4BR7A

Legionella pneumophila ntpdase1 crystal form i, open, ampnp complex
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
356
structure length
356
Chain Sequence
PCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
total genus 116
structure length 356
sequence length 356
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4br7A01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4br7A02
5BREA 3BP8A 4B1UB 4KBOA 3H3NO 3VF6A 1QQNA 3WXIA 3IFRA 3LDQA 2FSKA 3LL3A 5BN8A 4BR0A 3SJHA 5AZIA 3M3ZA 2A5XA 2I7PA 2VWBA 5CE3A 2D0OA 3O1BA 2BTFA 1X3MA 2W40A 4XH5A 3AY9A 4FO0A 4B1WB 3FZLA 3D2EA 4JHDB 5JMVA 5FPNA 4BC2A 3BF3A 4FPAA 2PAVA 3VEVA 1S3XA 4EHTA 3WQUA 1NMDA 3IDHA 2A40A 5AQYA 4CZLA 3DXKA 4BVOA 5EY4A 2FSNA 5AQHA 3L0QA 4BG9A 3GE1A 5ELZA 4BGAA 3EL2A 2P9IA 2ZF5O 2D1KA 1HJOA 4BRGA 4BR5A 4I6MB 3ZETB 2P9NB 3MK6A 2A42A 3EZWA 5BPMA 1MWKA 3VF2A 4H5NA 1K8KA 2QM1A 2Q1NA 1QQMA 1H1VA 5JICA 3CETA 4FWMA 4M7YA 3HI0A 4FWSA 1NGAA 5AQPA 3MN6A 2GUPA 4FL9A 3IMXA 4K25A 4PKHA 1BU6O 1GLDG 1V4SA 2IVPA 2ZGZA 3ATUA 3VESA 3U9ZA 4ISGA 3C0BA 4CD1A 3ULEB 3QB0A 2A6AA 3KVGA 2DPNA 1S22A 1DEJA 4FOIA 4RWTA 2YJFA 3QBWA 4BC4A 3DXMA 3P4IA 4ISEA 5AZJB 1NWKA 4IJAA 1HKBA 2E88A 2E8AA 4BR9A 4BQZA 1MA9B 1SZ2A 3QFPA 1Z05A 3ID8A 3QDKA 1IG8A 2GEMA 5KPRA 3O80A 1NGCA 5KQ8A 2FSJA 2QWMA 2FF3B 2F9WA 4H03B 4L3QA 2E2QA 3WT0A 5AQVA 4BVPA 3LM9A 4JAXA 4H5TA 1X3NA 3HSCA 4O5FA 1DGKN 3ZEUB 2AP1A 4H0VB 3SK3A 2A3ZA 4BR2A 4JNEA 2D4WA 4H0YB 4IWVA 4BR7A 4B1XB 5FPDA 2QXLA 4H0XB 4IJNA 4CZHA 3ZX0A 3R9PA 3ENHA 4RTFD 3MCPA 5AQNA 2V52B 3O08A 4H0OA 3FFKB 4FPBA 5AQJA 5EXWA 3UE5A 5KPZA 4BRQA 2YHXA 1QZ5A 3FLCO 5BRHA 2P9LB 2QWNA 2J4RA 1BWFO 4H5RA 4BGBA 5AR0A 4HTLA 5AQTA 3WEEB 4M63C 3MN7A 2ITMA 1BO5O 4IXCA 2QWOA 4DQ8A 3VOVA 4AM6A 3QBXA 1X9JA 3H46O 3H1VX 4Z94A 3CI5A 1NGEA 5AQUA 3GG4A 3L4IA 4BRFA 3IUCA 5LY3A 4FWOA 4BRHA 3M6GA 4I6MA 5E26A 3ZETA 2CGKA 2P9NA 2P9UB 2CGJA 1XUPO 3EKUA 3O8MA 3C7NB 1NBWA 3WXJA 3KZBA 1WOQA 2YCHA 3BEXA 3HBTA 3VEXA 4JN4A 4EHUA 1HX1A 1ESVA 4QS9A 5F2RA 2V7YA 4CBUA 3ZX2A 5F1XA 3ATVA 2QW9A 5AQSA 1U2VA 3O1WA 3ULEA 5F0XA 3LDNA 1P8ZA 2Q36A 4J8FA 4B1VA 4QS8A 5AZJA 4HWIA 1OKJA 4CZFA 2V51B 2P9PB 3MN9A 3CJ7A 2AA4A 3QICA 3R8EA 4QS7A 4B1ZA 3DAWA 4EFHA 3OHRA 1GLAG 1RFQA 4CBWA 4WQ4C 3U4LA 3CJ9A 3A0IX 3FZKA 4IO8A 3VETA 1NGJA 1C0FA 3WXKA 4B9QA 3ZEUA 3W3DA 1ATNA 4FWNA 4CZKA 4PL7A 5AQRA 3H45C 1JCEA 1YXQA 5I9EB 1BA1A 1ZC6A 3JS6A 3RSEB 3FZFA 2NLXA 4IZ9A 2CGLA 2Q97A 4JD2B 5EOYA 3FGUA 2IVOA 1XC3A 1SQKA 2YJEA 3CJCA 5AFUH 3J8AA 3VEZA 3VEOA 4FSVA 4B1YB 3H6EA 5KQDA 2GTDA 4MLEA 1KXPA 1ZXOA 3SMPA 3GOIA 1MWMA 3A5MC 3LDLA 5EX5A 3O4WA 3WQTA 4ISFA 2E1ZA 2P9LA 4K41A 4BRPA 1CZAN 2OANA 4BC5A 4A2AA 3WEEA 4YDUC 5BR9A 4WQ4A 4CZEA 1BA0A 2Q2RA 3GBTA 3SMSA 2QWPA 4DCHA 5AQQA 1T6DA 2PBDA 2ASMA 3LDPA 4BRAA 1JCGA 3O6WA 1ATSA 1GLEG 3UKUB 1XQSC 3AAPA 4A2BA 2P9KB 2BUPA 2IVNA 1TYQB 3FE1A 3KHYA 4BRNA 3B8AX 3I8BA 1V4TA 2HOEA 2I7NA 3D2FB 5FPMA 5BRDA 2ZGYA 2QWQA 3C7NA 1KAXA 2ZWHA 1G99A 2Q0UA 1HKCA 2QWLA 1LCUA 5E84A 2VCPA 3TU5A 4EAHD 5TKYA 5BPNA 1KAYA 4CZJA 1D4XA 4BRKA 5LJWA 3UKRB 3FZMA 4JHDA 4MO5A 4FWKA 4NO7A 5EVZA 3VEYA 2NZTA 1YAGA 1Z6RA 3M1FA 3D7EO 2GWJA 3LDOA 3G25A 3S41A 3GDQA 2P9PA 2GWKA 4H5WA 2VYPA 4FOEA 3MN5A 1QZ6A 3QMLA 5FPEA 3CIPA 5AQIA 1MDUB 1GLFO 1TUYA 3DXMB 5ADXA 5AQWA 4BC3A 3VF4A 4BRIA 3TPQA 1TUUA 4BRMA 3A5LC 1NM1A 2ASPA 4CZGA 5KPTA 4LC9B 5B8HA 5BRFA 2P9SB 3RSEA 2Q31A 3JXUA 3UB5A 2FLOA 3ENOA 3U8XA 1RDWX 3CQYA 1HUXA 4JD2A 2V7ZA 5AFUA 1DKGD 5AQXA 3VENA 4A62A 5AQZA 1ATRA 3L6QA 4WQ5C 4O8KA 4AM7A 1EQYA 1HLUA 1R59O 3AARA 3CERA 2QWRA 5LJVA 3R6MA 4PKGA 1LOTB 4BQLA 2YHWA 5AQFA 3I33A 4F9OA 1E4GT 3A8YA 1WUAA 1NGFA 3EO3A 1SAZA 5ADXH 3MMVA 2E1YA 2WUSA 4GNIA 1GLBG 3UKUA 4K43A 1HPMA 2UYTA 2YHYA 3O5BA 1QQOA 1KAZA 3SLCA 2P9KA 3FZHA 5JLFA 2E2PA 4H0PA 5AQLA 1TYQA 3FR0A 3VGKA 3WXLA 4RCHA 4XH1A 4WQ5A 4MO4A 4CZMA 3CQXA 4H0TB 1GLCG 3D2FA 3EN9A 2CH5A 3H3OB 2KHOA 2GELA 4PKIA 4NB4A 4CI6A 3HZ6A 2EWSA 5BN9A 2Q0RA 4BRDA 3ZX3A 5BPLA 4BR4A 1JCFA 1NLVA 1RGIA 3UKRA 5AZIB 4MLHA 4A61A 4XEIA 1U2VB 1Q18A 3QFUA 3DWLA 2D0PA 4FWRA 3D2EB 4PL8A 4BRCA 1BUPA 4CZIA 1E4FT 3A5NC 2FF6A 4K42A 3VGMA 5JLHA 2IIRA 1NGIA 2P9UA 1NGHA 5AQMA 3DXKB 4H5VA 3VPZA 3EKSA 2P9SA 2HF3A 5AQKA 2P9IB 1NGBA 1YVNA 3BF1A 3U9DA 4GY2B 1IJJA 4FWLA 4Y0WA 1U6ZA 1Y64A 1T6CA 2E2NA 3H1QA 4YDUA 2NRHA 2ASOA 1HKGA 1K8KB 3W0LA 4XH4A 4CJ7A 3CJBA 3HM8A 2H3GX 4BRLA 4CD3A 1GLJO 3CHWA 4E1JA 3CJ1A 1BDGA 3GL1A 2HF4A 3VGLA 1GLLO 1NGDA 1C0GA 2E2OA 3BUZB 2CH6A 4CBXA 4FWQA 4WYBA 3DJCA 4C23A 2F9TA 3VERA 4DB3A 5AQGA 4M7XA 2HMPA 4BREA 5AQOA 1QHAA 4BROA 1ZBSA 1J6ZA 3MDQA 4EIAA 1T44A 3A5OC 4BG8A 3WUHA 3CJAA 3F9MA 1BG3A 1YUWA 2W41A 2E20A 3LM2A 2FXUA 1NGGA 3VEWA 1BOTO 4DHYA 3HTVA 3AAQA 4FWPA 2A41A 2YI1A
chains in the Genus database with same CATH superfamily
5BREA 1U48A 5SZTA 1NJXA 4JI1K 4KBOA 1J53A 1T03A 2FSKA 3AA4A 4BR0A 1J5EK 3QERA 3M3ZA 5CE3A 5TKWA 3O1BA 1VQ8N 4FJLA 1N34K 2W40A 1C1BA 3AY9A 4FO0A 3L4QA 4JHDB 4H8KA 3BF3A 1C0MA 3LP2A 4DQPA 4EHTA 4CJFA 3IDHA 3R1XA 4BE1A 4CZLA 4KB1A 5KTQA 4BVOA 2FSNA 2VGMA 3L0QA 3PIOL 3NGYA 4BG9A 3BZCA 3GE1A 4DG1A 3EL2A 1IV0A 3VQ4A 3F2KA 2HBJA 4HVJA 2D1KA 4BR5A 4Y1CA 1ASVA 2RPIA 2RN2A 2YX6A 5BPMA 3I56N 1MWKA 2QM1A 4KH5A 5JICA 1VQ6N 4FWMA 4FWSA 3NH0A 2GUPA 4ZTJA 4KO0A 4K25A 4ZHRA 1V4SA 3ATUA 3VESA 3LDSA 3P83D 2BE2A 3U9ZA 4LSNA 3QB0A 2A6AA 4OLAA 4E7HA 2DPNA 1TL3A 3S9HA 4B3SK 1DEJA 4Z4EA 4RWTA 2YJFA 3K5LA 3NF6A 3U3YA 2BANA 3DXMA 1LV5A 4ISEA 4DR4K 1NWKA 1HKBA 2E8AA 3CCRN 2DFEA 1MA9B 1RNHA 1IG8A 2VGNA 2GEMA 3RWUA 1BL3A 3O80A 4FJIA 3P1GA 2QWMA 4H03B 1VQ7N 4Q0BA 2E2QA 3VQCA 1SKSA 5AQVA 4E7IA 4E19A 2KLAA 4JAXA 4BE2A 3ZEUB 1VQ4N 3KD5E 4JNEA 2HNDA 4ILGB 2O8CB 3BDPA 4CZHA 3ZX0A 3R9PA 2VQFK 3MCPA 5AQNA 2RE2A 2V52B 3FFKB 3QO9A 4IEEA 4JKCA 1VQPN 1D9FA 1VQLN 2UUBK 5LL6Z 2J4RA 1BWFO 1XNRK 4BGBA 1VRUA 4UQGA 1VAZA 5AQTA 3WEEB 4FLTA 2ZE2A 2ITMA 3T1HK 1HNIA 3SQ0A 1EP4A 5AJ3K 3BZKA 4CGGA 3D6RA 3Q7CA 3O3GA 1BCMA 2OPPA 4LF4K 4I7FA 4Z94A 3VQ5A 1NGEA 3DLHA 3ZT2A 4JV5K 3GG4A 3OTOK 4A5AA 3ZSQA 4I6MA 4F4KA 3MEGA 1JKHA 4ILHA 5C12A 3K59A 2CGJA 2BGGA 3CCMN 3THVA 1JLCA 3O8MA 1RTJA 3WXJA 3KZBA 1WOQA 3VEXA 4E7KA 4RG8A 1QSLA 3NDKA 3EZ5A 3O1WA 2WFBA 2QKBA 5AZJA 4PA1A 3RR7A 3LAMA 4KPYA 1B9FA 2DFHA 2KQ2A 4OGCA 3SBGA 4CZFA 3MN9A 4ELUA 4QS7A 5FDLA 3LPUA 1GLAG 1NNEA 4CJTA 1WNSA 3E66A 3TTDA 4CGIA 1VSEA 3WXKA 3KIOA 3TANA 3K9JA 4NCGA 1JCEA 4KKOA 4LF9K 4AHUA 3JS6A 2WC9A 5GAHP 3OW2M 2W6LA 4DLEA 1RT6A 3FGUA 3CJCA 3VEOA 2F8SA 5HP1A 5KQDA 4FW1A 1KXPA 3V1RA 2HHWA 3GOIA 3QEIA 3PO4A 3ENBA 3LDLA 5EX5A 1WSGA 3WQTA 4ISFA 2E1ZA 4K41A 4X64K 2HBLA 2OANA 1KSPA 4BC5A 3KLIA 4YDUC 1S1VA 5BR9A 4CZEA 1TK8A 1RT7A 3V9SA 2HHUA 3DOLA 3SMSA 2QWPA 3TTFA 3LWMA 3MX5A 2QEXN 4LF7K 3ASMA 3O6WA 4DS4A 2P9KB 1FW6A 4F8RA 1TAQA 2HOEA 1N5YA 3PSIA 5FPMA 4FLZA 3C7NA 4CF1A 3CPWM 5JS2A 2Q0UA 1GOBA 1RDBA 2IS3A 2UUAK 1LCUA 4DSIA 4C8MA 2HVHA 4BRKA 4AHVA 4WFNL 2QKKA 4CEEA 4CIGA 5EVZA 3CC4N 2DTUA 3C6AA 3M1FA 1Z6RA 3G25A 3S41A 4H5WA 2F8TA 5FPEA 5AQIA 5M1NA 4X65K 4LH5A 1GLFO 2B4JA 5M1PA 3DXMB 4FLXA 4E7LA 2KFZA 4BC3A 3VF4A 1QTMA 1JXEA 4CZGA 4E1NA 3MECA 1LAVA 1VQMN 3QETA 4LC9B 5HRRA 5B8HA 4R79A 4OLBA 3JXUA 2FLOA 3VTHA 1RDWX 1TL1A 4JKGA 4B9SA 4OPKA 1DKGD 4QAGA 5T7BA 2XY6A 1NK5A 3HP6A 1KD1O 2YV0X 1ATRA 4DU1A 3OYHA 2W6KA 3TI0A 3DRSA 4O8KA 4JKEA 1EQYA 1HLUA 4DR5K 3AARA 3AVHA 4J2EA 2Z1HA 3U3GA 3L8BA 4O0JA 4B8CA 4MDBA 2X78A 4FLWA 4BQLA 3I33A 4F9OA 3HJFA 3SZ2A 3AVKA 3DMJA 5C0YA 2VQEK 3LPTA 2HBMA 1UWBA 3G71N 4DV4K 5ADXH 4I2QA 4JI4K 1RTIA 2X6SA 4CHPA 4K43A 4A59A 1HPMA 2NRZA 1SL2A 2YHYA 4Z4HA 4M45A 3FZHA 3V1OA 5AQLA 1TYQA 3FR0A 3SUOA 4WE1A 1Z25A 1IKYA 4RCHA 1F21A 4DFMA 4DF4A 3D2FA 1KRPA 2VG7A 3T3FA 2YKNA 4LD0A 3KKSA 5E41A 2KZMA 5C15A 2EWSA 4FYDA 1XMOK 1BIUA 3L2VA 4DV2K 2OA8A 4WCEL 1W2BM 1JCFA 1NLVA 4RW7A 3TWHA 2Z1GA 4M3ZA 3DI6A 4CJSA 4DLGA 2FBTA 5LMNK 4FM2A 1RBTA 2D0PA 4PL8A 1VQON 1N36K 1E4FT 4DFJA 1JLQA 1TK0A 2FF6A 4LFCK 1QHTA 4IG0A 3TAMA 4H5VA 3SBTA 2RHKA 2HF3A 4DWIA 4DR6K 3V81A 1Y64A 4YDUA 3H1QA 1K8KB 3W0LA 5J2QA 3J7ZO 3CJBA 1FKOA 1OH6A 1HYZA 3LP0A 3SQ4A 4FZXC 4OPHA 3KJVA 4B3RK 4FLVA 1DTQA 1BDGA 3NH1A 1HNZK 4B3TK 3VMFB 4CFCA 2DFFA 3HVRA 3E9OA 1VSIA 1VSDA 2XRIA 4C23A 3DJCA 3D0PA 4DB3A 2P1JA 4CFBA 1I3AA 4GMJB 1RTDA 4EP5A 4DTUA 4GV9A 3PX0A 4HUEA 3BY5A 5H1SQ 3LAKA 3WUHA 2VWKA 3ZT1A 3CFRA 1GOAA 3CJAA 3F9MA 2E20A 4IDKA 4YORA 5IWAK 1S6PA 5MLCQ 3HTVA 4O4GA 1VQ5N 3QINA 3P31A 1A5XA 4B9MA 5M1QA 1A5WA 4BACA 1YJ9N 3BP8A 3ZT0A 1MU2A 3PUFA 2WONA 4KHNA 2F96A 3LDQA 1C0UA 3ZT3A 5AZIA 1BGXT 1JJ2M 3RR8A 1L5UA 2O8BB 2BTFA 1Q86O 1Q9YA 4LF5K 1JLFA 4JRQA 1NK9A 3FZLA 1JL2A 4E0DA 3I0SA 2NRVA 4NLBA 4YOTA 5FPNA 4OVLA 4FPAA 2PAVA 5BR8K 3OYFA 1S3XA 1T3VA 3ZSVA 4BDYA 1VRTA 3NGZA 5AQYA 1TKTA 4M41A 3DXKA 4ELVA 2G8FA 5AQHA 3HPGA 4BGAA 2FBXA 5ELZA 4KB0A 2P9IA 1Y97A 4CECA 4DSJA 2JLEA 4CEFA 4IFYA 2F4VK 3CQ8A 4H5NA 5KRTA 2AJQA 1QQMA 3ZSXA 1SKRA 1NGAA 2KFNA 4DF8A 1GLDG 2ZGZA 4JKGB 1N33K 3TSQA 3PO5A 1M90O 1NK6A 2HHHK 4CD1A 2ZJRL 4RW4A 4IOCL 3RMAA 3SUPA 4BC4A 4IJAA 4YOYA 3PV8A 4CGJA 4CGDA 1RT1A 3VQAA 4JK9A 4JI7K 1RBUA 5C2FA 3BGRA 1NGCA 3QEPA 4FJ9A 4BWMA 1TVRA 2FF3B 5C25A 3ZCMA 1ZBLA 4BVPA 3LM9A 3KK1A 2HVIA 4DTNA 2D4WA 4H0YB 3LZJA 1YITN 4B1XB 5GIPA 3VN5A 4H0XB 4IJNA 3L3UA 4IO9L 3QNOA 2OYQA 5HOOA 4K8ZA 1X9SA 2OZSA 3UIQA 1R0AA 5EXWA 3C65A 1NOYA 1RT3A 4CF9A 1QZ5A 4IEIA 3OYCA 2QWNA 3DRPA 4NXMK 3B6PA 3MN7A 4IXCA 4NLCA 4U7BA 3AVLA 1X9JA 4FJ8A 4XIUA 4HTUA 2HSTA 3WNEA 1NKEA 3H1VX 1L3VA 5HRPA 3HRGA 5LY3A 4FWOA 4LSLA 4B3OA 3G6EN 3ZETA 2CGKA 2P9NA 3IAYA 1OH7A 1XUPO 3I8DA 5KI6A 1KVBA 1WSJA 1VHXA 2O8EB 1VSMA 4EP4A 1ESVA 4YOUA 3NMUA 3E9LA 3O3HA 3CC2N 3KWGA 3ULEA 5AQSA 1U2VA 4RW6A 4CEZA 3QEXA 3NVKA 2Q36A 5FROA 4J8FA 4B1VA 1BI4B 2P9PB 2AA4A 4DR3K 4B1ZA 3DLBA 1NJYA 5GAEP 4JRPA 4W5OA 1BQMA 1XI1A 3U4LA 3A0IX 4NCAA 3EE8A 1S9GA 2PFUA 2WBNA 3FFIA 3W3DA 3AVAA 5CZ1A 4CZKA 1IBKK 1QS4A 1YXQA 3RSEB 4CEDA 4DSFA 4J2AA 1TAUA 4JD2B 4RW8A 1HQUA 5EOYA 2O4IA 3VEZA 2YJEA 5AFUH 3J8AA 4E3SA 4FSVA 3H6EA 2GTDA 4MLEA 4HHTA 1MWMA 3G10A 3O4WA 1IO2A 3ALYA 1IBMK 3AVBA 2P9LA 3T1YK 4GKKK 1SL0A 1RT2A 4A2AA 5KGXA 4FZZA 1OH5A 4WQ4A 4PUOA 1EX4A 4JI2K 2OTLN 4DV1K 4YNQA 3THWB 2Q2RA 3I55N 4DCHA 4OPAA 4G9ZA 4OJRA 3LDPA 1JLAA 1GLEG 3UKUB 1XQSC 3VQEA 1SKWA 3MEDA 4N41A 4NYNA 4CK3A 3AAPA 4KHQA 2HHXA 1CXUA 3FE1A 3B8AX 3O9RA 4DU3A 4IFEA 1V4TA 2O8DB 2O8FB 3DOKA 2XY8A 4CF2A 3CC7N 2YHAA 3S3OA 3DRRA 2ZGYA 2PYLA 3F5TA 1KAXA 2ZWHA 3RVCA 2QWLA 4GV3A 4FJHA 4EAHD 1KAYA 4CZJA 2OPSA 4JKFA 5CZ2A 2ZJQL 2XO7A 4DUYK 1HQEA 3THYA 1NKBA 2GWJA 4KFBA 2GWKA 2VYPA 1VSLA 1QZ6A 3MN5A 3DYAA 3ZSOA 4ILJA 1S1TA 1RCHA 2RKIA 3OA9A 4CHQA 3L2UA 4B9TA 3RTVA 1TUUA 4ID1A 5CR4A 4LFAK 4OO1J 4CJ3A 3CCSN 3K5NA 3QEVA 3JSMA 1K9MO 2E5LK 3PX6A 2NUBA 2P9SB 4J2DA 3O9TA 2Q31A 3QESA 2GUIA 3KLFA 3U8XA 4YY3K 3WNGA 1HUXA 1NJIO 4M3WA 5AFUA 5IT9O 4B8AB 2HHQA 3CM5A 5AQZA 4FM0A 1RDCA 3L6QA 1VQ9N 1FXXA 5HROA 3Q7BA 1QVGM 1R59O 3EY1A 1YHQN 1TKDA 5LJVA 3R6MA 1LOTB 2D0AA 3SAGA 2YHWA 1ZBIA 3A8YA 5DMRA 2ATQA 1CLQA 1W0HA 3EO3A 1SAZA 2E1YA 2WUSA 1NK0A 4QCLA 2UXCK 2UYTA 4CF0A 1KAZA 5JLFA 3VGKA 4CJQA 1RBRA 2PY5A 3EN9A 1Q82O 4CJ4A 1U47A 1XHXA 4PKIA 4CJPA 4NB4A 3K57A 4C1NK 4JLHA 4BRDA 2HB5A 3NF8A 4LFBK 3SPYA 2HNYA 3ITHA 5CYMA 5CYQA 4J2BA 3JYTA 3QIOA 1RGIA 3UKRA 3HOTA 4WFBL 2NRXA 3I0RA 3E9PA 4W5RA 3VA0A 4KHYA 1UOCA 4XEIA 4LY7A 4Z4GA 2OCEA 4JK7A 1U2VB 1OVYA 1X9MA 1JLEA 1BUPA 4A5BA 3VQ8A 3ZYYX 2HW3A 1JXBA 1NGIA 1NU0A 4DSLA 1C1CA 4LF6K 3VPZA 4GY2B 3WNHA 3KKRA 4C8LA 2X6NA 2E2NA 4Q5VA 3SV3A 4KTQA 4OGEA 3TAQA 4B9UA 3PSFA 3AVGA 2JWKA 3AA3A 2YNHA 3G0ZA 2H3GX 3RMDA 3NGIA 1O1WA 3N4PA 4BRLA 1FKPA 4JS4A 3AO2A 2G8VA 4FVUA 4KAZA 3M5RA 1W9HA 3GL1A 2HF4A 4PHTX 1NGDA 2E2OA 1XMQK 3BUZB 4CK1A 3AVCA 3OYEA 1U04A 3RMBA 3O9QA 3M8QA 4WYBA 3TSPA 3MEEA 1IKXA 5AQGA 4CJWA 5JVGL 4BREA 1N8RO 5AQOA 4CERA 4FM1A 3V6DA 1QHAA 2G8KA 4F2SA 4CEQA 1J6ZA 3SQ1A 4CHYA 4TSXA 3VQ9A 4E89A 4FJMA 2UXBK 1ZBUA 2EX3A 4ID5A 3LP1A 2W41A 3IRXA 4H4OA 4HUGA 1NGGA 4M42A 1BOTO 5GADP 3OBYA 2E4LA 4FWPA 4DV7K 2A41A 2YI1A 3OYMA 4JI0K 4B1UB 3VF6A 1LAWA 1QQNA 3IFRA 5BN8A 1BHLA 3MAQA 3SJHA 2VWJA 4OX9K 2NRWA 2VWBA 4KRFA 1EETA 3NE6A 2HHSA 2D0OA 3CMAN 4CVNE 3PLAA 3AVNA 2ITGA 1X3MA 3KWIA 2G8IA 4JK8A 4AHSA 4CESA 2KW4A 3D2EA 3NVMA 5K14A 3IKMA 5JMVA 3TABA 3SAHA 4BC2A 5HBMA 1T05A 1B92A 3HSTB 4LH4A 2D0BA 4X66K 3THXA 3M8RA 5EY4A 4W5NA 4O55A 4UY8O 4CF8A 4V19S 2QXFA 4FLYA 2ZF5O 4N56A 4BRGA 4DMNA 4I6MB 4QOZB 1I39A 3MK6A 3OS1A 3EZWA 3VF2A 4AHTA 3VTIA 4W5QA 4M7YA 1WAJA 3NFAA 2F7TA 1J5OA 1WSFA 1BU6O 3A2FA 4PKHA 1GOCA 3MXIA 2OPRA 1FK9A 1CZBA 4CE9A 1BIZA 1S22A 1REVA 5KGWA 4FOIA 3N4QA 3DLGA 2HHTA 3VA3A 3P4IA 5AZJB 4BQZA 4BR9A 2E88A 5DM6L 2KTQA 4DQRA 3QFPA 3ID8A 3QDKA 4O0IA 5LMUK 1EWQA 1Q7YO 3CPEA 3P39A 2FSJA 2F9WA 3T7ZA 1ZYQA 4KHUA 4GW6A 3AVFA 4B08A 2GV9A 4CFAA 4RW9A 1HPZA 1DGKN 4O5FA 4H0VB 3SK3A 4AF1A 4DTMA 2GBZA 3SPZA 4B9NA 4C8KA 1EKEA 5FPDA 2QXLA 1XNQK 1WSHA 1YI2N 4ELTA 1NK8A 4M3UA 1TKZA 3O08A 1Q8IA 1LW0A 4FPBA 5AQJA 3UE5A 4BRQA 1SV5A 3FLCO 2D0CA 5BRHA 3SV4A 5AR0A 4HTLA 3V9ZA 4M63C 3LP3A 1BO5O 1BCOA 2QWOA 2EHGA 1VK0A 4AM6A 1ZBFA 3H46O 4JKHA 1TV6A 5AQUA 4CJ5A 4DR2K 3IUCA 3CFPA 4CJLA 5KRSA 4DR1K 5E26A 1NKCA 3MXJA 1VSJA 3HT3A 3JAMO 3EKUA 5M1KA 3C7NB 1KFSA 1NBWA 3EE9A 4JN4A 1HX1A 5C42A 3CCQN 5F1XA 2HNZA 3ATVA 5J2NA 4CK2A 3SNNA 1K8AO 5F0XA 4BY9C 4FVMA 3LDNA 3O3FA 4FJ7A 2JGUA 4Z0UA 1X1PA 3J7AP 4JI3K 5C24A 1N32K 1YF5L 4DTSA 3CJ7A 5I42A 2UXDK 3DAWA 4FZYA 3CCJN 1RFQA 4CBWA 4WQ4C 3KLHA 4BDPA 3SYZA 3QEWA 2BH1A 4CIFA 2G8UA 3FZKA 4IO8A 3VETA 1NGJA 4YOVA 4AHRA 3ZEUA 1NG9A 4NYFA 4FWNA 4PL7A 5AQRA 3H45C 4YFUA 5I9EB 3CCEN 1BA1A 1ZC6A 3ZSYA 3LALA 3QLHA 1DLOA 4IZ9A 3KTQA 4JEPA 2IVOA 1XC3A 1SQKA 4B1YB 2B6AA 1K73O 4AHCA 3V9WA 4YOXA 1ZXOA 1T7PA 4ZTFA 3A5MC 4E7JA 3KLEA 4BRPA 4FJGA 2HBKA 5EU7A 3V4IA 3WEEA 3S3NA 1N6QA 3ID6A 1IKVA 4KREA 2UUCK 3C95A 1RBSA 1X9WA 3ZSZA 2WOMA 5AQQA 1BISA 1WN7A 1S5JA 2PBDA 3C94A 4DQSA 2A1SA 1ATSA 1CZ9A 1EWRA 3V9XA 4MQ3A 4YHHK 3NF9A 2IVNA 1TYQB 3KHYA 4BRNA 3HVTA 3I8BA 2W42A 2PYJA 2I7NA 3ZSWA 3K0SA 3D2FB 1L3TA 4DTPA 2QWQA 3O9UA 3F73A 1YJWN 4CEBA 1HKCA 5HLFA 1LWEA 2VCPA 3TU5A 3K5MA 1D4XA 4DFKA 1Q81O 2ZM6K 4MO5A 1RT5A 3VEYA 1WSIA 1HJRA 3T69A 4L8RB 3RRHA 3D7EO 1W7AA 1QSSA 3D45A 1HNVA 4FOEA 3PX4A 3QMLA 3CIPA 1MDUB 1C0TA 1TUYA 3VQ6A 3CD6N 1D5AA 3CF5L 1NM1A 5GAGP 2ASPA 4DR7K 4E1MA 3AA5X 4CHNA 1SL1A 1NOZA 1OVQA 1KLNA 3CQYA 3OYJA 1RBVA 1TK5A 5AQXA 4FK4A 1KLMA 4A62A 1KC8O 4CFDA 2RF2A 4DTXA 3AVIA 3TR8A 3AV9A 4CW7B 4PKGA 1YJNN 3DLLL 3ULDA 5AQFA 1E4GT 4KH6A 4M3YA 1WUAA 2XY7A 1NGFA 1A5VA 2E6LA 3CCUN 1TKXA 3KK7A 3OJUA 3EEQA 4GNIA 1SUQA 3O5BA 1QQOA 3SLCA 2P9KA 4CEAA 1D9DA 2E2PA 4H0PA 2Y1IA 2FBVA 3WXLA 1G15A 4JKDA 2ETJA 4WQ5A 3CQXA 5C10A 4HCBA 2KHOA 2FBYA 4CI6A 1YIJN 4CEOA 5BN9A 3ZX3A 1NK4A 1S1XA 4DU4A 4CIEA 1QQCA 4JS5A 1LWCA 2P51A 3HM9A 1HNWK 4FJNA 3C6HA 3HP9A 4DV0K 4I9QA 2R7YA 5AZIB 3OYDA 1ZBHA 4A61A 1L3UA 2IOCA 2E6MA 3O9SA 1S72N 3TAGA 4FXDA 5J1EA 3VQPA 4CZIA 5D3GA 3A5NC 4K42A 2DY4A 4KV8A 5M1OA 3VGMA 5JLHA 2IIRA 4WFAL 4FCYA 2NRRA 4K8XA 2P9UA 1NGHA 1HMVA 4R5PA 5HRSA 3DXKB 1QE1A 3CFOA 4DSEA 1NJWA 1KQSM 2OZMA 4IOAL 2P9IB 1NMNA 1YT3A 3TAEA 3U9DA 3C6TA 3SUNA 3S3MA 4M3XA 3EYZA 1U6ZA 1T6CA 2ASOA 1HKGA 4CJEA 2IC3A 1SS6A 1O13A 4GKJK 4XH4A 4CJ7A 3HM8A 4EZ9A 5JVHL 3DLKA 3OYNA 3CHWA 4E1JA 4FW2A 3CJ1A 4FK0A 4JKBA 4C1NI 1EO1A 4DTOA 2CH6A 2LSNA 1U45A 2BDPA 4FWQA 3HK2A 2Z1IA 2F9TA 2IAJA 3VERA 4KHPK 4M7XA 2HMPA 3OY9A 3MDQA 3DLRA 1S1UA 3AVJA 4AH9A 1XWLA 5CY4A 3TSUA 1BG3A 3LM2A 2FXUA 3E1YA 4DHYA 3K5OA 3AAQA 3C6UA 2KKZA 1HJOA 1KCFA 3MWPA 4DUZK 3H3NO 5J2MA 3WXIA 1VSFA 2YNFA 3LL3A 4CGHA 3J81O 2ZJPL 2QA4N 1UA0A 3F9KA 4KI6A 2A5XA 2I7PA 4KI4A 3L3VA 3KK2A 3L2WA 2Y1JA 1WAFA 4XH5A 4B1WB 3HPOA 3CM6A 3MX2A 3DLEA 3TTCA 2YHBA 4JI6K 4FJJA 2YNGA 2OPQA 3VEVA 3T19A 2UU9K 3WQUA 3J80O 1NMDA 1T8EA 2A40A 4FK2A 1UA1A 3AO5A 4F3OA 5A2QO 4IG3A 4DV6K 3DM2A 2VG5A 4OKKA 3ZETB 2P9NB 2A42A 1QVFM 1Z26A 1W97L 1K8KA 3LANA 2Q1NA 1H1VA 3CETA 2A1RA 3HI0A 2PZSA 5AQPA 4DQIA 3L2QA 4NXNK 1KVCA 3MN6A 4FL9A 3IMXA 3RRGA 2IVPA 2G8WA 1YTUA 3E01A 4ISGA 3C0BA 3ULEB 3AGRA 3KVGA 3VQDA 3K58A 3QBWA 1JLGA 3NHGA 2IDOA 3OYBA 3SUQA 3ZT4A 4W5TA 3OS2A 3IS9A 4YOWA 1SZ2A 1Z05A 4NCBA 3T1AA 2YNIA 5KPRA 3V1QA 3G4SN 4I9LA 5KQ8A 4L3QA 3WT0A 4CGFA 4H5TA 1VSHA 1X3NA 1M1KO 3HSCA 1KTQA 1YTAA 2AP1A 5SWMA 2A3ZA 4CCHA 4BR2A 1RILA 4IWVA 4BR7A 1LWFA 3CCLN 4F2RA 3AO1A 1IG9A 3ENHA 4RTFD 3L2RA 4BE0A 5J2PA 4H0OA 3NF7A 2QK9A 4PQUA 3AA2A 2B5JA 3AO4A 5HL7L 5KPZA 3OS0A 4BDZA 2YHXA 1L3SA 4M3TA 1IKWA 2P9LB 3OYAA 2O8BA 4H5RA 4JKAA 1WBBA 2G8HA 4C8NA 1ITGA 1J54A 4FJKA 4DQ8A 3VOVA 3QBXA 3ISNC 1WB9A 1VQNN 4CHOA 4MDAA 4N76A 2KZZA 3CI5A 2ZD1A 4KTZA 2Z1JA 3K9KA 3LWLA 3L4IA 5GINA 4B9LA 1UAXA 4BRFA 2Q3SA 3OYIA 4BRHA 3M6GA 3WXMB 2P9UB 4HUFA 3HBTA 2YCHA 3BEXA 2XHBA 4ICLA 4EHUA 1NK7A 1HRHA 4QS9A 1WBDA 5F2RA 2V7YA 4CBUA 3ZX2A 1EXQA 3MXMA 2QW9A 3B6OA 2NNWA 4KHSA 3CXCM 1P8ZA 1U49A 4O8UA 4PWDA 1E3MA 4QS8A 3AO3A 4JI5K 4HWIA 3VQQA 3THYB 1OKJA 1Q9XA 4N47A 5C2DA 2V51B 3QICA 3R8EA 3OYGA 4MFBA 3ZSRA 3OHRA 4EFHA 4WF9L 4M3RA 4DV3K 3CJ9A 5CHIA 1IH7A 3CMEN 1C0FA 4B9QA 3HPHA 1ATNA 4EZ6A 1KFDA 2WTUA 1S9EA 4LF8K 3FZFA 2NLXA 1B9DA 2CGLA 2Q97A 4GV6A 4KTWA 1OH8A 1JL1A 1IBLK 3NH2A 1HNXK 4O5BA 3SMPA 3U6FA 1WLJA 3NBPA 2I5JA 1CZAN 3V9UA 4DV5K 1FJGK 1BA0A 3MCAB 3GBTA 4HCCA 3P5JA 4CJRA 3J7YP 1T6DA 2ASMA 4BRAA 4Z4IA 1JCGA 4FJ5A 4B9VA 4A2BA 2O4GA 3KD1E 4N5SA 2BUPA 4OPJA 1XC9A 3RMCA 4JYAK 2VG6A 5BRDA 4CJKA 2XY5A 2D5RA 3OYLA 1NJZA 4PY5A 2O8EA 1S1WA 1G99A 1ILYA 2HMIA 4AQYK 3SAFA 5E84A 5BPNA 5TKYA 5LJWA 3UKRB 3FZMA 4JHDA 3OJSA 4FWKA 4NO7A 3CYMA 3KK3A 4DTRA 2NZTA 1YAGA 3NCIA 1BQNA 4Z4FA 3HO1A 3LDOA 2OTJN 1QSYA 1BI4A 3GDQA 2P9PA 4G1QA 2HHVA 1I94K 3O4QA 4B3MK 3M8PA 5ADXA 5AQWA 3M8SA 3K2PA 4BRIA 3TPQA 4BRMA 3A5LC 1KVAA 1HYSA 3OYKA 5KPTA 5I3UA 4O44A 3WNFA 5BRFA 5GIOA 3RSEA 3UB5A 4IOXA 4CJUA 3ENOA 2P5GA 4JD2A 4OKJA 4DKWA 2V7ZA 3TAPA 3VENA 4CJVA 4DQQA 4WQ5C 4AM7A 4AILC 3TARA 4CHZA 3CERA 2QWRA 4IFVA 4FLUA 3THWA 3NAEA 2ZQBA 3MMVA 2QTDA 3O4NA 1YVUA 3VQ7A 1XHZA 3AGKA 1GLBG 1K6YA 3OBWA 3UKUA 3SCXA 1WSEA 4I2PA 2NRTA 1RDUA 5FRMA 4KH4A 4K0KK 2O8CA 1LW2A 4XH1A 4MO4A 4CZMA 2O8DA 2O8FA 4H0TB 1C6VA 1GLCG 2QI2A 4BWJA 2CH5A 3H3OB 4IBNA 2GELA 3VQBA 1HR0K 3HZ6A 5BPLA 2Q0RA 1C1AA 4H4MA 1RTHA 5DK5A 4BR4A 1VQKN 2IGIA 3LZIA 1U4BA 1DT9A 1RDAA 1CXQA 2X74A 4MLHA 1D8YA 1Q18A 1VSKA 3OVNA 3QFUA 3DWLA 3SI6A 3CCVN 3PY8A 4OKEA 4FWRA 2P5OA 3D2EB 4BRCA 3HOSA 3HL8A 1S6QA 3KLGA 4C8OA 4Z4CA 4IKFA 3P38A 5AQMA 3THXB 3EKSA 2P9SA 1TGOA 5AQKA 1ASWA 1NGBA 4F3TA 1YVNA 3BF1A 3HYFA 1J9AA 5DM7L 1IJJA 3H08A 4FWLA 4Y0WA 3SQ2A 2NRHA 1DTTA 4A57A 5M1FA 4FJXA 2FC0A 3HXMA 2JWLA 3PIPL 1ASUA 3IG1A 3QNNA 4CD3A 5JS1A 3TAFA 3CG7A 5HRNA 4JI8K 4GVMA 1GLJO 4DTJA 2YKMA 3R3LA 3MWTA 3VGLA 1GLLO 4IDHA 1C0GA 4X62K 4CBXA 4U67L 3QIPA 1JLBA 4DSKA 4Y1DA 4DS5A 3SJJA 4BROA 4KHWA 1ZBSA 1RDDA 4EIAA 1T44A 3A5OC 2GX9A 4BG8A 4GVEA 3ZLJA 4DFPA 1HYVA 3AVMA 1P90A 1YUWA 3VEWA 5FRNA 1RT4A 5FLXO
chains in the Genus database with same CATH topology
5BREA 1YJ9N 3MWPA 3BP8A 4B1UB 4KBOA 3H3NO 3VF6A 1QQNA 3WXIA 3IFRA 3LDQA 2FSKA 3LL3A 5BN8A 4BR0A 3SJHA 2ZJPL 2NRWA 5AZIA 2QA4N 1JJ2M 3M3ZA 2A5XA 2I7PA 2VWBA 5CE3A 2D0OA 5TKWA 3CMAN 3O1BA 1VQ8N 3PLAA 2BTFA 1Q86O 1X3MA 2W40A 3KWIA 4XH5A 3AY9A 4JK8A 4FO0A 4B1WB 3FZLA 3D2EA 3NVMA 3L4QA 4JHDB 3IKMA 5JMVA 2NRVA 3MX2A 4NLBA 4YOTA 5FPNA 3TTCA 4BC2A 3SAHA 3BF3A 4FPAA 2PAVA 3VEVA 1S3XA 1T3VA 4EHTA 3WQUA 1NMDA 3IDHA 2A40A 3R1XA 5AQYA 4CZLA 3DXKA 4BVOA 5EY4A 2FSNA 2VGMA 5AQHA 3L0QA 3PIOL 4BG9A 4UY8O 3GE1A 5ELZA 4BGAA 3EL2A 2P9IA 3F2KA 2HBJA 2ZF5O 2D1KA 1HJOA 4BRGA 4BR5A 4I6MB 3ZETB 2P9NB 3MK6A 2A42A 3EZWA 2YX6A 5BPMA 3I56N 1MWKA 3VF2A 1W97L 1K8KA 2QM1A 4H5NA 3VTIA 2Q1NA 1QQMA 1H1VA 4KH5A 5JICA 3CETA 4FWMA 4M7YA 1VQ6N 3HI0A 4FWSA 1NGAA 5AQPA 3MN6A 2GUPA 4FL9A 3IMXA 2F7TA 4K25A 4PKHA 1BU6O 1GLDG 1V4SA 2IVPA 2ZGZA 3ATUA 4JKGB 3TSQA 3VESA 1M90O 3U9ZA 4ISGA 3C0BA 4CD1A 3ULEB 3QB0A 2A6AA 3AGRA 2ZJRL 3KVGA 2DPNA 1S22A 4IOCL 1DEJA 4FOIA 4RWTA 2YJFA 3N4QA 3QBWA 4BC4A 3DXMA 3P4IA 4ISEA 5AZJB 1NWKA 4IJAA 1HKBA 2E88A 2E8AA 4BR9A 4BQZA 5DM6L 4YOYA 3CCRN 1MA9B 4YOWA 1SZ2A 3QFPA 1Z05A 3ID8A 3QDKA 4JK9A 1IG8A 2VGNA 2GEMA 5KPRA 1Q7YO 3O80A 5C2FA 1NGCA 3CPEA 3G4SN 3P39A 5KQ8A 2FSJA 2QWMA 2FF3B 2F9WA 4H03B 4L3QA 2E2QA 3WT0A 3T7ZA 1VQ7N 2YI1A 5AQVA 4BVPA 2KLAA 3LM9A 4JAXA 4H5TA 1M1KO 1X3NA 3HSCA 4O5FA 1DGKN 3ZEUB 2AP1A 4H0VB 3SK3A 4AF1A 2A3ZA 1VQ4N 4BR2A 4JNEA 2D4WA 4H0YB 4IWVA 4BR7A 1YITN 4B1XB 3CCLN 4ILGB 5GIPA 5FPDA 2QXLA 4H0XB 4IJNA 4CZHA 4IO9L 1YI2N 3ZX0A 3R9PA 3ENHA 4RTFD 5HOOA 3MCPA 5AQNA 2RE2A 2V52B 3O08A 4H0OA 3FFKB 4FPBA 4IEEA 4JKCA 5AQJA 5EXWA 5HL7L 3C65A 3UE5A 5KPZA 4BRQA 2YHXA 1QZ5A 4IEIA 3FLCO 1VQPN 1VQLN 5BRHA 2P9LB 2QWNA 2J4RA 1BWFO 4H5RA 4JKAA 4BGBA 1VAZA 5AR0A 4HTLA 5AQTA 3WEEB 4M63C 3MN7A 2ITMA 1BO5O 4IXCA 4NLCA 2QWOA 4U7BA 4DQ8A 3VOVA 4AM6A 3QBXA 3D6RA 3Q7CA 1X9JA 1VQNN 2HSTA 3H46O 4JKHA 3H1VX 4MDAA 4Z94A 3CI5A 1NGEA 5AQUA 3K9KA 3GG4A 3L4IA 5GINA 4BRFA 3HRGA 3IUCA 4FWOA 5LY3A 4A5AA 4BRHA 3M6GA 3WXMB 4I6MA 5E26A 3G6EN 4ILHA 2CGKA 2P9NA 2P9UB 2CGJA 3ZETA 5C12A 3CCMN 1XUPO 3EKUA 5M1KA 3O8MA 3C7NB 1NBWA 3EE9A 3KZBA 1WOQA 2YCHA 3BEXA 3HBTA 3WXJA 3VEXA 4JN4A 4EHUA 1HX1A 1ESVA 4QS9A 4YOUA 3NMUA 3E9LA 5F2RA 2V7YA 4CBUA 3ZX2A 3CCQN 5F1XA 3CC2N 3KWGA 3ATVA 2QW9A 5AQSA 1U2VA 2NNWA 3O1WA 3ULEA 3CXCM 5F0XA 1K8AO 4BY9C 3NVKA 3LDNA 1P8ZA 2WFBA 2Q36A 4J8FA 4O8UA 4B1VA 4QS8A 5AZJA 4HWIA 1OKJA 3SBGA 1YF5L 4CZFA 2V51B 5C2DA 2P9PB 3MN9A 3CJ7A 2AA4A 3QICA 3R8EA 4QS7A 4B1ZA 3DAWA 4EFHA 3OHRA 4WF9L 1GLAG 5GAEP 3CCJN 1RFQA 4CBWA 4WQ4C 2BH1A 3U4LA 3CJ9A 3A0IX 5CHIA 3FZKA 4IO8A 3E66A 3EE8A 3TTDA 3CMEN 3VETA 1NGJA 1C0FA 2PFUA 2WBNA 4YOVA 3WXKA 4B9QA 3ZEUA 3W3DA 1ATNA 4FWNA 4CZKA 4PL7A 5AQRA 3H45C 3K9JA 1JCEA 1YXQA 5I9EB 3CCEN 1BA1A 1ZC6A 3JS6A 2WC9A 3FZFA 2NLXA 3RSEB 5GAHP 3OW2M 4IZ9A 2CGLA 2Q97A 4JEPA 4JD2B 4GV6A 5EOYA 3FGUA 2IVOA 1XC3A 1SQKA 2YJEA 3CJCA 5AFUH 3J8AA 3VEZA 3VEOA 4FSVA 4B1YB 1K73O 3H6EA 5KQDA 2GTDA 4MLEA 4YOXA 1KXPA 1ZXOA 3SMPA 3GOIA 1MWMA 3ENBA 3A5MC 3LDLA 5EX5A 3O4WA 3WQTA 4ISFA 2E1ZA 2P9LA 4K41A 4BRPA 1CZAN 2HBLA 2HBKA 2OANA 4BC5A 4A2AA 3WEEA 4YDUC 5BR9A 4WQ4A 4CZEA 1BA0A 2OTLN 3ID6A 3MCAB 2Q2RA 3GBTA 3SMSA 3I55N 2QWPA 3TTFA 4DCHA 3MX5A 4OPAA 5AQQA 2QEXN 4G9ZA 1T6DA 2PBDA 2ASMA 3LDPA 4BRAA 1JCGA 3O6WA 1ATSA 1GLEG 3UKUB 1XQSC 3AAPA 4A2BA 2P9KB 2BUPA 2IVNA 1TYQB 3FE1A 3KHYA 4BRNA 3B8AX 3I8BA 3O9RA 4IFEA 1V4TA 2HOEA 2I7NA 3CC7N 3D2FB 5FPMA 5BRDA 2ZGYA 2QWQA 3C7NA 3O9UA 3F5TA 3CPWM 1KAXA 2ZWHA 1G99A 1YJWN 1ILYA 2Q0UA 3RVCA 1HKCA 3SAFA 2QWLA 1LCUA 4GV3A 5E84A 2VCPA 3TU5A 4EAHD 5TKYA 5BPNA 1KAYA 4CZJA 1D4XA 1Q81O 4BRKA 5LJWA 3UKRB 4WFNL 3FZMA 4JKFA 4JHDA 4MO5A 4FWKA 2ZJQL 4NO7A 5EVZA 3VEYA 3CC4N 2NZTA 3C6AA 1YAGA 1Z6RA 3M1FA 3T69A 3D7EO 2GWJA 3LDOA 3G25A 2OTJN 3S41A 3GDQA 2P9PA 2GWKA 4H5WA 2VYPA 4FOEA 3MN5A 1QZ6A 3QMLA 5FPEA 3CIPA 5AQIA 5M1NA 4ILJA 1MDUB 1GLFO 5M1PA 1TUYA 3DXMB 3OA9A 5AQWA 5ADXA 4BC3A 3VF4A 3CD6N 4BRIA 3CF5L 3TPQA 1TUUA 4BRMA 3A5LC 5CR4A 1NM1A 5GAGP 4OO1J 2ASPA 4CZGA 3CCSN 1VQMN 5KPTA 5GIOA 4LC9B 5B8HA 5BRFA 4R79A 1K9MO 2P9SB 3O9TA 2Q31A 3JXUA 3RSEA 4IOXA 3UB5A 2FLOA 3ENOA 3U8XA 1RDWX 3CQYA 1HUXA 4JD2A 3VTHA 4JKGA 4DKWA 2V7ZA 1NJIO 5AFUA 1DKGD 5AQXA 1KD1O 3VENA 4A62A 5AQZA 1ATRA 3L6QA 1VQ9N 1KC8O 4WQ5C 4O8KA 3Q7BA 1QVGM 4JKEA 4AM7A 1EQYA 1HLUA 1R59O 3AARA 3CERA 2QWRA 1YHQN 5LJVA 3R6MA 4PKGA 1YJNN 4MDBA 3DLLL 1LOTB 3SAGA 4BQLA 2YHWA 5AQFA 3I33A 4F9OA 1E4GT 3A8YA 4KH6A 5C0YA 2HBMA 1WUAA 1NGFA 3G71N 3EO3A 1SAZA 5ADXH 3CCUN 3MMVA 2E1YA 2QTDA 2WUSA 3KK7A 4GNIA 3AGKA 1GLBG 3OBWA 3UKUA 4K43A 4A59A 1HPMA 2NRZA 2UYTA 2YHYA 3O5BA 1QQOA 1KAZA 2NRTA 2P9KA 3FZHA 3SLCA 5JLFA 2E2PA 1RDUA 4H0PA 4KH4A 5AQLA 1TYQA 3FR0A 3VGKA 3WXLA 4RCHA 4XH1A 4JKDA 4MO4A 4WQ5A 3CQXA 4CZMA 5C10A 4H0TB 1GLCG 2QI2A 3D2FA 3EN9A 1Q82O 2CH5A 3H3OB 2KHOA 2GELA 4PKIA 4NB4A 4CI6A 4C1NK 1YIJN 3HZ6A 5C15A 2EWSA 5BN9A 2Q0RA 4BRDA 3ZX3A 5BPLA 4BR4A 4WCEL 1W2BM 3C6HA 1VQKN 1JCFA 1NLVA 1RGIA 3UKRA 3HOTA 1DT9A 4WFBL 5AZIB 2NRXA 3E9PA 4MLHA 4A61A 4XEIA 4JK7A 1U2VB 1Q18A 3QFUA 3DWLA 1S72N 3O9SA 3CCVN 1OVYA 2D0PA 4FWRA 3D2EB 4PL8A 1VQON 4BRCA 1BUPA 4CZIA 1E4FT 3HOSA 4A5BA 3A5NC 2FF6A 4K42A 5M1OA 3VGMA 5JLHA 2IIRA 3ZYYX 4WFAL 2NRRA 1NGIA 3P38A 2P9UA 1NGHA 5AQMA 3DXKB 4H5VA 3VPZA 3EKSA 3SBTA 2P9SA 2RHKA 2HF3A 1KQSM 5AQKA 4IOAL 2P9IB 1NGBA 1YVNA 3BF1A 3U9DA 4GY2B 5DM7L 1IJJA 4FWLA 4Y0WA 1U6ZA 1Y64A 1T6CA 2E2NA 3H1QA 4YDUA 2NRHA 2ASOA 4A57A 1HKGA 5M1FA 1K8KB 3W0LA 1SS6A 1O13A 4XH4A 3J7ZO 4CJ7A 3CJBA 2JWKA 3HM8A 2JWLA 3PIPL 2H3GX 3N4PA 5JVHL 4BRLA 4CD3A 1GLJO 3CHWA 4FVUA 4OPHA 4E1JA 3CJ1A 1BDGA 3M5RA 3R3LA 4JKBA 3GL1A 2HF4A 3MWTA 3VGLA 4C1NI 1GLLO 4PHTX 1NGDA 4IDHA 1C0GA 2E2OA 3VMFB 1EO1A 3BUZB 2CH6A 4CBXA 4U67L 3O9QA 3E9OA 4FWQA 4WYBA 3DJCA 4C23A 2F9TA 3TSPA 3VERA 4DB3A 5AQGA 4M7XA 2HMPA 5JVGL 4BREA 1N8RO 5AQOA 1QHAA 4GV9A 4BROA 1ZBSA 1QVFM 1J6ZA 3MDQA 4EIAA 1T44A 3A5OC 2GX9A 4BG8A 3WUHA 4GVEA 5H1SQ 3CJAA 3F9MA 3TSUA 1BG3A 1P90A 1YUWA 2W41A 2E20A 3LM2A 2FXUA 4YORA 1NGGA 3VEWA 3E1YA 5MLCQ 1BOTO 4DHYA 3HTVA 5GADP 3OBYA 3AAQA 1VQ5N 3P31A 4FWPA 2A41A 2KKZA 5M1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BRE A;  3BP8 A;  4B1U B;  4KBO A;  3H3N O;  3VF6 A;  1QQN A;  3WXI A;  3IFR A;  3LDQ A;  2FSK A;  3LL3 A;  5BN8 A;  4BR0 A;  3SJH A;  5AZI A;  3M3Z A;  2A5X A;  2I7P A;  2VWB A;  5CE3 A;  2D0O A;  3O1B A;  2BTF A;  1X3M A;  2W40 A;  4XH5 A;  3AY9 A;  4FO0 A;  4B1W B;  3FZL A;  3D2E A;  4JHD B;  5JMV A;  5FPN A;  4BC2 A;  3BF3 A;  4FPA A;  2PAV A;  3VEV A;  1S3X A;  4EHT A;  3WQU A;  1NMD A;  3IDH A;  2A40 A;  5AQY A;  4CZL A;  3DXK A;  4BVO A;  5EY4 A;  2FSN A;  5AQH A;  3L0Q A;  4BG9 A;  3GE1 A;  5ELZ A;  4BGA A;  3EL2 A;  2P9I A;  2ZF5 O;  2D1K A;  1HJO A;  4BRG A;  4BR5 A;  4I6M B;  3ZET B;  2P9N B;  3MK6 A;  2A42 A;  3EZW A;  5BPM A;  1MWK A;  3VF2 A;  4H5N A;  1K8K A;  2QM1 A;  2Q1N A;  1QQM A;  1H1V A;  5JIC A;  3CET A;  4FWM A;  4M7Y A;  3HI0 A;  4FWS A;  1NGA A;  5AQP A;  3MN6 A;  2GUP A;  4FL9 A;  3IMX A;  4K25 A;  4PKH A;  1BU6 O;  1GLD G;  1V4S A;  2IVP A;  2ZGZ A;  3ATU A;  3VES A;  3U9Z A;  4ISG A;  3C0B A;  4CD1 A;  3ULE B;  3QB0 A;  2A6A A;  3KVG A;  2DPN A;  1S22 A;  1DEJ A;  4FOI A;  4RWT A;  2YJF A;  3QBW A;  4BC4 A;  3DXM A;  3P4I A;  4ISE A;  5AZJ B;  1NWK A;  4IJA A;  1HKB A;  2E88 A;  2E8A A;  4BR9 A;  4BQZ A;  1MA9 B;  1SZ2 A;  3QFP A;  1Z05 A;  3ID8 A;  3QDK A;  1IG8 A;  2GEM A;  5KPR A;  3O80 A;  1NGC A;  5KQ8 A;  2FSJ A;  2QWM A;  2FF3 B;  2F9W A;  4H03 B;  4L3Q A;  2E2Q A;  3WT0 A;  5AQV A;  4BVP A;  3LM9 A;  4JAX A;  4H5T A;  1X3N A;  3HSC A;  4O5F A;  1DGK N;  3ZEU B;  2AP1 A;  4H0V B;  3SK3 A;  2A3Z A;  4BR2 A;  4JNE A;  2D4W A;  4H0Y B;  4IWV A;  4BR7 A;  4B1X B;  5FPD A;  2QXL A;  4H0X B;  4IJN A;  4CZH A;  3ZX0 A;  3R9P A;  3ENH A;  4RTF D;  3MCP A;  5AQN A;  2V52 B;  3O08 A;  4H0O A;  3FFK B;  4FPB A;  5AQJ A;  5EXW A;  3UE5 A;  5KPZ A;  4BRQ A;  2YHX A;  1QZ5 A;  3FLC O;  5BRH A;  2P9L B;  2QWN A;  2J4R A;  1BWF O;  4H5R A;  4BGB A;  5AR0 A;  4HTL A;  5AQT A;  3WEE B;  4M63 C;  3MN7 A;  2ITM A;  1BO5 O;  4IXC A;  2QWO A;  4DQ8 A;  3VOV A;  4AM6 A;  3QBX A;  1X9J A;  3H46 O;  3H1V X;  4Z94 A;  3CI5 A;  1NGE A;  5AQU A;  3GG4 A;  3L4I A;  4BRF A;  3IUC A;  5LY3 A;  4FWO A;  4BRH A;  3M6G A;  4I6M A;  5E26 A;  3ZET A;  2CGK A;  2P9N A;  2P9U B;  2CGJ A;  1XUP O;  3EKU A;  3O8M A;  3C7N B;  1NBW A;  3WXJ A;  3KZB A;  1WOQ A;  2YCH A;  3BEX A;  3HBT A;  3VEX A;  4JN4 A;  4EHU A;  1HX1 A;  1ESV A;  4QS9 A;  5F2R A;  2V7Y A;  4CBU A;  3ZX2 A;  5F1X A;  3ATV A;  2QW9 A;  5AQS A;  1U2V A;  3O1W A;  3ULE A;  5F0X A;  3LDN A;  1P8Z A;  2Q36 A;  4J8F A;  4B1V A;  4QS8 A;  5AZJ A;  4HWI A;  1OKJ A;  4CZF A;  2V51 B;  2P9P B;  3MN9 A;  3CJ7 A;  2AA4 A;  3QIC A;  3R8E A;  4QS7 A;  4B1Z A;  3DAW A;  4EFH A;  3OHR A;  1GLA G;  1RFQ A;  4CBW A;  4WQ4 C;  3U4L A;  3CJ9 A;  3A0I X;  3FZK A;  4IO8 A;  3VET A;  1NGJ A;  1C0F A;  3WXK A;  4B9Q A;  3ZEU A;  3W3D A;  1ATN A;  4FWN A;  4CZK A;  4PL7 A;  5AQR A;  3H45 C;  1JCE A;  1YXQ A;  5I9E B;  1BA1 A;  1ZC6 A;  3JS6 A;  3RSE B;  3FZF A;  2NLX A;  4IZ9 A;  2CGL A;  2Q97 A;  4JD2 B;  5EOY A;  3FGU A;  2IVO A;  1XC3 A;  1SQK A;  2YJE A;  3CJC A;  5AFU H;  3J8A A;  3VEZ A;  3VEO A;  4FSV A;  4B1Y B;  3H6E A;  5KQD A;  2GTD A;  4MLE A;  1KXP A;  1ZXO A;  3SMP A;  3GOI A;  1MWM A;  3A5M C;  3LDL A;  5EX5 A;  3O4W A;  3WQT A;  4ISF A;  2E1Z A;  2P9L A;  4K41 A;  4BRP A;  1CZA N;  2OAN A;  4BC5 A;  4A2A A;  3WEE A;  4YDU C;  5BR9 A;  4WQ4 A;  4CZE A;  1BA0 A;  2Q2R A;  3GBT A;  3SMS A;  2QWP A;  4DCH A;  5AQQ A;  1T6D A;  2PBD A;  2ASM A;  3LDP A;  4BRA A;  1JCG A;  3O6W A;  1ATS A;  1GLE G;  3UKU B;  1XQS C;  3AAP A;  4A2B A;  2P9K B;  2BUP A;  2IVN A;  1TYQ B;  3FE1 A;  3KHY A;  4BRN A;  3B8A X;  3I8B A;  1V4T A;  2HOE A;  2I7N A;  3D2F B;  5FPM A;  5BRD A;  2ZGY A;  2QWQ A;  3C7N A;  1KAX A;  2ZWH A;  1G99 A;  2Q0U A;  1HKC A;  2QWL A;  1LCU A;  5E84 A;  2VCP A;  3TU5 A;  4EAH D;  5TKY A;  5BPN A;  1KAY A;  4CZJ A;  1D4X A;  4BRK A;  5LJW A;  3UKR B;  3FZM A;  4JHD A;  4MO5 A;  4FWK A;  4NO7 A;  5EVZ A;  3VEY A;  2NZT A;  1YAG A;  1Z6R A;  3M1F A;  3D7E O;  2GWJ A;  3LDO A;  3G25 A;  3S41 A;  3GDQ A;  2P9P A;  2GWK A;  4H5W A;  2VYP A;  4FOE A;  3MN5 A;  1QZ6 A;  3QML A;  5FPE A;  3CIP A;  5AQI A;  1MDU B;  1GLF O;  1TUY A;  3DXM B;  5ADX A;  5AQW A;  4BC3 A;  3VF4 A;  4BRI A;  3TPQ A;  1TUU A;  4BRM A;  3A5L C;  1NM1 A;  2ASP A;  4CZG A;  5KPT A;  4LC9 B;  5B8H A;  5BRF A;  2P9S B;  3RSE A;  2Q31 A;  3JXU A;  3UB5 A;  2FLO A;  3ENO A;  3U8X A;  1RDW X;  3CQY A;  1HUX A;  4JD2 A;  2V7Z A;  5AFU A;  1DKG D;  5AQX A;  3VEN A;  4A62 A;  5AQZ A;  1ATR A;  3L6Q A;  4WQ5 C;  4O8K A;  4AM7 A;  1EQY A;  1HLU A;  1R59 O;  3AAR A;  3CER A;  2QWR A;  5LJV A;  3R6M A;  4PKG A;  1LOT B;  4BQL A;  2YHW A;  5AQF A;  3I33 A;  4F9O A;  1E4G T;  3A8Y A;  1WUA A;  1NGF A;  3EO3 A;  1SAZ A;  5ADX H;  3MMV A;  2E1Y A;  2WUS A;  4GNI A;  1GLB G;  3UKU A;  4K43 A;  1HPM A;  2UYT A;  2YHY A;  3O5B A;  1QQO A;  1KAZ A;  3SLC A;  2P9K A;  3FZH A;  5JLF A;  2E2P A;  4H0P A;  5AQL A;  1TYQ A;  3FR0 A;  3VGK A;  3WXL A;  4RCH A;  4XH1 A;  4WQ5 A;  4MO4 A;  4CZM A;  3CQX A;  4H0T B;  1GLC G;  3D2F A;  3EN9 A;  2CH5 A;  3H3O B;  2KHO A;  2GEL A;  4PKI A;  4NB4 A;  4CI6 A;  3HZ6 A;  2EWS A;  5BN9 A;  2Q0R A;  4BRD A;  3ZX3 A;  5BPL A;  4BR4 A;  1JCF A;  1NLV A;  1RGI A;  3UKR A;  5AZI B;  4MLH A;  4A61 A;  4XEI A;  1U2V B;  1Q18 A;  3QFU A;  3DWL A;  2D0P A;  4FWR A;  3D2E B;  4PL8 A;  4BRC A;  1BUP A;  4CZI A;  1E4F T;  3A5N C;  2FF6 A;  4K42 A;  3VGM A;  5JLH A;  2IIR A;  1NGI A;  2P9U A;  1NGH A;  5AQM A;  3DXK B;  4H5V A;  3VPZ A;  3EKS A;  2P9S A;  2HF3 A;  5AQK A;  2P9I B;  1NGB A;  1YVN A;  3BF1 A;  3U9D A;  4GY2 B;  1IJJ A;  4FWL A;  4Y0W A;  1U6Z A;  1Y64 A;  1T6C A;  2E2N A;  3H1Q A;  4YDU A;  2NRH A;  2ASO A;  1HKG A;  1K8K B;  3W0L A;  4XH4 A;  4CJ7 A;  3CJB A;  3HM8 A;  2H3G X;  4BRL A;  4CD3 A;  1GLJ O;  3CHW A;  4E1J A;  3CJ1 A;  1BDG A;  3GL1 A;  2HF4 A;  3VGL A;  1GLL O;  1NGD A;  1C0G A;  2E2O A;  3BUZ B;  2CH6 A;  4CBX A;  4FWQ A;  4WYB A;  3DJC A;  4C23 A;  2F9T A;  3VER A;  4DB3 A;  5AQG A;  4M7X A;  2HMP A;  4BRE A;  5AQO A;  1QHA A;  4BRO A;  1ZBS A;  1J6Z A;  3MDQ A;  4EIA A;  1T44 A;  3A5O C;  4BG8 A;  3WUH A;  3CJA A;  3F9M A;  1BG3 A;  1YUW A;  2W41 A;  2E20 A;  3LM2 A;  2FXU A;  1NGG A;  3VEW A;  1BOT O;  4DHY A;  3HTV A;  3AAQ A;  4FWP A;  2A41 A;  2YI1 A; 
#chains in the Genus database with same CATH topology
 5BRE A;  1U48 A;  5SZT A;  1NJX A;  4JI1 K;  4KBO A;  1J53 A;  1T03 A;  2FSK A;  3AA4 A;  4BR0 A;  1J5E K;  3QER A;  3M3Z A;  5CE3 A;  5TKW A;  3O1B A;  1VQ8 N;  4FJL A;  1N34 K;  2W40 A;  1C1B A;  3AY9 A;  4FO0 A;  3L4Q A;  4JHD B;  4H8K A;  3BF3 A;  1C0M A;  3LP2 A;  4DQP A;  4EHT A;  4CJF A;  3IDH A;  3R1X A;  4BE1 A;  4CZL A;  4KB1 A;  5KTQ A;  4BVO A;  2FSN A;  2VGM A;  3L0Q A;  3PIO L;  3NGY A;  4BG9 A;  3BZC A;  3GE1 A;  4DG1 A;  3EL2 A;  1IV0 A;  3VQ4 A;  3F2K A;  2HBJ A;  4HVJ A;  2D1K A;  4BR5 A;  4Y1C A;  1ASV A;  2RPI A;  2RN2 A;  2YX6 A;  5BPM A;  3I56 N;  1MWK A;  2QM1 A;  4KH5 A;  5JIC A;  1VQ6 N;  4FWM A;  4FWS A;  3NH0 A;  2GUP A;  4ZTJ A;  4KO0 A;  4K25 A;  4ZHR A;  1V4S A;  3ATU A;  3VES A;  3LDS A;  3P83 D;  2BE2 A;  3U9Z A;  4LSN A;  3QB0 A;  2A6A A;  4OLA A;  4E7H A;  2DPN A;  1TL3 A;  3S9H A;  4B3S K;  1DEJ A;  4Z4E A;  4RWT A;  2YJF A;  3K5L A;  3NF6 A;  3U3Y A;  2BAN A;  3DXM A;  1LV5 A;  4ISE A;  4DR4 K;  1NWK A;  1HKB A;  2E8A A;  3CCR N;  2DFE A;  1MA9 B;  1RNH A;  1IG8 A;  2VGN A;  2GEM A;  3RWU A;  1BL3 A;  3O80 A;  4FJI A;  3P1G A;  2QWM A;  4H03 B;  1VQ7 N;  4Q0B A;  2E2Q A;  3VQC A;  1SKS A;  5AQV A;  4E7I A;  4E19 A;  2KLA A;  4JAX A;  4BE2 A;  3ZEU B;  1VQ4 N;  3KD5 E;  4JNE A;  2HND A;  4ILG B;  2O8C B;  3BDP A;  4CZH A;  3ZX0 A;  3R9P A;  2VQF K;  3MCP A;  5AQN A;  2RE2 A;  2V52 B;  3FFK B;  3QO9 A;  4IEE A;  4JKC A;  1VQP N;  1D9F A;  1VQL N;  2UUB K;  5LL6 Z;  2J4R A;  1BWF O;  1XNR K;  4BGB A;  1VRU A;  4UQG A;  1VAZ A;  5AQT A;  3WEE B;  4FLT A;  2ZE2 A;  2ITM A;  3T1H K;  1HNI A;  3SQ0 A;  1EP4 A;  5AJ3 K;  3BZK A;  4CGG A;  3D6R A;  3Q7C A;  3O3G A;  1BCM A;  2OPP A;  4LF4 K;  4I7F A;  4Z94 A;  3VQ5 A;  1NGE A;  3DLH A;  3ZT2 A;  4JV5 K;  3GG4 A;  3OTO K;  4A5A A;  3ZSQ A;  4I6M A;  4F4K A;  3MEG A;  1JKH A;  4ILH A;  5C12 A;  3K59 A;  2CGJ A;  2BGG A;  3CCM N;  3THV A;  1JLC A;  3O8M A;  1RTJ A;  3WXJ A;  3KZB A;  1WOQ A;  3VEX A;  4E7K A;  4RG8 A;  1QSL A;  3NDK A;  3EZ5 A;  3O1W A;  2WFB A;  2QKB A;  5AZJ A;  4PA1 A;  3RR7 A;  3LAM A;  4KPY A;  1B9F A;  2DFH A;  2KQ2 A;  4OGC A;  3SBG A;  4CZF A;  3MN9 A;  4ELU A;  4QS7 A;  5FDL A;  3LPU A;  1GLA G;  1NNE A;  4CJT A;  1WNS A;  3E66 A;  3TTD A;  4CGI A;  1VSE A;  3WXK A;  3KIO A;  3TAN A;  3K9J A;  4NCG A;  1JCE A;  4KKO A;  4LF9 K;  4AHU A;  3JS6 A;  2WC9 A;  5GAH P;  3OW2 M;  2W6L A;  4DLE A;  1RT6 A;  3FGU A;  3CJC A;  3VEO A;  2F8S A;  5HP1 A;  5KQD A;  4FW1 A;  1KXP A;  3V1R A;  2HHW A;  3GOI A;  3QEI A;  3PO4 A;  3ENB A;  3LDL A;  5EX5 A;  1WSG A;  3WQT A;  4ISF A;  2E1Z A;  4K41 A;  4X64 K;  2HBL A;  2OAN A;  1KSP A;  4BC5 A;  3KLI A;  4YDU C;  1S1V A;  5BR9 A;  4CZE A;  1TK8 A;  1RT7 A;  3V9S A;  2HHU A;  3DOL A;  3SMS A;  2QWP A;  3TTF A;  3LWM A;  3MX5 A;  2QEX N;  4LF7 K;  3ASM A;  3O6W A;  4DS4 A;  2P9K B;  1FW6 A;  4F8R A;  1TAQ A;  2HOE A;  1N5Y A;  3PSI A;  5FPM A;  4FLZ A;  3C7N A;  4CF1 A;  3CPW M;  5JS2 A;  2Q0U A;  1GOB A;  1RDB A;  2IS3 A;  2UUA K;  1LCU A;  4DSI A;  4C8M A;  2HVH A;  4BRK A;  4AHV A;  4WFN L;  2QKK A;  4CEE A;  4CIG A;  5EVZ A;  3CC4 N;  2DTU A;  3C6A A;  3M1F A;  1Z6R A;  3G25 A;  3S41 A;  4H5W A;  2F8T A;  5FPE A;  5AQI A;  5M1N A;  4X65 K;  4LH5 A;  1GLF O;  2B4J A;  5M1P A;  3DXM B;  4FLX A;  4E7L A;  2KFZ A;  4BC3 A;  3VF4 A;  1QTM A;  1JXE A;  4CZG A;  4E1N A;  3MEC A;  1LAV A;  1VQM N;  3QET A;  4LC9 B;  5HRR A;  5B8H A;  4R79 A;  4OLB A;  3JXU A;  2FLO A;  3VTH A;  1RDW X;  1TL1 A;  4JKG A;  4B9S A;  4OPK A;  1DKG D;  4QAG A;  5T7B A;  2XY6 A;  1NK5 A;  3HP6 A;  1KD1 O;  2YV0 X;  1ATR A;  4DU1 A;  3OYH A;  2W6K A;  3TI0 A;  3DRS A;  4O8K A;  4JKE A;  1EQY A;  1HLU A;  4DR5 K;  3AAR A;  3AVH A;  4J2E A;  2Z1H A;  3U3G A;  3L8B A;  4O0J A;  4B8C A;  4MDB A;  2X78 A;  4FLW A;  4BQL A;  3I33 A;  4F9O A;  3HJF A;  3SZ2 A;  3AVK A;  3DMJ A;  5C0Y A;  2VQE K;  3LPT A;  2HBM A;  1UWB A;  3G71 N;  4DV4 K;  5ADX H;  4I2Q A;  4JI4 K;  1RTI A;  2X6S A;  4CHP A;  4K43 A;  4A59 A;  1HPM A;  2NRZ A;  1SL2 A;  2YHY A;  4Z4H A;  4M45 A;  3FZH A;  3V1O A;  5AQL A;  1TYQ A;  3FR0 A;  3SUO A;  4WE1 A;  1Z25 A;  1IKY A;  4RCH A;  1F21 A;  4DFM A;  4DF4 A;  3D2F A;  1KRP A;  2VG7 A;  3T3F A;  2YKN A;  4LD0 A;  3KKS A;  5E41 A;  2KZM A;  5C15 A;  2EWS A;  4FYD A;  1XMO K;  1BIU A;  3L2V A;  4DV2 K;  2OA8 A;  4WCE L;  1W2B M;  1JCF A;  1NLV A;  4RW7 A;  3TWH A;  2Z1G A;  4M3Z A;  3DI6 A;  4CJS A;  4DLG A;  2FBT A;  5LMN K;  4FM2 A;  1RBT A;  2D0P A;  4PL8 A;  1VQO N;  1N36 K;  1E4F T;  4DFJ A;  1JLQ A;  1TK0 A;  2FF6 A;  4LFC K;  1QHT A;  4IG0 A;  3TAM A;  4H5V A;  3SBT A;  2RHK A;  2HF3 A;  4DWI A;  4DR6 K;  3V81 A;  1Y64 A;  4YDU A;  3H1Q A;  1K8K B;  3W0L A;  5J2Q A;  3J7Z O;  3CJB A;  1FKO A;  1OH6 A;  1HYZ A;  3LP0 A;  3SQ4 A;  4FZX C;  4OPH A;  3KJV A;  4B3R K;  4FLV A;  1DTQ A;  1BDG A;  3NH1 A;  1HNZ K;  4B3T K;  3VMF B;  4CFC A;  2DFF A;  3HVR A;  3E9O A;  1VSI A;  1VSD A;  2XRI A;  4C23 A;  3DJC A;  3D0P A;  4DB3 A;  2P1J A;  4CFB A;  1I3A A;  4GMJ B;  1RTD A;  4EP5 A;  4DTU A;  4GV9 A;  3PX0 A;  4HUE A;  3BY5 A;  5H1S Q;  3LAK A;  3WUH A;  2VWK A;  3ZT1 A;  3CFR A;  1GOA A;  3CJA A;  3F9M A;  2E20 A;  4IDK A;  4YOR A;  5IWA K;  1S6P A;  5MLC Q;  3HTV A;  4O4G A;  1VQ5 N;  3QIN A;  3P31 A;  1A5X A;  4B9M A;  5M1Q A;  1A5W A;  4BAC A;  1YJ9 N;  3BP8 A;  3ZT0 A;  1MU2 A;  3PUF A;  2WON A;  4KHN A;  2F96 A;  3LDQ A;  1C0U A;  3ZT3 A;  5AZI A;  1BGX T;  1JJ2 M;  3RR8 A;  1L5U A;  2O8B B;  2BTF A;  1Q86 O;  1Q9Y A;  4LF5 K;  1JLF A;  4JRQ A;  1NK9 A;  3FZL A;  1JL2 A;  4E0D A;  3I0S A;  2NRV A;  4NLB A;  4YOT A;  5FPN A;  4OVL A;  4FPA A;  2PAV A;  5BR8 K;  3OYF A;  1S3X A;  1T3V A;  3ZSV A;  4BDY A;  1VRT A;  3NGZ A;  5AQY A;  1TKT A;  4M41 A;  3DXK A;  4ELV A;  2G8F A;  5AQH A;  3HPG A;  4BGA A;  2FBX A;  5ELZ A;  4KB0 A;  2P9I A;  1Y97 A;  4CEC A;  4DSJ A;  2JLE A;  4CEF A;  4IFY A;  2F4V K;  3CQ8 A;  4H5N A;  5KRT A;  2AJQ A;  1QQM A;  3ZSX A;  1SKR A;  1NGA A;  2KFN A;  4DF8 A;  1GLD G;  2ZGZ A;  4JKG B;  1N33 K;  3TSQ A;  3PO5 A;  1M90 O;  1NK6 A;  2HHH K;  4CD1 A;  2ZJR L;  4RW4 A;  4IOC L;  3RMA A;  3SUP A;  4BC4 A;  4IJA A;  4YOY A;  3PV8 A;  4CGJ A;  4CGD A;  1RT1 A;  3VQA A;  4JK9 A;  4JI7 K;  1RBU A;  5C2F A;  3BGR A;  1NGC A;  3QEP A;  4FJ9 A;  4BWM A;  1TVR A;  2FF3 B;  5C25 A;  3ZCM A;  1ZBL A;  4BVP A;  3LM9 A;  3KK1 A;  2HVI A;  4DTN A;  2D4W A;  4H0Y B;  3LZJ A;  1YIT N;  4B1X B;  5GIP A;  3VN5 A;  4H0X B;  4IJN A;  3L3U A;  4IO9 L;  3QNO A;  2OYQ A;  5HOO A;  4K8Z A;  1X9S A;  2OZS A;  3UIQ A;  1R0A A;  5EXW A;  3C65 A;  1NOY A;  1RT3 A;  4CF9 A;  1QZ5 A;  4IEI A;  3OYC A;  2QWN A;  3DRP A;  4NXM K;  3B6P A;  3MN7 A;  4IXC A;  4NLC A;  4U7B A;  3AVL A;  1X9J A;  4FJ8 A;  4XIU A;  4HTU A;  2HST A;  3WNE A;  1NKE A;  3H1V X;  1L3V A;  5HRP A;  3HRG A;  5LY3 A;  4FWO A;  4LSL A;  4B3O A;  3G6E N;  3ZET A;  2CGK A;  2P9N A;  3IAY A;  1OH7 A;  1XUP O;  3I8D A;  5KI6 A;  1KVB A;  1WSJ A;  1VHX A;  2O8E B;  1VSM A;  4EP4 A;  1ESV A;  4YOU A;  3NMU A;  3E9L A;  3O3H A;  3CC2 N;  3KWG A;  3ULE A;  5AQS A;  1U2V A;  4RW6 A;  4CEZ A;  3QEX A;  3NVK A;  2Q36 A;  5FRO A;  4J8F A;  4B1V A;  1BI4 B;  2P9P B;  2AA4 A;  4DR3 K;  4B1Z A;  3DLB A;  1NJY A;  5GAE P;  4JRP A;  4W5O A;  1BQM A;  1XI1 A;  3U4L A;  3A0I X;  4NCA A;  3EE8 A;  1S9G A;  2PFU A;  2WBN A;  3FFI A;  3W3D A;  3AVA A;  5CZ1 A;  4CZK A;  1IBK K;  1QS4 A;  1YXQ A;  3RSE B;  4CED A;  4DSF A;  4J2A A;  1TAU A;  4JD2 B;  4RW8 A;  1HQU A;  5EOY A;  2O4I A;  3VEZ A;  2YJE A;  5AFU H;  3J8A A;  4E3S A;  4FSV A;  3H6E A;  2GTD A;  4MLE A;  4HHT A;  1MWM A;  3G10 A;  3O4W A;  1IO2 A;  3ALY A;  1IBM K;  3AVB A;  2P9L A;  3T1Y K;  4GKK K;  1SL0 A;  1RT2 A;  4A2A A;  5KGX A;  4FZZ A;  1OH5 A;  4WQ4 A;  4PUO A;  1EX4 A;  4JI2 K;  2OTL N;  4DV1 K;  4YNQ A;  3THW B;  2Q2R A;  3I55 N;  4DCH A;  4OPA A;  4G9Z A;  4OJR A;  3LDP A;  1JLA A;  1GLE G;  3UKU B;  1XQS C;  3VQE A;  1SKW A;  3MED A;  4N41 A;  4NYN A;  4CK3 A;  3AAP A;  4KHQ A;  2HHX A;  1CXU A;  3FE1 A;  3B8A X;  3O9R A;  4DU3 A;  4IFE A;  1V4T A;  2O8D B;  2O8F B;  3DOK A;  2XY8 A;  4CF2 A;  3CC7 N;  2YHA A;  3S3O A;  3DRR A;  2ZGY A;  2PYL A;  3F5T A;  1KAX A;  2ZWH A;  3RVC A;  2QWL A;  4GV3 A;  4FJH A;  4EAH D;  1KAY A;  4CZJ A;  2OPS A;  4JKF A;  5CZ2 A;  2ZJQ L;  2XO7 A;  4DUY K;  1HQE A;  3THY A;  1NKB A;  2GWJ A;  4KFB A;  2GWK A;  2VYP A;  1VSL A;  1QZ6 A;  3MN5 A;  3DYA A;  3ZSO A;  4ILJ A;  1S1T A;  1RCH A;  2RKI A;  3OA9 A;  4CHQ A;  3L2U A;  4B9T A;  3RTV A;  1TUU A;  4ID1 A;  5CR4 A;  4LFA K;  4OO1 J;  4CJ3 A;  3CCS N;  3K5N A;  3QEV A;  3JSM A;  1K9M O;  2E5L K;  3PX6 A;  2NUB A;  2P9S B;  4J2D A;  3O9T A;  2Q31 A;  3QES A;  2GUI A;  3KLF A;  3U8X A;  4YY3 K;  3WNG A;  1HUX A;  1NJI O;  4M3W A;  5AFU A;  5IT9 O;  4B8A B;  2HHQ A;  3CM5 A;  5AQZ A;  4FM0 A;  1RDC A;  3L6Q A;  1VQ9 N;  1FXX A;  5HRO A;  3Q7B A;  1QVG M;  1R59 O;  3EY1 A;  1YHQ N;  1TKD A;  5LJV A;  3R6M A;  1LOT B;  2D0A A;  3SAG A;  2YHW A;  1ZBI A;  3A8Y A;  5DMR A;  2ATQ A;  1CLQ A;  1W0H A;  3EO3 A;  1SAZ A;  2E1Y A;  2WUS A;  1NK0 A;  4QCL A;  2UXC K;  2UYT A;  4CF0 A;  1KAZ A;  5JLF A;  3VGK A;  4CJQ A;  1RBR A;  2PY5 A;  3EN9 A;  1Q82 O;  4CJ4 A;  1U47 A;  1XHX A;  4PKI A;  4CJP A;  4NB4 A;  3K57 A;  4C1N K;  4JLH A;  4BRD A;  2HB5 A;  3NF8 A;  4LFB K;  3SPY A;  2HNY A;  3ITH A;  5CYM A;  5CYQ A;  4J2B A;  3JYT A;  3QIO A;  1RGI A;  3UKR A;  3HOT A;  4WFB L;  2NRX A;  3I0R A;  3E9P A;  4W5R A;  3VA0 A;  4KHY A;  1UOC A;  4XEI A;  4LY7 A;  4Z4G A;  2OCE A;  4JK7 A;  1U2V B;  1OVY A;  1X9M A;  1JLE A;  1BUP A;  4A5B A;  3VQ8 A;  3ZYY X;  2HW3 A;  1JXB A;  1NGI A;  1NU0 A;  4DSL A;  1C1C A;  4LF6 K;  3VPZ A;  4GY2 B;  3WNH A;  3KKR A;  4C8L A;  2X6N A;  2E2N A;  4Q5V A;  3SV3 A;  4KTQ A;  4OGE A;  3TAQ A;  4B9U A;  3PSF A;  3AVG A;  2JWK A;  3AA3 A;  2YNH A;  3G0Z A;  2H3G X;  3RMD A;  3NGI A;  1O1W A;  3N4P A;  4BRL A;  1FKP A;  4JS4 A;  3AO2 A;  2G8V A;  4FVU A;  4KAZ A;  3M5R A;  1W9H A;  3GL1 A;  2HF4 A;  4PHT X;  1NGD A;  2E2O A;  1XMQ K;  3BUZ B;  4CK1 A;  3AVC A;  3OYE A;  1U04 A;  3RMB A;  3O9Q A;  3M8Q A;  4WYB A;  3TSP A;  3MEE A;  1IKX A;  5AQG A;  4CJW A;  5JVG L;  4BRE A;  1N8R O;  5AQO A;  4CER A;  4FM1 A;  3V6D A;  1QHA A;  2G8K A;  4F2S A;  4CEQ A;  1J6Z A;  3SQ1 A;  4CHY A;  4TSX A;  3VQ9 A;  4E89 A;  4FJM A;  2UXB K;  1ZBU A;  2EX3 A;  4ID5 A;  3LP1 A;  2W41 A;  3IRX A;  4H4O A;  4HUG A;  1NGG A;  4M42 A;  1BOT O;  5GAD P;  3OBY A;  2E4L A;  4FWP A;  4DV7 K;  2A41 A;  2YI1 A;  3OYM A;  4JI0 K;  4B1U B;  3VF6 A;  1LAW A;  1QQN A;  3IFR A;  5BN8 A;  1BHL A;  3MAQ A;  3SJH A;  2VWJ A;  4OX9 K;  2NRW A;  2VWB A;  4KRF A;  1EET A;  3NE6 A;  2HHS A;  2D0O A;  3CMA N;  4CVN E;  3PLA A;  3AVN A;  2ITG A;  1X3M A;  3KWI A;  2G8I A;  4JK8 A;  4AHS A;  4CES A;  2KW4 A;  3D2E A;  3NVM A;  5K14 A;  3IKM A;  5JMV A;  3TAB A;  3SAH A;  4BC2 A;  5HBM A;  1T05 A;  1B92 A;  3HST B;  4LH4 A;  2D0B A;  4X66 K;  3THX A;  3M8R A;  5EY4 A;  4W5N A;  4O55 A;  4UY8 O;  4CF8 A;  4V19 S;  2QXF A;  4FLY A;  2ZF5 O;  4N56 A;  4BRG A;  4DMN A;  4I6M B;  4QOZ B;  1I39 A;  3MK6 A;  3OS1 A;  3EZW A;  3VF2 A;  4AHT A;  3VTI A;  4W5Q A;  4M7Y A;  1WAJ A;  3NFA A;  2F7T A;  1J5O A;  1WSF A;  1BU6 O;  3A2F A;  4PKH A;  1GOC A;  3MXI A;  2OPR A;  1FK9 A;  1CZB A;  4CE9 A;  1BIZ A;  1S22 A;  1REV A;  5KGW A;  4FOI A;  3N4Q A;  3DLG A;  2HHT A;  3VA3 A;  3P4I A;  5AZJ B;  4BQZ A;  4BR9 A;  2E88 A;  5DM6 L;  2KTQ A;  4DQR A;  3QFP A;  3ID8 A;  3QDK A;  4O0I A;  5LMU K;  1EWQ A;  1Q7Y O;  3CPE A;  3P39 A;  2FSJ A;  2F9W A;  3T7Z A;  1ZYQ A;  4KHU A;  4GW6 A;  3AVF A;  4B08 A;  2GV9 A;  4CFA A;  4RW9 A;  1HPZ A;  1DGK N;  4O5F A;  4H0V B;  3SK3 A;  4AF1 A;  4DTM A;  2GBZ A;  3SPZ A;  4B9N A;  4C8K A;  1EKE A;  5FPD A;  2QXL A;  1XNQ K;  1WSH A;  1YI2 N;  4ELT A;  1NK8 A;  4M3U A;  1TKZ A;  3O08 A;  1Q8I A;  1LW0 A;  4FPB A;  5AQJ A;  3UE5 A;  4BRQ A;  1SV5 A;  3FLC O;  2D0C A;  5BRH A;  3SV4 A;  5AR0 A;  4HTL A;  3V9Z A;  4M63 C;  3LP3 A;  1BO5 O;  1BCO A;  2QWO A;  2EHG A;  1VK0 A;  4AM6 A;  1ZBF A;  3H46 O;  4JKH A;  1TV6 A;  5AQU A;  4CJ5 A;  4DR2 K;  3IUC A;  3CFP A;  4CJL A;  5KRS A;  4DR1 K;  5E26 A;  1NKC A;  3MXJ A;  1VSJ A;  3HT3 A;  3JAM O;  3EKU A;  5M1K A;  3C7N B;  1KFS A;  1NBW A;  3EE9 A;  4JN4 A;  1HX1 A;  5C42 A;  3CCQ N;  5F1X A;  2HNZ A;  3ATV A;  5J2N A;  4CK2 A;  3SNN A;  1K8A O;  5F0X A;  4BY9 C;  4FVM A;  3LDN A;  3O3F A;  4FJ7 A;  2JGU A;  4Z0U A;  1X1P A;  3J7A P;  4JI3 K;  5C24 A;  1N32 K;  1YF5 L;  4DTS A;  3CJ7 A;  5I42 A;  2UXD K;  3DAW A;  4FZY A;  3CCJ N;  1RFQ A;  4CBW A;  4WQ4 C;  3KLH A;  4BDP A;  3SYZ A;  3QEW A;  2BH1 A;  4CIF A;  2G8U A;  3FZK A;  4IO8 A;  3VET A;  1NGJ A;  4YOV A;  4AHR A;  3ZEU A;  1NG9 A;  4NYF A;  4FWN A;  4PL7 A;  5AQR A;  3H45 C;  4YFU A;  5I9E B;  3CCE N;  1BA1 A;  1ZC6 A;  3ZSY A;  3LAL A;  3QLH A;  1DLO A;  4IZ9 A;  3KTQ A;  4JEP A;  2IVO A;  1XC3 A;  1SQK A;  4B1Y B;  2B6A A;  1K73 O;  4AHC A;  3V9W A;  4YOX A;  1ZXO A;  1T7P A;  4ZTF A;  3A5M C;  4E7J A;  3KLE A;  4BRP A;  4FJG A;  2HBK A;  5EU7 A;  3V4I A;  3WEE A;  3S3N A;  1N6Q A;  3ID6 A;  1IKV A;  4KRE A;  2UUC K;  3C95 A;  1RBS A;  1X9W A;  3ZSZ A;  2WOM A;  5AQQ A;  1BIS A;  1WN7 A;  1S5J A;  2PBD A;  3C94 A;  4DQS A;  2A1S A;  1ATS A;  1CZ9 A;  1EWR A;  3V9X A;  4MQ3 A;  4YHH K;  3NF9 A;  2IVN A;  1TYQ B;  3KHY A;  4BRN A;  3HVT A;  3I8B A;  2W42 A;  2PYJ A;  2I7N A;  3ZSW A;  3K0S A;  3D2F B;  1L3T A;  4DTP A;  2QWQ A;  3O9U A;  3F73 A;  1YJW N;  4CEB A;  1HKC A;  5HLF A;  1LWE A;  2VCP A;  3TU5 A;  3K5M A;  1D4X A;  4DFK A;  1Q81 O;  2ZM6 K;  4MO5 A;  1RT5 A;  3VEY A;  1WSI A;  1HJR A;  3T69 A;  4L8R B;  3RRH A;  3D7E O;  1W7A A;  1QSS A;  3D45 A;  1HNV A;  4FOE A;  3PX4 A;  3QML A;  3CIP A;  1MDU B;  1C0T A;  1TUY A;  3VQ6 A;  3CD6 N;  1D5A A;  3CF5 L;  1NM1 A;  5GAG P;  2ASP A;  4DR7 K;  4E1M A;  3AA5 X;  4CHN A;  1SL1 A;  1NOZ A;  1OVQ A;  1KLN A;  3CQY A;  3OYJ A;  1RBV A;  1TK5 A;  5AQX A;  4FK4 A;  1KLM A;  4A62 A;  1KC8 O;  4CFD A;  2RF2 A;  4DTX A;  3AVI A;  3TR8 A;  3AV9 A;  4CW7 B;  4PKG A;  1YJN N;  3DLL L;  3ULD A;  5AQF A;  1E4G T;  4KH6 A;  4M3Y A;  1WUA A;  2XY7 A;  1NGF A;  1A5V A;  2E6L A;  3CCU N;  1TKX A;  3KK7 A;  3OJU A;  3EEQ A;  4GNI A;  1SUQ A;  3O5B A;  1QQO A;  3SLC A;  2P9K A;  4CEA A;  1D9D A;  2E2P A;  4H0P A;  2Y1I A;  2FBV A;  3WXL A;  1G15 A;  4JKD A;  2ETJ A;  4WQ5 A;  3CQX A;  5C10 A;  4HCB A;  2KHO A;  2FBY A;  4CI6 A;  1YIJ N;  4CEO A;  5BN9 A;  3ZX3 A;  1NK4 A;  1S1X A;  4DU4 A;  4CIE A;  1QQC A;  4JS5 A;  1LWC A;  2P51 A;  3HM9 A;  1HNW K;  4FJN A;  3C6H A;  3HP9 A;  4DV0 K;  4I9Q A;  2R7Y A;  5AZI B;  3OYD A;  1ZBH A;  4A61 A;  1L3U A;  2IOC A;  2E6M A;  3O9S A;  1S72 N;  3TAG A;  4FXD A;  5J1E A;  3VQP A;  4CZI A;  5D3G A;  3A5N C;  4K42 A;  2DY4 A;  4KV8 A;  5M1O A;  3VGM A;  5JLH A;  2IIR A;  4WFA L;  4FCY A;  2NRR A;  4K8X A;  2P9U A;  1NGH A;  1HMV A;  4R5P A;  5HRS A;  3DXK B;  1QE1 A;  3CFO A;  4DSE A;  1NJW A;  1KQS M;  2OZM A;  4IOA L;  2P9I B;  1NMN A;  1YT3 A;  3TAE A;  3U9D A;  3C6T A;  3SUN A;  3S3M A;  4M3X A;  3EYZ A;  1U6Z A;  1T6C A;  2ASO A;  1HKG A;  4CJE A;  2IC3 A;  1SS6 A;  1O13 A;  4GKJ K;  4XH4 A;  4CJ7 A;  3HM8 A;  4EZ9 A;  5JVH L;  3DLK A;  3OYN A;  3CHW A;  4E1J A;  4FW2 A;  3CJ1 A;  4FK0 A;  4JKB A;  4C1N I;  1EO1 A;  4DTO A;  2CH6 A;  2LSN A;  1U45 A;  2BDP A;  4FWQ A;  3HK2 A;  2Z1I A;  2F9T A;  2IAJ A;  3VER A;  4KHP K;  4M7X A;  2HMP A;  3OY9 A;  3MDQ A;  3DLR A;  1S1U A;  3AVJ A;  4AH9 A;  1XWL A;  5CY4 A;  3TSU A;  1BG3 A;  3LM2 A;  2FXU A;  3E1Y A;  4DHY A;  3K5O A;  3AAQ A;  3C6U A;  2KKZ A;  1HJO A;  1KCF A;  3MWP A;  4DUZ K;  3H3N O;  5J2M A;  3WXI A;  1VSF A;  2YNF A;  3LL3 A;  4CGH A;  3J81 O;  2ZJP L;  2QA4 N;  1UA0 A;  3F9K A;  4KI6 A;  2A5X A;  2I7P A;  4KI4 A;  3L3V A;  3KK2 A;  3L2W A;  2Y1J A;  1WAF A;  4XH5 A;  4B1W B;  3HPO A;  3CM6 A;  3MX2 A;  3DLE A;  3TTC A;  2YHB A;  4JI6 K;  4FJJ A;  2YNG A;  2OPQ A;  3VEV A;  3T19 A;  2UU9 K;  3WQU A;  3J80 O;  1NMD A;  1T8E A;  2A40 A;  4FK2 A;  1UA1 A;  3AO5 A;  4F3O A;  5A2Q O;  4IG3 A;  4DV6 K;  3DM2 A;  2VG5 A;  4OKK A;  3ZET B;  2P9N B;  2A42 A;  1QVF M;  1Z26 A;  1W97 L;  1K8K A;  3LAN A;  2Q1N A;  1H1V A;  3CET A;  2A1R A;  3HI0 A;  2PZS A;  5AQP A;  4DQI A;  3L2Q A;  4NXN K;  1KVC A;  3MN6 A;  4FL9 A;  3IMX A;  3RRG A;  2IVP A;  2G8W A;  1YTU A;  3E01 A;  4ISG A;  3C0B A;  3ULE B;  3AGR A;  3KVG A;  3VQD A;  3K58 A;  3QBW A;  1JLG A;  3NHG A;  2IDO A;  3OYB A;  3SUQ A;  3ZT4 A;  4W5T A;  3OS2 A;  3IS9 A;  4YOW A;  1SZ2 A;  1Z05 A;  4NCB A;  3T1A A;  2YNI A;  5KPR A;  3V1Q A;  3G4S N;  4I9L A;  5KQ8 A;  4L3Q A;  3WT0 A;  4CGF A;  4H5T A;  1VSH A;  1X3N A;  1M1K O;  3HSC A;  1KTQ A;  1YTA A;  2AP1 A;  5SWM A;  2A3Z A;  4CCH A;  4BR2 A;  1RIL A;  4IWV A;  4BR7 A;  1LWF A;  3CCL N;  4F2R A;  3AO1 A;  1IG9 A;  3ENH A;  4RTF D;  3L2R A;  4BE0 A;  5J2P A;  4H0O A;  3NF7 A;  2QK9 A;  4PQU A;  3AA2 A;  2B5J A;  3AO4 A;  5HL7 L;  5KPZ A;  3OS0 A;  4BDZ A;  2YHX A;  1L3S A;  4M3T A;  1IKW A;  2P9L B;  3OYA A;  2O8B A;  4H5R A;  4JKA A;  1WBB A;  2G8H A;  4C8N A;  1ITG A;  1J54 A;  4FJK A;  4DQ8 A;  3VOV A;  3QBX A;  3ISN C;  1WB9 A;  1VQN N;  4CHO A;  4MDA A;  4N76 A;  2KZZ A;  3CI5 A;  2ZD1 A;  4KTZ A;  2Z1J A;  3K9K A;  3LWL A;  3L4I A;  5GIN A;  4B9L A;  1UAX A;  4BRF A;  2Q3S A;  3OYI A;  4BRH A;  3M6G A;  3WXM B;  2P9U B;  4HUF A;  3HBT A;  2YCH A;  3BEX A;  2XHB A;  4ICL A;  4EHU A;  1NK7 A;  1HRH A;  4QS9 A;  1WBD A;  5F2R A;  2V7Y A;  4CBU A;  3ZX2 A;  1EXQ A;  3MXM A;  2QW9 A;  3B6O A;  2NNW A;  4KHS A;  3CXC M;  1P8Z A;  1U49 A;  4O8U A;  4PWD A;  1E3M A;  4QS8 A;  3AO3 A;  4JI5 K;  4HWI A;  3VQQ A;  3THY B;  1OKJ A;  1Q9X A;  4N47 A;  5C2D A;  2V51 B;  3QIC A;  3R8E A;  3OYG A;  4MFB A;  3ZSR A;  3OHR A;  4EFH A;  4WF9 L;  4M3R A;  4DV3 K;  3CJ9 A;  5CHI A;  1IH7 A;  3CME N;  1C0F A;  4B9Q A;  3HPH A;  1ATN A;  4EZ6 A;  1KFD A;  2WTU A;  1S9E A;  4LF8 K;  3FZF A;  2NLX A;  1B9D A;  2CGL A;  2Q97 A;  4GV6 A;  4KTW A;  1OH8 A;  1JL1 A;  1IBL K;  3NH2 A;  1HNX K;  4O5B A;  3SMP A;  3U6F A;  1WLJ A;  3NBP A;  2I5J A;  1CZA N;  3V9U A;  4DV5 K;  1FJG K;  1BA0 A;  3MCA B;  3GBT A;  4HCC A;  3P5J A;  4CJR A;  3J7Y P;  1T6D A;  2ASM A;  4BRA A;  4Z4I A;  1JCG A;  4FJ5 A;  4B9V A;  4A2B A;  2O4G A;  3KD1 E;  4N5S A;  2BUP A;  4OPJ A;  1XC9 A;  3RMC A;  4JYA K;  2VG6 A;  5BRD A;  4CJK A;  2XY5 A;  2D5R A;  3OYL A;  1NJZ A;  4PY5 A;  2O8E A;  1S1W A;  1G99 A;  1ILY A;  2HMI A;  4AQY K;  3SAF A;  5E84 A;  5BPN A;  5TKY A;  5LJW A;  3UKR B;  3FZM A;  4JHD A;  3OJS A;  4FWK A;  4NO7 A;  3CYM A;  3KK3 A;  4DTR A;  2NZT A;  1YAG A;  3NCI A;  1BQN A;  4Z4F A;  3HO1 A;  3LDO A;  2OTJ N;  1QSY A;  1BI4 A;  3GDQ A;  2P9P A;  4G1Q A;  2HHV A;  1I94 K;  3O4Q A;  4B3M K;  3M8P A;  5ADX A;  5AQW A;  3M8S A;  3K2P A;  4BRI A;  3TPQ A;  4BRM A;  3A5L C;  1KVA A;  1HYS A;  3OYK A;  5KPT A;  5I3U A;  4O44 A;  3WNF A;  5BRF A;  5GIO A;  3RSE A;  3UB5 A;  4IOX A;  4CJU A;  3ENO A;  2P5G A;  4JD2 A;  4OKJ A;  4DKW A;  2V7Z A;  3TAP A;  3VEN A;  4CJV A;  4DQQ A;  4WQ5 C;  4AM7 A;  4AIL C;  3TAR A;  4CHZ A;  3CER A;  2QWR A;  4IFV A;  4FLU A;  3THW A;  3NAE A;  2ZQB A;  3MMV A;  2QTD A;  3O4N A;  1YVU A;  3VQ7 A;  1XHZ A;  3AGK A;  1GLB G;  1K6Y A;  3OBW A;  3UKU A;  3SCX A;  1WSE A;  4I2P A;  2NRT A;  1RDU A;  5FRM A;  4KH4 A;  4K0K K;  2O8C A;  1LW2 A;  4XH1 A;  4MO4 A;  4CZM A;  2O8D A;  2O8F A;  4H0T B;  1C6V A;  1GLC G;  2QI2 A;  4BWJ A;  2CH5 A;  3H3O B;  4IBN A;  2GEL A;  3VQB A;  1HR0 K;  3HZ6 A;  5BPL A;  2Q0R A;  1C1A A;  4H4M A;  1RTH A;  5DK5 A;  4BR4 A;  1VQK N;  2IGI A;  3LZI A;  1U4B A;  1DT9 A;  1RDA A;  1CXQ A;  2X74 A;  4MLH A;  1D8Y A;  1Q18 A;  1VSK A;  3OVN A;  3QFU A;  3DWL A;  3SI6 A;  3CCV N;  3PY8 A;  4OKE A;  4FWR A;  2P5O A;  3D2E B;  4BRC A;  3HOS A;  3HL8 A;  1S6Q A;  3KLG A;  4C8O A;  4Z4C A;  4IKF A;  3P38 A;  5AQM A;  3THX B;  3EKS A;  2P9S A;  1TGO A;  5AQK A;  1ASW A;  1NGB A;  4F3T A;  1YVN A;  3BF1 A;  3HYF A;  1J9A A;  5DM7 L;  1IJJ A;  3H08 A;  4FWL A;  4Y0W A;  3SQ2 A;  2NRH A;  1DTT A;  4A57 A;  5M1F A;  4FJX A;  2FC0 A;  3HXM A;  2JWL A;  3PIP L;  1ASU A;  3IG1 A;  3QNN A;  4CD3 A;  5JS1 A;  3TAF A;  3CG7 A;  5HRN A;  4JI8 K;  4GVM A;  1GLJ O;  4DTJ A;  2YKM A;  3R3L A;  3MWT A;  3VGL A;  1GLL O;  4IDH A;  1C0G A;  4X62 K;  4CBX A;  4U67 L;  3QIP A;  1JLB A;  4DSK A;  4Y1D A;  4DS5 A;  3SJJ A;  4BRO A;  4KHW A;  1ZBS A;  1RDD A;  4EIA A;  1T44 A;  3A5O C;  2GX9 A;  4BG8 A;  4GVE A;  3ZLJ A;  4DFP A;  1HYV A;  3AVM A;  1P90 A;  1YUW A;  3VEW A;  5FRN A;  1RT4 A;  5FLX O; 
#chains in the Genus database with same CATH homology
 5BRE A;  1YJ9 N;  3MWP A;  3BP8 A;  4B1U B;  4KBO A;  3H3N O;  3VF6 A;  1QQN A;  3WXI A;  3IFR A;  3LDQ A;  2FSK A;  3LL3 A;  5BN8 A;  4BR0 A;  3SJH A;  2ZJP L;  2NRW A;  5AZI A;  2QA4 N;  1JJ2 M;  3M3Z A;  2A5X A;  2I7P A;  2VWB A;  5CE3 A;  2D0O A;  5TKW A;  3CMA N;  3O1B A;  1VQ8 N;  3PLA A;  2BTF A;  1Q86 O;  1X3M A;  2W40 A;  3KWI A;  4XH5 A;  3AY9 A;  4JK8 A;  4FO0 A;  4B1W B;  3FZL A;  3D2E A;  3NVM A;  3L4Q A;  4JHD B;  3IKM A;  5JMV A;  2NRV A;  3MX2 A;  4NLB A;  4YOT A;  5FPN A;  3TTC A;  4BC2 A;  3SAH A;  3BF3 A;  4FPA A;  2PAV A;  3VEV A;  1S3X A;  1T3V A;  4EHT A;  3WQU A;  1NMD A;  3IDH A;  2A40 A;  3R1X A;  5AQY A;  4CZL A;  3DXK A;  4BVO A;  5EY4 A;  2FSN A;  2VGM A;  5AQH A;  3L0Q A;  3PIO L;  4BG9 A;  4UY8 O;  3GE1 A;  5ELZ A;  4BGA A;  3EL2 A;  2P9I A;  3F2K A;  2HBJ A;  2ZF5 O;  2D1K A;  1HJO A;  4BRG A;  4BR5 A;  4I6M B;  3ZET B;  2P9N B;  3MK6 A;  2A42 A;  3EZW A;  2YX6 A;  5BPM A;  3I56 N;  1MWK A;  3VF2 A;  1W97 L;  1K8K A;  2QM1 A;  4H5N A;  3VTI A;  2Q1N A;  1QQM A;  1H1V A;  4KH5 A;  5JIC A;  3CET A;  4FWM A;  4M7Y A;  1VQ6 N;  3HI0 A;  4FWS A;  1NGA A;  5AQP A;  3MN6 A;  2GUP A;  4FL9 A;  3IMX A;  2F7T A;  4K25 A;  4PKH A;  1BU6 O;  1GLD G;  1V4S A;  2IVP A;  2ZGZ A;  3ATU A;  4JKG B;  3TSQ A;  3VES A;  1M90 O;  3U9Z A;  4ISG A;  3C0B A;  4CD1 A;  3ULE B;  3QB0 A;  2A6A A;  3AGR A;  2ZJR L;  3KVG A;  2DPN A;  1S22 A;  4IOC L;  1DEJ A;  4FOI A;  4RWT A;  2YJF A;  3N4Q A;  3QBW A;  4BC4 A;  3DXM A;  3P4I A;  4ISE A;  5AZJ B;  1NWK A;  4IJA A;  1HKB A;  2E88 A;  2E8A A;  4BR9 A;  4BQZ A;  5DM6 L;  4YOY A;  3CCR N;  1MA9 B;  4YOW A;  1SZ2 A;  3QFP A;  1Z05 A;  3ID8 A;  3QDK A;  4JK9 A;  1IG8 A;  2VGN A;  2GEM A;  5KPR A;  1Q7Y O;  3O80 A;  5C2F A;  1NGC A;  3CPE A;  3G4S N;  3P39 A;  5KQ8 A;  2FSJ A;  2QWM A;  2FF3 B;  2F9W A;  4H03 B;  4L3Q A;  2E2Q A;  3WT0 A;  3T7Z A;  1VQ7 N;  2YI1 A;  5AQV A;  4BVP A;  2KLA A;  3LM9 A;  4JAX A;  4H5T A;  1M1K O;  1X3N A;  3HSC A;  4O5F A;  1DGK N;  3ZEU B;  2AP1 A;  4H0V B;  3SK3 A;  4AF1 A;  2A3Z A;  1VQ4 N;  4BR2 A;  4JNE A;  2D4W A;  4H0Y B;  4IWV A;  4BR7 A;  1YIT N;  4B1X B;  3CCL N;  4ILG B;  5GIP A;  5FPD A;  2QXL A;  4H0X B;  4IJN A;  4CZH A;  4IO9 L;  1YI2 N;  3ZX0 A;  3R9P A;  3ENH A;  4RTF D;  5HOO A;  3MCP A;  5AQN A;  2RE2 A;  2V52 B;  3O08 A;  4H0O A;  3FFK B;  4FPB A;  4IEE A;  4JKC A;  5AQJ A;  5EXW A;  5HL7 L;  3C65 A;  3UE5 A;  5KPZ A;  4BRQ A;  2YHX A;  1QZ5 A;  4IEI A;  3FLC O;  1VQP N;  1VQL N;  5BRH A;  2P9L B;  2QWN A;  2J4R A;  1BWF O;  4H5R A;  4JKA A;  4BGB A;  1VAZ A;  5AR0 A;  4HTL A;  5AQT A;  3WEE B;  4M63 C;  3MN7 A;  2ITM A;  1BO5 O;  4IXC A;  4NLC A;  2QWO A;  4U7B A;  4DQ8 A;  3VOV A;  4AM6 A;  3QBX A;  3D6R A;  3Q7C A;  1X9J A;  1VQN N;  2HST A;  3H46 O;  4JKH A;  3H1V X;  4MDA A;  4Z94 A;  3CI5 A;  1NGE A;  5AQU A;  3K9K A;  3GG4 A;  3L4I A;  5GIN A;  4BRF A;  3HRG A;  3IUC A;  4FWO A;  5LY3 A;  4A5A A;  4BRH A;  3M6G A;  3WXM B;  4I6M A;  5E26 A;  3G6E N;  4ILH A;  2CGK A;  2P9N A;  2P9U B;  2CGJ A;  3ZET A;  5C12 A;  3CCM N;  1XUP O;  3EKU A;  5M1K A;  3O8M A;  3C7N B;  1NBW A;  3EE9 A;  3KZB A;  1WOQ A;  2YCH A;  3BEX A;  3HBT A;  3WXJ A;  3VEX A;  4JN4 A;  4EHU A;  1HX1 A;  1ESV A;  4QS9 A;  4YOU A;  3NMU A;  3E9L A;  5F2R A;  2V7Y A;  4CBU A;  3ZX2 A;  3CCQ N;  5F1X A;  3CC2 N;  3KWG A;  3ATV A;  2QW9 A;  5AQS A;  1U2V A;  2NNW A;  3O1W A;  3ULE A;  3CXC M;  5F0X A;  1K8A O;  4BY9 C;  3NVK A;  3LDN A;  1P8Z A;  2WFB A;  2Q36 A;  4J8F A;  4O8U A;  4B1V A;  4QS8 A;  5AZJ A;  4HWI A;  1OKJ A;  3SBG A;  1YF5 L;  4CZF A;  2V51 B;  5C2D A;  2P9P B;  3MN9 A;  3CJ7 A;  2AA4 A;  3QIC A;  3R8E A;  4QS7 A;  4B1Z A;  3DAW A;  4EFH A;  3OHR A;  4WF9 L;  1GLA G;  5GAE P;  3CCJ N;  1RFQ A;  4CBW A;  4WQ4 C;  2BH1 A;  3U4L A;  3CJ9 A;  3A0I X;  5CHI A;  3FZK A;  4IO8 A;  3E66 A;  3EE8 A;  3TTD A;  3CME N;  3VET A;  1NGJ A;  1C0F A;  2PFU A;  2WBN A;  4YOV A;  3WXK A;  4B9Q A;  3ZEU A;  3W3D A;  1ATN A;  4FWN A;  4CZK A;  4PL7 A;  5AQR A;  3H45 C;  3K9J A;  1JCE A;  1YXQ A;  5I9E B;  3CCE N;  1BA1 A;  1ZC6 A;  3JS6 A;  2WC9 A;  3FZF A;  2NLX A;  3RSE B;  5GAH P;  3OW2 M;  4IZ9 A;  2CGL A;  2Q97 A;  4JEP A;  4JD2 B;  4GV6 A;  5EOY A;  3FGU A;  2IVO A;  1XC3 A;  1SQK A;  2YJE A;  3CJC A;  5AFU H;  3J8A A;  3VEZ A;  3VEO A;  4FSV A;  4B1Y B;  1K73 O;  3H6E A;  5KQD A;  2GTD A;  4MLE A;  4YOX A;  1KXP A;  1ZXO A;  3SMP A;  3GOI A;  1MWM A;  3ENB A;  3A5M C;  3LDL A;  5EX5 A;  3O4W A;  3WQT A;  4ISF A;  2E1Z A;  2P9L A;  4K41 A;  4BRP A;  1CZA N;  2HBL A;  2HBK A;  2OAN A;  4BC5 A;  4A2A A;  3WEE A;  4YDU C;  5BR9 A;  4WQ4 A;  4CZE A;  1BA0 A;  2OTL N;  3ID6 A;  3MCA B;  2Q2R A;  3GBT A;  3SMS A;  3I55 N;  2QWP A;  3TTF A;  4DCH A;  3MX5 A;  4OPA A;  5AQQ A;  2QEX N;  4G9Z A;  1T6D A;  2PBD A;  2ASM A;  3LDP A;  4BRA A;  1JCG A;  3O6W A;  1ATS A;  1GLE G;  3UKU B;  1XQS C;  3AAP A;  4A2B A;  2P9K B;  2BUP A;  2IVN A;  1TYQ B;  3FE1 A;  3KHY A;  4BRN A;  3B8A X;  3I8B A;  3O9R A;  4IFE A;  1V4T A;  2HOE A;  2I7N A;  3CC7 N;  3D2F B;  5FPM A;  5BRD A;  2ZGY A;  2QWQ A;  3C7N A;  3O9U A;  3F5T A;  3CPW M;  1KAX A;  2ZWH A;  1G99 A;  1YJW N;  1ILY A;  2Q0U A;  3RVC A;  1HKC A;  3SAF A;  2QWL A;  1LCU A;  4GV3 A;  5E84 A;  2VCP A;  3TU5 A;  4EAH D;  5TKY A;  5BPN A;  1KAY A;  4CZJ A;  1D4X A;  1Q81 O;  4BRK A;  5LJW A;  3UKR B;  4WFN L;  3FZM A;  4JKF A;  4JHD A;  4MO5 A;  4FWK A;  2ZJQ L;  4NO7 A;  5EVZ A;  3VEY A;  3CC4 N;  2NZT A;  3C6A A;  1YAG A;  1Z6R A;  3M1F A;  3T69 A;  3D7E O;  2GWJ A;  3LDO A;  3G25 A;  2OTJ N;  3S41 A;  3GDQ A;  2P9P A;  2GWK A;  4H5W A;  2VYP A;  4FOE A;  3MN5 A;  1QZ6 A;  3QML A;  5FPE A;  3CIP A;  5AQI A;  5M1N A;  4ILJ A;  1MDU B;  1GLF O;  5M1P A;  1TUY A;  3DXM B;  3OA9 A;  5AQW A;  5ADX A;  4BC3 A;  3VF4 A;  3CD6 N;  4BRI A;  3CF5 L;  3TPQ A;  1TUU A;  4BRM A;  3A5L C;  5CR4 A;  1NM1 A;  5GAG P;  4OO1 J;  2ASP A;  4CZG A;  3CCS N;  1VQM N;  5KPT A;  5GIO A;  4LC9 B;  5B8H A;  5BRF A;  4R79 A;  1K9M O;  2P9S B;  3O9T A;  2Q31 A;  3JXU A;  3RSE A;  4IOX A;  3UB5 A;  2FLO A;  3ENO A;  3U8X A;  1RDW X;  3CQY A;  1HUX A;  4JD2 A;  3VTH A;  4JKG A;  4DKW A;  2V7Z A;  1NJI O;  5AFU A;  1DKG D;  5AQX A;  1KD1 O;  3VEN A;  4A62 A;  5AQZ A;  1ATR A;  3L6Q A;  1VQ9 N;  1KC8 O;  4WQ5 C;  4O8K A;  3Q7B A;  1QVG M;  4JKE A;  4AM7 A;  1EQY A;  1HLU A;  1R59 O;  3AAR A;  3CER A;  2QWR A;  1YHQ N;  5LJV A;  3R6M A;  4PKG A;  1YJN N;  4MDB A;  3DLL L;  1LOT B;  3SAG A;  4BQL A;  2YHW A;  5AQF A;  3I33 A;  4F9O A;  1E4G T;  3A8Y A;  4KH6 A;  5C0Y A;  2HBM A;  1WUA A;  1NGF A;  3G71 N;  3EO3 A;  1SAZ A;  5ADX H;  3CCU N;  3MMV A;  2E1Y A;  2QTD A;  2WUS A;  3KK7 A;  4GNI A;  3AGK A;  1GLB G;  3OBW A;  3UKU A;  4K43 A;  4A59 A;  1HPM A;  2NRZ A;  2UYT A;  2YHY A;  3O5B A;  1QQO A;  1KAZ A;  2NRT A;  2P9K A;  3FZH A;  3SLC A;  5JLF A;  2E2P A;  1RDU A;  4H0P A;  4KH4 A;  5AQL A;  1TYQ A;  3FR0 A;  3VGK A;  3WXL A;  4RCH A;  4XH1 A;  4JKD A;  4MO4 A;  4WQ5 A;  3CQX A;  4CZM A;  5C10 A;  4H0T B;  1GLC G;  2QI2 A;  3D2F A;  3EN9 A;  1Q82 O;  2CH5 A;  3H3O B;  2KHO A;  2GEL A;  4PKI A;  4NB4 A;  4CI6 A;  4C1N K;  1YIJ N;  3HZ6 A;  5C15 A;  2EWS A;  5BN9 A;  2Q0R A;  4BRD A;  3ZX3 A;  5BPL A;  4BR4 A;  4WCE L;  1W2B M;  3C6H A;  1VQK N;  1JCF A;  1NLV A;  1RGI A;  3UKR A;  3HOT A;  1DT9 A;  4WFB L;  5AZI B;  2NRX A;  3E9P A;  4MLH A;  4A61 A;  4XEI A;  4JK7 A;  1U2V B;  1Q18 A;  3QFU A;  3DWL A;  1S72 N;  3O9S A;  3CCV N;  1OVY A;  2D0P A;  4FWR A;  3D2E B;  4PL8 A;  1VQO N;  4BRC A;  1BUP A;  4CZI A;  1E4F T;  3HOS A;  4A5B A;  3A5N C;  2FF6 A;  4K42 A;  5M1O A;  3VGM A;  5JLH A;  2IIR A;  3ZYY X;  4WFA L;  2NRR A;  1NGI A;  3P38 A;  2P9U A;  1NGH A;  5AQM A;  3DXK B;  4H5V A;  3VPZ A;  3EKS A;  3SBT A;  2P9S A;  2RHK A;  2HF3 A;  1KQS M;  5AQK A;  4IOA L;  2P9I B;  1NGB A;  1YVN A;  3BF1 A;  3U9D A;  4GY2 B;  5DM7 L;  1IJJ A;  4FWL A;  4Y0W A;  1U6Z A;  1Y64 A;  1T6C A;  2E2N A;  3H1Q A;  4YDU A;  2NRH A;  2ASO A;  4A57 A;  1HKG A;  5M1F A;  1K8K B;  3W0L A;  1SS6 A;  1O13 A;  4XH4 A;  3J7Z O;  4CJ7 A;  3CJB A;  2JWK A;  3HM8 A;  2JWL A;  3PIP L;  2H3G X;  3N4P A;  5JVH L;  4BRL A;  4CD3 A;  1GLJ O;  3CHW A;  4FVU A;  4OPH A;  4E1J A;  3CJ1 A;  1BDG A;  3M5R A;  3R3L A;  4JKB A;  3GL1 A;  2HF4 A;  3MWT A;  3VGL A;  4C1N I;  1GLL O;  4PHT X;  1NGD A;  4IDH A;  1C0G A;  2E2O A;  3VMF B;  1EO1 A;  3BUZ B;  2CH6 A;  4CBX A;  4U67 L;  3O9Q A;  3E9O A;  4FWQ A;  4WYB A;  3DJC A;  4C23 A;  2F9T A;  3TSP A;  3VER A;  4DB3 A;  5AQG A;  4M7X A;  2HMP A;  5JVG L;  4BRE A;  1N8R O;  5AQO A;  1QHA A;  4GV9 A;  4BRO A;  1ZBS A;  1QVF M;  1J6Z A;  3MDQ A;  4EIA A;  1T44 A;  3A5O C;  2GX9 A;  4BG8 A;  3WUH A;  4GVE A;  5H1S Q;  3CJA A;  3F9M A;  3TSU A;  1BG3 A;  1P90 A;  1YUW A;  2W41 A;  2E20 A;  3LM2 A;  2FXU A;  4YOR A;  1NGG A;  3VEW A;  3E1Y A;  5MLC Q;  1BOT O;  4DHY A;  3HTV A;  5GAD P;  3OBY A;  3AAQ A;  1VQ5 N;  3P31 A;  4FWP A;  2A41 A;  2KKZ A;  5M1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...