2FSNA

Crystal structure of ta0583, an archaeal actin homolog, complex with adp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
325
structure length
310
Chain Sequence
MVVVGLDVGYGDTKVIGVDGKRIIFPSRWAVTIPVLSTDGGQTKFIYGKYASGNNIRVPQGDGRLASKEAFPLIAAALWESGIHVDLVIGSGTPLGTFDLEVKAAKEALENKVLTVTGPEGEVRQFNITRLIMRPQGVGAALYLLNQGIIEQQPGYGVVIDVGSRTTDVLTINLMDMEPVVELSFSLQIGVGDAISALSRKIAKETGFVVPFDLAQEALSHPVMFRQKQVGGPEVSGPILEDLANRIIENIRLNLRGEVDRVTSLIPVGGGSNLIGDRFEEIAPGTLVKIKPEDLQFANALGYRDAAERS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an archaeal actin homolog
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Structural protein
molecule keywords hypothetical protein Ta0583
total genus 71
structure length 310
sequence length 325
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17989 ALP_N Actin like proteins N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2fsnA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2fsnA01
3CJ1A 3VETA 3H45C 4H0YB 4YDUA 1Y64A 3BP8A 3GE1A 4BC3A 4FPBA 4AM7A 2QWPA 5BRHA 1QQMA 2YHWA 3EKUA 2QWOA 1NGHA 3AY9A 4BR7A 4BR2A 3A5MC 3VGMA 3VPZA 3GBTA 3HTVA 1SZ2A 2GUPA 4CZMA 2Q97A 3SLCA 5AQXA 3SMPA 5AQLA 5KQ8A 3DJCA 1NGGA 3SMSA 3UKRB 3WQTA 4ISGA 4H0OA 1X9JA 3FR0A 4XEIA 1SQKA 4NB4A 1NGJA 3FZFA 3ZEUA 2FF6A 1NGEA 1V4TA 3R9PA 3GDQA 1TUUA 5FPNA 1BDGA 1WUAA 4Y0WA 3ZETA 4CZHA 4EAHD 2YHYA 2A40A 3AAQA 1ATRA 1NBWA 1JCGA 4IO8A 4CD1A 2E8AA 2UYTA 4ISEA 2ITMA 3B8AX 1IG8A 2I7NA 4HWIA 4BRIA 1MA9B 2FXUA 3KVGA 3WXKA 4A2BA 4K43A 2IVOA 4NO7A 5LJWA 3RSEA 5AZJA 3CJ7A 4H0VB 4JAXA 4BR0A 3VEWA 3ZX0A 4J8FA 3VF4A 5BN8A 3OHRA 2PAVA 2YI1A 4EIAA 3DXKA 1OKJA 1T6DA 3H1VX 3QBXA 1S3XA 3BF3A 1RFQA 1ZBSA 5AQIA 1C0GA 3M1FA 3GOIA 3WEEB 3MN9A 2P9LA 3BF1A 3QMLA 1U2VA 2A42A 1Z6RA 4XH5A 2GWKA 1GLBG 2P9PB 2HOEA 4FWQA 2P9SA 4BRLA 3WEEA 2F9WA 1NGDA 5AFUH 5AQRA 3DXMB 5I9EB 2BUPA 5EXWA 4B9QA 3I33A 3JXUA 1NGCA 3HSCA 3CJAA 3UKUB 4BC4A 4FPAA 4KBOA 4K42A 4IXCA 4H5TA 1BWFO 5AQTA 2Q0UA 5FPMA 4B1ZA 5BR9A 1U6ZA 3VENA 2Q1NA 5ELZA 3CETA 4QS7A 2P9UA 2W41A 3WXJA 5AQHA 5JLFA 4BR5A 2YJEA 1XUPO 2DPNA 2KHOA 2A41A 2J4RA 5EOYA 2HF4A 4FWKA 3ENOA 2D1KA 4YDUC 3S41A 3WT0A 3WXIA 1DEJA 2VCPA 3VEVA 1HJOA 2E2OA 4B1YB 1BUPA 1HKBA 3GG4A 3MN5A 3O80A 2E1YA 4XH1A 4FWPA 3H46O 4H5NA 4MO5A 3U8XA 4JHDB 1J6ZA 4M7XA 3LDNA 3CERA 4B1WB 5BRDA 2H3GX 3WUHA 5AZIB 2E1ZA 5AQPA 2VWBA 3ZEUB 4K25A 5AQKA 4BREA 4FWLA 5JMVA 5AQGA 2NZTA 1Z05A 3ENHA 3O08A 1V4SA 1XC3A 4BRHA 5AQZA 3R8EA 2CH6A 3U9ZA 2A5XA 1GLAG 2ZWHA 4C23A 1LCUA 3P4IA 3AARA 4BR9A 3LL3A 1S22A 3MDQA 3HBTA 1LOTB 3DWLA 1E4FT 4A2AA 3LM9A 4IJAA 2I7PA 3FZMA 1ESVA 5FPDA 4WQ4A 2A6AA 3QB0A 4JD2B 4BRAA 4CJ7A 2ZGYA 4O8KA 3QBWA 4IZ9A 5CE3A 4BRKA 4A62A 1G99A 4BVPA 2GELA 3ATUA 3HI0A 1H1VA 3H3OB 3I8BA 5EVZA 5JLHA 2IVNA 3SJHA 3CJCA 3BUZB 2F9TA 1IJJA 3ULEB 1NGIA 2AP1A 4GNIA 3UB5A 1GLFO 3ULEA 3D2EB 3ZETB 1ATNA 2CH5A 5KQDA 1ZC6A 2D0OA 3L4IA 4H0XB 5AR0A 5EX5A 5AQFA 2QWLA 3D2EA 4BQZA 4BGBA 5FPEA 2FSKA 3M3ZA 4QS8A 2QWNA 1BA1A 5AQYA 2QWMA 1QHAA 3EL2A 3C7NA 3A5OC 1K8KA 4QS9A 4CZFA 2D4WA 2FSNA 1MWKA 1TYQB 3A8YA 5AZIA 3RSEB 4BRFA 3EN9A 3VF6A 4MO4A 5ADXH 3IMXA 3VESA 5BPMA 1YXQA 1DGKN 3DXKB 1YUWA 2GTDA 1NGBA 2E2NA 1BU6O 1NM1A 4PKGA 1YAGA 2P9KA 4BRCA 4CD3A 1BOTO 2Q31A 4BRGA 1RGIA 4CZJA 5E84A 3JS6A 1CZAN 4M7YA 1TYQA 1T44A 1QQOA 3VEOA 4MLEA 3KZBA 4LC9B 1K8KB 4PKHA 4CZEA 2CGKA 2V51B 4BROA 1GLCG 3VEZA 1QZ6A 1Q18A 5AQJA 5BRFA 3FLCO 5AZJB 1RDWX 3EO3A 2V7YA 4FO0A 4JN4A 4MLHA 3ZX3A 1P8ZA 3CHWA 4CZGA 2FF3B 4CZKA 4O5FA 5AQWA 3A0IX 5JICA 2NLXA 1QQNA 3VGLA 1KXPA 3EKSA 4BGAA 1HUXA 4H5VA 2GEMA 4JHDA 5BPLA 3VERA 3L6QA 2P9LB 2BTFA 4H5RA 2P9NA 2A3ZA 4DQ8A 4CBUA 4WQ4C 3VGKA 2YHXA 2D0PA 3DXMA 1BG3A 1HPMA 3EZWA 2AA4A 2QW9A 3O5BA 3CQYA 4RCHA 2NRHA 3O1WA 5AQSA 1NWKA 4FWMA 2E2PA 3FZLA 2OANA 3D2FB 3H6EA 4F9OA 1U2VB 3MN6A 4I6MB 2ASOA 2WUSA 3VEYA 3ZX2A 2YCHA 3CIPA 4ISFA 4K41A 3R6MA 5LJVA 2Q2RA 3O1BA 4CZIA 3CI5A 1GLLO 5TKYA 2FLOA 1HKCA 4WYBA 2Q36A 3MMVA 2E88A 1GLDG 2QXLA 3QFPA 4BRNA 3LM2A 3H3NO 3UE5A 4PKIA 4B1XB 3LDQA 5AQMA 1XQSC 4FL9A 4Z94A 1D4XA 1GLJO 2ZF5O 5BN9A 3BEXA 5F0XA 3W3DA 3O4WA 4BVOA 2ASPA 4A61A 4FWRA 3L0QA 4BG8A 3HZ6A 5LY3A 1BA0A 1HKGA 3ATVA 3VOVA 3CQXA 3CJBA 5KPRA 4EHUA 5AQQA 2W40A 4DCHA 2P9NB 3F9MA 3A5LC 4CBWA 5KPTA 4H0TB 3MK6A 2V7ZA 4H03B 3SK3A 3WQUA 5E26A 4BQLA 3UKRA 1ZXOA 3MCPA 2CGJA 4FWOA 3CJ9A 3FZKA 3KHYA 4RTFD 3TPQA 5B8HA 3J8AA 3DAWA 4CBXA 3IFRA 4M63C 4BC2A 1JCFA 5AFUA 4WQ5C 3GL1A 2FSJA 3FE1A 3D7EO 1HLUA 1YVNA 1T6CA 2VYPA 3O8MA 3FZHA 4JNEA 5EY4A 4FWNA 4RWTA 4WQ5A 4I6MA 4BRQA 2EWSA 4PL7A 3FGUA 3LDOA 3QDKA 4H0PA 1TUYA 4CI6A 3C7NB 5KPZA 4IJNA 1NMDA 3FFKB 2HMPA 1QZ5A 3A5NC 3HM8A 1WOQA 2ASMA 5AQUA 5ADXA 1X3MA 1KAYA 3MN7A 1GLEG 4BR4A 2CGLA 3M6GA 4BG9A 4BRDA 3QICA 1KAZA 1MWMA 4CZLA 5BPNA 4PL8A 2P9UB 1DKGD 4FOEA 3G25A 5F1XA 1ATSA 4BRMA 4FOIA 2P9IB 1HX1A 4HTLA 2P9IA 4E1JA 4EFHA 2PBDA 4FWSA 3O6WA 5BREA 3LDPA 4FSVA 4BRPA 3U4LA 4EHTA 1NGAA 3LDLA 2QWQA 4GY2B 3ID8A 3IDHA 2IIRA 2Q0RA 1X3NA 2QM1A 3H1QA 3IUCA 5AQNA 4H5WA 4B1UB 3UKUA 4IWVA 1MDUB 3AAPA 2GWJA 2HF3A 3VF2A 3WXLA 1NLVA 4B1VA 1JCEA 2IVPA 2P9SB 4BC5A 4DHYA 2QWRA 1R59O 2P9PA 3QFUA 2P9KB 3C0BA 3TU5A 5AQOA 4JD2A 2E2QA 2E20A 4L3QA 1NGFA 3W0LA 3D2FA 2ZGZA 1C0FA 3U9DA 4DB3A 4AM6A 1SAZA 1BO5O 2YJFA 3VEXA 1E4GT 5F2RA 4XH4A 5AQVA 1KAXA 1EQYA 2V52B
chains in the Genus database with same CATH superfamily
3CJ1A 4YDUA 3D0PA 2DY4A 4KV8A 3KK7A 4AM7A 3HOTA 1IO2A 3VQPA 2YHWA 4CJ5A 4L8RB 1U04A 4F3OA 1HNZK 3NVKA 1W97L 3VGMA 4NCBA 4CZMA 4KHUA 1KFSA 5AQLA 2AJQA 3WQTA 1VQPN 4CIFA 3OBYA 1N8RO 2PY5A 3FR0A 1WSEA 3KLFA 4OPAA 1NGJA 1NK4A 2FF6A 4M3ZA 4JK9A 4CF0A 3SAFA 3DLRA 3GDQA 2OYQA 3ALYA 1TUUA 5FPNA 4CFCA 2G8WA 1NOYA 4ZTFA 4FM1A 3PX6A 3VA3A 4JI0K 1LWCA 4JKBA 4CJRA 4CD1A 3HM9A 4M45A 3AGRA 3EY1A 4E19A 1L3SA 4J2DA 2XY7A 1X9SA 3WXKA 1RBSA 4A2BA 2IVOA 3RSEA 3OYIA 1N5YA 4DR3K 4YOVA 1NG9A 3KTQA 4BR0A 2NRRA 4DUZK 3SQ4A 3OHRA 4CFAA 4LF4K 4JEPA 1OKJA 1T6DA 4NCGA 1C1AA 1S3XA 1C0GA 4LF8K 1S9GA 3CCRN 3BF1A 1U2VA 4XH5A 1Z6RA 2GWKA 2O8FA 1REVA 4FWQA 4YOTA 2VQFK 1W7AA 4EP4A 3QNOA 1RT1A 1RCHA 4W5QA 2BUPA 4O55A 3CCVN 2EHGA 1JXBA 3J80O 3CJAA 3UKUB 4C8NA 3SQ1A 1BHLA 3QETA 1NOZA 2JLEA 2WONA 4K42A 4CIEA 5AQTA 4B1ZA 2Q0UA 4WCEL 1QSLA 1NK5A 2NRVA 4N41A 5ELZA 1EETA 3ZT4A 3OTOK 4KB0A 1QTMA 2E5LK 2HF4A 3ENOA 2D1KA 3WT0A 4DV4K 4F8RA 1DEJA 3VEVA 2IGIA 4BWMA 2YKMA 1HKBA 1NK7A 3O4QA 4JKGA 4FWPA 5J2PA 3SI6A 1UA0A 2Y1JA 5FROA 4JHDB 1J6ZA 2GX9A 3LDNA 4B1WB 3HOSA 3V9UA 4FK4A 3P31A 2D0BA 5FDLA 1Z05A 3ENHA 4JRPA 1XC3A 3L2RA 4DUYK 3BY5A 3AA4A 4KTQA 2A5XA 4CJVA 3THXB 1EP4A 3MDQA 5CZ2A 4CF2A 1LOTB 3LM9A 1YTUA 4IJAA 1K8AO 2I7PA 4E0DA 4JKCA 4JD2B 5SWMA 2ZGYA 2UXCK 2I5JA 3T3FA 2ITGA 3QBWA 1NMNA 1TKDA 3LANA 3OYHA 1C0MA 3QEPA 1G99A 3SAHA 2DFEA 3HI0A 3IS9A 3TAFA 5M1OA 3H3OB 1OH6A 3VN5A 3CJCA 3BUZB 3V9WA 4JK7A 4K0KK 3UB5A 1GLFO 3NBPA 5HL7L 3D2EB 3TTFA 4X66K 5KQDA 3QLHA 4H0XB 1WB9A 5KTQA 2QWLA 3O4NA 2F8SA 4HUGA 4IEIA 4BQZA 3Q7CA 4CGJA 3C65A 1BA1A 4ELVA 2P5GA 4XIUA 3EL2A 3I0RA 3MXMA 4YFUA 3DLHA 1HNWK 5HOOA 2FSNA 1MWKA 4C8LA 3RWUA 3RSEB 1LW2A 3VF6A 4BRFA 1SL2A 4MO4A 3LZJA 1WAFA 5ADXH 1A5VA 3IMXA 3VESA 2PYJA 1YXQA 1NGBA 1BU6O 2JWKA 1JLBA 3CCQN 2Z1HA 3R1XA 4PKGA 3O3HA 3SBTA 1LW0A 3OVNA 2NUBA 1JLQA 1S9EA 1HNXK 3OJSA 4CERA 4DTJA 1VQ9N 1BOTO 1WSJA 3OYGA 1X9MA 4KHWA 1RGIA 2A1SA 4EP5A 4WFAL 3PSIA 3OYKA 3RVCA 1TYQA 1T44A 1QQOA 1ASWA 5M1KA 5GAHP 4MLEA 4Q0BA 4PKHA 2HHHK 2CGKA 2V51B 4BROA 3KLIA 1GLCG 4QOZB 5AQJA 3K5MA 4ILGB 4DV7K 3ZSWA 4CF8A 3NDKA 3KWGA 1P8ZA 4CZGA 4MQ3A 4CZKA 4AH9A 4I9LA 3A0IX 3DRPA 1Q9YA 5JICA 3U3GA 1QQNA 3VGLA 1LAVA 4DF4A 4BGAA 3B6OA 3HO1A 4H5VA 5KI6A 4JHDA 3KD5E 1Z25A 5CZ1A 5AJ3K 4OKEA 2Y1IA 5C24A 4DQ8A 4NYNA 4WQ4C 3SQ0A 2YHXA 1JLCA 4ID5A 5FLXO 3NAEA 4CJ4A 3DXMA 1NKEA 3EZWA 2QW9A 2OTLN 1RTIA 2IDOA 4J2EA 2NRHA 1BI4B 3OYAA 5AQSA 1NWKA 1IKXA 4AHVA 3D45A 1YJ9N 4FK0A 4B9TA 1NJIO 3EZ5A 3D2FB 3C95A 1U2VB 3TAGA 4I6MB 2ASOA 2WUSA 4LF7K 2QKBA 3DLKA 3ZYYX 1RBRA 5TKYA 4LSLA 3L8BA 4CHYA 3PIPL 2QXLA 3V1QA 2GV9A 3LM2A 3QEIA 2ZQBA 4B1XB 1XQSC 4CEZA 1IBKK 1D4XA 3OYNA 5H1SQ 1GLJO 1XI1A 5K14A 3PO5A 3W3DA 3NF8A 4BE1A 1T03A 2XY6A 1HKGA 3VOVA 3CJBA 3PLAA 1CZ9A 4EHUA 4JKGB 3KD1E 4DTOA 3A5LC 5D3GA 4F2SA 4DMNA 5KPTA 4H0TB 3MK6A 4H03B 1OVQA 4H8KA 3OBWA 5E26A 2E6MA 3TAMA 2O8BB 1ZXOA 4O8UA 3TPQA 3CPWM 3THWB 2HHSA 3TTCA 3J8AA 4M63C 4FJIA 2HVIA 4IFVA 4KI6A 5AFUA 3GL1A 4UQGA 4FLTA 4DSLA 1YVNA 1VQON 4RWTA 3FZHA 4CJ3A 3PO4A 3KLHA 3VQCA 3K9JA 5GIPA 4H0PA 1TUYA 1EKEA 3SUPA 3C7NB 4IJNA 4O44A 4FZYA 3FFKB 3A5NC 1NK8A 3VQEA 1WOQA 1FJGK 5HLFA 3OA9A 3OYFA 3T1HK 4DQSA 2FBYA 4OPHA 3MEEA 4BG9A 3K0SA 1MWMA 4CZLA 3G10A 4DFKA 5F1XA 3VQ5A 1ATSA 4DFPA 3K5OA 4X62K 3O6WA 2WFBA 4BRPA 3NMUA 1NGAA 2QWQA 3N4PA 3LWLA 2IIRA 2WOMA 1NNEA 3OS0A 4BE0A 4IDKA 4JKDA 5HRPA 3HPOA 1TL3A 1NLVA 1JCEA 4LFAK 3NF9A 3PY8A 2QWRA 2R7YA 2P9PA 4ILJA 3WNHA 3QIOA 3NGZA 1NK6A 3TU5A 3T69A 4TSXA 1HJRA 4L3QA 4FJ7A 3D2FA 1C0FA 3U9DA 1SAZA 1BO5O 2YJFA 1YITN 1S1VA 4B3TK 1E4GT 4GV9A 3H45C 4JRQA 1NK0A 4H0YB 3CQ8A 1Y64A 3BP8A 2ZE2A 1VSDA 3NH2A 2QWPA 1T8EA 4DQIA 2G8KA 2NNWA 1LWFA 3AVLA 1GOAA 2VG5A 3I8DA 3V9XA 3AY9A 3DYAA 1KQSM 1TK0A 3VPZA 4GVMA 4DV6K 1UWBA 2BDPA 2Q97A 3SLCA 3SMPA 3UIQA 4AHRA 1YI2N 5LMUK 3SMSA 3E9LA 3IRXA 4H0OA 4NB4A 4JLHA 1CLQA 3LP0A 1BIUA 2OTJN 1NGEA 1GOBA 2O8CB 1BDGA 3V6DA 1WUAA 4B8AB 1A5WA 2YHYA 4DLEA 1S1XA 5C12A 4BE2A 3VQBA 1JCGA 2XY8A 5E41A 3BZKA 2E8AA 4OPKA 2UYTA 4CGIA 5A2QO 5IT9O 4BRIA 4G1QA 4CGDA 4DR4K 4CEOA 4K43A 1S1UA 1BQNA 1JL2A 1VQKN 3OYDA 4CJPA 1WSFA 1FXXA 3DOLA 4JAXA 4AILC 4J8FA 5BN8A 4B3OA 2O8DB 1B9FA 4EIAA 3H1VX 2O4GA 3QIPA 1QS4A 4DR6K 4DR1K 2KQ2A 3M1FA 3GOIA 3WEEB 2P9LA 1J53A 2HOEA 4NCAA 3ZLJA 5AFUH 1U47A 3L2QA 3J7ZO 5I42A 3HK2A 3S3NA 3LWMA 1NGCA 1CXQA 3HSCA 4CGGA 4KBOA 2P5OA 2HHUA 4KHQA 4OKJA 5KGXA 2O8CA 2HNYA 3SQ2A 4YHHK 1BWFO 5BR9A 2OA8A 1VSHA 3MECA 1S6QA 1YVUA 4I7FA 4QS7A 2HVHA 1C1BA 4FK2A 4BR5A 2DPNA 2KHOA 1SV5A 3WNGA 3CMEN 3WXIA 3AA3A 4E7LA 2F8TA 2ZM6K 1HNIA 5M1PA 2FBVA 3MN5A 3O80A 4F3TA 4ELTA 5LMNK 3PSFA 4H5NA 3TSQA 1D9FA 4M7XA 4CEAA 3PIOL 1N36K 4KTWA 3SPYA 3ZEUB 5AQKA 4FWLA 3LAMA 3ZT0A 3CXCM 4OJRA 3SUQA 1V4SA 2HBKA 4B08A 5M1FA 1HPZA 1UAXA 3P5JA 5AQZA 1ASUA 3C94A 1GLAG 4IG0A 3C6HA 1TVRA 1CZBA 1QSSA 3SV3A 1LAWA 4BR9A 3HBTA 3AVAA 4PHTX 2DFHA 1E4FT 3AGKA 4RW8A 5CYMA 3FZMA 2NRWA 3QB0A 4CJ7A 2G8HA 4O8KA 3K5LA 1O13A 4CJFA 3THVA 4BVPA 4FJGA 4BDPA 1HMVA 4AHTA 4M3YA 1L5UA 2B5JA 5JLHA 3SJHA 2XY5A 2W42A 4GNIA 3DRSA 3F9KA 1ZC6A 2D0OA 4E7IA 4Z4EA 1JLFA 4IO9L 5AQFA 4RW6A 5M1QA 3OYCA 4ZTJA 1WSHA 5FPEA 2FSKA 5MLCQ 1EWRA 3AVIA 3ZSQA 1WN7A 3TTDA 1ZBFA 3RTVA 2E4LA 3OS1A 4FJHA 4FJJA 1K6YA 1K8KA 3DI6A 2D4WA 3DLLL 3C6UA 1TYQB 5AZIA 4B3RK 1DTQA 3DXKB 1YT3A 1YUWA 1VSKA 4GKJK 4RW9A 4CHNA 4GMJB 4Y1CA 1VSEA 4BRCA 1Q82O 3TSPA 5JVHL 2OCEA 3I56N 4BRGA 4LD0A 3MX2A 4GW6A 5HRRA 1CZAN 3K58A 1EWQA 4DV1K 3KZBA 4LC9B 4CZEA 5DM6L 4Z4FA 1IH7A 3VEZA 1S6PA 1Q18A 3DMJA 4CK3A 3FLCO 1RDWX 4MLHA 1WBBA 1NK9A 4DS5A 3E01A 2G8FA 3R3LA 4LF5K 4O4GA 1VAZA 3V81A 1JJ2M 3DLGA 4KKOA 3CFOA 1HUXA 2GEMA 5BPLA 4Z4HA 4H5RA 4U7BA 2HW3A 2A3ZA 3CG7A 3ZCMA 1U49A 4KPYA 3AVMA 2HBJA 4JS5A 3O3GA 3N4QA 1YIJN 3O5BA 4N56A 1SKSA 3L2WA 3FZLA 3H6EA 3HXMA 4F9OA 5GINA 2NRZA 1NJWA 3MN6A 2PZSA 3ZX2A 4ISFA 3PX0A 3R6MA 1VQ5N 1DT9A 4ELUA 4BWJA 1HYZA 2BE2A 4B9NA 2FLOA 3IKMA 1WAJA 4W5OA 4OKKA 1HKCA 2F4VK 2BGGA 3L2UA 2E88A 4OX9K 1ZBUA 4BY9C 3H3NO 2YKNA 4DSKA 4C1NK 2XHBA 3BEXA 5F0XA 4BVOA 2ASPA 4FWRA 5KGWA 1N34K 4R5PA 1N6QA 2HBLA 1Q86O 3NH1A 3THYB 1Z26A 2W40A 3ISNC 2D0CA 3O9SA 3U3YA 2V7ZA 1Q7YO 4KB1A 3WQUA 3TABA 3Q7BA 3TAPA 3D6RA 1OH7A 1S5JA 3MCPA 5HROA 4FWOA 3KHYA 4YOYA 1I94K 1ASVA 1TKXA 1YJNN 5B8HA 4CBXA 1T3VA 3IFRA 3LP1A 1VQ6N 4DSEA 3FE1A 4FYDA 1HLUA 4DFJA 4JNEA 2VYPA 4PQUA 4CF1A 2O8EB 3KKRA 4WQ5A 3QESA 4A5AA 4BRQA 1IKVA 3NF6A 4MFBA 3KK2A 3OYMA 4LFBK 4CHZA 4CK1A 3OW2M 1NMDA 2RKIA 3J81O 1QZ5A 3HM8A 2UXBK 4DV3K 1VQ4N 4Z4GA 1X3MA 3MN7A 1GLEG 3ZSXA 2CGLA 4ILHA 4BRDA 3G6EN 4FLXA 5BPNA 1BI4A 1ILYA 4F4KA 1DKGD 4X64K 3PUFA 5LL6Z 3DRRA 2OPRA 5C10A 3AVHA 1DLOA 4GKKK 4YNQA 4BRMA 4CJEA 4CJKA 4FLYA 2PBDA 1VSLA 1RNHA 3LDPA 3SAGA 4FSVA 2OPSA 4EHTA 1HQEA 4CJTA 4GY2B 3ID8A 4DTXA 1VQLN 3VMFB 2Q0RA 1BCOA 4FJ8A 4CJSA 2IS3A 3IUCA 5AQNA 5CHIA 1EO1A 2RHKA 3BDPA 1MDUB 2HF3A 4JKHA 3VF2A 2HMIA 2IVPA 4DG1A 3S3OA 2HHWA 1NKBA 4J2AA 4DV2K 4ICLA 1QVFM 4DHYA 4CFDA 3CCLN 3C0BA 5AQOA 2E20A 3CCMN 2VWKA 3T1YK 4AM6A 1XMQK 4DF8A 1VHXA 4LY7A 3GE1A 4NLBA 2EX3A 4LH4A 1KFDA 5BRHA 5DK5A 1QQMA 2Z1IA 2YNGA 3JSMA 4CJWA 1NKCA 4JK8A 3TAEA 1NJZA 4CJUA 1W9HA 3GBTA 2GUPA 5AQXA 1HRHA 3DLEA 2G8UA 3OYLA 3DJCA 4FVMA 1NGGA 2VG7A 4ISGA 4R79A 1SQKA 4KHYA 4FJXA 3ZEUA 1XWLA 1QVGM 4DSIA 3AVGA 4M3XA 4GV6A 4FM0A 1V4TA 4DR5K 3R9PA 4CEFA 1RILA 3NCIA 3VQQA 1ZBLA 4Y0WA 3ZETA 4W5TA 1P90A 4CJQA 3T7ZA 3E66A 2XO7A 3K57A 3AAQA 3QERA 1Q9XA 2HHTA 1NBWA 4KFBA 4IO8A 3EE9A 1L3VA 2KKZA 2DFFA 3ASMA 4I2PA 2YHAA 3P38A 2ITMA 2I7NA 3ULDA 5J2QA 1E3MA 3CC4N 3EEQA 2HNZA 4EZ9A 5AZJA 4KH5A 4H0VB 3VEWA 4BACA 4LF6K 1C6VA 2W6KA 2YI1A 1KLMA 3HT3A 3LDSA 1XHXA 1RFQA 2Q3SA 3LP3A 5AQIA 4DR2K 3EYZA 4FJNA 4N47A 3QMLA 4AHCA 2P9PB 4BDZA 3CC2N 4BRLA 2F9WA 5AQRA 4CW7B 3P83D 4B8CA 4DSJA 5EXWA 4B9QA 4B9MA 3SZ2A 3JXUA 1IBMK 1SS6A 4FPAA 4BC4A 3V4IA 3SCXA 4DS4A 2YNFA 1KLNA 4IXCA 4H5TA 5FPMA 1Q8IA 2FC0A 4M3TA 3MCAB 1U6ZA 3VENA 1BIZA 2P9UA 3WXJA 3RMAA 5AQHA 2NRTA 3CMAN 3OS2A 2YJEA 4CE9A 1XUPO 2A41A 4O5BA 2J4RA 3SUNA 1X9WA 4FWKA 4YDUC 3S41A 3OJUA 3KK3A 2E2OA 1BUPA 2VQEK 1VRTA 2ZD1A 2E1YA 1C1CA 5C25A 2JGUA 3H46O 1KD1O 4KHPK 3CERA 4ID1A 1D9DA 2H3GX 1KVBA 3E9OA 3WUHA 4B9SA 2E1ZA 4K25A 4E1MA 4E7JA 3O08A 3ITHA 1RTJA 4O0JA 1G15A 1TL1A 4BRHA 3JYTA 3G71N 3V9ZA 3R8EA 2G8VA 3NH0A 2NRXA 2ZWHA 1LCUA 3SUOA 4M41A 3LL3A 1S22A 3SPZA 2B4JA 3AA2A 3DOKA 1ESVA 5FPDA 4WQ4A 2A6AA 5GAGP 4BRAA 2KW4A 4IDHA 3ID6A 3P39A 1SL1A 1N33K 4IZ9A 4OGCA 1SKWA 4JV5K 2FBXA 3O9RA 4BRKA 1X1PA 2GELA 1J9AA 3OY9A 3I8BA 3DLBA 3CCJN 4F2RA 1IJJA 2WTUA 3ULEB 1NGIA 2AP1A 3P1GA 3ULEA 1OVYA 3ZETB 1ATNA 2CH5A 1RDUA 4YOXA 5HP1A 3L4IA 1UOCA 3D2EA 4BGBA 4CECA 4DTSA 1RDBA 3M3ZA 4QS8A 5AQYA 1FK9A 1QHAA 5CR4A 3VQ8A 1CXUA 3HP9A 1YJWN 4DTPA 3A5OC 4QS9A 3NGYA 5CYQA 3A8YA 4YY3K 3NE6A 3QEVA 3VA0A 1RT5A 4QCLA 1FKPA 3AO3A 5BPMA 4JKAA 1DGKN 1VSIA 1HYSA 2HHXA 1RDDA 4KHNA 1W0HA 3C6AA 3QEWA 3THXA 1R0AA 4CD3A 1XC9A 2YV0X 4KI4A 5E84A 3JS6A 3SJJA 1B9DA 3AO1A 3BGRA 1OH5A 3BZCA 1K8KB 4JI1K 3M8SA 2RF2A 2Z1GA 4LSNA 4JI7K 3CYMA 5BRFA 4DU4A 3TI0A 3L2VA 3F73A 2HB5A 3EO3A 4FO0A 4OLAA 3ZX3A 1XMOK 2FF3B 2WBNA 5JS2A 3SV4A 4O5FA 1IKWA 3QNNA 5AQWA 2NLXA 4Q5VA 1Q81O 2Z1JA 3CCUN 1KXPA 4LH5A 4IFYA 4FJKA 4LF9K 2P9LB 4KHSA 2BTFA 1NU0A 1B92A 2X6NA 1J54A 3ZT2A 4CHOA 2AA4A 1JXEA 1KTQA 4RCHA 3O1WA 1JLEA 2E2PA 4O0IA 1WNSA 3OYJA 3NVMA 1RT6A 2X74A 5I3UA 1YTAA 1A5XA 1ITGA 3V1RA 1U4BA 4E1NA 3V1OA 1VSJA 1KRPA 3VEYA 4FJMA 1QQCA 3OYEA 4YORA 3RR7A 2F7TA 4DQQA 1L3UA 5LJVA 2Q2RA 1ZBIA 4CZIA 4I2QA 4FLVA 2FBTA 3TANA 3HPGA 2UXDK 1I39A 2Q36A 4WYBA 3MMVA 4M3WA 1SL0A 3QFPA 4RG8A 1WSGA 4AF1A 4FJLA 3LDQA 3CM6A 5AQMA 4FL9A 2ZJPL 3I0SA 3HPHA 4DU3A 5BN9A 2ZF5O 4DLGA 4BDYA 4CCHA 3VQ7A 3AV9A 3LPTA 2P51A 4A61A 3HZ6A 1BA0A 3VQ6A 1J5EK 3CQXA 3ZT3A 5GIOA 1JLAA 4DCHA 4FW2A 4CBWA 1K9MO 3ENBA 3AVCA 4KH6A 4BQLA 3UKRA 3QO9A 3L3VA 3RMDA 2CGJA 3LZIA 4RTFD 3FZKA 4FLZA 1TGOA 3TWHA 4IBNA 1FKOA 4BC2A 1JCFA 2IC3A 4WQ5C 2FSJA 1XNRK 3D7EO 2XRIA 4HVJA 4Z4IA 3CCSN 1T6CA 3O8MA 3HP6A 1XHZA 4HUEA 4FWNA 3AO4A 4I6MA 3HSTB 4CHQA 4PL7A 1TKTA 1YHQN 3FGUA 3LDOA 3OYBA 4CI6A 1RBTA 5KPZA 5BR8K 4IG3A 3AVFA 3G0ZA 4CHPA 3J7YP 4PWDA 1FW6A 2ASMA 3T1AA 2X78A 3WNFA 1LWEA 5ADXA 4CFBA 3KIOA 3E1YA 5J2MA 3V9SA 1L3TA 4FW1A 1TV6A 2P9UB 1SKRA 4FOEA 5GAEP 3ZSOA 3C6TA 1EXQA 3E9PA 4Z0UA 2P9IB 1HX1A 4HTLA 4HTUA 2P9IA 4M3UA 1RDCA 3H08A 4DTRA 5BREA 3MWTA 2HHQA 4A59A 3LDLA 3MWPA 4AHSA 4DQPA 4WE1A 4CESA 2ATQA 3QEXA 3IDHA 1VQ8N 2VGMA 2E6LA 1X3NA 2QM1A 1NJYA 3H1QA 3L4QA 4CVNE 4DFMA 2QTDA 1BL3A 3AAPA 1WSIA 1T7PA 5HRNA 4BC5A 1RT3A 3SYZA 2O8FB 4FLWA 3AO2A 4FZXC 4JD2A 2E2QA 2QKKA 1NGFA 2B6AA 3F5TA 4DV5K 4DB3A 3HVRA 2PYLA 5EU7A 3EE8A 5AQVA 3HJFA 2V52B 3VETA 4BC3A 1EX4A 3K5NA 4FPBA 5M1NA 2PFUA 4FJ9A 4DTMA 4K8ZA 3EKUA 5KRSA 2QWOA 1NGHA 4BR7A 3AVJA 4BR2A 3A5MC 4KTZA 3WXMB 2LSNA 3MXJA 3AO5A 2O8EA 3HTVA 3TARA 1S1TA 1SZ2A 3NF7A 1DTTA 4C8KA 5KQ8A 2OZMA 3UKRB 1X9JA 4XEIA 3KJVA 3FZFA 2A1RA 1T05A 3ZSYA 2QK9A 3AVBA 1ZYQA 3K2PA 3VQ4A 4CZHA 4GV3A 4EAHD 2IOCA 5TKWA 2A40A 4IOCL 3KKSA 3VTIA 1ATRA 2KLAA 3ZT1A 3MX5A 3S3MA 4X65K 1KVAA 5C42A 1ZBHA 5DMRA 4ISEA 3B8AX 1IG8A 4HWIA 1Y97A 4FLUA 1MA9B 2FXUA 4KRFA 1VSMA 3KVGA 2O8DA 4NO7A 5LJWA 1BGXT 3K9KA 2W6LA 4B3MK 3CJ7A 1QE1A 4E3SA 3NHGA 3ZSZA 3KLGA 3ZX0A 3VF4A 1HQUA 2G8IA 4IEEA 2PAVA 5C2FA 3G4SN 3DXKA 1IBLK 3QBXA 3BF3A 3M8QA 1C0TA 1ZBSA 2VG6A 4M3RA 3ZSVA 3MN9A 3SBGA 1W2BM 4WFBL 1VQMN 2A42A 1GLBG 4HUFA 2P9SA 1JKHA 4RW7A 3WEEA 1BISA 1NGDA 2BANA 1VSFA 3AVNA 3DXMB 5I9EB 4IOAL 4AHUA 4IOXA 3I33A 1RTHA 2D0AA 3QINA 4KAZA 3LP2A 2P1JA 4PY5A 4DU1A 4KH4A 2ETJA 4H4OA 2Q1NA 3CETA 2W41A 5JLFA 1RT4A 4NLCA 4I9QA 4V19S 3NFAA 3KWIA 2WC9A 5EOYA 1KSPA 2O4IA 2OZSA 4M42A 2VCPA 1HJOA 1SUQA 3ZSRA 2OPPA 1IKYA 4B1YB 5GADP 4OGEA 3GG4A 4LFCK 2JWLA 4XH1A 1KCFA 4MO5A 3U8XA 5SZTA 5BRDA 3HYFA 4CGHA 5AZIB 5AQPA 4IKFA 2VWBA 4OVLA 4BREA 2DTUA 4U67L 5JMVA 5AQGA 2NZTA 3CM5A 1VRUA 3CC7N 2CH6A 3U9ZA 2KFNA 3S9HA 4C23A 3PV8A 3P4IA 4GVEA 4CEDA 3AARA 2QEXN 4JS4A 3WNEA 3DWLA 4FM2A 4A2AA 1JLGA 4A57A 1VQ7N 3RRGA 1TAUA 3F2KA 3CF5L 3THWA 4K8XA 2KFZA 5KRTA 1D8YA 3CFPA 4FCYA 4C8OA 4WF9L 4IFEA 5CE3A 4A62A 3CPEA 5J2NA 4KO0A 1VQNN 3ATUA 1RTDA 1H1VA 4HCCA 4YOUA 5EVZA 1KVCA 2IVNA 1C0UA 4DTUA 2F9TA 2HHVA 3NGIA 3O3FA 2GUIA 4JI4K 2YX6A 5AR0A 5EX5A 4NYFA 4CGFA 4C8MA 4E7KA 1F21A 4WFNL 2HSTA 2QWNA 1WLJA 2QWMA 4HHTA 3CFRA 4CIGA 3I55N 3C7NA 1HNVA 4Y1DA 4JI5K 3RMCA 4CZFA 3EN9A 4B3SK 1M1KO 1M90O 5JS1A 1N32K 2RN2A 3MEDA 4B9LA 2GTDA 3AVKA 2E2NA 1NM1A 1YAGA 2D5RA 3VQAA 4JI6K 1OH8A 2P9KA 2YNHA 5FRMA 1S1WA 1WBDA 1O1WA 2Q31A 3L3UA 4CZJA 5DM7L 4M7YA 4JI2K 2IAJA 5HBMA 3VEOA 5J1EA 1U48A 4DKWA 3PX4A 1QZ6A 2GBZA 3MEGA 1XNQK 1MU2A 4JKEA 5AZJB 2V7YA 4JN4A 4W5RA 5CY4A 3CHWA 3IAYA 2X6SA 3TAQA 1TAQA 3MXIA 4N76A 1RBVA 4PA1A 3AA5X 1HR0K 3EKSA 3HVTA 2QXFA 3L6QA 3VERA 4J2BA 2QI2A 4NXMK 2P9NA 4CBUA 3KLEA 3VGKA 4W5NA 4CEBA 3TR8A 4JYAK 1KC8O 2D0PA 1BG3A 4CEQA 4JI3K 1HPMA 3KK1A 4C1NI 3JAMO 2RPIA 3CQYA 3DM2A 1JL1A 1QHTA 3J7AP 4FWMA 2UUBK 4JI8K 3TSUA 2OANA 5JVGL 4H4MA 3SNNA 4A5BA 4ZHRA 1GOCA 3CD6N 1RBUA 2RE2A 4DWIA 4Z4CA 3VQ9A 2YCHA 3CIPA 4K41A 4HCBA 3O1BA 3CI5A 1GLLO 2VGNA 1RT2A 4DQRA 2O8BA 1GLDG 4BRNA 3VQDA 3UE5A 1D5AA 4PKIA 4EZ6A 3HL8A 1HYVA 4Z94A 3O9QA 3M8PA 5FRNA 1I3AA 3O4WA 3M5RA 1K73O 1BQMA 4B9VA 3THYA 5LY3A 3L0QA 4MDBA 4BG8A 5HRSA 4B9UA 3RR8A 4NXNK 1IG9A 3A2FA 2QA4N 3ATVA 5KPRA 1S72N 5AQQA 2P9NB 2UU9K 3F9MA 3M8RA 3LPUA 3SK3A 3O9UA 3O9TA 2ZJQL 3IG1A 3RRHA 3CJ9A 4FVUA 4OPJA 1RDAA 3DAWA 2KTQA 4KREA 3RMBA 5C0YA 1TK5A 5EY4A 3T19A 3HRGA 3CCEN 2EWSA 3QDKA 4N5SA 2UUCK 1TK8A 5IWAK 4CK2A 1LV5A 1VK0A 2BH1A 2HMPA 5T7BA 2KZZA 4AQYK 4JKFA 4DTNA 1NJXA 5AQUA 5C15A 4OO1J 2HNDA 1KAYA 1YF5L 1RT7A 4BR4A 3M6GA 4MDAA 3QICA 1KAZA 2KZMA 2OPQA 4PL8A 4DSFA 4CF9A 1TKZA 4DV0K 3U6FA 3G25A 4QAGA 4RW4A 4FZZA 4E89A 4YOWA 4DR7K 4FOIA 4FJ5A 1IV0A 3MAQA 4E1JA 4EFHA 4E7HA 2ZJRL 4FWSA 4UY8O 1U45A 3U4LA 4G9ZA 1J5OA 1QSYA 3B6PA 4H5WA 4B1UB 3UKUA 4IWVA 2YNIA 2GWJA 3WXLA 4CJLA 2VWJA 4B1VA 2HBMA 5C2DA 4OLBA 2P9SB 4FXDA 4CEEA 3LALA 1R59O 3QFUA 4PUOA 2P9KB 3FFIA 3K59A 3LAKA 3VTHA 1UA1A 3W0LA 2F96A 2ZGZA 1BCMA 2YHBA 3VEXA 2UUAK 5F2RA 4XH4A 1KAXA 1EQYA
chains in the Genus database with same CATH topology
3CJ1A 3VETA 3H45C 4H0YB 4YDUA 1Y64A 3BP8A 3GE1A 4NLBA 4BC3A 4FPBA 5M1NA 3KK7A 4AM7A 2PFUA 2QWPA 5BRHA 3HOTA 1QQMA 2YHWA 2NNWA 3EKUA 2QWOA 1NGHA 3NVKA 3AY9A 4BR7A 4BR2A 3A5MC 3WXMB 1KQSM 1W97L 4JK8A 3VGMA 3VPZA 3GBTA 3HTVA 1SZ2A 2GUPA 4CZMA 2Q97A 3SLCA 5AQXA 3SMPA 5AQLA 5KQ8A 3DJCA 1YI2N 1NGGA 3SMSA 3UKRB 3WQTA 1VQPN 3E9LA 4ISGA 3OBYA 1N8RO 4H0OA 4R79A 1X9JA 3FR0A 4XEIA 4OPAA 1SQKA 4NB4A 1NGJA 3FZFA 3ZEUA 2FF6A 1QVGM 4GV6A 2OTJN 1NGEA 1V4TA 4JK9A 3SAFA 3R9PA 3GDQA 1TUUA 5FPNA 1BDGA 1WUAA 4Y0WA 3ZETA 4CZHA 4GV3A 1P90A 4EAHD 3T7ZA 2YHYA 3E66A 5TKWA 5C12A 2A40A 4IOCL 3AAQA 1ATRA 3VTIA 4JKBA 1NBWA 1JCGA 2KLAA 4IO8A 3EE9A 4CD1A 3MX5A 2KKZA 2E8AA 3P38A 2UYTA 4ISEA 2ITMA 3AGRA 3B8AX 1IG8A 2I7NA 4HWIA 4BRIA 1MA9B 2FXUA 3CC4N 3KVGA 3WXKA 4A2BA 4K43A 2IVOA 4NO7A 5LJWA 3K9KA 4GV9A 1VQKN 3RSEA 5AZJA 3CJ7A 4KH5A 4H0VB 4JAXA 4YOVA 4BR0A 3VEWA 2NRRA 3ZX0A 4J8FA 3VF4A 5BN8A 3OHRA 4IEEA 2PAVA 5C2FA 2YI1A 3G4SN 4JEPA 4EIAA 3DXKA 1OKJA 1T6DA 3H1VX 3QBXA 1S3XA 3BF3A 1RFQA 1ZBSA 5AQIA 1C0GA 3M1FA 3GOIA 3WEEB 3CCRN 3MN9A 2P9LA 3BF1A 3QMLA 3SBGA 4WFBL 1W2BM 1U2VA 2A42A 1Z6RA 4XH5A 2GWKA 1VQMN 1GLBG 2P9PB 2HOEA 4FWQA 4YOTA 3CC2N 2P9SA 4BRLA 3WEEA 2F9WA 1NGDA 5AFUH 5AQRA 3DXMB 5I9EB 4IOAL 3J7ZO 4IOXA 2BUPA 5EXWA 4B9QA 3CCVN 3I33A 3JXUA 1NGCA 3HSCA 3CJAA 3UKUB 1SS6A 4FPAA 4BC4A 4KBOA 4K42A 4KH4A 4IXCA 4H5TA 1BWFO 5AQTA 2Q0UA 5FPMA 4B1ZA 4WCEL 5BR9A 3MCAB 1U6ZA 2NRVA 3VENA 2Q1NA 5ELZA 3CETA 4QS7A 2P9UA 2W41A 3WXJA 4NLCA 5AQHA 5JLFA 2NRTA 3CMAN 4BR5A 2YJEA 1XUPO 2DPNA 2KHOA 2A41A 3KWIA 2WC9A 2J4RA 5EOYA 2HF4A 4FWKA 3ENOA 2D1KA 4YDUC 3S41A 3WT0A 3WXIA 3CMEN 1DEJA 2VCPA 3VEVA 1HJOA 2E2OA 4B1YB 5M1PA 5GADP 1BUPA 1HKBA 3GG4A 3MN5A 3O80A 2E1YA 2JWLA 4FWPA 4JKGA 4XH1A 3H46O 3TSQA 4H5NA 1KD1O 4MO5A 3U8XA 4JHDB 1J6ZA 2GX9A 4M7XA 3LDNA 3CERA 4B1WB 5BRDA 3PIOL 3HOSA 2H3GX 3E9OA 3WUHA 5AZIB 2E1ZA 5AQPA 2VWBA 3ZEUB 4K25A 5AQKA 4BREA 4FWLA 4U67L 3P31A 5JMVA 5AQGA 3CXCM 2NZTA 1Z05A 3ENHA 3O08A 1V4SA 2HBKA 1XC3A 3CC7N 5M1FA 4BRHA 3G71N 5AQZA 3R8EA 2CH6A 3U9ZA 2A5XA 1GLAG 3C6HA 2NRXA 2ZWHA 4C23A 1LCUA 3P4IA 4GVEA 3AARA 4BR9A 3LL3A 2QEXN 1S22A 3MDQA 3HBTA 1LOTB 3DWLA 4PHTX 1E4FT 3AGKA 4A2AA 3LM9A 4A57A 1VQ7N 4IJAA 1K8AO 2I7PA 3FZMA 2NRWA 1ESVA 3F2KA 5FPDA 4WQ4A 2A6AA 3QB0A 4JD2B 4JKCA 4BRAA 2ZGYA 4CJ7A 5GAGP 4IDHA 4O8KA 3CF5L 3ID6A 3QBWA 3P39A 4IZ9A 4WF9L 4IFEA 1O13A 3O9RA 4BRKA 4A62A 5CE3A 1G99A 3CPEA 4BVPA 1VQNN 2GELA 3SAHA 3ATUA 3HI0A 1H1VA 5M1OA 3H3OB 3I8BA 4YOUA 5EVZA 5JLHA 2IVNA 3SJHA 3CJCA 3BUZB 3CCJN 2F9TA 1IJJA 3ULEB 4JK7A 1NGIA 2AP1A 4GNIA 3UB5A 1GLFO 3ULEA 5HL7L 1OVYA 3D2EB 3ZETB 3TTFA 1ATNA 2CH5A 1RDUA 5KQDA 4YOXA 2YX6A 1ZC6A 2D0OA 3L4IA 4H0XB 5AR0A 4IO9L 5EX5A 5AQFA 2QWLA 5M1QA 3D2EA 4IEIA 4BQZA 3Q7CA 4BGBA 5FPEA 3C65A 2FSKA 4WFNL 3M3ZA 5MLCQ 2HSTA 4QS8A 2QWNA 1BA1A 5AQYA 2QWMA 3TTDA 1QHAA 3EL2A 5CR4A 1YJWN 3I55N 3C7NA 3A5OC 1K8KA 4QS9A 4CZFA 2D4WA 3DLLL 5HOOA 2FSNA 1MWKA 1TYQB 3A8YA 5AZIA 3RSEB 4BRFA 3EN9A 3VF6A 1M1KO 1M90O 4MO4A 5ADXH 3IMXA 3VESA 5BPMA 1YXQA 1DGKN 3DXKB 4JKAA 1YUWA 2GTDA 1NGBA 2E2NA 1BU6O 2JWKA 1NM1A 3CCQN 3R1XA 4PKGA 3C6AA 1YAGA 3SBTA 2P9KA 1VQ9N 4BRCA 4CD3A 1Q82O 3TSPA 1BOTO 5JVHL 2Q31A 3I56N 4BRGA 1RGIA 4CZJA 3MX2A 5E84A 5DM7L 3JS6A 1CZAN 4WFAL 4M7YA 3RVCA 1TYQA 1T44A 1QQOA 5M1KA 3VEOA 5GAHP 4MLEA 3KZBA 4LC9B 1K8KB 4PKHA 4CZEA 4DKWA 2CGKA 2V51B 4BROA 5DM6L 1GLCG 3VEZA 1QZ6A 1Q18A 5AQJA 5BRFA 4ILGB 3FLCO 4JKEA 5AZJB 1RDWX 3EO3A 2V7YA 4FO0A 4JN4A 4MLHA 3KWGA 3ZX3A 1P8ZA 3CHWA 4CZGA 2FF3B 2WBNA 4CZKA 3R3LA 4O5FA 5AQWA 3A0IX 5JICA 2NLXA 1QQNA 1VAZA 1JJ2M 3VGLA 1Q81O 3CCUN 1KXPA 3EKSA 4BGAA 1HUXA 4H5VA 2GEMA 4JHDA 5BPLA 3VERA 3L6QA 2P9LB 2BTFA 4H5RA 2QI2A 4U7BA 2P9NA 2A3ZA 4DQ8A 4CBUA 4WQ4C 3VGKA 2YHXA 1KC8O 2D0PA 2HBJA 1BG3A 3DXMA 1HPMA 3EZWA 2AA4A 2QW9A 3N4QA 4C1NI 1YIJN 3O5BA 2OTLN 3CQYA 4RCHA 2NRHA 3O1WA 5AQSA 1NWKA 4FWMA 2E2PA 3FZLA 1YJ9N 1NJIO 3TSUA 3NVMA 2OANA 5JVGL 3D2FB 3H6EA 4F9OA 1U2VB 2NRZA 5GINA 3MN6A 4I6MB 4A5BA 2ASOA 2WUSA 3VEYA 3CD6N 2RE2A 4YORA 3ZX2A 2YCHA 2F7TA 3CIPA 3ZYYX 4ISFA 4K41A 3R6MA 5LJVA 2Q2RA 1VQ5N 1DT9A 3O1BA 4CZIA 3CI5A 1GLLO 5TKYA 2FLOA 2VGNA 3IKMA 1HKCA 4WYBA 2Q36A 3MMVA 2E88A 3PIPL 1GLDG 2QXLA 3QFPA 4BRNA 3LM2A 4BY9C 3H3NO 4AF1A 3UE5A 4PKIA 4B1XB 3LDQA 5AQMA 1XQSC 4FL9A 2ZJPL 4Z94A 1D4XA 3O9QA 5H1SQ 4C1NK 1GLJO 2ZF5O 5BN9A 3BEXA 5F0XA 3W3DA 3O4WA 4BVOA 3M5RA 1K73O 2ASPA 4A61A 4FWRA 3L0QA 4MDBA 3HZ6A 4BG8A 1BA0A 5LY3A 1HKGA 3ATVA 3VOVA 3CQXA 3CJBA 5KPRA 5GIOA 2QA4N 1S72N 3PLAA 2HBLA 4EHUA 1Q86O 5AQQA 2W40A 4DCHA 4JKGB 2P9NB 3F9MA 3A5LC 4CBWA 1K9MO 5KPTA 4H0TB 3O9SA 3MK6A 2V7ZA 4H03B 3SK3A 1Q7YO 3ENBA 3OBWA 4KH6A 3WQUA 5E26A 4BQLA 3Q7BA 3UKRA 3D6RA 3O9UA 1ZXOA 3O9TA 2ZJQL 3MCPA 2CGJA 4FWOA 3CJ9A 3FZKA 3KHYA 4O8UA 4RTFD 3TPQA 4YOYA 3CPWM 4FVUA 1YJNN 5B8HA 3J8AA 1T3VA 3DAWA 3IFRA 4M63C 3TTCA 1JCFA 4BC2A 4CBXA 1VQ6N 5AFUA 4WQ5C 3GL1A 2FSJA 3FE1A 5C0YA 3D7EO 1HLUA 1YVNA 3CCSN 1T6CA 2VYPA 3O8MA 3FZHA 4JNEA 5EY4A 4FWNA 4RWTA 1VQON 4WQ5A 3HRGA 3K9JA 5GIPA 3CCEN 4A5AA 4I6MA 4BRQA 2EWSA 4PL7A 1YHQN 3FGUA 3LDOA 3QDKA 4H0PA 1TUYA 4CI6A 3C7NB 5KPZA 4IJNA 3OW2M 1NMDA 2BH1A 3FFKB 2HMPA 1QZ5A 3A5NC 3HM8A 4JKFA 1VQ4N 1WOQA 2ASMA 3OA9A 5AQUA 5C15A 5ADXA 4OO1J 1X3MA 1KAYA 3MN7A 1GLEG 1YF5L 4OPHA 3E1YA 4BR4A 2CGLA 3M6GA 4BG9A 4ILHA 3QICA 4MDAA 1KAZA 1MWMA 4BRDA 4CZLA 5BPNA 4PL8A 3G6EN 1ILYA 2P9UB 1DKGD 4FOEA 5GAEP 3G25A 5F1XA 1ATSA 5C10A 4YOWA 3E9PA 4BRMA 4FOIA 2P9IB 1HX1A 4HTLA 2P9IA 4E1JA 4EFHA 2PBDA 2ZJRL 4FWSA 3O6WA 4UY8O 5BREA 3LDPA 3SAGA 3MWTA 2WFBA 4FSVA 4A59A 4BRPA 3U4LA 3NMUA 4EHTA 1NGAA 3LDLA 3MWPA 2QWQA 3N4PA 4GY2B 3ID8A 4G9ZA 1VQLN 3IDHA 3VMFB 2IIRA 2Q0RA 1VQ8N 2VGMA 1X3NA 2QM1A 3H1QA 3IUCA 3L4QA 5AQNA 4H5WA 5CHIA 2RHKA 1EO1A 4B1UB 3UKUA 4IWVA 1MDUB 4JKDA 2QTDA 3AAPA 2GWJA 2HF3A 4JKHA 3VF2A 3WXLA 1NLVA 4B1VA 1JCEA 2IVPA 2HBMA 5C2DA 2P9SB 4BC5A 1QVFM 4DHYA 2QWRA 3CCLN 1R59O 2P9PA 4ILJA 3QFUA 2P9KB 3C0BA 3TU5A 3T69A 5AQOA 4JD2A 2E2QA 2E20A 4L3QA 1NGFA 3VTHA 3F5TA 3CCMN 3W0LA 3D2FA 2ZGZA 1C0FA 3U9DA 4DB3A 4AM6A 1SAZA 1BO5O 2YJFA 3VEXA 1YITN 3EE8A 1E4GT 5F2RA 4XH4A 5AQVA 1KAXA 1EQYA 2V52B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CJ1 A;  3VET A;  3H45 C;  4H0Y B;  4YDU A;  1Y64 A;  3BP8 A;  3GE1 A;  4BC3 A;  4FPB A;  4AM7 A;  2QWP A;  5BRH A;  1QQM A;  2YHW A;  3EKU A;  2QWO A;  1NGH A;  3AY9 A;  4BR7 A;  4BR2 A;  3A5M C;  3VGM A;  3VPZ A;  3GBT A;  3HTV A;  1SZ2 A;  2GUP A;  4CZM A;  2Q97 A;  3SLC A;  5AQX A;  3SMP A;  5AQL A;  5KQ8 A;  3DJC A;  1NGG A;  3SMS A;  3UKR B;  3WQT A;  4ISG A;  4H0O A;  1X9J A;  3FR0 A;  4XEI A;  1SQK A;  4NB4 A;  1NGJ A;  3FZF A;  3ZEU A;  2FF6 A;  1NGE A;  1V4T A;  3R9P A;  3GDQ A;  1TUU A;  5FPN A;  1BDG A;  1WUA A;  4Y0W A;  3ZET A;  4CZH A;  4EAH D;  2YHY A;  2A40 A;  3AAQ A;  1ATR A;  1NBW A;  1JCG A;  4IO8 A;  4CD1 A;  2E8A A;  2UYT A;  4ISE A;  2ITM A;  3B8A X;  1IG8 A;  2I7N A;  4HWI A;  4BRI A;  1MA9 B;  2FXU A;  3KVG A;  3WXK A;  4A2B A;  4K43 A;  2IVO A;  4NO7 A;  5LJW A;  3RSE A;  5AZJ A;  3CJ7 A;  4H0V B;  4JAX A;  4BR0 A;  3VEW A;  3ZX0 A;  4J8F A;  3VF4 A;  5BN8 A;  3OHR A;  2PAV A;  2YI1 A;  4EIA A;  3DXK A;  1OKJ A;  1T6D A;  3H1V X;  3QBX A;  1S3X A;  3BF3 A;  1RFQ A;  1ZBS A;  5AQI A;  1C0G A;  3M1F A;  3GOI A;  3WEE B;  3MN9 A;  2P9L A;  3BF1 A;  3QML A;  1U2V A;  2A42 A;  1Z6R A;  4XH5 A;  2GWK A;  1GLB G;  2P9P B;  2HOE A;  4FWQ A;  2P9S A;  4BRL A;  3WEE A;  2F9W A;  1NGD A;  5AFU H;  5AQR A;  3DXM B;  5I9E B;  2BUP A;  5EXW A;  4B9Q A;  3I33 A;  3JXU A;  1NGC A;  3HSC A;  3CJA A;  3UKU B;  4BC4 A;  4FPA A;  4KBO A;  4K42 A;  4IXC A;  4H5T A;  1BWF O;  5AQT A;  2Q0U A;  5FPM A;  4B1Z A;  5BR9 A;  1U6Z A;  3VEN A;  2Q1N A;  5ELZ A;  3CET A;  4QS7 A;  2P9U A;  2W41 A;  3WXJ A;  5AQH A;  5JLF A;  4BR5 A;  2YJE A;  1XUP O;  2DPN A;  2KHO A;  2A41 A;  2J4R A;  5EOY A;  2HF4 A;  4FWK A;  3ENO A;  2D1K A;  4YDU C;  3S41 A;  3WT0 A;  3WXI A;  1DEJ A;  2VCP A;  3VEV A;  1HJO A;  2E2O A;  4B1Y B;  1BUP A;  1HKB A;  3GG4 A;  3MN5 A;  3O80 A;  2E1Y A;  4XH1 A;  4FWP A;  3H46 O;  4H5N A;  4MO5 A;  3U8X A;  4JHD B;  1J6Z A;  4M7X A;  3LDN A;  3CER A;  4B1W B;  5BRD A;  2H3G X;  3WUH A;  5AZI B;  2E1Z A;  5AQP A;  2VWB A;  3ZEU B;  4K25 A;  5AQK A;  4BRE A;  4FWL A;  5JMV A;  5AQG A;  2NZT A;  1Z05 A;  3ENH A;  3O08 A;  1V4S A;  1XC3 A;  4BRH A;  5AQZ A;  3R8E A;  2CH6 A;  3U9Z A;  2A5X A;  1GLA G;  2ZWH A;  4C23 A;  1LCU A;  3P4I A;  3AAR A;  4BR9 A;  3LL3 A;  1S22 A;  3MDQ A;  3HBT A;  1LOT B;  3DWL A;  1E4F T;  4A2A A;  3LM9 A;  4IJA A;  2I7P A;  3FZM A;  1ESV A;  5FPD A;  4WQ4 A;  2A6A A;  3QB0 A;  4JD2 B;  4BRA A;  4CJ7 A;  2ZGY A;  4O8K A;  3QBW A;  4IZ9 A;  5CE3 A;  4BRK A;  4A62 A;  1G99 A;  4BVP A;  2GEL A;  3ATU A;  3HI0 A;  1H1V A;  3H3O B;  3I8B A;  5EVZ A;  5JLH A;  2IVN A;  3SJH A;  3CJC A;  3BUZ B;  2F9T A;  1IJJ A;  3ULE B;  1NGI A;  2AP1 A;  4GNI A;  3UB5 A;  1GLF O;  3ULE A;  3D2E B;  3ZET B;  1ATN A;  2CH5 A;  5KQD A;  1ZC6 A;  2D0O A;  3L4I A;  4H0X B;  5AR0 A;  5EX5 A;  5AQF A;  2QWL A;  3D2E A;  4BQZ A;  4BGB A;  5FPE A;  2FSK A;  3M3Z A;  4QS8 A;  2QWN A;  1BA1 A;  5AQY A;  2QWM A;  1QHA A;  3EL2 A;  3C7N A;  3A5O C;  1K8K A;  4QS9 A;  4CZF A;  2D4W A;  2FSN A;  1MWK A;  1TYQ B;  3A8Y A;  5AZI A;  3RSE B;  4BRF A;  3EN9 A;  3VF6 A;  4MO4 A;  5ADX H;  3IMX A;  3VES A;  5BPM A;  1YXQ A;  1DGK N;  3DXK B;  1YUW A;  2GTD A;  1NGB A;  2E2N A;  1BU6 O;  1NM1 A;  4PKG A;  1YAG A;  2P9K A;  4BRC A;  4CD3 A;  1BOT O;  2Q31 A;  4BRG A;  1RGI A;  4CZJ A;  5E84 A;  3JS6 A;  1CZA N;  4M7Y A;  1TYQ A;  1T44 A;  1QQO A;  3VEO A;  4MLE A;  3KZB A;  4LC9 B;  1K8K B;  4PKH A;  4CZE A;  2CGK A;  2V51 B;  4BRO A;  1GLC G;  3VEZ A;  1QZ6 A;  1Q18 A;  5AQJ A;  5BRF A;  3FLC O;  5AZJ B;  1RDW X;  3EO3 A;  2V7Y A;  4FO0 A;  4JN4 A;  4MLH A;  3ZX3 A;  1P8Z A;  3CHW A;  4CZG A;  2FF3 B;  4CZK A;  4O5F A;  5AQW A;  3A0I X;  5JIC A;  2NLX A;  1QQN A;  3VGL A;  1KXP A;  3EKS A;  4BGA A;  1HUX A;  4H5V A;  2GEM A;  4JHD A;  5BPL A;  3VER A;  3L6Q A;  2P9L B;  2BTF A;  4H5R A;  2P9N A;  2A3Z A;  4DQ8 A;  4CBU A;  4WQ4 C;  3VGK A;  2YHX A;  2D0P A;  3DXM A;  1BG3 A;  1HPM A;  3EZW A;  2AA4 A;  2QW9 A;  3O5B A;  3CQY A;  4RCH A;  2NRH A;  3O1W A;  5AQS A;  1NWK A;  4FWM A;  2E2P A;  3FZL A;  2OAN A;  3D2F B;  3H6E A;  4F9O A;  1U2V B;  3MN6 A;  4I6M B;  2ASO A;  2WUS A;  3VEY A;  3ZX2 A;  2YCH A;  3CIP A;  4ISF A;  4K41 A;  3R6M A;  5LJV A;  2Q2R A;  3O1B A;  4CZI A;  3CI5 A;  1GLL O;  5TKY A;  2FLO A;  1HKC A;  4WYB A;  2Q36 A;  3MMV A;  2E88 A;  1GLD G;  2QXL A;  3QFP A;  4BRN A;  3LM2 A;  3H3N O;  3UE5 A;  4PKI A;  4B1X B;  3LDQ A;  5AQM A;  1XQS C;  4FL9 A;  4Z94 A;  1D4X A;  1GLJ O;  2ZF5 O;  5BN9 A;  3BEX A;  5F0X A;  3W3D A;  3O4W A;  4BVO A;  2ASP A;  4A61 A;  4FWR A;  3L0Q A;  4BG8 A;  3HZ6 A;  5LY3 A;  1BA0 A;  1HKG A;  3ATV A;  3VOV A;  3CQX A;  3CJB A;  5KPR A;  4EHU A;  5AQQ A;  2W40 A;  4DCH A;  2P9N B;  3F9M A;  3A5L C;  4CBW A;  5KPT A;  4H0T B;  3MK6 A;  2V7Z A;  4H03 B;  3SK3 A;  3WQU A;  5E26 A;  4BQL A;  3UKR A;  1ZXO A;  3MCP A;  2CGJ A;  4FWO A;  3CJ9 A;  3FZK A;  3KHY A;  4RTF D;  3TPQ A;  5B8H A;  3J8A A;  3DAW A;  4CBX A;  3IFR A;  4M63 C;  4BC2 A;  1JCF A;  5AFU A;  4WQ5 C;  3GL1 A;  2FSJ A;  3FE1 A;  3D7E O;  1HLU A;  1YVN A;  1T6C A;  2VYP A;  3O8M A;  3FZH A;  4JNE A;  5EY4 A;  4FWN A;  4RWT A;  4WQ5 A;  4I6M A;  4BRQ A;  2EWS A;  4PL7 A;  3FGU A;  3LDO A;  3QDK A;  4H0P A;  1TUY A;  4CI6 A;  3C7N B;  5KPZ A;  4IJN A;  1NMD A;  3FFK B;  2HMP A;  1QZ5 A;  3A5N C;  3HM8 A;  1WOQ A;  2ASM A;  5AQU A;  5ADX A;  1X3M A;  1KAY A;  3MN7 A;  1GLE G;  4BR4 A;  2CGL A;  3M6G A;  4BG9 A;  4BRD A;  3QIC A;  1KAZ A;  1MWM A;  4CZL A;  5BPN A;  4PL8 A;  2P9U B;  1DKG D;  4FOE A;  3G25 A;  5F1X A;  1ATS A;  4BRM A;  4FOI A;  2P9I B;  1HX1 A;  4HTL A;  2P9I A;  4E1J A;  4EFH A;  2PBD A;  4FWS A;  3O6W A;  5BRE A;  3LDP A;  4FSV A;  4BRP A;  3U4L A;  4EHT A;  1NGA A;  3LDL A;  2QWQ A;  4GY2 B;  3ID8 A;  3IDH A;  2IIR A;  2Q0R A;  1X3N A;  2QM1 A;  3H1Q A;  3IUC A;  5AQN A;  4H5W A;  4B1U B;  3UKU A;  4IWV A;  1MDU B;  3AAP A;  2GWJ A;  2HF3 A;  3VF2 A;  3WXL A;  1NLV A;  4B1V A;  1JCE A;  2IVP A;  2P9S B;  4BC5 A;  4DHY A;  2QWR A;  1R59 O;  2P9P A;  3QFU A;  2P9K B;  3C0B A;  3TU5 A;  5AQO A;  4JD2 A;  2E2Q A;  2E20 A;  4L3Q A;  1NGF A;  3W0L A;  3D2F A;  2ZGZ A;  1C0F A;  3U9D A;  4DB3 A;  4AM6 A;  1SAZ A;  1BO5 O;  2YJF A;  3VEX A;  1E4G T;  5F2R A;  4XH4 A;  5AQV A;  1KAX A;  1EQY A;  2V52 B; 
#chains in the Genus database with same CATH topology
 3CJ1 A;  4YDU A;  3D0P A;  2DY4 A;  4KV8 A;  3KK7 A;  4AM7 A;  3HOT A;  1IO2 A;  3VQP A;  2YHW A;  4CJ5 A;  4L8R B;  1U04 A;  4F3O A;  1HNZ K;  3NVK A;  1W97 L;  3VGM A;  4NCB A;  4CZM A;  4KHU A;  1KFS A;  5AQL A;  2AJQ A;  3WQT A;  1VQP N;  4CIF A;  3OBY A;  1N8R O;  2PY5 A;  3FR0 A;  1WSE A;  3KLF A;  4OPA A;  1NGJ A;  1NK4 A;  2FF6 A;  4M3Z A;  4JK9 A;  4CF0 A;  3SAF A;  3DLR A;  3GDQ A;  2OYQ A;  3ALY A;  1TUU A;  5FPN A;  4CFC A;  2G8W A;  1NOY A;  4ZTF A;  4FM1 A;  3PX6 A;  3VA3 A;  4JI0 K;  1LWC A;  4JKB A;  4CJR A;  4CD1 A;  3HM9 A;  4M45 A;  3AGR A;  3EY1 A;  4E19 A;  1L3S A;  4J2D A;  2XY7 A;  1X9S A;  3WXK A;  1RBS A;  4A2B A;  2IVO A;  3RSE A;  3OYI A;  1N5Y A;  4DR3 K;  4YOV A;  1NG9 A;  3KTQ A;  4BR0 A;  2NRR A;  4DUZ K;  3SQ4 A;  3OHR A;  4CFA A;  4LF4 K;  4JEP A;  1OKJ A;  1T6D A;  4NCG A;  1C1A A;  1S3X A;  1C0G A;  4LF8 K;  1S9G A;  3CCR N;  3BF1 A;  1U2V A;  4XH5 A;  1Z6R A;  2GWK A;  2O8F A;  1REV A;  4FWQ A;  4YOT A;  2VQF K;  1W7A A;  4EP4 A;  3QNO A;  1RT1 A;  1RCH A;  4W5Q A;  2BUP A;  4O55 A;  3CCV N;  2EHG A;  1JXB A;  3J80 O;  3CJA A;  3UKU B;  4C8N A;  3SQ1 A;  1BHL A;  3QET A;  1NOZ A;  2JLE A;  2WON A;  4K42 A;  4CIE A;  5AQT A;  4B1Z A;  2Q0U A;  4WCE L;  1QSL A;  1NK5 A;  2NRV A;  4N41 A;  5ELZ A;  1EET A;  3ZT4 A;  3OTO K;  4KB0 A;  1QTM A;  2E5L K;  2HF4 A;  3ENO A;  2D1K A;  3WT0 A;  4DV4 K;  4F8R A;  1DEJ A;  3VEV A;  2IGI A;  4BWM A;  2YKM A;  1HKB A;  1NK7 A;  3O4Q A;  4JKG A;  4FWP A;  5J2P A;  3SI6 A;  1UA0 A;  2Y1J A;  5FRO A;  4JHD B;  1J6Z A;  2GX9 A;  3LDN A;  4B1W B;  3HOS A;  3V9U A;  4FK4 A;  3P31 A;  2D0B A;  5FDL A;  1Z05 A;  3ENH A;  4JRP A;  1XC3 A;  3L2R A;  4DUY K;  3BY5 A;  3AA4 A;  4KTQ A;  2A5X A;  4CJV A;  3THX B;  1EP4 A;  3MDQ A;  5CZ2 A;  4CF2 A;  1LOT B;  3LM9 A;  1YTU A;  4IJA A;  1K8A O;  2I7P A;  4E0D A;  4JKC A;  4JD2 B;  5SWM A;  2ZGY A;  2UXC K;  2I5J A;  3T3F A;  2ITG A;  3QBW A;  1NMN A;  1TKD A;  3LAN A;  3OYH A;  1C0M A;  3QEP A;  1G99 A;  3SAH A;  2DFE A;  3HI0 A;  3IS9 A;  3TAF A;  5M1O A;  3H3O B;  1OH6 A;  3VN5 A;  3CJC A;  3BUZ B;  3V9W A;  4JK7 A;  4K0K K;  3UB5 A;  1GLF O;  3NBP A;  5HL7 L;  3D2E B;  3TTF A;  4X66 K;  5KQD A;  3QLH A;  4H0X B;  1WB9 A;  5KTQ A;  2QWL A;  3O4N A;  2F8S A;  4HUG A;  4IEI A;  4BQZ A;  3Q7C A;  4CGJ A;  3C65 A;  1BA1 A;  4ELV A;  2P5G A;  4XIU A;  3EL2 A;  3I0R A;  3MXM A;  4YFU A;  3DLH A;  1HNW K;  5HOO A;  2FSN A;  1MWK A;  4C8L A;  3RWU A;  3RSE B;  1LW2 A;  3VF6 A;  4BRF A;  1SL2 A;  4MO4 A;  3LZJ A;  1WAF A;  5ADX H;  1A5V A;  3IMX A;  3VES A;  2PYJ A;  1YXQ A;  1NGB A;  1BU6 O;  2JWK A;  1JLB A;  3CCQ N;  2Z1H A;  3R1X A;  4PKG A;  3O3H A;  3SBT A;  1LW0 A;  3OVN A;  2NUB A;  1JLQ A;  1S9E A;  1HNX K;  3OJS A;  4CER A;  4DTJ A;  1VQ9 N;  1BOT O;  1WSJ A;  3OYG A;  1X9M A;  4KHW A;  1RGI A;  2A1S A;  4EP5 A;  4WFA L;  3PSI A;  3OYK A;  3RVC A;  1TYQ A;  1T44 A;  1QQO A;  1ASW A;  5M1K A;  5GAH P;  4MLE A;  4Q0B A;  4PKH A;  2HHH K;  2CGK A;  2V51 B;  4BRO A;  3KLI A;  1GLC G;  4QOZ B;  5AQJ A;  3K5M A;  4ILG B;  4DV7 K;  3ZSW A;  4CF8 A;  3NDK A;  3KWG A;  1P8Z A;  4CZG A;  4MQ3 A;  4CZK A;  4AH9 A;  4I9L A;  3A0I X;  3DRP A;  1Q9Y A;  5JIC A;  3U3G A;  1QQN A;  3VGL A;  1LAV A;  4DF4 A;  4BGA A;  3B6O A;  3HO1 A;  4H5V A;  5KI6 A;  4JHD A;  3KD5 E;  1Z25 A;  5CZ1 A;  5AJ3 K;  4OKE A;  2Y1I A;  5C24 A;  4DQ8 A;  4NYN A;  4WQ4 C;  3SQ0 A;  2YHX A;  1JLC A;  4ID5 A;  5FLX O;  3NAE A;  4CJ4 A;  3DXM A;  1NKE A;  3EZW A;  2QW9 A;  2OTL N;  1RTI A;  2IDO A;  4J2E A;  2NRH A;  1BI4 B;  3OYA A;  5AQS A;  1NWK A;  1IKX A;  4AHV A;  3D45 A;  1YJ9 N;  4FK0 A;  4B9T A;  1NJI O;  3EZ5 A;  3D2F B;  3C95 A;  1U2V B;  3TAG A;  4I6M B;  2ASO A;  2WUS A;  4LF7 K;  2QKB A;  3DLK A;  3ZYY X;  1RBR A;  5TKY A;  4LSL A;  3L8B A;  4CHY A;  3PIP L;  2QXL A;  3V1Q A;  2GV9 A;  3LM2 A;  3QEI A;  2ZQB A;  4B1X B;  1XQS C;  4CEZ A;  1IBK K;  1D4X A;  3OYN A;  5H1S Q;  1GLJ O;  1XI1 A;  5K14 A;  3PO5 A;  3W3D A;  3NF8 A;  4BE1 A;  1T03 A;  2XY6 A;  1HKG A;  3VOV A;  3CJB A;  3PLA A;  1CZ9 A;  4EHU A;  4JKG B;  3KD1 E;  4DTO A;  3A5L C;  5D3G A;  4F2S A;  4DMN A;  5KPT A;  4H0T B;  3MK6 A;  4H03 B;  1OVQ A;  4H8K A;  3OBW A;  5E26 A;  2E6M A;  3TAM A;  2O8B B;  1ZXO A;  4O8U A;  3TPQ A;  3CPW M;  3THW B;  2HHS A;  3TTC A;  3J8A A;  4M63 C;  4FJI A;  2HVI A;  4IFV A;  4KI6 A;  5AFU A;  3GL1 A;  4UQG A;  4FLT A;  4DSL A;  1YVN A;  1VQO N;  4RWT A;  3FZH A;  4CJ3 A;  3PO4 A;  3KLH A;  3VQC A;  3K9J A;  5GIP A;  4H0P A;  1TUY A;  1EKE A;  3SUP A;  3C7N B;  4IJN A;  4O44 A;  4FZY A;  3FFK B;  3A5N C;  1NK8 A;  3VQE A;  1WOQ A;  1FJG K;  5HLF A;  3OA9 A;  3OYF A;  3T1H K;  4DQS A;  2FBY A;  4OPH A;  3MEE A;  4BG9 A;  3K0S A;  1MWM A;  4CZL A;  3G10 A;  4DFK A;  5F1X A;  3VQ5 A;  1ATS A;  4DFP A;  3K5O A;  4X62 K;  3O6W A;  2WFB A;  4BRP A;  3NMU A;  1NGA A;  2QWQ A;  3N4P A;  3LWL A;  2IIR A;  2WOM A;  1NNE A;  3OS0 A;  4BE0 A;  4IDK A;  4JKD A;  5HRP A;  3HPO A;  1TL3 A;  1NLV A;  1JCE A;  4LFA K;  3NF9 A;  3PY8 A;  2QWR A;  2R7Y A;  2P9P A;  4ILJ A;  3WNH A;  3QIO A;  3NGZ A;  1NK6 A;  3TU5 A;  3T69 A;  4TSX A;  1HJR A;  4L3Q A;  4FJ7 A;  3D2F A;  1C0F A;  3U9D A;  1SAZ A;  1BO5 O;  2YJF A;  1YIT N;  1S1V A;  4B3T K;  1E4G T;  4GV9 A;  3H45 C;  4JRQ A;  1NK0 A;  4H0Y B;  3CQ8 A;  1Y64 A;  3BP8 A;  2ZE2 A;  1VSD A;  3NH2 A;  2QWP A;  1T8E A;  4DQI A;  2G8K A;  2NNW A;  1LWF A;  3AVL A;  1GOA A;  2VG5 A;  3I8D A;  3V9X A;  3AY9 A;  3DYA A;  1KQS M;  1TK0 A;  3VPZ A;  4GVM A;  4DV6 K;  1UWB A;  2BDP A;  2Q97 A;  3SLC A;  3SMP A;  3UIQ A;  4AHR A;  1YI2 N;  5LMU K;  3SMS A;  3E9L A;  3IRX A;  4H0O A;  4NB4 A;  4JLH A;  1CLQ A;  3LP0 A;  1BIU A;  2OTJ N;  1NGE A;  1GOB A;  2O8C B;  1BDG A;  3V6D A;  1WUA A;  4B8A B;  1A5W A;  2YHY A;  4DLE A;  1S1X A;  5C12 A;  4BE2 A;  3VQB A;  1JCG A;  2XY8 A;  5E41 A;  3BZK A;  2E8A A;  4OPK A;  2UYT A;  4CGI A;  5A2Q O;  5IT9 O;  4BRI A;  4G1Q A;  4CGD A;  4DR4 K;  4CEO A;  4K43 A;  1S1U A;  1BQN A;  1JL2 A;  1VQK N;  3OYD A;  4CJP A;  1WSF A;  1FXX A;  3DOL A;  4JAX A;  4AIL C;  4J8F A;  5BN8 A;  4B3O A;  2O8D B;  1B9F A;  4EIA A;  3H1V X;  2O4G A;  3QIP A;  1QS4 A;  4DR6 K;  4DR1 K;  2KQ2 A;  3M1F A;  3GOI A;  3WEE B;  2P9L A;  1J53 A;  2HOE A;  4NCA A;  3ZLJ A;  5AFU H;  1U47 A;  3L2Q A;  3J7Z O;  5I42 A;  3HK2 A;  3S3N A;  3LWM A;  1NGC A;  1CXQ A;  3HSC A;  4CGG A;  4KBO A;  2P5O A;  2HHU A;  4KHQ A;  4OKJ A;  5KGX A;  2O8C A;  2HNY A;  3SQ2 A;  4YHH K;  1BWF O;  5BR9 A;  2OA8 A;  1VSH A;  3MEC A;  1S6Q A;  1YVU A;  4I7F A;  4QS7 A;  2HVH A;  1C1B A;  4FK2 A;  4BR5 A;  2DPN A;  2KHO A;  1SV5 A;  3WNG A;  3CME N;  3WXI A;  3AA3 A;  4E7L A;  2F8T A;  2ZM6 K;  1HNI A;  5M1P A;  2FBV A;  3MN5 A;  3O80 A;  4F3T A;  4ELT A;  5LMN K;  3PSF A;  4H5N A;  3TSQ A;  1D9F A;  4M7X A;  4CEA A;  3PIO L;  1N36 K;  4KTW A;  3SPY A;  3ZEU B;  5AQK A;  4FWL A;  3LAM A;  3ZT0 A;  3CXC M;  4OJR A;  3SUQ A;  1V4S A;  2HBK A;  4B08 A;  5M1F A;  1HPZ A;  1UAX A;  3P5J A;  5AQZ A;  1ASU A;  3C94 A;  1GLA G;  4IG0 A;  3C6H A;  1TVR A;  1CZB A;  1QSS A;  3SV3 A;  1LAW A;  4BR9 A;  3HBT A;  3AVA A;  4PHT X;  2DFH A;  1E4F T;  3AGK A;  4RW8 A;  5CYM A;  3FZM A;  2NRW A;  3QB0 A;  4CJ7 A;  2G8H A;  4O8K A;  3K5L A;  1O13 A;  4CJF A;  3THV A;  4BVP A;  4FJG A;  4BDP A;  1HMV A;  4AHT A;  4M3Y A;  1L5U A;  2B5J A;  5JLH A;  3SJH A;  2XY5 A;  2W42 A;  4GNI A;  3DRS A;  3F9K A;  1ZC6 A;  2D0O A;  4E7I A;  4Z4E A;  1JLF A;  4IO9 L;  5AQF A;  4RW6 A;  5M1Q A;  3OYC A;  4ZTJ A;  1WSH A;  5FPE A;  2FSK A;  5MLC Q;  1EWR A;  3AVI A;  3ZSQ A;  1WN7 A;  3TTD A;  1ZBF A;  3RTV A;  2E4L A;  3OS1 A;  4FJH A;  4FJJ A;  1K6Y A;  1K8K A;  3DI6 A;  2D4W A;  3DLL L;  3C6U A;  1TYQ B;  5AZI A;  4B3R K;  1DTQ A;  3DXK B;  1YT3 A;  1YUW A;  1VSK A;  4GKJ K;  4RW9 A;  4CHN A;  4GMJ B;  4Y1C A;  1VSE A;  4BRC A;  1Q82 O;  3TSP A;  5JVH L;  2OCE A;  3I56 N;  4BRG A;  4LD0 A;  3MX2 A;  4GW6 A;  5HRR A;  1CZA N;  3K58 A;  1EWQ A;  4DV1 K;  3KZB A;  4LC9 B;  4CZE A;  5DM6 L;  4Z4F A;  1IH7 A;  3VEZ A;  1S6P A;  1Q18 A;  3DMJ A;  4CK3 A;  3FLC O;  1RDW X;  4MLH A;  1WBB A;  1NK9 A;  4DS5 A;  3E01 A;  2G8F A;  3R3L A;  4LF5 K;  4O4G A;  1VAZ A;  3V81 A;  1JJ2 M;  3DLG A;  4KKO A;  3CFO A;  1HUX A;  2GEM A;  5BPL A;  4Z4H A;  4H5R A;  4U7B A;  2HW3 A;  2A3Z A;  3CG7 A;  3ZCM A;  1U49 A;  4KPY A;  3AVM A;  2HBJ A;  4JS5 A;  3O3G A;  3N4Q A;  1YIJ N;  3O5B A;  4N56 A;  1SKS A;  3L2W A;  3FZL A;  3H6E A;  3HXM A;  4F9O A;  5GIN A;  2NRZ A;  1NJW A;  3MN6 A;  2PZS A;  3ZX2 A;  4ISF A;  3PX0 A;  3R6M A;  1VQ5 N;  1DT9 A;  4ELU A;  4BWJ A;  1HYZ A;  2BE2 A;  4B9N A;  2FLO A;  3IKM A;  1WAJ A;  4W5O A;  4OKK A;  1HKC A;  2F4V K;  2BGG A;  3L2U A;  2E88 A;  4OX9 K;  1ZBU A;  4BY9 C;  3H3N O;  2YKN A;  4DSK A;  4C1N K;  2XHB A;  3BEX A;  5F0X A;  4BVO A;  2ASP A;  4FWR A;  5KGW A;  1N34 K;  4R5P A;  1N6Q A;  2HBL A;  1Q86 O;  3NH1 A;  3THY B;  1Z26 A;  2W40 A;  3ISN C;  2D0C A;  3O9S A;  3U3Y A;  2V7Z A;  1Q7Y O;  4KB1 A;  3WQU A;  3TAB A;  3Q7B A;  3TAP A;  3D6R A;  1OH7 A;  1S5J A;  3MCP A;  5HRO A;  4FWO A;  3KHY A;  4YOY A;  1I94 K;  1ASV A;  1TKX A;  1YJN N;  5B8H A;  4CBX A;  1T3V A;  3IFR A;  3LP1 A;  1VQ6 N;  4DSE A;  3FE1 A;  4FYD A;  1HLU A;  4DFJ A;  4JNE A;  2VYP A;  4PQU A;  4CF1 A;  2O8E B;  3KKR A;  4WQ5 A;  3QES A;  4A5A A;  4BRQ A;  1IKV A;  3NF6 A;  4MFB A;  3KK2 A;  3OYM A;  4LFB K;  4CHZ A;  4CK1 A;  3OW2 M;  1NMD A;  2RKI A;  3J81 O;  1QZ5 A;  3HM8 A;  2UXB K;  4DV3 K;  1VQ4 N;  4Z4G A;  1X3M A;  3MN7 A;  1GLE G;  3ZSX A;  2CGL A;  4ILH A;  4BRD A;  3G6E N;  4FLX A;  5BPN A;  1BI4 A;  1ILY A;  4F4K A;  1DKG D;  4X64 K;  3PUF A;  5LL6 Z;  3DRR A;  2OPR A;  5C10 A;  3AVH A;  1DLO A;  4GKK K;  4YNQ A;  4BRM A;  4CJE A;  4CJK A;  4FLY A;  2PBD A;  1VSL A;  1RNH A;  3LDP A;  3SAG A;  4FSV A;  2OPS A;  4EHT A;  1HQE A;  4CJT A;  4GY2 B;  3ID8 A;  4DTX A;  1VQL N;  3VMF B;  2Q0R A;  1BCO A;  4FJ8 A;  4CJS A;  2IS3 A;  3IUC A;  5AQN A;  5CHI A;  1EO1 A;  2RHK A;  3BDP A;  1MDU B;  2HF3 A;  4JKH A;  3VF2 A;  2HMI A;  2IVP A;  4DG1 A;  3S3O A;  2HHW A;  1NKB A;  4J2A A;  4DV2 K;  4ICL A;  1QVF M;  4DHY A;  4CFD A;  3CCL N;  3C0B A;  5AQO A;  2E20 A;  3CCM N;  2VWK A;  3T1Y K;  4AM6 A;  1XMQ K;  4DF8 A;  1VHX A;  4LY7 A;  3GE1 A;  4NLB A;  2EX3 A;  4LH4 A;  1KFD A;  5BRH A;  5DK5 A;  1QQM A;  2Z1I A;  2YNG A;  3JSM A;  4CJW A;  1NKC A;  4JK8 A;  3TAE A;  1NJZ A;  4CJU A;  1W9H A;  3GBT A;  2GUP A;  5AQX A;  1HRH A;  3DLE A;  2G8U A;  3OYL A;  3DJC A;  4FVM A;  1NGG A;  2VG7 A;  4ISG A;  4R79 A;  1SQK A;  4KHY A;  4FJX A;  3ZEU A;  1XWL A;  1QVG M;  4DSI A;  3AVG A;  4M3X A;  4GV6 A;  4FM0 A;  1V4T A;  4DR5 K;  3R9P A;  4CEF A;  1RIL A;  3NCI A;  3VQQ A;  1ZBL A;  4Y0W A;  3ZET A;  4W5T A;  1P90 A;  4CJQ A;  3T7Z A;  3E66 A;  2XO7 A;  3K57 A;  3AAQ A;  3QER A;  1Q9X A;  2HHT A;  1NBW A;  4KFB A;  4IO8 A;  3EE9 A;  1L3V A;  2KKZ A;  2DFF A;  3ASM A;  4I2P A;  2YHA A;  3P38 A;  2ITM A;  2I7N A;  3ULD A;  5J2Q A;  1E3M A;  3CC4 N;  3EEQ A;  2HNZ A;  4EZ9 A;  5AZJ A;  4KH5 A;  4H0V B;  3VEW A;  4BAC A;  4LF6 K;  1C6V A;  2W6K A;  2YI1 A;  1KLM A;  3HT3 A;  3LDS A;  1XHX A;  1RFQ A;  2Q3S A;  3LP3 A;  5AQI A;  4DR2 K;  3EYZ A;  4FJN A;  4N47 A;  3QML A;  4AHC A;  2P9P B;  4BDZ A;  3CC2 N;  4BRL A;  2F9W A;  5AQR A;  4CW7 B;  3P83 D;  4B8C A;  4DSJ A;  5EXW A;  4B9Q A;  4B9M A;  3SZ2 A;  3JXU A;  1IBM K;  1SS6 A;  4FPA A;  4BC4 A;  3V4I A;  3SCX A;  4DS4 A;  2YNF A;  1KLN A;  4IXC A;  4H5T A;  5FPM A;  1Q8I A;  2FC0 A;  4M3T A;  3MCA B;  1U6Z A;  3VEN A;  1BIZ A;  2P9U A;  3WXJ A;  3RMA A;  5AQH A;  2NRT A;  3CMA N;  3OS2 A;  2YJE A;  4CE9 A;  1XUP O;  2A41 A;  4O5B A;  2J4R A;  3SUN A;  1X9W A;  4FWK A;  4YDU C;  3S41 A;  3OJU A;  3KK3 A;  2E2O A;  1BUP A;  2VQE K;  1VRT A;  2ZD1 A;  2E1Y A;  1C1C A;  5C25 A;  2JGU A;  3H46 O;  1KD1 O;  4KHP K;  3CER A;  4ID1 A;  1D9D A;  2H3G X;  1KVB A;  3E9O A;  3WUH A;  4B9S A;  2E1Z A;  4K25 A;  4E1M A;  4E7J A;  3O08 A;  3ITH A;  1RTJ A;  4O0J A;  1G15 A;  1TL1 A;  4BRH A;  3JYT A;  3G71 N;  3V9Z A;  3R8E A;  2G8V A;  3NH0 A;  2NRX A;  2ZWH A;  1LCU A;  3SUO A;  4M41 A;  3LL3 A;  1S22 A;  3SPZ A;  2B4J A;  3AA2 A;  3DOK A;  1ESV A;  5FPD A;  4WQ4 A;  2A6A A;  5GAG P;  4BRA A;  2KW4 A;  4IDH A;  3ID6 A;  3P39 A;  1SL1 A;  1N33 K;  4IZ9 A;  4OGC A;  1SKW A;  4JV5 K;  2FBX A;  3O9R A;  4BRK A;  1X1P A;  2GEL A;  1J9A A;  3OY9 A;  3I8B A;  3DLB A;  3CCJ N;  4F2R A;  1IJJ A;  2WTU A;  3ULE B;  1NGI A;  2AP1 A;  3P1G A;  3ULE A;  1OVY A;  3ZET B;  1ATN A;  2CH5 A;  1RDU A;  4YOX A;  5HP1 A;  3L4I A;  1UOC A;  3D2E A;  4BGB A;  4CEC A;  4DTS A;  1RDB A;  3M3Z A;  4QS8 A;  5AQY A;  1FK9 A;  1QHA A;  5CR4 A;  3VQ8 A;  1CXU A;  3HP9 A;  1YJW N;  4DTP A;  3A5O C;  4QS9 A;  3NGY A;  5CYQ A;  3A8Y A;  4YY3 K;  3NE6 A;  3QEV A;  3VA0 A;  1RT5 A;  4QCL A;  1FKP A;  3AO3 A;  5BPM A;  4JKA A;  1DGK N;  1VSI A;  1HYS A;  2HHX A;  1RDD A;  4KHN A;  1W0H A;  3C6A A;  3QEW A;  3THX A;  1R0A A;  4CD3 A;  1XC9 A;  2YV0 X;  4KI4 A;  5E84 A;  3JS6 A;  3SJJ A;  1B9D A;  3AO1 A;  3BGR A;  1OH5 A;  3BZC A;  1K8K B;  4JI1 K;  3M8S A;  2RF2 A;  2Z1G A;  4LSN A;  4JI7 K;  3CYM A;  5BRF A;  4DU4 A;  3TI0 A;  3L2V A;  3F73 A;  2HB5 A;  3EO3 A;  4FO0 A;  4OLA A;  3ZX3 A;  1XMO K;  2FF3 B;  2WBN A;  5JS2 A;  3SV4 A;  4O5F A;  1IKW A;  3QNN A;  5AQW A;  2NLX A;  4Q5V A;  1Q81 O;  2Z1J A;  3CCU N;  1KXP A;  4LH5 A;  4IFY A;  4FJK A;  4LF9 K;  2P9L B;  4KHS A;  2BTF A;  1NU0 A;  1B92 A;  2X6N A;  1J54 A;  3ZT2 A;  4CHO A;  2AA4 A;  1JXE A;  1KTQ A;  4RCH A;  3O1W A;  1JLE A;  2E2P A;  4O0I A;  1WNS A;  3OYJ A;  3NVM A;  1RT6 A;  2X74 A;  5I3U A;  1YTA A;  1A5X A;  1ITG A;  3V1R A;  1U4B A;  4E1N A;  3V1O A;  1VSJ A;  1KRP A;  3VEY A;  4FJM A;  1QQC A;  3OYE A;  4YOR A;  3RR7 A;  2F7T A;  4DQQ A;  1L3U A;  5LJV A;  2Q2R A;  1ZBI A;  4CZI A;  4I2Q A;  4FLV A;  2FBT A;  3TAN A;  3HPG A;  2UXD K;  1I39 A;  2Q36 A;  4WYB A;  3MMV A;  4M3W A;  1SL0 A;  3QFP A;  4RG8 A;  1WSG A;  4AF1 A;  4FJL A;  3LDQ A;  3CM6 A;  5AQM A;  4FL9 A;  2ZJP L;  3I0S A;  3HPH A;  4DU3 A;  5BN9 A;  2ZF5 O;  4DLG A;  4BDY A;  4CCH A;  3VQ7 A;  3AV9 A;  3LPT A;  2P51 A;  4A61 A;  3HZ6 A;  1BA0 A;  3VQ6 A;  1J5E K;  3CQX A;  3ZT3 A;  5GIO A;  1JLA A;  4DCH A;  4FW2 A;  4CBW A;  1K9M O;  3ENB A;  3AVC A;  4KH6 A;  4BQL A;  3UKR A;  3QO9 A;  3L3V A;  3RMD A;  2CGJ A;  3LZI A;  4RTF D;  3FZK A;  4FLZ A;  1TGO A;  3TWH A;  4IBN A;  1FKO A;  4BC2 A;  1JCF A;  2IC3 A;  4WQ5 C;  2FSJ A;  1XNR K;  3D7E O;  2XRI A;  4HVJ A;  4Z4I A;  3CCS N;  1T6C A;  3O8M A;  3HP6 A;  1XHZ A;  4HUE A;  4FWN A;  3AO4 A;  4I6M A;  3HST B;  4CHQ A;  4PL7 A;  1TKT A;  1YHQ N;  3FGU A;  3LDO A;  3OYB A;  4CI6 A;  1RBT A;  5KPZ A;  5BR8 K;  4IG3 A;  3AVF A;  3G0Z A;  4CHP A;  3J7Y P;  4PWD A;  1FW6 A;  2ASM A;  3T1A A;  2X78 A;  3WNF A;  1LWE A;  5ADX A;  4CFB A;  3KIO A;  3E1Y A;  5J2M A;  3V9S A;  1L3T A;  4FW1 A;  1TV6 A;  2P9U B;  1SKR A;  4FOE A;  5GAE P;  3ZSO A;  3C6T A;  1EXQ A;  3E9P A;  4Z0U A;  2P9I B;  1HX1 A;  4HTL A;  4HTU A;  2P9I A;  4M3U A;  1RDC A;  3H08 A;  4DTR A;  5BRE A;  3MWT A;  2HHQ A;  4A59 A;  3LDL A;  3MWP A;  4AHS A;  4DQP A;  4WE1 A;  4CES A;  2ATQ A;  3QEX A;  3IDH A;  1VQ8 N;  2VGM A;  2E6L A;  1X3N A;  2QM1 A;  1NJY A;  3H1Q A;  3L4Q A;  4CVN E;  4DFM A;  2QTD A;  1BL3 A;  3AAP A;  1WSI A;  1T7P A;  5HRN A;  4BC5 A;  1RT3 A;  3SYZ A;  2O8F B;  4FLW A;  3AO2 A;  4FZX C;  4JD2 A;  2E2Q A;  2QKK A;  1NGF A;  2B6A A;  3F5T A;  4DV5 K;  4DB3 A;  3HVR A;  2PYL A;  5EU7 A;  3EE8 A;  5AQV A;  3HJF A;  2V52 B;  3VET A;  4BC3 A;  1EX4 A;  3K5N A;  4FPB A;  5M1N A;  2PFU A;  4FJ9 A;  4DTM A;  4K8Z A;  3EKU A;  5KRS A;  2QWO A;  1NGH A;  4BR7 A;  3AVJ A;  4BR2 A;  3A5M C;  4KTZ A;  3WXM B;  2LSN A;  3MXJ A;  3AO5 A;  2O8E A;  3HTV A;  3TAR A;  1S1T A;  1SZ2 A;  3NF7 A;  1DTT A;  4C8K A;  5KQ8 A;  2OZM A;  3UKR B;  1X9J A;  4XEI A;  3KJV A;  3FZF A;  2A1R A;  1T05 A;  3ZSY A;  2QK9 A;  3AVB A;  1ZYQ A;  3K2P A;  3VQ4 A;  4CZH A;  4GV3 A;  4EAH D;  2IOC A;  5TKW A;  2A40 A;  4IOC L;  3KKS A;  3VTI A;  1ATR A;  2KLA A;  3ZT1 A;  3MX5 A;  3S3M A;  4X65 K;  1KVA A;  5C42 A;  1ZBH A;  5DMR A;  4ISE A;  3B8A X;  1IG8 A;  4HWI A;  1Y97 A;  4FLU A;  1MA9 B;  2FXU A;  4KRF A;  1VSM A;  3KVG A;  2O8D A;  4NO7 A;  5LJW A;  1BGX T;  3K9K A;  2W6L A;  4B3M K;  3CJ7 A;  1QE1 A;  4E3S A;  3NHG A;  3ZSZ A;  3KLG A;  3ZX0 A;  3VF4 A;  1HQU A;  2G8I A;  4IEE A;  2PAV A;  5C2F A;  3G4S N;  3DXK A;  1IBL K;  3QBX A;  3BF3 A;  3M8Q A;  1C0T A;  1ZBS A;  2VG6 A;  4M3R A;  3ZSV A;  3MN9 A;  3SBG A;  1W2B M;  4WFB L;  1VQM N;  2A42 A;  1GLB G;  4HUF A;  2P9S A;  1JKH A;  4RW7 A;  3WEE A;  1BIS A;  1NGD A;  2BAN A;  1VSF A;  3AVN A;  3DXM B;  5I9E B;  4IOA L;  4AHU A;  4IOX A;  3I33 A;  1RTH A;  2D0A A;  3QIN A;  4KAZ A;  3LP2 A;  2P1J A;  4PY5 A;  4DU1 A;  4KH4 A;  2ETJ A;  4H4O A;  2Q1N A;  3CET A;  2W41 A;  5JLF A;  1RT4 A;  4NLC A;  4I9Q A;  4V19 S;  3NFA A;  3KWI A;  2WC9 A;  5EOY A;  1KSP A;  2O4I A;  2OZS A;  4M42 A;  2VCP A;  1HJO A;  1SUQ A;  3ZSR A;  2OPP A;  1IKY A;  4B1Y B;  5GAD P;  4OGE A;  3GG4 A;  4LFC K;  2JWL A;  4XH1 A;  1KCF A;  4MO5 A;  3U8X A;  5SZT A;  5BRD A;  3HYF A;  4CGH A;  5AZI B;  5AQP A;  4IKF A;  2VWB A;  4OVL A;  4BRE A;  2DTU A;  4U67 L;  5JMV A;  5AQG A;  2NZT A;  3CM5 A;  1VRU A;  3CC7 N;  2CH6 A;  3U9Z A;  2KFN A;  3S9H A;  4C23 A;  3PV8 A;  3P4I A;  4GVE A;  4CED A;  3AAR A;  2QEX N;  4JS4 A;  3WNE A;  3DWL A;  4FM2 A;  4A2A A;  1JLG A;  4A57 A;  1VQ7 N;  3RRG A;  1TAU A;  3F2K A;  3CF5 L;  3THW A;  4K8X A;  2KFZ A;  5KRT A;  1D8Y A;  3CFP A;  4FCY A;  4C8O A;  4WF9 L;  4IFE A;  5CE3 A;  4A62 A;  3CPE A;  5J2N A;  4KO0 A;  1VQN N;  3ATU A;  1RTD A;  1H1V A;  4HCC A;  4YOU A;  5EVZ A;  1KVC A;  2IVN A;  1C0U A;  4DTU A;  2F9T A;  2HHV A;  3NGI A;  3O3F A;  2GUI A;  4JI4 K;  2YX6 A;  5AR0 A;  5EX5 A;  4NYF A;  4CGF A;  4C8M A;  4E7K A;  1F21 A;  4WFN L;  2HST A;  2QWN A;  1WLJ A;  2QWM A;  4HHT A;  3CFR A;  4CIG A;  3I55 N;  3C7N A;  1HNV A;  4Y1D A;  4JI5 K;  3RMC A;  4CZF A;  3EN9 A;  4B3S K;  1M1K O;  1M90 O;  5JS1 A;  1N32 K;  2RN2 A;  3MED A;  4B9L A;  2GTD A;  3AVK A;  2E2N A;  1NM1 A;  1YAG A;  2D5R A;  3VQA A;  4JI6 K;  1OH8 A;  2P9K A;  2YNH A;  5FRM A;  1S1W A;  1WBD A;  1O1W A;  2Q31 A;  3L3U A;  4CZJ A;  5DM7 L;  4M7Y A;  4JI2 K;  2IAJ A;  5HBM A;  3VEO A;  5J1E A;  1U48 A;  4DKW A;  3PX4 A;  1QZ6 A;  2GBZ A;  3MEG A;  1XNQ K;  1MU2 A;  4JKE A;  5AZJ B;  2V7Y A;  4JN4 A;  4W5R A;  5CY4 A;  3CHW A;  3IAY A;  2X6S A;  3TAQ A;  1TAQ A;  3MXI A;  4N76 A;  1RBV A;  4PA1 A;  3AA5 X;  1HR0 K;  3EKS A;  3HVT A;  2QXF A;  3L6Q A;  3VER A;  4J2B A;  2QI2 A;  4NXM K;  2P9N A;  4CBU A;  3KLE A;  3VGK A;  4W5N A;  4CEB A;  3TR8 A;  4JYA K;  1KC8 O;  2D0P A;  1BG3 A;  4CEQ A;  4JI3 K;  1HPM A;  3KK1 A;  4C1N I;  3JAM O;  2RPI A;  3CQY A;  3DM2 A;  1JL1 A;  1QHT A;  3J7A P;  4FWM A;  2UUB K;  4JI8 K;  3TSU A;  2OAN A;  5JVG L;  4H4M A;  3SNN A;  4A5B A;  4ZHR A;  1GOC A;  3CD6 N;  1RBU A;  2RE2 A;  4DWI A;  4Z4C A;  3VQ9 A;  2YCH A;  3CIP A;  4K41 A;  4HCB A;  3O1B A;  3CI5 A;  1GLL O;  2VGN A;  1RT2 A;  4DQR A;  2O8B A;  1GLD G;  4BRN A;  3VQD A;  3UE5 A;  1D5A A;  4PKI A;  4EZ6 A;  3HL8 A;  1HYV A;  4Z94 A;  3O9Q A;  3M8P A;  5FRN A;  1I3A A;  3O4W A;  3M5R A;  1K73 O;  1BQM A;  4B9V A;  3THY A;  5LY3 A;  3L0Q A;  4MDB A;  4BG8 A;  5HRS A;  4B9U A;  3RR8 A;  4NXN K;  1IG9 A;  3A2F A;  2QA4 N;  3ATV A;  5KPR A;  1S72 N;  5AQQ A;  2P9N B;  2UU9 K;  3F9M A;  3M8R A;  3LPU A;  3SK3 A;  3O9U A;  3O9T A;  2ZJQ L;  3IG1 A;  3RRH A;  3CJ9 A;  4FVU A;  4OPJ A;  1RDA A;  3DAW A;  2KTQ A;  4KRE A;  3RMB A;  5C0Y A;  1TK5 A;  5EY4 A;  3T19 A;  3HRG A;  3CCE N;  2EWS A;  3QDK A;  4N5S A;  2UUC K;  1TK8 A;  5IWA K;  4CK2 A;  1LV5 A;  1VK0 A;  2BH1 A;  2HMP A;  5T7B A;  2KZZ A;  4AQY K;  4JKF A;  4DTN A;  1NJX A;  5AQU A;  5C15 A;  4OO1 J;  2HND A;  1KAY A;  1YF5 L;  1RT7 A;  4BR4 A;  3M6G A;  4MDA A;  3QIC A;  1KAZ A;  2KZM A;  2OPQ A;  4PL8 A;  4DSF A;  4CF9 A;  1TKZ A;  4DV0 K;  3U6F A;  3G25 A;  4QAG A;  4RW4 A;  4FZZ A;  4E89 A;  4YOW A;  4DR7 K;  4FOI A;  4FJ5 A;  1IV0 A;  3MAQ A;  4E1J A;  4EFH A;  4E7H A;  2ZJR L;  4FWS A;  4UY8 O;  1U45 A;  3U4L A;  4G9Z A;  1J5O A;  1QSY A;  3B6P A;  4H5W A;  4B1U B;  3UKU A;  4IWV A;  2YNI A;  2GWJ A;  3WXL A;  4CJL A;  2VWJ A;  4B1V A;  2HBM A;  5C2D A;  4OLB A;  2P9S B;  4FXD A;  4CEE A;  3LAL A;  1R59 O;  3QFU A;  4PUO A;  2P9K B;  3FFI A;  3K59 A;  3LAK A;  3VTH A;  1UA1 A;  3W0L A;  2F96 A;  2ZGZ A;  1BCM A;  2YHB A;  3VEX A;  2UUA K;  5F2R A;  4XH4 A;  1KAX A;  1EQY A; 
#chains in the Genus database with same CATH homology
 3CJ1 A;  3VET A;  3H45 C;  4H0Y B;  4YDU A;  1Y64 A;  3BP8 A;  3GE1 A;  4NLB A;  4BC3 A;  4FPB A;  5M1N A;  3KK7 A;  4AM7 A;  2PFU A;  2QWP A;  5BRH A;  3HOT A;  1QQM A;  2YHW A;  2NNW A;  3EKU A;  2QWO A;  1NGH A;  3NVK A;  3AY9 A;  4BR7 A;  4BR2 A;  3A5M C;  3WXM B;  1KQS M;  1W97 L;  4JK8 A;  3VGM A;  3VPZ A;  3GBT A;  3HTV A;  1SZ2 A;  2GUP A;  4CZM A;  2Q97 A;  3SLC A;  5AQX A;  3SMP A;  5AQL A;  5KQ8 A;  3DJC A;  1YI2 N;  1NGG A;  3SMS A;  3UKR B;  3WQT A;  1VQP N;  3E9L A;  4ISG A;  3OBY A;  1N8R O;  4H0O A;  4R79 A;  1X9J A;  3FR0 A;  4XEI A;  4OPA A;  1SQK A;  4NB4 A;  1NGJ A;  3FZF A;  3ZEU A;  2FF6 A;  1QVG M;  4GV6 A;  2OTJ N;  1NGE A;  1V4T A;  4JK9 A;  3SAF A;  3R9P A;  3GDQ A;  1TUU A;  5FPN A;  1BDG A;  1WUA A;  4Y0W A;  3ZET A;  4CZH A;  4GV3 A;  1P90 A;  4EAH D;  3T7Z A;  2YHY A;  3E66 A;  5TKW A;  5C12 A;  2A40 A;  4IOC L;  3AAQ A;  1ATR A;  3VTI A;  4JKB A;  1NBW A;  1JCG A;  2KLA A;  4IO8 A;  3EE9 A;  4CD1 A;  3MX5 A;  2KKZ A;  2E8A A;  3P38 A;  2UYT A;  4ISE A;  2ITM A;  3AGR A;  3B8A X;  1IG8 A;  2I7N A;  4HWI A;  4BRI A;  1MA9 B;  2FXU A;  3CC4 N;  3KVG A;  3WXK A;  4A2B A;  4K43 A;  2IVO A;  4NO7 A;  5LJW A;  3K9K A;  4GV9 A;  1VQK N;  3RSE A;  5AZJ A;  3CJ7 A;  4KH5 A;  4H0V B;  4JAX A;  4YOV A;  4BR0 A;  3VEW A;  2NRR A;  3ZX0 A;  4J8F A;  3VF4 A;  5BN8 A;  3OHR A;  4IEE A;  2PAV A;  5C2F A;  2YI1 A;  3G4S N;  4JEP A;  4EIA A;  3DXK A;  1OKJ A;  1T6D A;  3H1V X;  3QBX A;  1S3X A;  3BF3 A;  1RFQ A;  1ZBS A;  5AQI A;  1C0G A;  3M1F A;  3GOI A;  3WEE B;  3CCR N;  3MN9 A;  2P9L A;  3BF1 A;  3QML A;  3SBG A;  4WFB L;  1W2B M;  1U2V A;  2A42 A;  1Z6R A;  4XH5 A;  2GWK A;  1VQM N;  1GLB G;  2P9P B;  2HOE A;  4FWQ A;  4YOT A;  3CC2 N;  2P9S A;  4BRL A;  3WEE A;  2F9W A;  1NGD A;  5AFU H;  5AQR A;  3DXM B;  5I9E B;  4IOA L;  3J7Z O;  4IOX A;  2BUP A;  5EXW A;  4B9Q A;  3CCV N;  3I33 A;  3JXU A;  1NGC A;  3HSC A;  3CJA A;  3UKU B;  1SS6 A;  4FPA A;  4BC4 A;  4KBO A;  4K42 A;  4KH4 A;  4IXC A;  4H5T A;  1BWF O;  5AQT A;  2Q0U A;  5FPM A;  4B1Z A;  4WCE L;  5BR9 A;  3MCA B;  1U6Z A;  2NRV A;  3VEN A;  2Q1N A;  5ELZ A;  3CET A;  4QS7 A;  2P9U A;  2W41 A;  3WXJ A;  4NLC A;  5AQH A;  5JLF A;  2NRT A;  3CMA N;  4BR5 A;  2YJE A;  1XUP O;  2DPN A;  2KHO A;  2A41 A;  3KWI A;  2WC9 A;  2J4R A;  5EOY A;  2HF4 A;  4FWK A;  3ENO A;  2D1K A;  4YDU C;  3S41 A;  3WT0 A;  3WXI A;  3CME N;  1DEJ A;  2VCP A;  3VEV A;  1HJO A;  2E2O A;  4B1Y B;  5M1P A;  5GAD P;  1BUP A;  1HKB A;  3GG4 A;  3MN5 A;  3O80 A;  2E1Y A;  2JWL A;  4FWP A;  4JKG A;  4XH1 A;  3H46 O;  3TSQ A;  4H5N A;  1KD1 O;  4MO5 A;  3U8X A;  4JHD B;  1J6Z A;  2GX9 A;  4M7X A;  3LDN A;  3CER A;  4B1W B;  5BRD A;  3PIO L;  3HOS A;  2H3G X;  3E9O A;  3WUH A;  5AZI B;  2E1Z A;  5AQP A;  2VWB A;  3ZEU B;  4K25 A;  5AQK A;  4BRE A;  4FWL A;  4U67 L;  3P31 A;  5JMV A;  5AQG A;  3CXC M;  2NZT A;  1Z05 A;  3ENH A;  3O08 A;  1V4S A;  2HBK A;  1XC3 A;  3CC7 N;  5M1F A;  4BRH A;  3G71 N;  5AQZ A;  3R8E A;  2CH6 A;  3U9Z A;  2A5X A;  1GLA G;  3C6H A;  2NRX A;  2ZWH A;  4C23 A;  1LCU A;  3P4I A;  4GVE A;  3AAR A;  4BR9 A;  3LL3 A;  2QEX N;  1S22 A;  3MDQ A;  3HBT A;  1LOT B;  3DWL A;  4PHT X;  1E4F T;  3AGK A;  4A2A A;  3LM9 A;  4A57 A;  1VQ7 N;  4IJA A;  1K8A O;  2I7P A;  3FZM A;  2NRW A;  1ESV A;  3F2K A;  5FPD A;  4WQ4 A;  2A6A A;  3QB0 A;  4JD2 B;  4JKC A;  4BRA A;  2ZGY A;  4CJ7 A;  5GAG P;  4IDH A;  4O8K A;  3CF5 L;  3ID6 A;  3QBW A;  3P39 A;  4IZ9 A;  4WF9 L;  4IFE A;  1O13 A;  3O9R A;  4BRK A;  4A62 A;  5CE3 A;  1G99 A;  3CPE A;  4BVP A;  1VQN N;  2GEL A;  3SAH A;  3ATU A;  3HI0 A;  1H1V A;  5M1O A;  3H3O B;  3I8B A;  4YOU A;  5EVZ A;  5JLH A;  2IVN A;  3SJH A;  3CJC A;  3BUZ B;  3CCJ N;  2F9T A;  1IJJ A;  3ULE B;  4JK7 A;  1NGI A;  2AP1 A;  4GNI A;  3UB5 A;  1GLF O;  3ULE A;  5HL7 L;  1OVY A;  3D2E B;  3ZET B;  3TTF A;  1ATN A;  2CH5 A;  1RDU A;  5KQD A;  4YOX A;  2YX6 A;  1ZC6 A;  2D0O A;  3L4I A;  4H0X B;  5AR0 A;  4IO9 L;  5EX5 A;  5AQF A;  2QWL A;  5M1Q A;  3D2E A;  4IEI A;  4BQZ A;  3Q7C A;  4BGB A;  5FPE A;  3C65 A;  2FSK A;  4WFN L;  3M3Z A;  5MLC Q;  2HST A;  4QS8 A;  2QWN A;  1BA1 A;  5AQY A;  2QWM A;  3TTD A;  1QHA A;  3EL2 A;  5CR4 A;  1YJW N;  3I55 N;  3C7N A;  3A5O C;  1K8K A;  4QS9 A;  4CZF A;  2D4W A;  3DLL L;  5HOO A;  2FSN A;  1MWK A;  1TYQ B;  3A8Y A;  5AZI A;  3RSE B;  4BRF A;  3EN9 A;  3VF6 A;  1M1K O;  1M90 O;  4MO4 A;  5ADX H;  3IMX A;  3VES A;  5BPM A;  1YXQ A;  1DGK N;  3DXK B;  4JKA A;  1YUW A;  2GTD A;  1NGB A;  2E2N A;  1BU6 O;  2JWK A;  1NM1 A;  3CCQ N;  3R1X A;  4PKG A;  3C6A A;  1YAG A;  3SBT A;  2P9K A;  1VQ9 N;  4BRC A;  4CD3 A;  1Q82 O;  3TSP A;  1BOT O;  5JVH L;  2Q31 A;  3I56 N;  4BRG A;  1RGI A;  4CZJ A;  3MX2 A;  5E84 A;  5DM7 L;  3JS6 A;  1CZA N;  4WFA L;  4M7Y A;  3RVC A;  1TYQ A;  1T44 A;  1QQO A;  5M1K A;  3VEO A;  5GAH P;  4MLE A;  3KZB A;  4LC9 B;  1K8K B;  4PKH A;  4CZE A;  4DKW A;  2CGK A;  2V51 B;  4BRO A;  5DM6 L;  1GLC G;  3VEZ A;  1QZ6 A;  1Q18 A;  5AQJ A;  5BRF A;  4ILG B;  3FLC O;  4JKE A;  5AZJ B;  1RDW X;  3EO3 A;  2V7Y A;  4FO0 A;  4JN4 A;  4MLH A;  3KWG A;  3ZX3 A;  1P8Z A;  3CHW A;  4CZG A;  2FF3 B;  2WBN A;  4CZK A;  3R3L A;  4O5F A;  5AQW A;  3A0I X;  5JIC A;  2NLX A;  1QQN A;  1VAZ A;  1JJ2 M;  3VGL A;  1Q81 O;  3CCU N;  1KXP A;  3EKS A;  4BGA A;  1HUX A;  4H5V A;  2GEM A;  4JHD A;  5BPL A;  3VER A;  3L6Q A;  2P9L B;  2BTF A;  4H5R A;  2QI2 A;  4U7B A;  2P9N A;  2A3Z A;  4DQ8 A;  4CBU A;  4WQ4 C;  3VGK A;  2YHX A;  1KC8 O;  2D0P A;  2HBJ A;  1BG3 A;  3DXM A;  1HPM A;  3EZW A;  2AA4 A;  2QW9 A;  3N4Q A;  4C1N I;  1YIJ N;  3O5B A;  2OTL N;  3CQY A;  4RCH A;  2NRH A;  3O1W A;  5AQS A;  1NWK A;  4FWM A;  2E2P A;  3FZL A;  1YJ9 N;  1NJI O;  3TSU A;  3NVM A;  2OAN A;  5JVG L;  3D2F B;  3H6E A;  4F9O A;  1U2V B;  2NRZ A;  5GIN A;  3MN6 A;  4I6M B;  4A5B A;  2ASO A;  2WUS A;  3VEY A;  3CD6 N;  2RE2 A;  4YOR A;  3ZX2 A;  2YCH A;  2F7T A;  3CIP A;  3ZYY X;  4ISF A;  4K41 A;  3R6M A;  5LJV A;  2Q2R A;  1VQ5 N;  1DT9 A;  3O1B A;  4CZI A;  3CI5 A;  1GLL O;  5TKY A;  2FLO A;  2VGN A;  3IKM A;  1HKC A;  4WYB A;  2Q36 A;  3MMV A;  2E88 A;  3PIP L;  1GLD G;  2QXL A;  3QFP A;  4BRN A;  3LM2 A;  4BY9 C;  3H3N O;  4AF1 A;  3UE5 A;  4PKI A;  4B1X B;  3LDQ A;  5AQM A;  1XQS C;  4FL9 A;  2ZJP L;  4Z94 A;  1D4X A;  3O9Q A;  5H1S Q;  4C1N K;  1GLJ O;  2ZF5 O;  5BN9 A;  3BEX A;  5F0X A;  3W3D A;  3O4W A;  4BVO A;  3M5R A;  1K73 O;  2ASP A;  4A61 A;  4FWR A;  3L0Q A;  4MDB A;  3HZ6 A;  4BG8 A;  1BA0 A;  5LY3 A;  1HKG A;  3ATV A;  3VOV A;  3CQX A;  3CJB A;  5KPR A;  5GIO A;  2QA4 N;  1S72 N;  3PLA A;  2HBL A;  4EHU A;  1Q86 O;  5AQQ A;  2W40 A;  4DCH A;  4JKG B;  2P9N B;  3F9M A;  3A5L C;  4CBW A;  1K9M O;  5KPT A;  4H0T B;  3O9S A;  3MK6 A;  2V7Z A;  4H03 B;  3SK3 A;  1Q7Y O;  3ENB A;  3OBW A;  4KH6 A;  3WQU A;  5E26 A;  4BQL A;  3Q7B A;  3UKR A;  3D6R A;  3O9U A;  1ZXO A;  3O9T A;  2ZJQ L;  3MCP A;  2CGJ A;  4FWO A;  3CJ9 A;  3FZK A;  3KHY A;  4O8U A;  4RTF D;  3TPQ A;  4YOY A;  3CPW M;  4FVU A;  1YJN N;  5B8H A;  3J8A A;  1T3V A;  3DAW A;  3IFR A;  4M63 C;  3TTC A;  1JCF A;  4BC2 A;  4CBX A;  1VQ6 N;  5AFU A;  4WQ5 C;  3GL1 A;  2FSJ A;  3FE1 A;  5C0Y A;  3D7E O;  1HLU A;  1YVN A;  3CCS N;  1T6C A;  2VYP A;  3O8M A;  3FZH A;  4JNE A;  5EY4 A;  4FWN A;  4RWT A;  1VQO N;  4WQ5 A;  3HRG A;  3K9J A;  5GIP A;  3CCE N;  4A5A A;  4I6M A;  4BRQ A;  2EWS A;  4PL7 A;  1YHQ N;  3FGU A;  3LDO A;  3QDK A;  4H0P A;  1TUY A;  4CI6 A;  3C7N B;  5KPZ A;  4IJN A;  3OW2 M;  1NMD A;  2BH1 A;  3FFK B;  2HMP A;  1QZ5 A;  3A5N C;  3HM8 A;  4JKF A;  1VQ4 N;  1WOQ A;  2ASM A;  3OA9 A;  5AQU A;  5C15 A;  5ADX A;  4OO1 J;  1X3M A;  1KAY A;  3MN7 A;  1GLE G;  1YF5 L;  4OPH A;  3E1Y A;  4BR4 A;  2CGL A;  3M6G A;  4BG9 A;  4ILH A;  3QIC A;  4MDA A;  1KAZ A;  1MWM A;  4BRD A;  4CZL A;  5BPN A;  4PL8 A;  3G6E N;  1ILY A;  2P9U B;  1DKG D;  4FOE A;  5GAE P;  3G25 A;  5F1X A;  1ATS A;  5C10 A;  4YOW A;  3E9P A;  4BRM A;  4FOI A;  2P9I B;  1HX1 A;  4HTL A;  2P9I A;  4E1J A;  4EFH A;  2PBD A;  2ZJR L;  4FWS A;  3O6W A;  4UY8 O;  5BRE A;  3LDP A;  3SAG A;  3MWT A;  2WFB A;  4FSV A;  4A59 A;  4BRP A;  3U4L A;  3NMU A;  4EHT A;  1NGA A;  3LDL A;  3MWP A;  2QWQ A;  3N4P A;  4GY2 B;  3ID8 A;  4G9Z A;  1VQL N;  3IDH A;  3VMF B;  2IIR A;  2Q0R A;  1VQ8 N;  2VGM A;  1X3N A;  2QM1 A;  3H1Q A;  3IUC A;  3L4Q A;  5AQN A;  4H5W A;  5CHI A;  2RHK A;  1EO1 A;  4B1U B;  3UKU A;  4IWV A;  1MDU B;  4JKD A;  2QTD A;  3AAP A;  2GWJ A;  2HF3 A;  4JKH A;  3VF2 A;  3WXL A;  1NLV A;  4B1V A;  1JCE A;  2IVP A;  2HBM A;  5C2D A;  2P9S B;  4BC5 A;  1QVF M;  4DHY A;  2QWR A;  3CCL N;  1R59 O;  2P9P A;  4ILJ A;  3QFU A;  2P9K B;  3C0B A;  3TU5 A;  3T69 A;  5AQO A;  4JD2 A;  2E2Q A;  2E20 A;  4L3Q A;  1NGF A;  3VTH A;  3F5T A;  3CCM N;  3W0L A;  3D2F A;  2ZGZ A;  1C0F A;  3U9D A;  4DB3 A;  4AM6 A;  1SAZ A;  1BO5 O;  2YJF A;  3VEX A;  1YIT N;  3EE8 A;  1E4G T;  5F2R A;  4XH4 A;  5AQV A;  1KAX A;  1EQY A;  2V52 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...