4BR7A

Legionella pneumophila ntpdase1 crystal form i, open, ampnp complex
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
356
structure length
356
Chain Sequence
PCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 116
structure length 356
sequence length 356
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4br7A01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4br7A02
2P9SB 3B8AX 1XQSC 3CHWA 3FZHA 3I33A 3C0BA 1LCUA 4H0XB 4BRGA 2FF6A 2FSNA 3VEOA 4FWRA 4JD2A 3CJ1A 3D2EA 5AQXA 1RFQA 4QS7A 4BRPA 4WQ4A 3D2EB 1D4XA 5EXWA 5AQJA 3FLCO 3VGKA 2NLXA 1WOQA 1SZ2A 4O5FA 4BRFA 5AZIA 4BRCA 4FWQA 3UKUA 1BA0A 5AZIB 2A42A 3UKUB 2V51B 3KZBA 2D0PA 4K42A 1IG8A 3ULEA 1S3XA 3RSEA 2FF3B 4A62A 3ULEB 3VEXA 4CI6A 3VOVA 5CE3A 4EHUA 3MN5A 2E1YA 4L3QA 1MA9B 2BTFA 1QQOA 2QWLA 3GG4A 3CJ7A 3QDKA 1V4SA 1NWKA 2ZGYA 4CZHA 4PKHA 2QWOA 3DWLA 4CZLA 4CZIA 2P9NA 3DJCA 1NLVA 3A5NC 1HPMA 2P9NB 4FWKA 1HUXA 4CBXA 2YCHA 3MN9A 3QMLA 2IVOA 5TKYA 3ATUA 3A8YA 3GBTA 4A2BA 2Q36A 3M1FA 4BG9A 1KXPA 4C23A 5BPLA 2CGJA 5AQZA 1NM1A 1T6DA 2PAVA 2NRHA 2E88A 3MCPA 2OANA 3H46O 2P9KA 4J8FA 3W3DA 3QICA 5FPEA 1U2VA 4RWTA 2P9KB 3VERA 2E2NA 4IJNA 4HTLA 2HOEA 3O1WA 1NGGA 4WQ4C 4AM6A 1E4GT 4BGAA 3VEWA 4B1XB 2P9IA 5AQTA 1HX1A 5EVZA 3ZX0A 1E4FT 2P9IB 1BUPA 2P9UA 5AQOA 3VEYA 1GLFO 1BWFO 2P9UB 2YHWA 3ZX3A 3DXMA 1BOTO 3VF6A 2YI1A 4H0VB 3FE1A 1K8KA 3DXMB 4MO5A 2QWNA 1K8KB 4H5RA 2F9WA 2P9PB 2GWKA 3CIPA 3HM8A 4A61A 4H0TB 4H5WA 3CJ9A 4K43A 4M63C 3HBTA 3QFUA 4CZGA 5BRDA 1BA1A 2QM1A 5FPNA 2GUPA 2KHOA 3VEZA 4DCHA 4FOEA 1ATNA 2GTDA 4PL7A 3CJBA 2A3ZA 2HMPA 4IWVA 4BG8A 4BC4A 2Q0RA 4K41A 4JNEA 4H5NA 5AFUH 4BRAA 2D1KA 4BRHA 4H0OA 4DHYA 4EAHD 3FZKA 4BGBA 4EFHA 3H45C 2CGLA 1J6ZA 1NGCA 2PBDA 1MWMA 2HF4A 3GL1A 3ENHA 4FWSA 4QS8A 4BR2A 5AZJA 3F9MA 3ZX2A 1YAGA 2FSKA 5AZJB 3S41A 4BROA 4CD3A 4FL9A 5AFUA 2Q0UA 3MN7A 2VYPA 4RCHA 2FLOA 2J4RA 4WQ5C 4ISFA 5AQRA 3CQYA 2YHYA 3QB0A 1YVNA 3I8BA 2A6AA 3FGUA 3VGMA 1HKBA 3U4LA 1V4TA 1NGIA 2ASPA 2Q2RA 4JD2B 3O6WA 3UB5A 5JLFA 3DAWA 1X9JA 4CBUA 1GLCG 4B9QA 1X3MA 5LJVA 1HKCA 3CERA 3AAPA 4BRNA 1QZ5A 3MK6A 2ZWHA 4XEIA 2GEMA 1XC3A 2IVPA 5AQKA 2ZF5O 1QQMA 4DB3A 2GWJA 4IXCA 1IJJA 3RSEB 1WUAA 3H3NO 1Z05A 2Q1NA 1GLJO 3G25A 4KBOA 4M7XA 2E8AA 3L4IA 3BF1A 4FO0A 4MLEA 4FWLA 1C0GA 1YXQA 3M3ZA 3HZ6A 3ENOA 3AY9A 3FZMA 5E84A 1DKGD 5AQYA 3TPQA 3OHRA 3VETA 1NGBA 5ELZA 5AQQA 3O8MA 5LJWA 3P4IA 4B1YB 5F0XA 4PKGA 1X3NA 3R6MA 4JHDA 2Q31A 3A5MC 4JN4A 4BREA 5KPTA 4JHDB 1T44A 4QS9A 4B1WB 3M6GA 4BVOA 3O80A 2UYTA 1C0FA 1QHAA 4XH5A 5EX5A 4FWPA 3AAQA 4CD1A 4BRMA 1U2VB 2I7PA 3SK3A 3H1QA 1TYQA 5AQLA 3VEVA 3BEXA 1TYQB 5AQGA 3SMPA 3UKRA 5JLHA 5F2RA 3BF3A 3DXKA 3UKRB 3H3OB 2CGKA 3LL3A 5KQDA 4GY2B 4H5VA 4I6MA 3VF2A 3DXKB 3CI5A 3WXKA 2QWPA 1Q18A 4I6MB 1XUPO 2ITMA 3L0QA 4EHTA 2D4WA 3R8EA 1GLAG 1H1VA 1NGDA 4A2AA 5AQHA 3U9ZA 3CETA 3JXUA 2A40A 4B1ZA 2AA4A 3ID8A 2F9TA 3LM9A 3FZLA 4IJAA 2V7YA 1TUUA 4BVPA 5ADXA 1RGIA 3O4WA 4BR9A 3EKUA 1QZ6A 2H3GX 4NB4A 5EOYA 5AQSA 1BO5O 4FWMA 4AM7A 1RDWX 3O1BA 3SMSA 4BC2A 3A5LC 1DGKN 2QW9A 4MO4A 5B8HA 4FOIA 2P9LA 2ASOA 3WQTA 4CZJA 3ZETA 2P9LB 1GLDG 2V52B 4M7YA 4BR5A 3ZETB 5AQNA 1ATRA 1BU6O 3HSCA 3J8AA 3WXLA 5AQPA 1SAZA 3BUZB 5JMVA 4PKIA 1NGEA 4CBWA 3VESA 5JICA 1CZAN 4H0YB 2D0OA 2YJEA 3TU5A 3WEEA 1S22A 3EO3A 2E2QA 1NGAA 2QWQA 3WEEB 3GE1A 1OKJA 1HJOA 5AR0A 3L6QA 3MDQA 5BRHA 2Q97A 4XH1A 3U9DA 3WQUA 3HTVA 4GNIA 1GLBG 2EWSA 4HWIA 3QBXA 2IVNA 4FPAA 4BC3A 3VPZA 2V7ZA 2VWBA 3EN9A 1EQYA 4FWNA 1GLEG 1LOTB 4PL8A 4NO7A 4H5TA 3CQXA 1U6ZA 2YJFA 4BQZA 2AP1A 4E1JA 1Z6RA 4CJ7A 5KPZA 3ATVA 1JCFA 1R59O 2A5XA 4BQLA 3EZWA 1KAXA 1ZBSA 3MN6A 4JAXA 4BR0A 4CZKA 3FFKB 4IO8A 3WXIA 5BN8A 2FSJA 3VF4A 2I7NA 5BPNA 3LDLA 5LY3A 5BN9A 2E2OA 4K25A 2A41A 3SLCA 3IDHA 4YDUC 2CH5A 2YHXA 5KQ8A 4BC5A 3FZFA 1ATSA 3QFPA 5FPDA 5KPRA 5I9EB 1YUWA 5AQUA 1NGHA 3QBWA 5EY4A 3AARA 5BPMA 1KAZA 3C7NA 2E20A 1KAYA 1TUYA 3C7NB 3UE5A 3BP8A 1HKGA 2W41A 4H0PA 2GELA 4IZ9A 1MDUB 2E2PA 5BRFA 2CH6A 3R9PA 2ASMA 3U8XA 2BUPA 3IFRA 1G99A 2NZTA 2ZGZA 2IIRA 3WUHA 5AQMA 3LDNA 1QQNA 4CZMA 5ADXH 2QWMA 2DPNA 2QWRA 4Z94A 4BR4A 4MLHA 5BR9A 4BRIA 1BG3A 1NMDA 3CJCA 3HI0A 3A0IX 3SJHA 4BRQA 5BREA 4FWOA 3VGLA 4O8KA 3GOIA 4WQ5A 4XH4A 4F9OA 3IUCA 3O08A 5E26A 3KVGA 1SQKA 2FXUA 1HLUA 2E1ZA 3MMVA 1ZC6A 4CZFA 4B1VA 3LDQA 3O5BA 3EL2A 4ISGA 3IMXA 1NGFA 1JCGA 4H03B 1P8ZA 3ZEUA 3H6EA 2WUSA 3ZEUB 2P9PA 4FPBA 3WXJA 1NBWA 5AQIA 4YDUA 3CJAA 2W40A 1DEJA 4B1UB 3WT0A 3W0LA 4RTFD 2HF3A 3KHYA 5AQWA 3A5OC 4BRDA 1ESVA 1ZXOA 2QXLA 1Y64A 3EKSA 3LDPA 5FPMA 4BR7A 1GLLO 3VENA 3LDOA 4WYBA 4CZEA 3D2FA 4BRLA 1BDGA 3D2FB 3LM2A 5F1XA 4BRKA 4Y0WA 1MWKA 3GDQA 2VCPA 1T6CA 3JS6A 4LC9B 1JCEA 5AQVA 3FR0A 3H1VX 4FSVA 3D7EO 4EIAA 1NGJA 5AQFA 2P9SA 4ISEA 4DQ8A
chains in the Genus database with same CATH superfamily
2P9SB 4FJLA 4OPKA 3CHWA 1VQ6N 3SI6A 4FZXC 4B9TA 3VA3A 1XMQK 4JD2A 1GOBA 3D2EA 4X66K 1RFQA 3V9WA 3MCAB 4FXDA 3AVFA 4C8MA 5EXWA 5AQJA 3FLCO 3VGKA 2NLXA 1WOQA 1VSKA 3CCJN 3EY1A 1NK6A 4LF6K 1JLQA 1SKWA 3TAPA 5C25A 1YIJN 1S72N 3ASMA 1ZBHA 3UKUB 4AQYK 4A62A 3VEXA 4CI6A 4EHUA 4FLUA 3MN5A 2JWKA 1XC9A 3CJ7A 4NCGA 1V4SA 1WBBA 1XWLA 4YOUA 1C1CA 4CZHA 3R1XA 3NH1A 3DLKA 3VTIA 3KLIA 1VSJA 3A5NC 4FWKA 5HL7L 3SV4A 2D0CA 2GBZA 2IVOA 1C0TA 3ATUA 4B9LA 4A2BA 2Q36A 3AVLA 1TVRA 2OYQA 4KTZA 5AQZA 3WNEA 1T6DA 4KHUA 3W3DA 3SUNA 3SPYA 2E2NA 4IJNA 4HTLA 4C8LA 4FJXA 3VEWA 4B1XB 5AQTA 4B9MA 2P9IB 4FZYA 4ELUA 3CFRA 4KHNA 1GLFO 3DRRA 2P9UB 4C8NA 2HVIA 3P38A 4H0VB 4CJ3A 1C1BA 3DXMB 5C10A 1FW6A 2GWKA 3CIPA 2AJQA 4OKEA 2KW4A 1HNZK 3RMBA 3VQ5A 3LWLA 4K43A 4FJKA 4DU3A 3PO4A 5BRDA 2QM1A 2GUIA 3THXA 4JI4K 1ATNA 5CR4A 3DOKA 2ZJQL 1OH7A 4BG8A 1FK9A 2Q0RA 4JNEA 4H5NA 2D1KA 4DHYA 1TAUA 3DOLA 4BGBA 1NJXA 2BANA 1J6ZA 4FJJA 3J80O 2HF4A 1Q86O 2HHTA 3CG7A 3LP0A 2HSTA 3F9MA 1JL2A 4KHPK 1GOAA 4BROA 4E1NA 4PY5A 4O5BA 3MN7A 1KLMA 2VYPA 1S6QA 3MWTA 4YOXA 1RDDA 2YHYA 3CM6A 4OGCA 3Q7CA 3V9XA 1YTAA 1V4TA 1OVQA 4ILGB 4KB0A 1X9JA 3KWIA 3CC4N 1C6VA 1GLCG 1X3MA 1Q9XA 3CERA 1QZ5A 1VQ5N 4E7LA 4XEIA 4RW7A 1XC3A 2OZSA 5DM7L 4GKKK 3SPZA 1QQMA 2RPIA 1NJZA 4DB3A 3LZIA 3DI6A 3DYAA 5CYQA 1QS4A 3M8PA 1WUAA 1NOYA 2OCEA 2KLAA 1TAQA 4B3TK 4M7XA 3P5JA 4CEFA 2E8AA 2IC3A 1N34K 2ZJPL 1YXQA 4JKFA 3M3ZA 4NYFA 3V9UA 1BL3A 5CYMA 2WONA 1DKGD 3TPQA 2O8CA 3PIOL 3OHRA 1QSYA 5HBMA 1K9MO 1EO1A 3CPWM 3VQ8A 4B1YB 3HVTA 4JN4A 1Q7YO 4I7FA 4JHDB 4B1WB 4DR2K 2KTQA 4HUFA 1QHAA 1FKPA 3K0SA 3AO3A 2P51A 2I7PA 4YY3K 1KRPA 4KH6A 3BEXA 3RRGA 5AQGA 1OH5A 4JI2K 4JI0K 4CEOA 4DSKA 1P90A 3H3OB 3LL3A 3VF2A 4I6MA 5KI6A 4EHTA 1M90O 1TV6A 1HQUA 3MECA 4Z4EA 5AQHA 3CETA 3JXUA 2A40A 3Q7BA 4FLYA 1JLAA 3ID8A 1VSMA 2F9TA 2V7YA 3HK2A 4JI5K 4J2BA 4NB4A 1QZ6A 2H3GX 4OO1J 1BGXT 3D0PA 4AM7A 3PV8A 3O1BA 4BC2A 4FJMA 4GV9A 3O9SA 1VQON 3WQTA 4CZJA 2P9LB 3NF8A 3OS2A 3ZETB 3TTCA 5AQNA 2D0AA 2BH1A 1SAZA 1K6YA 4B9NA 1LW0A 1REVA 4HUGA 4E89A 3QNOA 2KZMA 3TAQA 2FC0A 1CZAN 4DV1K 1RBVA 2D0OA 1FXXA 3VQAA 3I56N 5M1FA 3WEEA 3VQ4A 1TGOA 2D0BA 2E2QA 2QWQA 1ZBLA 1OKJA 1HJOA 2OPPA 4OVLA 3EE9A 3MDQA 2W42A 4CEEA 1IBMK 5D3GA 2JLEA 3JSMA 4GNIA 2EWSA 3QBXA 2IVNA 4BC3A 4PUOA 5KTQA 3EN9A 2XY5A 1LOTB 4PL8A 4NO7A 1U6ZA 3S3MA 3AVCA 4X64K 2A5XA 5SWMA 1CXUA 4B9UA 4NXMK 3K57A 3N4QA 4Z0UA 1BCOA 1SL1A 3VF4A 4DTNA 4DFKA 5BN9A 3OYJA 3O9UA 2E2OA 4LF8K 1LW2A 3SLCA 4YDUC 3RTVA 2YHBA 1UOCA 2UXDK 4DTOA 3T1YK 5KQ8A 3E1YA 2HMIA 3QIPA 3QFPA 4IO9L 3N4PA 4R79A 1FJGK 1N36K 2KZZA 5I9EB 3HXMA 3PX4A 3QBWA 4FJIA 1VQNN 4JI6K 5I3UA 3AVNA 3C7NA 1KAYA 3SAGA 4FJ9A 3BP8A 2E2PA 3PY8A 3R9PA 2BUPA 4OPAA 2NZTA 3NF6A 3SJJA 2ZGZA 1OVYA 4FM1A 5CZ2A 5CY4A 3LDNA 5AQMA 3ZSOA 5GIOA 2QWRA 2X74A 4MLHA 2X6SA 1NMDA 4JKEA 5IWAK 3LDSA 4CFDA 4NCAA 1S1UA 4LY7A 5BREA 4DTRA 3VGLA 5KRSA 1VQ4N 3O08A 4KV8A 4GKJK 4K8ZA 4CF8A 4CVNE 3F73A 3BY5A 4Y1DA 1C1AA 3LDQA 4JI7K 3NHGA 4ISGA 2ZD1A 4I9LA 3V4IA 1P8ZA 1BI4B 3O9TA 3ZEUB 5AQIA 2LSNA 2RHKA 4YDUA 4CEAA 2VG5A 1TL1A 1BISA 4CERA 4DS4A 3DLBA 3WT0A 1L3VA 3SAHA 5GIPA 3EKSA 4CGFA 1JXEA 4O4GA 5HLFA 4B3OA 3D2FA 1BDGA 3MX2A 1KVCA 2O8BA 5F1XA 1NKBA 1MWKA 4N5SA 4C1NK 4CEDA 2F4VK 3KLHA 2VCPA 4JRQA 1T6CA 3JS6A 1JCEA 2F96A 1JLEA 3FR0A 4DLGA 4F4KA 3PLAA 1HYSA 1NGJA 4JI1K 3M5RA 5AQFA 3HPGA 1U45A 4NLBA 4DQ8A 2Y1IA 3MXJA 3B8AX 4CFAA 3SQ2A 4Y1CA 3K9KA 4AF1A 1VSIA 4V19S 2FSNA 4QS7A 4BRPA 4WQ4A 3C6UA 3QLHA 4Z4IA 4ZTJA 1NKCA 1TKZA 1SZ2A 3QO9A 3U3GA 4DTSA 4FYDA 1VQ7N 4BRCA 4YOTA 2RKIA 1VSEA 1BA0A 5AZIB 2A42A 4DU4A 1IG8A 3HL8A 1S1TA 1S3XA 3PUFA 3ULEB 1TK0A 3VQEA 1IV0A 5CE3A 2XY7A 4X65K 3LP3A 2VG7A 4JI3K 1QQOA 2QWLA 5C0YA 3QDKA 2G8FA 3LPTA 1B9DA 3DM2A 4FJ5A 2HHUA 2O8FA 3WNGA 3DWLA 4CZLA 3VQ6A 4W5RA 3CPEA 2P9NA 3DJCA 1S5JA 3CCQN 3CCVN 4KHYA 3KJVA 4AH9A 1EWRA 4KH4A 1N32K 3FFIA 2GV9A 3QMLA 2RN2A 5BPLA 2F8TA 3M1FA 3ID6A 4CFBA 3MWPA 4E1MA 1NM1A 4N76A 2PAVA 2E88A 2OANA 4GVEA 1EETA 2NRVA 4J8FA 3QICA 4IKFA 2P9KB 4CHPA 4FK0A 1UA1A 3PSIA 1NNEA 3ZSWA 3TAEA 2O8DA 4M3WA 3KLEA 4MDBA 3L4QA 4AM6A 4BGAA 3T1HK 5J2NA 1HX1A 3T69A 4ID5A 2OZMA 4CGJA 4L8RB 3VEYA 1BWFO 4JYAK 2YHWA 5CHIA 3AGKA 1BOTO 3VF6A 2YI1A 3CCEN 1BQMA 4HVJA 4O0JA 2JGUA 3BZCA 2FBVA 2QWNA 1K8KB 4MO5A 3J81O 4H5RA 2F9WA 4OLBA 1NMNA 5TKWA 2OTLN 3HM8A 4N47A 1CLQA 1G15A 2F7TA 5C24A 3HBTA 4CHNA 4CZGA 1BA1A 3AVMA 1SL2A 2KHOA 1D5AA 4DCHA 4F3OA 2Y1JA 4BC4A 5M1OA 4H0OA 2QA4N 4CJRA 4CECA 4Z4GA 3QESA 1ZBUA 4RW4A 1ZBFA 4AHVA 4QS8A 2UUAK 5AZJB 3QEIA 3S41A 4RW6A 4NLCA 4DQQA 3KK3A 4CF1A 1SKRA 4HTUA 4DQSA 1KC8O 4FZZA 4CJLA 1RNHA 3HPOA 3SCXA 4JV5K 3O3FA 5KRTA 3LP2A 3CQYA 2XHBA 3S3NA 2VWKA 2FBYA 3HRGA 3L3UA 3TARA 5MLCQ 4B9QA 3RVCA 1HKCA 2EX3A 1WSJA 4JK8A 2ZWHA 2YKNA 2IVPA 4CHQA 4G9ZA 4FM2A 4GMJB 2ZF5O 2P5OA 4DV5K 2HHHK 2GWJA 3ZSVA 3G6EN 3ZSYA 3RSEB 3H3NO 1YI2N 2Q1NA 1GLJO 4OKKA 3BF1A 4MLEA 3THYA 1C0GA 3HZ6A 3ENOA 5AQYA 4CHYA 1UA0A 5ELZA 3OS1A 2NNWA 4M3YA 5LJWA 1YHQN 3MEDA 4LF7K 1X3NA 3ITHA 4ILHA 2NRWA 1RCHA 1T44A 3KK1A 4BWMA 4QS9A 1I39A 4F2SA 4CGHA 3DLHA 4BVOA 1BQNA 2UYTA 1C0FA 2Z1IA 1VQ8N 2XRIA 3QEPA 1N5YA 4FWPA 3J7YP 3AAQA 5JS1A 4CD1A 1U2VB 1B92A 1TYQA 5AQLA 3C6TA 4UQGA 4I2PA 3SMPA 3NBPA 3M8RA 1IH7A 5JLHA 4FJGA 3BF3A 3TI0A 3UKRB 2CGKA 3DXKB 3CI5A 2I5JA 1Q18A 4ELTA 1E3MA 2D4WA 1RT7A 3T7ZA 1Y97A 3TSQA 3AA5X 4A2AA 3J7AP 5IT9O 4B1ZA 1RT3A 3OA9A 3HT3A 4IJAA 4CJ4A 3THWB 2G8WA 1KVBA 1TUUA 4FW2A 4AILC 5ADXA 1NK9A 3O3HA 5EOYA 4DTJA 2OPQA 3OYDA 1RDWX 3HSTB 4WFBL 1CZ9A 3LPUA 4K8XA 4LH4A 1RT4A 5B8HA 3HYFA 2Q3SA 1KQSM 2V52B 3R3LA 4BR5A 5SZTA 4FCYA 4ELVA 4JKGB 3QETA 1ATRA 3HSCA 3J8AA 3NVKA 4CESA 3WXLA 5AQPA 1RILA 3BUZB 5DM6L 1RDAA 4IFYA 2G8UA 2VQEK 3HVRA 3CCMN 1K73O 4CF2A 1RDCA 5JICA 4H0YB 1OH8A 3EYZA 3TU5A 3LAKA 5E41A 4Q0BA 3HO1A 1NGAA 4QAGA 2X6NA 5BRHA 3K5NA 3L6QA 4JKAA 2XY8A 4XH1A 1IKWA 3U9DA 1X1PA 3WQUA 3HTVA 1GLBG 4CJSA 4FPAA 5C42A 3VPZA 4EZ6A 4CK3A 2YV0X 3CQXA 4BQZA 3ZYYX 5BR8K 4E1JA 4M3ZA 3SV3A 1Z6RA 5KPZA 3ATVA 1ZYQA 3EZWA 1KAXA 1ZBSA 4QCLA 1RDUA 4IO8A 3CF5L 5FROA 1QVFM 3ISNC 5KGXA 2I7NA 2YNIA 3LDLA 5LY3A 4HUEA 4CIFA 4MQ3A 3LP1A 2O4GA 2PZSA 2O8EB 2GX9A 2A41A 4HCBA 3IDHA 4H4MA 1HNXK 2VQFK 3FZFA 3T3FA 1FKOA 4FLWA 2YNGA 5FPDA 2YNFA 1TKDA 3CM5A 4KKOA 1JKHA 3HOSA 4FLTA 1NK4A 4NYNA 4DSJA 2QK9A 4DTUA 3RMAA 4B9VA 1RDBA 3HPHA 1SKSA 1KAZA 1D9DA 4JI8K 2E20A 3NGZA 3V1RA 3K9JA 3TR8A 2A1SA 1MDUB 3HJFA 4CK1A 3VQQA 2ASMA 3HOTA 3JAMO 3OYIA 1VQMN 1ITGA 1G99A 4M3TA 4CZMA 5FLXO 2QWMA 3AVHA 2DPNA 4Z94A 1GOCA 4CEQA 4DF8A 3AVAA 4CHZA 3ZSQA 3D6RA 1J5EK 3SJHA 3J7ZO 3PO5A 2Z1JA 4WQ5A 1Q9YA 4F9OA 2YX6A 3CMAN 3CMEN 1SQKA 4H4OA 3VN5A 4DV0K 4DSIA 2FXUA 3MMVA 4LSLA 3OBYA 1WLJA 3O4QA 1YJWN 4CJFA 3NE6A 2P5GA 1JCGA 4OJRA 5HP1A 3H6EA 4ID1A 4A5AA 3AVGA 4FPBA 3VQDA 3RR8A 1YJNN 3C6HA 2W40A 3I55N 1NG9A 4I9QA 1T03A 1DEJA 3SZ2A 4PQUA 4CJWA 3QERA 3M8QA 4RTFD 2HF3A 3KHYA 1ESVA 1ZXOA 4BR7A 3OTOK 1U48A 4FLZA 3VQBA 1SV5A 1S9EA 3AA4A 3LDOA 4B08A 1NJWA 3SYZA 4BRKA 3TSPA 3QNNA 1T8EA 2QXFA 1OH6A 1IBKK 1I3AA 1VQLN 3GDQA 5J2QA 2PFUA 4IFEA 4JEPA 4U67L 4E19A 3D7EO 1EX4A 3I8DA 3P31A 1J54A 2Z1HA 3K59A 4DV7K 1U4BA 1WSFA 2HB5A 2P9SA 4ISEA 2ETJA 2IDOA 3F5TA 1RBUA 1XQSC 2G8IA 1VSHA 2X78A 3OJUA 2PYJA 5DK5A 5C15A 4A5BA 3VEOA 1R0AA 3OYGA 2HBLA 5AQXA 2WTUA 3D2EB 1D4XA 3P1GA 3CCUN 3SQ0A 4O5FA 2IGIA 1QTMA 3SQ1A 3UKUA 3LZJA 2HHVA 2V51B 4K42A 3C95A 3TWHA 4U7BA 3O9RA 3RSEA 2G8VA 5J2PA 3OY9A 4L3QA 1MA9B 4ICLA 4JLHA 4WCEL 2BTFA 3D45A 3GG4A 1U04A 3F9KA 1NWKA 2ZGYA 4BDZA 1MU2A 4IG0A 2QWOA 4CF9A 2VGMA 3THVA 4CZIA 1UAXA 1NLVA 4DWIA 1HPMA 3PX6A 2PY5A 4CJTA 4CBXA 2YCHA 4GVMA 3MN9A 1ASVA 1L3TA 4FJNA 4FW1A 2KKZA 3A8YA 3GBTA 4C23A 1LAWA 2CGJA 4DS5A 3CC2N 4DLEA 3MCPA 3CD6N 3CYMA 5CZ1A 4KHSA 3IG1A 1U2VA 3ZCMA 2A1RA 3VERA 3ULDA 4A57A 3L3VA 4FK2A 1YF5L 2NRTA 3CFPA 2HOEA 3O1WA 4DTPA 1IG9A 1NGGA 3LALA 4WQ4C 1RBSA 1Q8IA 2P9IA 5EVZA 3ZX0A 1EP4A 3OJSA 1E4FT 1T3VA 3QEVA 4CIEA 1BUPA 2ITGA 2P9UA 5DMRA 1SUQA 4W5QA 2WC9A 1HNWK 3DXMA 1IKYA 3V9SA 3AVBA 3OYHA 3V81A 4DQIA 2OTJN 4LFAK 2YKMA 4A61A 4H5WA 1L3UA 1RBRA 1YTUA 3CJ9A 3TABA 3CC7N 4BWJA 3QFUA 4J2EA 3QINA 4DR6K 2GTDA 3ZT1A 4CIGA 4CCHA 2HNYA 3CJBA 3H08A 2A3ZA 3C6AA 3THXB 2OA8A 2XY6A 4IWVA 1HRHA 1RT1A 4JKGA 1YJ9N 1VK0A 4EAHD 1DTTA 1QE1A 2CGLA 1MWMA 1RBTA 1JJ2M 2ZM6K 1WAJA 3PIPL 1QSLA 4BR2A 1XI1A 2FSKA 3ZT2A 3HM9A 4FL9A 4DSEA 1HMVA 3NMUA 3B6OA 2Q0UA 4RCHA 2J4RA 4RW8A 1LV5A 1BIUA 5AQRA 3ENBA 1IKXA 3WNFA 2A6AA 3FGUA 3VGMA 4B9SA 1ASWA 1HKBA 4LH5A 3U4LA 2ASPA 3NVMA 2Q2RA 3UB5A 1ILYA 3VQ9A 3O6WA 4J2AA 5JLFA 2NRRA 4CBUA 5JVGL 4E7KA 3IS9A 2JWLA 4B3MK 4BRNA 3MK6A 3TAFA 3OYAA 4CEZA 5H1SQ 3SUQA 4ILJA 4LSNA 3S9HA 4RW9A 1WSHA 4BACA 4M45A 4DR5K 2HBMA 1Z05A 2YNHA 4DV4K 4KBOA 4AHUA 4FWLA 2HHWA 3KLGA 2O8EA 3L2UA 4EP5A 3OS0A 3IAYA 3S3OA 3AV9A 4M41A 3AY9A 5E84A 4AHCA 2O8CB 3O8MA 2BDPA 3P4IA 3UIQA 3K5MA 4JHDA 2Q31A 3A5MC 4OGEA 4OX9K 4BREA 3P83D 2WFBA 3TAGA 4DMNA 3M6GA 4KAZA 1NKEA 2NRXA 4XH5A 4BE1A 4HHTA 5EX5A 2NUBA 3E01A 3EZ5A 4DFPA 4CF0A 4DU1A 4DSFA 5AJ3K 1KSPA 3SK3A 3H1QA 4CW7B 3VEVA 4AHTA 2OPRA 4KI4A 1NOZA 1NK0A 5A2QO 4NCBA 3I0SA 5J2MA 3ALYA 1Q81O 4CGGA 4I6MB 1XUPO 2ITMA 5HOOA 3SNNA 2DFFA 4JS5A 5EU7A 4BE0A 3JYTA 3WXMB 3U9ZA 4JRPA 4DFJA 4C8KA 1BCMA 2AA4A 3FZLA 4OPJA 4BE2A 1LAVA 4MFBA 1S1XA 3EKUA 4KPYA 4FK4A 1BO5O 4FWMA 4EZ9A 4IOXA 3VQCA 4QOZB 3VTHA 4MO4A 2QTDA 3VQ7A 5M1QA 2P9LA 2ASOA 3K2PA 1LWCA 4I2QA 3ZETA 2UXBK 1GLDG 4KFBA 4M7YA 1BU6O 4RG8A 1F21A 3EE8A 3VQPA 1VRTA 3ZT4A 4Q5VA 1NGEA 4CGIA 2FBTA 3VESA 2YJEA 3SBGA 3RWUA 4JKDA 1S22A 1JLGA 3OYCA 3WEEB 4KB1A 3GE1A 5AR0A 2Q97A 4CEBA 1W2BM 4HWIA 1O1WA 3MEEA 3KKSA 4DFMA 2V7ZA 2VWBA 5T7BA 5GAEP 4F8RA 4FWNA 4Z4FA 1GLEG 3AO2A 4H5TA 2YJFA 4FLVA 4DQRA 4DV2K 4CJ7A 1JCFA 1R59O 4BQLA 1BIZA 4LF4K 3MN6A 3LANA 4JAXA 4BR0A 4IOCL 1HNVA 3NGIA 1CZBA 5BN8A 4X62K 2W6LA 4B3SK 1WN7A 4KHQA 4ZTFA 4CJ5A 4K25A 3F2KA 1KLNA 4B8CA 3MXIA 2E5LK 5KGWA 4C8OA 2YHXA 1IO2A 1JL1A 1KD1O 1ATSA 1DT9A 2VGNA 4W5OA 4GV6A 1YUWA 5AQUA 3U3YA 1NGHA 5EY4A 2OPSA 3AARA 5BPMA 4LF9K 2DFEA 4R5PA 3K58A 1HPZA 2VG6A 2BE2A 1TUYA 3C7NB 3UE5A 3ZT3A 1HKGA 4H0PA 2NRZA 4PHTX 3RR7A 3U8XA 4PA1A 3IFRA 4DF4A 4DQPA 2IIRA 3WUHA 1QQNA 3CQ8A 5ADXH 4CJQA 1XNQK 4BR4A 5BR9A 4BRIA 1BG3A 3TSUA 3EEQA 3G4SN 4WFNL 1S1VA 1S1WA 4BRQA 4FWOA 4O8KA 3GOIA 1RTDA 5C12A 3VA0A 2ZE2A 3KK7A 4OKJA 3KTQA 1C0MA 1HLUA 4B1VA 2DY4A 3EL2A 2RF2A 3IMXA 1BI4A 4CJPA 4YORA 4CE9A 4H03B 1T7PA 3SUOA 3ZEUA 4BDYA 1WSEA 4KTQA 1QVGM 3WXJA 3NGYA 1N8RO 3CJAA 3E66A 5M1PA 4CFCA 4B1UB 3MX5A 1KFDA 3MEGA 1EWQA 3HP9A 4Z4HA 1ZBIA 2HHXA 3A5OC 4BRDA 4CJKA 1Y64A 3LDPA 1VQKN 4NXNK 3VENA 4N56A 4F2RA 4CZEA 1T05A 3D2FB 5HRRA 3V1OA 4YFUA 4Y0WA 2O8BB 4CGDA 3DLRA 1UWBA 2G8HA 3DRPA 4LC9B 5AQVA 4DR4K 4FLXA 3C94A 3K5OA 4WQ5C 2HNDA 4IDHA 3NH0A 3FZHA 3I33A 4DR7K 3C0BA 1LCUA 4H0XB 3OBWA 2FF6A 4BRGA 1WSGA 3V1QA 4FWRA 1YT3A 3CJ1A 4M3UA 3KWGA 4F3TA 4IDKA 4OPHA 4K0KK 2HBKA 3CFOA 1WSIA 3OYEA 3L2WA 4W5TA 4BRFA 2DFHA 5AZIA 4FWQA 2DTUA 4HCCA 3KZBA 2D0PA 3BDPA 3ULEA 2PYLA 3O9QA 1VHXA 1TKXA 2FF3B 3VOVA 1S6PA 2E1YA 3T1AA 1EXQA 1WAFA 3OYNA 2Z1GA 4MDAA 4PKHA 3NF9A 2O8FB 4UY8O 2ZQBA 3T19A 3LAMA 1YVUA 2B6AA 4M3XA 2P9NB 3NFAA 1HUXA 4FJHA 1KVAA 3OYMA 4YOWA 4G1QA 5TKYA 1QSSA 1RT6A 4BG9A 1KXPA 5K14A 4KREA 3ZLJA 2NRHA 4E7HA 3H46O 4FVUA 2P9KA 5FPEA 4RWTA 2RE2A 4KHWA 2XO7A 4JK9A 4GW6A 1J53A 1RTIA 2ATQA 4IEIA 4JS4A 2O8DB 1E4GT 4DSLA 1DLOA 5JS2A 4PWDA 3MXMA 1C0UA 5AQOA 1VQPN 2E4LA 4B8AB 4O44A 3ZX3A 1N33K 3FE1A 1K8KA 3CXCM 1ASUA 2P9PB 4FJ7A 2O4IA 3OYFA 4DUYK 4H0TB 3NH2A 4DTXA 1KFSA 4AHRA 1VQ9N 2EHGA 2YHAA 4M63C 3DMJA 5FPNA 2GUPA 3OW2M 3VEZA 4FOEA 1I94K 2B5JA 4PL7A 3L2RA 4IEEA 2HMPA 3TANA 5C2DA 1NK7A 2WBNA 4LF5K 3AVKA 3L8BA 4K41A 4C1NI 5AFUH 4BRAA 4BY9C 4BRHA 4E3SA 3FZKA 4EFHA 3H45C 1NGCA 2PBDA 4KO0A 3GL1A 3TTDA 5GAHP 1NJYA 1QQCA 3ENHA 4FWSA 4B3RK 4OLAA 1CXQA 4IG3A 3WNHA 5AZJA 3L2QA 2UXCK 3ZX2A 1YAGA 4CD3A 1KTQA 4E7IA 4KTWA 5AFUA 1YITN 5HRPA 4JKCA 2FLOA 4ISFA 3QB0A 1YVNA 3I8BA 4ZHRA 3BGRA 3E9LA 1NGIA 4JD2B 1XHXA 3DAWA 4E7JA 3O4NA 3B6PA 1TK8A 2QKKA 3KD5E 5LJVA 2F8SA 3AAPA 2P1JA 4GV3A 2GEMA 3AO5A 5AQKA 3V6DA 4JK7A 4IXCA 4WE1A 1IJJA 4DG1A 2QEXN 3G25A 1Z26A 1NK8A 1JLBA 3L4IA 4FO0A 3U6FA 2QKBA 3TAMA 3THYB 1KCFA 1IBLK 3FZMA 5FDLA 1J9AA 3SUPA 5HROA 1RTHA 3VETA 1NGBA 1RT5A 4WFAL 5AQQA 4KI6A 5F0XA 4PKGA 5J1EA 3R6MA 4JKHA 2UUBK 3IKMA 5KPTA 1XHZA 1VRUA 2D5RA 1X9WA 3O80A 4DUZK 2IS3A 3DLLL 3AGRA 1TK5A 4H8KA 3NDKA 1W97L 4BRMA 3HP6A 1D8YA 4BDPA 2IAJA 1Q82O 3AO1A 1TYQB 3KD1E 1WBDA 3UKRA 4LFBK 5F2RA 1LWFA 3DXKA 5KQDA 4GY2B 4H5VA 3WXKA 2QWPA 5JVHL 1TKTA 4YHHK 3L0QA 4YNQA 3ZSZA 3R8EA 3OYLA 1GLAG 5FRMA 4KRFA 1H1VA 1NGDA 3LWMA 4IBNA 3IRXA 2KFNA 3THWA 2HHQA 3LM9A 1HYZA 1JXBA 4BVPA 1RGIA 3O4WA 4CK2A 4IFVA 1LWEA 4DV6K 4BR9A 1VAZA 4LFCK 1HQEA 4FJ8A 5AQSA 4N41A 4TSXA 3SMSA 3BZKA 1A5WA 3A5LC 5GAGP 1DGKN 2QW9A 1VSDA 4FOIA 3A2FA 4CJUA 2E6LA 2ZJRL 1X9MA 1SL0A 4KH5A 1TL3A 1J5OA 4FM0A 4AHSA 5JMVA 5LMUK 1L5UA 1A5XA 2B4JA 3CCLN 2QI2A 1JLCA 4PKIA 4WF9L 4CBWA 4DTMA 1EKEA 1X9SA 5GINA 3P39A 2KFZA 4E0DA 3EO3A 3OYKA 1K8AO 1RTJA 3OVNA 3QIOA 3E9PA 4IOAL 1Z25A 3ZSXA 4W5NA 4Z4CA 3K5LA 1U49A 1EQYA 5M1KA 2E6MA 2AP1A 3PX0A 5I42A 3G10A 2HW3A 3KLFA 3G71N 4CZKA 4DV3K 3FFKB 4JKBA 3KK2A 3WXIA 4O0IA 2FSJA 1VSFA 1WNSA 5BPNA 2HVHA 4M42A 4CHOA 4M3RA 5LL6Z 3ZSRA 2FBXA 3NAEA 1A5VA 1S9GA 2CH5A 1NK5A 3AVIA 3TTFA 3G0ZA 4BC5A 5HRNA 1RT2A 5KPRA 3MAQA 2UU9K 3AO4A 3NCIA 3I0RA 1QHTA 3PSFA 1D9FA 1XMOK 4LD0A 3NF7A 1HYVA 2W41A 2GELA 4IZ9A 3QEWA 2G8KA 4DR1K 5BRFA 2CH6A 1B9FA 4YOVA 3V9ZA 4DKWA 2HHSA 3SAFA 4FVMA 1N6QA 3L2VA 4EP4A 2KQ2A 3RMCA 1HNIA 3CJCA 1HJRA 1VSLA 3AA3A 3HI0A 1U47A 3A0IX 3O3GA 5M1NA 4XH4A 5GADP 4CJVA 3RRHA 3IUCA 5E26A 3KVGA 3DLEA 1IKVA 2HBJA 3KIOA 3VMFB 4XIUA 1HR0K 2E1ZA 2BGGA 1ZC6A 1NJIO 4CZFA 1SS6A 2IOCA 3C65A 3O5BA 1W7AA 4J2DA 1NGFA 3DRSA 4CJEA 3AVJA 3QEXA 2WUSA 2P9PA 3KKRA 1NBWA 2UUCK 3W0LA 4A59A 3OYBA 2VWJA 1O13A 3SBTA 5HRSA 3E9OA 5AQWA 3AA2A 1DTQA 1L3SA 1JLFA 4YOYA 5FRNA 2QXLA 3ZT0A 1WB9A 5FPMA 1GLLO 1XNRK 1M1KO 4WYBA 1W9HA 4BRLA 2WOMA 2W6KA 3LM2A 3CCSN 1W0HA 4O8UA 5C2FA 1NU0A 3CCRN 4O55A 4DR3K 2R7YA 3RMDA 3SQ4A 3H1VX 4FSVA 4EIAA 3DLGA 2HNZA 5LMNK 1BHLA 3M8SA
chains in the Genus database with same CATH topology
2P9SB 3B8AX 3F5TA 4IDHA 1XQSC 3CHWA 3FZHA 3I33A 3K9KA 4AF1A 3C0BA 1LCUA 4H0XB 1VQ6N 3OBWA 2FF6A 4BRGA 5C15A 4A5BA 2FSNA 3VEOA 4FWRA 4JD2A 3CJ1A 3D2EA 2HBLA 1RFQA 5AQXA 3MCAB 4QS7A 4BRPA 4WQ4A 3D2EB 3KWGA 1D4XA 4OPHA 5EXWA 3CCUN 5AQJA 3FLCO 2HBKA 3VGKA 2NLXA 1WOQA 1SZ2A 4O5FA 3CCJN 1VQ7N 4BRFA 5AZIA 4BRCA 4FWQA 4YOTA 1YIJN 1S72N 3UKUA 1BA0A 5AZIB 2A42A 3UKUB 2V51B 3KZBA 2D0PA 4K42A 1IG8A 4U7BA 3ULEA 3O9QA 3O9RA 1S3XA 3RSEA 2FF3B 4A62A 3ULEB 3VEXA 4CI6A 3VOVA 5CE3A 4EHUA 3MN5A 2E1YA 4L3QA 1MA9B 4WCEL 2BTFA 2JWKA 1QQOA 2QWLA 5C0YA 3GG4A 3CJ7A 3QDKA 1V4SA 1NWKA 2ZGYA 4YOUA 4MDAA 4PKHA 2QWOA 3R1XA 4CZHA 2VGMA 3DWLA 4CZLA 3VTIA 4UY8O 4CZIA 3CPEA 2P9NA 3DJCA 1NLVA 3CCQN 3A5NC 1HPMA 3CCVN 2P9NB 4FWKA 4KH4A 5HL7L 1HUXA 4CBXA 2YCHA 4YOWA 3MN9A 3QMLA 2IVOA 5TKYA 3ATUA 2KKZA 3A8YA 3GBTA 4A2BA 2Q36A 3M1FA 4BG9A 1KXPA 4C23A 5BPLA 3ID6A 2CGJA 3MWPA 5AQZA 1NM1A 3CC2N 1T6DA 2PAVA 2NRHA 2E88A 3MCPA 2OANA 4GVEA 3CD6N 3H46O 4FVUA 2P9KA 2NRVA 4J8FA 3W3DA 3QICA 5FPEA 1U2VA 4RWTA 2P9KB 2RE2A 3VERA 2E2NA 4JK9A 4IJNA 4A57A 1YF5L 4IEIA 2NRTA 4HTLA 2HOEA 3O1WA 1NGGA 4MDBA 4WQ4C 3L4QA 4AM6A 1E4GT 4BGAA 3VEWA 4B1XB 2P9IA 5AQTA 1HX1A 5EVZA 3ZX0A 3T69A 1E4FT 1T3VA 2P9IB 1BUPA 2P9UA 5AQOA 1VQPN 3VEYA 1GLFO 1BWFO 2WC9A 2P9UB 2YHWA 3ZX3A 5CHIA 3AGKA 3DXMA 1BOTO 3P38A 2YI1A 4H0VB 3VF6A 3CCEN 3FE1A 1K8KA 3DXMB 5C10A 3CXCM 4MO5A 2QWNA 1K8KB 4H5RA 2F9WA 2P9PB 2GWKA 3CIPA 2OTJN 5TKWA 2OTLN 3HM8A 4A61A 4H0TB 4H5WA 3CJ9A 4K43A 1VQ9N 2F7TA 4M63C 3CC7N 3HBTA 3QFUA 4CZGA 5BRDA 1BA1A 2QM1A 5FPNA 2GUPA 3OW2M 2KHOA 3VEZA 4DCHA 4FOEA 1ATNA 2GTDA 5CR4A 4PL7A 3CJBA 2A3ZA 3C6AA 2ZJQL 4IEEA 2HMPA 4IWVA 4BG8A 5C2DA 2WBNA 4BC4A 2Q0RA 4K41A 4C1NI 4JNEA 4H5NA 5AFUH 4JKGA 4BRAA 4BY9C 2D1KA 5M1OA 4H0OA 4BRHA 4DHYA 4EAHD 1YJ9N 3FZKA 4BGBA 2QA4N 4EFHA 3H45C 2CGLA 1J6ZA 1NGCA 2PBDA 1MWMA 2HF4A 3GL1A 1Q86O 1JJ2M 3TTDA 5GAHP 3ENHA 4FWSA 3PIPL 4QS8A 4BR2A 5AZJA 2HSTA 3F9MA 3ZX2A 1YAGA 2FSKA 5AZJB 3S41A 4BROA 4CD3A 4NLCA 4FL9A 3NMUA 5AFUA 2Q0UA 3MN7A 2VYPA 4RCHA 1KC8O 1YITN 4JKCA 2FLOA 2J4RA 4WQ5C 3MWTA 4YOXA 4ISFA 5AQRA 3ENBA 3CQYA 2YHYA 3QB0A 1YVNA 3I8BA 2A6AA 3FGUA 3VGMA 3Q7CA 1HKBA 3E9LA 3U4LA 1V4TA 1NGIA 2ASPA 2Q2RA 3HRGA 3NVMA 3O6WA 4JD2B 3UB5A 1ILYA 4ILGB 5JLFA 3DAWA 1X9JA 2NRRA 4CBUA 5JVGL 3KWIA 3CC4N 5MLCQ 1GLCG 4B9QA 1X3MA 3RVCA 1HKCA 5LJVA 2JWLA 3CERA 3AAPA 4BRNA 1QZ5A 4JK8A 3MK6A 1VQ5N 2ZWHA 5H1SQ 4GV3A 4ILJA 4XEIA 2GEMA 1XC3A 2IVPA 5DM7L 4G9ZA 5AQKA 2ZF5O 1QQMA 4DB3A 2GWJA 4JK7A 4IXCA 3G6EN 1IJJA 3RSEB 2HBMA 2QEXN 1WUAA 3H3NO 1YI2N 1Z05A 2KLAA 2Q1NA 1GLJO 3G25A 4KBOA 4M7XA 2E8AA 3L4IA 3BF1A 4FO0A 4MLEA 4FWLA 2ZJPL 1C0GA 1YXQA 4JKFA 3M3ZA 3HZ6A 3ENOA 3AY9A 3FZMA 5E84A 1DKGD 5AQYA 3TPQA 3PIOL 3OHRA 3VETA 1NGBA 5ELZA 2NNWA 4WFAL 1K9MO 5AQQA 3O8MA 5LJWA 1EO1A 3CPWM 1YHQN 3P4IA 4B1YB 5F0XA 4PKGA 1X3NA 3R6MA 4JKHA 2Q31A 3A5MC 4JHDA 4JN4A 4ILHA 2NRWA 1Q7YO 3IKMA 4BREA 5KPTA 4JHDB 1T44A 4QS9A 2WFBA 4B1WB 3M6GA 4BVOA 3O80A 2UYTA 1C0FA 1VQ8N 2NRXA 3DLLL 1QHAA 4XH5A 3AGRA 5EX5A 4FWPA 3AAQA 1W97L 4BRMA 4CD1A 1U2VB 2I7PA 3SK3A 3H1QA 1TYQA 1Q82O 4KH6A 5AQLA 3VEVA 3BEXA 1TYQB 5AQGA 3SMPA 3UKRA 5JLHA 5F2RA 3BF3A 1P90A 3DXKA 3UKRB 3H3OB 2CGKA 3LL3A 5KQDA 4GY2B 4H5VA 4I6MA 3VF2A 3DXKB 3CI5A 3WXKA 2QWPA 5JVHL 1Q81O 1Q18A 4I6MB 1XUPO 2ITMA 5HOOA 3L0QA 4EHTA 2D4WA 3R8EA 1M90O 1GLAG 3T7ZA 1H1VA 3TSQA 1NGDA 4A2AA 3WXMB 5AQHA 3U9ZA 3CETA 3JXUA 2A40A 3Q7BA 4B1ZA 3OA9A 2AA4A 3ID8A 2F9TA 3LM9A 3FZLA 4IJAA 2V7YA 1TUUA 4BVPA 5ADXA 1RGIA 3O4WA 4BR9A 1VAZA 1QZ6A 2H3GX 3EKUA 4NB4A 5EOYA 4OO1J 5AQSA 1BO5O 4FWMA 4AM7A 1RDWX 4IOXA 3O1BA 3SMSA 4BC2A 4WFBL 4GV9A 3VTHA 3A5LC 5GAGP 1DGKN 2QW9A 3O9SA 4MO4A 5B8HA 2QTDA 4FOIA 5M1QA 2P9LA 2ASOA 1VQON 3WQTA 2ZJRL 4CZJA 1KQSM 3ZETA 2P9LB 1GLDG 2V52B 3R3LA 4KH5A 4M7YA 4BR5A 3ZETB 3TTCA 5AQNA 4JKGB 1ATRA 1BU6O 3HSCA 3J8AA 3NVKA 2BH1A 5AQPA 3WXLA 1SAZA 3BUZB 5JMVA 5DM6L 3EE8A 3CCLN 2QI2A 4PKIA 1NGEA 4WF9L 3CCMN 4CBWA 1K73O 3VESA 5JICA 1CZAN 4H0YB 2D0OA 3P39A 2YJEA 3SBGA 5GINA 3TU5A 5M1FA 3I56N 3WEEA 4JKDA 1S22A 3EO3A 2E2QA 1NGAA 2QWQA 3WEEB 1K8AO 3GE1A 1OKJA 1HJOA 5AR0A 3EE9A 3L6QA 3MDQA 2Q97A 4JKAA 5BRHA 4XH1A 3U9DA 3E9PA 4IOAL 3WQUA 3HTVA 4GNIA 1GLBG 1W2BM 2EWSA 4HWIA 3QBXA 2IVNA 4FPAA 4BC3A 3VPZA 2V7ZA 2VWBA 5GAEP 3EN9A 1EQYA 4FWNA 1GLEG 1LOTB 4PL8A 4NO7A 4H5TA 3CQXA 1U6ZA 2YJFA 3ZYYX 4BQZA 5M1KA 2AP1A 4E1JA 1Z6RA 4CJ7A 5KPZA 3ATVA 1JCFA 1R59O 2A5XA 4BQLA 3EZWA 1KAXA 1ZBSA 3MN6A 4JAXA 4BR0A 3G71N 4IOCL 4CZKA 1RDUA 3FFKB 3N4QA 4IO8A 4JKBA 3WXIA 3CF5L 1QVFM 5BN8A 2FSJA 3VF4A 2I7NA 5BPNA 3LDLA 5LY3A 5BN9A 3O9UA 2E2OA 4K25A 2GX9A 2A41A 3F2KA 3SLCA 3IDHA 4YDUC 2CH5A 2YHXA 5KQ8A 3TTFA 3E1YA 4BC5A 3FZFA 1KD1O 1ATSA 1DT9A 2VGNA 3QFPA 5FPDA 4IO9L 3N4PA 4R79A 5KPRA 5I9EB 3HOSA 4GV6A 1YUWA 5AQUA 1NGHA 3QBWA 5EY4A 1VQNN 3AARA 5BPMA 1KAZA 3C7NA 2E20A 1KAYA 3SAGA 1TUYA 3C7NB 3K9JA 3UE5A 3BP8A 1HKGA 2W41A 4H0PA 2GELA 2NRZA 1MDUB 4IZ9A 4PHTX 2E2PA 5BRFA 2CH6A 3R9PA 2ASMA 3U8XA 4YOVA 2BUPA 4OPAA 4DKWA 3HOTA 3IFRA 1VQMN 1G99A 2NZTA 2ZGZA 1OVYA 2IIRA 3WUHA 3SAFA 5AQMA 3LDNA 1QQNA 4CZMA 5GIOA 5ADXH 2QWMA 2DPNA 2QWRA 4Z94A 4BR4A 4MLHA 5BR9A 4BRIA 4JKEA 1BG3A 1NMDA 3TSUA 3G4SN 3CJCA 4WFNL 3HI0A 3D6RA 3A0IX 3SJHA 4BRQA 5BREA 4FWOA 3J7ZO 3VGLA 4O8KA 3GOIA 1VQ4N 4WQ5A 5C12A 5M1NA 4XH4A 5GADP 4F9OA 3IUCA 3O08A 2YX6A 3KK7A 3KVGA 5E26A 3CMAN 3CMEN 1SQKA 2HBJA 2FXUA 1HLUA 3VMFB 2E1ZA 3MMVA 1ZC6A 1NJIO 4CZFA 1SS6A 3OBYA 4B1VA 3LDQA 3C65A 3O5BA 1YJWN 3EL2A 4ISGA 3IMXA 1NGFA 1JCGA 4YORA 4H03B 1P8ZA 3O9TA 3H6EA 3ZEUA 4DQ8A 4A5AA 2WUSA 3ZEUB 1QVGM 2P9PA 4FPBA 3WXJA 1NBWA 5AQIA 3C6HA 1YJNN 2RHKA 4YDUA 3CJAA 3E66A 2W40A 1N8RO 3I55N 5M1PA 1DEJA 4B1UB 3MX5A 3WT0A 3W0LA 4A59A 3SAHA 1O13A 3SBTA 4RTFD 2HF3A 3E9OA 3KHYA 5AQWA 3A5OC 4BRDA 4YOYA 5GIPA 1ESVA 1ZXOA 2QXLA 1Y64A 3EKSA 3LDPA 5FPMA 4BR7A 1VQKN 1GLLO 3VENA 3LDOA 1M1KO 4WYBA 4CZEA 3D2FA 4BRLA 1BDGA 3MX2A 3D2FB 3LM2A 5F1XA 4BRKA 4Y0WA 3TSPA 3CCSN 1MWKA 4O8UA 5C2FA 4C1NK 1VQLN 3GDQA 2VCPA 3CCRN 2PFUA 1T6CA 3JS6A 4LC9B 1JCEA 4IFEA 5AQVA 4JEPA 4U67L 3FR0A 3H1VX 4FSVA 3D7EO 3PLAA 4EIAA 1NGJA 3M5RA 3P31A 5AQFA 2P9SA 4ISEA 4NLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9S B;  3B8A X;  1XQS C;  3CHW A;  3FZH A;  3I33 A;  3C0B A;  1LCU A;  4H0X B;  4BRG A;  2FF6 A;  2FSN A;  3VEO A;  4FWR A;  4JD2 A;  3CJ1 A;  3D2E A;  5AQX A;  1RFQ A;  4QS7 A;  4BRP A;  4WQ4 A;  3D2E B;  1D4X A;  5EXW A;  5AQJ A;  3FLC O;  3VGK A;  2NLX A;  1WOQ A;  1SZ2 A;  4O5F A;  4BRF A;  5AZI A;  4BRC A;  4FWQ A;  3UKU A;  1BA0 A;  5AZI B;  2A42 A;  3UKU B;  2V51 B;  3KZB A;  2D0P A;  4K42 A;  1IG8 A;  3ULE A;  1S3X A;  3RSE A;  2FF3 B;  4A62 A;  3ULE B;  3VEX A;  4CI6 A;  3VOV A;  5CE3 A;  4EHU A;  3MN5 A;  2E1Y A;  4L3Q A;  1MA9 B;  2BTF A;  1QQO A;  2QWL A;  3GG4 A;  3CJ7 A;  3QDK A;  1V4S A;  1NWK A;  2ZGY A;  4CZH A;  4PKH A;  2QWO A;  3DWL A;  4CZL A;  4CZI A;  2P9N A;  3DJC A;  1NLV A;  3A5N C;  1HPM A;  2P9N B;  4FWK A;  1HUX A;  4CBX A;  2YCH A;  3MN9 A;  3QML A;  2IVO A;  5TKY A;  3ATU A;  3A8Y A;  3GBT A;  4A2B A;  2Q36 A;  3M1F A;  4BG9 A;  1KXP A;  4C23 A;  5BPL A;  2CGJ A;  5AQZ A;  1NM1 A;  1T6D A;  2PAV A;  2NRH A;  2E88 A;  3MCP A;  2OAN A;  3H46 O;  2P9K A;  4J8F A;  3W3D A;  3QIC A;  5FPE A;  1U2V A;  4RWT A;  2P9K B;  3VER A;  2E2N A;  4IJN A;  4HTL A;  2HOE A;  3O1W A;  1NGG A;  4WQ4 C;  4AM6 A;  1E4G T;  4BGA A;  3VEW A;  4B1X B;  2P9I A;  5AQT A;  1HX1 A;  5EVZ A;  3ZX0 A;  1E4F T;  2P9I B;  1BUP A;  2P9U A;  5AQO A;  3VEY A;  1GLF O;  1BWF O;  2P9U B;  2YHW A;  3ZX3 A;  3DXM A;  1BOT O;  3VF6 A;  2YI1 A;  4H0V B;  3FE1 A;  1K8K A;  3DXM B;  4MO5 A;  2QWN A;  1K8K B;  4H5R A;  2F9W A;  2P9P B;  2GWK A;  3CIP A;  3HM8 A;  4A61 A;  4H0T B;  4H5W A;  3CJ9 A;  4K43 A;  4M63 C;  3HBT A;  3QFU A;  4CZG A;  5BRD A;  1BA1 A;  2QM1 A;  5FPN A;  2GUP A;  2KHO A;  3VEZ A;  4DCH A;  4FOE A;  1ATN A;  2GTD A;  4PL7 A;  3CJB A;  2A3Z A;  2HMP A;  4IWV A;  4BG8 A;  4BC4 A;  2Q0R A;  4K41 A;  4JNE A;  4H5N A;  5AFU H;  4BRA A;  2D1K A;  4BRH A;  4H0O A;  4DHY A;  4EAH D;  3FZK A;  4BGB A;  4EFH A;  3H45 C;  2CGL A;  1J6Z A;  1NGC A;  2PBD A;  1MWM A;  2HF4 A;  3GL1 A;  3ENH A;  4FWS A;  4QS8 A;  4BR2 A;  5AZJ A;  3F9M A;  3ZX2 A;  1YAG A;  2FSK A;  5AZJ B;  3S41 A;  4BRO A;  4CD3 A;  4FL9 A;  5AFU A;  2Q0U A;  3MN7 A;  2VYP A;  4RCH A;  2FLO A;  2J4R A;  4WQ5 C;  4ISF A;  5AQR A;  3CQY A;  2YHY A;  3QB0 A;  1YVN A;  3I8B A;  2A6A A;  3FGU A;  3VGM A;  1HKB A;  3U4L A;  1V4T A;  1NGI A;  2ASP A;  2Q2R A;  4JD2 B;  3O6W A;  3UB5 A;  5JLF A;  3DAW A;  1X9J A;  4CBU A;  1GLC G;  4B9Q A;  1X3M A;  5LJV A;  1HKC A;  3CER A;  3AAP A;  4BRN A;  1QZ5 A;  3MK6 A;  2ZWH A;  4XEI A;  2GEM A;  1XC3 A;  2IVP A;  5AQK A;  2ZF5 O;  1QQM A;  4DB3 A;  2GWJ A;  4IXC A;  1IJJ A;  3RSE B;  1WUA A;  3H3N O;  1Z05 A;  2Q1N A;  1GLJ O;  3G25 A;  4KBO A;  4M7X A;  2E8A A;  3L4I A;  3BF1 A;  4FO0 A;  4MLE A;  4FWL A;  1C0G A;  1YXQ A;  3M3Z A;  3HZ6 A;  3ENO A;  3AY9 A;  3FZM A;  5E84 A;  1DKG D;  5AQY A;  3TPQ A;  3OHR A;  3VET A;  1NGB A;  5ELZ A;  5AQQ A;  3O8M A;  5LJW A;  3P4I A;  4B1Y B;  5F0X A;  4PKG A;  1X3N A;  3R6M A;  4JHD A;  2Q31 A;  3A5M C;  4JN4 A;  4BRE A;  5KPT A;  4JHD B;  1T44 A;  4QS9 A;  4B1W B;  3M6G A;  4BVO A;  3O80 A;  2UYT A;  1C0F A;  1QHA A;  4XH5 A;  5EX5 A;  4FWP A;  3AAQ A;  4CD1 A;  4BRM A;  1U2V B;  2I7P A;  3SK3 A;  3H1Q A;  1TYQ A;  5AQL A;  3VEV A;  3BEX A;  1TYQ B;  5AQG A;  3SMP A;  3UKR A;  5JLH A;  5F2R A;  3BF3 A;  3DXK A;  3UKR B;  3H3O B;  2CGK A;  3LL3 A;  5KQD A;  4GY2 B;  4H5V A;  4I6M A;  3VF2 A;  3DXK B;  3CI5 A;  3WXK A;  2QWP A;  1Q18 A;  4I6M B;  1XUP O;  2ITM A;  3L0Q A;  4EHT A;  2D4W A;  3R8E A;  1GLA G;  1H1V A;  1NGD A;  4A2A A;  5AQH A;  3U9Z A;  3CET A;  3JXU A;  2A40 A;  4B1Z A;  2AA4 A;  3ID8 A;  2F9T A;  3LM9 A;  3FZL A;  4IJA A;  2V7Y A;  1TUU A;  4BVP A;  5ADX A;  1RGI A;  3O4W A;  4BR9 A;  3EKU A;  1QZ6 A;  2H3G X;  4NB4 A;  5EOY A;  5AQS A;  1BO5 O;  4FWM A;  4AM7 A;  1RDW X;  3O1B A;  3SMS A;  4BC2 A;  3A5L C;  1DGK N;  2QW9 A;  4MO4 A;  5B8H A;  4FOI A;  2P9L A;  2ASO A;  3WQT A;  4CZJ A;  3ZET A;  2P9L B;  1GLD G;  2V52 B;  4M7Y A;  4BR5 A;  3ZET B;  5AQN A;  1ATR A;  1BU6 O;  3HSC A;  3J8A A;  3WXL A;  5AQP A;  1SAZ A;  3BUZ B;  5JMV A;  4PKI A;  1NGE A;  4CBW A;  3VES A;  5JIC A;  1CZA N;  4H0Y B;  2D0O A;  2YJE A;  3TU5 A;  3WEE A;  1S22 A;  3EO3 A;  2E2Q A;  1NGA A;  2QWQ A;  3WEE B;  3GE1 A;  1OKJ A;  1HJO A;  5AR0 A;  3L6Q A;  3MDQ A;  5BRH A;  2Q97 A;  4XH1 A;  3U9D A;  3WQU A;  3HTV A;  4GNI A;  1GLB G;  2EWS A;  4HWI A;  3QBX A;  2IVN A;  4FPA A;  4BC3 A;  3VPZ A;  2V7Z A;  2VWB A;  3EN9 A;  1EQY A;  4FWN A;  1GLE G;  1LOT B;  4PL8 A;  4NO7 A;  4H5T A;  3CQX A;  1U6Z A;  2YJF A;  4BQZ A;  2AP1 A;  4E1J A;  1Z6R A;  4CJ7 A;  5KPZ A;  3ATV A;  1JCF A;  1R59 O;  2A5X A;  4BQL A;  3EZW A;  1KAX A;  1ZBS A;  3MN6 A;  4JAX A;  4BR0 A;  4CZK A;  3FFK B;  4IO8 A;  3WXI A;  5BN8 A;  2FSJ A;  3VF4 A;  2I7N A;  5BPN A;  3LDL A;  5LY3 A;  5BN9 A;  2E2O A;  4K25 A;  2A41 A;  3SLC A;  3IDH A;  4YDU C;  2CH5 A;  2YHX A;  5KQ8 A;  4BC5 A;  3FZF A;  1ATS A;  3QFP A;  5FPD A;  5KPR A;  5I9E B;  1YUW A;  5AQU A;  1NGH A;  3QBW A;  5EY4 A;  3AAR A;  5BPM A;  1KAZ A;  3C7N A;  2E20 A;  1KAY A;  1TUY A;  3C7N B;  3UE5 A;  3BP8 A;  1HKG A;  2W41 A;  4H0P A;  2GEL A;  4IZ9 A;  1MDU B;  2E2P A;  5BRF A;  2CH6 A;  3R9P A;  2ASM A;  3U8X A;  2BUP A;  3IFR A;  1G99 A;  2NZT A;  2ZGZ A;  2IIR A;  3WUH A;  5AQM A;  3LDN A;  1QQN A;  4CZM A;  5ADX H;  2QWM A;  2DPN A;  2QWR A;  4Z94 A;  4BR4 A;  4MLH A;  5BR9 A;  4BRI A;  1BG3 A;  1NMD A;  3CJC A;  3HI0 A;  3A0I X;  3SJH A;  4BRQ A;  5BRE A;  4FWO A;  3VGL A;  4O8K A;  3GOI A;  4WQ5 A;  4XH4 A;  4F9O A;  3IUC A;  3O08 A;  5E26 A;  3KVG A;  1SQK A;  2FXU A;  1HLU A;  2E1Z A;  3MMV A;  1ZC6 A;  4CZF A;  4B1V A;  3LDQ A;  3O5B A;  3EL2 A;  4ISG A;  3IMX A;  1NGF A;  1JCG A;  4H03 B;  1P8Z A;  3ZEU A;  3H6E A;  2WUS A;  3ZEU B;  2P9P A;  4FPB A;  3WXJ A;  1NBW A;  5AQI A;  4YDU A;  3CJA A;  2W40 A;  1DEJ A;  4B1U B;  3WT0 A;  3W0L A;  4RTF D;  2HF3 A;  3KHY A;  5AQW A;  3A5O C;  4BRD A;  1ESV A;  1ZXO A;  2QXL A;  1Y64 A;  3EKS A;  3LDP A;  5FPM A;  4BR7 A;  1GLL O;  3VEN A;  3LDO A;  4WYB A;  4CZE A;  3D2F A;  4BRL A;  1BDG A;  3D2F B;  3LM2 A;  5F1X A;  4BRK A;  4Y0W A;  1MWK A;  3GDQ A;  2VCP A;  1T6C A;  3JS6 A;  4LC9 B;  1JCE A;  5AQV A;  3FR0 A;  3H1V X;  4FSV A;  3D7E O;  4EIA A;  1NGJ A;  5AQF A;  2P9S A;  4ISE A;  4DQ8 A; 
#chains in the Genus database with same CATH topology
 2P9S B;  4FJL A;  4OPK A;  3CHW A;  1VQ6 N;  3SI6 A;  4FZX C;  4B9T A;  3VA3 A;  1XMQ K;  4JD2 A;  1GOB A;  3D2E A;  4X66 K;  1RFQ A;  3V9W A;  3MCA B;  4FXD A;  3AVF A;  4C8M A;  5EXW A;  5AQJ A;  3FLC O;  3VGK A;  2NLX A;  1WOQ A;  1VSK A;  3CCJ N;  3EY1 A;  1NK6 A;  4LF6 K;  1JLQ A;  1SKW A;  3TAP A;  5C25 A;  1YIJ N;  1S72 N;  3ASM A;  1ZBH A;  3UKU B;  4AQY K;  4A62 A;  3VEX A;  4CI6 A;  4EHU A;  4FLU A;  3MN5 A;  2JWK A;  1XC9 A;  3CJ7 A;  4NCG A;  1V4S A;  1WBB A;  1XWL A;  4YOU A;  1C1C A;  4CZH A;  3R1X A;  3NH1 A;  3DLK A;  3VTI A;  3KLI A;  1VSJ A;  3A5N C;  4FWK A;  5HL7 L;  3SV4 A;  2D0C A;  2GBZ A;  2IVO A;  1C0T A;  3ATU A;  4B9L A;  4A2B A;  2Q36 A;  3AVL A;  1TVR A;  2OYQ A;  4KTZ A;  5AQZ A;  3WNE A;  1T6D A;  4KHU A;  3W3D A;  3SUN A;  3SPY A;  2E2N A;  4IJN A;  4HTL A;  4C8L A;  4FJX A;  3VEW A;  4B1X B;  5AQT A;  4B9M A;  2P9I B;  4FZY A;  4ELU A;  3CFR A;  4KHN A;  1GLF O;  3DRR A;  2P9U B;  4C8N A;  2HVI A;  3P38 A;  4H0V B;  4CJ3 A;  1C1B A;  3DXM B;  5C10 A;  1FW6 A;  2GWK A;  3CIP A;  2AJQ A;  4OKE A;  2KW4 A;  1HNZ K;  3RMB A;  3VQ5 A;  3LWL A;  4K43 A;  4FJK A;  4DU3 A;  3PO4 A;  5BRD A;  2QM1 A;  2GUI A;  3THX A;  4JI4 K;  1ATN A;  5CR4 A;  3DOK A;  2ZJQ L;  1OH7 A;  4BG8 A;  1FK9 A;  2Q0R A;  4JNE A;  4H5N A;  2D1K A;  4DHY A;  1TAU A;  3DOL A;  4BGB A;  1NJX A;  2BAN A;  1J6Z A;  4FJJ A;  3J80 O;  2HF4 A;  1Q86 O;  2HHT A;  3CG7 A;  3LP0 A;  2HST A;  3F9M A;  1JL2 A;  4KHP K;  1GOA A;  4BRO A;  4E1N A;  4PY5 A;  4O5B A;  3MN7 A;  1KLM A;  2VYP A;  1S6Q A;  3MWT A;  4YOX A;  1RDD A;  2YHY A;  3CM6 A;  4OGC A;  3Q7C A;  3V9X A;  1YTA A;  1V4T A;  1OVQ A;  4ILG B;  4KB0 A;  1X9J A;  3KWI A;  3CC4 N;  1C6V A;  1GLC G;  1X3M A;  1Q9X A;  3CER A;  1QZ5 A;  1VQ5 N;  4E7L A;  4XEI A;  4RW7 A;  1XC3 A;  2OZS A;  5DM7 L;  4GKK K;  3SPZ A;  1QQM A;  2RPI A;  1NJZ A;  4DB3 A;  3LZI A;  3DI6 A;  3DYA A;  5CYQ A;  1QS4 A;  3M8P A;  1WUA A;  1NOY A;  2OCE A;  2KLA A;  1TAQ A;  4B3T K;  4M7X A;  3P5J A;  4CEF A;  2E8A A;  2IC3 A;  1N34 K;  2ZJP L;  1YXQ A;  4JKF A;  3M3Z A;  4NYF A;  3V9U A;  1BL3 A;  5CYM A;  2WON A;  1DKG D;  3TPQ A;  2O8C A;  3PIO L;  3OHR A;  1QSY A;  5HBM A;  1K9M O;  1EO1 A;  3CPW M;  3VQ8 A;  4B1Y B;  3HVT A;  4JN4 A;  1Q7Y O;  4I7F A;  4JHD B;  4B1W B;  4DR2 K;  2KTQ A;  4HUF A;  1QHA A;  1FKP A;  3K0S A;  3AO3 A;  2P51 A;  2I7P A;  4YY3 K;  1KRP A;  4KH6 A;  3BEX A;  3RRG A;  5AQG A;  1OH5 A;  4JI2 K;  4JI0 K;  4CEO A;  4DSK A;  1P90 A;  3H3O B;  3LL3 A;  3VF2 A;  4I6M A;  5KI6 A;  4EHT A;  1M90 O;  1TV6 A;  1HQU A;  3MEC A;  4Z4E A;  5AQH A;  3CET A;  3JXU A;  2A40 A;  3Q7B A;  4FLY A;  1JLA A;  3ID8 A;  1VSM A;  2F9T A;  2V7Y A;  3HK2 A;  4JI5 K;  4J2B A;  4NB4 A;  1QZ6 A;  2H3G X;  4OO1 J;  1BGX T;  3D0P A;  4AM7 A;  3PV8 A;  3O1B A;  4BC2 A;  4FJM A;  4GV9 A;  3O9S A;  1VQO N;  3WQT A;  4CZJ A;  2P9L B;  3NF8 A;  3OS2 A;  3ZET B;  3TTC A;  5AQN A;  2D0A A;  2BH1 A;  1SAZ A;  1K6Y A;  4B9N A;  1LW0 A;  1REV A;  4HUG A;  4E89 A;  3QNO A;  2KZM A;  3TAQ A;  2FC0 A;  1CZA N;  4DV1 K;  1RBV A;  2D0O A;  1FXX A;  3VQA A;  3I56 N;  5M1F A;  3WEE A;  3VQ4 A;  1TGO A;  2D0B A;  2E2Q A;  2QWQ A;  1ZBL A;  1OKJ A;  1HJO A;  2OPP A;  4OVL A;  3EE9 A;  3MDQ A;  2W42 A;  4CEE A;  1IBM K;  5D3G A;  2JLE A;  3JSM A;  4GNI A;  2EWS A;  3QBX A;  2IVN A;  4BC3 A;  4PUO A;  5KTQ A;  3EN9 A;  2XY5 A;  1LOT B;  4PL8 A;  4NO7 A;  1U6Z A;  3S3M A;  3AVC A;  4X64 K;  2A5X A;  5SWM A;  1CXU A;  4B9U A;  4NXM K;  3K57 A;  3N4Q A;  4Z0U A;  1BCO A;  1SL1 A;  3VF4 A;  4DTN A;  4DFK A;  5BN9 A;  3OYJ A;  3O9U A;  2E2O A;  4LF8 K;  1LW2 A;  3SLC A;  4YDU C;  3RTV A;  2YHB A;  1UOC A;  2UXD K;  4DTO A;  3T1Y K;  5KQ8 A;  3E1Y A;  2HMI A;  3QIP A;  3QFP A;  4IO9 L;  3N4P A;  4R79 A;  1FJG K;  1N36 K;  2KZZ A;  5I9E B;  3HXM A;  3PX4 A;  3QBW A;  4FJI A;  1VQN N;  4JI6 K;  5I3U A;  3AVN A;  3C7N A;  1KAY A;  3SAG A;  4FJ9 A;  3BP8 A;  2E2P A;  3PY8 A;  3R9P A;  2BUP A;  4OPA A;  2NZT A;  3NF6 A;  3SJJ A;  2ZGZ A;  1OVY A;  4FM1 A;  5CZ2 A;  5CY4 A;  3LDN A;  5AQM A;  3ZSO A;  5GIO A;  2QWR A;  2X74 A;  4MLH A;  2X6S A;  1NMD A;  4JKE A;  5IWA K;  3LDS A;  4CFD A;  4NCA A;  1S1U A;  4LY7 A;  5BRE A;  4DTR A;  3VGL A;  5KRS A;  1VQ4 N;  3O08 A;  4KV8 A;  4GKJ K;  4K8Z A;  4CF8 A;  4CVN E;  3F73 A;  3BY5 A;  4Y1D A;  1C1A A;  3LDQ A;  4JI7 K;  3NHG A;  4ISG A;  2ZD1 A;  4I9L A;  3V4I A;  1P8Z A;  1BI4 B;  3O9T A;  3ZEU B;  5AQI A;  2LSN A;  2RHK A;  4YDU A;  4CEA A;  2VG5 A;  1TL1 A;  1BIS A;  4CER A;  4DS4 A;  3DLB A;  3WT0 A;  1L3V A;  3SAH A;  5GIP A;  3EKS A;  4CGF A;  1JXE A;  4O4G A;  5HLF A;  4B3O A;  3D2F A;  1BDG A;  3MX2 A;  1KVC A;  2O8B A;  5F1X A;  1NKB A;  1MWK A;  4N5S A;  4C1N K;  4CED A;  2F4V K;  3KLH A;  2VCP A;  4JRQ A;  1T6C A;  3JS6 A;  1JCE A;  2F96 A;  1JLE A;  3FR0 A;  4DLG A;  4F4K A;  3PLA A;  1HYS A;  1NGJ A;  4JI1 K;  3M5R A;  5AQF A;  3HPG A;  1U45 A;  4NLB A;  4DQ8 A;  2Y1I A;  3MXJ A;  3B8A X;  4CFA A;  3SQ2 A;  4Y1C A;  3K9K A;  4AF1 A;  1VSI A;  4V19 S;  2FSN A;  4QS7 A;  4BRP A;  4WQ4 A;  3C6U A;  3QLH A;  4Z4I A;  4ZTJ A;  1NKC A;  1TKZ A;  1SZ2 A;  3QO9 A;  3U3G A;  4DTS A;  4FYD A;  1VQ7 N;  4BRC A;  4YOT A;  2RKI A;  1VSE A;  1BA0 A;  5AZI B;  2A42 A;  4DU4 A;  1IG8 A;  3HL8 A;  1S1T A;  1S3X A;  3PUF A;  3ULE B;  1TK0 A;  3VQE A;  1IV0 A;  5CE3 A;  2XY7 A;  4X65 K;  3LP3 A;  2VG7 A;  4JI3 K;  1QQO A;  2QWL A;  5C0Y A;  3QDK A;  2G8F A;  3LPT A;  1B9D A;  3DM2 A;  4FJ5 A;  2HHU A;  2O8F A;  3WNG A;  3DWL A;  4CZL A;  3VQ6 A;  4W5R A;  3CPE A;  2P9N A;  3DJC A;  1S5J A;  3CCQ N;  3CCV N;  4KHY A;  3KJV A;  4AH9 A;  1EWR A;  4KH4 A;  1N32 K;  3FFI A;  2GV9 A;  3QML A;  2RN2 A;  5BPL A;  2F8T A;  3M1F A;  3ID6 A;  4CFB A;  3MWP A;  4E1M A;  1NM1 A;  4N76 A;  2PAV A;  2E88 A;  2OAN A;  4GVE A;  1EET A;  2NRV A;  4J8F A;  3QIC A;  4IKF A;  2P9K B;  4CHP A;  4FK0 A;  1UA1 A;  3PSI A;  1NNE A;  3ZSW A;  3TAE A;  2O8D A;  4M3W A;  3KLE A;  4MDB A;  3L4Q A;  4AM6 A;  4BGA A;  3T1H K;  5J2N A;  1HX1 A;  3T69 A;  4ID5 A;  2OZM A;  4CGJ A;  4L8R B;  3VEY A;  1BWF O;  4JYA K;  2YHW A;  5CHI A;  3AGK A;  1BOT O;  3VF6 A;  2YI1 A;  3CCE N;  1BQM A;  4HVJ A;  4O0J A;  2JGU A;  3BZC A;  2FBV A;  2QWN A;  1K8K B;  4MO5 A;  3J81 O;  4H5R A;  2F9W A;  4OLB A;  1NMN A;  5TKW A;  2OTL N;  3HM8 A;  4N47 A;  1CLQ A;  1G15 A;  2F7T A;  5C24 A;  3HBT A;  4CHN A;  4CZG A;  1BA1 A;  3AVM A;  1SL2 A;  2KHO A;  1D5A A;  4DCH A;  4F3O A;  2Y1J A;  4BC4 A;  5M1O A;  4H0O A;  2QA4 N;  4CJR A;  4CEC A;  4Z4G A;  3QES A;  1ZBU A;  4RW4 A;  1ZBF A;  4AHV A;  4QS8 A;  2UUA K;  5AZJ B;  3QEI A;  3S41 A;  4RW6 A;  4NLC A;  4DQQ A;  3KK3 A;  4CF1 A;  1SKR A;  4HTU A;  4DQS A;  1KC8 O;  4FZZ A;  4CJL A;  1RNH A;  3HPO A;  3SCX A;  4JV5 K;  3O3F A;  5KRT A;  3LP2 A;  3CQY A;  2XHB A;  3S3N A;  2VWK A;  2FBY A;  3HRG A;  3L3U A;  3TAR A;  5MLC Q;  4B9Q A;  3RVC A;  1HKC A;  2EX3 A;  1WSJ A;  4JK8 A;  2ZWH A;  2YKN A;  2IVP A;  4CHQ A;  4G9Z A;  4FM2 A;  4GMJ B;  2ZF5 O;  2P5O A;  4DV5 K;  2HHH K;  2GWJ A;  3ZSV A;  3G6E N;  3ZSY A;  3RSE B;  3H3N O;  1YI2 N;  2Q1N A;  1GLJ O;  4OKK A;  3BF1 A;  4MLE A;  3THY A;  1C0G A;  3HZ6 A;  3ENO A;  5AQY A;  4CHY A;  1UA0 A;  5ELZ A;  3OS1 A;  2NNW A;  4M3Y A;  5LJW A;  1YHQ N;  3MED A;  4LF7 K;  1X3N A;  3ITH A;  4ILH A;  2NRW A;  1RCH A;  1T44 A;  3KK1 A;  4BWM A;  4QS9 A;  1I39 A;  4F2S A;  4CGH A;  3DLH A;  4BVO A;  1BQN A;  2UYT A;  1C0F A;  2Z1I A;  1VQ8 N;  2XRI A;  3QEP A;  1N5Y A;  4FWP A;  3J7Y P;  3AAQ A;  5JS1 A;  4CD1 A;  1U2V B;  1B92 A;  1TYQ A;  5AQL A;  3C6T A;  4UQG A;  4I2P A;  3SMP A;  3NBP A;  3M8R A;  1IH7 A;  5JLH A;  4FJG A;  3BF3 A;  3TI0 A;  3UKR B;  2CGK A;  3DXK B;  3CI5 A;  2I5J A;  1Q18 A;  4ELT A;  1E3M A;  2D4W A;  1RT7 A;  3T7Z A;  1Y97 A;  3TSQ A;  3AA5 X;  4A2A A;  3J7A P;  5IT9 O;  4B1Z A;  1RT3 A;  3OA9 A;  3HT3 A;  4IJA A;  4CJ4 A;  3THW B;  2G8W A;  1KVB A;  1TUU A;  4FW2 A;  4AIL C;  5ADX A;  1NK9 A;  3O3H A;  5EOY A;  4DTJ A;  2OPQ A;  3OYD A;  1RDW X;  3HST B;  4WFB L;  1CZ9 A;  3LPU A;  4K8X A;  4LH4 A;  1RT4 A;  5B8H A;  3HYF A;  2Q3S A;  1KQS M;  2V52 B;  3R3L A;  4BR5 A;  5SZT A;  4FCY A;  4ELV A;  4JKG B;  3QET A;  1ATR A;  3HSC A;  3J8A A;  3NVK A;  4CES A;  3WXL A;  5AQP A;  1RIL A;  3BUZ B;  5DM6 L;  1RDA A;  4IFY A;  2G8U A;  2VQE K;  3HVR A;  3CCM N;  1K73 O;  4CF2 A;  1RDC A;  5JIC A;  4H0Y B;  1OH8 A;  3EYZ A;  3TU5 A;  3LAK A;  5E41 A;  4Q0B A;  3HO1 A;  1NGA A;  4QAG A;  2X6N A;  5BRH A;  3K5N A;  3L6Q A;  4JKA A;  2XY8 A;  4XH1 A;  1IKW A;  3U9D A;  1X1P A;  3WQU A;  3HTV A;  1GLB G;  4CJS A;  4FPA A;  5C42 A;  3VPZ A;  4EZ6 A;  4CK3 A;  2YV0 X;  3CQX A;  4BQZ A;  3ZYY X;  5BR8 K;  4E1J A;  4M3Z A;  3SV3 A;  1Z6R A;  5KPZ A;  3ATV A;  1ZYQ A;  3EZW A;  1KAX A;  1ZBS A;  4QCL A;  1RDU A;  4IO8 A;  3CF5 L;  5FRO A;  1QVF M;  3ISN C;  5KGX A;  2I7N A;  2YNI A;  3LDL A;  5LY3 A;  4HUE A;  4CIF A;  4MQ3 A;  3LP1 A;  2O4G A;  2PZS A;  2O8E B;  2GX9 A;  2A41 A;  4HCB A;  3IDH A;  4H4M A;  1HNX K;  2VQF K;  3FZF A;  3T3F A;  1FKO A;  4FLW A;  2YNG A;  5FPD A;  2YNF A;  1TKD A;  3CM5 A;  4KKO A;  1JKH A;  3HOS A;  4FLT A;  1NK4 A;  4NYN A;  4DSJ A;  2QK9 A;  4DTU A;  3RMA A;  4B9V A;  1RDB A;  3HPH A;  1SKS A;  1KAZ A;  1D9D A;  4JI8 K;  2E20 A;  3NGZ A;  3V1R A;  3K9J A;  3TR8 A;  2A1S A;  1MDU B;  3HJF A;  4CK1 A;  3VQQ A;  2ASM A;  3HOT A;  3JAM O;  3OYI A;  1VQM N;  1ITG A;  1G99 A;  4M3T A;  4CZM A;  5FLX O;  2QWM A;  3AVH A;  2DPN A;  4Z94 A;  1GOC A;  4CEQ A;  4DF8 A;  3AVA A;  4CHZ A;  3ZSQ A;  3D6R A;  1J5E K;  3SJH A;  3J7Z O;  3PO5 A;  2Z1J A;  4WQ5 A;  1Q9Y A;  4F9O A;  2YX6 A;  3CMA N;  3CME N;  1SQK A;  4H4O A;  3VN5 A;  4DV0 K;  4DSI A;  2FXU A;  3MMV A;  4LSL A;  3OBY A;  1WLJ A;  3O4Q A;  1YJW N;  4CJF A;  3NE6 A;  2P5G A;  1JCG A;  4OJR A;  5HP1 A;  3H6E A;  4ID1 A;  4A5A A;  3AVG A;  4FPB A;  3VQD A;  3RR8 A;  1YJN N;  3C6H A;  2W40 A;  3I55 N;  1NG9 A;  4I9Q A;  1T03 A;  1DEJ A;  3SZ2 A;  4PQU A;  4CJW A;  3QER A;  3M8Q A;  4RTF D;  2HF3 A;  3KHY A;  1ESV A;  1ZXO A;  4BR7 A;  3OTO K;  1U48 A;  4FLZ A;  3VQB A;  1SV5 A;  1S9E A;  3AA4 A;  3LDO A;  4B08 A;  1NJW A;  3SYZ A;  4BRK A;  3TSP A;  3QNN A;  1T8E A;  2QXF A;  1OH6 A;  1IBK K;  1I3A A;  1VQL N;  3GDQ A;  5J2Q A;  2PFU A;  4IFE A;  4JEP A;  4U67 L;  4E19 A;  3D7E O;  1EX4 A;  3I8D A;  3P31 A;  1J54 A;  2Z1H A;  3K59 A;  4DV7 K;  1U4B A;  1WSF A;  2HB5 A;  2P9S A;  4ISE A;  2ETJ A;  2IDO A;  3F5T A;  1RBU A;  1XQS C;  2G8I A;  1VSH A;  2X78 A;  3OJU A;  2PYJ A;  5DK5 A;  5C15 A;  4A5B A;  3VEO A;  1R0A A;  3OYG A;  2HBL A;  5AQX A;  2WTU A;  3D2E B;  1D4X A;  3P1G A;  3CCU N;  3SQ0 A;  4O5F A;  2IGI A;  1QTM A;  3SQ1 A;  3UKU A;  3LZJ A;  2HHV A;  2V51 B;  4K42 A;  3C95 A;  3TWH A;  4U7B A;  3O9R A;  3RSE A;  2G8V A;  5J2P A;  3OY9 A;  4L3Q A;  1MA9 B;  4ICL A;  4JLH A;  4WCE L;  2BTF A;  3D45 A;  3GG4 A;  1U04 A;  3F9K A;  1NWK A;  2ZGY A;  4BDZ A;  1MU2 A;  4IG0 A;  2QWO A;  4CF9 A;  2VGM A;  3THV A;  4CZI A;  1UAX A;  1NLV A;  4DWI A;  1HPM A;  3PX6 A;  2PY5 A;  4CJT A;  4CBX A;  2YCH A;  4GVM A;  3MN9 A;  1ASV A;  1L3T A;  4FJN A;  4FW1 A;  2KKZ A;  3A8Y A;  3GBT A;  4C23 A;  1LAW A;  2CGJ A;  4DS5 A;  3CC2 N;  4DLE A;  3MCP A;  3CD6 N;  3CYM A;  5CZ1 A;  4KHS A;  3IG1 A;  1U2V A;  3ZCM A;  2A1R A;  3VER A;  3ULD A;  4A57 A;  3L3V A;  4FK2 A;  1YF5 L;  2NRT A;  3CFP A;  2HOE A;  3O1W A;  4DTP A;  1IG9 A;  1NGG A;  3LAL A;  4WQ4 C;  1RBS A;  1Q8I A;  2P9I A;  5EVZ A;  3ZX0 A;  1EP4 A;  3OJS A;  1E4F T;  1T3V A;  3QEV A;  4CIE A;  1BUP A;  2ITG A;  2P9U A;  5DMR A;  1SUQ A;  4W5Q A;  2WC9 A;  1HNW K;  3DXM A;  1IKY A;  3V9S A;  3AVB A;  3OYH A;  3V81 A;  4DQI A;  2OTJ N;  4LFA K;  2YKM A;  4A61 A;  4H5W A;  1L3U A;  1RBR A;  1YTU A;  3CJ9 A;  3TAB A;  3CC7 N;  4BWJ A;  3QFU A;  4J2E A;  3QIN A;  4DR6 K;  2GTD A;  3ZT1 A;  4CIG A;  4CCH A;  2HNY A;  3CJB A;  3H08 A;  2A3Z A;  3C6A A;  3THX B;  2OA8 A;  2XY6 A;  4IWV A;  1HRH A;  1RT1 A;  4JKG A;  1YJ9 N;  1VK0 A;  4EAH D;  1DTT A;  1QE1 A;  2CGL A;  1MWM A;  1RBT A;  1JJ2 M;  2ZM6 K;  1WAJ A;  3PIP L;  1QSL A;  4BR2 A;  1XI1 A;  2FSK A;  3ZT2 A;  3HM9 A;  4FL9 A;  4DSE A;  1HMV A;  3NMU A;  3B6O A;  2Q0U A;  4RCH A;  2J4R A;  4RW8 A;  1LV5 A;  1BIU A;  5AQR A;  3ENB A;  1IKX A;  3WNF A;  2A6A A;  3FGU A;  3VGM A;  4B9S A;  1ASW A;  1HKB A;  4LH5 A;  3U4L A;  2ASP A;  3NVM A;  2Q2R A;  3UB5 A;  1ILY A;  3VQ9 A;  3O6W A;  4J2A A;  5JLF A;  2NRR A;  4CBU A;  5JVG L;  4E7K A;  3IS9 A;  2JWL A;  4B3M K;  4BRN A;  3MK6 A;  3TAF A;  3OYA A;  4CEZ A;  5H1S Q;  3SUQ A;  4ILJ A;  4LSN A;  3S9H A;  4RW9 A;  1WSH A;  4BAC A;  4M45 A;  4DR5 K;  2HBM A;  1Z05 A;  2YNH A;  4DV4 K;  4KBO A;  4AHU A;  4FWL A;  2HHW A;  3KLG A;  2O8E A;  3L2U A;  4EP5 A;  3OS0 A;  3IAY A;  3S3O A;  3AV9 A;  4M41 A;  3AY9 A;  5E84 A;  4AHC A;  2O8C B;  3O8M A;  2BDP A;  3P4I A;  3UIQ A;  3K5M A;  4JHD A;  2Q31 A;  3A5M C;  4OGE A;  4OX9 K;  4BRE A;  3P83 D;  2WFB A;  3TAG A;  4DMN A;  3M6G A;  4KAZ A;  1NKE A;  2NRX A;  4XH5 A;  4BE1 A;  4HHT A;  5EX5 A;  2NUB A;  3E01 A;  3EZ5 A;  4DFP A;  4CF0 A;  4DU1 A;  4DSF A;  5AJ3 K;  1KSP A;  3SK3 A;  3H1Q A;  4CW7 B;  3VEV A;  4AHT A;  2OPR A;  4KI4 A;  1NOZ A;  1NK0 A;  5A2Q O;  4NCB A;  3I0S A;  5J2M A;  3ALY A;  1Q81 O;  4CGG A;  4I6M B;  1XUP O;  2ITM A;  5HOO A;  3SNN A;  2DFF A;  4JS5 A;  5EU7 A;  4BE0 A;  3JYT A;  3WXM B;  3U9Z A;  4JRP A;  4DFJ A;  4C8K A;  1BCM A;  2AA4 A;  3FZL A;  4OPJ A;  4BE2 A;  1LAV A;  4MFB A;  1S1X A;  3EKU A;  4KPY A;  4FK4 A;  1BO5 O;  4FWM A;  4EZ9 A;  4IOX A;  3VQC A;  4QOZ B;  3VTH A;  4MO4 A;  2QTD A;  3VQ7 A;  5M1Q A;  2P9L A;  2ASO A;  3K2P A;  1LWC A;  4I2Q A;  3ZET A;  2UXB K;  1GLD G;  4KFB A;  4M7Y A;  1BU6 O;  4RG8 A;  1F21 A;  3EE8 A;  3VQP A;  1VRT A;  3ZT4 A;  4Q5V A;  1NGE A;  4CGI A;  2FBT A;  3VES A;  2YJE A;  3SBG A;  3RWU A;  4JKD A;  1S22 A;  1JLG A;  3OYC A;  3WEE B;  4KB1 A;  3GE1 A;  5AR0 A;  2Q97 A;  4CEB A;  1W2B M;  4HWI A;  1O1W A;  3MEE A;  3KKS A;  4DFM A;  2V7Z A;  2VWB A;  5T7B A;  5GAE P;  4F8R A;  4FWN A;  4Z4F A;  1GLE G;  3AO2 A;  4H5T A;  2YJF A;  4FLV A;  4DQR A;  4DV2 K;  4CJ7 A;  1JCF A;  1R59 O;  4BQL A;  1BIZ A;  4LF4 K;  3MN6 A;  3LAN A;  4JAX A;  4BR0 A;  4IOC L;  1HNV A;  3NGI A;  1CZB A;  5BN8 A;  4X62 K;  2W6L A;  4B3S K;  1WN7 A;  4KHQ A;  4ZTF A;  4CJ5 A;  4K25 A;  3F2K A;  1KLN A;  4B8C A;  3MXI A;  2E5L K;  5KGW A;  4C8O A;  2YHX A;  1IO2 A;  1JL1 A;  1KD1 O;  1ATS A;  1DT9 A;  2VGN A;  4W5O A;  4GV6 A;  1YUW A;  5AQU A;  3U3Y A;  1NGH A;  5EY4 A;  2OPS A;  3AAR A;  5BPM A;  4LF9 K;  2DFE A;  4R5P A;  3K58 A;  1HPZ A;  2VG6 A;  2BE2 A;  1TUY A;  3C7N B;  3UE5 A;  3ZT3 A;  1HKG A;  4H0P A;  2NRZ A;  4PHT X;  3RR7 A;  3U8X A;  4PA1 A;  3IFR A;  4DF4 A;  4DQP A;  2IIR A;  3WUH A;  1QQN A;  3CQ8 A;  5ADX H;  4CJQ A;  1XNQ K;  4BR4 A;  5BR9 A;  4BRI A;  1BG3 A;  3TSU A;  3EEQ A;  3G4S N;  4WFN L;  1S1V A;  1S1W A;  4BRQ A;  4FWO A;  4O8K A;  3GOI A;  1RTD A;  5C12 A;  3VA0 A;  2ZE2 A;  3KK7 A;  4OKJ A;  3KTQ A;  1C0M A;  1HLU A;  4B1V A;  2DY4 A;  3EL2 A;  2RF2 A;  3IMX A;  1BI4 A;  4CJP A;  4YOR A;  4CE9 A;  4H03 B;  1T7P A;  3SUO A;  3ZEU A;  4BDY A;  1WSE A;  4KTQ A;  1QVG M;  3WXJ A;  3NGY A;  1N8R O;  3CJA A;  3E66 A;  5M1P A;  4CFC A;  4B1U B;  3MX5 A;  1KFD A;  3MEG A;  1EWQ A;  3HP9 A;  4Z4H A;  1ZBI A;  2HHX A;  3A5O C;  4BRD A;  4CJK A;  1Y64 A;  3LDP A;  1VQK N;  4NXN K;  3VEN A;  4N56 A;  4F2R A;  4CZE A;  1T05 A;  3D2F B;  5HRR A;  3V1O A;  4YFU A;  4Y0W A;  2O8B B;  4CGD A;  3DLR A;  1UWB A;  2G8H A;  3DRP A;  4LC9 B;  5AQV A;  4DR4 K;  4FLX A;  3C94 A;  3K5O A;  4WQ5 C;  2HND A;  4IDH A;  3NH0 A;  3FZH A;  3I33 A;  4DR7 K;  3C0B A;  1LCU A;  4H0X B;  3OBW A;  2FF6 A;  4BRG A;  1WSG A;  3V1Q A;  4FWR A;  1YT3 A;  3CJ1 A;  4M3U A;  3KWG A;  4F3T A;  4IDK A;  4OPH A;  4K0K K;  2HBK A;  3CFO A;  1WSI A;  3OYE A;  3L2W A;  4W5T A;  4BRF A;  2DFH A;  5AZI A;  4FWQ A;  2DTU A;  4HCC A;  3KZB A;  2D0P A;  3BDP A;  3ULE A;  2PYL A;  3O9Q A;  1VHX A;  1TKX A;  2FF3 B;  3VOV A;  1S6P A;  2E1Y A;  3T1A A;  1EXQ A;  1WAF A;  3OYN A;  2Z1G A;  4MDA A;  4PKH A;  3NF9 A;  2O8F B;  4UY8 O;  2ZQB A;  3T19 A;  3LAM A;  1YVU A;  2B6A A;  4M3X A;  2P9N B;  3NFA A;  1HUX A;  4FJH A;  1KVA A;  3OYM A;  4YOW A;  4G1Q A;  5TKY A;  1QSS A;  1RT6 A;  4BG9 A;  1KXP A;  5K14 A;  4KRE A;  3ZLJ A;  2NRH A;  4E7H A;  3H46 O;  4FVU A;  2P9K A;  5FPE A;  4RWT A;  2RE2 A;  4KHW A;  2XO7 A;  4JK9 A;  4GW6 A;  1J53 A;  1RTI A;  2ATQ A;  4IEI A;  4JS4 A;  2O8D B;  1E4G T;  4DSL A;  1DLO A;  5JS2 A;  4PWD A;  3MXM A;  1C0U A;  5AQO A;  1VQP N;  2E4L A;  4B8A B;  4O44 A;  3ZX3 A;  1N33 K;  3FE1 A;  1K8K A;  3CXC M;  1ASU A;  2P9P B;  4FJ7 A;  2O4I A;  3OYF A;  4DUY K;  4H0T B;  3NH2 A;  4DTX A;  1KFS A;  4AHR A;  1VQ9 N;  2EHG A;  2YHA A;  4M63 C;  3DMJ A;  5FPN A;  2GUP A;  3OW2 M;  3VEZ A;  4FOE A;  1I94 K;  2B5J A;  4PL7 A;  3L2R A;  4IEE A;  2HMP A;  3TAN A;  5C2D A;  1NK7 A;  2WBN A;  4LF5 K;  3AVK A;  3L8B A;  4K41 A;  4C1N I;  5AFU H;  4BRA A;  4BY9 C;  4BRH A;  4E3S A;  3FZK A;  4EFH A;  3H45 C;  1NGC A;  2PBD A;  4KO0 A;  3GL1 A;  3TTD A;  5GAH P;  1NJY A;  1QQC A;  3ENH A;  4FWS A;  4B3R K;  4OLA A;  1CXQ A;  4IG3 A;  3WNH A;  5AZJ A;  3L2Q A;  2UXC K;  3ZX2 A;  1YAG A;  4CD3 A;  1KTQ A;  4E7I A;  4KTW A;  5AFU A;  1YIT N;  5HRP A;  4JKC A;  2FLO A;  4ISF A;  3QB0 A;  1YVN A;  3I8B A;  4ZHR A;  3BGR A;  3E9L A;  1NGI A;  4JD2 B;  1XHX A;  3DAW A;  4E7J A;  3O4N A;  3B6P A;  1TK8 A;  2QKK A;  3KD5 E;  5LJV A;  2F8S A;  3AAP A;  2P1J A;  4GV3 A;  2GEM A;  3AO5 A;  5AQK A;  3V6D A;  4JK7 A;  4IXC A;  4WE1 A;  1IJJ A;  4DG1 A;  2QEX N;  3G25 A;  1Z26 A;  1NK8 A;  1JLB A;  3L4I A;  4FO0 A;  3U6F A;  2QKB A;  3TAM A;  3THY B;  1KCF A;  1IBL K;  3FZM A;  5FDL A;  1J9A A;  3SUP A;  5HRO A;  1RTH A;  3VET A;  1NGB A;  1RT5 A;  4WFA L;  5AQQ A;  4KI6 A;  5F0X A;  4PKG A;  5J1E A;  3R6M A;  4JKH A;  2UUB K;  3IKM A;  5KPT A;  1XHZ A;  1VRU A;  2D5R A;  1X9W A;  3O80 A;  4DUZ K;  2IS3 A;  3DLL L;  3AGR A;  1TK5 A;  4H8K A;  3NDK A;  1W97 L;  4BRM A;  3HP6 A;  1D8Y A;  4BDP A;  2IAJ A;  1Q82 O;  3AO1 A;  1TYQ B;  3KD1 E;  1WBD A;  3UKR A;  4LFB K;  5F2R A;  1LWF A;  3DXK A;  5KQD A;  4GY2 B;  4H5V A;  3WXK A;  2QWP A;  5JVH L;  1TKT A;  4YHH K;  3L0Q A;  4YNQ A;  3ZSZ A;  3R8E A;  3OYL A;  1GLA G;  5FRM A;  4KRF A;  1H1V A;  1NGD A;  3LWM A;  4IBN A;  3IRX A;  2KFN A;  3THW A;  2HHQ A;  3LM9 A;  1HYZ A;  1JXB A;  4BVP A;  1RGI A;  3O4W A;  4CK2 A;  4IFV A;  1LWE A;  4DV6 K;  4BR9 A;  1VAZ A;  4LFC K;  1HQE A;  4FJ8 A;  5AQS A;  4N41 A;  4TSX A;  3SMS A;  3BZK A;  1A5W A;  3A5L C;  5GAG P;  1DGK N;  2QW9 A;  1VSD A;  4FOI A;  3A2F A;  4CJU A;  2E6L A;  2ZJR L;  1X9M A;  1SL0 A;  4KH5 A;  1TL3 A;  1J5O A;  4FM0 A;  4AHS A;  5JMV A;  5LMU K;  1L5U A;  1A5X A;  2B4J A;  3CCL N;  2QI2 A;  1JLC A;  4PKI A;  4WF9 L;  4CBW A;  4DTM A;  1EKE A;  1X9S A;  5GIN A;  3P39 A;  2KFZ A;  4E0D A;  3EO3 A;  3OYK A;  1K8A O;  1RTJ A;  3OVN A;  3QIO A;  3E9P A;  4IOA L;  1Z25 A;  3ZSX A;  4W5N A;  4Z4C A;  3K5L A;  1U49 A;  1EQY A;  5M1K A;  2E6M A;  2AP1 A;  3PX0 A;  5I42 A;  3G10 A;  2HW3 A;  3KLF A;  3G71 N;  4CZK A;  4DV3 K;  3FFK B;  4JKB A;  3KK2 A;  3WXI A;  4O0I A;  2FSJ A;  1VSF A;  1WNS A;  5BPN A;  2HVH A;  4M42 A;  4CHO A;  4M3R A;  5LL6 Z;  3ZSR A;  2FBX A;  3NAE A;  1A5V A;  1S9G A;  2CH5 A;  1NK5 A;  3AVI A;  3TTF A;  3G0Z A;  4BC5 A;  5HRN A;  1RT2 A;  5KPR A;  3MAQ A;  2UU9 K;  3AO4 A;  3NCI A;  3I0R A;  1QHT A;  3PSF A;  1D9F A;  1XMO K;  4LD0 A;  3NF7 A;  1HYV A;  2W41 A;  2GEL A;  4IZ9 A;  3QEW A;  2G8K A;  4DR1 K;  5BRF A;  2CH6 A;  1B9F A;  4YOV A;  3V9Z A;  4DKW A;  2HHS A;  3SAF A;  4FVM A;  1N6Q A;  3L2V A;  4EP4 A;  2KQ2 A;  3RMC A;  1HNI A;  3CJC A;  1HJR A;  1VSL A;  3AA3 A;  3HI0 A;  1U47 A;  3A0I X;  3O3G A;  5M1N A;  4XH4 A;  5GAD P;  4CJV A;  3RRH A;  3IUC A;  5E26 A;  3KVG A;  3DLE A;  1IKV A;  2HBJ A;  3KIO A;  3VMF B;  4XIU A;  1HR0 K;  2E1Z A;  2BGG A;  1ZC6 A;  1NJI O;  4CZF A;  1SS6 A;  2IOC A;  3C65 A;  3O5B A;  1W7A A;  4J2D A;  1NGF A;  3DRS A;  4CJE A;  3AVJ A;  3QEX A;  2WUS A;  2P9P A;  3KKR A;  1NBW A;  2UUC K;  3W0L A;  4A59 A;  3OYB A;  2VWJ A;  1O13 A;  3SBT A;  5HRS A;  3E9O A;  5AQW A;  3AA2 A;  1DTQ A;  1L3S A;  1JLF A;  4YOY A;  5FRN A;  2QXL A;  3ZT0 A;  1WB9 A;  5FPM A;  1GLL O;  1XNR K;  1M1K O;  4WYB A;  1W9H A;  4BRL A;  2WOM A;  2W6K A;  3LM2 A;  3CCS N;  1W0H A;  4O8U A;  5C2F A;  1NU0 A;  3CCR N;  4O55 A;  4DR3 K;  2R7Y A;  3RMD A;  3SQ4 A;  3H1V X;  4FSV A;  4EIA A;  3DLG A;  2HNZ A;  5LMN K;  1BHL A;  3M8S A; 
#chains in the Genus database with same CATH homology
 2P9S B;  3B8A X;  3F5T A;  4IDH A;  1XQS C;  3CHW A;  3FZH A;  3I33 A;  3K9K A;  4AF1 A;  3C0B A;  1LCU A;  4H0X B;  1VQ6 N;  3OBW A;  2FF6 A;  4BRG A;  5C15 A;  4A5B A;  2FSN A;  3VEO A;  4FWR A;  4JD2 A;  3CJ1 A;  3D2E A;  2HBL A;  1RFQ A;  5AQX A;  3MCA B;  4QS7 A;  4BRP A;  4WQ4 A;  3D2E B;  3KWG A;  1D4X A;  4OPH A;  5EXW A;  3CCU N;  5AQJ A;  3FLC O;  2HBK A;  3VGK A;  2NLX A;  1WOQ A;  1SZ2 A;  4O5F A;  3CCJ N;  1VQ7 N;  4BRF A;  5AZI A;  4BRC A;  4FWQ A;  4YOT A;  1YIJ N;  1S72 N;  3UKU A;  1BA0 A;  5AZI B;  2A42 A;  3UKU B;  2V51 B;  3KZB A;  2D0P A;  4K42 A;  1IG8 A;  4U7B A;  3ULE A;  3O9Q A;  3O9R A;  1S3X A;  3RSE A;  2FF3 B;  4A62 A;  3ULE B;  3VEX A;  4CI6 A;  3VOV A;  5CE3 A;  4EHU A;  3MN5 A;  2E1Y A;  4L3Q A;  1MA9 B;  4WCE L;  2BTF A;  2JWK A;  1QQO A;  2QWL A;  5C0Y A;  3GG4 A;  3CJ7 A;  3QDK A;  1V4S A;  1NWK A;  2ZGY A;  4YOU A;  4MDA A;  4PKH A;  2QWO A;  3R1X A;  4CZH A;  2VGM A;  3DWL A;  4CZL A;  3VTI A;  4UY8 O;  4CZI A;  3CPE A;  2P9N A;  3DJC A;  1NLV A;  3CCQ N;  3A5N C;  1HPM A;  3CCV N;  2P9N B;  4FWK A;  4KH4 A;  5HL7 L;  1HUX A;  4CBX A;  2YCH A;  4YOW A;  3MN9 A;  3QML A;  2IVO A;  5TKY A;  3ATU A;  2KKZ A;  3A8Y A;  3GBT A;  4A2B A;  2Q36 A;  3M1F A;  4BG9 A;  1KXP A;  4C23 A;  5BPL A;  3ID6 A;  2CGJ A;  3MWP A;  5AQZ A;  1NM1 A;  3CC2 N;  1T6D A;  2PAV A;  2NRH A;  2E88 A;  3MCP A;  2OAN A;  4GVE A;  3CD6 N;  3H46 O;  4FVU A;  2P9K A;  2NRV A;  4J8F A;  3W3D A;  3QIC A;  5FPE A;  1U2V A;  4RWT A;  2P9K B;  2RE2 A;  3VER A;  2E2N A;  4JK9 A;  4IJN A;  4A57 A;  1YF5 L;  4IEI A;  2NRT A;  4HTL A;  2HOE A;  3O1W A;  1NGG A;  4MDB A;  4WQ4 C;  3L4Q A;  4AM6 A;  1E4G T;  4BGA A;  3VEW A;  4B1X B;  2P9I A;  5AQT A;  1HX1 A;  5EVZ A;  3ZX0 A;  3T69 A;  1E4F T;  1T3V A;  2P9I B;  1BUP A;  2P9U A;  5AQO A;  1VQP N;  3VEY A;  1GLF O;  1BWF O;  2WC9 A;  2P9U B;  2YHW A;  3ZX3 A;  5CHI A;  3AGK A;  3DXM A;  1BOT O;  3P38 A;  2YI1 A;  4H0V B;  3VF6 A;  3CCE N;  3FE1 A;  1K8K A;  3DXM B;  5C10 A;  3CXC M;  4MO5 A;  2QWN A;  1K8K B;  4H5R A;  2F9W A;  2P9P B;  2GWK A;  3CIP A;  2OTJ N;  5TKW A;  2OTL N;  3HM8 A;  4A61 A;  4H0T B;  4H5W A;  3CJ9 A;  4K43 A;  1VQ9 N;  2F7T A;  4M63 C;  3CC7 N;  3HBT A;  3QFU A;  4CZG A;  5BRD A;  1BA1 A;  2QM1 A;  5FPN A;  2GUP A;  3OW2 M;  2KHO A;  3VEZ A;  4DCH A;  4FOE A;  1ATN A;  2GTD A;  5CR4 A;  4PL7 A;  3CJB A;  2A3Z A;  3C6A A;  2ZJQ L;  4IEE A;  2HMP A;  4IWV A;  4BG8 A;  5C2D A;  2WBN A;  4BC4 A;  2Q0R A;  4K41 A;  4C1N I;  4JNE A;  4H5N A;  5AFU H;  4JKG A;  4BRA A;  4BY9 C;  2D1K A;  5M1O A;  4H0O A;  4BRH A;  4DHY A;  4EAH D;  1YJ9 N;  3FZK A;  4BGB A;  2QA4 N;  4EFH A;  3H45 C;  2CGL A;  1J6Z A;  1NGC A;  2PBD A;  1MWM A;  2HF4 A;  3GL1 A;  1Q86 O;  1JJ2 M;  3TTD A;  5GAH P;  3ENH A;  4FWS A;  3PIP L;  4QS8 A;  4BR2 A;  5AZJ A;  2HST A;  3F9M A;  3ZX2 A;  1YAG A;  2FSK A;  5AZJ B;  3S41 A;  4BRO A;  4CD3 A;  4NLC A;  4FL9 A;  3NMU A;  5AFU A;  2Q0U A;  3MN7 A;  2VYP A;  4RCH A;  1KC8 O;  1YIT N;  4JKC A;  2FLO A;  2J4R A;  4WQ5 C;  3MWT A;  4YOX A;  4ISF A;  5AQR A;  3ENB A;  3CQY A;  2YHY A;  3QB0 A;  1YVN A;  3I8B A;  2A6A A;  3FGU A;  3VGM A;  3Q7C A;  1HKB A;  3E9L A;  3U4L A;  1V4T A;  1NGI A;  2ASP A;  2Q2R A;  3HRG A;  3NVM A;  3O6W A;  4JD2 B;  3UB5 A;  1ILY A;  4ILG B;  5JLF A;  3DAW A;  1X9J A;  2NRR A;  4CBU A;  5JVG L;  3KWI A;  3CC4 N;  5MLC Q;  1GLC G;  4B9Q A;  1X3M A;  3RVC A;  1HKC A;  5LJV A;  2JWL A;  3CER A;  3AAP A;  4BRN A;  1QZ5 A;  4JK8 A;  3MK6 A;  1VQ5 N;  2ZWH A;  5H1S Q;  4GV3 A;  4ILJ A;  4XEI A;  2GEM A;  1XC3 A;  2IVP A;  5DM7 L;  4G9Z A;  5AQK A;  2ZF5 O;  1QQM A;  4DB3 A;  2GWJ A;  4JK7 A;  4IXC A;  3G6E N;  1IJJ A;  3RSE B;  2HBM A;  2QEX N;  1WUA A;  3H3N O;  1YI2 N;  1Z05 A;  2KLA A;  2Q1N A;  1GLJ O;  3G25 A;  4KBO A;  4M7X A;  2E8A A;  3L4I A;  3BF1 A;  4FO0 A;  4MLE A;  4FWL A;  2ZJP L;  1C0G A;  1YXQ A;  4JKF A;  3M3Z A;  3HZ6 A;  3ENO A;  3AY9 A;  3FZM A;  5E84 A;  1DKG D;  5AQY A;  3TPQ A;  3PIO L;  3OHR A;  3VET A;  1NGB A;  5ELZ A;  2NNW A;  4WFA L;  1K9M O;  5AQQ A;  3O8M A;  5LJW A;  1EO1 A;  3CPW M;  1YHQ N;  3P4I A;  4B1Y B;  5F0X A;  4PKG A;  1X3N A;  3R6M A;  4JKH A;  2Q31 A;  3A5M C;  4JHD A;  4JN4 A;  4ILH A;  2NRW A;  1Q7Y O;  3IKM A;  4BRE A;  5KPT A;  4JHD B;  1T44 A;  4QS9 A;  2WFB A;  4B1W B;  3M6G A;  4BVO A;  3O80 A;  2UYT A;  1C0F A;  1VQ8 N;  2NRX A;  3DLL L;  1QHA A;  4XH5 A;  3AGR A;  5EX5 A;  4FWP A;  3AAQ A;  1W97 L;  4BRM A;  4CD1 A;  1U2V B;  2I7P A;  3SK3 A;  3H1Q A;  1TYQ A;  1Q82 O;  4KH6 A;  5AQL A;  3VEV A;  3BEX A;  1TYQ B;  5AQG A;  3SMP A;  3UKR A;  5JLH A;  5F2R A;  3BF3 A;  1P90 A;  3DXK A;  3UKR B;  3H3O B;  2CGK A;  3LL3 A;  5KQD A;  4GY2 B;  4H5V A;  4I6M A;  3VF2 A;  3DXK B;  3CI5 A;  3WXK A;  2QWP A;  5JVH L;  1Q81 O;  1Q18 A;  4I6M B;  1XUP O;  2ITM A;  5HOO A;  3L0Q A;  4EHT A;  2D4W A;  3R8E A;  1M90 O;  1GLA G;  3T7Z A;  1H1V A;  3TSQ A;  1NGD A;  4A2A A;  3WXM B;  5AQH A;  3U9Z A;  3CET A;  3JXU A;  2A40 A;  3Q7B A;  4B1Z A;  3OA9 A;  2AA4 A;  3ID8 A;  2F9T A;  3LM9 A;  3FZL A;  4IJA A;  2V7Y A;  1TUU A;  4BVP A;  5ADX A;  1RGI A;  3O4W A;  4BR9 A;  1VAZ A;  1QZ6 A;  2H3G X;  3EKU A;  4NB4 A;  5EOY A;  4OO1 J;  5AQS A;  1BO5 O;  4FWM A;  4AM7 A;  1RDW X;  4IOX A;  3O1B A;  3SMS A;  4BC2 A;  4WFB L;  4GV9 A;  3VTH A;  3A5L C;  5GAG P;  1DGK N;  2QW9 A;  3O9S A;  4MO4 A;  5B8H A;  2QTD A;  4FOI A;  5M1Q A;  2P9L A;  2ASO A;  1VQO N;  3WQT A;  2ZJR L;  4CZJ A;  1KQS M;  3ZET A;  2P9L B;  1GLD G;  2V52 B;  3R3L A;  4KH5 A;  4M7Y A;  4BR5 A;  3ZET B;  3TTC A;  5AQN A;  4JKG B;  1ATR A;  1BU6 O;  3HSC A;  3J8A A;  3NVK A;  2BH1 A;  5AQP A;  3WXL A;  1SAZ A;  3BUZ B;  5JMV A;  5DM6 L;  3EE8 A;  3CCL N;  2QI2 A;  4PKI A;  1NGE A;  4WF9 L;  3CCM N;  4CBW A;  1K73 O;  3VES A;  5JIC A;  1CZA N;  4H0Y B;  2D0O A;  3P39 A;  2YJE A;  3SBG A;  5GIN A;  3TU5 A;  5M1F A;  3I56 N;  3WEE A;  4JKD A;  1S22 A;  3EO3 A;  2E2Q A;  1NGA A;  2QWQ A;  3WEE B;  1K8A O;  3GE1 A;  1OKJ A;  1HJO A;  5AR0 A;  3EE9 A;  3L6Q A;  3MDQ A;  2Q97 A;  4JKA A;  5BRH A;  4XH1 A;  3U9D A;  3E9P A;  4IOA L;  3WQU A;  3HTV A;  4GNI A;  1GLB G;  1W2B M;  2EWS A;  4HWI A;  3QBX A;  2IVN A;  4FPA A;  4BC3 A;  3VPZ A;  2V7Z A;  2VWB A;  5GAE P;  3EN9 A;  1EQY A;  4FWN A;  1GLE G;  1LOT B;  4PL8 A;  4NO7 A;  4H5T A;  3CQX A;  1U6Z A;  2YJF A;  3ZYY X;  4BQZ A;  5M1K A;  2AP1 A;  4E1J A;  1Z6R A;  4CJ7 A;  5KPZ A;  3ATV A;  1JCF A;  1R59 O;  2A5X A;  4BQL A;  3EZW A;  1KAX A;  1ZBS A;  3MN6 A;  4JAX A;  4BR0 A;  3G71 N;  4IOC L;  4CZK A;  1RDU A;  3FFK B;  3N4Q A;  4IO8 A;  4JKB A;  3WXI A;  3CF5 L;  1QVF M;  5BN8 A;  2FSJ A;  3VF4 A;  2I7N A;  5BPN A;  3LDL A;  5LY3 A;  5BN9 A;  3O9U A;  2E2O A;  4K25 A;  2GX9 A;  2A41 A;  3F2K A;  3SLC A;  3IDH A;  4YDU C;  2CH5 A;  2YHX A;  5KQ8 A;  3TTF A;  3E1Y A;  4BC5 A;  3FZF A;  1KD1 O;  1ATS A;  1DT9 A;  2VGN A;  3QFP A;  5FPD A;  4IO9 L;  3N4P A;  4R79 A;  5KPR A;  5I9E B;  3HOS A;  4GV6 A;  1YUW A;  5AQU A;  1NGH A;  3QBW A;  5EY4 A;  1VQN N;  3AAR A;  5BPM A;  1KAZ A;  3C7N A;  2E20 A;  1KAY A;  3SAG A;  1TUY A;  3C7N B;  3K9J A;  3UE5 A;  3BP8 A;  1HKG A;  2W41 A;  4H0P A;  2GEL A;  2NRZ A;  1MDU B;  4IZ9 A;  4PHT X;  2E2P A;  5BRF A;  2CH6 A;  3R9P A;  2ASM A;  3U8X A;  4YOV A;  2BUP A;  4OPA A;  4DKW A;  3HOT A;  3IFR A;  1VQM N;  1G99 A;  2NZT A;  2ZGZ A;  1OVY A;  2IIR A;  3WUH A;  3SAF A;  5AQM A;  3LDN A;  1QQN A;  4CZM A;  5GIO A;  5ADX H;  2QWM A;  2DPN A;  2QWR A;  4Z94 A;  4BR4 A;  4MLH A;  5BR9 A;  4BRI A;  4JKE A;  1BG3 A;  1NMD A;  3TSU A;  3G4S N;  3CJC A;  4WFN L;  3HI0 A;  3D6R A;  3A0I X;  3SJH A;  4BRQ A;  5BRE A;  4FWO A;  3J7Z O;  3VGL A;  4O8K A;  3GOI A;  1VQ4 N;  4WQ5 A;  5C12 A;  5M1N A;  4XH4 A;  5GAD P;  4F9O A;  3IUC A;  3O08 A;  2YX6 A;  3KK7 A;  3KVG A;  5E26 A;  3CMA N;  3CME N;  1SQK A;  2HBJ A;  2FXU A;  1HLU A;  3VMF B;  2E1Z A;  3MMV A;  1ZC6 A;  1NJI O;  4CZF A;  1SS6 A;  3OBY A;  4B1V A;  3LDQ A;  3C65 A;  3O5B A;  1YJW N;  3EL2 A;  4ISG A;  3IMX A;  1NGF A;  1JCG A;  4YOR A;  4H03 B;  1P8Z A;  3O9T A;  3H6E A;  3ZEU A;  4DQ8 A;  4A5A A;  2WUS A;  3ZEU B;  1QVG M;  2P9P A;  4FPB A;  3WXJ A;  1NBW A;  5AQI A;  3C6H A;  1YJN N;  2RHK A;  4YDU A;  3CJA A;  3E66 A;  2W40 A;  1N8R O;  3I55 N;  5M1P A;  1DEJ A;  4B1U B;  3MX5 A;  3WT0 A;  3W0L A;  4A59 A;  3SAH A;  1O13 A;  3SBT A;  4RTF D;  2HF3 A;  3E9O A;  3KHY A;  5AQW A;  3A5O C;  4BRD A;  4YOY A;  5GIP A;  1ESV A;  1ZXO A;  2QXL A;  1Y64 A;  3EKS A;  3LDP A;  5FPM A;  4BR7 A;  1VQK N;  1GLL O;  3VEN A;  3LDO A;  1M1K O;  4WYB A;  4CZE A;  3D2F A;  4BRL A;  1BDG A;  3MX2 A;  3D2F B;  3LM2 A;  5F1X A;  4BRK A;  4Y0W A;  3TSP A;  3CCS N;  1MWK A;  4O8U A;  5C2F A;  4C1N K;  1VQL N;  3GDQ A;  2VCP A;  3CCR N;  2PFU A;  1T6C A;  3JS6 A;  4LC9 B;  1JCE A;  4IFE A;  5AQV A;  4JEP A;  4U67 L;  3FR0 A;  3H1V X;  4FSV A;  3D7E O;  3PLA A;  4EIA A;  1NGJ A;  3M5R A;  3P31 A;  5AQF A;  2P9S A;  4ISE A;  4NLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...