4V19S

Structure of the large subunit of the mammalian mitoribosome, part 1 of 2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
143
structure length
143
Chain Sequence
PVENEAVAPEFTNRNPRNLELLAVARKERGWGTVWPSREFWHRLRVIRTQHHIEALVEHRNGQVVVSASTREWAIKKHLYSTRNVVACESVGRVLAERCLEAGINFMVYHPTPWEAASDSIKRLQHAMTEGGVVLREPRRIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITORIBOSOMAL PROTEIN BL27M, MRPL27
publication title The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4v19S00
4JV5K 4DR7K 4X65K 5IWAK 4NXNK 3J7AP 3T1YK 1HNZK 4CVNE 4LFCK 4GKKK 4JI6K 4DR2K 4LFBK 4LF9K 2HHHK 2UU9K 4OX9K 4DV3K 4DV6K 3J7YP 1XNQK 4JI4K 4V19S 2UUAK 2VQFK 1N32K 4KHPK 4DR1K 2UXDK 4B3MK 4JI1K 4YY3K 3JAMO 3J81O 4LF6K 4LF7K 4JI8K 4B3SK 1IBMK 4LF4K 1I94K 4DR5K 4DV7K 2UXBK 3T1HK 4NXMK 5LMUK 3J80O 4DV1K 2E5LK 4LF5K 4JI5K 1N33K 4JI0K 1J5EK 4B3TK 4JI7K 4DR6K 4JYAK 5LL6Z 4AQYK 1IBLK 4LFAK 4JI2K 2UUBK 5AJ3K 5A2QO 5IT9O 1N34K 4GKJK 4CW7B 4DV5K 1HNXK 4DR4K 4JI3K 4LF8K 4B3RK 4X66K 1HR0K 5FLXO 1IBKK 4K0KK 4X62K 2UXCK 2UUCK 1FJGK 5LMNK 4DUZK 1XMOK 4DUYK 1N36K 4DR3K 1XNRK 4DV0K 2ZM6K 4YHHK 4X64K 1HNWK 2VQEK 1XMQK 3OTOK 4DV2K 4DV4K 2F4VK 5BR8K
chains in the Genus database with same CATH superfamily
3WNEA 1RT1A 5C42A 2VWBA 4IDKA 3D2EB 3OYAA 3O8MA 3V9WA 2ZD1A 2Q0UA 1C0MA 3M8QA 4F2SA 1BIUA 2VCPA 3HSTB 4DTJA 2PAVA 2VG6A 1GOBA 1YJ9N 3PLAA 4GKKK 4FZZA 1Q7YO 5DM7L 4LF9K 4EIAA 3THXB 3RVCA 4BE2A 3SV4A 3PO5A 5TKYA 4M3YA 1T44A 5HP1A 3THWB 5AQXA 3AVKA 4FJKA 1XWLA 1XNQK 1N32K 2HBKA 2ZWHA 1K8AO 3I0SA 5DMRA 1YXQA 3AVHA 4EHUA 4JI8K 3AO3A 5DM6L 2HHQA 3VEZA 3HYFA 5LMUK 4MO4A 5H1SQ 4JD2B 4CFCA 1BDGA 3CF5L 3NGIA 4KPYA 3HO1A 4B3TK 1FXXA 1BUPA 3BUZB 4C8MA 4XIUA 3QFPA 1HQUA 3K5NA 1LOTB 3EYZA 4FWRA 1DTQA 1S1UA 3PX6A 3FGUA 4YNQA 5ELZA 1KCFA 3NE6A 3RMAA 2CH5A 2D0PA 4C8OA 3I0RA 4CHQA 3L6QA 2NRRA 4E1JA 2RN2A 3DOLA 2FF6A 3ENHA 2UXCK 5LMNK 2JWLA 1Z26A 2NUBA 4H0OA 5E84A 1XNRK 2EX3A 4IG0A 4FM2A 3VQ9A 4FPBA 3SAHA 3G0ZA 3P39A 3OTOK 1RNHA 4QS8A 5AQGA 3G6EN 3AAPA 3CMAN 3VOVA 2XRIA 4FM1A 5F2RA 4JV5K 4X65K 3B8AX 5CHIA 5HRPA 4AH9A 5CY4A 3HT3A 1WBBA 3DLGA 1QSSA 3ZLJA 1RBVA 1JLGA 3FFIA 1M1KO 4BACA 3ZYYX 3G4SN 2AA4A 3M5RA 1RFQA 3V9XA 3U6FA 3A5MC 3P1GA 4JI6K 3QETA 2HW3A 3VEYA 5JLFA 3QB0A 3TANA 4Z4EA 1TK8A 3PY8A 2O8FA 2QWPA 4B1YB 4EZ9A 2OPSA 3ZT1A 2KZMA 2V7YA 1E3MA 4EAHD 4JI4K 5J2MA 4FVMA 2HBJA 4KHUA 4PA1A 3F9KA 4GMJB 4YY3K 3QIPA 3AVGA 5C25A 3V6DA 4LF7K 3VQ6A 3ZT2A 1TYQB 1VQON 4ICLA 3ZX2A 4LF4K 3VQ8A 4O0IA 4JKGB 4RW9A 1LAVA 4NXMK 2F9TA 1L3UA 4FJ8A 3VN5A 2YNGA 3HRGA 1ATSA 2E1ZA 3O80A 3NF6A 4BROA 3O3GA 3ATVA 3NGZA 4AQYK 1S5JA 4ZHRA 4JHDB 3QERA 1QSYA 1RBTA 4J2BA 1C6VA 2YHAA 4K25A 1EO1A 4BRMA 4MO5A 3M8PA 2P9UA 3LDSA 2QA4N 4JKBA 4BR2A 3DLKA 4LF8K 4ID1A 1OKJA 1KFSA 3C6TA 4W5RA 4OPKA 3IFRA 4DTRA 3TTDA 1W97L 4CZIA 1YVUA 1OH6A 1E4GT 3KD5E 3HPOA 4KV8A 3MN5A 4BRFA 1NKCA 4MDBA 1LAWA 2P9PA 4DB3A 5T7BA 4CEZA 1RDAA 3AVLA 4CE9A 1L3VA 4MFBA 4CZMA 4IJNA 3LAKA 1D4XA 2QWNA 5KQDA 4CD1A 3ZSYA 3QMLA 3VQ4A 4DQSA 3C6UA 3L4QA 1WN7A 3ULDA 1C1BA 1XI1A 3TTFA 3HL8A 5C2FA 1BOTO 4CF9A 4IXCA 4C8KA 1NGGA 1C0TA 1D9FA 4FWNA 3LP0A 2X6SA 3O08A 5KRSA 1KTQA 4H0VB 5SWMA 4KH4A 1NK4A 4BQLA 1O13A 4IFVA 4H0TB 5AQLA 4TSXA 4I7FA 1YF5L 1SKWA 3CHWA 2F96A 4DSIA 3P83D 1HQEA 5F1XA 3C0BA 3O6WA 1KVBA 3ZSXA 4BE1A 4M3ZA 3OA9A 1QZ5A 1QS4A 4JK9A 2GUPA 3C94A 4H0PA 2YX6A 1ATRA 4Q5VA 1T8EA 1Z25A 5AQUA 3RSEA 4FLZA 4DSLA 3VMFB 2A42A 3WXLA 4QS9A 4W5TA 4F3TA 4CJQA 1RILA 4WYBA 3EN9A 2Z1GA 3E9PA 3ZSQA 3SCXA 4IDHA 4KFBA 3LDNA 1RCHA 4W5QA 2B5JA 3VQ7A 2X78A 3CJ9A 3SUPA 4GV9A 1NBWA 1LWCA 3H08A 4CGIA 1JLFA 4FWQA 3CJCA 4EP4A 1HNXK 1QVFM 3OJUA 1C0GA 2P9NA 1NGJA 4K8XA 4UY8O 2VWJA 3OY9A 4KHSA 4A57A 3K9JA 1JLEA 2FBTA 3CCQN 4QCLA 3V9SA 2HHUA 1HYSA 4BRIA 3SK3A 3QNNA 4FLYA 4ZTJA 3SUNA 4YOWA 5HRNA 5B8HA 3CJ7A 4FLVA 5FPNA 3AARA 3VF6A 3LM9A 2ZM6K 4B1XB 3KLGA 4IOAL 1JLQA 4LC9B 3KLFA 1HNWK 3VQPA 2F9WA 3PV8A 2Y1IA 4CJ7A 1RTDA 4KTZA 4B9SA 1X1PA 3QINA 4C1NI 2GWKA 4FJ5A 5M1QA 3OYDA 4JEPA 5TKWA 4JD2A 2J4RA 4CK2A 1JLCA 2A6AA 3CQYA 5CE3A 5HRSA 3KIOA 3K59A 4I2QA 4DFPA 4OLBA 1RDWX 2B4JA 3ZSRA 3DXKA 1U2VB 3MCPA 4O55A 3BF3A 1KLMA 4FK2A 3LZJA 4BR0A 3LDLA 1VQKN 3G25A 4MDAA 1HNVA 3FZLA 4B3MK 1SZ2A 5J2PA 1R0AA 4LF6K 3WNGA 3O3FA 2QWRA 3M3ZA 3M8RA 4BVOA 4CIGA 1IBMK 5AQHA 4N76A 4OKKA 3BZKA 1OVYA 3D6RA 5AQSA 4WQ5C 2BDPA 3SPZA 4C1NK 2KTQA 5C0YA 3AY9A 2PZSA 4GVEA 3W0LA 4BRLA 3CM5A 1NGIA 4WFAL 3I55N 5BRDA 1VQNN 4F2RA 2O8CA 1CZBA 1JCFA 1YHQN 1ZBSA 3AGRA 3MXIA 2P5GA 3LALA 3A5OC 1EETA 1LWFA 4JKCA 4FJGA 1YVNA 1T3VA 4K41A 4K42A 2D5RA 2JWKA 2WC9A 3OYEA 2A3ZA 2Q3SA 4WFNL 1VSLA 3BGRA 3CFRA 4CGHA 4ELVA 1L5UA 1JCEA 1W7AA 2DPNA 3JSMA 4W5NA 4IEEA 4WCEL 4FLTA 1XMQK 4YOVA 4IFYA 1NK0A 4AILC 2VGNA 4E1MA 1NGHA 4DQRA 1FW6A 3P38A 5CR4A 2F7TA 4GV6A 4L8RB 1JL2A 4I6MB 1KQSM 1EQYA 1RDDA 3VETA 1HNZK 2FSNA 4LFCK 1QVGM 4JKHA 2HHTA 3M8SA 3CPWM 4JLHA 3HZ6A 3ZCMA 3AVIA 5EY4A 3RTVA 2OA8A 3E01A 2HF4A 3H3OB 2F8SA 4FXDA 4KI4A 1HMVA 3F2KA 1U49A 1CZ9A 2OTLN 1Q8IA 1TAUA 1XUPO 4JKFA 4CBXA 5M1OA 2GTDA 4DQIA 3C7NB 1RTIA 1IKXA 3ZX3A 4DV7K 2UXBK 1T7PA 1Q81O 2GWJA 2WTUA 3MN6A 4IWVA 4KBOA 3MAQA 4JI5K 4O5FA 1NK5A 5JVGL 1IBLK 1ATNA 1C0FA 2VG5A 4ELTA 3KD1E 3SJHA 4LD0A 3WUHA 3FZFA 3SLCA 4FO0A 3KJVA 4OPAA 3SNNA 1MWMA 2X74A 1BI4B 2ITMA 3UB5A 3T3FA 3NVMA 3UE5A 4KHWA 4PKGA 1NJXA 2F8TA 4KHNA 4CJSA 2DFHA 3ATUA 3CC7N 4EHTA 1G15A 2W6LA 2HHWA 4XEIA 2W42A 4JRQA 1BA0A 4G1QA 4DSEA 5C10A 2OPQA 2Q0RA 1EWRA 3NF7A 5GINA 3U3YA 1OH8A 2YHYA 3NGYA 4BRQA 1DLOA 3CG7A 3SI6A 3ZETB 2DTUA 4IBNA 4CJTA 3ULEA 4LH5A 1YT3A 3UKRB 1S3XA 3WNHA 3R8EA 4A62A 2ZJPL 4YOXA 2KLAA 3MN9A 2HHHK 3RMDA 3QEPA 3V1OA 2ZGYA 3NF8A 2NLXA 1RT6A 4HTUA 1U04A 1V4TA 2X6NA 3OYHA 3BF1A 5EXWA 4CBUA 5GAHP 3O3HA 3DI6A 4CFDA 4HUEA 4DTNA 4B9NA 1MA9B 4N47A 3OYKA 5D3GA 1HX1A 4M3XA 1S1TA 2DFFA 2PBDA 3L0QA 2HNYA 3TAMA 4CJEA 4RTFD 3VQBA 3VEWA 4BQZA 1O1WA 4XH1A 3WQTA 1Q18A 5AZIB 1LV5A 5M1NA 4FLUA 4DSKA 3WXJA 4PQUA 3RR8A 4DLGA 2IOCA 1Q9XA 3TPQA 1JXBA 4FJJA 4JYAK 1IKWA 1A5XA 3CMEN 3LL3A 4HTLA 4JK7A 4DF4A 4I9LA 4FJIA 3OS1A 2E2OA 1IG9A 3H1QA 4CGJA 3HOTA 4E89A 1TUYA 3IDHA 3TSUA 3SMSA 2LSNA 2OZMA 1V4SA 3S3NA 4BC3A 1DTTA 4FJMA 1NJZA 4NO7A 3DXMB 1HR0K 3QIOA 2E6LA 5BPLA 4EZ6A 1U2VA 5AZJB 5AR0A 4M42A 5SZTA 1NJIO 3A5NC 4NLCA 4YOUA 2NZTA 3GBTA 4KB0A 2O8BB 4CGFA 3S3MA 4IOCL 2IIRA 2GBZA 2P9KA 4CERA 3P31A 4H5WA 4DUYK 4AHVA 4DS5A 4DR3K 4RW8A 1U45A 3ZT0A 4H5VA 1I39A 5BN9A 4JK8A 2P9IB 2QWQA 1TL3A 3O9UA 4B1UB 2QWOA 4CZJA 4E7KA 1XC9A 4FJLA 4FCYA 1YI2N 3GDQA 3V81A 3EE8A 4FPAA 2W41A 5JICA 1XHZA 1TV6A 5JLHA 4NXNK 1NMNA 4YOYA 1RT7A 1WSJA 4DR2K 3VF4A 3ITHA 5C15A 3QICA 1JJ2M 2P9LB 4MQ3A 3PIPL 1RBUA 4EP5A 5GAGP 1X3MA 4Z4FA 5KRTA 4OKEA 4YDUC 2PYLA 4IOXA 4KH6A 3OYBA 2UXDK 4BG9A 5HBMA 3AVAA 1NMDA 2G8KA 1QZ6A 2ATQA 3QNOA 2KKZA 3HSCA 4CZFA 2IGIA 5AQFA 1BWFO 1KLNA 2PYJA 3R6MA 4DTUA 4H4OA 1B9DA 2Q36A 3H46O 3DJCA 3M1FA 2O8EA 3LWMA 1U48A 1NGDA 3S9HA 3VTHA 4U7BA 4AHTA 2ASMA 2R7YA 3L4IA 4LF5K 4PKHA 1H1VA 2VYPA 1KRPA 3TI0A 3KWGA 3K5OA 3TAPA 2XY6A 1K8KB 2P5OA 3VERA 3VQ5A 3WEEB 2P9SB 2RHKA 4I6MA 1N34K 3OYNA 3THYA 3MDQA 2W40A 4KTQA 3U9ZA 1LW2A 3THVA 4X66K 4CEQA 1K73O 5K14A 1TGOA 5FLXO 5ADXA 1CXQA 1BU6O 3D2FB 3FR0A 1VHXA 2HBMA 2Q97A 5BR9A 3E9OA 4FWLA 2BE2A 4B1ZA 1LWEA 1HKCA 5M1KA 3O9TA 4YHHK 4DKWA 3NHGA 4LY7A 2NRVA 5BPNA 1S6QA 3OW2M 2FBXA 3K9KA 1S9GA 3KTQA 1VQ4N 1NGAA 2WUSA 4PL8A 4CJUA 4B8AB 2YHXA 4YFUA 4CEBA 4IO8A 3P5JA 4BGAA 4BE0A 4FLWA 3HM8A 2HOEA 2G8IA 4DFMA 1HJRA 4EFHA 3CJ1A 1QQOA 3C6AA 3S3OA 5FDLA 4N5SA 1YIJN 3CYMA 2VG7A 1GLLO 2XY5A 1TAQA 3AA4A 3WNFA 1F21A 3WQUA 1CLQA 2HNZA 1LCUA 4RWTA 4HHTA 1S1VA 3E66A 3TTCA 2I7PA 5BRFA 4DLEA 5CYQA 3JAMO 1WUAA 2W6KA 1QQNA 3CC2N 1SKRA 3ZEUA 1MDUB 4F9OA 3IUCA 1ZXOA 3EZWA 1SQKA 4FWMA 1NLVA 3L3VA 3AVFA 2Q1NA 4PUOA 4WQ4A 4PWDA 2ZF5O 3TABA 4OVLA 3J80O 3CCMN 2G8UA 4BR5A 2NRTA 4CEOA 5AQTA 4CJPA 1XHXA 2IS3A 4LSNA 1T6DA 4JKDA 4DR6K 3K57A 2PY5A 5AQJA 1WSIA 1BQMA 3O4NA 1UA1A 5IT9O 5E26A 1W9HA 1UAXA 2WBNA 3UKRA 3OS0A 1VSFA 1FK9A 5AFUH 2EWSA 5BN8A 3HI0A 4OKJA 3SQ4A 2RPIA 4BC4A 4BDYA 2QWLA 4H4MA 4U67L 1J53A 3PSIA 2KZZA 4I9QA 3BDPA 5HROA 1BA1A 4B9UA 4X62K 1FJGK 3QLHA 3FLCO 3ISNC 3D2EA 4I2PA 4UQGA 2QKKA 5EOYA 3R1XA 3MX2A 4CHPA 3VEVA 4JKAA 2IVNA 3G10A 1HUXA 2ZE2A 2OCEA 1WSHA 3BEXA 2HHVA 3WT0A 3HM9A 3EY1A 3CXCM 3HJFA 5HOOA 3THXA 4M3WA 1EWQA 3CERA 4FWSA 3ID8A 3VGMA 3OYLA 3U3GA 2XY8A 5KGXA 3THWA 1TVRA 3F73A 3TSPA 1YTUA 4CJKA 4CEDA 1IJJA 1U4BA 2BANA 1WBDA 2BTFA 1VQLN 2CGKA 1HPMA 5FRNA 4AHRA 4NCAA 3KK1A 3CPEA 1L3TA 1XQSC 3T7ZA 2YNHA 2O4GA 2VQFK 2IVPA 3HVTA 4FOEA 3DXMA 1GOCA 4K8ZA 4M41A 2Q31A 2OZSA 1VSMA 1NKEA 3KZBA 3J81O 1NGEA 1JCGA 2AJQA 4Z4GA 4M45A 4CJVA 1UOCA 3HP6A 3NFAA 5BREA 4AM6A 5I9EB 1XC3A 3C95A 3IMXA 4XH5A 4KTWA 4RG8A 3T1HK 1YTAA 1S1WA 3V9UA 1YJWN 1Y64A 2GEMA 3KK2A 3KLHA 3O4WA 1MWKA 4DFJA 1X9JA 3VF2A 4F4KA 4CF8A 4DQQA 2UUBK 1TK0A 3QEXA 1U6ZA 5AQQA 3SBGA 1K9MO 3WXIA 4AHCA 2D0OA 4BWMA 1NKBA 3AGKA 1QE1A 2HB5A 3JXUA 2XO7A 3GG4A 4FK0A 2FBYA 1KAXA 4B9LA 1KSPA 2G8WA 1S72N 1RTHA 3N4QA 1RT4A 3NVKA 3PO4A 4PY5A 3OBWA 1JLBA 1HNIA 4BRGA 4DQ8A 3OYFA 4OO1J 4JAXA 4G9ZA 3SUQA 2JLEA 2P1JA 3CI5A 1Y97A 4C23A 1KD1O 4KI6A 2QI2A 2CH6A 1ASVA 3O9QA 4GV3A 1NGBA 4H5RA 3R9PA 4FJHA 3ALYA 1ESVA 3K5LA 1IO2A 1VQ5N 3D0PA 3CCLN 4AHSA 3TAQA 1C1CA 1T03A 5LY3A 4HUFA 1KVCA 3UKUB 4LFBK 1DEJA 3DLBA 3SQ2A 4IKFA 3BY5A 3N4PA 3CETA 2QM1A 4H0YB 1ZC6A 1KAYA 4CZKA 4BR7A 1TYQA 4ILHA 4A59A 3RRGA 3RWUA 3NMUA 1G99A 4JKGA 1RDCA 3AA5X 5GIPA 3CCRN 5KGWA 2JGUA 4JI1K 4JN4A 3MWTA 3MEDA 5FPDA 3W3DA 4BRCA 4O8KA 2O8FB 4YORA 1WSFA 1UWBA 4CK3A 3CCSN 4E7HA 3PX4A 5FPMA 3F9MA 3U9DA 4M3UA 4JHDA 2G8FA 3I33A 4CZHA 4B9VA 2H3GX 1J9AA 4DV1K 3QDKA 2FXUA 3QEWA 2ETJA 4M7XA 1NNEA 4C8LA 1GLEG 4CZLA 1J5EK 4NYNA 3G71N 5GAEP 4OLAA 5HLFA 4KAZA 1I3AA 4ISEA 4MLEA 2YKNA 2B6AA 3ENBA 3CQ8A 2QWMA 2FSKA 1C0UA 3VPZA 1SUQA 3R3LA 3ZT3A 4CJRA 1DT9A 3IRXA 1S1XA 2ASOA 1B9FA 4M3TA 4NYFA 2QKBA 1WAJA 5LJVA 4NB4A 3PIOL 3T19A 4K43A 3H1VX 4QS7A 1JKHA 4A61A 3PSFA 2D0BA 3D45A 5I42A 3OYMA 3KVGA 5KQ8A 2YNFA 5J2NA 4DV0K 3SMPA 3LANA 1DKGD 1R59O 4M63C 1WNSA 2ZJQL 2P9PB 4CJ4A 2OPPA 1NK9A 3NH1A 4O5BA 3LM2A 3EKUA 3D7EO 1KXPA 5IWAK 1NJYA 3VQDA 4E7LA 3PUFA 1M90O 3AO2A 3J7AP 3M6GA 2YJEA 3O9SA 4CJLA 2Q2RA 1RGIA 4Y1CA 4DQPA 3VQCA 4ZTFA 5EX5A 4IZ9A 1U47A 1RBSA 3SZ2A 3SJJA 1QHTA 2A40A 1IG8A 1HJOA 4GY2B 2UUAK 4IO9L 4DR1K 4CI6A 4NLBA 3LP3A 4ID5A 4KHQA 5JS2A 4FZYA 4DSJA 4AF1A 4B3SK 4CCHA 4HCBA 1VSJA 4CHNA 4CHZA 3TR8A 1VSDA 3HPGA 3NBPA 1K6YA 3QESA 1VRUA 1N33K 2ZJRL 4JI0K 1EX4A 2PFUA 1GOAA 3AVJA 2A5XA 3VA3A 2A41A 2WFBA 3Q7BA 3RSEB 3HOSA 3FZHA 4FJNA 4WQ5A 3KWIA 2NRWA 3QBWA 1BG3A 2V7ZA 4KH5A 2WONA 3L2UA 3O5BA 3BZCA 2EHGA 3OYGA 4BR9A 4Y0WA 4B3RK 1BCMA 2G8HA 5JS1A 4CHYA 4HUGA 1E4FT 2KHOA 1GLCG 4B9MA 5LJWA 2HNDA 4K0KK 4DWIA 4WFBL 3MK6A 3IAYA 1GLFO 2P9NB 3AVCA 4GVMA 1EP4A 3OBYA 1ZBLA 3TSQA 3EEQA 5KPZA 4ILJA 3SUOA 4OGCA 1IKYA 4B1VA 3T69A 3L2QA 1VSHA 3LDPA 1JLAA 3EL2A 4DF8A 5BR8K 3HXMA 5I3UA 4BRKA 4O0JA 3HVRA 4WQ4C 4BG8A 4Q0BA 4Z4HA 2Y1JA 3DM2A 4O8UA 5FPEA 4DTOA 3T1YK 3OS2A 4ELUA 4CZEA 3ZSZA 1MU2A 1Q82O 2NRXA 2QW9A 3C6HA 3EKSA 1D5AA 1ZBHA 1QHAA 2ASPA 2RE2A 4E1NA 3V1QA 4FWKA 3HBTA 4B1WB 1P8ZA 1ASUA 3AVBA 3GOIA 3QO9A 3PX0A 1N6QA 4B3OA 1GLAG 5ADXH 3NH0A 4H8KA 2E1YA 3DXKB 3AO1A 1VQ7N 4QAGA 2HVIA 1BCOA 4GW6A 3J8AA 1OVQA 4DR5K 3F5TA 3K2PA 5KTQA 2Z1HA 2QXLA 2Z1JA 3KLIA 4Z4IA 4J2EA 3B6PA 2ITGA 3DAWA 3RRHA 2E5LK 4JS4A 3QBXA 4BRHA 1S9EA 3MXMA 1VQPN 5FROA 2O4IA 4W5OA 3NCIA 4OPHA 5LL6Z 1TL1A 1TKTA 2A1SA 4CECA 4CGDA 1RDUA 2HMIA 4DMNA 5AQVA 4H5TA 4GKJK 2Z1IA 4CW7B 4DV5K 1RT2A 3AVMA 4AHUA 1A5WA 3UKUA 4A5BA 3QEVA 2KW4A 3I56N 3L8BA 3TWHA 1T6CA 4R79A 1EKEA 2E2NA 3V1RA 1QSLA 4BDZA 2O8CB 1IBKK 2VGMA 3OHRA 2ZQBA 1J6ZA 1ZBIA 3V4IA 1NG9A 4KREA 2FSJA 2UUCK 5AQMA 4CF0A 3KLEA 3HP9A 3FE1A 4DUZK 3L2VA 3OVNA 5AQIA 1JL1A 4CJ5A 3GE1A 4O44A 1C1AA 5AQYA 2YHBA 4J8FA 3MEEA 1X9MA 5EU7A 1W0HA 4LH4A 3SQ0A 2E88A 5F0XA 3WXKA 4OGEA 2E2PA 4JKEA 2IAJA 4F3OA 5CZ2A 4DTPA 3CM6A 3MMVA 2XHBA 1NK7A 1NK6A 3DLRA 3TAGA 4Z0UA 4J2DA 3EZ5A 5E41A 4Z94A 2QTDA 4Z4CA 4IFEA 3TARA 4H0XB 4BC5A 3L2WA 3SBTA 3J7YP 1N5YA 5C24A 3C7NA 1WOQA 3OJSA 4V19S 1YAGA 1VQ8N 4KHPK 1YJNN 1P90A 5GIOA 2E2QA 1VRTA 5GADP 1KFDA 4BR4A 4HCCA 4BDPA 4H03B 4J2AA 3SPYA 3OYJA 1I94K 3JYTA 1NGFA 2E6MA 3AO5A 3CCUN 1D9DA 2XY7A 1L3SA 3RMBA 1NU0A 4A2BA 4B8CA 1OH5A 5JVHL 1KC8O 4DTXA 4OPJA 3MXJA 5AQKA 2YV0X 5J2QA 2V51B 4LFAK 1TK5A 1UA0A 2WOMA 4H5NA 4IG3A 5A2QO 4B9TA 2HHSA 3ENOA 1BI4A 4BC2A 4NCGA 3K0SA 1X9SA 3I8DA 4DR4K 4DU1A 4BRNA 3MCAB 3VGLA 1VSIA 4ISFA 1QQMA 3O1BA 4CD3A 4KB1A 2YI1A 5AQWA 3LWLA 3BP8A 5MLCQ 2OPRA 4Y1DA 4CIFA 3CCVN 3EO3A 3DRPA 2IC3A 4YOTA 1WB9A 2D1KA 1BQNA 2BUPA 1S22A 2HSTA 3ZETA 3AV9A 1YITN 3EE9A 1HKBA 5C12A 4PL7A 3V9ZA 4FW2A 4FZXC 1VQ9N 3ID6A 1FKPA 4AM7A 3H6EA 1HYZA 2FC0A 4DHYA 4C8NA 4DG1A 3OYCA 3DLEA 5KPTA 4CIEA 4HWIA 2O8DB 1HPZA 2D0AA 4CVNE 3VQQA 2IVOA 1CZAN 4BRPA 4CBWA 1VAZA 4DSFA 4E7IA 1KAZA 3E9LA 3DRRA 3RR7A 1BL3A 3LAMA 5AQOA 5M1FA 3ULEB 1HYVA 4CK1A 3UIQA 1TKDA 5AZIA 3FZKA 1SS6A 3O4QA 1B92A 4CJWA 1Z6RA 3VESA 1Q9YA 1EXQA 3AA3A 3CC4N 4CF2A 5DK5A 1KVAA 2YKMA 1RTJA 4M3RA 4DS4A 4M7YA 4YDUA 4KRFA 3WXMB 3NDKA 1X9WA 4CEEA 1GLJO 1W2BM 4KHYA 1SL0A 1HRHA 3TAEA 2YNIA 3A2FA 4FM0A 4BWJA 4OJRA 3DRSA 2YHWA 3DLLL 2E20A 1QQCA 5FRMA 5AJ3K 3CJBA 5AZJA 1LW0A 3SAFA 5EVZA 4PHTX 3LPUA 5BPMA 3J7ZO 2O8BA 3A8YA 2RKIA 3QFUA 1D8YA 4E7JA 4FWOA 4IEIA 4CF1A 1JXEA 3DMJA 3FZMA 4FW1A 2GX9A 2CGLA 2OANA 3ZT4A 2P9IA 1RT5A 3JS6A 3MN7A 3HK2A 1BISA 4DCHA 3KKRA 4CESA 1DGKN 4E19A 3RMCA 3A0IX 1NWKA 2FLOA 5AFUA 1TKZA 2I5JA 1NM1A 2E4LA 3FFKB 1N36K 4ISGA 4X64K 1HLUA 3P4IA 4BRDA 2VQEK 5BRHA 2KFZA 4DV2K 4DV4K 1HKGA 3B6OA 2HHXA 3O1WA 2I7NA 1RT3A 4JRPA 4FK4A 2P9KB 4DR7K 2G8VA 2P9LA 4CEAA 3ASMA 3DWLA 1CXUA 2OYQA 3CIPA 4BY9C 4GNIA 2P51A 3A5LC 4FJXA 2BGGA 1ILYA 4FSVA 3CJAA 2IDOA 1BGXT 1J54A 2GUIA 5CYMA 1NJWA 2UU9K 3CQXA 4RW4A 1VQ6N 1WLJA 3DYAA 2HVHA 2KFNA 2YJFA 4OX9K 4DV3K 4DV6K 1IV0A 2QXFA 3AA2A 3VTIA 4FOIA 1BIZA 3AAQA 4O4GA 5KI6A 4RW7A 4F8RA 1N8RO 2HBLA 1ZBUA 4QOZB 4DU4A 2FBVA 5JMVA 3SV3A 4FVUA 1K8KA 3I8BA 3TAFA 3CCJN 3QEIA 4RCHA 3HPHA 4CGGA 1S6PA 2P9SA 2DFEA 3WEEA 4HVJA 4JS5A 1VQMN 2GV9A 3DOKA 3MWPA 2OTJN 4CEFA 2D4WA 1T05A 3KK7A 4A5AA 4BGBA 3TU5A 2ZGZA 4B08A 3MX5A 3S41A 1IH7A 2GELA 2O8EB 3CFOA 3C65A 3VQAA 4N41A 3ZSOA 2HF3A 4BVPA 3K58A 3D2FA 1YUWA 1J5OA 4KKOA 4LSLA 4JI3K 4R5PA 3AO4A 4FJ9A 1VSEA 1ASWA 1A5VA 2V52B 3HTVA 3GL1A 4CFBA 2UYTA 3CFPA 3LZIA 5HL7L 3THYB 3ZSWA 3ZSVA 4A2AA 1ITGA 2E8AA 3LDOA 4FL9A 3U4LA 1NK8A 1VSKA 4RW6A 3AVNA 1BO5O 2YCHA 4DTSA 3U8XA 3H45C 4CZGA 3KK3A 4XH4A 3NAEA 1GLBG 3VQEA 3MECA 1SL1A 2QEXN 4B9QA 2NNWA 1ZYQA 1TUUA 1WSEA 3T1AA 4CJFA 2NRHA 4MLHA 5AQRA 1Q86O 2P9UB 4FLXA 3SYZA 3K5MA 3L3UA 3KKSA 3DLHA 4WF9L 3IKMA 5AQZA 3VEXA 4DTMA 4BREA 5HRRA 1RBRA 2BH1A 1FKOA 1VK0A 4DFKA 2FF3B 2QK9A 1NOYA 3MEGA 3OYIA 4CJ3A 4NCBA 3NH2A 3E1YA 2KQ2A 1Z05A 3KHYA 2AP1A 4WE1A 3O9RA 2DY4A 2HMPA 4JNEA 4BRAA 2RF2A 1SKSA 4IJAA 5AQPA 4L3QA 3L2RA 1SL2A 3LP2A 4E3SA 3ZEUB 4JI7K 3SAGA 4JI2K 3CCEN 2NRZA 3VA0A 1TKXA 3LPTA 5M1PA 2A1RA 3Q7CA 5C2DA 4E0DA 4KO0A 4CFAA 2O8DA 4ILGB 5CZ1A 1GLDG 3IG1A 2D0CA 3LP1A 1NOZA 4FJ7A 3NF9A 3LDQA 3SQ1A 1RDBA 2VWKA 1WAFA 1WSGA 4N56A 5KPRA 3VEOA 5AQNA 1SV5A 1OH7A 1REVA 1NGCA 3ZX0A 1X3NA 1QTMA 3VGKA 1ZBFA 4FYDA 1XMOK 4PKIA 3IS9A 4FWPA 2CGJA 3CD6N 1BHLA 5J1EA 3H3NO 1IKVA 1SAZA 3VENA 4CHOA 2F4VK 4DU3A
chains in the Genus database with same CATH topology
4JV5K 4DR7K 4X65K 5IWAK 4NXNK 3J7AP 3T1YK 1HNZK 4CVNE 4LFCK 4GKKK 4JI6K 4DR2K 4LFBK 4LF9K 2HHHK 2UU9K 4OX9K 4DV3K 4DV6K 3J7YP 1XNQK 4JI4K 4V19S 2UUAK 2VQFK 1N32K 4KHPK 4DR1K 2UXDK 4B3MK 4JI1K 4YY3K 3JAMO 3J81O 4LF6K 4LF7K 4JI8K 4B3SK 1IBMK 4LF4K 1I94K 4DR5K 4DV7K 2UXBK 3T1HK 4NXMK 5LMUK 3J80O 4DV1K 2E5LK 4LF5K 4JI5K 1N33K 4JI0K 1J5EK 4B3TK 4JI7K 4DR6K 4JYAK 5LL6Z 4AQYK 1IBLK 4LFAK 4JI2K 2UUBK 5AJ3K 5A2QO 5IT9O 1N34K 4GKJK 4CW7B 4DV5K 1HNXK 4DR4K 4JI3K 4LF8K 4B3RK 4X66K 1HR0K 5FLXO 1IBKK 4K0KK 4X62K 2UXCK 2UUCK 1FJGK 5LMNK 4DUZK 1XMOK 4DUYK 1N36K 4DR3K 1XNRK 4DV0K 2ZM6K 4YHHK 4X64K 1HNWK 2VQEK 1XMQK 3OTOK 4DV2K 4DV4K 2F4VK 5BR8K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 K;  4DR7 K;  4X65 K;  5IWA K;  4NXN K;  3J7A P;  3T1Y K;  1HNZ K;  4CVN E;  4LFC K;  4GKK K;  4JI6 K;  4DR2 K;  4LFB K;  4LF9 K;  2HHH K;  2UU9 K;  4OX9 K;  4DV3 K;  4DV6 K;  3J7Y P;  1XNQ K;  4JI4 K;  4V19 S;  2UUA K;  2VQF K;  1N32 K;  4KHP K;  4DR1 K;  2UXD K;  4B3M K;  4JI1 K;  4YY3 K;  3JAM O;  3J81 O;  4LF6 K;  4LF7 K;  4JI8 K;  4B3S K;  1IBM K;  4LF4 K;  1I94 K;  4DR5 K;  4DV7 K;  2UXB K;  3T1H K;  4NXM K;  5LMU K;  3J80 O;  4DV1 K;  2E5L K;  4LF5 K;  4JI5 K;  1N33 K;  4JI0 K;  1J5E K;  4B3T K;  4JI7 K;  4DR6 K;  4JYA K;  5LL6 Z;  4AQY K;  1IBL K;  4LFA K;  4JI2 K;  2UUB K;  5AJ3 K;  5A2Q O;  5IT9 O;  1N34 K;  4GKJ K;  4CW7 B;  4DV5 K;  1HNX K;  4DR4 K;  4JI3 K;  4LF8 K;  4B3R K;  4X66 K;  1HR0 K;  5FLX O;  1IBK K;  4K0K K;  4X62 K;  2UXC K;  2UUC K;  1FJG K;  5LMN K;  4DUZ K;  1XMO K;  4DUY K;  1N36 K;  4DR3 K;  1XNR K;  4DV0 K;  2ZM6 K;  4YHH K;  4X64 K;  1HNW K;  2VQE K;  1XMQ K;  3OTO K;  4DV2 K;  4DV4 K;  2F4V K;  5BR8 K; 
#chains in the Genus database with same CATH topology
 3WNE A;  1RT1 A;  5C42 A;  2VWB A;  4IDK A;  3D2E B;  3OYA A;  3O8M A;  3V9W A;  2ZD1 A;  2Q0U A;  1C0M A;  3M8Q A;  4F2S A;  1BIU A;  2VCP A;  3HST B;  4DTJ A;  2PAV A;  2VG6 A;  1GOB A;  1YJ9 N;  3PLA A;  4GKK K;  4FZZ A;  1Q7Y O;  5DM7 L;  4LF9 K;  4EIA A;  3THX B;  3RVC A;  4BE2 A;  3SV4 A;  3PO5 A;  5TKY A;  4M3Y A;  1T44 A;  5HP1 A;  3THW B;  5AQX A;  3AVK A;  4FJK A;  1XWL A;  1XNQ K;  1N32 K;  2HBK A;  2ZWH A;  1K8A O;  3I0S A;  5DMR A;  1YXQ A;  3AVH A;  4EHU A;  4JI8 K;  3AO3 A;  5DM6 L;  2HHQ A;  3VEZ A;  3HYF A;  5LMU K;  4MO4 A;  5H1S Q;  4JD2 B;  4CFC A;  1BDG A;  3CF5 L;  3NGI A;  4KPY A;  3HO1 A;  4B3T K;  1FXX A;  1BUP A;  3BUZ B;  4C8M A;  4XIU A;  3QFP A;  1HQU A;  3K5N A;  1LOT B;  3EYZ A;  4FWR A;  1DTQ A;  1S1U A;  3PX6 A;  3FGU A;  4YNQ A;  5ELZ A;  1KCF A;  3NE6 A;  3RMA A;  2CH5 A;  2D0P A;  4C8O A;  3I0R A;  4CHQ A;  3L6Q A;  2NRR A;  4E1J A;  2RN2 A;  3DOL A;  2FF6 A;  3ENH A;  2UXC K;  5LMN K;  2JWL A;  1Z26 A;  2NUB A;  4H0O A;  5E84 A;  1XNR K;  2EX3 A;  4IG0 A;  4FM2 A;  3VQ9 A;  4FPB A;  3SAH A;  3G0Z A;  3P39 A;  3OTO K;  1RNH A;  4QS8 A;  5AQG A;  3G6E N;  3AAP A;  3CMA N;  3VOV A;  2XRI A;  4FM1 A;  5F2R A;  4JV5 K;  4X65 K;  3B8A X;  5CHI A;  5HRP A;  4AH9 A;  5CY4 A;  3HT3 A;  1WBB A;  3DLG A;  1QSS A;  3ZLJ A;  1RBV A;  1JLG A;  3FFI A;  1M1K O;  4BAC A;  3ZYY X;  3G4S N;  2AA4 A;  3M5R A;  1RFQ A;  3V9X A;  3U6F A;  3A5M C;  3P1G A;  4JI6 K;  3QET A;  2HW3 A;  3VEY A;  5JLF A;  3QB0 A;  3TAN A;  4Z4E A;  1TK8 A;  3PY8 A;  2O8F A;  2QWP A;  4B1Y B;  4EZ9 A;  2OPS A;  3ZT1 A;  2KZM A;  2V7Y A;  1E3M A;  4EAH D;  4JI4 K;  5J2M A;  4FVM A;  2HBJ A;  4KHU A;  4PA1 A;  3F9K A;  4GMJ B;  4YY3 K;  3QIP A;  3AVG A;  5C25 A;  3V6D A;  4LF7 K;  3VQ6 A;  3ZT2 A;  1TYQ B;  1VQO N;  4ICL A;  3ZX2 A;  4LF4 K;  3VQ8 A;  4O0I A;  4JKG B;  4RW9 A;  1LAV A;  4NXM K;  2F9T A;  1L3U A;  4FJ8 A;  3VN5 A;  2YNG A;  3HRG A;  1ATS A;  2E1Z A;  3O80 A;  3NF6 A;  4BRO A;  3O3G A;  3ATV A;  3NGZ A;  4AQY K;  1S5J A;  4ZHR A;  4JHD B;  3QER A;  1QSY A;  1RBT A;  4J2B A;  1C6V A;  2YHA A;  4K25 A;  1EO1 A;  4BRM A;  4MO5 A;  3M8P A;  2P9U A;  3LDS A;  2QA4 N;  4JKB A;  4BR2 A;  3DLK A;  4LF8 K;  4ID1 A;  1OKJ A;  1KFS A;  3C6T A;  4W5R A;  4OPK A;  3IFR A;  4DTR A;  3TTD A;  1W97 L;  4CZI A;  1YVU A;  1OH6 A;  1E4G T;  3KD5 E;  3HPO A;  4KV8 A;  3MN5 A;  4BRF A;  1NKC A;  4MDB A;  1LAW A;  2P9P A;  4DB3 A;  5T7B A;  4CEZ A;  1RDA A;  3AVL A;  4CE9 A;  1L3V A;  4MFB A;  4CZM A;  4IJN A;  3LAK A;  1D4X A;  2QWN A;  5KQD A;  4CD1 A;  3ZSY A;  3QML A;  3VQ4 A;  4DQS A;  3C6U A;  3L4Q A;  1WN7 A;  3ULD A;  1C1B A;  1XI1 A;  3TTF A;  3HL8 A;  5C2F A;  1BOT O;  4CF9 A;  4IXC A;  4C8K A;  1NGG A;  1C0T A;  1D9F A;  4FWN A;  3LP0 A;  2X6S A;  3O08 A;  5KRS A;  1KTQ A;  4H0V B;  5SWM A;  4KH4 A;  1NK4 A;  4BQL A;  1O13 A;  4IFV A;  4H0T B;  5AQL A;  4TSX A;  4I7F A;  1YF5 L;  1SKW A;  3CHW A;  2F96 A;  4DSI A;  3P83 D;  1HQE A;  5F1X A;  3C0B A;  3O6W A;  1KVB A;  3ZSX A;  4BE1 A;  4M3Z A;  3OA9 A;  1QZ5 A;  1QS4 A;  4JK9 A;  2GUP A;  3C94 A;  4H0P A;  2YX6 A;  1ATR A;  4Q5V A;  1T8E A;  1Z25 A;  5AQU A;  3RSE A;  4FLZ A;  4DSL A;  3VMF B;  2A42 A;  3WXL A;  4QS9 A;  4W5T A;  4F3T A;  4CJQ A;  1RIL A;  4WYB A;  3EN9 A;  2Z1G A;  3E9P A;  3ZSQ A;  3SCX A;  4IDH A;  4KFB A;  3LDN A;  1RCH A;  4W5Q A;  2B5J A;  3VQ7 A;  2X78 A;  3CJ9 A;  3SUP A;  4GV9 A;  1NBW A;  1LWC A;  3H08 A;  4CGI A;  1JLF A;  4FWQ A;  3CJC A;  4EP4 A;  1HNX K;  1QVF M;  3OJU A;  1C0G A;  2P9N A;  1NGJ A;  4K8X A;  4UY8 O;  2VWJ A;  3OY9 A;  4KHS A;  4A57 A;  3K9J A;  1JLE A;  2FBT A;  3CCQ N;  4QCL A;  3V9S A;  2HHU A;  1HYS A;  4BRI A;  3SK3 A;  3QNN A;  4FLY A;  4ZTJ A;  3SUN A;  4YOW A;  5HRN A;  5B8H A;  3CJ7 A;  4FLV A;  5FPN A;  3AAR A;  3VF6 A;  3LM9 A;  2ZM6 K;  4B1X B;  3KLG A;  4IOA L;  1JLQ A;  4LC9 B;  3KLF A;  1HNW K;  3VQP A;  2F9W A;  3PV8 A;  2Y1I A;  4CJ7 A;  1RTD A;  4KTZ A;  4B9S A;  1X1P A;  3QIN A;  4C1N I;  2GWK A;  4FJ5 A;  5M1Q A;  3OYD A;  4JEP A;  5TKW A;  4JD2 A;  2J4R A;  4CK2 A;  1JLC A;  2A6A A;  3CQY A;  5CE3 A;  5HRS A;  3KIO A;  3K59 A;  4I2Q A;  4DFP A;  4OLB A;  1RDW X;  2B4J A;  3ZSR A;  3DXK A;  1U2V B;  3MCP A;  4O55 A;  3BF3 A;  1KLM A;  4FK2 A;  3LZJ A;  4BR0 A;  3LDL A;  1VQK N;  3G25 A;  4MDA A;  1HNV A;  3FZL A;  4B3M K;  1SZ2 A;  5J2P A;  1R0A A;  4LF6 K;  3WNG A;  3O3F A;  2QWR A;  3M3Z A;  3M8R A;  4BVO A;  4CIG A;  1IBM K;  5AQH A;  4N76 A;  4OKK A;  3BZK A;  1OVY A;  3D6R A;  5AQS A;  4WQ5 C;  2BDP A;  3SPZ A;  4C1N K;  2KTQ A;  5C0Y A;  3AY9 A;  2PZS A;  4GVE A;  3W0L A;  4BRL A;  3CM5 A;  1NGI A;  4WFA L;  3I55 N;  5BRD A;  1VQN N;  4F2R A;  2O8C A;  1CZB A;  1JCF A;  1YHQ N;  1ZBS A;  3AGR A;  3MXI A;  2P5G A;  3LAL A;  3A5O C;  1EET A;  1LWF A;  4JKC A;  4FJG A;  1YVN A;  1T3V A;  4K41 A;  4K42 A;  2D5R A;  2JWK A;  2WC9 A;  3OYE A;  2A3Z A;  2Q3S A;  4WFN L;  1VSL A;  3BGR A;  3CFR A;  4CGH A;  4ELV A;  1L5U A;  1JCE A;  1W7A A;  2DPN A;  3JSM A;  4W5N A;  4IEE A;  4WCE L;  4FLT A;  1XMQ K;  4YOV A;  4IFY A;  1NK0 A;  4AIL C;  2VGN A;  4E1M A;  1NGH A;  4DQR A;  1FW6 A;  3P38 A;  5CR4 A;  2F7T A;  4GV6 A;  4L8R B;  1JL2 A;  4I6M B;  1KQS M;  1EQY A;  1RDD A;  3VET A;  1HNZ K;  2FSN A;  4LFC K;  1QVG M;  4JKH A;  2HHT A;  3M8S A;  3CPW M;  4JLH A;  3HZ6 A;  3ZCM A;  3AVI A;  5EY4 A;  3RTV A;  2OA8 A;  3E01 A;  2HF4 A;  3H3O B;  2F8S A;  4FXD A;  4KI4 A;  1HMV A;  3F2K A;  1U49 A;  1CZ9 A;  2OTL N;  1Q8I A;  1TAU A;  1XUP O;  4JKF A;  4CBX A;  5M1O A;  2GTD A;  4DQI A;  3C7N B;  1RTI A;  1IKX A;  3ZX3 A;  4DV7 K;  2UXB K;  1T7P A;  1Q81 O;  2GWJ A;  2WTU A;  3MN6 A;  4IWV A;  4KBO A;  3MAQ A;  4JI5 K;  4O5F A;  1NK5 A;  5JVG L;  1IBL K;  1ATN A;  1C0F A;  2VG5 A;  4ELT A;  3KD1 E;  3SJH A;  4LD0 A;  3WUH A;  3FZF A;  3SLC A;  4FO0 A;  3KJV A;  4OPA A;  3SNN A;  1MWM A;  2X74 A;  1BI4 B;  2ITM A;  3UB5 A;  3T3F A;  3NVM A;  3UE5 A;  4KHW A;  4PKG A;  1NJX A;  2F8T A;  4KHN A;  4CJS A;  2DFH A;  3ATU A;  3CC7 N;  4EHT A;  1G15 A;  2W6L A;  2HHW A;  4XEI A;  2W42 A;  4JRQ A;  1BA0 A;  4G1Q A;  4DSE A;  5C10 A;  2OPQ A;  2Q0R A;  1EWR A;  3NF7 A;  5GIN A;  3U3Y A;  1OH8 A;  2YHY A;  3NGY A;  4BRQ A;  1DLO A;  3CG7 A;  3SI6 A;  3ZET B;  2DTU A;  4IBN A;  4CJT A;  3ULE A;  4LH5 A;  1YT3 A;  3UKR B;  1S3X A;  3WNH A;  3R8E A;  4A62 A;  2ZJP L;  4YOX A;  2KLA A;  3MN9 A;  2HHH K;  3RMD A;  3QEP A;  3V1O A;  2ZGY A;  3NF8 A;  2NLX A;  1RT6 A;  4HTU A;  1U04 A;  1V4T A;  2X6N A;  3OYH A;  3BF1 A;  5EXW A;  4CBU A;  5GAH P;  3O3H A;  3DI6 A;  4CFD A;  4HUE A;  4DTN A;  4B9N A;  1MA9 B;  4N47 A;  3OYK A;  5D3G A;  1HX1 A;  4M3X A;  1S1T A;  2DFF A;  2PBD A;  3L0Q A;  2HNY A;  3TAM A;  4CJE A;  4RTF D;  3VQB A;  3VEW A;  4BQZ A;  1O1W A;  4XH1 A;  3WQT A;  1Q18 A;  5AZI B;  1LV5 A;  5M1N A;  4FLU A;  4DSK A;  3WXJ A;  4PQU A;  3RR8 A;  4DLG A;  2IOC A;  1Q9X A;  3TPQ A;  1JXB A;  4FJJ A;  4JYA K;  1IKW A;  1A5X A;  3CME N;  3LL3 A;  4HTL A;  4JK7 A;  4DF4 A;  4I9L A;  4FJI A;  3OS1 A;  2E2O A;  1IG9 A;  3H1Q A;  4CGJ A;  3HOT A;  4E89 A;  1TUY A;  3IDH A;  3TSU A;  3SMS A;  2LSN A;  2OZM A;  1V4S A;  3S3N A;  4BC3 A;  1DTT A;  4FJM A;  1NJZ A;  4NO7 A;  3DXM B;  1HR0 K;  3QIO A;  2E6L A;  5BPL A;  4EZ6 A;  1U2V A;  5AZJ B;  5AR0 A;  4M42 A;  5SZT A;  1NJI O;  3A5N C;  4NLC A;  4YOU A;  2NZT A;  3GBT A;  4KB0 A;  2O8B B;  4CGF A;  3S3M A;  4IOC L;  2IIR A;  2GBZ A;  2P9K A;  4CER A;  3P31 A;  4H5W A;  4DUY K;  4AHV A;  4DS5 A;  4DR3 K;  4RW8 A;  1U45 A;  3ZT0 A;  4H5V A;  1I39 A;  5BN9 A;  4JK8 A;  2P9I B;  2QWQ A;  1TL3 A;  3O9U A;  4B1U B;  2QWO A;  4CZJ A;  4E7K A;  1XC9 A;  4FJL A;  4FCY A;  1YI2 N;  3GDQ A;  3V81 A;  3EE8 A;  4FPA A;  2W41 A;  5JIC A;  1XHZ A;  1TV6 A;  5JLH A;  4NXN K;  1NMN A;  4YOY A;  1RT7 A;  1WSJ A;  4DR2 K;  3VF4 A;  3ITH A;  5C15 A;  3QIC A;  1JJ2 M;  2P9L B;  4MQ3 A;  3PIP L;  1RBU A;  4EP5 A;  5GAG P;  1X3M A;  4Z4F A;  5KRT A;  4OKE A;  4YDU C;  2PYL A;  4IOX A;  4KH6 A;  3OYB A;  2UXD K;  4BG9 A;  5HBM A;  3AVA A;  1NMD A;  2G8K A;  1QZ6 A;  2ATQ A;  3QNO A;  2KKZ A;  3HSC A;  4CZF A;  2IGI A;  5AQF A;  1BWF O;  1KLN A;  2PYJ A;  3R6M A;  4DTU A;  4H4O A;  1B9D A;  2Q36 A;  3H46 O;  3DJC A;  3M1F A;  2O8E A;  3LWM A;  1U48 A;  1NGD A;  3S9H A;  3VTH A;  4U7B A;  4AHT A;  2ASM A;  2R7Y A;  3L4I A;  4LF5 K;  4PKH A;  1H1V A;  2VYP A;  1KRP A;  3TI0 A;  3KWG A;  3K5O A;  3TAP A;  2XY6 A;  1K8K B;  2P5O A;  3VER A;  3VQ5 A;  3WEE B;  2P9S B;  2RHK A;  4I6M A;  1N34 K;  3OYN A;  3THY A;  3MDQ A;  2W40 A;  4KTQ A;  3U9Z A;  1LW2 A;  3THV A;  4X66 K;  4CEQ A;  1K73 O;  5K14 A;  1TGO A;  5FLX O;  5ADX A;  1CXQ A;  1BU6 O;  3D2F B;  3FR0 A;  1VHX A;  2HBM A;  2Q97 A;  5BR9 A;  3E9O A;  4FWL A;  2BE2 A;  4B1Z A;  1LWE A;  1HKC A;  5M1K A;  3O9T A;  4YHH K;  4DKW A;  3NHG A;  4LY7 A;  2NRV A;  5BPN A;  1S6Q A;  3OW2 M;  2FBX A;  3K9K A;  1S9G A;  3KTQ A;  1VQ4 N;  1NGA A;  2WUS A;  4PL8 A;  4CJU A;  4B8A B;  2YHX A;  4YFU A;  4CEB A;  4IO8 A;  3P5J A;  4BGA A;  4BE0 A;  4FLW A;  3HM8 A;  2HOE A;  2G8I A;  4DFM A;  1HJR A;  4EFH A;  3CJ1 A;  1QQO A;  3C6A A;  3S3O A;  5FDL A;  4N5S A;  1YIJ N;  3CYM A;  2VG7 A;  1GLL O;  2XY5 A;  1TAQ A;  3AA4 A;  3WNF A;  1F21 A;  3WQU A;  1CLQ A;  2HNZ A;  1LCU A;  4RWT A;  4HHT A;  1S1V A;  3E66 A;  3TTC A;  2I7P A;  5BRF A;  4DLE A;  5CYQ A;  3JAM O;  1WUA A;  2W6K A;  1QQN A;  3CC2 N;  1SKR A;  3ZEU A;  1MDU B;  4F9O A;  3IUC A;  1ZXO A;  3EZW A;  1SQK A;  4FWM A;  1NLV A;  3L3V A;  3AVF A;  2Q1N A;  4PUO A;  4WQ4 A;  4PWD A;  2ZF5 O;  3TAB A;  4OVL A;  3J80 O;  3CCM N;  2G8U A;  4BR5 A;  2NRT A;  4CEO A;  5AQT A;  4CJP A;  1XHX A;  2IS3 A;  4LSN A;  1T6D A;  4JKD A;  4DR6 K;  3K57 A;  2PY5 A;  5AQJ A;  1WSI A;  1BQM A;  3O4N A;  1UA1 A;  5IT9 O;  5E26 A;  1W9H A;  1UAX A;  2WBN A;  3UKR A;  3OS0 A;  1VSF A;  1FK9 A;  5AFU H;  2EWS A;  5BN8 A;  3HI0 A;  4OKJ A;  3SQ4 A;  2RPI A;  4BC4 A;  4BDY A;  2QWL A;  4H4M A;  4U67 L;  1J53 A;  3PSI A;  2KZZ A;  4I9Q A;  3BDP A;  5HRO A;  1BA1 A;  4B9U A;  4X62 K;  1FJG K;  3QLH A;  3FLC O;  3ISN C;  3D2E A;  4I2P A;  4UQG A;  2QKK A;  5EOY A;  3R1X A;  3MX2 A;  4CHP A;  3VEV A;  4JKA A;  2IVN A;  3G10 A;  1HUX A;  2ZE2 A;  2OCE A;  1WSH A;  3BEX A;  2HHV A;  3WT0 A;  3HM9 A;  3EY1 A;  3CXC M;  3HJF A;  5HOO A;  3THX A;  4M3W A;  1EWQ A;  3CER A;  4FWS A;  3ID8 A;  3VGM A;  3OYL A;  3U3G A;  2XY8 A;  5KGX A;  3THW A;  1TVR A;  3F73 A;  3TSP A;  1YTU A;  4CJK A;  4CED A;  1IJJ A;  1U4B A;  2BAN A;  1WBD A;  2BTF A;  1VQL N;  2CGK A;  1HPM A;  5FRN A;  4AHR A;  4NCA A;  3KK1 A;  3CPE A;  1L3T A;  1XQS C;  3T7Z A;  2YNH A;  2O4G A;  2VQF K;  2IVP A;  3HVT A;  4FOE A;  3DXM A;  1GOC A;  4K8Z A;  4M41 A;  2Q31 A;  2OZS A;  1VSM A;  1NKE A;  3KZB A;  3J81 O;  1NGE A;  1JCG A;  2AJQ A;  4Z4G A;  4M45 A;  4CJV A;  1UOC A;  3HP6 A;  3NFA A;  5BRE A;  4AM6 A;  5I9E B;  1XC3 A;  3C95 A;  3IMX A;  4XH5 A;  4KTW A;  4RG8 A;  3T1H K;  1YTA A;  1S1W A;  3V9U A;  1YJW N;  1Y64 A;  2GEM A;  3KK2 A;  3KLH A;  3O4W A;  1MWK A;  4DFJ A;  1X9J A;  3VF2 A;  4F4K A;  4CF8 A;  4DQQ A;  2UUB K;  1TK0 A;  3QEX A;  1U6Z A;  5AQQ A;  3SBG A;  1K9M O;  3WXI A;  4AHC A;  2D0O A;  4BWM A;  1NKB A;  3AGK A;  1QE1 A;  2HB5 A;  3JXU A;  2XO7 A;  3GG4 A;  4FK0 A;  2FBY A;  1KAX A;  4B9L A;  1KSP A;  2G8W A;  1S72 N;  1RTH A;  3N4Q A;  1RT4 A;  3NVK A;  3PO4 A;  4PY5 A;  3OBW A;  1JLB A;  1HNI A;  4BRG A;  4DQ8 A;  3OYF A;  4OO1 J;  4JAX A;  4G9Z A;  3SUQ A;  2JLE A;  2P1J A;  3CI5 A;  1Y97 A;  4C23 A;  1KD1 O;  4KI6 A;  2QI2 A;  2CH6 A;  1ASV A;  3O9Q A;  4GV3 A;  1NGB A;  4H5R A;  3R9P A;  4FJH A;  3ALY A;  1ESV A;  3K5L A;  1IO2 A;  1VQ5 N;  3D0P A;  3CCL N;  4AHS A;  3TAQ A;  1C1C A;  1T03 A;  5LY3 A;  4HUF A;  1KVC A;  3UKU B;  4LFB K;  1DEJ A;  3DLB A;  3SQ2 A;  4IKF A;  3BY5 A;  3N4P A;  3CET A;  2QM1 A;  4H0Y B;  1ZC6 A;  1KAY A;  4CZK A;  4BR7 A;  1TYQ A;  4ILH A;  4A59 A;  3RRG A;  3RWU A;  3NMU A;  1G99 A;  4JKG A;  1RDC A;  3AA5 X;  5GIP A;  3CCR N;  5KGW A;  2JGU A;  4JI1 K;  4JN4 A;  3MWT A;  3MED A;  5FPD A;  3W3D A;  4BRC A;  4O8K A;  2O8F B;  4YOR A;  1WSF A;  1UWB A;  4CK3 A;  3CCS N;  4E7H A;  3PX4 A;  5FPM A;  3F9M A;  3U9D A;  4M3U A;  4JHD A;  2G8F A;  3I33 A;  4CZH A;  4B9V A;  2H3G X;  1J9A A;  4DV1 K;  3QDK A;  2FXU A;  3QEW A;  2ETJ A;  4M7X A;  1NNE A;  4C8L A;  1GLE G;  4CZL A;  1J5E K;  4NYN A;  3G71 N;  5GAE P;  4OLA A;  5HLF A;  4KAZ A;  1I3A A;  4ISE A;  4MLE A;  2YKN A;  2B6A A;  3ENB A;  3CQ8 A;  2QWM A;  2FSK A;  1C0U A;  3VPZ A;  1SUQ A;  3R3L A;  3ZT3 A;  4CJR A;  1DT9 A;  3IRX A;  1S1X A;  2ASO A;  1B9F A;  4M3T A;  4NYF A;  2QKB A;  1WAJ A;  5LJV A;  4NB4 A;  3PIO L;  3T19 A;  4K43 A;  3H1V X;  4QS7 A;  1JKH A;  4A61 A;  3PSF A;  2D0B A;  3D45 A;  5I42 A;  3OYM A;  3KVG A;  5KQ8 A;  2YNF A;  5J2N A;  4DV0 K;  3SMP A;  3LAN A;  1DKG D;  1R59 O;  4M63 C;  1WNS A;  2ZJQ L;  2P9P B;  4CJ4 A;  2OPP A;  1NK9 A;  3NH1 A;  4O5B A;  3LM2 A;  3EKU A;  3D7E O;  1KXP A;  5IWA K;  1NJY A;  3VQD A;  4E7L A;  3PUF A;  1M90 O;  3AO2 A;  3J7A P;  3M6G A;  2YJE A;  3O9S A;  4CJL A;  2Q2R A;  1RGI A;  4Y1C A;  4DQP A;  3VQC A;  4ZTF A;  5EX5 A;  4IZ9 A;  1U47 A;  1RBS A;  3SZ2 A;  3SJJ A;  1QHT A;  2A40 A;  1IG8 A;  1HJO A;  4GY2 B;  2UUA K;  4IO9 L;  4DR1 K;  4CI6 A;  4NLB A;  3LP3 A;  4ID5 A;  4KHQ A;  5JS2 A;  4FZY A;  4DSJ A;  4AF1 A;  4B3S K;  4CCH A;  4HCB A;  1VSJ A;  4CHN A;  4CHZ A;  3TR8 A;  1VSD A;  3HPG A;  3NBP A;  1K6Y A;  3QES A;  1VRU A;  1N33 K;  2ZJR L;  4JI0 K;  1EX4 A;  2PFU A;  1GOA A;  3AVJ A;  2A5X A;  3VA3 A;  2A41 A;  2WFB A;  3Q7B A;  3RSE B;  3HOS A;  3FZH A;  4FJN A;  4WQ5 A;  3KWI A;  2NRW A;  3QBW A;  1BG3 A;  2V7Z A;  4KH5 A;  2WON A;  3L2U A;  3O5B A;  3BZC A;  2EHG A;  3OYG A;  4BR9 A;  4Y0W A;  4B3R K;  1BCM A;  2G8H A;  5JS1 A;  4CHY A;  4HUG A;  1E4F T;  2KHO A;  1GLC G;  4B9M A;  5LJW A;  2HND A;  4K0K K;  4DWI A;  4WFB L;  3MK6 A;  3IAY A;  1GLF O;  2P9N B;  3AVC A;  4GVM A;  1EP4 A;  3OBY A;  1ZBL A;  3TSQ A;  3EEQ A;  5KPZ A;  4ILJ A;  3SUO A;  4OGC A;  1IKY A;  4B1V A;  3T69 A;  3L2Q A;  1VSH A;  3LDP A;  1JLA A;  3EL2 A;  4DF8 A;  5BR8 K;  3HXM A;  5I3U A;  4BRK A;  4O0J A;  3HVR A;  4WQ4 C;  4BG8 A;  4Q0B A;  4Z4H A;  2Y1J A;  3DM2 A;  4O8U A;  5FPE A;  4DTO A;  3T1Y K;  3OS2 A;  4ELU A;  4CZE A;  3ZSZ A;  1MU2 A;  1Q82 O;  2NRX A;  2QW9 A;  3C6H A;  3EKS A;  1D5A A;  1ZBH A;  1QHA A;  2ASP A;  2RE2 A;  4E1N A;  3V1Q A;  4FWK A;  3HBT A;  4B1W B;  1P8Z A;  1ASU A;  3AVB A;  3GOI A;  3QO9 A;  3PX0 A;  1N6Q A;  4B3O A;  1GLA G;  5ADX H;  3NH0 A;  4H8K A;  2E1Y A;  3DXK B;  3AO1 A;  1VQ7 N;  4QAG A;  2HVI A;  1BCO A;  4GW6 A;  3J8A A;  1OVQ A;  4DR5 K;  3F5T A;  3K2P A;  5KTQ A;  2Z1H A;  2QXL A;  2Z1J A;  3KLI A;  4Z4I A;  4J2E A;  3B6P A;  2ITG A;  3DAW A;  3RRH A;  2E5L K;  4JS4 A;  3QBX A;  4BRH A;  1S9E A;  3MXM A;  1VQP N;  5FRO A;  2O4I A;  4W5O A;  3NCI A;  4OPH A;  5LL6 Z;  1TL1 A;  1TKT A;  2A1S A;  4CEC A;  4CGD A;  1RDU A;  2HMI A;  4DMN A;  5AQV A;  4H5T A;  4GKJ K;  2Z1I A;  4CW7 B;  4DV5 K;  1RT2 A;  3AVM A;  4AHU A;  1A5W A;  3UKU A;  4A5B A;  3QEV A;  2KW4 A;  3I56 N;  3L8B A;  3TWH A;  1T6C A;  4R79 A;  1EKE A;  2E2N A;  3V1R A;  1QSL A;  4BDZ A;  2O8C B;  1IBK K;  2VGM A;  3OHR A;  2ZQB A;  1J6Z A;  1ZBI A;  3V4I A;  1NG9 A;  4KRE A;  2FSJ A;  2UUC K;  5AQM A;  4CF0 A;  3KLE A;  3HP9 A;  3FE1 A;  4DUZ K;  3L2V A;  3OVN A;  5AQI A;  1JL1 A;  4CJ5 A;  3GE1 A;  4O44 A;  1C1A A;  5AQY A;  2YHB A;  4J8F A;  3MEE A;  1X9M A;  5EU7 A;  1W0H A;  4LH4 A;  3SQ0 A;  2E88 A;  5F0X A;  3WXK A;  4OGE A;  2E2P A;  4JKE A;  2IAJ A;  4F3O A;  5CZ2 A;  4DTP A;  3CM6 A;  3MMV A;  2XHB A;  1NK7 A;  1NK6 A;  3DLR A;  3TAG A;  4Z0U A;  4J2D A;  3EZ5 A;  5E41 A;  4Z94 A;  2QTD A;  4Z4C A;  4IFE A;  3TAR A;  4H0X B;  4BC5 A;  3L2W A;  3SBT A;  3J7Y P;  1N5Y A;  5C24 A;  3C7N A;  1WOQ A;  3OJS A;  4V19 S;  1YAG A;  1VQ8 N;  4KHP K;  1YJN N;  1P90 A;  5GIO A;  2E2Q A;  1VRT A;  5GAD P;  1KFD A;  4BR4 A;  4HCC A;  4BDP A;  4H03 B;  4J2A A;  3SPY A;  3OYJ A;  1I94 K;  3JYT A;  1NGF A;  2E6M A;  3AO5 A;  3CCU N;  1D9D A;  2XY7 A;  1L3S A;  3RMB A;  1NU0 A;  4A2B A;  4B8C A;  1OH5 A;  5JVH L;  1KC8 O;  4DTX A;  4OPJ A;  3MXJ A;  5AQK A;  2YV0 X;  5J2Q A;  2V51 B;  4LFA K;  1TK5 A;  1UA0 A;  2WOM A;  4H5N A;  4IG3 A;  5A2Q O;  4B9T A;  2HHS A;  3ENO A;  1BI4 A;  4BC2 A;  4NCG A;  3K0S A;  1X9S A;  3I8D A;  4DR4 K;  4DU1 A;  4BRN A;  3MCA B;  3VGL A;  1VSI A;  4ISF A;  1QQM A;  3O1B A;  4CD3 A;  4KB1 A;  2YI1 A;  5AQW A;  3LWL A;  3BP8 A;  5MLC Q;  2OPR A;  4Y1D A;  4CIF A;  3CCV N;  3EO3 A;  3DRP A;  2IC3 A;  4YOT A;  1WB9 A;  2D1K A;  1BQN A;  2BUP A;  1S22 A;  2HST A;  3ZET A;  3AV9 A;  1YIT N;  3EE9 A;  1HKB A;  5C12 A;  4PL7 A;  3V9Z A;  4FW2 A;  4FZX C;  1VQ9 N;  3ID6 A;  1FKP A;  4AM7 A;  3H6E A;  1HYZ A;  2FC0 A;  4DHY A;  4C8N A;  4DG1 A;  3OYC A;  3DLE A;  5KPT A;  4CIE A;  4HWI A;  2O8D B;  1HPZ A;  2D0A A;  4CVN E;  3VQQ A;  2IVO A;  1CZA N;  4BRP A;  4CBW A;  1VAZ A;  4DSF A;  4E7I A;  1KAZ A;  3E9L A;  3DRR A;  3RR7 A;  1BL3 A;  3LAM A;  5AQO A;  5M1F A;  3ULE B;  1HYV A;  4CK1 A;  3UIQ A;  1TKD A;  5AZI A;  3FZK A;  1SS6 A;  3O4Q A;  1B92 A;  4CJW A;  1Z6R A;  3VES A;  1Q9Y A;  1EXQ A;  3AA3 A;  3CC4 N;  4CF2 A;  5DK5 A;  1KVA A;  2YKM A;  1RTJ A;  4M3R A;  4DS4 A;  4M7Y A;  4YDU A;  4KRF A;  3WXM B;  3NDK A;  1X9W A;  4CEE A;  1GLJ O;  1W2B M;  4KHY A;  1SL0 A;  1HRH A;  3TAE A;  2YNI A;  3A2F A;  4FM0 A;  4BWJ A;  4OJR A;  3DRS A;  2YHW A;  3DLL L;  2E20 A;  1QQC A;  5FRM A;  5AJ3 K;  3CJB A;  5AZJ A;  1LW0 A;  3SAF A;  5EVZ A;  4PHT X;  3LPU A;  5BPM A;  3J7Z O;  2O8B A;  3A8Y A;  2RKI A;  3QFU A;  1D8Y A;  4E7J A;  4FWO A;  4IEI A;  4CF1 A;  1JXE A;  3DMJ A;  3FZM A;  4FW1 A;  2GX9 A;  2CGL A;  2OAN A;  3ZT4 A;  2P9I A;  1RT5 A;  3JS6 A;  3MN7 A;  3HK2 A;  1BIS A;  4DCH A;  3KKR A;  4CES A;  1DGK N;  4E19 A;  3RMC A;  3A0I X;  1NWK A;  2FLO A;  5AFU A;  1TKZ A;  2I5J A;  1NM1 A;  2E4L A;  3FFK B;  1N36 K;  4ISG A;  4X64 K;  1HLU A;  3P4I A;  4BRD A;  2VQE K;  5BRH A;  2KFZ A;  4DV2 K;  4DV4 K;  1HKG A;  3B6O A;  2HHX A;  3O1W A;  2I7N A;  1RT3 A;  4JRP A;  4FK4 A;  2P9K B;  4DR7 K;  2G8V A;  2P9L A;  4CEA A;  3ASM A;  3DWL A;  1CXU A;  2OYQ A;  3CIP A;  4BY9 C;  4GNI A;  2P51 A;  3A5L C;  4FJX A;  2BGG A;  1ILY A;  4FSV A;  3CJA A;  2IDO A;  1BGX T;  1J54 A;  2GUI A;  5CYM A;  1NJW A;  2UU9 K;  3CQX A;  4RW4 A;  1VQ6 N;  1WLJ A;  3DYA A;  2HVH A;  2KFN A;  2YJF A;  4OX9 K;  4DV3 K;  4DV6 K;  1IV0 A;  2QXF A;  3AA2 A;  3VTI A;  4FOI A;  1BIZ A;  3AAQ A;  4O4G A;  5KI6 A;  4RW7 A;  4F8R A;  1N8R O;  2HBL A;  1ZBU A;  4QOZ B;  4DU4 A;  2FBV A;  5JMV A;  3SV3 A;  4FVU A;  1K8K A;  3I8B A;  3TAF A;  3CCJ N;  3QEI A;  4RCH A;  3HPH A;  4CGG A;  1S6P A;  2P9S A;  2DFE A;  3WEE A;  4HVJ A;  4JS5 A;  1VQM N;  2GV9 A;  3DOK A;  3MWP A;  2OTJ N;  4CEF A;  2D4W A;  1T05 A;  3KK7 A;  4A5A A;  4BGB A;  3TU5 A;  2ZGZ A;  4B08 A;  3MX5 A;  3S41 A;  1IH7 A;  2GEL A;  2O8E B;  3CFO A;  3C65 A;  3VQA A;  4N41 A;  3ZSO A;  2HF3 A;  4BVP A;  3K58 A;  3D2F A;  1YUW A;  1J5O A;  4KKO A;  4LSL A;  4JI3 K;  4R5P A;  3AO4 A;  4FJ9 A;  1VSE A;  1ASW A;  1A5V A;  2V52 B;  3HTV A;  3GL1 A;  4CFB A;  2UYT A;  3CFP A;  3LZI A;  5HL7 L;  3THY B;  3ZSW A;  3ZSV A;  4A2A A;  1ITG A;  2E8A A;  3LDO A;  4FL9 A;  3U4L A;  1NK8 A;  1VSK A;  4RW6 A;  3AVN A;  1BO5 O;  2YCH A;  4DTS A;  3U8X A;  3H45 C;  4CZG A;  3KK3 A;  4XH4 A;  3NAE A;  1GLB G;  3VQE A;  3MEC A;  1SL1 A;  2QEX N;  4B9Q A;  2NNW A;  1ZYQ A;  1TUU A;  1WSE A;  3T1A A;  4CJF A;  2NRH A;  4MLH A;  5AQR A;  1Q86 O;  2P9U B;  4FLX A;  3SYZ A;  3K5M A;  3L3U A;  3KKS A;  3DLH A;  4WF9 L;  3IKM A;  5AQZ A;  3VEX A;  4DTM A;  4BRE A;  5HRR A;  1RBR A;  2BH1 A;  1FKO A;  1VK0 A;  4DFK A;  2FF3 B;  2QK9 A;  1NOY A;  3MEG A;  3OYI A;  4CJ3 A;  4NCB A;  3NH2 A;  3E1Y A;  2KQ2 A;  1Z05 A;  3KHY A;  2AP1 A;  4WE1 A;  3O9R A;  2DY4 A;  2HMP A;  4JNE A;  4BRA A;  2RF2 A;  1SKS A;  4IJA A;  5AQP A;  4L3Q A;  3L2R A;  1SL2 A;  3LP2 A;  4E3S A;  3ZEU B;  4JI7 K;  3SAG A;  4JI2 K;  3CCE N;  2NRZ A;  3VA0 A;  1TKX A;  3LPT A;  5M1P A;  2A1R A;  3Q7C A;  5C2D A;  4E0D A;  4KO0 A;  4CFA A;  2O8D A;  4ILG B;  5CZ1 A;  1GLD G;  3IG1 A;  2D0C A;  3LP1 A;  1NOZ A;  4FJ7 A;  3NF9 A;  3LDQ A;  3SQ1 A;  1RDB A;  2VWK A;  1WAF A;  1WSG A;  4N56 A;  5KPR A;  3VEO A;  5AQN A;  1SV5 A;  1OH7 A;  1REV A;  1NGC A;  3ZX0 A;  1X3N A;  1QTM A;  3VGK A;  1ZBF A;  4FYD A;  1XMO K;  4PKI A;  3IS9 A;  4FWP A;  2CGJ A;  3CD6 N;  1BHL A;  5J1E A;  3H3N O;  1IKV A;  1SAZ A;  3VEN A;  4CHO A;  2F4V K;  4DU3 A; 
#chains in the Genus database with same CATH homology
 4JV5 K;  4DR7 K;  4X65 K;  5IWA K;  4NXN K;  3J7A P;  3T1Y K;  1HNZ K;  4CVN E;  4LFC K;  4GKK K;  4JI6 K;  4DR2 K;  4LFB K;  4LF9 K;  2HHH K;  2UU9 K;  4OX9 K;  4DV3 K;  4DV6 K;  3J7Y P;  1XNQ K;  4JI4 K;  4V19 S;  2UUA K;  2VQF K;  1N32 K;  4KHP K;  4DR1 K;  2UXD K;  4B3M K;  4JI1 K;  4YY3 K;  3JAM O;  3J81 O;  4LF6 K;  4LF7 K;  4JI8 K;  4B3S K;  1IBM K;  4LF4 K;  1I94 K;  4DR5 K;  4DV7 K;  2UXB K;  3T1H K;  4NXM K;  5LMU K;  3J80 O;  4DV1 K;  2E5L K;  4LF5 K;  4JI5 K;  1N33 K;  4JI0 K;  1J5E K;  4B3T K;  4JI7 K;  4DR6 K;  4JYA K;  5LL6 Z;  4AQY K;  1IBL K;  4LFA K;  4JI2 K;  2UUB K;  5AJ3 K;  5A2Q O;  5IT9 O;  1N34 K;  4GKJ K;  4CW7 B;  4DV5 K;  1HNX K;  4DR4 K;  4JI3 K;  4LF8 K;  4B3R K;  4X66 K;  1HR0 K;  5FLX O;  1IBK K;  4K0K K;  4X62 K;  2UXC K;  2UUC K;  1FJG K;  5LMN K;  4DUZ K;  1XMO K;  4DUY K;  1N36 K;  4DR3 K;  1XNR K;  4DV0 K;  2ZM6 K;  4YHH K;  4X64 K;  1HNW K;  2VQE K;  1XMQ K;  3OTO K;  4DV2 K;  4DV4 K;  2F4V K;  5BR8 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...