3HVTA

Structural basis of asymmetry in the human immunodeficiency virus type 1 reverse transcriptase heterodimer
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
555
structure length
555
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
publication title Structure of the binding site for nonnucleoside inhibitors of the reverse transcriptase of human immunodeficiency virus type 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 95
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1994-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3hvtA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvtA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvtA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvtA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hvtA05
2W42A 3U3YA 4F4XA 2ASLA 1NJXA 1DTTB 4ICLA 1KHWA 3GV7B 3OL6A 1KCFA 4HHTA 4FZYA 4FS1A 4CGIA 1WSHA 4FM0A 1N4LA 2YNFA 4J9PA 3PY8A 1JIHA 4K4SA 4J2BA 1VSHA 3BQ0A 5J2MB 2DY4A 1ASWA 1RT4B 4KTWA 1QAIA 4O0JA 5KI6A 1R0AA 3KMQA 3IGNA 1FXXA 4NZ0A 5KT6A 4C8MA 2Q3SA 4IH7A 3NMAA 3OVNA 1CZ9A 4DFMA 4QAGA 4EBEA 4K50A 4URGA 2QE5A 2RN2A 1LWFB 2F8TA 2FLPA 4RUCA 4M94A 3N6LA 2HNDB 3L3VA 2BRLA 3LP1A 3ZCMA 2ZD1B 5DG9A 1N56A 2G8HA 3RB0A 4DL4A 2FVRA 1RTIB 5KFMA 3UR0A 2ETJA 4O3SA 3AVJA 4ED1A 3MEDA 4CIEA 1LW2A 3MEEA 1ZTWA 2QK9A 4RW4A 4KKOA 1NHUA 1CXUA 1TL1B 1X9WA 1RTDA 1FK9A 2HHUA 2W9CA 3QIPA 3PW7A 3HT3A 1TK8A 5J1EA 2HB5A 4KPYA 2IMWP 2D0AA 2HHTA 3PUFA 4MFBA 4ED3A 2FVQA 4FZXC 4MH8A 2VA2A 4KHWA 1VSMA 4Q8EA 1SH0A 2ILZA 2BR0A 2BGGA 4M3RA 3M8SA 3M9OB 1IKWA 4RNOA 4N5SA 3T19A 3HSTB 1UWBA 2ASDA 3E01B 3V6DB 3PO5A 1I3AA 4E7IA 4ZP9A 2B4JA 1JLFB 5I3UB 3L3UA 4IFYA 1RT1B 4EZ6A 2IS3A 1JKHA 3NF9A 3S3MA 4ID5B 2AJQA 4ID1A 2NUBA 4M42A 2RKIB 1QE1A 4I2QB 1XR5A 1RT5A 1RDRA 4CEDA 3SQ4A 1N6QA 3IG1B 3HP6A 1VSDA 3D0PA 5EWGA 2HHVA 1EETA 3BGRA 3QO9B 3MAQA 2RDIA 5HP1A 3ULDA 3BR9A 4QPXA 3M9NB 3TABA 3S3OA 4RW6B 3ITHA 4K8ZA 1J5OA 3NAHA 3VQQA 1BQNB 2QV6A 3DYAB 3LPTA 4G1QB 2B5JB 3V9UA 4WFXA 3AV9A 3K58A 4E1MA 4WZMA 4DTJA 1HQEA 3PW4A 1U09A 1BI4B 1HNIB 4DEZA 3RRGA 3DOKB 3SQ2A 2IM3A 1SKRA 1KLMA 3MF5A 1S1XB 4KTQA 3RR8A 3H5UA 4RNHA 2XRIA 3H40A 2OZSA 4OPKA 1RT6B 3QEPA 1UAXA 1K1SA 1KFDA 1LWCB 2VA3A 3GIMA 4FJ8A 3SPYA 1GOAA 3NBPA 1QUVA 3DDKA 1T05B 3MXIA 4HKQA 4KHMA 3V9XA 1TVRB 1NOYA 3NF7A 2OPRA 2FJXA 2DPIA 5HRNA 4L8RB 3PVXA 5KFWA 2HMIA 1RT7A 4ZHRB 4NLPA 1SKSA 1HYZA 2GIRA 3O4NA 5CZ1A 2O4IA 4J9NA 4Z0UA 3KD1E 4KTZA 3KLVA 3BQ2A 1IKXB 3RB4A 1FKPA 4ELTA 2P5GA 1JX4A 2B6AB 4O44A 4URQU 3G86A 4E7JA 2HNZB 4B3OA 3TAEA 1S6QA 1JL1A 3CDWA 1S1VA 3D45A 5F9NA 2RDJA 1GOCA 3OS0A 3HO1A 4IRKA 3VA0A 3D5MA 3HVRA 4CJVA 2QKKA 2X78A 1YVUA 3SQ0A 1UOCA 2R2SA 5E41A 4I7FA 2KFNA 5HROA 3RMBA 4QWDA 3GIIA 3HK2A 4I2PA 3L2WA 4F2RA 1S1TA 4LQ3A 4CF1A 3FQLA 4YR2A 3DLGB 3VQ5A 1YTUA 2FBXA 3SFGA 4CFCA 4O4GA 1W0HA 3ASMA 5CYMB 1LAVA 3L2QA 3VQ6A 1NHVA 3NH2A 2X6NA 4NYFA 3AVKA 4NYNA 4IFVA 4CHNA 1KSPA 3UDLA 4DU1A 4RW7A 3IRXB 3H5YA 4N41A 2KFZA 4I9LA 1KLNA 4TLRA 3QEIA 4DMNA 3MXMA 3QZ8A 2YNIB 3SQ1A 2AGOA 2AQ4A 3MECA 4B9UA 1SL0A 4DSFA 1NJZA 3V1OA 4AHTA 2WHOA 1RNHA 2R8JA 3C95A 5F8GA 3KLFB 2ZQBA 5KT7A 4WE1B 4N56A 4NLWA 4FW1A 5KG0A 4EBDA 5C25A 4TY8B 1XWLA 1EP4A 3IS9A 3VQ4A 4E7KA 3SJJA 5KT2A 2FBTA 4CERA 4BDYA 4E7HA 3Q8RB 4DWIA 4FJ5A 4C8NA 2R8GA 1C0TB 2JEFA 2QXFA 3B6OA 1NK9A 2D3ZA 2EX3A 2GC8A 3S3NA 4O55A 3AVCA 2V4RA 3T1AA 4O3OA 1TK5A 2YNHB 4HUFA 2IC3B 4DTXA 4R5PB 2HVIA 1ZYQA 2HHWA 1S49A 1KVCA 2G8UA 1JLAA 4TYAA 1TAUA 3M8RA 4DTRA 4GC7A 4IR1A 3DLKB 3T5HA 1BHLA 4DQPA 4M3TA 4CHZA 2FLNA 5DG7A 4KB1A 3DM2B 4CESA 4H4OA 4IRDA 5EUHA 1WSFA 3RRHA 3QGGA 3G0ZA 2HNDA 1U48A 2OPPA 4IDKB 2VG7A 3QIOA 3ISNC 3OYHA 4CJ3A 3GV8B 2PZSA 2G8IA 3LP2A 1BQMB 5EWFA 4CJEA 3OYDA 3DI6B 2RF2B 3QLHA 1SV5B 2D7SA 4HYKA 3NGIA 2VG5A 2XC9A 4IBNA 1S0OA 3D28A 4LSNB 4CFDA 5FDLB 5SWMA 3KLHA 2D5RA 4WYWA 3AVFA 1RDAA 3RMCA 3V6JA 1VSJA 2IJNA 3JYTB 4H8KA 1Z4UA 1IKYA 3HXMA 3PW5A 3H98A 3TI0A 2XY7A 4RNMA 1I6JA 3EPIA 3HKWA 2W7PA 3LP0B 4TQRA 4TSXA 4NLXA 3I5BA 4LH4A 5KFKA 2E6LA 4B9VA 5I42A 4CFBA 4WYLA 5KFHA 4CJQA 3NKYA 2YKNB 1MMLA 1JLFA 3V4IA 4TN2A 4Y1CA 1YT3A 3GIJA 4KREA 1UA0A 1RT1A 3JSMB 3DRRA 1T3NA 4M41A 4W5NA 4F2SA 5KFNA 4I2QA 3MEGB 4MIBA 1O1WA 4KV8A 3NHGA 3K59A 3FQKA 3CFPA 4CGFA 3OJSA 4IRCA 1BCMA 3KLGA 2YNGB 4E19A 2UVRA 3CM6A 5KFXA 4KI4A 1KHVA 5KFYA 2IAJB 2OPSA 1IKVA 4J9QA 4CEBA 4JRQA 4CK3A 4OKJA 3OYBA 2BE2A 4JRPA 3DOLB 4LD0A 4CJWA 3IGVA 1IG9A 2FLLA 1BQNA 3SUPA 4QWCA 3NGDA 4CJRA 3V9WA 1JLEA 2ZE2B 1W9HA 1RTJB 4DFKA 2D3UA 2HAIA 1JLQA 1BI4A 4K4ZA 3T3FA 3IN5A 3CYMA 1HPZB 1VRTB 1RA6A 3C94A 5J2NB 4CJLA 1TV6A 1VSIA 1HQUA 3CM5A 3WNGA 4X2BA 3PJWA 1CSJA 3DLEB 3CFRA 4RW8A 4XIUA 1LWCA 1ZBHA 5L1IA 2XY5A 3CG7A 5KT4A 4DQRA 4H4MB 2WB4A 2X74A 4FJNA 5FROA 3NL0A 3ZSWA 4QOZB 4CHQA 3QIDA 3I0SA 1S0MA 3C6TA 3RMDA 4J9RA 2IM1A 1I39A 3V1RA 2HWHA 1EX4A 3LWLA 3OS1A 5KG2A 4Q8FA 3PW0A 4MK9A 1D9DA 3PX6A 1S1UB 5EU7A 3NCIA 1L3TA 3M8QA 4DG1A 1A5VA 4IOBA 1U45A 4NLTA 4B9NA 2R2RA 4AHUA 4R8UB 1RBRA 3PO4A 4F4WA 4DSIA 2AX1A 4BDPA 4NLYA 2IA6A 1JLBB 2B6AA 3TAMB 2FJVA 4YMEA 3AA2A 5J2PA 3HVTB 2VG6B 1C1CB 1KVBA 1S10A 1QHTA 1JLCA 4I9QA 3VA3A 3TAPA 3KLIB 4DTPA 4DL2A 3S9HA 3HL8A 3MFHA 1QSLA 1BCOA 1U47A 3IAYA 4W5TA 1RT2A 4W5OA 3N6NA 5C42B 3Q8SB 4F4YA 3AVMA 4MKAA 4Q44A 3M9MB 3U6FA 4EYHB 3H5SA 1RBVA 3G6YA 1JL2A 4RUAA 3BSOA 2F96A 4DTUA 4ELUA 4PUOB 2YKMA 4RW9B 5KFVA 2IDOA 3KTQA 4KAZA 4ZP8A 1JXLA 1RCHA 2FVCA 5HBMA 4DU4A 3CJ4A 4PQUA 1LWEA 1TKZB 1T03B 4FLYA 1C1BA 1JLGA 2W8KA 1S97A 4W5RA 3FFIB 3T5LA 1HNVB 2E9ZA 3NAIA 2G8FA 2KZZA 4EP5A 4KO0A 3PJXA 4TYBA 1RBTA 3OYFA 2DFHA 4OKKA 4CHPA 1NK8A 2PYLA 3HVWA 4QWAA 4LSLA 1LW0A 1L3UA 1IM4A 2VWKA 2OPQB 3KK2B 1NNDA 1S4FA 2YV0X 3HPGA 5JXSA 4Q0BB 3NE6A 3SV4A 4JS5A 4RG8A 4CJSA 2DTUA 2DFEA 1TL3A 1N5YB 1A5WA 4CJPA 4DL5A 1S9GA 2R8HA 1NK5A 3SI8A 4JS4A 3KLEB 3SZ2A 2GIQA 3U3GA 5DQHA 3MR2A 2WRMA 1VSFA 3DRSA 3ZT0A 3TAFA 1OS5A 4NLQA 3DMJA 2IC3A 3UPFA 4EO6A 5KRSA 1D9FA 2W9BB 1S6PB 3BSAA 2GUIA 2GBZA 3P5JA 2BQ3A 3LWMA 1HYSA 3KK1A 3OJUA 4KB0A 1FKOB 4NLSA 3PHEA 1WNEA 5F9LA 1KRPA 3T5JA 3DM2A 2CKWA 3ZSXA 1CZBA 2G8WA 3LDSA 5KG6A 4CHOA 3QEWA 4O4RA 3DRPB 5DGAA 4NLOA 4ED8A 5CZ2A 3VQ8A 1GX6A 2BQRA 4PA1A 3LAKA 5DMRA 2HWIA 2QKBA 3GILA 5HRSA 4E0DA 1JXEA 3KKSA 3CDEA 4AH9A 1YVFA 1XI1A 1BQMA 4PWDA 2JC0A 1TKXA 3DI6A 1TP7A 2W9AA 3EPGA 1U4BA 1RTHA 2Y1JA 4TXSA 2O5DA 1VSEA 4DQIA 4NLRA 3N6MA 2GV9A 4RNFA 1NKCA 3VQSA 3RBEA 4FJLA 5KG1A 3SUQA 4YNQA 2I5JA 4DLGA 1QTMA 4UQGA 4KAIA 3WNEA 1S1WA 3H4DA 1S0NA 4CEFA 1C1AA 3LP3A 4FLTA 2C2EA 4NCAA 3I0RA 4NLGA 2C28A 4BWJA 4AHCA 1WSEA 3QEXA 1RT3B 1TAQA 1VRUA 4ICLB 4KFBA 3JSMA 4DFPA 3ZT4A 2HVHA 3MR3A 4GC6A 3KMSA 4CJTA 3KNAA 2UVUA 5C5JA 4OGEA 4YR0A 3KKRA 2F8SA 4IH6A 1J9AA 4O5BA 1Y97A 1R0AB 1X9MA 3H4BA 4NYZA 4F4KA 2YHAA 1KFSA 4OVLA 1SH2A 1C0UA 4KSEB 4DQQA 4ECYA 4CK1A 2IAJA 4M3UA 1T7PA 3LPUA 3ZSYA 4FJHA 3PX4A 5HLFA 4QWEA 2HNYA 4BE1A 5CYQA 3HHKA 3L2UA 4M95A 3CO9A 4AHSA 4B8CA 1CLQA 4FVMA 4FJKA 3LP1B 4ZPBA 4ZTJA 4Y1DA 3TVKA 4IKAA 3SUOA 2HHXA 4R0EA 1REVA 5KT5A 1DTQA 2I1RA 3MEDB 3MEEB 3OHBA 3UIQA 4RW4B 4KKOB 5KFJA 2PYJA 4FLWA 5J2NA 1RTDB 5K14A 2W9CB 2UUWA 3QIPB 3KK3B 3QNOA 5C24A 4ZTFA 2C22A 4OLBA 3TAGA 3SNNA 3M8PB 4F4ZA 3NAEA 4Q5VA 1S48A 1W25A 1GX5A 2DFFA 2BANA 4MFBB 3KIOA 2D0CA 4DTOA 3TANA 3SUNA 3WNFA 4O3QA 2WONA 3OYIA 1IKWB 2WOMA 4IG3A 1RYSA 1BGXT 1RDDA 4JUZA 3NGYA 1WAJA 4HTUA 1UWBB 3THVA 4MK7A 4LY7A 2G8VA 1TKDA 4NLVA 4J9KA 1DTTA 4OPJA 3QESA 3CIZA 4U6PA 3VQPA 2UVVA 1S1UA 4IFYB 1XC9A 4J9MA 3FSIA 1JKHB 4KHYA 4ECWA 3OL8A 5J2MA 3H5XA 1RT4A 1QE1B 1S9FA 1SUQB 1N6QB 4PY5A 1IO2A 2ATQA 3G6XA 3RTVA 4FJGA 1DLOB 1ASVA 1EETB 3BGRB 3HVTA 3FDSA 1NK4A 5HP1B 4LH5A 4CGHA 4DTSA 3ALYA 1EXQA 4CE9A 3CJ0A 3ITHB 4FXDA 1LWFA 2C2RA 4MQ3A 3RB6A 4M45A 3LAMA 3KHGA 4J9SA 2PY5A 5DGBA 3NH0A 2ZD1A 4TQSA 2AX0A 4E3SA 4ZPCA 4BE2A 5D3GB 3P1GA 4N76A 1RTIA 4PUOA 3AA5X 4RW9A 3VQ9A 4Z4FA 4FJ9A 4WFZA 3QINA 3LALA 2ALZA 1TL1A 4KRFA 1KLMB 2BDPA 5EDWA 1TKZA 3PR5B 1B92A 5KG5A 2BRKA 3KHLA 4FM2A 1NJYA 3MXJA 1EKEA 2VWJA 3CVKA 3GIKA 4K4TA 1XHXA 4N47A 3AO3A 4K4XA 5KFSA 1D0EA 2P51A 4O3PA 1TGOA 2XY6A 3NBPB 2EHGA 3E01A 3V6DA 2AWZA 3SPZA 2E4LA 4FBUA 3OYGA 3VQ7A 3ZSOA 5I3UA 2OPRB 2ILYA 5CY4A 4XO0A 3OYNA 3QZ7A 1RT7B 4ID5A 4KB7A 2Z1GA 3AVIA 3OY9A 5DQGA 3O4QA 4CJ4A 3NDKA 2RKIA 4ECXA 5KG3A 4QW8A 3IG1A 5T7BA 3GYNA 2R8IA 1GOBA 3QO9A 4O44B 2IBKA 3KD5E 3L2VA 3ZSRA 3HPHA 4YR3A 2FVPA 5KG4A 2W7OA 4B3OB 1S6QB 4RW6A 2FBYA 1S1VB 4FYDA 4Z4HA 3V9SA 3LZIA 2W9BA 4DS4A 2HHSA 5KRTA 4WXOA 2P1JA 4I7FB 3DYAA 5HROB 4MKBA 3NH1A 4G1QA 2B5JA 4I2PB 4H54A 1B9DA 1X9SA 2R2UA 2JGUA 3ZSVA 1WLJA 3SFUA 3ISND 5KFQA 3DLHA 1L3VA 4KHQA 1D1UA 1S1TB 1HNIA 1J54A 1HMVB 4AILC 3DOKA 3I5AA 1RDCA 4WXWA 1S1XA 2P5OA 3OLBA 3V1QA 3KOAA 3O3HA 1ZBFA 2WK4A 1NJWA 4O3RA 3O3GA 3OYCA 5T14A 1RT6A 3OSPA 4B9LA 3QETA 4RW7B 4EEYA 3MR5A 4ED7A 2O4GA 3O3FA 2JC1A 1S9EB 5KFZA 1XR7A 1T05A 1WNSA 2IOCA 2E9TA 1NKEA 4CF9A 3GQCA 3MR6A 4M3ZA 1TVRA 3G10A 2D41A 4CF8A 4HUEA 5F8JA 3HVAA 3MECB 4DSLA 4XPEA 2OH2A 4MIAA 4DF8A 4IG0B 3DLBA 3CJ5A 4ZHRA 4CF2A 3VQDA 1BL3A 3I5CA 3AVNA 5C25B 3IS9B 5KFFA 4ECUA 2G8KA 3ICLA 1ITGA 1IKXA 2J6TA 4OL8A 1XR6A 4FJIA 4ECRA 1D5AA 4QW9A 2V4QA 3VN5A 1Q8IA 4KBIA 3AA3A 4RZRA 3CJ2A 2HNZA 5L1LA 4E1NA 3OYEA 4FLVA 1RDBA 1L3SA 1KVAA 3MFIA 3SCXA 3DLRA 3KJVB 1JLAB 2YHBA 4FW2A 4RU9A 2Y1IA 3TWHA 3L2RA 5JUMA 4QCLA 1D8YA 3OYAA 5HRPA 2A1SA 2AU0A 2Z1HA 4JLHA 4ZVFA 2FVSA 3BSCA 4CGJA 4H4OB 3VQEA 2EC0A 1SL1A 4M3XA 3KHRA 4HCBA 3DLGA 2Z1IA 3BSNA 5KFOA 5L1JA 1MU2B 2XCAA 3L8BA 2UUTA 3PR4A 1QSSA 3V81B 5CYMA 3CDUA 2JLEA 5KFGA 2OPPB 3QGIA 1TK0A 3A2FA 4C8OA 3QNNA 2VG7B 2WTFA 1N48A 2BQUA 3NF8A 1QQCA 3IRXA 3LP2B 4IH5A 5KFDA 4FZZA 4OKEA 3QLHB 1TKTB 2HHQA 2RPIA 4CEOA 3C6UB 2VG5B 3KK3A 3M8PA 4O0IA 5SZTA 3OYJA 5F8HA 4WZQA 3K5MA 1HRHA 5FRMA 2YNIA 3KLHB 3ZSQA 3V9ZA 4YP3A 3AVAA 4JV1A 1IKYB 4NRTA 2XCPA 4K4UA 4Z4CA 3ZT2A 4DLEA 4FLZA 3KLFA 4WE1A 2OA8A 4BDZA 4TY8A 5I42B 3B6PA 4OJRA 4DTMA 4DL6A 3TARA 1NK7A 3AO4A 3V4IB 3K57A 1C0TA 4AHRA 3PV8A 3OLAA 5J2QB 4WFYA 3DRRB 1JXBA 2YNHA 5JS2A 4CJ5A 2E9RX 1F21A 3AO2A 4J2AA 4DS5A 4R5PA 5DLGA 4FBTA 4CF0A 1SUQA 4KV8B 5F8MA 4ECVA 3KLGB 3EZUA 1DLOA 4CJFA 2OYQA 3DLKA 2IM0A 1WSGA 4CEAA 4HUGA 4KHNA 4BACA 1NKBA 3NFAA 3LZJA 2OPSB 4J2EA 1VSKA 4Q43A 3NGZA 1IKVB 4FLUA 4J9OA 4NCGB 5KFTA 4F3OA 4IKFA 3BDPA 2BE2B 4ED2A 2FBVA 5L9XA 4IDKA 1X1PA 5KGXA 1JLEB 5D3GA 3G6VA 3BREA 1C6VA 4F3TA 4LQ9A 3K5OA 1JLQB 3UQSA 2RF2A 1SV5A 3T5KA 1NK0A 4J2DA 2CJQA 3WNHA 2XI2A 4K4VA 1TV6B 4LSNA 1HQUB 4Y3CA 4GVMA 5FDLA 2V9WA 1B9FA 4QWBA 4AHVA 4DL7A 3RR7A 4E7LA 4RW8B 3JYTA 3V6KA 4EP4A 4NLDA 3OS2A 3LP0A 3VQAA 5JS1A 3QEVA 4HVJA 4Z4EA 1WN7A 4YQWA 2HW3A 4NCBA 4CEEA 3AVLA 4FK2A 1UA1A 2XO7A 3I0SB 4ZPDA 2AGQA 2YKNA 3C6TB 3EZ5A 4G3IA 3HPOA 1QAJA 4DF4A 4E89A 4GW6A 2XWYA 4YFUA 4KI6A 4JV2A 4CGDA 3H2LA 3EYZA 3HP9A 1C0MA 3M8QB 2YNFB 1U49A 4C8LA 2XGPA 4DG1B 4B08A 4B9SA 3Q8PB 2F8EX 3MEGA 4HCCA 3ZSZA 1T8EA 4DSKA 1Z25A 1ASUA 2YNGA 3PZPA 5KFEA 3EY1A 4K4YA 5J2PB 3SV3A 1A5XA 1SKWA 5KG7A 4ECSA 2A1RA 2KTQA 1JLCB 4F50A 2DPJA 3ZT3A 4M3WA 2OZMA 3HJFA 4CEQA 1YTAA 2B43A 2IGIA 1RT2B 3AO5A 3AVGA 3DOLA 2WCXA 1SH3A 2E6MA 1C2PA 2ZE2A 4FS2A 2V0NA 2ZKUA 4IQXA 3CWJA 1RTJA 4KHSA 3FRZA 3RBDA 2YKMB 5KFUA 4FK0A 1HMVA 1LW2B 5KFIA 1KTQA 1HPZA 1VRTA 5HBMB 2R7YA 1FK9B 4PQUB 1LWEB 4Y2CA 1NOZA 1C1BB 1ZBUA 5KFRA 5J1EB 4BE0A 1JLGB 1WSIA 4ZP7A 3DLEA 1QS4A 1S5JA 4ECTA 5F8LA 4RNNA 2ITGA 4FJ7A 2FJWA 1J53A 4KO0B 4M3YA 1S9EA 1Z26A 2XGQA 4CK2A 3QERA 4B9MA 4H4MA 2ASJA 2KW4A 4O3NA 2D0BA 4NLUA 1RBSA 1L5UA 4LSLB 4EO8A 1LW0B 5HRRA 4Z4GA 5DG8A 3TR8A 4IG0A 4F8RA 5KFAA 4EYIB 1QSYA 4KE5A 4U7CA 3OHAA 2J6UA 2C2DA 4FK4A 1TL3B 3TAQA 4DL3A 1RT5B 4R8UA 5KT3A 3ZT1A 1WAFA 1S9GB 4NRUA 3HM9A 1JLBA 3TAMA 3V6HA 4MK8A 4CECA 2VG6A 2XI3A 1C1CA 4EZ9A 4BWMA 3DRSB 2IJFA 3DMJB 3KLIA 4EBCA 2JEJA 3OYMA 3KJVA 4FJXA 4Y34A 1J5OB 5KTQA 3SYZA 5C42A 3KK1B 1HYSB 1ZBIA 4K4WA 3F9KA 2IM2A 2W8LA 5KFPA 3HYFA 3OL9A 4C8KA 3RB3A 3PX0A 4ELVA 3F73A 4J9LA 3AO1A 1WSJA 1HQEB 3H59A 3BQ1A 1MU2A 4DU3A 5L1KA 4ECZA 3V81A 3H08A 4FCYA 1T03A 1RA7A 3PW2A 4Z4IA 1K6YA 3I8DA 1U04A 3FFIA 1HNVA 1ZBLA 4DSJA 4PWDB 1TKXB 4CIGA 1TKTA 2R8KA 3C6UA 1RTHB 4FM1A 3K5NA 4ZVGA 4CJKA 4W5QA 4CEZA 1BIUA 2XY8A 5KFCA 3VQBA 3AVBA 3BJYA 4Q45A 2I5JB 1RAJA 1HYVA 1S1WB 2OPQA 2FC0A 3KK2A 3AA4A 3TQ1A 4Q0BA 4CJUA 2HMIB 4ZVHA 3I0RB 2KZMA 3MTKA 2XHBA 1NK6A 4FJJA 3LANA 4GMJB 1N5YA 4URSA 3QGHA 1ZTTA 4FJMA 5EWEA 1FKPB 3RWUA 1K1QA 5DLFA 1VRUB 2JEGA 3OL7A 5FRNA 3KLEA 5J2QA 3AVHA 4KFBB 4ZP6A 4JV0A 3CFOA 4ED6A 1RILA 3OYLA 2J6SA 3GV5B 1S6PA 4XPCA 4DFJA 2LSNA 5F8IA 5F8NA 1FKOA 1LV5A 3OSNA 2UVWA 3CQ8A 1C0UB 1ZETA 5KFBA 1VSLA 1RYRA 3E51A 3RAXA 3P83D 1RBUA 4Y2AA 3CJ3A 1G15A 5HLFB 4NCGA 2HNYB 1Q9YA 5CYQB 3DRPA 4O4GB 2X6SA 2JEIA 1VK0A 3RMAA 4IFVB 3RAQA 5KGWA 4CHYA 4IR9A 1REVB 3K2PA 4CGGA 4CIFA 2AGPA 1HARA 3K5LA 1BIZA 1DTQB 3SI6A 4KHUA 1TQLA 5DQIA 1XHZA 1IH7A 4FLXA 1LAWA 4KHRA 1HJRA 5K14B 5C24B 4ZPAA 3OYKA 5KFLA 1T94A 1BISA 4B9TA 4ZVEA 2BANB 2Z1JA 4ECQA 4K8XA 3Q8QB 4DSEA 3VQCA 2R2TA 3QYYA 4ZMMA 4B8AB 2WONB 1CXQA 1SL2A 2WOMB 4IG3B 4CCHA 2ATLA 4DQSA 4OLAA 4DTNA 3KHHA 4OGCA 2KQ2A 4TY9A 1EP4B 5DK5A 3NF6A 4CFAA 4ED0A 1RT3A 1Q9XA
chains in the Genus database with same CATH superfamily
4F4XA 4BRCA 4ICLA 4CTAA 3OL6A 1G4CA 4AXIA 3UVJA 3VAJA 4DPYA 4J9PA 4I6MB 4FWOA 1VSHA 1ASWA 5CR4A 1RT4B 4UW2A 5FD1A 5A0YB 4FWPA 3CCLS 4LF8J 3QSIA 3G6ES 1YJWN 4F3QA 2C2KB 2Q3SA 4IH7A 3B8HA 4K50A 4URGA 2K7JA 1IBKJ 3M6XA 1I94F 3C3LA 2QL5B 1KQSM 1LWFB 2F8TA 2FLPA 2OUGA 2XZWA 4RUCA 4M94A 2R4FA 3PFOA 3ZCMA 2NSCA 3LL3A 2QFIA 2E1PA 4DL4A 1RTIB 2ETJA 3MM8A 3MEDA 3MEEA 2W01A 4KKOA 3CCZA 5IWAF 1X9WA 3ENQA 2IVPA 3EGZA 2HHUA 2W9CA 1EX8A 2RHSB 2IMWP 1BA0A 2KB2A 2D0AA 4OZ1A 4JI4J 2WW8A 3FRYA 4GRSA 4KT0C 1VHIA 2LMIA 4C9DA 5A2QY 2FVQA 1X4EA 1WF0A 1F6TA 2VA2A 1VSMA 2BR0A 1F3VA 1WWHA 2UUBF 2XSJB 4WKRA 3T19A 1N32F 3HSTB 1YRTA 1UWBA 5ETRA 3ZTOA 2ASDA 3CCWA 2J7WA 3E01B 5FPMA 4HHJA 3O1BA 4IXCA 4OYAA 2B4JA 3P8BB 2J0QD 1UAWA 3H7HB 2UXBF 4IFYA 2ZOMA 4E2FB 2G4BA 1JKHA 3BM7A 4J91A 4ID5B 4F4AA 2AJQA 2FSNA 4ID1A 4I2QB 1XR5A 3BY5A 1VSDA 5DO2A 3D0PA 4CLLA 4LFBK 4PG8A 2B0GA 3ZETB 4U7UD 4H5NA 3BR9A 1GLCG 2KJVA 1XMBA 1MLAA 4C4WA 1MWMA 2VCPA 2VQFF 2Q0RA 3NAHA 3VQQA 3HFKA 1P9QC 1AXQA 3E3XA 1FWKA 3VV2B 2W24A 2QV6A 1QHAA 2PN6A 2O67A 1P90A 1NSKL 3LPTA 3M2VB 4G1QB 2B5JB 2UXCJ 4WFXA 4E1MA 4Z7YA 4M5GA 3RRGA 1BI4B 4YOYA 1HNIB 3CMAN 4GMKA 1N0VC 4J5OA 2RHQB 1KLMA 1YBTA 1S1XB 2AHOB 4JI0J 3RR8A 5LY3A 5AE3A 1BU6O 1HNZF 3H5UA 4USMA 1B7YB 3H40A 1N0UA 4X4NA 3ID6A 3LF0A 2WVDA 4IFEA 3I55S 1PC5A 5GAGP 4X62J 4OYIA 2IDLA 4NLBA 1U24A 3IKMA 2UU9K 2GELA 1QUVA 2ADBA 4LF7J 2JZ5A 1NOYA 4B3RJ 3BBCA 3NF7A 2FD2A 5LMNF 5HRNA 3BO3A 5KFWA 3QFHA 3ZZTA 3AJ1A 4ALZA 3TA0A 1KNZA 4CD3A 4J9NA 2CG4A 3TW0A 1OJ4A 3EVOA 1WHWA 3UN2A 1BG3A 2B6AB 4B3MF 3TAEA 2AMCB 4LUBA 1S6QA 1JL1A 2AP1A 2GAHC 1X4BA 2UUAK 3VA0A 3NVMA 4RL1A 2Z2MA 3HVRA 1H7XA 4QR1A 5D4NA 3VVTA 2X78A 2QN6B 3DKDA 4ZCKA 4I4BA 2CADA 2Q1NA 4C6AA 5GAGI 3HK2A 1WOQA 5JICA 2VF3A 3T9NA 3L2WA 1SI9A 1S1TA 1OH6A 4KH5A 5T7LA 4C1NK 2IMOA 1IXKA 1YTUA 1U0SA 1TUVA 3W2VA 1WTFA 2ABYA 1FE4A 4O4GA 4B9QA 2PE8A 3L2QA 5BPLA 1NHVA 4A59A 4NYFA 3OR1B 3EDRB 4BRGA 2BMBA 4IFVA 3MDQA 4CHNA 4DU1A 4Y28C 4C23A 3CC4N 1CLFA 3NNAA 3VALA 2KFZA 3KFWX 3PRVA 2RE1A 4CM2A 3VENA 5H9EJ 4USUA 4C48A 3MECA 3EZWA 3ZYYX 4CYUB 1VQPS 1FFSB 1RNHA 3CERA 1VQ8N 2ZQBA 5KT7A 4M7XA 3MM7B 5MAOA 4WFAL 4Y6IA 3VQ4A 3POTB 1FF2A 3SJJA 4CERA 2OFGX 4DWIA 4FJ5A 3O08A 4BC7A 1C0TB 1YRUA 2JEFA 1H2VZ 2P8IA 2H3GX 1NK9A 5BR8K 4L74A 1U1LA 1XMOF 2DTJA 2OTLS 4A8MP 3RSEB 2AYEA 2MKYA 2HVIA 2G8UA 2P5VA 3C8YA 3SSSA 4PXCA 5IV4A 3ZTRA 3M8RA 4DTRA 4GC7A 6FD1A 2VZ9A 3T5HA 4FF2A 5DG7A 4KB1A 3DM2B 1BWFO 2F9TA 3ENAA 2VPZB 2O8DB 4IRDA 3RG6A 5T41A 5EUHA 1WSFA 3RRHA 3QFWA 5DDRC 3FBFA 3NMUA 3A8KA 1A6LA 4MLHA 1U48A 4V1Ak 1Y5LB 3TRGA 3BBBA 3OYHA 2MTLA 1BQMB 5EWFA 1EARA 3H90A 2WTUA 1R0BG 2P9UA 4HYKA 3NGIA 3Q86A 1FTCA 1NAQA 2KXFA 5FDLB 4CFDA 4ED5A 2OELA 4DV0F 2P9CA 5AQFA 3AVFA 4F3MA 2OMLA 4A4JA 4ANDA 3EEQA 2KVQE 4FZVA 4RNMA 3EPIA 4LF5K 3MMBA 4TQRA 4KGMA 4A62A 4LH4A 5KFKA 2E6LA 2XSJA 1CZAN 4A8SA 1O13A 4CFBA 1RGIA 2D1CA 1U0HB 4CJQA 4A8OA 1OYEA 4TN2A 1YT3A 5GVQA 1U1NA 1UA0A 3Q2SC 3MCSA 1ZM4A 2P9LB 3QRPA 5JLFA 4F2SA 1TELA 2B56A 3GG1A 1X0PA 1JB0C 5KFNA 4I2QA 5ADZA 4MIBA 3OHRA 3OJSA 1SC3B 2YNGB 2WB1D 4E19A 1Y9OA 2PI5A 1RSCA 2ZH9A 1KHVA 2RSQA 5CHCB 3ZETA 3WEEA 4P2FA 2IAJB 4DKWA 1Q81O 2FQQB 5EGYA 1NDKA 4J7CA 3DRYA 1O8BA 2B7BB 4CK3A 3OYBA 5E84A 4DV7J 2BE2A 4RLEA 2HS3A 4LD0A 5AQYA 1IG9A 3SUPA 1QDUB 4QWCA 2MKKA 2R42A 3V9WA 1JLEA 3JSRA 3NWGA 4DUZF 5DM7L 1VGYA 1N34F 1Q8LA 3CCLN 1XJWB 3AT1B 1FNXH 2D3UA 3G6EN 2MLYA 1BI4A 1RAFB 2X1GA 4WYBA 5LL6d 1AROP 2NS1B 1S5ZA 1R8PA 1VSIA 3C15B 3D6FB 4YOWA 1S72S 2EW9A 3O2IA 3DLEB 3D0GE 2P9NB 3X1LB 2ZHBA 4XIUA 1H98A 2Q66A 1WUUA 1ZBHA 3CG7A 3CC2S 3T1HJ 1GTHA 2WB4A 2R7OA 5AQZA 4QOZB 4CHQA 1IV0A 1S0MA 3CW2C 3RMDA 3V1RA 3LWLA 5BYRA 2RT3A 2AZ1A 3G4SS 4C1NI 5EU7A 2HF4A 1L3TA 4YDDB 4RBVA 4C8YA 1U45A 4NLTA 1RISA 1S59A 1TUGB 3AODA 4DSIA 2AX1A 4BDPA 1X5OA 2ITMA 2IA6A 1LEOA 2B6AA 3HVTB 2VG6B 1C1CB 1S10A 1QHTA 3F5TA 3W63A 3D0IE 3VA3A 4C3MA 2LEPA 3IAYA 1QSLA 1BCOA 2V2KA 3M6UA 1RAGB 2IVNA 4X65F 4MKAA 1YHQS 4Q44A 2J0XA 2U1AA 1RBVA 1P8ZA 2XYHB 3BSOA 3R8EA 4DTUA 4BBYA 2XB2D 3HZEA 3OV7A 3JSBA 1JXLA 1WBBA 2XS5A 3FC9A 3S01A 5HBMA 4PQUA 4FLYA 4ZDNA 3VGMA 2AYBA 4QR2A 1JLGA 2QXLA 1W97L 3D0HE 1UVMA 2HBZB 2W8KA 3BYRA 4PL7A 3NAIA 2G8FA 1Y7PA 4HI2A 3R97A 1QLNA 4WQ5C 4ZPWR 1S7IA 1M90O 2BXJA 4JI1J 1IM4A 4JYAJ 3CEDA 2VWKA 2OPQB 3KK2B 1S4FA 2YV0X 2ZITA 1RDWX 5D0RA 2NXEA 4OZ3A 3MM7A 2VC1A 2MXYA 3I55N 1TL3A 2QEXS 3W8GA 3POTA 4UQTA 1HNXK 4LF4J 4DL5A 3SI8A 3ZTQA 4CWBA 2GIQA 5D0HA 3MR2A 4DV1K 2WRMA 4EO6A 3O6WA 1D9FA 4RR5A 1IQTA 1T9XA 5B0EA 3LWMA 3OJUA 1XNRK 1X60A 5M2PA 2DBBA 1KR4A 5B08A 3DM2A 2QTDA 3R27A 1FXRA 4AQYJ 5B8HA 1CZBA 1HWKA 1RUSA 1OKJA 4CHOA 3W65A 4O4RA 5DGAA 4I64A 4NLOA 4F26A 2BEFA 2YXLA 1GX6A 2RRNA 4Y65A 2BQRA 2DCUB 4ILGB 2HFNA 3LW5C 2HFVA 3GJTB 3AA8A 3KKSA 3ZX3A 4AH9A 1YVFA 2B51A 1BQMA 1XI1A 2JC0A 3TR5A 2BX6A 4LF9K 1VSEA 1XBWA 1TUUA 2PFDA 3N6MA 2GV9A 2PMWA 1NKCA 3VQSA 3SUQA 4YNQA 3FMWA 3HFVA 2I5JA 5C2GA 2G13A 2HIQA 4KAIA 1U2FA 4YOXA 3VR1A 4DR6K 1CPZA 2ZH2A 2MGZB 1FHTA 3LP3A 3QJPA 4GY2B 2HVZA 1VS3A 4L76A 4E98A 2C28A 1ZM9A 1U0HA 3AQPA 4AHCA 4L3NA 3QEXA 3CCES 3VF2A 2M8HA 2HQCA 2P9KB 2JH3A 3MR3A 1VQYA 1XTZA 2W4CA 5E33A 4WU2A 4DOZA 2H5JB 5BPMA 1F0XA 1NPPA 4NYZA 2YHAA 4OVLA 1GLFO 1P9YA 1SH2A 4KSEB 4DQQA 1ZOTA 2IAJA 2OTJN 3P3DA 4I69A 2IYGA 2KG0A 3UB5A 5CAAA 3WBZA 4B8CA 3S1TA 4FVMA 4LFCK 4ILHA 2Z56B 4CO1A 1T3VA 2AJ4A 2OTLN 3PIPQ 2QWMA 4BG9A 4M63C 4FNHA 1VC0A 3IUCA 4IKAA 3D2EB 2HHXA 4KY3A 3J7Z5 4CZMA 3N4QA 4NYPA 3O9QA 3AGKA 3GJRB 2QIFA 4UT4A 2HQIA 2KHDA 2CPZA 4D3GA 5CYJA 2VC0A 4OI0A 2CZ9A 2PYJA 4CO3A 5K14A 1F2HA 3KK3B 5E0OA 2Q97A 4ZTFA 3SNNA 2MZJA 3BEXA 3M8PB 3M3ZA 3NAEA 4Q5VA 4DV4K 2DFFA 1HBMA 1ZPVA 2XNQA 4WU3A 2W2NP 1U2VA 4JI3K 2LQJA 1RDDA 2CPXA 4PKIA 3THVA 4MK7A 4FSVA 2HHPA 1FDAA 3D67A 4OPJA 3VQPA 2BJ9A 3FSIA 3A1YG 3F56A 5KPTA 1YLXA 4R25A 1Q81T 1UVKA 2Z2ZA 5HSPA 1RGVA 3SJHA 3A8IA 2HSTA 4KGVB 1T6CA 1N6QB 2IVYA 3HVTA 3FDSA 2FPHX 1UMJA 1NK4A 4JK8A 5HP1B 5HAOA 1R8CA 1FDDA 1PBAA 2D69A 1ZH5A 2G2OA 2O8CB 3RB6A 3QNWB 3A3PB 3C65A 4TQSA 2DR9A 1T95A 4N76A 2JVRA 4RWWA 3VQ9A 1E6YB 4WFZA 4PXEA 3WX4A 2A6OA 1N5VA 5GMEA 3PKYA 3UNGC 3B4MA 3GL1A 5EDWA 3LDLA 5LJ5Y 1Y11A 1HWIA 3ENOA 3QMLA 4K4TA 1MN7A 2CQ3A 3CMES 4FWRA 3EVWA 1D0EA 4JHDA 4L3KA 2GWKA 4JB8B 2DHSA 4EIAA 3MZIA 2DIVA 3JS6A 2VASA 3SAGA 2LQ9A 1WC1A 2HPUA 4M5MA 3NBPB 1DEJA 5C10A 3D4JA 1A7GE 3SBMA 4DR7J 3MN7A 4PWWA 2WVBA 4HT7A 5CY4A 4C7QA 2MLZA 3OYNA 4JKFA 1UPMB 5EX0A 1S72N 3AVIA 3OY9A 5DQGA 1GNKA 4QPTA 1DGKN 5KG3A 1D3WA 3HSCA 4OPAA 2ZKTA 1NXIA 4GV6A 1GOBA 3CC2N 3CPWM 2IBKA 2F1FA 5AQKA 4DI6A 3L2VA 3HPHA 4YR3A 2FVPA 1OH8A 1WI8A 2ZNZA 3G8QA 2FBYA 2LECA 1S1VB 4BS2A 1E4GT 4B3SK 4DS4A 2HHSA 4CZLA 4WXOA 3G4SN 2XEXA 1ZAXA 2LDYA 3W64A 2YKOA 5HROB 1Y10A 4MKBA 1QQMA 4I2PB 4H54A 3DNCA 4P71A 1WHVA 3ISND 3DLHA 3CD6S 3TX0A 3US5A 2QTWA 3VGTA 3I5AA 3SQGB 4WXWA 2P5OA 1B64A 4DR3F 3KOAA 3O3HA 3SDEB 2DO0A 2D0OA 2P6TA 2QC3A 2ZJRL 1DAXA 1YHQN 1PBUA 3O44A 3W9JA 4IEEA 5G0RA 5KFZA 1ZA1B 1N36K 1WNSA 5FPEA 1WKLA 3GQCA 2JLGA 2JFKA 4LF1A 3MR6A 1FWLA 4HUEA 5F8JA 4A5AA 4XPEA 2O3DA 2GMHA 2MGZA 4ZHRA 2LU1A 4CF2A 3VQDA 4K43A 1PJ6A 1LOUA 4KHPF 1BL3A 3AVNA 2UXBJ 5LSLA 1F1BB 4ECUA 1IKXA 2J6TA 4OL8A 4FJIA 3DCAA 4ZN3A 1D5AA 1OY9A 4KBIA 4C97A 4NA1A 2P9KA 4IO9L 3CJ2A 5AZIA 5IS2A 2HNZA 5ETMA 2O8FB 1TL7B 1VOMA 2BV3A 1L3SA 1DT9A 4JV5K 3GTYX 4GNIA 1ZZNA 2RHKA 3D1QA 1JLAB 3RW6A 2YHBA 4RU9A 2V4JA 4RWTA 2E5LK 3OTDA 5JUMA 2VQFJ 3BGOP 2QEXN 3THXB 2XMWA 3ZZZA 4JI2J 3BSCA 4CGJA 4ZVQB 2EC0A 4P2SA 1O51A 3HF5A 4M3XA 3CIMA 3DLGA 2HBMA 5AQPA 1RWUA 2W6LA 1QAYA 3CULA 2ZHAA 3HHLC 4V19J 5CYMA 2JLEA 2OPPB 2VOOA 4O5FA 1MW7A 2OCEA 4DV3J 4KH4A 2VD3A 3WQTA 5A8RB 3H42A 2E1CA 3NF8A 1QQCA 3IRXA 4DHVA 4P6QA 5KFDA 1VBXA 4OKEA 2RPIA 1GXLA 2VG5B 3KK3A 4GVBB 2YI1A 5BRDA 2GVDA 3LM9A 3M8PA 3T6JA 4UOHA 1HRHA 5FRMA 2YNIA 2BJ3A 4JV1A 2O1PA 1IKYB 1RHMB 2CDRB 2GS8A 2YJFA 4OJHA 4FLZA 2PT0A 3KLFA 2OA8A 1QQOA 9ATCB 2PA3A 2ZM6J 1G6BA 2FB0A 4TY8A 1PSDA 3B6PA 3W3SA 4AYBD 2LDIA 1VK8A 4DUYJ 4DL6A 3TARA 1NK7A 1SBRA 2WUSA 1B4SA 5AQIA 3PV8A 1BDGA 1WC0A 4JOUA 2G2ZA 2IVMA 2DNZA 1F21A 4QS7A 2YPZA 2V8PA 5F8MA 2EEYA 4LFBF 4WQ4C 3DLKA 2IM0A 1WSGA 4HUGA 3NFAA 2RRAA 3NS5A 4BRKA 3W5XA 4Q43A 2UV8A 1SQEA 4H0XB 3NGZA 3CCEN 2QWQA 2N4CA 4JKGB 4J37A 3GP9A 2BA9A 1FJCA 5L9XA 4IDKA 1CULB 1U1PA 4J90A 2Z0GA 4LQ9A 3K5OA 1VQOS 1JLQB 1ZA2B 3UQSA 2BTFA 4Q7AA 1Q7LB 5SUHA 1YRXA 3PLAA 4K4VA 4LSNA 4GVMA 4Y3CA 3VZHA 1FX4A 4W98A 4AHVA 4DL7A 5A8WA 4E7LA 3MGJA 4RW8B 2GQQA 3A8EA 4NLDA 3I6PA 4JP8A 2VH7A 3QEVA 3MMCA 4LFAK 3CETA 4HVJA 4Z4EA 2IRXA 2YPYA 4NCBA 2YH0A 4CEEA 1RQ0A 2G2YA 5A76A 5HOOA 1UA1A 5GAEI 4K5SA 3EZOA 2M4MA 5E26A 4G3IA 3W7BA 4DF4A 4LIWA 2FJBB 4K0KK 1HX1A 1HBOA 1U8WA 4KI6A 2KVIA 4CGDA 3UCGA 1GLEG 3R5GA 2R7SA 3HP9A 2RB7A 2XGPA 4CZEA 4OMFG 1KEKA 3W3DA 1URRA 4PG4A 2F9WA 4YY3J 1ASUA 2O8EB 4ZLPA 4JBCA 4FWSA 1YJTA 2VOPA 5J2PB 3BV8A 3SV3A 1SKWA 1A5XA 1FRXA 3R5CA 2DPJA 4M3WA 3U9ZA 5M1OA 2OMOA 1X5PA 1SH3A 2HLUA 4ATNA 2GEMA 3AFGA 5AXNA 1C2PA 4FS2A 3PJ9A 3BH7B 2LVWA 4CVNE 1KTQA 1YX2A 1VRTA 2EWSA 4Y2MA 1OMSA 2OEJA 2CQ2A 5J1EB 3MAAB 3SDEA 4QZVB 3IO1A 1QS4A 3SIPB 5HJYA 5HO4A 1W7AA 4RNNA 2ITGA 2GGPA 2M70A 3TEHB 1J53A 1WBDA 4M3YA 1Z26A 5C15A 1RAAB 4QQBA 1CJKB 4Y0FA 4H4MA 2X3GA 2Z30B 4K41A 3DXSX 5AXMA 3PXGa 2NNWA 1RBSA 4JI5K 2IIHA 1YJNS 4DJBA 3D2FB 1FXLA 2XG8A 4M5NA 4JK7A 2DGQA 1N33F 2F9DA 5E3RA 2M5YA 1QSYA 4KE5A 2PI4A 4G9ZA 2C2DA 4JKCA 3CMEN 4FK4A 1UJ6A 2JVOA 2IRYA 1V9OA 2L9WA 3HSDA 1IVZA 3IC1A 2NRVA 1RHUB 5BR8F 1K0VA 3VEWA 1TL7A 2XZDB 2X1FA 3N4PA 3DMJB 3KLIA 2UUCJ 5DJBA 1N8RO 5B0DA 1J5OB 2DR8A 2JSXA 1VC5A 1ZBIA 3W66A 1GLBG 5KFPA 3PX0A 3P4IA 4ELVA 2BM0A 4YN3B 3WHIA 3FR0A 1HQEB 2QGFB 1CBKA 3JB9k 1NHKL 3O5BA 3H08A 1FJEB 4X64F 1RA7A 4BLGA 4Z4IA 4DV2K 1SXLA 1PCAA 1CG2A 1HNVA 1ZBLA 3FBCA 4B17A 4CIGA 4L73A 2R8KA 5FLXY 4XAKA 2KT5A 4ISFA 3CD6N 1S7HA 3VQBA 2F4VF 2E7VA 3U27A 4KH0B 3KXDA 3BJYA 1VLYA 1S1WB 3ENBA 3P5BP 1UVNA 2QWPA 1EZZB 4RCHA 3EMTA 3MTKA 2XHBA 4P2MA 3NMRA 1N5YA 3QGHA 4Y0WA 1HBUA 3ETOA 1IBCB 1VRUB 5DLFA 3MM5A 3OL7A 5FRNA 1IBMF 1R6YA 4ZKAA 4ED4A 1UEKA 3M1FA 4JV0A 3VCDA 3CFOA 2W7AA 3OFHA 3PIOL 1PILA 4XPCA 5IFMA 2BKOA 1VHXA 5M1QA 3I8BA 1FKOA 2FJDB 1LV5A 4AT1B 2UVWA 2QX0A 2M8DB 1ZETA 3GFYA 3RAXA 1PKUA 4H0YB 3CJ3A 2HF3A 4X65J 5HLFB 1G15A 3MD3A 3BKUA 4KGZB 5CYQB 4OI1A 2KKHA 4DV5K 1D09B 3SXLA 1W2IA 1HNWK 3LA0A 2K8GA 3RMAA 4JD2B 3RAQA 4X66K 2FHOB 4CIFA 3UDEA 3MN5A 4BRDA 2FTRA 1TQLA 3NP5A 3MM6B 4HHUA 3WQPA 2DRDA 4LBIA 1HA1A 2XMJA 2ZC4A 2JWLA 2FHJA 4IOAQ 1ZPWX 1T94A 1BISA 3IBWA 4QYZK 4NE9C 4K8XA 4DU8A 3M5RA 2DR5A 3BF3A 1SL2A 3I87A 2WOMB 4IG3B 3D7SB 3UD5A 2PEBA 3KHHA 1EP4B 3CC7S 3NF6A 4CFAA 1VQSA 1Q9XA 1RE1B 1JMTA 1NBEB 3J81O 4U7BA 4MDBA 2V9KA 1IBLJ 4HHTA 2O8BB 2VQEK 2HSEB 4DR1K 2R7RA 1N4LA 4RBTA 1JIHA 4K4SA 4J2BA 3BQ0A 5J2MB 1VQNS 5LMUK 3TP2A 1KTVA 4OHYA 5KI6A 3R6LB 1FXXA 4NO7A 5KT6A 3BZQA 3D1HA 3IR7B 3OBIA 3UO0A 4ANEA 1CZ9A 2YX1A 4CZFA 3HRGA 1SJFA 2RN2A 4YOTA 3BN4A 2QLBB 3QT8A 3AAPA 1RWPB 4YDXA 3LP1A 3L3VA 3OTBA 3MX5A 3DLLL 3O1WA 5DG9A 2G8HA 3WXJA 1X7VA 2FVRA 4NXNK 4M5HA 1RKJA 2UYTA 3EGVA 1ZTWA 2QK9A 2MYFA 3ZX2A 5IWAK 1RTDA 1S77D 3DGVA 5F3TA 5J1EA 3I96A 3A13A 2FYXA 2HHTA 4X4OA 1FERA 4CLWA 4ED3A 5RUBA 3B82A 2E66A 1Q4RA 4U8YA 1KP6A 3HJVA 1VQON 3PO5A 2YQ1A 1YIJS 1ZXOA 3D2FA 3A0IX 1T9UA 1P6TA 1PO6A 3R3LA 5HMYA 3S3MA 3ZTSA 3MDFA 1JCFA 2NUBA 4M42A 1QE1A 1CJTB 4CEDA 3HP6A 4YB1P 4BGBA 3QFPA 5EWGA 1M5SA 3MPUB 3BGRA 3QO9B 1LFWA 1JK9B 2BW2A 3ULDA 4QPXA 2L08A 2LKZA 1QAXA 1RHJB 3ITHA 1J6ZA 1NU0A 1J5OA 2H5IB 2LCWA 1XNRF 3SMPA 3AJ2A 4CLTA 4ZVPB 2NXCA 1HQEA 3GJQB 3SQ2A 4PG7A 2MQLA 3ZXWA 4AUKA 4OI3A 1TFWA 1HNZK 2EPIA 2OZSA 5IT9U 5CZVA 2DGSA 3JTOA 3D1OA 3U9DA 4LF6K 1UAXA 1ICEB 3PYGA 1KFDA 1WKJA 4LF9F 2Y0BB 4FJ8A 4LF2A 1GOAA 2HZVA 1TVRB 2Y3YA 4H5VA 3I82A 2OPRA 2DPIA 2W40A 4L8RB 3CCMS 3EJMA 4DR6F 3NNCA 1PC4A 2W41A 3C6HA 1SKSA 2O66A 1NZ8A 2GIRA 5CZ1A 5HN0A 1DFDA 1N8RT 2HZCA 3QDKA 4B3TF 4XDCA 4O44A 4URQU 1QVFM 1EB0A 2NUUG 4B3MK 2Y0SD 2L41A 3HO1A 2RDJA 1RWKB 4ZVOB 3GFHA 1YJNN 2LYVA 4MKVA 3OTOJ 4CJVA 4BRLA 3Q23A 2UXCK 3UW1A 2ZJRQ 2HGLA 2A5XA 1MWKA 1UOCA 2R2SA 4EFHA 2DGVA 4I7FA 2DHAA 2KFNA 2MKJA 3RMBA 4QWDA 1M1KO 3ID8A 3R5AA 2DGTA 4G65A 1K8AO 4LQ3A 4CF1A 3FQLA 3VQ5A 2CPEA 1SJQA 2W1BA 2FJAB 2V2ZA 3GSIA 4DL0C 3ASMA 3M2RB 5D4PA 1LAVA 2I2YA 3VQ6A 3NH2A 4NYNA 3VF4A 3UDLA 4BVOA 4RW7A 5C2DA 3D2WA 4KQZA 2B8QA 2YX4A 1DQ8A 4M5DA 2IJRA 4LF7K 4DR4J 4I9LA 4OYZA 2I38A 4PL8A 1KLNA 3MUMP 5DDOC 1OSDA 3MXMA 5LJ3Y 3QZ8A 2CJKA 4BRFA 4IUFA 2GFFA 3SQ1A 4X4QA 2OD6A 5HVHA 4DSFA 1NJZA 3MOJB 3V1OA 4AHTA 4WE1B 1N52B 4N56A 3Q8UA 2I6WA 4NLWA 2J76E 4FW1A 1XWLA 1EP4A 4E7KA 3ENWA 1RAOA 3K5PA 3WXMB 4BDYA 3CSKA 3Q8RB 4CBUA 1NU4A 4O23A 1VQLS 2P9EA 2O8BA 2QXFA 4RPFA 3BBFA 3R7NB 3U7JA 3AVCA 4DMZA 2V4RA 1XMOK 4O3OA 2E5IA 2HHHJ 3FZMA 2NXUA 3NCPA 3CCVS 4DTXA 1ZYQA 3PEJA 1S12A 4KH1B 1R59O 3JAMU 5B0GA 2MB0B 4J9VA 1YG0A 3TZZA 4LR8A 1BHLA 1HFEL 4CHZA 2FLNA 1M5KC 2BJDA 3HD2A 3PYDA 1OSCA 4JI8J 1FW6A 4DPWA 1E6VB 2V50A 2FXUA 2D1KA 3OFGA 3S6EA 3ZZPA 4FYXB 4DDFA 2XLKA 2VG7A 4V19S 3IFEA 4OX9K 2XBPA 2HG4A 3LP2A 3FCHA 4GKJF 1VIOA 4ZN1A 3DI6B 2RF2B 1SV5B 2D7SA 2XC9A 3QSYB 1FEHA 2H1YA 4GKKJ 1NGFA 3FEYB 4B1VA 2I7NA 3U1MA 3DOMB 4DV0K 3KLHA 2D5RA 1J5EK 1AB8A 1RDAA 1Z4UA 3TI0A 1UVIA 3TJ8A 3TOQA 4TSXA 3I5BA 2JX2A 3C14A 4NMXA 2ZOFA 5I42A 4OHXA 2JWKA 3HSGA 1NJIO 1PGZA 3NKYA 3CI5A 1MMLA 5G4DA 4JKDA 3G25A 2CDQA 4YB6A 3DRRA 4M41A 3O9UA 4A47A 3NXZA 2GMJA 2QYCA 1X3MA 3O9RA 3MEGB 2UZAA 4BROA 2AYGA 3AOBA 4CGFA 4IRCA 1G7CB 5KPZA 4KI4A 4CIOA 2XHCA 1UCNA 1WELA 2ZH1A 2OPSA 3CC7N 3HI9A 3WC2A 1IKVA 4CEBA 4B3SF 1Y3JA 2CNKB 3C66A 4JRQA 2GIFA 4AL5A 3BH6B 3IGVA 1VQNN 4HACB 3NGDA 4DUZK 2ZE2B 4LT6A 5IT9O 3G71N 3VEVA 2CQ0A 1NEEA 2B4UA 3RBZA 2QT7A 3TJAA 3CYMA 1HPZB 3J7YI 5BN9A 2WAQD 3E2EA 3C94A 1IWAA 4CJLA 1AUSL 3VWSA 3CM5A 3DHWC 5D78A 2OSQA 3PJWA 1CSJA 1Y5IB 2HBLA 2V5HG 2FZGB 5L1IA 2XY5A 5KT4A 4DQRA 3VGKA 2VODA 3B78A 4BR0A 4DB3A 2X74A 1RDUA 4FJNA 4C0HA 2A18A 1X4AA 2D3OR 3C6TA 2CJ9A 3KJQB 1V3SA 5GADU 2HWHA 3HCXA 1GXUA 3PW0A 3N9UC 1D9DA 1FTRA 3PX6A 1S1UB 4IOCL 4DG1A 2HQFA 4K42A 1A5VA 4IOBA 1EO1A 5ETTA 4B9NA 4ISGA 3DRXA 1YBUA 4R8UB 3PO4A 4F4WA 1BMQB 3J81j 4HLBA 3TAMB 4YMEA 1P1TA 2C2NA 2VFUA 1JLCA 1YK9A 4LFBJ 3V5RA 5ADXA 3S9HA 1OQ3A 3MFHA 4W5TA 3BEGB 1RT2A 4H0VB 4W5OA 3C46A 3RGIA 3U6FA 3OD2A 3G6YA 1JL2A 2F96A 4KGKA 4ELUA 3EGWB 1KKHA 3IR6B 4JK9A 1GLJO 5M1FA 4OFZA 2MEWA 2YHXA 3CJ4A 3RW7A 1LWEA 2AJ2A 1C1BA 2CPHA 2O01C 4LMZA 2D0PA 1S97A 4W5RA 1WDDA 3M1VA 3FFIB 2E9ZA 1HW9A 1V4TA 2KZZA 5A6WA 2CQCA 4GVLA 2FC8A 2VHGA 2ZZTA 1NB2A 5F3ZA 3HVWA 2UU9J 1LW0A 3MCNA 4DN9A 3AY0A 4Q2MA 2WSFC 1GH8A 3HHDA 2VV5A 1NGAA 3EM1A 3HPGA 5L46A 1EKRA 4F0HA 4M5LA 2DFEA 4MTPA 3N28A 4CJPA 1Q1KA 1S9GA 3HT0A 3JAMO 4JS4A 2QMXA 3KLEB 3SZ2A 1DKGD 2HS0A 3U3GA 2V51B 1FEEA 2P9PB 1VSFA 3DRSA 3TAFA 1M1KT 4XTTA 4J8FA 5KRSA 2GHVC 1XQIA 1KQGB 2W9BB 1K8AT 3CCMN 2GUIA 3RJMB 2BQ3A 2W2MP 2NLXA 3KK1A 2UUAJ 1Q5YA 1RHQB 3TUZC 2CVEA 2Q31A 2RQKA 1UZHA 3CJSA 3HHLD 2MHNA 5F9LA 2CKWA 4BRPA 3I32A 2G8WA 2FZCB 2ZH5A 1NSPA 1WDTA 3QEWA 1VISA 4PR6A 3DRPB 2ASYA 2Z2LA 3ILJA 2GVZA 1M0SA 1TYQB 2I9SA 2VDIA 2HWIA 2BE7D 2QKBA 1QD1A 5HRSA 3BKFA 4HTIA 1JXEA 1VJQA 1XNQF 1HLWA 3TUJC 4P74A 4A8WA 3H25A 4PWDA 4OJ3A 1FRKA 1TKXA 3DI6A 1TP7A 1K73O 1U4BA 1RTHA 4NYOA 4TXSA 2O5DA 1WKKA 2VFVA 4JI1K 3W5ZA 4JYAK 3LDPA 3R1XA 4FJLA 3DOMA 5AXLA 5KG1A 5IQ6A 3O1LA 4DLGA 1B70B 1HI1A 2N82B 3H4DA 1S0NA 3CNQP 4NWBA 4X4VA 2AZ3A 4ENOA 2C2EA 4NCAA 3DU5A 3I0RA 3GB0A 4WP8A 3TUIC 1VQ4N 4BWJA 3FSXA 2JFDA 4A46A 1RCOB 2XLIA 3UR3C 4F0KA 1GT8A 4YHHK 4ICLB 1KBRA 4CTAB 1V3RA 4KJIA 2HVHA 3UVJB 4GV3A 3KMSA 2UVUA 3RVCA 2YH1A 3JQMA 4OGEA 1VQMS 4BR9A 5BR8J 1J9AA 3CXCM 2EK6A 4MO5A 4F4KA 1B7FA 1OPIA 2DRBA 2WBMA 3C7NA 2B3TB 1C0UA 1FX2A 4ECYA 4CK1A 1T7PA 1KOHA 2FGCA 3PX4A 2HNYA 2CNNB 4PYAA 1VQLN 3L2UA 2C3OA 3SSQA 1NGIA 4M95A 1WF2A 2C3MA 4DR2F 2A6AA 1R8HA 2P9GA 2PD1A 1CLQA 4FJKA 4ZVUB 4ZTJA 3TVKA 2DJWA 2ALYB 3VF0B 1RXOB 3SUOA 4BG8A 2D9PA 3DDIA 2M2BA 2JRSA 3MM8B 3SCKE 3MEDB 3MEEB 2PC6A 1HR0J 3UIQA 4KKOB 5KFJA 4DV6F 4G6VB 2W9CB 1WF1A 2C22A 3CJTA 3TAGA 4B1XB 3VZIA 5H1SV 1W25A 1KS2A 3TYTA 2BANA 3KIOA 1W2BR 5CCMA 3K8WA 4A5BA 2KXHA 3WNFA 2WONA 3SAHA 1NCLA 3CJ9A 3PACA 1RYSA 1OIAA 1MSWD 1CJUB 1PYTA 3NGUA 1WAJA 2OANA 4HTUA 2NCKL 1UWBB 4OHWA 4LF5J 4ES3A 1HHTP 2OGUA 4JI5F 1SZ2A 4A61A 1KD1O 3EN9A 2G8VA 1TKDA 3A12A 2AD9A 4NLVA 1DTTA 1FO1A 2ZFHA 2UVVA 1S1UA 4IFYB 5BXIA 1JKHB 2NYIA 2E7WA 3LQVA 3OL8A 1C4AA 3H5XA 1WEYA 1CQMA 3R5BA 4C11A 1ZAVA 3G6XA 1DLOB 4I6AA 4DTSA 3ALYA 4JKEA 4CE9A 2DNHA 4P9SA 1BWEA 1T9WA 3KHGA 4J9SA 4B1WB 2PY5A 1Q78A 1CJVA 2ZWHA 4USVA 2MQPA 2ZD1A 4DPUA 4ZPCA 1KN6A 3GFZA 1YWXA 2NZCA 4CH7A 5AQTA 7FDRA 4N8OA 4FJ9A 2ZVSA 3QINA 4PWUA 3LALA 2GTDA 5M2UA 1TL1A 1KLMB 5K8OA 2BDPA 4P52A 2MY7A 2VWBA 5KG5A 5A8KA 4M1KA 4YUDA 4BVPA 2OI2A 1DY3A 2X3DA 1EKEA 1XHXA 1K9MO 1SJ1A 3RBXA 2F5GA 2ZWOA 2VUGA 2VJVA 4W90B 1MDUB 2EHGA 4GVEA 3V6DA 3SPZA 3RYLA 1JWWA 3VQ7A 3ZSOA 1FE0A 5I3UA 3CGIA 1SB6A 1DBDA 2CGKA 4NLCA 1ZS6A 3K9KA 4LRDA 4KB7A 2RKIA 4NL5A 1UPPA 1W26A 4ZPVR 5AE1A 3V2UC 3IG1A 4YDUA 5T7BA 3KJNB 3FZ2A 3D7EO 5ETOA 3VQTA 5L9NA 2R8IA 4NZ6A 2HAFA 2PFFB 3ZSRA 2XYGB 4JKAA 1NMEB 1NMNA 1S6QB 3H45C 4RW6A 4FYDA 2VDHA 4Z4HA 3V9SA 3LZIA 2W9BA 5KRTA 2FZKB 2RRBA 2NZ4A 3KHYA 4C2MA 3T7ZA 1HBNA 3KG1A 3G8TA 5E3AA 2AJ1A 3DYAA 1VK3A 3T1YJ 3F9MA 2R2UA 3ZSVA 5KFQA 1S1TB 1HMVB 4AILC 3DOKA 5T7LB 4ZIWA 3TA1A 3M7VA 4U7UK 3W2VB 1XK8A 5AQUA 4DR3K 1TYQA 1ZBFA 2WK4A 3HHEA 1RAHB 3O3GA 4FOIA 4X66F 1RT6A 4B9LA 3QETA 3MR5A 4RTFD 5GAGU 2FDNA 2YWWA 3A5LC 3D3CJ 4DR7K 1SIZA 4CH0S 2GX8A 3ZNUA 1IN0A 1T05A 1MMNA 1NKEA 2E9TA 5ADXH 3VTIA 3TVZA 3W8PA 3P38A 4CF8A 4B1UB 3MECB 2E2QA 3DLBA 3PIPL 3I4PA 1OH5A 3MWPA 1NGCA 2HBRB 1ITGA 1XR6A 4BRNA 4QW9A 2CXEA 2KLAA 1Q8IA 3M4XA 3AA3A 3TQEA 5GIPA 4FPRA 4RZRA 2VQEF 4DR1F 1HNXJ 2J9DA 3MCAB 1RDBA 5LMUF 4ILLA 1KVAA 3SCXA 1UFWA 3WDOA 2KYXA 2L48A 1X0FA 4DV1J 2J4RA 4FW2A 2Y1IA 3TWHA 3L2RA 3A4TA 4Z7CA 5EX5A 3OYAA 3Q7CA 3TSPA 4ZVFA 2FVSA 2Q79A 4WFBL 3H1QA 3CT9A 2ROGA 1C0GA 4CZKA 2Z1IA 2A10A 2HFZA 1MU2B 3HZGA 2DD8S 1AFIA 3FEXB 1QSSA 1K73T 3GFXA 3CDUA 3HM8A 3FFKB 2WTFA 1VQ9S 4NXNF 3E9LA 1X4HA 4X84A 2QMUB 3S41A 1BO5O 4IH5A 5LXRA 5D0EA 2KXNB 2QG9B 3CJ1A 2N3LA 2HHQA 3D68A 3G82A 2P9UB 1BUXA 1G99A 2CH6A 4OI2A 3OYJA 4WZQA 3ETMA 3VAMA 3V9ZA 4YP3A 3AVAA 3CPWR 2YX6A 3HZ6A 2XCPA 4Z4CA 5HVFA 3MMBB 4PABA 4UUWA 1M5HA 1CJUA 1QQNA 2DITA 3WXLA 4CO0A 1H7WA 1NZAA 3L7UA 3M2UB 1NH7A 3AO4A 4AHRA 5LT5A 2ZUGA 5J2QB 3QMQA 1JXBA 2YNHA 4CJ5A 4J2AA 3J80U 3HSZA 2C42A 2E1ZA 3TNVA 4R5PA 4FBTA 5DLGA 4CF0A 2QMWA 1DZ5A 1YXQA 4JI2K 4ITSA 4ECVA 1FDBA 2MLXA 4FO0A 5CCLA 1IBKF 1DLOA 4CEAA 3WEEB 3LZJA 4FOEA 2MY8A 4DV3K 2J0SD 2BE2B 4LBPA 3SK3A 3QQCD 1K8KB 1X1PA 1JLEB 1VQMN 3IBCB 3N5BA 1C6VA 4LFCJ 1XN9A 5LSRA 3FMBA 2V8HA 2A2DA 4JI4F 4BRMA 1NK0A 4J2DA 3WNHA 4HTJA 4L3QA 3LTOA 4DX6A 1RK8A 3QAUA 2V9WA 1B9FA 1PYSB 3UFCX 2HQDA 4NPOA 3JYTA 4LF6F 2CGLA 8RUCA 3R1HA 3OS2A 3LP0A 5JS1A 1EWQA 5B0FA 4DV4J 2OAUA 2F40A 3FEZA 3PFEA 3ZZYA 3VF6A 2HW3A 3LO3A 4FK2A 2XO7A 4JI3J 4FPBA 2YKNA 3EZ5A 1NGEA 2QLJB 4E89A 5CA5A 3CJ7A 4C8LA 2YNFB 1FRJA 2GCFA 5K9FA 4B9SA 4NEZA 5LSOA 4HCCA 1T8EA 4DSKA 4QJVA 4PYDA 5D77A 3PZPA 3R3TA 1PJ7A 3EY1A 3H3OB 3OVAA 4CNYA 4M7YA 3MPVA 4H4KA 2A1RA 1FD8A 3AD8C 3ZT3A 1T9VA 3OQ2A 3VESA 4HDHA 2AW0A 2B43A 4IQMA 3FE1A 2MJUA 2UXCF 2NRTA 3R6GB 3DOLA 1VHFA 3GBTA 5EX3A 2X7IA 4L6V3 2E6MA 5B0BA 4A8FA 1JQGA 2V0NA 2ZKUA 4IQXA 1BQXA 1RTJA 4KHSA 3DLJA 3FRZA 4DZ6A 3PHTA 5HVGA 2DEIA 2ZJPQ 1K9MT 4W4MA 1HMVA 3KWMA 3TZYA 5HBMB 2R7YA 4PQUB 2CGJA 4Y2CA 1NOZA 2MZQA 2ADCA 4BE0A 4X62F 2LEAA 4QIWD 1JLGB 1WSIA 4ZP7A 4F67A 4IOCQ 4UY8O 1S5JA 2HWTA 1PIEA 2IVFB 5F8LA 1X31C 3PSFA 2FJWA 4LF7F 1NDPA 2OFHX 2KKZA 1FKAF 4CK2A 4EI2A 4R79A 4B9MA 2ASJA 2PBDA 2QA1A 1QJHA 2QYGA 2D0BA 2CJXB 4NLUA 4DQ8A 2R7WA 3ZX0A 5DG8A 1AYEA 2EFPA 3SCLE 2RUGA 3J7ZO 4F8RA 5KFAA 1N33K 2R7QA 2VICA 4A2BA 3ULEA 4U7CA 3OHAA 2J6UA 1WSVA 3QPIA 4H0OA 1TL3B 2LXUA 4CLFA 3TAQA 2OTJS 2W2PP 2W2OP 5M1KA 4NRUA 3I9V9 3HM9A 1YJ9S 4CI6A 1JLBA 3V6HA 5EOYA 4MK8A 4CECA 5EY4A 4EZ9A 2RH3A 1HKBA 2EG2A 4BWMA 3OUYA 1LK5A 3GR0A 2FSKA 1FCAA 1KWMA 3M30A 1PYOB 5KTQA 5C42A 3F0NA 1UEVA 3F9KA 2W8LA 2A6MA 3NWRA 2MSTA 3OTEA 1S57A 1ROFA 2VGMA 1GMVA 3H59A 1MU2A 5JJBA 4DU3A 3QGPA 2HOEA 1T03A 4X64K 4XEIA 1PAUB 3L4IA 3QT6A 2E88A 4OX9F 1FRIA 2OHDA 3L7PA 3O3LA 2YWGA 1RAIB 3IRWP 3S8SA 4WCEQ 5FPDA 2AIRB 4ZVGA 4CJKA 4W5QA 4CEZA 2VBZA 2J7KA 4JNEA 1BIUA 2XY8A 3E9OA 1UWAA 1J5EF 2DEJA 2F4VK 3UN3A 1IJJA 5JVHL 2I5JB 3VOVA 1N36J 3HOTA 3AA4A 3TQ1A 3SCIE 4Q0BA 3AOAA 2P9SA 2H5EA 4K8RA 1LOTB 2HMIB 4ZVHA 3NEKA 2B8PA 2KZMA 2YBVA 4CZHA 4FJJA 3J80O 4PKDB 3THWA 3VAKA 4URSA 1URNA 2WW4A 3QWUA 3M2UA 5EWEA 1FKPB 1K1QA 2V7YA 2HLTA 4V19X 1IBMK 5J2QA 3AVHA 1HKCA 3T41A 4ZP6A 1U6ZA 5BRFA 3HFZB 2A2CA 5HL7Q 5CQGA 4MLEA 3GV5B 1S6PA 4DFJA 2LSNA 5F8IA 5F8NA 4WTYA 4JV5J 5C2FA 1VAZA 3AA9A 4OV6A 1Q82O 1VFJA 4O8KA 1RBUA 2E5LJ 2V6AA 2UXDK 2J9CA 2DPNA 1NH8A 3R9LA 3F2KA 2CWKA 3IAM9 1K8KA 4HR2A 2NRRA 1WI6A 5KGWA 3SMZA 4CHYA 4EAHD 1BIZA 1VLOA 3SI6A 4KHUA 3GZ7A 5DQIA 3IXQA 4R0JA 1Q16B 1HJRA 5K14B 2CZ4A 4U9RA 2Z4PA 3O9SA 3OYKA 5KFLA 1TU0B 1VYAA 4ETXA 1GAOA 2B4PA 3CCRN 1HBMB 1Q18A 4DSEA 1T11A 4CO5A 4ZCLA 4IWVA 3VQCA 3QYYA 4NXMK 1OWXA 1U2VB 1CXQA 4YOVA 1VQ9N 1FD2A 4CCHA 4DTNA 2J8AA 3P6YC 3GE1A 3D6HB 1RT3A 3WIUA 4DPOA 2ZZNA 3U3YA 2M52A 2ASLA 1VQKS 1KHWA 3GV7B 3OBWA 1SJ3P 4FZYA 4FS1A 4CGIA 1PJ5A 4FM0A 2YNFA 3PY8A 2DY4A 4KTWA 1QAIA 1BD6A 1RBAA 4O0JA 1R0AA 3A3OB 3KMQA 3IGNA 2XMMA 3O9TA 4QIFA 2YTCA 2ERRA 3VAGA 3NMAA 2P2CB 4DFMA 2MSSA 4DV7F 4QAGA 3KDNA 1R8BA 3KG4A 4J9UE 2L9DA 3FCVA 4USWA 2NRXA 1VQ6N 1QVGM 3N6LA 2BRLA 3MXHP 2A0FB 2KI2A 3H2VE 2IHR1 1X8DA 1N56A 1UW9A 1SC1B 3OTCA 5HATA 3UR0A 4O3SA 2KG1A 4CIEA 4RW4A 1NHUA 3QIPA 4DR5K 1R89A 3AAWB 3PW7A 2HB5A 1FVQA 4I6WA 3OVSA 2KDOA 3WUHA 3PUFA 4MFBA 2E5HA 1MWYA 2DH9A 4JKHA 4GO7X 3U02A 5DS7A 4JHDB 4KHWA 3TO8A 4Q8EA 4OPHA 1IJFB 4A8QA 4M3RA 1GQEA 3CJBA 1IKWA 2MKSA 6AT1B 2V34A 4LFAJ 1I3AA 4ZP9A 4LVOP 5C0YA 1JLFB 2GHWA 3L3UA 1JNRB 4EK2A 2DHXA 4LR9A 2QA4G 1RT1B 3D6MB 4EZ6A 2IS3A 1Z2ZA 1YI2S 4K0KJ 3MHYA 4CT8A 3SQ4A 2CPIA 5KQDA 4ZPTR 2ZH8A 1J2VA 5KOXA 4H0PA 2G0CA 2LFVA 1EETA 2F65A 1KVIA 3M9NB 3Q8VA 5C2CA 3S3OA 3ATUA 3NS6A 1JJ2R 1MNEA 4CLYA 2QRRA 4JN4A 4CM0A 1BQNB 2RILA 3W9HA 1U2CA 4CP5A 3AV9A 1NMDA 4DTJA 3PW4A 1U09A 1X4DA 4DEZA 5HMWA 1JJHA 2IM3A 1SKRA 1FFGB 3KDOA 4M5IA 2KM8C 3Q2TC 1RLDA 4OPKA 1I5OB 1WC5A 3MCMA 2K3KA 1GEHA 3J7ZT 1LWCB 3GIMA 2KU7A 5G0RB 3SPYA 4JI1F 1Y4ZB 4JYAF 1GMWD 4LR7A 4WFNQ 3MXIA 4HKQA 4KHMA 4G1IA 2PMHA 5GADP 4DX8H 3HDSA 4DHYA 2ZF5O 1K47A 2CNOB 2A42A 4AL7A 1WOSA 3MD1A 3PVXA 4JI5J 2HMIA 2PFUA 1RT7A 4ZHRB 1YVNA 1LKZA 4NLPA 4DU7A 3ATVA 2HVDA 1M1HA 2O4IA 5JMVA 2D74B 1FJGJ 3OR2A 4KTZA 1IKXB 3THYA 3A5OC 3BUZB 5B0AA 1F9FA 2IYIA 1FKPA 1VBYA 2F8MA 4YHHF 4ELTA 2P5GA 1JX4A 3FJ2A 4B3TK 4IOAL 4DZDA 2Z2YB 4C98A 2YVSA 1MA9B 5AZIB 4AFFA 2HNZB 3IA0A 4B3OA 1F3FA 1VIXA 3D45A 1GOCA 3OS0A 4IRKA 3CD5A 4IO1A 2QKKA 2FGOA 1YVUA 2V4JB 3SQ0A 3RZAA 1GXTA 4AQYF 4UY85 3CJ8A 4OLOA 3P5TL 2KYZA 1ATNA 4F2RA 3BDEA 1YJ9N 7AT1B 2HGMA 3MEKA 1RCXB 4NX9A 3DLGB 3SFGA 4CFCA 1W0HA 5GADI 5CYMB 1AUDA 2HVEA 2X6NA 1NDCA 3AVKA 1GK8A 1KSPA 2YQ3A 2ROPA 3IRXB 3H5YA 5IXUA 4N41A 5ITHA 4DV2J 2DISA 3MX2A 2CQGA 4BC5A 1DQ9A 4H5RA 1R27B 2X1BA 4TLRA 3B8AX 4ERDA 3QEIA 3IDHA 4DMNA 1TMMA 2GVDB 1U8SA 3U1NA 2RS8A 2YNIB 4OYMA 3L4QA 4B9UA 1SL0A 4PKHA 4OZ5A 4LRFA 2A3ZA 2WHOA 3RRKA 2R8JA 2KRBA 3C95A 4FN5A 3KLFB 2FJEB 2XZTB 5KG0A 4EBDA 5C25A 4TY8B 3IS9A 5KT2A 2FBTA 4E7HA 2ACMA 2AA4A 4WFBQ 3UNYA 4C8NA 2R8GA 1KVKA 4K2XA 1S0VA 2R3VA 3G8SA 1RBLA 2EX3A 3CD7A 2GC8A 3S3NA 4O55A 2CAJA 4DX5A 1Q82T 3T1AA 4HUFA 2IC3B 2HHWA 4QOTA 1S49A 1KVCA 2E7XA 1T6DA 2MPUA 3ZZOA 1TAUA 4IR1A 3DLKB 4M3TA 5ETQA 2H4WB 4H4OA 4AF1A 1FA0A 3LDNA 5M1PA 3QGGA 1SQFA 2CH5A 3N79A 2KL8A 2OSRA 2WSCC 4BRAA 4IDKB 3CCJS 3QIOA 3ISNC 4DV5J 4DR4K 1JJ4A 4QS8A 4CJ3A 2N4DA 5B0CA 3IMQJ 2NR0A 1HNWJ 1IM6A 5LL6Z 2G8IA 4GKJK 2BJEA 1UL3A 3VEZA 3OYDA 3QLHA 4OLPA 4X66J 1U1KA 3UD4P 3M6WA 2Z57B 4ZITA 5CH7B 1S0OA 4K7QA 4LSNB 3IWNC 1XUPO 3TTCA 5SWMA 4WYWA 3RMCA 3C16A 5A8WB 3V6JA 3H6EA 1VSJA 4H8KA 2NRZA 3CJKA 2XY7A 2IFXA 3HKWA 4K25A 2W7PA 1YGYA 4P75A 4QYZJ 3MMCB 3AD7C 3UKUB 5K5MA 2XMAA 4LRBA 1HWJA 4GO5X 2GJFA 4C8ZA 2DNKA 3V4IA 1JLFA 2ZUAA 4Y1CA 3GIJA 3HSJA 1HBOB 3RAMA 1RT1A 3AOCA 4U95A 1T3NA 3HBTA 2VQEJ 4DR1J 4B1ZA 3QAEA 5LM7E 4KV8A 3FVYA 3CF5L 3K59A 3QBCA 3IWXA 1BCMA 3KLGA 2XQCA 4FVUA 3CM6A 5KFXA 3MCPA 3QATA 5KFYA 1HI0P 3W1YC 5GAEU 2MJNA 3EXCX 3U4LA 4J9QA 1VQKN 1F5CA 1YKWA 1BQNA 1I94J 2FLLA 3E8OA 3CQXA 2ZBIA 3ZTPA 4U67L 2JJ4D 4CJRA 2NQPA 1W9HA 2LQ8A 4HDGA 1S6UA 1RABB 2XYPB 5ETVA 4GKKK 4B1YB 3IN5A 1C0FA 1VRTB 5J2NB 1TV6A 2YX7A 1HQUA 3DJCA 4P2XA 3L95X 4MJKA 1SJRA 5IWAJ 1TZ0A 1VI7A 2V8DA 4AD6A 1M90T 4BC2A 3LGNA 2BVZA 4MYUA 4OHZA 2GGPB 1LWCA 4DR7F 2RU3A 3GPAA 3PEHA 4H4MB 2E1RA 3ZNJ1 5FROA 3NL0A 1UFKA 3I0SA 2RQCA 2UUBJ 4J9RA 2IM1A 3D6RA 1EX4A 3PG9A 1N32J 1SIWB 4BR2A 3B6BA 3OW2R 5KG2A 3O8WA 4MK9A 2MZSA 3M8QA 2CQ4A 5KOWA 1LNQA 2AKWB 2R2RA 2NUHA 4AHUA 5AZJA 4OO1J 3MWBA 1KVJA 3O4WA 3QT5A 3GCXP 4OZ0A 5KPRA 1VQ5S 5JVGL 1RU1A 2OEKA 4I9QA 3KLIB 4OI6A 3HL8A 3CDBA 4CBWA 3N6NA 4F4YA 1YI2N 3MPDA 3M9MB 3VAIA 1ITPA 3H5SA 3NS7B 2Q1LA 3VTHA 1XQSC 4PUOB 2YKMA 1HIYA 4RW9B 5KFVA 3H46O 4ZP8A 2FVCA 4FF3A 4DU4A 2XHWA 2YY3A 2QWOA 1HNVB 1HNZJ 5HK4A 4EP5A 4KO0A 1UZDA 3L7OA 3QT7A 3PJXA 4TYBA 3LDOA 3W2WA 4LF6J 2P9IA 3OYFA 2DFHA 3CPEA 2BOPA 1EWRA 1NK8A 2C3UA 4QWAA 3F41A 1YTYA 4LSLA 2QL7B 1WC6A 2ATCB 4CT9A 3TZXA 3THTA 5ETNA 5JXSA 2E1AA 3N4WA 4JS5A 4MIWA 1SQKA 5LMNJ 4F02A 1AW0A 4RO0A 1N5YB 1A5WA 5FPNA 2AF6A 1RP5A 2R8HA 1HBUB 1TUWA 3VGUA 1NGDA 4QIEA 3MM5B 2R7UA 3CCQS 3ZT0A 3ZZ0A 5AQMA 1OS5A 1S22A 3CO0P 5CXTA 2IC3A 4HWIA 3UPFA 2X51A 3L4BC 2B9YA 3SLCA 1Q86O 2VGNA 3DXKA 4B3MJ 1ZM3A 2LU2A 2MZ1A 3BN7A 4JI2F 2XMTA 1HYSA 4KB0A 1FKOB 2PMZD 1WNEA 1KRPA 5K8NA 3EKSA 3LDSA 3DGPA 5KG6A 1GFWB 2DNGA 3CDAA 1YUWA 3AXMA 4DV3F 5E7OB 5AJ3K 5CZ2A 2DGUA 5JVHQ 4OV1A 4PA1A 1D8ZA 5IZHA 1RHRB 3X3UA 3KZBA 2RNEA 3GILA 4LIRA 3JTNA 1XNQK 1OVQA 1U1RA 2CQIA 2K7KA 2B4VA 1U1OA 2W9AA 3WX8A 1WEXA 4DQIA 4NLRA 3I9ZA 2MKIA 4PXBA 2E2PA 4P72A 3RBEA 1EHWA 2AJFE 2RQ4A 4TLQA 4FWQA 1QTMA 3IP0A 2ZM6F 4CEFA 5ETLA 3K7RA 4DUYF 2DXFA 4FLTA 3MPYA 3UKUA 1YITS 2XLJA 2HK3A 1QZ5A 3WQUA 4WQ5A 4K5RA 3BZKA 2F7VA 2Z8QA 1ZM2A 1ESVA 3BF1A 4KFBA 1WHYA 2CJYB 5KQ8A 1I51B 4GC6A 4CJTA 3KNAA 3DXMA 5C5JA 4HH0A 3ENVA 3KKRA 4IH6A 1Y97A 1P27B 3H4BA 1XMOJ 3R5JB 3J81U 1KFSA 4FDFA 2HRYA 2A1BA 2VIHA 4M3UA 3M32A 2NRWA 4QIVA 3H3NO 2DHHA 3P45B 1R6VA 4QWEA 3FBEA 3CE8A 5D4OA 4EFAC 3PRDA 3CO9A 4DR2K 3LP1B 4ZPBA 2IVOA 3QRQA 4HT5A 2EFGA 4R0EA 2DNMA 1REVA 3ET6A 4FWMA 2F7TA 5KT5A 4JI7K 5AQWA 3CCTA 1DTQA 3OHBA 2MHEA 1NDLA 4OX9J 1U6FA 5J2NA 1RTDB 4DV6K 1S99A 5C24A 4OLBA 2HRUA 4LBHA 1WACA 1KAYA 1GX5A 3I56S 4X4PA 2R7XA 3ZEUA 1FRLA 3MMAA 4DV0J 2BJ7A 4ZLJA 4JI6K 5BR9A 1J5EJ 3SUNA 4UOCA 3CCJN 1BY9A 4Q2LA 1BGXT 1HLUA 3TVYA 4JUZA 3NGYA 2DGOA 5K8MA 2MQQA 4QR0A 3EICA 4I67A 3K17A 4PG6A 4J9KA 3R1LA 2M9KA 2H4YB 3QESA 4U6PA 5I3PA 2LLZA 1HPMA 5CE3A 4KHYA 4YY3F 4I6MA 4ECWA 2VONA 2POKA 3Q83A 1RT4A 1NM1A 5A0YA 1QE1B 2G0IA 4CW7B 1B0VA 1SUQB 3FZLA 4PY5A 4XK8C 3H0PA 4USKA 2ATQA 5H1SQ 2V8VA 5IM0B 4FJGA 3R9PA 1ASVA 1VBZA 5HQMA 3BGRB 3RU0A 4P73A 3QICA 4LH5A 4CLUA 3CJ0A 3ITHB 2QWLA 4FXDA 1LWFA 2C2RA 4FNIA 4MQ3A 2VYPA 2VJUA 4M45A 5DGBA 3B4DA 2DY1A 5HJXA 4E3SA 5K8PA 5F0WA 4BE2A 1HR0K 5D3GB 1KOOA 3P1GA 1RTIA 4PUOA 4RW9A 2VU5A 2ZDOA 2Y8WA 3T9ZA 4DUZJ 1IR1A 5CABA 4KRFA 1N34J 5K20B 2ZH4A 3ZLJA 3HHLB 3GE9A 2NLWA 3CMQA 1NJYA 3MXJA 4M63A 3CVKA 4N47A 2PO4A 2DR7A 4CZJA 4K4XA 2P51A 2QWRA 4O3PA 5H9FK 3NGSA 2MZRA 2XY6A 3FGVA 4M8LA 5AFUA 3CXCR 3E01A 2AWZA 1D9AA 5LOQA 2G0JA