3ULEA 4FWLA 4HWIA 5AQOA 3CI5A 4EFHA 3DXMB 3QBWA 3DWLA 3TPQA 2A40A 5ADXH 3EO3A 2J4RA 4A62A 1QQMA 3A5MC 1K8KB 2D0PA 4H5TA 1U2VB 3CJ7A 1U6ZA 2QWQA 3JS6A 1HKGA 4BG9A 3LDOA 1MA9B 5AQTA 5FPDA 4WQ5A 4PL7A 1V4SA 2P9IB 1SQKA 4FWNA 3FZMA 2H3GX 1Q18A 2WUSA 3BF3A 5AZIA 3HSCA 3MN7A 2PAVA 1LOTB 4BRIA 5F0XA 2V52B 1KAYA 4FWOA 1NBWA 4M63C 3CERA 5AQQA 2YI1A 5BRHA 4IZ9A 2YHWA 3FGUA 2A6AA 2GTDA 1QQOA
chains in the Genus database with same CATH superfamily
4FSVA 4I2PA 3OJSA 1CXUA 3VQCA 2ZGYA 3CQ8A 4FJ5A 2O8EA 2ATQA 4FW1A 1EETA 4NXMK 4L8RB 1NOZA 2GUIA 5KPRA 2I7NA 1ATSA 3V9UA 4JI7K 2KFZA 4M3ZA 5AQWA 4M42A 4CJWA 5C2FA 3M6GA 5AJ3K 4LFCK 5JS1A 3ZEUA 3CFOA 4G1QA 1IKXA 5JMVA 3BY5A 4CJ3A 1Q9YA 4RW7A 1L5UA 4B08A 1WLJA 5GAHP 3KD5E 4CFCA 3RRHA 3RSEA 1DLOA 2Y1JA 3SPYA 3ITHA 4JI0K 5AQNA 4IO9L 3FZHA 3VETA 3T3FA 1REVA 2IS3A 4CFDA 3QEWA 1J9AA 4FJIA 3AVJA 1WBDA 1NGJA 1VK0A 4Q5VA 3U3GA 4BWMA 3F73A 4CZGA 4YDUA 4CEQA 3IDHA 3IAYA 5C15A 2DFEA 1WSHA 2WFBA 2ZGZA 3LM2A 3TWHA 2OYQA 3R1XA 3DRSA 3SAHA 5F2RA 3KJVA 4LF6K 4CHPA 1L3VA 4FXDA 4X65K 1I3AA 1RDWX 4B9QA 4RTFD 3SUPA 4BGAA 2ZD1A 5FPMA 4JYAK 3IMXA 5AZJA 4W5NA 1S1TA 3CCRN 2IVPA 4JD2A 4JK8A 2D5RA 4DS4A 1KVCA 4IFEA 5AQZA 4UQGA 3LANA 4YY3K 4CEEA 2YNHA 3HZ6A 4ID1A 3Q7BA 4E89A 3WEEA 3FLCO 4FM1A 4O5FA 4DTPA 1QSSA 5AQIA 3WQTA 3BUZB 4C1NI 4FW2A 4DV2K 2DFHA 4JKCA 3AA2A 1K9MO 4DLGA 1ZBSA 4FYDA 4IJNA 1JXBA 3TSUA 4KREA 4BRMA 2ZJQL 2FF6A 2D1KA 2XO7A 5ELZA 5K14A 3OY9A 3UKRB 1RTJA 1VSDA 3A5LC 5GIPA 4A2AA 4HUFA 1N33K 1NK0A 3UKUA 4CJSA 2G8KA 4DV1K 2IIRA 3FZLA 1SKRA 4MDAA 3I8DA 1JL1A 2GEMA 4B8CA 3PLAA 1IBMK 4LH4A 3VF6A 4H0VB 3HBTA 3SV3A 2P9NA 4OLBA 3TTDA 2O8CA 2Q3SA 4UY8O 2XHBA 3LAKA 3IFRA 3M8QA 3THVA 1Q82O 5CYQA 1SZ2A 4K8XA 1KVBA 3AVMA 3OHRA 4YNQA 4I7FA 4BVOA 4XIUA 5EVZA 4BR7A 3DMJA 3IUCA 4NXNK 4FWSA 2YJFA 4WFBL 3SI6A 4DV0K 1DKGD 1EWRA 3RMCA 4CEBA 4B9TA 2FF3B 3BF1A 4IWVA 4I9LA 1ZXOA 3GOIA 5EY4A 1TKXA 4DHYA 2VCPA 5M1FA 4CVNE 4PHTX 5EXWA 2UUAK 2P9SB 5KGWA 1X3MA 3H45C 2NRWA 1YTAA 2NRZA 3VOVA 1KLMA 3OYKA 3KLHA 4ELTA 3PY8A 2P9NB 1W0HA 4B1YB 1RDDA 3V1OA 5AZIB 1TAUA 1OH8A 1VQNN 1NGAA 5BN9A 4YDUC 1TYQA 1YAGA 3CXCM 4ISFA 4BG8A 5AQFA 1WNSA 2HHVA 5LL6Z 2KFNA 1KXPA 4CZHA 1XI1A 2A1RA 2O8DB 2A42A 3DRPA 1BOTO 1KC8O 1H1VA 3PIOL 2P5GA 2KQ2A 4A61A 2G8IA 4JI3K 2HHHK 1E3MA 3AV9A 4OO1J 4DTRA 1QZ6A 2JWLA 3L8BA 2PYLA 3E9OA 2E1ZA 2Q0UA 3KKRA 2UUCK 1XWLA 4JI5K 3O4NA 3NDKA 4GV6A 3K5OA 2X78A 5A2QO 3CCJN 3OS1A 4B3MK 4M3TA 1LV5A 3L2QA 4FJLA 3AVFA 1X3NA 2IVNA 1W2BM 1NJZA 4A59A 3DXKB 4DU4A 3O1WA 4DR6K 4H0TB 2YHAA 1IKVA 5AR0A 2YHYA 3P5JA 1UWBA 2A1SA 2GELA 2IAJA 3U3YA 4CD1A 4B9MA 2O8BB 2O8FB 3UB5A 2HHWA 3K5LA 1NGHA 2CGKA 4YOVA 3GBTA 1QHTA 4CZEA 1BCOA 1MU2A 1JLBA 1RTHA 2I5JA 4CJKA 2VGNA 2KKZA 4CECA 3W0LA 4DV7K 1VQ8N 4PQUA 4CBXA 4OVLA 2KHOA 2HBLA 4JLHA 2CGLA 3THYA 1BHLA 4WFNL 3KK7A 4JI4K 2F7TA 3QNNA 3DLBA 4BRKA 3AA3A 3SAGA 3NVMA 1NNEA 3Q7CA 4ISEA 4E7LA 4HHTA 3AVBA 5LMNK 5TKWA 4G9ZA 3LP2A 4IG0A 4CJLA 3I33A 1CZBA 4GVEA 3OTOK 3DLLL 4KHYA 2W42A 5B8HA 3OYMA 5KRTA 3CC4N 3TAMA 5CY4A 4AM6A 4I9QA 4LH5A 4KHQA 1ASWA 4FCYA 3PIPL 2KLAA 3P83D 5HRPA 4LFBK 1C6VA 2P9KA 3SQ4A 5FROA 1RT6A 3J80O 3HJFA 5EU7A 4BVPA 4JS5A 4QS8A 3OYJA 5SZTA 5BN8A 3SJHA 4CIGA 1BI4B 1X9JA 4O44A 1MDUB 3C6AA 2BE2A 3RMDA 1ATRA 4B3TK 1ESVA 3MWPA 4IBNA 3TANA 3SLCA 1XMQK 2GWKA 3O9SA 4DF4A 5JLFA 1KAZA 3H1VX 2XY5A 3CETA 2ZJRL 1HJOA 1I94K 2RE2A 2D0AA 2QWNA 3VESA 3B6PA 3CPEA 2Z1HA 4ICLA 4JKEA 1M90O 1ZC6A 4BRCA 2HHSA 1NK8A 2XRIA 2QK9A 3CJCA 2E2QA 2W6KA 2A40A 3KLGA 1TK8A 1FK9A 3HPHA 2VGMA 4FJ7A 3JS6A 1HNXK 4CE9A 1MA9B 5AQTA 3NHGA 4B9VA 3OYGA 3ZT1A 3VTIA 2H3GX 4DTOA 5AZIA 4CHQA 2E6LA 3CC7N 3C6UA 3HSTB 4BRIA 3OJUA 2UUBK 3CERA 1RDCA 5BRHA 2BDPA 4JI1K 3NBPA 2FBVA 3ZSXA 1QQOA 3H08A 3NE6A 3NF9A 1L3SA 4IXCA 2YHXA 4XH5A 1KFDA 1LWFA 4U7BA 4DQSA 5LY3A 4KV8A 1NWKA 4GV3A 4BR0A 3FZKA 2QEXN 3MCPA 4W5OA 2V51B 3C95A 1B9DA 3O1BA 1NU0A 4CJTA 3D0PA 3O3HA 3TSPA 4FO0A 2XY6A 1VQMN 3G10A 1W9HA 3L3UA 4BDYA 1TL1A 4EP4A 1IBKK 4LSLA 4FLZA 2Q2RA 1O1WA 5J2NA 4GNIA 1RT2A 2A3ZA 2YCHA 5BREA 1RDBA 5E26A 3G6EN 3NFAA 1U49A 3M8PA 4PUOA 1A5WA 1Q9XA 1NGFA 5KRSA 1T6DA 4XEIA 1I39A 1E4GT 4H0YB 2X6NA 4Z4EA 4TSXA 2HNYA 4BE2A 1GLFO 5AQSA 3OYBA 3WXKA 5E84A 4FZXC 4B1VA 2F4VK 1HNIA 1NK7A 3QLHA 1S1UA 3ZETB 2QWOA 3CFRA 3EYZA 4IFYA 3L2WA 4CF9A 4ZHRA 1IKWA 3CJAA 4L3QA 1VSLA 1XNQK 1KFSA 4IKFA 4LSNA 4KHPK 1K6YA 1U47A 1C0MA 5AQLA 1VSFA 3NH0A 3C7NA 2VQFK 4AHRA 5AQXA 1T03A 1WOQA 3EKSA 1J54A 4DR2K 3O9RA 1WN7A 4O0JA 3DJCA 4KBOA 1WUAA 4F3OA 4WE1A 3KWIA 4KFBA 4WCEL 5HRRA 2QWMA 4DR7K 3RSEB 2PYJA 4B3RK 3O5BA 4MLHA 1YIJN 3QNOA 4KHNA 3VEYA 4JK9A 1VSMA 4DWIA 4AHSA 4FOEA 1N5YA 3NF6A 5KGXA 3F9MA 4I2QA 2Z1JA 1DTQA 4CK3A 5AQYA 4M7XA 4B3SK 2DPNA 1EQYA 4DSKA 3K59A 3HI0A 5KPZA 1WSFA 3FZFA 1HUXA 4OPKA 2XY8A 3M1FA 3KD1E 4BR4A 5BPLA 4CEFA 1RBRA 3J7AP 3QMLA 3QDKA 5SWMA 4IDHA 3TAQA 2RHKA 2V7ZA 4CGJA 4QS7A 3KHYA 1NGCA 4DS5A 1Z05A 1YJ9N 4A2BA 2NRHA 3TI0A 3HOTA 4FM0A 1T3VA 4DCHA 3SUOA 4B9SA 1LW0A 4K0KK 1NG9A 1BIZA 1QSLA 1JLCA 2AJQA 1XHXA 1Q7YO 3QETA 1JLEA 1KCFA 1SV5A 4NB4A 3SMPA 2E5LK 3DI6A 4NLBA 1JL2A 1ZBHA 1TVRA 3K0SA 3WXJA 4I6MA 2OCEA 4GV9A 4H0XB 3OS2A 4JN4A 3MAQA 1HR0K 3SAFA 4YOYA 4PA1A 1QSYA 2EX3A 1BDGA 1NK9A 4CGIA 4FZYA 1QS4A 1OH7A 3L2RA 2OPRA 3PO5A 4JI6K 1JCEA 4YOUA 4W5RA 3NGIA 3ASMA 3NH2A 5FPNA 3O4QA 1JLFA 2WBNA 1S1VA 3HOSA 1TUUA 3KZBA 1P90A 3WNEA 4K43A 4E7HA 1K73O 1NMNA 5AZJB 2AA4A 4DQPA 3LWLA 3T1YK 1K8KA 4BDZA 1VSIA 4KAZA 3MX5A 1LWCA 3HM9A 4M45A 4M41A 4BRQA 3VQ4A 1MWKA 3SCXA 1HNVA 3HL8A 3R9PA 4E7KA 4DF8A 1V4TA 2OTJN 4PKIA 4LF9K 3LAMA 3KK3A 1DTTA 2QWLA 4DQ8A 3QINA 4BRAA 3CCMN 1ZYQA 3QB0A 4WFAL 3OBWA 3AARA 2Q97A 2NRXA 2O4IA 4CGGA 4AF1A 5FLXO 3B6OA 1XC9A 3ZETA 1B92A 1EP4A 1R59O 4CK2A 2VWBA 2O8EB 1Z26A 1YT3A 3FFIA 3UIQA 4K8ZA 4DSFA 3CQYA 4DSJA 1WSGA 2LSNA 4DFMA 3OYHA 1SL1A 5JVHL 4DR4K 4BRLA 3I56N 3JYTA 1A5VA 3I8BA 3L4IA 4EAHD 1C0GA 4Z94A 2UXDK 1RBSA 1VQ5N 3K2PA 4DU3A 3W3DA 1X9MA 1RT1A 3VGKA 4HCCA 4Z4GA 2FC0A 4FM2A 4DB3A 2AP1A 3CPWM 2QWPA 2FSKA 2GX9A 1J5OA 3WUHA 4N76A 3LP0A 3TSQA 4CZIA 4BRHA 4C8LA 1WSIA 3B8AX 4ZTJA 4CBUA 3WXLA 4JRPA 2PY5A 5E41A 5CZ1A 3QIOA 3H3OB 2D0OA 1IG8A 4JI8K 4ILHA 1B9FA 1OVYA 5I9EB 4ILJA 3OVNA 1IO2A 4E1MA 1XNRK 5AQVA 1T7PA 2NNWA 2E4LA 3S3NA 3A0IX 1TK5A 4BWJA 4CEAA 3QEVA 2HW3A 3ID6A 2GV9A 4AHUA 4MQ3A 3SQ0A 3GL1A 2FXUA 3P1GA 1J5EK 4FK0A 4CHYA 4C8KA 5M1PA 3SK3A 2HOEA 2XY7A 4CFAA 1Y64A 2P9PA 2YNGA 1JKHA 1OH6A 1ZBIA 4MFBA 1WAFA 1R0AA 1GLDG 1FKOA 4AHTA 2QWRA 1HQUA 1RGIA 4DTSA 2D0CA 2QXFA 3QIPA 4CEOA 5IWAK 4BRNA 3ZSYA 3DM2A 1HPZA 4FVUA 3EN9A 4IJAA 1GOBA 1JCGA 3A2FA 4CZLA 4N41A 3E9PA 4YOWA 3EE9A 3K9JA 3NMUA 3CYMA 3VF4A 4AHVA 3S9HA 4LF4K 1CZ9A 4CERA 3AVGA 3PSIA 4RWTA 3ATUA 1VRTA 2X6SA 4FPBA 4WF9L 3BEXA 3SUQA 3V4IA 1NMDA 1TL3A 4PWDA 3NGZA 4C8MA 1XHZA 3VQ9A 1D5AA 1KSPA 4R5PA 4CZFA 3HP9A 3AA5X 3QO9A 3ZT0A 4C8OA 4CZJA 3I55N 4XH1A 4QOZB 3V9ZA 3MX2A 3THYB 4JHDB 1KRPA 1FW6A 4NYFA 1S6QA 4JD2B 4KH6A 3TAPA 1VQKN 4IOAL 4CJQA 3TTCA 1SUQA 2P51A 4M7YA 3NAEA 1NKCA 1OKJA 4CJPA 2G8FA 4H0OA 4F4KA 2O8FA 1NK4A 3CI5A 5CHIA 2F96A 3AVAA 5HRSA 5ADXH 3AVKA 2J4RA 1HQEA 3ZT4A 1NOYA 1QQMA 4Z4HA 2D0PA 5IT9O 3VQPA 1U2VB 2QWQA 4J2EA 1HKGA 4BG9A 4IFVA 4DQRA 4X62K 3BZKA 1V4SA 5M1OA 1SQKA 4JKDA 4Z4CA 1FKPA 3FZMA 2KZMA 4FJ9A 2WUSA 1M1KO 4CF0A 1LOTB 1EO1A 1C1AA 3D45A 2V52B 4FWOA 3PUFA 1RT7A 1HMVA 2DFFA 1U48A 2A6AA 1HNWK 4F3TA 2KTQA 5C0YA 3TAFA 3KTQA 1ZBFA 2P5OA 2QA4N 4DR5K 3VQ6A 3CCQN 3RWUA 2BH1A 2QW9A 4HVJA 4E3SA 3DOLA 3VF2A 4B1UB 5KPTA 5AFUA 3HP6A 2YKNA 1QZ5A 1JLQA 4H03B 1WBBA 1GOCA 4J2DA 3RMAA 4BGBA 3QEIA 3EZWA 1T44A 4HCBA 3F9KA 4CJVA 1Q86O 4CK1A 1BQNA 4FLYA 1U45A 3K5NA 2OZMA 1VSHA 2ZF5O 3MN9A 4IO8A 1CZAN 4B1ZA 4DV5K 4YHHK 3AGRA 1LCUA 1P8ZA 4BQLA 3CQXA 5FDLA 3MDQA 4AILC 5BRFA 4W5QA 3D6RA 3QEXA 4FJNA 4OGEA 4EHTA 4RW8A 3LDLA 1YF5L 3LM9A 2EWSA 3EZ5A 4JKAA 4O0IA 3ZEUB 3WQUA 4DR1K 5HRNA 4CJ5A 4RW4A 1HYSA 2QI2A 1S1XA 4BY9C 5J2PA 4H5NA 3K58A 3CJBA 3MMVA 2ZM6K 3SZ2A 3G0ZA 4BC2A 4CGDA 1FJGK 1N8RO 4FVMA 3CJ1A 4DQQA 3J7YP 1VSJA 4DFPA 4NO7A 4FL9A 1S6PA 2FBYA 3ZSVA 3QICA 4QS9A 2VG7A 5I3UA 3KLIA 3LL3A 1GOAA 3TTFA 1TGOA 3M3ZA 3ZSOA 3A5OC 3ULDA 1NJYA 4CHOA 2B6AA 4O4GA 2A5XA 1VQ9N 1L3TA 1IG9A 3GG4A 4QCLA 2RF2A 4LC9B 3V81A 1HX1A 2HMIA 5BPMA 2OPSA 1VQ6N 3U4LA 4ELVA 1VQ7N 4AHCA 5AQUA 4E1JA 2BANA 4CHZA 4RCHA 1JLAA 2ASPA 2I7PA 2PBDA 3CHWA 3VQAA 3D2FB 4DSLA 3M8RA 3KWGA 5H1SQ 4CEDA 1NGDA 3TU5A 3DYAA 4PKGA 2HMPA 4H4MA 1L3UA 1JCFA 1RTIA 1T6CA 4HUGA 1ITGA 4EZ9A 3ZT3A 3O6WA 3VPZA 3L3VA 2HVIA 3VENA 3THWB 4CF1A 1TK0A 3ZLJA 4JKGA 1NKBA 5AFUH 3NH1A 3SQ2A 4M3RA 3CMAN 4OKKA 4B9NA 3HPGA 4JKFA 3MK6A 4JK7A 4OJRA 4OKJA 3T7ZA 1Q8IA 3SV4A 2NLXA 3KLEA 4Q0BA 3UKUB 2ZJPL 2G8WA 5C2DA 3THXA 2Z1IA 4FJJA 3F5TA 1BI4A 2CH6A 3HRGA 1HKCA 1VRUA 4J2BA 2E88A 4ID5A 4GKKK 1VHXA 3DLKA 1VQ4N 2B5JA 3DXMA 3PV8A 3TR8A 1HYZA 2QTDA 3KIOA 4E7JA 3RRGA 4FOIA 4B1WB 3A8YA 3ZYYX 4NCBA 3CG7A 1JLGA 5DMRA 3O9QA 1G99A 5GINA 4OPJA 4Y0WA 4KHWA 5I42A 1TKTA 1LAWA 2O8BA 3E1YA 4CGHA 2EHGA 4ILGB 4CZKA 4CJFA 1GLCG 4CHNA 4JRQA 4OKEA 2HHUA 4CI6A 4H4OA 4MLEA 1NK6A 2ITGA 4PL8A 5HROA 2ASOA 2OPQA 5J1EA 4FWMA 1YITN 4X66K 3WNFA 4DTUA 4E19A 4RG8A 2E2NA 1CXQA 4XH4A 1S5JA 3ENOA 4CF8A 3LP1A 4IDKA 1Y97A 4O8UA 4FLWA 4KRFA 2ZE2A 4C1NK 2NRTA 2UYTA 4H5WA 3ZCMA 2P9UA 1S72N 3D2FA 3LPUA 1N6QA 2P9LB 3MECA 3VA0A 3DOKA 4I6MB 4CGFA 4DTMA 3AAPA 1EX4A 2CGJA 4DQIA 3TABA 4KI4A 1C0FA 3IG1A 4DV3K 3PX6A 2YX6A 2O8DA 1RFQA 4DSIA 3EE8A 3HXMA 3CC2N 5BRDA 3G71N 4FLVA 4JKGB 4DUYK 3TARA 2VG5A 3O9TA 3THWA 3V9SA 3WXMB 3V1RA 1RT4A 1G15A 4IEEA 4DR3K 4BDPA 3BGRA 3LP3A 2ETJA 2F9WA 5TKYA 3CMEN 1QVFM 5CYMA 3VQEA 5KTQA 1QE1A 1SKWA 3VQ5A 3SMSA 4WQ5C 4O5BA 4YORA 4BR2A 3CIPA 3VQ7A 5LJVA 1QTMA 1MWMA 2P9LA 1HLUA 4DTXA 1YHQN 2P1JA 4CJUA 1BA0A 3AGKA 4YFUA 4F9OA 3ATVA 3ISNC 4Z4FA 1HRHA 3ENHA 4KB1A 3HTVA 5AQJA 3C0BA 4M3UA 4ELUA 2F8SA 3DAWA 3ENBA 4N5SA 2IOCA 2ZWHA 3OS0A 2UXBK 4FWQA 2YHBA 3R3LA 1WB9A 4Z4IA 4CIFA 4DU1A 1HKBA 4BRFA 4LY7A 3OYCA 2HF3A 4LFAK 3OYAA 2KZZA 3HK2A 2BGGA 4CF2A 1NGBA 3CCLN 2G8UA 2UU9K 4FJXA 1YJNN 1TAQA 2E2OA 5F1XA 4BRGA 4H5RA 1NGIA 4FJ8A 4DTNA 1N36K 3GE1A 3AVLA 3ZSQA 4DFKA 1YVUA 5AQGA 2B4JA 3SUNA 3H1QA 3AY9A 3V9WA 3ULEB 4WQ4A 3THXB 4FPAA 5BR8K 3MXJA 3WNHA 3JXUA 5JLHA 2YNFA 1F21A 3LZJA 3PSFA 1IKYA 1C0UA 3MN6A 4IOCL 1IJJA 2YV0X 4V19S 3AO5A 1DGKN 2QM1A 4H0PA 2ASMA 1S1WA 2Q36A 3L2VA 3CCEN 1BGXT 2WTUA 1QHAA 4NYNA 1ATNA 3NGYA 4J8FA 4A5AA 3HVRA 4KB0A 1XC3A 3VQ8A 3PX0A 4BE1A 4JAXA 3VQDA 3AVNA 3U8XA 4H8KA 1U04A 2HHQA 1HJRA 4LF8K 3O80A 3MEDA 2HHTA 1YTUA 3LZIA 3HT3A 3AVCA 2P9SA 1NLVA 4K42A 2F9TA 1NGGA 4YOTA 4CW7B 1J6ZA 4BC3A 2GWJA 5CZ2A 3HPOA 1UA0A 3OYEA 3T69A 4FWLA 3MEGA 4HWIA 4EFHA 5HP1A 4B9LA 3DXMB 3VTHA 3OBYA 3QBWA 3DWLA 4FLUA 1WSJA 4A62A 4BACA 3ZSZA 3VQQA 3A5MC 3AO3A 4H5TA 2OTLN 3LDOA 1TKDA 3CCVN 3ALYA 4WQ5A 4PL7A 3C6TA 3VN5A 2R7YA 2PZSA 5GAEP 4FWNA 4FLTA 4Y1DA 4FK2A 3OYIA 3RVCA 4FJMA 3CF5L 2JGUA 2OZSA 3HSCA 4DG1A 3MN7A 1BQMA 3I0SA 5F0XA 4FJKA 1NBWA 4M63C 5AQQA 4KI6A 4E0DA 2YHWA 3FGUA 2O4GA 3DLGA 3KKSA 2GTDA 4X64K 1S9EA 4CJRA 5MLCQ 4NCAA 2RN2A 3H3NO 4RW9A 5AQMA 3OYLA 4JEPA 4DUZK 4PY5A 3V6DA 3OYFA 3AO2A 5EOYA 4MO5A 1JJ2M 3SNNA 2P9PB 4O8KA 5AQPA 5BPNA 4AQYK 3RR7A 5GAGP 3S41A 5C25A 1UA1A 3SQ1A 2NRRA 3J8AA 5JICA 3L6QA 1T05A 4JHDA 3ZSRA 3D7EO 1Z6RA 4E7IA 5C24A 3OA9A 2QXLA 4FWKA 3OW2M 2VYPA 3L4QA 1XQSC 1TYQB 1YJWN 1W97L 3MEEA 1TUYA 4DFJA 2HHXA 1X9WA 2WC9A 3EL2A 3O08A 1GLEG 3C7NB 1W7AA 4LF7K 3AVHA 3HVTA 1HYVA 1QQCA 4Z0UA 4GMJB 3AVIA 4DTJA 3FE1A 1VSEA 2HB5A 3VEXA 2HBJA 4EP5A 5GADP 4KKOA 1BWFO 2P9UB 3M5RA 2VQEK 3V9XA 4EZ6A 3A5NC 4A57A 2E8AA 3CJ9A 3KK1A 3CCUN 4BREA 3LDPA 5KQDA 2IDOA 4KTZA 4CD3A 3AO1A 3F2KA 1BU6O 3ZX3A 5HL7L 3C65A 2FSNA 5FRMA 4N47A 3TAEA 3L0QA 4H5VA 4FJHA 3IS9A 3CFPA 1Z25A 1TV6A 1KD1O 4OLAA 1XUPO 1RBTA 1KVAA 4DSEA 2VWKA 3IRXA 1YVNA 2E1YA 3J81O 3VEWA 3E01A 1GLBG 4HTLA 1GLLO 1KAXA 2GBZA 3N4QA 4OX9K 1KTQA 1E4FT 3DLEA 1LWEA 3QFUA 2IC3A 1BG3A 3QESA 3OYNA 2F8TA 3E66A 1RT5A 4CBWA 1KLNA 4C8NA 3ID8A 1BO5O 3TAGA 2ITMA 4FK4A 2HBKA 1C0TA 3SYZA 5GIOA 5M1KA 2YKMA 1VAZA 2NUBA 3O9UA 1A5XA 2O8CB 4BRDA 4GW6A 1SL2A 5DM7L 3AA4A 3T1AA 5CE3A 1RTDA 2Q1NA 3FR0A 4NCGA 2A41A 2IVOA 3VMFB 3O3GA 1D9FA 2YNIA 3BP8A 4EIAA 1DT9A 1GLJO 1HPMA 3E9LA 4JI2K 4JNEA 3UE5A 3QERA 1VQPN 4B3OA 1NM1A 3ZT2A 2V7YA 5HBMA 4R79A 4CJ7A 1OH5A 4JV5K 5C10A 4JKBA 1EXQA 3VA3A 1SKSA 5DK5A 1BCMA 1YXQA 2QKKA 1S22A 2Q0RA 1GLAG 3ZX0A 2G8VA 3BZCA 3MN5A 2VWJA 1ILYA 3QEPA 4J2AA 2DTUA 4AM7A 2OA8A 3H46O 3N4PA 3SPZA 2HNZA 3GDQA 4DV4K 1UOCA 1K8AO 1RCHA 3EKUA 2FSJA 4HTUA 5BR9A 1YI2N 3QBXA 3JAMO 1IH7A 2E2PA 4BC5A 5T7BA 2W6LA 2P9IA 5LJWA 3D2EA 3R6MA 3K5MA 1SAZA 4HUEA 4ZTFA 3VGMA 3HYFA 3U9DA 3CCSN 4W5TA 1BIUA 4IG3A 1QQNA 4PKHA 4KH4A 1JXEA 3KLFA 2X74A 5CR4A 4ISGA 3P38A 2OANA 4LD0A 1YUWA 3U6FA 5KQ8A 3G4SN 3WT0A 1EKEA 3LWMA 4OPAA 3LDSA 4K25A 1RILA 1QVGM 1C1BA 3PO4A 3T19A 3ZX2A 5AQHA 1X9SA 2NZTA 3AAQA 3MCAB 4M3XA 5C42A 5HLFA 4FWRA 4GY2B 1BISA 4A5BA 4CFBA 3V1QA 4F8RA 4KHUA 3SBTA 1NJIO 4F2RA 1N34K 5KI6A 2Q31A 3WEEB 4K41A 3G25A 5FPEA 4KH5A 3O3FA 3P31A 1LAVA 4GVMA 4FLXA 1LW2A 4AH9A 4OPHA 2HF4A 2RPIA 3U9ZA 1S3XA 4NLCA 4B8AB 1BL3A 4WQ4C 4MO4A 3O8MA 4GKJK 3EEQA 1NK5A 2Z1GA 5D3GA 2GUPA 3HM8A 2W41A 3WNGA 3NCIA 3C6HA 1NGEA 3RTVA 3VEVA 5J2MA 3UKRA 2VG6A 1FXXA 2FBTA 3K9KA 1ZBUA 3FFKB 3C94A 4M3WA 4FJGA 4WYBA 2QKBA 1BUPA 4Y1CA 4RW6A 3NF7A 3CM6A 4EHUA 1ZBLA 2OPPA 1D9DA 2RKIA 3KVGA 1WSEA 3QFPA 4U67L 4BR9A 1D4XA 2CH5A 5AQRA 2E20A 4KO0A 4MDBA 1UAXA 3T1HK 1DEJA 2W40A 4OGCA 1SL0A 1RBVA 1IBLK 3VEZA 1WAJA 5LMUK 3D2EB 4BC4A 3P4IA 4BQZA 4O55A 1RNHA 3BDPA 2HBMA 2UXCK 1O13A 4N56A 3RMBA 3H6EA 3OYDA 3IKMA 3VGLA 4CEZA 2PFUA 2BUPA 4F2SA 3PX4A 1U2VA 3CD6N 3I0RA 4BROA 3VERA 3SJJA 4B1XB 3HO1A 5FRNA 4DKWA 5ADXA 1NJXA 5JS2A 4YOXA 5M1NA 1SS6A 3WXIA 4BRPA 4KTWA 3SBGA 1RDAA 3NVKA 3CM5A 1BA1A 1S9GA 3EY1A 1OVQA 2YJEA 4CJEA 3MXMA 4CZMA 3L2UA 4FWPA 3M8SA 2ZQBA 1XMOK 3MWTA 1RBUA 4CJ4A 4JKHA 2BTFA 2D4WA 3DXKA 3K57A 1VQLN 5EX5A 1KQSM 3LALA 3S3OA 2HVHA 5AQKA 3VEOA 4BR5A 5HOOA 5J2QA 3O4WA 3J7ZO 2Y1IA 2JWKA 4LF5K 3DRRA 1TKZA 4BE0A 5C12A 4KPYA 5DM6L 2HNDA 3S3MA 3NF8A 1Q81O 2JLEA 3LDQA 1RDUA 1VSKA 2FBXA 3JSMA 4QAGA 2P9KB 2WOMA 3R8EA 3VQBA 3LDNA 1NKEA 1CLQA 1VQON 2FLOA 4C23A 1ASVA 3ULEA 3DLHA 2E6MA 5AQOA 4KHSA 3TPQA 2D0BA 3EO3A 2G8HA 2HSTA 1HNZK 4CESA 1C1CA 1K8KB 1NJWA 4M3YA 3RR8A 3CJ7A 3KK2A 1U6ZA 4CCHA 1U4BA 4DLEA 3MXIA 2DY4A 4IOXA 5FPDA 4JS4A 2P9IB 4B9UA 3LPTA 2NRVA 2IGIA 5JVGL 1IV0A 1D8YA 1X1PA 3P39A 1Q18A 2KW4A 3BF3A 3AO4A 1ASUA 4FZZA 1N32K 4CIEA 2PAVA 5M1QA 4E1NA 3ZSWA 1EWQA 1KAYA 1T8EA 2YI1A 4IEIA 1RT3A 1J53A 2WONA 4KTQA 4IZ9A 4DV6K 4DMNA 3DLRA
chains in the Genus database with same CATH topology
3H3NO 4FSVA 2QA4N 3CCQN 5AQMA 2BH1A 2QW9A 4IXCA 4JEPA 2YHXA 4XH5A 4U7BA 2ZGYA 5LY3A 1NWKA 4GV3A 5EOYA 4BR0A 4MO5A 3FZKA 2QEXN 3VF2A 1JJ2M 3MCPA 2V51B 3O1BA 4B1UB 2P9PB 4O8KA 5AQPA 5AFUA 5BPNA 5KPTA 5KPRA 1QZ5A 3S41A 5GAGP 2I7NA 1ATSA 4H03B 3TSPA 4FO0A 2NRRA 1VQMN 5AQWA 3J8AA 4BGBA 5JICA 3EZWA 3L6QA 4JHDA 3D7EO 5C2FA 1Z6RA 1T44A 3M6GA 3OA9A 3ZEUA 2Q2RA 1Q86O 2QXLA 4FWKA 3OW2M 2VYPA 3L4QA 4GNIA 5JMVA 1XQSC 2A3ZA 2YCHA 1TYQB 1YJWN 1W97L 5BREA 5E26A 1TUYA 5GAHP 2ZF5O 3G6EN 3MN9A 4IO8A 2WC9A 1CZAN 3RSEA 3EL2A 4B1ZA 3O08A 1NGFA 1GLEG 1T6DA 3AGRA 4XEIA 3C7NB 5AQNA 4IO9L 3FZHA 3VETA 1LCUA 1P8ZA 1E4GT 4H0YB 3CQXA 4BQLA 3MDQA 1GLFO 5BRFA 3D6RA 5AQSA 1NGJA 3WXKA 5E84A 4EHTA 3LDLA 1YF5L 3LM9A 2EWSA 4JKAA 4CZGA 4YDUA 4B1VA 3ZEUB 3WQUA 3IDHA 3FE1A 3ZETB 5C15A 2QWOA 2WFBA 2ZGZA 3VEXA 3LM2A 2QI2A 3CJAA 2HBJA 4L3QA 3R1XA 3SAHA 5F2RA 4BY9C 5GADP 4H5NA 3CJBA 1BWFO 2P9UB 3M5RA 3MMVA 4BC2A 1RDWX 5AQLA 4B9QA 3C7NA 3A5NC 4A57A 2E8AA 3CJ9A 5AQXA 4RTFD 1N8RO 3CCUN 4BREA 1WOQA 3CJ1A 3LDPA 5FPMA 4BGAA 3IMXA 5AZJA 5KQDA 3EKSA 4CD3A 4NO7A 4FL9A 3F2KA 3CCRN 2IVPA 4JD2A 1BU6O 4JK8A 3O9RA 3ZX3A 5HL7L 3C65A 3QICA 2FSNA 4QS9A 3DJCA 4KBOA 3LL3A 1WUAA 4IFEA 3TTFA 5AQZA 3L0QA 4H5VA 3M3ZA 3KWIA 3A5OC 4WCEL 3HZ6A 1KD1O 2QWMA 3Q7BA 3RSEB 3WEEA 3FLCO 1XUPO 3O5BA 2A5XA 4MLHA 4O5FA 1YIJN 1VQ9N 3GG4A 5AQIA 3WQTA 3VEYA 4JK9A 3BUZB 1YVNA 4LC9B 2E1YA 4C1NI 1HX1A 5BPMA 4FOEA 3VEWA 3F9MA 1GLBG 1VQ6N 4HTLA 1GLLO 1KAXA 3U4LA 3N4QA 4JKCA 1K9MO 1VQ7N 5AQYA 4M7XA 5AQUA 1ZBSA 2DPNA 4E1JA 1E4FT 3QFUA 4RCHA 1EQYA 2ASPA 2I7PA 4IJNA 2PBDA 1BG3A 3CHWA 3D2FB 3E66A 3TSUA 4BRMA 4CBWA 2ZJQL 2FF6A 2D1KA 3KWGA 3HI0A 3ID8A 5ELZA 5H1SQ 1BO5O 2ITMA 3UKRB 5KPZA 3A5LC 5GIPA 1NGDA 3TU5A 4A2AA 3FZFA 2HBKA 1HUXA 5GIOA 3UKUA 3M1FA 4PKGA 2HMPA 5M1KA 1VAZA 4BR4A 2IIRA 3FZLA 1JCFA 5BPLA 4MDAA 1T6CA 3QMLA 3O9UA 2GEMA 3QDKA 4IDHA 3O6WA 3PLAA 4BRDA 2RHKA 3VPZA 2V7ZA 4QS7A 5DM7L 3VF6A 3KHYA 1NGCA 3VENA 4H0VB 3HBTA 5CE3A 2P9NA 1Z05A 2Q1NA 3FR0A 1YJ9N 2A41A 2IVOA 4JKGA 4A2BA 2NRHA 5AFUH 3TTDA 3VMFB 3HOTA 1T3VA 4DCHA 4UY8O 3CMAN 3IFRA 3BP8A 1Q82O 4JKFA 4EIAA 3MK6A 1SZ2A 4JK7A 1DT9A 3OHRA 1GLJO 1HPMA 3E9LA 4BVOA 4JNEA 3T7ZA 3UE5A 1VQPN 2NLXA 1Q7YO 3UKUB 2ZJPL 3SMPA 4NB4A 5EVZA 4BR7A 1NM1A 5C2DA 2V7YA 4NLBA 3F5TA 3IUCA 4CJ7A 2CH6A 3HRGA 4R79A 4FWSA 1HKCA 2YJFA 4JKBA 5C10A 3WXJA 4I6MA 4GV9A 4WFBL 2E88A 1DKGD 4H0XB 1YXQA 1VQ4N 3DXMA 4JN4A 2FF3B 3BF1A 2QTDA 3SAFA 1S22A 4IWVA 4YOYA 1ZXOA 2Q0RA 3GOIA 5EY4A 1GLAG 4FOIA 3ZX0A 1BDGA 4B1WB 3A8YA 3ZYYX 4DHYA 2VCPA 5M1FA 4PHTX 3MN5A 1ILYA 5EXWA 4AM7A 2P9SB 3O9QA 1X3MA 3H45C 1G99A 3H46O 3N4PA 1JCEA 2NRWA 5GINA 2NRZA 3VOVA 4YOUA 4Y0WA 3GDQA 2P9NB 4B1YB 1K8AO 3EKUA 2FSJA 5FPNA 5AZIB 5BR9A 3E1YA 2WBNA 1YI2N 3HOSA 1TUUA 3KZBA 1P90A 1VQNN 3QBXA 1NGAA 4ILGB 2E2PA 4BC5A 4CZKA 4K43A 1K73O 5BN9A 2P9IA 4YDUC 3D2EA 5LJWA 3R6MA 1TYQA 1YAGA 1GLCG 5AZJB 1SAZA 2AA4A 3CXCM 4ISFA 4BG8A 4CI6A 3VGMA 4MLEA 5AQFA 3U9DA 3CCSN 4PL8A 1K8KA 2ASOA 4FWMA 1YITN 1QQNA 3MX5A 1KXPA 4PKHA 4CZHA 2E2NA 4KH4A 4XH4A 4BRQA 1MWKA 3ENOA 2A42A 3R9PA 1BOTO 1KC8O 1H1VA 1V4TA 3PIOL 4A61A 5CR4A 4O8UA 2OTJN 4ISGA 3P38A 2OANA 4PKIA 4C1NK 2NRTA 1YUWA 2UYTA 4H5WA 2QWLA 2P9UA 4DQ8A 3WT0A 4BRAA 5KQ8A 3G4SN 3CCMN 1S72N 4OO1J 1QZ6A 3D2FA 3QB0A 4OPAA 2P9LB 2JWLA 4K25A 1QVGM 4WFAL 3OBWA 3AARA 2Q97A 2NRXA 4I6MB 3ZX2A 5AQHA 4AF1A 2NZTA 3AAQA 3MCAB 3E9OA 2CGJA 3AAPA 2E1ZA 3ZETA 2Q0UA 1R59O 4FWRA 1C0FA 4GY2B 2VWBA 4A5BA 4GV6A 3CCJN 3SBTA 1NJIO 2YX6A 1RFQA 2Q31A 3EE8A 1X3NA 2IVNA 1W2BM 3CC2N 3WEEB 3CQYA 4A59A 5BRDA 4K41A 3DXKB 3G71N 5JVHL 3G25A 3O1WA 4JKGB 3O9TA 5FPEA 4BRLA 4KH5A 4H0TB 3I56N 3I8BA 3L4IA 3P31A 4EAHD 5AR0A 1C0GA 2YHYA 4Z94A 3WXMB 1VQ5N 4OPHA 2HF4A 3U9ZA 2GELA 1S3XA 4IEEA 4NLCA 4WQ4C 3W3DA 3VGKA 4CD1A 4MO4A 3O8MA 4DB3A 2AP1A 2GUPA 3HM8A 2F9WA 2W41A 5TKYA 3UB5A 3CMEN 1QVFM 3C6HA 1NGHA 2CGKA 1NGEA 3CPWM 4YOVA 2QWPA 3GBTA 2FSKA 3SMSA 4WQ5C 3UKRA 4YORA 2GX9A 3VEVA 3CIPA 4BR2A 4CZEA 5LJVA 3WUHA 3K9KA 1MWMA 2P9LA 3FFKB 3TSQA 4CZIA 4BRHA 1HLUA 4WYBA 3B8AX 1YHQN 4CBUA 3WXLA 2VGNA 1BA0A 2KKZA 3AGKA 3W0LA 1BUPA 4F9OA 3H3OB 2D0OA 1IG8A 4ILHA 3ATVA 1VQ8N 3ENHA 1OVYA 4EHUA 5I9EB 3HTVA 5AQJA 3C0BA 4ILJA 4CBXA 2KHOA 3KVGA 5AQVA 2HBLA 3QFPA 2NNWA 3DAWA 3ENBA 4BR9A 2CGLA 1D4XA 3A0IX 4U67L 2ZWHA 4WFNL 2CH5A 3KK7A 5AQRA 3ID6A 2E20A 4FWQA 2F7TA 4MDBA 3R3LA 4BRKA 3SAGA 3NVMA 3GL1A 2FXUA 1DEJA 2W40A 3Q7CA 1HKBA 4ISEA 4BRFA 3VEZA 2HF3A 3D2EB 5M1PA 3SK3A 4BC4A 3P4IA 2HOEA 4BQZA 5TKWA 1NGBA 1Y64A 3CCLN 2HBMA 2P9PA 1O13A 3H6EA 4G9ZA 3IKMA 3VGLA 1YJNN 2PFUA 2E2OA 1GLDG 2BUPA 2QWRA 3I33A 4GVEA 5F1XA 4BRGA 1U2VA 4H5RA 3DLLL 1RGIA 1NGIA 3CD6N 4BROA 5B8HA 3VERA 3GE1A 5AQGA 4B1XB 4BRNA 3CC4N 3H1QA 3AY9A 4DKWA 4AM6A 5ADXA 4FVUA 3ULEB 3EN9A 4IJAA 4WQ4A 4YOXA 5M1NA 1SS6A 4FPAA 3WXIA 3PIPL 1JCGA 4BRPA 2KLAA 3SBGA 4CZLA 3JXUA 5JLHA 3NVKA 2P9KA 3MN6A 4IOCL 3E9PA 1BA1A 1IJJA 4YOWA 3EE9A 3K9JA 4BVPA 3NMUA 1DGKN 4QS8A 2QM1A 4H0PA 2ASMA 2YJEA 3VF4A 2Q36A 3CCEN 5BN8A 3SJHA 4CZMA 4FWPA 1X9JA 1QHAA 1MDUB 3MWTA 3C6AA 1ATNA 4RWTA 3ATUA 4FPBA 4JKHA 4WF9L 2BTFA 3BEXA 2D4WA 3DXKA 1NMDA 4J8FA 4A5AA 1VQLN 5EX5A 1KQSM 1ATRA 1XC3A 1ESVA 3MWPA 3SLCA 2GWKA 5AQKA 4JAXA 3VEOA 4BR5A 3O9SA 5HOOA 3O4WA 4CZFA 5JLFA 1KAZA 3J7ZO 3U8XA 3H1VX 2JWKA 3CETA 3O80A 4CZJA 2ZJRL 1HJOA 3I55N 2RE2A 4XH1A 3VESA 2QWNA 5C12A 3MX2A 5DM6L 1Q81O 4JHDB 3CPEA 2P9SA 1NLVA 4JKEA 3LDQA 1M90O 4K42A 4JD2B 4KH6A 1ZC6A 1VQKN 4IOAL 1RDUA 2F9TA 4BRCA 1NGGA 4YOTA 3TTCA 2P9KB 1J6ZA 4M7YA 3R8EA 1OKJA 3LDNA 4BC3A 2GWJA 2FLOA 1VQON 4C23A 3CJCA 2E2QA 4H0OA 3T69A 3ULEA 4FWLA 4HWIA 5AQOA 3CI5A 4EFHA 3DXMB 3VTHA 3OBYA 3QBWA 3DWLA 3TPQA 5CHIA 2A40A 5ADXH 3EO3A 2J4RA 4A62A 2HSTA 1QQMA 3A5MC 1K8KB 2D0PA 2VGMA 4H5TA 1U2VB 3CJ7A 1U6ZA 2QWQA 3JS6A 1HKGA 4BG9A 2OTLN 3LDOA 1MA9B 3CCVN 5AQTA 4IOXA 5FPDA 4WQ5A 4PL7A 1V4SA 5M1OA 2P9IB 1SQKA 5GAEP 4JKDA 2NRVA 4FWNA 5JVGL 3VTIA 3FZMA 2H3GX 3P39A 3RVCA 1Q18A 3CF5L 2WUSA 3BF3A 5AZIA 3HSCA 1M1KO 3CC7N 3MN7A 2PAVA 5M1QA 1LOTB 4BRIA 1EO1A 5F0XA 2V52B 1KAYA 4FWOA 1NBWA 4M63C 3CERA 5AQQA 2YI1A 4IEIA 5BRHA 4IZ9A 2YHWA 3FGUA 2A6AA 2GTDA 5MLCQ 5C0YA 1QQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3N O;  4FSV A;  5AQM A;  2QW9 A;  4IXC A;  2YHX A;  4XH5 A;  2ZGY A;  5LY3 A;  1NWK A;  5EOY A;  4BR0 A;  4MO5 A;  3FZK A;  3VF2 A;  3MCP A;  2V51 B;  3O1B A;  4B1U B;  2P9P B;  4O8K A;  5AQP A;  5AFU A;  5BPN A;  5KPT A;  5KPR A;  1QZ5 A;  3S41 A;  2I7N A;  1ATS A;  4H03 B;  4FO0 A;  5AQW A;  3J8A A;  4BGB A;  5JIC A;  3EZW A;  3L6Q A;  4JHD A;  3D7E O;  1Z6R A;  1T44 A;  3M6G A;  3ZEU A;  2Q2R A;  2QXL A;  4FWK A;  2VYP A;  4GNI A;  5JMV A;  1XQS C;  2A3Z A;  2YCH A;  1TYQ B;  5BRE A;  5E26 A;  1TUY A;  2ZF5 O;  3MN9 A;  4IO8 A;  3RSE A;  1CZA N;  3EL2 A;  4B1Z A;  3O08 A;  1NGF A;  1GLE G;  1T6D A;  4XEI A;  3C7N B;  5AQN A;  3FZH A;  3VET A;  1LCU A;  1P8Z A;  1E4G T;  4H0Y B;  3CQX A;  4BQL A;  3MDQ A;  1GLF O;  5BRF A;  5AQS A;  1NGJ A;  3WXK A;  5E84 A;  4EHT A;  3LDL A;  3LM9 A;  2EWS A;  4CZG A;  4YDU A;  4B1V A;  3ZEU B;  3WQU A;  3IDH A;  3FE1 A;  3ZET B;  2QWO A;  2ZGZ A;  3VEX A;  3LM2 A;  3CJA A;  4L3Q A;  5F2R A;  4H5N A;  3CJB A;  1BWF O;  2P9U B;  3MMV A;  4BC2 A;  1RDW X;  5AQL A;  4B9Q A;  3C7N A;  3A5N C;  2E8A A;  3CJ9 A;  5AQX A;  4RTF D;  4BRE A;  1WOQ A;  3CJ1 A;  3LDP A;  5FPM A;  4BGA A;  3IMX A;  5AZJ A;  5KQD A;  3EKS A;  4CD3 A;  4NO7 A;  4FL9 A;  2IVP A;  4JD2 A;  1BU6 O;  3ZX3 A;  3QIC A;  4QS9 A;  2FSN A;  3DJC A;  4KBO A;  3LL3 A;  1WUA A;  5AQZ A;  3L0Q A;  4H5V A;  3M3Z A;  3A5O C;  3HZ6 A;  2QWM A;  3RSE B;  3WEE A;  3FLC O;  1XUP O;  3O5B A;  2A5X A;  4MLH A;  4O5F A;  3GG4 A;  5AQI A;  3WQT A;  3VEY A;  3BUZ B;  1YVN A;  4LC9 B;  2E1Y A;  1HX1 A;  5BPM A;  4FOE A;  3VEW A;  3F9M A;  1GLB G;  4HTL A;  1GLL O;  1KAX A;  3U4L A;  5AQY A;  4M7X A;  5AQU A;  1ZBS A;  2DPN A;  4E1J A;  1E4F T;  3QFU A;  4RCH A;  1EQY A;  2ASP A;  2I7P A;  4IJN A;  2PBD A;  1BG3 A;  3CHW A;  3D2F B;  4BRM A;  4CBW A;  2FF6 A;  2D1K A;  3HI0 A;  3ID8 A;  5ELZ A;  1BO5 O;  2ITM A;  3UKR B;  5KPZ A;  3A5L C;  1NGD A;  3TU5 A;  4A2A A;  3FZF A;  1HUX A;  3UKU A;  3M1F A;  4PKG A;  2HMP A;  4BR4 A;  2IIR A;  3FZL A;  1JCF A;  5BPL A;  1T6C A;  3QML A;  2GEM A;  3QDK A;  3O6W A;  4BRD A;  3VPZ A;  2V7Z A;  4QS7 A;  3VF6 A;  3KHY A;  1NGC A;  3VEN A;  4H0V B;  3HBT A;  5CE3 A;  2P9N A;  1Z05 A;  2Q1N A;  3FR0 A;  2A41 A;  2IVO A;  4A2B A;  2NRH A;  5AFU H;  4DCH A;  3IFR A;  3BP8 A;  4EIA A;  3MK6 A;  1SZ2 A;  3OHR A;  1GLJ O;  1HPM A;  4BVO A;  4JNE A;  3UE5 A;  2NLX A;  3UKU B;  3SMP A;  4NB4 A;  5EVZ A;  4BR7 A;  1NM1 A;  2V7Y A;  3IUC A;  4CJ7 A;  2CH6 A;  4FWS A;  1HKC A;  2YJF A;  3WXJ A;  4I6M A;  2E88 A;  1DKG D;  4H0X B;  1YXQ A;  3DXM A;  4JN4 A;  2FF3 B;  3BF1 A;  1S22 A;  4IWV A;  1ZXO A;  2Q0R A;  3GOI A;  5EY4 A;  1GLA G;  4FOI A;  3ZX0 A;  1BDG A;  4B1W B;  3A8Y A;  4DHY A;  2VCP A;  3MN5 A;  5EXW A;  4AM7 A;  2P9S B;  1X3M A;  3H45 C;  1G99 A;  3H46 O;  1JCE A;  3VOV A;  4Y0W A;  3GDQ A;  2P9N B;  4B1Y B;  3EKU A;  2FSJ A;  5FPN A;  5AZI B;  5BR9 A;  1TUU A;  3KZB A;  3QBX A;  1NGA A;  2E2P A;  4BC5 A;  4CZK A;  4K43 A;  5BN9 A;  2P9I A;  4YDU C;  3D2E A;  5LJW A;  3R6M A;  1TYQ A;  1YAG A;  1GLC G;  5AZJ B;  1SAZ A;  2AA4 A;  4ISF A;  4BG8 A;  4CI6 A;  3VGM A;  4MLE A;  5AQF A;  3U9D A;  4PL8 A;  1K8K A;  2ASO A;  4FWM A;  1QQN A;  1KXP A;  4PKH A;  4CZH A;  2E2N A;  4XH4 A;  4BRQ A;  1MWK A;  3ENO A;  2A42 A;  3R9P A;  1BOT O;  1H1V A;  1V4T A;  4A61 A;  4ISG A;  4PKI A;  2OAN A;  1YUW A;  2UYT A;  4H5W A;  2QWL A;  2P9U A;  4DQ8 A;  3WT0 A;  4BRA A;  5KQ8 A;  1QZ6 A;  3D2F A;  3QB0 A;  2P9L B;  4K25 A;  3AAR A;  2Q97 A;  4I6M B;  3ZX2 A;  5AQH A;  2NZT A;  3AAQ A;  3AAP A;  2CGJ A;  2E1Z A;  3ZET A;  2Q0U A;  1R59 O;  4FWR A;  1C0F A;  4GY2 B;  2VWB A;  1RFQ A;  2Q31 A;  1X3N A;  2IVN A;  3WEE B;  3CQY A;  5BRD A;  4K41 A;  3DXK B;  3G25 A;  3O1W A;  5FPE A;  4BRL A;  4H0T B;  3I8B A;  3L4I A;  4EAH D;  5AR0 A;  1C0G A;  2YHY A;  4Z94 A;  2HF4 A;  3U9Z A;  2GEL A;  1S3X A;  4WQ4 C;  3W3D A;  3VGK A;  4CD1 A;  4MO4 A;  3O8M A;  4DB3 A;  2AP1 A;  2GUP A;  3HM8 A;  2F9W A;  2W41 A;  5TKY A;  3UB5 A;  1NGH A;  2CGK A;  1NGE A;  2QWP A;  3GBT A;  2FSK A;  3SMS A;  4WQ5 C;  3UKR A;  3VEV A;  4BR2 A;  3CIP A;  4CZE A;  5LJV A;  3WUH A;  1MWM A;  2P9L A;  3FFK B;  4CZI A;  4BRH A;  1HLU A;  4WYB A;  3B8A X;  4CBU A;  3WXL A;  1BA0 A;  3W0L A;  1BUP A;  4F9O A;  3H3O B;  2D0O A;  1IG8 A;  3ATV A;  3ENH A;  4EHU A;  5I9E B;  3HTV A;  5AQJ A;  3C0B A;  4CBX A;  2KHO A;  3KVG A;  5AQV A;  3QFP A;  3DAW A;  4BR9 A;  2CGL A;  1D4X A;  3A0I X;  2ZWH A;  2CH5 A;  5AQR A;  2E20 A;  4FWQ A;  4BRK A;  3GL1 A;  2FXU A;  1DEJ A;  2W40 A;  1HKB A;  4ISE A;  4BRF A;  3VEZ A;  2HF3 A;  3D2E B;  3SK3 A;  4BC4 A;  3P4I A;  2HOE A;  4BQZ A;  1NGB A;  1Y64 A;  2P9P A;  3H6E A;  3VGL A;  1GLD G;  2E2O A;  2BUP A;  3I33 A;  2QWR A;  5F1X A;  4BRG A;  1U2V A;  4H5R A;  1RGI A;  1NGI A;  4BRO A;  5B8H A;  3VER A;  3GE1 A;  5AQG A;  4B1X B;  4BRN A;  3H1Q A;  3AY9 A;  4AM6 A;  5ADX A;  3ULE B;  3EN9 A;  4IJA A;  4WQ4 A;  4FPA A;  3WXI A;  1JCG A;  4BRP A;  4CZL A;  3JXU A;  5JLH A;  2P9K A;  3MN6 A;  1BA1 A;  1IJJ A;  4BVP A;  1DGK N;  4QS8 A;  2QM1 A;  4H0P A;  2ASM A;  2YJE A;  3VF4 A;  2Q36 A;  5BN8 A;  3SJH A;  4CZM A;  4FWP A;  1X9J A;  1QHA A;  1MDU B;  1ATN A;  4RWT A;  3ATU A;  4FPB A;  2BTF A;  3BEX A;  2D4W A;  3DXK A;  1NMD A;  4J8F A;  5EX5 A;  1ATR A;  1XC3 A;  1ESV A;  3SLC A;  2GWK A;  5AQK A;  4JAX A;  3VEO A;  4BR5 A;  3O4W A;  4CZF A;  5JLF A;  1KAZ A;  3U8X A;  3H1V X;  3CET A;  3O80 A;  4CZJ A;  1HJO A;  4XH1 A;  3VES A;  2QWN A;  4JHD B;  2P9S A;  1NLV A;  3LDQ A;  4K42 A;  4JD2 B;  1ZC6 A;  4BRC A;  2F9T A;  1NGG A;  2P9K B;  1J6Z A;  4M7Y A;  3R8E A;  1OKJ A;  3LDN A;  4BC3 A;  2GWJ A;  2FLO A;  4C23 A;  3CJC A;  2E2Q A;  4H0O A;  3ULE A;  4FWL A;  4HWI A;  5AQO A;  3CI5 A;  4EFH A;  3DXM B;  3QBW A;  3DWL A;  3TPQ A;  2A40 A;  5ADX H;  3EO3 A;  2J4R A;  4A62 A;  1QQM A;  3A5M C;  1K8K B;  2D0P A;  4H5T A;  1U2V B;  3CJ7 A;  1U6Z A;  2QWQ A;  3JS6 A;  1HKG A;  4BG9 A;  3LDO A;  1MA9 B;  5AQT A;  5FPD A;  4WQ5 A;  4PL7 A;  1V4S A;  2P9I B;  1SQK A;  4FWN A;  3FZM A;  2H3G X;  1Q18 A;  2WUS A;  3BF3 A;  5AZI A;  3HSC A;  3MN7 A;  2PAV A;  1LOT B;  4BRI A;  5F0X A;  2V52 B;  1KAY A;  4FWO A;  1NBW A;  4M63 C;  3CER A;  5AQQ A;  2YI1 A;  5BRH A;  4IZ9 A;  2YHW A;  3FGU A;  2A6A A;  2GTD A;  1QQO A; 
#chains in the Genus database with same CATH topology
 4FSV A;  4I2P A;  3OJS A;  1CXU A;  3VQC A;  2ZGY A;  3CQ8 A;  4FJ5 A;  2O8E A;  2ATQ A;  4FW1 A;  1EET A;  4NXM K;  4L8R B;  1NOZ A;  2GUI A;  5KPR A;  2I7N A;  1ATS A;  3V9U A;  4JI7 K;  2KFZ A;  4M3Z A;  5AQW A;  4M42 A;  4CJW A;  5C2F A;  3M6G A;  5AJ3 K;  4LFC K;  5JS1 A;  3ZEU A;  3CFO A;  4G1Q A;  1IKX A;  5JMV A;  3BY5 A;  4CJ3 A;  1Q9Y A;  4RW7 A;  1L5U A;  4B08 A;  1WLJ A;  5GAH P;  3KD5 E;  4CFC A;  3RRH A;  3RSE A;  1DLO A;  2Y1J A;  3SPY A;  3ITH A;  4JI0 K;  5AQN A;  4IO9 L;  3FZH A;  3VET A;  3T3F A;  1REV A;  2IS3 A;  4CFD A;  3QEW A;  1J9A A;  4FJI A;  3AVJ A;  1WBD A;  1NGJ A;  1VK0 A;  4Q5V A;  3U3G A;  4BWM A;  3F73 A;  4CZG A;  4YDU A;  4CEQ A;  3IDH A;  3IAY A;  5C15 A;  2DFE A;  1WSH A;  2WFB A;  2ZGZ A;  3LM2 A;  3TWH A;  2OYQ A;  3R1X A;  3DRS A;  3SAH A;  5F2R A;  3KJV A;  4LF6 K;  4CHP A;  1L3V A;  4FXD A;  4X65 K;  1I3A A;  1RDW X;  4B9Q A;  4RTF D;  3SUP A;  4BGA A;  2ZD1 A;  5FPM A;  4JYA K;  3IMX A;  5AZJ A;  4W5N A;  1S1T A;  3CCR N;  2IVP A;  4JD2 A;  4JK8 A;  2D5R A;  4DS4 A;  1KVC A;  4IFE A;  5AQZ A;  4UQG A;  3LAN A;  4YY3 K;  4CEE A;  2YNH A;  3HZ6 A;  4ID1 A;  3Q7B A;  4E89 A;  3WEE A;  3FLC O;  4FM1 A;  4O5F A;  4DTP A;  1QSS A;  5AQI A;  3WQT A;  3BUZ B;  4C1N I;  4FW2 A;  4DV2 K;  2DFH A;  4JKC A;  3AA2 A;  1K9M O;  4DLG A;  1ZBS A;  4FYD A;  4IJN A;  1JXB A;  3TSU A;  4KRE A;  4BRM A;  2ZJQ L;  2FF6 A;  2D1K A;  2XO7 A;  5ELZ A;  5K14 A;  3OY9 A;  3UKR B;  1RTJ A;  1VSD A;  3A5L C;  5GIP A;  4A2A A;  4HUF A;  1N33 K;  1NK0 A;  3UKU A;  4CJS A;  2G8K A;  4DV1 K;  2IIR A;  3FZL A;  1SKR A;  4MDA A;  3I8D A;  1JL1 A;  2GEM A;  4B8C A;  3PLA A;  1IBM K;  4LH4 A;  3VF6 A;  4H0V B;  3HBT A;  3SV3 A;  2P9N A;  4OLB A;  3TTD A;  2O8C A;  2Q3S A;  4UY8 O;  2XHB A;  3LAK A;  3IFR A;  3M8Q A;  3THV A;  1Q82 O;  5CYQ A;  1SZ2 A;  4K8X A;  1KVB A;  3AVM A;  3OHR A;  4YNQ A;  4I7F A;  4BVO A;  4XIU A;  5EVZ A;  4BR7 A;  3DMJ A;  3IUC A;  4NXN K;  4FWS A;  2YJF A;  4WFB L;  3SI6 A;  4DV0 K;  1DKG D;  1EWR A;  3RMC A;  4CEB A;  4B9T A;  2FF3 B;  3BF1 A;  4IWV A;  4I9L A;  1ZXO A;  3GOI A;  5EY4 A;  1TKX A;  4DHY A;  2VCP A;  5M1F A;  4CVN E;  4PHT X;  5EXW A;  2UUA K;  2P9S B;  5KGW A;  1X3M A;  3H45 C;  2NRW A;  1YTA A;  2NRZ A;  3VOV A;  1KLM A;  3OYK A;  3KLH A;  4ELT A;  3PY8 A;  2P9N B;  1W0H A;  4B1Y B;  1RDD A;  3V1O A;  5AZI B;  1TAU A;  1OH8 A;  1VQN N;  1NGA A;  5BN9 A;  4YDU C;  1TYQ A;  1YAG A;  3CXC M;  4ISF A;  4BG8 A;  5AQF A;  1WNS A;  2HHV A;  5LL6 Z;  2KFN A;  1KXP A;  4CZH A;  1XI1 A;  2A1R A;  2O8D B;  2A42 A;  3DRP A;  1BOT O;  1KC8 O;  1H1V A;  3PIO L;  2P5G A;  2KQ2 A;  4A61 A;  2G8I A;  4JI3 K;  2HHH K;  1E3M A;  3AV9 A;  4OO1 J;  4DTR A;  1QZ6 A;  2JWL A;  3L8B A;  2PYL A;  3E9O A;  2E1Z A;  2Q0U A;  3KKR A;  2UUC K;  1XWL A;  4JI5 K;  3O4N A;  3NDK A;  4GV6 A;  3K5O A;  2X78 A;  5A2Q O;  3CCJ N;  3OS1 A;  4B3M K;  4M3T A;  1LV5 A;  3L2Q A;  4FJL A;  3AVF A;  1X3N A;  2IVN A;  1W2B M;  1NJZ A;  4A59 A;  3DXK B;  4DU4 A;  3O1W A;  4DR6 K;  4H0T B;  2YHA A;  1IKV A;  5AR0 A;  2YHY A;  3P5J A;  1UWB A;  2A1S A;  2GEL A;  2IAJ A;  3U3Y A;  4CD1 A;  4B9M A;  2O8B B;  2O8F B;  3UB5 A;  2HHW A;  3K5L A;  1NGH A;  2CGK A;  4YOV A;  3GBT A;  1QHT A;  4CZE A;  1BCO A;  1MU2 A;  1JLB A;  1RTH A;  2I5J A;  4CJK A;  2VGN A;  2KKZ A;  4CEC A;  3W0L A;  4DV7 K;  1VQ8 N;  4PQU A;  4CBX A;  4OVL A;  2KHO A;  2HBL A;  4JLH A;  2CGL A;  3THY A;  1BHL A;  4WFN L;  3KK7 A;  4JI4 K;  2F7T A;  3QNN A;  3DLB A;  4BRK A;  3AA3 A;  3SAG A;  3NVM A;  1NNE A;  3Q7C A;  4ISE A;  4E7L A;  4HHT A;  3AVB A;  5LMN K;  5TKW A;  4G9Z A;  3LP2 A;  4IG0 A;  4CJL A;  3I33 A;  1CZB A;  4GVE A;  3OTO K;  3DLL L;  4KHY A;  2W42 A;  5B8H A;  3OYM A;  5KRT A;  3CC4 N;  3TAM A;  5CY4 A;  4AM6 A;  4I9Q A;  4LH5 A;  4KHQ A;  1ASW A;  4FCY A;  3PIP L;  2KLA A;  3P83 D;  5HRP A;  4LFB K;  1C6V A;  2P9K A;  3SQ4 A;  5FRO A;  1RT6 A;  3J80 O;  3HJF A;  5EU7 A;  4BVP A;  4JS5 A;  4QS8 A;  3OYJ A;  5SZT A;  5BN8 A;  3SJH A;  4CIG A;  1BI4 B;  1X9J A;  4O44 A;  1MDU B;  3C6A A;  2BE2 A;  3RMD A;  1ATR A;  4B3T K;  1ESV A;  3MWP A;  4IBN A;  3TAN A;  3SLC A;  1XMQ K;  2GWK A;  3O9S A;  4DF4 A;  5JLF A;  1KAZ A;  3H1V X;  2XY5 A;  3CET A;  2ZJR L;  1HJO A;  1I94 K;  2RE2 A;  2D0A A;  2QWN A;  3VES A;  3B6P A;  3CPE A;  2Z1H A;  4ICL A;  4JKE A;  1M90 O;  1ZC6 A;  4BRC A;  2HHS A;  1NK8 A;  2XRI A;  2QK9 A;  3CJC A;  2E2Q A;  2W6K A;  2A40 A;  3KLG A;  1TK8 A;  1FK9 A;  3HPH A;  2VGM A;  4FJ7 A;  3JS6 A;  1HNX K;  4CE9 A;  1MA9 B;  5AQT A;  3NHG A;  4B9V A;  3OYG A;  3ZT1 A;  3VTI A;  2H3G X;  4DTO A;  5AZI A;  4CHQ A;  2E6L A;  3CC7 N;  3C6U A;  3HST B;  4BRI A;  3OJU A;  2UUB K;  3CER A;  1RDC A;  5BRH A;  2BDP A;  4JI1 K;  3NBP A;  2FBV A;  3ZSX A;  1QQO A;  3H08 A;  3NE6 A;  3NF9 A;  1L3S A;  4IXC A;  2YHX A;  4XH5 A;  1KFD A;  1LWF A;  4U7B A;  4DQS A;  5LY3 A;  4KV8 A;  1NWK A;  4GV3 A;  4BR0 A;  3FZK A;  2QEX N;  3MCP A;  4W5O A;  2V51 B;  3C95 A;  1B9D A;  3O1B A;  1NU0 A;  4CJT A;  3D0P A;  3O3H A;  3TSP A;  4FO0 A;  2XY6 A;  1VQM N;  3G10 A;  1W9H A;  3L3U A;  4BDY A;  1TL1 A;  4EP4 A;  1IBK K;  4LSL A;  4FLZ A;  2Q2R A;  1O1W A;  5J2N A;  4GNI A;  1RT2 A;  2A3Z A;  2YCH A;  5BRE A;  1RDB A;  5E26 A;  3G6E N;  3NFA A;  1U49 A;  3M8P A;  4PUO A;  1A5W A;  1Q9X A;  1NGF A;  5KRS A;  1T6D A;  4XEI A;  1I39 A;  1E4G T;  4H0Y B;  2X6N A;  4Z4E A;  4TSX A;  2HNY A;  4BE2 A;  1GLF O;  5AQS A;  3OYB A;  3WXK A;  5E84 A;  4FZX C;  4B1V A;  2F4V K;  1HNI A;  1NK7 A;  3QLH A;  1S1U A;  3ZET B;  2QWO A;  3CFR A;  3EYZ A;  4IFY A;  3L2W A;  4CF9 A;  4ZHR A;  1IKW A;  3CJA A;  4L3Q A;  1VSL A;  1XNQ K;  1KFS A;  4IKF A;  4LSN A;  4KHP K;  1K6Y A;  1U47 A;  1C0M A;  5AQL A;  1VSF A;  3NH0 A;  3C7N A;  2VQF K;  4AHR A;  5AQX A;  1T03 A;  1WOQ A;  3EKS A;  1J54 A;  4DR2 K;  3O9R A;  1WN7 A;  4O0J A;  3DJC A;  4KBO A;  1WUA A;  4F3O A;  4WE1 A;  3KWI A;  4KFB A;  4WCE L;  5HRR A;  2QWM A;  4DR7 K;  3RSE B;  2PYJ A;  4B3R K;  3O5B A;  4MLH A;  1YIJ N;  3QNO A;  4KHN A;  3VEY A;  4JK9 A;  1VSM A;  4DWI A;  4AHS A;  4FOE A;  1N5Y A;  3NF6 A;  5KGX A;  3F9M A;  4I2Q A;  2Z1J A;  1DTQ A;  4CK3 A;  5AQY A;  4M7X A;  4B3S K;  2DPN A;  1EQY A;  4DSK A;  3K59 A;  3HI0 A;  5KPZ A;  1WSF A;  3FZF A;  1HUX A;  4OPK A;  2XY8 A;  3M1F A;  3KD1 E;  4BR4 A;  5BPL A;  4CEF A;  1RBR A;  3J7A P;  3QML A;  3QDK A;  5SWM A;  4IDH A;  3TAQ A;  2RHK A;  2V7Z A;  4CGJ A;  4QS7 A;  3KHY A;  1NGC A;  4DS5 A;  1Z05 A;  1YJ9 N;  4A2B A;  2NRH A;  3TI0 A;  3HOT A;  4FM0 A;  1T3V A;  4DCH A;  3SUO A;  4B9S A;  1LW0 A;  4K0K K;  1NG9 A;  1BIZ A;  1QSL A;  1JLC A;  2AJQ A;  1XHX A;  1Q7Y O;  3QET A;  1JLE A;  1KCF A;  1SV5 A;  4NB4 A;  3SMP A;  2E5L K;  3DI6 A;  4NLB A;  1JL2 A;  1ZBH A;  1TVR A;  3K0S A;  3WXJ A;  4I6M A;  2OCE A;  4GV9 A;  4H0X B;  3OS2 A;  4JN4 A;  3MAQ A;  1HR0 K;  3SAF A;  4YOY A;  4PA1 A;  1QSY A;  2EX3 A;  1BDG A;  1NK9 A;  4CGI A;  4FZY A;  1QS4 A;  1OH7 A;  3L2R A;  2OPR A;  3PO5 A;  4JI6 K;  1JCE A;  4YOU A;  4W5R A;  3NGI A;  3ASM A;  3NH2 A;  5FPN A;  3O4Q A;  1JLF A;  2WBN A;  1S1V A;  3HOS A;  1TUU A;  3KZB A;  1P90 A;  3WNE A;  4K43 A;  4E7H A;  1K73 O;  1NMN A;  5AZJ B;  2AA4 A;  4DQP A;  3LWL A;  3T1Y K;  1K8K A;  4BDZ A;  1VSI A;  4KAZ A;  3MX5 A;  1LWC A;  3HM9 A;  4M45 A;  4M41 A;  4BRQ A;  3VQ4 A;  1MWK A;  3SCX A;  1HNV A;  3HL8 A;  3R9P A;  4E7K A;  4DF8 A;  1V4T A;  2OTJ N;  4PKI A;  4LF9 K;  3LAM A;  3KK3 A;  1DTT A;  2QWL A;  4DQ8 A;  3QIN A;  4BRA A;  3CCM N;  1ZYQ A;  3QB0 A;  4WFA L;  3OBW A;  3AAR A;  2Q97 A;  2NRX A;  2O4I A;  4CGG A;  4AF1 A;  5FLX O;  3B6O A;  1XC9 A;  3ZET A;  1B92 A;  1EP4 A;  1R59 O;  4CK2 A;  2VWB A;  2O8E B;  1Z26 A;  1YT3 A;  3FFI A;  3UIQ A;  4K8Z A;  4DSF A;  3CQY A;  4DSJ A;  1WSG A;  2LSN A;  4DFM A;  3OYH A;  1SL1 A;  5JVH L;  4DR4 K;  4BRL A;  3I56 N;  3JYT A;  1A5V A;  3I8B A;  3L4I A;  4EAH D;  1C0G A;  4Z94 A;  2UXD K;  1RBS A;  1VQ5 N;  3K2P A;  4DU3 A;  3W3D A;  1X9M A;  1RT1 A;  3VGK A;  4HCC A;  4Z4G A;  2FC0 A;  4FM2 A;  4DB3 A;  2AP1 A;  3CPW M;  2QWP A;  2FSK A;  2GX9 A;  1J5O A;  3WUH A;  4N76 A;  3LP0 A;  3TSQ A;  4CZI A;  4BRH A;  4C8L A;  1WSI A;  3B8A X;  4ZTJ A;  4CBU A;  3WXL A;  4JRP A;  2PY5 A;  5E41 A;  5CZ1 A;  3QIO A;  3H3O B;  2D0O A;  1IG8 A;  4JI8 K;  4ILH A;  1B9F A;  1OVY A;  5I9E B;  4ILJ A;  3OVN A;  1IO2 A;  4E1M A;  1XNR K;  5AQV A;  1T7P A;  2NNW A;  2E4L A;  3S3N A;  3A0I X;  1TK5 A;  4BWJ A;  4CEA A;  3QEV A;  2HW3 A;  3ID6 A;  2GV9 A;  4AHU A;  4MQ3 A;  3SQ0 A;  3GL1 A;  2FXU A;  3P1G A;  1J5E K;  4FK0 A;  4CHY A;  4C8K A;  5M1P A;  3SK3 A;  2HOE A;  2XY7 A;  4CFA A;  1Y64 A;  2P9P A;  2YNG A;  1JKH A;  1OH6 A;  1ZBI A;  4MFB A;  1WAF A;  1R0A A;  1GLD G;  1FKO A;  4AHT A;  2QWR A;  1HQU A;  1RGI A;  4DTS A;  2D0C A;  2QXF A;  3QIP A;  4CEO A;  5IWA K;  4BRN A;  3ZSY A;  3DM2 A;  1HPZ A;  4FVU A;  3EN9 A;  4IJA A;  1GOB A;  1JCG A;  3A2F A;  4CZL A;  4N41 A;  3E9P A;  4YOW A;  3EE9 A;  3K9J A;  3NMU A;  3CYM A;  3VF4 A;  4AHV A;  3S9H A;  4LF4 K;  1CZ9 A;  4CER A;  3AVG A;  3PSI A;  4RWT A;  3ATU A;  1VRT A;  2X6S A;  4FPB A;  4WF9 L;  3BEX A;  3SUQ A;  3V4I A;  1NMD A;  1TL3 A;  4PWD A;  3NGZ A;  4C8M A;  1XHZ A;  3VQ9 A;  1D5A A;  1KSP A;  4R5P A;  4CZF A;  3HP9 A;  3AA5 X;  3QO9 A;  3ZT0 A;  4C8O A;  4CZJ A;  3I55 N;  4XH1 A;  4QOZ B;  3V9Z A;  3MX2 A;  3THY B;  4JHD B;  1KRP A;  1FW6 A;  4NYF A;  1S6Q A;  4JD2 B;  4KH6 A;  3TAP A;  1VQK N;  4IOA L;  4CJQ A;  3TTC A;  1SUQ A;  2P51 A;  4M7Y A;  3NAE A;  1NKC A;  1OKJ A;  4CJP A;  2G8F A;  4H0O A;  4F4K A;  2O8F A;  1NK4 A;  3CI5 A;  5CHI A;  2F96 A;  3AVA A;  5HRS A;  5ADX H;  3AVK A;  2J4R A;  1HQE A;  3ZT4 A;  1NOY A;  1QQM A;  4Z4H A;  2D0P A;  5IT9 O;  3VQP A;  1U2V B;  2QWQ A;  4J2E A;  1HKG A;  4BG9 A;  4IFV A;  4DQR A;  4X62 K;  3BZK A;  1V4S A;  5M1O A;  1SQK A;  4JKD A;  4Z4C A;  1FKP A;  3FZM A;  2KZM A;  4FJ9 A;  2WUS A;  1M1K O;  4CF0 A;  1LOT B;  1EO1 A;  1C1A A;  3D45 A;  2V52 B;  4FWO A;  3PUF A;  1RT7 A;  1HMV A;  2DFF A;  1U48 A;  2A6A A;  1HNW K;  4F3T A;  2KTQ A;  5C0Y A;  3TAF A;  3KTQ A;  1ZBF A;  2P5O A;  2QA4 N;  4DR5 K;  3VQ6 A;  3CCQ N;  3RWU A;  2BH1 A;  2QW9 A;  4HVJ A;  4E3S A;  3DOL A;  3VF2 A;  4B1U B;  5KPT A;  5AFU A;  3HP6 A;  2YKN A;  1QZ5 A;  1JLQ A;  4H03 B;  1WBB A;  1GOC A;  4J2D A;  3RMA A;  4BGB A;  3QEI A;  3EZW A;  1T44 A;  4HCB A;  3F9K A;  4CJV A;  1Q86 O;  4CK1 A;  1BQN A;  4FLY A;  1U45 A;  3K5N A;  2OZM A;  1VSH A;  2ZF5 O;  3MN9 A;  4IO8 A;  1CZA N;  4B1Z A;  4DV5 K;  4YHH K;  3AGR A;  1LCU A;  1P8Z A;  4BQL A;  3CQX A;  5FDL A;  3MDQ A;  4AIL C;  5BRF A;  4W5Q A;  3D6R A;  3QEX A;  4FJN A;  4OGE A;  4EHT A;  4RW8 A;  3LDL A;  1YF5 L;  3LM9 A;  2EWS A;  3EZ5 A;  4JKA A;  4O0I A;  3ZEU B;  3WQU A;  4DR1 K;  5HRN A;  4CJ5 A;  4RW4 A;  1HYS A;  2QI2 A;  1S1X A;  4BY9 C;  5J2P A;  4H5N A;  3K58 A;  3CJB A;  3MMV A;  2ZM6 K;  3SZ2 A;  3G0Z A;  4BC2 A;  4CGD A;  1FJG K;  1N8R O;  4FVM A;  3CJ1 A;  4DQQ A;  3J7Y P;  1VSJ A;  4DFP A;  4NO7 A;  4FL9 A;  1S6P A;  2FBY A;  3ZSV A;  3QIC A;  4QS9 A;  2VG7 A;  5I3U A;  3KLI A;  3LL3 A;  1GOA A;  3TTF A;  1TGO A;  3M3Z A;  3ZSO A;  3A5O C;  3ULD A;  1NJY A;  4CHO A;  2B6A A;  4O4G A;  2A5X A;  1VQ9 N;  1L3T A;  1IG9 A;  3GG4 A;  4QCL A;  2RF2 A;  4LC9 B;  3V81 A;  1HX1 A;  2HMI A;  5BPM A;  2OPS A;  1VQ6 N;  3U4L A;  4ELV A;  1VQ7 N;  4AHC A;  5AQU A;  4E1J A;  2BAN A;  4CHZ A;  4RCH A;  1JLA A;  2ASP A;  2I7P A;  2PBD A;  3CHW A;  3VQA A;  3D2F B;  4DSL A;  3M8R A;  3KWG A;  5H1S Q;  4CED A;  1NGD A;  3TU5 A;  3DYA A;  4PKG A;  2HMP A;  4H4M A;  1L3U A;  1JCF A;  1RTI A;  1T6C A;  4HUG A;  1ITG A;  4EZ9 A;  3ZT3 A;  3O6W A;  3VPZ A;  3L3V A;  2HVI A;  3VEN A;  3THW B;  4CF1 A;  1TK0 A;  3ZLJ A;  4JKG A;  1NKB A;  5AFU H;  3NH1 A;  3SQ2 A;  4M3R A;  3CMA N;  4OKK A;  4B9N A;  3HPG A;  4JKF A;  3MK6 A;  4JK7 A;  4OJR A;  4OKJ A;  3T7Z A;  1Q8I A;  3SV4 A;  2NLX A;  3KLE A;  4Q0B A;  3UKU B;  2ZJP L;  2G8W A;  5C2D A;  3THX A;  2Z1I A;  4FJJ A;  3F5T A;  1BI4 A;  2CH6 A;  3HRG A;  1HKC A;  1VRU A;  4J2B A;  2E88 A;  4ID5 A;  4GKK K;  1VHX A;  3DLK A;  1VQ4 N;  2B5J A;  3DXM A;  3PV8 A;  3TR8 A;  1HYZ A;  2QTD A;  3KIO A;  4E7J A;  3RRG A;  4FOI A;  4B1W B;  3A8Y A;  3ZYY X;  4NCB A;  3CG7 A;  1JLG A;  5DMR A;  3O9Q A;  1G99 A;  5GIN A;  4OPJ A;  4Y0W A;  4KHW A;  5I42 A;  1TKT A;  1LAW A;  2O8B A;  3E1Y A;  4CGH A;  2EHG A;  4ILG B;  4CZK A;  4CJF A;  1GLC G;  4CHN A;  4JRQ A;  4OKE A;  2HHU A;  4CI6 A;  4H4O A;  4MLE A;  1NK6 A;  2ITG A;  4PL8 A;  5HRO A;  2ASO A;  2OPQ A;  5J1E A;  4FWM A;  1YIT N;  4X66 K;  3WNF A;  4DTU A;  4E19 A;  4RG8 A;  2E2N A;  1CXQ A;  4XH4 A;  1S5J A;  3ENO A;  4CF8 A;  3LP1 A;  4IDK A;  1Y97 A;  4O8U A;  4FLW A;  4KRF A;  2ZE2 A;  4C1N K;  2NRT A;  2UYT A;  4H5W A;  3ZCM A;  2P9U A;  1S72 N;  3D2F A;  3LPU A;  1N6Q A;  2P9L B;  3MEC A;  3VA0 A;  3DOK A;  4I6M B;  4CGF A;  4DTM A;  3AAP A;  1EX4 A;  2CGJ A;  4DQI A;  3TAB A;  4KI4 A;  1C0F A;  3IG1 A;  4DV3 K;  3PX6 A;  2YX6 A;  2O8D A;  1RFQ A;  4DSI A;  3EE8 A;  3HXM A;  3CC2 N;  5BRD A;  3G71 N;  4FLV A;  4JKG B;  4DUY K;  3TAR A;  2VG5 A;  3O9T A;  3THW A;  3V9S A;  3WXM B;  3V1R A;  1RT4 A;  1G15 A;  4IEE A;  4DR3 K;  4BDP A;  3BGR A;  3LP3 A;  2ETJ A;  2F9W A;  5TKY A;  3CME N;  1QVF M;  5CYM A;  3VQE A;  5KTQ A;  1QE1 A;  1SKW A;  3VQ5 A;  3SMS A;  4WQ5 C;  4O5B A;  4YOR A;  4BR2 A;  3CIP A;  3VQ7 A;  5LJV A;  1QTM A;  1MWM A;  2P9L A;  1HLU A;  4DTX A;  1YHQ N;  2P1J A;  4CJU A;  1BA0 A;  3AGK A;  4YFU A;  4F9O A;  3ATV A;  3ISN C;  4Z4F A;  1HRH A;  3ENH A;  4KB1 A;  3HTV A;  5AQJ A;  3C0B A;  4M3U A;  4ELU A;  2F8S A;  3DAW A;  3ENB A;  4N5S A;  2IOC A;  2ZWH A;  3OS0 A;  2UXB K;  4FWQ A;  2YHB A;  3R3L A;  1WB9 A;  4Z4I A;  4CIF A;  4DU1 A;  1HKB A;  4BRF A;  4LY7 A;  3OYC A;  2HF3 A;  4LFA K;  3OYA A;  2KZZ A;  3HK2 A;  2BGG A;  4CF2 A;  1NGB A;  3CCL N;  2G8U A;  2UU9 K;  4FJX A;  1YJN N;  1TAQ A;  2E2O A;  5F1X A;  4BRG A;  4H5R A;  1NGI A;  4FJ8 A;  4DTN A;  1N36 K;  3GE1 A;  3AVL A;  3ZSQ A;  4DFK A;  1YVU A;  5AQG A;  2B4J A;  3SUN A;  3H1Q A;  3AY9 A;  3V9W A;  3ULE B;  4WQ4 A;  3THX B;  4FPA A;  5BR8 K;  3MXJ A;  3WNH A;  3JXU A;  5JLH A;  2YNF A;  1F21 A;  3LZJ A;  3PSF A;  1IKY A;  1C0U A;  3MN6 A;  4IOC L;  1IJJ A;  2YV0 X;  4V19 S;  3AO5 A;  1DGK N;  2QM1 A;  4H0P A;  2ASM A;  1S1W A;  2Q36 A;  3L2V A;  3CCE N;  1BGX T;  2WTU A;  1QHA A;  4NYN A;  1ATN A;  3NGY A;  4J8F A;  4A5A A;  3HVR A;  4KB0 A;  1XC3 A;  3VQ8 A;  3PX0 A;  4BE1 A;  4JAX A;  3VQD A;  3AVN A;  3U8X A;  4H8K A;  1U04 A;  2HHQ A;  1HJR A;  4LF8 K;  3O80 A;  3MED A;  2HHT A;  1YTU A;  3LZI A;  3HT3 A;  3AVC A;  2P9S A;  1NLV A;  4K42 A;  2F9T A;  1NGG A;  4YOT A;  4CW7 B;  1J6Z A;  4BC3 A;  2GWJ A;  5CZ2 A;  3HPO A;  1UA0 A;  3OYE A;  3T69 A;  4FWL A;  3MEG A;  4HWI A;  4EFH A;  5HP1 A;  4B9L A;  3DXM B;  3VTH A;  3OBY A;  3QBW A;  3DWL A;  4FLU A;  1WSJ A;  4A62 A;  4BAC A;  3ZSZ A;  3VQQ A;  3A5M C;  3AO3 A;  4H5T A;  2OTL N;  3LDO A;  1TKD A;  3CCV N;  3ALY A;  4WQ5 A;  4PL7 A;  3C6T A;  3VN5 A;  2R7Y A;  2PZS A;  5GAE P;  4FWN A;  4FLT A;  4Y1D A;  4FK2 A;  3OYI A;  3RVC A;  4FJM A;  3CF5 L;  2JGU A;  2OZS A;  3HSC A;  4DG1 A;  3MN7 A;  1BQM A;  3I0S A;  5F0X A;  4FJK A;  1NBW A;  4M63 C;  5AQQ A;  4KI6 A;  4E0D A;  2YHW A;  3FGU A;  2O4G A;  3DLG A;  3KKS A;  2GTD A;  4X64 K;  1S9E A;  4CJR A;  5MLC Q;  4NCA A;  2RN2 A;  3H3N O;  4RW9 A;  5AQM A;  3OYL A;  4JEP A;  4DUZ K;  4PY5 A;  3V6D A;  3OYF A;  3AO2 A;  5EOY A;  4MO5 A;  1JJ2 M;  3SNN A;  2P9P B;  4O8K A;  5AQP A;  5BPN A;  4AQY K;  3RR7 A;  5GAG P;  3S41 A;  5C25 A;  1UA1 A;  3SQ1 A;  2NRR A;  3J8A A;  5JIC A;  3L6Q A;  1T05 A;  4JHD A;  3ZSR A;  3D7E O;  1Z6R A;  4E7I A;  5C24 A;  3OA9 A;  2QXL A;  4FWK A;  3OW2 M;  2VYP A;  3L4Q A;  1XQS C;  1TYQ B;  1YJW N;  1W97 L;  3MEE A;  1TUY A;  4DFJ A;  2HHX A;  1X9W A;  2WC9 A;  3EL2 A;  3O08 A;  1GLE G;  3C7N B;  1W7A A;  4LF7 K;  3AVH A;  3HVT A;  1HYV A;  1QQC A;  4Z0U A;  4GMJ B;  3AVI A;  4DTJ A;  3FE1 A;  1VSE A;  2HB5 A;  3VEX A;  2HBJ A;  4EP5 A;  5GAD P;  4KKO A;  1BWF O;  2P9U B;  3M5R A;  2VQE K;  3V9X A;  4EZ6 A;  3A5N C;  4A57 A;  2E8A A;  3CJ9 A;  3KK1 A;  3CCU N;  4BRE A;  3LDP A;  5KQD A;  2IDO A;  4KTZ A;  4CD3 A;  3AO1 A;  3F2K A;  1BU6 O;  3ZX3 A;  5HL7 L;  3C65 A;  2FSN A;  5FRM A;  4N47 A;  3TAE A;  3L0Q A;  4H5V A;  4FJH A;  3IS9 A;  3CFP A;  1Z25 A;  1TV6 A;  1KD1 O;  4OLA A;  1XUP O;  1RBT A;  1KVA A;  4DSE A;  2VWK A;  3IRX A;  1YVN A;  2E1Y A;  3J81 O;  3VEW A;  3E01 A;  1GLB G;  4HTL A;  1GLL O;  1KAX A;  2GBZ A;  3N4Q A;  4OX9 K;  1KTQ A;  1E4F T;  3DLE A;  1LWE A;  3QFU A;  2IC3 A;  1BG3 A;  3QES A;  3OYN A;  2F8T A;  3E66 A;  1RT5 A;  4CBW A;  1KLN A;  4C8N A;  3ID8 A;  1BO5 O;  3TAG A;  2ITM A;  4FK4 A;  2HBK A;  1C0T A;  3SYZ A;  5GIO A;  5M1K A;  2YKM A;  1VAZ A;  2NUB A;  3O9U A;  1A5X A;  2O8C B;  4BRD A;  4GW6 A;  1SL2 A;  5DM7 L;  3AA4 A;  3T1A A;  5CE3 A;  1RTD A;  2Q1N A;  3FR0 A;  4NCG A;  2A41 A;  2IVO A;  3VMF B;  3O3G A;  1D9F A;  2YNI A;  3BP8 A;  4EIA A;  1DT9 A;  1GLJ O;  1HPM A;  3E9L A;  4JI2 K;  4JNE A;  3UE5 A;  3QER A;  1VQP N;  4B3O A;  1NM1 A;  3ZT2 A;  2V7Y A;  5HBM A;  4R79 A;  4CJ7 A;  1OH5 A;  4JV5 K;  5C10 A;  4JKB A;  1EXQ A;  3VA3 A;  1SKS A;  5DK5 A;  1BCM A;  1YXQ A;  2QKK A;  1S22 A;  2Q0R A;  1GLA G;  3ZX0 A;  2G8V A;  3BZC A;  3MN5 A;  2VWJ A;  1ILY A;  3QEP A;  4J2A A;  2DTU A;  4AM7 A;  2OA8 A;  3H46 O;  3N4P A;  3SPZ A;  2HNZ A;  3GDQ A;  4DV4 K;  1UOC A;  1K8A O;  1RCH A;  3EKU A;  2FSJ A;  4HTU A;  5BR9 A;  1YI2 N;  3QBX A;  3JAM O;  1IH7 A;  2E2P A;  4BC5 A;  5T7B A;  2W6L A;  2P9I A;  5LJW A;  3D2E A;  3R6M A;  3K5M A;  1SAZ A;  4HUE A;  4ZTF A;  3VGM A;  3HYF A;  3U9D A;  3CCS N;  4W5T A;  1BIU A;  4IG3 A;  1QQN A;  4PKH A;  4KH4 A;  1JXE A;  3KLF A;  2X74 A;  5CR4 A;  4ISG A;  3P38 A;  2OAN A;  4LD0 A;  1YUW A;  3U6F A;  5KQ8 A;  3G4S N;  3WT0 A;  1EKE A;  3LWM A;  4OPA A;  3LDS A;  4K25 A;  1RIL A;  1QVG M;  1C1B A;  3PO4 A;  3T19 A;  3ZX2 A;  5AQH A;  1X9S A;  2NZT A;  3AAQ A;  3MCA B;  4M3X A;  5C42 A;  5HLF A;  4FWR A;  4GY2 B;  1BIS A;  4A5B A;  4CFB A;  3V1Q A;  4F8R A;  4KHU A;  3SBT A;  1NJI O;  4F2R A;  1N34 K;  5KI6 A;  2Q31 A;  3WEE B;  4K41 A;  3G25 A;  5FPE A;  4KH5 A;  3O3F A;  3P31 A;  1LAV A;  4GVM A;  4FLX A;  1LW2 A;  4AH9 A;  4OPH A;  2HF4 A;  2RPI A;  3U9Z A;  1S3X A;  4NLC A;  4B8A B;  1BL3 A;  4WQ4 C;  4MO4 A;  3O8M A;  4GKJ K;  3EEQ A;  1NK5 A;  2Z1G A;  5D3G A;  2GUP A;  3HM8 A;  2W41 A;  3WNG A;  3NCI A;  3C6H A;  1NGE A;  3RTV A;  3VEV A;  5J2M A;  3UKR A;  2VG6 A;  1FXX A;  2FBT A;  3K9K A;  1ZBU A;  3FFK B;  3C94 A;  4M3W A;  4FJG A;  4WYB A;  2QKB A;  1BUP A;  4Y1C A;  4RW6 A;  3NF7 A;  3CM6 A;  4EHU A;  1ZBL A;  2OPP A;  1D9D A;  2RKI A;  3KVG A;  1WSE A;  3QFP A;  4U67 L;  4BR9 A;  1D4X A;  2CH5 A;  5AQR A;  2E20 A;  4KO0 A;  4MDB A;  1UAX A;  3T1H K;  1DEJ A;  2W40 A;  4OGC A;  1SL0 A;  1RBV A;  1IBL K;  3VEZ A;  1WAJ A;  5LMU K;  3D2E B;  4BC4 A;  3P4I A;  4BQZ A;  4O55 A;  1RNH A;  3BDP A;  2HBM A;  2UXC K;  1O13 A;  4N56 A;  3RMB A;  3H6E A;  3OYD A;  3IKM A;  3VGL A;  4CEZ A;  2PFU A;  2BUP A;  4F2S A;  3PX4 A;  1U2V A;  3CD6 N;  3I0R A;  4BRO A;  3VER A;  3SJJ A;  4B1X B;  3HO1 A;  5FRN A;  4DKW A;  5ADX A;  1NJX A;  5JS2 A;  4YOX A;  5M1N A;  1SS6 A;  3WXI A;  4BRP A;  4KTW A;  3SBG A;  1RDA A;  3NVK A;  3CM5 A;  1BA1 A;  1S9G A;  3EY1 A;  1OVQ A;  2YJE A;  4CJE A;  3MXM A;  4CZM A;  3L2U A;  4FWP A;  3M8S A;  2ZQB A;  1XMO K;  3MWT A;  1RBU A;  4CJ4 A;  4JKH A;  2BTF A;  2D4W A;  3DXK A;  3K57 A;  1VQL N;  5EX5 A;  1KQS M;  3LAL A;  3S3O A;  2HVH A;  5AQK A;  3VEO A;  4BR5 A;  5HOO A;  5J2Q A;  3O4W A;  3J7Z O;  2Y1I A;  2JWK A;  4LF5 K;  3DRR A;  1TKZ A;  4BE0 A;  5C12 A;  4KPY A;  5DM6 L;  2HND A;  3S3M A;  3NF8 A;  1Q81 O;  2JLE A;  3LDQ A;  1RDU A;  1VSK A;  2FBX A;  3JSM A;  4QAG A;  2P9K B;  2WOM A;  3R8E A;  3VQB A;  3LDN A;  1NKE A;  1CLQ A;  1VQO N;  2FLO A;  4C23 A;  1ASV A;  3ULE A;  3DLH A;  2E6M A;  5AQO A;  4KHS A;  3TPQ A;  2D0B A;  3EO3 A;  2G8H A;  2HST A;  1HNZ K;  4CES A;  1C1C A;  1K8K B;  1NJW A;  4M3Y A;  3RR8 A;  3CJ7 A;  3KK2 A;  1U6Z A;  4CCH A;  1U4B A;  4DLE A;  3MXI A;  2DY4 A;  4IOX A;  5FPD A;  4JS4 A;  2P9I B;  4B9U A;  3LPT A;  2NRV A;  2IGI A;  5JVG L;  1IV0 A;  1D8Y A;  1X1P A;  3P39 A;  1Q18 A;  2KW4 A;  3BF3 A;  3AO4 A;  1ASU A;  4FZZ A;  1N32 K;  4CIE A;  2PAV A;  5M1Q A;  4E1N A;  3ZSW A;  1EWQ A;  1KAY A;  1T8E A;  2YI1 A;  4IEI A;  1RT3 A;  1J53 A;  2WON A;  4KTQ A;  4IZ9 A;  4DV6 K;  4DMN A;  3DLR A; 
#chains in the Genus database with same CATH homology
 3H3N O;  4FSV A;  2QA4 N;  3CCQ N;  5AQM A;  2BH1 A;  2QW9 A;  4IXC A;  4JEP A;  2YHX A;  4XH5 A;  4U7B A;  2ZGY A;  5LY3 A;  1NWK A;  4GV3 A;  5EOY A;  4BR0 A;  4MO5 A;  3FZK A;  2QEX N;  3VF2 A;  1JJ2 M;  3MCP A;  2V51 B;  3O1B A;  4B1U B;  2P9P B;  4O8K A;  5AQP A;  5AFU A;  5BPN A;  5KPT A;  5KPR A;  1QZ5 A;  3S41 A;  5GAG P;  2I7N A;  1ATS A;  4H03 B;  3TSP A;  4FO0 A;  2NRR A;  1VQM N;  5AQW A;  3J8A A;  4BGB A;  5JIC A;  3EZW A;  3L6Q A;  4JHD A;  3D7E O;  5C2F A;  1Z6R A;  1T44 A;  3M6G A;  3OA9 A;  3ZEU A;  2Q2R A;  1Q86 O;  2QXL A;  4FWK A;  3OW2 M;  2VYP A;  3L4Q A;  4GNI A;  5JMV A;  1XQS C;  2A3Z A;  2YCH A;  1TYQ B;  1YJW N;  1W97 L;  5BRE A;  5E26 A;  1TUY A;  5GAH P;  2ZF5 O;  3G6E N;  3MN9 A;  4IO8 A;  2WC9 A;  1CZA N;  3RSE A;  3EL2 A;  4B1Z A;  3O08 A;  1NGF A;  1GLE G;  1T6D A;  3AGR A;  4XEI A;  3C7N B;  5AQN A;  4IO9 L;  3FZH A;  3VET A;  1LCU A;  1P8Z A;  1E4G T;  4H0Y B;  3CQX A;  4BQL A;  3MDQ A;  1GLF O;  5BRF A;  3D6R A;  5AQS A;  1NGJ A;  3WXK A;  5E84 A;  4EHT A;  3LDL A;  1YF5 L;  3LM9 A;  2EWS A;  4JKA A;  4CZG A;  4YDU A;  4B1V A;  3ZEU B;  3WQU A;  3IDH A;  3FE1 A;  3ZET B;  5C15 A;  2QWO A;  2WFB A;  2ZGZ A;  3VEX A;  3LM2 A;  2QI2 A;  3CJA A;  2HBJ A;  4L3Q A;  3R1X A;  3SAH A;  5F2R A;  4BY9 C;  5GAD P;  4H5N A;  3CJB A;  1BWF O;  2P9U B;  3M5R A;  3MMV A;  4BC2 A;  1RDW X;  5AQL A;  4B9Q A;  3C7N A;  3A5N C;  4A57 A;  2E8A A;  3CJ9 A;  5AQX A;  4RTF D;  1N8R O;  3CCU N;  4BRE A;  1WOQ A;  3CJ1 A;  3LDP A;  5FPM A;  4BGA A;  3IMX A;  5AZJ A;  5KQD A;  3EKS A;  4CD3 A;  4NO7 A;  4FL9 A;  3F2K A;  3CCR N;  2IVP A;  4JD2 A;  1BU6 O;  4JK8 A;  3O9R A;  3ZX3 A;  5HL7 L;  3C65 A;  3QIC A;  2FSN A;  4QS9 A;  3DJC A;  4KBO A;  3LL3 A;  1WUA A;  4IFE A;  3TTF A;  5AQZ A;  3L0Q A;  4H5V A;  3M3Z A;  3KWI A;  3A5O C;  4WCE L;  3HZ6 A;  1KD1 O;  2QWM A;  3Q7B A;  3RSE B;  3WEE A;  3FLC O;  1XUP O;  3O5B A;  2A5X A;  4MLH A;  4O5F A;  1YIJ N;  1VQ9 N;  3GG4 A;  5AQI A;  3WQT A;  3VEY A;  4JK9 A;  3BUZ B;  1YVN A;  4LC9 B;  2E1Y A;  4C1N I;  1HX1 A;  5BPM A;  4FOE A;  3VEW A;  3F9M A;  1GLB G;  1VQ6 N;  4HTL A;  1GLL O;  1KAX A;  3U4L A;  3N4Q A;  4JKC A;  1K9M O;  1VQ7 N;  5AQY A;  4M7X A;  5AQU A;  1ZBS A;  2DPN A;  4E1J A;  1E4F T;  3QFU A;  4RCH A;  1EQY A;  2ASP A;  2I7P A;  4IJN A;  2PBD A;  1BG3 A;  3CHW A;  3D2F B;  3E66 A;  3TSU A;  4BRM A;  4CBW A;  2ZJQ L;  2FF6 A;  2D1K A;  3KWG A;  3HI0 A;  3ID8 A;  5ELZ A;  5H1S Q;  1BO5 O;  2ITM A;  3UKR B;  5KPZ A;  3A5L C;  5GIP A;  1NGD A;  3TU5 A;  4A2A A;  3FZF A;  2HBK A;  1HUX A;  5GIO A;  3UKU A;  3M1F A;  4PKG A;  2HMP A;  5M1K A;  1VAZ A;  4BR4 A;  2IIR A;  3FZL A;  1JCF A;  5BPL A;  4MDA A;  1T6C A;  3QML A;  3O9U A;  2GEM A;  3QDK A;  4IDH A;  3O6W A;  3PLA A;  4BRD A;  2RHK A;  3VPZ A;  2V7Z A;  4QS7 A;  5DM7 L;  3VF6 A;  3KHY A;  1NGC A;  3VEN A;  4H0V B;  3HBT A;  5CE3 A;  2P9N A;  1Z05 A;  2Q1N A;  3FR0 A;  1YJ9 N;  2A41 A;  2IVO A;  4JKG A;  4A2B A;  2NRH A;  5AFU H;  3TTD A;  3VMF B;  3HOT A;  1T3V A;  4DCH A;  4UY8 O;  3CMA N;  3IFR A;  3BP8 A;  1Q82 O;  4JKF A;  4EIA A;  3MK6 A;  1SZ2 A;  4JK7 A;  1DT9 A;  3OHR A;  1GLJ O;  1HPM A;  3E9L A;  4BVO A;  4JNE A;  3T7Z A;  3UE5 A;  1VQP N;  2NLX A;  1Q7Y O;  3UKU B;  2ZJP L;  3SMP A;  4NB4 A;  5EVZ A;  4BR7 A;  1NM1 A;  5C2D A;  2V7Y A;  4NLB A;  3F5T A;  3IUC A;  4CJ7 A;  2CH6 A;  3HRG A;  4R79 A;  4FWS A;  1HKC A;  2YJF A;  4JKB A;  5C10 A;  3WXJ A;  4I6M A;  4GV9 A;  4WFB L;  2E88 A;  1DKG D;  4H0X B;  1YXQ A;  1VQ4 N;  3DXM A;  4JN4 A;  2FF3 B;  3BF1 A;  2QTD A;  3SAF A;  1S22 A;  4IWV A;  4YOY A;  1ZXO A;  2Q0R A;  3GOI A;  5EY4 A;  1GLA G;  4FOI A;  3ZX0 A;  1BDG A;  4B1W B;  3A8Y A;  3ZYY X;  4DHY A;  2VCP A;  5M1F A;  4PHT X;  3MN5 A;  1ILY A;  5EXW A;  4AM7 A;  2P9S B;  3O9Q A;  1X3M A;  3H45 C;  1G99 A;  3H46 O;  3N4P A;  1JCE A;  2NRW A;  5GIN A;  2NRZ A;  3VOV A;  4YOU A;  4Y0W A;  3GDQ A;  2P9N B;  4B1Y B;  1K8A O;  3EKU A;  2FSJ A;  5FPN A;  5AZI B;  5BR9 A;  3E1Y A;  2WBN A;  1YI2 N;  3HOS A;  1TUU A;  3KZB A;  1P90 A;  1VQN N;  3QBX A;  1NGA A;  4ILG B;  2E2P A;  4BC5 A;  4CZK A;  4K43 A;  1K73 O;  5BN9 A;  2P9I A;  4YDU C;  3D2E A;  5LJW A;  3R6M A;  1TYQ A;  1YAG A;  1GLC G;  5AZJ B;  1SAZ A;  2AA4 A;  3CXC M;  4ISF A;  4BG8 A;  4CI6 A;  3VGM A;  4MLE A;  5AQF A;  3U9D A;  3CCS N;  4PL8 A;  1K8K A;  2ASO A;  4FWM A;  1YIT N;  1QQN A;  3MX5 A;  1KXP A;  4PKH A;  4CZH A;  2E2N A;  4KH4 A;  4XH4 A;  4BRQ A;  1MWK A;  3ENO A;  2A42 A;  3R9P A;  1BOT O;  1KC8 O;  1H1V A;  1V4T A;  3PIO L;  4A61 A;  5CR4 A;  4O8U A;  2OTJ N;  4ISG A;  3P38 A;  2OAN A;  4PKI A;  4C1N K;  2NRT A;  1YUW A;  2UYT A;  4H5W A;  2QWL A;  2P9U A;  4DQ8 A;  3WT0 A;  4BRA A;  5KQ8 A;  3G4S N;  3CCM N;  1S72 N;  4OO1 J;  1QZ6 A;  3D2F A;  3QB0 A;  4OPA A;  2P9L B;  2JWL A;  4K25 A;  1QVG M;  4WFA L;  3OBW A;  3AAR A;  2Q97 A;  2NRX A;  4I6M B;  3ZX2 A;  5AQH A;  4AF1 A;  2NZT A;  3AAQ A;  3MCA B;  3E9O A;  2CGJ A;  3AAP A;  2E1Z A;  3ZET A;  2Q0U A;  1R59 O;  4FWR A;  1C0F A;  4GY2 B;  2VWB A;  4A5B A;  4GV6 A;  3CCJ N;  3SBT A;  1NJI O;  2YX6 A;  1RFQ A;  2Q31 A;  3EE8 A;  1X3N A;  2IVN A;  1W2B M;  3CC2 N;  3WEE B;  3CQY A;  4A59 A;  5BRD A;  4K41 A;  3DXK B;  3G71 N;  5JVH L;  3G25 A;  3O1W A;  4JKG B;  3O9T A;  5FPE A;  4BRL A;  4KH5 A;  4H0T B;  3I56 N;  3I8B A;  3L4I A;  3P31 A;  4EAH D;  5AR0 A;  1C0G A;  2YHY A;  4Z94 A;  3WXM B;  1VQ5 N;  4OPH A;  2HF4 A;  3U9Z A;  2GEL A;  1S3X A;  4IEE A;  4NLC A;  4WQ4 C;  3W3D A;  3VGK A;  4CD1 A;  4MO4 A;  3O8M A;  4DB3 A;  2AP1 A;  2GUP A;  3HM8 A;  2F9W A;  2W41 A;  5TKY A;  3UB5 A;  3CME N;  1QVF M;  3C6H A;  1NGH A;  2CGK A;  1NGE A;  3CPW M;  4YOV A;  2QWP A;  3GBT A;  2FSK A;  3SMS A;  4WQ5 C;  3UKR A;  4YOR A;  2GX9 A;  3VEV A;  3CIP A;  4BR2 A;  4CZE A;  5LJV A;  3WUH A;  3K9K A;  1MWM A;  2P9L A;  3FFK B;  3TSQ A;  4CZI A;  4BRH A;  1HLU A;  4WYB A;  3B8A X;  1YHQ N;  4CBU A;  3WXL A;  2VGN A;  1BA0 A;  2KKZ A;  3AGK A;  3W0L A;  1BUP A;  4F9O A;  3H3O B;  2D0O A;  1IG8 A;  4ILH A;  3ATV A;  1VQ8 N;  3ENH A;  1OVY A;  4EHU A;  5I9E B;  3HTV A;  5AQJ A;  3C0B A;  4ILJ A;  4CBX A;  2KHO A;  3KVG A;  5AQV A;  2HBL A;  3QFP A;  2NNW A;  3DAW A;  3ENB A;  4BR9 A;  2CGL A;  1D4X A;  3A0I X;  4U67 L;  2ZWH A;  4WFN L;  2CH5 A;  3KK7 A;  5AQR A;  3ID6 A;  2E20 A;  4FWQ A;  2F7T A;  4MDB A;  3R3L A;  4BRK A;  3SAG A;  3NVM A;  3GL1 A;  2FXU A;  1DEJ A;  2W40 A;  3Q7C A;  1HKB A;  4ISE A;  4BRF A;  3VEZ A;  2HF3 A;  3D2E B;  5M1P A;  3SK3 A;  4BC4 A;  3P4I A;  2HOE A;  4BQZ A;  5TKW A;  1NGB A;  1Y64 A;  3CCL N;  2HBM A;  2P9P A;  1O13 A;  3H6E A;  4G9Z A;  3IKM A;  3VGL A;  1YJN N;  2PFU A;  2E2O A;  1GLD G;  2BUP A;  2QWR A;  3I33 A;  4GVE A;  5F1X A;  4BRG A;  1U2V A;  4H5R A;  3DLL L;  1RGI A;  1NGI A;  3CD6 N;  4BRO A;  5B8H A;  3VER A;  3GE1 A;  5AQG A;  4B1X B;  4BRN A;  3CC4 N;  3H1Q A;  3AY9 A;  4DKW A;  4AM6 A;  5ADX A;  4FVU A;  3ULE B;  3EN9 A;  4IJA A;  4WQ4 A;  4YOX A;  5M1N A;  1SS6 A;  4FPA A;  3WXI A;  3PIP L;  1JCG A;  4BRP A;  2KLA A;  3SBG A;  4CZL A;  3JXU A;  5JLH A;  3NVK A;  2P9K A;  3MN6 A;  4IOC L;  3E9P A;  1BA1 A;  1IJJ A;  4YOW A;  3EE9 A;  3K9J A;  4BVP A;  3NMU A;  1DGK N;  4QS8 A;  2QM1 A;  4H0P A;  2ASM A;  2YJE A;  3VF4 A;  2Q36 A;  3CCE N;  5BN8 A;  3SJH A;  4CZM A;  4FWP A;  1X9J A;  1QHA A;  1MDU B;  3MWT A;  3C6A A;  1ATN A;  4RWT A;  3ATU A;  4FPB A;  4JKH A;  4WF9 L;  2BTF A;  3BEX A;  2D4W A;  3DXK A;  1NMD A;  4J8F A;  4A5A A;  1VQL N;  5EX5 A;  1KQS M;  1ATR A;  1XC3 A;  1ESV A;  3MWP A;  3SLC A;  2GWK A;  5AQK A;  4JAX A;  3VEO A;  4BR5 A;  3O9S A;  5HOO A;  3O4W A;  4CZF A;  5JLF A;  1KAZ A;  3J7Z O;  3U8X A;  3H1V X;  2JWK A;  3CET A;  3O80 A;  4CZJ A;  2ZJR L;  1HJO A;  3I55 N;  2RE2 A;  4XH1 A;  3VES A;  2QWN A;  5C12 A;  3MX2 A;  5DM6 L;  1Q81 O;  4JHD B;  3CPE A;  2P9S A;  1NLV A;  4JKE A;  3LDQ A;  1M90 O;  4K42 A;  4JD2 B;  4KH6 A;  1ZC6 A;  1VQK N;  4IOA L;  1RDU A;  2F9T A;  4BRC A;  1NGG A;  4YOT A;  3TTC A;  2P9K B;  1J6Z A;  4M7Y A;  3R8E A;  1OKJ A;  3LDN A;  4BC3 A;  2GWJ A;  2FLO A;  1VQO N;  4C23 A;  3CJC A;  2E2Q A;  4H0O A;  3T69 A;  3ULE A;  4FWL A;  4HWI A;  5AQO A;  3CI5 A;  4EFH A;  3DXM B;  3VTH A;  3OBY A;  3QBW A;  3DWL A;  3TPQ A;  5CHI A;  2A40 A;  5ADX H;  3EO3 A;  2J4R A;  4A62 A;  2HST A;  1QQM A;  3A5M C;  1K8K B;  2D0P A;  2VGM A;  4H5T A;  1U2V B;  3CJ7 A;  1U6Z A;  2QWQ A;  3JS6 A;  1HKG A;  4BG9 A;  2OTL N;  3LDO A;  1MA9 B;  3CCV N;  5AQT A;  4IOX A;  5FPD A;  4WQ5 A;  4PL7 A;  1V4S A;  5M1O A;  2P9I B;  1SQK A;  5GAE P;  4JKD A;  2NRV A;  4FWN A;  5JVG L;  3VTI A;  3FZM A;  2H3G X;  3P39 A;  3RVC A;  1Q18 A;  3CF5 L;  2WUS A;  3BF3 A;  5AZI A;  3HSC A;  1M1K O;  3CC7 N;  3MN7 A;  2PAV A;  5M1Q A;  1LOT B;  4BRI A;  1EO1 A;  5F0X A;  2V52 B;  1KAY A;  4FWO A;  1NBW A;  4M63 C;  3CER A;  5AQQ A;  2YI1 A;  4IEI A;  5BRH A;  4IZ9 A;  2YHW A;  3FGU A;  2A6A A;  2GTD A;  5MLC Q;  5C0Y A;  1QQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...