4V19S

Structure of the large subunit of the mammalian mitoribosome, part 1 of 2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
143
structure length
143
Chain Sequence
PVENEAVAPEFTNRNPRNLELLAVARKERGWGTVWPSREFWHRLRVIRTQHHIEALVEHRNGQVVVSASTREWAIKKHLYSTRNVVACESVGRVLAERCLEAGINFMVYHPTPWEAASDSIKRLQHAMTEGGVVLREPRRIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords MITORIBOSOMAL PROTEIN BL27M, MRPL27
publication title The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
pubmed doi rcsb
total genus 25
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4v19S00
4NXNK 4B3TK 1N33K 4X65K 4JYAK 3T1YK 2HHHK 1XMOK 1N32K 4JI7K 4LF9K 2VQFK 4JI4K 4DUYK 3J7YP 4LFAK 4B3RK 4DR5K 5AJ3K 1I94K 4JI5K 4LF8K 4DR1K 1HR0K 4LF5K 5IWAK 4AQYK 4V19S 1XNQK 4DV6K 4JI2K 4B3MK 2UXCK 4KHPK 4JI1K 4YHHK 4X64K 3J81O 4K0KK 5BR8K 2UUBK 4JI0K 4YY3K 5FLXO 4DR6K 4DV2K 1IBLK 4DR7K 5A2QO 4GKKK 3T1HK 3OTOK 2UXDK 4DR4K 4CW7B 5LMNK 3JAMO 2F4VK 4DR3K 5LL6Z 4DR2K 1N36K 1J5EK 4LFBK 4JI8K 4X62K 4DV7K 4B3SK 2ZM6K 4DV4K 2E5LK 4DUZK 4X66K 1IBMK 4DV3K 4OX9K 4LF6K 5LMUK 1HNZK 1N34K 4LFCK 5IT9O 1FJGK 4DV1K 4LF4K 4NXMK 2UXBK 4CVNE 4DV0K 4JV5K 2UUCK 1XMQK 1HNWK 2UU9K 1XNRK 3J7AP 3J80O 1HNXK 4LF7K 2VQEK 1IBKK 4DV5K 4JI3K 4JI6K 2UUAK 4GKJK
chains in the Genus database with same CATH superfamily
3I0SA 3TTFA 3WXLA 4F3TA 3CFOA 4CF2A 1TYQA 4FW1A 1XHXA 2ASOA 1VSMA 1EQYA 1GOCA 1RDBA 4K25A 1NK4A 4A2AA 3SQ1A 1T3VA 2JWKA 5KI6A 1TL3A 4BWJA 4JRQA 4Y1DA 5JLHA 3UKRA 3KIOA 1MWKA 4O5FA 5AQYA 1KSPA 1P90A 4CJPA 3V4IA 2VG5A 4I7FA 1VQNN 3TSUA 4DU4A 1FKOA 3WUHA 3OBWA 1B9FA 1KC8O 1TAUA 1RT4A 3MDQA 4H4OA 4DQIA 3F73A 3F5TA 2XO7A 4PL8A 4ELUA 2D0PA 2GTDA 3GE1A 4G1QA 5EXWA 4FLXA 3PX4A 2QTDA 3SYZA 3LM9A 4B9SA 2GX9A 4EHUA 3OYMA 4MLHA 5LL6Z 4KB0A 1U49A 1TUYA 2NRXA 3D6RA 4BDPA 1D4XA 4KKOA 3LALA 1VQ7N 3JXUA 3DXKB 2GUIA 3NAEA 1RDAA 3WXIA 3MEDA 4OKEA 3AVJA 4LF6K 3J8AA 1S22A 4E19A 4BRGA 3ZT1A 4DTXA 4IEIA 2QWPA 2YHWA 2OZMA 4BGBA 4M7XA 2HHQA 4YOXA 4ELVA 1U4BA 1QE1A 2HBKA 2QWNA 3TABA 3AARA 1RT5A 1Y97A 4HUEA 4BRKA 3O9QA 2O4GA 3PX0A 3WNEA 4KBOA 1ZBFA 3PIPL 3QICA 2Q31A 4CJFA 2AA4A 4FW2A 2UU9K 4QS8A 3V1RA 1C0TA 1BU6O 3E9LA 3I8DA 1I39A 3V1OA 3SAFA 1GLDG 4WFBL 2IS3A 5MLCQ 3JS6A 4CGGA 4Z4CA 4CJTA 4BG8A 1RDUA 1Q7YO 4FYDA 1JXBA 1VAZA 4H0OA 2ZE2A 4MLEA 4AHTA 3KK2A 1HNIA 2B6AA 4LF9K 3MCAB 4K42A 1YVNA 4CESA 3T3FA 2ASPA 3TR8A 1DTQA 4CEBA 4JN4A 5D3GA 1QVGM 2VGNA 1QQNA 4M3YA 4DU3A 4CHOA 1N6QA 1DEJA 3ATUA 4A57A 4WFAL 1NU0A 3VQEA 1LW2A 2F8SA 3KKSA 5F0XA 5H1SQ 3V9SA 2ZD1A 2KKZA 1QZ6A 3AVHA 4CZGA 4N76A 4FLUA 3EO3A 2PBDA 4CBXA 4B3MK 4JI1K 3IS9A 3U8XA 1EXQA 4PHTX 3SAGA 3CPEA 4DQSA 1NKBA 1S3XA 2P9NB 1HX1A 4N41A 3DOKA 2OPRA 4H0PA 2QWLA 4M63C 3NH0A 5BPNA 3QFPA 4BRCA 5JMVA 1YHQN 1J9AA 2RHKA 3MWPA 4FWPA 1A5VA 2QA4N 3THXB 1VSDA 1RDCA 4B8AB 3CC7N 3JAMO 1QSLA 3DLGA 4TSXA 4DTMA 3VQ8A 4JKCA 4LH4A 3ZX0A 2QWMA 3KLFA 4DV7K 2E5LK 3IAYA 3E9PA 3DWLA 1ZBLA 1K9MO 4NCBA 1IKVA 5FROA 3L2WA 3H1VX 4QAGA 5GIOA 3L8BA 2P9SA 1HNZK 4Z4EA 4M3UA 4KI6A 5JS1A 2BDPA 1WUAA 1S6PA 2P9PB 1NGAA 4LF4K 4NXMK 3O1WA 5LJVA 3OS1A 3QEIA 5AQOA 4U7BA 1KFDA 3ZT0A 2F7TA 1VQKN 4DS5A 4BRQA 3SBTA 3VESA 1VQ9N 1RTHA 3HSCA 2E1ZA 3CCEN 1JLFA 1CZBA 2RE2A 4CJ7A 1YT3A 4DF4A 1T6DA 4PKGA 3DXKA 3SJJA 1U6ZA 2G8UA 1VRUA 3L2VA 1TKZA 1YVUA 1RT3A 3TPQA 4FK2A 3KWIA 4M41A 4JK9A 3LPTA 4BC4A 3AO3A 1RTDA 4BR9A 4XH1A 4CJSA 3NH1A 4CZKA 1HLUA 4JAXA 1BG3A 3SBGA 4A5AA 3KKRA 4OKJA 4XH4A 1KQSM 4F3OA 3KVGA 4DV6K 3S3MA 4JS4A 3OS0A 3HP6A 4CEQA 4Z4GA 3ENOA 3NCIA 3C95A 4NYFA 3E01A 1TGOA 3MWTA 1BCMA 3N4PA 4FZYA 2IIRA 1ATNA 2O8CB 3K9JA 3RMAA 2UXDK 4CEAA 1BI4A 3QEPA 4W5QA 4CW7B 3LDPA 4OLAA 4E7HA 3V81A 4DFMA 3RMDA 4PY5A 2G8FA 1K8KB 4A5BA 4EP4A 2OTLN 4Z4FA 2OPPA 5ADXH 3AVCA 3R3LA 3THYB 1K73O 1KXPA 2VG7A 3THWB 2G8WA 1CXQA 3DLKA 3OBYA 4A62A 3CQ8A 3QMLA 4CZJA 5IT9O 1FJGK 3GG4A 3TAGA 4AH9A 1TK5A 2P9NA 4AHVA 3H08A 3G71N 3H3NO 5EOYA 3M1FA 4A2BA 1HKBA 3S9HA 4HWIA 4HTUA 3THXA 3CYMA 3ULEB 5BPMA 1C1BA 1QQOA 2YCHA 1VK0A 2DPNA 4FWQA 4H0TB 1ZBSA 2OYQA 4N5SA 1RCHA 1WAFA 3AGRA 5KQ8A 4KHNA 1LWFA 3BP8A 2UUAK 4GKJK 2KW4A 1LOTB 1JLBA 2VWJA 1OH6A 4OJRA 4CGHA 4CHQA 1RBRA 5AQQA 4DTJA 3T1YK 3CCRN 1XMOK 2ZGYA 5CYMA 3TAFA 4IXCA 4CZHA 1R0AA 2YNGA 4H5NA 2P9PA 3O8MA 1TK0A 3SQ2A 4C8OA 2HHUA 5E84A 4KTQA 1BQNA 1P8ZA 1DLOA 3TSPA 1T6CA 1Q86O 4CIFA 2IAJA 1FW6A 3EE8A 1VSHA 3UB5A 4FLYA 3EY1A 4O44A 3TWHA 2HB5A 1B92A 1RNHA 4CEZA 5KQDA 4F8RA 3R9PA 4DTNA 1ILYA 3U9ZA 3ZSWA 3ZX3A 1WBBA 2WTUA 3U9DA 4XIUA 4A59A 4CEFA 2EX3A 3G10A 4BRFA 1NG9A 3LDSA 3GDQA 5AZJB 4DR6K 1S9GA 1IBLK 2NNWA 4CERA 1LCUA 2WUSA 3MXIA 4UY8O 3A5LC 4KHYA 1WSIA 3EE9A 2IGIA 4I2PA 3H45C 4DLGA 3OYIA 4HVJA 3SMPA 4EFHA 4B3SK 1S72N 3DRPA 5CHIA 3VEZA 3L2RA 1D9DA 4OO1J 1GLJO 3PLAA 3VN5A 1W0HA 4QOZB 3MK6A 1LW0A 2XY8A 3O9SA 2Z1JA 4CD3A 1GLCG 1MA9B 3CJAA 5HBMA 2PYJA 3M8QA 4DSKA 3NF8A 4KO0A 2GV9A 2HW3A 4ELTA 1OKJA 4YOWA 3VQ4A 4DG1A 5BR9A 3TAQA 4BY9C 2O8CA 5FPMA 3K57A 1C0UA 4Y0WA 2HHVA 4HCCA 4LF7K 3WXJA 4WF9L 2PY5A 4K41A 3K5OA 4ISEA 3SV3A 3OW2M 2V7YA 1VQPN 1FKPA 4JKFA 3VTIA 3J7ZO 2D0BA 3EKUA 3I8BA 1I3AA 3THWA 1TV6A 3CCMN 3ENHA 4CK1A 4JI4K 3G6EN 4HHTA 2OA8A 2OANA 1BOTO 3CQYA 3HPGA 4BC3A 4BR2A 3OYNA 4BRLA 4EIAA 3MECA 3OJSA 2DFHA 4FM2A 4ZTJA 4GMJB 3NHGA 1J6ZA 2DFEA 3A0IX 3JYTA 1X9MA 5AQMA 1NLVA 3ULEA 3Q7BA 4WFNL 3ITHA 4KRFA 1RBUA 5B8HA 1J53A 2CGLA 2DFFA 5F1XA 3K5LA 4YHHK 1Q8IA 1HNVA 3G25A 1IKWA 3LDOA 1ZBIA 4IFYA 2J4RA 3QBXA 3VERA 3UKUB 3PSFA 3HP9A 3VA3A 3HOSA 1RT2A 3B8AX 4E1JA 1UA0A 4RW7A 3LM2A 3AAQA 4CJKA 1U2VB 1N36K 4BR5A 2JWLA 1NOZA 1DKGD 3P4IA 4DUZK 3V9XA 5J2NA 3NBPA 5EU7A 3PSIA 5GINA 5KPZA 1QVFM 2I7NA 4EP5A 3OYBA 3C6HA 2JGUA 4WCEL 4FPBA 5I42A 1M1KO 5DM6L 3QEWA 4E7JA 4H5VA 1SS6A 4FWRA 1QZ5A 2OPQA 4AHRA 3OYAA 1NK5A 5AQPA 3M6GA 4ILGB 3RTVA 2G8VA 4BROA 3CMAN 2CGKA 3OHRA 3VQBA 2Z1GA 3LP2A 3CM5A 3EZWA 5AFUH 5M1PA 4KV8A 4CF1A 1NGFA 1LV5A 3HRGA 3KWGA 4DFKA 1IG8A 4PWDA 3C6UA 3VEOA 3G0ZA 3T19A 4J2BA 3FZFA 1JJ2M 5I9EB 1Q81O 2VG6A 3VQQA 2E2NA 1N33K 3KLGA 4AHSA 3HM8A 2EHGA 2KTQA 2E1YA 1MU2A 1TUUA 5EY4A 3VQPA 1VQ8N 1X1PA 3SPZA 2YKMA 3KLIA 3O3GA 3R1XA 3O1BA 3A8YA 5AJ3K 3BDPA 5JS2A 1XHZA 3H3OB 4JRPA 3MN6A 2HBLA 4AQYK 4Z4IA 4M45A 3NVMA 4FWOA 2BH1A 1JCFA 4FSVA 5F2RA 4JI2K 2GWKA 1GLEG 2Q0UA 4M3XA 4AILC 4X64K 4QS7A 1JCGA 4MQ3A 4DB3A 3DYAA 4BWMA 4DFPA 4DSLA 1XWLA 4JKEA 3NFAA 3DM2A 2D0AA 2A1SA 3M8PA 3VF2A 5LMNK 4BRAA 3WXKA 4B9VA 4FJ8A 3SUQA 4AM6A 3ZSVA 4IJNA 4FJ7A 1XUPO 2FBXA 4DV4K 3AVAA 5E41A 1VRTA 3FE1A 4DMNA 1RDWX 4DV3K 3LDNA 3T1AA 4FJNA 5LJWA 4WQ5C 5M1NA 3HI0A 5AQVA 1L3UA 3O5BA 4CK2A 1NKEA 5ADXA 3K2PA 2O8EB 3D2EB 3BZCA 2ETJA 4KPYA 4CHNA 4IG0A 1WN7A 3LAMA 3SAHA 1NBWA 4CJVA 2W6KA 1WB9A 3UKUA 2VWKA 1R59O 1JCEA 3AA3A 4IZ9A 3MAQA 2YNHA 2HVHA 4CJEA 1HNWK 4IOAL 3TANA 3ZSXA 1TKXA 2ZGZA 3OYFA 1BUPA 5KPTA 3B6PA 1U2VA 2HHXA 2ZQBA 1SL2A 3MMVA 4CIGA 4DV5K 1Q9YA 1WBDA 4CD1A 4DTOA 4EHTA 2I5JA 2Y1IA 3MXJA 4CZIA 2Z1HA 4E1NA 5C12A 4X65K 4CF0A 3P1GA 4CJ3A 4JHDA 2FSKA 4XEIA 3J7YP 4FZXC 3OYLA 3AVNA 1BO5O 3VQCA 4CZMA 2WC9A 4DS4A 4J8FA 3QLHA 5J2PA 3NH2A 3TAPA 3WEEB 4YOTA 1JLCA 3OA9A 1N8RO 4CJLA 1VQ6N 4A61A 3IRXA 3F2KA 4N56A 1KVAA 2E6MA 4U67L 3GBTA 3MX2A 5J1EA 4FM0A 1ASWA 1E3MA 2QWOA 4H5WA 2E2OA 3OVNA 4DR7K 4YOYA 4RCHA 1A5WA 2HBJA 1L5UA 1C0GA 2ITGA 1VSLA 1KTQA 4LFBK 3MCPA 3T7ZA 3EYZA 3P5JA 4JD2A 1KCFA 4B9QA 1NJXA 1T8EA 2G8KA 3CCJN 4YNQA 4FLTA 3NGZA 4OGEA 3F9MA 4B1WB 1GLAG 1YJNN 5GAHP 1EKEA 3QFUA 1NGBA 4CECA 3O3HA 4FXDA 2HF4A 1VQ4N 1VSKA 4JKAA 4NO7A 4BGAA 2XY6A 5DK5A 4IDKA 3SQ4A 3AVGA 4IO8A 5HRSA 4E3SA 4XH5A 4M42A 3J80O 1U48A 3OYKA 2D5RA 5BRHA 1UAXA 1K6YA 1S1XA 1T03A 3HBTA 3KLEA 3CJBA 4CZLA 2EWSA 1BIZA 1XC9A 5LY3A 2O8FB 3BEXA 4IFEA 4KAZA 3CCLN 2P9LB 1E4GT 3VOVA 4BR4A 4PKHA 1N32K 4JI7K 1GLLO 1V4TA 2NRTA 4FWKA 2O8EA 4FJGA 1YTAA 4JKBA 4B1UB 1NK6A 2YHBA 1NK7A 1KAZA 2QXFA 3AVBA 4B3RK 2FF6A 4N47A 3THVA 2IVPA 3K5NA 1EWQA 1X3NA 3V1QA 2PYLA 1C1CA 4DTUA 1HR0K 5ELZA 4YORA 1XNQK 2YHXA 1VSFA 3DLHA 1ZC6A 5BRFA 2RPIA 2JLEA 3VGKA 4MO4A 1T44A 2HF3A 5FDLA 4M7YA 3CC2N 3CXCM 4CFAA 1U45A 4JI0K 5AQNA 3ZSZA 3KTQA 1QTMA 2IVOA 2VYPA 5A2QO 3ZSQA 4FK4A 3SUNA 2I7PA 2A40A 3S3NA 4B9TA 4LSNA 2G8HA 4DSJA 2XRIA 2E6LA 5AQLA 4YDUC 1NGDA 2E20A 2WONA 3FZHA 2WOMA 4KH6A 4L8RB 3WEEA 5J2QA 4O0IA 3QETA 4CZFA 2FSJA 1FK9A 4Z4HA 3PV8A 4EZ9A 4C1NI 1B9DA 1N34K 4K8ZA 3MN9A 3CPWM 1JL2A 3LP1A 4Q5VA 2PAVA 3A5MC 1X9SA 4GV3A 5KRTA 3KD5E 1NM1A 4DWIA 1Q18A 3QIOA 3VF6A 1BWFO 4RW9A 3KK1A 1TK8A 1XNRK 1WOQA 4OLBA 3P83D 5FRNA 1FXXA 3DLEA 3LZIA 3J7AP 4NLCA 1NGHA 5AQGA 3ZCMA 5AFUA 4NCAA 1NK0A 3BZKA 1S9EA 4FJLA 4FJKA 4RW4A 4FJJA 3CHWA 4ZHRA 2GBZA 3LDLA 1L3VA 3HK2A 4LY7A 4BC2A 2NRVA 2HHTA 3ZETB 1K8AO 4G9ZA 4EZ6A 4C1NK 5KPRA 4F2RA 2Y1JA 3IG1A 4JI5K 4BE0A 3SQ0A 3IKMA 3HYFA 4H0VB 5AQIA 1WSEA 3OJUA 4B08A 2A6AA 3TU5A 5GIPA 1HKGA 1J54A 3BF3A 4DQRA 3TTCA 2E8AA 4KTZA 5CR4A 2FSNA 1E4FT 3V9ZA 3KK7A 3SI6A 1HMVA 2O8FA 1DTTA 5FLXO 3QINA 1HKCA 1RBTA 2P9LA 3M3ZA 4BR7A 3PX6A 2ZF5O 4E7KA 3VEXA 4O8KA 5BREA 1C1AA 3O9RA 4YOVA 4BC5A 3SZ2A 3FR0A 1SUQA 4ZTFA 3F9KA 4DFJA 4BRNA 1NKCA 5GADP 1CLQA 1M90O 4B9MA 1YXQA 4BACA 4CGIA 4O0JA 2XY5A 5HP1A 1ZBHA 1C0FA 4ICLA 4Q0BA 3D0PA 3NVKA 3FZKA 1YF5L 1HJOA 3SUOA 2P9KB 3ALYA 5FPDA 2UUCK 4R5PA 2NRZA 4J2AA 1IV0A 3SJHA 2DTUA 1JKHA 4AHUA 1LAVA 4IG3A 3NDKA 4GNIA 1HNXK 4O5BA 2W41A 3T69A 3CCUN 3CFPA 2RKIA 2P9IB 1SKRA 3NMUA 2RF2A 1HQEA 1JXEA 1Q82O 1IKXA 3QEXA 3L2QA 2HHHK 2VQFK 2OPSA 1KLNA 4CF9A 3U3GA 2FXUA 4LFAK 3V9WA 5HOOA 5CZ2A 4NLBA 4BDZA 3QESA 1S6QA 3WXMB 3U4LA 4HUGA 2HSTA 1K8KA 2ZJPL 4IJAA 1NMNA 4Y1CA 5E26A 3AO4A 1QSSA 1NJIO 3RSEB 3K5MA 3ID6A 3THYA 4CBUA 3A5NC 4RWTA 2QW9A 4CBWA 3TSQA 1NMDA 4CGDA 5AQJA 4BQZA 3DRRA 4FLWA 1YAGA 4H8KA 1VSJA 4PQUA 2E2PA 4CJ4A 2P51A 4DV2K 1QHTA 5M1KA 1BDGA 1YJ9N 3CF5L 1XQSC 3T1HK 1OVYA 3OTOK 3L4IA 4FVMA 3LANA 3D7EO 2BGGA 4DR3K 3ULDA 3DXMB 5BN8A 4CJ5A 2GUPA 3UKRB 5C24A 4CI6A 4IKFA 4DSEA 4FCYA 2IVNA 5C0YA 3VQ7A 3I0RA 4BREA 2XHBA 3ZX2A 4IEEA 3PY8A 4O55A 2GELA 4FJHA 1ZXOA 3L2UA 3S3OA 3VQ9A 5M1OA 3CETA 4I9LA 1WAJA 5SZTA 1Z05A 2KFZA 4IDHA 1VSIA 3KK3A 3O80A 4CJRA 5AQXA 3VGMA 4JS5A 4KREA 1BA0A 1C6VA 2D4WA 1EP4A 1REVA 1XMQK 1UWBA 1D9FA 3VQ5A 3VEVA 4FJXA 3QDKA 1SV5A 3G4SN 3LP0A 3Q7CA 1ATRA 3CIPA 2NUBA 2UXBK 1Q9XA 4DKWA 4E7LA 4J2EA 1IH7A 5HROA 2E4LA 3B6OA 3AA2A 1BQMA 2IC3A 2NZTA 5AZJA 2ZWHA 1U04A 1HYSA 4C23A 4DUYK 2YI1A 4K43A 1WLJA 4OGCA 1O1WA 3CERA 4C8MA 4BE1A 3HT3A 5CY4A 3HZ6A 2A1RA 3VTHA 2A42A 1I94K 4LF8K 4DR1K 2P9KA 3OS2A 4LF5K 1F21A 4Z0UA 5FPEA 2PFUA 4WYBA 4CFDA 4OPKA 3VPZA 1TKTA 3SLCA 4PL7A 3RMCA 3OYGA 2FBYA 1ZYQA 3AVLA 4RW6A 3GL1A 2P9IA 4OPAA 3C0BA 3EEQA 4KI4A 3W3DA 3WNHA 3O9UA 1SL0A 3VETA 3DMJA 4LD0A 1NGJA 2F9TA 5K14A 3HVTA 4DLEA 5AQRA 1J5EK 3L4QA 3A2FA 3ASMA 2ATQA 2O8DB 4UQGA 4WQ4C 1XC3A 2ZM6K 3PUFA 4M3RA 3CJ7A 2KLAA 3MX5A 3RRGA 4DTSA 4DSFA 4B1YB 4DTPA 4ISFA 3RSEA 3AY9A 3CD6N 5TKYA 5BPLA 3M8SA 3EZ5A 3OY9A 3HO1A 3VQAA 2CGJA 4FOEA 4JKHA 1KD1O 3AVFA 3U3YA 5AQUA 3FFKB 3TAMA 1BA1A 5AZIB 4KHQA 4AM7A 2UYTA 3LZJA 3R6MA 1S5JA 3SUPA 3BF1A 3LAKA 1Y64A 3DXMA 4F2SA 1O13A 2Q3SA 1YUWA 4JI3K 4JI6K 4F9OA 4CJQA 1HYVA 3FGUA 4KH5A 2P9SB 4L3QA 3ZLJA 5GAGP 4FLZA 3CCVN 1OH5A 2WBNA 4IBNA 3CG7A 3NGYA 2QEXN 3HVRA 4KTWA 4FWLA 1RFQA 3MN7A 2HHWA 5IWAK 1WSGA 3CI5A 4IOXA 3ATVA 3DAWA 4H5TA 2W42A 1BL3A 4DU1A 4CGJA 3WQTA 4ID5A 4CEEA 1JLAA 1KLMA 2BTFA 4CZEA 1YIJN 1N5YA 3EL2A 3ENBA 4JLHA 3TTDA 4JK8A 4GW6A 3I55N 3WQUA 4IOCL 3EKSA 3O4QA 4GV6A 4MO5A 3D2FB 1D5AA 5DM7L 1WNSA 1EWRA 1X9WA 4E1MA 1QQMA 4GVMA 3AV9A 3CMEN 3UIQA 4JNEA 1IG9A 4KB1A 2BE2A 1SAZA 2IOCA 3IFRA 2WFBA 3AVMA 1IBMK 4YFUA 3VA0A 3MEGA 4I2QA 3JSMA 3RMBA 4RW8A 3PIOL 1W2BM 3LPUA 3M8RA 4OPHA 3AAPA 1RTIA 3NF9A 4DV1K 4FJ5A 3NE6A 5J2MA 4JV5K 1RTJA 3KLHA 4FWSA 1BI4B 2HHSA 3WNGA 4CHZA 5M1FA 3AGKA 3IDHA 4CJWA 2VGMA 5AQZA 4BRHA 5HL7L 1HYZA 3DRSA 2FF3B 1IBKK 2AP1A 2D0OA 4FJMA 2O8DA 5TKWA 4F4KA 4DTRA 1EO1A 4BG9A 2D1KA 2Q36A 2E2QA 1S1TA 1OVQA 5M1QA 2QKBA 4O8UA 3HL8A 2BUPA 4PUOA 3K0SA 3O4NA 5C2FA 3U6FA 3C6TA 4QCLA 4ILJA 4BRMA 4B3OA 3E9OA 4B1ZA 4LH5A 4W5NA 2ZJRL 4W5OA 3IUCA 5AZIA 2ASMA 2YV0X 4H4MA 3O9TA 4CIEA 2PZSA 4LC9B 2X78A 2FBTA 2YNFA 1RDDA 3SMSA 5FPNA 2NRHA 1NGCA 1NGEA 5HRPA 4JKGB 3J81O 4HUFA 1IJJA 1X3MA 3D2EA 3L6QA 3VEYA 1TL1A 5HRRA 2X74A 4W5RA 2HVIA 2HMIA 5BN9A 2QI2A 2FBVA 4Z94A 3VEWA 1RGIA 4DR2K 1CZAN 4LSLA 2D0CA 1D8YA 5JVGL 3H46O 4KFBA 2X6NA 2QWQA 2QKKA 3AO2A 4CFCA 2LSNA 1TAQA 3ZYYX 1NWKA 3O08A 4BQLA 4CHPA 3KJVA 3QEVA 3EN9A 3CJCA 4KHWA 1L3TA 3ZSYA 1MDUB 1DT9A 3CQXA 1ATSA 4DQPA 3HSTB 2P1JA 4DQQA 2B5JA 4FWNA 1L3SA 2YHYA 3ZSOA 1Z6RA 1IKYA 3I56N 3AO1A 4FJ9A 2CH6A 1WSHA 4BVPA 3D2FA 3OYDA 2YHAA 3HM9A 4OVLA 4FK0A 2O8BB 1KAYA 1OH8A 4WQ4A 2A41A 4B9NA 3RWUA 4B8CA 2P9UB 3LWMA 3RVCA 1MWMA 3KD1E 4NXNK 4RG8A 1QSYA 1T05A 2HBMA 2VCPA 1SKWA 3L3VA 3FFIA 3SNNA 3HPHA 2V52B 1EX4A 4JKDA 1RT1A 2HNDA 4AF1A 4YOUA 1SZ2A 5AR0A 4KHSA 1NJZA 3P39A 3QB0A 4O4GA 3ZT3A 4DQ8A 2VWBA 4BRIA 5JVHL 1WSFA 2OZSA 4DR5K 3A5OC 3GOIA 1A5XA 4E7IA 4FVUA 3ID8A 3O4WA 2KQ2A 3DOLA 4WQ5A 2G8IA 4MDAA 1W9HA 3WT0A 4BVOA 3TARA 5SWMA 4B9LA 1YI2N 2E88A 3QNNA 3AO5A 3OYCA 2UUBK 1QQCA 1SL1A 4BRPA 1NK9A 4NYNA 4K8XA 1LWCA 3E1YA 3P38A 1SKSA 2ITMA 1OH7A 5C42A 4NB4A 5FRMA 3OYJA 4I6MB 4I9QA 2F4VK 3ZT4A 3L3UA 5AQSA 1VQ5N 1RBSA 1HQUA 1WSJA 4GVEA 3RRHA 5DMRA 2A5XA 4H03B 3QNOA 2F96A 4OX9K 4FO0A 2Q1NA 4FPAA 3KZBA 2QK9A 4R79A 3P31A 5AQKA 1ESVA 2AJQA 1HRHA 4B1XB 3C94A 4CK3A 4DF8A 2O4IA 1NJYA 4LFCK 1LWEA 1Z26A 4JKGA 2NLXA 1BGXT 1VHXA 4E89A 4CCHA 3VGLA 1HUXA 4BDYA 4DV0K 4GY2B 3CCQN 3O6WA 3CC4N 2YNIA 2IDOA 3K9KA 3C6AA 3BY5A 4FOIA 3OYEA 1VQMN 2Q2RA 2F8TA 3ZT2A 3AVKA 3MEEA 2Q0RA 3VQ6A 4JK7A 5JLFA 4EAHD 1X9JA 2QWRA 5CYQA 4C8NA 3ZEUB 1V4SA 3FZLA 1JLEA 4B3TK 2QXLA 3L0QA 4IWVA 2DY4A 3UE5A 1SQKA 1QS4A 2P5GA 1NK8A 4M3WA 3H6EA 4FL9A 5AQHA 2HNYA 4GV9A 1TVRA 3NF6A 3V9UA 5T7BA 2ZJQL 3DLRA 4ISGA 2HMPA 1W7AA 4FJIA 4CGFA 4H0XB 3N4QA 2W6LA 1U47A 4C8LA 3DLBA 2CH5A 2HOEA 2X6SA 1NGIA 1S1WA 1J5OA 1YITN 4V19S 3HJFA 2O8BA 1DGKN 2KZMA 2UXCK 3ISNC 1JL1A 2YJFA 4KHPK 3I33A 2P9UA 2V51B 4AHCA 4JEPA 4QS9A 5C25A 4BE2A 3NGIA 4K0KK 5KRSA 4IFVA 5BR8K 4IO9L 4WE1A 5GAEP 3D45A 3SCXA 2YKNA 4DCHA 4FM1A 1G15A 3CJ1A 3NF7A 5AQWA 3HXMA 4GKKK 1C0MA 3H1QA 4W5TA 4H0YB 3PO5A 1CXUA 1GOBA 5C2DA 4CHYA 3FZMA 5EX5A 2NRRA 2H3GX 1QHAA 2B4JA 3C7NB 4PA1A 4X62K 5C15A 3QO9A 4X66K 4KHUA 5KGXA 1BIUA 3HPOA 3SPYA 2R7YA 1TYQB 3AVIA 4HCBA 4MFBA 4CEDA 5C10A 5HRNA 3LWLA 5I3UA 1H1VA 5JICA 1RBVA 3DLLL 4J2DA 1RILA 3SV4A 1ASVA 2GWJA 2GEMA 4BR0A 3BUZB 5KGWA 2YX6A 3ZETA 1KFSA 1T7PA 3TI0A 4B9UA 4NCGA 4C8KA 1S1VA 4CVNE 4RTFD 1BISA 3V6DA 2Q97A 3HOTA 1HPZA 4BRDA 1KVCA 2XY7A 2QM1A 1RT7A 1Z25A 3QIPA 4I6MA 3LP3A 1KRPA 3CCSN 4PKIA 1VQLN 2W40A 2KFNA 4OKKA 2RN2A 4KH4A 2VQEK 1YJWN 1VQON 3MXMA 4B1VA 1BHLA 1G99A 2OTJN 2V7ZA 1UA1A 3RR7A 1VSEA 3K58A 4JYAK 3PO4A 2FC0A 4E0DA 4CJUA 2Z1IA 3WNFA 3CJ9A 2F9WA 4YDUA 3IMXA 4FZZA 3QBWA 4MDBA 1TKDA 1HPMA 2BANA 4FWMA 3VQDA 1KVBA 1NNEA 2A3ZA 1CZ9A 1YTUA 1HJRA 1JLQA 1S1UA 2OCEA 4CFBA 2HNZA 1LAWA 1GLBG 3O3FA 3K59A 1EETA 4M3ZA 3TAEA 4CEOA 4OPJA 5KTQA 4M3TA 5AQTA 3ZEUA 3CFRA 2KZZA 4YY3K 4ID1A 3RR8A 1NOYA 5CE3A 4FLVA 4JHDB 3E66A 1RT6A 4CE9A 1ITGA 3VENA 3HTVA 4DR4K 1ASUA 5AQFA 4JI8K 3DI6A 1BCOA 4ILHA 1JLGA 3BGRA 3KHYA 3R8EA 3W0LA 1UOCA 3LL3A 1GOAA 5LMUK 1W97L 3QERA 3AA5X 5CZ1A 5EVZA 5BRDA 3MN5A 5HLFA 1NGGA 3VMFB 3ZSRA 2YJEA 1GLFO 3S41A 3OYHA 3C65A 4H5RA 1IO2A 4CF8A 2P5OA 2FLOA 3AA4A 1KAXA 4HTLA 3FLCO 1ZBUA 3LDQA 4DHYA 4JD2B 1XI1A 2KHOA 3VF4A 3C7NA 4DSIA 3SK3A 3M5RA 2NRWA 1NJWA 3DJCA 3CM6A
chains in the Genus database with same CATH topology
4NXNK 4B3TK 1N33K 4X65K 4JYAK 3T1YK 2HHHK 1XMOK 1N32K 4JI7K 4LF9K 2VQFK 4JI4K 4DUYK 3J7YP 4LFAK 4B3RK 4DR5K 5AJ3K 1I94K 4JI5K 4LF8K 4DR1K 1HR0K 4LF5K 5IWAK 4AQYK 4V19S 1XNQK 4DV6K 4JI2K 4B3MK 2UXCK 4KHPK 4JI1K 4YHHK 4X64K 3J81O 4K0KK 5BR8K 2UUBK 4JI0K 4YY3K 5FLXO 4DR6K 4DV2K 1IBLK 4DR7K 5A2QO 4GKKK 3T1HK 3OTOK 2UXDK 4DR4K 4CW7B 5LMNK 3JAMO 2F4VK 4DR3K 5LL6Z 4DR2K 1N36K 1J5EK 4LFBK 4JI8K 4X62K 4DV7K 4B3SK 2ZM6K 4DV4K 2E5LK 4DUZK 4X66K 1IBMK 4DV3K 4OX9K 4LF6K 5LMUK 1HNZK 1N34K 4LFCK 5IT9O 1FJGK 4DV1K 4LF4K 4NXMK 2UXBK 4CVNE 4DV0K 4JV5K 2UUCK 1XMQK 1HNWK 2UU9K 1XNRK 3J7AP 3J80O 1HNXK 4LF7K 2VQEK 1IBKK 4DV5K 4JI3K 4JI6K 2UUAK 4GKJK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN K;  4B3T K;  1N33 K;  4X65 K;  4JYA K;  3T1Y K;  2HHH K;  1XMO K;  1N32 K;  4JI7 K;  4LF9 K;  2VQF K;  4JI4 K;  4DUY K;  3J7Y P;  4LFA K;  4B3R K;  4DR5 K;  5AJ3 K;  1I94 K;  4JI5 K;  4LF8 K;  4DR1 K;  1HR0 K;  4LF5 K;  5IWA K;  4AQY K;  4V19 S;  1XNQ K;  4DV6 K;  4JI2 K;  4B3M K;  2UXC K;  4KHP K;  4JI1 K;  4YHH K;  4X64 K;  3J81 O;  4K0K K;  5BR8 K;  2UUB K;  4JI0 K;  4YY3 K;  5FLX O;  4DR6 K;  4DV2 K;  1IBL K;  4DR7 K;  5A2Q O;  4GKK K;  3T1H K;  3OTO K;  2UXD K;  4DR4 K;  4CW7 B;  5LMN K;  3JAM O;  2F4V K;  4DR3 K;  5LL6 Z;  4DR2 K;  1N36 K;  1J5E K;  4LFB K;  4JI8 K;  4X62 K;  4DV7 K;  4B3S K;  2ZM6 K;  4DV4 K;  2E5L K;  4DUZ K;  4X66 K;  1IBM K;  4DV3 K;  4OX9 K;  4LF6 K;  5LMU K;  1HNZ K;  1N34 K;  4LFC K;  5IT9 O;  1FJG K;  4DV1 K;  4LF4 K;  4NXM K;  2UXB K;  4CVN E;  4DV0 K;  4JV5 K;  2UUC K;  1XMQ K;  1HNW K;  2UU9 K;  1XNR K;  3J7A P;  3J80 O;  1HNX K;  4LF7 K;  2VQE K;  1IBK K;  4DV5 K;  4JI3 K;  4JI6 K;  2UUA K;  4GKJ K; 
#chains in the Genus database with same CATH topology
 3I0S A;  3TTF A;  3WXL A;  4F3T A;  3CFO A;  4CF2 A;  1TYQ A;  4FW1 A;  1XHX A;  2ASO A;  1VSM A;  1EQY A;  1GOC A;  1RDB A;  4K25 A;  1NK4 A;  4A2A A;  3SQ1 A;  1T3V A;  2JWK A;  5KI6 A;  1TL3 A;  4BWJ A;  4JRQ A;  4Y1D A;  5JLH A;  3UKR A;  3KIO A;  1MWK A;  4O5F A;  5AQY A;  1KSP A;  1P90 A;  4CJP A;  3V4I A;  2VG5 A;  4I7F A;  1VQN N;  3TSU A;  4DU4 A;  1FKO A;  3WUH A;  3OBW A;  1B9F A;  1KC8 O;  1TAU A;  1RT4 A;  3MDQ A;  4H4O A;  4DQI A;  3F73 A;  3F5T A;  2XO7 A;  4PL8 A;  4ELU A;  2D0P A;  2GTD A;  3GE1 A;  4G1Q A;  5EXW A;  4FLX A;  3PX4 A;  2QTD A;  3SYZ A;  3LM9 A;  4B9S A;  2GX9 A;  4EHU A;  3OYM A;  4MLH A;  5LL6 Z;  4KB0 A;  1U49 A;  1TUY A;  2NRX A;  3D6R A;  4BDP A;  1D4X A;  4KKO A;  3LAL A;  1VQ7 N;  3JXU A;  3DXK B;  2GUI A;  3NAE A;  1RDA A;  3WXI A;  3MED A;  4OKE A;  3AVJ A;  4LF6 K;  3J8A A;  1S22 A;  4E19 A;  4BRG A;  3ZT1 A;  4DTX A;  4IEI A;  2QWP A;  2YHW A;  2OZM A;  4BGB A;  4M7X A;  2HHQ A;  4YOX A;  4ELV A;  1U4B A;  1QE1 A;  2HBK A;  2QWN A;  3TAB A;  3AAR A;  1RT5 A;  1Y97 A;  4HUE A;  4BRK A;  3O9Q A;  2O4G A;  3PX0 A;  3WNE A;  4KBO A;  1ZBF A;  3PIP L;  3QIC A;  2Q31 A;  4CJF A;  2AA4 A;  4FW2 A;  2UU9 K;  4QS8 A;  3V1R A;  1C0T A;  1BU6 O;  3E9L A;  3I8D A;  1I39 A;  3V1O A;  3SAF A;  1GLD G;  4WFB L;  2IS3 A;  5MLC Q;  3JS6 A;  4CGG A;  4Z4C A;  4CJT A;  4BG8 A;  1RDU A;  1Q7Y O;  4FYD A;  1JXB A;  1VAZ A;  4H0O A;  2ZE2 A;  4MLE A;  4AHT A;  3KK2 A;  1HNI A;  2B6A A;  4LF9 K;  3MCA B;  4K42 A;  1YVN A;  4CES A;  3T3F A;  2ASP A;  3TR8 A;  1DTQ A;  4CEB A;  4JN4 A;  5D3G A;  1QVG M;  2VGN A;  1QQN A;  4M3Y A;  4DU3 A;  4CHO A;  1N6Q A;  1DEJ A;  3ATU A;  4A57 A;  4WFA L;  1NU0 A;  3VQE A;  1LW2 A;  2F8S A;  3KKS A;  5F0X A;  5H1S Q;  3V9S A;  2ZD1 A;  2KKZ A;  1QZ6 A;  3AVH A;  4CZG A;  4N76 A;  4FLU A;  3EO3 A;  2PBD A;  4CBX A;  4B3M K;  4JI1 K;  3IS9 A;  3U8X A;  1EXQ A;  4PHT X;  3SAG A;  3CPE A;  4DQS A;  1NKB A;  1S3X A;  2P9N B;  1HX1 A;  4N41 A;  3DOK A;  2OPR A;  4H0P A;  2QWL A;  4M63 C;  3NH0 A;  5BPN A;  3QFP A;  4BRC A;  5JMV A;  1YHQ N;  1J9A A;  2RHK A;  3MWP A;  4FWP A;  1A5V A;  2QA4 N;  3THX B;  1VSD A;  1RDC A;  4B8A B;  3CC7 N;  3JAM O;  1QSL A;  3DLG A;  4TSX A;  4DTM A;  3VQ8 A;  4JKC A;  4LH4 A;  3ZX0 A;  2QWM A;  3KLF A;  4DV7 K;  2E5L K;  3IAY A;  3E9P A;  3DWL A;  1ZBL A;  1K9M O;  4NCB A;  1IKV A;  5FRO A;  3L2W A;  3H1V X;  4QAG A;  5GIO A;  3L8B A;  2P9S A;  1HNZ K;  4Z4E A;  4M3U A;  4KI6 A;  5JS1 A;  2BDP A;  1WUA A;  1S6P A;  2P9P B;  1NGA A;  4LF4 K;  4NXM K;  3O1W A;  5LJV A;  3OS1 A;  3QEI A;  5AQO A;  4U7B A;  1KFD A;  3ZT0 A;  2F7T A;  1VQK N;  4DS5 A;  4BRQ A;  3SBT A;  3VES A;  1VQ9 N;  1RTH A;  3HSC A;  2E1Z A;  3CCE N;  1JLF A;  1CZB A;  2RE2 A;  4CJ7 A;  1YT3 A;  4DF4 A;  1T6D A;  4PKG A;  3DXK A;  3SJJ A;  1U6Z A;  2G8U A;  1VRU A;  3L2V A;  1TKZ A;  1YVU A;  1RT3 A;  3TPQ A;  4FK2 A;  3KWI A;  4M41 A;  4JK9 A;  3LPT A;  4BC4 A;  3AO3 A;  1RTD A;  4BR9 A;  4XH1 A;  4CJS A;  3NH1 A;  4CZK A;  1HLU A;  4JAX A;  1BG3 A;  3SBG A;  4A5A A;  3KKR A;  4OKJ A;  4XH4 A;  1KQS M;  4F3O A;  3KVG A;  4DV6 K;  3S3M A;  4JS4 A;  3OS0 A;  3HP6 A;  4CEQ A;  4Z4G A;  3ENO A;  3NCI A;  3C95 A;  4NYF A;  3E01 A;  1TGO A;  3MWT A;  1BCM A;  3N4P A;  4FZY A;  2IIR A;  1ATN A;  2O8C B;  3K9J A;  3RMA A;  2UXD K;  4CEA A;  1BI4 A;  3QEP A;  4W5Q A;  4CW7 B;  3LDP A;  4OLA A;  4E7H A;  3V81 A;  4DFM A;  3RMD A;  4PY5 A;  2G8F A;  1K8K B;  4A5B A;  4EP4 A;  2OTL N;  4Z4F A;  2OPP A;  5ADX H;  3AVC A;  3R3L A;  3THY B;  1K73 O;  1KXP A;  2VG7 A;  3THW B;  2G8W A;  1CXQ A;  3DLK A;  3OBY A;  4A62 A;  3CQ8 A;  3QML A;  4CZJ A;  5IT9 O;  1FJG K;  3GG4 A;  3TAG A;  4AH9 A;  1TK5 A;  2P9N A;  4AHV A;  3H08 A;  3G71 N;  3H3N O;  5EOY A;  3M1F A;  4A2B A;  1HKB A;  3S9H A;  4HWI A;  4HTU A;  3THX A;  3CYM A;  3ULE B;  5BPM A;  1C1B A;  1QQO A;  2YCH A;  1VK0 A;  2DPN A;  4FWQ A;  4H0T B;  1ZBS A;  2OYQ A;  4N5S A;  1RCH A;  1WAF A;  3AGR A;  5KQ8 A;  4KHN A;  1LWF A;  3BP8 A;  2UUA K;  4GKJ K;  2KW4 A;  1LOT B;  1JLB A;  2VWJ A;  1OH6 A;  4OJR A;  4CGH A;  4CHQ A;  1RBR A;  5AQQ A;  4DTJ A;  3T1Y K;  3CCR N;  1XMO K;  2ZGY A;  5CYM A;  3TAF A;  4IXC A;  4CZH A;  1R0A A;  2YNG A;  4H5N A;  2P9P A;  3O8M A;  1TK0 A;  3SQ2 A;  4C8O A;  2HHU A;  5E84 A;  4KTQ A;  1BQN A;  1P8Z A;  1DLO A;  3TSP A;  1T6C A;  1Q86 O;  4CIF A;  2IAJ A;  1FW6 A;  3EE8 A;  1VSH A;  3UB5 A;  4FLY A;  3EY1 A;  4O44 A;  3TWH A;  2HB5 A;  1B92 A;  1RNH A;  4CEZ A;  5KQD A;  4F8R A;  3R9P A;  4DTN A;  1ILY A;  3U9Z A;  3ZSW A;  3ZX3 A;  1WBB A;  2WTU A;  3U9D A;  4XIU A;  4A59 A;  4CEF A;  2EX3 A;  3G10 A;  4BRF A;  1NG9 A;  3LDS A;  3GDQ A;  5AZJ B;  4DR6 K;  1S9G A;  1IBL K;  2NNW A;  4CER A;  1LCU A;  2WUS A;  3MXI A;  4UY8 O;  3A5L C;  4KHY A;  1WSI A;  3EE9 A;  2IGI A;  4I2P A;  3H45 C;  4DLG A;  3OYI A;  4HVJ A;  3SMP A;  4EFH A;  4B3S K;  1S72 N;  3DRP A;  5CHI A;  3VEZ A;  3L2R A;  1D9D A;  4OO1 J;  1GLJ O;  3PLA A;  3VN5 A;  1W0H A;  4QOZ B;  3MK6 A;  1LW0 A;  2XY8 A;  3O9S A;  2Z1J A;  4CD3 A;  1GLC G;  1MA9 B;  3CJA A;  5HBM A;  2PYJ A;  3M8Q A;  4DSK A;  3NF8 A;  4KO0 A;  2GV9 A;  2HW3 A;  4ELT A;  1OKJ A;  4YOW A;  3VQ4 A;  4DG1 A;  5BR9 A;  3TAQ A;  4BY9 C;  2O8C A;  5FPM A;  3K57 A;  1C0U A;  4Y0W A;  2HHV A;  4HCC A;  4LF7 K;  3WXJ A;  4WF9 L;  2PY5 A;  4K41 A;  3K5O A;  4ISE A;  3SV3 A;  3OW2 M;  2V7Y A;  1VQP N;  1FKP A;  4JKF A;  3VTI A;  3J7Z O;  2D0B A;  3EKU A;  3I8B A;  1I3A A;  3THW A;  1TV6 A;  3CCM N;  3ENH A;  4CK1 A;  4JI4 K;  3G6E N;  4HHT A;  2OA8 A;  2OAN A;  1BOT O;  3CQY A;  3HPG A;  4BC3 A;  4BR2 A;  3OYN A;  4BRL A;  4EIA A;  3MEC A;  3OJS A;  2DFH A;  4FM2 A;  4ZTJ A;  4GMJ B;  3NHG A;  1J6Z A;  2DFE A;  3A0I X;  3JYT A;  1X9M A;  5AQM A;  1NLV A;  3ULE A;  3Q7B A;  4WFN L;  3ITH A;  4KRF A;  1RBU A;  5B8H A;  1J53 A;  2CGL A;  2DFF A;  5F1X A;  3K5L A;  4YHH K;  1Q8I A;  1HNV A;  3G25 A;  1IKW A;  3LDO A;  1ZBI A;  4IFY A;  2J4R A;  3QBX A;  3VER A;  3UKU B;  3PSF A;  3HP9 A;  3VA3 A;  3HOS A;  1RT2 A;  3B8A X;  4E1J A;  1UA0 A;  4RW7 A;  3LM2 A;  3AAQ A;  4CJK A;  1U2V B;  1N36 K;  4BR5 A;  2JWL A;  1NOZ A;  1DKG D;  3P4I A;  4DUZ K;  3V9X A;  5J2N A;  3NBP A;  5EU7 A;  3PSI A;  5GIN A;  5KPZ A;  1QVF M;  2I7N A;  4EP5 A;  3OYB A;  3C6H A;  2JGU A;  4WCE L;  4FPB A;  5I42 A;  1M1K O;  5DM6 L;  3QEW A;  4E7J A;  4H5V A;  1SS6 A;  4FWR A;  1QZ5 A;  2OPQ A;  4AHR A;  3OYA A;  1NK5 A;  5AQP A;  3M6G A;  4ILG B;  3RTV A;  2G8V A;  4BRO A;  3CMA N;  2CGK A;  3OHR A;  3VQB A;  2Z1G A;  3LP2 A;  3CM5 A;  3EZW A;  5AFU H;  5M1P A;  4KV8 A;  4CF1 A;  1NGF A;  1LV5 A;  3HRG A;  3KWG A;  4DFK A;  1IG8 A;  4PWD A;  3C6U A;  3VEO A;  3G0Z A;  3T19 A;  4J2B A;  3FZF A;  1JJ2 M;  5I9E B;  1Q81 O;  2VG6 A;  3VQQ A;  2E2N A;  1N33 K;  3KLG A;  4AHS A;  3HM8 A;  2EHG A;  2KTQ A;  2E1Y A;  1MU2 A;  1TUU A;  5EY4 A;  3VQP A;  1VQ8 N;  1X1P A;  3SPZ A;  2YKM A;  3KLI A;  3O3G A;  3R1X A;  3O1B A;  3A8Y A;  5AJ3 K;  3BDP A;  5JS2 A;  1XHZ A;  3H3O B;  4JRP A;  3MN6 A;  2HBL A;  4AQY K;  4Z4I A;  4M45 A;  3NVM A;  4FWO A;  2BH1 A;  1JCF A;  4FSV A;  5F2R A;  4JI2 K;  2GWK A;  1GLE G;  2Q0U A;  4M3X A;  4AIL C;  4X64 K;  4QS7 A;  1JCG A;  4MQ3 A;  4DB3 A;  3DYA A;  4BWM A;  4DFP A;  4DSL A;  1XWL A;  4JKE A;  3NFA A;  3DM2 A;  2D0A A;  2A1S A;  3M8P A;  3VF2 A;  5LMN K;  4BRA A;  3WXK A;  4B9V A;  4FJ8 A;  3SUQ A;  4AM6 A;  3ZSV A;  4IJN A;  4FJ7 A;  1XUP O;  2FBX A;  4DV4 K;  3AVA A;  5E41 A;  1VRT A;  3FE1 A;  4DMN A;  1RDW X;  4DV3 K;  3LDN A;  3T1A A;  4FJN A;  5LJW A;  4WQ5 C;  5M1N A;  3HI0 A;  5AQV A;  1L3U A;  3O5B A;  4CK2 A;  1NKE A;  5ADX A;  3K2P A;  2O8E B;  3D2E B;  3BZC A;  2ETJ A;  4KPY A;  4CHN A;  4IG0 A;  1WN7 A;  3LAM A;  3SAH A;  1NBW A;  4CJV A;  2W6K A;  1WB9 A;  3UKU A;  2VWK A;  1R59 O;  1JCE A;  3AA3 A;  4IZ9 A;  3MAQ A;  2YNH A;  2HVH A;  4CJE A;  1HNW K;  4IOA L;  3TAN A;  3ZSX A;  1TKX A;  2ZGZ A;  3OYF A;  1BUP A;  5KPT A;  3B6P A;  1U2V A;  2HHX A;  2ZQB A;  1SL2 A;  3MMV A;  4CIG A;  4DV5 K;  1Q9Y A;  1WBD A;  4CD1 A;  4DTO A;  4EHT A;  2I5J A;  2Y1I A;  3MXJ A;  4CZI A;  2Z1H A;  4E1N A;  5C12 A;  4X65 K;  4CF0 A;  3P1G A;  4CJ3 A;  4JHD A;  2FSK A;  4XEI A;  3J7Y P;  4FZX C;  3OYL A;  3AVN A;  1BO5 O;  3VQC A;  4CZM A;  2WC9 A;  4DS4 A;  4J8F A;  3QLH A;  5J2P A;  3NH2 A;  3TAP A;  3WEE B;  4YOT A;  1JLC A;  3OA9 A;  1N8R O;  4CJL A;  1VQ6 N;  4A61 A;  3IRX A;  3F2K A;  4N56 A;  1KVA A;  2E6M A;  4U67 L;  3GBT A;  3MX2 A;  5J1E A;  4FM0 A;  1ASW A;  1E3M A;  2QWO A;  4H5W A;  2E2O A;  3OVN A;  4DR7 K;  4YOY A;  4RCH A;  1A5W A;  2HBJ A;  1L5U A;  1C0G A;  2ITG A;  1VSL A;  1KTQ A;  4LFB K;  3MCP A;  3T7Z A;  3EYZ A;  3P5J A;  4JD2 A;  1KCF A;  4B9Q A;  1NJX A;  1T8E A;  2G8K A;  3CCJ N;  4YNQ A;  4FLT A;  3NGZ A;  4OGE A;  3F9M A;  4B1W B;  1GLA G;  1YJN N;  5GAH P;  1EKE A;  3QFU A;  1NGB A;  4CEC A;  3O3H A;  4FXD A;  2HF4 A;  1VQ4 N;  1VSK A;  4JKA A;  4NO7 A;  4BGA A;  2XY6 A;  5DK5 A;  4IDK A;  3SQ4 A;  3AVG A;  4IO8 A;  5HRS A;  4E3S A;  4XH5 A;  4M42 A;  3J80 O;  1U48 A;  3OYK A;  2D5R A;  5BRH A;  1UAX A;  1K6Y A;  1S1X A;  1T03 A;  3HBT A;  3KLE A;  3CJB A;  4CZL A;  2EWS A;  1BIZ A;  1XC9 A;  5LY3 A;  2O8F B;  3BEX A;  4IFE A;  4KAZ A;  3CCL N;  2P9L B;  1E4G T;  3VOV A;  4BR4 A;  4PKH A;  1N32 K;  4JI7 K;  1GLL O;  1V4T A;  2NRT A;  4FWK A;  2O8E A;  4FJG A;  1YTA A;  4JKB A;  4B1U B;  1NK6 A;  2YHB A;  1NK7 A;  1KAZ A;  2QXF A;  3AVB A;  4B3R K;  2FF6 A;  4N47 A;  3THV A;  2IVP A;  3K5N A;  1EWQ A;  1X3N A;  3V1Q A;  2PYL A;  1C1C A;  4DTU A;  1HR0 K;  5ELZ A;  4YOR A;  1XNQ K;  2YHX A;  1VSF A;  3DLH A;  1ZC6 A;  5BRF A;  2RPI A;  2JLE A;  3VGK A;  4MO4 A;  1T44 A;  2HF3 A;  5FDL A;  4M7Y A;  3CC2 N;  3CXC M;  4CFA A;  1U45 A;  4JI0 K;  5AQN A;  3ZSZ A;  3KTQ A;  1QTM A;  2IVO A;  2VYP A;  5A2Q O;  3ZSQ A;  4FK4 A;  3SUN A;  2I7P A;  2A40 A;  3S3N A;  4B9T A;  4LSN A;  2G8H A;  4DSJ A;  2XRI A;  2E6L A;  5AQL A;  4YDU C;  1NGD A;  2E20 A;  2WON A;  3FZH A;  2WOM A;  4KH6 A;  4L8R B;  3WEE A;  5J2Q A;  4O0I A;  3QET A;  4CZF A;  2FSJ A;  1FK9 A;  4Z4H A;  3PV8 A;  4EZ9 A;  4C1N I;  1B9D A;  1N34 K;  4K8Z A;  3MN9 A;  3CPW M;  1JL2 A;  3LP1 A;  4Q5V A;  2PAV A;  3A5M C;  1X9S A;  4GV3 A;  5KRT A;  3KD5 E;  1NM1 A;  4DWI A;  1Q18 A;  3QIO A;  3VF6 A;  1BWF O;  4RW9 A;  3KK1 A;  1TK8 A;  1XNR K;  1WOQ A;  4OLB A;  3P83 D;  5FRN A;  1FXX A;  3DLE A;  3LZI A;  3J7A P;  4NLC A;  1NGH A;  5AQG A;  3ZCM A;  5AFU A;  4NCA A;  1NK0 A;  3BZK A;  1S9E A;  4FJL A;  4FJK A;  4RW4 A;  4FJJ A;  3CHW A;  4ZHR A;  2GBZ A;  3LDL A;  1L3V A;  3HK2 A;  4LY7 A;  4BC2 A;  2NRV A;  2HHT A;  3ZET B;  1K8A O;  4G9Z A;  4EZ6 A;  4C1N K;  5KPR A;  4F2R A;  2Y1J A;  3IG1 A;  4JI5 K;  4BE0 A;  3SQ0 A;  3IKM A;  3HYF A;  4H0V B;  5AQI A;  1WSE A;  3OJU A;  4B08 A;  2A6A A;  3TU5 A;  5GIP A;  1HKG A;  1J54 A;  3BF3 A;  4DQR A;  3TTC A;  2E8A A;  4KTZ A;  5CR4 A;  2FSN A;  1E4F T;  3V9Z A;  3KK7 A;  3SI6 A;  1HMV A;  2O8F A;  1DTT A;  5FLX O;  3QIN A;  1HKC A;  1RBT A;  2P9L A;  3M3Z A;  4BR7 A;  3PX6 A;  2ZF5 O;  4E7K A;  3VEX A;  4O8K A;  5BRE A;  1C1A A;  3O9R A;  4YOV A;  4BC5 A;  3SZ2 A;  3FR0 A;  1SUQ A;  4ZTF A;  3F9K A;  4DFJ A;  4BRN A;  1NKC A;  5GAD P;  1CLQ A;  1M90 O;  4B9M A;  1YXQ A;  4BAC A;  4CGI A;  4O0J A;  2XY5 A;  5HP1 A;  1ZBH A;  1C0F A;  4ICL A;  4Q0B A;  3D0P A;  3NVK A;  3FZK A;  1YF5 L;  1HJO A;  3SUO A;  2P9K B;  3ALY A;  5FPD A;  2UUC K;  4R5P A;  2NRZ A;  4J2A A;  1IV0 A;  3SJH A;  2DTU A;  1JKH A;  4AHU A;  1LAV A;  4IG3 A;  3NDK A;  4GNI A;  1HNX K;  4O5B A;  2W41 A;  3T69 A;  3CCU N;  3CFP A;  2RKI A;  2P9I B;  1SKR A;  3NMU A;  2RF2 A;  1HQE A;  1JXE A;  1Q82 O;  1IKX A;  3QEX A;  3L2Q A;  2HHH K;  2VQF K;  2OPS A;  1KLN A;  4CF9 A;  3U3G A;  2FXU A;  4LFA K;  3V9W A;  5HOO A;  5CZ2 A;  4NLB A;  4BDZ A;  3QES A;  1S6Q A;  3WXM B;  3U4L A;  4HUG A;  2HST A;  1K8K A;  2ZJP L;  4IJA A;  1NMN A;  4Y1C A;  5E26 A;  3AO4 A;  1QSS A;  1NJI O;  3RSE B;  3K5M A;  3ID6 A;  3THY A;  4CBU A;  3A5N C;  4RWT A;  2QW9 A;  4CBW A;  3TSQ A;  1NMD A;  4CGD A;  5AQJ A;  4BQZ A;  3DRR A;  4FLW A;  1YAG A;  4H8K A;  1VSJ A;  4PQU A;  2E2P A;  4CJ4 A;  2P51 A;  4DV2 K;  1QHT A;  5M1K A;  1BDG A;  1YJ9 N;  3CF5 L;  1XQS C;  3T1H K;  1OVY A;  3OTO K;  3L4I A;  4FVM A;  3LAN A;  3D7E O;  2BGG A;  4DR3 K;  3ULD A;  3DXM B;  5BN8 A;  4CJ5 A;  2GUP A;  3UKR B;  5C24 A;  4CI6 A;  4IKF A;  4DSE A;  4FCY A;  2IVN A;  5C0Y A;  3VQ7 A;  3I0R A;  4BRE A;  2XHB A;  3ZX2 A;  4IEE A;  3PY8 A;  4O55 A;  2GEL A;  4FJH A;  1ZXO A;  3L2U A;  3S3O A;  3VQ9 A;  5M1O A;  3CET A;  4I9L A;  1WAJ A;  5SZT A;  1Z05 A;  2KFZ A;  4IDH A;  1VSI A;  3KK3 A;  3O80 A;  4CJR A;  5AQX A;  3VGM A;  4JS5 A;  4KRE A;  1BA0 A;  1C6V A;  2D4W A;  1EP4 A;  1REV A;  1XMQ K;  1UWB A;  1D9F A;  3VQ5 A;  3VEV A;  4FJX A;  3QDK A;  1SV5 A;  3G4S N;  3LP0 A;  3Q7C A;  1ATR A;  3CIP A;  2NUB A;  2UXB K;  1Q9X A;  4DKW A;  4E7L A;  4J2E A;  1IH7 A;  5HRO A;  2E4L A;  3B6O A;  3AA2 A;  1BQM A;  2IC3 A;  2NZT A;  5AZJ A;  2ZWH A;  1U04 A;  1HYS A;  4C23 A;  4DUY K;  2YI1 A;  4K43 A;  1WLJ A;  4OGC A;  1O1W A;  3CER A;  4C8M A;  4BE1 A;  3HT3 A;  5CY4 A;  3HZ6 A;  2A1R A;  3VTH A;  2A42 A;  1I94 K;  4LF8 K;  4DR1 K;  2P9K A;  3OS2 A;  4LF5 K;  1F21 A;  4Z0U A;  5FPE A;  2PFU A;  4WYB A;  4CFD A;  4OPK A;  3VPZ A;  1TKT A;  3SLC A;  4PL7 A;  3RMC A;  3OYG A;  2FBY A;  1ZYQ A;  3AVL A;  4RW6 A;  3GL1 A;  2P9I A;  4OPA A;  3C0B A;  3EEQ A;  4KI4 A;  3W3D A;  3WNH A;  3O9U A;  1SL0 A;  3VET A;  3DMJ A;  4LD0 A;  1NGJ A;  2F9T A;  5K14 A;  3HVT A;  4DLE A;  5AQR A;  1J5E K;  3L4Q A;  3A2F A;  3ASM A;  2ATQ A;  2O8D B;  4UQG A;  4WQ4 C;  1XC3 A;  2ZM6 K;  3PUF A;  4M3R A;  3CJ7 A;  2KLA A;  3MX5 A;  3RRG A;  4DTS A;  4DSF A;  4B1Y B;  4DTP A;  4ISF A;  3RSE A;  3AY9 A;  3CD6 N;  5TKY A;  5BPL A;  3M8S A;  3EZ5 A;  3OY9 A;  3HO1 A;  3VQA A;  2CGJ A;  4FOE A;  4JKH A;  1KD1 O;  3AVF A;  3U3Y A;  5AQU A;  3FFK B;  3TAM A;  1BA1 A;  5AZI B;  4KHQ A;  4AM7 A;  2UYT A;  3LZJ A;  3R6M A;  1S5J A;  3SUP A;  3BF1 A;  3LAK A;  1Y64 A;  3DXM A;  4F2S A;  1O13 A;  2Q3S A;  1YUW A;  4JI3 K;  4JI6 K;  4F9O A;  4CJQ A;  1HYV A;  3FGU A;  4KH5 A;  2P9S B;  4L3Q A;  3ZLJ A;  5GAG P;  4FLZ A;  3CCV N;  1OH5 A;  2WBN A;  4IBN A;  3CG7 A;  3NGY A;  2QEX N;  3HVR A;  4KTW A;  4FWL A;  1RFQ A;  3MN7 A;  2HHW A;  5IWA K;  1WSG A;  3CI5 A;  4IOX A;  3ATV A;  3DAW A;  4H5T A;  2W42 A;  1BL3 A;  4DU1 A;  4CGJ A;  3WQT A;  4ID5 A;  4CEE A;  1JLA A;  1KLM A;  2BTF A;  4CZE A;  1YIJ N;  1N5Y A;  3EL2 A;  3ENB A;  4JLH A;  3TTD A;  4JK8 A;  4GW6 A;  3I55 N;  3WQU A;  4IOC L;  3EKS A;  3O4Q A;  4GV6 A;  4MO5 A;  3D2F B;  1D5A A;  5DM7 L;  1WNS A;  1EWR A;  1X9W A;  4E1M A;  1QQM A;  4GVM A;  3AV9 A;  3CME N;  3UIQ A;  4JNE A;  1IG9 A;  4KB1 A;  2BE2 A;  1SAZ A;  2IOC A;  3IFR A;  2WFB A;  3AVM A;  1IBM K;  4YFU A;  3VA0 A;  3MEG A;  4I2Q A;  3JSM A;  3RMB A;  4RW8 A;  3PIO L;  1W2B M;  3LPU A;  3M8R A;  4OPH A;  3AAP A;  1RTI A;  3NF9 A;  4DV1 K;  4FJ5 A;  3NE6 A;  5J2M A;  4JV5 K;  1RTJ A;  3KLH A;  4FWS A;  1BI4 B;  2HHS A;  3WNG A;  4CHZ A;  5M1F A;  3AGK A;  3IDH A;  4CJW A;  2VGM A;  5AQZ A;  4BRH A;  5HL7 L;  1HYZ A;  3DRS A;  2FF3 B;  1IBK K;  2AP1 A;  2D0O A;  4FJM A;  2O8D A;  5TKW A;  4F4K A;  4DTR A;  1EO1 A;  4BG9 A;  2D1K A;  2Q36 A;  2E2Q A;  1S1T A;  1OVQ A;  5M1Q A;  2QKB A;  4O8U A;  3HL8 A;  2BUP A;  4PUO A;  3K0S A;  3O4N A;  5C2F A;  3U6F A;  3C6T A;  4QCL A;  4ILJ A;  4BRM A;  4B3O A;  3E9O A;  4B1Z A;  4LH5 A;  4W5N A;  2ZJR L;  4W5O A;  3IUC A;  5AZI A;  2ASM A;  2YV0 X;  4H4M A;  3O9T A;  4CIE A;  2PZS A;  4LC9 B;  2X78 A;  2FBT A;  2YNF A;  1RDD A;  3SMS A;  5FPN A;  2NRH A;  1NGC A;  1NGE A;  5HRP A;  4JKG B;  3J81 O;  4HUF A;  1IJJ A;  1X3M A;  3D2E A;  3L6Q A;  3VEY A;  1TL1 A;  5HRR A;  2X74 A;  4W5R A;  2HVI A;  2HMI A;  5BN9 A;  2QI2 A;  2FBV A;  4Z94 A;  3VEW A;  1RGI A;  4DR2 K;  1CZA N;  4LSL A;  2D0C A;  1D8Y A;  5JVG L;  3H46 O;  4KFB A;  2X6N A;  2QWQ A;  2QKK A;  3AO2 A;  4CFC A;  2LSN A;  1TAQ A;  3ZYY X;  1NWK A;  3O08 A;  4BQL A;  4CHP A;  3KJV A;  3QEV A;  3EN9 A;  3CJC A;  4KHW A;  1L3T A;  3ZSY A;  1MDU B;  1DT9 A;  3CQX A;  1ATS A;  4DQP A;  3HST B;  2P1J A;  4DQQ A;  2B5J A;  4FWN A;  1L3S A;  2YHY A;  3ZSO A;  1Z6R A;  1IKY A;  3I56 N;  3AO1 A;  4FJ9 A;  2CH6 A;  1WSH A;  4BVP A;  3D2F A;  3OYD A;  2YHA A;  3HM9 A;  4OVL A;  4FK0 A;  2O8B B;  1KAY A;  1OH8 A;  4WQ4 A;  2A41 A;  4B9N A;  3RWU A;  4B8C A;  2P9U B;  3LWM A;  3RVC A;  1MWM A;  3KD1 E;  4NXN K;  4RG8 A;  1QSY A;  1T05 A;  2HBM A;  2VCP A;  1SKW A;  3L3V A;  3FFI A;  3SNN A;  3HPH A;  2V52 B;  1EX4 A;  4JKD A;  1RT1 A;  2HND A;  4AF1 A;  4YOU A;  1SZ2 A;  5AR0 A;  4KHS A;  1NJZ A;  3P39 A;  3QB0 A;  4O4G A;  3ZT3 A;  4DQ8 A;  2VWB A;  4BRI A;  5JVH L;  1WSF A;  2OZS A;  4DR5 K;  3A5O C;  3GOI A;  1A5X A;  4E7I A;  4FVU A;  3ID8 A;  3O4W A;  2KQ2 A;  3DOL A;  4WQ5 A;  2G8I A;  4MDA A;  1W9H A;  3WT0 A;  4BVO A;  3TAR A;  5SWM A;  4B9L A;  1YI2 N;  2E88 A;  3QNN A;  3AO5 A;  3OYC A;  2UUB K;  1QQC A;  1SL1 A;  4BRP A;  1NK9 A;  4NYN A;  4K8X A;  1LWC A;  3E1Y A;  3P38 A;  1SKS A;  2ITM A;  1OH7 A;  5C42 A;  4NB4 A;  5FRM A;  3OYJ A;  4I6M B;  4I9Q A;  2F4V K;  3ZT4 A;  3L3U A;  5AQS A;  1VQ5 N;  1RBS A;  1HQU A;  1WSJ A;  4GVE A;  3RRH A;  5DMR A;  2A5X A;  4H03 B;  3QNO A;  2F96 A;  4OX9 K;  4FO0 A;  2Q1N A;  4FPA A;  3KZB A;  2QK9 A;  4R79 A;  3P31 A;  5AQK A;  1ESV A;  2AJQ A;  1HRH A;  4B1X B;  3C94 A;  4CK3 A;  4DF8 A;  2O4I A;  1NJY A;  4LFC K;  1LWE A;  1Z26 A;  4JKG A;  2NLX A;  1BGX T;  1VHX A;  4E89 A;  4CCH A;  3VGL A;  1HUX A;  4BDY A;  4DV0 K;  4GY2 B;  3CCQ N;  3O6W A;  3CC4 N;  2YNI A;  2IDO A;  3K9K A;  3C6A A;  3BY5 A;  4FOI A;  3OYE A;  1VQM N;  2Q2R A;  2F8T A;  3ZT2 A;  3AVK A;  3MEE A;  2Q0R A;  3VQ6 A;  4JK7 A;  5JLF A;  4EAH D;  1X9J A;  2QWR A;  5CYQ A;  4C8N A;  3ZEU B;  1V4S A;  3FZL A;  1JLE A;  4B3T K;  2QXL A;  3L0Q A;  4IWV A;  2DY4 A;  3UE5 A;  1SQK A;  1QS4 A;  2P5G A;  1NK8 A;  4M3W A;  3H6E A;  4FL9 A;  5AQH A;  2HNY A;  4GV9 A;  1TVR A;  3NF6 A;  3V9U A;  5T7B A;  2ZJQ L;  3DLR A;  4ISG A;  2HMP A;  1W7A A;  4FJI A;  4CGF A;  4H0X B;  3N4Q A;  2W6L A;  1U47 A;  4C8L A;  3DLB A;  2CH5 A;  2HOE A;  2X6S A;  1NGI A;  1S1W A;  1J5O A;  1YIT N;  4V19 S;  3HJF A;  2O8B A;  1DGK N;  2KZM A;  2UXC K;  3ISN C;  1JL1 A;  2YJF A;  4KHP K;  3I33 A;  2P9U A;  2V51 B;  4AHC A;  4JEP A;  4QS9 A;  5C25 A;  4BE2 A;  3NGI A;  4K0K K;  5KRS A;  4IFV A;  5BR8 K;  4IO9 L;  4WE1 A;  5GAE P;  3D45 A;  3SCX A;  2YKN A;  4DCH A;  4FM1 A;  1G15 A;  3CJ1 A;  3NF7 A;  5AQW A;  3HXM A;  4GKK K;  1C0M A;  3H1Q A;  4W5T A;  4H0Y B;  3PO5 A;  1CXU A;  1GOB A;  5C2D A;  4CHY A;  3FZM A;  5EX5 A;  2NRR A;  2H3G X;  1QHA A;  2B4J A;  3C7N B;  4PA1 A;  4X62 K;  5C15 A;  3QO9 A;  4X66 K;  4KHU A;  5KGX A;  1BIU A;  3HPO A;  3SPY A;  2R7Y A;  1TYQ B;  3AVI A;  4HCB A;  4MFB A;  4CED A;  5C10 A;  5HRN A;  3LWL A;  5I3U A;  1H1V A;  5JIC A;  1RBV A;  3DLL L;  4J2D A;  1RIL A;  3SV4 A;  1ASV A;  2GWJ A;  2GEM A;  4BR0 A;  3BUZ B;  5KGW A;  2YX6 A;  3ZET A;  1KFS A;  1T7P A;  3TI0 A;  4B9U A;  4NCG A;  4C8K A;  1S1V A;  4CVN E;  4RTF D;  1BIS A;  3V6D A;  2Q97 A;  3HOT A;  1HPZ A;  4BRD A;  1KVC A;  2XY7 A;  2QM1 A;  1RT7 A;  1Z25 A;  3QIP A;  4I6M A;  3LP3 A;  1KRP A;  3CCS N;  4PKI A;  1VQL N;  2W40 A;  2KFN A;  4OKK A;  2RN2 A;  4KH4 A;  2VQE K;  1YJW N;  1VQO N;  3MXM A;  4B1V A;  1BHL A;  1G99 A;  2OTJ N;  2V7Z A;  1UA1 A;  3RR7 A;  1VSE A;  3K58 A;  4JYA K;  3PO4 A;  2FC0 A;  4E0D A;  4CJU A;  2Z1I A;  3WNF A;  3CJ9 A;  2F9W A;  4YDU A;  3IMX A;  4FZZ A;  3QBW A;  4MDB A;  1TKD A;  1HPM A;  2BAN A;  4FWM A;  3VQD A;  1KVB A;  1NNE A;  2A3Z A;  1CZ9 A;  1YTU A;  1HJR A;  1JLQ A;  1S1U A;  2OCE A;  4CFB A;  2HNZ A;  1LAW A;  1GLB G;  3O3F A;  3K59 A;  1EET A;  4M3Z A;  3TAE A;  4CEO A;  4OPJ A;  5KTQ A;  4M3T A;  5AQT A;  3ZEU A;  3CFR A;  2KZZ A;  4YY3 K;  4ID1 A;  3RR8 A;  1NOY A;  5CE3 A;  4FLV A;  4JHD B;  3E66 A;  1RT6 A;  4CE9 A;  1ITG A;  3VEN A;  3HTV A;  4DR4 K;  1ASU A;  5AQF A;  4JI8 K;  3DI6 A;  1BCO A;  4ILH A;  1JLG A;  3BGR A;  3KHY A;  3R8E A;  3W0L A;  1UOC A;  3LL3 A;  1GOA A;  5LMU K;  1W97 L;  3QER A;  3AA5 X;  5CZ1 A;  5EVZ A;  5BRD A;  3MN5 A;  5HLF A;  1NGG A;  3VMF B;  3ZSR A;  2YJE A;  1GLF O;  3S41 A;  3OYH A;  3C65 A;  4H5R A;  1IO2 A;  4CF8 A;  2P5O A;  2FLO A;  3AA4 A;  1KAX A;  4HTL A;  3FLC O;  1ZBU A;  3LDQ A;  4DHY A;  4JD2 B;  1XI1 A;  2KHO A;  3VF4 A;  3C7N A;  4DSI A;  3SK3 A;  3M5R A;  2NRW A;  1NJW A;  3DJC A;  3CM6 A; 
#chains in the Genus database with same CATH homology
 4NXN K;  4B3T K;  1N33 K;  4X65 K;  4JYA K;  3T1Y K;  2HHH K;  1XMO K;  1N32 K;  4JI7 K;  4LF9 K;  2VQF K;  4JI4 K;  4DUY K;  3J7Y P;  4LFA K;  4B3R K;  4DR5 K;  5AJ3 K;  1I94 K;  4JI5 K;  4LF8 K;  4DR1 K;  1HR0 K;  4LF5 K;  5IWA K;  4AQY K;  4V19 S;  1XNQ K;  4DV6 K;  4JI2 K;  4B3M K;  2UXC K;  4KHP K;  4JI1 K;  4YHH K;  4X64 K;  3J81 O;  4K0K K;  5BR8 K;  2UUB K;  4JI0 K;  4YY3 K;  5FLX O;  4DR6 K;  4DV2 K;  1IBL K;  4DR7 K;  5A2Q O;  4GKK K;  3T1H K;  3OTO K;  2UXD K;  4DR4 K;  4CW7 B;  5LMN K;  3JAM O;  2F4V K;  4DR3 K;  5LL6 Z;  4DR2 K;  1N36 K;  1J5E K;  4LFB K;  4JI8 K;  4X62 K;  4DV7 K;  4B3S K;  2ZM6 K;  4DV4 K;  2E5L K;  4DUZ K;  4X66 K;  1IBM K;  4DV3 K;  4OX9 K;  4LF6 K;  5LMU K;  1HNZ K;  1N34 K;  4LFC K;  5IT9 O;  1FJG K;  4DV1 K;  4LF4 K;  4NXM K;  2UXB K;  4CVN E;  4DV0 K;  4JV5 K;  2UUC K;  1XMQ K;  1HNW K;  2UU9 K;  1XNR K;  3J7A P;  3J80 O;  1HNX K;  4LF7 K;  2VQE K;  1IBK K;  4DV5 K;  4JI3 K;  4JI6 K;  2UUA K;  4GKJ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...