1RT1A

Crystal structure of hiv-1 reverse transcriptase complexed with mkc-442
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
539
structure length
538
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Complexes of HIV-1 reverse transcriptase with inhibitors of the HEPT series reveal conformational changes relevant to the design of potent non-nucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 147
structure length 538
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt1A05
1VSDA 4BWMA 3RB6A 5HLFA 1ZETA 2E6LA 3CJ3A 4ZVEA 5F9LA 5KFDA 4CF2A 5L1JA 4CJRA 1S9FA 2GV9A 1WSFA 3AO5A 3V4IB 3KD1E 1FK9B 3VQ6A 4KPYA 1YVUA 1S9GA 1S1VB 4ED3A 4FW2A 2PZSA 3IS9B 4FJHA 2BR0A 5KFZA 3LAKA 4CF1A 3CWJA 5JUMA 1RBVA 1GOCA 4HVJA 3NE6A 4KRFA 1TKTA 4PWDB 1X1PA 4EBCA 3K59A 4ELVA 4RW9A 4FJJA 2RPIA 4NZ0A 5D3GB 1HNIA 5KT5A 1RDDA 1Q8IA 4I2PA 3CJ2A 5F8NA 5KT6A 4FZXC 4CJTA 3RMCA 3EZUA 2EHGA 1XR5A 5F8GA 3HYFA 4WZMA 1T03B 3NH1A 1HQUB 3CYMA 3DM2B 4EZ9A 4EYHB 3OYKA 2HW3A 4CHZA 2VG7B 4RU9A 4KAIA 4RUCA 3KLVA 4CFAA 1QS4A 1XR7A 3OYGA 4E7JA 3I8DA 2AGPA 2X74A 2AX1A 4C8NA 4NLYA 3UR0A 3KLEB 3GV8B 1XI1A 2C22A 3KOAA 2IJNA 2BQUA 3NGDA 3LANA 1Z25A 4KHNA 3ZSWA 4CJWA 3O3GA 4CFBA 1NKCA 5KFEA 1JLCA 3OSNA 3V6JA 3TARA 1HQEA 2HMIB 1GX6A 2OPQB 4JS5A 4KHMA 1TL3B 3QEVA 5HP1A 1LWFA 1BISA 3T5JA 4NLTA 3MXMA 3KHLA 4FS2A 3HPOA 4ECXA 4DF4A 4F3OA 3QGHA 5KFAA 4HUFA 5DQGA 1TK8A 3ZCMA 4IOBA 1CZ9A 4M94A 2IAJA 4AHCA 4DQRA 5KFKA 3OL6A 1OS5A 4CK1A 3OYMA 3PJXA 1T3NA 2QK9A 3PO5A 4JS4A 3MFIA 4DF8A 4RZRA 4EBEA 1QHTA 1N6QA 3OYNA 1LW0A 3C6UB 4NLVA 2VG5A 2JEFA 4KSEB 2FVRA 4O3PA 4R8UA 5JXSA 4F4ZA 1NJZA 1DLOA 4N56A 4DTXA 5C5JA 3LPTA 2BANB 1JXEA 4CEAA 4IG0B 3PY8A 4Q0BB 3S3NA 4CJVA 4W5TA 3KLFA 5KT7A 2D5RA 2XWYA 2PYLA 2RDJA 4Q44A 3MXJA 5J2PB 2UVUA 3CFRA 1RT5B 3RMBA 1LWEB 1TV6B 3QIPB 3JSMB 4CJUA 4FZYA 2B6AB 4O3OA 3K2PA 4WFXA 2VWKA 3ALYA 4EP4A 2XCPA 4YR0A 5DQHA 1RT3B 3BREA 1N48A 4M42A 2FVPA 2HHQA 4RW8B 3CG7A 1SKRA 3OYHA 5I42A 3MR5A 1CXQA 4ID5A 1WSEA 4BACA 4FLYA 1SUQA 3NBPA 4DL4A 3H5UA 3H2LA 1YTAA 1BIUA 1XHXA 5DLGA 1VRTB 1S6QB 3QO9A 5J2MB 3VQBA 1KCFA 3KKRA 1R0AA 1KLMA 2FJXA 3AVHA 3SFUA 4LSNA 2XC9A 3L2QA 2W8KA 4CJ3A 1WN7A 2R2SA 2BRLA 5L1LA 3H59A 4M3RA 2FLPA 3E01B 4J9RA 1JLQB 5KFQA 4DTRA 4DSLA 1KVAA 4AH9A 4KFBA 3IRXA 4OKEA 4CE9A 4ICLA 1A5WA 1RTHB 4M41A 2FLNA 1N5YB 2WOMB 3PHEA 4Q45A 1KRPA 2WB4A 3BGRB 2J6TA 3CM5A 3ZT4A 4JRQA 4U7CA 3OS2A 2FLLA 1RBTA 2NUBA 3V1RA 2I5JA 3TAGA 4FK0A 1TQLA 3FSIA 1IKVA 1CLQA 1QSLA 3MAQA 1JXBA 5J2QB 4OGEA 1BCOA 4IH6A 3KNAA 1X9WA 4CGIA 4KKOA 4RNOA 3C6TB 2AGOA 3QNOA 3MEDB 1TP7A 2BE2A 2R8GA 3O3FA 1SL1A 2A1RA 2XCAA 3RB0A 3MEEA 1BQNB 5KGXA 3DMJA 1J54A 4DU3A 1Z26A 1FKPA 4DLEA 4FVMA 1JIHA 1S1WA 1QAJA 3A2FA 3LP1B 3RR7A 4E7LA 4UQGA 4CCHA 4F4KA 4F4XA 4J2AA 3U3YA 2VWJA 3SYZA 4J9KA 4ZVHA 3UPFA 4LD0A 4FM1A 1JXLA 5EWFA 4GW6A 4RW7B 2D0BA 3M8RA 3MEGA 2V4QA 2UVWA 3GQCA 4DQSA 2JEIA 5CYQB 2J6UA 2G8UA 3KHRA 1BIZA 5J2NB 1NJXA 3EYZA 4H4MB 1C1AA 3LAMA 3KK1A 3AO4A 1WAFA 3QGGA 3QIOA 3HP6A 2J6SA 3TQ1A 4CJFA 2P51A 1NK9A 3OHBA 4O4GB 1J5OB 1EX4A 3KK2B 4FJ7A 3KLGB 4ED0A 4IG3B 4NLXA 3NGYA 4F4WA 4Z4CA 1HYVA 4J9NA 1IM4A 4Z4GA 2ZD1A 3HVAA 2WK4A 3KJVB 1SH2A 3TAMA 4GMJB 2I1RA 3Q8RB 4CERA 4AHUA 2RKIB 3QLHB 4ECTA 3ITHB 4CIEA 4CEDA 4MKBA 4CF8A 1TKXB 1U04A 5KG6A 4Z0UA 3H98A 3OYBA 3OJSA 5K14A 4DS5A 1YVFA 1RT2A 4O0IA 2JLEA 2F8TA 1S1TB 3BDPA 3V6DA 3LZJA 3KMSA 3D5MA 4PUOA 2R2UA 4CJ4A 3SQ2A 2R8KA 3GIKA 3OS0A 4J2DA 2IM0A 3AVAA 4O4RA 1L3SA 5HBMA 1EP4B 3KD5E 3ZT1A 1RTDB 1KFSA 2B5JA 1S4FA 1NK7A 3JYTA 3NFAA 3ZSZA 2IJFA 1VSKA 1U4BA 4L8RB 5KT3A 3I5AA 3PW4A 2P5OA 1CXUA 1TKTB 1U09A 3M9NB 2G8KA 4J9PA 3PX0A 3KLIB 2O4GA 5DK5A 4RW9B 3KLHA 5F8MA 3NH2A 3C94A 2FBTA 3NKYA 1YT3A 4LY7A 1RDAA 4CJKA 3OL8A 4DMNA 3L2WA 4OPJA 2D41A 4FYDA 3PW7A 4WYWA 4GVMA 3C95A 4FJGA 4FM2A 4FXDA 1CSJA 2DFEA 1DTTA 1VSJA 3AA5X 4NLRA 4ED7A 4TLRA 5DQIA 4KAZA 2DY4A 5KT4A 3V81A 3RRGA 3OJUA 4HCBA 4TYBA 3PW0A 4F2SA 1RILA 3DRPB 1KHVA 4O44B 2HNDA 2X6NA 4R0EA 1XWLA 3IG1B 3DDKA 1L3VA 2ZE2A 4KHWA 4F8RA 2VG6A 4IH7A 4Z4FA 1S1UA 1D0EA 4ZP7A 2OPRB 2R8HA 3VQ5A 1FKOA 4LQ9A 5EWEA 1HQEB 3DI6B 2HB5A 2IM2A 4K4VA 1XC9A 1L3UA 2HHUA 4MFBA 1LWFB 4XPEA 1RDRA 1ITGA 4CIGA 1HPZA 1JKHB 2FBYA 3AVFA 4HUEA 2ATLA 3Q8QB 4R5PB 3KHHA 1UA1A 2IAJB 3LP3A 2GBZA 1X9MA 2IM1A 2W7PA 3DRRA 2IC3A 4OL8A 1QE1B 5KFBA 4JLHA 1VRUA 2FVQA 4ZPCA 2IGIA 2YKNB 2C2EA 5KFTA 4U6PA 1O1WA 4E3SA 4ZP9A 3GIIA 1N6QB 2VG5B 2ASLA 3SQ1A 4KBIA 4OKKA 3LP0A 4Y1CA 4F4YA 4DTMA 4CF9A 3KKSA 5JS2A 1QSSA 1I39A 4TY9A 1IKXB 3DOLB 1ZTWA 2JEGA 2D3UA 1BQMB 4I7FA 2KFNA 4CFDA 3T5LA 3GILA 4URGA 4NLSA 2F96A 4ECQA 3G10A 2VA3A 2OPPB 1S6PA 5I3UA 4NYNA 2XRIA 2XY6A 3DLEA 4O55A 2KZMA 3PW2A 1LW2A 4G1QA 2WHOA 5KT2A 4LH5A 5CY4A 5KRSA 1NK8A 1WLJA 2YNFB 1C0UB 3DLKB 1SUQB 1KFDA 2Y1JA 3M8PB 1TKZA 3I0RB 1S9EA 2DPIA 3THVA 4FLTA 1T05A 4HCCA 5C25A 4K50A 3QGIA 3OYFA 4DTOA 3H08A 1KLMB 4K4UA 4CHYA 3L3UA 2E6MA 2HHXA 3SZ2A 1SKWA 3O3HA 3G86A 3D45A 3M8QA 4CIFA 4KREA 3I0SA 4J9SA 5KFFA 2W9BA 4LSLA 1RT7A 2FVCA 2ZKUA 4TN2A 4Q8EA 2AJQA 4DL7A 1NJYA 4IFYA 4IFVB 1TL1B 3CIZA 4ZP8A 1IKWB 3DLBA 1YTUA 5C42A 1RT1A 1TVRA 3CQ8A 1C1CA 4NRUA 2D0CA 1JLAA 2R2TA 4YR2A 3RMAA 5F8IA 4DL6A 1LWCA 2I5JB 5FDLB 4JV2A 4AILC 3RWUA 4Z4HA 3D28A 3CJ5A 3G6VA 4ED1A 1S1XB 4URQU 4O0JA 4OGCA 2HWIA 4RW4A 4FJLA 2HHSA 2YHAA 4XIUA 4ZHRA 1S48A 3O4QA 1RTJB 4YFUA 1S0MA 4FJNA 2IBKA 3HVTB 4DQPA 4CHNA 2WONB 3LP2A 1NK6A 2Z1HA 5SWMA 1NOZA 1HNVA 3QEIA 3DRSB 4E7KA 1J9AA 2IDOA 4DG1A 1RDBA 2KFZA 4CESA 2FVSA 5J1EA 4PQUA 4J9QA 1MU2A 4PA1A 1B92A 2OYQA 5JS1A 4KB0A 3V9ZA 4DSFA 3ZSRA 3ZT3A 4N5SA 2HNYB 4IDKB 1JLEA 2WTFA 4NLGA 2FBXA 1C1BA 1RT4A 1EKEA 5HRPA 4Q43A 3RMDA 3V6KA 1QSYA 2JGUA 3NHGA 1NKBA 4B3OA 3RR8A 1RTIB 1SV5A 4ELUA 4JV0A 4NCBA 3MR3A 4KHUA 4TQRA 3RBEA 4EP5A 1ZBIA 1BI4A 1JL1A 4DFMA 1KLNA 4O3NA 4CEZA 1TK5A 2IM3A 3VQDA 1NOYA 3PZPA 4DU1A 2RF2B 4CJPA 2YKMB 1JLGA 3U3GA 3AO3A 4I2QA 4NCGB 1LAWA 2IA6A 3L3VA 5FRMA 3HKWA 2XY5A 1S5JA 3CFOA 3D0PA 2W9CB 3TABA 4FK2A 1D8YA 4MH8A 2ZD1B 3GIJA 3IN5A 4QWBA 1FK9A 1S1VA 4WE1B 4ZTJA 1RCHA 3G6YA 4KV8A 3TAMB 3OL7A 3NAEA 2XGPA 2AQ4A 3V9XA 2UUTA 3BQ1A 2YNIB 3DLGB 3KK3B 4E1MA 4OPKA 4HUGA 3SV3A 2W9AA 1NK0A 3TVKA 5DGAA 1WNSA 3PO4A 1GOAA 4IKFA 1QQCA 1ASVA 3DLRA 5EDWA 2D7SA 5D3GA 5DG9A 3DOKB 2UVVA 1TAQA 2YNGB 4OLAA 3VQQA 4DEZA 1HRHA 1I3AA 1NNDA 1Y97A 1NJWA 2YNHB 1T03A 1HQUA 3DM2A 4PUOB 3QINA 3TAFA 3H40A 2VG7A 3MR2A 3BSOA 1VSFA 2RN2A 4Z4EA 1JLFA 1C0TB 4I9QA 4NYZA 5HBMB 4QW9A 5CZ2A 4QWAA 4RUAA 3NF6A 3LDSA 4AHVA 2B5JB 3JYTB 2HHTA 3BR9A 4E1NA 4QCLA 5KFRA 2R8IA 2YHBA 4RW6B 3QESA 5DG7A 2O4IA 1RT6B 2KQ2A 2XI2A 3VQPA 2HMIA 4ZMMA 4B8CA 4CEEA 1W25A 5HRSA 4WZQA 2ZQBA 5C24B 3QEWA 2GIRA 5T7BA 2RDIA 1S0NA 4KHSA 1U49A 1SL2A 3SFGA 3E51A 5L1KA 2E9RX 1F21A 1DTQB 2ILZA 1XR6A 5KG5A 3T5KA 3CDWA 1DTTB 2V4RA 4DL2A 2QKKA 4XO0A 1CZBA 4ZPDA 5DLFA 5HROB 3BSCA 4ZPBA 4IRKA 2BGGA 3SUNA 4K8XA 1IKYA 4MK7A 1Z4UA 1BL3A 4CHQA 3SQ4A 4NLQA 3CJ0A 2HAIA 4NLWA 2X6SA 1A5VA 3C6UA 3V9SA 3IAYA 4IR9A 2LSNA 3L2RA 4IG0A 3ZSYA 5CYMB 1HPZB 2OZMA 3F73A 2EX3A 4LQ3A 3NGZA 4CEFA 4KO0B 4B08A 4CGJA 1LWEA 4E0DA 1TV6A 3QIPA 1N56A 3JSMA 3HO1A 2P1JA 2E9TA 4DL5A 2B6AA 3SUQA 3QZ8A 1D1UA 1QUVA 1RT3A 3PR5B 2V0NA 3ULDA 2PYJA 2O5DA 3WNEA 4CGHA 4DWIA 5KFPA 2OPSB 3TANA 3T3FA 4O3QA 2ASJA 1S6QA 3RAQA 4X2BA 5J2MA 5KRTA 4C8OA 3K5NA 2G8FA 1RAJA 4W5OA 3NF8A 4M45A 1LV5A 1JLBB 1HYSB 2FC0A 1IO2A 2JC1A 3TI0A 4KTWA 3E01A 2E4LA 1VSHA 4DFKA 4K4TA 5HLFB 4ZVGA 4B9LA 3VQ4A 1JLQA 3CJ4A 4LH4A 5KFWA 2G8VA 1D9DA 4EYIB 1NHVA 1RTHA 4QWEA 3HK2A 3PX4A 1S6PB 1S9GB 1N5YA 3VQSA 3TWHA 2R7YA 3HP9A 2WOMA 4Y34A 2BQ3A 1RYSA 3BGRA 3HL8A 3BQ2A 4URSA 5J2QA 2HWHA 1S10A 4NYFA 4CFCA 2UUWA 4J9MA 3OYIA 1ZBHA 3C6TA 1HNIB 3OYEA 4F3TA 3AA4A 3MEDA 4I2PB 3AV9A 1HMVA 1TKDA 1RA6A 4CECA 4FK4A 3VA3A 4J2EA 1BQNA 3M8QB 5KTQA 1RBRA 5KG4A 4B9UA 2XHBA 3K5OA 3I0SB 3NAIA 3LZIA 4DSKA 3QERA 3LP1A 3LWLA 2KZZA 5KFSA 1K1SA 4IFYB 5T14A 1WSHA 4BWJA 4WYLA 4YQWA 4DTUA 1I6JA 4N47A 4RNHA 4K4YA 4B9NA 5KG7A 3BJYA 1C1CB 3OSPA 4M3UA 3V9WA 4FBTA 4RW7A 4ECVA 1EETA 2AU0A 4CGDA 4ECWA 1JLAB 2IS3A 1VSLA 2WRMA 4DSJA 5CYQA 5KFXA 3NF7A 4W5QA 5J2NA 1JLCB 4PY5A 2ASDA 4AHRA 3H5YA 3QNNA 4Y2AA 4RW4B 3L2UA 4H4MA 5HP1B 2Q3SA 4FJ9A 5KFOA 4CHOA 3T19A 3S9HA 4E7HA 3ZSQA 4NLPA 2G8HA 3AVIA 4O4GA 4DSEA 3VN5A 1J5OA 3SV4A 3V1OA 2PY5A 3P1GA 3KK2A 4DL3A 4MQ3A 3OLBA 3KLGA 1T8EA 4CJEA 4FJKA 4QPXA 1KVCA 2B4JA 3VQ7A 1REVA 3ZSVA 3NCIA 4FCYA 3TAQA 3RRHA 3TAEA 3QZ7A 4OJRA 1EXQA 3PW5A 4DQIA 2ITGA 3AVJA 3IGVA 1LW0B 2ILYA 4Y1DA 4R8UB 5DG8A 1DLOB 1UWBA 2RKIA 3ITHA 3QLHA 4ED6A 1S97A 3SJJA 1TKXA 1ZBLA 5F8HA 1Q9YA 3KLFB 2QXFA 3GV7B 3L8BA 4FJ8A 1T7PA 4CK2A 4J9LA 3NH0A 3SI8A 3SUPA 3M9MB 3CDEA 4MK8A 3MR6A 3P5JA 4DS4A 3WNFA 1RDCA 1NK5A 1WSJA 5I42B 2HNZA 1ZBUA 4FJIA 4FJ5A 3CDUA 5KFNA 4ID5B 1S0OA 1KHWA 3NBPB 1J53A 4KI4A 4ECYA 1EP4A 5KFJA 3MFHA 1RTDA 3QO9B 3ZSXA 4O5BA 5L9XA 4DTPA 4Y3CA 3FQLA 2XGQA 2C28A 1R0AB 4KV8B 4KHRA 4FLVA 3AVBA 3F9KA 4TYAA 4LSNB 1U45A 2C2RA 1JX4A 4B9MA 5F9NA 4DTSA 3FFIA 4JUZA 3AVCA 4DTNA 4IKAA 4CEBA 4CHPA 3V9UA 1TAUA 1KTQA 4FLUA 5KG0A 1ZYQA 1RA7A 3KLIA 2F8EX 5DMRA 1RYRA 3AVGA 4KFBB 3IRXB 4BDPA 4FS1A 4ICLB 4IBNA 2A1SA 4CEOA 4BE0A 4O3RA 1L5UA 3N6NA 3NGIA 3AVMA 4M3XA 4QAGA 1X9SA 4ECRA 3U6FA 4WFYA 3T5HA 1C6VA 1UA0A 1SH3A 1IKVB 1JLFB 2E9ZA 3SCXA 1TGOA 3Q8SB 4TY8A 4HYKA 3OYJA 4DFJA 4DQQA 4RNFA 1L3TA 3DRPA 4J9OA 4O44A 1C0MA 4KKOB 3IG1A 2W7OA 5F8JA 4DSIA 4Q8FA 5KFLA 2DFFA 2BE2B 4IH5A 4KB1A 4H8KA 3GIMA 2OPRA 3MEEB 3N6MA 2XI3A 3DMJB 4TSXA 1FKPB 4F2RA 3DI6A 3QYYA 1S1WB 3VQCA 1JKHA 2ATQA 3OY9A 4CK3A 3S3MA 3WNHA 3HVWA 4Q5VA 4M3WA 4H4OA 3H4BA 4M95A 3O4NA 4R5PA 3MECA 2HHWA 4QWDA 2C2DA 1ASWA 3MEGB 3H5XA 4DTJA 5KI6A 2BDPA 1QE1A 2G8WA 4KI6A 3HHKA 2OH2A 4RG8A 1IKYB 4FM0A 2OZSA 4ZPAA 3HJFA 2YKNA 3KK1B 5KFIA 4AHSA 1B9FA 3VQAA 4B8AB 4ECZA 2JEJA 1RBUA 2IOCA 2Y1IA 4W5NA 3FQKA 3DYAA 4W5RA 1LAVA 3BSAA 3Q8PB 1W9HA 3V6HA 5KFCA 4EBDA 1SH0A 1D9FA 3TAPA 1IH7A 1IKXA 3DOLA 2QV6A 2HVHA 1BQMA 4QWCA 4ID1A 1TK0A 4NLUA 2FJWA 2HHVA 2R2RA 3V4IA 2OPPA 1NK4A 4IQXA 3MF5A 5EU7A 4E19A 1SL0A 3IS9A 4IR1A 3RAXA 1UOCA 4NCAA 1ZTTA 2YNFA 1C0UA 3DLKA 1W0HA 1MMLA 3M8PA 3OHAA 3I0RA 1A5XA 4PWDA 3BSNA 2XO7A 3H5SA 3S3OA 1JL2A 3K5MA 4K4SA 3FRZA 3G6XA 2KW4A 3OYAA 5K14B 1K6YA 1RT2B 1QAIA 3MTKA 4N76A 5KFMA 1ZBFA 1IG9A 4FLXA 1U47A 3SUOA 3V6DB 3PJWA 3LALA 1B9DA 5E41A 4M3ZA 2Z1GA 4RNMA 4IFVA 3UDLA 3SNNA 1NKEA 1GX5A 3HT3A 1TL1A 1HARA 1IKWA 1QTMA 4K4WA 3KLEA 3EPGA 4ZP6A 2P5GA 1ASUA 4EEYA 3G0ZA 3L2VA 4OKJA 3HSTB 2BRKA 4ZTFA 4WFZA 1NHUA 5CZ1A 5FDLA 3RB4A 2IMWP 1G15A 4NLDA 2WCXA 1S1XA 2DPJA 2OPQA 1TL3A 3OYCA 3I5CA 3ZT2A 2QE5A 3KLHB 3RBDA 2GUIA 2Z1IA 1RTJA 1HMVB 4DLGA 5KFGA 5HRRA 2GIQA 3OS1A 4YR3A 4F50A 3HVTA 3OYDA 2WONA 4JRPA 2W42A 2JC0A 4I9LA 3P83D 4K4ZA 2VA2A 3DRSA 1GOBA 3OYLA 3UQSA 1HJRA 1FXXA 3AO2A 3V81B 4FJXA 2D0AA 3HM9A 3VQ9A 2HNDB 3CO9A 3ICLA 5DGBA 4G3IA 3QEPA 3IGNA 2ZE2B 3LPUA 4MIAA 1EETB 4EO8A 3ZSOA 2CJQA 2HNYA 2XY7A 4IDKA 2VG6B 1S1UB 2QKBA 2BQRA 1FKOB 2BANA 1RTIA 3MXIA 4EZ6A 4BDYA 1HYZA 4MFBB 3PR4A 4Q0BA 3CM6A 5KGWA 3TR8A 3FDSA 5J2PA 1RT5A 2RF2A 4HTUA 2YKMA 5KG3A 3PX6A 3QIDA 4FLZA 4NCGA 5EUHA 3HPHA 2OA8A 4KE5A 4RW8A 3M8SA 2B43A 3DRRB 2IC3B 2AWZA 4WXOA 4B9SA 2KTQA 1VSEA 1REVB 4BE1A 3OLAA 3B6PA 2W9CA 4E89A 4BE2A 1VRUB 5F8LA 4O3SA 1RBSA 3KTQA 3RB3A 3LWMA 1VRTA 1WAJA 4K4XA 1T94A 4WE1A 4HKQA 2YNIA 3DLGA 1UWBB 3KK3A 5EWGA 1D5AA 4FW1A 4DFPA 3LP0B 3CFPA 4KTQA 3WNGA 4JV1A 5KFVA 4DU4A 1K1QA 4CJ5A 4E7IA 2AX0A 3QEXA 4YNQA 4I7FB 2DFHA 3NAHA 3AVNA 4CGGA 3VQ8A 3DOKA 4QOZB 2YNGA 3H4DA 4ELTA 4CGFA 1VSIA 3KIOA 5I3UB 3HXMA 2YNHA 3DLEB 4B9VA 4KHYA 2F8SA 3KMQA 1LW2B 3PVXA 5KG1A 1WNEA 3OVNA 1KSPA 2HNZB 4G1QB 1Q9XA 2G8IA 4J2BA 3SPYA 1TKZB 3V1QA 3PUFA 1VK0A 1C0TA 1N4LA 1S9EB 5KFUA 1T05B 1S49A 5C25B 3SI6A 1VSMA 4OVLA 4AHTA 4ED8A 5HRNA 4RW6A 4WXWA 5KFHA 3AA2A 1RT6A 3BQ0A 5KG2A 3K57A 3FFIB 4MKAA 4XPCA 2FBVA 2UVRA 3EY1A 2W9BB 2Z1JA 4LSLB 4MK9A 4KTZA 1RT7B 4ZVFA 4TQSA 5C24A 2DTUA 4IRCA 1BHLA 3VA0A 4K8ZA 4CJQA 4C8KA 2HVIA 5FRNA 3NMAA 5C42B 1RT1B 1WSGA 1TVRB 3VQEA 4NLOA 2D3ZA 1DTQA 1XHZA 4RNNA 2ALZA 3B6OA 1KVBA 2R8JA 1LWCB 4ED2A 2AGQA 4FJMA 5HROA 3ISNC 4EO6A 4YP3A 3DLHA 4TY8B 3N6LA 4Y2CA 4CF0A 3ISND 3RTVA 4QW8A 4HHTA 3M9OB 4ZHRB 2W8LA 1UAXA 3PV8A 4H54A 4M3TA 3SPZA 3QETA 3LP2B 5FROA 4MIBA 3K5LA 2X78A 5SZTA 5L1IA 4NRTA 1HNVB 3EPIA 4M3YA 3CVKA 1SKSA 5CYMA 4DG1B 2V9WA 3ZT0A 4FZZA 4IG3A 5J1EB 4PQUB 2XY8A 3HVRA 4KO0A 3K58A 4C8MA 1U48A 1MU2B 3AVKA 4B9TA 3EZ5A 2ETJA 4H4OB 3KHGA 3MECB 3KJVA 3I5BA 1BGXT 4KHQA 4C8LA 4CJSA 4TXSA 3OL9A 1JLEB 1C1BB 1RT4B 4ECSA 4KB7A 3NL0A 3NDKA 2EC0A 2FJVA 3SQ0A 3GYNA 3AA3A 4B3OB 3NF9A 2OPSA 1SV5B 3T1AA 4CJLA 3ASMA 1BI4B 3GV5B 4GC7A 4Z4IA 2GC8A 4YMEA 1C2PA 3AO1A 4OLBA 4GC6A 2CKWA 3AVLA 4BDZA 1JLGB 4FBUA 3UIQA 1JLBA 3DYAB 1HYSA 5KFYA 4FLWA 1RNHA 4I2QB 1WSIA 2YV0X 1S1TA 4N41A 1BCMA 3HPGA 4CEQA 4IRDA 4ECUA
chains in the Genus database with same CATH superfamily
2VH7A 4M5HA 3RB6A 3NRBA 3CJ3A 4NA2A 2AIRB 4ZVEA 5F9LA 2NRWA 1N0UA 2AMCB 4CVNE 5C0YA 4FXWA 2AJ1A 2DGOA 3D9BA 1S9GA 1SI9A 4ED3A 4EHTA 1Y10A 3OXFA 4NYOA 4HTIA 1GOCA 1WD6A 3I4PA 3M30B 4PWDB 1X1PA 2MQMA 3K59A 2VZ9A 4FJJA 4HTJA 5D3GB 2RILA 1Q8IA 2CQ1A 5F8NA 2QLWA 4FZXC 4CTAA 3M2UB 1XR5A 3VGLA 1Q7LB 3FZ2A 3TYTA 1TUWA 3T9NA 2JHEA 2NSCA 2J9CA 3OYKA 2HW3A 4CHZA 3IBWA 4C4WA 3CCSS 4DPWA 3OYGA 2W01A 2AX1A 3D54A 3QAUA 3L7OA 3LANA 3O3GA 4CFBA 1YAGA 4H0VB 1NKCA 3V6JA 5A0YA 2Y1LB 2B9XA 1D4XA 1HW8A 3B8HA 3QEVA 4FVUA 1BISA 4ZCIA 4NLTA 5LY3A 4ANEA 1KWMA 3HPOA 4DF4A 3CULA 5GIOA 3QGHA 2ROEA 2H4YB 5KFAA 1P8GA 4OX9J 1KNZA 2ADBA 3ZCMA 1CZ9A 1YLXA 3E9PA 4M94A 2XULA 4DQRA 2M8HA 5TKYA 3MX2A 1OS5A 5LXYA 2XMUA 3OYMA 3TSPA 3PJXA 3M5RA 2V69A 4JI4J 2MDAA 1F60B 1CLFA 4JS4A 1IBCB 2NCKL 2O8BB 1X31C 3MFIA 2I7NA 2Q0UA 4DF8A 2G1DA 1LCUA 2YH1A 1SJRA 5CZVA 3H2VE 2P9LA 1URNA 4NLVA 4O3PA 5JXSA 4F4ZA 3TTFA 1DLOA 5C5JA 2CFXA 4CJVA 5KT7A 2D5RA 2HVEA 2XWYA 2PYLA 2RDJA 5CE3A 3MXJA 5J2PB 3CFRA 1FX4A 3RMBA 1CULB 1Z1ZA 2CQ3A 4ZLJA 2VWKA 3ALYA 4YR0A 4MT1A 2Q1LA 2RMLA 5DQHA 1HBNA 1KP6A 3RJMB 3O6WA 2FVPA 2HHQA 1SKRA 3OYHA 1WC0A 2JFDA 3FKBA 4BACA 2ZWHA 3NBPA 2CGKA 1GEHA 3WXKA 2QLBB 4RBTA 5DLGA 1PJ6A 2DNMA 3K5PA 5J2MB 4B3SF 4B3SK 1KCFA 4DCJB 2DNRA 1KLMA 3C7NA 2FJXA 1TMMA 1Q95G 3SFUA 3I55S 4LSNA 3L2QA 1IUJA 2E44A 5L1LA 1LFWA 4QR1A 2A10A 3MM7A 4AXIA 2CZ9A 5DM7Q 2P9KB 4C0HA 4GV6A 3MM6B 1XNQK 2GWKA 1V9OA 1OH8A 2A1BA 1GK8A 4M41A 4JK8A 2AJ0A 1N5YB 4KHPF 5B0CA 1NGAA 4KHPK 3MMBB 1VDHA 3BGRB 2HFOA 5K20B 3Q23A 2J6TA 1U8WA 4JRQA 4F9OA 4IOCL 5AQTA 5BXIA 3MAQA 4NLBA 3R9PA 1KAXA 3T1YJ 3S1TA 2LQ8A 1BCOA 4I67A 3AD8C 1Y3KA 4CGIA 4KKOA 4RNOA 3MEDB 2BE2A 5E3RA 4CZCA 3O3FA 3RB0A 1BQNB 3WX4A 1J54A 2CJYB 3ZEUA 2Q43A 4FVMA 2CXEA 3LP1B 4DX8H 3QJLA 1R27B 3L4BC 2BM1A 4F4KA 3LM2A 3BO3A 4CI0B 5CZXA 4A8YA 1NMNA 1BO5O 5ELZA 3IKMA 4J2AA 2WVBA 1A0OB 3U4LA 4PG6A 3AXMA 3CCVS 3UPFA 3FZBA 3GFXA 3M8RA 2W2PP 2UYTA 2A3JA 4DQSA 2NZ4A 2G8UA 2F7TA 4PHTX 2IYIA 5J2NB 2HSTA 1AFIA 3S6EA 1RWMB 1P8ZA 2QA1A 1MDUB 3M05A 1C1AA 3KK1A 1PYSB 3BBBA 2PMWA 1GMWD 1VMBA 5HANA 1OH7A 3QGGA 3QIOA 3HP6A 2J6SA 2P9NB 2XB2D 1FD2A 2DNGA 1NK9A 4NB4A 1UVJA 2ZBIA 1EX4A 4OYPA 3KK2B 4ZPWR 3WX8A 2EK6A 4IG3B 1RDWX 2PBDA 4JKGA 2VGMA 4NLXA 2GJ2A 2NXJA 4JI6K 2XSJB 2Q0RA 2ZD1A 3HT0A 4A8QA 1XNRK 3T7ZA 2HFUA 2ZH3A 3TAMA 3IWLA 4JN4A 3IFRA 2I1RA 3Q8RB 1KDNA 4DPUA 3K17A 3MPWA 2ZHAA 2AV5A 4CF8A 1MG7A 1U04A 3BDEA 5A8RB 2EKYA 4Z0UA 1I3OB 2W41A 4CZMA 2PI4A 4OHVA 2UUCJ 4HWIA 2Q3PA 4DV4F 2HLUA 3D3BJ 2F9DA 4X4SA 2LEBA 4DV4K 4DS5A 1YVFA 1VI7A 4I6MA 4O0IA 2QA4S 4H0TB 1P1LA 3GWCA 2DNHA 3KMSA 2LEAA 2ZVIA 4C1NI 2FYXA 2R8KA 3OS0A 4IOAQ 2IM0A 2NUHA 4I4BA 1KFSA 3I87A 3O80A 2HK2A 1S4FA 4BCAA 1VQYA 1MROA 5HSPA 2IJFA 3VEOA 4IJAA 3TX8A 3LQVA 3SIPB 3MOJB 4YB7A 2P8IA 3PW4A 2P5OA 1WOQA 1B0TA 1CXUA 3OFHA 1R43A 3HI9A 1NUEA 1R8HA 2G8KA 2A41A 3WQPA 5DK5A 2VD3A 1FO1A 5F8MA 3EUNA 5LJWA 2KG1A 2FBTA 1HQ2A 4M5NA 4CTAB 2NRRA 3BGOP 4FYDA 4HVZA 3I32A 4FXDA 1F6TA 5AZIB 4TLRA 5DQIA 5KT4A 3V81A 4BR5A 3H7HB 3OJUA 1YJ9S 5IOLA 4DV7J 4DV6K 4QPTA 1GT8A 3PHTA 1KHVA 2X6NA 2FHKA 4ZKAA 1L3VA 4GKKK 3H1QA 1RTZA 2VONA 4F8RA 2DGUA 3G8SA 2OPRB 2MZRA 2FJAB 3UCZP 2IM2A 3AA9A 1UJ6A 3N4QA 1L3UA 2HHUA 3WBZA 1RDRA 1ITGA 2IMOA 4ZDNA 4XTTA 2FBYA 2PMHA 2CVIA 3OR1B 1CJKB 2F1FA 3WXMB 5TKWA 3OPKA 4D3GA 3CMAS 2XBPA 2CRLA 2ZH8A 2W7PA 3IM8A 1ULRA 5D4NA 5GAEI 1ZM3A 3HZGA 3TW0A 5HQLA 3VF0B 1NWKA 2FVQA 2CQBA 3SSRA 2F9JA 4C9DA 2QYGA 5A2QO 4U6PA 2UP1A 4C3LA 5IWAJ 5LJ5Y 1M5VC 1P27B 3OTOK 3LP0A 3E1YA 4MAKA 1FEHA 3NCQA 4B17A 3I56S 4BR4A 4TY9A 1SC1B 3C46A 1IKXB 4OJ1A 4I64A 3P5BP 4I7FA 2KFNA 4CFDA 3ULHA 1FJGK 3T5LA 1MMDA 3O9SA 4ECQA 3G10A 2E7XA 3MM8B 1TL5A 4CH7A 5CY4A 3R5AA 4YOVA 3DLKB 5LM7E 4Q2LA 1S6OA 3A5NC 3GR0A 3U27A 4A2BA 1UZDA 4HL9A 2MYFA 5THWA 4DHVA 4LJMA 5LJ3Y 2KXNB 1N34F 1X4FA 1KLMB 4M5MA 4LFBK 5DETA 2E6MA 4W90B 2YX6A 1CJVB 3CMQA 3SZ2A 1SKWA 3O3HA 3G86A 2CPEA 4CIFA 3MM7B 1ZZNA 4J9SA 4YEAA 5I3QA 2R42A 4M7XA 4Q8EA 2YKAA 1NJYA 4IFYA 2X1BA 4ZP8A 3DLBA 4JI1J 1U02A 1TVRA 1UW9A 4PXDA 4BR0A 2HS0A 1IQTA 2R2TA 2GGPB 3NOGA 3SBGA 4Z4HA 4FWQA 3CJ5A 3G6VA 4HI1A 3VWSA 1UZHA 3HHLA 4IDHA 4B1ZA 2HWIA 2HRYA 4FOIA 4FJLA 4BRHA 4XIUA 5IT4A 4HDGA 3O4QA 2EPIA 1RTJB 1OYEA 1S0MA 3CCSN 2QA2A 2CNKB 2WONB 4WJBA 3LP2A 1RLCL 1GNKA 1NK6A 3ZEUB 4C2MA 4DUYJ 2FZKB 4C8YA 4LF6J 4OYOA 1J9AA 2VDIA 1RDBA 4ALZA 2BMBA 3MX5A 1V6HA 2FVSA 5J1EA 1MU2A 4JK9A 3UN3A 1B92A 3C15B 4J8FA 1N8RT 5K8NA 2X3DA 3V9ZA 4N5SA 4H03B 2HNYB 4IDKB 1JLEA 1C1BA 3RMDA 3V6KA 4IFEA 2QWRA 2GUPA 4L6V3 3MN6A 3BH7B 1QQNA 4NCBA 3W5YA 1BI4A 2HZAA 1AZSA 2V8PA 1KLNA 4F3QA 1CJUA 3BF4A 2YKMB 2KDOA 1JLGA 4OX9F 3DU5A 5LMUF 1BOTO 4OX9K 4I2QA 1LAWA 2IA6A 3C14B 1TUYA 1KEKA 2XY5A 1S5JA 1RABB 3TABA 4TU8A 3ZZ0A 4LFCJ 1D8YA 4ISEA 4JI4F 2ZD1B 4CZIA 4JI4K 2YX7A 2QM1A 2P9CA 1FK9A 3IA0A 1EAYC 1NM1A 3G6YA 3TAMB 2V8DA 3SMSA 5B0FA 2AQ4A 3V9XA 4HUGA 3VERA 1WNSA 5EXWA 1RCXB 4DZ6A 2KM8C 4OJHA 1DURA 5ITHA 1ASVA 1RWWB 3FBEA 2DNZA 3QT7A 3H2UB 4DV0J 1PYOB 2DH8A 4CD3A 2W25A 2WC9A 3A3NB 4KH6A 3DOKB 3EM1A 2YNGB 3LGNA 4DEZA 3KJFB 4LC9B 4A4JA 3Q83A 1K0TA 1VQ4N 5F0WA 4Z4EA 1C0TB 4U96A 4CLUA 5CZ2A 4C6AA 3NF6A 4RUAA 1RI7A 3ETOA 5M1QA 2MKIA 4LR7A 4DR6F 2GHWA 2V2KA 5MLCQ 2FSKA 2HMIA 3O9TA 4DV1J 1CQMA 3TA1A 4FWSA 2O01C 5HRSA 2QXLA 3S41A 3PIOQ 2ZQBA 5C24B 4CNZA 2GIRA 3H20A 3R27A 5T7BA 3K0JA 4F0HA 2XMTA 1A7GE 3QATA 2ZEJA 2E9RX 2HZVA 2ASPA 1M90O 4DL2A 1DZ5A 3DC2A 4RWWA 5AQOA 5DLFA 3CCEN 3BSCA 3GJSB 2NS1B 3W63A 2GVZA 3DLLL 2NXCA 2LDIA 1BL3A 3T1YF 3T1YK 3VCDA 2W4PA 4LF7J 5FPNA 1A5VA 3DXBA 2F9TA 3HD1A 3V9SA 4UUWA 2VGNA 4P72A 1JWWA 4IR9A 3NGSA 1AA1B 2W6KA 4HDHA 5I3PA 3ZSYA 1NEEA 3CCVN 2P9PB 2HQGA 3AT1B 2EX3A 4KO0B 2G9OA 3NMUA 1LWEA 4JV5F 1TV6A 1N56A 3JSMA 5B0EA 2P1JA 2E9TA 4DL5A 4ETZA 2E1RA 1S4EA 3FE1A 3SUQA 1RT3A 4OIXA 4PPDA 4LVNP 4EK2A 3WNEA 3R6LB 4BR7A 3ADAC 4LIWA 4QIWD 4DWIA 2M9KA 2FLOA 3TANA 2LU1A 1WELA 4O3QA 4WQ5C 2ASJA 3Q89A 3O08A 5AQUA 1RWVB 3CO0P 1TELA 1RAJA 3CERA 3NF8A 1RBAA 3DRXA 5KQ8A 3JAMO 1KS2A 4FYVB 3TI0A 2B0GA 4LT6A 3W65A 4K4TA 5HLFB 4ZVGA 3MHYA 2GX9A 3VQ4A 1JLQA 2WW8A 4YHHJ 3CC2S 1WF0A 3AHPA 4X65K 4EYIB 1NHVA 1HKBA 4QWEA 1U1OA 1AT1B 2HRUA 4GV9A 2WOMA 4P7TA 3MDQA 2R7UA 1RYSA 1VQ7S 4M5IA 2LFVA 3LDQA 4OZ2A 3ZZRA 3CF5Q 4NYFA 1S10A 4CFCA 2UUWA 1R8AA 2O8FB 1Y5IB 4JB8B 4FWLA 5KPRA 3OYIA 2E2OA 4MJKA 1HNIB 2YQ1A 2HBQB 2UUCF 4CECA 4FK4A 4G9ZA 2UUCK 3D1QA 2IDLA 1RBRA 3J7ZO 4B9UA 2NREA 1VQ6N 4LF5J 3QERA 1S5ZA 3LWLA 4IFYB 3KYLA 4JBCA 1WSHA 3BO4A 4YQWA 2HFSA 1ATRA 1I6JA 3P8BB 4LFAJ 1MNEA 3V9WA 4RW7A 1RCOB 3CHWA 4JKCA 2VPZB 3CCRS 4CLFA 3S7RA 4RBVA 4W5QA 1HWUA 2HGNA 1TMJA 2V68A 2ASDA 1JJ2R 3QNNA 4A8KA 4H4MA 3P49B 1ZZFA 3MPDA 4Z94A 3GDQA 3T19A 2FHJA 2ZH2A 3S9HA 1U0HA 4E7HA 2B4PA 2B4UA 4J9VA 4EFHA 4C8ZA 2G8HA 2DGXA 3G8TA 4O4GA 3ET6A 2FXUA 3V1OA 1WKLA 2ZH7A 4PZVA 5KPZA 1T8EA 1SC4B 4QPXA 4OI0A 3SDEB 1J5EJ 3VQ7A 1GH8A 1REVA 2EW9A 3MCOA 5MAOA 3ZSVA 4DV7K 2HBZB 4P75A 2DCUB 2O8EA 4DQIA 2BE7D 1NJIT 3IGVA 4PQAA 4R8UB 2RKIA 4NA3A 3ITHA 4HHJA 1NPPA 3FC9A 3SJJA 1TKXA 2ZFHA 1FERA 1HWIA 2ZH4A 4UY8T 4EFAC 4YUDA 1AZSB 4RO0A 5C2FA 3WXLA 5D0GA 3R9LA 1T7PA 1P9YA 3NH0A 3CMAN 2BJ7A 3GSDA 2XYHB 3VAJA 3SI8A 3CDEA 3ZZTA 4MK8A 4B3MJ 2DR6A 3MR6A 2MGZA 1WBBA 2M70A 1RDCA 5AXMA 1X60A 5B0BA 1VC6A 1UP1A 1ZBUA 4FJ5A 4V19S 5K9FA 2VFUA 2ZBRA 4K2JA 2HHHJ 5BPLA 1RTDA 4C3KA 3TUJC 2C28A 3FBBA 1R0AB 3I56N 4ZPTR 3SQGB 3VTIA 1U45A 4EAHD 3E66A 5IWAK 4B9MA 2KT3A 3MMAB 1PIEA 2ZITA 1VQLS 4DTSA 4B3RJ 4OYWA 2KG0A 4CEBA 2RU3A 1HR0K 1RA7A 3AVGA 3THTA 3MN7A 4DJBA 4BDPA 2Q6CA 8AT1B 3MM5B 1UVLA 4ICLB 4G1PA 2GAGC 4CEOA 3MM9B 1L5UA 4NYPA 1GTEA 2DGWA 3T6BA 1B3TA 4WFAL 4H0PA 5A8WB 3BN4A 4K42A 4WFYA 2J9DA 3THPA 3QWUA 2MLYA 1EQMA 1IKVB 2HS4A 4MLHA 3SCXA 1TGOA 3Q8SB 3OYJA 4LRDA 2NRTA 1L3TA 2JOQA 1C0MA 2QX0A 2VDHA 2E5IA 4Q8FA 2DFFA 4X64K 1F5AA 4IH5A 3Q2SC 1HA1A 3MEEB 2W40A 2XI3A 3BB5A 1HBOA 1U2VB 1FKPB 2HFNA 1RAIB 4F2RA 3QYYA 1HHTP 3DN9A 1WC5A 3TSUA 3ILIA 3FVYA 3MMCB 3DXKA 1JKHA 1BWFO 3KK7A 1NSKL 2CAJA 1D9AA 3M1VA 4Q5VA 4UY85 3VGKA 4JI1F 4M95A 3BPSP 4JI1K 2DGTA 3D0IE 3MEGB 3H5XA 5KI6A 2EXUA 1QE1A 2G8WA 2YWGA 1OWXA 2GVZB 3HHKA 2OH2A 4KI6A 4RG8A 4HACB 3NNCA 1OVYA 3PXGa 2YKNA 4A8MP 5KFIA 4AHSA 4JI8K 2C42A 5A2QY 5JMNA 2IOCA 2AJ2A 4W5RA 4JNEA 4H5RA 1RHJB 1V5VA 5KFCA 4DUYK 1D9FA 2RRNA 5AQZA 3RVCA 4LF6K 3DOLA 2XS2A 2R7VA 4WWSA 3GYXB 2HVHA 4QWCA 2QRRA 2E66A 3MPYA 2FJWA 2R2RA 3V4IA 1J27A 1NK4A 4IQXA 4KBOA 4PG4A 3MZIA 1HL6A 4IR1A 3RAXA 1GLEG 4NCAA 3PACA 5B0AA 3GSIA 1ZTTA 1C0UA 1W0HA 5CA5A 2ERRA 3I0RA 1DEJA 3PSIA 4WIIA 4C23A 3S3OA 3H5SA 1RJJA 3NGTA 1DQ8A 3K5MA 1EB0A 3FRZA 3PSFA 4MTPA 3G6XA 5LMNJ 4I6YA 3EKUA 1QAIA 5KFMA 2AJ4A 1ZBFA 4FLXA 3SJHA 3CPWM 4Z37A 3V6DB 5A76A 5E41A 1B9DA 3M8YA 1RAHB 3DGPA 4ES1A 3A8KA 4RNMA 4IFVA 3SNNA 1NKEA 1JNZB 2CPZA 1QTMA 3GPAA 4LFCF 3EPGA 4IOCQ 2P5GA 1SJQA 1ASUA 4EEYA 3KFWX 1RWPB 4TLQA 5GVQA 1FHTA 4CT9A 2UUBF 4DDFA 1A9NB 2P9GA 3D68A 3P5TL 3H45C 3G6EN 1CC8A 4NLDA 1FRHA 2XNQA 4PXCA 1FD8A 3QT6A 4A8FA 2OPQA 3OYCA 1J2VA 3I5CA 3SCLE 3KLHB 2GUIA 1JCFA 4RBUA 1R0CB 4DV0F 4RKUC 4DV0K 3N4PA 4NZ6A 2A5XA 4DLGA 2EFQA 5LT5A 1T44A 2W1BA 2GIQA 3TJ8A 5HRRA 3KDNA 1ZPVA 2W42A 2JC0A 4I9LA 3JS9A 4K4ZA 4MMOA 3DRSA 3RRKA 1GOBA 1MN7A 3LTOA 1CBKA 3HHEA 2U1AA 2COLA 5JLFA 2AYMA 1MW7A 3QJPA 3PIPL 2HNDB 3I31A 3G9CA 3ICLA 2CPFA 5DGBA 4G3IA 1UFWA 3IGNA 4QBUA 1F5BA 2VG6B 2K1RB 1S1UB 3A5LC 3PYGA 1UJ5A 2DIUA 2V63A 1ACMB 3BGUA 5BYQA 2DISA 2DXDA 4I69A 4BDYA 1AROP 4DV1F 2MLZA 2ZOGA 4DV1K 1K9MT 4ILMA 5KGWA 3C0BA 5H9FJ 1PJ5A 3TR8A 2FSJA 1NDPA 1U0HB 4GKJK 2KXFA 3QIDA 4FLZA 4NCGA 3L7UA 5EUHA 2CJAA 5J1PA 3Q8UA 2GMHA 3M8SA 3BBFA 1VRQC 1NAQA 4B9SA 3D2WA 1REVB 3OLAA 3B6PA 2W9CA 1RWUA 1T3OA 3RB3A 2FY8A 1WAJA 2AJFE 2QIFA 1O13A 2O8EB 2XZTB 4H4KA 2BUNA 1M1GA 3AARA 2CPYA 1U6FA 4LF7F 4DV5F 2XLJA 1WB9A 4LF7K 2YNIA 1KKHA 2CPHA 3CFPA 4BY9C 2KHCA 4C1NK 1HLUA 1LK5A 2AX0A 3ZFVA 1HLWA 3FMBA 4A8XA 2BJ1A 1N88A 4QOZB 1S77D 3H4DA 3P4IA 2Q79A 4CW7B 3HXMA 1ILYA 3DLEB 3X3UA 1P9QC 4RCHA 2AEMA 3OVNA 4JI2J 4G1QB 2RQMA 4EWTA 1K8KA 4YORA 2ASYA 2J0QD 1VK0A 4ZLNA 2VL1A 5KFUA 1RE1B 2B9WA 3SI6A 4ED5A 4AHTA 4ED8A 1APSA 1TUUA 2B7CB 5KFHA 4EUVA 3CXCM 1WOSA 3UCUP 4MKAA 2B56A 3CC2N 1YI2N 2M0GB 3GCXP 4LSLB 4U8VA 2FJBB 1UPPA 2YTCA 1RP5A 4YHHF 4IRCA 4NMXA 4YHHK 4C8KA 4PR6A 3IRWP 1IBLJ 2V2VA 5GADP 1VQ7N 3NMAA 1WSGA 3N9UC 3DU6A 2GMJA 2ZH5A 2OFHX 2E2QA 3MAAB 2D3ZA 2DTJA 2DITA 4RNNA 2F4FA 4ED2A 2RUGA 3LPYA 4ZA1A 1K8AT 4X4OA 4CF0A 4P7VA 3JTNA 3PLAA 4OHZA 4ZHRB 4X84A 3CD5A 1Q0NA 2A6MA 3PV8A 1UAXA 1WC3A 3M7VA 4IEEA 1HBOB 1VGYA 3R5GA 4OZ1A 3CVKA 4XEIA 1DHMA 4DG1B 2V9WA 2AP1A 4LF5F 4FZZA 4LF5K 4PQUB 2XY8A 3A0IX 2ZHBA 3K58A 3ZO7A 3M1VB 3CCMS 2OEJA 4L73A 3CCRN 2HSEB 2ZJRL 1Q82O 3KHGA 1LEOA 2BKPA 3KJVA 4LFAF 1BGXT 5IS2A 3DRYA 4LFAK 1FT8A 4C7QA 4TXSA 1C4CA 3NL0A 5ETQA 3FR0A 5DZ7A 3SQ0A 2XMKA 3NF9A 3T1AA 2K3IA 4KRWA 4GC7A 4LREA 2H54B 1S76D 5AQSA 4FPIA 3AO1A 2MEWA 2AZ3A 3J81Y 4CZFA 1BXNA 1JLBA 1HYSA 5KFYA 3J80Y 1VQNS 4LUBA 3G82A 3VVUA 1S1TA 1MWYA 1BCMA 3HPGA 4CEQA 4BWMA 1ZETA 3GJTB 1O6XA 3R97A 3EEQA 1J5EF 5E33A 3AB2B 1QQMA 1WSFA 1EHWA 4ERDA 3V4IB 3AO5A 2HHPA 3MN9A 3ATVA 2PZSA 4FJHA 3ILOA 5IM0B 3LAKA 4DV3K 3CWJA 3LO3A 1QAYA 2C2OB 5BYSA 4HVJA 4KRFA 2UU9J 2E7WA 4EBCA 4YB1P 3ZZPA 2DEIA 4K2XA 4B1YB 2Z0GA 4NA1A 2RPIA 5KT5A 4K0KJ 4I2PA 3CJ2A 1IXKA 1IBMJ 5GAGI 3RMCA 3GONA 3UB5A 4C48A 4B3MF 3HYFA 4KR0B 1KVKA 1HQUB 3NH1A 4BVPA 3RBXA 4NASA 1JJCB 2WUSA 3DGPB 3Q7BA 4DX7A 2PFUA 4KAIA 3KLVA 4CFAA 2IVNA 1QS4A 2OTJS 3QPIA 1NGJA 3JQMA 4C8NA 4PXBA 4X4RA 2MHNA 3GV8B 2HHHF 1XI1A 1VQLN 2HHHK 3VR1A 4KGXB 2IJNA 7FDRA 1Z25A 1YX2A 3IXQA 2POKA 2V50A 3S8SA 1JLCA 3OSNA 3TARA 1GX6A 4B3RF 2OPQB 4B3RK 3UI3A 3TUPA 5HP1A 3E8OA 1VIOA 4LSZB 5DM6L 1YBUA 3T5JA 2E29A 4WQ4C 3FNNA 4F3OA 5BPMA 4PKDB 5DQGA 2CPJA 4IOBA 4J37A 1V5IB 2G2ZA 4MDAA 4AHCA 5KFKA 1VJWA 4EI2A 3MPUB 4DPYA 3QSIA 3AGRA 5DS7A 3SAHA 2P9UA 4ZN1A 3WEEB 3P31A 1QHTA 2XYGB 5JVHL 3DOMB 3C6UB 4FWOA 2FVRA 3FZHA 1NJZA 3LPTA 3BYPA 3AAQA 1WF2A 1XUPO 2EWSA 4Q44A 1T6CA 4BC2A 3QIPB 4CJUA 3Q24A 4V1Ak 4ZPVR 3B4MA 2JWKA 4WFXA 3GE9A 4AQYK 2XCPA 1WOOA 4M42A 3AQOA 5I42A 3MDFA 1AB8A 3FZMA 4ID5A 3R3LA 1N5TA 4DHYA 3ETMA 3UKUB 3H5UA 1WORA 1HUXA 2ZJPL 3KVGA 4M1KA 3KKRA 4OV1A 3AVHA 1XMOJ 4HEA9 3W1YC 4DN0A 1TL7A 1WN7A 2R2SA 4M3RA 4FSVA 3E01B 5ETPA 1IBKJ 2KKHA 4J9RA 4DR3J 4I56A 1KVAA 4KFBA 3I4HX 4HLBA 3D2EA 4OKEA 4JHDB 4ES3A 1A5WA 1RTHB 2FLNA 1CJTA 2ZZNA 3DJCA 3PHEA 1W2IA 2OANA 5AE2A 1U2CA 4U7CA 4IZ9A 2FLLA 3V1RA 1CLQA 2I5JA 2I38A 2JWLA 3TNVA 1JXBA 5J2QB 5IC6B 4OGEA 4ITSA 2NRXA 3H42A 2AGOA 2M52A 2DNKA 2PE8A 1BQXA 2XCAA 5LMNF 5KGXA 4DU3A 1FWPA 3K89A 1S1WA 4AL6A 2L48A 3RR7A 4UQGA 4CCHA 1W7AA 3F0NA 4JD2A 4F4XA 2QYCA 3O3LA 3U3YA 1X4GA 4LVOP 3J7YU 3SYZA 3W3DA 1BLUA 4LD0A 2KFYA 4O8UA 4FM1A 3DLLQ 3D1HA 3X1LB 4JI3J 1K73T 2HIYA 2UVWA 1RAAB 1REGX 4EIAA 5CYQB 1WUAA 3TO8A 3JSBA 1NJXA 4OV6A 2KU7A 2ROPA 2B4VA 2RSQA 2IFXA 3AO4A 3DWLA 3M2RB 3TQ1A 5AE1A 4F04B 2P51A 3DXMB 3OHBA 2NXEA 1SJ4P 3DDNA 2W4DA 2L41A 2CJKA 3D1OA 3SBMA 2NUUG 2MKCA 2UUAF 4ZVSB 5DDRC 1XK8A 3U9ZA 4J9NA 3B4DA 3THYB 1E4FT 3KJVB 4K5RA 2I7PA 2F8MA 3EDRB 4ECTA 7FD1A 4CIEA 2MQLA 4MKBA 2G0IA 1NZAA 4ZVTB 5F3ZA 1YJVA 1NSPA 1OIAA 4M5GA 3TX0A 3OYBA 4FO0A 3JSRA 2Y0SD 2PA3A 2OAUA 3QFUA 5CCMA 1RK8A 5K14A 5AFUA 4I0WA 4DUZJ 3MN5A 4JKAA 2F8TA 2EFOA 1KQSM 1S1TB 3LZJA 2MHEA 3D5MA 1EWQA 4PUOA 3HHLC 2DH9A 4CJ4A 3FBFA 4YY3J 3SQ2A 3GIKA 5A8KA 4J2DA 2RRAA 2RS8A 1Z6RA 3LDOA 3ZT1A 1U0SA 4NPOA 1R59O 2OEKA 2KJVA 3ZSZA 1VSKA 1U4BA 3PYDA 1R8BA 1EJ7L 3I5AA 5HQ8A 1VS3A 1N32J 1U09A 3M9NB 2H9ZA 4J9PA 3PX0A 1S72S 3KLIB 3SCKE 5BRFA 4BRMA 3NH2A 4CYUA 3C94A 3N5FA 2LEPA 3MURP 2OLWA 1HNXJ 4CJKA 3OL8A 5M2RA 2B9EA 2GAHC 2FF6A 2BOPA 4GVMA 3C95A 1Q86T 1CSJA 3LF0A 1DTTA 4JI2F 4ED7A 3RRGA 2MQ8A 1N33J 4TYBA 2CGJA 3OTEA 4F2SA 5FPEA 4QYZJ 3DRPB 1T9UA 3IG1B 1W7WA 2ZE2A 1BDGA 2ZGYA 1U26A 4IH7A 3VQ5A 3CDAA 2C3OA 2R8HA 1E4GT 4LQ9A 2C3YA 2XM3A 4A46A 3UO0A 1XC9A 4K4VA 2MSTA 4MFBA 3QWPA 2VBXA 4CIGA 1HPZA 1ZOTA 3ZTQA 1DBDA 2JRSA 2C1EB 5B7WA 3POTB 2DH7A 2OIHA 5D4LA 3CCLS 1IBLF 4R5PB 3KHHA 1IBLK 3LP3A 2D3O1 1P90A 2GBZA 4JKDA 2VFSA 3DRRA 5HL7Q 5I9EB 1KQKA 3KUHA 4O0NA 3CUNA 4JLHA 1VRUA 4ZPCA 3ZTOA 1U6BA 3RG6A 2C2EA 4F36A 4FN5A 1Q1KA 3O44A 5KFTA 1M5OC 2MKYA 3SQ1A 3AAWB 3KG0A 4OKKA 1G1XA 4DTMA 2HGMA 5LL6Z 4CF9A 5BPNA 3CCMN 1QSSA 1MWQA 1F9FA 3GE1A 2Z2YB 4PKIA 2YX4A 2DEJA 4UZCA 4PWUA 1NBWA 1BQMB 4GY2B 3GILA 1RBOB 3C66A 3JB9k 2VA3A 2XRIA 4O55A 4IXCA 1M1KT 3PW2A 1LW2A 5F2RA 2E1MC 1IG8A 5HMZA 2WHOA 5KT2A 4OYXA 1NGEA 2KHOA 3VETA 5KRSA 1RLDA 4TNOA 3T1HJ 1JMTA 4ZVOB 1TKZA 2E5LF 2DPIA 2GQCA 4FLTA 1T05A 2YWFA 4HCCA 2F4VJ 4C98A 1E6VB 2XLKA 4P52A 1VQNN 3QGIA 3OYFA 4DTOA 4B3TJ 2HHXA 1D09B 4ED4A 2E1YA 1WG1A 5HMXA 1UEKA 1FTCA 3T9ZA 2HBMA 4FWPA 3DCAA 3VEYA 3D45A 5A6PA 3EO3A 5KFFA 3UKRA 1RT7A 2FVCA 2ZKUA 4TN2A 4WFAQ 4WQ5A 2AYBA 3KWGA 5GAHU 4KH4A 1JLAA 4YR2A 1CS4B 2I5JB 4A48A 1SIZA 2W2QP 2ZBCA 1FRMA 1HI8A 1S1XB 4URQU 4OGCA 2UU9F 1CC7A 2RNEA 2WVCA 2YHAA 2UU9K 1QZ6A 4M7YA 4EMDA 1PJ7A 4K0KF 4K0KK 1IBMF 2XWXA 1IBMK 4DQPA 2LYVA 2ZOFA 4CO5A 5SWMA 2OTJN 4ES2A 1NOZA 1HNVA 3QEIA 3W66A 4DV2J 4E7KA 3EE3A 2D3OR 2PT0A 1WKKA 5IXUA 4X62J 4J9QA 1C4AA 3MWBA 5AXLA 1YWXA 1O0PA 4KB0A 4ILGB 1F9EB 4DZDA 1KOOA 3ZT3A 4C3MA 2WTFA 4NLGA 1RT4A 5HRPA 2FHOB 1N8RO 1NMDA 1QSYA 2JGUA 4IOXA 2V2ZA 4B3OA 2BABA 4ELUA 4EP5A 4DOZA 1IR1A 2P9IA 2NRVA 1ATSA 2QN6B 1IVZA 4CEZA 2V8HA 3A5OC 3PZPA 4DU1A 2RF2B 2VODA 1FWLA 4FVCA 1URRA 3U3GA 2HF4A 1S6UA 2N82B 3AO3A 3KUGA 3KUEA 5FRMA 1YJUA 1PYTA 2E1PA 2HS3A 2CQ2A 1R89A 1X4AA 1LFPA 3GIJA 3IN5A 4BRNA 1OH5A 3PFOA 5D77A 4WE1B 3Q0AA 1RCHA 3VMFB 4OPKA 3BQ1A 3DLGB 3SV3A 4E1MA 2W9AA 1NK0A 3TVKA 4NI2B 1GOAA 5AQJA 1X5PA 3FSXA 1Q81T 3R2DJ 3M30A 4IKFA 3KHYA 4WFNQ 1NU4A 2KRRA 5D3GA 2CG8A 5DG9A 1Y11A 1NH7A 3LM9A 1RQ0A 2NXUA 3VQQA 3AJ2A 4P2XA 1WC1A 1I3AA 1NNDA 4QIEA 2YNHB 4BBYA 1T9WA 2EK1A 1U1QA 2IBOA 1VC5A 4PUOB 3TAFA 1AFJA 1VSFA 2RN2A 5A8KB 2KB2A 4H5WA 2FHMA 3CPWR 4QWAA 2ASMA 1U6ZA 1D3WA 1OMSA 2MZSA 4CQ1A 4A8WA 2YPYA 4ETXA 2HHTA 4E1NA 1QDUB 5KFRA 2R8IA 4RW6B 3QESA 4P71A 2O4IA 2KQ2A 3CIPA 1XMOF 3BKTA 5E3PA 2F5GA 3F41A 4WCEL 4ZMMA 3WXIA 3US5A 4CEEA 2ZGZA 3UE5A 1R6YA 3ZZZA 1IBKF 2DY9A 1S22A 1IJFB 1YBAA 1IBKK 4WZQA 4CYUB 3QEWA 2HRTA 2WAQD 3HHDA 4DMZA 4DR3F 4WYBA 4ATNA 1S0NA 4DR3K 5F41A 3IR6B 1U49A 2FGCA 2IYGA 3E51A 4DU7A 1DTQB 3PIPQ 1NCLA 1DTTB 1J6ZA 4XAKA 2HVZA 3PJ9A 3SUNA 4K8XA 3B54A 4RPFA 2XHWA 1NPKA 4MK7A 1PG5B 3M6UA 4U7BA 3SQ4A 5BJRA 3CJ0A 2HAIA 1RZMA 2A40A 1FRXA 1R6VA 3IAYA 4HH0A 1F5CA 2M3DA 3C3LA 1XJWB 3AH6A 5CYMB 1HPZB 2VC0A 3D6HB 1NLKL 2OMLA 4CEFA 4B08A 4E0DA 1CULA 2VHGA 2CA9A 2ZKTA 2LLZA 4CZKA 5CQGA 2IHR1 1KVJA 4QIFA 3IP0A 3QZ8A 1QUVA 2JJ4D 3UCGA 4JI3F 3PR5B 2FC9A 2V0NA 4JI3K 3ULDA 2PYJA 2O5DA 4CGHA 2MTLA 2OPSB 3JS6A 3QMQA 2HFVA 4X2BA 5LSOA 5J2MA 5IFMA 1WHWA 2MKJA 4C8OA 2CJBA 2G8FA 5JMVA 4BRCA 3N4WA 3D4JA 4DUTA 2HYIB 1HW9A 2I8EA 3BO2A 2WSEC 2HWTA 2E4LA 1Y5LB 4B9LA 2P9KA 5F3TA 2WW4A 4GV3A 3MM6A 2CZ4A 1D9DA 5T7LB 4DR7J 4GO5X 3RSEB 5FIIA 1X5TA 3PX4A 2VKRA 1N5YA 3D2FB 3VQSA 4MO4A 4TU9A 4A8OA 2R7YA 4Y34A 3ZZOA 3MMBA 4P2FA 3PM9A 3BGRA 2H5IB 1BUXA 4IO8A 1GLDG 1QVGM 3BQ2A 2VQEK 3KXDA 2YKPA 2QT7A 4P73A 3JQKA 1ZBHA 3OYEA 4F3TA 3MEDA 3AV9A 4EHUA 1HMVA 1TKDA 4OJ3A 2NLXA 1BQNA 4DUZF 1MWKA 3QRQA 4USKA 3LZIA 3LP1A 4DCPB 2KZZA 1NM2A 3W2VB 1K1SA 3VVTA 1H2UX 3CXCR 5GADI 2VPYB 3GB0A 4BWJA 4YY3F 4YY3K 3UD4P 3H3NO 4DTUA 4N47A 3CCUN 4RNHA 3A13A 3MUVP 3ID6A 5M2PA 1EETA 3NS7B 1JLAB 2IS3A 1S72N 1LQ9A 4DSJA 3L0QA 5KFXA 3NF7A 4LR8A 5J2NA 3CC7S 1N32F 4AHRA 4Y2AA 1N32K 2O8CB 3CC4S 2NZTA 3R8YA 4B1WB 1AYEA 3MI7X 5KFOA 4CHOA 3CQYA 1F2HA 4NLPA 1HNXF 2P9NA 5KQDA 3AVIA 4DSEA 3VN5A 1VC0A 2PY5A 3P1GA 3KK2A 2ZJRQ 3MCPA 4DL3A 4MQ3A 4DBQA 4FJKA 2B4JA 1F0XA 1Y9OA 2YWEA 4CLWA 1N33K 2GX8A 2XSJA 3TAQA 5FPDA 2XLIA 2DR8A 3C19A 1QLNA 1EXQA 2FPHX 2ZH1A 3PW5A 1LW0B 1M5PC 4UT4A 1UWBA 5CHCB 3Q8VA 1TFWA 1S3XA 4KY3A 1ZBLA 5A8RA 1NJIO 2LU2A 3CCLN 4OYZA 3KLFB 2P9IB 2M8DB 1N5SA 4AD6A 4FJ8A 3ZC4A 3VAKA 2DHXA 4UY8O 2QMXA 1D8ZA 1WSJA 2IA0A 2EVZA 1XQIA 1RB0A 3D7EO 2NYHA 3MD3A 1ZAVA 1J53A 4KI4A 3BV8A 3SQOP 2DGQA 3OUYB 3QO9B 3ZSXA 2AA4A 4DTPA 4QS8A 4BG9A 1LNQA 4YOXA 4C0BA 4TYAA 1JX4A 4M5JA 2ZF5O 5F9NA 5D8HB 3FFIA 2BVZA 4IKAA 3V9UA 6FD1A 3K8VA 5KG0A 4OJGA 3G96A 1G7CB 2MLXA 3SSSA 3THXB 3IRXB 4OYAA 5U47A 5DJBA 2D69A 3CD7A 4BE0A 3MPVA 1KVIA 1TUVA 3R5DA 2IIHA 4M3XA 2OHDA 1V3ZA 1GXTA 2DK2A 1VQ8S 3NVKA 5AZIA 1C6VA 1SH3A 1VCTA 2E9ZA 1TUGB 3T1HF 3T1HK 3TA2A 5HOOA 2F4VF 5L39A 3V5RA 4DSIA 2F4VK 4B3TF 1WEZA 1YGYA 4B3TK 5DM6Q 5ETOA 5JLHA 3TWZA 3RYLA 3GIMA 3GJQB 2OPRA 2FC8A 3HX9A 3N6MA 2FF3B 4A47A 3DMJB 3BUZB 4TKTA 3VQCA 5LSLA 2ATQA 4CLSA 4CK3A 2X7IA 2WVDA 4H4KC 2QSFA 1PAEX 3HVWA 3OR1A 3EX7B 3L4QA 4ZVRB 1RFQA 5LMUJ 3H4BA 1OQ3A 1CJKA 3MECA 2C2DA 4Y0WA 2GFFA 4WBFA 2IDEA 3ENWA 5JVHQ 4ZPAA 3MCSA 2KKZA 2FJDB 3CCWA 3GYGA 2NPFA 3H8YA 1SIWB 3VAIA 5CAAA 1N52B 1RBUA 2Y1IA 3DYAA 4QQBA 5BYRA 1U1KA 3U8XA 1W9HA 4ZLPA 2ZJQL 2GV1A 4UF4A 3V6HA 4DV2F 3TAPA 1IH7A 1IKXA 5M1FA 1CPZA 2QV6A 5DZ6A 4ID1A 2CUYA 1OKJA 4X62F 3UW1A 3TZYA 4NLUA 3B8AX 2B51A 2AF6A 3PCOB 1WI8A 2ASOA 2PGCA 3MM8A 1SL0A 2ZJPQ 3MCAB 2H5JB 4B1XB 2C2KB 3DLKA 1MMLA 3TTCA 2Q66A 1ZM4A 3BSNA 1VQ4S 4K4SA 3K0SA 1NMEB 3DGVA 2VASA 4XK8C 4DR6J 3ZXWA 3OYAA 4BVOA 1K6YA 2E5JA 1CJVA 1RT2B 2PD1A 2G2YA 4LIRA 2E5HA 1YUWA 3SUOA 2JVRA 1XBWA 3PJWA 5ETNA 3GL1A 4CRJA 4PCQA 1F3VA 3AD9C 1MN9A 4JAXA 1YZ6A 4K4WA 2R4FA 3KLEA 1UKUA 2CQCA 4XH1A 2MZJA 3AJDA 3G0ZA 2EC2A 3V2UC 4USUA 4BREA 1VHFA 4OKJA 4DR5J 4ZTFA 3VEXA 4WFZA 2GGPA 3C16B 4IWVA 4L72B 5CZ1A 3M2VB 2DGVA 2ZZMA 2WCXA 3QFHA 4DI6A 4GVBA 5BREA 2QE5A 3G8QA 3CCES 3GTYX 2Z1IA 1RTJA 1HMVB 2KI2A 2GELA 1GFWB 3R6MA 5KFGA 4YR3A 4F50A 2CPDA 2WONA 1R8CA 3QRPA 1G2EA 4CO2A 4LF9J 5H1SV 2NLWA 1HJRA 4MYUA 3K9KA 4JV5J 4FXVA 1VQOS 3EZOA 1GAOA 2XHCA 5HMYA 4YOYA 1VQ5S 3C15A 3LPEA 1EETB 4EO8A 3ZSOA 2XY7A 2HNYA 4IDKA 4FYXB 2QKBA 1FKOB 3JSYA 1QJHA 2OJ3A 2Z4PA 4EZ6A 1FDNA 5L38A 1DY3A 1RUSA 2QG9B 1YRTA 4BROA 4AM7A 3HFZB 1F9HA 4BQLA 3E9LA 1M5KC 4HTUA 1K9MO 2YKMA 4DR1J 3PX6A 1BD6A 1Y0HA 4K41A 4BRGA 4X66F 2OA8A 2HBJA 5F0UA 3C14A 2D9OA 4RW8A 2IC3B 4CO3A 3NY0A 2KTQA 4BE1A 4BGAA 4BE2A 5F8LA 4O3SA 3R1HA 4WQ4A 3F9MA 2H4WB 3NCRA 2ADCA 2BJ8A 4HKQA 3CJTA 3DHXA 2VWBA 1UWBB 3D7SB 4DFPA 2GO9A 4KTQA 5H9EK 4FPAA 4ID8A 3VF6A 2KL8A 4E7IA 4OI1A 1HKCA 1DJ0A 4ZIVA 2L9WA 4CGGA 1U2FA 3DOKA 4QZVB 3HFKA 2YNGA 2M5YA 4CGFA 1N5QA 3KIOA 5I3UB 3O6QA 2DR7A 1NGIA 4B9VA 2F8SA 3UVJB 5KG1A 1WNEA 1OY9A 2PSZA 3V1QA 3PUFA 1C0TA 1S9EB 1VQ6S 1FEEA 5C25B 4A8SA 4LMZA 4DPTA 3PRDA 2CGLA 5HRNA 4DB3A 2J7WA 2Z8QA 3GG0A 3AA2A 1RGIA 3K57A 3FFIB 4XPCA 3BBCA 1U1MA 2W9BB 4KTZA 4MK9A 5G0RB 2D9PA 5C24A 2DTUA 1H72C 2Z2LA 3VA0A 4K8ZA 5C42B 1RT1B 3PEJA 2FY1A 3F2KA 3AOCA 4DR7F 4DR7K 3VQEA 1MLAA 4BRKA 1XHZA 3NLCA 2CH6A 3KKFA 1LWCB 3IO1A 2AGQA 1WHYA 3J7AN 1P1TA 2FZCB 2GMLA 3RGIA 4BRDA 4DXLA 2I0XA 5BR8J 1RXOB 5E3AA 1K8AO 3AY0A 1HI1A 4GVEA 4M3TA 1H73A 3PYFA 5IT9U 2PDAA 2W2OP 4MIBA 2X78A 5SZTA 2M7SA 1WUUA 4M3YA 3IBFB 1SKSA 1H2TZ 1CVJA 2HFZA 3ZT0A 2P9PA 1VLOA 3HVRA 4KO0A 4B9TA 3AVKA 4U9RA 1KOHA 2W7AA 2J7KA 3CD0A 3MECB 4WFBL 3TZXA 3CC7N 4OX7A 4C8LA 4CJSA 3WC2A 3CC4N 2R7QA 1WACA 5HO4A 2GVDB 2IVFB 3NDKA 2FJVA 1RADB 3ZYYX 3GYNA 2PN6A 4M5DB 4BC3A 1SV5B 4CJLA 3MR7A 4Z4IA 1NRKA 2HQFA 1UFKA 4YMEA 3BF3A 4GC6A 3O9QA 3DYAB 4FLWA 2CG4A 1RBLA 4CO1A 2ATCB 2YV0X 4N41A 4Y2KA 4IRDA 3T69A 2QLJB 2QGFB 3M3ZA 2IVYA 5HLFA 5KFDA 4CF2A 5E3CA 1S9FA 5LL6d 2P9SB 2XZDB 2GWJA 3KD1E 3UD5A 3VQ6A 1NDCA 1S1VB 1DRZA 2VIHA 4F25A 4FW2A 5CR4A 2RAQA 3I9V9 1N36J 2PC6A 2BR0A 2QJ3A 3AGKA 2FJEB 4CF1A 1WEXA 2OSRA 5JUMA 3GCWP 4ZVQB 1TKTA 4R0JA 1QZ5A 2N7CA 4N77A 2O8FA 4TVAB 4LBHA 1N34K 1HNIA 1RDDA 1K47A 4BC7A 4XH4A 2EHGA 3AY9A 2QWLA 9ATCB 3QDKA 2CNLB 1VFJA 1T03B 2OTLS 3QGPA 2DNYA 2LQ5A 3DM2B 4EZ9A 4EYHB 2VG7B 4H0YB 2UZAA 5AQYA 4RU9A 3VF4A 4K43A 2AW0A 2X74A 3UR0A 3KLEB 1FXDA 2C22A 4NXNJ 1T3VA 4KHNA 3EICA 3ZSWA 1YHQS 1Q7YT 3IBCB 5KFEA 2K8GA 2QWOA 1VK8A 4GVBB 4CZGA 1LWFA 3FJ2A 3MXMA 2IJRA 3ENOA 4FS2A 1VQ8N 3WT0A 1TK8A 5EX0A 4NMLA 4P9SA 1VQSA 4O8KA 2IAJA 4JKHA 2OUGA 3OL6A 2CPXA 1FKAF 2K2PA 4LF8F 3SDEA 2UXDF 3HJVA 4JYAJ 1HBUB 3U1MA 5C15A 2QK9A 3PO5A 3VGMA 1PBAA 4CH1A 4RZRA 4EBEA 1N6QA 3OYNA 2VG5A 4R8UA 1JXEA 4CP5A 4IG0B 3PY8A 3QT8A 3S3NA 1PKUA 1SCJB 1XNQJ 1WBDA 4BC5A 3H25A 1T9YA 4FZYA 1BA0A 2B6AB 1LOTB 4FL9A 4O3OA 3IUCA 3IDHA 4EP4A 5LMUK 5DDPC 4ILJA 1FRIA 3D66A 3NNAA 3BREA 1N48A 1BC6A 3FCHA 4RW8B 3QFPA 3MCMA 1H7WA 2YVSA 5FLXU 2V7ZA 1GLCG 1CXQA 2DO4A 1H38A 1PC5A 4R79A 1SUQA 4DL4A 1YTAA 3O5TB 1S6QB 3OVBA 4J5OA 1R0AA 2UUBJ 3SQGA 2XC9A 1QUPA 2L9NA 3FGVA 1C0FA 3ID8A 3FSYA 3MMAA 1KBRA 5F1XA 1QHAA 4L74A 1FDAA 2FLPA 2XQCA 2ZWPA 2MJUA 4FP9A 2HZCA 3L09A 1YJTA 4DSLA 3G6ES 2E1ZA 1M5SA 4AH9A 3OR2A 2ALYB 4CE9A 3MM5A 2O8DB 4ICLA 2KYZA 2DB1A 2BJ3A 2MXYA 3MM9A 1BWVA 4G6VB 4FKYA 2CADA 1TYQA 3RW7A 1AUDA 2WB4A 1VBKA 5A8WA 1VQPS 3ZT4A 3H6EA 3H90A 2EFPA 3LL3A 1XMBA 3OS2A 1RBTA 1FXRA 2NUBA 3FSIA 1IKVA 1QSLA 3M6WA 4IH6A 1X9WA 3KNAA 3TVYA 3VF2A 3PTWA 1V3RA 4J7CA 3C6TB 4N7TA 3QNOA 2E7VA 1IM6A 4WCEQ 2R8GA 1SL1A 4DR6K 3A1YG 3TRGA 3MEEA 1UWAA 3WZ0A 5AQXA 1SQEA 1Q5YA 2N4CA 1FI4A 1FKPA 1OPZA 1U2VA 1Z26A 4DLEA 1JIHA 1QAJA 3A2FA 4USVA 3MMCA 4E7LA 4GRSA 4DPOA 4NEZA 4JI6J 1VBXA 3IM9A 2VWJA 4F67A 4LRBA 4K8RA 1V4TA 3TEGA 4GW6A 3MEGA 2CQGA 1Y7PA 2APOA 2JEIA 4DR5F 2WBMA 2G1HA 3KHRA 2I2YA 4DR5K 1BIZA 3C6HA 5EX5A 2HBRB 2V4JB 4BRIA 1K73O 4HACA 1SVDA 3R8EA 3DHWC 3LAMA 1YK9A 2B3TB 1WAFA 1X4EA 4DV5J 1XIQA 3CJSA 4H5TA 2BACA 1XC3A 4CJFA 1VQON 4YDUA 1J5OB 2KT5A 2X1GA 3BR8A 4LF9F 3J7YP 3KLGB 4LF9K 1VQ5N 3CCZA 3W2WA 4UOCA 3BZCA 4JV5K 4F4WA 4Z4CA 4CBWA 1IM4A 2CDRB 4Z4GA 3SBTA 3HVAA 2WK4A 4JI5J 3HCXA 3G71N 4GMJB 4AHUA 1AXQA 2VOOA 2PMZD 3FK4A 3QLHB 4RX6A 3KNGA 5AZJB 4ANDA 4Y65A 3RUBL 1KAZA 4CD1A 3SAFA 4CLLA 1S79A 1WJ9A 4DX6A 3J81O 2DRBA 2ZH6A 4MYTA 4ILLA 3J80O 3LDNA 2JLEA 4ZITA 2PAVA 3VEWA 5AQPA 4YOUA 4DR1F 4DR1K 3BDPA 3V6DA 3PYEA 5FJ4A 2VJVA 4CZEA 2R2UA 2DRDA 4DV6J 4DX5A 1FA0A 2GHVC 3AVAA 1YI2S 5HBMA 1EP4B 3KD5E 3HHLD 1TR0A 2XG8A 3CJCA 1NK7A 1VHIA 4GKKJ 2VFTA 1OSCA 2WFBA 3TJAA 4L8RB 5KT3A 2QFIA 4PG5A 1VQKS 1TKTB 3VZIA 2CVEA 2O4GA 2YI1A 3KLHA 1E6YB 4AF1A 4QOTA 1QVGR 4FOEA 4KH0B 1ICEB 1NH8A 3NKYA 2GEMA 3LW5C 4LY7A 1RDAA 1BU6O 3SMPA 2OO4A 1YJNS 2YWKA 3L2WA 1QM9A 1F1BB 5D78A 1JJ2M 5AQMA 2MJNA 4FJGA 1T9TA 3M6GA 3AA5X 1SQGA 4NLRA 4KAZA 1KR4A 4HCBA 4Q7AA 1RILA 4U8YA 1Q86O 1ZBTA 4O44B 2HNDA 1U8SA 1XWLA 3NP5A 4R0EA 3CMES 4CZHA 2J8AA 3SSQA 3OTOJ 2DR9A 2VG6A 3EL2A 2K1RA 1S1UA 1D0EA 1UEVA 4ZP7A 3F44A 5HVHA 2B4OA 5FPMA 5EWEA 3DI6B 3ONQA 4IO9L 1LWFB 4WTOB 2YPZA 4S0MA 3AVFA 1MSWD 4HUEA 1FJGJ 5M1OA 3OQ2A 1RISA 8RUCA 2D4WA 2IAJB 2GS8A 2Y8WA 3CJQA 1VLYA 2HOEA 3BF1A 4OL8A 3K2YA 5CABA 2QWMA 3DFEA 3ZNJ1 3HD2A 2ZUGA 1EWRA 5HL7L 4LFBJ 1O1WA 4E3SA 1JB0C 5BR8F 1RWKB 2CH5A 5BR8K 3GIIA 1N6QB 3SCIE 2VG5B 2PI5A 3TPQA 1RWOB 4KBIA 2VUGA 4Y1CA 4F4YA 5B08A 4K25A 1UJ4A 5C2CA 1I39A 3LGMA 1SZ2A 4I68A 2JEGA 4ZN3A 2D3UA 1GMWA 9RUBA 4U7UK 5G4DA 1S57A 1HPMA 4A62A 3Q22A 1B4SA 4M8LA 2OPPB 2RHQB 1ITPA 1S6PA 1NBEB 1S7HA 3DLEA 1WTFA 1VIXA 2KZMA 4Y2MA 3UE2A 5L9NA 3LGHA 2CPIA 5D6GA 4G1QA 4OHXA 3G2XA 1NK8A 1WLJA 2YNFB 2Y1JA 1BUPA 1SUQB 1KFDA 3M8PB 1T9VA 1M1KO 4J90A 2WTUA 3THVA 5JVGL 5LOQA 4K50A 2EWHA 1VR6A 2MQQA 2EEYA 1WF1A 2NXNA 3M8QA 3M8WA 3TTDA 4KREA 3CJRA 3OVSA 2K06A 1HD1A 4LSLA 1X4DA 3CD6S 5M1PA 1FX2A 1BY9A 2JZ5A 3OR2B 5L46A 3MGJA 1TL1B 3CIZA 1YTUA 1IKWB 2GTDA 2HEKA 2QTDA 2N3LA 4DKWA 2DNPA 2QC3A 3CQ8A 1C1CA 1FRLA 1GTHA 4NRUA 1TYQB 2D0CA 2YH0A 3EXYA 4PAAA 3MAAA 3K7RA 2WB1D 2PIIA 1N36F 5FDLB 3BS9A 1N36K 4JV2A 4WIQA 3D28A 3P3DA 1ELOA 4ISGA 4RW4A 1FRJA 2BJEA 3VGVA 2QWQA 3EE8A 2OTLN 4ZHRA 3ZETB 5AQVA 3OFFA 2DY1A 4YFUA 5ADXA 3VTHA 2IBKA 5IT9Y 3HVTB 2AHOB 4AFFA 4MDBA 1KC8T 4V19X 2R7OA 2RRBA 3EMTA 4DG1A 3KJQB 1X9JA 4CESA 4PQUA 1X5SA 4IJNA 4MIWA 5GAHP 1WDTA 3HSGA 2Q1NA 4NE9C 3EZWA 2OYQA 1YHQN 1HNWJ 5JS1A 4XDDA 5C10A 2ZBPA 1RHRB 4KPCA 1YQHA 4BR9A 3WHIA 4DSFA 3MD1A 3L3CA 1OJ4A 4NXNF 3A12A 4NXNK 4Q43A 3VAGA 2R7SA 4JP8A 3RR8A 1RTIB 4JV0A 4KHUA 4TQRA 3ZTPA 1S12A 4O3NA 3P38A 2ZJQQ 5K8MA 1NB2A 4WK1A 4I6AA 3QRRA 5HN0A 2YX1A 3GIRA 1SC6A 1OPIA 2CQ0A 5AQFA 5BRHA 5E3QA 4ZIWA 2J5AA 4KQZA 2PEHA 3W2WB 2O3DA 4PABA 4JYAF 4JYAK 4MH8A 2VJUA 1Z2ZA 4ZTJA 4KV8A 1DAXA 2XGPA 4FF4A 3FZKA 3KK3B 1NSQA 2AD9A 5IM0A 5DGAA 4OMFG 4QJVA 2HQIA 4KGZB 4XDCA 5M2UA 1QQCA 2J9EA 2Q2RA 2R7WA 2YY3A 5E26A 4F3MA 3DLRA 5EDWA 1I94J 2FUG9 1TL4A 1XNQF 1Q81O 1NZ8A 1SXLA 4NLCA 3EVWA 4WFNL 3IWNC 1HRHA 3QQCD 1NJWA 3KJNB 1H0HB 3LUYA 1HQUA 4M63C 3TZWA 1YSJA 2FTRA 2N4DA 1SS6A 4NOHA 2ZBQA 3MAHA 3QINA 3H0PA 2IVOA 3BSOA 3PKYA 1JLFA 2CNNB 1GXLA 2XSFA 5HBMB 4NYZA 5KOWA 3VOVA 3LDSA 1OQ6A 4LFCK 1CG2A 3BR9A 1Q8LA 2FHJD 5DG7A 2UUBK 1RT6B 1H3DA 1R3NA 2G4BA 3NWRA 3I33A 5D4OA 3VQPA 3HSCA 4B8CA 1W25A 3UWTA 2HAFA 2V94A 4ZCLA 1HBMB 4CZLA 1KD1T 5ETSA 2RDIA 4KHSA 1VQPN 4DN9A 1SL2A 2D1KA 3SFGA 3TUIC 5L1KA 2FD2A 2ILZA 1VYAA 1XR6A 5KG5A 3T5KA 2QKKA 1O5JA 4XO0A 4UQTA 4ZPDA 2UUAJ 5HROB 3H46O 4IRKA 4X4TA 4L3NA 3M32B 2VYPA 1Z4UA 3C65A 5ETKA 3R7BB 1MWZA 4CHQA 2AKWB 1NB7A 3WEEA 4NLWA 1YJRA 2X6SA 2MMYA 3C6UA 3DOMA 3W5ZA 4F02A 2LSNA 2WVEA 2Q31A 2AYEA 3U1NA 3RW6A 3L2RA 4I1TA 1JCEA 3CJKB 3F73A 4DQ8A 4LQ3A 2PFDA 3NGZA 4H0OA 3GP9A 3QIPA 4X65J 4USJC 4JI6F 5HATA 4PG7A 1XNRF 1D1UA 1FFGB 1YBTA 3EDQB 5FLXY 2XMWA 4USHA 3VEVA 4CM2A 2KXHA 5D0EA 3ZNUA 3UKUA 4RUBA 4BLGA 4DCHA 5M1KA 4OX8A 2GO8A 2BA9A 2LA6A 2BOAA 4M45A 5CXTA 4DV5K 3FFKB 2H48B 1IO2A 4FF2A 4A5AA 5ETTA 4KTWA 3E01A 1VSHA 2X51A 3GMGA 4WF9L 4FWNA 3R5BA 4YB5A 2E2PA 5KFWA 1JQGA 2C3UA 3OHRA 1HWLA 1GLLO 2G8VA 2DCLA 3A3OB 4JHDA 5AQWA 1RTHA 1HNZJ 1S6PB 4CJ7A 1S9GB 4JI5F 3TWHA 2BW7A 2KH9A 4JI5K 2SXLA 1K44A 3ZZUA 2GQQA 2H1YA 1UVKA 1XERA 5AQGA