2FSNA

Crystal structure of ta0583, an archaeal actin homolog, complex with adp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
325
structure length
310
Chain Sequence
MVVVGLDVGYGDTKVIGVDGKRIIFPSRWAVTIPVLSTDGGQTKFIYGKYASGNNIRVPQGDGRLASKEAFPLIAAALWESGIHVDLVIGSGTPLGTFDLEVKAAKEALENKVLTVTGPEGEVRQFNITRLIMRPQGVGAALYLLNQGIIEQQPGYGVVIDVGSRTTDVLTINLMDMEPVVELSFSLQIGVGDAISALSRKIAKETGFVVPFDLAQEALSHPVMFRQKQVGGPEVSGPILEDLANRIIENIRLNLRGEVDRVTSLIPVGGGSNLIGDRFEEIAPGTLVKIKPEDLQFANALGYRDAAERS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein Ta0583
publication title Crystal structure of an archaeal actin homolog
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Structural protein
total genus 71
structure length 310
sequence length 325
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17989 ALP_N Actin like proteins N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2fsnA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2fsnA01
5ADXH 3EKUA 3VPZA 2P9PA 2PBDA 3U4LA 4B1UB 3UKRB 2D4WA 4L3QA 4BRHA 1RGIA 3LM2A 2VCPA 2IIRA 4FWKA 3G25A 1BO5O 5AQJA 4AM7A 3A0IX 4K41A 3VOVA 1G99A 1GLJO 3MN5A 3VF6A 3WXJA 2FSNA 3CETA 3VERA 5AQUA 5BR9A 1HX1A 4BC3A 3BF3A 3TPQA 4BREA 1SQKA 2CGKA 5AFUH 3MN7A 5AQPA 4RWTA 2P9SB 2ITMA 3MDQA 4M63C 1IG8A 4BQZA 2GEMA 3UKUB 3QDKA 3ZEUB 2Q0RA 4K25A 2FLOA 4IZ9A 3ATVA 4IWVA 3CIPA 3HI0A 5JLHA 2P9KA 3EO3A 1S22A 5EY4A 3VGLA 2P9IB 1YAGA 3J8AA 3CHWA 5EXWA 1HUXA 4BRNA 5TKYA 1MDUB 2P9PB 4A62A 3LDPA 4HWIA 1NGHA 5AQGA 3WT0A 3OHRA 3VENA 1YXQA 3HZ6A 5AQMA 1XC3A 3MN6A 2YHWA 1ATSA 5AZIA 5AQLA 1HPMA 4BRAA 4H5RA 4XH5A 3BUZB 2AA4A 3ENOA 1NLVA 1BWFO 1T6CA 4JD2A 3M3ZA 5AQWA 1NBWA 2VWBA 1GLLO 3CJAA 2BUPA 2GUPA 4H0YB 2P9UA 3HTVA 3ENHA 2CGJA 3ZETA 4B1VA 3O08A 1Z05A 1NGJA 3EL2A 1DGKN 3VF2A 5AQYA 2ZF5O 4WQ5A 4DHYA 3GL1A 3A8YA 3WEEB 4DQ8A 3LDNA 3C0BA 5AQFA 1OKJA 2GWKA 2E1YA 2PAVA 4B9QA 4CBWA 2Q2RA 1YVNA 5ELZA 3CERA 2H3GX 2QWRA 2A40A 3RSEA 3ZX0A 3L4IA 1P8ZA 2CH5A 4IXCA 2KHOA 4M7YA 4BC2A 1QQMA 2QWQA 3KVGA 3FZKA 3H1VX 4CZHA 5AZIB 1NGDA 3O80A 3WUHA 2IVNA 2F9TA 2V7ZA 3KHYA 3FR0A 3QICA 3GG4A 2YHXA 3LM9A 4H5NA 3QBXA 4JD2B 3W0LA 5AFUA 3SLCA 1NGIA 3R8EA 3WXLA 1QHAA 1QZ6A 4HTLA 1HJOA 3SMSA 3IFRA 2HF3A 3DAWA 3D2EA 1QQNA 3LDLA 2I7PA 2P9UB 3VESA 3VEWA 2A3ZA 4BRKA 5F0XA 4CJ7A 1X9JA 2E2PA 4PL8A 3O4WA 2QWLA 4PKHA 4MLEA 5LY3A 4BRIA 3DWLA 2HMPA 3FE1A 2CH6A 4YDUA 2I7NA 3RSEB 3QB0A 3O1BA 2WUSA 4DCHA 2Q97A 5AQNA 3ZX2A 5BPNA 5BN9A 1BG3A 1YUWA 5EOYA 3A5OC 3FZFA 3ID8A 4BR2A 2W41A 3VETA 1EQYA 4H0TB 3GDQA 3I8BA 3VEXA 1J6ZA 3ATUA 5AR0A 1K8KA 4BC5A 4I6MA 1BUPA 4FWNA 1Y64A 4A2AA 1SAZA 1NGEA 4BRPA 3D2EB 2GTDA 1Q18A 4FO0A 1BU6O 1GLAG 1JCGA 3D2FA 3FGUA 4GNIA 4RTFD 2YHYA 5FPEA 2FF6A 3SJHA 4RCHA 2QW9A 3FLCO 2E2NA 1GLFO 5BRDA 1GLCG 3FFKB 3WXKA 3MMVA 1C0GA 3AAQA 1X3MA 1KAXA 1V4SA 3QBWA 5F1XA 2ASOA 3EZWA 4B1WB 3JS6A 5KQDA 3DXMA 4CZKA 4FWSA 1BOTO 3A5MC 4BG8A 5KPTA 3UE5A 2A5XA 2E8AA 2HF4A 3VEYA 3GBTA 3A5NC 5BRFA 3LDQA 2D0PA 3AAPA 1MWMA 2YJFA 1BA0A 3AY9A 1E4GT 2FF3B 4QS7A 1K8KB 3O8MA 1NWKA 3HSCA 3GE1A 4M7XA 4O8KA 4BRLA 1NGGA 4J8FA 5E84A 1LCUA 1X3NA 1GLBG 4IO8A 3QFPA 1DEJA 3D2FB 4BR5A 1U2VA 1HKBA 4FWOA 4Y0WA 5ADXA 2P9KB 3IDHA 4BRMA 4ISEA 4WQ4C 3BEXA 3H45C 3MK6A 5F2RA 4H03B 4CD1A 4FWLA 3DXMB 3GOIA 1DKGD 3AARA 3I33A 4H0OA 4EHUA 4AM6A 4EHTA 5KPRA 2IVOA 2E2QA 3M1FA 5AZJA 2ASMA 3O5BA 5AQSA 5B8HA 5AQZA 4EIAA 1XQSC 3S41A 1ZC6A 4MO4A 4C23A 2GELA 1TUUA 2ZGYA 5KQ8A 1NGAA 4H5VA 3VGKA 2NRHA 2QWPA 2YJEA 1E4FT 3CJ9A 3ZETB 1WUAA 1D4XA 3O1WA 4FWPA 4FPBA 4NO7A 4CZGA 2QM1A 3WQUA 1U2VB 2D1KA 4B1YB 2DPNA 4FSVA 4GY2B 4BR0A 1T44A 2J4RA 1HKGA 3CQXA 4KBOA 4CZIA 3W3DA 3VEZA 3CJCA 1LOTB 2QWOA 4B1XB 2F9WA 5KPZA 2E20A 4FWMA 5FPMA 4CBUA 5EVZA 5AQKA 4BR9A 4K42A 4FL9A 4B1ZA 4EFHA 3L0QA 3IUCA 2Q1NA 2QWMA 1S3XA 4LC9B 4XH1A 4CZLA 4CBXA 4E1JA 5AZJB 5BREA 2CGLA 4QS8A 1R59O 1KAZA 2V7YA 2A6AA 3FZLA 2E1ZA 3A5LC 3H1QA 3JXUA 4FPAA 3EN9A 2EWSA 3QMLA 1ATRA 3SK3A 2QWNA 1Z6RA 2Q36A 3BP8A 4XEIA 1TUYA 4BRCA 5BN8A 4A2BA 3MCPA 3WQTA 4QS9A 4EAHD 1QQOA 4JHDA 2D0OA 4ISGA 3ULEA 5JICA 4CD3A 4JAXA 3C7NA 4PKIA 3FZMA 4JNEA 5AQOA 2VYPA 2HOEA 2ZWHA 1CZAN 1MA9B 4BRQA 1H1VA 1HLUA 4WYBA 4CZJA 4FWRA 2BTFA 3H46O 5AQQA 2Q0UA 5BRHA 1KXPA 3QFUA 5JMVA 4WQ5C 3WEEA 3DJCA 4CZEA 1XUPO 2QXLA 4O5FA 1ZBSA 4IJNA 4DB3A 4PL7A 4BC4A 2NZTA 4CI6A 4I6MB 3H6EA 4H0PA 5AQRA 1NGBA 2ASPA 2YCHA 4IJAA 3VEVA 1NMDA 4BG9A 3VEOA 3HM8A 4BR7A 3U9ZA 2FSKA 3F9MA 5JLFA 1GLEG 3EKSA 1C0FA 3M6GA 4JHDB 4BGBA 2V52B 4H5TA 1U6ZA 2ZGZA 3ULEB 5LJVA 4MLHA 5BPLA 3U8XA 3MN9A 4PKGA 3BF1A 2GWJA 4FWQA 2Q31A 4XH4A 3VGMA 3DXKA 3C7NB 1NGFA 5AQHA 4BQLA 4CZMA 2P9LA 1V4TA 3ZX3A 1RDWX 1NM1A 2E88A 1MWKA 2FXUA 2A42A 5I9EB 4BGAA 4NB4A 3D7EO 3L6QA 2IVPA 5LJWA 1QZ5A 2P9NA 1TYQA 2UYTA 3U9DA 5AQVA 4A61A 4F9OA 4MO5A 1HKCA 4BVPA 3CJ1A 3UKRA 5AQXA 4BVOA 1ZXOA 4YDUC 1KAYA 5FPDA 3B8AX 4BROA 4FOIA 4BR4A 4BRDA 1NGCA 4K43A 5CE3A 3O6WA 3VF4A 2YI1A 5EX5A 4H0VB 5FPNA 3IMXA 1ATNA 3H3NO 4JN4A 3UB5A 1ESVA 3H3OB 3WXIA 1SZ2A 1RFQA 4BRGA 2W40A 2A41A 4H5WA 2FSJA 1GLDG 3CJBA 4WQ4A 5BPMA 3R9PA 3FZHA 3DXKB 2E2OA 4ISFA 2AP1A 5E26A 3CI5A 3R6MA 5AQTA 3SMPA 2P9SA 3TU5A 1BDGA 5AQIA 2P9LB 2OANA 3LL3A 3UKUA 3ZEUA 1T6DA 1JCEA 2NLXA 4BRFA 4CZFA 4FOEA 1IJJA 4H0XB 1WOQA 3HBTA 2P9NB 1BA1A 1JCFA 1TYQB 2V51B 3CJ7A 3CQYA 3LDOA 4Z94A 3KZBA 2P9IA 3P4IA
chains in the Genus database with same CATH superfamily
5ADXH 3EKUA 2P9PA 4B1UB 4CF2A 1T3VA 2P51A 1S5JA 3MXMA 2Z1GA 1N8RO 4E7LA 2IIRA 1BO5O 3OTOK 4KO0A 4K41A 5GAGP 3VOVA 4C8KA 1ZYQA 1GLJO 3KK3A 3MN5A 2XHBA 4OGCA 3CETA 1S1XA 1LWFA 1CZBA 4AQYK 4LH5A 4LF4K 5M1NA 1VK0A 3LP0A 4CEDA 4FLYA 5CHIA 3HPGA 2UU9K 5AFUH 2O4GA 3AA2A 3MN7A 2ZJRL 4RWTA 2IS3A 2RPIA 1X9WA 2FC0A 2GEMA 3UKUB 3ZEUB 4IOAL 4KH6A 4DTRA 2OZMA 4IWVA 4KI4A 5JLHA 1JLGA 4CHOA 2FBTA 3EO3A 4O4GA 5EY4A 2P9IB 3CHWA 4BRNA 4C8NA 5TKYA 1MDUB 2P9PB 4B9MA 5KGXA 4CJRA 1X9SA 4FM2A 1VSEA 5AQMA 4HUEA 1JXBA 3LZJA 4H5RA 3BUZB 2AA4A 3NGYA 4OO1J 3OYHA 1BCMA 3VQ5A 2XRIA 1RT1A 2XO7A 5M1PA 5HRNA 1SL1A 3DLRA 1L3SA 2GUPA 3ENBA 4F2RA 2P9UA 1HJRA 1IV0A 1QVFM 3EL2A 3L3UA 4B3RK 3VF2A 5AQYA 4DR2K 4DHYA 3A8YA 3C0BA 1YJ9N 4N76A 1VQ5N 5FRMA 4E89A 3OYKA 4B9QA 1LW0A 2H3GX 3ZX0A 4OPKA 2CH5A 4IXCA 3S3OA 4M7YA 4FZZA 4BC2A 1QQMA 1ZBFA 2QWQA 3V1OA 3H1VX 4CZHA 1VAZA 2HNDA 2QTDA 3WUHA 3V9WA 2V7ZA 3FR0A 3EE9A 3R8EA 2QK9A 4HTLA 3IFRA 3NHGA 3G6EN 3DAWA 3VQAA 4BE0A 4YOWA 1NOZA 2P9UB 1A5XA 4DSFA 1FJGK 3DRRA 4GMJB 3DM2A 3P1GA 4CHQA 3K59A 5C2FA 4BWMA 4DQPA 2B5JA 4NCAA 4BRIA 3FE1A 1HYSA 4N5SA 1OH8A 4FJ5A 3PSIA 4PA1A 2Q97A 3MEEA 5AQNA 4DWIA 3IG1A 4N41A 4JK7A 3FZFA 3PUFA 1NJZA 2KTQA 3NGZA 5GIPA 3GDQA 4FJJA 1J6ZA 3ATUA 5AR0A 1K8KA 4UY8O 3VQ7A 1EWQA 1EETA 2DTUA 4ELVA 1Y64A 4J2AA 1VQNN 3TAFA 2F4VK 4A2AA 2ZQBA 2GTDA 1Q18A 1VQ7N 2AJQA 4LD0A 5SWMA 4DQSA 2IGIA 2IDOA 1YITN 1NKBA 4E7IA 5BRDA 3L2WA 1GLCG 3HOSA 3WXKA 3MMVA 2BE2A 2F96A 1X3MA 5LMUK 3OYNA 4B3MK 5F1XA 3JS6A 2YNGA 2OTJN 5KQDA 3DXMA 3SPYA 5KPTA 3MEGA 2A5XA 2E8AA 3ZT2A 2F8TA 3I55N 2VGMA 4KH5A 3K9KA 3GBTA 2WC9A 3HOTA 1RT4A 1BA0A 3F73A 1E4GT 3TAEA 1K8KB 3O8MA 4O8KA 5J2MA 1NMNA 1KVAA 4J8FA 2XY8A 4IO8A 1KD1O 1DEJA 3EYZA 3SI6A 1WSHA 4HTUA 1IO2A 4FWOA 3OJSA 3ZSOA 1UWBA 5C10A 4ISEA 3RTVA 3NH0A 3TAMA 1TV6A 3H45C 1RBRA 4WFAL 1JKHA 4FM1A 4JI2K 3DXMB 4Z0UA 4JI1K 3OJUA 4EHTA 2WOMA 2IVOA 2E2QA 2HNZA 5AQSA 2VG5A 4C8MA 1IBLK 3ZSVA 3SUNA 3OS2A 1KVBA 3V9SA 3NAEA 4DSKA 4CEQA 3RR8A 3VGKA 5CYQA 4CEEA 4B9LA 2QWPA 3CJ9A 1X1PA 1WUAA 5J2NA 1YT3A 3O1WA 3KWGA 2VG6A 2NRZA 5I3UA 4FPBA 5C0YA 2Q3SA 4G9ZA 4B9UA 4JK9A 4B1YB 4GY2B 4BR0A 2HHHK 3RVCA 4KBOA 3CCEN 4H4MA 1FXXA 2X6NA 3VEZA 3SPZA 1Q9XA 4FWMA 4FLVA 5AQKA 4BR9A 1P90A 4K42A 4B1ZA 4EFHA 3L0QA 3SNNA 2Q1NA 3QEPA 4CBXA 4E1JA 1QS4A 1ZBIA 4QS8A 1R59O 4CJKA 1Q86O 2A6AA 3A5LC 3H1QA 2Z1JA 2VGNA 3PIOL 3G0ZA 4BDPA 1HYVA 4Z4EA 2UXCK 2Q36A 3TTCA 2D0BA 3UIQA 5CY4A 5FROA 1Q7YO 3VMFB 1SKRA 1VRUA 2GUIA 3MWTA 4OX9K 4IEEA 1RILA 5GAEP 4X66K 3PO4A 3R3LA 4DMNA 1B9FA 4DR1K 1TVRA 5E41A 4JNEA 4NYFA 2RN2A 2QEXN 5HRPA 4A5BA 1MA9B 3MECA 4CZJA 2PY5A 1LAVA 3TI0A 5AQQA 4PWDA 4FJGA 5BRHA 1HQUA 3AO1A 3K9JA 4CGFA 5JMVA 4FM0A 3CMEN 2P1JA 3SBGA 3MWPA 4I9LA 4I7FA 1C0TA 4I2PA 1NJIO 1XUPO 4O5FA 3VA0A 4DB3A 3O9RA 5FLXO 4JV5K 4BC4A 4AHCA 4CI6A 2ASPA 4CW7B 3CPEA 1XHXA 3MCAB 3SV3A 3THWA 3T3FA 3U9ZA 4DUYK 1GLEG 3EKSA 1REVA 3M6GA 2V52B 3QEIA 1JJ2M 4MLHA 2XY5A 1YF5L 1JLAA 4XH4A 3V81A 4YNQA 3DXKA 3PX4A 3AA5X 4ZTJA 5K14A 3SAFA 1I39A 4CZMA 1S1WA 4CJTA 3R1XA 1D5AA 1NM1A 2O4IA 5HL7L 4BGAA 5LJWA 2IVPA 4AHUA 1QZ5A 3L3VA 4CECA 3CCUN 1G15A 1IKXA 3AO3A 3DOKA 3DLKA 5AQVA 3WNHA 4ICLA 1ZBLA 5AQXA 3VA3A 1QTMA 1UOCA 3AGRA 4FOIA 3THWB 1NGCA 5GINA 3HT3A 3RRGA 2YI1A 4DR7K 3E9OA 5FPNA 3H08A 1ATNA 1BIUA 4CK3A 1SZ2A 4BRGA 4CF0A 2GV9A 3ALYA 3CJBA 4WQ4A 5BPMA 3DXKB 2AP1A 4CHZA 1LV5A 2VWKA 4KB0A 1L3VA 4DU4A 4RW8A 4JEPA 1T6DA 1T03A 2NLXA 4BRFA 2G8FA 2YKNA 3T1HK 4CIEA 3OVNA 1KFSA 2JWLA 2D0AA 1WLJA 3HBTA 1X9MA 1RT7A 5D3GA 2VWJA 4CJ3A 1Q81O 2HHUA 4DTMA 5BR8K 3OYIA 3U4LA 3HP6A 3U3YA 4PHTX 4X65K 4NLCA 4PUOA 2DFHA 4DSJA 1RGIA 3SYZA 3E1YA 3VQQA 3G25A 4DUZK 1NJYA 5AQJA 2ZM6K 4CJWA 1ASUA 3KKRA 3VERA 5AQUA 1SS6A 5BR9A 4BC3A 3BF3A 3TPQA 3NVKA 3B6PA 4O55A 5C15A 4CFCA 3C95A 4JI3K 4LH4A 3NFAA 4KPYA 1IG8A 3CCSN 4BQZA 3P5JA 2Q0RA 3HK2A 4KAZA 4M3TA 3V4IA 1W97L 1S1TA 3KWIA 4DF4A 1S22A 3OBWA 2GX9A 3J8AA 3LANA 5EXWA 1HUXA 4KB1A 3ZT1A 4A62A 3LDPA 3AO4A 2O8DB 5AQGA 3WT0A 1N34K 3HZ6A 3LAMA 1XC3A 3CCRN 3RRHA 4DS4A 3AA3A 5AZIA 3MAQA 1HQEA 3ENOA 4JKFA 4JD2A 3HPOA 1A5WA 3M3ZA 4FJ9A 1NBWA 4FJMA 2BUPA 3DI6A 1OH7A 1YJWN 4CEZA 3TABA 3HTVA 4WE1A 2CGJA 3ZETA 1N5YA 1NGJA 3OYDA 2ZF5O 1SL2A 1JL1A 3PIPL 3V6DA 3GL1A 1U47A 3SQ2A 5M1QA 3WEEB 1LWCA 1FK9A 3M8SA 1OKJA 3MX5A 2GWKA 2VG7A 4Y1DA 2PAVA 2Q2RA 1WSJA 3SUOA 5ELZA 4OLBA 2A40A 1BCOA 5KRSA 2KFZA 4M3ZA 2KHOA 3V1QA 1Q82O 4FJ7A 3KVGA 3NF9A 3FZKA 3VTIA 5AZIB 1RDAA 3O80A 3CCMN 3CM6A 3O3HA 1EXQA 4RG8A 2YHXA 3LM9A 3J80O 4JD2B 3SLCA 1VQ9N 1NGIA 3WXLA 1QHAA 1QZ6A 4OLAA 1HNIA 4NXNK 2XY7A 2WBNA 4A57A 4FVMA 3D2EA 4CERA 3TAPA 4RW4A 3VEWA 2A3ZA 1HRHA 3DYAA 1U49A 1RCHA 4ID1A 3KK1A 4PL8A 1W2BM 5HLFA 1LAWA 2I5JA 3LDSA 4J2DA 2QWLA 1ASVA 3C65A 4PKHA 3DWLA 1TK0A 4AH9A 4E1MA 4CHPA 3F2KA 3QB0A 5HOOA 4DCHA 4CE9A 4KHSA 3VQBA 5BN9A 1BG3A 3LPUA 3P31A 4FK0A 2OPSA 3ID8A 4BR2A 4DSEA 3TARA 1EQYA 4H0TB 3I8BA 1K9MO 1WB9A 2HHVA 4NCBA 5HROA 4JI5K 3CQ8A 1NGEA 4DF8A 3D2EB 3AVIA 1BU6O 3FGUA 1JCGA 3TWHA 4GNIA 4Y1CA 3TSQA 2UUCK 3DOLA 2E2NA 5GADP 1GLFO 3CCVN 3ZSQA 1WAJA 5M1FA 1V4SA 2ASOA 1CZ9A 3L2UA 3IS9A 4CZKA 4FWSA 1BOTO 4BG8A 3UE5A 1TKDA 4XIUA 5HBMA 3KLGA 2IAJA 3NDKA 1JLEA 3ZT3A 3AY9A 2BGGA 4DFPA 4QS7A 3LWLA 4LFAK 4QOZB 3C6AA 1UA0A 1I3AA 2G8VA 4M7XA 1TK5A 3TAGA 1NK5A 4JKHA 4F4KA 5E84A 3K5OA 1LCUA 3JAMO 3I56N 1IG9A 1S9GA 3AVKA 4Y0WA 3WNFA 3L2QA 4M3UA 4F3TA 3CCLN 4B3SK 4WQ4C 4N47A 3KLEA 4CJEA 4C1NK 3OW2M 1QQCA 5DK5A 4CFAA 4PQUA 1FW6A 3GOIA 3I33A 4CJLA 4H0OA 2YNHA 4AM6A 3NF6A 1WSIA 4A59A 4YFUA 3M1FA 2ASMA 3C94A 1ZC6A 4R5PA 2GELA 2ZGYA 4JI0K 4IEIA 4NCGA 2PZSA 4V19S 1D4XA 2GBZA 4NO7A 1RDBA 3HRGA 4CK2A 4CZGA 3WQUA 2LSNA 2D1KA 2DPNA 4FSVA 1HKGA 1T8EA 3W3DA 4KREA 3PX0A 3QO9A 1EO1A 1LOTB 5KPZA 2E20A 4GW6A 1IKYA 1WBBA 3ULDA 2YX6A 3TSPA 1L3UA 3IUCA 1S3XA 4LC9B 4XH1A 1D9DA 4CZLA 4KTWA 1KAZA 3OS1A 4DQIA 4JS4A 2Z1IA 3JXUA 3T1AA 4DS5A 2EWSA 1J9AA 3SK3A 4GVEA 2QWNA 3QESA 1L5UA 3BP8A 4HVJA 4DLEA 5BN8A 3QEWA 4EAHD 4JHDA 4EP4A 4LFBK 5KI6A 1NNEA 2Y1JA 1XMQK 4PY5A 4CGIA 3FZMA 4CEBA 2IC3A 3ID6A 4B08A 1CZAN 3ZSZA 1N36K 5DM7L 4YOTA 5C2DA 3PY8A 2RE2A 2Q0UA 4W5OA 4FLXA 3D6RA 4CZEA 2F7TA 1XNRK 2A1RA 3TANA 4H0PA 1NGBA 1TAQA 4B9VA 3E9LA 1XHZA 1QSYA 1NMDA 4DQQA 3L4QA 3HM8A 4AHTA 3O4NA 2WTUA 3ZCMA 1C0FA 4JHDB 4H5TA 2ZGZA 1HNXK 3KD5E 4PKGA 3BF1A 4FWQA 4WFBL 4YOVA 4KTZA 1C0MA 4FJKA 3OYGA 3NE6A 4DTXA 4GV9A 1N32K 3C6HA 2X74A 3TTFA 1V4TA 2G8WA 1IBMK 4KHQA 1VHXA 2E88A 5KRTA 2OCEA 1J53A 2HB5A 3D7EO 4CFBA 1D9FA 1QSLA 3SZ2A 1M90O 4AHSA 2DY4A 5T7BA 5J2QA 4MO5A 2NRVA 4C8OA 3UKRA 1N33K 4YOUA 2YHBA 4BVOA 3AV9A 2OTLN 3Q7BA 1KAYA 5FPDA 3B8AX 4BR4A 4BRDA 3AGKA 2OPQA 1E3MA 3O6WA 3VF4A 1TL3A 4CFDA 1NU0A 4JN4A 3V9ZA 2P5GA 3H3OB 4LSNA 4GKKK 4H5WA 2FSJA 3S3NA 4FJ8A 3CXCM 3FZHA 4ISFA 5KGWA 3N4QA 3O9UA 3NH2A 2P9SA 1UA1A 1BDGA 5AQIA 3LL3A 4FXDA 3HJFA 4CJ4A 4EZ9A 4L8RB 1WN7A 1RDUA 2KZZA 2FBVA 1IJJA 4AF1A 4H0XB 3SCXA 3LDOA 1SV5A 1RBUA 2V51B 3CJ7A 1YTUA 3P4IA 3P83D 3VPZA 2PBDA 4DSLA 3UKRB 2D4WA 4DV1K 3F5TA 2DFFA 3LM2A 2VCPA 4CJSA 4AM7A 4JK8A 4Q5VA 3VF6A 3SAHA 3OYLA 1VSLA 1VSFA 1U48A 2BH1A 1W0HA 1C0UA 1U4BA 2CGKA 2B4JA 5AQPA 2P9SB 2ITMA 4FLTA 3MDQA 1VQ4N 4QCLA 1J54A 2HBLA 1QHTA 1BQNA 2FLOA 4YY3K 4IZ9A 2HHTA 1KLMA 3HI0A 1NJXA 2P9KA 4IFYA 1C6VA 3VGLA 1YAGA 3EY1A 4EZ6A 5J1EA 4HWIA 1NGHA 4OKJA 3ISNC 3MN6A 1QVGM 4B3TK 1QE1A 3VQ4A 1O1WA 2A1SA 2PFUA 5AQLA 1HPMA 5CR4A 4BRAA 2QKBA 1S6PA 4QAGA 3QIPA 4DV7K 3QLHA 1NLVA 1HNZK 2WFBA 1BWFO 3PV8A 4HCCA 1T6CA 4DV2K 1C1CA 1S1VA 1GLLO 1Q9YA 5GIOA 3WNGA 2E6LA 5CYMA 3O4QA 3ENHA 1RT3A 1TL1A 4M42A 5M1KA 1Z05A 1HNVA 3U6FA 5AJ3K 4O5BA 3LALA 3TR8A 3LDNA 3C6TA 4LFCK 4ILJA 1TK8A 1VQ8N 3CYMA 4F3OA 2E1YA 4CBWA 4JKBA 2ZJQL 1YVNA 4BDZA 3CERA 4LSLA 3I0SA 2G8IA 3L4IA 1GOBA 1P8ZA 5SZTA 4FW2A 1LW2A 2HBMA 1MU2A 1J5OA 1HMVA 1RTDA 3ZSRA 4H5NA 3QBXA 3W0LA 5AFUA 3OYEA 3K5NA 2HBJA 4YOXA 1EP4A 3SAGA 1HR0K 3LDLA 2I7PA 3VESA 4BACA 4IFEA 3TAQA 3HM9A 1X9JA 5HP1A 3THVA 1KQSM 1B9DA 4KHYA 2ATQA 2HVHA 4MLEA 1TKZA 4CJFA 2HMPA 3NH1A 4YDUA 2I7NA 3AVCA 3G10A 2BANA 4IDKA 2WUSA 3HO1A 4E3SA 3K5LA 2UXDK 1XMOK 3SQ1A 3A5OC 1XC9A 3KLHA 4Z4GA 4Z4FA 3VETA 1YIJN 3VEXA 1Y97A 3G71N 3SQ0A 4E0DA 1JLCA 4IOXA 4BC5A 4I6MA 4OKEA 4FWNA 2NRTA 3T69A 3OYMA 1UAXA 1VQMN 4K8XA 4FO0A 4DR3K 2YNFA 4RTFD 4E7JA 4AILC 2YHYA 3AVAA 2FF6A 4RCHA 1C1BA 2QW9A 4JYAK 3FLCO 2QKKA 1C0GA 3AAQA 4KI6A 1JLBA 1KAXA 2JLEA 3EZWA 5DMRA 3IAYA 3OYJA 3A5MC 3NCIA 4DFKA 4DQRA 2X6SA 4DFMA 3SBTA 3LDQA 4KHWA 4B9SA 2YJFA 1NWKA 1OH6A 3HSCA 3GE1A 4BRLA 2OZSA 1X3NA 3C6UA 1NK6A 4NLBA 4ELUA 4CEOA 3QIOA 4K8ZA 4NYNA 1U2VA 4JI7K 4OPHA 3ZT0A 1HKBA 3CM5A 4KHPK 4FLUA 3VQCA 3J7AP 3IDHA 3HXMA 1BHLA 3LP3A 4BRMA 3V1RA 4CGDA 3HVTA 3K57A 3MK6A 3KIOA 2HNYA 4H03B 1O13A 4CD1A 4FWLA 2DFEA 3AARA 1C1AA 3A2FA 4JLHA 5AZJA 2FBYA 2HHSA 2HVIA 1T7PA 3DLEA 3O5BA 3VQ8A 1A5VA 3J7ZO 5B8HA 1RBSA 5AQZA 3BGRA 1CLQA 4MO4A 4AHRA 4OPJA 1DT9A 5KQ8A 1NGAA 1S6QA 1TAUA 3E01A 3SQ4A 2NRHA 1U45A 1DLOA 1KFDA 1E4FT 2ZE2A 3ZETB 1K8AO 4R79A 3ZSYA 4FWPA 4W5NA 1RT6A 3N4PA 5C42A 2QM1A 1U2VB 1IBKK 1YHQN 3LP1A 4KHUA 3T19A 2J4RA 3CQXA 4CZIA 1TKXA 3CJCA 4B1XB 3FFIA 2F9WA 4FCYA 1NKCA 1W7AA 3QERA 3AVGA 5A2QO 1RBTA 1BISA 2UUBK 4JKGA 3ZSXA 3OY9A 1RT5A 3I8DA 1QSSA 3CC7N 5AZJB 4FK4A 5M1OA 3QNNA 5BREA 3CCQN 4DTJA 2CGLA 4EP5A 2V7YA 3F9KA 2E1ZA 2WONA 3LAKA 4FVUA 3EN9A 3QMLA 2B6AA 3TTDA 1ATRA 3LWMA 4IG3A 5CZ2A 4XEIA 2D5RA 1VQPN 4NXMK 4BRCA 1VQKN 3U3GA 4J2BA 3MCPA 3WQTA 2G8UA 4QS9A 1QQOA 4RW9A 2D0OA 4O0IA 4ISGA 3ULEA 5JICA 2OPPA 4CJUA 1RTHA 4TSXA 5HRSA 4JI4K 4JAXA 3D45A 3QINA 4JRPA 4MFBA 1VQ6N 2HHWA 3C7NA 1BL3A 4PKIA 3ASMA 3LZIA 1YI2N 4CGJA 2VYPA 2HOEA 4HCBA 4BRQA 5J2PA 2E5LK 1S9EA 5C12A 1ILYA 3M8QA 1CXUA 1KXPA 4DFJA 3QFUA 4JKGB 4MDAA 3DJCA 1VSMA 2QXLA 1RT2A 4OKKA 2O8FA 4CEAA 5TKWA 4ILHA 1L3TA 2NZTA 1KRPA 4O44A 5AQRA 3JSMA 3D0PA 4IO9L 4G1QA 1S1UA 4IJAA 2FSKA 3RR7A 2BDPA 4IDHA 2UUAK 4Q0BA 3ULEB 1U6ZA 1Z25A 1VQLN 3KTQA 3AVMA 5BPLA 3ZSWA 3U8XA 4CJVA 2VQFK 3DRSA 2GWJA 3J81O 4FW1A 3CFPA 3VGMA 3WNEA 1KVCA 1M1KO 4LF6K 3C7NB 4HUGA 5AQHA 4DTPA 4BQLA 2P9LA 1RDWX 2EX3A 3OYBA 2FXUA 2A42A 3S9HA 4FJXA 3EE8A 4CGHA 1D8YA 2HW3A 3L6QA 5I42A 2X78A 1TYQA 4C1NI 4J2EA 2UYTA 1GOCA 4A61A 2O8FB 4BVPA 3CJ1A 1VSKA 4JKAA 4YDUC 4WF9L 4RW6A 4CCHA 4CIFA 4U7BA 3AVJA 1KTQA 4K43A 5CE3A 4IG0A 4M3RA 3BZCA 2KW4A 3CCJN 3OA9A 4H0VB 3IMXA 2G8HA 4DV0K 3H3NO 1ESVA 3WXIA 1K73O 1I94K 2KZMA 1ITGA 3E9PA 4CJQA 4M3WA 4JI8K 3R9PA 1IH7A 5IWAK 4LF7K 3R6MA 5AQTA 3SMPA 1OVQA 5KTQA 3TU5A 2P9LB 4ILGB 4CZFA 2NRRA 1VSIA 1BA1A 1TYQB 1BI4A 3CQYA 4Z94A 3KZBA 4BDYA 2R7YA 1Q8IA 1FKOA 4L3QA 4JRQA 4OGEA 4BRHA 3KLFA 1OVYA 4FWKA 3A0IX 4OVLA 3DLGA 1G99A 3M8PA 3WXJA 4DV6K 4E7HA 1RNHA 2FSNA 3VQDA 4A5AA 4CF1A 4DU3A 1HX1A 2O8EA 4YORA 3DLLL 1VSDA 4BREA 1SQKA 3AVNA 4FLWA 4KH4A 3QEXA 4X64K 3Q7CA 5DM6L 4M63C 3CD6N 3RMCA 3QDKA 4JKCA 3M5RA 4Z4HA 4K25A 4CF9A 3P39A 4FLZA 3ATVA 1T05A 3CIPA 3AVLA 1BI4B 3K5MA 2OA8A 2E4LA 1NG9A 1VQON 2EHGA 4X62K 3OHRA 3VENA 4FYDA 1OH5A 1YXQA 3ZLJA 3RMDA 2YHWA 1ATSA 3O3GA 4CF8A 2W6KA 4XH5A 4C8LA 3OYCA 4M41A 3PLAA 3HSTB 5AQWA 2O8EB 2VWBA 4DV4K 3NF7A 3CJAA 2OPRA 4H0YB 3EZ5A 1WBDA 4W5RA 1NK9A 3KK7A 4B1VA 1R0AA 3O08A 4CGGA 1DGKN 1NOYA 3B6OA 3AO2A 4WQ5A 1Z26A 4DQ8A 5AQFA 1YTAA 3KJVA 4FJLA 1CXQA 3CFRA 2QWRA 3RSEA 4F8RA 2HHQA 3QNOA 1NGDA 2IVNA 2F9TA 3KHYA 3RMBA 4BY9C 1N6QA 3QICA 3GG4A 3AVBA 3SUPA 3KKSA 1HJOA 3SMSA 2HF3A 4LF9K 1U04A 1YVUA 1LWEA 1QQNA 3O9TA 4BRKA 5F0XA 2KLAA 1K6YA 4CJ7A 4U67L 4CHNA 4E19A 2E2PA 2ZJPL 1ZBHA 3DRPA 1TKTA 4B9NA 3O4WA 4K0KK 4DR6K 5LY3A 4I9QA 1VSJA 2CH6A 3IRXA 4H4OA 2UXBK 3RSEB 3O1BA 4RW7A 5FRNA 3ZX2A 2VQEK 5BPNA 3IKMA 1YUWA 5EOYA 1BGXT 4IFVA 2W41A 4CJPA 1HYZA 4Z4CA 3LP2A 4DTNA 4B9TA 5H1SQ 1KSPA 3G4SN 1NKEA 3THXA 2RF2A 1BUPA 3PX6A 4BE1A 4I2QA 1SAZA 4BRPA 2RKIA 3LPTA 1GLAG 2HSTA 2YHAA 3D2FA 3VQ9A 3RMAA 3KD1E 5FPEA 3CFOA 4CJ5A 2JGUA 2NRWA 3SJHA 3WXMB 2P5OA 1ASWA 4WFNL 4GV3A 4UQGA 4YOYA 3FFKB 2W42A 4DSIA 3O9QA 4CK1A 1F21A 3QBWA 4LF8K 1WSFA 4B1WB 1ZBUA 4FJIA 1IKVA 1WSGA 4DR5K 4JKEA 3DLBA 3NGIA 4IOCL 3VQ6A 2HF4A 3VEYA 2KFNA 3QETA 4B3OA 3A5NC 5BRFA 2JWKA 2D0PA 3AAPA 1MWMA 1XNQK 2FF3B 2NUBA 4DTOA 1SKSA 2O8CA 3THXB 2ITGA 5JS1A 4LY7A 1NGGA 3O9SA 4LF5K 4M3YA 2Z1HA 3VQPA 1RDCA 1IKWA 3KLIA 1GLBG 5LMNK 3QFPA 2E6MA 4DR4K 3D2FB 4KKOA 3CPWM 4BR5A 2W6LA 1SKWA 1HPZA 5ADXA 1WSEA 2F8SA 2P9KB 3CMAN 3HP9A 5C25A 1NK4A 2HBKA 4CIGA 4JS5A 1BQMA 1KC8O 2ZD1A 3THYA 3SJJA 3BEXA 4CHYA 1EX4A 5F2RA 3L2RA 3M8RA 3MXJA 4B8AB 4FZYA 1DKGD 1BIZA 2IOCA 1NK7A 4EHUA 5KPRA 3NVMA 4ZTFA 4EIAA 1XQSC 3S41A 4C23A 1TUUA 5IT9O 2O8CB 2HMIA 4F2SA 4H5VA 3NMUA 4KV8A 5MLCQ 2YJEA 3CC2N 1DTQA 1EWRA 4OJRA 3BDPA 2YNIA 1RDDA 4W5TA 2XY6A 1XWLA 3ZT4A 5C24A 4GV6A 1T44A 4CEFA 2D0CA 3E66A 1FKPA 4BE2A 2QWOA 3THYB 4DTUA 1NK0A 5FPMA 4CBUA 4FJHA 5EVZA 5JS2A 4M45A 4IBNA 4FL9A 1NK8A 1VRTA 5LL6Z 3RWUA 4MDBA 2ETJA 3CC4N 2QWMA 3I0RA 3BY5A 4DLGA 4HHTA 3S3MA 4AHVA 3OYAA 4OPAA 1DTTA 3K2PA 1HNWK 4FJNA 4O0JA 3FZLA 3QEVA 4W5QA 3PSFA 3NBPA 4FPAA 2O8DA 1EKEA 1S72N 2NRXA 3ITHA 4GVMA 1Z6RA 2OYQA 1TUYA 5EU7A 3HVRA 4KRFA 4ID5A 2PYLA 2YKMA 4A2BA 3OS0A 3AO5A 1SL0A 4DTSA 2HHXA 4Z4IA 4O8UA 3J7YP 4CD3A 4CESA 3MX2A 3VN5A 4ELTA 4N56A 3SV4A 5AQOA 3O3FA 1WAFA 2KQ2A 3OBYA 2ZWHA 1W9HA 1B92A 4BWJA 1H1VA 1HLUA 1TGOA 2PYJA 4WYBA 4FWRA 5CZ1A 2BTFA 3H46O 3HPHA 4WQ5C 3PO5A 3WEEA 2O8BA 3CF5L 4DG1A 4DKWA 3ZYYX 3EEQA 1NJWA 1ZBSA 4IJNA 4H8KA 4JKDA 4PL7A 3L8BA 2QA4N 4DV5K 3T7ZA 3DLHA 3NF8A 3H6EA 3HL8A 4I6MB 4WCEL 2YCHA 3OYFA 3VEVA 3MEDA 4KHNA 4BG9A 3VEOA 4YHHK 3HYFA 4BR7A 3KK2A 1J5EK 3F9MA 5JLFA 1JLFA 4CVNE 4BGBA 4M3XA 5JVHL 5LJVA 1RTJA 4E1NA 3AVHA 4DV3K 3MN9A 3CG7A 3T1YK 2Q31A 4DU1A 3VTHA 5GAHP 3L2VA 1NGFA 1KCFA 1RBVA 4B8CA 3ZX3A 2G8KA 1MWKA 5I9EB 4IKFA 3SUQA 3V9XA 3VQEA 1WNSA 4NB4A 4JI6K 4KTQA 2P9NA 3AVFA 1KLNA 2KKZA 1JXEA 2O8BB 1XI1A 3U9DA 4F9OA 1HKCA 1ZXOA 3DMJA 4MQ3A 4FZXC 2FBXA 3K0SA 4BROA 1RTIA 1VSHA 4GKJK 5EX5A 3UB5A 1RFQA 4HUFA 2W40A 4FK2A 2Y1IA 2A41A 1GLDG 4ZHRA 5FDLA 3TSUA 2E2OA 5E26A 3MXIA 3CI5A 1JLQA 1JL2A 1GOAA 2QXFA 2OANA 4KFBA 3UKUA 3ZEUA 5JVGL 2NNWA 1JCEA 3P38A 1SUQA 5HRRA 3JYTA 4FOEA 2QI2A 3V9UA 2RHKA 3AA4A 3BZKA 1WOQA 3K58A 2P9NB 4E7KA 1JCFA 2YV0X 1YJNN 2P9IA
chains in the Genus database with same CATH topology
5ADXH 3EKUA 3VPZA 2P9PA 2PBDA 3U4LA 4B1UB 1T3VA 3UKRB 2D4WA 4L3QA 4PHTX 4NLCA 3F5TA 4BRHA 1RGIA 1OVYA 3LM2A 1N8RO 2VCPA 3E1YA 2IIRA 4FWKA 3G25A 1BO5O 5AQJA 4AM7A 3A0IX 4K41A 4JK8A 5GAGP 3VOVA 1G99A 1GLJO 3MN5A 3VF6A 3WXJA 2FSNA 3CETA 3VERA 3SAHA 5AQUA 4A5AA 1SS6A 1HX1A 4BC3A 5BR9A 5M1NA 3BF3A 3TPQA 4YORA 3NVKA 3DLLL 2BH1A 5C15A 4BREA 5CHIA 1SQKA 2CGKA 4KH4A 5AFUH 3Q7CA 5DM6L 3MN7A 5AQPA 2ZJRL 4RWTA 2P9SB 2ITMA 3MDQA 4M63C 1IG8A 3CD6N 3CCSN 1VQ4N 4BQZA 2GEMA 3UKUB 3QDKA 3ZEUB 4IOAL 2Q0RA 4JKCA 3M5RA 2HBLA 4KH6A 4K25A 2FLOA 3P39A 4IZ9A 3ATVA 4IWVA 3CIPA 3HI0A 1W97L 2P9KA 5JLHA 3KWIA 3EO3A 1S22A 3OBWA 5EY4A 2GX9A 2P9IB 1YAGA 3J8AA 3VGLA 3CHWA 5EXWA 1HUXA 4BRNA 5TKYA 1MDUB 2P9PB 4A62A 3LDPA 4HWIA 1NGHA 1VQON 5AQGA 3WT0A 3OHRA 3VENA 1YXQA 3HZ6A 5AQMA 1XC3A 3MN6A 1QVGM 3CCRN 2YHWA 1ATSA 5AZIA 2PFUA 5AQLA 1HPMA 5CR4A 4BRAA 4H5RA 4XH5A 3BUZB 2AA4A 4OO1J 3ENOA 1NLVA 2WFBA 3PLAA 1BWFO 4JKFA 1T6CA 4JD2A 3M3ZA 5AQWA 1NBWA 2VWBA 1GLLO 5M1PA 3CJAA 2BUPA 5GIOA 1YJWN 2GUPA 4H0YB 3ENBA 2P9UA 3HTVA 3ENHA 2CGJA 3KK7A 3ZETA 4B1VA 3O08A 5M1KA 1Z05A 1QVFM 1NGJA 3EL2A 1DGKN 3VF2A 5AQYA 2ZF5O 4WQ5A 4DHYA 3PIPL 3GL1A 5M1QA 3A8YA 3WEEB 4DQ8A 3LDNA 3C0BA 1YJ9N 4ILJA 5AQFA 1VQ5N 1OKJA 3MX5A 2GWKA 1VQ8N 2E1YA 2PAVA 4B9QA 4CBWA 2Q2RA 4JKBA 2ZJQL 1YVNA 5ELZA 3CERA 2H3GX 2QWRA 2A40A 3RSEA 3ZX0A 3L4IA 1P8ZA 2CH5A 4IXCA 2KHOA 4M7YA 2HBMA 4BC2A 1QQMA 1Q82O 2QWQA 3KVGA 3FZKA 3H1VX 3VTIA 1VAZA 5AZIB 4CZHA 1NGDA 3O80A 3CCMN 3WUHA 2QTDA 2IVNA 2F9TA 2V7ZA 3KHYA 4BY9C 3FR0A 3EE9A 3QICA 3GG4A 2YHXA 3LM9A 4H5NA 3QBXA 4JD2B 3W0LA 5AFUA 3SLCA 1VQ9N 1NGIA 3R8EA 3WXLA 1QHAA 1QZ6A 4HTLA 1HJOA 3SMSA 2HBJA 2HF3A 3IFRA 4YOXA 3G6EN 2WBNA 4A57A 3DAWA 3SAGA 3D2EA 4YOWA 1QQNA 3LDLA 2I7PA 2P9UB 3VESA 3O9TA 3VEWA 2A3ZA 4IFEA 4BRKA 5F0XA 2KLAA 4CJ7A 4U67L 1X9JA 2E2PA 5C2FA 1KQSM 2ZJPL 4PL8A 1W2BM 3O4WA 2QWLA 3C65A 4PKHA 4MLEA 5LY3A 4BRIA 3DWLA 2HMPA 3FE1A 2CH6A 4YDUA 2I7NA 3F2KA 3RSEB 3QB0A 3O1BA 5HOOA 2WUSA 4DCHA 2Q97A 5AQNA 3ZX2A 5BPNA 4JK7A 5BN9A 3IKMA 1BG3A 1YUWA 5EOYA 3A5OC 3P31A 3FZFA 3ID8A 4BR2A 2W41A 3VETA 1EQYA 4H0TB 5GIPA 1YIJN 3GDQA 3I8BA 3VEXA 5H1SQ 3G71N 1J6ZA 1K9MO 3ATUA 5AR0A 1K8KA 4IOXA 4BC5A 3G4SN 4UY8O 4I6MA 1BUPA 4FWNA 2NRTA 1VQNN 1Y64A 3T69A 4A2AA 1VQMN 1SAZA 1NGEA 4BRPA 3D2EB 2GTDA 1Q18A 4FO0A 1VQ7N 1BU6O 1GLAG 1JCGA 2HSTA 3D2FA 3FGUA 4GNIA 4RTFD 2YHYA 3TSQA 5FPEA 2FF6A 2NRWA 4RCHA 3SJHA 3WXMB 1YITN 2QW9A 3FLCO 2E2NA 4WFNL 5GADP 4GV3A 1GLFO 5BRDA 1GLCG 4YOYA 3FFKB 3WXKA 3HOSA 3MMVA 1C0GA 3AAQA 5M1FA 1X3MA 1KAXA 1V4SA 3O9QA 3QBWA 5F1XA 2ASOA 3EZWA 4B1WB 3JS6A 2OTJN 5KQDA 3DXMA 4CZKA 4FWSA 1BOTO 3A5MC 4BG8A 5KPTA 3UE5A 4JKEA 2A5XA 2E8AA 3I55N 4IOCL 2VGMA 4KH5A 2HF4A 3VEYA 3K9KA 3GBTA 3A5NC 3SBTA 5BRFA 2WC9A 2JWKA 2D0PA 3LDQA 3AAPA 3HOTA 1MWMA 2YJFA 1BA0A 3AY9A 1E4GT 2FF3B 4QS7A 1K8KB 3O8MA 1NWKA 3C6AA 3HSCA 3GE1A 4M7XA 4O8KA 4BRLA 1NGGA 3O9SA 4JKHA 4J8FA 5E84A 1LCUA 1X3NA 1GLBG 4IO8A 3QFPA 1KD1O 1DEJA 3I56N 4NLBA 3D2FB 3CPWM 4BR5A 1U2VA 4OPHA 1HKBA 4FWOA 4Y0WA 5ADXA 2P9KB 3IDHA 3CMAN 2HBKA 3CCLN 4BRMA 5C10A 1KC8O 4ISEA 4WQ4C 3BEXA 3H45C 3MK6A 5F2RA 4C1NK 3OW2M 4WFAL 4H03B 1O13A 4CD1A 4FWLA 3DXMB 3GOIA 1DKGD 3AARA 3I33A 4H0OA 4EHUA 4AM6A 4EHTA 5KPRA 3NVMA 2IVOA 4A59A 2E2QA 3M1FA 5AZJA 2ASMA 3O5BA 5AQSA 3J7ZO 5B8HA 5AQZA 4EIAA 1XQSC 3S41A 1ZC6A 4MO4A 4C23A 2GELA 1TUUA 2ZGYA 1DT9A 5KQ8A 1NGAA 4H5VA 3NMUA 3VGKA 4IEIA 2NRHA 5MLCQ 2QWPA 2YJEA 1E4FT 3CJ9A 3ZETB 1WUAA 1K8AO 3CC2N 4R79A 1D4XA 3O1WA 4FWPA 3KWGA 2NRZA 4FPBA 4NO7A 5C0YA 4G9ZA 3HRGA 3N4PA 4CZGA 2QM1A 3WQUA 1U2VB 1YHQN 2D1KA 4JK9A 2DPNA 4FSVA 4B1YB 4GY2B 4GV6A 4BR0A 1T44A 2J4RA 1HKGA 3CQXA 4KBOA 3RVCA 4CZIA 3E66A 3W3DA 3VEZA 3CCEN 3CJCA 1EO1A 1LOTB 2QWOA 4B1XB 2F9WA 5KPZA 2E20A 4FWMA 5FPMA 4CBUA 5EVZA 5AQKA 4BR9A 2YX6A 3TSPA 1P90A 4K42A 4FL9A 4B1ZA 4EFHA 3CCVN 3L0QA 3IUCA 2Q1NA 4MDBA 3CC4N 2QWMA 1S3XA 4LC9B 4XH1A 4JKGA 4CZLA 4CBXA 3CC7N 4E1JA 5AZJB 5M1OA 5BREA 4OPAA 3CCQN 2CGLA 4QS8A 1R59O 1KAZA 2V7YA 1Q86O 2A6AA 3FZLA 2E1ZA 3A5LC 3H1QA 3JXUA 2VGNA 4FPAA 3PIOL 1S72N 4FVUA 3EN9A 2NRXA 2EWSA 3QMLA 3TTDA 1ATRA 3SK3A 4GVEA 2QWNA 1Z6RA 2Q36A 3TTCA 3BP8A 4XEIA 1TUYA 1VQPN 1VQKN 4BRCA 5BN8A 4A2BA 1Q7YO 3MCPA 3WQTA 4QS9A 3VMFB 4EAHD 1QQOA 4JHDA 2D0OA 3MWTA 4ISGA 3ULEA 4O8UA 5JICA 4CD3A 4IEEA 5GAEP 3MX2A 4JAXA 3R3LA 1VQ6N 3C7NA 4PKIA 3FZMA 4JNEA 1YI2N 5AQOA 2VYPA 2HOEA 3ID6A 3OBYA 2QEXN 2ZWHA 1CZAN 4A5BA 1MA9B 4BRQA 1H1VA 1HLUA 5C12A 1ILYA 4WYBA 4CZJA 4FWRA 4YOTA 5DM7L 2BTFA 3H46O 5C2DA 5AQQA 2RE2A 2Q0UA 5BRHA 1KXPA 3K9JA 3CMEN 3QFUA 5JMVA 4WQ5C 3SBGA 3WEEA 3MWPA 4JKGB 4MDAA 3CF5L 1NJIO 3D6RA 3DJCA 4CZEA 1XUPO 2QXLA 2F7TA 4O5FA 3ZYYX 4DKWA 1ZBSA 3O9RA 4IJNA 4JKDA 4DB3A 4PL7A 2QA4N 5TKWA 4ILHA 4BC4A 2NZTA 3T7ZA 4CI6A 4I6MB 3H6EA 4H0PA 5AQRA 1NGBA 4WCEL 4IO9L 2ASPA 2YCHA 3CPEA 3MCAB 3E9LA 4IJAA 3VEVA 1NMDA 4BG9A 3VEOA 3L4QA 3HM8A 4BR7A 3U9ZA 2FSKA 3F9MA 5JLFA 3CXCM 4IDHA 1GLEG 3EKSA 1C0FA 3M6GA 4JHDB 4BGBA 5JVHL 2V52B 4H5TA 1U6ZA 2ZGZA 3ULEB 5LJVA 4MLHA 5BPLA 1JJ2M 1VQLN 3U8XA 3MN9A 1YF5L 4PKGA 3BF1A 2GWJA 4FWQA 4WFBL 2Q31A 4XH4A 4YOVA 3VGMA 3DXKA 1M1KO 3C7NB 3VTHA 5GAHP 4GV9A 3C6HA 1NGFA 3TTFA 5AQHA 3SAFA 4BQLA 4CZMA 2P9LA 1V4TA 3ZX3A 1RDWX 3R1XA 1NM1A 2E88A 1MWKA 2FXUA 2A42A 5I9EB 5HL7L 4BGAA 3EE8A 4NB4A 3D7EO 3L6QA 2IVPA 5LJWA 1QZ5A 3CCUN 2P9NA 4C1NI 1TYQA 2KKZA 1M90O 2UYTA 3U9DA 5AQVA 4A61A 4F9OA 4MO5A 1HKCA 2NRVA 4BVPA 3CJ1A 3UKRA 4YOUA 5AQXA 4JKAA 4BVOA 1ZXOA 4YDUC 4WF9L 2OTLN 3AGRA 3Q7BA 1KAYA 5FPDA 3B8AX 4BROA 4FOIA 4BR4A 4BRDA 3AGKA 4U7BA 1NGCA 4K43A 5CE3A 3O6WA 3VF4A 5GINA 3CCJN 2YI1A 5EX5A 3OA9A 4H0VB 3E9OA 3IMXA 5FPNA 1ATNA 3H3NO 4JN4A 3UB5A 1ESVA 3H3OB 3WXIA 1SZ2A 1K73O 1RFQA 4BRGA 2W40A 2A41A 3E9PA 4H5WA 2FSJA 1GLDG 3CJBA 4WQ4A 5BPMA 3R9PA 3FZHA 3DXKB 2E2OA 4ISFA 2AP1A 5E26A 3TSUA 3N4QA 3CI5A 3O9UA 3R6MA 5AQTA 2P9SA 3SMPA 3TU5A 1BDGA 4JEPA 5AQIA 2P9LB 2OANA 3LL3A 3UKUA 3ZEUA 1T6DA 2NNWA 5JVGL 1JCEA 2NLXA 4BRFA 3P38A 4ILGB 4CZFA 1RDUA 4FOEA 2QI2A 2JWLA 2RHKA 1IJJA 4AF1A 4H0XB 1WOQA 2NRRA 3HBTA 2P9NB 1BA1A 1JCFA 1TYQB 2V51B 3CJ7A 3CQYA 3LDOA 4Z94A 3KZBA 2P9IA 1YJNN 1Q81O 3P4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ADX H;  3EKU A;  3VPZ A;  2P9P A;  2PBD A;  3U4L A;  4B1U B;  3UKR B;  2D4W A;  4L3Q A;  4BRH A;  1RGI A;  3LM2 A;  2VCP A;  2IIR A;  4FWK A;  3G25 A;  1BO5 O;  5AQJ A;  4AM7 A;  3A0I X;  4K41 A;  3VOV A;  1G99 A;  1GLJ O;  3MN5 A;  3VF6 A;  3WXJ A;  2FSN A;  3CET A;  3VER A;  5AQU A;  5BR9 A;  1HX1 A;  4BC3 A;  3BF3 A;  3TPQ A;  4BRE A;  1SQK A;  2CGK A;  5AFU H;  3MN7 A;  5AQP A;  4RWT A;  2P9S B;  2ITM A;  3MDQ A;  4M63 C;  1IG8 A;  4BQZ A;  2GEM A;  3UKU B;  3QDK A;  3ZEU B;  2Q0R A;  4K25 A;  2FLO A;  4IZ9 A;  3ATV A;  4IWV A;  3CIP A;  3HI0 A;  5JLH A;  2P9K A;  3EO3 A;  1S22 A;  5EY4 A;  3VGL A;  2P9I B;  1YAG A;  3J8A A;  3CHW A;  5EXW A;  1HUX A;  4BRN A;  5TKY A;  1MDU B;  2P9P B;  4A62 A;  3LDP A;  4HWI A;  1NGH A;  5AQG A;  3WT0 A;  3OHR A;  3VEN A;  1YXQ A;  3HZ6 A;  5AQM A;  1XC3 A;  3MN6 A;  2YHW A;  1ATS A;  5AZI A;  5AQL A;  1HPM A;  4BRA A;  4H5R A;  4XH5 A;  3BUZ B;  2AA4 A;  3ENO A;  1NLV A;  1BWF O;  1T6C A;  4JD2 A;  3M3Z A;  5AQW A;  1NBW A;  2VWB A;  1GLL O;  3CJA A;  2BUP A;  2GUP A;  4H0Y B;  2P9U A;  3HTV A;  3ENH A;  2CGJ A;  3ZET A;  4B1V A;  3O08 A;  1Z05 A;  1NGJ A;  3EL2 A;  1DGK N;  3VF2 A;  5AQY A;  2ZF5 O;  4WQ5 A;  4DHY A;  3GL1 A;  3A8Y A;  3WEE B;  4DQ8 A;  3LDN A;  3C0B A;  5AQF A;  1OKJ A;  2GWK A;  2E1Y A;  2PAV A;  4B9Q A;  4CBW A;  2Q2R A;  1YVN A;  5ELZ A;  3CER A;  2H3G X;  2QWR A;  2A40 A;  3RSE A;  3ZX0 A;  3L4I A;  1P8Z A;  2CH5 A;  4IXC A;  2KHO A;  4M7Y A;  4BC2 A;  1QQM A;  2QWQ A;  3KVG A;  3FZK A;  3H1V X;  4CZH A;  5AZI B;  1NGD A;  3O80 A;  3WUH A;  2IVN A;  2F9T A;  2V7Z A;  3KHY A;  3FR0 A;  3QIC A;  3GG4 A;  2YHX A;  3LM9 A;  4H5N A;  3QBX A;  4JD2 B;  3W0L A;  5AFU A;  3SLC A;  1NGI A;  3R8E A;  3WXL A;  1QHA A;  1QZ6 A;  4HTL A;  1HJO A;  3SMS A;  3IFR A;  2HF3 A;  3DAW A;  3D2E A;  1QQN A;  3LDL A;  2I7P A;  2P9U B;  3VES A;  3VEW A;  2A3Z A;  4BRK A;  5F0X A;  4CJ7 A;  1X9J A;  2E2P A;  4PL8 A;  3O4W A;  2QWL A;  4PKH A;  4MLE A;  5LY3 A;  4BRI A;  3DWL A;  2HMP A;  3FE1 A;  2CH6 A;  4YDU A;  2I7N A;  3RSE B;  3QB0 A;  3O1B A;  2WUS A;  4DCH A;  2Q97 A;  5AQN A;  3ZX2 A;  5BPN A;  5BN9 A;  1BG3 A;  1YUW A;  5EOY A;  3A5O C;  3FZF A;  3ID8 A;  4BR2 A;  2W41 A;  3VET A;  1EQY A;  4H0T B;  3GDQ A;  3I8B A;  3VEX A;  1J6Z A;  3ATU A;  5AR0 A;  1K8K A;  4BC5 A;  4I6M A;  1BUP A;  4FWN A;  1Y64 A;  4A2A A;  1SAZ A;  1NGE A;  4BRP A;  3D2E B;  2GTD A;  1Q18 A;  4FO0 A;  1BU6 O;  1GLA G;  1JCG A;  3D2F A;  3FGU A;  4GNI A;  4RTF D;  2YHY A;  5FPE A;  2FF6 A;  3SJH A;  4RCH A;  2QW9 A;  3FLC O;  2E2N A;  1GLF O;  5BRD A;  1GLC G;  3FFK B;  3WXK A;  3MMV A;  1C0G A;  3AAQ A;  1X3M A;  1KAX A;  1V4S A;  3QBW A;  5F1X A;  2ASO A;  3EZW A;  4B1W B;  3JS6 A;  5KQD A;  3DXM A;  4CZK A;  4FWS A;  1BOT O;  3A5M C;  4BG8 A;  5KPT A;  3UE5 A;  2A5X A;  2E8A A;  2HF4 A;  3VEY A;  3GBT A;  3A5N C;  5BRF A;  3LDQ A;  2D0P A;  3AAP A;  1MWM A;  2YJF A;  1BA0 A;  3AY9 A;  1E4G T;  2FF3 B;  4QS7 A;  1K8K B;  3O8M A;  1NWK A;  3HSC A;  3GE1 A;  4M7X A;  4O8K A;  4BRL A;  1NGG A;  4J8F A;  5E84 A;  1LCU A;  1X3N A;  1GLB G;  4IO8 A;  3QFP A;  1DEJ A;  3D2F B;  4BR5 A;  1U2V A;  1HKB A;  4FWO A;  4Y0W A;  5ADX A;  2P9K B;  3IDH A;  4BRM A;  4ISE A;  4WQ4 C;  3BEX A;  3H45 C;  3MK6 A;  5F2R A;  4H03 B;  4CD1 A;  4FWL A;  3DXM B;  3GOI A;  1DKG D;  3AAR A;  3I33 A;  4H0O A;  4EHU A;  4AM6 A;  4EHT A;  5KPR A;  2IVO A;  2E2Q A;  3M1F A;  5AZJ A;  2ASM A;  3O5B A;  5AQS A;  5B8H A;  5AQZ A;  4EIA A;  1XQS C;  3S41 A;  1ZC6 A;  4MO4 A;  4C23 A;  2GEL A;  1TUU A;  2ZGY A;  5KQ8 A;  1NGA A;  4H5V A;  3VGK A;  2NRH A;  2QWP A;  2YJE A;  1E4F T;  3CJ9 A;  3ZET B;  1WUA A;  1D4X A;  3O1W A;  4FWP A;  4FPB A;  4NO7 A;  4CZG A;  2QM1 A;  3WQU A;  1U2V B;  2D1K A;  4B1Y B;  2DPN A;  4FSV A;  4GY2 B;  4BR0 A;  1T44 A;  2J4R A;  1HKG A;  3CQX A;  4KBO A;  4CZI A;  3W3D A;  3VEZ A;  3CJC A;  1LOT B;  2QWO A;  4B1X B;  2F9W A;  5KPZ A;  2E20 A;  4FWM A;  5FPM A;  4CBU A;  5EVZ A;  5AQK A;  4BR9 A;  4K42 A;  4FL9 A;  4B1Z A;  4EFH A;  3L0Q A;  3IUC A;  2Q1N A;  2QWM A;  1S3X A;  4LC9 B;  4XH1 A;  4CZL A;  4CBX A;  4E1J A;  5AZJ B;  5BRE A;  2CGL A;  4QS8 A;  1R59 O;  1KAZ A;  2V7Y A;  2A6A A;  3FZL A;  2E1Z A;  3A5L C;  3H1Q A;  3JXU A;  4FPA A;  3EN9 A;  2EWS A;  3QML A;  1ATR A;  3SK3 A;  2QWN A;  1Z6R A;  2Q36 A;  3BP8 A;  4XEI A;  1TUY A;  4BRC A;  5BN8 A;  4A2B A;  3MCP A;  3WQT A;  4QS9 A;  4EAH D;  1QQO A;  4JHD A;  2D0O A;  4ISG A;  3ULE A;  5JIC A;  4CD3 A;  4JAX A;  3C7N A;  4PKI A;  3FZM A;  4JNE A;  5AQO A;  2VYP A;  2HOE A;  2ZWH A;  1CZA N;  1MA9 B;  4BRQ A;  1H1V A;  1HLU A;  4WYB A;  4CZJ A;  4FWR A;  2BTF A;  3H46 O;  5AQQ A;  2Q0U A;  5BRH A;  1KXP A;  3QFU A;  5JMV A;  4WQ5 C;  3WEE A;  3DJC A;  4CZE A;  1XUP O;  2QXL A;  4O5F A;  1ZBS A;  4IJN A;  4DB3 A;  4PL7 A;  4BC4 A;  2NZT A;  4CI6 A;  4I6M B;  3H6E A;  4H0P A;  5AQR A;  1NGB A;  2ASP A;  2YCH A;  4IJA A;  3VEV A;  1NMD A;  4BG9 A;  3VEO A;  3HM8 A;  4BR7 A;  3U9Z A;  2FSK A;  3F9M A;  5JLF A;  1GLE G;  3EKS A;  1C0F A;  3M6G A;  4JHD B;  4BGB A;  2V52 B;  4H5T A;  1U6Z A;  2ZGZ A;  3ULE B;  5LJV A;  4MLH A;  5BPL A;  3U8X A;  3MN9 A;  4PKG A;  3BF1 A;  2GWJ A;  4FWQ A;  2Q31 A;  4XH4 A;  3VGM A;  3DXK A;  3C7N B;  1NGF A;  5AQH A;  4BQL A;  4CZM A;  2P9L A;  1V4T A;  3ZX3 A;  1RDW X;  1NM1 A;  2E88 A;  1MWK A;  2FXU A;  2A42 A;  5I9E B;  4BGA A;  4NB4 A;  3D7E O;  3L6Q A;  2IVP A;  5LJW A;  1QZ5 A;  2P9N A;  1TYQ A;  2UYT A;  3U9D A;  5AQV A;  4A61 A;  4F9O A;  4MO5 A;  1HKC A;  4BVP A;  3CJ1 A;  3UKR A;  5AQX A;  4BVO A;  1ZXO A;  4YDU C;  1KAY A;  5FPD A;  3B8A X;  4BRO A;  4FOI A;  4BR4 A;  4BRD A;  1NGC A;  4K43 A;  5CE3 A;  3O6W A;  3VF4 A;  2YI1 A;  5EX5 A;  4H0V B;  5FPN A;  3IMX A;  1ATN A;  3H3N O;  4JN4 A;  3UB5 A;  1ESV A;  3H3O B;  3WXI A;  1SZ2 A;  1RFQ A;  4BRG A;  2W40 A;  2A41 A;  4H5W A;  2FSJ A;  1GLD G;  3CJB A;  4WQ4 A;  5BPM A;  3R9P A;  3FZH A;  3DXK B;  2E2O A;  4ISF A;  2AP1 A;  5E26 A;  3CI5 A;  3R6M A;  5AQT A;  3SMP A;  2P9S A;  3TU5 A;  1BDG A;  5AQI A;  2P9L B;  2OAN A;  3LL3 A;  3UKU A;  3ZEU A;  1T6D A;  1JCE A;  2NLX A;  4BRF A;  4CZF A;  4FOE A;  1IJJ A;  4H0X B;  1WOQ A;  3HBT A;  2P9N B;  1BA1 A;  1JCF A;  1TYQ B;  2V51 B;  3CJ7 A;  3CQY A;  3LDO A;  4Z94 A;  3KZB A;  2P9I A;  3P4I A; 
#chains in the Genus database with same CATH topology
 5ADX H;  3EKU A;  2P9P A;  4B1U B;  4CF2 A;  1T3V A;  2P51 A;  1S5J A;  3MXM A;  2Z1G A;  1N8R O;  4E7L A;  2IIR A;  1BO5 O;  3OTO K;  4KO0 A;  4K41 A;  5GAG P;  3VOV A;  4C8K A;  1ZYQ A;  1GLJ O;  3KK3 A;  3MN5 A;  2XHB A;  4OGC A;  3CET A;  1S1X A;  1LWF A;  1CZB A;  4AQY K;  4LH5 A;  4LF4 K;  5M1N A;  1VK0 A;  3LP0 A;  4CED A;  4FLY A;  5CHI A;  3HPG A;  2UU9 K;  5AFU H;  2O4G A;  3AA2 A;  3MN7 A;  2ZJR L;  4RWT A;  2IS3 A;  2RPI A;  1X9W A;  2FC0 A;  2GEM A;  3UKU B;  3ZEU B;  4IOA L;  4KH6 A;  4DTR A;  2OZM A;  4IWV A;  4KI4 A;  5JLH A;  1JLG A;  4CHO A;  2FBT A;  3EO3 A;  4O4G A;  5EY4 A;  2P9I B;  3CHW A;  4BRN A;  4C8N A;  5TKY A;  1MDU B;  2P9P B;  4B9M A;  5KGX A;  4CJR A;  1X9S A;  4FM2 A;  1VSE A;  5AQM A;  4HUE A;  1JXB A;  3LZJ A;  4H5R A;  3BUZ B;  2AA4 A;  3NGY A;  4OO1 J;  3OYH A;  1BCM A;  3VQ5 A;  2XRI A;  1RT1 A;  2XO7 A;  5M1P A;  5HRN A;  1SL1 A;  3DLR A;  1L3S A;  2GUP A;  3ENB A;  4F2R A;  2P9U A;  1HJR A;  1IV0 A;  1QVF M;  3EL2 A;  3L3U A;  4B3R K;  3VF2 A;  5AQY A;  4DR2 K;  4DHY A;  3A8Y A;  3C0B A;  1YJ9 N;  4N76 A;  1VQ5 N;  5FRM A;  4E89 A;  3OYK A;  4B9Q A;  1LW0 A;  2H3G X;  3ZX0 A;  4OPK A;  2CH5 A;  4IXC A;  3S3O A;  4M7Y A;  4FZZ A;  4BC2 A;  1QQM A;  1ZBF A;  2QWQ A;  3V1O A;  3H1V X;  4CZH A;  1VAZ A;  2HND A;  2QTD A;  3WUH A;  3V9W A;  2V7Z A;  3FR0 A;  3EE9 A;  3R8E A;  2QK9 A;  4HTL A;  3IFR A;  3NHG A;  3G6E N;  3DAW A;  3VQA A;  4BE0 A;  4YOW A;  1NOZ A;  2P9U B;  1A5X A;  4DSF A;  1FJG K;  3DRR A;  4GMJ B;  3DM2 A;  3P1G A;  4CHQ A;  3K59 A;  5C2F A;  4BWM A;  4DQP A;  2B5J A;  4NCA A;  4BRI A;  3FE1 A;  1HYS A;  4N5S A;  1OH8 A;  4FJ5 A;  3PSI A;  4PA1 A;  2Q97 A;  3MEE A;  5AQN A;  4DWI A;  3IG1 A;  4N41 A;  4JK7 A;  3FZF A;  3PUF A;  1NJZ A;  2KTQ A;  3NGZ A;  5GIP A;  3GDQ A;  4FJJ A;  1J6Z A;  3ATU A;  5AR0 A;  1K8K A;  4UY8 O;  3VQ7 A;  1EWQ A;  1EET A;  2DTU A;  4ELV A;  1Y64 A;  4J2A A;  1VQN N;  3TAF A;  2F4V K;  4A2A A;  2ZQB A;  2GTD A;  1Q18 A;  1VQ7 N;  2AJQ A;  4LD0 A;  5SWM A;  4DQS A;  2IGI A;  2IDO A;  1YIT N;  1NKB A;  4E7I A;  5BRD A;  3L2W A;  1GLC G;  3HOS A;  3WXK A;  3MMV A;  2BE2 A;  2F96 A;  1X3M A;  5LMU K;  3OYN A;  4B3M K;  5F1X A;  3JS6 A;  2YNG A;  2OTJ N;  5KQD A;  3DXM A;  3SPY A;  5KPT A;  3MEG A;  2A5X A;  2E8A A;  3ZT2 A;  2F8T A;  3I55 N;  2VGM A;  4KH5 A;  3K9K A;  3GBT A;  2WC9 A;  3HOT A;  1RT4 A;  1BA0 A;  3F73 A;  1E4G T;  3TAE A;  1K8K B;  3O8M A;  4O8K A;  5J2M A;  1NMN A;  1KVA A;  4J8F A;  2XY8 A;  4IO8 A;  1KD1 O;  1DEJ A;  3EYZ A;  3SI6 A;  1WSH A;  4HTU A;  1IO2 A;  4FWO A;  3OJS A;  3ZSO A;  1UWB A;  5C10 A;  4ISE A;  3RTV A;  3NH0 A;  3TAM A;  1TV6 A;  3H45 C;  1RBR A;  4WFA L;  1JKH A;  4FM1 A;  4JI2 K;  3DXM B;  4Z0U A;  4JI1 K;  3OJU A;  4EHT A;  2WOM A;  2IVO A;  2E2Q A;  2HNZ A;  5AQS A;  2VG5 A;  4C8M A;  1IBL K;  3ZSV A;  3SUN A;  3OS2 A;  1KVB A;  3V9S A;  3NAE A;  4DSK A;  4CEQ A;  3RR8 A;  3VGK A;  5CYQ A;  4CEE A;  4B9L A;  2QWP A;  3CJ9 A;  1X1P A;  1WUA A;  5J2N A;  1YT3 A;  3O1W A;  3KWG A;  2VG6 A;  2NRZ A;  5I3U A;  4FPB A;  5C0Y A;  2Q3S A;  4G9Z A;  4B9U A;  4JK9 A;  4B1Y B;  4GY2 B;  4BR0 A;  2HHH K;  3RVC A;  4KBO A;  3CCE N;  4H4M A;  1FXX A;  2X6N A;  3VEZ A;  3SPZ A;  1Q9X A;  4FWM A;  4FLV A;  5AQK A;  4BR9 A;  1P90 A;  4K42 A;  4B1Z A;  4EFH A;  3L0Q A;  3SNN A;  2Q1N A;  3QEP A;  4CBX A;  4E1J A;  1QS4 A;  1ZBI A;  4QS8 A;  1R59 O;  4CJK A;  1Q86 O;  2A6A A;  3A5L C;  3H1Q A;  2Z1J A;  2VGN A;  3PIO L;  3G0Z A;  4BDP A;  1HYV A;  4Z4E A;  2UXC K;  2Q36 A;  3TTC A;  2D0B A;  3UIQ A;  5CY4 A;  5FRO A;  1Q7Y O;  3VMF B;  1SKR A;  1VRU A;  2GUI A;  3MWT A;  4OX9 K;  4IEE A;  1RIL A;  5GAE P;  4X66 K;  3PO4 A;  3R3L A;  4DMN A;  1B9F A;  4DR1 K;  1TVR A;  5E41 A;  4JNE A;  4NYF A;  2RN2 A;  2QEX N;  5HRP A;  4A5B A;  1MA9 B;  3MEC A;  4CZJ A;  2PY5 A;  1LAV A;  3TI0 A;  5AQQ A;  4PWD A;  4FJG A;  5BRH A;  1HQU A;  3AO1 A;  3K9J A;  4CGF A;  5JMV A;  4FM0 A;  3CME N;  2P1J A;  3SBG A;  3MWP A;  4I9L A;  4I7F A;  1C0T A;  4I2P A;  1NJI O;  1XUP O;  4O5F A;  3VA0 A;  4DB3 A;  3O9R A;  5FLX O;  4JV5 K;  4BC4 A;  4AHC A;  4CI6 A;  2ASP A;  4CW7 B;  3CPE A;  1XHX A;  3MCA B;  3SV3 A;  3THW A;  3T3F A;  3U9Z A;  4DUY K;  1GLE G;  3EKS A;  1REV A;  3M6G A;  2V52 B;  3QEI A;  1JJ2 M;  4MLH A;  2XY5 A;  1YF5 L;  1JLA A;  4XH4 A;  3V81 A;  4YNQ A;  3DXK A;  3PX4 A;  3AA5 X;  4ZTJ A;  5K14 A;  3SAF A;  1I39 A;  4CZM A;  1S1W A;  4CJT A;  3R1X A;  1D5A A;  1NM1 A;  2O4I A;  5HL7 L;  4BGA A;  5LJW A;  2IVP A;  4AHU A;  1QZ5 A;  3L3V A;  4CEC A;  3CCU N;  1G15 A;  1IKX A;  3AO3 A;  3DOK A;  3DLK A;  5AQV A;  3WNH A;  4ICL A;  1ZBL A;  5AQX A;  3VA3 A;  1QTM A;  1UOC A;  3AGR A;  4FOI A;  3THW B;  1NGC A;  5GIN A;  3HT3 A;  3RRG A;  2YI1 A;  4DR7 K;  3E9O A;  5FPN A;  3H08 A;  1ATN A;  1BIU A;  4CK3 A;  1SZ2 A;  4BRG A;  4CF0 A;  2GV9 A;  3ALY A;  3CJB A;  4WQ4 A;  5BPM A;  3DXK B;  2AP1 A;  4CHZ A;  1LV5 A;  2VWK A;  4KB0 A;  1L3V A;  4DU4 A;  4RW8 A;  4JEP A;  1T6D A;  1T03 A;  2NLX A;  4BRF A;  2G8F A;  2YKN A;  3T1H K;  4CIE A;  3OVN A;  1KFS A;  2JWL A;  2D0A A;  1WLJ A;  3HBT A;  1X9M A;  1RT7 A;  5D3G A;  2VWJ A;  4CJ3 A;  1Q81 O;  2HHU A;  4DTM A;  5BR8 K;  3OYI A;  3U4L A;  3HP6 A;  3U3Y A;  4PHT X;  4X65 K;  4NLC A;  4PUO A;  2DFH A;  4DSJ A;  1RGI A;  3SYZ A;  3E1Y A;  3VQQ A;  3G25 A;  4DUZ K;  1NJY A;  5AQJ A;  2ZM6 K;  4CJW A;  1ASU A;  3KKR A;  3VER A;  5AQU A;  1SS6 A;  5BR9 A;  4BC3 A;  3BF3 A;  3TPQ A;  3NVK A;  3B6P A;  4O55 A;  5C15 A;  4CFC A;  3C95 A;  4JI3 K;  4LH4 A;  3NFA A;  4KPY A;  1IG8 A;  3CCS N;  4BQZ A;  3P5J A;  2Q0R A;  3HK2 A;  4KAZ A;  4M3T A;  3V4I A;  1W97 L;  1S1T A;  3KWI A;  4DF4 A;  1S22 A;  3OBW A;  2GX9 A;  3J8A A;  3LAN A;  5EXW A;  1HUX A;  4KB1 A;  3ZT1 A;  4A62 A;  3LDP A;  3AO4 A;  2O8D B;  5AQG A;  3WT0 A;  1N34 K;  3HZ6 A;  3LAM A;  1XC3 A;  3CCR N;  3RRH A;  4DS4 A;  3AA3 A;  5AZI A;  3MAQ A;  1HQE A;  3ENO A;  4JKF A;  4JD2 A;  3HPO A;  1A5W A;  3M3Z A;  4FJ9 A;  1NBW A;  4FJM A;  2BUP A;  3DI6 A;  1OH7 A;  1YJW N;  4CEZ A;  3TAB A;  3HTV A;  4WE1 A;  2CGJ A;  3ZET A;  1N5Y A;  1NGJ A;  3OYD A;  2ZF5 O;  1SL2 A;  1JL1 A;  3PIP L;  3V6D A;  3GL1 A;  1U47 A;  3SQ2 A;  5M1Q A;  3WEE B;  1LWC A;  1FK9 A;  3M8S A;  1OKJ A;  3MX5 A;  2GWK A;  2VG7 A;  4Y1D A;  2PAV A;  2Q2R A;  1WSJ A;  3SUO A;  5ELZ A;  4OLB A;  2A40 A;  1BCO A;  5KRS A;  2KFZ A;  4M3Z A;  2KHO A;  3V1Q A;  1Q82 O;  4FJ7 A;  3KVG A;  3NF9 A;  3FZK A;  3VTI A;  5AZI B;  1RDA A;  3O80 A;  3CCM N;  3CM6 A;  3O3H A;  1EXQ A;  4RG8 A;  2YHX A;  3LM9 A;  3J80 O;  4JD2 B;  3SLC A;  1VQ9 N;  1NGI A;  3WXL A;  1QHA A;  1QZ6 A;  4OLA A;  1HNI A;  4NXN K;  2XY7 A;  2WBN A;  4A57 A;  4FVM A;  3D2E A;  4CER A;  3TAP A;  4RW4 A;  3VEW A;  2A3Z A;  1HRH A;  3DYA A;  1U49 A;  1RCH A;  4ID1 A;  3KK1 A;  4PL8 A;  1W2B M;  5HLF A;  1LAW A;  2I5J A;  3LDS A;  4J2D A;  2QWL A;  1ASV A;  3C65 A;  4PKH A;  3DWL A;  1TK0 A;  4AH9 A;  4E1M A;  4CHP A;  3F2K A;  3QB0 A;  5HOO A;  4DCH A;  4CE9 A;  4KHS A;  3VQB A;  5BN9 A;  1BG3 A;  3LPU A;  3P31 A;  4FK0 A;  2OPS A;  3ID8 A;  4BR2 A;  4DSE A;  3TAR A;  1EQY A;  4H0T B;  3I8B A;  1K9M O;  1WB9 A;  2HHV A;  4NCB A;  5HRO A;  4JI5 K;  3CQ8 A;  1NGE A;  4DF8 A;  3D2E B;  3AVI A;  1BU6 O;  3FGU A;  1JCG A;  3TWH A;  4GNI A;  4Y1C A;  3TSQ A;  2UUC K;  3DOL A;  2E2N A;  5GAD P;  1GLF O;  3CCV N;  3ZSQ A;  1WAJ A;  5M1F A;  1V4S A;  2ASO A;  1CZ9 A;  3L2U A;  3IS9 A;  4CZK A;  4FWS A;  1BOT O;  4BG8 A;  3UE5 A;  1TKD A;  4XIU A;  5HBM A;  3KLG A;  2IAJ A;  3NDK A;  1JLE A;  3ZT3 A;  3AY9 A;  2BGG A;  4DFP A;  4QS7 A;  3LWL A;  4LFA K;  4QOZ B;  3C6A A;  1UA0 A;  1I3A A;  2G8V A;  4M7X A;  1TK5 A;  3TAG A;  1NK5 A;  4JKH A;  4F4K A;  5E84 A;  3K5O A;  1LCU A;  3JAM O;  3I56 N;  1IG9 A;  1S9G A;  3AVK A;  4Y0W A;  3WNF A;  3L2Q A;  4M3U A;  4F3T A;  3CCL N;  4B3S K;  4WQ4 C;  4N47 A;  3KLE A;  4CJE A;  4C1N K;  3OW2 M;  1QQC A;  5DK5 A;  4CFA A;  4PQU A;  1FW6 A;  3GOI A;  3I33 A;  4CJL A;  4H0O A;  2YNH A;  4AM6 A;  3NF6 A;  1WSI A;  4A59 A;  4YFU A;  3M1F A;  2ASM A;  3C94 A;  1ZC6 A;  4R5P A;  2GEL A;  2ZGY A;  4JI0 K;  4IEI A;  4NCG A;  2PZS A;  4V19 S;  1D4X A;  2GBZ A;  4NO7 A;  1RDB A;  3HRG A;  4CK2 A;  4CZG A;  3WQU A;  2LSN A;  2D1K A;  2DPN A;  4FSV A;  1HKG A;  1T8E A;  3W3D A;  4KRE A;  3PX0 A;  3QO9 A;  1EO1 A;  1LOT B;  5KPZ A;  2E20 A;  4GW6 A;  1IKY A;  1WBB A;  3ULD A;  2YX6 A;  3TSP A;  1L3U A;  3IUC A;  1S3X A;  4LC9 B;  4XH1 A;  1D9D A;  4CZL A;  4KTW A;  1KAZ A;  3OS1 A;  4DQI A;  4JS4 A;  2Z1I A;  3JXU A;  3T1A A;  4DS5 A;  2EWS A;  1J9A A;  3SK3 A;  4GVE A;  2QWN A;  3QES A;  1L5U A;  3BP8 A;  4HVJ A;  4DLE A;  5BN8 A;  3QEW A;  4EAH D;  4JHD A;  4EP4 A;  4LFB K;  5KI6 A;  1NNE A;  2Y1J A;  1XMQ K;  4PY5 A;  4CGI A;  3FZM A;  4CEB A;  2IC3 A;  3ID6 A;  4B08 A;  1CZA N;  3ZSZ A;  1N36 K;  5DM7 L;  4YOT A;  5C2D A;  3PY8 A;  2RE2 A;  2Q0U A;  4W5O A;  4FLX A;  3D6R A;  4CZE A;  2F7T A;  1XNR K;  2A1R A;  3TAN A;  4H0P A;  1NGB A;  1TAQ A;  4B9V A;  3E9L A;  1XHZ A;  1QSY A;  1NMD A;  4DQQ A;  3L4Q A;  3HM8 A;  4AHT A;  3O4N A;  2WTU A;  3ZCM A;  1C0F A;  4JHD B;  4H5T A;  2ZGZ A;  1HNX K;  3KD5 E;  4PKG A;  3BF1 A;  4FWQ A;  4WFB L;  4YOV A;  4KTZ A;  1C0M A;  4FJK A;  3OYG A;  3NE6 A;  4DTX A;  4GV9 A;  1N32 K;  3C6H A;  2X74 A;  3TTF A;  1V4T A;  2G8W A;  1IBM K;  4KHQ A;  1VHX A;  2E88 A;  5KRT A;  2OCE A;  1J53 A;  2HB5 A;  3D7E O;  4CFB A;  1D9F A;  1QSL A;  3SZ2 A;  1M90 O;  4AHS A;  2DY4 A;  5T7B A;  5J2Q A;  4MO5 A;  2NRV A;  4C8O A;  3UKR A;  1N33 K;  4YOU A;  2YHB A;  4BVO A;  3AV9 A;  2OTL N;  3Q7B A;  1KAY A;  5FPD A;  3B8A X;  4BR4 A;  4BRD A;  3AGK A;  2OPQ A;  1E3M A;  3O6W A;  3VF4 A;  1TL3 A;  4CFD A;  1NU0 A;  4JN4 A;  3V9Z A;  2P5G A;  3H3O B;  4LSN A;  4GKK K;  4H5W A;  2FSJ A;  3S3N A;  4FJ8 A;  3CXC M;  3FZH A;  4ISF A;  5KGW A;  3N4Q A;  3O9U A;  3NH2 A;  2P9S A;  1UA1 A;  1BDG A;  5AQI A;  3LL3 A;  4FXD A;  3HJF A;  4CJ4 A;  4EZ9 A;  4L8R B;  1WN7 A;  1RDU A;  2KZZ A;  2FBV A;  1IJJ A;  4AF1 A;  4H0X B;  3SCX A;  3LDO A;  1SV5 A;  1RBU A;  2V51 B;  3CJ7 A;  1YTU A;  3P4I A;  3P83 D;  3VPZ A;  2PBD A;  4DSL A;  3UKR B;  2D4W A;  4DV1 K;  3F5T A;  2DFF A;  3LM2 A;  2VCP A;  4CJS A;  4AM7 A;  4JK8 A;  4Q5V A;  3VF6 A;  3SAH A;  3OYL A;  1VSL A;  1VSF A;  1U48 A;  2BH1 A;  1W0H A;  1C0U A;  1U4B A;  2CGK A;  2B4J A;  5AQP A;  2P9S B;  2ITM A;  4FLT A;  3MDQ A;  1VQ4 N;  4QCL A;  1J54 A;  2HBL A;  1QHT A;  1BQN A;  2FLO A;  4YY3 K;  4IZ9 A;  2HHT A;  1KLM A;  3HI0 A;  1NJX A;  2P9K A;  4IFY A;  1C6V A;  3VGL A;  1YAG A;  3EY1 A;  4EZ6 A;  5J1E A;  4HWI A;  1NGH A;  4OKJ A;  3ISN C;  3MN6 A;  1QVG M;  4B3T K;  1QE1 A;  3VQ4 A;  1O1W A;  2A1S A;  2PFU A;  5AQL A;  1HPM A;  5CR4 A;  4BRA A;  2QKB A;  1S6P A;  4QAG A;  3QIP A;  4DV7 K;  3QLH A;  1NLV A;  1HNZ K;  2WFB A;  1BWF O;  3PV8 A;  4HCC A;  1T6C A;  4DV2 K;  1C1C A;  1S1V A;  1GLL O;  1Q9Y A;  5GIO A;  3WNG A;  2E6L A;  5CYM A;  3O4Q A;  3ENH A;  1RT3 A;  1TL1 A;  4M42 A;  5M1K A;  1Z05 A;  1HNV A;  3U6F A;  5AJ3 K;  4O5B A;  3LAL A;  3TR8 A;  3LDN A;  3C6T A;  4LFC K;  4ILJ A;  1TK8 A;  1VQ8 N;  3CYM A;  4F3O A;  2E1Y A;  4CBW A;  4JKB A;  2ZJQ L;  1YVN A;  4BDZ A;  3CER A;  4LSL A;  3I0S A;  2G8I A;  3L4I A;  1GOB A;  1P8Z A;  5SZT A;  4FW2 A;  1LW2 A;  2HBM A;  1MU2 A;  1J5O A;  1HMV A;  1RTD A;  3ZSR A;  4H5N A;  3QBX A;  3W0L A;  5AFU A;  3OYE A;  3K5N A;  2HBJ A;  4YOX A;  1EP4 A;  3SAG A;  1HR0 K;  3LDL A;  2I7P A;  3VES A;  4BAC A;  4IFE A;  3TAQ A;  3HM9 A;  1X9J A;  5HP1 A;  3THV A;  1KQS M;  1B9D A;  4KHY A;  2ATQ A;  2HVH A;  4MLE A;  1TKZ A;  4CJF A;  2HMP A;  3NH1 A;  4YDU A;  2I7N A;  3AVC A;  3G10 A;  2BAN A;  4IDK A;  2WUS A;  3HO1 A;  4E3S A;  3K5L A;  2UXD K;  1XMO K;  3SQ1 A;  3A5O C;  1XC9 A;  3KLH A;  4Z4G A;  4Z4F A;  3VET A;  1YIJ N;  3VEX A;  1Y97 A;  3G71 N;  3SQ0 A;  4E0D A;  1JLC A;  4IOX A;  4BC5 A;  4I6M A;  4OKE A;  4FWN A;  2NRT A;  3T69 A;  3OYM A;  1UAX A;  1VQM N;  4K8X A;  4FO0 A;  4DR3 K;  2YNF A;  4RTF D;  4E7J A;  4AIL C;  2YHY A;  3AVA A;  2FF6 A;  4RCH A;  1C1B A;  2QW9 A;  4JYA K;  3FLC O;  2QKK A;  1C0G A;  3AAQ A;  4KI6 A;  1JLB A;  1KAX A;  2JLE A;  3EZW A;  5DMR A;  3IAY A;  3OYJ A;  3A5M C;  3NCI A;  4DFK A;  4DQR A;  2X6S A;  4DFM A;  3SBT A;  3LDQ A;  4KHW A;  4B9S A;  2YJF A;  1NWK A;  1OH6 A;  3HSC A;  3GE1 A;  4BRL A;  2OZS A;  1X3N A;  3C6U A;  1NK6 A;  4NLB A;  4ELU A;  4CEO A;  3QIO A;  4K8Z A;  4NYN A;  1U2V A;  4JI7 K;  4OPH A;  3ZT0 A;  1HKB A;  3CM5 A;  4KHP K;  4FLU A;  3VQC A;  3J7A P;  3IDH A;  3HXM A;  1BHL A;  3LP3 A;  4BRM A;  3V1R A;  4CGD A;  3HVT A;  3K57 A;  3MK6 A;  3KIO A;  2HNY A;  4H03 B;  1O13 A;  4CD1 A;  4FWL A;  2DFE A;  3AAR A;  1C1A A;  3A2F A;  4JLH A;  5AZJ A;  2FBY A;  2HHS A;  2HVI A;  1T7P A;  3DLE A;  3O5B A;  3VQ8 A;  1A5V A;  3J7Z O;  5B8H A;  1RBS A;  5AQZ A;  3BGR A;  1CLQ A;  4MO4 A;  4AHR A;  4OPJ A;  1DT9 A;  5KQ8 A;  1NGA A;  1S6Q A;  1TAU A;  3E01 A;  3SQ4 A;  2NRH A;  1U45 A;  1DLO A;  1KFD A;  1E4F T;  2ZE2 A;  3ZET B;  1K8A O;  4R79 A;  3ZSY A;  4FWP A;  4W5N A;  1RT6 A;  3N4P A;  5C42 A;  2QM1 A;  1U2V B;  1IBK K;  1YHQ N;  3LP1 A;  4KHU A;  3T19 A;  2J4R A;  3CQX A;  4CZI A;  1TKX A;  3CJC A;  4B1X B;  3FFI A;  2F9W A;  4FCY A;  1NKC A;  1W7A A;  3QER A;  3AVG A;  5A2Q O;  1RBT A;  1BIS A;  2UUB K;  4JKG A;  3ZSX A;  3OY9 A;  1RT5 A;  3I8D A;  1QSS A;  3CC7 N;  5AZJ B;  4FK4 A;  5M1O A;  3QNN A;  5BRE A;  3CCQ N;  4DTJ A;  2CGL A;  4EP5 A;  2V7Y A;  3F9K A;  2E1Z A;  2WON A;  3LAK A;  4FVU A;  3EN9 A;  3QML A;  2B6A A;  3TTD A;  1ATR A;  3LWM A;  4IG3 A;  5CZ2 A;  4XEI A;  2D5R A;  1VQP N;  4NXM K;  4BRC A;  1VQK N;  3U3G A;  4J2B A;  3MCP A;  3WQT A;  2G8U A;  4QS9 A;  1QQO A;  4RW9 A;  2D0O A;  4O0I A;  4ISG A;  3ULE A;  5JIC A;  2OPP A;  4CJU A;  1RTH A;  4TSX A;  5HRS A;  4JI4 K;  4JAX A;  3D45 A;  3QIN A;  4JRP A;  4MFB A;  1VQ6 N;  2HHW A;  3C7N A;  1BL3 A;  4PKI A;  3ASM A;  3LZI A;  1YI2 N;  4CGJ A;  2VYP A;  2HOE A;  4HCB A;  4BRQ A;  5J2P A;  2E5L K;  1S9E A;  5C12 A;  1ILY A;  3M8Q A;  1CXU A;  1KXP A;  4DFJ A;  3QFU A;  4JKG B;  4MDA A;  3DJC A;  1VSM A;  2QXL A;  1RT2 A;  4OKK A;  2O8F A;  4CEA A;  5TKW A;  4ILH A;  1L3T A;  2NZT A;  1KRP A;  4O44 A;  5AQR A;  3JSM A;  3D0P A;  4IO9 L;  4G1Q A;  1S1U A;  4IJA A;  2FSK A;  3RR7 A;  2BDP A;  4IDH A;  2UUA K;  4Q0B A;  3ULE B;  1U6Z A;  1Z25 A;  1VQL N;  3KTQ A;  3AVM A;  5BPL A;  3ZSW A;  3U8X A;  4CJV A;  2VQF K;  3DRS A;  2GWJ A;  3J81 O;  4FW1 A;  3CFP A;  3VGM A;  3WNE A;  1KVC A;  1M1K O;  4LF6 K;  3C7N B;  4HUG A;  5AQH A;  4DTP A;  4BQL A;  2P9L A;  1RDW X;  2EX3 A;  3OYB A;  2FXU A;  2A42 A;  3S9H A;  4FJX A;  3EE8 A;  4CGH A;  1D8Y A;  2HW3 A;  3L6Q A;  5I42 A;  2X78 A;  1TYQ A;  4C1N I;  4J2E A;  2UYT A;  1GOC A;  4A61 A;  2O8F B;  4BVP A;  3CJ1 A;  1VSK A;  4JKA A;  4YDU C;  4WF9 L;  4RW6 A;  4CCH A;  4CIF A;  4U7B A;  3AVJ A;  1KTQ A;  4K43 A;  5CE3 A;  4IG0 A;  4M3R A;  3BZC A;  2KW4 A;  3CCJ N;  3OA9 A;  4H0V B;  3IMX A;  2G8H A;  4DV0 K;  3H3N O;  1ESV A;  3WXI A;  1K73 O;  1I94 K;  2KZM A;  1ITG A;  3E9P A;  4CJQ A;  4M3W A;  4JI8 K;  3R9P A;  1IH7 A;  5IWA K;  4LF7 K;  3R6M A;  5AQT A;  3SMP A;  1OVQ A;  5KTQ A;  3TU5 A;  2P9L B;  4ILG B;  4CZF A;  2NRR A;  1VSI A;  1BA1 A;  1TYQ B;  1BI4 A;  3CQY A;  4Z94 A;  3KZB A;  4BDY A;  2R7Y A;  1Q8I A;  1FKO A;  4L3Q A;  4JRQ A;  4OGE A;  4BRH A;  3KLF A;  1OVY A;  4FWK A;  3A0I X;  4OVL A;  3DLG A;  1G99 A;  3M8P A;  3WXJ A;  4DV6 K;  4E7H A;  1RNH A;  2FSN A;  3VQD A;  4A5A A;  4CF1 A;  4DU3 A;  1HX1 A;  2O8E A;  4YOR A;  3DLL L;  1VSD A;  4BRE A;  1SQK A;  3AVN A;  4FLW A;  4KH4 A;  3QEX A;  4X64 K;  3Q7C A;  5DM6 L;  4M63 C;  3CD6 N;  3RMC A;  3QDK A;  4JKC A;  3M5R A;  4Z4H A;  4K25 A;  4CF9 A;  3P39 A;  4FLZ A;  3ATV A;  1T05 A;  3CIP A;  3AVL A;  1BI4 B;  3K5M A;  2OA8 A;  2E4L A;  1NG9 A;  1VQO N;  2EHG A;  4X62 K;  3OHR A;  3VEN A;  4FYD A;  1OH5 A;  1YXQ A;  3ZLJ A;  3RMD A;  2YHW A;  1ATS A;  3O3G A;  4CF8 A;  2W6K A;  4XH5 A;  4C8L A;  3OYC A;  4M41 A;  3PLA A;  3HST B;  5AQW A;  2O8E B;  2VWB A;  4DV4 K;  3NF7 A;  3CJA A;  2OPR A;  4H0Y B;  3EZ5 A;  1WBD A;  4W5R A;  1NK9 A;  3KK7 A;  4B1V A;  1R0A A;  3O08 A;  4CGG A;  1DGK N;  1NOY A;  3B6O A;  3AO2 A;  4WQ5 A;  1Z26 A;  4DQ8 A;  5AQF A;  1YTA A;  3KJV A;  4FJL A;  1CXQ A;  3CFR A;  2QWR A;  3RSE A;  4F8R A;  2HHQ A;  3QNO A;  1NGD A;  2IVN A;  2F9T A;  3KHY A;  3RMB A;  4BY9 C;  1N6Q A;  3QIC A;  3GG4 A;  3AVB A;  3SUP A;  3KKS A;  1HJO A;  3SMS A;  2HF3 A;  4LF9 K;  1U04 A;  1YVU A;  1LWE A;  1QQN A;  3O9T A;  4BRK A;  5F0X A;  2KLA A;  1K6Y A;  4CJ7 A;  4U67 L;  4CHN A;  4E19 A;  2E2P A;  2ZJP L;  1ZBH A;  3DRP A;  1TKT A;  4B9N A;  3O4W A;  4K0K K;  4DR6 K;  5LY3 A;  4I9Q A;  1VSJ A;  2CH6 A;  3IRX A;  4H4O A;  2UXB K;  3RSE B;  3O1B A;  4RW7 A;  5FRN A;  3ZX2 A;  2VQE K;  5BPN A;  3IKM A;  1YUW A;  5EOY A;  1BGX T;  4IFV A;  2W41 A;  4CJP A;  1HYZ A;  4Z4C A;  3LP2 A;  4DTN A;  4B9T A;  5H1S Q;  1KSP A;  3G4S N;  1NKE A;  3THX A;  2RF2 A;  1BUP A;  3PX6 A;  4BE1 A;  4I2Q A;  1SAZ A;  4BRP A;  2RKI A;  3LPT A;  1GLA G;  2HST A;  2YHA A;  3D2F A;  3VQ9 A;  3RMA A;  3KD1 E;  5FPE A;  3CFO A;  4CJ5 A;  2JGU A;  2NRW A;  3SJH A;  3WXM B;  2P5O A;  1ASW A;  4WFN L;  4GV3 A;  4UQG A;  4YOY A;  3FFK B;  2W42 A;  4DSI A;  3O9Q A;  4CK1 A;  1F21 A;  3QBW A;  4LF8 K;  1WSF A;  4B1W B;  1ZBU A;  4FJI A;  1IKV A;  1WSG A;  4DR5 K;  4JKE A;  3DLB A;  3NGI A;  4IOC L;  3VQ6 A;  2HF4 A;  3VEY A;  2KFN A;  3QET A;  4B3O A;  3A5N C;  5BRF A;  2JWK A;  2D0P A;  3AAP A;  1MWM A;  1XNQ K;  2FF3 B;  2NUB A;  4DTO A;  1SKS A;  2O8C A;  3THX B;  2ITG A;  5JS1 A;  4LY7 A;  1NGG A;  3O9S A;  4LF5 K;  4M3Y A;  2Z1H A;  3VQP A;  1RDC A;  1IKW A;  3KLI A;  1GLB G;  5LMN K;  3QFP A;  2E6M A;  4DR4 K;  3D2F B;  4KKO A;  3CPW M;  4BR5 A;  2W6L A;  1SKW A;  1HPZ A;  5ADX A;  1WSE A;  2F8S A;  2P9K B;  3CMA N;  3HP9 A;  5C25 A;  1NK4 A;  2HBK A;  4CIG A;  4JS5 A;  1BQM A;  1KC8 O;  2ZD1 A;  3THY A;  3SJJ A;  3BEX A;  4CHY A;  1EX4 A;  5F2R A;  3L2R A;  3M8R A;  3MXJ A;  4B8A B;  4FZY A;  1DKG D;  1BIZ A;  2IOC A;  1NK7 A;  4EHU A;  5KPR A;  3NVM A;  4ZTF A;  4EIA A;  1XQS C;  3S41 A;  4C23 A;  1TUU A;  5IT9 O;  2O8C B;  2HMI A;  4F2S A;  4H5V A;  3NMU A;  4KV8 A;  5MLC Q;  2YJE A;  3CC2 N;  1DTQ A;  1EWR A;  4OJR A;  3BDP A;  2YNI A;  1RDD A;  4W5T A;  2XY6 A;  1XWL A;  3ZT4 A;  5C24 A;  4GV6 A;  1T44 A;  4CEF A;  2D0C A;  3E66 A;  1FKP A;  4BE2 A;  2QWO A;  3THY B;  4DTU A;  1NK0 A;  5FPM A;  4CBU A;  4FJH A;  5EVZ A;  5JS2 A;  4M45 A;  4IBN A;  4FL9 A;  1NK8 A;  1VRT A;  5LL6 Z;  3RWU A;  4MDB A;  2ETJ A;  3CC4 N;  2QWM A;  3I0R A;  3BY5 A;  4DLG A;  4HHT A;  3S3M A;  4AHV A;  3OYA A;  4OPA A;  1DTT A;  3K2P A;  1HNW K;  4FJN A;  4O0J A;  3FZL A;  3QEV A;  4W5Q A;  3PSF A;  3NBP A;  4FPA A;  2O8D A;  1EKE A;  1S72 N;  2NRX A;  3ITH A;  4GVM A;  1Z6R A;  2OYQ A;  1TUY A;  5EU7 A;  3HVR A;  4KRF A;  4ID5 A;  2PYL A;  2YKM A;  4A2B A;  3OS0 A;  3AO5 A;  1SL0 A;  4DTS A;  2HHX A;  4Z4I A;  4O8U A;  3J7Y P;  4CD3 A;  4CES A;  3MX2 A;  3VN5 A;  4ELT A;  4N56 A;  3SV4 A;  5AQO A;  3O3F A;  1WAF A;  2KQ2 A;  3OBY A;  2ZWH A;  1W9H A;  1B92 A;  4BWJ A;  1H1V A;  1HLU A;  1TGO A;  2PYJ A;  4WYB A;  4FWR A;  5CZ1 A;  2BTF A;  3H46 O;  3HPH A;  4WQ5 C;  3PO5 A;  3WEE A;  2O8B A;  3CF5 L;  4DG1 A;  4DKW A;  3ZYY X;  3EEQ A;  1NJW A;  1ZBS A;  4IJN A;  4H8K A;  4JKD A;  4PL7 A;  3L8B A;  2QA4 N;  4DV5 K;  3T7Z A;  3DLH A;  3NF8 A;  3H6E A;  3HL8 A;  4I6M B;  4WCE L;  2YCH A;  3OYF A;  3VEV A;  3MED A;  4KHN A;  4BG9 A;  3VEO A;  4YHH K;  3HYF A;  4BR7 A;  3KK2 A;  1J5E K;  3F9M A;  5JLF A;  1JLF A;  4CVN E;  4BGB A;  4M3X A;  5JVH L;  5LJV A;  1RTJ A;  4E1N A;  3AVH A;  4DV3 K;  3MN9 A;  3CG7 A;  3T1Y K;  2Q31 A;  4DU1 A;  3VTH A;  5GAH P;  3L2V A;  1NGF A;  1KCF A;  1RBV A;  4B8C A;  3ZX3 A;  2G8K A;  1MWK A;  5I9E B;  4IKF A;  3SUQ A;  3V9X A;  3VQE A;  1WNS A;  4NB4 A;  4JI6 K;  4KTQ A;  2P9N A;  3AVF A;  1KLN A;  2KKZ A;  1JXE A;  2O8B B;  1XI1 A;  3U9D A;  4F9O A;  1HKC A;  1ZXO A;  3DMJ A;  4MQ3 A;  4FZX C;  2FBX A;  3K0S A;  4BRO A;  1RTI A;  1VSH A;  4GKJ K;  5EX5 A;  3UB5 A;  1RFQ A;  4HUF A;  2W40 A;  4FK2 A;  2Y1I A;  2A41 A;  1GLD G;  4ZHR A;  5FDL A;  3TSU A;  2E2O A;  5E26 A;  3MXI A;  3CI5 A;  1JLQ A;  1JL2 A;  1GOA A;  2QXF A;  2OAN A;  4KFB A;  3UKU A;  3ZEU A;  5JVG L;  2NNW A;  1JCE A;  3P38 A;  1SUQ A;  5HRR A;  3JYT A;  4FOE A;  2QI2 A;  3V9U A;  2RHK A;  3AA4 A;  3BZK A;  1WOQ A;  3K58 A;  2P9N B;  4E7K A;  1JCF A;  2YV0 X;  1YJN N;  2P9I A; 
#chains in the Genus database with same CATH homology
 5ADX H;  3EKU A;  3VPZ A;  2P9P A;  2PBD A;  3U4L A;  4B1U B;  1T3V A;  3UKR B;  2D4W A;  4L3Q A;  4PHT X;  4NLC A;  3F5T A;  4BRH A;  1RGI A;  1OVY A;  3LM2 A;  1N8R O;  2VCP A;  3E1Y A;  2IIR A;  4FWK A;  3G25 A;  1BO5 O;  5AQJ A;  4AM7 A;  3A0I X;  4K41 A;  4JK8 A;  5GAG P;  3VOV A;  1G99 A;  1GLJ O;  3MN5 A;  3VF6 A;  3WXJ A;  2FSN A;  3CET A;  3VER A;  3SAH A;  5AQU A;  4A5A A;  1SS6 A;  1HX1 A;  4BC3 A;  5BR9 A;  5M1N A;  3BF3 A;  3TPQ A;  4YOR A;  3NVK A;  3DLL L;  2BH1 A;  5C15 A;  4BRE A;  5CHI A;  1SQK A;  2CGK A;  4KH4 A;  5AFU H;  3Q7C A;  5DM6 L;  3MN7 A;  5AQP A;  2ZJR L;  4RWT A;  2P9S B;  2ITM A;  3MDQ A;  4M63 C;  1IG8 A;  3CD6 N;  3CCS N;  1VQ4 N;  4BQZ A;  2GEM A;  3UKU B;  3QDK A;  3ZEU B;  4IOA L;  2Q0R A;  4JKC A;  3M5R A;  2HBL A;  4KH6 A;  4K25 A;  2FLO A;  3P39 A;  4IZ9 A;  3ATV A;  4IWV A;  3CIP A;  3HI0 A;  1W97 L;  2P9K A;  5JLH A;  3KWI A;  3EO3 A;  1S22 A;  3OBW A;  5EY4 A;  2GX9 A;  2P9I B;  1YAG A;  3J8A A;  3VGL A;  3CHW A;  5EXW A;  1HUX A;  4BRN A;  5TKY A;  1MDU B;  2P9P B;  4A62 A;  3LDP A;  4HWI A;  1NGH A;  1VQO N;  5AQG A;  3WT0 A;  3OHR A;  3VEN A;  1YXQ A;  3HZ6 A;  5AQM A;  1XC3 A;  3MN6 A;  1QVG M;  3CCR N;  2YHW A;  1ATS A;  5AZI A;  2PFU A;  5AQL A;  1HPM A;  5CR4 A;  4BRA A;  4H5R A;  4XH5 A;  3BUZ B;  2AA4 A;  4OO1 J;  3ENO A;  1NLV A;  2WFB A;  3PLA A;  1BWF O;  4JKF A;  1T6C A;  4JD2 A;  3M3Z A;  5AQW A;  1NBW A;  2VWB A;  1GLL O;  5M1P A;  3CJA A;  2BUP A;  5GIO A;  1YJW N;  2GUP A;  4H0Y B;  3ENB A;  2P9U A;  3HTV A;  3ENH A;  2CGJ A;  3KK7 A;  3ZET A;  4B1V A;  3O08 A;  5M1K A;  1Z05 A;  1QVF M;  1NGJ A;  3EL2 A;  1DGK N;  3VF2 A;  5AQY A;  2ZF5 O;  4WQ5 A;  4DHY A;  3PIP L;  3GL1 A;  5M1Q A;  3A8Y A;  3WEE B;  4DQ8 A;  3LDN A;  3C0B A;  1YJ9 N;  4ILJ A;  5AQF A;  1VQ5 N;  1OKJ A;  3MX5 A;  2GWK A;  1VQ8 N;  2E1Y A;  2PAV A;  4B9Q A;  4CBW A;  2Q2R A;  4JKB A;  2ZJQ L;  1YVN A;  5ELZ A;  3CER A;  2H3G X;  2QWR A;  2A40 A;  3RSE A;  3ZX0 A;  3L4I A;  1P8Z A;  2CH5 A;  4IXC A;  2KHO A;  4M7Y A;  2HBM A;  4BC2 A;  1QQM A;  1Q82 O;  2QWQ A;  3KVG A;  3FZK A;  3H1V X;  3VTI A;  1VAZ A;  5AZI B;  4CZH A;  1NGD A;  3O80 A;  3CCM N;  3WUH A;  2QTD A;  2IVN A;  2F9T A;  2V7Z A;  3KHY A;  4BY9 C;  3FR0 A;  3EE9 A;  3QIC A;  3GG4 A;  2YHX A;  3LM9 A;  4H5N A;  3QBX A;  4JD2 B;  3W0L A;  5AFU A;  3SLC A;  1VQ9 N;  1NGI A;  3R8E A;  3WXL A;  1QHA A;  1QZ6 A;  4HTL A;  1HJO A;  3SMS A;  2HBJ A;  2HF3 A;  3IFR A;  4YOX A;  3G6E N;  2WBN A;  4A57 A;  3DAW A;  3SAG A;  3D2E A;  4YOW A;  1QQN A;  3LDL A;  2I7P A;  2P9U B;  3VES A;  3O9T A;  3VEW A;  2A3Z A;  4IFE A;  4BRK A;  5F0X A;  2KLA A;  4CJ7 A;  4U67 L;  1X9J A;  2E2P A;  5C2F A;  1KQS M;  2ZJP L;  4PL8 A;  1W2B M;  3O4W A;  2QWL A;  3C65 A;  4PKH A;  4MLE A;  5LY3 A;  4BRI A;  3DWL A;  2HMP A;  3FE1 A;  2CH6 A;  4YDU A;  2I7N A;  3F2K A;  3RSE B;  3QB0 A;  3O1B A;  5HOO A;  2WUS A;  4DCH A;  2Q97 A;  5AQN A;  3ZX2 A;  5BPN A;  4JK7 A;  5BN9 A;  3IKM A;  1BG3 A;  1YUW A;  5EOY A;  3A5O C;  3P31 A;  3FZF A;  3ID8 A;  4BR2 A;  2W41 A;  3VET A;  1EQY A;  4H0T B;  5GIP A;  1YIJ N;  3GDQ A;  3I8B A;  3VEX A;  5H1S Q;  3G71 N;  1J6Z A;  1K9M O;  3ATU A;  5AR0 A;  1K8K A;  4IOX A;  4BC5 A;  3G4S N;  4UY8 O;  4I6M A;  1BUP A;  4FWN A;  2NRT A;  1VQN N;  1Y64 A;  3T69 A;  4A2A A;  1VQM N;  1SAZ A;  1NGE A;  4BRP A;  3D2E B;  2GTD A;  1Q18 A;  4FO0 A;  1VQ7 N;  1BU6 O;  1GLA G;  1JCG A;  2HST A;  3D2F A;  3FGU A;  4GNI A;  4RTF D;  2YHY A;  3TSQ A;  5FPE A;  2FF6 A;  2NRW A;  4RCH A;  3SJH A;  3WXM B;  1YIT N;  2QW9 A;  3FLC O;  2E2N A;  4WFN L;  5GAD P;  4GV3 A;  1GLF O;  5BRD A;  1GLC G;  4YOY A;  3FFK B;  3WXK A;  3HOS A;  3MMV A;  1C0G A;  3AAQ A;  5M1F A;  1X3M A;  1KAX A;  1V4S A;  3O9Q A;  3QBW A;  5F1X A;  2ASO A;  3EZW A;  4B1W B;  3JS6 A;  2OTJ N;  5KQD A;  3DXM A;  4CZK A;  4FWS A;  1BOT O;  3A5M C;  4BG8 A;  5KPT A;  3UE5 A;  4JKE A;  2A5X A;  2E8A A;  3I55 N;  4IOC L;  2VGM A;  4KH5 A;  2HF4 A;  3VEY A;  3K9K A;  3GBT A;  3A5N C;  3SBT A;  5BRF A;  2WC9 A;  2JWK A;  2D0P A;  3LDQ A;  3AAP A;  3HOT A;  1MWM A;  2YJF A;  1BA0 A;  3AY9 A;  1E4G T;  2FF3 B;  4QS7 A;  1K8K B;  3O8M A;  1NWK A;  3C6A A;  3HSC A;  3GE1 A;  4M7X A;  4O8K A;  4BRL A;  1NGG A;  3O9S A;  4JKH A;  4J8F A;  5E84 A;  1LCU A;  1X3N A;  1GLB G;  4IO8 A;  3QFP A;  1KD1 O;  1DEJ A;  3I56 N;  4NLB A;  3D2F B;  3CPW M;  4BR5 A;  1U2V A;  4OPH A;  1HKB A;  4FWO A;  4Y0W A;  5ADX A;  2P9K B;  3IDH A;  3CMA N;  2HBK A;  3CCL N;  4BRM A;  5C10 A;  1KC8 O;  4ISE A;  4WQ4 C;  3BEX A;  3H45 C;  3MK6 A;  5F2R A;  4C1N K;  3OW2 M;  4WFA L;  4H03 B;  1O13 A;  4CD1 A;  4FWL A;  3DXM B;  3GOI A;  1DKG D;  3AAR A;  3I33 A;  4H0O A;  4EHU A;  4AM6 A;  4EHT A;  5KPR A;  3NVM A;  2IVO A;  4A59 A;  2E2Q A;  3M1F A;  5AZJ A;  2ASM A;  3O5B A;  5AQS A;  3J7Z O;  5B8H A;  5AQZ A;  4EIA A;  1XQS C;  3S41 A;  1ZC6 A;  4MO4 A;  4C23 A;  2GEL A;  1TUU A;  2ZGY A;  1DT9 A;  5KQ8 A;  1NGA A;  4H5V A;  3NMU A;  3VGK A;  4IEI A;  2NRH A;  5MLC Q;  2QWP A;  2YJE A;  1E4F T;  3CJ9 A;  3ZET B;  1WUA A;  1K8A O;  3CC2 N;  4R79 A;  1D4X A;  3O1W A;  4FWP A;  3KWG A;  2NRZ A;  4FPB A;  4NO7 A;  5C0Y A;  4G9Z A;  3HRG A;  3N4P A;  4CZG A;  2QM1 A;  3WQU A;  1U2V B;  1YHQ N;  2D1K A;  4JK9 A;  2DPN A;  4FSV A;  4B1Y B;  4GY2 B;  4GV6 A;  4BR0 A;  1T44 A;  2J4R A;  1HKG A;  3CQX A;  4KBO A;  3RVC A;  4CZI A;  3E66 A;  3W3D A;  3VEZ A;  3CCE N;  3CJC A;  1EO1 A;  1LOT B;  2QWO A;  4B1X B;  2F9W A;  5KPZ A;  2E20 A;  4FWM A;  5FPM A;  4CBU A;  5EVZ A;  5AQK A;  4BR9 A;  2YX6 A;  3TSP A;  1P90 A;  4K42 A;  4FL9 A;  4B1Z A;  4EFH A;  3CCV N;  3L0Q A;  3IUC A;  2Q1N A;  4MDB A;  3CC4 N;  2QWM A;  1S3X A;  4LC9 B;  4XH1 A;  4JKG A;  4CZL A;  4CBX A;  3CC7 N;  4E1J A;  5AZJ B;  5M1O A;  5BRE A;  4OPA A;  3CCQ N;  2CGL A;  4QS8 A;  1R59 O;  1KAZ A;  2V7Y A;  1Q86 O;  2A6A A;  3FZL A;  2E1Z A;  3A5L C;  3H1Q A;  3JXU A;  2VGN A;  4FPA A;  3PIO L;  1S72 N;  4FVU A;  3EN9 A;  2NRX A;  2EWS A;  3QML A;  3TTD A;  1ATR A;  3SK3 A;  4GVE A;  2QWN A;  1Z6R A;  2Q36 A;  3TTC A;  3BP8 A;  4XEI A;  1TUY A;  1VQP N;  1VQK N;  4BRC A;  5BN8 A;  4A2B A;  1Q7Y O;  3MCP A;  3WQT A;  4QS9 A;  3VMF B;  4EAH D;  1QQO A;  4JHD A;  2D0O A;  3MWT A;  4ISG A;  3ULE A;  4O8U A;  5JIC A;  4CD3 A;  4IEE A;  5GAE P;  3MX2 A;  4JAX A;  3R3L A;  1VQ6 N;  3C7N A;  4PKI A;  3FZM A;  4JNE A;  1YI2 N;  5AQO A;  2VYP A;  2HOE A;  3ID6 A;  3OBY A;  2QEX N;  2ZWH A;  1CZA N;  4A5B A;  1MA9 B;  4BRQ A;  1H1V A;  1HLU A;  5C12 A;  1ILY A;  4WYB A;  4CZJ A;  4FWR A;  4YOT A;  5DM7 L;  2BTF A;  3H46 O;  5C2D A;  5AQQ A;  2RE2 A;  2Q0U A;  5BRH A;  1KXP A;  3K9J A;  3CME N;  3QFU A;  5JMV A;  4WQ5 C;  3SBG A;  3WEE A;  3MWP A;  4JKG B;  4MDA A;  3CF5 L;  1NJI O;  3D6R A;  3DJC A;  4CZE A;  1XUP O;  2QXL A;  2F7T A;  4O5F A;  3ZYY X;  4DKW A;  1ZBS A;  3O9R A;  4IJN A;  4JKD A;  4DB3 A;  4PL7 A;  2QA4 N;  5TKW A;  4ILH A;  4BC4 A;  2NZT A;  3T7Z A;  4CI6 A;  4I6M B;  3H6E A;  4H0P A;  5AQR A;  1NGB A;  4WCE L;  4IO9 L;  2ASP A;  2YCH A;  3CPE A;  3MCA B;  3E9L A;  4IJA A;  3VEV A;  1NMD A;  4BG9 A;  3VEO A;  3L4Q A;  3HM8 A;  4BR7 A;  3U9Z A;  2FSK A;  3F9M A;  5JLF A;  3CXC M;  4IDH A;  1GLE G;  3EKS A;  1C0F A;  3M6G A;  4JHD B;  4BGB A;  5JVH L;  2V52 B;  4H5T A;  1U6Z A;  2ZGZ A;  3ULE B;  5LJV A;  4MLH A;  5BPL A;  1JJ2 M;  1VQL N;  3U8X A;  3MN9 A;  1YF5 L;  4PKG A;  3BF1 A;  2GWJ A;  4FWQ A;  4WFB L;  2Q31 A;  4XH4 A;  4YOV A;  3VGM A;  3DXK A;  1M1K O;  3C7N B;  3VTH A;  5GAH P;  4GV9 A;  3C6H A;  1NGF A;  3TTF A;  5AQH A;  3SAF A;  4BQL A;  4CZM A;  2P9L A;  1V4T A;  3ZX3 A;  1RDW X;  3R1X A;  1NM1 A;  2E88 A;  1MWK A;  2FXU A;  2A42 A;  5I9E B;  5HL7 L;  4BGA A;  3EE8 A;  4NB4 A;  3D7E O;  3L6Q A;  2IVP A;  5LJW A;  1QZ5 A;  3CCU N;  2P9N A;  4C1N I;  1TYQ A;  2KKZ A;  1M90 O;  2UYT A;  3U9D A;  5AQV A;  4A61 A;  4F9O A;  4MO5 A;  1HKC A;  2NRV A;  4BVP A;  3CJ1 A;  3UKR A;  4YOU A;  5AQX A;  4JKA A;  4BVO A;  1ZXO A;  4YDU C;  4WF9 L;  2OTL N;  3AGR A;  3Q7B A;  1KAY A;  5FPD A;  3B8A X;  4BRO A;  4FOI A;  4BR4 A;  4BRD A;  3AGK A;  4U7B A;  1NGC A;  4K43 A;  5CE3 A;  3O6W A;  3VF4 A;  5GIN A;  3CCJ N;  2YI1 A;  5EX5 A;  3OA9 A;  4H0V B;  3E9O A;  3IMX A;  5FPN A;  1ATN A;  3H3N O;  4JN4 A;  3UB5 A;  1ESV A;  3H3O B;  3WXI A;  1SZ2 A;  1K73 O;  1RFQ A;  4BRG A;  2W40 A;  2A41 A;  3E9P A;  4H5W A;  2FSJ A;  1GLD G;  3CJB A;  4WQ4 A;  5BPM A;  3R9P A;  3FZH A;  3DXK B;  2E2O A;  4ISF A;  2AP1 A;  5E26 A;  3TSU A;  3N4Q A;  3CI5 A;  3O9U A;  3R6M A;  5AQT A;  2P9S A;  3SMP A;  3TU5 A;  1BDG A;  4JEP A;  5AQI A;  2P9L B;  2OAN A;  3LL3 A;  3UKU A;  3ZEU A;  1T6D A;  2NNW A;  5JVG L;  1JCE A;  2NLX A;  4BRF A;  3P38 A;  4ILG B;  4CZF A;  1RDU A;  4FOE A;  2QI2 A;  2JWL A;  2RHK A;  1IJJ A;  4AF1 A;  4H0X B;  1WOQ A;  2NRR A;  3HBT A;  2P9N B;  1BA1 A;  1JCF A;  1TYQ B;  2V51 B;  3CJ7 A;  3CQY A;  3LDO A;  4Z94 A;  3KZB A;  2P9I A;  1YJN N;  1Q81 O;  3P4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...