4KHPK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S Ribosomal RNA
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4khpK00
4YY3K 3J80O 4B3SK 2E5LK 4LF9K 2UUCK 3T1HK 4DV0K 1FJGK 4DV2K 5AJ3K 4CW7B 4JI1K 4LF5K 4X64K 4CVNE 1XNQK 1IBKK 4DR4K 4X65K 4NXNK 1HR0K 4JYAK 2UXCK 4JI0K 4LF7K 4LF8K 4JI3K 4JI2K 4KHPK 2F4VK 1XMQK 1HNWK 2VQEK 2VQFK 4LF4K 4DR3K 4DV6K 4DUZK 5LMNK 5FLXO 4DR1K 4DV3K 1HNXK 3J7YP 1HNZK 2ZM6K 4GKJK 1XNRK 5IWAK 3OTOK 1J5EK 3J81O 4DR6K 4DV7K 2UUAK 4B3RK 4JI7K 2UXBK 4X62K 1IBMK 4YHHK 4JI6K 1N34K 3J7AP 3T1YK 2UXDK 1IBLK 4K0KK 4JI8K 2HHHK 4GKKK 4B3TK 4LFCK 1I94K 4DV5K 4DR5K 4LF6K 4DV4K 4OX9K 4DV1K 4NXMK 4JI4K 5BR8K 4DR7K 4X66K 4JI5K 4JV5K 4V19S 2UUBK 5LMUK 4LFAK 3JAMO 5IT9O 1XMOK 1N32K 4DUYK 4AQYK 5A2QO 4B3MK 1N33K 4LFBK 5LL6Z 1N36K 2UU9K 4DR2K
chains in the Genus database with same CATH superfamily
3SMPA 2G8KA 1TL3A 3I55N 3V4IA 2G8UA 1NK7A 3MEDA 5CE3A 3LWLA 4BDYA 1WSEA 3DOKA 5AQGA 1WSJA 4IG3A 4YOTA 4FLUA 4DSIA 2P9SA 1LWEA 4CW7B 3DXMB 3C7NA 3P83D 4E0DA 3AO4A 4JEPA 4R5PA 2GBZA 1ZC6A 2QA4N 2Z1HA 2HVHA 4CEOA 1YUWA 1YI2N 4DTSA 4NCBA 3OS0A 5AQIA 1Q86O 4ELUA 4M3ZA 1SKRA 3LZJA 4H0TB 3H45C 2FBTA 3LP2A 1HUXA 2XY7A 2O8FA 3MCAB 3FZKA 4CEDA 4H8KA 4FO0A 4BDZA 1TKDA 3I0RA 4I9QA 2E88A 3J7YP 2HHQA 3DRSA 5M1KA 3IFRA 3K5OA 4BRFA 3SJJA 2D4WA 4CJSA 2UUAK 5AQJA 4CJEA 3HPHA 3L2RA 4B3RK 2HBJA 4CHYA 1RILA 2P9LA 2Z1JA 3AVKA 1Q9XA 4C1NK 3JSMA 1Z26A 3TTCA 3S3OA 5ADXH 4Z4FA 4H5RA 2O8CA 3VQ7A 3G10A 4RCHA 3J7ZO 3THVA 1O1WA 2WTUA 3HVTA 4M3WA 1BG3A 1SZ2A 4CK3A 4FLTA 2F9TA 3SUQA 1TKXA 1BL3A 1VSHA 2OZSA 3SUOA 4JI5K 4JV5K 4CGFA 3C6HA 3G0ZA 2G8WA 2RPIA 3KLGA 3GG4A 2YJFA 1UWBA 1HKCA 4I9LA 1NWKA 2ZGZA 4BRPA 3VTIA 4FVUA 1NG9A 2V51B 5A2QO 2Q0UA 1HRHA 4OLAA 1D9DA 4K43A 3VTHA 4CI6A 3EEQA 1ILYA 1SL0A 1NGEA 4CHOA 2E6LA 5C2DA 2BGGA 3AARA 4JI1K 3RWUA 4FZZA 1JLGA 1GLFO 3LDPA 2NRVA 4KFBA 4J2EA 4FWPA 1VHXA 1TUUA 2P1JA 3O9QA 3AA3A 1NMNA 3ZSYA 4JYAK 1VQMN 3T7ZA 3VA3A 4LF7K 1ASUA 2NRRA 3ZT4A 4JKFA 2W6LA 4JI2K 2A1SA 4H0OA 3SNNA 1TYQB 1C0GA 3BF1A 2D0OA 3R9PA 2VQFK 1HNIA 5KPRA 1NGDA 3HOSA 1HNXK 3CMEN 3CM6A 4BE1A 3PLAA 2OTLN 3NF8A 4IEEA 2P5OA 2E2PA 1JXEA 4U67L 3ZX2A 2HNDA 3L8BA 4DSJA 4KHQA 4FK4A 2X6SA 2YNIA 4CFCA 3R8EA 2DFHA 1GLLO 2UXDK 3B6OA 4E7IA 5GIPA 3ZSRA 3UKRB 1Q9YA 4PA1A 4HVJA 4CIFA 1RT4A 3TARA 4WCEL 4DR5K 1Q81O 4DSLA 3BY5A 4MQ3A 3L3UA 1DT9A 2OTJN 3A2FA 4H5VA 1BU6O 1ATRA 4C1NI 1WOQA 1IKXA 3HZ6A 1X3NA 4ID1A 1NK9A 2QWRA 3OS2A 4PL7A 2X78A 1TGOA 3CFPA 3AVAA 4GMJB 2E1YA 2I7NA 1YTUA 1U47A 2W40A 4LFBK 1BDGA 1HYVA 4O8KA 2F7TA 1OH7A 2H3GX 1ZBSA 3T69A 2QK9A 3HP9A 4FJ9A 3EL2A 4BG9A 4RWTA 4MO5A 3CF5L 1HYSA 5AQTA 4CBUA 4YDUA 3S3MA 4CHNA 1YXQA 2P9PA 2HNYA 1K73O 3TAGA 4IO8A 1HR0K 1S22A 4FWRA 2VWBA 4FWLA 4KHNA 3QERA 5FRMA 3DLRA 4OPKA 3SYZA 3AO1A 4CIEA 3QEXA 1SAZA 3AVIA 3MX5A 4UY8O 1RT6A 4B9LA 1XMQK 2XY8A 4M41A 3ZT2A 1VSJA 4IJAA 4W5RA 4DV3K 1VRUA 4CZFA 4MFBA 1ASWA 1MWKA 1NGFA 1KLNA 3J81O 5I9EB 1TKTA 4ID5A 3P38A 2GX9A 4QS8A 2HOEA 3OYLA 3MAQA 5AQYA 3CC7N 2F9WA 4JHDA 3PUFA 4FWOA 2P9UA 3K2PA 4KBOA 3CFRA 2BTFA 4FWQA 5KQ8A 1C0TA 1IKWA 1JL1A 2BH1A 3LPUA 1XQSC 3MWPA 3ULEB 4AHCA 4DV1K 4IZ9A 2ZE2A 1Q18A 5DK5A 4Q5VA 1RTJA 4ISEA 3HI0A 3MWTA 2AJQA 2UUBK 2E6MA 4DMNA 4RW7A 3LDOA 3ENBA 4DSKA 1BIUA 2NZTA 1HPMA 3FE1A 1VSLA 1M1KO 3O80A 4A61A 4FJXA 5BPMA 1JXBA 1JLFA 4YDUC 3ZEUB 3THYA 1HKBA 4K8ZA 4DR2K 1YVUA 3S3NA 4DQQA 1T8EA 2EHGA 1B9FA 1WSGA 3C7NB 4C8LA 4DWIA 5AR0A 5AJ3K 4RW9A 3KIOA 1ZBIA 3CC4N 3HOTA 1NJIO 4LF5K 1HYZA 1IBKK 3QEVA 3O3HA 3OYMA 3LANA 3RMAA 4Z4GA 3AVNA 1D5AA 4FWSA 4CBXA 3VGLA 3QEWA 1A5WA 4FOEA 3QICA 1NGBA 3RRGA 3E1YA 3JXUA 3RTVA 4KB1A 2JGUA 4CGDA 4OKKA 5AQLA 5EU7A 3O3GA 3MN9A 4IFVA 5KI6A 3UKUB 4DV6K 2YHXA 1BCMA 3OYCA 5FPEA 1NK6A 4CZHA 3DOLA 1NGAA 3O6WA 5F2RA 2OCEA 2Y1JA 5FRNA 3QO9A 3QLHA 4UQGA 4IBNA 4GNIA 4BRLA 1BI4B 3ZT1A 4A2BA 2UXBK 4KI4A 1H1VA 4YHHK 4H0PA 2I7PA 2PYLA 2W42A 5HP1A 1TL1A 2RHKA 3AA2A 3THWB 4BRMA 4GY2B 2PYJA 5AQUA 4K0KK 3LL3A 3VQQA 1C1CA 1XHXA 1YAGA 3ENHA 4MLEA 2Y1IA 4B3TK 3UE5A 1EETA 4DV5K 2VWKA 2ZJRL 2QWOA 3VA0A 2Q2RA 3DRPA 3KK2A 2QM1A 3DLKA 4BC4A 2QTDA 2RKIA 3E9OA 4X66K 1QZ5A 3CPEA 2YHYA 4O5FA 4EZ6A 3T19A 1FKOA 1UA1A 3WQUA 2VGMA 3AVLA 4O44A 4H5WA 3OVNA 2FC0A 4FWMA 2DY4A 4DQIA 1KAXA 2O8FB 1D9FA 4YY3K 3K58A 1QQCA 4CEQA 1HQEA 2P9KB 2HHUA 3D2EB 3DLBA 4RG8A 4DV0K 1VSIA 4W5QA 2QKBA 3LAMA 3IAYA 3TSPA 1QHTA 3WEEA 1TVRA 2OPQA 4BGBA 1GLAG 4NLCA 1OH6A 1D8YA 5BR9A 3W0LA 4FLWA 4WQ4A 3M1FA 5EX5A 3M8SA 3CJBA 4CHPA 3CCVN 1N5YA 1CXUA 3BDPA 3M6GA 3QFPA 2F8TA 5TKWA 1RTDA 1WSFA 2YJEA 5M1OA 2A41A 3L4QA 3O8MA 4FW1A 4C23A 4JAXA 1ITGA 1K8AO 1HPZA 3MMVA 2QKKA 3TAMA 3H46O 3TTFA 3I8DA 3AGKA 1FW6A 5ADXA 4FZYA 3Q7CA 2P9NB 3DRRA 1RCHA 3MXJA 4I6MA 1Q8IA 3OTOK 1VRTA 4DFMA 4PKIA 3PX0A 4DTJA 4CF0A 4B9SA 4WQ4C 1IBMK 4JD2B 5HBMA 5KQDA 5AQXA 3SV3A 3QMLA 3T1YK 3NF7A 2NRTA 3AVCA 4CFDA 3FGUA 2ZQBA 3U8XA 2J4RA 1W2BM 1Y64A 1QE1A 2QWPA 4CJPA 2G8FA 2E2QA 2D5RA 5J2MA 1KTQA 1YT3A 3NBPA 5GINA 2P9NA 4CERA 1YVNA 1ZXOA 3P39A 3P1GA 3AAQA 4FWNA 3VEOA 3HVRA 2YV0X 3F73A 3WXJA 1HJRA 4V19S 3CCLN 2YNFA 1NKCA 2BANA 1G99A 4CBWA 1NBWA 5IT9O 2D0BA 4IWVA 3O9TA 1VQ8N 1VQ4N 4KHWA 3CERA 2D1KA 3J80O 2HMIA 4B3SK 3VENA 5B8HA 2P9LB 4DLGA 3CJ7A 1UAXA 1D4XA 2A5XA 3O1WA 3TSQA 5AZIB 2OYQA 1VQ5N 3R6MA 3U6FA 1X1PA 5EXWA 3L2QA 2O8CB 4XH1A 3VF6A 1ZBHA 4AM7A 3G6EN 4EZ9A 2IGIA 5JS2A 1B92A 4JKBA 3V6DA 1LAWA 3ISNC 2CGKA 4E89A 4BVPA 3EZ5A 1X9SA 3SK3A 2NRWA 4Z4IA 4DTXA 4AM6A 4BR5A 2OANA 2O4IA 3KWIA 1P90A 3NF9A 3V9WA 3T3FA 4CHQA 3WUHA 3F2KA 4M63C 3VOVA 1OVYA 3IG1A 3C6TA 4GKJK 1ATSA 4IFEA 1GLCG 3O4NA 5M1PA 1JLAA 2PAVA 5SWMA 2FXUA 4KV8A 5CZ1A 5GAGP 1L5UA 2D0PA 5AZIA 1JLEA 5M1FA 2Q3SA 4Z4EA 1HKGA 3H3NO 3NGIA 1KC8O 2Q1NA 3OYNA 1VQLN 3DLGA 3OYHA 3MXMA 1RDUA 1XI1A 3LM2A 3SLCA 3HP6A 4JKAA 1MWMA 3MECA 1BISA 3S9HA 1BQMA 3WXKA 4YOVA 5AQSA 4FM1A 1NGCA 2YHAA 3ALYA 3HRGA 3WNGA 5HL7L 3SPZA 4KTZA 3TAFA 1NGIA 5CR4A 4CZLA 4FL9A 3HM9A 1KAYA 2E2NA 1G15A 1LCUA 1E3MA 1JL2A 3FZFA 1S1WA 2PFUA 4EFHA 4HHTA 4EHUA 3WXMB 3OA9A 3OYKA 2GV9A 3U9ZA 1BCOA 1KSPA 3A5OC 2QEXN 1V4SA 3NFAA 2HHTA 2NLXA 4RW8A 5AQKA 3CCUN 3LPTA 5I42A 2ASOA 3DLLL 1KVBA 4IOAL 2DPNA 2BE2A 4I6MB 2HF4A 3VN5A 2GUIA 3F5TA 4BRIA 5AFUH 1I39A 4DU1A 1EKEA 4B8AB 3LALA 3ITHA 4DSFA 3W3DA 2QWNA 3ZX0A 5CHIA 1KCFA 4E7LA 4DR3K 3RMBA 1BWFO 2GELA 3PX6A 5FLXO 5HLFA 4JKEA 4BROA 4OPHA 2YHBA 3QESA 4C8NA 4ICLA 4JKCA 3IRXA 4AHSA 4EAHD 3LZIA 3D7EO 4NO7A 4E1NA 3O4QA 3WNEA 3P31A 1KRPA 4R79A 3QNNA 1VAZA 1J53A 2RE2A 4HTLA 5FPMA 2HHXA 4WFBL 1RT1A 5FPDA 1XWLA 2KFNA 1S3XA 1GLJO 3AV9A 4FJNA 1RBRA 3M8RA 4HUGA 3CETA 4OPJA 3O9UA 4ISGA 4O5BA 1HX1A 1RDCA 3CJ1A 4B1YB 4GV3A 1SKSA 2ZF5O 3VEXA 1RDBA 1T6CA 2IVOA 3VQ4A 3ZSQA 1IJJA 2IOCA 4ILJA 3CXCM 3H6EA 4LC9B 4CZKA 1QHAA 2QWMA 1U49A 4M3TA 3CCRN 3OYBA 1C6VA 1RTIA 2XO7A 3QINA 2QWQA 3FZHA 1RBUA 1IO2A 1FKPA 1RTHA 1T44A 5HOOA 3MXIA 4FOIA 2GUPA 3ZETB 3Q7BA 4U7BA 3N4PA 2ZD1A 3RSEB 1X9MA 1N33K 2YHWA 4M3XA 1KFDA 5SZTA 2Z1GA 4OGCA 3D6RA 2G8VA 1UOCA 4FLZA 2FSJA 3FZMA 3G25A 3THWA 5J2PA 1L3VA 1EWQA 3LP3A 4LH5A 3WQTA 3QB0A 4LSNA 4A5AA 4DTNA 3GE1A 4CEEA 4H4OA 4NXNK 1WNSA 1L3UA 2X74A 4H03B 2IIRA 3LDSA 1J5OA 4KTQA 1EX4A 4N5SA 1QVGM 4FVMA 3ID8A 3LAKA 2XRIA 3A5MC 4LF4K 1DTTA 4DUZK 5LMNK 1T6DA 3OHRA 4DU3A 4KB0A 3CCMN 1QQNA 3HJFA 3NGZA 4PWDA 3VF4A 2ZGYA 4M7XA 4K42A 1W9HA 3DAWA 4CEAA 2DFEA 4DU4A 3TSUA 1VQ7N 1XHZA 3ZLJA 4DTPA 3BP8A 4BC2A 1LWCA 1A5VA 3DXKA 4IFYA 4GKKK 1HNVA 3I56N 1RDWX 3O9SA 3V9UA 3WXLA 1TK5A 4IDKA 5C42A 4DTOA 4FJKA 4CCHA 4OX9K 1IKYA 1BO5O 2Z1IA 4CD3A 3HK2A 3HM8A 3VQ6A 4QCLA 1GLBG 1NNEA 5AQMA 4JK7A 5FPNA 4M42A 2P9IA 1RBVA 4B08A 4M45A 3V9ZA 1TAQA 3JYTA 4CEZA 2FBXA 2GTDA 3K9JA 3NE6A 4ELVA 1GLEG 3E9LA 5HRSA 3ZCMA 5BRHA 2HNZA 2P9IB 4FJLA 1OVQA 3VEVA 1N36K 2JLEA 2YCHA 1ESVA 2ITMA 5AQFA 2V7ZA 2KZMA 3VMFB 1BHLA 1EP4A 4Z4HA 1C0MA 4GVMA 5KRSA 1HMVA 3SQ0A 3QEPA 2E2OA 1U6ZA 4H0XB 4PL8A 4CJ4A 4OVLA 3MN6A 2YKMA 3E66A 5KRTA 2HBMA 3FFKB 4GW6A 3KKRA 3SUPA 3ASMA 4M3RA 3EKSA 5JLHA 3O9RA 1BA1A 1CZAN 1Q82O 1C0FA 2YKNA 4CJLA 3JS6A 1XC9A 4LD0A 5AQQA 4CE9A 2UXCK 3LDNA 1ZBUA 3K5NA 4AHUA 1P8ZA 1JJ2M 2Q36A 3AO5A 4I2PA 4Y1DA 2CH6A 2DTUA 4NCGA 3DYAA 3SMSA 1EO1A 4XH4A 3OBYA 3L6QA 5K14A 4YOXA 1BOTO 3P4IA 3CD6N 3U9DA 3AA4A 1YJWN 3FZLA 1KD1O 3EKUA 1IV0A 4DV7K 2Q0RA 2O8DA 1S6QA 4W5OA 2UYTA 2O8EB 1S1TA 4FK0A 4JLHA 4JI6K 4M7YA 3VEWA 2QXLA 3ZSXA 3THXB 3VEZA 4KRFA 4DQ8A 3TI0A 4CGHA 1K8KA 5C10A 2KZZA 1KXPA 4LFCK 3P5JA 2HVIA 3QIPA 5EY4A 4ISFA 4C8OA 3SQ4A 4FM0A 1WN7A 3ZT0A 1T03A 5TKYA 2YNHA 3FR0A 1LW2A 3MCPA 4QOZB 3PSFA 5GIOA 4FWKA 1ZBLA 3ATVA 4Z0UA 2DFFA 3ZT3A 2BDPA 5BRDA 1DGKN 5BRFA 3L3VA 1QSLA 3ULDA 2OZMA 3C65A 4BR0A 2BUPA 1DKGD 1CZ9A 1RGIA 5JLFA 5KTQA 5J2NA 3TABA 3M3ZA 4B3MK 4IOXA 4CJWA 4YOWA 2HW3A 4JS4A 4BRAA 3NH1A 3ID6A 3PV8A 3KLEA 2ATQA 4BACA 4BC3A 3QETA 2HB5A 4E7HA 3RRHA 2B4JA 2XHBA 3OJSA 4N56A 4H4MA 4RW4A 5M1NA 5C2FA 4GV9A 3HPGA 2B5JA 3KHYA 4B1WB 2AA4A 3VQPA 4DR4K 4I2QA 1X3MA 4IG0A 1ZBFA 4YOUA 1YF5L 3LDLA 3CJCA 2IVPA 3ZSOA 3RR7A 5AZJB 3DLEA 4AH9A 3CPWM 3VEYA 3VGKA 2VWJA 5I3UA 2NRXA 2KQ2A 3H08A 3WNFA 4CECA 3SBTA 4JKHA 2Q97A 2E20A 1YITN 4BR2A 1KAZA 4BDPA 1HNZK 3EZWA 4WE1A 4B1UB 3AVJA 4B9TA 1XNRK 4KAZA 5IWAK 2ASPA 5BPLA 5LJVA 3UIQA 4CF2A 4F2SA 4KI6A 5BREA 2Q31A 1OH8A 3LP0A 4GV6A 5EOYA 3C6UA 4KREA 2HMPA 1WB9A 5MLCQ 4PKHA 2HHHK 2JWKA 3K59A 1VQON 4OO1J 3O5BA 3RSEA 1V4TA 3DWLA 2F8SA 3VQBA 4JD2A 1NGJA 2V7YA 3LP1A 2ITGA 4FZXC 3RMCA 3MN5A 1GOBA 4E1JA 5KGXA 1REVA 4CJTA 1GOCA 2A3ZA 3E01A 5CZ2A 4F4KA 1KVCA 1LOTB 4HUFA 1Z05A 4GVEA 1VQPN 1YTAA 4IEIA 5AZJA 1QSSA 1T3VA 1U48A 1RDAA 1EXQA 4CESA 3OYGA 1NKEA 5DM7L 4DTRA 1M90O 4E1MA 1NKBA 4IKFA 3SAFA 2UU9K 5AQHA 3KK1A 4JRPA 3DMJA 2E5LK 4LF9K 4FJ8A 4A2AA 3PIPL 3KD1E 4FLVA 1R59O 3OYJA 3TU5A 4CJKA 1JCGA 5CYQA 3RR8A 4W5NA 3OS1A 1RBSA 3NVMA 1F21A 3BUZB 1OKJA 3FLCO 4L8RB 2IAJA 5E84A 2O4GA 3VQ8A 5GAEP 3MEGA 1SV5A 1TV6A 4WF9L 3T1AA 4O8UA 1NOYA 3LM9A 4LH4A 5JVHL 3I33A 4BRGA 4DLEA 1U2VA 4FPBA 5E41A 3EE9A 2JWLA 2ASMA 2HHSA 3ZSWA 1TAUA 4JKGB 1J6ZA 5HRNA 3EY1A 2YX6A 2FLOA 4YORA 4HCBA 1MU2A 1S1XA 1W0HA 3HL8A 1IKVA 4KH6A 2NUBA 3NGYA 4M3UA 3HSCA 4ILHA 1K8KB 1JKHA 2LSNA 3LWMA 2XY5A 3V1OA 5HROA 3NCIA 4DFJA 2KHOA 1BA0A 2P9SB 4FJMA 5HRPA 3A0IX 1IG8A 5M1QA 2VG6A 4DG1A 1L3SA 2KFZA 2IS3A 1N8RO 4A5BA 2O8EA 3C6AA 3B6PA 1SS6A 1WBDA 3CQYA 2KLAA 4BRNA 3G4SN 5T7BA 1X9JA 1Q7YO 1BI4A 1O13A 4BC5A 4ZHRA 3PIOL 1NJZA 2FSNA 2GWJA 1NOZA 4LFAK 2NNWA 3JAMO 1QZ6A 3L2WA 3AGRA 3OBWA 3K9KA 4DS5A 4FK2A 3OY9A 2F96A 4DTMA 4CHZA 3HO1A 4FXDA 3CM5A 1QQOA 3DM2A 3QDKA 3KD5E 3NH2A 4DFPA 3K5MA 1E4FT 4H0VB 1GOAA 1NJWA 4IXCA 1WBBA 5CYMA 3T1HK 3SI6A 4DV2K 1ATNA 4B9NA 4YFUA 4CF8A 1JLCA 1ASVA 4J8FA 4CVNE 4CF9A 3ZYYX 5JVGL 2ETJA 4JK8A 2A40A 4JN4A 3CCJN 3NF6A 3ZETA 3AY9A 2G8HA 1U2VB 1UA0A 3OJUA 1S9EA 3FFIA 1CLQA 3HYFA 4OJRA 1TKZA 4CJFA 2WBNA 4E19A 2WC9A 1RFQA 1VK0A 4F3OA 3R3LA 5AQOA 4BE0A 1QQMA 4B9UA 1RNHA 4DR1K 4E7KA 4BWMA 5AQNA 4JK9A 3WNHA 2HHVA 2I5JA 3NH0A 4ILGB 4DS4A 3KLIA 4E7JA 3WEEB 4KPYA 4FJ5A 4PY5A 1NM1A 1WAJA 1NK5A 4OLBA 4JI7K 1JLQA 3U4LA 3NAEA 4Q0BA 4N41A 2WFBA 4X62K 4LY7A 2GWKA 4JS5A 3BZKA 4KH4A 4A62A 4BR4A 3KTQA 3J7AP 2WONA 1IBLK 4J2BA 4CGIA 4FLXA 4K41A 4CK2A 4F3TA 4MDAA 4QS7A 3O1BA 4IO9L 1WUAA 3HPOA 3TANA 4RW6A 2KKZA 3IDHA 3VF2A 3PY8A 3DI6A 4KHSA 1T05A 4DF4A 3E9PA 3MK6A 4PKGA 4CZEA 3AVMA 1S9GA 3C0BA 4CD1A 3C94A 1KFSA 1KVAA 4A57A 4JNEA 3IS9A 3TWHA 4ZTFA 1XC3A 3SUNA 2CGJA 3EO3A 3V9XA 1WSHA 4C8KA 4WFNL 3GOIA 4M3YA 3EN9A 1TK0A 3SAHA 1NLVA 4O55A 3V1QA 1B9DA 4FCYA 1S1VA 4BRHA 2FSKA 3SQ2A 3GL1A 5EVZA 3D45A 3SJHA 1BGXT 3DXMA 2NRZA 2V52B 3CJAA 3QNOA 3THXA 1XUPO 3L2VA 2P9PB 4FJGA 4FM2A 2RF2A 3OYDA 3VETA 1FK9A 4NB4A 4BE2A 3AVFA 4CZJA 3NDKA 4BWJA 3UKUA 4HTUA 4KHYA 5BN8A 4BG8A 4CZGA 3ZX3A 4F2RA 4WQ5C 3VQEA 1RT2A 4CEBA 5AQRA 1SKWA 1VSKA 1HNWK 3BZCA 3IUCA 2VQEK 5JS1A 3HTVA 3QBXA 5AQPA 3O08A 1GLDG 4BGAA 3BEXA 1SL2A 3PO5A 3OW2M 4CJRA 3EE8A 4CJ3A 1NK8A 3CHWA 4CEFA 1N6QA 4K25A 1DLOA 1I3AA 3AA5X 3TTDA 5DMRA 4DCHA 4PQUA 4O0JA 1LWFA 1YIJN 3ZSZA 1T7PA 1S1UA 4CZIA 3QIOA 4FJIA 5F0XA 1U4BA 5J2QA 3M8QA 4AHTA 4Y1CA 3DLHA 1OH5A 1TK8A 1SQKA 3QBWA 3O3FA 4B1ZA 3D2EA 1VSMA 5BPNA 4BR7A 2AP1A 1NJXA 4BREA 2WOMA 1S72N 4JKGA 4YNQA 4KHUA 1I94K 5JICA 1FXXA 4B9QA 4B3OA 4DV4K 4CK1A 2O8BB 1E4GT 2D0AA 1BIZA 3H1VX 3VQCA 4NXMK 2HF3A 3CC2N 3CCEN 3HSTB 1IG9A 2ZJQL 2G8IA 3KLFA 3G71N 2RN2A 2D0CA 5C24A 4DHYA 4KH5A 1JCFA 1LV5A 3U3YA 5C12A 3DJCA 3CMAN 3LDQA 4N47A 4N76A 4DUYK 3O4WA 4DQSA 4DSEA 4JKDA 3AVGA 4WFAL 1QSYA 5AQZA 3NHGA 1TYQA 3ZSVA 1K9MO 1CXQA 4CJUA 1KQSM 1CZBA 3ULEA 3D2FB 1HJOA 1FJGK 3RVCA 4FPAA 4CJ5A 3VESA 3CCSN 4AF1A 5JMVA 1VSFA 5KPTA 4Z4CA 4H5TA 3UB5A 3AO2A 3EYZA 3VQ9A 1SUQA 2NRHA 3A8YA 2FF6A 1QTMA 4BR9A 1W97L 4LF8K 2QXFA 3PSIA 3MDQA 3M5RA 3MN7A 3D0PA 4FLYA 4FYDA 2W41A 2XY6A 1S6PA 4J2DA 2VYPA 4WQ5A 3KK3A 1WSIA 3KLHA 3C95A 4ELTA 2PZSA 1SL1A 2IDOA 5F1XA 4KO0A 2QW9A 3A5LC 4DR6K 5GADP 3HXMA 3TR8A 4CFAA 3CFOA 1K6YA 4NCAA 3VGMA 2OA8A 3S41A 1NU0A 3NVKA 4HCCA 1J54A 4YOYA 5AQVA 3D2FA 1YHQN 3K5LA 4I7FA 5E26A 3SAGA 2ZWHA 1VSDA 4K8XA 3CCQN 3ZEUA 3THYB 2HSTA 1RBTA 1VQNN 4OPAA 2B6AA 3HBTA 3K0SA 3WXIA 4B8CA 4JI4K 3I0SA 4NLBA 5BR8K 4EP5A 4FJ7A 4ZTJA 4L3QA 3F9MA 5LMUK 4EP4A 2VCPA 4AHVA 2P51A 4DKWA 1ZYQA 3CYMA 1IH7A 4O0IA 4QAGA 3AVHA 1Z25A 3TAQA 3V81A 4CJVA 3IKMA 1L3TA 4BRKA 2O8BA 4EIAA 1WLJA 5LL6Z 1QS4A 4OKJA 3V1RA 1NK0A 3KVGA 4CJ7A 3CIPA 5J1EA 2GEMA 2P9UB 3CJ9A 2UUCK 5GAHP 3CG7A 4JHDB 5LJWA 3BGRA 2P5GA 3OYFA 1VQKN 3H3OB 3MEEA 5HRRA 1LAVA 5DM6L 4X64K 1WAFA 3DXKB 5ELZA 1W7AA 3UKRA 1C1BA 2VGNA 4X65K 3A5NC 3SBGA 4KKOA 4KTWA 4CGJA 1NJYA 2HBKA 3OYIA 3VPZA 3CQ8A 5CY4A 2PY5A 1LW0A 4JI3K 3SZ2A 5AQWA 4KHPK 2X6NA 2F4VK 1C1AA 3SPYA 4IJNA 2EWSA 1TUYA 4FJHA 2HHWA 4LSLA 1NGHA 4MO4A 4G9ZA 1X9WA 1NK4A 3KWGA 4RTFD 4B1XB 2VG5A 3CQXA 2YNGA 3PO4A 1J9AA 4FSVA 2IVNA 4BVOA 2ZJPL 4FW2A 3I8BA 3QFUA 2R7YA 4DTUA 4QS9A 5FDLA 2O8DB 1DTQA 4PHTX 3SQ1A 1A5XA 4E3SA 3OYAA 4JI8K 4XEIA 5C0YA 1MA9B 4DB3A 3KKSA 2PBDA 1Y97A 3TPQA 4F9OA 3ATUA 5FROA 4XH5A 4BY9C 4FJJA 3GBTA 4W5TA 1R0AA 2E8AA 1C0UA 1JCEA 4HWIA 4B9MA 4DR7K 2CGLA 2QWLA 4B9VA 4EHTA 2FBYA 3RMDA 1EWRA 4C8MA 4IDHA 2CH5A 4J2AA 4Y0WA 1RT5A 4A59A 4BRQA 3M8PA 3TAPA 2E4LA 5LY3A 3H1QA 4CFBA 4CZMA 4CJQA 3L4IA 4AQYK 4BRCA 3R1XA 4DF8A 4WYBA 5AFUA 5H1SQ 2OPPA 1JLBA 4OGEA 3VQAA 4MDBA 4DQRA 2QI2A 4CF1A 4NYFA 1XNQK 2P9KA 3ENOA 3NMUA 3F9KA 4BRDA 2OPRA 3GDQA 5D3GA 2KW4A 4XIUA 3PX4A 1YJNN 4CGGA 3QEIA 4H5NA 3SCXA 3TAEA 4H0YB 4JI0K 2E1ZA 3U3GA 3N4QA 5KPZA 5C15A 3L0QA 1BQNA 1KLMA 1U45A 1NGGA 4B1VA 3HT3A 4DFKA 2IC3A 1BUPA 2HBLA 3AAPA 3KZBA 5KGWA 1MDUB 4O4GA 1RT7A 4Z94A 2EX3A 1U04A 3MX2A 3B8AX 3V9SA 4F8RA 4CIGA 1NMDA 4OKEA 3AVBA 2ZM6K 2FF3B 1J5EK 2KTQA 1QVFM 2YI1A 2W6KA 1S5JA 4HUEA 3VQ5A 4DQPA 1YJ9N 3SV4A 3VERA 1N34K 4JRQA 3AO3A 2WUSA 4G1QA 2FBVA 1HLUA 3OYEA 3VQDA 3K57A 4BQZA 1VQ9N 4LF6K 3BF3A 2A1RA 4NYNA 4PUOA 1VSEA 2VG7A 4BQLA 1VQ6N 3L2UA 4IOCL 1RT3A 5BN9A 4AILC 1HQUA 1Z6RA 3KK7A 1DEJA 5C25A 3WT0A 1RDDA 1XMOK 2OPSA 3CI5A 2A6AA 1N32K 4AHRA 1EQYA 3J8AA 2A42A 3KJVA 4MLHA 4TSXA 3IMXA
chains in the Genus database with same CATH topology
4YY3K 3J80O 4B3SK 2E5LK 4LF9K 2UUCK 3T1HK 4DV0K 1FJGK 4DV2K 5AJ3K 4CW7B 4JI1K 4LF5K 4X64K 4CVNE 1XNQK 1IBKK 4DR4K 4X65K 4NXNK 1HR0K 4JYAK 2UXCK 4JI0K 4LF7K 4LF8K 4JI3K 4JI2K 4KHPK 2F4VK 1XMQK 1HNWK 2VQEK 2VQFK 4LF4K 4DR3K 4DV6K 4DUZK 5LMNK 5FLXO 4DR1K 4DV3K 1HNXK 3J7YP 1HNZK 2ZM6K 4GKJK 1XNRK 5IWAK 3OTOK 1J5EK 3J81O 4DR6K 4DV7K 2UUAK 4B3RK 4JI7K 2UXBK 4X62K 1IBMK 4YHHK 4JI6K 1N34K 3J7AP 3T1YK 2UXDK 1IBLK 4K0KK 4JI8K 2HHHK 4GKKK 4B3TK 4LFCK 1I94K 4DV5K 4DR5K 4LF6K 4DV4K 4OX9K 4DV1K 4NXMK 4JI4K 5BR8K 4DR7K 4X66K 4JI5K 4JV5K 4V19S 2UUBK 5LMUK 4LFAK 3JAMO 5IT9O 1XMOK 1N32K 4DUYK 4AQYK 5A2QO 4B3MK 1N33K 4LFBK 5LL6Z 1N36K 2UU9K 4DR2K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 K;  3J80 O;  4B3S K;  2E5L K;  4LF9 K;  2UUC K;  3T1H K;  4DV0 K;  1FJG K;  4DV2 K;  5AJ3 K;  4CW7 B;  4JI1 K;  4LF5 K;  4X64 K;  4CVN E;  1XNQ K;  1IBK K;  4DR4 K;  4X65 K;  4NXN K;  1HR0 K;  4JYA K;  2UXC K;  4JI0 K;  4LF7 K;  4LF8 K;  4JI3 K;  4JI2 K;  4KHP K;  2F4V K;  1XMQ K;  1HNW K;  2VQE K;  2VQF K;  4LF4 K;  4DR3 K;  4DV6 K;  4DUZ K;  5LMN K;  5FLX O;  4DR1 K;  4DV3 K;  1HNX K;  3J7Y P;  1HNZ K;  2ZM6 K;  4GKJ K;  1XNR K;  5IWA K;  3OTO K;  1J5E K;  3J81 O;  4DR6 K;  4DV7 K;  2UUA K;  4B3R K;  4JI7 K;  2UXB K;  4X62 K;  1IBM K;  4YHH K;  4JI6 K;  1N34 K;  3J7A P;  3T1Y K;  2UXD K;  1IBL K;  4K0K K;  4JI8 K;  2HHH K;  4GKK K;  4B3T K;  4LFC K;  1I94 K;  4DV5 K;  4DR5 K;  4LF6 K;  4DV4 K;  4OX9 K;  4DV1 K;  4NXM K;  4JI4 K;  5BR8 K;  4DR7 K;  4X66 K;  4JI5 K;  4JV5 K;  4V19 S;  2UUB K;  5LMU K;  4LFA K;  3JAM O;  5IT9 O;  1XMO K;  1N32 K;  4DUY K;  4AQY K;  5A2Q O;  4B3M K;  1N33 K;  4LFB K;  5LL6 Z;  1N36 K;  2UU9 K;  4DR2 K; 
#chains in the Genus database with same CATH topology
 3SMP A;  2G8K A;  1TL3 A;  3I55 N;  3V4I A;  2G8U A;  1NK7 A;  3MED A;  5CE3 A;  3LWL A;  4BDY A;  1WSE A;  3DOK A;  5AQG A;  1WSJ A;  4IG3 A;  4YOT A;  4FLU A;  4DSI A;  2P9S A;  1LWE A;  4CW7 B;  3DXM B;  3C7N A;  3P83 D;  4E0D A;  3AO4 A;  4JEP A;  4R5P A;  2GBZ A;  1ZC6 A;  2QA4 N;  2Z1H A;  2HVH A;  4CEO A;  1YUW A;  1YI2 N;  4DTS A;  4NCB A;  3OS0 A;  5AQI A;  1Q86 O;  4ELU A;  4M3Z A;  1SKR A;  3LZJ A;  4H0T B;  3H45 C;  2FBT A;  3LP2 A;  1HUX A;  2XY7 A;  2O8F A;  3MCA B;  3FZK A;  4CED A;  4H8K A;  4FO0 A;  4BDZ A;  1TKD A;  3I0R A;  4I9Q A;  2E88 A;  3J7Y P;  2HHQ A;  3DRS A;  5M1K A;  3IFR A;  3K5O A;  4BRF A;  3SJJ A;  2D4W A;  4CJS A;  2UUA K;  5AQJ A;  4CJE A;  3HPH A;  3L2R A;  4B3R K;  2HBJ A;  4CHY A;  1RIL A;  2P9L A;  2Z1J A;  3AVK A;  1Q9X A;  4C1N K;  3JSM A;  1Z26 A;  3TTC A;  3S3O A;  5ADX H;  4Z4F A;  4H5R A;  2O8C A;  3VQ7 A;  3G10 A;  4RCH A;  3J7Z O;  3THV A;  1O1W A;  2WTU A;  3HVT A;  4M3W A;  1BG3 A;  1SZ2 A;  4CK3 A;  4FLT A;  2F9T A;  3SUQ A;  1TKX A;  1BL3 A;  1VSH A;  2OZS A;  3SUO A;  4JI5 K;  4JV5 K;  4CGF A;  3C6H A;  3G0Z A;  2G8W A;  2RPI A;  3KLG A;  3GG4 A;  2YJF A;  1UWB A;  1HKC A;  4I9L A;  1NWK A;  2ZGZ A;  4BRP A;  3VTI A;  4FVU A;  1NG9 A;  2V51 B;  5A2Q O;  2Q0U A;  1HRH A;  4OLA A;  1D9D A;  4K43 A;  3VTH A;  4CI6 A;  3EEQ A;  1ILY A;  1SL0 A;  1NGE A;  4CHO A;  2E6L A;  5C2D A;  2BGG A;  3AAR A;  4JI1 K;  3RWU A;  4FZZ A;  1JLG A;  1GLF O;  3LDP A;  2NRV A;  4KFB A;  4J2E A;  4FWP A;  1VHX A;  1TUU A;  2P1J A;  3O9Q A;  3AA3 A;  1NMN A;  3ZSY A;  4JYA K;  1VQM N;  3T7Z A;  3VA3 A;  4LF7 K;  1ASU A;  2NRR A;  3ZT4 A;  4JKF A;  2W6L A;  4JI2 K;  2A1S A;  4H0O A;  3SNN A;  1TYQ B;  1C0G A;  3BF1 A;  2D0O A;  3R9P A;  2VQF K;  1HNI A;  5KPR A;  1NGD A;  3HOS A;  1HNX K;  3CME N;  3CM6 A;  4BE1 A;  3PLA A;  2OTL N;  3NF8 A;  4IEE A;  2P5O A;  2E2P A;  1JXE A;  4U67 L;  3ZX2 A;  2HND A;  3L8B A;  4DSJ A;  4KHQ A;  4FK4 A;  2X6S A;  2YNI A;  4CFC A;  3R8E A;  2DFH A;  1GLL O;  2UXD K;  3B6O A;  4E7I A;  5GIP A;  3ZSR A;  3UKR B;  1Q9Y A;  4PA1 A;  4HVJ A;  4CIF A;  1RT4 A;  3TAR A;  4WCE L;  4DR5 K;  1Q81 O;  4DSL A;  3BY5 A;  4MQ3 A;  3L3U A;  1DT9 A;  2OTJ N;  3A2F A;  4H5V A;  1BU6 O;  1ATR A;  4C1N I;  1WOQ A;  1IKX A;  3HZ6 A;  1X3N A;  4ID1 A;  1NK9 A;  2QWR A;  3OS2 A;  4PL7 A;  2X78 A;  1TGO A;  3CFP A;  3AVA A;  4GMJ B;  2E1Y A;  2I7N A;  1YTU A;  1U47 A;  2W40 A;  4LFB K;  1BDG A;  1HYV A;  4O8K A;  2F7T A;  1OH7 A;  2H3G X;  1ZBS A;  3T69 A;  2QK9 A;  3HP9 A;  4FJ9 A;  3EL2 A;  4BG9 A;  4RWT A;  4MO5 A;  3CF5 L;  1HYS A;  5AQT A;  4CBU A;  4YDU A;  3S3M A;  4CHN A;  1YXQ A;  2P9P A;  2HNY A;  1K73 O;  3TAG A;  4IO8 A;  1HR0 K;  1S22 A;  4FWR A;  2VWB A;  4FWL A;  4KHN A;  3QER A;  5FRM A;  3DLR A;  4OPK A;  3SYZ A;  3AO1 A;  4CIE A;  3QEX A;  1SAZ A;  3AVI A;  3MX5 A;  4UY8 O;  1RT6 A;  4B9L A;  1XMQ K;  2XY8 A;  4M41 A;  3ZT2 A;  1VSJ A;  4IJA A;  4W5R A;  4DV3 K;  1VRU A;  4CZF A;  4MFB A;  1ASW A;  1MWK A;  1NGF A;  1KLN A;  3J81 O;  5I9E B;  1TKT A;  4ID5 A;  3P38 A;  2GX9 A;  4QS8 A;  2HOE A;  3OYL A;  3MAQ A;  5AQY A;  3CC7 N;  2F9W A;  4JHD A;  3PUF A;  4FWO A;  2P9U A;  3K2P A;  4KBO A;  3CFR A;  2BTF A;  4FWQ A;  5KQ8 A;  1C0T A;  1IKW A;  1JL1 A;  2BH1 A;  3LPU A;  1XQS C;  3MWP A;  3ULE B;  4AHC A;  4DV1 K;  4IZ9 A;  2ZE2 A;  1Q18 A;  5DK5 A;  4Q5V A;  1RTJ A;  4ISE A;  3HI0 A;  3MWT A;  2AJQ A;  2UUB K;  2E6M A;  4DMN A;  4RW7 A;  3LDO A;  3ENB A;  4DSK A;  1BIU A;  2NZT A;  1HPM A;  3FE1 A;  1VSL A;  1M1K O;  3O80 A;  4A61 A;  4FJX A;  5BPM A;  1JXB A;  1JLF A;  4YDU C;  3ZEU B;  3THY A;  1HKB A;  4K8Z A;  4DR2 K;  1YVU A;  3S3N A;  4DQQ A;  1T8E A;  2EHG A;  1B9F A;  1WSG A;  3C7N B;  4C8L A;  4DWI A;  5AR0 A;  5AJ3 K;  4RW9 A;  3KIO A;  1ZBI A;  3CC4 N;  3HOT A;  1NJI O;  4LF5 K;  1HYZ A;  1IBK K;  3QEV A;  3O3H A;  3OYM A;  3LAN A;  3RMA A;  4Z4G A;  3AVN A;  1D5A A;  4FWS A;  4CBX A;  3VGL A;  3QEW A;  1A5W A;  4FOE A;  3QIC A;  1NGB A;  3RRG A;  3E1Y A;  3JXU A;  3RTV A;  4KB1 A;  2JGU A;  4CGD A;  4OKK A;  5AQL A;  5EU7 A;  3O3G A;  3MN9 A;  4IFV A;  5KI6 A;  3UKU B;  4DV6 K;  2YHX A;  1BCM A;  3OYC A;  5FPE A;  1NK6 A;  4CZH A;  3DOL A;  1NGA A;  3O6W A;  5F2R A;  2OCE A;  2Y1J A;  5FRN A;  3QO9 A;  3QLH A;  4UQG A;  4IBN A;  4GNI A;  4BRL A;  1BI4 B;  3ZT1 A;  4A2B A;  2UXB K;  4KI4 A;  1H1V A;  4YHH K;  4H0P A;  2I7P A;  2PYL A;  2W42 A;  5HP1 A;  1TL1 A;  2RHK A;  3AA2 A;  3THW B;  4BRM A;  4GY2 B;  2PYJ A;  5AQU A;  4K0K K;  3LL3 A;  3VQQ A;  1C1C A;  1XHX A;  1YAG A;  3ENH A;  4MLE A;  2Y1I A;  4B3T K;  3UE5 A;  1EET A;  4DV5 K;  2VWK A;  2ZJR L;  2QWO A;  3VA0 A;  2Q2R A;  3DRP A;  3KK2 A;  2QM1 A;  3DLK A;  4BC4 A;  2QTD A;  2RKI A;  3E9O A;  4X66 K;  1QZ5 A;  3CPE A;  2YHY A;  4O5F A;  4EZ6 A;  3T19 A;  1FKO A;  1UA1 A;  3WQU A;  2VGM A;  3AVL A;  4O44 A;  4H5W A;  3OVN A;  2FC0 A;  4FWM A;  2DY4 A;  4DQI A;  1KAX A;  2O8F B;  1D9F A;  4YY3 K;  3K58 A;  1QQC A;  4CEQ A;  1HQE A;  2P9K B;  2HHU A;  3D2E B;  3DLB A;  4RG8 A;  4DV0 K;  1VSI A;  4W5Q A;  2QKB A;  3LAM A;  3IAY A;  3TSP A;  1QHT A;  3WEE A;  1TVR A;  2OPQ A;  4BGB A;  1GLA G;  4NLC A;  1OH6 A;  1D8Y A;  5BR9 A;  3W0L A;  4FLW A;  4WQ4 A;  3M1F A;  5EX5 A;  3M8S A;  3CJB A;  4CHP A;  3CCV N;  1N5Y A;  1CXU A;  3BDP A;  3M6G A;  3QFP A;  2F8T A;  5TKW A;  1RTD A;  1WSF A;  2YJE A;  5M1O A;  2A41 A;  3L4Q A;  3O8M A;  4FW1 A;  4C23 A;  4JAX A;  1ITG A;  1K8A O;  1HPZ A;  3MMV A;  2QKK A;  3TAM A;  3H46 O;  3TTF A;  3I8D A;  3AGK A;  1FW6 A;  5ADX A;  4FZY A;  3Q7C A;  2P9N B;  3DRR A;  1RCH A;  3MXJ A;  4I6M A;  1Q8I A;  3OTO K;  1VRT A;  4DFM A;  4PKI A;  3PX0 A;  4DTJ A;  4CF0 A;  4B9S A;  4WQ4 C;  1IBM K;  4JD2 B;  5HBM A;  5KQD A;  5AQX A;  3SV3 A;  3QML A;  3T1Y K;  3NF7 A;  2NRT A;  3AVC A;  4CFD A;  3FGU A;  2ZQB A;  3U8X A;  2J4R A;  1W2B M;  1Y64 A;  1QE1 A;  2QWP A;  4CJP A;  2G8F A;  2E2Q A;  2D5R A;  5J2M A;  1KTQ A;  1YT3 A;  3NBP A;  5GIN A;  2P9N A;  4CER A;  1YVN A;  1ZXO A;  3P39 A;  3P1G A;  3AAQ A;  4FWN A;  3VEO A;  3HVR A;  2YV0 X;  3F73 A;  3WXJ A;  1HJR A;  4V19 S;  3CCL N;  2YNF A;  1NKC A;  2BAN A;  1G99 A;  4CBW A;  1NBW A;  5IT9 O;  2D0B A;  4IWV A;  3O9T A;  1VQ8 N;  1VQ4 N;  4KHW A;  3CER A;  2D1K A;  3J80 O;  2HMI A;  4B3S K;  3VEN A;  5B8H A;  2P9L B;  4DLG A;  3CJ7 A;  1UAX A;  1D4X A;  2A5X A;  3O1W A;  3TSQ A;  5AZI B;  2OYQ A;  1VQ5 N;  3R6M A;  3U6F A;  1X1P A;  5EXW A;  3L2Q A;  2O8C B;  4XH1 A;  3VF6 A;  1ZBH A;  4AM7 A;  3G6E N;  4EZ9 A;  2IGI A;  5JS2 A;  1B92 A;  4JKB A;  3V6D A;  1LAW A;  3ISN C;  2CGK A;  4E89 A;  4BVP A;  3EZ5 A;  1X9S A;  3SK3 A;  2NRW A;  4Z4I A;  4DTX A;  4AM6 A;  4BR5 A;  2OAN A;  2O4I A;  3KWI A;  1P90 A;  3NF9 A;  3V9W A;  3T3F A;  4CHQ A;  3WUH A;  3F2K A;  4M63 C;  3VOV A;  1OVY A;  3IG1 A;  3C6T A;  4GKJ K;  1ATS A;  4IFE A;  1GLC G;  3O4N A;  5M1P A;  1JLA A;  2PAV A;  5SWM A;  2FXU A;  4KV8 A;  5CZ1 A;  5GAG P;  1L5U A;  2D0P A;  5AZI A;  1JLE A;  5M1F A;  2Q3S A;  4Z4E A;  1HKG A;  3H3N O;  3NGI A;  1KC8 O;  2Q1N A;  3OYN A;  1VQL N;  3DLG A;  3OYH A;  3MXM A;  1RDU A;  1XI1 A;  3LM2 A;  3SLC A;  3HP6 A;  4JKA A;  1MWM A;  3MEC A;  1BIS A;  3S9H A;  1BQM A;  3WXK A;  4YOV A;  5AQS A;  4FM1 A;  1NGC A;  2YHA A;  3ALY A;  3HRG A;  3WNG A;  5HL7 L;  3SPZ A;  4KTZ A;  3TAF A;  1NGI A;  5CR4 A;  4CZL A;  4FL9 A;  3HM9 A;  1KAY A;  2E2N A;  1G15 A;  1LCU A;  1E3M A;  1JL2 A;  3FZF A;  1S1W A;  2PFU A;  4EFH A;  4HHT A;  4EHU A;  3WXM B;  3OA9 A;  3OYK A;  2GV9 A;  3U9Z A;  1BCO A;  1KSP A;  3A5O C;  2QEX N;  1V4S A;  3NFA A;  2HHT A;  2NLX A;  4RW8 A;  5AQK A;  3CCU N;  3LPT A;  5I42 A;  2ASO A;  3DLL L;  1KVB A;  4IOA L;  2DPN A;  2BE2 A;  4I6M B;  2HF4 A;  3VN5 A;  2GUI A;  3F5T A;  4BRI A;  5AFU H;  1I39 A;  4DU1 A;  1EKE A;  4B8A B;  3LAL A;  3ITH A;  4DSF A;  3W3D A;  2QWN A;  3ZX0 A;  5CHI A;  1KCF A;  4E7L A;  4DR3 K;  3RMB A;  1BWF O;  2GEL A;  3PX6 A;  5FLX O;  5HLF A;  4JKE A;  4BRO A;  4OPH A;  2YHB A;  3QES A;  4C8N A;  4ICL A;  4JKC A;  3IRX A;  4AHS A;  4EAH D;  3LZI A;  3D7E O;  4NO7 A;  4E1N A;  3O4Q A;  3WNE A;  3P31 A;  1KRP A;  4R79 A;  3QNN A;  1VAZ A;  1J53 A;  2RE2 A;  4HTL A;  5FPM A;  2HHX A;  4WFB L;  1RT1 A;  5FPD A;  1XWL A;  2KFN A;  1S3X A;  1GLJ O;  3AV9 A;  4FJN A;  1RBR A;  3M8R A;  4HUG A;  3CET A;  4OPJ A;  3O9U A;  4ISG A;  4O5B A;  1HX1 A;  1RDC A;  3CJ1 A;  4B1Y B;  4GV3 A;  1SKS A;  2ZF5 O;  3VEX A;  1RDB A;  1T6C A;  2IVO A;  3VQ4 A;  3ZSQ A;  1IJJ A;  2IOC A;  4ILJ A;  3CXC M;  3H6E A;  4LC9 B;  4CZK A;  1QHA A;  2QWM A;  1U49 A;  4M3T A;  3CCR N;  3OYB A;  1C6V A;  1RTI A;  2XO7 A;  3QIN A;  2QWQ A;  3FZH A;  1RBU A;  1IO2 A;  1FKP A;  1RTH A;  1T44 A;  5HOO A;  3MXI A;  4FOI A;  2GUP A;  3ZET B;  3Q7B A;  4U7B A;  3N4P A;  2ZD1 A;  3RSE B;  1X9M A;  1N33 K;  2YHW A;  4M3X A;  1KFD A;  5SZT A;  2Z1G A;  4OGC A;  3D6R A;  2G8V A;  1UOC A;  4FLZ A;  2FSJ A;  3FZM A;  3G25 A;  3THW A;  5J2P A;  1L3V A;  1EWQ A;  3LP3 A;  4LH5 A;  3WQT A;  3QB0 A;  4LSN A;  4A5A A;  4DTN A;  3GE1 A;  4CEE A;  4H4O A;  4NXN K;  1WNS A;  1L3U A;  2X74 A;  4H03 B;  2IIR A;  3LDS A;  1J5O A;  4KTQ A;  1EX4 A;  4N5S A;  1QVG M;  4FVM A;  3ID8 A;  3LAK A;  2XRI A;  3A5M C;  4LF4 K;  1DTT A;  4DUZ K;  5LMN K;  1T6D A;  3OHR A;  4DU3 A;  4KB0 A;  3CCM N;  1QQN A;  3HJF A;  3NGZ A;  4PWD A;  3VF4 A;  2ZGY A;  4M7X A;  4K42 A;  1W9H A;  3DAW A;  4CEA A;  2DFE A;  4DU4 A;  3TSU A;  1VQ7 N;  1XHZ A;  3ZLJ A;  4DTP A;  3BP8 A;  4BC2 A;  1LWC A;  1A5V A;  3DXK A;  4IFY A;  4GKK K;  1HNV A;  3I56 N;  1RDW X;  3O9S A;  3V9U A;  3WXL A;  1TK5 A;  4IDK A;  5C42 A;  4DTO A;  4FJK A;  4CCH A;  4OX9 K;  1IKY A;  1BO5 O;  2Z1I A;  4CD3 A;  3HK2 A;  3HM8 A;  3VQ6 A;  4QCL A;  1GLB G;  1NNE A;  5AQM A;  4JK7 A;  5FPN A;  4M42 A;  2P9I A;  1RBV A;  4B08 A;  4M45 A;  3V9Z A;  1TAQ A;  3JYT A;  4CEZ A;  2FBX A;  2GTD A;  3K9J A;  3NE6 A;  4ELV A;  1GLE G;  3E9L A;  5HRS A;  3ZCM A;  5BRH A;  2HNZ A;  2P9I B;  4FJL A;  1OVQ A;  3VEV A;  1N36 K;  2JLE A;  2YCH A;  1ESV A;  2ITM A;  5AQF A;  2V7Z A;  2KZM A;  3VMF B;  1BHL A;  1EP4 A;  4Z4H A;  1C0M A;  4GVM A;  5KRS A;  1HMV A;  3SQ0 A;  3QEP A;  2E2O A;  1U6Z A;  4H0X B;  4PL8 A;  4CJ4 A;  4OVL A;  3MN6 A;  2YKM A;  3E66 A;  5KRT A;  2HBM A;  3FFK B;  4GW6 A;  3KKR A;  3SUP A;  3ASM A;  4M3R A;  3EKS A;  5JLH A;  3O9R A;  1BA1 A;  1CZA N;  1Q82 O;  1C0F A;  2YKN A;  4CJL A;  3JS6 A;  1XC9 A;  4LD0 A;  5AQQ A;  4CE9 A;  2UXC K;  3LDN A;  1ZBU A;  3K5N A;  4AHU A;  1P8Z A;  1JJ2 M;  2Q36 A;  3AO5 A;  4I2P A;  4Y1D A;  2CH6 A;  2DTU A;  4NCG A;  3DYA A;  3SMS A;  1EO1 A;  4XH4 A;  3OBY A;  3L6Q A;  5K14 A;  4YOX A;  1BOT O;  3P4I A;  3CD6 N;  3U9D A;  3AA4 A;  1YJW N;  3FZL A;  1KD1 O;  3EKU A;  1IV0 A;  4DV7 K;  2Q0R A;  2O8D A;  1S6Q A;  4W5O A;  2UYT A;  2O8E B;  1S1T A;  4FK0 A;  4JLH A;  4JI6 K;  4M7Y A;  3VEW A;  2QXL A;  3ZSX A;  3THX B;  3VEZ A;  4KRF A;  4DQ8 A;  3TI0 A;  4CGH A;  1K8K A;  5C10 A;  2KZZ A;  1KXP A;  4LFC K;  3P5J A;  2HVI A;  3QIP A;  5EY4 A;  4ISF A;  4C8O A;  3SQ4 A;  4FM0 A;  1WN7 A;  3ZT0 A;  1T03 A;  5TKY A;  2YNH A;  3FR0 A;  1LW2 A;  3MCP A;  4QOZ B;  3PSF A;  5GIO A;  4FWK A;  1ZBL A;  3ATV A;  4Z0U A;  2DFF A;  3ZT3 A;  2BDP A;  5BRD A;  1DGK N;  5BRF A;  3L3V A;  1QSL A;  3ULD A;  2OZM A;  3C65 A;  4BR0 A;  2BUP A;  1DKG D;  1CZ9 A;  1RGI A;  5JLF A;  5KTQ A;  5J2N A;  3TAB A;  3M3Z A;  4B3M K;  4IOX A;  4CJW A;  4YOW A;  2HW3 A;  4JS4 A;  4BRA A;  3NH1 A;  3ID6 A;  3PV8 A;  3KLE A;  2ATQ A;  4BAC A;  4BC3 A;  3QET A;  2HB5 A;  4E7H A;  3RRH A;  2B4J A;  2XHB A;  3OJS A;  4N56 A;  4H4M A;  4RW4 A;  5M1N A;  5C2F A;  4GV9 A;  3HPG A;  2B5J A;  3KHY A;  4B1W B;  2AA4 A;  3VQP A;  4DR4 K;  4I2Q A;  1X3M A;  4IG0 A;  1ZBF A;  4YOU A;  1YF5 L;  3LDL A;  3CJC A;  2IVP A;  3ZSO A;  3RR7 A;  5AZJ B;  3DLE A;  4AH9 A;  3CPW M;  3VEY A;  3VGK A;  2VWJ A;  5I3U A;  2NRX A;  2KQ2 A;  3H08 A;  3WNF A;  4CEC A;  3SBT A;  4JKH A;  2Q97 A;  2E20 A;  1YIT N;  4BR2 A;  1KAZ A;  4BDP A;  1HNZ K;  3EZW A;  4WE1 A;  4B1U B;  3AVJ A;  4B9T A;  1XNR K;  4KAZ A;  5IWA K;  2ASP A;  5BPL A;  5LJV A;  3UIQ A;  4CF2 A;  4F2S A;  4KI6 A;  5BRE A;  2Q31 A;  1OH8 A;  3LP0 A;  4GV6 A;  5EOY A;  3C6U A;  4KRE A;  2HMP A;  1WB9 A;  5MLC Q;  4PKH A;  2HHH K;  2JWK A;  3K59 A;  1VQO N;  4OO1 J;  3O5B A;  3RSE A;  1V4T A;  3DWL A;  2F8S A;  3VQB A;  4JD2 A;  1NGJ A;  2V7Y A;  3LP1 A;  2ITG A;  4FZX C;  3RMC A;  3MN5 A;  1GOB A;  4E1J A;  5KGX A;  1REV A;  4CJT A;  1GOC A;  2A3Z A;  3E01 A;  5CZ2 A;  4F4K A;  1KVC A;  1LOT B;  4HUF A;  1Z05 A;  4GVE A;  1VQP N;  1YTA A;  4IEI A;  5AZJ A;  1QSS A;  1T3V A;  1U48 A;  1RDA A;  1EXQ A;  4CES A;  3OYG A;  1NKE A;  5DM7 L;  4DTR A;  1M90 O;  4E1M A;  1NKB A;  4IKF A;  3SAF A;  2UU9 K;  5AQH A;  3KK1 A;  4JRP A;  3DMJ A;  2E5L K;  4LF9 K;  4FJ8 A;  4A2A A;  3PIP L;  3KD1 E;  4FLV A;  1R59 O;  3OYJ A;  3TU5 A;  4CJK A;  1JCG A;  5CYQ A;  3RR8 A;  4W5N A;  3OS1 A;  1RBS A;  3NVM A;  1F21 A;  3BUZ B;  1OKJ A;  3FLC O;  4L8R B;  2IAJ A;  5E84 A;  2O4G A;  3VQ8 A;  5GAE P;  3MEG A;  1SV5 A;  1TV6 A;  4WF9 L;  3T1A A;  4O8U A;  1NOY A;  3LM9 A;  4LH4 A;  5JVH L;  3I33 A;  4BRG A;  4DLE A;  1U2V A;  4FPB A;  5E41 A;  3EE9 A;  2JWL A;  2ASM A;  2HHS A;  3ZSW A;  1TAU A;  4JKG B;  1J6Z A;  5HRN A;  3EY1 A;  2YX6 A;  2FLO A;  4YOR A;  4HCB A;  1MU2 A;  1S1X A;  1W0H A;  3HL8 A;  1IKV A;  4KH6 A;  2NUB A;  3NGY A;  4M3U A;  3HSC A;  4ILH A;  1K8K B;  1JKH A;  2LSN A;  3LWM A;  2XY5 A;  3V1O A;  5HRO A;  3NCI A;  4DFJ A;  2KHO A;  1BA0 A;  2P9S B;  4FJM A;  5HRP A;  3A0I X;  1IG8 A;  5M1Q A;  2VG6 A;  4DG1 A;  1L3S A;  2KFZ A;  2IS3 A;  1N8R O;  4A5B A;  2O8E A;  3C6A A;  3B6P A;  1SS6 A;  1WBD A;  3CQY A;  2KLA A;  4BRN A;  3G4S N;  5T7B A;  1X9J A;  1Q7Y O;  1BI4 A;  1O13 A;  4BC5 A;  4ZHR A;  3PIO L;  1NJZ A;  2FSN A;  2GWJ A;  1NOZ A;  4LFA K;  2NNW A;  3JAM O;  1QZ6 A;  3L2W A;  3AGR A;  3OBW A;  3K9K A;  4DS5 A;  4FK2 A;  3OY9 A;  2F96 A;  4DTM A;  4CHZ A;  3HO1 A;  4FXD A;  3CM5 A;  1QQO A;  3DM2 A;  3QDK A;  3KD5 E;  3NH2 A;  4DFP A;  3K5M A;  1E4F T;  4H0V B;  1GOA A;  1NJW A;  4IXC A;  1WBB A;  5CYM A;  3T1H K;  3SI6 A;  4DV2 K;  1ATN A;  4B9N A;  4YFU A;  4CF8 A;  1JLC A;  1ASV A;  4J8F A;  4CVN E;  4CF9 A;  3ZYY X;  5JVG L;  2ETJ A;  4JK8 A;  2A40 A;  4JN4 A;  3CCJ N;  3NF6 A;  3ZET A;  3AY9 A;  2G8H A;  1U2V B;  1UA0 A;  3OJU A;  1S9E A;  3FFI A;  1CLQ A;  3HYF A;  4OJR A;  1TKZ A;  4CJF A;  2WBN A;  4E19 A;  2WC9 A;  1RFQ A;  1VK0 A;  4F3O A;  3R3L A;  5AQO A;  4BE0 A;  1QQM A;  4B9U A;  1RNH A;  4DR1 K;  4E7K A;  4BWM A;  5AQN A;  4JK9 A;  3WNH A;  2HHV A;  2I5J A;  3NH0 A;  4ILG B;  4DS4 A;  3KLI A;  4E7J A;  3WEE B;  4KPY A;  4FJ5 A;  4PY5 A;  1NM1 A;  1WAJ A;  1NK5 A;  4OLB A;  4JI7 K;  1JLQ A;  3U4L A;  3NAE A;  4Q0B A;  4N41 A;  2WFB A;  4X62 K;  4LY7 A;  2GWK A;  4JS5 A;  3BZK A;  4KH4 A;  4A62 A;  4BR4 A;  3KTQ A;  3J7A P;  2WON A;  1IBL K;  4J2B A;  4CGI A;  4FLX A;  4K41 A;  4CK2 A;  4F3T A;  4MDA A;  4QS7 A;  3O1B A;  4IO9 L;  1WUA A;  3HPO A;  3TAN A;  4RW6 A;  2KKZ A;  3IDH A;  3VF2 A;  3PY8 A;  3DI6 A;  4KHS A;  1T05 A;  4DF4 A;  3E9P A;  3MK6 A;  4PKG A;  4CZE A;  3AVM A;  1S9G A;  3C0B A;  4CD1 A;  3C94 A;  1KFS A;  1KVA A;  4A57 A;  4JNE A;  3IS9 A;  3TWH A;  4ZTF A;  1XC3 A;  3SUN A;  2CGJ A;  3EO3 A;  3V9X A;  1WSH A;  4C8K A;  4WFN L;  3GOI A;  4M3Y A;  3EN9 A;  1TK0 A;  3SAH A;  1NLV A;  4O55 A;  3V1Q A;  1B9D A;  4FCY A;  1S1V A;  4BRH A;  2FSK A;  3SQ2 A;  3GL1 A;  5EVZ A;  3D45 A;  3SJH A;  1BGX T;  3DXM A;  2NRZ A;  2V52 B;  3CJA A;  3QNO A;  3THX A;  1XUP O;  3L2V A;  2P9P B;  4FJG A;  4FM2 A;  2RF2 A;  3OYD A;  3VET A;  1FK9 A;  4NB4 A;  4BE2 A;  3AVF A;  4CZJ A;  3NDK A;  4BWJ A;  3UKU A;  4HTU A;  4KHY A;  5BN8 A;  4BG8 A;  4CZG A;  3ZX3 A;  4F2R A;  4WQ5 C;  3VQE A;  1RT2 A;  4CEB A;  5AQR A;  1SKW A;  1VSK A;  1HNW K;  3BZC A;  3IUC A;  2VQE K;  5JS1 A;  3HTV A;  3QBX A;  5AQP A;  3O08 A;  1GLD G;  4BGA A;  3BEX A;  1SL2 A;  3PO5 A;  3OW2 M;  4CJR A;  3EE8 A;  4CJ3 A;  1NK8 A;  3CHW A;  4CEF A;  1N6Q A;  4K25 A;  1DLO A;  1I3A A;  3AA5 X;  3TTD A;  5DMR A;  4DCH A;  4PQU A;  4O0J A;  1LWF A;  1YIJ N;  3ZSZ A;  1T7P A;  1S1U A;  4CZI A;  3QIO A;  4FJI A;  5F0X A;  1U4B A;  5J2Q A;  3M8Q A;  4AHT A;  4Y1C A;  3DLH A;  1OH5 A;  1TK8 A;  1SQK A;  3QBW A;  3O3F A;  4B1Z A;  3D2E A;  1VSM A;  5BPN A;  4BR7 A;  2AP1 A;  1NJX A;  4BRE A;  2WOM A;  1S72 N;  4JKG A;  4YNQ A;  4KHU A;  1I94 K;  5JIC A;  1FXX A;  4B9Q A;  4B3O A;  4DV4 K;  4CK1 A;  2O8B B;  1E4G T;  2D0A A;  1BIZ A;  3H1V X;  3VQC A;  4NXM K;  2HF3 A;  3CC2 N;  3CCE N;  3HST B;  1IG9 A;  2ZJQ L;  2G8I A;  3KLF A;  3G71 N;  2RN2 A;  2D0C A;  5C24 A;  4DHY A;  4KH5 A;  1JCF A;  1LV5 A;  3U3Y A;  5C12 A;  3DJC A;  3CMA N;  3LDQ A;  4N47 A;  4N76 A;  4DUY K;  3O4W A;  4DQS A;  4DSE A;  4JKD A;  3AVG A;  4WFA L;  1QSY A;  5AQZ A;  3NHG A;  1TYQ A;  3ZSV A;  1K9M O;  1CXQ A;  4CJU A;  1KQS M;  1CZB A;  3ULE A;  3D2F B;  1HJO A;  1FJG K;  3RVC A;  4FPA A;  4CJ5 A;  3VES A;  3CCS N;  4AF1 A;  5JMV A;  1VSF A;  5KPT A;  4Z4C A;  4H5T A;  3UB5 A;  3AO2 A;  3EYZ A;  3VQ9 A;  1SUQ A;  2NRH A;  3A8Y A;  2FF6 A;  1QTM A;  4BR9 A;  1W97 L;  4LF8 K;  2QXF A;  3PSI A;  3MDQ A;  3M5R A;  3MN7 A;  3D0P A;  4FLY A;  4FYD A;  2W41 A;  2XY6 A;  1S6P A;  4J2D A;  2VYP A;  4WQ5 A;  3KK3 A;  1WSI A;  3KLH A;  3C95 A;  4ELT A;  2PZS A;  1SL1 A;  2IDO A;  5F1X A;  4KO0 A;  2QW9 A;  3A5L C;  4DR6 K;  5GAD P;  3HXM A;  3TR8 A;  4CFA A;  3CFO A;  1K6Y A;  4NCA A;  3VGM A;  2OA8 A;  3S41 A;  1NU0 A;  3NVK A;  4HCC A;  1J54 A;  4YOY A;  5AQV A;  3D2F A;  1YHQ N;  3K5L A;  4I7F A;  5E26 A;  3SAG A;  2ZWH A;  1VSD A;  4K8X A;  3CCQ N;  3ZEU A;  3THY B;  2HST A;  1RBT A;  1VQN N;  4OPA A;  2B6A A;  3HBT A;  3K0S A;  3WXI A;  4B8C A;  4JI4 K;  3I0S A;  4NLB A;  5BR8 K;  4EP5 A;  4FJ7 A;  4ZTJ A;  4L3Q A;  3F9M A;  5LMU K;  4EP4 A;  2VCP A;  4AHV A;  2P51 A;  4DKW A;  1ZYQ A;  3CYM A;  1IH7 A;  4O0I A;  4QAG A;  3AVH A;  1Z25 A;  3TAQ A;  3V81 A;  4CJV A;  3IKM A;  1L3T A;  4BRK A;  2O8B A;  4EIA A;  1WLJ A;  5LL6 Z;  1QS4 A;  4OKJ A;  3V1R A;  1NK0 A;  3KVG A;  4CJ7 A;  3CIP A;  5J1E A;  2GEM A;  2P9U B;  3CJ9 A;  2UUC K;  5GAH P;  3CG7 A;  4JHD B;  5LJW A;  3BGR A;  2P5G A;  3OYF A;  1VQK N;  3H3O B;  3MEE A;  5HRR A;  1LAV A;  5DM6 L;  4X64 K;  1WAF A;  3DXK B;  5ELZ A;  1W7A A;  3UKR A;  1C1B A;  2VGN A;  4X65 K;  3A5N C;  3SBG A;  4KKO A;  4KTW A;  4CGJ A;  1NJY A;  2HBK A;  3OYI A;  3VPZ A;  3CQ8 A;  5CY4 A;  2PY5 A;  1LW0 A;  4JI3 K;  3SZ2 A;  5AQW A;  4KHP K;  2X6N A;  2F4V K;  1C1A A;  3SPY A;  4IJN A;  2EWS A;  1TUY A;  4FJH A;  2HHW A;  4LSL A;  1NGH A;  4MO4 A;  4G9Z A;  1X9W A;  1NK4 A;  3KWG A;  4RTF D;  4B1X B;  2VG5 A;  3CQX A;  2YNG A;  3PO4 A;  1J9A A;  4FSV A;  2IVN A;  4BVO A;  2ZJP L;  4FW2 A;  3I8B A;  3QFU A;  2R7Y A;  4DTU A;  4QS9 A;  5FDL A;  2O8D B;  1DTQ A;  4PHT X;  3SQ1 A;  1A5X A;  4E3S A;  3OYA A;  4JI8 K;  4XEI A;  5C0Y A;  1MA9 B;  4DB3 A;  3KKS A;  2PBD A;  1Y97 A;  3TPQ A;  4F9O A;  3ATU A;  5FRO A;  4XH5 A;  4BY9 C;  4FJJ A;  3GBT A;  4W5T A;  1R0A A;  2E8A A;  1C0U A;  1JCE A;  4HWI A;  4B9M A;  4DR7 K;  2CGL A;  2QWL A;  4B9V A;  4EHT A;  2FBY A;  3RMD A;  1EWR A;  4C8M A;  4IDH A;  2CH5 A;  4J2A A;  4Y0W A;  1RT5 A;  4A59 A;  4BRQ A;  3M8P A;  3TAP A;  2E4L A;  5LY3 A;  3H1Q A;  4CFB A;  4CZM A;  4CJQ A;  3L4I A;  4AQY K;  4BRC A;  3R1X A;  4DF8 A;  4WYB A;  5AFU A;  5H1S Q;  2OPP A;  1JLB A;  4OGE A;  3VQA A;  4MDB A;  4DQR A;  2QI2 A;  4CF1 A;  4NYF A;  1XNQ K;  2P9K A;  3ENO A;  3NMU A;  3F9K A;  4BRD A;  2OPR A;  3GDQ A;  5D3G A;  2KW4 A;  4XIU A;  3PX4 A;  1YJN N;  4CGG A;  3QEI A;  4H5N A;  3SCX A;  3TAE A;  4H0Y B;  4JI0 K;  2E1Z A;  3U3G A;  3N4Q A;  5KPZ A;  5C15 A;  3L0Q A;  1BQN A;  1KLM A;  1U45 A;  1NGG A;  4B1V A;  3HT3 A;  4DFK A;  2IC3 A;  1BUP A;  2HBL A;  3AAP A;  3KZB A;  5KGW A;  1MDU B;  4O4G A;  1RT7 A;  4Z94 A;  2EX3 A;  1U04 A;  3MX2 A;  3B8A X;  3V9S A;  4F8R A;  4CIG A;  1NMD A;  4OKE A;  3AVB A;  2ZM6 K;  2FF3 B;  1J5E K;  2KTQ A;  1QVF M;  2YI1 A;  2W6K A;  1S5J A;  4HUE A;  3VQ5 A;  4DQP A;  1YJ9 N;  3SV4 A;  3VER A;  1N34 K;  4JRQ A;  3AO3 A;  2WUS A;  4G1Q A;  2FBV A;  1HLU A;  3OYE A;  3VQD A;  3K57 A;  4BQZ A;  1VQ9 N;  4LF6 K;  3BF3 A;  2A1R A;  4NYN A;  4PUO A;  1VSE A;  2VG7 A;  4BQL A;  1VQ6 N;  3L2U A;  4IOC L;  1RT3 A;  5BN9 A;  4AIL C;  1HQU A;  1Z6R A;  3KK7 A;  1DEJ A;  5C25 A;  3WT0 A;  1RDD A;  1XMO K;  2OPS A;  3CI5 A;  2A6A A;  1N32 K;  4AHR A;  1EQY A;  3J8A A;  2A42 A;  3KJV A;  4MLH A;  4TSX A;  3IMX A; 
#chains in the Genus database with same CATH homology
 4YY3 K;  3J80 O;  4B3S K;  2E5L K;  4LF9 K;  2UUC K;  3T1H K;  4DV0 K;  1FJG K;  4DV2 K;  5AJ3 K;  4CW7 B;  4JI1 K;  4LF5 K;  4X64 K;  4CVN E;  1XNQ K;  1IBK K;  4DR4 K;  4X65 K;  4NXN K;  1HR0 K;  4JYA K;  2UXC K;  4JI0 K;  4LF7 K;  4LF8 K;  4JI3 K;  4JI2 K;  4KHP K;  2F4V K;  1XMQ K;  1HNW K;  2VQE K;  2VQF K;  4LF4 K;  4DR3 K;  4DV6 K;  4DUZ K;  5LMN K;  5FLX O;  4DR1 K;  4DV3 K;  1HNX K;  3J7Y P;  1HNZ K;  2ZM6 K;  4GKJ K;  1XNR K;  5IWA K;  3OTO K;  1J5E K;  3J81 O;  4DR6 K;  4DV7 K;  2UUA K;  4B3R K;  4JI7 K;  2UXB K;  4X62 K;  1IBM K;  4YHH K;  4JI6 K;  1N34 K;  3J7A P;  3T1Y K;  2UXD K;  1IBL K;  4K0K K;  4JI8 K;  2HHH K;  4GKK K;  4B3T K;  4LFC K;  1I94 K;  4DV5 K;  4DR5 K;  4LF6 K;  4DV4 K;  4OX9 K;  4DV1 K;  4NXM K;  4JI4 K;  5BR8 K;  4DR7 K;  4X66 K;  4JI5 K;  4JV5 K;  4V19 S;  2UUB K;  5LMU K;  4LFA K;  3JAM O;  5IT9 O;  1XMO K;  1N32 K;  4DUY K;  4AQY K;  5A2Q O;  4B3M K;  1N33 K;  4LFB K;  5LL6 Z;  1N36 K;  2UU9 K;  4DR2 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...