2FSNA

Crystal structure of ta0583, an archaeal actin homolog, complex with adp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
325
structure length
310
Chain Sequence
MVVVGLDVGYGDTKVIGVDGKRIIFPSRWAVTIPVLSTDGGQTKFIYGKYASGNNIRVPQGDGRLASKEAFPLIAAALWESGIHVDLVIGSGTPLGTFDLEVKAAKEALENKVLTVTGPEGEVRQFNITRLIMRPQGVGAALYLLNQGIIEQQPGYGVVIDVGSRTTDVLTINLMDMEPVVELSFSLQIGVGDAISALSRKIAKETGFVVPFDLAQEALSHPVMFRQKQVGGPEVSGPILEDLANRIIENIRLNLRGEVDRVTSLIPVGGGSNLIGDRFEEIAPGTLVKIKPEDLQFANALGYRDAAERS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an archaeal actin homolog
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Structural protein
molecule keywords hypothetical protein Ta0583
total genus 71
structure length 310
sequence length 325
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17989 ALP_N Actin like proteins N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2fsnA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2fsnA01
2Q31A 4XH1A 1DGKN 2A3ZA 5AQWA 1BUPA 4H0TB 5AQJA 2FXUA 4IXCA 3R9PA 5ADXA 3FZLA 3LDLA 3FLCO 1TYQB 5AQFA 4BR7A 2BTFA 4MO4A 2OANA 5AQSA 3DJCA 1JCGA 1TUUA 3VEXA 3R6MA 1T44A 3QBXA 3DWLA 5AFUA 3F9MA 3QDKA 4B1XB 2E8AA 4K43A 1BO5O 1GLAG 1BOTO 2F9WA 4JD2B 4H0PA 1JCFA 5AFUH 3AARA 1D4XA 2IVOA 5AQZA 4MLHA 3WEEA 2FLOA 3S41A 2P9LA 3CJ7A 1X3MA 4Y0WA 1HKGA 4H0XB 1TYQA 4FOIA 1Z6RA 3D7EO 2Q0UA 2QWQA 1YAGA 2W41A 3VF2A 1NGDA 3C7NA 3HZ6A 4I6MB 2D0OA 4BC3A 3VOVA 3IMXA 3ID8A 3I8BA 4JAXA 4A2BA 4BRPA 3QICA 5LY3A 3H6EA 4WQ4A 1KAXA 2WUSA 1T6DA 3CQYA 4QS7A 3SK3A 1NGAA 4FWQA 5AQTA 2D1KA 1S3XA 1ZXOA 2PAVA 3QB0A 4B1UB 4NB4A 1J6ZA 3M3ZA 4H03B 1ZC6A 4CZLA 5F1XA 4CZIA 3CI5A 3TPQA 3ZX2A 3O5BA 1OKJA 4FWNA 2I7PA 2NRHA 3MDQA 1U2VA 4WQ4C 3WXKA 5AQIA 3O80A 5JLHA 2VWBA 1LOTB 4RTFD 1DKGD 2J4RA 2E2OA 1X9JA 2V51B 3D2FA 4H5TA 3TU5A 4BRCA 3R8EA 4FOEA 5KQ8A 1QZ6A 3D2EB 3VEYA 4BVOA 3U8XA 2D4WA 2QM1A 4JD2A 1MWMA 3U9DA 3WXIA 4BRDA 1SQKA 5AQGA 1ATRA 1ESVA 4H5RA 2P9KA 3QBWA 1GLBG 1S22A 4QS8A 3UKRB 4H5WA 4FPAA 4BR9A 5AZJB 1C0GA 3VF4A 3DAWA 5AQRA 3A5NC 1ATNA 3D2FB 1QQOA 3O8MA 4ISGA 3ULEB 5AQVA 1HLUA 1YUWA 1HJOA 4IWVA 5KPRA 1XQSC 3GG4A 4CZFA 2E2QA 1MA9B 5ADXH 3KHYA 3CIPA 5BR9A 2P9UA 3SMPA 5AQQA 1QQNA 3B8AX 4CZJA 4KBOA 2P9UB 5I9EB 4JN4A 3LDOA 3WXJA 4CD1A 4NO7A 3G25A 2D0PA 3MN9A 5BRFA 3H1VX 4BC2A 5KPZA 4BC4A 3FZFA 3ZETB 3H45C 1RDWX 3H46O 2GEMA 2ASOA 3ZETA 4BRGA 1GLJO 1QQMA 1V4TA 2P9PA 2YHYA 1HX1A 4BG9A 5F0XA 3DXMA 5AQOA 3A5OC 4CBUA 4QS9A 2P9IB 1U2VB 2F9TA 1NMDA 4CBXA 3SJHA 5BRHA 1BG3A 3VPZA 3CJ1A 1MDUB 1K8KA 3EZWA 2E2PA 5F2RA 4H0VB 4IZ9A 5JLFA 5EXWA 1Q18A 2QW9A 3GE1A 3O4WA 5BN9A 1YVNA 2YJEA 3AAPA 3HI0A 3KZBA 3IDHA 3LDQA 4IO8A 3OHRA 3ZEUB 1C0FA 3IUCA 4A61A 4GY2B 5BRDA 2V52B 1KXPA 2CGJA 4PL7A 4XH5A 4IJAA 1MWKA 2QWLA 4CZMA 2P9SB 4H5NA 3BP8A 1IJJA 3EKUA 3DXMB 4WYBA 2ZGZA 3J8AA 4EAHD 1WOQA 1SZ2A 2P9KB 3VEOA 1NGCA 2P9LB 3W0LA 3EKSA 1HKCA 1NGFA 3CHWA 2A40A 3SLCA 3U4LA 5BN8A 3KVGA 3QMLA 4WQ5C 4B1VA 4BRAA 1IG8A 3W3DA 3UB5A 4FPBA 2GUPA 3MN5A 4BR0A 4H0OA 2ZGYA 1H1VA 3UKUA 3FE1A 4EHUA 5JMVA 5KQDA 4A2AA 2HOEA 2PBDA 4JHDA 2W40A 5AZJA 4ISEA 2QWRA 4WQ5A 5AR0A 4BR5A 2CGLA 1GLFO 4CZEA 5BPMA 1BU6O 2V7YA 4JHDB 5FPEA 1Z05A 3MK6A 4AM7A 3AY9A 3CJ9A 5AQXA 4BVPA 4PKGA 4EIAA 4YDUC 3MCPA 3GL1A 1NLVA 3BF3A 2Q97A 2AP1A 2Q1NA 3D2EA 3LDNA 4FL9A 1HKBA 1E4GT 5BPNA 4K41A 3I33A 2A5XA 2P9IA 3BUZB 3ENHA 3H3OB 5FPMA 2CGKA 1RGIA 1YXQA 4FWKA 4K42A 5E84A 1BA0A 2VYPA 4EFHA 5CE3A 1NGGA 5AQUA 4CZGA 5KPTA 2GWKA 4M63C 3VETA 1XC3A 2YCHA 4GNIA 5AQPA 4J8FA 4FWOA 4B1WB 4CI6A 2QWOA 3O08A 3M6GA 2Q0RA 3ZX0A 1GLLO 4BREA 2P9NA 1K8KB 3VGLA 2QWNA 2Q2RA 4LC9B 2YHXA 4XH4A 2P9NB 2A41A 2QXLA 3EO3A 3P4IA 3WEEB 4DQ8A 5AZIB 5AQHA 4BG8A 1HPMA 2IVNA 2HMPA 3HBTA 2GTDA 3ULEA 2HF3A 2CH5A 1EQYA 3LL3A 4DB3A 2FF6A 2P9SA 1NGBA 4BRMA 3UKUB 2AA4A 4E1JA 3DXKB 4B1YB 4Z94A 2P9PB 2YI1A 4BQZA 4ISFA 1BWFO 1ZBSA 2IVPA 3GOIA 2NZTA 4XEIA 3O1WA 3H3NO 3GBTA 2Q36A 4IJNA 4K25A 5EY4A 1GLDG 1NWKA 5AZIA 4JNEA 1E4FT 1SAZA 3MMVA 4M7YA 4FWMA 1RFQA 3VEZA 4FWPA 3JS6A 3UE5A 5B8HA 1GLEG 4BR2A 3IFRA 3O6WA 3VF6A 1U6ZA 1DEJA 4YDUA 5TKYA 3L6QA 2ASMA 4FWLA 4CD3A 2E20A 3VGMA 2NLXA 2DPNA 1NM1A 4HTLA 3SMSA 1Y64A 4O8KA 3O1BA 4RCHA 5AQLA 5AQNA 1NBWA 2I7NA 5BPLA 3MN6A 5AQKA 4DHYA 2KHOA 3FZHA 3ENOA 4BRHA 1NGEA 1G99A 3A8YA 3FFKB 3ATVA 2FSJA 3L0QA 4BRFA 1NGJA 4O5FA 2A6AA 2CH6A 3UKRA 2FSNA 3FZKA 5ELZA 5JICA 3AAQA 4C23A 4PL8A 4H0YB 5EOYA 1CZAN 3QFUA 3WQTA 2ZWHA 4FO0A 4PKIA 1R59O 2A42A 2E88A 4CBWA 3EL2A 4F9OA 5LJVA 4BR4A 5FPNA 5AQYA 1BDGA 3CQXA 4AM6A 3FR0A 4H5VA 4B1ZA 3HTVA 3JXUA 3U9ZA 4BRNA 4MO5A 4FWSA 3VERA 3CJCA 4BC5A 2EWSA 1X3NA 1WUAA 3A0IX 4MLEA 4CJ7A 3C0BA 3L4IA 3LM9A 3CJBA 2ITMA 1ATSA 2BUPA 3VESA 2E2NA 1JCEA 3M1FA 3CETA 1LCUA 2IIRA 2GWJA 4BGAA 2E1YA 1GLCG 4BQLA 3MN7A 2VCPA 4HWIA 3BEXA 1BA1A 3ZEUA 3WXLA 1KAZA 3WUHA 2UYTA 3RSEA 3FZMA 3BF1A 3FGUA 3ZX3A 2HF4A 3RSEB 2FF3B 2YHWA 1HUXA 1QZ5A 3WT0A 3GDQA 1KAYA 3LM2A 3C7NB 3EN9A 4I6MA 4BRQA 2GELA 3HSCA 2QWMA 1QHAA 2QWPA 1P8ZA 4BRLA 2V7ZA 3QFPA 3VEWA 3A5MC 1XUPO 4BROA 4B9QA 3CJAA 3ATUA 5EVZA 2YJFA 2H3GX 5AQMA 3VEVA 5EX5A 1NGHA 4EHTA 3LDPA 2FSKA 3CERA 4M7XA 1TUYA 4L3QA 4CZKA 4RWTA 5E26A 3DXKA 3H1QA 4FSVA 4BGBA 2E1ZA 3A5LC 4CZHA 4A62A 5FPDA 2ZF5O 4BRIA 2ASPA 1T6CA 4FWRA 3VENA 4BRKA 4DCHA 1NGIA 3WQUA 1V4SA 4PKHA 3HM8A 5LJWA 3VGKA 5BREA
chains in the Genus database with same CATH superfamily
3I8DA 3QETA 2OYQA 1DGKN 5AQWA 4DS4A 4WFAL 2R7YA 4CJ5A 3TAEA 1N5YA 2BTFA 4MDAA 2OANA 1DTTA 4NCGA 1B92A 2F96A 1TUUA 3VEXA 3ZT1A 3TTDA 1T44A 3QBXA 3G71N 1NJWA 4CVNE 2A1RA 4K8XA 4B1XB 5LL6Z 3QERA 2O8DB 4H0PA 5AFUH 2VGMA 4CJRA 3VQBA 1Q9XA 3O9TA 1RT2A 4MLHA 1VRTA 3CJ7A 4Y0WA 4H0XB 3TAFA 3OS1A 4B3TK 1NKBA 2HVIA 4FOIA 4DV1K 3HOTA 3ZYYX 3DMJA 1Z6RA 3D7EO 4LF6K 4KTQA 2O4GA 2OPRA 3QNNA 1HRHA 3C7NA 3HZ6A 1HR0K 4KTWA 2FBYA 3NF7A 3TAMA 3CM5A 3VOVA 3IMXA 3ID8A 1VQKN 3I8BA 4JAXA 4DTXA 1S1XA 5K14A 3LZIA 1EWRA 3M8QA 4M3RA 1NK0A 1T3VA 5LY3A 1N36K 4CGIA 1SL0A 1O1WA 2D1KA 3ZLJA 5M1NA 3QB0A 1ZBIA 2O8BA 4DUZK 4B1UB 4H03B 1QSYA 5SWMA 4CZIA 3CI5A 3O5BA 3OBWA 1OKJA 4GVEA 3O9RA 3NF9A 2I7PA 1HYSA 3WNFA 4LSLA 5C10A 5AQIA 4EZ9A 1I39A 1TK8A 1YJNN 1O13A 1LOTB 1DKGD 3D2FA 3TU5A 4CFCA 4FOEA 3B6PA 3QEXA 2NRZA 3U8XA 2QM1A 1LWFA 4CEZA 3OYGA 3THXA 4JV5K 1IV0A 3TARA 2KZMA 2E6MA 1I94K 1SQKA 4H5RA 3V6DA 1GLBG 4QS8A 4H5WA 4V19S 3EEQA 4FPAA 3E9OA 2QKBA 3SQ0A 3BGRA 4E1NA 3CC7N 1QQOA 3OJSA 5AQVA 1HLUA 1HJOA 4IWVA 3HL8A 3RMBA 5KPRA 4DUYK 2X6SA 3KHYA 5BR9A 3HP9A 4JI6K 1LAWA 1KVBA 3PIOL 5I9EB 4JN4A 1NU0A 4M3XA 3ZT3A 4K8ZA 3JYTA 3G25A 3MN9A 4KV8A 4PQUA 5KPZA 4B3SK 2F8TA 3FZFA 4DTJA 3H45C 1U4BA 2ASOA 4BE2A 5C42A 1NJXA 3ZETA 1U04A 2P9PA 2YHYA 1N8RO 3DXMA 4ILJA 4CBXA 4CIFA 4F2RA 3CJ1A 1MDUB 3MEDA 4KB1A 4FM1A 5F2RA 4H0VB 3KIOA 5JLFA 4DQRA 4BACA 5EXWA 1Q18A 2QW9A 4N41A 4IO8A 2GV9A 1C0FA 1ZBUA 3IUCA 4FW1A 4M3TA 2KTQA 2V52B 2CGJA 3ISNC 4IEEA 4L8RB 1MWKA 3BP8A 4KPYA 1D9FA 1BQNA 3VQ7A 2P9KB 3VEOA 1NGCA 2ETJA 4X62K 3CHWA 3N4QA 5BN8A 1WNSA 1S1WA 5JVGL 2XY5A 3W3DA 3UB5A 1RDAA 2GUPA 3MN5A 2P51A 1BL3A 2ZGYA 2QA4N 4H8KA 1H1VA 3FE1A 2YNFA 5KTQA 2PBDA 1SKSA 5AZJA 4ISEA 1LV5A 2ZM6K 4BR5A 2LSNA 4CZEA 1BU6O 4JHDB 1XMOK 2YV0X 4KHUA 3S9HA 3CCQN 3MK6A 4DTMA 2FBTA 5AQXA 4PKGA 3J7AP 3BF3A 1BI4A 3C6AA 4FL9A 4E3SA 3LDNA 4WF9L 4JKHA 4UY8O 2QXFA 2A5XA 1A5XA 2JGUA 4KH6A 1C0MA 3H3OB 1NOZA 2CGKA 4FWKA 3VN5A 2G8WA 4Y1CA 4EFHA 5CE3A 3H08A 3THVA 4J2DA 4CZGA 2FC0A 1YHQN 3VETA 4JYAK 5HP1A 1XC3A 2YCHA 1SS6A 4B1WB 2P1JA 4C8MA 3SI6A 3M6GA 2HHUA 4DR7K 3ZX0A 2O8DA 3CC4N 4KHQA 1K8KB 4OGCA 3VGLA 3OS2A 2YHXA 1U49A 2P9NB 3EO3A 4DQ8A 1ITGA 2EHGA 1T03A 2PYLA 4E7KA 1UA1A 4WFBL 2IVNA 5HRPA 2HF3A 4PWDA 4FJ5A 1EQYA 4DB3A 4YORA 5IT9O 3OBYA 1NGBA 4ELUA 4BRMA 3OYIA 1I3AA 1N33K 4AHUA 1C1CA 2YI1A 3SV4A 4ISFA 2Y1JA 1R0AA 3PSIA 3IRXA 3GOIA 1D8YA 1M1KO 4Z4GA 3CFOA 2Q36A 3PX6A 3E01A 4DV2K 1GLDG 4FLYA 4ID5A 4DQPA 3F73A 3OYFA 3ZSZA 3MMVA 1RBUA 4FWMA 4M7YA 3JS6A 3UE5A 4OJRA 4BR2A 3IFRA 4CHYA 3DLRA 4JKBA 4CF1A 1BCOA 3ZT4A 4JKAA 3VQAA 1QQCA 1WSFA 3T7ZA 1RDCA 3L6QA 1T05A 2NLXA 3AVNA 3HP6A 2NNWA 3K59A 1J5OA 4HTLA 4E7IA 3SMSA 3LAMA 3O1BA 5AQLA 4FJKA 1FK9A 3QEWA 1L3UA 4R79A 1TKXA 4DTPA 1CXQA 4CECA 5CYQA 1VSIA 3FZHA 3ENOA 5C24A 1G99A 4A5AA 3FFKB 3L0QA 1NGJA 3CCEN 4O5FA 1W7AA 1ASVA 3CFRA 4RW6A 2HHQA 4PL8A 1RBRA 3WQTA 3LWLA 3CG7A 2E88A 4F9OA 2IS3A 1HNZK 4IFYA 3V4IA 5M1KA 5AQYA 3TSQA 1C1AA 4WCEL 2Y1IA 1BDGA 3T1AA 1JLCA 1XNRK 3DLGA 1FKOA 1WSIA 3VERA 3TAPA 1HNXK 1Q86O 1WUAA 3D6RA 3QEVA 3LM9A 3ULDA 3CJBA 2HHVA 3ZSWA 1VQ9N 4FJLA 2D0AA 3DOKA 4DTSA 4B9VA 2E4LA 2NRTA 2GWJA 2FBVA 4ICLA 3SBTA 4BGAA 3AVHA 4JI4K 3BEXA 1BA1A 3CFPA 1KC8O 2UYTA 2OTJN 2O8FB 1YTAA 3WT0A 3GDQA 3NF8A 2HBJA 3C7NB 3EN9A 4BRQA 2GELA 2G8UA 4EZ6A 5BR8K 5IWAK 3ENBA 3I55N 1QHAA 2QWPA 1FXXA 2BH1A 1VSDA 2BANA 2G8HA 3VEWA 1XUPO 1ILYA 4OVLA 4CK2A 3O9UA 4IO9L 5CYMA 5EVZA 2H3GX 1OH5A 3O3GA 1UWBA 2KZZA 4EHTA 3CERA 4GVMA 3DXKA 4KHYA 4IFEA 3OYEA 1DT9A 4AHSA 5FDLA 4PHTX 3AGRA 3I0SA 3PO5A 4B9SA 2UU9K 4CF0A 5FPDA 4JEPA 1YJWN 2ZF5O 3DLLL 2ASPA 4M3ZA 1RTHA 1NNEA 1NOYA 4DCHA 1VQON 1WLJA 2KKZA 3WQUA 4PKHA 3KK7A 2Q31A 4HUEA 4CJTA 4XH1A 2A3ZA 5AQJA 3WXMB 4Z4HA 4CGDA 5ADXA 1VSLA 2O8CB 3FLCO 3SAHA 1SV5A 1SL1A 4LSNA 4LD0A 5KRSA 1VQ7N 3RRGA 1JCGA 1NMNA 3SV3A 5AFUA 1VSHA 3F9MA 3QDKA 5HRSA 3U3YA 4R5PA 1EKEA 2NUBA 3I0RA 1JCFA 2ZD1A 3M8RA 4JI0K 3PO4A 3WNHA 1JJ2M 2B6AA 3ZSXA 4CJPA 3OYJA 4F2SA 5FRMA 2P9LA 1HKGA 1P90A 3K57A 1XHXA 1TYQA 2WONA 1QE1A 3V9SA 3RMCA 3VQ6A 2AJQA 4FJHA 3DLEA 2W41A 3PLAA 3VF2A 1GOAA 1NG9A 1YVUA 1LWCA 3V9UA 1OH6A 3TI0A 1IBMK 4CIGA 4IG3A 4NYFA 1U48A 1S5JA 2YHAA 4AILC 3SPYA 1NK5A 3SUNA 1NGAA 1TL3A 4CCHA 2I5JA 4NB4A 4H4OA 2UXBK 3R1XA 3RRHA 2HBLA 1RT5A 4CZLA 4ZTJA 4N56A 3HJFA 1IBLK 4F3TA 3WXKA 3G4SN 4N47A 1XC9A 1VQNN 3L8BA 3ID6A 2E2OA 4BRCA 3ZT2A 4CFBA 1TK0A 4O8UA 2QK9A 3EE8A 5TKWA 3R8EA 4Z4EA 4AF1A 5I3UA 3ZSYA 5HLFA 3D2EB 3VEYA 1HMVA 4YHHK 5J2NA 4KREA 1UA0A 2D5RA 3CMAN 1RT1A 3S3NA 1ESVA 3AVFA 2P9KA 3QBWA 4FVUA 1YT3A 5AZJB 3CQ8A 3DLHA 2HNYA 4J2EA 5AQRA 3D2FB 4ISGA 4OLAA 2P5GA 3ULEB 4CEFA 1YUWA 4CJSA 3GG4A 3QIPA 4DKWA 3HPOA 1MA9B 5M1OA 1JLAA 3SMPA 1VQPN 5AQQA 3SQ2A 4CZJA 4CJ4A 4CF2A 3CCSN 3NVKA 2XRIA 1B9FA 3RTVA 3LP3A 3KWIA 4BDPA 4NLBA 5BRFA 3H1VX 4U7BA 2HHSA 3PY8A 3ZETB 4CFDA 2GEMA 5C2DA 3RR8A 2UUAK 1HX1A 1RTIA 5F0XA 4CBUA 1U2VB 1NMDA 5BRHA 1KFSA 1BG3A 3AO2A 4KHPK 3NGZA 5KGWA 3EZWA 4RG8A 4F8RA 4DV7K 3O4WA 5BN9A 3NHGA 3AAPA 3KZBA 3SJJA 3LDQA 4GY2B 2DTUA 4G1QA 1VRUA 1SKRA 2KQ2A 4CJKA 4FJ8A 2QWLA 4Z4IA 2ATQA 2P9SB 2YHBA 4KHWA 5DM7L 4EAHD 1WOQA 1HYVA 1SZ2A 1HKCA 4DTOA 3LP1A 3NF6A 3MXJA 4JKEA 4AHVA 4BRAA 1BCMA 3IG1A 4IEIA 4M42A 3CCUN 4IFVA 4BR0A 4YOXA 3NGYA 1WSJA 3LAKA 3ZSOA 4A5BA 3FFIA 4EHUA 5JMVA 2O8EA 2HOEA 4DSFA 1EP4A 4JHDA 2W40A 3EE9A 4DSJA 4WQ5A 4OPAA 3NE6A 5LMNK 2CGLA 1ASWA 1GLFO 3HSTB 4KHNA 2V7YA 4DSKA 3VQ4A 3KK3A 4AM7A 1Z25A 2YNHA 4DR4K 1NLVA 4MDBA 1Q8IA 4FLXA 3CC2N 1HKBA 5BPNA 4K41A 3I33A 1RDUA 1KFDA 1IH7A 1ZBHA 3D0PA 1RTDA 3LPUA 1RGIA 4W5TA 3SNNA 3DRSA 4K42A 2VYPA 2Z1JA 1NGGA 1Q7YO 4QOZB 3NDKA 4M63C 4HVJA 4W5RA 4GNIA 5CY4A 5AQPA 4FWOA 3CCRN 2QWOA 1WB9A 4F4KA 3NMUA 4DR3K 2Z1HA 3MAQA 2QWNA 4DV3K 2Q2RA 4LC9B 5DM6L 2A41A 3ZSQA 1W9HA 2XY7A 5AZIB 3THYA 2WFBA 5T7BA 1YTUA 2HMPA 2GTDA 4OKEA 1YIJN 2CH5A 3LL3A 2FF6A 1QTMA 1JL1A 4CEBA 1NK6A 3UKUB 2AA4A 4B1YB 3QIOA 4CHPA 4Z94A 3TANA 1K6YA 3AO1A 3TSPA 4WE1A 4IOCL 3LALA 5CZ1A 3L2RA 3P1GA 4XEIA 4HHTA 4IJNA 2IGIA 3THWA 3AVCA 4CJEA 1JLFA 4GW6A 1QVGM 2WBNA 1ZBFA 3MEEA 4CGFA 3CPWM 3JSMA 4GKKK 4FWPA 5B8HA 4KTZA 4BE0A 3BZKA 1TKTA 3KK2A 1VSFA 3CMEN 1NKEA 5LMUK 4BWJA 4C8KA 5I42A 1U6ZA 2RE2A 3CPEA 3L3VA 4YDUA 4X64K 2ASMA 4FWLA 4OX9K 2RHKA 3KWGA 1Q9YA 3MXMA 1A5WA 4A59A 5FRNA 3M8PA 1NM1A 4FJNA 4O8KA 2HHTA 4KO0A 4DSIA 4B3OA 4Q5VA 1NK4A 4FZXC 5AQNA 1OVQA 2OZSA 5BPLA 3V9XA 5AQKA 5M1PA 1T7PA 4AQYK 3F5TA 5CZ2A 1VHXA 1NGEA 3A8YA 2JWLA 1NK9A 5C2FA 1IG9A 4CHQA 3SAFA 4W5NA 1QHTA 3IAYA 5C12A 2CH6A 4OPKA 2FSNA 2IC3A 3J81O 3K5OA 5JICA 4U67L 1JKHA 4CW7B 3QFUA 3AVKA 1RNHA 1R59O 2A42A 4M45A 2PYJA 4FJ7A 5LJVA 4FJMA 3D45A 4AM6A 3FR0A 3OJUA 4LF7K 3MWTA 3JXUA 4OKKA 4CE9A 1EO1A 4FWSA 4BC5A 3HRGA 3K0SA 3VMFB 3SUQA 4DR2K 4PA1A 3KK1A 3VESA 2UXDK 3AVGA 1WSHA 1GOBA 3CETA 2IIRA 1VQ6N 3DOLA 2YKNA 4BQLA 4LF4K 2UXCK 4IOAL 4J2BA 2VCPA 4FZZA 5E41A 3F9KA 2VQFK 1TKDA 4CK1A 1YF5L 1KAZA 3WUHA 5GAEP 2DY4A 5JS1A 3C6TA 4CGHA 3AO3A 3FGUA 3ZX3A 3G10A 1J53A 3DLBA 3RSEB 5EU7A 2YHWA 4CESA 1RDBA 4DQQA 1KAYA 3LM2A 5FROA 4LFCK 2QWMA 4HTUA 1JLQA 3NH2A 2WC9A 4BRLA 1J54A 1HYZA 2V7ZA 4FYDA 1LW2A 1CXUA 4YOYA 1CZBA 3TR8A 3CJAA 3ATUA 5A2QO 4JKFA 4E7LA 5C0YA 5AQMA 3VEVA 3MXIA 2BGGA 1KRPA 5GINA 1TUYA 4L3QA 5E26A 3H1QA 3CF5L 4FSVA 4B9TA 3AVIA 1KTQA 4CZHA 4B9NA 5CR4A 4A62A 3VQQA 4JRPA 1D9DA 1OVYA 4YOUA 2HNZA 3VENA 2VG6A 1JL2A 3OA9A 3HM8A 1DLOA 4W5QA 3AVJA 3VA0A 4DV5K 4H0TB 4WFNL 3AV9A 2HSTA 4B08A 4JKCA 3FZLA 3WNEA 4MQ3A 4JS4A 1ZYQA 1DTQA 5HOOA 4MO4A 1D5AA 3KTQA 1HQEA 1JLGA 3L2WA 4Q0BA 3CD6N 2E8AA 4KH4A 1BO5O 2X74A 4DTNA 4FK0A 4FM2A 3CCJN 4FZYA 5AQZA 4O0IA 3KLHA 3S41A 5MLCQ 3QEIA 3ZT0A 3TSUA 3V1OA 2P5OA 3K9KA 4B9UA 4IOXA 4OLBA 1YAGA 3HOSA 4M3WA 1KLMA 3IKMA 3K9JA 1NGDA 5JVHL 4JLHA 4FLUA 4DLEA 2D0OA 4DF4A 1WBDA 3MECA 3H6EA 4I2QA 3VTHA 1KAXA 3SK3A 1JLEA 1S3XA 1ZXOA 2PAVA 3MX2A 1UOCA 1J6ZA 4BY9C 3T19A 5CHIA 3NGIA 2HHXA 5F1XA 4EP5A 3TPQA 1TKZA 3ZX2A 4DWIA 4CJLA 4I7FA 3T1YK 2OZMA 1U2VA 3DLKA 4WQ4C 3TWHA 2G8IA 3HYFA 2XY6A 3SUOA 2VWBA 3THWB 4CF9A 2J4RA 4H5TA 1X9JA 2V51B 3KLIA 4MFBA 2JLEA 5KQ8A 1NJIO 1IKWA 2VG7A 3NCIA 4BVOA 2O8BB 1Y97A 2D4WA 3OYLA 4N5SA 1X9MA 2ITGA 3U9DA 3WXIA 2QTDA 3O3FA 1ATRA 2OPSA 3PX4A 2HB5A 5HRNA 3VA3A 3UKRB 3OY9A 3LZJA 3LWMA 4BR9A 2RN2A 4DR6K 1JXEA 3A5NC 4N76A 4TSXA 4GV3A 1XQSC 5ADXH 3CIPA 3LP2A 3G6EN 1QQNA 3B8AX 4KBOA 4LF9K 4DTRA 2P9UB 3T1HK 1VSMA 2D0BA 4CD1A 4NO7A 1BISA 5KRTA 2KFNA 2RPIA 4BC4A 1TGOA 2KFZA 1IKYA 3P39A 4B3MK 3BY5A 4LH5A 1RDWX 3H46O 2XHBA 4Z0UA 5HL7L 1VSKA 3ASMA 4KHSA 5GIOA 4CEAA 3SJHA 4E7HA 4QCLA 4DLGA 4AHTA 1NK8A 1K8KA 3OYCA 2UUCK 4LFAK 4IZ9A 4Z4CA 1KVAA 1YI2N 4B9LA 2B4JA 1EETA 3GE1A 5DMRA 3Q7BA 4CFAA 1YVNA 3OYMA 3HI0A 2NRWA 3IDHA 3E1YA 4Y1DA 5BRDA 3P5JA 4PL7A 4XH5A 4IJAA 2F4VK 3M5RA 3EKUA 3DXMB 4DSEA 3A2FA 1S9EA 2OPPA 3W0LA 2A40A 3ZSVA 1C0UA 4CJ3A 4WQ5C 1IG8A 1XMQK 4FPBA 2G8FA 1S9GA 4CEDA 1QVFM 3AO4A 2VWJA 3UKUA 4O55A 3SQ4A 2F7TA 4FCYA 3SUPA 4DU3A 1S6PA 3BDPA 5BPMA 4AHCA 1HNVA 5FPEA 4C1NK 3AY9A 3CJ9A 3MCPA 3GL1A 4NCBA 4M3UA 4XIUA 1YITN 3HPGA 3PIPL 2Q1NA 2YNIA 1E4GT 3HPHA 3QNOA 3BUZB 1T8EA 3PUFA 3ENHA 4OO1J 2DFEA 4FW2A 4JRQA 4Z4FA 1YXQA 1BA0A 1SUQA 1TV6A 3Q7CA 4GKJK 5AQUA 2O8FA 2GWKA 3RVCA 1WAFA 5DK5A 4J8FA 4DR1K 1BI4B 4CI6A 3THXB 1KCFA 3O08A 4YY3K 5C15A 2Q0RA 3LDSA 1GOCA 1GLLO 2P9NA 3LP0A 4CGGA 4ILHA 4XH4A 1MU2A 4O0JA 4EP4A 3P4IA 3AO5A 4BG8A 3L2UA 3V9ZA 2G8KA 1L3VA 3HBTA 3OYKA 3NBPA 4I2PA 1RTJA 5M1QA 4IBNA 1RBSA 3CCMN 3DXKB 3F2KA 5JS2A 4FLZA 1U45A 1ZBSA 2IVPA 3GBTA 4K25A 3UIQA 3AVLA 1NWKA 3J7YP 2W42A 2RF2A 4FK4A 3O4NA 3CM6A 4FVMA 3VEZA 2PZSA 2ZQBA 1L3SA 5J2MA 1GLEG 2HVHA 4O44A 3BZCA 3O6WA 4DSLA 1DEJA 5TKYA 4CD3A 1FJGK 3O4QA 2E20A 3AA2A 4OKJA 3VGMA 1ZBLA 4F3OA 3J7ZO 3S3OA 2DPNA 2GX9A 3K5LA 1Y64A 4FK2A 2EX3A 4C8OA 3CYMA 4KRFA 4BDZA 4DR5K 2HNDA 1CZ9A 2I7NA 3ALYA 4NXNK 1RILA 4CHOA 3MN6A 3ZCMA 4HUFA 4DHYA 3PX0A 2KHOA 3HM9A 3LANA 3C94A 3EYZA 3K5NA 4ZHRA 3ATVA 4BRFA 4FJGA 3O3HA 5H1SQ 1WSEA 1M90O 2OPQA 2OA8A 1WAJA 3UKRA 1XNQK 4DFJA 4KI4A 3AAQA 4C23A 4DU1A 4H0YB 5EOYA 5KI6A 4DV4K 2GUIA 2ZWHA 4FO0A 3SPZA 3DYAA 3C65A 1L3TA 5C25A 4I9LA 2KLAA 4BR4A 3PV8A 2WTUA 1XI1A 4DS5A 4H5VA 3HTVA 3PSFA 3U9ZA 2O8CA 4MO5A 3CJCA 4JK8A 4DFPA 2EWSA 1X3NA 4CJ7A 3CCLN 3JAMO 4DQSA 2ITMA 1J9AA 1ATSA 2W6KA 1E3MA 5AJ3K 1IKXA 3HT3A 2O4IA 2E2NA 1LCUA 4M3YA 2E1YA 4RW8A 3MN7A 3VQ5A 3ZEUA 2VWKA 3BF1A 5HRRA 1L5UA 4DV6K 2HF4A 3AA4A 4E19A 1QZ5A 1RT4A 4ELVA 1SKWA 3HVTA 3E9PA 3HSCA 3VQCA 3KD5E 2A1SA 4YNQA 3DRRA 2GBZA 4BROA 2E6LA 2YJFA 3S3MA 1WN7A 4DFKA 1F21A 3LDPA 2FSKA 2QEXN 4M7XA 2W6LA 4BGBA 1IBKK 4FXDA 4FLWA 3A5LC 3KD1E 5GAGP 3QO9A 5KGXA 3R3LA 3U6FA 4KAZA 1SL2A 1T6CA 1S1UA 4LH4A 3E66A 3AVMA 4LY7A 4CHNA 1NGIA 1V4SA 4RW9A 3SBGA 5BREA 4E89A 4DQIA 2FBXA 3N4PA 1BUPA 2FXUA 4IXCA 3R9PA 4YOWA 3LDLA 4JK7A 1TYQB 5AQFA 1BQMA 4BR7A 3VQ8A 5AQSA 2ZE2A 3NH1A 3DJCA 4JKGA 2KW4A 3R6MA 2HMIA 3DWLA 4K43A 3ZSRA 1GLAG 3K5MA 2UUBK 1BOTO 2F9WA 4JD2B 3V81A 3AARA 1D4XA 2IVOA 4CEOA 4YOTA 2OCEA 3WEEA 2FLOA 4OGEA 1X3MA 1WSGA 1TL1A 1VQ4N 2BDPA 1BHLA 2Q0UA 2QWQA 3NAEA 4W5OA 4AH9A 1XHZA 4B8AB 4I6MB 4FLTA 3CXCM 4BC3A 4PUOA 1VSEA 3HXMA 1BGXT 4A2BA 4BRPA 3QICA 4JI2K 4IKFA 4WQ4A 3P83D 2WUSA 1T6DA 3CQYA 4NYNA 4QS7A 4FWQA 5AQTA 4AHRA 1VQ8N 3KLEA 3M8SA 4C8NA 4LF5K 3M3ZA 1KQSM 1RT3A 2X78A 1ZC6A 3B6OA 3OW2M 5HROA 2OTLN 2Q3SA 1X9WA 4KFBA 4LFBK 4E0DA 4FWNA 2NRHA 3MDQA 5SZTA 3C6UA 3O80A 4CERA 5JLHA 5J2PA 1UAXA 4RTFD 1N32K 4CEQA 3TABA 3V1RA 1TK5A 1QZ6A 3AA3A 3QESA 1NJZA 3ITHA 2NRRA 3LPTA 4C8LA 4OPHA 4YFUA 3C6HA 4E1MA 4JD2A 1MWMA 2ZJPL 1RBVA 3SZ2A 3QLHA 4FJIA 4BRDA 2QKKA 4KKOA 5AQGA 1RT6A 2ZJRL 3AA5X 1LW0A 1S22A 1HQUA 2YX6A 1C0TA 1C0GA 3VF4A 3THYB 3DAWA 1K73O 1ATNA 3O8MA 3VQ9A 2F8SA 1NKCA 1LAVA 4CZFA 2E2QA 3L3UA 4CJVA 2P9UA 3NFAA 3VQDA 1W2BM 3VTIA 4X66K 1KD1O 3EY1A 2YNGA 3OYHA 3LDOA 2E5LK 3WXJA 1LWEA 3V1QA 2D0PA 1BIUA 4FJXA 3QINA 4BC2A 2PY5A 3T69A 3TAGA 1ASUA 4CIEA 1FKPA 4BRGA 1GLJO 1QQMA 1V4TA 4DU4A 1N6QA 4IG0A 4BG9A 1NK7A 5AQOA 3A5OC 4QS9A 1YJ9N 1RDDA 2F9TA 1JLBA 2P9IB 3P31A 4CF8A 3NVMA 1QSSA 3DRPA 4B3RK 3VPZA 2XO7A 3V9WA 2E2PA 3KLGA 3OTOK 3OS0A 2YJEA 4QAGA 4G9ZA 4FJJA 3ZEUB 3OHRA 4A61A 2B5JA 1HPZA 1KXPA 4CZMA 4H5NA 1IJJA 4CJFA 4WYBA 2ZGZA 3J8AA 4KI6A 3G0ZA 2P9LB 4GV6A 4ZTFA 3EKSA 1NGFA 4JKDA 3OYDA 3SLCA 3U4LA 3KVGA 3QMLA 4B1VA 1X9SA 3OYAA 1W0HA 5D3GA 2IAJA 4CJWA 4H0OA 2RKIA 2Z1GA 5GAHP 2O8EB 2IOCA 3RR7A 5GADP 5KQDA 4A2AA 1S1VA 2QWRA 5AR0A 3P38A 5FLXO 3KJVA 1J5EK 3HK2A 4DFMA 4LF8K 1Z05A 4BVPA 1VQLN 1VSJA 4EIAA 4YDUC 5M1FA 2Q97A 2AP1A 3TAQA 3D2EA 2HHWA 1Q82O 3AVAA 4HUGA 2JWKA 2P9IA 1EX4A 1RT7A 5FPMA 3L2VA 3E9LA 1Q81O 5E84A 3AVBA 3SQ1A 2HBKA 4KB0A 5KPTA 3HVRA 3WNGA 3J80O 2VQEK 4IDHA 3QEPA 1EWQA 3T3FA 3DI6A 4NXMK 3U3GA 1NJYA 3OYNA 4ELTA 4BREA 1X1PA 1TAQA 4NLCA 1IKVA 4NCAA 2QXLA 4OPJA 4KH5A 1TVRA 3WEEB 4FJ9A 5AQHA 1B9DA 2VGNA 1HPMA 3ULEA 1REVA 2P9SA 3O9SA 4CK3A 2HHHK 4O5BA 4E1JA 4CJUA 2P9PB 4BQZA 4C1NI 1S72N 1BWFO 2ZJQL 4I9QA 2NZTA 3O1WA 3H3NO 5EY4A 4DTUA 1CLQA 2YKMA 4JNEA 5AZIA 1E4FT 1SAZA 3O9QA 1RFQA 4JI8K 3SCXA 4M41A 2X6NA 4O4GA 1HJRA 1JXBA 4FLVA 4E7JA 4H4MA 1U47A 4B9MA 3VF6A 4BWMA 4JI5K 4UQGA 4FM0A 2HW3A 4JKGB 3VQPA 4BDYA 4RCHA 3MX5A 4A57A 1NBWA 1QSLA 3IS9A 1EXQA 4BRHA 2FSJA 1W97L 2A6AA 5GIPA 3FZKA 5ELZA 5J2QA 3RMAA 4GMJB 3CCVN 1CZAN 2BE2A 3MWPA 4PKIA 3OVNA 2G8VA 1TAUA 4CBWA 4CGJA 1KVCA 3EL2A 1OH7A 2NRVA 3RMDA 5FPNA 1XWLA 4GV9A 1HNIA 4JI1K 1VQMN 4B8CA 3CQXA 4DV0K 3K2PA 1VAZA 4B1ZA 4BRNA 3HO1A 3SYZA 3RWUA 3A0IX 4MLEA 1KLNA 3C0BA 3L4IA 4CEEA 1IO2A 4DMNA 5HBMA 2BUPA 4BE1A 4ID1A 1JCEA 2VG5A 3M1FA 1C6VA 4HCCA 2IDOA 3AGKA 3MCAB 4HCBA 1GLCG 1RBTA 4HWIA 5J1EA 1Z26A 3K58A 4RW4A 4PY5A 3WXLA 3DM2A 3RSEA 3FZMA 1KSPA 3C95A 4ILGB 2WOMA 2FF3B 1HUXA 3OYBA 1A5VA 2NRXA 4JI7K 4I6MA 2XY8A 2QI2A 3MEGA 3KLFA 4JI3K 1P8ZA 1G15A 3QFPA 3A5MC 1QS4A 4J2AA 4JK9A 2D0CA 4B9QA 1C1BA 3I56N 1S1TA 4CHZA 1VK0A 3L2QA 5EX5A 4CJQA 1NGHA 4RW7A 3SAGA 1RCHA 2Z1IA 3KKSA 4DG1A 4CZKA 3KKRA 3TTCA 4RWTA 2DFHA 2E1ZA 1OH8A 1K9MO 3L4QA 1HNWK 1K8AO 4X65K 2PFUA 3TTFA 4YOVA 4BRIA 4K0KK 3NH0A 3EZ5A 4IDKA 4FWRA 1N34K 1FW6A 1S6QA 4BRKA 1VQ5N 2DFFA 4JS5A 1WBBA 1BIZA 5LJWA 2HBMA 3VQEA 3VGKA 4DF8A
chains in the Genus database with same CATH topology
2Q31A 3N4PA 4XH1A 1DGKN 2A3ZA 5AQWA 1BUPA 4H0TB 4WFNL 5AQJA 3WXMB 2FXUA 4IXCA 2HSTA 3R9PA 4WFAL 4JKCA 3FZLA 5ADXA 4YOWA 3LDLA 4JK7A 3FLCO 1TYQB 3SAHA 5AQFA 4BR7A 5HOOA 2BTFA 4MDAA 4MO4A 2OANA 5AQSA 1VQ7N 3DJCA 4JKGA 1JCGA 3TTDA 1TUUA 3VEXA 3G71N 3R6MA 1T44A 3QBXA 3DWLA 5AFUA 3CD6N 3F9MA 3QDKA 4B1XB 2E8AA 4K43A 4KH4A 1BO5O 1GLAG 1BOTO 2F9WA 4JD2B 4H0PA 1JCFA 5AFUH 2VGMA 3AARA 1D4XA 3CCJN 2IVOA 5AQZA 4YOTA 1JJ2M 3O9TA 4MLHA 3WEEA 2FLOA 3S41A 2P9LA 3CJ7A 1X3MA 4Y0WA 5MLCQ 1HKGA 1P90A 4H0XB 3TSUA 1TYQA 4FOIA 1VQ4N 3HOTA 3ZYYX 1Z6RA 3D7EO 3K9KA 2Q0UA 2QWQA 4IOXA 1YAGA 3HOSA 2W41A 3PLAA 3VF2A 3IKMA 3K9JA 1NGDA 3C7NA 3HZ6A 4I6MB 5JVHL 3CXCM 2D0OA 4BC3A 3VOVA 3IMXA 3ID8A 1VQKN 3I8BA 4JAXA 4A2BA 4BRPA 3QICA 1T3VA 5LY3A 3H6EA 4WQ4A 3VTHA 1KAXA 2WUSA 1T6DA 3CQYA 4QS7A 3SK3A 1NGAA 4FWQA 5AQTA 2D1KA 1VQ8N 1S3XA 1ZXOA 2PAVA 3MX2A 3QB0A 5M1NA 4B1UB 4NB4A 1J6ZA 3M3ZA 3R1XA 1KQSM 4H03B 2HBLA 1ZC6A 5CHIA 3OW2M 4BY9C 2OTLN 4CZLA 5F1XA 4CZIA 3CI5A 3TPQA 3ZX2A 3O5BA 3OBWA 1OKJA 4GVEA 4FWNA 3O9RA 2I7PA 2NRHA 3MDQA 1U2VA 4WQ4C 3WXKA 5AQIA 5C10A 3G4SN 3O80A 5JLHA 2VWBA 1YJNN 1VQNN 1O13A 1LOTB 4RTFD 1DKGD 2J4RA 2E2OA 1X9JA 2V51B 3D2FA 3ID6A 4H5TA 4O8UA 3TU5A 4BRCA 3EE8A 4FOEA 5TKWA 3R8EA 5KQ8A 1QZ6A 4AF1A 1NJIO 3D2EB 3VEYA 4BVOA 2NRZA 2NRRA 3U8XA 2D4WA 2QM1A 4OPHA 3C6HA 2ZJPL 4JD2A 1MWMA 3U9DA 3WXIA 2QTDA 4BRDA 3CMAN 1SQKA 5AQGA 1ATRA 2ZJRL 1ESVA 4H5RA 2P9KA 3QBWA 1GLBG 1S22A 2YX6A 4QS8A 3UKRB 4H5WA 4FVUA 4FPAA 3E9OA 4BR9A 5AZJB 1C0GA 1Q86O 3VF4A 3DAWA 5AQRA 3CC7N 3A5NC 1K73O 1ATNA 3D2FB 1QQOA 3O8MA 4ISGA 3ULEB 5AQVA 1HLUA 1YUWA 1HJOA 4IWVA 4GV3A 5KPRA 1XQSC 3GG4A 4CZFA 2E2QA 4DKWA 1MA9B 5ADXH 3KHYA 3CIPA 5BR9A 2P9UA 1W2BM 5M1OA 3G6EN 3SMPA 3VTIA 5AQQA 1QQNA 3B8AX 4CZJA 4KBOA 1VQPN 1KD1O 3CCSN 2P9UB 3PIOL 5I9EB 4JN4A 3LDOA 3NVKA 3WXJA 4CD1A 4NO7A 3KWIA 3G25A 2D0PA 3MN9A 4NLBA 5BRFA 3H1VX 4BC2A 5KPZA 4U7BA 4BC4A 3P39A 3FZFA 3T69A 3ZETB 3PIPL 3H45C 1RDWX 3H46O 2GEMA 2ASOA 5HL7L 5C2DA 3ZETA 4BRGA 1GLJO 1QQMA 1V4TA 2P9PA 2YHYA 1HX1A 4BG9A 1N8RO 5F0XA 3DXMA 5AQOA 3A5OC 4CBUA 4QS9A 5GIOA 4ILJA 1YJ9N 2P9IB 1U2VB 2F9TA 1NMDA 3P31A 3SJHA 4CBXA 5BRHA 1BG3A 3NVMA 3VPZA 3CJ1A 1MDUB 1K8KA 3EZWA 2E2PA 5F2RA 4H0VB 4IZ9A 5JLFA 1YI2N 5EXWA 1Q18A 2QW9A 3GE1A 3O4WA 5BN9A 3Q7BA 1YVNA 2YJEA 3AAPA 2NRWA 3HI0A 3KZBA 3IDHA 4G9ZA 3E1YA 3LDQA 4IO8A 3OHRA 3ZEUB 1C0FA 3IUCA 4A61A 4GY2B 5BRDA 2V52B 1KXPA 2CGJA 4IEEA 4PL7A 4XH5A 4IJAA 1MWKA 2QWLA 4CZMA 2P9SB 3M5RA 4H5NA 3BP8A 1IJJA 3EKUA 3DXMB 5DM7L 4WYBA 2ZGZA 3J8AA 4EAHD 1WOQA 1SZ2A 2P9KB 3VEOA 1NGCA 2P9LB 4GV6A 3W0LA 3EKSA 1HKCA 1NGFA 4JKDA 3CHWA 3N4QA 2A40A 3SLCA 3U4LA 5BN8A 3KVGA 3QMLA 5JVGL 4WQ5C 4JKEA 4B1VA 1IG8A 4BRAA 3W3DA 3UB5A 4IEIA 4FPBA 3CCUN 2GUPA 3MN5A 1QVFM 4BR0A 4H0OA 5GAHP 4YOXA 2ZGYA 2QA4N 1H1VA 3UKUA 3FE1A 5GADP 2F7TA 4A5BA 4EHUA 5JMVA 5KQDA 4A2AA 2HOEA 2PBDA 4JHDA 2W40A 5AZJA 3EE9A 4ISEA 2QWRA 4WQ5A 5AR0A 4OPAA 3P38A 4BR5A 2CGLA 1GLFO 4CZEA 5BPMA 1BU6O 2V7YA 4JHDB 5FPEA 1Z05A 3CCQN 3MK6A 4AM7A 3AY9A 3CJ9A 5AQXA 4BVPA 4PKGA 4C1NK 4YDUC 4EIAA 1VQLN 3MCPA 3BF3A 1NLVA 3GL1A 5M1FA 3C6AA 4MDBA 1YITN 2Q97A 2AP1A 2Q1NA 3D2EA 3LDNA 4FL9A 4WF9L 4JKHA 1HKBA 1E4GT 5BPNA 1Q82O 3CC2N 4UY8O 4K41A 3I33A 2A5XA 1RDUA 2JWKA 2P9IA 3BUZB 4KH6A 3ENHA 3H3OB 5FPMA 4OO1J 3E9LA 2CGKA 1RGIA 1Q81O 1YXQA 4FWKA 4K42A 5E84A 1BA0A 2VYPA 4EFHA 2HBKA 3Q7CA 5CE3A 1NGGA 1Q7YO 5AQUA 4CZGA 5KPTA 2GWKA 4IDHA 4M63C 3RVCA 1YHQN 3VETA 1XC3A 2YCHA 1SS6A 4GNIA 4J8FA 4FWOA 5AQPA 4B1WB 4CI6A 3CCRN 2QWOA 3O08A 3M6GA 3NMUA 5C15A 2Q0RA 3ZX0A 1GLLO 4BREA 3CC4N 2P9NA 1K8KB 3VGLA 4NLCA 2QWNA 2Q2RA 4ILHA 4LC9B 2YHXA 4XH4A 2P9NB 2A41A 2QXLA 3EO3A 5DM6L 3P4IA 4KH5A 3WEEB 4DQ8A 5AZIB 5AQHA 4BG8A 2WFBA 2VGNA 4WFBL 1HPMA 2IVNA 2HMPA 2GTDA 3HBTA 1YIJN 3ULEA 2HF3A 2CH5A 1EQYA 3LL3A 4YORA 4DB3A 2FF6A 5M1QA 2P9SA 3OBYA 1NGBA 3O9SA 3CCMN 4BRMA 3UKUB 2AA4A 4E1JA 3DXKB 4B1YB 3F2KA 4Z94A 2P9PB 2YI1A 4BQZA 4ISFA 3TSPA 1BWFO 4C1NI 4IOCL 1S72N 1ZBSA 2ZJQL 2IVPA 3GOIA 2NZTA 4XEIA 3O1WA 1M1KO 3H3NO 3GBTA 2Q36A 4IJNA 4K25A 5EY4A 1QVGM 1GLDG 1NWKA 2WBNA 4JNEA 5AZIA 1E4FT 3CPWM 1SAZA 3MMVA 3O9QA 4M7YA 4FWMA 1RFQA 3VEZA 4FWPA 3JS6A 3UE5A 5B8HA 1GLEG 4BR2A 3IFRA 3CMEN 3O6WA 4JKBA 3VF6A 1U6ZA 4JKAA 3T7ZA 1DEJA 2RE2A 3CPEA 4YDUA 5TKYA 3L6QA 2ASMA 4FWLA 4CD3A 2RHKA 2E20A 3VGMA 2NLXA 3KWGA 3J7ZO 2DPNA 4A59A 2NNWA 2GX9A 1NM1A 4HTLA 4JKGB 3SMSA 1Y64A 4O8KA 3O1BA 4RCHA 5AQLA 4R79A 3MX5A 5AQNA 4A57A 1NBWA 2I7NA 5BPLA 3MN6A 5AQKA 4DHYA 5M1PA 2KHOA 3F5TA 3FZHA 3ENOA 4BRHA 1NGEA 1G99A 3A8YA 2JWLA 4A5AA 3ATVA 2FSJA 3FFKB 3L0QA 4BRFA 5C2FA 1NGJA 5H1SQ 1W97L 3SAFA 3CCEN 1M90O 4O5FA 2A6AA 5C12A 2CH6A 3UKRA 5GIPA 2FSNA 3FZKA 5ELZA 5JICA 3AAQA 4C23A 4U67L 4PL8A 4H0YB 5EOYA 3CCVN 1CZAN 3QFUA 3WQTA 2ZWHA 3MWPA 4FO0A 4PKIA 1R59O 2A42A 3C65A 2E88A 4CBWA 3EL2A 4F9OA 5LJVA 2KLAA 2NRVA 4BR4A 5FPNA 4GV9A 5M1KA 5AQYA 3TSQA 4WCEL 1VQMN 1BDGA 3CQXA 4AM6A 3FR0A 4H5VA 1VAZA 4B1ZA 3MWTA 3HTVA 3JXUA 3U9ZA 4BRNA 4MO5A 1EO1A 4FWSA 3VERA 3CJCA 4BC5A 3HRGA 4JK8A 2EWSA 1X3NA 1WUAA 3A0IX 3D6RA 4MLEA 3VMFB 4CJ7A 3C0BA 3L4IA 3CCLN 3LM9A 3CJBA 2ITMA 1ATSA 1VQ9N 2BUPA 3VESA 2E2NA 1JCEA 3M1FA 3CETA 1LCUA 2IIRA 2NRTA 2GWJA 3AGKA 3MCAB 3SBTA 1VQ6N 4BGAA 2E1YA 1GLCG 4BQLA 4IOAL 3MN7A 2VCPA 4HWIA 3BEXA 1BA1A 3ZEUA 1KC8O 1YF5L 1KAZA 3WUHA 3WXLA 2UYTA 3RSEA 3FZMA 5GAEP 2OTJN 3BF1A 3FGUA 3ZX3A 4ILGB 2HF4A 3RSEB 2FF3B 2YHWA 1HUXA 1QZ5A 2NRXA 3WT0A 3GDQA 1KAYA 3LM2A 2HBJA 3C7NB 3EN9A 4I6MA 2QI2A 4BRQA 2GELA 3E9PA 3HSCA 2QWMA 3ENBA 1QHAA 2QWPA 3I55N 2BH1A 2WC9A 1P8ZA 4BRLA 2V7ZA 3QFPA 3VEWA 3A5MC 1XUPO 4BROA 4JK9A 4B9QA 4YOYA 1ILYA 3CJAA 3O9UA 3ATUA 4IO9L 4JKFA 3I56N 5EVZA 2YJFA 2H3GX 5C0YA 5AQMA 3VEVA 5EX5A 1NGHA 4EHTA 3LDPA 2FSKA 3CERA 3SAGA 5GINA 2QEXN 4M7XA 1TUYA 4L3QA 4CZKA 3TTCA 5E26A 4RWTA 3DXKA 3H1QA 3CF5L 4FSVA 4BGBA 2E1ZA 4IFEA 1DT9A 3A5LC 4CZHA 3AGRA 4PHTX 5GAGP 1K9MO 5CR4A 3L4QA 4A62A 5FPDA 3R3LA 1K8AO 4JEPA 1OVYA 2PFUA 3TTFA 4YOVA 1YJWN 2ZF5O 4BRIA 3DLLL 2ASPA 1T6CA 4YOUA 4FWRA 3VENA 3E66A 4BRKA 4DCHA 1VQON 1VQ5N 2KKZA 1NGIA 3OA9A 1V4SA 3KK7A 4PKHA 3HM8A 3SBGA 3WQUA 2HBMA 5LJWA 3VGKA 5BREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q31 A;  4XH1 A;  1DGK N;  2A3Z A;  5AQW A;  1BUP A;  4H0T B;  5AQJ A;  2FXU A;  4IXC A;  3R9P A;  5ADX A;  3FZL A;  3LDL A;  3FLC O;  1TYQ B;  5AQF A;  4BR7 A;  2BTF A;  4MO4 A;  2OAN A;  5AQS A;  3DJC A;  1JCG A;  1TUU A;  3VEX A;  3R6M A;  1T44 A;  3QBX A;  3DWL A;  5AFU A;  3F9M A;  3QDK A;  4B1X B;  2E8A A;  4K43 A;  1BO5 O;  1GLA G;  1BOT O;  2F9W A;  4JD2 B;  4H0P A;  1JCF A;  5AFU H;  3AAR A;  1D4X A;  2IVO A;  5AQZ A;  4MLH A;  3WEE A;  2FLO A;  3S41 A;  2P9L A;  3CJ7 A;  1X3M A;  4Y0W A;  1HKG A;  4H0X B;  1TYQ A;  4FOI A;  1Z6R A;  3D7E O;  2Q0U A;  2QWQ A;  1YAG A;  2W41 A;  3VF2 A;  1NGD A;  3C7N A;  3HZ6 A;  4I6M B;  2D0O A;  4BC3 A;  3VOV A;  3IMX A;  3ID8 A;  3I8B A;  4JAX A;  4A2B A;  4BRP A;  3QIC A;  5LY3 A;  3H6E A;  4WQ4 A;  1KAX A;  2WUS A;  1T6D A;  3CQY A;  4QS7 A;  3SK3 A;  1NGA A;  4FWQ A;  5AQT A;  2D1K A;  1S3X A;  1ZXO A;  2PAV A;  3QB0 A;  4B1U B;  4NB4 A;  1J6Z A;  3M3Z A;  4H03 B;  1ZC6 A;  4CZL A;  5F1X A;  4CZI A;  3CI5 A;  3TPQ A;  3ZX2 A;  3O5B A;  1OKJ A;  4FWN A;  2I7P A;  2NRH A;  3MDQ A;  1U2V A;  4WQ4 C;  3WXK A;  5AQI A;  3O80 A;  5JLH A;  2VWB A;  1LOT B;  4RTF D;  1DKG D;  2J4R A;  2E2O A;  1X9J A;  2V51 B;  3D2F A;  4H5T A;  3TU5 A;  4BRC A;  3R8E A;  4FOE A;  5KQ8 A;  1QZ6 A;  3D2E B;  3VEY A;  4BVO A;  3U8X A;  2D4W A;  2QM1 A;  4JD2 A;  1MWM A;  3U9D A;  3WXI A;  4BRD A;  1SQK A;  5AQG A;  1ATR A;  1ESV A;  4H5R A;  2P9K A;  3QBW A;  1GLB G;  1S22 A;  4QS8 A;  3UKR B;  4H5W A;  4FPA A;  4BR9 A;  5AZJ B;  1C0G A;  3VF4 A;  3DAW A;  5AQR A;  3A5N C;  1ATN A;  3D2F B;  1QQO A;  3O8M A;  4ISG A;  3ULE B;  5AQV A;  1HLU A;  1YUW A;  1HJO A;  4IWV A;  5KPR A;  1XQS C;  3GG4 A;  4CZF A;  2E2Q A;  1MA9 B;  5ADX H;  3KHY A;  3CIP A;  5BR9 A;  2P9U A;  3SMP A;  5AQQ A;  1QQN A;  3B8A X;  4CZJ A;  4KBO A;  2P9U B;  5I9E B;  4JN4 A;  3LDO A;  3WXJ A;  4CD1 A;  4NO7 A;  3G25 A;  2D0P A;  3MN9 A;  5BRF A;  3H1V X;  4BC2 A;  5KPZ A;  4BC4 A;  3FZF A;  3ZET B;  3H45 C;  1RDW X;  3H46 O;  2GEM A;  2ASO A;  3ZET A;  4BRG A;  1GLJ O;  1QQM A;  1V4T A;  2P9P A;  2YHY A;  1HX1 A;  4BG9 A;  5F0X A;  3DXM A;  5AQO A;  3A5O C;  4CBU A;  4QS9 A;  2P9I B;  1U2V B;  2F9T A;  1NMD A;  4CBX A;  3SJH A;  5BRH A;  1BG3 A;  3VPZ A;  3CJ1 A;  1MDU B;  1K8K A;  3EZW A;  2E2P A;  5F2R A;  4H0V B;  4IZ9 A;  5JLF A;  5EXW A;  1Q18 A;  2QW9 A;  3GE1 A;  3O4W A;  5BN9 A;  1YVN A;  2YJE A;  3AAP A;  3HI0 A;  3KZB A;  3IDH A;  3LDQ A;  4IO8 A;  3OHR A;  3ZEU B;  1C0F A;  3IUC A;  4A61 A;  4GY2 B;  5BRD A;  2V52 B;  1KXP A;  2CGJ A;  4PL7 A;  4XH5 A;  4IJA A;  1MWK A;  2QWL A;  4CZM A;  2P9S B;  4H5N A;  3BP8 A;  1IJJ A;  3EKU A;  3DXM B;  4WYB A;  2ZGZ A;  3J8A A;  4EAH D;  1WOQ A;  1SZ2 A;  2P9K B;  3VEO A;  1NGC A;  2P9L B;  3W0L A;  3EKS A;  1HKC A;  1NGF A;  3CHW A;  2A40 A;  3SLC A;  3U4L A;  5BN8 A;  3KVG A;  3QML A;  4WQ5 C;  4B1V A;  4BRA A;  1IG8 A;  3W3D A;  3UB5 A;  4FPB A;  2GUP A;  3MN5 A;  4BR0 A;  4H0O A;  2ZGY A;  1H1V A;  3UKU A;  3FE1 A;  4EHU A;  5JMV A;  5KQD A;  4A2A A;  2HOE A;  2PBD A;  4JHD A;  2W40 A;  5AZJ A;  4ISE A;  2QWR A;  4WQ5 A;  5AR0 A;  4BR5 A;  2CGL A;  1GLF O;  4CZE A;  5BPM A;  1BU6 O;  2V7Y A;  4JHD B;  5FPE A;  1Z05 A;  3MK6 A;  4AM7 A;  3AY9 A;  3CJ9 A;  5AQX A;  4BVP A;  4PKG A;  4EIA A;  4YDU C;  3MCP A;  3GL1 A;  1NLV A;  3BF3 A;  2Q97 A;  2AP1 A;  2Q1N A;  3D2E A;  3LDN A;  4FL9 A;  1HKB A;  1E4G T;  5BPN A;  4K41 A;  3I33 A;  2A5X A;  2P9I A;  3BUZ B;  3ENH A;  3H3O B;  5FPM A;  2CGK A;  1RGI A;  1YXQ A;  4FWK A;  4K42 A;  5E84 A;  1BA0 A;  2VYP A;  4EFH A;  5CE3 A;  1NGG A;  5AQU A;  4CZG A;  5KPT A;  2GWK A;  4M63 C;  3VET A;  1XC3 A;  2YCH A;  4GNI A;  5AQP A;  4J8F A;  4FWO A;  4B1W B;  4CI6 A;  2QWO A;  3O08 A;  3M6G A;  2Q0R A;  3ZX0 A;  1GLL O;  4BRE A;  2P9N A;  1K8K B;  3VGL A;  2QWN A;  2Q2R A;  4LC9 B;  2YHX A;  4XH4 A;  2P9N B;  2A41 A;  2QXL A;  3EO3 A;  3P4I A;  3WEE B;  4DQ8 A;  5AZI B;  5AQH A;  4BG8 A;  1HPM A;  2IVN A;  2HMP A;  3HBT A;  2GTD A;  3ULE A;  2HF3 A;  2CH5 A;  1EQY A;  3LL3 A;  4DB3 A;  2FF6 A;  2P9S A;  1NGB A;  4BRM A;  3UKU B;  2AA4 A;  4E1J A;  3DXK B;  4B1Y B;  4Z94 A;  2P9P B;  2YI1 A;  4BQZ A;  4ISF A;  1BWF O;  1ZBS A;  2IVP A;  3GOI A;  2NZT A;  4XEI A;  3O1W A;  3H3N O;  3GBT A;  2Q36 A;  4IJN A;  4K25 A;  5EY4 A;  1GLD G;  1NWK A;  5AZI A;  4JNE A;  1E4F T;  1SAZ A;  3MMV A;  4M7Y A;  4FWM A;  1RFQ A;  3VEZ A;  4FWP A;  3JS6 A;  3UE5 A;  5B8H A;  1GLE G;  4BR2 A;  3IFR A;  3O6W A;  3VF6 A;  1U6Z A;  1DEJ A;  4YDU A;  5TKY A;  3L6Q A;  2ASM A;  4FWL A;  4CD3 A;  2E20 A;  3VGM A;  2NLX A;  2DPN A;  1NM1 A;  4HTL A;  3SMS A;  1Y64 A;  4O8K A;  3O1B A;  4RCH A;  5AQL A;  5AQN A;  1NBW A;  2I7N A;  5BPL A;  3MN6 A;  5AQK A;  4DHY A;  2KHO A;  3FZH A;  3ENO A;  4BRH A;  1NGE A;  1G99 A;  3A8Y A;  3FFK B;  3ATV A;  2FSJ A;  3L0Q A;  4BRF A;  1NGJ A;  4O5F A;  2A6A A;  2CH6 A;  3UKR A;  2FSN A;  3FZK A;  5ELZ A;  5JIC A;  3AAQ A;  4C23 A;  4PL8 A;  4H0Y B;  5EOY A;  1CZA N;  3QFU A;  3WQT A;  2ZWH A;  4FO0 A;  4PKI A;  1R59 O;  2A42 A;  2E88 A;  4CBW A;  3EL2 A;  4F9O A;  5LJV A;  4BR4 A;  5FPN A;  5AQY A;  1BDG A;  3CQX A;  4AM6 A;  3FR0 A;  4H5V A;  4B1Z A;  3HTV A;  3JXU A;  3U9Z A;  4BRN A;  4MO5 A;  4FWS A;  3VER A;  3CJC A;  4BC5 A;  2EWS A;  1X3N A;  1WUA A;  3A0I X;  4MLE A;  4CJ7 A;  3C0B A;  3L4I A;  3LM9 A;  3CJB A;  2ITM A;  1ATS A;  2BUP A;  3VES A;  2E2N A;  1JCE A;  3M1F A;  3CET A;  1LCU A;  2IIR A;  2GWJ A;  4BGA A;  2E1Y A;  1GLC G;  4BQL A;  3MN7 A;  2VCP A;  4HWI A;  3BEX A;  1BA1 A;  3ZEU A;  3WXL A;  1KAZ A;  3WUH A;  2UYT A;  3RSE A;  3FZM A;  3BF1 A;  3FGU A;  3ZX3 A;  2HF4 A;  3RSE B;  2FF3 B;  2YHW A;  1HUX A;  1QZ5 A;  3WT0 A;  3GDQ A;  1KAY A;  3LM2 A;  3C7N B;  3EN9 A;  4I6M A;  4BRQ A;  2GEL A;  3HSC A;  2QWM A;  1QHA A;  2QWP A;  1P8Z A;  4BRL A;  2V7Z A;  3QFP A;  3VEW A;  3A5M C;  1XUP O;  4BRO A;  4B9Q A;  3CJA A;  3ATU A;  5EVZ A;  2YJF A;  2H3G X;  5AQM A;  3VEV A;  5EX5 A;  1NGH A;  4EHT A;  3LDP A;  2FSK A;  3CER A;  4M7X A;  1TUY A;  4L3Q A;  4CZK A;  4RWT A;  5E26 A;  3DXK A;  3H1Q A;  4FSV A;  4BGB A;  2E1Z A;  3A5L C;  4CZH A;  4A62 A;  5FPD A;  2ZF5 O;  4BRI A;  2ASP A;  1T6C A;  4FWR A;  3VEN A;  4BRK A;  4DCH A;  1NGI A;  3WQU A;  1V4S A;  4PKH A;  3HM8 A;  5LJW A;  3VGK A;  5BRE A; 
#chains in the Genus database with same CATH topology
 3I8D A;  3QET A;  2OYQ A;  1DGK N;  5AQW A;  4DS4 A;  4WFA L;  2R7Y A;  4CJ5 A;  3TAE A;  1N5Y A;  2BTF A;  4MDA A;  2OAN A;  1DTT A;  4NCG A;  1B92 A;  2F96 A;  1TUU A;  3VEX A;  3ZT1 A;  3TTD A;  1T44 A;  3QBX A;  3G71 N;  1NJW A;  4CVN E;  2A1R A;  4K8X A;  4B1X B;  5LL6 Z;  3QER A;  2O8D B;  4H0P A;  5AFU H;  2VGM A;  4CJR A;  3VQB A;  1Q9X A;  3O9T A;  1RT2 A;  4MLH A;  1VRT A;  3CJ7 A;  4Y0W A;  4H0X B;  3TAF A;  3OS1 A;  4B3T K;  1NKB A;  2HVI A;  4FOI A;  4DV1 K;  3HOT A;  3ZYY X;  3DMJ A;  1Z6R A;  3D7E O;  4LF6 K;  4KTQ A;  2O4G A;  2OPR A;  3QNN A;  1HRH A;  3C7N A;  3HZ6 A;  1HR0 K;  4KTW A;  2FBY A;  3NF7 A;  3TAM A;  3CM5 A;  3VOV A;  3IMX A;  3ID8 A;  1VQK N;  3I8B A;  4JAX A;  4DTX A;  1S1X A;  5K14 A;  3LZI A;  1EWR A;  3M8Q A;  4M3R A;  1NK0 A;  1T3V A;  5LY3 A;  1N36 K;  4CGI A;  1SL0 A;  1O1W A;  2D1K A;  3ZLJ A;  5M1N A;  3QB0 A;  1ZBI A;  2O8B A;  4DUZ K;  4B1U B;  4H03 B;  1QSY A;  5SWM A;  4CZI A;  3CI5 A;  3O5B A;  3OBW A;  1OKJ A;  4GVE A;  3O9R A;  3NF9 A;  2I7P A;  1HYS A;  3WNF A;  4LSL A;  5C10 A;  5AQI A;  4EZ9 A;  1I39 A;  1TK8 A;  1YJN N;  1O13 A;  1LOT B;  1DKG D;  3D2F A;  3TU5 A;  4CFC A;  4FOE A;  3B6P A;  3QEX A;  2NRZ A;  3U8X A;  2QM1 A;  1LWF A;  4CEZ A;  3OYG A;  3THX A;  4JV5 K;  1IV0 A;  3TAR A;  2KZM A;  2E6M A;  1I94 K;  1SQK A;  4H5R A;  3V6D A;  1GLB G;  4QS8 A;  4H5W A;  4V19 S;  3EEQ A;  4FPA A;  3E9O A;  2QKB A;  3SQ0 A;  3BGR A;  4E1N A;  3CC7 N;  1QQO A;  3OJS A;  5AQV A;  1HLU A;  1HJO A;  4IWV A;  3HL8 A;  3RMB A;  5KPR A;  4DUY K;  2X6S A;  3KHY A;  5BR9 A;  3HP9 A;  4JI6 K;  1LAW A;  1KVB A;  3PIO L;  5I9E B;  4JN4 A;  1NU0 A;  4M3X A;  3ZT3 A;  4K8Z A;  3JYT A;  3G25 A;  3MN9 A;  4KV8 A;  4PQU A;  5KPZ A;  4B3S K;  2F8T A;  3FZF A;  4DTJ A;  3H45 C;  1U4B A;  2ASO A;  4BE2 A;  5C42 A;  1NJX A;  3ZET A;  1U04 A;  2P9P A;  2YHY A;  1N8R O;  3DXM A;  4ILJ A;  4CBX A;  4CIF A;  4F2R A;  3CJ1 A;  1MDU B;  3MED A;  4KB1 A;  4FM1 A;  5F2R A;  4H0V B;  3KIO A;  5JLF A;  4DQR A;  4BAC A;  5EXW A;  1Q18 A;  2QW9 A;  4N41 A;  4IO8 A;  2GV9 A;  1C0F A;  1ZBU A;  3IUC A;  4FW1 A;  4M3T A;  2KTQ A;  2V52 B;  2CGJ A;  3ISN C;  4IEE A;  4L8R B;  1MWK A;  3BP8 A;  4KPY A;  1D9F A;  1BQN A;  3VQ7 A;  2P9K B;  3VEO A;  1NGC A;  2ETJ A;  4X62 K;  3CHW A;  3N4Q A;  5BN8 A;  1WNS A;  1S1W A;  5JVG L;  2XY5 A;  3W3D A;  3UB5 A;  1RDA A;  2GUP A;  3MN5 A;  2P51 A;  1BL3 A;  2ZGY A;  2QA4 N;  4H8K A;  1H1V A;  3FE1 A;  2YNF A;  5KTQ A;  2PBD A;  1SKS A;  5AZJ A;  4ISE A;  1LV5 A;  2ZM6 K;  4BR5 A;  2LSN A;  4CZE A;  1BU6 O;  4JHD B;  1XMO K;  2YV0 X;  4KHU A;  3S9H A;  3CCQ N;  3MK6 A;  4DTM A;  2FBT A;  5AQX A;  4PKG A;  3J7A P;  3BF3 A;  1BI4 A;  3C6A A;  4FL9 A;  4E3S A;  3LDN A;  4WF9 L;  4JKH A;  4UY8 O;  2QXF A;  2A5X A;  1A5X A;  2JGU A;  4KH6 A;  1C0M A;  3H3O B;  1NOZ A;  2CGK A;  4FWK A;  3VN5 A;  2G8W A;  4Y1C A;  4EFH A;  5CE3 A;  3H08 A;  3THV A;  4J2D A;  4CZG A;  2FC0 A;  1YHQ N;  3VET A;  4JYA K;  5HP1 A;  1XC3 A;  2YCH A;  1SS6 A;  4B1W B;  2P1J A;  4C8M A;  3SI6 A;  3M6G A;  2HHU A;  4DR7 K;  3ZX0 A;  2O8D A;  3CC4 N;  4KHQ A;  1K8K B;  4OGC A;  3VGL A;  3OS2 A;  2YHX A;  1U49 A;  2P9N B;  3EO3 A;  4DQ8 A;  1ITG A;  2EHG A;  1T03 A;  2PYL A;  4E7K A;  1UA1 A;  4WFB L;  2IVN A;  5HRP A;  2HF3 A;  4PWD A;  4FJ5 A;  1EQY A;  4DB3 A;  4YOR A;  5IT9 O;  3OBY A;  1NGB A;  4ELU A;  4BRM A;  3OYI A;  1I3A A;  1N33 K;  4AHU A;  1C1C A;  2YI1 A;  3SV4 A;  4ISF A;  2Y1J A;  1R0A A;  3PSI A;  3IRX A;  3GOI A;  1D8Y A;  1M1K O;  4Z4G A;  3CFO A;  2Q36 A;  3PX6 A;  3E01 A;  4DV2 K;  1GLD G;  4FLY A;  4ID5 A;  4DQP A;  3F73 A;  3OYF A;  3ZSZ A;  3MMV A;  1RBU A;  4FWM A;  4M7Y A;  3JS6 A;  3UE5 A;  4OJR A;  4BR2 A;  3IFR A;  4CHY A;  3DLR A;  4JKB A;  4CF1 A;  1BCO A;  3ZT4 A;  4JKA A;  3VQA A;  1QQC A;  1WSF A;  3T7Z A;  1RDC A;  3L6Q A;  1T05 A;  2NLX A;  3AVN A;  3HP6 A;  2NNW A;  3K59 A;  1J5O A;  4HTL A;  4E7I A;  3SMS A;  3LAM A;  3O1B A;  5AQL A;  4FJK A;  1FK9 A;  3QEW A;  1L3U A;  4R79 A;  1TKX A;  4DTP A;  1CXQ A;  4CEC A;  5CYQ A;  1VSI A;  3FZH A;  3ENO A;  5C24 A;  1G99 A;  4A5A A;  3FFK B;  3L0Q A;  1NGJ A;  3CCE N;  4O5F A;  1W7A A;  1ASV A;  3CFR A;  4RW6 A;  2HHQ A;  4PL8 A;  1RBR A;  3WQT A;  3LWL A;  3CG7 A;  2E88 A;  4F9O A;  2IS3 A;  1HNZ K;  4IFY A;  3V4I A;  5M1K A;  5AQY A;  3TSQ A;  1C1A A;  4WCE L;  2Y1I A;  1BDG A;  3T1A A;  1JLC A;  1XNR K;  3DLG A;  1FKO A;  1WSI A;  3VER A;  3TAP A;  1HNX K;  1Q86 O;  1WUA A;  3D6R A;  3QEV A;  3LM9 A;  3ULD A;  3CJB A;  2HHV A;  3ZSW A;  1VQ9 N;  4FJL A;  2D0A A;  3DOK A;  4DTS A;  4B9V A;  2E4L A;  2NRT A;  2GWJ A;  2FBV A;  4ICL A;  3SBT A;  4BGA A;  3AVH A;  4JI4 K;  3BEX A;  1BA1 A;  3CFP A;  1KC8 O;  2UYT A;  2OTJ N;  2O8F B;  1YTA A;  3WT0 A;  3GDQ A;  3NF8 A;  2HBJ A;  3C7N B;  3EN9 A;  4BRQ A;  2GEL A;  2G8U A;  4EZ6 A;  5BR8 K;  5IWA K;  3ENB A;  3I55 N;  1QHA A;  2QWP A;  1FXX A;  2BH1 A;  1VSD A;  2BAN A;  2G8H A;  3VEW A;  1XUP O;  1ILY A;  4OVL A;  4CK2 A;  3O9U A;  4IO9 L;  5CYM A;  5EVZ A;  2H3G X;  1OH5 A;  3O3G A;  1UWB A;  2KZZ A;  4EHT A;  3CER A;  4GVM A;  3DXK A;  4KHY A;  4IFE A;  3OYE A;  1DT9 A;  4AHS A;  5FDL A;  4PHT X;  3AGR A;  3I0S A;  3PO5 A;  4B9S A;  2UU9 K;  4CF0 A;  5FPD A;  4JEP A;  1YJW N;  2ZF5 O;  3DLL L;  2ASP A;  4M3Z A;  1RTH A;  1NNE A;  1NOY A;  4DCH A;  1VQO N;  1WLJ A;  2KKZ A;  3WQU A;  4PKH A;  3KK7 A;  2Q31 A;  4HUE A;  4CJT A;  4XH1 A;  2A3Z A;  5AQJ A;  3WXM B;  4Z4H A;  4CGD A;  5ADX A;  1VSL A;  2O8C B;  3FLC O;  3SAH A;  1SV5 A;  1SL1 A;  4LSN A;  4LD0 A;  5KRS A;  1VQ7 N;  3RRG A;  1JCG A;  1NMN A;  3SV3 A;  5AFU A;  1VSH A;  3F9M A;  3QDK A;  5HRS A;  3U3Y A;  4R5P A;  1EKE A;  2NUB A;  3I0R A;  1JCF A;  2ZD1 A;  3M8R A;  4JI0 K;  3PO4 A;  3WNH A;  1JJ2 M;  2B6A A;  3ZSX A;  4CJP A;  3OYJ A;  4F2S A;  5FRM A;  2P9L A;  1HKG A;  1P90 A;  3K57 A;  1XHX A;  1TYQ A;  2WON A;  1QE1 A;  3V9S A;  3RMC A;  3VQ6 A;  2AJQ A;  4FJH A;  3DLE A;  2W41 A;  3PLA A;  3VF2 A;  1GOA A;  1NG9 A;  1YVU A;  1LWC A;  3V9U A;  1OH6 A;  3TI0 A;  1IBM K;  4CIG A;  4IG3 A;  4NYF A;  1U48 A;  1S5J A;  2YHA A;  4AIL C;  3SPY A;  1NK5 A;  3SUN A;  1NGA A;  1TL3 A;  4CCH A;  2I5J A;  4NB4 A;  4H4O A;  2UXB K;  3R1X A;  3RRH A;  2HBL A;  1RT5 A;  4CZL A;  4ZTJ A;  4N56 A;  3HJF A;  1IBL K;  4F3T A;  3WXK A;  3G4S N;  4N47 A;  1XC9 A;  1VQN N;  3L8B A;  3ID6 A;  2E2O A;  4BRC A;  3ZT2 A;  4CFB A;  1TK0 A;  4O8U A;  2QK9 A;  3EE8 A;  5TKW A;  3R8E A;  4Z4E A;  4AF1 A;  5I3U A;  3ZSY A;  5HLF A;  3D2E B;  3VEY A;  1HMV A;  4YHH K;  5J2N A;  4KRE A;  1UA0 A;  2D5R A;  3CMA N;  1RT1 A;  3S3N A;  1ESV A;  3AVF A;  2P9K A;  3QBW A;  4FVU A;  1YT3 A;  5AZJ B;  3CQ8 A;  3DLH A;  2HNY A;  4J2E A;  5AQR A;  3D2F B;  4ISG A;  4OLA A;  2P5G A;  3ULE B;  4CEF A;  1YUW A;  4CJS A;  3GG4 A;  3QIP A;  4DKW A;  3HPO A;  1MA9 B;  5M1O A;  1JLA A;  3SMP A;  1VQP N;  5AQQ A;  3SQ2 A;  4CZJ A;  4CJ4 A;  4CF2 A;  3CCS N;  3NVK A;  2XRI A;  1B9F A;  3RTV A;  3LP3 A;  3KWI A;  4BDP A;  4NLB A;  5BRF A;  3H1V X;  4U7B A;  2HHS A;  3PY8 A;  3ZET B;  4CFD A;  2GEM A;  5C2D A;  3RR8 A;  2UUA K;  1HX1 A;  1RTI A;  5F0X A;  4CBU A;  1U2V B;  1NMD A;  5BRH A;  1KFS A;  1BG3 A;  3AO2 A;  4KHP K;  3NGZ A;  5KGW A;  3EZW A;  4RG8 A;  4F8R A;  4DV7 K;  3O4W A;  5BN9 A;  3NHG A;  3AAP A;  3KZB A;  3SJJ A;  3LDQ A;  4GY2 B;  2DTU A;  4G1Q A;  1VRU A;  1SKR A;  2KQ2 A;  4CJK A;  4FJ8 A;  2QWL A;  4Z4I A;  2ATQ A;  2P9S B;  2YHB A;  4KHW A;  5DM7 L;  4EAH D;  1WOQ A;  1HYV A;  1SZ2 A;  1HKC A;  4DTO A;  3LP1 A;  3NF6 A;  3MXJ A;  4JKE A;  4AHV A;  4BRA A;  1BCM A;  3IG1 A;  4IEI A;  4M42 A;  3CCU N;  4IFV A;  4BR0 A;  4YOX A;  3NGY A;  1WSJ A;  3LAK A;  3ZSO A;  4A5B A;  3FFI A;  4EHU A;  5JMV A;  2O8E A;  2HOE A;  4DSF A;  1EP4 A;  4JHD A;  2W40 A;  3EE9 A;  4DSJ A;  4WQ5 A;  4OPA A;  3NE6 A;  5LMN K;  2CGL A;  1ASW A;  1GLF O;  3HST B;  4KHN A;  2V7Y A;  4DSK A;  3VQ4 A;  3KK3 A;  4AM7 A;  1Z25 A;  2YNH A;  4DR4 K;  1NLV A;  4MDB A;  1Q8I A;  4FLX A;  3CC2 N;  1HKB A;  5BPN A;  4K41 A;  3I33 A;  1RDU A;  1KFD A;  1IH7 A;  1ZBH A;  3D0P A;  1RTD A;  3LPU A;  1RGI A;  4W5T A;  3SNN A;  3DRS A;  4K42 A;  2VYP A;  2Z1J A;  1NGG A;  1Q7Y O;  4QOZ B;  3NDK A;  4M63 C;  4HVJ A;  4W5R A;  4GNI A;  5CY4 A;  5AQP A;  4FWO A;  3CCR N;  2QWO A;  1WB9 A;  4F4K A;  3NMU A;  4DR3 K;  2Z1H A;  3MAQ A;  2QWN A;  4DV3 K;  2Q2R A;  4LC9 B;  5DM6 L;  2A41 A;  3ZSQ A;  1W9H A;  2XY7 A;  5AZI B;  3THY A;  2WFB A;  5T7B A;  1YTU A;  2HMP A;  2GTD A;  4OKE A;  1YIJ N;  2CH5 A;  3LL3 A;  2FF6 A;  1QTM A;  1JL1 A;  4CEB A;  1NK6 A;  3UKU B;  2AA4 A;  4B1Y B;  3QIO A;  4CHP A;  4Z94 A;  3TAN A;  1K6Y A;  3AO1 A;  3TSP A;  4WE1 A;  4IOC L;  3LAL A;  5CZ1 A;  3L2R A;  3P1G A;  4XEI A;  4HHT A;  4IJN A;  2IGI A;  3THW A;  3AVC A;  4CJE A;  1JLF A;  4GW6 A;  1QVG M;  2WBN A;  1ZBF A;  3MEE A;  4CGF A;  3CPW M;  3JSM A;  4GKK K;  4FWP A;  5B8H A;  4KTZ A;  4BE0 A;  3BZK A;  1TKT A;  3KK2 A;  1VSF A;  3CME N;  1NKE A;  5LMU K;  4BWJ A;  4C8K A;  5I42 A;  1U6Z A;  2RE2 A;  3CPE A;  3L3V A;  4YDU A;  4X64 K;  2ASM A;  4FWL A;  4OX9 K;  2RHK A;  3KWG A;  1Q9Y A;  3MXM A;  1A5W A;  4A59 A;  5FRN A;  3M8P A;  1NM1 A;  4FJN A;  4O8K A;  2HHT A;  4KO0 A;  4DSI A;  4B3O A;  4Q5V A;  1NK4 A;  4FZX C;  5AQN A;  1OVQ A;  2OZS A;  5BPL A;  3V9X A;  5AQK A;  5M1P A;  1T7P A;  4AQY K;  3F5T A;  5CZ2 A;  1VHX A;  1NGE A;  3A8Y A;  2JWL A;  1NK9 A;  5C2F A;  1IG9 A;  4CHQ A;  3SAF A;  4W5N A;  1QHT A;  3IAY A;  5C12 A;  2CH6 A;  4OPK A;  2FSN A;  2IC3 A;  3J81 O;  3K5O A;  5JIC A;  4U67 L;  1JKH A;  4CW7 B;  3QFU A;  3AVK A;  1RNH A;  1R59 O;  2A42 A;  4M45 A;  2PYJ A;  4FJ7 A;  5LJV A;  4FJM A;  3D45 A;  4AM6 A;  3FR0 A;  3OJU A;  4LF7 K;  3MWT A;  3JXU A;  4OKK A;  4CE9 A;  1EO1 A;  4FWS A;  4BC5 A;  3HRG A;  3K0S A;  3VMF B;  3SUQ A;  4DR2 K;  4PA1 A;  3KK1 A;  3VES A;  2UXD K;  3AVG A;  1WSH A;  1GOB A;  3CET A;  2IIR A;  1VQ6 N;  3DOL A;  2YKN A;  4BQL A;  4LF4 K;  2UXC K;  4IOA L;  4J2B A;  2VCP A;  4FZZ A;  5E41 A;  3F9K A;  2VQF K;  1TKD A;  4CK1 A;  1YF5 L;  1KAZ A;  3WUH A;  5GAE P;  2DY4 A;  5JS1 A;  3C6T A;  4CGH A;  3AO3 A;  3FGU A;  3ZX3 A;  3G10 A;  1J53 A;  3DLB A;  3RSE B;  5EU7 A;  2YHW A;  4CES A;  1RDB A;  4DQQ A;  1KAY A;  3LM2 A;  5FRO A;  4LFC K;  2QWM A;  4HTU A;  1JLQ A;  3NH2 A;  2WC9 A;  4BRL A;  1J54 A;  1HYZ A;  2V7Z A;  4FYD A;  1LW2 A;  1CXU A;  4YOY A;  1CZB A;  3TR8 A;  3CJA A;  3ATU A;  5A2Q O;  4JKF A;  4E7L A;  5C0Y A;  5AQM A;  3VEV A;  3MXI A;  2BGG A;  1KRP A;  5GIN A;  1TUY A;  4L3Q A;  5E26 A;  3H1Q A;  3CF5 L;  4FSV A;  4B9T A;  3AVI A;  1KTQ A;  4CZH A;  4B9N A;  5CR4 A;  4A62 A;  3VQQ A;  4JRP A;  1D9D A;  1OVY A;  4YOU A;  2HNZ A;  3VEN A;  2VG6 A;  1JL2 A;  3OA9 A;  3HM8 A;  1DLO A;  4W5Q A;  3AVJ A;  3VA0 A;  4DV5 K;  4H0T B;  4WFN L;  3AV9 A;  2HST A;  4B08 A;  4JKC A;  3FZL A;  3WNE A;  4MQ3 A;  4JS4 A;  1ZYQ A;  1DTQ A;  5HOO A;  4MO4 A;  1D5A A;  3KTQ A;  1HQE A;  1JLG A;  3L2W A;  4Q0B A;  3CD6 N;  2E8A A;  4KH4 A;  1BO5 O;  2X74 A;  4DTN A;  4FK0 A;  4FM2 A;  3CCJ N;  4FZY A;  5AQZ A;  4O0I A;  3KLH A;  3S41 A;  5MLC Q;  3QEI A;  3ZT0 A;  3TSU A;  3V1O A;  2P5O A;  3K9K A;  4B9U A;  4IOX A;  4OLB A;  1YAG A;  3HOS A;  4M3W A;  1KLM A;  3IKM A;  3K9J A;  1NGD A;  5JVH L;  4JLH A;  4FLU A;  4DLE A;  2D0O A;  4DF4 A;  1WBD A;  3MEC A;  3H6E A;  4I2Q A;  3VTH A;  1KAX A;  3SK3 A;  1JLE A;  1S3X A;  1ZXO A;  2PAV A;  3MX2 A;  1UOC A;  1J6Z A;  4BY9 C;  3T19 A;  5CHI A;  3NGI A;  2HHX A;  5F1X A;  4EP5 A;  3TPQ A;  1TKZ A;  3ZX2 A;  4DWI A;  4CJL A;  4I7F A;  3T1Y K;  2OZM A;  1U2V A;  3DLK A;  4WQ4 C;  3TWH A;  2G8I A;  3HYF A;  2XY6 A;  3SUO A;  2VWB A;  3THW B;  4CF9 A;  2J4R A;  4H5T A;  1X9J A;  2V51 B;  3KLI A;  4MFB A;  2JLE A;  5KQ8 A;  1NJI O;  1IKW A;  2VG7 A;  3NCI A;  4BVO A;  2O8B B;  1Y97 A;  2D4W A;  3OYL A;  4N5S A;  1X9M A;  2ITG A;  3U9D A;  3WXI A;  2QTD A;  3O3F A;  1ATR A;  2OPS A;  3PX4 A;  2HB5 A;  5HRN A;  3VA3 A;  3UKR B;  3OY9 A;  3LZJ A;  3LWM A;  4BR9 A;  2RN2 A;  4DR6 K;  1JXE A;  3A5N C;  4N76 A;  4TSX A;  4GV3 A;  1XQS C;  5ADX H;  3CIP A;  3LP2 A;  3G6E N;  1QQN A;  3B8A X;  4KBO A;  4LF9 K;  4DTR A;  2P9U B;  3T1H K;  1VSM A;  2D0B A;  4CD1 A;  4NO7 A;  1BIS A;  5KRT A;  2KFN A;  2RPI A;  4BC4 A;  1TGO A;  2KFZ A;  1IKY A;  3P39 A;  4B3M K;  3BY5 A;  4LH5 A;  1RDW X;  3H46 O;  2XHB A;  4Z0U A;  5HL7 L;  1VSK A;  3ASM A;  4KHS A;  5GIO A;  4CEA A;  3SJH A;  4E7H A;  4QCL A;  4DLG A;  4AHT A;  1NK8 A;  1K8K A;  3OYC A;  2UUC K;  4LFA K;  4IZ9 A;  4Z4C A;  1KVA A;  1YI2 N;  4B9L A;  2B4J A;  1EET A;  3GE1 A;  5DMR A;  3Q7B A;  4CFA A;  1YVN A;  3OYM A;  3HI0 A;  2NRW A;  3IDH A;  3E1Y A;  4Y1D A;  5BRD A;  3P5J A;  4PL7 A;  4XH5 A;  4IJA A;  2F4V K;  3M5R A;  3EKU A;  3DXM B;  4DSE A;  3A2F A;  1S9E A;  2OPP A;  3W0L A;  2A40 A;  3ZSV A;  1C0U A;  4CJ3 A;  4WQ5 C;  1IG8 A;  1XMQ K;  4FPB A;  2G8F A;  1S9G A;  4CED A;  1QVF M;  3AO4 A;  2VWJ A;  3UKU A;  4O55 A;  3SQ4 A;  2F7T A;  4FCY A;  3SUP A;  4DU3 A;  1S6P A;  3BDP A;  5BPM A;  4AHC A;  1HNV A;  5FPE A;  4C1N K;  3AY9 A;  3CJ9 A;  3MCP A;  3GL1 A;  4NCB A;  4M3U A;  4XIU A;  1YIT N;  3HPG A;  3PIP L;  2Q1N A;  2YNI A;  1E4G T;  3HPH A;  3QNO A;  3BUZ B;  1T8E A;  3PUF A;  3ENH A;  4OO1 J;  2DFE A;  4FW2 A;  4JRQ A;  4Z4F A;  1YXQ A;  1BA0 A;  1SUQ A;  1TV6 A;  3Q7C A;  4GKJ K;  5AQU A;  2O8F A;  2GWK A;  3RVC A;  1WAF A;  5DK5 A;  4J8F A;  4DR1 K;  1BI4 B;  4CI6 A;  3THX B;  1KCF A;  3O08 A;  4YY3 K;  5C15 A;  2Q0R A;  3LDS A;  1GOC A;  1GLL O;  2P9N A;  3LP0 A;  4CGG A;  4ILH A;  4XH4 A;  1MU2 A;  4O0J A;  4EP4 A;  3P4I A;  3AO5 A;  4BG8 A;  3L2U A;  3V9Z A;  2G8K A;  1L3V A;  3HBT A;  3OYK A;  3NBP A;  4I2P A;  1RTJ A;  5M1Q A;  4IBN A;  1RBS A;  3CCM N;  3DXK B;  3F2K A;  5JS2 A;  4FLZ A;  1U45 A;  1ZBS A;  2IVP A;  3GBT A;  4K25 A;  3UIQ A;  3AVL A;  1NWK A;  3J7Y P;  2W42 A;  2RF2 A;  4FK4 A;  3O4N A;  3CM6 A;  4FVM A;  3VEZ A;  2PZS A;  2ZQB A;  1L3S A;  5J2M A;  1GLE G;  2HVH A;  4O44 A;  3BZC A;  3O6W A;  4DSL A;  1DEJ A;  5TKY A;  4CD3 A;  1FJG K;  3O4Q A;  2E20 A;  3AA2 A;  4OKJ A;  3VGM A;  1ZBL A;  4F3O A;  3J7Z O;  3S3O A;  2DPN A;  2GX9 A;  3K5L A;  1Y64 A;  4FK2 A;  2EX3 A;  4C8O A;  3CYM A;  4KRF A;  4BDZ A;  4DR5 K;  2HND A;  1CZ9 A;  2I7N A;  3ALY A;  4NXN K;  1RIL A;  4CHO A;  3MN6 A;  3ZCM A;  4HUF A;  4DHY A;  3PX0 A;  2KHO A;  3HM9 A;  3LAN A;  3C94 A;  3EYZ A;  3K5N A;  4ZHR A;  3ATV A;  4BRF A;  4FJG A;  3O3H A;  5H1S Q;  1WSE A;  1M90 O;  2OPQ A;  2OA8 A;  1WAJ A;  3UKR A;  1XNQ K;  4DFJ A;  4KI4 A;  3AAQ A;  4C23 A;  4DU1 A;  4H0Y B;  5EOY A;  5KI6 A;  4DV4 K;  2GUI A;  2ZWH A;  4FO0 A;  3SPZ A;  3DYA A;  3C65 A;  1L3T A;  5C25 A;  4I9L A;  2KLA A;  4BR4 A;  3PV8 A;  2WTU A;  1XI1 A;  4DS5 A;  4H5V A;  3HTV A;  3PSF A;  3U9Z A;  2O8C A;  4MO5 A;  3CJC A;  4JK8 A;  4DFP A;  2EWS A;  1X3N A;  4CJ7 A;  3CCL N;  3JAM O;  4DQS A;  2ITM A;  1J9A A;  1ATS A;  2W6K A;  1E3M A;  5AJ3 K;  1IKX A;  3HT3 A;  2O4I A;  2E2N A;  1LCU A;  4M3Y A;  2E1Y A;  4RW8 A;  3MN7 A;  3VQ5 A;  3ZEU A;  2VWK A;  3BF1 A;  5HRR A;  1L5U A;  4DV6 K;  2HF4 A;  3AA4 A;  4E19 A;  1QZ5 A;  1RT4 A;  4ELV A;  1SKW A;  3HVT A;  3E9P A;  3HSC A;  3VQC A;  3KD5 E;  2A1S A;  4YNQ A;  3DRR A;  2GBZ A;  4BRO A;  2E6L A;  2YJF A;  3S3M A;  1WN7 A;  4DFK A;  1F21 A;  3LDP A;  2FSK A;  2QEX N;  4M7X A;  2W6L A;  4BGB A;  1IBK K;  4FXD A;  4FLW A;  3A5L C;  3KD1 E;  5GAG P;  3QO9 A;  5KGX A;  3R3L A;  3U6F A;  4KAZ A;  1SL2 A;  1T6C A;  1S1U A;  4LH4 A;  3E66 A;  3AVM A;  4LY7 A;  4CHN A;  1NGI A;  1V4S A;  4RW9 A;  3SBG A;  5BRE A;  4E89 A;  4DQI A;  2FBX A;  3N4P A;  1BUP A;  2FXU A;  4IXC A;  3R9P A;  4YOW A;  3LDL A;  4JK7 A;  1TYQ B;  5AQF A;  1BQM A;  4BR7 A;  3VQ8 A;  5AQS A;  2ZE2 A;  3NH1 A;  3DJC A;  4JKG A;  2KW4 A;  3R6M A;  2HMI A;  3DWL A;  4K43 A;  3ZSR A;  1GLA G;  3K5M A;  2UUB K;  1BOT O;  2F9W A;  4JD2 B;  3V81 A;  3AAR A;  1D4X A;  2IVO A;  4CEO A;  4YOT A;  2OCE A;  3WEE A;  2FLO A;  4OGE A;  1X3M A;  1WSG A;  1TL1 A;  1VQ4 N;  2BDP A;  1BHL A;  2Q0U A;  2QWQ A;  3NAE A;  4W5O A;  4AH9 A;  1XHZ A;  4B8A B;  4I6M B;  4FLT A;  3CXC M;  4BC3 A;  4PUO A;  1VSE A;  3HXM A;  1BGX T;  4A2B A;  4BRP A;  3QIC A;  4JI2 K;  4IKF A;  4WQ4 A;  3P83 D;  2WUS A;  1T6D A;  3CQY A;  4NYN A;  4QS7 A;  4FWQ A;  5AQT A;  4AHR A;  1VQ8 N;  3KLE A;  3M8S A;  4C8N A;  4LF5 K;  3M3Z A;  1KQS M;  1RT3 A;  2X78 A;  1ZC6 A;  3B6O A;  3OW2 M;  5HRO A;  2OTL N;  2Q3S A;  1X9W A;  4KFB A;  4LFB K;  4E0D A;  4FWN A;  2NRH A;  3MDQ A;  5SZT A;  3C6U A;  3O80 A;  4CER A;  5JLH A;  5J2P A;  1UAX A;  4RTF D;  1N32 K;  4CEQ A;  3TAB A;  3V1R A;  1TK5 A;  1QZ6 A;  3AA3 A;  3QES A;  1NJZ A;  3ITH A;  2NRR A;  3LPT A;  4C8L A;  4OPH A;  4YFU A;  3C6H A;  4E1M A;  4JD2 A;  1MWM A;  2ZJP L;  1RBV A;  3SZ2 A;  3QLH A;  4FJI A;  4BRD A;  2QKK A;  4KKO A;  5AQG A;  1RT6 A;  2ZJR L;  3AA5 X;  1LW0 A;  1S22 A;  1HQU A;  2YX6 A;  1C0T A;  1C0G A;  3VF4 A;  3THY B;  3DAW A;  1K73 O;  1ATN A;  3O8M A;  3VQ9 A;  2F8S A;  1NKC A;  1LAV A;  4CZF A;  2E2Q A;  3L3U A;  4CJV A;  2P9U A;  3NFA A;  3VQD A;  1W2B M;  3VTI A;  4X66 K;  1KD1 O;  3EY1 A;  2YNG A;  3OYH A;  3LDO A;  2E5L K;  3WXJ A;  1LWE A;  3V1Q A;  2D0P A;  1BIU A;  4FJX A;  3QIN A;  4BC2 A;  2PY5 A;  3T69 A;  3TAG A;  1ASU A;  4CIE A;  1FKP A;  4BRG A;  1GLJ O;  1QQM A;  1V4T A;  4DU4 A;  1N6Q A;  4IG0 A;  4BG9 A;  1NK7 A;  5AQO A;  3A5O C;  4QS9 A;  1YJ9 N;  1RDD A;  2F9T A;  1JLB A;  2P9I B;  3P31 A;  4CF8 A;  3NVM A;  1QSS A;  3DRP A;  4B3R K;  3VPZ A;  2XO7 A;  3V9W A;  2E2P A;  3KLG A;  3OTO K;  3OS0 A;  2YJE A;  4QAG A;  4G9Z A;  4FJJ A;  3ZEU B;  3OHR A;  4A61 A;  2B5J A;  1HPZ A;  1KXP A;  4CZM A;  4H5N A;  1IJJ A;  4CJF A;  4WYB A;  2ZGZ A;  3J8A A;  4KI6 A;  3G0Z A;  2P9L B;  4GV6 A;  4ZTF A;  3EKS A;  1NGF A;  4JKD A;  3OYD A;  3SLC A;  3U4L A;  3KVG A;  3QML A;  4B1V A;  1X9S A;  3OYA A;  1W0H A;  5D3G A;  2IAJ A;  4CJW A;  4H0O A;  2RKI A;  2Z1G A;  5GAH P;  2O8E B;  2IOC A;  3RR7 A;  5GAD P;  5KQD A;  4A2A A;  1S1V A;  2QWR A;  5AR0 A;  3P38 A;  5FLX O;  3KJV A;  1J5E K;  3HK2 A;  4DFM A;  4LF8 K;  1Z05 A;  4BVP A;  1VQL N;  1VSJ A;  4EIA A;  4YDU C;  5M1F A;  2Q97 A;  2AP1 A;  3TAQ A;  3D2E A;  2HHW A;  1Q82 O;  3AVA A;  4HUG A;  2JWK A;  2P9I A;  1EX4 A;  1RT7 A;  5FPM A;  3L2V A;  3E9L A;  1Q81 O;  5E84 A;  3AVB A;  3SQ1 A;  2HBK A;  4KB0 A;  5KPT A;  3HVR A;  3WNG A;  3J80 O;  2VQE K;  4IDH A;  3QEP A;  1EWQ A;  3T3F A;  3DI6 A;  4NXM K;  3U3G A;  1NJY A;  3OYN A;  4ELT A;  4BRE A;  1X1P A;  1TAQ A;  4NLC A;  1IKV A;  4NCA A;  2QXL A;  4OPJ A;  4KH5 A;  1TVR A;  3WEE B;  4FJ9 A;  5AQH A;  1B9D A;  2VGN A;  1HPM A;  3ULE A;  1REV A;  2P9S A;  3O9S A;  4CK3 A;  2HHH K;  4O5B A;  4E1J A;  4CJU A;  2P9P B;  4BQZ A;  4C1N I;  1S72 N;  1BWF O;  2ZJQ L;  4I9Q A;  2NZT A;  3O1W A;  3H3N O;  5EY4 A;  4DTU A;  1CLQ A;  2YKM A;  4JNE A;  5AZI A;  1E4F T;  1SAZ A;  3O9Q A;  1RFQ A;  4JI8 K;  3SCX A;  4M41 A;  2X6N A;  4O4G A;  1HJR A;  1JXB A;  4FLV A;  4E7J A;  4H4M A;  1U47 A;  4B9M A;  3VF6 A;  4BWM A;  4JI5 K;  4UQG A;  4FM0 A;  2HW3 A;  4JKG B;  3VQP A;  4BDY A;  4RCH A;  3MX5 A;  4A57 A;  1NBW A;  1QSL A;  3IS9 A;  1EXQ A;  4BRH A;  2FSJ A;  1W97 L;  2A6A A;  5GIP A;  3FZK A;  5ELZ A;  5J2Q A;  3RMA A;  4GMJ B;  3CCV N;  1CZA N;  2BE2 A;  3MWP A;  4PKI A;  3OVN A;  2G8V A;  1TAU A;  4CBW A;  4CGJ A;  1KVC A;  3EL2 A;  1OH7 A;  2NRV A;  3RMD A;  5FPN A;  1XWL A;  4GV9 A;  1HNI A;  4JI1 K;  1VQM N;  4B8C A;  3CQX A;  4DV0 K;  3K2P A;  1VAZ A;  4B1Z A;  4BRN A;  3HO1 A;  3SYZ A;  3RWU A;  3A0I X;  4MLE A;  1KLN A;  3C0B A;  3L4I A;  4CEE A;  1IO2 A;  4DMN A;  5HBM A;  2BUP A;  4BE1 A;  4ID1 A;  1JCE A;  2VG5 A;  3M1F A;  1C6V A;  4HCC A;  2IDO A;  3AGK A;  3MCA B;  4HCB A;  1GLC G;  1RBT A;  4HWI A;  5J1E A;  1Z26 A;  3K58 A;  4RW4 A;  4PY5 A;  3WXL A;  3DM2 A;  3RSE A;  3FZM A;  1KSP A;  3C95 A;  4ILG B;  2WOM A;  2FF3 B;  1HUX A;  3OYB A;  1A5V A;  2NRX A;  4JI7 K;  4I6M A;  2XY8 A;  2QI2 A;  3MEG A;  3KLF A;  4JI3 K;  1P8Z A;  1G15 A;  3QFP A;  3A5M C;  1QS4 A;  4J2A A;  4JK9 A;  2D0C A;  4B9Q A;  1C1B A;  3I56 N;  1S1T A;  4CHZ A;  1VK0 A;  3L2Q A;  5EX5 A;  4CJQ A;  1NGH A;  4RW7 A;  3SAG A;  1RCH A;  2Z1I A;  3KKS A;  4DG1 A;  4CZK A;  3KKR A;  3TTC A;  4RWT A;  2DFH A;  2E1Z A;  1OH8 A;  1K9M O;  3L4Q A;  1HNW K;  1K8A O;  4X65 K;  2PFU A;  3TTF A;  4YOV A;  4BRI A;  4K0K K;  3NH0 A;  3EZ5 A;  4IDK A;  4FWR A;  1N34 K;  1FW6 A;  1S6Q A;  4BRK A;  1VQ5 N;  2DFF A;  4JS5 A;  1WBB A;  1BIZ A;  5LJW A;  2HBM A;  3VQE A;  3VGK A;  4DF8 A; 
#chains in the Genus database with same CATH homology
 2Q31 A;  3N4P A;  4XH1 A;  1DGK N;  2A3Z A;  5AQW A;  1BUP A;  4H0T B;  4WFN L;  5AQJ A;  3WXM B;  2FXU A;  4IXC A;  2HST A;  3R9P A;  4WFA L;  4JKC A;  3FZL A;  5ADX A;  4YOW A;  3LDL A;  4JK7 A;  3FLC O;  1TYQ B;  3SAH A;  5AQF A;  4BR7 A;  5HOO A;  2BTF A;  4MDA A;  4MO4 A;  2OAN A;  5AQS A;  1VQ7 N;  3DJC A;  4JKG A;  1JCG A;  3TTD A;  1TUU A;  3VEX A;  3G71 N;  3R6M A;  1T44 A;  3QBX A;  3DWL A;  5AFU A;  3CD6 N;  3F9M A;  3QDK A;  4B1X B;  2E8A A;  4K43 A;  4KH4 A;  1BO5 O;  1GLA G;  1BOT O;  2F9W A;  4JD2 B;  4H0P A;  1JCF A;  5AFU H;  2VGM A;  3AAR A;  1D4X A;  3CCJ N;  2IVO A;  5AQZ A;  4YOT A;  1JJ2 M;  3O9T A;  4MLH A;  3WEE A;  2FLO A;  3S41 A;  2P9L A;  3CJ7 A;  1X3M A;  4Y0W A;  5MLC Q;  1HKG A;  1P90 A;  4H0X B;  3TSU A;  1TYQ A;  4FOI A;  1VQ4 N;  3HOT A;  3ZYY X;  1Z6R A;  3D7E O;  3K9K A;  2Q0U A;  2QWQ A;  4IOX A;  1YAG A;  3HOS A;  2W41 A;  3PLA A;  3VF2 A;  3IKM A;  3K9J A;  1NGD A;  3C7N A;  3HZ6 A;  4I6M B;  5JVH L;  3CXC M;  2D0O A;  4BC3 A;  3VOV A;  3IMX A;  3ID8 A;  1VQK N;  3I8B A;  4JAX A;  4A2B A;  4BRP A;  3QIC A;  1T3V A;  5LY3 A;  3H6E A;  4WQ4 A;  3VTH A;  1KAX A;  2WUS A;  1T6D A;  3CQY A;  4QS7 A;  3SK3 A;  1NGA A;  4FWQ A;  5AQT A;  2D1K A;  1VQ8 N;  1S3X A;  1ZXO A;  2PAV A;  3MX2 A;  3QB0 A;  5M1N A;  4B1U B;  4NB4 A;  1J6Z A;  3M3Z A;  3R1X A;  1KQS M;  4H03 B;  2HBL A;  1ZC6 A;  5CHI A;  3OW2 M;  4BY9 C;  2OTL N;  4CZL A;  5F1X A;  4CZI A;  3CI5 A;  3TPQ A;  3ZX2 A;  3O5B A;  3OBW A;  1OKJ A;  4GVE A;  4FWN A;  3O9R A;  2I7P A;  2NRH A;  3MDQ A;  1U2V A;  4WQ4 C;  3WXK A;  5AQI A;  5C10 A;  3G4S N;  3O80 A;  5JLH A;  2VWB A;  1YJN N;  1VQN N;  1O13 A;  1LOT B;  4RTF D;  1DKG D;  2J4R A;  2E2O A;  1X9J A;  2V51 B;  3D2F A;  3ID6 A;  4H5T A;  4O8U A;  3TU5 A;  4BRC A;  3EE8 A;  4FOE A;  5TKW A;  3R8E A;  5KQ8 A;  1QZ6 A;  4AF1 A;  1NJI O;  3D2E B;  3VEY A;  4BVO A;  2NRZ A;  2NRR A;  3U8X A;  2D4W A;  2QM1 A;  4OPH A;  3C6H A;  2ZJP L;  4JD2 A;  1MWM A;  3U9D A;  3WXI A;  2QTD A;  4BRD A;  3CMA N;  1SQK A;  5AQG A;  1ATR A;  2ZJR L;  1ESV A;  4H5R A;  2P9K A;  3QBW A;  1GLB G;  1S22 A;  2YX6 A;  4QS8 A;  3UKR B;  4H5W A;  4FVU A;  4FPA A;  3E9O A;  4BR9 A;  5AZJ B;  1C0G A;  1Q86 O;  3VF4 A;  3DAW A;  5AQR A;  3CC7 N;  3A5N C;  1K73 O;  1ATN A;  3D2F B;  1QQO A;  3O8M A;  4ISG A;  3ULE B;  5AQV A;  1HLU A;  1YUW A;  1HJO A;  4IWV A;  4GV3 A;  5KPR A;  1XQS C;  3GG4 A;  4CZF A;  2E2Q A;  4DKW A;  1MA9 B;  5ADX H;  3KHY A;  3CIP A;  5BR9 A;  2P9U A;  1W2B M;  5M1O A;  3G6E N;  3SMP A;  3VTI A;  5AQQ A;  1QQN A;  3B8A X;  4CZJ A;  4KBO A;  1VQP N;  1KD1 O;  3CCS N;  2P9U B;  3PIO L;  5I9E B;  4JN4 A;  3LDO A;  3NVK A;  3WXJ A;  4CD1 A;  4NO7 A;  3KWI A;  3G25 A;  2D0P A;  3MN9 A;  4NLB A;  5BRF A;  3H1V X;  4BC2 A;  5KPZ A;  4U7B A;  4BC4 A;  3P39 A;  3FZF A;  3T69 A;  3ZET B;  3PIP L;  3H45 C;  1RDW X;  3H46 O;  2GEM A;  2ASO A;  5HL7 L;  5C2D A;  3ZET A;  4BRG A;  1GLJ O;  1QQM A;  1V4T A;  2P9P A;  2YHY A;  1HX1 A;  4BG9 A;  1N8R O;  5F0X A;  3DXM A;  5AQO A;  3A5O C;  4CBU A;  4QS9 A;  5GIO A;  4ILJ A;  1YJ9 N;  2P9I B;  1U2V B;  2F9T A;  1NMD A;  3P31 A;  3SJH A;  4CBX A;  5BRH A;  1BG3 A;  3NVM A;  3VPZ A;  3CJ1 A;  1MDU B;  1K8K A;  3EZW A;  2E2P A;  5F2R A;  4H0V B;  4IZ9 A;  5JLF A;  1YI2 N;  5EXW A;  1Q18 A;  2QW9 A;  3GE1 A;  3O4W A;  5BN9 A;  3Q7B A;  1YVN A;  2YJE A;  3AAP A;  2NRW A;  3HI0 A;  3KZB A;  3IDH A;  4G9Z A;  3E1Y A;  3LDQ A;  4IO8 A;  3OHR A;  3ZEU B;  1C0F A;  3IUC A;  4A61 A;  4GY2 B;  5BRD A;  2V52 B;  1KXP A;  2CGJ A;  4IEE A;  4PL7 A;  4XH5 A;  4IJA A;  1MWK A;  2QWL A;  4CZM A;  2P9S B;  3M5R A;  4H5N A;  3BP8 A;  1IJJ A;  3EKU A;  3DXM B;  5DM7 L;  4WYB A;  2ZGZ A;  3J8A A;  4EAH D;  1WOQ A;  1SZ2 A;  2P9K B;  3VEO A;  1NGC A;  2P9L B;  4GV6 A;  3W0L A;  3EKS A;  1HKC A;  1NGF A;  4JKD A;  3CHW A;  3N4Q A;  2A40 A;  3SLC A;  3U4L A;  5BN8 A;  3KVG A;  3QML A;  5JVG L;  4WQ5 C;  4JKE A;  4B1V A;  1IG8 A;  4BRA A;  3W3D A;  3UB5 A;  4IEI A;  4FPB A;  3CCU N;  2GUP A;  3MN5 A;  1QVF M;  4BR0 A;  4H0O A;  5GAH P;  4YOX A;  2ZGY A;  2QA4 N;  1H1V A;  3UKU A;  3FE1 A;  5GAD P;  2F7T A;  4A5B A;  4EHU A;  5JMV A;  5KQD A;  4A2A A;  2HOE A;  2PBD A;  4JHD A;  2W40 A;  5AZJ A;  3EE9 A;  4ISE A;  2QWR A;  4WQ5 A;  5AR0 A;  4OPA A;  3P38 A;  4BR5 A;  2CGL A;  1GLF O;  4CZE A;  5BPM A;  1BU6 O;  2V7Y A;  4JHD B;  5FPE A;  1Z05 A;  3CCQ N;  3MK6 A;  4AM7 A;  3AY9 A;  3CJ9 A;  5AQX A;  4BVP A;  4PKG A;  4C1N K;  4YDU C;  4EIA A;  1VQL N;  3MCP A;  3BF3 A;  1NLV A;  3GL1 A;  5M1F A;  3C6A A;  4MDB A;  1YIT N;  2Q97 A;  2AP1 A;  2Q1N A;  3D2E A;  3LDN A;  4FL9 A;  4WF9 L;  4JKH A;  1HKB A;  1E4G T;  5BPN A;  1Q82 O;  3CC2 N;  4UY8 O;  4K41 A;  3I33 A;  2A5X A;  1RDU A;  2JWK A;  2P9I A;  3BUZ B;  4KH6 A;  3ENH A;  3H3O B;  5FPM A;  4OO1 J;  3E9L A;  2CGK A;  1RGI A;  1Q81 O;  1YXQ A;  4FWK A;  4K42 A;  5E84 A;  1BA0 A;  2VYP A;  4EFH A;  2HBK A;  3Q7C A;  5CE3 A;  1NGG A;  1Q7Y O;  5AQU A;  4CZG A;  5KPT A;  2GWK A;  4IDH A;  4M63 C;  3RVC A;  1YHQ N;  3VET A;  1XC3 A;  2YCH A;  1SS6 A;  4GNI A;  4J8F A;  4FWO A;  5AQP A;  4B1W B;  4CI6 A;  3CCR N;  2QWO A;  3O08 A;  3M6G A;  3NMU A;  5C15 A;  2Q0R A;  3ZX0 A;  1GLL O;  4BRE A;  3CC4 N;  2P9N A;  1K8K B;  3VGL A;  4NLC A;  2QWN A;  2Q2R A;  4ILH A;  4LC9 B;  2YHX A;  4XH4 A;  2P9N B;  2A41 A;  2QXL A;  3EO3 A;  5DM6 L;  3P4I A;  4KH5 A;  3WEE B;  4DQ8 A;  5AZI B;  5AQH A;  4BG8 A;  2WFB A;  2VGN A;  4WFB L;  1HPM A;  2IVN A;  2HMP A;  2GTD A;  3HBT A;  1YIJ N;  3ULE A;  2HF3 A;  2CH5 A;  1EQY A;  3LL3 A;  4YOR A;  4DB3 A;  2FF6 A;  5M1Q A;  2P9S A;  3OBY A;  1NGB A;  3O9S A;  3CCM N;  4BRM A;  3UKU B;  2AA4 A;  4E1J A;  3DXK B;  4B1Y B;  3F2K A;  4Z94 A;  2P9P B;  2YI1 A;  4BQZ A;  4ISF A;  3TSP A;  1BWF O;  4C1N I;  4IOC L;  1S72 N;  1ZBS A;  2ZJQ L;  2IVP A;  3GOI A;  2NZT A;  4XEI A;  3O1W A;  1M1K O;  3H3N O;  3GBT A;  2Q36 A;  4IJN A;  4K25 A;  5EY4 A;  1QVG M;  1GLD G;  1NWK A;  2WBN A;  4JNE A;  5AZI A;  1E4F T;  3CPW M;  1SAZ A;  3MMV A;  3O9Q A;  4M7Y A;  4FWM A;  1RFQ A;  3VEZ A;  4FWP A;  3JS6 A;  3UE5 A;  5B8H A;  1GLE G;  4BR2 A;  3IFR A;  3CME N;  3O6W A;  4JKB A;  3VF6 A;  1U6Z A;  4JKA A;  3T7Z A;  1DEJ A;  2RE2 A;  3CPE A;  4YDU A;  5TKY A;  3L6Q A;  2ASM A;  4FWL A;  4CD3 A;  2RHK A;  2E20 A;  3VGM A;  2NLX A;  3KWG A;  3J7Z O;  2DPN A;  4A59 A;  2NNW A;  2GX9 A;  1NM1 A;  4HTL A;  4JKG B;  3SMS A;  1Y64 A;  4O8K A;  3O1B A;  4RCH A;  5AQL A;  4R79 A;  3MX5 A;  5AQN A;  4A57 A;  1NBW A;  2I7N A;  5BPL A;  3MN6 A;  5AQK A;  4DHY A;  5M1P A;  2KHO A;  3F5T A;  3FZH A;  3ENO A;  4BRH A;  1NGE A;  1G99 A;  3A8Y A;  2JWL A;  4A5A A;  3ATV A;  2FSJ A;  3FFK B;  3L0Q A;  4BRF A;  5C2F A;  1NGJ A;  5H1S Q;  1W97 L;  3SAF A;  3CCE N;  1M90 O;  4O5F A;  2A6A A;  5C12 A;  2CH6 A;  3UKR A;  5GIP A;  2FSN A;  3FZK A;  5ELZ A;  5JIC A;  3AAQ A;  4C23 A;  4U67 L;  4PL8 A;  4H0Y B;  5EOY A;  3CCV N;  1CZA N;  3QFU A;  3WQT A;  2ZWH A;  3MWP A;  4FO0 A;  4PKI A;  1R59 O;  2A42 A;  3C65 A;  2E88 A;  4CBW A;  3EL2 A;  4F9O A;  5LJV A;  2KLA A;  2NRV A;  4BR4 A;  5FPN A;  4GV9 A;  5M1K A;  5AQY A;  3TSQ A;  4WCE L;  1VQM N;  1BDG A;  3CQX A;  4AM6 A;  3FR0 A;  4H5V A;  1VAZ A;  4B1Z A;  3MWT A;  3HTV A;  3JXU A;  3U9Z A;  4BRN A;  4MO5 A;  1EO1 A;  4FWS A;  3VER A;  3CJC A;  4BC5 A;  3HRG A;  4JK8 A;  2EWS A;  1X3N A;  1WUA A;  3A0I X;  3D6R A;  4MLE A;  3VMF B;  4CJ7 A;  3C0B A;  3L4I A;  3CCL N;  3LM9 A;  3CJB A;  2ITM A;  1ATS A;  1VQ9 N;  2BUP A;  3VES A;  2E2N A;  1JCE A;  3M1F A;  3CET A;  1LCU A;  2IIR A;  2NRT A;  2GWJ A;  3AGK A;  3MCA B;  3SBT A;  1VQ6 N;  4BGA A;  2E1Y A;  1GLC G;  4BQL A;  4IOA L;  3MN7 A;  2VCP A;  4HWI A;  3BEX A;  1BA1 A;  3ZEU A;  1KC8 O;  1YF5 L;  1KAZ A;  3WUH A;  3WXL A;  2UYT A;  3RSE A;  3FZM A;  5GAE P;  2OTJ N;  3BF1 A;  3FGU A;  3ZX3 A;  4ILG B;  2HF4 A;  3RSE B;  2FF3 B;  2YHW A;  1HUX A;  1QZ5 A;  2NRX A;  3WT0 A;  3GDQ A;  1KAY A;  3LM2 A;  2HBJ A;  3C7N B;  3EN9 A;  4I6M A;  2QI2 A;  4BRQ A;  2GEL A;  3E9P A;  3HSC A;  2QWM A;  3ENB A;  1QHA A;  2QWP A;  3I55 N;  2BH1 A;  2WC9 A;  1P8Z A;  4BRL A;  2V7Z A;  3QFP A;  3VEW A;  3A5M C;  1XUP O;  4BRO A;  4JK9 A;  4B9Q A;  4YOY A;  1ILY A;  3CJA A;  3O9U A;  3ATU A;  4IO9 L;  4JKF A;  3I56 N;  5EVZ A;  2YJF A;  2H3G X;  5C0Y A;  5AQM A;  3VEV A;  5EX5 A;  1NGH A;  4EHT A;  3LDP A;  2FSK A;  3CER A;  3SAG A;  5GIN A;  2QEX N;  4M7X A;  1TUY A;  4L3Q A;  4CZK A;  3TTC A;  5E26 A;  4RWT A;  3DXK A;  3H1Q A;  3CF5 L;  4FSV A;  4BGB A;  2E1Z A;  4IFE A;  1DT9 A;  3A5L C;  4CZH A;  3AGR A;  4PHT X;  5GAG P;  1K9M O;  5CR4 A;  3L4Q A;  4A62 A;  5FPD A;  3R3L A;  1K8A O;  4JEP A;  1OVY A;  2PFU A;  3TTF A;  4YOV A;  1YJW N;  2ZF5 O;  4BRI A;  3DLL L;  2ASP A;  1T6C A;  4YOU A;  4FWR A;  3VEN A;  3E66 A;  4BRK A;  4DCH A;  1VQO N;  1VQ5 N;  2KKZ A;  1NGI A;  3OA9 A;  1V4S A;  3KK7 A;  4PKH A;  3HM8 A;  3SBG A;  3WQU A;  2HBM A;  5LJW A;  3VGK A;  5BRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...