2FSNA

Crystal structure of ta0583, an archaeal actin homolog, complex with adp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
325
structure length
310
Chain Sequence
MVVVGLDVGYGDTKVIGVDGKRIIFPSRWAVTIPVLSTDGGQTKFIYGKYASGNNIRVPQGDGRLASKEAFPLIAAALWESGIHVDLVIGSGTPLGTFDLEVKAAKEALENKVLTVTGPEGEVRQFNITRLIMRPQGVGAALYLLNQGIIEQQPGYGVVIDVGSRTTDVLTINLMDMEPVVELSFSLQIGVGDAISALSRKIAKETGFVVPFDLAQEALSHPVMFRQKQVGGPEVSGPILEDLANRIIENIRLNLRGEVDRVTSLIPVGGGSNLIGDRFEEIAPGTLVKIKPEDLQFANALGYRDAAERS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords hypothetical protein Ta0583
publication title Crystal structure of an archaeal actin homolog
pubmed doi rcsb
source organism Thermoplasma acidophilum
total genus 71
structure length 310
sequence length 325
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17989 ALP_N Actin like proteins N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2fsnA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2fsnA01
3CJ1A 5BPNA 1HLUA 3JS6A 2I7PA 4IJAA 3VF6A 2Q0RA 4ISGA 3WEEA 2W41A 4CJ7A 4RWTA 2UYTA 2D4WA 3MK6A 3SMSA 2GELA 3MDQA 2CH5A 4BGBA 3FZFA 3P4IA 1SAZA 4M7XA 5LY3A 3HSCA 4DCHA 1D4XA 2P9IB 1NBWA 4H0PA 2YJEA 3D2FA 3VENA 3WXJA 4BR5A 4JHDA 3UE5A 3C0BA 1QZ6A 4H5WA 1NGDA 3RSEA 4FPBA 3ZETB 3ZX0A 3ULEB 5AQQA 1KXPA 3WXIA 4BR4A 1BOTO 4M7YA 2P9LA 5LJWA 3WUHA 3LDQA 2P9UA 3C7NB 1DGKN 4GY2B 4CZLA 2CGKA 4A61A 3EO3A 4LC9B 1NMDA 2D0PA 1RFQA 4IO8A 1OKJA 2E1YA 1GLBG 1YAGA 5AQWA 3VEXA 1QHAA 1V4SA 4EIAA 3GE1A 1MWMA 5AR0A 3QBWA 4PKIA 4BR9A 2F9TA 3FZHA 4I6MA 3BP8A 4FOIA 2PBDA 4IXCA 3A5MC 2W40A 3IDHA 4CZFA 4H0XB 3WEEB 2QXLA 2FLOA 3CJCA 1Q18A 3R6MA 4EHUA 3QICA 1BA0A 3LDOA 3AAQA 1ATSA 1Z6RA 4H03B 1EQYA 1NGGA 4BRHA 3MN5A 4BRMA 1T6DA 2FF6A 1NGIA 5AQJA 2DPNA 4FPAA 3FZMA 3FZLA 2A6AA 3QFPA 3QB0A 4Z94A 2E88A 4XH1A 1HJOA 3RSEB 2Q31A 4H0VB 2NZTA 1HKGA 1GLEG 4H5TA 1BA1A 1E4GT 1JCFA 5ELZA 4Y0WA 3IFRA 2P9LB 2IIRA 5AQOA 3VGKA 1X3NA 4JN4A 2P9UB 3ENOA 3ID8A 3DWLA 2GEMA 3KZBA 4NO7A 5AFUA 3H3NO 3UKUB 4BR2A 3VGMA 5AQPA 1LOTB 4BRFA 2A41A 2F9WA 2Q1NA 1LCUA 1C0GA 4I6MB 5AQZA 3O8MA 5E26A 1ZBSA 1QQOA 3ATVA 2QWLA 4B1UB 3VESA 4FWKA 5JICA 3WXLA 1NM1A 2CH6A 3M1FA 2CGJA 4C23A 3VEVA 5CE3A 4CI6A 5AQVA 3SJHA 1KAZA 3BF3A 2QW9A 4PKHA 5AQLA 1BO5O 3B8AX 1DKGD 2FSKA 5BRHA 5ADXA 2QM1A 1QQNA 4FWPA 1BG3A 2ASOA 4DB3A 5TKYA 2ASMA 1GLJO 2P9NA 1WUAA 3EZWA 2NRHA 4FWOA 2I7NA 1GLDG 3DXMA 3ZEUA 4WYBA 1T6CA 3ENHA 3U9ZA 2P9KB 3HBTA 1ESVA 4FSVA 2AP1A 3SK3A 5AQRA 1HPMA 1NGHA 1KAXA 1BU6O 3LL3A 3D7EO 2AA4A 1NGCA 2ZGYA 4EFHA 3BEXA 2P9PA 4HWIA 1K8KA 4CZEA 4KBOA 4B1VA 2VCPA 4BGAA 3CHWA 5AQXA 5AQUA 2P9SB 3U9DA 3DXKA 3BF1A 4FWRA 1HUXA 4FWSA 3GOIA 3L0QA 3O5BA 3VEZA 3MN9A 5EVZA 5BN9A 3O80A 2GWKA 3EL2A 4O5FA 4XEIA 4JD2B 3LDPA 4FWLA 3CJ7A 4M63C 3CETA 2ITMA 2BTFA 3A5OC 4H5NA 2PAVA 3S41A 1IG8A 5KQ8A 2P9NB 4AM7A 3G25A 2FSJA 3BUZB 2KHOA 2E2NA 3FR0A 5KPZA 4BRGA 3DXMB 3ZEUB 3WQTA 4BRAA 1V4TA 2Q36A 5KPRA 4BC4A 4PL7A 3DJCA 2Q2RA 5BRDA 3FFKB 4K42A 5BPLA 4J8FA 4GNIA 4YDUC 1MDUB 3ZX3A 1TYQA 3GDQA 1ZXOA 3QMLA 4H0YB 1YUWA 4ISFA 4BRQA 4BRIA 3A8YA 2E20A 1K8KB 2E8AA 3D2FB 4WQ5C 5JLHA 4JHDB 4CD3A 4CZHA 5AZJA 5EX5A 5AQNA 3H45C 4FWMA 4BRKA 2YJFA 4CZIA 3DXKB 2H3GX 1QQMA 3EN9A 3VETA 5LJVA 3O1BA 3LDNA 3ATUA 3VEWA 1H1VA 2QWQA 5AZIA 1HX1A 1U2VA 5JMVA 2EWSA 3IMXA 1RDWX 1X3MA 4K41A 4RCHA 4A62A 1X9JA 3VPZA 4BQLA 3GL1A 1GLLO 1HKBA 3JXUA 3R8EA 2FXUA 4BROA 5FPNA 1XC3A 3DAWA 3L4IA 5I9EB 4BVPA 3HI0A 5FPDA 3FGUA 1U6ZA 1NWKA 3QBXA 3O08A 5AQHA 1YVNA 5B8HA 3L6QA 4FWQA 3H1VX 4AM6A 4K43A 2YHWA 3H1QA 2NLXA 4IJNA 5AFUH 3M3ZA 3O1WA 2HF4A 2FSNA 4RTFD 4QS7A 2J4RA 5BN8A 3SLCA 2P9IA 4B1YB 4O8KA 2V7ZA 2A3ZA 1E4FT 1RGIA 4CZGA 2V52B 1TYQB 1YXQA 4B1ZA 1TUYA 4H5VA 4EAHD 1J6ZA 1MWKA 3AARA 3CQXA 4MLHA 3HZ6A 3LM9A 4H0OA 5AZJB 2VYPA 1R59O 3TU5A 3CJBA 3FZKA 4ISEA 4CBWA 1S22A 2VWBA 1GLCG 3H6EA 3GG4A 4PKGA 4YDUA 5AQKA 4BR0A 4DQ8A 2ZF5O 5AZIB 1XUPO 5ADXH 3KHYA 4PL8A 4MO5A 1GLFO 2D1KA 3D2EA 3UKRA 4BG8A 5KPTA 4JNEA 5AQIA 3FLCO 2YHXA 4FOEA 4WQ5A 4F9OA 4CZKA 5FPMA 1MA9B 5AQMA 3W3DA 4FWNA 3MN7A 3VEOA 2E2QA 4XH5A 1DEJA 1ATRA 2IVPA 3HTVA 3CIPA 1GLAG 3A0IX 4CZMA 1NGBA 1BDGA 3U4LA 3A5LC 4JAXA 4NB4A 3MMVA 4E1JA 4B1XB 4WQ4C 1XQSC 5AQTA 4BRCA 3QFUA 2Q97A 1ATNA 3R9PA 4BC2A 3F9MA 5F0XA 3FE1A 1SZ2A 1JCEA 3H3OB 1QZ5A 3EKUA 4BVOA 3HM8A 4CBXA 2ZWHA 2QWRA 4FO0A 5KQDA 1WOQA 4BQZA 3M6GA 3TPQA 3VEYA 1G99A 2E1ZA 2IVNA 1S3XA 4CD1A 2GWJA 3ZX2A 2A40A 3UKUA 3MN6A 3D2EB 3UKRB 2A5XA 3VF4A 3AAPA 5AQFA 2QWOA 4A2BA 2P9PB 4EHTA 2YCHA 5EXWA 1P8ZA 1TUUA 2HF3A 5BREA 1T44A 3GBTA 1Y64A 3O6WA 4MLEA 5AQGA 4BC3A 2HMPA 3LDLA 2CGLA 2V7YA 5BRFA 5E84A 5EOYA 2GUPA 4H5RA 3I8BA 2D0OA 4B9QA 1NGJA 3WT0A 3EKSA 5AQYA 1CZAN 2ASPA 5EY4A 3KVGA 3QDKA 2YI1A 1NLVA 2OANA 3VOVA 2IVOA 4BRNA 4XH4A 1SQKA 1BUPA 3H46O 3SMPA 4H0TB 5BPMA 2ZGZA 2WUSA 3IUCA 3W0LA 2HOEA 2P9KA 4B1WB 3WQUA 3UB5A 5JLFA 2E2PA 2BUPA 3VGLA 3VERA 3LM2A 4WQ4A 1NGEA 2FF3B 2GTDA 2QWPA 2QWMA 2QWNA 4DHYA 3U8XA 3WXKA 1HKCA 4BRPA 2Q0UA 5FPEA 4QS8A 1C0FA 3VF2A 3O4WA 4QS9A 4FL9A 1NGFA 4K25A 2P9SA 4L3QA 4BREA 4BG9A 3ZETA 1IJJA 2YHYA 4IWVA 3ULEA 3J8AA 5F1XA 2V51B 1BWFO 1Z05A 3C7NA 4BC5A 4BRDA 5BR9A 3CQYA 3CJAA 5F2RA 5AQSA 4JD2A 1NGAA 3CERA 4HTLA 2A42A 4BR7A 3I33A 3A5NC 1U2VB 3CJ9A 3OHRA 4A2AA 3AY9A 4IZ9A 1JCGA 1ZC6A 3MCPA 1KAYA 4CZJA 4CBUA 4MO4A 2E2OA 3CI5A 4BRLA
chains in the Genus database with same CATH superfamily
4V19S 5BPNA 3M5RA 4DWIA 1VSHA 4ISGA 4BE1A 2W6KA 3WEEA 3DLLL 2ZJQL 2WONA 1NMNA 4TSXA 3KK1A 3I8DA 1N36K 2D4WA 1J54A 1LWCA 1NJZA 3MDQA 4W5QA 1C1AA 4CGHA 1DT9A 3P4IA 1TKXA 3HVTA 3SUQA 1SAZA 4M7XA 1WN7A 2D0AA 1NBWA 1HQEA 2YJEA 3PLAA 4BR5A 4GMJB 2HHTA 2UU9K 4HHTA 4FPBA 2E6LA 4CHNA 2HHWA 1KXPA 2P9LA 3TR8A 3LAKA 4HUGA 3KTQA 4RW9A 4NLCA 5T7BA 1SV5A 2CGKA 4CJ3A 4GV9A 2Y1JA 1NMDA 1EX4A 2E1YA 3DLGA 4JI2K 3VEXA 5HP1A 1QHAA 4IFVA 2KW4A 1VQKN 2HHVA 4DTJA 4BR9A 4CJEA 4DTPA 3FZHA 2RPIA 3RMBA 4DTNA 2VWKA 3CJCA 1WSIA 5HRPA 3QICA 2F8TA 3RMCA 3TAQA 1QSSA 3T1AA 2B5JA 4DLEA 3C65A 4H03B 4FLXA 1NGGA 2FF6A 1B92A 1S1TA 3DYAA 1VSIA 3O4NA 4FVMA 4GVEA 3HT3A 1KFSA 3FZLA 2VG6A 3V9UA 4CJRA 3VQ7A 4Z94A 4CW7B 1TL1A 4XH1A 3SZ2A 2NUBA 3RSEB 2Q31A 3V9ZA 2NZTA 1GLEG 2KQ2A 3IFRA 4FW1A 1NG9A 5AQOA 4JI0K 2KKZA 3TSUA 1EO1A 3TAFA 3K9JA 3L2RA 2VWJA 2GEMA 4NO7A 3EE9A 1EXQA 5HLFA 2QK9A 4CGJA 2HNZA 5FRMA 2HNYA 4CECA 3O9SA 3IG1A 3UKUB 1S9GA 3O3HA 1JL1A 1WBBA 1CLQA 4ELUA 2JWLA 3M8SA 2BDPA 4BRFA 1LCUA 3NH1A 4KPYA 2G8IA 3TWHA 1TK0A 4AHVA 4CGDA 4RW8A 2CH6A 4EP4A 3N4PA 4Q0BA 4Z0UA 2O8DA 4PKHA 3THYB 1BO5O 1D8YA 3RR7A 4E1NA 1DKGD 4CF1A 2P9NA 1NOZA 2XHBA 4W5OA 4CF2A 4FJ5A 3NFAA 3CC4N 3AA5X 3HOTA 4WYBA 3ENHA 3MEEA 3U9ZA 3J80O 3JSMA 5LMNK 4CJVA 4C1NI 4LF5K 2O4GA 2P9KB 3HBTA 1QVGM 2XY6A 2RN2A 3HYFA 3SK3A 5AQRA 1HPMA 4E89A 1NGHA 4LD0A 1BU6O 1NGCA 4CHOA 2BE2A 4N56A 1X1PA 1U47A 3R3LA 2VG5A 3EY1A 4DTUA 3U9DA 4JI3K 1HUXA 3TAPA 2Z1HA 3G4SN 3L0QA 1Q86O 4CFBA 1SL2A 5BN9A 3OYKA 4DSJA 4OVLA 1KCFA 2IDOA 2ETJA 4E1MA 3EL2A 4XEIA 2F7TA 3VA0A 4LSNA 3CJ7A 3SAHA 1YT3A 3CETA 4CCHA 1NJWA 3MCAB 2BTFA 3A5OC 3TAEA 1JLAA 4JRPA 4CJWA 2E2NA 1QQCA 3IAYA 3DXMB 1CZ9A 2YV0X 4KO0A 3WQTA 4BRAA 4WFNL 4I7FA 2Q36A 4BC4A 1VQLN 5GAEP 3FFKB 4K42A 1MDUB 4WFAL 3LAMA 1I94K 2G8FA 4LFCK 1C0TA 1NK0A 3QMLA 2UUAK 4B3RK 4WQ5C 3P38A 5GIOA 4L8RB 4O8UA 3PV8A 4KHNA 4R79A 4FJ8A 4BRKA 3AVLA 2QEXN 4CZIA 3DXKB 4CEBA 5LJVA 2NRXA 3ZSZA 1HNWK 2O8BB 3LDNA 3VEWA 1H1VA 5AZIA 2KFNA 4DQPA 3J7YP 4FXDA 2W42A 1QVFM 4JS5A 4CEFA 4CK1A 3GL1A 1GLLO 4E19A 3L2QA 4KHSA 3JXUA 5M1QA 1EWRA 1FKPA 3AVIA 4ILJA 1KVBA 4BVPA 3HI0A 1NKCA 5FPDA 3FGUA 3QBXA 3O08A 4FJKA 5AQHA 2HMIA 3I0SA 3VQCA 2PY5A 1YF5L 4AM6A 4K43A 3LANA 4DMNA 4IDKA 4IJNA 4JKCA 5CZ2A 4QAGA 3O1WA 1RBTA 4QS7A 1RT3A 1C0MA 2P9IA 4B1YB 4B3OA 1BI4A 1EP4A 1BL3A 2V7ZA 4A5AA 3VQDA 2JGUA 4NCGA 4KRFA 4B1ZA 4JKGB 1D9FA 1Z25A 4DR3K 3CQXA 3CPEA 3OVNA 2FBVA 5AZJB 2O8EB 1R59O 5IWAK 1RTDA 3CJBA 1M90O 2YHAA 1YJNN 3NF7A 3OBWA 5HOOA 4DQ8A 2ZF5O 2KFZA 5ADXH 4KTZA 1ZBFA 4MO5A 3UKRA 4JV5K 2XY5A 3HP9A 2YHXA 4F8RA 4DV2K 5AJ3K 3V9SA 5AQMA 3RRHA 4YY3K 3MXIA 1ASWA 2HBLA 2B6AA 1GLAG 3CIPA 4CJTA 3THVA 1LWFA 1NGBA 3NH0A 3VQ5A 3ZSWA 4WFBL 1E3MA 3RTVA 4NB4A 2HHSA 2Q97A 4DV3K 3V9XA 4BC2A 5JS1A 3F9MA 1HMVA 4R5PA 4JI4K 2O8DB 3NH2A 2DFHA 1YITN 1ZBUA 1DTQA 1O13A 1F21A 4GKKK 3AO2A 3EKUA 5GINA 1W7AA 4PY5A 5DM6L 4CBXA 1JKHA 1WOQA 3V81A 3TPQA 2E1ZA 1SL1A 4O0JA 3HJFA 4CD1A 3LDSA 3CFPA 1OVQA 4FLTA 1B9DA 2GX9A 1VSKA 2VGNA 2IS3A 2OPPA 1P8ZA 4CK2A 5BREA 2A1SA 1XMOK 3GBTA 3M8PA 1BHLA 4OKKA 3TARA 1ZBLA 4J2AA 2HMPA 2V7YA 2P1JA 5IT9O 2WC9A 2PZSA 3J81O 3EKSA 4CEOA 3SJJA 4YOVA 1CZAN 3KVGA 4O5BA 3DLHA 1WB9A 4XH4A 4RW4A 1SQKA 1BUPA 3H46O 4H0TB 4DSFA 4AHRA 3SAFA 1C1BA 3W0LA 3KWIA 2HOEA 3WQUA 4F2SA 4LFAK 3AA2A 1IBMK 2QWPA 2QWMA 2NRZA 4DQRA 3OY9A 3P5JA 1IKXA 2F96A 3AVFA 5M1FA 2QI2A 2P9SA 4L3QA 1IJJA 3OYEA 1HYVA 2OTLN 3L8BA 1Z05A 1HR0K 4BRDA 5BR9A 3HPOA 1VQ4N 3CQYA 4JEPA 3AVNA 3T19A 4KAZA 2Z1GA 4BR7A 3U6FA 4W5TA 3CJ9A 3TSPA 4IZ9A 3QEVA 4DSIA 4F2RA 1ZC6A 5H1SQ 3MCPA 3K59A 4CBUA 4H8KA 2E2OA 4H0OA 3HM8A 3CI5A 4DV4K 3CJ1A 5HRNA 1OH7A 3AVHA 3JS6A 3SQ2A 3VF6A 2Q0RA 3TAMA 3CG7A 1WNSA 4RWTA 2KTQA 3MK6A 3K5LA 3B6PA 2YKMA 2CH5A 4BGBA 3VQ8A 2HHQA 3NAEA 3U3YA 5LY3A 4DCHA 1D4XA 2P9IB 3LP3A 4H0PA 3WXJA 1BI4B 2NRTA 3UE5A 4O44A 4MDBA 4OKJA 1QZ6A 2D0BA 2FC0A 4B8AB 4FK0A 3RSEA 5GAGP 4DF4A 5J2MA 3ZX0A 2E6MA 5AQQA 4WF9L 4CJFA 1KC8O 4BR4A 4FVUA 1TV6A 4J2BA 3WUHA 1DGKN 1RTHA 4DU4A 2D0PA 3JAMO 1RFQA 5EU7A 1OKJA 1KVAA 3K5OA 4JLHA 5AQWA 1XNRK 3S3MA 4FCYA 3K0SA 3CXCM 5AR0A 3QBWA 4PKIA 1UAXA 1K8AO 1KD1O 3SQ0A 3AVMA 3O9UA 2BGGA 4HUEA 1Q18A 4RW6A 4KH5A 3OBYA 3AAQA 4JKHA 4AH9A 4N41A 3MN5A 4BRMA 1T6DA 1NGIA 3OYBA 1XHZA 2P51A 4Y1CA 3IS9A 2YNFA 5BR8K 1YTUA 3SUPA 3QB0A 3NCIA 4FZYA 2E88A 3CMAN 3E66A 1BA1A 1JCFA 1VQMN 3QINA 2IIRA 3VGKA 2OCEA 3T1HK 2P9UB 4CK3A 1K9MO 1X9WA 3F5TA 3DWLA 3ID8A 3OYAA 4B9LA 3KZBA 4CEAA 4DV7K 4FJ9A 2DTUA 3HVRA 1Q9YA 4AF1A 1RBVA 3C6UA 1XC9A 1FJGK 3NF9A 1RT1A 5AFUA 1I39A 3QNOA 2XRIA 4AQYK 5AQPA 4I6MB 3O8MA 3ATVA 2QWLA 1SKSA 1TKZA 4HCBA 3WXLA 3OA9A 4IKFA 2CGJA 4CI6A 3WXMB 3AVGA 1VQ9N 2WFBA 1Q8IA 3FFIA 3B8AX 4K0KK 2QM1A 1QQNA 1J9AA 2ASOA 4DB3A 2ASMA 3EYZA 1WUAA 3EZWA 3G10A 1L3SA 3RMAA 5M1NA 1GLDG 3DXMA 4AILC 3OYIA 1BQMA 1T6CA 4AHTA 4FJNA 2DY4A 1BCOA 4U7BA 4AHUA 3CPWM 4FJ7A 2AP1A 4YOXA 1NNEA 4KHUA 4OPHA 4Q5VA 3KLEA 4BWMA 3AVBA 5C24A 1S1XA 1TK8A 1HNVA 4Z4HA 4FJGA 3TANA 1Q82O 5AQXA 2P9SB 3KK7A 1SKRA 1QSYA 4BACA 3DXKA 2O8BA 3ULDA 1TAQA 4FWSA 3GOIA 4DS5A 1REVA 3O9RA 1WSJA 4YORA 3MN9A 1XHXA 3TAGA 3O80A 4YOYA 4FZZA 3RR8A 4O5FA 3AA4A 4FLVA 3LDPA 5HBMA 2G8WA 1ZYQA 1GOCA 1U4BA 5CHIA 5CZ1A 3O9QA 3LP1A 4CFAA 3CCQN 2ITMA 4DR2K 5C0YA 4KV8A 4B3SK 2PAVA 2G8KA 1VHXA 1N5YA 1BIZA 5KQ8A 3R1XA 1RBSA 3G25A 3ZT0A 2HHHK 3RVCA 3ZEUB 3ZSRA 3ENBA 1V4TA 4DV0K 3NGYA 4PL7A 4OPJA 3AO5A 2Q2RA 5BRDA 1A5VA 4J8FA 1VSEA 3K9KA 1UA1A 4JKGA 4GV3A 4BRIA 3A8YA 2E20A 4UY8O 4DTSA 3ALYA 5JLHA 2YHBA 2X78A 5AZJA 2O8EA 4CHYA 5EX5A 4MFBA 3HXMA 3H45C 3E01A 4E3SA 1J5EK 2YJFA 4LF6K 4C8LA 1TAUA 3KWGA 3CQ8A 1VSLA 3MWPA 1U2VA 3NF8A 2G8UA 2IGIA 2OPRA 4ILGB 4DU1A 2BH1A 1X3MA 4K41A 4RCHA 4A62A 4DSEA 4DFMA 3VPZA 1D5AA 4BQLA 1HKBA 3DLKA 4CJKA 3R8EA 4K8ZA 3SQ4A 1VQ5N 2DFEA 5I9EB 4GVMA 4FM2A 5DK5A 2QKKA 5HRRA 2IAJA 1YVNA 3F2KA 3TABA 3OJSA 4FWQA 2NLXA 1KSPA 3VTHA 2QKBA 3BY5A 5HROA 1YIJN 1L5UA 3V6DA 3KKSA 1DLOA 2HB5A 2RE2A 4QOZB 1U49A 4O8KA 1N34K 4OLBA 4CZGA 2V52B 1TYQB 5C2DA 1YJ9N 1JLQA 2F8SA 1ILYA 4JI5K 2UXCK 3AARA 1N8RO 4B9SA 4MLHA 3BDPA 3TTDA 2XY7A 2VYPA 4JI1K 3FZKA 4ISEA 4LFBK 3O4QA 1GLCG 4CVNE 5GIPA 3H6EA 3F73A 3GG4A 4YDUA 5AQKA 4YOTA 1U48A 4JKEA 3KHYA 4PL8A 4LF8K 2D1KA 4F3OA 4DUYK 3QETA 3FLCO 4CZKA 3HO1A 1MA9B 4CESA 5JS2A 5JVHL 1NJIO 4OJRA 1DEJA 3HTVA 1IKVA 4DFKA 3A0IX 4JK9A 4CZMA 3KLGA 4B1XB 4WQ4C 4BRCA 3QFUA 1A5XA 4QCLA 1NJXA 3O3GA 3IKMA 3Q7BA 3FE1A 3AGKA 2NRRA 4FLUA 4DU3A 4B9NA 2HVHA 4PQUA 2ZWHA 2QWRA 1L3UA 1HYSA 4RW7A 3M6GA 3K5MA 3VEYA 4DTMA 3MXJA 1N32K 1S3XA 3OTOK 1FXXA 3I56N 3ZX2A 5TKWA 2E5LK 1BISA 5KGWA 3D2EB 3VF4A 3AAPA 3SAGA 4A2BA 4EHTA 3VA3A 4M3RA 3LPTA 2HF3A 3LZIA 1IBLK 1T44A 3L2VA 4MLEA 1Y64A 5AQGA 3LDLA 4HTUA 4KB0A 5BRFA 5E84A 3EE8A 1VSFA 3OS0A 1NU0A 3QEWA 3WT0A 5C10A 5LMUK 4CFDA 3NGIA 4M3XA 1X9SA 5EY4A 1SL0A 2X74A 3NF6A 1NLVA 3VOVA 4FLZA 1VRTA 3SQ1A 4N5SA 3EZ5A 5BPMA 3IRXA 2WUSA 3OYNA 4DUZK 4JI7K 3CMEN 3ZCMA 4DS4A 3KK2A 3NMUA 1S1UA 5JLFA 2E2PA 3VERA 3OYJA 4I9QA 4KREA 3HOSA 2QA4N 1LW2A 1QE1A 4M3UA 4DSKA 4DHYA 3U8XA 4IFEA 1HRHA 2ZQBA 3K2PA 3C6TA 3VF2A 3O4WA 2VQEK 3T3FA 3VQPA 1T7PA 4CJSA 3EEQA 2YHYA 3ITHA 4IWVA 4B8CA 3J8AA 2QTDA 1EKEA 5F2RA 4JD2A 3P1GA 2O8FA 1XMQK 3ZYYX 2A42A 4EZ6A 1WSFA 2Q3SA 3A5NC 1U2VB 1ZBHA 4A2AA 3HL8A 4C8OA 3L3UA 3PIPL 1S1VA 4PWDA 4I2QA 1HLUA 2I7PA 2W41A 4CJ7A 5C15A 3G71N 2YNIA 3DOLA 3SMSA 3CCUN 2FBTA 3PUFA 2WOMA 3CCJN 4FW2A 3FZFA 4JKAA 3MAQA 3N4QA 1C1CA 1VQ7N 3DI6A 2HBJA 3C0BA 4KI4A 4FLWA 4H5WA 1NGDA 3HPHA 3D45A 4B3MK 3K58A 3WNFA 2QXFA 5M1PA 2BANA 3WXIA 1BOTO 3AGRA 4O55A 3OYFA 4O4GA 2P9UA 1K73O 3C7NB 4GY2B 4CZLA 4A61A 3KD5E 3E9LA 4LC9B 4IO8A 1RT4A 5D3GA 1VQPN 1GLBG 1YAGA 1RDAA 1YTAA 1V4SA 4CE9A 3M8RA 4EIAA 2Z1JA 3I55N 2UXDK 1LAVA 3E9PA 4I6MA 3BP8A 4FOIA 3C94A 3J7ZO 4LF4K 3A5MC 1GOBA 4CF8A 3IDHA 4H0XB 3R6MA 4EHUA 1BA0A 4YNQA 3ASMA 3LWMA 3RRGA 2JWKA 1Z6RA 4CEEA 2Z1IA 2O8CB 1EQYA 1M1KO 3U3GA 4BRHA 1RBUA 2DPNA 4FPAA 4PA1A 3CCLN 2ZE2A 4C8NA 4JKBA 2A6AA 3QFPA 4BDZA 1RT2A 1HJOA 1CXUA 4H0VB 4H5TA 1HKGA 1O1WA 2HHXA 1E4GT 4IEEA 5ELZA 2JLEA 1YHQN 1X3NA 4CJPA 3S3NA 3PY8A 1ASUA 3DLEA 4DQQA 3QEPA 4Z4FA 4UQGA 4WE1A 2OA8A 4CEZA 3VGMA 1IKYA 3UIQA 2A41A 2F9WA 3ZSXA 5AQZA 5E26A 1ZBSA 1QQOA 2VQFK 4Z4IA 4M42A 3VESA 4FWKA 3PSFA 3MXMA 1NM1A 1XI1A 4LY7A 4FZXC 1JLFA 3OS1A 3AO4A 3CM5A 2FBXA 1VSJA 3DLBA 4LF9K 4C23A 1LAWA 3VEVA 5CE3A 1Q81O 5AQVA 3SJHA 1KAZA 1RDBA 3CCMN 4DTOA 5AQLA 4CERA 1BQNA 4DV6K 5MLCQ 4KTWA 2I5JA 1BG3A 5TKYA 3KKRA 5C2FA 1GLJO 4LF7K 1K6YA 3AVCA 4IEIA 4FWOA 2I7NA 3VQ9A 3ZEUA 2HBKA 1S5JA 3OW2M 1NK8A 4KHYA 3NHGA 4I2PA 3CFRA 1ZBIA 3LL3A 4C8MA 4DV1K 4NYNA 2P9PA 4CZEA 4KBOA 3L2WA 2VCPA 1YI2N 4FJLA 4CHPA 1HJRA 5HRSA 4W5RA 4B9UA 3V1QA 4FWRA 3MEDA 3LALA 3PSIA 5E41A 3HM9A 4ILHA 1T8EA 1HNIA 4MDAA 1NOYA 1TVRA 4JD2B 3H08A 3CCSN 1CZBA 2O8FB 1S6PA 4CF0A 4Z4GA 4M63C 2O4IA 1RT6A 4BE0A 2HNDA 5SWMA 1W0HA 3S41A 1IG8A 3KIOA 4OGCA 4AM7A 2FSJA 3BUZB 3SV4A 4BRGA 3SI6A 1KFDA 1OH5A 4J2DA 1GOAA 2GBZA 2GV9A 4GNIA 4F3TA 4I9LA 4A57A 3ZX3A 3CCVN 4M3ZA 3O9TA 3ZSQA 2RKIA 4JI6K 1TYQA 3GDQA 5FROA 1D9DA 3PX0A 3RWUA 1YUWA 4CJ4A 3MEGA 4BRQA 4YHHK 4DR1K 1K8KB 5FRNA 2YX6A 3BZCA 4CD3A 4CZHA 4JS4A 4CF9A 3S3OA 1YVUA 2D0CA 4CGIA 4LH5A 4BE2A 1FKOA 2H3GX 1QQMA 1RILA 3VETA 3O1BA 3ATUA 5C12A 4FJIA 4OLAA 1HNXK 4C8KA 3AA3A 5JMVA 4ID5A 3IMXA 1N6QA 4IO9L 2OZMA 1OVYA 1X9JA 4KHWA 1QTMA 5JVGL 2HBMA 3NE6A 1L3VA 2VGMA 2FXUA 1XC3A 4LSLA 3AVAA 3DAWA 3L4IA 3AO1A 3OS2A 1U6ZA 3P31A 5HL7L 4M45A 1JLGA 3L6QA 4JKFA 1W2BM 3DMJA 5AFUH 3M3ZA 4H4MA 2HF4A 2FSNA 1P90A 2J4RA 5BN8A 3SLCA 3CCEN 1IKWA 1CXQA 1E4FT 1RGIA 3AVJA 1YXQA 3VQQA 4K8XA 1J6ZA 1MWKA 5J1EA 3QEIA 3LM9A 1G15A 4CIFA 3MECA 1KVCA 2PYLA 1HPZA 4DSLA 2OPQA 4PKGA 4BR0A 2ZJPL 1XUPO 3TSQA 3D2EA 2AJQA 4BG8A 5KPTA 4JNEA 5KGXA 4FOEA 3KJVA 4IOCL 4WQ5A 4F9OA 5J2QA 1OH8A 1EWQA 3F9KA 3KLFA 3W3DA 1EETA 3MN7A 3VEOA 4XH5A 5LL6Z 4J2EA 4DR5K 1KTQA 1C6VA 3T69A 2LSNA 4JAXA 4BWJA 3P83D 1XQSC 5M1OA 2ZJRL 3OYMA 4FJHA 4JKDA 4U67L 5F0XA 4DR7K 1SZ2A 3D0PA 3ID6A 1JCEA 4PHTX 2A1RA 4BVOA 4FO0A 3VMFB 4CEQA 2NRWA 1I3AA 2IVNA 3VQAA 4IG0A 2GWJA 1VQON 4LH4A 3L2UA 4DQIA 3ZT2A 2ITGA 4JK7A 2A5XA 5CYMA 5AQFA 3L3VA 4IBNA 2P9PB 2YCHA 1TUUA 1FW6A 4OPKA 3THXB 3O6WA 2IC3A 3VTIA 3K5NA 1S72N 2IOCA 3VQ6A 2CGLA 1R0AA 5KRTA 3HRGA 3OYDA 1BIUA 5EOYA 4X62K 1IBKK 2GUPA 4X64K 4H5RA 2XY8A 4Y1DA 2D0OA 3NDKA 4B9QA 5AQYA 2ASPA 1W97L 4M41A 4NLBA 4ZHRA 5J2PA 2NNWA 2YI1A 3D6RA 4BRNA 1VK0A 1RT7A 1DTTA 3DRSA 4A5BA 2ZGZA 3IUCA 5CR4A 4B1WB 3UB5A 4X65K 4YOUA 4YFUA 3QNNA 3VGLA 3SCXA 1LV5A 1NGEA 2FF3B 2GTDA 1J53A 2QWNA 1HKCA 5FPEA 3V9WA 1KLNA 3CCRN 4FL9A 2EHGA 1NGFA 4K25A 1S9EA 4BREA 4BG9A 4OKEA 2R7YA 4CJ5A 5F1XA 4CGGA 3S9HA 2YNHA 3C7NA 4ICLA 3I0RA 5AQSA 4G1QA 1NGAA 2W6LA 4ZTJA 3I33A 3QEXA 4BDPA 2HW3A 3SBGA 1IG9A 3AY9A 2ZD1A 4MO4A 3OYHA 1HYZA 4CGFA 4BY9C 4IJAA 3SUOA 4KTQA 4F4KA 4CHQA 2UYTA 4E7JA 3OYCA 5GAHP 5KRSA 3AO3A 1MU2A 2GELA 2O8CA 4DFJA 3QO9A 5DMRA 3BZKA 1BCMA 4KFBA 3ZT4A 2HHUA 3HSCA 3D2FA 3VENA 4JHDA 4KH6A 4E7LA 1T3VA 3C6AA 2GUIA 3ZETB 1TKTA 1VAZA 3ULEB 2UUBK 4M7YA 5LJWA 1WBDA 3LDQA 1OH6A 1L3TA 1J5OA 4H4OA 2ATQA 3OYLA 1NK6A 3ZLJA 3EO3A 3PO4A 2DFFA 1FK9A 1JL2A 2OZSA 3GE1A 2F4VK 3A2FA 4FM0A 4ELTA 3HK2A 1MWMA 2F9TA 1Q9XA 2PBDA 2OYQA 5DM7L 4IXCA 2P5OA 1RCHA 2W40A 1HNZK 4CZFA 3WEEB 2QXLA 2FLOA 4DR4K 1LW0A 2X6NA 4B9TA 1KRPA 3LDOA 1ATSA 4KB1A 1WSHA 1A5WA 4ZTFA 3THWA 1S1WA 3ZSYA 5AQJA 1JLEA 4JK8A 3TTCA 3LWLA 1T03A 3FZMA 3T1YK 4A59A 2XO7A 2YNGA 3KK3A 2WTUA 1RTIA 1VRUA 5SZTA 4OGEA 4CIGA 1RT5A 3QESA 4Y0WA 2P9LB 4E0DA 4JN4A 1WLJA 3ENOA 1RBRA 5GADP 4NCBA 3H3NO 3LP0A 1VSMA 4BR2A 2NRVA 1LOTB 2Q1NA 3ISNC 1C0GA 3WNGA 1TGOA 1RNHA 4N47A 4B1UB 3V1RA 5JICA 4FJXA 1SKWA 1IO2A 1U04A 3M1FA 1QHTA 1TK5A 4NYFA 4CIEA 3MX5A 2G8VA 2RF2A 3BF3A 2QW9A 1NKBA 2FSKA 3HPGA 3DRRA 5BRHA 5ADXA 4DTRA 4FWPA 5J2NA 3RMDA 4KHPK 3CM6A 1Z26A 1JJ2M 4B3TK 2NRHA 4CJLA 1TKDA 1VSDA 4O0IA 5FDLA 4B9VA 3QIPA 4N76A 1ESVA 4FSVA 5I42A 3MWTA 4DG1A 1KAXA 3D7EO 2AA4A 4EFHA 2ZGYA 4YOWA 3BEXA 4CEDA 4Z4EA 4HWIA 1K8KA 1N33K 5I3UA 4B1VA 4BGAA 3KLHA 4OO1J 3QIOA 3CHWA 3DRPA 2KZZA 1NKEA 3B6OA 5AQUA 5K14A 2EX3A 3VQBA 3ZT3A 4CFCA 3BF1A 4DV5K 3AVKA 3E9OA 3O5BA 4DTXA 1HQUA 3VEZA 5EVZA 1U45A 1YJWN 1QSLA 2GWKA 4DR6K 4AHCA 3SPYA 1NK4A 1RDCA 3T7ZA 4FWLA 4KH4A 3ZT1A 4H5NA 3OJUA 3M8QA 4JI8K 4FK2A 3TTFA 1S6QA 2P9NB 2E4LA 4CJUA 1UWBA 1T05A 4OX9K 2KHOA 4HCCA 3FR0A 5KPZA 3NVKA 1JXEA 5KPRA 3DJCA 3VN5A 3KLIA 5BPLA 4YDUC 3HP6A 1ZXOA 1IH7A 4H0YB 4KKOA 4ISFA 3Q7CA 3C6HA 2E8AA 3D2FB 4JHDB 3SYZA 4JRQA 1SUQA 1NK9A 5AQNA 4FWMA 3MX2A 2VG7A 3SNNA 1ITGA 4IDHA 4E7KA 3EN9A 4OPAA 2Y1IA 2QWQA 5C25A 5KTQA 1HX1A 4FM1A 1NK7A 2EWSA 3DM2A 1RDWX 4M3TA 1KQSM 1SS6A 1WSEA 4IOAL 5A2QO 3P39A 4FLYA 4BROA 5FPNA 1NWKA 3OYGA 1UA0A 5B8HA 4CJQA 3H1VX 2KLAA 2YHWA 3H1QA 3LZJA 1VQNN 4RTFD 3PX4A 3O3FA 3PO5A 4MQ3A 4DLGA 3V4IA 2HVIA 4Z4CA 4WCEL 4RG8A 4G9ZA 2A3ZA 3THWB 3LP2A 3TI0A 3L4QA 1TUYA 4H5VA 4EAHD 5CYQA 2D5RA 3HZ6A 3DOKA 3PX6A 4NXMK 3TU5A 3SV3A 4CBWA 3PIOL 1S22A 4M3WA 3DLRA 2VWBA 3ZSVA 1NJYA 5AZIB 3BGRA 1Y97A 4IG3A 4IFYA 1GLFO 2ZM6K 5AQIA 4E7HA 3NBPA 1WAFA 3SPZA 3NGZA 5FPMA 2G8HA 2RHKA 4FJMA 2UXBK 4FWNA 3THXA 4C1NK 1IV0A 4HUFA 1C0UA 2E2QA 1RDUA 1ATRA 2IVPA 4EP5A 1XNQK 1W9HA 3V1OA 1BDGA 1JLBA 3U4LA 3A5LC 4B08A 2KZMA 3MMVA 4E1JA 2PYJA 5AQTA 5FLXO 1ATNA 3R9PA 5M1KA 4NCAA 3WNEA 1VQ6N 4DFPA 3H3OB 4HVJA 1QZ5A 3CF5L 4GKJK 3E1YA 4ID1A 4X66K 2P5GA 5CY4A 2YKNA 5KQDA 3WNHA 4BQZA 2OPSA 1G99A 4FYDA 4XIUA 3SUNA 1NK5A 2OTJN 1B9FA 4GV6A 1XWLA 2A40A 3MN6A 3UKUA 3VQEA 4EZ9A 3UKRB 3CC7N 4DKWA 2QWOA 3HSTB 5EXWA 4GW6A 3LPUA 3K57A 1TL3A 3G0ZA 2UUCK 3NVMA 4BC3A 2X6SA 2B4JA 1JLCA 4PUOA 3I8BA 1NGJA 3THYA 4AHSA 4B9MA 1X9MA 3CYMA 3CD6N 4KHQA 3G6EN 3QDKA 4W5NA 3QLHA 2OANA 2IVOA 4IOXA 1LWEA 4E7IA 4FJJA 3SMPA 3VQ4A 4NXNK 3SBTA 1KLMA 3C95A 2P9KA 1JXBA 2BUPA 3LM2A 4WQ4A 4KI6A 1RTJA 3CFOA 3QERA 4CHZA 5KI6A 3KD1E 4BDYA 3WXKA 4BRPA 2Q0UA 4QS8A 1C0FA 4DF8A 4DQSA 4QS9A 3J7AP 4JYAK 4M3YA 1WAJA 3ZETA 1BGXT 3ZSOA 1RDDA 3ULEA 1Q7YO 2V51B 1VQ8N 1UOCA 1BWFO 4BC5A 5C42A 3CJAA 2WBNA 3CERA 4HTLA 3AV9A 3JYTA 1QS4A 2FBYA 3OHRA 2PFUA 1WSGA 4ELVA 1JCGA 1KAYA 2HSTA 4CZJA 4FK4A 3CC2N 4BRLA 1ASVA
chains in the Genus database with same CATH topology
3CJ1A 5BPNA 1HLUA 3M5RA 3JS6A 4BY9C 2I7PA 4IJAA 3VF6A 2Q0RA 4ISGA 3WEEA 3DLLL 2W41A 2ZJQL 4CJ7A 5C15A 3G71N 4RWTA 2UYTA 2D4WA 3MK6A 3SMSA 5GAHP 3CCUN 2GELA 3MDQA 3CCJN 2CH5A 4BGBA 1DT9A 3FZFA 3P4IA 4JKAA 3N4QA 1SAZA 4M7XA 5LY3A 3HSCA 4DCHA 1D4XA 2P9IB 1NBWA 4H0PA 1VQ7N 2YJEA 3D2FA 3PLAA 3VENA 3WXJA 4BR5A 2NRTA 4JHDA 3UE5A 4KH6A 2HBJA 4MDBA 3C0BA 1QZ6A 4H5WA 1NGDA 3RSEA 1T3VA 4FPBA 3C6AA 5GAGP 3ZETB 3ZX0A 1VAZA 5M1PA 3ULEB 5AQQA 4WF9L 1KC8O 1KXPA 3WXIA 4BR4A 4FVUA 1BOTO 3AGRA 2P9LA 4M7YA 5LJWA 3WUHA 3LDQA 2P9UA 1K73O 4NLCA 3C7NB 1DGKN 4GY2B 4CZLA 2CGKA 4A61A 4GV9A 3E9LA 3EO3A 4LC9B 1NMDA 2D0PA 1RFQA 4IO8A 1OKJA 2E1YA 1VQPN 1GLBG 1YAGA 5AQWA 3VEXA 1VQKN 1QHAA 1V4SA 4EIAA 3GE1A 3I55N 3CXCM 1MWMA 5AR0A 3QBWA 4PKIA 4BR9A 2F9TA 3E9PA 3FZHA 4I6MA 3BP8A 4FOIA 2PBDA 1K8AO 3J7ZO 5DM7L 4IXCA 3A5MC 1KD1O 2W40A 3IDHA 3O9UA 4H0XB 4CZFA 3WEEB 2QXLA 2FLOA 3CJCA 1Q18A 3R6MA 4EHUA 3QICA 1BA0A 4KH5A 3LDOA 3OBYA 2JWKA 1ATSA 3AAQA 4JKHA 1Z6RA 3C65A 4H03B 1EQYA 1M1KO 1NGGA 4BRHA 3MN5A 4BRMA 1T6DA 2FF6A 1NGIA 5AQJA 4JK8A 2DPNA 3TTCA 4FPAA 3FZMA 3CCLN 4GVEA 4JKBA 3FZLA 4A59A 2A6AA 3QFPA 3QB0A 4Z94A 2E88A 4XH1A 1HJOA 3RSEB 2Q31A 4H0VB 3CMAN 3E66A 2NZTA 1HKGA 1GLEG 4H5TA 1BA1A 1E4GT 1JCFA 4IEEA 5ELZA 1VQMN 4Y0WA 3IFRA 2P9LB 2IIRA 5AQOA 3VGKA 1YHQN 1X3NA 4JN4A 2KKZA 3TSUA 2P9UB 1EO1A 3ENOA 3K9JA 1K9MO 3F5TA 3DWLA 3ID8A 2GEMA 3KZBA 4NO7A 3EE9A 4AF1A 5GADP 5AFUA 3H3NO 3O9SA 3UKUB 4BR2A 2NRVA 3VGMA 2JWLA 5AQPA 1LOTB 4BRFA 2A41A 2F9WA 2Q1NA 1LCUA 1C0GA 4I6MB 5AQZA 3O8MA 5E26A 1ZBSA 1QQOA 3ATVA 2QWLA 4B1UB 3VESA 4FWKA 5JICA 3WXLA 1NM1A 2CH6A 3M1FA 3N4PA 3OA9A 2CGJA 4C23A 3VEVA 5CE3A 1Q81O 4CI6A 3MX5A 5AQVA 3WXMB 3SJHA 1KAZA 3BF3A 1VQ9N 3CCMN 2QW9A 2WFBA 4PKHA 5AQLA 1BO5O 3B8AX 1DKGD 2FSKA 5MLCQ 5BRHA 5ADXA 2QM1A 1QQNA 4FWPA 1BG3A 2ASOA 4DB3A 5TKYA 2ASMA 5C2FA 1GLJO 2P9NA 1WUAA 3EZWA 1JJ2M 2NRHA 4IEIA 4FWOA 2I7NA 5M1NA 1GLDG 3DXMA 3HOTA 3CC4N 3ZEUA 4WYBA 1T6CA 3ENHA 2HBKA 3U9ZA 3OW2M 4C1NI 4U7BA 3CPWM 2P9KB 3HBTA 1ESVA 1QVGM 4FSVA 2AP1A 3MWTA 3SK3A 4YOXA 5AQRA 1HPMA 1NGHA 1KAXA 1BU6O 3LL3A 3D7EO 2AA4A 1NGCA 2ZGYA 4OPHA 4EFHA 4YOWA 3BEXA 2P9PA 4HWIA 1K8KA 4CZEA 4KBOA 4B1VA 2VCPA 4BGAA 1YI2N 4OO1J 3CHWA 1Q82O 5AQXA 5AQUA 3R3LA 2P9SB 3KK7A 3U9DA 3DXKA 3BF1A 4FWRA 1HUXA 3G4SN 3E9OA 4FWSA 3GOIA 3L0QA 4ILHA 3O5BA 3O9RA 4YORA 3VEZA 4MDAA 1Q86O 3MN9A 5EVZA 5BN9A 1YJWN 3O80A 4YOYA 2GWKA 3EL2A 4O5FA 4XEIA 2F7TA 4JD2B 3LDPA 3CCSN 3T7ZA 4FWLA 3CJ7A 4M63C 4KH4A 3SAHA 3CETA 5CHIA 3O9QA 3CCQN 5C0YA 2ITMA 3MCAB 2BTFA 3A5OC 4H5NA 2PAVA 3S41A 3TTFA 1IG8A 5KQ8A 3R1XA 2P9NB 4AM7A 3G25A 2FSJA 3BUZB 2KHOA 2E2NA 3FR0A 3RVCA 4BRGA 5KPZA 3DXMB 3ZEUB 4WFNL 3WQTA 4BRAA 3ENBA 1V4TA 3NVKA 2Q36A 5KPRA 4BC4A 4PL7A 3DJCA 1VQLN 5GAEP 2Q2RA 5BRDA 3FFKB 4K42A 5BPLA 4J8FA 4GNIA 4YDUC 1MDUB 3CC2N 4A57A 3ZX3A 4WFAL 3K9KA 3CCVN 3O9TA 1TYQA 3GDQA 1ZXOA 3QMLA 4H0YB 4JKGA 4GV3A 1YUWA 4ISFA 4BRQA 3Q7CA 3A8YA 2E20A 3C6HA 4BRIA 4UY8O 1K8KB 2E8AA 3D2FB 3P38A 4WQ5C 5GIOA 5JLHA 2YX6A 4JHDB 4CD3A 4CZHA 4O8UA 5AZJA 5EX5A 5AQNA 3H45C 4FWMA 3MX2A 4R79A 4BRKA 2YJFA 2QEXN 4IDHA 4CZIA 3DXKB 2H3GX 1QQMA 3EN9A 2NRXA 3VETA 3O1BA 3KWGA 3LDNA 4OPAA 3ATUA 5C12A 3VEWA 1H1VA 2QWQA 5AZIA 1HX1A 3MWPA 1U2VA 5JMVA 4ILGB 1QVFM 2EWSA 3IMXA 1RDWX 1X3MA 2BH1A 4K41A 4RCHA 4A62A 1OVYA 4IO9L 1X9JA 3VPZA 1KQSM 1SS6A 4BQLA 3GL1A 1GLLO 1HKBA 2HBMA 5JVGL 3JXUA 4IOAL 3P39A 5M1QA 3R8EA 2VGMA 2FXUA 4BROA 5FPNA 1XC3A 1VQ5N 4ILJA 3DAWA 3L4IA 5I9EB 4BVPA 3HI0A 5FPDA 3FGUA 1U6ZA 1NWKA 3P31A 3O08A 3QBXA 5AQHA 5HL7L 1YVNA 3F2KA 5B8HA 3L6QA 1YF5L 4FWQA 3H1VX 4JKFA 4K43A 4AM6A 1W2BM 2KLAA 2YHWA 3H1QA 2NLXA 4IJNA 4JKCA 5AFUH 3VTHA 3M3ZA 3O1WA 2HF4A 2FSNA 1VQNN 4RTFD 1P90A 2J4RA 4QS7A 3SLCA 5BN8A 2P9IA 4B1YB 1YIJN 3CCEN 4WCEL 2RE2A 4O8KA 2V7ZA 4A5AA 4G9ZA 2A3ZA 1E4FT 1RGIA 4CZGA 2V52B 1TYQB 1YXQA 5C2DA 1YJ9N 4B1ZA 1ILYA 3L4QA 1TUYA 4H5VA 4JKGB 4EAHD 1J6ZA 1MWKA 3AARA 1N8RO 3CQXA 4MLHA 3HZ6A 3CPEA 3LM9A 4H0OA 5AZJB 3TTDA 5LJVA 2VYPA 1R59O 3TU5A 3CJBA 3FZKA 4ISEA 1M90O 4CBWA 3PIOL 1S22A 2VWBA 1YJNN 1GLCG 5GIPA 3OBWA 5HOOA 3H6EA 3GG4A 4PKGA 4YDUA 5AQKA 4YOTA 4BR0A 2ZF5O 5AZIB 1XUPO 4JKEA 4DQ8A 5ADXH 2ZJPL 3KHYA 4PL8A 3TSQA 4MO5A 1GLFO 2D1KA 3D2EA 3UKRA 4BG8A 5KPTA 4JNEA 5AQIA 3FLCO 2YHXA 4FOEA 4IOCL 4WQ5A 4F9OA 4CZKA 5FPMA 2RHKA 1MA9B 5AQMA 3W3DA 4FWNA 3MN7A 3VEOA 4C1NK 2E2QA 4XH5A 5JVHL 1NJIO 1RDUA 1DEJA 1ATRA 2HBLA 2IVPA 3HTVA 1GLAG 3A0IX 3CIPA 4JK9A 4CZMA 1NGBA 1BDGA 3T69A 4WFBL 3U4LA 3A5LC 4JAXA 4NB4A 3MMVA 4E1JA 4B1XB 4WQ4C 1XQSC 5AQTA 4BRCA 3QFUA 2Q97A 1ATNA 5M1OA 2ZJRL 3R9PA 4BC2A 5M1KA 3IKMA 3F9MA 3Q7BA 4JKDA 4U67L 5F0XA 3FE1A 1VQ6N 3AGKA 1SZ2A 3ID6A 1YITN 2NRRA 1JCEA 4PHTX 3H3OB 1O13A 1QZ5A 3CF5L 3EKUA 5GINA 3E1YA 4BVOA 3HM8A 5DM6L 4CBXA 2ZWHA 2QWRA 4FO0A 3VMFB 5KQDA 1WOQA 4BQZA 3M6GA 2NRWA 3TPQA 3VEYA 1G99A 2E1ZA 2IVNA 2OTJN 1S3XA 4CD1A 2GWJA 1VQON 3I56N 3ZX2A 5TKWA 4GV6A 2A40A 3UKUA 3MN6A 3D2EB 3UKRB 4JK7A 3CC7N 2A5XA 3VF4A 4DKWA 2GX9A 3AAPA 3SAGA 2VGNA 5AQFA 2QWOA 4A2BA 2P9PB 4EHTA 2YCHA 5EXWA 1P8ZA 1TUUA 2HF3A 5BREA 1T44A 3GBTA 1Y64A 3O6WA 4MLEA 5AQGA 3VTIA 3NVMA 1S72N 4BC3A 2HMPA 3LDLA 2CGLA 2V7YA 3HRGA 5BRFA 5E84A 3EE8A 5EOYA 2GUPA 4H5RA 3I8BA 2WC9A 2D0OA 4B9QA 1NGJA 3WT0A 5C10A 3EKSA 5AQYA 4YOVA 1CZAN 1W97L 2ASPA 4NLBA 3CD6N 2NNWA 5EY4A 3KVGA 3G6EN 3QDKA 2YI1A 1NLVA 3D6RA 2OANA 3VOVA 2IVOA 4IOXA 4BRNA 4XH4A 1SQKA 1BUPA 3H46O 3SMPA 4H0TB 4A5BA 5BPMA 2ZGZA 3SBTA 2WUSA 3SAFA 3IUCA 5CR4A 3CMEN 3W0LA 3KWIA 2HOEA 2P9KA 4B1WB 3NMUA 3WQUA 3UB5A 4YOUA 5JLFA 2E2PA 2BUPA 3VGLA 3VERA 3LM2A 4WQ4A 1NGEA 2FF3B 2GTDA 3HOSA 2QA4N 2QWPA 2QWMA 2NRZA 2QWNA 4DHYA 3U8XA 4IFEA 3WXKA 1HKCA 4BRPA 2Q0UA 5FPEA 4QS8A 1C0FA 3VF2A 3CCRN 5M1FA 3O4WA 4QS9A 4FL9A 1NGFA 4K25A 2QI2A 2P9SA 4L3QA 4BREA 4BG9A 3ZETA 1IJJA 2YHYA 4IWVA 3ULEA 2OTLN 3J8AA 1Q7YO 5F1XA 2QTDA 2V51B 1VQ8N 1BWFO 1Z05A 3C7NA 4BC5A 4BRDA 5BR9A 1VQ4N 3CQYA 3CJAA 5F2RA 5AQSA 4JEPA 4JD2A 1NGAA 2WBNA 3CERA 3ZYYX 4HTLA 2A42A 4BR7A 3I33A 3A5NC 1U2VB 3CJ9A 3OHRA 3SBGA 4A2AA 3TSPA 3AY9A 2PFUA 4IZ9A 1JCGA 1ZC6A 5H1SQ 3MCPA 1KAYA 2HSTA 4CZJA 4CBUA 4MO4A 3PIPL 2E2OA 3CI5A 4BRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CJ1 A;  5BPN A;  1HLU A;  3JS6 A;  2I7P A;  4IJA A;  3VF6 A;  2Q0R A;  4ISG A;  3WEE A;  2W41 A;  4CJ7 A;  4RWT A;  2UYT A;  2D4W A;  3MK6 A;  3SMS A;  2GEL A;  3MDQ A;  2CH5 A;  4BGB A;  3FZF A;  3P4I A;  1SAZ A;  4M7X A;  5LY3 A;  3HSC A;  4DCH A;  1D4X A;  2P9I B;  1NBW A;  4H0P A;  2YJE A;  3D2F A;  3VEN A;  3WXJ A;  4BR5 A;  4JHD A;  3UE5 A;  3C0B A;  1QZ6 A;  4H5W A;  1NGD A;  3RSE A;  4FPB A;  3ZET B;  3ZX0 A;  3ULE B;  5AQQ A;  1KXP A;  3WXI A;  4BR4 A;  1BOT O;  4M7Y A;  2P9L A;  5LJW A;  3WUH A;  3LDQ A;  2P9U A;  3C7N B;  1DGK N;  4GY2 B;  4CZL A;  2CGK A;  4A61 A;  3EO3 A;  4LC9 B;  1NMD A;  2D0P A;  1RFQ A;  4IO8 A;  1OKJ A;  2E1Y A;  1GLB G;  1YAG A;  5AQW A;  3VEX A;  1QHA A;  1V4S A;  4EIA A;  3GE1 A;  1MWM A;  5AR0 A;  3QBW A;  4PKI A;  4BR9 A;  2F9T A;  3FZH A;  4I6M A;  3BP8 A;  4FOI A;  2PBD A;  4IXC A;  3A5M C;  2W40 A;  3IDH A;  4CZF A;  4H0X B;  3WEE B;  2QXL A;  2FLO A;  3CJC A;  1Q18 A;  3R6M A;  4EHU A;  3QIC A;  1BA0 A;  3LDO A;  3AAQ A;  1ATS A;  1Z6R A;  4H03 B;  1EQY A;  1NGG A;  4BRH A;  3MN5 A;  4BRM A;  1T6D A;  2FF6 A;  1NGI A;  5AQJ A;  2DPN A;  4FPA A;  3FZM A;  3FZL A;  2A6A A;  3QFP A;  3QB0 A;  4Z94 A;  2E88 A;  4XH1 A;  1HJO A;  3RSE B;  2Q31 A;  4H0V B;  2NZT A;  1HKG A;  1GLE G;  4H5T A;  1BA1 A;  1E4G T;  1JCF A;  5ELZ A;  4Y0W A;  3IFR A;  2P9L B;  2IIR A;  5AQO A;  3VGK A;  1X3N A;  4JN4 A;  2P9U B;  3ENO A;  3ID8 A;  3DWL A;  2GEM A;  3KZB A;  4NO7 A;  5AFU A;  3H3N O;  3UKU B;  4BR2 A;  3VGM A;  5AQP A;  1LOT B;  4BRF A;  2A41 A;  2F9W A;  2Q1N A;  1LCU A;  1C0G A;  4I6M B;  5AQZ A;  3O8M A;  5E26 A;  1ZBS A;  1QQO A;  3ATV A;  2QWL A;  4B1U B;  3VES A;  4FWK A;  5JIC A;  3WXL A;  1NM1 A;  2CH6 A;  3M1F A;  2CGJ A;  4C23 A;  3VEV A;  5CE3 A;  4CI6 A;  5AQV A;  3SJH A;  1KAZ A;  3BF3 A;  2QW9 A;  4PKH A;  5AQL A;  1BO5 O;  3B8A X;  1DKG D;  2FSK A;  5BRH A;  5ADX A;  2QM1 A;  1QQN A;  4FWP A;  1BG3 A;  2ASO A;  4DB3 A;  5TKY A;  2ASM A;  1GLJ O;  2P9N A;  1WUA A;  3EZW A;  2NRH A;  4FWO A;  2I7N A;  1GLD G;  3DXM A;  3ZEU A;  4WYB A;  1T6C A;  3ENH A;  3U9Z A;  2P9K B;  3HBT A;  1ESV A;  4FSV A;  2AP1 A;  3SK3 A;  5AQR A;  1HPM A;  1NGH A;  1KAX A;  1BU6 O;  3LL3 A;  3D7E O;  2AA4 A;  1NGC A;  2ZGY A;  4EFH A;  3BEX A;  2P9P A;  4HWI A;  1K8K A;  4CZE A;  4KBO A;  4B1V A;  2VCP A;  4BGA A;  3CHW A;  5AQX A;  5AQU A;  2P9S B;  3U9D A;  3DXK A;  3BF1 A;  4FWR A;  1HUX A;  4FWS A;  3GOI A;  3L0Q A;  3O5B A;  3VEZ A;  3MN9 A;  5EVZ A;  5BN9 A;  3O80 A;  2GWK A;  3EL2 A;  4O5F A;  4XEI A;  4JD2 B;  3LDP A;  4FWL A;  3CJ7 A;  4M63 C;  3CET A;  2ITM A;  2BTF A;  3A5O C;  4H5N A;  2PAV A;  3S41 A;  1IG8 A;  5KQ8 A;  2P9N B;  4AM7 A;  3G25 A;  2FSJ A;  3BUZ B;  2KHO A;  2E2N A;  3FR0 A;  5KPZ A;  4BRG A;  3DXM B;  3ZEU B;  3WQT A;  4BRA A;  1V4T A;  2Q36 A;  5KPR A;  4BC4 A;  4PL7 A;  3DJC A;  2Q2R A;  5BRD A;  3FFK B;  4K42 A;  5BPL A;  4J8F A;  4GNI A;  4YDU C;  1MDU B;  3ZX3 A;  1TYQ A;  3GDQ A;  1ZXO A;  3QML A;  4H0Y B;  1YUW A;  4ISF A;  4BRQ A;  4BRI A;  3A8Y A;  2E20 A;  1K8K B;  2E8A A;  3D2F B;  4WQ5 C;  5JLH A;  4JHD B;  4CD3 A;  4CZH A;  5AZJ A;  5EX5 A;  5AQN A;  3H45 C;  4FWM A;  4BRK A;  2YJF A;  4CZI A;  3DXK B;  2H3G X;  1QQM A;  3EN9 A;  3VET A;  5LJV A;  3O1B A;  3LDN A;  3ATU A;  3VEW A;  1H1V A;  2QWQ A;  5AZI A;  1HX1 A;  1U2V A;  5JMV A;  2EWS A;  3IMX A;  1RDW X;  1X3M A;  4K41 A;  4RCH A;  4A62 A;  1X9J A;  3VPZ A;  4BQL A;  3GL1 A;  1GLL O;  1HKB A;  3JXU A;  3R8E A;  2FXU A;  4BRO A;  5FPN A;  1XC3 A;  3DAW A;  3L4I A;  5I9E B;  4BVP A;  3HI0 A;  5FPD A;  3FGU A;  1U6Z A;  1NWK A;  3QBX A;  3O08 A;  5AQH A;  1YVN A;  5B8H A;  3L6Q A;  4FWQ A;  3H1V X;  4AM6 A;  4K43 A;  2YHW A;  3H1Q A;  2NLX A;  4IJN A;  5AFU H;  3M3Z A;  3O1W A;  2HF4 A;  2FSN A;  4RTF D;  4QS7 A;  2J4R A;  5BN8 A;  3SLC A;  2P9I A;  4B1Y B;  4O8K A;  2V7Z A;  2A3Z A;  1E4F T;  1RGI A;  4CZG A;  2V52 B;  1TYQ B;  1YXQ A;  4B1Z A;  1TUY A;  4H5V A;  4EAH D;  1J6Z A;  1MWK A;  3AAR A;  3CQX A;  4MLH A;  3HZ6 A;  3LM9 A;  4H0O A;  5AZJ B;  2VYP A;  1R59 O;  3TU5 A;  3CJB A;  3FZK A;  4ISE A;  4CBW A;  1S22 A;  2VWB A;  1GLC G;  3H6E A;  3GG4 A;  4PKG A;  4YDU A;  5AQK A;  4BR0 A;  4DQ8 A;  2ZF5 O;  5AZI B;  1XUP O;  5ADX H;  3KHY A;  4PL8 A;  4MO5 A;  1GLF O;  2D1K A;  3D2E A;  3UKR A;  4BG8 A;  5KPT A;  4JNE A;  5AQI A;  3FLC O;  2YHX A;  4FOE A;  4WQ5 A;  4F9O A;  4CZK A;  5FPM A;  1MA9 B;  5AQM A;  3W3D A;  4FWN A;  3MN7 A;  3VEO A;  2E2Q A;  4XH5 A;  1DEJ A;  1ATR A;  2IVP A;  3HTV A;  3CIP A;  1GLA G;  3A0I X;  4CZM A;  1NGB A;  1BDG A;  3U4L A;  3A5L C;  4JAX A;  4NB4 A;  3MMV A;  4E1J A;  4B1X B;  4WQ4 C;  1XQS C;  5AQT A;  4BRC A;  3QFU A;  2Q97 A;  1ATN A;  3R9P A;  4BC2 A;  3F9M A;  5F0X A;  3FE1 A;  1SZ2 A;  1JCE A;  3H3O B;  1QZ5 A;  3EKU A;  4BVO A;  3HM8 A;  4CBX A;  2ZWH A;  2QWR A;  4FO0 A;  5KQD A;  1WOQ A;  4BQZ A;  3M6G A;  3TPQ A;  3VEY A;  1G99 A;  2E1Z A;  2IVN A;  1S3X A;  4CD1 A;  2GWJ A;  3ZX2 A;  2A40 A;  3UKU A;  3MN6 A;  3D2E B;  3UKR B;  2A5X A;  3VF4 A;  3AAP A;  5AQF A;  2QWO A;  4A2B A;  2P9P B;  4EHT A;  2YCH A;  5EXW A;  1P8Z A;  1TUU A;  2HF3 A;  5BRE A;  1T44 A;  3GBT A;  1Y64 A;  3O6W A;  4MLE A;  5AQG A;  4BC3 A;  2HMP A;  3LDL A;  2CGL A;  2V7Y A;  5BRF A;  5E84 A;  5EOY A;  2GUP A;  4H5R A;  3I8B A;  2D0O A;  4B9Q A;  1NGJ A;  3WT0 A;  3EKS A;  5AQY A;  1CZA N;  2ASP A;  5EY4 A;  3KVG A;  3QDK A;  2YI1 A;  1NLV A;  2OAN A;  3VOV A;  2IVO A;  4BRN A;  4XH4 A;  1SQK A;  1BUP A;  3H46 O;  3SMP A;  4H0T B;  5BPM A;  2ZGZ A;  2WUS A;  3IUC A;  3W0L A;  2HOE A;  2P9K A;  4B1W B;  3WQU A;  3UB5 A;  5JLF A;  2E2P A;  2BUP A;  3VGL A;  3VER A;  3LM2 A;  4WQ4 A;  1NGE A;  2FF3 B;  2GTD A;  2QWP A;  2QWM A;  2QWN A;  4DHY A;  3U8X A;  3WXK A;  1HKC A;  4BRP A;  2Q0U A;  5FPE A;  4QS8 A;  1C0F A;  3VF2 A;  3O4W A;  4QS9 A;  4FL9 A;  1NGF A;  4K25 A;  2P9S A;  4L3Q A;  4BRE A;  4BG9 A;  3ZET A;  1IJJ A;  2YHY A;  4IWV A;  3ULE A;  3J8A A;  5F1X A;  2V51 B;  1BWF O;  1Z05 A;  3C7N A;  4BC5 A;  4BRD A;  5BR9 A;  3CQY A;  3CJA A;  5F2R A;  5AQS A;  4JD2 A;  1NGA A;  3CER A;  4HTL A;  2A42 A;  4BR7 A;  3I33 A;  3A5N C;  1U2V B;  3CJ9 A;  3OHR A;  4A2A A;  3AY9 A;  4IZ9 A;  1JCG A;  1ZC6 A;  3MCP A;  1KAY A;  4CZJ A;  4CBU A;  4MO4 A;  2E2O A;  3CI5 A;  4BRL A; 
#chains in the Genus database with same CATH topology
 4V19 S;  5BPN A;  3M5R A;  4DWI A;  1VSH A;  4ISG A;  4BE1 A;  2W6K A;  3WEE A;  3DLL L;  2ZJQ L;  2WON A;  1NMN A;  4TSX A;  3KK1 A;  3I8D A;  1N36 K;  2D4W A;  1J54 A;  1LWC A;  1NJZ A;  3MDQ A;  4W5Q A;  1C1A A;  4CGH A;  1DT9 A;  3P4I A;  1TKX A;  3HVT A;  3SUQ A;  1SAZ A;  4M7X A;  1WN7 A;  2D0A A;  1NBW A;  1HQE A;  2YJE A;  3PLA A;  4BR5 A;  4GMJ B;  2HHT A;  2UU9 K;  4HHT A;  4FPB A;  2E6L A;  4CHN A;  2HHW A;  1KXP A;  2P9L A;  3TR8 A;  3LAK A;  4HUG A;  3KTQ A;  4RW9 A;  4NLC A;  5T7B A;  1SV5 A;  2CGK A;  4CJ3 A;  4GV9 A;  2Y1J A;  1NMD A;  1EX4 A;  2E1Y A;  3DLG A;  4JI2 K;  3VEX A;  5HP1 A;  1QHA A;  4IFV A;  2KW4 A;  1VQK N;  2HHV A;  4DTJ A;  4BR9 A;  4CJE A;  4DTP A;  3FZH A;  2RPI A;  3RMB A;  4DTN A;  2VWK A;  3CJC A;  1WSI A;  5HRP A;  3QIC A;  2F8T A;  3RMC A;  3TAQ A;  1QSS A;  3T1A A;  2B5J A;  4DLE A;  3C65 A;  4H03 B;  4FLX A;  1NGG A;  2FF6 A;  1B92 A;  1S1T A;  3DYA A;  1VSI A;  3O4N A;  4FVM A;  4GVE A;  3HT3 A;  1KFS A;  3FZL A;  2VG6 A;  3V9U A;  4CJR A;  3VQ7 A;  4Z94 A;  4CW7 B;  1TL1 A;  4XH1 A;  3SZ2 A;  2NUB A;  3RSE B;  2Q31 A;  3V9Z A;  2NZT A;  1GLE G;  2KQ2 A;  3IFR A;  4FW1 A;  1NG9 A;  5AQO A;  4JI0 K;  2KKZ A;  3TSU A;  1EO1 A;  3TAF A;  3K9J A;  3L2R A;  2VWJ A;  2GEM A;  4NO7 A;  3EE9 A;  1EXQ A;  5HLF A;  2QK9 A;  4CGJ A;  2HNZ A;  5FRM A;  2HNY A;  4CEC A;  3O9S A;  3IG1 A;  3UKU B;  1S9G A;  3O3H A;  1JL1 A;  1WBB A;  1CLQ A;  4ELU A;  2JWL A;  3M8S A;  2BDP A;  4BRF A;  1LCU A;  3NH1 A;  4KPY A;  2G8I A;  3TWH A;  1TK0 A;  4AHV A;  4CGD A;  4RW8 A;  2CH6 A;  4EP4 A;  3N4P A;  4Q0B A;  4Z0U A;  2O8D A;  4PKH A;  3THY B;  1BO5 O;  1D8Y A;  3RR7 A;  4E1N A;  1DKG D;  4CF1 A;  2P9N A;  1NOZ A;  2XHB A;  4W5O A;  4CF2 A;  4FJ5 A;  3NFA A;  3CC4 N;  3AA5 X;  3HOT A;  4WYB A;  3ENH A;  3MEE A;  3U9Z A;  3J80 O;  3JSM A;  5LMN K;  4CJV A;  4C1N I;  4LF5 K;  2O4G A;  2P9K B;  3HBT A;  1QVG M;  2XY6 A;  2RN2 A;  3HYF A;  3SK3 A;  5AQR A;  1HPM A;  4E89 A;  1NGH A;  4LD0 A;  1BU6 O;  1NGC A;  4CHO A;  2BE2 A;  4N56 A;  1X1P A;  1U47 A;  3R3L A;  2VG5 A;  3EY1 A;  4DTU A;  3U9D A;  4JI3 K;  1HUX A;  3TAP A;  2Z1H A;  3G4S N;  3L0Q A;  1Q86 O;  4CFB A;  1SL2 A;  5BN9 A;  3OYK A;  4DSJ A;  4OVL A;  1KCF A;  2IDO A;  2ETJ A;  4E1M A;  3EL2 A;  4XEI A;  2F7T A;  3VA0 A;  4LSN A;  3CJ7 A;  3SAH A;  1YT3 A;  3CET A;  4CCH A;  1NJW A;  3MCA B;  2BTF A;  3A5O C;  3TAE A;  1JLA A;  4JRP A;  4CJW A;  2E2N A;  1QQC A;  3IAY A;  3DXM B;  1CZ9 A;  2YV0 X;  4KO0 A;  3WQT A;  4BRA A;  4WFN L;  4I7F A;  2Q36 A;  4BC4 A;  1VQL N;  5GAE P;  3FFK B;  4K42 A;  1MDU B;  4WFA L;  3LAM A;  1I94 K;  2G8F A;  4LFC K;  1C0T A;  1NK0 A;  3QML A;  2UUA K;  4B3R K;  4WQ5 C;  3P38 A;  5GIO A;  4L8R B;  4O8U A;  3PV8 A;  4KHN A;  4R79 A;  4FJ8 A;  4BRK A;  3AVL A;  2QEX N;  4CZI A;  3DXK B;  4CEB A;  5LJV A;  2NRX A;  3ZSZ A;  1HNW K;  2O8B B;  3LDN A;  3VEW A;  1H1V A;  5AZI A;  2KFN A;  4DQP A;  3J7Y P;  4FXD A;  2W42 A;  1QVF M;  4JS5 A;  4CEF A;  4CK1 A;  3GL1 A;  1GLL O;  4E19 A;  3L2Q A;  4KHS A;  3JXU A;  5M1Q A;  1EWR A;  1FKP A;  3AVI A;  4ILJ A;  1KVB A;  4BVP A;  3HI0 A;  1NKC A;  5FPD A;  3FGU A;  3QBX A;  3O08 A;  4FJK A;  5AQH A;  2HMI A;  3I0S A;  3VQC A;  2PY5 A;  1YF5 L;  4AM6 A;  4K43 A;  3LAN A;  4DMN A;  4IDK A;  4IJN A;  4JKC A;  5CZ2 A;  4QAG A;  3O1W A;  1RBT A;  4QS7 A;  1RT3 A;  1C0M A;  2P9I A;  4B1Y B;  4B3O A;  1BI4 A;  1EP4 A;  1BL3 A;  2V7Z A;  4A5A A;  3VQD A;  2JGU A;  4NCG A;  4KRF A;  4B1Z A;  4JKG B;  1D9F A;  1Z25 A;  4DR3 K;  3CQX A;  3CPE A;  3OVN A;  2FBV A;  5AZJ B;  2O8E B;  1R59 O;  5IWA K;  1RTD A;  3CJB A;  1M90 O;  2YHA A;  1YJN N;  3NF7 A;  3OBW A;  5HOO A;  4DQ8 A;  2ZF5 O;  2KFZ A;  5ADX H;  4KTZ A;  1ZBF A;  4MO5 A;  3UKR A;  4JV5 K;  2XY5 A;  3HP9 A;  2YHX A;  4F8R A;  4DV2 K;  5AJ3 K;  3V9S A;  5AQM A;  3RRH A;  4YY3 K;  3MXI A;  1ASW A;  2HBL A;  2B6A A;  1GLA G;  3CIP A;  4CJT A;  3THV A;  1LWF A;  1NGB A;  3NH0 A;  3VQ5 A;  3ZSW A;  4WFB L;  1E3M A;  3RTV A;  4NB4 A;  2HHS A;  2Q97 A;  4DV3 K;  3V9X A;  4BC2 A;  5JS1 A;  3F9M A;  1HMV A;  4R5P A;  4JI4 K;  2O8D B;  3NH2 A;  2DFH A;  1YIT N;  1ZBU A;  1DTQ A;  1O13 A;  1F21 A;  4GKK K;  3AO2 A;  3EKU A;  5GIN A;  1W7A A;  4PY5 A;  5DM6 L;  4CBX A;  1JKH A;  1WOQ A;  3V81 A;  3TPQ A;  2E1Z A;  1SL1 A;  4O0J A;  3HJF A;  4CD1 A;  3LDS A;  3CFP A;  1OVQ A;  4FLT A;  1B9D A;  2GX9 A;  1VSK A;  2VGN A;  2IS3 A;  2OPP A;  1P8Z A;  4CK2 A;  5BRE A;  2A1S A;  1XMO K;  3GBT A;  3M8P A;  1BHL A;  4OKK A;  3TAR A;  1ZBL A;  4J2A A;  2HMP A;  2V7Y A;  2P1J A;  5IT9 O;  2WC9 A;  2PZS A;  3J81 O;  3EKS A;  4CEO A;  3SJJ A;  4YOV A;  1CZA N;  3KVG A;  4O5B A;  3DLH A;  1WB9 A;  4XH4 A;  4RW4 A;  1SQK A;  1BUP A;  3H46 O;  4H0T B;  4DSF A;  4AHR A;  3SAF A;  1C1B A;  3W0L A;  3KWI A;  2HOE A;  3WQU A;  4F2S A;  4LFA K;  3AA2 A;  1IBM K;  2QWP A;  2QWM A;  2NRZ A;  4DQR A;  3OY9 A;  3P5J A;  1IKX A;  2F96 A;  3AVF A;  5M1F A;  2QI2 A;  2P9S A;  4L3Q A;  1IJJ A;  3OYE A;  1HYV A;  2OTL N;  3L8B A;  1Z05 A;  1HR0 K;  4BRD A;  5BR9 A;  3HPO A;  1VQ4 N;  3CQY A;  4JEP A;  3AVN A;  3T19 A;  4KAZ A;  2Z1G A;  4BR7 A;  3U6F A;  4W5T A;  3CJ9 A;  3TSP A;  4IZ9 A;  3QEV A;  4DSI A;  4F2R A;  1ZC6 A;  5H1S Q;  3MCP A;  3K59 A;  4CBU A;  4H8K A;  2E2O A;  4H0O A;  3HM8 A;  3CI5 A;  4DV4 K;  3CJ1 A;  5HRN A;  1OH7 A;  3AVH A;  3JS6 A;  3SQ2 A;  3VF6 A;  2Q0R A;  3TAM A;  3CG7 A;  1WNS A;  4RWT A;  2KTQ A;  3MK6 A;  3K5L A;  3B6P A;  2YKM A;  2CH5 A;  4BGB A;  3VQ8 A;  2HHQ A;  3NAE A;  3U3Y A;  5LY3 A;  4DCH A;  1D4X A;  2P9I B;  3LP3 A;  4H0P A;  3WXJ A;  1BI4 B;  2NRT A;  3UE5 A;  4O44 A;  4MDB A;  4OKJ A;  1QZ6 A;  2D0B A;  2FC0 A;  4B8A B;  4FK0 A;  3RSE A;  5GAG P;  4DF4 A;  5J2M A;  3ZX0 A;  2E6M A;  5AQQ A;  4WF9 L;  4CJF A;  1KC8 O;  4BR4 A;  4FVU A;  1TV6 A;  4J2B A;  3WUH A;  1DGK N;  1RTH A;  4DU4 A;  2D0P A;  3JAM O;  1RFQ A;  5EU7 A;  1OKJ A;  1KVA A;  3K5O A;  4JLH A;  5AQW A;  1XNR K;  3S3M A;  4FCY A;  3K0S A;  3CXC M;  5AR0 A;  3QBW A;  4PKI A;  1UAX A;  1K8A O;  1KD1 O;  3SQ0 A;  3AVM A;  3O9U A;  2BGG A;  4HUE A;  1Q18 A;  4RW6 A;  4KH5 A;  3OBY A;  3AAQ A;  4JKH A;  4AH9 A;  4N41 A;  3MN5 A;  4BRM A;  1T6D A;  1NGI A;  3OYB A;  1XHZ A;  2P51 A;  4Y1C A;  3IS9 A;  2YNF A;  5BR8 K;  1YTU A;  3SUP A;  3QB0 A;  3NCI A;  4FZY A;  2E88 A;  3CMA N;  3E66 A;  1BA1 A;  1JCF A;  1VQM N;  3QIN A;  2IIR A;  3VGK A;  2OCE A;  3T1H K;  2P9U B;  4CK3 A;  1K9M O;  1X9W A;  3F5T A;  3DWL A;  3ID8 A;  3OYA A;  4B9L A;  3KZB A;  4CEA A;  4DV7 K;  4FJ9 A;  2DTU A;  3HVR A;  1Q9Y A;  4AF1 A;  1RBV A;  3C6U A;  1XC9 A;  1FJG K;  3NF9 A;  1RT1 A;  5AFU A;  1I39 A;  3QNO A;  2XRI A;  4AQY K;  5AQP A;  4I6M B;  3O8M A;  3ATV A;  2QWL A;  1SKS A;  1TKZ A;  4HCB A;  3WXL A;  3OA9 A;  4IKF A;  2CGJ A;  4CI6 A;  3WXM B;  3AVG A;  1VQ9 N;  2WFB A;  1Q8I A;  3FFI A;  3B8A X;  4K0K K;  2QM1 A;  1QQN A;  1J9A A;  2ASO A;  4DB3 A;  2ASM A;  3EYZ A;  1WUA A;  3EZW A;  3G10 A;  1L3S A;  3RMA A;  5M1N A;  1GLD G;  3DXM A;  4AIL C;  3OYI A;  1BQM A;  1T6C A;  4AHT A;  4FJN A;  2DY4 A;  1BCO A;  4U7B A;  4AHU A;  3CPW M;  4FJ7 A;  2AP1 A;  4YOX A;  1NNE A;  4KHU A;  4OPH A;  4Q5V A;  3KLE A;  4BWM A;  3AVB A;  5C24 A;  1S1X A;  1TK8 A;  1HNV A;  4Z4H A;  4FJG A;  3TAN A;  1Q82 O;  5AQX A;  2P9S B;  3KK7 A;  1SKR A;  1QSY A;  4BAC A;  3DXK A;  2O8B A;  3ULD A;  1TAQ A;  4FWS A;  3GOI A;  4DS5 A;  1REV A;  3O9R A;  1WSJ A;  4YOR A;  3MN9 A;  1XHX A;  3TAG A;  3O80 A;  4YOY A;  4FZZ A;  3RR8 A;  4O5F A;  3AA4 A;  4FLV A;  3LDP A;  5HBM A;  2G8W A;  1ZYQ A;  1GOC A;  1U4B A;  5CHI A;  5CZ1 A;  3O9Q A;  3LP1 A;  4CFA A;  3CCQ N;  2ITM A;  4DR2 K;  5C0Y A;  4KV8 A;  4B3S K;  2PAV A;  2G8K A;  1VHX A;  1N5Y A;  1BIZ A;  5KQ8 A;  3R1X A;  1RBS A;  3G25 A;  3ZT0 A;  2HHH K;  3RVC A;  3ZEU B;  3ZSR A;  3ENB A;  1V4T A;  4DV0 K;  3NGY A;  4PL7 A;  4OPJ A;  3AO5 A;  2Q2R A;  5BRD A;  1A5V A;  4J8F A;  1VSE A;  3K9K A;  1UA1 A;  4JKG A;  4GV3 A;  4BRI A;  3A8Y A;  2E20 A;  4UY8 O;  4DTS A;  3ALY A;  5JLH A;  2YHB A;  2X78 A;  5AZJ A;  2O8E A;  4CHY A;  5EX5 A;  4MFB A;  3HXM A;  3H45 C;  3E01 A;  4E3S A;  1J5E K;  2YJF A;  4LF6 K;  4C8L A;  1TAU A;  3KWG A;  3CQ8 A;  1VSL A;  3MWP A;  1U2V A;  3NF8 A;  2G8U A;  2IGI A;  2OPR A;  4ILG B;  4DU1 A;  2BH1 A;  1X3M A;  4K41 A;  4RCH A;  4A62 A;  4DSE A;  4DFM A;  3VPZ A;  1D5A A;  4BQL A;  1HKB A;  3DLK A;  4CJK A;  3R8E A;  4K8Z A;  3SQ4 A;  1VQ5 N;  2DFE A;  5I9E B;  4GVM A;  4FM2 A;  5DK5 A;  2QKK A;  5HRR A;  2IAJ A;  1YVN A;  3F2K A;  3TAB A;  3OJS A;  4FWQ A;  2NLX A;  1KSP A;  3VTH A;  2QKB A;  3BY5 A;  5HRO A;  1YIJ N;  1L5U A;  3V6D A;  3KKS A;  1DLO A;  2HB5 A;  2RE2 A;  4QOZ B;  1U49 A;  4O8K A;  1N34 K;  4OLB A;  4CZG A;  2V52 B;  1TYQ B;  5C2D A;  1YJ9 N;  1JLQ A;  2F8S A;  1ILY A;  4JI5 K;  2UXC K;  3AAR A;  1N8R O;  4B9S A;  4MLH A;  3BDP A;  3TTD A;  2XY7 A;  2VYP A;  4JI1 K;  3FZK A;  4ISE A;  4LFB K;  3O4Q A;  1GLC G;  4CVN E;  5GIP A;  3H6E A;  3F73 A;  3GG4 A;  4YDU A;  5AQK A;  4YOT A;  1U48 A;  4JKE A;  3KHY A;  4PL8 A;  4LF8 K;  2D1K A;  4F3O A;  4DUY K;  3QET A;  3FLC O;  4CZK A;  3HO1 A;  1MA9 B;  4CES A;  5JS2 A;  5JVH L;  1NJI O;  4OJR A;  1DEJ A;  3HTV A;  1IKV A;  4DFK A;  3A0I X;  4JK9 A;  4CZM A;  3KLG A;  4B1X B;  4WQ4 C;  4BRC A;  3QFU A;  1A5X A;  4QCL A;  1NJX A;  3O3G A;  3IKM A;  3Q7B A;  3FE1 A;  3AGK A;  2NRR A;  4FLU A;  4DU3 A;  4B9N A;  2HVH A;  4PQU A;  2ZWH A;  2QWR A;  1L3U A;  1HYS A;  4RW7 A;  3M6G A;  3K5M A;  3VEY A;  4DTM A;  3MXJ A;  1N32 K;  1S3X A;  3OTO K;  1FXX A;  3I56 N;  3ZX2 A;  5TKW A;  2E5L K;  1BIS A;  5KGW A;  3D2E B;  3VF4 A;  3AAP A;  3SAG A;  4A2B A;  4EHT A;  3VA3 A;  4M3R A;  3LPT A;  2HF3 A;  3LZI A;  1IBL K;  1T44 A;  3L2V A;  4MLE A;  1Y64 A;  5AQG A;  3LDL A;  4HTU A;  4KB0 A;  5BRF A;  5E84 A;  3EE8 A;  1VSF A;  3OS0 A;  1NU0 A;  3QEW A;  3WT0 A;  5C10 A;  5LMU K;  4CFD A;  3NGI A;  4M3X A;  1X9S A;  5EY4 A;  1SL0 A;  2X74 A;  3NF6 A;  1NLV A;  3VOV A;  4FLZ A;  1VRT A;  3SQ1 A;  4N5S A;  3EZ5 A;  5BPM A;  3IRX A;  2WUS A;  3OYN A;  4DUZ K;  4JI7 K;  3CME N;  3ZCM A;  4DS4 A;  3KK2 A;  3NMU A;  1S1U A;  5JLF A;  2E2P A;  3VER A;  3OYJ A;  4I9Q A;  4KRE A;  3HOS A;  2QA4 N;  1LW2 A;  1QE1 A;  4M3U A;  4DSK A;  4DHY A;  3U8X A;  4IFE A;  1HRH A;  2ZQB A;  3K2P A;  3C6T A;  3VF2 A;  3O4W A;  2VQE K;  3T3F A;  3VQP A;  1T7P A;  4CJS A;  3EEQ A;  2YHY A;  3ITH A;  4IWV A;  4B8C A;  3J8A A;  2QTD A;  1EKE A;  5F2R A;  4JD2 A;  3P1G A;  2O8F A;  1XMQ K;  3ZYY X;  2A42 A;  4EZ6 A;  1WSF A;  2Q3S A;  3A5N C;  1U2V B;  1ZBH A;  4A2A A;  3HL8 A;  4C8O A;  3L3U A;  3PIP L;  1S1V A;  4PWD A;  4I2Q A;  1HLU A;  2I7P A;  2W41 A;  4CJ7 A;  5C15 A;  3G71 N;  2YNI A;  3DOL A;  3SMS A;  3CCU N;  2FBT A;  3PUF A;  2WOM A;  3CCJ N;  4FW2 A;  3FZF A;  4JKA A;  3MAQ A;  3N4Q A;  1C1C A;  1VQ7 N;  3DI6 A;  2HBJ A;  3C0B A;  4KI4 A;  4FLW A;  4H5W A;  1NGD A;  3HPH A;  3D45 A;  4B3M K;  3K58 A;  3WNF A;  2QXF A;  5M1P A;  2BAN A;  3WXI A;  1BOT O;  3AGR A;  4O55 A;  3OYF A;  4O4G A;  2P9U A;  1K73 O;  3C7N B;  4GY2 B;  4CZL A;  4A61 A;  3KD5 E;  3E9L A;  4LC9 B;  4IO8 A;  1RT4 A;  5D3G A;  1VQP N;  1GLB G;  1YAG A;  1RDA A;  1YTA A;  1V4S A;  4CE9 A;  3M8R A;  4EIA A;  2Z1J A;  3I55 N;  2UXD K;  1LAV A;  3E9P A;  4I6M A;  3BP8 A;  4FOI A;  3C94 A;  3J7Z O;  4LF4 K;  3A5M C;  1GOB A;  4CF8 A;  3IDH A;  4H0X B;  3R6M A;  4EHU A;  1BA0 A;  4YNQ A;  3ASM A;  3LWM A;  3RRG A;  2JWK A;  1Z6R A;  4CEE A;  2Z1I A;  2O8C B;  1EQY A;  1M1K O;  3U3G A;  4BRH A;  1RBU A;  2DPN A;  4FPA A;  4PA1 A;  3CCL N;  2ZE2 A;  4C8N A;  4JKB A;  2A6A A;  3QFP A;  4BDZ A;  1RT2 A;  1HJO A;  1CXU A;  4H0V B;  4H5T A;  1HKG A;  1O1W A;  2HHX A;  1E4G T;  4IEE A;  5ELZ A;  2JLE A;  1YHQ N;  1X3N A;  4CJP A;  3S3N A;  3PY8 A;  1ASU A;  3DLE A;  4DQQ A;  3QEP A;  4Z4F A;  4UQG A;  4WE1 A;  2OA8 A;  4CEZ A;  3VGM A;  1IKY A;  3UIQ A;  2A41 A;  2F9W A;  3ZSX A;  5AQZ A;  5E26 A;  1ZBS A;  1QQO A;  2VQF K;  4Z4I A;  4M42 A;  3VES A;  4FWK A;  3PSF A;  3MXM A;  1NM1 A;  1XI1 A;  4LY7 A;  4FZX C;  1JLF A;  3OS1 A;  3AO4 A;  3CM5 A;  2FBX A;  1VSJ A;  3DLB A;  4LF9 K;  4C23 A;  1LAW A;  3VEV A;  5CE3 A;  1Q81 O;  5AQV A;  3SJH A;  1KAZ A;  1RDB A;  3CCM N;  4DTO A;  5AQL A;  4CER A;  1BQN A;  4DV6 K;  5MLC Q;  4KTW A;  2I5J A;  1BG3 A;  5TKY A;  3KKR A;  5C2F A;  1GLJ O;  4LF7 K;  1K6Y A;  3AVC A;  4IEI A;  4FWO A;  2I7N A;  3VQ9 A;  3ZEU A;  2HBK A;  1S5J A;  3OW2 M;  1NK8 A;  4KHY A;  3NHG A;  4I2P A;  3CFR A;  1ZBI A;  3LL3 A;  4C8M A;  4DV1 K;  4NYN A;  2P9P A;  4CZE A;  4KBO A;  3L2W A;  2VCP A;  1YI2 N;  4FJL A;  4CHP A;  1HJR A;  5HRS A;  4W5R A;  4B9U A;  3V1Q A;  4FWR A;  3MED A;  3LAL A;  3PSI A;  5E41 A;  3HM9 A;  4ILH A;  1T8E A;  1HNI A;  4MDA A;  1NOY A;  1TVR A;  4JD2 B;  3H08 A;  3CCS N;  1CZB A;  2O8F B;  1S6P A;  4CF0 A;  4Z4G A;  4M63 C;  2O4I A;  1RT6 A;  4BE0 A;  2HND A;  5SWM A;  1W0H A;  3S41 A;  1IG8 A;  3KIO A;  4OGC A;  4AM7 A;  2FSJ A;  3BUZ B;  3SV4 A;  4BRG A;  3SI6 A;  1KFD A;  1OH5 A;  4J2D A;  1GOA A;  2GBZ A;  2GV9 A;  4GNI A;  4F3T A;  4I9L A;  4A57 A;  3ZX3 A;  3CCV N;  4M3Z A;  3O9T A;  3ZSQ A;  2RKI A;  4JI6 K;  1TYQ A;  3GDQ A;  5FRO A;  1D9D A;  3PX0 A;  3RWU A;  1YUW A;  4CJ4 A;  3MEG A;  4BRQ A;  4YHH K;  4DR1 K;  1K8K B;  5FRN A;  2YX6 A;  3BZC A;  4CD3 A;  4CZH A;  4JS4 A;  4CF9 A;  3S3O A;  1YVU A;  2D0C A;  4CGI A;  4LH5 A;  4BE2 A;  1FKO A;  2H3G X;  1QQM A;  1RIL A;  3VET A;  3O1B A;  3ATU A;  5C12 A;  4FJI A;  4OLA A;  1HNX K;  4C8K A;  3AA3 A;  5JMV A;  4ID5 A;  3IMX A;  1N6Q A;  4IO9 L;  2OZM A;  1OVY A;  1X9J A;  4KHW A;  1QTM A;  5JVG L;  2HBM A;  3NE6 A;  1L3V A;  2VGM A;  2FXU A;  1XC3 A;  4LSL A;  3AVA A;  3DAW A;  3L4I A;  3AO1 A;  3OS2 A;  1U6Z A;  3P31 A;  5HL7 L;  4M45 A;  1JLG A;  3L6Q A;  4JKF A;  1W2B M;  3DMJ A;  5AFU H;  3M3Z A;  4H4M A;  2HF4 A;  2FSN A;  1P90 A;  2J4R A;  5BN8 A;  3SLC A;  3CCE N;  1IKW A;  1CXQ A;  1E4F T;  1RGI A;  3AVJ A;  1YXQ A;  3VQQ A;  4K8X A;  1J6Z A;  1MWK A;  5J1E A;  3QEI A;  3LM9 A;  1G15 A;  4CIF A;  3MEC A;  1KVC A;  2PYL A;  1HPZ A;  4DSL A;  2OPQ A;  4PKG A;  4BR0 A;  2ZJP L;  1XUP O;  3TSQ A;  3D2E A;  2AJQ A;  4BG8 A;  5KPT A;  4JNE A;  5KGX A;  4FOE A;  3KJV A;  4IOC L;  4WQ5 A;  4F9O A;  5J2Q A;  1OH8 A;  1EWQ A;  3F9K A;  3KLF A;  3W3D A;  1EET A;  3MN7 A;  3VEO A;  4XH5 A;  5LL6 Z;  4J2E A;  4DR5 K;  1KTQ A;  1C6V A;  3T69 A;  2LSN A;  4JAX A;  4BWJ A;  3P83 D;  1XQS C;  5M1O A;  2ZJR L;  3OYM A;  4FJH A;  4JKD A;  4U67 L;  5F0X A;  4DR7 K;  1SZ2 A;  3D0P A;  3ID6 A;  1JCE A;  4PHT X;  2A1R A;  4BVO A;  4FO0 A;  3VMF B;  4CEQ A;  2NRW A;  1I3A A;  2IVN A;  3VQA A;  4IG0 A;  2GWJ A;  1VQO N;  4LH4 A;  3L2U A;  4DQI A;  3ZT2 A;  2ITG A;  4JK7 A;  2A5X A;  5CYM A;  5AQF A;  3L3V A;  4IBN A;  2P9P B;  2YCH A;  1TUU A;  1FW6 A;  4OPK A;  3THX B;  3O6W A;  2IC3 A;  3VTI A;  3K5N A;  1S72 N;  2IOC A;  3VQ6 A;  2CGL A;  1R0A A;  5KRT A;  3HRG A;  3OYD A;  1BIU A;  5EOY A;  4X62 K;  1IBK K;  2GUP A;  4X64 K;  4H5R A;  2XY8 A;  4Y1D A;  2D0O A;  3NDK A;  4B9Q A;  5AQY A;  2ASP A;  1W97 L;  4M41 A;  4NLB A;  4ZHR A;  5J2P A;  2NNW A;  2YI1 A;  3D6R A;  4BRN A;  1VK0 A;  1RT7 A;  1DTT A;  3DRS A;  4A5B A;  2ZGZ A;  3IUC A;  5CR4 A;  4B1W B;  3UB5 A;  4X65 K;  4YOU A;  4YFU A;  3QNN A;  3VGL A;  3SCX A;  1LV5 A;  1NGE A;  2FF3 B;  2GTD A;  1J53 A;  2QWN A;  1HKC A;  5FPE A;  3V9W A;  1KLN A;  3CCR N;  4FL9 A;  2EHG A;  1NGF A;  4K25 A;  1S9E A;  4BRE A;  4BG9 A;  4OKE A;  2R7Y A;  4CJ5 A;  5F1X A;  4CGG A;  3S9H A;  2YNH A;  3C7N A;  4ICL A;  3I0R A;  5AQS A;  4G1Q A;  1NGA A;  2W6L A;  4ZTJ A;  3I33 A;  3QEX A;  4BDP A;  2HW3 A;  3SBG A;  1IG9 A;  3AY9 A;  2ZD1 A;  4MO4 A;  3OYH A;  1HYZ A;  4CGF A;  4BY9 C;  4IJA A;  3SUO A;  4KTQ A;  4F4K A;  4CHQ A;  2UYT A;  4E7J A;  3OYC A;  5GAH P;  5KRS A;  3AO3 A;  1MU2 A;  2GEL A;  2O8C A;  4DFJ A;  3QO9 A;  5DMR A;  3BZK A;  1BCM A;  4KFB A;  3ZT4 A;  2HHU A;  3HSC A;  3D2F A;  3VEN A;  4JHD A;  4KH6 A;  4E7L A;  1T3V A;  3C6A A;  2GUI A;  3ZET B;  1TKT A;  1VAZ A;  3ULE B;  2UUB K;  4M7Y A;  5LJW A;  1WBD A;  3LDQ A;  1OH6 A;  1L3T A;  1J5O A;  4H4O A;  2ATQ A;  3OYL A;  1NK6 A;  3ZLJ A;  3EO3 A;  3PO4 A;  2DFF A;  1FK9 A;  1JL2 A;  2OZS A;  3GE1 A;  2F4V K;  3A2F A;  4FM0 A;  4ELT A;  3HK2 A;  1MWM A;  2F9T A;  1Q9X A;  2PBD A;  2OYQ A;  5DM7 L;  4IXC A;  2P5O A;  1RCH A;  2W40 A;  1HNZ K;  4CZF A;  3WEE B;  2QXL A;  2FLO A;  4DR4 K;  1LW0 A;  2X6N A;  4B9T A;  1KRP A;  3LDO A;  1ATS A;  4KB1 A;  1WSH A;  1A5W A;  4ZTF A;  3THW A;  1S1W A;  3ZSY A;  5AQJ A;  1JLE A;  4JK8 A;  3TTC A;  3LWL A;  1T03 A;  3FZM A;  3T1Y K;  4A59 A;  2XO7 A;  2YNG A;  3KK3 A;  2WTU A;  1RTI A;  1VRU A;  5SZT A;  4OGE A;  4CIG A;  1RT5 A;  3QES A;  4Y0W A;  2P9L B;  4E0D A;  4JN4 A;  1WLJ A;  3ENO A;  1RBR A;  5GAD P;  4NCB A;  3H3N O;  3LP0 A;  1VSM A;  4BR2 A;  2NRV A;  1LOT B;  2Q1N A;  3ISN C;  1C0G A;  3WNG A;  1TGO A;  1RNH A;  4N47 A;  4B1U B;  3V1R A;  5JIC A;  4FJX A;  1SKW A;  1IO2 A;  1U04 A;  3M1F A;  1QHT A;  1TK5 A;  4NYF A;  4CIE A;  3MX5 A;  2G8V A;  2RF2 A;  3BF3 A;  2QW9 A;  1NKB A;  2FSK A;  3HPG A;  3DRR A;  5BRH A;  5ADX A;  4DTR A;  4FWP A;  5J2N A;  3RMD A;  4KHP K;  3CM6 A;  1Z26 A;  1JJ2 M;  4B3T K;  2NRH A;  4CJL A;  1TKD A;  1VSD A;  4O0I A;  5FDL A;  4B9V A;  3QIP A;  4N76 A;  1ESV A;  4FSV A;  5I42 A;  3MWT A;  4DG1 A;  1KAX A;  3D7E O;  2AA4 A;  4EFH A;  2ZGY A;  4YOW A;  3BEX A;  4CED A;  4Z4E A;  4HWI A;  1K8K A;  1N33 K;  5I3U A;  4B1V A;  4BGA A;  3KLH A;  4OO1 J;  3QIO A;  3CHW A;  3DRP A;  2KZZ A;  1NKE A;  3B6O A;  5AQU A;  5K14 A;  2EX3 A;  3VQB A;  3ZT3 A;  4CFC A;  3BF1 A;  4DV5 K;  3AVK A;  3E9O A;  3O5B A;  4DTX A;  1HQU A;  3VEZ A;  5EVZ A;  1U45 A;  1YJW N;  1QSL A;  2GWK A;  4DR6 K;  4AHC A;  3SPY A;  1NK4 A;  1RDC A;  3T7Z A;  4FWL A;  4KH4 A;  3ZT1 A;  4H5N A;  3OJU A;  3M8Q A;  4JI8 K;  4FK2 A;  3TTF A;  1S6Q A;  2P9N B;  2E4L A;  4CJU A;  1UWB A;  1T05 A;  4OX9 K;  2KHO A;  4HCC A;  3FR0 A;  5KPZ A;  3NVK A;  1JXE A;  5KPR A;  3DJC A;  3VN5 A;  3KLI A;  5BPL A;  4YDU C;  3HP6 A;  1ZXO A;  1IH7 A;  4H0Y B;  4KKO A;  4ISF A;  3Q7C A;  3C6H A;  2E8A A;  3D2F B;  4JHD B;  3SYZ A;  4JRQ A;  1SUQ A;  1NK9 A;  5AQN A;  4FWM A;  3MX2 A;  2VG7 A;  3SNN A;  1ITG A;  4IDH A;  4E7K A;  3EN9 A;  4OPA A;  2Y1I A;  2QWQ A;  5C25 A;  5KTQ A;  1HX1 A;  4FM1 A;  1NK7 A;  2EWS A;  3DM2 A;  1RDW X;  4M3T A;  1KQS M;  1SS6 A;  1WSE A;  4IOA L;  5A2Q O;  3P39 A;  4FLY A;  4BRO A;  5FPN A;  1NWK A;  3OYG A;  1UA0 A;  5B8H A;  4CJQ A;  3H1V X;  2KLA A;  2YHW A;  3H1Q A;  3LZJ A;  1VQN N;  4RTF D;  3PX4 A;  3O3F A;  3PO5 A;  4MQ3 A;  4DLG A;  3V4I A;  2HVI A;  4Z4C A;  4WCE L;  4RG8 A;  4G9Z A;  2A3Z A;  3THW B;  3LP2 A;  3TI0 A;  3L4Q A;  1TUY A;  4H5V A;  4EAH D;  5CYQ A;  2D5R A;  3HZ6 A;  3DOK A;  3PX6 A;  4NXM K;  3TU5 A;  3SV3 A;  4CBW A;  3PIO L;  1S22 A;  4M3W A;  3DLR A;  2VWB A;  3ZSV A;  1NJY A;  5AZI B;  3BGR A;  1Y97 A;  4IG3 A;  4IFY A;  1GLF O;  2ZM6 K;  5AQI A;  4E7H A;  3NBP A;  1WAF A;  3SPZ A;  3NGZ A;  5FPM A;  2G8H A;  2RHK A;  4FJM A;  2UXB K;  4FWN A;  3THX A;  4C1N K;  1IV0 A;  4HUF A;  1C0U A;  2E2Q A;  1RDU A;  1ATR A;  2IVP A;  4EP5 A;  1XNQ K;  1W9H A;  3V1O A;  1BDG A;  1JLB A;  3U4L A;  3A5L C;  4B08 A;  2KZM A;  3MMV A;  4E1J A;  2PYJ A;  5AQT A;  5FLX O;  1ATN A;  3R9P A;  5M1K A;  4NCA A;  3WNE A;  1VQ6 N;  4DFP A;  3H3O B;  4HVJ A;  1QZ5 A;  3CF5 L;  4GKJ K;  3E1Y A;  4ID1 A;  4X66 K;  2P5G A;  5CY4 A;  2YKN A;  5KQD A;  3WNH A;  4BQZ A;  2OPS A;  1G99 A;  4FYD A;  4XIU A;  3SUN A;  1NK5 A;  2OTJ N;  1B9F A;  4GV6 A;  1XWL A;  2A40 A;  3MN6 A;  3UKU A;  3VQE A;  4EZ9 A;  3UKR B;  3CC7 N;  4DKW A;  2QWO A;  3HST B;  5EXW A;  4GW6 A;  3LPU A;  3K57 A;  1TL3 A;  3G0Z A;  2UUC K;  3NVM A;  4BC3 A;  2X6S A;  2B4J A;  1JLC A;  4PUO A;  3I8B A;  1NGJ A;  3THY A;  4AHS A;  4B9M A;  1X9M A;  3CYM A;  3CD6 N;  4KHQ A;  3G6E N;  3QDK A;  4W5N A;  3QLH A;  2OAN A;  2IVO A;  4IOX A;  1LWE A;  4E7I A;  4FJJ A;  3SMP A;  3VQ4 A;  4NXN K;  3SBT A;  1KLM A;  3C95 A;  2P9K A;  1JXB A;  2BUP A;  3LM2 A;  4WQ4 A;  4KI6 A;  1RTJ A;  3CFO A;  3QER A;  4CHZ A;  5KI6 A;  3KD1 E;  4BDY A;  3WXK A;  4BRP A;  2Q0U A;  4QS8 A;  1C0F A;  4DF8 A;  4DQS A;  4QS9 A;  3J7A P;  4JYA K;  4M3Y A;  1WAJ A;  3ZET A;  1BGX T;  3ZSO A;  1RDD A;  3ULE A;  1Q7Y O;  2V51 B;  1VQ8 N;  1UOC A;  1BWF O;  4BC5 A;  5C42 A;  3CJA A;  2WBN A;  3CER A;  4HTL A;  3AV9 A;  3JYT A;  1QS4 A;  2FBY A;  3OHR A;  2PFU A;  1WSG A;  4ELV A;  1JCG A;  1KAY A;  2HST A;  4CZJ A;  4FK4 A;  3CC2 N;  4BRL A;  1ASV A; 
#chains in the Genus database with same CATH homology
 3CJ1 A;  5BPN A;  1HLU A;  3M5R A;  3JS6 A;  4BY9 C;  2I7P A;  4IJA A;  3VF6 A;  2Q0R A;  4ISG A;  3WEE A;  3DLL L;  2W41 A;  2ZJQ L;  4CJ7 A;  5C15 A;  3G71 N;  4RWT A;  2UYT A;  2D4W A;  3MK6 A;  3SMS A;  5GAH P;  3CCU N;  2GEL A;  3MDQ A;  3CCJ N;  2CH5 A;  4BGB A;  1DT9 A;  3FZF A;  3P4I A;  4JKA A;  3N4Q A;  1SAZ A;  4M7X A;  5LY3 A;  3HSC A;  4DCH A;  1D4X A;  2P9I B;  1NBW A;  4H0P A;  1VQ7 N;  2YJE A;  3D2F A;  3PLA A;  3VEN A;  3WXJ A;  4BR5 A;  2NRT A;  4JHD A;  3UE5 A;  4KH6 A;  2HBJ A;  4MDB A;  3C0B A;  1QZ6 A;  4H5W A;  1NGD A;  3RSE A;  1T3V A;  4FPB A;  3C6A A;  5GAG P;  3ZET B;  3ZX0 A;  1VAZ A;  5M1P A;  3ULE B;  5AQQ A;  4WF9 L;  1KC8 O;  1KXP A;  3WXI A;  4BR4 A;  4FVU A;  1BOT O;  3AGR A;  2P9L A;  4M7Y A;  5LJW A;  3WUH A;  3LDQ A;  2P9U A;  1K73 O;  4NLC A;  3C7N B;  1DGK N;  4GY2 B;  4CZL A;  2CGK A;  4A61 A;  4GV9 A;  3E9L A;  3EO3 A;  4LC9 B;  1NMD A;  2D0P A;  1RFQ A;  4IO8 A;  1OKJ A;  2E1Y A;  1VQP N;  1GLB G;  1YAG A;  5AQW A;  3VEX A;  1VQK N;  1QHA A;  1V4S A;  4EIA A;  3GE1 A;  3I55 N;  3CXC M;  1MWM A;  5AR0 A;  3QBW A;  4PKI A;  4BR9 A;  2F9T A;  3E9P A;  3FZH A;  4I6M A;  3BP8 A;  4FOI A;  2PBD A;  1K8A O;  3J7Z O;  5DM7 L;  4IXC A;  3A5M C;  1KD1 O;  2W40 A;  3IDH A;  3O9U A;  4H0X B;  4CZF A;  3WEE B;  2QXL A;  2FLO A;  3CJC A;  1Q18 A;  3R6M A;  4EHU A;  3QIC A;  1BA0 A;  4KH5 A;  3LDO A;  3OBY A;  2JWK A;  1ATS A;  3AAQ A;  4JKH A;  1Z6R A;  3C65 A;  4H03 B;  1EQY A;  1M1K O;  1NGG A;  4BRH A;  3MN5 A;  4BRM A;  1T6D A;  2FF6 A;  1NGI A;  5AQJ A;  4JK8 A;  2DPN A;  3TTC A;  4FPA A;  3FZM A;  3CCL N;  4GVE A;  4JKB A;  3FZL A;  4A59 A;  2A6A A;  3QFP A;  3QB0 A;  4Z94 A;  2E88 A;  4XH1 A;  1HJO A;  3RSE B;  2Q31 A;  4H0V B;  3CMA N;  3E66 A;  2NZT A;  1HKG A;  1GLE G;  4H5T A;  1BA1 A;  1E4G T;  1JCF A;  4IEE A;  5ELZ A;  1VQM N;  4Y0W A;  3IFR A;  2P9L B;  2IIR A;  5AQO A;  3VGK A;  1YHQ N;  1X3N A;  4JN4 A;  2KKZ A;  3TSU A;  2P9U B;  1EO1 A;  3ENO A;  3K9J A;  1K9M O;  3F5T A;  3DWL A;  3ID8 A;  2GEM A;  3KZB A;  4NO7 A;  3EE9 A;  4AF1 A;  5GAD P;  5AFU A;  3H3N O;  3O9S A;  3UKU B;  4BR2 A;  2NRV A;  3VGM A;  2JWL A;  5AQP A;  1LOT B;  4BRF A;  2A41 A;  2F9W A;  2Q1N A;  1LCU A;  1C0G A;  4I6M B;  5AQZ A;  3O8M A;  5E26 A;  1ZBS A;  1QQO A;  3ATV A;  2QWL A;  4B1U B;  3VES A;  4FWK A;  5JIC A;  3WXL A;  1NM1 A;  2CH6 A;  3M1F A;  3N4P A;  3OA9 A;  2CGJ A;  4C23 A;  3VEV A;  5CE3 A;  1Q81 O;  4CI6 A;  3MX5 A;  5AQV A;  3WXM B;  3SJH A;  1KAZ A;  3BF3 A;  1VQ9 N;  3CCM N;  2QW9 A;  2WFB A;  4PKH A;  5AQL A;  1BO5 O;  3B8A X;  1DKG D;  2FSK A;  5MLC Q;  5BRH A;  5ADX A;  2QM1 A;  1QQN A;  4FWP A;  1BG3 A;  2ASO A;  4DB3 A;  5TKY A;  2ASM A;  5C2F A;  1GLJ O;  2P9N A;  1WUA A;  3EZW A;  1JJ2 M;  2NRH A;  4IEI A;  4FWO A;  2I7N A;  5M1N A;  1GLD G;  3DXM A;  3HOT A;  3CC4 N;  3ZEU A;  4WYB A;  1T6C A;  3ENH A;  2HBK A;  3U9Z A;  3OW2 M;  4C1N I;  4U7B A;  3CPW M;  2P9K B;  3HBT A;  1ESV A;  1QVG M;  4FSV A;  2AP1 A;  3MWT A;  3SK3 A;  4YOX A;  5AQR A;  1HPM A;  1NGH A;  1KAX A;  1BU6 O;  3LL3 A;  3D7E O;  2AA4 A;  1NGC A;  2ZGY A;  4OPH A;  4EFH A;  4YOW A;  3BEX A;  2P9P A;  4HWI A;  1K8K A;  4CZE A;  4KBO A;  4B1V A;  2VCP A;  4BGA A;  1YI2 N;  4OO1 J;  3CHW A;  1Q82 O;  5AQX A;  5AQU A;  3R3L A;  2P9S B;  3KK7 A;  3U9D A;  3DXK A;  3BF1 A;  4FWR A;  1HUX A;  3G4S N;  3E9O A;  4FWS A;  3GOI A;  3L0Q A;  4ILH A;  3O5B A;  3O9R A;  4YOR A;  3VEZ A;  4MDA A;  1Q86 O;  3MN9 A;  5EVZ A;  5BN9 A;  1YJW N;  3O80 A;  4YOY A;  2GWK A;  3EL2 A;  4O5F A;  4XEI A;  2F7T A;  4JD2 B;  3LDP A;  3CCS N;  3T7Z A;  4FWL A;  3CJ7 A;  4M63 C;  4KH4 A;  3SAH A;  3CET A;  5CHI A;  3O9Q A;  3CCQ N;  5C0Y A;  2ITM A;  3MCA B;  2BTF A;  3A5O C;  4H5N A;  2PAV A;  3S41 A;  3TTF A;  1IG8 A;  5KQ8 A;  3R1X A;  2P9N B;  4AM7 A;  3G25 A;  2FSJ A;  3BUZ B;  2KHO A;  2E2N A;  3FR0 A;  3RVC A;  4BRG A;  5KPZ A;  3DXM B;  3ZEU B;  4WFN L;  3WQT A;  4BRA A;  3ENB A;  1V4T A;  3NVK A;  2Q36 A;  5KPR A;  4BC4 A;  4PL7 A;  3DJC A;  1VQL N;  5GAE P;  2Q2R A;  5BRD A;  3FFK B;  4K42 A;  5BPL A;  4J8F A;  4GNI A;  4YDU C;  1MDU B;  3CC2 N;  4A57 A;  3ZX3 A;  4WFA L;  3K9K A;  3CCV N;  3O9T A;  1TYQ A;  3GDQ A;  1ZXO A;  3QML A;  4H0Y B;  4JKG A;  4GV3 A;  1YUW A;  4ISF A;  4BRQ A;  3Q7C A;  3A8Y A;  2E20 A;  3C6H A;  4BRI A;  4UY8 O;  1K8K B;  2E8A A;  3D2F B;  3P38 A;  4WQ5 C;  5GIO A;  5JLH A;  2YX6 A;  4JHD B;  4CD3 A;  4CZH A;  4O8U A;  5AZJ A;  5EX5 A;  5AQN A;  3H45 C;  4FWM A;  3MX2 A;  4R79 A;  4BRK A;  2YJF A;  2QEX N;  4IDH A;  4CZI A;  3DXK B;  2H3G X;  1QQM A;  3EN9 A;  2NRX A;  3VET A;  3O1B A;  3KWG A;  3LDN A;  4OPA A;  3ATU A;  5C12 A;  3VEW A;  1H1V A;  2QWQ A;  5AZI A;  1HX1 A;  3MWP A;  1U2V A;  5JMV A;  4ILG B;  1QVF M;  2EWS A;  3IMX A;  1RDW X;  1X3M A;  2BH1 A;  4K41 A;  4RCH A;  4A62 A;  1OVY A;  4IO9 L;  1X9J A;  3VPZ A;  1KQS M;  1SS6 A;  4BQL A;  3GL1 A;  1GLL O;  1HKB A;  2HBM A;  5JVG L;  3JXU A;  4IOA L;  3P39 A;  5M1Q A;  3R8E A;  2VGM A;  2FXU A;  4BRO A;  5FPN A;  1XC3 A;  1VQ5 N;  4ILJ A;  3DAW A;  3L4I A;  5I9E B;  4BVP A;  3HI0 A;  5FPD A;  3FGU A;  1U6Z A;  1NWK A;  3P31 A;  3O08 A;  3QBX A;  5AQH A;  5HL7 L;  1YVN A;  3F2K A;  5B8H A;  3L6Q A;  1YF5 L;  4FWQ A;  3H1V X;  4JKF A;  4K43 A;  4AM6 A;  1W2B M;  2KLA A;  2YHW A;  3H1Q A;  2NLX A;  4IJN A;  4JKC A;  5AFU H;  3VTH A;  3M3Z A;  3O1W A;  2HF4 A;  2FSN A;  1VQN N;  4RTF D;  1P90 A;  2J4R A;  4QS7 A;  3SLC A;  5BN8 A;  2P9I A;  4B1Y B;  1YIJ N;  3CCE N;  4WCE L;  2RE2 A;  4O8K A;  2V7Z A;  4A5A A;  4G9Z A;  2A3Z A;  1E4F T;  1RGI A;  4CZG A;  2V52 B;  1TYQ B;  1YXQ A;  5C2D A;  1YJ9 N;  4B1Z A;  1ILY A;  3L4Q A;  1TUY A;  4H5V A;  4JKG B;  4EAH D;  1J6Z A;  1MWK A;  3AAR A;  1N8R O;  3CQX A;  4MLH A;  3HZ6 A;  3CPE A;  3LM9 A;  4H0O A;  5AZJ B;  3TTD A;  5LJV A;  2VYP A;  1R59 O;  3TU5 A;  3CJB A;  3FZK A;  4ISE A;  1M90 O;  4CBW A;  3PIO L;  1S22 A;  2VWB A;  1YJN N;  1GLC G;  5GIP A;  3OBW A;  5HOO A;  3H6E A;  3GG4 A;  4PKG A;  4YDU A;  5AQK A;  4YOT A;  4BR0 A;  2ZF5 O;  5AZI B;  1XUP O;  4JKE A;  4DQ8 A;  5ADX H;  2ZJP L;  3KHY A;  4PL8 A;  3TSQ A;  4MO5 A;  1GLF O;  2D1K A;  3D2E A;  3UKR A;  4BG8 A;  5KPT A;  4JNE A;  5AQI A;  3FLC O;  2YHX A;  4FOE A;  4IOC L;  4WQ5 A;  4F9O A;  4CZK A;  5FPM A;  2RHK A;  1MA9 B;  5AQM A;  3W3D A;  4FWN A;  3MN7 A;  3VEO A;  4C1N K;  2E2Q A;  4XH5 A;  5JVH L;  1NJI O;  1RDU A;  1DEJ A;  1ATR A;  2HBL A;  2IVP A;  3HTV A;  1GLA G;  3A0I X;  3CIP A;  4JK9 A;  4CZM A;  1NGB A;  1BDG A;  3T69 A;  4WFB L;  3U4L A;  3A5L C;  4JAX A;  4NB4 A;  3MMV A;  4E1J A;  4B1X B;  4WQ4 C;  1XQS C;  5AQT A;  4BRC A;  3QFU A;  2Q97 A;  1ATN A;  5M1O A;  2ZJR L;  3R9P A;  4BC2 A;  5M1K A;  3IKM A;  3F9M A;  3Q7B A;  4JKD A;  4U67 L;  5F0X A;  3FE1 A;  1VQ6 N;  3AGK A;  1SZ2 A;  3ID6 A;  1YIT N;  2NRR A;  1JCE A;  4PHT X;  3H3O B;  1O13 A;  1QZ5 A;  3CF5 L;  3EKU A;  5GIN A;  3E1Y A;  4BVO A;  3HM8 A;  5DM6 L;  4CBX A;  2ZWH A;  2QWR A;  4FO0 A;  3VMF B;  5KQD A;  1WOQ A;  4BQZ A;  3M6G A;  2NRW A;  3TPQ A;  3VEY A;  1G99 A;  2E1Z A;  2IVN A;  2OTJ N;  1S3X A;  4CD1 A;  2GWJ A;  1VQO N;  3I56 N;  3ZX2 A;  5TKW A;  4GV6 A;  2A40 A;  3UKU A;  3MN6 A;  3D2E B;  3UKR B;  4JK7 A;  3CC7 N;  2A5X A;  3VF4 A;  4DKW A;  2GX9 A;  3AAP A;  3SAG A;  2VGN A;  5AQF A;  2QWO A;  4A2B A;  2P9P B;  4EHT A;  2YCH A;  5EXW A;  1P8Z A;  1TUU A;  2HF3 A;  5BRE A;  1T44 A;  3GBT A;  1Y64 A;  3O6W A;  4MLE A;  5AQG A;  3VTI A;  3NVM A;  1S72 N;  4BC3 A;  2HMP A;  3LDL A;  2CGL A;  2V7Y A;  3HRG A;  5BRF A;  5E84 A;  3EE8 A;  5EOY A;  2GUP A;  4H5R A;  3I8B A;  2WC9 A;  2D0O A;  4B9Q A;  1NGJ A;  3WT0 A;  5C10 A;  3EKS A;  5AQY A;  4YOV A;  1CZA N;  1W97 L;  2ASP A;  4NLB A;  3CD6 N;  2NNW A;  5EY4 A;  3KVG A;  3G6E N;  3QDK A;  2YI1 A;  1NLV A;  3D6R A;  2OAN A;  3VOV A;  2IVO A;  4IOX A;  4BRN A;  4XH4 A;  1SQK A;  1BUP A;  3H46 O;  3SMP A;  4H0T B;  4A5B A;  5BPM A;  2ZGZ A;  3SBT A;  2WUS A;  3SAF A;  3IUC A;  5CR4 A;  3CME N;  3W0L A;  3KWI A;  2HOE A;  2P9K A;  4B1W B;  3NMU A;  3WQU A;  3UB5 A;  4YOU A;  5JLF A;  2E2P A;  2BUP A;  3VGL A;  3VER A;  3LM2 A;  4WQ4 A;  1NGE A;  2FF3 B;  2GTD A;  3HOS A;  2QA4 N;  2QWP A;  2QWM A;  2NRZ A;  2QWN A;  4DHY A;  3U8X A;  4IFE A;  3WXK A;  1HKC A;  4BRP A;  2Q0U A;  5FPE A;  4QS8 A;  1C0F A;  3VF2 A;  3CCR N;  5M1F A;  3O4W A;  4QS9 A;  4FL9 A;  1NGF A;  4K25 A;  2QI2 A;  2P9S A;  4L3Q A;  4BRE A;  4BG9 A;  3ZET A;  1IJJ A;  2YHY A;  4IWV A;  3ULE A;  2OTL N;  3J8A A;  1Q7Y O;  5F1X A;  2QTD A;  2V51 B;  1VQ8 N;  1BWF O;  1Z05 A;  3C7N A;  4BC5 A;  4BRD A;  5BR9 A;  1VQ4 N;  3CQY A;  3CJA A;  5F2R A;  5AQS A;  4JEP A;  4JD2 A;  1NGA A;  2WBN A;  3CER A;  3ZYY X;  4HTL A;  2A42 A;  4BR7 A;  3I33 A;  3A5N C;  1U2V B;  3CJ9 A;  3OHR A;  3SBG A;  4A2A A;  3TSP A;  3AY9 A;  2PFU A;  4IZ9 A;  1JCG A;  1ZC6 A;  5H1S Q;  3MCP A;  1KAY A;  2HST A;  4CZJ A;  4CBU A;  4MO4 A;  3PIP L;  2E2O A;  3CI5 A;  4BRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...