2KKZA

Solution nmr structure of the monomeric w187r mutant of a/udorn ns1 effector domain. northeast structural genomics target or8c[w187r].
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
134
structure length
134
Chain Sequence
b'MPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLERNDNTVRVSKTLQRFAWGSSNENGRPPLTLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein NS1
publication title Solution NMR structure of the monomeric W187R mutant of A/Udorn NS1 effector domain. Northeast Structural Genomics target OR8C[W187R].
rcsb
source organism Influenza a virus
molecule tags Antiviral protein
total genus 34
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2009-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2kkzA00
3KWGA 3O9QA 3EE9A 3KWIA 3M5RA 3P38A 3O9UA 2GX9A 2KKZA 3OA9A 2RHKA 3RVCA 3O9RA 3O9SA 3O9TA 3L4QA 4OPAA 3EE8A 3P39A 3P31A 4OPHA 3D6RA 3F5TA
chains in the Genus database with same CATH superfamily
5C15A 5AZJA 2PYJA 1L5UA 2P9IB 1XUPO 3D7EO 2FSNA 3AVFA 5BPLA 1NGIA 1IG9A 5EVZA 4JI4K 1TK5A 4DR4K 1X3MA 2P9SB 4A62A 5BRHA 3L4QA 1HLUA 2ASMA 4PKHA 1JJ2M 3KD5E 1F21A 1JLGA 3AVNA 3WXLA 1NKBA 3A5LC 4CJPA 5JICA 2VQFK 3VEZA 1OVYA 3AV9A 1T6CA 1Q82O 4HTUA 4RTFD 3A5NC 4B1UB 3NGIA 4IDHA 2X6NA 1VQ9N 1VRTA 4JKBA 3L2UA 1EWRA 1MWKA 1L3SA 5JLHA 4C1NK 4CCHA 1N32K 4FJXA 3HPGA 4ICLA 1UA0A 1FK9A 5KPTA 5HROA 2ZJPL 1RBTA 2HNDA 3D6RA 4OLBA 1ATNA 4GKKK 1ZYQA 1RDWX 2IIRA 2P9NB 3QESA 5J2NA 3O4QA 5MLCQ 4BC4A 4B9QA 3GG4A 3I55N 1X3NA 1IO2A 4LFBK 3NH2A 1U49A 2A40A 4B9UA 1FKOA 3KK1A 4DV1K 3ZT1A 4GV3A 1QZ6A 3TSQA 1NJIO 3DOKA 4TSXA 3QB0A 4OKKA 3O5BA 5I3UA 4YDUC 4JNEA 5C0YA 4K42A 2KLAA 2WFBA 4OVLA 1M1KO 1RDDA 2QM1A 3HZ6A 2O8EB 1QSLA 2PY5A 3J8AA 1BO5O 4BRKA 2W41A 3VQ9A 3QFPA 3ZETA 4BRAA 4CEAA 4IG3A 1RBUA 3ZSVA 3VQ6A 5BR8K 3MEEA 3DRSA 1EWQA 2ZJQL 1VQ6N 1BU6O 4DQPA 4K41A 3OYNA 3ZSWA 1HQEA 1U2VB 3B6PA 3O3FA 3IAYA 1Y97A 5BPNA 3I56N 4U67L 5LJWA 1Y64A 2ATQA 3PO4A 3AVIA 1FJGK 2YKMA 4DLGA 3AGRA 3C65A 4H5VA 3KK2A 1I94K 3LDSA 3OW2M 1VQ8N 1NGCA 1YTUA 3WQUA 4DSIA 4IO8A 4Z94A 4BR7A 3W0LA 4BGBA 4C8NA 3SYZA 1TGOA 2HHUA 1TK8A 3AO3A 4E7LA 2RN2A 4MLHA 3V1RA 4PL8A 1S1XA 4NLCA 3WNFA 3VA3A 4YOXA 3O1WA 1KTQA 4FPAA 1XHXA 5FPEA 1JLBA 3CCQN 1TAQA 2FSKA 1BA1A 1BCOA 4MO5A 1JLAA 2IVOA 4O4GA 1X9WA 3FE1A 3K9KA 3U6FA 5M1PA 5ADXA 1QTMA 3G71N 4JI5K 3NF8A 4EIAA 4B9VA 1NJYA 1HNWK 4CZJA 5J2PA 5F2RA 1HYSA 2O8DA 4NCBA 4NCGA 4MDBA 2Q3SA 3KWGA 4CJSA 3AGKA 3VQ4A 2D1KA 3CERA 4I6MB 1C0UA 1JL2A 4DF8A 4CF0A 1NU0A 3OYJA 3SV3A 2EWSA 1KAZA 3OTOK 1HYZA 3RR7A 1WLJA 4WQ5C 4RG8A 2XRIA 2P9UB 4LF4K 4H0VB 4CGIA 2KZZA 4CF1A 1C1CA 4M3ZA 3HO1A 5FRMA 3O9QA 3AO4A 5HLFA 3THYA 3L2QA 1ASVA 2YHBA 3PSIA 4KV8A 2P9IA 3K58A 1VQMN 3CD6N 1S1VA 1C1AA 3FZLA 1TKTA 1KAXA 1WSHA 3CJBA 2HW3A 4JKGA 5C10A 4BROA 3M8SA 2GEMA 4DFKA 1NGDA 3QO9A 4FJ5A 1YVNA 4FJHA 3PIPL 4DWIA 2HHXA 4DKWA 3AO5A 1TVRA 3SUOA 1VSHA 3L3VA 3SI6A 1R0AA 2E4LA 1SAZA 4CE9A 4XH1A 4CVNE 5KPRA 2QWMA 3RSEA 4WFNL 1LAVA 1RILA 4BR9A 2GWJA 3NCIA 4I2PA 3OHRA 4FJIA 1A5XA 3TSPA 4CJUA 5HRSA 1K9MO 1QQCA 3SJHA 1U47A 4BR0A 1FXXA 5AR0A 1HNIA 2OZSA 4H03B 1RTDA 3OS1A 3VENA 2OA8A 4FJ7A 4N76A 3G6EN 4B3MK 3EKSA 1RTHA 4FWKA 4DCHA 4CGDA 5I42A 4OPKA 3PV8A 4JYAK 3TABA 4B1YB 4FL9A 1JLEA 3ID8A 3OYFA 4CEOA 4EHUA 2HHHK 3A5OC 3MX5A 1HRHA 5AQRA 3DOLA 2RF2A 3O1BA 4BRQA 2R7YA 3HJFA 1YJ9N 2YHWA 2O8EA 4DR3K 1RBSA 3K0SA 1RNHA 1NMNA 1JKHA 3CJAA 2DFEA 1IBMK 3JYTA 3M8QA 4PQUA 5EXWA 3ATVA 3L2WA 3C95A 4DQRA 5KPZA 4CECA 3MK6A 5B8HA 3TAGA 3DLKA 1TUUA 3LP3A 3HI0A 4JKAA 3A5MC 4RWTA 4M41A 3CCJN 1NGAA 3O9TA 3TPQA 3CETA 1MDUB 1HPMA 4IEIA 1I39A 2JLEA 1EXQA 3SPZA 3TI0A 2JGUA 2B5JA 2HNYA 3RRGA 4ISEA 3T3FA 4M7YA 4KHNA 3HK2A 4N47A 4LSLA 3M8PA 4CK3A 1JL1A 4FW1A 5FDLA 3WEEA 2D0CA 1VSDA 3M8RA 2OPPA 4DSFA 3HT3A 4BRHA 3OJSA 3TTDA 3THVA 4UQGA 4JKCA 5AQKA 4DTPA 3VEWA 4JRQA 1IG8A 3QIPA 2CH5A 1Q9YA 3BEXA 4Y0WA 1KVAA 4Z4IA 3IUCA 4A57A 3ZT4A 2HHSA 1T8EA 2E2QA 2Q36A 4FPBA 4PHTX 4AILC 1RT1A 4X65K 4PKGA 3H3OB 4DV0K 2VWKA 4IG0A 4FM2A 1VSJA 4JKEA 4I6MA 3CC7N 4H5NA 2QA4N 3SV4A 4K8ZA 1OH5A 1JCGA 3QEXA 4WCEL 1GOCA 1V4TA 4YOYA 4I9LA 1NG9A 4N41A 5AQIA 5AZJB 4JN4A 4BRCA 3T69A 5AQTA 2KFNA 2QWOA 1K8KA 2NRWA 3KIOA 2HVIA 1XWLA 2HHQA 5TKYA 1VQON 4DF4A 3CCEN 1U45A 4Q0BA 4WQ5A 2W6LA 3D45A 1SL1A 4FXDA 1JLQA 3SQ0A 2ASOA 2D0AA 4C8KA 5KRSA 1LOTB 5AQHA 1HMVA 5EX5A 1XMOK 1CXUA 1FW6A 3IS9A 4H5WA 4BRDA 5KGXA 3GDQA 2QKBA 4B1WB 4OLAA 3CF5L 3NFAA 3MEGA 3TSUA 3ID6A 1WB9A 5AQXA 4A5AA 3AVLA 2P5GA 1DGKN 2UYTA 1T03A 3IMXA 3HYFA 4PA1A 4EFHA 3Q7BA 5AQMA 3AVCA 3ASMA 2QWRA 3QICA 3DMJA 4Z4EA 4BQZA 3CJ9A 4RW6A 2PAVA 1RTIA 2YX6A 4JHDA 1S3XA 3UKRA 1BHLA 3FLCO 3LANA 1J53A 1HPZA 1BIUA 3VQ7A 4E89A 3L3UA 3U8XA 3VGKA 3M3ZA 1KAYA 1Q9XA 3O3HA 4HHTA 1GOAA 4CD1A 3QFUA 4LF5K 1VHXA 3A2FA 1IBLK 1NGGA 3QINA 4O8KA 2P51A 4O55A 5KI6A 1VQPN 1IKYA 3CJ1A 4O44A 4AH9A 4B8AB 4FSVA 4NXNK 3LP2A 2G8VA 2QWNA 1UWBA 4YOUA 3NH1A 4FWSA 4FJMA 2D0PA 4XEIA 5E84A 3QEPA 1XQSC 1ZBIA 1KCFA 4BRIA 4BE0A 1D4XA 2E2NA 3VQ8A 1IV0A 2E2PA 5EOYA 3AA3A 3MCAB 1HNZK 3T7ZA 4JAXA 1ESVA 3AA4A 1LW0A 2XHBA 5AQLA 4CGHA 2F8TA 2ZGYA 5JMVA 4ILJA 1LAWA 1RT4A 2HBJA 1VQ7N 1DT9A 1DTQA 4DTRA 3RMDA 3ENHA 3A0IX 1ASWA 1NGFA 4M3RA 5F1XA 2HBLA 3LDQA 1RT5A 3P1GA 1EQYA 1VSKA 4AHSA 2D0BA 3HP6A 4KH5A 4DFMA 3PUFA 2QI2A 4YNQA 3ENBA 1W2BM 5EY4A 3D2EA 4AHUA 2F4VK 3CC4N 1MA9B 2QEXN 4O5FA 4Z4CA 4AHVA 3OYKA 1IJJA 1YXQA 3CIPA 4FOIA 2YKNA 3F2KA 2WBNA 3RMBA 5JLFA 4JKHA 4DTJA 2O8DB 3QEVA 2E20A 4Y1DA 3VQBA 3VPZA 4B1VA 3EO3A 3VEOA 3CCVN 1NGHA 4QS9A 3S3MA 3F9MA 1RDUA 5LL6Z 1NKEA 2V7YA 3MXIA 4GVEA 5GIPA 3SCXA 3UIQA 1GLDG 3AO2A 1XHZA 3SQ1A 3FR0A 2YHYA 4IKFA 1DEJA 1MU2A 2A1RA 4DV6K 3QNOA 3TAPA 2QW9A 2EX3A 4FCYA 2F7TA 3S3NA 3MEDA 2GELA 1Z6RA 2QWPA 4DR2K 4FWPA 1NK9A 3LP0A 3BP8A 1EETA 4XH5A 2E1YA 1HKBA 5DK5A 1J9AA 1R59O 2Q97A 1BDGA 3FZHA 4JKGB 3GOIA 3TAMA 4KB0A 4CHYA 1XNRK 3EE8A 4LSNA 4DTXA 4A61A 2CGLA 4PL7A 1L3VA 3VF6A 5HP1A 3VQ5A 4FWOA 2FSJA 2P9KA 4Z4HA 3E01A 4JS4A 3V9ZA 4IWVA 4CEQA 3ULEA 3WXMB 5SWMA 5AQJA 3HPOA 1RT2A 1OVQA 3BY5A 3RSEB 4CBUA 4E7KA 2NZTA 3CPEA 3VF4A 4CW7B 2HHVA 4EAHD 4HUFA 3NVKA 5AQOA 2AA4A 1S6PA 3VEYA 4YY3K 1KVBA 1NM1A 4FYDA 2YNIA 1JCFA 3KHYA 3KZBA 3CMEN 1HQUA 4LC9B 1VQ4N 4CEDA 4WQ4C 3PY8A 4M63C 5J2MA 4BGAA 2YNFA 2QTDA 2FBTA 4CF2A 4M45A 2AP1A 1T44A 3T19A 2HF3A 1YIJN 5AQSA 1RT3A 3LAMA 3LDNA 2WC9A 5FPMA 2FBVA 3ALYA 5DMRA 4AM7A 2YV0X 4BG9A 4E1NA 4DFPA 2P9PA 1C0FA 3VEVA 4DQIA 2NRHA 1KD1O 3AY9A 3DRPA 4LF8K 2PBDA 5BRDA 2WUSA 3WUHA 4GY2B 3SMPA 3C7NA 3DAWA 3LDOA 2A1SA 3QLHA 4IFEA 1XI1A 4CJRA 5CYQA 4ID1A 2E88A 3N4PA 3P39A 2ZD1A 3PIOL 3K57A 3ZSQA 5CHIA 3OYAA 4U7BA 5AQNA 1J5EK 1H1VA 3HM9A 4H5RA 1QVFM 3PX6A 2KKZA 3HP9A 2YNGA 3TARA 3MX2A 3C6UA 3CCSN 1KFSA 4FZZA 4FM0A 2QWQA 2ZGZA 1BA0A 1ZBFA 4H4OA 4B3RK 3O6WA 5C25A 5FROA 3WEEB 4JKFA 3MXMA 3AVAA 4B08A 1IKVA 4IJAA 1IBKK 3UB5A 4DB3A 3FFKB 2GBZA 1TL1A 4QCLA 4X62K 3CG7A 4DTSA 3V9SA 1O13A 1YAGA 4DSKA 3ZSXA 1NJWA 4JEPA 1SUQA 3QERA 4H5TA 1VQLN 3CM6A 2QXFA 4OO1J 3VERA 2VG6A 5CR4A 1S6QA 2F9WA 3HTVA 2OPQA 4DV4K 4BG8A 1A5VA 3NF6A 3TWHA 4KB1A 2G8UA 4DV2K 3NF7A 4H0YB 3LDPA 4GV6A 1NGEA 4E7HA 5AZIA 4J2BA 2XY8A 1J6ZA 3KLFA 4BR4A 3V9XA 5C42A 1VK0A 3DLGA 3THYB 4B9LA 5BPMA 1K8KB 4CIEA 4DR1K 2O8BA 1GLBG 1BWFO 3VOVA 3H1QA 4FOEA 4FWMA 3IG1A 5DM7L 3LZIA 4I7FA 3PSFA 3VQEA 4FJ9A 3L8BA 1M90O 3D2FA 4DSEA 4KHYA 4RCHA 1S72N 3EY1A 2E6MA 1SKRA 4FZXC 4RW9A 4DTUA 3S41A 3WQTA 1NMDA 1NK7A 2Z1HA 2ETJA 1WSGA 3P31A 3LM2A 2FF3B 1O1WA 3G4SN 3NHGA 5GAGP 1ASUA 1ZBSA 1RFQA 1A5WA 5M1OA 1QHAA 1SKWA 1Q8IA 3MDQA 5KTQA 1VSEA 4X66K 1BQMA 2VG5A 1C0GA 3VQCA 1S22A 4BRPA 3V1OA 1B92A 3O9RA 3H6EA 1K73O 1JLFA 1W0HA 3CQXA 4JHDB 1D9FA 2Y1JA 4CJQA 3AVBA 3UKRB 3I33A 2DTUA 4OKJA 3CJCA 4JI7K 3EZ5A 4DU4A 3V6DA 2Z1IA 5AJ3K 2OPSA 4K0KK 4KHPK 2HF4A 4OGEA 4PKIA 5AQZA 3KLHA 4DUZK 3SQ4A 1QQNA 1S1WA 3OA9A 5H1SQ 4GKJK 2FLOA 2E8AA 1J5OA 4HUEA 4BRMA 3ZT2A 2CGJA 3AARA 3DM2A 5LJVA 5GINA 2WTUA 3GE1A 2GUIA 2LSNA 4BWMA 2A41A 2Q31A 4FWLA 2IVNA 3HBTA 5KRTA 1Q86O 3HSTB 1GOBA 3PO5A 1GLFO 1S1TA 1NJZA 5AQGA 3CI5A 2YNHA 4PY5A 3B6OA 4RW7A 4BRGA 2VG7A 4WQ4A 4CEBA 4I9QA 1YHQN 2ITGA 1HJRA 3B8AX 4R79A 4YFUA 4FK4A 3VQDA 3OYCA 1RBVA 4CBWA 5AQVA 3F73A 5J2QA 3AVGA 1SQKA 1XMQK 4FWQA 2NNWA 3IKMA 3VQQA 4CEEA 3LWLA 3T1AA 1TKXA 1L3TA 4LH5A 2X6SA 3KVGA 3C6HA 4JI0K 4IOXA 4I2QA 1U4BA 3AA2A 3SUQA 1K6YA 1NGBA 3WXIA 4FWRA 4FLTA 2QXLA 4BREA 1ATRA 4F4KA 1HKGA 3FZFA 4QS7A 4IFYA 5I9EB 1ITGA 1TL3A 4FJNA 1QVGM 4Z0UA 4W5QA 4J2DA 2Q0UA 3GL1A 1QSYA 4IXCA 3ZX2A 4LFAK 4FLZA 4KFBA 3CMAN 3D2EB 5GAHP 4CZHA 4DFJA 1QHTA 1BISA 3FGUA 4CZLA 3VETA 1ZBHA 1VQNN 3TAQA 3VEXA 1BOTO 1X1PA 4E1MA 4KHQA 1G99A 2FC0A 1EO1A 4O0IA 1NLVA 4JI1K 4FK0A 4BDZA 1E4GT 3LAKA 3L0QA 1EP4A 3THWB 3KLEA 4KO0A 2KFZA 1U04A 2KTQA 5LMNK 4JS5A 3Q7CA 3ZT0A 4JI8K 4BQLA 2IC3A 3U3YA 1YVUA 4CZKA 2UXCK 1NOYA 3CYMA 1J54A 5C24A 4JKDA 2QWLA 3HOTA 3NF9A 1B9FA 4MQ3A 3SJJA 3P38A 1IKWA 3R8EA 4B3SK 3OYLA 1W7AA 4CERA 1NBWA 1OH7A 2ZF5O 2HHWA 4GW6A 3K2PA 4LD0A 4N5SA 3CM5A 1UOCA 3J7YP 4ISFA 2P9KB 1WSIA 2X78A 1CZBA 3ULEB 3CHWA 3NGZA 4CGGA 3CCRN 4EHTA 3M6GA 4O0JA 3DLHA 3BZKA 2VYPA 1KQSM 2PYLA 4FO0A 2KW4A 5IWAK 4CJEA 3KKSA 4DS5A 5JVHL 4B9TA 4QOZB 4LFCK 1W9HA 5AQUA 2IS3A 2JWLA 4FW2A 1U6ZA 2A5XA 3SZ2A 3OYHA 4AF1A 2HHTA 4ILGB 5BREA 1WUAA 1B9DA 1REVA 4F2RA 4CJLA 1WNSA 3QIOA 3H46O 1KLNA 3DXKA 4CHNA 3T1YK 4Z4FA 2RKIA 4KHUA 3SQ2A 1DKGD 5GADP 1S1UA 4W5RA 4KH6A 3CJ7A 3OY9A 3NAEA 4KTWA 4RW8A 4R5PA 5C2FA 1TK0A 2DFHA 5E41A 3J7ZO 2P9PB 5AFUH 4CFDA 3O8MA 2B6AA 3E9PA 4CJ3A 1HNVA 5E26A 2IDOA 3V1QA 4XH4A 4F9OA 4IO9L 4CJFA 3AVJA 4FK2A 1HX1A 2I7NA 3C7NB 4H0OA 3L2VA 3DLEA 1YJWN 3VTHA 3U3GA 1BI4A 4V19S 3AVMA 4JD2B 4Z4GA 1D8YA 5CYMA 4F3OA 1WSJA 3DXMA 3G0ZA 3PX4A 2D0OA 3IDHA 4M3XA 4DU3A 1TYQA 1YTAA 1T6DA 4ILHA 5SZTA 2HMIA 1CXQA 1NK4A 4K8XA 5AQWA 3EEQA 3AA5X 3O4WA 1BCMA 1P90A 1KRPA 1OH6A 3CFPA 3J81O 4M3YA 2IOCA 3S9HA 1C0MA 3NGYA 3H08A 4H8KA 4CJ5A 3BDPA 4KI6A 5KGWA 3ENOA 3NBPA 1E4FT 2F9TA 3K9JA 1KXPA 4FLUA 1WSEA 1JXEA 1Q7YO 3SMSA 2PFUA 4FJGA 4HCBA 2E5LK 4JI2K 4M3WA 3SAGA 4N56A 4KTZA 4W5NA 3R6MA 4BDYA 3O3GA 3OJUA 1T7PA 4BWJA 3BF3A 5HOOA 3LL3A 3WNEA 4WFAL 5KQDA 3S3OA 3JSMA 1LW2A 2HBMA 2VCPA 2QKKA 5LY3A 3ZSYA 5AZIB 3MWTA 2RHKA 1JCEA 3THWA 3CC2N 1Z26A 2BANA 4Y1CA 1RDCA 3KTQA 4DG1A 3EYZA 2BE2A 4FJ8A 4A5BA 4B9SA 3ZX0A 2I5JA 4F8RA 4FM1A 3W3DA 3O4NA 3C6AA 2O8BB 1HYVA 4OJRA 3CQ8A 3G25A 2GWKA 4C1NI 5GIOA 3H3NO 3MCPA 4DQSA 3KK7A 3MN5A 3D2FB 4H0XB 4CZGA 1VAZA 1VSLA 2BH1A 2X74A 4CHZA 2UUAK 3OVNA 4K25A 2W42A 4MLEA 1LV5A 4HVJA 3AAPA 4OPJA 4FVUA 2BUPA 1Z25A 2P1JA 5FRNA 1N33K 4JK9A 3E1YA 4DHYA 4BE2A 2NRTA 2PZSA 4AM6A 1JLCA 2OZMA 3G10A 5HRNA 3LALA 5C2DA 3MXJA 2ZM6K 4HTLA 4CFBA 2F8SA 4NO7A 1VQKN 5HRPA 3MECA 3LZJA 3OBWA 4DS4A 5M1NA 2XO7A 1NK8A 3R1XA 1WOQA 5TKWA 3GBTA 3LPUA 3MMVA 4BR2A 4FLYA 3V9UA 1YI2N 4DLEA 3CCLN 3AAQA 4K43A 2HOEA 4UY8O 3ZEUB 4M3UA 4E1JA 4JK8A 1ZBLA 1FKPA 4BE1A 2G8IA 4CHPA 2O8CB 1G15A 4WYBA 1JXBA 4CZIA 3V9WA 4CD3A 4DTMA 3DLLL 3AVHA 2FBXA 3LPTA 3ISNC 3MAQA 4H0TB 4DMNA 1CLQA 2P5OA 3OYIA 1D9DA 3QDKA 4OPHA 1QQMA 3TTFA 1YT3A 4DR5K 5BN9A 1NNEA 2XY6A 4AQYK 1X9JA 1WBDA 3L4IA 4B3TK 3QBWA 3P83D 4DSJA 1D5AA 5HRRA 2OYQA 3UKUA 2YHXA 5JS2A 1RTJA 3QETA 1NGJA 2H3GX 4AHTA 1N6QA 4LF7K 3RWUA 4KRFA 4JD2A 4FLVA 3PLAA 2W6KA 3QBXA 4CESA 5JVGL 2VWJA 4DQ8A 2NRZA 3BZCA 1I3AA 2DY4A 3BF1A 1VSMA 4BDPA 3NH0A 5FPDA 1DTTA 2NRRA 5M1KA 3K5LA 1NJXA 1V4SA 2BDPA 4DR7K 1GLJO 1YUWA 5BRFA 5ADXH 3C94A 2VQEK 4GV9A 4LH4A 3H45C 4BC2A 1RBRA 3TR8A 2Q0RA 5A2QO 3THXA 3SLCA 3V81A 3I0SA 4CFAA 5J1EA 1RT6A 4JI6K 2E2OA 3BUZB 3F9KA 2CGKA 3T1HK 4CBXA 3RR8A 3SAHA 2WONA 4CHQA 3QEWA 1VQ5N 3CCMN 1OKJA 4YORA 3J7AP 3P4IA 2DPNA 4A2BA 3CPWM 1UA1A 5CY4A 4CGFA 3CXCM 4C8LA 4W5OA 3F5TA 3V4IA 5JS1A 1KFDA 2HSTA 3WNGA 2Q2RA 2XY7A 1KSPA 1GLEG 3HRGA 2OANA 3NVMA 1QSSA 3R9PA 1WBBA 2V52B 1NK6A 3MN9A 4F2SA 1EX4A 2YJEA 3VA0A 4E7JA 3HXMA 3OYMA 4CK2A 4J2EA 3HM8A 4CJ7A 2OCEA 5HL7L 4FWNA 1SKSA 3SNNA 3BGRA 3WT0A 3KD1E 4CEZA 1RDAA 2GTDA 4FJKA 3L6QA 2ZQBA 1S9EA 3NE6A 4BRNA 3DJCA 3KK3A 2ZJRL 1N8RO 4FVMA 3KWIA 2VWBA 4NB4A 4KBOA 4J2AA 3VQPA 1YF5L 5AQQA 4CJKA 4MO4A 4B1ZA 2JWKA 2O8FA 2P9LA 3OYEA 1GLCG 1RCHA 1YITN 4HCCA 5DM6L 1P8ZA 1MWMA 3OS0A 4NCAA 3E66A 1WSFA 1NKCA 4WF9L 2G8WA 2UU9K 3ZYYX 4B1XB 3E9LA 3M5RA 3WNHA 1LWFA 3SUPA 1HKCA 3MWPA 1S9GA 1WAJA 4OGCA 3D0PA 3SK3A 3HVRA 4H0PA 4BRLA 3TAEA 2P9SA 3SBTA 3R3LA 3HOSA 4DUYK 1KC8O 2WOMA 2YHAA 1ZBUA 3VF2A 4DSLA 2ASPA 3A8YA 4AHRA 2FF6A 4A59A 1TKZA 5LMUK 3VGLA 4CJVA 4LF9K 4G9ZA 1GLAG 1TAUA 4HUGA 3ZEUA 1RT7A 3DXKB 2HMPA 2UXDK 3O9SA 4L3QA 2G8FA 2O8CA 4IOCL 2FBYA 2IGIA 4FJJA 4CZEA 4KI4A 1SZ2A 4DTOA 4Q5VA 1VSFA 3ZSZA 2A6AA 1HNXK 4E0DA 2NUBA 3O08A 5C12A 4EZ6A 2P9NA 4KHWA 2YI1A 3EN9A 1CZAN 5BN8A 4ELTA 3VQAA 2O4IA 3JS6A 1BI4B 3OYGA 4KAZA 1RGIA 4CEFA 3DLBA 2G8HA 3DXMB 1SV5A 4BR5A 3DWLA 1TYQB 4JI3K 3TTCA 2E6LA 2KHOA 4WE1A 4E7IA 4IBNA 1IKXA 1Q81O 1OH8A 1S5JA 4CJWA 4BY9C 1QS4A 3LWMA 4EP4A 2IVPA 2J4RA 1U48A 3QMLA 1RDBA 4C8OA 4DQQA 2G8KA 4BVPA 1LWEA 1ATSA 3ZLJA 4YDUA 1XC3A 4YOVA 3VTIA 3I8DA 4BVOA 2XY5A 2D5RA 2OTJN 4FLXA 3DLRA 4DV5K 4KKOA 1U2VA 3MN6A 4NYFA 4X64K 4ZHRA 3J80O 1SL0A 4JV5K 1DLOA 4J8FA 4IOAL 4CF9A 1GLLO 4IDKA 1UAXA 4CZMA 4DTNA 3C6TA 2OPRA 3ZSRA 2YJFA 1C1BA 5AQPA 3DI6A 4ID5A 4F3TA 2W40A 2QK9A 2AJQA 3TAFA 3SPYA 4DR6K 4KPYA 3K5NA 3UE5A 4PUOA 2IAJA 3P5JA 2KZMA 4CJTA 4H4MA 3I8BA 4NXMK 4B8CA 4B3OA 3VGMA 4ZTJA 3O9UA 4GMJB 5AQFA 3CCUN 2OTLN 4BC3A 3KKRA 1SL2A 5CE3A 5FPNA 3RRHA 3LM9A 2BTFA 3ULDA 2ZWHA 2Z1JA 1K8AO 4O5BA 3HVTA 4DV3K 1NK0A 3AO1A 3O80A 4CZFA 4CIFA 2ZE2A 1ZC6A 3IRXA 2HVHA 1YJNN 2VGNA 5KQ8A 1IH7A 1BL3A 4JK7A 5BR9A 4QS8A 2Q1NA 3EL2A 1BQNA 1BG3A 3TANA 5M1QA 3SBGA 4IFVA 4M42A 4IZ9A 4G1QA 4M7XA 3NMUA 2P9UA 3N4QA 2BGGA 1SS6A 1E3MA 2KQ2A 3QEIA 1VSIA 1XNQK 3HSCA 3ZSOA 2ITMA 2VGMA 4RW4A 2A42A 2DFFA 3VMFB 1Q18A 1T3VA 3ITHA 4NYNA 4XIUA 3DYAA 3NDKA 2RE2A 2FXUA 4ELVA 4MDAA 4A2AA 3OS2A 4CI6A 1X9MA 3KJVA 4YOTA 2EHGA 4IJNA 3KLIA 5EU7A 1KVCA 3CFOA 1N5YA 3K59A 1WN7A 5ELZA 4B9NA 3SAFA 1W97L 4CK1A 4L8RB 2HNZA 3WXKA 2E1ZA 4EP5A 1NK5A 3C0BA 2O4GA 4LF6K 3EZWA 3U9ZA 1BIZA 3VESA 3FFIA 4DU1A 3TU5A 3M1FA 1T05A 1LCUA 1X9SA 2HBKA 2V7ZA 2GUPA 3K5MA 3KLGA 3H1VX 4OX9K 3EKUA 3ZX3A 1BGXT 4FJLA 3UKUB 4C23A 1TV6A 5T7BA 4BC5A 4C8MA 4E3SA 1ZXOA 3I0RA 2RPIA 3OBYA 2NRVA 2UUCK 4EZ9A 4MFBA 1HUXA 4YOWA 2HB5A 4BACA 3HL8A 3EE9A 4NLBA 5CZ2A 3ZETB 3CQYA 3OYBA 2V51B 2NRXA 3HPHA 5F0XA 4O8UA 3RVCA 2GV9A 4CF8A 1HR0K 3K5OA 4PWDA 5GAEP 4ISGA 2NLXA 4CFCA 4E19A 4JLHA 3E9OA 3VN5A 3LDLA 4OPAA 5K14A 1KLMA 1WAFA 2YCHA 3L2RA 5AFUA 5M1FA 5AQYA 3RMAA 1TUYA 4CHOA 3THXB 3U4LA 3RTVA 1C6VA 3ZCMA 4WFBL 3ZT3A 1NOZA 4AHCA 1QZ5A 2GX9A 5HBMA 3OYDA 2I7PA 4CGJA 3LP1A 3CFRA 4CIGA 1BUPA 1VRUA 3DRRA 2UUBK 1NWKA 2F96A 4DV7K 3U9DA 3ATUA 4FZYA 2B4JA 2CH6A 1EKEA 4QAGA 3SUNA 4GVMA 3JXUA 3AVKA 3FZKA 3JAMO 2A3ZA 3RMCA 1LWCA 4LY7A 2Y1IA 1C0TA 3WXJA 1HJOA 1XC9A 2Z1GA 3QNNA 4KHSA 1QE1A 4GNIA 4FLWA 5D3GA 1ILYA 4KTQA 4ZTFA 4JRPA 1L3UA 2D4WA 5FLXO 4BRFA 1Z05A 1N36K 4KREA 1TKDA 3FZMA 4ELUA 1CZ9A 4HWIA 4IEEA 2O8FB 4YHHK 2P9LB 4B9MA 1QQOA 2UXBK 3PX0A 4W5TA 4M3TA 5CZ1A 1N34K 5IT9O 3IFRA 4CJ4A 4OKEA 4KH4A 3MN7A
chains in the Genus database with same CATH topology
4FWQA 5C15A 2NNWA 2HSTA 3IKMA 5AZJA 2P9IB 2Q2RA 1XUPO 3D7EO 3KVGA 1GLEG 3HRGA 3C6HA 2FSNA 5BPLA 2OANA 3NVMA 3M3ZA 4IOXA 3U8XA 3VGKA 3R9PA 1NGIA 1NGBA 5EVZA 2V52B 3WXIA 3MN9A 1KAYA 1X3MA 2YJEA 4FWRA 2P9SB 4A62A 5BRHA 2QXLA 4CD1A 3QFUA 3HM8A 3L4QA 4CJ7A 4BREA 1HLUA 1ATRA 2ASMA 4PKHA 5HL7L 1JJ2M 4FWNA 1HKGA 3FZFA 4QS7A 3WT0A 1NGGA 3WXLA 5I9EB 3A5LC 5JICA 2GTDA 4O8KA 1QVGM 3VEZA 2Q0UA 1OVYA 3GL1A 3L6QA 4IXCA 1VQPN 3CJ1A 4BRNA 3DJCA 3ZX2A 2ZJRL 1N8RO 4NB4A 1T6CA 2VWBA 3KWIA 1Q82O 4FSVA 4KBOA 3CMAN 3D2EB 1YF5L 5AQQA 4RTFD 4CZHA 3A5NC 4B1UB 5GAHP 4MO4A 2QWNA 4B1ZA 4IDHA 4YOUA 2JWKA 3FGUA 1VQ9N 2P9LA 3VETA 4FWSA 4CZLA 2D0PA 4JKBA 4XEIA 5E84A 1GLCG 1MWKA 1YITN 1VQNN 3VEXA 1XQSC 1P8ZA 1BOTO 1MWMA 5JLHA 5DM6L 4C1NK 4BRIA 1G99A 1D4XA 2E2NA 5KPTA 2ZJPL 3E66A 1EO1A 2E2PA 1NLVA 3D6RA 5EOYA 4WF9L 3MCAB 3T7ZA 1ATNA 1E4GT 3ZYYX 4JAXA 1ESVA 1RDWX 3L0QA 2IIRA 2P9NB 4B1XB 3E9LA 3M5RA 5AQLA 5MLCQ 4BC4A 4B9QA 3GG4A 3I55N 1X3NA 1HKCA 2ZGYA 3MWPA 5JMVA 4ILJA 2A40A 3Q7CA 3SK3A 2HBJA 4BQLA 4DHYA 1VQ7N 4GV3A 1QZ6A 3TSQA 4H0PA 4BRLA 4CZKA 1DT9A 2P9SA 1NJIO 3SBTA 3QB0A 3R3LA 3HOSA 1KC8O 3O5BA 4YDUC 4JNEA 5C0YA 3ENHA 4K42A 4JKDA 2KLAA 2QWLA 2WFBA 3HOTA 3A0IX 3VF2A 1NGFA 1M1KO 2ASPA 3A8YA 2FF6A 2QM1A 4A59A 5F1XA 2HBLA 3HZ6A 3VGLA 3LDQA 1EQYA 3J8AA 1BO5O 4G9ZA 1GLAG 3P38A 3R8EA 4KH5A 4BRKA 2W41A 2QI2A 3ENBA 3ZEUA 1W2BM 3QFPA 3ZETA 4BRAA 5EY4A 3D2EA 3DXKB 2HMPA 1MA9B 3CC4N 2QEXN 1NBWA 2ZF5O 3O9SA 4L3QA 4O5FA 1IJJA 1YXQA 3CIPA 4FOIA 4IOCL 3F2KA 2WBNA 2ZJQL 1VQ6N 1BU6O 5JLFA 4JKHA 4K41A 2E20A 4CZEA 1U2VB 3VPZA 4B1VA 1SZ2A 3EO3A 3VEOA 3CCVN 1NGHA 4QS9A 2A6AA 4ISFA 5BPNA 2P9KB 4U67L 3I56N 3O08A 5C12A 3F9MA 1RDUA 5LJWA 1Y64A 3ULEB 2P9NA 2V7YA 4GVEA 5GIPA 2YI1A 3EN9A 1CZAN 5BN8A 3CHWA 3AGRA 3C65A 4H5VA 1GLDG 3CCRN 3JS6A 4EHTA 3OW2M 3M6GA 1VQ8N 1RGIA 3FR0A 1NGCA 2YHYA 2VYPA 3WQUA 3DXMB 1DEJA 4IO8A 1KQSM 4FO0A 4Z94A 4BR7A 4BR5A 3DWLA 3W0LA 4BGBA 1TYQB 2QW9A 3TTCA 2KHOA 5JVHL 2F7TA 2GELA 1Z6RA 2QWPA 5AQUA 4MLHA 2JWLA 1U6ZA 4FWPA 2A5XA 4PL8A 1Q81O 4NLCA 3BP8A 4YOXA 3O1WA 4XH5A 4AF1A 2E1YA 4BY9C 4ILGB 4FPAA 2IVPA 5BREA 5FPEA 2J4RA 1HKBA 3QMLA 1WUAA 2FSKA 3CCQN 1BA1A 4MO5A 1R59O 2IVOA 4BVPA 3H46O 1ATSA 2Q97A 1BDGA 3FE1A 3DXKA 3K9KA 3FZHA 4YDUA 1XC3A 5M1PA 3VTIA 5ADXA 4YOVA 4JKGB 3G71N 3GOIA 4BVOA 1DKGD 4EIAA 5GADP 2OTJN 4CZJA 3EE8A 4KH6A 5F2RA 3CJ7A 4A61A 2CGLA 1U2VA 3MN6A 4MDBA 5C2FA 3KWGA 4PL7A 3AGKA 4J8FA 3VF6A 3J7ZO 2P9PB 4IOAL 5AFUH 2D1KA 4FWOA 1GLLO 3O8MA 2FSJA 3E9PA 3CERA 4I6MB 2P9KA 5E26A 4IWVA 4CZMA 4F9OA 4XH4A 4IO9L 3ULEA 3WXMB 2YJFA 5AQJA 1HX1A 2I7NA 3C7NB 4H0OA 5AQPA 2EWSA 3VTHA 3RSEB 4CBUA 1KAZA 1YJWN 2NZTA 2W40A 4WQ5C 3CPEA 3VF4A 4JD2B 2P9UB 4H0VB 4EAHD 3DXMA 2D0OA 3IDHA 1TYQA 5AQOA 3UE5A 1T6DA 3NVKA 2AA4A 3O9QA 4ILHA 3VEYA 3I8BA 3VGMA 1NM1A 3O9UA 5AQFA 2P9IA 1JCFA 3KHYA 3KZBA 1VQMN 5AQWA 3CMEN 3CD6N 3CCUN 4LC9B 2OTLN 4BC3A 1VQ4N 4WQ4C 5CE3A 3O4WA 4M63C 5FPNA 3LM9A 4BGAA 2BTFA 2QTDA 1P90A 2ZWHA 3FZLA 2AP1A 1T44A 1KAXA 3CJBA 4JKGA 5C10A 1K8AO 2HF3A 1YIJN 5AQSA 4BROA 3ENOA 3O80A 3LDNA 2WC9A 5FPMA 4CZFA 2GEMA 1E4FT 2F9TA 3K9JA 1NGDA 1KXPA 1ZC6A 1YVNA 4AM7A 4BG9A 1YJNN 2VGNA 1Q7YO 5KQ8A 4JK7A 3SMSA 5BR9A 3PIPL 4QS8A 2P9PA 2PFUA 2Q1NA 4DKWA 1C0FA 3EL2A 3VEVA 2NRHA 3SAGA 1KD1O 3AY9A 1BG3A 5M1QA 3SBGA 2PBDA 5BRDA 2WUSA 3WUHA 4GY2B 4IZ9A 1SAZA 3C7NA 3DAWA 3LDOA 3R6MA 4M7XA 4IFEA 4XH1A 3SMPA 5M1FA 3NMUA 5KPRA 2QWMA 3RSEA 4WFNL 3BF3A 2E88A 3N4PA 5HOOA 3P39A 3LL3A 2GWJA 4BR9A 3PIOL 2P9UA 5CHIA 3N4QA 4WFAL 4U7BA 3OHRA 1SS6A 5AQNA 5KQDA 1H1VA 3TSPA 3HSCA 2ITMA 2HBMA 4H5RA 2VGMA 2A42A 2VCPA 1K9MO 1QVFM 5LY3A 3SJHA 4BR0A 2KKZA 3VMFB 1Q18A 5AR0A 1T3VA 3MWTA 2RHKA 5AZIB 1JCEA 4H03B 2RE2A 3MX2A 3CC2N 3CCSN 3VENA 2FXUA 3G6EN 3EKSA 4FWKA 4MDAA 4A2AA 4DCHA 4A5BA 3ZX0A 4CI6A 2QWQA 2ZGZA 4B1YB 4YOTA 4FL9A 3W3DA 4IJNA 1BA0A 3C6AA 3ID8A 4EHUA 3A5OC 3MX5A 5ELZA 3O6WA 5AQRA 3SAFA 3WEEB 1W97L 3O1BA 3G25A 4BRQA 4JKFA 2GWKA 4C1NI 5GIOA 1YJ9N 3H3NO 3MCPA 2YHWA 3WXKA 3KK7A 2E1ZA 3MN5A 3D2FB 4H0XB 4CZGA 4IJAA 3UB5A 4DB3A 3C0BA 1VAZA 2BH1A 3FFKB 3EZWA 3CJAA 4K25A 3U9ZA 1O13A 1YAGA 4MLEA 3VESA 5EXWA 3ATVA 4JEPA 3AAPA 4H5TA 1VQLN 3TU5A 3M1FA 4OO1J 3VERA 4FVUA 2BUPA 1LCUA 5CR4A 5KPZA 2F9WA 3E1YA 3HTVA 4JK9A 2HBKA 2NRTA 2GUPA 2V7ZA 3MK6A 4AM6A 5B8HA 4BG8A 1TUUA 3H1VX 3HI0A 3EKUA 3ZX3A 4JKAA 5C2DA 3A5MC 4H0YB 3LDPA 4GV6A 4RWTA 1NGEA 4HTLA 3UKUB 1NGAA 4C23A 3CCJN 5AZIA 3O9TA 4NO7A 1VQKN 3TPQA 1J6ZA 3OBWA 4BR4A 3CETA 1MDUB 1HPMA 4IEIA 5M1NA 4BC5A 1WOQA 3R1XA 3GBTA 1ZXOA 3MMVA 5TKWA 4BR2A 3OBYA 2NRVA 1YI2N 4ISEA 4M7YA 1HUXA 5BPMA 4YOWA 3CCLN 1K8KB 3AAQA 1GLBG 4K43A 3EE9A 1BWFO 2HOEA 4NLBA 3VOVA 3ZEUB 4UY8O 3H1QA 4FOEA 3ZETB 4FWMA 3WEEA 4E1JA 3CQYA 4JK8A 5DM7L 2V51B 2NRXA 5F0XA 4O8UA 3RVCA 4BRHA 4WYBA 4CZIA 3TTDA 1M90O 3D2FA 4RCHA 4CD3A 5GAEP 4JKCA 1S72N 3DLLL 5AQKA 4ISGA 2NLXA 3VEWA 3S41A 3WQTA 1IG8A 3E9OA 2CH5A 1NMDA 4H0TB 3BEXA 3LDLA 4OPAA 4Y0WA 3P31A 3IUCA 4A57A 3QDKA 2YCHA 3LM2A 1QQMA 4OPHA 2FF3B 3TTFA 2E2QA 2Q36A 4FPBA 5AQYA 4PHTX 1TUYA 5GAGP 1ZBSA 1RFQA 5M1OA 3G4SN 1QHAA 3MDQA 4PKGA 3U4LA 4WFBL 3H3OB 5BN9A 1QZ5A 1C0GA 2GX9A 1S22A 4BRPA 1X9JA 2I7PA 3L4IA 4JKEA 3O9RA 4I6MA 3CC7N 3QBWA 4H5NA 2QA4N 3H6EA 1K73O 3UKUA 1BUPA 3CQXA 2YHXA 4JHDB 1JCGA 4WCEL 1NGJA 1NWKA 1V4TA 2H3GX 4YOYA 3UKRB 3U9DA 3ATUA 3I33A 2CH6A 5AQIA 5AZJB 4JN4A 4JD2A 4BRCA 3CJCA 3T69A 3PLAA 3JXUA 3QBXA 5AQTA 3FZKA 2QWOA 1K8KA 2NRWA 5JVGL 2A3ZA 2HF4A 4PKIA 5AQZA 2NRZA 4DQ8A 1QQNA 3OA9A 5H1SQ 5TKYA 3BF1A 1VQON 3CCEN 3WXJA 1HJOA 2FLOA 4WQ5A 2E8AA 5FPDA 4BRMA 2CGJA 3AARA 2NRRA 5LJVA 5GINA 4GNIA 3GE1A 5M1KA 1V4SA 5AFUA 2ASOA 2A41A 1GLJO 1ILYA 1YUWA 2Q31A 1LOTB 4FWLA 5BRFA 5ADXH 2IVNA 3HBTA 5AQHA 5EX5A 1Q86O 2D4WA 4H5WA 4BRDA 4GV9A 4BRFA 1GLFO 3GDQA 3H45C 4BC2A 1Z05A 5AQGA 3CI5A 4B1WB 3CF5L 2Q0RA 3TSUA 3ID6A 3FZMA 3SLCA 4BRGA 4WQ4A 4HWIA 5AQXA 4IEEA 4A5AA 2P9LB 1YHQN 1QQOA 1DGKN 2UYTA 3IMXA 2E2OA 3B8AX 3BUZB 2CGKA 4CBXA 4EFHA 4R79A 3SAHA 1VQ5N 3Q7BA 3CCMN 5AQMA 4CBWA 1OKJA 4YORA 2QWRA 3QICA 5AQVA 3P4IA 2DPNA 4A2BA 4BQZA 3CJ9A 3IFRA 2PAVA 2YX6A 4JHDA 3CPWM 1SQKA 1S3XA 3CXCM 3UKRA 3FLCO 4KH4A 3MN7A 3F5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWG A;  3O9Q A;  3EE9 A;  3KWI A;  3M5R A;  3P38 A;  3O9U A;  2GX9 A;  2KKZ A;  3OA9 A;  2RHK A;  3RVC A;  3O9R A;  3O9S A;  3O9T A;  3L4Q A;  4OPA A;  3EE8 A;  3P39 A;  3P31 A;  4OPH A;  3D6R A;  3F5T A; 
#chains in the Genus database with same CATH topology
 5C15 A;  5AZJ A;  2PYJ A;  1L5U A;  2P9I B;  1XUP O;  3D7E O;  2FSN A;  3AVF A;  5BPL A;  1NGI A;  1IG9 A;  5EVZ A;  4JI4 K;  1TK5 A;  4DR4 K;  1X3M A;  2P9S B;  4A62 A;  5BRH A;  3L4Q A;  1HLU A;  2ASM A;  4PKH A;  1JJ2 M;  3KD5 E;  1F21 A;  1JLG A;  3AVN A;  3WXL A;  1NKB A;  3A5L C;  4CJP A;  5JIC A;  2VQF K;  3VEZ A;  1OVY A;  3AV9 A;  1T6C A;  1Q82 O;  4HTU A;  4RTF D;  3A5N C;  4B1U B;  3NGI A;  4IDH A;  2X6N A;  1VQ9 N;  1VRT A;  4JKB A;  3L2U A;  1EWR A;  1MWK A;  1L3S A;  5JLH A;  4C1N K;  4CCH A;  1N32 K;  4FJX A;  3HPG A;  4ICL A;  1UA0 A;  1FK9 A;  5KPT A;  5HRO A;  2ZJP L;  1RBT A;  2HND A;  3D6R A;  4OLB A;  1ATN A;  4GKK K;  1ZYQ A;  1RDW X;  2IIR A;  2P9N B;  3QES A;  5J2N A;  3O4Q A;  5MLC Q;  4BC4 A;  4B9Q A;  3GG4 A;  3I55 N;  1X3N A;  1IO2 A;  4LFB K;  3NH2 A;  1U49 A;  2A40 A;  4B9U A;  1FKO A;  3KK1 A;  4DV1 K;  3ZT1 A;  4GV3 A;  1QZ6 A;  3TSQ A;  1NJI O;  3DOK A;  4TSX A;  3QB0 A;  4OKK A;  3O5B A;  5I3U A;  4YDU C;  4JNE A;  5C0Y A;  4K42 A;  2KLA A;  2WFB A;  4OVL A;  1M1K O;  1RDD A;  2QM1 A;  3HZ6 A;  2O8E B;  1QSL A;  2PY5 A;  3J8A A;  1BO5 O;  4BRK A;  2W41 A;  3VQ9 A;  3QFP A;  3ZET A;  4BRA A;  4CEA A;  4IG3 A;  1RBU A;  3ZSV A;  3VQ6 A;  5BR8 K;  3MEE A;  3DRS A;  1EWQ A;  2ZJQ L;  1VQ6 N;  1BU6 O;  4DQP A;  4K41 A;  3OYN A;  3ZSW A;  1HQE A;  1U2V B;  3B6P A;  3O3F A;  3IAY A;  1Y97 A;  5BPN A;  3I56 N;  4U67 L;  5LJW A;  1Y64 A;  2ATQ A;  3PO4 A;  3AVI A;  1FJG K;  2YKM A;  4DLG A;  3AGR A;  3C65 A;  4H5V A;  3KK2 A;  1I94 K;  3LDS A;  3OW2 M;  1VQ8 N;  1NGC A;  1YTU A;  3WQU A;  4DSI A;  4IO8 A;  4Z94 A;  4BR7 A;  3W0L A;  4BGB A;  4C8N A;  3SYZ A;  1TGO A;  2HHU A;  1TK8 A;  3AO3 A;  4E7L A;  2RN2 A;  4MLH A;  3V1R A;  4PL8 A;  1S1X A;  4NLC A;  3WNF A;  3VA3 A;  4YOX A;  3O1W A;  1KTQ A;  4FPA A;  1XHX A;  5FPE A;  1JLB A;  3CCQ N;  1TAQ A;  2FSK A;  1BA1 A;  1BCO A;  4MO5 A;  1JLA A;  2IVO A;  4O4G A;  1X9W A;  3FE1 A;  3K9K A;  3U6F A;  5M1P A;  5ADX A;  1QTM A;  3G71 N;  4JI5 K;  3NF8 A;  4EIA A;  4B9V A;  1NJY A;  1HNW K;  4CZJ A;  5J2P A;  5F2R A;  1HYS A;  2O8D A;  4NCB A;  4NCG A;  4MDB A;  2Q3S A;  3KWG A;  4CJS A;  3AGK A;  3VQ4 A;  2D1K A;  3CER A;  4I6M B;  1C0U A;  1JL2 A;  4DF8 A;  4CF0 A;  1NU0 A;  3OYJ A;  3SV3 A;  2EWS A;  1KAZ A;  3OTO K;  1HYZ A;  3RR7 A;  1WLJ A;  4WQ5 C;  4RG8 A;  2XRI A;  2P9U B;  4LF4 K;  4H0V B;  4CGI A;  2KZZ A;  4CF1 A;  1C1C A;  4M3Z A;  3HO1 A;  5FRM A;  3O9Q A;  3AO4 A;  5HLF A;  3THY A;  3L2Q A;  1ASV A;  2YHB A;  3PSI A;  4KV8 A;  2P9I A;  3K58 A;  1VQM N;  3CD6 N;  1S1V A;  1C1A A;  3FZL A;  1TKT A;  1KAX A;  1WSH A;  3CJB A;  2HW3 A;  4JKG A;  5C10 A;  4BRO A;  3M8S A;  2GEM A;  4DFK A;  1NGD A;  3QO9 A;  4FJ5 A;  1YVN A;  4FJH A;  3PIP L;  4DWI A;  2HHX A;  4DKW A;  3AO5 A;  1TVR A;  3SUO A;  1VSH A;  3L3V A;  3SI6 A;  1R0A A;  2E4L A;  1SAZ A;  4CE9 A;  4XH1 A;  4CVN E;  5KPR A;  2QWM A;  3RSE A;  4WFN L;  1LAV A;  1RIL A;  4BR9 A;  2GWJ A;  3NCI A;  4I2P A;  3OHR A;  4FJI A;  1A5X A;  3TSP A;  4CJU A;  5HRS A;  1K9M O;  1QQC A;  3SJH A;  1U47 A;  4BR0 A;  1FXX A;  5AR0 A;  1HNI A;  2OZS A;  4H03 B;  1RTD A;  3OS1 A;  3VEN A;  2OA8 A;  4FJ7 A;  4N76 A;  3G6E N;  4B3M K;  3EKS A;  1RTH A;  4FWK A;  4DCH A;  4CGD A;  5I42 A;  4OPK A;  3PV8 A;  4JYA K;  3TAB A;  4B1Y B;  4FL9 A;  1JLE A;  3ID8 A;  3OYF A;  4CEO A;  4EHU A;  2HHH K;  3A5O C;  3MX5 A;  1HRH A;  5AQR A;  3DOL A;  2RF2 A;  3O1B A;  4BRQ A;  2R7Y A;  3HJF A;  1YJ9 N;  2YHW A;  2O8E A;  4DR3 K;  1RBS A;  3K0S A;  1RNH A;  1NMN A;  1JKH A;  3CJA A;  2DFE A;  1IBM K;  3JYT A;  3M8Q A;  4PQU A;  5EXW A;  3ATV A;  3L2W A;  3C95 A;  4DQR A;  5KPZ A;  4CEC A;  3MK6 A;  5B8H A;  3TAG A;  3DLK A;  1TUU A;  3LP3 A;  3HI0 A;  4JKA A;  3A5M C;  4RWT A;  4M41 A;  3CCJ N;  1NGA A;  3O9T A;  3TPQ A;  3CET A;  1MDU B;  1HPM A;  4IEI A;  1I39 A;  2JLE A;  1EXQ A;  3SPZ A;  3TI0 A;  2JGU A;  2B5J A;  2HNY A;  3RRG A;  4ISE A;  3T3F A;  4M7Y A;  4KHN A;  3HK2 A;  4N47 A;  4LSL A;  3M8P A;  4CK3 A;  1JL1 A;  4FW1 A;  5FDL A;  3WEE A;  2D0C A;  1VSD A;  3M8R A;  2OPP A;  4DSF A;  3HT3 A;  4BRH A;  3OJS A;  3TTD A;  3THV A;  4UQG A;  4JKC A;  5AQK A;  4DTP A;  3VEW A;  4JRQ A;  1IG8 A;  3QIP A;  2CH5 A;  1Q9Y A;  3BEX A;  4Y0W A;  1KVA A;  4Z4I A;  3IUC A;  4A57 A;  3ZT4 A;  2HHS A;  1T8E A;  2E2Q A;  2Q36 A;  4FPB A;  4PHT X;  4AIL C;  1RT1 A;  4X65 K;  4PKG A;  3H3O B;  4DV0 K;  2VWK A;  4IG0 A;  4FM2 A;  1VSJ A;  4JKE A;  4I6M A;  3CC7 N;  4H5N A;  2QA4 N;  3SV4 A;  4K8Z A;  1OH5 A;  1JCG A;  3QEX A;  4WCE L;  1GOC A;  1V4T A;  4YOY A;  4I9L A;  1NG9 A;  4N41 A;  5AQI A;  5AZJ B;  4JN4 A;  4BRC A;  3T69 A;  5AQT A;  2KFN A;  2QWO A;  1K8K A;  2NRW A;  3KIO A;  2HVI A;  1XWL A;  2HHQ A;  5TKY A;  1VQO N;  4DF4 A;  3CCE N;  1U45 A;  4Q0B A;  4WQ5 A;  2W6L A;  3D45 A;  1SL1 A;  4FXD A;  1JLQ A;  3SQ0 A;  2ASO A;  2D0A A;  4C8K A;  5KRS A;  1LOT B;  5AQH A;  1HMV A;  5EX5 A;  1XMO K;  1CXU A;  1FW6 A;  3IS9 A;  4H5W A;  4BRD A;  5KGX A;  3GDQ A;  2QKB A;  4B1W B;  4OLA A;  3CF5 L;  3NFA A;  3MEG A;  3TSU A;  3ID6 A;  1WB9 A;  5AQX A;  4A5A A;  3AVL A;  2P5G A;  1DGK N;  2UYT A;  1T03 A;  3IMX A;  3HYF A;  4PA1 A;  4EFH A;  3Q7B A;  5AQM A;  3AVC A;  3ASM A;  2QWR A;  3QIC A;  3DMJ A;  4Z4E A;  4BQZ A;  3CJ9 A;  4RW6 A;  2PAV A;  1RTI A;  2YX6 A;  4JHD A;  1S3X A;  3UKR A;  1BHL A;  3FLC O;  3LAN A;  1J53 A;  1HPZ A;  1BIU A;  3VQ7 A;  4E89 A;  3L3U A;  3U8X A;  3VGK A;  3M3Z A;  1KAY A;  1Q9X A;  3O3H A;  4HHT A;  1GOA A;  4CD1 A;  3QFU A;  4LF5 K;  1VHX A;  3A2F A;  1IBL K;  1NGG A;  3QIN A;  4O8K A;  2P51 A;  4O55 A;  5KI6 A;  1VQP N;  1IKY A;  3CJ1 A;  4O44 A;  4AH9 A;  4B8A B;  4FSV A;  4NXN K;  3LP2 A;  2G8V A;  2QWN A;  1UWB A;  4YOU A;  3NH1 A;  4FWS A;  4FJM A;  2D0P A;  4XEI A;  5E84 A;  3QEP A;  1XQS C;  1ZBI A;  1KCF A;  4BRI A;  4BE0 A;  1D4X A;  2E2N A;  3VQ8 A;  1IV0 A;  2E2P A;  5EOY A;  3AA3 A;  3MCA B;  1HNZ K;  3T7Z A;  4JAX A;  1ESV A;  3AA4 A;  1LW0 A;  2XHB A;  5AQL A;  4CGH A;  2F8T A;  2ZGY A;  5JMV A;  4ILJ A;  1LAW A;  1RT4 A;  2HBJ A;  1VQ7 N;  1DT9 A;  1DTQ A;  4DTR A;  3RMD A;  3ENH A;  3A0I X;  1ASW A;  1NGF A;  4M3R A;  5F1X A;  2HBL A;  3LDQ A;  1RT5 A;  3P1G A;  1EQY A;  1VSK A;  4AHS A;  2D0B A;  3HP6 A;  4KH5 A;  4DFM A;  3PUF A;  2QI2 A;  4YNQ A;  3ENB A;  1W2B M;  5EY4 A;  3D2E A;  4AHU A;  2F4V K;  3CC4 N;  1MA9 B;  2QEX N;  4O5F A;  4Z4C A;  4AHV A;  3OYK A;  1IJJ A;  1YXQ A;  3CIP A;  4FOI A;  2YKN A;  3F2K A;  2WBN A;  3RMB A;  5JLF A;  4JKH A;  4DTJ A;  2O8D B;  3QEV A;  2E20 A;  4Y1D A;  3VQB A;  3VPZ A;  4B1V A;  3EO3 A;  3VEO A;  3CCV N;  1NGH A;  4QS9 A;  3S3M A;  3F9M A;  1RDU A;  5LL6 Z;  1NKE A;  2V7Y A;  3MXI A;  4GVE A;  5GIP A;  3SCX A;  3UIQ A;  1GLD G;  3AO2 A;  1XHZ A;  3SQ1 A;  3FR0 A;  2YHY A;  4IKF A;  1DEJ A;  1MU2 A;  2A1R A;  4DV6 K;  3QNO A;  3TAP A;  2QW9 A;  2EX3 A;  4FCY A;  2F7T A;  3S3N A;  3MED A;  2GEL A;  1Z6R A;  2QWP A;  4DR2 K;  4FWP A;  1NK9 A;  3LP0 A;  3BP8 A;  1EET A;  4XH5 A;  2E1Y A;  1HKB A;  5DK5 A;  1J9A A;  1R59 O;  2Q97 A;  1BDG A;  3FZH A;  4JKG B;  3GOI A;  3TAM A;  4KB0 A;  4CHY A;  1XNR K;  3EE8 A;  4LSN A;  4DTX A;  4A61 A;  2CGL A;  4PL7 A;  1L3V A;  3VF6 A;  5HP1 A;  3VQ5 A;  4FWO A;  2FSJ A;  2P9K A;  4Z4H A;  3E01 A;  4JS4 A;  3V9Z A;  4IWV A;  4CEQ A;  3ULE A;  3WXM B;  5SWM A;  5AQJ A;  3HPO A;  1RT2 A;  1OVQ A;  3BY5 A;  3RSE B;  4CBU A;  4E7K A;  2NZT A;  3CPE A;  3VF4 A;  4CW7 B;  2HHV A;  4EAH D;  4HUF A;  3NVK A;  5AQO A;  2AA4 A;  1S6P A;  3VEY A;  4YY3 K;  1KVB A;  1NM1 A;  4FYD A;  2YNI A;  1JCF A;  3KHY A;  3KZB A;  3CME N;  1HQU A;  4LC9 B;  1VQ4 N;  4CED A;  4WQ4 C;  3PY8 A;  4M63 C;  5J2M A;  4BGA A;  2YNF A;  2QTD A;  2FBT A;  4CF2 A;  4M45 A;  2AP1 A;  1T44 A;  3T19 A;  2HF3 A;  1YIJ N;  5AQS A;  1RT3 A;  3LAM A;  3LDN A;  2WC9 A;  5FPM A;  2FBV A;  3ALY A;  5DMR A;  4AM7 A;  2YV0 X;  4BG9 A;  4E1N A;  4DFP A;  2P9P A;  1C0F A;  3VEV A;  4DQI A;  2NRH A;  1KD1 O;  3AY9 A;  3DRP A;  4LF8 K;  2PBD A;  5BRD A;  2WUS A;  3WUH A;  4GY2 B;  3SMP A;  3C7N A;  3DAW A;  3LDO A;  2A1S A;  3QLH A;  4IFE A;  1XI1 A;  4CJR A;  5CYQ A;  4ID1 A;  2E88 A;  3N4P A;  3P39 A;  2ZD1 A;  3PIO L;  3K57 A;  3ZSQ A;  5CHI A;  3OYA A;  4U7B A;  5AQN A;  1J5E K;  1H1V A;  3HM9 A;  4H5R A;  1QVF M;  3PX6 A;  2KKZ A;  3HP9 A;  2YNG A;  3TAR A;  3MX2 A;  3C6U A;  3CCS N;  1KFS A;  4FZZ A;  4FM0 A;  2QWQ A;  2ZGZ A;  1BA0 A;  1ZBF A;  4H4O A;  4B3R K;  3O6W A;  5C25 A;  5FRO A;  3WEE B;  4JKF A;  3MXM A;  3AVA A;  4B08 A;  1IKV A;  4IJA A;  1IBK K;  3UB5 A;  4DB3 A;  3FFK B;  2GBZ A;  1TL1 A;  4QCL A;  4X62 K;  3CG7 A;  4DTS A;  3V9S A;  1O13 A;  1YAG A;  4DSK A;  3ZSX A;  1NJW A;  4JEP A;  1SUQ A;  3QER A;  4H5T A;  1VQL N;  3CM6 A;  2QXF A;  4OO1 J;  3VER A;  2VG6 A;  5CR4 A;  1S6Q A;  2F9W A;  3HTV A;  2OPQ A;  4DV4 K;  4BG8 A;  1A5V A;  3NF6 A;  3TWH A;  4KB1 A;  2G8U A;  4DV2 K;  3NF7 A;  4H0Y B;  3LDP A;  4GV6 A;  1NGE A;  4E7H A;  5AZI A;  4J2B A;  2XY8 A;  1J6Z A;  3KLF A;  4BR4 A;  3V9X A;  5C42 A;  1VK0 A;  3DLG A;  3THY B;  4B9L A;  5BPM A;  1K8K B;  4CIE A;  4DR1 K;  2O8B A;  1GLB G;  1BWF O;  3VOV A;  3H1Q A;  4FOE A;  4FWM A;  3IG1 A;  5DM7 L;  3LZI A;  4I7F A;  3PSF A;  3VQE A;  4FJ9 A;  3L8B A;  1M90 O;  3D2F A;  4DSE A;  4KHY A;  4RCH A;  1S72 N;  3EY1 A;  2E6M A;  1SKR A;  4FZX C;  4RW9 A;  4DTU A;  3S41 A;  3WQT A;  1NMD A;  1NK7 A;  2Z1H A;  2ETJ A;  1WSG A;  3P31 A;  3LM2 A;  2FF3 B;  1O1W A;  3G4S N;  3NHG A;  5GAG P;  1ASU A;  1ZBS A;  1RFQ A;  1A5W A;  5M1O A;  1QHA A;  1SKW A;  1Q8I A;  3MDQ A;  5KTQ A;  1VSE A;  4X66 K;  1BQM A;  2VG5 A;  1C0G A;  3VQC A;  1S22 A;  4BRP A;  3V1O A;  1B92 A;  3O9R A;  3H6E A;  1K73 O;  1JLF A;  1W0H A;  3CQX A;  4JHD B;  1D9F A;  2Y1J A;  4CJQ A;  3AVB A;  3UKR B;  3I33 A;  2DTU A;  4OKJ A;  3CJC A;  4JI7 K;  3EZ5 A;  4DU4 A;  3V6D A;  2Z1I A;  5AJ3 K;  2OPS A;  4K0K K;  4KHP K;  2HF4 A;  4OGE A;  4PKI A;  5AQZ A;  3KLH A;  4DUZ K;  3SQ4 A;  1QQN A;  1S1W A;  3OA9 A;  5H1S Q;  4GKJ K;  2FLO A;  2E8A A;  1J5O A;  4HUE A;  4BRM A;  3ZT2 A;  2CGJ A;  3AAR A;  3DM2 A;  5LJV A;  5GIN A;  2WTU A;  3GE1 A;  2GUI A;  2LSN A;  4BWM A;  2A41 A;  2Q31 A;  4FWL A;  2IVN A;  3HBT A;  5KRT A;  1Q86 O;  3HST B;  1GOB A;  3PO5 A;  1GLF O;  1S1T A;  1NJZ A;  5AQG A;  3CI5 A;  2YNH A;  4PY5 A;  3B6O A;  4RW7 A;  4BRG A;  2VG7 A;  4WQ4 A;  4CEB A;  4I9Q A;  1YHQ N;  2ITG A;  1HJR A;  3B8A X;  4R79 A;  4YFU A;  4FK4 A;  3VQD A;  3OYC A;  1RBV A;  4CBW A;  5AQV A;  3F73 A;  5J2Q A;  3AVG A;  1SQK A;  1XMQ K;  4FWQ A;  2NNW A;  3IKM A;  3VQQ A;  4CEE A;  3LWL A;  3T1A A;  1TKX A;  1L3T A;  4LH5 A;  2X6S A;  3KVG A;  3C6H A;  4JI0 K;  4IOX A;  4I2Q A;  1U4B A;  3AA2 A;  3SUQ A;  1K6Y A;  1NGB A;  3WXI A;  4FWR A;  4FLT A;  2QXL A;  4BRE A;  1ATR A;  4F4K A;  1HKG A;  3FZF A;  4QS7 A;  4IFY A;  5I9E B;  1ITG A;  1TL3 A;  4FJN A;  1QVG M;  4Z0U A;  4W5Q A;  4J2D A;  2Q0U A;  3GL1 A;  1QSY A;  4IXC A;  3ZX2 A;  4LFA K;  4FLZ A;  4KFB A;  3CMA N;  3D2E B;  5GAH P;  4CZH A;  4DFJ A;  1QHT A;  1BIS A;  3FGU A;  4CZL A;  3VET A;  1ZBH A;  1VQN N;  3TAQ A;  3VEX A;  1BOT O;  1X1P A;  4E1M A;  4KHQ A;  1G99 A;  2FC0 A;  1EO1 A;  4O0I A;  1NLV A;  4JI1 K;  4FK0 A;  4BDZ A;  1E4G T;  3LAK A;  3L0Q A;  1EP4 A;  3THW B;  3KLE A;  4KO0 A;  2KFZ A;  1U04 A;  2KTQ A;  5LMN K;  4JS5 A;  3Q7C A;  3ZT0 A;  4JI8 K;  4BQL A;  2IC3 A;  3U3Y A;  1YVU A;  4CZK A;  2UXC K;  1NOY A;  3CYM A;  1J54 A;  5C24 A;  4JKD A;  2QWL A;  3HOT A;  3NF9 A;  1B9F A;  4MQ3 A;  3SJJ A;  3P38 A;  1IKW A;  3R8E A;  4B3S K;  3OYL A;  1W7A A;  4CER A;  1NBW A;  1OH7 A;  2ZF5 O;  2HHW A;  4GW6 A;  3K2P A;  4LD0 A;  4N5S A;  3CM5 A;  1UOC A;  3J7Y P;  4ISF A;  2P9K B;  1WSI A;  2X78 A;  1CZB A;  3ULE B;  3CHW A;  3NGZ A;  4CGG A;  3CCR N;  4EHT A;  3M6G A;  4O0J A;  3DLH A;  3BZK A;  2VYP A;  1KQS M;  2PYL A;  4FO0 A;  2KW4 A;  5IWA K;  4CJE A;  3KKS A;  4DS5 A;  5JVH L;  4B9T A;  4QOZ B;  4LFC K;  1W9H A;  5AQU A;  2IS3 A;  2JWL A;  4FW2 A;  1U6Z A;  2A5X A;  3SZ2 A;  3OYH A;  4AF1 A;  2HHT A;  4ILG B;  5BRE A;  1WUA A;  1B9D A;  1REV A;  4F2R A;  4CJL A;  1WNS A;  3QIO A;  3H46 O;  1KLN A;  3DXK A;  4CHN A;  3T1Y K;  4Z4F A;  2RKI A;  4KHU A;  3SQ2 A;  1DKG D;  5GAD P;  1S1U A;  4W5R A;  4KH6 A;  3CJ7 A;  3OY9 A;  3NAE A;  4KTW A;  4RW8 A;  4R5P A;  5C2F A;  1TK0 A;  2DFH A;  5E41 A;  3J7Z O;  2P9P B;  5AFU H;  4CFD A;  3O8M A;  2B6A A;  3E9P A;  4CJ3 A;  1HNV A;  5E26 A;  2IDO A;  3V1Q A;  4XH4 A;  4F9O A;  4IO9 L;  4CJF A;  3AVJ A;  4FK2 A;  1HX1 A;  2I7N A;  3C7N B;  4H0O A;  3L2V A;  3DLE A;  1YJW N;  3VTH A;  3U3G A;  1BI4 A;  4V19 S;  3AVM A;  4JD2 B;  4Z4G A;  1D8Y A;  5CYM A;  4F3O A;  1WSJ A;  3DXM A;  3G0Z A;  3PX4 A;  2D0O A;  3IDH A;  4M3X A;  4DU3 A;  1TYQ A;  1YTA A;  1T6D A;  4ILH A;  5SZT A;  2HMI A;  1CXQ A;  1NK4 A;  4K8X A;  5AQW A;  3EEQ A;  3AA5 X;  3O4W A;  1BCM A;  1P90 A;  1KRP A;  1OH6 A;  3CFP A;  3J81 O;  4M3Y A;  2IOC A;  3S9H A;  1C0M A;  3NGY A;  3H08 A;  4H8K A;  4CJ5 A;  3BDP A;  4KI6 A;  5KGW A;  3ENO A;  3NBP A;  1E4F T;  2F9T A;  3K9J A;  1KXP A;  4FLU A;  1WSE A;  1JXE A;  1Q7Y O;  3SMS A;  2PFU A;  4FJG A;  4HCB A;  2E5L K;  4JI2 K;  4M3W A;  3SAG A;  4N56 A;  4KTZ A;  4W5N A;  3R6M A;  4BDY A;  3O3G A;  3OJU A;  1T7P A;  4BWJ A;  3BF3 A;  5HOO A;  3LL3 A;  3WNE A;  4WFA L;  5KQD A;  3S3O A;  3JSM A;  1LW2 A;  2HBM A;  2VCP A;  2QKK A;  5LY3 A;  3ZSY A;  5AZI B;  3MWT A;  2RHK A;  1JCE A;  3THW A;  3CC2 N;  1Z26 A;  2BAN A;  4Y1C A;  1RDC A;  3KTQ A;  4DG1 A;  3EYZ A;  2BE2 A;  4FJ8 A;  4A5B A;  4B9S A;  3ZX0 A;  2I5J A;  4F8R A;  4FM1 A;  3W3D A;  3O4N A;  3C6A A;  2O8B B;  1HYV A;  4OJR A;  3CQ8 A;  3G25 A;  2GWK A;  4C1N I;  5GIO A;  3H3N O;  3MCP A;  4DQS A;  3KK7 A;  3MN5 A;  3D2F B;  4H0X B;  4CZG A;  1VAZ A;  1VSL A;  2BH1 A;  2X74 A;  4CHZ A;  2UUA K;  3OVN A;  4K25 A;  2W42 A;  4MLE A;  1LV5 A;  4HVJ A;  3AAP A;  4OPJ A;  4FVU A;  2BUP A;  1Z25 A;  2P1J A;  5FRN A;  1N33 K;  4JK9 A;  3E1Y A;  4DHY A;  4BE2 A;  2NRT A;  2PZS A;  4AM6 A;  1JLC A;  2OZM A;  3G10 A;  5HRN A;  3LAL A;  5C2D A;  3MXJ A;  2ZM6 K;  4HTL A;  4CFB A;  2F8S A;  4NO7 A;  1VQK N;  5HRP A;  3MEC A;  3LZJ A;  3OBW A;  4DS4 A;  5M1N A;  2XO7 A;  1NK8 A;  3R1X A;  1WOQ A;  5TKW A;  3GBT A;  3LPU A;  3MMV A;  4BR2 A;  4FLY A;  3V9U A;  1YI2 N;  4DLE A;  3CCL N;  3AAQ A;  4K43 A;  2HOE A;  4UY8 O;  3ZEU B;  4M3U A;  4E1J A;  4JK8 A;  1ZBL A;  1FKP A;  4BE1 A;  2G8I A;  4CHP A;  2O8C B;  1G15 A;  4WYB A;  1JXB A;  4CZI A;  3V9W A;  4CD3 A;  4DTM A;  3DLL L;  3AVH A;  2FBX A;  3LPT A;  3ISN C;  3MAQ A;  4H0T B;  4DMN A;  1CLQ A;  2P5O A;  3OYI A;  1D9D A;  3QDK A;  4OPH A;  1QQM A;  3TTF A;  1YT3 A;  4DR5 K;  5BN9 A;  1NNE A;  2XY6 A;  4AQY K;  1X9J A;  1WBD A;  3L4I A;  4B3T K;  3QBW A;  3P83 D;  4DSJ A;  1D5A A;  5HRR A;  2OYQ A;  3UKU A;  2YHX A;  5JS2 A;  1RTJ A;  3QET A;  1NGJ A;  2H3G X;  4AHT A;  1N6Q A;  4LF7 K;  3RWU A;  4KRF A;  4JD2 A;  4FLV A;  3PLA A;  2W6K A;  3QBX A;  4CES A;  5JVG L;  2VWJ A;  4DQ8 A;  2NRZ A;  3BZC A;  1I3A A;  2DY4 A;  3BF1 A;  1VSM A;  4BDP A;  3NH0 A;  5FPD A;  1DTT A;  2NRR A;  5M1K A;  3K5L A;  1NJX A;  1V4S A;  2BDP A;  4DR7 K;  1GLJ O;  1YUW A;  5BRF A;  5ADX H;  3C94 A;  2VQE K;  4GV9 A;  4LH4 A;  3H45 C;  4BC2 A;  1RBR A;  3TR8 A;  2Q0R A;  5A2Q O;  3THX A;  3SLC A;  3V81 A;  3I0S A;  4CFA A;  5J1E A;  1RT6 A;  4JI6 K;  2E2O A;  3BUZ B;  3F9K A;  2CGK A;  3T1H K;  4CBX A;  3RR8 A;  3SAH A;  2WON A;  4CHQ A;  3QEW A;  1VQ5 N;  3CCM N;  1OKJ A;  4YOR A;  3J7A P;  3P4I A;  2DPN A;  4A2B A;  3CPW M;  1UA1 A;  5CY4 A;  4CGF A;  3CXC M;  4C8L A;  4W5O A;  3F5T A;  3V4I A;  5JS1 A;  1KFD A;  2HST A;  3WNG A;  2Q2R A;  2XY7 A;  1KSP A;  1GLE G;  3HRG A;  2OAN A;  3NVM A;  1QSS A;  3R9P A;  1WBB A;  2V52 B;  1NK6 A;  3MN9 A;  4F2S A;  1EX4 A;  2YJE A;  3VA0 A;  4E7J A;  3HXM A;  3OYM A;  4CK2 A;  4J2E A;  3HM8 A;  4CJ7 A;  2OCE A;  5HL7 L;  4FWN A;  1SKS A;  3SNN A;  3BGR A;  3WT0 A;  3KD1 E;  4CEZ A;  1RDA A;  2GTD A;  4FJK A;  3L6Q A;  2ZQB A;  1S9E A;  3NE6 A;  4BRN A;  3DJC A;  3KK3 A;  2ZJR L;  1N8R O;  4FVM A;  3KWI A;  2VWB A;  4NB4 A;  4KBO A;  4J2A A;  3VQP A;  1YF5 L;  5AQQ A;  4CJK A;  4MO4 A;  4B1Z A;  2JWK A;  2O8F A;  2P9L A;  3OYE A;  1GLC G;  1RCH A;  1YIT N;  4HCC A;  5DM6 L;  1P8Z A;  1MWM A;  3OS0 A;  4NCA A;  3E66 A;  1WSF A;  1NKC A;  4WF9 L;  2G8W A;  2UU9 K;  3ZYY X;  4B1X B;  3E9L A;  3M5R A;  3WNH A;  1LWF A;  3SUP A;  1HKC A;  3MWP A;  1S9G A;  1WAJ A;  4OGC A;  3D0P A;  3SK3 A;  3HVR A;  4H0P A;  4BRL A;  3TAE A;  2P9S A;  3SBT A;  3R3L A;  3HOS A;  4DUY K;  1KC8 O;  2WOM A;  2YHA A;  1ZBU A;  3VF2 A;  4DSL A;  2ASP A;  3A8Y A;  4AHR A;  2FF6 A;  4A59 A;  1TKZ A;  5LMU K;  3VGL A;  4CJV A;  4LF9 K;  4G9Z A;  1GLA G;  1TAU A;  4HUG A;  3ZEU A;  1RT7 A;  3DXK B;  2HMP A;  2UXD K;  3O9S A;  4L3Q A;  2G8F A;  2O8C A;  4IOC L;  2FBY A;  2IGI A;  4FJJ A;  4CZE A;  4KI4 A;  1SZ2 A;  4DTO A;  4Q5V A;  1VSF A;  3ZSZ A;  2A6A A;  1HNX K;  4E0D A;  2NUB A;  3O08 A;  5C12 A;  4EZ6 A;  2P9N A;  4KHW A;  2YI1 A;  3EN9 A;  1CZA N;  5BN8 A;  4ELT A;  3VQA A;  2O4I A;  3JS6 A;  1BI4 B;  3OYG A;  4KAZ A;  1RGI A;  4CEF A;  3DLB A;  2G8H A;  3DXM B;  1SV5 A;  4BR5 A;  3DWL A;  1TYQ B;  4JI3 K;  3TTC A;  2E6L A;  2KHO A;  4WE1 A;  4E7I A;  4IBN A;  1IKX A;  1Q81 O;  1OH8 A;  1S5J A;  4CJW A;  4BY9 C;  1QS4 A;  3LWM A;  4EP4 A;  2IVP A;  2J4R A;  1U48 A;  3QML A;  1RDB A;  4C8O A;  4DQQ A;  2G8K A;  4BVP A;  1LWE A;  1ATS A;  3ZLJ A;  4YDU A;  1XC3 A;  4YOV A;  3VTI A;  3I8D A;  4BVO A;  2XY5 A;  2D5R A;  2OTJ N;  4FLX A;  3DLR A;  4DV5 K;  4KKO A;  1U2V A;  3MN6 A;  4NYF A;  4X64 K;  4ZHR A;  3J80 O;  1SL0 A;  4JV5 K;  1DLO A;  4J8F A;  4IOA L;  4CF9 A;  1GLL O;  4IDK A;  1UAX A;  4CZM A;  4DTN A;  3C6T A;  2OPR A;  3ZSR A;  2YJF A;  1C1B A;  5AQP A;  3DI6 A;  4ID5 A;  4F3T A;  2W40 A;  2QK9 A;  2AJQ A;  3TAF A;  3SPY A;  4DR6 K;  4KPY A;  3K5N A;  3UE5 A;  4PUO A;  2IAJ A;  3P5J A;  2KZM A;  4CJT A;  4H4M A;  3I8B A;  4NXM K;  4B8C A;  4B3O A;  3VGM A;  4ZTJ A;  3O9U A;  4GMJ B;  5AQF A;  3CCU N;  2OTL N;  4BC3 A;  3KKR A;  1SL2 A;  5CE3 A;  5FPN A;  3RRH A;  3LM9 A;  2BTF A;  3ULD A;  2ZWH A;  2Z1J A;  1K8A O;  4O5B A;  3HVT A;  4DV3 K;  1NK0 A;  3AO1 A;  3O80 A;  4CZF A;  4CIF A;  2ZE2 A;  1ZC6 A;  3IRX A;  2HVH A;  1YJN N;  2VGN A;  5KQ8 A;  1IH7 A;  1BL3 A;  4JK7 A;  5BR9 A;  4QS8 A;  2Q1N A;  3EL2 A;  1BQN A;  1BG3 A;  3TAN A;  5M1Q A;  3SBG A;  4IFV A;  4M42 A;  4IZ9 A;  4G1Q A;  4M7X A;  3NMU A;  2P9U A;  3N4Q A;  2BGG A;  1SS6 A;  1E3M A;  2KQ2 A;  3QEI A;  1VSI A;  1XNQ K;  3HSC A;  3ZSO A;  2ITM A;  2VGM A;  4RW4 A;  2A42 A;  2DFF A;  3VMF B;  1Q18 A;  1T3V A;  3ITH A;  4NYN A;  4XIU A;  3DYA A;  3NDK A;  2RE2 A;  2FXU A;  4ELV A;  4MDA A;  4A2A A;  3OS2 A;  4CI6 A;  1X9M A;  3KJV A;  4YOT A;  2EHG A;  4IJN A;  3KLI A;  5EU7 A;  1KVC A;  3CFO A;  1N5Y A;  3K59 A;  1WN7 A;  5ELZ A;  4B9N A;  3SAF A;  1W97 L;  4CK1 A;  4L8R B;  2HNZ A;  3WXK A;  2E1Z A;  4EP5 A;  1NK5 A;  3C0B A;  2O4G A;  4LF6 K;  3EZW A;  3U9Z A;  1BIZ A;  3VES A;  3FFI A;  4DU1 A;  3TU5 A;  3M1F A;  1T05 A;  1LCU A;  1X9S A;  2HBK A;  2V7Z A;  2GUP A;  3K5M A;  3KLG A;  3H1V X;  4OX9 K;  3EKU A;  3ZX3 A;  1BGX T;  4FJL A;  3UKU B;  4C23 A;  1TV6 A;  5T7B A;  4BC5 A;  4C8M A;  4E3S A;  1ZXO A;  3I0R A;  2RPI A;  3OBY A;  2NRV A;  2UUC K;  4EZ9 A;  4MFB A;  1HUX A;  4YOW A;  2HB5 A;  4BAC A;  3HL8 A;  3EE9 A;  4NLB A;  5CZ2 A;  3ZET B;  3CQY A;  3OYB A;  2V51 B;  2NRX A;  3HPH A;  5F0X A;  4O8U A;  3RVC A;  2GV9 A;  4CF8 A;  1HR0 K;  3K5O A;  4PWD A;  5GAE P;  4ISG A;  2NLX A;  4CFC A;  4E19 A;  4JLH A;  3E9O A;  3VN5 A;  3LDL A;  4OPA A;  5K14 A;  1KLM A;  1WAF A;  2YCH A;  3L2R A;  5AFU A;  5M1F A;  5AQY A;  3RMA A;  1TUY A;  4CHO A;  3THX B;  3U4L A;  3RTV A;  1C6V A;  3ZCM A;  4WFB L;  3ZT3 A;  1NOZ A;  4AHC A;  1QZ5 A;  2GX9 A;  5HBM A;  3OYD A;  2I7P A;  4CGJ A;  3LP1 A;  3CFR A;  4CIG A;  1BUP A;  1VRU A;  3DRR A;  2UUB K;  1NWK A;  2F96 A;  4DV7 K;  3U9D A;  3ATU A;  4FZY A;  2B4J A;  2CH6 A;  1EKE A;  4QAG A;  3SUN A;  4GVM A;  3JXU A;  3AVK A;  3FZK A;  3JAM O;  2A3Z A;  3RMC A;  1LWC A;  4LY7 A;  2Y1I A;  1C0T A;  3WXJ A;  1HJO A;  1XC9 A;  2Z1G A;  3QNN A;  4KHS A;  1QE1 A;  4GNI A;  4FLW A;  5D3G A;  1ILY A;  4KTQ A;  4ZTF A;  4JRP A;  1L3U A;  2D4W A;  5FLX O;  4BRF A;  1Z05 A;  1N36 K;  4KRE A;  1TKD A;  3FZM A;  4ELU A;  1CZ9 A;  4HWI A;  4IEE A;  2O8F B;  4YHH K;  2P9L B;  4B9M A;  1QQO A;  2UXB K;  3PX0 A;  4W5T A;  4M3T A;  5CZ1 A;  1N34 K;  5IT9 O;  3IFR A;  4CJ4 A;  4OKE A;  4KH4 A;  3MN7 A; 
#chains in the Genus database with same CATH homology
 4FWQ A;  5C15 A;  2NNW A;  2HST A;  3IKM A;  5AZJ A;  2P9I B;  2Q2R A;  1XUP O;  3D7E O;  3KVG A;  1GLE G;  3HRG A;  3C6H A;  2FSN A;  5BPL A;  2OAN A;  3NVM A;  3M3Z A;  4IOX A;  3U8X A;  3VGK A;  3R9P A;  1NGI A;  1NGB A;  5EVZ A;  2V52 B;  3WXI A;  3MN9 A;  1KAY A;  1X3M A;  2YJE A;  4FWR A;  2P9S B;  4A62 A;  5BRH A;  2QXL A;  4CD1 A;  3QFU A;  3HM8 A;  3L4Q A;  4CJ7 A;  4BRE A;  1HLU A;  1ATR A;  2ASM A;  4PKH A;  5HL7 L;  1JJ2 M;  4FWN A;  1HKG A;  3FZF A;  4QS7 A;  3WT0 A;  1NGG A;  3WXL A;  5I9E B;  3A5L C;  5JIC A;  2GTD A;  4O8K A;  1QVG M;  3VEZ A;  2Q0U A;  1OVY A;  3GL1 A;  3L6Q A;  4IXC A;  1VQP N;  3CJ1 A;  4BRN A;  3DJC A;  3ZX2 A;  2ZJR L;  1N8R O;  4NB4 A;  1T6C A;  2VWB A;  3KWI A;  1Q82 O;  4FSV A;  4KBO A;  3CMA N;  3D2E B;  1YF5 L;  5AQQ A;  4RTF D;  4CZH A;  3A5N C;  4B1U B;  5GAH P;  4MO4 A;  2QWN A;  4B1Z A;  4IDH A;  4YOU A;  2JWK A;  3FGU A;  1VQ9 N;  2P9L A;  3VET A;  4FWS A;  4CZL A;  2D0P A;  4JKB A;  4XEI A;  5E84 A;  1GLC G;  1MWK A;  1YIT N;  1VQN N;  3VEX A;  1XQS C;  1P8Z A;  1BOT O;  1MWM A;  5JLH A;  5DM6 L;  4C1N K;  4BRI A;  1G99 A;  1D4X A;  2E2N A;  5KPT A;  2ZJP L;  3E66 A;  1EO1 A;  2E2P A;  1NLV A;  3D6R A;  5EOY A;  4WF9 L;  3MCA B;  3T7Z A;  1ATN A;  1E4G T;  3ZYY X;  4JAX A;  1ESV A;  1RDW X;  3L0Q A;  2IIR A;  2P9N B;  4B1X B;  3E9L A;  3M5R A;  5AQL A;  5MLC Q;  4BC4 A;  4B9Q A;  3GG4 A;  3I55 N;  1X3N A;  1HKC A;  2ZGY A;  3MWP A;  5JMV A;  4ILJ A;  2A40 A;  3Q7C A;  3SK3 A;  2HBJ A;  4BQL A;  4DHY A;  1VQ7 N;  4GV3 A;  1QZ6 A;  3TSQ A;  4H0P A;  4BRL A;  4CZK A;  1DT9 A;  2P9S A;  1NJI O;  3SBT A;  3QB0 A;  3R3L A;  3HOS A;  1KC8 O;  3O5B A;  4YDU C;  4JNE A;  5C0Y A;  3ENH A;  4K42 A;  4JKD A;  2KLA A;  2QWL A;  2WFB A;  3HOT A;  3A0I X;  3VF2 A;  1NGF A;  1M1K O;  2ASP A;  3A8Y A;  2FF6 A;  2QM1 A;  4A59 A;  5F1X A;  2HBL A;  3HZ6 A;  3VGL A;  3LDQ A;  1EQY A;  3J8A A;  1BO5 O;  4G9Z A;  1GLA G;  3P38 A;  3R8E A;  4KH5 A;  4BRK A;  2W41 A;  2QI2 A;  3ENB A;  3ZEU A;  1W2B M;  3QFP A;  3ZET A;  4BRA A;  5EY4 A;  3D2E A;  3DXK B;  2HMP A;  1MA9 B;  3CC4 N;  2QEX N;  1NBW A;  2ZF5 O;  3O9S A;  4L3Q A;  4O5F A;  1IJJ A;  1YXQ A;  3CIP A;  4FOI A;  4IOC L;  3F2K A;  2WBN A;  2ZJQ L;  1VQ6 N;  1BU6 O;  5JLF A;  4JKH A;  4K41 A;  2E20 A;  4CZE A;  1U2V B;  3VPZ A;  4B1V A;  1SZ2 A;  3EO3 A;  3VEO A;  3CCV N;  1NGH A;  4QS9 A;  2A6A A;  4ISF A;  5BPN A;  2P9K B;  4U67 L;  3I56 N;  3O08 A;  5C12 A;  3F9M A;  1RDU A;  5LJW A;  1Y64 A;  3ULE B;  2P9N A;  2V7Y A;  4GVE A;  5GIP A;  2YI1 A;  3EN9 A;  1CZA N;  5BN8 A;  3CHW A;  3AGR A;  3C65 A;  4H5V A;  1GLD G;  3CCR N;  3JS6 A;  4EHT A;  3OW2 M;  3M6G A;  1VQ8 N;  1RGI A;  3FR0 A;  1NGC A;  2YHY A;  2VYP A;  3WQU A;  3DXM B;  1DEJ A;  4IO8 A;  1KQS M;  4FO0 A;  4Z94 A;  4BR7 A;  4BR5 A;  3DWL A;  3W0L A;  4BGB A;  1TYQ B;  2QW9 A;  3TTC A;  2KHO A;  5JVH L;  2F7T A;  2GEL A;  1Z6R A;  2QWP A;  5AQU A;  4MLH A;  2JWL A;  1U6Z A;  4FWP A;  2A5X A;  4PL8 A;  1Q81 O;  4NLC A;  3BP8 A;  4YOX A;  3O1W A;  4XH5 A;  4AF1 A;  2E1Y A;  4BY9 C;  4ILG B;  4FPA A;  2IVP A;  5BRE A;  5FPE A;  2J4R A;  1HKB A;  3QML A;  1WUA A;  2FSK A;  3CCQ N;  1BA1 A;  4MO5 A;  1R59 O;  2IVO A;  4BVP A;  3H46 O;  1ATS A;  2Q97 A;  1BDG A;  3FE1 A;  3DXK A;  3K9K A;  3FZH A;  4YDU A;  1XC3 A;  5M1P A;  3VTI A;  5ADX A;  4YOV A;  4JKG B;  3G71 N;  3GOI A;  4BVO A;  1DKG D;  4EIA A;  5GAD P;  2OTJ N;  4CZJ A;  3EE8 A;  4KH6 A;  5F2R A;  3CJ7 A;  4A61 A;  2CGL A;  1U2V A;  3MN6 A;  4MDB A;  5C2F A;  3KWG A;  4PL7 A;  3AGK A;  4J8F A;  3VF6 A;  3J7Z O;  2P9P B;  4IOA L;  5AFU H;  2D1K A;  4FWO A;  1GLL O;  3O8M A;  2FSJ A;  3E9P A;  3CER A;  4I6M B;  2P9K A;  5E26 A;  4IWV A;  4CZM A;  4F9O A;  4XH4 A;  4IO9 L;  3ULE A;  3WXM B;  2YJF A;  5AQJ A;  1HX1 A;  2I7N A;  3C7N B;  4H0O A;  5AQP A;  2EWS A;  3VTH A;  3RSE B;  4CBU A;  1KAZ A;  1YJW N;  2NZT A;  2W40 A;  4WQ5 C;  3CPE A;  3VF4 A;  4JD2 B;  2P9U B;  4H0V B;  4EAH D;  3DXM A;  2D0O A;  3IDH A;  1TYQ A;  5AQO A;  3UE5 A;  1T6D A;  3NVK A;  2AA4 A;  3O9Q A;  4ILH A;  3VEY A;  3I8B A;  3VGM A;  1NM1 A;  3O9U A;  5AQF A;  2P9I A;  1JCF A;  3KHY A;  3KZB A;  1VQM N;  5AQW A;  3CME N;  3CD6 N;  3CCU N;  4LC9 B;  2OTL N;  4BC3 A;  1VQ4 N;  4WQ4 C;  5CE3 A;  3O4W A;  4M63 C;  5FPN A;  3LM9 A;  4BGA A;  2BTF A;  2QTD A;  1P90 A;  2ZWH A;  3FZL A;  2AP1 A;  1T44 A;  1KAX A;  3CJB A;  4JKG A;  5C10 A;  1K8A O;  2HF3 A;  1YIJ N;  5AQS A;  4BRO A;  3ENO A;  3O80 A;  3LDN A;  2WC9 A;  5FPM A;  4CZF A;  2GEM A;  1E4F T;  2F9T A;  3K9J A;  1NGD A;  1KXP A;  1ZC6 A;  1YVN A;  4AM7 A;  4BG9 A;  1YJN N;  2VGN A;  1Q7Y O;  5KQ8 A;  4JK7 A;  3SMS A;  5BR9 A;  3PIP L;  4QS8 A;  2P9P A;  2PFU A;  2Q1N A;  4DKW A;  1C0F A;  3EL2 A;  3VEV A;  2NRH A;  3SAG A;  1KD1 O;  3AY9 A;  1BG3 A;  5M1Q A;  3SBG A;  2PBD A;  5BRD A;  2WUS A;  3WUH A;  4GY2 B;  4IZ9 A;  1SAZ A;  3C7N A;  3DAW A;  3LDO A;  3R6M A;  4M7X A;  4IFE A;  4XH1 A;  3SMP A;  5M1F A;  3NMU A;  5KPR A;  2QWM A;  3RSE A;  4WFN L;  3BF3 A;  2E88 A;  3N4P A;  5HOO A;  3P39 A;  3LL3 A;  2GWJ A;  4BR9 A;  3PIO L;  2P9U A;  5CHI A;  3N4Q A;  4WFA L;  4U7B A;  3OHR A;  1SS6 A;  5AQN A;  5KQD A;  1H1V A;  3TSP A;  3HSC A;  2ITM A;  2HBM A;  4H5R A;  2VGM A;  2A42 A;  2VCP A;  1K9M O;  1QVF M;  5LY3 A;  3SJH A;  4BR0 A;  2KKZ A;  3VMF B;  1Q18 A;  5AR0 A;  1T3V A;  3MWT A;  2RHK A;  5AZI B;  1JCE A;  4H03 B;  2RE2 A;  3MX2 A;  3CC2 N;  3CCS N;  3VEN A;  2FXU A;  3G6E N;  3EKS A;  4FWK A;  4MDA A;  4A2A A;  4DCH A;  4A5B A;  3ZX0 A;  4CI6 A;  2QWQ A;  2ZGZ A;  4B1Y B;  4YOT A;  4FL9 A;  3W3D A;  4IJN A;  1BA0 A;  3C6A A;  3ID8 A;  4EHU A;  3A5O C;  3MX5 A;  5ELZ A;  3O6W A;  5AQR A;  3SAF A;  3WEE B;  1W97 L;  3O1B A;  3G25 A;  4BRQ A;  4JKF A;  2GWK A;  4C1N I;  5GIO A;  1YJ9 N;  3H3N O;  3MCP A;  2YHW A;  3WXK A;  3KK7 A;  2E1Z A;  3MN5 A;  3D2F B;  4H0X B;  4CZG A;  4IJA A;  3UB5 A;  4DB3 A;  3C0B A;  1VAZ A;  2BH1 A;  3FFK B;  3EZW A;  3CJA A;  4K25 A;  3U9Z A;  1O13 A;  1YAG A;  4MLE A;  3VES A;  5EXW A;  3ATV A;  4JEP A;  3AAP A;  4H5T A;  1VQL N;  3TU5 A;  3M1F A;  4OO1 J;  3VER A;  4FVU A;  2BUP A;  1LCU A;  5CR4 A;  5KPZ A;  2F9W A;  3E1Y A;  3HTV A;  4JK9 A;  2HBK A;  2NRT A;  2GUP A;  2V7Z A;  3MK6 A;  4AM6 A;  5B8H A;  4BG8 A;  1TUU A;  3H1V X;  3HI0 A;  3EKU A;  3ZX3 A;  4JKA A;  5C2D A;  3A5M C;  4H0Y B;  3LDP A;  4GV6 A;  4RWT A;  1NGE A;  4HTL A;  3UKU B;  1NGA A;  4C23 A;  3CCJ N;  5AZI A;  3O9T A;  4NO7 A;  1VQK N;  3TPQ A;  1J6Z A;  3OBW A;  4BR4 A;  3CET A;  1MDU B;  1HPM A;  4IEI A;  5M1N A;  4BC5 A;  1WOQ A;  3R1X A;  3GBT A;  1ZXO A;  3MMV A;  5TKW A;  4BR2 A;  3OBY A;  2NRV A;  1YI2 N;  4ISE A;  4M7Y A;  1HUX A;  5BPM A;  4YOW A;  3CCL N;  1K8K B;  3AAQ A;  1GLB G;  4K43 A;  3EE9 A;  1BWF O;  2HOE A;  4NLB A;  3VOV A;  3ZEU B;  4UY8 O;  3H1Q A;  4FOE A;  3ZET B;  4FWM A;  3WEE A;  4E1J A;  3CQY A;  4JK8 A;  5DM7 L;  2V51 B;  2NRX A;  5F0X A;  4O8U A;  3RVC A;  4BRH A;  4WYB A;  4CZI A;  3TTD A;  1M90 O;  3D2F A;  4RCH A;  4CD3 A;  5GAE P;  4JKC A;  1S72 N;  3DLL L;  5AQK A;  4ISG A;  2NLX A;  3VEW A;  3S41 A;  3WQT A;  1IG8 A;  3E9O A;  2CH5 A;  1NMD A;  4H0T B;  3BEX A;  3LDL A;  4OPA A;  4Y0W A;  3P31 A;  3IUC A;  4A57 A;  3QDK A;  2YCH A;  3LM2 A;  1QQM A;  4OPH A;  2FF3 B;  3TTF A;  2E2Q A;  2Q36 A;  4FPB A;  5AQY A;  4PHT X;  1TUY A;  5GAG P;  1ZBS A;  1RFQ A;  5M1O A;  3G4S N;  1QHA A;  3MDQ A;  4PKG A;  3U4L A;  4WFB L;  3H3O B;  5BN9 A;  1QZ5 A;  1C0G A;  2GX9 A;  1S22 A;  4BRP A;  1X9J A;  2I7P A;  3L4I A;  4JKE A;  3O9R A;  4I6M A;  3CC7 N;  3QBW A;  4H5N A;  2QA4 N;  3H6E A;  1K73 O;  3UKU A;  1BUP A;  3CQX A;  2YHX A;  4JHD B;  1JCG A;  4WCE L;  1NGJ A;  1NWK A;  1V4T A;  2H3G X;  4YOY A;  3UKR B;  3U9D A;  3ATU A;  3I33 A;  2CH6 A;  5AQI A;  5AZJ B;  4JN4 A;  4JD2 A;  4BRC A;  3CJC A;  3T69 A;  3PLA A;  3JXU A;  3QBX A;  5AQT A;  3FZK A;  2QWO A;  1K8K A;  2NRW A;  5JVG L;  2A3Z A;  2HF4 A;  4PKI A;  5AQZ A;  2NRZ A;  4DQ8 A;  1QQN A;  3OA9 A;  5H1S Q;  5TKY A;  3BF1 A;  1VQO N;  3CCE N;  3WXJ A;  1HJO A;  2FLO A;  4WQ5 A;  2E8A A;  5FPD A;  4BRM A;  2CGJ A;  3AAR A;  2NRR A;  5LJV A;  5GIN A;  4GNI A;  3GE1 A;  5M1K A;  1V4S A;  5AFU A;  2ASO A;  2A41 A;  1GLJ O;  1ILY A;  1YUW A;  2Q31 A;  1LOT B;  4FWL A;  5BRF A;  5ADX H;  2IVN A;  3HBT A;  5AQH A;  5EX5 A;  1Q86 O;  2D4W A;  4H5W A;  4BRD A;  4GV9 A;  4BRF A;  1GLF O;  3GDQ A;  3H45 C;  4BC2 A;  1Z05 A;  5AQG A;  3CI5 A;  4B1W B;  3CF5 L;  2Q0R A;  3TSU A;  3ID6 A;  3FZM A;  3SLC A;  4BRG A;  4WQ4 A;  4HWI A;  5AQX A;  4IEE A;  4A5A A;  2P9L B;  1YHQ N;  1QQO A;  1DGK N;  2UYT A;  3IMX A;  2E2O A;  3B8A X;  3BUZ B;  2CGK A;  4CBX A;  4EFH A;  4R79 A;  3SAH A;  1VQ5 N;  3Q7B A;  3CCM N;  5AQM A;  4CBW A;  1OKJ A;  4YOR A;  2QWR A;  3QIC A;  5AQV A;  3P4I A;  2DPN A;  4A2B A;  4BQZ A;  3CJ9 A;  3IFR A;  2PAV A;  2YX6 A;  4JHD A;  3CPW M;  1SQK A;  1S3X A;  3CXC M;  3UKR A;  3FLC O;  4KH4 A;  3MN7 A;  3F5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...