5K14A

Hiv-1 reverse transcriptase in complex with a 2,6-difluorophenyl dapy analog
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
543
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords HIV-1 reverse transcriptase(isolate HXB2)
publication title Novel (2,6-difluorophenyl)(2-(phenylamino)pyrimidin-4-yl)methanones with restricted conformation as potent non-nucleoside reverse transcriptase inhibitors against HIV-1.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
total genus 156
structure length 536
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5k14A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5k14A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5k14A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5k14A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5k14A05
1RTIA 4CJLA 3FQLA 4K8ZA 4IDKB 2ATQA 5I42A 2OPSB 4R5PA 4TXSA 4F3TA 3AVGA 1FK9B 4HUEA 5F8JA 4O4RA 3M8QA 4DSFA 3RMCA 4ICLA 3NKYA 1WNEA 1LW0B 3V6DA 4ZTFA 4KO0A 3OYLA 3TR8A 5DMRA 2VG6A 5J1EA 3KK2A 3DLGA 3NGZA 4CEZA 5T14A 4BWJA 2W42A 1D5AA 4O55A 3KD1E 1RTIB 5KFHA 3PO4A 3OL6A 3EZ5A 3BQ1A 5E41A 1SL2A 1KLMB 4CHQA 4RW4A 3H59A 2O5DA 3N6NA 4DL6A 3ZSYA 2XCPA 1YT3A 1QUVA 2HNDA 4DU3A 1IKVB 5J1EB 4F8RA 1SL0A 4FW2A 4B9LA 4ID1A 2VG7A 4L8RB 4DL4A 2F8SA 1HPZA 2R2TA 1YTAA 1S0OA 2KFNA 4DQSA 3M8PB 1GOCA 1VRUA 2XI3A 3PJXA 2IJNA 4TYBA 4WXWA 2DY4A 2P1JA 1S9FA 4CHNA 3VQAA 4RW4B 1W9HA 4CGHA 1A5WA 4OVLA 3AVAA 3WNEA 3QLHA 1S1VA 5KGWA 1XR7A 3NAEA 3VN5A 3QEWA 1RT1B 4XO0A 1HPZB 4NLYA 1XR6A 3ZCMA 1JLCA 1LAVA 2HHXA 3RB0A 1JL2A 3RMDA 5DQIA 2HB5A 1DLOA 2XRIA 1BL3A 3ASMA 3CDEA 4CGJA 3RWUA 1RCHA 3K58A 1RA6A 1U04A 1S1VB 1NNDA 3ZSQA 3U6FA 3TAPA 2OH2A 4PQUA 1DTQA 5HP1B 3UPFA 1QAJA 3NGDA 1JLCB 1VSIA 4C8MA 1HNVA 4ZP6A 1REVB 4H4MB 4DS5A 3BDPA 4CHOA 2ILZA 3T19A 3T1AA 1DLOB 3RB4A 3GIMA 1RT6A 4ZPCA 5KG1A 1SKWA 1SH2A 3OSNA 3DOLB 3L2WA 4BDPA 2DPJA 4CEDA 3FSIA 4ELUA 2XY7A 3RR7A 3KHHA 4U6PA 3KMQA 1WSEA 4J9KA 4CEAA 3O3HA 3DOKA 3HPOA 4MK8A 4TQRA 3SFUA 3RR8A 3M9OB 1JLQA 5KFXA 3F9KA 4C8KA 1LWCA 3SUNA 4K4VA 1JLEB 2ALZA 3DMJA 5L1LA 3U3YA 1QHTA 4KHYA 3HT3A 3AO4A 1U09A 4I2PA 3HVAA 2E4LA 4RG8A 5DG7A 3TWHA 3DLBA 4FJNA 4KRFA 4EO8A 2Y1JA 2JEJA 4M95A 4ELVA 4PWDB 1WAJA 4CJEA 2FBYA 1S0MA 4IG0B 4FS2A 2HWIA 3P5JA 4GMJB 3NF6A 1FKPB 3C6TB 4EBCA 4ZVFA 3SFGA 3SI6A 1HMVA 2R2RA 4KB1A 3QNOA 3VQ5A 1X9SA 2V9WA 3DLEA 1EX4A 4CGGA 3WNFA 1JIHA 4WZMA 1RDDA 4FLZA 3SPZA 3DRRA 5FROA 1N4LA 3ZT1A 3QZ7A 4BE1A 4NLTA 3KK3A 3G86A 4CJWA 1HMVB 4M42A 3AO5A 3BREA 3AVIA 1KLNA 1IKXA 3L3UA 2J6TA 4Y1CA 3TI0A 4CJKA 1S48A 1U45A 1NOYA 4F4XA 4O0JA 5KG2A 3OYJA 1HYVA 3KK3B 5C25A 4MK9A 1N5YA 2ASJA 4E3SA 2G8WA 4NLQA 4E0DA 3TAFA 4F4YA 3L2RA 4O3OA 3VQDA 3HP6A 5FRNA 1WAFA 4IRKA 1SV5A 1JXLA 5KFGA 3BGRB 4CERA 3L2QA 2UVRA 3I0RB 4BDYA 4RUAA 4HCBA 3IS9B 4KFBA 5KFIA 3NGYA 3VQ6A 3PW2A 3CJ2A 4ECUA 4F4WA 2R2SA 3ISND 1TK5A 4OL8A 1KCFA 4FJIA 1S4FA 5F9LA 2HNYB 5KG0A 4W5OA 3V9ZA 1WSGA 4FZZA 1SV5B 4MK7A 4JV2A 4KV8A 5F9NA 1S5JA 3OLBA 1KVBA 2B4JA 2B5JB 2AWZA 5EUHA 2UUWA 3ZSZA 2JGUA 2ZQBA 3UDLA 1C0UB 5J2QA 2YNIB 4PY5A 5KT5A 2FVSA 4G3IA 4MFBA 2O4GA 3T5KA 5HRRA 2B6AA 3HYFA 2FVQA 3OJSA 4CJRA 3CQ8A 4Z0UA 3OHAA 3OYBA 4O3PA 4NLXA 3GIIA 2GIQA 3O3FA 3RTVA 3AVNA 4C8LA 1NJXA 3SYZA 4ELTA 5J2PA 4AILC 2YNHA 4TLRA 5J2QB 3OY9A 1IKWB 4LH4A 1EETA 3HXMA 2KW4A 4MFBB 3LP2B 2B6AB 4MH8A 3H5SA 1BIZA 4ZVGA 1NJWA 2OZSA 4B9NA 4KTWA 3HVTB 3KLFA 3KOAA 2R8GA 4B3OA 2OYQA 3I0SB 5JUMA 5C5JA 4FM1A 3NHGA 2OPQA 4B9VA 2IAJA 2YNHB 3GV7B 5KRTA 3V9SA 4CF0A 4LQ3A 4K4UA 4PUOB 1RYRA 3TAGA 1L3UA 4ECXA 3H2LA 3LPTA 1WLJA 3V6KA 3KLFB 1Y97A 1JKHA 4FJMA 4CJ5A 2P51A 1K1QA 2WCXA 2OPQB 4BE2A 1HQUA 4Q0BB 4DFMA 4J2BA 1A5XA 2B43A 4KHWA 1JLBA 3SQ1A 2C28A 2XHBA 4ECSA 3OS2A 4J9OA 2I1RA 1JKHB 4QPXA 4CF9A 1RBRA 2GUIA 3HPHA 3NF7A 3ZT0A 4I2QB 3RB3A 1HQUB 1W0HA 4DTNA 4FCYA 4ZPBA 4O44B 4CIGA 1NK4A 3MFIA 4IOBA 4MQ3A 1L3VA 2NUBA 4GW6A 1VRTB 1CZBA 2HHUA 4DL2A 4ZPAA 3TQ1A 4FJ7A 3KMSA 2HHWA 4LSNB 1S97A 1S1WA 5KFWA 2IM0A 5KFOA 3DYAB 2V4RA 4CJ3A 2FJWA 3OYKA 1U47A 4F2RA 1D9DA 2RF2B 3MEEA 2YKNA 3L2VA 1N6QA 2C2EA 3NF8A 3V81A 3QNNA 2C22A 1B9DA 5I3UB 3VQPA 2I5JB 5HRNA 2X74A 5KFFA 1IH7A 1KHVA 1KVCA 4Y34A 3P1GA 1S1WB 5HROA 5DLFA 4O4GB 4FJJA 4O3QA 2XY5A 3N6MA 1KTQA 1QS4A 2YKNB 1N6QB 2ETJA 3M9MB 1TKTA 4ZHRB 1B9FA 4OJRA 3HO1A 4JRPA 2F8EX 4TY9A 1S1TB 3AVFA 3LP1B 1RT4A 2WOMA 2V4QA 1KRPA 1ASUA 3NFAA 1KHWA 4NLOA 5KFRA 4M3UA 4CK3A 1FKOA 1T3NA 3V1OA 3V9UA 3AVJA 3BJYA 4CJPA 4NZ0A 2HNZA 4QW9A 4TQSA 1U4BA 3QIPB 3LDSA 4RNNA 3V6JA 2HHTA 2EHGA 4CESA 5HRSA 3V9WA 3CIZA 4RZRA 1JLAB 3WNGA 4FK4A 5KG5A 3GQCA 4FZXC 1NJZA 4JLHA 4Q8EA 1LW2A 3CM6A 4DSKA 1ZBUA 1KVAA 1CXQA 1XI1A 4Z4IA 4KREA 1T05A 3Q8PB 3KK1A 4NCAA 4JV0A 4IFYB 4R8UA 4E7IA 1I3AA 3IAYA 1VSJA 3CJ5A 1S6QA 3C95A 4DU4A 2FVRA 3JYTB 3WNHA 3OS0A 4Q5VA 1LW2B 3JSMA 1QSLA 1T8EA 1TKDA 1T05B 1TL3A 2IM2A 2LSNA 4E7LA 3KK1B 3PW7A 3ITHA 3TANA 4K4YA 5C24A 1QSSA 1Q8IA 4DFJA 3DI6B 1C1BB 2ZE2A 2AX1A 4CJ4A 4ECZA 5SZTA 4DQPA 3OL8A 3LWLA 5I42B 2BDPA 3VQ8A 4WFXA 1S1UA 4R5PB 3ISNC 3M8QB 1WSJA 3D0PA 2DFEA 4ICLB 3HPGA 1TL3B 3S3OA 3ITHB 5KT4A 4FW1A 3V9XA 3V6DB 1MU2A 2QE5A 4QWBA 4KO0B 2VG6B 4CJVA 3KK2B 3DLGB 4FJKA 2ZE2B 4DL7A 5KFLA 4OPKA 2RDIA 3OYCA 1S1UB 1BI4A 4I9QA 1A5VA 4NLGA 2IS3A 3QGIA 4IH7A 2O4IA 2FVCA 1S6PA 2WONA 3QGGA 1SH0A 4LH5A 4EP4A 4FZYA 4FLTA 4DL3A 4CGIA 1BISA 4O5BA 4F50A 1HYSA 2E9ZA 1XC9A 1MU2B 4KSEB 4AHRA 2HNDB 4FVMA 1IO2A 1JX4A 4ED2A 4B8CA 2VG7B 4NCGA 1O1WA 4M94A 4DG1A 3IGVA 2ASDA 1JLFA 1X1PA 4KE5A 4JRQA 2IM1A 3KLHA 1BI4B 1VRUB 4GC6A 1RDBA 4DU1A 1J5OA 3I8DA 3KKRA 3H5UA 1S6PB 2WONB 4CCHA 2D3ZA 2E6MA 4N47A 5KFQA 3I5CA 3OVNA 3QLHB 3E51A 3HKWA 4B9TA 3NF9A 2HMIA 2QK9A 4CFDA 4Z4HA 1JLFB 1X9MA 4WE1A 4HHTA 2RPIA 1RT5A 1J5OB 5KG6A 3MR5A 5F8GA 1TK8A 4RU9A 5F8LA 5KFJA 3SCXA 1TL1A 1Z4UA 3VA3A 1L3TA 5KFTA 4YP3A 4KAIA 4K8XA 3H4BA 3VQ4A 2W9AA 4XPCA 2HMIB 1JLGA 1RT2A 4PQUB 4DSLA 1DTQB 4TYAA 3PUFA 4BWMA 3AVBA 4CFBA 1HNVB 1BQMA 4OGEA 1RT5B 4DLEA 3CO9A 1J53A 1S9GA 1QAIA 1RT6B 3VQ9A 3SPYA 3SJJA 4CGFA 3AO2A 5KFDA 3S3NA 4J9SA 5CYMA 2VG5A 4YQWA 3T5JA 3GIKA 3ZSWA 3O4NA 4Z4GA 1EP4A 1JLGB 1LV5A 5KRSA 2HHVA 5KT3A 3SUOA 3K59A 1SKRA 2FC0A 2JEIA 4O3SA 4KBIA 3DOKB 1LWFA 5KTQA 4O0IA 4N76A 1MMLA 4FLWA 4OLAA 1JLQB 4PA1A 1LWCB 2G8VA 5DK5A 3DMJB 1QTMA 3ICLA 4CFCA 3BSCA 3PV8A 3D45A 5L9XA 4I2PB 3OYFA 1XHXA 4IR1A 1TAQA 3MFHA 4CEEA 4RW9A 1LWFB 3KJVA 2W8LA 3QEPA 2AU0A 2R8JA 3C94A 3KKSA 4IRDA 4B9SA 4J9PA 4RNMA 1ASVA 4G1QA 3K5OA 2DPIA 2QKBA 1NOZA 1S49A 2YNGA 3N6LA 4YMEA 3QERA 1NK6A 4ZVEA 1IG9A 4CFAA 3DLEB 1TKZA 4NLWA 3OL7A 3AO1A 2A1RA 5DG9A 4LSLA 4RNOA 4RW9B 3ZSRA 4QAGA 3DRRB 3CVKA 3AVHA 2Z1JA 3LPUA 1F21A 4EYIB 1EKEA 3SV3A 3HVWA 4QW8A 4E7JA 3FFIA 4M41A 5HBMA 4FLXA 3MAQA 1I6JA 3AVMA 3LWMA 1IKXB 3DDKA 1TKXA 2FLNA 2GC8A 1BQNA 3KHRA 1N48A 4FLUA 4NYNA 2R8KA 4C8NA 4YR2A 1C1CA 1TK0A 4LSLB 5T7BA 4DWIA 2D0CA 1RBSA 1Z26A 3SZ2A 4AHCA 2QXFA 4CE9A 4RW6A 4Z4FA 5C25B 2E9RX 1J9AA 1N5YB 3PJWA 1C6VA 1TKXB 4WFZA 4KHUA 5KFYA 5KFCA 2BGGA 4Z4CA 1ZBIA 3PO5A 1RA7A 1TQLA 2WTFA 1TV6A 3OYIA 1SH3A 1K6YA 1NJYA 4KFBB 2FBTA 3LAMA 4HVJA 4DTSA 4KHQA 3KLVA 4J9LA 5CZ2A 4M3TA 1ZTWA 3GILA 2G8FA 5EU7A 5EWGA 3ZT2A 3DRSA 4M45A 3DLKA 3CJ4A 4KV8B 2XI2A 3T5LA 3RAXA 2QV6A 4TSXA 4JS4A 1YVUA 1NKEA 3OHBA 3MEDA 4DTUA 4H54A 4H4OA 4Q45A 3TARA 4K4ZA 4ECWA 4K50A 4CEOA 4I9LA 1VSEA 4MIBA 2ILYA 3DLKB 4CHZA 4J9RA 3RRHA 4URGA 1NHVA 3FDSA 4DTMA 4M3XA 3MEDB 4E19A 3C6UA 1TAUA 5J2PB 4LQ9A 2XGQA 4M3ZA 4RW8A 4JUZA 3NCIA 4ZPDA 3H98A 4MKBA 1EETB 4QWDA 1UWBA 5HRPA 2YHBA 4AHTA 5C42A 4K4SA 3I5AA 5KGXA 4J2DA 3AV9A 2WK4A 5EWFA 2IM3A 2C2RA 5KG4A 2YV0X 3PX0A 4B3OB 2IAJB 4CF1A 4RW8B 4YR0A 1HRHA 3CG7A 1ZBFA 5JS1A 1HQEA 2G8HA 4IH5A 4DTJA 2FBVA 3OJUA 3IG1A 5L1IA 3G10A 1IM4A 4E89A 3FQKA 2EX3A 4DEZA 1ITGA 4FJLA 2VA2A 3G6XA 2GBZA 2ASLA 5D3GA 3CFPA 5KT2A 2E6LA 4DQQA 2W7OA 3KNAA 1YVFA 1JLBB 5K14A 3RB6A 4QWEA 2OPRA 4ED8A 2DTUA 2HW3A 4NLSA 3NBPA 3IG1B 2QKKA 4IG3A 5KFPA 4KKOA 1EXQA 4AHUA 3AVKA 2RDJA 3T3FA 1BIUA 3QYYA 4E7KA 1VSMA 5D3GB 3QO9A 1BHLA 4DSEA 5K14B 2OPRB 1BGXT 1VSDA 1RNHA 4YR3A 1I39A 4IG3B 4IR9A 5JXSA 2IOCA 3TVKA 1YTUA 2ZKUA 2PYLA 3KLEA 2P5OA 2PZSA 3MEEB 2IBKA 3IRXA 2XC9A 4H8KA 2YNFA 4NYFA 4OGCA 3V81B 2PY5A 3UIQA 3S3MA 4EZ6A 4F3OA 1TVRA 4FJHA 1RBVA 3TAEA 4ED7A 5DGAA 2XGPA 5KFVA 2D0AA 4FLYA 5HROB 3U3GA 2DFFA 4W5QA 3B6PA 4W5TA 3DLRA 4RUCA 3G6VA 1WN7A 2R8IA 4K4WA 1N56A 2Z1GA 1TKTB 4M3YA 1XWLA 4J2EA 3MTKA 1L5UA 3AA2A 2VA3A 3EZUA 1RT4B 2WOMB 3NMAA 1R0AA 1UAXA 4DQRA 4DMNA 4Q44A 3RAQA 3KTQA 1RAJA 2KTQA 1FKOB 1XR5A 3ULDA 1RYSA 1HYZA 4HTUA 2ATLA 2HNZB 4ECQA 1S1XA 4CK2A 3ALYA 1HNIA 2BE2A 3LP0A 2BANA 1VSLA 5DLGA 3ZSXA 4R0EA 4Y1DA 3NL0A 3HJFA 3CDUA 2AGOA 2UVVA 4CK1A 4CIEA 2BQRA 3QESA 1FK9A 3HVRA 4FK0A 1C0MA 2FJVA 1LW0A 4NLVA 3I5BA 3EPIA 2BE2B 3GIJA 3OS1A 2BANB 1DTTA 4KI6A 4ID5A 3KHGA 4R8UB 4QWAA 4DFPA 1UA1A 3SV4A 3OYHA 3SUQA 1S6QB 5KFMA 3V4IA 1KLMA 3FRZA 2YKMA 3JSMB 4ZVHA 2FVPA 2XWYA 4I7FA 4TY8A 4FK2A 5KFNA 2XY6A 3BQ0A 4CECA 4DSIA 5KFAA 5JS2A 1IKVA 4KHMA 1RT3A 2CJQA 1DTTB 4ID5B 2JC1A 2X6SA 5CY4A 2BRKA 5C24B 1WSFA 3PR5B 3VA0A 4IKFA 3K2PA 3IN5A 3H08A 3QGHA 3M8PA 1ZETA 3KHLA 2BQUA 3BSOA 1W25A 3SQ0A 4KHNA 3V4IB 3AA5X 4XIUA 5HLFA 2YKMB 4BACA 3AO3A 4DFKA 4URSA 4I7FB 4HCCA 4TY8B 4GVMA 3LZJA 4DTXA 1U48A 1TP7A 1RT3B 4CJQA 1RT1A 4O3NA 2XY8A 4ECYA 3QEVA 5KFBA 5J2MA 1QQCA 4IKAA 2CKWA 4B9UA 1JXEA 1HARA 5SWMA 2V0NA 5CZ1A 2IMWP 5HLFB 5F8HA 2KQ2A 4JS5A 1FXXA 3ZSOA 1SKSA 1TGOA 2WB4A 1X9WA 4ZTJA 3OYNA 3UR0A 2W9BA 3LANA 4FM0A 1HYSB 3CYMA 2IC3A 4Q43A 4QOZB 5HP1A 5J2MB 3M8SA 4QWCA 4NCGB 4FJ9A 2AJQA 1C1AA 1REVA 4DG1B 1T94A 4H4MA 1RTDA 4AH9A 4IFVA 3KLHB 1NK9A 1VSKA 3P83D 3EPGA 3KLIA 4ED6A 4Y3CA 4URQU 2W9BB 1K1SA 3L2UA 3AVCA 3QEXA 4K4TA 2D0BA 3DOLA 4OKEA 2IC3B 5EDWA 1SL1A 1RDAA 3MF5A 4TN2A 1QE1A 3H4DA 3MXIA 1JL1A 3HSTB 4KPYA 1RTDB 4IFVB 3DLHA 4WE1B 3OL9A 4CF2A 4M3RA 2IDOA 4KAZA 3KLIB 4IQXA 4BE0A 2IA6A 1JLEA 4EBDA 4ECRA 1TL1B 3OYMA 4DTRA 1ZBHA 2D7SA 5F8IA 3MEGA 1QE1B 3PX6A 1RT2B 4E1NA 3QIOA 2VWJA 3TAQA 4PWDA 1BQMB 4IG0A 1BCMA 4QCLA 1FKPA 1S9GB 2WHOA 3C6TA 2R8HA 2R2UA 1JXBA 3NH0A 3VQQA 4NLUA 4ECTA 3K5MA 4DF4A 4E1MA 4NLRA 2YHAA 5CYMB 2VG5B 2JC0A 3OLAA 4HYKA 3MEGB 1S0NA 4J9NA 3PY8A 4WXOA 1EP4B 1LAWA 4AHVA 3K57A 2KZZA 2G8KA 4J9MA 3LALA 4CEQA 4CJFA 1GOAA 1NHUA 3NDKA 1RT7A 4NCBA 1ZTTA 1VSHA 1D0EA 3EYZA 3MECA 5DQHA 5KFSA 3LAKA 2W9CA 4Z4EA 4DLGA 4DL5A 1WSIA 4C8OA 5KFKA 3CDWA 3KLGA 2XCAA 1RT7B 3KJVB 3AVLA 4KB0A 4FS1A 4ZMMA 4B08A 4G1QB 3MECB 3G0ZA 3K5NA 1KFSA 2W9CB 3HK2A 4K4XA 2OA8A 3MR2A 2YNGB 1RDCA 3CFRA 3H40A 1TKZB 3CJ0A 2G8UA 1RBTA 5F8MA 3QINA 1C0TA 2X6NA 3KLGB 4RW7A 4ED3A 2G8IA 4IBNA 3PW0A 4O3RA 3BGRA 2Z1HA 3I0RA 4JV1A 4B9MA 3IS9A 4EZ9A 4DTOA 3PHEA 1IKYA 2BRLA 4DF8A 3CFOA 5KG3A 3MR6A 3FFIB 3NH2A 5HBMB 1NK0A 1NKBA 2HNYA 4IH6A 1NK8A 4EP5A 1Q9YA 2AGQA 1S10A 1BQNB 1KFDA 1CSJA 3V6HA 1C0TB 3AA4A 1C1CB 4RW7B 3K5LA 3PVXA 4YNQA 2B5JA 3VQSA 2HHQA 4FJXA 2A1SA 4OLBA 5FDLA 1CXUA 4F4KA 3CWJA 4M3WA 1IKYB 2IGIA 2OPPA 3RRGA 4U7CA 1C0UA 4RW6B 3SQ4A 3L8BA 2YNIA 3TAMA 4X2BA 3MR3A 4HUFA 3NAHA 2WRMA 4OKKA 4Y2AA 2UUTA 2J6SA 1WNSA 5KFUA 2C2DA 4N56A 4CJSA 3HP9A 3QETA 5L1JA 5FDLB 4N5SA 5DQGA 4KI4A 1ASWA 1TV6B 2AX0A 2OPPB 3BSAA 3HL8A 2XO7A 2D5RA 1HJRA 1T7PA 3H5YA 3D5MA 4FBTA 3LZIA 1IKWA 3TAMB 4EEYA 3OYDA 3OSPA 2VWKA 2FBXA 2P5GA 3LP2A 3OYAA 4KB7A 3BSNA 5KT7A 3VQCA 4GC7A 4CF8A 3Q8RB 3Q8QB 4FJ5A 3KD5E 3DRSB 2W7PA 5DG8A 3HVTA 3ZT3A 4FJGA 4LY7A 3I0SA 1OS5A 2DFHA 2KFZA 4EBEA 5KI6A 3VQBA 1QSYA 4H4OB 4NLPA 1RTHA 4CIFA 4CHYA 4YFUA 1RBUA 1NK7A 1CLQA 1GOBA 4MIAA 4PUOA 1XHZA 2D3UA 4ZP8A 3RBDA 4J9QA 3BR9A 5KFEA 3E01A 1S9EA 4FXDA 1T03A 2ZD1A 4CJTA 3O4QA 3MXJA 4ECVA 3C6UB 1L3SA 1RTHB 3RMAA 2BR0A 4Q0BA 3F73A 3MXMA 4ZP7A 4CGDA 1KSPA 1UWBB 1Z25A 4CEFA 3THVA 1J54A 2RKIA 2JEGA 5C42B 1GX6A 2FJXA 4BDZA 3GV8B 3E01B 4DSJA 4FLVA 5F8NA 1S9EB 2Y1IA 5DGBA 1T03B 1ZBLA 2ZD1B 2FLLA 2F8TA 1G15A 4F2SA 3LP3A 4I2QA 4DQIA 1D9FA 1RILA 4CJUA 3DRPA 4W5NA 2UVUA 3GYNA 2W8KA 4O44A 4B8AB 3RMBA 4CEBA 1HQEB 1VRTA 2RKIB 3NH1A 1B92A 2OZMA 4XPEA 1LWEA 1RTJA 4F4ZA 4LSNA 3VQ7A 3EY1A 4DS4A 3DYAA 3SUPA 3HM9A 3DRPB 3V1RA 2Z1IA 2FLPA 2RF2A 1BCOA 4DTPA 1GX5A 3GV5B 3ZSVA 3T5HA 3QIDA 2J6UA 3NE6A 4HKQA 4FM2A 3Q8SB 1WSHA 4AHSA 4RNFA 4N41A 1LWEB 2KZMA 3QEIA 5I3UA 2I5JA 3HHKA 1VK0A 1RTJB 1C2PA 3NBPB 5L1KA 3G6YA 1U49A 1RDRA 4W5RA 4O4GA 4NRUA 4KKOB 4Q8FA 5KT6A 5J2NA 4NRTA 3PZPA 3S9HA 1NKCA 2JLEA 4ZHRA 4HUGA 2ITGA 5KG7A 3BQ2A 2EC0A 3DM2A 3QO9B 4NYZA 5FRMA 2AGPA 5EWEA 4FJ8A 4RNHA 1S1TA 4NLDA 4Y2CA 1D8YA 4KHRA 3LP1A 4OPJA 3AA3A 3SNNA 2PYJA 2HWHA 4WYLA 3SI8A 4FBUA 2HAIA 5CYQA 5J2NB 4LD0A 1D1UA 3KLEB 4UQGA 4KHSA 2AQ4A 3DM2B 4KTQA 3NGIA 3IRXB 3QIPA 2Q3SA 3V1QA 4EYHB 2YNFB 2HVHA 2GIRA 3TABA 4E7HA 4CHPA 3CM5A 3M9NB 2GV9A 1JLAA 1TVRB 4WZQA 2HVIA 1SUQA 4ED1A 4FYDA 3A2FA 2JEFA 5CYQB 4J2AA 4MKAA 4KTZA 3IGNA 3O3GA 1UOCA 2D41A 3NAIA 2X78A 3CJ3A 2HHSA 4OKJA 4IRCA 1NK5A 4IFYA 3PW5A 3D28A 4ZP9A 3SQ2A 3PX4A 1Q9XA 1SUQB 2UVWA 1CZ9A 3B6OA 4ED0A 4IDKA 3RBEA 2OPSA 4WYWA 3OYEA 3JYTA 2E9TA 2BQ3A 1R0AB 3KIOA 4WFYA 3UQSA 3ZT4A 3QZ8A 2F96A 3VQEA 3OYGA 2R7YA 3PW4A 5KFZA 2RN2A 1VSFA 1UA0A 3PR4A 3M8RA 1S1XB 3H5XA 3L3VA 3LP0B 1HNIB 1ZYQA 4EO6A 3DI6A 2IJFA 1C1BA
chains in the Genus database with same CATH superfamily
3C65A 3FQLA 3H7HB 2ATQA 1SC6A 2YCHA 4YHHK 3ENAA 5KAKA 5HVHA 1ATSA 1C0GA 2ZM6K 3LF0A 1X5TA 3RW7A 4KO0A 1IJEB 2VG6A 1BOTO 3R1LA 4WKRA 3JTNA 2IVYA 2W42A 4Y6IA 1NG9A 3ZEUB 3KD1E 3R7NB 3PO4A 1G1XA 4U96A 3CIPA 1RCXB 4DUYF 5IWAJ 1SL2A 3NGTA 4YOXA 4DL6A 2CPIA 5DM6L 1YT3A 1Q82O 2DNMA 2YWKA 3UNGC 1CZAN 1YJUA 3WUHA 3ILLA 3CJKA 1RHMB 4FW2A 4ID1A 5CD4H 4DL4A 1S7IA 1T44A 1YTAA 1NWKA 1OYDA 1I94F 2KFNA 2DHSA 2Z2ZA 2UUCF 1L3KA 4TYBA 2DY4A 3GJTB 4CHNA 3A12A 1W9HA 2E2OA 2N4DA 2F40A 2H51B 3R3TA 2E7XA 1S1VA 4BR2A 4CZFA 1VS3A 4FVUA 3VETA 1TMJA 1CJTB 2LDIA 3VERA 2GIFA 5B0FA 5C2DA 3E9OA 1MN9A 2WVCA 3FEXB 1GNKA 4NXMF 1VQ5S 3VEWA 2HB5A 1Q7LB 2ZNYA 2DY9A 3T1HJ 3GFHA 2ZKTA 2OSQA 4FNIA 3THTA 4CGJA 1RCHA 1I3OB 3K58A 1CJVB 4OZLA 4JI6J 3R3LA 4DV5J 4WTOB 2PBDA 5K20B 5MLCV 2K1RB 4C8MA 1TL7B 1VSIA 3BZKA 2HKEA 3VEOA 3BDPA 1DLOB 3RB4A 3GIMA 3VENA 2G9OA 3CCWA 1F5BA 2ASPA 1VQNN 2X51A 2ZHOA 3QDKA 2UUBF 3M2VA 1FW6A 2CJ9A 2HFNA 2HFVA 3MAAB 5GADU 3CCUS 3L7UA 4J37A 4U6PA 3KMQA 1JJ4A 1WSEA 1KC8T 4FZVA 4CEAA 1LWXA 5GAEP 4TQRA 3SFUA 2V4JB 2DTJA 4UOFA 5HAOA 2AYBA 3PYDA 3FBFA 2K7KA 1LWCA 2ALZA 3DMJA 3BDEA 5L1LA 3WEEB 1QHTA 2PMZD 1EAYC 3C14A 4KHYA 3HT3A 2J9DE 5KPTA 5C0YA 3AB2B 4FJNA 4EO8A 2JEJA 4OZ0A 4PWDB 2ZEJA 4CJEA 2FBYA 2K8GA 3Q24A 2HWIA 3P5JA 1RAEB 2DR7A 1FKPB 1KXPA 1OY6A 4EBCA 3SI6A 3EMTA 2V51B 1HPMA 4YDUC 5GMEA 3MM8B 4DV6J 2R2RA 4KB1A 3QNOA 1U0SA 3PIOL 4BC5A 2F1FA 4X65K 1CQMA 2B9EA 4UUXA 2CQDA 4ZIVA 1RDDA 3JXUA 3DWLA 1S57A 3DRRA 5FROA 1RDWX 3FKBA 5F2RA 4QYZK 1H0HB 2O66A 4CJWA 3AVIA 3R27A 3MD1A 1KLNA 2WUSA 1CC8A 1IKXA 5AQZA 3TPQA 2J6TA 4BROA 2NUUG 1G6BA 1UAWA 3TI0A 5C15A 1WHWA 1OVQA 4CJKA 5M1PA 3UCUP 1U45A 1IJJA 1NOYA 4JYAF 4DBQA 5KG2A 2QWLA 3OYJA 2PT0A 1FE0A 5I3PA 2Z2MA 5C25A 3NXZA 4MK9A 1TFWA 1N5YA 3JAMU 3NY0A 1W26A 1X3MA 4F4YA 2XWXA 3VQDA 3HP6A 4X4PA 2EFNA 3W2VA 4IRKA 1RU1A 2VZ9A 2VDHA 1JXLA 1M5HA 2HBLA 4BDYA 4RUAA 4HCBA 4K0KK 4WP3A 5KFIA 3SSRA 3QMLA 1KVIA 1TK5A 2XS2A 5F9LA 4W5OA 2GAGC 2JFDA 5DZ7A 2HRUA 2K3KA 4C11B 1KC8O 5KPZA 5DS7A 1N36J 3VAGA 2B4JA 3R5AA 4ZJOA 2QIFA 2UUWA 3X1LB 1PBAA 2JGUA 3JSRA 2FF3B 3UDLA 2I6WA 1XMOJ 4WQ5A 4OX9F 2FSJA 2ZH4A 3SDEB 1N34F 2MQPA 4AXJA 3W64A 3OYBA 4A8OA 2GIQA 3GIIA 1SKUB 1HBNA 3UDEA 3RTVA 3AVNA 4C8LA 2F9DA 3GE1A 3M2UB 3WXKA 2HK3A 5DM7L 5J2PA 4M5NA 1ZZNA 2JHEA 2E1PA 1IKWB 5EX3A 1MWMA 3N4QA 4JKCA 4MFBB 2BUPA 3D54A 3H5SA 4CLTA 4X62K 4WFAQ 4CZLA 3EVOA 3JQJA 3JTPA 4OPAA 1C0FA 3KLFA 3KOAA 4B3OA 2OYQA 3I0SB 3OTEA 4FM1A 3NHGA 4B9VA 1PSDA 1FDBA 3WZ0A 1YIJS 4K4UA 1YTYA 4BC3A 1FDAA 4EFAC 1L3UA 2AV5A 4ECXA 3H2LA 3EGVA 5JJBA 1UL3A 3CMEN 4FJMA 2QC3A 3G8QA 4JKEA 1MWZA 2LXIA 2A6MA 1HQUA 4Q0BB 4DFMA 4FWMA 2XQCA 3HOSA 3GJSB 1S99A 2VCPA 4UZBA 4ED4A 5B0EA 4YUDA 3J81Y 4YOVA 2I1RA 1JKHB 2FSNA 2HQCA 2GUIA 1IBLF 4I2QB 2Y0SD 1AUSL 3VF0B 4ZPBA 5F1XA 4HWIA 4CIGA 4IOBA 1RGIA 1GLDG 2NUBA 4A4JA 3BZQA 5K8MA 2J7KA 3TQ1A 5AFUA 4DR1F 4FJ7A 1A0OB 3ONQA 1KNZA 2QWPA 4LSNB 1NB2A 3AY0A 5J1PA 2HWTA 5KFWA 4CJ3A 2EK6A 2CJBA 3OYKA 4IQMA 1U47A 2HQDA 1IG8A 2YKNA 3HJVA 2C2EA 3ULHA 2N7YA 1H38A 2C22A 2ZHAA 3CCZA 1P1LA 2XNRA 2BMBA 5I3UB 5HRNA 1IH7A 2F65A 1KVCA 1QVGR 1S1WB 5HROA 3J81j 1YBAA 4FJJA 4JD2A 1BHNA 2XY5A 1YQHA 3QWUA 2FC9A 4QJVA 2FY1A 5E7OB 3M9MB 4Y2IA 1JCFA 4UQTA 2CPZA 4OJRA 3T9NA 3AVFA 5JVGQ 1FWKA 1RT4A 3F9MA 4CH1A 2CPFA 3IRWP 3NFAA 4QIFA 1F6TA 1KHWA 1Z6RA 4HH0A 3LOUA 1FKOA 1T3NA 3V1OA 5GADP 2D0OA 4K43A 4FWOA 1HBUB 1S77D 3EJMA 3QIPB 1UVMA 1FI4A 4PABA 2A6AA 1YHQS 1J5EJ 3M1VB 3EZWA 3V9WA 3CIZA 4DV4J 1R8PA 2VGMA 4FZXC 3O8WA 1MLAA 1JWWA 2XULA 3ADAC 1ZBUA 1VQ9N 1CXQA 4Z4IA 1T05A 3Q8PB 4HHHA 3KG4A 2AJ0A 4JI2K 4R8UA 5E3QA 4CZCA 1NZAA 1I3AA 2QGFB 4DR1K 3H3NO 4CH7A 1S6QA 3R8EA 3AJ2A 3JYTB 3WNHA 4ATNA 4Q5VA 3B4MA 4DPYA 1LW2B 2J0XA 2ZVSA 1TKDA 1BLUA 1TL3A 4DR5F 2RS2A 3KK1B 1Y3KA 3ITHA 3TANA 1J27A 2DY1A 2DXDA 2QA4G 4K4YA 3ENHA 3HFZB 4WCEQ 3KKFA 1QSSA 4DFJA 2AX1A 3AGRA 1WG5A 2A3JA 4OHXA 2E2QA 2OKQA 2WVBA 3OL8A 5I42B 4ZCKA 3VQ8A 4R5PB 4X4TA 5ETSA 2HSTA 2QWMA 5AXLA 1NDPA 4JI1F 1OSDA 2DFEA 3GSDA 4LF7J 3OVAA 2YI1A 5KT4A 5M1QA 1F9FA 4OJ1A 1U02A 4CJVA 4ZVSB 3KK2B 2HVZA 1YG0A 4FJKA 2ZE2B 4DL7A 1ZM9A 2RDIA 2DNGA 3OYCA 5A8RA 5H9EJ 2DIUA 4NLGA 2XYHB 4IH7A 4X64K 1S6PA 1SH0A 4DL3A 4CGIA 2ERRA 4O5BA 3H25A 4NWBA 1HWLA 2V8GA 4F50A 1HYSA 2E9ZA 4LFAF 3PM9A 3M30B 1Q16B 2UYTA 4WFBL 4AHRA 5ETQA 4CJ7A 1OY8A 3EDRB 3QFUA 4ED2A 2Q79A 4DG1A 3K2YA 2HVEA 3PFOA 3IGVA 5EX0A 4KE5A 5SUHA 1BI4B 2MHEA 1RDBA 4DU1A 4LRFA 4M5HA 2R7WA 1O8BA 1LEOA 3L4IA 1WDDA 2E6MA 3R7BB 5KFQA 5IQQA 3QLHB 5AQYA 2AYEA 3ZZ0A 1HA1A 3NF9A 2HFUA 4CFDA 1R27B 3CJ8A 3I9V9 4Z4HA 1X9MA 1DFDA 2FTRA 1U1NA 4ISFA 3HOTA 5E84A 4RU9A 5F8LA 1SJRA 4DR5K 1R6YA 1HNWK 5KFJA 3VA3A 1L3TA 1WHYA 1HJOA 2KVQE 4PG7A 4KAIA 3H4BA 5BPMA 4DSLA 2OJ3A 3D2EB 2GO9A 2CPJA 4KT0C 1RT5B 5G0RA 2NRRA 3THWA 1RT6B 1PAEX 3SJJA 4USMA 4BQLA 4LFBF 1VBYA 4YQWA 3T5JA 4DQ8A 3ZSWA 4J8FA 2YVSA 2M8HA 1JLGB 3AQPA 4EHTA 3QSIA 4MKYA 1NPPA 4WQ4C 4C7QA 3PCOB 2JEIA 1WBDA 4JI8F 1LWFA 5KTQA 4O0IA 2GJ2A 1MMLA 1RXOB 5AQMA 1RB0A 1JLQB 2VC1A 2QFJA 4LFAK 2DIVA 1TYQB 4O5FA 3BSCA 1H7XA 3D45A 4I2PB 2ZH2A 1F0XA 2CXEA 1FX4A 3MFHA 1TTHB 2NXJA 2XEXA 3KJVA 1N32J 2AU0A 2R8JA 3KKSA 1MWQA 1CULB 2QKBA 2EFOA 3QERA 4CFAA 4CLWA 3OXLA 1DHMA 2QJ3A 3HKZD 1V4TA 2CAJA 4CZEA 2GX8A 4QAGA 2KB2A 4GY2B 3AVHA 1E6VB 3LPUA 1G2EA 4Z2XA 3MUVP 2MQNA 2VKZG 3HVWA 1N5VA 4QW8A 5AT1B 3FFIA 4WQ4A 3I56N 5GMDA 1WELA 4BY9C 4DPTA 4CH0S 3VZIA 1GTHA 1DBDA 3LWMA 2GC8A 4B9QA 1BQNA 2GMJA 4V1Ak 1C1CA 5T7BA 4WPAA 3MUTP 1RBSA 1RFQA 2H9ZA 2Z57B 2QXFA 4CE9A 4HH1A 1DKGD 4QR0A 2ZC4A 4I68A 1TKXB 2UXBJ 1UVLA 1R8AA 5KFYA 5THWA 2QLXA 4JP8A 4CI6A 2NQPA 2C2OB 2QEXN 2O8EA 1HKGA 5AQGA 4CZHA 4WYBA 5K9FA 4KFBB 4AL5A 3LAMA 4DTSA 2CWXA 4A8WA 2BH1A 3WX4A 1ZTWA 2D4WA 3GILA 2G8FA 3VEVA 5EWGA 2VGNA 1SIZA 2CQIA 5DRKA 3ULEA 1BO5O 2ZOFA 3KUEA 1AZSA 4CYUB 5E33A 4TSXA 1GH8A 4H54A 3R5DA 3OVBA 2OTLS 4K4ZA 4ECWA 1NMEB 4RJVA 1NLVA 2D69A 2Z56B 4K50A 4CEOA 4I9LA 5T7LB 3KJNB 2COLA 1KONA 4KGZB 1N5SA 1HLUA 3Q89A 3M3ZA 3DLKB 1ZXOA 1NHVA 2IIRA 2BJ9A 5LM7E 2J9CA 3C6UA 2DK2A 1RHUB 2H5IB 4RW8A 3K7RA 5KQDA 3NCIA 4ZPDA 1EETB 4QWDA 2YHBA 4CBWA 4YEAA 2ZH7A 5C42A 3KNGA 3V4MA 3H90A 3I5AA 2YX1A 4LJMA 4J2DA 4AD6A 4K25A 2HGMA 4OYXA 3AV9A 1HHTP 2WK4A 4OZ3A 1M5SA 2C2RA 4DCJB 5F0WA 2YV0X 1E4GT 4LF5K 2UXDJ 2FJEB 2IAJB 4OJGA 4YR0A 3BN4A 3CG7A 3VAKA 5IQ6A 1HQEA 1Q0NA 4DTJA 3W7BA 4LF4F 4B1ZA 3OJUA 5L1IA 2VV5A 3G10A 4E89A 2NYIA 4JV5K 2CVIA 1ITGA 1MWYA 2RJZA 4UY8O 2VA2A 2GBZA 3OUYA 3CFPA 4CTAA 4DQQA 2CIMA 3PIPQ 2LXUA 3G8TA 1JLBB 2OPRA 4ED8A 4YS2A 3KVGA 1ZPVA 4DR2F 5ADXA 2E1RA 3NOGA 3AVKA 4DXLA 2RDJA 1N33K 1HW8A 1BIUA 4E7KA 2V2KA 1FCAA 2ZBRA 7AT1B 2OMOA 3MCMA 4JI5K 4DSEA 2CJYB 1BGXT 3GONA 2N3LA 2DT9A 1RNHA 4YR3A 4WU3A 5AXNA 4YY3F 3TVKA 1YRTA 2MQLA 1O5JA 1BDGA 3U27A 1QD1A 1F1BB 2A0FB 2IBKA 3CCMN 2XC9A 5A76A 4H8KA 2YNFA 3O4WA 3MX2A 4WF9Q 2XM3A 2PY5A 4E2FB 3UIQA 4OYMA 3RVCA 1TVRA 2W1BA 3BN7A 2IVMA 2NLWA 5DGAA 3PRDA 3A3NB 1DGKN 2D0AA 4PEOA 5A8KB 3ID8A 4BLGA 3OV7A 3W2WB 2B7BB 3AT1B 4W5QA 3B6PA 4LT6A 4JI0F 4RUCA 1WUUA 2RMLA 5D6GA 2R8IA 1N56A 1TKTB 2ZBQA 3DHXA 4X4NA 3J7YU 5BYQA 4L6V3 2KHOA 2OO4A 3N28A 3N01A 3TOQA 4UT4A 4LF9J 1Y3JA 2VA3A 2BE9B 1DQ9A 3M2RA 4NZ7A 3FBCA 2FZKB 1RAJA 2KTQA 2Z2YB 1RYSA 2WBRA 1HBOB 4HTUA 1LKZA 5AQRA 2HZCA 5BYSA 4CK2A 3UE2A 3ALYA 1AB8A 4D3HA 3SIPB 4B3TF 3HJFA 1M90O 4C8ZA 4KHPJ 2L41A 4AXIA 4F3QA 3TTFA 3HVRA 3WBZA 2MKYA 4USUA 2FJVA 1LW0A 3AQOA 1KQSM 2WW4A 5ETKA 1RU2A 2BANB 1DTTA 1IBMJ 4ID5A 1T9YA 4JK8A 2BXJA 1PGZA 1UA1A 1K9MT 3VAHA 3OYHA 1MMNA 5KFMA 1YI2N 1GXTA 4ZVHA 3FGUA 3DFEA 5KFNA 1OJ4A 3BQ0A 2A2CA 5FPMA 2RAQA 4DUZF 2X6SA 3WQTA 2CGLA 5C24B 4YB6A 3K2PA 3PEHA 3QGHA 1ZETA 3KHLA 5D77A 5DDQC 2DNKA 5LY3A 1W25A 4KHNA 1P1TA 3HHLD 4XIUA 1WC6A 2YKMB 3AO3A 4AM6A 4HCCA 1FNXH 4GVMA 3LZJA 2LQBA 4DTXA 3R1HA 1U48A 3CCQS 2EBGA 4IEIA 4CJQA 3LDNA 1BWEA 2GUPA 4BR9A 3QEVA 4JK7A 2YQ3A 3TU5A 4DZDA 4IKAA 2QW9A 2V0NA 5CZ1A 7FDRA 5HLFB 1WWHA 3ZO7A 2VL1A 4Y0FA 2KFYA 4BHQA 1ILYA 2LQJA 2QWQA 4FM0A 3GFZA 1S5ZA 4ZJLA 4Q43A 4GKKF 1EKSA 5HP1A 1FRLA 1KKHA 1FEHA 4NCGB 2GHVC 1KOOA 1C1AA 5EOYA 4H4MA 1VQPS 4AH9A 1RBAA 2GZOA 3IDHA 1U0HA 5HJXA 3KLIA 4OI3A 4Y3CA 2W9BB 1SXLA 3MMAA 3DOLA 4OKEA 1UVKA 2W40A 4BR4A 2IC3B 5AZIA 1G99A 4QYRA 1SL1A 3K89A 3MPDA 1QVFR 1KR4A 3H4DA 3RSEB 3MXIA 2PD1A 1JL1A 3HSTB 3OBIA 5HJYA 4IFVB 3GZ7A 4WE1B 1KVKA 2OEMA 3E66A 4MJKA 4RO0A 3T1YK 4TU9A 3W9HA 3CETA 4DV0F 2RHSB 2MGZB 2YBVA 1P6TA 2DNYA 1YLXA 1T3OA 3GG1A 1VFJA 4DTRA 1NB7A 3D2FB 3MMVA 1GK8A 2DRDA 3QT7A 1K9MO 3QIOA 3BS9A 2VWJA 4LC9B 2LU2A 4UOCA 1BQMB 2Q97A 4QCLA 5AQIA 1RUSA 5K8OA 3NH0A 5ITHA 4HTLA 2A40A 4ECTA 1RHRB 1ZAWA 5LMUF 3OLAA 3QATA 1S0NA 5H9FJ 4FF2A 3BGOP 4AHVA 4J9MA 2O8CB 1HR0J 4B17A 5IT9Y 4K2JA 4NCBA 5AQSA 1VSHA 5DDPC 5KFSA 4OLOA 4H0TB 1AW0A 5L46A 4XDDA 4Z4EA 3PYEA 4DLGA 4DL5A 4NA1A 1YWXA 4BR0A 4C8OA 2QM1A 1QJHA 4UZCA 2XB2D 3WX8A 1DURA 2KRRA 3IBWA 1Q8BA 3KLGA 1RT7B 2KL8A 4FS1A 4ZMMA 1UFWA 3P5TL 1FRXA 2ZGYA 4K4XA 4M7XA 2YNGB 3S7RA 4JI3F 3NCPA 1OMSA 2R7RA 1RBTA 5F8MA 1C0TA 3LTOA 1WC4A 2ZJPL 5GMKa 3LO3A 2G8IA 4IBNA 3BGRA 2QFIA 1UVNA 4ISEA 5EX5A 1FFWB 4JV1A 3IS9A 2DXEA 3KFWX 2BRLA 4ZCIA 1H2UX 1NK0A 5CR4A 2G0CA 1DAXA 1NKBA 2UUAJ 2HNYA 1NK8A 3QNWB 4EP5A 4NO7A 4OI1A 3K9JA 1CSJA 4JI4K 3RBXA 3V6HA 4C6AA 2B5JA 3VQSA 2A1SA 3W61A 3QRQA 3SQGA 3VVTA 3EXYA 4OPHA 1Q8KA 4NXNJ 2YNIA 4G1PA 4JKFA 4LR9A 5ELZA 1RK8A 4X4RA 3SLCA 2UUTA 2HHHF 1R43A 2ZH3A 1BXNA 3CCES 4Q2MA 3HP9A 4QR1A 1NSQA 3N9UC 5DQGA 3D67A 1TV6B 2OPPB 3HL8A 2D5RA 1HJRA 1T7PA 3DXMA 3TAMB 3OYDA 3OSPA 3TO8A 4NLCA 4FJ5A 2NNWA 3DRSB 1YF5L 3R1XA 3HVTA 3ZT3A 1N32K 2BJ3A 4FJGA 4LY7A 2NXNA 1OS5A 2DFHA 2KFZA 2HF3A 4EBEA 3VQBA 2G0IA 4H4OB 4G65A 4NLPA 3I87A 1WI6A 2E1ZA 4CIFA 4CHYA 2NR0A 1VQKN 5L9NA 1RBUA 3CJSA 4ES2A 1N5TA 3MD3A 4JAXA 2APOA 2O8DA 2D3UA 2VHGA 3RBDA 1QY7A 3BZCA 1UEKA 4FXDA 2H4YB 1T03A 4V19J 1IVZA 4CJTA 3ENQA 4QOTA 1SQFA 3MXJA 4NMXA 2BOPA 1VAZA 1L3SA 4RWTA 3C19A 3DDNA 1U1OA 3OTOK 5GAGU 5HATA 1VLOA 3EEQA 1Z25A 4CEFA 3VESA 5AQFA 2VBYA 3MGJA 4IOAQ 4DSJA 3MK6A 1FRIA 3LQVA 4IZ9A 4IO9Q 1TUYA 2QYCA 2BUNA 1D9FA 1GTEA 3P96A 3DRPA 1TELA 3DGVA 2HFOA 3KG0A 4F0MA 2MPUA 1B92A 3NNAA 4LFCK 1KVJA 2JVOA 4PKHA 3VQ7A 4L76A 4ILRA 3BGFA 4B1WB 3SUPA 3HM9A 2FJAB 5AZJA 5JMVA 2GMHA 4DTPA 2V5HG 4DCPB 4OZNA 4WFBQ 4A5AA 3NWRA 3UD5A 5D0GA 4GV9A 3SEOA 4PXCA 2BW2A 5A2QO 3QIDA 4HKQA 2DO4A 4FM2A 2XSJA 4AHSA 1LWEB 1UP1A 3UN3A 1RTJB 5JVHQ 3NBPB 4AQYK 5L1KA 2O8BB 2W24A 1XMQF 3G6YA 4KKOB 4J7CA 5KT6A 1UVIA 1G4CA 2F7TA 3VAFA 4ZHRA 4MMOA 2KT5A 4H0OA 2C3UA 4B1UB 1S1TA 2O01C 2U2FA 4NLDA 3FNNA 4U95A 3JS6A 1XQSC 3AA3A 2EC2A 1HWIA 2HWHA 5CYQA 5J2NB 2A41A 4U8YA 3OFEA 5ETTA 3PSIA 5LMNJ 4KTQA 3NGIA 1KBRA 3V1QA 2GIRA 3TABA 1G3OA 1KTVA 4YDDB 1X31C 1YUWA 5TKYA 3M9NB 1JLAA 3H1QA 4ED1A 4RCHA 4ALZA 3A2FA 1RCOB 2DCUB 4J90A 1UOCA 4M5DA 2D41A 3NAIA 1F2GA 1F3FA 4IRCA 3PW5A 4LF6F 3SQ2A 3DNCA 4ZK7M 3TQEA 1SUQB 2UVWA 3B6OA 4ED0A 3RBEA 3M4XA 4WYWA 3D6HB 1R0AB 2VQEF 4WFYA 1XC3A 3UQSA 3FZBA 2YWHA 3VQEA 5KFZA 4MLEA 3CJTA 1UA0A 1YDLA 2PGCA 1S1XB 1Q81O 3DLLL 1C1BA 3W5YA 3QSYB 4P9SA 4CJLA 4K8ZA 4IDKB 2C3YA 2CQ0A 1RBOB 5F8JA 4O4RA 2SXLA 3M8QA 2DNNA 1S6OA 2QRRA 4ICLA 1RDUA 4LUBA 3MWPA 4PWWA 1KAZA 3BH7B 2PSZA 5G4DA 3V6DA 3J80O 3OYLA 1D5AA 1KWMA 1RTIB 3EX7B 3W66A 3ZTOA 3MM6B 2WSFC 5E41A 1KLMB 4DX7A 4ID8A 5IWAF 3H59A 2YHXA 2DGQA 2VPXB 1HHSA 2D9PA 1QUVA 3NS5A 2NS1B 1QM9A 4L8RB 2NCKL 1GLAG 5B0DA 4B3RK 5ETOA 2FHMA 1S0OA 1VRUA 2XI3A 3PJXA 3FJ2A 4WXWA 3QBXA 2P1JA 1S9FA 2VFSA 4OHWA 3VQAA 1RABB 3ZETB 4X84A 5AJ3J 1SJQA 4OVLA 1HNXF 1MA9B 4P74A 1XR7A 3QEWA 2ZH1A 1RT1B 4XO0A 3DOMB 1HPZB 4OO1J 4NLYA 2K1RA 3ZCMA 2GV1A 3AODA 1VHIA 1TL7A 2QYGA 4LBPA 1LAVA 2N4CA 2V69A 4CZKA 3MCNA 1DLOA 2VQEK 1IBKJ 2VU5A 3W63A 1X4BA 3CDEA 5A8WA 2A10A 3T1HF 1RA6A 1U04A 3BKTA 4L75A 4JI6F 5IFMA 3MAAA 4DV5F 4PQUA 2MY8A 3FZKA 1XK8A 3G6ES 4C1NK 4ZP6A 4E98A 2ILZA 4KHPK 1LQ9A 2VPZB 1PO6A 2V4JA 4DU7A 2OTJN 4XH1A 4F9OA 1PBUA 3TX8A 1SH2A 2LQ9A 3A0IX 3OSNA 3MMJA 5GVQA 1NLKL 3IA0A 3L2WA 2DPJA 3WEEA 4CO1A 3E9PA 2FHOB 3TTCA 3FSIA 2LCWA 4CEDA 2XY7A 4NI2B 5KOWA 3RR7A 2P9PA 4MYTA 1UFKA 4OYPA 3CC7S 3Q8UA 3O3HA 2GCFA 3HSGA 3TZWA 3F9KA 3CTRA 1JLEB 3R9PA 3P38A 5HI7A 3PRVA 1DEJA 9RUBA 1OSCA 3HVAA 4OI2A 1K0VA 4KRFA 4DN0A 3FCWA 3UDVA 2LQ8A 1VQSA 4PCQA 4IG0B 4FS2A 3MAHA 3C6TB 3IMQJ 5F0UA 4ZVFA 1BA1A 2OFHX 3OD2A 1RJJA 4DV7J 2EKNA 4DV6F 5AQTA 3DLEA 3D0IE 1EX4A 1NEEA 4YDXA 4H4KC 2Y3YA 4FLZA 3SPZA 1SC3B 1N4LA 2B4PA 1U7LA 4OMFG 3A5NC 4QS8A 2VC0A 1RBLA 4Y1CA 3ET6B 3MTJA 2KN4A 2RDDA 4U7UD 4O0JA 4BRMA 3CC2N 4UOHA 3KK3B 2I2YA 5LXYA 4E3SA 2G8WA 4V19X 2IDLA 4WU2A 5FRNA 2P9UB 3ZZPA 3QGPA 1BG3A 5E0OA 4C11A 1M1GA 3KJQB 3FZMA 1FXDA 5KFGA 4CERA 3L2QA 1NSKL 2IY5B 3PW2A 3MM5A 2P9IA 1XNQK 3TSPA 4F4WA 1JQGA 2NXCA 3B8AX 4NL5A 2H3GX 4OL8A 5KG0A 1LXJA 4KH0B 4F26A 3CJ1A 1SV5B 3DXSX 2ZITA 4KV8A 1S5JA 4LREA 4FWNA 1N36F 3M2UA 5EUHA 3FZFA 3GFYA 3SAFA 3GWCA 3ZSZA 5M1FA 3CCVS 5IM0B 3S41A 2AA4A 3P5BP 1F9EB 2JZ5A 1HNZJ 1JJCB 1XMOF 4G3IA 4MFBA 3J7AP 3MN9A 2IRYA 2MZJA 1OH7A 3MN7A 3MUMP 3CQ8A 4Z0UA 4B3SK 1Q5YA 3ZTSA 4O3PA 4NLXA 4NLBA 2CZ4A 3B4DA 1NJXA 1S59A 3SYZA 1QAXA 3MMCB 3CD5A 4TLRA 2Q3PA 2CH5A 3QFPA 2KW4A 1HW9A 3LP2B 1FJGJ 4MH8A 1RHQB 1NJWA 3MEKA 5D4NA 4B9NA 4C0BA 4UF4A 1SVDA 2HZVA 4G6VB 1WG4A 1Y4ZB 5C5JA 2GEMA 5KRTA 1FX2A 4CF0A 2QSFA 4OX6A 4X4QA 3BYRA 2VBWA 4LF8J 3G87A 3VEZA 4PUOB 2DGSA 4PL7A 1RYRA 2IVOA 2V52B 2W4DA 2GNKA 5CD4A 1WLJA 3MN5A 1WEZA 3MPYA 1V3RA 2RD5C 4YOYA 1JKHA 4CJ5A 1K1QA 2FLOA 4QIGA 3EE9A 2CQHA 1JMTA 5LL6d 3Q23A 1R59O 4A59A 3UI3A 4KHWA 3T7ZA 2JWLA 2C42A 3B8HA 2XHBA 1CPZA 4ECSA 3Q86A 4Y00A 1WOQA 2M9KA 4OLPA 1CJKA 2FZGB 4CF9A 2DO0A 4NXNK 4DR6F 4ILMA 4KGMA 3M5RA 2QA4N 2IDEA 1VRTB 4PKIA 2E1MC 5A2QU 4USJC 3OA9A 2OGUA 2E88A 4YHHJ 1UEVA 5EVZA 1C4AA 1RTZA 1S1WA 4OV6A 3DYAB 4F2RA 1Q7YO 3HHLB 1WF1A 1UEUA 2QMUB 3TJ8A 2KXNB 1S12A 4DR3K 4MKVA 4C3KA 3VQPA 5KFFA 1KHVA 1TU0B 4Y34A 5GADI 3ZTQA 1YX2A 4Q2LA 2XMTA 2VICA 1YXQA 3GG0A 1X0FA 3J81O 4BRCA 2XZTB 1N6QB 2ETJA 1B9FA 3QJJA 4WK3A 2IIHA 2E5LJ 3EWGA 4ZPVR 2WOMA 3HTVA 4GVBA 2XTJP 2BBEA 5KFRA 2HG4A 4ZN3A 4M3UA 4CK3A 3N4PA 3V9UA 1OYEA 1MMDA 3BJYA 3O9SA 5CCLA 4NZ0A 1KOHA 3R5CA 2HNZA 3U8XA 1FVQA 2OCEA 3CD6N 4PYDA 2MHNA 2YKPA 3IWNC 3BY5A 2CGJA 4CESA 2KKZA 5HRSA 4F04B 2M2BA 1J5EF 1F5AA 2JWNA 2HBQB 3GQCA 2HS4A 2X1AA 4OJ3A 4JLHA 2EK1A 4OYBA 3O6WA 1LW2A 1KVAA 4KREA 2DITA 1NCLA 3KK1A 3MCPA 3HHDA 2P9SB 4ISGA 2IMOA 4JV0A 4IFYB 4IOCQ 3NMUA 2IPOB 4WFAL 3SMZA 2FVRA 4P2FA 1CBKA 1VQMN 1SZ2A 3JSMA 5BRHA 2CNLB 1QSLA 8ATCB 2IM2A 2F3JA 2LSNA 4E7LA 3CC4N 3NMRA 3R7SB 3RG6A 3AA8A 3UB5A 2KJVA 3J80U 4DR7F 2ZE2A 8AT1B 1NH8A 2N82B 4CJ4A 4ITSA 2BDPA 3IUCA 4WFXA 3OTBA 1PKUA 3FZ2A 2ZDPA 3ISNC 3W8PA 3HPGA 3S3OA 4BGBA 3ELHA 2NUHA 3KK7A 4A8FA 3W1YC 4LF7F 4PKGA 2NZ4A 4KO0B 4IFEA 2VG6B 4DV1K 2PI4A 1EWQA 1WF0A 2KXHA 2ZJQQ 2XMJA 4ENOA 2NRXA 1GT8A 1BI4A 2DGOA 1A5VA 1RAGB 2IS3A 2B8PA 2O4IA 4FZYA 4CO5A 2XMUA 3W9JA 1DARA 4CZIA 1VQ7S 3HI9A 2EEYA 1WEYA 1V9OA 4KSEB 3PHTA 2M70A 2MB0B 4X65J 3MHYA 4FVMA 1Y64A 3EKUA 3TSUA 2CGKA 1JX4A 1HL6A 3GJQB 2ASDA 1U2RA 1X4GA 4GC6A 4QYZJ 4OHZA 3I8DA 3KKRA 2WONB 3CW2C 2ZH5A 2VONA 4CCHA 3FMWA 2D3ZA 1YJWS 3O80A 3CC2S 3I5CA 5F0XA 3D2WA 1CJUB 1UETA 4UTGA 2MKCA 2QK9A 5DO2A 1JLFB 1OH6A 2RPIA 1RT5A 1J5OB 4KY3A 5KG6A 3A4TA 1DQAA 2V8HA 2DISA 4C4WA 1TL1A 5MLCQ 2HYIB 4YP3A 3IFEA 4BBYA 4K8XA 3VQ4A 2KYZA 1XBWA 1GEHA 2HMIB 1JLGA 2NRTA 3I55N 3O8MA 2HQFA 3PUFA 4BWMA 4LVNP 4CFBA 4KGKA 4OGEA 1JJ2R 5GIPA 4DLEA 1J53A 1K73T 1WHXA 1QAIA 2Z4PA 3FZHA 3IR6B 1VK8A 3CCRS 3S3NA 2F9WA 5KPRA 4P7TA 1M5PC 3M2VB 3O4NA 1FFSB 4Z4GA 3A8JA 3R2CJ 6FDRA 1LV5A 5AQHA 1FWLA 1F2HA 5KT3A 1E6YB 4DPOA 4KBIA 2KT2A 4OV1A 4FLWA 2QA1A 1J6ZA 4W92B 4DOZA 1QAYA 2W2PP 1LWCB 1CULA 4WTYA 2QWOA 1PG5B 3DMJB 4H0XB 3IR5B 3H46O 1QTMA 4CFCA 3M6UA 4CO2A 1XHXA 4IR1A 1TAQA 1U2CA 2R42A 4DJBA 3D6RA 1R7IA 2W8LA 2NZTA 3AHPA 1E6VA 4G1QA 3K5OA 5GINA 1NGFA 2DPIA 4GKJK 3MN6A 3CULA 4YMEA 1IG9A 3HMJG 4CLPA 3ETMA 1QVGM 1TKZA 4WCEL 3OL7A 3AO1A 1V5IB 4JYAJ 1UZHA 4RW9B 4RNOA 5D0HA 3DRRB 2DNRA 3CVKA 2MZRA 1F21A 4PG5A 1UVJA 3SV3A 5HBMA 2I0XA 4QIVA 4CRJA 4BRAA 5F3TA 3TUZC 1IKXB 1TKXA 3LUYA 2C1EB 3KHRA 1VQ5N 4FLUA 5M2UA 2DB1A 4BRGA 1RWUA 4NYNA 3DDIA 1H98A 4C8NA 2R8KA 4YR2A 2HBMA 3CCJS 1TK0A 3VEYA 4LSLB 1V3ZA 2PMHA 3CD7A 3D7SB 3TP2A 4C9DA 3EKSA 2C2NA 1O6XA 1XTZA 4AHCA 4RW6A 5C25B 2GVDB 1UW4A 3KWIA 5A0YB 4PAAA 3LDLA 1XERA 1N5YB 2Q0UA 1C6VA 4BG8A 4BRNA 2UXBF 2Q2RA 3HSCA 4ZVOB 3W2VB 4Z4CA 3L6QA 1K73O 1TQLA 4CYUA 3OYIA 2BX6A 1K6YA 2JOQA 3CCUN 3ZZOA 2HLUA 4NPOA 2FBTA 3O08A 1FF2A 1LK7A 4DKWA 1N34J 4M3TA 2QX0A 5T7LA 3DC2A 2RQ4A 1KDNA 5FJ4A 4M45A 2FPHX 3DLKA 1X4HA 4JS4A 2GFFA 3CGIA 2C3MA 2YPYA 2CNNB 4DR4K 1PJ5A 4PL8A 3UVJB 3OQ2A 3DU6A 1FWPA 3TTDA 1MROB 3TJ9A 2ILYA 1HBNB 4J9RA 2OSRA 4DV2F 1LXNA 2I8EA 4URGA 2H4WB 3MEDB 5FLXY 5J2PB 2XGQA 1E4FT 3Q7BA 3BH6B 1FJEB 3D1HA 1RWMB 1IR1A 1S7HA 3QFHA 4BRPA 5HRPA 4K8RA 1CEZA 1TL5A 1KAYA 3G71S 3HHLC 3SAHA 5D0EA 2MMYA 2E66A 2QZ8A 3X3UA 2CNOB 2IM3A 4PQAA 5CZXA 4B3OB 2DHAA 3OW2R 2FC8A 2UXDF 3EO3A 1GLFO 1YBUA 4IH5A 2RSQA 2B9YA 2V63A 1M1KT 2H3EB 2BM0A 1CLFA 5F3ZA 3BEGB 1RWOB 1Q4RA 1U6FA 2DR6A 4DEZA 1RWXB 1KAXA 3OBYA 4AFFA 3CMQA 3G6XA 4DV3K 3OR1A 1FT8A 1K8KA 4JI2J 5KT2A 2MKKA 2E6LA 2W7OA 1TUWA 3KNAA 3T41A 3RB6A 2WW8A 4QWEA 2QN6B 4OYZA 4DR1J 3IG1B 1S3XA 1VLYA 2WB1D 2IJRA 3C3LA 4KGXB 4WK1A 1VSMA 5KQ8A 3HZ6A 2AMCB 4FVCA 3SAGA 1NSAA 2AYMA 3ZX0A 5K14B 2YPZA 4WIIA 1Z05A 3L09A 1I39A 1PJ7A 4IG3B 4IR9A 3G4SS 4DV2K 1YTUA 5TKWA 2U1AA 2HQ3A 3LW5C 1Z1ZA 5A8KA 4KC5A 2P5OA 2Y8YA 3W2WA 2P9KA 2PZSA 1SC4B 3WIUA 3J81U 1FJGK 2DGXA 4O0NA 3S3MA 5CQGA 4FJHA 1K0TA 3TAEA 2AJ2A 3ATVA 3N5BA 1YRXA 1F9HA 5LJVA 5KFVA 4X64J 5HROB 3U3GA 4U7BA 1TZ0A 2DFFA 1CG2A 3G6VA 3J8AA 3LL3A 3FC9A 2Z1GA 5AQLA 4LF8K 4A48A 2J8AA 1NRKA 2CZ9A 2C3PA 1U8SA 1LFWA 1L5UA 1BE4A 3AA2A 1BU6O 3GR1A 4RKUC 1RT4B 3NMAA 4LF9F 4DMNA 4Q44A 1YIJN 1U1MA 1WTFA 1FKOB 2ADCA 1AA1B 3ULDA 4I6WA 3VQTA 1GMWA 2O3DA 1XIQA 3LP0A 2BANA 2WSCC 4R0EA 1YK9A 4AL6A 1M1KO 5DZ6A 3TSQA 3HZGA 4S0MA 4CIEA 1NMDA 1FK9A 4MO4A 1VMBA 4FK0A 4DR5J 1MG7A 1HNWJ 4F67A 2F8HA 4HACA 3BP8A 2JLFA 4YOEA 3I5BA 2ACMA 2ZBPA 3GIJA 3PEJA 3J7A1 3KHGA 4R8UB 4DFPA 2B4OA 3THXB 3HULA 2F4VK 2HFSA 1NJIT 2Y8WA 1S6QB 1EB0A 4JI1J 2YKMA 2HGLA 1VGYA 4FK2A 2XY6A 4DSIA 2DRAA 5KFAA 1IKVA 4I56A 1Y5LB 4IO8A 1EZZB 2JRSA 1VR6A 2BRKA 1WSFA 5BREA 2FGCA 3VA0A 4N7TA 2Q31A 3E9LA 3H08A 3M8PA 3BSOA 2YHYA 1D8ZA 1X7VA 2NRHA 5HLFA 3BF3A 2GW8A 2H5JB 4I7FB 4TY8B 3TR5A 4O8KA 2OELA 4LFAJ 1TP7A 1RT3B 1XNRF 1HD0A 4O3NA 2XY8A 4ECYA 3PIPL 5KFBA 1QQCA 3CPWR 4GNIA 2QA2A 2E5LK 2CKWA 2DPNA 4F0KA 5F8HA 5I9EB 4A5BA 4A46A 1NGBA 4NYPA 3UR0A 2W9BA 4TU8A 2OEKA 4A2BA 5H1SQ 1HYSB 3HD2A 3IXQA 2IC3A 1TUUA 4A47A 5J2MB 3TVZA 3ZXWA 3RSEA 5F41A 3SSSA 3E1YA 4R0JA 1REVA 4DG1B 4IFVA 1SIWB 3EPGA 2XMAA 3L2UA 1YHQN 1FD2A 2D0BA 1T02A 1ZPWX 4M5JA 3AOCA 1AROP 3RAMA 3A5LC 1FO1A 3GJRB 4TN2A 1R3NA 4WF9L 3RUBL 3QQCD 3NGRA 3OL9A 4CF2A 2IDOA 2X7IA 1WKKA 1M5VC 4IQXA 4BE0A 1K8AO 2IA6A 5ETPA 1WD6A 2ZH9A 1WDTA 3OYMA 1BA0A 5F8IA 4ILHA 1QE1B 4ZVTB 4AE5A 2YX4A 1OPIA 4DUYK 1PYSB 1NJIO 1SJ4P 2CJKA 2R8HA 1FE4A 1JXBA 3MR7A 4NLUA 3FMBA 1VBKA 3AXMA 1RSCA 3KWMA 2G13A 2AKWB 4NLRA 2YHAA 3GP9A 3PY8A 1LAWA 1I94K 3MWTA 2UUCK 1YJ7A 4R79A 2KZZA 2G8KA 3LALA 4CJFA 3IBCB 1RT7A 4USKA 1ZA1B 1HR0F 3HZEA 3F56A 3EYZA 2BJEA 3LAKA 2ITMA 1BMQB 2CWKA 2XCAA 4NXMK 3FEZA 3KJVB 4KH4A 4KB0A 3FSYA 4B08A 1W7AA 2UV8G 3MECB 2YQ0A 1KFSA 2DEJA 3ZTPA 2W9CB 3HK2A 5AQQA 3MR2A 5ETNA 3CFRA 4CLYA 4YB5A 4L72B 3Q2SC 3M1FA 3QPIA 3KWGA 2G8UA 4WQ5C 3PW0A 3ENWA 3NNCA 4P7VA 3N79A 2G1DA 3I0RA 2Z1HA 4EZ9A 4ZIWA 4LF5J 3PHEA 2R3VA 2JJ4D 4DF8A 3MR6A 5C2FA 3FFIB 3AD8C 3NH2A 2UUBK 5HQLA 3OXGA 2MJNA 2EFVA 5IT9O 5EXWA 1NAQA 2UUAF 1S10A 4H5WA 1BQNB 1KFDA 3TYTA 4YOUA 1C1CB 4K2XA 3OFFA 2J4RA 5BRDA 4OLBA 4F4KA 3CWJA 4JV5J 1X4EA 4M3WA 5LSRA 1IKYB 2UV8A 3TVYA 2OPPA 1NBEB 4U7CA 1C0UA 3SQ4A 3TAMA 2KHDA 2FY8A 3MR3A 2CYYA 1FJCA 2HS0A 1T9XA 4Y2AA 3U02A 5K8NA 4N56A 2MZQA 4JKDA 2O8EB 3BUZB 3GDQA 2CPDA 3QETA 4RUBA 5FDLB 4CLFA 3R5GA 1N33J 1ASWA 2XO7A 4FWRA 1R6VA 3H5YA 4FBTA 3LZIA 4M8LA 4Y2MA 1RWPB 2VWKA 4JI5J 2P5GA 3OYAA 4ZA1A 3BSNA 3TA1A 2W7PA 3ULEB 1VQ6S 2AEJA 2GA7A 1AZSB 1U26A 2A18A 3TUIC 1NGCA 2Z58B 1WEXA 2QL5B 2QLJB 5BR8F 4MIAA 1XHZA 1UJ4A 3UKUA 5D78A 4J9QA 3BR9A 4ZPTR 4JYAK 2WFBA 3GIRA 2B56A 1EQYA 5K8PA 3NRBA 3O4QA 3C6UB 2G2ZA 1S6UA 3RMAA 4CO3A 3SJHA 3HX9A 4LIRA 3PKYA 4ZP7A 3M8ZA 3PYFA 3T9ZA 4OHYA 2GGPB 5C42B 2YX7A 2KYXA 4LF4J 4BDZA 3GV8B 3MPUB 1S9EB 2CPEA 5M1OA 1RILA 2RUSA 2Z2LA 4W5NA 4O44A 3RMBA 2CQ1A 1HX1A 1HQEB 2Z8QA 2RKIB 3NH1A 4WBFA 3OTCA 2OZMA 3GOIA 2DEIA 1LWEA 5EN1A 2ZWHA 1RTJA 3LM2A 4NX9A 2GQCA 4C0HA 2P6TA 4DR2J 3BKFA 3EY1A 2EXUA 5HK4A 2R7VA 5LJ5Y 4JI7F 4I6MB 1QVFM 3AJDA 2QTWA 2HLTA 2VFVA 2Z1IA 1BCOA 2RF2A 1GX5A 4OX9K 3T5HA 1B7YB 3OUYB 1N34K 2J6UA 3CF5Q 3NE6A 3LM9A 3Q8SB 4RNFA 1H6KX 2JX2A 3D1QA 2KZMA 3OFHA 2I5JA 1NZ8A 3HHKA 1VK0A 3D3CJ 3DGPA 4O4GA 4NRUA 4Q8FA 5J2NA 4W98A 4NRTA 3S9HA 1NKCA 1YBTA 2QTDA 3BQ2A 4ZCLA 4NYZA 2DR8A 4GV6A 5T41A 5FRMA 4A61A 4A57A 4FJ8A 4F0HA 4RNHA 2OTLN 4NMLA 3LP1A 2VIHA 3PKMA 3WQUA 1IBCB 5IT0A 3SI8A 3ATUA 2M0GB 4HT7A 4JI0J 2X1BA 4KHSA 2AQ4A 3DM2B 3WXIA 1HI0P 2Q3SA 1HD1A 2YNFB 1B70B 2DH8A 4IJNA 4CO0A 2DNQA 4CHPA 3H1VX 3CM5A 2RUGA 1TVRB 1SUQA 2WVDA 4FYDA 4J2AA 4M5MA 4RU2A 1N52B 3BF1A 1JCGA 2W7AA 2FYXA 1QTNB 5E2QA 4Q7AA 2VOPA 2EI5A 1LCUA 4B3TJ 4BS2A 3NGKA 1NGEA 3PX4A 1CZ9A 4IDKA 2JH3A 3OYEA 2NSCA 1IBLK 2BQ3A 3VGMA 3ZT4A 5M1KA 3HLUA 3OYGA 5M1NA 2GQ2A 5AQOA 4E8UA 1VSFA 2YX6A 3PR4A 3H5XA 3TA2A 3L3VA 3QJPA 3H0PA 1ZYQA 4EO6A 3DI6A 3P8BB 1RTIA 3MM6A 4TXSA 2H1YA 2KM8C 3T1YJ 1GMVA 4Z7YA 4HUEA 3C46A 4YN3B 4I6AA 4GVLA 3RMCA 4ZOSA 2MKJA 3NKYA 1WNEA 1LW0B 3AD7C 1X5SA 3O3LA 1PAUB 3TR8A 2L08A 3U1MA 3DLGA 4U67Q 4CEZA 5T14A 4OZJA 2VQFF 4O55A 4I69A 4IOAL 4FNHA 1EJ7L 1RGVA 3OL6A 3BQ1A 4IO9L 4Y28C 5GIOA 3C7NB 2ASMA 2JWKA 2NRVA 3ZETA 3CSKA 3N6NA 3MMBA 4F7VA 2VFRA 3HD1A 5LJWA 2HNDA 2YWFA 4ETZA 4DU3A 2E8AA 5J1EB 2AD9A 1SL0A 2VG7A 1HPZA 2R2TA 2ZNZA 2RHQB 2ROGA 3TUPA 1FTRA 5BXIA 2VD3A 4RW4B 3U7JA 4CGHA 1A5WA 4RBVA 5E3RA 5AJ3F 2AEMA 5KGWA 1SBRA 4GKKJ 2MXYA 1Y5NB 3NAEA 3VN5A 3LDPA 2RHKA 1YJRA 4FDFA 5JVHL 5C2CA 4I6YA 3RB0A 4M63A 1JL2A 5AR0A 2XZDB 2XRIA 2CQ4A 4BC2A 2RE1A 4ETXA 1BL3A 5CYJA 2ZGZA 1IBKF 3ZSQA 4X66F 3D66A 4QIWD 4IWVA 3TAPA 3VAMA 1DTQA 5HP1B 4P52A 3UPFA 3W0LA 3NGDA 1JLCB 1HNVA 1S22A 4H4MB 1DQ8A 2V8VA 5B0AA 3T19A 3KZBA 1U0HB 2DHXA 4DV0J 2AT1B 1SKWA 5B7WA 2F7VA 3MMAB 1VOMA 3DOLB 2HOEA 2ZWOA 5B0CA 2P2CB 5AZIB 2E2NA 2RE2A 4JI4J 3H20A 2X1GA 3KHHA 5GAGI 4J9KA 2G2OA 3DOKA 1LFPA 1KQFB 1VQOS 5CHCB 2E1AA 1FESA 1H74A 4JI1K 4Z7CA 1GXUA 3M9OB 3CI5A 5KFXA 4C8KA 1IR0A 1YRUA 3CMAS 4XTTA 3L9ZA 1U8WA 3U3YA 1NM2A 4OZ2A 2FUG9 3AO4A 4FWQA 3FBEA 2E4LA 4RG8A 3DLBA 2QSWA 3TWHA 4PXEA 2CFXA 2Y1JA 3F0NA 4ELVA 1T6DA 2P5VA 1WAJA 2ZWPA 3NF6A 1ZBTA 2QG9B 3C6HA 4I1TA 4FO0A 3SFGA 2XMKA 1U1LA 3KHYA 1KD1T 3WDOA 1X9SA 3ET6A 4DV7F 2DGVA 3UWTA 4WZMA 1WC0A 5AE2A 1ZAXA 3ZT1A 3PACA 3CCQN 4BE1A 4B1XB 3N4WA 4ZVRB 3KK3A 4CLLA 1R89A 1HMVB 4M42A 3AO5A 3BREA 4A62A 3MZIA 1QQMA 1HLWA 1NBWA 4HR2A 3L3UA 2A1BA 4FWKA 3BO2A 1REGX 2H5EA 3QT5A 4JI3J 1S48A 2P9UA 2QLWA 3LPEA 1WC5A 1HYVA 3VEXA 3EXCX 3D7EO 3JAMO 1YAGA 1VQ8S 3OTOJ 2ASJA 3C0BA 4X4VA 2ZC3A 1VQPN 2CG8A 1JNZB 4M1KA 5IT9U 1WAFA 3PYGA 1SV5A 4ZS6A 4BREA 3BGRB 3IS9B 2AP1A 4KBOA 4XK8C 1YZ6A 4NE9C 4UY8T 3B54A 4ECUA 4LFBK 4FXWA 3HSDA 3ISND 1NO8A 2VJUA 3QAEA 1KCFA 2HNYB 2DNOA 4BRLA 1SB6A 4LRDA 2HHHJ 4LFCJ 2WTUA 1WSGA 3ZNUA 2W2OP 4FPAA 2B7CB 3JB9k 4JI8K 4MK7A 1KQKA 4DPUA 2P6SA 3OLBA 1UJ6A 2B5JB 2AWZA 2K2PA 5FPNA 3BPDA 3TJAA 3MMCA 3SQGB 2ZQBA 2V34A 1ZZFA 1P8ZA 2YNIB 4PY5A 2FHKA 5KT5A 2FVSA 4NA3A 2N7CA 5HRRA 1HNZF 3HYFA 2FVQA 2ACYA 2D1KA 1J2VA 4AQYJ 1WKJA 2UU9F 3O3FA 4PXBA 2HHPA 4Z94A 3A3OB 3IO1A 1TUVA 4AT1B 3VF2A 5J2QB 3OY9A 3NS6A 3DXMB 1KD1O 4LH4A 4RUHA 5GAEU 4W4MA 2EW9A 2UZAA 1UW9A 3HXMA 2ZVIA 2B6AB 1BIZA 2BABA 3FUYA 2OZSA 1Q8LA 3TA0A 1YJVA 1WC1A 2EFGA 4KTWA 3KUHA 3HVTB 2PDAA 4R25A 1CC7A 5JUMA 1YGYA 2EPIA 3CJRA 2I9SA 2YNHB 3L4QA 4CZGA 1U6BA 3TUJC 3VGTA 4LQ3A 4JBCA 2Q66A 3UKRA 3CJBA 1T11A 3TAGA 3U4LA 2O8DB 1B64A 2VASA 3LPTA 2C2KB 1WOOA 5AE3A 2P51A 4GVEA 2HBKA 3O6QA 2WCXA 2OPQB 3NS7B 4LRBA 3I96A 1A5XA 3HM8A 3M7VA 1VBXA 5BN8A 3SQ1A 3W9IA 3BO4A 2AF6A 1M90T 4J9OA 1LNQA 4RBUA 1RBRA 3RB3A 2PFUA 3SCLE 4FCYA 4BRHA 2IFXA 3MFIA 1XJWB 3SK3A 4MQ3A 1L3VA 5IXUA 3CJQA 2HHUA 3EZOA 2IVPA 3P6YC 4FPIA 2HHWA 2MY7A 4YHHF 4W90B 2IM0A 4ZLJA 1X4FA 4A8KA 2FJWA 2XYGB 5AZJB 1D9DA 2M52A 4B02A 4IYQA 1B0TA 3MEEA 4LVOP 2ZM6F 1N6QA 2JVRA 3CCEN 3V81A 4FPBA 1FVSA 2XSJB 3NCQA 1B9DA 1YJ9S 4JK9A 2X74A 1UPPA 2DHHA 3CCLS 3H2VE 3AJ1A 4ZHRB 4OYOA 6FD1A 1X9JA 2PO4A 1HHQA 4B3RJ 3HO1A 1S1TB 3BPSP 1SQKA 1TL4A 1N0UA 2V4QA 1KRPA 1HIYA 1ASUA 3K0JA 5CABA 2ZUGA 5EGYA 1MSWD 2B9XA 2LLZA 3ZX2A 2MLXA 1FRMA 3DXKB 2P9SA 3AGKA 4TQSA 1U4BA 1Y5IB 3LDSA 4LF4K 3UDCA 3QMQA 2EHGA 3IC1A 2OD6A 4EFHA 1S72S 1QQNA 3CPEA 2IYGA 1JLAB 3CCSS 3W3DA 5M2PA 4FK4A 3IP0A 2VQEJ 3V2UC 4FN5A 3CM6A 4DSKA 3WXLA 2CUYA 1VK3A 1M5KC 4M5DB 4C8YA 4DDFA 1WBBA 4DI6A 3MM7B 1ATRA 5D4OA 4DR2K 3AOBA 4DU4A 4KJIA 3OS0A 2HGNA 5LT5A 1DRZA 3WC2A 3D6MB 4A2AA 3PW7A 1RISA 4RLEA 2GELA 2YJFA 3PG9A 2HEKA 3QBCA 3CE8A 1C1BB 4YY3K 4ECZA 1A9NB 4DQPA 4QU7A 4ILGB 3DRYA 1W97L 3M8QB 1WSJA 3D0PA 5CAAA 4ICLB 2YKAA 3GPAA 2M5YA 4ZDNA 4FW1A 5HVFA 4BRKA 2CJAA 3V6DB 3V9XA 2PMWA 2Q6BA 2QE5A 4QWBA 2MQOA 2V8DA 3KDNA 1S1UB 3SCKE 1AT1B 4I9QA 5ETLA 3QGIA 2FVCA 2WONA 4LH5A 4EP4A 4FLTA 1BISA 4JI0K 1HNXJ 1MU2B 1CJUA 4BCAA 3AARA 2OP5A 4P75A 2PIIA 1IO2A 2YY3A 4X65F 2IYIA 1O1WA 3VPZA 1JLFA 3SQOP 4JRQA 2IM1A 3KLHA 1VRUB 5CCMA 1J5OA 1FRJA 2WBMA 1Q86T 3C66A 2WZ1A 4N47A 3OVNA 1B3TA 4NB4A 4XH4A 4EMDA 3E51A 4USIA 9ATCB 4B9TA 1NHKL 4B3TK 4DN9A 2HMIA 3VZHA 3FEYB 1Q78A 1RLCL 3KYLA 1N88A 3JQKA 4M5GA 4HHTA 5F8GA 3NWGA 3I8BA 5AQPA 1JK9B 3US5A 2MLYA 2BOAA 5A8WB 3SCXA 2GHWA 1Z4UA 4KRWA 2W9AA 1RT2A 4PQUB 5HANA 1ZOTA 2R7XA 4TYAA 1E6YA 3ZZRA 2LMIA 1GMUA 4C98A 1QDUB 1B99A 2E5IA 3CO9A 3GL1A 3ILJA 1S9GA 4HHJA 1XQIA 4ZVPB 3O2IA 1GMWD 3S6EA 1XNQJ 4FL9A 3VQ9A 4K0KF 5EHHA 2R7UA 3SPYA 4CGFA 3AO2A 5KFDA 4J9SA 5CYMA 2VG5A 3UE5A 1X5OA 3GIKA 4DUZK 2KJWA 2KRBA 1EP4A 4QU6A 1A6LA 3SUOA 1EKRA 2PEHA 2P9PB 3K59A 1SKRA 4WJBA 2X1FA 4GRSA 2LFVA 4N76A 2A2DA 1BC6A 2VFTA 2XYPB 1RACB 2G8VA 3C16A 2DVIA 2G0JA 3HSZA 2HRYA 4PG8A 2CQPA 3ICLA 4HTIA 3PV8A 4IOCL 5L9XA 4B3SJ 2QMWA 4RW9A 4OYAA 3L95X 4HDHA 3QEPA 3C15A 4IRDA 2O67A 4J9PA 4RNMA 3C2PA 4M5LA 2QT7A 2HBZB 3N6LA 1NK6A 4GKKK 4ZVEA 2EVZA 2V67A 1T9UA 3DLEB 1T9VA 4X62F 4DB3A 1XMBA 4LSLA 3ZZUA 2Z1JA 4USTA 2GQQA 4EYIB 1Q86O 2VPYB 3CCTA 4L73A 3WT0A 2GVDA 4FLXA 1VC5A 1UTAA 2FGOA 5A0YA 2OMLA 3MAQA 3VAJA 4C97A 1I6JA 3AVMA 4EHUA 3NEKA 3CJCA 3UR3C 2IVFB 1GQEA 1RAAB 2J7WA 4YDUA 2ZJQL 2G2YA 2IHR1 1FXRA 4KH1B 1NGJA 2BEFA 3AFGA 1Z26A 3EE8A 2IA0A 7FD1A 4DV0K 4NEYA 4Z4FA 3B6BA 2E9RX 3QAUA 3H3OB 2P8IA 4YB1P 2LKZA 3G6EN 1YJNS 5B8HA 4H5TA 2UXCF 2XMMA 2XHCA 3LDOA 4WFZA 3L7PA 3AH6A 5KFCA 2F9TA 1W2IA 2L9DA 3S1TA 2BGGA 4ANCA 2W6LA 4NYOA 5BPNA 3O1WA 4FP9A 3G25A 4ILLA 5E5NA 2WTFA 2QMXA 1B0PA 5U47A 2HBYB 1SH3A 1NJYA 3WHIA 1V5VA 4HVJA 5LMUK 2LXFA 3MM5B 3I31A 2P9IB 3ZLJA 5HN0A 3KLVA 3VF6A 3CC7N 4C48A 4FF4A 2Q1NA 3NG8A 3UVJA 1Q1KA 5CXTA 3EM1A 1SI9A 5JMNA 1MROA 3A5OC 2MSSA 3CJ4A 4KV8B 2XI2A 3T5LA 3RAXA 2QV6A 3F2KA 3MEDA 4KQZA 4DTUA 1FRKA 1ZM2A 2KU7A 4Q45A 1EHWA 3J7YP 4DR3J 5CH7B 1VSEA 4MIBA 3I6PA 3QBWA 3SBMA 2W25A 3RBZA 1I51B 2GWJA 3VGSA 2D3OR 1IUJA 1TAUA 1VBZA 1N54B 4LQ9A 4M3ZA 2DNZA 2XMWA 4JUZA 1UMJA 4MAKA 4JI3K 1UWBA 2RRBA 3M6GA 5EWFA 4XH5A 3ZYYX 3KJFB 3M32A 2FDNA 3PX0A 5B0GA 2V2ZA 3KUGA 2GMLA 4TU7A 5DJBA 4CF1A 1BUXA 5I4MA 1FKAF 1SJ1A 1ZH5A 1HRHA 4OI4A 2UXCK 4CNZA 2GO8A 4E1JA 3CNQP 3IG1A 5E26A 4CP5A 5AQKA 5A6WA 2EX3A