1RT1A

Crystal structure of hiv-1 reverse transcriptase complexed with mkc-442
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
539
structure length
538
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Complexes of HIV-1 reverse transcriptase with inhibitors of the HEPT series reveal conformational changes relevant to the design of potent non-nucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 147
structure length 538
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt1A05
2RKIB 3PZPA 3NAIA 5C5JA 4FLTA 1WSFA 2HHWA 3I5CA 4Z4EA 3PVXA 1NJXA 4J9LA 4WFXA 3K59A 2VA3A 1BCMA 3LANA 3AA2A 4I2QB 3KK3B 4URQU 3NHGA 3T5KA 4QWBA 2ILZA 1S9FA 1WSJA 4RZRA 3NMAA 4FJMA 2YHBA 2EC0A 4IH5A 3G86A 2YKMA 1GOCA 2O4IA 5KT6A 1WNEA 1S1WB 4JUZA 4R5PA 1VSDA 5J2NA 2JLEA 1RAJA 4ECSA 3V9ZA 4IG3B 3VN5A 4DSEA 2F8SA 5DQIA 1XR6A 2OPPA 2HNZA 1J54A 4RW4B 3AVHA 4AH9A 2FVSA 4TYBA 3EZUA 5L1KA 1RTJA 4ZHRA 4DTJA 4ED1A 3OJUA 2R8KA 3CG7A 2ASJA 1RT3A 3AO4A 4AHCA 1HYSB 4J9NA 2HNDB 3KLHB 4Q0BA 5KT3A 2WOMA 4K50A 4Q45A 3V1QA 2Z1GA 2YKNB 2X6SA 4E3SA 3QGGA 3MFIA 2IC3A 1SUQA 4CJEA 5KFFA 5KI6A 3M8QA 3FQKA 5EWGA 5HBMA 2VA2A 1HNIB 5JS1A 5DG7A 5KFVA 4E7IA 3V9XA 4NRUA 4O4GB 3MEEB 5L1JA 3BREA 4YNQA 2KQ2A 4B9UA 2QKBA 5L9XA 3MTKA 2E4LA 2YNGA 4I7FA 4EBDA 4ECWA 3NGZA 4F4ZA 4NRTA 5KFRA 2J6UA 4FLZA 2OZSA 2XC9A 3RTVA 4CF0A 3V1OA 1UWBA 1RTDA 1Z26A 3I0RA 2IAJB 1N5YA 4O3QA 5KFAA 1RT2B 2Y1IA 3CFRA 3LAKA 4CJ3A 3AVFA 3HSTB 4NCGB 3PR5B 4OJRA 4FJXA 3EYZA 5CYMB 1WLJA 2HB5A 4FCYA 1JLAA 3KNAA 3KK1A 4ID1A 2YNHB 1GX5A 1ASUA 5F8HA 5HRRA 3CDUA 3V81B 4TSXA 3BQ2A 2D5RA 5KFXA 1VSLA 3MEGA 3AA5X 3DLEB 2YNFA 1RDBA 4DS5A 3ZSWA 2ILYA 3HVTB 3MECA 1YT3A 1S1UA 1ZBIA 1G15A 1BHLA 3ISND 3IGNA 4RW8B 1S9EA 3QNNA 4B9TA 3OYKA 1RTIB 1GX6A 3S3OA 4EP5A 4ZPBA 3TAQA 4FJJA 2FBYA 1B9FA 5J2PB 4U6PA 1ZBFA 3RB6A 1TGOA 3M8SA 3TAMA 2FBTA 3G10A 1KVCA 4F4KA 2AGOA 1S1VA 3V6DB 2QV6A 4M41A 3N6NA 2DFEA 1LWCB 1T05A 3PW5A 4NLYA 4AHSA 4AHTA 4KPYA 5CZ2A 3I0SA 3DLGB 4IDKB 3CJ5A 3RBDA 3L2VA 3AO3A 3PHEA 4DTUA 2FVQA 1S49A 2XY6A 3PO5A 2C2DA 1IKXA 1CZ9A 3PJXA 1U04A 4URGA 1C0UA 4OL8A 4ZP8A 4N56A 4K4YA 2E6MA 4FJHA 3THVA 3H5SA 4M94A 4NLVA 4WXWA 1UA0A 5C42B 4JRQA 4DU4A 2HWHA 3SI6A 1IKWA 1VRUB 3OYHA 3M9NB 1RT6B 3L2QA 1NJZA 4M3ZA 5KFLA 2BE2B 4OGCA 2FVCA 2A1SA 4IFVB 2BRKA 1RYRA 3V4IB 3GIKA 3CM6A 1TKTB 3AVIA 4ED6A 1QUVA 3QNOA 4Z4CA 3C6UB 4KHNA 2JEFA 4DQRA 4ECXA 5I3UA 5HLFA 5HP1A 2DFHA 1L5UA 1D0EA 1C0TB 1CZBA 4FJKA 1RA7A 4ZP6A 4B3OB 1A5WA 1RBVA 3DMJA 1S1TB 3PJWA 4WYLA 4CJRA 2R2UA 3U6FA 4E7HA 4CEEA 1RBRA 1SL1A 3AVCA 4DLEA 4O44A 2ASLA 5EWFA 3ZT1A 4DL4A 4EYHB 3OYJA 1JLGB 3IGVA 4ED0A 1VSJA 3D45A 3DLBA 3IG1A 1GOAA 4CGHA 5E41A 5J2QB 2ATQA 4RU9A 3Q8SB 3KHGA 4CEZA 2VWKA 4DMNA 3HL8A 3V9WA 2RKIA 2WONB 2ALZA 4IRKA 1XHZA 1XR7A 4HVJA 4W5QA 4PUOA 2DFFA 4EP4A 4CESA 3GQCA 4AHVA 4EZ9A 4L8RB 3PW0A 3C6TB 3O4NA 4KKOB 4LSNA 4PA1A 1EETB 4I2QA 4NYZA 1LWFB 3PX6A 1L3VA 1RDAA 2GBZA 2R8JA 4OVLA 4BE0A 2AX1A 1S1WA 3KLEB 2Q3SA 1B92A 3G6YA 3H5XA 2IOCA 5EWEA 4I9QA 3OYIA 4DSIA 3OYGA 4J9SA 1T8EA 3PUFA 1F21A 2D0CA 4RNNA 4R8UB 4CHNA 4G1QA 5KFHA 4ELTA 1EX4A 3O4QA 3LPUA 4WZMA 4KI6A 3C95A 1UAXA 4B9LA 3FSIA 2BQ3A 2FJVA 2QE5A 3I5AA 2IGIA 4ZTFA 4TY8A 3CVKA 4CJ4A 4RUAA 2HNDA 4KB1A 4Z0UA 2YKNA 1TVRB 4DFJA 1S10A 4K4WA 4FM1A 4E89A 1LW2B 4KHRA 4QW8A 1B9DA 1TK5A 3LAMA 1C2PA 3NF6A 4GMJB 5JS2A 1BGXT 1HNIA 4HUEA 4RW9B 3UPFA 1J5OB 3VQ7A 1IG9A 4O4GA 1TAQA 3MEEA 3ITHB 4DSKA 4J9RA 4IG0B 2KTQA 4DFPA 5FRNA 4Y1CA 5C24A 1BQNB 3K5OA 1S48A 3SV4A 3ISNC 2G8VA 4AILC 2HW3A 3Q8RB 3QINA 1WAJA 1RDDA 3QEWA 3TARA 4LSLB 3AO2A 5KFDA 1NK7A 2JEIA 3AV9A 4WE1B 3G0ZA 4DTRA 2FVPA 4F2RA 4Q8FA 1W25A 5KFJA 4O0IA 2IAJA 4FK4A 4CJ5A 1WSHA 5J1EA 3NCIA 3KKRA 3QEXA 4K8ZA 3BGRB 2ATLA 3AVNA 4NCGA 4EYIB 4CJTA 3VQQA 3V6JA 3DM2B 4MQ3A 2YNHA 2VG5B 4CGIA 4QWCA 4TY9A 3P5JA 3KKSA 2YNIB 2C2EA 3HVTA 3H5YA 4CHZA 3OYFA 3O3GA 4KHWA 4YP3A 4BDYA 4B9VA 3CO9A 1BIZA 4Z4HA 4F4WA 4DWIA 2I5JB 1BQMB 4FJLA 4MK8A 3PX4A 4E19A 1RTIA 3KLFA 1N4LA 4CIEA 2XY7A 4QOZB 4DTNA 4M3RA 3KK2B 3VQSA 2E9RX 1KSPA 4RG8A 3PV8A 4FBUA 4FLXA 2GC8A 3H4DA 4OLAA 3ZT4A 5KG2A 5F8MA 2P5OA 1ZTWA 4IH6A 1MU2B 3V6DA 1RTHB 1LWCA 3RAXA 3PW2A 1S5JA 5FROA 4IDKA 4BDPA 3BJYA 3F9KA 3PO4A 5CZ1A 4PWDB 3MF5A 1U09A 2E6LA 3K5MA 1I6JA 1EXQA 3MXIA 3O3HA 1N6QB 4XPEA 1RYSA 4OPKA 3CJ4A 2VWJA 4QWEA 4FJ5A 3KHLA 4FM2A 3SFGA 1SH3A 1LWEA 3E51A 4LQ3A 3K57A 3ZSXA 4CEFA 5C42A 4PQUB 3D5MA 1J53A 4TLRA 3VA3A 4DTPA 3UR0A 1VRUA 1RBSA 3VQ8A 2QKKA 5F8NA 3HM9A 3DRSB 3T5JA 1HQEB 2BE2A 3BSOA 4DL6A 3TANA 3RR8A 1T7PA 4IFVA 3K5NA 1SKRA 3RMCA 5FDLA 3V4IA 1QAIA 3MEDA 3H59A 3QZ7A 4LY7A 4IKFA 4EO6A 1TKTA 4DQPA 2JC0A 4AHRA 1BI4B 1JLEB 3NGIA 3C6UA 1JL2A 3ALYA 4ZPCA 4J9OA 1SV5B 1NK4A 2Z1IA 3AA3A 1BIUA 3RRGA 1YTUA 1C0TA 4EO8A 3JSMA 3M8PB 4FLUA 4GC6A 4FJGA 4NCAA 3LP0B 3PR4A 4TN2A 4NLTA 1RBTA 1S6QA 2XGPA 2F8EX 4ED2A 4KBIA 3L3UA 4HUGA 1TQLA 1S1TA 3SYZA 4W5NA 4XIUA 5KFTA 5F8GA 1W9HA 4O3OA 4N47A 5KG3A 1A5VA 4CK2A 3HT3A 3TAGA 4K4ZA 4IQXA 1U47A 4GVMA 4ZP7A 4KFBB 1JLGA 4MFBA 3Q8PB 4CK1A 3QIDA 5J2QA 4B9NA 2E9ZA 2WONA 2W9BB 4J2AA 1FK9A 1QAJA 2F8TA 1VSFA 1GOBA 4MKBA 5DLFA 3AVBA 3C6TA 3VQDA 4KKOA 1QSLA 1EETA 3SUPA 3NAEA 1LWFA 3NKYA 2FVRA 3OS0A 4CF2A 1WSGA 1JLQB 4UQGA 4CJWA 1FXXA 1IH7A 3KLEA 3HKWA 5D3GA 4U7CA 3VQ4A 1XI1A 2OPRA 4ICLA 4ID5B 3RB0A 3L3VA 2E9TA 4KSEB 4KV8B 1HRHA 3CJ0A 2XY5A 2V4QA 3LP2A 4RNMA 1WSEA 4C8MA 1JKHB 4MIBA 3EPIA 1L3TA 5KG5A 2B5JB 1D9DA 1KLNA 4B08A 4QCLA 4OLBA 1TL1B 3CYMA 3V6KA 3IAYA 1OS5A 2HHVA 2P1JA 3Q8QB 4NLGA 4K4TA 1TVRA 4DEZA 3QETA 1DTQB 4DG1B 2CJQA 1VSIA 3SJJA 4ZPDA 1RT4B 3K58A 1FKPB 3GV8B 2R2SA 4Q43A 3GV5B 4CEQA 2ASDA 4RW9A 2Z1HA 3CJ3A 3RBEA 4CGGA 3OYEA 4FS1A 4ECTA 3SQ4A 2FLPA 5DQGA 4Y2CA 1NHVA 4HHTA 3OSPA 1MMLA 4ZVFA 4KAZA 1BQNA 4H4MB 4M42A 5KFCA 1HNVB 4LSLA 3SUOA 2BANA 2ZE2A 2W42A 1S0OA 3RRHA 3UIQA 3DRPB 1N56A 2WCXA 4XO0A 2FC0A 4EBCA 2G8WA 3IRXB 1HARA 4NLXA 5KFIA 3SNNA 3EPGA 3ZSRA 3SPZA 3DM2A 2YV0X 3A2FA 3BQ1A 5KG1A 4O3NA 2VG5A 4KHMA 1VRTB 3F73A 3PX0A 3MAQA 4FXDA 2Z1JA 4LH4A 2OA8A 4F8RA 1D9FA 3NBPB 2BR0A 2V0NA 3ZCMA 4KRFA 2RF2B 1BQMA 3NF9A 5F8LA 4CE9A 4WFYA 3H4BA 4JV2A 1C6VA 2IS3A 3PW7A 5KFPA 4ZMMA 3QGIA 3KK2A 1QE1B 4WYWA 4BDZA 4WFZA 4M3WA 1S9GB 3DYAA 2FJWA 4X2BA 3RMBA 4KHYA 4B9SA 3FFIB 1SL2A 3AA4A 4FJ9A 2VG7B 1RNHA 1MU2A 4MKAA 1NNDA 1T03B 2W8LA 1KVAA 3DLKB 4KTQA 4CF8A 3G6XA 2VG6A 1XHXA 1RT7A 1S4FA 3TWHA 3GIJA 1HQUB 3PW4A 2FJXA 3KHHA 4F50A 2D0AA 4O5BA 4YFUA 2BGGA 4CJPA 4RW7B 1IM4A 1RT1B 2HHTA 1FKOB 5SWMA 2D3UA 3OLAA 2OPSB 4E0DA 2J6TA 1RILA 3NH1A 1JXLA 3QYYA 2XWYA 3HK2A 4KE5A 5I42A 4NLRA 1Q8IA 1UOCA 4N76A 4PQUA 4MK9A 3HVWA 4KB7A 1TK0A 4CEBA 4DFKA 4IFYA 1HQEA 3NH2A 3S3NA 3QEPA 4CJKA 4YMEA 4C8LA 4RNHA 4PY5A 4N5SA 3VQ6A 3NFAA 2PY5A 4NLDA 4NYNA 1QSSA 1SV5A 4KTWA 2HAIA 3DRRB 2YKMB 3FDSA 4B8AB 4FS2A 3H5UA 1QQCA 3M8PA 4R5PB 3V9UA 3KTQA 4BE2A 2RPIA 2UUTA 3KK3A 4Y1DA 1L3UA 1Y97A 4O3RA 4XPCA 4CFDA 1C1CB 2BQUA 3RWUA 2IJFA 4KO0B 2Y1JA 5KG7A 4DSJA 3D28A 4O4RA 2D41A 3M8RA 4IG3A 3OHBA 3VQ5A 3CDWA 5J2MB 2W9BA 1HYZA 3TVKA 4RW4A 1XC9A 3HVRA 2GV9A 2IC3B 3QERA 1SUQB 4E1MA 4K4XA 4FYDA 1HYSA 3U3YA 3M8QB 2LSNA 3TAFA 1JLQA 3BR9A 3KLHA 1NK9A 3OL6A 3EZ5A 4E7LA 3OLBA 4K4SA 1XWLA 4RNFA 4Q8EA 1DTTB 5DG9A 4NCBA 4CFAA 4M3YA 2QK9A 1IKYB 2OH2A 4Q44A 2BQRA 4Y3CA 2YNGB 2C22A 2D0BA 1TKXB 2PYLA 2RDIA 1ASVA 1UWBB 4J2BA 2PYJA 2AJQA 3SPYA 3V9SA 1DLOB 2B5JA 3VQCA 3L2RA 5KFNA 3ZSYA 1R0AB 2IM0A 1N5YB 3ZT2A 5KFSA 1SKSA 2BDPA 5DK5A 4ECZA 3LWLA 3KLIB 3QEIA 2OZMA 1DTQA 1CSJA 1K1SA 3AVLA 4J9KA 4ED8A 3LP1B 4DL5A 1RT4A 3OYAA 1RT2A 1FKPA 3DOKB 3MR6A 3OS2A 3T5HA 5CYMA 3ZT0A 3TAPA 3MECB 1TL3B 4M3TA 2O5DA 4JS4A 3V81A 2IBKA 4I2PB 5KFKA 3DLEA 4YR0A 5KGXA 4W5TA 3JYTB 2R7YA 4O0JA 4DQQA 4IRCA 5KTQA 1HNVA 2BRLA 4TXSA 3T19A 3LDSA 4RW8A 2IJNA 3WNHA 4HCBA 4FZXC 3DRPA 4CJFA 5C25B 4N41A 3SUNA 1S1VB 5J2PA 1NKCA 5K14B 3ZT3A 5KRSA 4IH7A 4FW1A 3SQ1A 2C2RA 1T94A 2W7PA 1LW0B 3SV3A 1U45A 1Z4UA 1REVB 4ELVA 1D5AA 4CGJA 5CY4A 3NBPA 3N6LA 1LV5A 4E7KA 3IS9B 5HRPA 3DLGA 5F9LA 2RF2A 1LAWA 3NDKA 4F4XA 4CJQA 1ZBUA 3LP3A 1I3AA 5KFZA 3OL7A 4QWDA 2ITGA 2HNYB 4C8NA 4DTMA 1C1AA 5KFOA 1QE1A 4B8CA 4Q5VA 3DDKA 2P51A 2JGUA 3CFPA 1YVFA 3TQ1A 4K4VA 3QO9B 1HMVB 3H98A 2OYQA 2B6AB 3OY9A 1NOZA 1NHUA 5KGWA 3FFIA 4NLWA 5DLGA 3LWMA 2VG7A 1T3NA 1T03A 4JV1A 4FLVA 3OYNA 3V6HA 1D8YA 2D3ZA 5KG0A 4IBNA 5T7BA 1RT6A 5KFMA 5I3UB 4DTSA 5HLFB 4QWAA 5HP1B 2R8IA 3RB4A 5DGBA 3RR7A 2G8IA 4YQWA 3OHAA 3LPTA 4CIGA 4NLPA 4RW7A 1SH0A 1RT1A 3HP6A 3VQEA 3DMJB 3ASMA 4DF8A 1FKOA 3ZSQA 2FLLA 2OPSA 3V1RA 1YTAA 3NL0A 1JIHA 3LZIA 3DI6B 1K6YA 3B6PA 4DQIA 2C28A 3FQLA 2OPQB 2FBXA 1S1XB 3T3FA 4B3OA 4CEOA 3E01B 1TAUA 3OYMA 2WTFA 4C8KA 2AWZA 5KT7A 5KT4A 4MH8A 4KI4A 3S9HA 4QPXA 2IM3A 3OJSA 2KZMA 2W7OA 4PUOB 4DTXA 4KHUA 4CJLA 1XR5A 2W9CB 2KZZA 4ZVHA 2P5GA 2DPJA 4LSNB 1SKWA 3DLRA 2KFNA 2WRMA 3GIMA 2FBVA 4CCHA 2IM2A 3L2WA 1KHVA 3K5LA 1SL0A 3NAHA 4O3PA 3SFUA 3AO5A 3DRRA 4KAIA 3EY1A 3SQ0A 3BQ0A 2XRIA 4DSFA 3KLVA 1HPZB 4FJ7A 2R8GA 1D1UA 1Z25A 3MXJA 4M3UA 2XHBA 4Z4FA 1BCOA 4IR9A 4HUFA 3S3MA 1C1CA 2RDJA 4KO0A 4KTZA 3ZSVA 3NGYA 4CHPA 3HYFA 3RMAA 4G1QB 4CK3A 4EZ6A 4F3TA 2DTUA 3VQBA 3ULDA 3QLHB 3SUQA 3CDEA 1U4BA 2ZD1B 5KT5A 1NKBA 5KG4A 4TY8B 1KFSA 4NZ0A 5J2MA 2XY8A 4R8UA 5HRNA 2QXFA 4CEAA 3OL8A 5KFQA 4CJSA 3AVAA 2KFZA 4ED7A 4H8KA 1JLCB 1EKEA 3T5LA 1RCHA 1LAVA 2IM1A 3KLGB 3VQPA 3KMSA 1ZBLA 1JLBB 4DL2A 4URSA 4M45A 4DLGA 1HJRA 1ZBHA 1HYVA 4RW6B 1DTTA 2UUWA 1NKEA 3HHKA 4ED3A 1LW2A 1IKYA 1ZETA 3KD5E 3KJVB 4DSLA 4CHYA 5F9NA 3WNFA 5C24B 1TKXA 3M9MB 1J5OA 3NF7A 4HKQA 3ITHA 5HROB 5KFEA 3AVGA 4F4YA 1DLOA 4NLSA 4IG0A 3H2LA 3DOLB 5F8JA 1Q9YA 3MR3A 1QHTA 1RBUA 5EU7A 3DLHA 1R0AA 1S97A 2J6SA 5J1EB 1JXBA 1KCFA 3HJFA 3KMQA 2IDOA 3L2UA 3P1GA 3KLIA 5JXSA 3NF8A 4AHUA 4OPJA 4E7JA 1JLFB 1VSEA 1I39A 1C0MA 2X74A 4WE1A 4LD0A 4MK7A 1S0NA 1RDRA 2AU0A 1BL3A 4CF1A 4RNOA 1JXEA 4EEYA 3LP1A 1TKZB 3QZ8A 2RN2A 3BGRA 3DOKA 4ZTJA 1ZTTA 1TV6B 4CGDA 1S6PB 4H4OB 2R2TA 3KHRA 2FLNA 1TL3A 3I5BA 4BE1A 3QIOA 3UDLA 4CJUA 3RMDA 1KTQA 1NK6A 3HXMA 3KD1E 3TI0A 3OS1A 4IR1A 4I2PA 3KLFB 4FLWA 1NK0A 4OKEA 3TABA 2YNIA 3WNEA 3JYTA 2O4GA 3H40A 2DY4A 3GILA 3AVJA 4O55A 4FJ8A 3LALA 1C1BB 4ECVA 2I5JA 3HO1A 3QIPB 1O1WA 3QEVA 5KFWA 4OKJA 5C25A 4DFMA 2AGQA 2XI3A 2HVHA 3QESA 5FRMA 3T1AA 4K4UA 2XO7A 5K14A 2HWIA 1IKVB 2HHXA 2XI2A 1VK0A 4GC7A 4K8XA 2HMIB 4G3IA 1LW0A 2IMWP 2A1RA 3B6OA 5KFBA 1A5XA 1TP7A 1REVA 2KW4A 1RTHA 3WNGA 4DL7A 5EDWA 2DPIA 3CM5A 2UVVA 4Z4IA 5DMRA 4KREA 3IS9A 4CHQA 3CQ8A 1LWEB 4PWDA 4JS5A 5CYQB 5EUHA 1KLMB 4LH5A 2V4RA 2HNYA 2W8KA 2G8KA 2GIRA 2EX3A 3AO1A 3RAQA 3KOAA 3HPGA 1RT5B 2HHUA 2NUBA 4CHOA 3C94A 1N6QA 1SH2A 3MXMA 3QO9A 4NLUA 1HMVA 2B6AA 1X9MA 4IRDA 4OKKA 5KRTA 3BDPA 4QAGA 3NH0A 5FDLB 1QS4A 4M3XA 1WSIA 1ZYQA 3MEDB 3MR5A 2WB4A 1WNSA 3OVNA 1EP4B 2X78A 4QW9A 5KFGA 4CERA 1TK8A 4FZYA 3DRSA 3ZSOA 2HHQA 5SZTA 4YR2A 3JSMB 1S6QB 3BSNA 3L8BA 5HRSA 1BI4A 1JLEA 1WN7A 3CIZA 4CF9A 3DI6A 2OPQA 1CLQA 5J2NB 3LP0A 4R0EA 4KHSA 2B43A 1S1XA 4MFBB 4B9MA 3CFOA 3E01A 1CXQA 1K1QA 4NYFA 2XCPA 3CWJA 4J9MA 2OPPB 2HNZB 1FK9B 5DQHA 4Y2AA 1VSKA 3M9OB 4KFBA 2W9CA 5T14A 2G8UA 1RTJB 4ZHRB 5DG8A 3KIOA 4GW6A 3MR2A 4RUCA 1RT3B 4J9PA 4KB0A 1NJWA 4Q0BB 2WOMB 3ZSZA 3AVKA 5D3GB 1HPZA 4DF4A 2OPRB 4BWMA 3HVAA 4ICLB 4BACA 4F2SA 4Y34A 2UVUA 1RDCA 4CECA 4DQSA 3K2PA 4FK0A 3SCXA 4ELUA 2WHOA 5HBMB 2ETJA 3CJ2A 4FBTA 3VQ9A 4CFBA 3LP2B 3G6VA 4F3OA 4ID5A 3O3FA 2R8HA 4FVMA 3QLHA 1CXUA 3SI8A 2ZD1A 1ITGA 4FW2A 1U49A 4W5RA 2JEGA 4I7FB 4KV8A 4DU1A 1KFDA 3PY8A 1RA6A 1JKHA 1RTDB 2HVIA 4JLHA 4CEDA 4H54A 2IA6A 4WXOA 1JLCA 4HYKA 2B4JA 4WZQA 3HPOA 1TL1A 3I0RB 5F8IA 3KLGA 3BSAA 4JV0A 4ECQA 1JLBA 1JL1A 2G8HA 4OGEA 4NLOA 4RW6A 3OSNA 1QSYA 1JLAB 4DG1A 3NE6A 1KRPA 2D7SA 3KK1B 4MIAA 4LQ9A 1UA1A 2GUIA 3BSCA 4DL3A 3MEGB 3KJVA 2YNFB 4TQSA 1NOYA 4BWJA 4ZVEA 4ECRA 1VSHA 5L1LA 5HROA 1S1UB 5L1IA 5KG6A 2BANB 2ZE2B 1S9EB 3DOLA 3LZJA 4FZZA 2HHSA 1KHWA 2R2RA 4H4MA 2JC1A 3HPHA 4NLQA 4DS4A 4YR3A 2ZKUA 1JLFA 4KHQA 2W9AA 4TQRA 3TAMB 4HTUA 2WK4A 5DGAA 1X9WA 2G8FA 1W0HA 2F96A 3SZ2A 1TKZA 2AGPA 4M95A 5KFUA 1TV6A 1T05B 3U3GA 4CGFA 1S6PA 3IRXA 4H4OA 2XGQA 3IN5A 3H08A 3I0SB 3FRZA 2X6NA 3GIIA 4EBEA 4JRPA 4O3SA 4CIFA 3RB3A 1BISA 1VRTA 4W5OA 1KVBA 3OYCA 5KT2A 5JUMA 2UVRA 1Q9XA 3VA0A 4CFCA 1IKXB 1J9AA 4IOBA 1QTMA 1NJYA 1X1PA 4J2DA 3I8DA 3DYAB 1C0UB 1C1BA 4HCCA 3VQAA 3QIPA 3TR8A 1NK5A 4IKAA 3GYNA 2V9WA 4ECYA 3P83D 4FK2A 3N6MA 1WAFA 3OYDA 1IKWB 4Z4GA 2VG6B 1IKVA 1S9GA 1RT7B 4ZP9A 4FLYA 4J9QA 4ZPAA 1S0MA 4I9LA 4FM0A 4FJNA 3AVMA 2HMIA 4DTOA 1N48A 3UQSA 4TYAA 4DU3A 3GV7B 4J2EA 3ICLA 3QGHA 4C8OA 3DLKA 2UVWA 1IO2A 2GIQA 3OYBA 4FJIA 5KFYA 1YVUA 1HQUA 2CKWA 3D0PA 3OL9A 2PZSA 5CYQA 1U48A 1KLMA 1ASWA 5I42B 3TAEA 1RT5A 3SQ2A 3MFHA 2YHAA 2I1RA 3HP9A 3OYLA 2ZQBA 4IFYB 1L3SA 2JEJA 4O44B 1JX4A 4ECUA 2AQ4A 2AX0A 1NK8A 4ZVGA 3IG1B 2XCAA 4CJVA 4E1NA 2EHGA 1TKDA 3NGDA 1VSMA 1EP4A 1X9SA
chains in the Genus database with same CATH superfamily
3PZPA 4JI5J 4QBUA 4LF7J 3LA0A 3O2IA 5IT9Y 1GMWD 2F9JA 1NJXA 3QICA 3EZOA 5IQQA 4KY3A 3D9BA 3I56N 2GUPA 1Q5VA 3LANA 1X4DA 3SAHA 3UFCX 4QWBA 2ILZA 2E5HA 1WSJA 1PC4A 3LW5C 4YDXA 3G86A 2LEPA 4Y65A 4M5HA 1GOCA 3QB0A 1J2VA 1SJFA 1WNEA 1GXLA 4USJC 5J2NA 4NYPA 1WKKA 1VQKN 2DHHA 4NASA 4Z7CA 2FSKA 4DSEA 3DXMB 4FWNA 5K8OA 2F8SA 4I6MA 1DBDA 3W2VB 2HNZA 3BH7B 2CVEA 5C2DA 2DNYA 2MLZA 1JK9B 1HR0F 3EZUA 5A2QY 1NNEA 4K7QA 3OJUA 2R8KA 4DV1J 3ZZYA 4AHCA 2BE7D 1JNRB 3M7VA 2RILA 2GO8A 2EFOA 3ILIA 2HNDB 5F3ZA 4Q0BA 4BC3A 4E3SA 5IXUA 3MFIA 2Q36A 2FF6A 2KM8C 1B3TA 3A5LC 2ZH5A 2KT5A 4KC5A 3R7BB 2VA2A 3LGNA 1HNIB 4ES2A 4JI2J 3PSIA 5KFVA 4NRUA 3OR2A 3MEEB 4KGVB 3VGVA 3BREA 1VMBA 3G71N 2KQ2A 4NI2B 5L9XA 4F02A 4B1XB 4NRTA 2J6UA 2E5LK 3KK7A 1IG8A 3RTVA 3MEKA 1RTDA 4LR9A 3DKDA 3QFUA 2VQFJ 3CDAA 3KWIA 1N5YA 4O3QA 3SQGB 2NUHA 3CFRA 3LAKA 1U25A 4CJ3A 4OJRA 5CYMB 4WCEQ 4FCYA 2MZTA 4KGKA 3KK1A 2PA8D 4ZCKA 2KDOA 5F8HA 2UV8A 2CAJA 1YX2A 4CLYA 1QD1A 3KNGA 4DL0C 2ITMA 1XMOJ 2ILYA 4I1TA 5ETOA 2I7PA 4CO0A 2KXFA 2V7YA 1A7GE 1S1UA 1RI7A 4RW8B 1M1HA 1S9EA 4UF4A 1MROB 3O8WA 4B9TA 1HQ2A 1NH7A 3IBWA 4AUKA 3TAQA 2CQBA 1MNEA 4WJBA 2HEKA 3MCPA 1B9FA 3VAFA 2U2FA 2KN4A 2YWFA 4W98A 5A6PA 2E8AA 1RCXB 2GMHA 2OSQA 4PHTX 2F8MA 2AYMA 4ALZA 2R42A 4OJ1A 4WFNL 3R9PA 4OI1A 3ENVA 4J7CA 1S1VA 3K8VA 1VCTA 2V4JB 4KPYA 4LVOP 5TKYA 2FZGB 1F5BA 3HX9A 3BEXA 4DPYA 3DLGB 1UFWA 4IDKB 4NEZA 3CJ5A 3MD3A 5JMNA 3CCMS 2XS7A 3AO3A 4DTUA 2XNRA 2FVQA 1KVKA 1S49A 1VJQA 1JQGA 2E5IA 1CZ9A 5D78A 3PJXA 1U04A 4URGA 4OL8A 5AQUA 3W65A 3SQOP 1P8ZA 3R2DJ 2VWBA 2HWHA 3GSDA 3RBXA 3L2QA 3SDEB 4OGCA 4F25A 2HSTA 3T6BA 1RYRA 4BR5A 5HSPA 1DAXA 1QUVA 3C6UB 2W6KA 5HLFA 3TO8A 4USHA 1D0EA 1NRKA 2BMBA 1RA7A 1WHYA 4ZP6A 3ENBA 3M8ZA 4KRWA 1NSAA 3EDRB 2XMVA 3J81U 1X3MA 4E7HA 5CD4H 1RLCL 2NSCA 5M2RA 2DNOA 4C0HA 2H3GX 3H2VE 4ED0A 3IGVA 1VSJA 3DLBA 4RU9A 2Z56B 3KHGA 4B1YB 4CEZA 2VWKA 3A4TA 2VU5A 3HL8A 2CQGA 1VQPS 1U1PA 1XR7A 1M90O 2DXEA 1CJUA 2ZDOA 2DB1A 1VDHA 5MAOA 2XLKA 1VQMS 4HT7A 1H3DA 4L8RB 3C6TB 3O4NA 4PA1A 1VFJA 2XZTB 3PX6A 1L3VA 4JNEA 2R8JA 1RUSA 1X4BA 1OPIA 4BE0A 1OQ3A 4DPOA 2JWKA 3H5XA 2FJBB 1KR4A 1VQON 5B0GA 2QA1A 4O8UA 1IJFB 3M2RA 1U24A 1T8EA 4LFBK 4CRJA 3HD2A 4ELTA 3H7HB 3HZEA 5ELZA 3LPUA 4LVNP 4WZMA 1UAXA 3FSIA 3CC7N 2A6MA 4DV7J 2BQ3A 3CQYA 3I5AA 4ZTFA 1VS3A 3CVKA 2AJ0A 1N36J 4KB1A 4A4JA 2V52B 5T7LB 2GMLA 1UVNA 3BBBA 3D6RA 1OJ4A 4E89A 1B9DA 5LMUJ 1UVJA 5B8HA 1C2PA 4J91A 4MKVA 3OVBA 3NF6A 4PXDA 1RAOA 1FNOA 3D7EO 1BOTO 3UWTA 3VQ7A 4O4GA 4DV3K 1HHSA 2ZBCA 3AODA 4IG0B 2JRSA 2K7JA 2GWJA 4LFBF 5C24A 3MN7A 2ZJQQ 4UY8O 4AILC 2CPDA 2HGLA 3CERA 2A18A 1NK7A 3G0ZA 3HSZA 2W2MP 4Q8FA 5M1OA 2MQLA 2P9UB 2RU9A 4USTA 4AXIA 4K43A 4FK4A 4CJ5A 1T9WA 5A0YA 3KKRA 4LRCA 4K8ZA 2ATLA 3QATA 1NJIT 1QM9A 4CJTA 2HBMA 4M1KA 3DM2B 3H0PA 2YNHA 5LSRA 2VG5B 2GQCA 3A8YA 1HNWK 4QWCA 1VQ9N 1U1LA 3D67A 2Q0UA 4DV3F 5CAAA 4KHWA 2O01C 3QT6A 4PG7A 4B9VA 2GX8A 1BIZA 1BQMB 3POTB 4MK8A 3SCLE 3PX4A 2CJYB 4E19A 2RSQA 1F5CA 4QOZB 2GJIA 4AXJA 3T1HK 2QC3A 3VQSA 3PV8A 4MMOA 4MJKA 3DGPB 3H4DA 4OLAA 3ZT4A 2MKSA 3H45C 5F8MA 4ZVOB 1ZTWA 3M2VA 3R97A 3V6DA 3MCSA 1WDDA 4LBHA 1PJ7A 2L9NA 2V5HG 3CW2C 3UE2A 5AQRA 4BDPA 3F5TA 1HNWF 1IBLK 3UCZP 2ROPA 4HACB 3H1VX 1I6JA 1YJVA 3J80U 1W7AA 1S99A 3SFGA 1HHQA 4I69A 4IJNA 3JAMU 3TOQA 3IBCB 3T1HF 3TPQA 4U67L 4FPBA 3RAMA 2UXBJ 3O9TA 3Q2SC 4S0MA 3AJDA 1RSCA 1VRUA 1RBSA 3W8GA 5F8NA 3SBTA 1YHQS 2BE2A 4DUZJ 3RR8A 2KT3A 1T7PA 4B3RJ 3QRPA 5M1NA 3ZTPA 3MEDA 3DDIA 1U2VB 1FO1A 2MKKA 1U6BA 4GKKJ 4DX5A 3ADAC 5AQFA 3THPA 2JC0A 4CZKA 4IOCL 2VOOA 3W2WB 2H5EA 2VC1A 3IM9A 3ALYA 1IBLF 3MUTP 4PYDA 3RRGA 4LF9J 2DBBA 4BRCA 5BRDA 4FJGA 3M8PB 4YS2A 4GC6A 3LP0B 1S6QA 2XGPA 1YZ7A 3RUBL 1TQLA 3C2PA 2R7RA 1W9HA 1P9QC 4N47A 2R7VA 2JOQA 2G2YA 3C16A 1U47A 4GVMA 5AXNA 4KFBB 1LWXA 3QIDA 5J2QA 3VEYA 4M5LA 4OZ3A 4FWRA 2JVRA 4JHDA 2DPNA 2W9BB 4EU0A 3PYFA 2WTUA 1QAJA 2Q66A 5CHIA 3SMPA 4HTJA 4CLZA 4FF2A 3AVBA 2N3LA 1EETA 1LWFA 5ETRA 3DNCA 1WSGA 1TL5A 4CF2A 2FF3B 2O8BB 3VTIA 5SUHA 1FXXA 3KLEA 4U7CA 4JI3J 1RTZA 4P72A 1XI1A 4TKTA 3EJMA 3FSYA 1GTEA 3EGZA 1QQNA 1OH8A 3CJ0A 1OQ6A 2MQ8A 4JV5K 4C1NK 3NWRA 2HBJA 3THXA 1WSEA 4MIBA 3EPIA 4QCLA 2CPHA 1FRIA 2E1AA 1VQ4S 4LFCJ 4EFHA 1OS5A 2HFNA 4JKHA 2W4PA 4CZFA 4OX9K 4DI6A 4K4TA 4DEZA 4CI6A 2KG0A 1DTQB 2DO0A 2QLBB 5J1PA 1ZOTA 3NVMA 3WIUA 4CZCA 1BE4A 4FYYB 3GR0A 5K8NA 3EICA 3LL3A 1FKPB 2YKOA 4Q43A 1N5QA 4CEQA 3QWPA 1IBKJ 5EVZA 4FWMA 4CGGA 1VQYA 1NAQA 2V2KA 3CQXA 2P9GA 1DQAA 2FLPA 3GFYA 3N4QA 2CDQA 4HHTA 3M2UA 3HHLD 1QVGM 4JV5F 1BQNA 3MM6B 2O8FB 4M42A 5KFCA 1RBOB 1FFWB 4DR2K 2RQMA 1VBXA 4OMFG 1V5VA 2QLWA 3CCRS 1N56A 1CZAN 4QYZK 2ZH4A 2EK6A 4OX9F 2FC0A 3PRBA 3NCRA 3IRXB 1YSJA 3J7YP 2FB0A 3W5XA 3SPZA 4M7YA 1WACA 1Y11A 4EFAC 1F9FA 4KHMA 2IVPA 3MAQA 5IT4A 1CJKB 2NRZA 2OA8A 1Q53A 2MKHA 2E7VA 1X8DA 4K2JA 4CE9A 3AH6A 5F8LA 5GAEU 1Y64A 2FHOB 2IS3A 2JDJA 3QGIA 2QW9A 1QE1B 4BDZA 4WFZA 4DR2F 3NNAA 4M3WA 1S9GB 3UN5A 4X2BA 1HNXJ 3RMBA 4DKWA 4PKIA 1M5OC 3AA4A 2FHJA 5C15A 4MKAA 4KTQA 3VAKA 1RGIA 3IA0A 4CD3A 3CIMA 4FF3A 3R8YA 1WUUA 2DHXA 2FJXA 2BGGA 4FXWA 1HI0P 4CWBA 1ULRA 4Y0WA 2I9SA 4IUFA 1WB9A 2P8IA 2MPUA 3VPZA 5HVHA 1FW6A 2R7XA 5I42A 1SJRA 2HLTA 4NLRA 1Q8IA 1UOCA 1PC5A 1WEZA 4PQUA 4OHZA 1PIEA 3PRDA 3D6FB 5AQVA 1ZBSA 2M5YA 1U8SA 2PMHA 4CEBA 3MR7A 4DFKA 4IFYA 1HQEA 2OEKA 1SPBP 4BRPA 3W5ZA 3H90A 4CZLA 1XNQK 4C8LA 3VEOA 3QQCD 2ZM6J 2PA3A 4PY5A 4Y2MA 4FWKA 2CJXB 2I7NA 3NFAA 2PY5A 4NLDA 1KP6A 1XIQA 1URNA 3FDSA 4B8AB 1R43A 4L76A 3QFPA 2BM1A 3KK3A 1QHAA 1L3UA 3KXDA 5LXYA 3CD0A 4XPCA 4PXEA 1ZZNA 4CFDA 5AQYA 2VPZB 2UP1A 1ZM3A 4HEA9 2LLZA 2Y1JA 3QJLA 3D28A 1RWXB 4NMXA 4IG3A 2QX0A 3QRQA 3DAWA 4AQYK 1XNQF 2QWPA 1YBAA 1XC9A 2GV9A 4YB7A 2E1ZA 2LMIA 3J7ZT 1FRJA 3AA9A 2KVQE 1PCAA 4K4XA 4FYDA 5GVQA 2M4MA 4OZLA 2LSNA 3TAFA 3BR9A 3KLHA 1NK9A 3EZWA 4E7LA 4DV4J 4NO7A 2V9KA 4CVNE 3W1YC 2XMWA 4NCBA 2P9LA 4DJBA 2DCUB 3CJ1A 1VBKA 4FF1A 2LEAA 2E2NA 1Q7YO 2RDIA 3GBTA 1ASVA 4QJVA 4OV6A 1LXNA 3OXGA 2B5JA 4WK1A 3HOSA 2ZOGA 4AQYF 1G6BA 1R0AB 2IM0A 1N5YB 3L7UA 2RD5C 4GV9A 2JFKA 1HBOA 5KFSA 1RHKB 4NXMF 3LWLA 3CCVS 3GE1A 3PIPL 3OVAA 3KLIB 3Q8VA 1VQPN 3VENA 2XBPA 5BYQA 3ZZPA 3M5RA 1RGVA 3AVLA 3JS6A 3N4PA 1R8CA 1RT4A 3OYAA 1BWEA 2VPXB 4U95A 2FQQB 1YTYA 3I4PA 4IO9Q 3F0NA 2X51A 1TL3B 2BJ8A 2IY5B 2XMMA 2AF6A 3V81A 5K5MA 5KFKA 2VL1A 4CBUA 1OO0B 4YR0A 4QIVA 4A2AA 4W5TA 3R6GB 4O0JA 4V1Ak 2BRLA 4TXSA 2H54B 3TRGA 3AQPA 1S0VA 4H0VB 4WKYA 3DXSX 4ZLPA 4JKAA 1S1VB 4TU7A 2MTLA 4UY85 4WU3A 5AZJA 4KYZA 2DJWA 2OO4A 2WFBA 2JFDA 2AD9A 1LW0B 4JOUA 4IO1A 4ELVA 1WOPA 3OBYA 3ZTRA 3N6LA 1J5EJ 2WBRA 2RF2A 3TSQA 3NDKA 5C12A 1N34J 2K1RA 1I3AA 5KFZA 3CIPA 1LFPA 2ITGA 2EPIA 2H48B 1C1AA 1FXDA 4F26A 3DDKA 1YVFA 1FJEB 3AXMA 4AT1B 2B6AB 2FYXA 3CO0P 2EBEA 4ZIVA 2VICA 5KGWA 2W7AA 5DLGA 3T69A 2VG7A 2XTJP 1T03A 4FLVA 1D8YA 2Z58B 4FP9A 4WF9Q 1RT6A 2PGCA 5KFMA 5HLFB 2AA4A 3PFOA 1VAZA 2COLA 2ADBA 2NPIA 2YI1A 4YQWA 4FNIA 2EFQA 3OHAA 2GGPA 4NLPA 4RW7A 3HP6A 4OYXA 3L4IA 1FKOA 2LQ8A 2OPSA 2FY8A 3IP0A 3LZIA 1K6YA 3B6PA 4DQIA 3FQLA 2OPQB 5EY4A 1KN6A 2DXFA 4B3OA 1MDUB 3VEZA 3E01B 2WTFA 3H46O 2NREA 1Q79A 4ANDA 2LA4A 1N0VC 5E5NA 3B82A 2KZMA 3CEDA 2W7OA 1R8PA 1IN0A 5DDRC 4Z94A 4DTXA 4CJLA 3W9IA 1BUXA 2P5GA 1ICEB 1SKWA 2C3OA 3CJTA 4QS8A 3CNQP 2CJKA 2KFNA 2WRMA 3IFEA 1KHVA 3UB5A 4BVOA 3DRRA 5GAGU 2F4FA 1CQNA 3KLVA 3UNGC 4CIOA 5BR8K 1NWKA 2J4RA 1D1UA 2H1YA 1Z25A 3VGKA 4M3UA 2B7CB 3A3OB 3NGTA 4HUFA 3S3MA 4O23A 3SAFA 5M2PA 2H4YB 3ZSVA 2NLXA 4PPZA 4CHPA 1QDUB 1GAOA 4RX6A 2E1PA 2CQDA 3ULDA 2GHVC 2CPEA 1FVSA 4LF8K 2GAGC 5AE3A 2IIRA 5KT5A 1X7VA 2VPYB 3IDHA 2GW8A 5J2MA 3PEHA 3TW0A 1UJ4A 2XY8A 1EQYA 4CEAA 3OL8A 5FPMA 2CWKA 5JVHQ 1YHQN 1JLCB 1DT9A 3T5LA 3GYXB 2MQOA 1RCHA 4WQ5A 1GLAG 4WQ4A 2MZRA 3KLGB 2ZOMA 5BR8F 2PE8A 3FSXA 4HDHA 4URSA 1N8RO 3NGSA 1HJRA 2HPUA 1HYVA 4RW6B 5LMNK 5EHHA 3VWSA 1NJIO 3HHKA 1Q81T 1ZETA 4YUDA 2ZC3A 4DSLA 3WNFA 5C24B 3N79A 5FPDA 1HBMB 3THYA 3AJ2A 4LF8F 1DHMA 2YY3A 5HROB 1MWZA 4RBUA 2O8EA 5BN8A 1GMWA 3V2UC 3H2LA 1Y3JA 3W5YA 1QHTA 5EU7A 3DLHA 4KPCA 4NZ7A 1S97A 2ZVIA 1JXBA 3OUYB 2NR0A 3HJFA 3L2UA 3EGNA 5LJVA 3P1GA 5JXSA 3NF8A 4OPJA 1JLFB 1I39A 2X74A 2G4BA 4LD0A 1JXEA 2L48A 4F0MA 3LP1A 3R5BA 5B0AA 1XK8A 1FDBA 4NXNK 1ZTTA 5LMNF 4H4OB 3KHRA 4CH7A 3RW6A 3WT0A 4OZJA 3I5BA 4BE1A 3QIOA 2DNMA 3UDLA 3RMDA 1N5VA 4P2SA 3S6EA 1NK6A 3MDQA 2MHNA 3HXMA 2M9KA 4CTAA 2O4GA 3GILA 3TVYA 2E7WA 4WKRA 4FJ8A 4OYZA 5D6GA 2I5JA 1GQEA 3KJNB 5FLXU 4JKGB 2RB7A 4JI1J 4OKJA 3UNYA 3M2VB 3LDPA 5AQLA 5FRMA 4K4UA 5K14A 2BYCA 3O8MA 2HHXA 2XI2A 4RLEA 4D3HA 1VQ4N 1ITPA 1IWAA 1ZXOA 4G3IA 2IMWP 4LIWA 3B6OA 5KFBA 4YOYA 4YDUA 3M4XA 4IEEA 4NXNF 1TP7A 1REVA 1ZM2A 2HMPA 5JVGL 3CUNA 4DL7A 5EDWA 4Z4IA 4GMKA 3HRGA 1UW4A 2Q43A 4CHQA 4JS5A 4ISGA 3IO1A 1XMQK 1HJOA 3HPGA 1RT5B 2NUBA 3ZYYX 3ET6B 4CHOA 4NLUA 1HMVA 5LOQA 4K5SA 4YB5A 5KRTA 3K5PA 2CNKB 1T9VA 1H74A 1WSIA 3MEDB 3MR5A 2UXDJ 3N01A 2X78A 2NXJA 2Y1LB 1M0SA 3DRSA 1YJNS 2M70A 5SZTA 2X1BA 3CCRN 3THWA 2ACYA 2BJ9A 3U1NA 1S6QB 4DZ6A 3UKUB 3WZ0A 3BSNA 3DRYA 1CC8A 3MPYA 3L8BA 3EWGA 2F4VJ 4JAXA 3CIZA 4CF9A 3DI6A 1SJ1A 4ERDA 2GFFA 1CLQA 1XMQF 4R0EA 2BA9A 5M1FA 1KVJA 2DEJA 4P74A 1NCLA 4FZVA 2YH1A 1S7HA 2OCEA 1DQ8A 5BJRA 3X1LB 3DHXA 3M6WA 4LF5J 3M9OB 4ZHRB 5DG8A 3KIOA 3R1LA 3EE3A 4KB0A 1ZAXA 3F2KA 1HBUA 1NJWA 3U02A 4ILGB 2W24A 2G0IA 3F44A 2BOAA 4USWA 3CCQS 4CJ7A 1HPZA 2HGMA 3HVAA 2MGZA 3OTBA 2C3UA 2UVUA 1VISA 1RDCA 4CECA 4FK0A 2RNEA 2G1DA 2WHOA 1N88A 1UZDA 4G65A 2MMYA 2QTDA 3VQ9A 2DXDA 3FKBA 3THXB 2ZZMA 2NRTA 2A5XA 2MKYA 1WDTA 3MCOA 4FW2A 1U49A 1YK9A 4YEAA 4A47A 4W5RA 4I7FB 2KXNB 4DU1A 4WU2A 3HM8A 1N5TA 5M1PA 4LF4K 1KFDA 4EHTA 1WTBA 1Z05A 2DR8A 3VGMA 4H54A 4WXOA 2B4JA 4WZQA 5FIIA 1WG5A 3R2CJ 4TU9A 1NUEA 1ESVA 5CQGA 2ZHOA 1JCEA 1RISA 4LT6A 2KG1A 3O1WA 4RJVA 4NLOA 3OXLA 4G6VB 2F40A 5HMXA 3SBMA 4DG1A 3QT8A 1F3VA 1KRPA 4DV2J 2RMLA 3R5AA 1UA1A 2GUIA 4YDDB 3KJVA 4DV1K 4TQSA 5LY3A 4K5RA 3GG0A 4FPAA 2P2CB 1A0OB 1LNQA 1BXNA 1S79A 1Q86T 1YVNA 3DOLA 4EGLA 3BPDA 2O8DB 4LF4F 3FZMA 3BGLA 4YR3A 4H5VA 3D1OA 1ZM4A 3TAMB 4JI2K 1AZSA 3ENAA 3E2EA 1RKJA 4FWOA 2G8FA 2JNJA 2J9CA 2DR5A 4M95A 1MWMA 5KFUA 4JB8B 4IJAA 2VHGA 4NA1A 3IN5A 1UEVA 3I0SB 2VFRA 2KO1A 6FDRA 2X6NA 3ZEUB 4C9DA 4U96A 4E2FB 4JRPA 4DV1F 4CIFA 2BX6A 1BISA 4W5OA 2Z2LA 3NNCA 1VQ5S 2VQFK 4CFCA 1Q7LB 3P6YC 3GL1A 1X1PA 4J2DA 4CZJA 1C0UB 5FD1A 3MI7X 3QIPA 3TX0A 2VJVA 4IKAA 3GYNA 2AJFE 5DDPC 4FOIA 5DM7L 2WBNA 4I64A 4ECYA 3P83D 5KPTA 1XN9A 1IUJA 4Z4GA 2UUBK 4JI2F 3LDNA 3UD3P 2LDYA 2F1FA 4FLYA 1XMOK 4ZPAA 1S0MA 4I9LA 4BRQA 4USMA 3G8TA 4DTOA 2XMTA 4TYAA 2YWKA 4DZDA 3CCVN 4N77A 3GV7B 2EFVA 2YJEA 1S72N 4MDAA 1WHVA 3T9ZA 1IO2A 3IWLA 3BPSP 1YVUA 4P7VA 1MWYA 4WIQA 1RACB 3OL9A 2E44A 3N5FA 5CYQA 5I42B 2VQFF 3MFHA 2YHAA 4IFYB 1Q95G 1Q82T 3T6JA 3O9RA 2HYIB 1DKGD 4O44B 1JX4A 2NYHA 2GVDA 4EAHD 3IR6B 1NDKA 2JLGA 2UUBF 4BVPA 4CJVA 5H1SQ 1EP4A 4LFBJ 2RKIB 1WSFA 5AR0A 3KFWX 3PACA 3WBZA 3E66A 3GPAA 1E3MA 1C0FA 3VTHA 3KK3B 4URQU 3NHGA 1NZAA 3OXFA 3NMAA 5A8KA 4U67Q 1X5PA 2WVBA 4R0JA 2YKMA 4DHVA 3CCJS 5KT6A 1S1WB 4JUZA 4R5PA 2VUGA 2R7UA 4Q7AA 1CJTA 3TR5A 1MG7A 3V9ZA 2BXJA 4IG3B 3VN5A 4ZJLA 3O9UA 1LQ9A 2Z8QA 2XB2D 1XR6A 3L6QA 1TL7B 2BEFA 1OVQA 4DV3J 4HLBA 4TYBA 3ID8A 1GLJO 2XEXA 3BS9A 1RTJA 2K7KA 1X5TA 2ASJA 3FZBA 5BREA 2D4WA 1NG9A 5MLCV 4J9NA 4CO2A 3G8QA 3KLHB 4F9OA 5KT3A 5HL7L 4K50A 2YKNB 1K44A 1BQXA 3QGGA 3WQTA 4IOAL 2IC3A 1P27B 3TEGA 4AF1A 1IJJA 4DR7J 5KFFA 3M8QA 4H4KC 2VBYA 5EWGA 1U02A 2R9LA 2ZBPA 5DG7A 5L1JA 3C14A 3AARA 1NM2A 4YNQA 2P6SA 4B9UA 4V19S 2QKBA 1V5IB 4BREA 1EZZB 2P9SB 3MTKA 2BV3A 2E5JA 4EBDA 2O1PA 4BR7A 3NGZA 3IUCA 5KFRA 2QA2A 4FLZA 3HDSA 3VEVA 2OZSA 2OMOA 2CQHA 4A2BA 1NGFA 1Z26A 3SCJE 1BHNA 4I6WA 4ILLA 4BR9A 2DR7A 3TTFA 1VC0A 3I0RA 1N52B 1RQ0A 2IAJB 4DR6K 3NWGA 2Y1IA 4KT0C 5C10A 1RHJB 3QT5A 1ZBTA 3IR5B 4NCGB 3WQUA 9ATCB 3EYZA 2A1BA 3IWXA 2HB5A 2A41A 3O1BA 4ZIWA 1ASUA 5HRRA 3CDUA 3V81B 3HFKA 5IM0B 4DUYJ 3MEGA 4PR6A 3AA5X 2YNFA 3MWPA 4DV7K 4OO1J 1RDBA 5E84A 1DEJA 3ZSWA 4M5DA 2GNKA 4KH6A 3MECA 1HLWA 4BS2A 1WKJA 1ZBIA 1G15A 3IGNA 3QNNA 3OYKA 2ACMA 2OTJS 3GU0A 4JKEA 2FBYA 3LF0A 5LMUK 2NQPA 1ZBFA 1O13A 4L6V3 5AZJB 1HW9A 4DR6F 2YKAA 3CF5L 2CPJA 3C6HA 3C65A 2X1FA 2O66A 2DFEA 1T05A 4NLYA 3HKZD 3BN7A 5E26A 3GP9A 4OYAA 4X4TA 3CMAS 3D1QA 3MAAA 1TTHB 4M5NA 1TFWA 4DV7F 5IWAJ 3SK3A 3G6EN 4ZITA 3VQTA 2I38A 2XY6A 3PO5A 4OX7A 1HKAA 1X0PA 2J7UA 3ZZ0A 1VQ6S 2XZWA 4N56A 2E6MA 1CJVA 5ETKA 3ZTQA 3U7JA 3THVA 3H5SA 4M94A 1NPPA 4NLVA 4EWTA 5LMUF 5C42B 4DU4A 3VZIA 4Y2KA 3SI6A 2DD8S 1BA1A 3OW2R 2J7WA 4FDFA 1DRZA 1F5AA 3U9DA 3M9NB 1RT6B 5KFLA 2FVCA 1SJ4P 4OPHA 2GVZA 3V4IB 3CC2S 1XMBA 3AVIA 1ZM9A 3SLCA 2CPFA 4DQRA 4B9QA 3T1YJ 5I3UA 3HHLA 4ETZA 1QQMA 2HHHJ 4DX8H 2DFHA 3MOJB 1C0TB 3UD4P 5BPLA 4B3OB 2H65B 4KH5A 2O8CB 4NZ6A 1PAUB 1SCJB 2BKOA 1YZ6A 3PSFA 3A8JA 4CEEA 1SL1A 4DLEA 5LJWA 3FE1A 1RAEB 3OYJA 4K59A 1JLGB 2YXLA 5E41A 4DMNA 4WFBL 4JV5J 2WONB 2XSJB 3VERA 1KAXA 1XHZA 4W5QA 2QA4S 2QFJA 4GVEA 1OSCA 3K2YA 2MQPA 4AHVA 1F9EB 4EZ9A 3PW0A 2GBZA 1KTVA 2UXBK 2IDLA 4JK7A 2Q3SA 2HBRB 2CNNB 2CGKA 4DUZK 2H9ZA 3WXMB 5RUBA 2P9CA 3Q8YA 3DXMA 3VAJA 3W2VA 4J9SA 3NGRA 4PPDA 1F21A 3PUFA 1NGIA 1G2EA 3O4QA 4LF9K 4JYAK 2NCKL 4KI6A 3N9UC 2FJVA 4PWUA 2LU1A 3WC2A 1NO8A 3LDQA 1RDWX 2I8EA 2HNDA 4BRIA 4Z0UA 5ETLA 1SIZA 1TVRB 2W41A 4DFJA 4OZ1A 2CQPA 2X7IA 2BUNA 4QYZJ 5GIPA 3U4LA 3L0QA 1YJNN 2UXBF 3JTOA 3LAMA 1P8GA 1BWFO 4BC9A 1EX8A 2GJ2A 2P9NA 4DUZF 2VBWA 1HNIA 4HUEA 3AFGA 3MEEA 1RHUB 1EKSA 3D1HA 3P8BB 4J9RA 1W2BR 5J1NA 4NI2A 2MZSA 2E88A 4Y1CA 4C97A 2FDNA 4LF9F 3S41A 4JYAF 3ISNC 2G8VA 2HK2A 2YWGA 1RDDA 3GG4A 2DIUA 5IC6B 1YJ9N 2FHMA 1FD2A 2WVEA 1BLUA 2XYHB 3PKMA 1WSHA 3NCIA 1GMVA 4CLWA 2Q6BA 3SQGA 2FHKA 2OTLS 3BZQA 4MQ3A 1Y3KA 2V63A 1GLBG 2IMOA 1ELOA 4TY9A 3CCQN 3KKSA 1UVKA 4OYWA 2C2EA 2J9EA 1ATSA 4DPXA 3OYFA 4LFCK 1H2UX 3DFEA 4P73A 3S01A 3ZZTA 4BRDA 4Z4HA 2I5JB 4QU6A 1MN9A 3PIPQ 3MPUB 1MROA 3KLFA 4CIEA 1FJGJ 3DHWC 1P9YA 3KK2B 3LH2S 2ZH8A 3NOCA 1REGX 3A1YG 3P39A 3RG6A 1R7IA 2RRAA 4FLXA 3UDVA 5KG2A 2UUAJ 1B0TA 2D9OA 4IH6A 4H5WA 4L3QA 3RAXA 1XNQJ 2E5GA 1E6YA 1S5JA 2HVEA 4IDKA 1T6CA 3F9KA 5CZ1A 5CE3A 5ETVA 1HBNB 1U09A 2IVMA 4LFCF 1EXQA 3MXIA 3M6XA 5ITHA 3CJ4A 4QWEA 2ATCB 1SH3A 1YRUA 4CEFA 2YX7A 2KT2A 3ZZZA 1J53A 3QAEA 1T95A 3VA3A 1U2RA 3VQ8A 2AYEA 2QKKA 3HM9A 2D0OA 3DRSB 4DL6A 3SDEA 3TANA 1K9MO 3KG4A 2POKA 3THWB 2BACA 1KEKA 3BM7A 5FDLA 3H59A 4IEIA 2GS8A 3VHQA 3C6UA 2ZZTA 3S7RA 2HBLA 1SV5B 3SSRA 2MQMA 1R8BA 2Z1IA 3AA3A 3AY9A 4NXMJ 2OIHA 4EO8A 4TN2A 1HNXK 2NXUA 3SYZA 4CO4A 3M30B 3I31A 3HFZB 1Q18A 1SXLA 3GR1A 4RU2A 2IDEA 5BRHA 2DNPA 2QWLA 2A3JA 4B9NA 2CGJA 3MN5A 4J9VA 1VQLS 2E9ZA 1N54B 1S59A 2FUG9 2A40A 1FK9A 2F8TA 4YN3B 1VSFA 1QUPA 4WFAL 3GYGA 3C6TA 2DISA 3NAEA 3NKYA 2FVRA 4RUBA 1U8WA 2FC8A 2HS0A 4UQGA 3QJPA 4CJWA 3VALA 3TJAA 3HKWA 5D3GA 3VQ4A 5IS2A 1WBBA 2E1CA 4ICLA 4KR0B 5EX0A 1M90T 2HFZA 3L3VA 2IA0A 2ZM6K 2G2OA 3FBEA 2ZVSA 2XY5A 2A10A 1QVFR 3LP2A 4RNMA 1D4XA 3GZ7A 2F9TA 3MMVA 1L3TA 4CLUA 5HJYA 4OLBA 4M63A 3IXQA 3UR3C 3BZCA 3F56A 5GAGP 1RU1A 2WSCC 4M5IA 3MD1A 1NGCA 3QETA 4DG1B 2CJQA 1X4AA 1ZA2B 3ENWA 4ZPDA 3K58A 1TYQB 2AJ1A 3GV5B 2ASDA 3HSJA 1ZA1B 3CJ3A 2JX2A 1NMNA 2C3YA 3SQ4A 2AV5A 2ZM6F 2DNLA 5DM6Q 5JLHA 5E3CA 4YOUA 4Z37A 1VYAA 2OI2A 4BC5A 3ZO7A 1HNVB 1UFKA 4RWTA 4DV4K 2W42A 1AZSB 2W01A 5HI7A 4H0YB 1ZPVA 3DRPB 4P9SA 3D6HB 1K0TA 4A5AA 4JI6J 1I1GA 3O6WA 4ISEA 3DM2A 2YV0X 4P75A 5KG1A 1FCAA 3KUGA 4O3NA 2VG5A 4UY8T 3M05A 1GH8A 4MYUA 2Z1JA 1AFIA 4LH4A 1D9FA 3SEOA 3NBPB 2BR0A 3FGVA 2QWRA 4KRFA 1BQMA 3POTA 4JV2A 1SAZA 3BV8A 1EARA 3PW7A 1IV0A 4ZMMA 2N3OA 1UZHA 4DV4F 3TJ8A 4H5TA 5DZ6A 1Q5YA 3DGPA 2E66A 5K8MA 4B9SA 4LR8A 3FFIB 2KM8B 1Q82O 2CQ1A 4CH0S 2P9IA 1RNHA 1H73A 2I0XA 4CF8A 1YJ7A 1S4FA 5E7OB 4L3KA 4L74A 3BY5A 1YQHA 4XH4A 3GJSB 3KHHA 4YFUA 2D69A 4PCQA 3Q89A 3MCMA 1EQ0A 1P90A 4HACA 1XBWA 2RRNA 2RHSB 2D3UA 1HUXA 1KQGB 3IM8A 1JXLA 1Q8LA 2XWYA 2BOPA 4MK9A 2F63A 1TK0A 3CD6S 3ULHA 3AD9C 1HD1A 5JVGQ 3NH2A 2OTJN 4LRBA 1J5EK 4RNHA 3BN4A 4N5SA 4K2XA 3VQ6A 3W2WA 2YHWA 4Y00A 1NDLA 5B08A 3I9ZA 4OI3A 5A8KB 2CNOB 2YKMB 1ACMB 4FS2A 2Q79A 4BGAA 1SS6A 1QQCA 3M8PA 4R5PB 5B0FA 2EFPA 4BE2A 3I33A 1Y0HA 1CJTB 3CMAN 5C2GA 2OFHX 3R6MA 1EWQA 2QT7A 1C1CB 3GCWP 2BQUA 3GIRA 1Q8BA 2IJFA 3P45B 2DITA 4PAAA 3TUJC 2A2CA 3WXJA 2V51B 1VQ6N 1I94K 2D41A 3M8RA 1FI4A 2LDIA 2GQQA 3OHBA 3VQ5A 2VBZA 4E8UA 1J5EF 2WVCA 2W9BA 2V6AA 3TVKA 1CVJA 4DBQA 5DJBA 4C2MA 5E33A 5D4PA 2PDAA 2QLFB 2ABYA 2IC3B 2MLYA 1IJEB 4GKJJ 2ASOA 1NGDA 2JL9A 1HYSA 4EIAA 3M8QB 2O8BA 3OL6A 3QGPA 3CC2N 2YWWA 3EZ5A 3OLBA 3EGWB 4CZEA 2R4FA 4K4SA 2ZF5O 1HWUA 3GFXA 4Q8EA 1DTTB 4ZCIA 1FJCA 4M3YA 3F9MA 5C7PA 2QK9A 4NXNJ 4Q44A 3CD7A 1VC6A 1IM6A 3PG9A 4Y3CA 4IYQA 5C2CA 3MCAB 1TKXB 2PYLA 1EIYB 2BVZA 5JLFA 1I94F 3H6EA 5L46A 2AJQA 3E9LA 2EFGA 3SPYA 2SXLA 1SC4B 3G2XA 1LKZA 3OTEA 5KFNA 4X66J 1H2TZ 3KJFB 1HPMA 5HAOA 2XG8A 4ED4A 2KLAA 1DTQA 1K1SA 3KWGA 4DV6F 1YITS 2NRRA 3FEYB 3MM7B 3TYTA 2QA4N 1KOOA 1RT2A 3O80A 1X4EA 5I3PA 2AYBA 1FKPA 3MR6A 1L3KA 3T5HA 2CRLA 3MECB 5L8RC 1YJWS 3TX8A 3WX4A 2IBKA 5F3TA 3DLEA 3IWNC 1Z1ZA 1F0XA 3MM6A 1TFYA 4J5OA 2NRHA 3FFKB 1FRXA 4LR7A 1TELA 4IRCA 5KTQA 2FLOA 2FIUA 3BF4A 3T19A 5D15A 5AQHA 3EMTA 4CLSA 3WNHA 4HCBA 4FZXC 4FOEA 5C25B 4QIEA 2GCFA 5J2PA 1NZ8A 1NHKL 2K3KA 2C2RA 3AHPA 3MAAB 4WP9A 3SV3A 1X3NA 4JI7J 1Z4UA 1RJJA 1PG5B 3FK4A 5L39A 5L38A 1CJKA 3LPYA 2QTWA 4DOZA 1HI1A 3G4SS 1LV5A 2MSSA 4C7QA 4E7KA 1B0PA 1QJHA 5HRPA 5F9LA 4ZOSA 1CJVB 4F4XA 1WG1A 2EFNA 1FVQA 4OLOA 4QWDA 2CQ4A 1T3OA 4DX7A 2HSEB 2ZEJA 4B8CA 1QE1A 3TUPA 2P51A 1S12A 3CFPA 2X3DA 3TQ1A 3QO9B 4FWSA 3WQPA 2MYFA 4H0OA 1NHUA 3OTOJ 4NLWA 2HURA 1Q16B 4XEIA 3C3LA 3OYNA 3V6HA 5KG0A 4GO7X 2QIFA 2HRTA 4JN4A 4JK9A 5I3UB 4DTSA 4QWAA 2QL5B 2R8IA 1V9OA 3RR7A 3FEZA 2V8DA 1SH0A 2F5GA 3U27A 3VQEA 2YVSA 3MK6A 2OTLN 4HHUA 4JI1K 2FLLA 2XYPB 1VQ8N 5E2QA 4XH1A 2DTJA 2DRDA 3DCAA 1S1XB 4CEOA 1XNRJ 1TAUA 1BMQB 5KT7A 4KI4A 2F7TA 3MZIA 2W25A 2IM3A 3OJSA 5AJ3J 3ETMA 1K47A 2KZZA 5AQGA 3D2EA 4AL7A 5GAHI 2NLWA 1Z2LA 1OKJA 3OW2M 1VLOA 2IM2A 4LF4J 3K5LA 3LTOA 2QWNA 4PABA 1QTNB 3SFUA 3SQ0A 2XRIA 1RAGB 4FJ7A 3DXBA 3ENQA 3NS6A 2HF4A 4JI1F 2FGOA 3MXJA 4Z4FA 2VOPA 3IAM9 3N5BA 4IR9A 4DHYA 2UXDK 3ZX0A 3BO3A 1NB2A 1MN7A 2HBZB 3EXYA 4BG9A 4F3TA 1RWMB 4OI2A 3JQJA 3I8BA 5CABA 2OFGX 3QLHB 1TMJA 3SUQA 2ZD1B 5THWA 2CZ9A 5F0UA 1KFSA 4KBOA 2F4VK 1FXRA 2YX6A 4R8UA 4CJSA 4KJIA 3AVAA 2YWHA 2VFSA 3M6VA 2B9YA 2UXCJ 1EKEA 1B7YB 4Q2MA 3EKSA 1M5HA 3NEKA 1PYSB 2NZCA 2P9NB 3MWTA 5B0CA 4DLGA 3PXGa 3DRXA 4ZPVR 1ZBHA 3Q23A 4LJMA 3VAMA 2HRUA 4ED3A 2UXDF 1H6KX 4LF5K 3G82A 3MMCB 4NWBA 4FWLA 5AQOA 4BC4A 3KD5E 4CHYA 4J90A 5F9NA 1IBCB 1H7XA 1YLXA 1J5OA 4QS7A 4HKQA 5HL7Q 5GMDA 1KAZA 4F4YA 5M1KA 4NLSA 1Q9YA 5F8JA 1R0AA 2F4VF 2J6SA 1RLDA 3UE5A 1KCFA 3KLIA 1VQLN 4UUXA 2BTFA 2N82B 3TWZA 2JWNA 1C0MA 1S0NA 4LRAA 4RNOA 1Q7YT 1IQTA 2ZWHA 3E3XA 4A61A 4EEYA 2UUBJ 3X3UA 5BPMA 3KVGA 1TKZB 4CLTA 2BE9B 2X1AA 3NLCA 3JS9A 1TV6B 1T11A 1LOTB 4CGDA 4LF5F 1TL3A 2GAHC 3OS1A 1WD6A 3KLFB 1NK0A 4OKEA 4DPUA 4V19X 4TVAB 3TABA 4YORA 3H40A 2DY4A 2Q1LA 5LJ3Y 1SBRA 3AVJA 3LALA 1C1BB 2ZWPA 4ZLJA 3TEHB 3U8XA 2AGQA 4DV2K 2XI3A 3QESA 4L73A 2XO7A 2HWIA 5JMVA 1E6YB 4I0WA 4P6QA 4GC7A 2HMIB 1LW0A 1GXUA 4UOFA 4C11A 2YX1A 1FWKA 2J0XA 3ZLJA 4OYOA 4YOXA 3UN2A 3WNGA 2DPIA 4JBCA 1CC7A 2ZHAA 3EEQA 1RWKB 4CO1A 3PYEA 3KKFA 3CQ8A 4HTLA 2MB0B 1JWWA 3AB4B 1KLMB 1QLNA 2G8KA 2WW8A 2PEHA 1HWIA 3AO1A 3JXOA 3GFHA 2HHUA 5JICA 3MGJA 2Y9HA 1N6QA 3W9JA 4MO5A 3D2FB 3A3PB 2B6AA 2ZZNA 3VEWA 4DV2F 3BDPA 2NPFA 5FDLB 4M3XA 1ZYQA 1HLUA 2J76E 2PI5A 1N33J 2DHGA 4QW9A 5KFGA 4FZYA 1GNKA 4YOWA 1U1NA 3MN9A 2V2VA 2CH5A 2YHXA 1V3SA 4LFAJ 1TL4A 3CI5A 1BI4A 5CZVA 3N0VA 3R1HA 4I6AA 3NMUA 4DR3K 2OPQA 1XQIA 2CYYA 1UJ5A 4MAKA 4B9MA 3O5BA 1RWWB 3E01A 1CXQA 3CWJA 1IR0A 5AQZA 2PMWA 1Q1KA 2CQ2A 2OPPB 1FK9B 1HKBA 2D74B 4FO0A 3OFGA 2Z4PA 1Y4ZB 4JI4F 3ZNUA 3LUYA 1RT3B 1NPKA 3DU6A 1PYOB 3I32A 1CS4B 1FKAF 2WOMB 4H0TB 5D3GB 3HSGA 2K3IA 2E20A 4ICLB 3DC2A 3OT9A 4DR6J 4BACA 1AFJA 2ASYA 3WXLA 2ZJQL 4DQSA 3K2PA 2QGFB 4DR3F 2MKIA 5HBMB 2ETJA 3CJ2A 3OVSA 1J27A 1S3XA 1KAYA 4CFBA 3LP2B 3G6VA 4F3OA 4ID5A 3VGSA 5DS7A 2R8HA 4N8OA 3FGUA 3NS7B 1CXUA 2QYCA 3SI8A 3KUHA 3VGTA 1KQKA 2AEMA 5AQWA 4ZLNA 3C46A 3VMFB 2DO4A 2QWMA 4B3TJ 3PY8A 1RA6A 1WC4A 3SAGA 4JLHA 4CEDA 1JLCA 1RP5A 2FJEB 3C7NA 1TL1A 2X3GA 1M5PC 1FERA 3KLGA 3BSAA 1UW9A 4ECQA 1OH6A 2KHOA 1FT8A 4OGEA 3IAS9 4PZVA 4RW6A 3OSNA 1JLAB 4C3MA 2H3EB 4MIAA 3BSCA 4DL3A 3T41A 1NMEB 3PDNA 1NOYA 3UCGA 4ECRA 1HBMA 2L9WA 4BRAA 1OH5A 5HROA 5KG6A 1H1VA 1EKRA 4CT9A 4ZJOA 1RE1B 4LIRA 3LZJA 1N8RT 4FZZA 5A8WB 3DN9A 1KHWA 4DR7K 2R2RA 3OUYA 4LBPA 4NLQA 5CD4A 2YBVA 1JLFA 1QVFM 2E7XA 4PYAA 1U26A 3C19A 3IC1A 1APSA 3O9SA 5DGAA 3HSCA 2D1KA 1PBAA 1FNMA 3BH6B 2HQDA 1U1KA 2AGPA 1UWAA 1U2FA 1M5SA 1D8ZA 5BRFA 4H4OA 3OTCA 3VGLA 4M5JA 5EXWA 2YHYA 1BU6O 3GIIA 1O51A 2VV5A 4FYVB 2APOA 3L09A 1KVBA 3OYCA 2V34A 4U8YA 3VA0A 3UD5A 1IKXB 1VLYA 1QAYA 4IOBA 2VBXA 5IT9U 3I8DA 3EXCX 1NK5A 4DR7F 1HD0A 4JKGA 3NXZA 2P9IB 2V9WA 5HOOA 1GK8A 1WAFA 3OYDA 1IKWB 2RH3A 6AT1B 3V5RA 3GCXP 4DUYK 2DT9A 1MMNA 4ZVTB 4FM0A 4FJNA 3AVMA 1U7LA 4A8SA 4BROA 1PYTA 3MUVP 1WBDA 4X62J 2IVYA 3DLKA 5LJ5Y 2UVWA 2JLFA 4KGZB 1YITN 2P6TA 4FJIA 3EM1A 5KFYA 4OHYA 1HQUA 2CKWA 2PZSA 5A2QU 2DIVA 1BD6A 1V3RA 3UKRB 1G4CA 1RT5A 1OIAA 3ET6A 2I1RA 1YJWN 4DV0J 2ZQBA 5AT1B 3MN6A 4X4QA 3AOCA 5A8RB 2AQ4A 1CG2A 2AX0A 4DR5J 3DDNA 3L4BC 4DDFA 3IG1B 4DUYF 1TKDA 2A2DA 2QL9B 3FMBA 3NGDA 2EHGA 2NYIA 4E1NA 2XLIA 5IWAK 2GHPA 2WAQD 4QR1A 2RAQA 5C5JA 4FLTA 1YBUA 4E98A 2HHWA 3I5CA 4Z4EA 4JYAJ 3LGHA 4JKBA 2OP5A 1SVDA 2N7YA 2PAVA 4MYTA 3K59A 3AGKA 4KQZA 2KHDA 1BCMA 3UKUA 3AA2A 4I2QB 3T5KA 3KG0A 5KOWA 4LRFA 5I4MA 2KRBA 1S9FA 4PKGA 4RZRA 1XEZA 1EO1A 2YHBA 2EC0A 4IH5A 4RL1A 3P4IA 1DURA 5M2UA 1ZZFA 2WC9A 1RAJA 2H5JB 3G4SN 2B8PA 2DGQA 3A0IX 1RWOB 4EK2A 1HI8A 1WHXA 1J54A 4PL7A 2RQCA 2AJ4A 4AH9A 2FVSA 3T1YK 4QIGA 2DGSA 3TJ9A 2CH6A 2HHHK 2AKWB 3I4HX 3VF0B 4ZHRA 1FRLA 2CQ3A 5IWAF 1RADB 2CGLA 3AO4A 3P31A 4I4BA 1HYSB 1PJ6A 1TZ0A 2DY9A 4AYBD 1M5VC 5AQQA 3V1QA 2Z1GA 2X6SA 3AGRA 4OYBA 4CZHA 3Q8UA 2MDAA 1OYEA 4NOHA 1SUQA 2VZ9A 5KI6A 2IRYA 2ZH2A 1R59O 2HAFA 4JI0K 2PBDA 3GJRB 3V9XA 2Q3PA 3R27A 1SQFA 2YQ3A 5B0BA 2ZJPQ 3NP5A 1FFGB 5HQMA 4DN0A 4I7FA 4W90B 2CXEA 4ECWA 3B4DA 3T1YF 1E6VB 4F4ZA 3FBFA 3A3NB 2HHHF 3O08A 1BUPA 1YRXA 2XC9A 4O0NA 4CF0A 1ATRA 3CC4S 1RT2B 2I2YA 3ULEB 3OFEA 4CNYA 3PR5B 1X31C 3TA0A 4GV3A 3GFZA 4ID1A 4JI0F 4TSXA 5KFXA 1TUUA 3DLEB 3A8KA 2BW7A 2J8AA 4DS5A 1SC1B 3HVTB 3O1LA 3VCDA 2DNKA 1YT3A 1VHFA 1YKWA 3NGUA 1RBLA 1JCFA 1RTIB 4EP5A 2O8DA 4FJJA 5J2PB 3M32B 2YH0A 1TGOA 2JZ5A 3M8SA 3TAMA 2F7VA 4B1WB 2FBTA 3BZKA 1K8KB 3CCES 2HQCA 2HFVA 1KVCA 4F4KA 4Y28C 3HLUA 2H4WB 1GMUA 1NGJA 2QV6A 1DQ9A 3HCXA 1LWCB 4AHTA 4AHSA 2OHDA 2OKQA 1S6OA 4BHQA 5CZ2A 3ZEUA 3I0SA 2KJVA 4CLKA 1JJ2R 3VETA 3V4MA 4ED5A 4FN5A 2C2DA 4WQ5C 4WQ4C 1VQOS 4R25A 1C0UA 4ZP8A 3PIOL 3PJ9A 4G1PA 2FD2A 2YPYA 2IVOA 2EXUA 2C3PA 1RHMB 1UA0A 2J0WA 4CT8A 2V94A 4WP8A 1RHRB 1GXTA 1SJ3P 4IFVB 5D0EA 3NCPA 2BRKA 2ERRA 3FLCO 3GIKA 1EB0A 1TKTB 1YBTA 1FJGK 4Z4CA 1H72C 4OZ2A 4ECXA 3CMQA 1PAEX 1L5UA 1R6VA 3CE8A 1A5WA 1UAWA 1Y9OA 3T9NA 3J81O 3VAIA 1S1TB 1PJ5A 2UUAK 2NUUG 3PJWA 4WYLA 2ZC4A 4QOTA 3FZHA 4H5NA 4L3NA 4O44A 2ASLA 5EWFA 3ZT1A 4C3KA 3D45A 1VIOA 4CGHA 4F3QA 2GA7A 3Q8SB 3D2EB 2M3DA 3LM9A 2MKCA 2RKIA 4HH1A 3D68A 2ALZA 4UOGA 4HVJA 2CIMA 4PUOA 4EP4A 3P96A 1NGHA 4KKOB 4LSNA 1FJGF 3QBWA 4BBYA 3BGFA 2QSFA 1RDAA 1KD1O 2WBMA 2B9WA 3CCMN 1RU2A 1WOSA 4X4RA 2AX1A 1S1WA 3CT9A 1B92A 3G6YA 3BP8A 2IOCA 2UUAF 1S57A 5EWEA 5D4OA 4A62A 5D4NA 4I9QA 3CJ9A 4BR4A 4YDUC 5ETNA 2ZBIA 1TL7A 2ZJRQ 3CPEA 4TU8A 1G1XA 2D0CA 4RNNA 4R8UB 4CHNA 3VGUA 1EX4A 2IBOA 1Q8KA 2QSWA 4NXMK 3C95A 4B9LA 1IQZA 2QE5A 2KU7A 3J81Y 4NYOA 3P3DA 3CJRA 3EE8A 4CJ4A 4RUAA 1MSWD 2A3ZA 3TZXA 2V8VA 1RXOB 2YKNA 1D9AA 1S10A 1KKHA 4K4WA 4FM1A 4OYIA 2LP4A 2IIHA 4LBIA 3G82B 4QW8A 2ZKTA 1J6ZA 4U7UD 4GMJB 2CADA 3FCWA 3BGUA 5JJBA 5JS2A 4ES1A 4RW9B 3UPFA 1AW0A 1J5OB 3MPDA 4X64F 1IG9A 1TAQA 3MPVA 3Q86A 3O6QA 2Q31A 5EX3A 2KTQA 4GV6A 5H9EK 1U0SA 3PNIA 2HLUA 2DH7A 4GRSA 2P9SA 4LRDA 2CQIA 5FRNA 1T9YA 3G8SA 3PCOB 3K5OA 3VF2A 3W7BA 1AUSL 3ZX3A 3QINA 4PG8A 3TARA 3QEWA 4LSLB 3TTCA 3AO2A 4DTRA 4HR2A 5KFJA 2QO3A 2V2QA 3J8AA 2IAJA 3DXKB 1VQMN 5J1EA 2XO6A 3QEXA 1MWQA 3NVKA 1UPPA 2V7ZA 4NCGA 1RZMA 3VQQA 3V6JA 2GMJA 2QLXA 2BKPA 2OGUA 2BH1A 3SIPB 4CGIA 5IM0A 2QI2A 2NXCA 3R5DA 4ZVRB 2PN6A 3P5JA 1FX2A 1O5JA 4RCHA 2DGTA 3SXLA 7FDRA 5AQIA 3H5YA 2J0SD 4CHZA 2XS2A 1BA0A 4YP3A 3C0BA 1RAAB 4A8YA 3CJBA 1IR1A 4F4WA 3J7A1 4ILMA 4XDDA 3FZFA 2XWXA 5GADI 4DTNA 4M3RA 4FVUA 3QSIA 3DLJA 5IT9O 1KSPA 3L9ZA 1R0CB 1NXIA 4LMZA 4B02A 4C11B 2A0FB 2ZUAA 2P5OA 1MU2B 5FROA 1AA1B 4X84A 2ZH7A 2E6LA 5FPEA 4CI0B 3K5MA 3J80O 4NX9A 3O3HA 1N6QB 4XPEA 1RYSA 2VWJA 3M1VB 3KHLA 4NLCA 4FM2A 3JAMO 3W63A 3F41A 4NE9C 2F9WA 3E51A 4LQ3A 3K57A 4JI6K 2DGVA 3EKUA 5C42A 4ANEA 3D5MA 4TLRA 2B51A 3UR0A 4DPWA 4DN9A 4A48A 3ZXWA 1B64A 3Q7BA 3H2UB 3B6BA 2R7OA 1SKRA 1I94J 3RMCA 3V4IA 3SMZA 1TUWA 1FXLA 4IKFA 4EO6A 2N4CA 4DQPA 1F9HA 1DY3A 4LF1A 4AHRA 4DB3A 1BI4B 1JL2A 4QZVB 4J9OA 1TUGB 1BIUA 1OVYA 1W26A 1WOOA 5AQJA 1C0TA 3JSMA 4HH0A 4CLLA 4NCAA 2MQQA 3PR4A 4NLTA 2F8EX 5F41A 4DV6J 2O8CA 1RCOB 3L3UA 4HUGA 4W5NA 4XIUA 2LA6A 2Y3YA 4HT5A 2LXIA 3HT3A 3TAGA 5JVHL 4JI6F 4K4ZA 4IQXA 1JLGA 4MFBA 3HZ6A 4CK1A 1RFQA 5EN1A 4HDGA 1E4FT 1QZ5A 2RE1A 1WC1A 3J80Y 2VYPA 2GZOA 1UFLA 2WONA 1RDUA 2XSJA 3JAMY 1OY8A 4DPTA 4BR2A 3DU5A 3L3CA 1GOBA 3E8OA 3WXIA 4MKBA 3UN3A 2UU9J 4KH4A 5DLFA 3SUPA 2HVZA 2M0GB 3OS0A 2DVIA 1JLQB 3CMES 3QBXA 1OSDA 4XTTA 2CDRB 3FUYA 4CZIA 1IH7A 1UMJA 1NSKL 1HNZJ 3D66A 4OJHA 3B4MA 4ID5B 5GIOA 2NSBA 2NRWA 3RB0A 3K89A 3ATUA 2E9TA 1M5KC 2DRBA 4KSEB 3ENHA 3EVOA 4RBVA 1LFWA 2V4QA 2QFIA 4C8MA 4C8ZA 1NM1A 5KG5A 1K73T 1D9DA 3D0IE 4B08A 3C7NB 1TL1B 4P2MA 3O9QA 4ES3A 5KPZA 3FR0A 2HHVA 2F8HA 3Q8QB 4NLGA 3UVJA 1UL3A 2HKEA 1TVRA 2KHCA 2QMUB 2J7KA 3SJJA 4OLPA 2P9KA 4ZPTR 3GV8B 2Q6CA 3A8IA 2R2SA 1WHWA 3RBEA 4FS1A 1GLFO 4ECTA 1VC5A 5DQGA 4B1ZA 5GAHU 5C2FA 4Y2CA 3D0GE 4ZJQA 4G9ZA 5B0DA 1HFEL 2CZ4A 3VVUA 4GKJK 1OH7A 4TLQA 4I68A 4FWPA 2W1BA 2ZH9A 2CQCA 2OD6A 1WC3A 1FEHA 3SUOA 2BANA 5B09A 1T9TA 2ZE2A 1S0OA 2XLJA 2VIHA 2HFOA 5TKWA 1IBMJ 1JMTA 2E5LF 5B7WA 4UQTA 4HTIA 3MURP 2B8QA 3WDOA 3KDOA 1K8AT 3SNNA 2QG9B 3EPGA 2M8DB 1OY9A 4P71A 1JB0C 3A2FA 2K2PA 4F3MA 4JEPA 2GO9A 3AD8C 4LF6K 1DZ5A 2DKOB 2VQEJ 2QWOA 1HL6A 4FXDA 4IWVA 2K8GA 5G0RA 4X66K 4J9UE 2V0NA 3ZCMA 2OANA 5I9EB 1R0BG 3ISZA 3ILLA 5EGYA 4J37A 3TA1A 3NF9A 4OPAA 4WWSA 3AQOA 4WFYA 1EQMA 4GKJF 4IZ9A 1H2VZ 4JI8J 5KFPA 3Q7CA 1BC6A 1MMDA 3KK2A 4CQ1A 3A5OC 4QS9A 4WYWA 3W3DA 2QL7B 2NS1B 4Z7YA 2HF3A 4CYUB 1EAYC 1R31A 1SL2A 2DR6A 4ZK7M 4DUTA 4CO3A 3E9OA 1XUPO 2W8LA 5G4DA 3MMAB 5E3QA 3DLKB 1YG0A 3CXCR 1KVAA 4RUHA 3G6XA 4MLEA 2VG6A 2HQ3A 3LQVA 3CJKA 3OD2A 2EC2A 3GIJA 3K9KA 1HQUB 1VQSA 1HX1A 1BO5O 3NMRA 4LF6F 2D0AA 3R7SB 3CC4N 3RSEB 1WOQA 4R79A 3PYGA 1HBNA 4C48A 1IM4A 1RT1B 1FWLA 4X66F 4C98A 2HHTA 2VFUA 5SWMA 2Z57B 4WFNQ 1Y00A 1WI6A 3QYYA 2QEXS 2ZGZA 4DMZA 3HK2A 4KE5A 3IR7B 3TUZC 4N76A 3HVWA 4KB7A 3NCQA 3KG1A 4JI7K 1CULB 4A59A 4EI2A 3SBGA 2PI4A 4GVBB 5AZIB 4CJKA 4NEYA 3CCEN 3ILOA 1SV5A 2HAIA 5AXLA 4QQBA 3H5UA 3VZHA 3OHRA 3V9UA 2VJUA 4OQJA 1LCUA 2RPIA 4JD2A 2UUTA 2FY1A 4Y1DA 1K9MT 2VFTA 3OTDA 2H51B 3OTOK 1YIJS 4O3RA 5K20B 1NGBA 2HBYB 3M30A 2NNWA 1YWXA 3RWUA 4KO0B 4LC9B 1WSVA 3DOMB 4U8VA 1WKLA 4A8KA 3D4JA 1TR0A 4O4RA 4UW2A 4JI7F 4EHUA 1WEXA 4FYXB 2KI2A 3CJSA 1Z6RA 2Z2ZA 3VV2B 4RWWA 4RW4A 2C2NA 3HVRA 1TMMA 1JXVA 3QERA 3HT0A 1SUQB 1V4TA 4E1MA 5LSLA 2RDDA 3GJQB 2RVJA 3TTDA 4FWQA 1XNRK 3EVMA 5AQTA 5ADZA 2OEMA 4RNFA 4ZVPB 3OTOF 3FBCA 3O5TB 5AJ3K 5LL6d 5DG9A 3S8SA 3DLLL 1IKYB 2DHAA 4PQAA 3J81j 1HWJA 2ROGA 2C22A 2MJUA 3CJA