2KKZA

Solution nmr structure of the monomeric w187r mutant of a/udorn ns1 effector domain. northeast structural genomics target or8c[w187r].
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
134
structure length
134
Chain Sequence
MPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLERNDNTVRVSKTLQRFAWGSSNENGRPPLTLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein NS1
publication title Solution NMR structure of the monomeric W187R mutant of A/Udorn NS1 effector domain. Northeast Structural Genomics target OR8C[W187R].
rcsb
source organism Influenza a virus
molecule tags Antiviral protein
total genus 34
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2009-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2kkzA00
3EE9A 3O9UA 3P38A 4OPHA 3P31A 3KWGA 2KKZA 3F5TA 3D6RA 3O9TA 4OPAA 3M5RA 3O9SA 2RHKA 3RVCA 2GX9A 3OA9A 3O9RA 3O9QA 3L4QA 3KWIA 3P39A 3EE8A
chains in the Genus database with same CATH superfamily
2FSKA 3LAMA 1KFDA 4DQ8A 2P9PB 2VQFK 4CEBA 3C6HA 4O44A 2G8KA 1IG8A 3PX4A 3DOKA 2X6NA 4I6MA 1TV6A 3SK3A 5CYMA 1WUAA 4DR1K 4CHOA 5M1FA 3K9KA 3PIPL 3VGKA 4H0YB 3EY1A 1ZBSA 4B1VA 4IOAL 2V7YA 5MLCQ 3HO1A 3LPTA 3SMSA 1HNVA 3KLGA 5M1PA 3PSIA 3OYEA 4OPAA 1TK0A 3L2VA 2FSJA 2OTLN 3VQ9A 4CGIA 3O6WA 3CI5A 1VSMA 1OVQA 2YNHA 5AQIA 1XC9A 1NJZA 4LF9K 4CCHA 1JCGA 3BY5A 1LWCA 3ZEUA 4BR5A 5AQOA 4MFBA 3A8YA 4FJLA 4DS4A 1O13A 4J2BA 3H3OB 4W5NA 4IBNA 1VAZA 1JLCA 1C1CA 1YUWA 4DV2K 5EXWA 2IOCA 4H5TA 1YVNA 1NGGA 3CJCA 3I0RA 2A42A 4HCBA 4DUZK 4PUOA 2QW9A 2QKBA 2E2PA 4B3RK 3KKRA 3SV3A 5HOOA 3O4NA 3THVA 2QTDA 3SV4A 3QNNA 3HPGA 4H4OA 3PO5A 3CCVN 1VHXA 1NMDA 4FJ8A 2HHVA 1NOZA 3H6EA 3DWLA 4H5WA 4BRKA 2G8WA 1WOQA 4GW6A 2E1YA 3DAWA 2G8VA 4M3XA 2B6AA 2F8TA 2YX6A 4DV7K 4K25A 2Q3SA 2CGKA 4YY3K 1NLVA 3OYDA 3CCEN 4A57A 4CZMA 1RDWX 3LM9A 4CEQA 2F9TA 5KTQA 3AVJA 3O08A 3VETA 3Q7CA 4H0PA 2RHKA 3OBYA 4GMJB 1LW2A 3DLGA 3SLCA 4DG1A 1CZAN 3O80A 3UIQA 4BR0A 1HPMA 5C25A 3TAFA 1NJIO 4E3SA 3WNGA 4FPAA 3OS2A 2P9NA 1RBSA 1JL1A 1IG9A 3OYJA 1YIJN 4M63C 4BE2A 4NYNA 4C8MA 3LP3A 4Y1CA 3RR7A 4N76A 3D6RA 4LC9B 1EWQA 4B9TA 4OO1J 3AVNA 1XHXA 4YOXA 4OLBA 4AHRA 4KI6A 4E0DA 4YOYA 1IH7A 1ASVA 3DRSA 2YHBA 3SJJA 3KWIA 4H5RA 3VQBA 3LDOA 3DLBA 3VF4A 4DLGA 2KHOA 1REVA 2NRTA 2XY5A 1HUXA 4FJHA 3LDNA 3MMVA 1QZ5A 3EE9A 1RDUA 5AQRA 2VQEK 1YI2N 2G8UA 2VGMA 4LH5A 5AQFA 2Y1JA 2P5GA 4IJNA 1OVYA 3IG1A 4JKHA 4K42A 4FJ7A 4DV1K 3VERA 2D4WA 4LF5K 3AVLA 4IDKA 4RW8A 4U67L 3V9ZA 3NF8A 3CF5L 2ZQBA 2ZJPL 1X9JA 4GV9A 3OJSA 1W9HA 5LJVA 2HNZA 3T1HK 2E5LK 4PA1A 1WBDA 5HBMA 2QWNA 1JXBA 5AZIB 4WE1A 3HPOA 1MDUB 4BG8A 4XH4A 2UU9K 4DSJA 3HBTA 4Y1DA 1N6QA 4BC4A 3RMCA 3N4PA 3CCJN 2BDPA 4H5NA 1U2VB 4NCAA 4ILGB 4IG0A 2P9IB 4BE1A 3O3HA 1EP4A 3NFAA 4HTUA 5H1SQ 4Z0UA 4F2RA 3O3GA 4CJSA 3SUQA 4RWTA 1BL3A 1BOTO 3VGMA 3NVMA 1T8EA 1RBVA 2CGJA 4CJEA 3HSCA 4MO5A 1WLJA 3U3YA 3V6DA 3OYLA 3HOSA 4BY9C 2VG7A 2P9UA 3ZSYA 2O8BA 3O4WA 2O8DB 4DS5A 1IBLK 1VQ8N 3ZETA 1IBMK 4DTUA 4JK8A 4CF9A 3UKUA 1NK7A 3ZSWA 3ZT4A 4E7LA 2AP1A 2GBZA 2NRZA 1U47A 3SUOA 2XY6A 4FWLA 4LH4A 2NRRA 3ATUA 4A62A 4CF0A 3DOLA 3CQYA 1T6CA 1WB9A 4IKFA 3HRGA 4G9ZA 3VN5A 1B9FA 2BH1A 3C6AA 1YJ9N 4AHUA 3L2QA 4K8XA 1GLLO 1K9MO 4DFPA 1C0MA 3J81O 1OH7A 4CFBA 3TAMA 4BRLA 3L3UA 1JLEA 4C23A 3D0PA 3V9SA 4CFAA 1L3VA 3CFPA 2GUPA 5HRSA 1K8AO 4CECA 2QXLA 2KW4A 4DTJA 1IBKK 3VQ4A 5EX5A 1S1WA 3D7EO 3OW2M 1FKOA 3SAFA 1J9AA 4CK1A 2O4IA 4XH5A 3WXLA 4HUEA 4DSKA 3M8QA 3ZSZA 2GUIA 2HNYA 4LF4K 3HSTB 3ZSVA 4FLZA 2WOMA 5FPEA 4M3YA 4ISGA 2QWLA 1LWFA 4KRFA 4MDBA 4LFCK 3LWLA 2YI1A 1BWFO 1OH5A 4FL9A 1BIZA 1VQ6N 3T3FA 5C12A 5C10A 1RDCA 4OGEA 4GVEA 3ZSXA 4YDUA 2IS3A 2RN2A 3F73A 3TTFA 3Q7BA 3VQAA 3EO3A 3J7ZO 3M8SA 3AO5A 5AQYA 3V9UA 1GOCA 2D0BA 2HBMA 2ASPA 1QQMA 4EAHD 1J5EK 3QERA 5AQSA 4UQGA 4DTSA 4FM0A 3AAQA 2IVOA 4HUGA 1RTJA 5HP1A 2P9SB 3ULDA 3WXMB 4JI7K 3WNHA 1ESVA 2HBLA 4FJ5A 2ZM6K 3AO3A 4BR2A 1QE1A 4A2AA 2JWKA 1NGBA 4CEZA 2P1JA 1QQNA 3ASMA 2IVNA 3NBPA 3I56N 1GLFO 3VEWA 3GOIA 5BN8A 3T7ZA 1QHTA 1LAWA 2KTQA 1YHQN 2W6KA 4JI8K 4FWQA 3S3MA 1X9SA 3EKUA 3FR0A 2ZJRL 2D0CA 5JICA 1EKEA 4JK9A 1U45A 5TKYA 4IFVA 3LDLA 2O8FB 4KH6A 4M3WA 5DM7L 4MLEA 3RMAA 4Y0WA 2DFEA 3SPYA 1KRPA 2HW3A 1LCUA 5M1KA 5EOYA 3MXJA 5T7BA 3O9SA 3MX2A 4A61A 1WSGA 4CF1A 3SI6A 3DM2A 4CIFA 1ZYQA 1KQSM 1S1XA 3GBTA 5BRHA 1HNZK 5KI6A 4GV3A 2NRVA 2A3ZA 3G4SN 4A5BA 1ASUA 4IO8A 5AQTA 5BPMA 4Q5VA 3OYCA 1YTAA 3CCUN 4PL7A 4CD1A 3NH2A 2W40A 3VESA 1ATSA 2NRHA 3ZCMA 4DFMA 2E2QA 1S6QA 4HCCA 2O8EB 3ZT0A 1HR0K 5I9EB 4MO4A 2FF6A 3RRGA 3D2EB 3QIOA 1ITGA 4FWPA 3EL2A 5JVGL 5ELZA 4I2PA 4CGFA 1VQ9N 4IZ9A 1N36K 1L3SA 4GNIA 2P9LB 1K8KB 4IFEA 1DLOA 4U7BA 1X3NA 2BE2A 5AQKA 4AHVA 1BGXT 4I2QA 3VTIA 3TABA 1EQYA 1G99A 1HMVA 1D5AA 1ZBUA 3ISNC 1A5VA 3O4QA 3QESA 4NB4A 4B9VA 3P31A 3AVFA 1TAQA 1VSHA 3CM6A 2ZJQL 3V1QA 3DXMB 2RE2A 2ASMA 2ITMA 2IVPA 3PV8A 1Q81O 1EETA 4J8FA 3HP6A 3CPWM 1X9MA 5AQPA 3IFRA 3EE8A 2I5JA 4CEDA 1TUUA 2EWSA 4CZGA 3A0IX 1UWBA 3AA4A 2UYTA 4ID1A 3KK2A 4DR5K 5JS2A 3ZX2A 1BHLA 4CEOA 2G8IA 3U8XA 4I7FA 1P90A 3DJCA 1VSLA 4RW9A 2IGIA 3H1QA 2O8CB 5FPMA 5JS1A 3H3NO 1LV5A 4JAXA 1CLQA 3ZSQA 3ZX3A 3QFPA 3LDSA 3L2WA 1T3VA 3I33A 4YORA 3WT0A 4OPKA 1J6ZA 2NNWA 1I39A 4FW2A 3K58A 3PO4A 4FWSA 1BU6O 4NCBA 2VWBA 5LL6Z 4OGCA 4FXDA 5IWAK 1LWEA 5AR0A 3TAGA 2WC9A 2HOEA 3LZJA 3L4QA 1FW6A 2PY5A 4DSIA 3O8MA 5AZIA 4BRIA 2HHQA 4C8KA 2QI2A 1W0HA 4KFBA 3R8EA 5GADP 3VF2A 2HVHA 1JL2A 3KLEA 1B9DA 1NMNA 3OYHA 4DU3A 2LSNA 2P9IA 3CERA 1Q82O 3SUNA 3K5OA 5LMUK 5CR4A 4IDHA 4CBXA 4EZ6A 5A2QO 1VQNN 3SQ0A 4DCHA 4GKJK 1C0TA 4M3TA 1W2BM 3NF9A 1NJWA 1VQ5N 4JI3K 3C65A 4PKGA 5F1XA 1TKDA 4OX9K 3AVGA 1B92A 1WN7A 2QWRA 1MA9B 4CHZA 4BWMA 3CFRA 3NH0A 3LM2A 4IFYA 2J4RA 3SBGA 4DQIA 1NGFA 3AVKA 3UKRB 3MWPA 4FPBA 3WNFA 3K5LA 4I9LA 3J8AA 3BDPA 1V4TA 3ULEB 5J2NA 3TSQA 3VGLA 4A2BA 1S9EA 3IMXA 3LDPA 5J1EA 3EN9A 4F3OA 1RFQA 4LF6K 3KTQA 1MWKA 3KD1E 1IV0A 4FLWA 4E1NA 3OYNA 1KAZA 2ITGA 1HNWK 3P83D 3A2FA 4ID5A 1M1KO 2V51B 3M6GA 2FLOA 5I42A 4J2DA 5C2FA 4BREA 5FDLA 4CBUA 1C0FA 4W5RA 1JCEA 4JLHA 1NWKA 3PIOL 3VQ8A 3WQTA 2E6MA 3JXUA 3JAMO 2G8FA 2D0AA 4X65K 1NJYA 3VF6A 4CERA 3HK2A 2P9KA 2HHTA 3SMPA 2JLEA 4CJLA 3MEDA 4DWIA 3RSEA 2HB5A 3LPUA 1YAGA 1HRHA 5FRNA 5C15A 3SUPA 3H45C 3ENOA 2ATQA 3I8BA 4C8NA 3P5JA 1Q9XA 1XWLA 2A1RA 4KHWA 2A41A 2GEMA 4N41A 5AQMA 4FLYA 4CFDA 3SAGA 4YOWA 1YTUA 3B6OA 4CJ3A 3AVCA 2X6SA 1J5OA 2OTJN 5CZ2A 4BQZA 3KK3A 2OCEA 2W41A 4RTFD 2BTFA 3V9WA 3QIPA 3H08A 4BRNA 4CZFA 4ISFA 2DFHA 1X9WA 3C6UA 3O5BA 2GTDA 5HRRA 4B08A 2P9SA 2QWMA 1NGHA 2B4JA 1XMOK 3T1YK 4BVPA 4PKHA 4DQQA 1X1PA 2AA4A 4X62K 3U6FA 2JGUA 4M7XA 5KGWA 1QVFM 3SQ4A 4DV6K 4ZTJA 5GAEP 3SQ1A 2Z1IA 3K5NA 2UUAK 4JKGB 4YNQA 1EX4A 5AQQA 4JNEA 1DTTA 5HRNA 5C24A 1KVBA 3NGIA 1RT3A 4FVMA 4CW7B 4EP4A 1L5UA 1SL1A 3O9QA 3BGRA 3GL1A 1QS4A 3CCRN 2OZMA 4QCLA 1TL3A 1TKZA 2QEXN 1TUYA 4WQ5C 2VG5A 5JLHA 2XY8A 4AHCA 1HQUA 3AAPA 4KV8A 1U49A 3MN9A 5AQGA 3ZT3A 3THWB 4WYBA 3SAHA 3J7AP 5KQDA 3U3GA 3VQCA 1Q18A 1C6VA 4H8KA 1HX1A 4KKOA 5GAHP 3L2RA 1Z6RA 4WQ4A 2E1ZA 1S22A 4QS7A 1U04A 3U9DA 1C0UA 1TYQA 1NNEA 4ELVA 1RILA 1QTMA 1GLJO 3CIPA 2OPQA 1S9GA 5DK5A 4JI6K 1G15A 2ASOA 2O8EA 4M45A 3MECA 4B9NA 4CEAA 5SWMA 1TK8A 4BR4A 3TARA 3HVRA 1GLEG 3D2EA 3K2PA 2ZD1A 4B8CA 3U9ZA 4CI6A 2UXBK 5KPRA 2FBYA 3ZYYX 4FJXA 2BGGA 3QO9A 2P9LA 3CQ8A 1K8KA 4AHSA 3ALYA 3AGKA 3CFOA 3L0QA 3A5NC 4DLEA 3TWHA 4CHQA 2YHYA 4CGJA 3VENA 2KFZA 3CJ9A 1JLQA 4FLTA 4CJUA 1FXXA 2E88A 5HRPA 2XY7A 1XMQK 5FPNA 4G1QA 4IEEA 3TTDA 2YHWA 3DXMA 3SQ2A 4JHDA 1HJOA 3PSFA 4M41A 1M90O 3VOVA 1ZBHA 5EU7A 1BA0A 4B9QA 2HF3A 4M7YA 1ASWA 2Q97A 3AARA 3NGYA 4DV0K 3ZSOA 1BI4A 1TGOA 4O0JA 3PY8A 4DHYA 1HNXK 1R59O 2WFBA 2YNGA 2A1SA 4CK2A 1CXQA 3KKSA 4FZYA 1HKCA 4DFKA 1C1BA 1RNHA 3WUHA 4X66K 1SL0A 3UE5A 5KQ8A 3R9PA 3W0LA 2IAJA 1CZBA 2O4GA 4EHTA 2EHGA 4KPYA 4WFAL 4E19A 4YFUA 3HL8A 4H5VA 3DLRA 4QOZB 4BRHA 3ZT1A 5AZJB 1RT2A 1SUQA 2Q0UA 3N4QA 5DM6L 3M3ZA 1VQMN 2ZGYA 3OVNA 1KFSA 3G10A 1L3UA 4DR4K 4LF7K 1E4FT 4O55A 1ATRA 4B1XB 1SV5A 1NU0A 2KFNA 1N33K 1Z05A 5M1NA 1WAJA 4BRCA 4FLVA 3R1XA 1NKEA 3E9PA 4DTOA 3G0ZA 1Q86O 1KAXA 4BC2A 4FOEA 3KLHA 4DTNA 4QAGA 4B1WB 4FK2A 4CHPA 3OYBA 4JI1K 3D2FA 3M5RA 2P51A 4F2SA 2NRXA 4V19S 4H4MA 3OYGA 3HJFA 3ZLJA 5HLFA 1IKXA 2P9PA 3KK1A 5AQWA 3MDQA 5AQNA 3NAEA 1XI1A 1K6YA 5FLXO 2OPRA 4AILC 1EWRA 1BISA 1HLUA 2F4VK 3LWMA 1NKCA 2YHAA 3S3NA 4A59A 4YOUA 3UKRA 4FJGA 2UXDK 1QSSA 3F5TA 2DY4A 4BRDA 1GLAG 3ULEA 5AQJA 3DLEA 3V4IA 4NCGA 1WSJA 1KLMA 1QZ6A 1HYVA 1NK5A 2HSTA 1RDBA 4AM7A 1YJWN 2YKMA 1ZXOA 3E9LA 1T6DA 4DTPA 5FRMA 2KZMA 5I3UA 3H46O 1Y97A 4NLBA 2Z1HA 3AA3A 3CM5A 3L8BA 1TKTA 4JYAK 3CETA 4WF9L 4DR2K 3KJVA 2Q31A 2P9NB 1KD1O 3ID6A 3LP0A 5J2MA 4BR9A 3VQ7A 1SKSA 3I0SA 5F2RA 1WBBA 2XRIA 3QFUA 2YNIA 1S1UA 4BRAA 1SS6A 4GV6A 3KVGA 3QEVA 3F9MA 2Z1GA 3C7NB 3QLHA 4FW1A 2CH5A 1ZBLA 1S1VA 4JI4K 1VSIA 1WSHA 1X3MA 3JSMA 2AJQA 4BACA 5C42A 3DMJA 4H0OA 1WSFA 4F8RA 3B6PA 3NF6A 1JLBA 4FOIA 4CF8A 3WEEB 4IXCA 1N5YA 3AO1A 2KQ2A 3V1OA 1QQOA 1VQ4N 4OKEA 3QMLA 4K8ZA 3DXKB 3OYFA 4PQUA 1WNSA 2OYQA 1U48A 3MN6A 2KLAA 1KCFA 2F9WA 2XO7A 2VG6A 3CD6N 4K41A 4R5PA 2HF4A 3QETA 2PBDA 1BUPA 5AQXA 4B9LA 4DR6K 3IRXA 2OPPA 4NO7A 4NXNK 4B9MA 2YKNA 3MWTA 3L4IA 3LP2A 4I9QA 3GE1A 1OKJA 5BPLA 3DRRA 3AVAA 3MAQA 3DI6A 1S72N 2WUSA 4AHTA 1ILYA 4Z4GA 4JKGA 2NUBA 5JLFA 1VRUA 2GV9A 1S3XA 1JLGA 5KRSA 1XHZA 1T44A 3QICA 3TANA 4KH4A 5J2QA 3TAEA 3DRPA 1RDDA 1D4XA 5KPZA 4H0XB 1KVAA 4L3QA 1HKBA 4KTWA 5KPTA 3L6QA 2PFUA 4BVOA 1DGKN 3PUFA 1TAUA 1VRTA 5GINA 4CE9A 3E01A 3UKUB 1XNRK 4RW7A 1JLFA 4BRFA 3P39A 3VPZA 1RBTA 3MXIA 3FFIA 3SNNA 2Q36A 1RTDA 4DF4A 3DYAA 2FSNA 4BQLA 2FBXA 2YCHA 3FZLA 4E89A 1O1WA 4BDZA 1RTIA 4PHTX 4B3SK 5CE3A 4RG8A 4CJWA 1VSKA 1XC3A 3SCXA 2PYLA 3KK7A 3AA5X 2HBJA 1W7AA 3VEVA 5LY3A 4FJKA 5M1OA 4CJ4A 2WTUA 1HNIA 4FLXA 1S5JA 2WONA 4IEIA 1NKBA 1SL2A 4XIUA 1T03A 2OA8A 3HYFA 3CYMA 2FBTA 2X78A 4JK7A 1UA0A 4ILHA 3MXMA 4OPHA 4CZJA 4OJRA 1W97L 3L3VA 2YV0X 2X74A 2HMPA 4KHPK 2IC3A 1NJXA 4FZZA 3CC2N 2UXCK 1U2VA 3LZIA 1UOCA 3E1YA 4LF8K 2ZGZA 5GIPA 4DTMA 1FK9A 5C0YA 3UB5A 2EX3A 3NMUA 3AO2A 1VSEA 1VQ7N 4PKIA 3VTHA 4CJ5A 4B9UA 2QXFA 2RF2A 3M8PA 3B8AX 3NE6A 4DQRA 3HVTA 4BC5A 3OYIA 3O3FA 4M42A 4N56A 3THYB 1GOAA 3OYMA 4A5AA 4KHQA 4BRMA 4M3ZA 3O9TA 3VEYA 3MK6A 1YT3A 3QDKA 2O8DA 1TKXA 5AFUA 3CJ7A 4JRQA 4KB1A 4IOCL 4L8RB 5BR8K 5JVHL 4FM2A 2H3GX 1NK0A 1VQLN 1N32K 3OYAA 2VWJA 1HYZA 5ADXA 5DMRA 3P38A 4EIAA 4YOVA 1RTHA 4FJJA 3KWGA 4CGHA 2HMIA 2D0OA 2ZWHA 4WFBL 1Q9YA 4GY2B 3G71N 3WQUA 4CGDA 3VA0A 2VGNA 2NLXA 3O9RA 1NK4A 3RMBA 3MX5A 3ZSRA 1N8RO 1KAYA 4LD0A 3FGUA 2VWKA 3AY9A 4B3TK 3K9JA 3R6MA 4QS9A 3TU5A 4EP5A 3K0SA 1T7PA 1NBWA 3KLIA 4CF2A 2QK9A 4CJVA 3M8RA 4FZXC 5AZJA 2PZSA 4DQSA 3NH1A 1MU2A 3CJAA 2Y1IA 4ELTA 4WFNL 3V1RA 2A5XA 4KREA 3LDQA 4TSXA 2GELA 3EKSA 1N34K 1NG9A 5C2DA 4FWRA 2BUPA 3QBXA 4Z4IA 3ZT2A 1C1AA 2QWOA 4YHHK 3WXJA 1RBUA 4N47A 5FPDA 4AH9A 3KIOA 3THXB 4KHYA 2HNDA 4AM6A 4JKEA 3A5LC 3W3DA 3TSPA 1BCMA 4CZIA 3LP1A 4F4KA 1LW0A 4FM1A 4ZTFA 3TTCA 4DTRA 4CJPA 3VQQA 3VQPA 1YVUA 4DFJA 3VEZA 1RT5A 3HM8A 1A5XA 4B3OA 2CH6A 4CJRA 3HI0A 4RW6A 1KTQA 4CBWA 1V4SA 3E9OA 1SKRA 3KD5E 3JYTA 4YDUC 4W5QA 4FK0A 3CC4N 1QSLA 4JN4A 4LFAK 3EEQA 5FROA 4DQPA 5CHIA 1Q7YO 3LANA 2A6AA 1K73O 5AQZA 2O8FA 2Z1JA 1I94K 3NF7A 2DTUA 4CEFA 3FLCO 3OA9A 3ENBA 3RR8A 1RT4A 3PLAA 3RMDA 1JKHA 4CESA 3CG7A 1QVGM 2FC0A 2F96A 4Z4EA 4LSNA 5JMVA 1RBRA 4CZKA 3D45A 4FCYA 1BQNA 1XQSC 5BRDA 3BP8A 1CXUA 3CHWA 4CGGA 5BPNA 3NGZA 4DF8A 3VQ5A 4CJTA 4B1YB 4CZEA 2VYPA 3NCIA 3C7NA 3IUCA 4HWIA 3V9XA 2Q1NA 1EXQA 3LALA 3DLKA 1RDAA 3OHRA 3PX0A 2PAVA 1JXEA 4IO9L 2P5OA 1HYSA 3WNEA 5BN9A 5M1QA 3HPHA 3FZHA 1VSDA 4BRGA 1T05A 3K5MA 1J54A 2IDOA 4X64K 3O1BA 3ENHA 3EZ5A 3OY9A 4DTXA 3M1FA 3PX6A 3WEEA 2HVIA 3KLFA 4CJ7A 4FVUA 3CCQN 4Z4HA 4ELUA 4DV5K 4E7HA 4FJMA 4KBOA 3QEPA 1RT6A 3AVMA 4J2EA 3DXKA 4E1MA 4ZHRA 2E4LA 4CEEA 3TAPA 3CMEN 1KXPA 2ZF5O 4IJAA 4F9OA 3LAKA 1OH8A 4O4GA 2ETJA 5KGXA 3IDHA 2KKZA 3AVHA 1JJ2M 4OLAA 4FLUA 1RCHA 3MCAB 4DSEA 3CXCM 3QEXA 4JD2B 4F3TA 3HT3A 1QHAA 2B5JA 2R7YA 3OTOK 4OPJA 4PL8A 3BZKA 2YHXA 4MLHA 3G25A 3K59A 4NXMK 3IAYA 4JV5K 1SAZA 4DV3K 3J80O 4K43A 1NGJA 3CCSN 1BQMA 2W42A 3T69A 1E3MA 3MCPA 2E8AA 3C6TA 3WXKA 3A5OC 4E7JA 4BRPA 3RVCA 4KHNA 1KVCA 3V81A 2E6LA 4E1JA 3OYKA 3E66A 4O0IA 3U4LA 2V52B 4HTLA 4NLCA 1U4BA 5D3GA 3TR8A 1NOYA 4KO0A 4BROA 3MEGA 4IOXA 4DUYK 4KAZA 1VSJA 2QKKA 4Z4FA 4FK4A 3RTVA 5EVZA 2YJEA 4I6MB 2HBKA 3TAQA 1FJGK 2O8CA 4LY7A 4CJKA 1OH6A 2I7PA 4DSLA 1VSFA 2QWQA 4FJIA 3A5MC 3H1VX 2QA4N 4FJNA 4FWMA 3BZCA 3TPQA 2PYJA 4JEPA 5AQUA 4BG9A 1TL1A 1BDGA 2NZTA 5B8HA 2KZZA 4B3MK 3F9KA 5BR9A 4K0KK 3SBTA 3OS0A 2GX9A 3ZEUB 4J2AA 1BG3A 4IG3A 1VQPN 4LSLA 3VEOA 4AQYK 5AFUH 4YOTA 1C0GA 3FZFA 4W5TA 1UA1A 2P9KB 4FSVA 2RPIA 2Q0RA 4JKFA 1RT1A 1GOBA 1JCFA 4KHSA 3J7YP 3RSEB 1NK8A 3AA2A 4WCEL 5ADXH 2FF3B 1RT7A 4KH5A 3QB0A 3S3OA 2ZE2A 3GG4A 2OANA 2JWLA 3TI0A 3THYA 4JI2K 4RCHA 1MWMA 5E84A 2E2NA 1R0AA 1LAVA 4JKAA 3DLHA 1WSEA 5K14A 3HZ6A 1Y64A 3CCLN 3ID8A 3IS9A 1FKPA 1U6ZA 4DU4A 4FO0A 1XUPO 4MDAA 1I3AA 1IKYA 3O1WA 5CZ1A 3EYZA 3AVIA 2GWKA 1S1TA 3QEWA 1IJJA 4H0TB 3S9HA 5EY4A 2F8SA 1J53A 2IIRA 3RRHA 3CJBA 5J2PA 3BEXA 1Z25A 1NGAA 2V7ZA 1VQKN 2E20A 2A40A 2OPSA 4ICLA 2RKIA 4DR7K 4JS5A 1ATNA 3HM9A 1NK6A 3HP9A 2NRWA 4C8OA 4WQ5A 1WAFA 2FXUA 1KLNA 3BF1A 1NGCA 3FZMA 4W5OA 4H03B 5E41A 4HHTA 4CZLA 4BGBA 1VQON 3QBWA 4IWVA 5TKWA 4NYFA 3LL3A 1GLBG 1RGIA 3I55N 4DSFA 2E2OA 5CY4A 4XH1A 4EHUA 3VQDA 4M3RA 1HPZA 2HHXA 3S41A 3ATVA 1QSYA 3C94A 5GAGP 4EFHA 2UUBK 1GLDG 1NGDA 2WBNA 1KSPA 4AF1A 3AV9A 3HTVA 3MEEA 3NDKA 5IT9O 5KRTA 1WSIA 3HOTA 3JS6A 1YXQA 1GLCG 1BCOA 4JRPA 1D8YA 3VQ6A 3CC7N 1SKWA 4Z4CA 3KHYA 3QNOA 3THXA 1D9DA 3QEIA 4B1ZA 1NGEA 1Q8IA 4KTQA 3DLLL 3T1AA 3VMFB 1BA1A 5BREA 3T19A 4JI0K 3ZX0A 1HKGA 1TYQB 3CJ1A 3P1GA 1BIUA 1NM1A 4OKKA 4KB0A 4JKBA 3G6EN 4FJ9A 2HHUA 4B9SA 4EZ9A 2D1KA 1D9FA 5F0XA 4CVNE 2I7NA 4XEIA 4HVJA 1CZ9A 2Q2RA 4N5SA 3AO4A 3SPZA 1S6PA 3KZBA 3MN7A 4CFCA 3K57A 4CIEA 2DPNA 5LMNK 1A5WA 2QWPA 4BRQA 1BO5O 5E26A 4ILJA 3EZWA 1TVRA 1LOTB 1DKGD 5BRFA 3QINA 4B1UB 4KHUA 2UUCK 4DKWA 3FFKB 4FWOA 4BGAA 3CMAN 3MN5A 4Q0BA 4CHNA 3GDQA 4KI4A 3ITHA 4RW4A 3R3LA 4JS4A 4GVMA 4H0VB 2OZSA 1ZBFA 4JI5K 3F2KA 2YNFA 5GIOA 3NVKA 3SZ2A 3VQEA 1H1VA 4PY5A 2P9UB 4JKDA 4JHDB 4PWDA 1IKWA 2O8BB 3BF3A 4JKCA 4B8AB 1ZBIA 3FZKA 3OJUA 3ZETB 1JLAA 1DEJA 2BANA 4CK3A 5SZTA 3CCMN 4CIGA 4MQ3A 5CYQA 3C95A 4FWNA 1BI4B 3THWA 4BDYA 3L2UA 1VK0A 5AJ3K 4LFBK 2D0PA 4O5FA 2YJFA 1SZ2A 4DU1A 2QM1A 3CQXA 5HL7L 2FBVA 1L3TA 3BUZB 3VEXA 1NK9A 2W6LA 3FE1A 3NHGA 4DMNA 1XNQK 1UAXA 1EO1A 1Z26A 1YITN 4DB3A 2DFFA 4C1NK 4E7IA 1IO2A 4C1NI 4CD3A 1F21A 3WXIA 4HUFA 4M3UA 4KTZA 2HHWA 3AGRA 1DTQA 5AQVA 1KC8O 2D5RA 4CHYA 3SYZA 1HJRA 1IKVA 4ISEA 4C8LA 4GKKK 3AVBA 1QQCA 3CPEA 3OS1A 4CZHA 4BWJA 4FYDA 4CJQA 3VA3A 2VCPA 4O8KA 4OKJA 3C0BA 4O8UA 4WQ4C 4Z94A 2GWJA 3SJHA 4BR7A 4E7KA 4BC3A 4OVLA 4O5BA 4QS8A 4DR3K 2HHSA 5AQHA 4JD2A 4R79A 5LJWA 4BE0A 2F7TA 3O9UA 4BDPA 1YF5L 4CJFA 2CGLA 3HXMA 1ZC6A 4DV4K 3IKMA 5HROA 1NGIA 2HHHK 1E4GT 1TK5A 1YJNN 2XHBA 4FWKA 3RWUA 3OBWA 3P4IA 1HQEA 5AQLA 2G8HA 1P8ZA 3I8DA 1SQKA 4UY8O 1DT9A 3D2FB 3TSUA
chains in the Genus database with same CATH topology
5I9EB 4H5VA 2FSKA 2FF6A 4MO4A 5JMVA 4BRHA 3D2EB 4CZKA 5AZJB 4DQ8A 2P9PB 2Q0UA 3EL2A 3N4QA 1XQSC 4FWPA 5JVGL 5BRDA 3C6HA 3BP8A 5ELZA 3CHWA 5BPNA 5DM6L 1VQ9N 4IZ9A 1IG8A 3M3ZA 2ZGYA 1VQMN 4GNIA 4B1YB 4CZEA 2P9LB 2VYPA 3C7NA 1K8KB 4IFEA 4I6MA 1E4FT 1ATRA 3IUCA 4HWIA 3SK3A 4B1XB 4U7BA 1X3NA 1WUAA 5AQKA 2Q1NA 3VTIA 1Z05A 5M1NA 5M1FA 1EQYA 3K9KA 3OHRA 4BRCA 1G99A 3R1XA 2PAVA 4IO9L 3PIPL 3E9PA 3VGKA 4H0YB 1ZBSA 5BN9A 5M1QA 4B1VA 4IOAL 1Q86O 1KAXA 2V7YA 3FZHA 4BRGA 4BC2A 5MLCQ 4FOEA 4NB4A 3SMSA 3P31A 3O1BA 5M1PA 3ENHA 4B1WB 3M1FA 3D2FA 3M5RA 4OPAA 2ZJQL 2NRXA 3WEEA 3DXMB 4CJ7A 4FVUA 2FSJA 2OTLN 3CCQN 2RE2A 3CI5A 2ASMA 3O6WA 2ITMA 4KBOA 2IVPA 2P9PA 5AQWA 1Q81O 3MDQA 4J8FA 5AQIA 5AQNA 3CPWM 3DXKA 1JCGA 5AQPA 3IFRA 3ZEUA 3EE8A 4BR5A 3CMEN 1HLUA 5AQOA 1KXPA 1TUUA 2ZF5O 4IJAA 2EWSA 4CZGA 4F9OA 3A0IX 3A8YA 2UYTA 4A59A 1O13A 4YOUA 3UKRA 3ZX2A 3IDHA 2KKZA 3F5TA 3H3OB 3U8XA 1GLAG 4BRDA 1JJ2M 3ULEA 1P90A 3DJCA 3MCAB 1VAZA 5AQJA 3CXCM 1QZ6A 1YUWA 2HSTA 4AM7A 4JD2B 5EXWA 3E9LA 1ZXOA 1QHAA 3H1QA 4H5TA 1YJWN 1YVNA 5FPMA 1T6DA 4PL8A 2YHXA 4MLHA 1NGGA 3CJCA 3G25A 3H3NO 4JAXA 2A42A 3ZX3A 3H46O 4NLBA 3QFPA 2QW9A 1SAZA 2E2PA 1T3VA 3I33A 4YORA 3WT0A 4K43A 1NGJA 5HOOA 3CETA 1J6ZA 2NNWA 3CCSN 2QTDA 4WF9L 3T69A 4FWSA 3MCPA 2E8AA 1BU6O 3WXKA 3A5OC 3CCVN 2VWBA 1NMDA 4BRPA 3RVCA 2Q31A 2P9NB 3H6EA 3DWLA 4H5WA 3ID6A 3E66A 5AR0A 4BRKA 4E1JA 3U4LA 1KD1O 2V52B 2WC9A 1WOQA 4HTLA 4NLCA 4BR9A 2E1YA 2HOEA 3L4QA 5F2RA 3DAWA 3O8MA 3QFUA 2YX6A 4BROA 4IOXA 5AZIA 4BRAA 1SS6A 4BRIA 4GV6A 3KVGA 3F9MA 4K25A 3C7NB 2QI2A 5EVZA 2YJEA 2CGKA 4I6MB 1NLVA 2HBKA 3CCEN 4A57A 2CH5A 3R8EA 5GADP 4CZMA 1RDWX 3LM9A 3VF2A 2F9TA 2I7PA 3O08A 3VETA 3Q7CA 4H0PA 2QWQA 2RHKA 1X3MA 3OBYA 2P9IA 3A5MC 3H1VX 3SLCA 3CERA 1CZAN 3O80A 2QA4N 1Q82O 4BR0A 4FWMA 5CR4A 1HPMA 4IDHA 4CBXA 3TPQA 1NJIO 4H0OA 1VQNN 4JEPA 5AQUA 4BG9A 4DCHA 4FPAA 4FOIA 2P9NA 3WEEB 4IXCA 1BDGA 1YIJN 2NZTA 4M63C 5B8HA 1W2BM 1VQ5N 1QQOA 1VQ4N 3C65A 4PKGA 5F1XA 5BR9A 3QMLA 3D6RA 4LC9B 2QWRA 4OO1J 3DXKB 3SBTA 1MA9B 2GX9A 3ZEUB 4YOXA 3MN6A 2KLAA 1BG3A 3LM2A 1VQPN 3VEOA 2J4RA 2F9WA 5AFUH 4YOYA 3SBGA 1NGFA 3CD6N 4YOTA 4K41A 3UKRB 1C0GA 3FZFA 3MWPA 3KWIA 4FPBA 4H5RA 2HF4A 2P9KB 2PBDA 3J8AA 3LDOA 1BUPA 4FSVA 5AQXA 1V4TA 3ULEB 3VF4A 2KHOA 2Q0RA 4JKFA 3TSQA 4NO7A 3VGLA 2NRTA 4A2BA 1HUXA 3IMXA 3LDNA 3L4IA 3EN9A 1QZ5A 3LDPA 3MMVA 3MWTA 3EE9A 3GE1A 1RDUA 1JCFA 5AQRA 1OKJA 1RFQA 5BPLA 3RSEB 1YI2N 2VGMA 1MWKA 5AQFA 1S72N 4WCEL 2WUSA 2FF3B 4IJNA 5ADXH 4KH5A 1OVYA 1KAZA 3QB0A 4JKHA 4K42A 1ILYA 4JKGA 3GG4A 5JLFA 3VERA 2OANA 2D4WA 1M1KO 1S3XA 2JWLA 2V51B 3M6GA 2FLOA 4RCHA 1MWMA 1T44A 2E2NA 3QICA 5E84A 4BREA 4U67L 5C2FA 4JKAA 4CBUA 1C0FA 1Y64A 3HZ6A 4KH4A 3CF5L 3CCLN 3ID8A 1JCEA 1U6ZA 1NWKA 2ZJPL 1D4XA 3PIOL 4FO0A 5KPZA 1XUPO 4MDAA 1X9JA 4H0XB 3WQTA 3O1WA 4GV9A 3JXUA 4L3QA 5LJVA 1HKBA 2GWKA 3VF6A 1IJJA 5KPTA 2P9KA 4H0TB 3SMPA 3L6QA 5EY4A 2PFUA 2QWNA 5AZIB 4BVOA 1DGKN 2IIRA 1MDUB 3CJBA 4BG8A 5GINA 4XH4A 3BEXA 3HBTA 3RSEA 3UKUB 1NGAA 1YAGA 2V7ZA 1VQKN 2E20A 4BC4A 2A40A 5C15A 3H45C 1ATNA 3ENOA 3N4PA 3P39A 3VPZA 4H5NA 3I8BA 4BRFA 3CCJN 1U2VB 2Q36A 2NRWA 4ILGB 2A41A 2GEMA 2P9IB 4WQ5A 2FSNA 4BQLA 2FXUA 5AQMA 3SAGA 5H1SQ 3BF1A 1NGCA 3FZMA 4YOWA 2YCHA 3FZLA 4H03B 4CZLA 4BGBA 1VQON 4RWTA 4PHTX 1BOTO 3VGMA 3QBWA 5CE3A 2OTJN 4IWVA 1XC3A 3NVMA 4BQZA 3KK7A 5TKWA 2CGJA 2HBJA 3HSCA 4MO5A 3VEVA 5LY3A 2W41A 3LL3A 5M1OA 1GLBG 1RGIA 3HOSA 4BY9C 3I55N 4RTFD 2E2OA 2BTFA 4IEIA 4XH1A 2P9UA 4BRNA 4CZFA 4EHUA 3O4WA 4ISFA 1VQ8N 3ZETA 4JK7A 3O5BA 3S41A 3ATVA 4ILHA 2GTDA 4JK8A 3UKUA 5GAGP 4OPHA 4CZJA 4EFHA 1GLDG 1NGDA 2P9SA 2QWMA 1W97L 2WBNA 1NGHA 2AP1A 4AF1A 2NRZA 2HMPA 3HTVA 4FWLA 4BVPA 4PKHA 3CC2N 1U2VA 2NRRA 2AA4A 3E1YA 3ATUA 2ZGZA 4A62A 3HOTA 3JS6A 1YXQA 5GIPA 3CQYA 1T6CA 5C0YA 3UB5A 4M7XA 3NMUA 1GLCG 1VQ7N 3HRGA 4PKIA 3VTHA 1QVFM 4G9ZA 3B8AX 5GAEP 2BH1A 3C6AA 1YJ9N 3CC7N 3KHYA 4JKGB 4BC5A 1GLLO 1K9MO 4B1ZA 1NGEA 5AQQA 4JNEA 3DLLL 4BRLA 4A5AA 4BRMA 4C23A 3O9TA 3VMFB 3VEYA 1BA1A 3MK6A 5BREA 2GUPA 3QDKA 3ZX0A 5AFUA 1HKGA 1K8AO 1TYQB 2QXLA 3CJ1A 3O9QA 1NM1A 3CJ7A 3GL1A 4JKBA 3G6EN 3CCRN 5EX5A 3D7EO 2D1KA 3OW2M 4IOCL 3SAFA 2QEXN 5F0XA 5JVHL 1TUYA 4XH5A 2I7NA 4XEIA 4WQ5C 3WXLA 2H3GX 2Q2RA 5JLHA 1VQLN 5ADXA 3KZBA 3P38A 3AAPA 4EIAA 4YOVA 5FPEA 3MN7A 3KWGA 2DPNA 2D0OA 2ZWHA 3MN9A 4ISGA 4WFBL 2QWLA 4GY2B 5AQGA 2QWPA 4MDBA 3G71N 4BRQA 3WQUA 1BO5O 5E26A 2VGNA 4ILJA 2YI1A 1BWFO 2NLXA 3EZWA 3O9RA 4FL9A 1LOTB 4WYBA 3SAHA 1VQ6N 5KQDA 3MX5A 5C12A 1DKGD 5BRFA 4B1UB 1KAYA 1N8RO 1Q18A 1HX1A 3FGUA 5GAHP 4DKWA 3FFKB 4FWOA 4BGAA 3CMAN 3AY9A 1Z6RA 3MN5A 4WQ4A 5C10A 2E1ZA 1S22A 3GDQA 4GVEA 4QS7A 4YDUA 3K9JA 3U9DA 3R6MA 3R3LA 3TTFA 1TYQA 4QS9A 3Q7BA 4H0VB 3TU5A 1GLJO 3CIPA 3EO3A 3J7ZO 2ASOA 3F2KA 1NBWA 5AQYA 5GIOA 3NVKA 2HBMA 1H1VA 4BR4A 2ASPA 1QQMA 2P9UB 4JKDA 4JHDB 4EAHD 1GLEG 3BF3A 4JKCA 3D2EA 5AQSA 5AZJA 3FZKA 3ZETB 3U9ZA 3AAQA 2IVOA 3CJAA 4CI6A 1DEJA 5KPRA 3ZYYX 3CCMN 2P9SB 4WFNL 2P9LA 3WXMB 2A5XA 1ESVA 1K8KA 2HBLA 3AGKA 4FWNA 3L0QA 3A5NC 3LDQA 4BR2A 4A2AA 2GELA 3EKSA 2JWKA 1NGBA 5C2DA 2YHYA 2D0PA 1QQNA 4O5FA 2YJFA 1SZ2A 4FWRA 3VENA 3CJ9A 2BUPA 2IVNA 3I56N 1GLFO 3QBXA 3GOIA 3VEWA 2QM1A 3CQXA 5HL7L 2QWOA 5BN8A 3BUZB 3T7ZA 3VEXA 2E88A 3WXJA 3FE1A 1YHQN 5FPDA 4FWQA 1EO1A 5FPNA 3EKUA 1YITN 3FR0A 4DB3A 4AM6A 2ZJRL 4JKEA 5JICA 4IEEA 3A5LC 3W3DA 3TTDA 4JK9A 2YHWA 5TKYA 4C1NK 3DXMA 3LDLA 3TSPA 4C1NI 4CD3A 4JHDA 1HJOA 4KH6A 3WXIA 1M90O 5DM7L 4CZIA 4MLEA 3AGRA 3VOVA 5AQVA 3TTCA 1BA0A 4Y0WA 4B9QA 1KC8O 2HF3A 4M7YA 4ISEA 1LCUA 2Q97A 3AARA 5M1KA 5EOYA 3VEZA 3HM8A 3CPEA 3MX2A 3O9SA 4A61A 2CH6A 4CZHA 3HI0A 4CBWA 1V4SA 3GBTA 1KQSM 2VCPA 4O8KA 5BRHA 4DHYA 3C0BA 3E9OA 4O8UA 4WQ4C 4Z94A 4GV3A 4YDUC 2GWJA 1R59O 2NRVA 2A3ZA 2WFBA 3SJHA 4BR7A 3G4SN 4BC3A 4A5BA 4QS8A 3CC4N 4JN4A 4IO8A 5AQHA 4JD2A 1HKCA 4R79A 5LJWA 2F7TA 3O9UA 5CHIA 5AQTA 5BPMA 1Q7YO 1YF5L 3WUHA 2CGLA 2A6AA 1K73O 1ZC6A 5AQZA 3CCUN 3IKMA 3UE5A 5KQ8A 1NGIA 3R9PA 3W0LA 1E4GT 3FLCO 4CD1A 4PL7A 1YJNN 3OA9A 2W40A 3ENBA 3VESA 1ATSA 2NRHA 4FWKA 3PLAA 4EHTA 2E2QA 3OBWA 3P4IA 4WFAL 5AQLA 1P8ZA 1SQKA 4UY8O 1DT9A 3D2FB 3TSUA 1QVGM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EE9 A;  3O9U A;  3P38 A;  4OPH A;  3P31 A;  3KWG A;  2KKZ A;  3F5T A;  3D6R A;  3O9T A;  4OPA A;  3M5R A;  3O9S A;  2RHK A;  3RVC A;  2GX9 A;  3OA9 A;  3O9R A;  3O9Q A;  3L4Q A;  3KWI A;  3P39 A;  3EE8 A; 
#chains in the Genus database with same CATH topology
 2FSK A;  3LAM A;  1KFD A;  4DQ8 A;  2P9P B;  2VQF K;  4CEB A;  3C6H A;  4O44 A;  2G8K A;  1IG8 A;  3PX4 A;  3DOK A;  2X6N A;  4I6M A;  1TV6 A;  3SK3 A;  5CYM A;  1WUA A;  4DR1 K;  4CHO A;  5M1F A;  3K9K A;  3PIP L;  3VGK A;  4H0Y B;  3EY1 A;  1ZBS A;  4B1V A;  4IOA L;  2V7Y A;  5MLC Q;  3HO1 A;  3LPT A;  3SMS A;  1HNV A;  3KLG A;  5M1P A;  3PSI A;  3OYE A;  4OPA A;  1TK0 A;  3L2V A;  2FSJ A;  2OTL N;  3VQ9 A;  4CGI A;  3O6W A;  3CI5 A;  1VSM A;  1OVQ A;  2YNH A;  5AQI A;  1XC9 A;  1NJZ A;  4LF9 K;  4CCH A;  1JCG A;  3BY5 A;  1LWC A;  3ZEU A;  4BR5 A;  5AQO A;  4MFB A;  3A8Y A;  4FJL A;  4DS4 A;  1O13 A;  4J2B A;  3H3O B;  4W5N A;  4IBN A;  1VAZ A;  1JLC A;  1C1C A;  1YUW A;  4DV2 K;  5EXW A;  2IOC A;  4H5T A;  1YVN A;  1NGG A;  3CJC A;  3I0R A;  2A42 A;  4HCB A;  4DUZ K;  4PUO A;  2QW9 A;  2QKB A;  2E2P A;  4B3R K;  3KKR A;  3SV3 A;  5HOO A;  3O4N A;  3THV A;  2QTD A;  3SV4 A;  3QNN A;  3HPG A;  4H4O A;  3PO5 A;  3CCV N;  1VHX A;  1NMD A;  4FJ8 A;  2HHV A;  1NOZ A;  3H6E A;  3DWL A;  4H5W A;  4BRK A;  2G8W A;  1WOQ A;  4GW6 A;  2E1Y A;  3DAW A;  2G8V A;  4M3X A;  2B6A A;  2F8T A;  2YX6 A;  4DV7 K;  4K25 A;  2Q3S A;  2CGK A;  4YY3 K;  1NLV A;  3OYD A;  3CCE N;  4A57 A;  4CZM A;  1RDW X;  3LM9 A;  4CEQ A;  2F9T A;  5KTQ A;  3AVJ A;  3O08 A;  3VET A;  3Q7C A;  4H0P A;  2RHK A;  3OBY A;  4GMJ B;  1LW2 A;  3DLG A;  3SLC A;  4DG1 A;  1CZA N;  3O80 A;  3UIQ A;  4BR0 A;  1HPM A;  5C25 A;  3TAF A;  1NJI O;  4E3S A;  3WNG A;  4FPA A;  3OS2 A;  2P9N A;  1RBS A;  1JL1 A;  1IG9 A;  3OYJ A;  1YIJ N;  4M63 C;  4BE2 A;  4NYN A;  4C8M A;  3LP3 A;  4Y1C A;  3RR7 A;  4N76 A;  3D6R A;  4LC9 B;  1EWQ A;  4B9T A;  4OO1 J;  3AVN A;  1XHX A;  4YOX A;  4OLB A;  4AHR A;  4KI6 A;  4E0D A;  4YOY A;  1IH7 A;  1ASV A;  3DRS A;  2YHB A;  3SJJ A;  3KWI A;  4H5R A;  3VQB A;  3LDO A;  3DLB A;  3VF4 A;  4DLG A;  2KHO A;  1REV A;  2NRT A;  2XY5 A;  1HUX A;  4FJH A;  3LDN A;  3MMV A;  1QZ5 A;  3EE9 A;  1RDU A;  5AQR A;  2VQE K;  1YI2 N;  2G8U A;  2VGM A;  4LH5 A;  5AQF A;  2Y1J A;  2P5G A;  4IJN A;  1OVY A;  3IG1 A;  4JKH A;  4K42 A;  4FJ7 A;  4DV1 K;  3VER A;  2D4W A;  4LF5 K;  3AVL A;  4IDK A;  4RW8 A;  4U67 L;  3V9Z A;  3NF8 A;  3CF5 L;  2ZQB A;  2ZJP L;  1X9J A;  4GV9 A;  3OJS A;  1W9H A;  5LJV A;  2HNZ A;  3T1H K;  2E5L K;  4PA1 A;  1WBD A;  5HBM A;  2QWN A;  1JXB A;  5AZI B;  4WE1 A;  3HPO A;  1MDU B;  4BG8 A;  4XH4 A;  2UU9 K;  4DSJ A;  3HBT A;  4Y1D A;  1N6Q A;  4BC4 A;  3RMC A;  3N4P A;  3CCJ N;  2BDP A;  4H5N A;  1U2V B;  4NCA A;  4ILG B;  4IG0 A;  2P9I B;  4BE1 A;  3O3H A;  1EP4 A;  3NFA A;  4HTU A;  5H1S Q;  4Z0U A;  4F2R A;  3O3G A;  4CJS A;  3SUQ A;  4RWT A;  1BL3 A;  1BOT O;  3VGM A;  3NVM A;  1T8E A;  1RBV A;  2CGJ A;  4CJE A;  3HSC A;  4MO5 A;  1WLJ A;  3U3Y A;  3V6D A;  3OYL A;  3HOS A;  4BY9 C;  2VG7 A;  2P9U A;  3ZSY A;  2O8B A;  3O4W A;  2O8D B;  4DS5 A;  1IBL K;  1VQ8 N;  3ZET A;  1IBM K;  4DTU A;  4JK8 A;  4CF9 A;  3UKU A;  1NK7 A;  3ZSW A;  3ZT4 A;  4E7L A;  2AP1 A;  2GBZ A;  2NRZ A;  1U47 A;  3SUO A;  2XY6 A;  4FWL A;  4LH4 A;  2NRR A;  3ATU A;  4A62 A;  4CF0 A;  3DOL A;  3CQY A;  1T6C A;  1WB9 A;  4IKF A;  3HRG A;  4G9Z A;  3VN5 A;  1B9F A;  2BH1 A;  3C6A A;  1YJ9 N;  4AHU A;  3L2Q A;  4K8X A;  1GLL O;  1K9M O;  4DFP A;  1C0M A;  3J81 O;  1OH7 A;  4CFB A;  3TAM A;  4BRL A;  3L3U A;  1JLE A;  4C23 A;  3D0P A;  3V9S A;  4CFA A;  1L3V A;  3CFP A;  2GUP A;  5HRS A;  1K8A O;  4CEC A;  2QXL A;  2KW4 A;  4DTJ A;  1IBK K;  3VQ4 A;  5EX5 A;  1S1W A;  3D7E O;  3OW2 M;  1FKO A;  3SAF A;  1J9A A;  4CK1 A;  2O4I A;  4XH5 A;  3WXL A;  4HUE A;  4DSK A;  3M8Q A;  3ZSZ A;  2GUI A;  2HNY A;  4LF4 K;  3HST B;  3ZSV A;  4FLZ A;  2WOM A;  5FPE A;  4M3Y A;  4ISG A;  2QWL A;  1LWF A;  4KRF A;  4MDB A;  4LFC K;  3LWL A;  2YI1 A;  1BWF O;  1OH5 A;  4FL9 A;  1BIZ A;  1VQ6 N;  3T3F A;  5C12 A;  5C10 A;  1RDC A;  4OGE A;  4GVE A;  3ZSX A;  4YDU A;  2IS3 A;  2RN2 A;  3F73 A;  3TTF A;  3Q7B A;  3VQA A;  3EO3 A;  3J7Z O;  3M8S A;  3AO5 A;  5AQY A;  3V9U A;  1GOC A;  2D0B A;  2HBM A;  2ASP A;  1QQM A;  4EAH D;  1J5E K;  3QER A;  5AQS A;  4UQG A;  4DTS A;  4FM0 A;  3AAQ A;  2IVO A;  4HUG A;  1RTJ A;  5HP1 A;  2P9S B;  3ULD A;  3WXM B;  4JI7 K;  3WNH A;  1ESV A;  2HBL A;  4FJ5 A;  2ZM6 K;  3AO3 A;  4BR2 A;  1QE1 A;  4A2A A;  2JWK A;  1NGB A;  4CEZ A;  2P1J A;  1QQN A;  3ASM A;  2IVN A;  3NBP A;  3I56 N;  1GLF O;  3VEW A;  3GOI A;  5BN8 A;  3T7Z A;  1QHT A;  1LAW A;  2KTQ A;  1YHQ N;  2W6K A;  4JI8 K;  4FWQ A;  3S3M A;  1X9S A;  3EKU A;  3FR0 A;  2ZJR L;  2D0C A;  5JIC A;  1EKE A;  4JK9 A;  1U45 A;  5TKY A;  4IFV A;  3LDL A;  2O8F B;  4KH6 A;  4M3W A;  5DM7 L;  4MLE A;  3RMA A;  4Y0W A;  2DFE A;  3SPY A;  1KRP A;  2HW3 A;  1LCU A;  5M1K A;  5EOY A;  3MXJ A;  5T7B A;  3O9S A;  3MX2 A;  4A61 A;  1WSG A;  4CF1 A;  3SI6 A;  3DM2 A;  4CIF A;  1ZYQ A;  1KQS M;  1S1X A;  3GBT A;  5BRH A;  1HNZ K;  5KI6 A;  4GV3 A;  2NRV A;  2A3Z A;  3G4S N;  4A5B A;  1ASU A;  4IO8 A;  5AQT A;  5BPM A;  4Q5V A;  3OYC A;  1YTA A;  3CCU N;  4PL7 A;  4CD1 A;  3NH2 A;  2W40 A;  3VES A;  1ATS A;  2NRH A;  3ZCM A;  4DFM A;  2E2Q A;  1S6Q A;  4HCC A;  2O8E B;  3ZT0 A;  1HR0 K;  5I9E B;  4MO4 A;  2FF6 A;  3RRG A;  3D2E B;  3QIO A;  1ITG A;  4FWP A;  3EL2 A;  5JVG L;  5ELZ A;  4I2P A;  4CGF A;  1VQ9 N;  4IZ9 A;  1N36 K;  1L3S A;  4GNI A;  2P9L B;  1K8K B;  4IFE A;  1DLO A;  4U7B A;  1X3N A;  2BE2 A;  5AQK A;  4AHV A;  1BGX T;  4I2Q A;  3VTI A;  3TAB A;  1EQY A;  1G99 A;  1HMV A;  1D5A A;  1ZBU A;  3ISN C;  1A5V A;  3O4Q A;  3QES A;  4NB4 A;  4B9V A;  3P31 A;  3AVF A;  1TAQ A;  1VSH A;  3CM6 A;  2ZJQ L;  3V1Q A;  3DXM B;  2RE2 A;  2ASM A;  2ITM A;  2IVP A;  3PV8 A;  1Q81 O;  1EET A;  4J8F A;  3HP6 A;  3CPW M;  1X9M A;  5AQP A;  3IFR A;  3EE8 A;  2I5J A;  4CED A;  1TUU A;  2EWS A;  4CZG A;  3A0I X;  1UWB A;  3AA4 A;  2UYT A;  4ID1 A;  3KK2 A;  4DR5 K;  5JS2 A;  3ZX2 A;  1BHL A;  4CEO A;  2G8I A;  3U8X A;  4I7F A;  1P90 A;  3DJC A;  1VSL A;  4RW9 A;  2IGI A;  3H1Q A;  2O8C B;  5FPM A;  5JS1 A;  3H3N O;  1LV5 A;  4JAX A;  1CLQ A;  3ZSQ A;  3ZX3 A;  3QFP A;  3LDS A;  3L2W A;  1T3V A;  3I33 A;  4YOR A;  3WT0 A;  4OPK A;  1J6Z A;  2NNW A;  1I39 A;  4FW2 A;  3K58 A;  3PO4 A;  4FWS A;  1BU6 O;  4NCB A;  2VWB A;  5LL6 Z;  4OGC A;  4FXD A;  5IWA K;  1LWE A;  5AR0 A;  3TAG A;  2WC9 A;  2HOE A;  3LZJ A;  3L4Q A;  1FW6 A;  2PY5 A;  4DSI A;  3O8M A;  5AZI A;  4BRI A;  2HHQ A;  4C8K A;  2QI2 A;  1W0H A;  4KFB A;  3R8E A;  5GAD P;  3VF2 A;  2HVH A;  1JL2 A;  3KLE A;  1B9D A;  1NMN A;  3OYH A;  4DU3 A;  2LSN A;  2P9I A;  3CER A;  1Q82 O;  3SUN A;  3K5O A;  5LMU K;  5CR4 A;  4IDH A;  4CBX A;  4EZ6 A;  5A2Q O;  1VQN N;  3SQ0 A;  4DCH A;  4GKJ K;  1C0T A;  4M3T A;  1W2B M;  3NF9 A;  1NJW A;  1VQ5 N;  4JI3 K;  3C65 A;  4PKG A;  5F1X A;  1TKD A;  4OX9 K;  3AVG A;  1B92 A;  1WN7 A;  2QWR A;  1MA9 B;  4CHZ A;  4BWM A;  3CFR A;  3NH0 A;  3LM2 A;  4IFY A;  2J4R A;  3SBG A;  4DQI A;  1NGF A;  3AVK A;  3UKR B;  3MWP A;  4FPB A;  3WNF A;  3K5L A;  4I9L A;  3J8A A;  3BDP A;  1V4T A;  3ULE B;  5J2N A;  3TSQ A;  3VGL A;  4A2B A;  1S9E A;  3IMX A;  3LDP A;  5J1E A;  3EN9 A;  4F3O A;  1RFQ A;  4LF6 K;  3KTQ A;  1MWK A;  3KD1 E;  1IV0 A;  4FLW A;  4E1N A;  3OYN A;  1KAZ A;  2ITG A;  1HNW K;  3P83 D;  3A2F A;  4ID5 A;  1M1K O;  2V51 B;  3M6G A;  2FLO A;  5I42 A;  4J2D A;  5C2F A;  4BRE A;  5FDL A;  4CBU A;  1C0F A;  4W5R A;  1JCE A;  4JLH A;  1NWK A;  3PIO L;  3VQ8 A;  3WQT A;  2E6M A;  3JXU A;  3JAM O;  2G8F A;  2D0A A;  4X65 K;  1NJY A;  3VF6 A;  4CER A;  3HK2 A;  2P9K A;  2HHT A;  3SMP A;  2JLE A;  4CJL A;  3MED A;  4DWI A;  3RSE A;  2HB5 A;  3LPU A;  1YAG A;  1HRH A;  5FRN A;  5C15 A;  3SUP A;  3H45 C;  3ENO A;  2ATQ A;  3I8B A;  4C8N A;  3P5J A;  1Q9X A;  1XWL A;  2A1R A;  4KHW A;  2A41 A;  2GEM A;  4N41 A;  5AQM A;  4FLY A;  4CFD A;  3SAG A;  4YOW A;  1YTU A;  3B6O A;  4CJ3 A;  3AVC A;  2X6S A;  1J5O A;  2OTJ N;  5CZ2 A;  4BQZ A;  3KK3 A;  2OCE A;  2W41 A;  4RTF D;  2BTF A;  3V9W A;  3QIP A;  3H08 A;  4BRN A;  4CZF A;  4ISF A;  2DFH A;  1X9W A;  3C6U A;  3O5B A;  2GTD A;  5HRR A;  4B08 A;  2P9S A;  2QWM A;  1NGH A;  2B4J A;  1XMO K;  3T1Y K;  4BVP A;  4PKH A;  4DQQ A;  1X1P A;  2AA4 A;  4X62 K;  3U6F A;  2JGU A;  4M7X A;  5KGW A;  1QVF M;  3SQ4 A;  4DV6 K;  4ZTJ A;  5GAE P;  3SQ1 A;  2Z1I A;  3K5N A;  2UUA K;  4JKG B;  4YNQ A;  1EX4 A;  5AQQ A;  4JNE A;  1DTT A;  5HRN A;  5C24 A;  1KVB A;  3NGI A;  1RT3 A;  4FVM A;  4CW7 B;  4EP4 A;  1L5U A;  1SL1 A;  3O9Q A;  3BGR A;  3GL1 A;  1QS4 A;  3CCR N;  2OZM A;  4QCL A;  1TL3 A;  1TKZ A;  2QEX N;  1TUY A;  4WQ5 C;  2VG5 A;  5JLH A;  2XY8 A;  4AHC A;  1HQU A;  3AAP A;  4KV8 A;  1U49 A;  3MN9 A;  5AQG A;  3ZT3 A;  3THW B;  4WYB A;  3SAH A;  3J7A P;  5KQD A;  3U3G A;  3VQC A;  1Q18 A;  1C6V A;  4H8K A;  1HX1 A;  4KKO A;  5GAH P;  3L2R A;  1Z6R A;  4WQ4 A;  2E1Z A;  1S22 A;  4QS7 A;  1U04 A;  3U9D A;  1C0U A;  1TYQ A;  1NNE A;  4ELV A;  1RIL A;  1QTM A;  1GLJ O;  3CIP A;  2OPQ A;  1S9G A;  5DK5 A;  4JI6 K;  1G15 A;  2ASO A;  2O8E A;  4M45 A;  3MEC A;  4B9N A;  4CEA A;  5SWM A;  1TK8 A;  4BR4 A;  3TAR A;  3HVR A;  1GLE G;  3D2E A;  3K2P A;  2ZD1 A;  4B8C A;  3U9Z A;  4CI6 A;  2UXB K;  5KPR A;  2FBY A;  3ZYY X;  4FJX A;  2BGG A;  3QO9 A;  2P9L A;  3CQ8 A;  1K8K A;  4AHS A;  3ALY A;  3AGK A;  3CFO A;  3L0Q A;  3A5N C;  4DLE A;  3TWH A;  4CHQ A;  2YHY A;  4CGJ A;  3VEN A;  2KFZ A;  3CJ9 A;  1JLQ A;  4FLT A;  4CJU A;  1FXX A;  2E88 A;  5HRP A;  2XY7 A;  1XMQ K;  5FPN A;  4G1Q A;  4IEE A;  3TTD A;  2YHW A;  3DXM A;  3SQ2 A;  4JHD A;  1HJO A;  3PSF A;  4M41 A;  1M90 O;  3VOV A;  1ZBH A;  5EU7 A;  1BA0 A;  4B9Q A;  2HF3 A;  4M7Y A;  1ASW A;  2Q97 A;  3AAR A;  3NGY A;  4DV0 K;  3ZSO A;  1BI4 A;  1TGO A;  4O0J A;  3PY8 A;  4DHY A;  1HNX K;  1R59 O;  2WFB A;  2YNG A;  2A1S A;  4CK2 A;  1CXQ A;  3KKS A;  4FZY A;  1HKC A;  4DFK A;  1C1B A;  1RNH A;  3WUH A;  4X66 K;  1SL0 A;  3UE5 A;  5KQ8 A;  3R9P A;  3W0L A;  2IAJ A;  1CZB A;  2O4G A;  4EHT A;  2EHG A;  4KPY A;  4WFA L;  4E19 A;  4YFU A;  3HL8 A;  4H5V A;  3DLR A;  4QOZ B;  4BRH A;  3ZT1 A;  5AZJ B;  1RT2 A;  1SUQ A;  2Q0U A;  3N4Q A;  5DM6 L;  3M3Z A;  1VQM N;  2ZGY A;  3OVN A;  1KFS A;  3G10 A;  1L3U A;  4DR4 K;  4LF7 K;  1E4F T;  4O55 A;  1ATR A;  4B1X B;  1SV5 A;  1NU0 A;  2KFN A;  1N33 K;  1Z05 A;  5M1N A;  1WAJ A;  4BRC A;  4FLV A;  3R1X A;  1NKE A;  3E9P A;  4DTO A;  3G0Z A;  1Q86 O;  1KAX A;  4BC2 A;  4FOE A;  3KLH A;  4DTN A;  4QAG A;  4B1W B;  4FK2 A;  4CHP A;  3OYB A;  4JI1 K;  3D2F A;  3M5R A;  2P51 A;  4F2S A;  2NRX A;  4V19 S;  4H4M A;  3OYG A;  3HJF A;  3ZLJ A;  5HLF A;  1IKX A;  2P9P A;  3KK1 A;  5AQW A;  3MDQ A;  5AQN A;  3NAE A;  1XI1 A;  1K6Y A;  5FLX O;  2OPR A;  4AIL C;  1EWR A;  1BIS A;  1HLU A;  2F4V K;  3LWM A;  1NKC A;  2YHA A;  3S3N A;  4A59 A;  4YOU A;  3UKR A;  4FJG A;  2UXD K;  1QSS A;  3F5T A;  2DY4 A;  4BRD A;  1GLA G;  3ULE A;  5AQJ A;  3DLE A;  3V4I A;  4NCG A;  1WSJ A;  1KLM A;  1QZ6 A;  1HYV A;  1NK5 A;  2HST A;  1RDB A;  4AM7 A;  1YJW N;  2YKM A;  1ZXO A;  3E9L A;  1T6D A;  4DTP A;  5FRM A;  2KZM A;  5I3U A;  3H46 O;  1Y97 A;  4NLB A;  2Z1H A;  3AA3 A;  3CM5 A;  3L8B A;  1TKT A;  4JYA K;  3CET A;  4WF9 L;  4DR2 K;  3KJV A;  2Q31 A;  2P9N B;  1KD1 O;  3ID6 A;  3LP0 A;  5J2M A;  4BR9 A;  3VQ7 A;  1SKS A;  3I0S A;  5F2R A;  1WBB A;  2XRI A;  3QFU A;  2YNI A;  1S1U A;  4BRA A;  1SS6 A;  4GV6 A;  3KVG A;  3QEV A;  3F9M A;  2Z1G A;  3C7N B;  3QLH A;  4FW1 A;  2CH5 A;  1ZBL A;  1S1V A;  4JI4 K;  1VSI A;  1WSH A;  1X3M A;  3JSM A;  2AJQ A;  4BAC A;  5C42 A;  3DMJ A;  4H0O A;  1WSF A;  4F8R A;  3B6P A;  3NF6 A;  1JLB A;  4FOI A;  4CF8 A;  3WEE B;  4IXC A;  1N5Y A;  3AO1 A;  2KQ2 A;  3V1O A;  1QQO A;  1VQ4 N;  4OKE A;  3QML A;  4K8Z A;  3DXK B;  3OYF A;  4PQU A;  1WNS A;  2OYQ A;  1U48 A;  3MN6 A;  2KLA A;  1KCF A;  2F9W A;  2XO7 A;  2VG6 A;  3CD6 N;  4K41 A;  4R5P A;  2HF4 A;  3QET A;  2PBD A;  1BUP A;  5AQX A;  4B9L A;  4DR6 K;  3IRX A;  2OPP A;  4NO7 A;  4NXN K;  4B9M A;  2YKN A;  3MWT A;  3L4I A;  3LP2 A;  4I9Q A;  3GE1 A;  1OKJ A;  5BPL A;  3DRR A;  3AVA A;  3MAQ A;  3DI6 A;  1S72 N;  2WUS A;  4AHT A;  1ILY A;  4Z4G A;  4JKG A;  2NUB A;  5JLF A;  1VRU A;  2GV9 A;  1S3X A;  1JLG A;  5KRS A;  1XHZ A;  1T44 A;  3QIC A;  3TAN A;  4KH4 A;  5J2Q A;  3TAE A;  3DRP A;  1RDD A;  1D4X A;  5KPZ A;  4H0X B;  1KVA A;  4L3Q A;  1HKB A;  4KTW A;  5KPT A;  3L6Q A;  2PFU A;  4BVO A;  1DGK N;  3PUF A;  1TAU A;  1VRT A;  5GIN A;  4CE9 A;  3E01 A;  3UKU B;  1XNR K;  4RW7 A;  1JLF A;  4BRF A;  3P39 A;  3VPZ A;  1RBT A;  3MXI A;  3FFI A;  3SNN A;  2Q36 A;  1RTD A;  4DF4 A;  3DYA A;  2FSN A;  4BQL A;  2FBX A;  2YCH A;  3FZL A;  4E89 A;  1O1W A;  4BDZ A;  1RTI A;  4PHT X;  4B3S K;  5CE3 A;  4RG8 A;  4CJW A;  1VSK A;  1XC3 A;  3SCX A;  2PYL A;  3KK7 A;  3AA5 X;  2HBJ A;  1W7A A;  3VEV A;  5LY3 A;  4FJK A;  5M1O A;  4CJ4 A;  2WTU A;  1HNI A;  4FLX A;  1S5J A;  2WON A;  4IEI A;  1NKB A;  1SL2 A;  4XIU A;  1T03 A;  2OA8 A;  3HYF A;  3CYM A;  2FBT A;  2X78 A;  4JK7 A;  1UA0 A;  4ILH A;  3MXM A;  4OPH A;  4CZJ A;  4OJR A;  1W97 L;  3L3V A;  2YV0 X;  2X74 A;  2HMP A;  4KHP K;  2IC3 A;  1NJX A;  4FZZ A;  3CC2 N;  2UXC K;  1U2V A;  3LZI A;  1UOC A;  3E1Y A;  4LF8 K;  2ZGZ A;  5GIP A;  4DTM A;  1FK9 A;  5C0Y A;  3UB5 A;  2EX3 A;  3NMU A;  3AO2 A;  1VSE A;  1VQ7 N;  4PKI A;  3VTH A;  4CJ5 A;  4B9U A;  2QXF A;  2RF2 A;  3M8P A;  3B8A X;  3NE6 A;  4DQR A;  3HVT A;  4BC5 A;  3OYI A;  3O3F A;  4M42 A;  4N56 A;  3THY B;  1GOA A;  3OYM A;  4A5A A;  4KHQ A;  4BRM A;  4M3Z A;  3O9T A;  3VEY A;  3MK6 A;  1YT3 A;  3QDK A;  2O8D A;  1TKX A;  5AFU A;  3CJ7 A;  4JRQ A;  4KB1 A;  4IOC L;  4L8R B;  5BR8 K;  5JVH L;  4FM2 A;  2H3G X;  1NK0 A;  1VQL N;  1N32 K;  3OYA A;  2VWJ A;  1HYZ A;  5ADX A;  5DMR A;  3P38 A;  4EIA A;  4YOV A;  1RTH A;  4FJJ A;  3KWG A;  4CGH A;  2HMI A;  2D0O A;  2ZWH A;  4WFB L;  1Q9Y A;  4GY2 B;  3G71 N;  3WQU A;  4CGD A;  3VA0 A;  2VGN A;  2NLX A;  3O9R A;  1NK4 A;  3RMB A;  3MX5 A;  3ZSR A;  1N8R O;  1KAY A;  4LD0 A;  3FGU A;  2VWK A;  3AY9 A;  4B3T K;  3K9J A;  3R6M A;  4QS9 A;  3TU5 A;  4EP5 A;  3K0S A;  1T7P A;  1NBW A;  3KLI A;  4CF2 A;  2QK9 A;  4CJV A;  3M8R A;  4FZX C;  5AZJ A;  2PZS A;  4DQS A;  3NH1 A;  1MU2 A;  3CJA A;  2Y1I A;  4ELT A;  4WFN L;  3V1R A;  2A5X A;  4KRE A;  3LDQ A;  4TSX A;  2GEL A;  3EKS A;  1N34 K;  1NG9 A;  5C2D A;  4FWR A;  2BUP A;  3QBX A;  4Z4I A;  3ZT2 A;  1C1A A;  2QWO A;  4YHH K;  3WXJ A;  1RBU A;  4N47 A;  5FPD A;  4AH9 A;  3KIO A;  3THX B;  4KHY A;  2HND A;  4AM6 A;  4JKE A;  3A5L C;  3W3D A;  3TSP A;  1BCM A;  4CZI A;  3LP1 A;  4F4K A;  1LW0 A;  4FM1 A;  4ZTF A;  3TTC A;  4DTR A;  4CJP A;  3VQQ A;  3VQP A;  1YVU A;  4DFJ A;  3VEZ A;  1RT5 A;  3HM8 A;  1A5X A;  4B3O A;  2CH6 A;  4CJR A;  3HI0 A;  4RW6 A;  1KTQ A;  4CBW A;  1V4S A;  3E9O A;  1SKR A;  3KD5 E;  3JYT A;  4YDU C;  4W5Q A;  4FK0 A;  3CC4 N;  1QSL A;  4JN4 A;  4LFA K;  3EEQ A;  5FRO A;  4DQP A;  5CHI A;  1Q7Y O;  3LAN A;  2A6A A;  1K73 O;  5AQZ A;  2O8F A;  2Z1J A;  1I94 K;  3NF7 A;  2DTU A;  4CEF A;  3FLC O;  3OA9 A;  3ENB A;  3RR8 A;  1RT4 A;  3PLA A;  3RMD A;  1JKH A;  4CES A;  3CG7 A;  1QVG M;  2FC0 A;  2F96 A;  4Z4E A;  4LSN A;  5JMV A;  1RBR A;  4CZK A;  3D45 A;  4FCY A;  1BQN A;  1XQS C;  5BRD A;  3BP8 A;  1CXU A;  3CHW A;  4CGG A;  5BPN A;  3NGZ A;  4DF8 A;  3VQ5 A;  4CJT A;  4B1Y B;  4CZE A;  2VYP A;  3NCI A;  3C7N A;  3IUC A;  4HWI A;  3V9X A;  2Q1N A;  1EXQ A;  3LAL A;  3DLK A;  1RDA A;  3OHR A;  3PX0 A;  2PAV A;  1JXE A;  4IO9 L;  2P5O A;  1HYS A;  3WNE A;  5BN9 A;  5M1Q A;  3HPH A;  3FZH A;  1VSD A;  4BRG A;  1T05 A;  3K5M A;  1J54 A;  2IDO A;  4X64 K;  3O1B A;  3ENH A;  3EZ5 A;  3OY9 A;  4DTX A;  3M1F A;  3PX6 A;  3WEE A;  2HVI A;  3KLF A;  4CJ7 A;  4FVU A;  3CCQ N;  4Z4H A;  4ELU A;  4DV5 K;  4E7H A;  4FJM A;  4KBO A;  3QEP A;  1RT6 A;  3AVM A;  4J2E A;  3DXK A;  4E1M A;  4ZHR A;  2E4L A;  4CEE A;  3TAP A;  3CME N;  1KXP A;  2ZF5 O;  4IJA A;  4F9O A;  3LAK A;  1OH8 A;  4O4G A;  2ETJ A;  5KGX A;  3IDH A;  2KKZ A;  3AVH A;  1JJ2 M;  4OLA A;  4FLU A;  1RCH A;  3MCA B;  4DSE A;  3CXC M;  3QEX A;  4JD2 B;  4F3T A;  3HT3 A;  1QHA A;  2B5J A;  2R7Y A;  3OTO K;  4OPJ A;  4PL8 A;  3BZK A;  2YHX A;  4MLH A;  3G25 A;  3K59 A;  4NXM K;  3IAY A;  4JV5 K;  1SAZ A;  4DV3 K;  3J80 O;  4K43 A;  1NGJ A;  3CCS N;  1BQM A;  2W42 A;  3T69 A;  1E3M A;  3MCP A;  2E8A A;  3C6T A;  3WXK A;  3A5O C;  4E7J A;  4BRP A;  3RVC A;  4KHN A;  1KVC A;  3V81 A;  2E6L A;  4E1J A;  3OYK A;  3E66 A;  4O0I A;  3U4L A;  2V52 B;  4HTL A;  4NLC A;  1U4B A;  5D3G A;  3TR8 A;  1NOY A;  4KO0 A;  4BRO A;  3MEG A;  4IOX A;  4DUY K;  4KAZ A;  1VSJ A;  2QKK A;  4Z4F A;  4FK4 A;  3RTV A;  5EVZ A;  2YJE A;  4I6M B;  2HBK A;  3TAQ A;  1FJG K;  2O8C A;  4LY7 A;  4CJK A;  1OH6 A;  2I7P A;  4DSL A;  1VSF A;  2QWQ A;  4FJI A;  3A5M C;  3H1V X;  2QA4 N;  4FJN A;  4FWM A;  3BZC A;  3TPQ A;  2PYJ A;  4JEP A;  5AQU A;  4BG9 A;  1TL1 A;  1BDG A;  2NZT A;  5B8H A;  2KZZ A;  4B3M K;  3F9K A;  5BR9 A;  4K0K K;  3SBT A;  3OS0 A;  2GX9 A;  3ZEU B;  4J2A A;  1BG3 A;  4IG3 A;  1VQP N;  4LSL A;  3VEO A;  4AQY K;  5AFU H;  4YOT A;  1C0G A;  3FZF A;  4W5T A;  1UA1 A;  2P9K B;  4FSV A;  2RPI A;  2Q0R A;  4JKF A;  1RT1 A;  1GOB A;  1JCF A;  4KHS A;  3J7Y P;  3RSE B;  1NK8 A;  3AA2 A;  4WCE L;  5ADX H;  2FF3 B;  1RT7 A;  4KH5 A;  3QB0 A;  3S3O A;  2ZE2 A;  3GG4 A;  2OAN A;  2JWL A;  3TI0 A;  3THY A;  4JI2 K;  4RCH A;  1MWM A;  5E84 A;  2E2N A;  1R0A A;  1LAV A;  4JKA A;  3DLH A;  1WSE A;  5K14 A;  3HZ6 A;  1Y64 A;  3CCL N;  3ID8 A;  3IS9 A;  1FKP A;  1U6Z A;  4DU4 A;  4FO0 A;  1XUP O;  4MDA A;  1I3A A;  1IKY A;  3O1W A;  5CZ1 A;  3EYZ A;  3AVI A;  2GWK A;  1S1T A;  3QEW A;  1IJJ A;  4H0T B;  3S9H A;  5EY4 A;  2F8S A;  1J53 A;  2IIR A;  3RRH A;  3CJB A;  5J2P A;  3BEX A;  1Z25 A;  1NGA A;  2V7Z A;  1VQK N;  2E20 A;  2A40 A;  2OPS A;  4ICL A;  2RKI A;  4DR7 K;  4JS5 A;  1ATN A;  3HM9 A;  1NK6 A;  3HP9 A;  2NRW A;  4C8O A;  4WQ5 A;  1WAF A;  2FXU A;  1KLN A;  3BF1 A;  1NGC A;  3FZM A;  4W5O A;  4H03 B;  5E41 A;  4HHT A;  4CZL A;  4BGB A;  1VQO N;  3QBW A;  4IWV A;  5TKW A;  4NYF A;  3LL3 A;  1GLB G;  1RGI A;  3I55 N;  4DSF A;  2E2O A;  5CY4 A;  4XH1 A;  4EHU A;  3VQD A;  4M3R A;  1HPZ A;  2HHX A;  3S41 A;  3ATV A;  1QSY A;  3C94 A;  5GAG P;  4EFH A;  2UUB K;  1GLD G;  1NGD A;  2WBN A;  1KSP A;  4AF1 A;  3AV9 A;  3HTV A;  3MEE A;  3NDK A;  5IT9 O;  5KRT A;  1WSI A;  3HOT A;  3JS6 A;  1YXQ A;  1GLC G;  1BCO A;  4JRP A;  1D8Y A;  3VQ6 A;  3CC7 N;  1SKW A;  4Z4C A;  3KHY A;  3QNO A;  3THX A;  1D9D A;  3QEI A;  4B1Z A;  1NGE A;  1Q8I A;  4KTQ A;  3DLL L;  3T1A A;  3VMF B;  1BA1 A;  5BRE A;  3T19 A;  4JI0 K;  3ZX0 A;  1HKG A;  1TYQ B;  3CJ1 A;  3P1G A;  1BIU A;  1NM1 A;  4OKK A;  4KB0 A;  4JKB A;  3G6E N;  4FJ9 A;  2HHU A;  4B9S A;  4EZ9 A;  2D1K A;  1D9F A;  5F0X A;  4CVN E;  2I7N A;  4XEI A;  4HVJ A;  1CZ9 A;  2Q2R A;  4N5S A;  3AO4 A;  3SPZ A;  1S6P A;  3KZB A;  3MN7 A;  4CFC A;  3K57 A;  4CIE A;  2DPN A;  5LMN K;  1A5W A;  2QWP A;  4BRQ A;  1BO5 O;  5E26 A;  4ILJ A;  3EZW A;  1TVR A;  1LOT B;  1DKG D;  5BRF A;  3QIN A;  4B1U B;  4KHU A;  2UUC K;  4DKW A;  3FFK B;  4FWO A;  4BGA A;  3CMA N;  3MN5 A;  4Q0B A;  4CHN A;  3GDQ A;  4KI4 A;  3ITH A;  4RW4 A;  3R3L A;  4JS4 A;  4GVM A;  4H0V B;  2OZS A;  1ZBF A;  4JI5 K;  3F2K A;  2YNF A;  5GIO A;  3NVK A;  3SZ2 A;  3VQE A;  1H1V A;  4PY5 A;  2P9U B;  4JKD A;  4JHD B;  4PWD A;  1IKW A;  2O8B B;  3BF3 A;  4JKC A;  4B8A B;  1ZBI A;  3FZK A;  3OJU A;  3ZET B;  1JLA A;  1DEJ A;  2BAN A;  4CK3 A;  5SZT A;  3CCM N;  4CIG A;  4MQ3 A;  5CYQ A;  3C95 A;  4FWN A;  1BI4 B;  3THW A;  4BDY A;  3L2U A;  1VK0 A;  5AJ3 K;  4LFB K;  2D0P A;  4O5F A;  2YJF A;  1SZ2 A;  4DU1 A;  2QM1 A;  3CQX A;  5HL7 L;  2FBV A;  1L3T A;  3BUZ B;  3VEX A;  1NK9 A;  2W6L A;  3FE1 A;  3NHG A;  4DMN A;  1XNQ K;  1UAX A;  1EO1 A;  1Z26 A;  1YIT N;  4DB3 A;  2DFF A;  4C1N K;  4E7I A;  1IO2 A;  4C1N I;  4CD3 A;  1F21 A;  3WXI A;  4HUF A;  4M3U A;  4KTZ A;  2HHW A;  3AGR A;  1DTQ A;  5AQV A;  1KC8 O;  2D5R A;  4CHY A;  3SYZ A;  1HJR A;  1IKV A;  4ISE A;  4C8L A;  4GKK K;  3AVB A;  1QQC A;  3CPE A;  3OS1 A;  4CZH A;  4BWJ A;  4FYD A;  4CJQ A;  3VA3 A;  2VCP A;  4O8K A;  4OKJ A;  3C0B A;  4O8U A;  4WQ4 C;  4Z94 A;  2GWJ A;  3SJH A;  4BR7 A;  4E7K A;  4BC3 A;  4OVL A;  4O5B A;  4QS8 A;  4DR3 K;  2HHS A;  5AQH A;  4JD2 A;  4R79 A;  5LJW A;  4BE0 A;  2F7T A;  3O9U A;  4BDP A;  1YF5 L;  4CJF A;  2CGL A;  3HXM A;  1ZC6 A;  4DV4 K;  3IKM A;  5HRO A;  1NGI A;  2HHH K;  1E4G T;  1TK5 A;  1YJN N;  2XHB A;  4FWK A;  3RWU A;  3OBW A;  3P4I A;  1HQE A;  5AQL A;  2G8H A;  1P8Z A;  3I8D A;  1SQK A;  4UY8 O;  1DT9 A;  3D2F B;  3TSU A; 
#chains in the Genus database with same CATH homology
 5I9E B;  4H5V A;  2FSK A;  2FF6 A;  4MO4 A;  5JMV A;  4BRH A;  3D2E B;  4CZK A;  5AZJ B;  4DQ8 A;  2P9P B;  2Q0U A;  3EL2 A;  3N4Q A;  1XQS C;  4FWP A;  5JVG L;  5BRD A;  3C6H A;  3BP8 A;  5ELZ A;  3CHW A;  5BPN A;  5DM6 L;  1VQ9 N;  4IZ9 A;  1IG8 A;  3M3Z A;  2ZGY A;  1VQM N;  4GNI A;  4B1Y B;  4CZE A;  2P9L B;  2VYP A;  3C7N A;  1K8K B;  4IFE A;  4I6M A;  1E4F T;  1ATR A;  3IUC A;  4HWI A;  3SK3 A;  4B1X B;  4U7B A;  1X3N A;  1WUA A;  5AQK A;  2Q1N A;  3VTI A;  1Z05 A;  5M1N A;  5M1F A;  1EQY A;  3K9K A;  3OHR A;  4BRC A;  1G99 A;  3R1X A;  2PAV A;  4IO9 L;  3PIP L;  3E9P A;  3VGK A;  4H0Y B;  1ZBS A;  5BN9 A;  5M1Q A;  4B1V A;  4IOA L;  1Q86 O;  1KAX A;  2V7Y A;  3FZH A;  4BRG A;  4BC2 A;  5MLC Q;  4FOE A;  4NB4 A;  3SMS A;  3P31 A;  3O1B A;  5M1P A;  3ENH A;  4B1W B;  3M1F A;  3D2F A;  3M5R A;  4OPA A;  2ZJQ L;  2NRX A;  3WEE A;  3DXM B;  4CJ7 A;  4FVU A;  2FSJ A;  2OTL N;  3CCQ N;  2RE2 A;  3CI5 A;  2ASM A;  3O6W A;  2ITM A;  4KBO A;  2IVP A;  2P9P A;  5AQW A;  1Q81 O;  3MDQ A;  4J8F A;  5AQI A;  5AQN A;  3CPW M;  3DXK A;  1JCG A;  5AQP A;  3IFR A;  3ZEU A;  3EE8 A;  4BR5 A;  3CME N;  1HLU A;  5AQO A;  1KXP A;  1TUU A;  2ZF5 O;  4IJA A;  2EWS A;  4CZG A;  4F9O A;  3A0I X;  3A8Y A;  2UYT A;  4A59 A;  1O13 A;  4YOU A;  3UKR A;  3ZX2 A;  3IDH A;  2KKZ A;  3F5T A;  3H3O B;  3U8X A;  1GLA G;  4BRD A;  1JJ2 M;  3ULE A;  1P90 A;  3DJC A;  3MCA B;  1VAZ A;  5AQJ A;  3CXC M;  1QZ6 A;  1YUW A;  2HST A;  4AM7 A;  4JD2 B;  5EXW A;  3E9L A;  1ZXO A;  1QHA A;  3H1Q A;  4H5T A;  1YJW N;  1YVN A;  5FPM A;  1T6D A;  4PL8 A;  2YHX A;  4MLH A;  1NGG A;  3CJC A;  3G25 A;  3H3N O;  4JAX A;  2A42 A;  3ZX3 A;  3H46 O;  4NLB A;  3QFP A;  2QW9 A;  1SAZ A;  2E2P A;  1T3V A;  3I33 A;  4YOR A;  3WT0 A;  4K43 A;  1NGJ A;  5HOO A;  3CET A;  1J6Z A;  2NNW A;  3CCS N;  2QTD A;  4WF9 L;  3T69 A;  4FWS A;  3MCP A;  2E8A A;  1BU6 O;  3WXK A;  3A5O C;  3CCV N;  2VWB A;  1NMD A;  4BRP A;  3RVC A;  2Q31 A;  2P9N B;  3H6E A;  3DWL A;  4H5W A;  3ID6 A;  3E66 A;  5AR0 A;  4BRK A;  4E1J A;  3U4L A;  1KD1 O;  2V52 B;  2WC9 A;  1WOQ A;  4HTL A;  4NLC A;  4BR9 A;  2E1Y A;  2HOE A;  3L4Q A;  5F2R A;  3DAW A;  3O8M A;  3QFU A;  2YX6 A;  4BRO A;  4IOX A;  5AZI A;  4BRA A;  1SS6 A;  4BRI A;  4GV6 A;  3KVG A;  3F9M A;  4K25 A;  3C7N B;  2QI2 A;  5EVZ A;  2YJE A;  2CGK A;  4I6M B;  1NLV A;  2HBK A;  3CCE N;  4A57 A;  2CH5 A;  3R8E A;  5GAD P;  4CZM A;  1RDW X;  3LM9 A;  3VF2 A;  2F9T A;  2I7P A;  3O08 A;  3VET A;  3Q7C A;  4H0P A;  2QWQ A;  2RHK A;  1X3M A;  3OBY A;  2P9I A;  3A5M C;  3H1V X;  3SLC A;  3CER A;  1CZA N;  3O80 A;  2QA4 N;  1Q82 O;  4BR0 A;  4FWM A;  5CR4 A;  1HPM A;  4IDH A;  4CBX A;  3TPQ A;  1NJI O;  4H0O A;  1VQN N;  4JEP A;  5AQU A;  4BG9 A;  4DCH A;  4FPA A;  4FOI A;  2P9N A;  3WEE B;  4IXC A;  1BDG A;  1YIJ N;  2NZT A;  4M63 C;  5B8H A;  1W2B M;  1VQ5 N;  1QQO A;  1VQ4 N;  3C65 A;  4PKG A;  5F1X A;  5BR9 A;  3QML A;  3D6R A;  4LC9 B;  2QWR A;  4OO1 J;  3DXK B;  3SBT A;  1MA9 B;  2GX9 A;  3ZEU B;  4YOX A;  3MN6 A;  2KLA A;  1BG3 A;  3LM2 A;  1VQP N;  3VEO A;  2J4R A;  2F9W A;  5AFU H;  4YOY A;  3SBG A;  1NGF A;  3CD6 N;  4YOT A;  4K41 A;  3UKR B;  1C0G A;  3FZF A;  3MWP A;  3KWI A;  4FPB A;  4H5R A;  2HF4 A;  2P9K B;  2PBD A;  3J8A A;  3LDO A;  1BUP A;  4FSV A;  5AQX A;  1V4T A;  3ULE B;  3VF4 A;  2KHO A;  2Q0R A;  4JKF A;  3TSQ A;  4NO7 A;  3VGL A;  2NRT A;  4A2B A;  1HUX A;  3IMX A;  3LDN A;  3L4I A;  3EN9 A;  1QZ5 A;  3LDP A;  3MMV A;  3MWT A;  3EE9 A;  3GE1 A;  1RDU A;  1JCF A;  5AQR A;  1OKJ A;  1RFQ A;  5BPL A;  3RSE B;  1YI2 N;  2VGM A;  1MWK A;  5AQF A;  1S72 N;  4WCE L;  2WUS A;  2FF3 B;  4IJN A;  5ADX H;  4KH5 A;  1OVY A;  1KAZ A;  3QB0 A;  4JKH A;  4K42 A;  1ILY A;  4JKG A;  3GG4 A;  5JLF A;  3VER A;  2OAN A;  2D4W A;  1M1K O;  1S3X A;  2JWL A;  2V51 B;  3M6G A;  2FLO A;  4RCH A;  1MWM A;  1T44 A;  2E2N A;  3QIC A;  5E84 A;  4BRE A;  4U67 L;  5C2F A;  4JKA A;  4CBU A;  1C0F A;  1Y64 A;  3HZ6 A;  4KH4 A;  3CF5 L;  3CCL N;  3ID8 A;  1JCE A;  1U6Z A;  1NWK A;  2ZJP L;  1D4X A;  3PIO L;  4FO0 A;  5KPZ A;  1XUP O;  4MDA A;  1X9J A;  4H0X B;  3WQT A;  3O1W A;  4GV9 A;  3JXU A;  4L3Q A;  5LJV A;  1HKB A;  2GWK A;  3VF6 A;  1IJJ A;  5KPT A;  2P9K A;  4H0T B;  3SMP A;  3L6Q A;  5EY4 A;  2PFU A;  2QWN A;  5AZI B;  4BVO A;  1DGK N;  2IIR A;  1MDU B;  3CJB A;  4BG8 A;  5GIN A;  4XH4 A;  3BEX A;  3HBT A;  3RSE A;  3UKU B;  1NGA A;  1YAG A;  2V7Z A;  1VQK N;  2E20 A;  4BC4 A;  2A40 A;  5C15 A;  3H45 C;  1ATN A;  3ENO A;  3N4P A;  3P39 A;  3VPZ A;  4H5N A;  3I8B A;  4BRF A;  3CCJ N;  1U2V B;  2Q36 A;  2NRW A;  4ILG B;  2A41 A;  2GEM A;  2P9I B;  4WQ5 A;  2FSN A;  4BQL A;  2FXU A;  5AQM A;  3SAG A;  5H1S Q;  3BF1 A;  1NGC A;  3FZM A;  4YOW A;  2YCH A;  3FZL A;  4H03 B;  4CZL A;  4BGB A;  1VQO N;  4RWT A;  4PHT X;  1BOT O;  3VGM A;  3QBW A;  5CE3 A;  2OTJ N;  4IWV A;  1XC3 A;  3NVM A;  4BQZ A;  3KK7 A;  5TKW A;  2CGJ A;  2HBJ A;  3HSC A;  4MO5 A;  3VEV A;  5LY3 A;  2W41 A;  3LL3 A;  5M1O A;  1GLB G;  1RGI A;  3HOS A;  4BY9 C;  3I55 N;  4RTF D;  2E2O A;  2BTF A;  4IEI A;  4XH1 A;  2P9U A;  4BRN A;  4CZF A;  4EHU A;  3O4W A;  4ISF A;  1VQ8 N;  3ZET A;  4JK7 A;  3O5B A;  3S41 A;  3ATV A;  4ILH A;  2GTD A;  4JK8 A;  3UKU A;  5GAG P;  4OPH A;  4CZJ A;  4EFH A;  1GLD G;  1NGD A;  2P9S A;  2QWM A;  1W97 L;  2WBN A;  1NGH A;  2AP1 A;  4AF1 A;  2NRZ A;  2HMP A;  3HTV A;  4FWL A;  4BVP A;  4PKH A;  3CC2 N;  1U2V A;  2NRR A;  2AA4 A;  3E1Y A;  3ATU A;  2ZGZ A;  4A62 A;  3HOT A;  3JS6 A;  1YXQ A;  5GIP A;  3CQY A;  1T6C A;  5C0Y A;  3UB5 A;  4M7X A;  3NMU A;  1GLC G;  1VQ7 N;  3HRG A;  4PKI A;  3VTH A;  1QVF M;  4G9Z A;  3B8A X;  5GAE P;  2BH1 A;  3C6A A;  1YJ9 N;  3CC7 N;  3KHY A;  4JKG B;  4BC5 A;  1GLL O;  1K9M O;  4B1Z A;  1NGE A;  5AQQ A;  4JNE A;  3DLL L;  4BRL A;  4A5A A;  4BRM A;  4C23 A;  3O9T A;  3VMF B;  3VEY A;  1BA1 A;  3MK6 A;  5BRE A;  2GUP A;  3QDK A;  3ZX0 A;  5AFU A;  1HKG A;  1K8A O;  1TYQ B;  2QXL A;  3CJ1 A;  3O9Q A;  1NM1 A;  3CJ7 A;  3GL1 A;  4JKB A;  3G6E N;  3CCR N;  5EX5 A;  3D7E O;  2D1K A;  3OW2 M;  4IOC L;  3SAF A;  2QEX N;  5F0X A;  5JVH L;  1TUY A;  4XH5 A;  2I7N A;  4XEI A;  4WQ5 C;  3WXL A;  2H3G X;  2Q2R A;  5JLH A;  1VQL N;  5ADX A;  3KZB A;  3P38 A;  3AAP A;  4EIA A;  4YOV A;  5FPE A;  3MN7 A;  3KWG A;  2DPN A;  2D0O A;  2ZWH A;  3MN9 A;  4ISG A;  4WFB L;  2QWL A;  4GY2 B;  5AQG A;  2QWP A;  4MDB A;  3G71 N;  4BRQ A;  3WQU A;  1BO5 O;  5E26 A;  2VGN A;  4ILJ A;  2YI1 A;  1BWF O;  2NLX A;  3EZW A;  3O9R A;  4FL9 A;  1LOT B;  4WYB A;  3SAH A;  1VQ6 N;  5KQD A;  3MX5 A;  5C12 A;  1DKG D;  5BRF A;  4B1U B;  1KAY A;  1N8R O;  1Q18 A;  1HX1 A;  3FGU A;  5GAH P;  4DKW A;  3FFK B;  4FWO A;  4BGA A;  3CMA N;  3AY9 A;  1Z6R A;  3MN5 A;  4WQ4 A;  5C10 A;  2E1Z A;  1S22 A;  3GDQ A;  4GVE A;  4QS7 A;  4YDU A;  3K9J A;  3U9D A;  3R6M A;  3R3L A;  3TTF A;  1TYQ A;  4QS9 A;  3Q7B A;  4H0V B;  3TU5 A;  1GLJ O;  3CIP A;  3EO3 A;  3J7Z O;  2ASO A;  3F2K A;  1NBW A;  5AQY A;  5GIO A;  3NVK A;  2HBM A;  1H1V A;  4BR4 A;  2ASP A;  1QQM A;  2P9U B;  4JKD A;  4JHD B;  4EAH D;  1GLE G;  3BF3 A;  4JKC A;  3D2E A;  5AQS A;  5AZJ A;  3FZK A;  3ZET B;  3U9Z A;  3AAQ A;  2IVO A;  3CJA A;  4CI6 A;  1DEJ A;  5KPR A;  3ZYY X;  3CCM N;  2P9S B;  4WFN L;  2P9L A;  3WXM B;  2A5X A;  1ESV A;  1K8K A;  2HBL A;  3AGK A;  4FWN A;  3L0Q A;  3A5N C;  3LDQ A;  4BR2 A;  4A2A A;  2GEL A;  3EKS A;  2JWK A;  1NGB A;  5C2D A;  2YHY A;  2D0P A;  1QQN A;  4O5F A;  2YJF A;  1SZ2 A;  4FWR A;  3VEN A;  3CJ9 A;  2BUP A;  2IVN A;  3I56 N;  1GLF O;  3QBX A;  3GOI A;  3VEW A;  2QM1 A;  3CQX A;  5HL7 L;  2QWO A;  5BN8 A;  3BUZ B;  3T7Z A;  3VEX A;  2E88 A;  3WXJ A;  3FE1 A;  1YHQ N;  5FPD A;  4FWQ A;  1EO1 A;  5FPN A;  3EKU A;  1YIT N;  3FR0 A;  4DB3 A;  4AM6 A;  2ZJR L;  4JKE A;  5JIC A;  4IEE A;  3A5L C;  3W3D A;  3TTD A;  4JK9 A;  2YHW A;  5TKY A;  4C1N K;  3DXM A;  3LDL A;  3TSP A;  4C1N I;  4CD3 A;  4JHD A;  1HJO A;  4KH6 A;  3WXI A;  1M90 O;  5DM7 L;  4CZI A;  4MLE A;  3AGR A;  3VOV A;  5AQV A;  3TTC A;  1BA0 A;  4Y0W A;  4B9Q A;  1KC8 O;  2HF3 A;  4M7Y A;  4ISE A;  1LCU A;  2Q97 A;  3AAR A;  5M1K A;  5EOY A;  3VEZ A;  3HM8 A;  3CPE A;  3MX2 A;  3O9S A;  4A61 A;  2CH6 A;  4CZH A;  3HI0 A;  4CBW A;  1V4S A;  3GBT A;  1KQS M;  2VCP A;  4O8K A;  5BRH A;  4DHY A;  3C0B A;  3E9O A;  4O8U A;  4WQ4 C;  4Z94 A;  4GV3 A;  4YDU C;  2GWJ A;  1R59 O;  2NRV A;  2A3Z A;  2WFB A;  3SJH A;  4BR7 A;  3G4S N;  4BC3 A;  4A5B A;  4QS8 A;  3CC4 N;  4JN4 A;  4IO8 A;  5AQH A;  4JD2 A;  1HKC A;  4R79 A;  5LJW A;  2F7T A;  3O9U A;  5CHI A;  5AQT A;  5BPM A;  1Q7Y O;  1YF5 L;  3WUH A;  2CGL A;  2A6A A;  1K73 O;  1ZC6 A;  5AQZ A;  3CCU N;  3IKM A;  3UE5 A;  5KQ8 A;  1NGI A;  3R9P A;  3W0L A;  1E4G T;  3FLC O;  4CD1 A;  4PL7 A;  1YJN N;  3OA9 A;  2W40 A;  3ENB A;  3VES A;  1ATS A;  2NRH A;  4FWK A;  3PLA A;  4EHT A;  2E2Q A;  3OBW A;  3P4I A;  4WFA L;  5AQL A;  1P8Z A;  1SQK A;  4UY8 O;  1DT9 A;  3D2F B;  3TSU A;  1QVG M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...