4V19S

Structure of the large subunit of the mammalian mitoribosome, part 1 of 2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
143
structure length
143
Chain Sequence
PVENEAVAPEFTNRNPRNLELLAVARKERGWGTVWPSREFWHRLRVIRTQHHIEALVEHRNGQVVVSASTREWAIKKHLYSTRNVVACESVGRVLAERCLEAGINFMVYHPTPWEAASDSIKRLQHAMTEGGVVLREPRRIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
pubmed doi rcsb
molecule tags Ribosome
molecule keywords MITORIBOSOMAL PROTEIN BL27M, MRPL27
total genus 25
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4v19S00
4DV0K 4LFAK 2UXCK 4B3TK 4YHHK 2VQFK 2ZM6K 4DV1K 1HR0K 4V19S 4DV3K 3T1YK 4JI1K 1I94K 4B3SK 4LF4K 4JI3K 4DUYK 3T1HK 1XMOK 4YY3K 4K0KK 4DR5K 4X62K 2UUAK 4DV7K 2HHHK 1N36K 1FJGK 4X66K 1IBMK 1IBKK 4NXNK 4GKKK 4JI5K 1IBLK 3J80O 2UUBK 1N34K 5A2QO 5LMNK 1J5EK 4LF8K 2VQEK 3J7AP 1XNRK 4B3MK 5IWAK 3J7YP 4DR7K 1XNQK 4OX9K 4B3RK 4CVNE 4DR3K 3J81O 2UXBK 5AJ3K 4DR6K 4DV4K 4GKJK 2E5LK 4AQYK 5LL6Z 4JI0K 4JI2K 4DR1K 5LMUK 4LF6K 4X65K 4JI7K 4DV2K 4DR4K 3JAMO 1N33K 1HNXK 4X64K 4LF9K 5FLXO 4DUZK 4LFCK 4JI8K 5BR8K 4DV6K 1HNZK 4LF5K 1HNWK 1N32K 4CW7B 2UUCK 4NXMK 1XMQK 4DR2K 4KHPK 2F4VK 4LF7K 4JI4K 4LFBK 2UU9K 4JYAK 4DV5K 4JV5K 5IT9O 2UXDK 4JI6K 3OTOK
chains in the Genus database with same CATH superfamily
1VSJA 4B1YB 4BG8A 3OYNA 4WQ4C 1C0FA 4BRGA 1B9DA 1C1BA 2E2PA 3NHGA 2HBKA 5J1EA 5KTQA 3KWIA 1RBVA 4AM7A 4KTQA 3OYBA 4CECA 1RTDA 1D9DA 3T1HK 2HMIA 4CEEA 4FJ7A 2CH6A 4CZGA 4BG9A 3IDHA 2ZGYA 1Q81O 4CEOA 5M1PA 3VOVA 5J2QA 4FWOA 4CEQA 4HHTA 1K8AO 1GOBA 3HP9A 4KTZA 3QBWA 1WUAA 1VQNN 1YVUA 3OY9A 5AQVA 4C8MA 4DF8A 4FOEA 3HPGA 4FWNA 3VQQA 1TKZA 3ISNC 1JLBA 1RDDA 4B9NA 3V81A 4CJWA 4CEFA 4U7BA 4N5SA 3CG7A 1T7PA 4H5VA 1BDGA 2F9TA 1LCUA 3PX6A 1RT6A 1H1VA 2D0PA 1L3TA 3CYMA 2WC9A 4IG0A 4JI2K 3CFPA 5JLFA 2JWKA 2YV0X 1L3VA 3LDSA 3KTQA 1HJOA 4H0XB 3PSFA 4FLVA 4CHPA 2Q97A 3HVTA 1BO5O 4CJ5A 4JI7K 5JS1A 3JAMO 1TK8A 3OYHA 3CM5A 4K8ZA 2A5XA 1VQLN 3DLRA 1OVYA 2Q3SA 3VTHA 3D45A 2NRHA 4PL8A 1NGHA 4M41A 1RBTA 2VWJA 1KC8O 2FBVA 2NRRA 4GV9A 3OYCA 1ATNA 2PBDA 3QB0A 1QQMA 3LWLA 1EQYA 3BEXA 3WNFA 3LDQA 3CCEN 1KAYA 4JD2B 2IC3A 2FSJA 4H0TB 3VQ7A 4LF7K 3CPEA 2QWLA 3D2EB 3VQ8A 3V6DA 4Y1DA 5BPMA 4K42A 3AVNA 2O8DB 4DQPA 2E4LA 3NGZA 1NMDA 4QOZB 3TAPA 3L8BA 1EO1A 2O4GA 1RFQA 3DI6A 4DTOA 4CZKA 3TSQA 3EKSA 5F1XA 4FSVA 3DYAA 5GAHP 2FSNA 2P5GA 1XMOK 4BWMA 4I9QA 4FZXC 4CBXA 4CFCA 4FJ5A 4FLTA 4CJPA 3KK7A 2ZJQL 5TKWA 1ZXOA 2HOEA 1T3VA 4J2EA 2PZSA 1NU0A 1LW0A 4CHQA 5HRSA 2VCPA 3MMVA 4RCHA 2Q31A 2FBTA 2PYLA 3LZIA 3ALYA 2KHOA 1QVGM 4WCEL 2G8IA 3EN9A 3HPHA 3VESA 1XNRK 1VSEA 4CJTA 4ZTJA 3KIOA 5JVHL 4B3RK 2D1KA 5C24A 4KHUA 1YTAA 3G25A 1NOYA 4FYDA 3V9ZA 3D7EO 4DKWA 3WXKA 3SUPA 2G8VA 5DK5A 1VQ6N 3TI0A 3NH1A 1IH7A 1SL0A 3ZT2A 3O9TA 2QI2A 4CBUA 3WNHA 1UAXA 4IXCA 2YKMA 4DV2K 3JYTA 3PX4A 3AO5A 2W40A 4LF9K 2P9PA 2Y1IA 5KPRA 4CZFA 3AARA 3VEZA 1OH6A 3E1YA 5BR8K 4BRIA 1WLJA 4Z4CA 4EHTA 3CJAA 1ATRA 3U8XA 4KB0A 1ILYA 3P5JA 3DLKA 4CJRA 4CZIA 3HTVA 2KLAA 4DFKA 3RWUA 4HVJA 4BDZA 4ID1A 5EU7A 3OYLA 3CQXA 3AVJA 4JRPA 1K8KB 4FPAA 5EXWA 1UA0A 3FFKB 2UXDK 1VQ7N 1X1PA 4FK4A 4DSFA 2VG6A 3M8SA 1HUXA 2RE2A 4EP5A 2WUSA 3KHYA 2NZTA 1XC3A 3HSCA 4BC2A 2FBYA 5SWMA 5LJVA 1NGAA 4X66K 2OCEA 3SLCA 1HQUA 4JKAA 3NAEA 1JCEA 4A57A 4PKHA 1S6PA 1KFSA 2IVOA 4OPAA 4BC4A 2ZWHA 4A59A 3DLHA 4HTUA 2GELA 5E84A 1T03A 4ELTA 3C0BA 4AHSA 5A2QO 2YNHA 5M1NA 4BE0A 3OS1A 2F7TA 1VQ9N 3BF3A 4KFBA 2F9WA 1YF5L 4CEDA 1JJ2M 5IWAK 3D0PA 1VQ5N 1J54A 3VEWA 3MCPA 4CIEA 2OZSA 4WF9L 5I9EB 4DTSA 3NVKA 4GKJK 3PUFA 4BVPA 1IKXA 4Q0BA 1VK0A 2FF6A 1NK4A 3U4LA 3HOSA 4BREA 3S3NA 1R0AA 3EO3A 4A61A 2P9NB 1VQKN 3WEEA 1LWFA 3B8AX 3RRGA 4CGGA 4JS4A 3W0LA 1QHTA 4FWKA 4B1ZA 2WOMA 3IRXA 4Z0UA 4FK0A 1FK9A 2E2OA 4FW2A 5AQOA 4QCLA 1XWLA 4FPBA 5HRNA 4NYFA 1QQOA 2PAVA 4ZHRA 1K6YA 4MQ3A 1IG9A 2QXLA 3L2UA 3LWMA 3LAMA 4GNIA 5SZTA 4IZ9A 3CQYA 1KD1O 2UU9K 2YI1A 1WSHA 2YHXA 3IKMA 2AP1A 4DSIA 4JEPA 3WNGA 5CHIA 4Z4FA 3AVLA 4K25A 3FFIA 3L3UA 2CH5A 2A6AA 1NJXA 2P5OA 3S3MA 4BRHA 1I94K 1RBRA 2ITGA 1WSJA 4ELVA 5D3GA 5EOYA 4DUYK 4OKJA 3LDNA 1TGOA 1LWEA 4K0KK 1UOCA 2GUPA 3SI6A 1ASVA 4IFVA 3CCQN 1MDUB 2E2NA 3JXUA 2D0CA 1Q86O 2CGKA 2P9LB 3VTIA 4Z4HA 4OGEA 1NGJA 4Z4EA 4EHUA 4AF1A 3J80O 3DMJA 2D0OA 3DOLA 5ELZA 2FLOA 3SQ0A 1FXXA 1S6QA 5LMNK 3LPTA 1C0UA 1REVA 1VRTA 5AQRA 3V9SA 3E66A 2E2QA 3OYIA 1HJRA 3F9KA 3SAGA 4CZEA 3PO5A 2QWQA 4OX9K 3A5OC 1HKBA 1KXPA 3E9PA 4RW4A 1VAZA 5BPLA 1DT9A 3A5LC 1J53A 3OJSA 3KD1E 5FPDA 3SUNA 1XHZA 1RGIA 3ZSXA 3FZKA 4NYNA 1T8EA 3OVNA 3N4PA 1GLFO 2XHBA 4DU1A 1VSIA 3EY1A 4DTUA 5FPMA 1XHXA 4HTLA 4CJ3A 3ZSRA 4KHSA 1HNZK 4LF5K 1HNIA 2X74A 2GUIA 2KTQA 4OLBA 3OYMA 4NXMK 1SKRA 1LV5A 1ZBHA 4E19A 2YJEA 5FROA 1EXQA 3RVCA 3CFOA 5BRFA 3L6QA 2YCHA 1EETA 5AQIA 1U4BA 4B1VA 3FZHA 1VHXA 1VQMN 5KI6A 3QEPA 1NK7A 1S5JA 3L2WA 4OJRA 2PY5A 4FWQA 4B1UB 1LAWA 4WQ5A 1HKGA 2B5JA 5C42A 4BGAA 2W41A 3CCRN 1FKOA 4H0PA 2RF2A 3WUHA 3HJFA 1C0GA 3RR8A 2E8AA 4DV1K 3D2FA 2IS3A 3A8YA 2G8UA 3GBTA 4O0IA 3LM2A 2O4IA 3VA3A 2D4WA 2QKBA 4CJKA 2ASOA 1KLMA 3ULEA 4CCHA 4JN4A 4Y0WA 2QK9A 4BVOA 2B4JA 3K9KA 1TKTA 4KKOA 4RW9A 4ICLA 3OS2A 1U45A 1Z6RA 1N5YA 3WXLA 3PV8A 3WQUA 3QMLA 4CIGA 3MXMA 3BDPA 3K9JA 1QHAA 2VQEK 3I33A 2UYTA 4M63C 3D2EA 4QS9A 4PA1A 3K58A 1HYZA 3RSEA 4K8XA 1KVAA 4JRQA 1XNQK 4CVNE 1LOTB 1NNEA 4CK2A 1GOCA 4PWDA 4DR6K 1HLUA 1VSLA 2P9UB 2Q2RA 2KW4A 3MXIA 2A3ZA 4U67L 4L8RB 3RMAA 3O8MA 3G6EN 3V4IA 1TVRA 3RMCA 1TKDA 3SAHA 4FJNA 2F8SA 3KVGA 4H5RA 4XH4A 4DS5A 2V52B 3OYDA 3VF4A 3ID8A 3MDQA 3HBTA 2QWOA 3CERA 4DV6K 4BR9A 4DTJA 5K14A 4B9TA 4JKHA 4FLWA 5F0XA 3NF8A 4CD1A 1XC9A 4FWSA 4N41A 5AQMA 1NGBA 4RW8A 3PIOL 3OHRA 4CEZA 3MXJA 3LAKA 3GOIA 2H3GX 1KVCA 4LD0A 3AA4A 3OTOK 3ENBA 4C1NK 2UXCK 2OPPA 3NFAA 5HOOA 2EHGA 4YHHK 2VQFK 4C8KA 4N56A 4FJ9A 4CFBA 5BN8A 1XUPO 1WSEA 3RTVA 4KRFA 3P38A 4E7JA 2A1RA 3L0QA 1QE1A 2NNWA 4MFBA 4H0VB 3T7ZA 5AZIA 1OH5A 3LDPA 2HHHK 4FO0A 3SZ2A 2ASMA 1IBKK 4CHZA 3SPZA 2FXUA 3VEXA 2DY4A 4XH1A 1Q8IA 4DLEA 3ZT1A 4BR2A 3MECA 1BIZA 1N34K 1K8KA 1RT3A 5BR9A 2HHUA 4GY2B 2VG7A 3THVA 4EZ6A 4M42A 3U3YA 3SUOA 3M8QA 4FXDA 4O44A 4M3TA 3O3GA 3C6UA 1K9MO 1TV6A 4J8FA 4HCBA 4I6MA 4DR3K 3ZLJA 3ZETB 3IAYA 2W6LA 3A5NC 4DB3A 1P90A 2WONA 1T44A 4JK7A 1QQNA 4FWLA 4FM2A 3QBXA 1MWMA 4DQ8A 3O4QA 2G8FA 3FZMA 3F2KA 1FKPA 5C15A 5KRSA 5AQUA 2HHTA 2AA4A 4YOWA 1JKHA 1HNWK 3TR8A 2YHWA 4CW7B 4JHDB 3Q7CA 4GVMA 1W0HA 1NK9A 1NG9A 1X9MA 4A2AA 4FL9A 4CEBA 4O5BA 3DRRA 3NF9A 2DFHA 3OYGA 4Z94A 4FJMA 4CJ7A 3K5OA 4BRFA 1D4XA 5IT9O 2QWPA 5CYQA 4IBNA 3OYFA 4FLZA 3VGLA 4DV0K 2GWJA 5AQTA 4CESA 4DQQA 5ADXH 4IEIA 2QXFA 2O8CA 3DLGA 2HHWA 2ZE2A 3TAMA 4JI1K 4DLGA 4TSXA 2W6KA 4H4MA 3ZSOA 1NJYA 4YY3K 4CJ4A 3RMDA 3HO1A 3M6GA 3C65A 1SKWA 2B6AA 4E7HA 4LC9B 3M8PA 5AQHA 4BE2A 4CGFA 4BC3A 4FM1A 2O8DA 2XY8A 2VGNA 1HQEA 2XY6A 1C6VA 1WNSA 4IDHA 3L2RA 1IBLK 3AA2A 3B6PA 1P8ZA 1NK8A 4ILJA 2RPIA 1NK0A 3OYEA 3NVMA 4O8KA 3UKRB 1NBWA 3VQAA 2WBNA 1YJ9N 3CCUN 4DR7K 1KQSM 1E4FT 4RTFD 5HROA 2OYQA 1HRHA 3J81O 2ASPA 4MDBA 1VQON 2BANA 1FW6A 2WFBA 3NMUA 1G99A 1NGCA 1YT3A 3I0RA 1BIUA 4N47A 3P4IA 1Z26A 3QINA 5LMUK 1QSLA 4O0JA 3MN7A 4DU3A 3R9PA 1TL3A 3GDQA 4CJSA 4E1MA 2I7NA 3GL1A 2F96A 3CCVN 3VETA 3F73A 4E3SA 5AQKA 4AHUA 4DUZK 4CI6A 3ID6A 1OH7A 4RW6A 4BRQA 2R7YA 4H8KA 1CZ9A 1B9FA 2UUCK 4JKDA 3CETA 3I0SA 4ISFA 2DFFA 4ELUA 4AHTA 4CJUA 4IEEA 1BCOA 4BDYA 1VSFA 1WSGA 4Q5VA 5M1FA 4LFBK 3LP0A 4ZTFA 3WXMB 3OW2M 3Q7BA 4PHTX 1NLVA 3TAQA 3CCLN 3F9MA 3DWLA 4JKGB 1GLLO 4WQ4A 3D2FB 4KHYA 3ZYYX 5BREA 1U49A 4IFEA 1C1CA 3SJJA 1HR0K 4V19S 3C7NB 3T1YK 2YKNA 2BH1A 3AY9A 3V9UA 1U2VB 4DTMA 4JK9A 1RT2A 3LP2A 3HVRA 2UUAK 2D0AA 3L3VA 1L5UA 3LDLA 4UQGA 1S1XA 5CR4A 3CFRA 3TWHA 4DS4A 3E01A 3ZX0A 2PYJA 2ZJPL 3MAQA 4FLYA 2NRTA 4JI5K 3THYB 4O5FA 4CF2A 1NWKA 3EYZA 3H1QA 3VEVA 4C8LA 3UKUA 4BGBA 5KGWA 2OZMA 2OANA 4MO4A 1VQ4N 1BU6O 4J2BA 3V9XA 1JCFA 1RDCA 2YX6A 3K5LA 4FJIA 2ZQBA 1BOTO 3N4QA 2I7PA 3O3HA 4NB4A 2YNFA 5FRMA 4HUGA 4QS8A 3KKRA 2E5LK 4FJLA 3TARA 1RT1A 4DTPA 3K0SA 1XI1A 4B08A 4HWIA 1EWRA 1DTQA 1S1WA 2WTUA 1TK0A 1JLFA 2OPRA 4DTRA 3ENOA 3AA3A 1J6ZA 2P9KB 5KRTA 1VSHA 1X3NA 5CE3A 1NGFA 1ZC6A 4A2BA 1NGGA 3OYJA 5CY4A 1YJWN 2VYPA 1GOAA 3KLFA 4DR2K 3DLLL 2HF4A 3AO1A 1TKXA 3DXMA 4NO7A 1BI4A 5AQQA 1IKWA 3TTFA 4B9QA 1CLQA 3F5TA 4BRPA 3ATVA 3QEWA 1YXQA 1C0MA 3CC2N 4JV5K 4F3OA 1GLJO 5B8HA 1IKYA 1Q7YO 3A0IX 1S9GA 3RR7A 3ATUA 1JLAA 4CEAA 1NKBA 1QS4A 1D5AA 3CJ7A 1OKJA 3AVAA 3MX2A 3CMAN 4FWRA 4DV3K 3CXCM 1NGEA 3VENA 4JK8A 4BQZA 1DEJA 2HHSA 3QESA 1VSKA 3DXMB 1GLDG 2HSTA 4YNQA 1YIJN 4DV7K 3NF6A 3VF2A 3MWTA 3HRGA 1BL3A 1DGKN 4CK1A 2QWNA 4LSNA 2P9SA 3QDKA 3NGYA 3ASMA 4IFYA 3IG1A 5FRNA 1W9HA 5HLFA 2OA8A 4FJGA 4M3YA 4HCCA 4CF1A 3ZX2A 1HYVA 1HX1A 1EP4A 4Z4GA 3L2VA 3GE1A 3O9UA 3SMSA 1ZBFA 1JL1A 4AHVA 3PIPL 4F3TA 5E26A 4LF8K 4NCGA 1Y64A 3W3DA 4KAZA 3EL2A 3HI0A 4KBOA 1TUUA 2E1ZA 3G4SN 3C6HA 1UWBA 3L4QA 3J7YP 4JS5A 2P9NA 3TSUA 3O1BA 3M1FA 1KTQA 1KAXA 3QEXA 3CHWA 4E89A 2EWSA 3P1GA 4J2AA 2YHAA 4CZMA 4JI0K 3WT0A 3K5MA 5T7BA 3VQBA 2P9PB 5EX5A 5C10A 4DQIA 4BR5A 4LF6K 4ISGA 2FBXA 1RILA 1VRUA 1C1AA 1ITGA 4BR0A 3OS0A 4AILC 1SS6A 3WQTA 3WXIA 4M3UA 5BRHA 3AO3A 3THYA 4B1XB 3ZSYA 1RDWX 3R3LA 4KB1A 4CJVA 1QSSA 1IV0A 1DLOA 4BRKA 3WNEA 3ZSWA 4BACA 4FLXA 2BTFA 2QM1A 1X9JA 3H45C 1RBSA 3OBYA 2DPNA 4JI4K 2O8FB 4CGDA 4CZLA 5AQGA 3CC4N 1KAZA 3U9ZA 4F2RA 4JKGA 3O5BA 1SKSA 1S9EA 3DRSA 2OTJN 4BRDA 1EX4A 2F8TA 3LZJA 5M1QA 3CCJN 1SAZA 4EP4A 4DMNA 1JXEA 4IJNA 3AAQA 2HHXA 3CI5A 5JICA 3AVFA 5BN9A 3P31A 4A5BA 4PKIA 4GVEA 2YNGA 2QA4N 3THWA 4KO0A 4KH4A 4CGIA 4X62K 5HP1A 1RBUA 4M3RA 5ADXA 3THWB 1BCMA 2ETJA 2GX9A 4G1QA 3VQPA 2OPSA 4I2PA 3O9RA 4F4KA 5AQZA 1HNVA 3OYKA 1S1TA 3L4IA 3AVGA 2X6NA 3P83D 4BROA 1WSIA 5FPEA 4MLHA 1U6ZA 1X9SA 4CD3A 4BE1A 3QIOA 5H1SQ 2O8FA 3AGKA 1SQKA 4LSLA 3C95A 3AA5X 1GLBG 4CHOA 4DCHA 5J2MA 2E20A 2UXBK 2I5JA 4DSJA 1B92A 3T1AA 5CZ1A 3VQDA 1V4TA 1Z25A 1KCFA 3DXKA 3PSIA 2IIRA 1TK5A 2E6LA 1ZYQA 3VN5A 5JS2A 2EX3A 1UA1A 2FSKA 5MLCQ 3SJHA 1WAFA 4F2SA 4BRAA 2BUPA 4JKFA 1MU2A 1NGIA 1I39A 3R8EA 1M1KO 3FE1A 3BF1A 3SPYA 4BRMA 3MN9A 5JLHA 1YJNN 4YFUA 2NRVA 2GEMA 5LJWA 4BY9C 1YTUA 4B9SA 1Q18A 1ASUA 1O1WA 4YDUA 4DFMA 3HOTA 3O80A 1C0TA 2HBMA 3ZSVA 4B3OA 3AVBA 3CM6A 4AH9A 2KZMA 4YOYA 3AVHA 2ITMA 2Y1JA 1W7AA 4DF4A 4KPYA 4IO9L 2RHKA 3ZCMA 4RW7A 4A5AA 2E88A 3E9OA 4ISEA 4WFBL 3SQ1A 1RTJA 4OLAA 3ULDA 4FJ8A 4DFJA 1KRPA 5AFUA 3LP3A 3EEQA 3K2PA 1YUWA 3T69A 4BDPA 4M3ZA 5BPNA 4H0OA 2IVPA 1OH8A 2KFZA 1N36K 1NM1A 4FM0A 1Q82O 4OGCA 3R6MA 5AQPA 1JLCA 4KHQA 3JS6A 5AQSA 3VQ6A 4MLEA 2QW9A 2XY7A 3THXA 3V1RA 2CGJA 3HXMA 1U48A 1S1VA 4YOUA 3TPQA 3A5MC 4I9LA 1BA1A 1CZBA 4FJJA 3CF5L 4B3MK 1BQNA 3CQ8A 1W2BM 3FLCO 3HSTB 1LW2A 4E0DA 5AJ3K 2G8KA 4KV8A 1JCGA 2Z1IA 3QETA 1JLQA 3ZETA 4M3WA 4IDKA 4I6MB 3UE5A 3VMFB 1HKCA 1RNHA 1IO2A 3ENHA 4ILHA 4BRNA 1A5VA 3AAPA 1BGXT 3QIPA 2IOCA 4CJEA 4X65K 4C8OA 4DR4K 3PX0A 3DLEA 3NF7A 3SBTA 4FVUA 3C6AA 3AVMA 4MDAA 3MEGA 3H08A 3MK6A 3TAGA 4UY8O 2J4RA 3TAFA 2P9SB 3RRHA 4JKCA 1VSDA 3T3FA 2AJQA 4XIUA 2BDPA 5C0YA 1S1UA 4LY7A 2P9LA 1ZBIA 4JNEA 3AVKA 2Z1GA 4W5OA 1CZAN 3ZEUA 3KKSA 3QERA 3BZKA 3I8BA 2FF3B 3PLAA 4QS7A 4DSLA 4DTNA 3SMPA 1GLAG 3UKUB 5KPZA 4B3TK 4BWJA 5KQDA 4WE1A 4O55A 4M7YA 3PO4A 1V4SA 4Y1CA 4B3SK 3G71N 1JXBA 2VWBA 5GINA 4HUFA 1Z05A 1RT7A 2HBLA 3FZLA 4OPHA 2IDOA 2NRWA 2YHBA 1BISA 1ZBLA 1U2VA 4H03B 5AZJB 4F8RA 3MN6A 3GG4A 3NE6A 2VWKA 3C7NA 3V1QA 2P1JA 1GLEG 4OO1J 4IOAL 3IFRA 1KLNA 3QNOA 1WN7A 5GIOA 1CXUA 5CZ2A 3O4WA 5AQJA 3NH0A 4IO8A 1SL1A 3DLBA 4RWTA 3KLEA 1JLEA 2HNYA 3V1OA 3QO9A 3RSEB 4CZJA 1VQPN 5HBMA 4B8CA 4DR1K 3DJCA 3SCXA 1Y97A 2NRZA 3K57A 5J2PA 3O08A 3VQEA 4WFNL 3NDKA 2YJFA 2V51B 3LANA 2Q36A 2HNDA 4GV3A 4H5TA 5HRPA 3CD6N 3ZT3A 5AQLA 3EE9A 4H5NA 1XMQK 5TKYA 3O4NA 4WYBA 4XEIA 1YITN 2KZZA 5AQNA 3MN5A 1RT4A 1NGDA 5JMVA 1RCHA 3UKRA 4BR4A 2O8EA 1IKVA 3V9WA 3VGMA 1SUQA 4DFPA 1JL2A 4DU4A 4QAGA 3I56N 3CMEN 2NLXA 1NJIO 5KPTA 4CK3A 5AZJA 2QEXN 1MA9B 3HM9A 2XY5A 1F21A 3VEOA 3LDOA 2GTDA 4FZYA 4E7IA 3IS9A 4CF9A 4E7KA 3H1VX 2CGLA 3I55N 1QTMA 1DTTA 3SBGA 3BGRA 5EY4A 2YHYA 3M3ZA 1YI2N 1IBMK 4W5RA 4A62A 3VQ9A 5BRDA 4M7XA 4YOTA 4RG8A 5HL7L 3TTCA 3QEVA 4H4OA 4GW6A 3RMBA 3ZEUB 2A40A 2JWLA 3SAFA 1J5EK 4EIAA 3J7AP 3KLHA 2Z1HA 3QICA 3KK1A 2G8WA 4DHYA 5AFUH 1WB9A 1IJJA 4NLBA 5HRRA 1RT5A 4CZHA 1KVBA 3NBPA 4J2DA 5I42A 3ZSQA 5LY3A 4KI6A 2HB5A 3O9SA 4B9VA 4YORA 4OPKA 4NCBA 3TU5A 1U04A 4IKFA 2QWMA 2V7ZA 1HPZA 2HBJA 4BQLA 4DG1A 3C6TA 3QFPA 1ATSA 3G10A 3KD5E 5DM6L 1K73O 1HYSA 2VGMA 3P39A 4IG3A 3HL8A 1ASWA 3MWPA 1ZBSA 2BGGA 3A2FA 4CJLA 4C1NI 4LFCK 1RDAA 4F9OA 4FVMA 2GV9A 4NCAA 1WSFA 3TANA 1CXQA 2FC0A 4EZ9A 3HYFA 3FR0A 1W97L 1NK5A 1IG8A 4IWVA 3B6OA 4C23A 1HPMA 4YDUC 1KSPA 3H3NO 1I3AA 2D0BA 3AGRA 3AVIA 3LALA 5DM7L 4PQUA 3J7ZO 4FCYA 2O8CB 3BY5A 3THXB 4B9MA 1SV5A 3VF6A 3PY8A 1M90O 4JI6K 4DQRA 1LAVA 3NH2A 1TL1A 5C2FA 1N8RO 3S9HA 4FLUA 4PY5A 3VA0A 4WFAL 2A41A 3EE8A 4BR7A 1D9FA 1T05A 3LL3A 4JAXA 1S3XA 1NJZA 2HW3A 5AZIB 3TAEA 2HF3A 2NUBA 1S22A 2Z1JA 4JKEA 2ATQA 3BUZB 2V7YA 3K5NA 4JHDA 4CERA 5CYMA 1NMNA 1QQCA 3AV9A 3CJBA 3O9QA 1WOQA 4EAHD 1X3MA 3EZWA 1SL2A 3ITHA 3LPUA 2XO7A 1WAJA 3SYZA 3T19A 3HPOA 1YAGA 3UIQA 3ZT4A 3OYAA 5JVGL 3IMXA 2HMPA 4HUEA 2D5RA 3CC7N 3HM8A 3J8AA 5DMRA 2E6MA 4CHYA 1BI4B 4W5TA 2P51A 1A5WA 3R1XA 4DV4K 3WXJA 5LL6Z 1RTHA 3OJUA 4B9UA 1LWCA 3NGIA 4OKKA 4CFAA 4CFDA 4M45A 5C2DA 3QLHA 2P9KA 2PFUA 1WBBA 5M1OA 3HK2A 3DXKB 1HNXK 4X64K 3VEYA 4AHRA 4CE9A 4BRCA 4FK2A 1HMVA 3EKUA 4W5QA 2JGUA 1QZ6A 4CBWA 4CJQA 4R79A 5E41A 1D8YA 3VQ4A 5F2RA 5C25A 3BP8A 1NK6A 2BE2A 3QFUA 4ILGB 4KHNA 2RKIA 1BA0A 3U6FA 1BHLA 4AHCA 3ZT0A 3LM9A 4CHNA 4E7LA 1XQSC 3CJ1A 5I3UA 2Q0RA 3MEDA 3TABA 4ID5A 3DM2A 4GMJB 3G0ZA 4CF0A 3NCIA 3VQCA 2A42A 4FWMA 2ZM6K 1YHQN 3CIPA 3M5RA 4M3XA 3CCSN 1GLCG 3ULEB 1NKEA 2HHQA 3M8RA 4KTWA 1R59O 1U47A 4YOVA 3DRPA 3SV3A 5GAEP 3DOKA 3EZ5A 2OTLN 4NLCA 3HP6A 4DSKA 1L3UA 4NXNK 1QZ5A 4LH4A 5C12A 1EKEA 2IGIA 3SK3A 4KHWA 4H0YB 1MWKA 1NOZA 5EVZA 2UUBK 2Q1NA 3KLGA 1RDUA 2QTDA 3OA9A 2ZGZA 4C8NA 3H6EA 1TUYA 3KJVA 5AQFA 3FZFA 2W42A 1O13A 1E3MA 4K43A 1QSYA 1T6CA 4WQ5C 3O3FA 2P9UA 1X9WA 2ZF5O 3D6RA 4O8UA 2QKKA 1BUPA 4B1WB 3FGUA 4LH5A 3MCAB 2E1YA 3IUCA 4DQSA 3CJCA 4I2QA 1Q9XA 4JLHA 1BG3A 4R5PA 3JSMA 4G9ZA 2XRIA 3QNNA 2P9IA 3S3OA 2HNZA 4KH5A 3UB5A 1BWFO 1JLGA 3K59A 2GBZA 2OPQA 3ZX3A 4K41A 1G15A 3LP1A 3AO2A 1TYQA 2GWKA 3VQ5A 1RTIA 5AQWA 4CJFA 2HVIA 4IOXA 4CIFA 3SQ2A 4KHPK 3AO4A 1RDBA 2DTUA 4OPJA 1E4GT 5KQ8A 2JLEA 4O4GA 2DFEA 3KLIA 4JYAK 4FW1A 4DV5K 4GV6A 1YVNA 4W5NA 4EFHA 2LSNA 4MO5A 1KFDA 2ZJRL 5J2NA 2O8BB 1OVQA 2IVNA 4BC5A 4YOXA 4LFAK 3U9DA 1N6QA 3E9LA 3O1WA 4JKBA 3SV4A 3C94A 3MX5A 2X6SA 4AM6A 1J5OA 2O8BA 4XH5A 5GADP 4LF4K 4JD2A 4L3QA 4B9LA 4JI3K 3HT3A 1TAUA 2O8EB 2IAJA 3H46O 4KI4A 1SZ2A 4N76A 4IJAA 3SUQA 4DR5K 3H3OB 1ESVA 1VQ8N 3SNNA 1FJGK 5KGXA 3AVCA 2KQ2A 4OVLA 4DTXA 4FJHA 5AR0A 4FZZA 4OKEA 4GKKK 1TYQB 3KK3A 1ZBUA 4PL7A 3KWGA 1T6DA 3TSPA 2Q0UA 4KH6A 5GAGP 3KK2A 1L3SA 2P9IB 4Z4IA 2KFNA 1A5XA 3HZ6A 4E1JA 2KKZA 1TAQA 4PKGA 3MEEA 1EWQA 5AQYA 3KZBA 4PUOA 5FDLA 1Q9YA 4B8AB 2HHVA 1DKGD 4AQYK 1NKCA 1J9AA 2G8HA 3SQ4A 5GIPA 1BQMA 5FPNA 4E1NA 3DAWA 2QWRA 4BRLA 4CF8A 3QEIA 2VG5A 4DWIA 1N33K 2X78A 2NRXA 3WEEB 5FLXO 4JI8K 2YNIA 1QVFM 1S72N 3L2QA 1N32K 3CPWM 4KREA 3O6WA 3VERA 5M1KA 4IOCL 4FJXA 4CGHA 1NJWA 3OBWA 4DSEA 4FWPA 3BZCA 3VPZA 2ZD1A 4I7FA 3ZSZA 4FOIA 3CJ9A 1WBDA 2F4VK 4CGJA 4H5WA 3S41A 3U3GA 2RN2A 3I8DA 3VGKA 3CCMN 1VSMA 3TTDA 5AQXA 2A1SA 2HVHA 4FJKA
chains in the Genus database with same CATH topology
4DV0K 4LFAK 2UXCK 4B3TK 4YHHK 2VQFK 2ZM6K 4DV1K 1HR0K 4V19S 4DV3K 3T1YK 4JI1K 1I94K 4B3SK 4LF4K 4JI3K 4DUYK 3T1HK 1XMOK 4YY3K 4K0KK 4DR5K 4X62K 2UUAK 4DV7K 2HHHK 1N36K 1FJGK 4X66K 1IBMK 1IBKK 4NXNK 4GKKK 4JI5K 1IBLK 3J80O 2UUBK 1N34K 5A2QO 5LMNK 1J5EK 4LF8K 2VQEK 3J7AP 1XNRK 4B3MK 5IWAK 3J7YP 4DR7K 1XNQK 4OX9K 4B3RK 4CVNE 4DR3K 3J81O 2UXBK 5AJ3K 4DR6K 4DV4K 4GKJK 2E5LK 4AQYK 5LL6Z 4JI0K 4JI2K 4DR1K 5LMUK 4LF6K 4X65K 4JI7K 4DV2K 4DR4K 3JAMO 1N33K 1HNXK 4X64K 4LF9K 5FLXO 4DUZK 4LFCK 4JI8K 5BR8K 4DV6K 1HNZK 4LF5K 1HNWK 1N32K 4CW7B 2UUCK 4NXMK 1XMQK 4DR2K 4KHPK 2F4VK 4LF7K 4JI4K 4LFBK 2UU9K 4JYAK 4DV5K 4JV5K 5IT9O 2UXDK 4JI6K 3OTOK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 K;  4LFA K;  2UXC K;  4B3T K;  4YHH K;  2VQF K;  2ZM6 K;  4DV1 K;  1HR0 K;  4V19 S;  4DV3 K;  3T1Y K;  4JI1 K;  1I94 K;  4B3S K;  4LF4 K;  4JI3 K;  4DUY K;  3T1H K;  1XMO K;  4YY3 K;  4K0K K;  4DR5 K;  4X62 K;  2UUA K;  4DV7 K;  2HHH K;  1N36 K;  1FJG K;  4X66 K;  1IBM K;  1IBK K;  4NXN K;  4GKK K;  4JI5 K;  1IBL K;  3J80 O;  2UUB K;  1N34 K;  5A2Q O;  5LMN K;  1J5E K;  4LF8 K;  2VQE K;  3J7A P;  1XNR K;  4B3M K;  5IWA K;  3J7Y P;  4DR7 K;  1XNQ K;  4OX9 K;  4B3R K;  4CVN E;  4DR3 K;  3J81 O;  2UXB K;  5AJ3 K;  4DR6 K;  4DV4 K;  4GKJ K;  2E5L K;  4AQY K;  5LL6 Z;  4JI0 K;  4JI2 K;  4DR1 K;  5LMU K;  4LF6 K;  4X65 K;  4JI7 K;  4DV2 K;  4DR4 K;  3JAM O;  1N33 K;  1HNX K;  4X64 K;  4LF9 K;  5FLX O;  4DUZ K;  4LFC K;  4JI8 K;  5BR8 K;  4DV6 K;  1HNZ K;  4LF5 K;  1HNW K;  1N32 K;  4CW7 B;  2UUC K;  4NXM K;  1XMQ K;  4DR2 K;  4KHP K;  2F4V K;  4LF7 K;  4JI4 K;  4LFB K;  2UU9 K;  4JYA K;  4DV5 K;  4JV5 K;  5IT9 O;  2UXD K;  4JI6 K;  3OTO K; 
#chains in the Genus database with same CATH topology
 1VSJ A;  4B1Y B;  4BG8 A;  3OYN A;  4WQ4 C;  1C0F A;  4BRG A;  1B9D A;  1C1B A;  2E2P A;  3NHG A;  2HBK A;  5J1E A;  5KTQ A;  3KWI A;  1RBV A;  4AM7 A;  4KTQ A;  3OYB A;  4CEC A;  1RTD A;  1D9D A;  3T1H K;  2HMI A;  4CEE A;  4FJ7 A;  2CH6 A;  4CZG A;  4BG9 A;  3IDH A;  2ZGY A;  1Q81 O;  4CEO A;  5M1P A;  3VOV A;  5J2Q A;  4FWO A;  4CEQ A;  4HHT A;  1K8A O;  1GOB A;  3HP9 A;  4KTZ A;  3QBW A;  1WUA A;  1VQN N;  1YVU A;  3OY9 A;  5AQV A;  4C8M A;  4DF8 A;  4FOE A;  3HPG A;  4FWN A;  3VQQ A;  1TKZ A;  3ISN C;  1JLB A;  1RDD A;  4B9N A;  3V81 A;  4CJW A;  4CEF A;  4U7B A;  4N5S A;  3CG7 A;  1T7P A;  4H5V A;  1BDG A;  2F9T A;  1LCU A;  3PX6 A;  1RT6 A;  1H1V A;  2D0P A;  1L3T A;  3CYM A;  2WC9 A;  4IG0 A;  4JI2 K;  3CFP A;  5JLF A;  2JWK A;  2YV0 X;  1L3V A;  3LDS A;  3KTQ A;  1HJO A;  4H0X B;  3PSF A;  4FLV A;  4CHP A;  2Q97 A;  3HVT A;  1BO5 O;  4CJ5 A;  4JI7 K;  5JS1 A;  3JAM O;  1TK8 A;  3OYH A;  3CM5 A;  4K8Z A;  2A5X A;  1VQL N;  3DLR A;  1OVY A;  2Q3S A;  3VTH A;  3D45 A;  2NRH A;  4PL8 A;  1NGH A;  4M41 A;  1RBT A;  2VWJ A;  1KC8 O;  2FBV A;  2NRR A;  4GV9 A;  3OYC A;  1ATN A;  2PBD A;  3QB0 A;  1QQM A;  3LWL A;  1EQY A;  3BEX A;  3WNF A;  3LDQ A;  3CCE N;  1KAY A;  4JD2 B;  2IC3 A;  2FSJ A;  4H0T B;  3VQ7 A;  4LF7 K;  3CPE A;  2QWL A;  3D2E B;  3VQ8 A;  3V6D A;  4Y1D A;  5BPM A;  4K42 A;  3AVN A;  2O8D B;  4DQP A;  2E4L A;  3NGZ A;  1NMD A;  4QOZ B;  3TAP A;  3L8B A;  1EO1 A;  2O4G A;  1RFQ A;  3DI6 A;  4DTO A;  4CZK A;  3TSQ A;  3EKS A;  5F1X A;  4FSV A;  3DYA A;  5GAH P;  2FSN A;  2P5G A;  1XMO K;  4BWM A;  4I9Q A;  4FZX C;  4CBX A;  4CFC A;  4FJ5 A;  4FLT A;  4CJP A;  3KK7 A;  2ZJQ L;  5TKW A;  1ZXO A;  2HOE A;  1T3V A;  4J2E A;  2PZS A;  1NU0 A;  1LW0 A;  4CHQ A;  5HRS A;  2VCP A;  3MMV A;  4RCH A;  2Q31 A;  2FBT A;  2PYL A;  3LZI A;  3ALY A;  2KHO A;  1QVG M;  4WCE L;  2G8I A;  3EN9 A;  3HPH A;  3VES A;  1XNR K;  1VSE A;  4CJT A;  4ZTJ A;  3KIO A;  5JVH L;  4B3R K;  2D1K A;  5C24 A;  4KHU A;  1YTA A;  3G25 A;  1NOY A;  4FYD A;  3V9Z A;  3D7E O;  4DKW A;  3WXK A;  3SUP A;  2G8V A;  5DK5 A;  1VQ6 N;  3TI0 A;  3NH1 A;  1IH7 A;  1SL0 A;  3ZT2 A;  3O9T A;  2QI2 A;  4CBU A;  3WNH A;  1UAX A;  4IXC A;  2YKM A;  4DV2 K;  3JYT A;  3PX4 A;  3AO5 A;  2W40 A;  4LF9 K;  2P9P A;  2Y1I A;  5KPR A;  4CZF A;  3AAR A;  3VEZ A;  1OH6 A;  3E1Y A;  5BR8 K;  4BRI A;  1WLJ A;  4Z4C A;  4EHT A;  3CJA A;  1ATR A;  3U8X A;  4KB0 A;  1ILY A;  3P5J A;  3DLK A;  4CJR A;  4CZI A;  3HTV A;  2KLA A;  4DFK A;  3RWU A;  4HVJ A;  4BDZ A;  4ID1 A;  5EU7 A;  3OYL A;  3CQX A;  3AVJ A;  4JRP A;  1K8K B;  4FPA A;  5EXW A;  1UA0 A;  3FFK B;  2UXD K;  1VQ7 N;  1X1P A;  4FK4 A;  4DSF A;  2VG6 A;  3M8S A;  1HUX A;  2RE2 A;  4EP5 A;  2WUS A;  3KHY A;  2NZT A;  1XC3 A;  3HSC A;  4BC2 A;  2FBY A;  5SWM A;  5LJV A;  1NGA A;  4X66 K;  2OCE A;  3SLC A;  1HQU A;  4JKA A;  3NAE A;  1JCE A;  4A57 A;  4PKH A;  1S6P A;  1KFS A;  2IVO A;  4OPA A;  4BC4 A;  2ZWH A;  4A59 A;  3DLH A;  4HTU A;  2GEL A;  5E84 A;  1T03 A;  4ELT A;  3C0B A;  4AHS A;  5A2Q O;  2YNH A;  5M1N A;  4BE0 A;  3OS1 A;  2F7T A;  1VQ9 N;  3BF3 A;  4KFB A;  2F9W A;  1YF5 L;  4CED A;  1JJ2 M;  5IWA K;  3D0P A;  1VQ5 N;  1J54 A;  3VEW A;  3MCP A;  4CIE A;  2OZS A;  4WF9 L;  5I9E B;  4DTS A;  3NVK A;  4GKJ K;  3PUF A;  4BVP A;  1IKX A;  4Q0B A;  1VK0 A;  2FF6 A;  1NK4 A;  3U4L A;  3HOS A;  4BRE A;  3S3N A;  1R0A A;  3EO3 A;  4A61 A;  2P9N B;  1VQK N;  3WEE A;  1LWF A;  3B8A X;  3RRG A;  4CGG A;  4JS4 A;  3W0L A;  1QHT A;  4FWK A;  4B1Z A;  2WOM A;  3IRX A;  4Z0U A;  4FK0 A;  1FK9 A;  2E2O A;  4FW2 A;  5AQO A;  4QCL A;  1XWL A;  4FPB A;  5HRN A;  4NYF A;  1QQO A;  2PAV A;  4ZHR A;  1K6Y A;  4MQ3 A;  1IG9 A;  2QXL A;  3L2U A;  3LWM A;  3LAM A;  4GNI A;  5SZT A;  4IZ9 A;  3CQY A;  1KD1 O;  2UU9 K;  2YI1 A;  1WSH A;  2YHX A;  3IKM A;  2AP1 A;  4DSI A;  4JEP A;  3WNG A;  5CHI A;  4Z4F A;  3AVL A;  4K25 A;  3FFI A;  3L3U A;  2CH5 A;  2A6A A;  1NJX A;  2P5O A;  3S3M A;  4BRH A;  1I94 K;  1RBR A;  2ITG A;  1WSJ A;  4ELV A;  5D3G A;  5EOY A;  4DUY K;  4OKJ A;  3LDN A;  1TGO A;  1LWE A;  4K0K K;  1UOC A;  2GUP A;  3SI6 A;  1ASV A;  4IFV A;  3CCQ N;  1MDU B;  2E2N A;  3JXU A;  2D0C A;  1Q86 O;  2CGK A;  2P9L B;  3VTI A;  4Z4H A;  4OGE A;  1NGJ A;  4Z4E A;  4EHU A;  4AF1 A;  3J80 O;  3DMJ A;  2D0O A;  3DOL A;  5ELZ A;  2FLO A;  3SQ0 A;  1FXX A;  1S6Q A;  5LMN K;  3LPT A;  1C0U A;  1REV A;  1VRT A;  5AQR A;  3V9S A;  3E66 A;  2E2Q A;  3OYI A;  1HJR A;  3F9K A;  3SAG A;  4CZE A;  3PO5 A;  2QWQ A;  4OX9 K;  3A5O C;  1HKB A;  1KXP A;  3E9P A;  4RW4 A;  1VAZ A;  5BPL A;  1DT9 A;  3A5L C;  1J53 A;  3OJS A;  3KD1 E;  5FPD A;  3SUN A;  1XHZ A;  1RGI A;  3ZSX A;  3FZK A;  4NYN A;  1T8E A;  3OVN A;  3N4P A;  1GLF O;  2XHB A;  4DU1 A;  1VSI A;  3EY1 A;  4DTU A;  5FPM A;  1XHX A;  4HTL A;  4CJ3 A;  3ZSR A;  4KHS A;  1HNZ K;  4LF5 K;  1HNI A;  2X74 A;  2GUI A;  2KTQ A;  4OLB A;  3OYM A;  4NXM K;  1SKR A;  1LV5 A;  1ZBH A;  4E19 A;  2YJE A;  5FRO A;  1EXQ A;  3RVC A;  3CFO A;  5BRF A;  3L6Q A;  2YCH A;  1EET A;  5AQI A;  1U4B A;  4B1V A;  3FZH A;  1VHX A;  1VQM N;  5KI6 A;  3QEP A;  1NK7 A;  1S5J A;  3L2W A;  4OJR A;  2PY5 A;  4FWQ A;  4B1U B;  1LAW A;  4WQ5 A;  1HKG A;  2B5J A;  5C42 A;  4BGA A;  2W41 A;  3CCR N;  1FKO A;  4H0P A;  2RF2 A;  3WUH A;  3HJF A;  1C0G A;  3RR8 A;  2E8A A;  4DV1 K;  3D2F A;  2IS3 A;  3A8Y A;  2G8U A;  3GBT A;  4O0I A;  3LM2 A;  2O4I A;  3VA3 A;  2D4W A;  2QKB A;  4CJK A;  2ASO A;  1KLM A;  3ULE A;  4CCH A;  4JN4 A;  4Y0W A;  2QK9 A;  4BVO A;  2B4J A;  3K9K A;  1TKT A;  4KKO A;  4RW9 A;  4ICL A;  3OS2 A;  1U45 A;  1Z6R A;  1N5Y A;  3WXL A;  3PV8 A;  3WQU A;  3QML A;  4CIG A;  3MXM A;  3BDP A;  3K9J A;  1QHA A;  2VQE K;  3I33 A;  2UYT A;  4M63 C;  3D2E A;  4QS9 A;  4PA1 A;  3K58 A;  1HYZ A;  3RSE A;  4K8X A;  1KVA A;  4JRQ A;  1XNQ K;  4CVN E;  1LOT B;  1NNE A;  4CK2 A;  1GOC A;  4PWD A;  4DR6 K;  1HLU A;  1VSL A;  2P9U B;  2Q2R A;  2KW4 A;  3MXI A;  2A3Z A;  4U67 L;  4L8R B;  3RMA A;  3O8M A;  3G6E N;  3V4I A;  1TVR A;  3RMC A;  1TKD A;  3SAH A;  4FJN A;  2F8S A;  3KVG A;  4H5R A;  4XH4 A;  4DS5 A;  2V52 B;  3OYD A;  3VF4 A;  3ID8 A;  3MDQ A;  3HBT A;  2QWO A;  3CER A;  4DV6 K;  4BR9 A;  4DTJ A;  5K14 A;  4B9T A;  4JKH A;  4FLW A;  5F0X A;  3NF8 A;  4CD1 A;  1XC9 A;  4FWS A;  4N41 A;  5AQM A;  1NGB A;  4RW8 A;  3PIO L;  3OHR A;  4CEZ A;  3MXJ A;  3LAK A;  3GOI A;  2H3G X;  1KVC A;  4LD0 A;  3AA4 A;  3OTO K;  3ENB A;  4C1N K;  2UXC K;  2OPP A;  3NFA A;  5HOO A;  2EHG A;  4YHH K;  2VQF K;  4C8K A;  4N56 A;  4FJ9 A;  4CFB A;  5BN8 A;  1XUP O;  1WSE A;  3RTV A;  4KRF A;  3P38 A;  4E7J A;  2A1R A;  3L0Q A;  1QE1 A;  2NNW A;  4MFB A;  4H0V B;  3T7Z A;  5AZI A;  1OH5 A;  3LDP A;  2HHH K;  4FO0 A;  3SZ2 A;  2ASM A;  1IBK K;  4CHZ A;  3SPZ A;  2FXU A;  3VEX A;  2DY4 A;  4XH1 A;  1Q8I A;  4DLE A;  3ZT1 A;  4BR2 A;  3MEC A;  1BIZ A;  1N34 K;  1K8K A;  1RT3 A;  5BR9 A;  2HHU A;  4GY2 B;  2VG7 A;  3THV A;  4EZ6 A;  4M42 A;  3U3Y A;  3SUO A;  3M8Q A;  4FXD A;  4O44 A;  4M3T A;  3O3G A;  3C6U A;  1K9M O;  1TV6 A;  4J8F A;  4HCB A;  4I6M A;  4DR3 K;  3ZLJ A;  3ZET B;  3IAY A;  2W6L A;  3A5N C;  4DB3 A;  1P90 A;  2WON A;  1T44 A;  4JK7 A;  1QQN A;  4FWL A;  4FM2 A;  3QBX A;  1MWM A;  4DQ8 A;  3O4Q A;  2G8F A;  3FZM A;  3F2K A;  1FKP A;  5C15 A;  5KRS A;  5AQU A;  2HHT A;  2AA4 A;  4YOW A;  1JKH A;  1HNW K;  3TR8 A;  2YHW A;  4CW7 B;  4JHD B;  3Q7C A;  4GVM A;  1W0H A;  1NK9 A;  1NG9 A;  1X9M A;  4A2A A;  4FL9 A;  4CEB A;  4O5B A;  3DRR A;  3NF9 A;  2DFH A;  3OYG A;  4Z94 A;  4FJM A;  4CJ7 A;  3K5O A;  4BRF A;  1D4X A;  5IT9 O;  2QWP A;  5CYQ A;  4IBN A;  3OYF A;  4FLZ A;  3VGL A;  4DV0 K;  2GWJ A;  5AQT A;  4CES A;  4DQQ A;  5ADX H;  4IEI A;  2QXF A;  2O8C A;  3DLG A;  2HHW A;  2ZE2 A;  3TAM A;  4JI1 K;  4DLG A;  4TSX A;  2W6K A;  4H4M A;  3ZSO A;  1NJY A;  4YY3 K;  4CJ4 A;  3RMD A;  3HO1 A;  3M6G A;  3C65 A;  1SKW A;  2B6A A;  4E7H A;  4LC9 B;  3M8P A;  5AQH A;  4BE2 A;  4CGF A;  4BC3 A;  4FM1 A;  2O8D A;  2XY8 A;  2VGN A;  1HQE A;  2XY6 A;  1C6V A;  1WNS A;  4IDH A;  3L2R A;  1IBL K;  3AA2 A;  3B6P A;  1P8Z A;  1NK8 A;  4ILJ A;  2RPI A;  1NK0 A;  3OYE A;  3NVM A;  4O8K A;  3UKR B;  1NBW A;  3VQA A;  2WBN A;  1YJ9 N;  3CCU N;  4DR7 K;  1KQS M;  1E4F T;  4RTF D;  5HRO A;  2OYQ A;  1HRH A;  3J81 O;  2ASP A;  4MDB A;  1VQO N;  2BAN A;  1FW6 A;  2WFB A;  3NMU A;  1G99 A;  1NGC A;  1YT3 A;  3I0R A;  1BIU A;  4N47 A;  3P4I A;  1Z26 A;  3QIN A;  5LMU K;  1QSL A;  4O0J A;  3MN7 A;  4DU3 A;  3R9P A;  1TL3 A;  3GDQ A;  4CJS A;  4E1M A;  2I7N A;  3GL1 A;  2F96 A;  3CCV N;  3VET A;  3F73 A;  4E3S A;  5AQK A;  4AHU A;  4DUZ K;  4CI6 A;  3ID6 A;  1OH7 A;  4RW6 A;  4BRQ A;  2R7Y A;  4H8K A;  1CZ9 A;  1B9F A;  2UUC K;  4JKD A;  3CET A;  3I0S A;  4ISF A;  2DFF A;  4ELU A;  4AHT A;  4CJU A;  4IEE A;  1BCO A;  4BDY A;  1VSF A;  1WSG A;  4Q5V A;  5M1F A;  4LFB K;  3LP0 A;  4ZTF A;  3WXM B;  3OW2 M;  3Q7B A;  4PHT X;  1NLV A;  3TAQ A;  3CCL N;  3F9M A;  3DWL A;  4JKG B;  1GLL O;  4WQ4 A;  3D2F B;  4KHY A;  3ZYY X;  5BRE A;  1U49 A;  4IFE A;  1C1C A;  3SJJ A;  1HR0 K;  4V19 S;  3C7N B;  3T1Y K;  2YKN A;  2BH1 A;  3AY9 A;  3V9U A;  1U2V B;  4DTM A;  4JK9 A;  1RT2 A;  3LP2 A;  3HVR A;  2UUA K;  2D0A A;  3L3V A;  1L5U A;  3LDL A;  4UQG A;  1S1X A;  5CR4 A;  3CFR A;  3TWH A;  4DS4 A;  3E01 A;  3ZX0 A;  2PYJ A;  2ZJP L;  3MAQ A;  4FLY A;  2NRT A;  4JI5 K;  3THY B;  4O5F A;  4CF2 A;  1NWK A;  3EYZ A;  3H1Q A;  3VEV A;  4C8L A;  3UKU A;  4BGB A;  5KGW A;  2OZM A;  2OAN A;  4MO4 A;  1VQ4 N;  1BU6 O;  4J2B A;  3V9X A;  1JCF A;  1RDC A;  2YX6 A;  3K5L A;  4FJI A;  2ZQB A;  1BOT O;  3N4Q A;  2I7P A;  3O3H A;  4NB4 A;  2YNF A;  5FRM A;  4HUG A;  4QS8 A;  3KKR A;  2E5L K;  4FJL A;  3TAR A;  1RT1 A;  4DTP A;  3K0S A;  1XI1 A;  4B08 A;  4HWI A;  1EWR A;  1DTQ A;  1S1W A;  2WTU A;  1TK0 A;  1JLF A;  2OPR A;  4DTR A;  3ENO A;  3AA3 A;  1J6Z A;  2P9K B;  5KRT A;  1VSH A;  1X3N A;  5CE3 A;  1NGF A;  1ZC6 A;  4A2B A;  1NGG A;  3OYJ A;  5CY4 A;  1YJW N;  2VYP A;  1GOA A;  3KLF A;  4DR2 K;  3DLL L;  2HF4 A;  3AO1 A;  1TKX A;  3DXM A;  4NO7 A;  1BI4 A;  5AQQ A;  1IKW A;  3TTF A;  4B9Q A;  1CLQ A;  3F5T A;  4BRP A;  3ATV A;  3QEW A;  1YXQ A;  1C0M A;  3CC2 N;  4JV5 K;  4F3O A;  1GLJ O;  5B8H A;  1IKY A;  1Q7Y O;  3A0I X;  1S9G A;  3RR7 A;  3ATU A;  1JLA A;  4CEA A;  1NKB A;  1QS4 A;  1D5A A;  3CJ7 A;  1OKJ A;  3AVA A;  3MX2 A;  3CMA N;  4FWR A;  4DV3 K;  3CXC M;  1NGE A;  3VEN A;  4JK8 A;  4BQZ A;  1DEJ A;  2HHS A;  3QES A;  1VSK A;  3DXM B;  1GLD G;  2HST A;  4YNQ A;  1YIJ N;  4DV7 K;  3NF6 A;  3VF2 A;  3MWT A;  3HRG A;  1BL3 A;  1DGK N;  4CK1 A;  2QWN A;  4LSN A;  2P9S A;  3QDK A;  3NGY A;  3ASM A;  4IFY A;  3IG1 A;  5FRN A;  1W9H A;  5HLF A;  2OA8 A;  4FJG A;  4M3Y A;  4HCC A;  4CF1 A;  3ZX2 A;  1HYV A;  1HX1 A;  1EP4 A;  4Z4G A;  3L2V A;  3GE1 A;  3O9U A;  3SMS A;  1ZBF A;  1JL1 A;  4AHV A;  3PIP L;  4F3T A;  5E26 A;  4LF8 K;  4NCG A;  1Y64 A;  3W3D A;  4KAZ A;  3EL2 A;  3HI0 A;  4KBO A;  1TUU A;  2E1Z A;  3G4S N;  3C6H A;  1UWB A;  3L4Q A;  3J7Y P;  4JS5 A;  2P9N A;  3TSU A;  3O1B A;  3M1F A;  1KTQ A;  1KAX A;  3QEX A;  3CHW A;  4E89 A;  2EWS A;  3P1G A;  4J2A A;  2YHA A;  4CZM A;  4JI0 K;  3WT0 A;  3K5M A;  5T7B A;  3VQB A;  2P9P B;  5EX5 A;  5C10 A;  4DQI A;  4BR5 A;  4LF6 K;  4ISG A;  2FBX A;  1RIL A;  1VRU A;  1C1A A;  1ITG A;  4BR0 A;  3OS0 A;  4AIL C;  1SS6 A;  3WQT A;  3WXI A;  4M3U A;  5BRH A;  3AO3 A;  3THY A;  4B1X B;  3ZSY A;  1RDW X;  3R3L A;  4KB1 A;  4CJV A;  1QSS A;  1IV0 A;  1DLO A;  4BRK A;  3WNE A;  3ZSW A;  4BAC A;  4FLX A;  2BTF A;  2QM1 A;  1X9J A;  3H45 C;  1RBS A;  3OBY A;  2DPN A;  4JI4 K;  2O8F B;  4CGD A;  4CZL A;  5AQG A;  3CC4 N;  1KAZ A;  3U9Z A;  4F2R A;  4JKG A;  3O5B A;  1SKS A;  1S9E A;  3DRS A;  2OTJ N;  4BRD A;  1EX4 A;  2F8T A;  3LZJ A;  5M1Q A;  3CCJ N;  1SAZ A;  4EP4 A;  4DMN A;  1JXE A;  4IJN A;  3AAQ A;  2HHX A;  3CI5 A;  5JIC A;  3AVF A;  5BN9 A;  3P31 A;  4A5B A;  4PKI A;  4GVE A;  2YNG A;  2QA4 N;  3THW A;  4KO0 A;  4KH4 A;  4CGI A;  4X62 K;  5HP1 A;  1RBU A;  4M3R A;  5ADX A;  3THW B;  1BCM A;  2ETJ A;  2GX9 A;  4G1Q A;  3VQP A;  2OPS A;  4I2P A;  3O9R A;  4F4K A;  5AQZ A;  1HNV A;  3OYK A;  1S1T A;  3L4I A;  3AVG A;  2X6N A;  3P83 D;  4BRO A;  1WSI A;  5FPE A;  4MLH A;  1U6Z A;  1X9S A;  4CD3 A;  4BE1 A;  3QIO A;  5H1S Q;  2O8F A;  3AGK A;  1SQK A;  4LSL A;  3C95 A;  3AA5 X;  1GLB G;  4CHO A;  4DCH A;  5J2M A;  2E20 A;  2UXB K;  2I5J A;  4DSJ A;  1B92 A;  3T1A A;  5CZ1 A;  3VQD A;  1V4T A;  1Z25 A;  1KCF A;  3DXK A;  3PSI A;  2IIR A;  1TK5 A;  2E6L A;  1ZYQ A;  3VN5 A;  5JS2 A;  2EX3 A;  1UA1 A;  2FSK A;  5MLC Q;  3SJH A;  1WAF A;  4F2S A;  4BRA A;  2BUP A;  4JKF A;  1MU2 A;  1NGI A;  1I39 A;  3R8E A;  1M1K O;  3FE1 A;  3BF1 A;  3SPY A;  4BRM A;  3MN9 A;  5JLH A;  1YJN N;  4YFU A;  2NRV A;  2GEM A;  5LJW A;  4BY9 C;  1YTU A;  4B9S A;  1Q18 A;  1ASU A;  1O1W A;  4YDU A;  4DFM A;  3HOT A;  3O80 A;  1C0T A;  2HBM A;  3ZSV A;  4B3O A;  3AVB A;  3CM6 A;  4AH9 A;  2KZM A;  4YOY A;  3AVH A;  2ITM A;  2Y1J A;  1W7A A;  4DF4 A;  4KPY A;  4IO9 L;  2RHK A;  3ZCM A;  4RW7 A;  4A5A A;  2E88 A;  3E9O A;  4ISE A;  4WFB L;  3SQ1 A;  1RTJ A;  4OLA A;  3ULD A;  4FJ8 A;  4DFJ A;  1KRP A;  5AFU A;  3LP3 A;  3EEQ A;  3K2P A;  1YUW A;  3T69 A;  4BDP A;  4M3Z A;  5BPN A;  4H0O A;  2IVP A;  1OH8 A;  2KFZ A;  1N36 K;  1NM1 A;  4FM0 A;  1Q82 O;  4OGC A;  3R6M A;  5AQP A;  1JLC A;  4KHQ A;  3JS6 A;  5AQS A;  3VQ6 A;  4MLE A;  2QW9 A;  2XY7 A;  3THX A;  3V1R A;  2CGJ A;  3HXM A;  1U48 A;  1S1V A;  4YOU A;  3TPQ A;  3A5M C;  4I9L A;  1BA1 A;  1CZB A;  4FJJ A;  3CF5 L;  4B3M K;  1BQN A;  3CQ8 A;  1W2B M;  3FLC O;  3HST B;  1LW2 A;  4E0D A;  5AJ3 K;  2G8K A;  4KV8 A;  1JCG A;  2Z1I A;  3QET A;  1JLQ A;  3ZET A;  4M3W A;  4IDK A;  4I6M B;  3UE5 A;  3VMF B;  1HKC A;  1RNH A;  1IO2 A;  3ENH A;  4ILH A;  4BRN A;  1A5V A;  3AAP A;  1BGX T;  3QIP A;  2IOC A;  4CJE A;  4X65 K;  4C8O A;  4DR4 K;  3PX0 A;  3DLE A;  3NF7 A;  3SBT A;  4FVU A;  3C6A A;  3AVM A;  4MDA A;  3MEG A;  3H08 A;  3MK6 A;  3TAG A;  4UY8 O;  2J4R A;  3TAF A;  2P9S B;  3RRH A;  4JKC A;  1VSD A;  3T3F A;  2AJQ A;  4XIU A;  2BDP A;  5C0Y A;  1S1U A;  4LY7 A;  2P9L A;  1ZBI A;  4JNE A;  3AVK A;  2Z1G A;  4W5O A;  1CZA N;  3ZEU A;  3KKS A;  3QER A;  3BZK A;  3I8B A;  2FF3 B;  3PLA A;  4QS7 A;  4DSL A;  4DTN A;  3SMP A;  1GLA G;  3UKU B;  5KPZ A;  4B3T K;  4BWJ A;  5KQD A;  4WE1 A;  4O55 A;  4M7Y A;  3PO4 A;  1V4S A;  4Y1C A;  4B3S K;  3G71 N;  1JXB A;  2VWB A;  5GIN A;  4HUF A;  1Z05 A;  1RT7 A;  2HBL A;  3FZL A;  4OPH A;  2IDO A;  2NRW A;  2YHB A;  1BIS A;  1ZBL A;  1U2V A;  4H03 B;  5AZJ B;  4F8R A;  3MN6 A;  3GG4 A;  3NE6 A;  2VWK A;  3C7N A;  3V1Q A;  2P1J A;  1GLE G;  4OO1 J;  4IOA L;  3IFR A;  1KLN A;  3QNO A;  1WN7 A;  5GIO A;  1CXU A;  5CZ2 A;  3O4W A;  5AQJ A;  3NH0 A;  4IO8 A;  1SL1 A;  3DLB A;  4RWT A;  3KLE A;  1JLE A;  2HNY A;  3V1O A;  3QO9 A;  3RSE B;  4CZJ A;  1VQP N;  5HBM A;  4B8C A;  4DR1 K;  3DJC A;  3SCX A;  1Y97 A;  2NRZ A;  3K57 A;  5J2P A;  3O08 A;  3VQE A;  4WFN L;  3NDK A;  2YJF A;  2V51 B;  3LAN A;  2Q36 A;  2HND A;  4GV3 A;  4H5T A;  5HRP A;  3CD6 N;  3ZT3 A;  5AQL A;  3EE9 A;  4H5N A;  1XMQ K;  5TKY A;  3O4N A;  4WYB A;  4XEI A;  1YIT N;  2KZZ A;  5AQN A;  3MN5 A;  1RT4 A;  1NGD A;  5JMV A;  1RCH A;  3UKR A;  4BR4 A;  2O8E A;  1IKV A;  3V9W A;  3VGM A;  1SUQ A;  4DFP A;  1JL2 A;  4DU4 A;  4QAG A;  3I56 N;  3CME N;  2NLX A;  1NJI O;  5KPT A;  4CK3 A;  5AZJ A;  2QEX N;  1MA9 B;  3HM9 A;  2XY5 A;  1F21 A;  3VEO A;  3LDO A;  2GTD A;  4FZY A;  4E7I A;  3IS9 A;  4CF9 A;  4E7K A;  3H1V X;  2CGL A;  3I55 N;  1QTM A;  1DTT A;  3SBG A;  3BGR A;  5EY4 A;  2YHY A;  3M3Z A;  1YI2 N;  1IBM K;  4W5R A;  4A62 A;  3VQ9 A;  5BRD A;  4M7X A;  4YOT A;  4RG8 A;  5HL7 L;  3TTC A;  3QEV A;  4H4O A;  4GW6 A;  3RMB A;  3ZEU B;  2A40 A;  2JWL A;  3SAF A;  1J5E K;  4EIA A;  3J7A P;  3KLH A;  2Z1H A;  3QIC A;  3KK1 A;  2G8W A;  4DHY A;  5AFU H;  1WB9 A;  1IJJ A;  4NLB A;  5HRR A;  1RT5 A;  4CZH A;  1KVB A;  3NBP A;  4J2D A;  5I42 A;  3ZSQ A;  5LY3 A;  4KI6 A;  2HB5 A;  3O9S A;  4B9V A;  4YOR A;  4OPK A;  4NCB A;  3TU5 A;  1U04 A;  4IKF A;  2QWM A;  2V7Z A;  1HPZ A;  2HBJ A;  4BQL A;  4DG1 A;  3C6T A;  3QFP A;  1ATS A;  3G10 A;  3KD5 E;  5DM6 L;  1K73 O;  1HYS A;  2VGM A;  3P39 A;  4IG3 A;  3HL8 A;  1ASW A;  3MWP A;  1ZBS A;  2BGG A;  3A2F A;  4CJL A;  4C1N I;  4LFC K;  1RDA A;  4F9O A;  4FVM A;  2GV9 A;  4NCA A;  1WSF A;  3TAN A;  1CXQ A;  2FC0 A;  4EZ9 A;  3HYF A;  3FR0 A;  1W97 L;  1NK5 A;  1IG8 A;  4IWV A;  3B6O A;  4C23 A;  1HPM A;  4YDU C;  1KSP A;  3H3N O;  1I3A A;  2D0B A;  3AGR A;  3AVI A;  3LAL A;  5DM7 L;  4PQU A;  3J7Z O;  4FCY A;  2O8C B;  3BY5 A;  3THX B;  4B9M A;  1SV5 A;  3VF6 A;  3PY8 A;  1M90 O;  4JI6 K;  4DQR A;  1LAV A;  3NH2 A;  1TL1 A;  5C2F A;  1N8R O;  3S9H A;  4FLU A;  4PY5 A;  3VA0 A;  4WFA L;  2A41 A;  3EE8 A;  4BR7 A;  1D9F A;  1T05 A;  3LL3 A;  4JAX A;  1S3X A;  1NJZ A;  2HW3 A;  5AZI B;  3TAE A;  2HF3 A;  2NUB A;  1S22 A;  2Z1J A;  4JKE A;  2ATQ A;  3BUZ B;  2V7Y A;  3K5N A;  4JHD A;  4CER A;  5CYM A;  1NMN A;  1QQC A;  3AV9 A;  3CJB A;  3O9Q A;  1WOQ A;  4EAH D;  1X3M A;  3EZW A;  1SL2 A;  3ITH A;  3LPU A;  2XO7 A;  1WAJ A;  3SYZ A;  3T19 A;  3HPO A;  1YAG A;  3UIQ A;  3ZT4 A;  3OYA A;  5JVG L;  3IMX A;  2HMP A;  4HUE A;  2D5R A;  3CC7 N;  3HM8 A;  3J8A A;  5DMR A;  2E6M A;  4CHY A;  1BI4 B;  4W5T A;  2P51 A;  1A5W A;  3R1X A;  4DV4 K;  3WXJ A;  5LL6 Z;  1RTH A;  3OJU A;  4B9U A;  1LWC A;  3NGI A;  4OKK A;  4CFA A;  4CFD A;  4M45 A;  5C2D A;  3QLH A;  2P9K A;  2PFU A;  1WBB A;  5M1O A;  3HK2 A;  3DXK B;  1HNX K;  4X64 K;  3VEY A;  4AHR A;  4CE9 A;  4BRC A;  4FK2 A;  1HMV A;  3EKU A;  4W5Q A;  2JGU A;  1QZ6 A;  4CBW A;  4CJQ A;  4R79 A;  5E41 A;  1D8Y A;  3VQ4 A;  5F2R A;  5C25 A;  3BP8 A;  1NK6 A;  2BE2 A;  3QFU A;  4ILG B;  4KHN A;  2RKI A;  1BA0 A;  3U6F A;  1BHL A;  4AHC A;  3ZT0 A;  3LM9 A;  4CHN A;  4E7L A;  1XQS C;  3CJ1 A;  5I3U A;  2Q0R A;  3MED A;  3TAB A;  4ID5 A;  3DM2 A;  4GMJ B;  3G0Z A;  4CF0 A;  3NCI A;  3VQC A;  2A42 A;  4FWM A;  2ZM6 K;  1YHQ N;  3CIP A;  3M5R A;  4M3X A;  3CCS N;  1GLC G;  3ULE B;  1NKE A;  2HHQ A;  3M8R A;  4KTW A;  1R59 O;  1U47 A;  4YOV A;  3DRP A;  3SV3 A;  5GAE P;  3DOK A;  3EZ5 A;  2OTL N;  4NLC A;  3HP6 A;  4DSK A;  1L3U A;  4NXN K;  1QZ5 A;  4LH4 A;  5C12 A;  1EKE A;  2IGI A;  3SK3 A;  4KHW A;  4H0Y B;  1MWK A;  1NOZ A;  5EVZ A;  2UUB K;  2Q1N A;  3KLG A;  1RDU A;  2QTD A;  3OA9 A;  2ZGZ A;  4C8N A;  3H6E A;  1TUY A;  3KJV A;  5AQF A;  3FZF A;  2W42 A;  1O13 A;  1E3M A;  4K43 A;  1QSY A;  1T6C A;  4WQ5 C;  3O3F A;  2P9U A;  1X9W A;  2ZF5 O;  3D6R A;  4O8U A;  2QKK A;  1BUP A;  4B1W B;  3FGU A;  4LH5 A;  3MCA B;  2E1Y A;  3IUC A;  4DQS A;  3CJC A;  4I2Q A;  1Q9X A;  4JLH A;  1BG3 A;  4R5P A;  3JSM A;  4G9Z A;  2XRI A;  3QNN A;  2P9I A;  3S3O A;  2HNZ A;  4KH5 A;  3UB5 A;  1BWF O;  1JLG A;  3K59 A;  2GBZ A;  2OPQ A;  3ZX3 A;  4K41 A;  1G15 A;  3LP1 A;  3AO2 A;  1TYQ A;  2GWK A;  3VQ5 A;  1RTI A;  5AQW A;  4CJF A;  2HVI A;  4IOX A;  4CIF A;  3SQ2 A;  4KHP K;  3AO4 A;  1RDB A;  2DTU A;  4OPJ A;  1E4G T;  5KQ8 A;  2JLE A;  4O4G A;  2DFE A;  3KLI A;  4JYA K;  4FW1 A;  4DV5 K;  4GV6 A;  1YVN A;  4W5N A;  4EFH A;  2LSN A;  4MO5 A;  1KFD A;  2ZJR L;  5J2N A;  2O8B B;  1OVQ A;  2IVN A;  4BC5 A;  4YOX A;  4LFA K;  3U9D A;  1N6Q A;  3E9L A;  3O1W A;  4JKB A;  3SV4 A;  3C94 A;  3MX5 A;  2X6S A;  4AM6 A;  1J5O A;  2O8B A;  4XH5 A;  5GAD P;  4LF4 K;  4JD2 A;  4L3Q A;  4B9L A;  4JI3 K;  3HT3 A;  1TAU A;  2O8E B;  2IAJ A;  3H46 O;  4KI4 A;  1SZ2 A;  4N76 A;  4IJA A;  3SUQ A;  4DR5 K;  3H3O B;  1ESV A;  1VQ8 N;  3SNN A;  1FJG K;  5KGX A;  3AVC A;  2KQ2 A;  4OVL A;  4DTX A;  4FJH A;  5AR0 A;  4FZZ A;  4OKE A;  4GKK K;  1TYQ B;  3KK3 A;  1ZBU A;  4PL7 A;  3KWG A;  1T6D A;  3TSP A;  2Q0U A;  4KH6 A;  5GAG P;  3KK2 A;  1L3S A;  2P9I B;  4Z4I A;  2KFN A;  1A5X A;  3HZ6 A;  4E1J A;  2KKZ A;  1TAQ A;  4PKG A;  3MEE A;  1EWQ A;  5AQY A;  3KZB A;  4PUO A;  5FDL A;  1Q9Y A;  4B8A B;  2HHV A;  1DKG D;  4AQY K;  1NKC A;  1J9A A;  2G8H A;  3SQ4 A;  5GIP A;  1BQM A;  5FPN A;  4E1N A;  3DAW A;  2QWR A;  4BRL A;  4CF8 A;  3QEI A;  2VG5 A;  4DWI A;  1N33 K;  2X78 A;  2NRX A;  3WEE B;  5FLX O;  4JI8 K;  2YNI A;  1QVF M;  1S72 N;  3L2Q A;  1N32 K;  3CPW M;  4KRE A;  3O6W A;  3VER A;  5M1K A;  4IOC L;  4FJX A;  4CGH A;  1NJW A;  3OBW A;  4DSE A;  4FWP A;  3BZC A;  3VPZ A;  2ZD1 A;  4I7F A;  3ZSZ A;  4FOI A;  3CJ9 A;  1WBD A;  2F4V K;  4CGJ A;  4H5W A;  3S41 A;  3U3G A;  2RN2 A;  3I8D A;  3VGK A;  3CCM N;  1VSM A;  3TTD A;  5AQX A;  2A1S A;  2HVH A;  4FJK A; 
#chains in the Genus database with same CATH homology
 4DV0 K;  4LFA K;  2UXC K;  4B3T K;  4YHH K;  2VQF K;  2ZM6 K;  4DV1 K;  1HR0 K;  4V19 S;  4DV3 K;  3T1Y K;  4JI1 K;  1I94 K;  4B3S K;  4LF4 K;  4JI3 K;  4DUY K;  3T1H K;  1XMO K;  4YY3 K;  4K0K K;  4DR5 K;  4X62 K;  2UUA K;  4DV7 K;  2HHH K;  1N36 K;  1FJG K;  4X66 K;  1IBM K;  1IBK K;  4NXN K;  4GKK K;  4JI5 K;  1IBL K;  3J80 O;  2UUB K;  1N34 K;  5A2Q O;  5LMN K;  1J5E K;  4LF8 K;  2VQE K;  3J7A P;  1XNR K;  4B3M K;  5IWA K;  3J7Y P;  4DR7 K;  1XNQ K;  4OX9 K;  4B3R K;  4CVN E;  4DR3 K;  3J81 O;  2UXB K;  5AJ3 K;  4DR6 K;  4DV4 K;  4GKJ K;  2E5L K;  4AQY K;  5LL6 Z;  4JI0 K;  4JI2 K;  4DR1 K;  5LMU K;  4LF6 K;  4X65 K;  4JI7 K;  4DV2 K;  4DR4 K;  3JAM O;  1N33 K;  1HNX K;  4X64 K;  4LF9 K;  5FLX O;  4DUZ K;  4LFC K;  4JI8 K;  5BR8 K;  4DV6 K;  1HNZ K;  4LF5 K;  1HNW K;  1N32 K;  4CW7 B;  2UUC K;  4NXM K;  1XMQ K;  4DR2 K;  4KHP K;  2F4V K;  4LF7 K;  4JI4 K;  4LFB K;  2UU9 K;  4JYA K;  4DV5 K;  4JV5 K;  5IT9 O;  2UXD K;  4JI6 K;  3OTO K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...