3HVTA

Structural basis of asymmetry in the human immunodeficiency virus type 1 reverse transcriptase heterodimer
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
555
structure length
555
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
publication title Structure of the binding site for nonnucleoside inhibitors of the reverse transcriptase of human immunodeficiency virus type 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 95
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1994-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3hvtA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvtA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvtA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvtA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hvtA05
2R2SA 3HPHA 5KGXA 3G6YA 4CF8A 1XHXA 3SV3A 3NKYA 3KKSA 5JUMA 4NLWA 1RDDA 4TXSA 1NHUA 4KHRA 1SH3A 1IKXA 4K4UA 1GX5A 3ZSWA 3QEXA 5CY4A 5C24B 1JKHA 4R5PA 5FRMA 3C94A 5F8IA 1FK9A 4Z4HA 1SKSA 2WHOA 4FS2A 4JRPA 2YHAA 4Y3CA 2YNHB 3NAHA 2RKIB 1RT5B 1ZETA 1VRTA 1RT2B 3SJJA 1KVBA 4DL6A 4O3NA 4DS4A 2PYLA 2QKBA 2WONA 2Z1HA 1LW0B 1S1XA 3GV8B 4Y2AA 1QUVA 2JEGA 1WSEA 1LWFB 3DM2A 4W5RA 4E7KA 4E7JA 2OPSA 2HW3A 4M3TA 5F8LA 4DWIA 3ISNC 2VG7A 4RZRA 1NOYA 1S10A 1TKZA 4KKOB 3D28A 4X2BA 4FJ8A 1DTTA 1BQNB 3KLHA 4ZP9A 3MR2A 1NKEA 1S9GA 5KFBA 4DTMA 3MECB 4E89A 1HNVA 3EY1A 4KFBB 3ZT4A 3VQDA 4B8CA 1RYRA 4Y1CA 1UWBB 1F21A 1REVB 1SKWA 4ID5A 4ZTFA 4DLGA 1NK0A 2HNYA 3BQ1A 3CG7A 2XY5A 4F4KA 4KB1A 1KLMA 3M8PB 4C8OA 2XI2A 4E7IA 4ECXA 5DQGA 4KSEB 4OVLA 3NGIA 3G10A 2HHWA 5KG0A 3GYNA 2JEIA 4FJMA 4CGJA 5HROB 4CEEA 4RW8A 2JC0A 3QNOA 1ZYQA 3L8BA 1RT3A 1BIUA 3RR8A 1T03A 4LQ9A 4C8LA 3ZT0A 3D5MA 2FJWA 3BQ2A 3VQEA 4HTUA 3F9KA 2D7SA 4CGFA 4M3RA 3KLIA 3ZSYA 3HYFA 3OYLA 2V4RA 1JLCA 4O3RA 4B8AB 1NK8A 1G15A 3RRHA 4OPJA 1DLOA 4IG0A 4IDKA 3H5SA 3OJUA 2D0CA 4GC7A 4RG8A 5DG9A 4FLUA 3NGYA 4DSIA 1JLEA 2YHBA 4NLRA 3DI6A 4NLPA 4NRUA 3KK1A 4DTNA 3NCIA 4URQU 3HVTB 2ZD1A 1HYSB 3OHAA 1FKOA 4CGIA 5HBMA 1ASVA 4CJPA 4EZ9A 4IOBA 4AHTA 4DQRA 3TABA 3TAGA 1VK0A 1X9SA 3V1RA 3QNNA 4ZHRB 3KLFA 5KFGA 3AVLA 1JLGB 2OPQA 2QV6A 3H98A 2XRIA 5J2MB 4B08A 1ZBLA 3TVKA 2W7OA 3NE6A 4DU4A 3HP6A 3PW2A 1C2PA 1S9EB 1S6PB 4RNOA 4GVMA 3VQ5A 2FVQA 3QLHA 3DLEB 4KV8A 1BQMA 2Q3SA 1Q9XA 4HUGA 4MFBB 3Q8QB 2W9BB 1CZBA 4E1NA 1XHZA 3QGGA 1CLQA 1SUQA 4EEYA 4AHSA 4O3OA 3N6LA 4DU1A 3QEWA 3K5LA 4O3PA 2XGQA 3IRXB 3G0ZA 2AGPA 5KFTA 1RTDA 1TKXB 1S1TA 4NCAA 2HHXA 1RBRA 3IGNA 4HUEA 3MEDA 5T7BA 1TQLA 4KHUA 5J2PB 3TAEA 5KG3A 4FJKA 1QSYA 4MKBA 4Z4GA 2IAJB 1C1BA 1YTAA 5KFDA 2R8GA 5KFXA 4KREA 1ZTTA 4OGCA 3AO4A 5I3UA 4IRDA 1I3AA 1R0AA 4RNMA 1ASUA 4DSKA 2HNZB 3CO9A 1RTHB 1IKWB 4WZQA 2IJFA 3SNNA 1QAJA 4CIGA 3I0RA 3CDUA 3GILA 1A5VA 2RF2A 4N5SA 3OYIA 3NH0A 4DF4A 2X74A 4ZVHA 2VWKA 3T5JA 4Z4EA 3KLEA 1J54A 1TL1B 5KFKA 1DTQB 1S1WB 4BWJA 1S0OA 4RW6A 3UPFA 3LZIA 4ZP8A 2G8HA 1N56A 2GIRA 1BI4B 2KFNA 4MIAA 4AHRA 1JIHA 1HMVB 4J9PA 4HHTA 2UUTA 3DRRA 1QE1B 3THVA 1VSLA 4BDYA 3HJFA 2OPPB 4Q0BA 4K4TA 5KG5A 3LP3A 1LW2A 4KTZA 1W0HA 2F8TA 4Q45A 2CJQA 1S6QA 2ILZA 4O3SA 2E9RX 3VQ7A 5J1EB 3OHBA 4DFJA 4KTWA 3AV9A 4U7CA 5DQHA 4FK2A 1TK8A 3H4BA 5HRSA 2FLPA 4ICLA 1KHWA 2HHTA 3TAMB 3B6PA 4M42A 4FJ7A 4MIBA 4BE0A 3RTVA 1RBTA 4YR3A 1J53A 2XWYA 4AHCA 3O3GA 3ZT2A 1WNSA 2HHVA 4ZVEA 4IBNA 3L3VA 1KTQA 5KFMA 1QQCA 3I0SB 1L3VA 1JLBB 5J2NB 4FJLA 3UR0A 2F8SA 4I7FA 4PQUA 1NKBA 2RKIA 2F96A 5FDLA 1RT5A 2W9CB 5HLFB 4Y2CA 4IQXA 2KQ2A 4KHYA 3OYJA 1NJZA 2DPJA 1GOCA 5KT6A 2CKWA 4ED8A 4TYBA 1T7PA 4ZP6A 4M3YA 1RTIB 1N5YB 1LW0A 4TYAA 4PUOA 3EYZA 1BL3A 3MXJA 3QO9B 4Q43A 2D41A 5KI6A 1WSIA 1NK9A 3H08A 3MEEB 4CESA 2PYJA 3LANA 4ECTA 1RDRA 1UA1A 1BQNA 2IM2A 2KW4A 2ZQBA 4CEBA 2FC0A 4EP5A 1ITGA 1A5WA 4HKQA 4J9NA 3QIPB 1UWBA 1REVA 4K4XA 4AH9A 1ZBUA 3SQ2A 4ECQA 3JYTB 3CVKA 5KG1A 4DF8A 3LP0B 1JLAB 4O4GB 4RU9A 1I39A 4DQIA 4TY9A 3AA2A 4NLUA 1VSFA 2C22A 3BDPA 4TSXA 2D3UA 1D1UA 2XHBA 3Q8SB 4C8MA 4MKAA 3OL9A 5CZ2A 4AHVA 3DOKB 2ATQA 2IS3A 3LP2B 2GUIA 3ALYA 2LSNA 3DRSA 1U4BA 3T5HA 5F8JA 3CFOA 3CJ4A 3WNHA 4QWEA 3FQKA 1NOZA 5KRSA 3C6UB 3QIOA 2B6AB 3RB0A 3L2VA 1QAIA 1S48A 2FBXA 3M8RA 3ZSRA 4ZMMA 3NGDA 2D0AA 3D45A 4H4OB 4ED7A 1BGXT 1LWEB 3ZSZA 4E7LA 2HHQA 2HNDB 1NNDA 1IKVB 1RT7B 4CJEA 1EP4A 4FLZA 5KFPA 1S1VB 1WAJA 3VQ8A 5KFOA 2ASLA 2RN2A 3HVTA 4FLTA 2GIQA 1OS5A 5I42B 2R7YA 4WYWA 2FBYA 4KO0B 4BACA 4WFXA 4CJSA 3OYEA 2F8EX 2ITGA 3CWJA 1VSIA 3V9ZA 4ECSA 4KRFA 2V0NA 3MXMA 3LP1B 4QOZB 1C0TB 4NLTA 2NUBA 4KAIA 1RCHA 1NKCA 3PO5A 4IKAA 3RB3A 4F3TA 2KZMA 4FLYA 1S0MA 3GIKA 1U47A 2R8KA 4MK9A 1L3TA 3KK2B 4DMNA 1HQUB 4JS5A 2BGGA 3TQ1A 4XIUA 4HCCA 4J9QA 3VQ9A 2UVVA 4CEZA 4WXWA 5C42B 5D3GB 3DLRA 2IA6A 1S9EA 1S6PA 4CGGA 3OL6A 3VQBA 1NJWA 3KHLA 1TGOA 1B92A 2VA2A 2VG6A 2DFFA 4Q5VA 4FM0A 4KAZA 4MFBA 1TP7A 3O3HA 4Z4FA 3PW0A 3SFUA 3A2FA 4CJRA 4DS5A 3G6VA 5CYMA 3BSCA 2P5OA 2G8WA 1TKXA 3T19A 1S9FA 4QAGA 2C28A 3K5OA 4M3ZA 3ITHB 5DGBA 2WTFA 5DGAA 1L3UA 2BQ3A 3O4NA 4RW7B 1HPZB 5J2PA 4CF1A 4ECWA 2JC1A 3ZCMA 3M9MB 3NF8A 3KOAA 3FFIB 1D5AA 4WE1A 3SUPA 1D8YA 2W9AA 2R8JA 1RTHA 1IKWA 1VSJA 4CEFA 2YKNB 1RA7A 1ZBIA 3V6JA 1B9DA 4KBIA 1RA6A 3KLGB 3OJSA 3KHGA 3BJYA 4WFZA 2XGPA 2KTQA 5KG2A 1TKTB 1JLFA 1HYVA 3OS0A 2AX1A 1DTQA 2O4IA 1T94A 4FVMA 3O4QA 2JEJA 3HT3A 1BI4A 4EBDA 3K58A 3PJWA 3V6KA 3LPTA 4FM1A 1HMVA 1KSPA 1QE1A 4CERA 2WOMA 4WYLA 5KG6A 4DTXA 3DLKB 2OA8A 1X9WA 1BHLA 3MEGB 2QE5A 5FROA 1RTJB 4F4WA 1BCOA 4M3WA 5DG7A 3PHEA 4MK8A 5EDWA 1C0UA 3OY9A 4ZPDA 3V6DB 4EO6A 4CCHA 1J9AA 3EPGA 4IFYB 4QWAA 4CHQA 3OYGA 4J9KA 5DLFA 3FSIA 4B9TA 1FKPB 1C1CB 3IS9A 3AO3A 5E41A 1CSJA 1U49A 3QGHA 2HWIA 1LV5A 2BE2B 1Z26A 3GV7B 4K4VA 4EZ6A 4ECYA 2IOCA 2QXFA 3VQQA 1JLBA 5J2NA 2E9TA 5F8GA 3LWMA 3V81B 4IRCA 4CIEA 4CGDA 2G8KA 4ZPAA 3T1AA 2W9CA 5HLFA 3H59A 3KD5E 1CXQA 5C25B 4EO8A 3L3UA 3BSOA 3RB6A 2IGIA 1TV6B 3TAQA 1J5OB 4CJLA 1YTUA 4F2SA 2G8IA 3QEIA 1RTIA 4NCBA 4FLWA 1N5YA 1HQEB 3LAMA 5F8MA 5HRNA 3QO9A 2VWJA 1ZBFA 4CK3A 3SQ4A 2DY4A 3NFAA 2GC8A 3DOLB 2DFHA 1WSJA 1NHVA 3MEEA 3AVIA 2HMIB 3MAQA 1RT6A 1IKYA 4O44B 3V9UA 4FBTA 3OVNA 4NRTA 4R8UA 4CJ3A 3MR5A 2AGQA 3SV4A 5C5JA 3QESA 3NAEA 4QWDA 3OS1A 4H4MB 3GV5B 5KGWA 5DK5A 3HPGA 3I5AA 2ALZA 4CJKA 4ZPCA 4KTQA 3DYAB 3QIPA 3ICLA 5JS1A 2FLLA 2YKMA 3CIZA 4RUAA 1LAVA 3JYTA 3BSAA 1WAFA 3LP0A 1S49A 1FXXA 1JLAA 2X6NA 3NBPB 4CGHA 4I2PB 1KFDA 1JLQB 4MK7A 4RNHA 1O1WA 1RT4A 2XY6A 2AWZA 3AVMA 3ZT3A 2ZE2B 2FVRA 4M3UA 1XR6A 4OLBA 4QCLA 3HP9A 2AX0A 2HVHA 4CEQA 1TL3A 1YT3A 2BQRA 3LALA 3DOKA 4FYDA 3QERA 5L1JA 4PA1A 1XR7A 5KFHA 2AQ4A 1WSFA 3HKWA 5KG4A 3KIOA 1IKXB 4H4OA 4RW9B 5KFLA 3AVAA 4OKKA 1MMLA 1LWEA 3HVAA 1RDCA 2YNIB 4R5PB 3DRPA 3TR8A 2HNDA 4J9LA 1IKVA 3VQ4A 5EU7A 2V4QA 4C8KA 2W8KA 1VRTB 2HVIA 3MFHA 3RRGA 1SV5A 5HP1B 3SUQA 1S1UB 5KFNA 3OLBA 3RBDA 3ZSXA 3IAYA 1UA0A 4W5QA 3OYDA 4KO0A 2OZSA 3NGZA 1GX6A 3LPUA 3V9SA 4IH5A 4O4RA 4I2QB 3P1GA 1Q9YA 1TK0A 4FCYA 2OPSB 2ASDA 3LP1A 4AILC 2IJNA 4KHMA 3AVCA 4Y34A 3S3MA 4TY8A 4J2AA 5F9LA 1DTTB 4JUZA 1KVCA 4ECVA 4FZXC 3I5CA 4FJHA 1S9GB 3KHHA 3CYMA 3K2PA 1NJXA 1NK6A 3E01B 3TI0A 1HNVB 5C42A 5D3GA 1VSDA 4CJQA 3SQ0A 4O3QA 2KZZA 3UQSA 3VQSA 5J2QA 4B3OB 3C95A 3T5LA 1X9MA 2PY5A 3C6TB 5KT2A 3H5YA 1Y97A 3KKRA 2E6LA 4HUFA 1X1PA 4IKFA 1TAQA 3N6NA 2YNGB 2IMWP 3HVWA 4YFUA 4IFVB 5KT4A 5KTQA 5F9NA 5KT5A 4YR0A 3PJXA 1XI1A 3ITHA 4JLHA 2A1RA 4RW7A 2EX3A 5C24A 4QPXA 3H2LA 1RT3B 2C2RA 4IRKA 3HPOA 1RT1B 1N48A 1HRHA 2R2UA 1T03B 4IR9A 2ATLA 2YNHA 3AVFA 4FS1A 3FFIA 4Y1DA 1XR5A 3L2QA 1RT2A 3KLIB 2IM3A 5KT7A 2YKNA 2BR0A 3OSPA 4JV2A 1JX4A 4CHPA 1DLOB 4IG0B 3OYCA 3H5UA 3KMSA 2R2RA 4KB7A 4G1QB 3ASMA 4Q44A 1LWFA 3EPIA 3CDWA 3KK1B 1TKTA 3ISND 1Z4UA 4KKOA 2OPRB 3DMJB 2XI3A 1KFSA 2BANB 1RDBA 3HSTB 4JV0A 5KFAA 4QWCA 4H54A 4LD0A 4KHSA 3MECA 4YMEA 4KFBA 2QKKA 3NF6A 3KLFB 4CF9A 2KFZA 2AJQA 1XWLA 2WRMA 4F4XA 2J6TA 3DLKA 4M41A 2VG5B 4CFCA 4B9LA 4KHQA 4NYZA 1RBSA 3M8PA 3V6DA 4DTUA 3PX6A 4OLAA 3QLHB 3KLVA 4IFYA 5HROA 3RAXA 5F8NA 4FLXA 2AGOA 4O5BA 1K1SA 1SUQB 2E9ZA 1C1CA 1KVAA 4ECRA 3H5XA 4E7HA 3AVNA 5KFJA 4J9OA 1NK7A 3CM6A 2AU0A 4KE5A 2B5JB 1RBUA 3CFRA 3JSMB 4DQQA 3MEDB 2XCAA 1SKRA 3OSNA 2P5GA 2OZMA 4RW4B 3NH1A 1EXQA 4EBCA 1C1BB 2DTUA 4CEDA 4CECA 4E3SA 4B9NA 3RMDA 2X6SA 4IH6A 5KFSA 5I3UB 3RB4A 1R0AB 4RUCA 2W8LA 1K6YA 2JGUA 4RNNA 3KMQA 4R0EA 1HYSA 3SFGA 4H8KA 1TV6A 1IG9A 2IM1A 3HL8A 3DLHA 3NL0A 1HQEA 1Z25A 4CEAA 1RAJA 2WB4A 2OYQA 4CEOA 1WSGA 1N6QB 1ZBHA 4GMJB 4HCBA 4DFPA 4ZHRA 3H40A 2YNFB 1JLGA 3KTQA 4O44A 1RILA 5J2MA 3V4IB 4DTOA 1U04A 4OKJA 4EYIB 1JXEA 3OYKA 4H4MA 3G86A 2B43A 4ZPBA 1GOBA 1D9FA 3AVGA 4NLQA 3DYAA 4FJGA 3TANA 3AA3A 3P83D 3VA3A 3DLEA 3U3GA 3BGRB 4FBUA 2DFEA 3NF9A 2JEFA 1EETB 3NBPA 2W9BA 4I2PA 2PZSA 4LSLB 4DTRA 4CFBA 2BRKA 4QWBA 3AVJA 3IRXA 3AO1A 3CM5A 3SUNA 4B9VA 2WK4A 4DSLA 4J2BA 3KJVB 1C1AA 4DFKA 1SL1A 4DTSA 3VQAA 3RBEA 2P1JA 4J9MA 3L2WA 5SWMA 5HRPA 2IAJA 3AVKA 5JS2A 4ZVGA 2IC3B 3MR6A 1YVFA 4GC6A 3MXIA 2HNZA 2WCXA 1L3SA 4K50A 4CF2A 4RW9A 4CHNA 3KNAA 3VQCA 5EWGA 2YNIA 3L2RA 1WSHA 5SZTA 2P51A 3SI6A 1YVUA 4I7FB 4PQUB 4F4ZA 2Y1IA 4M3XA 2G8FA 2G8VA 4NCGB 1C0MA 5FDLB 4DL4A 5HP1A 4NYFA 1S1UA 3V9WA 1TL1A 4DQSA 3UIQA 3SCXA 1S97A 4FJJA 4BWMA 1S1WA 4LH4A 4FXDA 3NAIA 4F8RA 4URSA 3H4DA 3RMCA 4KHWA 3PX4A 2I5JB 3F73A 4K4YA 4K4SA 4PUOB 3OL8A 4I2QA 3L2UA 4CFDA 3FDSA 3TARA 4EYHB 4ED3A 3ZSOA 3IG1B 4DL7A 2Y1JA 3PVXA 3LWLA 4IR1A 1VRUB 3OYMA 2OPPA 3PW4A 1S5JA 4ELUA 4KB0A 5KFZA 2YV0X 5KFRA 2FLNA 3E01A 2OH2A 4FW2A 5J1EA 4DEZA 4LQ3A 3ZSQA 3QGIA 3NHGA 3M8QB 4B3OA 2R2TA 4QW8A 3VA0A 3C6TA 3DLGB 1SL0A 5DLGA 3TAMA 2BDPA 5DQIA 1ASWA 3KD1E 5KFUA 3SUOA 1MU2B 2YNGA 4NLYA 3WNFA 1HARA 4IFVA 3PX0A 4FJXA 1WNEA 3I0SA 4DSFA 3QZ7A 3NH2A 4BDPA 3S3NA 4DG1B 3CJ0A 1JXLA 3DRSB 3SPYA 5CZ1A 1RT1A 1K1QA 4NLVA 3OYAA 1WN7A 2X78A 3KK3B 4ID1A 1LWCB 3AVBA 3WNEA 2UVUA 2C2DA 3KHRA 5DG8A 5KFYA 3V1QA 1T05B 3OS2A 1SH2A 4ELVA 4NLOA 1SL2A 1EP4B 4G1QA 3T5KA 3K57A 3TWHA 3OYHA 4CK1A 4WFYA 1XC9A 2FBVA 1BIZA 4FK0A 2HHSA 2R8IA 4ECZA 1HNIB 4RNFA 4OKEA 3CQ8A 4I9LA 2OPRA 4YP3A 3DMJA 3LDSA 3ULDA 4DLEA 2A1SA 5DMRA 4DTJA 4F3OA 2BANA 4LSNB 3GIMA 4M94A 1UAXA 4DL5A 4K8XA 5CYQB 1RNHA 2EHGA 3OYNA 3AA4A 4MH8A 1HJRA 3K59A 4IG3B 3D0PA 4CFAA 4O4GA 4ECUA 2VG5A 4CJWA 3U6FA 1VSKA 1TVRB 5K14B 2I1RA 4U6PA 4NLXA 4WXOA 4J9RA 4NYNA 1NJYA 2HWHA 4G3IA 3QEPA 4B9SA 2FVSA 4PWDB 1RBVA 2VG6B 2RDJA 3K5NA 3DDKA 4O55A 2C2EA 3DLBA 4DSJA 4ZTJA 1LAWA 3GQCA 2D5RA 4BE2A 4W5NA 2RDIA 3LP2A 4DSEA 3O3FA 4FJ9A 4CJTA 5CYMB 3BREA 4GW6A 3PZPA 1EKEA 1JXBA 2R8HA 3S3OA 4XO0A 3S9HA 3C6UA 2B6AA 3K5MA 5L1KA 3SPZA 3CDEA 4YR2A 2B5JA 3JSMA 4FW1A 4HVJA 3PW5A 1T8EA 4W5TA 1JKHB 4CJFA 4RW4A 1WLJA 3SQ1A 3LAKA 1KCFA 4MQ3A 5L1IA 3WNGA 1FK9B 4YNQA 1RT7A 3BR9A 4OPKA 4J2DA 5T14A 4WE1B 4TN2A 4ELTA 4E1MA 1S1VA 2D3ZA 2E6MA 3PR5B 3ZSVA 4OL8A 4NZ0A 3MTKA 1NK4A 2Z1IA 3I8DA 4Q8FA 5I42A 2WONB 4XPCA 4F2RA 2O4GA 2DPIA 3RWUA 4CHOA 2XO7A 3CJ5A 1S1XB 1RYSA 1U48A 3DM2B 1C6VA 5F8HA 1N6QA 3NMAA 4O0JA 1C0TA 2VG7B 2XY8A 2BQUA 1JLFB 1B9FA 1TKZB 2YNFA 4YQWA 3QIDA 3V4IA 3KLHB 3LZJA 3KK2A 1HQUA 3N6MA 2HHUA 1NK5A 4WZMA 2GBZA 4DTPA 4UQGA 3OL7A 4CJ5A 3AO2A 2IDOA 4HYKA 3AA5X 4FJIA 2WOMB 2FVPA 5EWEA 2FJVA 3PUFA 3EZUA 3VQPA 3BGRA 4ID5B 1KRPA 2FJXA 3QYYA 2HNYB 1I6JA 3OLAA 1RDAA 3QINA 1EETA 2E4LA 2W7PA 4LSLA 1C0UB 1KLMB 4NLDA 4K4ZA 3OYBA 3U3YA 4BDZA 3BQ0A 1W25A 3HXMA 2J6UA 3V9XA 3KJVA 4J9SA 3MFIA 5KFEA 4N76A 4RW8B 4I9QA 4BE1A 1HPZA 1QS4A 3M9OB 4O0IA 2JLEA 3M8SA 1D0EA 1QHTA 3PR4A 4CJ4A 4XPEA 1EX4A 3IS9B 4TLRA 1U09A 4Z4CA 4LY7A 2EC0A 1N4LA 3UDLA 4ZP7A 2IC3A 4OGEA 1U45A 4ZVFA 3SI8A 1T3NA 1TAUA 4N47A 4FZYA 5L9XA 4CF0A 4DFMA 1JLCB 4ED1A 2BRLA 4IDKB 4F4YA 4B9MA 3I5BA 1UOCA 3KLGA 2HB5A 3CJ2A 4Q8EA 4CE9A 4NCGA 1JLEB 4ED2A 3HK2A 4FLVA 3B6OA 3DI6B 3TAPA 4FJ5A 2VA3A 4FM2A 4KI4A 4PY5A 3OYFA 3TAFA 1IM4A 2ZD1B 2ZKUA 2UVWA 4W5OA 1FKOB 3SZ2A 2IBKA 5HBMB 1A5XA 1TKDA 2I5JA 2ILYA 4CJUA 1QSLA 2D0BA 2GV9A 4QW9A 3VN5A 2FVCA 3IG1A 4NLSA 2OPQB 2XC9A 1RT6B 1IKYB 4DU3A 3PY8A 3FQLA 1VRUA 4CK2A 4FZZA 2ETJA 4C8NA 4CHYA 1W9HA 3P5JA 4R8UB 3MEGA 1RTJA 3RR7A 1VSEA 3HM9A 3BSNA 1HYZA 3RMAA 2FBTA 4EBEA 4B9UA 4LH5A 1IH7A 4TQRA 3CJ3A 3NF7A 3MF5A 2YKMB 3M8QA 4KV8B 1BQMB 3PV8A 3DLGA 1QSSA 1Q8IA 1SH0A 2RPIA 3GIIA 4L8RB 4AHUA 2UVRA 5KG7A 1MU2A 3M9NB 1FKPA 4JV1A 4K8ZA 1RT4B 3IGVA 2J6SA 1TK5A 4JRQA 1RTDB 4FJNA 4J2EA 2BE2A 4CJVA 1S1TB 4FK4A 1KHVA 5KT3A 4Z4IA 4N41A 1TL3B 2V9WA 3NDKA 3VQ6A 4DQPA 4CIFA 4DG1A 3QZ8A 3V81A 1KLNA 4EP4A 1VSHA 2O5DA 4E0DA 2Z1GA 2Z1JA 1S4FA 2IM0A 3Q8PB 3ZT1A 3KK3A 3G6XA 1BISA 1LWCA 1JL2A 5C25A 3I0RB 4M95A 5KRTA 3HVRA 2RF2B 3EZ5A 1J5OA 3DRPB 3T3FA 4KPYA 1CXUA 5FRNA 3V1OA 1T05A 3Q8RB 1BCMA 4KI6A 5JXSA 3GIJA 1SV5B 4DL2A 4IH7A 3KLEB 2W42A 3DOLA 1HNIA 2UUWA 3IN5A 2HMIA 1ZTWA 5EWFA 4E19A 4F50A 1JL1A 4RW6B 4DL3A 4KHNA 4CHZA 1L5UA 2G8UA 4LSNA 5KFIA 3E51A 3V6HA 3CFPA 3SYZA 3FRZA 4ED6A 3DRRB 5L1LA 2B4JA 4TQSA 4OJRA 3RMBA 5CYQA 4ED0A 4K4WA 4TY8B 1VSMA 4IG3A 4JS4A 2XCPA 2XY7A 4Q0BB 3MR3A 5KFQA 4M45A 5HRRA 4N56A 1QTMA 1LW2B 1S6QB 1TVRA 1JLQA 2HAIA 3RAQA 5EUHA 5K14A 2ASJA 3HHKA 5KFFA 3PW7A 4URGA 3QETA 4PWDA 3QEVA 2ZE2A 2QK9A 3HO1A 5J2QB 1CZ9A 5KFVA 5KFWA 1GOAA 4NLGA 1IO2A 5KFCA 3AO5A 1S0NA 4ICLB 3AVHA 1D9DA 3PO4A 4Z0UA
chains in the Genus database with same CATH superfamily
2WZ1A 3G6YA 4ERDA 4CF8A 1F6TA 3NKYA 1MNEA 4WPAA 1V5IB 4NLWA 5E3AA 1RDDA 3VEWA 4WP8A 1T9UA 4KHRA 1SH3A 2LMIA 3VAGA 1DJ0A 3QEXA 3NS7B 2IA0A 2NRTA 5AZIA 1QJHA 5A0YB 2NYIA 2V94A 3C94A 2EI5A 5AE3A 1FK9A 2WHOA 1Q7YT 1FJGK 4JRPA 4YOVA 3WZ0A 1RT2B 1P27B 3SJJA 3HSJA 3OFHA 5ETPA 4FPIA 2PYLA 4NMXA 3FFKB 2UYTA 2WONA 2Z1HA 4MLHA 1QUVA 1S3XA 2JEGA 3DM2A 2AHOB 4E7KA 4HI2A 4M3TA 1NOYA 3WC2A 4GV9A 1P90A 4UOGA 3D28A 3ZNUA 4X2BA 2QWNA 2GGPA 1FT8A 3Q22A 4ZP9A 3UVJB 1MROB 1X4HA 1I51B 2Z56B 3MECB 3EY1A 4KFBB 1Q78A 1VQ8S 5M2RA 4NA1A 4I1TA 2QT7A 1OKJA 2E5HA 3UD4P 1TTHB 2CDRB 1CJUB 3VF2A 4LR9A 3BQ1A 3M05A 2NSCA 3ENAA 3CPEA 3HDSA 1IUJA 3C8YA 3NGIA 3G10A 4DXLA 3GTYX 4OI3A 3HF5A 2GNKA 2JEIA 4CGJA 4PWUA 3EVMA 1URRA 3B8HA 3S41A 3L8BA 5A8RA 3U27A 2FJAB 5K8MA 4C8LA 4LFCF 3D5MA 2FJWA 3F9KA 5HK4A 2XZWA 1OY9A 2WVCA 3AB2B 4JI6J 4H5TA 3G4SS 3GLJA 3KLIA 3CCQN 1BE4A 2NQPA 4B8AB 2K7KA 1NK8A 4MLEA 3OJUA 2D69A 4RLEA 3TUZC 3CJTA 2MTLA 4NEZA 4C2MA 2R7VA 2MLZA 4CLUA 1GXLA 4DTNA 3KJQB 2V69A 1TMJA 3A5MC 4B3TJ 3HVTB 4K2XA 3NOGA 4OJGA 2K7JA 1HYSB 1NGBA 2EFPA 3M32B 4DV4F 2ROGA 1RAIB 2DISA 2YCHA 1ASVA 4LFAF 1N34J 1WF1A 3V1RA 1VQ7N 2UU9F 2OI2A 1HWIA 2QV6A 2VWBA 1ZBLA 1I94J 3KG1A 3TVKA 2W7OA 1QZ5A 3G4SN 3ILLA 2D74B 4MYUA 2M3DA 4QYRA 8AT1B 4B3TF 3F41A 2Q36A 1IWAA 2LYVA 2Q3SA 3CMQA 4O8KA 2G13A 1R89A 4CZHA 1Q53A 3THXA 2NLWA 3Q8QB 4E1NA 3UNYA 3IAS9 4AHSA 3J81U 2FZGB 2XGQA 4PAAA 2AGPA 5BR9A 3RW7A 4ANCA 2VB6A 2XS2A 1RBRA 4HUEA 3LA0A 2XLKA 5G0RA 2KRRA 5KG3A 1YX2A 1TZ0A 3I33A 1PAEX 5K8NA 2QIFA 1QDUB 4KREA 2ZH3A 1ZTTA 3AO4A 4FF1A 1R0AA 3CO9A 4OV6A 4WZQA 3SNNA 3I0RA 2ZITA 1A5VA 2RF2A 3TYTA 1E6VA 4N5SA 4JN4A 3FCVA 1IBCB 4DF4A 1TYQB 2HIQA 4ZVHA 3SAGA 2OKQA 2HFVA 1SQEA 1FXRA 3NS5A 1DTQB 3UPFA 1RWNB 2E1AA 2GIRA 4MIAA 3OR2A 3CD6S 3TA0A 3PYDA 1JIHA 3OTOK 4HHTA 3NP5A 5E3PA 3V4MA 3S7RA 4J91A 2KL8A 4ZLNA 2OPPB 3LP3A 1SKUB 3E9PA 3PEJA 2F8TA 4Q45A 2N3LA 3BYPA 4HACA 4O3SA 1GT8A 2XS7A 1XMOJ 2F5GA 3AV9A 4UOHA 1FRIA 2CPJA 1M5PC 2B7BB 1YJWS 5KPRA 5HRSA 2FLPA 1KHWA 3K17A 3B6PA 1RSCA 3H45C 4M42A 4BE0A 2A40A 4YOXA 4K5RA 2U2FA 2WBRA 3O3GA 4CTAB 1WNSA 1RABB 5AE1A 3LOUA 3CD6N 1RFQA 1IV0A 1KTQA 1T6CA 5J2NB 1S6OA 2X3DA 3UR0A 2RS8A 1NKBA 1WBBA 4YOUA 2F96A 5FDLA 3IMXA 1DURA 2KQ2A 1U0SA 5AQFA 5IFMA 3M30A 1FI4A 3ADAC 1BWVA 4CLWA 3OTDA 3CEDA 1XNQK 4ED8A 2P9IA 4ZP6A 2W1BA 1UTAA 2G1HA 1YJWN 3M3ZA 4LREA 4Q43A 1AROP 2D41A 5KI6A 3TSUA 4JI1J 4CESA 4JV5F 3LANA 1V3RA 2KW4A 2X1FA 1JCFA 5A8WB 2FC0A 5HL7L 2NR0A 1RWXB 4LF6J 1A5WA 4TVAB 3MM9B 4HKQA 4GV6A 3J81O 4UTGA 4BC5A 1HBOB 3SAHA 3VGVA 1JCEA 2JNJA 3PJ9A 1S0VA 3CVKA 1VQOS 3K2YA 1JLAB 2DR6A 3M1VB 4HHUA 3AA2A 1Y0HA 1VSFA 3DXMA 3BDPA 2IVPA 4TSXA 3M6UA 4DN9A 4PL7A 1HBMB 3OL9A 1QHAA 2ZH4A 5HVHA 2B9YA 2DGSA 5CZ2A 4AHVA 2N4DA 2IS3A 2GUIA 5CE3A 1CVJA 1GLJO 1NU4A 3DRSA 3W5XA 5F8JA 2HZCA 1DHMA 1FRJA 3BGFA 3FQKA 2RT3A 3GR1A 3R9PA 1FWLA 4L75A 4JKCA 3WQUA 1QAIA 1KVIA 3D45A 1VI7A 4H4OB 2AYEA 1LWEB 1MWYA 1HNZJ 3UB5A 3R3LA 4DCHA 2CQ2A 2W2NP 4LFBJ 4K0KJ 2BACA 1VQON 2W2OP 1WAJA 3GJQB 4DV5J 4C0OC 2FSNA 2BTFA 1OS5A 3R1HA 1Q95G 2EKYA 2OSQA 3O2IA 1EO1A 2VDHA 3WC0A 1J6ZA 3R5JB 2UXCF 2FC9A 2FJEB 2YY3A 1LXJA 4PG8A 3PO5A 2DK2A 3RB3A 2KZMA 2PT0A 1S0MA 1L3TA 1HNZF 3M2UB 1R0CB 3A8YA 2FY1A 4JEPA 4LFBF 2P9PB 4HCCA 5ETLA 3IO1A 5C42B 1CG2A 3DLRA 3EXYA 3J80Y 2QC3A 3OL6A 1RBAA 1TGOA 2K1RA 2HK3A 1N52B 3BPDA 1GLLO 2VCPA 4DS5A 2AD9A 3UKRA 3L4BC 2X3GA 5LXRA 3T19A 4W98A 3S8SA 2PAVA 1S9FA 3OVBA 2D9PA 3SLCA 4M3ZA 4GVBB 3ITHB 5DGBA 4BLGA 4H0OA 5J2PA 4UZCA 2J7WA 5E0OA 3F56A 4F3QA 3MHYA 3SUPA 5DZ7A 4QIVA 1RTHA 4CM2A 1VSJA 1OY8A 4DX5A 4GY2B 1N36F 2KVIA 2HQFA 2HG4A 2XGPA 3TSPA 3LPYA 1RUSA 5KG2A 3A13A 2EPIA 5LMUK 1QVFM 1M90O 2YX7A 3CTRA 4FVMA 2XMMA 5ITHA 2IIRA 1GH8A 3ENVA 4ES3A 5KG6A 1FFWB 1RTZA 1YUWA 3CERA 2QE5A 1RTJB 2ZBRA 7AT1B 3D54A 2YKQA 3MN9A 5T7LA 3OY9A 5HL7Q 4EO6A 4CCHA 2ZDPA 2L9DA 2RQKA 5AQQA 4IFYB 2GO9A 1SQKA 2NRWA 2JRSA 1ZOTA 2CPFA 4FO0A 3VGMA 2PGCA 4B9TA 1VQPS 1FKPB 5IV4A 5GAEP 4YOWA 3IS9A 3AO3A 4DJBA 3ZC4A 2WFBA 2HWIA 2QSFA 2VZ9A 2BE2B 5AQJA 2DO0A 5ETMA 2MKHA 5CA5A 4ECYA 3VQQA 3QWPA 3ELHA 4LBIA 3CC4S 2GELA 2HBMA 2G8KA 1SBRA 4GV3A 5HLFA 2A41A 3AD7C 1S5ZA 2HVEA 2LA6A 3PKYA 1NB2A 3MN7A 3L4QA 1CXQA 2B0GA 3L3UA 1KC8O 1BD6A 4CJ7A 2IGIA 3TAQA 3HHLC 1RJJA 2DJWA 3M5RA 4AT1B 2G8IA 2HF4A 3EKUA 3QEIA 4FLWA 4ZVQB 1ZBSA 1G2EA 3LAMA 2B7CB 4CK3A 2NRHA 2DRDA 1UVJA 3DOLB 4FF3A 1VQPN 2HMIB 3V9UA 1X5SA 1RE1B 5K8OA 2WUSA 1NM1A 2LLZA 3TZYA 4CJ3A 3MR5A 4DOZA 2DR8A 5C5JA 3QESA 3HPGA 4I56A 1N33J 2DNMA 4YN3B 1NGJA 1WC4A 3NGTA 3DYAB 3QIPA 1F2GA 4CT8A 2V2VA 2JWLA 5EXWA 4A8YA 4WKRA 3CIZA 1LAVA 2ZJRL 1YGYA 4OHYA 5TKYA 5HQMA 2LQBA 1JLQB 2L41A 1O1WA 1RT4A 5E84A 1IWGA 4M7YA 1XR6A 2ZH8A 2HVHA 2DYAA 2ROPA 2BQRA 1NH7A 1Q5YA 5BYRA 4IO8A 3NWGA 3QERA 4PA1A 1TR0A 1DARA 5I9EB 2AQ4A 4EAHD 2DRAA 3HKWA 4FOEA 1IKXB 4JI5K 1HIYA 4CYUA 1Y11A 3ZO7A 4OHVA 3TR8A 4NXNK 1M5HA 4FVUA 4CBWA 2E7XA 1RK8A 3ISZA 2W8KA 1VRTB 3D0GE 3AA8A 1TUWA 1S59A 5HP1B 2MSTA 2UXDF 4P9SA 1FNXH 1WEZA 4CO4A 4W5QA 4PYDA 4KGMA 1ESVA 4KO0A 3CJCA 3LPUA 4IO9L 1WKJA 1N54B 4JKGB 3LO3A 2VOPA 2VU5A 1YJVA 1TK0A 2Z2YB 4AILC 3ZETA 1FESA 3S3MA 4ZCLA 4ZVPB 2ZOFA 2ZEJA 3I5CA 2OJ3A 1YJUA 3ATUA 4QJVA 1NK6A 2SXLA 5LJVA 2M88A 3OV7A 1U1LA 5A6WA 2IVYA 1VSDA 2AEMA 4O3QA 2KZZA 3MCAB 3OR1B 5CCLA 2DITA 4KHPJ 3C95A 3O1WA 3C6TB 3TU5A 4M5JA 1Y97A 2B51A 4X4RA 2RMLA 2AEFA 3ILIA 1X1PA 2VPYB 2XO6A 3TWZA 1TAQA 3DDNA 5DETA 4M5DB 3G87A 1E4GT 4HTLA 4YFUA 3D6MB 4ENOA 1WSRA 4LUBA 2G2YA 3PJXA 4OMFG 4JD2A 2EX3A 3CIPA 5H1SQ 1F2HA 3H2LA 4OIXA 1RT3B 3HPOA 2B56A 1HRHA 4IUFA 3UN5A 2DIUA 3L2QA 4PYAA 1UL3A 1RT2A 3N0VA 3SCLE 2KU7A 2HWTA 3AAWB 2IM3A 3QFPA 1LQ9A 4Z2XA 2IMOA 3NEKA 3VF6A 3OSPA 3FEXB 4JV2A 1DLOB 3H5UA 2ZHAA 3KMSA 2FC8A 4PCQA 3KG4A 1FCAA 4Q44A 1W7WA 3EPIA 1T11A 3D2EB 5EVZA 5ETKA 1FNOA 1U1KA 1KFSA 5AQVA 3THTA 1NMNA 3UVJA 1IVZA 3HSTB 4LD0A 4KHSA 3MECA 1WD6A 2MKYA 3RRKA 4YMEA 3RW6A 4KFBA 1FJCA 3NF6A 3KLFB 1IJEB 4DR3J 2AJQA 4P10A 4CZFA 4M1KA 1FWPA 4JOUA 2W2QP 2J6TA 3THWB 3DLKA 1X4GA 1WEXA 1WG1A 2W4DA 1RBSA 3F44A 4I69A 2MZRA 3RAXA 5F8NA 4FLXA 2C1EB 3QRQA 2ROEA 3DXKA 6FD1A 4BRKA 2ZJRQ 1YVNA 2QA4S 4ECRA 3DAWA 2P8IA 4C8YA 5CZXA 4DR3F 4ID8A 3EVWA 3MN5A 5IOLA 2AU0A 1R8HA 2O67A 4KE5A 4OYXA 2Z2LA 3MEDB 2XCAA 1CS4B 3OT9A 3DOMA 4CEDA 4CECA 1YKWA 4B9NA 4IH6A 1PAUB 1YITS 3KUEA 1RWMB 4RNNA 1HYSA 3SFGA 1IG9A 2D9OA 1Q81O 3M32A 3WEEB 3DLHA 2CJKA 1Z25A 2OYQA 1RAJA 5LMNK 1K47A 4FN5A 4FWNA 3OBYA 2EG1A 4DX7A 4GMJB 4HCBA 2CJXB 4OX8A 4CO0A 3KTQA 1VHXA 2QM1A 3O80A 2CQ4A 1IR2A 1JXEA 1JB0C 2U1AA 3OYKA 4H4MA 2MJNA 4ZPBA 1SC1B 4IO9Q 3TANA 3MMCA 4L72B 2HS0A 2Y3YA 1VOMA 1VDHA 3OFGA 4DTRA 2VPZB 3DHWC 5ELZA 3OBWA 4XH5A 4NMLA 2UXBJ 2WK4A 2MQQA 4J2BA 4KH1B 1C1AA 2VGNA 2Y8WA 4DTSA 3IWXA 3R5CA 4RWXA 3FLCO 4J9MA 2QWMA 5HRPA 1DQ9A 1N8RO 3N28A 2JZ5A 3EDQB 3BF4A 4CH7A 2QWRA 3L09A 4Y0FA 1J5EF 3JS6A 1RHRB 4RW9A 1S72S 2C3MA 3KNAA 4CHNA 2CNKB 2YNIA 2P51A 1YVUA 3B4DA 4ZLLA 2QWOA 3C3LA 2G8FA 1TYQA 4IOXA 3O3LA 2J0SD 3GONA 4TKTA 4L76A 1S1UA 1NGHA 2BW7A 1KBRA 2HURA 3ONQA 2EFNA 5DO2A 4B3RF 4OYWA 4LH4A 3OTEA 4F8RA 1UJ5A 1QM9A 3H4DA 3RMCA 5I3PA 4K4YA 4PUOB 3OL8A 4I2QA 1NUEA 3FDSA 1HNXK 4EIAA 2Y1JA 3A3OB 5HQ8A 2OPPA 3PW4A 1Q82O 5AQSA 1XERA 2BJ3A 5KFZA 2M5YA 3RUBL 1KP6A 3MX5A 2E1ZA 2OH2A 3MM7A 3IP0A 5CHCB 3H42A 1DGKN 3ZSQA 4B3OA 2R2TA 3VA0A 1SL0A 4UT4A 2JSXA 5DLGA 4BR2A 4HI1A 2GQQA 1S7IA 4G6VB 3ENBA 3KD1E 3R8YA 2ABYA 1HBNB 4NLYA 3MPWA 4CTAA 4U67L 2BJEA 3CJAA 2QL5B 3R5GA 2HOEA 2J76E 3ZFVA 3QZ7A 3CJ0A 2UUAF 4CNZA 1RT1A 4J5OA 4NLVA 1IBMJ 1A0OB 1TUYA 2CQPA 3OYAA 2X78A 1K9MO 1LWCB 3WNEA 3KHRA 4LF4J 4ZJQA 3V1QA 3OTCA 1WB9A 4NLOA 1EP4B 4G1QA 2XB2D 4EK2A 2VQEJ 4OX9K 3K57A 3TWHA 4CK1A 2POKA 1B0PA 2OHDA 3CMAS 2HHSA 2FHJA 2HHHF 1HNIB 4UZBA 4OKEA 4FWOA 5EGYA 3CQ8A 3IR7B 2OPRA 4YP3A 3MGJA 3AQPA 1YG0A 3NVKA 4OYZA 2V50A 5L8RC 1AFIA 2PIIA 4WIQA 2BV3A 2RUGA 3K0JA 4DL5A 3W2WB 2GMLA 5CYQB 1UAWA 3OYNA 4MH8A 3G6EN 2MJUA 3W3SA 4AD6A 1GLAG 4IG3B 4XH1A 1VSKA 3OPKA 1TVRB 5K14B 4U6PA 4NLXA 4WXOA 4NYNA 3BB5A 4N77A 2HWHA 3RGIA 4BRCA 4NPOA 3CJ1A 2ZBCA 1HBMA 3IR6B 2RDJA 4OPAA 5RUBA 3DLBA 4ZTJA 1H0HB 4BE2A 5ETSA 4W5NA 3RG6A 2RDIA 5CCMA 4FF2A 3CMAN 4C3LA 4ZN3A 3T9ZA 3Q7CA 3S3OA 1Y9OA 1HLWA 4KGZB 5L1KA 1VIXA 4GO7X 4YR2A 2R4FA 4FW1A 3R97A 3QFUA 3SQ1A 3RBXA 4MQ3A 4YNQA 4UY85 5T14A 4WE1B 1VGYA 2E6MA 4HDHA 1RDUA 1HWLA 2B3TB 4BGAA 3MTKA 1P9QC 1NK4A 4F67A 4QIWD 2F63A 4JI2F 2R7TA 2O4GA 4DV7J 1S1XB 1L3KA 3ZX2A 3O9SA 1N6QA 2VG7B 2AEJA 1B9FA 3C2PA 4IQMA 2RNEA 3QIDA 1F9FA 3KLHB 3M2UA 2ZWHA 2VV5A 1HR0J 4WBFA 4Y2KA 3R7BB 2HHUA 4WZMA 2LA4A 4CJ5A 2FVPA 3H20A 2ZNYA 3BF3A 3EZUA 3VQPA 3BGRA 1ZXOA 3VPZA 4V19S 2HNYB 2W01A 1I6JA 1SZ2A 3QINA 1EETA 2E4LA 3PRBA 4A5BA 2DEIA 2G9OA 5DZ6A 4ZCKA 2A2CA 4CM0A 3VEXA 4H0VB 2F4VF 4J90A 2A1BA 4I9QA 1VQKS 4O0IA 2JLEA 3CJRA 1D0EA 2DHSA 4DL0C 4TLRA 2QMXA 4LY7A 2EC0A 1N4LA 3OBIA 4CZJA 4ZP7A 5LY3A 1U45A 4ZVFA 3SI8A 4GRSA 1TAUA 4FPRA 2GEMA 2CQGA 4X62K 2NUHA 3HI9A 1JLCB 4U67Q 4WU3A 1OSDA 3DRYA 1K8KB 6FDRA 4F4YA 2NZCA 4B9MA 3I5BA 2BE9B 1UOCA 4Q8EA 4N7TA 5HMXA 2IRYA 1H6KX 4G9ZA 4NWBA 5AQPA 4Q2MA 7FDRA 2WSCC 2E2PA 1IM4A 2R7QA 1PJ6A 2YQ1A 4E2FB 2ZVIA 5HBMB 1QLNA 4X66F 4BRLA 2UUCJ 1P9YA 3HSGA 2ILYA 4HT5A 4CJUA 1PYTA 3FMBA 1JJHA 4L6V3 2UP1A 3SCKE 1HBUB 2FVCA 2P9NB 4OYBA 3C7NA 2XLIA 1IKYB 4I6WA 3PY8A 4DU3A 1O13A 4CK2A 4FZZA 2ETJA 3P5JA 4R8UB 1RTJA 4YHHJ 4DUZJ 3BSNA 4OHXA 3RMAA 4DV1K 1SIZA 2JDJA 1FEEA 3FE1A 4DV3F 4USMA 3MF5A 3M8QA 2EC2A 1BQMB 1QSSA 3TPQA 1NGAA 3MAHA 4X4OA 4OZ3A 2B9XA 3M2VA 1FKPA 1B4SA 4JV1A 4K8ZA 4GVLA 2VONA 2CQBA 2BE2A 3DFEA 2GQCA 4N41A 2V9WA 3NDKA 4PPZA 1AZSB 4DQPA 2C2ZB 1YTYA 3GFHA 1BHNA 3MCOA 2J8AA 4DPOA 1VSHA 2LQ5A 2IYIA 2YKPA 4E0DA 5EN1A 2Z1GA 5D4LA 3ZT1A 4M5LA 3T69A 3JSRA 2N7YA 2MEWA 1DKGD 3A5LC 4FDFA 4M95A 2RDDA 5KRTA 3RAMA 3HD2A 1CXUA 1VMBA 2R7SA 1I1GA 5H9FK 3FVYA 3GIJA 1ZA2B 3WX4A 4UW2A 3KLEB 5B0DA 3DOLA 1JNZB 1LNQA 1N0VC 2UUWA 2HMIA 3PYFA 2GX8A 4F50A 3HHNB 1BMQB 1VK8A 2ZFHA 4DL3A 5MLCV 4CHZA 2P9KB 1CBKA 5CABA 1QY7A 3FRZA 1MWQA 3AJ2A 2EFQA 2VICA 4OJRA 3U9DA 3RMBA 4ED0A 2CADA 1XQIA 2OP5A 1TL4A 2A18A 2ZVSA 1TFYA 3PHTA 1GXUA 3NXZA 4N56A 5HRRA 4ILLA 1QTMA 2B4OA 1SC4B 3QBCA 3Q86A 1JLQA 1KOHA 2HAIA 5EUHA 3RAQA 2Q31A 3HHKA 2DBBA 3BBBA 1I5OB 3IFRA 3VAKA 1UP1A 4RBVA 1W2IA 5J2QB 3KK7A 2J0XA 1D9DA 1RU1A 1FFGB 2R2SA 3HPHA 4AYBD 5KGXA 3GPAA 1XHXA 2KVQE 4CH1A 2DR5A 3KKSA 2H9ZA 1W26A 2H3GX 2XYHB 1IKXA 1HD0A 3NNAA 1GX5A 4K4UA 3ZSWA 1NGEA 3F9MA 5CY4A 2QLFB 2F8HA 1JKHA 3WXLA 1S7HA 1P8ZA 4DR7F 5F8IA 4Y3CA 4C97A 3NAHA 2RKIB 1RT5B 1ZETA 1VRTA 4ZCMA 3W8GA 3ENWA 3BGLA 3QT6A 2OSRA 2NRRA 1UJ4A 1LK7A 4DS4A 4OI4A 1X31C 5BJRA 2BM1A 2W2PP 4QR0A 1EKRA 3TVZA 1WSEA 4JKGA 3HOTA 3J7AN 4HTIA 4PXBA 2OTJN 2JOQA 5F8LA 4QS7A 1OH7A 5AQKA 1TKZA 3A12A 2MKCA 1BQNB 2KYZA 5ETOA 3MR2A 4DR1J 3RYLA 3GP9A 5B09A 1CJTB 4O23A 1EQMA 3LW5C 4UOCA 3ZT4A 4B8CA 1HNXJ 3KXDA 1OH8A 1SKWA 2XHCA 4BROA 1X60A 4ID5A 4ZTFA 5FLXU 4DLGA 2Q1LA 2BZ2A 2Z30B 4ZLJA 1U1RA 1FNMA 2LVWA 1D3WA 1FW6A 5EX5A 4M5DA 1UZHA 4NXMJ 2MHNA 2FTRA 1KLMA 4C8OA 2DHHA 4KSEB 2DB1A 4JKDA 2RRBA 5KG0A 4FJMA 1NZ8A 4CEEA 2RU9A 3QNOA 2DHGA 1B3TA 5AQLA 1RT3A 4OHZA 2XZTB 4LQ9A 4Z37A 4CGFA 1GEHA 1FO1A 1W2BM 3HYFA 4YDDB 2KHOA 4OPJA 1Y5IB 2HBKA 1DLOA 4IDKA 3H5SA 3EUNA 3WX8A 4GC7A 4C9DA 3NGYA 5H9EK 1JLEA 4LBHA 2AW0A 2YWKA 4O0NA 2DEJA 4YDUA 2O8BB 4NLPA 2FGOA 3SIPB 1MN7A 2DNYA 3D2EA 3NCIA 2HBYB 3OHAA 4BG8A 3QT7A 1FKOA 1SC3B 3CJ8A 2APOA 3BZCA 3TAGA 2PDAA 1BU6O 1X9SA 4ZHRB 2M0GB 3KLFA 5KFGA 3DGPA 3AVLA 3J7ZT 2OPQA 2F1FA 1T6DA 2WVEA 2IVOA 4B08A 3CO0P 1GMWD 2YWWA 4DV6J 3NE6A 4DU4A 2E5LK 3J7AP 3CCRN 4GVMA 5AXMA 1Q9XA 3VGTA 2W9BB 1CZBA 1CLQA 3W0LA 4H5WA 4EEYA 2C2MB 4O3OA 4O3PA 3IRXB 5KFTA 1Q18A 4LF1A 4RO0A 4C1NK 1NGGA 2DNPA 1X4BA 3IGNA 4FYXB 3MEDA 1CS4A 3B6BA 1KQFB 2ZM6K 1TQLA 4YOTA 3EXCX 4DDFA 1QSYA 3NMRA 2FHMA 4Z4GA 4DV6F 2IAJB 1T9VA 2Z2MA 1PKUA 2E44A 2ZC3A 4CO1A 1K73T 1I3AA 1RLDA 3CE8A 1ASUA 1AW0A 1U7LA 1IKWB 2EFGA 3EDRB 3KJNB 3JTOA 2IJFA 3POTB 4JI4K 3CDUA 3GILA 3AOAA 1U02A 1N32K 1GLBG 3WEEA 3NH0A 4WFBL 3KDOA 2X74A 3T5JA 4Z4EA 4P71A 2CPYA 4FWRA 1H2VZ 4Q2LA 1TL1B 3VEYA 5JMVA 1X4EA 5FPEA 3LZIA 5FLXO 4DX8H 2RQ4A 5JMNA 1BI4B 2EWSA 2E1MC 2ACMA 3ULHA 2KM8C 4J9PA 3W2VB 1FTRA 4JB8B 3THVA 1VSLA 2K3IA 2BYCA 2E66A 3HJFA 1RAEB 2D0OA 4P2FA 2UV8A 4Q0BA 4K4TA 2CG4A 4NE9C 2NRVA 3U7JA 1LW2A 2JFKA 2E1CA 1A9NB 2CJQA 2H65B 1TELA 4LRCA 5AFUA 2QLWA 1S6QA 2KI2A 2ILZA 4QOTA 3NCQA 3UFCX 3VQ7A 5J1EB 2HHPA 4BCAA 4KTWA 1WKLA 3CI5A 4FK2A 4ETZA 3SQGA 2MZSA 9ATCB 5F0WA 3AGRA 1KOOA 2NREA 4OI0A 4DR2F 4MIBA 3E9LA 1J2VA 1Y00A 4YR3A 1Y3JA 3BGOP 4GKKJ 3A8IA 4WK3A 1LOTB 2XWYA 4AHCA 3KDNA 1LWXA 2AP6A 4IBNA 1N5TA 2KG0A 4DR6K 5KFMA 3WIVA 3I0SB 3IM8A 3SCJE 1JLBB 5CD4H 4MKVA 1F60B 3CGIA 2F8SA 3A8EA 3CCZA 4LT6A 1X4DA 2X1BA 4WWSA 2B4UA 5GAGI 2UUBJ 4IQXA 1XMQJ 2P9UA 3OYJA 2EKNA 5C7PA 3ENHA 4B1UB 1Q4RA 1AUSL 3VAMA 3DDIA 5A6PA 2HQIA 2MSSA 4WFAL 1YJ7A 4TYBA 4GKKF 3RZAA 1LW0A 4PUOA 3QRRA 3GCWP 4DUYJ 3H08A 3QB0A 5CZVA 3MEEB 4JI3F 2PYJA 4ECTA 1HNWJ 1VQ4N 5D77A 2J0QD 2JX2A 4CEBA 2AF6A 2XNRA 2UUBF 5A2QY 4JKBA 4K8RA 4RKUC 3IKMA 3CJKB 3ZTPA 1UWBA 1REVA 3TA2A 2YHYA 1ZBUA 3T1YK 4K43A 4C1NI 4ECQA 3JYTB 1R8CA 1XNQF 3OW2M 3LP0B 1NWKA 4RU9A 1I39A 4C48A 4OJ3A 4NLUA 1HBNA 5BR8J 2D3UA 1D1UA 5GADP 3P5BP 1JJ2R 2GAGC 4C8MA 3UN3A 2B8PA 4A62A 3DOKB 3R7NB 2ATQA 5C2DA 3GOIA 2LSNA 1U4BA 3T5HA 2N7CA 1YWXA 1ZPWX 2W2MP 3LL3A 5KRSA 1YJ9S 2B6AB 2A3JA 3RB0A 1S48A 2FBXA 3FRYA 3TEHB 4ZMMA 3MD1A 4LF7K 4JI7J 1XNRK 2N4CA 1JJ4A 1WUUA 3BZQA 2LXFA 3ZSZA 2DD8S 5AJ3J 4E7LA 2HHQA 2HNDB 3W65A 3PIOL 1IKVB 1EP4A 4BR7A 5GAGP 1IBLK 2RU3A 4A2AA 2FY8A 2BUPA 3QGPA 3L0QA 1NB7A 2ASLA 1K0VA 4DR4J 3MWTA 2ZGZA 2OAUA 3GSDA 3MUVP 2VIHA 2R7YA 4BACA 2WB1D 4X64K 4CJSA 3BY5A 2F8EX 4M63C 3EJMA 2MY7A 1ZPVA 4ECSA 2V0NA 3MXMA 3LP1B 1C0TB 4WFBQ 3M8YA 2VASA 4KAIA 3A4TA 5M1QA 4IKAA 5AJ3F 2J0WA 4ZDNA 4MK9A 3KK2B 2A2DA 1HQUB 4DMNA 4DCJB 4J9QA 1M5KC 4FWQA 5D3GB 1S9EA 1S6PA 4PXDA 4CGGA 3OUYB 3T6BA 4OZ0A 4JYAJ 4DR4F 1VQMS 4Q5VA 4FM0A 2Y8YA 4MFBA 3D9BA 3EE8A 3WQTA 3A2FA 4CJRA 3G6VA 1F1BB 4USUA 2PFUA 1ACMB 1KS2A 1TKXA 4H0YB 4QAGA 5ETRA 1GLFO 3K5OA 3N5BA 5DGAA 3FZBA 1YJTA 1U2VB 2H3EB 4LRDA 3M9MB 2E7VA 3NF8A 1YIJS 1D5AA 4WE1A 2H48B 2DGWA 5AQGA 1RA7A 4L73A 2ADBA 2GVDB 3AGKA 3M6WA 1RA6A 3KLGB 3KHGA 2G4BA 4WFZA 3G8QA 2KTQA 2V68A 2QJ3A 3VTHA 1HYVA 2PI5A 1WBDA 2ZOGA 1S4EA 3O4QA 3HT3A 2VF3A 3W9IA 3G96A 3V6KA 4FM1A 1OWXA 1HMVA 1KSPA 4WFAQ 2LU1A 4LFCK 2DXFA 1QE1A 1O8BA 2P9SA 4CLYA 3F5TA 2FHJD 2V4JB 4NYOA 2OA8A 3MEGB 5FROA 1RAAB 4OYPA 4DR5J 4M3WA 4JKAA 5DG7A 4MK8A 5EDWA 4BGBA 2MLXA 1V4TA 4CLSA 4MO5A 4DQ8A 5LMUF 4QWAA 5GMDA 4J9KA 2O8CB 4J37A 1U8SA 1CSJA 1U49A 1SS6A 5A8KA 4N8NA 3MMVA 3GV7B 4JI6K 2RJZA 1LK5A 4H4KA 5B0AA 4C11A 2QXLA 3PKMA 4K4VA 1B99A 2WBNA 2BKPA 5F8GA 3VEZA 2ZBPA 3CUNA 1N5SA 1WOQA 4CIEA 1DEJA 4ZPAA 3TP2A 2W9CA 3AQOA 3H59A 3T1HF 3J80U 3AFGA 4B3TK 3KD5E 1Q7YO 1DQ8A 2J9DA 3RB6A 1TV6B 2LU2A 1YTUA 4F2SA 3LDQA 3AHPA 4F4AA 1RTIA 5KPZA 1N5YA 1PYSB 4KPCA 2J9CA 3QO9A 2VWJA 1DQAA 1ZBFA 3J7Z5 2BOPA 2AT1B 3PIOQ 2GC8A 4ZKAA 1HBUA 5GAEU 2A6OA 1WSJA 2P9NA 1NHVA 3MAQA 1IKYA 3EL2A 4O44B 2Y1RI 3O08A 3MPYA 4NRTA 3ZZOA 4R8UA 4QS9A 2AGQA 1EQYA 3NAEA 2XWXA 3JQMA 1HA1A 4KTQA 2LQJA 3CMEN 3MTJA 3TUJC 4RUAA 3BSAA 2CJ9A 3TNVA 1WAFA 4U8YA 2X6NA 3NBPB 4I2PB 3MM5B 4RTFD 2XY6A 2AWZA 3AVMA 4OLBA 4G1IA 4H5NA 2AX0A 2QYGA 3LALA 4HR2A 4ZJOA 1AZSA 4OZNA 3ZTQA 2M8DB 4FYDA 1NBWA 1VLYA 1FKAF 4LF8J 3M6XA 1XR7A 5KFHA 3CDBA 2E1YA 3IMQJ 2F9JA 1WHYA 2XSFA 2XBPA 4JI0J 3LTOA 3KIOA 1W2BR 2R7XA 1MMLA 1RDCA 4M5GA 4NASA 2J8SA 4R5PB 1JXVA 4J9LA 4NI2A 2V4QA 5EOYA 2I7NA 2MYFA 2HVIA 2LQ8A 2KJWA 2JHEA 1VQ6N 5KFNA 3R2CJ 3ZSXA 3IAYA 3E8OA 4J9UE 2DRBA 3OYDA 1S76D 2O1PA 1CJVA 1NZAA 3KWIA 2Q0UA 3P1GA 1Q9YA 5HVGA 2PD1A 2IJNA 1KN6A 5M1PA 1XK8A 4KHMA 4YY3J 1F5CA 4JI5F 1TL7B 4ECVA 3ZEUA 1F3VA 1WF0A 1Y5LB 4FZXC 2O8EB 3WBZA 4PL8A 2O01C 1S9GB 2GAHC 3CYMA 1NJXA 3GZ7A 3E01B 1HNVB 2BA9A 2KN4A 2K8GA 1XMOK 4DHVA 3CSKA 4CJQA 3SQ0A 4FWLA 1HQ2A 2MGZB 5J2QA 1QQMA 1PJ7A 3H5YA 3ZNJ1 1RADB 3KKRA 1CLFA 2G0JA 2E6LA 4HUFA 1K8AO 1FE0A 3VALA 3QJJA 3N6NA 1LOUA 3FGUA 3HVWA 4IFVB 1U2CA 5F9NA 4YY3F 4D3HA 3J80O 2J7UA 1WWHA 2IJRA 1XI1A 2XSJA 4RW7A 1GLEG 3BYRA 4BC9A 1KAYA 1UFKA 2CGJA 1GAOA 2LEAA 2R2UA 1UEUA 4P6QA 2ATLA 4FS1A 3FFIA 3Q2SC 1XR5A 4KGXB 4QPTA 5AQHA 1BUPA 4BQLA 3CCES 2YKNA 1FVQA 2JLFA 3OYCA 2A10A 4UUWA 2GUPA 2NSBA 3ASMA 2KM8B 1RWOB 2MZJA 3NGRA 3H3NO 2AZ3A 3CDWA 4JI1K 1TKTA 1JWWA 5F0XA 1Z4UA 2V8GA 2YWGA 2XI3A 3U1LA 1ILYA 4JV0A 4H54A 3UO0A 4LF6K 1WC6A 1CJTA 4CF9A 1MSWD 5L9NA 1WOPA 2FB0A 2W7AA 5D0RA 2NRZA 2XMWA 4W92B 1VC0A 3P39A 3MMAB 4M41A 2VG5B 1U1MA 5JLHA 4QYZJ 1IG8A 3CCEN 3KUGA 2KXHA 2MQMA 4NL5A 3V6DA 1HKAA 4L3QA 4K7QA 4DTUA 3PX6A 4OLAA 3KLVA 4CI0B 2LECA 2HLUA 3Q24A 4O5BA 1SUQB 3FZMA 3CJ9A 1HX1A 2ZF5O 3GG1A 1C1CA 1M1KT 2EFVA 3H5XA 4E7HA 3I6PA 5KFJA 4ZVOB 4OLPA 1KXPA 1MLAA 1RBUA 4KBOA 1UJ6A 3JSMB 4DQQA 4I6MB 1M0SA 1U0HB 3OSNA 1HNZK 4RW4B 2KYXA 5L46A 1C0FA 4BQZA 3UI3A 1C1BB 1K44A 4K0KK 4LFBK 2OIHA 4DZ6A 3HLUA 3RB4A 2DGOA 4DV5K 2JGUA 2NXJA 4H8KA 1ICEB 1VQ9S 4CEAA 1HQEA 2ZH1A 4KT0C 5ADXH 2BMBA 2Y9HA 1WSGA 3H7HB 1ZBHA 3HZ6A 4R79A 3C15B 4ZHRA 3H40A 4A46A 2KXNB 4H5VA 1MDUB 3TZXA 1RILA 3J7YI 4RCHA 3V4IB 4WFNL 4OKJA 4EYIB 1R8PA 1WC5A 1HW8A 2R42A 2V8PA 2RQCA 3G86A 4CH0S 1R0BG 1GOBA 3CD0A 5HATA 1D9FA 2KLAA 1FX2A 3IBWA 4FJGA 3BBFA 1NM2A 3IBCB 4BRAA 3P83D 3U3GA 4EFAC 2HF3A 1NXIA 2M4MA 4B3SF 1WTFA 2W9BA 2IBOA 1RKJA 4IOAL 5LMNF 1E4FT 4CFBA 4AFFA 3OHRA 3IRXA 3RSEB 2Q43A 3MK6A 4B9VA 3CM5A 3SUNA 4OYIA 3BP8A 1KONA 2CZVC 2OMLA 2P1JA 5SWMA 2IAJA 3QT5A 3GU0A 4ZVGA 5C2CA 3LDPA 3JQKA 2IC3B 2PN6A 3C19A 3S01A 4NA3A 3MXIA 4OJ1A 5SZTA 2OELA 4I7FB 3C14B 4ISGA 5GVQA 3SXLA 4F4ZA 2Y1IA 2VOOA 2EBEA 2G8VA 4NCGB 1S12A 1C0MA 3QWUA 5E3RA 4OQJA 4DL4A 1NDPA 1KNZA 4NYFA 1HWJA 2QTDA 2YWEA 2QLBB 1TL1A 2CNOB 4DQSA 2ERRA 2RS2A 3UIQA 3IBFB 3UE2A 5B08A 1S97A 2Z2ZA 4B1ZA 1NH8A 3PFEA 2I5JB 2ATCB 3F73A 1S57A 4QS8A 4BR4A 3W2VA 4F9OA 4OFZA 2YWHA 4ED3A 2L3MA 1YQHA 3K8WA 3E9OA 3HBTA 3PCOB 1N5QA 2VBWA 1T0TV 4ZA1A 1VRUB 5AQNA 1KEKA 3J7YP 4ELUA 4IFEA 1EWQA 2YHXA 3CCQS 1BLUA 4FW2A 2HQ3A 5J1EA 3K7RA 4LFCJ 4P2MA 4LJMA 1URNA 1IJJA 3FNNA 1WC3A 2GVZB 2Q66A 3DLGB 2CAJA 1DT9A 1VQLN 1Q1KA 2BDPA 4GVEA 4B1YB 1HI8A 1RCOB 3NCPA 3QQCD 2K2PA 5EX0A 3SUOA 2YNGA 4HWIA 3G71N 4JKEA 5LSOA 4ZS6A 2W25A 2CNLB 4CIOA 5D15A 4ES2A 2CGLA 3JAMY 4MIWA 2XZDB 2EFOA 3I0SA 1VQ7S 3S3NA 4A2BA 3QSIA 4DV4J 3O8MA 2E1RA 3SPYA 1YLXA 2QW9A 4LFAJ 2DNKA 4DU8A 3ENOA 1WN7A 3KK3B 4ID1A 3KJFB 2UU9J 1NGFA 1TUUA 2D1KA 2YI1A 2LKZA 3GJTB 2C2DA 2MKJA 5KFYA 4OI2A 2IVFB 1VFJA 3WIUA 3PEHA 2FBVA 4FK0A 1G99A 2R8IA 1WG4A 2M9KA 2QA1A 2G0CA 1F5AA 3TVYA 3DMJA 3LDSA 5DMRA 1R27B 2BANA 4ZPWR 3HULA 3GIMA 4IYQA 4ANEA 1QVGR 4Y2IA 1N33K 2VKRA 1UAXA 1YRUA 3GIRA 1Z2LA 4K8XA 3ZZPA 4DV2J 3VENA 4E8UA 2GX9A 4Y2MA 2LP4A 3AA4A 4C3KA 4YB6A 4JI8F 2RHKA 4QZVB 3U6FA 1NPKA 4V19J 1KVKA 4WFNQ 2B9WA 3G82B 3QEPA 4B9SA 4NO7A 4J9VA 3C0BA 1AUDA 1RBVA 1K8AT 2MKSA 3MXHP 3IWLA 4DSJA 4CRJA 2UXDK 2D5RA 1FERA 1BXNA 4BC2A 1PG5B 3O3FA 1AT1B 4NZ6A 4GW6A 4DV2F 3Q83A 2RVJA 2B6AA 1WTBA 3K5MA 3SEOA 3SPZA 3CDEA 4IOAQ 3ZZRA 3CD5A 2B5JA 4HVJA 2IPOB 1FDNA 4YOYA 4A8OA 4KY3A 4W5TA 5AZIB 1WLJA 4CI6A 2H4YB 5L1IA 3WNGA 1FK9B 4OPKA 1JCGA 1HWKA 4ELTA 3H1VX 2D3ZA 3AXMA 3ZSVA 2KHCA 1Q16B 2DR9A 5SUHA 1CEZA 2GV1A 2WONB 4XPCA 3T7ZA 4AQYJ 4FKXA 3DM2B 5F8HA 1C0TA 1VHIA 2XY8A 3BKUA 4NEYA 2BQUA 5DM7L 2YNFA 1RU2A 4BRNA 2ZOMA 2GGPB 2CA9A 5IT9Y 2MZTA 3KK2A 1HQUA 1NK5A 4DTPA 4WTOB 3BO2A 5LL6d 2CZ9A 2IDOA 4HYKA 2WOMB 4KHPK 4E1JA 1NBEB 4CZMA 1FVSA 3PUFA 5D0EA 2ZGYA 4AQYF 1WDTA 1LFWA 4YB1P 4LSLA 4BG9A 2HEKA 4OO1J 4K4ZA 4A8MP 1MW7A 3VESA 3PYGA 3BQ0A 3HXMA 4X4UA 3KJVA 4U95A 4BE1A 3M9OB 1AFJA 1NG9A 4C6AA 3MPVA 3GFXA 5A8RB 4CJ4A 1VCTA 4XPEA 1EX4A 3HOSA 1NMEB 3UDLA 2DTJA 3OXFA 2W6LA 3FZFA 2JWKA 5DDOC 3EKSA 4LF5J 2HZVA 4JV5J 3QFWA 4DFMA 1N5VA 3DN9A 3O9UA 2AP1A 2HSTA 3BR8A 3KLGA 2HB5A 1JQGA 3CJ2A 3GFZA 1WEYA 3P8BB 3VVUA 3TAPA 4FM2A 1ZH5A 4KI4A 5LJ5Y 3NS6A 2ZKUA 1RAFB 1RHJB 4W5OA 2L08A 3SZ2A 2LDYA 1UVNA 4UY8O 5ETVA 1B7YB 3MUMP 1TKDA 5M1KA 3EM1A 2W4CA 4EI2A 3UCZP 2JL9A 1QSLA 3AD9C 3NMUA 3P49B 4BVPA 4PZVA 4DR3K 3THYB 3IG1A 4LF5F 4X4VA 1Q8KA 4ER8A 3QMLA 1RT6B 4K41A 5IWAF 1NDCA 3FQLA 2LFVA 4CHYA 3MEGA 3RR7A 5F1XA 3HM9A 1SXLA 2CQDA 3ULEA 2DH8A 2JFDA 4B9UA 1J27A 4TQRA 3CJ3A 3VGSA 2PA8D 1SH0A 2VFTA 2ZHOA 2V8HA 4AHUA 1MU2A 3M9NB 3NGKA 3IGVA 1KD1O 4FK4A 3B54A 1VRQC 5KT3A 2D0PA 2XMKA 1TL3B 2ZH6A 4B1XB 3U1NA 3MEKA 3VQ6A 5G0RB 1G3OA 2WTUA 2MZQA 3MURP 3ZLJA 3KWGA 4DG1A 4HHHA 1Z2ZA 4DUTA 3QZ8A 3OVSA 1KLNA 4JHDB 1RWKB 2AJ0A 4DV1F 9RUBA 3D6HB 3CCMS 2O5DA 4DMZA 2Z1JA 1H2TZ 2UXCJ 2GQ2A 4FOIA 1BISA 3ZZYA 3TO8A 3I0RB 2RF2B 4U96A 3EZ5A 5D0HA 1E6VB 3T3FA 3DRPB 1WHXA 2QLXA 1WG5A 2VHGA 4KPYA 5FRNA 2I6WA 4J7CA 1T05A 3Q8RB 1W97L 2I9SA 4DL2A 3BGUA 4UUXA 4PKGA 3TOQA 3AAPA 2NXNA 4P72A 5EWFA 1JL1A 4MT1A 3W1YC 1ZM3A 4IOCL 2G8UA 4LSNA 2M8HA 4ED6A 3D1HA 3KVGA 2E20A 4RX6A 3CCJS 5L1LA 4K4WA 1JJCB 4TY8B 4GMKA 1NCLA 2XCPA 3MR3A 3CCMN 2HQCA 3Q7BA 2ZDOA 1OMSA 5E7OB 2L9NA 4HACB 5DM7Q 3MM5A 2JLGA 5KFFA 3PW7A 2W6KA 3BO3A 4PWDA 3QEVA 2QK9A 2UXBK 1BDGA 4CWBA 1CZ9A 4NLGA 5F3ZA 5KFCA 4OX6A 4F3MA 3AO5A 3VWSA 3AVHA 2BVZA 3PO4A 4QBUA 3AXKA 1N36J 1D8ZA 5GMEA 3DJCA 1NHUA 3TJ8A 4P2SA 1X5PA 4XAKA 2VL1A 4TU9A 3BH6B 1SPBP 1WOSA 3CCJN 5C24B 3E1YA 1X4FA 2DGUA 4R5PA 5FRMA 1G7CB 1NPRA 2YNHB 3VAHA 1HUXA 4CO5A 3EICA 4ZIWA 4HDGA 2ZUGA 4AUKA 3M30B 1H74A 4O3NA 2OD4A 1YZ7A 4AF1A 3EO3A 2F7VA 3GV8B 1A6LA 5IXUA 1LWFB 4W5RA 3S6EA 2HRYA 2VYPA 2VH7A 2YTCA 4DWIA 2L48A 3ISNC 2ZWOA 4KKOB 3FZKA 3I32A 4GKJJ 5ETQA 2CQ0A 3UN2A 3D2WA 1D4XA 4WYBA 2O8EA 3TJAA 1NKEA 1FX4A 2HKEA 5E26A 1S9GA 1NJIO 3CCWA 5KFBA 4DTMA 5CXTA 1PYOB 4E89A 1HNVA 1U6BA 3LDNA 1EKSA 3VQDA 2VC1A 5K9FA 3MCSA 3DLLL 1F21A 2AA4A 2GJIA 3HX9A 2BJDA 2FPHX 3NRBA 5KPTA 4IEIA 1MWZA 3DXMB 3CG7A 3UKUB 2KH9A 4KB1A 2KB2A 3VQTA 5I4MA 3CETA 3TTCA 1BUXA 2XI2A 4E7IA 2CQ3A 4OVLA 2HHWA 4GKJF 5GINA 3RJMB 4RW8A 2NUUG 1U8WA 3OFEA 4MYTA 2MXYA 1ZYQA 4Y28C 1T02A 1Z1ZA 1BIUA 5AXKA 3RR8A 1IBMK 5HMWA 2J5AA 5GIPA 3ZT0A 2HBJA 4M3RA 4DPWA 3DXSX 3P5TL 3SSQA 2PC6A 3ZSYA 3OYLA 4O3RA 2Q6BA 4LF4K 1G15A 1Y4ZB 4M5NA 2D0CA 2DR7A 2VQEK 2QG9B 2VFRA 4U7BA 3VF4A 2YWFA 2YHBA 3GE9A 3DI6A 2M70A 4NRUA 2PMHA 2DNZA 2ZD1A 3ID6A 2N82B 4CGIA 5J1NA 2V2KA 3L6QA 2GHVC 1T9WA 4DU7A 1ATSA 4PWWA 4CJPA 1YRTA 4EZ9A 4IOBA 4DQRA 2WC9A 2RE2A 3LF0A 4BRFA 4CBXA 2D1CA 3QNNA 3NCRA 3W9HA 3H98A 2FF6A 2NZ4A 3BZKA 3O44A 1RAGB 5GAHI 1NDKA 3WHIA 1C2PA 1W7AA 4WQ4A 1NSKL 2RB7A 4IOCQ 2AJ2A 4RNOA 3GDQA 2FVQA 3DLEB 4KV8A 2YBVA 1SI9A 4FL9A 4HUGA 4JI2K 3EGZA 3QGGA 2XMAA 1SUQA 1UFWA 3FEYB 4G65A 2FYXA 4NZ7A 4RUHA 3N6LA 4DU1A 3QEWA 3K5LA 3UKRB 3CD7A 1UKUA 4M5IA 2BJ1A 5IT4A 3G0ZA 1RTDA 1S1TA 2VBYA 2HHXA 4KC5A 2DIVA 4FF4A 2UXDJ 2QWPA 4X65J 1P6TA 4KHUA 5J2PB 3TAEA 4WKYA 3IXQA 2QLJB 2V67A 1C1BA 1YTAA 1RLCL 2R8GA 2GJFA 4YEAA 4IRDA 1KKHA 2GMJA 4RNMA 2COLA 4DSKA 3CPWR 2HNZB 1RWVB 3BN7A 1RTHB 1ZA1B 3KNGA 4BBYA 4OI6A 2EK6A 1QAJA 4CIGA 2KT3A 4DV7K 4EU0A 2MQLA 5B8HA 2R7OA 2VWKA 4TNOA 4UY8T 4F0KA 1VBKA 4DCOB 4X65F 1S1WB 1S0OA 1GMWA 3EWGA 4RW6A 4YB7A 4ZP8A 1HR0K 1N56A 3CJ7A 4C23A 2KFNA 5CYJA 3AY0A 3CCUN 5E33A 2QL9B 3DRRA 4BDYA 1G6BA 3Q23A 4JI4F 3D67A 5KG5A 2KDOA 3M2RB 1SJ3P 1W0HA 2J4RA 3DNCA 1KR4A 2C2OB 1FRHA 4LVNP 3OHBA 1X0FA 4DFJA 3RSEA 5DQHA 4IXCA 2JJ4D 4IZ9A 4ZIVA 3IUCA 1YRXA 4ICLA 2HHTA 4P52A 4USHA 2HVDA 3CXCR 4FJ7A 1KD1T 2RRNA 3W64A 3RTVA 1RBTA 3DLLQ 2EWHA 3UR3C 1J53A 2EVZA 3AOBA 3BKTA 2Z8QA 2HQDA 3SMZA 3IR5B 1R6VA 4FKYA 2CPDA 4EFHA 3W62A 3L3VA 4PKIA 4IJAA 1L3VA 5HMYA 1X9JA 2FZKB 5A0YA 5E3CA 4I7FA 3C14A 2YJEA 3UWTA 1GLDG 3X1LB 6AT1B 1K0TA 2HBZB 2GJ2A 2Q79A 3E2EA 5HLFB 2QSWA 4Y2CA 4J8FA 3MMBB 1B70B 1NJZA 1NSPA 2CKWA 4W4MA 2AYGA 3MAAB 1OVYA 1T7PA 3HKZD 2UUCK 2GA7A 5M2UA 1BL3A 3MXJA 1V3SA 1UFLA 2CVIA 1NK9A 2IFXA 1AB8A 2FF3B 4B1VA 4MJKA 4PXCA 1UA1A 3W63A 2ZQBA 1MROA 4YHHK 2HFNA 4DUZK 3VAFA 1ITGA 3CJQA 3GBTA 4J9NA 1LXNA 3QIPB 2EK1A 4RR5A 4K4XA 2GVZA 1CJUA 4DQIA 4HH0A 3O8WA 3CCVN 1HD1A 4HTJA 2ZC4A 2XHBA 5AQRA 2ITMA 4OPHA 2CWXA 2OTLS 2C2KB 1RBLA 2PO4A 1Y7PA 3NGSA 3LP2B 3ALYA 3C16B 3FBBA 4RBTA 5A76A 4YUDA 4B3MJ 3UW1A 2CPIA 3CFOA 2QGFB 3WNHA 4QWEA 5EY4A 3C6UB 3DU6A 2GFFA 3L2VA 3ZSRA 3FZLA 2RD5C 3T1YF 2KT5A 5F2RA 4CYUB 1BGXT 4FVCA 3VHQA 1Q5VA 4CJEA 2CDQA 8RUCA 4M7XA 5KFPA 3R1XA 3FCHA 2OANA 3VQ8A 1UEKA 1G1XA 2WSEC 3M8ZA 5KFOA 3HVTA 5D4NA 5GADU 4X4QA 4CZGA 5I42B 2CFXA 2FBYA 4B3MF 4KO0B 3FZHA 2OTLN 1PIEA 3CWJA 5C10A 4QOZB 3ZETB 2DY1A 3EE9A 5C2FA 2NUBA 2BABA 1RCHA 1NJIT 2QZ8A 3P3DA 1HLUA 3GIKA 1U47A 1Q86T 5DM6L 5BRHA 1Q7LB 4JS5A 2BGGA 1WKKA 3VQ9A 4C0BA 4BHQA 3ZX0A 2UVVA 1IBLF 4WXWA 1DY3A 2OUGA 2IA6A 1NJWA 3G82A 3VQBA 3Q8UA 3KHLA 1B92A 1J5EJ 1B64A 1MWMA 5GAGU 2ZJPL 5F3TA 4KAZA 1TP7A 3O3HA 4Z4FA 2XLJA 2ASMA 4X64F 3R5AA 4TU8A 3PW0A 2RRAA 4K59A 3TEGA 3AA9A 2GHPA 1TL5A 1OVQA 2G8WA 1OH6A 1KQGB 5BPLA 3PM9A 3VCDA 2WTFA 1L3UA 2BQ3A 4B3RJ 1SQFA 4JD2B 4BVOA 4ECWA 2JC1A 3EVOA 1XTZA 4CQ1A 1S99A 5H1SV 5A2QU 4A8QA 1B0VA 3KOAA 2FSKA 2W9AA 2RSQA 4B02A 2R8JA 1TUGB 1VJQA 2BJ7A 4CEFA 3P45B 1B9DA 4KBIA 3JTNA 3DWLA 3OJSA 3BJYA 3U1MA 2GHWA 4U9RA 4USWA 3J8AA 3OS0A 5B0FA 2AX1A 1DTQA 5FIIA 2O4IA 2O8DB 2MKIA 4DR1K 4FYVB 3K58A 3PJWA 3QRPA 2H5EA 4ED4A 2CIMA 3HMJG 3LM9A 4CERA 2WOMA 4WYLA 4CZIA 4DTXA 3DLKB 1BHLA 1OJ4A 2B4VA 4F4WA 1BCOA 2VD3A 3ZX3A 4ILMA 2UUAJ 3PHEA 4NXMK 2P5VA 4ZPDA 2C3YA 1VC6A 4ETXA 3EPGA 2XHWA 2YXLA 2BXJA 3B4MA 3G9CA 4CHQA 2MMYA 3HFVA 3DXKB 3FSIA 3OFFA 3H1QA 4USTA 2AKWB 2DNOA 3SSSA 3QGHA 1LV5A 4PKDB 4K42A 2HHHJ 2AMCB 2IOCA 5M1OA 5J2NA 3HZGA 4EUVA 1VQ8N 3LWMA 3DOMB 2CYYA 4DZDA 3G6ES 1FJEB 4CGDA 4KH0B 3R6GB 3T1AA 2KFYA 5AQUA 4OYAA 1IBKJ 3A0IX 5C25B 2C2NA 3BSOA 3I55S 5E2QA 1J5OB 5DDRC 4ZPVR 4CJLA 2HSEB 1SJRA 3WXIA 2ZZTA 1NSQA 3DKDA 1EWRA 3NFAA 2DFHA 2VJUA 4JI6F 5AZJB 3THYA 3AVIA 3BV8A 5AE2A 3FBEA 1RT6A 5CH7B 4C0HA 4FBTA 5BYSA 4A4JA 2IVMA 5A8WA 1U1NA 5AT1B 5BYQA 4DV6K 3HFZB 3TTFA 4H4MB 3GV5B 5DK5A 1U6FA 2ALZA 3MM9A 5AQTA 4BC7A 4CJKA 2GWKA 2Z0GA 1HBOA 3EMTA 1IBKF 3MZIA 2YH0A 1NEEA 3DGVA 4RL1A 3ICLA 5JS1A 1OO0B 3MMCB 3RU0A 4CD1A 5IC4B 4GO5X 2KO1A 1JLAA 1FXXA 3NY0A 4CGHA 3M1VA 1KFDA 4DPYA 5EHHA 3FC9A 3LGHA 2EBGA 3I55N 5DM6Q 1N34F 4ES1A 3FMWA 5A2QO 2ZE2B 2FVRA 1WHVA 2XEXA 4UOFA 4DI6A 4M3UA 1X3MA 3HP9A 1QZ6A 2RH3A 1TL3A 1YT3A 2O66A 4N8OA 2V5HG 1I94F 4JI2J 5L1JA 5HN0A 2MZ1A 4JHDA 2ZJPQ 5BRDA 3ZZTA 1RISA 3P96A 4CLFA 1WSFA 1GK8A 3QJLA 5KG4A 2MQOA 4H4OA 4RW9B 5KFLA 1KDNA 1LWEA 3HHLB 3HVAA 2YNIB 2XMVA 1SJFA 5AR0A 3DRPA 4PG6A 1F9EB 3ID8A 4LRAA 5EU7A 2RHSB 1QUPA 3MFHA 3RRGA 1DZ5A 2I7PA 1S1UB 1VQNS 4AM6A 5IS2A 1VHFA 2ZHBA 2OCEA 4DR2K 3OD2A 2OZSA 1T3OA 3NGZA 1GX6A 3V9SA 4IH5A 4O4RA 4ZJLA 4I2QB 1BQXA 1ZM2A 4YDUC 2OPSB 4BRPA 1KQSR 1U2RA 3R1LA 3E66A 1VBZA 4CD3A 4Y34A 1EQ0A 4TY8A 3BPSP 2Q0RA 5F9LA 1DTTB 2F4VJ 1KVCA 4DCPB 2RHQB 3CIMA 3AD8C 2P9PA 4EHUA 3J7ZO 3K2PA 2HAFA 2NXCA 3TI0A 5C42A 3MM7B 2DY9A 3VQSA 4B3OB 1IQZA 1X9MA 3R2DJ 3LH2S 2BKOA 3GJRB 4GKKK 1VQNN 3R9LA 3T6JA 1D09B 2DHXA 4OYOA 5KTQA 1JJ2M 4JI3K 4AM7A 4YR0A 3IC1A 4BY9C 3K0SA 3WXMB 3JB9k 1V4SA 3FGVA 3ITHA 4GVBA 5I3QA 4JLHA 5C24A 4QPXA 1PSDA 2I38A 4X66J 2C2RA 4IRKA 3L7UA 1RT1B 2UUBK 1T03B 1XIQA 4LF9J 3MM6B 4IR9A 2IRUA 1XMOF 2YNHA 2CG8A 3AVFA 1H7WA 4Y1DA 1XMQK 4OI1A 3LM2A 4F04B 2VDIA 1BA1A 2KT2A 2ZH9A 5DS7A 2BR0A 1JX4A 4F25A 3Q8YA 5CHIA 1K73O 4IG0B 4A5AA 3ETMA 1NLVA 4CZEA 4KB7A 1HI1A 4G1QB 4JKFA 1KQKA 1LWFA 1KVJA 2YX1A 3KK1B 4DUYK 4DV3J 1BG3A 3QPIA 1HNWK 4KKOA 2OPRB 4AL7A 3HCXA 2DGXA 4ALZA 1Q8LA 1RDBA 2Q3PA 3W8PA 5JJBA 4LF9F 3T41A 3SBGA 4YOEA 1U1OA 1CQNA 2DNRA 4NLBA 2WRMA 2DCUB 2ASPA 1VBYA 1X5TA 4CFCA 4B9LA 4OLOA 5BR8K 3UKUA 1OIAA 2QRRA 3CCSS 3BN4A 4JI1F 1YZ6A 2O3DA 3QLHB 4ZVSB 4CBUA 3L7OA 4IFYA 1RACB 1YXQA 5JVGL 1K1SA 2E9ZA