3HVTA

Structural basis of asymmetry in the human immunodeficiency virus type 1 reverse transcriptase heterodimer
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
555
structure length
555
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the binding site for nonnucleoside inhibitors of the reverse transcriptase of human immunodeficiency virus type 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
total genus 95
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1994-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3hvtA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvtA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvtA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvtA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hvtA05
3EPIA 1IG9A 1MMLA 2XY5A 1IKWA 2JGUA 2DPJA 3QLHA 2BE2B 3E51A 4IFVB 4DL6A 1K1QA 2OH2A 4OLAA 5C5JA 1BCOA 2RPIA 1RTIB 3QO9A 3HL8A 3HT3A 3U3GA 3KLIA 4GC7A 1VRUB 1VSEA 1U4BA 4QW9A 5EU7A 1XR7A 3LPUA 4FXDA 4DTRA 4K4VA 1ZBUA 4I2PA 4TY9A 1RYRA 4NLSA 1FKOA 2IJFA 4IH5A 1T94A 1Z26A 1B9FA 3DOKB 3HKWA 5DQHA 3KHRA 2RF2B 1YVFA 4RW6B 3V6DB 3VQEA 1RTIA 4OKJA 1B92A 3K57A 4QOZB 1ZETA 3SQ4A 3LP0A 4ZVFA 3V9WA 4JRPA 3JYTB 3H2LA 4ECWA 1A5WA 2BE2A 3G0ZA 1RA6A 4K50A 5CZ2A 4NCBA 5J2PA 3DMJB 4R5PB 5KG6A 5DMRA 4FLTA 3U6FA 3G6VA 3CG7A 1A5VA 4CGDA 3KNAA 4F4XA 2ATQA 4EBDA 4ED6A 2YKNB 1C6VA 1FKPA 3KK3A 4FJKA 3V1QA 4J9PA 3TWHA 4J9KA 4F3TA 4DTNA 5JXSA 2BQUA 3NF7A 4KO0A 1S6PA 1BCMA 1TKXA 3OS2A 4AHVA 3LP1B 3FRZA 1S48A 3WNEA 5F8IA 4NLPA 2HMIB 4MK9A 2AGOA 3S3OA 3SPZA 5KT2A 1TAQA 2FVQA 2G8KA 2F96A 4KO0B 3L2VA 4WXWA 1MU2A 3P83D 3ISND 2IJNA 4I9LA 2IS3A 1XWLA 2AWZA 4CJSA 4Y1DA 2VWJA 3PO4A 2ILZA 1S4FA 4MK8A 3D0PA 3QLHB 5F8MA 1QE1B 1RILA 4IBNA 3KLIB 2X74A 4TSXA 5FRNA 4H4OA 1N5YB 3KKSA 2RDIA 4N56A 4EEYA 2XGPA 5KFYA 3D5MA 3CJ3A 3MR2A 2AGQA 4ZTJA 3V81B 1KLMB 3SI6A 4RZRA 1RT2A 4B3OB 5KFJA 3C6UA 4L8RB 1HNIB 4BWJA 3RBDA 1RT4B 3QIPB 1RAJA 1FK9B 4U6PA 4KHSA 2AU0A 3AVKA 2OPQA 3VQ8A 4O44A 3AVHA 3VN5A 1BI4A 4DTSA 3NDKA 4KBIA 4WFXA 4C8MA 3SFGA 3CJ0A 1N56A 5HRNA 1JKHA 2B4JA 4PQUB 4J2AA 4J2EA 1JXBA 4EYIB 3V6JA 2CJQA 2XCAA 4CIFA 2IGIA 3BGRB 5J2MB 4J9RA 2YKMB 3KJVB 1SKWA 1BHLA 4JS4A 3LDSA 3VQ9A 5KGXA 3NE6A 1HPZB 3PX6A 3AV9A 5J2NB 1TGOA 4M3TA 2HNDA 1SUQA 4NRTA 3KLFB 4M45A 2WK4A 4E3SA 5KFRA 3NGYA 3SFUA 3BQ2A 1RT1A 4PWDA 1JKHB 3QO9B 3WNHA 4I7FA 4FJGA 4Q8EA 2BGGA 3T5JA 4O3SA 1X9WA 1RTHB 2OPSA 1R0AA 1O1WA 2NUBA 4X2BA 2QV6A 1HYZA 1N6QA 2HNZA 2IMWP 1SKSA 4MKAA 2IOCA 5J2NA 3CIZA 3L3VA 2DTUA 4LH4A 3SI8A 2XGQA 1DLOA 4M3RA 1HMVB 4DG1B 1QQCA 4Z4EA 4OKKA 2E6MA 3SQ2A 1S9FA 3GV7B 3HPOA 1S1WA 3O4NA 1HQEB 2ZE2B 4DL7A 1QE1A 1X1PA 4NLWA 3HPGA 4CJTA 4GC6A 4K4YA 4GW6A 2XY8A 3DRSB 3RR8A 3OYMA 2GBZA 4KAIA 2F8EX 3QIOA 2OYQA 1FK9A 3OYFA 1Z4UA 5KFQA 4NCGB 3ZT4A 3V9SA 3OS0A 1NHUA 3KK3B 4ICLB 1TV6A 4FYDA 1TL3A 4RNMA 2JEJA 3DRRA 4CGIA 4FK0A 1RT4A 3QIPA 4B8AB 3OYGA 1ZBHA 1C2PA 3L2RA 4DTXA 3IN5A 1NKEA 4RG8A 3KLEA 4AHRA 3OYHA 3QERA 2HNYA 5D3GB 1JX4A 5DG9A 3L2WA 4FLYA 2RDJA 3KMQA 2C28A 1EETB 1VRTA 5F9LA 1IKXA 4IRDA 4NLXA 1T05B 3SYZA 2HHVA 3QEPA 3MR6A 1RTDA 1JXEA 5L1LA 1ZBFA 3IGNA 1YTUA 4C8NA 1C0UB 3PX4A 4J9SA 2HWHA 3VA3A 4YNQA 4Q45A 4WFYA 2DFFA 4CK3A 5HBMB 1T05A 4ZPAA 4Z4CA 1Q8IA 1JLBB 2BANA 5KFZA 4B9VA 5DLGA 4KB1A 1TVRA 2OPSB 3ZSWA 1DTTB 4B9MA 2G8FA 1RDDA 4FW1A 1RT1B 4PWDB 4B9LA 4K8XA 4WXOA 4IRCA 4NLVA 4DTPA 1U45A 4Y2AA 1RT3A 3T19A 2Z1IA 4DU4A 4H4MB 3S3NA 1S1UB 1BGXT 3G86A 3SUPA 3T5HA 5F8GA 3C95A 1S1VB 3DLGB 4UQGA 1S10A 3LAMA 4ZP8A 1TK5A 2J6UA 5C42A 1I3AA 1KVAA 4FJ9A 4O3PA 2YV0X 4BE2A 4FJ8A 2P51A 3IG1B 3JYTA 4GMJB 3KLHB 2KZMA 1TKZB 3QNOA 2FVSA 2QE5A 3TAMB 2HVHA 4O4GA 5KG5A 1S1UA 2C22A 4WE1B 4CIGA 5SZTA 4M41A 3DM2B 3T3FA 4RW9B 4B9SA 4IDKB 3T5KA 3OLBA 4FJJA 4Q43A 3T5LA 3ZSYA 2OA8A 2Z1GA 3I0RB 2PYLA 4R8UB 3HP9A 5DG8A 3OLAA 3HO1A 4LQ9A 2B5JB 3CJ5A 3G6YA 5KI6A 3B6OA 3IAYA 1RT7B 4OL8A 3AA4A 2YNFA 4ECYA 4N76A 2VG5B 4KKOB 4K4SA 4CHQA 3NGDA 4LSLA 3AO1A 1RDRA 3I0RA 2HHWA 2FLNA 5KT4A 4CECA 4DFJA 1XC9A 3DM2A 4OJRA 3DLRA 1C1BB 1JIHA 4IG3A 1VSMA 3TI0A 3THVA 3CJ4A 1NK6A 1X9MA 2I5JB 3QZ8A 4RW8A 2IAJA 4NLGA 2UUTA 5JS1A 2XHBA 4KV8B 1D9DA 3PY8A 5HBMA 2VG5A 5CZ1A 1IKYA 4XO0A 3N6NA 4ECVA 4J2DA 4DFKA 1C0TA 1J53A 3VQBA 2RF2A 2OPPA 2O5DA 3BQ0A 1SL0A 2UUWA 4E1MA 3V6DA 4TLRA 3PX0A 4O4RA 5KRSA 3K2PA 3AVLA 4YR0A 1T03A 4EZ6A 4RW8B 4IR9A 1CXUA 1S9GB 2VG7A 3LALA 3ICLA 2R8HA 5DQGA 1C0TB 3M9NB 3HSTB 2YKNA 2G8WA 5KFIA 2D5RA 3OYCA 1WNEA 3CVKA 3EZ5A 3IG1A 5T7BA 5KT5A 4HHTA 4N41A 4O3OA 3BR9A 1IKWB 3HK2A 3DI6A 4M94A 4CHPA 4TXSA 3SUNA 1HMVA 4IG0B 4TYAA 1BQNB 2P5OA 1RT6B 4TY8A 3OSNA 5CYMB 2B5JA 3DLHA 2W8LA 2OZSA 1D5AA 5HROB 1NJZA 4MIAA 2KW4A 4LSLB 4WYLA 3DRSA 3GIKA 4DEZA 4IDKA 1QSSA 1T3NA 3BSAA 3DLKB 3KHLA 2IM1A 1ASVA 4FLUA 1EKEA 2UVRA 1N48A 4NLUA 1RDAA 1C1CB 1TKDA 5KG0A 3M9OB 1NJWA 1RBVA 1REVA 1LWFA 4RUCA 1TV6B 3ZSQA 2KTQA 1TAUA 4EZ9A 4K4TA 2Y1JA 4H4MA 2EX3A 4R0EA 4FBUA 2GC8A 3CJ2A 1S0NA 3UIQA 3QGGA 4OGEA 1FKPB 4DSFA 4ELTA 4FK2A 4OVLA 3RB3A 4HUGA 4K4WA 1R0AB 4W5OA 4ZP7A 1TQLA 1HNVB 1BIZA 1RA7A 3CDUA 1OS5A 3HVWA 3QESA 1NK9A 1RYSA 1NJXA 1ZTWA 4DSKA 2V4RA 4O4GB 4NLYA 1IKYB 3DDKA 1EP4A 3FFIB 2XI3A 3A2FA 2ZE2A 3LAKA 1EXQA 1RT5B 2OPRB 4OKEA 5J2QB 4NRUA 4O3QA 2V4QA 4O5BA 4HKQA 4FJ5A 1MU2B 1T7PA 2FBYA 3VA0A 3RMDA 1JXLA 3WNGA 4DQQA 3TAEA 1JLQB 4M42A 1VSJA 3DLEB 2AGPA 3QNNA 3AVIA 1QAIA 3HP6A 3M8PB 4IFYB 2ASJA 4NCAA 4FCYA 1D0EA 3RR7A 5JUMA 3LPTA 3K5LA 4Z4FA 4IR1A 4ECTA 3VQ5A 5KFVA 1HPZA 4FS2A 3HJFA 3OHAA 1WNSA 1YVUA 4FJXA 3RRHA 3IRXB 2C2RA 2VG6A 4BDPA 1S6QB 3SZ2A 3MR5A 3ULDA 3CM6A 3SQ1A 3SPYA 4HCBA 5KT6A 4CJVA 1LW2A 3KLVA 1VSDA 4FM2A 4ECRA 4LQ3A 4PY5A 1KFSA 4XPEA 2E9TA 4F3OA 3LP1A 3PHEA 3H98A 3AVBA 2XY7A 1WN7A 4CEOA 3ZSVA 4KHQA 1J54A 5DG7A 5DQIA 2W42A 2D41A 4OGCA 4MIBA 1BQMA 3NGIA 2JEIA 2JEFA 1UA1A 3NF8A 3LZJA 1S97A 4RW7A 2R2SA 2GIQA 3KHGA 2HB5A 1RT3B 2X78A 1ASUA 3NL0A 3CDEA 2HAIA 3L8BA 1LWFB 4CFDA 3RAQA 2ASDA 4M3UA 3QYYA 1RNHA 5KGWA 4O0IA 2UVWA 4HCCA 1HRHA 3KK1B 2XCPA 1RTJB 3PW0A 1XI1A 3OHBA 3O3GA 4CHNA 3TAPA 3TR8A 3DI6B 2W8KA 4CGJA 4ED2A 2DFEA 4FJ7A 4DTMA 1JL1A 4DF4A 3V6KA 1HARA 3RBEA 2E4LA 2P1JA 1HQUB 4YFUA 4EP5A 3JSMB 3K5NA 4TQSA 4ZHRA 4LH5A 3OYLA 3QGIA 3VQCA 2KFZA 1YT3A 3GQCA 4Z4HA 2HNZB 1JLEA 3CFPA 5HRPA 4KRFA 2GUIA 2FJVA 3V81A 1NK4A 4LSNA 1KHVA 3O4QA 3ZT0A 1QS4A 4K4UA 2XI2A 5KFSA 1REVB 3ZCMA 5KFPA 4FJIA 4E7IA 1L3UA 4C8LA 4FK4A 4F4KA 1QUVA 2HHQA 4OPJA 3M8SA 3MXIA 1HNVA 4QPXA 4Y34A 5KFHA 3T1AA 4FVMA 4Q0BA 2GV9A 1GOBA 4F4YA 1ZTTA 1S9GA 2VG7B 3ISNC 2W7OA 1VK0A 3MXJA 4ZP6A 3G10A 3LP2A 2OPRA 1GX6A 4M3XA 1ZBIA 1T03B 3QEIA 4CJLA 2UVUA 4FLWA 2YNGA 1LAWA 2DFHA 3OYNA 1F21A 1UOCA 5KG4A 4W5TA 2AQ4A 2W9BA 3O3FA 3GV5B 3GILA 3KJVA 4WYWA 3TAQA 5F8LA 3WNFA 4N47A 1S1VA 3DLGA 3F73A 1RDCA 3OL9A 4DSIA 5F8NA 1FXXA 2B43A 1B9DA 3HVTB 4OLBA 1UWBB 5KFWA 4BDZA 4E7JA 4B3OA 5I3UB 5KG7A 1JLQA 3KMSA 4O3RA 3OYJA 4JUZA 2HHTA 3CM5A 1TKZA 3H40A 4W5RA 3DOLB 1NKCA 1TK8A 1S49A 1SV5A 4RW9A 2B6AA 2J6TA 2JC0A 2BANB 3AO4A 3I8DA 3CO9A 5KFOA 3MEEB 3ZT2A 4ELVA 3PJWA 4Q44A 4AHCA 1C1AA 2XO7A 3DLKA 5L9XA 4DWIA 2HHSA 4JLHA 1C0MA 2IC3A 3CWJA 2KQ2A 1NOZA 4MKBA 3CDWA 3B6PA 1TL3B 5KFDA 3QINA 1QAJA 1JLAB 4J9OA 5CY4A 1S9EB 2D3ZA 5HRSA 5KFUA 3K59A 3GIMA 3PW2A 1SKRA 3V1RA 5T14A 4QWCA 3VQAA 3K58A 5KFMA 4KI4A 3LP3A 3MEEA 3QEWA 3KLHA 4F4ZA 3LP0B 3MEGB 4CF9A 3KLEB 4H4OB 4KV8A 2R8KA 3AA3A 3KK2A 1N4LA 3GV8B 3LP2B 4ID1A 3AVJA 5FRMA 1HYSB 5KFBA 1JLAA 5KFXA 2HHUA 3NMAA 4NYNA 4F4WA 5CYQA 4MFBA 3KLGA 4YP3A 3QGHA 1KLNA 4J9MA 4DSEA 3C94A 3PW5A 2FJWA 5KTQA 1HNIA 4FM1A 3MEGA 4Q0BB 1U47A 3AVMA 4ZVGA 5KFLA 2ZD1B 1ITGA 2IM3A 3MEDB 4ZTFA 3IS9B 3OS1A 3HXMA 5J1EA 3H5SA 4NLQA 3V6HA 4CEEA 3HVRA 4YMEA 4LSNB 2IM0A 2W9BB 3SJJA 3M8PA 3AVCA 1RT7A 4LY7A 3OYKA 2HWIA 2A1SA 4ID5A 4JV2A 4BDYA 1NK0A 2HVIA 3PVXA 3LZIA 3N6LA 3DOLA 1EX4A 3HYFA 1LAVA 5KRTA 3H5UA 3M8QB 2QKBA 4I2PB 5C24B 2X6NA 3AO2A 1WAFA 1QTMA 5K14B 4Y2CA 3VQ7A 3Q8QB 2R2UA 3S9HA 2X6SA 1DTTA 2HNYB 3LWMA 4IFYA 1SV5B 4Z4GA 5DLFA 3RMAA 4FJHA 3AVGA 5C42B 2BQ3A 1UAXA 2IDOA 2YNIB 4Z4IA 3H59A 1IKVB 4QW8A 3I5CA 1KFDA 1BISA 4KSEB 2ALZA 3Q8RB 2UVVA 1IH7A 2ITGA 1Q9YA 3AO5A 2YNGB 3Q8SB 4ZMMA 1NKBA 1KTQA 5DK5A 4ZVHA 1D1UA 5L1KA 2YHAA 4B08A 3SNNA 4PA1A 2O4IA 2XC9A 2FLPA 1KSPA 2WOMA 3MFIA 4KTZA 3NH2A 4AHTA 2R7YA 4KKOA 3LWLA 1S1TB 5FROA 2B6AB 4U7CA 4NYFA 3BJYA 1JLBA 5FDLA 1LV5A 1A5XA 1TL1A 4XIUA 1TKTA 1QHTA 4CJKA 1SUQB 4ICLA 2BDPA 5J2QA 4CCHA 3H5YA 2EC0A 4M3YA 2A1RA 1EP4B 3DRPB 4WZQA 3RMCA 4G1QB 1LWCB 2WRMA 1LWEA 2D7SA 3SQ0A 2JEGA 1J9AA 4KE5A 3KK1A 5D3GA 3DLEA 3MEDA 4Q5VA 4I7FB 4OPKA 4CIEA 2ASLA 1K6YA 3AA2A 4DL3A 4DU3A 4KFBB 1K1SA 4CK1A 4FBTA 4KHNA 5KG2A 1TK0A 3OVNA 2O4GA 3ASMA 3OYEA 2OPQB 2C2DA 4KREA 3MECA 4DQSA 4F2RA 3ITHA 4EBEA 4ID5B 4HYKA 3OL7A 3KK2B 1S1XB 3V9ZA 4IQXA 4O0JA 3LANA 4HUEA 1XHZA 4KHUA 4EYHB 3RAXA 3PW7A 4BWMA 2WCXA 4NLOA 3V9UA 3CQ8A 1JLGA 2WB4A 4CJPA 1IM4A 3RWUA 4PQUA 4KAZA 4KB0A 4CEFA 4FJNA 2HNDB 4KHRA 5EWEA 3DOKA 2V0NA 1RBUA 2FBXA 2G8UA 4C8KA 3MECB 4IKFA 1FKOB 2Y1IA 2VG6B 4RNHA 2FJXA 2EHGA 1C1BA 1WSIA 4FZXC 5HLFA 4QWDA 4ECQA 3NFAA 4B8CA 4URSA 3NBPA 3K5OA 1QSYA 3ITHB 2D0BA 3OJUA 4H8KA 3NAHA 1J5OA 2R2TA 2QKKA 2BR0A 2E6LA 3F9KA 1WLJA 4CJEA 4I2QB 3L3UA 2BRKA 1VRTB 4TQRA 2IA6A 3I0SA 1S0MA 2G8IA 1JLCA 2P5GA 1CXQA 2I1RA 4RNNA 4CERA 1Q9XA 3RB0A 3ZSOA 1D8YA 2DY4A 2BRLA 4ED0A 2WHOA 4CJRA 1DLOB 1T8EA 1J5OB 1HQEA 5F8JA 3BQ1A 1WSGA 4G1QA 1CZBA 2OPPB 1IKVA 1VSIA 3MF5A 1KVCA 3H4BA 2OZMA 1U04A 4ZPBA 2YKMA 4IH7A 2R8IA 1VSLA 4NCGA 2FVCA 2AJQA 4CESA 1HQUA 4RUAA 3H08A 3MAQA 3HM9A 4CJWA 3BGRA 1JLFA 4CJ3A 3ZT1A 3OY9A 3PV8A 2WONA 5HP1A 2WTFA 3TVKA 2AX1A 4IG3B 3RTVA 1XR5A 3GYNA 4DQIA 2ZKUA 4M95A 4K4XA 4ECXA 5CYMA 3E01B 4DLEA 1RBTA 3KLGB 4JV0A 4FJMA 4URGA 2XY6A 3RB6A 4Z0UA 2ETJA 3KHHA 1TKTB 4AILC 4RW4B 2FVRA 3UPFA 4QAGA 4CEDA 1W9HA 4CJFA 1BI4B 4AHSA 4GVMA 2YHBA 5J1EB 4G3IA 3NAEA 1X9SA 4E7HA 4HTUA 1W25A 4YQWA 3AA5X 1NK7A 4IRKA 1S1WB 3VQ4A 2JC1A 3Q8PB 4ED3A 1KHWA 2R2RA 1ASWA 4O44B 3VQSA 3O3HA 4NLTA 3H4DA 1NOYA 3M8QA 1C1CA 1JL2A 4AHUA 4MFBB 3I5BA 1CLQA 4PUOA 4KHYA 4Y3CA 5KG1A 2FLLA 5I3UA 4J9QA 1D9FA 3IGVA 4B9NA 3V4IB 3ZSRA 1UWBA 4CEAA 5L1IA 1DTQB 4NLDA 4FM0A 3NHGA 4URQU 4DMNA 4DFMA 1NK5A 3S3MA 2JLEA 2YNFB 4EBCA 2E9ZA 2R8GA 4DL2A 2RKIA 4O3NA 4PUOB 5KFFA 2G8HA 4WZMA 3CYMA 3KLFA 2CKWA 4ZPDA 2ATLA 2ZD1A 4FLZA 4IG0A 1U48A 3HVAA 5I42B 3FSIA 4QCLA 1RDBA 4FW2A 1W0HA 3ZT3A 3M9MB 4WE1A 1SH3A 4ZP9A 1SH0A 4KHMA 4ED1A 5C25A 2XRIA 4ZPCA 3PO5A 1S5JA 1LW0A 4CJUA 1UA0A 3RB4A 2R8JA 2D3UA 3NF6A 4CEBA 3QIDA 5DGBA 5HLFB 3KD5E 3NF9A 4DG1A 5KFAA 1TKXB 4FJLA 1C0UA 3NCIA 4K4ZA 3HPHA 4RNFA 2E9RX 4R8UA 3M8RA 3E01A 3IRXA 4B9TA 2HHXA 1WSJA 1JLFB 3HVTA 1JLEB 4J2BA 2W9CB 1S0OA 1VRUA 5KFEA 4CGHA 3H5XA 3G6XA 3BSOA 1U09A 4CFCA 4LD0A 2D0AA 3BSNA 4NLRA 5KFNA 4E0DA 1WSEA 1SL1A 3TANA 4JRQA 1QSLA 3SUQA 1XR6A 2W9CA 1BL3A 2IM2A 2G8VA 5L1JA 4CJ4A 2I5JA 1L3SA 3PR5B 1WSFA 1BIUA 4M3WA 1RTDB 4DS4A 2WONB 5HP1B 3KIOA 3NGZA 4YR2A 5DGAA 4KTQA 4QWEA 3TAFA 3D45A 3EZUA 3ALYA 1IKXB 1CZ9A 1LWEB 3V4IA 4JV1A 3VQQA 4DQPA 5J2PB 4FLXA 1LWCA 2XWYA 3PR4A 5KFCA 4IFVA 1S6PB 1SH2A 3KKRA 2J6SA 3MR3A 3NKYA 1NNDA 4RW4A 4QWBA 4E7KA 1U49A 2D0CA 3NBPB 3NH1A 4KFBA 4DTJA 4CHZA 4EO6A 3EY1A 1L3VA 4HVJA 5KFTA 4EO8A 5J2MA 2YNIA 4ELUA 1RBSA 4ZHRB 4J9NA 4CK2A 2PY5A 1TVRB 3MFHA 4TN2A 4DU1A 4E1NA 3I0SB 1Z25A 2V9WA 2YNHB 1IO2A 3SCXA 1S1XA 4F8RA 2KFNA 3U3YA 2FC0A 1JLGB 2HW3A 4DSLA 5HRRA 1DTQA 1KVBA 2ZQBA 4CFBA 2IAJB 4WFZA 5KT7A 2Q3SA 2KZZA 1HYVA 3VQ6A 4DTOA 2ILYA 3KOAA 4DF8A 4DTUA 1BQNA 5EUHA 3PJXA 4N5SA 1RTHA 3N6MA 2DPIA 3NH0A 4CEZA 4CGFA 2IC3B 1BQMB 2LSNA 4DL4A 4HUFA 2RKIB 4ECUA 5FDLB 4CF0A 3PW4A 2QXFA 4ED8A 4O55A 1N6QB 2Z1JA 4DLGA 3QEVA 2PZSA 5KFKA 3FQKA 3JSMA 3BDPA 4I2QA 4DL5A 3AVFA 4ED7A 5EWGA 3OL8A 1EETA 1JLCB 3TAGA 4CHYA 3DRPA 3C6TB 3DLBA 3QETA 3V1OA 1L5UA 3OYAA 1GOCA 3FQLA 4KB7A 1RTJA 4ZVEA 4DS5A 1LW2B 5KT3A 1I6JA 3DYAA 5EDWA 4C8OA 4B9UA 4MK7A 2FVPA 4YR3A 3FFIA 1HYSA 3PZPA 3OYDA 3UQSA 2Z1HA 4FZZA 1RT5A 1YTAA 1ZBLA 3DRRB 1N5YA 3C6TA 2F8SA 1NHVA 2BQRA 3OYIA 3MXMA 1WSHA 1Y97A 4MQ3A 3KTQA 3OL6A 2FBTA 3IS9A 3QEXA 4ECSA 3VQDA 3BSCA 4FZYA 4NYZA 3KD1E 4BE1A 1NJYA 4RW6A 2PYJA 3P5JA 4BE0A 4DQRA 4J9LA 1RCHA 1RBRA 2VA2A 3DYAB 3NAIA 4CF2A 1L3TA 1SL2A 1KLMA 3OJSA 4KPYA 1TP7A 3L2UA 1VSKA 5F9NA 3RMBA 1GX5A 4ECZA 4CE9A 4R5PA 4RW7B 3C6UB 4KTWA 5EWFA 2F8TA 4I9QA 4MH8A 5E41A 1VSHA 1WAJA 3CFOA 3RRGA 4NZ0A 4AH9A 4BACA 4F50A 4CF8A 4KHWA 4M3ZA 2YNHA 4E19A 4CJ5A 3BREA 1KCFA 4JS5A 2GIRA 5I42A 1CSJA 1S6QA 2VA3A 4FLVA 3P1GA 1G15A 4DFPA 2W7PA 1GOAA 3SUOA 5CYQB 3VQPA 3SV4A 3OYBA 3AVAA 4Y1CA 1KRPA 3V9XA 3OSPA 4CFAA 5JS2A 1RT6A 4TY8B 1LW0B 3ZSXA 1NK8A 4E7LA 3EYZA 3TABA 4IOBA 2FBVA 4RNOA 3D28A 2QK9A 3DMJA 1XHXA 2C2EA 4FS1A 5KG3A 3FDSA 1ZYQA 4CF1A 2WOMB 4H54A 3L2QA 4W5NA 3ZSZA 4QWAA 1HJRA 4F2SA 5HROA 4E89A 4IH6A 3GIJA 3UDLA 1S9EA 1RT2B 5KFGA 3PUFA 1S1TA 3SV3A 2RN2A 1VSFA 5SWMA 3TAMA 3MTKA 4CHOA 1I39A 1TL1B 3I5AA 2VWKA 2IBKA 3AVNA 2HMIA 4IKAA 4CEQA 3K5MA 4KI6A 4K8ZA 3AO3A 5C25B 3TQ1A 4XPCA 4W5QA 3TARA 2AX0A 4CJQA 5C24A 4CGGA 3HHKA 5K14A 3CFRA 3UR0A 3QZ7A 4RU9A 4EP4A 3EPGA 4Q8FA 5F8HA 2W9AA 4TYBA 4DSJA 3GIIA
chains in the Genus database with same CATH superfamily
2V63A 1RJJA 2KT5A 2EW9A 4A8OA 2JJ4D 4CZLA 1RWPB 2JGUA 3EXCX 4E98A 2DPJA 3GDQA 3TUZC 4IFVB 2OH2A 1FX2A 5C5JA 1BCOA 4CZGA 2IRUA 3CCRN 2MZ1A 5BYQA 3IM8A 3U3GA 1HW9A 1ZM4A 4MJKA 1Y9OA 3QAEA 4QW9A 3LPUA 4H03B 4CTAB 2NR0A 3QICA 1HWKA 1PAEX 4Z2XA 4TY9A 1RYRA 4WK1A 1T94A 4DV7K 2RF2B 2KU7A 3QNWB 4RW6B 4JI0F 5GADP 3VQEA 4QR1A 1YITN 5D8HB 2HFSA 4UY8O 4LF5J 1C4CA 3L3CA 1YJ7A 4JRPA 2QO3A 1RA6A 2V4JB 5HI7A 3FEYB 3W2VA 4OZLA 2YJEA 3QBXA 1Q8LA 3DMJB 5AQUA 4OYPA 3D0HE 4IO9Q 4ZCMA 7FDRA 4CGDA 2ATQA 3DJCA 2GJFA 2YKNB 1HD0A 5THWA 4BRQA 4JKAA 1VC5A 4JI4J 1IR0A 2ZH6A 3VZHA 1TZ0A 4KO0A 3EKUA 1TKXA 4DV7F 4AHVA 4JI5K 4NXMK 2ZHBA 1DURA 1S48A 2QMUB 1D3WA 1F2GA 1JK9B 2EXUA 2QLWA 4X62J 3AA9A 3TJ8A 1MMNA 4HT5A 1TAQA 2FVQA 2B9EA 2G8KA 5B0GA 4OI3A 3MI7X 4FWMA 2JL9A 2F63A 4I64A 3ISND 1Y3KA 2IS3A 3U1MA 5A8RB 2AWZA 5ELZA 3PHTA 2J7WA 2ILZA 5GVQA 4FYVB 3N4PA 2DJWA 3THYB 1BU6O 4ZTJA 1TFWA 3JS6A 1KVKA 3V81B 3JXOA 3GONA 1KLMB 1RT2A 2KG1A 2HQGA 1HNIB 4P71A 1RT4B 2JFDA 2GO8A 2AHOB 3SJHA 5IZHA 2V94A 2AP6A 2Q1NA 2OPQA 3J7A1 4X4SA 4O44A 4ZN1A 3VN5A 1KXPA 4DTSA 4KBIA 4WFXA 4C8MA 3VZIA 3WIVA 2EFQA 1D09B 1VBZA 4LR8A 1FNOA 5IS2A 1IR1A 1SC3B 4ERDA 1OVYA 2DEIA 2YKMB 3KJVB 5DDQC 1W7AA 1QQMA 4JS4A 2CJXB 2OTJN 2YKAA 4D3GA 2V52B 1VGYA 1NZAA 3FMBA 4WFAQ 3CCUS 1TGOA 4M3TA 2CPZA 1RWXB 1FKAF 4FF3A 1RDWX 4M45A 4E3SA 2DRBA 1X5SA 3DDIA 3BYPA 1JKHB 1FNXH 4I7FA 1H7WA 1JQGA 4LF6K 3NWGA 3ENQA 4O3SA 3JTNA 1R0AA 4LF2A 2NUBA 1WSRA 4X2BA 2MKYA 3KG0A 5GINA 2IMWP 1Z2LA 5EVZA 3L4IA 3H45C 3L3VA 5CZVA 2XGQA 1DLOA 4CM2A 5HMYA 2WB1D 4RCHA 8AT1B 3HD1A 4K5SA 3O4NA 1HQEB 2Z2YB 2KVIA 4DPUA 2ZE2B 2V4JA 4YUDA 1NU0A 3S6EA 3QB0A 4GC6A 3UDEA 2XY8A 3DRSB 4C0BA 3THYA 2ZH5A 2F8EX 3HT0A 2AJ2A 2OYQA 1Z4UA 4NCGB 5HQ8A 3O9RA 3V9SA 4CVNE 1M5PC 1TV6A 4FYDA 2JEJA 3X1LB 4FK0A 3RSEA 4B8AB 4BRGA 3HI9A 1BQXA 2X1AA 5IT9Y 4BRKA 4RG8A 3KLEA 3UO0A 4LJMA 1FD2A 2ZGZA 4B3MK 2IRXA 2ZNZA 2ZZMA 2HNYA 2ZJPL 2D9PA 4KRWA 1JX4A 2RUGA 2BOAA 2OO4A 4L76A 1FDBA 2C28A 1IBKJ 4DMZA 1W2BM 3U9DA 3E1YA 3IGNA 2ZJQL 1D8ZA 1RWVB 2KYXA 2UUAF 5IQQA 2CQCA 1WC4A 3LM9A 4IEIA 1RCXB 1U25A 5AQWA 4CZEA 5JVGQ 3WXJA 1P6TA 1IQZA 4I67A 1Q8IA 2NRTA 4YN3B 2D74B 5DLGA 4H5NA 1XEZA 2J8SA 3R6GB 4LBHA 2HSEB 2G8FA 1R27B 2XYGB 1ZZNA 2C3MA 5KQ8A 1R59O 1LFPA 4ES1A 1U45A 2M2BA 1RT3A 2MZSA 1VQ9N 1OQ6A 3N28A 1NDKA 1VDHA 1ZAXA 1IWAA 5FLXU 1WC1A 3LA0A 2XB2D 3C95A 3DLGB 1S10A 4B1YB 3FBFA 3J7YU 4GV9A 1KVAA 1PAUB 4DV5J 4O3PA 2NZCA 1UJ6A 3UN3A 2GTDA 1HPMA 3IWNC 3KLHB 3RW6A 1AUSL 2QE5A 1LFWA 5SZTA 4CIGA 4M41A 3TTCA 1MWYA 3T3FA 4FKYA 2VFTA 2FSKA 3UR3C 2NCKL 3T5LA 1XMQJ 3NNAA 3ZSYA 1VJWA 4MO5A 4FOEA 3HO1A 1Q86O 5GMDA 1MN7A 3MPUB 4N76A 3TQEA 5E5NA 3CCJN 4PL8A 4FXWA 4LSLA 3QBCA 1VQNS 1MWMA 4JV5K 3FE1A 1RDRA 1PBAA 2E2NA 3I0RA 3GTYX 2C2KB 3R7BB 1OO0B 3VAHA 3TVYA 2DD8S 2BJ3A 4QS9A 1Y10A 1WC6A 1SXLA 4JHDA 4PZVA 3TI0A 2IVOA 4OHZA 1VQNN 1X9MA 2I5JB 4M8LA 1FJGF 1ZS6A 2E88A 4BG8A 1EO1A 1PYTA 4DUZJ 2CGLA 3SQGA 3M2RA 5HBMA 5MLCV 3GU0A 1IKYA 3N6NA 4OYOA 2W01A 1N33F 5LMNF 4FVCA 2HVZA 4JV5F 3P49B 2HG4A 1VQYA 3OBIA 1T03A 4EZ6A 4RW8B 1HA1A 3O2IA 2O8CB 3OXGA 3PIOL 1S9GB 3JTOA 2QI2A 3DC2A 2G8WA 4HI1A 1OJ4A 3HZEA 3LOUA 3W8PA 1UAWA 4U67Q 3IG1A 4DV3K 2CZVC 3VAGA 2ZNYA 4HHTA 4TKTA 4O3OA 3BR9A 4M94A 3I55N 4UOGA 5C2GA 2ZH9A 3PKYA 5KOWA 6AT1B 1RT6B 4TY8A 3DXKB 3DXSX 2W8LA 1I94J 5HROB 4IWVA 3I9V9 2VH7A 2WVCA 3R5BA 3GIKA 1VMBA 1QSSA 1RHJB 4GY2B 1T3NA 1J5EF 3N01A 2H4YB 2VBZA 3FZMA 1HQ2A 4TU7A 2IM1A 1ASVA 3R2DJ 2UVRA 3FR0A 1M1KT 3Q22A 4WFBQ 1TKDA 4AL6A 3D4JA 1FRIA 1LWFA 3GG4A 1H2TZ 1TV6B 3ZSQA 1HKBA 2JLFA 2EX3A 4M5HA 3CJ2A 2MEWA 3UIQA 3J80Y 3AARA 3DNCA 3AGKA 1RKIA 4LR7A 1QZ6A 4ZP7A 1VQ6S 2FHMA 2RS8A 1NK9A 1NJXA 2DNYA 1P27B 4DSKA 5GADI 1IKYB 4F0HA 1TUVA 2FZGB 1Y5NB 2ZM6F 2ZE2A 5DZ6A 3WX8A 2ZJQQ 5LMUK 4JI7F 5AFUH 1XNRF 4O5BA 2XMTA 4FJ5A 1MU2B 1FD8A 2FBYA 1M5SA 1RLDA 3VA0A 3GYXB 1PYOB 2K2PA 3K17A 3ILIA 4M42A 1VSJA 2P9GA 3M30B 3AVIA 1IUJA 3FGUA 3M8PB 4B3SF 3G8QA 2ASJA 1RXOB 4JD2A 4M5DA 4A61A 2B56A 2VQEF 4IR1A 3H0PA 4NZ7A 2ITMA 3VQ5A 5KFVA 3CXCM 1WNSA 2A1BA 1IR2A 4CO5A 3RRHA 4Y2KA 3IRXB 1S6QB 1ZA2B 3MR5A 1KAXA 5KT6A 2FY8A 4CZCA 2CZ4A 3KLVA 1VSDA 2RHQB 3BBCA 4LQ3A 2D3OR 4PY5A 2OHDA 1KFSA 1VRQC 2E9TA 3NNCA 3VERA 3LP1A 4K43A 3KUGA 1N32J 2E66A 2KRBA 2Y0SD 2EWSA 4DV0K 5FIIA 2F1FA 1WN7A 2R7OA 3QFPA 5HL7L 4KHQA 2W42A 1QAXA 2DCLA 1UVIA 4OGCA 1VC0A 1K9MO 2O8CA 2JEIA 2JEFA 3NF8A 1BOTO 2M8HA 3M32B 4LF6J 1RT3B 4B1WB 1PJ6A 1ASUA 5IWAJ 3CDEA 1WC0A 1LWFB 5DZ7A 2RNEA 4DZDA 2QEXS 4HCCA 2VJUA 3KK1B 1RTJB 4LBIA 2QA4N 1XI1A 3TAPA 3DI6B 3CMEN 4CGJA 2DFEA 1XQIA 4DTMA 2J0SD 2WFBA 4DF4A 4QS8A 2P1JA 2D0PA 3N9UC 3JSMB 3PJ9A 3ISZA 1WOQA 3TX0A 3K5NA 1NWKA 4ZHRA 4CT9A 3AODA 3R9PA 4AM7A 3GQCA 2MLZA 2CDQA 3AXMA 2HSTA 1JLEA 3CFPA 3FZLA 3D6HB 2HOEA 2F9TA 4JI2K 4LF6F 2KKHA 3H90A 1B64A 1REVB 4YOUA 3P4IA 4YHHJ 4FJIA 3G6EN 2MQ8A 4F4KA 1QUVA 4LIRA 4OPJA 4BGBA 5AZJB 3MXIA 1HNVA 3QQCD 1BUPA 4WU3A 1SIZA 2QLXA 4Y0WA 4J90A 1XNQF 2W2OP 2GV9A 1GOBA 1S9GA 4FXVA 2F3JA 1RI7A 2QSWA 3MDFA 1PSDA 3MMBA 1F60B 2R4FA 3TUPA 2YHWA 2Q3PA 1GXLA 2OPRA 1GX6A 4B3MF 3ZETB 3MAHA 1WOPA 2DGSA 3QEIA 2ZUAA 3I4PA 3OYNA 1RAFB 1UOCA 5KG4A 1TL7A 3O3FA 2AEFA 2O8FB 4USVA 2UXCK 1RDUA 1S1VA 5D15A 5GMKa 1RDCA 3OL9A 3HVTB 2DGQA 1H0HB 3W64A 5I3UB 3KMSA 2QM1A 3WXLA 2APOA 2Q1LA 1TKZA 3ZZTA 1KVIA 1NKCA 1SV5A 4A8KA 4CD1A 1KONA 1R0CB 3TTDA 4KR0B 5KFOA 2XS2A 3ZT2A 2HRYA 3UW1A 4GVBA 2MYFA 1S77D 2VU5A 3MAAA 3CW2C 1HWUA 1J5EJ 4DWIA 3POTA 2CWKA 5CQGA 4FPRA 1F9HA 3CJKB 1NOZA 1FCAA 2J9CA 1RAAB 3QINA 3BPSP 5A0YA 1Y3JA 4LF5K 3ZTOA 3K59A 3ZZOA 3CMAS 5I9EB 1FRKA 3VQAA 1FERA 1NO8A 3WC0A 4CF9A 1Q5YA 4KV8A 3LP2B 1JLAA 3ZEUA 4H5WA 2OEKA 3QGHA 2XNQA 3NG8A 4J9MA 4C3KA 3PW5A 1HNIA 3QSYB 3K8WA 4Q0BB 4DZ6A 3H6EA 1U47A 1FFSB 1HKGA 3N4WA 5KFLA 2ZD1B 3MEDB 4ZTFA 1WORA 2BV3A 5J1EA 4IOCL 4ILGB 4M5JA 5A8WB 2IM0A 2W9BB 3SJJA 4X66F 2CPJA 3H1VX 4CDIA 5B0FA 4DR1F 4OHVA 3ILJA 3H8YA 4K0KF 5DM6Q 3DOLA 1EX4A 3L6QA 1TUYA 4EIAA 4AL7A 4WKRA 2X6NA 5CHIA 1QTMA 1WAFA 5H9EJ 3I6PA 1Y0HA 2X6SA 1DTTA 1MMDA 3G82B 2OFGX 1NGDA 1SV5B 2UXDJ 5DLFA 2GGPB 1X4CA 3AVGA 2DNGA 2BQ3A 1UAXA 2IDOA 4OPHA 2F4VF 1IKVB 3FBCA 4EAHD 1KFDA 3LDPA 4PG7A 4KSEB 4X66K 4DUZK 3R3TA 1NH8A 2ITGA 1Q9YA 2G0JA 3JSBA 4MTPA 5F1XA 2ROPA 4OYZA 1T9UA 1NDPA 2YHAA 3SNNA 1QLNA 5B0AA 4OJ3A 5KPZA 2E5JA 4I4BA 1YBAA 2QA1A 4LF8K 4HHUA 1KSPA 4KTZA 2C42A 2C3PA 4KKOA 4LFAF 3LWLA 4J91A 4KIAA 3TEGA 4LVNP 2ZC4A 1YJTA 4RTFD 1VQ8S 1SUQB 2HFVA 3FBEA 5J2QA 2F5GA 2DISA 4KC5A 3HHLA 2Z2LA 2EC0A 4M3YA 4JYAK 1LWCB 4XDDA 3OXLA 1UVKA 3VAIA 3H3NO 5HMZA 4ED5A 4KE5A 4AUKA 5LY3A 1S12A 2BJEA 2CVIA 4Q5VA 4OPKA 4CIEA 4AYBD 2KYZA 4KFBB 1REGX 3NNHA 3BBBA 2PMWA 4KREA 3R1LA 2DGTA 4EBEA 3G71N 5BPNA 4ID5B 5LSOA 1N36J 5C12A 1YJNN 3L7PA 2DH8A 1N5SA 4JI3F 4BRDA 4K25A 1R31A 4CO0A 1FO1A 4FPBA 4FWRA 2VICA 1SB6A 4HHHA 4EYHB 3PW7A 2XMWA 1NSKL 3SIPB 2WCXA 3V9UA 3CQ8A 2OD4A 2QFJA 4PQUA 4KAZA 2I7NA 2UV8G 4KHRA 2FDNA 4ANDA 3MPDA 1WEZA 2CPXA 1UEVA 1FKOB 2WW4A 2Z57B 4ANEA 2VG6B 4RNHA 2FJXA 5GADU 1VQSA 3PYDA 1T9VA 1C1BA 3BZKA 4FZXC 4ECQA 3NFAA 2Z4PA 4OI2A 4CZMA 2BR0A 3TU5A 1NLVA 4CERA 3TZYA 1WKKA 4ED0A 2QC3A 4CJRA 1T8EA 2BMBA 4K0KJ 5LSLA 2LDIA 3GFYA 3IM9A 1WSGA 2ATCB 3P45B 3I82A 1NM1A 4DB3A 1WC5A 1S99A 1K73T 2YKMA 4IH7A 1QVGR 4CZHA 2IFXA 3M7VA 2OIHA 4ENOA 1KOOA 2BJDA 3TVKA 2BTFA 4HHJA 1F3FA 3GYNA 5GMEA 4DUYJ 4IQMA 4RJVA 4NXNK 4K4XA 5C15A 5E2QA 3ILOA 4WFAL 1JJHA 1SJ3P 1S3XA 1P1LA 1TUUA 3MM5B 5ETPA 3CE8A 1TKTB 4N7TA 1VCTA 4B1ZA 1HI0P 1B7FA 1BMQB 3Q83A 1W9HA 4G6VB 4C6AA 3C14B 3DOMB 2CH6A 2B9XA 1BI4B 2AYEA 4GVMA 1NGAA 3C19A 2XEXA 4G3IA 2HBZB 1X9SA 4F3QA 3KWIA 4HTUA 1H2VZ 1NK7A 4P2SA 4RUBA 2R2RA 1Q4RA 2DNLA 1GMUA 3FZFA 3VEXA 3O3HA 4F02A 2GW8A 2DHSA 3H4DA 2OEMA 2Q43A 2OJ3A 4AHUA 4MLEA 2B0GA 4R25A 3LO3A 4J9QA 2IYIA 1UWBA 3AHPA 1WF2A 4BR7A 2LXFA 5IT0A 4OPAA 1KAZA 1FRLA 4JI7J 5F2RA 3I9ZA 2RS2A 2E9ZA 1XMQF 4QZVB 1SVDA 1H1VA 4PUOB 2CJBA 3KLFA 2CKWA 3WZ0A 3I8BA 3GWCA 2DCUB 2DNOA 2R7RA 1CC7A 2MKKA 1ICEB 3EX7B 2UUBF 1O5JA 3SAGA 4DN0A 5DDOC 3M9MB 4RX6A 1FT8A 3GYGA 4HACB 2M9KA 3M6WA 3O1LA 2XRIA 1LW0A 2VBWA 1UA0A 2D3UA 2A3JA 3NF6A 1IBMF 3ZNUA 2BACA 1HUXA 2CNOB 1HLWA 2ZH4A 3C16B 4CO1A 4FJLA 2MDAA 4DG1A 1C0UA 4P52A 5CD4A 4R8UA 1OPZA 4B9TA 3VPZA 2HHXA 2QFIA 3RAMA 1WSJA 1G4CA 3MWBA 3VALA 4A2AA 3LQVA 3BSOA 4BC4A 4FYWB 2FJBB 3GB0A 2D0AA 3BSNA 1SPBP 1ZM3A 2W2PP 1WSEA 1QZ5A 1F0XA 5I3PA 3R5GA 4GV6A 4JRQA 3A8IA 2CQDA 1AZSB 1IBMK 1RWOB 3EJMA 2IY5B 3RU0A 4JI5J 3BZCA 1BL3A 2IM2A 2P5VA 1A6LA 3V5RA 2D9OA 2WONB 4CH7A 1IBLJ 1HNXF 2B4UA 4YR2A 5DGAA 4KTQA 2ZBCA 3JAMU 2ASPA 3CCVS 2IVNA 4WFBL 3ALYA 2QWLA 3VQQA 4DQPA 5J2PB 5C2FA 1LWCA 2XTJP 2P9PA 1GAOA 5KFCA 1A0OB 1S6PB 4GKJJ 3ZLJA 2HHPA 3AAWB 4LF1A 3CC2N 2XSFA 1N5QA 4QWBA 4RW4A 3WEEA 2D0CA 1XMOF 4KFBA 2HAFA 2CQGA 1NMEB 1T6DA 3KWMA 3UCUP 1QVFR 4EO8A 4XH5A 3SBGA 2HF4A 4ZHRB 5D4OA 2Y3YA 4CK2A 3MFHA 2FJAB 1GK8A 2YNHB 2YX7A 3L7OA 3SCXA 1S1XA 1HBOA 3FZBA 2KFNA 1FJGK 1VC6A 2FC0A 4DR1K 4AFFA 5L46A 2HW3A 2ASMA 5M1OA 3F5TA 5HRRA 1DTQA 2OMLA 4WFZA 1Y00A 5M2RA 2UUCF 2NLXA 2Q3SA 3DXBA 2F4VJ 3VQ6A 2ILYA 4DTUA 5LMNK 3JXUA 1BQNA 5IT9U 3CCQS 5CD4H 5HK4A 5E0OA 2H4WB 4HUFA 2PFFB 2Z1JA 2PZSA 2QLJB 5KFKA 2L08A 3W7BA 4I2QA 2FD2A 2K7JA 5EWGA 2RIJA 2OAUA 4BVPA 3CJQA 3C6TB 1OVQA 3MURP 5JMNA 2E5HA 3QFHA 1I6JA 3DYAA 5EDWA 4B9UA 1H72C 2GMJA 4YR3A 2IRYA 4K2XA 3D2WA 4ZKAA 5G0RB 1ZBLA 2E20A 3QAUA 1LKZA 1R89A 4ED4A 4MQ3A 3UFCX 3KTQA 3BSCA 3VMFB 3TEHB 1I94K 3MM6A 2X3DA 4BE1A 4DQRA 3NAIA 4QR2A 4CF2A 1ATSA 4HWIA 5AJ3K 1F9FA 1KLMA 4ILJA 4KPYA 1TP7A 3L2UA 2AV5A 3O9UA 1GX5A 3QMLA 4GKKJ 4ECZA 3BGUA 4R5PA 3MPVA 4DHYA 4I9QA 4RWXA 1TYQB 5E41A 1VSHA 2GJIA 3KG4A 3RRGA 3Q8UA 4AH9A 4BACA 4JI1K 4F50A 4CF8A 4JI8K 4M3ZA 2YNHA 3L4BC 2B51A 1KCFA 4YDDB 2HBQB 3V4MA 5LMUJ 3QRPA 2VA3A 4FLVA 1G3OA 4LSZB 1B0VA 2R7XA 1YDLA 3VQPA 4V1Ak 5E3PA 1VQOS 1BWVA 3DFEA 3Q7BA 4JI7K 3OSPA 3MCSA 5LOQA 1LW0B 2E5LF 2VD3A 2HQCA 4OJHA 3C15A 4USWA 2NXNA 3EYZA 3TABA 3B8HA 4IOBA 3TOQA 3D28A 2QK9A 1DZ5A 3FDSA 1RAGB 1KEKA 5DO2A 1NDCA 2NZTA 2WOMB 3HSZA 3BDEA 3Q2TC 1U0SA 1TR0A 2BX6A 4BR2A 4F2SA 4BRHA 3GIJA 3OUYA 2XNRA 5CA5A 4KH1B 3ZTSA 2FSJA 2LDYA 3R1XA 1VSFA 2F7VA 3ZO7A 1UP1A 3KJFB 3N4QA 3TR5A 1I39A 4DV1J 2PA3A 4IKAA 4CEQA 2O67A 3K5MA 4LVOP 1JCGA 3U7JA 3AH6A 1NLKL 4E1JA 3M2UA 4CGGA 4NXNJ 5K14A 1FXDA 1ROFA 2ZBQA 4EP4A 1DAXA 3EPGA 4NLCA 1XBWA 4Q8FA 3BZQA 2R7TA 1WKJA 4H0PA 1OSDA 4DV5K 3R9LA 1WF1A 1YJRA 4DDFA 3GLJA 5A8WA 3MUMP 5HN0A 3J8AA 3QLHA 2BE2B 3OR2A 1I1GA 5LL6Z 2YTCA 2DNZA 2VFUA 2RPIA 3QO9A 4Y2IA 3ZETA 3K0SA 4WQ5C 4BRCA 4Q2MA 3KLIA 3CCES 4DQ8A 1VRUB 1VSEA 1RBLA 1U4BA 1RBOB 1XR7A 3FFKB 3U1NA 2O8DA 2Z0GA 1KQSR 2EVZA 1HR0F 1S5ZA 1U26A 3HBTA 1B9FA 3DOKB 3KHRA 3MUVP 1FRMA 1RTIA 4OKJA 4DV5F 3SQ4A 4RBVA 1G6BA 3G0ZA 3S8SA 3WQUA 4BC3A 3CCEN 2ZBRA 5J2PA 1NB7A 3UN5A 5KG6A 3U6FA 2KJWA 2UXDK 2VPXB 3J7AN 2P6SA 2NXEA 2H5EA 5IM0A 4FJKA 2XS7A 1YZ7A 2G13A 5H9EK 1FDNA 3TWHA 1HR0J 4J9KA 1CC8A 4MLHA 1HR0K 3ENWA 1S6PA 3ZNJ1 2NYIA 3OS2A 3TVZA 3WNEA 3DXMB 2OP5A 1XMQK 4MK9A 1UVNA 3CJSA 2ZITA 1YF5L 2AGOA 3S3OA 3SPZA 5KT2A 1X5TA 1ILYA 3L2VA 4D3HA 1U0HB 1MU2A 3MMAA 2VUGA 2VB6A 3P83D 2B8QA 4OYAA 1XWLA 2L41A 2VWJA 5CE3A 4Q7AA 3A8YA 3LTOA 4MK8A 3D0PA 4JAXA 1QE1B 4JD2B 4S0MA 4IBNA 4DR2K 5FRNA 1J6ZA 1CJTA 3OTOF 3KKSA 3LL3A 4N56A 4EEYA 1UW9A 3D5MA 1W2BR 1XNQJ 3DKDA 1ZH5A 4RZRA 1NHKL 5B09A 1V6HA 1WOOA 1FK9B 2G4BA 1FFWB 1CJVA 3L0QA 5ETOA 3A13A 3AVHA 1F1BB 2MHNA 3SFGA 1N56A 5CHCB 3VGLA 3J7YI 2GZOA 3CPWR 3BGRB 2MPUA 5GAGI 2EK6A 3FC9A 1XMBA 3UVJB 1SKWA 1BHLA 4JI6F 5AQXA 2HK3A 4TVAB 3LDSA 4EWTA 2HK2A 3DRXA 1RUSA 3TSQA 3AV9A 3A8KA 2RQMA 5JLFA 4OZ5A 1B99A 2E7XA 2OSRA 3BQ2A 4PWDA 4W90B 1SC6A 1X9WA 3BN4A 1LK7A 1W7WA 2QV6A 3SDEA 1N6QA 4CT8A 1K8AT 1XMOK 2DB1A 5J2NA 1NZ8A 1VR6A 2QGFB 4FL9A 2XHCA 5AQKA 3SI8A 4M3RA 3THWA 4Z4EA 3DU6A 4ILLA 3SQ2A 1VLOA 1S9FA 5BRFA 4A62A 3P5BP 1TTHB 2EWHA 3BO4A 1ZBTA 1QE1A 2HHHF 4NLWA 3MHYA 3HPGA 4CJTA 1KOHA 3FNNA 2GBZA 3QIOA 2LU2A 2YWFA 4F0KA 1RAHB 5KFQA 5FD1A 4JI8J 3A12A 2DPNA 3HFKA 5IM0B 4A5BA 3OS0A 5CCLA 3UCZP 2DH7A 3VR1A 5AQYA 1RT4A 3BN7A 4OZ1A 1HLUA 4WFNL 2O8BB 4USIA 4CIOA 3D1HA 4QIWD 3IN5A 1NKEA 4DUZF 3ID6A 2H65B 3HHDA 1V3SA 3J80O 2M4MA 3L2WA 3NCPA 2UXBJ 5B8HA 2VASA 1WHYA 2ZZTA 4UF4A 1VRTA 4M5IA 2UU9J 2KO1A 3MMAB 3QEPA 2BBEA 4MIWA 4NO7A 1JXEA 1ZBFA 4C8NA 4J9SA 5F0XA 2P9NB 4LFAK 3VQTA 1YI2S 1HWJA 4OHYA 2HKEA 4Q45A 3MPWA 3DAWA 1KBRA 1X0PA 3WBZA 1WG1A 3E2EA 2A3ZA 2P9PB 4CK3A 1T05A 4Z4CA 2QYCA 2BANA 5CYJA 5FPMA 1U1OA 2F8HA 1EJ7L 1EX8A 1VQKS 1V9OA 5KAKA 4X4TA 5AXLA 1IBMJ 3ZSWA 3H7HB 2MY7A 4A8WA 1F2HA 4B9MA 4FW1A 4PWDB 4WXOA 3OW2R 4NLVA 4Y2AA 3T19A 2Z1IA 4DU4A 5KQDA 1LWXA 1AFIA 1U2VB 4PXBA 3HHNB 1BGXT 3SUPA 2DRAA 2VPZB 3ET6A 1DT9A 2AJ0A 4LFCF 3BH7B 1I3AA 5AXNA 4FJ8A 2JZ5A 4GMJB 1TKZB 4HACA 2DT9A 4CI0B 2F65A 1NSPA 3O1WA 5JVHQ 2HS4A 1CVJA 4OZNA 3IWLA 2Y0BB 3DM2B 2RMLA 2AKWB 1M5HA 4B9SA 3CDBA 1YRUA 2OA8A 3C6AA 2R42A 4R8UB 4NXMJ 1NGFA 4GVBB 3HP9A 4BRAA 3O44A 5EXWA 5KI6A 5AZIB 2A41A 1JWWA 2AYBA 4JI0K 4ECYA 3MAAB 4UQTA 4WYBA 4LFCK 2MZTA 3MWTA 3PRBA 3W2WB 2FLNA 5HMWA 4ZCIA 1YUWA 1YAGA 1PYSB 1KDNA 4OJRA 3DLRA 1T3OA 1JIHA 5AQNA 1VSMA 4YOVA 3CJ4A 2V69A 3LDLA 3O6WA 1NK6A 3D1QA 3J81Y 3QZ8A 4RW8A 1XTZA 2IVYA 2UUTA 5JS1A 3D6TB 2BJ1A 4ECVA 4J2DA 3QDKA 4DFKA 2ZDPA 3F2KA 1PJ5A 1SL0A 4KGMA 1VHXA 3V6DA 2QL9B 4TLRA 3VAJA 4L75A 1W2IA 3K2PA 4LC9B 2A0FB 1Y11A 2FIUA 4WPAA 3J7YP 3OVAA 3EVMA 1Q0NA 1M5VC 2NRRA 3VGSA 2QW9A 3LALA 2CJAA 1RAOA 1C0TB 3M9NB 5KPRA 1RISA 2CQBA 3CVKA 3MM7A 3WQTA 3IMXA 1PO6A 3EXYA 3RVCA 1QM9A 3HK2A 2O8FA 3JQMA 1VI7A 4TXSA 2DGVA 3P96A 2P9NA 1FRJA 1HMVA 4IG0B 1F3VA 1XMOJ 2RU9A 2E5GA 1BQNB 3QT6A 2BKNA 4BG9A 1UZDA 4E8UA 2NNWA 2OZSA 1RWWB 3GOIA 1NJZA 1D5AA 4FWSA 4MIAA 1JJ4A 3Q24A 2YWKA 2XMVA 1SIWB 4LSLB 2I8EA 1YGYA 2Q79A 4IDKA 4QYZJ 1N0VC 1NXIA 3GG1A 3CC4S 2QEXN 2B4OA 4OLPA 4UOCA 2UXDF 5L9NA 4NLUA 1RDAA 5KG0A 1NJWA 4CI6A 1WI6A 4RUCA 2QA4G 3VF2A 1TAUA 4GO5X 4CO2A 3RJMB 5A2QU 2JRSA 2GHWA 2HQFA 1FKPB 3KHYA 5IV3A 4FK2A 4OVLA 3RB3A 3BEXA 2PEHA 3FK4A 3U8XA 2PC6A 2DY9A 2Y8YA 3CDUA 4UOFA 2QJ3A 3HVWA 2I0XA 3QESA 5DM7Q 2DNNA 4P2XA 1UVJA 4CNYA 3G25A 2GX8A 4C9DA 3M30A 3DDKA 2ZWPA 1EP4A 1FI4A 2XI3A 2K7KA 1K9MT 3PSIA 3EMTA 4EK2A 1IWGA 4OKEA 4JI4F 2VDIA 4X4RA 1VQ4S 3CD5A 4GKJF 4MKVA 1T7PA 4LFBF 5T7LA 4YORA 4CTAA 3DLEB 3R5CA 3QNNA 2HHHJ 1VIXA 3HP6A 4NCAA 2KHOA 1D0EA 3K5LA 4YDXA 4Z4FA 1OYEA 1EQ0A 1HPZA 4CH1A 4ZA1A 2BUPA 1FJEB 2V5HG 4TLQA 1T9YA 4FJXA 1ELOA 4FF1A 1PG5B 3CM6A 3SQ1A 3RYLA 4ZITA 4HCBA 4CJVA 1CJVB 2OD6A 4DCJB 3C7NA 4DV3J 1X4FA 4CLSA 3CF5Q 4LFBK 3BY5A 4F0MA 4F3OA 5HVHA 2DNKA 4O8KA 1RZMA 3P38A 3AY0A 3HSCA 3PHEA 3H98A 2MQQA 3AVBA 4OZ2A 1B4SA 1RWNB 5DQIA 1AT1B 2UZAA 1YBUA 1BQMA 4C8YA 1PILA 3DGPB 2UP1A 1FJCA 4OHXA 3D7SB 1CS4B 2PGCA 1WWHA 3M2VB 4FNHA 4EMDA 3NL0A 3L8BA 4IUFA 3RAQA 1O13A 4CFDA 3DXKA 3OFHA 2UVWA 4NI2A 1KQFB 3PW0A 3OD2A 2XMUA 3OHBA 3TZXA 3P8BB 2RQ4A 3C3LA 2W8KA 4ETXA 3A5OC 4FJ7A 1JL1A 5ADXA 3V6KA 3RBEA 2E4LA 4ZVTB 3THPA 2W2QP 2ZVIA 4JBCA 3KK7A 1GLLO 4LH5A 3QGIA 3VQCA 1YT3A 3HFZB 4OFZA 2HNZB 5LXYA 1VQ7N 4L73A 5HRPA 3CCUN 3V81A 1KHVA 3PEJA 3M6GA 3ZCMA 3MCPA 5ETVA 2CXEA 4C8LA 1W97L 5SUHA 4NZ6A 5CABA 2A2CA 4L3NA 1FA0A 3DLLQ 3W0LA 1XQSC 3C8YA 4QPXA 1Q86T 4Y34A 5KFHA 5A2QO 4Q0BA 1RCOB 4KGXB 5D77A 3J81j 3A5LC 2RILA 4F4YA 2DNPA 3NGKA 1AA1B 2AZ3A 2RUSA 2ZH2A 5D6GA 3G10A 1FRHA 4XTTA 4M3XA 1ZBIA 2HHHK 1Y4ZB 3TSPA 4JHDB 2UVUA 1SJ4P 4MDBA 4M5NA 1F21A 4QJVA 2AQ4A 1WBDA 3KJVA 2H54B 3LDQA 1UFWA 3KNGA 3M8YA 5F8NA 2HFOA 4OLBA 4RL1A 3R6MA 1UWBB 5KFWA 2LECA 2J0QD 5CR4A 1Q18A 2KLAA 1T11A 4U95A 5M1FA 3CJKA 3OYJA 3CM5A 2UXBF 3POTB 4C97A 2ZBPA 2R7QA 2KHCA 4Y6IA 2J6TA 3OR1B 2ZOGA 2BANB 3AO4A 2FGOA 3I8DA 5DM7L 1XN9A 1R43A 1RSCA 3R1HA 3CC7N 3WHIA 4AHCA 4DPWA 4YEAA 3U9ZA 3SBMA 2IC3A 3FKBA 2KQ2A 3QMQA 2EEYA 3CDWA 1ZA1B 2FJEB 1TL3B 5KFDA 1QAJA 1JLAB 1RU2A 3C0BA 1S9EB 2HZVA 3CCWA 4JKFA 3VAKA 2E2OA 3PW2A 1RHMB 2LEPA 1OKJA 4WIIA 1RAEB 3V1RA 4QWCA 3K58A 5E26A 4M63C 4KH0B 4DR4K 4BRMA 3LP0B 3MEGB 3A8EA 3TNVA 3CERA 4L3QA 3KK2A 3GV8B 2WSEC 5KFBA 3NMAA 4NYNA 5CYQA 3C15B 4PKDB 2UUAJ 1R6YA 3IWXA 1YITS 1OPIA 3VTIA 1HWIA 4DSEA 1S4EA 2C3YA 1ATNA 4FM1A 1CJKA 3R8YA 3TO8A 1NGHA 1HI1A 1XNRJ 1GTHA 1HIYA 4ZVGA 4H5TA 4DV1F 4B17A 2ZGYA 4PWUA 1KNZA 3OW2M 3V6HA 4DPOA 3EGWB 3HVRA 4YMEA 4LSNB 5A6PA 1J27A 1RGIA 3HM8A 2BW7A 1RT7A 1FVSA 2HWIA 4G1IA 4ID5A 1K0VA 4JV2A 4DV2K 3M6XA 3LGNA 3HCXA 3PYFA 3PVXA 3CT9A 7FD1A 3SEOA 5AQHA 3E66A 3LH2S 4NXMF 5KRTA 3D66A 1DARA 3H5UA 4AF1A 3LDOA 3EN9A 5K14B 2Y1RI 2DEJA 3Q8QB 2R2UA 3OR1A 2HNYB 2VYPA 1YTYA 2PI5A 2JOQA 5C42B 4OYWA 1R3NA 1YJVA 3H59A 3QSIA 1BISA 3UD5A 1ATRA 4AL5A 2E1RA 5LMUF 3ET6B 4M7XA 4HT7A 4QR0A 2RB7A 2HIYA 2F7TA 1TU0B 4DX5A 3LGMA 4OZJA 1W26A 1S7HA 4ZVHA 2C2NA 4B08A 4UUWA 4ETZA 2DR6A 4CLTA 2J0WA 2W4PA 3BS9A 2LVWA 1YSJA 2M70A 2EKYA 4J5OA 3QFUA 3MFIA 4AHTA 4KGZB 1V5IB 2R7YA 1S1TB 2B6AB 2N4CA 4NYFA 3BJYA 5F0WA 1LV5A 1A5XA 4ZDNA 1TL1A 3UN2A 4CRJA 3Q7CA 5GAEI 2GV1A 1BO5O 5FPEA 1HNZF 2DHXA 4CCHA 4HI2A 3J80U 3O8MA 4WWSA 2A2DA 3BF4A 4WZQA 3RMCA 4BROA 1LWEA 3SQ0A 2JEGA 2OMOA 3KK1A 2WZ1A 3MEDA 2H48B 3CJ7A 3UE5A 4M1KA 3R5JB 1K6YA 3AA2A 4IEEA 2VFRA 4PPZA 2BA9A 4OYXA 4EUVA 4KHNA 1TK0A 4NI2B 2O4GA 3ASMA 3MUTP 5C10A 1PC5A 4DQSA 4LF4F 5F3TA 2G0CA 3V9ZA 1CLFA 4HUEA 1RWKB 3CJ9A 1Q53A 4LF7J 4IOXA 4JI4K 5BR8J 2Q2RA 4LRBA 5B0EA 3QT7A 2XLKA 2GA7A 2A40A 3IDHA 2AW0A 5E3QA 5EWEA 2DITA 1B0TA 5BR8K 2YWEA 2LYVA 2M8DB 4ZIVA 2EHGA 2PMHA 1VAZA 4HLBA 3T6JA 3AD8C 1T9WA 4B8CA 1VYAA 1WHXA 1HJOA 4KPCA 2D0BA 2QX0A 1R7IA 1HBMB 4LF4K 1FDAA 2R2TA 2FF3B 2MJUA 4KGKA 3I0SA 2I1RA 1Q9XA 3IBCB 1DEJA 2DY4A 5AE1A 4ZLNA 4G1PA 4PAAA 2VF3A 1XNQK 1J5OB 2QL7B 2JVOA 2ZKTA 3T41A 3BQ1A 2D0OA 1CZBA 3BH6B 1RHRB 3AOAA 1VSIA 3MF5A 1KVCA 1U04A 4J9VA 4ZPBA 2R8IA 1SS6A 4B1UB 2AD9A 2E1CA 2AJQA 1HQUA 4I6WA 3US5A 4CJWA 4BRFA 4E2FB 2VOOA 1KWMA 3ONQA 3OY9A 3ZT1A 2UUAK 5HP1A 1X4BA 1FWPA 3NEKA 2AX1A 2JSXA 3RTVA 1XR5A 4WU2A 4LRFA 2ZKUA 4M95A 5H1SV 2EBEA 3E01B 4DLEA 2UV8A 3KLGB 4WP3A 4URGA 4CZFA 5HAOA 5EX0A 1GMWA 1UCNA 2DKOB 2FB0A 3HRGA 4AILC 2CFXA 4JK9A 1E6VB 2FVRA 3UPFA 4QAGA 2NQPA 2V34A 4NEYA 4CEDA 4ZJQA 1DQ9A 2CG8A 2YWWA 4TU9A 1P1TA 5EY4A 5J1NA 4YQWA 2ZWHA 2LCWA 3H42A 3KJQB 2L3MA 3VQ4A 1F5CA 3Q2SC 3Q8PB 4ED3A 1WJ9A 2FC9A 4X84A 1R6VA 4O44B 4U7UD 4Y28C 2MZRA 1MROA 4WCEL 3I5BA 4PUOA 4Y3CA 5KG1A 1D9FA 4LF5F 3R8EA 5L1IA 2CJ9A 4DPYA 3JB9k 3NHGA 3W2WA 4DFMA 4N8NA 3UKUB 1NK5A 3S3MA 2LQ8A 4EBCA 4USJC 4ZVOB 2R7WA 2G8HA 3CYMA 3TUJC 2X51A 1MWZA 1ZXOA 4IG0A 1U48A 4C98A 3EE8A 4QCLA 1RDBA 4UOHA 2HPUA 3SK3A 3ZT3A 3SBTA 1ITPA 4ZP9A 1BA1A 4ED1A 2PBDA 5C25A 4Z7YA 5RUBA 5E84A 1S5JA 4CJUA 4DX6A 1NGBA 3RB4A 2E2QA 4YY3J 2LEAA 5IT4A 3PM9A 4P6QA 3KD5E 3NRBA 5KFAA 1TKXB 4H0VB 2DO0A 2AT1B 2E9RX 3M8RA 1H74A 4NWBA 1T44A 3IRXA 1S57A 3VEOA 4CP5A 4X65F 3PCOB 1JLEB 4J2BA 3ULHA 1WSVA 1WDDA 5FLXO 1N32F 2CPYA 1VRUA 5KFEA 4CGHA 2C2MB 5AQLA 3AB4B 1E4GT 3H5XA 3VAMA 3QWPA 4CFCA 1WF0A 5JICA 2XO6A 4E0DA 3R97A 3TANA 4X62F 3L9ZA 2BEFA 2XMJA 5E3RA 3VEWA 1QSLA 1VIOA 4CLZA 4B1VA 4L6V3 2G8VA 4RLEA 3E9PA 1WSFA 1F5AA 2VC0A 2BW2A 2JLGA 5D4LA 1BIUA 5F3ZA 4DV6J 4DV3F 4DS4A 4NEZA 2IBOA 3KIOA 3HSJA 1IV0A 3LW5C 1DRZA 4QWEA 1S0VA 3TAFA 3MR7A 4P75A 3D45A 4QIEA 1IKXB 4JYAJ 2LQ5A 1CZ9A 1LWEB 4FLXA 1Q81O 3GFHA 3PR4A 4BS2A 4K42A 4PG8A 3GJSB 2XM3A 5HL7Q 3UB5A 1VK8A 2ASOA 1IBKF 2OTLN 2CQ0A 3KKRA 3IBFB 2J6SA 3MZIA 1RABB 4F67A 2QZ8A 3OTBA 3R5DA 3NKYA 1U49A 4O23A 2EKNA 2GUPA 4A8MP 4DTJA 4LF8J 4YB7A 3EY1A 5JMVA 4AQYK 5KFTA 1N34J 1K8KB 4DR6F 2YNIA 1RBSA 1KS2A 3ETOA 3IFEA 4TN2A 4BC7A 3I0SB 1Z25A 4OLOA 5ETKA 4F8RA 2HBMA 2YPZA 3U3YA 1U1PA 1VFJA 3BYRA 5F0UA 3MPYA 3I96A 1SQEA 4B3RK 1WI8A 1FE4A 2GAHC 2Z8QA 3NP5A 4DL0C 4DTOA 3BF3A 4DF8A 3TYTA 1S79A 1FEEA 4DV1K 1JXVA 3WDOA 2DPIA 4QYRA 1V3ZA 1BQMB 4DPXA 3B4DA 1U2CA 2RSQA 1M1GA 5FDLB 4AQYF 1S72S 3PW4A 3H1QA 1CULA 1FEHA 3WXMB 1N6QB 1NGIA 3QEVA 4DLGA 4A2BA 4IFEA 3JSMA 1IN0A 4PABA 3TPQA 3FCVA 1M5OC 1NRKA 3DLBA 2ACMA 5HMXA 3V1OA 3OYAA 1WC3A 1GOCA 3FQLA 4ZVEA 2ADCA 3O3LA 5KT3A 2IMOA 4LF9K 3RSEB 3BB5A 4C8OA 2RE1A 1Y7PA 2IIRA 1N5VA 3FRYA 1OH7A 1HYSA 4KYZA 4UZCA 3OYDA 2Z1HA 5IT9O 1YTAA 1CJTB 2KRRA 3P3DA 4BREA 1U2RA 3IS9A 3QEXA 4ECSA 1IVZA 4WQ5A 3KD1E 2W7AA 2BVZA 1NJYA 2GFFA 1NGEA 4RW6A 2PYJA 1P90A 2CQ4A 5BPLA 4J9LA 1X4DA 1RCHA 2VA2A 4DN9A 4NB4A 1L3TA 3I56N 1SL2A 1FVQA 3OJSA 2WSFC 1VSKA 2CPDA 2X1FA 2GMLA 1SQGA 4F7VA 1GLAG 4RW7B 1MWQA 3NXZA 3TZZA 4DJBA 4DV4F 4GKKK 4M5LA 4MH8A 4M7YA 1NBEB 2IVMA 1WAJA 3HDSA 3JTPA 1FXRA 4NZ0A 1KKHA 3GZ7A 3HHEA 4E19A 4JS5A 4DR3K 2LQ9A 4ZCKA 3NVMA 5I42A 2CADA 1CSJA 4DFPA 4U67L 2W7PA 4WBFA 3MN6A 3IKMA 1X31C 3KDOA 1LQ9A 3AVAA 2W41A 4Y1CA 3QRQA 2NSBA 2OCEA 2R9LA 2LMIA 4ZLLA 3AFGA 2VBXA 4E7LA 4ATNA 3MXHP 5E7OB 5ADXH 4BC5A 1XHXA 4FS1A 4H54A 4C0HA 3Q89A 2IHR1 5BRDA 4OMFG 4F04B 3ZSZA 1HJRA 4ZK7M 4C2MA 3UDLA 3F44A 4B3TK 3M8ZA 1GT8A 2PE8A 3SV3A 3D7EO 2RN2A 2FLOA 2YWGA 3UCGA 5SWMA 2UXCJ 3I5AA 3AVNA 3M1VB 1WEXA 2HMIA 2ABYA 3SSRA 2RJZA 1HBNA 4C11A 3SMPA 3TQ1A 5BR8F 4XPCA 2YHXA 4I69A 5ETMA 4JKHA 4NL5A 4PPDA 3QZ7A 4RU9A 1PBUA 1QVGM 5F8HA 2W9AA 4TYBA 3CD6S 1HNWJ 1PKUA 3EKSA 2O8DB 1X5PA 5G4DA 2C3UA 1IG9A 2E7VA 1RFQA 1OY9A 1PIEA 4DCOB 1H2UX 2CWXA 5BJRA 3E51A 2G2YA 1K8AO 1K1QA 2QWMA 1XIQA 1GQEA 3HT3A 2R3VA 2B9WA 2V51B 1A9NB 5HOOA 2CQ3A 4PYDA 4DTRA 4K4VA 1ZBUA 4FZVA 1UZHA 2B3TB 1FKOA 2M88A 2IJFA 4IH5A 2KFYA 1Z26A 4RBTA 3PEHA 3CD6N 4DHVA 3V6DB 1NPRA 2G0IA 1B92A 3M5RA 2DNHA 2XZTB 3V9WA 3JYTB 4ECWA 2LQBA 3PLAA 2EPIA 5CZ2A 4NCBA 1DJ0A 4R5PB 3CCRS 3DXMA 4FLTA 5ETNA 3G6VA 1H38A 1A5VA 1V4TA 1YHQS 2JWKA 4GVEA 4EBDA 4ED6A 4KHPK 4M5MA 2XWXA 1FKPA 3SCIE 4NX9A 3AOBA 1T9TA 3OV7A 4J9PA 4BC9A 4F3TA 4DTNA 4G65A 3NF7A 6FD1A 2C2ZB 1YRXA 3Q8VA 2NXUA 4I0WA 3M3ZA 1HBNB 4C11B 5F8IA 1U24A 3VGKA 2MQMA 2HMIB 3DHXA 4C3MA 2E44A 3ZTPA 3MN5A 3HSDA 1Y5IB 2KXFA 1BDGA 4UY8T 2IJNA 4PXDA 1D4XA 4CJSA 1TUGB 2GVDA 1Q95G 3PO4A 2MGZA 2YKPA 1S4FA 3QLHB 1RILA 4A57A 3KLIB 5A2QY 2X74A 3BGLA 1N5YB 5CH7B 4WTOB 1JJ2R 4K0KK 3MR2A 2AGQA 5DETA 3GL1A 2QWOA 3SI6A 3BF1A 1OSCA 4B3OB 3B82A 4NPOA 5B0CA 3VWSA 2RVJA 4BWJA 3RBDA 3QIPB 1RAJA 3GJTB 4FKXA 3W9JA 3VQ8A 3EVOA 3D1OA 1BI4A 3NDKA 3W63A 4OX8A 4WK3A 1GH8A 1JKHA 3K89A 3KZBA 2EK1A 3IAS9 4PQUB 1CBKA 2YX1A 2CRLA 2EFNA 1T0TV 5IWAF 4C7QA 2ZC3A 4P7TA 3CUNA 2J9EA 4CIFA 2KB2A 3ZXWA 5J2MB 4J9RA 1GLCG 2CUYA 3H25A 3M2VA 1C4AA 3VQ9A 4DR4F 2RQKA 2PEBA 5GAHI 5KGXA 3NE6A 3PX6A 4FYYB 5A8KB 5J2NB 2ASYA 1EWRA 3M05A 4I56A 4PYAA 2WK4A 4OI6A 5KFRA 4Y00A 2U1AA 2WTUA 5DDRC 3FZHA 1RT1A 2ZHAA 4TU8A 2XG8A 3QO9B 2JWNA 2OUGA 2Z2ZA 4Q8EA 2BGGA 1T02A 1LXJA 3NGSA 1X8DA 1UW4A 1WKLA 4A46A 1XERA 1O1WA 3UKRB 1I94F 1HYZA 2K1RA 2ZH1A 2HNZA 4WTYA 1E6VA 5TKYA 5L39A 1X4HA 2Q0RA 3OTOJ 3MTJA 5LM7E 3P6YC 2DTUA 4LH4A 1UJ4A 2QMWA 3C2PA 4BHQA 1S72N 1HMVB 1QQCA 1YJNS 2E29A 2E6MA 1KQGB 3HPOA 3EE9A 2DGUA 5CZXA 2CGJA 3L09A 1IJEB 4DL7A 1X1PA 2V2QA 4QS7A 2ROGA 4GW6A 4YB6A 2N3OA 3OYMA 1QD1A 2V8HA 4KAIA 4DUTA 2VC1A 2VL1A 2HVEA 1SC1B 3ZT4A 3VV2B 1EKSA 1NHUA 2GJ2A 4DR6K 4RNMA 3DRRA 1RP5A 2RHKA 4DTXA 3GMGA 2FGCA 3GPAA 3OFGA 1N88A 3JAMO 2QYGA 1SQFA 4LF9J 1NG9A 2Q6BA 5DG9A 3SCJE 4LRDA 4DCHA 4FLYA 3I87A 1FESA 3KMQA 3E3XA 4X66J 1M5KC 2V8VA 2K3IA 3MCOA 1EETB 1X9JA 5F9LA 3O1BA 4IRDA 4NLXA 2ZWOA 2KVQE 1T05B 3IO1A 2HHVA 2XS5A 4HR2A 2Z30B 4JK7A 1MROB 5L1LA 4F3MA 1YTUA 1C0UB 1YRTA 2H1YA 3PX4A 3MEKA 3O5TB 2CDRB 4ISEA 1DBDA 4YNQA 2MXYA 2DFFA 1N36K 1G2EA 1UPMB 1RHUB 2GCFA 2L9DA 3G2XA 4ZPAA 4IO9L 1TVRA 2V2ZA 3K0JA 3OTEA 2EI5A 4W4MA 4BR0A 4JI5F 3ATVA 3VGTA 1RDDA 2FTRA 4OQJA 1YK9A 2CIMA 1HBMA 1RT1B 2KM8C 4K8XA 2OTLS 4IRCA 3JAMY 3A3OB 3THXA 2DXEA 4RBUA 2NRZA 3R5AA 4AM6A 4GKKF 4DV4K 4ER8A 3S3NA 2HFUA 3T5HA 2LEBA 1S1VB 4UQGA 1J2VA 1VQ4N 4ZP8A 1TK5A 2J6UA 4FJ9A 2ZEJA 4PXEA 4FNIA 3CJCA 2EFVA 2CH5A 2P51A 4NYOA 1IXKA 3PIPQ 3Q0AA 3N79A 5LT5A 1Q78A 2XLJA 2FVSA 4NXNF 5BXIA 3TAMB 4O4GA 1S1UA 1DQAA 1LXNA 2C22A 4WE1B 5D0RA 1U1LA 4IDKB 3NY0A 3OLBA 1YKWA 5GIOA 3IC1A 2BE9B 3I0RB 2PYLA 1UMJA 5AXKA 3OLAA 2U2FA 2E1ZA 2B5JB 3CJ5A 3G6YA 3CCJS 4DV6K 2DHAA 4OL8A 3AA4A 2E1PA 2VG5B 3DN9A 4CLYA 4CHQA 3NGDA 3AQOA 3PDNA 2XULA 2HHWA 1DHMA 2O3DA 5KT4A 4CECA 5IC4B 4DFJA 1XC9A 4J37A 1AW0A 2ZBIA 3CD0A 2W2MP 2JFKA 2NXCA 3THVA 1EKRA 5BRHA 2PDAA 4NLGA 4ZLJA 4YB1P 4UY85 2XHBA 4KV8B 1D9DA 3PY8A 2Q31A 4KGVB 5CZ1A 1KD1O 4XO0A 2OKQA 1C0TA 1J53A 3VQBA 2MKSA 4HTIA 2RF2A 2OPPA 3BQ0A 4E1MA 1NEEA 1I3OB 4P7VA 5LJWA 2D1CA 4O4RA 3RBZA 5KRSA 4LIWA 2OGUA 3THXB 2WVFA 1SQKA 3S7RA 1JCFA 1CPZA 2VG7A 1DY3A 3ICLA 1P8GA 3M4XA 3NCRA 4X4PA 3HSTB 2YKNA 2D5RA 3OYCA 3MOZA 4B3SJ 3EZ5A 4YS2A 2BKPA 5GAHP 2RD5C 2BM1A 2XZWA 1IKWB 1VHFA 1V5VA 3IA0A 4CHPA 3IRWP 3SUNA 1WACA 4TYAA 3J81O 5HJYA 4P73A 2P5OA 1AYEA 5CYMB 4JN4A 4CO4A 4F25A 3JSRA 2J4RA 1FNMA 3HTVA 2Y1LB 2UXCF 1WTBA 1FDDA 4WYLA 2P9IB 4JI2J 2EBGA 4DEZA 4WP9A 1AUDA 4FWNA 3KHLA 3HZ6A 2J9DE 4FLUA 1EKEA 1N48A 1S6UA 2G1HA 1C1CB 3L95X 3O8WA 1X4GA 2KTQA 2Y8WA 4K4TA 4HH0A 2Y1JA 4IYQA 1SAZA 3W3SA 4FBUA 2GC8A 1S0NA 3QGGA 4OGEA 4UTGA 1NMDA 4KH4A 4ELTA 4HUGA 3ENBA 1NBWA 3OXFA 1TQLA 2ZJRQ 1HNVB 1BIZA 3MCNA 1RA7A 1OS5A 5IC6B 5E33A 3NWRA 3AJDA 2N82B 3MOJB 3R2CJ 2V4RA 2QT7A 4NLYA 3TA2A 4CWBA 1O0PA 2DGWA 4IOAL 3LAKA 1EXQA 2OPRB 8RUCA 5J2QB 2H9ZA 1TL5A 4NRUA 4K41A 2CJKA 3AB2B 4OHWA 3B4MA 5MAOA 2V4QA 4DR5F 4HKQA 5A76A 3UDCA 3SMSA 3RMDA 3K2YA 1JXLA 1KC8O 2QWRA 3GR1A 1TMMA 4DQQA 1JLQB 3L4QA 1BWFO 1UFKA 2J5AA 5HQMA 1M1KO 1X7VA 2Q6CA 1QAIA 5L38A 3GR0A 4AXIA 4ZLPA 3P39A 4UUXA 4L3KA 4IFYB 2MHEA 4BGAA 3RR7A 2ZOMA 4PL7A 5HJXA 1T6CA 2UUCK 3J7AP 3TJ9A 4FS2A 2MZQA 3HKZD 3D2FA 7AT1B 4JKGB 4BDPA 5BREA 3ULDA 3ZZUA 4CO3A 1U6BA 1V3RA 1LW2A 4OYIA 5U47A 4ECRA 1WUAA 3M32A 3CCQN 4Z37A 1FTCA 5K8OA 4YDUA 4GV3A 4X64J 2XY7A 2J9DA 2CNLB 4F4AA 2BZ2A 5H9FJ 4U7BA 3D9BA 4MT1A 2IPOB 4MIBA 2ZDOA 5ETLA 3LZJA 1S97A 4RW7A 4JI3J 4BBYA 3KHGA 2HB5A 4USUA 2CNKB 2X78A 5B08A 4HTLA 2HZAA 2HAIA 5IWAK 2FZCB 1IBLK 3QYYA 1RNHA 5KGWA 2CGKA 1HRHA 1YBTA 3RW7A 2B9YA 2M5YA 4DV7J 1HBUA 3O3GA 3TR8A 2QWNA 4ED2A 4FF2A 5AQFA 2YX6A 5IQ6A 4YFUA 4EP5A 5C2CA 2FHKA 2ZJRL 3ZTQA 2WBMA 4JP8A 1RK8A 4Z4HA 4GO7X 1WHWA 1VQ6N 4KRFA 1RLCL 1I51B 2UUBJ 1QS4A 4K4UA 5KFSA 1CEZA 5KFPA 1RU1A 3D68A 2PO4A 4E7IA 1R8PA 4NYPA 3CCMS 2J7UA 3BKUA 4PQAA 1FX4A 4XK8C 2F4VK 2ZUGA 3G9CA 1RTZA 3NMRA 3ZX0A 2I7PA 1VBYA 2VG7B 3K5PA 3ISNC 2W7OA 2E5LK 3CIPA 2HBJA 3LP2A 1FTRA 2F9WA 3DDNA 4CJLA 2YNGA 3FCWA 1LAWA 2HFNA 2DFHA 3VF0B 3NLCA 1VLYA 2P9SA 4NMLA 5DS7A 4C8ZA 3GV5B 3GILA 3UVJA 4WYWA 3D6RA 5F8LA 3RBXA 5K5MA 3DLGA 3EE3A 4DX7A 3F73A 2AEMA 1N33J 4DSIA 3QFWA 1FXXA 4AT1B 2B43A 1B9DA 2UUCJ 3W3DA 1YHQN 1IBCB 4BDZA 4E7JA 4OIXA 4ZJOA 3KUHA 5KG7A 1JJCB 2P9IA 4PKHA 1N36F 2A5XA 1YVNA 4U8YA 3MN7A 5K9FA 3VGUA 2BABA 3W9HA 2HHTA 3CJAA 3TRGA 3H40A 3EDQB 3HX9A 3DOLB 4YOEA 1HKCA 4RW9A 3UKRA 6FDRA 1Q1KA 2K06A 2DGXA 2JC0A 4Q2LA 4B1XB 5C0YA 3MEEB 2MZJA 2KH9A 4ELVA 1B70B 1C1AA 3DLKA 4DV2J 1N8RT 2CQPA 5L9XA 2KXHA 1SJFA 2WUSA 2VQEK 3CWJA 3MMJA 4MKBA 4ILHA 4BQZA 1UVLA 3C6HA 4J9OA 1XNRK 2D3ZA 5KFUA 5AQTA 2YCHA 1U1MA 4C23A 1VISA 2GQQA 3FZKA 4A8XA 3SCLE 3O9QA 5KFMA 5AQRA 4KI4A 3GCXP 2QSFA 2HEKA 1YWXA 2DR5A 3KLEB 2R8KA 3AA3A 1WBBA 2FQQB 1U1RA 3DHWC 2W25A 3M2RB 2DNQA 5KFXA 2HHUA 4MFBA 4DR3J 4NA1A 2DRDA 4BQLA 2DK2A 2HYIB 2A42A 2FJWA 5KTQA 2AP1A 4HH1A 3NGUA 1F9EB 1NPPA 3OTCA 3O08A 3CMES 4XH4A 1ITGA 3OTDA 4FYXB 3HXMA 4NLQA 1KD1T 2Z58B 4CEEA 1HNWF 2GGPA 1LOTB 2KM8B 2HZCA 3AVCA 4LY7A 1GFWB 3OYKA 1X4AA 3ATUA 3ZYYX 4BDYA 4DV0F 1O51A 1NK0A 2HVIA 2UYTA 3JQJA 3S1TA 4DR5J 3N6LA 4DV6F 3HYFA 1LAVA 2P9UA 5JVGL 1UTAA 1KQKA 1P9QC 2IA0A 4I2PB 5C24B 2G1DA 3AO2A 2MLYA 1NGGA 3S9HA 2KN4A 4KH6A 2GWKA 4V19J 2VPYB 3LWMA 3M6UA 4IFYA 2MSTA 4Z4GA 2QTWA 1HHQA 3I4HX 3TA1A 1WG4A 2YQ0A 1OWXA 4QW8A 1RADB 1GLEG 3X3UA 3Q8RB 2MLXA 1IH7A 4YOXA 4IOCQ 3PFEA 2NUUG 3AO5A 2YNGB 2HWTA 3W61A 4ANCA 1EB0A 1IJJA 4DR2F 4R0JA 4MAKA 1KTQA 3AJ2A 3T1HK 1D1UA</