1SZ2A

Crystal structure of e. coli glucokinase in complex with glucose
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
319
structure length
319
Chain Sequence
KYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGCIAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFGGAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAEIGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVIMGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIVHDNPGLLGSGAHLRQTLGHIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glucokinase
publication title Crystal structures of Escherichia coli ATP-dependent glucokinase and its complex with glucose
pubmed doi rcsb
source organism Escherichia coli
total genus 97
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature ec 2.7.1.2: Glucokinase.
pdb deposition date 2004-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02685 Glucokinase Glucokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1sz2A01
3.40.367.20 Alpha Beta 3-Layer(aba) Sandwich Hexokinase; domain 1 Hexokinase; domain 1 1sz2A02
2GWKA 4XH5A 4CZHA 4EHTA 3FZKA 3O08A 3VGMA 4HTLA 5AQKA 3H3OB 4LC9B 5AZJB 1MWKA 3ATVA 2QWOA 4CBWA 3ULEA 5AZIB 1ZXOA 1U6ZA 3DXMA 2CGJA 3A5NC 3IMXA 1KXPA 4J8FA 2D4WA 3FE1A 1TUUA 3ZEUA 4L3QA 3I8BA 5ELZA 3U9ZA 4FPAA 4CZKA 3QBWA 4BRPA 4EFHA 3WXIA 5ADXH 2QW9A 3C0BA 3WXLA 3SLCA 1EQYA 3ZETA 4PL7A 1NGIA 4FWPA 4H5NA 3UKRB 4B1XB 3LDOA 4ISGA 5AQXA 3U8XA 2W41A 4BROA 2V7YA 4JHDA 5B8HA 5AQUA 2YCHA 1MWMA 2ASPA 2E2OA 2VYPA 4GNIA 3LM9A 5AQLA 4BREA 2Q0UA 4H5WA 2A41A 3H3NO 1BA1A 2QWPA 4BVOA 3ZX3A 5BRDA 4WQ5A 3AAQA 5AQJA 1IG8A 4BRQA 1YUWA 5E26A 3TPQA 4ISFA 2WUSA 5AQZA 3VGKA 5BN9A 2YI1A 3QDKA 3BF3A 1GLEG 1NMDA 4B1UB 2IVNA 5F0XA 4FWMA 4MLHA 4FWLA 2E1ZA 1ESVA 3VESA 5BPMA 2YHYA 5AQYA 3CETA 2P9UA 4H0TB 3CJ1A 4PKHA 3U9DA 4WYBA 4A2BA 3IUCA 3DXKB 5TKYA 2KHOA 3CJCA 4B1YB 3LDLA 3IFRA 5BRFA 2QWLA 3WEEA 1BU6O 2FSJA 4WQ4A 5EX5A 1HKBA 2YHXA 5AQQA 2P9PB 4JD2B 4XH4A 4IJAA 1TUYA 3CHWA 4BG9A 2PBDA 2VCPA 3W3DA 1WOQA 4FWNA 3LL3A 3O80A 2A6AA 3HZ6A 3B8AX 3VEWA 4H03B 4BC2A 4FWKA 2YJEA 1Y64A 2P9NA 1TYQB 2Q36A 3DXMB 4CBUA 4CZGA 4DCHA 4B1VA 1E4GT 1NGDA 4FWSA 4K43A 5JMVA 3AARA 1JCEA 4DQ8A 3FGUA 4FWRA 3F9MA 4FOIA 5LJWA 1DGKN 2BTFA 3ZETB 1J6ZA 1HJOA 1SQKA 1NGCA 3H6EA 3A5MC 3SMPA 1BO5O 3AY9A 3VETA 3FR0A 1X3MA 2ZWHA 3GL1A 4RTFD 3ZX0A 4JHDB 3R9PA 4IXCA 3RSEB 3VF4A 4JNEA 1RFQA 1HKGA 2E2NA 3EO3A 1NGAA 4MO4A 4AM7A 1NM1A 3VERA 3EKSA 2QWRA 3J8AA 2CH5A 2IVOA 5AQRA 1Z6RA 4FO0A 4K41A 3OHRA 2NRHA 4CZEA 4F9OA 1LOTB 3VEVA 2P9KA 2VWBA 4I6MA 3M1FA 5F2RA 4CBXA 2Q1NA 2YHWA 2DPNA 1BUPA 3HM8A 3VOVA 1YAGA 3LM2A 1G99A 1GLFO 3D2EA 3WQTA 2I7PA 4IZ9A 1R59O 3DJCA 4O8KA 2A40A 3SMSA 2P9UB 5AQVA 3GDQA 4BRDA 1C0FA 3IDHA 4H5TA 3W0LA 1NLVA 3C7NA 1K8KA 3ZX2A 5FPDA 1P8ZA 2D1KA 5AQTA 5FPEA 2AP1A 1IJJA 2I7NA 4XEIA 4DB3A 3O1BA 3WEEB 1JCGA 4BR0A 2UYTA 3L0QA 5I9EB 3D2FA 4BC4A 2FF6A 2CGLA 1Z05A 3WT0A 3I33A 4FL9A 5AQIA 5LY3A 3QFPA 3R6MA 3P4IA 3MN9A 3UB5A 4IJNA 4AM6A 4QS7A 2NLXA 3U4LA 2CH6A 4CD3A 3TU5A 2D0OA 4H0VB 2P9NB 3BF1A 1NGEA 1QZ5A 1KAZA 3HTVA 4BRLA 4BQLA 4H5RA 2E8AA 2FSKA 5AFUH 2GEMA 1GLBG 3SJHA 5BPNA 3QMLA 4BGBA 4IO8A 1YVNA 5EOYA 4BRHA 3G25A 3HBTA 4A61A 1MA9B 4IWVA 1T6CA 2P9LB 3A5OC 3FZHA 3UE5A 4RWTA 5E84A 1KAXA 1GLAG 1NGBA 3BUZB 5AZIA 1HLUA 4H0OA 3VF2A 3VEOA 3VPZA 2FF3B 2V51B 4PKIA 3UKUA 4FPBA 4FWQA 4EHUA 3CJAA 3VEYA 1JCFA 1QQNA 5ADXA 1ZBSA 3GOIA 1SAZA 4BR5A 1U2VA 2A5XA 3JXUA 4I6MB 2A42A 3LDNA 3ULEB 1ATSA 2E1YA 2EWSA 4XH1A 4BRIA 3MMVA 2ITMA 1OKJA 3HSCA 3CERA 3ZEUB 4YDUC 4CZFA 3CIPA 2V52B 2ZGYA 4CZLA 1T6DA 1GLDG 5AQSA 5BREA 2IIRA 3C7NB 5BRHA 2ZF5O 1WUAA 2A3ZA 3EL2A 1NGJA 2QXLA 3CJ7A 3ATUA 1BWFO 3MN6A 2P9SA 4GY2B 4BRMA 4B1ZA 3D2FB 3QB0A 3AAPA 3EKUA 3KHYA 4ISEA 3QBXA 4M63C 5AFUA 3S41A 3GBTA 3M3ZA 2Q31A 5AQHA 3GE1A 5AQWA 3CQYA 3DXKA 1XC3A 1BDGA 4CI6A 1HPMA 3D7EO 3VF6A 4BC3A 5JLFA 1S3XA 3FZLA 5CE3A 1HX1A 2D0PA 2F9WA 2FLOA 4MO5A 4BC5A 1MDUB 4EIAA 4PKGA 1S22A 1KAYA 2YJFA 4M7XA 3WXJA 1GLJO 2HMPA 3EZWA 3KVGA 4K25A 1DKGD 5BPLA 1RDWX 3MCPA 3VGLA 3JS6A 1HUXA 4FWOA 4EAHD 2ASMA 1NWKA 4WQ5C 4MLEA 5KPRA 1TYQA 5KPZA 3O8MA 1QQOA 1DEJA 4NB4A 1X3NA 2QWNA 1QQMA 5EXWA 5AR0A 4BRFA 3WXKA 2HF3A 3UKUB 1D4XA 3QICA 3O1WA 1HKCA 3BEXA 4CD1A 2P9IA 5F1XA 3WQUA 2FSNA 4H0PA 4H0XB 4BRAA 1H1VA 1ZC6A 4FSVA 1U2VB 4JN4A 4BRKA 4BQZA 3LDQA 2E20A 1GLCG 3GG4A 1V4TA 3QFUA 5FPMA 3RSEA 1T44A 4FOEA 4M7YA 1BG3A 3CJBA 2CGKA 1XQSC 4WQ4C 4BVPA 2GELA 4H0YB 1GLLO 3FZMA 3MN7A 2J4RA 2GWJA 2GTDA 5AQPA 4BRCA 2ASOA 3A5LC 1NGHA 2FXUA 5AZJA 2IVPA 4CJ7A 2BUPA 1X9JA 3HI0A 4Z94A 3VEZA 2P9SB 2HOEA 5KQ8A 1C0GA 4CZIA 3L4IA 2F9TA 2HF4A 3EN9A 4BG8A 2E2PA 1ATNA 3CQXA 3ENHA 3DAWA 3MK6A 3H1VX 3O4WA 4E1JA 2Q2RA 2W40A 4H5VA 2PAVA 3UKRA 3KZBA 2OANA 2P9KB 1CZAN 3MN5A 5EVZA 5FPNA 3CJ9A 1QZ6A 2ZGZA 1V4SA 5AQFA 3ID8A 5KPTA 3H46O 3BP8A 3ENOA 1NGGA 3FLCO 3D2EB 3VENA 1SZ2A 3VEXA 2Q97A 3DWLA 5KQDA 1YXQA 3O5BA 2E88A 4B1WB 3MDQA 4BR9A 4QS8A 4QS9A 3WUHA 1K8KB 4DHYA 3R8EA 1E4FT 2Q0RA 4A2AA 5AQGA 3FZFA 4NO7A 5JICA 4Y0WA 1NGFA 2QM1A 3H1QA 3O6WA 4C23A 1XUPO 2GUPA 5LJVA 1ATRA 4PL8A 3LDPA 1BA0A 3CI5A 2NZTA 2P9IB 2AA4A 4BR2A 4A62A 3H45C 5BR9A 4CZMA 2P9LA 2V7ZA 2QWMA 1NBWA 4O5FA 1QHAA 2H3GX 3SK3A 5AQNA 4BRNA 2E2QA 4BR7A 5JLHA 4CZJA 2QWQA 4JAXA 5AQOA 4YDUA 3FFKB 3M6GA 4K42A 4HWIA 4BGAA 1LCUA 4B9QA 2P9PA 4JD2A 4KBOA 3A0IX 5AQMA 3A8YA 3L6QA 4RCHA 5BN8A 1RGIA 4BR4A 1Q18A 4BRGA 5EY4A 1BOTO
chains in the Genus database with same CATH superfamily
4XH5A 3NVMA 3C94A 3PSIA 4JI2K 4CF2A 3VQBA 4KREA 5AZIB 2KKZA 4CIFA 4FXDA 3AVFA 3IMXA 3IRXA 3KWGA 4CJ4A 1MU2A 4R5PA 1TUUA 1T05A 5ELZA 4CZKA 1LWCA 1C0MA 2QW9A 3WXLA 4FWPA 1C1AA 3LDOA 5AQXA 1VSFA 4DV0K 3V6DA 4BROA 4F3TA 3OY9A 3ZYYX 4GVEA 1FKPA 3OW2M 2Q0UA 3NF7A 3VQ8A 3H3NO 2QWPA 1IG9A 2F8SA 2JWLA 2RHKA 4KTWA 1DTTA 3KWIA 1ZBUA 4WQ5A 3SI6A 5AQJA 4LSLA 1RBSA 4ID5A 4BRQA 1YUWA 5E26A 3CFPA 1T8EA 4GKKK 5J2QA 2YI1A 3BF3A 3OYDA 2DFHA 5HRNA 4MLHA 1ESVA 2YHYA 4YOWA 2E6MA 3CJ1A 3KKRA 4IDKA 4A2BA 2RPIA 3CC2N 4JKDA 3PX0A 4PHTX 4WFAL 3DXKB 1XNRK 4UQGA 3D0PA 4B1YB 4XIUA 3LDLA 3NDKA 3WEEA 1BU6O 5EX5A 4OPJA 1JL2A 1SL2A 1BL3A 3WNFA 2E4LA 4F2SA 2P9PB 4DR7K 5LMNK 1W9HA 3SYZA 1S1XA 3CHWA 4DLEA 1WOQA 3LL3A 5J1EA 3LAKA 1VQ6N 3O3GA 4DU1A 3VEWA 3OS1A 3AVKA 4JI0K 4KH4A 5C24A 1ZBHA 3NGIA 2YJEA 2P9NA 3AGRA 4IBNA 4OO1J 1QSYA 1NGDA 2KLAA 4C8MA 1JCEA 1U47A 1S6QA 4FOIA 3ZETB 1J6ZA 3VA3A 2ZJQL 4PY5A 3H6EA 4Z4FA 1BO5O 3O9RA 2A1SA 1ZBFA 3FR0A 3GL1A 5CZ1A 1ZYQA 4JHDB 4IXCA 2NRZA 4CJSA 4JNEA 3JAMO 1VQMN 3KLFA 5KI6A 4B08A 3AVIA 2QWRA 4NCBA 1NK6A 2IVOA 3K5NA 1YIJN 1NK5A 4CZEA 3O9SA 4RW4A 1LOTB 2ETJA 2BGGA 3M1FA 5F2RA 1J5EK 2Q1NA 2YHWA 3RWUA 2O8EA 1XWLA 3HL8A 2DPNA 3IKMA 1YAGA 3VOVA 1E3MA 3D2EA 4IZ9A 2G8IA 2P9UB 5AQVA 1KC8O 4I9LA 5JVHL 4PQUA 2O8FA 3IDHA 2FBYA 5HRPA 1KTQA 1NLVA 3ZX2A 1RTJA 3DRPA 2HSTA 3NAEA 4JI4K 3O1BA 4BR0A 4LD0A 1C0TA 1RCHA 4FK0A 3KLIA 3SPZA 5I42A 4M3UA 1Z05A 5CR4A 1YHQN 2FBTA 3R6MA 3P4IA 3MECA 3QLHA 2D5RA 4IJNA 2VQFK 2UXDK 4AM6A 3V1QA 4DSJA 3HOSA 2NLXA 4W5NA 3U4LA 5DM7L 4CJKA 1NGEA 4M41A 1SKWA 4BQLA 3CQ8A 4KV8A 4ELTA 4IO9L 4H4MA 2GEMA 4R79A 2VWJA 4BRHA 1Q9XA 1MA9B 1K9MO 4OX9K 1QHTA 5GAHP 1VRTA 1K6YA 4RWTA 1EWQA 3VF2A 3RTVA 3VPZA 1HR0K 4ELUA 3ENBA 2V51B 4DV3K 4PKIA 3UKUA 4GKJK 2HW3A 3K5MA 2JLEA 3VEYA 2IDOA 1JCFA 4DU3A 2A5XA 2PYLA 3L2QA 4QOZB 3M8PA 2F96A 5D3GA 3SUNA 3PIPL 4B3SK 3SAHA 2ZGYA 4CZLA 3TTFA 4YOYA 1T6DA 4DTJA 1GLDG 5AQSA 5BREA 1IH7A 4DSKA 1GOCA 4OKKA 2ZF5O 1WUAA 2A3ZA 3TARA 2DTUA 3ZSQA 3V9UA 3SAGA 4B1ZA 4DS5A 4KFBA 1FXXA 3KHYA 3SUOA 1KCFA 3L2WA 3G10A 2DFEA 2Q31A 4DR5K 3G4SN 3CQYA 4W5RA 1OH7A 1QSSA 3G71N 1BDGA 1QQCA 1SL1A 1HNIA 1HPMA 2PZSA 5FLXO 1S3XA 5CE3A 4CJ3A 4PKGA 1S22A 1KAYA 4M7XA 4BACA 1RT3A 4DTSA 3M8SA 4KHSA 4KHQA 3NMUA 4DTRA 1RDWX 1N6QA 3VGLA 1HUXA 1BI4B 3O8MA 1OVQA 1X3NA 4B9SA 1U4BA 4DR1K 4L8RB 3BEXA 3ZSXA 4CD1A 3F5TA 3M8QA 1KLNA 2HBKA 4H0PA 1K73O 1X1PA 2X78A 2BDPA 1H1VA 2GX9A 1VQPN 2P5OA 1U2VB 3LDQA 2YNIA 2KZMA 3CPWM 1GLCG 4IG3A 1V4TA 2O8DA 4ZHRA 3DYAA 4FOEA 5SWMA 1REVA 4U7BA 3QNOA 2OTLN 3HPHA 4FLWA 4DKWA 4FJ7A 4IFVA 5LMUK 2O8CB 2QTDA 4AILC 2ZE2A 4Q5VA 2OZSA 4FLYA 2P9SB 1C0GA 4CZIA 2G8UA 2QK9A 3OYIA 2OCEA 3DAWA 5GAGP 3O4WA 5TKWA 4E1JA 3CFRA 3SQ2A 3LALA 1TV6A 3KK3A 1LWFA 2P9KB 1CZAN 5FPNA 4G9ZA 2XY6A 1A5WA 4CFAA 4DV6K 5AQFA 5KPTA 3CCEN 3BP8A 4C1NK 2OPQA 1NGGA 1W7AA 2WBNA 2Q97A 3ZSZA 2XY7A 1YITN 2E88A 2HB5A 1N33K 4BR9A 3CCQN 4PA1A 3WUHA 4DR2K 1K8KB 4LF6K 3NCIA 1C1BA 4A2AA 5AQGA 3E9LA 4RG8A 1UWBA 1NGFA 3KD1E 2IAJA 2QM1A 5A2QO 1T03A 3CCSN 5LJVA 1ATRA 1OH8A 1NKEA 1BA0A 3CI5A 3DRRA 4BR2A 1RBVA 2Z1IA 3HXMA 1RDUA 4B3MK 2G8KA 5C15A 2QWMA 4O5FA 1S72N 2H3GX 4BRNA 5AQNA 5AJ3K 2E2QA 2QEXN 4HUEA 2W6KA 5CZ2A 1U45A 4LF8K 5J2PA 2XHBA 4FLXA 4LSNA 3FFKB 3N4PA 4BGAA 4B9QA 3TI0A 3RMDA 4JD2A 1WLJA 3A8YA 4CFCA 5BN8A 2WFBA 3OVNA 4OPHA 4F4KA 1UA1A 4BRGA 4JKBA 3RRGA 1HMVA 4WCEL 2YX6A 4CZHA 3O08A 3VGMA 4LC9B 3EE9A 2QWOA 4CBWA 5JVGL 3ULEA 1WBBA 3DXMA 1U6ZA 3K58A 1VQLN 2CGJA 1HNVA 1NJZA 4DTMA 4DTUA 3FE1A 3ZEUA 3L2RA 4EFHA 4CGFA 4YOUA 4C1NI 1GOBA 3EYZA 1EQYA 4CK3A 1NGIA 3UKRB 1JJ2M 4ISGA 4YORA 1IBLK 4ZTJA 3T19A 3P83D 4I2PA 4OPAA 3VMFB 5IT9O 3NFAA 3VTIA 4FJJA 3SNNA 4KHPK 2E2OA 2VYPA 4DTXA 4BREA 1G15A 4E89A 2A41A 3J7YP 2VGNA 5C12A 1T7PA 3CCLN 3N4QA 4LF5K 3AA5X 3K57A 3C65A 1JKHA 3AO3A 5GADP 2IC3A 3MCAB 1JLBA 3TPQA 2WONA 4ISFA 1HNZK 5AQZA 3MX2A 1WSIA 3KLHA 4IEIA 4GVMA 2IVNA 2UXBK 1HRHA 4FZZA 4H0TB 1UA0A 3U9DA 2D0CA 4WYBA 4FLUA 2KHOA 1HPZA 1WSJA 4CK2A 3OYGA 4DTNA 2QWLA 2IOCA 2FSJA 2YHXA 2Z1GA 5CHIA 5AQQA 3AVBA 4XH4A 3CF5L 1VRUA 2YHBA 3ISNC 3IAYA 2PBDA 1VQ5N 3W3DA 4CESA 3THYB 4FWNA 2OTJN 3HZ6A 2E6LA 1VSLA 4H03B 4BC2A 1T3VA 3CMAN 4DSIA 4JKFA 3L3VA 1TYQB 3VQ9A 2HNYA 4JK7A 3WXMB 3OYNA 3AO5A 3AARA 1RT7A 2WC9A 1WSEA 4CERA 1LAWA 3L2UA 4FW1A 3NF8A 1Q82O 3DLRA 1NGCA 3NVKA 3A5MC 4AHTA 5FDLA 1X3MA 4O55A 4ICLA 1TVRA 3R9PA 3RSEB 3VF4A 1HKGA 1NGAA 1B9FA 3AVAA 1Q81O 4AHSA 4AM7A 1CZBA 3VERA 1VQ7N 3EKSA 4JI5K 4Z4EA 1NOYA 1EX4A 4CJPA 1P90A 2O8BA 2CH5A 1WN7A 1Z6RA 4FO0A 3SBTA 1N8RO 3THXB 4I6MA 2GV9A 3OYEA 2ITGA 1M90O 3V9SA 4KKOA 3NHGA 4DV5K 3HM8A 1G99A 2I7PA 1R59O 4B8CA 3LANA 1VHXA 4M45A 3GDQA 1C0FA 4H5TA 3ITHA 1VAZA 1TGOA 3AO2A 1ZBIA 3C7NA 3BY5A 4GW6A 5AQTA 5FPEA 2AP1A 2I7NA 4XEIA 4DB3A 2O4IA 3WEEB 1BQNA 2ZQBA 1YF5L 3L0QA 4KHNA 2FF6A 5DMRA 2G8WA 3D6RA 3O9TA 4LH4A 5I3UA 3I33A 1I39A 3BGRA 3QFPA 3MN9A 4JS5A 5FROA 3NE6A 1N34K 1DTQA 2CH6A 4H0VB 1JL1A 2P9NB 3TANA 1NK7A 4FJ8A 4H5RA 3CM5A 3CG7A 3V9WA 2QKBA 2BE2A 3SJHA 3QMLA 4IO8A 2PYJA 3HBTA 3OTOK 1KD1O 3THWB 1T6CA 2P9LB 5C42A 3FZHA 1KFDA 1EETA 3UE5A 3OBYA 4MFBA 1GLAG 3BUZB 3KKSA 5AZIA 3SBGA 3AA4A 3ASMA 3O9UA 4E7KA 2YNHA 4DSLA 3SQ0A 4B8AB 4DR6K 4FPBA 4FWQA 4DSFA 4DFKA 4CGHA 4LF7K 4EHUA 3EZ5A 3TTCA 4IFEA 3CJAA 3L4QA 2ATQA 4WE1A 1SAZA 1KRPA 4OPKA 5K14A 3RR7A 4FZYA 3HPOA 1C6VA 2HHTA 2EWSA 4BRIA 3QEXA 3MMVA 3LP3A 1OKJA 4IDHA 2ITMA 1HQUA 3HSCA 4CIEA 3CERA 1TL3A 3OYKA 3JYTA 2VGMA 4RW8A 5HBMA 2O8FB 4OGCA 3O4NA 4DFMA 2IIRA 3ULDA 5BRHA 4YHHK 3KK2A 4BWMA 4DUZK 3EL2A 2O4GA 4B9UA 3CJ7A 1KFSA 3V1RA 5SZTA 1NK4A 4KH5A 3DLEA 4KHYA 3V9ZA 4CHOA 4CHYA 1LV5A 3EY1A 4K8ZA 4IOAL 3QB0A 1WSGA 3P31A 1ITGA 4KTZA 4JI8K 5BR8K 1NJXA 1VQ8N 3MXIA 3DXKA 3VQ7A 3PO4A 4FW2A 4H4OA 3G0ZA 3IG1A 2HHHK 1W0HA 2NRRA 4E7JA 3VF6A 4BC3A 1ASVA 5JLFA 3QNNA 4CJLA 3ZT3A 2OZMA 2D0PA 2HBLA 4MO5A 5M1OA 4BC5A 4O4GA 4HHTA 2HNZA 4LH5A 1GLJO 2HMPA 3EZWA 4K25A 1DKGD 1NKCA 2GBZA 4N47A 3MCPA 3ID6A 4FWOA 4M3YA 2ASMA 1X9MA 2Z1HA 3I0RA 5KPZA 4CIGA 1DEJA 5EXWA 2QWNA 1QQMA 3SUPA 4BRFA 3WXKA 2HF3A 3UKUB 3WNEA 1D4XA 4BDZA 2B4JA 4M3WA 4JRQA 2P9IA 4E1NA 1S1TA 1TKZA 1BQMA 4JN4A 1L3VA 2JWKA 4BQZA 4CF8A 2E20A 4CK1A 1U48A 5FPMA 4UY8O 4M7YA 4IEEA 1XQSC 1NK9A 3HP6A 3TR8A 4WQ4C 3VQAA 1KVAA 5M1FA 4NLBA 3MX5A 1RBTA 2OPPA 4FJGA 4GMJB 2JGUA 4KRFA 4O5BA 3A5LC 4HTUA 5AZJA 4CJ7A 3CC4N 5HP1A 4TSXA 4C8NA 3NF6A 2I5JA 2QA4N 5KQ8A 1HNWK 4KAZA 2HVHA 4AH9A 1J53A 3NH2A 4J2AA 3ZT2A 2YKNA 2WTUA 3H1VX 4B9TA 3ZCMA 4Y1CA 1L3TA 1OVYA 4H5VA 2W40A 4DQRA 2PAVA 4E7LA 5EVZA 3MN5A 3LDSA 5EU7A 1V4SA 4DQQA 3CCJN 3QEPA 3NH1A 3ENOA 3Q7CA 1RDAA 4FLZA 1U49A 1SZ2A 4FCYA 1LWEA 1BHLA 3L3UA 4CEZA 3QEWA 4DV7K 4B1WB 4QS8A 4DHYA 4IG0A 1E4FT 2F4VK 1NK8A 3FZFA 1QTMA 4WFNL 4DU4A 4Y0WA 4O8UA 3MXJA 4E7HA 2UUAK 2P51A 3H1QA 3O6WA 4OKJA 4YOXA 1VQ4N 4O0JA 2UUCK 2VG5A 4I2QA 3PLAA 3O3HA 2V7ZA 3SK3A 2W6LA 4BR7A 2Q3SA 4N5SA 1VQ9N 2O8DB 3C6AA 3ZLJA 3JSMA 1KSPA 4CHPA 4Z4IA 4DFJA 4BDPA 4K42A 4JKGA 4HWIA 4C8KA 1LCUA 4NLCA 4IKFA 4B3RK 3T7ZA 4RCHA 4KB1A 4BR4A 4JLHA 2OPSA 4EHTA 1JLCA 1LW2A 5HRRA 3M8RA 3HO1A 4LY7A 4E19A 4OKEA 4J2BA 1MWKA 3ATVA 3LAMA 3S3MA 4X62K 1LAVA 1TK5A 1KXPA 4GV3A 4J8FA 2D4WA 4KHUA 5KRSA 4LFAK 1J54A 1BCOA 2IS3A 1F21A 4BRPA 3RMBA 3AVNA 1I3AA 3WXIA 4KI4A 2ZJRL 3C0BA 1WBDA 4M3XA 4PL7A 2YHAA 2X6SA 3HYFA 4FJMA 5CYMA 1C0UA 2W41A 4CGDA 5B8HA 1S1UA 2YCHA 2VG7A 3KK1A 3WNHA 3LM9A 5AQLA 4M3RA 1QE1A 4N41A 2QXFA 1BA1A 4BVOA 3NBPA 3HJFA 1IO2A 5BRDA 3TAGA 1ASUA 3AAQA 3OS2A 1D5AA 3SJJA 3VQ5A 2WUSA 3VGKA 3VQPA 5BN9A 3QESA 4MDBA 4CGGA 3QDKA 1RTDA 4IOCL 1NMDA 1RT4A 3S3OA 5F0XA 4FWMA 4FWLA 4CHQA 2E1ZA 4DUYK 1CXQA 5KGXA 4IFYA 1DT9A 4J2EA 5HRSA 2HMIA 3FFIA 3S3NA 2HHXA 3OBWA 1WAFA 4RW9A 4ILJA 2KFNA 3IUCA 1S1WA 3OYJA 3CJCA 2KQ2A 3BZKA 3IFRA 5BRFA 5CYQA 4DMNA 3VQ6A 4WQ4A 1L3SA 4KH6A 3DI6A 3NGYA 2PY5A 2X74A 4JD2B 4IJAA 1TUYA 4YOTA 2VCPA 4CGIA 1XMOK 4CFBA 4HUFA 2YNFA 3O80A 2VQEK 4FVUA 3ZT1A 1EP4A 4DR3K 1NJWA 1FW6A 1ZBLA 3ZT4A 4FWKA 1Y64A 3AO4A 1BISA 5C2FA 3DXMB 1N5YA 4CBUA 4CZGA 4YY3K 4B1VA 1E4GT 4FWSA 4K43A 5JMVA 4CE9A 3CPEA 1HJRA 4LFCK 4DQ8A 3FGUA 2VWKA 4FWRA 3F9MA 1Z26A 3MEDA 5LJWA 1DGKN 2BTFA 1HJOA 1SQKA 2NRWA 1Z25A 4B9VA 4CEBA 1VK0A 4DQIA 4LF9K 1TL1A 1K8AO 3DLGA 2NUBA 1RFQA 2E2NA 4MO4A 1EWRA 1NM1A 1XC9A 5MLCQ 5C0YA 3J8AA 1RBUA 2YV0X 3QETA 3KK7A 4CJRA 1D9FA 1IKVA 5AQRA 2NRXA 4K41A 3RVCA 4FM2A 1YJWN 1I94K 3OHRA 2LSNA 4F9OA 4FJ5A 1RDDA 2HVIA 3VEVA 2OYQA 2P9KA 4QCLA 3VQDA 3SPYA 4PWDA 3LP1A 4DSEA 3LM2A 2HHUA 3KLEA 4O8KA 3HM9A 2A40A 4CHZA 4DV4K 4NCGA 5CY4A 4NYNA 2YKMA 3W0LA 3MEEA 3TSQA 3PX6A 3HRGA 1K8KA 4FJXA 3HVRA 3Q7BA 4W5OA 3LWMA 3AO1A 2UYTA 1RT2A 2NNWA 3QERA 3RRHA 3D2FA 2CGLA 3H08A 3WT0A 2ZJPL 2DY4A 5AQIA 4J2DA 2RE2A 3CYMA 4CF9A 3DMJA 2HHQA 1YJNN 3QO9A 4FK2A 1A5XA 4CD3A 3TU5A 1XHZA 4C8LA 3E01A 1YJ9N 1QZ5A 1NU0A 1FKOA 3A2FA 3TSPA 4JI7K 4DG1A 3P39A 1SUQA 1N36K 4DQSA 2FSKA 1GLBG 5BPNA 3OS0A 4BGBA 2UUBK 1B92A 1JLQA 5EOYA 2PFUA 4FVMA 4A61A 2G8FA 2B5JA 3IS9A 4DLGA 3VQEA 1IBMK 2BANA 3DOLA 5E84A 1KAXA 1NGBA 2R7YA 1HLUA 2W42A 1XNQK 4QAGA 3PSFA 3I55N 1NJYA 3S9HA 1VSKA 5C25A 3OYCA 2O8BB 2G8HA 3K9KA 4O0IA 1QQNA 1Y97A 3GOIA 4BR5A 3JXUA 3KLGA 3SAFA 4I6MB 1C1CA 1IV0A 2A42A 1NK0A 1JXEA 3SV3A 1ATSA 4FYDA 1NNEA 1Q9YA 2E1YA 4DF8A 4XH1A 3T3FA 1NG9A 2P5GA 2FBVA 1RTIA 2QI2A 3HPGA 2G8VA 4CZFA 4DTPA 3V81A 1KVBA 2ZD1A 4KHWA 1Q86O 3BZCA 2D0BA 3C7NB 4HVJA 1S9GA 4Z0UA 3L2VA 4K0KK 1SKRA 1HNXK 4JV5K 3EE8A 1NGJA 4M3ZA 1QS4A 4FLTA 2HNDA 1BWFO 3MN6A 4BRMA 4GY2B 3ZSOA 3DRSA 3NGZA 3AAPA 3EKUA 4DV1K 3QBXA 1X9WA 4M63C 5AFUA 3S41A 4H8KA 4KPYA 3M3ZA 1QVGM 5AQHA 3GE1A 5AQWA 3DLHA 1TK0A 3OYFA 3K0SA 4CI6A 1D8YA 1U04A 5LL6Z 1ILYA 4CEAA 3FZLA 1ASWA 1HX1A 2F9WA 4BE0A 1MDUB 2HBJA 1CLQA 4EIAA 1BCMA 4CJ5A 3WXJA 2YJFA 3THYA 2B6AA 4ILGB 3KVGA 2A1RA 5BPLA 1VQNN 3JS6A 4EAHD 1NWKA 4E3SA 4MLEA 1TYQA 1YI2N 1QQOA 3R3LA 3C6UA 4NB4A 1YTAA 3E9PA 2QKKA 4Q0BA 3PUFA 1TAQA 4FJHA 3QIOA 3O1WA 3UIQA 5F1XA 4CCHA 2FSNA 4H0XB 2X6NA 4FSVA 4BRKA 3J7ZO 4CF0A 1XMQK 1NJIO 3GG4A 3RSEA 3SV4A 4CJWA 1QVFM 3U3YA 1BG3A 1VQKN 1FK9A 5DK5A 2XY5A 3CM6A 3OYAA 4BVPA 2GELA 3HP9A 1GLLO 3LPUA 1DLOA 1S6PA 4JKEA 2GTDA 1NMNA 2XO7A 1BIUA 1JLGA 2ASOA 3THXA 4F3OA 1NGHA 2IVPA 1VSEA 2BUPA 1X9JA 1S1VA 3VEZA 1IKYA 3AA2A 4CEQA 4V19S 1RDCA 3TAEA 2F9TA 3CD6N 2HF4A 3EN9A 2E2PA 4O44A 3CQXA 3ENHA 3MK6A 1VSIA 4W5TA 3I56N 2HHWA 2Q2RA 4CEFA 4YNQA 1WB9A 4K8XA 2OANA 4ZTFA 4FK4A 3B6PA 2O8EB 3CJ9A 1QZ6A 4CJTA 3ID8A 3FLCO 3D2EB 3WNGA 4X66K 1YTUA 5KQDA 1YXQA 3C6HA 1SS6A 3O5BA 3K5OA 4QS9A 4CJFA 3CCUN 2DFFA 3R8EA 1HYSA 3HSTB 1XI1A 4M3TA 4NO7A 4JRPA 1W2BM 2RF2A 4OGEA 1XUPO 4PL8A 4BE2A 3KD5E 5E41A 4F8RA 1M1KO 4BDYA 4DS4A 4I7FA 2P9IB 3ZSRA 5T7BA 3VQCA 5BR9A 3B6OA 4CZMA 3THWA 2P9LA 1RTHA 4AQYK 4CZJA 2QWQA 4JAXA 5AQOA 1TKXA 4FJ9A 1WAJA 3VA0A 1TKDA 4DTOA 3J81O 1RT5A 2KFZA 1JLFA 2P9PA 4KBOA 4EZ6A 5FRNA 3AVCA 3VQQA 1YT3A 3H45C 1BOTO 2GWKA 1L5UA 3MEGA 3FZKA 4HTLA 5AQKA 3H3OB 3TTDA 1Q7YO 4CJVA 1X9SA 3OYHA 5AZJB 1VQON 1YVUA 1L3UA 1ZXOA 2HHVA 4B9NA 3A5NC 4CGJA 3ALYA 4L3QA 3V1OA 3I8BA 3U9ZA 4FPAA 4FJLA 4YOVA 3QBWA 3OJUA 5ADXH 3AA3A 3SLCA 3ZETA 3SCXA 5HLFA 4Z4GA 4H5NA 4KTQA 4B1XB 4OVLA 3CMEN 3OA9A 2FBXA 4OLAA 1KLMA 3U8XA 4KI6A 2V7YA 4JHDA 5AQUA 1OH5A 3P1GA 1WNSA 5M1QA 1MWMA 4BY9C 2ASPA 1EO1A 4GNIA 3O4QA 4H5WA 4CJQA 1IKXA 3L8BA 3RMCA 1OH6A 4CEEA 1XHXA 1A5VA 3ZX3A 3HOTA 2XY8A 3VQ4A 3LP0A 3LP2A 1IG8A 3V4IA 4FM0A 3DLLL 1GLEG 4B1UB 4CJUA 2RN2A 2AJQA 3VESA 3HK2A 4A57A 5BPMA 2ZM6K 5AQYA 4CJEA 1SL0A 3CETA 3M5RA 3PX4A 2P9UA 4PKHA 4KB0A 3CC7N 4N56A 1O13A 5TKYA 1O1WA 2VG6A 3THVA 4AHCA 1SKSA 2YNGA 4A59A 4CVNE 1IKWA 3NF9A 3DOKA 3E66A 1HKBA 1TAUA 3OYMA 4JKGB 1VSHA 4EP5A 5M1PA 4BG9A 1J9AA 4AF1A 4E1MA 4DQPA 2HHSA 2Y1IA 3KTQA 2A6AA 3U6FA 4WFBL 3B8AX 4BE1A 1NKBA 3SZ2A 4IOXA 2HBMA 3CCRN 4GV9A 2Q36A 2OPRA 4CW7B 4CHNA 3MWTA 4DCHA 4B9LA 4U67L 1RT1A 1CXUA 3AVHA 3AVLA 3SMPA 2NRVA 3AY9A 3VETA 2ZWHA 3ZX0A 4RTFD 4FLVA 3KIOA 4NXMK 3EO3A 3MWPA 1B9DA 5IWAK 4W5QA 4MDAA 1JXBA 1GOAA 3ZSYA 3TAPA 4DR4K 1HYVA 3TWHA 3K9JA 3F9KA 4E0DA 2NRHA 4HCBA 2VWBA 4CBXA 2F8TA 3VTHA 3OJSA 5M1NA 1BUPA 2F7TA 1BGXT 1GLFO 3WQTA 4DWIA 3CXCM 3DJCA 4DFPA 1CZ9A 4JI1K 3SMSA 3SQ4A 4BRDA 4EP4A 3AVJA 5GINA 1R0AA 1TK8A 3DLBA 5FPDA 2KTQA 4HUGA 1P8ZA 2D1KA 1EKEA 1IJJA 1JCGA 4B3OA 5I9EB 3LZJA 4B3TK 4Z4CA 4BC4A 4LF4K 4FL9A 3TABA 4JI3K 5LY3A 3UB5A 1RNHA 2BH1A 4QS7A 3VN5A 3J80O 2D0OA 3BF1A 3KJVA 1KAZA 3HTVA 4BRLA 3P5JA 3LPTA 2E8AA 5AFUH 3P38A 4X64K 3K59A 4Z4HA 1YVNA 4OLBA 1RBRA 3G25A 4IWVA 1VSJA 3ZSWA 3A5OC 4JK8A 1UOCA 3AVMA 3DLKA 1D9DA 1BI4A 2FC0A 3O9QA 4RW6A 4H0OA 2E5LK 3TAFA 3VEOA 3O3FA 3C95A 2FF3B 5FRMA 3V9XA 4B9MA 5ADXA 1ZBSA 1U2VA 4A5BA 4AHVA 5J2MA 3ULEB 3LDNA 1HYZA 1RDBA 3LZIA 3MAQA 3T1HK 3PIOL 5HL7L 2EX3A 5KRTA 2UU9K 1S5JA 3ZEUB 5J2NA 4YDUC 2D0AA 4EZ9A 3CIPA 4NCAA 3R1XA 1KVCA 2V52B 1Q8IA 3TAQA 2RKIA 4BWJA 2O8CA 1RT6A 1HQEA 4AHRA 5KTQA 3AVGA 2QXLA 3QIPA 4JK9A 5KGWA 2IGIA 3ATUA 2P9SA 3U3GA 1IBKK 4CEOA 3D2FB 1QSLA 4ISEA 3GBTA 4FM1A 4FJKA 4CECA 4OJRA 1LW0A 5JS1A 5GAEP 3NH0A 4FJNA 1XC3A 4X65K 1S9EA 5GIPA 5C2DA 3D7EO 1BIZA 4CFDA 3E9OA 2FLOA 3T1AA 1N32K 3F2KA 4YFUA 3T1YK 3TSUA 4FJIA 5JS2A 4F2RA 4WQ5C 4Y1DA 4ID1A 5KPRA 1J5OA 1VSMA 4N76A 3D45A 4JYAK 5AR0A 3SUQA 4JS4A 4CEDA 3QICA 3AGKA 1HKCA 3RMAA 1WSHA 3WQUA 4HCCA 4BRAA 1ZC6A 3ZT0A 3QEIA 4JKAA 3CCMN 3QFUA 3PV8A 1FJGK 1T44A 4A5AA 5GIOA 3TAMA 3CJBA 2CGKA 3J7AP 2WOMA 2Y1JA 1TKTA 3I0SA 3SQ1A 3RR8A 4H0YB 2Z1JA 3FZMA 3MN7A 2OA8A 2J4RA 2GWJA 3F73A 1W97L 4MQ3A 5AQPA 3MXMA 5HOOA 1VSDA 5HROA 4BRCA 4PUOA 3K2PA 2KZZA 2FXUA 5M1KA 4C8OA 3HI0A 4CF1A 4Z94A 5C10A 2HOEA 1WSFA 2EHGA 4M42A 3L4IA 3ZSVA 1EXQA 4BG8A 1ATNA 3T69A 3CFOA 3BDPA 3OYLA 4AHUA 4JKHA 2XRIA 3UKRA 4WF9L 3HVTA 3KZBA 4NYFA 2NRTA 3G6EN 2GUIA 2ZGZA 4FZXC 4JKCA 5H1SQ 3K5LA 3H46O 3VENA 4RW7A 3QEVA 3VEXA 3DWLA 2UXCK 1JLEA 3AV9A 4E7IA 4G1QA 3MDQA 4ELVA 1NOZA 3DM2A 4JI6K 2Q0RA 5JICA 4I9QA 1SV5A 4DF4A 1UAXA 3HT3A 3C6TA 1RILA 3QINA 4C23A 2GUPA 3LDPA 3OYBA 2NZTA 2AA4A 4A62A 4DV2K 2P1JA 1JLAA 1NBWA 1QHAA 4KO0A 5JLHA 4GV6A 3I8DA 3LWLA 4JEPA 3PY8A 1KQSM 4YDUA 3M6GA 4ILHA 3E1YA 4NXNK 4LFBK 3PO5A 5DM6L 3A0IX 5AQMA 3L6QA 1RGIA 1Q18A 2KW4A 3EEQA 5EY4A 3CCVN
chains in the Genus database with same CATH topology
2GWKA 4XH5A 4CZHA 4EHTA 3FZKA 3NVMA 3O08A 4HTLA 3VGMA 5AQKA 3H3OB 3TTDA 1Q7YO 4LC9B 3EE9A 1MWKA 3ATVA 2QWOA 5AZJB 1VQON 4CBWA 5JVGL 3ULEA 5AZIB 2KKZA 1ZXOA 1U6ZA 3DXMA 1VQLN 2CGJA 3A5NC 3IMXA 1KXPA 4GV3A 4J8FA 3KWGA 2D4WA 3FE1A 1TUUA 3ZEUA 4L3QA 3I8BA 5ELZA 3U9ZA 4FPAA 4CZKA 3QBWA 4BRPA 4EFHA 4YOVA 4YOUA 4C1NI 3WXIA 5ADXH 2QW9A 2ZJRL 3C0BA 3WXLA 3SLCA 1EQYA 3ZETA 4PL7A 1NGIA 4FWPA 4H5NA 3UKRB 1JJ2M 4B1XB 3LDOA 4ISGA 4YORA 3CMEN 3OA9A 5AQXA 3U8XA 2W41A 4BROA 2V7YA 4JHDA 4OPAA 5B8HA 3VMFB 5AQUA 3ZYYX 4GVEA 2YCHA 5M1QA 1MWMA 3VTIA 4BY9C 2ASPA 1EO1A 2E2OA 2VYPA 4GNIA 3LM9A 5AQLA 4BREA 3OW2M 2Q0UA 4H5WA 2A41A 2VGNA 3H3NO 1BA1A 2QWPA 5C12A 4BVOA 2JWLA 2RHKA 3CCLN 3N4QA 3C65A 3ZX3A 5BRDA 3KWIA 3HOTA 4WQ5A 3AAQA 5AQJA 5GADP 1IG8A 4BRQA 1YUWA 3MCAB 5E26A 3TPQA 4ISFA 2WUSA 5AQZA 3VGKA 5BN9A 3MX2A 2YI1A 3QDKA 4MDBA 3DLLL 3BF3A 1GLEG 4IEIA 4IOCL 1NMDA 4B1UB 2IVNA 5F0XA 4FWMA 4MLHA 4FWLA 2E1ZA 1ESVA 3VESA 4A57A 5BPMA 2YHYA 1DT9A 5AQYA 4YOWA 3CETA 3M5RA 2P9UA 4H0TB 3CJ1A 4PKHA 3U9DA 3OBWA 4WYBA 4A2BA 3CC7N 3CC2N 4ILJA 4JKDA 4PHTX 1O13A 3DXKB 3IUCA 2KHOA 5TKYA 4WFAL 3CJCA 4B1YB 4A59A 3LDLA 3IFRA 5BRFA 2QWLA 3WEEA 1BU6O 2FSJA 3E66A 4WQ4A 4KH6A 1HKBA 5EX5A 2YHXA 5CHIA 4JKGB 5AQQA 2P9PB 4JD2B 4XH4A 3CF5L 4IJAA 1TUYA 4YOTA 3CHWA 5M1PA 2PBDA 2VCPA 3W3DA 4BG9A 1VQ5N 4AF1A 1WOQA 4FWNA 3LL3A 3O80A 2A6AA 2OTJN 1VQ6N 3HZ6A 4FVUA 4WFBL 3B8AX 3VEWA 4H03B 4BC2A 1T3VA 4KH4A 4IOXA 3CMAN 2HBMA 4FWKA 2YJEA 4JKFA 1Y64A 2P9NA 5C2FA 1TYQB 3CCRN 4GV9A 2Q36A 3AGRA 3DXMB 4CBUA 3MWTA 4CZGA 4OO1J 4DCHA 4B1VA 1E4GT 1NGDA 2KLAA 4JK7A 3WXMB 4FWSA 4K43A 5JMVA 4U67L 3AARA 3CPEA 1JCEA 2WC9A 4DQ8A 3FGUA 4FWRA 3F9MA 4FOIA 5LJWA 1DGKN 2BTFA 3ZETB 1J6ZA 1HJOA 1SQKA 2NRWA 1Q82O 2ZJQL 1NGCA 3H6EA 3NVKA 3A5MC 3SMPA 1BO5O 2NRVA 3AY9A 3O9RA 3VETA 1X3MA 2ZWHA 3FR0A 3GL1A 4RTFD 3ZX0A 4JHDB 1K8AO 3R9PA 4IXCA 3RSEB 2NRZA 3VF4A 4JNEA 1RFQA 1HKGA 2E2NA 3EO3A 1VQMN 1NGAA 4MO4A 1Q81O 3MWPA 4AM7A 4MDAA 1NM1A 3VERA 1VQ7N 3EKSA 2QWRA 5MLCQ 5C0YA 3J8AA 1P90A 3KK7A 2CH5A 3K9JA 2IVOA 5AQRA 1Z6RA 2NRXA 4FO0A 4K41A 3RVCA 3SBTA 1YIJN 1YJWN 3OHRA 1N8RO 2NRHA 4CZEA 4F9OA 3O9SA 1LOTB 3VEVA 2P9KA 2VWBA 4I6MA 3M1FA 5F2RA 4CBXA 1M90O 2Q1NA 2YHWA 3VTHA 5M1NA 2DPNA 1BUPA 2F7TA 3HM8A 3IKMA 1YAGA 3LM2A 3VOVA 1G99A 1GLFO 3D2EA 3WQTA 2I7PA 3CXCM 4IZ9A 1R59O 3DJCA 4O8KA 3CCVN 2A40A 3SMSA 2P9UB 5AQVA 1KC8O 5JVHL 3GDQA 4BRDA 1C0FA 3IDHA 4H5TA 3TSQA 3W0LA 1VAZA 1NLVA 5GINA 3HRGA 3C7NA 1K8KA 3ZX2A 5FPDA 2HSTA 1P8ZA 2D1KA 3Q7BA 5AQTA 5FPEA 2AP1A 1IJJA 2I7NA 4XEIA 4DB3A 3O1BA 3WEEB 1JCGA 4BR0A 2UYTA 2NNWA 1YF5L 3L0QA 5I9EB 3D2FA 4BC4A 2FF6A 2CGLA 1Z05A 5CR4A 3WT0A 3D6RA 3O9TA 2ZJPL 3I33A 4FL9A 5AQIA 5LY3A 1YHQN 3QFPA 3R6MA 3P4IA 2RE2A 3MN9A 3UB5A 4IJNA 4AM6A 1YJNN 2BH1A 4QS7A 3HOSA 2NLXA 3U4LA 2CH6A 4CD3A 3TU5A 2D0OA 4H0VB 2P9NB 3BF1A 5DM7L 1YJ9N 1NGEA 1QZ5A 3TSPA 1KAZA 3HTVA 4BRLA 3P39A 4BQLA 4H5RA 2E8AA 2FSKA 5AFUH 4IO9L 3P38A 2GEMA 4R79A 1GLBG 3SJHA 5BPNA 3QMLA 4BGBA 4IO8A 1YVNA 5EOYA 2PFUA 4BRHA 3G25A 3HBTA 4A61A 1MA9B 4IWVA 1KD1O 1T6CA 2P9LB 1K9MO 3A5OC 4JK8A 3FZHA 5GAHP 3UE5A 3OBYA 4RWTA 5E84A 1KAXA 1GLAG 3O9QA 1NGBA 3BUZB 5AZIA 3SBGA 1HLUA 4H0OA 3VF2A 3O9UA 3VEOA 3VPZA 2FF3B 3I55N 3ENBA 2V51B 4PKIA 3UKUA 4FPBA 4FWQA 4EHUA 3K9KA 3TTCA 4IFEA 3CJAA 3L4QA 3VEYA 1JCFA 1QQNA 5ADXA 1ZBSA 3GOIA 1SAZA 4BR5A 1U2VA 4A5BA 2A5XA 3JXUA 3SAFA 4I6MB 2A42A 3LDNA 3ULEB 1ATSA 2E1YA 3PIOL 2EWSA 4XH1A 5HL7L 4BRIA 3MMVA 4IDHA 1OKJA 2QI2A 2ITMA 3HSCA 3CERA 3ZEUB 4YDUC 4CZFA 3CIPA 3R1XA 2VGMA 1Q86O 3PIPL 3SAHA 2V52B 2ZGYA 3TTFA 4CZLA 4YOYA 1T6DA 1GLDG 5AQSA 5BREA 2IIRA 3C7NB 5BRHA 2ZF5O 1WUAA 2A3ZA 3EL2A 3EE8A 1NGJA 2QXLA 3CJ7A 4JK9A 4KH5A 3ATUA 1BWFO 3MN6A 2P9SA 4GY2B 4BRMA 3SAGA 4B1ZA 3D2FB 4IOAL 3QB0A 3AAPA 3EKUA 3KHYA 4ISEA 3QBXA 3P31A 4M63C 5AFUA 3S41A 3GBTA 3M3ZA 1QVGM 2Q31A 5AQHA 3G4SN 5GAEP 3GE1A 1VQ8N 5AQWA 3CQYA 3DXKA 3G71N 1XC3A 1BDGA 4CI6A 5GIPA 2NRRA 1HPMA 5C2DA 3D7EO 3VF6A 1ILYA 4BC3A 5JLFA 1S3XA 3FZLA 3E9OA 5CE3A 1HX1A 2D0PA 2F9WA 2FLOA 2HBLA 4MO5A 5M1OA 1MDUB 4BC5A 2HBJA 4EIAA 4PKGA 1S22A 1KAYA 2YJFA 4M7XA 3WXJA 1GLJO 3F2KA 4ILGB 2HMPA 3NMUA 3EZWA 3KVGA 4K25A 1DKGD 3TSUA 5BPLA 1RDWX 3MCPA 3VGLA 3JS6A 1HUXA 3ID6A 4FWOA 1VQNN 4EAHD 2ASMA 1NWKA 4WQ5C 4MLEA 5KPRA 1TYQA 5KPZA 3O8MA 1YI2N 1QQOA 3R3LA 1DEJA 4NB4A 1X3NA 2QWNA 1QQMA 5EXWA 3E9PA 5AR0A 4BRFA 3WXKA 2HF3A 3UKUB 1D4XA 3QICA 3AGKA 3O1WA 1HKCA 3BEXA 4CD1A 2P9IA 3F5TA 5F1XA 3WQUA 2FSNA 2HBKA 4H0PA 4H0XB 1K73O 4BRAA 1H1VA 1ZC6A 2GX9A 4FSVA 1VQPN 1U2VB 4JN4A 4BRKA 3J7ZO 2JWKA 4BQZA 4JKAA 3LDQA 2E20A 3CCMN 1NJIO 3CPWM 1GLCG 3GG4A 1V4TA 3QFUA 5FPMA 3RSEA 1T44A 4UY8O 4FOEA 4A5AA 1QVFM 5GIOA 4M7YA 1BG3A 4IEEA 1VQKN 3CJBA 2CGKA 1XQSC 4U7BA 4WQ4C 4BVPA 2GELA 4H0YB 1GLLO 2OTLN 3FZMA 3MN7A 5M1FA 4JKEA 2J4RA 3MX5A 2GWJA 2GTDA 1W97L 4NLBA 5AQPA 4DKWA 5HOOA 4BRCA 2ASOA 3A5LC 2QTDA 1NGHA 2FXUA 5AZJA 5M1KA 2IVPA 4CJ7A 2BUPA 1X9JA 3HI0A 3CC4N 4Z94A 3VEZA 5C10A 2P9SB 2HOEA 2QA4N 5KQ8A 1C0GA 4CZIA 3L4IA 2F9TA 3CD6N 2HF4A 3EN9A 4BG8A 2E2PA 1ATNA 3T69A 3CQXA 3ENHA 3DAWA 3MK6A 5GAGP 3H1VX 3I56N 3O4WA 5TKWA 4JKHA 4E1JA 1OVYA 2Q2RA 2W40A 4H5VA 2PAVA 3UKRA 4WF9L 3KZBA 2OANA 2P9KB 1CZAN 2NRTA 3MN5A 5EVZA 5FPNA 3G6EN 4G9ZA 3CJ9A 1QZ6A 2ZGZA 4JKCA 5H1SQ 1V4SA 5AQFA 3ID8A 3CCJN 5KPTA 3H46O 3CCEN 3BP8A 3ENOA 3Q7CA 4C1NK 1NGGA 3FLCO 3D2EB 3VENA 2WBNA 1SZ2A 3VEXA 2Q97A 3DWLA 5KQDA 1YXQA 3C6HA 1SS6A 3O5BA 1YITN 2E88A 4B1WB 3MDQA 4BR9A 4QS8A 4QS9A 3WUHA 3CCQN 3CCUN 1K8KB 4DHYA 3R8EA 1E4FT 2Q0RA 4A2AA 5AQGA 3FZFA 4NO7A 5JICA 4WFNL 3E9LA 4Y0WA 4O8UA 1W2BM 1NGFA 2QM1A 3H1QA 3O6WA 4C23A 3CCSN 1XUPO 2GUPA 5LJVA 1ATRA 4PL8A 3LDPA 4YOXA 1BA0A 3CI5A 1VQ4N 1M1KO 2NZTA 2P9IB 2AA4A 4BR2A 4A62A 3PLAA 1RDUA 3H45C 5BR9A 5C15A 4CZMA 2P9LA 2V7ZA 2QWMA 1NBWA 4O5FA 1S72N 1QHAA 2H3GX 3SK3A 5AQNA 4BRNA 2E2QA 4BR7A 5JLHA 4CZJA 2QEXN 4GV6A 2QWQA 1VQ9N 4JAXA 3C6AA 4JEPA 5AQOA 1KQSM 4YDUA 3FFKB 3M6GA 4ILHA 3E1YA 3N4PA 4HWIA 4JKGA 1LCUA 4K42A 4NLCA 4BGAA 4B9QA 2P9PA 4JD2A 4KBOA 3A0IX 5DM6L 5AQMA 3A8YA 3L6QA 3T7ZA 4RCHA 5BN8A 2WFBA 1RGIA 4OPHA 4BR4A 1Q18A 4BRGA 4JKBA 5EY4A 1BOTO 4WCEL 2YX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GWK A;  4XH5 A;  4CZH A;  4EHT A;  3FZK A;  3O08 A;  3VGM A;  4HTL A;  5AQK A;  3H3O B;  4LC9 B;  5AZJ B;  1MWK A;  3ATV A;  2QWO A;  4CBW A;  3ULE A;  5AZI B;  1ZXO A;  1U6Z A;  3DXM A;  2CGJ A;  3A5N C;  3IMX A;  1KXP A;  4J8F A;  2D4W A;  3FE1 A;  1TUU A;  3ZEU A;  4L3Q A;  3I8B A;  5ELZ A;  3U9Z A;  4FPA A;  4CZK A;  3QBW A;  4BRP A;  4EFH A;  3WXI A;  5ADX H;  2QW9 A;  3C0B A;  3WXL A;  3SLC A;  1EQY A;  3ZET A;  4PL7 A;  1NGI A;  4FWP A;  4H5N A;  3UKR B;  4B1X B;  3LDO A;  4ISG A;  5AQX A;  3U8X A;  2W41 A;  4BRO A;  2V7Y A;  4JHD A;  5B8H A;  5AQU A;  2YCH A;  1MWM A;  2ASP A;  2E2O A;  2VYP A;  4GNI A;  3LM9 A;  5AQL A;  4BRE A;  2Q0U A;  4H5W A;  2A41 A;  3H3N O;  1BA1 A;  2QWP A;  4BVO A;  3ZX3 A;  5BRD A;  4WQ5 A;  3AAQ A;  5AQJ A;  1IG8 A;  4BRQ A;  1YUW A;  5E26 A;  3TPQ A;  4ISF A;  2WUS A;  5AQZ A;  3VGK A;  5BN9 A;  2YI1 A;  3QDK A;  3BF3 A;  1GLE G;  1NMD A;  4B1U B;  2IVN A;  5F0X A;  4FWM A;  4MLH A;  4FWL A;  2E1Z A;  1ESV A;  3VES A;  5BPM A;  2YHY A;  5AQY A;  3CET A;  2P9U A;  4H0T B;  3CJ1 A;  4PKH A;  3U9D A;  4WYB A;  4A2B A;  3IUC A;  3DXK B;  5TKY A;  2KHO A;  3CJC A;  4B1Y B;  3LDL A;  3IFR A;  5BRF A;  2QWL A;  3WEE A;  1BU6 O;  2FSJ A;  4WQ4 A;  5EX5 A;  1HKB A;  2YHX A;  5AQQ A;  2P9P B;  4JD2 B;  4XH4 A;  4IJA A;  1TUY A;  3CHW A;  4BG9 A;  2PBD A;  2VCP A;  3W3D A;  1WOQ A;  4FWN A;  3LL3 A;  3O80 A;  2A6A A;  3HZ6 A;  3B8A X;  3VEW A;  4H03 B;  4BC2 A;  4FWK A;  2YJE A;  1Y64 A;  2P9N A;  1TYQ B;  2Q36 A;  3DXM B;  4CBU A;  4CZG A;  4DCH A;  4B1V A;  1E4G T;  1NGD A;  4FWS A;  4K43 A;  5JMV A;  3AAR A;  1JCE A;  4DQ8 A;  3FGU A;  4FWR A;  3F9M A;  4FOI A;  5LJW A;  1DGK N;  2BTF A;  3ZET B;  1J6Z A;  1HJO A;  1SQK A;  1NGC A;  3H6E A;  3A5M C;  3SMP A;  1BO5 O;  3AY9 A;  3VET A;  3FR0 A;  1X3M A;  2ZWH A;  3GL1 A;  4RTF D;  3ZX0 A;  4JHD B;  3R9P A;  4IXC A;  3RSE B;  3VF4 A;  4JNE A;  1RFQ A;  1HKG A;  2E2N A;  3EO3 A;  1NGA A;  4MO4 A;  4AM7 A;  1NM1 A;  3VER A;  3EKS A;  2QWR A;  3J8A A;  2CH5 A;  2IVO A;  5AQR A;  1Z6R A;  4FO0 A;  4K41 A;  3OHR A;  2NRH A;  4CZE A;  4F9O A;  1LOT B;  3VEV A;  2P9K A;  2VWB A;  4I6M A;  3M1F A;  5F2R A;  4CBX A;  2Q1N A;  2YHW A;  2DPN A;  1BUP A;  3HM8 A;  3VOV A;  1YAG A;  3LM2 A;  1G99 A;  1GLF O;  3D2E A;  3WQT A;  2I7P A;  4IZ9 A;  1R59 O;  3DJC A;  4O8K A;  2A40 A;  3SMS A;  2P9U B;  5AQV A;  3GDQ A;  4BRD A;  1C0F A;  3IDH A;  4H5T A;  3W0L A;  1NLV A;  3C7N A;  1K8K A;  3ZX2 A;  5FPD A;  1P8Z A;  2D1K A;  5AQT A;  5FPE A;  2AP1 A;  1IJJ A;  2I7N A;  4XEI A;  4DB3 A;  3O1B A;  3WEE B;  1JCG A;  4BR0 A;  2UYT A;  3L0Q A;  5I9E B;  3D2F A;  4BC4 A;  2FF6 A;  2CGL A;  1Z05 A;  3WT0 A;  3I33 A;  4FL9 A;  5AQI A;  5LY3 A;  3QFP A;  3R6M A;  3P4I A;  3MN9 A;  3UB5 A;  4IJN A;  4AM6 A;  4QS7 A;  2NLX A;  3U4L A;  2CH6 A;  4CD3 A;  3TU5 A;  2D0O A;  4H0V B;  2P9N B;  3BF1 A;  1NGE A;  1QZ5 A;  1KAZ A;  3HTV A;  4BRL A;  4BQL A;  4H5R A;  2E8A A;  2FSK A;  5AFU H;  2GEM A;  1GLB G;  3SJH A;  5BPN A;  3QML A;  4BGB A;  4IO8 A;  1YVN A;  5EOY A;  4BRH A;  3G25 A;  3HBT A;  4A61 A;  1MA9 B;  4IWV A;  1T6C A;  2P9L B;  3A5O C;  3FZH A;  3UE5 A;  4RWT A;  5E84 A;  1KAX A;  1GLA G;  1NGB A;  3BUZ B;  5AZI A;  1HLU A;  4H0O A;  3VF2 A;  3VEO A;  3VPZ A;  2FF3 B;  2V51 B;  4PKI A;  3UKU A;  4FPB A;  4FWQ A;  4EHU A;  3CJA A;  3VEY A;  1JCF A;  1QQN A;  5ADX A;  1ZBS A;  3GOI A;  1SAZ A;  4BR5 A;  1U2V A;  2A5X A;  3JXU A;  4I6M B;  2A42 A;  3LDN A;  3ULE B;  1ATS A;  2E1Y A;  2EWS A;  4XH1 A;  4BRI A;  3MMV A;  2ITM A;  1OKJ A;  3HSC A;  3CER A;  3ZEU B;  4YDU C;  4CZF A;  3CIP A;  2V52 B;  2ZGY A;  4CZL A;  1T6D A;  1GLD G;  5AQS A;  5BRE A;  2IIR A;  3C7N B;  5BRH A;  2ZF5 O;  1WUA A;  2A3Z A;  3EL2 A;  1NGJ A;  2QXL A;  3CJ7 A;  3ATU A;  1BWF O;  3MN6 A;  2P9S A;  4GY2 B;  4BRM A;  4B1Z A;  3D2F B;  3QB0 A;  3AAP A;  3EKU A;  3KHY A;  4ISE A;  3QBX A;  4M63 C;  5AFU A;  3S41 A;  3GBT A;  3M3Z A;  2Q31 A;  5AQH A;  3GE1 A;  5AQW A;  3CQY A;  3DXK A;  1XC3 A;  1BDG A;  4CI6 A;  1HPM A;  3D7E O;  3VF6 A;  4BC3 A;  5JLF A;  1S3X A;  3FZL A;  5CE3 A;  1HX1 A;  2D0P A;  2F9W A;  2FLO A;  4MO5 A;  4BC5 A;  1MDU B;  4EIA A;  4PKG A;  1S22 A;  1KAY A;  2YJF A;  4M7X A;  3WXJ A;  1GLJ O;  2HMP A;  3EZW A;  3KVG A;  4K25 A;  1DKG D;  5BPL A;  1RDW X;  3MCP A;  3VGL A;  3JS6 A;  1HUX A;  4FWO A;  4EAH D;  2ASM A;  1NWK A;  4WQ5 C;  4MLE A;  5KPR A;  1TYQ A;  5KPZ A;  3O8M A;  1QQO A;  1DEJ A;  4NB4 A;  1X3N A;  2QWN A;  1QQM A;  5EXW A;  5AR0 A;  4BRF A;  3WXK A;  2HF3 A;  3UKU B;  1D4X A;  3QIC A;  3O1W A;  1HKC A;  3BEX A;  4CD1 A;  2P9I A;  5F1X A;  3WQU A;  2FSN A;  4H0P A;  4H0X B;  4BRA A;  1H1V A;  1ZC6 A;  4FSV A;  1U2V B;  4JN4 A;  4BRK A;  4BQZ A;  3LDQ A;  2E20 A;  1GLC G;  3GG4 A;  1V4T A;  3QFU A;  5FPM A;  3RSE A;  1T44 A;  4FOE A;  4M7Y A;  1BG3 A;  3CJB A;  2CGK A;  1XQS C;  4WQ4 C;  4BVP A;  2GEL A;  4H0Y B;  1GLL O;  3FZM A;  3MN7 A;  2J4R A;  2GWJ A;  2GTD A;  5AQP A;  4BRC A;  2ASO A;  3A5L C;  1NGH A;  2FXU A;  5AZJ A;  2IVP A;  4CJ7 A;  2BUP A;  1X9J A;  3HI0 A;  4Z94 A;  3VEZ A;  2P9S B;  2HOE A;  5KQ8 A;  1C0G A;  4CZI A;  3L4I A;  2F9T A;  2HF4 A;  3EN9 A;  4BG8 A;  2E2P A;  1ATN A;  3CQX A;  3ENH A;  3DAW A;  3MK6 A;  3H1V X;  3O4W A;  4E1J A;  2Q2R A;  2W40 A;  4H5V A;  2PAV A;  3UKR A;  3KZB A;  2OAN A;  2P9K B;  1CZA N;  3MN5 A;  5EVZ A;  5FPN A;  3CJ9 A;  1QZ6 A;  2ZGZ A;  1V4S A;  5AQF A;  3ID8 A;  5KPT A;  3H46 O;  3BP8 A;  3ENO A;  1NGG A;  3FLC O;  3D2E B;  3VEN A;  1SZ2 A;  3VEX A;  2Q97 A;  3DWL A;  5KQD A;  1YXQ A;  3O5B A;  2E88 A;  4B1W B;  3MDQ A;  4BR9 A;  4QS8 A;  4QS9 A;  3WUH A;  1K8K B;  4DHY A;  3R8E A;  1E4F T;  2Q0R A;  4A2A A;  5AQG A;  3FZF A;  4NO7 A;  5JIC A;  4Y0W A;  1NGF A;  2QM1 A;  3H1Q A;  3O6W A;  4C23 A;  1XUP O;  2GUP A;  5LJV A;  1ATR A;  4PL8 A;  3LDP A;  1BA0 A;  3CI5 A;  2NZT A;  2P9I B;  2AA4 A;  4BR2 A;  4A62 A;  3H45 C;  5BR9 A;  4CZM A;  2P9L A;  2V7Z A;  2QWM A;  1NBW A;  4O5F A;  1QHA A;  2H3G X;  3SK3 A;  5AQN A;  4BRN A;  2E2Q A;  4BR7 A;  5JLH A;  4CZJ A;  2QWQ A;  4JAX A;  5AQO A;  4YDU A;  3FFK B;  3M6G A;  4K42 A;  4HWI A;  4BGA A;  1LCU A;  4B9Q A;  2P9P A;  4JD2 A;  4KBO A;  3A0I X;  5AQM A;  3A8Y A;  3L6Q A;  4RCH A;  5BN8 A;  1RGI A;  4BR4 A;  1Q18 A;  4BRG A;  5EY4 A;  1BOT O; 
#chains in the Genus database with same CATH topology
 4XH5 A;  3NVM A;  3C94 A;  3PSI A;  4JI2 K;  4CF2 A;  3VQB A;  4KRE A;  5AZI B;  2KKZ A;  4CIF A;  4FXD A;  3AVF A;  3IMX A;  3IRX A;  3KWG A;  4CJ4 A;  1MU2 A;  4R5P A;  1TUU A;  1T05 A;  5ELZ A;  4CZK A;  1LWC A;  1C0M A;  2QW9 A;  3WXL A;  4FWP A;  1C1A A;  3LDO A;  5AQX A;  1VSF A;  4DV0 K;  3V6D A;  4BRO A;  4F3T A;  3OY9 A;  3ZYY X;  4GVE A;  1FKP A;  3OW2 M;  2Q0U A;  3NF7 A;  3VQ8 A;  3H3N O;  2QWP A;  1IG9 A;  2F8S A;  2JWL A;  2RHK A;  4KTW A;  1DTT A;  3KWI A;  1ZBU A;  4WQ5 A;  3SI6 A;  5AQJ A;  4LSL A;  1RBS A;  4ID5 A;  4BRQ A;  1YUW A;  5E26 A;  3CFP A;  1T8E A;  4GKK K;  5J2Q A;  2YI1 A;  3BF3 A;  3OYD A;  2DFH A;  5HRN A;  4MLH A;  1ESV A;  2YHY A;  4YOW A;  2E6M A;  3CJ1 A;  3KKR A;  4IDK A;  4A2B A;  2RPI A;  3CC2 N;  4JKD A;  3PX0 A;  4PHT X;  4WFA L;  3DXK B;  1XNR K;  4UQG A;  3D0P A;  4B1Y B;  4XIU A;  3LDL A;  3NDK A;  3WEE A;  1BU6 O;  5EX5 A;  4OPJ A;  1JL2 A;  1SL2 A;  1BL3 A;  3WNF A;  2E4L A;  4F2S A;  2P9P B;  4DR7 K;  5LMN K;  1W9H A;  3SYZ A;  1S1X A;  3CHW A;  4DLE A;  1WOQ A;  3LL3 A;  5J1E A;  3LAK A;  1VQ6 N;  3O3G A;  4DU1 A;  3VEW A;  3OS1 A;  3AVK A;  4JI0 K;  4KH4 A;  5C24 A;  1ZBH A;  3NGI A;  2YJE A;  2P9N A;  3AGR A;  4IBN A;  4OO1 J;  1QSY A;  1NGD A;  2KLA A;  4C8M A;  1JCE A;  1U47 A;  1S6Q A;  4FOI A;  3ZET B;  1J6Z A;  3VA3 A;  2ZJQ L;  4PY5 A;  3H6E A;  4Z4F A;  1BO5 O;  3O9R A;  2A1S A;  1ZBF A;  3FR0 A;  3GL1 A;  5CZ1 A;  1ZYQ A;  4JHD B;  4IXC A;  2NRZ A;  4CJS A;  4JNE A;  3JAM O;  1VQM N;  3KLF A;  5KI6 A;  4B08 A;  3AVI A;  2QWR A;  4NCB A;  1NK6 A;  2IVO A;  3K5N A;  1YIJ N;  1NK5 A;  4CZE A;  3O9S A;  4RW4 A;  1LOT B;  2ETJ A;  2BGG A;  3M1F A;  5F2R A;  1J5E K;  2Q1N A;  2YHW A;  3RWU A;  2O8E A;  1XWL A;  3HL8 A;  2DPN A;  3IKM A;  1YAG A;  3VOV A;  1E3M A;  3D2E A;  4IZ9 A;  2G8I A;  2P9U B;  5AQV A;  1KC8 O;  4I9L A;  5JVH L;  4PQU A;  2O8F A;  3IDH A;  2FBY A;  5HRP A;  1KTQ A;  1NLV A;  3ZX2 A;  1RTJ A;  3DRP A;  2HST A;  3NAE A;  4JI4 K;  3O1B A;  4BR0 A;  4LD0 A;  1C0T A;  1RCH A;  4FK0 A;  3KLI A;  3SPZ A;  5I42 A;  4M3U A;  1Z05 A;  5CR4 A;  1YHQ N;  2FBT A;  3R6M A;  3P4I A;  3MEC A;  3QLH A;  2D5R A;  4IJN A;  2VQF K;  2UXD K;  4AM6 A;  3V1Q A;  4DSJ A;  3HOS A;  2NLX A;  4W5N A;  3U4L A;  5DM7 L;  4CJK A;  1NGE A;  4M41 A;  1SKW A;  4BQL A;  3CQ8 A;  4KV8 A;  4ELT A;  4IO9 L;  4H4M A;  2GEM A;  4R79 A;  2VWJ A;  4BRH A;  1Q9X A;  1MA9 B;  1K9M O;  4OX9 K;  1QHT A;  5GAH P;  1VRT A;  1K6Y A;  4RWT A;  1EWQ A;  3VF2 A;  3RTV A;  3VPZ A;  1HR0 K;  4ELU A;  3ENB A;  2V51 B;  4DV3 K;  4PKI A;  3UKU A;  4GKJ K;  2HW3 A;  3K5M A;  2JLE A;  3VEY A;  2IDO A;  1JCF A;  4DU3 A;  2A5X A;  2PYL A;  3L2Q A;  4QOZ B;  3M8P A;  2F96 A;  5D3G A;  3SUN A;  3PIP L;  4B3S K;  3SAH A;  2ZGY A;  4CZL A;  3TTF A;  4YOY A;  1T6D A;  4DTJ A;  1GLD G;  5AQS A;  5BRE A;  1IH7 A;  4DSK A;  1GOC A;  4OKK A;  2ZF5 O;  1WUA A;  2A3Z A;  3TAR A;  2DTU A;  3ZSQ A;  3V9U A;  3SAG A;  4B1Z A;  4DS5 A;  4KFB A;  1FXX A;  3KHY A;  3SUO A;  1KCF A;  3L2W A;  3G10 A;  2DFE A;  2Q31 A;  4DR5 K;  3G4S N;  3CQY A;  4W5R A;  1OH7 A;  1QSS A;  3G71 N;  1BDG A;  1QQC A;  1SL1 A;  1HNI A;  1HPM A;  2PZS A;  5FLX O;  1S3X A;  5CE3 A;  4CJ3 A;  4PKG A;  1S22 A;  1KAY A;  4M7X A;  4BAC A;  1RT3 A;  4DTS A;  3M8S A;  4KHS A;  4KHQ A;  3NMU A;  4DTR A;  1RDW X;  1N6Q A;  3VGL A;  1HUX A;  1BI4 B;  3O8M A;  1OVQ A;  1X3N A;  4B9S A;  1U4B A;  4DR1 K;  4L8R B;  3BEX A;  3ZSX A;  4CD1 A;  3F5T A;  3M8Q A;  1KLN A;  2HBK A;  4H0P A;  1K73 O;  1X1P A;  2X78 A;  2BDP A;  1H1V A;  2GX9 A;  1VQP N;  2P5O A;  1U2V B;  3LDQ A;  2YNI A;  2KZM A;  3CPW M;  1GLC G;  4IG3 A;  1V4T A;  2O8D A;  4ZHR A;  3DYA A;  4FOE A;  5SWM A;  1REV A;  4U7B A;  3QNO A;  2OTL N;  3HPH A;  4FLW A;  4DKW A;  4FJ7 A;  4IFV A;  5LMU K;  2O8C B;  2QTD A;  4AIL C;  2ZE2 A;  4Q5V A;  2OZS A;  4FLY A;  2P9S B;  1C0G A;  4CZI A;  2G8U A;  2QK9 A;  3OYI A;  2OCE A;  3DAW A;  5GAG P;  3O4W A;  5TKW A;  4E1J A;  3CFR A;  3SQ2 A;  3LAL A;  1TV6 A;  3KK3 A;  1LWF A;  2P9K B;  1CZA N;  5FPN A;  4G9Z A;  2XY6 A;  1A5W A;  4CFA A;  4DV6 K;  5AQF A;  5KPT A;  3CCE N;  3BP8 A;  4C1N K;  2OPQ A;  1NGG A;  1W7A A;  2WBN A;  2Q97 A;  3ZSZ A;  2XY7 A;  1YIT N;  2E88 A;  2HB5 A;  1N33 K;  4BR9 A;  3CCQ N;  4PA1 A;  3WUH A;  4DR2 K;  1K8K B;  4LF6 K;  3NCI A;  1C1B A;  4A2A A;  5AQG A;  3E9L A;  4RG8 A;  1UWB A;  1NGF A;  3KD1 E;  2IAJ A;  2QM1 A;  5A2Q O;  1T03 A;  3CCS N;  5LJV A;  1ATR A;  1OH8 A;  1NKE A;  1BA0 A;  3CI5 A;  3DRR A;  4BR2 A;  1RBV A;  2Z1I A;  3HXM A;  1RDU A;  4B3M K;  2G8K A;  5C15 A;  2QWM A;  4O5F A;  1S72 N;  2H3G X;  4BRN A;  5AQN A;  5AJ3 K;  2E2Q A;  2QEX N;  4HUE A;  2W6K A;  5CZ2 A;  1U45 A;  4LF8 K;  5J2P A;  2XHB A;  4FLX A;  4LSN A;  3FFK B;  3N4P A;  4BGA A;  4B9Q A;  3TI0 A;  3RMD A;  4JD2 A;  1WLJ A;  3A8Y A;  4CFC A;  5BN8 A;  2WFB A;  3OVN A;  4OPH A;  4F4K A;  1UA1 A;  4BRG A;  4JKB A;  3RRG A;  1HMV A;  4WCE L;  2YX6 A;  4CZH A;  3O08 A;  3VGM A;  4LC9 B;  3EE9 A;  2QWO A;  4CBW A;  5JVG L;  3ULE A;  1WBB A;  3DXM A;  1U6Z A;  3K58 A;  1VQL N;  2CGJ A;  1HNV A;  1NJZ A;  4DTM A;  4DTU A;  3FE1 A;  3ZEU A;  3L2R A;  4EFH A;  4CGF A;  4YOU A;  4C1N I;  1GOB A;  3EYZ A;  1EQY A;  4CK3 A;  1NGI A;  3UKR B;  1JJ2 M;  4ISG A;  4YOR A;  1IBL K;  4ZTJ A;  3T19 A;  3P83 D;  4I2P A;  4OPA A;  3VMF B;  5IT9 O;  3NFA A;  3VTI A;  4FJJ A;  3SNN A;  4KHP K;  2E2O A;  2VYP A;  4DTX A;  4BRE A;  1G15 A;  4E89 A;  2A41 A;  3J7Y P;  2VGN A;  5C12 A;  1T7P A;  3CCL N;  3N4Q A;  4LF5 K;  3AA5 X;  3K57 A;  3C65 A;  1JKH A;  3AO3 A;  5GAD P;  2IC3 A;  3MCA B;  1JLB A;  3TPQ A;  2WON A;  4ISF A;  1HNZ K;  5AQZ A;  3MX2 A;  1WSI A;  3KLH A;  4IEI A;  4GVM A;  2IVN A;  2UXB K;  1HRH A;  4FZZ A;  4H0T B;  1UA0 A;  3U9D A;  2D0C A;  4WYB A;  4FLU A;  2KHO A;  1HPZ A;  1WSJ A;  4CK2 A;  3OYG A;  4DTN A;  2QWL A;  2IOC A;  2FSJ A;  2YHX A;  2Z1G A;  5CHI A;  5AQQ A;  3AVB A;  4XH4 A;  3CF5 L;  1VRU A;  2YHB A;  3ISN C;  3IAY A;  2PBD A;  1VQ5 N;  3W3D A;  4CES A;  3THY B;  4FWN A;  2OTJ N;  3HZ6 A;  2E6L A;  1VSL A;  4H03 B;  4BC2 A;  1T3V A;  3CMA N;  4DSI A;  4JKF A;  3L3V A;  1TYQ B;  3VQ9 A;  2HNY A;  4JK7 A;  3WXM B;  3OYN A;  3AO5 A;  3AAR A;  1RT7 A;  2WC9 A;  1WSE A;  4CER A;  1LAW A;  3L2U A;  4FW1 A;  3NF8 A;  1Q82 O;  3DLR A;  1NGC A;  3NVK A;  3A5M C;  4AHT A;  5FDL A;  1X3M A;  4O55 A;  4ICL A;  1TVR A;  3R9P A;  3RSE B;  3VF4 A;  1HKG A;  1NGA A;  1B9F A;  3AVA A;  1Q81 O;  4AHS A;  4AM7 A;  1CZB A;  3VER A;  1VQ7 N;  3EKS A;  4JI5 K;  4Z4E A;  1NOY A;  1EX4 A;  4CJP A;  1P90 A;  2O8B A;  2CH5 A;  1WN7 A;  1Z6R A;  4FO0 A;  3SBT A;  1N8R O;  3THX B;  4I6M A;  2GV9 A;  3OYE A;  2ITG A;  1M90 O;  3V9S A;  4KKO A;  3NHG A;  4DV5 K;  3HM8 A;  1G99 A;  2I7P A;  1R59 O;  4B8C A;  3LAN A;  1VHX A;  4M45 A;  3GDQ A;  1C0F A;  4H5T A;  3ITH A;  1VAZ A;  1TGO A;  3AO2 A;  1ZBI A;  3C7N A;  3BY5 A;  4GW6 A;  5AQT A;  5FPE A;  2AP1 A;  2I7N A;  4XEI A;  4DB3 A;  2O4I A;  3WEE B;  1BQN A;  2ZQB A;  1YF5 L;  3L0Q A;  4KHN A;  2FF6 A;  5DMR A;  2G8W A;  3D6R A;  3O9T A;  4LH4 A;  5I3U A;  3I33 A;  1I39 A;  3BGR A;  3QFP A;  3MN9 A;  4JS5 A;  5FRO A;  3NE6 A;  1N34 K;  1DTQ A;  2CH6 A;  4H0V B;  1JL1 A;  2P9N B;  3TAN A;  1NK7 A;  4FJ8 A;  4H5R A;  3CM5 A;  3CG7 A;  3V9W A;  2QKB A;  2BE2 A;  3SJH A;  3QML A;  4IO8 A;  2PYJ A;  3HBT A;  3OTO K;  1KD1 O;  3THW B;  1T6C A;  2P9L B;  5C42 A;  3FZH A;  1KFD A;  1EET A;  3UE5 A;  3OBY A;  4MFB A;  1GLA G;  3BUZ B;  3KKS A;  5AZI A;  3SBG A;  3AA4 A;  3ASM A;  3O9U A;  4E7K A;  2YNH A;  4DSL A;  3SQ0 A;  4B8A B;  4DR6 K;  4FPB A;  4FWQ A;  4DSF A;  4DFK A;  4CGH A;  4LF7 K;  4EHU A;  3EZ5 A;  3TTC A;  4IFE A;  3CJA A;  3L4Q A;  2ATQ A;  4WE1 A;  1SAZ A;  1KRP A;  4OPK A;  5K14 A;  3RR7 A;  4FZY A;  3HPO A;  1C6V A;  2HHT A;  2EWS A;  4BRI A;  3QEX A;  3MMV A;  3LP3 A;  1OKJ A;  4IDH A;  2ITM A;  1HQU A;  3HSC A;  4CIE A;  3CER A;  1TL3 A;  3OYK A;  3JYT A;  2VGM A;  4RW8 A;  5HBM A;  2O8F B;  4OGC A;  3O4N A;  4DFM A;  2IIR A;  3ULD A;  5BRH A;  4YHH K;  3KK2 A;  4BWM A;  4DUZ K;  3EL2 A;  2O4G A;  4B9U A;  3CJ7 A;  1KFS A;  3V1R A;  5SZT A;  1NK4 A;  4KH5 A;  3DLE A;  4KHY A;  3V9Z A;  4CHO A;  4CHY A;  1LV5 A;  3EY1 A;  4K8Z A;  4IOA L;  3QB0 A;  1WSG A;  3P31 A;  1ITG A;  4KTZ A;  4JI8 K;  5BR8 K;  1NJX A;  1VQ8 N;  3MXI A;  3DXK A;  3VQ7 A;  3PO4 A;  4FW2 A;  4H4O A;  3G0Z A;  3IG1 A;  2HHH K;  1W0H A;  2NRR A;  4E7J A;  3VF6 A;  4BC3 A;  1ASV A;  5JLF A;  3QNN A;  4CJL A;  3ZT3 A;  2OZM A;  2D0P A;  2HBL A;  4MO5 A;  5M1O A;  4BC5 A;  4O4G A;  4HHT A;  2HNZ A;  4LH5 A;  1GLJ O;  2HMP A;  3EZW A;  4K25 A;  1DKG D;  1NKC A;  2GBZ A;  4N47 A;  3MCP A;  3ID6 A;  4FWO A;  4M3Y A;  2ASM A;  1X9M A;  2Z1H A;  3I0R A;  5KPZ A;  4CIG A;  1DEJ A;  5EXW A;  2QWN A;  1QQM A;  3SUP A;  4BRF A;  3WXK A;  2HF3 A;  3UKU B;  3WNE A;  1D4X A;  4BDZ A;  2B4J A;  4M3W A;  4JRQ A;  2P9I A;  4E1N A;  1S1T A;  1TKZ A;  1BQM A;  4JN4 A;  1L3V A;  2JWK A;  4BQZ A;  4CF8 A;  2E20 A;  4CK1 A;  1U48 A;  5FPM A;  4UY8 O;  4M7Y A;  4IEE A;  1XQS C;  1NK9 A;  3HP6 A;  3TR8 A;  4WQ4 C;  3VQA A;  1KVA A;  5M1F A;  4NLB A;  3MX5 A;  1RBT A;  2OPP A;  4FJG A;  4GMJ B;  2JGU A;  4KRF A;  4O5B A;  3A5L C;  4HTU A;  5AZJ A;  4CJ7 A;  3CC4 N;  5HP1 A;  4TSX A;  4C8N A;  3NF6 A;  2I5J A;  2QA4 N;  5KQ8 A;  1HNW K;  4KAZ A;  2HVH A;  4AH9 A;  1J53 A;  3NH2 A;  4J2A A;  3ZT2 A;  2YKN A;  2WTU A;  3H1V X;  4B9T A;  3ZCM A;  4Y1C A;  1L3T A;  1OVY A;  4H5V A;  2W40 A;  4DQR A;  2PAV A;  4E7L A;  5EVZ A;  3MN5 A;  3LDS A;  5EU7 A;  1V4S A;  4DQQ A;  3CCJ N;  3QEP A;  3NH1 A;  3ENO A;  3Q7C A;  1RDA A;  4FLZ A;  1U49 A;  1SZ2 A;  4FCY A;  1LWE A;  1BHL A;  3L3U A;  4CEZ A;  3QEW A;  4DV7 K;  4B1W B;  4QS8 A;  4DHY A;  4IG0 A;  1E4F T;  2F4V K;  1NK8 A;  3FZF A;  1QTM A;  4WFN L;  4DU4 A;  4Y0W A;  4O8U A;  3MXJ A;  4E7H A;  2UUA K;  2P51 A;  3H1Q A;  3O6W A;  4OKJ A;  4YOX A;  1VQ4 N;  4O0J A;  2UUC K;  2VG5 A;  4I2Q A;  3PLA A;  3O3H A;  2V7Z A;  3SK3 A;  2W6L A;  4BR7 A;  2Q3S A;  4N5S A;  1VQ9 N;  2O8D B;  3C6A A;  3ZLJ A;  3JSM A;  1KSP A;  4CHP A;  4Z4I A;  4DFJ A;  4BDP A;  4K42 A;  4JKG A;  4HWI A;  4C8K A;  1LCU A;  4NLC A;  4IKF A;  4B3R K;  3T7Z A;  4RCH A;  4KB1 A;  4BR4 A;  4JLH A;  2OPS A;  4EHT A;  1JLC A;  1LW2 A;  5HRR A;  3M8R A;  3HO1 A;  4LY7 A;  4E19 A;  4OKE A;  4J2B A;  1MWK A;  3ATV A;  3LAM A;  3S3M A;  4X62 K;  1LAV A;  1TK5 A;  1KXP A;  4GV3 A;  4J8F A;  2D4W A;  4KHU A;  5KRS A;  4LFA K;  1J54 A;  1BCO A;  2IS3 A;  1F21 A;  4BRP A;  3RMB A;  3AVN A;  1I3A A;  3WXI A;  4KI4 A;  2ZJR L;  3C0B A;  1WBD A;  4M3X A;  4PL7 A;  2YHA A;  2X6S A;  3HYF A;  4FJM A;  5CYM A;  1C0U A;  2W41 A;  4CGD A;  5B8H A;  1S1U A;  2YCH A;  2VG7 A;  3KK1 A;  3WNH A;  3LM9 A;  5AQL A;  4M3R A;  1QE1 A;  4N41 A;  2QXF A;  1BA1 A;  4BVO A;  3NBP A;  3HJF A;  1IO2 A;  5BRD A;  3TAG A;  1ASU A;  3AAQ A;  3OS2 A;  1D5A A;  3SJJ A;  3VQ5 A;  2WUS A;  3VGK A;  3VQP A;  5BN9 A;  3QES A;  4MDB A;  4CGG A;  3QDK A;  1RTD A;  4IOC L;  1NMD A;  1RT4 A;  3S3O A;  5F0X A;  4FWM A;  4FWL A;  4CHQ A;  2E1Z A;  4DUY K;  1CXQ A;  5KGX A;  4IFY A;  1DT9 A;  4J2E A;  5HRS A;  2HMI A;  3FFI A;  3S3N A;  2HHX A;  3OBW A;  1WAF A;  4RW9 A;  4ILJ A;  2KFN A;  3IUC A;  1S1W A;  3OYJ A;  3CJC A;  2KQ2 A;  3BZK A;  3IFR A;  5BRF A;  5CYQ A;  4DMN A;  3VQ6 A;  4WQ4 A;  1L3S A;  4KH6 A;  3DI6 A;  3NGY A;  2PY5 A;  2X74 A;  4JD2 B;  4IJA A;  1TUY A;  4YOT A;  2VCP A;  4CGI A;  1XMO K;  4CFB A;  4HUF A;  2YNF A;  3O80 A;  2VQE K;  4FVU A;  3ZT1 A;  1EP4 A;  4DR3 K;  1NJW A;  1FW6 A;  1ZBL A;  3ZT4 A;  4FWK A;  1Y64 A;  3AO4 A;  1BIS A;  5C2F A;  3DXM B;  1N5Y A;  4CBU A;  4CZG A;  4YY3 K;  4B1V A;  1E4G T;  4FWS A;  4K43 A;  5JMV A;  4CE9 A;  3CPE A;  1HJR A;  4LFC K;  4DQ8 A;  3FGU A;  2VWK A;  4FWR A;  3F9M A;  1Z26 A;  3MED A;  5LJW A;  1DGK N;  2BTF A;  1HJO A;  1SQK A;  2NRW A;  1Z25 A;  4B9V A;  4CEB A;  1VK0 A;  4DQI A;  4LF9 K;  1TL1 A;  1K8A O;  3DLG A;  2NUB A;  1RFQ A;  2E2N A;  4MO4 A;  1EWR A;  1NM1 A;  1XC9 A;  5MLC Q;  5C0Y A;  3J8A A;  1RBU A;  2YV0 X;  3QET A;  3KK7 A;  4CJR A;  1D9F A;  1IKV A;  5AQR A;  2NRX A;  4K41 A;  3RVC A;  4FM2 A;  1YJW N;  1I94 K;  3OHR A;  2LSN A;  4F9O A;  4FJ5 A;  1RDD A;  2HVI A;  3VEV A;  2OYQ A;  2P9K A;  4QCL A;  3VQD A;  3SPY A;  4PWD A;  3LP1 A;  4DSE A;  3LM2 A;  2HHU A;  3KLE A;  4O8K A;  3HM9 A;  2A40 A;  4CHZ A;  4DV4 K;  4NCG A;  5CY4 A;  4NYN A;  2YKM A;  3W0L A;  3MEE A;  3TSQ A;  3PX6 A;  3HRG A;  1K8K A;  4FJX A;  3HVR A;  3Q7B A;  4W5O A;  3LWM A;  3AO1 A;  2UYT A;  1RT2 A;  2NNW A;  3QER A;  3RRH A;  3D2F A;  2CGL A;  3H08 A;  3WT0 A;  2ZJP L;  2DY4 A;  5AQI A;  4J2D A;  2RE2 A;  3CYM A;  4CF9 A;  3DMJ A;  2HHQ A;  1YJN N;  3QO9 A;  4FK2 A;  1A5X A;  4CD3 A;  3TU5 A;  1XHZ A;  4C8L A;  3E01 A;  1YJ9 N;  1QZ5 A;  1NU0 A;  1FKO A;  3A2F A;  3TSP A;  4JI7 K;  4DG1 A;  3P39 A;  1SUQ A;  1N36 K;  4DQS A;  2FSK A;  1GLB G;  5BPN A;  3OS0 A;  4BGB A;  2UUB K;  1B92 A;  1JLQ A;  5EOY A;  2PFU A;  4FVM A;  4A61 A;  2G8F A;  2B5J A;  3IS9 A;  4DLG A;  3VQE A;  1IBM K;  2BAN A;  3DOL A;  5E84 A;  1KAX A;  1NGB A;  2R7Y A;  1HLU A;  2W42 A;  1XNQ K;  4QAG A;  3PSF A;  3I55 N;  1NJY A;  3S9H A;  1VSK A;  5C25 A;  3OYC A;  2O8B B;  2G8H A;  3K9K A;  4O0I A;  1QQN A;  1Y97 A;  3GOI A;  4BR5 A;  3JXU A;  3KLG A;  3SAF A;  4I6M B;  1C1C A;  1IV0 A;  2A42 A;  1NK0 A;  1JXE A;  3SV3 A;  1ATS A;  4FYD A;  1NNE A;  1Q9Y A;  2E1Y A;  4DF8 A;  4XH1 A;  3T3F A;  1NG9 A;  2P5G A;  2FBV A;  1RTI A;  2QI2 A;  3HPG A;  2G8V A;  4CZF A;  4DTP A;  3V81 A;  1KVB A;  2ZD1 A;  4KHW A;  1Q86 O;  3BZC A;  2D0B A;  3C7N B;  4HVJ A;  1S9G A;  4Z0U A;  3L2V A;  4K0K K;  1SKR A;  1HNX K;  4JV5 K;  3EE8 A;  1NGJ A;  4M3Z A;  1QS4 A;  4FLT A;  2HND A;  1BWF O;  3MN6 A;  4BRM A;  4GY2 B;  3ZSO A;  3DRS A;  3NGZ A;  3AAP A;  3EKU A;  4DV1 K;  3QBX A;  1X9W A;  4M63 C;  5AFU A;  3S41 A;  4H8K A;  4KPY A;  3M3Z A;  1QVG M;  5AQH A;  3GE1 A;  5AQW A;  3DLH A;  1TK0 A;  3OYF A;  3K0S A;  4CI6 A;  1D8Y A;  1U04 A;  5LL6 Z;  1ILY A;  4CEA A;  3FZL A;  1ASW A;  1HX1 A;  2F9W A;  4BE0 A;  1MDU B;  2HBJ A;  1CLQ A;  4EIA A;  1BCM A;  4CJ5 A;  3WXJ A;  2YJF A;  3THY A;  2B6A A;  4ILG B;  3KVG A;  2A1R A;  5BPL A;  1VQN N;  3JS6 A;  4EAH D;  1NWK A;  4E3S A;  4MLE A;  1TYQ A;  1YI2 N;  1QQO A;  3R3L A;  3C6U A;  4NB4 A;  1YTA A;  3E9P A;  2QKK A;  4Q0B A;  3PUF A;  1TAQ A;  4FJH A;  3QIO A;  3O1W A;  3UIQ A;  5F1X A;  4CCH A;  2FSN A;  4H0X B;  2X6N A;  4FSV A;  4BRK A;  3J7Z O;  4CF0 A;  1XMQ K;  1NJI O;  3GG4 A;  3RSE A;  3SV4 A;  4CJW A;  1QVF M;  3U3Y A;  1BG3 A;  1VQK N;  1FK9 A;  5DK5 A;  2XY5 A;  3CM6 A;  3OYA A;  4BVP A;  2GEL A;  3HP9 A;  1GLL O;  3LPU A;  1DLO A;  1S6P A;  4JKE A;  2GTD A;  1NMN A;  2XO7 A;  1BIU A;  1JLG A;  2ASO A;  3THX A;  4F3O A;  1NGH A;  2IVP A;  1VSE A;  2BUP A;  1X9J A;  1S1V A;  3VEZ A;  1IKY A;  3AA2 A;  4CEQ A;  4V19 S;  1RDC A;  3TAE A;  2F9T A;  3CD6 N;  2HF4 A;  3EN9 A;  2E2P A;  4O44 A;  3CQX A;  3ENH A;  3MK6 A;  1VSI A;  4W5T A;  3I56 N;  2HHW A;  2Q2R A;  4CEF A;  4YNQ A;  1WB9 A;  4K8X A;  2OAN A;  4ZTF A;  4FK4 A;  3B6P A;  2O8E B;  3CJ9 A;  1QZ6 A;  4CJT A;  3ID8 A;  3FLC O;  3D2E B;  3WNG A;  4X66 K;  1YTU A;  5KQD A;  1YXQ A;  3C6H A;  1SS6 A;  3O5B A;  3K5O A;  4QS9 A;  4CJF A;  3CCU N;  2DFF A;  3R8E A;  1HYS A;  3HST B;  1XI1 A;  4M3T A;  4NO7 A;  4JRP A;  1W2B M;  2RF2 A;  4OGE A;  1XUP O;  4PL8 A;  4BE2 A;  3KD5 E;  5E41 A;  4F8R A;  1M1K O;  4BDY A;  4DS4 A;  4I7F A;  2P9I B;  3ZSR A;  5T7B A;  3VQC A;  5BR9 A;  3B6O A;  4CZM A;  3THW A;  2P9L A;  1RTH A;  4AQY K;  4CZJ A;  2QWQ A;  4JAX A;  5AQO A;  1TKX A;  4FJ9 A;  1WAJ A;  3VA0 A;  1TKD A;  4DTO A;  3J81 O;  1RT5 A;  2KFZ A;  1JLF A;  2P9P A;  4KBO A;  4EZ6 A;  5FRN A;  3AVC A;  3VQQ A;  1YT3 A;  3H45 C;  1BOT O;  2GWK A;  1L5U A;  3MEG A;  3FZK A;  4HTL A;  5AQK A;  3H3O B;  3TTD A;  1Q7Y O;  4CJV A;  1X9S A;  3OYH A;  5AZJ B;  1VQO N;  1YVU A;  1L3U A;  1ZXO A;  2HHV A;  4B9N A;  3A5N C;  4CGJ A;  3ALY A;  4L3Q A;  3V1O A;  3I8B A;  3U9Z A;  4FPA A;  4FJL A;  4YOV A;  3QBW A;  3OJU A;  5ADX H;  3AA3 A;  3SLC A;  3ZET A;  3SCX A;  5HLF A;  4Z4G A;  4H5N A;  4KTQ A;  4B1X B;  4OVL A;  3CME N;  3OA9 A;  2FBX A;  4OLA A;  1KLM A;  3U8X A;  4KI6 A;  2V7Y A;  4JHD A;  5AQU A;  1OH5 A;  3P1G A;  1WNS A;  5M1Q A;  1MWM A;  4BY9 C;  2ASP A;  1EO1 A;  4GNI A;  3O4Q A;  4H5W A;  4CJQ A;  1IKX A;  3L8B A;  3RMC A;  1OH6 A;  4CEE A;  1XHX A;  1A5V A;  3ZX3 A;  3HOT A;  2XY8 A;  3VQ4 A;  3LP0 A;  3LP2 A;  1IG8 A;  3V4I A;  4FM0 A;  3DLL L;  1GLE G;  4B1U B;  4CJU A;  2RN2 A;  2AJQ A;  3VES A;  3HK2 A;  4A57 A;  5BPM A;  2ZM6 K;  5AQY A;  4CJE A;  1SL0 A;  3CET A;  3M5R A;  3PX4 A;  2P9U A;  4PKH A;  4KB0 A;  3CC7 N;  4N56 A;  1O13 A;  5TKY A;  1O1W A;  2VG6 A;  3THV A;  4AHC A;  1SKS A;  2YNG A;  4A59 A;  4CVN E;  1IKW A;  3NF9 A;  3DOK A;  3E66 A;  1HKB A;  1TAU A;  3OYM A;  4JKG B;  1VSH A;  4EP5 A;  5M1P A;  4BG9 A;  1J9A A;  4AF1 A;  4E1M A;  4DQP A;  2HHS A;  2Y1I A;  3KTQ A;  2A6A A;  3U6F A;  4WFB L;  3B8A X;  4BE1 A;  1NKB A;  3SZ2 A;  4IOX A;  2HBM A;  3CCR N;  4GV9 A;  2Q36 A;  2OPR A;  4CW7 B;  4CHN A;  3MWT A;  4DCH A;  4B9L A;  4U67 L;  1RT1 A;  1CXU A;  3AVH A;  3AVL A;  3SMP A;  2NRV A;  3AY9 A;  3VET A;  2ZWH A;  3ZX0 A;  4RTF D;  4FLV A;  3KIO A;  4NXM K;  3EO3 A;  3MWP A;  1B9D A;  5IWA K;  4W5Q A;  4MDA A;  1JXB A;  1GOA A;  3ZSY A;  3TAP A;  4DR4 K;  1HYV A;  3TWH A;  3K9J A;  3F9K A;  4E0D A;  2NRH A;  4HCB A;  2VWB A;  4CBX A;  2F8T A;  3VTH A;  3OJS A;  5M1N A;  1BUP A;  2F7T A;  1BGX T;  1GLF O;  3WQT A;  4DWI A;  3CXC M;  3DJC A;  4DFP A;  1CZ9 A;  4JI1 K;  3SMS A;  3SQ4 A;  4BRD A;  4EP4 A;  3AVJ A;  5GIN A;  1R0A A;  1TK8 A;  3DLB A;  5FPD A;  2KTQ A;  4HUG A;  1P8Z A;  2D1K A;  1EKE A;  1IJJ A;  1JCG A;  4B3O A;  5I9E B;  3LZJ A;  4B3T K;  4Z4C A;  4BC4 A;  4LF4 K;  4FL9 A;  3TAB A;  4JI3 K;  5LY3 A;  3UB5 A;  1RNH A;  2BH1 A;  4QS7 A;  3VN5 A;  3J80 O;  2D0O A;  3BF1 A;  3KJV A;  1KAZ A;  3HTV A;  4BRL A;  3P5J A;  3LPT A;  2E8A A;  5AFU H;  3P38 A;  4X64 K;  3K59 A;  4Z4H A;  1YVN A;  4OLB A;  1RBR A;  3G25 A;  4IWV A;  1VSJ A;  3ZSW A;  3A5O C;  4JK8 A;  1UOC A;  3AVM A;  3DLK A;  1D9D A;  1BI4 A;  2FC0 A;  3O9Q A;  4RW6 A;  4H0O A;  2E5L K;  3TAF A;  3VEO A;  3O3F A;  3C95 A;  2FF3 B;  5FRM A;  3V9X A;  4B9M A;  5ADX A;  1ZBS A;  1U2V A;  4A5B A;  4AHV A;  5J2M A;  3ULE B;  3LDN A;  1HYZ A;  1RDB A;  3LZI A;  3MAQ A;  3T1H K;  3PIO L;  5HL7 L;  2EX3 A;  5KRT A;  2UU9 K;  1S5J A;  3ZEU B;  5J2N A;  4YDU C;  2D0A A;  4EZ9 A;  3CIP A;  4NCA A;  3R1X A;  1KVC A;  2V52 B;  1Q8I A;  3TAQ A;  2RKI A;  4BWJ A;  2O8C A;  1RT6 A;  1HQE A;  4AHR A;  5KTQ A;  3AVG A;  2QXL A;  3QIP A;  4JK9 A;  5KGW A;  2IGI A;  3ATU A;  2P9S A;  3U3G A;  1IBK K;  4CEO A;  3D2F B;  1QSL A;  4ISE A;  3GBT A;  4FM1 A;  4FJK A;  4CEC A;  4OJR A;  1LW0 A;  5JS1 A;  5GAE P;  3NH0 A;  4FJN A;  1XC3 A;  4X65 K;  1S9E A;  5GIP A;  5C2D A;  3D7E O;  1BIZ A;  4CFD A;  3E9O A;  2FLO A;  3T1A A;  1N32 K;  3F2K A;  4YFU A;  3T1Y K;  3TSU A;  4FJI A;  5JS2 A;  4F2R A;  4WQ5 C;  4Y1D A;  4ID1 A;  5KPR A;  1J5O A;  1VSM A;  4N76 A;  3D45 A;  4JYA K;  5AR0 A;  3SUQ A;  4JS4 A;  4CED A;  3QIC A;  3AGK A;  1HKC A;  3RMA A;  1WSH A;  3WQU A;  4HCC A;  4BRA A;  1ZC6 A;  3ZT0 A;  3QEI A;  4JKA A;  3CCM N;  3QFU A;  3PV8 A;  1FJG K;  1T44 A;  4A5A A;  5GIO A;  3TAM A;  3CJB A;  2CGK A;  3J7A P;  2WOM A;  2Y1J A;  1TKT A;  3I0S A;  3SQ1 A;  3RR8 A;  4H0Y B;  2Z1J A;  3FZM A;  3MN7 A;  2OA8 A;  2J4R A;  2GWJ A;  3F73 A;  1W97 L;  4MQ3 A;  5AQP A;  3MXM A;  5HOO A;  1VSD A;  5HRO A;  4BRC A;  4PUO A;  3K2P A;  2KZZ A;  2FXU A;  5M1K A;  4C8O A;  3HI0 A;  4CF1 A;  4Z94 A;  5C10 A;  2HOE A;  1WSF A;  2EHG A;  4M42 A;  3L4I A;  3ZSV A;  1EXQ A;  4BG8 A;  1ATN A;  3T69 A;  3CFO A;  3BDP A;  3OYL A;  4AHU A;  4JKH A;  2XRI A;  3UKR A;  4WF9 L;  3HVT A;  3KZB A;  4NYF A;  2NRT A;  3G6E N;  2GUI A;  2ZGZ A;  4FZX C;  4JKC A;  5H1S Q;  3K5L A;  3H46 O;  3VEN A;  4RW7 A;  3QEV A;  3VEX A;  3DWL A;  2UXC K;  1JLE A;  3AV9 A;  4E7I A;  4G1Q A;  3MDQ A;  4ELV A;  1NOZ A;  3DM2 A;  4JI6 K;  2Q0R A;  5JIC A;  4I9Q A;  1SV5 A;  4DF4 A;  1UAX A;  3HT3 A;  3C6T A;  1RIL A;  3QIN A;  4C23 A;  2GUP A;  3LDP A;  3OYB A;  2NZT A;  2AA4 A;  4A62 A;  4DV2 K;  2P1J A;  1JLA A;  1NBW A;  1QHA A;  4KO0 A;  5JLH A;  4GV6 A;  3I8D A;  3LWL A;  4JEP A;  3PY8 A;  1KQS M;  4YDU A;  3M6G A;  4ILH A;  3E1Y A;  4NXN K;  4LFB K;  3PO5 A;  5DM6 L;  3A0I X;  5AQM A;  3L6Q A;  1RGI A;  1Q18 A;  2KW4 A;  3EEQ A;  5EY4 A;  3CCV N; 
#chains in the Genus database with same CATH homology
 2GWK A;  4XH5 A;  4CZH A;  4EHT A;  3FZK A;  3NVM A;  3O08 A;  4HTL A;  3VGM A;  5AQK A;  3H3O B;  3TTD A;  1Q7Y O;  4LC9 B;  3EE9 A;  1MWK A;  3ATV A;  2QWO A;  5AZJ B;  1VQO N;  4CBW A;  5JVG L;  3ULE A;  5AZI B;  2KKZ A;  1ZXO A;  1U6Z A;  3DXM A;  1VQL N;  2CGJ A;  3A5N C;  3IMX A;  1KXP A;  4GV3 A;  4J8F A;  3KWG A;  2D4W A;  3FE1 A;  1TUU A;  3ZEU A;  4L3Q A;  3I8B A;  5ELZ A;  3U9Z A;  4FPA A;  4CZK A;  3QBW A;  4BRP A;  4EFH A;  4YOV A;  4YOU A;  4C1N I;  3WXI A;  5ADX H;  2QW9 A;  2ZJR L;  3C0B A;  3WXL A;  3SLC A;  1EQY A;  3ZET A;  4PL7 A;  1NGI A;  4FWP A;  4H5N A;  3UKR B;  1JJ2 M;  4B1X B;  3LDO A;  4ISG A;  4YOR A;  3CME N;  3OA9 A;  5AQX A;  3U8X A;  2W41 A;  4BRO A;  2V7Y A;  4JHD A;  4OPA A;  5B8H A;  3VMF B;  5AQU A;  3ZYY X;  4GVE A;  2YCH A;  5M1Q A;  1MWM A;  3VTI A;  4BY9 C;  2ASP A;  1EO1 A;  2E2O A;  2VYP A;  4GNI A;  3LM9 A;  5AQL A;  4BRE A;  3OW2 M;  2Q0U A;  4H5W A;  2A41 A;  2VGN A;  3H3N O;  1BA1 A;  2QWP A;  5C12 A;  4BVO A;  2JWL A;  2RHK A;  3CCL N;  3N4Q A;  3C65 A;  3ZX3 A;  5BRD A;  3KWI A;  3HOT A;  4WQ5 A;  3AAQ A;  5AQJ A;  5GAD P;  1IG8 A;  4BRQ A;  1YUW A;  3MCA B;  5E26 A;  3TPQ A;  4ISF A;  2WUS A;  5AQZ A;  3VGK A;  5BN9 A;  3MX2 A;  2YI1 A;  3QDK A;  4MDB A;  3DLL L;  3BF3 A;  1GLE G;  4IEI A;  4IOC L;  1NMD A;  4B1U B;  2IVN A;  5F0X A;  4FWM A;  4MLH A;  4FWL A;  2E1Z A;  1ESV A;  3VES A;  4A57 A;  5BPM A;  2YHY A;  1DT9 A;  5AQY A;  4YOW A;  3CET A;  3M5R A;  2P9U A;  4H0T B;  3CJ1 A;  4PKH A;  3U9D A;  3OBW A;  4WYB A;  4A2B A;  3CC7 N;  3CC2 N;  4ILJ A;  4JKD A;  4PHT X;  1O13 A;  3DXK B;  3IUC A;  2KHO A;  5TKY A;  4WFA L;  3CJC A;  4B1Y B;  4A59 A;  3LDL A;  3IFR A;  5BRF A;  2QWL A;  3WEE A;  1BU6 O;  2FSJ A;  3E66 A;  4WQ4 A;  4KH6 A;  1HKB A;  5EX5 A;  2YHX A;  5CHI A;  4JKG B;  5AQQ A;  2P9P B;  4JD2 B;  4XH4 A;  3CF5 L;  4IJA A;  1TUY A;  4YOT A;  3CHW A;  5M1P A;  2PBD A;  2VCP A;  3W3D A;  4BG9 A;  1VQ5 N;  4AF1 A;  1WOQ A;  4FWN A;  3LL3 A;  3O80 A;  2A6A A;  2OTJ N;  1VQ6 N;  3HZ6 A;  4FVU A;  4WFB L;  3B8A X;  3VEW A;  4H03 B;  4BC2 A;  1T3V A;  4KH4 A;  4IOX A;  3CMA N;  2HBM A;  4FWK A;  2YJE A;  4JKF A;  1Y64 A;  2P9N A;  5C2F A;  1TYQ B;  3CCR N;  4GV9 A;  2Q36 A;  3AGR A;  3DXM B;  4CBU A;  3MWT A;  4CZG A;  4OO1 J;  4DCH A;  4B1V A;  1E4G T;  1NGD A;  2KLA A;  4JK7 A;  3WXM B;  4FWS A;  4K43 A;  5JMV A;  4U67 L;  3AAR A;  3CPE A;  1JCE A;  2WC9 A;  4DQ8 A;  3FGU A;  4FWR A;  3F9M A;  4FOI A;  5LJW A;  1DGK N;  2BTF A;  3ZET B;  1J6Z A;  1HJO A;  1SQK A;  2NRW A;  1Q82 O;  2ZJQ L;  1NGC A;  3H6E A;  3NVK A;  3A5M C;  3SMP A;  1BO5 O;  2NRV A;  3AY9 A;  3O9R A;  3VET A;  1X3M A;  2ZWH A;  3FR0 A;  3GL1 A;  4RTF D;  3ZX0 A;  4JHD B;  1K8A O;  3R9P A;  4IXC A;  3RSE B;  2NRZ A;  3VF4 A;  4JNE A;  1RFQ A;  1HKG A;  2E2N A;  3EO3 A;  1VQM N;  1NGA A;  4MO4 A;  1Q81 O;  3MWP A;  4AM7 A;  4MDA A;  1NM1 A;  3VER A;  1VQ7 N;  3EKS A;  2QWR A;  5MLC Q;  5C0Y A;  3J8A A;  1P90 A;  3KK7 A;  2CH5 A;  3K9J A;  2IVO A;  5AQR A;  1Z6R A;  2NRX A;  4FO0 A;  4K41 A;  3RVC A;  3SBT A;  1YIJ N;  1YJW N;  3OHR A;  1N8R O;  2NRH A;  4CZE A;  4F9O A;  3O9S A;  1LOT B;  3VEV A;  2P9K A;  2VWB A;  4I6M A;  3M1F A;  5F2R A;  4CBX A;  1M90 O;  2Q1N A;  2YHW A;  3VTH A;  5M1N A;  2DPN A;  1BUP A;  2F7T A;  3HM8 A;  3IKM A;  1YAG A;  3LM2 A;  3VOV A;  1G99 A;  1GLF O;  3D2E A;  3WQT A;  2I7P A;  3CXC M;  4IZ9 A;  1R59 O;  3DJC A;  4O8K A;  3CCV N;  2A40 A;  3SMS A;  2P9U B;  5AQV A;  1KC8 O;  5JVH L;  3GDQ A;  4BRD A;  1C0F A;  3IDH A;  4H5T A;  3TSQ A;  3W0L A;  1VAZ A;  1NLV A;  5GIN A;  3HRG A;  3C7N A;  1K8K A;  3ZX2 A;  5FPD A;  2HST A;  1P8Z A;  2D1K A;  3Q7B A;  5AQT A;  5FPE A;  2AP1 A;  1IJJ A;  2I7N A;  4XEI A;  4DB3 A;  3O1B A;  3WEE B;  1JCG A;  4BR0 A;  2UYT A;  2NNW A;  1YF5 L;  3L0Q A;  5I9E B;  3D2F A;  4BC4 A;  2FF6 A;  2CGL A;  1Z05 A;  5CR4 A;  3WT0 A;  3D6R A;  3O9T A;  2ZJP L;  3I33 A;  4FL9 A;  5AQI A;  5LY3 A;  1YHQ N;  3QFP A;  3R6M A;  3P4I A;  2RE2 A;  3MN9 A;  3UB5 A;  4IJN A;  4AM6 A;  1YJN N;  2BH1 A;  4QS7 A;  3HOS A;  2NLX A;  3U4L A;  2CH6 A;  4CD3 A;  3TU5 A;  2D0O A;  4H0V B;  2P9N B;  3BF1 A;  5DM7 L;  1YJ9 N;  1NGE A;  1QZ5 A;  3TSP A;  1KAZ A;  3HTV A;  4BRL A;  3P39 A;  4BQL A;  4H5R A;  2E8A A;  2FSK A;  5AFU H;  4IO9 L;  3P38 A;  2GEM A;  4R79 A;  1GLB G;  3SJH A;  5BPN A;  3QML A;  4BGB A;  4IO8 A;  1YVN A;  5EOY A;  2PFU A;  4BRH A;  3G25 A;  3HBT A;  4A61 A;  1MA9 B;  4IWV A;  1KD1 O;  1T6C A;  2P9L B;  1K9M O;  3A5O C;  4JK8 A;  3FZH A;  5GAH P;  3UE5 A;  3OBY A;  4RWT A;  5E84 A;  1KAX A;  1GLA G;  3O9Q A;  1NGB A;  3BUZ B;  5AZI A;  3SBG A;  1HLU A;  4H0O A;  3VF2 A;  3O9U A;  3VEO A;  3VPZ A;  2FF3 B;  3I55 N;  3ENB A;  2V51 B;  4PKI A;  3UKU A;  4FPB A;  4FWQ A;  4EHU A;  3K9K A;  3TTC A;  4IFE A;  3CJA A;  3L4Q A;  3VEY A;  1JCF A;  1QQN A;  5ADX A;  1ZBS A;  3GOI A;  1SAZ A;  4BR5 A;  1U2V A;  4A5B A;  2A5X A;  3JXU A;  3SAF A;  4I6M B;  2A42 A;  3LDN A;  3ULE B;  1ATS A;  2E1Y A;  3PIO L;  2EWS A;  4XH1 A;  5HL7 L;  4BRI A;  3MMV A;  4IDH A;  1OKJ A;  2QI2 A;  2ITM A;  3HSC A;  3CER A;  3ZEU B;  4YDU C;  4CZF A;  3CIP A;  3R1X A;  2VGM A;  1Q86 O;  3PIP L;  3SAH A;  2V52 B;  2ZGY A;  3TTF A;  4CZL A;  4YOY A;  1T6D A;  1GLD G;  5AQS A;  5BRE A;  2IIR A;  3C7N B;  5BRH A;  2ZF5 O;  1WUA A;  2A3Z A;  3EL2 A;  3EE8 A;  1NGJ A;  2QXL A;  3CJ7 A;  4JK9 A;  4KH5 A;  3ATU A;  1BWF O;  3MN6 A;  2P9S A;  4GY2 B;  4BRM A;  3SAG A;  4B1Z A;  3D2F B;  4IOA L;  3QB0 A;  3AAP A;  3EKU A;  3KHY A;  4ISE A;  3QBX A;  3P31 A;  4M63 C;  5AFU A;  3S41 A;  3GBT A;  3M3Z A;  1QVG M;  2Q31 A;  5AQH A;  3G4S N;  5GAE P;  3GE1 A;  1VQ8 N;  5AQW A;  3CQY A;  3DXK A;  3G71 N;  1XC3 A;  1BDG A;  4CI6 A;  5GIP A;  2NRR A;  1HPM A;  5C2D A;  3D7E O;  3VF6 A;  1ILY A;  4BC3 A;  5JLF A;  1S3X A;  3FZL A;  3E9O A;  5CE3 A;  1HX1 A;  2D0P A;  2F9W A;  2FLO A;  2HBL A;  4MO5 A;  5M1O A;  1MDU B;  4BC5 A;  2HBJ A;  4EIA A;  4PKG A;  1S22 A;  1KAY A;  2YJF A;  4M7X A;  3WXJ A;  1GLJ O;  3F2K A;  4ILG B;  2HMP A;  3NMU A;  3EZW A;  3KVG A;  4K25 A;  1DKG D;  3TSU A;  5BPL A;  1RDW X;  3MCP A;  3VGL A;  3JS6 A;  1HUX A;  3ID6 A;  4FWO A;  1VQN N;  4EAH D;  2ASM A;  1NWK A;  4WQ5 C;  4MLE A;  5KPR A;  1TYQ A;  5KPZ A;  3O8M A;  1YI2 N;  1QQO A;  3R3L A;  1DEJ A;  4NB4 A;  1X3N A;  2QWN A;  1QQM A;  5EXW A;  3E9P A;  5AR0 A;  4BRF A;  3WXK A;  2HF3 A;  3UKU B;  1D4X A;  3QIC A;  3AGK A;  3O1W A;  1HKC A;  3BEX A;  4CD1 A;  2P9I A;  3F5T A;  5F1X A;  3WQU A;  2FSN A;  2HBK A;  4H0P A;  4H0X B;  1K73 O;  4BRA A;  1H1V A;  1ZC6 A;  2GX9 A;  4FSV A;  1VQP N;  1U2V B;  4JN4 A;  4BRK A;  3J7Z O;  2JWK A;  4BQZ A;  4JKA A;  3LDQ A;  2E20 A;  3CCM N;  1NJI O;  3CPW M;  1GLC G;  3GG4 A;  1V4T A;  3QFU A;  5FPM A;  3RSE A;  1T44 A;  4UY8 O;  4FOE A;  4A5A A;  1QVF M;  5GIO A;  4M7Y A;  1BG3 A;  4IEE A;  1VQK N;  3CJB A;  2CGK A;  1XQS C;  4U7B A;  4WQ4 C;  4BVP A;  2GEL A;  4H0Y B;  1GLL O;  2OTL N;  3FZM A;  3MN7 A;  5M1F A;  4JKE A;  2J4R A;  3MX5 A;  2GWJ A;  2GTD A;  1W97 L;  4NLB A;  5AQP A;  4DKW A;  5HOO A;  4BRC A;  2ASO A;  3A5L C;  2QTD A;  1NGH A;  2FXU A;  5AZJ A;  5M1K A;  2IVP A;  4CJ7 A;  2BUP A;  1X9J A;  3HI0 A;  3CC4 N;  4Z94 A;  3VEZ A;  5C10 A;  2P9S B;  2HOE A;  2QA4 N;  5KQ8 A;  1C0G A;  4CZI A;  3L4I A;  2F9T A;  3CD6 N;  2HF4 A;  3EN9 A;  4BG8 A;  2E2P A;  1ATN A;  3T69 A;  3CQX A;  3ENH A;  3DAW A;  3MK6 A;  5GAG P;  3H1V X;  3I56 N;  3O4W A;  5TKW A;  4JKH A;  4E1J A;  1OVY A;  2Q2R A;  2W40 A;  4H5V A;  2PAV A;  3UKR A;  4WF9 L;  3KZB A;  2OAN A;  2P9K B;  1CZA N;  2NRT A;  3MN5 A;  5EVZ A;  5FPN A;  3G6E N;  4G9Z A;  3CJ9 A;  1QZ6 A;  2ZGZ A;  4JKC A;  5H1S Q;  1V4S A;  5AQF A;  3ID8 A;  3CCJ N;  5KPT A;  3H46 O;  3CCE N;  3BP8 A;  3ENO A;  3Q7C A;  4C1N K;  1NGG A;  3FLC O;  3D2E B;  3VEN A;  2WBN A;  1SZ2 A;  3VEX A;  2Q97 A;  3DWL A;  5KQD A;  1YXQ A;  3C6H A;  1SS6 A;  3O5B A;  1YIT N;  2E88 A;  4B1W B;  3MDQ A;  4BR9 A;  4QS8 A;  4QS9 A;  3WUH A;  3CCQ N;  3CCU N;  1K8K B;  4DHY A;  3R8E A;  1E4F T;  2Q0R A;  4A2A A;  5AQG A;  3FZF A;  4NO7 A;  5JIC A;  4WFN L;  3E9L A;  4Y0W A;  4O8U A;  1W2B M;  1NGF A;  2QM1 A;  3H1Q A;  3O6W A;  4C23 A;  3CCS N;  1XUP O;  2GUP A;  5LJV A;  1ATR A;  4PL8 A;  3LDP A;  4YOX A;  1BA0 A;  3CI5 A;  1VQ4 N;  1M1K O;  2NZT A;  2P9I B;  2AA4 A;  4BR2 A;  4A62 A;  3PLA A;  1RDU A;  3H45 C;  5BR9 A;  5C15 A;  4CZM A;  2P9L A;  2V7Z A;  2QWM A;  1NBW A;  4O5F A;  1S72 N;  1QHA A;  2H3G X;  3SK3 A;  5AQN A;  4BRN A;  2E2Q A;  4BR7 A;  5JLH A;  4CZJ A;  2QEX N;  4GV6 A;  2QWQ A;  1VQ9 N;  4JAX A;  3C6A A;  4JEP A;  5AQO A;  1KQS M;  4YDU A;  3FFK B;  3M6G A;  4ILH A;  3E1Y A;  3N4P A;  4HWI A;  4JKG A;  1LCU A;  4K42 A;  4NLC A;  4BGA A;  4B9Q A;  2P9P A;  4JD2 A;  4KBO A;  3A0I X;  5DM6 L;  5AQM A;  3A8Y A;  3L6Q A;  3T7Z A;  4RCH A;  5BN8 A;  2WFB A;  1RGI A;  4OPH A;  4BR4 A;  1Q18 A;  4BRG A;  4JKB A;  5EY4 A;  1BOT O;  4WCE L;  2YX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...