4KHPK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4khpK00
5AJ3K 1XNQK 4GKJK 5A2QO 2UU9K 4YHHK 4DUZK 4JI3K 4NXMK 4DV7K 1HNXK 4DV2K 2UXDK 5LL6Z 4B3MK 4DV6K 3J7YP 4JI2K 3T1HK 4B3RK 4LFAK 1N36K 4LF6K 4V19S 4DR1K 4JI1K 4LF4K 1N33K 2HHHK 4JV5K 4KHPK 4YY3K 1XNRK 1N32K 1HR0K 5LMNK 1IBKK 4DV5K 2ZM6K 4DR2K 4CW7B 5IT9O 4JI4K 2UXBK 2UUBK 2VQEK 3OTOK 4CVNE 1IBMK 5BR8K 1I94K 3J7AP 4DV0K 4JI5K 4JI8K 4JI0K 1HNZK 4X64K 4NXNK 4DR4K 4DR7K 4DR3K 4X65K 4K0KK 5IWAK 4LFCK 2E5LK 4B3TK 1XMOK 5LMUK 1J5EK 2UUAK 3J80O 4JI7K 4LF9K 4DR6K 4LFBK 4GKKK 4LF8K 4LF5K 4DV1K 1N34K 2F4VK 3T1YK 1HNWK 4DR5K 4JYAK 4X62K 5FLXO 4AQYK 4OX9K 1FJGK 4DV3K 1IBLK 2UXCK 4X66K 2UUCK 3J81O 2VQFK 1XMQK 3JAMO 4JI6K 4DUYK 4B3SK 4DV4K 4LF7K
chains in the Genus database with same CATH superfamily
3EZWA 4CGIA 5TKYA 2KZZA 1BHLA 5LJVA 1ZC6A 1VQMN 1UOCA 2CH6A 3SQ0A 2VWKA 4YHHK 1VSFA 2Z1GA 2HBLA 4H03B 4H5NA 4HVJA 2GELA 1QQOA 3O3GA 4DTJA 4FJ8A 4M7XA 1U4BA 4FJNA 3KLHA 4IWVA 4CEEA 4CGHA 2Q36A 4IOXA 3E9LA 5HL7L 1CXUA 3RRGA 4O5FA 1EXQA 3QESA 4E19A 4DSLA 1TUUA 4HTLA 4JRPA 2ZM6K 3VTIA 3EL2A 4IDKA 4JI4K 4YOVA 3B6PA 2P1JA 4QS9A 1XI1A 4BC5A 3UB5A 5BR8K 5EVZA 3KK1A 3CF5L 5HLFA 3T69A 4JI0K 2HVHA 3C7NB 3QBWA 4MLEA 4F2SA 3SPYA 3JS6A 4BVPA 3BZCA 3MX5A 4CJVA 3HM9A 2QXLA 3CFOA 2HF3A 2ZE2A 4DR3K 1ATRA 3LP3A 2FF3B 3CMAN 3MXJA 4BRDA 2JWLA 3VPZA 4IFYA 3JSMA 1S6PA 3LDNA 4BVOA 3LWMA 4NO7A 1Z26A 3J8AA 1BI4B 3VQEA 1U47A 4CJRA 4BG8A 2QEXN 2NLXA 1HJOA 1BUPA 1S6QA 3OA9A 4Z0UA 4RG8A 4CGGA 4X62K 2XY7A 1U6ZA 3ZSWA 4CF9A 1WBDA 3LZIA 3AVAA 1ZYQA 4EZ6A 4CJ7A 3BZKA 5F2RA 2UXCK 2P9LB 1LWFA 4J2BA 4H5TA 1RBSA 1EQYA 3WXIA 3CCLN 4DFJA 3OHRA 4DMNA 1D8YA 4FJHA 4BG9A 4OPJA 3KD5E 4CGDA 2P9NB 4DUZK 1S9EA 1FW6A 4A59A 2A42A 1RNHA 3HPHA 4YDUC 3V9WA 1VQLN 1C0TA 2I7NA 3VMFB 1WNSA 4O8UA 4YOWA 1VQ4N 5B8HA 4YY3K 1BCMA 1XNRK 3CD6N 5LMNK 3TI0A 3M3ZA 5FPMA 4Y1CA 1RDBA 4FK0A 2G8WA 2E6MA 1Q7YO 4CD3A 4DR2K 2VGMA 4CW7B 2E2PA 3WXJA 4WQ5A 4F3OA 3QBXA 3M8RA 1Z05A 2D1KA 3KK7A 4G9ZA 1ATSA 2KW4A 3MK6A 4AHVA 2WC9A 4DQ8A 3LDSA 2JGUA 4ZTJA 3V1RA 2JWKA 3ZEUA 3V81A 2J4RA 4BRFA 2JLEA 1NKBA 3DLEA 2KLAA 5JLHA 4M3ZA 5C2DA 3KHYA 1X3MA 5JVGL 3EEQA 3D2EB 3IDHA 5J2QA 4CZIA 4OO1J 2P9KA 1TKZA 4M42A 1DTTA 4LF8K 4CZJA 3SUQA 4MDBA 1KVCA 2D4WA 3TAPA 3SYZA 4FM0A 5FLXO 3O1WA 3NE6A 3V9XA 1W9HA 4L8RB 2NZTA 4CEBA 4FWOA 5FROA 3AY9A 3MN6A 4I9LA 1BQNA 1TL1A 5SZTA 3TARA 3CCEN 4DUYK 3QICA 5E26A 4NLCA 4O55A 4IFVA 4IOCL 1NK7A 4CJ3A 4A61A 1YI2N 4CEOA 4FLWA 3VEOA 1JCFA 3BEXA 1VRUA 5GAEP 4M3UA 4RW7A 1N36K 4H0PA 4YOXA 5I3UA 1KC8O 2YHAA 5AFUH 1JLFA 1NJYA 4FWNA 2HHUA 4FWPA 1GLLO 3UKRA 5AQRA 3L2WA 3CIPA 3FZKA 3OYBA 3ENHA 3ZX2A 4A57A 4ID1A 4PL8A 3WUHA 1YT3A 3RMDA 1GLCG 3HSTB 4H0YB 3VENA 4B1UB 1VSIA 3FZLA 1C1CA 2GX9A 1NJZA 4FJ9A 5BN8A 2KFZA 4WQ4A 3CM5A 1HYZA 5AZJB 4W5NA 3HVTA 3MN5A 3U8XA 3M8PA 4JKAA 3KVGA 4H0OA 4W5QA 5HRPA 2HBKA 1UA1A 2GBZA 4WFAL 3KWIA 2HHSA 5T7BA 3MDQA 2KFNA 3O5BA 2YJFA 3V1OA 1RDCA 3I0RA 2ZF5O 4JLHA 5KQ8A 5AQMA 4CZMA 1OH8A 1KQSM 2D0AA 2V7YA 4H8KA 2V52B 2G8KA 1SL2A 3AVGA 3AVFA 1JXEA 2O8CA 1RDAA 3O9SA 5CHIA 4F2RA 3QEWA 1IO2A 4BGAA 2AA4A 4FJXA 1ILYA 3D2FB 3K0SA 1RTDA 2VG7A 1OVYA 4IKFA 1KD1O 2F8SA 4FLZA 1U04A 1YUWA 1FJGK 4CEQA 1IBLK 3DXKB 3UKUB 4N47A 4FCYA 3SUOA 1NK6A 2KHOA 1NOZA 3SJHA 4DLEA 4Y1DA 1XNQK 4GVMA 2QWRA 4GKJK 2W42A 2UU9K 3CJCA 5LY3A 2ASPA 2DFEA 3TTDA 3OS0A 2Y1IA 4I2QA 3TABA 1K9MO 3I8BA 1TUYA 4BRGA 4Z94A 2CGKA 5AQJA 4O44A 5AQIA 1QVGM 1T3VA 4E1NA 3WEEA 2Q0UA 1R59O 1JLQA 4ZTFA 4KH4A 3L4IA 1HR0K 2E8AA 1L5UA 4XH4A 2OPRA 4HUEA 3ZT3A 4CBXA 3THYA 2RHKA 5FRNA 4N5SA 3M8QA 4C8NA 3E01A 3VQ5A 2HNYA 4IBNA 3CQYA 1NGFA 1G15A 4B9QA 4DF4A 1HYSA 3VTHA 3KD1E 1W2BM 4DF8A 2W41A 1IBMK 3H08A 4CF0A 1T44A 3D7EO 4EHTA 2CGLA 2P9IA 5M1QA 3HOTA 1WAFA 4IG0A 3KWGA 2IVPA 4DR7K 3W0LA 3SK3A 2B4JA 3A5MC 1EWRA 4K0KK 3H46O 2HVIA 1B9DA 1C1AA 2GWJA 4DHYA 2QTDA 2E5LK 5MLCQ 3CCUN 3AVLA 5LMUK 3CMEN 1WLJA 1J5EK 3GG4A 3K58A 1BO5O 4YFUA 4A5BA 5GADP 3V6DA 4QOZB 1KCFA 3P31A 2NRVA 3HXMA 1N5YA 1CZAN 1Q18A 3CG7A 3OYCA 4AHRA 3SZ2A 1Q86O 4KI4A 2HMPA 4BRMA 2VWBA 3LP0A 3TWHA 1KRPA 2PAVA 1O1WA 1BGXT 2ZWHA 3J81O 4F4KA 1WSIA 3VQ8A 1I39A 1SAZA 2YV0X 3ZSQA 1XC9A 2E20A 3MXMA 4QS7A 3EZ5A 4FLXA 3I0SA 1WAJA 5LL6Z 2NRRA 4CK2A 1U45A 4BR4A 2DPNA 1FKOA 1HPZA 4PL7A 3TAGA 4IEEA 3TSQA 3KTQA 4B9TA 4JNEA 3C0BA 3ULEB 1S1TA 1IKVA 1T6DA 4CZKA 4DTNA 3K5OA 4M45A 1K6YA 3TSUA 4K8XA 4KRFA 2YHXA 5EXWA 4FZXC 4ISGA 1YTUA 3SUPA 2VCPA 4JD2A 3KLIA 4OPHA 3ID6A 4A5AA 3N4QA 1TK8A 1T7PA 1M1KO 2NRHA 4BRPA 4WFBL 1MDUB 4FJGA 5BPNA 4MO4A 4DTOA 4E7IA 4JEPA 1HKBA 1YVNA 1FXXA 4JKEA 4JI5K 4I6MA 2HHWA 4W5OA 2FBVA 3L2RA 5AQUA 4ILHA 3OJSA 2OCEA 3IS9A 5BREA 3LWLA 3TAQA 1J53A 1J9AA 4CJTA 3ZEUB 2WOMA 4RW4A 3L3VA 1KAZA 1ZBFA 3NH1A 3E9PA 5AFUA 4CZGA 4CFAA 1GLEG 3S3MA 3V9ZA 2IC3A 4FL9A 4FPBA 3NDKA 1ZBUA 5KPRA 4BRLA 3O9QA 3L2UA 5JLFA 2P9PA 4GV3A 1Q82O 3CQXA 4CFBA 2QKKA 2YX6A 2YCHA 4QS8A 2YNIA 4B1XB 3OYLA 2HNDA 1L3VA 2P5OA 4WQ4C 5GINA 3J7ZO 1L3TA 2ZGZA 3I56N 1UAXA 1Z6RA 4DV4K 1LV5A 4LF7K 1WSHA 4CCHA 3ASMA 4IJAA 3KLGA 1GOCA 3LDLA 2WBNA 2QXFA 1NJWA 4DV7K 4DS5A 1Q9YA 4DSIA 2BH1A 2B5JA 1VQON 5EU7A 1VQPN 1WOQA 1KTQA 4BACA 5HOOA 4FK2A 3LPUA 4EFHA 3SJJA 4DSEA 1QHTA 2P9UA 3LP1A 3PV8A 4BR0A 3IMXA 1NJXA 2E1YA 3GE1A 3O4QA 4B9VA 5KRSA 4V19S 1YF5L 4JI1K 4LF4K 1N33K 2FF6A 4DFMA 2QK9A 4KHYA 4KHPK 1RT7A 3THXB 3VEVA 3L3UA 1BISA 4JK8A 4B9UA 4EAHD 4YOUA 3VQBA 1KSPA 2A40A 1Y64A 1BA1A 4GMJB 4KHNA 1L3UA 4CHZA 3P5JA 3C6AA 3CJBA 2O4IA 1YIJN 4M63C 3VQ7A 4CHNA 1YXQA 2Y1JA 1WB9A 4FW1A 1VK0A 1KFDA 3LPTA 5HROA 1Q9XA 2O8EA 2XO7A 5C25A 3ENOA 3C6UA 3GBTA 1S1XA 3BF1A 4UY8O 1TAQA 4CEFA 4ILGB 3HL8A 4LFCK 3IG1A 1VQ7N 3S9HA 4OLAA 1OH5A 4K42A 2D0PA 5J1EA 4DCHA 1K8KB 3ATUA 2FXUA 2O8CB 4A2BA 3KZBA 3TPQA 3K5NA 1TAUA 2IGIA 1T6CA 3G25A 5J2NA 5AQTA 3HT3A 3HRGA 2NRTA 2A5XA 3T3FA 3AVNA 4XEIA 2VQFK 1XMQK 3NMUA 4JAXA 1VSDA 4CF1A 3BF3A 4N56A 2RE2A 1YHQN 4JKGB 1JCGA 1A5VA 1TVRA 4JKBA 3H3NO 4CJUA 3IRXA 5JMVA 4JS5A 2E2NA 1S5JA 4CHOA 1ATNA 3RMBA 4GV6A 1B92A 4JI2K 3W3DA 2Z1JA 2P9SB 4CEDA 1HNIA 5BR9A 2NRWA 3DOKA 4KHWA 3VQ4A 1BDGA 1EX4A 4JV5K 1X9JA 1X9SA 4J2DA 4PKHA 4ISFA 4CHPA 4DB3A 1D9FA 2Q3SA 4JK9A 2YNGA 4N76A 4HUFA 3CJ1A 3G10A 2X6NA 1YJWN 4O8KA 5AQPA 2ATQA 3DMJA 5AQQA 1SKRA 2XRIA 4ZHRA 4FJJA 2KTQA 4F8RA 3HTVA 4CVNE 4DWIA 3SNNA 4AF1A 4JI8K 5I42A 1RFQA 1NJIO 1EWQA 5BRFA 3VA3A 1NWKA 3RR7A 5F1XA 3L0QA 3RMAA 2G8IA 3HK2A 2IVOA 3NF7A 1YJ9N 4M3RA 1JLEA 3R1XA 3F9KA 3Q7CA 4LF9K 4JI7K 3AVKA 4JN4A 2E88A 2PY5A 1HNVA 4C1NI 2GUPA 3OYEA 2ZJRL 3CCJN 3QEVA 2FSJA 2PZSA 1EO1A 4EP5A 1VSKA 4ILJA 3F73A 4F9OA 1DLOA 1NGAA 2YKMA 3O1BA 2WFBA 1JLCA 3THVA 4ISEA 4OKJA 4ICLA 4HCCA 3NH2A 4DTXA 3DLGA 2OPSA 4FVMA 2VYPA 2ZQBA 3KJVA 4BC3A 3VQ9A 1JCEA 1GLDG 3AO3A 3I55N 3CHWA 1WN7A 4C8LA 5LJWA 1WBBA 3WQUA 3NF8A 3A5LC 3U4LA 4KBOA 3QETA 2PFUA 3CPWM 1GOBA 2GUIA 4J8FA 4AM7A 1HYVA 4O0JA 1XQSC 1RGIA 1ASWA 2GEMA 1YTAA 3VGKA 2VG5A 1BWFO 1IV0A 1HRHA 1HLUA 1S1UA 3TR8A 3MXIA 2O8FA 3E1YA 4CD1A 3RTVA 4CK1A 2BTFA 3H1QA 1YJNN 3AGRA 1YITN 5C42A 1XHZA 3KIOA 3AA2A 2E2QA 4B1WB 2FSNA 4FJKA 1ZXOA 3G6EN 4FZYA 2OPPA 3VEZA 4CI6A 4FLUA 4FO0A 1RTIA 1P90A 4AH9A 2OZMA 4DFPA 4AM6A 4DV0K 4HCBA 3AO4A 3SLCA 4NCBA 4Z4GA 4Z4HA 4FM1A 1ZBIA 4AHCA 1YAGA 2IVNA 4L3QA 5KGXA 1TYQB 3RSEA 5BRDA 5HRSA 4IG3A 5CR4A 2ZJPL 4LH5A 5IWAK 4NYNA 3N4PA 3DAWA 3HM8A 4JHDB 3NVKA 4MO5A 2HSTA 1K8AO 1HQEA 4Z4CA 4OLBA 3SPZA 3AVMA 4DR6K 3DJCA 3ZETB 1VSHA 1DEJA 2ETJA 1HNWK 3OYJA 4FWLA 2O8BB 1A5WA 3R9PA 4M3TA 1W7AA 1GOAA 3LDOA 2G8UA 4U7BA 3AO1A 1VQ9N 2NUBA 4KB0A 1NMDA 4JS4A 4NLBA 4FPAA 2E1ZA 1C0GA 1S72N 4DTUA 3VEWA 3EKSA 3S3NA 4KTQA 2BE2A 4DV2K 4BR5A 1Z25A 3KKSA 5EX5A 2P5GA 1VAZA 3DWLA 1NKCA 4R79A 4B3MK 4FW2A 4JKFA 4DLGA 1NBWA 3QDKA 4BC2A 1ZBSA 3SAHA 2ITMA 3SCXA 5DM6L 3V9UA 1T8EA 1LW0A 3AGKA 2W40A 3AVJA 5FPDA 4LH4A 2EWSA 2QWMA 4CJEA 4CEZA 4BDZA 1KAXA 3NF9A 2QWOA 5CE3A 4EIAA 4MDAA 3ID8A 4RW8A 3PY8A 5AQOA 3O4WA 5AQKA 4K43A 1S22A 1SS6A 2VQEK 1C0MA 3OTOK 4OGEA 1BI4A 4BDYA 4CECA 4DQQA 1Q81O 3SMPA 1E4GT 4Z4IA 4DQIA 2WUSA 2O8EB 4NXNK 4B1VA 1DTQA 4PHTX 4MLHA 2YNFA 4B3OA 3VQQA 4GV9A 1OVQA 3RMCA 1R0AA 2Z1IA 1S3XA 2X6SA 2OTLN 2P9LA 3D6RA 1NK0A 3FFKB 3NFAA 4CZEA 4NB4A 1XMOK 4J2AA 4CEAA 2FBYA 1KVBA 1VSLA 2A1SA 2E6LA 4DTRA 4KH5A 1RBVA 3AVBA 1VSJA 2P9NA 5DMRA 2FBTA 3M1FA 2X74A 3TTFA 3IKMA 3SQ1A 4H0XB 4KHQA 5AQHA 4IJNA 4EP4A 5KTQA 4BE2A 2EX3A 1VSMA 5AQSA 1ASUA 3EYZA 1LW2A 3MN7A 1MWKA 1QQNA 3KK3A 3SAFA 4BGBA 3P4IA 2LSNA 2YHYA 3DLHA 2QA4N 4EHUA 3BGRA 3ZLJA 4H0VB 4B3RK 4PWDA 3OYHA 1JL1A 2GV9A 2F9TA 1NGDA 4JKCA 3HP9A 4DR1K 3O4NA 5HRNA 1C0FA 4OJRA 1QS4A 4LSNA 3OS1A 2OA8A 1RT6A 4H5WA 1X9WA 3CYMA 5AQXA 1GLBG 3P83D 2PBDA 3DXMA 3E66A 4CZHA 1RDDA 3FFIA 4FWMA 5C2FA 3A0IX 2D5RA 2F8TA 5J2MA 3VETA 3PLAA 3CM6A 2Q97A 3OYAA 2F9WA 4I2PA 3FE1A 1HMVA 4FVUA 3HBTA 4CGJA 2PYLA 1HNZK 3AAQA 4CJFA 4C8KA 1CZ9A 3K59A 4KO0A 2HMIA 4E7LA 2Q1NA 5AZIA 3L2QA 3AO5A 4FM2A 3KK2A 4XH5A 1EETA 4GY2B 2ASOA 1VHXA 3FZFA 4M3YA 4IDHA 1RDUA 1D5AA 5TKWA 2QKBA 3CXCM 4BWMA 4Q0BA 1N34K 5JS1A 2BGGA 3CC2N 1W0HA 2WONA 3NBPA 1SKSA 2GWKA 5BPLA 4BRNA 3C65A 3D0PA 3K57A 3IAYA 3DRPA 3MX2A 1NGGA 1W97L 3WNEA 4M3XA 3T1AA 3PSIA 4FWQA 4PA1A 1KAYA 1ASVA 3HJFA 5BN9A 4JI6K 3VGLA 5AQYA 1NGEA 4B9NA 2O8DA 2G8FA 3SQ2A 2P9KB 3EN9A 1NNEA 3C95A 3QO9A 4BDPA 2FLOA 3SMSA 3OYGA 1RT3A 3CQ8A 4WF9L 4CHYA 2UXDK 4BR2A 1TL3A 1VRTA 3AA3A 4ELUA 3U3YA 4KKOA 3SAGA 5CZ2A 3DYAA 5AQNA 3VF2A 4DG1A 4GNIA 3G71N 3SQ4A 3CCVN 4CE9A 5AZJA 4LF6K 1QVFM 3PO5A 4DSJA 4B9LA 4H4OA 2Q2RA 4O4GA 3MEGA 3QERA 3TANA 3C94A 3DRSA 4NCGA 2O8FB 3VEXA 4XH1A 1F21A 3DM2A 1BOTO 4FLTA 3TAFA 3LDQA 1CXQA 3FR0A 3NH0A 3VQ6A 3HSCA 1XHXA 1QZ6A 4W5RA 3P1GA 5DK5A 1IKWA 3QEPA 5IT9O 3JYTA 3U9ZA 2RKIA 4JKDA 4C8OA 2CH5A 3WXLA 2G8VA 1TKXA 2HNZA 1OH7A 3J7AP 1KLNA 1SKWA 3F2KA 4R5PA 1HKCA 3O9UA 3O9TA 1BG3A 3HYFA 3ATVA 1OKJA 4HWIA 4FJLA 3D2FA 2R7YA 4B9MA 3UKRB 5J2PA 3AO2A 3RSEB 5H1SQ 1SQKA 4UQGA 3LM9A 4JKHA 3DXKA 3PSFA 3UKUA 1JJ2M 4CZFA 1VQ8N 5BRHA 2KKZA 3PX0A 4WE1A 3DOLA 4A2AA 5GAGP 2Z1HA 3V9SA 2UUAK 2CGJA 3J80O 4LFBK 4GKKK 4DQPA 4IZ9A 1IKXA 3PX4A 4FWRA 1HQUA 4KV8A 4OKKA 1WUAA 4FOIA 4CFDA 1C6VA 2A41A 2DTUA 2O4GA 3NVMA 4AQYK 4WFNL 4LD0A 3ZSZA 4OKEA 4OX9K 3QEIA 3AA5X 2W6LA 4O5BA 4DFKA 3JAMO 1EKEA 1LAWA 1TK5A 4FLYA 3NGIA 1HUXA 1TV6A 3SI6A 2AJQA 3VQDA 1RCHA 2DFHA 3H45C 3VQPA 1RTJA 3DRRA 1HX1A 3I8DA 3QIPA 3BY5A 1HNXK 3TAMA 2OZSA 3A5NC 5KQDA 1ZBHA 1BCOA 4M3WA 2V51B 2WTUA 3NCIA 1QZ5A 3T1HK 3CJ9A 5JS2A 1C0UA 5C12A 2IIRA 2ZD1A 5ADXA 4E7HA 1ZBLA 4ELTA 1IG8A 1LAVA 3CJ7A 3WNHA 1EP4A 5EY4A 1QSSA 1IKYA 2ZJQL 3M5RA 3CC4N 4LC9B 3A5OC 4CJPA 3ULDA 2DY4A 1NG9A 3G0ZA 4C8MA 5D3GA 5C24A 4QCLA 3QMLA 3K9KA 1YVUA 3CFRA 4AILC 1WSFA 3RR8A 1BL3A 4FJIA 1JKHA 4NYFA 4YOYA 3QEXA 4DQSA 2FSKA 1TK0A 4FJ5A 1I94K 4HUGA 3SUNA 4JK7A 3WEEB 2HOEA 4DTMA 1NOYA 4X64K 4IOAL 3MN9A 4H4MA 4GW6A 5SWMA 3M6GA 4Z4FA 4RW6A 1E4FT 4E3SA 1NKEA 3THYB 1N8RO 1P8ZA 2E4LA 3EO3A 2HBJA 2Q0RA 1V4SA 2YHWA 4CGFA 4CESA 3JXUA 3ISNC 4PUOA 2VWJA 1SUQA 4CERA 1ITGA 3I33A 2F4VK 4BRCA 3VF4A 3T1YK 2BDPA 5ELZA 4BR9A 4DR5K 4OVLA 3ALYA 2P9IB 3VESA 3VN5A 4I9QA 3CC7N 3U3GA 4K8ZA 1TGOA 5KPTA 2I7PA 1CZBA 5AQZA 3SV4A 5C0YA 2QWQA 3OYDA 4X66K 1JLBA 3PX6A 1FK9A 3B6OA 3ULEA 2NNWA 4E0DA 1RT5A 3NGZA 4KB1A 1UA0A 3VOVA 3K5LA 2HHXA 5AJ3K 3OVNA 3NF6A 4CJSA 3AAPA 4AHTA 1JLAA 4OPKA 2B6AA 2IAJA 3H1VX 2Q31A 4PQUA 2RPIA 4ELVA 4BRHA 1SL1A 4B1YB 1VQ5N 3QB0A 1XWLA 4KREA 4E1MA 5K14A 4LFAK 1E3MA 2F96A 1Y97A 1N6QA 3L8BA 1LOTB 3C6HA 4PKIA 5EOYA 1QSYA 3OJUA 4C1NK 2HHHK 5HP1A 1A5XA 3ZT0A 3AARA 5JICA 1KVAA 3O3FA 5HRRA 4MFBA 1U48A 3MMVA 1NMNA 1J6ZA 1IBKK 4HTUA 4DV5K 3TTCA 3DXMB 3V1QA 3VERA 1LWEA 3TU5A 4IO9L 4KI6A 1L3SA 5I9EB 3V4IA 4K25A 1BU6O 5M1KA 4CFCA 1NK5A 4ID5A 3H3OB 2A3ZA 2HF4A 3QLHA 3FZHA 3MECA 4KFBA 4XIUA 3OY9A 4FWSA 2QWLA 4EZ9A 2BUPA 5FDLA 3P39A 4CJ4A 2FBXA 3GL1A 3ZCMA 1RT1A 3THWA 3NAEA 3R3LA 4BC4A 1TKTA 2HW3A 4BRQA 5AZIB 1KLMA 3CETA 4BQLA 3SBTA 4JD2B 4BRKA 3DLRA 1RBTA 4G1QA 3WNFA 3KLEA 1QQCA 5KRTA 2OANA 4FOEA 5KI6A 3OYKA 1RILA 2VG6A 1U2VA 2QWNA 5GIPA 4LF5K 3PIOL 4DV1K 3QFUA 1QQMA 3MEDA 3QNNA 3S41A 4I6MB 1WSGA 1I3AA 3D45A 3LAKA 3KLFA 3H6EA 4CBUA 1TKDA 2QW9A 3P38A 4E1JA 2D0OA 3DLKA 3O08A 5M1OA 1SV5A 3ZT2A 4GVEA 1GLAG 4BY9C 3MCPA 2QM1A 2QI2A 3NGYA 3TAEA 4NCAA 2IDOA 4Z4EA 2HHQA 3MWTA 4B3SK 3AV9A 4CK3A 3HPOA 2PYJA 4BROA 2O8DB 4O0IA 1K73O 3MWPA 1GLJO 3WNGA 3THXA 2ITGA 2KQ2A 3LANA 1NU0A 4CZLA 3S3OA 3AA4A 2X78A 5AQFA 3WT0A 3MAQA 5KGWA 2RN2A 3C6TA 1M90O 3EY1A 2P9PB 3F5TA 3T19A 4CF8A 2HB5A 1JLGA 1NGHA 3MEEA 4AHSA 4DV6K 3J7YP 4DTPA 1S9GA 2YNHA 4RCHA 1X9MA 3LL3A 1QSLA 4B8CA 1RDWX 1IG9A 3QIOA 2HHTA 4B1ZA 1DKGD 1SL0A 2DFFA 4B08A 3LZJA 3ITHA 3NHGA 5KPZA 3M8SA 2QWPA 3PO4A 4KHSA 4Q5VA 4BWJA 1HKGA 3OS2A 5FRMA 1ESVA 2UXBK 4CJLA 3IFRA 3R6MA 2UUBK 2P9UB 4CHQA 4WCEL 5GAHP 5CY4A 4IXCA 1K8KA 3VA0A 1HPMA 3C7NA 3OYFA 2YKNA 3TSPA 1Q8IA 2YHBA 2VGNA 5HBMA 4H5RA 4BQZA 4BE1A 5GIOA 1IJJA 3U6FA 4DSFA 1VQ6N 4DKWA 3SBGA 3F9MA 4N41A 2ZGYA 1H1VA 1DT9A 4B3TK 2FC0A 4PKGA 3R8EA 4CIEA 1LWCA 3GOIA 3CPEA 5E41A 5DM7L 1T05A 4JKGA 3ZT4A 2IS3A 4FJ7A 1D9DA 3CJAA 4JYAK 5AQGA 1SZ2A 4BE0A 4DTSA 2ASMA 5AQVA 3K9JA 3LP2A 3T7ZA 3SV3A 4IO8A 4BRIA 1JXBA 3HOSA 2P9SA 1S1WA 5AQWA 4M7YA 4FK4A 5F0XA 2UUCK 5FPNA 4M41A 4YNQA 3OYMA 4IEIA 4FSVA 3VF6A 3CCRN 3L2VA 3OBYA 3BP8A 4FWKA 5A2QO 4B9SA 5ADXH 3O8MA 4DU3A 3O80A 3E9OA 3ZX3A 2RF2A 4E89A 1GLFO 1RT4A 4CJ5A 3DI6A 4DS4A 3EE8A 1KXPA 1XUPO 1NK8A 3CERA 3O9RA 3HO1A 3B8AX 1RBUA 4WYBA 3LM2A 3VEYA 1NGCA 4LY7A 4BR7A 4QAGA 3K5MA 4RWTA 3QNOA 1N32K 4E7KA 2F7TA 3K2PA 4F3TA 1X1PA 3A2FA 1WSEA 1XC3A 2A6AA 3BUZB 3KKRA 5C10A 5M1NA 1WSJA 3OW2M 4FXDA 3L4QA 5M1FA 2AP1A 4JRQA 3FLCO 2IOCA 3HPGA 4DQRA 3RRHA 4HHTA 4IFEA 3AVHA 3LAMA 3A8YA 1MWMA 4PY5A 4DR4K 4WQ5C 4E7JA 1NM1A 3OYIA 2GTDA 4CBWA 4X65K 3DLBA 4BRAA 2XY8A 2KZMA 3ZSVA 2E2OA 3CCQN 4OPAA 4DU4A 3IUCA 3D2EA 4K41A 5CZ1A 3ZX0A 3U9DA 3EE9A 4FZZA 3OBWA 3VQAA 4CIFA 3ZSYA 2G8HA 1VQKN 4YDUA 4KHUA 4OGCA 3ZYYX 3ENBA 4LSLA 1NGIA 2UYTA 3HP6A 3EKUA 5CYQA 1NGBA 1REVA 5CYMA 1NGJA 5E84A 2XY6A 3WQTA 4Y0WA 4YORA 1UWBA 4KTWA 2OTJN 2D0BA 4CJKA 4I7FA 1VSEA 1BIUA 4DU1A 2YJEA 3ZSOA 3Q7BA 4KAZA 3CFPA 1RTHA 4CJWA 2HHVA 1QTMA 2D0CA 3AVIA 4BREA 2NRZA 4C23A 1D4XA 4JI3K 4NXMK 1V4TA 3LDPA 4RW9A 3QFPA 1JL2A 4MQ3A 3G4SN 5JVHL 2OPQA 2P51A 4KH6A 1NLVA 1VQNN 3ZT1A 1MA9B 3O6WA 4YOTA 1O13A 3FZMA 1KFSA 5AQLA 4FYDA 3HVRA 4FLVA 3WXKA 5FPEA 1CLQA 3CI5A 5BPMA 4CJQA 2BANA 2OYQA 4AHUA 4FJMA 1T03A 1U49A 3UIQA 1TYQA 1J5OA 3FGUA 4KTZA 5C15A 3CCSN 2W6KA 5AR0A 1QE1A 3HZ6A 4JHDA 4CIGA 2HBMA 1DGKN 3OYNA 3CCMN 1FKPA 3ZETA 1NK4A 4A62A 2V7ZA 2H3GX 3VQCA 2O8BA 4U67L 3THWB 1RBRA 1QHAA 1IH7A 3QINA 4RTFD 4KPYA 3LALA 1C1BA 4B8AB 3L6QA 4CF2A 3RVCA 1OH6A 3PUFA 2XY5A 3WXMB 3O3HA 1LCUA 1BQMA 5M1PA 2EHGA 1U2VB 2I5JA 3ZSRA 3GDQA 1G99A 1BA0A 1MU2A 1RT2A 3HI0A 3AVCA 2YI1A 1NK9A 4J2EA 1B9FA 4H0TB 2A1RA 4DSKA 1BIZA 3PIPL 3BDPA 3RWUA 3UE5A 1HJRA 2XHBA 1X3NA 3VGMA 4DV3K 3DLLL 1S1VA 2NRXA 4W5TA 4H5VA 4TSXA 3MCAB 3ZSXA 1J54A
chains in the Genus database with same CATH topology
5AJ3K 1XNQK 4GKJK 5A2QO 2UU9K 4YHHK 4DUZK 4JI3K 4NXMK 4DV7K 1HNXK 4DV2K 2UXDK 5LL6Z 4B3MK 4DV6K 3J7YP 4JI2K 3T1HK 4B3RK 4LFAK 1N36K 4LF6K 4V19S 4DR1K 4JI1K 4LF4K 1N33K 2HHHK 4JV5K 4KHPK 4YY3K 1XNRK 1N32K 1HR0K 5LMNK 1IBKK 4DV5K 2ZM6K 4DR2K 4CW7B 5IT9O 4JI4K 2UXBK 2UUBK 2VQEK 3OTOK 4CVNE 1IBMK 5BR8K 1I94K 3J7AP 4DV0K 4JI5K 4JI8K 4JI0K 1HNZK 4X64K 4NXNK 4DR4K 4DR7K 4DR3K 4X65K 4K0KK 5IWAK 4LFCK 2E5LK 4B3TK 1XMOK 5LMUK 1J5EK 2UUAK 3J80O 4JI7K 4LF9K 4DR6K 4LFBK 4GKKK 4LF8K 4LF5K 4DV1K 1N34K 2F4VK 3T1YK 1HNWK 4DR5K 4JYAK 4X62K 5FLXO 4AQYK 4OX9K 1FJGK 4DV3K 1IBLK 2UXCK 4X66K 2UUCK 3J81O 2VQFK 1XMQK 3JAMO 4JI6K 4DUYK 4B3SK 4DV4K 4LF7K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AJ3 K;  1XNQ K;  4GKJ K;  5A2Q O;  2UU9 K;  4YHH K;  4DUZ K;  4JI3 K;  4NXM K;  4DV7 K;  1HNX K;  4DV2 K;  2UXD K;  5LL6 Z;  4B3M K;  4DV6 K;  3J7Y P;  4JI2 K;  3T1H K;  4B3R K;  4LFA K;  1N36 K;  4LF6 K;  4V19 S;  4DR1 K;  4JI1 K;  4LF4 K;  1N33 K;  2HHH K;  4JV5 K;  4KHP K;  4YY3 K;  1XNR K;  1N32 K;  1HR0 K;  5LMN K;  1IBK K;  4DV5 K;  2ZM6 K;  4DR2 K;  4CW7 B;  5IT9 O;  4JI4 K;  2UXB K;  2UUB K;  2VQE K;  3OTO K;  4CVN E;  1IBM K;  5BR8 K;  1I94 K;  3J7A P;  4DV0 K;  4JI5 K;  4JI8 K;  4JI0 K;  1HNZ K;  4X64 K;  4NXN K;  4DR4 K;  4DR7 K;  4DR3 K;  4X65 K;  4K0K K;  5IWA K;  4LFC K;  2E5L K;  4B3T K;  1XMO K;  5LMU K;  1J5E K;  2UUA K;  3J80 O;  4JI7 K;  4LF9 K;  4DR6 K;  4LFB K;  4GKK K;  4LF8 K;  4LF5 K;  4DV1 K;  1N34 K;  2F4V K;  3T1Y K;  1HNW K;  4DR5 K;  4JYA K;  4X62 K;  5FLX O;  4AQY K;  4OX9 K;  1FJG K;  4DV3 K;  1IBL K;  2UXC K;  4X66 K;  2UUC K;  3J81 O;  2VQF K;  1XMQ K;  3JAM O;  4JI6 K;  4DUY K;  4B3S K;  4DV4 K;  4LF7 K; 
#chains in the Genus database with same CATH topology
 3EZW A;  4CGI A;  5TKY A;  2KZZ A;  1BHL A;  5LJV A;  1ZC6 A;  1VQM N;  1UOC A;  2CH6 A;  3SQ0 A;  2VWK A;  4YHH K;  1VSF A;  2Z1G A;  2HBL A;  4H03 B;  4H5N A;  4HVJ A;  2GEL A;  1QQO A;  3O3G A;  4DTJ A;  4FJ8 A;  4M7X A;  1U4B A;  4FJN A;  3KLH A;  4IWV A;  4CEE A;  4CGH A;  2Q36 A;  4IOX A;  3E9L A;  5HL7 L;  1CXU A;  3RRG A;  4O5F A;  1EXQ A;  3QES A;  4E19 A;  4DSL A;  1TUU A;  4HTL A;  4JRP A;  2ZM6 K;  3VTI A;  3EL2 A;  4IDK A;  4JI4 K;  4YOV A;  3B6P A;  2P1J A;  4QS9 A;  1XI1 A;  4BC5 A;  3UB5 A;  5BR8 K;  5EVZ A;  3KK1 A;  3CF5 L;  5HLF A;  3T69 A;  4JI0 K;  2HVH A;  3C7N B;  3QBW A;  4MLE A;  4F2S A;  3SPY A;  3JS6 A;  4BVP A;  3BZC A;  3MX5 A;  4CJV A;  3HM9 A;  2QXL A;  3CFO A;  2HF3 A;  2ZE2 A;  4DR3 K;  1ATR A;  3LP3 A;  2FF3 B;  3CMA N;  3MXJ A;  4BRD A;  2JWL A;  3VPZ A;  4IFY A;  3JSM A;  1S6P A;  3LDN A;  4BVO A;  3LWM A;  4NO7 A;  1Z26 A;  3J8A A;  1BI4 B;  3VQE A;  1U47 A;  4CJR A;  4BG8 A;  2QEX N;  2NLX A;  1HJO A;  1BUP A;  1S6Q A;  3OA9 A;  4Z0U A;  4RG8 A;  4CGG A;  4X62 K;  2XY7 A;  1U6Z A;  3ZSW A;  4CF9 A;  1WBD A;  3LZI A;  3AVA A;  1ZYQ A;  4EZ6 A;  4CJ7 A;  3BZK A;  5F2R A;  2UXC K;  2P9L B;  1LWF A;  4J2B A;  4H5T A;  1RBS A;  1EQY A;  3WXI A;  3CCL N;  4DFJ A;  3OHR A;  4DMN A;  1D8Y A;  4FJH A;  4BG9 A;  4OPJ A;  3KD5 E;  4CGD A;  2P9N B;  4DUZ K;  1S9E A;  1FW6 A;  4A59 A;  2A42 A;  1RNH A;  3HPH A;  4YDU C;  3V9W A;  1VQL N;  1C0T A;  2I7N A;  3VMF B;  1WNS A;  4O8U A;  4YOW A;  1VQ4 N;  5B8H A;  4YY3 K;  1BCM A;  1XNR K;  3CD6 N;  5LMN K;  3TI0 A;  3M3Z A;  5FPM A;  4Y1C A;  1RDB A;  4FK0 A;  2G8W A;  2E6M A;  1Q7Y O;  4CD3 A;  4DR2 K;  2VGM A;  4CW7 B;  2E2P A;  3WXJ A;  4WQ5 A;  4F3O A;  3QBX A;  3M8R A;  1Z05 A;  2D1K A;  3KK7 A;  4G9Z A;  1ATS A;  2KW4 A;  3MK6 A;  4AHV A;  2WC9 A;  4DQ8 A;  3LDS A;  2JGU A;  4ZTJ A;  3V1R A;  2JWK A;  3ZEU A;  3V81 A;  2J4R A;  4BRF A;  2JLE A;  1NKB A;  3DLE A;  2KLA A;  5JLH A;  4M3Z A;  5C2D A;  3KHY A;  1X3M A;  5JVG L;  3EEQ A;  3D2E B;  3IDH A;  5J2Q A;  4CZI A;  4OO1 J;  2P9K A;  1TKZ A;  4M42 A;  1DTT A;  4LF8 K;  4CZJ A;  3SUQ A;  4MDB A;  1KVC A;  2D4W A;  3TAP A;  3SYZ A;  4FM0 A;  5FLX O;  3O1W A;  3NE6 A;  3V9X A;  1W9H A;  4L8R B;  2NZT A;  4CEB A;  4FWO A;  5FRO A;  3AY9 A;  3MN6 A;  4I9L A;  1BQN A;  1TL1 A;  5SZT A;  3TAR A;  3CCE N;  4DUY K;  3QIC A;  5E26 A;  4NLC A;  4O55 A;  4IFV A;  4IOC L;  1NK7 A;  4CJ3 A;  4A61 A;  1YI2 N;  4CEO A;  4FLW A;  3VEO A;  1JCF A;  3BEX A;  1VRU A;  5GAE P;  4M3U A;  4RW7 A;  1N36 K;  4H0P A;  4YOX A;  5I3U A;  1KC8 O;  2YHA A;  5AFU H;  1JLF A;  1NJY A;  4FWN A;  2HHU A;  4FWP A;  1GLL O;  3UKR A;  5AQR A;  3L2W A;  3CIP A;  3FZK A;  3OYB A;  3ENH A;  3ZX2 A;  4A57 A;  4ID1 A;  4PL8 A;  3WUH A;  1YT3 A;  3RMD A;  1GLC G;  3HST B;  4H0Y B;  3VEN A;  4B1U B;  1VSI A;  3FZL A;  1C1C A;  2GX9 A;  1NJZ A;  4FJ9 A;  5BN8 A;  2KFZ A;  4WQ4 A;  3CM5 A;  1HYZ A;  5AZJ B;  4W5N A;  3HVT A;  3MN5 A;  3U8X A;  3M8P A;  4JKA A;  3KVG A;  4H0O A;  4W5Q A;  5HRP A;  2HBK A;  1UA1 A;  2GBZ A;  4WFA L;  3KWI A;  2HHS A;  5T7B A;  3MDQ A;  2KFN A;  3O5B A;  2YJF A;  3V1O A;  1RDC A;  3I0R A;  2ZF5 O;  4JLH A;  5KQ8 A;  5AQM A;  4CZM A;  1OH8 A;  1KQS M;  2D0A A;  2V7Y A;  4H8K A;  2V52 B;  2G8K A;  1SL2 A;  3AVG A;  3AVF A;  1JXE A;  2O8C A;  1RDA A;  3O9S A;  5CHI A;  4F2R A;  3QEW A;  1IO2 A;  4BGA A;  2AA4 A;  4FJX A;  1ILY A;  3D2F B;  3K0S A;  1RTD A;  2VG7 A;  1OVY A;  4IKF A;  1KD1 O;  2F8S A;  4FLZ A;  1U04 A;  1YUW A;  1FJG K;  4CEQ A;  1IBL K;  3DXK B;  3UKU B;  4N47 A;  4FCY A;  3SUO A;  1NK6 A;  2KHO A;  1NOZ A;  3SJH A;  4DLE A;  4Y1D A;  1XNQ K;  4GVM A;  2QWR A;  4GKJ K;  2W42 A;  2UU9 K;  3CJC A;  5LY3 A;  2ASP A;  2DFE A;  3TTD A;  3OS0 A;  2Y1I A;  4I2Q A;  3TAB A;  1K9M O;  3I8B A;  1TUY A;  4BRG A;  4Z94 A;  2CGK A;  5AQJ A;  4O44 A;  5AQI A;  1QVG M;  1T3V A;  4E1N A;  3WEE A;  2Q0U A;  1R59 O;  1JLQ A;  4ZTF A;  4KH4 A;  3L4I A;  1HR0 K;  2E8A A;  1L5U A;  4XH4 A;  2OPR A;  4HUE A;  3ZT3 A;  4CBX A;  3THY A;  2RHK A;  5FRN A;  4N5S A;  3M8Q A;  4C8N A;  3E01 A;  3VQ5 A;  2HNY A;  4IBN A;  3CQY A;  1NGF A;  1G15 A;  4B9Q A;  4DF4 A;  1HYS A;  3VTH A;  3KD1 E;  1W2B M;  4DF8 A;  2W41 A;  1IBM K;  3H08 A;  4CF0 A;  1T44 A;  3D7E O;  4EHT A;  2CGL A;  2P9I A;  5M1Q A;  3HOT A;  1WAF A;  4IG0 A;  3KWG A;  2IVP A;  4DR7 K;  3W0L A;  3SK3 A;  2B4J A;  3A5M C;  1EWR A;  4K0K K;  3H46 O;  2HVI A;  1B9D A;  1C1A A;  2GWJ A;  4DHY A;  2QTD A;  2E5L K;  5MLC Q;  3CCU N;  3AVL A;  5LMU K;  3CME N;  1WLJ A;  1J5E K;  3GG4 A;  3K58 A;  1BO5 O;  4YFU A;  4A5B A;  5GAD P;  3V6D A;  4QOZ B;  1KCF A;  3P31 A;  2NRV A;  3HXM A;  1N5Y A;  1CZA N;  1Q18 A;  3CG7 A;  3OYC A;  4AHR A;  3SZ2 A;  1Q86 O;  4KI4 A;  2HMP A;  4BRM A;  2VWB A;  3LP0 A;  3TWH A;  1KRP A;  2PAV A;  1O1W A;  1BGX T;  2ZWH A;  3J81 O;  4F4K A;  1WSI A;  3VQ8 A;  1I39 A;  1SAZ A;  2YV0 X;  3ZSQ A;  1XC9 A;  2E20 A;  3MXM A;  4QS7 A;  3EZ5 A;  4FLX A;  3I0S A;  1WAJ A;  5LL6 Z;  2NRR A;  4CK2 A;  1U45 A;  4BR4 A;  2DPN A;  1FKO A;  1HPZ A;  4PL7 A;  3TAG A;  4IEE A;  3TSQ A;  3KTQ A;  4B9T A;  4JNE A;  3C0B A;  3ULE B;  1S1T A;  1IKV A;  1T6D A;  4CZK A;  4DTN A;  3K5O A;  4M45 A;  1K6Y A;  3TSU A;  4K8X A;  4KRF A;  2YHX A;  5EXW A;  4FZX C;  4ISG A;  1YTU A;  3SUP A;  2VCP A;  4JD2 A;  3KLI A;  4OPH A;  3ID6 A;  4A5A A;  3N4Q A;  1TK8 A;  1T7P A;  1M1K O;  2NRH A;  4BRP A;  4WFB L;  1MDU B;  4FJG A;  5BPN A;  4MO4 A;  4DTO A;  4E7I A;  4JEP A;  1HKB A;  1YVN A;  1FXX A;  4JKE A;  4JI5 K;  4I6M A;  2HHW A;  4W5O A;  2FBV A;  3L2R A;  5AQU A;  4ILH A;  3OJS A;  2OCE A;  3IS9 A;  5BRE A;  3LWL A;  3TAQ A;  1J53 A;  1J9A A;  4CJT A;  3ZEU B;  2WOM A;  4RW4 A;  3L3V A;  1KAZ A;  1ZBF A;  3NH1 A;  3E9P A;  5AFU A;  4CZG A;  4CFA A;  1GLE G;  3S3M A;  3V9Z A;  2IC3 A;  4FL9 A;  4FPB A;  3NDK A;  1ZBU A;  5KPR A;  4BRL A;  3O9Q A;  3L2U A;  5JLF A;  2P9P A;  4GV3 A;  1Q82 O;  3CQX A;  4CFB A;  2QKK A;  2YX6 A;  2YCH A;  4QS8 A;  2YNI A;  4B1X B;  3OYL A;  2HND A;  1L3V A;  2P5O A;  4WQ4 C;  5GIN A;  3J7Z O;  1L3T A;  2ZGZ A;  3I56 N;  1UAX A;  1Z6R A;  4DV4 K;  1LV5 A;  4LF7 K;  1WSH A;  4CCH A;  3ASM A;  4IJA A;  3KLG A;  1GOC A;  3LDL A;  2WBN A;  2QXF A;  1NJW A;  4DV7 K;  4DS5 A;  1Q9Y A;  4DSI A;  2BH1 A;  2B5J A;  1VQO N;  5EU7 A;  1VQP N;  1WOQ A;  1KTQ A;  4BAC A;  5HOO A;  4FK2 A;  3LPU A;  4EFH A;  3SJJ A;  4DSE A;  1QHT A;  2P9U A;  3LP1 A;  3PV8 A;  4BR0 A;  3IMX A;  1NJX A;  2E1Y A;  3GE1 A;  3O4Q A;  4B9V A;  5KRS A;  4V19 S;  1YF5 L;  4JI1 K;  4LF4 K;  1N33 K;  2FF6 A;  4DFM A;  2QK9 A;  4KHY A;  4KHP K;  1RT7 A;  3THX B;  3VEV A;  3L3U A;  1BIS A;  4JK8 A;  4B9U A;  4EAH D;  4YOU A;  3VQB A;  1KSP A;  2A40 A;  1Y64 A;  1BA1 A;  4GMJ B;  4KHN A;  1L3U A;  4CHZ A;  3P5J A;  3C6A A;  3CJB A;  2O4I A;  1YIJ N;  4M63 C;  3VQ7 A;  4CHN A;  1YXQ A;  2Y1J A;  1WB9 A;  4FW1 A;  1VK0 A;  1KFD A;  3LPT A;  5HRO A;  1Q9X A;  2O8E A;  2XO7 A;  5C25 A;  3ENO A;  3C6U A;  3GBT A;  1S1X A;  3BF1 A;  4UY8 O;  1TAQ A;  4CEF A;  4ILG B;  3HL8 A;  4LFC K;  3IG1 A;  1VQ7 N;  3S9H A;  4OLA A;  1OH5 A;  4K42 A;  2D0P A;  5J1E A;  4DCH A;  1K8K B;  3ATU A;  2FXU A;  2O8C B;  4A2B A;  3KZB A;  3TPQ A;  3K5N A;  1TAU A;  2IGI A;  1T6C A;  3G25 A;  5J2N A;  5AQT A;  3HT3 A;  3HRG A;  2NRT A;  2A5X A;  3T3F A;  3AVN A;  4XEI A;  2VQF K;  1XMQ K;  3NMU A;  4JAX A;  1VSD A;  4CF1 A;  3BF3 A;  4N56 A;  2RE2 A;  1YHQ N;  4JKG B;  1JCG A;  1A5V A;  1TVR A;  4JKB A;  3H3N O;  4CJU A;  3IRX A;  5JMV A;  4JS5 A;  2E2N A;  1S5J A;  4CHO A;  1ATN A;  3RMB A;  4GV6 A;  1B92 A;  4JI2 K;  3W3D A;  2Z1J A;  2P9S B;  4CED A;  1HNI A;  5BR9 A;  2NRW A;  3DOK A;  4KHW A;  3VQ4 A;  1BDG A;  1EX4 A;  4JV5 K;  1X9J A;  1X9S A;  4J2D A;  4PKH A;  4ISF A;  4CHP A;  4DB3 A;  1D9F A;  2Q3S A;  4JK9 A;  2YNG A;  4N76 A;  4HUF A;  3CJ1 A;  3G10 A;  2X6N A;  1YJW N;  4O8K A;  5AQP A;  2ATQ A;  3DMJ A;  5AQQ A;  1SKR A;  2XRI A;  4ZHR A;  4FJJ A;  2KTQ A;  4F8R A;  3HTV A;  4CVN E;  4DWI A;  3SNN A;  4AF1 A;  4JI8 K;  5I42 A;  1RFQ A;  1NJI O;  1EWQ A;  5BRF A;  3VA3 A;  1NWK A;  3RR7 A;  5F1X A;  3L0Q A;  3RMA A;  2G8I A;  3HK2 A;  2IVO A;  3NF7 A;  1YJ9 N;  4M3R A;  1JLE A;  3R1X A;  3F9K A;  3Q7C A;  4LF9 K;  4JI7 K;  3AVK A;  4JN4 A;  2E88 A;  2PY5 A;  1HNV A;  4C1N I;  2GUP A;  3OYE A;  2ZJR L;  3CCJ N;  3QEV A;  2FSJ A;  2PZS A;  1EO1 A;  4EP5 A;  1VSK A;  4ILJ A;  3F73 A;  4F9O A;  1DLO A;  1NGA A;  2YKM A;  3O1B A;  2WFB A;  1JLC A;  3THV A;  4ISE A;  4OKJ A;  4ICL A;  4HCC A;  3NH2 A;  4DTX A;  3DLG A;  2OPS A;  4FVM A;  2VYP A;  2ZQB A;  3KJV A;  4BC3 A;  3VQ9 A;  1JCE A;  1GLD G;  3AO3 A;  3I55 N;  3CHW A;  1WN7 A;  4C8L A;  5LJW A;  1WBB A;  3WQU A;  3NF8 A;  3A5L C;  3U4L A;  4KBO A;  3QET A;  2PFU A;  3CPW M;  1GOB A;  2GUI A;  4J8F A;  4AM7 A;  1HYV A;  4O0J A;  1XQS C;  1RGI A;  1ASW A;  2GEM A;  1YTA A;  3VGK A;  2VG5 A;  1BWF O;  1IV0 A;  1HRH A;  1HLU A;  1S1U A;  3TR8 A;  3MXI A;  2O8F A;  3E1Y A;  4CD1 A;  3RTV A;  4CK1 A;  2BTF A;  3H1Q A;  1YJN N;  3AGR A;  1YIT N;  5C42 A;  1XHZ A;  3KIO A;  3AA2 A;  2E2Q A;  4B1W B;  2FSN A;  4FJK A;  1ZXO A;  3G6E N;  4FZY A;  2OPP A;  3VEZ A;  4CI6 A;  4FLU A;  4FO0 A;  1RTI A;  1P90 A;  4AH9 A;  2OZM A;  4DFP A;  4AM6 A;  4DV0 K;  4HCB A;  3AO4 A;  3SLC A;  4NCB A;  4Z4G A;  4Z4H A;  4FM1 A;  1ZBI A;  4AHC A;  1YAG A;  2IVN A;  4L3Q A;  5KGX A;  1TYQ B;  3RSE A;  5BRD A;  5HRS A;  4IG3 A;  5CR4 A;  2ZJP L;  4LH5 A;  5IWA K;  4NYN A;  3N4P A;  3DAW A;  3HM8 A;  4JHD B;  3NVK A;  4MO5 A;  2HST A;  1K8A O;  1HQE A;  4Z4C A;  4OLB A;  3SPZ A;  3AVM A;  4DR6 K;  3DJC A;  3ZET B;  1VSH A;  1DEJ A;  2ETJ A;  1HNW K;  3OYJ A;  4FWL A;  2O8B B;  1A5W A;  3R9P A;  4M3T A;  1W7A A;  1GOA A;  3LDO A;  2G8U A;  4U7B A;  3AO1 A;  1VQ9 N;  2NUB A;  4KB0 A;  1NMD A;  4JS4 A;  4NLB A;  4FPA A;  2E1Z A;  1C0G A;  1S72 N;  4DTU A;  3VEW A;  3EKS A;  3S3N A;  4KTQ A;  2BE2 A;  4DV2 K;  4BR5 A;  1Z25 A;  3KKS A;  5EX5 A;  2P5G A;  1VAZ A;  3DWL A;  1NKC A;  4R79 A;  4B3M K;  4FW2 A;  4JKF A;  4DLG A;  1NBW A;  3QDK A;  4BC2 A;  1ZBS A;  3SAH A;  2ITM A;  3SCX A;  5DM6 L;  3V9U A;  1T8E A;  1LW0 A;  3AGK A;  2W40 A;  3AVJ A;  5FPD A;  4LH4 A;  2EWS A;  2QWM A;  4CJE A;  4CEZ A;  4BDZ A;  1KAX A;  3NF9 A;  2QWO A;  5CE3 A;  4EIA A;  4MDA A;  3ID8 A;  4RW8 A;  3PY8 A;  5AQO A;  3O4W A;  5AQK A;  4K43 A;  1S22 A;  1SS6 A;  2VQE K;  1C0M A;  3OTO K;  4OGE A;  1BI4 A;  4BDY A;  4CEC A;  4DQQ A;  1Q81 O;  3SMP A;  1E4G T;  4Z4I A;  4DQI A;  2WUS A;  2O8E B;  4NXN K;  4B1V A;  1DTQ A;  4PHT X;  4MLH A;  2YNF A;  4B3O A;  3VQQ A;  4GV9 A;  1OVQ A;  3RMC A;  1R0A A;  2Z1I A;  1S3X A;  2X6S A;  2OTL N;  2P9L A;  3D6R A;  1NK0 A;  3FFK B;  3NFA A;  4CZE A;  4NB4 A;  1XMO K;  4J2A A;  4CEA A;  2FBY A;  1KVB A;  1VSL A;  2A1S A;  2E6L A;  4DTR A;  4KH5 A;  1RBV A;  3AVB A;  1VSJ A;  2P9N A;  5DMR A;  2FBT A;  3M1F A;  2X74 A;  3TTF A;  3IKM A;  3SQ1 A;  4H0X B;  4KHQ A;  5AQH A;  4IJN A;  4EP4 A;  5KTQ A;  4BE2 A;  2EX3 A;  1VSM A;  5AQS A;  1ASU A;  3EYZ A;  1LW2 A;  3MN7 A;  1MWK A;  1QQN A;  3KK3 A;  3SAF A;  4BGB A;  3P4I A;  2LSN A;  2YHY A;  3DLH A;  2QA4 N;  4EHU A;  3BGR A;  3ZLJ A;  4H0V B;  4B3R K;  4PWD A;  3OYH A;  1JL1 A;  2GV9 A;  2F9T A;  1NGD A;  4JKC A;  3HP9 A;  4DR1 K;  3O4N A;  5HRN A;  1C0F A;  4OJR A;  1QS4 A;  4LSN A;  3OS1 A;  2OA8 A;  1RT6 A;  4H5W A;  1X9W A;  3CYM A;  5AQX A;  1GLB G;  3P83 D;  2PBD A;  3DXM A;  3E66 A;  4CZH A;  1RDD A;  3FFI A;  4FWM A;  5C2F A;  3A0I X;  2D5R A;  2F8T A;  5J2M A;  3VET A;  3PLA A;  3CM6 A;  2Q97 A;  3OYA A;  2F9W A;  4I2P A;  3FE1 A;  1HMV A;  4FVU A;  3HBT A;  4CGJ A;  2PYL A;  1HNZ K;  3AAQ A;  4CJF A;  4C8K A;  1CZ9 A;  3K59 A;  4KO0 A;  2HMI A;  4E7L A;  2Q1N A;  5AZI A;  3L2Q A;  3AO5 A;  4FM2 A;  3KK2 A;  4XH5 A;  1EET A;  4GY2 B;  2ASO A;  1VHX A;  3FZF A;  4M3Y A;  4IDH A;  1RDU A;  1D5A A;  5TKW A;  2QKB A;  3CXC M;  4BWM A;  4Q0B A;  1N34 K;  5JS1 A;  2BGG A;  3CC2 N;  1W0H A;  2WON A;  3NBP A;  1SKS A;  2GWK A;  5BPL A;  4BRN A;  3C65 A;  3D0P A;  3K57 A;  3IAY A;  3DRP A;  3MX2 A;  1NGG A;  1W97 L;  3WNE A;  4M3X A;  3T1A A;  3PSI A;  4FWQ A;  4PA1 A;  1KAY A;  1ASV A;  3HJF A;  5BN9 A;  4JI6 K;  3VGL A;  5AQY A;  1NGE A;  4B9N A;  2O8D A;  2G8F A;  3SQ2 A;  2P9K B;  3EN9 A;  1NNE A;  3C95 A;  3QO9 A;  4BDP A;  2FLO A;  3SMS A;  3OYG A;  1RT3 A;  3CQ8 A;  4WF9 L;  4CHY A;  2UXD K;  4BR2 A;  1TL3 A;  1VRT A;  3AA3 A;  4ELU A;  3U3Y A;  4KKO A;  3SAG A;  5CZ2 A;  3DYA A;  5AQN A;  3VF2 A;  4DG1 A;  4GNI A;  3G71 N;  3SQ4 A;  3CCV N;  4CE9 A;  5AZJ A;  4LF6 K;  1QVF M;  3PO5 A;  4DSJ A;  4B9L A;  4H4O A;  2Q2R A;  4O4G A;  3MEG A;  3QER A;  3TAN A;  3C94 A;  3DRS A;  4NCG A;  2O8F B;  3VEX A;  4XH1 A;  1F21 A;  3DM2 A;  1BOT O;  4FLT A;  3TAF A;  3LDQ A;  1CXQ A;  3FR0 A;  3NH0 A;  3VQ6 A;  3HSC A;  1XHX A;  1QZ6 A;  4W5R A;  3P1G A;  5DK5 A;  1IKW A;  3QEP A;  5IT9 O;  3JYT A;  3U9Z A;  2RKI A;  4JKD A;  4C8O A;  2CH5 A;  3WXL A;  2G8V A;  1TKX A;  2HNZ A;  1OH7 A;  3J7A P;  1KLN A;  1SKW A;  3F2K A;  4R5P A;  1HKC A;  3O9U A;  3O9T A;  1BG3 A;  3HYF A;  3ATV A;  1OKJ A;  4HWI A;  4FJL A;  3D2F A;  2R7Y A;  4B9M A;  3UKR B;  5J2P A;  3AO2 A;  3RSE B;  5H1S Q;  1SQK A;  4UQG A;  3LM9 A;  4JKH A;  3DXK A;  3PSF A;  3UKU A;  1JJ2 M;  4CZF A;  1VQ8 N;  5BRH A;  2KKZ A;  3PX0 A;  4WE1 A;  3DOL A;  4A2A A;  5GAG P;  2Z1H A;  3V9S A;  2UUA K;  2CGJ A;  3J80 O;  4LFB K;  4GKK K;  4DQP A;  4IZ9 A;  1IKX A;  3PX4 A;  4FWR A;  1HQU A;  4KV8 A;  4OKK A;  1WUA A;  4FOI A;  4CFD A;  1C6V A;  2A41 A;  2DTU A;  2O4G A;  3NVM A;  4AQY K;  4WFN L;  4LD0 A;  3ZSZ A;  4OKE A;  4OX9 K;  3QEI A;  3AA5 X;  2W6L A;  4O5B A;  4DFK A;  3JAM O;  1EKE A;  1LAW A;  1TK5 A;  4FLY A;  3NGI A;  1HUX A;  1TV6 A;  3SI6 A;  2AJQ A;  3VQD A;  1RCH A;  2DFH A;  3H45 C;  3VQP A;  1RTJ A;  3DRR A;  1HX1 A;  3I8D A;  3QIP A;  3BY5 A;  1HNX K;  3TAM A;  2OZS A;  3A5N C;  5KQD A;  1ZBH A;  1BCO A;  4M3W A;  2V51 B;  2WTU A;  3NCI A;  1QZ5 A;  3T1H K;  3CJ9 A;  5JS2 A;  1C0U A;  5C12 A;  2IIR A;  2ZD1 A;  5ADX A;  4E7H A;  1ZBL A;  4ELT A;  1IG8 A;  1LAV A;  3CJ7 A;  3WNH A;  1EP4 A;  5EY4 A;  1QSS A;  1IKY A;  2ZJQ L;  3M5R A;  3CC4 N;  4LC9 B;  3A5O C;  4CJP A;  3ULD A;  2DY4 A;  1NG9 A;  3G0Z A;  4C8M A;  5D3G A;  5C24 A;  4QCL A;  3QML A;  3K9K A;  1YVU A;  3CFR A;  4AIL C;  1WSF A;  3RR8 A;  1BL3 A;  4FJI A;  1JKH A;  4NYF A;  4YOY A;  3QEX A;  4DQS A;  2FSK A;  1TK0 A;  4FJ5 A;  1I94 K;  4HUG A;  3SUN A;  4JK7 A;  3WEE B;  2HOE A;  4DTM A;  1NOY A;  4X64 K;  4IOA L;  3MN9 A;  4H4M A;  4GW6 A;  5SWM A;  3M6G A;  4Z4F A;  4RW6 A;  1E4F T;  4E3S A;  1NKE A;  3THY B;  1N8R O;  1P8Z A;  2E4L A;  3EO3 A;  2HBJ A;  2Q0R A;  1V4S A;  2YHW A;  4CGF A;  4CES A;  3JXU A;  3ISN C;  4PUO A;  2VWJ A;  1SUQ A;  4CER A;  1ITG A;  3I33 A;  2F4V K;  4BRC A;  3VF4 A;  3T1Y K;  2BDP A;  5ELZ A;  4BR9 A;  4DR5 K;  4OVL A;  3ALY A;  2P9I B;  3VES A;  3VN5 A;  4I9Q A;  3CC7 N;  3U3G A;  4K8Z A;  1TGO A;  5KPT A;  2I7P A;  1CZB A;  5AQZ A;  3SV4 A;  5C0Y A;  2QWQ A;  3OYD A;  4X66 K;  1JLB A;  3PX6 A;  1FK9 A;  3B6O A;  3ULE A;  2NNW A;  4E0D A;  1RT5 A;  3NGZ A;  4KB1 A;  1UA0 A;  3VOV A;  3K5L A;  2HHX A;  5AJ3 K;  3OVN A;  3NF6 A;  4CJS A;  3AAP A;  4AHT A;  1JLA A;  4OPK A;  2B6A A;  2IAJ A;  3H1V X;  2Q31 A;  4PQU A;  2RPI A;  4ELV A;  4BRH A;  1SL1 A;  4B1Y B;  1VQ5 N;  3QB0 A;  1XWL A;  4KRE A;  4E1M A;  5K14 A;  4LFA K;  1E3M A;  2F96 A;  1Y97 A;  1N6Q A;  3L8B A;  1LOT B;  3C6H A;  4PKI A;  5EOY A;  1QSY A;  3OJU A;  4C1N K;  2HHH K;  5HP1 A;  1A5X A;  3ZT0 A;  3AAR A;  5JIC A;  1KVA A;  3O3F A;  5HRR A;  4MFB A;  1U48 A;  3MMV A;  1NMN A;  1J6Z A;  1IBK K;  4HTU A;  4DV5 K;  3TTC A;  3DXM B;  3V1Q A;  3VER A;  1LWE A;  3TU5 A;  4IO9 L;  4KI6 A;  1L3S A;  5I9E B;  3V4I A;  4K25 A;  1BU6 O;  5M1K A;  4CFC A;  1NK5 A;  4ID5 A;  3H3O B;  2A3Z A;  2HF4 A;  3QLH A;  3FZH A;  3MEC A;  4KFB A;  4XIU A;  3OY9 A;  4FWS A;  2QWL A;  4EZ9 A;  2BUP A;  5FDL A;  3P39 A;  4CJ4 A;  2FBX A;  3GL1 A;  3ZCM A;  1RT1 A;  3THW A;  3NAE A;  3R3L A;  4BC4 A;  1TKT A;  2HW3 A;  4BRQ A;  5AZI B;  1KLM A;  3CET A;  4BQL A;  3SBT A;  4JD2 B;  4BRK A;  3DLR A;  1RBT A;  4G1Q A;  3WNF A;  3KLE A;  1QQC A;  5KRT A;  2OAN A;  4FOE A;  5KI6 A;  3OYK A;  1RIL A;  2VG6 A;  1U2V A;  2QWN A;  5GIP A;  4LF5 K;  3PIO L;  4DV1 K;  3QFU A;  1QQM A;  3MED A;  3QNN A;  3S41 A;  4I6M B;  1WSG A;  1I3A A;  3D45 A;  3LAK A;  3KLF A;  3H6E A;  4CBU A;  1TKD A;  2QW9 A;  3P38 A;  4E1J A;  2D0O A;  3DLK A;  3O08 A;  5M1O A;  1SV5 A;  3ZT2 A;  4GVE A;  1GLA G;  4BY9 C;  3MCP A;  2QM1 A;  2QI2 A;  3NGY A;  3TAE A;  4NCA A;  2IDO A;  4Z4E A;  2HHQ A;  3MWT A;  4B3S K;  3AV9 A;  4CK3 A;  3HPO A;  2PYJ A;  4BRO A;  2O8D B;  4O0I A;  1K73 O;  3MWP A;  1GLJ O;  3WNG A;  3THX A;  2ITG A;  2KQ2 A;  3LAN A;  1NU0 A;  4CZL A;  3S3O A;  3AA4 A;  2X78 A;  5AQF A;  3WT0 A;  3MAQ A;  5KGW A;  2RN2 A;  3C6T A;  1M90 O;  3EY1 A;  2P9P B;  3F5T A;  3T19 A;  4CF8 A;  2HB5 A;  1JLG A;  1NGH A;  3MEE A;  4AHS A;  4DV6 K;  3J7Y P;  4DTP A;  1S9G A;  2YNH A;  4RCH A;  1X9M A;  3LL3 A;  1QSL A;  4B8C A;  1RDW X;  1IG9 A;  3QIO A;  2HHT A;  4B1Z A;  1DKG D;  1SL0 A;  2DFF A;  4B08 A;  3LZJ A;  3ITH A;  3NHG A;  5KPZ A;  3M8S A;  2QWP A;  3PO4 A;  4KHS A;  4Q5V A;  4BWJ A;  1HKG A;  3OS2 A;  5FRM A;  1ESV A;  2UXB K;  4CJL A;  3IFR A;  3R6M A;  2UUB K;  2P9U B;  4CHQ A;  4WCE L;  5GAH P;  5CY4 A;  4IXC A;  1K8K A;  3VA0 A;  1HPM A;  3C7N A;  3OYF A;  2YKN A;  3TSP A;  1Q8I A;  2YHB A;  2VGN A;  5HBM A;  4H5R A;  4BQZ A;  4BE1 A;  5GIO A;  1IJJ A;  3U6F A;  4DSF A;  1VQ6 N;  4DKW A;  3SBG A;  3F9M A;  4N41 A;  2ZGY A;  1H1V A;  1DT9 A;  4B3T K;  2FC0 A;  4PKG A;  3R8E A;  4CIE A;  1LWC A;  3GOI A;  3CPE A;  5E41 A;  5DM7 L;  1T05 A;  4JKG A;  3ZT4 A;  2IS3 A;  4FJ7 A;  1D9D A;  3CJA A;  4JYA K;  5AQG A;  1SZ2 A;  4BE0 A;  4DTS A;  2ASM A;  5AQV A;  3K9J A;  3LP2 A;  3T7Z A;  3SV3 A;  4IO8 A;  4BRI A;  1JXB A;  3HOS A;  2P9S A;  1S1W A;  5AQW A;  4M7Y A;  4FK4 A;  5F0X A;  2UUC K;  5FPN A;  4M41 A;  4YNQ A;  3OYM A;  4IEI A;  4FSV A;  3VF6 A;  3CCR N;  3L2V A;  3OBY A;  3BP8 A;  4FWK A;  5A2Q O;  4B9S A;  5ADX H;  3O8M A;  4DU3 A;  3O80 A;  3E9O A;  3ZX3 A;  2RF2 A;  4E89 A;  1GLF O;  1RT4 A;  4CJ5 A;  3DI6 A;  4DS4 A;  3EE8 A;  1KXP A;  1XUP O;  1NK8 A;  3CER A;  3O9R A;  3HO1 A;  3B8A X;  1RBU A;  4WYB A;  3LM2 A;  3VEY A;  1NGC A;  4LY7 A;  4BR7 A;  4QAG A;  3K5M A;  4RWT A;  3QNO A;  1N32 K;  4E7K A;  2F7T A;  3K2P A;  4F3T A;  1X1P A;  3A2F A;  1WSE A;  1XC3 A;  2A6A A;  3BUZ B;  3KKR A;  5C10 A;  5M1N A;  1WSJ A;  3OW2 M;  4FXD A;  3L4Q A;  5M1F A;  2AP1 A;  4JRQ A;  3FLC O;  2IOC A;  3HPG A;  4DQR A;  3RRH A;  4HHT A;  4IFE A;  3AVH A;  3LAM A;  3A8Y A;  1MWM A;  4PY5 A;  4DR4 K;  4WQ5 C;  4E7J A;  1NM1 A;  3OYI A;  2GTD A;  4CBW A;  4X65 K;  3DLB A;  4BRA A;  2XY8 A;  2KZM A;  3ZSV A;  2E2O A;  3CCQ N;  4OPA A;  4DU4 A;  3IUC A;  3D2E A;  4K41 A;  5CZ1 A;  3ZX0 A;  3U9D A;  3EE9 A;  4FZZ A;  3OBW A;  3VQA A;  4CIF A;  3ZSY A;  2G8H A;  1VQK N;  4YDU A;  4KHU A;  4OGC A;  3ZYY X;  3ENB A;  4LSL A;  1NGI A;  2UYT A;  3HP6 A;  3EKU A;  5CYQ A;  1NGB A;  1REV A;  5CYM A;  1NGJ A;  5E84 A;  2XY6 A;  3WQT A;  4Y0W A;  4YOR A;  1UWB A;  4KTW A;  2OTJ N;  2D0B A;  4CJK A;  4I7F A;  1VSE A;  1BIU A;  4DU1 A;  2YJE A;  3ZSO A;  3Q7B A;  4KAZ A;  3CFP A;  1RTH A;  4CJW A;  2HHV A;  1QTM A;  2D0C A;  3AVI A;  4BRE A;  2NRZ A;  4C23 A;  1D4X A;  4JI3 K;  4NXM K;  1V4T A;  3LDP A;  4RW9 A;  3QFP A;  1JL2 A;  4MQ3 A;  3G4S N;  5JVH L;  2OPQ A;  2P51 A;  4KH6 A;  1NLV A;  1VQN N;  3ZT1 A;  1MA9 B;  3O6W A;  4YOT A;  1O13 A;  3FZM A;  1KFS A;  5AQL A;  4FYD A;  3HVR A;  4FLV A;  3WXK A;  5FPE A;  1CLQ A;  3CI5 A;  5BPM A;  4CJQ A;  2BAN A;  2OYQ A;  4AHU A;  4FJM A;  1T03 A;  1U49 A;  3UIQ A;  1TYQ A;  1J5O A;  3FGU A;  4KTZ A;  5C15 A;  3CCS N;  2W6K A;  5AR0 A;  1QE1 A;  3HZ6 A;  4JHD A;  4CIG A;  2HBM A;  1DGK N;  3OYN A;  3CCM N;  1FKP A;  3ZET A;  1NK4 A;  4A62 A;  2V7Z A;  2H3G X;  3VQC A;  2O8B A;  4U67 L;  3THW B;  1RBR A;  1QHA A;  1IH7 A;  3QIN A;  4RTF D;  4KPY A;  3LAL A;  1C1B A;  4B8A B;  3L6Q A;  4CF2 A;  3RVC A;  1OH6 A;  3PUF A;  2XY5 A;  3WXM B;  3O3H A;  1LCU A;  1BQM A;  5M1P A;  2EHG A;  1U2V B;  2I5J A;  3ZSR A;  3GDQ A;  1G99 A;  1BA0 A;  1MU2 A;  1RT2 A;  3HI0 A;  3AVC A;  2YI1 A;  1NK9 A;  4J2E A;  1B9F A;  4H0T B;  2A1R A;  4DSK A;  1BIZ A;  3PIP L;  3BDP A;  3RWU A;  3UE5 A;  1HJR A;  2XHB A;  1X3N A;  3VGM A;  4DV3 K;  3DLL L;  1S1V A;  2NRX A;  4W5T A;  4H5V A;  4TSX A;  3MCA B;  3ZSX A;  1J54 A; 
#chains in the Genus database with same CATH homology
 5AJ3 K;  1XNQ K;  4GKJ K;  5A2Q O;  2UU9 K;  4YHH K;  4DUZ K;  4JI3 K;  4NXM K;  4DV7 K;  1HNX K;  4DV2 K;  2UXD K;  5LL6 Z;  4B3M K;  4DV6 K;  3J7Y P;  4JI2 K;  3T1H K;  4B3R K;  4LFA K;  1N36 K;  4LF6 K;  4V19 S;  4DR1 K;  4JI1 K;  4LF4 K;  1N33 K;  2HHH K;  4JV5 K;  4KHP K;  4YY3 K;  1XNR K;  1N32 K;  1HR0 K;  5LMN K;  1IBK K;  4DV5 K;  2ZM6 K;  4DR2 K;  4CW7 B;  5IT9 O;  4JI4 K;  2UXB K;  2UUB K;  2VQE K;  3OTO K;  4CVN E;  1IBM K;  5BR8 K;  1I94 K;  3J7A P;  4DV0 K;  4JI5 K;  4JI8 K;  4JI0 K;  1HNZ K;  4X64 K;  4NXN K;  4DR4 K;  4DR7 K;  4DR3 K;  4X65 K;  4K0K K;  5IWA K;  4LFC K;  2E5L K;  4B3T K;  1XMO K;  5LMU K;  1J5E K;  2UUA K;  3J80 O;  4JI7 K;  4LF9 K;  4DR6 K;  4LFB K;  4GKK K;  4LF8 K;  4LF5 K;  4DV1 K;  1N34 K;  2F4V K;  3T1Y K;  1HNW K;  4DR5 K;  4JYA K;  4X62 K;  5FLX O;  4AQY K;  4OX9 K;  1FJG K;  4DV3 K;  1IBL K;  2UXC K;  4X66 K;  2UUC K;  3J81 O;  2VQF K;  1XMQ K;  3JAM O;  4JI6 K;  4DUY K;  4B3S K;  4DV4 K;  4LF7 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...