5K14A

Hiv-1 reverse transcriptase in complex with a 2,6-difluorophenyl dapy analog
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
543
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase(isolate HXB2)
publication title Novel (2,6-difluorophenyl)(2-(phenylamino)pyrimidin-4-yl)methanones with restricted conformation as potent non-nucleoside reverse transcriptase inhibitors against HIV-1.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
molecule tags Transferase/transferase inhibitor
total genus 156
structure length 536
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5k14A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5k14A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5k14A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5k14A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5k14A05
3L8BA 4R8UB 4J9NA 2XRIA 5I3UB 3SNNA 4O0JA 4O4RA 1T8EA 3KJVA 4E1MA 4QW9A 3CM6A 1QQCA 3OYEA 4AHRA 3JSMA 3U3GA 4FM2A 4M3UA 2IJFA 4DS5A 3OS1A 3FSIA 1HRHA 4NLPA 4CF8A 3SJJA 3KK2B 3L2VA 4IRCA 4Z4HA 1U47A 1HQEB 1U49A 1KVBA 1SKWA 3I0RA 5C24A 4LH5A 3QO9A 1SV5B 3DLKB 4PWDB 5HRNA 3AA4A 3FQKA 1BQNB 1BI4B 1IO2A 3CJ3A 4ECQA 1HQUB 3UR0A 2OPQB 1HNVB 3ZSZA 5KFRA 3DRRA 3I5CA 3GIIA 4G3IA 4K4XA 3D28A 2ZQBA 4NCGB 3HPGA 3NGIA 5F8GA 5D3GA 3ISNC 4CGHA 5F8NA 5F8MA 3ICLA 4MKAA 1ZBLA 3F9KA 4DFJA 1NK7A 3WNHA 4YR3A 4NLSA 2W9AA 4B9UA 5KFZA 1B9FA 2VA3A 4ELUA 3LZIA 2OZSA 4HTUA 1NOZA 3GYNA 4CJKA 3JYTA 4CJ4A 3H08A 3VQEA 5KFAA 4BDYA 3T5KA 2FBVA 4RW6B 1L3TA 1EKEA 1QTMA 5KFVA 1L3VA 2O5DA 4B3OA 4DU3A 1TK5A 3QZ8A 4DTRA 1KFDA 3D5MA 1RTHA 1N6QA 1S10A 2E9TA 3RAQA 3SUQA 3KKSA 3QERA 4NZ0A 1MU2B 1S1VB 5FDLA 5KFSA 4EO8A 1C0TA 4K4VA 2XI3A 1TK0A 5EWGA 4DSIA 4NLRA 2YKMA 2R2TA 3OLAA 1JXBA 4HUGA 1UOCA 3P1GA 4RZRA 1LW0A 1JLEB 4NYFA 4ID1A 4IFVB 1LAWA 1RDAA 2WOMB 1VSFA 1ZBUA 4EZ6A 1RBRA 2YV0X 3SUOA 4L8RB 4CFAA 4FJ5A 3H4BA 4O44A 1TVRB 3KLHB 1UA1A 1HARA 4URSA 2OPRA 3IS9A 4FJIA 2KW4A 4CJFA 4CHOA 1VRUA 2XGPA 3LP0A 4DL6A 4RW4A 3T19A 5KFIA 4DTMA 3H40A 1JLFB 2FLPA 3QIPA 1BISA 2FBTA 5HRPA 3KKRA 4DTOA 4B9VA 1ZYQA 4Y2AA 1TL1A 2BE2B 3NKYA 5FROA 4WYWA 3O3FA 4E7HA 3DRPB 1T03B 4F2RA 4PQUB 3K59A 2ZE2A 4ED0A 4DF4A 1KLMB 1SUQA 4RW8B 3M8PA 3TAQA 1QE1A 5J2PA 3B6OA 4O4GA 3OVNA 1RA6A 1D8YA 3NCIA 1U09A 4F4WA 4NLTA 4HCCA 5KT6A 4TYBA 1WSHA 1N48A 1ASVA 5KI6A 3SQ4A 4BE0A 3NAHA 4LSNA 2JLEA 4EZ9A 1S9EA 4FBUA 5T7BA 4QAGA 4MK9A 4KKOA 2IOCA 1TP7A 4DU4A 2E6MA 2XY8A 4KFBB 4J9QA 4OJRA 4BWJA 4OKEA 1BQMA 1HPZB 3V9WA 5K14B 3CDUA 2HNDB 3PZPA 3PX0A 1NK6A 1S0OA 2IJNA 3MEDB 1RILA 4J9SA 1J5OA 1S6QB 3NFAA 2UVWA 3AVJA 1FK9A 2IBKA 4R5PB 2IS3A 4YP3A 4KHRA 3KHHA 2AWZA 2IM2A 3BQ0A 2W9CB 1JLBA 2HHTA 3PUFA 3AO3A 2HMIA 4C8OA 3AO1A 3CDWA 2VG5B 3DLEA 2ZD1B 4J2EA 4FJGA 4MFBA 1J9AA 4WFYA 3HPHA 4DL2A 1TK8A 2W9BA 3TAEA 4JV2A 2AGQA 4JV0A 2C28A 3CJ5A 4CEAA 4KRFA 3BR9A 3V9UA 3QZ7A 4FK0A 3ZSQA 1S4FA 4EBEA 3QGIA 4LD0A 2FVCA 1C0UB 1SH3A 3OL7A 4Y1CA 3OSPA 2IA6A 3K5NA 3M9NB 3ZCMA 2HHSA 4NLWA 3ITHA 2WK4A 4TQRA 5HROB 1JLAA 1JLQB 5L1JA 3KLEA 4IG3B 3MEEB 3L2QA 4O3RA 4R8UA 1NKBA 4CEFA 4F2SA 1C6VA 5I3UA 3Q8SB 4DG1B 4C8LA 1RA7A 4CEDA 4JRPA 4QOZB 1LW2B 2R8IA 3HO1A 4FZZA 4GC7A 3H98A 1VRTB 4J9MA 3VQCA 4WXWA 4HHTA 3KK2A 2P1JA 2D0CA 1VSEA 4YR2A 3RMBA 3FDSA 4YMEA 2QK9A 1I39A 1HQEA 4CHZA 1KVCA 3LAMA 1YTUA 4ZVEA 4PUOB 4E7JA 1SV5A 3DLKA 3GV5B 4PWDA 4H4OB 3CM5A 1BQNA 4EP4A 2I1RA 1BI4A 2R8GA 4KAIA 4BDPA 3DYAB 3KLGB 3KHGA 1HQUA 2OPQA 3DLRA 3MXJA 1HNVA 3LP1B 1RDRA 4DLEA 1RT3B 4IKFA 4NCGA 2VA2A 3C6TB 3AO4A 1ITGA 1K1SA 4KTWA 4LQ9A 3SI8A 1BGXT 4RNMA 4E7LA 3ASMA 2GUIA 1O1WA 1HMVB 2VWJA 4ECVA 3L2UA 2ILZA 2BANB 3RBDA 5KG1A 1KLNA 1BCMA 2BRLA 3K58A 3SQ2A 2IDOA 2WRMA 4Q44A 4FS2A 1S1UB 5C42B 1RYSA 4F4XA 4M45A 1JL2A 4RW6A 1S9GB 1SKRA 4KHWA 4FYDA 2G8FA 3OY9A 2Z1HA 1CLQA 4IG0B 1C1BB 1IM4A 1HYVA 3BQ1A 4DFKA 4KI6A 2D0BA 1ZTWA 4J9KA 4DU1A 4DEZA 5KT2A 4F8RA 1TL3B 5J2QB 2XI2A 4DSFA 2FLLA 2IM3A 4CFBA 1MU2A 1S1VA 1RT1B 4FLZA 3I0SB 2V4RA 3OYIA 3NAIA 4C8MA 4CGDA 3VQ8A 3P83D 4CF9A 3F73A 3S9HA 3DM2B 2IMWP 4NLUA 4EO6A 2XY7A 3MR5A 2HWIA 5KG2A 4E19A 2W8LA 5KT4A 3M9MB 1NNDA 4NLQA 1NKEA 1JLEA 4ECTA 1FKOA 3T5HA 5KRTA 1KSPA 4NLOA 4I2PB 4IFVA 5CYMB 2WOMA 1Y97A 3M8SA 3DDKA 4OL8A 5E41A 3V4IA 5JXSA 4FLWA 5KFJA 4IDKB 4JRQA 3OYDA 1JLGB 1TVRA 2UUTA 3KLHA 2HHQA 3NF8A 4OPJA 4FM0A 1JLFA 4ZVFA 3MF5A 1GOCA 3HM9A 3RMAA 3SUPA 4ZHRB 1CZBA 2BE2A 5HP1B 1RT2B 4BWMA 3GIMA 4FW2A 3DRPA 4CJEA 1T03A 5J2MA 3HK2A 2E9RX 5KGWA 2GIQA 4PQUA 4FLTA 4QPXA 3TABA 2YNHA 2DFHA 1KLMA 4TY8B 4RW8A 4IH7A 1SH2A 3G6XA 1HNIB 4DQSA 4DS4A 1RDCA 2V9WA 5F8LA 5JS1A 3RMCA 2FVSA 3SFUA 3OYLA 3SQ1A 2R8KA 3SV4A 3T5JA 4RU9A 1W9HA 4E3SA 1A5XA 5KG6A 4RNHA 2HNZB 1TKTB 3OSNA 1RDBA 4Z4CA 3GV8B 5HBMB 3CJ4A 4CIFA 1IKYB 2GBZA 4F50A 2Y1JA 1KCFA 4OLBA 3KLIB 4C8KA 2FBXA 3PW7A 3OHAA 1A5WA 4OKKA 4N76A 1GOBA 3UIQA 2D7SA 3LPTA 1EETB 2X74A 3O4QA 3NF6A 1G15A 4KFBA 2HAIA 5DG8A 3QYYA 3CVKA 1GX6A 4KBIA 5JS2A 1HPZA 3I8DA 3KD1E 1SKSA 2W8KA 5K14A 4NRTA 2HNDA 4Q5VA 1T05A 5KT5A 4NYZA 1WSIA 3SYZA 2G8IA 4R0EA 3MEDA 3V9SA 4KAZA 2KFZA 1S6QA 1RTJB 1B92A 1X1PA 2HHWA 1QHTA 4HYKA 2VG6B 4R5PA 5L9XA 2ATLA 3ZT4A 4Y3CA 3MEGB 2R8HA 1KRPA 4K8XA 1F21A 1IKXB 1Q9YA 2YNFB 2W9CA 2D3UA 4HVJA 1NK9A 4WFXA 3GIKA 5HRRA 4AH9A 4CERA 4FW1A 4Q45A 3OS0A 3HSTB 2VG5A 2WTFA 1JKHA 3L3UA 2ZD1A 3HVTB 4ED8A 3S3OA 4K4UA 1T94A 4JS5A 3NF9A 2ASLA 4W5NA 1N5YA 2QE5A 4J9OA 1NOYA 3SUNA 3HYFA 3MXIA 1D0EA 1REVB 2G8UA 4TQSA 3KLVA 3SI6A 1QS4A 1RTIB 1JLCB 4O0IA 3VQDA 3AA2A 2XC9A 4N5SA 1C0UA 4F3TA 4E7IA 3VQ5A 3CFRA 5KFDA 4O3PA 3DOLB 2RN2A 2B6AB 3B6PA 3SCXA 3NHGA 3PV8A 3RB4A 2JC0A 3KOAA 1D9FA 4G1QB 5HROA 4QW8A 3H4DA 1TKXB 1RYRA 1JLQA 4IG3A 4B8AB 3MEEA 4NCBA 4XPCA 1S48A 4EP5A 2BQRA 4DG1A 4HUEA 2IC3B 3M8QB 2BQ3A 3VQ9A 4WYLA 1LW2A 3K5OA 1IH7A 5L1IA 2OPPB 3ALYA 1VRTA 5KFOA 4CJTA 3PJXA 3DMJB 2I5JB 1VSMA 2AJQA 5KG5A 3D45A 4DSJA 1WSFA 3GQCA 3QGGA 3MR2A 1IKVA 4LY7A 4ED2A 4AHUA 3PR5B 5CYQB 2ZKUA 2W7PA 4IOBA 1RT7B 1HYSB 3WNEA 3LWLA 2FVPA 2E9ZA 3QNNA 2WHOA 3BSOA 1NJWA 4IBNA 5I42B 4PUOA 1BIUA 3AVMA 3PHEA 5KTQA 1T7PA 4ED6A 4H4OA 2FJVA 2KFNA 1KTQA 3DYAA 2KTQA 2ITGA 3BJYA 2HB5A 3TWHA 4K4YA 4TYAA 3EPIA 3PW4A 3QESA 3CQ8A 3K2PA 3NBPA 3LP1A 2HWHA 2Y1IA 1RT3A 5EUHA 3C6TA 4DWIA 1UWBB 4DMNA 3HJFA 1S1WB 3N6LA 4K4TA 4B9MA 5KG0A 2GIRA 3VQAA 2XGQA 4DTJA 2JC1A 4EEYA 2XCAA 4CGIA 4URGA 4M95A 3NL0A 1VSLA 4Z4FA 2HHUA 2BANA 1WAJA 3SPYA 5HLFB 4FJ9A 1S6PB 5KG3A 2YNGB 3RBEA 2QV6A 4Z0UA 1S1UA 4CEZA 5C42A 1TGOA 4E0DA 2E4LA 5KFMA 3KK3A 4K4WA 1RBTA 1S9GA 2ETJA 3RWUA 1D9DA 2JGUA 4IG0A 3THVA 1U48A 3VQSA 4FXDA 4MIAA 3MAQA 1QUVA 3Q8RB 3UQSA 2WONB 1QAJA 1TL3A 4CE9A 3OYHA 3PR4A 4ED3A 3ULDA 3T5LA 5FRMA 1RT1A 1VSIA 3I0SA 1LWFB 3BSNA 1DTTB 3DM2A 4Q43A 3LPUA 2F8TA 2IGIA 3MFHA 3RTVA 5KFCA 4KHYA 3NE6A 4IR9A 4KO0A 1BL3A 4I2PA 5CYMA 2B43A 3OYGA 3QEXA 2PY5A 3MR6A 4IDKA 3KMQA 2ATQA 3KK1B 1JLGA 3DOKB 4BE2A 2XY6A 4M3ZA 4DF8A 4CJPA 4FK4A 3K5MA 4I9LA 1NK5A 4GW6A 2HNYB 1S49A 3O3HA 2PYLA 1CXUA 5D3GB 1BHLA 4DTNA 3CWJA 4J9PA 3L2RA 4MK7A 3SPZA 4DSEA 2C2DA 1SL0A 4Z4IA 5DGAA 4XPEA 4ZP7A 4ZHRA 3D0PA 5HP1A 1RT2A 4OGCA 5FRNA 3AO2A 4BDZA 4CFDA 2X78A 4MIBA 1J53A 3QIDA 2FC0A 3NH2A 4O55A 4Q8FA 4M3RA 3KHLA 1WSJA 4TY8A 2IAJB 3JYTB 5KFPA 3KNAA 2Z1JA 3N6NA 4TN2A 5F8HA 1HNIA 2EHGA 1DLOB 3N6MA 5KGXA 3HP6A 2QKKA 5KRSA 3G6VA 5KFXA 5KFHA 3K5LA 3GILA 4RNOA 3DLGB 4CESA 3RAXA 3OJSA 2HNZA 2OZMA 1TKTA 3G10A 4ID5B 5HBMA 4FM1A 3H2LA 4WZQA 4ECXA 1NK0A 1IKYA 5KFLA 4CK3A 4UQGA 4KE5A 4QWDA 3KLIA 1EP4B 4IFYB 4F4YA 3HKWA 4X2BA 3OL9A 4EYHB 4HCBA 5EDWA 4LH4A 1EETA 1U04A 3RRHA 2OH2A 1X9SA 1NJZA 4MK8A 1VK0A 2GV9A 4CF0A 1LWEB 1FXXA 1QSLA 1XWLA 2YNIB 4TY9A 4Q0BB 1MMLA 1IKWB 5J1EB 3H5XA 1RTJA 2VWKA 2AX0A 4Z4EA 5KFQA 5DGBA 4Y34A 1S9FA 4JLHA 4CK1A 2VG6A 1LWCB 4O3NA 1ZBIA 4DTPA 3MEGA 4OPKA 5C5JA 4FJKA 2XO7A 1IKXA 4IQXA 2YNFA 1W25A 4NLGA 3E01B 3OYMA 2QKBA 3E51A 2Q3SA 3L3VA 4AHTA 3HVAA 1C0MA 1GX5A 2G8HA 4ZVHA 3HVTA 1WSEA 3AVBA 3VQQA 2ILYA 4CEBA 3ZT1A 2XY5A 4WFZA 4BE1A 1UA0A 3QLHB 4KHMA 1R0AB 1REVA 1JX4A 2F8SA 5DQGA 2G8VA 1RTIA 1JLCA 4IKAA 3LZJA 1SUQB 3EYZA 2F8EX 4IH5A 3VQ7A 1QE1B 3WNFA 4QWAA 3BQ2A 1Z26A 2R7YA 1WNSA 2RPIA 2RKIB 5CY4A 3DOLA 4ZPCA 4GC6A 2B6AA 1DTQB 3OYJA 3VA0A 2A1SA 3WNGA 3DRSB 4G1QA 4PY5A 4ED1A 1TKXA 4DTUA 3CFOA 2HW3A 5KFBA 3NF7A 3G6YA 2RDIA 3BDPA 4ECRA 4CHQA 2IC3A 2OPSB 2OPPA 5DMRA 3EPGA 1NJYA 4I2QB 3DMJA 3EZUA 3OYAA 2I5JA 5F9LA 3ZT2A 4ICLB 4TSXA 3OLBA 2OA8A 4CJUA 2YKNB 3AVCA 4FLVA 5CYQA 4DTXA 3CJ2A 1RT7A 1HYSA 3ZSXA 5L1LA 3I5AA 3NGZA 2RF2B 4K50A 5I42A 4WE1B 5DLFA 4AILC 4FZYA 1RT6B 3OYBA 3O3GA 2B5JB 2XWYA 4FJNA 4Y2CA 3MECB 1FK9B 4CHPA 3H5UA 1L3UA 2VG7B 3K57A 3M9OB 4N47A 1NK4A 4J2DA 3O4NA 4O5BA 4CJWA 3PJWA 3QINA 2HMIB 1UWBA 1ZETA 4QCLA 2DPIA 1S1WA 4H4MB 4E1NA 1TQLA 4J9LA 1KHWA 4KTZA 3V6DB 1EXQA 5KT3A 4MFBB 4B9NA 2JEJA 1JXLA 3PX4A 1RT4B 3FFIB 4ZP9A 3V6JA 3DLHA 4OKJA 4E89A 4ZTFA 4FJ7A 2AU0A 5HLFA 4KB7A 1S6PA 1TV6B 2WCXA 2YNGA 5DK5A 1SL1A 4TLRA 4BACA 4KPYA 2R2RA 2D41A 4CJQA 3GV7B 2C22A 3DI6B 4OLAA 4GMJB 5CZ2A 4RW9B 4CEOA 3QETA 1NHUA 4FK2A 3AA5X 4FLXA 4O3QA 2HHVA 2D5RA 2J6UA 3TANA 3ITHB 1K6YA 3V1QA 4DL4A 4ECSA 2WONA 3NMAA 3OYCA 1K1QA 3BSCA 3T3FA 4NCAA 4CJ5A 1FKPB 5J2NB 1S1TB 1LWFA 2KQ2A 3A2FA 2CKWA 4CJ3A 1DTTA 3OJUA 4HKQA 4KHNA 3KMSA 2AGOA 3QEVA 4N41A 2P51A 5CZ1A 1NHVA 5SZTA 3TAFA 1N56A 3LAKA 4KV8B 4CGFA 3SQ0A 1XR5A 2UUWA 2UVUA 3IGVA 4RG8A 2AQ4A 4N56A 1B9DA 3L2WA 4ZPDA 4LSLB 4OVLA 1BCOA 3KK1A 3DOKA 4RNFA 1KVAA 4CEQA 2EX3A 1T3NA 1RBVA 3ZSYA 2BQUA 2UVRA 5EWEA 3OS2A 3LP2B 3IG1B 2YHAA 2HNYA 2HHXA 1YTAA 3IRXB 3FRZA 5DG7A 3AVFA 3QEPA 1VSDA 4B9TA 1CXQA 5F9NA 3ZSOA 3CFPA 3HPOA 4KI4A 4CGJA 3TARA 4H8KA 4KSEB 3BGRB 4HUFA 3KLFB 1X9MA 3QEIA 1RTDB 2IM1A 3TVKA 4IRDA 5KFNA 3NDKA 1CZ9A 2DTUA 2IAJA 3QNOA 4ELVA 1DLOA 1ASWA 4ZMMA 3OL8A 4CF1A 3CO9A 1ZBHA 4CFCA 3ZSVA 4JV1A 1TAQA 1X9WA 1WSGA 3RB6A 3HP9A 2C2EA 3DLGA 4RW7B 5EU7A 3RR8A 1RBSA 2RDJA 1L5UA 4KHQA 4ID5A 2FBYA 4M3TA 4I7FB 2Z1IA 1N4LA 5KFFA 2XHBA 4RUAA 1QSYA 3RB0A 1NKCA 5KG7A 1XI1A 1EP4A 1A5VA 4IFYA 4EBDA 3NH0A 4F4KA 4KB0A 4M3XA 4M3WA 3KIOA 4KB1A 4QWCA 3Q8PB 4DSLA 3LP3A 4Q8EA 5HRSA 1TKZB 5C25B 3NAEA 1C1CB 5KG4A 2KZMA 1LWEA 3MTKA 4W5QA 3QEWA 2AGPA 1FKOB 4W5RA 4K8ZA 2HVHA 4NLXA 3OHBA 3CIZA 3KLGA 3IGNA 1XHZA 1QSSA 2YNIA 4Q0BA 3LWMA 3V4IB 3VQ4A 3SV3A 3V9XA 1IKWA 3C6UB 4AHVA 5J1EA 4FLUA 2R2UA 3PW5A 3ZSRA 3SFGA 4CECA 1S1XB 1LWCA 3MR3A 3MXMA 1VSKA 4CIGA 1U4BA 4W5TA 3CYMA 5KFUA 1RT5B 3E01A 2JEFA 3LALA 2FJXA 4FZXC 4URQU 1HMVA 3ZT3A 3EZ5A 4DLGA 1L3SA 3RR7A 1Q8IA 3AVKA 3TAGA 3G86A 1CSJA 2ALZA 5DQIA 1Z4UA 2V4QA 2Z1GA 5JUMA 3QLHA 4FCYA 2J6SA 5J2MB 2BR0A 1W0HA 4DTSA 1R0AA 4K4ZA 4EBCA 3V81B 4AHSA 2YNHB 4KREA 3SZ2A 2DFFA 4J9RA 1VSHA 1C1BA 3PO4A 4M41A 3TAPA 3V1OA 3PX6A 2FVRA 3HHKA 2LSNA 1TAUA 2RKIA 4QWBA 3TAMB 5J2QA 4RUCA 4FJHA 2YHBA 3U6FA 3G0ZA 4Y1DA 1DTQA 3PW2A 4XO0A 3DRSA 3KJVB 4M42A 4DSKA 3BREA 4FS1A 3JSMB 3ZSWA 4FLYA 3S3NA 2OPSA 1ZBFA 4FJJA 5F8IA 4IRKA 4I2QA 1GOAA 3VQBA 2G8KA 4O3OA 1OS5A 4ICLA 4U6PA 4DFPA 2YKNA 3OYKA 3HXMA 3IAYA 3I0RB 5C24B 3PVXA 3ZT0A 3TI0A 2P5OA 4ZP6A 1JXEA 1UAXA 3QO9B 4CK2A 2PZSA 3H5YA 4ZPAA 4FVMA 1C2PA 2RF2A 2A1RA 2BRKA 3C95A 2JEGA 1T05B 1D1UA 1SL2A 4WE1A 4YNQA 3UDLA 4O3SA 2D3ZA 1RT6A 3DRRB 3AVIA 4EYIB 4F3OA 2B5JA 3S3MA 4MKBA 4ECZA 3V9ZA 4CJLA 3MECA 2KZZA 2DY4A 2V0NA 3OYNA 2VG7A 2X6SA 4CF2A 3H59A 3AV9A 4XIUA 4FJLA 1JL1A 5KT7A 3PW0A 4H4MA 1JKHB 3C94A 4CCHA 3NGYA 3V6DA 4CGGA 4M3YA 1S0NA 1RT4A 1N5YB 3FFIA 3CDEA 1WLJA 3HL8A 4DL5A 4QWEA 2HVIA 4CJSA 4J2BA 1TV6A 4CEEA 5KFYA 4CIEA 1C1AA 1SH0A 3DI6A 4CHNA 3I5BA 4B3OB 1WAFA 4RW9A 1RTHB 5KFEA 1N6QB 3AVNA 3KTQA 3AO5A 4FJMA 4B9LA 5KFKA 1WN7A 1D5AA 5FDLB 1KFSA 4YFUA 4DFMA 3V1RA 1C0TB 3VQPA 4DQPA 2YKMB 1FKPA 1TKDA 5J2NA 2BDPA 1S1TA 4B08A 4H54A 4ZPBA 4YQWA 1RCHA 1RBUA 3RRGA 1LW0B 5SWMA 2W7OA 2NUBA 1IKVB 4MH8A 4B8CA 2FJWA 4FJXA 4ECWA 3QGHA 4ECYA 2R8JA 2DPJA 3AVLA 3NGDA 4CHYA 1XHXA 4I9QA 4KV8A 4RNNA 1YT3A 4YR0A 1ASUA 3VA3A 4O44B 1HJRA 4DQRA 3NH1A 3AVAA 2J6TA 1QAIA 5DG9A 4F4ZA 4KHSA 4LSLA 2OPRB 4JS4A 3IS9B 1EX4A 2B4JA 2ASJA 1VRUB 4WZMA 3LP0B 3KD5E 4J2AA 3RB3A 3BSAA 4RW4B 3FQLA 4B9SA 3IN5A 3NBPB 3QIPB 3LP2A 3AA3A 1I6JA 4PA1A 3IG1A 3IRXA 2OYQA 1RNHA 4W5OA 1TL1B 1RAJA 4ZTJA 1XR7A 1XC9A 1JIHA 2GC8A 3DLBA 4NLVA 2ZE2B 4NLDA 4LQ3A 4TXSA 3VN5A 4ELTA 2EC0A 4NRUA 3VQ6A 3LDSA 2G8WA 3BGRA 4Z4GA 3KLFA 4M94A 4U7CA 1RDDA 3M8PB 1S97A 1RTDA 5J2PB 2O4GA 4DQQA 3V6HA 4O4GB 2BGGA 2ASDA 2XCPA 3GIJA 4JUZA 3KK3B 1U45A 3TQ1A 3PY8A 2CJQA 3UPFA 2FLNA 4GVMA 2R2SA 1BIZA 5L1KA 2IM0A 4RW7A 3P5JA 3M8QA 4LSNB 4E7KA 3HVWA 4MQ3A 2C2RA 2PYJA 4I7FA 1I3AA 1S9EB 3CJ0A 1S0MA 2P5GA 4KKOB 2AX1A 3HVRA 1VSJA 5T14A 1BQMB 3U3YA 4IR1A 4ZP8A 3T1AA 1ZTTA 1TKZA 5C25A 1C1CA 1XR6A 3M8RA 3TR8A 1Z25A 3LANA 2DFEA 1LV5A 1J5OB 1IG9A 4KO0B 2WB4A 3HT3A 4DQIA 2FVQA 4ED7A 5DLGA 4IH6A 4DL3A 4KTQA 1NJXA 3C6UA 2W42A 1YVUA 4FJ8A 1JLBB 4NLYA 1NK8A 3KLEB 4AHCA 1S1XA 1LAVA 1HYZA 3DLEB 1YVFA 2O4IA 5KFWA 4DL7A 1RT5A 4NYNA 4OGEA 4ECUA 4CJVA 3EY1A 3H5SA 1S5JA 3QIOA 2W9BB 3RMDA 3AVGA 2X6NA 3PO5A 4WXOA 3AVHA 3OYFA 1Q9XA 1KHVA 1WNEA 3MFIA 2D0AA 3ISND 3Q8QB 4ZVGA 3V81A 5KFTA 4C8NA 1J54A 5DQHA 4CJRA 5EWFA 2JEIA 2UVVA 4K4SA 3OL6A 4KHUA 2F96A 3CG7A 2E6LA 4FBTA 3KHRA 1JLAB 3V6KA 3TAMA 5KFGA 5F8JA 2QXFA
chains in the Genus database with same CATH superfamily
2VQFJ 1FRKA 1W2BR 4WFNQ 1T44A 1KS2A 3SNNA 4O0JA 1K8KB 4O4RA 2V8HA 4E1MA 4DV5K 4QW9A 1WOPA 3I55S 2UUBJ 4M3UA 1PBAA 1YRXA 2J9CA 2E2QA 4LFAF 3E1YA 1HRHA 3GSDA 4BRHA 1GMUA 3RYLA 2V2KA 4RBUA 2ACYA 4A8MP 4Z4HA 4PWUA 2V4JB 1LXJA 3CCWA 1HQEB 1Q8KA 4OZ0A 5C24A 1S76D 3KG0A 2V7ZA 1M5PC 3AA4A 3NNAA 2GAGC 2FQQB 4M1KA 4O23A 2MZQA 3D28A 4NCGB 2OGUA 4RCHA 4YB7A 4DPOA 4I6WA 4CZHA 3F9KA 4DFJA 1NK7A 4IJNA 3MOJB 4YR3A 3PYEA 1SXLA 3KHYA 1O5JA 4NLSA 2CGKA 2F40A 2GO8A 2VA3A 2YI1A 2P9UB 3LZIA 1UFLA 4A8QA 3MDFA 4JP8A 4HTUA 1NOZA 3CDBA 3OBYA 5KFAA 1VFJA 3J81U 5DDPC 1EKEA 1YITN 5GAGP 2HF3A 3O9SA 1BA1A 1TK5A 3NCPA 2Z2LA 3SDEB 1VQ6N 4KGXB 2EBEA 4CT9A 2E1AA 4LIRA 3UB5A 1QAYA 4NZ0A 1MU2B 1W7WA 2YWFA 1UTAA 1C0TA 4K4VA 1TK0A 5EWGA 4NLRA 2YKMA 3I56S 4RZRA 3OW2R 1WI6A 3IR7B 2HBYB 3D1HA 1J6ZA 1BWEA 4EZ6A 4QU7A 1NGFA 4RX6A 4O44A 1TVRB 5IXUA 3I6PA 1UA1A 1WELA 1HARA 2ZJPQ 4WF9L 3L7OA 2LVWA 3VERA 4MDBA 4UTGA 2CZVC 4EIAA 3BZCA 4B3RJ 3H40A 1BISA 2FBTA 5HRPA 4OZ5A 1U1QA 2FC8A 3FZBA 1HWUA 3NKYA 3U1LA 1QQNA 4WYWA 4A8XA 5M1PA 1P6TA 3GE1A 1T03B 1SZ2A 2VIHA 4OYOA 3VV2B 2JVRA 1EB0A 4H5RA 1SJQA 4ED0A 1IBLK 4UZCA 1SUQA 2XLIA 4CYUA 2KT3A 3TAQA 5HATA 1P27B 3MPWA 3QDKA 2VFSA 4RWXA 3M2VB 2DO4A 3H25A 4DV6K 4DPXA 4F4WA 2MHNA 4NLTA 3CTRA 3MDQA 2O8DB 5KT6A 4WCEQ 2M9KA 3D1OA 2MKSA 2MQQA 3PTWA 4MO5A 2RQ4A 5D78A 2UUCJ 2JLEA 5E33A 4EZ9A 3KNGA 4MK9A 2IOCA 4DU4A 2E6MA 1Z1ZA 1S77D 1RWWB 3F0NA 4OJRA 4BWJA 1YRUA 2X1FA 5BRDA 4KHPJ 3V9WA 4NB4A 3D2FA 1YK9A 2EVZA 2D9PA 3ILIA 1SB6A 3MD3A 2DD8S 2W4CA 3R5JB 3TZWA 1S0OA 2IJNA 3O8WA 3DGPB 4KHPK 4J9SA 3UN3A 4G1PA 1T9YA 3NFAA 3CQYA 3HOTA 2UVWA 2G0CA 1FK9A 1H98A 3CCJN 2IS3A 4YP3A 2UUAJ 3H90A 2HFUA 1VIOA 1Q82T 4ZCKA 2HHTA 3ZETA 1HQ2A 2E1ZA 2VBWA 2HMIA 2CH5A 1HWJA 4O8UA 2O8BA 3L0QA 2ZD1B 3SJHA 4CIOA 3D2EB 3DU6A 1J9AA 3HPHA 1VGYA 5L9NA 3SCLE 3ZZTA 3G82A 5AJ3K 4JV2A 1XERA 4JV0A 2C28A 2QWPA 3QZ7A 4FK0A 4BLGA 1S4FA 4LD0A 3GOIA 2KT2A 1C0UB 2QRRA 4U8YA 1NBWA 3OL7A 4Y1CA 5ETLA 2IA6A 5LSOA 4A2BA 2DK2A 1I94K 4DR4J 2RQCA 1JLQB 5L1JA 1MN7A 4IG3B 3H1QA 4ED4A 1FFGB 1RA7A 4CEDA 4JRPA 4QOZB 4FZZA 4GC7A 4NXMF 1MWQA 3BF3A 3W62A 2NXUA 2Z2YB 2HLUA 2ZOMA 2D0CA 1VSEA 1VQ5S 1N32J 4YMEA 4GRSA 2DGUA 2QK9A 3ISZA 1U0HB 3I33A 1KVCA 2LQ9A 2YWHA 1YTUA 4OYXA 4PUOB 5JLFA 2DT9A 1VQ4N 3RRKA 2QEXS 3CM5A 1W2IA 1BQNA 4XAKA 2X3DA 4LF8K 3U1MA 3MXJA 3PIPQ 2W2PP 3DXMA 4DLEA 1RT3B 3C0BA 4IKFA 3AO4A 1I5OB 1U02A 4AQYF 3SI8A 1BGXT 1TMJA 5EXWA 4JYAF 4HTJA 1HMVB 1X4HA 3WXKA 4CLSA 2BANB 5KG1A 3AT1B 3MM9A 3SXLA 2DNGA 3SQ2A 4ZJLA 2NRTA 3VAFA 4GKKF 1S1UB 5IT0A 3VGSA 2FZGB 4GY2B 2JX2A 5D8HB 3MN5A 4NZ7A 4C1NI 1CLQA 4DFKA 2VWBA 1RHMB 3CCRN 4M63A 4J9KA 3U27A 4DU1A 1JCGA 1YJTA 3M8ZA 2XI2A 2QN6B 4DSFA 5M2RA 5C7PA 4FLZA 3OYIA 3NAIA 3F73A 1LK7A 1HNWJ 2E66A 2HWIA 2NPIA 4E19A 1HNXF 1NNDA 1FDNA 3B8HA 2H4WB 1KSPA 4ITSA 1RDWX 5CYMB 3EXCX 3M8SA 3DDKA 3BV8A 1KQFB 5JXSA 3UE5A 4IDKB 2CQPA 1FWLA 2LQ5A 4JRQA 3THXB 3OYDA 3H7HB 4C9DA 4OLOA 1RJJA 2HHQA 2CQHA 3QWPA 3KJQB 3NS7B 3MOZA 1D3WA 3IR5B 4LREA 2LA6A 2KN4A 3M2RA 1Q7YO 3G4SS 1OO0B 1Y5LB 1TL7A 5I4MA 3MF5A 2KG0A 5IQ6A 3RMAA 4CZFA 4ZHRB 1CZBA 3GFZA 1A7GE 2UXBK 3DRPA 2BKPA 1E6VA 4UF4A 4PQUA 4ISFA 4QIGA 4QPXA 3TABA 1KLMA 4IH7A 1Q16B 2GFFA 2HFNA 2NRVA 3V4MA 1O6XA 2HURA 4MYTA 3SV4A 4JV5J 2NRWA 1ZH5A 4JKFA 5DZ6A 2DGXA 1TKTB 1RDBA 4OI3A 2GTDA 2QTDA 3CJ4A 2Q3PA 3FEYB 4JI3K 4ZN3A 2Z57B 2GBZA 4F50A 3W3SA 1Y10A 2Y1JA 1JJ4A 4C8KA 2NYHA 1PO6A 4QIWD 2WZ1A 2XNQA 4OKKA 1HBNA 1CQMA 4IOAL 3UIQA 2C2OB 1Y5IB 3O4QA 4KFBA 3W8PA 2FGOA 2ZF5O 1GX6A 1U6BA 3I8DA 3KD1E 4B3MK 5K14A 4NRTA 2HNDA 3OT9A 4CD1A 4HLBA 3SYZA 3HX9A 3CJCA 3HDSA 4YOVA 1NJIO 2ASMA 3P49B 1VQKS 1PAUB 2HS3A 2OD4A 3MM6A 2HGLA 2KFZA 5K8MA 4DHYA 2H4YB 1VJQA 2P9KB 4A2AA 1HKAA 1QHTA 4BBYA 2YPZA 4Y3CA 2DO0A 3DHWC 2V7YA 1F21A 2YNFB 4DXLA 4HVJA 5G0RA 4WFXA 5HRRA 1KQKA 3SQOP 3HSTB 2RB7A 2XNRA 2O8CA 2JJ4D 4I64A 3I4PA 4ED8A 4K4UA 1Q7LB 1T94A 4NI2A 1U25A 4B17A 2QE5A 4J9OA 1M1KO 3SUNA 3HYFA 2NRHA 4HT5A 2NUHA 1D0EA 4EWTA 3L95X 2H9ZA 2KJWA 2ZZMA 3JSYA 2Y1RI 1RTIB 4O0IA 5D4NA 3VQDA 3DXKA 2ZITA 1XK8A 4WIIA 3D4JA 4E7IA 4CJ7A 1Q7YT 4JI6F 2OTJS 3SCXA 2QA4G 2R9LA 4MMOA 3PV8A 2JC0A 3OTBA 2IVNA 4QW8A 2VPZB 4BR0A 1X5TA 4NCBA 4CLLA 4XPCA 4DG1A 4WU2A 1V9OA 4WYLA 3R9PA 2AEJA 1IH7A 3B78A 3K17A 4CLPA 1YUWA 3AJ1A 5KFOA 3DMJB 3HZEA 3JTPA 1RE1B 1VSMA 5KG5A 3D45A 1WSFA 3MR2A 1IKVA 2O01C 4AHUA 3ZXWA 3PR5B 5CYQB 3JS9A 1NH8A 2V2VA 3A5LC 3R1LA 3LWLA 4EAHD 1RHJB 1QVFR 3M7VA 3HD1A 1U1RA 2N3OA 1BIUA 3AVMA 4DUZJ 3QSIA 3PHEA 2R7OA 2F7VA 3SIPB 4YY3F 5LY3A 3P4IA 3BJYA 2HB5A 3TWHA 2DIUA 3EPIA 2QWRA 2PSZA 3K2PA 2AZ1A 4A8OA 1TUGB 2DNKA 1EQ0A 3VOVA 1UWBB 5LXYA 3HJFA 1ZOTA 3N6LA 4B9MA 1HR0J 5KG0A 2GIRA 2XGQA 1YJNN 4DTJA 2F7TA 3KVGA 4CGIA 3PRBA 1RP5A 3GLJA 5B0FA 4GVLA 3GPAA 1NJIT 3SPYA 3ELHA 2RU3A 4DR1J 4LR7A 2ZJRL 3HHLD 1QHAA 3CC2N 1TFWA 4Z0UA 2CAJA 2VOOA 1BOTO 2HHPA 4E0DA 3GYXB 1GLLO 3LGHA 1BE4A 2JGUA 1AZSA 4JNEA 3VZHA 3QRPA 3R1HA 2QW9A 1QUVA 5IT9Y 4DV5F 3UQSA 2WONB 4CE9A 3G8QA 3PR4A 3ULDA 3C15B 1M1KT 1RT1A 1VSIA 4TU8A 2DNLA 4PABA 1WOSA 4A59A 4IFEA 4CH7A 3MWPA 2LXIA 4YDUC 2IGIA 3MFHA 4KHYA 1CLFA 2NXJA 5CHCB 1K9MT 3NE6A 1CG2A 5EGYA 1BL3A 4WP3A 1BXNA 3VEOA 3BP8A 2J9DA 1UL3A 3HHDA 5E7OB 2ADBA 2PY5A 1Q86T 2YX7A 2KH9A 3DOKB 2ALYB 4BE2A 2XY6A 2W6KA 3G87A 3ZEUB 4M3ZA 3T9ZA 3HHLC 3WXMB 1HBMA 1UETA 2QC3A 1NK5A 2Y8WA 2HNYB 3S6EA 2EFGA 5HSPA 1WI8A 5D3GB 2EG2A 4YHHJ 1NAQA 4J9PA 2JWLA 3ILOA 3L2RA 3SPZA 4DSEA 4CZJA 4Z4IA 1QQMA 3EGVA 3F41A 3MCAB 3HSGA 2MGZB 4BC5A 3CCZA 4F04B 3LQVA 4FO0A 2DNZA 3T69A 1J53A 5G4DA 1M5KC 2FC0A 2GGPA 2CG8A 4USJC 5RUBA 5GMDA 3KNAA 3DHXA 2ZZNA 5KGXA 2DR8A 3KKFA 4ILHA 3Q0AA 1M1HA 3E2EA 3G6VA 3K5LA 4B1XB 4RNOA 4CESA 3OJSA 3G10A 1FESA 3QFPA 3H2LA 5D0HA 4DN0A 1IKYA 3FBEA 5I3QA 4KE5A 2DH8A 2YJFA 4XH1A 3HKWA 4X2BA 3KG4A 2HFSA 1O8BA 3C46A 3RRHA 2CJYB 2GV9A 2KVIA 3BZQA 4CLUA 2KL8A 2EC2A 1QSLA 1XWLA 3OFEA 3K2YA 4ILJA 2FZKB 1NGHA 5AQVA 2GQQA 1IKWB 5J1EB 2ZM6K 1RTJA 1T6CA 4XTTA 4JLHA 4CNYA 2W4DA 1NSAA 1ZBIA 1TFYA 4OPKA 4FJKA 4OZJA 1IKXA 2XZTB 4PYAA 4ZPWR 3J7YI 2DYAA 3HVAA 1C0MA 1GX5A 2NLXA 2DJWA 1VQ8S 1MSWD 4ZVHA 1VQSA 3TNVA 3CETA 4Q2MA 5BYRA 4H0VB 4BRGA 3QNWB 2ILYA 1IBLF 4H0YB 4CEBA 3R5GA 4WFZA 4ZIVA 5AQTA 1HKBA 1H7XA 3FJ2A 1HBUA 1R0AB 2I38A 3FE1A 1JX4A 2F8SA 3UE2A 3JTNA 1N33F 2XLKA 4DV0K 3VTIA 4GNIA 4DV6F 3J7YP 1QE1B 3WNFA 3O2IA 4B3SJ 1I51B 2CQ1A 1OQ3A 1T11A 4DV3K 2RPIA 1WBDA 2RKIB 3QAUA 2B6AA 2NNWA 3J81Y 4A8FA 3VA0A 4DOZA 4G1QA 3LTOA 4ALZA 1TKXA 3OV7A 4DTUA 1IM6A 4FWQA 1OY6A 2RDIA 5HVFA 4JN4A 3G71S 2W24A 1HHTP 4JKEA 4CHQA 3HFVA 2QJ3A 2OPSB 1NJYA 4ATNA 4PXEA 4BVOA 1XNQJ 2HFOA 1VISA 1WACA 3TX0A 4ILRA 2DY9A 4DTXA 1RT7A 4AUKA 4YOUA 2LYVA 5L1LA 2GMLA 2BACA 2MQMA 1F3FA 1LNQA 4FJNA 3OTDA 4NYOA 3UN2A 2NLWA 4A8WA 1OH5A 4ZIWA 4K8RA 2RRBA 1H2UX 3BH6B 5AJ3F 2CG4A 2DPIA 5ETKA 1KHWA 4KTZA 3V6DB 2HS0A 4B9NA 1CJTA 4DR5J 2GELA 1NGIA 2PN6A 3PX4A 1V4SA 3FFIB 3DGVA 3VF0B 4OKJA 3DRYA 3AA9A 3M6UA 2FPHX 5DK5A 2GHWA 3GONA 2MLYA 3OTOJ 3TUIC 3UD5A 1M1GA 2CJAA 5U47A 2NPFA 1I94F 3WQUA 4BRKA 3MX2A 4X65J 4NX9A 3ITHB 2QLJB 2VPXB 4PPZA 4M7XA 5E3QA 3DXSX 1QY7A 2A3JA 1IWAA 2CGLA 1K1QA 4I68A 5J2NB 3OFGA 1XQSC 1S1TB 2HMPA 1FJGK 5DM7L 1ULRA 3A2FA 2IIHA 2NZ4A 1VQON 1LKZA 1KEKA 3OJUA 4JHDA 4KHNA 2O8FA 3KMSA 2OSQA 4N41A 5CZ1A 1VLYA 3OXLA 3TAFA 3LAKA 4NASA 3M6GA 1CULA 2NSBA 4LF8F 3IGVA 1CJUA 4RG8A 2AQ4A 1NUEA 3VESA 8RUCA 2KJVA 4N7TA 5EHHA 3FSYA 3TO8A 4YUDA 4AFFA 3N4WA 3HSCA 4EMDA 5EWEA 4X62K 2BVZA 3TEGA 3QEPA 4LRCA 4AE5A 1CXQA 5F9NA 3FUYA 1YHQS 1ZAWA 4H8KA 2K3KA 2DNRA 4FWNA 1RTDB 3CCES 2IM1A 3RUBL 2GZOA 2E1PA 1CZ9A 3E9PA 2DTUA 3Q23A 2VC0A 4BVPA 4ELVA 3MAAB 3CMEN 1ASWA 4ZMMA 2I6WA 1ZBHA 3EO3A 1KOOA 3DWLA 1NDKA 1IUJA 1Y7PA 3MWBA 4HVZA 3LM2A 1JXVA 4JAXA 2C2EA 3ZX3A 4WYBA 2RDJA 2HQGA 2FBYA 4M3TA 2ZJQL 4GO7X 1N4LA 1N34K 5KFFA 2UU9J 3GCXP 4RUAA 1NKCA 3QICA 5AQLA 4KB0A 3HZ6A 4M3XA 1BWVA 3Q83A 1TKZB 1GLJO 5C25B 4M5IA 3GDQA 2M2BA 5KG4A 4W5QA 2W40A 2ZDPA 4K8ZA 2HVHA 2AYBA 4JI0K 2XHWA 4Q0BA 3V9XA 1LFWA 2E5LK 3FC9A 5AE1A 3PW5A 1ZBSA 4H5NA 3VETA 1LWCA 3T41A 1U4BA 1ATNA 2B8PA 3E01A 3LALA 4QIFA 2FSKA 3Q2TC 1HMVA 4ENOA 2UXBF 2CWXA 4QYZJ 5BR8K 3RR7A 5JVHQ 4QYRA 1MNEA 4ZVRB 3H3OB 5T41A 2CIMA 4RJVA 3Q8UA 2RNEA 4IWVA 1NEEA 2BR0A 2MZJA 2IYGA 3EGNA 3H6EA 3WC2A 2CWKA 4PXDA 1CVJA 4AHSA 4KREA 2DFFA 3PO4A 1DBDA 3TAPA 3V1OA 1X7VA 2ZOGA 3D6TB 2WSFC 2LSNA 4CI6A 4QBUA 2ZH1A 2QWNA 4LFCK 2B9EA 4FJHA 3CNQP 4Y1DA 4JI3F 1LFPA 3QFWA 3EUNA 5C15A 4X4OA 3VWSA 3J7A1 4AF1A 1YDLA 1XMBA 2XB2D 2P8IA 1VHFA 2CPDA 4OHXA 5HJYA 4IRKA 4WIQA 3HD2A 4ICLA 5FIIA 4U6PA 4DV7J 4B3MF 3EVOA 2YKNA 2K3IA 3HXMA 1PYOB 5JLHA 3LPYA 3PVXA 2P5OA 3QO9B 2LQ8A 2OLWA 2FHJA 5JVGL 1U26A 5CR4A 2BRKA 2JEGA 1D1UA 1CJKA 4WE1A 1O0PA 4H4KA 2IY5B 2ZH6A 4CI0B 3ULEB 5H1SV 2B9WA 3DRRB 2YJEA 2B5JA 4ECZA 3V9ZA 1U6FA 1GLFO 1G4CA 4U67L 1ZXOA 4OX6A 1X9JA 2V50A 2VG7A 5LMNJ 3GWCA 3O9RA 1QVGM 3AV9A 2CZ4A 5M2PA 1IVZA 1OH8A 4CCHA 3C94A 3JAMU 4P6QA 2KHCA 2ZNZA 4M3YA 1S0NA 3OQ2A 1RWVB 2PA8D 4QWEA 3OVBA 2DHXA 2OTLS 2J0WA 3VF2A 2LP4A 4CEEA 5KFYA 4CIEA 1C1AA 2I7PA 1FERA 3TRGA 2WUSA 2R3VA 4RW9A 1CC8A 1V5VA 3GFYA 3A8KA 2WVFA 3IWXA 1TYQA 3R6GB 4B9LA 1TL5A 3IAM9 1D5AA 2AKWB 5FDLB 2VHGA 4DFMA 2PMWA 4DQPA 2KRRA 3M32B 5IT9O 5HANA 2BDPA 3MCNA 1VQ4S 2VPWB 1RCHA 1RBUA 2W7OA 3MPDA 4ZJQA 5CZVA 4B8CA 2FJWA 4FJXA 1RBLA 3NG8A 3NGDA 1M0SA 1XHXA 2OO4A 3BO4A 2VD3A 1HJRA 2MLXA 2D1KA 4BC7A 4GMKA 2D9OA 4LSLA 1WF1A 3R1XA 4AT1B 1EX4A 2ASJA 1VRUB 3LP0B 4J2AA 3BSAA 3FQLA 3X1LB 4BRLA 3R7BB 3LP2A 1GQEA 3AA3A 5FPMA 4KC5A 3D54A 2OYQA 1TL1B 2XLJA 4JI1J 4DPTA 2K06A 1XR7A 1BUXA 4V19S 3NS5A 3CCLS 4IZ9A 3GR0A 1AB8A 4JI5K 3P39A 2ZE2B 4NLDA 2NZCA 3KDOA 4ELTA 2EC0A 1HX1A 3CCRS 4NRUA 3BGRA 3KLFA 3GYGA 2O4GA 4DQQA 3V6HA 1MWYA 2F4VJ 2J7KA 4R25A 2XULA 5DZ7A 4Q2LA 5T7LB 3TQ1A 3PY8A 1XMOK 3UPFA 2FLNA 2F4VK 1KVJA 3M6VA 4GVMA 4Q7AA 2DNOA 4RL1A 4BRDA 4GVBA 4X4RA 1TU0B 4A5AA 3I9ZA 3NGKA 2CPHA 2PYJA 4I7FA 2YKAA 3M8YA 2P5GA 3CCSN 2AX1A 3D3BJ 2Y0BB 2MSTA 2DHGA 4M8LA 1YF5L 2MZRA 3U3YA 1ZTTA 3MGJA 4LF2A 3UNYA 4IOXA 2N7YA 2ZBCA 4C4WA 3M8RA 3VAIA 4CNZA 3LANA 3THWA 2HRYA 1IG9A 2EXUA 1NZ8A 1HBOB 5AR0A 2BJ1A 5DLGA 4KTQA 2GVZB 4DL3A 1KD1T 4OHWA 5K8PA 3M2UB 3RGIA 2JHEA 3MI7X 2VJUA 2UV8G 1VBZA 3ZTRA 1LAVA 3DLEB 1UVLA 3DLLL 4AL6A 3J7YU 4ECUA 3D6FB 1ITPA 3EY1A 5C2GA 2H54B 4UUWA 1S5JA 1TZ0A 3U4LA 4WFAL 3ENOA 3FBBA 4N8NA 3W7BA 3AVHA 3OYFA 1KHVA 3NXZA 2F1FA 3TSUA 2YQ0A 3MFIA 1HPMA 3VAMA 3WEEB 4XH5A 3UDCA 4CJRA 2AEMA 3GZ7A 2QA2A 2O8EA 3OL6A 2XMWA 3CG7A 3CJ7A 1H74A 3KHRA 1JLAB 3V6KA 3CCUN 2W2QP 4R8UB 3C15A 4J9NA 3CPEA 1T8EA 3KJVA 4CLFA 3CM6A 2NREA 3IA0A 1QQCA 4AHRA 3CCVS 3JSMA 3J81O 4DCJB 3FSIA 4CF8A 3SJJA 4X66J 4C7QA 2N7CA 3L2VA 4IRCA 2HQDA 2ABYA 4CD3A 2P9GA 4X66K 4RPFA 1SKWA 1CS4B 2LKZA 2NZTA 1SV5B 1C4AA 2BOAA 4OJGA 4PWDB 3BGFA 5HRNA 5ELZA 3MM5A 2ZM6F 4HI1A 1BI4B 3JXOA 2CADA 3CJ3A 3TOQA 2DR5A 2L41A 2PI5A 1R0BG 1HQUB 3I82A 3UR0A 2OPQB 2YXLA 3R5DA 5KFRA 2A1BA 3I5CA 2OAUA 2ZQBA 2D74B 1DEJA 2Q0UA 5D3GA 2XSFA 2KVQE 3IFEA 5F8MA 3ICLA 5I9EB 2B7CB 5B8HA 3WNHA 2FJDB 4OYAA 5K8OA 4M5LA 2Z56B 4OHYA 4B9UA 1B9FA 2KXHA 5E84A 3GR1A 4OJ3A 4JI2J 3HM8A 3TUJC 3PIOL 4DV0F 3S41A 3I9V9 4MYUA 4NXNJ 1T9XA 3AJ2A 5EN1A 4BDYA 4DV3F 2B0GA 4NMXA 3T5KA 4RW6B 3HHLB 2R7VA 4BR2A 3D0HE 3CD7A 2O5DA 1K8AO 2ZWHA 3P96A 3UW1A 3EZWA 4ZOSA 3A13A 1KFDA 3D5MA 1RTHA 2BM0A 4Z2XA 4L6V3 3H2UB 3RAQA 3PLAA 4FWLA 1S1VB 1QM9A 3NVKA 3T6JA 4EO8A 2FYXA 4ZK7M 4P2XA 4DSIA 4HACA 3OLAA 4HUGA 3P1GA 1WUUA 2BJEA 2K1RB 4C0BA 2UP1A 1LW0A 4NYFA 5BPMA 2DISA 4F9OA 3JB9k 1BU6O 2WOMB 1VSFA 1ZBUA 1SC3B 1RBRA 2YV0X 1Y5NB 4CFAA 1K44A 3KLHB 5ADXA 3I56N 4KQZA 2OHDA 2YQ3A 1CJVA 2XSJA 2FUG9 3O5BA 2OPRA 3IS9A 4FJIA 2KW4A 2CPXA 2Z30B 1KONA 2XGPA 4O8KA 2RS2A 4RW4A 4DTMA 2FSNA 3MZIA 3QIPA 2COLA 1S7HA 1RU1A 4B9VA 1ZYQA 4Y2AA 4LIWA 2BE2B 2AEFA 3O3FA 2F9WA 4JKGB 1ZBTA 2D3O1 2ZDOA 3UKUB 3K5PA 4DF4A 5IWAJ 4RW8B 1QE1A 5J2PA 4AL5A 3B6OA 3GCWP 4CM0A 3C16B 4O4GA 5AXKA 4FZVA 1D8YA 5EX0A 2NXCA 3SEOA 2P9SB 4GKJJ 4HCCA 2V2QA 3K7RA 1WBBA 5F3TA 2M8HA 3TU5A 3VZIA 1YBTA 1MWZA 1X3MA 3BKTA 1FJGF 1N48A 3G2XA 3IFRA 1ASVA 3NAHA 3EVWA 4C0OC 2MQ8A 2UXDK 1IJFB 1S9EA 5T7BA 4NEZA 3CJ8A 2HBKA 4KKOA 1VOMA 3CW2C 1XNRJ 2XY8A 2XYPB 4J9QA 5GAEI 1J5EK 2VDIA 2HRUA 2DPNA 1K8AT 3CDUA 1F2HA 3ZYYX 1J5OA 4K43A 1D9AA 1Z2LA 3SQGB 1YLXA 1S6QB 4IYQA 5AE2A 2A18A 3BH7B 4LF4K 4DV4J 3CJKB 5ETQA 2AWZA 1YXQA 3P5BP 4OI1A 2HRTA 5IT4A 4X62F 3BQ0A 4DV4K 2E7VA 1JLBA 2CNNB 5HJXA 1NWKA 4EFAC 1U2VA 2Q43A 3CDWA 1NNEA 2QA4S 4J2EA 4FJGA 3D7SB 4WFYA 4DL2A 3CUNA 1TK8A 2HF4A 1NG9A 5BXIA 3TAEA 3CO0P 4BY9C 3QT5A 1NXIA 2AD9A 3BR9A 1U1KA 3QGIA 5LMUK 1UPPA 4DJBA 1N5VA 2AJ1A 4ES2A 3F44A 1FEHA 3RU0A 3AFGA 2HHSA 3ITHA 2WK4A 4TQRA 5H1SQ 2OCEA 4MDAA 3KLEA 1N34F 5D4PA 3L2QA 4O3RA 1ZAXA 4F2SA 5I3UA 3M6WA 3Q8SB 2HWTA 5ITHA 1LW2B 2R8IA 1TMMA 3MPVA 3H98A 1VRTB 1NHKL 4UT4A 3TW0A 4RBTA 3KK2A 4LF9F 3KWIA 1U8SA 3O1BA 2JVOA 4CHZA 3DN9A 1R8CA 4JI0F 1AXQA 2IVFB 4ZVEA 1WUAA 3UD4P 2N4CA 3D6MB 3DLKA 2EEYA 3W64A 3GV5B 1E6YB 1EJ7L 2E5LF 5B08A 2I1RA 4G9ZA 4UW2A 4BDPA 2UXCJ 3KLGB 4DB3A 4J90A 1HNVA 2PBDA 1O13A 2DH9A 3LP1B 1RDRA 1FRMA 3D0IE 5A8WA 2QL5B 4UOGA 1ZPVA 3C6TB 3SCKE 4WP9A 1ITGA 1H72C 2DIVA 5BR8F 5AZJA 1K1SA 1BC6A 3HSDA 4KTWA 2MKHA 4E7LA 1Q8LA 3HF5A 3MMCB 4DR6K 2QL9B 2VWJA 4FL9A 1J2VA 3U7JA 2P9PA 2BW7A 4C11A 4OPAA 2OFHX 3RBDA 1N36K 3N9UC 1KLNA 1BCMA 2BRLA 2HIYA 2IDOA 4Q44A 5D0EA 3ZO7A 1QQOA 4LJMA 4F4XA 4USVA 4V1Ak 5H9EJ 1BDGA 3TJAA 2HOEA 4CZEA 4KHWA 3PNIA 4LFCF 2C42A 4OZNA 2BMBA 2KXFA 2DCUB 3BQ1A 1HYVA 4NLBA 2ZH5A 2JDJA 1G2EA 5KT2A 4OIXA 5D77A 4C3LA 1S7IA 1TL3B 2E29A 1EIYB 4FSVA 2IM3A 1NLKL 4CFBA 2CDQA 2JLGA 2D0OA 3I0SB 3AAQA 4C8MA 2HHHK 1YZ6A 2A40A 4RBVA 2ZOFA 3DM2B 1FXDA 3OHRA 3MR5A 5K9FA 1VIXA 2PFFB 2W8LA 4OLPA 4KH1B 3M9MB 5IC4B 2GWJA 4NLQA 1NKEA 1JLEA 1C4CA 5KRTA 2F5GA 4NLOA 4IFVA 3ILJA 3CJRA 4OL8A 2HZVA 1RUSA 5BPNA 2CJXB 2HEKA 3MMAA 2UUTA 1MMNA 3DXBA 2LDYA 4PL8A 3NP5A 3AQOA 3NF8A 4HTLA 1VBXA 4FM0A 2BEFA 1JLFA 3T1HK 4MIWA 5GAHI 1Q79A 4ZVFA 4WQ5C 4F67A 1GOCA 4C3KA 2QFIA 2F8HA 5HP1B 3MX5A 4QPTA 3F56A 2HSEB 4Y28C 3TTDA 3C2PA 3H45C 1RXOB 3AA8A 4TY8B 4ZVOB 3G4SN 4BQLA 4DR7J 2ROPA 2RUGA 4BR5A 1NO8A 4DQSA 1FJ7A 5J1PA 3FLCO 3DRXA 3IDHA 3W5XA 2PMZD 4BRPA 2XMKA 3RMCA 2IJRA 4OHZA 3OYLA 3T5JA 4RU9A 1VQOS 5KG6A 4HHUA 4RNHA 2HNZB 3OSNA 1RU2A 4Z4CA 4OZ1A 3VGLA 3A8JA 5F2RA 2ASYA 4ES1A 4WFNL 1SQKA 4P10A 4USHA 2B51A 1KCFA 4OLBA 3PW7A 3OHAA 4X4UA 3W2WB 4F25A 2A10A 5KQ8A 5GIOA 3AARA 3NF6A 2CQGA 2MZ1A 3EX7B 4AM7A 5JS2A 1HPZA 1NRKA 2CA9A 3MPYA 5LJ3Y 1WSIA 2G8IA 1RBOB 1MWMA 3MEDA 3V9SA 4ANCA 3IMQJ 2OMLA 3L4QA 2VG6B 1GNKA 4R5PA 4UOHA 5L9XA 2ATLA 2Z2ZA 3ZT4A 1KRPA 2R8HA 2D4WA 2W9CA 2D3UA 3WXJA 1NK9A 4AH9A 1ZAVA 3C65A 4CERA 4FW1A 1NZAA 3MEKA 2I8EA 3PSFA 1S3XA 2VG5A 2YWKA 2PEHA 3HVTB 1N5SA 4RO0A 3E9LA 1VQKN 2CNOB 4JI5F 3BN4A 1RHRB 3NF9A 2L48A 4W5NA 5BREA 4YB5A 3MUVP 1NOYA 3LOUA 3MXIA 2W41A 3VQTA 1REVB 4D3GA 4TQSA 3KLVA 1X31C 2JLFA 1QS4A 3ZX0A 4N5SA 1AT1B 3M5RA 1XMOF 4F3TA 2F4VF 2P9NB 1OMSA 4O3PA 1DZ5A 2O67A 2RN2A 3OR2A 3B6PA 1TUUA 2GVDA 1P8ZA 3RB4A 4BRIA 2QWLA 3J7AN 5HROA 1MROA 3H4DA 1HKGA 3C14B 3MEEA 4PQAA 3OA9A 2YHYA 3TWZA 1SJ4P 2L9WA 4P2SA 2IC3B 3NVMA 2G0JA 2BQ3A 3VQ9A 3FZ2A 3K5OA 3UVJB 5FPDA 3EE3A 3PJXA 2I5JB 2JL9A 3I87A 3CDAA 3G6ES 3GQCA 5H9FJ 2C2MB 2OTJN 3WT0A 2WFBA 5C2CA 2ZKUA 2W7PA 1VQLN 1Y4ZB 4ER8A 3WNEA 3TZXA 2FVPA 2WHOA 2KHDA 3QMLA 3GFXA 3SCIE 1UVJA 2I9SA 1T7PA 4ES3A 4H4OA 1X8DA 1KTQA 3DYAA 1ATSA 4KR0B 3N4QA 5AQMA 2CYYA 5B0GA 2ZJPL 1SS6A 1TTHB 1C0FA 1RAGB 1GXUA 3CCQS 1VQMS 5EUHA 4DWIA 3NGSA 3VHQA 1X4GA 4DMNA 1S1WB 4LRDA 1XMQK 3HSJA 5ETTA 4ILLA 5ADXH 4EEYA 1HL6A 3TSPA 1AFJA 4Z4FA 2EFPA 1WAJA 2WTUA 5AXLA 5KG3A 4CTAB 2WVEA 1U1LA 4ZS6A 2MQPA 2QZ8A 2F4FA 1QVGR 2XYHB 4CEZA 5C42A 2DITA 5KFMA 3BPDA 3O08A 3AD8C 4K4WA 4K59A 1S9GA 2ETJA 2GEMA 4QOTA 5DO2A 4S0MA 4IG0A 3THVA 1U48A 5GMKa 3KZBA 5B0EA 3MAQA 3Q8RB 2HGNA 2H65B 1N52B 4WCEL 4ED3A 2AW0A 1WEZA 2J9DE 3A5OC 1FF2A 2LECA 5FRMA 4PG5A 1HW8A 1LWFB 3DU5A 3DDIA 3BSNA 2NYIA 4QZVB 2CJ9A 2E1CA 2IVMA 1VI7A 4X66F 3D1QA 1XIQA 3THYA 2E1MC 3RTVA 3MAHA 3VGUA 3D9BA 4I2PA 2B43A 1KAXA 3QEXA 3GG4A 4DZ6A 4DR3J 2GVZA 1XC3A 3GP9A 2ATQA 1JLGA 3ZZPA 1FJEB 5HN0A 3EE8A 2MQOA 1B7YB 4DF8A 2G2YA 4I9LA 4HI2A 4MT1A 3W5ZA 4C98A 4HEA9 2CNKB 4F3QA 1BHLA 4QR0A 3CWJA 1FXRA 1RACB 3KWGA 2C2DA 1FHTA 2R42A 5DGAA 5ADZA 4XPEA 4ZP7A 4CO2A 3D0PA 1RT2A 4K0KK 4OGCA 5FRNA 4K5RA 4QR2A 3AO2A 4ANEA 4BDZA 1PJ6A 5JJBA 2DXEA 2XEXA 1PC4A 2GHPA 3DOMA 4M3RA 1KBRA 3JYTB 2QMWA 3N6NA 4J8FA 1HNIA 2EHGA 3J7AP 2EG1A 1DLOB 1H38A 3M1VB 4O0NA 1RWUA 5KFXA 3AXKA 4DZDA 4M5DA 1ZM2A 3DLGB 4FPIA 3VEWA 5HBMA 4B1WB 4X4QA 4UQGA 1APSA 4QWDA 3KLIA 3M30A 1EP4B 3CB4A 4F4YA 2LU2A 4HCBA 5EDWA 4LH4A 3L09A 4QIEA 1EETA 5GAEU 2OH2A 4V19J 1URNA 4MK8A 1NU4A 1LWEB 4BC3A 2FSJA 1KVKA 4MKVA 1FXXA 3AGRA 2KYZA 4XK8C 2DY1A 3W9IA 4L72B 2VWKA 4USTA 3I8BA 4Z4EA 2ACMA 3PM9A 4CK1A 5IV3A 2GCFA 3KDNA 2NXNA 3L9ZA 4DTPA 3MEGA 3OFHA 5IM0B 3PIPL 1UJ4A 1RADB 2QKBA 3E51A 1H0HB 4X64K 4UQTA 3IMXA 1P90A 2VYPA 4FF2A 3NGRA 3VGVA 4LFBK 1UVKA 3HMJG 4BE1A 1UA0A 3QLHB 4JKCA 4KHMA 5JMVA 2IVYA 4BR4A 1JLCA 4IKAA 2VBYA 3EYZA 2BW2A 2I2YA 1VQ8N 3VQ7A 2KFYA 2W2NP 3MK6A 5K20B 1OIAA 5BPLA 1IBMK 3A1YG 3DOLA 4LF5J 2YX4A 3BB5A 1DTQB 3CCSS 2P9IB 2A1SA 2HBZB 3DRSB 3ZZOA 4PY5A 4ED1A 2UXDF 2HW3A 2DXFA 4Z7YA 1F9EB 3BDPA 1LOUA 1WHYA 4ECRA 2OPPA 3EPGA 1J5EF 4PKIA 2EWSA 4RR5A 4C3MA 2WVBA 3ZT2A 4WK3A 2OA8A 2XWXA 1XJWB 1N88A 1D4XA 3AVCA 1RWNB 3CJ2A 2YQ1A 3SCJE 1VS3A 1HYSA 1NPRA 1GT8A 2ZVIA 3NGZA 4DR2J 2LXFA 3K89A 4A62A 2PFUA 1IBKK 3G71N 4LF4F 5I42A 1RHQB 1M90O 2D0PA 1A0OB 2B9YA 3ZTQA 1RT6B 4PXBA 3N0VA 4WFBQ 4DV4F 4NMLA 1U1NA 3O3GA 2C2KB 4AXJA 3MECB 2MQNA 1WSVA 2CPIA 4OI6A 5BR9A 2BX6A 5I3PA 1XEZA 4MTPA 2ZH9A 4YOXA 1NK4A 1FCAA 2FY1A 3PJWA 3QINA 1YI2S 3ENQA 4QCLA 4GO5X 4H4MB 2J9EA 4F4AA 2ERRA 1EXQA 4MFBB 2FHKA 1ZC6A 3PCOB 3V6JA 2JRSA 4E89A 4ZTFA 4FJ7A 1PYSB 5HLFA 5LMUF 4KB7A 1S6PA 1EHWA 2YNGA 3CCUS 1DQ9A 2GHVC 2WCXA 4BACA 2D41A 3GV7B 2C22A 3FEZA 4MLHA 1WKLA 4GMJB 1Y9OA 4PKGA 1V3ZA 5CZ2A 2OIHA 4CEOA 1NHUA 5AXNA 3QETA 1EKSA 2C3YA 4QU6A 2HHVA 2HBRB 4DUYK 4PKHA 1S22A 3TANA 4H5VA 4DCHA 3NMAA 3OYCA 1U7LA 3QJJA 3T3FA 1VMBA 1JB0C 4NCAA 1HD1A 1FKPB 1WEXA 2HK2A 2KQ2A 2QMUB 2VQFK 4AL7A 3W8GA 2V9KA 2CKWA 1DTTA 1VRQC 4HKQA 3C7NB 2ZH8A 2EBGA 2EFVA 4OX8A 3ENWA 4CWBA 2UUBK 2AA4A 4JKDA 1N56A 4L74A 4KV8B 3T1YJ 1IQZA 1FKAF 2JWNA 5LL6d 2V5HG 4FPRA 3T1YK 3L2WA 4LF1A 4DX7A 4FF1A 3KK1A 2EX3A 3B4MA 1RBVA 1YJUA 1VC6A 2UVRA 2Q36A 3OS2A 5LXRA 5D0GA 4DR6F 5DG7A 1YTAA 3AVFA 2QLFB 4P52A 1PIEA 3QSYB 4M5KA 4UOFA 1N36F 1IG8A 3ZSOA 4W98A 4KI4A 3LM9A 4CGJA 1W2BM 2H51B 1BUPA 1M90T 4HDHA 1VBYA 4U7UK 3QQCD 4H5TA 4BR9A 3TVKA 5KFNA 3PYFA 3NDKA 2WBNA 2V68A 4JD2B 2IAJA 3EE9A 2Y9HA 3L4IA 1SI9A 2Q6CA 1FNMA 5LJVA 1F0XA 3OL8A 3CO9A 1YHQN 5CQGA 3SSSA 5AFUA 4B1YB 3ZSVA 3OFFA 4YB6A 3CCMN 1TAQA 1WSGA 2WBRA 3RB6A 3RSEB 3O1LA 3CERA 3CCEN 4JI4J 1L5UA 4ID5A 2HHHF 4R79A 3CXCM 2LEAA 2VFTA 3K8VA 1PC5A 3WX4A 3MMBB 1QAXA 3TZZA 1XI1A 4OMFG 1A5VA 4IFYA 3VGMA 1U1OA 1RK8A 4F4KA 3LDOA 3NH0A 1Q82O 4JI7J 4M3WA 3KIOA 4QWCA 3SSRA 3LP3A 1J27A 3FSXA 2ZHAA 1LOTB 1C1CB 2HFZA 1K0VA 3QFUA 2DH7A 3M3ZA 2BKOA 5CHIA 2OKQA 4XDCA 1FNXH 3CIZA 3KLGA 3M8WA 3OR1B 3BPSP 2DHSA 2YNIA 3LWMA 3V4IB 3P4UB 1SKUB 2VJVA 3VF4A 4AHVA 1H73A 3FKBA 3TZYA 2W25A 3SFGA 3WZ0A 3FK4A 2R7XA 1S1XB 1NMNA 3MXMA 4CIGA 3T1HF 3PEJA 5HMZA 3M05A 4W5TA 3AOBA 1RT5B 2JEFA 4G6VB 4FZXC 1WTFA 4URQU 4PEOA 3ZT3A 2E2OA 3CSKA 4BC4A 2GMHA 2E44A 1L3SA 1JCEA 3TAGA 1CSJA 4B3RK 3AOAA 2J5AA 3RBZA 2HBQB 4FCYA 2J6SA 5J2MB 1RI7A 1HI1A 2B8QA 2RVJA 4DX8H 3V81B 1WC6A 4GVEA 2PAVA 2PEBA 2VASA 1VSHA 4M41A 4MLEA 3PX6A 4JOUA 2FVRA 3HHKA 4U9RA 1RLCL 3U6FA 4KJIA 1HLWA 4XO0A 4DSKA 3BREA 4FS1A 2DRAA 2RAQA 1W26A 4CLKA 4KPCA 2QYCA 4I2QA 4CQ1A 4O3OA 1VC5A 4OX9J 1NDCA 2UUCK 4BRCA 2FC9A 5C24B 3TI0A 1JXEA 5CD4A 3D6HB 3GBTA 2PZSA 4GV6A 1YBUA 4Y2IA 1GMWD 2C3UA 3A5MC 4Z37A 1C2PA 2RF2A 3ULHA 2A1RA 3LW5C 4TLQA 5BYQA 3C95A 4RTFD 1SL2A 9RUBA 2C3PA 2D3ZA 3V2UC 3AVIA 3CMQA 4EYIB 2WC9A 4EGLA 2MSSA 4BR7A 3A8YA 3S8SA 5A0YA 4IOCQ 1FRXA 1WDDA 3MCOA 2PT0A 2IVPA 5IOLA 4OO1J 3H59A 2UUAK 4XIUA 1JKHB 5M1NA 1S57A 2OSRA 3BM7A 2DGOA 1GMVA 3WQPA 2EKYA 1RT4A 1N5YB 2B4PA 1KC8T 3P5TL 4I6MA 4CZGA 4EHUA 2DGWA 1TV6A 2P5VA 4J2BA 1UCNA 1SH0A 5AQOA 3C6HA 3DI6A 3BKFA 4CHNA 3I5BA 4RLEA 2B9XA 1WAFA 2VQEJ 3O80A 3AVNA 2JZ5A 2QIFA 1VR6A 2VFVA 1WN7A 1HNZF 2VQEK 1KFSA 2OTLN 2H5EA 4F0MA 1C0TB 4LFAJ 1IR2A 3PSIA 1R7IA 3MN9A 2YKMB 4DR4K 2E20A 4C48A 3AAWB 4P7VA 1UMJA 4H54A 4YQWA 3OTCA 3RRGA 1MW7A 4TVAB 6AT1B 4MH8A 1RSCA 3SLCA 1GXTA 2C2NA 3AVLA 2MZTA 5CZXA 3S7RA 4O44B 3W2VA 2XS7A 3NH1A 1N32K 4H03B 2F65A 3ID6A 1QAIA 4E98A 4B3TF 2B4JA 3KD5E 1HD0A 3O4WA 3I4HX 2L9NA 1XMQF 4PWWA 3IG1A 3MM8A 5M1OA 3IRXA 1YIJN 4W5OA 4DCPB 1Q78A 3QT7A 4ZTJA 2MY7A 2IBOA 3HFZB 1GLDG 2RRNA 5IC6B 1Q8BA 4NLVA 3MWTA 2HLTA 4LQ3A 2CRLA 3V5RA 3VQ6A 2G8WA 4M94A 1H7WA 4GV9A 4CYUB 2EK6A 3CD6S 5A8KA 4U7BA 2XCPA 4A47A 1K73O 4JUZA 1X4CA 5EVZA 1EQYA 3CCLN 3WUHA 2XQCA 3C14A 2R2SA 3OVAA 5EOYA 2H5IB 4RW7A 1YKWA 1N5TA 1RAIB 4JBCA 3HVWA 4MQ3A 2IFXA 1BA0A 3CC7S 2CQBA 5IZHA 3D0GE 1RHUB 3CQXA 4IR1A 3T1AA 3FCHA 3D2FB 1HNWK 3TR8A 4C6AA 2W4PA 1LV5A 1AUSL 5DRKA 2NRRA 4NA1A 2FVQA 4IH6A 2CJKA 2E8AA 3WIVA 3C6UA 2CPFA 1YVUA 3LH2S 4ID8A 3ZZ0A 3ZETB 3R27A 4NL5A 2E5GA 3LO3A 2O8BB 1GEHA 3IAS9 1YVFA 4DL7A 2A2DA 4CJVA 3O9UA 2D69A 4K0KF 3H5SA 3RMDA 1NDLA 4KY3A 2BV3A 1P1LA 3G82B 3ET6A 1UZHA 3N5BA 2X6NA 3PO5A 4FWRA 3HHEA 2R7QA 4FNIA 1XN9A 3R97A 2DNQA 1VAZA 1YSJA 3A8EA 3CIPA 1PILA 1VK8A 3WX8A 1WG4A 1KAYA 1J54A 5CE3A 4AYBD 4EK2A 3B82A 2EFOA 2JEIA 5AQRA 4HH1A 3L4BC 3TAMA 5F8JA 1JCFA 5KOXA 3RAMA 3L8BA 2CJBA 4JI8F 3WXIA 2XRIA 3EKSA 3LGMA 2P9LA 4JV5K 3OYEA 2KDOA 4YOYA 3U3GA 4HDGA 4FM2A 2IJFA 2KRBA 3OS1A 4NLPA 1BO5O 4RUBA 3U02A 1REGX 3GMGA 4KGZB 1U47A 3QT6A 1U49A 1K73T 1YBAA 4QIVA 3I0RA 4C97A 4LH5A 2RE1A 3DJCA 3CCVN 1BQNB 3QBXA 1IO2A 4ECQA 1URRA 3VGTA 1CQNA 4P9SA 3DXMB 3GIIA 4G3IA 4K4XA 2KB2A 4X64F 5F8GA 4F0HA 1N8RO 4MKAA 2ROGA 4LFBF 3WBZA 5M1QA 5D15A 2W9AA 3L7UA 5KFZA 4OI2A 3W61A 4ZKAA 3MM9B 4ELUA 2OUGA 3MCPA 5AQUA 4IEEA 2OZSA 3IBCB 2PDAA 1HHQA 3R5CA 4CJKA 3JYTA 3H08A 2CNLB 3IXQA 1FWPA 2QLXA 2FBVA 1FT8A 3M1VA 1IBMF 2CGJA 4K5SA 2YH0A 5KFVA 1FEEA 2RE2A 4B3OA 5AQPA 4B9QA 1N6QA 3VEXA 2E9TA 1K9MO 3SUQA 1NGEA 1U24A 4NXMJ 2AT1B 4H4KC 2OEJA 5KFSA 1WJ9A 1VQLS 1T6DA 4IQMA 5M1KA 1N0VC 1Q86O 3SK3A 3UKRA 1NM1A 1HFEL 3PJ9A 1UOCA 4LRBA 4QS8A 5AFUH 4DQ8A 1ZM4A 4CLWA 4BRAA 5A8RA 1IBKF 3K9KA 4ID1A 1LAWA 1RDAA 1PGZA 4YEAA 1R8BA 1UKUA 3SUOA 1EAYC 4L8RB 2V34A 1ZPWX 2BE9B 3H4BA 4DBQA 3MM7A 1WC1A 4URSA 2MLZA 4ILGB 1UEUA 3FEXB 2IRYA 5GVQA 5IM0A 4CJFA 4CHOA 3US5A 4DUZK 4DPWA 2BJDA 3TX8A 4AQYJ 1WF0A 3M2RB 5KFIA 4JYAJ 1MLAA 4WTOB 2FLPA 1X3NA 1TL7B 1YAGA 1DGKN 2VUGA 3KKRA 2N82B 2A6AA 3DRPB 3VALA 1OKJA 4GKKJ 5JVHL 5GADI 1E6VB 2KM8C 1RAAB 4F2RA 4PQUB 3K59A 2VICA 1HR0K 1KLMB 2C1EB 3M8PA 1S72N 2HAFA 4CO4A 5JICA 2HQ3A 3H3NO 3OVNA 1RA6A 4DUYF 4DR1K 3NCIA 3OUYA 1N8RT 2GO9A 4NO7A 3NWRA 3SAGA 5A6WA 1KQSM 2DR7A 4TYBA 1QVFM 2GWKA 4I67A 1WSHA 1MN9A 5KI6A 3SQ4A 2VQFF 3MXHP 4BE0A 4LSNA 3ZNUA 3NNCA 1HNXJ 1HBNB 2BJ8A 4C0HA 3BY5A 1TP7A 2BM1A 4KFBB 2UUBF 3BGUA 2V6AA 4OKEA 5K5MA 2QFJA 1NH7A 1BQMA 5AZIA 3AXMA 3VEZA 5K14B 2HNDB 1G7CB 4FDFA 3PZPA 2AF6A 3T1YF 1NK6A 3UD3P 1LWXA 4QJVA 1RILA 3F9MA 3MM6B 1Q81T 4ZDNA 5FLXU 2HBMA 3AVJA 2G2ZA 2OJ3A 3ZNJ1 4KHRA 4I4BA 4K2XA 4P72A 5G0RB 5AQHA 3AO3A 4P75A 3Q8VA 1SJ3P 1Q18A 4USMA 2AV5A 4C8OA 2O8CB 3AO1A 1FVSA 1F5BA 4FXVA 3VCDA 4MFBA 3UNGC 4NI2B 1W7AA 3QPIA 2W9BA 2Y8YA 1GH8A 3FVYA 4YHHK 5HMXA 2ZBQA 2P6TA 3V9UA 3WC0A 3DXKB 4EBEA 3E9OA 1FFWB 2QA4N 3BEGB 2BXJA 3IBFB 2C3OA 3K5NA 3M9NB 4NLWA 1A9NB 1U2FA 3O44A 1RTZA 5ETOA 1R8PA 3R9LA 4NPOA 5B7WA 1C6VA 4DG1B 4C8LA 1K8KA 3EKUA 1FDBA 5AQKA 3VQCA 3ZTSA 4HHTA 4NA2A 2DHAA 2P1JA 5CCLA 3BDEA 2OFGX 4YR2A 3FDSA 3W60A 3HZGA 1QZ5A 2G2OA 2V4JA 1HQEA 1OQ6A 3LAMA 3EICA 1YRTA 4E7JA 4EP4A 1OYDA 2MKCA 1AYEA 1S6OA 4O5FA 4CZLA 2X7IA 4LBHA 2HPUA 4NCGA 3L3CA 1Y3KA 2X1GA 3CPWM 4LQ9A 1S79A 1NMDA 4RNMA 2W6LA 3ASMA 4B3RF 2GUIA 1O1WA 2LCWA 3CT9A 1E3MA 4ECVA 3GTYX 3O6WA 5FJ4A 1JJ2R 1T0TV 2P9UA 2ZC4A 2GS8A 5L46A 3DLJA 2HYIB 2WRMA 3IUCA 1RYSA 1JMTA 4M45A 4JI6J 1JL2A 5LL6Z 2WAQD 4WU3A 2G8FA 5HVHA 3QGPA 1IM4A 1AZSB 5HMWA 4KGVB 1RFQA 4FWKA 3U9ZA 4F8RA 2Y1LB 2K7JA 3SDEA 2AJFE 5D0RA 4B3SK 2ADCA 2JFDA 4G1IA 5IQQA 1MU2A 1RT1B 3FMBA 1NPKA 4CRJA 3WXLA 3VAGA 3VQ8A 3P83D 4CF9A 3IM9A 3UR3C 2IMWP 1EQMA 3MN7A 1RHKB 2UUCF 5F0UA 4EO6A 2XY7A 3THTA 5FPNA 4FVUA 1RQ0A 5KG2A 5KT4A 2G1HA 3GIRA 3T5HA 2BJ3A 5HO4A 1FD8A 4YY3J 1X4FA 1Y97A 3IC1A 2J76E 4KHPF 3R8EA 5E41A 3V4IA 1XNQK 4OYWA 4NZ6A 4F26A 5KFJA 3T6BA 1TVRA 3WHIA 3Q24A 3AD7C 2A6OA 3W0LA 1WD6A 1Z05A 1HBMB 5L8RC 2KG1A 2UUAF 3JQMA 3RW7A 2M0GB 2K2PA 4L76A 3EMTA 2V69A 3HM9A 2WW4A 3SUPA 2Z4PA 2JSXA 2CQ3A 2P6SA 2VCPA 1R43A 4BWMA 2SXLA 3GIMA 4FW2A 3DC2A 4YORA 1NGAA 2B4VA 1T03A 5J2MA 1GTEA 3HK2A 2E9RX 1VLOA 4A8YA 4FLTA 1ZZFA 1H2TZ 2DFHA 2IVOA 1SH2A 2Q1LA 4DR5K 3SMSA 4DS4A 1WOQA 2V9WA 2HFVA 1D8ZA 4DV5J 2FVSA 3SFUA 3M2VA 2R8KA 4IXCA 3PYDA 4OYBA 2VQEF 1W9HA 1A5XA 2LLZA 4FN5A 1UFKA 2KKHA 3OTOK 3BO2A 2O8DA 4DDFA 5DM6Q 4L73A 4LRFA 1NB2A 3TSQA 4CIFA 1IKYB 2FDNA 3IM8A 4DR4F 3O3LA 1R3NA 4PAAA 2FBXA 4E8UA 1SC1B 4X65K 1A5WA 4H0PA 2D7SA 3LPTA 2APOA 2V94A 2PI4A 1G15A 1K47A 2PIIA 3CF5Q 3ENAA 3QYYA 1XBWA 3CVKA 3H46O 2ZVSA 4KBIA 1V6HA 3CXCR 3JTOA 1T9UA 1N32F 1SVDA 4OV6A 4NYZA 2EW9A 4R0EA 3NCQA 3DGPA 1RTJB 2CQ2A 1B3TA 4ZA1A 1Y0HA 3QJPA 1B92A 2HHWA 4HYKA 2EPIA 4LC9B 3CD0A 2EFQA 1IKXB 1Q9YA 5GAGI 2E5HA 1RLDA 3AY9A 3FRYA 3POTB 3GIKA 2H3EB 4Q45A 2QXLA 1JKHA 2V51B 3L3UA 2ZD1A 3Q89A 3D2EA 3UN5A 2FF6A 1VQPN 1AFIA 1RGVA 1XTZA 2ASLA 1N5YA 3A3NB 3VR1A 1UEKA 3J80U 1FO1A 3CC4S 2WW8A 3EXYA 2O3DA 1HBUB 4CBXA 3QJLA 1T02A 2ZH2A 3CCMS 2DNHA 3MMVA 3AA2A 1Q5VA 2V52B 5KPTA 3B6BA 1C0UA 3LF0A 3VQ5A 5KFDA 4ZJOA 4WQ5A 1SQEA 2B6AB 3NHGA 2RDDA 3KOAA 1D9FA 4G1QB 5F0WA 2VBXA 1TKXB 1RYRA 1UW4A 3BGLA 1JLQA 1WC4A 3O5TB 4IG3A 4B8AB 3LDPA 3BF1A 1S48A 3M8QB 1FX4A 5B0CA 4CP5A 3QGGA 1JQGA 5THWA 4ED2A 1VHIA 2M70A 1RBAA 1HNWF 2KHOA 4IOBA 1RT7B 1WTBA 3HOSA 2UU9K 1IXKA 4YN3B 2E9ZA 3ZZUA 1U0HA 4TU7A 4LT6A 4IBNA 4PUOA 1QDUB 4ED6A 2FJVA 3C6AA 4DU8A 1NGDA 4YOWA 2KFNA 3JSRA 3TA0A 2KTQA 3G6EN 2ITGA 3TTFA 3PFOA 4K4YA 1RCOB 4R0JA 2E88A 3CQ8A 1HUXA 1SJ1A 3I96A 3CJSA 1UP1A 1RT3A 2R4FA 4LVOP 4USIA 2AIRB 3PEHA 4LMZA 3TPQA 1IBLJ 3VQAA 1T9WA 2W7AA 1A6LA 2J7WA 1CJTB 2JC1A 3ATVA 2ZHOA 2GJFA 4M95A 2QT7A 3NL0A 4DN9A 2HHUA 2BANA 4FJ9A 2IMOA 2V8GA 1N33J 2DR6A 2OEMA 3VVTA 3CCQN 1VQMN 4DV6J 1HI8A 4QYZK 3GJTB 3M4XA 1GLEG 1S1UA 1N33K 3KK7A 1RBTA 1ROFA 1U8WA 2MHEA 3VQSA 5AQQA 3KUHA 3P3DA 4Y0WA 1QAJA 1ESVA 3OPKA 3DDNA 4JV5F 3EJMA 1ZM9A 3LDQA 4IO9Q 5TKYA 1KQGB 2DGTA 3BEXA 2VB6A 4JHDB 2O8FB 4QS7A 1NDPA 1F5CA 3LPUA 2V8VA 2QI2A 5F41A 2F8TA 2DR9A 3AD9C 3D7EO 3JSBA 1CULB 1OY9A 1EWQA 1T3VA 2HQFA 5CYMA 1CJUB 3Q86A 4DV7K 3MR6A 4IDKA 4KH0B 5HL7Q 3THXA 4UZBA 3ZZYA 5AJ3J 1S49A 3FR0A 4EUVA 2DEJA 2ZWPA 2J0XA 3CE8A 2FXUA 3Q22A 2AP1A 3NMUA 4MK7A 1SL0A 1Y3JA 3ZTOA 1ILYA 4ZHRA 1TUVA 3ID8A 1KKHA 1PJ7A 5LMNK 4CFDA 5GADU 1RABB 3QIDA 2E5IA 3ADAC 2D3OR 4Q8FA 1I94J 1DARA 3KHLA 1WC5A 5KFPA 4CH1A 2E1YA 2YPYA 4WK1A 1FI4A 1PCAA 2I0XA 1YJVA 3HP6A 2V67A 5KRSA 3FFKB 5KFHA 1JJHA 4ERDA 3HULA 1WORA 3BYRA 2OZMA 4LSZB 4E2FB 1TKTA 4FM1A 1G6BA 4ECXA 4LVNP 1HHSA 1QUPA 5KFLA 2GUPA 3TP2A 4Y00A 4CK3A 4OZLA 2CZ9A 5E26A 1KD1O 4DV2J 3T7ZA 3OL9A 4EYHB 3N79A 2L9DA 2VBZA 4A8KA 1U04A 2XMJA 4B1UB 4DV2K 4A48A 5HQ8A 5AXMA 4LF8J 1VK0A 2GX9A 1WKKA 3U9DA 5AQGA 3KUEA 5CH7B 1BY9A 4Q0BB 1MMLA 3GFHA 3QATA 3QT8A 1YIJS 8ATCB 3H5XA 1NCLA 2B56A 4OZ2A 4DUZF 2AX0A 2P9KA 1S9FA 1LWCB 2M8DB 2GX8A 5C5JA 2YNFA 1FVQA 2NQPA 5KOWA 3E01B 3OYMA 2Q3SA 3L3VA 1DRZA 4AHTA 3W3DA 3RJMB