2KKZA

Solution nmr structure of the monomeric w187r mutant of a/udorn ns1 effector domain. northeast structural genomics target or8c[w187r].
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
134
structure length
134
Chain Sequence
MPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLERNDNTVRVSKTLQRFAWGSSNENGRPPLTLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antiviral protein
molecule keywords Non-structural protein NS1
publication title Solution NMR structure of the monomeric W187R mutant of A/Udorn NS1 effector domain. Northeast Structural Genomics target OR8C[W187R].
rcsb
source organism Influenza a virus
total genus 34
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2009-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2kkzA00
4OPAA 3O9TA 3KWIA 3EE8A 3P38A 3F5TA 3O9RA 3O9QA 3O9SA 4OPHA 2KKZA 2RHKA 3OA9A 3M5RA 3EE9A 2GX9A 3P39A 3P31A 3KWGA 3O9UA 3RVCA 3D6RA 3L4QA
chains in the Genus database with same CATH superfamily
1WUAA 2B6AA 1RT2A 1OVQA 3CI5A 3KKSA 1TUUA 4YHHK 4DLGA 3C6AA 3HXMA 5TKWA 1IH7A 2IDOA 4OO1J 1LWCA 3O9QA 2IVOA 4KHPK 3VQEA 1BA0A 4BRAA 3NE6A 3FE1A 4Z4EA 1TKXA 2RN2A 2FBYA 3TAEA 4XH5A 1D5AA 1EQYA 4NCGA 3GDQA 1FXXA 4B3RK 4RW8A 2JWKA 4AILC 3LWMA 4JKFA 5BREA 5KPTA 5JLHA 1QVFM 4KBOA 2X6SA 5GINA 3MXIA 2WFBA 2LSNA 1BCMA 2QWQA 4FWPA 1JLFA 3RRHA 3RMAA 4OGCA 2DY4A 3THYB 4FWMA 4LF9K 4KRFA 1EETA 1E4FT 1RDUA 4M3RA 1T6DA 4LF7K 1HMVA 2IOCA 2FF6A 3K57A 1IBKK 1NJXA 4CJKA 4F3OA 1XC3A 3UKUA 5AFUA 1B9DA 2GUPA 4CW7B 2ASMA 1HYZA 2IC3A 4CFBA 4F3TA 4FWOA 2V51B 1BHLA 4FJ9A 4FCYA 4J2BA 3KK7A 2W6LA 1JCFA 3IAYA 1GLFO 1VRUA 1QHAA 1S6QA 2JWLA 4BRMA 3SYZA 2VG7A 1G15A 4R5PA 2G8HA 1X1PA 4H5NA 3V1QA 4DSFA 3U4LA 2ZJPL 4FLTA 4Z4GA 4E89A 3EZ5A 1SL2A 4WQ4A 3CCEN 2HNDA 2GTDA 4I9QA 3SQ0A 4IJAA 4HTUA 3CCLN 3PX6A 4E19A 1YTAA 2VCPA 4BR9A 1BG3A 4W5QA 4FSVA 4DQRA 3PX4A 2ASPA 3QMLA 2QI2A 3LDNA 3VEWA 2NZTA 4CEAA 5E41A 4H0TB 2HNZA 4EHUA 3CJ1A 5CHIA 3ZSYA 5M1QA 3RR7A 4Z0UA 3H6EA 3QDKA 4NCBA 3ISNC 3LDQA 1SL1A 3TSPA 3KD1E 1HQUA 2G8VA 2B5JA 4E7HA 2HW3A 4JS4A 1RCHA 4KI6A 3P31A 4H5VA 4FPBA 3O4NA 4DR5K 4U67L 2G8FA 2GWJA 2A42A 3THXA 1ATNA 4BC2A 3WNHA 4CJUA 1VSKA 2W40A 5FPDA 1RBTA 1NGJA 5BPNA 2KFZA 4IKFA 3MEDA 3H3OB 3CCVN 5AQJA 1HLUA 4BR7A 4BC4A 1JXEA 4B1WB 5IT9O 3FLCO 2XY6A 4FJ5A 4KHQA 1XHXA 4NLCA 5J2QA 1LV5A 3TAQA 2W41A 4DQPA 3SV3A 3CJCA 4DUYK 1C0GA 3OW2M 1N8RO 1J6ZA 4G9ZA 3C94A 3OYGA 1S6PA 2A40A 4JKHA 3L3VA 3H45C 4Z4HA 3RMCA 2KKZA 1T3VA 3A5LC 4CF9A 1TVRA 1C1CA 4FJLA 3A5NC 1JL1A 4M3UA 1MU2A 1U2VA 4C8MA 4DR7K 3KWGA 1LWEA 1TYQB 2HHXA 4NXNK 1TK0A 1M90O 1OH7A 4ZTFA 3U6FA 4BDZA 4YOYA 3HT3A 3V9UA 1YTUA 4KH4A 3C95A 4E7KA 2R7YA 4M42A 1BI4A 1S1XA 2NUBA 3LL3A 4FJKA 4MFBA 1NK9A 1RILA 2NRVA 3IDHA 3KLIA 3C6TA 1XHZA 2ZE2A 1EWRA 3MN5A 4X66K 4AH9A 3V9SA 2X78A 3D2EB 1HUXA 2O8CA 2GWKA 3PLAA 4AHSA 1BQNA 1CZ9A 2O8FB 2IIRA 5KGXA 5KTQA 1VQ8N 3CC7N 4CFDA 2HF3A 2Y1JA 5MLCQ 2F9WA 3OYCA 3CFPA 1D4XA 3PO4A 4H5WA 2YKNA 4JKDA 3U3YA 1EX4A 3CPEA 4BGBA 4DV7K 3N4QA 2QWPA 3AV9A 2YHYA 3AARA 3QINA 2VQFK 4E1JA 5GAEP 3FZHA 3O9TA 3KLEA 1SZ2A 1S9GA 1KLNA 4JKGB 5AQGA 1HKGA 3QEIA 3GOIA 4DU1A 3VQ4A 4K8ZA 3SV4A 5HRNA 4YOTA 3J7YP 4GV6A 2Q2RA 3AAQA 3HM9A 4CJEA 3NVMA 3KLFA 1R0AA 3NF6A 3JYTA 4ZHRA 3A5OC 3LP3A 3VERA 1DEJA 3D7EO 2GELA 4PA1A 3RWUA 4BR2A 1XNQK 3U8XA 4QS8A 4BR5A 1SUQA 2FBXA 2YHAA 5HP1A 2O4GA 3SQ2A 4J2DA 3SCXA 3HPGA 4CGHA 2UXBK 4LH5A 4FJ7A 3NCIA 1NJYA 3D6RA 1EO1A 4BRQA 3O1WA 4FYDA 4J2EA 4B1VA 3L8BA 3LWLA 2DFEA 2UXDK 3VQ8A 4ID5A 2WONA 3ZX3A 3ZCMA 3BZKA 4FLVA 3ZT1A 1P90A 2UUBK 4FJMA 1JJ2M 4RW7A 2EHGA 3B8AX 5HL7L 2GBZA 4H5RA 2NRWA 3MCAB 2DFHA 1XQSC 4JD2B 3DOKA 1IV0A 3TI0A 1UA1A 4GKKK 3LPUA 2QWRA 1NK4A 1JCGA 1DLOA 2VWKA 4E3SA 4CVNE 3VGLA 3G0ZA 1LAVA 1TV6A 1BGXT 2P9SA 2KLAA 2YI1A 4BWMA 3ZEUA 4KHSA 3AVFA 5CY4A 4F2SA 3A2FA 4DQSA 4O55A 4LD0A 5AQKA 3T19A 3O9UA 4DR3K 1HKCA 5DM7L 2OZMA 1D8YA 4MLEA 1QSYA 4M3TA 3DAWA 3VQAA 4XIUA 1YVUA 1Q9YA 1SKWA 4YOWA 4M7XA 1A5VA 4A59A 3TTFA 4DFMA 4PWDA 1VK0A 3I0RA 3Q7CA 1NGDA 3M1FA 4JK7A 4A5BA 5AZIB 3CCSN 1VHXA 2CH6A 4BACA 3DXKB 2Q0RA 1IKWA 4FWSA 1OKJA 3QETA 4DSLA 4FLZA 2E2OA 4CBUA 3TAPA 5LJWA 1REVA 4IG3A 1BWFO 1RT3A 3SAHA 3FGUA 1Z26A 4BC5A 4QOZB 1LW0A 1Z6RA 3RRGA 2HHHK 3D0PA 4ISGA 3O1BA 1CXUA 3ZETA 1MWKA 4CZGA 4CJTA 4Z94A 1RBUA 1B9FA 3VENA 2HOEA 4H0YB 3TAGA 3TTDA 5AQIA 4ILHA 2ITMA 4DV5K 3ZT2A 1ZBLA 2PYLA 5AQHA 4B3MK 1GLCG 1Z05A 4DTXA 2AP1A 4N41A 1WBDA 1WN7A 2VGMA 3OVNA 1NOYA 1HJOA 1O1WA 1WNSA 3VQ5A 2FSNA 1ZBSA 5T7BA 1KSPA 4B9NA 3U9ZA 4C1NK 2DFFA 2FBTA 1Z25A 4B9LA 1NOZA 3FZLA 5JVGL 1CLQA 1WAJA 4JEPA 2NRHA 3TSUA 3SJHA 4CF1A 1T6CA 3THWA 4M3WA 1VQPN 4TSXA 1T05A 5EVZA 3J7AP 4DFPA 4AHRA 5KPRA 5M1KA 5KRTA 4EIAA 2QEXN 4M3XA 4GY2B 2HSTA 3AO1A 2Q31A 3JXUA 4HCCA 1XC9A 3FZFA 3TANA 3A8YA 2O8BA 1RT7A 3C6HA 1T8EA 4LSNA 3MX2A 1HR0K 1H1VA 4JKBA 3OYJA 5C2FA 3BDPA 4DU4A 3LZIA 1Q9XA 4CJ5A 1N32K 3VEYA 4DSJA 5AFUH 4RCHA 3VGKA 3F9MA 3VEVA 1L3TA 1E4GT 3M8PA 2HBKA 1QHTA 4AQYK 4FPAA 4FM1A 2DPNA 4CZEA 1QQCA 1EKEA 3AVKA 3OYKA 2V7YA 2IS3A 1NG9A 3KKRA 4IFVA 5HBMA 2O4IA 1VSHA 5C12A 4JI2K 3J8AA 2YHWA 1S1VA 1XWLA 4KB1A 3PO5A 2X6NA 4CZIA 3KLHA 4CJRA 4CCHA 4QAGA 2FC0A 3G71N 1XUPO 1TKTA 2RE2A 1BCOA 3ZSOA 3UB5A 4CJWA 5EXWA 3THYA 1X9MA 2P9UA 4A62A 3SZ2A 3DLHA 5FPEA 1ASWA 4DTJA 4X64K 4A61A 1S5JA 2W6KA 3MEGA 4AHTA 3RMDA 3HO1A 2KTQA 1JKHA 1DKGD 1KVCA 3FR0A 4IFEA 3VF2A 2QM1A 1J5OA 2OPRA 3OYEA 1EWQA 4EFHA 1ASVA 3VETA 2ASOA 4MDBA 4M3YA 4H4OA 1KAYA 4KTZA 1NK8A 3SBTA 3LM2A 2I7PA 3S3OA 4BWJA 1RTHA 2KHOA 2YNIA 1J5EK 4E0DA 4B9SA 1N5YA 2F8SA 2F7TA 2I5JA 4BRCA 4FJIA 3SAGA 1UAXA 3WXJA 4FWQA 2PY5A 3L4IA 4H0VB 1YUWA 1C0FA 2AA4A 3BF3A 5I9EB 3O5BA 1DTQA 5F0XA 3OYMA 4Q5VA 3RR8A 5BPMA 1L5UA 3P4IA 2PFUA 3K5LA 4CEOA 4EAHD 2O8DB 4BDPA 4DTUA 4BR4A 2P51A 2HHTA 2FSJA 5AJ3K 3CCRN 3ATUA 4DS5A 1RT4A 3O6WA 1ZXOA 2HHSA 2E5LK 4JKCA 2Z1GA 3TSQA 4KB0A 2P9LA 2QW9A 3KJVA 3ZT0A 3AO2A 1F21A 2CGLA 2Q1NA 3DRSA 4DV4K 4FJXA 4DR4K 3AVJA 4OKKA 1WOQA 4CESA 4B8AB 4CZJA 1TL3A 4EP4A 3E01A 1L3SA 1GOBA 3N4PA 3FFIA 1IJJA 3ENBA 4GVEA 1VSLA 2IGIA 3MXMA 4Y0WA 5KQDA 2Z1IA 4NB4A 3OJSA 3TABA 3AA3A 1CXQA 4E7IA 3WQTA 3HP9A 3OYFA 4RW6A 3ZSRA 2HHWA 2WOMA 1BUPA 3QICA 1JLEA 2A3ZA 4EHTA 3VQPA 1FKPA 1N33K 2P1JA 1KFSA 3EN9A 1WBBA 3AVMA 3CJBA 5J1EA 1BL3A 2JGUA 2OYQA 3K5MA 1A5WA 1WLJA 4DF4A 4H0XB 1K8AO 4C8NA 3T1YK 3ZSVA 3AVNA 3DI6A 3RSEA 2P5OA 5M1NA 4E7JA 4DTNA 2KZZA 2I7NA 1WSHA 5AQTA 1VQNN 3TPQA 5K14A 4O8UA 1TYQA 2F9TA 4JI6K 4J2AA 1NJZA 5LMUK 1UA0A 1QS4A 4PKIA 3W3DA 4I6MB 1IBMK 3CJ9A 1HKBA 4CZLA 1ASUA 4JLHA 4LF5K 3DXMB 3L6QA 3SK3A 4DV3K 4CZMA 2X74A 5AQFA 4YY3K 2A5XA 3K5NA 1C6VA 4RG8A 4WQ5C 3D2EA 1VRTA 4BQLA 4FOEA 3HVRA 3I55N 4WE1A 3ZT4A 3OS0A 2A1RA 2O8FA 4V19S 2XO7A 4LF4K 4XEIA 3W0LA 3T3FA 3SUOA 2QTDA 2RKIA 4M63C 3HYFA 2Q97A 5M1OA 4H8KA 3O4QA 3VF4A 3AY9A 3K5OA 2BANA 3QFPA 2ZM6K 3M8SA 3LDPA 3FZMA 5FLXO 2WC9A 1YHQN 2OPSA 3C7NA 4JHDB 2GX9A 2Q3SA 4HUGA 4HUFA 1N34K 1E3MA 4YOUA 4JKGA 3NH1A 1LAWA 3ASMA 4OLAA 3OHRA 1SAZA 3NGYA 5BRFA 3SLCA 5HRRA 5KGWA 3TTCA 3WNGA 1K8KA 3WNFA 3HSTB 1U04A 3AVHA 4BRFA 3L2WA 4U7BA 4BRNA 4CK2A 1NKEA 3MEEA 4A2AA 1V4SA 5E84A 3M8RA 4E7LA 4FJGA 3H1QA 1RT5A 3SMPA 3VF6A 2D4WA 3MWPA 2NRZA 4CHYA 3VQDA 3VESA 4CJ3A 4BDYA 4FLXA 3GBTA 1L3VA 3LP2A 3IKMA 3SI6A 1ZC6A 3DWLA 3THVA 1GLLO 5LL6Z 2HHQA 1I94K 5A2QO 3M6GA 3AO5A 3KVGA 3O08A 4DSKA 2HNYA 2OPPA 1OH8A 2YKMA 4KKOA 4R79A 3MX5A 2D0BA 3SJJA 2DTUA 3AA5X 3HBTA 3HSCA 2P9NB 3VOVA 1N36K 4KH5A 3DLKA 3A0IX 4G1QA 2HVHA 4Z4IA 4CJSA 1D9FA 3J7ZO 4JD2A 5AQSA 2KFNA 3L2QA 2CGKA 3VQBA 4GW6A 1XI1A 4LSLA 1DT9A 1VQON 4DR2K 3AVAA 4W5TA 1C0UA 4UY8O 5J2PA 2E6LA 3CYMA 5SZTA 2UUAK 4DTRA 3D2FA 5C2DA 2FXUA 5FDLA 5F2RA 4YDUC 4RWTA 3MN7A 1JLQA 1HNVA 2HMPA 4FLWA 3HI0A 3S41A 4DR6K 4NYFA 4O5FA 4CJPA 3UE5A 2O8EA 2ZJRL 5AZIA 1D9DA 4QS7A 1HPMA 3VQQA 3DXKA 3NH0A 4ELUA 3R8EA 4FWKA 1KTQA 4JNEA 1J53A 2P9IB 3LPTA 1ZBHA 4AM7A 3OA9A 3PIOL 4CHZA 1RTIA 1NJWA 1QZ6A 3MXJA 3G10A 1VSMA 3O3HA 1B92A 3V1OA 4KREA 4DTOA 5AQZA 4AM6A 2OZSA 1XMOK 1RDAA 1SS6A 1KFDA 2NRXA 4CZFA 1U2VB 4CZHA 5HROA 4AHVA 1K73O 1HNWK 4FWLA 5HLFA 1WB9A 3V81A 4KI4A 4CEEA 3MN9A 3WEEB 4JV5K 4IFYA 3NHGA 1BI4B 1S1WA 3OYDA 3HPOA 3DMJA 4FVUA 1A5XA 2WTUA 2HVIA 5KPZA 3V9XA 1KVBA 1VSFA 1GLJO 2QWMA 4JI5K 4IBNA 2OA8A 3CQYA 3NF8A 3CCUN 4W5NA 3R1XA 2PYJA 4CD3A 4I2PA 4KHNA 3CCQN 2V52B 4C1NI 4YNQA 2G8WA 2O8CB 4PHTX 4NO7A 5C10A 5JVHL 3RMBA 4X62K 1WSIA 4CEFA 3AO3A 4BG8A 4BVPA 1O13A 4FK0A 1J54A 3CF5L 2HBMA 3O3GA 3PX0A 3DLLL 2GV9A 3DRRA 3JAMO 4FJNA 1HYVA 3NAEA 3RTVA 2G8UA 1ATRA 1RTDA 2EX3A 4JYAK 2PBDA 3O3FA 5KQ8A 4JI0K 4B9MA 5GAHP 4JK9A 5KRSA 3BF1A 4IOAL 2YCHA 4DFJA 4BE1A 3BEXA 4E1MA 4N5SA 2D1KA 1NGBA 3ZX2A 3CETA 4JK8A 2ATQA 4RTFD 4FW1A 3WXMB 2BH1A 4N56A 4WQ4C 5CZ2A 4ISEA 3T69A 4BROA 3IS9A 1TUYA 3QEWA 2VYPA 2E88A 4KV8A 3QO9A 3WXKA 4JI8K 1YXQA 4DV2K 5EX5A 1KLMA 3UKRB 4B3SK 1ZYQA 2HBJA 3VQCA 2UXCK 1S22A 1WSFA 1NGFA 1IG9A 4B3TK 4MLHA 2P9KA 4JI1K 1NBWA 2WUSA 4CHQA 1X9SA 2FBVA 4DF8A 1M1KO 2E1ZA 4DQ8A 1VSDA 3P5JA 4FM0A 4FJHA 3CJ7A 4OPHA 1OH5A 3LP1A 4OKJA 4DMNA 4IOXA 3P39A 4IO9L 1JLAA 4JI7K 4WFNL 2OCEA 5FRMA 1WSJA 1C1BA 1HPZA 2QWNA 4OPAA 4N47A 2ETJA 1ZBIA 2V7ZA 5BPLA 2XY8A 4KO0A 2D0OA 3VQ7A 1QSSA 1NGCA 3LP0A 1ZBUA 5I42A 2P9SB 3AGRA 1X3MA 1LWFA 1U6ZA 3ZEUB 2Z1JA 4QCLA 3OYLA 3MCPA 4JKAA 2BTFA 1WAFA 2NNWA 4CK3A 2HHVA 3V1RA 2VWBA 3OYBA 4NYNA 1LW2A 4JAXA 3KLGA 3F73A 1T7PA 1YT3A 1CZBA 3EL2A 4H4MA 4FZXC 2OTLN 4B9UA 2O8DA 4JKEA 4N76A 1T44A 4GV3A 1HRHA 3LDOA 4LF6K 4NCAA 3AGKA 4LC9B 5M1PA 5AQLA 3WT0A 2VWJA 3QEPA 4F8RA 3PSIA 4CEQA 3MECA 2HF4A 4FWNA 2BUPA 4DHYA 4Q0BA 5DMRA 2E1YA 4BREA 4YOXA 4QS9A 4CECA 5AQUA 4RW9A 5JS2A 2Y1IA 1S3XA 1U4BA 3MWTA 4XH4A 1HNZK 3OS1A 4LFBK 5JS1A 1BA1A 5H1SQ 4JI3K 3NGZA 3ULEB 5ADXA 5TKYA 3VTHA 3E9OA 4KHWA 1Y64A 3Q7BA 2J4RA 4W5OA 4CBWA 4FWRA 4YORA 4WFBL 3HPHA 4I7FA 4K43A 5LY3A 2KW4A 4CZKA 3K2PA 2XHBA 1RT1A 4GKJK 3SMSA 1NU0A 1TGOA 4X65K 4B3OA 3DLEA 2QK9A 1YVNA 3BGRA 4PQUA 4IXCA 5FROA 3QLHA 3CCJN 3CIPA 2XY7A 3E1YA 3KD5E 1VSJA 3VEXA 1ITGA 3GG4A 1QQOA 3ENHA 4CEDA 3VEZA 1U45A 1X3NA 4FK2A 5I3UA 3HJFA 4CIEA 4DTPA 4CGJA 5DM6L 1RT6A 1NKCA 3PV8A 1SL0A 4O44A 1JLCA 2Q0UA 1OH6A 1I3AA 2ZQBA 4LY7A 1NK0A 3S3MA 4C8LA 3NBPA 4CE9A 3PSFA 4C8KA 3ZLJA 3MN6A 4B1UB 5CE3A 3VA3A 3JS6A 4C8OA 4LFAK 4I6MA 3L2RA 2O8BB 5JICA 5FPMA 5AQMA 2P9PB 3J80O 3T7ZA 1IO2A 3AVGA 3KIOA 3ULDA 3VA0A 3NF9A 2E8AA 3M5RA 1NM1A 4BRHA 4CHPA 1JCEA 2QA4N 4FLUA 1U47A 5AQYA 4H0OA 4BY9C 4F9OA 2QWOA 1QTMA 4DU3A 1NK6A 1HNIA 3I8BA 1RDBA 2VG6A 4A57A 2G8KA 1NGEA 2NRTA 2YHBA 3MK6A 3O9RA 4CJVA 4DV6K 4OKEA 3BP8A 4ILGB 3IFRA 4I2QA 1TAUA 3S9HA 3GE1A 1FKOA 5SWMA 1NGIA 3CXCM 1KXPA 4JN4A 1SQKA 3E66A 2JLEA 3QIOA 4B08A 3LM9A 1QQNA 1SV5A 1UWBA 3NH2A 2XRIA 4JHDA 3ID6A 1HYSA 4FJJA 3OYNA 2YNHA 4ICLA 2P9UB 4DKWA 4BGAA 2QWLA 3OTOK 1VSIA 1ESVA 4OPKA 1RNHA 5AQNA 5AZJB 4OLBA 1ILYA 3O80A 4ELTA 4KFBA 1Q18A 2Q36A 3CQXA 5AQXA 4CJFA 5C0YA 4DFKA 4BRDA 4OX9K 3F5TA 4PKGA 3EEQA 1VAZA 4BE0A 1V4TA 4HHTA 3WXIA 3QESA 1DTTA 3L3UA 1Q86O 4ELVA 2FF3B 3QEVA 2W42A 5JLFA 2QKBA 3U9DA 2VQEK 3CERA 5GAGP 3CM6A 4C23A 2YV0X 4J8FA 3QIPA 4HTLA 1JLGA 2E6MA 3L2VA 3AVIA 2ZD1A 1IKXA 2UUCK 2G8IA 4KAZA 1JXBA 1X9WA 4CGDA 2P9NA 3OY9A 4AHUA 4UQGA 4XH1A 5AQPA 3QBXA 3HP6A 1U49A 3NMUA 3CM5A 2F4VK 4NXMK 1TK5A 4BRLA 4DB3A 3V9ZA 1W0HA 1VQLN 1VQ4N 3SAFA 1Q82O 1WSGA 1GOCA 1YJ9N 1HQEA 2P9LB 2E2QA 3R6MA 3DRPA 4WYBA 3DM2A 3VPZA 4KTQA 4DUZK 3AVCA 3QBWA 5BRHA 1IKVA 1TKZA 4K8XA 5CR4A 5EOYA 3E9LA 3AVLA 4O5BA 4KHUA 1Q8IA 3CQ8A 3NVKA 3K58A 5GIPA 3NDKA 3OS2A 1YIJN 3L0QA 4FLYA 3NFAA 1RBRA 4DSEA 3O4WA 3L4QA 1KVAA 2HB5A 2FLOA 5FRNA 2BGGA 3BUZB 2A6AA 4GV9A 3V9WA 1R59O 3S3NA 2D0CA 3V4IA 3ATVA 1U48A 3K9KA 3HVTA 2YHXA 3O9SA 2KQ2A 4IJNA 5C42A 3UKUB 4RW4A 2NRRA 4GMJB 4BRKA 4CI6A 1BIZA 3TAFA 3IRXA 3NGIA 3L2UA 1K9MO 4L8RB 4IDKA 1J9AA 4LH4A 4IOCL 4IEEA 5E26A 3PIPL 2P9IA 2UYTA 4H03B 5IWAK 4BC3A 3K0SA 1QZ5A 1CZAN 1W7AA 4CGGA 1JL2A 4CERA 4WF9L 4K25A 2AJQA 3P38A 3U3GA 4IWVA 3RSEB 2B4JA 2YNFA 3A5MC 2WBNA 4A2BA 4JRPA 4AHCA 4MO4A 4H0PA 1FJGK 4CF8A 1S9EA 1QQMA 1RBVA 4DV0K 1BU6O 3WEEA 5B8HA 3IMXA 1BQMA 4ID1A 3OBWA 2GUIA 5FPNA 3EE8A 3MAQA 1ZBFA 1YJWN 4FW2A 1RTJA 3HZ6A 4GNIA 3K59A 3AVBA 4FL9A 3ZSXA 3TAMA 3WXLA 1OVYA 1NK7A 1DGKN 4CF0A 3V6DA 2QKKA 3EY1A 1QE1A 4DQQA 1KRPA 3KHYA 5CYQA 4DLEA 3G4SN 1VQKN 2VGNA 4CGIA 5HRSA 2ZGYA 1VQ9N 5AQVA 3HRGA 3HOSA 4JS5A 4FOIA 3C6UA 1S1TA 4CGFA 4EP5A 4BG9A 4MDAA 4E1NA 3TWHA 3OJUA 3LAMA 4PL7A 3QERA 3THXB 2YJFA 5KI6A 4BRGA 3KTQA 5J2NA 2PAVA 1GOAA 4K41A 1C1AA 3CHWA 3R3LA 3G6EN 4CD1A 1KCFA 3WUHA 1KC8O 1TL1A 4CJ7A 3H3NO 1RGIA 1RBSA 3C7NB 1IKYA 4O0JA 5LJVA 3HM8A 4NLBA 4B9TA 2QXLA 1WSEA 3ZX0A 3OYHA 1RDDA 1NJIO 1FW6A 4PY5A 5ELZA 3WQUA 4ISFA 4CF2A 1MA9B 4PL8A 5HRPA 3EE9A 3CPWM 4OVLA 1G99A 5BN8A 4DS4A 4M7YA 1K8KB 1NKBA 4JI4K 1NGHA 2YX6A 2D0AA 3SPZA 2QXFA 4F4KA 2RPIA 1BOTO 1BO5O 1KAZA 3VQ6A 3QFUA 3LAKA 1TKDA 4OGEA 3CFOA 5AR0A 3UKRA 4A5AA 4L3QA 3OYAA 4DCHA 4CJ4A 3ITHA 5JMVA 1LCUA 3CC4N 3PY8A 3BZCA 3DLGA 3VEOA 1TK8A 3CJAA 4MO5A 1NLVA 1SKRA 4DWIA 4KPYA 4O4GA 3NF7A 1VQ6N 4CFAA 2ZWHA 4KH6A 3JSMA 1KD1O 2IAJA 1VQ5N 5C24A 3EYZA 4IDHA 1S1UA 4FZYA 1Y97A 2ZF5O 3VTIA 4LFCK 3LDLA 1GLDG 3T1HK 3HK2A 3QB0A 3I56N 3CD6N 3I33A 4CJLA 5GIOA 1UOCA 3EZWA 3IG1A 3FFKB 3P83D 3DLBA 4KTWA 5HOOA 3ALYA 1GLAG 1JLBA 1RDWX 4YOVA 5ADXH 3ZSZA 4CK1A 1MDUB 4CIGA 4DR1K 2UU9K 2RHKA 3AA4A 3H1VX 5AQOA 1NMNA 3EKUA 3D2FB 4B8CA 4Z4FA 1HX1A 1RDCA 5BRDA 4LF8K 2FSKA 5BR9A 1IBLK 5D3GA 2EWSA 1XNRK 5AQWA 2F8TA 2OPQA 3IUCA 3LANA 1L3UA 3VN5A 3AO4A 3EO3A 3HTVA 3R9PA 4WCEL 2E4LA 1P8ZA 3HL8A 3LZJA 5CZ1A 2O8EB 3P1GA 3VGMA 2GEMA 3F9KA 4OJRA 4CBXA 3QEXA 3LDSA 1Q81O 5CYMA 3KZBA 4H5TA 4DSIA 5BN9A 3C65A 4PKHA 3TU5A 3WNEA 1MWMA 3RVCA 1S72N 3H08A 1C0MA 2IVNA 3AA2A 1QSLA 4BVOA 1VQ7N 1T03A 4DTSA 4BRPA 3ZSQA 4K0KK 4WQ5A 1W2BM 4M3ZA 4FO0A 5AQRA 1NGGA 1IG8A 3C0BA 1Q7YO 3ZT3A 3BY5A 3SNNA 3MDQA 3ULEA 3CFRA 2BE2A 1VSEA 4FVMA 4FK4A 1KAXA 2D0PA 3VQ9A 4HWIA 3EKSA 4FM2A 4IEIA 4DV1K 2YJEA 3KK1A 1QVGM 4FXDA 3CCMN 2YNGA 3ZSWA 3QNOA 1FK9A 3SBGA 5LMNK 5J2MA 1GLBG 1YI2N 4Y1CA 1NWKA 2F96A 4M45A 3D45A 5GADP 4CJQA 3QNNA 1YITN 3KK2A 3F2KA 4HVJA 2PZSA 1I39A 2E2NA 3OYIA 2ITGA 5C15A 1SKSA 1BISA 3UIQA 5EU7A 4KHYA 4EZ9A 3M3ZA 3SPYA 4CHOA 4BE2A 3KK3A 3H46O 4IO8A 4W5RA 4F2RA 1GLEG 1X9JA 3B6PA 3J81O 4BQZA 4HUEA 1KQSM 3B6OA 2NLXA 1K6YA 3G25A 2XY5A 2RF2A 2HBLA 4Y1DA 1TAQA 3HOTA 2P9PA 2Z1HA 1BIUA 3PUFA 4K42A 3T1AA 4FJ8A 5M1FA 4BR0A 4EZ6A 1NNEA 4WFAL 3LALA 4CEBA 4CHNA 1HNXK 4CFCA 3CC2N 2H3GX 3CG7A 3ZYYX 3GL1A 4CEZA 3DOLA 5DK5A 1EP4A 4O8KA 4DTMA 4ZTJA 3ZETB 5C25A 2KZMA 2OTJN 3SQ1A 4DQIA 3DLRA 2VG5A 1EXQA 3I0SA 2P9KB 4BRIA 1HJRA 2ZJQL 3MMVA 4CIFA 3ENOA 3OBYA 3AAPA 3E9PA 2OANA 3DYAA 3ID8A 2A1SA 4YFUA 4HCBA 4I9LA 5BR8K 2D5RA 3O8MA 4B1XB 4B9QA 4OPJA 1N6QA 4GVMA 2BDPA 2CGJA 2A41A 4M41A 4B9VA 4YDUA 5F1XA 4Z4CA 2IVPA 3TR8A 5AZJA 1NGAA 3I8DA 3FZKA 1BDGA 1NMDA 1YAGA 2E2PA 1LOTB 4ILJA 5AQQA 2P5GA 4FZZA 3M8QA 4IG0A 1C0TA 3THWB 3SUNA 4JRQA 2CH5A 4AF1A 3DJCA 1RFQA 2HHUA 3SQ4A 1YJNN 1VQMN 3KWIA 1W9HA 4MQ3A 3CMEN 3VMFB 3SUPA 3CMAN 4B1ZA 2ZGZA 5EY4A 1W97L 4B1YB 4O0IA 4IZ9A 3K9JA 4PUOA 3DXMA 1ATSA 1YF5L 2HMIA 3SUQA 2E20A 1XMQK 1NK5A 4DG1A 3TARA
chains in the Genus database with same CATH topology
1WUAA 2FLOA 4AM6A 3CI5A 3BUZB 2A6AA 4GV9A 1SS6A 2NRXA 1TUUA 3FZLA 4CZFA 1R59O 1U2VB 4CZHA 5JVGL 4JEPA 3C6AA 3ATVA 2NRHA 1K73O 3K9KA 4FWLA 5TKWA 3TSUA 2YHXA 4OO1J 3SJHA 1T6CA 3O9QA 2IVOA 3O9SA 1VQPN 3MN9A 3WEEB 4IJNA 3UKUB 1BA0A 2NRRA 5EVZA 4BRAA 4BRKA 4CI6A 5KPRA 3FE1A 4FVUA 5M1KA 4EIAA 2QEXN 4GY2B 2HSTA 2Q31A 3JXUA 4XH5A 5KPZA 1EQYA 1K9MO 3GDQA 3FZFA 4IOCL 4IEEA 3A8YA 2JWKA 5E26A 3PIPL 1GLJO 2QWMA 3C6HA 3CQYA 2P9IA 3MX2A 2UYTA 1H1VA 4JKBA 4JKFA 5BREA 4H03B 3CCUN 5KPTA 4BC3A 5C2FA 3R1XA 5JLHA 1QZ5A 1CZAN 1QVFM 4KBOA 5GINA 4WF9L 4CD3A 4K25A 3CCQN 3P38A 2V52B 2WFBA 4IWVA 3RSEB 4C1NI 2QWQA 4FWPA 4PHTX 4NO7A 3A5MC 5C10A 2WBNA 5JVHL 3VEYA 5AFUH 4RCHA 3VGKA 4FWMA 3F9MA 3VEVA 4A2BA 1E4FT 1RDUA 1E4GT 1T6DA 4MO4A 4H0PA 4BG8A 4BVPA 1O13A 2HBKA 2FF6A 3CF5L 4FPAA 2HBMA 1QQMA 2DPNA 4CZEA 3DLLL 1BU6O 3WEEA 5B8HA 2V7YA 1XC3A 3IMXA 3UKUA 5AFUA 2GUPA 2ASMA 3OBWA 5FPNA 3EE8A 1YJWN 5C12A 3HZ6A 4FWOA 4GNIA 3J8AA 2V51B 4FL9A 1ATRA 2YHWA 3KK7A 3WXLA 1OVYA 1DGKN 2PBDA 1JCFA 5KQ8A 1GLFO 4BRMA 1QHAA 2JWLA 4CZIA 5GAHP 3KHYA 4JK9A 3G4SN 1VQKN 3G71N 1XUPO 2RE2A 2VGNA 3BF1A 4IOAL 2YCHA 4H5NA 3UB5A 2ZGYA 3U4LA 1VQ9N 2ZJPL 3BEXA 5AQVA 3HRGA 5EXWA 3HOSA 4FOIA 2P9UA 4WQ4A 4A62A 3CCEN 2D1KA 1NGBA 3ZX2A 3CETA 4JK8A 4BG9A 4MDAA 5FPEA 2GTDA 4RTFD 3WXMB 2BH1A 4A61A 4IJAA 4WQ4C 4PL7A 4ISEA 1DKGD 3FR0A 4IFEA 2YJFA 3T69A 3VF2A 4BROA 3CCLN 1TUYA 4BRGA 2QM1A 2VYPA 2E88A 3WXKA 1YXQA 4EFHA 3VETA 2PAVA 2ASOA 2VCPA 5EX5A 4MDBA 3UKRB 4K41A 4BR9A 3R3LA 3CHWA 2HBJA 1BG3A 4CD1A 3G6EN 1KAYA 4FSVA 3WUHA 3SBTA 3LM2A 1KC8O 2I7PA 1S22A 1NGFA 4CJ7A 3H3NO 2KHOA 2ASPA 2P9KA 3C7NB 2QI2A 2WUSA 1RGIA 1NBWA 3LDNA 3QMLA 4MLHA 3VEWA 5LJVA 2NZTA 3HM8A 4H0TB 4NLBA 2F7TA 4BRCA 4EHUA 2QXLA 3CJ1A 5CHIA 3SAGA 5M1QA 3ZX0A 2E1ZA 3WXJA 1M1KO 3H6EA 4FWQA 3L4IA 4DQ8A 4H0VB 3QDKA 3CJ7A 1NJIO 1YUWA 1C0FA 2AA4A 3LDQA 4OPHA 5ELZA 3WQUA 3TSPA 4ISFA 3BF3A 5I9EB 1MA9B 4PL8A 4IOXA 3EE9A 3O5BA 5BN8A 1G99A 3P39A 3CPWM 4M7YA 1K8KB 3P31A 4H5VA 5F0XA 1NGHA 2YX6A 4FPBA 4IO9L 5BPMA 4WFNL 4U67L 3P4IA 2PFUA 1BOTO 1BO5O 1KAZA 2A42A 2GWJA 4EAHD 2QWNA 1ATNA 4BC2A 3QFUA 4OPAA 2W40A 4BR4A 5FPDA 5AR0A 5BPNA 1NGJA 2V7ZA 5BPLA 3UKRA 4A5AA 2FSJA 3H3OB 4L3QA 3CCRN 3ATUA 3CCVN 3O6WA 5AQJA 1HLUA 1ZXOA 4DCHA 2D0OA 1NGCA 4BR7A 5JMVA 4BC4A 4B1WB 1LCUA 3CC4N 3FLCO 4JKCA 3TSQA 2P9SB 3AGRA 4NLCA 3VEOA 1X3MA 3CJAA 4MO5A 2P9LA 2QW9A 3ZEUB 1NLVA 1U6ZA 2W41A 1VQ6N 2CGLA 2Q1NA 2ZWHA 3CJCA 4KH6A 1KD1O 1C0GA 3OW2M 1VQ5N 1N8RO 1J6ZA 4G9ZA 1WOQA 3MCPA 4IDHA 4JKAA 2BTFA 4CZJA 2NNWA 2ZF5O 2VWBA 4JAXA 2A40A 4JKHA 3H45C 3VTIA 3LDLA 1GLDG 3EL2A 2KKZA 2OTLN 1T3VA 3A5LC 3N4PA 1IJJA 3QB0A 3I56N 3CD6N 4JKEA 3I33A 1T44A 5GIOA 4GV3A 3A5NC 3ENBA 4GVEA 3LDOA 3EZWA 1U2VA 4Y0WA 3KWGA 5KQDA 3AGKA 4LC9B 1TYQB 3FFKB 5AQLA 5M1PA 4NB4A 1M90O 3WT0A 5HOOA 1GLAG 3WQTA 4YOYA 2HF4A 4KH4A 4FWNA 2BUPA 4DHYA 1RDWX 4YOVA 1BUPA 2E1YA 3LL3A 4BREA 3QICA 4QS9A 5ADXH 5AQUA 4YOXA 1MDUB 2A3ZA 4EHTA 2NRVA 1S3XA 3MWTA 2RHKA 3IDHA 3H1VX 5AQOA 3EN9A 4XH4A 3CJBA 3MN5A 1BA1A 3EKUA 4H0XB 3D2FB 5H1SQ 1K8AO 3ULEB 1HX1A 3D2EB 5ADXA 5BRDA 1HUXA 2FSKA 5TKYA 3RSEA 2GWKA 3VTHA 3PLAA 3E9OA 5M1NA 1Y64A 5BR9A 3Q7BA 2J4RA 2IIRA 2EWSA 4CBWA 5AQWA 4FWRA 2I7NA 3IUCA 4YORA 1VQ8N 3CC7N 5AQTA 1VQNN 4WFBL 3EO3A 3TPQA 2HF3A 4K43A 5LY3A 3HTVA 3R9PA 4WCEL 1P8ZA 4O8UA 1TYQA 5MLCQ 4CZKA 3VGMA 2GEMA 2F9TA 2F9WA 4CBXA 1Q81O 1D4XA 3KZBA 4H5WA 4H5TA 3SMSA 3C65A 4JKDA 4PKHA 3CPEA 5BN9A 4PKIA 1MWMA 3TU5A 4I6MB 3W3DA 4BGBA 3CJ9A 1HKBA 2QWPA 3N4QA 3RVCA 4CZLA 1S72N 2IVNA 1YVNA 2YHYA 3AARA 4BVOA 1VQ7N 4IXCA 3DXMB 4E1JA 3L6QA 3CCJN 3CIPA 3E1YA 4BRPA 5GAEP 3FZHA 3O9TA 4WQ5A 3SK3A 1W2BM 4CZMA 4FO0A 5AQRA 1NGGA 3VEXA 1IG8A 1SZ2A 3C0BA 5AQFA 1Q7YO 2A5XA 4JKGB 3GG4A 5AQGA 1HKGA 1QQOA 3MDQA 3ENHA 4WQ5C 3GOIA 3ULEA 3VEZA 3D2EA 4BQLA 4FOEA 1X3NA 3I55N 4YOTA 4GV6A 5DM6L 2Q2RA 3AAQA 1KAXA 2D0PA 4HWIA 3EKSA 3NVMA 2Q0UA 4IEIA 4XEIA 3W0LA 2YJEA 1QVGM 2QTDA 3CCMN 4M63C 3A5OC 2Q97A 5M1OA 3SBGA 3VERA 4RWTA 1GLBG 1YI2N 3MN6A 1DEJA 4B1UB 5CE3A 3VF4A 3AY9A 3JS6A 1NWKA 2GELA 3D7EO 3QFPA 4I6MA 4BR2A 3LDPA 5JICA 5GADP 3FZMA 3U8XA 5FPMA 5AQMA 2WC9A 4QS8A 2P9PB 4BR5A 1YHQN 3T7ZA 1YITN 3C7NA 2E8AA 3F2KA 3M5RA 1NM1A 2GX9A 4JHDB 4BRHA 2E2NA 1JCEA 2QA4N 4YOUA 5C15A 5AQYA 4H0OA 4JKGA 1EO1A 3D6RA 4BRQA 3O1WA 4BY9C 4F9OA 2QWOA 3OHRA 1SAZA 4B1VA 3I8BA 5BRFA 3M3ZA 4A57A 3SLCA 1NGEA 3TTCA 2NRTA 3H46O 4IO8A 3ZX3A 1K8KA 1P90A 3MK6A 3O9RA 1GLEG 4BRFA 1X9JA 4U7BA 3BP8A 4ILGB 4BRNA 3IFRA 1JJ2M 3GE1A 3B8AX 4A2AA 5HL7L 1NGIA 1V4SA 5E84A 3CXCM 4BQZA 1KXPA 4JN4A 1KQSM 4H5RA 2NRWA 2NLXA 3MCAB 3G25A 3H1QA 1SQKA 3SMPA 1XQSC 4JD2B 3E66A 3VF6A 2D4WA 3MWPA 3LM9A 2NRZA 2HBLA 1QQNA 3VESA 3HOTA 2QWRA 2P9PA 1JCGA 3GBTA 3IKMA 3VGLA 4JHDA 1ZC6A 4K42A 3DWLA 3ID6A 2P9SA 1GLLO 5M1FA 2KLAA 2YI1A 3ZEUA 4BR0A 2P9UB 4WFAL 3M6GA 4DKWA 5AQKA 4BGAA 2QWLA 3KVGA 3O08A 1ESVA 3CC2N 2H3GX 4R79A 3ZYYX 3GL1A 3O9UA 1HKCA 3MX5A 5DM7L 5AQNA 4O8KA 5AZJB 3HBTA 3HSCA 1ILYA 3O80A 2P9NB 3ZETB 4MLEA 3VOVA 4KH5A 1Q18A 3DAWA 2OTJN 3A0IX 2Q36A 3CQXA 5AQXA 5C0YA 4YOWA 4BRDA 4M7XA 3J7ZO 2P9KB 3F5TA 4JD2A 5AQSA 4BRIA 4A59A 3TTFA 4PKGA 1VAZA 1V4TA 3Q7CA 3WXIA 1NGDA 3M1FA 4JK7A 2CGKA 3MMVA 4A5BA 2FF3B 5AZIB 2ZJQL 3CCSN 1Q86O 2CH6A 3ENOA 3OBYA 1DT9A 3AAPA 3E9PA 3DXKB 2OANA 2Q0RA 1VQON 5JLFA 3ID8A 3U9DA 4FWSA 1OKJA 3CERA 4UY8O 5GAGP 4C23A 4J8FA 3O8MA 4B1XB 4B9QA 4HTLA 2E2OA 4CBUA 5LJWA 2CGJA 1BWFO 2A41A 3SAHA 3FGUA 3D2FA 4YDUA 4BC5A 5F1XA 1Z6RA 2IVPA 5AZJA 1NGAA 4ISGA 2FXUA 5C2DA 2P9NA 3O1BA 3ZETA 1MWKA 3FZKA 4CZGA 5F2RA 1BDGA 1NMDA 1YAGA 3MN7A 4XH1A 4YDUC 2E2PA 1LOTB 4ILJA 5AQPA 4Z94A 2HMPA 3QBXA 3HI0A 2HOEA 4H0YB 5AQQA 3S41A 3TTDA 3VENA 5BRHA 3NMUA 5AQIA 4ILHA 2ITMA 4O5FA 4BRLA 4DB3A 1VQLN 2CH5A 3SAFA 4AF1A 1Q82O 3DJCA 1VQ4N 3UE5A 1RFQA 1YJ9N 1YJNN 1VQMN 2ZJRL 3KWIA 5AZIA 5AQHA 2P9LB 1GLCG 2E2QA 4QS7A 3R6MA 3VMFB 1HPMA 3CMEN 3DXKA 4WYBA 1Z05A 3VPZA 2AP1A 3CMAN 3R8EA 4B1ZA 4FWKA 2ZGZA 3QBWA 4JNEA 1W97L 5EY4A 4B1YB 4IZ9A 2VGMA 3K9JA 2P9IB 5CR4A 5EOYA 3E9LA 1HJOA 4AM7A 3OA9A 2FSNA 3NVKA 1ZBSA 3DXMA 1ATSA 1YF5L 5GIPA 3PIOL 2E20A 1QZ6A 1YIJN 3L0QA 3U9ZA 4C1NK 3O4WA 3L4QA 5AQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPA A;  3O9T A;  3KWI A;  3EE8 A;  3P38 A;  3F5T A;  3O9R A;  3O9Q A;  3O9S A;  4OPH A;  2KKZ A;  2RHK A;  3OA9 A;  3M5R A;  3EE9 A;  2GX9 A;  3P39 A;  3P31 A;  3KWG A;  3O9U A;  3RVC A;  3D6R A;  3L4Q A; 
#chains in the Genus database with same CATH topology
 1WUA A;  2B6A A;  1RT2 A;  1OVQ A;  3CI5 A;  3KKS A;  1TUU A;  4YHH K;  4DLG A;  3C6A A;  3HXM A;  5TKW A;  1IH7 A;  2IDO A;  4OO1 J;  1LWC A;  3O9Q A;  2IVO A;  4KHP K;  3VQE A;  1BA0 A;  4BRA A;  3NE6 A;  3FE1 A;  4Z4E A;  1TKX A;  2RN2 A;  2FBY A;  3TAE A;  4XH5 A;  1D5A A;  1EQY A;  4NCG A;  3GDQ A;  1FXX A;  4B3R K;  4RW8 A;  2JWK A;  4AIL C;  3LWM A;  4JKF A;  5BRE A;  5KPT A;  5JLH A;  1QVF M;  4KBO A;  2X6S A;  5GIN A;  3MXI A;  2WFB A;  2LSN A;  1BCM A;  2QWQ A;  4FWP A;  1JLF A;  3RRH A;  3RMA A;  4OGC A;  2DY4 A;  3THY B;  4FWM A;  4LF9 K;  4KRF A;  1EET A;  1E4F T;  1RDU A;  4M3R A;  1T6D A;  4LF7 K;  1HMV A;  2IOC A;  2FF6 A;  3K57 A;  1IBK K;  1NJX A;  4CJK A;  4F3O A;  1XC3 A;  3UKU A;  5AFU A;  1B9D A;  2GUP A;  4CW7 B;  2ASM A;  1HYZ A;  2IC3 A;  4CFB A;  4F3T A;  4FWO A;  2V51 B;  1BHL A;  4FJ9 A;  4FCY A;  4J2B A;  3KK7 A;  2W6L A;  1JCF A;  3IAY A;  1GLF O;  1VRU A;  1QHA A;  1S6Q A;  2JWL A;  4BRM A;  3SYZ A;  2VG7 A;  1G15 A;  4R5P A;  2G8H A;  1X1P A;  4H5N A;  3V1Q A;  4DSF A;  3U4L A;  2ZJP L;  4FLT A;  4Z4G A;  4E89 A;  3EZ5 A;  1SL2 A;  4WQ4 A;  3CCE N;  2HND A;  2GTD A;  4I9Q A;  3SQ0 A;  4IJA A;  4HTU A;  3CCL N;  3PX6 A;  4E19 A;  1YTA A;  2VCP A;  4BR9 A;  1BG3 A;  4W5Q A;  4FSV A;  4DQR A;  3PX4 A;  2ASP A;  3QML A;  2QI2 A;  3LDN A;  3VEW A;  2NZT A;  4CEA A;  5E41 A;  4H0T B;  2HNZ A;  4EHU A;  3CJ1 A;  5CHI A;  3ZSY A;  5M1Q A;  3RR7 A;  4Z0U A;  3H6E A;  3QDK A;  4NCB A;  3ISN C;  3LDQ A;  1SL1 A;  3TSP A;  3KD1 E;  1HQU A;  2G8V A;  2B5J A;  4E7H A;  2HW3 A;  4JS4 A;  1RCH A;  4KI6 A;  3P31 A;  4H5V A;  4FPB A;  3O4N A;  4DR5 K;  4U67 L;  2G8F A;  2GWJ A;  2A42 A;  3THX A;  1ATN A;  4BC2 A;  3WNH A;  4CJU A;  1VSK A;  2W40 A;  5FPD A;  1RBT A;  1NGJ A;  5BPN A;  2KFZ A;  4IKF A;  3MED A;  3H3O B;  3CCV N;  5AQJ A;  1HLU A;  4BR7 A;  4BC4 A;  1JXE A;  4B1W B;  5IT9 O;  3FLC O;  2XY6 A;  4FJ5 A;  4KHQ A;  1XHX A;  4NLC A;  5J2Q A;  1LV5 A;  3TAQ A;  2W41 A;  4DQP A;  3SV3 A;  3CJC A;  4DUY K;  1C0G A;  3OW2 M;  1N8R O;  1J6Z A;  4G9Z A;  3C94 A;  3OYG A;  1S6P A;  2A40 A;  4JKH A;  3L3V A;  3H45 C;  4Z4H A;  3RMC A;  2KKZ A;  1T3V A;  3A5L C;  4CF9 A;  1TVR A;  1C1C A;  4FJL A;  3A5N C;  1JL1 A;  4M3U A;  1MU2 A;  1U2V A;  4C8M A;  4DR7 K;  3KWG A;  1LWE A;  1TYQ B;  2HHX A;  4NXN K;  1TK0 A;  1M90 O;  1OH7 A;  4ZTF A;  3U6F A;  4BDZ A;  4YOY A;  3HT3 A;  3V9U A;  1YTU A;  4KH4 A;  3C95 A;  4E7K A;  2R7Y A;  4M42 A;  1BI4 A;  1S1X A;  2NUB A;  3LL3 A;  4FJK A;  4MFB A;  1NK9 A;  1RIL A;  2NRV A;  3IDH A;  3KLI A;  3C6T A;  1XHZ A;  2ZE2 A;  1EWR A;  3MN5 A;  4X66 K;  4AH9 A;  3V9S A;  2X78 A;  3D2E B;  1HUX A;  2O8C A;  2GWK A;  3PLA A;  4AHS A;  1BQN A;  1CZ9 A;  2O8F B;  2IIR A;  5KGX A;  5KTQ A;  1VQ8 N;  3CC7 N;  4CFD A;  2HF3 A;  2Y1J A;  5MLC Q;  2F9W A;  3OYC A;  3CFP A;  1D4X A;  3PO4 A;  4H5W A;  2YKN A;  4JKD A;  3U3Y A;  1EX4 A;  3CPE A;  4BGB A;  4DV7 K;  3N4Q A;  2QWP A;  3AV9 A;  2YHY A;  3AAR A;  3QIN A;  2VQF K;  4E1J A;  5GAE P;  3FZH A;  3O9T A;  3KLE A;  1SZ2 A;  1S9G A;  1KLN A;  4JKG B;  5AQG A;  1HKG A;  3QEI A;  3GOI A;  4DU1 A;  3VQ4 A;  4K8Z A;  3SV4 A;  5HRN A;  4YOT A;  3J7Y P;  4GV6 A;  2Q2R A;  3AAQ A;  3HM9 A;  4CJE A;  3NVM A;  3KLF A;  1R0A A;  3NF6 A;  3JYT A;  4ZHR A;  3A5O C;  3LP3 A;  3VER A;  1DEJ A;  3D7E O;  2GEL A;  4PA1 A;  3RWU A;  4BR2 A;  1XNQ K;  3U8X A;  4QS8 A;  4BR5 A;  1SUQ A;  2FBX A;  2YHA A;  5HP1 A;  2O4G A;  3SQ2 A;  4J2D A;  3SCX A;  3HPG A;  4CGH A;  2UXB K;  4LH5 A;  4FJ7 A;  3NCI A;  1NJY A;  3D6R A;  1EO1 A;  4BRQ A;  3O1W A;  4FYD A;  4J2E A;  4B1V A;  3L8B A;  3LWL A;  2DFE A;  2UXD K;  3VQ8 A;  4ID5 A;  2WON A;  3ZX3 A;  3ZCM A;  3BZK A;  4FLV A;  3ZT1 A;  1P90 A;  2UUB K;  4FJM A;  1JJ2 M;  4RW7 A;  2EHG A;  3B8A X;  5HL7 L;  2GBZ A;  4H5R A;  2NRW A;  3MCA B;  2DFH A;  1XQS C;  4JD2 B;  3DOK A;  1IV0 A;  3TI0 A;  1UA1 A;  4GKK K;  3LPU A;  2QWR A;  1NK4 A;  1JCG A;  1DLO A;  2VWK A;  4E3S A;  4CVN E;  3VGL A;  3G0Z A;  1LAV A;  1TV6 A;  1BGX T;  2P9S A;  2KLA A;  2YI1 A;  4BWM A;  3ZEU A;  4KHS A;  3AVF A;  5CY4 A;  4F2S A;  3A2F A;  4DQS A;  4O55 A;  4LD0 A;  5AQK A;  3T19 A;  3O9U A;  4DR3 K;  1HKC A;  5DM7 L;  2OZM A;  1D8Y A;  4MLE A;  1QSY A;  4M3T A;  3DAW A;  3VQA A;  4XIU A;  1YVU A;  1Q9Y A;  1SKW A;  4YOW A;  4M7X A;  1A5V A;  4A59 A;  3TTF A;  4DFM A;  4PWD A;  1VK0 A;  3I0R A;  3Q7C A;  1NGD A;  3M1F A;  4JK7 A;  4A5B A;  5AZI B;  3CCS N;  1VHX A;  2CH6 A;  4BAC A;  3DXK B;  2Q0R A;  1IKW A;  4FWS A;  1OKJ A;  3QET A;  4DSL A;  4FLZ A;  2E2O A;  4CBU A;  3TAP A;  5LJW A;  1REV A;  4IG3 A;  1BWF O;  1RT3 A;  3SAH A;  3FGU A;  1Z26 A;  4BC5 A;  4QOZ B;  1LW0 A;  1Z6R A;  3RRG A;  2HHH K;  3D0P A;  4ISG A;  3O1B A;  1CXU A;  3ZET A;  1MWK A;  4CZG A;  4CJT A;  4Z94 A;  1RBU A;  1B9F A;  3VEN A;  2HOE A;  4H0Y B;  3TAG A;  3TTD A;  5AQI A;  4ILH A;  2ITM A;  4DV5 K;  3ZT2 A;  1ZBL A;  2PYL A;  5AQH A;  4B3M K;  1GLC G;  1Z05 A;  4DTX A;  2AP1 A;  4N41 A;  1WBD A;  1WN7 A;  2VGM A;  3OVN A;  1NOY A;  1HJO A;  1O1W A;  1WNS A;  3VQ5 A;  2FSN A;  1ZBS A;  5T7B A;  1KSP A;  4B9N A;  3U9Z A;  4C1N K;  2DFF A;  2FBT A;  1Z25 A;  4B9L A;  1NOZ A;  3FZL A;  5JVG L;  1CLQ A;  1WAJ A;  4JEP A;  2NRH A;  3TSU A;  3SJH A;  4CF1 A;  1T6C A;  3THW A;  4M3W A;  1VQP N;  4TSX A;  1T05 A;  5EVZ A;  3J7A P;  4DFP A;  4AHR A;  5KPR A;  5M1K A;  5KRT A;  4EIA A;  2QEX N;  4M3X A;  4GY2 B;  2HST A;  3AO1 A;  2Q31 A;  3JXU A;  4HCC A;  1XC9 A;  3FZF A;  3TAN A;  3A8Y A;  2O8B A;  1RT7 A;  3C6H A;  1T8E A;  4LSN A;  3MX2 A;  1HR0 K;  1H1V A;  4JKB A;  3OYJ A;  5C2F A;  3BDP A;  4DU4 A;  3LZI A;  1Q9X A;  4CJ5 A;  1N32 K;  3VEY A;  4DSJ A;  5AFU H;  4RCH A;  3VGK A;  3F9M A;  3VEV A;  1L3T A;  1E4G T;  3M8P A;  2HBK A;  1QHT A;  4AQY K;  4FPA A;  4FM1 A;  2DPN A;  4CZE A;  1QQC A;  1EKE A;  3AVK A;  3OYK A;  2V7Y A;  2IS3 A;  1NG9 A;  3KKR A;  4IFV A;  5HBM A;  2O4I A;  1VSH A;  5C12 A;  4JI2 K;  3J8A A;  2YHW A;  1S1V A;  1XWL A;  4KB1 A;  3PO5 A;  2X6N A;  4CZI A;  3KLH A;  4CJR A;  4CCH A;  4QAG A;  2FC0 A;  3G71 N;  1XUP O;  1TKT A;  2RE2 A;  1BCO A;  3ZSO A;  3UB5 A;  4CJW A;  5EXW A;  3THY A;  1X9M A;  2P9U A;  4A62 A;  3SZ2 A;  3DLH A;  5FPE A;  1ASW A;  4DTJ A;  4X64 K;  4A61 A;  1S5J A;  2W6K A;  3MEG A;  4AHT A;  3RMD A;  3HO1 A;  2KTQ A;  1JKH A;  1DKG D;  1KVC A;  3FR0 A;  4IFE A;  3VF2 A;  2QM1 A;  1J5O A;  2OPR A;  3OYE A;  1EWQ A;  4EFH A;  1ASV A;  3VET A;  2ASO A;  4MDB A;  4M3Y A;  4H4O A;  1KAY A;  4KTZ A;  1NK8 A;  3SBT A;  3LM2 A;  2I7P A;  3S3O A;  4BWJ A;  1RTH A;  2KHO A;  2YNI A;  1J5E K;  4E0D A;  4B9S A;  1N5Y A;  2F8S A;  2F7T A;  2I5J A;  4BRC A;  4FJI A;  3SAG A;  1UAX A;  3WXJ A;  4FWQ A;  2PY5 A;  3L4I A;  4H0V B;  1YUW A;  1C0F A;  2AA4 A;  3BF3 A;  5I9E B;  3O5B A;  1DTQ A;  5F0X A;  3OYM A;  4Q5V A;  3RR8 A;  5BPM A;  1L5U A;  3P4I A;  2PFU A;  3K5L A;  4CEO A;  4EAH D;  2O8D B;  4BDP A;  4DTU A;  4BR4 A;  2P51 A;  2HHT A;  2FSJ A;  5AJ3 K;  3CCR N;  3ATU A;  4DS5 A;  1RT4 A;  3O6W A;  1ZXO A;  2HHS A;  2E5L K;  4JKC A;  2Z1G A;  3TSQ A;  4KB0 A;  2P9L A;  2QW9 A;  3KJV A;  3ZT0 A;  3AO2 A;  1F21 A;  2CGL A;  2Q1N A;  3DRS A;  4DV4 K;  4FJX A;  4DR4 K;  3AVJ A;  4OKK A;  1WOQ A;  4CES A;  4B8A B;  4CZJ A;  1TL3 A;  4EP4 A;  3E01 A;  1L3S A;  1GOB A;  3N4P A;  3FFI A;  1IJJ A;  3ENB A;  4GVE A;  1VSL A;  2IGI A;  3MXM A;  4Y0W A;  5KQD A;  2Z1I A;  4NB4 A;  3OJS A;  3TAB A;  3AA3 A;  1CXQ A;  4E7I A;  3WQT A;  3HP9 A;  3OYF A;  4RW6 A;  3ZSR A;  2HHW A;  2WOM A;  1BUP A;  3QIC A;  1JLE A;  2A3Z A;  4EHT A;  3VQP A;  1FKP A;  1N33 K;  2P1J A;  1KFS A;  3EN9 A;  1WBB A;  3AVM A;  3CJB A;  5J1E A;  1BL3 A;  2JGU A;  2OYQ A;  3K5M A;  1A5W A;  1WLJ A;  4DF4 A;  4H0X B;  1K8A O;  4C8N A;  3T1Y K;  3ZSV A;  3AVN A;  3DI6 A;  3RSE A;  2P5O A;  5M1N A;  4E7J A;  4DTN A;  2KZZ A;  2I7N A;  1WSH A;  5AQT A;  1VQN N;  3TPQ A;  5K14 A;  4O8U A;  1TYQ A;  2F9T A;  4JI6 K;  4J2A A;  1NJZ A;  5LMU K;  1UA0 A;  1QS4 A;  4PKI A;  3W3D A;  4I6M B;  1IBM K;  3CJ9 A;  1HKB A;  4CZL A;  1ASU A;  4JLH A;  4LF5 K;  3DXM B;  3L6Q A;  3SK3 A;  4DV3 K;  4CZM A;  2X74 A;  5AQF A;  4YY3 K;  2A5X A;  3K5N A;  1C6V A;  4RG8 A;  4WQ5 C;  3D2E A;  1VRT A;  4BQL A;  4FOE A;  3HVR A;  3I55 N;  4WE1 A;  3ZT4 A;  3OS0 A;  2A1R A;  2O8F A;  4V19 S;  2XO7 A;  4LF4 K;  4XEI A;  3W0L A;  3T3F A;  3SUO A;  2QTD A;  2RKI A;  4M63 C;  3HYF A;  2Q97 A;  5M1O A;  4H8K A;  3O4Q A;  3VF4 A;  3AY9 A;  3K5O A;  2BAN A;  3QFP A;  2ZM6 K;  3M8S A;  3LDP A;  3FZM A;  5FLX O;  2WC9 A;  1YHQ N;  2OPS A;  3C7N A;  4JHD B;  2GX9 A;  2Q3S A;  4HUG A;  4HUF A;  1N34 K;  1E3M A;  4YOU A;  4JKG A;  3NH1 A;  1LAW A;  3ASM A;  4OLA A;  3OHR A;  1SAZ A;  3NGY A;  5BRF A;  3SLC A;  5HRR A;  5KGW A;  3TTC A;  3WNG A;  1K8K A;  3WNF A;  3HST B;  1U04 A;  3AVH A;  4BRF A;  3L2W A;  4U7B A;  4BRN A;  4CK2 A;  1NKE A;  3MEE A;  4A2A A;  1V4S A;  5E84 A;  3M8R A;  4E7L A;  4FJG A;  3H1Q A;  1RT5 A;  3SMP A;  3VF6 A;  2D4W A;  3MWP A;  2NRZ A;  4CHY A;  3VQD A;  3VES A;  4CJ3 A;  4BDY A;  4FLX A;  3GBT A;  1L3V A;  3LP2 A;  3IKM A;  3SI6 A;  1ZC6 A;  3DWL A;  3THV A;  1GLL O;  5LL6 Z;  2HHQ A;  1I94 K;  5A2Q O;  3M6G A;  3AO5 A;  3KVG A;  3O08 A;  4DSK A;  2HNY A;  2OPP A;  1OH8 A;  2YKM A;  4KKO A;  4R79 A;  3MX5 A;  2D0B A;  3SJJ A;  2DTU A;  3AA5 X;  3HBT A;  3HSC A;  2P9N B;  3VOV A;  1N36 K;  4KH5 A;  3DLK A;  3A0I X;  4G1Q A;  2HVH A;  4Z4I A;  4CJS A;  1D9F A;  3J7Z O;  4JD2 A;  5AQS A;  2KFN A;  3L2Q A;  2CGK A;  3VQB A;  4GW6 A;  1XI1 A;  4LSL A;  1DT9 A;  1VQO N;  4DR2 K;  3AVA A;  4W5T A;  1C0U A;  4UY8 O;  5J2P A;  2E6L A;  3CYM A;  5SZT A;  2UUA K;  4DTR A;  3D2F A;  5C2D A;  2FXU A;  5FDL A;  5F2R A;  4YDU C;  4RWT A;  3MN7 A;  1JLQ A;  1HNV A;  2HMP A;  4FLW A;  3HI0 A;  3S41 A;  4DR6 K;  4NYF A;  4O5F A;  4CJP A;  3UE5 A;  2O8E A;  2ZJR L;  5AZI A;  1D9D A;  4QS7 A;  1HPM A;  3VQQ A;  3DXK A;  3NH0 A;  4ELU A;  3R8E A;  4FWK A;  1KTQ A;  4JNE A;  1J53 A;  2P9I B;  3LPT A;  1ZBH A;  4AM7 A;  3OA9 A;  3PIO L;  4CHZ A;  1RTI A;  1NJW A;  1QZ6 A;  3MXJ A;  3G10 A;  1VSM A;  3O3H A;  1B92 A;  3V1O A;  4KRE A;  4DTO A;  5AQZ A;  4AM6 A;  2OZS A;  1XMO K;  1RDA A;  1SS6 A;  1KFD A;  2NRX A;  4CZF A;  1U2V B;  4CZH A;  5HRO A;  4AHV A;  1K73 O;  1HNW K;  4FWL A;  5HLF A;  1WB9 A;  3V81 A;  4KI4 A;  4CEE A;  3MN9 A;  3WEE B;  4JV5 K;  4IFY A;  3NHG A;  1BI4 B;  1S1W A;  3OYD A;  3HPO A;  3DMJ A;  4FVU A;  1A5X A;  2WTU A;  2HVI A;  5KPZ A;  3V9X A;  1KVB A;  1VSF A;  1GLJ O;  2QWM A;  4JI5 K;  4IBN A;  2OA8 A;  3CQY A;  3NF8 A;  3CCU N;  4W5N A;  3R1X A;  2PYJ A;  4CD3 A;  4I2P A;  4KHN A;  3CCQ N;  2V52 B;  4C1N I;  4YNQ A;  2G8W A;  2O8C B;  4PHT X;  4NO7 A;  5C10 A;  5JVH L;  3RMB A;  4X62 K;  1WSI A;  4CEF A;  3AO3 A;  4BG8 A;  4BVP A;  1O13 A;  4FK0 A;  1J54 A;  3CF5 L;  2HBM A;  3O3G A;  3PX0 A;  3DLL L;  2GV9 A;  3DRR A;  3JAM O;  4FJN A;  1HYV A;  3NAE A;  3RTV A;  2G8U A;  1ATR A;  1RTD A;  2EX3 A;  4JYA K;  2PBD A;  3O3F A;  5KQ8 A;  4JI0 K;  4B9M A;  5GAH P;  4JK9 A;  5KRS A;  3BF1 A;  4IOA L;  2YCH A;  4DFJ A;  4BE1 A;  3BEX A;  4E1M A;  4N5S A;  2D1K A;  1NGB A;  3ZX2 A;  3CET A;  4JK8 A;  2ATQ A;  4RTF D;  4FW1 A;  3WXM B;  2BH1 A;  4N56 A;  4WQ4 C;  5CZ2 A;  4ISE A;  3T69 A;  4BRO A;  3IS9 A;  1TUY A;  3QEW A;  2VYP A;  2E88 A;  4KV8 A;  3QO9 A;  3WXK A;  4JI8 K;  1YXQ A;  4DV2 K;  5EX5 A;  1KLM A;  3UKR B;  4B3S K;  1ZYQ A;  2HBJ A;  3VQC A;  2UXC K;  1S22 A;  1WSF A;  1NGF A;  1IG9 A;  4B3T K;  4MLH A;  2P9K A;  4JI1 K;  1NBW A;  2WUS A;  4CHQ A;  1X9S A;  2FBV A;  4DF8 A;  1M1K O;  2E1Z A;  4DQ8 A;  1VSD A;  3P5J A;  4FM0 A;  4FJH A;  3CJ7 A;  4OPH A;  1OH5 A;  3LP1 A;  4OKJ A;  4DMN A;  4IOX A;  3P39 A;  4IO9 L;  1JLA A;  4JI7 K;  4WFN L;  2OCE A;  5FRM A;  1WSJ A;  1C1B A;  1HPZ A;  2QWN A;  4OPA A;  4N47 A;  2ETJ A;  1ZBI A;  2V7Z A;  5BPL A;  2XY8 A;  4KO0 A;  2D0O A;  3VQ7 A;  1QSS A;  1NGC A;  3LP0 A;  1ZBU A;  5I42 A;  2P9S B;  3AGR A;  1X3M A;  1LWF A;  1U6Z A;  3ZEU B;  2Z1J A;  4QCL A;  3OYL A;  3MCP A;  4JKA A;  2BTF A;  1WAF A;  2NNW A;  4CK3 A;  2HHV A;  3V1R A;  2VWB A;  3OYB A;  4NYN A;  1LW2 A;  4JAX A;  3KLG A;  3F73 A;  1T7P A;  1YT3 A;  1CZB A;  3EL2 A;  4H4M A;  4FZX C;  2OTL N;  4B9U A;  2O8D A;  4JKE A;  4N76 A;  1T44 A;  4GV3 A;  1HRH A;  3LDO A;  4LF6 K;  4NCA A;  3AGK A;  4LC9 B;  5M1P A;  5AQL A;  3WT0 A;  2VWJ A;  3QEP A;  4F8R A;  3PSI A;  4CEQ A;  3MEC A;  2HF4 A;  4FWN A;  2BUP A;  4DHY A;  4Q0B A;  5DMR A;  2E1Y A;  4BRE A;  4YOX A;  4QS9 A;  4CEC A;  5AQU A;  4RW9 A;  5JS2 A;  2Y1I A;  1S3X A;  1U4B A;  3MWT A;  4XH4 A;  1HNZ K;  3OS1 A;  4LFB K;  5JS1 A;  1BA1 A;  5H1S Q;  4JI3 K;  3NGZ A;  3ULE B;  5ADX A;  5TKY A;  3VTH A;  3E9O A;  4KHW A;  1Y64 A;  3Q7B A;  2J4R A;  4W5O A;  4CBW A;  4FWR A;  4YOR A;  4WFB L;  3HPH A;  4I7F A;  4K43 A;  5LY3 A;  2KW4 A;  4CZK A;  3K2P A;  2XHB A;  1RT1 A;  4GKJ K;  3SMS A;  1NU0 A;  1TGO A;  4X65 K;  4B3O A;  3DLE A;  2QK9 A;  1YVN A;  3BGR A;  4PQU A;  4IXC A;  5FRO A;  3QLH A;  3CCJ N;  3CIP A;  2XY7 A;  3E1Y A;  3KD5 E;  1VSJ A;  3VEX A;  1ITG A;  3GG4 A;  1QQO A;  3ENH A;  4CED A;  3VEZ A;  1U45 A;  1X3N A;  4FK2 A;  5I3U A;  3HJF A;  4CIE A;  4DTP A;  4CGJ A;  5DM6 L;  1RT6 A;  1NKC A;  3PV8 A;  1SL0 A;  4O44 A;  1JLC A;  2Q0U A;  1OH6 A;  1I3A A;  2ZQB A;  4LY7 A;  1NK0 A;  3S3M A;  4C8L A;  3NBP A;  4CE9 A;  3PSF A;  4C8K A;  3ZLJ A;  3MN6 A;  4B1U B;  5CE3 A;  3VA3 A;  3JS6 A;  4C8O A;  4LFA K;  4I6M A;  3L2R A;  2O8B B;  5JIC A;  5FPM A;  5AQM A;  2P9P B;  3J80 O;  3T7Z A;  1IO2 A;  3AVG A;  3KIO A;  3ULD A;  3VA0 A;  3NF9 A;  2E8A A;  3M5R A;  1NM1 A;  4BRH A;  4CHP A;  1JCE A;  2QA4 N;  4FLU A;  1U47 A;  5AQY A;  4H0O A;  4BY9 C;  4F9O A;  2QWO A;  1QTM A;  4DU3 A;  1NK6 A;  1HNI A;  3I8B A;  1RDB A;  2VG6 A;  4A57 A;  2G8K A;  1NGE A;  2NRT A;  2YHB A;  3MK6 A;  3O9R A;  4CJV A;  4DV6 K;  4OKE A;  3BP8 A;  4ILG B;  3IFR A;  4I2Q A;  1TAU A;  3S9H A;  3GE1 A;  1FKO A;  5SWM A;  1NGI A;  3CXC M;  1KXP A;  4JN4 A;  1SQK A;  3E66 A;  2JLE A;  3QIO A;  4B08 A;  3LM9 A;  1QQN A;  1SV5 A;  1UWB A;  3NH2 A;  2XRI A;  4JHD A;  3ID6 A;  1HYS A;  4FJJ A;  3OYN A;  2YNH A;  4ICL A;  2P9U B;  4DKW A;  4BGA A;  2QWL A;  3OTO K;  1VSI A;  1ESV A;  4OPK A;  1RNH A;  5AQN A;  5AZJ B;  4OLB A;  1ILY A;  3O80 A;  4ELT A;  4KFB A;  1Q18 A;  2Q36 A;  3CQX A;  5AQX A;  4CJF A;  5C0Y A;  4DFK A;  4BRD A;  4OX9 K;  3F5T A;  4PKG A;  3EEQ A;  1VAZ A;  4BE0 A;  1V4T A;  4HHT A;  3WXI A;  3QES A;  1DTT A;  3L3U A;  1Q86 O;  4ELV A;  2FF3 B;  3QEV A;  2W42 A;  5JLF A;  2QKB A;  3U9D A;  2VQE K;  3CER A;  5GAG P;  3CM6 A;  4C23 A;  2YV0 X;  4J8F A;  3QIP A;  4HTL A;  1JLG A;  2E6M A;  3L2V A;  3AVI A;  2ZD1 A;  1IKX A;  2UUC K;  2G8I A;  4KAZ A;  1JXB A;  1X9W A;  4CGD A;  2P9N A;  3OY9 A;  4AHU A;  4UQG A;  4XH1 A;  5AQP A;  3QBX A;  3HP6 A;  1U49 A;  3NMU A;  3CM5 A;  2F4V K;  4NXM K;  1TK5 A;  4BRL A;  4DB3 A;  3V9Z A;  1W0H A;  1VQL N;  1VQ4 N;  3SAF A;  1Q82 O;  1WSG A;  1GOC A;  1YJ9 N;  1HQE A;  2P9L B;  2E2Q A;  3R6M A;  3DRP A;  4WYB A;  3DM2 A;  3VPZ A;  4KTQ A;  4DUZ K;  3AVC A;  3QBW A;  5BRH A;  1IKV A;  1TKZ A;  4K8X A;  5CR4 A;  5EOY A;  3E9L A;  3AVL A;  4O5B A;  4KHU A;  1Q8I A;  3CQ8 A;  3NVK A;  3K58 A;  5GIP A;  3NDK A;  3OS2 A;  1YIJ N;  3L0Q A;  4FLY A;  3NFA A;  1RBR A;  4DSE A;  3O4W A;  3L4Q A;  1KVA A;  2HB5 A;  2FLO A;  5FRN A;  2BGG A;  3BUZ B;  2A6A A;  4GV9 A;  3V9W A;  1R59 O;  3S3N A;  2D0C A;  3V4I A;  3ATV A;  1U48 A;  3K9K A;  3HVT A;  2YHX A;  3O9S A;  2KQ2 A;  4IJN A;  5C42 A;  3UKU B;  4RW4 A;  2NRR A;  4GMJ B;  4BRK A;  4CI6 A;  1BIZ A;  3TAF A;  3IRX A;  3NGI A;  3L2U A;  1K9M O;  4L8R B;  4IDK A;  1J9A A;  4LH4 A;  4IOC L;  4IEE A;  5E26 A;  3PIP L;  2P9I A;  2UYT A;  4H03 B;  5IWA K;  4BC3 A;  3K0S A;  1QZ5 A;  1CZA N;  1W7A A;  4CGG A;  1JL2 A;  4CER A;  4WF9 L;  4K25 A;  2AJQ A;  3P38 A;  3U3G A;  4IWV A;  3RSE B;  2B4J A;  2YNF A;  3A5M C;  2WBN A;  4A2B A;  4JRP A;  4AHC A;  4MO4 A;  4H0P A;  1FJG K;  4CF8 A;  1S9E A;  1QQM A;  1RBV A;  4DV0 K;  1BU6 O;  3WEE A;  5B8H A;  3IMX A;  1BQM A;  4ID1 A;  3OBW A;  2GUI A;  5FPN A;  3EE8 A;  3MAQ A;  1ZBF A;  1YJW N;  4FW2 A;  1RTJ A;  3HZ6 A;  4GNI A;  3K59 A;  3AVB A;  4FL9 A;  3ZSX A;  3TAM A;  3WXL A;  1OVY A;  1NK7 A;  1DGK N;  4CF0 A;  3V6D A;  2QKK A;  3EY1 A;  1QE1 A;  4DQQ A;  1KRP A;  3KHY A;  5CYQ A;  4DLE A;  3G4S N;  1VQK N;  2VGN A;  4CGI A;  5HRS A;  2ZGY A;  1VQ9 N;  5AQV A;  3HRG A;  3HOS A;  4JS5 A;  4FOI A;  3C6U A;  1S1T A;  4CGF A;  4EP5 A;  4BG9 A;  4MDA A;  4E1N A;  3TWH A;  3OJU A;  3LAM A;  4PL7 A;  3QER A;  3THX B;  2YJF A;  5KI6 A;  4BRG A;  3KTQ A;  5J2N A;  2PAV A;  1GOA A;  4K41 A;  1C1A A;  3CHW A;  3R3L A;  3G6E N;  4CD1 A;  1KCF A;  3WUH A;  1KC8 O;  1TL1 A;  4CJ7 A;  3H3N O;  1RGI A;  1RBS A;  3C7N B;  1IKY A;  4O0J A;  5LJV A;  3HM8 A;  4NLB A;  4B9T A;  2QXL A;  1WSE A;  3ZX0 A;  3OYH A;  1RDD A;  1NJI O;  1FW6 A;  4PY5 A;  5ELZ A;  3WQU A;  4ISF A;  4CF2 A;  1MA9 B;  4PL8 A;  5HRP A;  3EE9 A;  3CPW M;  4OVL A;  1G99 A;  5BN8 A;  4DS4 A;  4M7Y A;  1K8K B;  1NKB A;  4JI4 K;  1NGH A;  2YX6 A;  2D0A A;  3SPZ A;  2QXF A;  4F4K A;  2RPI A;  1BOT O;  1BO5 O;  1KAZ A;  3VQ6 A;  3QFU A;  3LAK A;  1TKD A;  4OGE A;  3CFO A;  5AR0 A;  3UKR A;  4A5A A;  4L3Q A;  3OYA A;  4DCH A;  4CJ4 A;  3ITH A;  5JMV A;  1LCU A;  3CC4 N;  3PY8 A;  3BZC A;  3DLG A;  3VEO A;  1TK8 A;  3CJA A;  4MO5 A;  1NLV A;  1SKR A;  4DWI A;  4KPY A;  4O4G A;  3NF7 A;  1VQ6 N;  4CFA A;  2ZWH A;  4KH6 A;  3JSM A;  1KD1 O;  2IAJ A;  1VQ5 N;  5C24 A;  3EYZ A;  4IDH A;  1S1U A;  4FZY A;  1Y97 A;  2ZF5 O;  3VTI A;  4LFC K;  3LDL A;  1GLD G;  3T1H K;  3HK2 A;  3QB0 A;  3I56 N;  3CD6 N;  3I33 A;  4CJL A;  5GIO A;  1UOC A;  3EZW A;  3IG1 A;  3FFK B;  3P83 D;  3DLB A;  4KTW A;  5HOO A;  3ALY A;  1GLA G;  1JLB A;  1RDW X;  4YOV A;  5ADX H;  3ZSZ A;  4CK1 A;  1MDU B;  4CIG A;  4DR1 K;  2UU9 K;  2RHK A;  3AA4 A;  3H1V X;  5AQO A;  1NMN A;  3EKU A;  3D2F B;  4B8C A;  4Z4F A;  1HX1 A;  1RDC A;  5BRD A;  4LF8 K;  2FSK A;  5BR9 A;  1IBL K;  5D3G A;  2EWS A;  1XNR K;  5AQW A;  2F8T A;  2OPQ A;  3IUC A;  3LAN A;  1L3U A;  3VN5 A;  3AO4 A;  3EO3 A;  3HTV A;  3R9P A;  4WCE L;  2E4L A;  1P8Z A;  3HL8 A;  3LZJ A;  5CZ1 A;  2O8E B;  3P1G A;  3VGM A;  2GEM A;  3F9K A;  4OJR A;  4CBX A;  3QEX A;  3LDS A;  1Q81 O;  5CYM A;  3KZB A;  4H5T A;  4DSI A;  5BN9 A;  3C65 A;  4PKH A;  3TU5 A;  3WNE A;  1MWM A;  3RVC A;  1S72 N;  3H08 A;  1C0M A;  2IVN A;  3AA2 A;  1QSL A;  4BVO A;  1VQ7 N;  1T03 A;  4DTS A;  4BRP A;  3ZSQ A;  4K0K K;  4WQ5 A;  1W2B M;  4M3Z A;  4FO0 A;  5AQR A;  1NGG A;  1IG8 A;  3C0B A;  1Q7Y O;  3ZT3 A;  3BY5 A;  3SNN A;  3MDQ A;  3ULE A;  3CFR A;  2BE2 A;  1VSE A;  4FVM A;  4FK4 A;  1KAX A;  2D0P A;  3VQ9 A;  4HWI A;  3EKS A;  4FM2 A;  4IEI A;  4DV1 K;  2YJE A;  3KK1 A;  1QVG M;  4FXD A;  3CCM N;  2YNG A;  3ZSW A;  3QNO A;  1FK9 A;  3SBG A;  5LMN K;  5J2M A;  1GLB G;  1YI2 N;  4Y1C A;  1NWK A;  2F96 A;  4M45 A;  3D45 A;  5GAD P;  4CJQ A;  3QNN A;  1YIT N;  3KK2 A;  3F2K A;  4HVJ A;  2PZS A;  1I39 A;  2E2N A;  3OYI A;  2ITG A;  5C15 A;  1SKS A;  1BIS A;  3UIQ A;  5EU7 A;  4KHY A;  4EZ9 A;  3M3Z A;  3SPY A;  4CHO A;  4BE2 A;  3KK3 A;  3H46 O;  4IO8 A;  4W5R A;  4F2R A;  1GLE G;  1X9J A;  3B6P A;  3J81 O;  4BQZ A;  4HUE A;  1KQS M;  3B6O A;  2NLX A;  1K6Y A;  3G25 A;  2XY5 A;  2RF2 A;  2HBL A;  4Y1D A;  1TAQ A;  3HOT A;  2P9P A;  2Z1H A;  1BIU A;  3PUF A;  4K42 A;  3T1A A;  4FJ8 A;  5M1F A;  4BR0 A;  4EZ6 A;  1NNE A;  4WFA L;  3LAL A;  4CEB A;  4CHN A;  1HNX K;  4CFC A;  3CC2 N;  2H3G X;  3CG7 A;  3ZYY X;  3GL1 A;  4CEZ A;  3DOL A;  5DK5 A;  1EP4 A;  4O8K A;  4DTM A;  4ZTJ A;  3ZET B;  5C25 A;  2KZM A;  2OTJ N;  3SQ1 A;  4DQI A;  3DLR A;  2VG5 A;  1EXQ A;  3I0S A;  2P9K B;  4BRI A;  1HJR A;  2ZJQ L;  3MMV A;  4CIF A;  3ENO A;  3OBY A;  3AAP A;  3E9P A;  2OAN A;  3DYA A;  3ID8 A;  2A1S A;  4YFU A;  4HCB A;  4I9L A;  5BR8 K;  2D5R A;  3O8M A;  4B1X B;  4B9Q A;  4OPJ A;  1N6Q A;  4GVM A;  2BDP A;  2CGJ A;  2A41 A;  4M41 A;  4B9V A;  4YDU A;  5F1X A;  4Z4C A;  2IVP A;  3TR8 A;  5AZJ A;  1NGA A;  3I8D A;  3FZK A;  1BDG A;  1NMD A;  1YAG A;  2E2P A;  1LOT B;  4ILJ A;  5AQQ A;  2P5G A;  4FZZ A;  3M8Q A;  4IG0 A;  1C0T A;  3THW B;  3SUN A;  4JRQ A;  2CH5 A;  4AF1 A;  3DJC A;  1RFQ A;  2HHU A;  3SQ4 A;  1YJN N;  1VQM N;  3KWI A;  1W9H A;  4MQ3 A;  3CME N;  3VMF B;  3SUP A;  3CMA N;  4B1Z A;  2ZGZ A;  5EY4 A;  1W97 L;  4B1Y B;  4O0I A;  4IZ9 A;  3K9J A;  4PUO A;  3DXM A;  1ATS A;  1YF5 L;  2HMI A;  3SUQ A;  2E20 A;  1XMQ K;  1NK5 A;  4DG1 A;  3TAR A; 
#chains in the Genus database with same CATH homology
 1WUA A;  2FLO A;  4AM6 A;  3CI5 A;  3BUZ B;  2A6A A;  4GV9 A;  1SS6 A;  2NRX A;  1TUU A;  3FZL A;  4CZF A;  1R59 O;  1U2V B;  4CZH A;  5JVG L;  4JEP A;  3C6A A;  3ATV A;  2NRH A;  1K73 O;  3K9K A;  4FWL A;  5TKW A;  3TSU A;  2YHX A;  4OO1 J;  3SJH A;  1T6C A;  3O9Q A;  2IVO A;  3O9S A;  1VQP N;  3MN9 A;  3WEE B;  4IJN A;  3UKU B;  1BA0 A;  2NRR A;  5EVZ A;  4BRA A;  4BRK A;  4CI6 A;  5KPR A;  3FE1 A;  4FVU A;  5M1K A;  4EIA A;  2QEX N;  4GY2 B;  2HST A;  2Q31 A;  3JXU A;  4XH5 A;  5KPZ A;  1EQY A;  1K9M O;  3GDQ A;  3FZF A;  4IOC L;  4IEE A;  3A8Y A;  2JWK A;  5E26 A;  3PIP L;  1GLJ O;  2QWM A;  3C6H A;  3CQY A;  2P9I A;  3MX2 A;  2UYT A;  1H1V A;  4JKB A;  4JKF A;  5BRE A;  4H03 B;  3CCU N;  5KPT A;  4BC3 A;  5C2F A;  3R1X A;  5JLH A;  1QZ5 A;  1CZA N;  1QVF M;  4KBO A;  5GIN A;  4WF9 L;  4CD3 A;  4K25 A;  3CCQ N;  3P38 A;  2V52 B;  2WFB A;  4IWV A;  3RSE B;  4C1N I;  2QWQ A;  4FWP A;  4PHT X;  4NO7 A;  3A5M C;  5C10 A;  2WBN A;  5JVH L;  3VEY A;  5AFU H;  4RCH A;  3VGK A;  4FWM A;  3F9M A;  3VEV A;  4A2B A;  1E4F T;  1RDU A;  1E4G T;  1T6D A;  4MO4 A;  4H0P A;  4BG8 A;  4BVP A;  1O13 A;  2HBK A;  2FF6 A;  3CF5 L;  4FPA A;  2HBM A;  1QQM A;  2DPN A;  4CZE A;  3DLL L;  1BU6 O;  3WEE A;  5B8H A;  2V7Y A;  1XC3 A;  3IMX A;  3UKU A;  5AFU A;  2GUP A;  2ASM A;  3OBW A;  5FPN A;  3EE8 A;  1YJW N;  5C12 A;  3HZ6 A;  4FWO A;  4GNI A;  3J8A A;  2V51 B;  4FL9 A;  1ATR A;  2YHW A;  3KK7 A;  3WXL A;  1OVY A;  1DGK N;  2PBD A;  1JCF A;  5KQ8 A;  1GLF O;  4BRM A;  1QHA A;  2JWL A;  4CZI A;  5GAH P;  3KHY A;  4JK9 A;  3G4S N;  1VQK N;  3G71 N;  1XUP O;  2RE2 A;  2VGN A;  3BF1 A;  4IOA L;  2YCH A;  4H5N A;  3UB5 A;  2ZGY A;  3U4L A;  1VQ9 N;  2ZJP L;  3BEX A;  5AQV A;  3HRG A;  5EXW A;  3HOS A;  4FOI A;  2P9U A;  4WQ4 A;  4A62 A;  3CCE N;  2D1K A;  1NGB A;  3ZX2 A;  3CET A;  4JK8 A;  4BG9 A;  4MDA A;  5FPE A;  2GTD A;  4RTF D;  3WXM B;  2BH1 A;  4A61 A;  4IJA A;  4WQ4 C;  4PL7 A;  4ISE A;  1DKG D;  3FR0 A;  4IFE A;  2YJF A;  3T69 A;  3VF2 A;  4BRO A;  3CCL N;  1TUY A;  4BRG A;  2QM1 A;  2VYP A;  2E88 A;  3WXK A;  1YXQ A;  4EFH A;  3VET A;  2PAV A;  2ASO A;  2VCP A;  5EX5 A;  4MDB A;  3UKR B;  4K41 A;  4BR9 A;  3R3L A;  3CHW A;  2HBJ A;  1BG3 A;  4CD1 A;  3G6E N;  1KAY A;  4FSV A;  3WUH A;  3SBT A;  3LM2 A;  1KC8 O;  2I7P A;  1S22 A;  1NGF A;  4CJ7 A;  3H3N O;  2KHO A;  2ASP A;  2P9K A;  3C7N B;  2QI2 A;  2WUS A;  1RGI A;  1NBW A;  3LDN A;  3QML A;  4MLH A;  3VEW A;  5LJV A;  2NZT A;  3HM8 A;  4H0T B;  4NLB A;  2F7T A;  4BRC A;  4EHU A;  2QXL A;  3CJ1 A;  5CHI A;  3SAG A;  5M1Q A;  3ZX0 A;  2E1Z A;  3WXJ A;  1M1K O;  3H6E A;  4FWQ A;  3L4I A;  4DQ8 A;  4H0V B;  3QDK A;  3CJ7 A;  1NJI O;  1YUW A;  1C0F A;  2AA4 A;  3LDQ A;  4OPH A;  5ELZ A;  3WQU A;  3TSP A;  4ISF A;  3BF3 A;  5I9E B;  1MA9 B;  4PL8 A;  4IOX A;  3EE9 A;  3O5B A;  5BN8 A;  1G99 A;  3P39 A;  3CPW M;  4M7Y A;  1K8K B;  3P31 A;  4H5V A;  5F0X A;  1NGH A;  2YX6 A;  4FPB A;  4IO9 L;  5BPM A;  4WFN L;  4U67 L;  3P4I A;  2PFU A;  1BOT O;  1BO5 O;  1KAZ A;  2A42 A;  2GWJ A;  4EAH D;  2QWN A;  1ATN A;  4BC2 A;  3QFU A;  4OPA A;  2W40 A;  4BR4 A;  5FPD A;  5AR0 A;  5BPN A;  1NGJ A;  2V7Z A;  5BPL A;  3UKR A;  4A5A A;  2FSJ A;  3H3O B;  4L3Q A;  3CCR N;  3ATU A;  3CCV N;  3O6W A;  5AQJ A;  1HLU A;  1ZXO A;  4DCH A;  2D0O A;  1NGC A;  4BR7 A;  5JMV A;  4BC4 A;  4B1W B;  1LCU A;  3CC4 N;  3FLC O;  4JKC A;  3TSQ A;  2P9S B;  3AGR A;  4NLC A;  3VEO A;  1X3M A;  3CJA A;  4MO5 A;  2P9L A;  2QW9 A;  3ZEU B;  1NLV A;  1U6Z A;  2W41 A;  1VQ6 N;  2CGL A;  2Q1N A;  2ZWH A;  3CJC A;  4KH6 A;  1KD1 O;  1C0G A;  3OW2 M;  1VQ5 N;  1N8R O;  1J6Z A;  4G9Z A;  1WOQ A;  3MCP A;  4IDH A;  4JKA A;  2BTF A;  4CZJ A;  2NNW A;  2ZF5 O;  2VWB A;  4JAX A;  2A40 A;  4JKH A;  3H45 C;  3VTI A;  3LDL A;  1GLD G;  3EL2 A;  2KKZ A;  2OTL N;  1T3V A;  3A5L C;  3N4P A;  1IJJ A;  3QB0 A;  3I56 N;  3CD6 N;  4JKE A;  3I33 A;  1T44 A;  5GIO A;  4GV3 A;  3A5N C;  3ENB A;  4GVE A;  3LDO A;  3EZW A;  1U2V A;  4Y0W A;  3KWG A;  5KQD A;  3AGK A;  4LC9 B;  1TYQ B;  3FFK B;  5AQL A;  5M1P A;  4NB4 A;  1M90 O;  3WT0 A;  5HOO A;  1GLA G;  3WQT A;  4YOY A;  2HF4 A;  4KH4 A;  4FWN A;  2BUP A;  4DHY A;  1RDW X;  4YOV A;  1BUP A;  2E1Y A;  3LL3 A;  4BRE A;  3QIC A;  4QS9 A;  5ADX H;  5AQU A;  4YOX A;  1MDU B;  2A3Z A;  4EHT A;  2NRV A;  1S3X A;  3MWT A;  2RHK A;  3IDH A;  3H1V X;  5AQO A;  3EN9 A;  4XH4 A;  3CJB A;  3MN5 A;  1BA1 A;  3EKU A;  4H0X B;  3D2F B;  5H1S Q;  1K8A O;  3ULE B;  1HX1 A;  3D2E B;  5ADX A;  5BRD A;  1HUX A;  2FSK A;  5TKY A;  3RSE A;  2GWK A;  3VTH A;  3PLA A;  3E9O A;  5M1N A;  1Y64 A;  5BR9 A;  3Q7B A;  2J4R A;  2IIR A;  2EWS A;  4CBW A;  5AQW A;  4FWR A;  2I7N A;  3IUC A;  4YOR A;  1VQ8 N;  3CC7 N;  5AQT A;  1VQN N;  4WFB L;  3EO3 A;  3TPQ A;  2HF3 A;  4K43 A;  5LY3 A;  3HTV A;  3R9P A;  4WCE L;  1P8Z A;  4O8U A;  1TYQ A;  5MLC Q;  4CZK A;  3VGM A;  2GEM A;  2F9T A;  2F9W A;  4CBX A;  1Q81 O;  1D4X A;  3KZB A;  4H5W A;  4H5T A;  3SMS A;  3C65 A;  4JKD A;  4PKH A;  3CPE A;  5BN9 A;  4PKI A;  1MWM A;  3TU5 A;  4I6M B;  3W3D A;  4BGB A;  3CJ9 A;  1HKB A;  2QWP A;  3N4Q A;  3RVC A;  4CZL A;  1S72 N;  2IVN A;  1YVN A;  2YHY A;  3AAR A;  4BVO A;  1VQ7 N;  4IXC A;  3DXM B;  4E1J A;  3L6Q A;  3CCJ N;  3CIP A;  3E1Y A;  4BRP A;  5GAE P;  3FZH A;  3O9T A;  4WQ5 A;  3SK3 A;  1W2B M;  4CZM A;  4FO0 A;  5AQR A;  1NGG A;  3VEX A;  1IG8 A;  1SZ2 A;  3C0B A;  5AQF A;  1Q7Y O;  2A5X A;  4JKG B;  3GG4 A;  5AQG A;  1HKG A;  1QQO A;  3MDQ A;  3ENH A;  4WQ5 C;  3GOI A;  3ULE A;  3VEZ A;  3D2E A;  4BQL A;  4FOE A;  1X3N A;  3I55 N;  4YOT A;  4GV6 A;  5DM6 L;  2Q2R A;  3AAQ A;  1KAX A;  2D0P A;  4HWI A;  3EKS A;  3NVM A;  2Q0U A;  4IEI A;  4XEI A;  3W0L A;  2YJE A;  1QVG M;  2QTD A;  3CCM N;  4M63 C;  3A5O C;  2Q97 A;  5M1O A;  3SBG A;  3VER A;  4RWT A;  1GLB G;  1YI2 N;  3MN6 A;  1DEJ A;  4B1U B;  5CE3 A;  3VF4 A;  3AY9 A;  3JS6 A;  1NWK A;  2GEL A;  3D7E O;  3QFP A;  4I6M A;  4BR2 A;  3LDP A;  5JIC A;  5GAD P;  3FZM A;  3U8X A;  5FPM A;  5AQM A;  2WC9 A;  4QS8 A;  2P9P B;  4BR5 A;  1YHQ N;  3T7Z A;  1YIT N;  3C7N A;  2E8A A;  3F2K A;  3M5R A;  1NM1 A;  2GX9 A;  4JHD B;  4BRH A;  2E2N A;  1JCE A;  2QA4 N;  4YOU A;  5C15 A;  5AQY A;  4H0O A;  4JKG A;  1EO1 A;  3D6R A;  4BRQ A;  3O1W A;  4BY9 C;  4F9O A;  2QWO A;  3OHR A;  1SAZ A;  4B1V A;  3I8B A;  5BRF A;  3M3Z A;  4A57 A;  3SLC A;  1NGE A;  3TTC A;  2NRT A;  3H46 O;  4IO8 A;  3ZX3 A;  1K8K A;  1P90 A;  3MK6 A;  3O9R A;  1GLE G;  4BRF A;  1X9J A;  4U7B A;  3BP8 A;  4ILG B;  4BRN A;  3IFR A;  1JJ2 M;  3GE1 A;  3B8A X;  4A2A A;  5HL7 L;  1NGI A;  1V4S A;  5E84 A;  3CXC M;  4BQZ A;  1KXP A;  4JN4 A;  1KQS M;  4H5R A;  2NRW A;  2NLX A;  3MCA B;  3G25 A;  3H1Q A;  1SQK A;  3SMP A;  1XQS C;  4JD2 B;  3E66 A;  3VF6 A;  2D4W A;  3MWP A;  3LM9 A;  2NRZ A;  2HBL A;  1QQN A;  3VES A;  3HOT A;  2QWR A;  2P9P A;  1JCG A;  3GBT A;  3IKM A;  3VGL A;  4JHD A;  1ZC6 A;  4K42 A;  3DWL A;  3ID6 A;  2P9S A;  1GLL O;  5M1F A;  2KLA A;  2YI1 A;  3ZEU A;  4BR0 A;  2P9U B;  4WFA L;  3M6G A;  4DKW A;  5AQK A;  4BGA A;  2QWL A;  3KVG A;  3O08 A;  1ESV A;  3CC2 N;  2H3G X;  4R79 A;  3ZYY X;  3GL1 A;  3O9U A;  1HKC A;  3MX5 A;  5DM7 L;  5AQN A;  4O8K A;  5AZJ B;  3HBT A;  3HSC A;  1ILY A;  3O80 A;  2P9N B;  3ZET B;  4MLE A;  3VOV A;  4KH5 A;  1Q18 A;  3DAW A;  2OTJ N;  3A0I X;  2Q36 A;  3CQX A;  5AQX A;  5C0Y A;  4YOW A;  4BRD A;  4M7X A;  3J7Z O;  2P9K B;  3F5T A;  4JD2 A;  5AQS A;  4BRI A;  4A59 A;  3TTF A;  4PKG A;  1VAZ A;  1V4T A;  3Q7C A;  3WXI A;  1NGD A;  3M1F A;  4JK7 A;  2CGK A;  3MMV A;  4A5B A;  2FF3 B;  5AZI B;  2ZJQ L;  3CCS N;  1Q86 O;  2CH6 A;  3ENO A;  3OBY A;  1DT9 A;  3AAP A;  3E9P A;  3DXK B;  2OAN A;  2Q0R A;  1VQO N;  5JLF A;  3ID8 A;  3U9D A;  4FWS A;  1OKJ A;  3CER A;  4UY8 O;  5GAG P;  4C23 A;  4J8F A;  3O8M A;  4B1X B;  4B9Q A;  4HTL A;  2E2O A;  4CBU A;  5LJW A;  2CGJ A;  1BWF O;  2A41 A;  3SAH A;  3FGU A;  3D2F A;  4YDU A;  4BC5 A;  5F1X A;  1Z6R A;  2IVP A;  5AZJ A;  1NGA A;  4ISG A;  2FXU A;  5C2D A;  2P9N A;  3O1B A;  3ZET A;  1MWK A;  3FZK A;  4CZG A;  5F2R A;  1BDG A;  1NMD A;  1YAG A;  3MN7 A;  4XH1 A;  4YDU C;  2E2P A;  1LOT B;  4ILJ A;  5AQP A;  4Z94 A;  2HMP A;  3QBX A;  3HI0 A;  2HOE A;  4H0Y B;  5AQQ A;  3S41 A;  3TTD A;  3VEN A;  5BRH A;  3NMU A;  5AQI A;  4ILH A;  2ITM A;  4O5F A;  4BRL A;  4DB3 A;  1VQL N;  2CH5 A;  3SAF A;  4AF1 A;  1Q82 O;  3DJC A;  1VQ4 N;  3UE5 A;  1RFQ A;  1YJ9 N;  1YJN N;  1VQM N;  2ZJR L;  3KWI A;  5AZI A;  5AQH A;  2P9L B;  1GLC G;  2E2Q A;  4QS7 A;  3R6M A;  3VMF B;  1HPM A;  3CME N;  3DXK A;  4WYB A;  1Z05 A;  3VPZ A;  2AP1 A;  3CMA N;  3R8E A;  4B1Z A;  4FWK A;  2ZGZ A;  3QBW A;  4JNE A;  1W97 L;  5EY4 A;  4B1Y B;  4IZ9 A;  2VGM A;  3K9J A;  2P9I B;  5CR4 A;  5EOY A;  3E9L A;  1HJO A;  4AM7 A;  3OA9 A;  2FSN A;  3NVK A;  1ZBS A;  3DXM A;  1ATS A;  1YF5 L;  5GIP A;  3PIO L;  2E20 A;  1QZ6 A;  1YIJ N;  3L0Q A;  3U9Z A;  4C1N K;  3O4W A;  3L4Q A;  5AQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...