1RT1A

Crystal structure of hiv-1 reverse transcriptase complexed with mkc-442
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
539
structure length
538
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Complexes of HIV-1 reverse transcriptase with inhibitors of the HEPT series reveal conformational changes relevant to the design of potent non-nucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 147
structure length 538
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt1A05
1LW0B 4WFZA 4JLHA 1UA1A 4CIEA 3PR4A 4RW7B 5I42B 4EP4A 2YKMA 4FJXA 4JV2A 1S1UA 2G8HA 4KB7A 3ZSWA 5KG4A 2HHUA 4AHVA 3M8RA 3SQ4A 4W5NA 1RCHA 1S1XB 3KHGA 4KB0A 1REVB 1QE1A 4DU1A 4M41A 3PR5B 4CJKA 2IJFA 1BISA 1C2PA 1GX6A 4Y34A 4I2QB 1TV6B 4KHRA 1K6YA 3KLFB 4Z4CA 4B9SA 4Z4FA 3LWMA 3UIQA 4Q45A 4EO6A 1T05B 3PW4A 5F9LA 3TARA 4B08A 4W5QA 2EHGA 1D8YA 4CHOA 1N5YB 1WLJA 2I1RA 2B6AB 4J9KA 1SKRA 4IRCA 3OJSA 1KLNA 3OYFA 3ZT0A 2C22A 4CEDA 1QSSA 2IOCA 4OJRA 3KK1A 4WZQA 2D5RA 4GW6A 4E7HA 1L5UA 1RT2A 3N6NA 4DTRA 3SCXA 2YHBA 1Q8IA 2Q3SA 4Q43A 1TGOA 4N47A 1VSIA 3OYCA 4YR3A 4DTXA 4GMJB 1C1CA 3AA5X 1RILA 2HNYA 1VRTB 2YKNA 4BE1A 2IC3A 2W8KA 1J54A 3PHEA 3UPFA 3JYTA 1JKHB 1YTUA 1RT6B 4C8KA 4ZPBA 4WZMA 1JLQB 4EBEA 1S1VB 3KMSA 3I8DA 1BQMA 2XC9A 3WNEA 2EX3A 2W42A 1RAJA 3KD5E 2D3UA 4H8KA 1WNEA 1D9DA 4H4MA 3IG1A 4ID5B 2ASJA 3FSIA 1HQEA 2FBTA 3QIPB 3NF7A 4I7FB 3NDKA 3RMAA 4RNMA 4RW6B 4CEOA 4M45A 1N6QA 1RBUA 1XHZA 2WCXA 4G3IA 1X9MA 4RW4B 1NK5A 1IM4A 5J2NB 4YQWA 2IMWP 1VSLA 1S0MA 4F3TA 4HKQA 3PW5A 1ZBLA 5KG7A 4M3RA 2IM0A 4TY8A 3BQ2A 1RDCA 2BE2A 3BGRB 3G0ZA 3MXIA 1HNVB 1KVAA 4GC6A 4IG0B 2O4IA 3OYKA 4CHYA 1BL3A 5F8HA 3MXMA 3S3MA 3DLGA 3AO2A 3ZT1A 5HROA 1L3UA 4KSEB 1S6PB 3K5OA 4KHWA 3ISNC 3OLAA 4CGJA 3DRSB 5KFIA 1X9SA 3VQQA 4EEYA 1J9AA 4R8UA 5HP1A 1RYSA 2D41A 3RMDA 4XO0A 1C0UA 4QW9A 4KHSA 4OLBA 2G8KA 4IFVB 3T5HA 4J9QA 3RMBA 4DL2A 1Z26A 3RAQA 3PW0A 2HWHA 3UR0A 2RKIA 4CEQA 2RDIA 3VQDA 4LD0A 4M42A 3KLVA 2X78A 4CJWA 3EYZA 1ZBIA 1UWBA 3VQEA 2VA3A 1UOCA 3CDEA 2F8TA 1SH2A 3HHKA 4FJ5A 1WAJA 4M95A 1JLGA 4NLUA 3M8QA 3NBPA 1RTIA 4K4UA 4DMNA 5EWEA 4ZVEA 1FKPA 1TVRB 1BQNB 4CFDA 4CEBA 2XCAA 4LSLB 1J5OB 3T5KA 5JS2A 4FJ8A 3O3HA 3AO1A 4FM1A 4O44A 1LWEA 4I2PB 4HVJA 1ZYQA 3M8PA 4Z4EA 3NH2A 1KHWA 1TKTA 4CHZA 2FJVA 3OYBA 3VQPA 2AGPA 2R2SA 2ZD1B 5DMRA 1S1UB 1CLQA 1D1UA 4ZTJA 2X74A 5EDWA 4Y3CA 1KVCA 5KFSA 3D0PA 4KV8B 3SFUA 5L1LA 1QE1B 1XR5A 1JIHA 3HP6A 2UVRA 4CIGA 1Y97A 3F9KA 4ZP9A 1HNIB 1LWCA 3PJXA 1SUQA 2FBYA 4R0EA 3RB4A 2HNZA 4XPEA 3QERA 4YP3A 1I39A 4FJIA 4CEZA 1KFSA 2VG5B 1ITGA 3H4DA 5KFWA 3ITHA 4QW8A 2FVPA 4N76A 2JEFA 1XR7A 3AVMA 4DSIA 4M94A 4KTZA 4TXSA 3NE6A 2VG7A 4DTJA 1B9FA 2KW4A 3PW7A 2AGQA 2AWZA 3T1AA 1XI1A 2D0BA 1O1WA 1KRPA 4WFYA 4FXDA 1NKBA 1WSFA 4Z4GA 4M3TA 4DEZA 4ICLA 4Z4HA 4FJMA 1D0EA 4RW8A 1TQLA 1C1CB 3M9MB 4RG8A 2HNYB 2ZE2B 4H54A 3DLEA 2YKNB 3ASMA 2HVHA 4FLYA 4NLXA 5KG1A 4O3RA 4FLTA 3B6PA 3HSTB 3ULDA 1CXUA 3H2LA 4DL4A 4KHMA 3THVA 3DMJA 4EZ6A 1A5VA 1YT3A 4MKBA 2XY7A 1VRUB 2KZZA 1SV5A 3HKWA 2F8SA 2R8KA 3IG1B 3AVBA 4QCLA 4RZRA 3KLGA 4KKOB 3PO5A 3HO1A 5KFFA 4KTQA 2B43A 2XRIA 2E9ZA 3BSCA 3KK2A 1N6QB 4FJGA 4GVMA 4JV0A 4F4XA 1JL2A 1WN7A 4J9RA 4LQ3A 3HVAA 2B5JA 5CZ2A 4PQUB 1S0OA 4C8OA 3QEWA 1NK4A 4ZPDA 1DTTA 5EUHA 2IAJA 5KFTA 1SH3A 2XY5A 2J6SA 5KFZA 2V9WA 3U6FA 4O3OA 4Y2CA 3VQAA 1S9EB 1X1PA 1LW2B 3T5LA 4NCBA 3QEVA 3S3OA 3DYAB 1NHVA 1JXEA 3DLGB 1CZBA 2YNIA 4CFAA 3RMCA 5HROB 5J2MB 3ZSVA 4K4VA 3V9UA 5DG7A 1RT5A 4NLGA 3L3VA 1ZTTA 5F9NA 1JLEA 4ED8A 4E1MA 3N6LA 1CSJA 3O4QA 5J1EA 3P83D 4R8UB 5HP1B 3CJ0A 2NUBA 2E9RX 4CJ3A 4CK1A 5EU7A 1C0UB 1HMVB 3KK3B 4ED1A 4F4YA 3QLHA 4Z4IA 4IKFA 3LAMA 1IH7A 2XGPA 1TK0A 2X6SA 3EY1A 4NCGA 1KSPA 4DLEA 2XY8A 3RBDA 4RNOA 1JLAA 2R8JA 3BSAA 2UUTA 3HVRA 1UWBB 5JUMA 4QWBA 2IA6A 4LSNA 1U48A 2JEIA 4G1QA 1GOBA 3OYNA 3HXMA 1JX4A 3KOAA 5KFHA 3M8QB 2IDOA 3RR7A 4HTUA 4J9PA 5KGXA 2DPIA 3OYAA 1FKPB 1NOYA 4CF2A 4DS4A 4CJLA 4ZPAA 1WSHA 1EP4B 2YHAA 2W9BA 1Z25A 3PV8A 3Q8QB 1VSDA 2D0AA 1VSJA 4K4XA 2WONA 1RT1A 2RPIA 4OL8A 4ECTA 2JLEA 5KFOA 4J2EA 1DTQB 2XO7A 1IKVA 3CDUA 2JEGA 3TABA 4KPYA 3PJWA 4YNQA 3U3GA 2BQUA 4K8XA 4R5PA 4FJHA 3F73A 4EYHB 2IBKA 5EWGA 2LSNA 4KFBA 3OYDA 5JS1A 4Q5VA 3K2PA 4C8NA 1HYSB 4DS5A 4CHPA 1LWCB 4ED0A 1SUQB 3LPTA 1TKXA 4DSLA 4W5RA 4DFJA 5C42A 1R0AA 2ATQA 3K57A 1T8EA 2PZSA 4E89A 3FFIA 5JXSA 3K5MA 1TKZA 3QEIA 3LP2A 5KFYA 4CEAA 3E01A 5DGAA 2J6UA 4HCBA 3BQ0A 2HHVA 4CK3A 3CVKA 4MK7A 5HBMA 1RTDB 4ZHRA 2UVWA 1NHUA 3D28A 2XY6A 4NLDA 4RNFA 4ZP8A 3TI0A 2IS3A 1YVUA 4ECRA 3NAHA 4Q44A 2ZKUA 3D5MA 1RBRA 1RBSA 2C28A 3OS1A 2HMIB 4YMEA 4EO8A 4FBUA 3ZSXA 1S10A 3H5YA 3DLEB 4H4OA 3SPYA 3L2UA 1B92A 4AHRA 5F8IA 1C1BB 3KJVB 1SL1A 3WNGA 5KT3A 3DI6B 3GIMA 5FDLA 5HRSA 3V6JA 4YR2A 4PWDB 1RT3A 4IQXA 2W7PA 1U4BA 4Y1DA 1Q9XA 3KLHB 4DSKA 3GIIA 3C6UA 3OYJA 2I5JA 4MIBA 3RRGA 1FK9B 3DMJB 4O3NA 4FJKA 4IR1A 3CJ5A 3IGNA 1SV5B 3I5AA 3AVNA 3Q8PB 2FC0A 4IR9A 1NKEA 1S6QA 3KLGB 4F2SA 3LP1A 3EPGA 5DG8A 5KG6A 5DQHA 4EBCA 3DRPA 2V0NA 4CJQA 3LWLA 3KK2B 5KFGA 4K50A 5HRRA 4O4GB 4CK2A 1SKSA 3KD1E 2D3ZA 3TANA 2DTUA 2Z1GA 4MFBB 1IKXA 1LAWA 1JL1A 3CDWA 5DK5A 2PYJA 3VQ7A 4ID1A 2BQ3A 1DTTB 4PUOB 2FVCA 3CO9A 4CGGA 4DTNA 4DG1B 5CYMA 3PX4A 4IFYA 4XPCA 5I3UB 4NRTA 3V81A 1U45A 3CFOA 4URSA 4IH5A 3MEDA 1IKYB 4ZP7A 3DLKA 4ED6A 4FLWA 3OL8A 4DQIA 3SZ2A 1LAVA 3ZT3A 1T3NA 5KFEA 1B9DA 3HPHA 1FKOB 3AO4A 1BIZA 2BANA 2OPQA 5J1EB 3I0RB 4IRKA 2ASLA 3P1GA 5L1KA 4O4RA 2RF2B 3RB0A 3RB6A 4CIFA 3LP0B 3PUFA 4ED7A 4K4TA 4BE2A 5KFAA 4FK0A 4DFKA 3I0SB 1BI4B 4LH4A 4WXOA 4TY9A 4NCGB 3O4NA 4C8LA 4FM2A 2G8VA 3H5SA 3DOKA 4CJ5A 4NLWA 3SQ0A 3I5BA 3S9HA 4BWMA 3V1OA 2OPPB 3SYZA 4G1QB 1QQCA 2YNFA 3C6TA 5HRNA 4B8CA 5DQIA 1RDAA 3MECB 3AO3A 4E7IA 4J2AA 3GIKA 1TL3A 4AHTA 1QSYA 4B9UA 2VG6A 1GOAA 2W9BB 3NAEA 4IH7A 3OHAA 4K4WA 5CZ1A 1EKEA 1RT1B 5KFRA 4W5OA 3CFPA 1RT7B 1MMLA 2OZMA 4IOBA 3GIJA 5F8JA 3K5LA 3AA2A 2GIRA 2R8IA 1IKVB 3B6OA 2R2RA 3SNNA 4AH9A 4DSFA 1RTHA 3MR3A 2BR0A 1RT4A 3RBEA 3HJFA 4HUEA 4FBTA 3BREA 4Z0UA 5FRNA 4FJJA 4KB1A 3QNNA 2GC8A 4DTUA 3SUPA 4CF9A 4B3OB 4ELUA 2R8GA 1VK0A 1IKWB 3VQ8A 1HYZA 1TKXB 4DQQA 4DWIA 4CJTA 2QK9A 1R0AB 3ISND 2YNGB 2KZMA 3JSMA 4K4SA 5C24B 1S9GA 2ILZA 4HUFA 4BDZA 4KREA 3QIDA 2OPSA 2WOMB 1L3SA 4FZYA 3PVXA 1JLFA 1KLMB 4ZHRB 1NOZA 2VWJA 4DTOA 2DFEA 1RTJB 3MEEA 3SI8A 1I6JA 4OKJA 4FLXA 1XC9A 3OVNA 3NGZA 2EC0A 3Q8SB 2CKWA 4Y2AA 3AVFA 2HW3A 3AVIA 4J9LA 3PY8A 2HNDA 1S1WA 4MK9A 4TQSA 4CHNA 4Q8EA 4MH8A 3H5UA 3ZCMA 1VSHA 1C1AA 4FW1A 4URQU 5HLFA 2ATLA 4ZMMA 2YKMB 4GC7A 1WSJA 5SWMA 5FDLB 3KHHA 2HHTA 1RT3B 4IDKA 3SJJA 4CJEA 4Q8FA 2I5JB 3V6DA 3QO9A 4B9LA 2P5OA 4B9NA 1SL2A 2C2DA 1VSKA 3NF6A 3V1RA 2HB5A 2P1JA 1S6QB 3LP1B 2R2UA 1RDDA 3RWUA 4O3QA 1VSEA 1GX5A 2GBZA 4MK8A 3HP9A 4NYZA 2W9CA 1JXLA 3NGYA 2OZSA 1S97A 4O3PA 3GV7B 5D3GA 3NF8A 3KIOA 4FLUA 1IKXB 4FJNA 4RUCA 4EP5A 1BIUA 5KFCA 2Z1IA 3RB3A 4CGDA 5J2PA 3QEXA 5CYMB 5FROA 3DLBA 3KK1B 4HUGA 1RT2B 4W5TA 2BGGA 3VQCA 1BGXT 1EXQA 1HYVA 1KVBA 2O4GA 4OVLA 3MEDB 4CEEA 4MIAA 3VN5A 4ECUA 3L2QA 1HJRA 3KLEA 5SZTA 3DLKB 4N5SA 2G8WA 1UAXA 1NK9A 3K59A 2IC3B 2AX1A 4DF4A 3JYTB 2DFFA 1T94A 1NK0A 2WB4A 2XI3A 2BANB 2OPQB 2QKBA 3CWJA 4NLQA 1DLOA 2E9TA 2FVQA 4ZP6A 3T3FA 1BQMB 4FK4A 1LW0A 4N41A 3PZPA 3E51A 4FCYA 1IG9A 5CY4A 4H4MB 1HQEB 3TVKA 2AJQA 4I9QA 4QWEA 5KT2A 3KMQA 2OA8A 2VA2A 1YTAA 3L8BA 1REVA 2YNFB 5KTQA 1S5JA 2BRKA 5L1IA 3GILA 4F50A 4ECZA 1NNDA 1LWFA 2XHBA 4CFBA 3BDPA 1JLBA 2VG6B 3T5JA 3QESA 3KLFA 2P51A 4N56A 1XR6A 4TY8B 1T05A 2BE2B 2QV6A 1U49A 2Z1HA 4KE5A 3CG7A 3MFHA 4RUAA 3QGHA 3LZIA 3WNFA 3O3FA 4ZVFA 3CJ2A 5HRPA 3N6MA 1TL1A 4NLOA 3A2FA 4KO0A 4BACA 5KT7A 5T14A 2A1RA 3D45A 1ASUA 1S1TA 4WYLA 3SI6A 3QEPA 2RKIB 1ZTWA 3QZ8A 3CQ8A 3NGDA 4ECVA 3JSMB 5CYQA 3QGIA 1UA0A 1JLCA 3IGVA 2ASDA 4HCCA 5T7BA 2W9AA 1ZBUA 3NHGA 1S1VA 4FYDA 3MTKA 3OYHA 1JXBA 4RW9A 1JLGB 3NBPB 4Y1CA 1RTIB 4E1NA 3TAEA 2JC0A 3OL9A 4O5BA 3NMAA 3L3UA 3NFAA 4OPKA 3NH1A 4EBDA 4ID5A 1RNHA 3ZSYA 5FRMA 3L2WA 2JGUA 3QIPA 2IM1A 4I7FA 2HNDB 1S1WB 4RW6A 4O44B 1S49A 4FVMA 3V4IA 1LWEB 3OYEA 5KT5A 3SQ2A 3M8PB 3G86A 3AA3A 4DTSA 5KFBA 3WNHA 4DQPA 2ETJA 3LDSA 1I3AA 1TKTB 4RW4A 2WTFA 1L3TA 4DQSA 2XWYA 4CF0A 5J2NA 3ZSOA 4CJFA 4QOZB 3LAKA 3SV4A 4MKAA 1W0HA 3CIZA 4FM0A 2VWKA 4E0DA 3BGRA 1HNVA 3NL0A 2FVSA 5KFNA 4NCAA 1TAQA 4TQRA 4IG0A 3GV5B 3M9NB 1Q9YA 4M3YA 2HNZB 1S6PA 4CEFA 4FS1A 3TAPA 4BWJA 3BR9A 3HVTA 3OS0A 1XHXA 2R7YA 1HARA 3EPIA 3G10A 1RBTA 3ITHB 3DLRA 1ZBHA 3L2RA 4J2BA 2VG7B 4IFVA 3SUNA 2RDJA 1Z4UA 4E3SA 1QTMA 3PO4A 1RYRA 2D7SA 3K58A 2BDPA 3S3NA 3TR8A 1W9HA 2YV0X 2R8HA 4WE1A 2QXFA 3OYLA 5KFMA 3LALA 4QWDA 4ICLB 5KFDA 3KLEB 4RW8B 4KRFA 1EX4A 3KTQA 4FS2A 3AVAA 3MR5A 4DQRA 1QAJA 1D9FA 1BQNA 2G8UA 4QWCA 3SV3A 2KTQA 1QAIA 2IJNA 3DOLA 4DTPA 2WK4A 3BJYA 4LSLA 1J5OA 5L9XA 3O3GA 1DLOB 4I2PA 2E4LA 4OLAA 4DSEA 3TAGA 4ED3A 2Z1JA 3QZ7A 4DL5A 2XI2A 2KQ2A 2ZD1A 1L3VA 1U04A 4CERA 4ECSA 4FLZA 4OPJA 2GIQA 5KFKA 1TK8A 1MU2A 1S4FA 1BHLA 3AO5A 3RRHA 4JS4A 4KV8A 1ASWA 2FJXA 4ECXA 4E19A 3KHRA 4UQGA 3ZSQA 1S48A 4O55A 1HNIA 1LWFB 1SH0A 1JLBB 3IRXA 2B5JB 1K1SA 2HHWA 3MR2A 4KHYA 4O3SA 4DFMA 3CM5A 3H59A 4OKKA 4URGA 3I5CA 5KT4A 4ECQA 2IAJB 3KNAA 4B9MA 2Y1JA 1EETA 1NKCA 1VSMA 2HAIA 2VG5A 2G8FA 1C6VA 3BQ1A 4QPXA 2HVIA 2R2TA 4PA1A 4F8RA 3HM9A 3QYYA 3NKYA 2YNIB 4E7KA 3QGGA 4CF1A 1RT5B 5J2QA 1CXQA 4CJSA 1G15A 2IM3A 1LV5A 5F8GA 5K14A 4WFXA 4QWAA 1JLEB 4CJ4A 3CJ3A 3C95A 1CZ9A 2HHXA 1N56A 3VQ5A 2FVRA 4DL6A 3EZUA 1TL1B 2FJWA 4ZVHA 2F96A 4KO0B 4IKAA 3PW2A 3QLHB 3SUOA 1S1TB 1U09A 2ZE2A 3VQ6A 3V9XA 1TP7A 5E41A 4TSXA 3LZJA 3NCIA 4F3OA 2AQ4A 1JLAB 3SFGA 5CYQB 5KG3A 3NH0A 3HK2A 4DTMA 1JLCB 3H5XA 4TYAA 2X6NA 4X2BA 1HQUA 2IM2A 4LSNB 4QAGA 4RW9B 4DU3A 1VRUA 4F2RA 4KAZA 3NGIA 3LANA 3UDLA 4KKOA 3M8SA 3QINA 2WONB 3OL6A 3AVJA 3V4IB 3G6XA 1WSIA 3U3YA 5KG2A 5KFVA 5KRTA 2FBVA 1SL0A 1FXXA 3V9ZA 4B9TA 4KHNA 3FRZA 4PQUA 2BQRA 3OY9A 2O5DA 4R5PB 4K8ZA 1OS5A 4WYWA 4CGFA 5DLFA 4CJUA 1C0TA 3ICLA 3AVCA 2KFZA 4CFCA 4Q0BA 4KFBB 4CJPA 1S0NA 1S9EA 1RA7A 2OPRA 3TAMA 2KFNA 1LW2A 2W8LA 4LQ9A 4AHCA 3SPZA 4E7JA 3DYAA 5C42B 5J2MA 5KGWA 1A5XA 3FFIB 1HPZA 4NLVA 4FZXC 3OJUA 1TKZB 3HVTB 2OH2A 3LP2B 4FJLA 2QKKA 1TAUA 3E01B 4TN2A 4KI4A 1QUVA 3Q8RB 5HBMB 1HMVA 3KK3A 4FK2A 3KHLA 4LY7A 3VA3A 4JUZA 4FJ7A 4F4KA 1YVFA 2FLNA 2WRMA 3HPOA 3DDKA 3H08A 3OYMA 4BDYA 1ZBFA 3IS9A 1C0MA 4WE1B 4LH5A 5KRSA 3PX0A 5F8LA 4BDPA 3FQLA 3TAFA 5DG9A 4DL3A 4TYBA 4BE0A 2OYQA 3VA0A 4ZTFA 2WHOA 3DM2A 4H4OB 4J2DA 3TAQA 4NRUA 3NAIA 3OSNA 1EP4A 3DOLB 3OYIA 2C2EA 4IH6A 4K4ZA 2QE5A 3BSNA 5L1JA 3C6UB 4NLSA 3SUQA 4AILC 5KG5A 3AVKA 3AVGA 3CM6A 2ILYA 1DTQA 3MEGA 4FJ9A 3G6VA 1NJXA 1F21A 2A1SA 1KTQA 2V4QA 1NK6A 2GUIA 4CGIA 4NZ0A 4AHUA 1T03A 1MU2B 3DRPB 4O0IA 2ZQBA 3AVHA 2AU0A 1RDRA 4ZPCA 4KAIA 3HYFA 2G8IA 5KFPA 3OLBA 2YNHA 3KLIA 3DRRA 1HYSA 4CJVA 2C2RA 5KG0A 3IRXB 4MQ3A 3HL8A 3KKSA 3OL7A 1NK8A 3EZ5A 5C25A 1EETB 4IFYB 4WXWA 1XWLA 1NJZA 1TKDA 3V81B 1KHVA 4JRQA 4IBNA 4FW2A 3V1QA 2BRLA 2UUWA 4DU4A 5F8NA 4ECYA 4U6PA 3ZSRA 3GV8B 1RTDA 3T19A 1WSEA 4J9MA 3K5NA 1RBVA 5J2QB 2Y1IA 5EWFA 4CESA 3GQCA 3QIOA 1RA6A 5K14B 5KFJA 4IG3A 1GOCA 1A5WA 4C8MA 1BCMA 4NLTA 3ALYA 1QSLA 4OGCA 2AGOA 4DLGA 1T7PA 1ASVA 2HMIA 3ZT4A 5KT6A 1SKWA 3H4BA 3TWHA 4RW7A 5I42A 4JV1A 1C1BA 1WAFA 3KJVA 2IGIA 3VQ9A 4NYFA 5KFUA 3LPUA 3DI6A 4K4YA 3DOKB 4PWDA 2FLLA 4EZ9A 3KLHA 1HQUB 1S1XA 3AV9A 1FK9A 3C6TB 2GV9A 3HT3A 4F4ZA 3FDSA 3OHBA 3FQKA 1TL3B 4I2QA 1J53A 4CGHA 2E6MA 3CFRA 3ZT2A 1TV6A 2UVUA 3V9SA 2JEJA 3AVLA 3MXJA 2PYLA 4OGEA 4FZZA 3MR6A 4KHUA 1NJYA 4O4GA 3VQSA 4KI6A 4J9OA 3QETA 1N5YA 4ELTA 4KBIA 4MFBA 4TLRA 5KFQA 1RTHB 2B6AA 1RT4B 4PUOA 2XCPA 4DG1A 4ELVA 2CJQA 1NJWA 4M3XA 3VQ4A 1C0TB 5I3UA 3AA4A 3CJ4A 4RNNA 4Q0BB 4RU9A 2OPRB 3TAMB 1IKYA 1S9FA 5C5JA 1KCFA 3RR8A 3LP3A 1D5AA 4J9NA 1VSFA 1VRTA 2DPJA 1HPZB 2D0CA 3MAQA 3RAXA 2HHQA 3V9WA 1FKOA 1JKHA 4OKEA 2HWIA 3KKRA 4CECA 1RT6A 1S9GB 3I0RA 3G6YA 3TQ1A 1RDBA 1JLQA 3V6KA 2RF2A 2OPSB 2ITGA 2V4RA 4ZVGA 1JLFB 1K1QA 2E6LA 2DY4A 3LP0A 4NLRA 3MEEB 3SQ1A 2P5GA 3I0SA 1BI4A 3CYMA 4CCHA 3IS9B 1NK7A 2UVVA 3IN5A 2F8EX 3PX6A 4CHQA 4EYIB 4CF8A 2OPPA 4RNHA 4J9SA 1W25A 2B4JA 3C94A 1TK5A 4M3UA 1KFDA 2FBXA 1HRHA 5KFXA 3DM2B 3MECA 1QS4A 3M9OB 5HLFB 4E7LA 3ZSZA 4M3WA 1IO2A 5KFLA 4DL7A 4IDKB 3OS2A 4L8RB 2RN2A 1RT7A 3MF5A 3V6DB 3QO9B 1ZETA 4CJRA 4I9LA 3DLHA 3H98A 4DF8A 4F4WA 3OSPA 3MEGB 5DLGA 2HHSA 3MFIA 3GYNA 3IAYA 4NLPA 3OYGA 5DGBA 4KTWA 2ALZA 3HVWA 4AHSA 4IRDA 1T03B 4JRPA 4KHQA 4HHTA 3VQBA 1X9WA 2XGQA 4B9VA 2W9CB 3H40A 3DRSA 2PY5A 4YR0A 4B3OA 3QNOA 2YNHB 3KLIB 5D3GB 3DRRB 1IKWA 3BSOA 3NF9A 5KI6A 4PY5A 1N48A 5DQGA 3L2VA 4HYKA 2W7OA 5J2PB 3V6HA 4YFUA 2YNGA 5C25B 4ED2A 3UQSA 5C24A 3P5JA 4FLVA 4O0JA 1N4LA 1WNSA 3RTVA 4CE9A 1U47A 2WOMA 3HPGA 4JS5A 1KLMA 1BCOA 1RTJA 4DFPA 2J6TA 2AX0A 4U7CA 4XIUA 4DSJA 2JC1A 1TVRA 2DFHA 4M3ZA 4ECWA 4IG3B 1QHTA 2FLPA 5F8MA 4NYNA 4NLYA 4B8AB 1WSGA
chains in the Genus database with same CATH superfamily
1LW0B 4WFZA 5I42B 2PA8D 3OBYA 3HBTA 3KG4A 2KG1A 1B0TA 4JV2A 3W5YA 4FYVB 2G8HA 4KB7A 1FWLA 3M8RA 4W5NA 3MCPA 1HWUA 1H72C 1S1XB 3KHGA 4KB0A 2HHHK 1QE1A 3CPWR 1RAAB 2HSTA 2IJFA 1GAOA 4RWWA 1C2PA 4OHVA 3CCSS 2G0JA 4LFAJ 1GLDG 1K6YA 2QWPA 5EX0A 2V8DA 1VJWA 5D0RA 3LDLA 3LWMA 2WBRA 3FEZA 2VC0A 2J7WA 5F9LA 2U1AA 4B08A 2EHGA 2DNYA 2MZQA 1XEZA 1W2BM 1RBLA 2ACYA 1KLNA 2C22A 1QSSA 4FZVA 5ADZA 2IOCA 2V9KA 4KC5A 3KK1A 4Y2KA 4WZQA 2ZWOA 1L5UA 1OQ6A 1RT2A 1Y4ZB 5FPMA 1VQLS 2R7VA 2YHBA 4USVA 2CNOB 1Q8IA 1GLLO 1TGOA 3OYCA 4GMJB 1RK8A 5G0RA 2A1BA 3HHLC 4UY8O 4LF7F 4BE1A 3QT7A 4CZKA 1T9WA 1VQON 1UAWA 1RT6B 2VASA 3ZTQA 4WZMA 4CLTA 1HWJA 2B9EA 4HTIA 2ZH7A 2ZH3A 2OAUA 2B9XA 5BYSA 2XC9A 1B3TA 1OQ3A 3WNEA 3KUGA 1IBMK 1W7WA 2EX3A 1NRKA 4LF6F 2BJ9A 2V51B 4H8KA 4BROA 1D9DA 3GCXP 2ASJA 3MM7B 3UW1A 1A6LA 3NDKA 2R3VA 4RW6B 4M45A 4DCJB 4G3IA 4V19X 1V5IB 1X9MA 4RW4B 3EGWB 3O5BA 2IMWP 3CDBA 1VSLA 5LL6Z 4F3TA 3PW5A 1B99A 1UJ5A 3P3DA 5KG7A 4M3RA 3BO3A 4BRNA 2BW2A 2IM0A 3BQ2A 2P9CA 3R6LB 2QWMA 1RDCA 2BE2A 3MXIA 3VAFA 4GC6A 2V2ZA 2F4FA 5JVHQ 3C6HA 1FJGK 3OVAA 3OYKA 5DM6Q 1S12A 2HHHJ 1BL3A 5F8HA 3DLGA 1KQKA 5KQDA 5L39A 1V3SA 4KHWA 1OH7A 3DRSB 3KZBA 4EEYA 3SQGA 5HP1A 4X66K 3RMDA 4XO0A 4KHSA 4OLBA 2G8KA 4ZCKA 5A8KA 4IOXA 3RMBA 4DL2A 1Z26A 3RAQA 3PW0A 2HWHA 2QO3A 2V4JA 2VOOA 2YQ0A 3VQDA 4KT0C 4DV7K 3TR5A 2R7OA 1ZAWA 4CJWA 4K2JA 1UWBA 1QVGR 2CYYA 4A59A 3WX4A 1SH2A 3QFUA 3HT0A 4K4UA 6AT1B 4G6VB 5AQSA 1NHKL 2Q0UA 1DHMA 3TYTA 3VAIA 2KH9A 4DX7A 2XCAA 3AAWB 3PEJA 2I38A 2E7XA 3AO1A 1VQNN 3THPA 3M1VA 3IMQJ 4HVJA 2XBPA 1ZYQA 1FXDA 3C7NB 2ZJRQ 2R2SA 1W26A 2F9TA 3UN2A 4PXDA 1D1UA 1IBMJ 4ZTJA 1RADB 3D0PA 4KV8B 1QE1B 3ZETB 3HP6A 1X5SA 1P8ZA 3OR2A 1D9AA 3PJXA 1NGBA 2CWKA 4DV5J 1YIJN 4B3SK 2PFUA 3QERA 4LF1A 3ZTRA 2PAVA 5CD4H 5CXTA 4CEZA 1BWEA 1CC7A 3PACA 4N76A 4TU8A 4JB8B 4QQBA 1ZM4A 2V8GA 2JEFA 4DSIA 3AVMA 3QBWA 4TXSA 3VAGA 2Q43A 2VG7A 2D3OR 2HQ3A 2FJEB 2KW4A 2AGQA 3T6JA 2UXCJ 2D0BA 2NPFA 3EZWA 3BKTA 2O8CB 1KAXA 3NY0A 4H0XB 4I1TA 2AZ1A 1NH7A 1SC1B 2C3YA 3FR0A 1NSAA 4CO1A 4UOCA 4UUWA 4ICLA 4DEZA 1EJ7L 2UXBF 3KG0A 3JAMU 1TQLA 3R9PA 4PQAA 2EFPA 2O8BB 1SQGA 2EFQA 1S99A 2ZE2B 4J37A 2AP1A 3P31A 2NYHA 1FD8A 3GIRA 3ASMA 5M1NA 5EXWA 3NGUA 2AEMA 4O3RA 4J9VA 4LBIA 4FLTA 4LUBA 2CFXA 3B6PA 1Y5IB 4C23A 4UZBA 4DL4A 4CD1A 4MKBA 4UTGA 2RUGA 1VRUB 1VDHA 5A0YA 1NG9A 2F8SA 3BO2A 4QCLA 3JTOA 1EIYB 5JJBA 3PO5A 3KNGA 5KFFA 4CBWA 5LJ3Y 2K7KA 4KTQA 1URNA 2POKA 4FJGA 2HVZA 2LXIA 4JV0A 3LL3A 2FHOB 2V34A 1JL2A 2E88A 3ATVA 2UYTA 2B5JA 3PYFA 1S0OA 3BS9A 5CZ2A 3SBGA 4ZPDA 1DTTA 4A8MP 3VENA 1SH3A 1IN0A 4OPHA 3U6FA 4O3OA 4PZVA 2J5AA 2BVZA 5ETTA 3DYAB 1F9FA 1JXEA 3DLGB 1CZBA 2YNIA 5J2MB 4OI4A 2NXEA 4LFCJ 3G82B 1ZTTA 2HOEA 1H2VZ 3RBZA 2D9PA 2KKHA 5J1EA 4CO5A 5HP1B 4B3SJ 1F6TA 5EU7A 2LA6A 4NXNK 5A8KB 5IV3A 1T0TV 4JHDB 2V4JB 1IH7A 3HSDA 3ZX2A 4HDHA 2X6SA 2FY1A 4NCGA 2I2YA 3VF4A 2XY8A 5BJRA 3K7RA 1N32J 2UUTA 3HVRA 1UWBB 3QSYB 4TLQA 2UU9F 4KHPF 2JWKA 4FWMA 4CO3A 1UVLA 3BH7B 4PKIA 1GOBA 3OYNA 2NYIA 2BJ8A 4FWRA 2VCPA 4FPBA 5M1KA 2BOAA 1I51B 2E5GA 2QWLA 3TX8A 3PV8A 1VSDA 1FE4A 3M1VB 4YDDB 2WONA 1RT1A 4DV6F 3THYB 1HKBA 2JLEA 1RABB 2JEGA 4X4NA 3O5TB 3PJWA 2UUBF 3L4IA 5CQGA 1MN7A 3DRYA 2Y9HA 3OTBA 1D8ZA 3UKRA 3D1HA 2IJRA 4OHWA 2OD4A 5JICA 3ILJA 3PCOB 4TU9A 2GNKA 2HPUA 3OR2B 4C8NA 4CVNE 4ED0A 3CHWA 1BXNA 4DFJA 3IWXA 3HOSA 2YHWA 3ONQA 5C42A 1R0AA 1PJ6A 3K57A 3ENVA 4OHXA 3J81Y 2HQIA 5KFYA 2J6UA 3M6GA 1UCNA 5HATA 1HNZF 2DXEA 2HQFA 5JMNA 3TUJC 4EAHD 3W66A 4BC3A 4ANEA 3DN9A 1F2HA 3BYPA 4Q44A 3O9TA 3DNCA 5DDOC 2C28A 2HMIB 4YMEA 1RU1A 4H5WA 4H4OA 1U7LA 4BRMA 2D69A 2MQLA 2LA4A 1C1BB 1IR0A 1KVJA 2CNLB 4NXNJ 4ZKAA 2V8HA 4IQXA 1RT3A 1AYEA 2W7PA 2AYGA 1HW8A 1WHWA 1FDBA 4MO4A 3GIIA 3C6UA 3PIPQ 2I5JA 4QS9A 1FK9B 1NJIT 4O3NA 4IR1A 1H3DA 5BPMA 2NZCA 4F2SA 5DG8A 5KG6A 3TWZA 1U6FA 1NMNA 2DD8S 4ZN1A 5KFGA 1RAIB 1K8KA 5HRRA 4O4GB 5IQQA 3KD1E 4CH7A 1GLFO 1QAYA 1IKXA 1LAWA 1JL1A 2BQ3A 4DR6F 1DTTB 3HX9A 2PN6A 3M2RA 5BR9A 3AD8C 3J7AP 4IFYA 2BKPA 1A9NB 5HQ8A 1ZS6A 1VQKN 4URSA 2A3ZA 3CF5L 4IH5A 3S8SA 4ED6A 2NRRA 4FP9A 3ZT3A 5GIOA 3W8PA 3NWRA 3LGMA 3MWBA 4OX6A 3N5BA 1BIZA 2IY5B 5J1EB 3R3TA 3KK7A 2A0FB 3HHLD 4JYAF 3FSYA 4DFKA 2E5LF 4D3HA 4NCGB 1ITPA 4FM2A 3BBCA 3CIPA 4BRLA 1GFWB 2LVWA 2DRBA 3PYEA 4X4UA 3W2WA 4NLWA 3SQ0A 1HBNA 3ATUA 3WHIA 1ZM2A 2YNFA 8AT1B 1QQCA 5D4LA 4B8CA 2Q6BA 4HT7A 1RDAA 5ETNA 2QEXN 4E7IA 1RP5A 2XNQA 4C97A 5L9NA 3WC2A 4AHTA 1GT8A 1QSYA 2XS5A 1HWKA 4A2AA 3NAEA 2W24A 4IH7A 2ZH2A 1RT1B 2QSFA 5KFRA 3PYGA 2Q1NA 1MMLA 2VONA 4IOBA 1RJJA 4WP9A 2AJ2A 3B6OA 4AH9A 3ID6A 1WC3A 1CS4B 1RT4A 2HS3A 5D4OA 3D2WA 3GSIA 4Z0UA 1S22A 3W5ZA 5FRNA 3UKRB 3SCKE 2IA0A 4CNZA 1OKJA 4CT9A 1YRXA 2ZH4A 2HLTA 1FVSA 1VK0A 2R7WA 4JKDA 3VQ8A 3BF1A 4CJTA 1IV0A 2ZUGA 1R0AB 2XG8A 4OYOA 2AHOB 5IC4B 3CCRS 4BRPA 4K4SA 1PO6A 1U6BA 4LFAF 1AROP 3NGRA 3QIDA 2OPSA 4FOEA 3PVXA 3MMBA 4DTOA 2DFEA 3CEDA 1I6JA 2QWQA 1XC9A 4EU0A 3NGZA 4Y2MA 2HFZA 3Q8SB 4ZVTB 3CCSN 1KQGB 4MK9A 4TQSA 4KR0B 3CCES 2AW0A 1HWLA 2BX6A 3H5UA 2A10A 1C1AA 4BVPA 1DURA 5HLFA 1X9JA 4GC7A 5SWMA 3KHHA 1KR4A 1RT3B 2F8MA 1RHUB 4CLKA 4NPOA 4Q8FA 3AY0A 2I5JB 3QO9A 3QMLA 3R27A 4B9NA 4DCOB 4CLZA 4L73A 2M2BA 3A1YG 1Q8KA 2R2UA 4M5JA 1RDDA 4CTAA 1VSEA 4A62A 2M70A 2DEJA 5GADI 2K8GA 2YY3A 5AQZA 3BGUA 2NZTA 3AARA 4KRWA 3GZ7A 1XUPO 1K8KB 2DRAA 4ZA1A 3QNWB 1ELOA 4FLUA 1IKXB 3J7A1 1M1KO 1BIUA 3P49B 1K73T 1M1GA 1VHFA 4HUGA 2DGQA 3I56S 3I9V9 3VN5A 1U02A 5IS2A 4ECUA 2IVMA 1YITS 3IKMA 5SZTA 4EFHA 2F63A 4OYBA 4B02A 4O8UA 4KY3A 3QPIA 1NCLA 2AX1A 3CTRA 5EY4A 1S72S 1NK0A 2HHHF 2WB4A 3QJLA 5FLXU 2HQGA 5D0EA 4NLQA 2B4PA 1DLOA 5G4DA 2FVQA 2Q6CA 3JTPA 3J80O 1BQMB 4N41A 2JLFA 3E51A 1CJTA 1HBMB 4FCYA 3N01A 1N5VA 3ZZUA 1HQEB 3JS9A 2AJQA 4I9QA 1HBNB 3KMQA 2OA8A 3U9ZA 1YTAA 3L8BA 1O5JA 1QQNA 2YNFB 3K2YA 4F50A 1VK8A 1IXKA 4L3QA 1K9MO 1JCEA 2DR6A 4RR5A 5AQQA 1LWFA 4USUA 1UZDA 1LEOA 2XZWA 5B0AA 3KXDA 4JI6J 2CRLA 4A46A 4OX8A 3KLFA 4K5SA 2A6OA 2IRXA 2ZFHA 4PAAA 2AJ1A 2R7QA 1Q86T 1B70B 1RAHB 2PBDA 4UY85 2VICA 3GWCA 1X0FA 2Z1HA 3CG7A 2C2MB 5F0UA 3H6EA 3IR5B 3MFHA 3GP9A 3ZZRA 4R0JA 2LCWA 3AH6A 2RQMA 1FJCA 3BUZB 2JOQA 1CEZA 5HSPA 2W4DA 4Y00A 2CZ4A 1IBMF 1WUUA 2KXFA 3MHYA 3WEEB 1RHMB 3D45A 1NBEB 1S1TA 4WFNL 2RKIB 1ZTWA 1CQNA 3CQ8A 3NGDA 2CG8A 4Q2MA 2MHEA 1UA0A 3QGIA 3IGVA 3PRDA 1F9EB 4H5NA 3CJ7A 1NSQA 3UCZP 5K8OA 3TTCA 1HKAA 1LFWA 3R5AA 1RDWX 2VBWA 4P2MA 2DGOA 3NBPB 3TAEA 4XH5A 1W2IA 2EVZA 3OL9A 1AZSA 1H98A 5HMWA 3L3UA 3CUNA 5HL7Q 4Z94A 4CH1A 4EBDA 3CJQA 2J7KA 4OZ5A 4QR2A 2ASMA 2JGUA 2CDRB 3T7ZA 1VISA 2UXCF 1HR0J 2W2MP 3Q7CA 1LWEB 3OYEA 3M8PB 3G86A 2QL5B 2ETJA 1ATSA 1YHQS 5J2NA 4BRKA 2YKAA 3TTFA 2E1MC 3MPUB 1JB0C 4BQZA 1FERA 3LAKA 3EZOA 4MYUA 3UN5A 1CQMA 4X66F 3HJVA 2VWKA 1HNVA 2FDNA 5TKYA 2GCFA 3FZMA 3SIPB 4ZCIA 1FA0A 1PC5A 4GVBA 4H4KC 1UETA 3DLLL 4BGAA 2XLJA 4M3YA 4DV7F 4HHUA 1S57A 3UO0A 4WP3A 4FS1A 2MZ1A 3MI7X 3DHXA 4BWJA 3HVTA 2BW7A 4YHHK 1HARA 3EPIA 2HK3A 3I96A 1QZ6A 2WSFC 1N52B 2W4PA 2JL9A 4RKUC 2GWKA 1QTMA 4PKHA 3VHQA 2BDPA 2K3KA 2YV0X 4DV2K 3MAAB 5AQKA 1NJIO 2PO4A 4O23A 1S6UA 2QXFA 1GQEA 4FVCA 3LALA 3K0JA 4OX7A 4QWDA 2R7UA 2MMYA 4DX8H 3CJKB 4KRFA 1EX4A 2C3PA 3KTQA 3AVAA 3AOBA 3MR5A 4DQRA 2YHXA 1QAJA 2J76E 4LRDA 4F36A 2GVZA 3WXJA 4Y0WA 2KTQA 4LSLA 2PMWA 3I82A 5T7LA 2B8QA 1NGIA 4CWBA 1DLOB 4JK9A 4C3KA 2W40A 1UVMA 4JI1K 2LDYA 5K20B 5BPLA 5ELZA 1CJTB 5GAHU 3VGLA 2Z1JA 4B3SF 4RWXA 2ZD1A 1L3VA 1VQYA 4ECSA 4FLZA 5KFKA 2G0CA 1EB0A 1YZ6A 1BHLA 2XWXA 5HMXA 5AQHA 4E19A 2DO4A 2ZGZA 1MA9B 2DNPA 1BDGA 4OYWA 1HNIA 4I6MA 1SC6A 1LWFB 1NMDA 4C3MA 3MR2A 4KHYA 4O3SA 3CM5A 3H59A 2FJDB 1QQOA 4U67Q 2G0IA 4DR3J 4ECQA 3KNAA 4B9MA 3A8YA 1GNKA 3CJ9A 3MN9A 3RGIA 1QD1A 2HAIA 1NGAA 5AR0A 3BQ1A 3FZFA 4PA1A 4HHHA 4CLPA 1YTYA 1TL4A 3QYYA 4YDUA 4CF1A 5J2QA 3M6UA 1G15A 2IM3A 2O8DA 4LF2A 1VR6A 4QYRA 1NZ8A 4QWAA 4CJ4A 3VQ5A 4DN9A 2FJWA 2JNJA 4WPAA 3OHRA 4U7UD 1KAYA 4IKAA 3QLHB 1S1TB 4IO9Q 4ERDA 1NM2A 4I67A 3LZJA 3J7AN 2FXUA 4RUBA 1JLAB 3EGVA 3EE3A 3T1YK 2ZDPA 4GO5X 1BWFO 1B7YB 1VQPS 1PBUA 4OX9J 4OV1A 4QAGA 4LIRA 3BBFA 1U1MA 4F2RA 4FNHA 3LANA 3UDLA 4ETXA 4KIAA 3M8SA 2BJEA 5FD1A 3QINA 2E5JA 3Q0AA 1UP1A 3MPWA 3CIMA 1WSIA 4CDIA 4H03B 5KRTA 2Q0RA 2FBVA 9RUBA 1IG8A 1H6KX 3WXIA 4B9TA 1OO0B 3QWUA 5LM7E 2LFVA 2O5DA 2WSCC 2VL1A 1OS5A 1TUWA 5DLFA 3FMBA 1P8GA 1C0TA 1WACA 3ICLA 4NXNF 2KFZA 1PILA 4CJPA 1S0NA 1N8RO 1RA7A 2AA4A 2OPRA 3TAMA 2ASPA 2DNKA 5AQNA 4W90B 1ZZFA 4AHCA 1D09B 2HFNA 3BM7A 2HBMA 4NZ7A 4MYTA 5E33A 4N7TA 5KGWA 2DXDA 3FFIB 3R8YA 4NLVA 1OJ4A 1TKZB 3HVTB 3O1LA 4OLOA 1OH8A 2PDAA 3E01B 3AQOA 3H0PA 1I3OB 3CERA 3TVZA 3R6MA 3IBCB 4JUZA 3B4MA 4F4KA 1YVFA 1HLUA 3M30B 2WRMA 1U0HB 3R6GB 3OYMA 2AYEA 4BDYA 3D0GE 4NA3A 3QQCD 1S3XA 4DZ6A 3IS9A 1T95A 1RGIA 3J7Z5 4DR4J 5KRSA 2YQ1A 3C19A 4LSZB 3CPWM 1QQMA 4BRCA 4P73A 4TYBA 5BREA 4PEOA 2WHOA 3DM2A 4J2DA 2EPIA 2IDEA 2GVZB 3OSNA 4USWA 3OYIA 3NCQA 5T7LB 2EXUA 4K4ZA 1KVKA 2HZVA 3SUQA 3FE1A 1WI8A 5KG5A 3CM6A 3W8GA 1DTQA 3CCUS 3L7OA 2A1SA 1U1QA 2EFGA 1NK6A 5AQFA 4CGIA 4NZ0A 4AHUA 3DU5A 1T03A 3UFCX 3EWGA 2ZUAA 4A48A 1Y3KA 4WCEQ 2QMXA 2AU0A 1RDRA 4C0OC 4K0KK 2HVEA 4A8YA 1X5PA 3VGSA 2OTJS 1HYSA 5D6GA 5BR8K 5H1SQ 4CJVA 2CQHA 3JQMA 4F7VA 4K42A 1ZOTA 1J2VA 3MD3A 5AJ3J 4BCAA 3UE2A 3V81B 4JRQA 4LF9K 4CLFA 2FZGB 5F8NA 2FPHX 3GV8B 4G1PA 1CJVA 3FCHA 2WAQD 2ZHOA 1P9YA 1GEHA 5J2QB 3R97A 3BO4A 4IG3A 1Q78A 4WK1A 1R8CA 2MSTA 4QU6A 4RL1A 3CMEN 1APSA 3Q23A 4NEYA 2GVDA 4DLGA 3PSIA 1N33K 1GXLA 2ZWPA 3AB2B 3H4BA 3TWHA 1RSCA 4YS2A 3O6WA 1YVNA 3SK3A 3BEGB 4OYIA 1WAFA 4ISGA 5KFUA 3SCLE 3UDCA 3DI6A 4PWDA 2FLLA 3KLHA 3ADAC 3C6TB 4MTPA 2GV9A 2HQDA 4CM0A 2ABYA 4OZ3A 1Q8LA 3FQKA 4YB7A 1B0VA 4I2QA 1J53A 3CFRA 4ZJOA 3QWPA 1X0PA 4Y28C 1QUPA 4ED5A 2NRHA 4KHUA 3VQSA 2DR5A 1Q7YO 3CCRN 3CQXA 4ELTA 3LDQA 2XYPB 2H3GX 4TLRA 3HMJG 2B6AA 3HKZD 3P5TL 4DG1A 1BWVA 2CJQA 1NJWA 1ZA1B 4M3XA 4WQ4C 1C0TB 5GAGI 1WEYA 2KT5A 3AA4A 3O1BA 4YB6A 3CJ4A 3M8YA 2L9NA 1QVGM 5DDPC 2OPRB 3TAMB 4JI5J 2QL9B 4M63C 2EW9A 1S9FA 3KJQB 5C5JA 1KCFA 2FYXA 3HM8A 5DZ7A 3LP3A 4K0KJ 3CCEN 1VSFA 2DPJA 4BGBA 2HHQA 1FDDA 1FKOA 3LM9A 1JKHA 2HWIA 2RH3A 4CECA 3QFHA 6FDRA 1KD1T 4X84A 1RKJA 4RX6A 1RZMA 2FF6A 3V6KA 5KOWA 2RF2A 5E84A 2YVSA 4ZVGA 3DLJA 2E1PA 3LOUA 1JLFB 1K1QA 4DUZJ 5B09A 3HTVA 4LF9J 3OUYB 3CYMA 3JSBA 3PIOQ 1FNXH 3DGPA 2EWHA 3IS9B 4WTYA 3IN5A 5D77A 2GIFA 1XNQJ 2VQFK 3U4LA 4CF8A 2GFFA 2O67A 3LO3A 1TK5A 2FBXA 5M2UA 4KH4A 5ETKA 2GWJA 3DM2B 2ZVSA 1VRQC 3M9OB 4M3WA 1JJCB 4IDKB 2D0OA 3MF5A 3V6DB 3I9ZA 1ZETA 4CJRA 3S1TA 3DLHA 2KI2A 3CCQS 5HAOA 5DLGA 4E1JA 3J7YI 3I56N 3OYGA 5DGBA 1IBKK 1YITN 1T03B 1RAGB 3N79A 3TA2A 2PY5A 4LR8A 2F7TA 1Z1ZA 5LJWA 5D3GB 1Q5YA 3C14B 4M5DA 3NF9A 3KUEA 2ROGA 1N48A 4JI4K 5DQGA 2ZBPA 3L2VA 4JBCA 1VIXA 3V6HA 2YNGA 2HBYB 5DDRC 4GO7X 3P5JA 1N4LA 4BC9A 1IBLJ 4KGKA 5KPRA 4DR7K 2WOMA 4CZHA 3TRGA 4JS5A 1CJVB 1RTJA 4K5RA 4IOAL 5MLCV 3MUVP 2AEFA 4DSJA 2JC1A 3PYDA 4IG3B 1QHTA 2BABA 1RISA 3GYGA 3OXFA 1Y3JA 3NGSA 1X4BA 3F41A 5JVGQ 2BJDA 3F44A 2GEMA 1FCAA 1WSGA 1EARA 1UFWA 3PHTA 3VAHA 4JLHA 1UA1A 4CIEA 3NLCA 2NRVA 3PR4A 1J5EK 4EP4A 1KN6A 4GVEA 4FJXA 1KVIA 3BV8A 4OJGA 4FDFA 3TX0A 1REVB 1XMBA 3MCSA 3TA0A 2KN4A 2X1AA 3PR5B 3AOCA 4X4SA 2GQQA 4CJKA 1BISA 4JI3K 4NA1A 2VQFJ 1GX6A 1OPZA 3PFEA 1E4GT 4I2QB 3SCJE 3ENOA 2LKZA 4B9SA 4DUTA 4ER8A 4LF4J 3C15B 2FSJA 4H0OA 4Q45A 5C2CA 3A3NB 3TARA 5DJBA 4A47A 1IR1A 4CO4A 3BGLA 1D8YA 4B3RK 1R0BG 3I55S 1X4CA 2YH1A 2B6AB 4J9KA 3OYFA 3ZT0A 3POTB 2FSNA 2IVYA 3GJQB 2PIIA 1UJ4A 4MO5A 4GW6A 2R7XA 1R7IA 3FCWA 3SCXA 5M1PA 2QWRA 5F0XA 1IBKJ 1OPIA 3HLUA 1WF2A 2CGKA 1C1CA 3AA5X 1XC3A 1JJHA 1RILA 2HNYA 4JKAA 4A4JA 2YKNA 2IC3A 2CQBA 4Q7AA 4M5GA 3KWMA 3JYTA 2CQGA 1JKHB 5AT1B 1YHQN 4JI4J 4DV3J 4ZPBA 1UPMB 3ZZZA 1N34K 3W2VB 4EBEA 1H7XA 3CE8A 2N82B 4QR1A 1PSDA 1NGJA 1RAJA 1WEZA 3KD5E 3NMRA 4DR7J 3NCPA 5C0YA 4H4MA 3IG1A 2UP1A 2E1RA 3LDOA 3FSIA 1UTAA 3NF7A 3QIPB 2X7IA 1HA1A 4I7FB 3RMAA 1UEUA 4WYBA 4CEOA 3OTCA 1YAGA 3LDNA 4B1XB 1U1OA 1NK5A 1PYSB 1VI7A 5F0WA 4YQWA 3TSQA 2KRRA 2ZJQL 1ESVA 4ZK7M 1ZBLA 2LXFA 4TY8A 1AB8A 3IO1A 1UVNA 1T9YA 3G0ZA 2MQNA 2H1YA 4LVOP 2CPYA 1XNRJ 4FWQA 4B1WB 1LOUA 1RBAA 5AZIA 2HBRB 1K0VA 1HIYA 3ZT1A 4KSEB 1ATNA 4JEPA 3G25A 4JI3J 3ISNC 3OLAA 2CQDA 2V63A 3N5FA 3PLAA 1VAZA 3MM9A 1J9AA 4DV1K 1P90A 2D41A 4QW9A 3T5HA 4J9QA 4OJ1A 2VFSA 3C16B 4QJVA 3L0QA 1YRTA 1BMQB 2DTJA 2Z2ZA 2UXDJ 4FJ5A 5FLXY 5A2QU 1JLGA 3U8XA 3CCMN 4IO1A 1FESA 5EWEA 4ZVEA 3W7BA 1FKPA 1BQNB 4CFDA 4CEBA 1LQ9A 2MQQA 1J5OB 5JS2A 2OD6A 4FJ8A 3O3HA 4FM1A 4I2PB 2SXLA 2OGUA 3OYBA 1N34J 3OBWA 4B3MJ 1U0SA 5DMRA 1E6YA 3THTA 5GADU 4IWVA 5KFSA 3SFUA 4JKFA 2RE1A 3BF4A 5JLHA 2DR8A 2KHCA 1H38A 3KHYA 3WBZA 4OX9F 4DV2F 2HNZA 5AQWA 1S5ZA 4XK8C 4NX9A 3EL2A 5A6PA 1ITGA 2XMTA 3HSGA 4WF9Q 4FWSA 4X4QA 3HRGA 4N8NA 2BKNA 1XR7A 4M94A 3NE6A 1V3RA 3MDQA 1B9FA 1WKLA 4QPTA 2AWZA 3T1AA 1VQPN 1XI1A 3TP2A 1HHTP 5LOQA 1PKUA 1GXUA 2MKCA 4JI1F 2ROEA 1WSFA 4QS8A 1Q79A 4BRHA 1D0EA 1EQYA 4RW8A 1C1CB 3VEOA 1HHSA 5IWAJ 2KG0A 2HNYB 2VV5A 3QJJA 2YKNB 3FEXB 1M1HA 1LCUA 3KUHA 1Q81O 4MLEA 1CXUA 3H2LA 3RVCA 1KQFB 1WTBA 3DMJA 1A5VA 2RT3A 4O0NA 2XY7A 1WG5A 3PNIA 2JX2A 1AFIA 2JH3A 3IG1B 1UW9A 2DB1A 3KLGA 1CBKA 4CRJA 4RZRA 1KDNA 4KKOB 1SJ3P 2B43A 2E9ZA 1MW7A 4QIEA 2CPZA 5D0GA 4F3MA 5HMYA 2V7YA 3J80Y 2DY9A 3QFWA 5KQ8A 2OEMA 1WN7A 4PG4A 4BRDA 3IFEA 4OI2A 2MZTA 4Y65A 4C9DA 3IWLA 1NK4A 4X64J 3R2DJ 5EUHA 3IDHA 3EKUA 2LLZA 4IEEA 5DZ6A 3U1NA 2J6SA 2V94A 4Y2CA 2C3OA 1X1PA 1T3OA 3C3LA 3QEVA 4IQMA 3PKMA 1NHVA 3T1YF 3G8TA 1RT5A 4NLGA 4OZNA 5DRKA 5F9NA 1K8AO 4ED8A 4E1MA 1CSJA 2IDLA 5B0EA 4FKYA 2DNZA 2XS2A 4ED1A 1PIEA 3ETMA 3MAHA 4F4YA 4Z4IA 4JKEA 1SKUB 3ETOA 1TK0A 4OPAA 1KSPA 3EY1A 2ZH6A 3AGKA 2BZ2A 4RNOA 1BY9A 4WJBA 3D2EA 4DHVA 5JUMA 4FWPA 4LSNA 1U48A 3HXMA 2N4CA 3CJBA 5AFUA 4HTUA 4LT6A 5KOXA 3OYAA 7FDRA 1FKPB 4CJLA 4ZPAA 1EP4B 4TVAB 4ATNA 2EG1A 1Z25A 1U8WA 2G9OA 4X62K 1FJEB 1BD6A 2VJUA 5KFOA 2XO7A 1YKWA 3TABA 2VB6A 2GQCA 2C42A 2ZOMA 3CC2S 4YNQA 4ZVRB 4R5PA 4FJHA 3F73A 3MGJA 1FXRA 5ETRA 1KC8O 5EWGA 5GAEI 4KFBA 1RWKB 2W4CA 3K2PA 2V52B 4M5IA 3GE9A 1SS6A 4CHPA 4JI2J 4ED4A 3TQEA 3T1HK 4DSLA 4W5RA 2DH7A 2PZSA 2ZEJA 3K5MA 2K7JA 4CQ1A 4CM2A 4CEAA 5BRHA 2FJBB 5J1NA 2OELA 4HCBA 2VDHA 4CK3A 4MK7A 4EK2A 5HBMA 2EEYA 1RTDB 3E9OA 2XY6A 3EE8A 4ZP8A 3W65A 3DXSX 1YJUA 4UUXA 2IS3A 5AQYA 2NUUG 1AW0A 4ECRA 5K8PA 3VV2B 1VQ4N 1XJWB 1NWKA 4FBUA 3ZSXA 3H5YA 3UR3C 3SPYA 3OT9A 3KJVB 5AQIA 1SL1A 3WNGA 3HHNB 2WZ1A 5KT3A 3C66A 2KHDA 3GIMA 4P10A 4K0KF 1Q8BA 2JFDA 2LEAA 3WXMB 2QIFA 4OQJA 3G8SA 5BR8F 3DMJB 1RKIA 4FJKA 1PC4A 3DXKA 3IGNA 5CHIA 2FC0A 4E2FB 1NKEA 5T41A 3KLGB 3GJTB 1HFEL 4LF9F 4EBCA 3DRPA 3LWLA 4CJQA 5LT5A 2QA1A 1AFJA 1LKZA 3KYLA 1SKSA 2KT2A 2DTUA 5LJ5Y 1WORA 2RJZA 1S0VA 3RRKA 1OYEA 4X62J 2VHGA 1NGEA 2CZ9A 1RDUA 3VQ7A 4CGGA 1VMBA 3D54A 2DGVA 4XPCA 1HW9A 4H5RA 3CFOA 1Q0NA 4ZLPA 4DPOA 3J8AA 1ZAVA 4ZP7A 3J81U 4DQIA 4DUYK 3SZ2A 4QOTA 1DZ5A 5JVHL 5KFEA 4CLLA 5DM6L 5A8WA 1GK8A 4CZMA 3HPHA 1N36J 3T1HJ 3RSEA 2ASLA 1FTRA 2QFIA 4XDCA 5CABA 4CIFA 5BN9A 4ED7A 3G87A 4K4TA 2L48A 3H1VX 3I0SB 5CHCB 1BI4B 5AQJA 4WXOA 4KPCA 3QFPA 4C8LA 4WFAQ 3OTOJ 5CCLA 1DARA 1Y00A 3EM1A 3GU0A 2AV5A 2D0PA 3EXCX 2E7VA 3BKUA 3V1OA 4M5NA 3BZKA 1NGDA 2N7CA 4LF8K 5FPNA 3MDFA 3AO3A 2MB0B 2M4MA 3R1XA 3UDEA 4ZS6A 1M5HA 1GOAA 2O8FA 2QA4G 3RJMB 1BA0A 4KGVB 3CCTA 4B1VA 1EKEA 1M0SA 4LRBA 2GIRA 4RLEA 4MLHA 3VEVA 3SNNA 3AY9A 4DSFA 1RTHA 3MR3A 2ZJRL 1LFPA 4FBTA 3Q2TC 4FVUA 1G1XA 1MSWD 1RGVA 2BJ3A 4M7YA 3QNNA 3SUPA 4B1ZA 3ZYYX 4B3OB 2LQ5A 1IKWB 2YKOA 2MKJA 1NGFA 5FJ4A 2A42A 2QK9A 1B0PA 3ISND 1NDKA 2D1CA 2UUCK 2VQFF 3HSCA 2QMUB 3JSMA 5C24B 2HRYA 4C11A 1Y5NB 1JXVA 1VGYA 1VQ8N 4KH1B 1XMOK 2ZHAA 1JJ2M 1KLMB 4A8FA 4P2FA 3MEEA 1SIWB 4C1NK 2WTUA 4J8FA 2CKWA 2AYBA 4WIIA 4MT1A 3EEQA 1NUEA 1VQ7N 4CW7B 2V2KA 3MPYA 1M5PC 4W98A 2M3DA 3ZCMA 1IBKF 1A0OB 3WZ0A 2P9KA 4URQU 3MWTA 2GHPA 4ZMMA 2YKMB 1YJWS 3SJJA 4CJEA 3H3OB 3C46A 1P1LA 1UFLA 4B9LA 2I7NA 1EHWA 3NVKA 5H1SV 2HBKA 3ET6A 4JI4F 4DV3F 5M1QA 1VSKA 1X4EA 2HB5A 1SZ2A 3O6QA 3SJHA 4WU2A 2GBZA 3TZWA 4LF8J 2EBGA 3HP9A 2G2OA 3GFXA 4DR7F 4OYPA 4WTOB 3HHLA 2VD3A 1JXLA 3NGYA 4O3PA 3W61A 1M90T 3D6FB 2EC2A 4J90A 4XAKA 4F4AA 2O3DA 3SBMA 4FJNA 4FXWA 4EP5A 4GV9A 1VIOA 4RUHA 3RB3A 2GQ2A 3NMUA 3BB5A 5J2PA 3QEXA 3SMPA 5KPTA 2BGGA 3VQCA 2L9DA 1BGXT 4HT5A 4A8WA 4CO2A 2DH8A 1HJRA 4DR1J 1J5EF 1UMJA 3EX7B 2BMBA 4N5SA 1S76D 1UAXA 2G8WA 1NK9A 4A8QA 5A8WB 3L7PA 1TYQA 5EHHA 1NU0A 2DFFA 3PDNA 5J1PA 2FQQB 3OA9A 1RWOB 1RWUA 4NI2A 2UUCJ 4JI3F 5F1XA 2HF4A 4ZP6A 3T3FA 2JWNA 1GLEG 2YX7A 4FK4A 1LW0A 2I8EA 3BZCA 2L3MA 2ATCB 3MPVA 1IG9A 1XMOJ 2QX0A 4JK7A 3TVKA 1OY9A 4QWEA 5KT2A 3UE5A 2VA2A 4JI0J 2GHVC 2D4WA 4JN4A 3GILA 3J81j 4FF2A 4ECZA 2UXDF 1OYDA 4R79A 3QESA 3MN6A 2HZAA 2QLXA 2QV6A 1Z2LA 3VCDA 4YOTA 4MAKA 2QLJB 3IM9A 2XZDB 2C3MA 3QGHA 4X4OA 1MWYA 1EWQA 2PFFB 1N34F 1ZH5A 4L74A 3WNFA 3CCVN 2DISA 3DGVA 2GGPA 3KDNA 2KYXA 2GZOA 3UKUA 4OO1J 1QM9A 1ULRA 4LBHA 1ATRA 3N6MA 3LM2A 3L4QA 2HIYA 5JMVA 2X51A 4DQ8A 2JVRA 1TMMA 2OP5A 4ECVA 3JSMB 2R7RA 3CMQA 5CYQA 2DNNA 5CCMA 4C11B 2UV8G 5BN8A 1WSRA 4FYDA 3VVTA 2H5JB 3SQOP 1RTIB 4LFBK 3L2WA 3MM7A 2UZAA 4A8OA 4RW6A 4O44B 3V4IA 2E1AA 4F02A 2PEHA 1SVDA 5KT5A 1R3NA 2JFKA 2LMIA 1NXIA 3WNHA 3FJ2A 4P6QA 3LDSA 1TKTB 4RW4A 4BR7A 4DQSA 3J7YU 2XWYA 4QYZK 4BR9A 2CZVC 1NSKL 3BKFA 5LJVA 5GADP 5M2PA 1VQMS 4USIA 1ACMB 4E0DA 4P2XA 3SAHA 5IT4A 3ET6B 3FEYB 1Q95G 4NCAA 2P9PB 2GA7A 4TQRA 3PIPL 1S7IA 2DBBA 2VFVA 1R8BA 3VF0B 1Q9YA 2J0QD 3QICA 4CBXA 3BEXA 3HHLB 3TAPA 4Z7CA 1LOTB 2HRUA 2HIQA 4ZLLA 3M05A 2RMLA 3ITHB 3DLRA 2ACMA 3L2RA 2FTRA 2ZC3A 3ILLA 1Z4UA 2RDJA 4E3SA 2D7SA 1QHAA 4KGZB 1WF1A 1FD2A 4JK8A 3TR8A 4OLPA 4K25A 2MKSA 2XMJA 4X64F 5CYJA 1R31A 2ZM6K 2QL7B 2XSJA 2YWWA 1YBTA 2VKZG 4XTTA 1NNEA 2PD1A 3FGVA 1D9FA 1TUUA 2E5IA 5F41A 3P6YC 2IJNA 5ADXH 4NL5A 4NI2B 5L9XA 3AOAA 2RILA 4GKKJ 3PXGa 2ZH5A 4OLAA 3C7NA 3SMSA 2VH7A 2BM0A 4DL5A 3VETA 2F7VA 3RUBL 1U2FA 3KG1A 5CZVA 4CERA 5AXLA 3W60A 2OMOA 3AO5A 4LFBJ 4KV8A 1YRUA 1ASWA 3HD2A 3ZETA 4UQGA 4ECXA 3OXGA 2P6TA 3KHRA 4PXCA 3E2EA 3TZYA 1NH8A 4NB4A 4O55A 1P27B 2HLUA 2KRBA 1SH0A 2J9EA 1JCFA 3VEWA 2HHWA 4L72B 2CADA 4FYWB 5LY3A 4DFMA 5LSLA 5D4PA 4URGA 5KT4A 2IAJB 2Y1JA 5K8MA 5HQLA 2BTFA 3MMCB 1EETA 1NKCA 4CNYA 1S79A 4QYZJ 3Q2SC 2G8FA 2HVIA 3HFVA 3HM9A 2WW4A 3WQPA 5AZJB 2ZHBA 5HQMA 2A2CA 1GLBG 2NLXA 2O8CA 2GGPB 2GX9A 2WBMA 4WFXA 2JLGA 1JLEB 3UKUB 3T9NA 3CJ3A 3C95A 2CG4A 3K9JA 4ZVHA 4DV0K 2F96A 3AD7C 1RCXB 3VAKA 3PW2A 2O8BA 4X65K 2ZE2A 3V9XA 3M3ZA 3BN4A 4JI2F 3KKFA 4F3OA 5A2QY 1SAZA 5CYQB 1X4HA 2HGNA 3H5XA 3CC2N 2X6NA 4X2BA 2IM2A 1V5VA 2NCKL 2RIJA 5K9FA 3IBWA 1VRUA 4KAZA 2ZM6J 5IT0A 3M6VA 3NGIA 3GFZA 1K44A 3ZO7A 2Q3PA 1GMUA 3AD9C 1N0VC 2R4FA 2P5VA 3OL6A 3AVJA 3JSYA 3V4IB 2QI2A 1TUGB 3FRYA 4DV5K 1X5OA 5KG2A 1X31C 3MOJB 4HDGA 2HSEB 2BM1A 2DK2A 4S0MA 3EO3A 3NG8A 1HBUB 2L9WA 1WWHA 3MCOA 2LQ9A 4Y6IA 1QY7A 3OTEA 3OY9A 5THWA 4K8ZA 4WYWA 4CGFA 3LGNA 2DPNA 2BBEA 4Z2XA 4NE9C 1RFQA 3VR1A 3TA1A 2UXCK 1TU0B 3L4BC 4E7JA 3DYAA 2JZ5A 5J2MA 1A5XA 1HPZA 2N4DA 3G82A 4B1YB 1QDUB 4UZCA 4J5OA 2OH2A 3LP2B 5AQVA 2BEFA 1YUWA 4TN2A 3E8OA 1QUVA 3SSRA 3CCLS 1GLJO 4FK2A 3KHLA 4OV6A 3VA3A 2YKPA 1UL3A 4JHDA 4LBPA 4OYZA 4X62F 5GIPA 1MWZA 3I31A 2CXEA 3SAFA 4I68A 1GTEA 2XSJB 5F8LA 4BDPA 3FQLA 4BS2A 2YH0A 4BE0A 3M8WA 3OFGA 1Y7PA 2OYQA 5C2GA 4AL5A 2M7SA 2FLOA 1NDLA 4NRUA 3Q86A 2F3JA 5HJXA 4DV0J 1T11A 2R9LA 1MNEA 2CPEA 3BSNA 3O1WA 4X65J 3TJ9A 1M90O 2D9OA 4NLSA 2X3GA 1U2RA 3THYA 4AILC 3AVGA 2CPDA 3T1HF 4K43A 3G6VA 2E1YA 4I56A 1F21A 3UVJA 1KTQA 2CGJA 3GR0A 2V4QA 2GUIA 4O0IA 2NPIA 3AFGA 1KOOA 1YJNS 4KAIA 2G8IA 4F0HA 2DITA 3OLBA 2YNHA 3KLIA 2D74B 3GG4A 4LFCK 3DDNA 1YG0A 4M5KA 3R8EA 3H25A 2C2RA 5D8HB 1GTHA 3CC4S 1Q82O 2PMZD 2NSBA 3EZ5A 2P8IA 1X8DA 4IUFA 4GV3A 2F1FA 1EETB 2R7TA 1XWLA 3GE1A 1YI2S 2WVDA 4DU8A 4DU4A 1AUSL 2E2OA 3T19A 3G96A 1N32K 1WSEA 3VF6A 2HRTA 2QYGA 4LC9B 5I3QA 3K5NA 4KH0B 1C4CA 1RBVA 5IT9Y 2Y1IA 3GQCA 4C6AA 1YJ7A 3QIOA 3CD6S 3D1OA 1FRXA 1IWAA 2UUAK 2P9GA 4NLBA 2CNNB 1T7PA 2HMIA 1MDUB 2J8SA 1G99A 1FHTA 1IJFB 1C1BA 1Q7LB 4Z37A 4KJIA 4IOCQ 2GX8A 3DOKB 4PWUA 1XBWA 4WFBQ 2XSFA 4C4WA 3QRRA 2EBEA 1C0GA 3AV9A 1FK9A 2B3TB 3HT3A 3A5NC 3FDSA 5CE3A 4JI7J 1TL3B 2OTLS 2E6MA 2CQ3A 3W3SA 1TV6A 2XMWA 3HDSA 2W41A 3PM9A 2JEJA 3AAPA 2PYLA 5HL7L 5EX3A 1YWXA 4NLCA 4O4GA 2B7CB 4RBTA 4DUYF 4A8KA 1ZC6A 4B3TJ 5KFQA 1AT1B 2XCPA 2OSQA 3T41A 2CJXB 4ELVA 2V68A 1X4AA 3HI9A 2G4BA 5LMUK 3CCWA 3VZHA 1D5AA 3MUMP 4C7QA 4J9NA 3G71S 1HPZB 1VK3A 5FPEA 2WFBA 2HFOA 2VFRA 4OZJA 1S9GB 4ES3A 3G6YA 3TQ1A 4LF8F 1YJWN 3M2VB 2E6LA 1DAXA 4DB3A 2H51B 4MJKA 3SQ1A 3HSJA 2P5GA 3VPZA 4QZVB 3RAMA 2ITMA 3G8QA 2UVVA 1U6ZA 3PX6A 4CHQA 4EYIB 1WOPA 3D6RA 2B4JA 2PMHA 4CO0A 3HSZA 3H2VE 1KFDA 1NLKL 4M3UA 1HRHA 4FO0A 2UUAJ 3A3OB 3MEKA 2VPZB 3VGMA 3J81O 2PGCA 3H98A 4DF8A 4CLUA 2QWOA 2HHSA 3ZFVA 4HL9A 3D6MB 5CH7B 4DPYA 3IAYA 2UUCF 4MKYA 1RWNB 1WKJA 3R5CA 2G13A 4GRSA 3UVJB 4FSVA 1CS4A 3VAJA 4AHSA 4HHTA 1YF5L 5HN0A 2W9CB 1XMOF 3R2CJ 3BF3A 4MKVA 2YNHB 3KLIB 3ZEUB 3CB4A 4LF6J 1TR0A 4ZJQA 4DOZA 1OWXA 3QBXA 2YJFA 2PSZA 3UQSA 2WW8A 2GMLA 2RHSB 4FLVA 3RTVA 4Y0FA 2FSKA 1HLWA 2FUG9 4U67L 3LH2S 3SMZA 3N4PA 4PYAA 3HPGA 3GCWP 4UW2A 5K5MA 2AX0A 1RACB 2MQMA 1IR2A 2HMPA 2E1ZA 1TVRA 5LMUJ 5C12A 4C3LA 4M3ZA 4NYNA 4Q2LA 1VLOA 1EKSA 1RBOB 2I6WA 2KYZA 4M5HA 2A18A 1EQ0A 2DIUA 3NVMA 1WC0A 2FHMA 4IO9L 2HHUA 3ZSWA 2E29A 4H0YB 1FX2A 4EFAC 5IC6B 2YWEA 4CH0S 5DETA 4M41A 4AYBD 1DFDA 1NPKA 4QIWD 3ZXWA 1VQNS 1TV6B 2OSRA 4Z4CA 1Y10A 1O13A 4P74A 3LPEA 3UIQA 2AJ4A 1XMQK 2H5IB 3P38A 4EO6A 1T05B 3MMAB 2RB7A 5A76A 3MWPA 5GAGP 4DR2K 4CHOA 5LSRA 2H65B 4QR0A 3WC0A 2I7PA 4PL7A 2I1RA 1SKRA 4IRCA 3T69A 4CEDA 3Q7BA 2XHCA 2HBZB 3JTNA 3AT1B 4U8YA 3X3UA 2D5RA 4E7HA 4I4BA 4F25A 4ILRA 1IJEB 2W2NP 5B0DA 3LDPA 4BG9A 1XQIA 4BBYA 4N47A 4DTXA 4OZLA 4BHQA 3CXCM 4K59A 2Y0SD 1SJFA 4FNIA 3TSUA 2W8KA 3PHEA 3KWGA 4CYUA 5K8NA 3BGOP 4N77A 1N0UA 3GONA 1S1VB 3TZZA 1TZ0A 1KS2A 3KMSA 3OVSA 4O5FA 1T6CA 2J8AA 4YY3K 3I8DA 1BQMA 2C2NA 1VQMN 4PXBA 1HBMA 2D3UA 4BC5A 1WNEA 1MLAA 3CJCA 2LEPA 4ID5B 2X1BA 1HQEA 2FBTA 4H4KA 2RUSA 1VC0A 4UY8T 3D0HE 3R9LA 4RNMA 1N6QA 1RBUA 1XHZA 2E2QA 2F9JA 1VS3A 3EJMA 1B4SA 5M2RA 4QBUA 5CZXA 2RD5C 3J7YP 3DXBA 3WDOA 4OI6A 2ZJPQ 3R5BA 4IDHA 1M5OC 1F5AA 5IM0B 3BGRB 2WC9A 3R7NB 2GMJA 2KVIA 2XM3A 1UVIA 3N0VA 1GMVA 4OYAA 4IG0B 2O4IA 2O8EB 3MXMA 3S3MA 3AO2A 3QB0A 5HROA 1L3UA 1S6PB 3K5OA 5BXIA 2ROPA 3WXKA 1X9SA 4R8UA 2E44A 1RYSA 4WCEL 4LFBF 3WEEA 1C0UA 4DCPB 1XMQJ 4IFVB 3GG0A 3Q83A 1HD1A 2IYIA 4DR2J 3UR0A 2RKIA 4CEQA 2GTDA 1WEXA 2RDIA 5H9EK 5DM7Q 3PKYA 1TELA 4UT4A 3ULEB 3KLVA 2X78A 3B82A 3VQEA 3A8IA 1UOCA 3IAS9 1N54B 3CDEA 2F8TA 3HHKA 2PEBA 2H3EB 1WAJA 3NBPA 2MKYA 3I87A 1XIQA 3TTDA 1Q53A 4DDFA 4YORA 1TVRB 4FYXB 3ZTOA 3CD0A 2DNGA 2EI5A 3T5KA 5ETLA 2RRAA 3Q89A 3K17A 3BZQA 4JI6K 1LWEA 2HS0A 3M8PA 4Z4EA 3H46O 3W9JA 1PGZA 5B0BA 2AGPA 4HTJA 4P75A 1JWWA 2XNRA 4YY3J 1T9XA 4E8UA 4BC4A 2CQ0A 5EDWA 4Y3CA 1KVCA 4CZGA 5E3PA 5L1LA 1XR5A 1H2TZ 2NQPA 1JIHA 2UVRA 4CIGA 2EKYA 1VQLN 3UI3A 4ZP9A 2XMAA 1QJHA 3JQKA 4UF4A 3RB4A 1RTZA 2OJ3A 4XPEA 1GMWD 3MTJA 1HNXK 2ZM6F 1I39A 3ENHA 1KFSA 2VG5B 3H4DA 4QW8A 1GXTA 4KTZA 3D3CJ 3GJSB 3SAGA 4DTJA 1EQMA 1F5CA 1HUXA 4TNOA 1KRPA 1O1WA 4WFYA 3MAAA 4DV6J 2M9KA 4FPIA 1Q18A 4Z4GA 4M3TA 4EHUA 3MM6A 2UUBJ 3CJKA 2XHWA 3LPYA 4RG8A 1FVQA 1HR0K 1AUDA 3NS5A 4PPDA 4C0HA 4H54A 3DLEA 4CYUB 2H4YB 3IRWP 3A0IX 3RU0A 3KDOA 4YB5A 1CPZA 4JKBA 3JXUA 4KHMA 5H9EJ 1YT3A 2MGZA 2KZZA 2R8KA 3AVBA 4ITSA 3VWSA 3HO1A 4X4PA 5FPDA 1RLDA 2YTCA 5A6WA 2QT7A 3PIOL 3S6EA 3KK2A 1N6QB 4LVNP 4GVMA 1QVFR 4NYPA 3D66A 2WB1D 5GMDA 2P9UB 3HVAA 4PQUB 4C8OA 3QEWA 3CCLN 2NXNA 3TJ8A 2XY5A 4DV0F 3DU6A 2WVFA 5KFZA 1OVQA 3GSDA 4U95A 1S9EB 4X65F 5AQTA 4L3NA 1LW2B 3T5LA 3S3OA 4CFAA 1JQGA 3RMCA 5HROB 2XMUA 4P71A 3ZZTA 1BC6A 5DG7A 4EHTA 3L3VA 3MM8A 1DQ8A 2ZH9A 1PYTA 1U2CA 4FN5A 3O4QA 5L8RC 4R8UB 2NUBA 2YX1A 2E9RX 4CJ3A 1HNXJ 1C0UB 2ZGYA 2WVEA 1HMVB 3KK3B 1RHRB 3QLHA 5AE2A 4ZIWA 2XGPA 4DLEA 1JLAA 3QATA 3GFYA 1PBAA 2R8JA 5KPZA 4DV5F 2OLWA 4DMZA 4QWBA 2IA6A 2JEIA 3CPEA 1JX4A 5M1OA 3KOAA 5KFHA 1GLAG 4DR6J 3CSKA 4J9PA 2Q2RA 4BR2A 5KGXA 2DPIA 1KKHA 1YJNN 2CPXA 1DQ9A 4MIWA 4RBVA 4KH6A 4CF2A 4DS4A 1DGKN 2W9BA 2QZ8A 2HBQB 1UWAA 1KQSR 3D68A 3CC4N 1HI1A 3F0NA 1REGX 4OL8A 4ECTA 1TTHB 2ZZMA 2BKOA 7FD1A 4DR3K 3CDUA 5JVGL 2D1KA 4A5BA 3IUCA 3U3GA 2FIUA 2BQUA 2Q97A 2ZBRA 4ILMA 3J80U 1WG4A 2A6MA 4EYHB 3ZZPA 2WUSA 1SJQA 3E1YA 4ZVPB 5JS1A 2O66A 1NO8A 5LXYA 3CD6N 4RCHA 4CZCA 4PKGA 3LPTA 1TKXA 3K9KA 1YGYA 2EFVA 1T8EA 4CD3A 3J7ZT 3FFIA 5JXSA 3EDQB 1F1BB 3ENBA 2DCLA 2ERRA 1TKZA 3E01A 5DGAA 2Y1LB 3BQ0A 2ZBIA 2HHVA 2IPOB 5C2FA 3CVKA 3CJ8A 1CJUB 2UVWA 3WQUA 3M30A 3D2FB 1XK8A 1U0HA 4LRFA 4YOEA 1G7CB 4OX9K 2Z56B 4B3TF 3ZX0A 1YVUA 3W9HA 3FK4A 3NAHA 2OTLN 3D5MA 3MM6B 1VOMA 2BA9A 2VPYB 3OS1A 3U02A 3DLEB 3I8BA 2DNMA 5F8IA 2ASYA 3SEOA 2DNLA 3V6JA 1WTFA 1U4BA 4Y1DA 1Q9XA 4OI1A 4DSKA 2Z4PA 3CJSA 4LFCF 3TO8A 1HKCA 3RRGA 4OI0A 1JJ2R 2DNRA 3CJ5A 2MGZB 4WQ4A 5CAAA 5AFUH 5GAHI 3I5AA 2AF6A 2QW9A 4FPRA 3Q8PB 1VC5A 4IR9A 1UZHA 4M63A 4NZ6A 1WB9A 4CI6A 3SDEB 1JCGA 2V0NA 1CJKA 3NEKA 3KK2B 3G71N 4RPFA 4K50A 2DGXA 1N32F 2KB2A 2D3ZA 3D67A 3BBBA 3HFKA 3P4UB 4PR6A 4MFBB 3IC1A 2NNWA 3P39A 2CQIA 4PUOB 2MYFA 5E3AA 1WHXA 2F5GA 5CYMA 2UUAF 3PX4A 4RBUA 5I3UB 4NRTA 3V81A 3MEDA 1IKYB 3CCZA 2RQCA 3UCUP 2KM8C 3A12A 2ZDOA 3DLKA 2BH1A 4DR4K 3OL8A 1LAVA 4JKGB 3MM8B 2BANA 2OPQA 4FXVA 3I0RB 3DOMA 5L1KA 4O4RA 4L76A 3RB0A 2HEKA 2QC3A 1YK9A 5BYQA 3LP0B 2XQCA 3PUFA 2EK1A 2RDDA 5KFAA 1T02A 2IYGA 4FK0A 4LH4A 2MQPA 4FYYB 2G8VA 4CJ5A 3S9HA 1OY8A 5E3CA 2OPPB 3SYZA 3UWTA 3C6TA 5HRNA 3QT8A 1WI6A 3FKBA 1FDAA 3MECB 4J2AA 3GIKA 2J4RA 5D0HA 2HFUA 1PJ5A 4B9UA 2VG6A 2CAJA 4P2SA 3NGTA 2W9BB 3EVOA 3OHAA 1WD6A 3CCJS 1RT7B 1CULA 5LMUF 2OZMA 4WIQA 3GIJA 3AA2A 5GAEP 2QN6B 5C15A 2R2RA 2IHR1 3PRVA 4I64A 5AJ3K 3FBBA 2VPWB 2DGTA 3C2PA 1R89A 3H2UB 3OV7A 3P96A 2B9WA 2LECA 2A6AA 3BREA 1TL7A 2CH6A 3JAMO 4FJJA 4KB1A 4GY2B 1YJ9S 4XH1A 3RZAA 4DTUA 2MLZA 4CF9A 3R5DA 4ELUA 2N3LA 1R6YA 2HS4A 1SPBP 2VGMA 1HYZA 1TKXB 4DQQA 3RG6A 3NWGA 3VESA 4BLGA 1TL5A 2KZMA 2MHNA 2RHKA 4HUFA 4BDZA 1L3SA 4ISEA 2QRRA 1JLFA 1NOZA 5EVZA 1RAOA 1NSPA 4WF9L 1JNRB 4OKJA 3OUYA 2J0XA 3V5RA 3GG1A 4P7TA 5HANA 3AVFA 3AVIA 2FB0A 2VWBA 1DQAA 2HNDA 4ZOSA 2N7YA 3KVGA 4JV5K 4Q8EA 4MH8A 2J9DA 1VSHA 1OH6A 4FW1A 3QMQA 2ATLA 1E6VA 2IVOA 2Q79A 2HHTA 4IDKA 2Z57B 4YDXA 4F0KA 1FRMA 1I94K 3V6DA 2P5OA 1K73O 3VMFB 2P9EA 1SL2A 1WC5A 3NF6A 1DT9A 3R5JB 4ZPVR 4O3QA 4JI5K 2DGUA 2N3OA 4MK8A 1P6TA 1CJKB 2HFVA 2COLA 2OZSA 3GV7B 5D3GA 1RHQB 2LXUA 3NF8A 3C14A 1X60A 2BYCA 2GJFA 5HVGA 4RUCA 2DYAA 5KFCA 1WHVA 1X4DA 4UQTA 3F2KA 1KXPA 5CYMB 5FROA 3DLBA 3KK1B 1LXNA 1FJGJ 5EN1A 4DUZK 1RT2B 2DY1A 2K2PA 1YX2A 4MDAA 2MQ8A 2P2CB 2O4GA 3MEDB 2DO0A 3WIVA 4HR2A 2Z2YB 4DKWA 5TKWA 3DLKB 2GMHA 2HVDA 1XNQK 5G0RB 5C2DA 2ZBQA 1RUSA 3K59A 1VQ5S 1M1KT 3M4XA 4X66J 4DF4A 4YEAA 2BANB 2OPQB 2QKBA 1IM6A 3DOMB 3L3CA 2FD2A 3F9MA 1FF2A 3FCVA 4WQ5C 4DV7J 3THWA 2NRTA 4CP5A 2B4VA 5CY4A 2E2PA 1Q86O 1XMQF 3EXYA 4L6V3 4DR2F 3UN3A 2ZF5O 4JKCA 1REVA 5KTQA 1S5JA 5IQ6A 5L1IA 4XEIA 2E7WA 4AXIA 2W1BA 2K06A 1NNDA 1Z2ZA 4CFBA 3KWIA 1JLBA 2FGCA 2VG6B 4JV5J 4N56A 3C15A 1CULB 2BE2B 4EWTA 2JJ4D 4X4RA 2ALYB 3S41A 4KE5A 3TNVA 1LNQA 3N4WA 1I94J 5H9FK 1LK5A 3POTA 1IBLK 2J9DE 1WJ9A 3HHDA 1K9MT 1TL7B 2IVNA 3UCGA 3O3FA 4ZVFA 3CJ2A 4YY3F 3GTYX 3SQGB 2VU5A 2QTWA 4DJBA 5HRPA 1TL1A 2K3IA 1F2GA 3CDAA 2Z0GA 5GVQA 4KO0A 4BACA 5KT7A 4J9UE 1NBWA 4JKHA 5B0GA 3SBTA 2A1RA 1ASUA 4WYLA 3QEPA 5EOYA 2E66A 3CJRA 3QZ8A 3P4IA 4ISFA 5RUBA 4OYMA 2W6KA 2DHSA 4HCCA 2W9AA 3W2VA 1ZBUA 2M0GB 2DGSA 3B78A 3MTKA 3W3DA 1X3NA 3VGTA 4Y1CA 4E1NA 5DO2A 2JC0A 4O5BA 2FHJD 4OPKA 2KXHA 1YDLA 5FRMA 3ZSYA 4JI8K 3QIPA 4I7FA 4NOHA 2HNDB 1S49A 1IUJA 2ZNYA 1G4CA 3SQ2A 4GNIA 3MPDA <