4LF6K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4lf6K00
1N36K 4YY3K 4JI6K 2UUCK 4DR5K 2VQEK 1N34K 2UUBK 4YHHK 4GKJK 4JI7K 4DR7K 4DV3K 5LMUK 1IBKK 4JV5K 4DUYK 4JI8K 4B3TK 3T1HK 4B3SK 4X64K 4LF5K 4DR4K 2UXBK 3JAMO 4DV7K 4DV6K 5BR8K 1HNZK 5FLXO 4X62K 4LFCK 4X65K 1HR0K 5AJ3K 5LMNK 4DV1K 1XMQK 4DV5K 1XNQK 4JI4K 4LF8K 4V19S 5IWAK 4LF9K 4LF4K 1I94K 3J7AP 4DUZK 2UUAK 2VQFK 3J7YP 3J81O 4CW7B 4B3RK 3T1YK 4DV0K 3OTOK 4DV2K 2F4VK 4OX9K 4DR1K 1HNWK 1FJGK 4CVNE 4AQYK 1IBMK 1XNRK 2ZM6K 2E5LK 5IT9O 4LFBK 4B3MK 2UU9K 4JI0K 4JI5K 4JYAK 1IBLK 2HHHK 4LF6K 1N32K 4JI2K 2UXCK 4DR3K 4LF7K 4LFAK 4X66K 4JI3K 4NXNK 5A2QO 3J80O 4JI1K 4K0KK 1XMOK 1HNXK 4DR2K 1J5EK 5LL6Z 2UXDK 4KHPK 4DV4K 1N33K 4DR6K 4NXMK 4GKKK
chains in the Genus database with same CATH superfamily
3K9JA 4OPKA 2IOCA 3G25A 1VQ9N 3KLEA 3MCPA 2GWJA 2UUCK 4BR5A 4AHCA 4CGFA 4IO9L 2NLXA 2V52B 3AY9A 1K8AO 4DKWA 1N5YA 3TARA 2ZE2A 3ZSWA 1NJWA 4GY2B 3CC2N 1Z26A 3V1QA 4L8RB 3DWLA 5B8HA 4H5NA 1VSMA 4B3SK 2D0AA 3KLGA 3PO5A 3QLHA 4W5RA 3QETA 2HMIA 3RMCA 3CMAN 3R1XA 3FZFA 5BN9A 1RBRA 1U47A 3WEEA 1HR0K 2OYQA 1NGDA 3OYAA 1LOTB 3U4LA 3ZETA 1HYSA 1GLEG 1OH7A 4C8MA 3NGIA 2BGGA 3THYA 4H0PA 4DU4A 5BPMA 2IS3A 4CZIA 2VYPA 1HLUA 2YX6A 4DHYA 1NU0A 1BWFO 5AQSA 4KHYA 1VQKN 3FZKA 3MCAB 1YTAA 4K8ZA 4BRAA 5CE3A 1CLQA 3T1YK 3U8XA 3NHGA 4DV0K 1LAWA 3QBWA 1RT5A 2RN2A 3V9SA 4IBNA 1YVUA 1TKTA 3MN9A 3WXKA 5FROA 1S9EA 3LALA 4MLHA 2ITMA 3DM2A 4GVEA 3SV3A 1ATRA 1IKVA 3D0PA 1XHXA 2QEXN 4H8KA 4DFPA 3PX0A 3SBGA 4B3MK 1TKZA 3K0SA 1HKGA 3DLBA 4I6MB 1VQON 3KVGA 4FJXA 4LF7K 4BR4A 4X66K 3DLRA 4CHQA 2X78A 4CJSA 2O8DA 3SAGA 1VSEA 1S5JA 4FJNA 4QOZB 1EWRA 4IG3A 1DEJA 2NRXA 5LL6Z 4JKCA 4BR9A 2JGUA 3Q7BA 4JKBA 2O8BA 3ISNC 3AVMA 2NRRA 5HRRA 4CJKA 2A3ZA 4HHTA 3O5BA 3AA3A 2V51B 4BVOA 1YJWN 4CEFA 4KHWA 2ATQA 1YITN 4K41A 1VRTA 4CZLA 3V9ZA 2DFEA 1RDDA 3E9OA 2HNDA 4KI4A 2PY5A 3I0SA 4ELTA 5FPNA 4A2AA 1TK8A 3BZCA 1EETA 3R3LA 3VN5A 3MXMA 5M1PA 1BA0A 4KBOA 4X65K 1FXXA 3A5OC 5BRFA 4WFAL 2ITGA 4DFJA 3O08A 1NKEA 1S9GA 5GAGP 1SQKA 4F2RA 2OPSA 1RTIA 1Q81O 3VA3A 1D4XA 3VOVA 5HOOA 5AQMA 1J9AA 5ELZA 3ID6A 3NFAA 4KHQA 3HP6A 1KFSA 3O9QA 5AQZA 4FLXA 4N5SA 1BQNA 3HPOA 5C25A 4DV2K 4JEPA 5AQRA 4Z0UA 5CZ1A 4BDPA 5EU7A 3NH1A 1ASWA 4BQZA 2A42A 5KQDA 3M3ZA 4DR1K 4FWKA 1C0TA 1V4TA 3MMVA 2ZM6K 4FLVA 5IT9O 4I2QA 1LW0A 3THXA 4FVUA 4B9SA 4E7KA 2NZTA 3TWHA 4CJWA 2I7NA 3LP3A 4Z4IA 2G8IA 1UA1A 3MEDA 2A5XA 4KB1A 3I56N 3BY5A 3JYTA 1HQUA 4JI1K 2B5JA 3ITHA 4PY5A 4BACA 4DQRA 1KAYA 3CYMA 4CFAA 3ZSRA 4JKAA 1RT7A 3EKSA 2KKZA 4N41A 5E41A 4N56A 4O55A 1Z6RA 5GIPA 2A6AA 3FE1A 3WXJA 2Z1JA 3DYAA 1LWCA 3SBTA 1JLBA 4AHSA 5F0XA 3SPYA 4DF4A 3VQ9A 1LV5A 3VGMA 4DTNA 1EKEA 5J2NA 3K9KA 3FZLA 4I9LA 5AQUA 3U3GA 2O4IA 1NGBA 1R59O 2P9LB 3MN6A 2D0OA 2NRTA 4A59A 4PA1A 2P9SB 3IRXA 2HNYA 3IUCA 4OPJA 4JV5K 4DUYK 1YUWA 5HLFA 1VHXA 1OKJA 4OGEA 1F21A 3GDQA 2P9NB 4OJRA 5AQQA 3CCQN 1WBDA 3FR0A 2FC0A 1MWKA 3ZSXA 1U45A 1RDWX 4BDYA 5AJ3K 4GNIA 4DV1K 4XEIA 5DMRA 1S1TA 2EX3A 4CEDA 1XNQK 4DTOA 2P1JA 4V19S 4ILHA 1ZXOA 2IVNA 2E6LA 4LF4K 3F9KA 3C6HA 3DMJA 4BRHA 3M1FA 3O4QA 4DTXA 4KO0A 4O8KA 3SMPA 1VQPN 3TAFA 5GAEP 3THVA 3C95A 3KHYA 4BVPA 3OYCA 3JS6A 4BR0A 4CJ7A 4AM7A 4FLZA 2VWJA 4IOAL 1WSIA 3U3YA 2E4LA 5BPLA 4BGAA 1KLMA 1KLNA 1BI4B 4NB4A 4HWIA 4Y1CA 5GINA 1VQLN 2CGKA 1NK0A 1Y64A 2UXCK 4JI2K 5LJWA 3SUPA 3U9ZA 1NJIO 2HHWA 4B9QA 3W3DA 3RRHA 1XMOK 4BE2A 2F8TA 1CXUA 4XH4A 3HJFA 3LDLA 4B1VA 1IKXA 3CXCM 3VQ7A 5CYQA 2D0CA 2BTFA 4OPAA 3MDQA 4CJ4A 5I3UA 3ZT2A 4NXMK 1ASUA 4H03B 4FWSA 4CJUA 3OYLA 1SL2A 4CEEA 4DQ8A 1QZ6A 1A5VA 4NLCA 1OVYA 2KW4A 3NF8A 5HP1A 2E2PA 3NGYA 2ZGZA 1YI2N 3SI6A 2Z1HA 4DV3K 5C12A 5LMUK 3EO3A 3E9LA 3O9UA 3K5NA 2OZSA 4JI8K 3CERA 3SYZA 4WQ5C 4FXDA 4H0OA 4KI6A 3UKUA 3QEVA 3OHRA 1J53A 2A1SA 4Z4HA 5LMNK 3J8AA 4H5TA 1VSIA 1MA9B 1LCUA 1RILA 1RDUA 4BREA 3KLHA 4NCBA 3N4PA 3G10A 3TABA 3TTCA 4BRMA 1VQ8N 3AA2A 3J7YP 1C0UA 3KKSA 2QXFA 2O4GA 4B1YB 4CEZA 2O8EA 1JXBA 1T3VA 3MXJA 3EL2A 5AZJA 2B6AA 4OX9K 5KQ8A 1JLGA 2Q0RA 1RT3A 2IC3A 3TTDA 4PWDA 2P9PA 2QWMA 1RDBA 1O1WA 1NJYA 3L2WA 1S1XA 4E7LA 5AQXA 3QEPA 5KGXA 2P9LA 3CJ1A 2QWRA 3RVCA 3HPHA 3AGRA 3K58A 5BR9A 3T1AA 1IBLK 2HSTA 1P90A 3S3OA 3HSTB 2HB5A 4KPYA 1QVGM 3CCSN 3QMLA 4NCAA 3DOKA 4CBUA 1SKRA 3AA5X 3ID8A 4KTZA 4FSVA 1RT4A 3VA0A 4PKGA 3WUHA 2W42A 2HF3A 2BH1A 4KFBA 3OYGA 3ULEA 4M7YA 4CJPA 3UIQA 3PX4A 4DSIA 2HHXA 4CBXA 1NGGA 3PUFA 4AILC 4KREA 3CF5L 3CCMN 4N76A 3ZYYX 3V1RA 3GE1A 2FSKA 5KRSA 5LJVA 1WAJA 3DXKB 2YCHA 4DR5K 3MAQA 3CC7N 4CIEA 3FFIA 1N34K 2UUBK 4DR7K 3CI5A 3TAEA 1JXEA 2GUPA 4DTJA 3ASMA 3OYEA 1WUAA 1U49A 4B9TA 4F4KA 3HVTA 1W7AA 5DM6L 1HMVA 5MLCQ 2HHUA 4OLAA 2E1YA 3QBXA 3LM9A 2QWQA 4GV6A 5EX5A 1CZBA 5M1QA 1RCHA 1RBTA 4DB3A 1I3AA 5BREA 3DJCA 2HF4A 4B9VA 1NGIA 1C1BA 1D8YA 4AHVA 4G1QA 2KZMA 3DRSA 2R7YA 1KQSM 2GV9A 5AQLA 5SWMA 4DU1A 2DY4A 4C23A 2JWLA 2Q0UA 3H1VX 3OYHA 1WAFA 4KRFA 3SQ0A 1GOAA 1WB9A 1WSEA 1U2VB 3HOSA 3AAQA 3OY9A 1ESVA 2QI2A 1GOCA 3VF6A 3TI0A 3BZKA 1RTDA 2AJQA 5KPTA 4C8KA 3JXUA 3TPQA 1RNHA 3CJ9A 2HVHA 4CGDA 4CVNE 1OH5A 5JLHA 3U9DA 3O9RA 1GLCG 2OTJN 4LH4A 4A5BA 4FLYA 1C1AA 4JI0K 4JYAK 5J2PA 2XY6A 1S6QA 3OYBA 5TKYA 2NRHA 4JI3K 3WXMB 5C0YA 3J80O 2YHXA 1HJOA 3VTIA 2B4JA 4BWMA 3KLFA 5I42A 1WSFA 4E7JA 3AVJA 3VF4A 3L2QA 1IH7A 4CGJA 4YOVA 3ENBA 1BU6O 5J2MA 4CZGA 1NGCA 4B1ZA 3BP8A 1C1CA 1RTHA 1HX1A 1KD1O 2FBTA 2YJEA 2YV0X 4JI6K 3V9WA 2FSJA 3DOLA 4ISGA 1JL2A 1NGJA 3CCUN 1Q9XA 4DSLA 2GWKA 4M41A 4FZZA 1V4SA 2RKIA 4E1NA 3NMUA 5D3GA 3HRGA 3KWGA 2KTQA 3VQ4A 1YHQN 4C8OA 1NK5A 3DXMB 3EZWA 4X64K 3AO3A 1YIJN 1T05A 4FJJA 2GX9A 3T7ZA 4BDZA 3NF7A 4DV6K 3ATUA 5HROA 5AFUA 4IO8A 1WSGA 2W40A 4JNEA 4IOCL 4CEBA 3LL3A 3HM9A 1XMQK 2YNFA 3HM8A 1E4GT 3M8SA 3W0LA 4JK7A 4IJAA 5EOYA 4FJLA 3TAMA 3DAWA 1NBWA 3T69A 4DTRA 1GOBA 3O1BA 3SUOA 4ILGB 3SLCA 4CJ3A 3UB5A 1ZC6A 2XY5A 2QKKA 1K73O 1IG9A 4JKEA 3AA4A 3L2VA 2HBJA 4IXCA 1NK8A 4YDUA 2GBZA 3CCLN 1IKYA 1IV0A 4KHSA 1LWEA 1NKBA 3LWMA 4B3OA 4IZ9A 4K42A 1VK0A 3A2FA 1JJ2M 5AQTA 3PO4A 4CHYA 1LWFA 4CEQA 2GUIA 2OTLN 2ZJRL 5SZTA 1DKGD 3FLCO 3OYKA 3V4IA 3O9SA 2NRVA 4ID1A 5ADXH 1VSFA 2ZWHA 1W2BM 4IFYA 3HZ6A 4M3UA 3LAMA 3VETA 4CBWA 4M3YA 4PQUA 4K0KK 4FM1A 1HNVA 4C8NA 1EXQA 1BOTO 2JLEA 4KTWA 4GMJB 3O3HA 1XI1A 5JVHL 3O8MA 3QIOA 3K5MA 5GIOA 3IG1A 1YVNA 3WEEB 3SMSA 4FJMA 3EZ5A 1ZBHA 4CK3A 3CQ8A 3TTFA 1VQ5N 1QQCA 3F73A 3H3NO 4CHZA 3SPZA 2RHKA 2HNZA 1U2VA 4DQIA 2ZF5O 3ENHA 5BRDA 1VSKA 1W9HA 2A41A 4JI7K 4FJGA 2OANA 4M63C 3L3VA 3MWPA 1IO2A 3CJ7A 3T1HK 4BY9C 3FZHA 3FZMA 5FDLA 4FWMA 3GG4A 1WSJA 3LANA 4JK8A 4YOXA 4FPAA 4IFEA 2YHBA 3QEXA 2ZGYA 5C15A 3AO4A 5AQJA 2F9WA 1TVRA 3NVMA 4WYBA 3ULDA 3J7AP 4DUZK 3NDKA 2NUBA 3M5RA 2UUAK 1QQNA 4EIAA 3CCJN 2QM1A 3CJCA 2O8DB 4CHOA 3D2EA 2LSNA 3L0QA 3P83D 1K9MO 4GV3A 3CCVN 2EHGA 1GLLO 3AVIA 3R6MA 4ZHRA 4ILJA 4ISEA 4HCBA 2OZMA 1G15A 1VQ6N 5FPDA 5CY4A 4JHDB 3VEYA 1CZAN 1XNRK 3P38A 1OVQA 3ZT3A 3THYB 4DSJA 4MLEA 2RPIA 2IDOA 4BRCA 3E01A 3J7ZO 3MECA 2XRIA 5CR4A 4PUOA 3NE6A 3KIOA 1NLVA 4E7IA 3QICA 3C6AA 1S6PA 1ASVA 4Z4EA 2HHSA 4R79A 2F96A 2P9IA 3CQYA 2UXDK 4GVMA 3OYDA 1YJ9N 3S3MA 4CJTA 3AVBA 2QWLA 4CEAA 1W0HA 3ATVA 1TL3A 1NGHA 4O0JA 3P31A 1HRHA 5JICA 5EY4A 3EY1A 2YHYA 2AP1A 4DSFA 3LP1A 1JCGA 1L3SA 3NVKA 4FJ7A 3K5OA 3GOIA 2QWPA 3KK3A 1BIZA 3QB0A 2VWKA 4CJEA 4LSNA 4DFKA 2G8HA 4FOEA 3HP9A 3VQ6A 2ASMA 3OJSA 2P9KB 4DR4K 3VQEA 4CD3A 1JCFA 3L8BA 2YNIA 4FO0A 1RT1A 3TAQA 2DPNA 3EEQA 4B8AB 4H0YB 2EWSA 1JLQA 4DWIA 4Y1DA 4MFBA 4JI4K 3LAKA 5HBMA 1MDUB 4DTMA 3V6DA 3VPZA 3LDNA 4PKHA 4CJRA 4BRIA 3V81A 4FW1A 1EP4A 1S1WA 5DK5A 1M90O 4CJVA 3BF3A 3K59A 4CJ5A 4Q0BA 2GELA 2PFUA 4B1WB 4PL8A 4KH5A 4CJLA 4JKFA 2YI1A 4OGCA 1YTUA 1ZBFA 4PHTX 1JLCA 1QTMA 4J2DA 4YDUC 3C0BA 3PX6A 5M1NA 4FK2A 4CI6A 1Q86O 2OPPA 4CF0A 4L3QA 2H3GX 1Q9YA 3WXLA 3ZX2A 1NGFA 1ILYA 2VG7A 3DLGA 2RF2A 4RTFD 2VG6A 3MWTA 4IG0A 5T7BA 4OVLA 3QNNA 4LFAK 3KK2A 3SAHA 4YOWA 5A2QO 4HUEA 4MO4A 3TSQA 2ZJPL 4CZHA 1VRUA 4GW6A 2NNWA 1GLAG 3AVNA 2W41A 3C7NB 2D0PA 4E1JA 4BG9A 4FW2A 3SK3A 4DR6K 4FJ8A 2Q97A 4HCCA 2QW9A 3AAPA 2J4RA 2D0BA 1BQMA 3TAGA 5HL7L 4FWPA 4IEEA 4WF9L 1K8KB 2XO7A 1W97L 1HQEA 4QCLA 1HJRA 3VESA 3ZX3A 5BRHA 4DQQA 4XH1A 4BC3A 4NO7A 3U6FA 5HRSA 1LW2A 1OH8A 2DTUA 4B3TK 4E19A 1KSPA 4BC2A 2IAJA 3WQUA 4MDBA 5K14A 4ID5A 4BRDA 5M1KA 5HRPA 1NMDA 4ZTFA 1UWBA 1TAQA 1J6ZA 1YT3A 1B9DA 4LF8K 4H4OA 2V7ZA 5IWAK 3A5NC 4LF9K 1RBUA 1QQMA 4C1NI 2G8WA 3T19A 4FLTA 2ASOA 3H6EA 3P1GA 3HPGA 4MQ3A 4WFNL 2V7YA 4B9LA 4CW7B 4OPHA 3V1OA 3D6RA 4DTUA 3G0ZA 4NYNA 5AQOA 1WSHA 3DRRA 3AVLA 4OKJA 2XHBA 4CFDA 3O4NA 4ZTJA 3S3NA 3QEWA 3K2PA 1M1KO 3VEXA 4RW8A 1QHAA 4I7FA 2G8UA 3LM2A 3TAPA 3NF6A 3MEEA 5FRMA 2UYTA 1RGIA 2X74A 3D2FA 3VQQA 1ZBLA 4B8CA 1T7PA 1GLFO 2FF3B 4DQPA 3LPUA 4JI5K 2ZJQL 1N32K 1WBBA 4IJNA 3WT0A 4HVJA 2VCPA 4FM2A 3QDKA 1HKBA 2G8KA 4F3TA 1HNXK 1QS4A 3F5TA 3BEXA 2QKBA 4H0VB 1J5EK 3THXB 3SNNA 1CXQA 3VTHA 4Z94A 2QXLA 2G8VA 1WNSA 4I2PA 1YXQA 1NOYA 1K8KA 2IIRA 4DLEA 4HTUA 2IGIA 3QEIA 4B1XB 4FWRA 1Z05A 2P9PB 2WFBA 1A5XA 1RDAA 3UKRA 3MN7A 4CF8A 3EYZA 2CGLA 4JN4A 3EE9A 4GKJK 2F8SA 4BRNA 3SAFA 3RWUA 2OA8A 1IBKK 4NLBA 1DTTA 5AQIA 2A40A 3QFUA 3L6QA 4CZJA 1JKHA 2QK9A 2NRWA 5AZJB 4EP5A 2ETJA 4MDAA 1RDCA 1KAZA 4JKGB 3ZSVA 1BHLA 3V9XA 3C7NA 2FLOA 3WNHA 3RSEA 3VEVA 5TKWA 3CPWM 4KB0A 3I8DA 1QE1A 4JRPA 1I94K 1SKSA 1Q18A 1BCMA 1NK4A 4BE0A 3MX5A 1JLFA 1H1VA 2VGMA 3IS9A 4BQLA 1NWKA 3SV4A 3S9HA 4ELUA 4N47A 1NK7A 4M3ZA 1FW6A 4DQSA 4FJ5A 2BE2A 1GLJO 4E0DA 3HL8A 3L4IA 3OYJA 2GTDA 5JMVA 4OLBA 4EZ6A 1X1PA 3PIPL 4H4MA 3ENOA 1IG8A 4A5AA 3HBTA 3O80A 1VQNN 4BRPA 4NYFA 4DU3A 3AVGA 4RW9A 5JLFA 1BUPA 4W5OA 1BL3A 1BISA 2UU9K 1C6VA 2HHHK 1VSJA 4AM6A 4ICLA 2E6MA 4EHTA 4CJFA 4I9QA 4CGGA 2D1KA 1NK6A 4LC9B 4DR2K 5I9EB 3G71N 1D5AA 3KWIA 3F9MA 4CZEA 1N33K 3OYFA 4XH5A 4CHPA 1X9MA 3H45C 3CETA 3HXMA 4M7XA 4O4GA 2HMPA 4YY3K 2YNGA 4CCHA 1U6ZA 4BGBA 4HUGA 3VEOA 1SL0A 2FBVA 4YHHK 4E89A 4F3OA 4Y0WA 4XIUA 4BE1A 1T6DA 4RCHA 3ZSOA 3LZJA 3C94A 3KD5E 5AQGA 1JLAA 1JL1A 3O9TA 3JAMO 5FPMA 4BWJA 1NMNA 1HNZK 5FLXO 3E9PA 4U67L 4B9MA 1WN7A 3S41A 4B9UA 3HK2A 3ZLJA 4FJIA 2HW3A 3K5LA 2O8CA 4IDHA 2E2NA 5HRNA 1NGEA 1C0MA 2BUPA 1RT6A 3P39A 4E3SA 4FK0A 2OPQA 2CGJA 2P51A 1NNEA 3R8EA 5C24A 3ZSYA 3LZIA 3OYIA 3BUZB 2KLAA 4CF2A 4JAXA 3VQ5A 4B9NA 4DSKA 3J81O 3SQ2A 1DGKN 1EQYA 3OS0A 2Y1JA 3PV8A 3KJVA 4IFVA 4YFUA 2E2OA 3CCEN 3EKUA 4JHDA 3RTVA 4BG8A 2KHOA 3OA9A 3HSCA 3CJBA 4FYDA 4KKOA 3PLAA 3CMEN 4DCHA 5AQHA 1C0GA 3PSFA 1BIUA 3CJAA 2BANA 2E5LK 4EFHA 3O1WA 2O8EB 4JKGA 1E3MA 1L3TA 3LP0A 1UAXA 4LF6K 3RSEB 1JLEA 3C6TA 4IDKA 2XY7A 3AVHA 1TUUA 4FLUA 3NAEA 2QWOA 1UA0A 4DFMA 2HOEA 1RBVA 1D9DA 2W6KA 5FPEA 3AVAA 2NRZA 1L5UA 1XWLA 5ADXA 3AV9A 1IJJA 3ZT1A 2YKNA 5DM7L 3VGLA 4CE9A 1NKCA 1XC3A 4H0TB 4C8LA 3A0IX 3CD6N 3QFPA 1KC8O 4CZMA 2E8AA 3O6WA 3G6EN 2D4WA 2WUSA 3PSIA 5AZIB 4CFBA 4MO5A 1QZ5A 3DLHA 3P4IA 2Q31A 3ZT4A 2HHVA 4CFCA 3HI0A 4DS4A 1TYQA 4R5PA 2UXBK 4C1NK 2Q36A 4LFCK 2Q1NA 3M8RA 3O4WA 4JS5A 4DLGA 5KPRA 3CFPA 2HBLA 2DFFA 4HTLA 3THWA 4BRQA 4TSXA 5C42A 5BPNA 3G4SN 5J2QA 4CEOA 1TAUA 3AARA 2GEMA 4M3XA 2ZD1A 3RRGA 1T8EA 4A62A 4B08A 1SL1A 3QINA 3OTOK 5AQKA 1KVAA 1S3XA 2P5OA 3DI6A 1KVCA 4CZFA 4RWTA 3HO1A 3AVFA 1FJGK 2KFNA 1X3MA 4BC5A 3E66A 3PY8A 1ZYQA 1GLDG 1IKWA 3BDPA 4CHNA 3MX2A 3TSPA 4A57A 1NG9A 3JSMA 1DT9A 1ITGA 3HT3A 4DR3K 3B6OA 4NXNK 1D9FA 3NBPA 2PBDA 1Q7YO 2JWKA 3WQTA 5AQPA 3ZSZA 1QQOA 1Q82O 3QESA 3D2EB 1MU2A 3CFOA 2HVIA 3CFRA 4JK9A 3KKRA 3B6PA 1FKOA 4BR7A 2HBMA 4A61A 3O3FA 4UQGA 4K43A 1TKXA 4JKDA 1OH6A 1GLBG 4O8UA 4F8RA 3DLEA 4FK4A 3EE8A 5AFUH 3OBWA 5JS2A 1U4BA 4WQ5A 4FJHA 4BRGA 3CIPA 2VWBA 4BC4A 2O8BB 2E1ZA 2O8CB 2F9TA 4K25A 1X9SA 3ZCMA 3CM6A 2DFHA 5KGWA 1L3UA 1HPZA 1BG3A 2E2QA 2PAVA 4O0IA 2F7TA 4CD1A 2KFZA 4CF1A 1X3NA 4WE1A 4DV7K 3ALYA 4W5TA 5F1XA 1KVBA 1WLJA 3THWB 3R9PA 4BRFA 1P8ZA 4X62K 5BN8A 2FBXA 5JVGL 3QO9A 2ZQBA 3LDQA 2CH6A 3OS2A 3C6UA 4NCGA 3FGUA 3ZSQA 3RMAA 1FKPA 4FWOA 3SCXA 1RFQA 4U7BA 4H5WA 2A1RA 4IOXA 1XUPO 3OBYA 1L3VA 4KHNA 4RG8A 4PL7A 3QERA 4QS7A 4B3RK 3ZEUA 5F2RA 1BA1A 3A8YA 3KK7A 3VEWA 5AZIA 1K6YA 4FWLA 3VEZA 3QNOA 3I55N 4DS5A 1YAGA 1VSLA 4DMNA 3KK1A 4E1MA 4KHUA 3D7EO 3T3FA 1HUXA 4QS9A 4OKEA 1BDGA 1RT2A 4G9ZA 4K8XA 2P9KA 1XQSC 4JD2B 1CZ9A 1QVFM 3WNFA 2YNHA 4M42A 3VQPA 5LY3A 5KPZA 2QTDA 1JCEA 4W5QA 4KAZA 3OYNA 5H1SQ 1NK9A 2P9NA 1TGOA 1WOQA 3A5MC 3VQAA 5C10A 3LDPA 5EXWA 4WQ4C 4J2BA 1SUQA 3TU5A 1A5WA 2O8FA 3SJJA 4FPBA 4FM0A 4GKKK 4F9OA 4CIFA 4CGHA 2PZSA 3WNEA 1SS6A 1N36K 1NOZA 3ZX0A 4AHRA 4CZKA 4CF9A 3H08A 3NF9A 1YJNN 3KD1E 2VQEK 4OO1J 4YOUA 2IVOA 1VQ7N 2OCEA 4J8FA 4CESA 4RW4A 5CYMA 4LD0A 3K57A 3V9UA 4Z4GA 1RTJA 3IFRA 4JS4A 2YJFA 4DTPA 5C2DA 1NJXA 1I39A 5AR0A 2FF6A 3VF2A 1SZ2A 1HYZA 4O44A 3PIOL 4JRQA 3NGZA 4EAHD 1KCFA 1NM1A 4LY7A 4Z4CA 2X6SA 1U04A 3LWLA 4OKKA 1N8RO 4WFBL 1ZBUA 1TK0A 3UKUB 4J2AA 3SUQA 2VQFK 1KTQA 3CPEA 5FRNA 1S1VA 1SV5A 3I33A 3EN9A 3D2FB 3CQXA 2CH5A 5AQWA 3VQ8A 2Z1IA 1RBSA 2WBNA 3AO1A 2OPRA 1TL1A 3VQBA 4FCYA 3SJHA 1EWQA 3RMBA 1TYQB 3N4QA 4AQYK 2I7PA 5GAHP 1VSDA 4I6MA 5AQVA 5JS1A 4E7HA 2Q3SA 4H0XB 4H5VA 4ELVA 3SZ2A 2YKMA 3OYMA 4RW6A 3KLIA 4IEIA 3QIPA 4CK1A 3HTVA 2PYJA 4AH9A 4EP4A 3IDHA 3M8PA 5KRTA 1ZBIA 1VQ4N 3DLKA 3B8AX 4KHPK 3DRPA 3ZEUB 4FJ9A 4FVMA 4KH6A 3I8BA 4DV4K 1ATSA 1Q8IA 3CC4N 1EO1A 2AA4A 3TANA 1KFDA 4AHUA 4CIGA 4AF1A 4UY8O 4CJQA 3VERA 5AQYA 1TK5A 4M3WA 1X9WA 2WOMA 3M8QA 1SAZA 3Q7CA 2E88A 3D45A 3RMDA 1VQMN 2ASPA 4FZXC 1QSLA 3DXKA 3AVCA 3OJUA 2WTUA 3BGRA 1J54A 3OS1A 3F2KA 1TKDA 2BDPA 2QWNA 5BR8K 1HPMA 4CECA 3SQ1A 4ISFA 1VSHA 2RE2A 4RW7A 3E1YA 4CGIA 1TUYA 3O3GA 1QSYA 4YNQA 3NH0A 1S1UA 3TR8A 4GV9A 2WC9A 2E20A 2YHAA 4YOYA 3RR8A 4BROA 3HVRA 4FJKA 3SUNA 3ZT0A 1HKCA 3M6GA 1HYVA 4H5RA 1SKWA 2O8FB 2QA4N 4JD2A 5KI6A 4Q5VA 1C0FA 2F4VK 1ZBSA 4CK2A 1EX4A 2W6LA 1VAZA 4FWNA 4BRKA 4FL9A 3SQ4A 1N6QA 2KZZA 5KTQA 4KTQA 1G99A 1KXPA 3AGKA 5AQNA 1BO5O 1IBMK 3VGKA 4B1UB 5GADP 3HOTA 3UE5A 3L2UA 3IMXA 2PYLA 4YORA 5C2FA 3ZETB 3OW2M 3KTQA 3IKMA 4O5BA 4M45A 4F2SA 4JKHA 1BCOA 3VQDA 4BRLA 4PKIA 1S22A 3L3UA 3VENA 1HNIA 2D5RA 4HUFA 3IAYA 4LH5A 3BF1A 1XC9A 1QHTA 4QS8A 4W5NA 1NJZA 3LDOA 3HYFA 2IVPA 4WCEL 5E26A 1T44A 4DF8A 1S72N 4M3RA 3GBTA 5J1EA 1KRPA 3MEGA 2P9SA 4FLWA 2VGNA 3I0RA 2P9UB 4AHTA 3ULEB 1KAXA 3MK6A 4EZ9A 3GL1A 5E84A 2FBYA 3RR7A 1X9JA 3C65A 3WNGA 2P9UA 3CG7A 1REVA 4CERA 4DTSA 5CZ2A 1QSSA 2WONA 3MN5A 1DTQA 2FXUA 4LF5K 2KQ2A 2X6NA 1E4FT 4DSEA 3LPTA 1B9FA 2HHTA 2I5JA 1B92A 1T03A 3H1QA 1ATNA 2HHQA 4DV5K 5EVZA 3VQCA 3AO5A 4DG1A 3DXMA 1TV6A 3A5LC 2G8FA 2HBKA 3UKRB 4IKFA 3L4QA 1DLOA 4QAGA 3AO2A 1BGXT 4LSLA 4IWVA 3KZBA 3LP2A 4J2EA 1R0AA 4BR2A 2P5GA 4FZYA 1O13A 4KV8A 3MXIA 4FOIA 2Z1GA 4KH4A 3L2RA 4A2BA 2FSNA 1MWMA 1T6CA 5CHIA 1YF5L 2P9IB 1BI4A 1UOCA 3OVNA 4YOTA 3CCRN 3H3OB 3NH2A 1FK9A 1HNWK 4M3TA 3LDSA 5AQFA 1Z25A 4JLHA 3DLLL 4LFBK 3H46O 2Y1IA 1Y97A 5M1FA 4WQ4A 4Z4FA 3FFKB 4FWQA 3P5JA 5M1OA 2YHWA 1U48A 2XY8A 3WXIA 3VMFB 2Q2RA 3CHWA 4O5FA 1LAVA 2VG5A 1J5OA 3NCIA 1XHZA 4EHUA 3AVKA 1NGAA 3CM5A 3TSUA
chains in the Genus database with same CATH topology
1N36K 4YY3K 4JI6K 2UUCK 4DR5K 2VQEK 1N34K 2UUBK 4YHHK 4GKJK 4JI7K 4DR7K 4DV3K 5LMUK 1IBKK 4JV5K 4DUYK 4JI8K 4B3TK 3T1HK 4B3SK 4X64K 4LF5K 4DR4K 2UXBK 3JAMO 4DV7K 4DV6K 5BR8K 1HNZK 5FLXO 4X62K 4LFCK 4X65K 1HR0K 5AJ3K 5LMNK 4DV1K 1XMQK 4DV5K 1XNQK 4JI4K 4LF8K 4V19S 5IWAK 4LF9K 4LF4K 1I94K 3J7AP 4DUZK 2UUAK 2VQFK 3J7YP 3J81O 4CW7B 4B3RK 3T1YK 4DV0K 3OTOK 4DV2K 2F4VK 4OX9K 4DR1K 1HNWK 1FJGK 4CVNE 4AQYK 1IBMK 1XNRK 2ZM6K 2E5LK 5IT9O 4LFBK 4B3MK 2UU9K 4JI0K 4JI5K 4JYAK 1IBLK 2HHHK 4LF6K 1N32K 4JI2K 2UXCK 4DR3K 4LF7K 4LFAK 4X66K 4JI3K 4NXNK 5A2QO 3J80O 4JI1K 4K0KK 1XMOK 1HNXK 4DR2K 1J5EK 5LL6Z 2UXDK 4KHPK 4DV4K 1N33K 4DR6K 4NXMK 4GKKK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N36 K;  4YY3 K;  4JI6 K;  2UUC K;  4DR5 K;  2VQE K;  1N34 K;  2UUB K;  4YHH K;  4GKJ K;  4JI7 K;  4DR7 K;  4DV3 K;  5LMU K;  1IBK K;  4JV5 K;  4DUY K;  4JI8 K;  4B3T K;  3T1H K;  4B3S K;  4X64 K;  4LF5 K;  4DR4 K;  2UXB K;  3JAM O;  4DV7 K;  4DV6 K;  5BR8 K;  1HNZ K;  5FLX O;  4X62 K;  4LFC K;  4X65 K;  1HR0 K;  5AJ3 K;  5LMN K;  4DV1 K;  1XMQ K;  4DV5 K;  1XNQ K;  4JI4 K;  4LF8 K;  4V19 S;  5IWA K;  4LF9 K;  4LF4 K;  1I94 K;  3J7A P;  4DUZ K;  2UUA K;  2VQF K;  3J7Y P;  3J81 O;  4CW7 B;  4B3R K;  3T1Y K;  4DV0 K;  3OTO K;  4DV2 K;  2F4V K;  4OX9 K;  4DR1 K;  1HNW K;  1FJG K;  4CVN E;  4AQY K;  1IBM K;  1XNR K;  2ZM6 K;  2E5L K;  5IT9 O;  4LFB K;  4B3M K;  2UU9 K;  4JI0 K;  4JI5 K;  4JYA K;  1IBL K;  2HHH K;  4LF6 K;  1N32 K;  4JI2 K;  2UXC K;  4DR3 K;  4LF7 K;  4LFA K;  4X66 K;  4JI3 K;  4NXN K;  5A2Q O;  3J80 O;  4JI1 K;  4K0K K;  1XMO K;  1HNX K;  4DR2 K;  1J5E K;  5LL6 Z;  2UXD K;  4KHP K;  4DV4 K;  1N33 K;  4DR6 K;  4NXM K;  4GKK K; 
#chains in the Genus database with same CATH topology
 3K9J A;  4OPK A;  2IOC A;  3G25 A;  1VQ9 N;  3KLE A;  3MCP A;  2GWJ A;  2UUC K;  4BR5 A;  4AHC A;  4CGF A;  4IO9 L;  2NLX A;  2V52 B;  3AY9 A;  1K8A O;  4DKW A;  1N5Y A;  3TAR A;  2ZE2 A;  3ZSW A;  1NJW A;  4GY2 B;  3CC2 N;  1Z26 A;  3V1Q A;  4L8R B;  3DWL A;  5B8H A;  4H5N A;  1VSM A;  4B3S K;  2D0A A;  3KLG A;  3PO5 A;  3QLH A;  4W5R A;  3QET A;  2HMI A;  3RMC A;  3CMA N;  3R1X A;  3FZF A;  5BN9 A;  1RBR A;  1U47 A;  3WEE A;  1HR0 K;  2OYQ A;  1NGD A;  3OYA A;  1LOT B;  3U4L A;  3ZET A;  1HYS A;  1GLE G;  1OH7 A;  4C8M A;  3NGI A;  2BGG A;  3THY A;  4H0P A;  4DU4 A;  5BPM A;  2IS3 A;  4CZI A;  2VYP A;  1HLU A;  2YX6 A;  4DHY A;  1NU0 A;  1BWF O;  5AQS A;  4KHY A;  1VQK N;  3FZK A;  3MCA B;  1YTA A;  4K8Z A;  4BRA A;  5CE3 A;  1CLQ A;  3T1Y K;  3U8X A;  3NHG A;  4DV0 K;  1LAW A;  3QBW A;  1RT5 A;  2RN2 A;  3V9S A;  4IBN A;  1YVU A;  1TKT A;  3MN9 A;  3WXK A;  5FRO A;  1S9E A;  3LAL A;  4MLH A;  2ITM A;  3DM2 A;  4GVE A;  3SV3 A;  1ATR A;  1IKV A;  3D0P A;  1XHX A;  2QEX N;  4H8K A;  4DFP A;  3PX0 A;  3SBG A;  4B3M K;  1TKZ A;  3K0S A;  1HKG A;  3DLB A;  4I6M B;  1VQO N;  3KVG A;  4FJX A;  4LF7 K;  4BR4 A;  4X66 K;  3DLR A;  4CHQ A;  2X78 A;  4CJS A;  2O8D A;  3SAG A;  1VSE A;  1S5J A;  4FJN A;  4QOZ B;  1EWR A;  4IG3 A;  1DEJ A;  2NRX A;  5LL6 Z;  4JKC A;  4BR9 A;  2JGU A;  3Q7B A;  4JKB A;  2O8B A;  3ISN C;  3AVM A;  2NRR A;  5HRR A;  4CJK A;  2A3Z A;  4HHT A;  3O5B A;  3AA3 A;  2V51 B;  4BVO A;  1YJW N;  4CEF A;  4KHW A;  2ATQ A;  1YIT N;  4K41 A;  1VRT A;  4CZL A;  3V9Z A;  2DFE A;  1RDD A;  3E9O A;  2HND A;  4KI4 A;  2PY5 A;  3I0S A;  4ELT A;  5FPN A;  4A2A A;  1TK8 A;  3BZC A;  1EET A;  3R3L A;  3VN5 A;  3MXM A;  5M1P A;  1BA0 A;  4KBO A;  4X65 K;  1FXX A;  3A5O C;  5BRF A;  4WFA L;  2ITG A;  4DFJ A;  3O08 A;  1NKE A;  1S9G A;  5GAG P;  1SQK A;  4F2R A;  2OPS A;  1RTI A;  1Q81 O;  3VA3 A;  1D4X A;  3VOV A;  5HOO A;  5AQM A;  1J9A A;  5ELZ A;  3ID6 A;  3NFA A;  4KHQ A;  3HP6 A;  1KFS A;  3O9Q A;  5AQZ A;  4FLX A;  4N5S A;  1BQN A;  3HPO A;  5C25 A;  4DV2 K;  4JEP A;  5AQR A;  4Z0U A;  5CZ1 A;  4BDP A;  5EU7 A;  3NH1 A;  1ASW A;  4BQZ A;  2A42 A;  5KQD A;  3M3Z A;  4DR1 K;  4FWK A;  1C0T A;  1V4T A;  3MMV A;  2ZM6 K;  4FLV A;  5IT9 O;  4I2Q A;  1LW0 A;  3THX A;  4FVU A;  4B9S A;  4E7K A;  2NZT A;  3TWH A;  4CJW A;  2I7N A;  3LP3 A;  4Z4I A;  2G8I A;  1UA1 A;  3MED A;  2A5X A;  4KB1 A;  3I56 N;  3BY5 A;  3JYT A;  1HQU A;  4JI1 K;  2B5J A;  3ITH A;  4PY5 A;  4BAC A;  4DQR A;  1KAY A;  3CYM A;  4CFA A;  3ZSR A;  4JKA A;  1RT7 A;  3EKS A;  2KKZ A;  4N41 A;  5E41 A;  4N56 A;  4O55 A;  1Z6R A;  5GIP A;  2A6A A;  3FE1 A;  3WXJ A;  2Z1J A;  3DYA A;  1LWC A;  3SBT A;  1JLB A;  4AHS A;  5F0X A;  3SPY A;  4DF4 A;  3VQ9 A;  1LV5 A;  3VGM A;  4DTN A;  1EKE A;  5J2N A;  3K9K A;  3FZL A;  4I9L A;  5AQU A;  3U3G A;  2O4I A;  1NGB A;  1R59 O;  2P9L B;  3MN6 A;  2D0O A;  2NRT A;  4A59 A;  4PA1 A;  2P9S B;  3IRX A;  2HNY A;  3IUC A;  4OPJ A;  4JV5 K;  4DUY K;  1YUW A;  5HLF A;  1VHX A;  1OKJ A;  4OGE A;  1F21 A;  3GDQ A;  2P9N B;  4OJR A;  5AQQ A;  3CCQ N;  1WBD A;  3FR0 A;  2FC0 A;  1MWK A;  3ZSX A;  1U45 A;  1RDW X;  4BDY A;  5AJ3 K;  4GNI A;  4DV1 K;  4XEI A;  5DMR A;  1S1T A;  2EX3 A;  4CED A;  1XNQ K;  4DTO A;  2P1J A;  4V19 S;  4ILH A;  1ZXO A;  2IVN A;  2E6L A;  4LF4 K;  3F9K A;  3C6H A;  3DMJ A;  4BRH A;  3M1F A;  3O4Q A;  4DTX A;  4KO0 A;  4O8K A;  3SMP A;  1VQP N;  3TAF A;  5GAE P;  3THV A;  3C95 A;  3KHY A;  4BVP A;  3OYC A;  3JS6 A;  4BR0 A;  4CJ7 A;  4AM7 A;  4FLZ A;  2VWJ A;  4IOA L;  1WSI A;  3U3Y A;  2E4L A;  5BPL A;  4BGA A;  1KLM A;  1KLN A;  1BI4 B;  4NB4 A;  4HWI A;  4Y1C A;  5GIN A;  1VQL N;  2CGK A;  1NK0 A;  1Y64 A;  2UXC K;  4JI2 K;  5LJW A;  3SUP A;  3U9Z A;  1NJI O;  2HHW A;  4B9Q A;  3W3D A;  3RRH A;  1XMO K;  4BE2 A;  2F8T A;  1CXU A;  4XH4 A;  3HJF A;  3LDL A;  4B1V A;  1IKX A;  3CXC M;  3VQ7 A;  5CYQ A;  2D0C A;  2BTF A;  4OPA A;  3MDQ A;  4CJ4 A;  5I3U A;  3ZT2 A;  4NXM K;  1ASU A;  4H03 B;  4FWS A;  4CJU A;  3OYL A;  1SL2 A;  4CEE A;  4DQ8 A;  1QZ6 A;  1A5V A;  4NLC A;  1OVY A;  2KW4 A;  3NF8 A;  5HP1 A;  2E2P A;  3NGY A;  2ZGZ A;  1YI2 N;  3SI6 A;  2Z1H A;  4DV3 K;  5C12 A;  5LMU K;  3EO3 A;  3E9L A;  3O9U A;  3K5N A;  2OZS A;  4JI8 K;  3CER A;  3SYZ A;  4WQ5 C;  4FXD A;  4H0O A;  4KI6 A;  3UKU A;  3QEV A;  3OHR A;  1J53 A;  2A1S A;  4Z4H A;  5LMN K;  3J8A A;  4H5T A;  1VSI A;  1MA9 B;  1LCU A;  1RIL A;  1RDU A;  4BRE A;  3KLH A;  4NCB A;  3N4P A;  3G10 A;  3TAB A;  3TTC A;  4BRM A;  1VQ8 N;  3AA2 A;  3J7Y P;  1C0U A;  3KKS A;  2QXF A;  2O4G A;  4B1Y B;  4CEZ A;  2O8E A;  1JXB A;  1T3V A;  3MXJ A;  3EL2 A;  5AZJ A;  2B6A A;  4OX9 K;  5KQ8 A;  1JLG A;  2Q0R A;  1RT3 A;  2IC3 A;  3TTD A;  4PWD A;  2P9P A;  2QWM A;  1RDB A;  1O1W A;  1NJY A;  3L2W A;  1S1X A;  4E7L A;  5AQX A;  3QEP A;  5KGX A;  2P9L A;  3CJ1 A;  2QWR A;  3RVC A;  3HPH A;  3AGR A;  3K58 A;  5BR9 A;  3T1A A;  1IBL K;  2HST A;  1P90 A;  3S3O A;  3HST B;  2HB5 A;  4KPY A;  1QVG M;  3CCS N;  3QML A;  4NCA A;  3DOK A;  4CBU A;  1SKR A;  3AA5 X;  3ID8 A;  4KTZ A;  4FSV A;  1RT4 A;  3VA0 A;  4PKG A;  3WUH A;  2W42 A;  2HF3 A;  2BH1 A;  4KFB A;  3OYG A;  3ULE A;  4M7Y A;  4CJP A;  3UIQ A;  3PX4 A;  4DSI A;  2HHX A;  4CBX A;  1NGG A;  3PUF A;  4AIL C;  4KRE A;  3CF5 L;  3CCM N;  4N76 A;  3ZYY X;  3V1R A;  3GE1 A;  2FSK A;  5KRS A;  5LJV A;  1WAJ A;  3DXK B;  2YCH A;  4DR5 K;  3MAQ A;  3CC7 N;  4CIE A;  3FFI A;  1N34 K;  2UUB K;  4DR7 K;  3CI5 A;  3TAE A;  1JXE A;  2GUP A;  4DTJ A;  3ASM A;  3OYE A;  1WUA A;  1U49 A;  4B9T A;  4F4K A;  3HVT A;  1W7A A;  5DM6 L;  1HMV A;  5MLC Q;  2HHU A;  4OLA A;  2E1Y A;  3QBX A;  3LM9 A;  2QWQ A;  4GV6 A;  5EX5 A;  1CZB A;  5M1Q A;  1RCH A;  1RBT A;  4DB3 A;  1I3A A;  5BRE A;  3DJC A;  2HF4 A;  4B9V A;  1NGI A;  1C1B A;  1D8Y A;  4AHV A;  4G1Q A;  2KZM A;  3DRS A;  2R7Y A;  1KQS M;  2GV9 A;  5AQL A;  5SWM A;  4DU1 A;  2DY4 A;  4C23 A;  2JWL A;  2Q0U A;  3H1V X;  3OYH A;  1WAF A;  4KRF A;  3SQ0 A;  1GOA A;  1WB9 A;  1WSE A;  1U2V B;  3HOS A;  3AAQ A;  3OY9 A;  1ESV A;  2QI2 A;  1GOC A;  3VF6 A;  3TI0 A;  3BZK A;  1RTD A;  2AJQ A;  5KPT A;  4C8K A;  3JXU A;  3TPQ A;  1RNH A;  3CJ9 A;  2HVH A;  4CGD A;  4CVN E;  1OH5 A;  5JLH A;  3U9D A;  3O9R A;  1GLC G;  2OTJ N;  4LH4 A;  4A5B A;  4FLY A;  1C1A A;  4JI0 K;  4JYA K;  5J2P A;  2XY6 A;  1S6Q A;  3OYB A;  5TKY A;  2NRH A;  4JI3 K;  3WXM B;  5C0Y A;  3J80 O;  2YHX A;  1HJO A;  3VTI A;  2B4J A;  4BWM A;  3KLF A;  5I42 A;  1WSF A;  4E7J A;  3AVJ A;  3VF4 A;  3L2Q A;  1IH7 A;  4CGJ A;  4YOV A;  3ENB A;  1BU6 O;  5J2M A;  4CZG A;  1NGC A;  4B1Z A;  3BP8 A;  1C1C A;  1RTH A;  1HX1 A;  1KD1 O;  2FBT A;  2YJE A;  2YV0 X;  4JI6 K;  3V9W A;  2FSJ A;  3DOL A;  4ISG A;  1JL2 A;  1NGJ A;  3CCU N;  1Q9X A;  4DSL A;  2GWK A;  4M41 A;  4FZZ A;  1V4S A;  2RKI A;  4E1N A;  3NMU A;  5D3G A;  3HRG A;  3KWG A;  2KTQ A;  3VQ4 A;  1YHQ N;  4C8O A;  1NK5 A;  3DXM B;  3EZW A;  4X64 K;  3AO3 A;  1YIJ N;  1T05 A;  4FJJ A;  2GX9 A;  3T7Z A;  4BDZ A;  3NF7 A;  4DV6 K;  3ATU A;  5HRO A;  5AFU A;  4IO8 A;  1WSG A;  2W40 A;  4JNE A;  4IOC L;  4CEB A;  3LL3 A;  3HM9 A;  1XMQ K;  2YNF A;  3HM8 A;  1E4G T;  3M8S A;  3W0L A;  4JK7 A;  4IJA A;  5EOY A;  4FJL A;  3TAM A;  3DAW A;  1NBW A;  3T69 A;  4DTR A;  1GOB A;  3O1B A;  3SUO A;  4ILG B;  3SLC A;  4CJ3 A;  3UB5 A;  1ZC6 A;  2XY5 A;  2QKK A;  1K73 O;  1IG9 A;  4JKE A;  3AA4 A;  3L2V A;  2HBJ A;  4IXC A;  1NK8 A;  4YDU A;  2GBZ A;  3CCL N;  1IKY A;  1IV0 A;  4KHS A;  1LWE A;  1NKB A;  3LWM A;  4B3O A;  4IZ9 A;  4K42 A;  1VK0 A;  3A2F A;  1JJ2 M;  5AQT A;  3PO4 A;  4CHY A;  1LWF A;  4CEQ A;  2GUI A;  2OTL N;  2ZJR L;  5SZT A;  1DKG D;  3FLC O;  3OYK A;  3V4I A;  3O9S A;  2NRV A;  4ID1 A;  5ADX H;  1VSF A;  2ZWH A;  1W2B M;  4IFY A;  3HZ6 A;  4M3U A;  3LAM A;  3VET A;  4CBW A;  4M3Y A;  4PQU A;  4K0K K;  4FM1 A;  1HNV A;  4C8N A;  1EXQ A;  1BOT O;  2JLE A;  4KTW A;  4GMJ B;  3O3H A;  1XI1 A;  5JVH L;  3O8M A;  3QIO A;  3K5M A;  5GIO A;  3IG1 A;  1YVN A;  3WEE B;  3SMS A;  4FJM A;  3EZ5 A;  1ZBH A;  4CK3 A;  3CQ8 A;  3TTF A;  1VQ5 N;  1QQC A;  3F73 A;  3H3N O;  4CHZ A;  3SPZ A;  2RHK A;  2HNZ A;  1U2V A;  4DQI A;  2ZF5 O;  3ENH A;  5BRD A;  1VSK A;  1W9H A;  2A41 A;  4JI7 K;  4FJG A;  2OAN A;  4M63 C;  3L3V A;  3MWP A;  1IO2 A;  3CJ7 A;  3T1H K;  4BY9 C;  3FZH A;  3FZM A;  5FDL A;  4FWM A;  3GG4 A;  1WSJ A;  3LAN A;  4JK8 A;  4YOX A;  4FPA A;  4IFE A;  2YHB A;  3QEX A;  2ZGY A;  5C15 A;  3AO4 A;  5AQJ A;  2F9W A;  1TVR A;  3NVM A;  4WYB A;  3ULD A;  3J7A P;  4DUZ K;  3NDK A;  2NUB A;  3M5R A;  2UUA K;  1QQN A;  4EIA A;  3CCJ N;  2QM1 A;  3CJC A;  2O8D B;  4CHO A;  3D2E A;  2LSN A;  3L0Q A;  3P83 D;  1K9M O;  4GV3 A;  3CCV N;  2EHG A;  1GLL O;  3AVI A;  3R6M A;  4ZHR A;  4ILJ A;  4ISE A;  4HCB A;  2OZM A;  1G15 A;  1VQ6 N;  5FPD A;  5CY4 A;  4JHD B;  3VEY A;  1CZA N;  1XNR K;  3P38 A;  1OVQ A;  3ZT3 A;  3THY B;  4DSJ A;  4MLE A;  2RPI A;  2IDO A;  4BRC A;  3E01 A;  3J7Z O;  3MEC A;  2XRI A;  5CR4 A;  4PUO A;  3NE6 A;  3KIO A;  1NLV A;  4E7I A;  3QIC A;  3C6A A;  1S6P A;  1ASV A;  4Z4E A;  2HHS A;  4R79 A;  2F96 A;  2P9I A;  3CQY A;  2UXD K;  4GVM A;  3OYD A;  1YJ9 N;  3S3M A;  4CJT A;  3AVB A;  2QWL A;  4CEA A;  1W0H A;  3ATV A;  1TL3 A;  1NGH A;  4O0J A;  3P31 A;  1HRH A;  5JIC A;  5EY4 A;  3EY1 A;  2YHY A;  2AP1 A;  4DSF A;  3LP1 A;  1JCG A;  1L3S A;  3NVK A;  4FJ7 A;  3K5O A;  3GOI A;  2QWP A;  3KK3 A;  1BIZ A;  3QB0 A;  2VWK A;  4CJE A;  4LSN A;  4DFK A;  2G8H A;  4FOE A;  3HP9 A;  3VQ6 A;  2ASM A;  3OJS A;  2P9K B;  4DR4 K;  3VQE A;  4CD3 A;  1JCF A;  3L8B A;  2YNI A;  4FO0 A;  1RT1 A;  3TAQ A;  2DPN A;  3EEQ A;  4B8A B;  4H0Y B;  2EWS A;  1JLQ A;  4DWI A;  4Y1D A;  4MFB A;  4JI4 K;  3LAK A;  5HBM A;  1MDU B;  4DTM A;  3V6D A;  3VPZ A;  3LDN A;  4PKH A;  4CJR A;  4BRI A;  3V81 A;  4FW1 A;  1EP4 A;  1S1W A;  5DK5 A;  1M90 O;  4CJV A;  3BF3 A;  3K59 A;  4CJ5 A;  4Q0B A;  2GEL A;  2PFU A;  4B1W B;  4PL8 A;  4KH5 A;  4CJL A;  4JKF A;  2YI1 A;  4OGC A;  1YTU A;  1ZBF A;  4PHT X;  1JLC A;  1QTM A;  4J2D A;  4YDU C;  3C0B A;  3PX6 A;  5M1N A;  4FK2 A;  4CI6 A;  1Q86 O;  2OPP A;  4CF0 A;  4L3Q A;  2H3G X;  1Q9Y A;  3WXL A;  3ZX2 A;  1NGF A;  1ILY A;  2VG7 A;  3DLG A;  2RF2 A;  4RTF D;  2VG6 A;  3MWT A;  4IG0 A;  5T7B A;  4OVL A;  3QNN A;  4LFA K;  3KK2 A;  3SAH A;  4YOW A;  5A2Q O;  4HUE A;  4MO4 A;  3TSQ A;  2ZJP L;  4CZH A;  1VRU A;  4GW6 A;  2NNW A;  1GLA G;  3AVN A;  2W41 A;  3C7N B;  2D0P A;  4E1J A;  4BG9 A;  4FW2 A;  3SK3 A;  4DR6 K;  4FJ8 A;  2Q97 A;  4HCC A;  2QW9 A;  3AAP A;  2J4R A;  2D0B A;  1BQM A;  3TAG A;  5HL7 L;  4FWP A;  4IEE A;  4WF9 L;  1K8K B;  2XO7 A;  1W97 L;  1HQE A;  4QCL A;  1HJR A;  3VES A;  3ZX3 A;  5BRH A;  4DQQ A;  4XH1 A;  4BC3 A;  4NO7 A;  3U6F A;  5HRS A;  1LW2 A;  1OH8 A;  2DTU A;  4B3T K;  4E19 A;  1KSP A;  4BC2 A;  2IAJ A;  3WQU A;  4MDB A;  5K14 A;  4ID5 A;  4BRD A;  5M1K A;  5HRP A;  1NMD A;  4ZTF A;  1UWB A;  1TAQ A;  1J6Z A;  1YT3 A;  1B9D A;  4LF8 K;  4H4O A;  2V7Z A;  5IWA K;  3A5N C;  4LF9 K;  1RBU A;  1QQM A;  4C1N I;  2G8W A;  3T19 A;  4FLT A;  2ASO A;  3H6E A;  3P1G A;  3HPG A;  4MQ3 A;  4WFN L;  2V7Y A;  4B9L A;  4CW7 B;  4OPH A;  3V1O A;  3D6R A;  4DTU A;  3G0Z A;  4NYN A;  5AQO A;  1WSH A;  3DRR A;  3AVL A;  4OKJ A;  2XHB A;  4CFD A;  3O4N A;  4ZTJ A;  3S3N A;  3QEW A;  3K2P A;  1M1K O;  3VEX A;  4RW8 A;  1QHA A;  4I7F A;  2G8U A;  3LM2 A;  3TAP A;  3NF6 A;  3MEE A;  5FRM A;  2UYT A;  1RGI A;  2X74 A;  3D2F A;  3VQQ A;  1ZBL A;  4B8C A;  1T7P A;  1GLF O;  2FF3 B;  4DQP A;  3LPU A;  4JI5 K;  2ZJQ L;  1N32 K;  1WBB A;  4IJN A;  3WT0 A;  4HVJ A;  2VCP A;  4FM2 A;  3QDK A;  1HKB A;  2G8K A;  4F3T A;  1HNX K;  1QS4 A;  3F5T A;  3BEX A;  2QKB A;  4H0V B;  1J5E K;  3THX B;  3SNN A;  1CXQ A;  3VTH A;  4Z94 A;  2QXL A;  2G8V A;  1WNS A;  4I2P A;  1YXQ A;  1NOY A;  1K8K A;  2IIR A;  4DLE A;  4HTU A;  2IGI A;  3QEI A;  4B1X B;  4FWR A;  1Z05 A;  2P9P B;  2WFB A;  1A5X A;  1RDA A;  3UKR A;  3MN7 A;  4CF8 A;  3EYZ A;  2CGL A;  4JN4 A;  3EE9 A;  4GKJ K;  2F8S A;  4BRN A;  3SAF A;  3RWU A;  2OA8 A;  1IBK K;  4NLB A;  1DTT A;  5AQI A;  2A40 A;  3QFU A;  3L6Q A;  4CZJ A;  1JKH A;  2QK9 A;  2NRW A;  5AZJ B;  4EP5 A;  2ETJ A;  4MDA A;  1RDC A;  1KAZ A;  4JKG B;  3ZSV A;  1BHL A;  3V9X A;  3C7N A;  2FLO A;  3WNH A;  3RSE A;  3VEV A;  5TKW A;  3CPW M;  4KB0 A;  3I8D A;  1QE1 A;  4JRP A;  1I94 K;  1SKS A;  1Q18 A;  1BCM A;  1NK4 A;  4BE0 A;  3MX5 A;  1JLF A;  1H1V A;  2VGM A;  3IS9 A;  4BQL A;  1NWK A;  3SV4 A;  3S9H A;  4ELU A;  4N47 A;  1NK7 A;  4M3Z A;  1FW6 A;  4DQS A;  4FJ5 A;  2BE2 A;  1GLJ O;  4E0D A;  3HL8 A;  3L4I A;  3OYJ A;  2GTD A;  5JMV A;  4OLB A;  4EZ6 A;  1X1P A;  3PIP L;  4H4M A;  3ENO A;  1IG8 A;  4A5A A;  3HBT A;  3O80 A;  1VQN N;  4BRP A;  4NYF A;  4DU3 A;  3AVG A;  4RW9 A;  5JLF A;  1BUP A;  4W5O A;  1BL3 A;  1BIS A;  2UU9 K;  1C6V A;  2HHH K;  1VSJ A;  4AM6 A;  4ICL A;  2E6M A;  4EHT A;  4CJF A;  4I9Q A;  4CGG A;  2D1K A;  1NK6 A;  4LC9 B;  4DR2 K;  5I9E B;  3G71 N;  1D5A A;  3KWI A;  3F9M A;  4CZE A;  1N33 K;  3OYF A;  4XH5 A;  4CHP A;  1X9M A;  3H45 C;  3CET A;  3HXM A;  4M7X A;  4O4G A;  2HMP A;  4YY3 K;  2YNG A;  4CCH A;  1U6Z A;  4BGB A;  4HUG A;  3VEO A;  1SL0 A;  2FBV A;  4YHH K;  4E89 A;  4F3O A;  4Y0W A;  4XIU A;  4BE1 A;  1T6D A;  4RCH A;  3ZSO A;  3LZJ A;  3C94 A;  3KD5 E;  5AQG A;  1JLA A;  1JL1 A;  3O9T A;  3JAM O;  5FPM A;  4BWJ A;  1NMN A;  1HNZ K;  5FLX O;  3E9P A;  4U67 L;  4B9M A;  1WN7 A;  3S41 A;  4B9U A;  3HK2 A;  3ZLJ A;  4FJI A;  2HW3 A;  3K5L A;  2O8C A;  4IDH A;  2E2N A;  5HRN A;  1NGE A;  1C0M A;  2BUP A;  1RT6 A;  3P39 A;  4E3S A;  4FK0 A;  2OPQ A;  2CGJ A;  2P51 A;  1NNE A;  3R8E A;  5C24 A;  3ZSY A;  3LZI A;  3OYI A;  3BUZ B;  2KLA A;  4CF2 A;  4JAX A;  3VQ5 A;  4B9N A;  4DSK A;  3J81 O;  3SQ2 A;  1DGK N;  1EQY A;  3OS0 A;  2Y1J A;  3PV8 A;  3KJV A;  4IFV A;  4YFU A;  2E2O A;  3CCE N;  3EKU A;  4JHD A;  3RTV A;  4BG8 A;  2KHO A;  3OA9 A;  3HSC A;  3CJB A;  4FYD A;  4KKO A;  3PLA A;  3CME N;  4DCH A;  5AQH A;  1C0G A;  3PSF A;  1BIU A;  3CJA A;  2BAN A;  2E5L K;  4EFH A;  3O1W A;  2O8E B;  4JKG A;  1E3M A;  1L3T A;  3LP0 A;  1UAX A;  4LF6 K;  3RSE B;  1JLE A;  3C6T A;  4IDK A;  2XY7 A;  3AVH A;  1TUU A;  4FLU A;  3NAE A;  2QWO A;  1UA0 A;  4DFM A;  2HOE A;  1RBV A;  1D9D A;  2W6K A;  5FPE A;  3AVA A;  2NRZ A;  1L5U A;  1XWL A;  5ADX A;  3AV9 A;  1IJJ A;  3ZT1 A;  2YKN A;  5DM7 L;  3VGL A;  4CE9 A;  1NKC A;  1XC3 A;  4H0T B;  4C8L A;  3A0I X;  3CD6 N;  3QFP A;  1KC8 O;  4CZM A;  2E8A A;  3O6W A;  3G6E N;  2D4W A;  2WUS A;  3PSI A;  5AZI B;  4CFB A;  4MO5 A;  1QZ5 A;  3DLH A;  3P4I A;  2Q31 A;  3ZT4 A;  2HHV A;  4CFC A;  3HI0 A;  4DS4 A;  1TYQ A;  4R5P A;  2UXB K;  4C1N K;  2Q36 A;  4LFC K;  2Q1N A;  3M8R A;  3O4W A;  4JS5 A;  4DLG A;  5KPR A;  3CFP A;  2HBL A;  2DFF A;  4HTL A;  3THW A;  4BRQ A;  4TSX A;  5C42 A;  5BPN A;  3G4S N;  5J2Q A;  4CEO A;  1TAU A;  3AAR A;  2GEM A;  4M3X A;  2ZD1 A;  3RRG A;  1T8E A;  4A62 A;  4B08 A;  1SL1 A;  3QIN A;  3OTO K;  5AQK A;  1KVA A;  1S3X A;  2P5O A;  3DI6 A;  1KVC A;  4CZF A;  4RWT A;  3HO1 A;  3AVF A;  1FJG K;  2KFN A;  1X3M A;  4BC5 A;  3E66 A;  3PY8 A;  1ZYQ A;  1GLD G;  1IKW A;  3BDP A;  4CHN A;  3MX2 A;  3TSP A;  4A57 A;  1NG9 A;  3JSM A;  1DT9 A;  1ITG A;  3HT3 A;  4DR3 K;  3B6O A;  4NXN K;  1D9F A;  3NBP A;  2PBD A;  1Q7Y O;  2JWK A;  3WQT A;  5AQP A;  3ZSZ A;  1QQO A;  1Q82 O;  3QES A;  3D2E B;  1MU2 A;  3CFO A;  2HVI A;  3CFR A;  4JK9 A;  3KKR A;  3B6P A;  1FKO A;  4BR7 A;  2HBM A;  4A61 A;  3O3F A;  4UQG A;  4K43 A;  1TKX A;  4JKD A;  1OH6 A;  1GLB G;  4O8U A;  4F8R A;  3DLE A;  4FK4 A;  3EE8 A;  5AFU H;  3OBW A;  5JS2 A;  1U4B A;  4WQ5 A;  4FJH A;  4BRG A;  3CIP A;  2VWB A;  4BC4 A;  2O8B B;  2E1Z A;  2O8C B;  2F9T A;  4K25 A;  1X9S A;  3ZCM A;  3CM6 A;  2DFH A;  5KGW A;  1L3U A;  1HPZ A;  1BG3 A;  2E2Q A;  2PAV A;  4O0I A;  2F7T A;  4CD1 A;  2KFZ A;  4CF1 A;  1X3N A;  4WE1 A;  4DV7 K;  3ALY A;  4W5T A;  5F1X A;  1KVB A;  1WLJ A;  3THW B;  3R9P A;  4BRF A;  1P8Z A;  4X62 K;  5BN8 A;  2FBX A;  5JVG L;  3QO9 A;  2ZQB A;  3LDQ A;  2CH6 A;  3OS2 A;  3C6U A;  4NCG A;  3FGU A;  3ZSQ A;  3RMA A;  1FKP A;  4FWO A;  3SCX A;  1RFQ A;  4U7B A;  4H5W A;  2A1R A;  4IOX A;  1XUP O;  3OBY A;  1L3V A;  4KHN A;  4RG8 A;  4PL7 A;  3QER A;  4QS7 A;  4B3R K;  3ZEU A;  5F2R A;  1BA1 A;  3A8Y A;  3KK7 A;  3VEW A;  5AZI A;  1K6Y A;  4FWL A;  3VEZ A;  3QNO A;  3I55 N;  4DS5 A;  1YAG A;  1VSL A;  4DMN A;  3KK1 A;  4E1M A;  4KHU A;  3D7E O;  3T3F A;  1HUX A;  4QS9 A;  4OKE A;  1BDG A;  1RT2 A;  4G9Z A;  4K8X A;  2P9K A;  1XQS C;  4JD2 B;  1CZ9 A;  1QVF M;  3WNF A;  2YNH A;  4M42 A;  3VQP A;  5LY3 A;  5KPZ A;  2QTD A;  1JCE A;  4W5Q A;  4KAZ A;  3OYN A;  5H1S Q;  1NK9 A;  2P9N A;  1TGO A;  1WOQ A;  3A5M C;  3VQA A;  5C10 A;  3LDP A;  5EXW A;  4WQ4 C;  4J2B A;  1SUQ A;  3TU5 A;  1A5W A;  2O8F A;  3SJJ A;  4FPB A;  4FM0 A;  4GKK K;  4F9O A;  4CIF A;  4CGH A;  2PZS A;  3WNE A;  1SS6 A;  1N36 K;  1NOZ A;  3ZX0 A;  4AHR A;  4CZK A;  4CF9 A;  3H08 A;  3NF9 A;  1YJN N;  3KD1 E;  2VQE K;  4OO1 J;  4YOU A;  2IVO A;  1VQ7 N;  2OCE A;  4J8F A;  4CES A;  4RW4 A;  5CYM A;  4LD0 A;  3K57 A;  3V9U A;  4Z4G A;  1RTJ A;  3IFR A;  4JS4 A;  2YJF A;  4DTP A;  5C2D A;  1NJX A;  1I39 A;  5AR0 A;  2FF6 A;  3VF2 A;  1SZ2 A;  1HYZ A;  4O44 A;  3PIO L;  4JRQ A;  3NGZ A;  4EAH D;  1KCF A;  1NM1 A;  4LY7 A;  4Z4C A;  2X6S A;  1U04 A;  3LWL A;  4OKK A;  1N8R O;  4WFB L;  1ZBU A;  1TK0 A;  3UKU B;  4J2A A;  3SUQ A;  2VQF K;  1KTQ A;  3CPE A;  5FRN A;  1S1V A;  1SV5 A;  3I33 A;  3EN9 A;  3D2F B;  3CQX A;  2CH5 A;  5AQW A;  3VQ8 A;  2Z1I A;  1RBS A;  2WBN A;  3AO1 A;  2OPR A;  1TL1 A;  3VQB A;  4FCY A;  3SJH A;  1EWQ A;  3RMB A;  1TYQ B;  3N4Q A;  4AQY K;  2I7P A;  5GAH P;  1VSD A;  4I6M A;  5AQV A;  5JS1 A;  4E7H A;  2Q3S A;  4H0X B;  4H5V A;  4ELV A;  3SZ2 A;  2YKM A;  3OYM A;  4RW6 A;  3KLI A;  4IEI A;  3QIP A;  4CK1 A;  3HTV A;  2PYJ A;  4AH9 A;  4EP4 A;  3IDH A;  3M8P A;  5KRT A;  1ZBI A;  1VQ4 N;  3DLK A;  3B8A X;  4KHP K;  3DRP A;  3ZEU B;  4FJ9 A;  4FVM A;  4KH6 A;  3I8B A;  4DV4 K;  1ATS A;  1Q8I A;  3CC4 N;  1EO1 A;  2AA4 A;  3TAN A;  1KFD A;  4AHU A;  4CIG A;  4AF1 A;  4UY8 O;  4CJQ A;  3VER A;  5AQY A;  1TK5 A;  4M3W A;  1X9W A;  2WOM A;  3M8Q A;  1SAZ A;  3Q7C A;  2E88 A;  3D45 A;  3RMD A;  1VQM N;  2ASP A;  4FZX C;  1QSL A;  3DXK A;  3AVC A;  3OJU A;  2WTU A;  3BGR A;  1J54 A;  3OS1 A;  3F2K A;  1TKD A;  2BDP A;  2QWN A;  5BR8 K;  1HPM A;  4CEC A;  3SQ1 A;  4ISF A;  1VSH A;  2RE2 A;  4RW7 A;  3E1Y A;  4CGI A;  1TUY A;  3O3G A;  1QSY A;  4YNQ A;  3NH0 A;  1S1U A;  3TR8 A;  4GV9 A;  2WC9 A;  2E20 A;  2YHA A;  4YOY A;  3RR8 A;  4BRO A;  3HVR A;  4FJK A;  3SUN A;  3ZT0 A;  1HKC A;  3M6G A;  1HYV A;  4H5R A;  1SKW A;  2O8F B;  2QA4 N;  4JD2 A;  5KI6 A;  4Q5V A;  1C0F A;  2F4V K;  1ZBS A;  4CK2 A;  1EX4 A;  2W6L A;  1VAZ A;  4FWN A;  4BRK A;  4FL9 A;  3SQ4 A;  1N6Q A;  2KZZ A;  5KTQ A;  4KTQ A;  1G99 A;  1KXP A;  3AGK A;  5AQN A;  1BO5 O;  1IBM K;  3VGK A;  4B1U B;  5GAD P;  3HOT A;  3UE5 A;  3L2U A;  3IMX A;  2PYL A;  4YOR A;  5C2F A;  3ZET B;  3OW2 M;  3KTQ A;  3IKM A;  4O5B A;  4M45 A;  4F2S A;  4JKH A;  1BCO A;  3VQD A;  4BRL A;  4PKI A;  1S22 A;  3L3U A;  3VEN A;  1HNI A;  2D5R A;  4HUF A;  3IAY A;  4LH5 A;  3BF1 A;  1XC9 A;  1QHT A;  4QS8 A;  4W5N A;  1NJZ A;  3LDO A;  3HYF A;  2IVP A;  4WCE L;  5E26 A;  1T44 A;  4DF8 A;  1S72 N;  4M3R A;  3GBT A;  5J1E A;  1KRP A;  3MEG A;  2P9S A;  4FLW A;  2VGN A;  3I0R A;  2P9U B;  4AHT A;  3ULE B;  1KAX A;  3MK6 A;  4EZ9 A;  3GL1 A;  5E84 A;  2FBY A;  3RR7 A;  1X9J A;  3C65 A;  3WNG A;  2P9U A;  3CG7 A;  1REV A;  4CER A;  4DTS A;  5CZ2 A;  1QSS A;  2WON A;  3MN5 A;  1DTQ A;  2FXU A;  4LF5 K;  2KQ2 A;  2X6N A;  1E4F T;  4DSE A;  3LPT A;  1B9F A;  2HHT A;  2I5J A;  1B92 A;  1T03 A;  3H1Q A;  1ATN A;  2HHQ A;  4DV5 K;  5EVZ A;  3VQC A;  3AO5 A;  4DG1 A;  3DXM A;  1TV6 A;  3A5L C;  2G8F A;  2HBK A;  3UKR B;  4IKF A;  3L4Q A;  1DLO A;  4QAG A;  3AO2 A;  1BGX T;  4LSL A;  4IWV A;  3KZB A;  3LP2 A;  4J2E A;  1R0A A;  4BR2 A;  2P5G A;  4FZY A;  1O13 A;  4KV8 A;  3MXI A;  4FOI A;  2Z1G A;  4KH4 A;  3L2R A;  4A2B A;  2FSN A;  1MWM A;  1T6C A;  5CHI A;  1YF5 L;  2P9I B;  1BI4 A;  1UOC A;  3OVN A;  4YOT A;  3CCR N;  3H3O B;  3NH2 A;  1FK9 A;  1HNW K;  4M3T A;  3LDS A;  5AQF A;  1Z25 A;  4JLH A;  3DLL L;  4LFB K;  3H46 O;  2Y1I A;  1Y97 A;  5M1F A;  4WQ4 A;  4Z4F A;  3FFK B;  4FWQ A;  3P5J A;  5M1O A;  2YHW A;  1U48 A;  2XY8 A;  3WXI A;  3VMF B;  2Q2R A;  3CHW A;  4O5F A;  1LAV A;  2VG5 A;  1J5O A;  3NCI A;  1XHZ A;  4EHU A;  3AVK A;  1NGA A;  3CM5 A;  3TSU A; 
#chains in the Genus database with same CATH homology
 1N36 K;  4YY3 K;  4JI6 K;  2UUC K;  4DR5 K;  2VQE K;  1N34 K;  2UUB K;  4YHH K;  4GKJ K;  4JI7 K;  4DR7 K;  4DV3 K;  5LMU K;  1IBK K;  4JV5 K;  4DUY K;  4JI8 K;  4B3T K;  3T1H K;  4B3S K;  4X64 K;  4LF5 K;  4DR4 K;  2UXB K;  3JAM O;  4DV7 K;  4DV6 K;  5BR8 K;  1HNZ K;  5FLX O;  4X62 K;  4LFC K;  4X65 K;  1HR0 K;  5AJ3 K;  5LMN K;  4DV1 K;  1XMQ K;  4DV5 K;  1XNQ K;  4JI4 K;  4LF8 K;  4V19 S;  5IWA K;  4LF9 K;  4LF4 K;  1I94 K;  3J7A P;  4DUZ K;  2UUA K;  2VQF K;  3J7Y P;  3J81 O;  4CW7 B;  4B3R K;  3T1Y K;  4DV0 K;  3OTO K;  4DV2 K;  2F4V K;  4OX9 K;  4DR1 K;  1HNW K;  1FJG K;  4CVN E;  4AQY K;  1IBM K;  1XNR K;  2ZM6 K;  2E5L K;  5IT9 O;  4LFB K;  4B3M K;  2UU9 K;  4JI0 K;  4JI5 K;  4JYA K;  1IBL K;  2HHH K;  4LF6 K;  1N32 K;  4JI2 K;  2UXC K;  4DR3 K;  4LF7 K;  4LFA K;  4X66 K;  4JI3 K;  4NXN K;  5A2Q O;  3J80 O;  4JI1 K;  4K0K K;  1XMO K;  1HNX K;  4DR2 K;  1J5E K;  5LL6 Z;  2UXD K;  4KHP K;  4DV4 K;  1N33 K;  4DR6 K;  4NXM K;  4GKK K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...