4LF6K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4lf6K00
4DR2K 4DR6K 4V19S 4K0KK 4CVNE 4DR3K 2VQEK 4LF6K 4LF9K 3JAMO 4DV1K 1HNZK 1XNQK 1HR0K 4DR5K 4DV6K 4YHHK 4X65K 1XMQK 4X62K 4B3TK 4JI4K 1XMOK 1J5EK 4YY3K 4DV5K 1HNWK 4B3SK 1IBKK 1N33K 4X66K 4GKJK 3T1YK 4DV2K 1XNRK 4DV7K 5A2QO 3J7YP 1FJGK 2UUBK 4OX9K 1I94K 4X64K 4B3RK 2E5LK 4JYAK 2UUCK 3J80O 4DV4K 4AQYK 4JV5K 4DV3K 1N32K 1N36K 2UXBK 4LF4K 4JI0K 4B3MK 4LF7K 4NXNK 5AJ3K 3J7AP 2HHHK 4LFBK 5LL6Z 2UXDK 3J81O 1IBMK 1HNXK 4LF5K 4JI2K 4JI7K 2ZM6K 4JI5K 4DUZK 4LFCK 2UUAK 4GKKK 2UU9K 5IWAK 4LF8K 1N34K 3T1HK 4NXMK 4CW7B 4LFAK 2VQFK 5BR8K 4DUYK 1IBLK 2UXCK 4JI1K 5LMUK 4DR1K 4DR4K 3OTOK 4KHPK 5IT9O 5LMNK 4JI6K 2F4VK 4DR7K 4JI8K 5FLXO 4DV0K 4JI3K
chains in the Genus database with same CATH superfamily
3OJUA 4JKEA 1UWBA 4CFAA 3BGRA 4K0KK 2V52B 3AGRA 1U45A 1LW2A 3WXIA 5LY3A 1C0FA 3IKMA 1CLQA 4DQRA 3O9TA 3JAMO 3HPGA 4ILJA 2W41A 3F9KA 4CF9A 2WOMA 4BWMA 4DF8A 3LDNA 4IXCA 2O4IA 3MX5A 3KHYA 1QQOA 4ICLA 3KWIA 4E19A 3GL1A 3NF7A 3HP6A 2HF4A 2CGLA 2YHXA 4JKFA 5FPNA 1QZ6A 3LL3A 1SV5A 4N56A 5HRNA 3VF2A 1C1AA 3CMEN 1N33K 1VQ9N 4BREA 3WQTA 3HJFA 5BRDA 1TYQA 3MXIA 3P38A 3SQ4A 1MA9B 1SUQA 1VSIA 3QLHA 5AQYA 3J7YP 1KQSM 4WFNL 2A42A 3V9SA 3QBWA 2Q2RA 3PO5A 4WF9L 4YOWA 5J2PA 4KH6A 4FJIA 1C0TA 3V1RA 1KSPA 3NGZA 4MQ3A 1Q18A 3DLKA 3E66A 5FPDA 5AZJA 4KHWA 3U8XA 1N32K 4FSVA 5CHIA 2D0AA 3IDHA 1QS4A 4JI0K 1XC9A 2QWQA 3SYZA 3NE6A 2YNHA 3AVFA 1RT4A 2D4WA 1GLAG 4FWKA 5C24A 1ASWA 3I33A 1RDBA 4E3SA 4M3XA 4I6MA 3U4LA 4FWRA 3O1WA 4DLGA 3HK2A 4BRKA 1JLAA 3VQ6A 4PHTX 3AY9A 1EP4A 4CW7B 1LAWA 4F3OA 3CMAN 1HNVA 5F0XA 5J2QA 5KRSA 2FBXA 3OYHA 1KCFA 1IBLK 5AQIA 1WNSA 4O55A 4A59A 5CR4A 3NFAA 3VF4A 1YJWN 1Y64A 1ZBUA 2W6KA 3LDLA 4KTQA 3EN9A 4A5AA 3ZSOA 4A5BA 1K9MO 3HPHA 3O9SA 2F8SA 1D4XA 2F96A 3HBTA 3QB0A 2QEXN 4DQQA 4LF9K 4FWSA 4IFVA 1Z26A 1ASUA 4IOAL 3G71N 2O8EB 5F2RA 2P9IA 3WNHA 2LSNA 4OPHA 2CGKA 4DTUA 3E01A 4EHTA 4CEQA 4CEZA 4WFBL 4CGIA 3E1YA 2YHAA 4CK1A 4DTMA 1BQMA 2HNZA 4B1UB 4CHNA 2QKBA 4YOYA 1J5EK 1YHQN 3R8EA 2YX6A 3GOIA 4OPJA 3S3MA 2UYTA 5TKYA 4IG3A 3UE5A 1W0HA 1NK0A 3MN7A 1D5AA 3I8DA 2O8DB 4FVMA 2ASMA 5BPNA 3VESA 3GG4A 3ULEB 1L3UA 2AJQA 1T6DA 3EO3A 4N76A 3T1AA 5BRFA 4OVLA 3SNNA 4C8OA 4O8UA 3HO1A 4MO4A 1KLMA 2EHGA 3M6GA 3W0LA 4JYAK 2OPSA 3AO4A 4CFDA 3VQ8A 5EU7A 4XH1A 3WXJA 4YOXA 1U2VA 4LF7K 3J7AP 3RTVA 3VQQA 4CJPA 4FJ7A 4IBNA 3WXLA 2ZF5O 1NGGA 4FXDA 3VTHA 2PBDA 1NMDA 4ZTJA 3DOKA 4I9QA 3LP3A 3OYBA 3AVAA 4C1NI 2YNIA 3QNNA 4M7XA 1D9DA 4LF8K 1LW0A 4DKWA 2IS3A 3DYAA 2BGGA 2GX9A 4B9TA 3CFPA 3SJHA 3HPOA 1MWMA 5KQ8A 1KTQA 4C8KA 3F73A 1NOZA 5C42A 4H0PA 2OANA 4BE1A 3ZT2A 2D1KA 3O4WA 4FLUA 4DR3K 2G8KA 4LF6K 3SBTA 1DTTA 3CHWA 3UB5A 1SKWA 1X1PA 2QXLA 5M1KA 3C6AA 1KLNA 4DTNA 3THXA 2ASOA 2BDPA 3QFUA 4KH4A 1KXPA 3MWTA 5FRMA 2YHWA 1GOBA 1JLEA 2G8HA 5HRPA 4HUEA 3QEWA 4IWVA 4B3SK 3LANA 1T7PA 3U6FA 4G1QA 1I39A 3L8BA 1XNRK 2OPQA 3CERA 4UQGA 1YF5L 1T8EA 3PV8A 4DSJA 3VEOA 2E2NA 1V4SA 4PKIA 1IKXA 4H5NA 1YJNN 1U4BA 3OYGA 3R1XA 4BY9C 4MO5A 1WAFA 3KWGA 3VPZA 2FSJA 2ASPA 3J7ZO 1JCFA 4ID5A 3E9PA 1GLDG 3MN5A 5C25A 1E4GT 3VGLA 1T03A 1RT7A 2Z1JA 4JD2A 4F4KA 1B9DA 4XH4A 3TSPA 3U3GA 2NLXA 2E1ZA 1SL0A 5KRTA 1HX1A 3V6DA 4NB4A 4JI7K 2HHTA 4BR4A 3AVNA 3M8SA 3KLIA 1Z25A 4O5FA 4E7IA 1M1KO 1J6ZA 5DMRA 1Q9YA 2X74A 3NF6A 4B3OA 1RBRA 4MLHA 3B8AX 3HSCA 3BF3A 3OBYA 3DLEA 5C2DA 4DG1A 3G25A 3CJCA 2KZZA 1K6YA 1WSIA 2I7NA 2P9PA 4DQ8A 1S9EA 4CZEA 5HOOA 2ATQA 1IG8A 4K43A 4BR7A 3ZT4A 3FZMA 3VEVA 3HT3A 3TSUA 4GV6A 4CVNE 2VQEK 2HSTA 1YTUA 4BDPA 3PUFA 3AA2A 3ZT1A 1BCOA 2HHVA 4DV1K 1YITN 3VEXA 2QWOA 5CYQA 4YOUA 1C0MA 1JLQA 2ZGYA 1X3MA 2X6SA 3A2FA 1ATNA 1TK8A 1HJRA 4NYNA 1RTDA 4GY2B 1B92A 2FBYA 3HTVA 3L4QA 4JKGB 4IG0A 1TKXA 1J53A 3ALYA 4Z94A 4CHYA 4CF1A 4FJXA 1K73O 3IFRA 3UKRA 4X66K 2Y1JA 3C0BA 3TANA 4KTZA 3FZLA 3WEEA 3KD1E 1HJOA 2NNWA 2P9SB 4ZHRA 1FJGK 1K8AO 1NK8A 2UUBK 2HMIA 3DXKB 3IUCA 1O13A 1KD1O 1RT1A 1VSMA 4CZLA 1QTMA 2ETJA 2UUCK 2DTUA 2IDOA 4FLYA 2VG5A 3ZEUB 4QS9A 1IH7A 2UXBK 4JK8A 4PL7A 4BR2A 3NH2A 3KVGA 4CZIA 2JLEA 4CIFA 3VMFB 3RVCA 3MX2A 4E7JA 1GLJO 4DHYA 4FM1A 4DTXA 1RFQA 4DUZK 1RBTA 4M7YA 2E8AA 5HRSA 1BL3A 1ATSA 3CQYA 3T1HK 2VQFK 3SUOA 1TKZA 4H5RA 3SJJA 3SUNA 1L5UA 3VQDA 3PLAA 3BEXA 1VSHA 3BF1A 3E9LA 4CJ5A 3OS0A 1S1VA 2OZSA 1QVFM 4KHPK 3THWA 4OLBA 1S1UA 4E7HA 3DLHA 1VQMN 4RW7A 3L2WA 1WSFA 5ADXA 3MN6A 1VQ5N 2BUPA 2VWBA 1WAJA 5M1QA 1IV0A 4J2BA 4CGFA 4QAGA 4RW9A 1GLCG 4IDHA 4BQLA 3VQBA 5KQDA 1S5JA 4CJSA 3O8MA 1CZAN 3JSMA 3D0PA 1NM1A 4FJ9A 4FOEA 3H3NO 3ISNC 5AZIB 1JLBA 4C8MA 4OPKA 3MCPA 1NWKA 3OA9A 3O6WA 1D9FA 2KFNA 3OYJA 2YNGA 2DFFA 4XIUA 3OYEA 3AVLA 3VQ4A 3DI6A 3AO1A 3MMVA 3KLHA 3IS9A 1C0GA 1XHXA 4AH9A 4KREA 1BISA 3A0IX 3HI0A 1S6QA 4E1NA 4JKCA 1UA1A 3OYFA 1GLEG 3ZETB 4CZJA 4DMNA 1VSKA 4BRCA 1JCGA 3S3NA 3CJ1A 4CD3A 4ELVA 1M90O 3SQ0A 1SAZA 2VGMA 3K5LA 1CZ9A 4CI6A 3U3YA 1CXQA 1LOTB 4JI2K 2O8EA 3O3FA 1RBVA 4HUGA 4JKBA 3CCEN 1FW6A 1HKCA 4DTRA 1J9AA 3NF8A 1Q86O 2AP1A 4DTSA 1S1XA 4FWQA 3D2FB 1VQPN 4CEOA 3KLFA 1LV5A 2G8VA 3AO5A 4FM2A 4B1VA 2OPPA 3C6HA 4JRQA 3OTOK 4FVUA 2XY6A 1NGEA 3VOVA 2O8DA 2FSNA 4FZZA 1Z6RA 5CY4A 2JWKA 3FGUA 4EIAA 4MDBA 4CCHA 4QOZB 3Q7BA 2QWNA 3T7ZA 2HHSA 3DMJA 4BC5A 1NK4A 3VQ7A 2A41A 4CEEA 1KAYA 2XY8A 2RE2A 4CECA 3QDKA 1Q81O 4M42A 5FDLA 4F2RA 4KPYA 1HYZA 1EWQA 1VSFA 4KKOA 3VEZA 2P9LA 5CYMA 4JK9A 1SL2A 1XMQK 4JI4K 4M3YA 3WXKA 4YY3K 3JS6A 3LP2A 4H0TB 3NCIA 5KI6A 5KPRA 2P9KB 4PKHA 2G8IA 5DM6L 4WFAL 3ZSVA 3I0RA 5JVGL 4DV2K 2J4RA 1GLLO 4CEFA 4LSNA 2HF3A 4DV7K 3M1FA 5A2QO 4BDYA 4GV3A 2GBZA 1KAZA 5JS2A 2BE2A 4H5WA 4X64K 2PYJA 4YOTA 4B3RK 3HZ6A 1RT6A 1WBBA 5AFUH 3J80O 4AQYK 2Q97A 4FLXA 2NUBA 4WYBA 3VQ5A 4DS5A 4AILC 4JRPA 4DSLA 4LH5A 2XO7A 3AA5X 4RW4A 3RR8A 3A5MC 2NRRA 2EWSA 5K14A 4KHYA 3I0SA 4F9OA 4N41A 1KVCA 2NRZA 3M8PA 3TPQA 4DU3A 1TL1A 3WQUA 3C65A 3OYDA 4DFKA 2NRHA 4N5SA 1CZBA 4DR1K 4BROA 4BRGA 1HUXA 2E2QA 3LP1A 3GBTA 4LC9B 3CCVN 3LAMA 5D3GA 2HHQA 4FPBA 2YV0X 4RW6A 4OKKA 1F21A 3LZIA 1BA1A 3MK6A 3O80A 5M1NA 3RSEB 2DY4A 4H0VB 3RMCA 3DRSA 2YI1A 4BRPA 2KFZA 1DKGD 1VSDA 4DR5K 2IC3A 3O9UA 3W3DA 3CJAA 3D7EO 1EETA 2GTDA 3OYMA 4X62K 2OZMA 1X3NA 2BTFA 3QNOA 3U9ZA 4DS4A 3L6QA 1WSHA 4L8RB 4CJWA 4BR9A 4WQ4C 4BRLA 4CF0A 1SZ2A 4JAXA 3O9QA 1QSLA 3IAYA 3PSIA 3L2VA 1NU0A 3K58A 3QEPA 2QK9A 3NVMA 4OX9K 3AV9A 2RF2A 2B6AA 4E7KA 2ZE2A 1WBDA 1WN7A 1YUWA 5GADP 3KZBA 3OS2A 3QEVA 4DV4K 3G0ZA 3R6MA 2OTLN 4WQ4A 1T44A 2VG7A 4BC2A 5C2FA 2NRTA 3VERA 4DSKA 2P5GA 3C6TA 2DFHA 2X78A 1BU6O 4EP5A 2E6LA 1X9SA 4IJAA 3KK7A 3RRHA 3EY1A 1GLBG 2GWJA 3PX0A 3OYIA 3VQEA 2RKIA 2D0OA 1GOAA 3QICA 1D8YA 3KLEA 2UUAK 5LJWA 1ASVA 3DLLL 1TVRA 4H0OA 2HBMA 2E88A 4NXMK 4YNQA 4F2SA 4PL8A 3IMXA 1BO5O 1JLCA 1VQ4N 4JKGA 4CGJA 3N4QA 3T69A 4FYDA 4ISEA 4CZKA 4IFEA 1ZC6A 4FJ5A 3WXMB 3C6UA 3HP9A 1ITGA 1QSSA 2O8BB 5IT9O 4DTOA 3K9JA 2CH6A 4A2BA 5FLXO 3ATUA 1NGDA 3AARA 4GMJB 5AQQA 1DGKN 4BVPA 2P9SA 4HWIA 4B08A 4FLVA 2Q0UA 1HQEA 1R59O 3DXKA 5KPZA 2HW3A 2VGNA 2NRXA 3O4NA 1HNIA 4H4OA 4WCEL 4RWTA 3WNFA 3ZEUA 3P39A 4IEEA 4DV6K 1I3AA 2FF6A 4OKJA 3VA0A 1IKWA 1DTQA 3FR0A 3V9UA 3IRXA 4E89A 4HVJA 4IOCL 4PWDA 1XMOK 4B1ZA 1YI2N 4CJ3A 3O08A 4B9SA 2GV9A 2Z1HA 2V7YA 4JKDA 2VWKA 1SQKA 4F3TA 4Z4EA 1RDAA 2GUIA 5HP1A 4WE1A 2FBVA 2FSKA 1Y97A 4IO8A 1JL2A 1NKCA 5EXWA 4CEAA 4U67L 2QWPA 1NKBA 1CXUA 4B1WB 2JGUA 3SAGA 3SQ1A 1TK5A 5FROA 1ZXOA 3VN5A 4BACA 1NG9A 2KLAA 3CETA 1KFSA 4B9UA 3DLRA 4B8AB 5HL7L 1JXEA 3VENA 2Q31A 4HHTA 4KI4A 1RCHA 5BPLA 3TWHA 4NXNK 1ESVA 4A62A 3SPZA 4DU1A 3OY9A 4GNIA 3ULDA 1IBMK 3DOLA 4N47A 2G8UA 3AA4A 2Q0RA 1S72N 2DPNA 3Q7CA 1BIUA 1U49A 1TL3A 3K2PA 1OH6A 3DM2A 5AQZA 1GOCA 4BG8A 2FXUA 1BWFO 1BGXT 1RDWX 1OH7A 2KTQA 4CJRA 1U6ZA 3LWLA 4CBXA 1ZYQA 4DR4K 3HOSA 3CJBA 3TABA 4OKEA 1HPMA 4KFBA 4H4MA 5AQMA 4CJLA 2IVPA 5FPMA 4JI6K 1VRTA 4M3TA 2VWJA 4B9MA 5GIOA 1NJIO 4KTWA 3A5LC 3WT0A 2HNYA 1NJXA 4FW2A 4AHUA 3ENOA 3CD6N 4C23A 3ZETA 5EX5A 5M1OA 1NGIA 3H45C 3RWUA 4IJNA 1XNQK 4DSIA 4O5BA 4FO0A 3D2EB 3OBWA 4EP4A 2WTUA 2QW9A 3UIQA 2HVHA 4B9QA 1VSEA 2RHKA 3SLCA 5AQLA 5GINA 3L3VA 4JEPA 3HVTA 3EE9A 3UKUB 2P9NB 1W9HA 2P5OA 3BY5A 3TU5A 3DWLA 3VF6A 3H46O 3FE1A 1YAGA 2Z1IA 1TV6A 1NJWA 2E5LK 3SCXA 4IKFA 2HBKA 2E20A 3KK3A 3CXCM 3OHRA 1LWFA 2WONA 1U04A 4FK2A 3NGYA 3QIPA 4DQSA 3KKRA 2PYLA 4LFBK 3QIOA 3MWPA 3KK2A 2OA8A 3O1BA 3J81O 1ZBLA 3AVBA 2XHBA 2FLOA 1TAQA 2B5JA 3EEQA 4L3QA 3CQ8A 2DFEA 1U47A 1U2VB 4O0IA 5AQWA 1NGFA 1WSJA 1QZ5A 1K8KB 4CFBA 3CFRA 4JK7A 4MFBA 3P1GA 4GW6A 5AQGA 3VQ9A 4CERA 4Q5VA 4Z4HA 5AQTA 4I2QA 3ENBA 1HKBA 4OLAA 4EFHA 4M63C 2P9KA 3RMAA 3U9DA 4O4GA 3LDSA 5LMNK 4FW1A 1RT3A 1RT2A 4K42A 4W5TA 2KHOA 1QE1A 3MDQA 3K0SA 5EVZA 3AGKA 3AAPA 3HRGA 3CCRN 1S3XA 4CHPA 3M5RA 4W5QA 1O1WA 1WSGA 1LAVA 3TAQA 3OYAA 1NLVA 5AQPA 3D45A 1OVQA 3KKSA 3LALA 4NLCA 2P51A 4JNEA 4BRMA 4BRAA 2P9UB 4CFCA 3G10A 3CF5L 3SV4A 5FRNA 2D5RA 3QERA 3WNEA 3CJ7A 3A5NC 4DFMA 2ITMA 4FJLA 1VRUA 4U7BA 4ID1A 1BCMA 4QCLA 4Y0WA 1QQNA 4BE2A 1YXQA 5AQOA 3ID6A 4DSFA 1BI4B 3MCAB 4GKJK 2G8FA 1JCEA 3K9KA 4HCBA 1YVNA 3RMDA 5JS1A 4KHSA 5AQJA 2ZQBA 1C1BA 5AQRA 4J2DA 4CJFA 4DB3A 3EYZA 4KHQA 4IDKA 4FLZA 2Y1IA 4FWMA 1LWEA 4E1JA 4YFUA 1YJ9N 3SZ2A 2HHXA 2H3GX 4RTFD 4BDZA 4FK0A 1NJYA 4LD0A 4BRHA 2A3ZA 1EXQA 2YJEA 2YNFA 5J2NA 1BDGA 3EKUA 4K8XA 4Z4IA 2I7PA 5LL6Z 4BG9A 2RN2A 1UA0A 4OO1J 4KHNA 3T19A 1Q82O 1QHAA 4I2PA 2ITGA 2ZM6K 2XY5A 2W40A 2CH5A 4LFCK 5SZTA 2QWMA 3NGIA 1VQ8N 3CCJN 2ZJRL 3AVIA 4YOVA 4F8RA 1OVYA 4NCBA 3TSQA 3C7NB 2QA4N 3BZKA 4IEIA 2ZJQL 3HL8A 1QQMA 2WUSA 2KQ2A 3VA3A 4EZ6A 3ZSQA 5LMUK 4H5VA 4BR5A 3VQCA 3LP0A 3O5BA 4O0JA 1IKVA 4GV9A 1T6CA 1OH8A 3M8RA 4CIGA 4FJHA 3ZT0A 3IG1A 2F4VK 1C6VA 1ZBHA 1IJJA 1VK0A 3CC4N 1KAXA 1IKYA 3KK1A 2QKKA 4FOIA 4CJUA 4CBUA 1N8RO 1KRPA 5HBMA 2HVIA 3V1QA 2PAVA 4H03B 2P9PB 3P31A 5E84A 2ZJPL 1XHZA 4BC3A 5FPEA 2F7TA 1HR0K 1OKJA 2F9WA 4MLEA 4AHVA 3L2QA 3KTQA 4FK4A 3ZSZA 4BQZA 4BR0A 2FBTA 3CCLN 3TTDA 4PY5A 1RT5A 1EKEA 3FZFA 5CZ2A 4YHHK 3DLGA 4LH4A 2Q1NA 5B8HA 3ULEA 3AA3A 4DF4A 2QM1A 4H8KA 3CPEA 1Z05A 3ZX2A 1MU2A 3CM6A 1VHXA 1L3TA 1BIZA 3SQ2A 2W6LA 1WLJA 3H1VX 4CEDA 5CE3A 5HLFA 3I8BA 3OYCA 3TAEA 1NGCA 3M3ZA 4BRQA 4CGDA 5I9EB 1W2BM 2O8BA 4C8LA 1HQUA 3DAWA 5E41A 4K41A 2PZSA 4JHDB 1UOCA 3ZSRA 2O8CB 3THYB 3LPUA 1G15A 3MEEA 1LCUA 3V1OA 4CE9A 4LY7A 4E7LA 1HLUA 1T3VA 1Q7YO 4LF5K 3S41A 3ATVA 4BRDA 1IG9A 4FJKA 1DEJA 1HYSA 1REVA 5AQHA 5EY4A 2UU9K 2B4JA 5IWAK 1C1CA 1N34K 3WUHA 1UAXA 4FL9A 4BVOA 4I7FA 4BGAA 2V51B 1X9WA 1ATRA 1BUPA 3R3LA 3A5OC 4CBWA 1KC8O 3EL2A 3B6OA 2EX3A 4CGHA 5C0YA 2VG6A 3EZWA 3JXUA 3CCUN 1DT9A 3CM5A 5C12A 3ENHA 3CCQN 3AVGA 5MLCQ 1EO1A 4NLBA 4AHCA 4NYFA 1X9MA 4A57A 2GUPA 4JS4A 1MDUB 3SK3A 1NGHA 3TTFA 3THWB 1RGIA 4IZ9A 4DWIA 4B1XB 4E1MA 4NCAA 4B8CA 2YKMA 2IGIA 1KFDA 4QS8A 4DU4A 4DQIA 4EZ9A 3FZHA 1TKDA 5AQVA 3FLCO 5BR9A 3TAPA 3BUZB 3SUPA 4BWJA 4FWNA 4BRNA 3CJ9A 5AFUA 1HNWK 4O8KA 2E4LA 1KVBA 1Q8IA 1GLFO 5BN9A 3BP8A 3SAHA 4KBOA 3HXMA 3OW2M 1WOQA 3CI5A 3SMPA 3K5NA 3QESA 3LDOA 3TAMA 3QFPA 1T05A 3VEYA 4CK2A 5GAGP 2NZTA 1QHTA 5J1EA 1DLOA 1FK9A 4WQ5C 3CQXA 2Q36A 4LSLA 2WFBA 1ZBIA 4BE0A 3L2RA 1EWRA 2D0CA 4EHUA 3K5MA 4AHTA 1TUYA 2D0BA 2KW4A 3DXMB 4W5RA 1G99A 4PA1A 4M3RA 4FWOA 1NGAA 4AF1A 5KGXA 2F9TA 4H5TA 4B1YB 4B3MK 1RTHA 1TGOA 1VQ6N 4WQ5A 5J2MA 1VQ7N 1NKEA 4CK3A 1Q9XA 2PFUA 3AAQA 4UY8O 1RDDA 2IAJA 3AVMA 2BANA 2XRIA 3NDKA 5BN8A 2YKNA 3NF9A 1H1VA 4FJNA 1QQCA 4CJKA 3SI6A 2HB5A 3CG7A 5I42A 3K57A 3QBXA 4KO0A 1NNEA 1BQNA 3D2EA 3P83D 5HRRA 2HHUA 3L0QA 3KD5E 3ZLJA 4DUYK 1RNHA 3G4SN 3KIOA 4RW8A 2XY7A 3MXMA 2UXCK 1YVUA 4K25A 2HMPA 4B9NA 4EAHD 5GAHP 1JLFA 3UKUA 1OH5A 2CGJA 2P9NA 4BC4A 4YORA 2W42A 1L3VA 3ZX3A 3THVA 4RCHA 4DV0K 1NK7A 4M45A 1E3MA 4ISFA 3C95A 4Q0BA 4KHUA 1E4FT 3F2KA 1FKOA 4ZTFA 1VSLA 3GDQA 4Z4GA 2O8FB 3ZX0A 4CJ7A 1VQNN 4KH5A 5AR0A 2VYPA 3OVNA 3HSTB 4B9VA 3TR8A 5H1SQ 2E1YA 4X65K 4CIEA 2GELA 5DK5A 2IVOA 3LDQA 3VQAA 4FWLA 2NRVA 3QEIA 1YIJN 2P9LB 1IBKK 3NAEA 4E0DA 3I56N 1RTJA 3MECA 3R9PA 4MDAA 1K8KA 3AO2A 2FC0A 3FFIA 4BGBA 3KLGA 4BRIA 3OJSA 2R7YA 5GIPA 1NBWA 1QVGM 3CPWM 4CHZA 5TKWA 1FKPA 5SWMA 4M3UA 4CJVA 4JV5K 3MEGA 2OTJN 3SAFA 1RTIA 1S9GA 5LJVA 3DRPA 3P5JA 1P90A 2HHHK 1J54A 4KV8A 3ASMA 1NK9A 3PIPL 4DFPA 1V4TA 3MEDA 4JLHA 5JLHA 4KB0A 3EE8A 1QSYA 2P9UA 3HM9A 1TYQB 3NMUA 4CF8A 3MAQA 1HYVA 1TUUA 3V9WA 4G9ZA 5AQFA 5BR8K 1X9JA 4R79A 3PO4A 4IFYA 3NHGA 1BG3A 2KZMA 3LWMA 3D6RA 5T7BA 4YDUC 3B6PA 5M1FA 3H08A 1BI4A 4FZYA 5ELZA 3J8AA 5AZJB 4CF2A 4PQUA 5AQSA 4FWPA 1SKSA 4JI8K 3GE1A 3SBGA 3NBPA 2A5XA 4DTPA 4DR2K 3S3OA 3DJCA 4DR6K 3AVCA 1BA0A 3N4PA 4CZHA 4CD1A 3SPYA 2AA4A 3H3OB 3DRRA 2YCHA 4YDUA 4AHSA 5KTQA 2HNDA 1A5WA 3EKSA 4KAZA 4J2EA 1ZBSA 3LPTA 4I6MB 5AZIA 3QO9A 1VQKN 4FPAA 1S1TA 4OGCA 2YHBA 3TTCA 5JICA 2YJFA 4ISGA 2E2PA 5BREA 4M41A 1N6QA 4JS5A 1ILYA 1A5XA 3AO3A 3QEXA 1KVAA 2IOCA 3PSFA 4CJEA 5JLFA 2PY5A 5AQNA 3C7NA 3VGMA 3QETA 4R5PA 4FLTA 3SUQA 1EX4A 1HKGA 2P9IB 4CGGA 4DV3K 5AQXA 2ZWHA 3OYLA 1N36K 3O4QA 3QINA 1W7AA 2HHWA 2KKZA 4JKHA 1JLGA 2X6NA 3S9HA 4DQPA 2QI2A 2P1JA 1B9FA 5CZ1A 4ILGB 5AQUA 3OYNA 1HNXK 4JN4A 3D2FA 2O4GA 3ZSXA 1R0AA 1S22A 2QXFA 2VCPA 2A1RA 4PUOA 4C1NK 5HROA 2E2OA 1S6PA 1NGBA 2ZD1A 4W5NA 1TKTA 5KGWA 1YT3A 5M1PA 3F5TA 4GVEA 4RG8A 1XUPO 2I5JA 1VSJA 1EQYA 4Z0UA 3ITHA 3HYFA 2QTDA 4DCHA 3CFOA 1RDUA 3E9OA 4V19S 3LM2A 4M3WA 2RPIA 4DFJA 3O9RA 3PY8A 4Y1CA 1A5VA 1HNZK 5JMVA 1P8ZA 4JHDA 1WUAA 4CHQA 3BZCA 1RBUA 1SS6A 5EOYA 2O8CA 3THYA 1LWCA 1XC3A 1BOTO 4B3TK 3CIPA 1SKRA 2QWRA 4Z4CA 5ADXH 1RILA 4FCYA 4HTUA 1NK6A 4J8FA 1XI1A 3O3HA 3AVJA 4CZGA 3OS1A 3SV3A 5I3UA 4ELUA 2Z1GA 4A61A 2A40A 3ZCMA 2IVNA 2A6AA 1NGJA 3EZ5A 5AQKA 3DLBA 2GWKA 2WBNA 2HOEA 5C10A 4CJTA 5BPMA 3L2UA 3FFKB 4FM0A 4CEBA 3V4IA 3THXB 2QWLA 4LF4K 4AHRA 4I9LA 3CC7N 5E26A 3PX6A 4FJ8A 1HMVA 1ZBFA 4IO9L 3C94A 2JWLA 2UXDK 4KB1A 1YTAA 4Y1DA 4Z4FA 4HTLA 4M3ZA 3AVKA 5KPTA 1XWLA 4CJQA 4JI5K 4KI6A 1C0UA 4CZFA 4B9LA 1FXXA 1N5YA 4A2AA 3RRGA 1WSEA 3WNGA 3VQPA 2HBLA 4CZMA 1J5OA 3RR7A 4JI1K 3O3GA 3NH0A 1IO2A 4FZXC 3VGKA 4W5OA 2OYQA 3LAKA 3RSEA 3OYKA 1NMNA 3LZJA 4DR7K 4H0YB 4ELTA 2E6MA 3QMLA 3ZT3A 2G8WA 4IOXA 4QS7A 4JI3K 1XQSC 1VQON 3ZYYX 4HCCA 4DLEA 2ZGZA 3K5OA 4JD2B 3CCMN 3PIOL 4XEIA 4AM7A 1RDCA 4OGEA 3VTIA 3G6EN 3LDPA 3TAGA 4KRFA 3DXMA 3L3UA 1W97L 5C15A 3P4IA 4GVMA 3JYTA 5BRHA 3CCSN 3I55N 4DTJA 3BDPA 2A1SA 1JXBA 2FF3B 4OJRA 1TAUA 1NOYA 2F8TA 3V9ZA 4DV5K 1NJZA 4DSEA 4C8NA 3ID8A 1S1WA 5GAEP 4ILHA 3T1YK 4NCGA 3TARA 1MWKA 2HBJA 1JJ2M 1RBSA 3CYMA 4AM6A 4FLWA 1I94K 2OCEA 3NH1A 3VETA 1VQLN 2OPRA 2NRWA 4HUFA 1BHLA 5JVHL 3ZSYA 3MXJA 4JKAA 3LM9A 4BRFA 3NVKA 3M8QA 4CESA 3A8YA 3TI0A 4FJGA 3KJVA 4FJMA 2BH1A 3V81A 3HM8A 4H0XB 1U48A 5AJ3K 3F9MA 3MN9A 1HPZA 1JKHA 3TAFA 3VEWA 1SL1A 2WC9A 3HOTA 3H6EA 5F1XA 3HVRA 4TSXA 5DM7L 2O8FA 4CJ4A 1TK0A 4O44A 3UKRB 1L3SA 3L4IA 4GKKK 4FJJA 1WB9A 3WEEB 4LFAK 3H1QA 2Q3SA 2IIRA 2GEMA 3AVHA 2YHYA 3RMBA 1VAZA 3V9XA 1NK5A 4K8ZA 2D0PA 1JL1A 3ZSWA 4CHOA 4OPAA 3T3FA 3PX4A 3K59A 3CC2N 3SMSA 4PKGA 4NO7A 4XH5A 4J2AA 2V7ZA 3FZKA 1HRHA
chains in the Genus database with same CATH topology
4DR2K 4DR6K 4V19S 4K0KK 4CVNE 4DR3K 2VQEK 4LF6K 4LF9K 3JAMO 4DV1K 1HNZK 1XNQK 1HR0K 4DR5K 4DV6K 4YHHK 4X65K 1XMQK 4X62K 4B3TK 4JI4K 1XMOK 1J5EK 4YY3K 4DV5K 1HNWK 4B3SK 1IBKK 1N33K 4X66K 4GKJK 3T1YK 4DV2K 1XNRK 4DV7K 5A2QO 3J7YP 1FJGK 2UUBK 4OX9K 1I94K 4X64K 4B3RK 2E5LK 4JYAK 2UUCK 3J80O 4DV4K 4AQYK 4JV5K 4DV3K 1N32K 1N36K 2UXBK 4LF4K 4JI0K 4B3MK 4LF7K 4NXNK 5AJ3K 3J7AP 2HHHK 4LFBK 5LL6Z 2UXDK 3J81O 1IBMK 1HNXK 4LF5K 4JI2K 4JI7K 2ZM6K 4JI5K 4DUZK 4LFCK 2UUAK 4GKKK 2UU9K 5IWAK 4LF8K 1N34K 3T1HK 4NXMK 4CW7B 4LFAK 2VQFK 5BR8K 4DUYK 1IBLK 2UXCK 4JI1K 5LMUK 4DR1K 4DR4K 3OTOK 4KHPK 5IT9O 5LMNK 4JI6K 2F4VK 4DR7K 4JI8K 5FLXO 4DV0K 4JI3K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR2 K;  4DR6 K;  4V19 S;  4K0K K;  4CVN E;  4DR3 K;  2VQE K;  4LF6 K;  4LF9 K;  3JAM O;  4DV1 K;  1HNZ K;  1XNQ K;  1HR0 K;  4DR5 K;  4DV6 K;  4YHH K;  4X65 K;  1XMQ K;  4X62 K;  4B3T K;  4JI4 K;  1XMO K;  1J5E K;  4YY3 K;  4DV5 K;  1HNW K;  4B3S K;  1IBK K;  1N33 K;  4X66 K;  4GKJ K;  3T1Y K;  4DV2 K;  1XNR K;  4DV7 K;  5A2Q O;  3J7Y P;  1FJG K;  2UUB K;  4OX9 K;  1I94 K;  4X64 K;  4B3R K;  2E5L K;  4JYA K;  2UUC K;  3J80 O;  4DV4 K;  4AQY K;  4JV5 K;  4DV3 K;  1N32 K;  1N36 K;  2UXB K;  4LF4 K;  4JI0 K;  4B3M K;  4LF7 K;  4NXN K;  5AJ3 K;  3J7A P;  2HHH K;  4LFB K;  5LL6 Z;  2UXD K;  3J81 O;  1IBM K;  1HNX K;  4LF5 K;  4JI2 K;  4JI7 K;  2ZM6 K;  4JI5 K;  4DUZ K;  4LFC K;  2UUA K;  4GKK K;  2UU9 K;  5IWA K;  4LF8 K;  1N34 K;  3T1H K;  4NXM K;  4CW7 B;  4LFA K;  2VQF K;  5BR8 K;  4DUY K;  1IBL K;  2UXC K;  4JI1 K;  5LMU K;  4DR1 K;  4DR4 K;  3OTO K;  4KHP K;  5IT9 O;  5LMN K;  4JI6 K;  2F4V K;  4DR7 K;  4JI8 K;  5FLX O;  4DV0 K;  4JI3 K; 
#chains in the Genus database with same CATH topology
 3OJU A;  4JKE A;  1UWB A;  4CFA A;  3BGR A;  4K0K K;  2V52 B;  3AGR A;  1U45 A;  1LW2 A;  3WXI A;  5LY3 A;  1C0F A;  3IKM A;  1CLQ A;  4DQR A;  3O9T A;  3JAM O;  3HPG A;  4ILJ A;  2W41 A;  3F9K A;  4CF9 A;  2WOM A;  4BWM A;  4DF8 A;  3LDN A;  4IXC A;  2O4I A;  3MX5 A;  3KHY A;  1QQO A;  4ICL A;  3KWI A;  4E19 A;  3GL1 A;  3NF7 A;  3HP6 A;  2HF4 A;  2CGL A;  2YHX A;  4JKF A;  5FPN A;  1QZ6 A;  3LL3 A;  1SV5 A;  4N56 A;  5HRN A;  3VF2 A;  1C1A A;  3CME N;  1N33 K;  1VQ9 N;  4BRE A;  3WQT A;  3HJF A;  5BRD A;  1TYQ A;  3MXI A;  3P38 A;  3SQ4 A;  1MA9 B;  1SUQ A;  1VSI A;  3QLH A;  5AQY A;  3J7Y P;  1KQS M;  4WFN L;  2A42 A;  3V9S A;  3QBW A;  2Q2R A;  3PO5 A;  4WF9 L;  4YOW A;  5J2P A;  4KH6 A;  4FJI A;  1C0T A;  3V1R A;  1KSP A;  3NGZ A;  4MQ3 A;  1Q18 A;  3DLK A;  3E66 A;  5FPD A;  5AZJ A;  4KHW A;  3U8X A;  1N32 K;  4FSV A;  5CHI A;  2D0A A;  3IDH A;  1QS4 A;  4JI0 K;  1XC9 A;  2QWQ A;  3SYZ A;  3NE6 A;  2YNH A;  3AVF A;  1RT4 A;  2D4W A;  1GLA G;  4FWK A;  5C24 A;  1ASW A;  3I33 A;  1RDB A;  4E3S A;  4M3X A;  4I6M A;  3U4L A;  4FWR A;  3O1W A;  4DLG A;  3HK2 A;  4BRK A;  1JLA A;  3VQ6 A;  4PHT X;  3AY9 A;  1EP4 A;  4CW7 B;  1LAW A;  4F3O A;  3CMA N;  1HNV A;  5F0X A;  5J2Q A;  5KRS A;  2FBX A;  3OYH A;  1KCF A;  1IBL K;  5AQI A;  1WNS A;  4O55 A;  4A59 A;  5CR4 A;  3NFA A;  3VF4 A;  1YJW N;  1Y64 A;  1ZBU A;  2W6K A;  3LDL A;  4KTQ A;  3EN9 A;  4A5A A;  3ZSO A;  4A5B A;  1K9M O;  3HPH A;  3O9S A;  2F8S A;  1D4X A;  2F96 A;  3HBT A;  3QB0 A;  2QEX N;  4DQQ A;  4LF9 K;  4FWS A;  4IFV A;  1Z26 A;  1ASU A;  4IOA L;  3G71 N;  2O8E B;  5F2R A;  2P9I A;  3WNH A;  2LSN A;  4OPH A;  2CGK A;  4DTU A;  3E01 A;  4EHT A;  4CEQ A;  4CEZ A;  4WFB L;  4CGI A;  3E1Y A;  2YHA A;  4CK1 A;  4DTM A;  1BQM A;  2HNZ A;  4B1U B;  4CHN A;  2QKB A;  4YOY A;  1J5E K;  1YHQ N;  3R8E A;  2YX6 A;  3GOI A;  4OPJ A;  3S3M A;  2UYT A;  5TKY A;  4IG3 A;  3UE5 A;  1W0H A;  1NK0 A;  3MN7 A;  1D5A A;  3I8D A;  2O8D B;  4FVM A;  2ASM A;  5BPN A;  3VES A;  3GG4 A;  3ULE B;  1L3U A;  2AJQ A;  1T6D A;  3EO3 A;  4N76 A;  3T1A A;  5BRF A;  4OVL A;  3SNN A;  4C8O A;  4O8U A;  3HO1 A;  4MO4 A;  1KLM A;  2EHG A;  3M6G A;  3W0L A;  4JYA K;  2OPS A;  3AO4 A;  4CFD A;  3VQ8 A;  5EU7 A;  4XH1 A;  3WXJ A;  4YOX A;  1U2V A;  4LF7 K;  3J7A P;  3RTV A;  3VQQ A;  4CJP A;  4FJ7 A;  4IBN A;  3WXL A;  2ZF5 O;  1NGG A;  4FXD A;  3VTH A;  2PBD A;  1NMD A;  4ZTJ A;  3DOK A;  4I9Q A;  3LP3 A;  3OYB A;  3AVA A;  4C1N I;  2YNI A;  3QNN A;  4M7X A;  1D9D A;  4LF8 K;  1LW0 A;  4DKW A;  2IS3 A;  3DYA A;  2BGG A;  2GX9 A;  4B9T A;  3CFP A;  3SJH A;  3HPO A;  1MWM A;  5KQ8 A;  1KTQ A;  4C8K A;  3F73 A;  1NOZ A;  5C42 A;  4H0P A;  2OAN A;  4BE1 A;  3ZT2 A;  2D1K A;  3O4W A;  4FLU A;  4DR3 K;  2G8K A;  4LF6 K;  3SBT A;  1DTT A;  3CHW A;  3UB5 A;  1SKW A;  1X1P A;  2QXL A;  5M1K A;  3C6A A;  1KLN A;  4DTN A;  3THX A;  2ASO A;  2BDP A;  3QFU A;  4KH4 A;  1KXP A;  3MWT A;  5FRM A;  2YHW A;  1GOB A;  1JLE A;  2G8H A;  5HRP A;  4HUE A;  3QEW A;  4IWV A;  4B3S K;  3LAN A;  1T7P A;  3U6F A;  4G1Q A;  1I39 A;  3L8B A;  1XNR K;  2OPQ A;  3CER A;  4UQG A;  1YF5 L;  1T8E A;  3PV8 A;  4DSJ A;  3VEO A;  2E2N A;  1V4S A;  4PKI A;  1IKX A;  4H5N A;  1YJN N;  1U4B A;  3OYG A;  3R1X A;  4BY9 C;  4MO5 A;  1WAF A;  3KWG A;  3VPZ A;  2FSJ A;  2ASP A;  3J7Z O;  1JCF A;  4ID5 A;  3E9P A;  1GLD G;  3MN5 A;  5C25 A;  1E4G T;  3VGL A;  1T03 A;  1RT7 A;  2Z1J A;  4JD2 A;  4F4K A;  1B9D A;  4XH4 A;  3TSP A;  3U3G A;  2NLX A;  2E1Z A;  1SL0 A;  5KRT A;  1HX1 A;  3V6D A;  4NB4 A;  4JI7 K;  2HHT A;  4BR4 A;  3AVN A;  3M8S A;  3KLI A;  1Z25 A;  4O5F A;  4E7I A;  1M1K O;  1J6Z A;  5DMR A;  1Q9Y A;  2X74 A;  3NF6 A;  4B3O A;  1RBR A;  4MLH A;  3B8A X;  3HSC A;  3BF3 A;  3OBY A;  3DLE A;  5C2D A;  4DG1 A;  3G25 A;  3CJC A;  2KZZ A;  1K6Y A;  1WSI A;  2I7N A;  2P9P A;  4DQ8 A;  1S9E A;  4CZE A;  5HOO A;  2ATQ A;  1IG8 A;  4K43 A;  4BR7 A;  3ZT4 A;  3FZM A;  3VEV A;  3HT3 A;  3TSU A;  4GV6 A;  4CVN E;  2VQE K;  2HST A;  1YTU A;  4BDP A;  3PUF A;  3AA2 A;  3ZT1 A;  1BCO A;  2HHV A;  4DV1 K;  1YIT N;  3VEX A;  2QWO A;  5CYQ A;  4YOU A;  1C0M A;  1JLQ A;  2ZGY A;  1X3M A;  2X6S A;  3A2F A;  1ATN A;  1TK8 A;  1HJR A;  4NYN A;  1RTD A;  4GY2 B;  1B92 A;  2FBY A;  3HTV A;  3L4Q A;  4JKG B;  4IG0 A;  1TKX A;  1J53 A;  3ALY A;  4Z94 A;  4CHY A;  4CF1 A;  4FJX A;  1K73 O;  3IFR A;  3UKR A;  4X66 K;  2Y1J A;  3C0B A;  3TAN A;  4KTZ A;  3FZL A;  3WEE A;  3KD1 E;  1HJO A;  2NNW A;  2P9S B;  4ZHR A;  1FJG K;  1K8A O;  1NK8 A;  2UUB K;  2HMI A;  3DXK B;  3IUC A;  1O13 A;  1KD1 O;  1RT1 A;  1VSM A;  4CZL A;  1QTM A;  2ETJ A;  2UUC K;  2DTU A;  2IDO A;  4FLY A;  2VG5 A;  3ZEU B;  4QS9 A;  1IH7 A;  2UXB K;  4JK8 A;  4PL7 A;  4BR2 A;  3NH2 A;  3KVG A;  4CZI A;  2JLE A;  4CIF A;  3VMF B;  3RVC A;  3MX2 A;  4E7J A;  1GLJ O;  4DHY A;  4FM1 A;  4DTX A;  1RFQ A;  4DUZ K;  1RBT A;  4M7Y A;  2E8A A;  5HRS A;  1BL3 A;  1ATS A;  3CQY A;  3T1H K;  2VQF K;  3SUO A;  1TKZ A;  4H5R A;  3SJJ A;  3SUN A;  1L5U A;  3VQD A;  3PLA A;  3BEX A;  1VSH A;  3BF1 A;  3E9L A;  4CJ5 A;  3OS0 A;  1S1V A;  2OZS A;  1QVF M;  4KHP K;  3THW A;  4OLB A;  1S1U A;  4E7H A;  3DLH A;  1VQM N;  4RW7 A;  3L2W A;  1WSF A;  5ADX A;  3MN6 A;  1VQ5 N;  2BUP A;  2VWB A;  1WAJ A;  5M1Q A;  1IV0 A;  4J2B A;  4CGF A;  4QAG A;  4RW9 A;  1GLC G;  4IDH A;  4BQL A;  3VQB A;  5KQD A;  1S5J A;  4CJS A;  3O8M A;  1CZA N;  3JSM A;  3D0P A;  1NM1 A;  4FJ9 A;  4FOE A;  3H3N O;  3ISN C;  5AZI B;  1JLB A;  4C8M A;  4OPK A;  3MCP A;  1NWK A;  3OA9 A;  3O6W A;  1D9F A;  2KFN A;  3OYJ A;  2YNG A;  2DFF A;  4XIU A;  3OYE A;  3AVL A;  3VQ4 A;  3DI6 A;  3AO1 A;  3MMV A;  3KLH A;  3IS9 A;  1C0G A;  1XHX A;  4AH9 A;  4KRE A;  1BIS A;  3A0I X;  3HI0 A;  1S6Q A;  4E1N A;  4JKC A;  1UA1 A;  3OYF A;  1GLE G;  3ZET B;  4CZJ A;  4DMN A;  1VSK A;  4BRC A;  1JCG A;  3S3N A;  3CJ1 A;  4CD3 A;  4ELV A;  1M90 O;  3SQ0 A;  1SAZ A;  2VGM A;  3K5L A;  1CZ9 A;  4CI6 A;  3U3Y A;  1CXQ A;  1LOT B;  4JI2 K;  2O8E A;  3O3F A;  1RBV A;  4HUG A;  4JKB A;  3CCE N;  1FW6 A;  1HKC A;  4DTR A;  1J9A A;  3NF8 A;  1Q86 O;  2AP1 A;  4DTS A;  1S1X A;  4FWQ A;  3D2F B;  1VQP N;  4CEO A;  3KLF A;  1LV5 A;  2G8V A;  3AO5 A;  4FM2 A;  4B1V A;  2OPP A;  3C6H A;  4JRQ A;  3OTO K;  4FVU A;  2XY6 A;  1NGE A;  3VOV A;  2O8D A;  2FSN A;  4FZZ A;  1Z6R A;  5CY4 A;  2JWK A;  3FGU A;  4EIA A;  4MDB A;  4CCH A;  4QOZ B;  3Q7B A;  2QWN A;  3T7Z A;  2HHS A;  3DMJ A;  4BC5 A;  1NK4 A;  3VQ7 A;  2A41 A;  4CEE A;  1KAY A;  2XY8 A;  2RE2 A;  4CEC A;  3QDK A;  1Q81 O;  4M42 A;  5FDL A;  4F2R A;  4KPY A;  1HYZ A;  1EWQ A;  1VSF A;  4KKO A;  3VEZ A;  2P9L A;  5CYM A;  4JK9 A;  1SL2 A;  1XMQ K;  4JI4 K;  4M3Y A;  3WXK A;  4YY3 K;  3JS6 A;  3LP2 A;  4H0T B;  3NCI A;  5KI6 A;  5KPR A;  2P9K B;  4PKH A;  2G8I A;  5DM6 L;  4WFA L;  3ZSV A;  3I0R A;  5JVG L;  4DV2 K;  2J4R A;  1GLL O;  4CEF A;  4LSN A;  2HF3 A;  4DV7 K;  3M1F A;  5A2Q O;  4BDY A;  4GV3 A;  2GBZ A;  1KAZ A;  5JS2 A;  2BE2 A;  4H5W A;  4X64 K;  2PYJ A;  4YOT A;  4B3R K;  3HZ6 A;  1RT6 A;  1WBB A;  5AFU H;  3J80 O;  4AQY K;  2Q97 A;  4FLX A;  2NUB A;  4WYB A;  3VQ5 A;  4DS5 A;  4AIL C;  4JRP A;  4DSL A;  4LH5 A;  2XO7 A;  3AA5 X;  4RW4 A;  3RR8 A;  3A5M C;  2NRR A;  2EWS A;  5K14 A;  4KHY A;  3I0S A;  4F9O A;  4N41 A;  1KVC A;  2NRZ A;  3M8P A;  3TPQ A;  4DU3 A;  1TL1 A;  3WQU A;  3C65 A;  3OYD A;  4DFK A;  2NRH A;  4N5S A;  1CZB A;  4DR1 K;  4BRO A;  4BRG A;  1HUX A;  2E2Q A;  3LP1 A;  3GBT A;  4LC9 B;  3CCV N;  3LAM A;  5D3G A;  2HHQ A;  4FPB A;  2YV0 X;  4RW6 A;  4OKK A;  1F21 A;  3LZI A;  1BA1 A;  3MK6 A;  3O80 A;  5M1N A;  3RSE B;  2DY4 A;  4H0V B;  3RMC A;  3DRS A;  2YI1 A;  4BRP A;  2KFZ A;  1DKG D;  1VSD A;  4DR5 K;  2IC3 A;  3O9U A;  3W3D A;  3CJA A;  3D7E O;  1EET A;  2GTD A;  3OYM A;  4X62 K;  2OZM A;  1X3N A;  2BTF A;  3QNO A;  3U9Z A;  4DS4 A;  3L6Q A;  1WSH A;  4L8R B;  4CJW A;  4BR9 A;  4WQ4 C;  4BRL A;  4CF0 A;  1SZ2 A;  4JAX A;  3O9Q A;  1QSL A;  3IAY A;  3PSI A;  3L2V A;  1NU0 A;  3K58 A;  3QEP A;  2QK9 A;  3NVM A;  4OX9 K;  3AV9 A;  2RF2 A;  2B6A A;  4E7K A;  2ZE2 A;  1WBD A;  1WN7 A;  1YUW A;  5GAD P;  3KZB A;  3OS2 A;  3QEV A;  4DV4 K;  3G0Z A;  3R6M A;  2OTL N;  4WQ4 A;  1T44 A;  2VG7 A;  4BC2 A;  5C2F A;  2NRT A;  3VER A;  4DSK A;  2P5G A;  3C6T A;  2DFH A;  2X78 A;  1BU6 O;  4EP5 A;  2E6L A;  1X9S A;  4IJA A;  3KK7 A;  3RRH A;  3EY1 A;  1GLB G;  2GWJ A;  3PX0 A;  3OYI A;  3VQE A;  2RKI A;  2D0O A;  1GOA A;  3QIC A;  1D8Y A;  3KLE A;  2UUA K;  5LJW A;  1ASV A;  3DLL L;  1TVR A;  4H0O A;  2HBM A;  2E88 A;  4NXM K;  4YNQ A;  4F2S A;  4PL8 A;  3IMX A;  1BO5 O;  1JLC A;  1VQ4 N;  4JKG A;  4CGJ A;  3N4Q A;  3T69 A;  4FYD A;  4ISE A;  4CZK A;  4IFE A;  1ZC6 A;  4FJ5 A;  3WXM B;  3C6U A;  3HP9 A;  1ITG A;  1QSS A;  2O8B B;  5IT9 O;  4DTO A;  3K9J A;  2CH6 A;  4A2B A;  5FLX O;  3ATU A;  1NGD A;  3AAR A;  4GMJ B;  5AQQ A;  1DGK N;  4BVP A;  2P9S A;  4HWI A;  4B08 A;  4FLV A;  2Q0U A;  1HQE A;  1R59 O;  3DXK A;  5KPZ A;  2HW3 A;  2VGN A;  2NRX A;  3O4N A;  1HNI A;  4H4O A;  4WCE L;  4RWT A;  3WNF A;  3ZEU A;  3P39 A;  4IEE A;  4DV6 K;  1I3A A;  2FF6 A;  4OKJ A;  3VA0 A;  1IKW A;  1DTQ A;  3FR0 A;  3V9U A;  3IRX A;  4E89 A;  4HVJ A;  4IOC L;  4PWD A;  1XMO K;  4B1Z A;  1YI2 N;  4CJ3 A;  3O08 A;  4B9S A;  2GV9 A;  2Z1H A;  2V7Y A;  4JKD A;  2VWK A;  1SQK A;  4F3T A;  4Z4E A;  1RDA A;  2GUI A;  5HP1 A;  4WE1 A;  2FBV A;  2FSK A;  1Y97 A;  4IO8 A;  1JL2 A;  1NKC A;  5EXW A;  4CEA A;  4U67 L;  2QWP A;  1NKB A;  1CXU A;  4B1W B;  2JGU A;  3SAG A;  3SQ1 A;  1TK5 A;  5FRO A;  1ZXO A;  3VN5 A;  4BAC A;  1NG9 A;  2KLA A;  3CET A;  1KFS A;  4B9U A;  3DLR A;  4B8A B;  5HL7 L;  1JXE A;  3VEN A;  2Q31 A;  4HHT A;  4KI4 A;  1RCH A;  5BPL A;  3TWH A;  4NXN K;  1ESV A;  4A62 A;  3SPZ A;  4DU1 A;  3OY9 A;  4GNI A;  3ULD A;  1IBM K;  3DOL A;  4N47 A;  2G8U A;  3AA4 A;  2Q0R A;  1S72 N;  2DPN A;  3Q7C A;  1BIU A;  1U49 A;  1TL3 A;  3K2P A;  1OH6 A;  3DM2 A;  5AQZ A;  1GOC A;  4BG8 A;  2FXU A;  1BWF O;  1BGX T;  1RDW X;  1OH7 A;  2KTQ A;  4CJR A;  1U6Z A;  3LWL A;  4CBX A;  1ZYQ A;  4DR4 K;  3HOS A;  3CJB A;  3TAB A;  4OKE A;  1HPM A;  4KFB A;  4H4M A;  5AQM A;  4CJL A;  2IVP A;  5FPM A;  4JI6 K;  1VRT A;  4M3T A;  2VWJ A;  4B9M A;  5GIO A;  1NJI O;  4KTW A;  3A5L C;  3WT0 A;  2HNY A;  1NJX A;  4FW2 A;  4AHU A;  3ENO A;  3CD6 N;  4C23 A;  3ZET A;  5EX5 A;  5M1O A;  1NGI A;  3H45 C;  3RWU A;  4IJN A;  1XNQ K;  4DSI A;  4O5B A;  4FO0 A;  3D2E B;  3OBW A;  4EP4 A;  2WTU A;  2QW9 A;  3UIQ A;  2HVH A;  4B9Q A;  1VSE A;  2RHK A;  3SLC A;  5AQL A;  5GIN A;  3L3V A;  4JEP A;  3HVT A;  3EE9 A;  3UKU B;  2P9N B;  1W9H A;  2P5O A;  3BY5 A;  3TU5 A;  3DWL A;  3VF6 A;  3H46 O;  3FE1 A;  1YAG A;  2Z1I A;  1TV6 A;  1NJW A;  2E5L K;  3SCX A;  4IKF A;  2HBK A;  2E20 A;  3KK3 A;  3CXC M;  3OHR A;  1LWF A;  2WON A;  1U04 A;  4FK2 A;  3NGY A;  3QIP A;  4DQS A;  3KKR A;  2PYL A;  4LFB K;  3QIO A;  3MWP A;  3KK2 A;  2OA8 A;  3O1B A;  3J81 O;  1ZBL A;  3AVB A;  2XHB A;  2FLO A;  1TAQ A;  2B5J A;  3EEQ A;  4L3Q A;  3CQ8 A;  2DFE A;  1U47 A;  1U2V B;  4O0I A;  5AQW A;  1NGF A;  1WSJ A;  1QZ5 A;  1K8K B;  4CFB A;  3CFR A;  4JK7 A;  4MFB A;  3P1G A;  4GW6 A;  5AQG A;  3VQ9 A;  4CER A;  4Q5V A;  4Z4H A;  5AQT A;  4I2Q A;  3ENB A;  1HKB A;  4OLA A;  4EFH A;  4M63 C;  2P9K A;  3RMA A;  3U9D A;  4O4G A;  3LDS A;  5LMN K;  4FW1 A;  1RT3 A;  1RT2 A;  4K42 A;  4W5T A;  2KHO A;  1QE1 A;  3MDQ A;  3K0S A;  5EVZ A;  3AGK A;  3AAP A;  3HRG A;  3CCR N;  1S3X A;  4CHP A;  3M5R A;  4W5Q A;  1O1W A;  1WSG A;  1LAV A;  3TAQ A;  3OYA A;  1NLV A;  5AQP A;  3D45 A;  1OVQ A;  3KKS A;  3LAL A;  4NLC A;  2P51 A;  4JNE A;  4BRM A;  4BRA A;  2P9U B;  4CFC A;  3G10 A;  3CF5 L;  3SV4 A;  5FRN A;  2D5R A;  3QER A;  3WNE A;  3CJ7 A;  3A5N C;  4DFM A;  2ITM A;  4FJL A;  1VRU A;  4U7B A;  4ID1 A;  1BCM A;  4QCL A;  4Y0W A;  1QQN A;  4BE2 A;  1YXQ A;  5AQO A;  3ID6 A;  4DSF A;  1BI4 B;  3MCA B;  4GKJ K;  2G8F A;  1JCE A;  3K9K A;  4HCB A;  1YVN A;  3RMD A;  5JS1 A;  4KHS A;  5AQJ A;  2ZQB A;  1C1B A;  5AQR A;  4J2D A;  4CJF A;  4DB3 A;  3EYZ A;  4KHQ A;  4IDK A;  4FLZ A;  2Y1I A;  4FWM A;  1LWE A;  4E1J A;  4YFU A;  1YJ9 N;  3SZ2 A;  2HHX A;  2H3G X;  4RTF D;  4BDZ A;  4FK0 A;  1NJY A;  4LD0 A;  4BRH A;  2A3Z A;  1EXQ A;  2YJE A;  2YNF A;  5J2N A;  1BDG A;  3EKU A;  4K8X A;  4Z4I A;  2I7P A;  5LL6 Z;  4BG9 A;  2RN2 A;  1UA0 A;  4OO1 J;  4KHN A;  3T19 A;  1Q82 O;  1QHA A;  4I2P A;  2ITG A;  2ZM6 K;  2XY5 A;  2W40 A;  2CH5 A;  4LFC K;  5SZT A;  2QWM A;  3NGI A;  1VQ8 N;  3CCJ N;  2ZJR L;  3AVI A;  4YOV A;  4F8R A;  1OVY A;  4NCB A;  3TSQ A;  3C7N B;  2QA4 N;  3BZK A;  4IEI A;  2ZJQ L;  3HL8 A;  1QQM A;  2WUS A;  2KQ2 A;  3VA3 A;  4EZ6 A;  3ZSQ A;  5LMU K;  4H5V A;  4BR5 A;  3VQC A;  3LP0 A;  3O5B A;  4O0J A;  1IKV A;  4GV9 A;  1T6C A;  1OH8 A;  3M8R A;  4CIG A;  4FJH A;  3ZT0 A;  3IG1 A;  2F4V K;  1C6V A;  1ZBH A;  1IJJ A;  1VK0 A;  3CC4 N;  1KAX A;  1IKY A;  3KK1 A;  2QKK A;  4FOI A;  4CJU A;  4CBU A;  1N8R O;  1KRP A;  5HBM A;  2HVI A;  3V1Q A;  2PAV A;  4H03 B;  2P9P B;  3P31 A;  5E84 A;  2ZJP L;  1XHZ A;  4BC3 A;  5FPE A;  2F7T A;  1HR0 K;  1OKJ A;  2F9W A;  4MLE A;  4AHV A;  3L2Q A;  3KTQ A;  4FK4 A;  3ZSZ A;  4BQZ A;  4BR0 A;  2FBT A;  3CCL N;  3TTD A;  4PY5 A;  1RT5 A;  1EKE A;  3FZF A;  5CZ2 A;  4YHH K;  3DLG A;  4LH4 A;  2Q1N A;  5B8H A;  3ULE A;  3AA3 A;  4DF4 A;  2QM1 A;  4H8K A;  3CPE A;  1Z05 A;  3ZX2 A;  1MU2 A;  3CM6 A;  1VHX A;  1L3T A;  1BIZ A;  3SQ2 A;  2W6L A;  1WLJ A;  3H1V X;  4CED A;  5CE3 A;  5HLF A;  3I8B A;  3OYC A;  3TAE A;  1NGC A;  3M3Z A;  4BRQ A;  4CGD A;  5I9E B;  1W2B M;  2O8B A;  4C8L A;  1HQU A;  3DAW A;  5E41 A;  4K41 A;  2PZS A;  4JHD B;  1UOC A;  3ZSR A;  2O8C B;  3THY B;  3LPU A;  1G15 A;  3MEE A;  1LCU A;  3V1O A;  4CE9 A;  4LY7 A;  4E7L A;  1HLU A;  1T3V A;  1Q7Y O;  4LF5 K;  3S41 A;  3ATV A;  4BRD A;  1IG9 A;  4FJK A;  1DEJ A;  1HYS A;  1REV A;  5AQH A;  5EY4 A;  2UU9 K;  2B4J A;  5IWA K;  1C1C A;  1N34 K;  3WUH A;  1UAX A;  4FL9 A;  4BVO A;  4I7F A;  4BGA A;  2V51 B;  1X9W A;  1ATR A;  1BUP A;  3R3L A;  3A5O C;  4CBW A;  1KC8 O;  3EL2 A;  3B6O A;  2EX3 A;  4CGH A;  5C0Y A;  2VG6 A;  3EZW A;  3JXU A;  3CCU N;  1DT9 A;  3CM5 A;  5C12 A;  3ENH A;  3CCQ N;  3AVG A;  5MLC Q;  1EO1 A;  4NLB A;  4AHC A;  4NYF A;  1X9M A;  4A57 A;  2GUP A;  4JS4 A;  1MDU B;  3SK3 A;  1NGH A;  3TTF A;  3THW B;  1RGI A;  4IZ9 A;  4DWI A;  4B1X B;  4E1M A;  4NCA A;  4B8C A;  2YKM A;  2IGI A;  1KFD A;  4QS8 A;  4DU4 A;  4DQI A;  4EZ9 A;  3FZH A;  1TKD A;  5AQV A;  3FLC O;  5BR9 A;  3TAP A;  3BUZ B;  3SUP A;  4BWJ A;  4FWN A;  4BRN A;  3CJ9 A;  5AFU A;  1HNW K;  4O8K A;  2E4L A;  1KVB A;  1Q8I A;  1GLF O;  5BN9 A;  3BP8 A;  3SAH A;  4KBO A;  3HXM A;  3OW2 M;  1WOQ A;  3CI5 A;  3SMP A;  3K5N A;  3QES A;  3LDO A;  3TAM A;  3QFP A;  1T05 A;  3VEY A;  4CK2 A;  5GAG P;  2NZT A;  1QHT A;  5J1E A;  1DLO A;  1FK9 A;  4WQ5 C;  3CQX A;  2Q36 A;  4LSL A;  2WFB A;  1ZBI A;  4BE0 A;  3L2R A;  1EWR A;  2D0C A;  4EHU A;  3K5M A;  4AHT A;  1TUY A;  2D0B A;  2KW4 A;  3DXM B;  4W5R A;  1G99 A;  4PA1 A;  4M3R A;  4FWO A;  1NGA A;  4AF1 A;  5KGX A;  2F9T A;  4H5T A;  4B1Y B;  4B3M K;  1RTH A;  1TGO A;  1VQ6 N;  4WQ5 A;  5J2M A;  1VQ7 N;  1NKE A;  4CK3 A;  1Q9X A;  2PFU A;  3AAQ A;  4UY8 O;  1RDD A;  2IAJ A;  3AVM A;  2BAN A;  2XRI A;  3NDK A;  5BN8 A;  2YKN A;  3NF9 A;  1H1V A;  4FJN A;  1QQC A;  4CJK A;  3SI6 A;  2HB5 A;  3CG7 A;  5I42 A;  3K57 A;  3QBX A;  4KO0 A;  1NNE A;  1BQN A;  3D2E A;  3P83 D;  5HRR A;  2HHU A;  3L0Q A;  3KD5 E;  3ZLJ A;  4DUY K;  1RNH A;  3G4S N;  3KIO A;  4RW8 A;  2XY7 A;  3MXM A;  2UXC K;  1YVU A;  4K25 A;  2HMP A;  4B9N A;  4EAH D;  5GAH P;  1JLF A;  3UKU A;  1OH5 A;  2CGJ A;  2P9N A;  4BC4 A;  4YOR A;  2W42 A;  1L3V A;  3ZX3 A;  3THV A;  4RCH A;  4DV0 K;  1NK7 A;  4M45 A;  1E3M A;  4ISF A;  3C95 A;  4Q0B A;  4KHU A;  1E4F T;  3F2K A;  1FKO A;  4ZTF A;  1VSL A;  3GDQ A;  4Z4G A;  2O8F B;  3ZX0 A;  4CJ7 A;  1VQN N;  4KH5 A;  5AR0 A;  2VYP A;  3OVN A;  3HST B;  4B9V A;  3TR8 A;  5H1S Q;  2E1Y A;  4X65 K;  4CIE A;  2GEL A;  5DK5 A;  2IVO A;  3LDQ A;  3VQA A;  4FWL A;  2NRV A;  3QEI A;  1YIJ N;  2P9L B;  1IBK K;  3NAE A;  4E0D A;  3I56 N;  1RTJ A;  3MEC A;  3R9P A;  4MDA A;  1K8K A;  3AO2 A;  2FC0 A;  3FFI A;  4BGB A;  3KLG A;  4BRI A;  3OJS A;  2R7Y A;  5GIP A;  1NBW A;  1QVG M;  3CPW M;  4CHZ A;  5TKW A;  1FKP A;  5SWM A;  4M3U A;  4CJV A;  4JV5 K;  3MEG A;  2OTJ N;  3SAF A;  1RTI A;  1S9G A;  5LJV A;  3DRP A;  3P5J A;  1P90 A;  2HHH K;  1J54 A;  4KV8 A;  3ASM A;  1NK9 A;  3PIP L;  4DFP A;  1V4T A;  3MED A;  4JLH A;  5JLH A;  4KB0 A;  3EE8 A;  1QSY A;  2P9U A;  3HM9 A;  1TYQ B;  3NMU A;  4CF8 A;  3MAQ A;  1HYV A;  1TUU A;  3V9W A;  4G9Z A;  5AQF A;  5BR8 K;  1X9J A;  4R79 A;  3PO4 A;  4IFY A;  3NHG A;  1BG3 A;  2KZM A;  3LWM A;  3D6R A;  5T7B A;  4YDU C;  3B6P A;  5M1F A;  3H08 A;  1BI4 A;  4FZY A;  5ELZ A;  3J8A A;  5AZJ B;  4CF2 A;  4PQU A;  5AQS A;  4FWP A;  1SKS A;  4JI8 K;  3GE1 A;  3SBG A;  3NBP A;  2A5X A;  4DTP A;  4DR2 K;  3S3O A;  3DJC A;  4DR6 K;  3AVC A;  1BA0 A;  3N4P A;  4CZH A;  4CD1 A;  3SPY A;  2AA4 A;  3H3O B;  3DRR A;  2YCH A;  4YDU A;  4AHS A;  5KTQ A;  2HND A;  1A5W A;  3EKS A;  4KAZ A;  4J2E A;  1ZBS A;  3LPT A;  4I6M B;  5AZI A;  3QO9 A;  1VQK N;  4FPA A;  1S1T A;  4OGC A;  2YHB A;  3TTC A;  5JIC A;  2YJF A;  4ISG A;  2E2P A;  5BRE A;  4M41 A;  1N6Q A;  4JS5 A;  1ILY A;  1A5X A;  3AO3 A;  3QEX A;  1KVA A;  2IOC A;  3PSF A;  4CJE A;  5JLF A;  2PY5 A;  5AQN A;  3C7N A;  3VGM A;  3QET A;  4R5P A;  4FLT A;  3SUQ A;  1EX4 A;  1HKG A;  2P9I B;  4CGG A;  4DV3 K;  5AQX A;  2ZWH A;  3OYL A;  1N36 K;  3O4Q A;  3QIN A;  1W7A A;  2HHW A;  2KKZ A;  4JKH A;  1JLG A;  2X6N A;  3S9H A;  4DQP A;  2QI2 A;  2P1J A;  1B9F A;  5CZ1 A;  4ILG B;  5AQU A;  3OYN A;  1HNX K;  4JN4 A;  3D2F A;  2O4G A;  3ZSX A;  1R0A A;  1S22 A;  2QXF A;  2VCP A;  2A1R A;  4PUO A;  4C1N K;  5HRO A;  2E2O A;  1S6P A;  1NGB A;  2ZD1 A;  4W5N A;  1TKT A;  5KGW A;  1YT3 A;  5M1P A;  3F5T A;  4GVE A;  4RG8 A;  1XUP O;  2I5J A;  1VSJ A;  1EQY A;  4Z0U A;  3ITH A;  3HYF A;  2QTD A;  4DCH A;  3CFO A;  1RDU A;  3E9O A;  4V19 S;  3LM2 A;  4M3W A;  2RPI A;  4DFJ A;  3O9R A;  3PY8 A;  4Y1C A;  1A5V A;  1HNZ K;  5JMV A;  1P8Z A;  4JHD A;  1WUA A;  4CHQ A;  3BZC A;  1RBU A;  1SS6 A;  5EOY A;  2O8C A;  3THY A;  1LWC A;  1XC3 A;  1BOT O;  4B3T K;  3CIP A;  1SKR A;  2QWR A;  4Z4C A;  5ADX H;  1RIL A;  4FCY A;  4HTU A;  1NK6 A;  4J8F A;  1XI1 A;  3O3H A;  3AVJ A;  4CZG A;  3OS1 A;  3SV3 A;  5I3U A;  4ELU A;  2Z1G A;  4A61 A;  2A40 A;  3ZCM A;  2IVN A;  2A6A A;  1NGJ A;  3EZ5 A;  5AQK A;  3DLB A;  2GWK A;  2WBN A;  2HOE A;  5C10 A;  4CJT A;  5BPM A;  3L2U A;  3FFK B;  4FM0 A;  4CEB A;  3V4I A;  3THX B;  2QWL A;  4LF4 K;  4AHR A;  4I9L A;  3CC7 N;  5E26 A;  3PX6 A;  4FJ8 A;  1HMV A;  1ZBF A;  4IO9 L;  3C94 A;  2JWL A;  2UXD K;  4KB1 A;  1YTA A;  4Y1D A;  4Z4F A;  4HTL A;  4M3Z A;  3AVK A;  5KPT A;  1XWL A;  4CJQ A;  4JI5 K;  4KI6 A;  1C0U A;  4CZF A;  4B9L A;  1FXX A;  1N5Y A;  4A2A A;  3RRG A;  1WSE A;  3WNG A;  3VQP A;  2HBL A;  4CZM A;  1J5O A;  3RR7 A;  4JI1 K;  3O3G A;  3NH0 A;  1IO2 A;  4FZX C;  3VGK A;  4W5O A;  2OYQ A;  3LAK A;  3RSE A;  3OYK A;  1NMN A;  3LZJ A;  4DR7 K;  4H0Y B;  4ELT A;  2E6M A;  3QML A;  3ZT3 A;  2G8W A;  4IOX A;  4QS7 A;  4JI3 K;  1XQS C;  1VQO N;  3ZYY X;  4HCC A;  4DLE A;  2ZGZ A;  3K5O A;  4JD2 B;  3CCM N;  3PIO L;  4XEI A;  4AM7 A;  1RDC A;  4OGE A;  3VTI A;  3G6E N;  3LDP A;  3TAG A;  4KRF A;  3DXM A;  3L3U A;  1W97 L;  5C15 A;  3P4I A;  4GVM A;  3JYT A;  5BRH A;  3CCS N;  3I55 N;  4DTJ A;  3BDP A;  2A1S A;  1JXB A;  2FF3 B;  4OJR A;  1TAU A;  1NOY A;  2F8T A;  3V9Z A;  4DV5 K;  1NJZ A;  4DSE A;  4C8N A;  3ID8 A;  1S1W A;  5GAE P;  4ILH A;  3T1Y K;  4NCG A;  3TAR A;  1MWK A;  2HBJ A;  1JJ2 M;  1RBS A;  3CYM A;  4AM6 A;  4FLW A;  1I94 K;  2OCE A;  3NH1 A;  3VET A;  1VQL N;  2OPR A;  2NRW A;  4HUF A;  1BHL A;  5JVH L;  3ZSY A;  3MXJ A;  4JKA A;  3LM9 A;  4BRF A;  3NVK A;  3M8Q A;  4CES A;  3A8Y A;  3TI0 A;  4FJG A;  3KJV A;  4FJM A;  2BH1 A;  3V81 A;  3HM8 A;  4H0X B;  1U48 A;  5AJ3 K;  3F9M A;  3MN9 A;  1HPZ A;  1JKH A;  3TAF A;  3VEW A;  1SL1 A;  2WC9 A;  3HOT A;  3H6E A;  5F1X A;  3HVR A;  4TSX A;  5DM7 L;  2O8F A;  4CJ4 A;  1TK0 A;  4O44 A;  3UKR B;  1L3S A;  3L4I A;  4GKK K;  4FJJ A;  1WB9 A;  3WEE B;  4LFA K;  3H1Q A;  2Q3S A;  2IIR A;  2GEM A;  3AVH A;  2YHY A;  3RMB A;  1VAZ A;  3V9X A;  1NK5 A;  4K8Z A;  2D0P A;  1JL1 A;  3ZSW A;  4CHO A;  4OPA A;  3T3F A;  3PX4 A;  3K59 A;  3CC2 N;  3SMS A;  4PKG A;  4NO7 A;  4XH5 A;  4J2A A;  2V7Z A;  3FZK A;  1HRH A; 
#chains in the Genus database with same CATH homology
 4DR2 K;  4DR6 K;  4V19 S;  4K0K K;  4CVN E;  4DR3 K;  2VQE K;  4LF6 K;  4LF9 K;  3JAM O;  4DV1 K;  1HNZ K;  1XNQ K;  1HR0 K;  4DR5 K;  4DV6 K;  4YHH K;  4X65 K;  1XMQ K;  4X62 K;  4B3T K;  4JI4 K;  1XMO K;  1J5E K;  4YY3 K;  4DV5 K;  1HNW K;  4B3S K;  1IBK K;  1N33 K;  4X66 K;  4GKJ K;  3T1Y K;  4DV2 K;  1XNR K;  4DV7 K;  5A2Q O;  3J7Y P;  1FJG K;  2UUB K;  4OX9 K;  1I94 K;  4X64 K;  4B3R K;  2E5L K;  4JYA K;  2UUC K;  3J80 O;  4DV4 K;  4AQY K;  4JV5 K;  4DV3 K;  1N32 K;  1N36 K;  2UXB K;  4LF4 K;  4JI0 K;  4B3M K;  4LF7 K;  4NXN K;  5AJ3 K;  3J7A P;  2HHH K;  4LFB K;  5LL6 Z;  2UXD K;  3J81 O;  1IBM K;  1HNX K;  4LF5 K;  4JI2 K;  4JI7 K;  2ZM6 K;  4JI5 K;  4DUZ K;  4LFC K;  2UUA K;  4GKK K;  2UU9 K;  5IWA K;  4LF8 K;  1N34 K;  3T1H K;  4NXM K;  4CW7 B;  4LFA K;  2VQF K;  5BR8 K;  4DUY K;  1IBL K;  2UXC K;  4JI1 K;  5LMU K;  4DR1 K;  4DR4 K;  3OTO K;  4KHP K;  5IT9 O;  5LMN K;  4JI6 K;  2F4V K;  4DR7 K;  4JI8 K;  5FLX O;  4DV0 K;  4JI3 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...