4V19S

Structure of the large subunit of the mammalian mitoribosome, part 1 of 2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
143
structure length
143
Chain Sequence
b'PVENEAVAPEFTNRNPRNLELLAVARKERGWGTVWPSREFWHRLRVIRTQHHIEALVEHRNGQVVVSASTREWAIKKHLYSTRNVVACESVGRVLAERCLEAGINFMVYHPTPWEAASDSIKRLQHAMTEGGVVLREPRRIYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITORIBOSOMAL PROTEIN BL27M, MRPL27
publication title The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4v19S00
2UXBK 4DR4K 1HNXK 4LFCK 4LF6K 1HNWK 2UXCK 1XMOK 4JI3K 4JV5K 2VQFK 4DR5K 5AJ3K 4B3RK 2HHHK 4CVNE 4AQYK 4DV6K 1N36K 1N34K 4DR2K 3J7YP 1IBMK 4JI8K 4JYAK 4B3SK 4DV7K 1XMQK 4DV0K 1IBKK 4DV4K 4X66K 2UUCK 3J7AP 4DR1K 1I94K 2UUBK 1N33K 4DR7K 4JI2K 4DV3K 3T1HK 4YHHK 4NXNK 2UU9K 4JI7K 3J81O 1N32K 4DV1K 3JAMO 4DV5K 4DR3K 4DUYK 5FLXO 5LMNK 4JI5K 4LF5K 4DV2K 4LFBK 2UUAK 4GKKK 4B3TK 1HNZK 2VQEK 4DUZK 2E5LK 3OTOK 5IT9O 4K0KK 2ZM6K 2UXDK 4LF7K 4JI1K 4LF9K 4X65K 5BR8K 4KHPK 4NXMK 4LF4K 4DR6K 5IWAK 4X62K 4LF8K 2F4VK 1HR0K 5A2QO 1J5EK 1XNRK 4JI4K 4CW7B 4LFAK 5LL6Z 4GKJK 4V19S 1FJGK 4B3MK 1XNQK 3T1YK 4X64K 4YY3K 4OX9K 3J80O 4JI0K 5LMUK 1IBLK 4JI6K
chains in the Genus database with same CATH superfamily
4JD2B 2EHGA 3HO1A 3M8PA 3T1AA 1KVBA 1X9WA 4HCBA 1GLAG 3THYB 1E3MA 3UKUA 1J53A 3LM2A 4PL7A 1TUUA 3OYDA 2BH1A 1NU0A 3NH1A 3JXUA 3WQTA 4QAGA 3ZX0A 3CJAA 4M3XA 2G8HA 3KKRA 4MLEA 1T05A 3RR8A 2E88A 4BDPA 3SNNA 1RT4A 5KPTA 3THWA 2D0CA 1KXPA 1KLMA 4CGGA 2P5GA 3SJJA 2KQ2A 3V9ZA 4FWKA 2P9KA 5C15A 3OYGA 3KLIA 1BA1A 2RF2A 3MEGA 4YOXA 3HP9A 4DV3K 4JK8A 2ZGYA 1IJJA 1JJ2M 2WOMA 1S1WA 3VQBA 3KIOA 4FWOA 4I7FA 4KI6A 4NLCA 4CEEA 4FZZA 4ID5A 4CF9A 3AVBA 4CD3A 1OH5A 1TYQA 3ATUA 4B3TK 1NM1A 4KHYA 1UWBA 2GTDA 4NYNA 3KK7A 4OLBA 4NCBA 3CD6N 1EX4A 3DRPA 2BTFA 3LM9A 3MN6A 1F21A 4OKJA 1CXQA 1ZBUA 2RKIA 1S6QA 1ESVA 3PO5A 4JHDA 2O8EA 4IFEA 4WQ5C 3F2KA 2BUPA 4XH1A 3DXKA 3MECA 2P9LA 3FFIA 3AVKA 3CCRN 3O9SA 1QE1A 3MCPA 1WAJA 3KD5E 1IO2A 4U67L 4B9MA 4K42A 3EZWA 1GOAA 3LZIA 3DLGA 1G15A 3E1YA 4WQ5A 1GLJO 1QTMA 3SAGA 1RGIA 4X64K 4CGFA 2OTLN 4JS4A 2YKMA 1C0TA 4BRNA 3DJCA 3JYTA 1HNXK 1HNWK 5DM6L 3VGKA 4O0IA 1J54A 1RTHA 4BR5A 3SUPA 3KLEA 1S1TA 2V7YA 4CD1A 5AQQA 4WF9L 1NK7A 1NK6A 1VQ5N 2HB5A 3EE8A 2E1ZA 1R0AA 2XRIA 4DQPA 1KSPA 3D2EA 3LP2A 3TSUA 1NK8A 2IVNA 2P9UB 5CR4A 4Z4CA 4DU1A 2E2OA 2JGUA 2HHUA 1N6QA 2F96A 3WNGA 4E1JA 1CZ9A 1IKVA 3OA9A 5KI6A 4DR1K 5EOYA 5CE3A 4KAZA 3VMFB 2I5JA 3M8QA 1EO1A 1KFDA 4BQZA 1XHZA 4F9OA 3FZMA 2FXUA 2ZD1A 4CJFA 3J8AA 3VTIA 4CJ3A 3SQ0A 1NWKA 4R5PA 2KZZA 3HXMA 4H5RA 3VF2A 4KPYA 4DFJA 1NJZA 3VA3A 4DUYK 4CK3A 3D2FA 4H4OA 3H3OB 4IFYA 3ZT3A 3W0LA 4I6MA 3IDHA 3L4IA 4CI6A 3CJCA 4GNIA 1BHLA 3UIQA 5JS1A 3VGMA 4BDYA 4E0DA 1YF5L 3R1XA 4CZFA 2ZM6K 1RTJA 1RT6A 1NGJA 5KRSA 3VQDA 4H0VB 4WFBL 4ISFA 4ID1A 1NGGA 4LD0A 1SL0A 4FVUA 4PY5A 4FLTA 4Y0WA 4E7JA 1YTAA 3TR8A 1GOBA 4CGJA 3SJHA 4ELTA 1RCHA 4B1VA 2ASMA 3THVA 4L3QA 3OYKA 3ZSXA 1JLGA 1Q8IA 2ASPA 4OPAA 1BOTO 1HYZA 5BN9A 3SI6A 3R9PA 4FJGA 4M42A 4FLUA 3IUCA 3HM9A 1T3VA 3LWMA 4IFVA 3MN5A 5DM7L 1GLLO 3CQ8A 3AY9A 3CI5A 4QS7A 4CJUA 3TTDA 3QEXA 1WSIA 4RW8A 4CFAA 2NRWA 2E4LA 1VSEA 3P1GA 5C0YA 4AH9A 4M7XA 4DTJA 4BRIA 3V1QA 3NGIA 2OPPA 1KC8O 1B92A 2ASOA 1D5AA 3GOIA 1XHXA 2B4JA 3L2WA 2F9TA 4IO9L 3HSTB 3I55N 3WUHA 4HUGA 5GAHP 4QS8A 5AQPA 3ZETA 4OPJA 2Z1HA 4BR9A 5HL7L 4IKFA 2RE2A 4IJAA 4BRGA 2OZSA 2OPSA 4CJRA 2NRXA 1Q9XA 1KVCA 4CEAA 2CGKA 1TAQA 4Z4FA 4XIUA 1BGXT 4FZYA 4C1NK 3SUQA 4OLAA 4CGHA 5KPZA 3HVTA 4E7IA 1NOZA 2HHWA 3OJSA 4CJPA 3AA2A 3HPHA 1OH6A 3G4SN 3BGRA 1NGEA 4CZHA 4BWJA 4CHOA 1BA0A 4DSEA 3HZ6A 4UQGA 4FJIA 4Z0UA 3K9JA 2W41A 3A5OC 3MEDA 4CEDA 3EL2A 3GG4A 5AQWA 1RNHA 4NXMK 3R6MA 4CZKA 5GAEP 1D8YA 2ZGZA 4LSNA 1J5EK 1TAUA 2GV9A 1RBVA 2AJQA 2HF3A 3B6OA 4K8ZA 1YXQA 3MN7A 4FJ9A 1FJGK 4EHTA 2OPQA 4O8UA 4TSXA 1JLEA 3M5RA 1T8EA 2KZMA 1UAXA 4LC9B 4DTNA 1K73O 3OY9A 1HYSA 1BCMA 2QWRA 3T69A 3CFOA 4KH4A 3CCJN 4YOUA 1W7AA 4DV6K 2YHAA 1IBMK 1B9FA 3VQ6A 3THXA 1LAVA 4FLVA 4JYAK 3QNNA 4CF0A 2QTDA 4BC2A 5AQJA 5AQSA 1NLVA 1YTUA 1TL1A 4KTQA 5M1OA 1U04A 4CFBA 3J7AP 1X9MA 4N56A 3S41A 4FWRA 3GBTA 1X9SA 1LWCA 3HM8A 1N33K 3NF8A 4FLYA 5M1KA 2A6AA 3H6EA 4PL8A 1NBWA 2RHKA 1C0UA 1VQLN 3CCVN 2VCPA 2OPRA 3AO5A 1KAXA 3RVCA 3VEYA 3R3LA 3B6PA 4H4MA 3EN9A 4BRKA 3GDQA 3L2QA 4K43A 5J1EA 4KV8A 2GBZA 4NCGA 4RCHA 3H3NO 3ATVA 1SS6A 5HRPA 1HMVA 3UKRA 4LF5K 4YOWA 2E6LA 3GE1A 1U49A 3PLAA 3BF3A 4DTMA 3CC2N 1BIZA 4IG3A 3EYZA 4EHUA 2X78A 2QM1A 3OTOK 2D4WA 2QWNA 3SMSA 2XO7A 1T6DA 3F73A 3SPYA 2UXDK 4O0JA 1FK9A 2VGMA 3QIOA 1BIUA 4J2DA 1KVAA 2O8CB 1ATSA 4DLGA 4ISEA 1S1XA 2X6NA 2WUSA 2YNGA 4F8RA 3KJVA 4GKJK 1WAFA 1TGOA 3B8AX 1BL3A 4RTFD 1T6CA 3VF6A 2KHOA 1XNQK 3SBGA 2P1JA 4BRCA 3P31A 4FJKA 3FZFA 2V52B 4PKGA 4JI0K 3AAPA 1E4GT 4LFCK 3CYMA 1YAGA 3UB5A 3VQEA 2VYPA 1C6VA 1U4BA 4JV5K 1J6ZA 4BRMA 4Q5VA 3LP1A 4IOAL 4YDUA 3MMVA 3O3HA 4WQ4C 1N34K 2DFFA 3QB0A 3KLFA 4RG8A 1MWMA 3A5LC 2G8KA 3HT3A 4KREA 4BC3A 3K9KA 3RSEB 3ENOA 4B08A 3A2FA 3O4NA 2FLOA 4DCHA 1KLNA 5CZ2A 2UUCK 4DTXA 3ID6A 1SZ2A 3VESA 2KKZA 3NFAA 4CGIA 4DS4A 1LWEA 2W40A 3JS6A 4KH5A 1L3TA 4Z4GA 4B1WB 3M8SA 3O1BA 2AP1A 1DGKN 1GLDG 4DLEA 3DYAA 4N76A 1ATRA 4CZEA 4GY2B 4A61A 2RPIA 3C6TA 2E6MA 1SKWA 3ZSQA 2X74A 3V1OA 3DOLA 4CF8A 5C42A 3KWGA 5HROA 2QXLA 3OVNA 1SUQA 3U3YA 5CYQA 3LAMA 4OPHA 1W97L 3CCLN 1S22A 4EFHA 4DFPA 2YNFA 4KTWA 4JKGB 5MLCQ 3LWLA 4CIEA 1VSHA 3G0ZA 3QMLA 4JKDA 2KFNA 5KTQA 3QO9A 1HX1A 5C24A 5KQDA 1O1WA 1Z05A 4A2AA 4GV6A 4H5TA 2VG5A 1ZXOA 4B1ZA 4X62K 3PV8A 4I9QA 2VG7A 4C8KA 3DXMB 3WXIA 1A5VA 2P9IB 5EY4A 3NF7A 5TKWA 4CJTA 5AQUA 4BRAA 4B3OA 3G25A 1U2VB 3U9DA 5HRNA 2YJEA 4M3ZA 2AA4A 3ULEA 4JLHA 4FSVA 3J80O 2E2NA 3VPZA 2YNHA 3AVNA 1RDDA 1RDBA 3GL1A 4BRDA 3VQQA 2A3ZA 2ZJPL 3DWLA 2NLXA 3QERA 3HOTA 3OYIA 3KK3A 3BF1A 4AQYK 4LH5A 4BVOA 3UKUB 2KTQA 3EY1A 1GOCA 4W5RA 1DLOA 1RT7A 4GVEA 5JLFA 3K5NA 1ASWA 1NMNA 1HNIA 4DV4K 1RBSA 3K5OA 4BE1A 4C8MA 1JLQA 5KGWA 1VQPN 3THWB 1I39A 1VQNN 1JL2A 1WSGA 4DR7K 1LW2A 1QSLA 4M3YA 3MAQA 2YJFA 2A42A 4YHHK 1G99A 4UY8O 1MA9B 2P9KB 3CCQN 3TAGA 4BREA 4F2SA 1VSKA 4B8CA 3D45A 3CXCM 1KRPA 3TAMA 3U3GA 4LSLA 3SQ4A 3AO2A 4M3UA 4W5QA 1HRHA 3HPOA 4BC4A 5C12A 4DU3A 4K41A 4Y1DA 1CLQA 3K5LA 4CZMA 1TUYA 4DV2K 2YV0X 1X9JA 3AVIA 1WBBA 1ITGA 1U48A 1HNZK 5AR0A 1NJWA 3Q7CA 4AILC 1ILYA 3MWPA 2OZMA 1YVUA 4QS9A 1BO5O 4BDZA 4C1NI 3WEEA 4N5SA 3S3OA 1YJ9N 3OYHA 5CY4A 5BREA 1RBTA 3CFPA 3WXJA 2FF6A 3FGUA 2QEXN 3DOKA 3L3VA 4DU4A 3BEXA 4JHDB 2O8EB 5A2QO 3RMBA 5DK5A 1TKTA 3VF4A 3H45C 3NCIA 3NBPA 3DXKB 2P9LB 2PFUA 3U8XA 4MFBA 4PQUA 3G71N 3TWHA 2YCHA 4FM1A 4KBOA 1D4XA 1REVA 3QLHA 4YOTA 5AZIA 5FPMA 1CZAN 4KO0A 2BGGA 4CBUA 3SUNA 2FBYA 3SAHA 3V4IA 4HUFA 4DR5K 2NRRA 3C6UA 4CECA 3KLHA 3PX6A 2HHHK 3CJ7A 1VQ4N 1C1AA 2NRZA 5E26A 5C10A 1QZ6A 3NGZA 2EX3A 3T7ZA 4AHUA 4DB3A 3O4QA 3S3NA 4DV0K 3D2EB 1RBRA 2DFHA 4B1YB 2ZF5O 1WB9A 3OS0A 1RBUA 2WONA 3ZSOA 4X66K 2GEMA 1BCOA 4PHTX 4E7HA 5JVGL 1NK4A 3PX0A 3L3UA 3E9OA 3U4LA 2O8FB 2UU9K 2P9NB 4BWMA 3LDSA 3AA4A 4O5FA 4FK0A 5I3UA 4CEOA 1BDGA 1IG9A 3OHRA 1JLAA 2NRVA 1ASUA 3I8DA 2UUAK 5AQMA 2VQEK 1NJXA 1RTIA 3VOVA 4BR7A 3OYEA 5J2QA 3HYFA 3O5BA 4I6MB 5TKYA 4F3TA 2DY4A 4M45A 1EP4A 1S9GA 4FW2A 4RW6A 2IDOA 3I56N 2NRTA 4MO4A 4B9UA 1D9DA 2HHQA 1WSHA 3AVLA 4Z94A 3DLKA 1OVYA 4ISGA 5K14A 4BGBA 4E89A 3I0RA 2XHBA 1YITN 4J2AA 1VQ6N 2O8DB 2YHBA 4LFAK 3ZSZA 3ZX2A 5HBMA 3AA3A 4FYDA 4JNEA 5AQFA 4E7LA 2OA8A 3J7ZO 3RRGA 5EXWA 1QQMA 2OANA 2P9PA 1KQSM 3E9LA 2G8VA 4H0YB 2F7TA 5KQ8A 4FJLA 4ILHA 4H0PA 1QSSA 4FZXC 3LDOA 1HKGA 3LDQA 5J2MA 1JKHA 1LAWA 3MEEA 1NG9A 3TARA 4PKIA 5H1SQ 1X3NA 2QXFA 4DR2K 3CJBA 3H1VX 4A2BA 4JI8K 3KD1E 3R8EA 5AQTA 4C8OA 4EP5A 5AQIA 1WSEA 4CJ7A 3DAWA 3HVRA 3ITHA 2W6LA 3LP0A 1IBKK 1M90O 1NGFA 4CGDA 4CFDA 1SV5A 3FZKA 2Q1NA 3WNHA 3VENA 3O9TA 3BDPA 2Z1JA 3SYZA 2BANA 2F8TA 1U45A 3K57A 1Q7YO 1HNVA 5AQKA 3OYLA 2YNIA 4YNQA 3FFKB 3QEVA 2QWLA 4A5AA 3LANA 1N32K 4O5BA 1VSJA 4HCCA 4JKEA 1NMDA 2A1SA 1UA0A 3KK1A 3C65A 4GV3A 4A57A 4DSIA 1CXUA 4CK1A 1S6PA 1X1PA 3M3ZA 1DEJA 3SK3A 4KHSA 1E4FT 4AHRA 4M41A 2Q97A 4IZ9A 4CERA 3U9ZA 4DQIA 3I33A 4CFCA 1EKEA 1YJWN 3O80A 3DMJA 5GIOA 3KVGA 4FJNA 5AQHA 4OGCA 1HR0K 1VQON 2OYQA 3VQPA 5AQNA 3KK2A 1NGDA 3L2VA 3HK2A 1SAZA 2HHTA 2G8UA 1TVRA 2P9SA 1J9AA 4BR4A 3VQ5A 3EZ5A 4G1QA 1ZC6A 4IDHA 5AFUH 1NGAA 2ZWHA 5EX5A 1EXQA 4KRFA 4CF2A 1XC9A 2RN2A 4IJNA 1VQ7N 3N4QA 3VEVA 4DTSA 2GELA 1YIJN 4I2QA 2QWPA 3OBYA 1LOTB 1L3VA 2YHWA 3CQXA 3M8RA 2E8AA 4IOCL 4JKBA 3WXKA 3VA0A 4CZIA 4B9VA 4RW9A 1RT1A 4DSKA 2EWSA 2QWOA 3C94A 5HRRA 4DTUA 2PY5A 2VWJA 3IS9A 1BUPA 5J2NA 3MN9A 3LALA 1NGIA 1WUAA 3AVCA 3RMCA 3TI0A 3LDLA 4ZTFA 4DTOA 1T03A 1W0HA 2VWBA 3PUFA 2FC0A 4DV5K 3C7NB 1TKDA 1QHTA 2OTJN 3NF6A 3NE6A 3LPUA 2Q0RA 2DFEA 3ZLJA 4I2PA 4H5WA 3S9HA 4YFUA 5B8HA 4H5NA 1QS4A 3ZT2A 3IG1A 3CG7A 4JN4A 2P5OA 1Q86O 3ZEUA 3ENHA 5GIPA 4BY9C 3HL8A 2PBDA 4LF9K 4KHWA 3NDKA 2E2PA 3CF5L 4CHQA 3MK6A 1SL1A 3ZYYX 4B9NA 1JXBA 1LWFA 3CQYA 1ZBLA 3AARA 3RWUA 3AAQA 3ZSWA 5AQGA 4BACA 5AZJA 3L2RA 1W2BM 4V19S 4IXCA 4J2BA 3RRHA 4OO1J 3BUZB 4EP4A 4B9SA 4FXDA 1HPZA 1MU2A 3F5TA 2XY6A 1C0MA 1YVNA 2D0OA 3H08A 3OW2M 1RDUA 1TK5A 1VHXA 4B1UB 5LMUK 3RMAA 3VEOA 4C8NA 4E7KA 2NRHA 4LF6K 4CESA 1TK0A 5SZTA 3WT0A 4CZLA 4CZJA 1QVGM 5KRTA 3PIPL 4FJHA 3AA5X 3QNOA 2F9WA 4FWQA 4RWTA 4CEZA 1BG3A 4ICLA 4YDUC 3QFUA 3V9XA 4XH4A 3SUOA 4DHYA 2A1RA 1K8KB 2BE2A 4KFBA 2GUIA 5CZ1A 4BE0A 4FJ8A 5ADXH 4DFKA 1OVQA 3BY5A 3PSFA 4FWMA 3WNEA 2E1YA 3SAFA 3CCMN 2H3GX 1YUWA 3EE9A 4CJ5A 1ZBHA 4CBXA 1L3UA 3BZCA 5E84A 1RDCA 3CJ1A 4NXNK 4M7YA 5FDLA 3J81O 3OYNA 4DV1K 1RDWX 3MX5A 1C0GA 1GLFO 3SV3A 1TKXA 4JI5K 5M1FA 3EKUA 3QINA 1BQNA 1HJRA 1SL2A 3DLBA 1HKCA 1Q82O 3IMXA 1UA1A 4CF1A 3KWIA 2V7ZA 4HVJA 2HOEA 1EQYA 4CIGA 1X3MA 3N4PA 4JI1K 2HBLA 4N47A 4BG9A 1DKGD 3MX2A 3D0PA 1S72N 5BR8K 5AQRA 2Q3SA 3AVAA 3C6HA 3BP8A 5I9EB 1NGCA 2CH5A 3OBWA 3TAQA 4HTUA 4PUOA 1I3AA 2YHYA 3E9PA 3A8YA 2PZSA 1S9EA 5HLFA 2VG6A 4ELUA 2W42A 3VQAA 4FLWA 3V9SA 1TL3A 4B3MK 2PAVA 4MO5A 4YY3K 3PY8A 2D5RA 4CCHA 2G8IA 3V6DA 3KLGA 1C0FA 2LSNA 3C0BA 3ULEB 4BG8A 5BPLA 4AHTA 2HW3A 1D9FA 1WLJA 4IO8A 3MXIA 3K0SA 3KTQA 2P51A 2I7NA 2IS3A 4JK9A 3P38A 4B9TA 5J2PA 3HBTA 4Y1CA 5AQZA 3HJFA 1XC3A 3TAPA 2HMPA 1J5OA 2ZQBA 3T3FA 3ID8A 2V51B 4CEQA 1RTDA 1DTTA 2Q2RA 1GLEG 4FK2A 4G9ZA 1VAZA 2DPNA 3SCXA 3CMAN 1P8ZA 4FO0A 4DQSA 1OH7A 1MDUB 4KTZA 1T44A 4K8XA 4E19A 4EIAA 4CJVA 1JXEA 3WXMB 4OGEA 3H46O 3OYFA 2O8BA 4FVMA 2UUBK 4O4GA 3AO3A 3EKSA 3EO3A 1TK8A 4CK2A 4CIFA 4F3OA 3O1WA 1VRTA 1Q18A 2Q36A 5DMRA 4ELVA 3OJUA 1M1KO 4L8RB 4WCEL 4KKOA 1DTQA 3OS2A 2P9IA 1VQKN 4GVMA 4CJKA 1JL1A 1KAYA 4FK4A 1NKCA 1U2VA 2XY5A 1WNSA 3OYMA 4BROA 3T19A 1ZBFA 1Q81O 4GW6A 1V4SA 2Q31A 5AFUA 1JLCA 1NJYA 3SQ2A 1KAZA 2ETJA 1CZBA 4CHPA 3ULDA 3DLHA 4BE2A 3W3DA 4YOVA 3HI0A 1WSJA 3NAEA 4LF7K 4DQQA 3WEEB 5LY3A 5FROA 5SWMA 2PYJA 3OYAA 3DLRA 4IEEA 3PIOL 1HLUA 4F2RA 1RT3A 5BN8A 2CGLA 2KFZA 3I8BA 1BI4A 4CW7B 1VSIA 1RILA 1TYQB 4E1NA 4B8AB 2GUPA 3CERA 4DS5A 4JD2A 3LDNA 4YOYA 5BPMA 1XQSC 4H5VA 4CJ4A 3THYA 4CJLA 3Q7BA 1IBLK 4U7BA 4O44A 5AZIB 3E66A 3K5MA 1Z6RA 4IG0A 4B9QA 4DKWA 4KB0A 3NHGA 3C95A 3TABA 3QDKA 4FJXA 2IAJA 3J7YP 3M6GA 5I42A 4M3TA 1C1BA 3VEZA 1K8AO 5AQLA 5JLHA 4DV7K 1HQUA 4FL9A 3A5NC 4IOXA 1Y64A 4PA1A 5CYMA 4MDAA 1IKYA 2HNYA 3PSIA 3S3MA 4JI2K 1YHQN 3CCUN 4PWDA 4JI7K 1SKSA 3CJ9A 4CEBA 4DR3K 4I9LA 3P4IA 1WBDA 2HMIA 1SQKA 4CE9A 2BDPA 3P83D 4WE1A 5EVZA 4NLBA 4FWSA 1ZBSA 4FJ5A 1ATNA 3VQCA 1GLBG 4DUZK 1NKBA 1NK9A 1S1VA 4W5NA 4BGAA 1NKEA 1C1CA 4KHNA 5FRNA 3DLLL 2O4GA 3VQ7A 4H0XB 1HJOA 3SQ1A 3NGYA 4IDKA 1N8RO 2NZTA 5BRDA 1BU6O 2D0PA 4LF4K 3SPZA 2YKNA 2FBTA 4LY7A 1XNRK 2IC3A 3P5JA 3KHYA 4BVPA 2QWMA 2FSKA 3P39A 3D2FB 3BZKA 1NOYA 5ADXA 4DQRA 3C6AA 4A5BA 1K6YA 1VSDA 1EETA 3QICA 3QEPA 4F4KA 1QSYA 4BR0A 4JKAA 2DTUA 1HYVA 3ZSYA 3H1QA 4DR4K 3OYBA 2O8FA 1JCFA 1KFSA 2P9PB 1FKOA 2VQFK 4FLZA 5LJVA 2JLEA 2P9NA 4J8FA 3WNFA 4Z4HA 4DFMA 2ZE2A 1IH7A 3WQUA 1P90A 4CVNE 2G8FA 2P9UA 5AQYA 3RMDA 4R79A 4DSLA 4DSJA 1WN7A 4AHCA 4B3SK 1QHAA 4O8KA 5JMVA 2D0AA 4CJEA 2HF4A 3QEIA 4BC5A 2QKBA 3DRRA 1ZYQA 1WSFA 1GLCG 1LCUA 1S5JA 3TSQA 1I94K 1EWQA 1FXXA 3HTVA 1VRUA 2GWKA 4DTPA 3T1HK 4CZGA 4AM7A 2HBMA 4JKFA 3DI6A 2R7YA 2NUBA 1JCGA 3E01A 2O8DA 1V4TA 1R59O 3O3FA 3AV9A 4H0TB 5FLXO 3V81A 5GADP 4PKHA 3F9KA 5LMNK 1B9DA 3A5MC 3K2PA 1U47A 1RT5A 3TU5A 3FZLA 4NO7A 4FPBA 2YX6A 1IKXA 3VTHA 1JLBA 1QQOA 4DF8A 2KLAA 1XI1A 4AHSA 3KZBA 2WTUA 3G10A 5LJWA 2QI2A 2E2QA 5AQVA 2WFBA 3OYJA 3AVJA 1NGHA 3ZETB 3RTVA 4MQ3A 1A5WA 5F2RA 3QESA 3A0IX 3FR0A 3IKMA 3DRSA 2F4VK 2FBXA 5HP1A 3AO4A 3HOSA 5C2FA 3CM6A 2Q0UA 2J4RA 3VERA 5JVHL 4YORA 3VEXA 5E41A 3U6FA 3SMPA 3O6WA 3AGKA 1HQEA 3TTCA 4BRHA 4CHNA 4BRPA 5ELZA 4OX9K 4K25A 1IKWA 4IEIA 5T7BA 2D1KA 3QBXA 2P9SB 4BRLA 4DQ8A 1ZBIA 2UYTA 2UXCK 3CC4N 1XMOK 4JI3K 1LW0A 2I7PA 4FCYA 2G8WA 3CMEN 3IFRA 3ALYA 4DWIA 3K58A 4NYFA 4B3RK 3TAFA 4BRFA 3TSPA 1TV6A 1UOCA 4WYBA 4ZTJA 1VQMN 4E1MA 1H1VA 3VQ4A 3OYCA 4XH5A 4JRQA 1JCEA 4ZHRA 2KW4A 1MWKA 2JWLA 3MCAB 3VEWA 5CHIA 4QOZB 4O55A 1L3SA 3IRXA 2XY8A 5JICA 2A41A 4WFNL 1U6ZA 1RFQA 4FJJA 2X6SA 3ASMA 4IWVA 3FLCO 4DG1A 1VQ9N 2ITGA 1LV5A 3JAMO 3ISNC 2GWJA 5EU7A 3TTFA 3QFPA 2HVIA 3VGLA 4JK7A 2ITMA 3THXB 3UE5A 3OS1A 2HNZA 4NCAA 3VETA 4B9LA 1VSFA 1FKPA 1O13A 1S3XA 4FWPA 2HBJA 5FRMA 5KPRA 1OKJA 5FPEA 4CJSA 1WOQA 5IT9O 3CM5A 3LDPA 3ZSRA 4W5OA 2ZJRL 4K0KK 4CHYA 1YJNN 5BR9A 4X65K 2QKKA 3ZEUB 1EWRA 2QA4N 3EEQA 3VN5A 5BPNA 4FJMA 4OPKA 4DF4A 1NK5A 3JSMA 3L6QA 4HWIA 3AVHA 3UKRB 2QWQA 1VK0A 2YHXA 4BR2A 4OJRA 4AM6A 5AZJB 3G6EN 3ZT1A 4Q0BA 4H0OA 1YI2N 3O4WA 2HNDA 1QQNA 1HPMA 4BRQA 3NH2A 4FWNA 5FPDA 2A5XA 3QBWA 3DLEA 4B1XB 2UXBK 2VGNA 2HHSA 4CJWA 3I0SA 4IBNA 1IG8A 2B6AA 3CHWA 3TANA 2ATQA 5AJ3K 3C7NA 3MWTA 4W5TA 1W9HA 2IOCA 4OKEA 4KHUA 2Z1IA 2FF3B 3CIPA 3D7EO 3O9RA 2FSNA 1TKZA 4AF1A 2YI1A 1HUXA 3AGRA 1XMQK 1XUPO 3SV4A 4M3WA 4AHVA 5BRHA 5F1XA 3V9UA 2Y1IA 2F8SA 2D0BA 1Z25A 4N41A 3LZJA 4JS5A 3ZT0A 1KCFA 1HKBA 3NH0A 4FPAA 5HOOA 3IAYA 3FZHA 3O08A 4MDBA 4C8LA 3AVFA 4CEFA 3QETA 4EAHD 4JRPA 4FOEA 4CJQA 3ZT4A 1K9MO 4HHTA 3V9WA 1KD1O 1DT9A 1RT2A 5M1NA 4FOIA 3CCSN 4M63C 3V1RA 5AQXA 4H8KA 3PX4A 4QCLA 3LAKA 1SKRA 3M1FA 2WC9A 4RW7A 3QIPA 2O8CA 2HHXA 4E3SA 3TAEA 3FE1A 1VSMA 1ASVA 2HVHA 2W6KA 3HSCA 4FWLA 4LH4A 2O4IA 3L0QA 4DR6K 4FLXA 1Y97A 4LF8K 5GINA 3ENBA 4C23A 4GMJB 1BWFO 1RDAA 4JI4K 5LL6Z 4ILGB 3KKSA 1K8KA 3AO1A 4MLHA 5HRSA 3HRGA 4KI4A 5M1QA 3CCEN 3TPQA 1N5YA 3ZCMA 1QQCA 3VQ9A 4KHQA 2IGIA 2PYLA 3CETA 3NMUA 3CPWM 2CH6A 4JEPA 4KB1A 3QEWA 4CBWA 3L2UA 4WQ4A 3WXLA 1Z26A 4JAXA 3NF9A 1Q9YA 1XWLA 1VSLA 4HUEA 1QZ5A 5C25A 4NB4A 5JS2A 3K59A 3CFRA 4WFAL 1OH8A 4EZ6A 4FM0A 3L8BA 1N36K 3LL3A 1BISA 3F9MA 3RSEA 4A59A 1T7PA 5D3GA 3NVKA 1BQMA 2A40A 2B5JA 5KGXA 1S1UA 3PO4A 1NJIO 1KTQA 5FPNA 4FW1A 3AVGA 3CC7N 3VQ8A 1FW6A 5GAGP 3MXMA 1YT3A 5M1PA 2WBNA 2Z1GA 4DSFA 3L4QA 4HTLA 4OVLA 2O8BB 2HBKA 4CHZA 4JKHA 3HP6A 3O8MA 3LPTA 1IV0A 1L5UA 3D6RA 3O9QA 4OKKA 1NGBA 5AQOA 5C2DA 4J2EA 1VQ8N 4EZ9A 4KH6A 4XEIA 4LFBK 4GKKK 3O3GA 4H03B 4FM2A 4JKGA 3ZX3A 5BRFA 4DTRA 3LP3A 5F0XA 4Z4IA 2JWKA 2E5LK 3SBTA 1NNEA 4GV9A 2Y1JA 3NVMA 3O9UA 2OCEA 4A62A 4Z4EA 2NNWA 3SZ2A 3MXJA 1A5XA 3DXMA 4JKCA 2ZJQL 2IVPA 4KHPK 2IVOA 5IWAK 1JLFA 2FSJA 2XY7A 2HHVA 4RW4A 2CGJA 2GX9A 2QK9A 3CPEA 2IIRA 2QW9A 4BQLA 3AVMA 3DM2A 1BI4B 2E20A 3SLCA 2HSTA 1NK0A 4M3RA 3ZSVA 3HPGA 1QVFM 2FBVA 3RR7A 4DMNA 3T1YK 4ILJA 2VWKA 3MDQA 4FJ7A 4JI6K
chains in the Genus database with same CATH topology
2UXBK 4DR4K 1HNXK 4LFCK 4LF6K 1HNWK 2UXCK 1XMOK 4JI3K 4JV5K 2VQFK 4DR5K 5AJ3K 4B3RK 2HHHK 4CVNE 4AQYK 4DV6K 1N36K 1N34K 4DR2K 3J7YP 1IBMK 4JI8K 4JYAK 4B3SK 4DV7K 1XMQK 4DV0K 1IBKK 4DV4K 4X66K 2UUCK 3J7AP 4DR1K 1I94K 2UUBK 1N33K 4DR7K 4JI2K 4DV3K 3T1HK 4YHHK 4NXNK 2UU9K 4JI7K 3J81O 1N32K 4DV1K 3JAMO 4DV5K 4DR3K 4DUYK 5FLXO 5LMNK 4JI5K 4LF5K 4DV2K 4LFBK 2UUAK 4GKKK 4B3TK 1HNZK 2VQEK 4DUZK 2E5LK 3OTOK 5IT9O 4K0KK 2ZM6K 2UXDK 4LF7K 4JI1K 4LF9K 4X65K 5BR8K 4KHPK 4NXMK 4LF4K 4DR6K 5IWAK 4X62K 4LF8K 2F4VK 1HR0K 5A2QO 1J5EK 1XNRK 4JI4K 4CW7B 4LFAK 5LL6Z 4GKJK 4V19S 1FJGK 4B3MK 1XNQK 3T1YK 4X64K 4YY3K 4OX9K 3J80O 4JI0K 5LMUK 1IBLK 4JI6K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXB K;  4DR4 K;  1HNX K;  4LFC K;  4LF6 K;  1HNW K;  2UXC K;  1XMO K;  4JI3 K;  4JV5 K;  2VQF K;  4DR5 K;  5AJ3 K;  4B3R K;  2HHH K;  4CVN E;  4AQY K;  4DV6 K;  1N36 K;  1N34 K;  4DR2 K;  3J7Y P;  1IBM K;  4JI8 K;  4JYA K;  4B3S K;  4DV7 K;  1XMQ K;  4DV0 K;  1IBK K;  4DV4 K;  4X66 K;  2UUC K;  3J7A P;  4DR1 K;  1I94 K;  2UUB K;  1N33 K;  4DR7 K;  4JI2 K;  4DV3 K;  3T1H K;  4YHH K;  4NXN K;  2UU9 K;  4JI7 K;  3J81 O;  1N32 K;  4DV1 K;  3JAM O;  4DV5 K;  4DR3 K;  4DUY K;  5FLX O;  5LMN K;  4JI5 K;  4LF5 K;  4DV2 K;  4LFB K;  2UUA K;  4GKK K;  4B3T K;  1HNZ K;  2VQE K;  4DUZ K;  2E5L K;  3OTO K;  5IT9 O;  4K0K K;  2ZM6 K;  2UXD K;  4LF7 K;  4JI1 K;  4LF9 K;  4X65 K;  5BR8 K;  4KHP K;  4NXM K;  4LF4 K;  4DR6 K;  5IWA K;  4X62 K;  4LF8 K;  2F4V K;  1HR0 K;  5A2Q O;  1J5E K;  1XNR K;  4JI4 K;  4CW7 B;  4LFA K;  5LL6 Z;  4GKJ K;  4V19 S;  1FJG K;  4B3M K;  1XNQ K;  3T1Y K;  4X64 K;  4YY3 K;  4OX9 K;  3J80 O;  4JI0 K;  5LMU K;  1IBL K;  4JI6 K; 
#chains in the Genus database with same CATH topology
 4JD2 B;  2EHG A;  3HO1 A;  3M8P A;  3T1A A;  1KVB A;  1X9W A;  4HCB A;  1GLA G;  3THY B;  1E3M A;  3UKU A;  1J53 A;  3LM2 A;  4PL7 A;  1TUU A;  3OYD A;  2BH1 A;  1NU0 A;  3NH1 A;  3JXU A;  3WQT A;  4QAG A;  3ZX0 A;  3CJA A;  4M3X A;  2G8H A;  3KKR A;  4MLE A;  1T05 A;  3RR8 A;  2E88 A;  4BDP A;  3SNN A;  1RT4 A;  5KPT A;  3THW A;  2D0C A;  1KXP A;  1KLM A;  4CGG A;  2P5G A;  3SJJ A;  2KQ2 A;  3V9Z A;  4FWK A;  2P9K A;  5C15 A;  3OYG A;  3KLI A;  1BA1 A;  2RF2 A;  3MEG A;  4YOX A;  3HP9 A;  4DV3 K;  4JK8 A;  2ZGY A;  1IJJ A;  1JJ2 M;  2WOM A;  1S1W A;  3VQB A;  3KIO A;  4FWO A;  4I7F A;  4KI6 A;  4NLC A;  4CEE A;  4FZZ A;  4ID5 A;  4CF9 A;  3AVB A;  4CD3 A;  1OH5 A;  1TYQ A;  3ATU A;  4B3T K;  1NM1 A;  4KHY A;  1UWB A;  2GTD A;  4NYN A;  3KK7 A;  4OLB A;  4NCB A;  3CD6 N;  1EX4 A;  3DRP A;  2BTF A;  3LM9 A;  3MN6 A;  1F21 A;  4OKJ A;  1CXQ A;  1ZBU A;  2RKI A;  1S6Q A;  1ESV A;  3PO5 A;  4JHD A;  2O8E A;  4IFE A;  4WQ5 C;  3F2K A;  2BUP A;  4XH1 A;  3DXK A;  3MEC A;  2P9L A;  3FFI A;  3AVK A;  3CCR N;  3O9S A;  1QE1 A;  3MCP A;  1WAJ A;  3KD5 E;  1IO2 A;  4U67 L;  4B9M A;  4K42 A;  3EZW A;  1GOA A;  3LZI A;  3DLG A;  1G15 A;  3E1Y A;  4WQ5 A;  1GLJ O;  1QTM A;  3SAG A;  1RGI A;  4X64 K;  4CGF A;  2OTL N;  4JS4 A;  2YKM A;  1C0T A;  4BRN A;  3DJC A;  3JYT A;  1HNX K;  1HNW K;  5DM6 L;  3VGK A;  4O0I A;  1J54 A;  1RTH A;  4BR5 A;  3SUP A;  3KLE A;  1S1T A;  2V7Y A;  4CD1 A;  5AQQ A;  4WF9 L;  1NK7 A;  1NK6 A;  1VQ5 N;  2HB5 A;  3EE8 A;  2E1Z A;  1R0A A;  2XRI A;  4DQP A;  1KSP A;  3D2E A;  3LP2 A;  3TSU A;  1NK8 A;  2IVN A;  2P9U B;  5CR4 A;  4Z4C A;  4DU1 A;  2E2O A;  2JGU A;  2HHU A;  1N6Q A;  2F96 A;  3WNG A;  4E1J A;  1CZ9 A;  1IKV A;  3OA9 A;  5KI6 A;  4DR1 K;  5EOY A;  5CE3 A;  4KAZ A;  3VMF B;  2I5J A;  3M8Q A;  1EO1 A;  1KFD A;  4BQZ A;  1XHZ A;  4F9O A;  3FZM A;  2FXU A;  2ZD1 A;  4CJF A;  3J8A A;  3VTI A;  4CJ3 A;  3SQ0 A;  1NWK A;  4R5P A;  2KZZ A;  3HXM A;  4H5R A;  3VF2 A;  4KPY A;  4DFJ A;  1NJZ A;  3VA3 A;  4DUY K;  4CK3 A;  3D2F A;  4H4O A;  3H3O B;  4IFY A;  3ZT3 A;  3W0L A;  4I6M A;  3IDH A;  3L4I A;  4CI6 A;  3CJC A;  4GNI A;  1BHL A;  3UIQ A;  5JS1 A;  3VGM A;  4BDY A;  4E0D A;  1YF5 L;  3R1X A;  4CZF A;  2ZM6 K;  1RTJ A;  1RT6 A;  1NGJ A;  5KRS A;  3VQD A;  4H0V B;  4WFB L;  4ISF A;  4ID1 A;  1NGG A;  4LD0 A;  1SL0 A;  4FVU A;  4PY5 A;  4FLT A;  4Y0W A;  4E7J A;  1YTA A;  3TR8 A;  1GOB A;  4CGJ A;  3SJH A;  4ELT A;  1RCH A;  4B1V A;  2ASM A;  3THV A;  4L3Q A;  3OYK A;  3ZSX A;  1JLG A;  1Q8I A;  2ASP A;  4OPA A;  1BOT O;  1HYZ A;  5BN9 A;  3SI6 A;  3R9P A;  4FJG A;  4M42 A;  4FLU A;  3IUC A;  3HM9 A;  1T3V A;  3LWM A;  4IFV A;  3MN5 A;  5DM7 L;  1GLL O;  3CQ8 A;  3AY9 A;  3CI5 A;  4QS7 A;  4CJU A;  3TTD A;  3QEX A;  1WSI A;  4RW8 A;  4CFA A;  2NRW A;  2E4L A;  1VSE A;  3P1G A;  5C0Y A;  4AH9 A;  4M7X A;  4DTJ A;  4BRI A;  3V1Q A;  3NGI A;  2OPP A;  1KC8 O;  1B92 A;  2ASO A;  1D5A A;  3GOI A;  1XHX A;  2B4J A;  3L2W A;  2F9T A;  4IO9 L;  3HST B;  3I55 N;  3WUH A;  4HUG A;  5GAH P;  4QS8 A;  5AQP A;  3ZET A;  4OPJ A;  2Z1H A;  4BR9 A;  5HL7 L;  4IKF A;  2RE2 A;  4IJA A;  4BRG A;  2OZS A;  2OPS A;  4CJR A;  2NRX A;  1Q9X A;  1KVC A;  4CEA A;  2CGK A;  1TAQ A;  4Z4F A;  4XIU A;  1BGX T;  4FZY A;  4C1N K;  3SUQ A;  4OLA A;  4CGH A;  5KPZ A;  3HVT A;  4E7I A;  1NOZ A;  2HHW A;  3OJS A;  4CJP A;  3AA2 A;  3HPH A;  1OH6 A;  3G4S N;  3BGR A;  1NGE A;  4CZH A;  4BWJ A;  4CHO A;  1BA0 A;  4DSE A;  3HZ6 A;  4UQG A;  4FJI A;  4Z0U A;  3K9J A;  2W41 A;  3A5O C;  3MED A;  4CED A;  3EL2 A;  3GG4 A;  5AQW A;  1RNH A;  4NXM K;  3R6M A;  4CZK A;  5GAE P;  1D8Y A;  2ZGZ A;  4LSN A;  1J5E K;  1TAU A;  2GV9 A;  1RBV A;  2AJQ A;  2HF3 A;  3B6O A;  4K8Z A;  1YXQ A;  3MN7 A;  4FJ9 A;  1FJG K;  4EHT A;  2OPQ A;  4O8U A;  4TSX A;  1JLE A;  3M5R A;  1T8E A;  2KZM A;  1UAX A;  4LC9 B;  4DTN A;  1K73 O;  3OY9 A;  1HYS A;  1BCM A;  2QWR A;  3T69 A;  3CFO A;  4KH4 A;  3CCJ N;  4YOU A;  1W7A A;  4DV6 K;  2YHA A;  1IBM K;  1B9F A;  3VQ6 A;  3THX A;  1LAV A;  4FLV A;  4JYA K;  3QNN A;  4CF0 A;  2QTD A;  4BC2 A;  5AQJ A;  5AQS A;  1NLV A;  1YTU A;  1TL1 A;  4KTQ A;  5M1O A;  1U04 A;  4CFB A;  3J7A P;  1X9M A;  4N56 A;  3S41 A;  4FWR A;  3GBT A;  1X9S A;  1LWC A;  3HM8 A;  1N33 K;  3NF8 A;  4FLY A;  5M1K A;  2A6A A;  3H6E A;  4PL8 A;  1NBW A;  2RHK A;  1C0U A;  1VQL N;  3CCV N;  2VCP A;  2OPR A;  3AO5 A;  1KAX A;  3RVC A;  3VEY A;  3R3L A;  3B6P A;  4H4M A;  3EN9 A;  4BRK A;  3GDQ A;  3L2Q A;  4K43 A;  5J1E A;  4KV8 A;  2GBZ A;  4NCG A;  4RCH A;  3H3N O;  3ATV A;  1SS6 A;  5HRP A;  1HMV A;  3UKR A;  4LF5 K;  4YOW A;  2E6L A;  3GE1 A;  1U49 A;  3PLA A;  3BF3 A;  4DTM A;  3CC2 N;  1BIZ A;  4IG3 A;  3EYZ A;  4EHU A;  2X78 A;  2QM1 A;  3OTO K;  2D4W A;  2QWN A;  3SMS A;  2XO7 A;  1T6D A;  3F73 A;  3SPY A;  2UXD K;  4O0J A;  1FK9 A;  2VGM A;  3QIO A;  1BIU A;  4J2D A;  1KVA A;  2O8C B;  1ATS A;  4DLG A;  4ISE A;  1S1X A;  2X6N A;  2WUS A;  2YNG A;  4F8R A;  3KJV A;  4GKJ K;  1WAF A;  1TGO A;  3B8A X;  1BL3 A;  4RTF D;  1T6C A;  3VF6 A;  2KHO A;  1XNQ K;  3SBG A;  2P1J A;  4BRC A;  3P31 A;  4FJK A;  3FZF A;  2V52 B;  4PKG A;  4JI0 K;  3AAP A;  1E4G T;  4LFC K;  3CYM A;  1YAG A;  3UB5 A;  3VQE A;  2VYP A;  1C6V A;  1U4B A;  4JV5 K;  1J6Z A;  4BRM A;  4Q5V A;  3LP1 A;  4IOA L;  4YDU A;  3MMV A;  3O3H A;  4WQ4 C;  1N34 K;  2DFF A;  3QB0 A;  3KLF A;  4RG8 A;  1MWM A;  3A5L C;  2G8K A;  3HT3 A;  4KRE A;  4BC3 A;  3K9K A;  3RSE B;  3ENO A;  4B08 A;  3A2F A;  3O4N A;  2FLO A;  4DCH A;  1KLN A;  5CZ2 A;  2UUC K;  4DTX A;  3ID6 A;  1SZ2 A;  3VES A;  2KKZ A;  3NFA A;  4CGI A;  4DS4 A;  1LWE A;  2W40 A;  3JS6 A;  4KH5 A;  1L3T A;  4Z4G A;  4B1W B;  3M8S A;  3O1B A;  2AP1 A;  1DGK N;  1GLD G;  4DLE A;  3DYA A;  4N76 A;  1ATR A;  4CZE A;  4GY2 B;  4A61 A;  2RPI A;  3C6T A;  2E6M A;  1SKW A;  3ZSQ A;  2X74 A;  3V1O A;  3DOL A;  4CF8 A;  5C42 A;  3KWG A;  5HRO A;  2QXL A;  3OVN A;  1SUQ A;  3U3Y A;  5CYQ A;  3LAM A;  4OPH A;  1W97 L;  3CCL N;  1S22 A;  4EFH A;  4DFP A;  2YNF A;  4KTW A;  4JKG B;  5MLC Q;  3LWL A;  4CIE A;  1VSH A;  3G0Z A;  3QML A;  4JKD A;  2KFN A;  5KTQ A;  3QO9 A;  1HX1 A;  5C24 A;  5KQD A;  1O1W A;  1Z05 A;  4A2A A;  4GV6 A;  4H5T A;  2VG5 A;  1ZXO A;  4B1Z A;  4X62 K;  3PV8 A;  4I9Q A;  2VG7 A;  4C8K A;  3DXM B;  3WXI A;  1A5V A;  2P9I B;  5EY4 A;  3NF7 A;  5TKW A;  4CJT A;  5AQU A;  4BRA A;  4B3O A;  3G25 A;  1U2V B;  3U9D A;  5HRN A;  2YJE A;  4M3Z A;  2AA4 A;  3ULE A;  4JLH A;  4FSV A;  3J80 O;  2E2N A;  3VPZ A;  2YNH A;  3AVN A;  1RDD A;  1RDB A;  3GL1 A;  4BRD A;  3VQQ A;  2A3Z A;  2ZJP L;  3DWL A;  2NLX A;  3QER A;  3HOT A;  3OYI A;  3KK3 A;  3BF1 A;  4AQY K;  4LH5 A;  4BVO A;  3UKU B;  2KTQ A;  3EY1 A;  1GOC A;  4W5R A;  1DLO A;  1RT7 A;  4GVE A;  5JLF A;  3K5N A;  1ASW A;  1NMN A;  1HNI A;  4DV4 K;  1RBS A;  3K5O A;  4BE1 A;  4C8M A;  1JLQ A;  5KGW A;  1VQP N;  3THW B;  1I39 A;  1VQN N;  1JL2 A;  1WSG A;  4DR7 K;  1LW2 A;  1QSL A;  4M3Y A;  3MAQ A;  2YJF A;  2A42 A;  4YHH K;  1G99 A;  4UY8 O;  1MA9 B;  2P9K B;  3CCQ N;  3TAG A;  4BRE A;  4F2S A;  1VSK A;  4B8C A;  3D45 A;  3CXC M;  1KRP A;  3TAM A;  3U3G A;  4LSL A;  3SQ4 A;  3AO2 A;  4M3U A;  4W5Q A;  1HRH A;  3HPO A;  4BC4 A;  5C12 A;  4DU3 A;  4K41 A;  4Y1D A;  1CLQ A;  3K5L A;  4CZM A;  1TUY A;  4DV2 K;  2YV0 X;  1X9J A;  3AVI A;  1WBB A;  1ITG A;  1U48 A;  1HNZ K;  5AR0 A;  1NJW A;  3Q7C A;  4AIL C;  1ILY A;  3MWP A;  2OZM A;  1YVU A;  4QS9 A;  1BO5 O;  4BDZ A;  4C1N I;  3WEE A;  4N5S A;  3S3O A;  1YJ9 N;  3OYH A;  5CY4 A;  5BRE A;  1RBT A;  3CFP A;  3WXJ A;  2FF6 A;  3FGU A;  2QEX N;  3DOK A;  3L3V A;  4DU4 A;  3BEX A;  4JHD B;  2O8E B;  5A2Q O;  3RMB A;  5DK5 A;  1TKT A;  3VF4 A;  3H45 C;  3NCI A;  3NBP A;  3DXK B;  2P9L B;  2PFU A;  3U8X A;  4MFB A;  4PQU A;  3G71 N;  3TWH A;  2YCH A;  4FM1 A;  4KBO A;  1D4X A;  1REV A;  3QLH A;  4YOT A;  5AZI A;  5FPM A;  1CZA N;  4KO0 A;  2BGG A;  4CBU A;  3SUN A;  2FBY A;  3SAH A;  3V4I A;  4HUF A;  4DR5 K;  2NRR A;  3C6U A;  4CEC A;  3KLH A;  3PX6 A;  2HHH K;  3CJ7 A;  1VQ4 N;  1C1A A;  2NRZ A;  5E26 A;  5C10 A;  1QZ6 A;  3NGZ A;  2EX3 A;  3T7Z A;  4AHU A;  4DB3 A;  3O4Q A;  3S3N A;  4DV0 K;  3D2E B;  1RBR A;  2DFH A;  4B1Y B;  2ZF5 O;  1WB9 A;  3OS0 A;  1RBU A;  2WON A;  3ZSO A;  4X66 K;  2GEM A;  1BCO A;  4PHT X;  4E7H A;  5JVG L;  1NK4 A;  3PX0 A;  3L3U A;  3E9O A;  3U4L A;  2O8F B;  2UU9 K;  2P9N B;  4BWM A;  3LDS A;  3AA4 A;  4O5F A;  4FK0 A;  5I3U A;  4CEO A;  1BDG A;  1IG9 A;  3OHR A;  1JLA A;  2NRV A;  1ASU A;  3I8D A;  2UUA K;  5AQM A;  2VQE K;  1NJX A;  1RTI A;  3VOV A;  4BR7 A;  3OYE A;  5J2Q A;  3HYF A;  3O5B A;  4I6M B;  5TKY A;  4F3T A;  2DY4 A;  4M45 A;  1EP4 A;  1S9G A;  4FW2 A;  4RW6 A;  2IDO A;  3I56 N;  2NRT A;  4MO4 A;  4B9U A;  1D9D A;  2HHQ A;  1WSH A;  3AVL A;  4Z94 A;  3DLK A;  1OVY A;  4ISG A;  5K14 A;  4BGB A;  4E89 A;  3I0R A;  2XHB A;  1YIT N;  4J2A A;  1VQ6 N;  2O8D B;  2YHB A;  4LFA K;  3ZSZ A;  3ZX2 A;  5HBM A;  3AA3 A;  4FYD A;  4JNE A;  5AQF A;  4E7L A;  2OA8 A;  3J7Z O;  3RRG A;  5EXW A;  1QQM A;  2OAN A;  2P9P A;  1KQS M;  3E9L A;  2G8V A;  4H0Y B;  2F7T A;  5KQ8 A;  4FJL A;  4ILH A;  4H0P A;  1QSS A;  4FZX C;  3LDO A;  1HKG A;  3LDQ A;  5J2M A;  1JKH A;  1LAW A;  3MEE A;  1NG9 A;  3TAR A;  4PKI A;  5H1S Q;  1X3N A;  2QXF A;  4DR2 K;  3CJB A;  3H1V X;  4A2B A;  4JI8 K;  3KD1 E;  3R8E A;  5AQT A;  4C8O A;  4EP5 A;  5AQI A;  1WSE A;  4CJ7 A;  3DAW A;  3HVR A;  3ITH A;  2W6L A;  3LP0 A;  1IBK K;  1M90 O;  1NGF A;  4CGD A;  4CFD A;  1SV5 A;  3FZK A;  2Q1N A;  3WNH A;  3VEN A;  3O9T A;  3BDP A;  2Z1J A;  3SYZ A;  2BAN A;  2F8T A;  1U45 A;  3K57 A;  1Q7Y O;  1HNV A;  5AQK A;  3OYL A;  2YNI A;  4YNQ A;  3FFK B;  3QEV A;  2QWL A;  4A5A A;  3LAN A;  1N32 K;  4O5B A;  1VSJ A;  4HCC A;  4JKE A;  1NMD A;  2A1S A;  1UA0 A;  3KK1 A;  3C65 A;  4GV3 A;  4A57 A;  4DSI A;  1CXU A;  4CK1 A;  1S6P A;  1X1P A;  3M3Z A;  1DEJ A;  3SK3 A;  4KHS A;  1E4F T;  4AHR A;  4M41 A;  2Q97 A;  4IZ9 A;  4CER A;  3U9Z A;  4DQI A;  3I33 A;  4CFC A;  1EKE A;  1YJW N;  3O80 A;  3DMJ A;  5GIO A;  3KVG A;  4FJN A;  5AQH A;  4OGC A;  1HR0 K;  1VQO N;  2OYQ A;  3VQP A;  5AQN A;  3KK2 A;  1NGD A;  3L2V A;  3HK2 A;  1SAZ A;  2HHT A;  2G8U A;  1TVR A;  2P9S A;  1J9A A;  4BR4 A;  3VQ5 A;  3EZ5 A;  4G1Q A;  1ZC6 A;  4IDH A;  5AFU H;  1NGA A;  2ZWH A;  5EX5 A;  1EXQ A;  4KRF A;  4CF2 A;  1XC9 A;  2RN2 A;  4IJN A;  1VQ7 N;  3N4Q A;  3VEV A;  4DTS A;  2GEL A;  1YIJ N;  4I2Q A;  2QWP A;  3OBY A;  1LOT B;  1L3V A;  2YHW A;  3CQX A;  3M8R A;  2E8A A;  4IOC L;  4JKB A;  3WXK A;  3VA0 A;  4CZI A;  4B9V A;  4RW9 A;  1RT1 A;  4DSK A;  2EWS A;  2QWO A;  3C94 A;  5HRR A;  4DTU A;  2PY5 A;  2VWJ A;  3IS9 A;  1BUP A;  5J2N A;  3MN9 A;  3LAL A;  1NGI A;  1WUA A;  3AVC A;  3RMC A;  3TI0 A;  3LDL A;  4ZTF A;  4DTO A;  1T03 A;  1W0H A;  2VWB A;  3PUF A;  2FC0 A;  4DV5 K;  3C7N B;  1TKD A;  1QHT A;  2OTJ N;  3NF6 A;  3NE6 A;  3LPU A;  2Q0R A;  2DFE A;  3ZLJ A;  4I2P A;  4H5W A;  3S9H A;  4YFU A;  5B8H A;  4H5N A;  1QS4 A;  3ZT2 A;  3IG1 A;  3CG7 A;  4JN4 A;  2P5O A;  1Q86 O;  3ZEU A;  3ENH A;  5GIP A;  4BY9 C;  3HL8 A;  2PBD A;  4LF9 K;  4KHW A;  3NDK A;  2E2P A;  3CF5 L;  4CHQ A;  3MK6 A;  1SL1 A;  3ZYY X;  4B9N A;  1JXB A;  1LWF A;  3CQY A;  1ZBL A;  3AAR A;  3RWU A;  3AAQ A;  3ZSW A;  5AQG A;  4BAC A;  5AZJ A;  3L2R A;  1W2B M;  4V19 S;  4IXC A;  4J2B A;  3RRH A;  4OO1 J;  3BUZ B;  4EP4 A;  4B9S A;  4FXD A;  1HPZ A;  1MU2 A;  3F5T A;  2XY6 A;  1C0M A;  1YVN A;  2D0O A;  3H08 A;  3OW2 M;  1RDU A;  1TK5 A;  1VHX A;  4B1U B;  5LMU K;  3RMA A;  3VEO A;  4C8N A;  4E7K A;  2NRH A;  4LF6 K;  4CES A;  1TK0 A;  5SZT A;  3WT0 A;  4CZL A;  4CZJ A;  1QVG M;  5KRT A;  3PIP L;  4FJH A;  3AA5 X;  3QNO A;  2F9W A;  4FWQ A;  4RWT A;  4CEZ A;  1BG3 A;  4ICL A;  4YDU C;  3QFU A;  3V9X A;  4XH4 A;  3SUO A;  4DHY A;  2A1R A;  1K8K B;  2BE2 A;  4KFB A;  2GUI A;  5CZ1 A;  4BE0 A;  4FJ8 A;  5ADX H;  4DFK A;  1OVQ A;  3BY5 A;  3PSF A;  4FWM A;  3WNE A;  2E1Y A;  3SAF A;  3CCM N;  2H3G X;  1YUW A;  3EE9 A;  4CJ5 A;  1ZBH A;  4CBX A;  1L3U A;  3BZC A;  5E84 A;  1RDC A;  3CJ1 A;  4NXN K;  4M7Y A;  5FDL A;  3J81 O;  3OYN A;  4DV1 K;  1RDW X;  3MX5 A;  1C0G A;  1GLF O;  3SV3 A;  1TKX A;  4JI5 K;  5M1F A;  3EKU A;  3QIN A;  1BQN A;  1HJR A;  1SL2 A;  3DLB A;  1HKC A;  1Q82 O;  3IMX A;  1UA1 A;  4CF1 A;  3KWI A;  2V7Z A;  4HVJ A;  2HOE A;  1EQY A;  4CIG A;  1X3M A;  3N4P A;  4JI1 K;  2HBL A;  4N47 A;  4BG9 A;  1DKG D;  3MX2 A;  3D0P A;  1S72 N;  5BR8 K;  5AQR A;  2Q3S A;  3AVA A;  3C6H A;  3BP8 A;  5I9E B;  1NGC A;  2CH5 A;  3OBW A;  3TAQ A;  4HTU A;  4PUO A;  1I3A A;  2YHY A;  3E9P A;  3A8Y A;  2PZS A;  1S9E A;  5HLF A;  2VG6 A;  4ELU A;  2W42 A;  3VQA A;  4FLW A;  3V9S A;  1TL3 A;  4B3M K;  2PAV A;  4MO5 A;  4YY3 K;  3PY8 A;  2D5R A;  4CCH A;  2G8I A;  3V6D A;  3KLG A;  1C0F A;  2LSN A;  3C0B A;  3ULE B;  4BG8 A;  5BPL A;  4AHT A;  2HW3 A;  1D9F A;  1WLJ A;  4IO8 A;  3MXI A;  3K0S A;  3KTQ A;  2P51 A;  2I7N A;  2IS3 A;  4JK9 A;  3P38 A;  4B9T A;  5J2P A;  3HBT A;  4Y1C A;  5AQZ A;  3HJF A;  1XC3 A;  3TAP A;  2HMP A;  1J5O A;  2ZQB A;  3T3F A;  3ID8 A;  2V51 B;  4CEQ A;  1RTD A;  1DTT A;  2Q2R A;  1GLE G;  4FK2 A;  4G9Z A;  1VAZ A;  2DPN A;  3SCX A;  3CMA N;  1P8Z A;  4FO0 A;  4DQS A;  1OH7 A;  1MDU B;  4KTZ A;  1T44 A;  4K8X A;  4E19 A;  4EIA A;  4CJV A;  1JXE A;  3WXM B;  4OGE A;  3H46 O;  3OYF A;  2O8B A;  4FVM A;  2UUB K;  4O4G A;  3AO3 A;  3EKS A;  3EO3 A;  1TK8 A;  4CK2 A;  4CIF A;  4F3O A;  3O1W A;  1VRT A;  1Q18 A;  2Q36 A;  5DMR A;  4ELV A;  3OJU A;  1M1K O;  4L8R B;  4WCE L;  4KKO A;  1DTQ A;  3OS2 A;  2P9I A;  1VQK N;  4GVM A;  4CJK A;  1JL1 A;  1KAY A;  4FK4 A;  1NKC A;  1U2V A;  2XY5 A;  1WNS A;  3OYM A;  4BRO A;  3T19 A;  1ZBF A;  1Q81 O;  4GW6 A;  1V4S A;  2Q31 A;  5AFU A;  1JLC A;  1NJY A;  3SQ2 A;  1KAZ A;  2ETJ A;  1CZB A;  4CHP A;  3ULD A;  3DLH A;  4BE2 A;  3W3D A;  4YOV A;  3HI0 A;  1WSJ A;  3NAE A;  4LF7 K;  4DQQ A;  3WEE B;  5LY3 A;  5FRO A;  5SWM A;  2PYJ A;  3OYA A;  3DLR A;  4IEE A;  3PIO L;  1HLU A;  4F2R A;  1RT3 A;  5BN8 A;  2CGL A;  2KFZ A;  3I8B A;  1BI4 A;  4CW7 B;  1VSI A;  1RIL A;  1TYQ B;  4E1N A;  4B8A B;  2GUP A;  3CER A;  4DS5 A;  4JD2 A;  3LDN A;  4YOY A;  5BPM A;  1XQS C;  4H5V A;  4CJ4 A;  3THY A;  4CJL A;  3Q7B A;  1IBL K;  4U7B A;  4O44 A;  5AZI B;  3E66 A;  3K5M A;  1Z6R A;  4IG0 A;  4B9Q A;  4DKW A;  4KB0 A;  3NHG A;  3C95 A;  3TAB A;  3QDK A;  4FJX A;  2IAJ A;  3J7Y P;  3M6G A;  5I42 A;  4M3T A;  1C1B A;  3VEZ A;  1K8A O;  5AQL A;  5JLH A;  4DV7 K;  1HQU A;  4FL9 A;  3A5N C;  4IOX A;  1Y64 A;  4PA1 A;  5CYM A;  4MDA A;  1IKY A;  2HNY A;  3PSI A;  3S3M A;  4JI2 K;  1YHQ N;  3CCU N;  4PWD A;  4JI7 K;  1SKS A;  3CJ9 A;  4CEB A;  4DR3 K;  4I9L A;  3P4I A;  1WBD A;  2HMI A;  1SQK A;  4CE9 A;  2BDP A;  3P83 D;  4WE1 A;  5EVZ A;  4NLB A;  4FWS A;  1ZBS A;  4FJ5 A;  1ATN A;  3VQC A;  1GLB G;  4DUZ K;  1NKB A;  1NK9 A;  1S1V A;  4W5N A;  4BGA A;  1NKE A;  1C1C A;  4KHN A;  5FRN A;  3DLL L;  2O4G A;  3VQ7 A;  4H0X B;  1HJO A;  3SQ1 A;  3NGY A;  4IDK A;  1N8R O;  2NZT A;  5BRD A;  1BU6 O;  2D0P A;  4LF4 K;  3SPZ A;  2YKN A;  2FBT A;  4LY7 A;  1XNR K;  2IC3 A;  3P5J A;  3KHY A;  4BVP A;  2QWM A;  2FSK A;  3P39 A;  3D2F B;  3BZK A;  1NOY A;  5ADX A;  4DQR A;  3C6A A;  4A5B A;  1K6Y A;  1VSD A;  1EET A;  3QIC A;  3QEP A;  4F4K A;  1QSY A;  4BR0 A;  4JKA A;  2DTU A;  1HYV A;  3ZSY A;  3H1Q A;  4DR4 K;  3OYB A;  2O8F A;  1JCF A;  1KFS A;  2P9P B;  1FKO A;  2VQF K;  4FLZ A;  5LJV A;  2JLE A;  2P9N A;  4J8F A;  3WNF A;  4Z4H A;  4DFM A;  2ZE2 A;  1IH7 A;  3WQU A;  1P90 A;  4CVN E;  2G8F A;  2P9U A;  5AQY A;  3RMD A;  4R79 A;  4DSL A;  4DSJ A;  1WN7 A;  4AHC A;  4B3S K;  1QHA A;  4O8K A;  5JMV A;  2D0A A;  4CJE A;  2HF4 A;  3QEI A;  4BC5 A;  2QKB A;  3DRR A;  1ZYQ A;  1WSF A;  1GLC G;  1LCU A;  1S5J A;  3TSQ A;  1I94 K;  1EWQ A;  1FXX A;  3HTV A;  1VRU A;  2GWK A;  4DTP A;  3T1H K;  4CZG A;  4AM7 A;  2HBM A;  4JKF A;  3DI6 A;  2R7Y A;  2NUB A;  1JCG A;  3E01 A;  2O8D A;  1V4T A;  1R59 O;  3O3F A;  3AV9 A;  4H0T B;  5FLX O;  3V81 A;  5GAD P;  4PKH A;  3F9K A;  5LMN K;  1B9D A;  3A5M C;  3K2P A;  1U47 A;  1RT5 A;  3TU5 A;  3FZL A;  4NO7 A;  4FPB A;  2YX6 A;  1IKX A;  3VTH A;  1JLB A;  1QQO A;  4DF8 A;  2KLA A;  1XI1 A;  4AHS A;  3KZB A;  2WTU A;  3G10 A;  5LJW A;  2QI2 A;  2E2Q A;  5AQV A;  2WFB A;  3OYJ A;  3AVJ A;  1NGH A;  3ZET B;  3RTV A;  4MQ3 A;  1A5W A;  5F2R A;  3QES A;  3A0I X;  3FR0 A;  3IKM A;  3DRS A;  2F4V K;  2FBX A;  5HP1 A;  3AO4 A;  3HOS A;  5C2F A;  3CM6 A;  2Q0U A;  2J4R A;  3VER A;  5JVH L;  4YOR A;  3VEX A;  5E41 A;  3U6F A;  3SMP A;  3O6W A;  3AGK A;  1HQE A;  3TTC A;  4BRH A;  4CHN A;  4BRP A;  5ELZ A;  4OX9 K;  4K25 A;  1IKW A;  4IEI A;  5T7B A;  2D1K A;  3QBX A;  2P9S B;  4BRL A;  4DQ8 A;  1ZBI A;  2UYT A;  2UXC K;  3CC4 N;  1XMO K;  4JI3 K;  1LW0 A;  2I7P A;  4FCY A;  2G8W A;  3CME N;  3IFR A;  3ALY A;  4DWI A;  3K58 A;  4NYF A;  4B3R K;  3TAF A;  4BRF A;  3TSP A;  1TV6 A;  1UOC A;  4WYB A;  4ZTJ A;  1VQM N;  4E1M A;  1H1V A;  3VQ4 A;  3OYC A;  4XH5 A;  4JRQ A;  1JCE A;  4ZHR A;  2KW4 A;  1MWK A;  2JWL A;  3MCA B;  3VEW A;  5CHI A;  4QOZ B;  4O55 A;  1L3S A;  3IRX A;  2XY8 A;  5JIC A;  2A41 A;  4WFN L;  1U6Z A;  1RFQ A;  4FJJ A;  2X6S A;  3ASM A;  4IWV A;  3FLC O;  4DG1 A;  1VQ9 N;  2ITG A;  1LV5 A;  3JAM O;  3ISN C;  2GWJ A;  5EU7 A;  3TTF A;  3QFP A;  2HVI A;  3VGL A;  4JK7 A;  2ITM A;  3THX B;  3UE5 A;  3OS1 A;  2HNZ A;  4NCA A;  3VET A;  4B9L A;  1VSF A;  1FKP A;  1O13 A;  1S3X A;  4FWP A;  2HBJ A;  5FRM A;  5KPR A;  1OKJ A;  5FPE A;  4CJS A;  1WOQ A;  5IT9 O;  3CM5 A;  3LDP A;  3ZSR A;  4W5O A;  2ZJR L;  4K0K K;  4CHY A;  1YJN N;  5BR9 A;  4X65 K;  2QKK A;  3ZEU B;  1EWR A;  2QA4 N;  3EEQ A;  3VN5 A;  5BPN A;  4FJM A;  4OPK A;  4DF4 A;  1NK5 A;  3JSM A;  3L6Q A;  4HWI A;  3AVH A;  3UKR B;  2QWQ A;  1VK0 A;  2YHX A;  4BR2 A;  4OJR A;  4AM6 A;  5AZJ B;  3G6E N;  3ZT1 A;  4Q0B A;  4H0O A;  1YI2 N;  3O4W A;  2HND A;  1QQN A;  1HPM A;  4BRQ A;  3NH2 A;  4FWN A;  5FPD A;  2A5X A;  3QBW A;  3DLE A;  4B1X B;  2UXB K;  2VGN A;  2HHS A;  4CJW A;  3I0S A;  4IBN A;  1IG8 A;  2B6A A;  3CHW A;  3TAN A;  2ATQ A;  5AJ3 K;  3C7N A;  3MWT A;  4W5T A;  1W9H A;  2IOC A;  4OKE A;  4KHU A;  2Z1I A;  2FF3 B;  3CIP A;  3D7E O;  3O9R A;  2FSN A;  1TKZ A;  4AF1 A;  2YI1 A;  1HUX A;  3AGR A;  1XMQ K;  1XUP O;  3SV4 A;  4M3W A;  4AHV A;  5BRH A;  5F1X A;  3V9U A;  2Y1I A;  2F8S A;  2D0B A;  1Z25 A;  4N41 A;  3LZJ A;  4JS5 A;  3ZT0 A;  1KCF A;  1HKB A;  3NH0 A;  4FPA A;  5HOO A;  3IAY A;  3FZH A;  3O08 A;  4MDB A;  4C8L A;  3AVF A;  4CEF A;  3QET A;  4EAH D;  4JRP A;  4FOE A;  4CJQ A;  3ZT4 A;  1K9M O;  4HHT A;  3V9W A;  1KD1 O;  1DT9 A;  1RT2 A;  5M1N A;  4FOI A;  3CCS N;  4M63 C;  3V1R A;  5AQX A;  4H8K A;  3PX4 A;  4QCL A;  3LAK A;  1SKR A;  3M1F A;  2WC9 A;  4RW7 A;  3QIP A;  2O8C A;  2HHX A;  4E3S A;  3TAE A;  3FE1 A;  1VSM A;  1ASV A;  2HVH A;  2W6K A;  3HSC A;  4FWL A;  4LH4 A;  2O4I A;  3L0Q A;  4DR6 K;  4FLX A;  1Y97 A;  4LF8 K;  5GIN A;  3ENB A;  4C23 A;  4GMJ B;  1BWF O;  1RDA A;  4JI4 K;  5LL6 Z;  4ILG B;  3KKS A;  1K8K A;  3AO1 A;  4MLH A;  5HRS A;  3HRG A;  4KI4 A;  5M1Q A;  3CCE N;  3TPQ A;  1N5Y A;  3ZCM A;  1QQC A;  3VQ9 A;  4KHQ A;  2IGI A;  2PYL A;  3CET A;  3NMU A;  3CPW M;  2CH6 A;  4JEP A;  4KB1 A;  3QEW A;  4CBW A;  3L2U A;  4WQ4 A;  3WXL A;  1Z26 A;  4JAX A;  3NF9 A;  1Q9Y A;  1XWL A;  1VSL A;  4HUE A;  1QZ5 A;  5C25 A;  4NB4 A;  5JS2 A;  3K59 A;  3CFR A;  4WFA L;  1OH8 A;  4EZ6 A;  4FM0 A;  3L8B A;  1N36 K;  3LL3 A;  1BIS A;  3F9M A;  3RSE A;  4A59 A;  1T7P A;  5D3G A;  3NVK A;  1BQM A;  2A40 A;  2B5J A;  5KGX A;  1S1U A;  3PO4 A;  1NJI O;  1KTQ A;  5FPN A;  4FW1 A;  3AVG A;  3CC7 N;  3VQ8 A;  1FW6 A;  5GAG P;  3MXM A;  1YT3 A;  5M1P A;  2WBN A;  2Z1G A;  4DSF A;  3L4Q A;  4HTL A;  4OVL A;  2O8B B;  2HBK A;  4CHZ A;  4JKH A;  3HP6 A;  3O8M A;  3LPT A;  1IV0 A;  1L5U A;  3D6R A;  3O9Q A;  4OKK A;  1NGB A;  5AQO A;  5C2D A;  4J2E A;  1VQ8 N;  4EZ9 A;  4KH6 A;  4XEI A;  4LFB K;  4GKK K;  3O3G A;  4H03 B;  4FM2 A;  4JKG A;  3ZX3 A;  5BRF A;  4DTR A;  3LP3 A;  5F0X A;  4Z4I A;  2JWK A;  2E5L K;  3SBT A;  1NNE A;  4GV9 A;  2Y1J A;  3NVM A;  3O9U A;  2OCE A;  4A62 A;  4Z4E A;  2NNW A;  3SZ2 A;  3MXJ A;  1A5X A;  3DXM A;  4JKC A;  2ZJQ L;  2IVP A;  4KHP K;  2IVO A;  5IWA K;  1JLF A;  2FSJ A;  2XY7 A;  2HHV A;  4RW4 A;  2CGJ A;  2GX9 A;  2QK9 A;  3CPE A;  2IIR A;  2QW9 A;  4BQL A;  3AVM A;  3DM2 A;  1BI4 B;  2E20 A;  3SLC A;  2HST A;  1NK0 A;  4M3R A;  3ZSV A;  3HPG A;  1QVF M;  2FBV A;  3RR7 A;  4DMN A;  3T1Y K;  4ILJ A;  2VWK A;  3MDQ A;  4FJ7 A;  4JI6 K; 
#chains in the Genus database with same CATH homology
 2UXB K;  4DR4 K;  1HNX K;  4LFC K;  4LF6 K;  1HNW K;  2UXC K;  1XMO K;  4JI3 K;  4JV5 K;  2VQF K;  4DR5 K;  5AJ3 K;  4B3R K;  2HHH K;  4CVN E;  4AQY K;  4DV6 K;  1N36 K;  1N34 K;  4DR2 K;  3J7Y P;  1IBM K;  4JI8 K;  4JYA K;  4B3S K;  4DV7 K;  1XMQ K;  4DV0 K;  1IBK K;  4DV4 K;  4X66 K;  2UUC K;  3J7A P;  4DR1 K;  1I94 K;  2UUB K;  1N33 K;  4DR7 K;  4JI2 K;  4DV3 K;  3T1H K;  4YHH K;  4NXN K;  2UU9 K;  4JI7 K;  3J81 O;  1N32 K;  4DV1 K;  3JAM O;  4DV5 K;  4DR3 K;  4DUY K;  5FLX O;  5LMN K;  4JI5 K;  4LF5 K;  4DV2 K;  4LFB K;  2UUA K;  4GKK K;  4B3T K;  1HNZ K;  2VQE K;  4DUZ K;  2E5L K;  3OTO K;  5IT9 O;  4K0K K;  2ZM6 K;  2UXD K;  4LF7 K;  4JI1 K;  4LF9 K;  4X65 K;  5BR8 K;  4KHP K;  4NXM K;  4LF4 K;  4DR6 K;  5IWA K;  4X62 K;  4LF8 K;  2F4V K;  1HR0 K;  5A2Q O;  1J5E K;  1XNR K;  4JI4 K;  4CW7 B;  4LFA K;  5LL6 Z;  4GKJ K;  4V19 S;  1FJG K;  4B3M K;  1XNQ K;  3T1Y K;  4X64 K;  4YY3 K;  4OX9 K;  3J80 O;  4JI0 K;  5LMU K;  1IBL K;  4JI6 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...