4BR7A

Legionella pneumophila ntpdase1 crystal form i, open, ampnp complex
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
356
structure length
356
Chain Sequence
PCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 116
structure length 356
sequence length 356
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4br7A01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4br7A02
4BG8A 5EY4A 2YI1A 3VERA 1HLUA 5AZJB 1BA1A 4A2AA 3R6MA 3R8EA 1LOTB 1S22A 1JCGA 3LDOA 3VF6A 4FWPA 4CZHA 2P9NA 1ZBSA 1GLFO 3CJ1A 3WXKA 5JLHA 3DAWA 4BR4A 3U4LA 1SZ2A 2E8AA 4CI6A 4BQLA 1YVNA 2YHXA 2PAVA 5CE3A 3O08A 5BPNA 5AQWA 2Q31A 3FLCO 3F9MA 3ZETB 4BC2A 4A61A 3VEXA 3VOVA 5BREA 1BDGA 3ENOA 4WYBA 1KXPA 4BR7A 1X3NA 3DXKB 2ZF5O 3MMVA 3C7NA 1ZC6A 1DKGD 4BRDA 2IIRA 3VPZA 3WQTA 5AQIA 1QQMA 4YDUA 2QWOA 4QS7A 5AQUA 3LL3A 2IVPA 4XEIA 3CERA 3VENA 4K25A 4O8KA 5AQJA 4BR9A 4EHUA 3O4WA 1JCFA 2HOEA 4WQ4C 1BA0A 1XC3A 2P9KA 2KHOA 4M63C 3QICA 2QW9A 4BRGA 1ATNA 3WXIA 3IFRA 3H6EA 5KPZA 3CJBA 3VGLA 5AQZA 4CZLA 1HKGA 2P9SB 3LDNA 3TPQA 3J8AA 1MA9B 3LDQA 4BRFA 2ZGZA 4FOIA 4FL9A 5AQRA 1GLCG 3IUCA 4AM6A 4JAXA 1HX1A 4KBOA 1C0FA 3HI0A 4BVPA 1GLLO 4H5WA 1XUPO 2V7YA 4B1WB 3DXMA 4HWIA 1P8ZA 3FE1A 1NM1A 5TKYA 3WEEA 3VETA 4RCHA 1ZXOA 3D2FB 4JN4A 4F9OA 2F9TA 4XH4A 4BRAA 3A5LC 3ENHA 2NRHA 4QS8A 3DWLA 1Z6RA 4I6MA 4E1JA 3A5NC 2CGLA 4EHTA 1NGGA 1KAYA 3BF1A 3VEWA 1S3XA 3EO3A 3HSCA 5AQVA 2FSJA 3CQXA 1IJJA 5FPDA 3EKUA 1T6CA 3FZMA 4JD2B 4WQ5C 3VEYA 4FWQA 4PKHA 3GOIA 3GBTA 4FWSA 1SQKA 3UKUB 4BROA 2QWLA 4WQ4A 3QB0A 5EVZA 1RGIA 5FPEA 2YJFA 3G25A 2PBDA 3QMLA 1NGJA 4LC9B 1HUXA 2E2QA 2P9NB 1MDUB 4JD2A 4FPAA 2E1ZA 4H0OA 3CQYA 4BQZA 2QWRA 3HTVA 2BTFA 1DGKN 1ATSA 4JNEA 2VYPA 3MCPA 4ISGA 3ZX0A 5AFUA 2Q97A 4FSVA 4B1UB 3H1VX 4BGAA 4PKIA 1C0GA 4BREA 5LJVA 2W41A 1KAZA 3CHWA 3C7NB 3FZFA 1NWKA 3L4IA 2QM1A 4EAHD 2ZWHA 5KQDA 3IMXA 2ITMA 4H5NA 1U2VA 3ATVA 4GY2B 5AQFA 4CZKA 4BC4A 4A2BA 4CBWA 2I7NA 3OHRA 5JLFA 5AQYA 4EFHA 2ASPA 3SMSA 1BO5O 4BRHA 3HBTA 5AQKA 3SLCA 3I8BA 3W3DA 5JMVA 3ZX2A 5BR9A 2P9KB 3WUHA 5AQOA 1K8KA 2GELA 3WQUA 3ZX3A 5BRFA 1J6ZA 1NGAA 4WQ5A 4AM7A 3JS6A 2QWNA 3RSEA 2Q1NA 1XQSC 2FLOA 1NBWA 1JCEA 1GLAG 3WXJA 3MK6A 3SMPA 3M3ZA 2J4RA 5BPLA 5F0XA 1Y64A 4XH1A 3U9DA 3EL2A 1U6ZA 4IJAA 3UKRA 5LJWA 3A5MC 1E4FT 5EOYA 4PKGA 3FGUA 3FZHA 4CZMA 3LM9A 2Q2RA 2Q36A 1MWMA 5AQXA 3DXMB 4MLHA 5EX5A 3CJAA 1BG3A 1QZ5A 2GEMA 3H45C 3WEEB 5F2RA 3HZ6A 3KVGA 5ADXA 1DEJA 4CJ7A 3VGKA 1YUWA 4BRQA 4BG9A 4BRIA 2A41A 3CI5A 4DCHA 1RDWX 3U8XA 4K43A 3R9PA 4I6MB 3QFUA 1NGBA 4BRLA 3VF2A 1T44A 3IDHA 2QXLA 1TYQA 4ISEA 4CZJA 4L3QA 3HM8A 1WOQA 2ASMA 3ULEA 3TU5A 2E20A 1R59O 3AAPA 4IWVA 5FPMA 2E1YA 5B8HA 3I33A 3AARA 1GLDG 5AFUH 1NGHA 5AQTA 2A40A 4Y0WA 1OKJA 2E2OA 2E2PA 1V4SA 4H0VB 3O5BA 1WUAA 2P9UA 1ESVA 2E2NA 2YJEA 2NZTA 1CZAN 4IZ9A 5AQPA 3U9ZA 1H1VA 2YHWA 2QWMA 1ATRA 3AAQA 3A8YA 4B9QA 2P9PA 3BP8A 4M7YA 3FR0A 4CBUA 3CJCA 3S41A 5LY3A 4CZEA 4DQ8A 5AR0A 4CZFA 2YHYA 4FO0A 2HF4A 3GG4A 4BRCA 4CZIA 4M7XA 4DB3A 5E26A 1X3MA 4H0YB 5ELZA 4PL8A 2W40A 3H1QA 1TUYA 5KQ8A 3A0IX 5AZIA 4FWKA 2D0OA 4CD1A 1YAGA 1HKCA 3BUZB 1U2VB 4FWNA 4BR0A 5BRDA 5AQGA 2I7PA 1E4GT 2V52B 3D2EA 3QFPA 3H46O 1G99A 3VESA 5JICA 4RWTA 2P9IA 3FFKB 3FZLA 3AY9A 3O6WA 1K8KB 4BR2A 5AQNA 2DPNA 3GDQA 4PL7A 1NGFA 4CBXA 3RSEB 2VCPA 4BRKA 1D4XA 4NO7A 1TUUA 3KZBA 3M1FA 3KHYA 4K42A 1HJOA 5AQLA 3A5OC 1NGEA 4O5FA 2FF6A 2A42A 1KAXA 2BUPA 4BVOA 3BEXA 3UKRB 1X9JA 4JHDA 3VGMA 4A62A 2V7ZA 2NLXA 3MN5A 2P9LB 3VEVA 4BRNA 1QQNA 2VWBA 3JXUA 3ZEUA 2QWQA 1QHAA 3O8MA 2D1KA 1HPMA 3H3OB 2FSKA 4MO4A 2FSNA 5E84A 3QDKA 1GLEG 2FXUA 2V51B 3CETA 4EIAA 2ASOA 1BU6O 1BOTO 3VF4A 5AZJA 3ID8A 1V4TA 2P9LA 5AQHA 4FOEA 4H0TB 4IO8A 2UYTA 2D4WA 2GTDA 3L6QA 1NLVA 1TYQB 3ZETA 3QBWA 3W0LA 2D0PA 3MDQA 3ULEB 4ISFA 4B1VA 3ATUA 2YCHA 2GWKA 3DXKA 2FF3B 3O1BA 5BPMA 4C23A 1BUPA 4FPBA 4B1XB 3WT0A 2AP1A 2H3GX 4K41A 2P9UB 2AA4A 5AQQA 3B8AX 1RFQA 3D7EO 3GL1A 4HTLA 1GLJO 1Q18A 2QWPA 3CJ7A 2P9PB 4GNIA 2HMPA 4CD3A 1YXQA 3EN9A 3DJCA 1NGCA 4BGBA 2EWSA 2OANA 3WXLA 3L0QA 4Z94A 1GLBG 2IVNA 3LDLA 2A6AA 4H5TA 4BC5A 4B1ZA 2P9SA 3MN7A 3P4IA 3CJ9A 2F9WA 4H03B 2WUSA 5FPNA 2CH6A 2E88A 3O80A 4NB4A 5AZIB 1EQYA 3VEOA 1HKBA 4CZGA 5F1XA 4BC3A 4BRPA 5KPRA 3EKSA 3D2EB 5EXWA 1SAZA 2CH5A 2P9IB 3FZKA 2CGKA 2A3ZA 2GUPA 4MO5A 3CIPA 1BWFO 3UB5A 4BR5A 5AQMA 1MWKA 3MN9A 5BRHA 4H0XB 3D2FA 3SK3A 1NGDA 4YDUC 2GWJA 4H0PA 3LM2A 3O1WA 4B1YB 5BN8A 4RTFD 1T6DA 4IXCA 4QS9A 1Z05A 4FWLA 4MLEA 1IG8A 2Q0UA 3MN6A 1QZ6A 4J8FA 1NMDA 3QBXA 3VEZA 4FWOA 4DHYA 4BRMA 3LDPA 2ZGYA 4JHDB 1QQOA 2A5XA 2CGJA 2HF3A 1LCUA 4H5RA 5AQSA 4IJNA 3BF3A 3M6GA 4FWRA 3GE1A 5I9EB 3ZEUB 5ADXH 4FWMA 5BN9A 1NGIA 2IVOA 4XH5A 3UKUA 2Q0RA 3H3NO 3SJHA 5KPTA 3EZWA 4H5VA 3UE5A 3C0BA
chains in the Genus database with same CATH superfamily
5M1FA 3LPTA 4OKJA 4B9UA 4M3ZA 4JI3K 1JCGA 3VF6A 2O4IA 1ZBSA 3NGYA 4F3TA 1HPZA 1NNEA 3DAWA 3AVCA 1Q9YA 1OVYA 1SZ2A 4BQLA 2PAVA 4AF1A 3CMEN 4J2DA 2Q31A 3FLCO 3F9MA 3ZETB 3RMCA 1SL0A 1CZBA 3NBPA 4NCBA 3VOVA 3ENOA 1NK7A 4ZHRA 3C6TA 4BACA 4C8NA 3MMVA 3MAQA 2NRTA 3C7NA 4FLUA 3TAMA 1TL3A 1SKRA 3VPZA 2UU9K 3WQTA 1Q9XA 3K57A 4DSFA 4C1NI 4CGHA 4AHRA 3LL3A 4XEIA 3TAFA 3MCAB 4KAZA 4LF4K 4BR9A 3O4WA 4ELTA 3SPZA 3AA5X 3IS9A 1XC3A 1KVAA 4RW8A 3CJBA 3VGLA 4CGFA 3DRPA 4CZLA 1HKGA 4FJ9A 1LW2A 1VSMA 4DR7K 1YHQN 2KW4A 3LDNA 3HPOA 3TPQA 1W97L 4FLYA 4AQYK 4CIGA 4BE2A 2O8BA 2ZGZA 2D5RA 1L5UA 1GLCG 3WNEA 4KBOA 4CHZA 4WFNL 4AHTA 1DTQA 2KKZA 4DQIA 4O4GA 4RCHA 4JI2K 1XWLA 4E7LA 5GIOA 4XH4A 3A5LC 5KGWA 2NRHA 1ZBUA 3D6RA 3DWLA 4I6MA 4CCHA 1NGGA 3BF1A 3EO3A 3HSCA 3NF7A 2FSJA 1EWQA 3OA9A 4JD2B 3VEYA 4PKHA 1IKYA 4FWSA 1SL1A 5FROA 4OGEA 1S1XA 3OJSA 2B4JA 5FPEA 4BE1A 3J7ZO 3NMUA 3PX0A 5JS2A 1NGJA 1KVBA 3VQ5A 3SJJA 1HUXA 4HUGA 2E2QA 2P9NB 1MDUB 3KLIA 2E1ZA 3CQYA 4LF8K 4IDHA 3BDPA 3F9KA 1ATSA 3CCQN 2VYPA 3LAMA 4E89A 1JLFA 3UIQA 4B1UB 5KRTA 1L3SA 3ZT1A 2F4VK 2W41A 1U45A 3FZFA 2X74A 1QSLA 4EAHD 5KQDA 3IMXA 3O3GA 1HQEA 2ZJPL 2O8FA 4H5NA 4FZYA 3E9LA 3L2UA 1U2VA 1KD1O 3AVMA 4DKWA 4CZKA 2HBJA 3AVKA 4PUOA 1BO5O 5AQKA 5JMVA 3SAGA 1TK5A 2GELA 3WQUA 3ZX3A 4CJRA 1EETA 4DF8A 1VQ8N 4DR5K 4AM7A 4FK0A 3CF5L 2QWNA 3AVBA 3RSEA 1VSFA 5DM7L 4UY8O 4HHTA 1JCEA 2RKIA 3OYAA 3SMPA 3M3ZA 4DSEA 1BI4B 4JRQA 1VQON 1DT9A 5LMUK 4XH1A 3EL2A 1KC8O 1N8RO 4IJAA 3UKRA 3P5JA 2IOCA 2Q36A 1NK5A 4YOVA 3DXMB 4MLHA 3SZ2A 1X9SA 1BG3A 4IG0A 5M1OA 1EP4A 1F21A 1XMOK 4C8MA 3MX2A 3U3YA 3AVFA 1C6VA 3EE9A 4IDKA 4K43A 3QFUA 4BRLA 3ZT4A 3ZT2A 3J81O 4LF7K 1WSJA 3U3GA 3OJUA 3IDHA 3L8BA 2R7YA 3PO4A 4KTZA 4ISEA 4Z4GA 1K9MO 3TU5A 1R59O 2F96A 4OJRA 1J5OA 3AAPA 4LF9K 3I55N 5B8HA 3TTCA 4IFYA 4CJ4A 3PSFA 3AA2A 5J2PA 4DF4A 2B5JA 2P9UA 1S1TA 2OZSA 3ZSYA 4DU4A 2E2NA 2NZTA 4IZ9A 2G8KA 1H1VA 4KTQA 1ATRA 2OPSA 4EP4A 4NYNA 4CBUA 3S41A 3N4PA 1S9EA 3K2PA 4FJXA 3OYIA 1EKEA 2HF4A 3GG4A 4CZIA 4M7XA 4U67L 3OS2A 1VSHA 4GMJB 5ELZA 2HNYA 4PL8A 4O5BA 1XMQK 4KRFA 4FWKA 1RBSA 3BUZB 4FWNA 4BR0A 5BRDA 3RRGA 5AQGA 2I7PA 1IKVA 4CJTA 5JICA 3OYMA 1TKDA 1IG9A 5GAGP 1FXXA 2VWKA 1TKXA 1XHZA 3GDQA 3QIOA 1WN7A 3THWB 2VCPA 1J5EK 1TUUA 3M1FA 3SQ2A 2YX6A 5TKWA 1NGEA 1NG9A 2FF6A 1JLQA 2A42A 4JHDA 1R0AA 3VGMA 2V7ZA 4HUEA 2NLXA 3OYHA 3V6DA 3MN5A 2P9LB 3AVNA 4BRNA 2YKMA 3OBWA 1C1CA 1ZBFA 1QHAA 1HPMA 4MO4A 2FSKA 2DFHA 3TR8A 4XIUA 3AGRA 3ZSWA 2HHHK 2HMIA 1U48A 3ID8A 4I2QA 3K5OA 2OTLN 2FBYA 4IO8A 2GTDA 4CF0A 3CMAN 3T1YK 3EEQA 5I42A 1REVA 3DLLL 3Q7BA 2YCHA 3CFOA 3SBGA 4YHHK 5IT9O 4GV6A 3LP3A 2FF3B 5CYMA 4ID1A 4B1XB 1XHXA 2AP1A 2H3GX 2YNFA 4K41A 3O9UA 3C94A 1ITGA 1RFQA 2I5JA 2WBNA 3DOKA 4DV1K 1JLBA 2P9PB 3NF6A 3QNOA 2HMPA 4AH9A 4LFCK 4CD3A 2O8EB 2YHBA 3DYAA 1JXBA 2OANA 4K8XA 1J9AA 4CF9A 4LFAK 4Z94A 3QEWA 3E01A 3O9QA 3C6AA 1XI1A 1JLGA 4M3WA 4O55A 1Q86O 4ELVA 3MN7A 3D0PA 2VWJA 5FPNA 4NB4A 1Y97A 1J54A 4W5OA 2EHGA 4CJVA 1RT4A 3NF8A 4IFEA 3OYEA 3RMBA 1VHXA 4CJSA 3LWLA 3S3OA 1O13A 4MO5A 2WONA 3L2VA 1XNQK 3AVLA 2HHTA 3D2FA 3VA3A 1T8EA 4N76A 4H0PA 4N5SA 4OVLA 4ZTJA 1T6DA 2VG5A 2PYJA 3SCXA 1Z05A 4MLEA 1RDCA 2OPPA 1WSIA 4J2AA 4X66K 1NMDA 3QBXA 1VQ4N 4NLCA 3VQ8A 4FWOA 2G8UA 2B6AA 3ISNC 5GAEP 4IJNA 3BF3A 4HTUA 5SZTA 4DLEA 3M6GA 3BZCA 3FFIA 4FWRA 4KTWA 5DMRA 4CECA 1ZBLA 3MWPA 4C8OA 4FWMA 3VQDA 3UKUA 2HBKA 4CVNE 4OPJA 3QLHA 3UE5A 4E3SA 2XY6A 3SUQA 4BG8A 2YI1A 4B3SK 3D45A 1HLUA 4WF9L 4W5NA 4A2AA 3R6MA 3R8EA 3DI6A 3LDOA 4FWPA 3NFAA 1GLFO 5JLHA 3V1QA 4JKHA 4N56A 3U4LA 2YHXA 4Q5VA 5CE3A 3ITHA 3O08A 1LWFA 2PZSA 4BC2A 2XY7A 5BREA 5KRSA 4HCBA 5A2QO 3SUPA 1KXPA 3DLGA 1C0MA 3HYFA 2OPRA 2IIRA 2WFBA 3B6PA 3F2KA 1U4BA 1FK9A 1TK8A 1QQMA 3OYFA 3LP1A 1VQMN 1FJGK 4DWIA 1KTQA 2QWOA 1NJYA 3O4QA 3G6EN 4CK1A 3VENA 4K25A 5AQJA 3PSIA 2YNGA 3OYCA 3CCRN 2O8BB 2HOEA 1IBKK 4WQ4C 3PO5A 1C1AA 1BA0A 2P9KA 2KHOA 4C1NK 4BRGA 1YI2N 3G0ZA 1VQ9N 3T69A 2JGUA 3VQPA 3I56N 1MA9B 3LDQA 4BRFA 4FOIA 5CYQA 3CFRA 4CJ5A 5I3UA 3J7AP 1HX1A 1YT3A 3O4NA 1RDBA 4CIEA 1GLLO 1XUPO 4B1WB 1WSHA 4Z4CA 1NM1A 1L3VA 4FLVA 1YIJN 4LF5K 4CIFA 4F3OA 1RBTA 3L3UA 4JN4A 4KH6A 4F9OA 4BRAA 1QE1A 5FLXO 3SBTA 4FM0A 4LH5A 2Y1JA 1Z6RA 4KHNA 3A5NC 1KAYA 3VEWA 3DM2A 5AQVA 1EX4A 1W2BM 1YTAA 5EU7A 2E5LK 3T1HK 4CEQA 3EKUA 4FM2A 4DTUA 1HMVA 3GBTA 1WBDA 4KREA 3O9SA 4CEAA 2G8FA 4Z0UA 4OLBA 2QWLA 2JWLA 2Q3SA 4DR1K 1RGIA 2YJFA 3G25A 1TV6A 4FJIA 3OTOK 3ZT0A 2X6SA 1EXQA 2XHBA 1JL2A 1P90A 5C24A 4B3TK 4DTPA 4FJ5A 3T3FA 4FPAA 3HRGA 4H0OA 4BQZA 4KB0A 3RMAA 4B9NA 3I0RA 5M1KA 5FRMA 3TAPA 2BH1A 4U7BA 3HP9A 1SV5A 4DTOA 2VG6A 1S1UA 3DLEA 4CFBA 5E41A 4M3XA 1E3MA 3ZT3A 4CJLA 1IBMK 3PY8A 1NWKA 1X9WA 3AO1A 4CGDA 1IO2A 3KKRA 2IGIA 5AQFA 4A2BA 1WLJA 5JLFA 4EZ6A 5J2MA 3EYZA 3ZSOA 4JKCA 3SMSA 4IG3A 4WFAL 4FJ8A 3SLCA 3CYMA 3W3DA 4H8KA 4N47A 4HVJA 3ZX2A 5BR9A 1QSYA 3WUHA 2ZJRL 2KFZA 5BRFA 1NGAA 4JK9A 2Q1NA 3AO3A 2FLOA 3WXJA 5GAHP 3MK6A 3S3NA 1BCOA 4ZTFA 3ZSQA 1Y64A 4JI5K 3ZSZA 4NXMK 3OY9A 5EOYA 4PKGA 2Q2RA 4IKFA 3EY1A 3LDSA 1WAFA 2UXBK 2WC9A 1QZ5A 3WEEB 3KVGA 1DEJA 3RRHA 4CESA 1YUWA 4AHSA 4FZXC 5HROA 2O8DB 3ZSXA 5HOOA 4DCHA 3OYNA 4KI6A 4JI8K 4OPKA 1UOCA 3ID6A 3WNGA 3KWIA 3M8PA 4BDYA 1NGBA 5C10A 4BWJA 3K59A 1T44A 1D9FA 4CZJA 4FJJA 1QQCA 3SAHA 3E9OA 4G1QA 3HM8A 2ASMA 3KK1A 2W6KA 4DV5K 4EP5A 3HOSA 3KJVA 4I2PA 1GLDG 1N33K 1QTMA 5AFUH 2A40A 4Y0WA 4FVUA 1OKJA 4FLXA 4H0VB 1WUAA 1JL1A 4KHUA 2LSNA 3VQ7A 3HT3A 4GVEA 3AVGA 3T7ZA 2P51A 4B9QA 1LW0A 3OS1A 3DLBA 1ZBHA 4M7YA 3IAYA 4YNQA 2ZE2A 3C95A 4E0DA 1RT1A 1UA0A 2D0BA 1NOYA 5HRSA 4GKKK 5CHIA 4JEPA 5E26A 3VA0A 1S72N 3KK3A 3VQAA 3SQ4A 2DFEA 3H1QA 1NJWA 2NRRA 4W5TA 3A0IX 5AZIA 5GADP 3O3HA 3E9PA 2V52B 3D2EA 2VQEK 1S1VA 1DLOA 2QK9A 3K0SA 2RPIA 3SAFA 1K8KB 4BR2A 2NUBA 3SI6A 4JKGA 5C0YA 4PL7A 2JWKA 1NGFA 4DTMA 4JI6K 4M3YA 3B6OA 3WNHA 4K42A 5AQLA 3A5OC 1ASUA 1QVGM 2QA4N 2KQ2A 3ALYA 4KFBA 4BVOA 4E19A 2Z1JA 4TSXA 4A62A 2G8WA 3M8SA 4F8RA 1XC9A 2YNIA 3DLKA 1TVRA 1QQNA 1VSIA 3KD5E 3TSPA 5HL7L 3H3OB 2FSNA 1T05A 3VQ9A 1RTJA 3OYGA 1GLEG 2FXUA 2KZMA 3ZCMA 1HNXK 2YNHA 1TL1A 3BZKA 3KK7A 5D3GA 3OYDA 2NRZA 4IOXA 4BE0A 4B3RK 4DTRA 4FLZA 2OTJN 3SYZA 4KH5A 4OKEA 4A57A 3CC4N 1TYQB 1WBBA 1RT2A 3ZETA 2UXCK 4DR2K 3ULEB 1D5AA 2HHUA 3HVTA 5KGXA 2W42A 1RDUA 1S9GA 3O1BA 3VMFB 5BPMA 4C23A 1NK8A 1BUPA 4DV4K 3PX6A 3TTDA 3M5RA 3OW2M 2AA4A 1JJ2M 2F7TA 4M45A 4IEEA 3F73A 3D7EO 3GL1A 2ZJQL 4DQQA 2QEXN 3TTFA 4CJUA 1HNWK 3F5TA 4HTLA 3CCLN 4FVMA 4WE1A 2DY4A 1G15A 4GNIA 2QI2A 3SUOA 4B3MK 4IOAL 3KD1E 1RT6A 4KHWA 1BQMA 1Z26A 3WXMB 1XNRK 1Q81O 4BGBA 3MX5A 3THXB 3TANA 3WXLA 4ID5A 2A1RA 3NH0A 3LDLA 4CK2A 3V4IA 1RTIA 4BC5A 3P4IA 4DTSA 2F9WA 2WUSA 2CH6A 3T1AA 1SS6A 3VEOA 1HKBA 3O9RA 1JKHA 5F1XA 3PV8A 3RMDA 3EKSA 5EXWA 1SAZA 2P1JA 2CH5A 2P9IB 4CGGA 2A3ZA 4N41A 5GIPA 2A1SA 5C2DA 4V19S 5BRHA 3SK3A 3L3VA 4YDUC 3LM2A 5BN8A 4RTFD 1VQNN 3PIPL 3U6FA 3K5NA 5JVHL 1EWRA 2AJQA 4FWLA 3T19A 2Q0UA 4J8FA 1QZ6A 3VEZA 3E66A 1BHLA 3AO4A 1HJRA 4BRMA 3LDPA 1QQOA 5AQSA 3NGIA 4DQRA 4CJKA 5J2QA 5C12A 3ZEUB 3PX4A 4XH5A 1M90O 1LAVA 4H5VA 3JAMO 1C0UA 4M3TA 3VERA 4KH4A 5AZJB 1BA1A 2P5GA 2RF2A 1LOTB 1VQ5N 4CZHA 2P9NA 4OX9K 3WXKA 2F8SA 2E8AA 4CJ3A 2D0CA 5C15A 4DMNA 3VQ6A 5SWMA 4YOYA 5BPNA 4R5PA 5AQWA 5M1QA 1S5JA 2DFFA 3L4QA 1KLNA 4JKDA 3NVMA 4BR7A 3CCJN 3DXKB 3MXMA 4FJNA 3BGRA 4OO1J 1ZC6A 3ZSRA 1VSKA 4FJ7A 3DRRA 1DKGD 4ICLA 3NF9A 1C0TA 1T3VA 4BRDA 1M1KO 2OZMA 4KHSA 5JS1A 5AQIA 1VK0A 5MLCQ 4BY9C 1FKPA 4QS7A 3K5LA 4ILHA 2G8IA 2HVHA 4O8KA 1A5XA 4EHUA 1JCFA 2XO7A 2O8CB 4QCLA 3KTQA 1HNZK 4Z4FA 4M63C 3QICA 2QW9A 4KPYA 1S1WA 3MXJA 3IFRA 3G71N 4DTNA 5KPZA 3ASMA 1OH7A 5CR4A 5AQZA 3DOLA 2P9SB 1BI4A 4CEDA 4WFBL 1BCMA 4FCYA 3KWGA 1TGOA 1DTTA 1KLMA 4FL9A 5AQRA 3IUCA 4JAXA 3JYTA 1SUQA 3HI0A 4H5WA 1B9DA 3KK2A 2V7YA 4DV3K 3DXMA 3AVIA 4HWIA 1P8ZA 4B9LA 4C8KA 4BWMA 1LV5A 1IKXA 3ENBA 4OPHA 1WAJA 1ZXOA 1RILA 3ENHA 1VSJA 4DLGA 1RBUA 1N6QA 4E1JA 2CGLA 1CXUA 3AA4A 2XY8A 3QINA 1NK6A 4RW9A 5IWAK 3AV9A 4IEIA 5FPDA 4FLWA 3J7YP 1JLEA 1T6CA 3FZMA 4WQ5C 5GINA 4Z4EA 3P83D 3OBYA 1SQKA 1YITN 3HSTB 5HRNA 4FM1A 4BROA 4WQ4A 3THYB 3AO2A 4B08A 1L3UA 1W9HA 4L8RB 3AVHA 3QMLA 5CZ2A 2IAJA 4QOZB 4LC9B 3K58A 2WTUA 4C8LA 5J1EA 3KLEA 2QWRA 4CHOA 1DGKN 4JNEA 4ISGA 3WNFA 3V9SA 4FSVA 2UUAK 1BIZA 1C0GA 5HRPA 4BREA 3TAQA 1KAZA 3CHWA 2PY5A 4WCEL 3C7NB 4JK8A 3O3FA 1X9MA 3KKSA 3L4IA 2QM1A 3HJFA 2ZWHA 3AGKA 1LAWA 2Z1IA 1NKCA 5DM6L 3OVNA 4JKBA 4GY2B 2Y1IA 2UUCK 1OVQA 4DV0K 2I7NA 2O4GA 3OHRA 4FZZA 4PY5A 5AQYA 4EFHA 1ZYQA 2ASPA 4G9ZA 3HBTA 3I8BA 1T03A 4HUFA 1HQUA 2HB5A 4GV3A 1XQSC 4YOWA 1NBWA 2RE2A 1YVUA 1RDDA 4DV7K 3QNNA 1U6ZA 5J2NA 1BGXT 5LJWA 1UA1A 1ASWA 1E4FT 2ETJA 3FGUA 3FZHA 4I7FA 4CJPA 1MWMA 3QEIA 3S3MA 3AA3A 4IO9L 1RTDA 4YOTA 5EX5A 3CJAA 1S6QA 3H45C 3AVAA 5F2RA 1HNIA 4KB1A 1MU2A 3SQ1A 3MWTA 3VGKA 3LAKA 2F8TA 4CFCA 4BG9A 4CHYA 4AHVA 3CI5A 2D0AA 1D9DA 2WOMA 1RDWX 4Z4IA 3QESA 4I6MB 2E6LA 4F2SA 4CEBA 1X1PA 4CW7B 1YTUA 4L3QA 4FW2A 1RBVA 4B9SA 1WOQA 1CXQA 3CC7N 4IBNA 4DSKA 1CZ9A 3NVKA 4IWVA 4CEEA 3SV3A 2E1YA 3ZLJA 1RBRA 2PFUA 3I33A 3ZSVA 4NLBA 3THVA 2E2OA 2E2PA 4LD0A 4O44A 4CF2A 3O5BA 3P1GA 4DR4K 1WSEA 1NKEA 5AQPA 1ILYA 2YHWA 2QWMA 1IH7A 3A8YA 4JI7K 2HBMA 4GVMA 4NXNK 2P9PA 1BL3A 1A5WA 3BP8A 4CFDA 3FR0A 5LY3A 2O8EA 4CZEA 2VGMA 1TK0A 3AO5A 4CZFA 1NMNA 4FO0A 2FBTA 3V9WA 5AJ3K 4DB3A 3QO9A 1X3MA 2X78A 3DLHA 4H0YB 4OGCA 4E7HA 3CCMN 4JV5K 1VQLN 2W40A 4X65K 1UAXA 3IKMA 1TUYA 5KQ8A 4CF1A 2O8FB 3VQBA 2D0OA 3NCIA 4CGIA 1JLCA 1VSDA 1HKCA 4KV8A 1U2VB 1RDAA 3KIOA 1EO1A 3QFPA 2KTQA 2VG7A 3H46O 1G99A 3VESA 4A5BA 1HYVA 4E7KA 4RWTA 3AY9A 3LP2A 1VQKN 3O6WA 5C42A 5AQNA 4E1NA 3RSEB 4YFUA 4BRKA 4NO7A 3RVCA 1JLAA 3TABA 2OYQA 1HJOA 1T7PA 1BIUA 3CG7A 3BEXA 3UKRB 1KFSA 3P31A 5FRNA 3MEEA 3VEVA 1YJWN 1W7AA 2HNZA 3QEPA 1FKOA 3JXUA 3TARA 1Z25A 3OYJA 5FDLA 3O8MA 2D1KA 5E84A 3M8QA 4JKAA 3QDKA 1K8AO 2V51B 4EIAA 1OH6A 1BU6O 3LWMA 1BOTO 3L2WA 3LZJA 3HVRA 5M1NA 4E7IA 1V4TA 4CERA 3KLGA 3M8RA 3L2QA 3TI0A 4H0TB 3NHGA 2UYTA 1JXEA 4YOUA 1NLVA 2GUIA 5BR8K 1NU0A 3TAGA 4B1VA 1K73O 3ATUA 4JKEA 1RT7A 4A5AA 3RTVA 4FPBA 1IV0A 2P9UB 3SPYA 5HLFA 1GOAA 1GLJO 1Q18A 3NH2A 4BDZA 4I9LA 1YXQA 3EN9A 4DTJA 1NGCA 2EWSA 3R3LA 3L0QA 1QVFM 4YY3K 4KO0A 3ZYYX 1GLBG 2IVNA 5C25A 2BANA 2KZZA 4E1MA 3CPEA 3RR8A 4K8ZA 4H03B 3O80A 2E88A 2UUBK 1EQYA 4X64K 1NJIO 4NYFA 3LPUA 2HHXA 4CGJA 3Q7CA 4CJQA 2HBLA 4HCCA 4UQGA 2CGKA 2GUPA 2UXDK 3CIPA 2FBXA 1ZBIA 1BWFO 4BR5A 5AQMA 1MWKA 3MN9A 4H0XB 4I9QA 1NGDA 2GWJA 4DG1A 4QAGA 4LSNA 1TKTA 1ASVA 4H4MA 2ITGA 3J80O 4B9VA 1NK0A 1A5VA 4JI4K 4MDBA 4W5RA 1N34K 4NCGA 3C65A 2E6MA 4JHDB 2ZGYA 2CGJA 2A5XA 2HF3A 2YHAA 1LCUA 4H5RA 3TSQA 1Q82O 3CQ8A 4KHQA 4B3OA 2IC3A 3V9XA 1HYZA 1RCHA 2GX9A 5ADXH 5BN9A 2ZM6K 1NGIA 2IVOA 4B8AB 2Q0RA 1RT3A 3H3NO 3SJHA 5KPTA 1I94K 4CF8A 4O0JA 4DFJA 4JI0K 2HHSA 5EY4A 4LF6K 3H08A 3K5MA 3V1RA 2NRVA 1S22A 4R79A 2HHWA 1YF5L 1NJXA 3CJ1A 4BR4A 2FC0A 4CI6A 4M3UA 1YVNA 4OLAA 4CJFA 1VAZA 3OYLA 2HSTA 3G10A 4A61A 3QERA 3VEXA 4FJHA 1VSLA 2OCEA 2RHKA 1BDGA 4WYBA 3VQ4A 1U49A 2IDOA 1X3NA 2ZF5O 3LP0A 3NGZA 1NK4A 1VRUA 2E4LA 4CHQA 1C1BA 2HNDA 4YDUA 3SNNA 3DLRA 2BDPA 1L3TA 5AQUA 2IVPA 3CERA 1J53A 5C2FA 2BE2A 1TAQA 1HNVA 1TKZA 3O9TA 3CC2N 2KLAA 1ATNA 2NRXA 3WXIA 3H6EA 4Y1CA 4KHYA 4OPAA 1OH5A 3MEDA 2QTDA 4W5QA 4EZ9A 3J8AA 2P5OA 2W6LA 3C6HA 3OS0A 3QEXA 1WNSA 4AM6A 3DRSA 4OKKA 1C0FA 4BVPA 3TSUA 4E7JA 5LMNK 1WB9A 3RWUA 4M41A 5TKYA 3FE1A 1N36K 3WEEA 3VETA 4B9TA 4Z4HA 3D2FB 1VRTA 2F9TA 4LFBK 2O8DA 4CHNA 4QS8A 4AHCA 4EHTA 4DU1A 3P38A 4MQ3A 1S3XA 4JKFA 4KKOA 3CQXA 1IJJA 3P39A 1IBLK 4M42A 4FWQA 3MEGA 3GOIA 4AHUA 4J2EA 4FJMA 2QKBA 1N32K 3TAEA 4DSLA 3UKUB 3OYBA 1SKWA 3QB0A 4MFBA 5EVZA 1NKBA 4LY7A 4JLHA 2PBDA 4ILGB 2GV9A 4CJWA 1I39A 3KLFA 4JD2A 2X6NA 3HTVA 2BTFA 4DR3K 2RN2A 3MCPA 2XRIA 3ZX0A 3I0SA 2Q97A 2VGNA 5AFUA 1NK9A 3VQQA 2JLEA 3H1VX 4BGAA 4PKIA 2FBVA 1KSPA 4DQPA 4CFAA 5LJVA 4JI1K 2DTUA 5LL6Z 4CK3A 4FJLA 4MDAA 4RW6A 1HR0K 2ITMA 3JSMA 1IKWA 3ATVA 4ILJA 4GKJK 1O1WA 4BC4A 4CBWA 3DMJA 3PIOL 4PHTX 1VSEA 3HO1A 4KI4A 1HYSA 4JRPA 4BRHA 4DFMA 2VQFK 3IRXA 2P9KB 3R1XA 5AQOA 1K8KA 1RT5A 1J6ZA 2IS3A 3AVJA 4WQ5A 3JS6A 3CCVN 4DUZK 2ZQBA 3V9UA 1SL2A 4FYDA 3HXMA 3EZ5A 4X62K 1GLAG 1KVCA 2J4RA 1Q7YO 4BDPA 5BPLA 5F0XA 3BY5A 3U9DA 2GBZA 4DTXA 3NH1A 3A5MC 4JS4A 4CZMA 3LM9A 3C6UA 4LH4A 5AQXA 4RW4A 5T7BA 5DK5A 2GEMA 3HZ6A 5ADXA 4CJ7A 1LWCA 4KHPK 4BRQA 4BRIA 4FLTA 2A41A 2NNWA 3HM9A 1TAUA 3PUFA 5KTQA 3U8XA 3R9PA 3KLHA 5HP1A 3VF2A 3QIPA 2KFNA 4DS5A 4CE9A 2QXLA 3VTHA 1TYQA 3N4QA 1VQ6N 2G8HA 3ULEA 2E20A 3L2RA 5FPMA 4FXDA 3AARA 4CHPA 1NGHA 4PWDA 2HVIA 5AQTA 1BQNA 1OH8A 1V4SA 3CM5A 1ESVA 1QHTA 2YJEA 1CZAN 3U9ZA 3AAQA 4PA1A 3CCUN 4FW1A 4DFKA 4GV9A 1HRHA 3CJCA 3TWHA 3I8DA 4DSIA 1Q8IA 4DQ8A 5JVGL 4Y1DA 5AR0A 3THXA 2BGGA 2YHYA 4GW6A 1YJ9N 4RW7A 4BRCA 1I3AA 3CCSN 4YOXA 3G4SN 3QEVA 2G8VA 4CEFA 4CD1A 1YAGA 2YV0X 1SKSA 1E4GT 4CEOA 3SV4A 4K0KK 2P9IA 3FFKB 5KI6A 4DV6K 3V9ZA 1B92A 3FZLA 1B9FA 3VTIA 3K9KA 3LZIA 2DPNA 1NJZA 1GOBA 4CBXA 1D4XA 4H4OA 4DS4A 3KZBA 5K14A 3KHYA 4FK4A 4JYAK 4FJKA 4O5FA 1FW6A 3HPGA 1KAXA 1W0HA 2BUPA 3CCEN 1X9JA 2EX3A 3LANA 4F4KA 1UWBA 3CPWM 1U47A 1N5YA 3HK2A 2PYLA 3THWA 1QSSA 2VWBA 3ZEUA 2NRWA 4LSLA 4B9MA 2QWQA 2HHVA 3K9JA 1U04A 3LALA 5H1SQ 5M1PA 3CETA 3V1OA 2ASOA 3VF4A 5AZJA 1LWEA 3CFPA 3NDKA 3VN5A 3V81A 2P9LA 3A2FA 5AQHA 4FOEA 4DFPA 2Z1GA 2HW3A 3RR7A 2D4WA 3L6QA 4JK7A 4AILC 3QBWA 3W0LA 2D0PA 3MDQA 3CXCM 4A59A 4ISFA 2QXFA 2GWKA 3DXKA 1KQSM 1WSFA 4RG8A 4Q0BA 3WT0A 1KFDA 1GOCA 3NE6A 3S9HA 3MXIA 3SQ0A 3CM6A 5AQQA 4FJGA 2OPQA 3B8AX 3QETA 3EE8A 4CJEA 4DR6K 2QWPA 3CJ7A 3HP6A 3SUNA 4PQUA 1QS4A 2O8CA 4F2RA 3HOTA 4NCAA 3DJCA 2YKNA 3OYKA 4J2BA 4YORA 3NAEA 1VQPN 4ELUA 4FK2A 2A6AA 4H5TA 1VQ7N 4B1ZA 2P9SA 5HRRA 3VQCA 4O0IA 5CY4A 3CJ9A 1KRPA 4IFVA 5AZIB 2HHQA 1RTHA 4DSJA 4CZGA 4BC3A 4BRPA 5KPRA 4B8CA 1KCFA 2ATQA 3D2EB 4DQSA 4M3RA 2OA8A 2XY5A 2QKKA 4DV2K 3FZKA 3CD6N 1RNHA 2Z1HA 3UB5A 3VQEA 1BISA 5HBMA 4IOCL 3HL8A 4JKGB 4DUYK 3O1WA 4B1YB 1CLQA 4IXCA 4QS9A 4O8UA 4JS5A 1IG8A 3MN6A 3E1YA 1NOZA 4DHYA 1S6PA 1K6YA 1WSGA 4CEZA 3MECA 3GE1A 1YJNN 3PLAA 5I9EB 5CZ1A 3ULDA 2ZD1A 4DU3A 3IG1A 3THYA 3HPHA 1D8YA 3EZWA 3C0BA
chains in the Genus database with same CATH topology
4BG8A 5M1FA 5EY4A 2YI1A 3VERA 1HLUA 4KH4A 1BA1A 5AZJB 3R6MA 3R8EA 4A2AA 4WF9L 1LOTB 2NRVA 1S22A 4R79A 1JCGA 3LDOA 1VQ5N 1YF5L 4FWPA 3VF6A 2P9NA 4CZHA 1ZBSA 1GLFO 3CJ1A 3WXKA 5JLHA 3DAWA 4BR4A 1OVYA 4JKHA 3U4LA 1SZ2A 2E8AA 4CI6A 4BQLA 1YVNA 2YHXA 2PAVA 4AF1A 5C15A 1VAZA 5CE3A 4YOYA 3O08A 3CMEN 5BPNA 2HSTA 5AQWA 2Q31A 3FLCO 3F9MA 5M1QA 3ZETB 4BC2A 4A61A 3VEXA 3VOVA 5BREA 3L4QA 2RHKA 4JKDA 1BDGA 3ENOA 3NVMA 4WYBA 1KXPA 4BR7A 3CCJN 1X3NA 3DXKB 2ZF5O 3MMVA 2NRTA 3C7NA 4OO1J 1ZC6A 1DKGD 1M1KO 1T3VA 4BRDA 2IIRA 2WFBA 3VPZA 3WQTA 3F2KA 5AQIA 1QQMA 5MLCQ 4YDUA 4BY9C 1VQMN 2QWOA 4QS7A 4ILHA 5AQUA 4C1NI 3G6EN 3LL3A 2IVPA 4XEIA 3CERA 3VENA 3MCAB 4K25A 4O8KA 5AQJA 5C2FA 4BR9A 4EHUA 3O4WA 3CCRN 1JCFA 2HOEA 4WQ4C 1BA0A 3O9TA 1XC3A 2P9KA 2KHOA 3CC2N 4C1NK 4M63C 3QICA 2QW9A 2KLAA 4BRGA 1YI2N 1ATNA 2NRXA 3WXIA 3IFRA 3H6EA 3G71N 5KPZA 3CJBA 3VGLA 1VQ9N 5CR4A 3T69A 5AQZA 4CZLA 4OPAA 1HKGA 2P9SB 1YHQN 3LDNA 3I56N 2QTDA 3TPQA 3J8AA 1W97L 1MA9B 3LDQA 4BRFA 4WFBL 3KWGA 2ZGZA 4FOIA 4FL9A 3C6HA 5AQRA 1GLCG 3IUCA 4AM6A 4JAXA 1HX1A 4KBOA 1C0FA 3HI0A 4BVPA 4WFNL 1GLLO 4H5WA 3TSUA 2KKZA 1XUPO 2V7YA 4B1WB 3DXMA 4HWIA 1P8ZA 3FE1A 1NM1A 5TKYA 1YIJN 3WEEA 3ENBA 4OPHA 3VETA 4RCHA 1ZXOA 3D2FB 5GIOA 4JN4A 4KH6A 4F9OA 2F9TA 4XH4A 4BRAA 3A5LC 3ENHA 2NRHA 3SBTA 4QS8A 3D6RA 3DWLA 1Z6RA 4I6MA 4E1JA 3A5NC 2CGLA 4EHTA 3P38A 1NGGA 1KAYA 3BF1A 3VEWA 1S3XA 3EO3A 3HSCA 5AQVA 4JKFA 1W2BM 2FSJA 3CQXA 1IJJA 4IEIA 5FPDA 3P39A 3EKUA 3OA9A 1T6CA 3FZMA 4JD2B 4WQ5C 3VEYA 5GINA 4FWQA 4PKHA 3GOIA 3GBTA 3O9SA 4FWSA 3OBYA 1SQKA 1YITN 3UKUB 4BROA 2QWLA 4WQ4A 2JWLA 3QB0A 5EVZA 1RGIA 5FPEA 2YJFA 3J7ZO 3G25A 3NMUA 2PBDA 4ILGB 3QMLA 1NGJA 1P90A 4LC9B 1HUXA 2E2QA 2P9NB 1MDUB 4JD2A 4FPAA 2E1ZA 3HRGA 4H0OA 3CQYA 4BQZA 2QWRA 4IDHA 3HTVA 2BTFA 5M1KA 1DGKN 1ATSA 3CCQN 4JNEA 2VYPA 3MCPA 4ISGA 2BH1A 4U7BA 3ZX0A 5AFUA 2Q97A 2VGNA 4FSVA 4B1UB 3H1VX 4BGAA 4PKIA 1C0GA 4BREA 5LJVA 2W41A 1KAZA 3CHWA 4WCEL 3C7NB 4JK8A 3FZFA 1NWKA 3L4IA 2QM1A 4EAHD 4MDAA 2ZWHA 5KQDA 3IMXA 2ITMA 3AGKA 2ZJPL 4H5NA 5DM6L 3E9LA 4JKBA 1U2VA 3ATVA 4GY2B 1KD1O 4ILJA 4DKWA 5AQFA 4CZKA 4BC4A 4A2BA 4CBWA 3PIOL 4PHTX 2I7NA 3OHRA 2HBJA 5JLFA 5AQYA 4EFHA 2ASPA 4JKCA 3SMSA 1BO5O 4BRHA 3HBTA 5AQKA 4WFAL 4G9ZA 3SLCA 3I8BA 3W3DA 5JMVA 3SAGA 3ZX2A 5BR9A 2P9KB 3WUHA 3R1XA 5AQOA 1K8KA 2GELA 3WQUA 3ZX3A 5BRFA 2ZJRL 1J6ZA 1VQ8N 1NGAA 4WQ5A 4AM7A 3CF5L 3JS6A 3CCVN 2QWNA 3RSEA 4GV3A 4JK9A 5DM7L 4UY8O 2Q1NA 1XQSC 2FLOA 4YOWA 1NBWA 1JCEA 1GLAG 3WXJA 5GAHP 3MK6A 3SMPA 3M3ZA 2RE2A 2J4RA 1Q7YO 5BPLA 1VQON 5F0XA 1DT9A 1Y64A 4XH1A 3U9DA 3EL2A 1KC8O 1U6ZA 1N8RO 4IJAA 3UKRA 5LJWA 3A5MC 1E4FT 5EOYA 4PKGA 3FGUA 3FZHA 4CZMA 3LM9A 2Q2RA 2Q36A 1MWMA 5AQXA 4IO9L 4YOTA 4YOVA 3DXMB 4MLHA 5EX5A 3CJAA 2WC9A 1BG3A 1QZ5A 2GEMA 3H45C 3WEEB 5M1OA 5F2RA 3HZ6A 3KVGA 5ADXA 1DEJA 4CJ7A 3MWTA 3VGKA 1YUWA 4BRQA 4BG9A 4BRIA 2A41A 3MX2A 2NNWA 3CI5A 5HOOA 4DCHA 1RDWX 3EE9A 4K43A 3R9PA 3U8XA 3ID6A 4I6MB 3KWIA 3QFUA 1NGBA 5C10A 4BRLA 3VF2A 1T44A 3IDHA 2QXLA 3VTHA 1TYQA 4ISEA 4CZJA 1K9MO 4L3QA 3SAHA 3E9OA 3N4QA 1VQ6N 3HM8A 1WOQA 2ASMA 3ULEA 3TU5A 2E20A 3CC7N 1R59O 3NVKA 3AAPA 4IWVA 3HOSA 5FPMA 3I55N 2E1YA 5B8HA 2PFUA 3I33A 3AARA 3TTCA 1GLDG 5AFUH 4NLBA 1NGHA 5AQTA 2A40A 4Y0WA 4FVUA 1OKJA 2E2OA 2E2PA 1V4SA 4H0VB 3O5BA 1WUAA 2P9UA 1ESVA 2E2NA 2YJEA 2NZTA 1CZAN 4IZ9A 5AQPA 3U9ZA 1H1VA 4GVEA 1ILYA 2YHWA 2QWMA 1ATRA 3AAQA 3A8YA 3T7ZA 2HBMA 3CCUN 4B9QA 2P9PA 3BP8A 4M7YA 3FR0A 4GV9A 4CBUA 3CJCA 3S41A 5LY3A 4CZEA 2VGMA 3N4PA 4DQ8A 5JVGL 5AR0A 4CZFA 2YHYA 4FO0A 5CHIA 4JEPA 1YJ9N 2HF4A 3GG4A 4BRCA 4CZIA 4M7XA 4DB3A 5E26A 4U67L 1X3MA 3CCSN 4YOXA 3G4SN 4H0YB 1S72N 5ELZA 3CCMN 4PL8A 1VQLN 2W40A 3IKMA 3H1QA 1TUYA 5KQ8A 2NRRA 3A0IX 5AZIA 4FWKA 2D0OA 4CD1A 5GADP 1YAGA 1HKCA 3BUZB 1U2VB 4FWNA 4BR0A 5BRDA 3E9PA 5AQGA 1EO1A 2I7PA 1E4GT 2V52B 3D2EA 3QFPA 3H46O 1G99A 3VESA 4A5BA 5JICA 4RWTA 2P9IA 3FFKB 3FZLA 3AY9A 1VQKN 3VTIA 3O6WA 3K9KA 3SAFA 1K8KB 4BR2A 5GAGP 5AQNA 4JKGA 2DPNA 5C0YA 3GDQA 2JWKA 4PL7A 1NGFA 4CBXA 3RSEB 2VCPA 4BRKA 1D4XA 4NO7A 1TUUA 3RVCA 3KZBA 3M1FA 3KHYA 2YX6A 5TKWA 4K42A 1HJOA 5AQLA 3A5OC 1NGEA 4O5FA 1QVGM 2FF6A 2QA4N 2A42A 1KAXA 2BUPA 4BVOA 3CCEN 3BEXA 3UKRB 1X9JA 4JHDA 3VGMA 4A62A 3P31A 2V7ZA 2NLXA 3MN5A 2P9LB 3CPWM 3VEVA 4BRNA 1YJWN 3OBWA 1QQNA 2VWBA 3JXUA 2NRWA 3ZEUA 2QWQA 1QHAA 3TSPA 3O8MA 2D1KA 1HPMA 3K9JA 3H3OB 2FSKA 4MO4A 2FSNA 5HL7L 5H1SQ 5E84A 5M1PA 4JKAA 3QDKA 1GLEG 2FXUA 2V51B 3AGRA 3CETA 2ASOA 4EIAA 1K8AO 1BU6O 1BOTO 3VF4A 5AZJA 3KK7A 5M1NA 3ID8A 1V4TA 2NRZA 2P9LA 5AQHA 4FOEA 4IOXA 2OTLN 2OTJN 4H0TB 4IO8A 4KH5A 2UYTA 2D4WA 2GTDA 3L6QA 4JK7A 4A57A 4YOUA 1NLVA 1TYQB 3CC4N 3ZETA 3QBWA 3W0LA 2D0PA 3CMAN 3MDQA 3CXCM 3ULEB 4A59A 4ISFA 3DLLL 3Q7BA 4B1VA 1K73O 3ATUA 2YCHA 3SBGA 4GV6A 4JKEA 2GWKA 3DXKA 1RDUA 2FF3B 1KQSM 3O1BA 3VMFB 4A5AA 5BPMA 4C23A 1BUPA 4FPBA 4B1XB 3WT0A 2AP1A 3TTDA 3M5RA 2H3GX 4K41A 3OW2M 2P9UB 2AA4A 5AQQA 3O9UA 2F7TA 1JJ2M 4IEEA 3B8AX 1RFQA 2WBNA 3EE8A 3D7EO 3GL1A 2ZJQL 2QEXN 3TTFA 3F5TA 4HTLA 3CCLN 1GLJO 1Q18A 2QWPA 3CJ7A 2P9PB 4GNIA 2QI2A 2HMPA 4IOAL 4CD3A 3HOTA 1YXQA 3WXMB 3EN9A 1Q81O 3DJCA 1NGCA 3MX5A 4BGBA 2EWSA 3R3LA 2OANA 4YORA 3WXLA 3L0QA 1QVFM 1VQPN 4Z94A 3ZYYX 1GLBG 2IVNA 3O9QA 3LDLA 2A6AA 3C6AA 4H5TA 4BC5A 1VQ7N 4B1ZA 2P9SA 1Q86O 3MN7A 3P4IA 3CPEA 3CJ9A 2F9WA 4H03B 2WUSA 5FPNA 2CH6A 2E88A 3O80A 4NB4A 5AZIB 1EQYA 1SS6A 3VEOA 1HKBA 3O9RA 4CZGA 4IFEA 5F1XA 4BC3A 4BRPA 5KPRA 1NJIO 3EKSA 3D2EB 3Q7CA 5EXWA 1SAZA 2HBLA 2CH5A 1O13A 2P9IB 3FZKA 3CD6N 2CGKA 2A3ZA 2GUPA 4MO5A 3CIPA 1BWFO 3UB5A 4BR5A 5GIPA 5AQMA 1MWKA 5C2DA 3MN9A 4IOCL 5BRHA 4H0XB 3D2FA 4JKGB 1NGDA 3SK3A 4YDUC 2GWJA 4H0PA 3LM2A 3O1WA 4B1YB 5BN8A 4RTFD 1T6DA 4IXCA 3PIPL 1VQNN 4QS9A 4O8UA 5JVHL 1Z05A 4FWLA 4MLEA 1IG8A 2Q0UA 3MN6A 1QZ6A 4J8FA 1NMDA 3E1YA 4MDBA 3QBXA 1VQ4N 3VEZA 3E66A 4NLCA 4FWOA 3C65A 4DHYA 4BRMA 3LDPA 2ZGYA 4JHDB 1QQOA 2A5XA 2CGJA 2HF3A 1LCUA 4H5RA 5AQSA 3TSQA 5GAEP 1Q82O 4IJNA 3BF3A 3M6GA 4FWRA 3GE1A 1YJNN 3MWPA 2GX9A 5I9EB 5C12A 3ZEUB 5ADXH 3PLAA 4FWMA 5BN9A 1NGIA 2IVOA 4XH5A 3UKUA 2Q0RA 3H3NO 2HBKA 3SJHA 5KPTA 1M90O 3EZWA 4H5VA 3UE5A 3C0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BG8 A;  5EY4 A;  2YI1 A;  3VER A;  1HLU A;  5AZJ B;  1BA1 A;  4A2A A;  3R6M A;  3R8E A;  1LOT B;  1S22 A;  1JCG A;  3LDO A;  3VF6 A;  4FWP A;  4CZH A;  2P9N A;  1ZBS A;  1GLF O;  3CJ1 A;  3WXK A;  5JLH A;  3DAW A;  4BR4 A;  3U4L A;  1SZ2 A;  2E8A A;  4CI6 A;  4BQL A;  1YVN A;  2YHX A;  2PAV A;  5CE3 A;  3O08 A;  5BPN A;  5AQW A;  2Q31 A;  3FLC O;  3F9M A;  3ZET B;  4BC2 A;  4A61 A;  3VEX A;  3VOV A;  5BRE A;  1BDG A;  3ENO A;  4WYB A;  1KXP A;  4BR7 A;  1X3N A;  3DXK B;  2ZF5 O;  3MMV A;  3C7N A;  1ZC6 A;  1DKG D;  4BRD A;  2IIR A;  3VPZ A;  3WQT A;  5AQI A;  1QQM A;  4YDU A;  2QWO A;  4QS7 A;  5AQU A;  3LL3 A;  2IVP A;  4XEI A;  3CER A;  3VEN A;  4K25 A;  4O8K A;  5AQJ A;  4BR9 A;  4EHU A;  3O4W A;  1JCF A;  2HOE A;  4WQ4 C;  1BA0 A;  1XC3 A;  2P9K A;  2KHO A;  4M63 C;  3QIC A;  2QW9 A;  4BRG A;  1ATN A;  3WXI A;  3IFR A;  3H6E A;  5KPZ A;  3CJB A;  3VGL A;  5AQZ A;  4CZL A;  1HKG A;  2P9S B;  3LDN A;  3TPQ A;  3J8A A;  1MA9 B;  3LDQ A;  4BRF A;  2ZGZ A;  4FOI A;  4FL9 A;  5AQR A;  1GLC G;  3IUC A;  4AM6 A;  4JAX A;  1HX1 A;  4KBO A;  1C0F A;  3HI0 A;  4BVP A;  1GLL O;  4H5W A;  1XUP O;  2V7Y A;  4B1W B;  3DXM A;  4HWI A;  1P8Z A;  3FE1 A;  1NM1 A;  5TKY A;  3WEE A;  3VET A;  4RCH A;  1ZXO A;  3D2F B;  4JN4 A;  4F9O A;  2F9T A;  4XH4 A;  4BRA A;  3A5L C;  3ENH A;  2NRH A;  4QS8 A;  3DWL A;  1Z6R A;  4I6M A;  4E1J A;  3A5N C;  2CGL A;  4EHT A;  1NGG A;  1KAY A;  3BF1 A;  3VEW A;  1S3X A;  3EO3 A;  3HSC A;  5AQV A;  2FSJ A;  3CQX A;  1IJJ A;  5FPD A;  3EKU A;  1T6C A;  3FZM A;  4JD2 B;  4WQ5 C;  3VEY A;  4FWQ A;  4PKH A;  3GOI A;  3GBT A;  4FWS A;  1SQK A;  3UKU B;  4BRO A;  2QWL A;  4WQ4 A;  3QB0 A;  5EVZ A;  1RGI A;  5FPE A;  2YJF A;  3G25 A;  2PBD A;  3QML A;  1NGJ A;  4LC9 B;  1HUX A;  2E2Q A;  2P9N B;  1MDU B;  4JD2 A;  4FPA A;  2E1Z A;  4H0O A;  3CQY A;  4BQZ A;  2QWR A;  3HTV A;  2BTF A;  1DGK N;  1ATS A;  4JNE A;  2VYP A;  3MCP A;  4ISG A;  3ZX0 A;  5AFU A;  2Q97 A;  4FSV A;  4B1U B;  3H1V X;  4BGA A;  4PKI A;  1C0G A;  4BRE A;  5LJV A;  2W41 A;  1KAZ A;  3CHW A;  3C7N B;  3FZF A;  1NWK A;  3L4I A;  2QM1 A;  4EAH D;  2ZWH A;  5KQD A;  3IMX A;  2ITM A;  4H5N A;  1U2V A;  3ATV A;  4GY2 B;  5AQF A;  4CZK A;  4BC4 A;  4A2B A;  4CBW A;  2I7N A;  3OHR A;  5JLF A;  5AQY A;  4EFH A;  2ASP A;  3SMS A;  1BO5 O;  4BRH A;  3HBT A;  5AQK A;  3SLC A;  3I8B A;  3W3D A;  5JMV A;  3ZX2 A;  5BR9 A;  2P9K B;  3WUH A;  5AQO A;  1K8K A;  2GEL A;  3WQU A;  3ZX3 A;  5BRF A;  1J6Z A;  1NGA A;  4WQ5 A;  4AM7 A;  3JS6 A;  2QWN A;  3RSE A;  2Q1N A;  1XQS C;  2FLO A;  1NBW A;  1JCE A;  1GLA G;  3WXJ A;  3MK6 A;  3SMP A;  3M3Z A;  2J4R A;  5BPL A;  5F0X A;  1Y64 A;  4XH1 A;  3U9D A;  3EL2 A;  1U6Z A;  4IJA A;  3UKR A;  5LJW A;  3A5M C;  1E4F T;  5EOY A;  4PKG A;  3FGU A;  3FZH A;  4CZM A;  3LM9 A;  2Q2R A;  2Q36 A;  1MWM A;  5AQX A;  3DXM B;  4MLH A;  5EX5 A;  3CJA A;  1BG3 A;  1QZ5 A;  2GEM A;  3H45 C;  3WEE B;  5F2R A;  3HZ6 A;  3KVG A;  5ADX A;  1DEJ A;  4CJ7 A;  3VGK A;  1YUW A;  4BRQ A;  4BG9 A;  4BRI A;  2A41 A;  3CI5 A;  4DCH A;  1RDW X;  3U8X A;  4K43 A;  3R9P A;  4I6M B;  3QFU A;  1NGB A;  4BRL A;  3VF2 A;  1T44 A;  3IDH A;  2QXL A;  1TYQ A;  4ISE A;  4CZJ A;  4L3Q A;  3HM8 A;  1WOQ A;  2ASM A;  3ULE A;  3TU5 A;  2E20 A;  1R59 O;  3AAP A;  4IWV A;  5FPM A;  2E1Y A;  5B8H A;  3I33 A;  3AAR A;  1GLD G;  5AFU H;  1NGH A;  5AQT A;  2A40 A;  4Y0W A;  1OKJ A;  2E2O A;  2E2P A;  1V4S A;  4H0V B;  3O5B A;  1WUA A;  2P9U A;  1ESV A;  2E2N A;  2YJE A;  2NZT A;  1CZA N;  4IZ9 A;  5AQP A;  3U9Z A;  1H1V A;  2YHW A;  2QWM A;  1ATR A;  3AAQ A;  3A8Y A;  4B9Q A;  2P9P A;  3BP8 A;  4M7Y A;  3FR0 A;  4CBU A;  3CJC A;  3S41 A;  5LY3 A;  4CZE A;  4DQ8 A;  5AR0 A;  4CZF A;  2YHY A;  4FO0 A;  2HF4 A;  3GG4 A;  4BRC A;  4CZI A;  4M7X A;  4DB3 A;  5E26 A;  1X3M A;  4H0Y B;  5ELZ A;  4PL8 A;  2W40 A;  3H1Q A;  1TUY A;  5KQ8 A;  3A0I X;  5AZI A;  4FWK A;  2D0O A;  4CD1 A;  1YAG A;  1HKC A;  3BUZ B;  1U2V B;  4FWN A;  4BR0 A;  5BRD A;  5AQG A;  2I7P A;  1E4G T;  2V52 B;  3D2E A;  3QFP A;  3H46 O;  1G99 A;  3VES A;  5JIC A;  4RWT A;  2P9I A;  3FFK B;  3FZL A;  3AY9 A;  3O6W A;  1K8K B;  4BR2 A;  5AQN A;  2DPN A;  3GDQ A;  4PL7 A;  1NGF A;  4CBX A;  3RSE B;  2VCP A;  4BRK A;  1D4X A;  4NO7 A;  1TUU A;  3KZB A;  3M1F A;  3KHY A;  4K42 A;  1HJO A;  5AQL A;  3A5O C;  1NGE A;  4O5F A;  2FF6 A;  2A42 A;  1KAX A;  2BUP A;  4BVO A;  3BEX A;  3UKR B;  1X9J A;  4JHD A;  3VGM A;  4A62 A;  2V7Z A;  2NLX A;  3MN5 A;  2P9L B;  3VEV A;  4BRN A;  1QQN A;  2VWB A;  3JXU A;  3ZEU A;  2QWQ A;  1QHA A;  3O8M A;  2D1K A;  1HPM A;  3H3O B;  2FSK A;  4MO4 A;  2FSN A;  5E84 A;  3QDK A;  1GLE G;  2FXU A;  2V51 B;  3CET A;  4EIA A;  2ASO A;  1BU6 O;  1BOT O;  3VF4 A;  5AZJ A;  3ID8 A;  1V4T A;  2P9L A;  5AQH A;  4FOE A;  4H0T B;  4IO8 A;  2UYT A;  2D4W A;  2GTD A;  3L6Q A;  1NLV A;  1TYQ B;  3ZET A;  3QBW A;  3W0L A;  2D0P A;  3MDQ A;  3ULE B;  4ISF A;  4B1V A;  3ATU A;  2YCH A;  2GWK A;  3DXK A;  2FF3 B;  3O1B A;  5BPM A;  4C23 A;  1BUP A;  4FPB A;  4B1X B;  3WT0 A;  2AP1 A;  2H3G X;  4K41 A;  2P9U B;  2AA4 A;  5AQQ A;  3B8A X;  1RFQ A;  3D7E O;  3GL1 A;  4HTL A;  1GLJ O;  1Q18 A;  2QWP A;  3CJ7 A;  2P9P B;  4GNI A;  2HMP A;  4CD3 A;  1YXQ A;  3EN9 A;  3DJC A;  1NGC A;  4BGB A;  2EWS A;  2OAN A;  3WXL A;  3L0Q A;  4Z94 A;  1GLB G;  2IVN A;  3LDL A;  2A6A A;  4H5T A;  4BC5 A;  4B1Z A;  2P9S A;  3MN7 A;  3P4I A;  3CJ9 A;  2F9W A;  4H03 B;  2WUS A;  5FPN A;  2CH6 A;  2E88 A;  3O80 A;  4NB4 A;  5AZI B;  1EQY A;  3VEO A;  1HKB A;  4CZG A;  5F1X A;  4BC3 A;  4BRP A;  5KPR A;  3EKS A;  3D2E B;  5EXW A;  1SAZ A;  2CH5 A;  2P9I B;  3FZK A;  2CGK A;  2A3Z A;  2GUP A;  4MO5 A;  3CIP A;  1BWF O;  3UB5 A;  4BR5 A;  5AQM A;  1MWK A;  3MN9 A;  5BRH A;  4H0X B;  3D2F A;  3SK3 A;  1NGD A;  4YDU C;  2GWJ A;  4H0P A;  3LM2 A;  3O1W A;  4B1Y B;  5BN8 A;  4RTF D;  1T6D A;  4IXC A;  4QS9 A;  1Z05 A;  4FWL A;  4MLE A;  1IG8 A;  2Q0U A;  3MN6 A;  1QZ6 A;  4J8F A;  1NMD A;  3QBX A;  3VEZ A;  4FWO A;  4DHY A;  4BRM A;  3LDP A;  2ZGY A;  4JHD B;  1QQO A;  2A5X A;  2CGJ A;  2HF3 A;  1LCU A;  4H5R A;  5AQS A;  4IJN A;  3BF3 A;  3M6G A;  4FWR A;  3GE1 A;  5I9E B;  3ZEU B;  5ADX H;  4FWM A;  5BN9 A;  1NGI A;  2IVO A;  4XH5 A;  3UKU A;  2Q0R A;  3H3N O;  3SJH A;  5KPT A;  3EZW A;  4H5V A;  3UE5 A;  3C0B A; 
#chains in the Genus database with same CATH topology
 5M1F A;  3LPT A;  4OKJ A;  4B9U A;  4M3Z A;  4JI3 K;  1JCG A;  3VF6 A;  2O4I A;  1ZBS A;  3NGY A;  4F3T A;  1HPZ A;  1NNE A;  3DAW A;  3AVC A;  1Q9Y A;  1OVY A;  1SZ2 A;  4BQL A;  2PAV A;  4AF1 A;  3CME N;  4J2D A;  2Q31 A;  3FLC O;  3F9M A;  3ZET B;  3RMC A;  1SL0 A;  1CZB A;  3NBP A;  4NCB A;  3VOV A;  3ENO A;  1NK7 A;  4ZHR A;  3C6T A;  4BAC A;  4C8N A;  3MMV A;  3MAQ A;  2NRT A;  3C7N A;  4FLU A;  3TAM A;  1TL3 A;  1SKR A;  3VPZ A;  2UU9 K;  3WQT A;  1Q9X A;  3K57 A;  4DSF A;  4C1N I;  4CGH A;  4AHR A;  3LL3 A;  4XEI A;  3TAF A;  3MCA B;  4KAZ A;  4LF4 K;  4BR9 A;  3O4W A;  4ELT A;  3SPZ A;  3AA5 X;  3IS9 A;  1XC3 A;  1KVA A;  4RW8 A;  3CJB A;  3VGL A;  4CGF A;  3DRP A;  4CZL A;  1HKG A;  4FJ9 A;  1LW2 A;  1VSM A;  4DR7 K;  1YHQ N;  2KW4 A;  3LDN A;  3HPO A;  3TPQ A;  1W97 L;  4FLY A;  4AQY K;  4CIG A;  4BE2 A;  2O8B A;  2ZGZ A;  2D5R A;  1L5U A;  1GLC G;  3WNE A;  4KBO A;  4CHZ A;  4WFN L;  4AHT A;  1DTQ A;  2KKZ A;  4DQI A;  4O4G A;  4RCH A;  4JI2 K;  1XWL A;  4E7L A;  5GIO A;  4XH4 A;  3A5L C;  5KGW A;  2NRH A;  1ZBU A;  3D6R A;  3DWL A;  4I6M A;  4CCH A;  1NGG A;  3BF1 A;  3EO3 A;  3HSC A;  3NF7 A;  2FSJ A;  1EWQ A;  3OA9 A;  4JD2 B;  3VEY A;  4PKH A;  1IKY A;  4FWS A;  1SL1 A;  5FRO A;  4OGE A;  1S1X A;  3OJS A;  2B4J A;  5FPE A;  4BE1 A;  3J7Z O;  3NMU A;  3PX0 A;  5JS2 A;  1NGJ A;  1KVB A;  3VQ5 A;  3SJJ A;  1HUX A;  4HUG A;  2E2Q A;  2P9N B;  1MDU B;  3KLI A;  2E1Z A;  3CQY A;  4LF8 K;  4IDH A;  3BDP A;  3F9K A;  1ATS A;  3CCQ N;  2VYP A;  3LAM A;  4E89 A;  1JLF A;  3UIQ A;  4B1U B;  5KRT A;  1L3S A;  3ZT1 A;  2F4V K;  2W41 A;  1U45 A;  3FZF A;  2X74 A;  1QSL A;  4EAH D;  5KQD A;  3IMX A;  3O3G A;  1HQE A;  2ZJP L;  2O8F A;  4H5N A;  4FZY A;  3E9L A;  3L2U A;  1U2V A;  1KD1 O;  3AVM A;  4DKW A;  4CZK A;  2HBJ A;  3AVK A;  4PUO A;  1BO5 O;  5AQK A;  5JMV A;  3SAG A;  1TK5 A;  2GEL A;  3WQU A;  3ZX3 A;  4CJR A;  1EET A;  4DF8 A;  1VQ8 N;  4DR5 K;  4AM7 A;  4FK0 A;  3CF5 L;  2QWN A;  3AVB A;  3RSE A;  1VSF A;  5DM7 L;  4UY8 O;  4HHT A;  1JCE A;  2RKI A;  3OYA A;  3SMP A;  3M3Z A;  4DSE A;  1BI4 B;  4JRQ A;  1VQO N;  1DT9 A;  5LMU K;  4XH1 A;  3EL2 A;  1KC8 O;  1N8R O;  4IJA A;  3UKR A;  3P5J A;  2IOC A;  2Q36 A;  1NK5 A;  4YOV A;  3DXM B;  4MLH A;  3SZ2 A;  1X9S A;  1BG3 A;  4IG0 A;  5M1O A;  1EP4 A;  1F21 A;  1XMO K;  4C8M A;  3MX2 A;  3U3Y A;  3AVF A;  1C6V A;  3EE9 A;  4IDK A;  4K43 A;  3QFU A;  4BRL A;  3ZT4 A;  3ZT2 A;  3J81 O;  4LF7 K;  1WSJ A;  3U3G A;  3OJU A;  3IDH A;  3L8B A;  2R7Y A;  3PO4 A;  4KTZ A;  4ISE A;  4Z4G A;  1K9M O;  3TU5 A;  1R59 O;  2F96 A;  4OJR A;  1J5O A;  3AAP A;  4LF9 K;  3I55 N;  5B8H A;  3TTC A;  4IFY A;  4CJ4 A;  3PSF A;  3AA2 A;  5J2P A;  4DF4 A;  2B5J A;  2P9U A;  1S1T A;  2OZS A;  3ZSY A;  4DU4 A;  2E2N A;  2NZT A;  4IZ9 A;  2G8K A;  1H1V A;  4KTQ A;  1ATR A;  2OPS A;  4EP4 A;  4NYN A;  4CBU A;  3S41 A;  3N4P A;  1S9E A;  3K2P A;  4FJX A;  3OYI A;  1EKE A;  2HF4 A;  3GG4 A;  4CZI A;  4M7X A;  4U67 L;  3OS2 A;  1VSH A;  4GMJ B;  5ELZ A;  2HNY A;  4PL8 A;  4O5B A;  1XMQ K;  4KRF A;  4FWK A;  1RBS A;  3BUZ B;  4FWN A;  4BR0 A;  5BRD A;  3RRG A;  5AQG A;  2I7P A;  1IKV A;  4CJT A;  5JIC A;  3OYM A;  1TKD A;  1IG9 A;  5GAG P;  1FXX A;  2VWK A;  1TKX A;  1XHZ A;  3GDQ A;  3QIO A;  1WN7 A;  3THW B;  2VCP A;  1J5E K;  1TUU A;  3M1F A;  3SQ2 A;  2YX6 A;  5TKW A;  1NGE A;  1NG9 A;  2FF6 A;  1JLQ A;  2A42 A;  4JHD A;  1R0A A;  3VGM A;  2V7Z A;  4HUE A;  2NLX A;  3OYH A;  3V6D A;  3MN5 A;  2P9L B;  3AVN A;  4BRN A;  2YKM A;  3OBW A;  1C1C A;  1ZBF A;  1QHA A;  1HPM A;  4MO4 A;  2FSK A;  2DFH A;  3TR8 A;  4XIU A;  3AGR A;  3ZSW A;  2HHH K;  2HMI A;  1U48 A;  3ID8 A;  4I2Q A;  3K5O A;  2OTL N;  2FBY A;  4IO8 A;  2GTD A;  4CF0 A;  3CMA N;  3T1Y K;  3EEQ A;  5I42 A;  1REV A;  3DLL L;  3Q7B A;  2YCH A;  3CFO A;  3SBG A;  4YHH K;  5IT9 O;  4GV6 A;  3LP3 A;  2FF3 B;  5CYM A;  4ID1 A;  4B1X B;  1XHX A;  2AP1 A;  2H3G X;  2YNF A;  4K41 A;  3O9U A;  3C94 A;  1ITG A;  1RFQ A;  2I5J A;  2WBN A;  3DOK A;  4DV1 K;  1JLB A;  2P9P B;  3NF6 A;  3QNO A;  2HMP A;  4AH9 A;  4LFC K;  4CD3 A;  2O8E B;  2YHB A;  3DYA A;  1JXB A;  2OAN A;  4K8X A;  1J9A A;  4CF9 A;  4LFA K;  4Z94 A;  3QEW A;  3E01 A;  3O9Q A;  3C6A A;  1XI1 A;  1JLG A;  4M3W A;  4O55 A;  1Q86 O;  4ELV A;  3MN7 A;  3D0P A;  2VWJ A;  5FPN A;  4NB4 A;  1Y97 A;  1J54 A;  4W5O A;  2EHG A;  4CJV A;  1RT4 A;  3NF8 A;  4IFE A;  3OYE A;  3RMB A;  1VHX A;  4CJS A;  3LWL A;  3S3O A;  1O13 A;  4MO5 A;  2WON A;  3L2V A;  1XNQ K;  3AVL A;  2HHT A;  3D2F A;  3VA3 A;  1T8E A;  4N76 A;  4H0P A;  4N5S A;  4OVL A;  4ZTJ A;  1T6D A;  2VG5 A;  2PYJ A;  3SCX A;  1Z05 A;  4MLE A;  1RDC A;  2OPP A;  1WSI A;  4J2A A;  4X66 K;  1NMD A;  3QBX A;  1VQ4 N;  4NLC A;  3VQ8 A;  4FWO A;  2G8U A;  2B6A A;  3ISN C;  5GAE P;  4IJN A;  3BF3 A;  4HTU A;  5SZT A;  4DLE A;  3M6G A;  3BZC A;  3FFI A;  4FWR A;  4KTW A;  5DMR A;  4CEC A;  1ZBL A;  3MWP A;  4C8O A;  4FWM A;  3VQD A;  3UKU A;  2HBK A;  4CVN E;  4OPJ A;  3QLH A;  3UE5 A;  4E3S A;  2XY6 A;  3SUQ A;  4BG8 A;  2YI1 A;  4B3S K;  3D45 A;  1HLU A;  4WF9 L;  4W5N A;  4A2A A;  3R6M A;  3R8E A;  3DI6 A;  3LDO A;  4FWP A;  3NFA A;  1GLF O;  5JLH A;  3V1Q A;  4JKH A;  4N56 A;  3U4L A;  2YHX A;  4Q5V A;  5CE3 A;  3ITH A;  3O08 A;  1LWF A;  2PZS A;  4BC2 A;  2XY7 A;  5BRE A;  5KRS A;  4HCB A;  5A2Q O;  3SUP A;  1KXP A;  3DLG A;  1C0M A;  3HYF A;  2OPR A;  2IIR A;  2WFB A;  3B6P A;  3F2K A;  1U4B A;  1FK9 A;  1TK8 A;  1QQM A;  3OYF A;  3LP1 A;  1VQM N;  1FJG K;  4DWI A;  1KTQ A;  2QWO A;  1NJY A;  3O4Q A;  3G6E N;  4CK1 A;  3VEN A;  4K25 A;  5AQJ A;  3PSI A;  2YNG A;  3OYC A;  3CCR N;  2O8B B;  2HOE A;  1IBK K;  4WQ4 C;  3PO5 A;  1C1A A;  1BA0 A;  2P9K A;  2KHO A;  4C1N K;  4BRG A;  1YI2 N;  3G0Z A;  1VQ9 N;  3T69 A;  2JGU A;  3VQP A;  3I56 N;  1MA9 B;  3LDQ A;  4BRF A;  4FOI A;  5CYQ A;  3CFR A;  4CJ5 A;  5I3U A;  3J7A P;  1HX1 A;  1YT3 A;  3O4N A;  1RDB A;  4CIE A;  1GLL O;  1XUP O;  4B1W B;  1WSH A;  4Z4C A;  1NM1 A;  1L3V A;  4FLV A;  1YIJ N;  4LF5 K;  4CIF A;  4F3O A;  1RBT A;  3L3U A;  4JN4 A;  4KH6 A;  4F9O A;  4BRA A;  1QE1 A;  5FLX O;  3SBT A;  4FM0 A;  4LH5 A;  2Y1J A;  1Z6R A;  4KHN A;  3A5N C;  1KAY A;  3VEW A;  3DM2 A;  5AQV A;  1EX4 A;  1W2B M;  1YTA A;  5EU7 A;  2E5L K;  3T1H K;  4CEQ A;  3EKU A;  4FM2 A;  4DTU A;  1HMV A;  3GBT A;  1WBD A;  4KRE A;  3O9S A;  4CEA A;  2G8F A;  4Z0U A;  4OLB A;  2QWL A;  2JWL A;  2Q3S A;  4DR1 K;  1RGI A;  2YJF A;  3G25 A;  1TV6 A;  4FJI A;  3OTO K;  3ZT0 A;  2X6S A;  1EXQ A;  2XHB A;  1JL2 A;  1P90 A;  5C24 A;  4B3T K;  4DTP A;  4FJ5 A;  3T3F A;  4FPA A;  3HRG A;  4H0O A;  4BQZ A;  4KB0 A;  3RMA A;  4B9N A;  3I0R A;  5M1K A;  5FRM A;  3TAP A;  2BH1 A;  4U7B A;  3HP9 A;  1SV5 A;  4DTO A;  2VG6 A;  1S1U A;  3DLE A;  4CFB A;  5E41 A;  4M3X A;  1E3M A;  3ZT3 A;  4CJL A;  1IBM K;  3PY8 A;  1NWK A;  1X9W A;  3AO1 A;  4CGD A;  1IO2 A;  3KKR A;  2IGI A;  5AQF A;  4A2B A;  1WLJ A;  5JLF A;  4EZ6 A;  5J2M A;  3EYZ A;  3ZSO A;  4JKC A;  3SMS A;  4IG3 A;  4WFA L;  4FJ8 A;  3SLC A;  3CYM A;  3W3D A;  4H8K A;  4N47 A;  4HVJ A;  3ZX2 A;  5BR9 A;  1QSY A;  3WUH A;  2ZJR L;  2KFZ A;  5BRF A;  1NGA A;  4JK9 A;  2Q1N A;  3AO3 A;  2FLO A;  3WXJ A;  5GAH P;  3MK6 A;  3S3N A;  1BCO A;  4ZTF A;  3ZSQ A;  1Y64 A;  4JI5 K;  3ZSZ A;  4NXM K;  3OY9 A;  5EOY A;  4PKG A;  2Q2R A;  4IKF A;  3EY1 A;  3LDS A;  1WAF A;  2UXB K;  2WC9 A;  1QZ5 A;  3WEE B;  3KVG A;  1DEJ A;  3RRH A;  4CES A;  1YUW A;  4AHS A;  4FZX C;  5HRO A;  2O8D B;  3ZSX A;  5HOO A;  4DCH A;  3OYN A;  4KI6 A;  4JI8 K;  4OPK A;  1UOC A;  3ID6 A;  3WNG A;  3KWI A;  3M8P A;  4BDY A;  1NGB A;  5C10 A;  4BWJ A;  3K59 A;  1T44 A;  1D9F A;  4CZJ A;  4FJJ A;  1QQC A;  3SAH A;  3E9O A;  4G1Q A;  3HM8 A;  2ASM A;  3KK1 A;  2W6K A;  4DV5 K;  4EP5 A;  3HOS A;  3KJV A;  4I2P A;  1GLD G;  1N33 K;  1QTM A;  5AFU H;  2A40 A;  4Y0W A;  4FVU A;  1OKJ A;  4FLX A;  4H0V B;  1WUA A;  1JL1 A;  4KHU A;  2LSN A;  3VQ7 A;  3HT3 A;  4GVE A;  3AVG A;  3T7Z A;  2P51 A;  4B9Q A;  1LW0 A;  3OS1 A;  3DLB A;  1ZBH A;  4M7Y A;  3IAY A;  4YNQ A;  2ZE2 A;  3C95 A;  4E0D A;  1RT1 A;  1UA0 A;  2D0B A;  1NOY A;  5HRS A;  4GKK K;  5CHI A;  4JEP A;  5E26 A;  3VA0 A;  1S72 N;  3KK3 A;  3VQA A;  3SQ4 A;  2DFE A;  3H1Q A;  1NJW A;  2NRR A;  4W5T A;  3A0I X;  5AZI A;  5GAD P;  3O3H A;  3E9P A;  2V52 B;  3D2E A;  2VQE K;  1S1V A;  1DLO A;  2QK9 A;  3K0S A;  2RPI A;  3SAF A;  1K8K B;  4BR2 A;  2NUB A;  3SI6 A;  4JKG A;  5C0Y A;  4PL7 A;  2JWK A;  1NGF A;  4DTM A;  4JI6 K;  4M3Y A;  3B6O A;  3WNH A;  4K42 A;  5AQL A;  3A5O C;  1ASU A;  1QVG M;  2QA4 N;  2KQ2 A;  3ALY A;  4KFB A;  4BVO A;  4E19 A;  2Z1J A;  4TSX A;  4A62 A;  2G8W A;  3M8S A;  4F8R A;  1XC9 A;  2YNI A;  3DLK A;  1TVR A;  1QQN A;  1VSI A;  3KD5 E;  3TSP A;  5HL7 L;  3H3O B;  2FSN A;  1T05 A;  3VQ9 A;  1RTJ A;  3OYG A;  1GLE G;  2FXU A;  2KZM A;  3ZCM A;  1HNX K;  2YNH A;  1TL1 A;  3BZK A;  3KK7 A;  5D3G A;  3OYD A;  2NRZ A;  4IOX A;  4BE0 A;  4B3R K;  4DTR A;  4FLZ A;  2OTJ N;  3SYZ A;  4KH5 A;  4OKE A;  4A57 A;  3CC4 N;  1TYQ B;  1WBB A;  1RT2 A;  3ZET A;  2UXC K;  4DR2 K;  3ULE B;  1D5A A;  2HHU A;  3HVT A;  5KGX A;  2W42 A;  1RDU A;  1S9G A;  3O1B A;  3VMF B;  5BPM A;  4C23 A;  1NK8 A;  1BUP A;  4DV4 K;  3PX6 A;  3TTD A;  3M5R A;  3OW2 M;  2AA4 A;  1JJ2 M;  2F7T A;  4M45 A;  4IEE A;  3F73 A;  3D7E O;  3GL1 A;  2ZJQ L;  4DQQ A;  2QEX N;  3TTF A;  4CJU A;  1HNW K;  3F5T A;  4HTL A;  3CCL N;  4FVM A;  4WE1 A;  2DY4 A;  1G15 A;  4GNI A;  2QI2 A;  3SUO A;  4B3M K;  4IOA L;  3KD1 E;  1RT6 A;  4KHW A;  1BQM A;  1Z26 A;  3WXM B;  1XNR K;  1Q81 O;  4BGB A;  3MX5 A;  3THX B;  3TAN A;  3WXL A;  4ID5 A;  2A1R A;  3NH0 A;  3LDL A;  4CK2 A;  3V4I A;  1RTI A;  4BC5 A;  3P4I A;  4DTS A;  2F9W A;  2WUS A;  2CH6 A;  3T1A A;  1SS6 A;  3VEO A;  1HKB A;  3O9R A;  1JKH A;  5F1X A;  3PV8 A;  3RMD A;  3EKS A;  5EXW A;  1SAZ A;  2P1J A;  2CH5 A;  2P9I B;  4CGG A;  2A3Z A;  4N41 A;  5GIP A;  2A1S A;  5C2D A;  4V19 S;  5BRH A;  3SK3 A;  3L3V A;  4YDU C;  3LM2 A;  5BN8 A;  4RTF D;  1VQN N;  3PIP L;  3U6F A;  3K5N A;  5JVH L;  1EWR A;  2AJQ A;  4FWL A;  3T19 A;  2Q0U A;  4J8F A;  1QZ6 A;  3VEZ A;  3E66 A;  1BHL A;  3AO4 A;  1HJR A;  4BRM A;  3LDP A;  1QQO A;  5AQS A;  3NGI A;  4DQR A;  4CJK A;  5J2Q A;  5C12 A;  3ZEU B;  3PX4 A;  4XH5 A;  1M90 O;  1LAV A;  4H5V A;  3JAM O;  1C0U A;  4M3T A;  3VER A;  4KH4 A;  5AZJ B;  1BA1 A;  2P5G A;  2RF2 A;  1LOT B;  1VQ5 N;  4CZH A;  2P9N A;  4OX9 K;  3WXK A;  2F8S A;  2E8A A;  4CJ3 A;  2D0C A;  5C15 A;  4DMN A;  3VQ6 A;  5SWM A;  4YOY A;  5BPN A;  4R5P A;  5AQW A;  5M1Q A;  1S5J A;  2DFF A;  3L4Q A;  1KLN A;  4JKD A;  3NVM A;  4BR7 A;  3CCJ N;  3DXK B;  3MXM A;  4FJN A;  3BGR A;  4OO1 J;  1ZC6 A;  3ZSR A;  1VSK A;  4FJ7 A;  3DRR A;  1DKG D;  4ICL A;  3NF9 A;  1C0T A;  1T3V A;  4BRD A;  1M1K O;  2OZM A;  4KHS A;  5JS1 A;  5AQI A;  1VK0 A;  5MLC Q;  4BY9 C;  1FKP A;  4QS7 A;  3K5L A;  4ILH A;  2G8I A;  2HVH A;  4O8K A;  1A5X A;  4EHU A;  1JCF A;  2XO7 A;  2O8C B;  4QCL A;  3KTQ A;  1HNZ K;  4Z4F A;  4M63 C;  3QIC A;  2QW9 A;  4KPY A;  1S1W A;  3MXJ A;  3IFR A;  3G71 N;  4DTN A;  5KPZ A;  3ASM A;  1OH7 A;  5CR4 A;  5AQZ A;  3DOL A;  2P9S B;  1BI4 A;  4CED A;  4WFB L;  1BCM A;  4FCY A;  3KWG A;  1TGO A;  1DTT A;  1KLM A;  4FL9 A;  5AQR A;  3IUC A;  4JAX A;  3JYT A;  1SUQ A;  3HI0 A;  4H5W A;  1B9D A;  3KK2 A;  2V7Y A;  4DV3 K;  3DXM A;  3AVI A;  4HWI A;  1P8Z A;  4B9L A;  4C8K A;  4BWM A;  1LV5 A;  1IKX A;  3ENB A;  4OPH A;  1WAJ A;  1ZXO A;  1RIL A;  3ENH A;  1VSJ A;  4DLG A;  1RBU A;  1N6Q A;  4E1J A;  2CGL A;  1CXU A;  3AA4 A;  2XY8 A;  3QIN A;  1NK6 A;  4RW9 A;  5IWA K;  3AV9 A;  4IEI A;  5FPD A;  4FLW A;  3J7Y P;  1JLE A;  1T6C A;  3FZM A;  4WQ5 C;  5GIN A;  4Z4E A;  3P83 D;  3OBY A;  1SQK A;  1YIT N;  3HST B;  5HRN A;  4FM1 A;  4BRO A;  4WQ4 A;  3THY B;  3AO2 A;  4B08 A;  1L3U A;  1W9H A;  4L8R B;  3AVH A;  3QML A;  5CZ2 A;  2IAJ A;  4QOZ B;  4LC9 B;  3K58 A;  2WTU A;  4C8L A;  5J1E A;  3KLE A;  2QWR A;  4CHO A;  1DGK N;  4JNE A;  4ISG A;  3WNF A;  3V9S A;  4FSV A;  2UUA K;  1BIZ A;  1C0G A;  5HRP A;  4BRE A;  3TAQ A;  1KAZ A;  3CHW A;  2PY5 A;  4WCE L;  3C7N B;  4JK8 A;  3O3F A;  1X9M A;  3KKS A;  3L4I A;  2QM1 A;  3HJF A;  2ZWH A;  3AGK A;  1LAW A;  2Z1I A;  1NKC A;  5DM6 L;  3OVN A;  4JKB A;  4GY2 B;  2Y1I A;  2UUC K;  1OVQ A;  4DV0 K;  2I7N A;  2O4G A;  3OHR A;  4FZZ A;  4PY5 A;  5AQY A;  4EFH A;  1ZYQ A;  2ASP A;  4G9Z A;  3HBT A;  3I8B A;  1T03 A;  4HUF A;  1HQU A;  2HB5 A;  4GV3 A;  1XQS C;  4YOW A;  1NBW A;  2RE2 A;  1YVU A;  1RDD A;  4DV7 K;  3QNN A;  1U6Z A;  5J2N A;  1BGX T;  5LJW A;  1UA1 A;  1ASW A;  1E4F T;  2ETJ A;  3FGU A;  3FZH A;  4I7F A;  4CJP A;  1MWM A;  3QEI A;  3S3M A;  3AA3 A;  4IO9 L;  1RTD A;  4YOT A;  5EX5 A;  3CJA A;  1S6Q A;  3H45 C;  3AVA A;  5F2R A;  1HNI A;  4KB1 A;  1MU2 A;  3SQ1 A;  3MWT A;  3VGK A;  3LAK A;  2F8T A;  4CFC A;  4BG9 A;  4CHY A;  4AHV A;  3CI5 A;  2D0A A;  1D9D A;  2WOM A;  1RDW X;  4Z4I A;  3QES A;  4I6M B;  2E6L A;  4F2S A;  4CEB A;  1X1P A;  4CW7 B;  1YTU A;  4L3Q A;  4FW2 A;  1RBV A;  4B9S A;  1WOQ A;  1CXQ A;  3CC7 N;  4IBN A;  4DSK A;  1CZ9 A;  3NVK A;  4IWV A;  4CEE A;  3SV3 A;  2E1Y A;  3ZLJ A;  1RBR A;  2PFU A;  3I33 A;  3ZSV A;  4NLB A;  3THV A;  2E2O A;  2E2P A;  4LD0 A;  4O44 A;  4CF2 A;  3O5B A;  3P1G A;  4DR4 K;  1WSE A;  1NKE A;  5AQP A;  1ILY A;  2YHW A;  2QWM A;  1IH7 A;  3A8Y A;  4JI7 K;  2HBM A;  4GVM A;  4NXN K;  2P9P A;  1BL3 A;  1A5W A;  3BP8 A;  4CFD A;  3FR0 A;  5LY3 A;  2O8E A;  4CZE A;  2VGM A;  1TK0 A;  3AO5 A;  4CZF A;  1NMN A;  4FO0 A;  2FBT A;  3V9W A;  5AJ3 K;  4DB3 A;  3QO9 A;  1X3M A;  2X78 A;  3DLH A;  4H0Y B;  4OGC A;  4E7H A;  3CCM N;  4JV5 K;  1VQL N;  2W40 A;  4X65 K;  1UAX A;  3IKM A;  1TUY A;  5KQ8 A;  4CF1 A;  2O8F B;  3VQB A;  2D0O A;  3NCI A;  4CGI A;  1JLC A;  1VSD A;  1HKC A;  4KV8 A;  1U2V B;  1RDA A;  3KIO A;  1EO1 A;  3QFP A;  2KTQ A;  2VG7 A;  3H46 O;  1G99 A;  3VES A;  4A5B A;  1HYV A;  4E7K A;  4RWT A;  3AY9 A;  3LP2 A;  1VQK N;  3O6W A;  5C42 A;  5AQN A;  4E1N A;  3RSE B;  4YFU A;  4BRK A;  4NO7 A;  3RVC A;  1JLA A;  3TAB A;  2OYQ A;  1HJO A;  1T7P A;  1BIU A;  3CG7 A;  3BEX A;  3UKR B;  1KFS A;  3P31 A;  5FRN A;  3MEE A;  3VEV A;  1YJW N;  1W7A A;  2HNZ A;  3QEP A;  1FKO A;  3JXU A;  3TAR A;  1Z25 A;  3OYJ A;  5FDL A;  3O8M A;  2D1K A;  5E84 A;  3M8Q A;  4JKA A;  3QDK A;  1K8A O;  2V51 B;  4EIA A;  1OH6 A;  1BU6 O;  3LWM A;  1BOT O;  3L2W A;  3LZJ A;  3HVR A;  5M1N A;  4E7I A;  1V4T A;  4CER A;  3KLG A;  3M8R A;  3L2Q A;  3TI0 A;  4H0T B;  3NHG A;  2UYT A;  1JXE A;  4YOU A;  1NLV A;  2GUI A;  5BR8 K;  1NU0 A;  3TAG A;  4B1V A;  1K73 O;  3ATU A;  4JKE A;  1RT7 A;  4A5A A;  3RTV A;  4FPB A;  1IV0 A;  2P9U B;  3SPY A;  5HLF A;  1GOA A;  1GLJ O;  1Q18 A;  3NH2 A;  4BDZ A;  4I9L A;  1YXQ A;  3EN9 A;  4DTJ A;  1NGC A;  2EWS A;  3R3L A;  3L0Q A;  1QVF M;  4YY3 K;  4KO0 A;  3ZYY X;  1GLB G;  2IVN A;  5C25 A;  2BAN A;  2KZZ A;  4E1M A;  3CPE A;  3RR8 A;  4K8Z A;  4H03 B;  3O80 A;  2E88 A;  2UUB K;  1EQY A;  4X64 K;  1NJI O;  4NYF A;  3LPU A;  2HHX A;  4CGJ A;  3Q7C A;  4CJQ A;  2HBL A;  4HCC A;  4UQG A;  2CGK A;  2GUP A;  2UXD K;  3CIP A;  2FBX A;  1ZBI A;  1BWF O;  4BR5 A;  5AQM A;  1MWK A;  3MN9 A;  4H0X B;  4I9Q A;  1NGD A;  2GWJ A;  4DG1 A;  4QAG A;  4LSN A;  1TKT A;  1ASV A;  4H4M A;  2ITG A;  3J80 O;  4B9V A;  1NK0 A;  1A5V A;  4JI4 K;  4MDB A;  4W5R A;  1N34 K;  4NCG A;  3C65 A;  2E6M A;  4JHD B;  2ZGY A;  2CGJ A;  2A5X A;  2HF3 A;  2YHA A;  1LCU A;  4H5R A;  3TSQ A;  1Q82 O;  3CQ8 A;  4KHQ A;  4B3O A;  2IC3 A;  3V9X A;  1HYZ A;  1RCH A;  2GX9 A;  5ADX H;  5BN9 A;  2ZM6 K;  1NGI A;  2IVO A;  4B8A B;  2Q0R A;  1RT3 A;  3H3N O;  3SJH A;  5KPT A;  1I94 K;  4CF8 A;  4O0J A;  4DFJ A;  4JI0 K;  2HHS A;  5EY4 A;  4LF6 K;  3H08 A;  3K5M A;  3V1R A;  2NRV A;  1S22 A;  4R79 A;  2HHW A;  1YF5 L;  1NJX A;  3CJ1 A;  4BR4 A;  2FC0 A;  4CI6 A;  4M3U A;  1YVN A;  4OLA A;  4CJF A;  1VAZ A;  3OYL A;  2HST A;  3G10 A;  4A61 A;  3QER A;  3VEX A;  4FJH A;  1VSL A;  2OCE A;  2RHK A;  1BDG A;  4WYB A;  3VQ4 A;  1U49 A;  2IDO A;  1X3N A;  2ZF5 O;  3LP0 A;  3NGZ A;  1NK4 A;  1VRU A;  2E4L A;  4CHQ A;  1C1B A;  2HND A;  4YDU A;  3SNN A;  3DLR A;  2BDP A;  1L3T A;  5AQU A;  2IVP A;  3CER A;  1J53 A;  5C2F A;  2BE2 A;  1TAQ A;  1HNV A;  1TKZ A;  3O9T A;  3CC2 N;  2KLA A;  1ATN A;  2NRX A;  3WXI A;  3H6E A;  4Y1C A;  4KHY A;  4OPA A;  1OH5 A;  3MED A;  2QTD A;  4W5Q A;  4EZ9 A;  3J8A A;  2P5O A;  2W6L A;  3C6H A;  3OS0 A;  3QEX A;  1WNS A;  4AM6 A;  3DRS A;  4OKK A;  1C0F A;  4BVP A;  3TSU A;  4E7J A;  5LMN K;  1WB9 A;  3RWU A;  4M41 A;  5TKY A;  3FE1 A;  1N36 K;  3WEE A;  3VET A;  4B9T A;  4Z4H A;  3D2F B;  1VRT A;  2F9T A;  4LFB K;  2O8D A;  4CHN A;  4QS8 A;  4AHC A;  4EHT A;  4DU1 A;  3P38 A;  4MQ3 A;  1S3X A;  4JKF A;  4KKO A;  3CQX A;  1IJJ A;  3P39 A;  1IBL K;  4M42 A;  4FWQ A;  3MEG A;  3GOI A;  4AHU A;  4J2E A;  4FJM A;  2QKB A;  1N32 K;  3TAE A;  4DSL A;  3UKU B;  3OYB A;  1SKW A;  3QB0 A;  4MFB A;  5EVZ A;  1NKB A;  4LY7 A;  4JLH A;  2PBD A;  4ILG B;  2GV9 A;  4CJW A;  1I39 A;  3KLF A;  4JD2 A;  2X6N A;  3HTV A;  2BTF A;  4DR3 K;  2RN2 A;  3MCP A;  2XRI A;  3ZX0 A;  3I0S A;  2Q97 A;  2VGN A;  5AFU A;  1NK9 A;  3VQQ A;  2JLE A;  3H1V X;  4BGA A;  4PKI A;  2FBV A;  1KSP A;  4DQP A;  4CFA A;  5LJV A;  4JI1 K;  2DTU A;  5LL6 Z;  4CK3 A;  4FJL A;  4MDA A;  4RW6 A;  1HR0 K;  2ITM A;  3JSM A;  1IKW A;  3ATV A;  4ILJ A;  4GKJ K;  1O1W A;  4BC4 A;  4CBW A;  3DMJ A;  3PIO L;  4PHT X;  1VSE A;  3HO1 A;  4KI4 A;  1HYS A;  4JRP A;  4BRH A;  4DFM A;  2VQF K;  3IRX A;  2P9K B;  3R1X A;  5AQO A;  1K8K A;  1RT5 A;  1J6Z A;  2IS3 A;  3AVJ A;  4WQ5 A;  3JS6 A;  3CCV N;  4DUZ K;  2ZQB A;  3V9U A;  1SL2 A;  4FYD A;  3HXM A;  3EZ5 A;  4X62 K;  1GLA G;  1KVC A;  2J4R A;  1Q7Y O;  4BDP A;  5BPL A;  5F0X A;  3BY5 A;  3U9D A;  2GBZ A;  4DTX A;  3NH1 A;  3A5M C;  4JS4 A;  4CZM A;  3LM9 A;  3C6U A;  4LH4 A;  5AQX A;  4RW4 A;  5T7B A;  5DK5 A;  2GEM A;  3HZ6 A;  5ADX A;  4CJ7 A;  1LWC A;  4KHP K;  4BRQ A;  4BRI A;  4FLT A;  2A41 A;  2NNW A;  3HM9 A;  1TAU A;  3PUF A;  5KTQ A;  3U8X A;  3R9P A;  3KLH A;  5HP1 A;  3VF2 A;  3QIP A;  2KFN A;  4DS5 A;  4CE9 A;  2QXL A;  3VTH A;  1TYQ A;  3N4Q A;  1VQ6 N;  2G8H A;  3ULE A;  2E20 A;  3L2R A;  5FPM A;  4FXD A;  3AAR A;  4CHP A;  1NGH A;  4PWD A;  2HVI A;  5AQT A;  1BQN A;  1OH8 A;  1V4S A;  3CM5 A;  1ESV A;  1QHT A;  2YJE A;  1CZA N;  3U9Z A;  3AAQ A;  4PA1 A;  3CCU N;  4FW1 A;  4DFK A;  4GV9 A;  1HRH A;  3CJC A;  3TWH A;  3I8D A;  4DSI A;  1Q8I A;  4DQ8 A;  5JVG L;  4Y1D A;  5AR0 A;  3THX A;  2BGG A;  2YHY A;  4GW6 A;  1YJ9 N;  4RW7 A;  4BRC A;  1I3A A;  3CCS N;  4YOX A;  3G4S N;  3QEV A;  2G8V A;  4CEF A;  4CD1 A;  1YAG A;  2YV0 X;  1SKS A;  1E4G T;  4CEO A;  3SV4 A;  4K0K K;  2P9I A;  3FFK B;  5KI6 A;  4DV6 K;  3V9Z A;  1B92 A;  3FZL A;  1B9F A;  3VTI A;  3K9K A;  3LZI A;  2DPN A;  1NJZ A;  1GOB A;  4CBX A;  1D4X A;  4H4O A;  4DS4 A;  3KZB A;  5K14 A;  3KHY A;  4FK4 A;  4JYA K;  4FJK A;  4O5F A;  1FW6 A;  3HPG A;  1KAX A;  1W0H A;  2BUP A;  3CCE N;  1X9J A;  2EX3 A;  3LAN A;  4F4K A;  1UWB A;  3CPW M;  1U47 A;  1N5Y A;  3HK2 A;  2PYL A;  3THW A;  1QSS A;  2VWB A;  3ZEU A;  2NRW A;  4LSL A;  4B9M A;  2QWQ A;  2HHV A;  3K9J A;  1U04 A;  3LAL A;  5H1S Q;  5M1P A;  3CET A;  3V1O A;  2ASO A;  3VF4 A;  5AZJ A;  1LWE A;  3CFP A;  3NDK A;  3VN5 A;  3V81 A;  2P9L A;  3A2F A;  5AQH A;  4FOE A;  4DFP A;  2Z1G A;  2HW3 A;  3RR7 A;  2D4W A;  3L6Q A;  4JK7 A;  4AIL C;  3QBW A;  3W0L A;  2D0P A;  3MDQ A;  3CXC M;  4A59 A;  4ISF A;  2QXF A;  2GWK A;  3DXK A;  1KQS M;  1WSF A;  4RG8 A;  4Q0B A;  3WT0 A;  1KFD A;  1GOC A;  3NE6 A;  3S9H A;  3MXI A;  3SQ0 A;  3CM6 A;  5AQQ A;  4FJG A;  2OPQ A;  3B8A X;  3QET A;  3EE8 A;  4CJE A;  4DR6 K;  2QWP A;  3CJ7 A;  3HP6 A;  3SUN A;  4PQU A;  1QS4 A;  2O8C A;  4F2R A;  3HOT A;  4NCA A;  3DJC A;  2YKN A;  3OYK A;  4J2B A;  4YOR A;  3NAE A;  1VQP N;  4ELU A;  4FK2 A;  2A6A A;  4H5T A;  1VQ7 N;  4B1Z A;  2P9S A;  5HRR A;  3VQC A;  4O0I A;  5CY4 A;  3CJ9 A;  1KRP A;  4IFV A;  5AZI B;  2HHQ A;  1RTH A;  4DSJ A;  4CZG A;  4BC3 A;  4BRP A;  5KPR A;  4B8C A;  1KCF A;  2ATQ A;  3D2E B;  4DQS A;  4M3R A;  2OA8 A;  2XY5 A;  2QKK A;  4DV2 K;  3FZK A;  3CD6 N;  1RNH A;  2Z1H A;  3UB5 A;  3VQE A;  1BIS A;  5HBM A;  4IOC L;  3HL8 A;  4JKG B;  4DUY K;  3O1W A;  4B1Y B;  1CLQ A;  4IXC A;  4QS9 A;  4O8U A;  4JS5 A;  1IG8 A;  3MN6 A;  3E1Y A;  1NOZ A;  4DHY A;  1S6P A;  1K6Y A;  1WSG A;  4CEZ A;  3MEC A;  3GE1 A;  1YJN N;  3PLA A;  5I9E B;  5CZ1 A;  3ULD A;  2ZD1 A;  4DU3 A;  3IG1 A;  3THY A;  3HPH A;  1D8Y A;  3EZW A;  3C0B A; 
#chains in the Genus database with same CATH homology
 4BG8 A;  5M1F A;  5EY4 A;  2YI1 A;  3VER A;  1HLU A;  4KH4 A;  1BA1 A;  5AZJ B;  3R6M A;  3R8E A;  4A2A A;  4WF9 L;  1LOT B;  2NRV A;  1S22 A;  4R79 A;  1JCG A;  3LDO A;  1VQ5 N;  1YF5 L;  4FWP A;  3VF6 A;  2P9N A;  4CZH A;  1ZBS A;  1GLF O;  3CJ1 A;  3WXK A;  5JLH A;  3DAW A;  4BR4 A;  1OVY A;  4JKH A;  3U4L A;  1SZ2 A;  2E8A A;  4CI6 A;  4BQL A;  1YVN A;  2YHX A;  2PAV A;  4AF1 A;  5C15 A;  1VAZ A;  5CE3 A;  4YOY A;  3O08 A;  3CME N;  5BPN A;  2HST A;  5AQW A;  2Q31 A;  3FLC O;  3F9M A;  5M1Q A;  3ZET B;  4BC2 A;  4A61 A;  3VEX A;  3VOV A;  5BRE A;  3L4Q A;  2RHK A;  4JKD A;  1BDG A;  3ENO A;  3NVM A;  4WYB A;  1KXP A;  4BR7 A;  3CCJ N;  1X3N A;  3DXK B;  2ZF5 O;  3MMV A;  2NRT A;  3C7N A;  4OO1 J;  1ZC6 A;  1DKG D;  1M1K O;  1T3V A;  4BRD A;  2IIR A;  2WFB A;  3VPZ A;  3WQT A;  3F2K A;  5AQI A;  1QQM A;  5MLC Q;  4YDU A;  4BY9 C;  1VQM N;  2QWO A;  4QS7 A;  4ILH A;  5AQU A;  4C1N I;  3G6E N;  3LL3 A;  2IVP A;  4XEI A;  3CER A;  3VEN A;  3MCA B;  4K25 A;  4O8K A;  5AQJ A;  5C2F A;  4BR9 A;  4EHU A;  3O4W A;  3CCR N;  1JCF A;  2HOE A;  4WQ4 C;  1BA0 A;  3O9T A;  1XC3 A;  2P9K A;  2KHO A;  3CC2 N;  4C1N K;  4M63 C;  3QIC A;  2QW9 A;  2KLA A;  4BRG A;  1YI2 N;  1ATN A;  2NRX A;  3WXI A;  3IFR A;  3H6E A;  3G71 N;  5KPZ A;  3CJB A;  3VGL A;  1VQ9 N;  5CR4 A;  3T69 A;  5AQZ A;  4CZL A;  4OPA A;  1HKG A;  2P9S B;  1YHQ N;  3LDN A;  3I56 N;  2QTD A;  3TPQ A;  3J8A A;  1W97 L;  1MA9 B;  3LDQ A;  4BRF A;  4WFB L;  3KWG A;  2ZGZ A;  4FOI A;  4FL9 A;  3C6H A;  5AQR A;  1GLC G;  3IUC A;  4AM6 A;  4JAX A;  1HX1 A;  4KBO A;  1C0F A;  3HI0 A;  4BVP A;  4WFN L;  1GLL O;  4H5W A;  3TSU A;  2KKZ A;  1XUP O;  2V7Y A;  4B1W B;  3DXM A;  4HWI A;  1P8Z A;  3FE1 A;  1NM1 A;  5TKY A;  1YIJ N;  3WEE A;  3ENB A;  4OPH A;  3VET A;  4RCH A;  1ZXO A;  3D2F B;  5GIO A;  4JN4 A;  4KH6 A;  4F9O A;  2F9T A;  4XH4 A;  4BRA A;  3A5L C;  3ENH A;  2NRH A;  3SBT A;  4QS8 A;  3D6R A;  3DWL A;  1Z6R A;  4I6M A;  4E1J A;  3A5N C;  2CGL A;  4EHT A;  3P38 A;  1NGG A;  1KAY A;  3BF1 A;  3VEW A;  1S3X A;  3EO3 A;  3HSC A;  5AQV A;  4JKF A;  1W2B M;  2FSJ A;  3CQX A;  1IJJ A;  4IEI A;  5FPD A;  3P39 A;  3EKU A;  3OA9 A;  1T6C A;  3FZM A;  4JD2 B;  4WQ5 C;  3VEY A;  5GIN A;  4FWQ A;  4PKH A;  3GOI A;  3GBT A;  3O9S A;  4FWS A;  3OBY A;  1SQK A;  1YIT N;  3UKU B;  4BRO A;  2QWL A;  4WQ4 A;  2JWL A;  3QB0 A;  5EVZ A;  1RGI A;  5FPE A;  2YJF A;  3J7Z O;  3G25 A;  3NMU A;  2PBD A;  4ILG B;  3QML A;  1NGJ A;  1P90 A;  4LC9 B;  1HUX A;  2E2Q A;  2P9N B;  1MDU B;  4JD2 A;  4FPA A;  2E1Z A;  3HRG A;  4H0O A;  3CQY A;  4BQZ A;  2QWR A;  4IDH A;  3HTV A;  2BTF A;  5M1K A;  1DGK N;  1ATS A;  3CCQ N;  4JNE A;  2VYP A;  3MCP A;  4ISG A;  2BH1 A;  4U7B A;  3ZX0 A;  5AFU A;  2Q97 A;  2VGN A;  4FSV A;  4B1U B;  3H1V X;  4BGA A;  4PKI A;  1C0G A;  4BRE A;  5LJV A;  2W41 A;  1KAZ A;  3CHW A;  4WCE L;  3C7N B;  4JK8 A;  3FZF A;  1NWK A;  3L4I A;  2QM1 A;  4EAH D;  4MDA A;  2ZWH A;  5KQD A;  3IMX A;  2ITM A;  3AGK A;  2ZJP L;  4H5N A;  5DM6 L;  3E9L A;  4JKB A;  1U2V A;  3ATV A;  4GY2 B;  1KD1 O;  4ILJ A;  4DKW A;  5AQF A;  4CZK A;  4BC4 A;  4A2B A;  4CBW A;  3PIO L;  4PHT X;  2I7N A;  3OHR A;  2HBJ A;  5JLF A;  5AQY A;  4EFH A;  2ASP A;  4JKC A;  3SMS A;  1BO5 O;  4BRH A;  3HBT A;  5AQK A;  4WFA L;  4G9Z A;  3SLC A;  3I8B A;  3W3D A;  5JMV A;  3SAG A;  3ZX2 A;  5BR9 A;  2P9K B;  3WUH A;  3R1X A;  5AQO A;  1K8K A;  2GEL A;  3WQU A;  3ZX3 A;  5BRF A;  2ZJR L;  1J6Z A;  1VQ8 N;  1NGA A;  4WQ5 A;  4AM7 A;  3CF5 L;  3JS6 A;  3CCV N;  2QWN A;  3RSE A;  4GV3 A;  4JK9 A;  5DM7 L;  4UY8 O;  2Q1N A;  1XQS C;  2FLO A;  4YOW A;  1NBW A;  1JCE A;  1GLA G;  3WXJ A;  5GAH P;  3MK6 A;  3SMP A;  3M3Z A;  2RE2 A;  2J4R A;  1Q7Y O;  5BPL A;  1VQO N;  5F0X A;  1DT9 A;  1Y64 A;  4XH1 A;  3U9D A;  3EL2 A;  1KC8 O;  1U6Z A;  1N8R O;  4IJA A;  3UKR A;  5LJW A;  3A5M C;  1E4F T;  5EOY A;  4PKG A;  3FGU A;  3FZH A;  4CZM A;  3LM9 A;  2Q2R A;  2Q36 A;  1MWM A;  5AQX A;  4IO9 L;  4YOT A;  4YOV A;  3DXM B;  4MLH A;  5EX5 A;  3CJA A;  2WC9 A;  1BG3 A;  1QZ5 A;  2GEM A;  3H45 C;  3WEE B;  5M1O A;  5F2R A;  3HZ6 A;  3KVG A;  5ADX A;  1DEJ A;  4CJ7 A;  3MWT A;  3VGK A;  1YUW A;  4BRQ A;  4BG9 A;  4BRI A;  2A41 A;  3MX2 A;  2NNW A;  3CI5 A;  5HOO A;  4DCH A;  1RDW X;  3EE9 A;  4K43 A;  3R9P A;  3U8X A;  3ID6 A;  4I6M B;  3KWI A;  3QFU A;  1NGB A;  5C10 A;  4BRL A;  3VF2 A;  1T44 A;  3IDH A;  2QXL A;  3VTH A;  1TYQ A;  4ISE A;  4CZJ A;  1K9M O;  4L3Q A;  3SAH A;  3E9O A;  3N4Q A;  1VQ6 N;  3HM8 A;  1WOQ A;  2ASM A;  3ULE A;  3TU5 A;  2E20 A;  3CC7 N;  1R59 O;  3NVK A;  3AAP A;  4IWV A;  3HOS A;  5FPM A;  3I55 N;  2E1Y A;  5B8H A;  2PFU A;  3I33 A;  3AAR A;  3TTC A;  1GLD G;  5AFU H;  4NLB A;  1NGH A;  5AQT A;  2A40 A;  4Y0W A;  4FVU A;  1OKJ A;  2E2O A;  2E2P A;  1V4S A;  4H0V B;  3O5B A;  1WUA A;  2P9U A;  1ESV A;  2E2N A;  2YJE A;  2NZT A;  1CZA N;  4IZ9 A;  5AQP A;  3U9Z A;  1H1V A;  4GVE A;  1ILY A;  2YHW A;  2QWM A;  1ATR A;  3AAQ A;  3A8Y A;  3T7Z A;  2HBM A;  3CCU N;  4B9Q A;  2P9P A;  3BP8 A;  4M7Y A;  3FR0 A;  4GV9 A;  4CBU A;  3CJC A;  3S41 A;  5LY3 A;  4CZE A;  2VGM A;  3N4P A;  4DQ8 A;  5JVG L;  5AR0 A;  4CZF A;  2YHY A;  4FO0 A;  5CHI A;  4JEP A;  1YJ9 N;  2HF4 A;  3GG4 A;  4BRC A;  4CZI A;  4M7X A;  4DB3 A;  5E26 A;  4U67 L;  1X3M A;  3CCS N;  4YOX A;  3G4S N;  4H0Y B;  1S72 N;  5ELZ A;  3CCM N;  4PL8 A;  1VQL N;  2W40 A;  3IKM A;  3H1Q A;  1TUY A;  5KQ8 A;  2NRR A;  3A0I X;  5AZI A;  4FWK A;  2D0O A;  4CD1 A;  5GAD P;  1YAG A;  1HKC A;  3BUZ B;  1U2V B;  4FWN A;  4BR0 A;  5BRD A;  3E9P A;  5AQG A;  1EO1 A;  2I7P A;  1E4G T;  2V52 B;  3D2E A;  3QFP A;  3H46 O;  1G99 A;  3VES A;  4A5B A;  5JIC A;  4RWT A;  2P9I A;  3FFK B;  3FZL A;  3AY9 A;  1VQK N;  3VTI A;  3O6W A;  3K9K A;  3SAF A;  1K8K B;  4BR2 A;  5GAG P;  5AQN A;  4JKG A;  2DPN A;  5C0Y A;  3GDQ A;  2JWK A;  4PL7 A;  1NGF A;  4CBX A;  3RSE B;  2VCP A;  4BRK A;  1D4X A;  4NO7 A;  1TUU A;  3RVC A;  3KZB A;  3M1F A;  3KHY A;  2YX6 A;  5TKW A;  4K42 A;  1HJO A;  5AQL A;  3A5O C;  1NGE A;  4O5F A;  1QVG M;  2FF6 A;  2QA4 N;  2A42 A;  1KAX A;  2BUP A;  4BVO A;  3CCE N;  3BEX A;  3UKR B;  1X9J A;  4JHD A;  3VGM A;  4A62 A;  3P31 A;  2V7Z A;  2NLX A;  3MN5 A;  2P9L B;  3CPW M;  3VEV A;  4BRN A;  1YJW N;  3OBW A;  1QQN A;  2VWB A;  3JXU A;  2NRW A;  3ZEU A;  2QWQ A;  1QHA A;  3TSP A;  3O8M A;  2D1K A;  1HPM A;  3K9J A;  3H3O B;  2FSK A;  4MO4 A;  2FSN A;  5HL7 L;  5H1S Q;  5E84 A;  5M1P A;  4JKA A;  3QDK A;  1GLE G;  2FXU A;  2V51 B;  3AGR A;  3CET A;  2ASO A;  4EIA A;  1K8A O;  1BU6 O;  1BOT O;  3VF4 A;  5AZJ A;  3KK7 A;  5M1N A;  3ID8 A;  1V4T A;  2NRZ A;  2P9L A;  5AQH A;  4FOE A;  4IOX A;  2OTL N;  2OTJ N;  4H0T B;  4IO8 A;  4KH5 A;  2UYT A;  2D4W A;  2GTD A;  3L6Q A;  4JK7 A;  4A57 A;  4YOU A;  1NLV A;  1TYQ B;  3CC4 N;  3ZET A;  3QBW A;  3W0L A;  2D0P A;  3CMA N;  3MDQ A;  3CXC M;  3ULE B;  4A59 A;  4ISF A;  3DLL L;  3Q7B A;  4B1V A;  1K73 O;  3ATU A;  2YCH A;  3SBG A;  4GV6 A;  4JKE A;  2GWK A;  3DXK A;  1RDU A;  2FF3 B;  1KQS M;  3O1B A;  3VMF B;  4A5A A;  5BPM A;  4C23 A;  1BUP A;  4FPB A;  4B1X B;  3WT0 A;  2AP1 A;  3TTD A;  3M5R A;  2H3G X;  4K41 A;  3OW2 M;  2P9U B;  2AA4 A;  5AQQ A;  3O9U A;  2F7T A;  1JJ2 M;  4IEE A;  3B8A X;  1RFQ A;  2WBN A;  3EE8 A;  3D7E O;  3GL1 A;  2ZJQ L;  2QEX N;  3TTF A;  3F5T A;  4HTL A;  3CCL N;  1GLJ O;  1Q18 A;  2QWP A;  3CJ7 A;  2P9P B;  4GNI A;  2QI2 A;  2HMP A;  4IOA L;  4CD3 A;  3HOT A;  1YXQ A;  3WXM B;  3EN9 A;  1Q81 O;  3DJC A;  1NGC A;  3MX5 A;  4BGB A;  2EWS A;  3R3L A;  2OAN A;  4YOR A;  3WXL A;  3L0Q A;  1QVF M;  1VQP N;  4Z94 A;  3ZYY X;  1GLB G;  2IVN A;  3O9Q A;  3LDL A;  2A6A A;  3C6A A;  4H5T A;  4BC5 A;  1VQ7 N;  4B1Z A;  2P9S A;  1Q86 O;  3MN7 A;  3P4I A;  3CPE A;  3CJ9 A;  2F9W A;  4H03 B;  2WUS A;  5FPN A;  2CH6 A;  2E88 A;  3O80 A;  4NB4 A;  5AZI B;  1EQY A;  1SS6 A;  3VEO A;  1HKB A;  3O9R A;  4CZG A;  4IFE A;  5F1X A;  4BC3 A;  4BRP A;  5KPR A;  1NJI O;  3EKS A;  3D2E B;  3Q7C A;  5EXW A;  1SAZ A;  2HBL A;  2CH5 A;  1O13 A;  2P9I B;  3FZK A;  3CD6 N;  2CGK A;  2A3Z A;  2GUP A;  4MO5 A;  3CIP A;  1BWF O;  3UB5 A;  4BR5 A;  5GIP A;  5AQM A;  1MWK A;  5C2D A;  3MN9 A;  4IOC L;  5BRH A;  4H0X B;  3D2F A;  4JKG B;  1NGD A;  3SK3 A;  4YDU C;  2GWJ A;  4H0P A;  3LM2 A;  3O1W A;  4B1Y B;  5BN8 A;  4RTF D;  1T6D A;  4IXC A;  3PIP L;  1VQN N;  4QS9 A;  4O8U A;  5JVH L;  1Z05 A;  4FWL A;  4MLE A;  1IG8 A;  2Q0U A;  3MN6 A;  1QZ6 A;  4J8F A;  1NMD A;  3E1Y A;  4MDB A;  3QBX A;  1VQ4 N;  3VEZ A;  3E66 A;  4NLC A;  4FWO A;  3C65 A;  4DHY A;  4BRM A;  3LDP A;  2ZGY A;  4JHD B;  1QQO A;  2A5X A;  2CGJ A;  2HF3 A;  1LCU A;  4H5R A;  5AQS A;  3TSQ A;  5GAE P;  1Q82 O;  4IJN A;  3BF3 A;  3M6G A;  4FWR A;  3GE1 A;  1YJN N;  3MWP A;  2GX9 A;  5I9E B;  5C12 A;  3ZEU B;  5ADX H;  3PLA A;  4FWM A;  5BN9 A;  1NGI A;  2IVO A;  4XH5 A;  3UKU A;  2Q0R A;  3H3N O;  2HBK A;  3SJH A;  5KPT A;  1M90 O;  3EZW A;  4H5V A;  3UE5 A;  3C0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...