4KHPK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4khpK00
2UUBK 2VQEK 4JI3K 4B3SK 4LF5K 4DR3K 4LF9K 1HR0K 2UXBK 2UXDK 4X66K 1XNQK 1N33K 1HNXK 3J81O 2F4VK 1IBMK 4DV6K 5IT9O 4YHHK 4B3RK 4X62K 4JV5K 4JI5K 5LL6Z 4GKKK 4LF8K 2UXCK 2UU9K 4B3TK 4JI4K 1IBKK 4CVNE 4JI8K 2E5LK 4JI0K 3OTOK 4DR1K 3T1YK 4LF7K 5IWAK 1HNWK 4GKJK 4DR7K 1I94K 1XNRK 4B3MK 4K0KK 1IBLK 4DV0K 2UUCK 5LMNK 4JYAK 3J7AP 4DR6K 4LFCK 1FJGK 4V19S 4JI2K 4DV3K 4X65K 2VQFK 1XMQK 4DV7K 4OX9K 4DUZK 3JAMO 4LFBK 5FLXO 1N34K 1J5EK 4NXNK 1N32K 1XMOK 2UUAK 2HHHK 4LFAK 4DUYK 5A2QO 4YY3K 4DR2K 4CW7B 4KHPK 4LF4K 3T1HK 4DR4K 4NXMK 3J7YP 5BR8K 5LMUK 1N36K 2ZM6K 1HNZK 4X64K 4JI1K 4DV1K 4JI6K 4DV2K 4DR5K 4JI7K 4DV5K 3J80O 4DV4K 5AJ3K 4AQYK 4LF6K
chains in the Genus database with same CATH superfamily
3UIQA 3AAQA 4FZYA 4U67L 1SS6A 4C1NI 2OZMA 3ZETA 3QEVA 4L8RB 3MK6A 3DLBA 3R8EA 5HROA 4OJRA 2GUIA 3AY9A 3AVIA 3EO3A 4AHTA 3FZKA 4CEBA 3QIOA 1HPZA 3IDHA 2OPQA 3AVNA 3MXIA 2HBKA 5AQSA 2R7YA 1TK8A 4CEQA 1X1PA 3D2FB 3WXJA 3I0RA 1JL1A 2DFHA 4FJ5A 4JV5K 3RMDA 3NVMA 3O9SA 4CJUA 3V1OA 4NLBA 3I0SA 3V81A 2OTLN 3DLEA 3G4SN 5IWAK 3HPGA 4Y1CA 4DR7K 3LP1A 2HOEA 4CBUA 4NCAA 4JKGA 2Q3SA 3PSIA 3UKRA 3WNEA 4KKOA 3AA5X 4NB4A 4CBXA 1C0MA 3BF3A 5HP1A 4DV7K 3CCEN 3WNHA 2XRIA 2P9PA 4YFUA 1RDAA 2G8FA 3HRGA 4JN4A 3ZSRA 5MLCQ 3M8SA 3PIPL 5JS2A 4DF4A 4Z94A 2ZGZA 4FXDA 3SAGA 3CCLN 3SV3A 3MCAB 4Z4FA 5F1XA 5FRNA 4LF4K 1K9MO 4BR7A 3CCUN 3VETA 5KRSA 4CJ5A 2YHXA 2ZD1A 1OVYA 5KPRA 1N6QA 3HP9A 3KLHA 3UB5A 4BC2A 3ZT0A 4BRNA 4R79A 5AQRA 4FJNA 4B9MA 4F2RA 3HOSA 2QWOA 5BRFA 2B5JA 5F0XA 4OPHA 4KH6A 2VWKA 4ZTFA 1H1VA 3EKSA 3WT0A 4FO0A 4AILC 2O8FA 2W6LA 4DLGA 4MLEA 3OY9A 4ILGB 3CJ1A 1QZ6A 3OW2M 4DTXA 5AQTA 3OYNA 5CYMA 1DEJA 2VYPA 4EZ9A 4MO5A 1N33K 1QSYA 1HJOA 3A2FA 1HKGA 4CZJA 1C0GA 4OPKA 3MEGA 5LJWA 4AHRA 4B9TA 1NK5A 4QAGA 3PSFA 2QKKA 1YTAA 2J4RA 3MN7A 1IKYA 1O13A 4I6MA 1VRUA 4G1QA 3O6WA 1C0UA 3NF8A 4ISGA 1NU0A 3IRXA 1L3UA 1XNRK 1JCEA 4H5TA 3B6PA 5C12A 5J2PA 2A41A 2ZQBA 3OJUA 3PX0A 3L8BA 4O5FA 2YJEA 5HRSA 1YJ9N 4OO1J 1NKEA 1NMDA 3ENOA 1OH7A 2O8BA 4A2BA 1VSEA 3IS9A 3T19A 1OH6A 4XH5A 3CD6N 2ITGA 4FW2A 1WN7A 4CIFA 1YI2N 3QDKA 1TAQA 1XMOK 3I8DA 3H1QA 3THWB 1QS4A 2EHGA 3V1QA 1QQCA 1X9JA 3QB0A 4H8KA 1OH5A 4BDYA 3J8AA 2Z1IA 1HYSA 2RPIA 3HBTA 2G8KA 4DG1A 4JLHA 4JRPA 4AHUA 1Q18A 4DSIA 2OANA 4DQPA 1U45A 2P9LA 4WFAL 2P9KB 3AVJA 3TSQA 5LMUK 3VPZA 4JS5A 4QS7A 1EO1A 5M1PA 3CG7A 5J1EA 3DYAA 4CERA 4CZMA 3ZSQA 3HP6A 3RMAA 1RBSA 3NMUA 4PKIA 4GV6A 4A57A 5E26A 4DMNA 3M5RA 2YNGA 4LSLA 2FSKA 3TANA 4IZ9A 1KVBA 2NRTA 1QSLA 3P39A 4Y0WA 5JVHL 4DTNA 4LF9K 3LAMA 3LDOA 3HM8A 5GIOA 3VQ8A 1NK9A 4YOUA 3SPYA 5JLFA 3F9MA 1VQ8N 2I7PA 4FLTA 1TK0A 1RBTA 1VQ9N 4RW8A 4CHOA 5KQ8A 3SQ4A 5AQPA 4H5NA 3K2PA 1IO2A 4CECA 2OA8A 2QWMA 1A5WA 1DGKN 1DTTA 4DS5A 4F4KA 1RTJA 5FDLA 2OYQA 2W6KA 1HYZA 4EZ6A 1JKHA 3QNOA 3L6QA 1TAUA 3WQUA 4YOWA 1IBLK 4RW6A 1YHQN 1MU2A 1JXBA 4HCBA 4IFVA 4O55A 3I55N 1G15A 4GVMA 1KFDA 4WQ4A 2W41A 4LFCK 2CH6A 1CXUA 1HNIA 4H0YB 4CD3A 5HBMA 4CGJA 4DS4A 1CZBA 3QINA 4DUZK 1KQSM 1SZ2A 3HPHA 4A59A 1NM1A 3MXJA 3JS6A 1I3AA 1JLFA 1N32K 4FLXA 2V7YA 1HUXA 2G8VA 4IO8A 4K42A 4CIGA 3TR8A 2F96A 4KRFA 4FSVA 5EX5A 3NGZA 1RT3A 3QEXA 4FWNA 4DTRA 4M63C 1WLJA 3BDPA 4CF0A 1NGAA 3KLGA 5BRDA 1ATNA 5CR4A 1S1VA 4UY8O 3ULEA 1DLOA 3NDKA 2RF2A 4IEEA 4C8MA 4CEOA 4BRDA 2NRWA 3AO1A 3FZLA 1J5OA 2JGUA 3C95A 4LSNA 3VQ6A 4CGIA 1NJZA 1RBRA 5ADXA 3LWLA 3E9PA 4DB3A 3BZKA 3CCSN 3VF4A 2ZF5O 3K9JA 4DLEA 4EP5A 3VEWA 4FM2A 4H0PA 3SQ0A 4IOXA 2P5GA 4CGDA 4LF5K 3U9ZA 3E9LA 3TTCA 2ASMA 5EXWA 2GV9A 1RT4A 2CGLA 3CJAA 2FSNA 4IKFA 1GLJO 5ADXH 2Z1HA 4CJKA 3CFPA 1XNQK 1HJRA 2A40A 1ZBFA 3HVTA 1YF5L 1IBMK 4F3OA 3IG1A 3RRGA 3D0PA 3QBWA 4GKKK 1ATSA 1TV6A 3FZFA 3SI6A 4AHSA 3P83D 1YJNN 4JI0K 4PKGA 4CGGA 3VQ4A 3QFPA 3ZEUB 4CZHA 4BR0A 1NK7A 3N4QA 4A5BA 2YHWA 4LF7K 3NFAA 5KPTA 5AQMA 4JHDA 1X3NA 3KLEA 3DOKA 3ZSYA 3UE5A 3NHGA 5HRRA 4WQ4C 4IXCA 2QI2A 3CIPA 4BWJA 5AQWA 2F8TA 1BDGA 1VSDA 3UKUA 3S3NA 3C0BA 2E6LA 1NK0A 1EWQA 1L3SA 4JAXA 1XMQK 5K14A 4B3OA 4PKHA 1TGOA 3T69A 3HTVA 2YNIA 5DK5A 2G8HA 4BDZA 4ICLA 3H6EA 3N4PA 3TSUA 4LD0A 4CGHA 2YHBA 4I9QA 3HJFA 1NWKA 4DUYK 2OZSA 3DRPA 1BOTO 1R0AA 1QHAA 2HBLA 4DR2K 1UA0A 1HYVA 2ETJA 2F8SA 4B1WB 1O1WA 2VG7A 1R59O 5FPMA 1GLAG 5AQVA 2DY4A 2KZMA 3DXKB 1LWFA 4KTQA 3PIOL 4FL9A 5BR8K 3VQBA 4E7JA 3D2EB 4PWDA 5EY4A 4JI1K 2A3ZA 2P9NB 4FJGA 4RW4A 1U4BA 1E3MA 2Z1JA 4FLWA 1U2VA 1KTQA 3RMBA 3NGYA 1YAGA 1CLQA 5AJ3K 4KHNA 3SBTA 1F21A 4DFJA 3QEIA 3SUQA 1LCUA 1GLFO 5C0YA 4J2DA 3PO4A 2BE2A 4DSJA 3O9TA 2QWRA 3OS0A 1U6ZA 3SK3A 1Q9YA 3AVMA 5GAGP 4OKJA 1TYQB 5AQYA 2O4IA 1TUYA 2YV0X 2ASOA 4A2AA 5BN9A 3AO5A 4N5SA 2B4JA 4BG9A 2BDPA 4HHTA 3HT3A 1YTUA 1ZBLA 1KVAA 3S41A 2XY7A 3WXKA 1YUWA 3VOVA 4K8ZA 1ILYA 1QVGM 4GKJK 3H08A 4MDBA 3LDLA 4FWSA 2E1ZA 3C6AA 3J7ZO 5CYQA 3RR8A 3F73A 1C0FA 4KHWA 2GTDA 2IVNA 2QWPA 2HHXA 1ESVA 3TAQA 2P9IA 2NLXA 1S72N 1S9GA 4QS8A 4O8KA 2VQFK 4G9ZA 4J8FA 2VWBA 5CZ1A 1N5YA 4OX9K 1W2BM 4BY9C 3AA3A 1FK9A 2HVIA 3WEEA 3KHYA 3SJJA 1NJWA 4CF8A 2HVHA 3VF6A 1TUUA 3H3OB 2F9TA 3EYZA 3KKSA 4IEIA 3MWTA 1J6ZA 3NF9A 1IH7A 3KKRA 3QNNA 1HNVA 4DU1A 1CZAN 5AQLA 4CK2A 3U6FA 2QTDA 1VSFA 3QERA 4FZXC 3T1HK 3ZETB 1TKDA 4FM1A 3O1WA 3LAKA 4AH9A 1HMVA 3KK3A 3GOIA 4ISEA 1MDUB 1RT5A 3LDQA 3F2KA 4KO0A 2YI1A 1RT1A 3DJCA 5AQQA 3TWHA 4Z4CA 3ZT3A 5AQNA 4H0XB 2BH1A 2O8EA 3DI6A 3R1XA 1YVNA 3L3VA 4DTUA 2A5XA 1B9FA 5C24A 2ZJPL 3U4LA 1WSFA 3SUNA 3KK1A 3L2WA 2E2QA 2G8UA 3OVNA 2D0CA 3TTDA 3FZHA 4IFYA 2BANA 4AQYK 4J2BA 3C7NA 3ID8A 2CGKA 4JK8A 1WAFA 2VQEK 4ELVA 4MDAA 5HRPA 2HHUA 4BRMA 1FKOA 1UAXA 4JKGB 1G99A 2ZJQL 1HR0K 1HPMA 2UYTA 3UKRB 4CI6A 1VQ6N 5H1SQ 2BTFA 4ELTA 2Q2RA 4DCHA 4DFMA 1TL3A 2O8DA 2HB5A 4JKEA 1VSKA 4DHYA 2P9PB 1RT2A 1RBVA 1KFSA 5CY4A 5J2QA 4M3YA 4DTPA 3HSTB 2OTJN 2IOCA 4IDKA 1VQ4N 1GLDG 3MN6A 2X78A 2IC3A 2V7ZA 3L4QA 4KI4A 4B3MK 2B6AA 1WB9A 4CJWA 1D5AA 4FYDA 1Q82O 4DSEA 4YOXA 1WBDA 4JYAK 1NBWA 4CHQA 4KB1A 3U3GA 4HVJA 2D0AA 2D4WA 3K5OA 3C6HA 4Z4HA 4BRPA 3P1GA 3WXLA 1IV0A 4CEDA 3O8MA 4GY2B 4M7YA 4KAZA 2Z1GA 3WXMB 1QTMA 1RDUA 1RFQA 3ATVA 3CHWA 4GMJB 1K8AO 2P51A 4JKCA 2P9UA 4E1MA 2Q31A 4WE1A 2O8FB 2P9SA 5M1KA 3TAEA 4N76A 3P31A 3P4IA 4B9UA 2WFBA 3B6OA 3O4WA 3LL3A 3VQDA 5EOYA 4C8OA 4OKKA 3D7EO 4DTJA 3OYJA 3AVLA 3ZCMA 4W5NA 3QICA 1V4TA 4EAHD 4AM6A 4CD1A 3LDNA 3OYLA 3CI5A 4DTMA 3O80A 1OKJA 1NK8A 4DV5K 3FGUA 1K8KA 4I6MB 4IDHA 5AQOA 3O4NA 3AA4A 4YHHK 3C94A 3PX6A 4RCHA 4FJHA 4KHUA 4CHZA 2JWLA 5KI6A 3CC7N 3ZYYX 2PY5A 1ASWA 1FXXA 1Y97A 3MX2A 2UXBK 3A8YA 1LOTB 3H3NO 4JRQA 4FPBA 3SUPA 2O8BB 4M3XA 2HBMA 2KTQA 4ELUA 3VN5A 3RSEA 2HHVA 3I8BA 3ZLJA 1RDDA 1D4XA 4JI8K 3MAQA 2JLEA 4FJJA 4BG8A 4CBWA 1JLEA 3EEQA 3KD1E 1HNWK 2D0BA 3G10A 2E88A 1JCGA 3TAPA 2WC9A 4BRIA 1QQMA 1KSPA 3OYHA 1T03A 4RWTA 2P9LB 4C8LA 1S3XA 1X9WA 3VEXA 1ZBSA 3CJBA 2NRRA 3IKMA 1NGFA 3MEEA 5HOOA 1XC9A 1L5UA 1WUAA 3THXA 2O4GA 4FWOA 5ELZA 4XEIA 4JKDA 2UUAK 4CIEA 4JK7A 4DSKA 1BO5O 3DXMA 4MQ3A 2CH5A 4BE0A 4KHPK 1T3VA 4BRGA 1SKRA 1ZBHA 1IKXA 3NCIA 1NK6A 4E3SA 4H5VA 4CFDA 4XH1A 3PX4A 2XY6A 3JYTA 5M1NA 4FJ9A 1MWMA 1KD1O 3LDPA 4H5RA 4KHSA 2QWLA 2Y1JA 3A5OC 4I2PA 3OJSA 1VQLN 1VSLA 1P8ZA 3LP0A 4DV1K 3KD5E 5JICA 3LZJA 3SQ2A 1JLBA 2FBYA 4KREA 3IMXA 1GLEG 2FF6A 3M1FA 2QWNA 4DV4K 3AO4A 4JKHA 4DQRA 4X62K 3I33A 2UUBK 4BVOA 2RHKA 2FBXA 2YJFA 3P38A 3DRSA 4DR3K 4CJSA 3SZ2A 1V4SA 2NRHA 1WNSA 3MECA 4KTWA 1U47A 1YVUA 2QXFA 2NNWA 3MMVA 3WQTA 1QHTA 5CZ2A 3ISNC 4FWQA 4PQUA 5KGWA 4M3TA 1LV5A 1WSGA 2PYJA 1NGDA 2UXCK 1JCFA 5LL6Z 1VQMN 1RDBA 4H03B 4W5OA 3LDSA 1BWFO 4CVNE 3DRRA 4B9QA 1KCFA 5BPNA 3KVGA 1BA1A 3ZX2A 3ENBA 3OYCA 1KC8O 2IDOA 4DSLA 4BREA 4HUFA 4FK0A 1Q9XA 3CCRN 5C25A 1VSJA 4PL8A 3VQ9A 1HRHA 3OBWA 4DU4A 4LY7A 1SAZA 4CEZA 3CPWM 4GV9A 3ITHA 4FOIA 5AQFA 1EQYA 3D45A 3VQEA 1U49A 1NGIA 3ULEB 3JAMO 1JL2A 2YCHA 3A5LC 4EFHA 3EE8A 3DAWA 5FPDA 4CF9A 5JMVA 1DKGD 3U8XA 2HHHK 3TPQA 3W0LA 3V9SA 3MEDA 4WYBA 4NCGA 1VQ5N 1DT9A 3I56N 1D8YA 3G0ZA 4CJ7A 5AQGA 4NXMK 5AZIA 1S1TA 1N36K 1RT6A 2E4LA 4CJRA 5AR0A 3VA3A 3C6UA 2PZSA 3FZMA 4ZTJA 2QW9A 1HX1A 4HUEA 1LAVA 3VEOA 5TKWA 4YOVA 2HNZA 1J54A 4JEPA 1YJWN 4QS9A 2WUSA 3P5JA 4B3SK 2YHAA 3E9OA 2FBTA 1NKCA 3KTQA 1KAZA 1RT7A 4DWIA 4X66K 3SAHA 2A1SA 1SV5A 3UKUB 4H4OA 3Q7CA 4CJLA 4Y1DA 3HM9A 3CCJN 1UWBA 1MA9B 3BGRA 5E41A 5BPMA 3O9RA 4AM7A 3OYEA 3CC2N 1BIUA 1C1AA 4JI4K 3ZSZA 4CEAA 4C8KA 3G25A 3L3UA 4CZKA 3SNNA 3OTOK 2HF3A 3AAPA 2Q36A 1KAXA 2FSJA 5HRNA 1LAWA 4GW6A 1VQON 4CJ4A 1BGXT 4O44A 4OGEA 1NG9A 4Q0BA 2NZTA 4M45A 1VSHA 2E6MA 2ZGYA 1BIZA 3QIPA 1UA1A 4KTZA 4C1NK 3DLHA 1VQNN 1T6CA 3CPEA 4JI2K 1UOCA 1RCHA 2P5OA 4J2EA 3VQQA 1C1BA 3BZCA 4F9OA 1GOAA 1U2VB 1VAZA 3L2VA 5I9EB 2WBNA 4L3QA 3CCVN 2HF4A 1ATRA 2GWJA 3KJVA 3M6GA 2BGGA 2P1JA 1JLGA 4KH5A 5J2NA 4OPAA 3MN9A 1VHXA 4BR5A 3CQYA 3BY5A 4BE2A 3L2RA 3CJ9A 3K5NA 4IJAA 2Q1NA 3LM2A 5KRTA 2HMIA 2KFZA 4N47A 2GX9A 3PUFA 1YIJN 3OYFA 5DM6L 1B92A 4IBNA 4FVMA 1WSJA 2FBVA 3VGMA 1WSIA 5EVZA 4DR5K 3QEWA 1ASUA 4B1UB 1T8EA 1NLVA 2QEXN 1Q7YO 1HKCA 3ZX0A 3AGRA 5CHIA 3S3OA 3R9PA 5AQXA 3OHRA 1IG8A 1Y64A 1NKBA 4C8NA 4BC4A 1NGEA 3VEZA 1W9HA 1YT3A 4CJFA 2F4VK 2P9IB 4PHTX 3TSPA 4OVLA 4LF8K 2HBJA 3MX5A 1BI4A 3T7ZA 3WEEB 1KLMA 2GWKA 2PFUA 4H5WA 5KPZA 2IVOA 4RW7A 3S9HA 2KLAA 4JKBA 1NJYA 2WTUA 3SJHA 3TAFA 5BPLA 4CJ3A 3ASMA 1TVRA 3FFIA 1VQ7N 4ILHA 3V6DA 3AVCA 4I9LA 3HL8A 3BP8A 5CE3A 4B1XB 3C65A 1ITGA 3LANA 1KRPA 2JWKA 3EL2A 4BC5A 2H3GX 4CEEA 4XIUA 2A6AA 3V9ZA 2O8EB 4FW1A 3OYAA 4E1JA 4EHUA 3K5MA 5FRMA 1W7AA 5FLXO 5KQDA 4IFEA 3WNFA 4C23A 3DM2A 1WSEA 4PUOA 1BHLA 4HTLA 3VF2A 1BQMA 4W5RA 4M3RA 2IVPA 1TKZA 1L3VA 3LP2A 2Q97A 3C7NB 2GEMA 3B8AX 5FROA 1QQNA 4NO7A 4AHCA 3VTHA 3OS1A 3W3DA 2ASPA 4RG8A 2HHTA 4JKFA 1NMNA 2O8DB 3VTIA 2ITMA 2ZM6K 3JXUA 3AVBA 3JSMA 3E1YA 4ISFA 1LW0A 3QO9A 3HO1A 2G8WA 4B9SA 5E84A 4R5PA 3D2EA 2E2NA 4AF1A 4J2AA 2OPSA 1S22A 2VG5A 4JI7K 1MWKA 3J80O 1CXQA 3QEPA 1YITN 3VESA 4JKAA 2YNHA 3ZSXA 4BVPA 1REVA 1JLAA 2W42A 2UXDK 3FLCO 4FWMA 4OPJA 3DMJA 4NCBA 4XH4A 4W5TA 3H46O 5BN8A 4IOCL 4OLBA 2KFNA 2FC0A 2UU9K 3KZBA 5JVGL 2XO7A 4IOAL 4GNIA 2E5LK 2O8CA 4CEFA 5HLFA 3NF7A 3AGKA 2P9UB 4CF1A 3OA9A 2A1RA 4K0KK 4YORA 3CJ7A 2P9SB 2VCPA 1CZ9A 2UUCK 1C1CA 2W40A 1SL0A 2HNYA 3J7AP 3K9KA 4QCLA 4B8CA 4A62A 2QK9A 5J2MA 4BRQA 2YKNA 3E01A 3SV4A 4JD2A 3RWUA 4FJXA 1X3MA 1OH8A 2NRZA 1T44A 3NGIA 5AFUA 4HUGA 2FXUA 1JJ2M 1LWCA 3CQXA 3VMFB 2WONA 1E4FT 2NRXA 2QWQA 4O8UA 2Q0UA 4N56A 4FWRA 4AHVA 4Z0UA 1SKWA 4I7FA 4YDUA 1K8KB 3SMPA 3ZSOA 1WSHA 4FWLA 4CW7B 1D9DA 4M3WA 5AZJA 3K57A 3CCQN 2GUPA 5AFUH 1TKXA 4E7HA 4LH5A 4CJVA 3BUZB 4IG0A 3AO3A 4DFKA 5C10A 5AQUA 3NH2A 3VERA 3DLGA 4KFBA 1B9DA 4CJEA 3O5BA 1SL2A 4CE9A 5TKYA 3AVKA 4PA1A 2QKBA 4JI6K 2ATQA 2D1KA 3RSEB 1XC3A 4BRCA 1TL1A 2VGNA 3SPZA 1W97L 1Z26A 3FE1A 1BA0A 5GAHP 4A5AA 2D0OA 1HQUA 4JS4A 3THYA 4GV3A 4CFAA 3ZSWA 5C15A 1EETA 4YNQA 4CHNA 3VA0A 4ID1A 5AQZA 3ENHA 2DTUA 2I5JA 1BISA 1YXQA 1BUPA 3CM5A 1HNXK 3M8PA 4DV6K 3GDQA 4BRAA 4WFBL 1LW2A 4CJPA 1J9AA 3THXB 1Q81O 1IBKK 1Q86O 4KHQA 4RTFD 2WOMA 4A61A 5BREA 1K6YA 3DXMB 1QZ5A 4BDPA 5LY3A 1S1XA 1A5XA 3HXMA 3L0QA 1S6QA 2V51B 1FKPA 1QVFM 3CCMN 1J53A 5GADP 2FLOA 4CK3A 1L3TA 4M42A 3D2FA 4DSFA 1VQPN 3ULDA 5I3UA 4WCEL 4IJNA 5I42A 4O5BA 3WNGA 2NRVA 3L2QA 4YDUC 3TAMA 3CJCA 3WXIA 3VQPA 3H1VX 3K58A 5A2QO 2ZJRL 2X6NA 3TAGA 3K0SA 5C2DA 2E20A 3PLAA 4B9VA 1I39A 4FJ7A 1U48A 4E7IA 1NGCA 1HKBA 4ZHRA 2PAVA 1HQEA 5DMRA 3KK2A 2YHYA 3LPUA 4H0TB 2KKZA 1NK4A 3QESA 1BU6O 1RNHA 5AQJA 1NGGA 4I2QA 4DV2K 4YOTA 1C0TA 4FVUA 3L2UA 4K8XA 3Q7BA 3G6EN 4NLCA 3K59A 4UQGA 2XHBA 4E19A 2KHOA 1GLBG 3LWMA 3MXMA 3V1RA 1U04A 1NNEA 1QE1A 3K5LA 2GBZA 3CFRA 3O3GA 3L4IA 4FJ8A 3M3ZA 4WF9L 3OS2A 3OYDA 1C6VA 3EZ5A 2QM1A 4BR9A 3RTVA 2V52B 5BRHA 3NVKA 2IS3A 4FLUA 4B3RK 4CZFA 1WBBA 3CQ8A 1EXQA 3V4IA 4E1NA 3EKUA 4B3TK 4ID5A 4HWIA 4BWMA 3ZT2A 1WOQA 3ZSVA 3THVA 4DR1K 1IKWA 3T1YK 5AQKA 5GAEP 3QBXA 1BCMA 5GIPA 1I94K 1EX4A 3WUHA 2ZE2A 3SAFA 3IFRA 3CC4N 4OKEA 4DQQA 4QOZB 2DPNA 1M90O 1NJIO 3GBTA 1D9FA 4CK1A 5AZIB 1FJGK 3O9UA 3M8QA 4DV3K 1BL3A 5SZTA 3DWLA 4FPAA 3E66A 1LWEA 2LSNA 2F7TA 4MO4A 4FWPA 4DF8A 2HMPA 3HOTA 1S6PA 3VQAA 3DLRA 4CFBA 4IWVA 5M1OA 3CMEN 1KAYA 3F9KA 3IAYA 1VSMA 1VSIA 4OGCA 4B1VA 3TTFA 3NBPA 3U3YA 3ATUA 4CJQA 1P90A 5JLHA 3AA2A 3T3FA 4CF2A 5AQHA 1X9SA 4FLZA 1K73O 4M3UA 4Z4IA 1IKVA 2YX6A 3DLLL 1BCOA 3MDQA 3GG4A 3MCPA 3HVRA 3SMSA 2D0PA 4FCYA 1NJXA 1RGIA 1ZBUA 1NOYA 3VEVA 2RE2A 4K25A 3THWA 3VGKA 3AO2A 1WAJA 3BF1A 3PV8A 2G8IA 3OYMA 2I7NA 4B1YB 4CHYA 3S3MA 1JLQA 1RBUA 4LH4A 2DFEA 1BG3A 1X9MA 2HNDA 1FW6A 3EN9A 3EZWA 4FLVA 1RILA 4N41A 3ZX3A 3O1BA 5FPNA 5M1FA 2OPRA 2P9KA 1N8RO 1RTDA 1ZC6A 2RN2A 4FJKA 1ASVA 5SWMA 1Q8IA 3ZT1A 3AVHA 4E7LA 3HSCA 4Z4EA 2IGIA 2HHWA 5D3GA 4O0IA 4H0OA 5HL7L 4B8AB 3HK2A 3LZIA 2AP1A 4JHDB 4B9LA 4Z4GA 2A42A 4CZGA 4FOEA 4B08A 4FJIA 1Z6RA 3FR0A 4H4MA 4JK9A 3KK7A 1DTQA 4O4GA 3VQCA 3RVCA 3A5NC 2CGJA 5LMNK 1SUQA 4DQIA 1RTHA 1XHXA 1W0HA 4KPYA 4M41A 4CCHA 3KWIA 4DR6K 1T05A 3LALA 3NH0A 2E1YA 1GLCG 4X65K 4DFPA 4LC9B 4IO9L 4LFBK 1KLNA 4EP4A 5DM7L 2QXLA 4NXNK 1KVCA 1ZYQA 5BR9A 4E0DA 5M1QA 3IUCA 3FFKB 1QQOA 2Q0RA 1ZBIA 1A5VA 4KH4A 1OVQA 3O9QA 4DR4K 3CF5L 2KZZA 3T1AA 2E8AA 4E89A 3VEYA 3A0IX 4Q5VA 3CERA 4U7BA 1S1WA 3J7YP 3RRHA 4BROA 4BRFA 1KXPA 4W5QA 2BUPA 3C6TA 4WFNL 1HNZK 4X64K 2X74A 2HHSA 1BI4B 4B1ZA 2KW4A 4CZLA 4CZEA 5FPEA 3TU5A 4DQ8A 3MN5A 2QA4N 3QETA 3DOLA 3HI0A 5LJVA 4BGBA 2OPPA 1Z05A 4KBOA 4F2SA 1RDCA 3HYFA 3R3LA 4BRHA 4RW9A 3RR7A 1S1UA 1SQKA 2DFFA 5F2RA 5C42A 3O3FA 4DTSA 2KQ2A 1BQNA 1GOBA 3O4QA 1EWRA 4ILJA 3CYMA 3HPOA 3M8RA 1NGBA 3SQ1A 4FLYA 4PY5A 3HZ6A 3LP3A 4F3TA 2IAJA 3ALYA 2HSTA 3AVAA 1M1KO 5B8HA 2HHQA 5GINA 3KWGA 2FF3B 3TABA 3SBGA 4TSXA 4EIAA 2XY5A 5AQIA 4FJMA 3KLFA 2VWJA 4CJTA 4DV0K 3D6RA 4B9NA 4HCCA 3SLCA 3OBYA 2VG6A 2YNFA 4FK2A 4V19S 3SUOA 3QFUA 4BQLA 4CGFA 3OYKA 1NOZA 3G71N 4PL7A 5C2FA 3EE9A 1N34K 1XQSC 3VQ7A 5EU7A 3ZEUA 3LM9A 2ZWHA 1XUPO 3H45C 1RTIA 4CZIA 3CMAN 3SYZA 3QLHA 4BGAA 5KGXA 2PYLA 4FZZA 3V9WA 2YKMA 3AVFA 1VRTA 4BE1A 1XI1A 4M7XA 2Y1IA 3CM6A 4WQ5A 3OYBA 1S5JA 4MLHA 1NGJA 2AA4A 3NF6A 3TARA 2GELA 3R6MA 4NYFA 2EWSA 4JNEA 3AARA 2O8CB 3EY1A 3VGLA 4FJLA 2NUBA 2XY8A 4FM0A 4LF6K 2IIRA 4JI3K 1S9EA 3O08A 3ZT4A 2EX3A 4IG3A 2HW3A 1XWLA 4GVEA 4BQZA 1SKSA 4K41A 1GLLO 1JLCA 4OLAA 4BRLA 3DXKA 1VK0A 3J81O 5IT9O 4BACA 4JD2B 3MWPA 1XHZA 4BR2A 2P9NA 1T7PA 4JI5K 3GE1A 4MFBA 4KI6A 4EHTA 2D5RA 3KLIA 3TI0A 2E2OA 4FK4A 3AV9A 4H0VB 1HLUA 4FWKA 3PO5A 4DTOA 1TKTA 5AZJB 2AJQA 3VENA 3NH1A 1EKEA 3CXCM 1IJJA 2RKIA 3A5MC 1QSSA 2E2PA 4E7KA 1E4GT 3SCXA 3U9DA 1TYQA 1GOCA 4K43A 4F8RA 3O3HA 4CESA 1VQKN 4DQSA 1IG9A 3NAEA 4HTUA 1T6DA 1J5EK 1ZXOA 4O0JA 3KIOA 1JXEA 4CHPA 4LFAK 4KB0A 3RMCA 1NGHA 1SL1A 1RDWX 2X6SA 4YY3K 3ID6A 2PBDA 3BEXA 3V9UA 4KHYA 3THYB 2OCEA 3QMLA 3AVGA 3OYIA 4YOYA 3CFOA 3GL1A 4BR4A 5KTQA 4M3ZA 4WQ5C 5T7BA 4NYNA 3OYGA 3DLKA 4KV8A 5JS1A 3VQ5A 4DKWA 3NE6A 4DU3A 1Z25A 2F9WA 2VGMA 1TK5A 4BRKA 3LPTA 1EP4A 3PY8A 3F5TA 3CETA 3V9XA 4BC3A 4CFCA
chains in the Genus database with same CATH topology
2UUBK 2VQEK 4JI3K 4B3SK 4LF5K 4DR3K 4LF9K 1HR0K 2UXBK 2UXDK 4X66K 1XNQK 1N33K 1HNXK 3J81O 2F4VK 1IBMK 4DV6K 5IT9O 4YHHK 4B3RK 4X62K 4JV5K 4JI5K 5LL6Z 4GKKK 4LF8K 2UXCK 2UU9K 4B3TK 4JI4K 1IBKK 4CVNE 4JI8K 2E5LK 4JI0K 3OTOK 4DR1K 3T1YK 4LF7K 5IWAK 1HNWK 4GKJK 4DR7K 1I94K 1XNRK 4B3MK 4K0KK 1IBLK 4DV0K 2UUCK 5LMNK 4JYAK 3J7AP 4DR6K 4LFCK 1FJGK 4V19S 4JI2K 4DV3K 4X65K 2VQFK 1XMQK 4DV7K 4OX9K 4DUZK 3JAMO 4LFBK 5FLXO 1N34K 1J5EK 4NXNK 1N32K 1XMOK 2UUAK 2HHHK 4LFAK 4DUYK 5A2QO 4YY3K 4DR2K 4CW7B 4KHPK 4LF4K 3T1HK 4DR4K 4NXMK 3J7YP 5BR8K 5LMUK 1N36K 2ZM6K 1HNZK 4X64K 4JI1K 4DV1K 4JI6K 4DV2K 4DR5K 4JI7K 4DV5K 3J80O 4DV4K 5AJ3K 4AQYK 4LF6K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB K;  2VQE K;  4JI3 K;  4B3S K;  4LF5 K;  4DR3 K;  4LF9 K;  1HR0 K;  2UXB K;  2UXD K;  4X66 K;  1XNQ K;  1N33 K;  1HNX K;  3J81 O;  2F4V K;  1IBM K;  4DV6 K;  5IT9 O;  4YHH K;  4B3R K;  4X62 K;  4JV5 K;  4JI5 K;  5LL6 Z;  4GKK K;  4LF8 K;  2UXC K;  2UU9 K;  4B3T K;  4JI4 K;  1IBK K;  4CVN E;  4JI8 K;  2E5L K;  4JI0 K;  3OTO K;  4DR1 K;  3T1Y K;  4LF7 K;  5IWA K;  1HNW K;  4GKJ K;  4DR7 K;  1I94 K;  1XNR K;  4B3M K;  4K0K K;  1IBL K;  4DV0 K;  2UUC K;  5LMN K;  4JYA K;  3J7A P;  4DR6 K;  4LFC K;  1FJG K;  4V19 S;  4JI2 K;  4DV3 K;  4X65 K;  2VQF K;  1XMQ K;  4DV7 K;  4OX9 K;  4DUZ K;  3JAM O;  4LFB K;  5FLX O;  1N34 K;  1J5E K;  4NXN K;  1N32 K;  1XMO K;  2UUA K;  2HHH K;  4LFA K;  4DUY K;  5A2Q O;  4YY3 K;  4DR2 K;  4CW7 B;  4KHP K;  4LF4 K;  3T1H K;  4DR4 K;  4NXM K;  3J7Y P;  5BR8 K;  5LMU K;  1N36 K;  2ZM6 K;  1HNZ K;  4X64 K;  4JI1 K;  4DV1 K;  4JI6 K;  4DV2 K;  4DR5 K;  4JI7 K;  4DV5 K;  3J80 O;  4DV4 K;  5AJ3 K;  4AQY K;  4LF6 K; 
#chains in the Genus database with same CATH topology
 3UIQ A;  3AAQ A;  4FZY A;  4U67 L;  1SS6 A;  4C1N I;  2OZM A;  3ZET A;  3QEV A;  4L8R B;  3MK6 A;  3DLB A;  3R8E A;  5HRO A;  4OJR A;  2GUI A;  3AY9 A;  3AVI A;  3EO3 A;  4AHT A;  3FZK A;  4CEB A;  3QIO A;  1HPZ A;  3IDH A;  2OPQ A;  3AVN A;  3MXI A;  2HBK A;  5AQS A;  2R7Y A;  1TK8 A;  4CEQ A;  1X1P A;  3D2F B;  3WXJ A;  3I0R A;  1JL1 A;  2DFH A;  4FJ5 A;  4JV5 K;  3RMD A;  3NVM A;  3O9S A;  4CJU A;  3V1O A;  4NLB A;  3I0S A;  3V81 A;  2OTL N;  3DLE A;  3G4S N;  5IWA K;  3HPG A;  4Y1C A;  4DR7 K;  3LP1 A;  2HOE A;  4CBU A;  4NCA A;  4JKG A;  2Q3S A;  3PSI A;  3UKR A;  3WNE A;  4KKO A;  3AA5 X;  4NB4 A;  4CBX A;  1C0M A;  3BF3 A;  5HP1 A;  4DV7 K;  3CCE N;  3WNH A;  2XRI A;  2P9P A;  4YFU A;  1RDA A;  2G8F A;  3HRG A;  4JN4 A;  3ZSR A;  5MLC Q;  3M8S A;  3PIP L;  5JS2 A;  4DF4 A;  4Z94 A;  2ZGZ A;  4FXD A;  3SAG A;  3CCL N;  3SV3 A;  3MCA B;  4Z4F A;  5F1X A;  5FRN A;  4LF4 K;  1K9M O;  4BR7 A;  3CCU N;  3VET A;  5KRS A;  4CJ5 A;  2YHX A;  2ZD1 A;  1OVY A;  5KPR A;  1N6Q A;  3HP9 A;  3KLH A;  3UB5 A;  4BC2 A;  3ZT0 A;  4BRN A;  4R79 A;  5AQR A;  4FJN A;  4B9M A;  4F2R A;  3HOS A;  2QWO A;  5BRF A;  2B5J A;  5F0X A;  4OPH A;  4KH6 A;  2VWK A;  4ZTF A;  1H1V A;  3EKS A;  3WT0 A;  4FO0 A;  4AIL C;  2O8F A;  2W6L A;  4DLG A;  4MLE A;  3OY9 A;  4ILG B;  3CJ1 A;  1QZ6 A;  3OW2 M;  4DTX A;  5AQT A;  3OYN A;  5CYM A;  1DEJ A;  2VYP A;  4EZ9 A;  4MO5 A;  1N33 K;  1QSY A;  1HJO A;  3A2F A;  1HKG A;  4CZJ A;  1C0G A;  4OPK A;  3MEG A;  5LJW A;  4AHR A;  4B9T A;  1NK5 A;  4QAG A;  3PSF A;  2QKK A;  1YTA A;  2J4R A;  3MN7 A;  1IKY A;  1O13 A;  4I6M A;  1VRU A;  4G1Q A;  3O6W A;  1C0U A;  3NF8 A;  4ISG A;  1NU0 A;  3IRX A;  1L3U A;  1XNR K;  1JCE A;  4H5T A;  3B6P A;  5C12 A;  5J2P A;  2A41 A;  2ZQB A;  3OJU A;  3PX0 A;  3L8B A;  4O5F A;  2YJE A;  5HRS A;  1YJ9 N;  4OO1 J;  1NKE A;  1NMD A;  3ENO A;  1OH7 A;  2O8B A;  4A2B A;  1VSE A;  3IS9 A;  3T19 A;  1OH6 A;  4XH5 A;  3CD6 N;  2ITG A;  4FW2 A;  1WN7 A;  4CIF A;  1YI2 N;  3QDK A;  1TAQ A;  1XMO K;  3I8D A;  3H1Q A;  3THW B;  1QS4 A;  2EHG A;  3V1Q A;  1QQC A;  1X9J A;  3QB0 A;  4H8K A;  1OH5 A;  4BDY A;  3J8A A;  2Z1I A;  1HYS A;  2RPI A;  3HBT A;  2G8K A;  4DG1 A;  4JLH A;  4JRP A;  4AHU A;  1Q18 A;  4DSI A;  2OAN A;  4DQP A;  1U45 A;  2P9L A;  4WFA L;  2P9K B;  3AVJ A;  3TSQ A;  5LMU K;  3VPZ A;  4JS5 A;  4QS7 A;  1EO1 A;  5M1P A;  3CG7 A;  5J1E A;  3DYA A;  4CER A;  4CZM A;  3ZSQ A;  3HP6 A;  3RMA A;  1RBS A;  3NMU A;  4PKI A;  4GV6 A;  4A57 A;  5E26 A;  4DMN A;  3M5R A;  2YNG A;  4LSL A;  2FSK A;  3TAN A;  4IZ9 A;  1KVB A;  2NRT A;  1QSL A;  3P39 A;  4Y0W A;  5JVH L;  4DTN A;  4LF9 K;  3LAM A;  3LDO A;  3HM8 A;  5GIO A;  3VQ8 A;  1NK9 A;  4YOU A;  3SPY A;  5JLF A;  3F9M A;  1VQ8 N;  2I7P A;  4FLT A;  1TK0 A;  1RBT A;  1VQ9 N;  4RW8 A;  4CHO A;  5KQ8 A;  3SQ4 A;  5AQP A;  4H5N A;  3K2P A;  1IO2 A;  4CEC A;  2OA8 A;  2QWM A;  1A5W A;  1DGK N;  1DTT A;  4DS5 A;  4F4K A;  1RTJ A;  5FDL A;  2OYQ A;  2W6K A;  1HYZ A;  4EZ6 A;  1JKH A;  3QNO A;  3L6Q A;  1TAU A;  3WQU A;  4YOW A;  1IBL K;  4RW6 A;  1YHQ N;  1MU2 A;  1JXB A;  4HCB A;  4IFV A;  4O55 A;  3I55 N;  1G15 A;  4GVM A;  1KFD A;  4WQ4 A;  2W41 A;  4LFC K;  2CH6 A;  1CXU A;  1HNI A;  4H0Y B;  4CD3 A;  5HBM A;  4CGJ A;  4DS4 A;  1CZB A;  3QIN A;  4DUZ K;  1KQS M;  1SZ2 A;  3HPH A;  4A59 A;  1NM1 A;  3MXJ A;  3JS6 A;  1I3A A;  1JLF A;  1N32 K;  4FLX A;  2V7Y A;  1HUX A;  2G8V A;  4IO8 A;  4K42 A;  4CIG A;  3TR8 A;  2F96 A;  4KRF A;  4FSV A;  5EX5 A;  3NGZ A;  1RT3 A;  3QEX A;  4FWN A;  4DTR A;  4M63 C;  1WLJ A;  3BDP A;  4CF0 A;  1NGA A;  3KLG A;  5BRD A;  1ATN A;  5CR4 A;  1S1V A;  4UY8 O;  3ULE A;  1DLO A;  3NDK A;  2RF2 A;  4IEE A;  4C8M A;  4CEO A;  4BRD A;  2NRW A;  3AO1 A;  3FZL A;  1J5O A;  2JGU A;  3C95 A;  4LSN A;  3VQ6 A;  4CGI A;  1NJZ A;  1RBR A;  5ADX A;  3LWL A;  3E9P A;  4DB3 A;  3BZK A;  3CCS N;  3VF4 A;  2ZF5 O;  3K9J A;  4DLE A;  4EP5 A;  3VEW A;  4FM2 A;  4H0P A;  3SQ0 A;  4IOX A;  2P5G A;  4CGD A;  4LF5 K;  3U9Z A;  3E9L A;  3TTC A;  2ASM A;  5EXW A;  2GV9 A;  1RT4 A;  2CGL A;  3CJA A;  2FSN A;  4IKF A;  1GLJ O;  5ADX H;  2Z1H A;  4CJK A;  3CFP A;  1XNQ K;  1HJR A;  2A40 A;  1ZBF A;  3HVT A;  1YF5 L;  1IBM K;  4F3O A;  3IG1 A;  3RRG A;  3D0P A;  3QBW A;  4GKK K;  1ATS A;  1TV6 A;  3FZF A;  3SI6 A;  4AHS A;  3P83 D;  1YJN N;  4JI0 K;  4PKG A;  4CGG A;  3VQ4 A;  3QFP A;  3ZEU B;  4CZH A;  4BR0 A;  1NK7 A;  3N4Q A;  4A5B A;  2YHW A;  4LF7 K;  3NFA A;  5KPT A;  5AQM A;  4JHD A;  1X3N A;  3KLE A;  3DOK A;  3ZSY A;  3UE5 A;  3NHG A;  5HRR A;  4WQ4 C;  4IXC A;  2QI2 A;  3CIP A;  4BWJ A;  5AQW A;  2F8T A;  1BDG A;  1VSD A;  3UKU A;  3S3N A;  3C0B A;  2E6L A;  1NK0 A;  1EWQ A;  1L3S A;  4JAX A;  1XMQ K;  5K14 A;  4B3O A;  4PKH A;  1TGO A;  3T69 A;  3HTV A;  2YNI A;  5DK5 A;  2G8H A;  4BDZ A;  4ICL A;  3H6E A;  3N4P A;  3TSU A;  4LD0 A;  4CGH A;  2YHB A;  4I9Q A;  3HJF A;  1NWK A;  4DUY K;  2OZS A;  3DRP A;  1BOT O;  1R0A A;  1QHA A;  2HBL A;  4DR2 K;  1UA0 A;  1HYV A;  2ETJ A;  2F8S A;  4B1W B;  1O1W A;  2VG7 A;  1R59 O;  5FPM A;  1GLA G;  5AQV A;  2DY4 A;  2KZM A;  3DXK B;  1LWF A;  4KTQ A;  3PIO L;  4FL9 A;  5BR8 K;  3VQB A;  4E7J A;  3D2E B;  4PWD A;  5EY4 A;  4JI1 K;  2A3Z A;  2P9N B;  4FJG A;  4RW4 A;  1U4B A;  1E3M A;  2Z1J A;  4FLW A;  1U2V A;  1KTQ A;  3RMB A;  3NGY A;  1YAG A;  1CLQ A;  5AJ3 K;  4KHN A;  3SBT A;  1F21 A;  4DFJ A;  3QEI A;  3SUQ A;  1LCU A;  1GLF O;  5C0Y A;  4J2D A;  3PO4 A;  2BE2 A;  4DSJ A;  3O9T A;  2QWR A;  3OS0 A;  1U6Z A;  3SK3 A;  1Q9Y A;  3AVM A;  5GAG P;  4OKJ A;  1TYQ B;  5AQY A;  2O4I A;  1TUY A;  2YV0 X;  2ASO A;  4A2A A;  5BN9 A;  3AO5 A;  4N5S A;  2B4J A;  4BG9 A;  2BDP A;  4HHT A;  3HT3 A;  1YTU A;  1ZBL A;  1KVA A;  3S41 A;  2XY7 A;  3WXK A;  1YUW A;  3VOV A;  4K8Z A;  1ILY A;  1QVG M;  4GKJ K;  3H08 A;  4MDB A;  3LDL A;  4FWS A;  2E1Z A;  3C6A A;  3J7Z O;  5CYQ A;  3RR8 A;  3F73 A;  1C0F A;  4KHW A;  2GTD A;  2IVN A;  2QWP A;  2HHX A;  1ESV A;  3TAQ A;  2P9I A;  2NLX A;  1S72 N;  1S9G A;  4QS8 A;  4O8K A;  2VQF K;  4G9Z A;  4J8F A;  2VWB A;  5CZ1 A;  1N5Y A;  4OX9 K;  1W2B M;  4BY9 C;  3AA3 A;  1FK9 A;  2HVI A;  3WEE A;  3KHY A;  3SJJ A;  1NJW A;  4CF8 A;  2HVH A;  3VF6 A;  1TUU A;  3H3O B;  2F9T A;  3EYZ A;  3KKS A;  4IEI A;  3MWT A;  1J6Z A;  3NF9 A;  1IH7 A;  3KKR A;  3QNN A;  1HNV A;  4DU1 A;  1CZA N;  5AQL A;  4CK2 A;  3U6F A;  2QTD A;  1VSF A;  3QER A;  4FZX C;  3T1H K;  3ZET B;  1TKD A;  4FM1 A;  3O1W A;  3LAK A;  4AH9 A;  1HMV A;  3KK3 A;  3GOI A;  4ISE A;  1MDU B;  1RT5 A;  3LDQ A;  3F2K A;  4KO0 A;  2YI1 A;  1RT1 A;  3DJC A;  5AQQ A;  3TWH A;  4Z4C A;  3ZT3 A;  5AQN A;  4H0X B;  2BH1 A;  2O8E A;  3DI6 A;  3R1X A;  1YVN A;  3L3V A;  4DTU A;  2A5X A;  1B9F A;  5C24 A;  2ZJP L;  3U4L A;  1WSF A;  3SUN A;  3KK1 A;  3L2W A;  2E2Q A;  2G8U A;  3OVN A;  2D0C A;  3TTD A;  3FZH A;  4IFY A;  2BAN A;  4AQY K;  4J2B A;  3C7N A;  3ID8 A;  2CGK A;  4JK8 A;  1WAF A;  2VQE K;  4ELV A;  4MDA A;  5HRP A;  2HHU A;  4BRM A;  1FKO A;  1UAX A;  4JKG B;  1G99 A;  2ZJQ L;  1HR0 K;  1HPM A;  2UYT A;  3UKR B;  4CI6 A;  1VQ6 N;  5H1S Q;  2BTF A;  4ELT A;  2Q2R A;  4DCH A;  4DFM A;  1TL3 A;  2O8D A;  2HB5 A;  4JKE A;  1VSK A;  4DHY A;  2P9P B;  1RT2 A;  1RBV A;  1KFS A;  5CY4 A;  5J2Q A;  4M3Y A;  4DTP A;  3HST B;  2OTJ N;  2IOC A;  4IDK A;  1VQ4 N;  1GLD G;  3MN6 A;  2X78 A;  2IC3 A;  2V7Z A;  3L4Q A;  4KI4 A;  4B3M K;  2B6A A;  1WB9 A;  4CJW A;  1D5A A;  4FYD A;  1Q82 O;  4DSE A;  4YOX A;  1WBD A;  4JYA K;  1NBW A;  4CHQ A;  4KB1 A;  3U3G A;  4HVJ A;  2D0A A;  2D4W A;  3K5O A;  3C6H A;  4Z4H A;  4BRP A;  3P1G A;  3WXL A;  1IV0 A;  4CED A;  3O8M A;  4GY2 B;  4M7Y A;  4KAZ A;  2Z1G A;  3WXM B;  1QTM A;  1RDU A;  1RFQ A;  3ATV A;  3CHW A;  4GMJ B;  1K8A O;  2P51 A;  4JKC A;  2P9U A;  4E1M A;  2Q31 A;  4WE1 A;  2O8F B;  2P9S A;  5M1K A;  3TAE A;  4N76 A;  3P31 A;  3P4I A;  4B9U A;  2WFB A;  3B6O A;  3O4W A;  3LL3 A;  3VQD A;  5EOY A;  4C8O A;  4OKK A;  3D7E O;  4DTJ A;  3OYJ A;  3AVL A;  3ZCM A;  4W5N A;  3QIC A;  1V4T A;  4EAH D;  4AM6 A;  4CD1 A;  3LDN A;  3OYL A;  3CI5 A;  4DTM A;  3O80 A;  1OKJ A;  1NK8 A;  4DV5 K;  3FGU A;  1K8K A;  4I6M B;  4IDH A;  5AQO A;  3O4N A;  3AA4 A;  4YHH K;  3C94 A;  3PX6 A;  4RCH A;  4FJH A;  4KHU A;  4CHZ A;  2JWL A;  5KI6 A;  3CC7 N;  3ZYY X;  2PY5 A;  1ASW A;  1FXX A;  1Y97 A;  3MX2 A;  2UXB K;  3A8Y A;  1LOT B;  3H3N O;  4JRQ A;  4FPB A;  3SUP A;  2O8B B;  4M3X A;  2HBM A;  2KTQ A;  4ELU A;  3VN5 A;  3RSE A;  2HHV A;  3I8B A;  3ZLJ A;  1RDD A;  1D4X A;  4JI8 K;  3MAQ A;  2JLE A;  4FJJ A;  4BG8 A;  4CBW A;  1JLE A;  3EEQ A;  3KD1 E;  1HNW K;  2D0B A;  3G10 A;  2E88 A;  1JCG A;  3TAP A;  2WC9 A;  4BRI A;  1QQM A;  1KSP A;  3OYH A;  1T03 A;  4RWT A;  2P9L B;  4C8L A;  1S3X A;  1X9W A;  3VEX A;  1ZBS A;  3CJB A;  2NRR A;  3IKM A;  1NGF A;  3MEE A;  5HOO A;  1XC9 A;  1L5U A;  1WUA A;  3THX A;  2O4G A;  4FWO A;  5ELZ A;  4XEI A;  4JKD A;  2UUA K;  4CIE A;  4JK7 A;  4DSK A;  1BO5 O;  3DXM A;  4MQ3 A;  2CH5 A;  4BE0 A;  4KHP K;  1T3V A;  4BRG A;  1SKR A;  1ZBH A;  1IKX A;  3NCI A;  1NK6 A;  4E3S A;  4H5V A;  4CFD A;  4XH1 A;  3PX4 A;  2XY6 A;  3JYT A;  5M1N A;  4FJ9 A;  1MWM A;  1KD1 O;  3LDP A;  4H5R A;  4KHS A;  2QWL A;  2Y1J A;  3A5O C;  4I2P A;  3OJS A;  1VQL N;  1VSL A;  1P8Z A;  3LP0 A;  4DV1 K;  3KD5 E;  5JIC A;  3LZJ A;  3SQ2 A;  1JLB A;  2FBY A;  4KRE A;  3IMX A;  1GLE G;  2FF6 A;  3M1F A;  2QWN A;  4DV4 K;  3AO4 A;  4JKH A;  4DQR A;  4X62 K;  3I33 A;  2UUB K;  4BVO A;  2RHK A;  2FBX A;  2YJF A;  3P38 A;  3DRS A;  4DR3 K;  4CJS A;  3SZ2 A;  1V4S A;  2NRH A;  1WNS A;  3MEC A;  4KTW A;  1U47 A;  1YVU A;  2QXF A;  2NNW A;  3MMV A;  3WQT A;  1QHT A;  5CZ2 A;  3ISN C;  4FWQ A;  4PQU A;  5KGW A;  4M3T A;  1LV5 A;  1WSG A;  2PYJ A;  1NGD A;  2UXC K;  1JCF A;  5LL6 Z;  1VQM N;  1RDB A;  4H03 B;  4W5O A;  3LDS A;  1BWF O;  4CVN E;  3DRR A;  4B9Q A;  1KCF A;  5BPN A;  3KVG A;  1BA1 A;  3ZX2 A;  3ENB A;  3OYC A;  1KC8 O;  2IDO A;  4DSL A;  4BRE A;  4HUF A;  4FK0 A;  1Q9X A;  3CCR N;  5C25 A;  1VSJ A;  4PL8 A;  3VQ9 A;  1HRH A;  3OBW A;  4DU4 A;  4LY7 A;  1SAZ A;  4CEZ A;  3CPW M;  4GV9 A;  3ITH A;  4FOI A;  5AQF A;  1EQY A;  3D45 A;  3VQE A;  1U49 A;  1NGI A;  3ULE B;  3JAM O;  1JL2 A;  2YCH A;  3A5L C;  4EFH A;  3EE8 A;  3DAW A;  5FPD A;  4CF9 A;  5JMV A;  1DKG D;  3U8X A;  2HHH K;  3TPQ A;  3W0L A;  3V9S A;  3MED A;  4WYB A;  4NCG A;  1VQ5 N;  1DT9 A;  3I56 N;  1D8Y A;  3G0Z A;  4CJ7 A;  5AQG A;  4NXM K;  5AZI A;  1S1T A;  1N36 K;  1RT6 A;  2E4L A;  4CJR A;  5AR0 A;  3VA3 A;  3C6U A;  2PZS A;  3FZM A;  4ZTJ A;  2QW9 A;  1HX1 A;  4HUE A;  1LAV A;  3VEO A;  5TKW A;  4YOV A;  2HNZ A;  1J54 A;  4JEP A;  1YJW N;  4QS9 A;  2WUS A;  3P5J A;  4B3S K;  2YHA A;  3E9O A;  2FBT A;  1NKC A;  3KTQ A;  1KAZ A;  1RT7 A;  4DWI A;  4X66 K;  3SAH A;  2A1S A;  1SV5 A;  3UKU B;  4H4O A;  3Q7C A;  4CJL A;  4Y1D A;  3HM9 A;  3CCJ N;  1UWB A;  1MA9 B;  3BGR A;  5E41 A;  5BPM A;  3O9R A;  4AM7 A;  3OYE A;  3CC2 N;  1BIU A;  1C1A A;  4JI4 K;  3ZSZ A;  4CEA A;  4C8K A;  3G25 A;  3L3U A;  4CZK A;  3SNN A;  3OTO K;  2HF3 A;  3AAP A;  2Q36 A;  1KAX A;  2FSJ A;  5HRN A;  1LAW A;  4GW6 A;  1VQO N;  4CJ4 A;  1BGX T;  4O44 A;  4OGE A;  1NG9 A;  4Q0B A;  2NZT A;  4M45 A;  1VSH A;  2E6M A;  2ZGY A;  1BIZ A;  3QIP A;  1UA1 A;  4KTZ A;  4C1N K;  3DLH A;  1VQN N;  1T6C A;  3CPE A;  4JI2 K;  1UOC A;  1RCH A;  2P5O A;  4J2E A;  3VQQ A;  1C1B A;  3BZC A;  4F9O A;  1GOA A;  1U2V B;  1VAZ A;  3L2V A;  5I9E B;  2WBN A;  4L3Q A;  3CCV N;  2HF4 A;  1ATR A;  2GWJ A;  3KJV A;  3M6G A;  2BGG A;  2P1J A;  1JLG A;  4KH5 A;  5J2N A;  4OPA A;  3MN9 A;  1VHX A;  4BR5 A;  3CQY A;  3BY5 A;  4BE2 A;  3L2R A;  3CJ9 A;  3K5N A;  4IJA A;  2Q1N A;  3LM2 A;  5KRT A;  2HMI A;  2KFZ A;  4N47 A;  2GX9 A;  3PUF A;  1YIJ N;  3OYF A;  5DM6 L;  1B92 A;  4IBN A;  4FVM A;  1WSJ A;  2FBV A;  3VGM A;  1WSI A;  5EVZ A;  4DR5 K;  3QEW A;  1ASU A;  4B1U B;  1T8E A;  1NLV A;  2QEX N;  1Q7Y O;  1HKC A;  3ZX0 A;  3AGR A;  5CHI A;  3S3O A;  3R9P A;  5AQX A;  3OHR A;  1IG8 A;  1Y64 A;  1NKB A;  4C8N A;  4BC4 A;  1NGE A;  3VEZ A;  1W9H A;  1YT3 A;  4CJF A;  2F4V K;  2P9I B;  4PHT X;  3TSP A;  4OVL A;  4LF8 K;  2HBJ A;  3MX5 A;  1BI4 A;  3T7Z A;  3WEE B;  1KLM A;  2GWK A;  2PFU A;  4H5W A;  5KPZ A;  2IVO A;  4RW7 A;  3S9H A;  2KLA A;  4JKB A;  1NJY A;  2WTU A;  3SJH A;  3TAF A;  5BPL A;  4CJ3 A;  3ASM A;  1TVR A;  3FFI A;  1VQ7 N;  4ILH A;  3V6D A;  3AVC A;  4I9L A;  3HL8 A;  3BP8 A;  5CE3 A;  4B1X B;  3C65 A;  1ITG A;  3LAN A;  1KRP A;  2JWK A;  3EL2 A;  4BC5 A;  2H3G X;  4CEE A;  4XIU A;  2A6A A;  3V9Z A;  2O8E B;  4FW1 A;  3OYA A;  4E1J A;  4EHU A;  3K5M A;  5FRM A;  1W7A A;  5FLX O;  5KQD A;  4IFE A;  3WNF A;  4C23 A;  3DM2 A;  1WSE A;  4PUO A;  1BHL A;  4HTL A;  3VF2 A;  1BQM A;  4W5R A;  4M3R A;  2IVP A;  1TKZ A;  1L3V A;  3LP2 A;  2Q97 A;  3C7N B;  2GEM A;  3B8A X;  5FRO A;  1QQN A;  4NO7 A;  4AHC A;  3VTH A;  3OS1 A;  3W3D A;  2ASP A;  4RG8 A;  2HHT A;  4JKF A;  1NMN A;  2O8D B;  3VTI A;  2ITM A;  2ZM6 K;  3JXU A;  3AVB A;  3JSM A;  3E1Y A;  4ISF A;  1LW0 A;  3QO9 A;  3HO1 A;  2G8W A;  4B9S A;  5E84 A;  4R5P A;  3D2E A;  2E2N A;  4AF1 A;  4J2A A;  2OPS A;  1S22 A;  2VG5 A;  4JI7 K;  1MWK A;  3J80 O;  1CXQ A;  3QEP A;  1YIT N;  3VES A;  4JKA A;  2YNH A;  3ZSX A;  4BVP A;  1REV A;  1JLA A;  2W42 A;  2UXD K;  3FLC O;  4FWM A;  4OPJ A;  3DMJ A;  4NCB A;  4XH4 A;  4W5T A;  3H46 O;  5BN8 A;  4IOC L;  4OLB A;  2KFN A;  2FC0 A;  2UU9 K;  3KZB A;  5JVG L;  2XO7 A;  4IOA L;  4GNI A;  2E5L K;  2O8C A;  4CEF A;  5HLF A;  3NF7 A;  3AGK A;  2P9U B;  4CF1 A;  3OA9 A;  2A1R A;  4K0K K;  4YOR A;  3CJ7 A;  2P9S B;  2VCP A;  1CZ9 A;  2UUC K;  1C1C A;  2W40 A;  1SL0 A;  2HNY A;  3J7A P;  3K9K A;  4QCL A;  4B8C A;  4A62 A;  2QK9 A;  5J2M A;  4BRQ A;  2YKN A;  3E01 A;  3SV4 A;  4JD2 A;  3RWU A;  4FJX A;  1X3M A;  1OH8 A;  2NRZ A;  1T44 A;  3NGI A;  5AFU A;  4HUG A;  2FXU A;  1JJ2 M;  1LWC A;  3CQX A;  3VMF B;  2WON A;  1E4F T;  2NRX A;  2QWQ A;  4O8U A;  2Q0U A;  4N56 A;  4FWR A;  4AHV A;  4Z0U A;  1SKW A;  4I7F A;  4YDU A;  1K8K B;  3SMP A;  3ZSO A;  1WSH A;  4FWL A;  4CW7 B;  1D9D A;  4M3W A;  5AZJ A;  3K57 A;  3CCQ N;  2GUP A;  5AFU H;  1TKX A;  4E7H A;  4LH5 A;  4CJV A;  3BUZ B;  4IG0 A;  3AO3 A;  4DFK A;  5C10 A;  5AQU A;  3NH2 A;  3VER A;  3DLG A;  4KFB A;  1B9D A;  4CJE A;  3O5B A;  1SL2 A;  4CE9 A;  5TKY A;  3AVK A;  4PA1 A;  2QKB A;  4JI6 K;  2ATQ A;  2D1K A;  3RSE B;  1XC3 A;  4BRC A;  1TL1 A;  2VGN A;  3SPZ A;  1W97 L;  1Z26 A;  3FE1 A;  1BA0 A;  5GAH P;  4A5A A;  2D0O A;  1HQU A;  4JS4 A;  3THY A;  4GV3 A;  4CFA A;  3ZSW A;  5C15 A;  1EET A;  4YNQ A;  4CHN A;  3VA0 A;  4ID1 A;  5AQZ A;  3ENH A;  2DTU A;  2I5J A;  1BIS A;  1YXQ A;  1BUP A;  3CM5 A;  1HNX K;  3M8P A;  4DV6 K;  3GDQ A;  4BRA A;  4WFB L;  1LW2 A;  4CJP A;  1J9A A;  3THX B;  1Q81 O;  1IBK K;  1Q86 O;  4KHQ A;  4RTF D;  2WOM A;  4A61 A;  5BRE A;  1K6Y A;  3DXM B;  1QZ5 A;  4BDP A;  5LY3 A;  1S1X A;  1A5X A;  3HXM A;  3L0Q A;  1S6Q A;  2V51 B;  1FKP A;  1QVF M;  3CCM N;  1J53 A;  5GAD P;  2FLO A;  4CK3 A;  1L3T A;  4M42 A;  3D2F A;  4DSF A;  1VQP N;  3ULD A;  5I3U A;  4WCE L;  4IJN A;  5I42 A;  4O5B A;  3WNG A;  2NRV A;  3L2Q A;  4YDU C;  3TAM A;  3CJC A;  3WXI A;  3VQP A;  3H1V X;  3K58 A;  5A2Q O;  2ZJR L;  2X6N A;  3TAG A;  3K0S A;  5C2D A;  2E20 A;  3PLA A;  4B9V A;  1I39 A;  4FJ7 A;  1U48 A;  4E7I A;  1NGC A;  1HKB A;  4ZHR A;  2PAV A;  1HQE A;  5DMR A;  3KK2 A;  2YHY A;  3LPU A;  4H0T B;  2KKZ A;  1NK4 A;  3QES A;  1BU6 O;  1RNH A;  5AQJ A;  1NGG A;  4I2Q A;  4DV2 K;  4YOT A;  1C0T A;  4FVU A;  3L2U A;  4K8X A;  3Q7B A;  3G6E N;  4NLC A;  3K59 A;  4UQG A;  2XHB A;  4E19 A;  2KHO A;  1GLB G;  3LWM A;  3MXM A;  3V1R A;  1U04 A;  1NNE A;  1QE1 A;  3K5L A;  2GBZ A;  3CFR A;  3O3G A;  3L4I A;  4FJ8 A;  3M3Z A;  4WF9 L;  3OS2 A;  3OYD A;  1C6V A;  3EZ5 A;  2QM1 A;  4BR9 A;  3RTV A;  2V52 B;  5BRH A;  3NVK A;  2IS3 A;  4FLU A;  4B3R K;  4CZF A;  1WBB A;  3CQ8 A;  1EXQ A;  3V4I A;  4E1N A;  3EKU A;  4B3T K;  4ID5 A;  4HWI A;  4BWM A;  3ZT2 A;  1WOQ A;  3ZSV A;  3THV A;  4DR1 K;  1IKW A;  3T1Y K;  5AQK A;  5GAE P;  3QBX A;  1BCM A;  5GIP A;  1I94 K;  1EX4 A;  3WUH A;  2ZE2 A;  3SAF A;  3IFR A;  3CC4 N;  4OKE A;  4DQQ A;  4QOZ B;  2DPN A;  1M90 O;  1NJI O;  3GBT A;  1D9F A;  4CK1 A;  5AZI B;  1FJG K;  3O9U A;  3M8Q A;  4DV3 K;  1BL3 A;  5SZT A;  3DWL A;  4FPA A;  3E66 A;  1LWE A;  2LSN A;  2F7T A;  4MO4 A;  4FWP A;  4DF8 A;  2HMP A;  3HOT A;  1S6P A;  3VQA A;  3DLR A;  4CFB A;  4IWV A;  5M1O A;  3CME N;  1KAY A;  3F9K A;  3IAY A;  1VSM A;  1VSI A;  4OGC A;  4B1V A;  3TTF A;  3NBP A;  3U3Y A;  3ATU A;  4CJQ A;  1P90 A;  5JLH A;  3AA2 A;  3T3F A;  4CF2 A;  5AQH A;  1X9S A;  4FLZ A;  1K73 O;  4M3U A;  4Z4I A;  1IKV A;  2YX6 A;  3DLL L;  1BCO A;  3MDQ A;  3GG4 A;  3MCP A;  3HVR A;  3SMS A;  2D0P A;  4FCY A;  1NJX A;  1RGI A;  1ZBU A;  1NOY A;  3VEV A;  2RE2 A;  4K25 A;  3THW A;  3VGK A;  3AO2 A;  1WAJ A;  3BF1 A;  3PV8 A;  2G8I A;  3OYM A;  2I7N A;  4B1Y B;  4CHY A;  3S3M A;  1JLQ A;  1RBU A;  4LH4 A;  2DFE A;  1BG3 A;  1X9M A;  2HND A;  1FW6 A;  3EN9 A;  3EZW A;  4FLV A;  1RIL A;  4N41 A;  3ZX3 A;  3O1B A;  5FPN A;  5M1F A;  2OPR A;  2P9K A;  1N8R O;  1RTD A;  1ZC6 A;  2RN2 A;  4FJK A;  1ASV A;  5SWM A;  1Q8I A;  3ZT1 A;  3AVH A;  4E7L A;  3HSC A;  4Z4E A;  2IGI A;  2HHW A;  5D3G A;  4O0I A;  4H0O A;  5HL7 L;  4B8A B;  3HK2 A;  3LZI A;  2AP1 A;  4JHD B;  4B9L A;  4Z4G A;  2A42 A;  4CZG A;  4FOE A;  4B08 A;  4FJI A;  1Z6R A;  3FR0 A;  4H4M A;  4JK9 A;  3KK7 A;  1DTQ A;  4O4G A;  3VQC A;  3RVC A;  3A5N C;  2CGJ A;  5LMN K;  1SUQ A;  4DQI A;  1RTH A;  1XHX A;  1W0H A;  4KPY A;  4M41 A;  4CCH A;  3KWI A;  4DR6 K;  1T05 A;  3LAL A;  3NH0 A;  2E1Y A;  1GLC G;  4X65 K;  4DFP A;  4LC9 B;  4IO9 L;  4LFB K;  1KLN A;  4EP4 A;  5DM7 L;  2QXL A;  4NXN K;  1KVC A;  1ZYQ A;  5BR9 A;  4E0D A;  5M1Q A;  3IUC A;  3FFK B;  1QQO A;  2Q0R A;  1ZBI A;  1A5V A;  4KH4 A;  1OVQ A;  3O9Q A;  4DR4 K;  3CF5 L;  2KZZ A;  3T1A A;  2E8A A;  4E89 A;  3VEY A;  3A0I X;  4Q5V A;  3CER A;  4U7B A;  1S1W A;  3J7Y P;  3RRH A;  4BRO A;  4BRF A;  1KXP A;  4W5Q A;  2BUP A;  3C6T A;  4WFN L;  1HNZ K;  4X64 K;  2X74 A;  2HHS A;  1BI4 B;  4B1Z A;  2KW4 A;  4CZL A;  4CZE A;  5FPE A;  3TU5 A;  4DQ8 A;  3MN5 A;  2QA4 N;  3QET A;  3DOL A;  3HI0 A;  5LJV A;  4BGB A;  2OPP A;  1Z05 A;  4KBO A;  4F2S A;  1RDC A;  3HYF A;  3R3L A;  4BRH A;  4RW9 A;  3RR7 A;  1S1U A;  1SQK A;  2DFF A;  5F2R A;  5C42 A;  3O3F A;  4DTS A;  2KQ2 A;  1BQN A;  1GOB A;  3O4Q A;  1EWR A;  4ILJ A;  3CYM A;  3HPO A;  3M8R A;  1NGB A;  3SQ1 A;  4FLY A;  4PY5 A;  3HZ6 A;  3LP3 A;  4F3T A;  2IAJ A;  3ALY A;  2HST A;  3AVA A;  1M1K O;  5B8H A;  2HHQ A;  5GIN A;  3KWG A;  2FF3 B;  3TAB A;  3SBG A;  4TSX A;  4EIA A;  2XY5 A;  5AQI A;  4FJM A;  3KLF A;  2VWJ A;  4CJT A;  4DV0 K;  3D6R A;  4B9N A;  4HCC A;  3SLC A;  3OBY A;  2VG6 A;  2YNF A;  4FK2 A;  4V19 S;  3SUO A;  3QFU A;  4BQL A;  4CGF A;  3OYK A;  1NOZ A;  3G71 N;  4PL7 A;  5C2F A;  3EE9 A;  1N34 K;  1XQS C;  3VQ7 A;  5EU7 A;  3ZEU A;  3LM9 A;  2ZWH A;  1XUP O;  3H45 C;  1RTI A;  4CZI A;  3CMA N;  3SYZ A;  3QLH A;  4BGA A;  5KGX A;  2PYL A;  4FZZ A;  3V9W A;  2YKM A;  3AVF A;  1VRT A;  4BE1 A;  1XI1 A;  4M7X A;  2Y1I A;  3CM6 A;  4WQ5 A;  3OYB A;  1S5J A;  4MLH A;  1NGJ A;  2AA4 A;  3NF6 A;  3TAR A;  2GEL A;  3R6M A;  4NYF A;  2EWS A;  4JNE A;  3AAR A;  2O8C B;  3EY1 A;  3VGL A;  4FJL A;  2NUB A;  2XY8 A;  4FM0 A;  4LF6 K;  2IIR A;  4JI3 K;  1S9E A;  3O08 A;  3ZT4 A;  2EX3 A;  4IG3 A;  2HW3 A;  1XWL A;  4GVE A;  4BQZ A;  1SKS A;  4K41 A;  1GLL O;  1JLC A;  4OLA A;  4BRL A;  3DXK A;  1VK0 A;  3J81 O;  5IT9 O;  4BAC A;  4JD2 B;  3MWP A;  1XHZ A;  4BR2 A;  2P9N A;  1T7P A;  4JI5 K;  3GE1 A;  4MFB A;  4KI6 A;  4EHT A;  2D5R A;  3KLI A;  3TI0 A;  2E2O A;  4FK4 A;  3AV9 A;  4H0V B;  1HLU A;  4FWK A;  3PO5 A;  4DTO A;  1TKT A;  5AZJ B;  2AJQ A;  3VEN A;  3NH1 A;  1EKE A;  3CXC M;  1IJJ A;  2RKI A;  3A5M C;  1QSS A;  2E2P A;  4E7K A;  1E4G T;  3SCX A;  3U9D A;  1TYQ A;  1GOC A;  4K43 A;  4F8R A;  3O3H A;  4CES A;  1VQK N;  4DQS A;  1IG9 A;  3NAE A;  4HTU A;  1T6D A;  1J5E K;  1ZXO A;  4O0J A;  3KIO A;  1JXE A;  4CHP A;  4LFA K;  4KB0 A;  3RMC A;  1NGH A;  1SL1 A;  1RDW X;  2X6S A;  4YY3 K;  3ID6 A;  2PBD A;  3BEX A;  3V9U A;  4KHY A;  3THY B;  2OCE A;  3QML A;  3AVG A;  3OYI A;  4YOY A;  3CFO A;  3GL1 A;  4BR4 A;  5KTQ A;  4M3Z A;  4WQ5 C;  5T7B A;  4NYN A;  3OYG A;  3DLK A;  4KV8 A;  5JS1 A;  3VQ5 A;  4DKW A;  3NE6 A;  4DU3 A;  1Z25 A;  2F9W A;  2VGM A;  1TK5 A;  4BRK A;  3LPT A;  1EP4 A;  3PY8 A;  3F5T A;  3CET A;  3V9X A;  4BC3 A;  4CFC A; 
#chains in the Genus database with same CATH homology
 2UUB K;  2VQE K;  4JI3 K;  4B3S K;  4LF5 K;  4DR3 K;  4LF9 K;  1HR0 K;  2UXB K;  2UXD K;  4X66 K;  1XNQ K;  1N33 K;  1HNX K;  3J81 O;  2F4V K;  1IBM K;  4DV6 K;  5IT9 O;  4YHH K;  4B3R K;  4X62 K;  4JV5 K;  4JI5 K;  5LL6 Z;  4GKK K;  4LF8 K;  2UXC K;  2UU9 K;  4B3T K;  4JI4 K;  1IBK K;  4CVN E;  4JI8 K;  2E5L K;  4JI0 K;  3OTO K;  4DR1 K;  3T1Y K;  4LF7 K;  5IWA K;  1HNW K;  4GKJ K;  4DR7 K;  1I94 K;  1XNR K;  4B3M K;  4K0K K;  1IBL K;  4DV0 K;  2UUC K;  5LMN K;  4JYA K;  3J7A P;  4DR6 K;  4LFC K;  1FJG K;  4V19 S;  4JI2 K;  4DV3 K;  4X65 K;  2VQF K;  1XMQ K;  4DV7 K;  4OX9 K;  4DUZ K;  3JAM O;  4LFB K;  5FLX O;  1N34 K;  1J5E K;  4NXN K;  1N32 K;  1XMO K;  2UUA K;  2HHH K;  4LFA K;  4DUY K;  5A2Q O;  4YY3 K;  4DR2 K;  4CW7 B;  4KHP K;  4LF4 K;  3T1H K;  4DR4 K;  4NXM K;  3J7Y P;  5BR8 K;  5LMU K;  1N36 K;  2ZM6 K;  1HNZ K;  4X64 K;  4JI1 K;  4DV1 K;  4JI6 K;  4DV2 K;  4DR5 K;  4JI7 K;  4DV5 K;  3J80 O;  4DV4 K;  5AJ3 K;  4AQY K;  4LF6 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...