5K14A

Hiv-1 reverse transcriptase in complex with a 2,6-difluorophenyl dapy analog
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
543
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel (2,6-difluorophenyl)(2-(phenylamino)pyrimidin-4-yl)methanones with restricted conformation as potent non-nucleoside reverse transcriptase inhibitors against HIV-1.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
molecule tags Transferase/transferase inhibitor
molecule keywords HIV-1 reverse transcriptase(isolate HXB2)
total genus 156
structure length 536
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5k14A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5k14A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5k14A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5k14A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5k14A05
3NL0A 1CZBA 3EZUA 1BQNA 3LWLA 4H4MB 5L1LA 3UQSA 2IC3A 3WNFA 1BISA 2DTUA 3OYAA 2RKIB 1ITGA 4KV8B 4ICLB 4BACA 3PW7A 2IGIA 2ZQBA 2FVSA 2J6SA 3NH2A 5KG4A 4G3IA 1NJYA 4QWAA 1VSIA 3QIOA 3L2RA 2FLLA 5EU7A 4ED6A 1RTHA 3L2QA 4UQGA 2XCPA 2JEGA 1S0NA 3ITHA 4LQ9A 1T7PA 5KFOA 1MU2B 1QAJA 1S1XA 1RT1B 4LSLB 1XI1A 2B4JA 1U49A 5J2QA 2IM3A 1NK9A 4K8XA 3H4DA 1N6QA 4M3ZA 4E7LA 1UOCA 1HYSA 1VSDA 3K57A 3KK2B 1JLQB 4Q0BB 2BQRA 3K5MA 1U45A 1C0TB 4B3OA 1EX4A 2D0CA 4CK2A 4M3YA 4KREA 5F9LA 2G8KA 1ASVA 5L1JA 4AHUA 2AQ4A 2D41A 5JXSA 1U09A 4HYKA 1JXEA 4DTPA 4EZ6A 4PY5A 2Y1IA 1JLFB 3K2PA 3GIKA 4J2DA 1BCOA 3WNEA 3CJ3A 3GV7B 3NFAA 3HVWA 2AGQA 2OZMA 4OGCA 3PW2A 1UA1A 2ZE2B 3CYMA 4NLVA 3KLEA 4HTUA 4FJMA 3DRRB 3ISNC 2JEFA 1BQMA 2IJFA 3IRXB 1RTHB 3DDKA 1Q9XA 1NOZA 3NDKA 3T19A 2KW4A 4NLRA 3GYNA 3OYEA 1TQLA 1X9WA 1ASWA 3KHLA 4CK3A 1BIUA 2WTFA 1S9GA 4DF4A 5KFYA 4K4UA 4W5NA 5KFAA 4FK2A 4E3SA 1JLEA 3AVBA 4CF1A 4M3RA 3QETA 1JL2A 2I5JB 3H08A 2BGGA 1RT6B 1JLAB 4E7JA 1CLQA 2R7YA 4BDPA 2HW3A 5KT4A 4FZYA 4OGEA 5HRSA 4FLXA 1JXLA 4B9LA 1JLGB 3T5LA 2QV6A 1JLCA 5KFZA 1S6PB 1FKOA 5DG9A 5D3GA 4ECXA 4IRKA 1YVUA 4F3TA 3KLGB 1VRUB 2YNHB 1Z25A 4LSNB 3KK1B 3IAYA 2AU0A 5KT5A 2BE2A 4M42A 1T03B 1XWLA 3T5HA 1CXQA 2HMIA 4NLSA 2D3UA 2VG6B 4CEAA 3ZSQA 1RT4A 4CHZA 5JS1A 3LP0A 2W9AA 2IBKA 1SUQB 2RDIA 3Q8RB 2HNZB 4FZZA 1T3NA 1S1TA 1TKXA 3MEEA 3MXIA 1HJRA 3NGDA 3MFIA 3V9WA 2YV0X 1NHVA 5KFUA 4CFAA 5J2NA 4TQSA 2D0AA 4FJ5A 3LDSA 2IS3A 4O3SA 4CJKA 3V6JA 4XPEA 2FJVA 4TSXA 3QZ8A 4Q45A 2HB5A 4DSFA 2J6UA 1L3TA 5J1EA 4CF8A 3RRHA 3DMJA 1TKXB 3MEEB 2XY8A 1RA6A 3N6MA 4EBDA 2G8UA 1K1QA 3HT3A 3SPZA 3QNOA 3TARA 3K5LA 4B9VA 3VQSA 3BSAA 1N48A 1TGOA 2UUTA 4PWDA 4RNHA 5DQHA 2BE2B 3SCXA 2V4RA 4FLZA 1S9FA 3Q8PB 3IS9A 1HPZA 1VSLA 4E7HA 1WAJA 1JKHA 3CJ0A 4DSLA 3MR2A 1YTUA 2W9CA 2RF2A 1FKOB 3AA5X 1XR5A 5F8JA 3CFPA 2YKNB 5KFHA 4CGJA 5KG1A 4OLBA 4FCYA 5KG7A 4ECUA 3GV8B 1IKXA 4NRUA 4IRDA 1TKZA 2VG5A 2I5JA 1SL1A 4J2EA 4B9SA 4URSA 3AVLA 4LD0A 4CJEA 2C22A 1EETA 1JLEB 1UAXA 2XWYA 2R2RA 4ID1A 3K5OA 3VN5A 4NLPA 4NCGB 4FJHA 4FM2A 1NOYA 4C8OA 4B9UA 1RBVA 3KNAA 1YVFA 3GIJA 3IRXA 1BHLA 1HYVA 3DLRA 3IGNA 3OYIA 3ZT3A 3KLEB 3D0PA 4KAIA 3RMAA 3M9OB 3NBPB 4O3QA 3KLFB 4NLUA 3ZSWA 3HXMA 4WFYA 2Z1GA 1KLMB 2Q3SA 4NLGA 4RG8A 2X74A 4B8AB 1HQUB 1JLFA 5DMRA 4CERA 2BQUA 3MEGA 2HVIA 1GX5A 1C0MA 3AVMA 4PA1A 2AX1A 3VQ7A 3ZSRA 3DM2B 2OPQA 3I5BA 1RDRA 1RBSA 3RRGA 3DRPA 2HNYB 1TAQA 3DOLB 3H5UA 5KFGA 2EHGA 3LP2A 1VRTB 3IN5A 4NLXA 4CJFA 3QIPA 1LWFA 4ZVEA 4FJJA 4DTOA 3PO4A 3SFGA 3E01A 1XR7A 3EZ5A 4CEFA 3ITHB 4CF2A 3HHKA 4L8RB 2ZD1B 2UVRA 5DQGA 5F8GA 3QEWA 1HNVB 4ECQA 4Q43A 3NHGA 3C6TA 2OYQA 4B08A 3QERA 1IKYB 3KJVA 5KG5A 1LW0B 4F4YA 4Y1CA 4NLWA 3GIMA 1S1WA 5J2PB 2DFFA 3NF6A 4DU1A 3OYLA 3RR8A 4ICLA 4IFVA 4KV8A 3QEXA 2RKIA 3CVKA 2I1RA 2JLEA 3KKRA 4H4MA 4BDYA 4IQXA 2IM0A 3VQPA 3KJVB 4URQU 3OY9A 3LP1B 1C6VA 1EP4A 4PQUB 2G8IA 4NZ0A 2C28A 1U4BA 4DTJA 3HYFA 3I0RA 4NLDA 1KVAA 4OVLA 4AHTA 4DMNA 3OJSA 4KI4A 2IDOA 4O3PA 2ASLA 4DL7A 3KD5E 2G8FA 3E01B 4FW2A 3Q8SB 3AVCA 3OHBA 4TQRA 1RDBA 4RW9B 3AVIA 1NKBA 2G8HA 3QO9A 1ZBIA 3RBEA 1BI4A 1DTTB 3AA3A 2YHBA 4G1QA 1W9HA 3DRPB 5CY4A 1XC9A 4LH4A 1FK9B 3AA4A 2Z1IA 2OPQB 3NH1A 5KFDA 4OLAA 3OJUA 3OSPA 2ITGA 4FJ9A 4ED8A 4M45A 4J2BA 3MEGB 4CF9A 4ZHRB 1N5YA 4XIUA 4N41A 2YNFB 5F8LA 3AVNA 2XCAA 4R8UA 2OPSB 1KLMA 4KKOA 1LWCA 4DL6A 3PJWA 3G6XA 1D0EA 2ASDA 3PJXA 3SUPA 3VQ6A 2AX0A 2QKBA 3RBDA 4J9LA 3N6NA 3DLKB 4J9QA 3PVXA 2R8GA 4J9NA 3V81B 4OPJA 4J9MA 2V9WA 3QZ7A 4CJ5A 4C8KA 3KKSA 4DL2A 4AHRA 3HVRA 1CSJA 2XO7A 5HROA 1GX6A 1EXQA 1TKTA 3GIIA 4RNFA 2W9BB 2FBVA 2KQ2A 2X78A 3I0SA 4NCGA 4KO0B 5KGWA 5DG8A 1K6YA 4CGGA 2WHOA 4GMJB 4EEYA 2NUBA 1TKZB 2VG5B 4FLVA 4RNNA 4ZP7A 4Q5VA 1IKXB 4IRCA 1BGXT 1IO2A 2B6AB 4CFBA 3ZT4A 1RYRA 3RMCA 2JC1A 1TVRB 3V4IA 2RF2B 4Z4FA 4QCLA 3SQ0A 1JKHB 5DQIA 1HPZB 3IS9B 4KHNA 3V9SA 3O3GA 2W7PA 3VQBA 2KTQA 4M3WA 2RDJA 3JSMB 4YFUA 4I7FA 3EPGA 2C2EA 4CFCA 4ZPCA 3AO2A 5T7BA 3RMDA 2FJXA 4FW1A 3P5JA 1G15A 3NAEA 1J53A 5L1KA 4HUGA 3HVTA 3OLAA 2Z1JA 4WYWA 2F8SA 4FLUA 4DTNA 4RW7A 3CJ5A 2AGPA 2E9ZA 5KFEA 2VG7A 5J1EB 4JLHA 3L2WA 1JL1A 3TWHA 4ID5B 4I9QA 4NLOA 4CGDA 3SFUA 1SKRA 2IAJA 3MXMA 1KCFA 4CHNA 5KRSA 2GBZA 1HARA 1HNIB 5KG0A 3HP9A 4F50A 5I42B 5DLGA 4ZTFA 5J2MB 3RMBA 4KRFA 4JRQA 2GIQA 5KFMA 4YR3A 1LW2B 1S1TB 3EYZA 1TK8A 5F8HA 4IKAA 1EKEA 4E1MA 3C94A 1RT4B 2XI2A 3H98A 5C24B 2HMIB 4ZVGA 3LPTA 4QW8A 4O3RA 3G86A 4IG3A 4CHQA 1MMLA 4NYNA 4MK9A 4JS5A 1KLNA 2OPPA 2XY7A 5HLFB 4O3OA 4O55A 3L3UA 4GW6A 3AO5A 2YKMB 3KK1A 2WRMA 4LSNA 1T94A 3PX4A 2YNHA 1VRUA 3PW4A 1N4LA 3OYDA 4CJVA 4KB7A 1JLCB 3GILA 3VQ5A 1SV5B 2WCXA 1JLGA 1ZBUA 5HRPA 4Y34A 4OPKA 3MR6A 4CGIA 5KGXA 3NAHA 1FKPB 3MAQA 4WZQA 5KFRA 2XI3A 3H5XA 4QAGA 1C2PA 3JYTA 4ECWA 3KMSA 2IA6A 3QYYA 3DLGB 3RB4A 3LAMA 1WSIA 3ISND 5E41A 3NE6A 3ALYA 3DRSA 3VA3A 4KTWA 3OS1A 4TN2A 3LP3A 2HHSA 4RNOA 4MKAA 1RA7A 4QW9A 1QE1B 3MR5A 3KMQA 1BQMB 3DRRA 2Z1HA 3EPIA 3M8RA 2OZSA 2ZE2A 2P5OA 2B43A 3QESA 4ECTA 1LWEB 3NGZA 5FRNA 3BSCA 2P5GA 1J5OB 4DLEA 2O4IA 2WK4A 5KTQA 3FQKA 5CYQA 4CEZA 1A5WA 3AVKA 1JX4A 1QSLA 3CDWA 5FROA 1RT5A 4MH8A 4Y2AA 1U47A 5KFBA 1C0UA 2ILZA 1ZBFA 4BWJA 4FJIA 2OPRB 2VA2A 1NJWA 4B3OB 1RT3A 1RT3B 4Q8EA 4O5BA 3PR5B 1C0UB 2FVQA 4CK1A 1QAIA 5SWMA 4RNMA 2R8KA 1HYSB 2CKWA 2D3ZA 4BE0A 5FDLA 5DG7A 1SKSA 3OYMA 1N6QB 1ASUA 4F8RA 4R5PA 5J2QB 3WNHA 3LZIA 5EWEA 1LWEA 4E1NA 4BDZA 3DYAB 1S1XB 4X2BA 3NGYA 1NK4A 3AVFA 1S97A 2RN2A 4F4KA 1S0OA 4U7CA 4K4YA 4IR1A 1WAFA 1T05A 2HHXA 2DPJA 3THVA 1IKVA 2WONA 3ZSOA 1RAJA 3V1QA 3HP6A 2IOCA 2WOMA 4DU3A 3G6VA 1RILA 4DQRA 4EO8A 3CDUA 2IC3B 3SYZA 3OYJA 4KHUA 2HHUA 4JV2A 3JYTB 3OL9A 5KT2A 2V4QA 3CQ8A 2FBTA 5KFSA 4K4TA 2V0NA 1FKPA 2R2TA 2HNDB 1R0AA 2KZZA 2HHQA 4KAZA 2BDPA 3BSOA 2FC0A 2HHWA 3BDPA 2OH2A 4WZMA 3BR9A 3AVJA 4TXSA 3SQ4A 4LH5A 5I3UA 4IFYB 1L3SA 1REVA 4K4SA 5EWFA 5KFJA 3K58A 4DTXA 5K14A 3KLVA 5HRRA 4FJKA 4FJGA 3HK2A 2R2SA 3HSTB 2XY5A 2XC9A 4KTZA 3TAMB 4URGA 1J9AA 1SH0A 3QNNA 3OHAA 4YNQA 4FVMA 3BJYA 3OL8A 5KFPA 4J9PA 3KHRA 3G6YA 4Q8FA 1FXXA 3KK3A 3NCIA 1RTIB 5KFVA 3V6DB 3ZSVA 2YNIA 1HMVA 3H5YA 1HQEB 2XGQA 1RT7A 3G0ZA 1D5AA 2R8JA 1TAUA 5F9NA 4DL4A 4RUCA 4KHYA 2HHVA 4ZVFA 4I2QB 4ZP8A 4WFXA 1D9DA 3TAEA 4DG1A 4TY8B 1CZ9A 3P1GA 1DLOB 1RCHA 3V6HA 3C6UB 4FS1A 3CWJA 3BQ1A 4Z0UA 3UPFA 1S1VA 3O3HA 4DSEA 3V9ZA 1NKEA 4EBCA 3MECB 3WNGA 4BE2A 4DLGA 1RYSA 4Y3CA 5KT3A 4CEBA 4K8ZA 2LSNA 2A1RA 1VSKA 4DSIA 2WB4A 4CJSA 3NMAA 4KSEB 3ULDA 2R8IA 3QLHA 4ECRA 2KZMA 1XHZA 3BGRB 1IKWB 1CXUA 5CZ1A 3CIZA 2HHTA 1RT2A 1RTJB 4CEOA 1RT2B 5L9XA 3ZT2A 2JEJA 3ZT1A 4NCAA 3FSIA 1S0MA 4O0JA 3SUQA 4M95A 1QUVA 1S9EB 4KFBB 4DFPA 4KHMA 4CEQA 3OS2A 3SV3A 4DTRA 4CJWA 2AGOA 4DFMA 3I8DA 3DOKB 4M3XA 1TKTB 2W9BA 2E9RX 4WFZA 5HROB 3MECA 2B5JA 4Z4CA 1K1SA 4IBNA 1TL3A 2C2RA 1S1VB 3EY1A 3O4QA 3QEVA 1RTDA 1O1WA 3PHEA 3DLKA 4M41A 4DG1B 3H59A 4TY8A 4PUOA 3M8QA 4H4OA 1RDCA 3QEPA 3OYBA 4B9NA 5DK5A 1UWBA 3TAGA 3MR3A 4DQIA 2OPSA 4R8UB 1YTAA 3V6DA 4WE1A 2YNFA 4O3NA 4RW4A 3KK3B 4C8MA 3GQCA 3CO9A 1TP7A 2O4GA 3OVNA 4I2PA 4W5QA 1OS5A 1I39A 2FLNA 3KLHB 2F96A 3OYKA 2ZKUA 1FK9A 3OLBA 5KI6A 3TAMA 3LWMA 2BR0A 1X9MA 4MQ3A 4IDKB 3OYNA 2X6SA 4G1QB 1KVCA 5K14B 2FVCA 4KB1A 3E51A 1WSHA 1BI4B 4H8KA 5F8MA 3QO9B 2IM1A 1VSEA 4CHOA 3KOAA 1C1CA 4CCHA 4EO6A 4LQ3A 5C5JA 4HHTA 3H4BA 3M8PB 1QQCA 4OKEA 4Q44A 3T5KA 5C42B 1NKCA 2DFHA 4IR9A 3DLEA 4OL8A 3PW0A 1D8YA 3KLIA 4MIBA 4PQUA 1R0AB 4AILC 2HNDA 2JC0A 3LP1A 5KFXA 3KIOA 3NGIA 4KI6A 5HBMB 4ZP6A 3ZSXA 3O4NA 4DEZA 4J9OA 4GC6A 5EDWA 4MK7A 4IOBA 4O4GB 3HKWA 4YMEA 1L3UA 4C8LA 2QK9A 4IFVB 1QTMA 4ZPBA 1S4FA 3TVKA 2F8TA 3S3MA 1KHVA 4O4GA 1IKVB 5J2PA 3V1RA 4Z4HA 1LW0A 5HBMA 1RDAA 2IM2A 5KRTA 1TV6A 1IKYA 3V6KA 4K4ZA 2JEIA 3KLIB 1SH2A 1ZTTA 3TAPA 3DLEB 4AHCA 5EUHA 2BRKA 4K4VA 4XO0A 5C42A 4N76A 1RDDA 4FJLA 2QE5A 3CDEA 1A5XA 4MK8A 1BCMA 3OYCA 3M9MB 2VWJA 1S5JA 3DYAA 2W8KA 1LWFB 4R5PB 2PY5A 1RBTA 3RB6A 2FJWA 2Y1JA 4Y1DA 3LP2B 4C8NA 3V1OA 5FDLB 1L5UA 3IGVA 4ED2A 3B6PA 1B92A 4YQWA 3RB0A 4GC7A 2JGUA 1Q9YA 3SI6A 4DL3A 3SI8A 3I5AA 2G8WA 3GV5B 3DM2A 3SPYA 3LZJA 4DSJA 3KLHA 4W5TA 1RT5B 1X1PA 4F2RA 4Z4IA 3SQ1A 2FBYA 4F3OA 5T14A 1IH7A 1S1UB 3CFRA 3BQ2A 4E19A 2ILYA 1T8EA 4TLRA 3KLFA 1UWBB 1JLBB 5KFTA 3KD1E 1QS4A 3RAQA 4PUOB 3OYGA 3L2VA 2XGPA 4O44B 1QE1A 4HCCA 4Y2CA 1NJXA 3TANA 4RUAA 4FXDA 4YR2A 3PR4A 4CEDA 5C25A 2ETJA 4ED3A 1NHUA 2E4LA 4Z4EA 3HJFA 4ZP9A 3V9UA 4DSKA 4ZTJA 1TK0A 1S6QA 3DRSB 4GVMA 3AA2A 4ED1A 5F8NA 3QINA 5SZTA 4B9MA 1S9EA 2PYJA 3DI6B 3UIQA 4NLQA 1ZBHA 5L1IA 3FRZA 4LY7A 1QSSA 4KPYA 4W5RA 4F4ZA 4OKJA 2XY6A 3TAQA 3B6OA 2YKNA 3SUOA 1SV5A 4O0IA 4MFBB 1I3AA 2QKKA 3U3YA 3TQ1A 4FBTA 1VSMA 5KG2A 3TR8A 4NLYA 2X6NA 1IKWA 3BGRA 1KTQA 2E6MA 3VQCA 2AWZA 4KBIA 2GC8A 4DTSA 2YKMA 1RBUA 2R8HA 3U6FA 1UA0A 3MF5A 3OYFA 3V9XA 5HLFA 4KE5A 4FLWA 3AVHA 2OPPB 4CJPA 4DFJA 1RNHA 3VQ9A 3N6LA 5KFIA 4B8CA 3VQDA 1D1UA 4CESA 1L3VA 1Z4UA 4YR0A 4CJLA 1WSFA 3VQ4A 3CJ2A 3LANA 4FM1A 2J6TA 4ELUA 2P1JA 4EYHB 4ECYA 3ZSYA 3T3FA 2D5RA 4ECVA 1LW2A 2DPIA 3NF9A 5KFNA 3T5JA 4HVJA 4YP3A 4TYBA 3HPHA 4BE1A 4N5SA 5I42A 4R0EA 2E6LA 3BREA 3AVGA 4I2QA 3ZSZA 4HCBA 1C1BA 4RW6A 3TI0A 1WN7A 1HNIA 2VWKA 1S49A 1Y97A 1RT7B 1HQEA 3PX6A 3OL6A 5DLFA 1C1BB 4RW6B 2HWIA 2GV9A 2GIRA 4NYFA 1W25A 3D28A 1WLJA 4KTQA 5J2NB 4H54A 2R2UA 2F8EX 2KFZA 4AH9A 3SQ2A 4CGHA 1NK8A 3NF8A 3LP0B 3HVTB 4ECZA 3CFOA 1GOAA 3SNNA 2ATQA 1LAVA 2D0BA 4CHPA 2VG6A 3OSNA 3NF7A 1LV5A 3PY8A 1ZYQA 1C1AA 4FJ8A 4IFYA 1KSPA 1QHTA 5HRNA 3F73A 4EP4A 4E0DA 1YT3A 4JV0A 2D7SA 2ALZA 3L2UA 2RPIA 3K59A 1LAWA 1KRPA 2QXFA 3V4IB 1TVRA 4EP5A 2E9TA 4MFBA 1TKDA 4J2AA 1VSJA 2B6AA 3S3OA 3RWUA 1U04A 1JLAA 1RT6A 4KHSA 4QWEA 1F21A 3RTVA 3DI6A 1KFSA 4CIGA 1GOBA 3M8SA 4NRTA 4IH5A 3CJ4A 2WOMB 3AO1A 2BRLA 4IH6A 1S6QB 3P83D 1NK5A 1S9GB 4KO0A 5KFKA 2WONB 5JUMA 3AV9A 3DLBA 2HAIA 3VQEA 5C25B 3PUFA 1T05B 4DS5A 1NK0A 4TYAA 2HWHA 3RB3A 4U6PA 1VK0A 3HPGA 4O44A 4J9RA 4F4WA 4M94A 1W0HA 4BWMA 1JLBA 3NKYA 3LPUA 1IM4A 3CG7A 2FBXA 3AVAA 1NNDA 4E7KA 2O5DA 4QWCA 1S1UA 1IG9A 3PO5A 4B9TA 2PYLA 3OS0A 5KG3A 4AHVA 4NYZA 3BSNA 2VA3A 4QWBA 1NK7A 4OJRA 1TK5A 2W7OA 1ZBLA 2W8LA 4KHRA 4CGFA 1Q8IA 2OPRA 1SL2A 3AO3A 3HO1A 1C0TA 4EBEA 4Q0BA 1JLQA 2XRIA 3KK2A 4FJ7A 2G8VA 4JV1A 2FVPA 5CYQB 4RW9A 3H5SA 1J5OA 4CJUA 3QEIA 1VSHA 4FJXA 4LSLA 1RT1A 5KFCA 3Q8QB 1BIZA 1MU2A 4HUEA 2DFEA 2FLPA 5KG6A 4MKBA 3I0RB 4CF0A 2DY4A 3ZT0A 3S9HA 1EP4B 3AO4A 4WXWA 1TV6B 1SL0A 5KFLA 4TY9A 3RAXA 3ASMA 5KT7A 4DL5A 4FJNA 4FS2A 4ELVA 4RU9A 2W42A 4ZVHA 3T1AA 1B9DA 1NJZA 3DLGA 4CE9A 4FZXC 1U48A 3K5NA 4MIAA 5DGBA 1S1WB 5DGAA 1XHXA 1BQNB 3PW5A 4CJ4A 1X9SA 3C6TB 3MFHA 3CM5A 4CECA 2P51A 1HNVA 3L8BA 4F4XA 4RW8B 4CFDA 2ZD1A 3OL7A 4W5OA 3H2LA 3M8PA 3KHGA 3FFIA 2XHBA 3RR7A 3HPOA 4KHQA 1C1CB 3QIPB 4QOZB 4EZ9A 1VRTA 3QGGA 4IG3B 5KFFA 4DTMA 3CM6A 5KT6A 5F8IA 3DOLA 1WNSA 3A2FA 5C24A 2HNYA 4IDKA 4NLTA 4FK4A 4ZMMA 4HUFA 5KFWA 4E7IA 3KTQA 4KHWA 3QGHA 2EX3A 3DLHA 2YHAA 3D5MA 1KFDA 5J2MA 4I2PB 4FBUA 3IG1B 4O4RA 1N56A 4K4XA 4DFKA 1S48A 4DTUA 4KB0A 4K50A 4RW4B 4DS4A 4WE1B 4CEEA 1HQUA 5JS2A 5KFQA 1TL1A 3ICLA 4DQQA 3BQ0A 2IAJB 4EYIB 1RBRA 3NBPA 4F2SA 2BANB 4H4OB 3M8QB 1QSYA 2CJQA 3FDSA 2C2DA 4ID5A 1VSFA 4FK0A 2AJQA 3NH0A 4CIEA 1JXBA 1RTDB 2VG7B 2ATLA 1ZETA 4J9KA 4RW7B 1TL3B 4IKFA 4FYDA 2IJNA 2B5JB 2YNGA 3MXJA 3PX0A 3DOKA 1S10A 4HKQA 4IG0A 3SV4A 4CJQA 1EETB 1GOCA 4DF8A 4KFBA 5CYMB 3O3FA 2A1SA 4DQPA 4N56A 1KHWA 3D45A 1DTQA 3MEDB 3M9NB 1HRHA 3LAKA 1I6JA 4I7FB 1WSEA 3JSMA 1BL3A 5HP1B 1WSJA 4CJ3A 4OKKA 2W9CB 1RTJA 3UDLA 1NK6A 5HP1A 1J54A 2ASJA 4ED7A 3SZ2A 3QLHB 2EC0A 4FLTA 4ECSA 1WSGA 3MEDA 1DTQB 4M3UA 4PWDB 3H40A 3S3NA 2FVRA 5CYMA 4N47A 3SJJA 1XR6A 4ZPDA 4DQSA 2PZSA 4DWIA 4IG0B 3PV8A 1A5VA 3I0SB 4IH7A 3QGIA 2YNGB 3VQQA 1B9FA 4QPXA 3TAFA 3U3GA 4FLYA 4I9LA 3F9KA 4CJTA 3DMJB 3SUNA 4Z4GA 4AHSA 3C6UA 3ZCMA 3V81A 1DLOA 5FRMA 4QWDA 3UR0A 2UVVA 1Z26A 2BANA 2UVUA 3HL8A 4ED0A 1SKWA 4JS4A 4CJRA 1LWCB 4KKOB 3TABA 3G10A 2GUIA 1HMVB 1TL1B 4J9SA 2YNIB 4JUZA 4WYLA 1RTIA 1N5YB 1D9FA 4ZHRA 3HM9A 5CZ2A 3IG1A 2HVHA 3OYHA 1HYZA 4CIFA 2KFNA 3KHHA 1KVBA 3VA0A 2OA8A 2HNZA 4WXOA 3HVAA 1WNEA 1SUQA 4RZRA 4FM0A 4ZPAA 3VQ8A 1DTTA 3QIDA 2UVWA 1JIHA 3MTKA 4K4WA 3L3VA 4JRPA 3VQAA 1REVB 4E89A 2BQ3A 5I3UB 1T03A 4DU4A 3I5CA 4CHYA 3PZPA 2IMWP 1ZTWA 5EWGA 1SH3A 3FFIB 2UUWA 4XPCA 3KLGA 3NAIA 3C95A 4ELTA 5D3GB 4M3TA 3FQLA 4RW8A 1S6PA 4NCBA 3LALA
chains in the Genus database with same CATH superfamily
3EZUA 4H4MB 1RE1B 1VQ7S 1Y00A 3WNFA 2VDIA 5CYJA 4BCAA 1ITGA 4ICLB 4K7QA 4BACA 3F56A 4GKKJ 3LDLA 3GTYX 1Q81T 2ZQBA 2HGMA 1CC8A 1GMUA 4G3IA 2IY5B 3PXGa 1NJYA 1VSIA 3M6GA 4J9UE 2FLLA 4FXWA 4CP5A 4ED6A 1MN7A 4ZJQA 4M1KA 1TFYA 3MN7A 4TU8A 3FKBA 2XCPA 2JEGA 1NMDA 2FHJD 3HHLC 4LQ9A 3LDNA 5KFOA 4OZ0A 2DGQA 1RT1B 4DPUA 5F3TA 5CCLA 5EXWA 3I9V9 3VGMA 2QLJB 3GU0A 1N6QA 1NPPA 3I31A 1QVGR 2JWNA 1UOCA 1HYSA 4FKXA 3FBBA 3K57A 3KK2B 2V94A 1HI1A 1U45A 3LL3A 2MY7A 2VONA 4B3OA 2ABYA 3H8YA 2YKQA 2G8KA 3JS6A 4LUBA 3TX0A 3I4PA 4MLEA 3TTDA 1U09A 4QIEA 4HYKA 2OTJS 4DTPA 2Y1IA 3K2PA 4J2DA 3MR7A 2XULA 2VFUA 3PSFA 3G71N 1U24A 2RIJA 3CYMA 3AXMA 3ZZTA 1OSCA 5LJVA 3QFHA 2IJFA 4RJVA 2RHQB 1RTHB 4GVEA 5MLCQ 3M6UA 3GYNA 3NGSA 1X9WA 4FL9A 4PG7A 2E2OA 3FZFA 1BIUA 2WTFA 4W5NA 4YHHF 2DNHA 4KH5A 3AVBA 3ZZPA 4CF1A 4M3RA 2Y8WA 4DR2J 2OJ3A 4JI8J 4OI6A 1LKZA 4ZN1A 3I9ZA 4FLXA 4HH1A 1GLLO 3BUZB 3T5LA 3HSZA 4RR5A 4H4KC 1FKOA 5DG9A 1N34J 1DJ0A 5D3GA 2CPJA 1NXIA 1RU2A 5M1OA 3KLGB 1IVZA 2R42A 4MMOA 5KT5A 4DUZK 1T03B 1XWLA 3MMJA 2ADCA 3VZIA 3MMCA 3HTVA 4KRWA 1MG7A 3RW7A 4DCJB 3W63A 1T6CA 3ZSQA 3J7YP 5JS1A 2W9AA 4GO7X 2RDIA 2HNZB 3MEEA 4XH4A 1HJRA 3NGDA 1NHVA 4JI0K 5J2NA 3M8ZA 2W7AA 1M5KC 3HD1A 3PEHA 1K8KB 3N5FA 3Q2TC 3P49B 1OVYA 7FD1A 1XNRF 3A12A 4CRJA 4O3SA 4CJKA 1MWYA 4TSXA 2FJVA 3OTOK 4KGKA 3QZ8A 4DUYF 3UE2A 3THTA 2DCLA 4USJC 4DSFA 4I4BA 1AYEA 2PT0A 5J1EA 4CF8A 4FWRA 1LWXA 2XY8A 1H7XA 3WX4A 3DXBA 3N6MA 3RJMB 3HT3A 4KHPK 3TARA 2OP5A 4B9VA 2IDEA 2HLUA 1N48A 4IO9Q 1DKGD 2UUTA 4PWDA 4X4NA 1SAZA 4P2MA 2C2ZB 2N3OA 2J0SD 4H5VA 2CG8A 1WAJA 1FKOB 5F8JA 1K9MT 5KFHA 4CGJA 4FCYA 4ECUA 1EQ0A 4EFAC 3GV8B 1IKXA 4NRUA 2DK2A 1FNOA 1SL1A 4BRQA 5A76A 3WUHA 4CJEA 1RK8A 2VBYA 2EBGA 3CD0A 4FWMA 1NOYA 2KG0A 3L6QA 3CDAA 3IRXA 2GAHC 5ETLA 4WP8A 1W2BM 3KLEB 5K9FA 4CT8A 3D0PA 4ANDA 3D1HA 4YY3F 3PIOL 1BD6A 4P9SA 1KLMB 1WOOA 1HQUB 2ZWOA 3BH6B 3TJ9A 3O1LA 3AHPA 3AOBA 3PKYA 4WJBA 4PA1A 3U8XA 3I32A 2B4UA 2AX1A 1VC5A 3DM2B 2HF3A 2OPQA 1RBSA 5F41A 3LA0A 1R7IA 3MCPA 4ILGB 1NLKL 4EK2A 5KFGA 2ZBRA 3CMES 3IN5A 1NZ8A 2NSBA 1K73O 4JI3J 4Z94A 4ZVEA 3ZZYA 1ZA1B 1XIQA 3A8YA 1Q4RA 2F9JA 3EZ5A 4K2XA 4JEPA 4GKJJ 3HHKA 4L8RB 4LR9A 2Q31A 5DQGA 3QEWA 2M8HA 3O9UA 1VQ6N 4ECQA 1VFJA 4Q43A 4B08A 1IKYB 1YZ7A 2QGFB 1S1WA 3NF6A 4LC9B 4E1JA 4RWXA 3OYLA 4K0KF 3H90A 4EUVA 5E33A 3CVKA 1P90A 4OPAA 1YJWS 3KJNB 4H4MA 4NWBA 1RTZA 3KJVB 1VK8A 3OY9A 5CD4H 2OIHA 2XHCA 4BC7A 2G8IA 2CQ1A 1U4BA 1SI9A 4NZ0A 3TUZC 4ZVOB 4B3TF 3NRBA 4NLDA 1Z1ZA 4U67Q 2BUNA 4WFAL 1SIZA 4OX9F 5LMNF 2B9YA 3UCUP 4KI4A 2IDOA 3VAGA 3GE9A 2G8FA 2EXUA 2E1MC 3E01B 4FW2A 4H5TA 2NRRA 3AVCA 2MQPA 1KR4A 4QQBA 2DHXA 4RW9B 1NKBA 3CPEA 1ZBIA 2XG8A 3RBEA 2FZCB 3AA3A 2YHBA 2BVZA 4CZLA 5CY4A 1FK9B 1WHVA 4EHTA 3NH1A 5KFDA 3J7AN 3UN2A 3OSPA 3CXCR 3U1NA 4ED8A 2D4WA 3MEGB 4N8OA 4ENOA 3OFGA 1N5YA 2YNFB 3EKSA 2V6AA 2VBXA 1T3VA 2OPSB 4KKOA 1LWCA 4DL6A 2IVYA 4CH1A 3PJXA 4PPDA 3TTFA 3VQ6A 1F6TA 3RBDA 2Y0SD 4J9QA 2R8GA 3V81B 1U6BA 3JQJA 4CJ5A 5KPTA 2QSFA 3L4BC 1NGDA 1EXQA 3FUYA 1TKTA 1WDTA 2FBVA 2KQ2A 2KT5A 4NCGA 1VQNN 5DG8A 3ETOA 3D2FA 3V4MA 3GR1A 5B8HA 2NUBA 3C3LA 2MZRA 4IWVA 4JHDA 4IFEA 4RNNA 4IRCA 3GFZA 2B6AB 3UCZP 4JI7F 4LVOP 1RYRA 1RKJA 1TVRB 2RF2B 3SQ0A 1QTNB 1HNWJ 3IS9B 1EKSA 2I7NA 3V9SA 1RWPB 4C1NK 3FGUA 3VQBA 2KTQA 4OJGA 4I7FA 5IWAF 4CFCA 3R8EA 2E2NA 3EKUA 1U25A 2FHKA 5T7BA 4TLQA 4FW1A 4YDXA 2LDYA 1MMNA 2ACMA 1G15A 2GMLA 3NAEA 2POKA 3R5DA 3AD9C 3OLAA 4HDGA 4MYUA 1TL7A 3Q7BA 4WYWA 2E66A 4CLUA 3D6MB 3CERA 4DTNA 2AGPA 3AD8C 3H0PA 2O01C 5KFEA 2A6OA 2KI2A 4WKYA 1DQAA 3QBWA 3R97A 3G2XA 1MWZA 4YOWA 1WC3A 1SKRA 2OANA 2KXFA 4NA2A 1K8AT 3VEZA 2QXLA 4B3RJ 1HARA 3GCXP 4ES2A 3UI3A 1R8PA 1BOTO 3VV2B 4ZTFA 2GIQA 1S76D 2J8SA 4P7VA 1RXOB 2RH3A 4K59A 5F8HA 4JYAK 7AT1B 2GO8A 3OW2R 1FF2A 4E1MA 5AQNA 3C94A 1RT4B 3H98A 1YBAA 1LFWA 4ATNA 3LPTA 4BREA 1MMLA 1OYEA 3CW2C 4XEIA 2DNQA 4JS5A 2K3IA 1HW8A 1FRLA 4O3OA 4O55A 3JQMA 4GW6A 3PFOA 3CCVS 2YKMB 2WRMA 2YNHA 2GHWA 2LLZA 3OYDA 4CJVA 1BWEA 1FA0A 2NRHA 4F4AA 3GILA 3ULEA 3GG4A 1JLGA 4WTOB 5ADXA 3CCUN 3NAHA 1FKPB 3H5XA 1YHQN 3JYTA 1HLWA 3M32B 1KQKA 1ZAVA 2IA6A 1RP5A 4HACB 3ALYA 1MW7A 5AQWA 2GGPA 3VA3A 1VQMN 3MGJA 5JLFA 2ZC3A 4DU8A 1RUSA 3ID6A 4FO0A 1HNZF 3A3PB 4PG6A 1RA7A 4DR5K 4M5MA 3CT9A 2X51A 3MR5A 1FRKA 3C15A 1HHSA 1VQ9S 2OZSA 2ZE2A 4DCPB 4ANCA 4EMDA 3EGVA 1LWEB 1BUXA 1YRXA 1J5OB 2H3GX 2O4IA 2CPEA 2WK4A 2ZC4A 4DMZA 3FQKA 5CYQA 4JV5J 5D0HA 2D1KA 3OTDA 4WQ5C 3H7HB 3GJRB 5FROA 1U47A 5KFBA 1D3WA 1UTAA 2OPRB 2VA2A 5IFMA 1RT3A 1RT3B 1JWWA 4CBUA 2O8FA 4F36A 3PR5B 1C0UB 4CK1A 2V8PA 3UW1A 1C0GA 4NOHA 5FDLA 4OJ3A 5GAGU 1UVIA 4I67A 5M1FA 1VC6A 4DV2K 3IMXA 3LZIA 1LWEA 2OAUA 1NK4A 4X2BA 1N0VC 4S0MA 1YJWN 1TYQA 3AVFA 3OD2A 1S0OA 4U7CA 3O3LA 5I9EB 1M5HA 4LF8F 3MWPA 3EGWB 2RQKA 3QT7A 2HHXA 4NE9C 1IKVA 3OTCA 2MYFA 5LT5A 1CZAN 3ZSOA 3EDQB 3SSRA 3A8JA 1H73A 4OYIA 2WOMA 2I0XA 4DL0C 3G6VA 1YUWA 2IJRA 4EO8A 3CDUA 4C97A 1N36F 2IC3B 2KT2A 3OYJA 2HHUA 1Q86T 4LFBK 3JYTB 3P45B 3RW6A 2V0NA 1Y5IB 4JI4J 4U95A 1B0PA 1R0AA 2HHQA 1AW0A 1A7GE 1F0XA 3H2VE 4CW7B 4DV1F 2FC0A 2J5AA 1AA1B 1NZAA 4LF6J 3BDPA 2OH2A 2FF3B 4TXSA 2XWXA 1NH8A 3MWBA 1L3SA 4K4SA 3KWGA 4FPBA 1HWIA 4DTXA 5K14A 4FJGA 3HSTB 4A8OA 1HUXA 3GR0A 2XC9A 1J9AA 5F2RA 1SH0A 3NS7B 2MHEA 2MSTA 4OX8A 1T9UA 4A8SA 3DXMA 3D3BJ 2LCWA 4OI4A 1UEUA 3H46O 2C3OA 1ZM3A 1K73T 4Q8FA 2XMKA 2DR5A 2VFRA 2JVRA 4AF1A 2HHPA 1HQEB 3TUPA 4DL4A 1VMBA 4ZP8A 1KQGB 4RBVA 1OY8A 8ATCB 2DH9A 2P2CB 1IBLJ 2PEHA 3CWJA 3CD6S 3ELHA 3R1LA 1AT1B 2W2NP 3MECB 2CQ0A 3ENVA 2HKEA 3WEEB 3P4UB 4BE2A 2VV5A 1TMJA 4B9QA 4Y3CA 1NGIA 2DH8A 3C0BA 2VQEJ 4JV5F 4CTAB 4BR7A 1JNZB 4UY8T 4GKKF 2FDNA 4ETXA 5JVGL 3MMBA 4OMFG 3CCRS 4CJSA 1S57A 3R5BA 3BGFA 3ULDA 3MDQA 2P9SB 2BW2A 4V19J 1IKWB 3DLLQ 3JAMO 2V63A 1KONA 3ZT2A 4AQYJ 4JK7A 4G65A 2JEJA 4HI2A 1SCJB 3OT9A 4I6AA 1BO5O 3CC2S 3SUQA 5GAEU 4KFBB 4DFPA 4ZPVR 4OYOA 4K41A 5F0XA 4DTRA 4CJWA 3OTOJ 3DWLA 3DOKB 1YX2A 4F02A 2H54B 3DXSX 2W9BA 2E9RX 4Z4CA 1TL3A 1Q1KA 2P9GA 1YDLA 3PHEA 4WIQA 4DG1B 4TY8A 4JKEA 4PUOA 3OA9A 8RUCA 1RDCA 4H4OA 3RAMA 5DK5A 3HHLB 2Q36A 3CMAN 3FEYB 1YTAA 4WE1A 2LFVA 4F0MA 3KK3B 4OZ2A 3GQCA 3VERA 2L9NA 5BR8K 4C1NI 2ZHOA 4K8RA 1Y4ZB 3TR5A 2F9TA 2M52A 2ZKUA 1FK9A 5HQLA 3TAMA 2D3O1 1C4CA 4G1QB 1KVCA 2MZSA 2VJUA 5HQMA 2OMLA 5E3QA 2IM1A 1JB0C 4FPIA 4CHOA 2QYGA 4QPTA 3CCLN 4CCHA 5B0EA 3CCEN 3MD1A 5B0DA 4CQ1A 3FVYA 4HHTA 2P9LA 4Q44A 4X66K 5C42B 4K5SA 3ILLA 1B7FA 1BLUA 4OL8A 4JI8K 4DX7A 1D8YA 5C10A 5AQJA 3KIOA 4KI6A 4AXJA 5HBMB 3O4NA 3DFEA 4GC6A 1SC1B 4O4GB 2J9DA 3AJ2A 4C8LA 4ZPBA 3W3SA 3R3TA 1CEZA 4I6YA 2E1YA 1KHVA 4O4GA 2ZJPQ 3PIOQ 4JKBA 1OJ4A 5HBMA 1TV6A 1IKYA 3V6KA 2ZKTA 3NP5A 3LM9A 1KN6A 1HR0F 5GADU 2QTDA 3DLEB 4AHCA 2BRKA 3J81j 2WC9A 4N76A 3N4PA 4X4SA 1RDDA 4WU3A 3CDEA 2ACYA 1WG5A 3WXKA 3DYAA 1C4AA 2C42A 4LF7K 1AUSL 4WKRA 3W8GA 2GQCA 2DHHA 4RLEA 1L5UA 2B9EA 3B6PA 4LJMA 3AAPA 4YOTA 2QC3A 4GC7A 2W25A 4DV3F 1WOSA 3SI6A 4WK3A 3SI8A 1NLVA 3DM2A 1F9FA 4DSJA 4P6QA 1X1PA 2X1GA 4Z4IA 2ZH2A 3Q8YA 3SQ1A 1VQ8N 5JMNA 3QJJA 1QQOA 1R0BG 4OZ3A 1S1UB 3BQ2A 2UUAK 4E19A 2ZOGA 2ILYA 2QMXA 3U27A 5CZXA 1OH5A 1T8EA 2A2CA 2XS7A 3NVKA 4NX9A 4PUOB 2KO1A 3THYA 2XGPA 2JFKA 1RFQA 4YR2A 3PR4A 4CEDA 1IN0A 4DV7F 2ETJA 4ED3A 4CLLA 1NHUA 4JI2F 4ZP9A 3V9UA 1NB2A 1HFEL 3DRSB 4JI3K 2H51B 3UIQA 4NLQA 3WBZA 5L1IA 2MQQA 1N33F 1QSSA 4I68A 5BPLA 1CJKB 5LMNJ 4UY85 1SV5A 4O0IA 4MFBB 3VWSA 1RWMB 5B0AA 5KPZA 2X6NA 1IKWA 1YF5L 4KBIA 1IR0A 2D0OA 5HAOA 3U6FA 3OYFA 3VAMA 4FLWA 5IT0A 3DXKA 2ZM6K 3O5BA 3IFEA 3CCJN 3MMBB 4OZ5A 2RSQA 4K0KJ 2VC1A 1EO1A 1D1UA 2W24A 4YR0A 1VHXA 3C14A 3G4SS 4NLCA 4BRDA 3CJ2A 1H38A 4BQZA 1MMDA 2P1JA 1SQFA 3W2VA 3WEEA 4CLFA 4ZCKA 5BYQA 5K8OA 5KFNA 2CNKB 2ZFHA 5THWA 4HVJA 4YP3A 2B7BB 2V8GA 2OSQA 2E6LA 2JLGA 5AQHA 4RW6A 4HTIA 2VWKA 2E8AA 1Y97A 1RT7B 3MN9A 1SZ2A 2HWIA 2WVDA 4DB3A 2GIRA 2MGZB 4NYFA 3HMJG 1WLJA 4NZ7A 5J2NB 3HRGA 2R2UA 2LECA 3LGHA 2UXDF 3U4LA 1OVQA 3D2EA 2BM1A 1DQ8A 2UV8G 1VHIA 3GYGA 3HVTB 1DHMA 1NGJA 5AQGA 3CFOA 1LAVA 1YITN 1LV5A 1ZYQA 2KKZA 4IO1A 1KOHA 4IFYA 1WC6A 1KSPA 1UCNA 5HRNA 3J80Y 3Q2SC 2XMAA 3I96A 5HVGA 4LRCA 1OH6A 2JFDA 3K59A 1KP6A 1KRPA 2YX6A 1KBRA 1QVFR 5AQOA 2C2OB 4JKFA 3M2VB 2EKYA 2CNLB 3VHQA 3T9NA 4A62A 4KIAA 3D7SB 5KOXA 2DGTA 4USMA 3T1HK 4LFCF 1BHNA 4IH5A 2WOMB 3VENA 5L46A 1B7YB 4AM7A 2WONB 1UJ6A 2HAIA 4LRFA 2DXFA 3PUFA 1B70B 2L9WA 4A57A 1VK0A 2HBRB 3THYB 2V51B 4M5IA 2E2QA 2ROPA 1YRUA 1W0HA 4BWMA 3MCSA 3EM1A 2FBXA 3AVAA 3M2RA 2LXUA 1NNDA 4E7KA 2IMOA 4H0TB 1S1UA 3PO5A 3MOJB 1VQON 4B9TA 2PYLA 2NS1B 4FWQA 4QWBA 4OJRA 3KJQB 3Q0AA 2ZNYA 4USVA 4JAXA 2W7OA 2W8LA 4Z2XA 1Q8IA 2OPRA 5KPRA 4ZK7M 3M05A 1FCAA 4Q0BA 4BLGA 2ZH6A 3KK2A 2RNEA 2YKOA 4CZFA 3SK3A 5CYQB 3NOGA 3FMWA 1J5OA 3FCVA 1KD1O 3QEIA 2M7SA 4OI1A 2GW8A 2MY8A 3UD4P 3L3CA 2XZWA 4X65F 3Q8QB 1UL3A 5KG6A 4DV5F 1RU1A 1M5VC 1SXLA 4CF0A 2DY4A 3S9HA 2NZ4A 3AO4A 1YJ7A 1XMOF 3TUJC 3AJ1A 3ILIA 3SJHA 1TV6B 5KFLA 2Q6CA 2XZTB 5A2QO 3G6ES 1NGCA 3HF5A 4M7YA 1YZ6A 1RHMB 4BRIA 2IVPA 4ELVA 1UFLA 3VESA 4RU9A 2GGPB 1ZBTA 2KN4A 3NCQA 3WX8A 1B9DA 3AQOA 3R6LB 1NJZA 1DURA 4FZXC 3M32A 3W65A 3J8AA 2CJYB 1RJJA 3VGTA 3PNIA 2YWHA 4RCHA 4CJ4A 1CLFA 3Q86A 5HO4A 3SXLA 3ULEB 3L8BA 2DNGA 4CFDA 3FRYA 1F5BA 1AUDA 3IP0A 3ZX2A 4DR1F 1HNWK 4DR2F 5IC6B 1WC1A 1U26A 1U1PA 2XYHB 1UVKA 1RAGB 4AM6A 3QGGA 2MZJA 5D6GA 2HNYA 3EVMA 1S99A 3JB9k 1VQ5N 4FK4A 5HVFA 4OLPA 2Y8YA 2V34A 1WELA 4LIWA 4M5LA 2PDAA 2P8IA 3H3NO 2FC8A 3AQPA 1R27B 4DTUA 4KB0A 4CEEA 3IO1A 1TL1A 3ICLA 3P5BP 3SSQA 2F4FA 2IVOA 1FXDA 2MKKA 3UKRA 4EYIB 1RBRA 4H4OB 4IEIA 4ID5A 1VSFA 3KZBA 3NH0A 1ZZNA 4MTPA 4CNZA 1TL3B 2VBWA 4CM0A 2IDLA 5IM0B 3VGVA 2GIFA 3PX0A 1LQ9A 3G9CA 4CLKA 3CCMS 3GJTB 4IG0A 3SV4A 4OZLA 4ZOSA 1GOCA 4KFBA 3BYPA 4QIWD 4M5JA 3M9NB 1I6JA 3UN3A 1HX1A 2WVCA 4BRMA 1E6YB 1TTHB 2GVDA 1WSJA 5HMYA 4CJ3A 2RRBA 2DRDA 2W9CB 4P2XA 1OYDA 2BTFA 2ASJA 3TW0A 2HHHF 2CQ3A 2EC0A 1X4FA 1AFIA 1DTQB 3H40A 4JHDB 4A8QA 1WF1A 1UVLA 1XR6A 1ESVA 4ZPDA 4DQSA 2Q66A 4NA3A 3D2FB 5E7OB 3T1YK 1DGKN 2MJNA 3I0SB 4IH7A 3VQQA 1B9FA 4QPXA 3TAFA 4ZS6A 2C3PA 4I9LA 3WIVA 3F9KA 3A13A 3DMJB 4PPZA 4JKGA 3V81A 4DI6A 2OMOA 2BUPA 5GADI 2CA9A 2WW8A 2LA4A 3HL8A 2H4WB 4DR7K 3UKRB 1Q5YA 1KQSR 4FKYA 3TABA 3EGNA 1F60B 2E5LK 2GVZA 1TL1B 4J9SA 2HGLA 3CB4A 1N5SA 2KRRA 1N5YB 2W01A 1D9FA 2XZDB 3RUBL 1GLAG 2HVHA 2E88A 1MWMA 3DXMB 3E8OA 3KHHA 4F3QA 2J7WA 4AQYK 3MWTA 4Y2KA 3O2IA 4BHQA 2UXCJ 4ZPAA 1KEKA 3Q22A 1QHAA 2JZ5A 3QIDA 2UVWA 4U9RA 1JIHA 3L3VA 5LSLA 1N36J 4JRPA 4H0OA 3VQAA 2H3EB 2GX9A 2BQ3A 5I3UB 4BY9C 4YOYA 1VIOA 3PZPA 1TMMA 2IMWP 5CXTA 4JN4A 2QA4N 5LMUF 3EE8A 1VYAA 4EGLA 1FD8A 3TNVA 5EX3A 3LALA 2MDAA 2MKHA 1WKLA 1BQNA 4BR4A 4JI4K 3W7BA 3QDKA 1P9QC 2XS5A 1WF2A 5L1LA 4ZVSB 4PKHA 1HD1A 2IC3A 2VQFF 4PWUA 2DTUA 2HIYA 5IZHA 1FVQA 4WFAQ 1FJGJ 3E9LA 3PW7A 2IGIA 2ZH4A 1RLCL 2J6SA 2CG4A 1M5SA 2D74B 1Q82T 4USTA 3L2RA 3MEKA 2FB0A 5IV4A 3HULA 2Q1LA 3L2QA 1FEHA 1HW9A 2VD3A 2HQGA 1EKRA 4JI5J 1T7PA 2F65A 1TUWA 1QAJA 1XI1A 3VALA 4ZCIA 1F2HA 3MX2A 4KGVB 1P27B 2J7KA 3RGIA 3CPWM 1Q8LA 4RWTA 2KVIA 3CCSN 3IR5B 1VQMS 2NUUG 4Q0BB 3K5MA 4X62J 4B3TJ 2Z8QA 1LEOA 2O8FB 4M3YA 4KREA 5F9LA 4CO2A 2D0PA 4AHUA 5EN1A 1QQNA 1B0VA 1IJJA 2BZ2A 1NDPA 1ULRA 4WPAA 1TL5A 3WDOA 2E44A 3IRWP 2HZAA 5AZIA 1LOUA 4ZPTR 1VQLN 3ET6A 3M2RB 3R5CA 2QG9B 2AGQA 4H0PA 2COLA 2PD1A 4OGCA 3PW2A 4BS2A 1MNEA 1UA1A 4OX7A 3KLEA 4FJMA 5ETRA 2NYIA 3IRXB 3LGMA 3R1XA 3NDKA 2KW4A 4NLRA 1TQLA 1FXRA 3BGOP 3DU6A 2J0WA 4LF9K 2D9PA 5KFYA 2ZZMA 2QL5B 4E3SA 1CQNA 2DY9A 4EWTA 1J27A 2ZBPA 3TQEA 3H08A 2BGGA 2CPYA 4QOTA 4E7JA 1I94F 3O8WA 4BDPA 5BYRA 1VBZA 5KT4A 4FZYA 4OGEA 3TRGA 2BJ9A 3VVUA 2ROGA 1JLGB 1JLCA 5KFZA 1S77D 2UXCK 3HT0A 1Y3KA 4L6V3 1ZS6A 2BE9B 2Z2MA 4ECXA 4IRKA 4F3TA 4CZIA 3CC4S 4UY8O 1Z25A 2KHOA 1T9XA 3G8SA 3MURP 1NNEA 3IAYA 2AU0A 1T3OA 2FGCA 2UUAJ 3P8BB 2UZAA 3IM8A 4M5NA 2C3UA 1WACA 3WXIA 4FVUA 3TEHB 1N5TA 1RT4A 2XNRA 2IBKA 3EE9A 4BC3A 3SDEA 1B99A 1B4SA 4EU0A 3V9WA 2HVZA 1NU0A 5HVHA 2RE2A 3D54A 2FSKA 4E2FB 2P5VA 3PACA 4C6AA 5CABA 4FJ5A 2RS2A 5MAOA 4LMZA 2FLOA 3F5TA 1NG9A 3J7ZT 3V6JA 4DV2J 2XMJA 4XPEA 4Q45A 4ALZA 4CD3A 3TSPA 2HB5A 2MSSA 3TTCA 1L3TA 2DRAA 1A9NB 4XTTA 3OXGA 3MEEB 1VQOS 3NG8A 5L9NA 4EBDA 3VF6A 1K1QA 3TU5A 3A5OC 4HHJA 3K5LA 1R8HA 1TGOA 1DARA 4UTGA 1Y64A 3SCIE 2YKPA 3JQKA 1Q81O 1B0TA 3PRBA 2V4RA 1E4GT 3PLAA 1RKIA 3Q8PB 2XO6A 2UUBK 2AV5A 2DYAA 4DSLA 3MR2A 3JS9A 1YTUA 4OYBA 1NJIO 1WHXA 5C7PA 5BR9A 3THXB 2BYCA 4JI1F 3CFPA 3AGKA 5KG1A 5FPMA 2YQ1A 2OEKA 5KG7A 1WOQA 3NGKA 2P9CA 4U8YA 4B9SA 3AVLA 2X7IA 1DRZA 3QWUA 3G8TA 1ZC6A 2R2RA 4ID1A 5DDQC 5B0GA 4NCGB 2UUCF 3CF5L 3BS9A 1O13A 1RI7A 1WD6A 5ETKA 1N32F 4QJVA 4RUBA 1LNQA 2J7UA 2FZGB 2AMCB 4Z7YA 2RDDA 3KNAA 3DDNA 3GIJA 1HYVA 5JJBA 3OYIA 3GG1A 3C7NB 4JKAA 4FF1A 3ZT3A 5D0GA 3MMAB 2DR7A 3O9RA 3ZSWA 4WFYA 2HLTA 2ZHBA 4C3MA 4RG8A 2X74A 3BYRA 4BVPA 3DGVA 1JLFA 4CERA 2WUSA 1NH7A 3MEGA 2D69A 4P7TA 1C0MA 1WI8A 1N34F 3ZSRA 3AXKA 1RDRA 4ZLNA 4CD1A 2LU1A 3PIPQ 4UOHA 2N4DA 3IFRA 2PGCA 2Q1NA 1DAXA 3H5UA 5K5MA 2EHGA 3LP2A 5KOWA 1VRTB 4NLXA 1YJ9S 5AQRA 4DHYA 2DGUA 4DTOA 3PO4A 3BO4A 3SFGA 3E01A 4LF4F 1FESA 2RUGA 1PG5B 3ITHB 4JYAF 1HNVB 3EVWA 3RVCA 2OYQA 3QERA 4B3MF 3KJVA 4H0YB 5KG5A 1T0TV 4NLWA 3GIMA 4Y1CA 5GAHP 5AR0A 4DU1A 4NEYA 2VJVA 4ICLA 5ETSA 2HQ3A 4L74A 3ZTSA 1UZHA 3SAGA 5CAAA 3HFZB 3IR6B 3KKRA 4JI0J 1RSCA 4BDYA 5ETOA 3NCPA 1MN9A 2N3LA 4IQXA 2IM0A 3VQPA 5AQLA 1C6VA 2IYIA 4DV3J 4C8ZA 3PTWA 3CJAA 3HYFA 4OVLA 4AHTA 2Y1RI 2P9LB 2R7XA 4LBHA 3EUNA 5E3PA 4YOEA 2C3MA 1VQ7N 3KJFB 4TQRA 1RDBA 3OVBA 1VRQC 4P10A 3TVZA 5B0BA 3ZO7A 2KJWA 3F44A 8AT1B 4G1QA 1RCXB 1VQKS 4LH4A 2D9OA 4N7TA 3GB0A 1WDDA 2M3DA 2L48A 2V5HG 4CF9A 4CLTA 3MM6B 3TJ8A 4WU2A 4N41A 3AVNA 2EK6A 1GK8A 2A3ZA 4R8UA 5M1PA 2BV3A 3PJWA 2NRWA 1SJFA 3SUPA 3H45C 2ZH8A 5C15A 3VGSA 2QKBA 1J2VA 3DLKB 3CD6N 3PVXA 2VOOA 4OHVA 2AA4A 4J9MA 3VEXA 4C8KA 3KKSA 3OV7A 2DGSA 1IQTA 4WF9L 2FUG9 2W9BB 3GIIA 3KDOA 2X78A 3I82A 4KO0B 1XERA 2W2QP 2EWSA 2WHOA 4GMJB 4EEYA 1Y11A 1OY6A 1IQZA 4FWKA 1FRMA 4ZP7A 1IKXB 4J8FA 2HFNA 1X8DA 1S72N 3CI5A 3THXA 3K17A 1XBWA 1H74A 2JC1A 3V4IA 3POTA 1TZ0A 3CCMN 3I8BA 3O3GA 4CBXA 1UW9A 4FZVA 2UUCJ 4U8VA 2C2EA 4LF4J 3HD2A 4ZPCA 3GWCA 3RMDA 2FJXA 4QIVA 4WTYA 4RBUA 3P5JA 1YQHA 4J91A 4NMXA 5L1KA 3OUYB 2EVZA 1QZ5A 3CCWA 1IV0A 4JI1J 1FKAF 3J7A1 3H2UB 2VG7A 3BN4A 3L4IA 4H5WA 3MCOA 4I9QA 2UYTA 4CGDA 2A2DA 1N33J 3SFUA 1RDUA 1JQGA 5DM7L 1KCFA 5GAGP 5KRSA 2PA8D 5ETVA 1DBDA 1M90T 1XJWB 1ZM9A 3CGIA 1NMEB 1YK9A 3LPYA 3HP9A 1K8KA 4F50A 5L8RC 5I42B 5DLGA 2C3YA 4F0KA 3JTOA 3FK4A 4DV4F 4Y2IA 4PL8A 2DKOB 3SDEB 4ZLLA 2DGXA 1FW6A 2B4OA 2HGNA 2AYEA 1ATRA 1VLYA 3C14B 2IRUA 4P73A 2EC2A 5A6WA 4ZVGA 4C3KA 1WTBA 3BEGB 3KUEA 1KLNA 2OPPA 4YHHJ 2XY7A 3DXKB 5HLFB 2DRBA 3G82A 4ED4A 2EBEA 4FWSA 3PX4A 3KUHA 1YJTA 3CJBA 1LOTB 1JLCB 1SV5B 4OPKA 3J7YI 4CGIA 4F9OA 3MAQA 4WZQA 2XI3A 1I3OB 3GG0A 4ECWA 2L3MA 3LAMA 3W2WB 3ISND 2PA3A 4UOFA 3P6YC 1EQMA 3BKFA 3DRSA 1HKAA 2P9KB 5AQFA 3T6JA 1OWXA 3VTIA 4BRPA 4TN2A 2XMWA 2VQEF 2JHEA 2PE8A 1VBKA 1QE1B 2QRRA 2Z1HA 2FSNA 3M8RA 1ILYA 1G6BA 3LPEA 3DHWC 1W2IA 3EO3A 3ET6B 1ZXOA 5F3ZA 2ZF5O 1IUJA 3R9LA 5AZIB 2QW9A 5IV3A 4CEZA 2HFZA 1IWAA 4PR6A 1QSLA 3BPDA 3MN5A 2L08A 3J80U 1RT5A 4MH8A 4ZLJA 2GJ2A 1C0UA 4FJIA 1T02A 4B3OB 1FE4A 4O5BA 1D4XA 2FVQA 7FDRA 4DR3F 2FQQB 3CE8A 3ETMA 4GV9A 2R8KA 4Q2LA 2AJ1A 1U1MA 3I56N 2CKWA 2D3ZA 3QAUA 5DG7A 5AQMA 1N6QB 3AB2B 1QVGM 3UDEA 5K8NA 3WNHA 3DYAB 4RU2A 5JVHQ 4NXMJ 1ATNA 3M5RA 1WWHA 3HM8A 3AOAA 1E6VB 1P8GA 3MM8B 2M8DB 1NMNA 4F4KA 1V3ZA 4K4YA 1WAFA 2YJFA 1T05A 4PKIA 2KVQE 1T44A 3OFEA 1RAJA 3V1QA 3VAJA 1SPBP 4DU3A 3CJ7A 2GEMA 1RAAB 4CO1A 4HACA 3W61A 3G4SN 2WVEA 2PSZA 4UZCA 3S7RA 1RAEB 3OL9A 2V4QA 3CQ8A 2FBTA 2P6TA 4K4TA 3QMQA 1FKPA 5CR4A 1FFGB 3W9JA 2A18A 1HBNB 4AFFA 3BSOA 4ID8A 4U7UD 2HHWA 1BWVA 5AXLA 3ULHA 1CJUA 3SQ4A 4LH5A 2KFYA 5I3UA 1UVNA 1VQ9N 4KBOA 1M0SA 3UKUA 5H1SV 3QRQA 4L3KA 3NGRA 2J0QD 2XY5A 2XMMA 3CQXA 1HR0K 4E8UA 1BDGA 3UNYA 1ELOA 3RG6A 3QNNA 3HBTA 3OHAA 3MCAB 3O1BA 2BKPA 5BRDA 1PILA 4L76A 3BJYA 3OL8A 3KHRA 3JTPA 4NXMF 1FXXA 2MTLA 3KK3A 1T6DA 3NCIA 3M8WA 2OEJA 2QWLA 3SBMA 3LM2A 3H5YA 4LRAA 1WC0A 2WSFC 2R8JA 2IVNA 4RUCA 1M1KO 2HHVA 2PMHA 3C46A 2O8CB 4WFXA 1D9DA 3V2UC 1CZ9A 1F9EB 3VGLA 2AZ1A 1RCHA 2J76E 3BQ1A 1S1VA 4IO9L 3V9ZA 3CCJS 5B09A 4X64J 1RLDA 4OI2A 3H1VX 4DLGA 3WNGA 3W5XA 2VOPA 1X4BA 3KVGA 3HSCA 5HANA 3QFUA 4K43A 4CEBA 4K8ZA 2Q6BA 4DQ8A 2VDHA 1JCGA 1G4CA 1X5SA 2A1RA 1VSKA 4DSIA 2L9DA 2O8EA 4KSEB 2R8IA 3C16A 2KZMA 1QLNA 1ZM2A 2J9EA 1XHZA 1VQKN 5A0YA 2HHTA 4PXDA 5AQTA 4W98A 2VBZA 5A0YB 1FO1A 2B51A 1WEXA 1M1HA 3D68A 2XLKA 3FSIA 2B4PA 2KKHA 1KAZA 1S0MA 1UZDA 4M95A 1R6YA 4CZMA 1HNZK 4OLOA 4KHMA 4CEQA 4QS9A 3TZYA 3QJLA 5E0OA 5ETPA 3FZKA 3PHTA 2AGOA 2B8PA 4DFMA 1T9WA 2DBBA 2V8HA 1TKTB 4WFZA 4F3MA 5IM0A 3MECA 1K1SA 2N7CA 4CH7A 5AQIA 1S1VB 4P71A 4GMKA 3O4QA 2QJ3A 3I55N 3W9HA 4CO5A 3QEPA 3OYBA 5G4DA 1UWBA 3TAGA 1VBXA 2B8QA 3CJRA 2OSRA 2OPSA 2DTJA 5AQPA 2YNFA 1FTRA 3WIUA 2XYPB 2JH3A 1VR6A 1SIWB 3OVNA 2ZZTA 3GE1A 3TSUA 4W5QA 1RWWB 3B6BA 4I6WA 1I39A 4YDUA 2FLNA 3KLHB 5AFUH 1FVSA 5D15A 5KI6A 4CLPA 4IDKB 1X4DA 5K14B 3E51A 2QWPA 4H8KA 5M2PA 2DVIA 1KAXA 3HCXA 1VSEA 1Q86O 1C1CA 4M8LA 1XK8A 1CJUB 4LQ3A 1ZAXA 4V19S 3H4BA 3WQTA 4OKEA 1SVDA 2UXDK 1X4EA 2DFHA 3BZQA 5HJXA 2NXEA 2RJZA 2AT1B 1IBKF 1YIJN 4AILC 2QWMA 4CO3A 4DR4K 2QLXA 2JVOA 4ZP6A 3K7RA 3ZSXA 4J9OA 5EDWA 3HKWA 3M6VA 4KGMA 3BO2A 3R7BB 4I0WA 1L3UA 3R5AA 2KT3A 1VCTA 2QK9A 1UW4A 3KKFA 3OR2A 5CA5A 3A5LC 4TVAB 2F8TA 3S3MA 3OVAA 2NRTA 4PEOA 2NYHA 3U1MA 1RWUA 2K06A 1Q78A 3KLIB 2F4VK 1S79A 3TAPA 5H9FK 3OBIA 4C11B 1NWKA 3MM8A 1E6VA 4XO0A 4DR7J 3W3DA 1PC5A 1KQSM 1CG2A 1A5XA 2N7YA 2VB6A 4RTFD 1BCMA 4OJHA 2XSFA 2QLBB 3PG9A 2E29A 3CJKB 1LWFB 1FRJA 2PY5A 4QIFA 2HK2A 3E9PA 4Y1DA 3V1OA 5FDLB 3IGVA 4ED2A 2UU9K 1B92A 4YQWA 2B7CB 2V69A 4XDCA 3GFXA 5BN8A 2NRXA 4DL3A 3I5AA 1IBMF 2G8WA 2LXIA 4W5TA 1RT5B 1WKKA 4F2RA 2E5GA 4USKA 3QICA 2FBYA 3H6EA 2R7VA 2GZOA 2V67A 1XC3A 1WEYA 1IH7A 4X4QA 4ED5A 2P9PB 4B1YB 3CC4N 4TLRA 4FYYB 2X3GA 3N4QA 2MB0B 1QS4A 2MLZA 3RAQA 2UXBJ 1BWFO 3U1LA 3SMSA 3L2VA 3C15B 5GIPA 4O44B 1QE1A 4OX6A 3CDBA 4Y2CA 2BM0A 2C2NA 1X60A 4RUAA 4FXDA 2RQMA 1FTCA 1H3DA 1FRXA 1Q16B 1HIYA 3IDHA 3HJFA 3FBFA 2UP1A 2P9KA 2ERRA 3W2WA 2DGVA 1S9EA 1T11A 3DI6B 2QMUB 2JSXA 3CJ1A 3FRZA 1MROB 4WYBA 4OKJA 1YIJS 2M5YA 5B08A 3M2VA 2YKNA 2VFVA 3N4WA 4UUXA 3SUOA 3IR7B 2A0FB 4JP8A 3U3YA 2DT9A 1HNXF 2E6MA 2RRNA 2AWZA 4DTSA 4A61A 3AA9A 1RBUA 3A0IX 5JLHA 3V9XA 1MA9B 5HLFA 5D4LA 2DJWA 2OPPB 1OH7A 5I3QA 4CJPA 1RHJB 3MUMP 1NEEA 3WQPA 1E4FT 3VQDA 5LJ3Y 3X3UA 3VAHA 3LANA 1I1GA 4ELUA 3H25A 1XMQF 4ECYA 3ZSYA 4UOGA 2FY1A 4HTLA 4BQLA 4HL9A 3HSGA 3HPHA 4BE1A 5C0YA 4JI7J 5I42A 3G25A 3BREA 5U47A 3W5ZA 4I2QA 4HCBA 3CMEN 2F40A 1WN7A 4LREA 1WC4A 2XLJA 3TEGA 4B1XB 4RW6B 2HSTA 2QM1A 4YY3J 2GV9A 1W25A 3D28A 3VAKA 4H54A 5EGYA 2F8EX 5DO2A 4AH9A 4X4TA 3L7UA 4C0BA 3W2VB 4CGHA 1B3TA 1NK8A 2DISA 4ECZA 2JWLA 2CPZA 3OUYA 3OSNA 1WI6A 3NF7A 4R25A 3PY8A 4BR9A 1R0CB 1C1AA 5AQVA 1LCUA 2RQ4A 4BRFA 3F73A 4PKDB 4EP4A 4OQJA 1YT3A 1SC3B 3R3LA 1O0PA 4FN5A 4DV0J 2ALZA 2RU3A 4GKKK 1LAWA 3V4IB 4ER8A 2E9TA 1V3SA 4MFBA 1TKDA 3A1YG 2G0IA 1VSJA 4O0NA 2FD2A 2EFPA 2DNOA 1JLAA 3RYLA 4KHSA 3RTVA 1F21A 4L73A 3O1WA 4CIGA 1GOBA 2E1ZA 4J9VA 5GAEI 5BRHA 1P9YA 4JI5K 4KO0A 5FPEA 2LVWA 1SJ3P 4J90A 5MLCV 3GLJA 4DS5A 1NK0A 4TYAA 1FWPA 2HWHA 2D1CA 1PAEX 3P96A 3HPGA 4X62F 4J9RA 2PIIA 2NR0A 4F4WA 4DKWA 5AQYA 3WHIA 2W41A 3HFVA 1S59A 1HI8A 1JCFA 3ZXWA 4WK1A 4ZCMA 1WB9A 4DUYJ 2XMUA 2CQDA 2QO3A 4RX6A 3G96A 4MLHA 3MAAB 4H4KA 4IOAL 1EIYB 2NSCA 2CJBA 3ZETA 4IOCL 2HPUA 2MXYA 5LY3A 1N5QA 1U2RA 2VA3A 2I8EA 5HQ8A 2CADA 1TK5A 4HT5A 2WBNA 2QZ8A 3IWXA 1ZBLA 3W64A 3LH2S 2QA4S 4CI0B 4U96A 1JJ2R 1N32J 2XRIA 4FJ7A 1X9JA 2FVPA 4RW9A 1Y3JA 3H5SA 4F25A 3FSXA 3JXUA 3ATVA 4CJUA 4MYTA 3QGPA 4DV6F 3X1LB 1RT1A 2YWGA 1VHFA 1ZBSA 4MKBA 1BE4A 4AQYF 1EHWA 3ZT0A 1QAXA 5HJYA 2FTRA 2DNMA 4USIA 4DZDA 5J1NA 1VIXA 5B7WA 3RAXA 3ASMA 4DL5A 3BY5A 1Y0HA 4FJNA 5C2DA 4FS2A 2GWKA 1REGX 1FI4A 1FRIA 4J5OA 1VS3A 2FYXA 2GV1A 2YX4A 1N52B 3DLGA 1KS2A 1H0HB 4KH1B 1U48A 3NNAA 1S1WB 3CPWR 3SCKE 1UP1A 1U7LA 3GYXB 3W0LA 1KAYA 3PW5A 1X9SA 4CECA 4F0HA 1HNVA 3LQVA 4A2BA 1JNRB 4W5OA 4PKGA 3KDNA 1SJ4P 3FJ2A 3J81Y 3FFIA 3BH7B 4NXNF 4KHQA 2BJ1A 4DCOB 4ILLA 1VRTA 4IG3B 4DTMA 4W4MA 1WNSA 2CGLA 4G1PA 5C24A 2P9EA 3Q24A 4ZMMA 4HUFA 1HL6A 3DAWA 2OTLN 4KR0B 3RSEA 1TUVA 4JI6K 3MPUB 1HHTP 3QBXA 5D4OA 2EX3A 4JD2A 3DLHA 3D5MA 1DFDA 2B0GA 3HHLD 5J2MA 2BEFA 2CDQA 5AT1B 2WSEC 3EEQA 3IG1B 4O4RA 1M5PC 4DFKA 4WFNL 1S48A 4DS4A 2HBKA 4WE1B 2UXBK 1HQUA 5KFQA 2ASYA 4DQQA 2ZJRQ 1RBAA 2IAJB 1NRKA 2B3TB 5AQUA 4BRLA 3HHLA 2FF6A 1TL4A 5DS7A 3M8QB 2CJQA 3ZZ0A 2BBEA 3D1QA 2W2MP 2VZ9A 5DZ7A 3FGVA 3LF0A 2ATLA 2Q0RA 1ZETA 2YXLA 4J9KA 3SMPA 5GVQA 4RW7B 2IJNA 2I2YA 2AEJA 4JK9A 4LIRA 3DOKA 2OI2A 4FWPA 1S10A 3UD3P 4HKQA 2KH9A 1HLUA 4CJQA 3PRDA 4LFAF 4EFHA 2A1SA 2AEMA 4N56A 3WXMB 4Q7AA 3D45A 4IOXA 2OD4A 1KNZA 3LAKA 4NEZA 5M2RA 4USHA 3SEOA 5HP1B 2ADBA 3CD5A 3P3DA 1RHKB 1EB0A 2XM3A 4FNIA 1V3RA 2DIVA 4FVCA 5ADXH 3UDLA 3E2EA 4ED7A 4LR7A 1CS4B 4LF9F 3QLHB 3M4XA 2YHYA 1WSGA 3MEDA 1UWAA 4PWDB 2YKAA 2FVRA 5CYMA 3SJJA 4FYXB 2A42A 3H20A 3F0NA 3U02A 2PZSA 2GO9A 4CTAA 4AE5A 4X66J 2PBDA 3PV8A 4M5HA 3QGIA 2YNGB 3D4JA 5GAEP 2E1PA 2B56A 4FLYA 4DR5J 4CJTA 2Z30B 1DLOA 4X4OA 1BG3A 2DNZA 1Z26A 2BANA 4FOEA 2UVUA 2ZVSA 3G10A 3Q23A 3EL2A 3MPVA 2YNIB 4JUZA 3SSSA 4ZHRA 4TNOA 1P1LA 1S7IA 1D8ZA 3K8VA 2JNJA 1HYZA 4CIFA 1RWNB 1HBOB 2KFNA 3FCHA 1RBLA 4WCEQ 2WTUA 1KVBA 2YQ0A 4IUFA 2OA8A 3HVAA 1N54B 2CIMA 3MUVP 3VQ8A 1IJEB 4MDBA 1DTTA 3K89A 3MTKA 1V4TA 3M8YA 1HA1A 1FJGF 2RS8A 1T03A 3IA0A 2YH1A 4DU4A 3EJMA 1HPMA 2A41A 2VL1A 4CHYA 4JB8B 4LF5J 1N36K 4XPCA 5D3GB 2BOAA 2H4YB 4H03B 4RW8A 3VGUA 3J7YU 5BYSA 4NCBA 2G2YA 3M2UA 4X64K 4CDIA 3TO8A 4M5DB 1R3NA 4ES3A 4OI3A 1BISA 3OYAA 2RKIB 4NMLA 4KV8B 3K5PA 3EN9A 4B3TK 2DNKA 2FVSA 5GAHU 3NH2A 5KG4A 2CPXA 1VQLS 4M63A 2A1BA 4LF6F 1KKHA 3WQUA 3QIOA 2DB1A 4DR1K 1RTHA 4B02A 1K47A 5ETTA 1HJOA 1TYQB 1S0VA 1MU2B 3DKDA 2F5GA 3FEZA 2A3JA 1U49A 2B4JA 4CT9A 3AARA 5I3PA 2QT7A 2IM3A 1NK9A 5LL6d 3THPA 3H4DA 4E7LA 2NRZA 1VSDA 3KG4A 1JLQB 2PEBA 4ZVPB 4DZ6A 2VYPA 2P9NB 4CZKA 4NPOA 2R7QA 4PXBA 4WP3A 2D0CA 1YHQS 3CMQA 2LEBA 2OO4A 1ASVA 5L1JA 5BREA 4FWNA 2R7OA 4FPAA 2D41A 4PAAA 1JXEA 1U8WA 4EZ6A 2HURA 3GIKA 1BCOA 3NFAA 3HVWA 1XTZA 2OZMA 3AAWB 1X5OA 4BBYA 1ZPVA 4DPOA 2ZE2B 4A8MP 4NLVA 4NXNJ 3DRRB 1FHTA 3HI9A 3C6AA 2CQ4A 1SJRA 3DDKA 1XNQK 4RKUC 1ASWA 3KHLA 3U9DA 1S9GA 4DF4A 3KK7A 4K4UA 4K42A 5KFAA 1JLEA 3MPYA 2MJUA 1GQEA 2WVBA 1JL2A 4NO7A 2I5JB 2YBVA 1RT6B 2AP6A 2V2QA 5ADZA 1NGFA 2HW3A 2R7YA 2H48B 4ETZA 1S72S 3ZX0A 2G9OA 5HRSA 1J5EF 1EARA 1JXLA 4B9LA 4FF2A 3WXLA 2XHWA 3IBWA 5M1QA 1U0SA 2YNHB 2CPFA 4GVBA 3L95X 5BJRA 2ZNZA 2BE2A 1NBEB 4M42A 1YJ9N 2ITMA 3T5HA 5EX5A 1CXQA 3GSIA 3GFHA 1H6KX 2YH0A 2NNWA 3UFCX 5CQGA 1Q95G 4NLSA 1A6LA 2D3UA 5LL6Z 3GONA 2VG6B 1IR2A 4CHZA 3J7AP 3Q8RB 1JJ2M 3HFKA 3MXIA 3PJ9A 3MFIA 1YGYA 2Q79A 5GMKa 4CFAA 5LOQA 2D0AA 4J7CA 3PYDA 3FR0A 2VGNA 2GVZB 2ZITA 4Z7CA 2PC6A 2UUBJ 2IS3A 2HFOA 3M3ZA 3WT0A 2R3VA 1KQFB 5D0EA 2J6UA 4I64A 4U7UK 3CCQS 2ZH5A 3DMJA 1TKXB 3LTOA 3D6FB 3NXZA 1RA6A 1Y10A 2G8UA 1HNZJ 2QEXS 3QNOA 1YTYA 3T9ZA 1P8ZA 2O8BB 2H9ZA 3BSAA 4CJ7A 4NYOA 3R5GA 3MCNA 4RNHA 5DQHA 5E3CA 2BE2B 2MZTA 3SCXA 1FRHA 3LGNA 3U9ZA 4H0VB 3IS9A 1JKHA 3CJ0A 4V19X 2W9CA 2RF2A 4BGBA 3ZEUB 5I4MA 1XR5A 2AKWB 4AYBD 5AZJA 5AQXA 2WBMA 3ADAC 4O8UA 3J81U 3A5MC 4QYZK 4PXCA 1RAFB 4URSA 2QX0A 2PFDA 1EETA 2C22A 1JLEB 2IBOA 3K5OA 3GSDA 1Q7YO 1CBKA 3OR1A 5IWAK 5GIOA 5F0WA 4FM2A 2NXJA 1IBLK 2ZBIA 4B9UA 1Q18A 1KTVA 2VC0A 3M1VA 1R31A 3US5A 1YVFA 5JMVA 4DV3K 1U1OA 3TP2A 2Z4PA 4IJNA 1VBYA 2NUHA 4KAIA 3CMAS 3RMAA 3M9OB 3NBPB 3CNQP 3HXMA 4CO0A 1LFPA 4HT7A 2BQUA 3M30A 5DDPC 4DHVA 4L72B 2Z57B 3EZWA 2HVIA 1GX5A 3AVMA 4PYDA 2EFVA 4F67A 3VQ7A 1KVJA 2Y0BB 3D3CJ 2GJIA 3H42A 2LKZA 3MM5B 2HNYB 4DV7K 1TAQA 4AL7A 5HN0A 5HI7A 2J9DE 5AJ3K 2KB2A 1R8AA 3N01A 1WC5A 1XNRJ 4CVNE 2Y3YA 3QIPA 3UDCA 3Q89A 3S8SA 2XLIA 2JDJA 1XR7A 2QL7B 4QU7A 2OCEA 4CEFA 4CF2A 2RMLA 2UVRA 1BU6O 3MCMA 1SQGA 2HBMA 3NHGA 1YJNN 3EMTA 3OQ2A 1LW0B 4F4YA 5J2PB 3PIPL 1KD1T 4LSZB 4WWSA 1ZA2B 3R9PA 3ZNUA 4IFVA 2RKIA 2QA2A 1FXLA 2CYYA 3S6EA 2CGJA 2YVSA 4L3QA 3ZZOA 4URQU 3LP1B 1EP4A 4PQUB 2F7VA 2A10A 4NASA 3SLCA 5CZVA 1GLDG 3MPDA 3HOTA 4DTJA 4DMNA 3OJSA 3UWTA 2IVMA 4O3PA 4MO4A 3AH6A 3Q8SB 3VF0B 4B1WB 2GX8A 2G8HA 3QO9A 3TZWA 3FBCA 1BI4A 3WC0A 1SQKA 5HATA 3DRPB 5FIIA 1XC9A 1S7HA 3AA4A 1HKGA 2OPQB 2O8DB 2ASOA 1HBOA 3CCSS 4A2AA 4FJ9A 4M45A 4J2BA 2VICA 3UO0A 4ZHRB 1HWLA 5F8LA 2XCAA 1KLMA 3U7JA 1CJVB 4USUA 1A0OB 2YPZA 2ASDA 5A8RB 2GHVC 1VI7A 2H1YA 2YQ3A 1F5CA 2MQMA 4J9NA 4OPJA 1RHUB 3QZ7A 5H9EJ 1WHYA 4AHRA 3DC2A 2HG4A 3HVRA 1CSJA 1OKJA 1GX6A 3PM9A 2V9KA 2E5LJ 5KGWA 1KDNA 4JKDA 1CULA 1K6YA 2V2VA 1VQ4S 2BH1A 1FEEA 3O6WA 5A2QY 2M88A 4GO5X 1H72C 3GDQA 4Q5VA 2ZUGA 2MHNA 3A5NC 2ZZNA 1CS4A 4KGXB 4YDUC 1BGXT 4C0OC 2F9DA 3PDNA 2AYBA 3RMCA 4Z4FA 2K7JA 1NPRA 1TU0B 4KHNA 4YEAA 1I94K 2W7PA 4FPRA 4DR6F 3JSMB 4YFUA 2KRBA 5A8KB 3KHYA 3DCAA 3EPGA 2MKCA 5AE3A 2HBZB 2W1BA 3K9KA 3QNWB 3FZ2A 4YY3K 4W92B 1PAUB 3O9SA 1V9OA 3CCES 4XAKA 4A8YA 3HVTA 1DEJA 2Z1JA 4N8NA 2U2FA 4PCQA 2DR9A 2F8SA 4FLUA 4DV1K 4CWBA 1H2TZ 2ZM6J 5J1EB 1FJCA 3S41A 3L2WA 4NB4A 1FD2A 3TWHA 2E5IA 2MGZA 3W60A 4LF5F 4NLOA 4GKJK 2C1EB 3IAM9 3HZ6A 2GBZA 1KOOA 2DGWA 1HNIB 2QI2A 2P9IA 2W6KA 4GY2B 3ZTOA 3CULA 4MO5A 3I6PA 2HVDA 1NHKL 4KRFA 2QWNA 1P1TA 2H5JB 1S1TB 1AXQA 3A3OB 1PKUA 2VWBA 3B54A 2XI2A 2X1BA 3PCOB 4LBPA 1GLFO 4LF4K 2HMIB 3SQGA 4O3RA 4CHQA 1W7AA 4NYNA 4MK9A 3VEYA 3TPQA 1K0TA 3ZC4A 3QSYB 1JMTA 4KHPF 4P52A 3L3UA 2V8DA 4LSNA 1T94A 3GCWP 3PW4A 2XNQA 1U1RA 4KB7A 2MZQA 4QR1A 1ZBUA 5KFRA 4OX9K 2Z0GA 4QAGA 4QBUA 1S12A 2VFSA 2LU2A 2KXHA 3DLGB 5E41A 1F2GA 4JI6J 3EE3A 4QR2A 1HBUB 3OS1A 5LMNK 1WORA 1NUEA 2ZH7A 4FNHA 2HHSA 1LK7A 1YJUA 4RNOA 2QWQA 4QW9A 4BG9A 1K44A 2W4CA 3CD7A 1BQMB 3OFHA 3Q83A 5LMUJ 3VEVA 2XS2A 3EPIA 1CVJA 1MWQA 4O5FA 4D3HA 2P5OA 3QESA 2Z58B 1Z05A 3NGZA 3G71S 4DLEA 3PSIA 4WBFA 4ZPWR 3GJSB 2J9CA 4DDFA 1A5WA 1JX4A 5K20B 5GMEA 1U1NA 4JKHA 4BWJA 4YOUA 2CQHA 5FD1A 4MKVA 5DM6Q 1IBKJ 3MK6A 3ZYYX 2EG2A 4OYAA 4RUHA 2WZ1A 4WFBQ 1HYSB 3ZETB 1SKSA 3OYMA 1ASUA 5AXNA 4R5PA 2NZCA 4BDZA 5EWEA 4E1NA 4KY3A 3NEKA 3NGYA 3NMUA 3W66A 4RWWA 3F41A 2ALYB 3L0QA 2KHDA 4IR1A 2LMIA 4BR2A 1OPZA 1FNXH 2DHAA 3FLCO 3AAQA 1RWOB 4X65J 3D9BA 2B4VA 3HSJA 1ZH5A 3HP6A 4JI8F 5IT4A 5FPNA 3BO3A 1RILA 2R7SA 5FLXO 3SYZA 3ISZA 1FE0A 3S01A 1HBMA 4JV2A 1RDWX 1WTFA 2OTJN 1UKUA 5KFSA 4K0KK 2R2TA 2CQ2A 4KH0B 2KZZA 1VQPS 2EK1A 4ZA1A 2JRSA 1JJ4A 2BDPA 1GLEG 4JI4F 2V7ZA 3BN7A 1Z6RA 2HMPA 3UN5A 5CCMA 3M7VA 4LT6A 5ETMA 3EGZA 4WZMA 5HMZA 3N0VA 2YPYA 1REVA 5D4PA 3B8HA 3GZ7A 5EWFA 3K58A 3CC7N 2QN6B 5HRRA 4FJKA 2R2SA 4C7QA 3C19A 3TAMB 2BABA 4URGA 3TOQA 2CH6A 3NCRA 1NSQA 2V7YA 4YNQA 3QPIA 5KFPA 3G6YA 4YS2A 3G8QA 3UE5A 2AHOB 5KFVA 2P9IB 3O44A 3ZSVA 3SCJE 3BF4A 3HHEA 4Y6IA 3EXCX 2F8HA 3G0ZA 5A8WB 3C66A 1LXJA 3RZAA 2UU9F 4KHYA 3QRPA 2ASMA 4O23A 4DG1A 4TY8B 3R5JB 3P1GA 1ZPWX 3V6HA 3C6UB 4OIXA 4FS1A 2GHPA 1U6ZA 1W7WA 4Z0UA 3UPFA 3O3HA 4I6MB 4CZCA 4EBCA 1NKEA 4WCEL 2I38A 2DIUA 2OFHX 2V2KA 1JJCB 3UCGA 4GVLA 2IA0A 4M7XA 3LW5C 5BN9A 2XQCA 3SBTA 5E5NA 1RHRB 1Q7LB 1HD0A 3NMAA 3DU5A 2FHJA 4CO4A 4RO0A 4CLYA 3FZHA 3BGRB 4ZIWA 1CXUA 1RT2A 3ENOA 1Z2LA 2W2OP 4CEOA 4DR5F 2AYMA 3EXYA 3ZT1A 4NCAA 1ZM4A 4F7VA 1S9EB 4BVOA 2KG1A 5E3AA 3OS2A 3SV3A 4QU6A 4CZEA 2DNPA 4X4VA 4PG5A 1I51B 5K8PA 3PYEA 3I8DA 5FLXY 3ZTPA 4M3XA 2DNRA 1PYTA 3C8YA 4BC9A 4DUTA 5HROB 2B5JA 3DHXA 2MZ1A 2CQCA 1URRA 4IBNA 3EY1A 2ZUAA 3T41A 1MDUB 1O1WA 1RAOA 4M41A 3H59A 4DUZF 4BG8A 4B9NA 5A8RA 1PGZA 1YAGA 1PJ6A 4DQIA 1YJVA 3DOMB 2ZVIA 4HLBA 4C8MA 2IRXA 3CO9A 4ANEA 1WHWA