1RT1A

Crystal structure of hiv-1 reverse transcriptase complexed with mkc-442
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
539
structure length
538
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complexes of HIV-1 reverse transcriptase with inhibitors of the HEPT series reveal conformational changes relevant to the design of potent non-nucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 147
structure length 538
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt1A05
4RW8A 4BDYA 3A2FA 1BCOA 4CCHA 4FLTA 3P1GA 2VG6B 5I42B 1A5XA 4CJ3A 1T03B 3D28A 3HVTA 3M9MB 4YMEA 4I7FA 2ITGA 3HL8A 1LWEB 3PR4A 3TANA 4KTZA 1TK8A 1VSMA 1VRTA 4TN2A 5L1JA 5FDLA 1NJWA 4ED2A 4CJPA 3UDLA 1VSJA 3KJVB 4CJFA 3CG7A 1WSFA 3OYCA 3PX4A 4RW8B 3OJUA 3H5SA 3SCXA 5KFMA 4BWJA 3AO1A 4E89A 4TQSA 5KFQA 4F50A 2OPRA 2YNGB 4RW4A 1JLBA 3VQPA 4M94A 2JEJA 5L1KA 2RF2A 1WN7A 4W5NA 4DTPA 4XO0A 1KCFA 2E6LA 3ZSYA 3NF6A 3SUOA 4ID5B 3O3HA 3SPYA 4AHCA 2D0CA 4RU9A 4B3OB 4IFYA 4N47A 4C8MA 1UA1A 1RT2A 3PZPA 4WZQA 3I8DA 3KLEB 4N56A 3T1AA 4BE1A 3DRSA 1HJRA 3C6TA 3WNEA 4IDKB 2HHVA 1SKSA 2KZMA 4OPKA 3MECB 3V6HA 1ZBLA 3M8QA 5D3GB 1C1AA 3VQBA 3H59A 3TR8A 1T94A 3PW2A 3NH1A 3Q8SB 4DTNA 2EC0A 4PQUA 2YKMB 4K4SA 1KVBA 3SZ2A 3L2WA 4AILC 2LSNA 5HROA 1JLGA 3K59A 4Z4FA 1ZBHA 1XHXA 4O0JA 1SV5A 1RT6A 2AGPA 1QUVA 2W8LA 1RTDB 5KFDA 3PX6A 5KFOA 4KKOA 1R0AB 2E6MA 3M8RA 3JSMB 5HP1B 3IN5A 5FDLB 3K58A 1CSJA 3QEVA 3H4DA 3OL6A 1J54A 2KW4A 2VWKA 1RA7A 5KFYA 3NF8A 1C0UA 4Q8FA 4FJKA 1KRPA 3KHLA 4ZHRB 3F73A 1S6QA 4K4ZA 1SL0A 2ILZA 1FK9B 2GIRA 4CF8A 3D5MA 1NJYA 4OKJA 3UR0A 3PUFA 1LAWA 4F3TA 3G0ZA 2FC0A 3HYFA 3FRZA 5HLFB 5C24B 2D5RA 3SV3A 5L9XA 4FJ5A 4CHOA 5DLGA 1S6QB 1RILA 1IKWB 1S9FA 2JEFA 2G8VA 2OPPB 3M8SA 5KFPA 1LV5A 4DEZA 4DMNA 1X9WA 2C2EA 4E1MA 4KI4A 3SI6A 4CF1A 2FVCA 1TAUA 5T7BA 4QWEA 1S6PA 2O4IA 3IG1A 1EP4B 4Q45A 1DLOA 2OA8A 2QK9A 4IG3A 3TAPA 3JYTB 5DGAA 1C1CA 1TP7A 2C22A 4CJQA 2HHUA 1S1WA 1HNVA 4DSLA 2P5GA 2FVRA 2FVQA 3KK2B 1IKWA 3AA2A 1UAXA 3VQ4A 4W5QA 2AGOA 3EPIA 1IKXA 2D3UA 3SPZA 1B92A 3L2RA 3MFIA 4TY8B 4NLSA 3PW7A 2OYQA 5F8LA 1YVUA 4M3ZA 4WE1B 4DTMA 3C94A 3ZSVA 3IGNA 4KV8B 4ED6A 3DMJA 2DFEA 4NZ0A 4TY9A 2YKNB 4GC7A 5FRMA 5CYMB 2B5JA 4IH6A 3NL0A 2ASJA 3HSTB 3OYLA 3GV7B 3AVLA 4I7FB 3ICLA 1X1PA 4EO8A 4CJUA 4W5TA 1UWBA 3MXIA 1JIHA 4E7HA 5KG6A 4KFBB 4J2EA 3MFHA 1SL2A 4CFDA 1TQLA 2R2RA 5F9NA 1JL2A 3KLFB 5HRNA 2R8JA 3G86A 3C6TB 1LW2B 3IGVA 1DTTA 2KFNA 2VG6A 3V9SA 1SUQB 4CEBA 2XY5A 4J2AA 1YTAA 5J2NA 4H4MB 4IBNA 3V1OA 5J2MA 2DY4A 3CJ0A 3ZT4A 2A1RA 1W0HA 1ZYQA 4ECXA 1C2PA 4KAZA 4Z0UA 4O44A 1JLGB 4CEOA 1N5YB 3CDEA 3EPGA 1LWFB 1TKXA 3ZSRA 1BI4A 3VQ7A 1SUQA 2WHOA 1BQMA 3OYFA 1C1BB 3RAQA 4DQPA 1TKTB 4DTXA 3NAHA 1TKZB 2P5OA 3L2UA 1TV6A 3VQ9A 2AWZA 3S9HA 3FQKA 2P1JA 4AHSA 2D3ZA 3NHGA 5KFEA 3CJ3A 1TAQA 3PJXA 5KFKA 4FLVA 4CF9A 3V4IA 5C24A 1TVRA 3DLKA 3D45A 4M3RA 3I0RA 1JKHA 3P5JA 3I5CA 1YT3A 4TSXA 4DFJA 2YNIA 4B9TA 3HO1A 2HWIA 1BQMB 5I42A 4EP5A 1C1BA 3C6UA 3RB0A 1RTJA 3Q8QB 3DYAB 3NKYA 2IA6A 2W9BB 3OHAA 4MQ3A 4O3RA 3PO5A 4KSEB 4Y2AA 4O4GA 2HWHA 3UPFA 3NMAA 1HNVB 2HVIA 1MU2A 4F4XA 3I0RB 1WNSA 4PUOA 3B6OA 1XR7A 4QWCA 5JS1A 3GIIA 4AH9A 4FLYA 4NLPA 1ZBUA 2E4LA 1N56A 3LP2B 1BIUA 2I5JA 2EX3A 3AVIA 1C0MA 5KT3A 2GBZA 1KLMB 1GOBA 3H2LA 3U6FA 1FKPA 4NRUA 3AV9A 4NLDA 3DM2A 1U09A 4B3OA 3FDSA 1NKCA 3UIQA 2WK4A 4I9QA 5CY4A 3ZT0A 5F8JA 2WB4A 1RT5A 2O5DA 4ICLB 3TAQA 1RCHA 4DS5A 4HTUA 3O4NA 5HRSA 2VG5B 5KG3A 1L3TA 4U6PA 1EETA 2YHBA 2IAJB 3AA4A 5KFSA 3QESA 2CKWA 4GMJB 1QS4A 3GILA 1TKDA 3AA3A 1RYRA 1LW2A 4DQQA 1TK5A 1NOZA 5KFZA 4EP4A 3V9WA 2JC1A 3CDWA 3OL9A 3LPTA 5CYMA 2IBKA 1JLCB 4O3OA 4CGIA 2V9WA 1RTDA 1S0NA 3S3NA 2HNZB 1G15A 4CF2A 3OYIA 4WE1A 4B9VA 3VQDA 2OPQB 3BSCA 1C1CB 3LAKA 3KLHA 4CK3A 3IS9B 4WYLA 4ZVEA 3U3YA 2R2UA 1KHVA 2ZD1B 4HCBA 4QWBA 5KG1A 3SFUA 1NJZA 2UVVA 3PR5B 3QLHB 1ZETA 3LDSA 4QOZB 1HMVB 3NE6A 4FZXC 3BSOA 4TY8A 1HYZA 1D5AA 4CEQA 3MR3A 4IFVA 4BACA 4ECVA 4C8NA 5KI6A 5C5JA 3OL7A 4CJKA 3KLHB 4CFCA 4FM0A 5J1EB 3ASMA 4EZ6A 3RMCA 3CQ8A 4FJXA 4ELVA 4YR2A 3BGRA 4MK7A 4DL5A 4NLVA 5F8IA 3NGDA 4H4OB 4J9KA 2Z1JA 1S97A 2J6TA 3M9OB 3VQCA 4H54A 1RTHA 3GIMA 4G1QB 2YNHB 4TXSA 4CE9A 3GIJA 1IKVA 1XC9A 4DL7A 4DTUA 2I1RA 1RT1A 2BQUA 4URGA 3L8BA 4YNQA 4K4YA 4CGFA 1LW0A 5DG8A 1VRUB 2VA2A 4ECUA 1RAJA 3LP3A 4NYFA 3GIKA 5KT4A 1ZBFA 1TKZA 5C42B 1N6QB 5SWMA 2W9BA 4KI6A 4ED1A 2BGGA 4N41A 4MIBA 3H98A 1ASVA 2DTUA 3MEGB 4CHZA 5J2PA 3BQ0A 4NCBA 4X2BA 3N6NA 3RR8A 1NKBA 5HBMB 3KOAA 3VA0A 5J2QA 3HVAA 4IRCA 2ATQA 4DQRA 4DF8A 4R5PA 1B9DA 4RW7B 5F8HA 3FSIA 4CGJA 3SFGA 3DM2B 1UOCA 4EBCA 2HHSA 1KVAA 4WXOA 1TVRB 3DLKB 4LQ9A 4MKAA 4M3TA 3V1RA 1TL1A 4KB0A 4N76A 3AO2A 2FJVA 3GV8B 1QQCA 4DQSA 4FJGA 4EO6A 2UVUA 3C6UB 3BJYA 3H5XA 3CYMA 3TAMB 5KG0A 3ITHA 4H4MA 4XIUA 3KHRA 5KFAA 3O4QA 4M3WA 2IJNA 1S0OA 5HLFA 4CF0A 4RW9B 4O55A 3QNNA 2XC9A 2HHXA 1RT3A 1S1TB 4BE2A 3ISNC 2FLLA 4EBEA 3QGIA 4KHQA 3LANA 3MF5A 3ZT2A 1NK8A 4KB7A 2IM1A 1WAFA 2ASLA 3MAQA 1JLFB 1EXQA 3DRPA 1IG9A 4HVJA 4ID5A 4LQ3A 4I9LA 4CHPA 3RTVA 4OKKA 4CK1A 3AVNA 1IKYA 1S1VA 5FROA 4J9OA 4ZVHA 1S1UA 1RTIB 1NJXA 4B9MA 1TL3B 1JLCA 3MR2A 1IO2A 2XY8A 5KGXA 2NUBA 3FFIB 1NOYA 4PWDA 5KFVA 4RW6B 3CIZA 2HW3A 2XHBA 5KFCA 1S5JA 5DMRA 4Z4GA 3HM9A 2BANB 4JLHA 3N6MA 2FLPA 1SL1A 1D8YA 3OYDA 3PW5A 3PY8A 3DMJB 1J5OA 1QAIA 4DSJA 2PYLA 2D0BA 4QWAA 4FS1A 2HNYA 1U48A 1L3SA 4K4VA 2HHQA 3FFIA 4J2BA 1BHLA 1RTHB 4NLRA 4G1QA 4RNMA 4DL6A 4KKOB 2IC3B 4RG8A 1T3NA 3KIOA 3QEPA 4I2QB 1RDDA 2D0AA 4PQUB 1N4LA 3KHHA 4DSIA 4B9NA 3DRSB 2WONB 2XY6A 1S48A 3NBPA 4IQXA 3HP9A 2GV9A 4FM2A 5J2PB 4KTWA 1J5OB 2ATLA 4CJ5A 1RNHA 2FBXA 2JGUA 3H5UA 2RF2B 4FZYA 4LSNA 1JLFA 4ZPDA 3NF7A 2KZZA 3NAIA 1HQUB 3WNHA 1S9GA 3QO9A 4FXDA 2B4JA 2W8KA 3VA3A 3NCIA 2BQRA 2HMIA 3AVJA 1QHTA 3CFRA 1HNIA 4QWDA 1QAJA 4O44B 1S1UB 4FLZA 3DOKB 1TL1B 2FJXA 3LP0A 1TKTA 3V6JA 2RPIA 3OS1A 3M8QB 4XPEA 3S3OA 2BE2A 4R5PB 5K14A 4OKEA 1RT7A 4ZPBA 4FJJA 1JL1A 4TYAA 3CWJA 2BANA 3QGHA 2AQ4A 1RT1B 3IS9A 3WNFA 3V9UA 1SKWA 3AO5A 3K5NA 3WNGA 4ZPCA 4ICLA 4CEAA 3HXMA 2OPPA 3AVCA 5KFNA 3MTKA 2G8FA 4OJRA 3LWMA 1S10A 4K50A 1VSIA 4MK8A 3QZ7A 4FLWA 4I2PB 4JUZA 2XRIA 2X74A 4OGCA 3ZSXA 3NGZA 3KLGB 4J2DA 4DQIA 4O4GB 4F8RA 5C25A 4O4RA 3SI8A 2Q3SA 4MFBB 3L2QA 5KT6A 2YKNA 1RDAA 3MEDA 4ZVGA 1BISA 3MEEB 3LP1B 4KRFA 3ZSQA 3OLAA 4O3SA 3OYEA 3UQSA 3PX0A 4AHVA 2HNZA 4RW7A 3C95A 4DL3A 1A5VA 1DLOB 1EX4A 4KTQA 2IM0A 1RDBA 4DTJA 1IM4A 4CGHA 3T5KA 3VQ8A 3E01B 2QV6A 1KVCA 4JS4A 3DRRB 3KK2A 1I3AA 3HPGA 2ZQBA 3V1QA 4GVMA 1GOCA 2ALZA 3LP0B 3L3VA 1ASUA 4HUGA 3DOLA 3OSNA 3DRPB 5DGBA 3RWUA 1RTJB 1REVB 5F8NA 2HAIA 4Q5VA 5K14B 1N6QA 2WCXA 4BDZA 3OYMA 1UWBB 1UA0A 4DU4A 1U49A 1QSSA 2IGIA 5KFRA 1KSPA 3NH2A 3F9KA 2GIQA 3KTQA 3DDKA 4JV1A 1S1WB 2R8GA 4JV2A 1JLEA 3DRRA 2IJFA 1S9EA 1K6YA 5JS2A 2XWYA 4C8KA 1BQNB 3HT3A 1TL3A 4K4XA 1TGOA 3OL8A 2W42A 2XCPA 2FVPA 5KFUA 4K4WA 1S9GB 1VSLA 1NK9A 3NH0A 4DS4A 4ELTA 4M95A 3T19A 2UUWA 4HUEA 4CEEA 3V4IB 3PJWA 4W5RA 1WSIA 3M9NB 1IKYB 1S1VB 5I3UA 3PW4A 1SKRA 2QKKA 1RDRA 3EZUA 1F21A 2IDOA 1ZBIA 4TLRA 4RW4B 5DQIA 3CJ5A 3G6XA 3DLHA 4FK4A 4G3IA 1NK5A 3DLEA 3CM6A 1HQEA 1HYSB 4B8AB 3HKWA 2F8SA 1RBTA 1S6PB 4WYWA 4FJNA 3I0SA 3QETA 4WXWA 4LY7A 5KFBA 5KFJA 2RN2A 4HUFA 1QE1A 4Y3CA 2J6UA 2RDIA 3N6LA 3CM5A 2RDJA 4KHMA 4F2RA 1JXBA 1RT3B 1S1TA 2R8IA 3DOKA 5KFXA 4W5OA 1L3VA 2F8EX 4K8XA 1BL3A 4ED8A 3CJ4A 4XPCA 3DOLB 5HRPA 3H5YA 4FJHA 1ZTWA 4RUCA 1X9SA 1WSGA 4NLOA 2FVSA 4FCYA 1S1XA 2BDPA 4CHQA 2IS3A 4ZVFA 4Z4IA 4O0IA 4NLQA 2ZD1A 4KV8A 3SQ4A 1S9EB 1D0EA 3RB3A 5CZ1A 3PV8A 2G8UA 1NNDA 2UVWA 5DLFA 2OH2A 4LSLB 3RMDA 5T14A 3BR9A 2IMWP 3ZSWA 4NCGA 2GC8A 4FJMA 1WNEA 3IG1B 1Q8IA 4OPJA 3RR7A 2XCAA 1RBUA 3T5JA 5C25B 4ZP8A 3TQ1A 2HNDA 2OPSA 3T5LA 3CFPA 1C6VA 4J9QA 1RBRA 1LWCA 3LWLA 1FK9A 4JV0A 1KHWA 2YHAA 1K1SA 4J9MA 2YV0X 3SNNA 3OYJA 4CGDA 2ZKUA 1CXUA 3SJJA 1LWEA 4O3PA 5L1IA 2HHWA 1FKPB 3KD1E 1VSHA 2VG7A 1SH2A 5KRTA 4BDPA 3GV5B 5J2MB 4FLXA 4FJLA 4YQWA 1T05B 3GQCA 3EYZA 3E01A 2R8HA 2JLEA 2D7SA 4NLTA 4ECTA 1WSEA 3G10A 3BQ2A 3KKRA 4RNHA 1VRUA 1JX4A 4Q8EA 1O1WA 4OL8A 3MR6A 3TI0A 3V9ZA 3V9XA 1NHVA 1NK7A 4CJSA 3IRXA 3VQEA 3QZ8A 2IM3A 1T03A 4L8RB 3TAMA 4FJ9A 3HVTB 5DG7A 3V81A 1REVA 5EWGA 3V6DB 3JSMA 5HP1A 4IFVB 4CEZA 2XY7A 3SQ2A 1ZTTA 3SV4A 2HMIB 4CESA 4ECZA 1JLEB 4MH8A 1J53A 2XI2A 1Z26A 4Z4EA 1YTUA 2UUTA 4QW9A 3U3GA 3L2VA 1KLNA 4M45A 3LZIA 4E0DA 1W25A 4DSKA 2WOMA 4Q0BB 4KO0B 3TAGA 4KHRA 3H4BA 4AHTA 5KT5A 2BE2B 3V81B 2C2DA 4J9RA 4OLAA 4Y1CA 3VQ6A 4NLYA 3ZT3A 3SQ1A 3VQ5A 4Q44A 3KLVA 3AVFA 2AX0A 3AVHA 4MIAA 1D1UA 4FBUA 3PHEA 4WFXA 2XGPA 3RB6A 1BQNA 4ID1A 2WRMA 4H4OA 4E7KA 1K1QA 4M3YA 4Y1DA 4YFUA 3ITHB 2W7PA 4NRTA 3HPOA 4C8OA 4MKBA 4O5BA 2FBVA 3ALYA 1VK0A 1XHZA 4N5SA 5KFGA 3QGGA 4HKQA 4WFZA 5HRRA 4ZTFA 2YKMA 2P51A 1DTQA 2BR0A 1WSHA 4M41A 3BGRB 4CJWA 3MEEA 4NCAA 4FJ8A 3PO4A 4DFPA 4EYHB 2IAJA 2IC3A 1ITGA 1RT7B 5KT2A 2Z1IA 2J6SA 4FK2A 1U47A 4ZP6A 3VQAA 1NK4A 5E41A 3OYKA 4KREA 4YP3A 4DTOA 4FLUA 3HP6A 3OYBA 1C0TA 3ZT1A 1RT2B 3ISND 3LZJA 3KKSA 3KLEA 2WONA 5J1EA 3AVAA 2C2RA 4ECWA 4CJTA 4LD0A 3ULDA 3AO4A 2X6NA 3VQSA 1MMLA 4LSLA 5KFTA 4M3UA 5C42A 3K5MA 4RW6A 4KHWA 3QO9B 4J9LA 2E9ZA 3S3MA 3I0SB 4CHNA 3JYTA 2RKIB 4O3NA 1BCMA 4CFBA 2AX1A 4TYBA 3KD5E 2FBYA 3HK2A 4MFBA 1QTMA 3NGIA 5KRSA 3CFOA 1JLQA 2DFFA 5JUMA 1D9DA 3PW0A 4B08A 2HNYB 1QSLA 3IRXB 3QLHA 4IRDA 2O4GA 1Q9XA 1S4FA 3CVKA 4FW1A 5DQGA 4NCGB 1R0AA 4DL4A 2B6AA 4KPYA 4IH7A 4ECYA 1I6JA 3Q8RB 3T3FA 3NBPB 2AU0A 1JLAA 2ETJA 5KG4A 5KFFA 4URSA 1BGXT 4ECRA 2B5JB 1GX6A 4IOBA 3CJ2A 4PY5A 4Q0BA 4F4ZA 5HBMA 1IKXB 2ILYA 3RAXA 4YR3A 2Y1JA 4JRPA 2VWJA 2ZE2A 1QSYA 5FRNA 2IOCA 4KB1A 2QE5A 3QNOA 1FKOA 2R2TA 4LH5A 3TAEA 3TARA 1L3UA 3KJVA 2V4QA 4E7IA 1SH3A 2Z1HA 1D9FA 4EBDA 4CJEA 1LW0B 2DFHA 4NLUA 3H40A 2DPIA 1N48A 1XI1A 2B43A 2CJQA 1JLBB 4IKAA 3G6VA 1GOAA 4DF4A 4Z4HA 4U7CA 5KG2A 4CECA 3I5AA 2PYJA 4CK2A 4QPXA 3O3FA 4NLXA 1CZ9A 3ZSOA 5J2NB 4DTSA 1S49A 2XI3A 3BSNA 1OS5A 4KAIA 4FVMA 5DK5A 4KBIA 3OS2A 3KMQA 4CJVA 4FW2A 4FBTA 4M42A 4DU1A 1JXLA 1JXEA 4OGEA 5KFLA 4JS5A 3RRHA 2G8IA 3VQQA 5J2QB 5F8GA 2JC0A 3P83D 1NK6A 2G8KA 4ZTJA 1RDCA 4AHRA 1VRTB 4DG1B 5KTQA 3HVRA 2HHTA 3CDUA 2R7YA 3SUPA 3T5HA 1XWLA 2IM2A 4NYZA 3K57A 2DPJA 1N5YA 1WAJA 4E7LA 3AVKA 4NLGA 1WSJA 1NK0A 2PZSA 3KK3A 3AO3A 4E3SA 2HVHA 1HYVA 1SV5B 3K2PA 3AVMA 1HRHA 4OLBA 3OYGA 1WLJA 4URQU 3OYNA 4PWDB 4IG0A 1HQUA 1TK0A 4ED0A 2OZMA 3PVXA 1EP4A 4OVLA 4ECSA 3QIDA 3B6PA 4IR1A 4FJ7A 5CYQB 1T8EA 3D0PA 4E7JA 3NFAA 1C0UB 2EHGA 4CIEA 1J9AA 1DTTB 1JLQB 3OJSA 5KG7A 3KK3B 4LH4A 4DL2A 3SUNA 2I5JB 2KFZA 4B9LA 4E1NA 3SQ0A 4CIFA 4J9NA 4IG0B 2R2SA 3VN5A 2F8TA 4KHYA 3EZ5A 3KMSA 3QEIA 1EKEA 2F96A 3GYNA 2Y1IA 1NHUA 3I5BA 3KNAA 3NF9A 4F3OA 3RRGA 2HNDB 3G6YA 1DTQB 3DLBA 1JKHB 3DLGB 3MEDB 3NAEA 1LWFA 1TKXB 1LWCB 3RB4A 2WOMB 4Y2CA 2VG5A 4YR0A 3OYHA 5CZ2A 4Y34A 1HARA 2ZE2B 4J9PA 3KLIB 4EYIB 4I2PA 4B9UA 4WFYA 2B6AB 3HJFA 4CJRA 2KTQA 4KFBA 3FQLA 2RKIA 2UVRA 4CJ4A 1CZBA 1T05A 1KTQA 3RMAA 4PUOB 2D41A 4DTRA 3O3GA 2W9CA 4CHYA 4DLEA 4FK0A 3QERA 2QXFA 4RNNA 2AJQA 4RUAA 3NDKA 2PY5A 4KHSA 3OYAA 3EY1A 2XGQA 5KT7A 5EU7A 1EETB 1Z25A 3M8PB 3L3UA 1VSFA 1FKOB 5KGWA 3QINA 3DLRA 4M3XA 4ECQA 4TQRA 4QW8A 2OPSB 4DWIA 5DG9A 1RT5B 2X6SA 4CEFA 1XR5A 3LALA 1RT4A 1RYSA 1BI4B 1RTIA 3BREA 1IH7A 3OS0A 1S0MA 3TVKA 4R8UB 4CFAA 2YNFA 1XR6A 1S1XB 1A5WA 4K8ZA 4DG1A 5KFIA 1ASWA 2E9RX 3E51A 4IFYB 4IKFA 4IR9A 3MXJA 3TWHA 3CO9A 4DLGA 4RW9A 4ZMMA 3LPUA 4ZPAA 1NKEA 3DLGA 2BQ3A 1JLAB 3TABA 4ZHRA 3QIPB 3HHKA 4JRQA 2V4RA 2YNIB 3BQ1A 4ED3A 4IH5A 4KE5A 3RBEA 3LP1A 1RBSA 4ZP7A 5F8MA 4FJIA 4K4TA 2XO7A 4FZZA 1FXXA 2YNHA 2KQ2A 4ELUA 4KHNA 4F4KA 2FBTA 3DYAA 3V6DA 1VSDA 3OHBA 4PA1A 4B9SA 1YVFA 2OPQA 4RZRA 1KFDA 3BDPA 3OVNA 1QE1B 3THVA 2FJWA 2VA3A 5EUHA 2W9CB 5SZTA 4B8CA 4QAGA 1T7PA 4F2SA 5KFWA 1U4BA 4IDKA 3BSAA 3HVWA 4DFMA 4KO0A 4FM1A 3SUQA 2OZSA 1HPZA 3DLEB 1KLMA 4CGGA 4BWMA 2VG7B 1IKVB 4ZP9A 1CLQA 3TAFA 5EWEA 3OY9A 2C28A 4MK9A 5CYQA 4IRKA 3RMBA 1LAVA 2G8WA 3QIOA 4DFKA 2OPRB 2YNGA 1RBVA 2QKBA 2ASDA 5EDWA 4K4UA 4Z4CA 5KFHA 5DQHA 4O3QA 4R8UA 5D3GA 1HPZB 3AA5X 3K5LA 4DU3A 4DSEA 1VSEA 4F4WA 1U04A 2W9AA 3Q8PB 1Z4UA 3AVGA 5F9LA 4E19A 3H08A 1MU2B 4FYDA 4BE0A 1X9MA 1VSKA 3MEGA 4CEDA 5I3UB 1KFSA 3V6KA 3DI6A 3KK1A 3SYZA 4EZ9A 3RBDA 4KHUA 3QYYA 3LP2A 4C8LA 2GUIA 3LAMA 4ED7A 4CERA 3OLBA 1BIZA 1HQEB 1TV6B 3KLIA 2E9TA 3ZCMA 4WZMA 2W7OA 4HYKA 3AVBA 1HNIB 5HROB 3ZSZA 4HHTA 4HCCA 2HB5A 4GW6A 4CIGA 3QEWA 1RT4B 2G8HA 3DI6B 3KK1B 4J9SA 2R8KA 3IAYA 3KHGA 1RT6B 4EEYA 4NLWA 4Q43A 1HMVA 4H8KA 2YNFB 1SH0A 1W9HA 5KG5A 3K5OA 5L1LA 3M8PA 4R0EA 4I2QA 2V0NA 2FLNA 4IG3B 1GX5A 1I39A 4DSFA 2X78A 4NYNA 2A1SA 4QCLA 3NGYA 4AHUA 2BRLA 2BRKA 1Y97A 3OSPA 3QIPA 2JEIA 3MECA 4RNFA 4RNOA 1Q9YA 4FS2A 4LSNB 3HPHA 1B9FA 5EWFA 1HYSA 4GC6A 4CJLA 3MXMA 1L5UA 3MR5A 2Z1GA 1RA6A 2WTFA 4UQGA 1CXQA 3KLGA 5JXSA 2AGQA 1C0TB 1U45A 2JEGA 3KLFA 3QEXA 4F4YA
chains in the Genus database with same CATH superfamily
2IIRA 1IBMK 2KHOA 4ISFA 4CCHA 4I67A 2N3LA 3P1GA 2VG6B 4JB8B 1A5XA 3M9MB 3HVTA 3J7AN 3HL8A 3LOUA 4KTZA 4K2JA 3ILIA 1VRTA 3EX7B 4DV3K 5FDLA 4JI0F 1WSFA 3OYCA 4RW8B 1GLAG 2A2DA 2Y1LB 3FGVA 3CJSA 1YZ6A 1IG8A 3MTJA 4TQSA 2O8FA 4F50A 1B7FA 2OPRA 2YNGB 1U2RA 1S79A 4M94A 2ZEJA 3CJKA 2JEJA 1FO1A 2CNLB 4W5NA 4XO0A 1T9WA 1KCFA 5E2QA 3ZSYA 4OYIA 1JCFA 4ID5B 3O3HA 4M63A 4AHCA 2D0CA 3PRVA 1NM1A 4WZQA 5IT4A 5LSRA 5L46A 4BE1A 1HJRA 3C6TA 3VGUA 1KP6A 4UY85 5AJ3F 2LEBA 3L9ZA 1U0SA 2R7RA 2XTJP 2VBXA 5B7WA 1FW6A 4IDKB 2NXEA 2KXNB 5D3GB 3VQBA 2ZVIA 1T94A 2OTLN 1UWAA 2YKMB 4K4SA 3QT5A 4OHZA 2ZH1A 4FXWA 3L2WA 5K8PA 3HSJA 5HROA 4J5OA 1XHXA 3H45C 4Q2LA 4DPWA 2HYIB 1IV0A 2W8LA 1RTDB 1AB8A 5KFDA 4OHYA 3PCOB 4DV0J 2JLGA 3W2WA 1R0AB 1S6OA 3K58A 3E1YA 3WUHA 5B08A 3BKTA 2P9KA 1VQNS 1R8BA 1XJWB 1H1VA 2VWKA 4GKJK 4Q8FA 2LEAA 1X60A 4ZHRB 2R7WA 2RU3A 2XNRA 4DHVA 1N36J 5IM0B 2M52A 1YJTA 2GIRA 4QR2A 1NJYA 3AY0A 3VEOA 1Q95G 2VDHA 1BG3A 3I31A 1UKUA 4F3TA 5I4MA 2FJBB 2CGKA 2DNOA 5A2QO 4Z2XA 2JRSA 3N4PA 2HBMA 3KNGA 3SV3A 4ISEA 1VQ6S 4F3MA 3UN3A 1RILA 1S9FA 1FNXH 4CZGA 3FSXA 2CJKA 2VQFJ 2MLXA 1RAAB 4K8RA 1X4AA 1VQ5S 2J0SD 2BKNA 1ESVA 1SQEA 1TAUA 5T7BA 1S6PA 3IG1A 3OUYB 4NZ6A 1C1CA 1TP7A 1FESA 4BRMA 4CJQA 3HSDA 2NLXA 2FC8A 1IKWA 3AA2A 1UAXA 1A7GE 1VCTA 3DHXA 3WX8A 2IRYA 1KC8T 2DT9A 2PFFB 3OVAA 2BOAA 3NMUA 2OYQA 5B0DA 1YVUA 1OVYA 1J5EJ 3MDFA 3C94A 3K2YA 2BJDA 2NSCA 1HFEL 4ED6A 4TY9A 5FRMA 4CI0B 2BW7A 3OTCA 4DV3F 4IH6A 4NEYA 3NL0A 2WVBA 2XMKA 3OYLA 5C12A 2M2BA 4CYUA 4NPOA 3ICLA 4JI2J 2K8GA 1UWBA 1SC4B 1RKJA 3MXIA 2OTJN 1JIHA 5KG6A 5I3PA 1IBLF 4J2EA 2ZZTA 5HL7L 3MFHA 4PKIA 2R2RA 2NUHA 1QAXA 3KLFB 4ZLNA 2R8JA 5LJ5Y 3IGVA 2XQCA 1B7YB 2PI4A 3SBMA 5AE3A 2PO4A 2P8IA 3V9SA 1NU4A 2ADCA 2XY5A 3AY9A 4J2AA 2F9DA 2WB1D 1FRIA 3UB5A 1A6LA 4IBNA 2FHJA 4H0OA 1U02A 3P49B 3CJ0A 4WFAL 2L9WA 4BRKA 5LOQA 3OTBA 1WKKA 3GYXB 4ECXA 1C2PA 1DQ8A 2RS2A 4KAZA 4O44A 3EPGA 1LWFB 2XNQA 3TUZC 2CH6A 4KGXB 5EX3A 1G7CB 1KQGB 1TKTB 4CZLA 2BJ7A 3NAHA 2P5OA 5C2GA 3FQKA 2CPJA 3OW2R 1WSVA 5KFEA 3NHGA 3PJXA 2CQPA 2HQCA 3WIVA 1NH7A 4B3TF 1VQ6N 2Y9HA 5C24A 3D45A 4M3RA 3BYRA 3I5CA 4CLYA 4TSXA 5EXWA 3W9HA 2HWIA 4V19X 3ZX2A 5I42A 2JVOA 3RB0A 1YTYA 3OT9A 1EKRA 2G1DA 3G6EN 5B09A 2HS0A 4CM2A 4YHHK 4MQ3A 3KVGA 4L73A 4HACB 3QJJA 2HWHA 5IV4A 3NMAA 1MU2A 4KT0C 5JS1A 3GIIA 4OI0A 5IS2A 4FLYA 1E4FT 4FOEA 2DNLA 3PYFA 1N34K 3AVIA 5E3AA 3EGVA 1HBMA 3EGWB 4NRUA 3WHIA 1BO5O 4B3OA 3FDSA 3CJAA 5D6GA 2GMLA 1VHFA 2WK4A 3T1YJ 4LFBK 2G2OA 1UEUA 4J9VA 2YJFA 4NX9A 2WB4A 1RT5A 4MYUA 1C0FA 2EFQA 3J81U 4DS5A 8ATCB 5KG3A 3HZGA 4ID8A 4OYBA 4A61A 1GT8A 5GIOA 1Y9OA 2GELA 4JI5F 3QESA 5AJ3J 4GMJB 1QS4A 2DHGA 1NGFA 4NI2B 3MWBA 1GXUA 3H0PA 4OYWA 1LW2A 1YRXA 1NOZA 3OBIA 2IRUA 1PILA 3LPTA 5CYMA 3JTPA 2DR5A 5AQJA 3T1YK 4FPBA 5FPEA 2ZH5A 2HNZB 5L9NA 3WC2A 4ZVRB 1AA1B 1I51B 1DFDA 2OPQB 5A8RA 2R2UA 4DB3A 4FWQA 4ZOSA 2GCFA 1AXQA 4JD2B 1OSDA 2LU2A 2AYEA 1QUPA 1WF2A 3BGUA 3R5CA 2JWKA 4C11B 5AQWA 3UD3P 2KDOA 3THWA 1D5AA 2MB0B 1S7HA 3HFVA 4ECVA 4C8NA 2IPOB 2EI5A 3OL7A 4CFCA 3CMEN 4FL9A 4HI2A 5HQLA 1R6YA 4FJXA 2FC9A 2DVIA 5F8IA 5CD4H 3H2UB 3Q23A 2BXJA 3MMCB 3TUPA 1C4AA 4A8MP 3D68A 1WC0A 3GIMA 4TXSA 1T0TV 1ZM4A 2D0OA 4JI7K 2QL9B 1IKVA 1W2IA 1WSRA 1H98A 4U8VA 1O0PA 4C2MA 4LR9A 1KN6A 2BQUA 1VK3A 4URGA 1GLBG 3ID8A 2CG8A 4I64A 1LW0A 3SQGB 2VJVA 2FGOA 5LJVA 1RAGB 1ZOTA 2OMOA 2VA2A 4LFBJ 3LP3A 5I9EB 5HANA 2H4WB 2UXBF 3QSIA 2LYVA 4S0MA 3WDOA 2ATCB 2QC3A 1UJ6A 3FBFA 1TKZA 2F3JA 3TEGA 1OH7A 2IY5B 3EN9A 1FF2A 2PMWA 3B6BA 3H98A 1ASVA 3MEGB 2Z58B 3ID6A 3AA8A 1DKGD 1NKBA 5D4PA 2LCWA 3KOAA 2V8VA 3VA0A 1HW8A 2AJ1A 3MN6A 4R5PA 1B9DA 2Y8YA 4BRIA 1GTHA 3ATVA 3VENA 5ADZA 4XDCA 9ATCB 2CADA 4I6MB 2QLXA 2KH9A 2R7QA 3DLKB 4LQ9A 4DR7J 1ZAXA 3V1RA 1TL1A 2WTUA 3G71S 2DD8S 4N76A 1FTCA 4ZA1A 3ITHA 3DN9A 2HQGA 2LQ8A 7FD1A 1RBLA 3THYA 1UFWA 3UCUP 2P9UB 4RW9B 2V4JA 2V7ZA 2HHXA 4X4RA 1S1TB 4GKJF 3MCPA 3VETA 4BE2A 3GFXA 3ISNC 2FLLA 4JI1F 4EBEA 3QGIA 4PZVA 1RWVB 3BB5A 3MF5A 1NK8A 1GEHA 2P9LA 1XN9A 1S4EA 1K73O 1EXQA 4NLBA 3R1LA 3OHRA 4BY9C 4LQ3A 3Q2SC 1IR0A 3L4BC 1X5SA 1WHWA 2PMZD 1UAWA 4CK1A 2XSJB 1FKAF 2IVNA 3AVNA 3FKBA 1S1VA 2ZOMA 5FROA 3GFYA 1EQ0A 2LP4A 3PIOL 1ZM2A 1WG1A 4V19J 5MAOA 2B0GA 1RE1B 2LXFA 3TX0A 1TUYA 2XY8A 3SMZA 2NUBA 4C0OC 1CS4B 2XMMA 3FFIB 4U7UD 2OHDA 4RW6B 2M5YA 4A8WA 2XHBA 5DMRA 1R27B 2BANB 4JLHA 4X66K 3N6MA 4BRNA 1RQ0A 1WUUA 3M4XA 1J5OA 3ZX3A 1VQ8S 2PYLA 2D0BA 3QICA 4UW2A 4FS1A 4CH7A 1U48A 1L3SA 4K4VA 3OFEA 3ZZPA 2ZC3A 1K73T 2VHGA 3U1NA 2AIRB 2IC3B 4YUDA 1WELA 4RG8A 1BA0A 3PNIA 3THYB 2KVQE 4DSIA 4DPUA 2XS2A 2HQ3A 1X5TA 3RRKA 1VOMA 1BA1A 4ISGA 1PAEX 2KM8C 2MQQA 2GJ2A 1JXVA 2Q0RA 4CJ5A 1XK8A 1P27B 1W7WA 3L95X 1RNHA 3ENWA 2FBXA 2WW8A 4F26A 3FMWA 4FZYA 4I6WA 3B82A 4LSNA 1HD1A 4MKYA 1IWGA 1HQUB 1ZZFA 3SIPB 3RW6A 2RUSA 4BROA 3PKYA 3GU0A 3MM9B 2JHEA 3LUYA 4IJNA 1HNIA 3NCQA 2MY8A 4CLUA 1IBMF 1KWMA 3M32B 3PM9A 3THXA 4FYXB 3FE1A 8AT1B 1RJJA 3MR7A 3DU5A 3M8QB 3G8SA 2BE2A 4G6VB 1WTBA 1PAUB 4MLEA 1RT1B 2ZVSA 1SKWA 2DHXA 4R25A 3S41A 4DN9A 5ETQA 3WNGA 1Q7YO 4ZPCA 1VIOA 1KAYA 4AL6A 3LWMA 1S10A 3JS6A 4MK8A 2VQFF 1DY3A 3C8YA 4JUZA 3VEWA 2BW2A 4OGCA 3ZSXA 3KLGB 3PIPL 4O4GB 4UZCA 2A0FB 2Y0SD 2CXEA 1LCUA 2E2NA 2HKEA 1E6YA 4ZVGA 1VQPS 5KOWA 1HNZK 3LP1B 1HNXF 4CO4A 3POTA 4O3SA 4AFFA 3UQSA 1XBWA 2MPUA 4F3QA 2HNZA 1A5VA 1EX4A 3V5RA 3UKUB 4LF8F 3T5KA 4FWNA 5A8RB 3VQ8A 4HVZA 4JS4A 1Y5LB 2FJDB 5H9FJ 2F8HA 1X9JA 3GJTB 2X3DA 4JD2A 4OHXA 3THXB 3ENQA 2DGSA 3D4JA 1HD0A 4HUGA 3UCGA 3DOLA 1BLUA 4XDDA 3NY0A 3DRPB 3RWUA 1RTJB 5F8NA 4PXBA 3VAHA 2WCXA 2P9NA 4C8ZA 1QSSA 2IGIA 5KFRA 1FDDA 4BRPA 3KTQA 1S1WB 4IZ9A 4ZIWA 1S9EA 1G6BA 5JS2A 1HHSA 4XTTA 3WIUA 1OPIA 2MQOA 3KUEA 2DNGA 1V3SA 3RZAA 1SXLA 4AT1B 3WXIA 5AZIA 1S9GB 1O6XA 1NK9A 2VPYB 2HQIA 4L3QA 2W2NP 4PKDB 2UUWA 2FF3B 4CEEA 4YN3B 4W5RA 3M30B 3J81O 4FSVA 1N5SA 3M9NB 2QTWA 2CG4A 3JTOA 1RWOB 4FF1A 4TLRA 2O8FB 3LGHA 4CZCA 1K9MO 7AT1B 3CM6A 1Q8LA 4X65F 3PIOQ 5EX0A 3JB9k 2F8SA 1RWUA 2BM0A 3I0SA 2ACYA 5KFJA 4DR3K 3HDSA 2ZUAA 1QE1A 2J6UA 2DPNA 3N6LA 4JI7J 1J2VA 1JXBA 1RT3B 5KFXA 1NGAA 5BREA 4W5OA 2VQEF 4HL9A 4JHDA 4ED8A 5DO2A 4XPCA 3DOLB 3MUVP 5HRPA 4FJHA 1X9SA 1VHXA 2FVSA 4MKVA 1BWFO 3J81j 4KH6A 5K9FA 1RHJB 5G0RA 4NXMF 2HBJA 2OFGX 1R8PA 4O0IA 3OBWA 4WF9L 1SAZA 4U67L 3D1OA 4HH1A 3RB3A 3R3LA 2DXDA 3V2UC 3KJFB 1T44A 1EWQA 2UVWA 3B4DA 2VONA 1IWAA 5DLFA 3CIMA 2OH2A 4LSLB 3B8HA 2BJ8A 1NBWA 1N32F 4LFCF 3ZSWA 4NCGA 4FJMA 1VQON 1TELA 2YKQA 3FJ2A 4OPJA 4KGVB 4OYOA 1RBUA 2HNDA 3AAWB 1FJEB 3T5LA 4KIAA 1C6VA 3CFPA 1T11A 1WOOA 1FK9A 3NS6A 2YHAA 1K1SA 3M2UB 1U6BA 4LF7J 3PEHA 2ZKUA 2NXJA 5L1IA 4LUBA 3LL3A 4KR0B 3KD1E 2N4CA 4G9ZA 4CTAA 2HHPA 1I94F 2E5IA 4K5SA 5J1NA 5J2MB 3Q89A 5LMNF 1T05B 5H9EK 2DEIA 1OY6A 3HT0A 3EYZA 1NLKL 4NLTA 5DDQC 3LO3A 3KKRA 1PBUA 1VRUA 5BYSA 1PGZA 1JX4A 1FEEA 3SBTA 2PMHA 3V9XA 1NHVA 3MCMA 3OXLA 3VQEA 4CJSA 4L8RB 4FJ9A 1RGIA 4YOVA 5HP1A 4LFAK 4BS2A 2ERRA 1ZTTA 4CESA 4ECZA 1JLEB 4MH8A 1J53A 1UVJA 4QW9A 3U3GA 1N0UA 1HBOB 2R7UA 4QS8A 2E44A 1SKUB 4OPHA 3MMJA 5KT5A 3R2CJ 3GDQA 4C8YA 4DV4F 4Y1CA 3VQ6A 1B0TA 4NLYA 5M1KA 3VQ5A 3H7HB 3QNWB 3SAHA 4NI2A 3AVFA 1CG2A 1RWWB 1VC0A 3B8AX 3PHEA 3V4MA 3NGKA 2JVRA 3U9DA 3CCUS 4YEAA 3QFWA 3BDEA 2QYCA 4M3YA 3EVOA 4Y1DA 4C8OA 3T1HK 2A3ZA 3SCJE 1U1LA 1DGKN 1XHZA 4F0KA 4HHJA 1IQZA 2WBNA 4IWVA 1RFQA 2J0WA 4BRDA 1W2BR 5BR9A 5LMNJ 1M0SA 5K20B 1NH8A 1WSHA 4M41A 2YXLA 4CJWA 3K0JA 3K89A 4UZBA 2MZSA 4UF4A 1OVQA 3PO4A 4DFPA 2QI2A 1NNEA 3MCOA 5KT2A 2Z1IA 2JWLA 3VGMA 3CEDA 4A5BA 4ZP6A 3HP6A 3ISND 3LZJA 2ZBRA 4X66F 4OPAA 3MDQA 1SPBP 3DXKB 2WVEA 1B4SA 2ZITA 4LF5F 4RX6A 2DCLA 4CJTA 1X3MA 2UXDK 5KFTA 4FDFA 4K0KK 4M3UA 5C42A 3X3UA 3K5MA 3CJ1A 2N7YA 2GQ2A 3CGIA 1JMTA 3MM7B 3S01A 2E9ZA 3S3MA 4HH0A 3GFZA 4LIWA 3NGUA 3MHYA 2YX6A 4I4BA 4RPFA 2VDIA 3HZEA 3QRRA 1AFJA 1QTMA 4FF2A 1GLFO 3PW0A 1K8KA 4B08A 2HBKA 5GAGU 1BQXA 3R1HA 3DJCA 1LEOA 2VIHA 4N7TA 1UL3A 1R0AA 4IH7A 1NGGA 1JB0C 1VBKA 2N4DA 3Q8RB 2FSKA 4ZVTB 4F9OA 3BZKA 3FGUA 3U1MA 2W01A 4ECRA 3DDNA 3LF0A 4GRSA 3CJ2A 4Q0BA 4DZ6A 5HBMA 4RTFD 3RAXA 4J8FA 2Z4PA 1JJHA 2OSRA 1E3MA 1B0VA 2VWJA 2QE5A 3QNOA 1FKOA 2QL7B 3M1VA 4LH5A 1RTZA 3TAEA 2A3JA 3TARA 3KJVA 4EHTA 2V4QA 2Q43A 3ENVA 1XMBA 1HBNA 1D9FA 4CJEA 4IO9L 1Z05A 2ZKTA 4DX8H 2DPIA 4LJMA 5GMEA 3ENAA 4JV5J 5HVFA 4DV3J 4IKAA 3TPQA 2Z2LA 4NXMK 3UO0A 1GOAA 5HJYA 4U7CA 4CK2A 3O3FA 5F3TA 2AV5A 3VHQA 1F5AA 1V4TA 4IDHA 2WZ1A 2FY8A 4RU2A 1OS5A 1TUVA 4FVMA 5DK5A 2K2PA 4KBIA 1IVZA 4WPAA 4UOHA 1WI6A 2P9SA 4J37A 4DU1A 2W7AA 1B70B 1JXEA 1KD1T 1YIJN 3JSRA 4DR6J 1M1KT 2PSZA 3ENOA 4RR5A 3RRHA 3VQQA 1VISA 4JV5F 5J2QB 1WHXA 2QA4N 4ZVPB 2HHTA 2FQQB 2Y0BB 2CQHA 2MSTA 2E5JA 1U25A 1N36K 1VJQA 5JVHL 1BDGA 3ZZRA 3ZTQA 4DUZK 3VMFB 3AVMA 4CYUB 2J0QD 4BLGA 4Y2KA 1WLJA 4PWDB 3U7JA 1HQUA 4ED0A 5C10A 2OZMA 1EP4A 1RACB 3EGNA 1T8EA 2VCPA 2PC6A 4E7JA 2ZZMA 4CIEA 2QL5B 1DTTB 1JLQB 3HKZD 3VQTA 1S59A 2O8DA 5GAGP 1YJUA 2MXYA 4JAXA 1UW9A 2IVYA 3CCRS 4CJ7A 4O8UA 1ILYA 1DARA 3CCSS 4X4NA 4B9LA 1OH6A 5A0YA 5CR4A 3NG8A 4IG0B 3VN5A 2Y3YA 5G4DA 4F3OA 2JWNA 4A8XA 2HNDB 2FY1A 3DLBA 3FEYB 4AXIA 3DLGB 1AUDA 3NAEA 1LWCB 3RB4A 1VBXA 3CJKB 3IM8A 3OYHA 2CAJA 4L76A 5CZ2A 3DU6A 5C0YA 2YCHA 3HJFA 4CJRA 3GOIA 3FQLA 3CUNA 2RKIA 2CQDA 1T05A 2QMWA 3CW2C 2DR8A 3R3TA 2GWJA 4KPCA 5GAEI 4LF6F 5GADP 4CHYA 3OVBA 3A1YG 2XZWA 3N4WA 2QXFA 3QERA 2E1RA 1Z2LA 3CMES 4EIAA 4KHSA 5BYRA 2BX6A 3CMAN 2ZZNA 1Z25A 5EU7A 3M8PB 2R7SA 1PJ5A 2MKHA 3C15A 1FKOB 5AR0A 5KGWA 4L3KA 3QINA 2CPZA 4M3XA 4NXMJ 4TQRA 3AH6A 4QW8A 2OPSB 4RWWA 1W26A 3DKDA 1XR5A 3LALA 3P38A 4DMZA 3BREA 1IH7A 2YVSA 2LDYA 4CFAA 5I3QA 1WDTA 2OEJA 4ZN1A 4YOUA 4PKHA 1Q82O 1NMEB 3A3OB 1ASWA 3GMGA 3VV2B 5AXMA 3CO9A 4BR4A 3A8JA 1HKGA 4RW9A 4YY3F 1YJVA 2UU9J 3CD5A 4QYZK 3DLGA 2BQ3A 3C0BA 5LL6d 2MKSA 3IM9A 3QIPB 3HHKA 4JRQA 4ED3A 1GK8A 1MN7A 1CJTA 1FEHA 3RBEA 2B51A 3VESA 4ZP7A 4OYZA 2H9ZA 1VQ4S 2YNHA 3C65A 4B3MJ 1NMNA 2FBTA 1NPRA 3TSUA 3MM5A 3UD5A 4HT7A 1YVFA 4RZRA 1VQLN 2A10A 2YWEA 3BDPA 3AOCA 1IM6A 2VA3A 2W2PP 1UVKA 5SZTA 1U4BA 3HVWA 4KO0A 4FM1A 2BACA 5DS7A 5A8WA 1YK9A 3M6XA 2DEJA 2QN6B 4CGGA 4L74A 4AF1A 1YBTA 3J7ZO 2GHPA 2XMTA 4USJC 5BRDA 1QAYA 3CCES 2V8GA 1BXNA 4YDUC 4KQZA 4DL0C 4JKEA 1HWLA 5AQYA 5EDWA 4K4UA 4HWIA 2MZJA 2FF6A 5DQHA 4O3QA 1HPZB 3K5LA 3AA5X 2F7VA 1Z2ZA 4DSEA 2QEXN 3L09A 4J7CA 2YH0A 1U04A 5FLXO 3F0NA 2VU5A 4LREA 2XMAA 4E2FB 4FYDA 1X9MA 4HTLA 4CEDA 1N52B 1ATSA 3V6KA 3QYYA 5A2QU 3LAMA 1BD6A 4ED7A 3OLBA 4A2BA 1HQEB 2F8MA 2Q6BA 4LF5K 4NZ7A 4QIWD 3AVBA 3RU0A 4CP5A 5CHCB 2CQ1A 3TJ9A 3OR1B 4C3LA 2CDQA 2RILA 3CC7S 5HI7A 3D0GE 1FDAA 3DI6B 2DNZA 2R4FA 3LTOA 3IAYA 5LSLA 1SH0A 3NEKA 3MM6B 4UOGA 3GP9A 3ZZ0A 2QWQA 4DR1F 4DSFA 2X78A 2HGNA 4I6MA 2F4VF 1GMUA 4AHUA 2EWSA 4DXLA 2QWPA 1RP5A 1FRHA 3KKFA 4RNOA 3HPHA 4BVPA 3OVSA 2J9DA 5ADXA 4GC6A 4B3SJ 3MR5A 1KONA 2WTFA 3KLGA 4K59A 3OFFA 2AGQA 1C0TB 4QOZB 4F4YA 4RW8A 1KQSM 4BDYA 1WOQA 2IYIA 1V3ZA 4X84A 4FLTA 5I42B 4CJ3A 1NGCA 4I7FA 1BMQB 1TK8A 5CH7B 4TN2A 1NJWA 1URNA 2RB7A 1VI7A 3EZOA 4USIA 3PYEA 3CPEA 3L7PA 3PX4A 1HKBA 2F4VK 3H5SA 2OKQA 2A18A 2ABYA 3S6EA 3TRGA 4JKGB 4ED4A 1JLBA 2NRTA 1BUXA 4DR6F 3H90A 1WN7A 2XYHB 3H3NO 4DTPA 1VQPN 3JAMU 2E6LA 2V51B 2YWWA 3O6QA 3SUOA 3P8BB 3QDKA 1DAXA 1YF5L 1YJNN 2CZ9A 1RT2A 3PZPA 3I8DA 2MQLA 2HSEB 3DRSA 2JOQA 2X1GA 1SJ1A 3W66A 5H9EJ 4OPKA 5F3ZA 3I6PA 4QYRA 3J7AP 5E0OA 3V6HA 1KBRA 1VJWA 3TR8A 3D6MB 4LMZA 3G4SS 1WOPA 3PW2A 3O5BA 4QIVA 3NGRA 3GSIA 5AQSA 2ASYA 2HAFA 1U24A 3HX9A 3R9PA 3K59A 1ATRA 2HFUA 2G2YA 4GMKA 3TJ8A 3CC4N 1H38A 2CZ4A 1EB0A 3VF6A 2G0JA 4YB5A 2AGPA 1U1MA 3PX6A 1H2VZ 1SJQA 3JSMB 2OELA 1WBDA 3NVKA 4UTGA 1CSJA 3K7RA 3QEVA 4HDGA 1BE4A 1EKSA 1J54A 3CCLS 2HGLA 1C0UA 4FJKA 1NJIT 3BF1A 3KHLA 4K4ZA 1AW0A 2ILZA 4LF9J 4CF8A 3D5MA 1JWWA 5D4NA 4O0NA 3M5RA 2CNOB 2CPYA 1HBMB 4CQ1A 3C46A 3SQOP 2FC0A 3FRZA 2WC9A 2D5RA 3TX8A 4CHOA 3VGVA 2G8VA 3I4HX 2D0PA 5AQRA 5KFPA 1LV5A 4LF1A 4UY8O 3LDQA 3OFHA 3C19A 4E1MA 3A0IX 4KI4A 4P75A 2M8HA 3SI6A 3GTYX 4CF1A 4DCHA 2OA8A 4K7QA 2QK9A 1SS6A 4PG6A 4ZJOA 1HNVA 2HLTA 2BYCA 1KVIA 2QLJB 3WXMB 3KK2B 1KVKA 1FE4A 4JKBA 4W5QA 1YJ9N 4NOHA 2AGOA 1IKXA 3H42A 1RGVA 3OTDA 3M2UA 2D3UA 2F9TA 4QS7A 4TY8B 2QSWA 1KQSR 4AM6A 3PW7A 4FOIA 6FDRA 1VQKN 2L9NA 5F0XA 3D2FA 1O8BA 3GFHA 4DTMA 2GQQA 2MYFA 4X65K 4P7TA 3QJPA 3IGNA 4WJBA 1ZS6A 3T69A 4KV8B 3DMJA 4CRJA 2DFEA 5AQFA 4OZ1A 4CO3A 2YKNB 1CJUA 2XEXA 5D4OA 1YIJS 1UTAA 2P9NB 2M3DA 1XNRF 4JYAK 1M1HA 4CFDA 1TQLA 2OAUA 5F9NA 5HRNA 3G86A 3OXGA 3C6TB 1PIEA 1DTTA 2KFNA 3M2RB 1VIXA 2BE7D 2VG6A 1CVJA 2EK6A 1N8RT 5BN9A 5CAAA 4BR7A 1YTAA 2HS4A 5LSOA 3V1OA 3EMTA 4ENOA 4RJVA 4JI8J 2CNKB 1W0HA 2Q31A 3QFHA 1I3OB 1R31A 3CDEA 2FDNA 2GVDB 2OJ3A 2I7PA 2YHYA 3RAQA 1FJCA 4A8FA 1TV6A 4RCHA 5AT1B 2P1JA 2RVJA 4CVNE 1XC3A 2FJAB 3P96A 3CJ3A 5KFKA 2HK3A 4FLVA 1WD6A 2NRVA 4DHYA 3M30A 5DDOC 1TVRA 3HMJG 1YBUA 3I0RA 1YT3A 2GHWA 3PYDA 2YNIA 2E88A 1DHMA 3T6JA 4C0BA 2GMHA 1BQMB 4B3TK 3N4QA 1JNZB 3C6UA 4UQTA 2OI2A 2VC1A 3L7OA 1RTJA 3Q8QB 1PJ6A 1KNZA 3NKYA 2ZGZA 2GTDA 4CNZA 2IA6A 2W9BB 2D1CA 4DR4J 1TL4A 4DUZF 3PO5A 3QFUA 2PE8A 2D3O1 3X1LB 3SSRA 3UPFA 4N8OA 3AXMA 1VQ9S 1AUSL 2Y1RI 4NLPA 2MGZA 2NNWA 1D3WA 1ZBUA 3HULA 3HTVA 4M5DA 5LM7E 2J76E 5KT3A 1KLMB 1GOBA 1FKPA 1APSA 3OBYA 3BEGB 4NLDA 1GFWB 4DV6F 4I9QA 5IT9Y 4AM7A 5CY4A 3CCRN 3ZT0A 3EVWA 2O5DA 4BC4A 4ICLB 3DGPA 1IXKA 3TAQA 4JI3F 1DURA 3W7BA 3ZZUA 4HTUA 4I6YA 4WK1A 3O4NA 3HM8A 4U6PA 2KKHA 4PG5A 3UNGC 2IAJB 4QIFA 1E6VB 2CKWA 1IJFB 3GE1A 3GILA 1NGIA 5M2PA 1TK5A 5KFZA 4EP4A 2JC1A 5HMXA 3MOZA 2Q0UA 3GPAA 1S0NA 4NA1A 2ZJRL 4C11A 5E3QA 3S3NA 4WP9A 4W4MA 1G15A 4CF2A 3OYIA 5B0GA 5CYJA 4ILRA 4KGKA 3VQDA 4Y28C 5CHIA 1SQFA 4CK3A 1C1CB 4CD3A 2FTRA 4NMXA 4ZVEA 1R0CB 1KHVA 4IOAQ 4HCBA 3MMAA 4M1KA 4HLBA 3SFUA 3BKFA 3PR5B 3QLHB 1EJ7L 1ZETA 1O13A 2CJBA 3NE6A 2CIMA 4FZXC 3BSOA 1YXQA 2W4CA 3MR3A 1OH8A 4BACA 1VBZA 2ZNYA 3KLHB 4A8OA 4X62K 5J1EB 3ASMA 4EZ6A 1RWMB 3RMCA 3CQ8A 4Y2IA 4RUBA 4H5TA 4DL5A 4NLVA 2HOEA 1F2GA 1BWEA 3NGDA 2Z1JA 1S97A 2J6TA 4DR2F 3VQCA 4G1QB 2YNHB 1V5IB 2OD4A 1UETA 4CTAB 1XC9A 2X51A 2I1RA 3NNCA 5M1QA 5KQ8A 2YKOA 4XH5A 3QGPA 3HD2A 4CGFA 1QLNA 1W97L 2AZ1A 4CT9A 4WQ5C 4WF9Q 4OZ3A 1RAJA 5IZHA 4G1IA 1DZ5A 2NXCA 2HEKA 2RHQB 2VFUA 5SWMA 1FFWB 5M1OA 2A6MA 2MLYA 4N41A 2FGCA 4MIBA 2PIIA 2MKCA 2KHDA 3ELHA 2DTUA 1LWXA 5J2PA 3BQ0A 2AHOB 3A8IA 4X2BA 4LF4K 3RR8A 2QWOA 3TZXA 4WKYA 3EKUA 4IRCA 2HFNA 3P4IA 1N88A 2YPYA 4JI4J 3PACA 5T41A 3FSIA 3SFGA 3Q22A 2XWXA 2HHSA 1KVAA 4WXOA 4MKAA 4E98A 2AF6A 1Q5YA 4KB0A 3W9IA 1R8HA 1X8DA 4DQSA 4EO6A 2UVUA 5C2FA 3BJYA 4H0TB 2NXNA 5KG0A 3ET6A 2V2QA 4R79A 4H4MA 1NCLA 2E2OA 1CQNA 2WVCA 2ITMA 2EEYA 4O55A 4W98A 3W2VB 4FZVA 4CBUA 4NA2A 1D4XA 4JKGA 4KHQA 2E20A 4PAAA 3C14A 4CIOA 3DWLA 4KB7A 2GQCA 3TNVA 4OJHA 3HFKA 3HD1A 1JLFB 3VWSA 4Y00A 4HVJA 2A6OA 2JJ4D 4I9LA 4ES1A 4CHPA 3RTVA 1I1GA 4OKKA 2KO1A 3FR0A 3OTOF 1S1UA 3HLUA 3O9SA 2X1AA 4B9MA 1TL3B 3N5BA 4DV2F 3SBGA 3MAAB 3EXYA 3BN4A 5KFVA 1VHIA 2HW3A 1UVNA 1F3VA 3CDBA 1E4GT 3IUCA 2FLPA 3OYDA 4BBYA 3PY8A 1WJ9A 4UUXA 1HNXJ 1HA1A 3BPDA 4DR4K 3TW0A 1G4CA 2V7YA 2E1CA 1NZ8A 4RNMA 4KKOB 4BQLA 3KG1A 3FZHA 3QEPA 4PQUB 1N4LA 3KHHA 4DCJB 2J9CA 2O3DA 2M4MA 3PFEA 2PA8D 1YI2N 2WONB 3FZFA 4FM2A 1M5VC 5ETLA 3GG0A 1QVGR 4BRAA 2VF3A 5AQPA 1S76D 3CMAS 1JLFA 1FE0A 2CZVC 3VZHA 3WNHA 4FXDA 3CCQS 3P45B 3VAMA 4CLPA 1N34J 4JN4A 4JP8A 3UI3A 3NCIA 1QZ5A 2O8EA 1O51A 1QHTA 1QAJA 4O44B 1S1UB 4F04B 2UXBJ 1HBOA 2FJXA 1SC3B 1YVNA 3A5LC 3EE9A 1X0FA 3C7NB 5HL7Q 4BRHA 4H03B 1TKTA 1N0VC 2YY3A 5T7LA 3OS1A 4Y2MA 2I7NA 2C2NA 3S3OA 4R5PB 2FHMA 2VFSA 1W2BM 4FJJA 4TYAA 5DZ6A 4DR4F 3CWJA 2AQ4A 4BRGA 3H1QA 5K5MA 3I55S 5TKYA 3GLJA 4ICLA 4U95A 3HXMA 1YHQS 5KFNA 3MTKA 4LF8K 2MSSA 3ENHA 3NLCA 2XMVA 1VSIA 4A57A 3QZ7A 1S0VA 2XRIA 3A12A 3S1TA 1K0TA 3NGZA 3D2FB 4J2DA 1HNXK 4F8RA 3Q86A 4GKKF 4WCEL 4X4UA 2H48B 3DOMB 1R8AA 4AQYK 2YKNA 1RDAA 1X0PA 3IMQJ 3KZBA 5FLXY 4XK8C 3OLAA 3UR3C 4KBOA 2V2KA 1ZM3A 4CLFA 2QWNA 4RW7A 1SJFA 3C95A 4YOXA 3A13A 3PG9A 4TNOA 3OUYA 4KTQA 4JK8A 2IM0A 4JI8F 1HKCA 4CGHA 1U8WA 3WXJA 4LRCA 3M6GA 4ED5A 1KVCA 5JVGL 3MMBA 2PA3A 3IBCB 2DR7A 3RGIA 2FXUA 4X62J 1GOCA 4PEOA 5ETMA 1ASUA 3FNNA 2NPFA 3D2EA 1HBUA 5DGBA 3CD6N 1RLCL 5K14B 1N6QA 4H0XB 1UA0A 5BR8F 1U49A 3BO4A 3GWCA 4CH1A 4LF4J 2J8AA 4IFEA 3NH2A 3PRBA 4C3MA 2R8GA 4JV2A 3FBBA 3CCVN 2E7WA 5CQGA 4X64F 2GVDA 2C2OB 2Q1NA 1TGOA 1XNQF 2DRAA 5HVGA 5D77A 3WQPA 1VSLA 4M5JA 4LRBA 4ELTA 3EDRB 4HUEA 2LU1A 1WSIA 1FRLA 1S1VB 3IRWP 5I3UA 4PXCA 3PW4A 1SKRA 3EZUA 1FDBA 2ZGYA 4DV7K 2UXCJ 1WHYA 2Z56B 3CJ5A 3PIPQ 3ENBA 4RWXA 4G3IA 1NK5A 5A8WB 3MOJB 1VQOS 5GAHP 1F2HA 3HKWA 1R59O 1RBTA 1S6PB 4CZKA 4B1UB 3VEYA 4WXWA 4LIRA 4TLQA 2RN2A 4HUFA 4Y3CA 2RDIA 3CM5A 3J7ZT 4HDHA 4F2RA 4PYAA 1UFLA 2ASMA 2KRRA 2DISA 3HCXA 2VFTA 1QVGM 4DPXA 2MQMA 1OY8A 5T7LB 1WC4A 1WSGA 4NLCA 4RUHA 4EUVA 2BDPA 1F9FA 3ZLJA 3NWGA 3L4IA 4X4TA 1R43A 5EY4A 2ZD1A 5F0WA 3PXGa 1FVSA 1GMVA 2HWTA 1KKHA 4ZVQB 1IR1A 2EBEA 3W65A 3BH6B 1RCXB 1NNDA 5H9FK 1IBKK 4TVAB 2C3MA 2Y8WA 4JI0J 1FWPA 1WNEA 1Q81O 4MT1A 5U47A 3RR7A 1FFSB 3DXMA 1WG4A 2NXUA 4OHWA 2E5HA 3TQ1A 2FYXA 2O8CA 2CFXA 1N5QA 4WQ4C 5EGYA 5BPNA 3IWLA 1RISA 4WK3A 4EI2A 4J9QA 3R8EA 5HN0A 4HHUA 3AJDA 4OMFG 4PKGA 4BG9A 3ZTSA 2YV0X 1VQ9N 4CGDA 1CXUA 4DR7F 1T02A 1LWEA 4WP8A 2HHWA 3GONA 1SH2A 4K41A 4NWBA 4BDPA 5KRTA 2FLOA 3ILOA 3I56N 5A8KA 3GQCA 1BC6A 2R8HA 3VERA 1WSEA 4RNHA 4LR8A 4Q8EA 3TTCA 1VQ4N 1NK7A 4K42A 5B0BA 2IM3A 3HSGA 2YHXA 1MWMA 2C2MB 5DG7A 4JK9A 1TU0B 5IWAF 5EWGA 3WQUA 2DJWA 4X4OA 2HRYA 2XY7A 1LFPA 3D3CJ 3O80A 2HQFA 1Z26A 4RLEA 2Q66A 1MMDA 3P39A 3LZIA 1SCJB 1W25A 3TJAA 1LXNA 2Q1LA 2HHHF 4YS2A 2CYYA 5HVHA 3V81B 2ZHBA 3BBCA 4B02A 5IFMA 1I94K 2GHVC 3ZT3A 3SQ1A 4F0HA 3KLVA 3OV7A 5K8MA 1RAFB 2YWGA 2P9EA 1OQ3A 1IN0A 4CZFA 4FBUA 5HMWA 2XGPA 1NLVA 2V67A 1AT1B 3OR2B 1EHWA 2FZGB 2L41A 3IDHA 3GR1A 4DX6A 1LK5A 2RE1A 4JKFA 2CUYA 4MKBA 4ZN3A 1VS3A 5A76A 3SDEB 6AT1B 1VK0A 5KFGA 4WFZA 5HRRA 5G0RB 4JI0K 4QIEA 2MEWA 1DTQA 4B3SF 3D7SB 5GAEP 1I94J 3MEEA 2J7UA 4FJ8A 5JICA 1RHRB 2XMJA 5A0YB 4EGLA 1NGEA 1ITGA 3FEXB 4DI6A 1U47A 3QT8A 2UUBF 3LM9A 1RT2B 1VQKS 5E3CA 3Q83A 3KLEA 3AVAA 1HHTP 2C2RA 1LNQA 3J80U 4ECWA 3UKRB 1U26A 4LD0A 3ULDA 4ER8A 3AO4A 4J9UE 3J81Y 4BC7A 4LSLA 3ET6B 4Y0WA 2XYGB 4KHWA 1EQMA 3I0SB 2Z2ZA 1FWLA 4L6V3 2RKIB 1BCMA 2EFOA 4DPOA 1H3DA 4CT8A 4CFBA 3KD5E 2FBYA 1S6UA 3OPKA 4Z7YA 3CFOA 3W3DA 2DFFA 5E26A 4FWRA 1D9DA 2HNYB 3AD7C 3IRXB 1T3OA 4WFAQ 2DKOB 4IRDA 3KUHA 3UN2A 3O9UA 1Q9XA 3A3NB 1S4FA 2V68A 4B1XB 1VGYA 3MWTA 1WDDA 5E3PA 2ZBPA 4U7BA 1DRZA 4DL4A 2B6AA 1SZ2A 3BO3A 4HEA9 1EX8A 2FUG9 2HVEA 3RVCA 4OLPA 3Q24A 2AU0A 1JLAA 3SLCA 3J7YI 2ETJA 4JYAJ 2N82B 5KG4A 2ZH3A 4TKTA 2KHCA 4H5RA 4IOBA 5KAKA 4I6AA 4PY5A 2XO6A 4F4ZA 2KFYA 2RS8A 2ILYA 4CZEA 1QQOA 2IBOA 3AHPA 4YR3A 4JRPA 2MQ8A 3J7YU 3CCLN 2O8BB 2NS1B 3O3LA 1XQSC 2X7IA 1S7IA 3W5YA 2QT7A 4PG7A 2YI1A 1P9YA 2DFHA 4JOUA 3P31A 4NLUA 4WU3A 2GO8A 4OJ3A 2L3MA 3QPIA 3CC4S 5CE3A 3HOTA 3N79A 4Z4HA 3FZMA 5KG2A 2BEFA 3MAAA 2B8QA 1KOOA 3DXBA 5M1NA 4NLXA 4YDUA 3ZSOA 1T95A 5J2NB 1P1LA 3ULHA 4DTSA 2GZOA 2LQ5A 1J5EF 3BSNA 1U1PA 3GL1A 4B1VA 1KVJA 4UUWA 1RAHB 2YX4A 5KFLA 3GBTA 2FSNA 1ZPWX 5AQMA 2G8KA 3MM6A 3BZCA 3G9CA 2JNJA 3HVRA 5BPMA 2R7YA 3SUPA 4BRQA 4GNIA 2IM2A 2DO4A 1MN9A 4C0HA 4DR5K 3LDLA 3ZZZA 3K57A 4LVOP 4FF3A 4AL7A 3QWPA 2AP1A 2RSQA 2DPJA 2RQMA 1WAJA 1WACA 2K7JA 1WSJA 1NK0A 5EX5A 3AO3A 4O8KA 2BUNA 3NWRA 1ZPVA 3K2PA 4LBPA 3A3PB 3UFCX 4ZPWR 4HI1A 2CQIA 1HRHA 3OYNA 2CJ9A 3CDAA 2Q79A 2GX9A 2IRXA 4ECSA 4JI5J 2WSEC 4AE5A 2DH8A 3N5FA 4FJ7A 2COLA 5E5NA 3F2KA 3D0PA 2JDJA 3IBFB 5ETVA 3ZETA 1Q53A 3OJSA 3J7A1 3KK3B 4B3RJ 3NOCA 4LH4A 2I5JB 2KFZA 3PHTA 4E1NA 4U67Q 2MKKA 4DUYJ 5JMVA 4KHYA 3KMSA 4G65A 1EKEA 3GYNA 1NHUA 3FUYA 5A6PA 1NPPA 1P9QC 2WUSA 2ZOGA 3NF9A 1OJ4A 2UXCK 1GLLO 3G6YA 1OO0B 5ETRA 3B4MA 5HJXA 5GAHU 2W4DA 3KJNB 1S22A 5LMUJ 3UE2A 1TKXB 3ZTPA 3DHWC 1Q7LB 2WOMB 3ZYYX 2VG5A 2KT3A 4USWA 5IC4B 5AQGA 1LOUA 4WFYA 3VF4A 3A8KA 2C2ZB 2H5IB 3ZZTA 2G13A 4DR1J 2DK2A 4CJ4A 3G71N 4DR6K 1KEKA 1KTQA 2K3KA 4CO5A 5AQUA 2H54B 2D41A 2KXFA 2QFIA 4EWTA 2C3UA 5FPDA 3DXSX 2AJQA 2HZCA 4ILLA 3NDKA 3OYAA 2XGQA 2QA4G 2WFBA 1VSFA 3WX4A 3RG6A 2L9DA 3UNYA 4K0KJ 4USTA 2H3EB 2QA1A 4DWIA 4K0KF 4CZMA 5DG9A 1XMOK 2XMUA 1N33F 3JQJA 2X6SA 4DJBA 2BKOA 1RT4A 1RTIA 3CF5Q 2XG8A 5DM6L 4PCQA 2A40A 3M8YA 3TVKA 4R8UB 2YNFA 2AJ0A 3LGNA 4PG4A 1HNWK 4H4KA 4DG1A 5KFIA 3E2EA 3AFGA 2GEMA 2E9RX 3E51A 4IFYB 2I38A 5H1SQ 4ZMMA 3LPUA 1OYDA 1A9NB 4ZHRA 3D2WA 1PG5B 1RBSA 3LP1A 3Q8UA 2I9SA 4JKAA 2E7VA 1KOHA 5AE1A 5HQMA 4FJIA 4K4TA 4FZZA 4KHNA 2MJUA 2ZM6J 4HTJA 4KYZA 3OHBA 4B9SA 5DETA 4KHPK 3OVNA 2FJWA 4ZLLA 4CO1A 4F36A 1ZXOA 4JI3K 5KFWA 3CPWR 4IDKA 1KS2A 2ZDOA 3FCHA 1WKJA 2OZSA 1HPZA 1KLMA 4DR3J 3EKSA 4BWMA 3CJ8A 5D15A 2VG7B 4GKJJ 5EWEA 2C28A 1NGBA 3BYPA 4HTIA 4ITSA 1RABB 2V4JB 1FJGK 3Q8YA 4LF7F 4QZVB 4QU6A 3I33A 4DFKA 2OPRB 2YNGA 3UE5A 1RBVA 2QKBA 2B9WA 4QR1A 1YAGA 4R8UA 2RH3A 2M0GB 3LH2S 1E6VA 2W9AA 3HHLA 3AVGA 2YH1A 1NM2A 1MU2B 4FPAA 1V6HA 4BE0A 4X4VA 3EJMA 3MEGA 5I3UB 1MW7A 4P73A 3DI6A 3SYZA 2VD3A 3AODA 4C8LA 2GUIA 3VOVA 1PKUA 4CERA 5HSPA 1BIZA 1PCAA 1A0OB 3EL2A 4A2AA 1M5OC 2BZ2A 2R7VA 1S5ZA 4ILGB 3T7ZA 2CPDA 5AE2A 4WZMA 1Y64A 3I55N 2W7OA 4ZIVA 3H6EA 2MTLA 1HNIB 5HROB 4HHTA 4HCCA 4GW6A 4CIGA 1K44A 2IDEA 2MLZA 3KK1B 2D69A 1Z1ZA 3KHGA 2UXCF 4H5WA 4EEYA 2NRXA 4DR5F 4NLWA 4Q43A 4H8KA 2G4BA 2Z0GA 1EIYB 2F5GA 1NXIA 1RCOB 4JI7F 3M8PA 1CC7A 4I2QA 2V0NA 1GX5A 2VBWA 3KJQB 3MURP 2A1SA 1IR2A 3NGYA 2BRKA 1Y97A 1MMNA 3W0LA 3QIPA 1JCGA 1HL6A 4LRFA 5K8OA 2NZTA 2KJVA 1IBKF 1B9FA 5EWFA 1HYSA 4DPTA 1U2VB 1L5UA 1RA6A 1IBMJ 4UQGA 5JXSA 3MN5A 1U45A 4OYMA 3KG0A 3VGSA 3A2FA 2CJXB 5DRKA 1Q86O 3CD6S 2CGLA 3D54A 2DRDA 3Q2TC 3JXUA 2LEPA 5AXKA 1T03B 1OKJA 1OY9A 3D28A 1M5PC 4LT6A 2BH1A 4PYDA 1CJVA 1LWEB 3TANA 3TSPA 1VSMA 3C6HA 4FYYB 5IQQA 4PABA 3VF2A 4ANDA 4JI6F 3UDLA 1WF0A 2YHWA 4CJFA 3R6MA 2QSFA 3K8WA 1Q86T 1M90O 3CXCM 2J9EA 5E33A 5KFMA 3QB0A 4BWJA 3TVZA 5KFQA 3QFPA 2MY7A 4RW4A 1FRMA 3MPDA 2OIHA 3GJRB 1GLEG 2RF2A 1VC5A 3NF6A 1D8ZA 3O1BA 2K1RB 1ZAVA 3SPYA 4B3OB 4N47A 2POKA 1H6KX 3KLEB 3A5NC 2VOOA 3T1AA 4DR3F 4PXDA 1OMSA 5FPNA 2HHVA 1SKSA 2KZMA 4KGMA 1FT8A 3MECB 1WEZA 2HG4A 3MPYA 4NYOA 4EU0A 1C1AA 1GLJO 3H59A 2APOA 1OQ6A 3D66A 3NH1A 2SXLA 4DTNA 4RWTA 2EC0A 4PQUA 4C3KA 1KVBA 3SK3A 4U7UK 5CCLA 1FXRA 1IBKJ 1Q7YT 1JLGA 1AZSB 3BKUA 1ZBHA 4O0JA 4KHPJ 4JI6K 3CCTA 2DHSA 1SV5A 1RT6A 1QUVA 2WSCC 2HZAA 3CHWA 2HBZB 4KKOA 3M8RA 5HP1B 2YWHA 3D0HE 3QJLA 1DQ9A 2O8EB 3H4DA 3OL6A 2KW4A 1RA7A 5KFYA 1KRPA 4H4KC 3GR0A 3F73A 2MQNA 1SL0A 1HHQA 3SCKE 2GAHC 2MZRA 4DCOB 3HI9A 3W60A 4OKJA 3PUFA 2M70A 4WP3A 1LAWA 3C2PA 3G0ZA 4P10A 3IR5B 5GVQA 1VBYA 5HAOA 3FBCA 3HYFA 5FPMA 5HLFB 4LVNP 2QA2A 4OZLA 5C24B 2X1BA 2A41A 5L9XA 4FJ5A 3CJTA 3T41A 5DLGA 1S6QB 4GVLA 1IKWB 2JEFA 1WC1A 2GUPA 2DNYA 4DEZA 2NZ4A 4USVA 1X9WA 2FVCA 3W1YC 4QWEA 4Z37A 2O4IA 4FWSA 4Q45A 1DLOA 1MLAA 3TAPA 5DGAA 2C22A 2HHUA 1RHKB 2ALYB 2DRBA 4WTYA 2YWFA 4DSLA 2BJ3A 1SJ3P 4EFAC 1XTZA 3M1FA 3L2RA 4PXEA 3MFIA 1H2TZ 3CCEN 3O1WA 4NLSA 2FHOB 5LT5A 5F8LA 4Q2MA 4M3ZA 1FI4A 2A1BA 2I8EA 3WBZA 1KC8O 1XQIA 4XH1A 2ZWHA 3ZSVA 3RSEA 1D09B 1F6TA 2P9IB 4LFCJ 1Y3KA 3TUIC 2ASJA 2OTJS 3H3OB 3LGMA 1VQ7S 2R3VA 2KLAA 3AVLA 1X1PA 4EO8A 2YKPA 4CJUA 3Q7CA 4EAHD 1TL7A 2HPUA 1ZAWA 3BBFA 4E7HA 3W62A 4DX7A 1SL2A 3CE8A 3HHNB 1JL2A 2EXUA 2KJWA 3AD8C 1LW2B 2XM3A 2AEFA 3LW5C 2HFVA 3AARA 1MWYA 3G8QA 2HF4A 2BJ9A 4I56A 2XYPB 1K47A 4BGBA 2OGUA 2E5LJ 3K5PA 1P8GA 5AXLA 5J2MA 2DY4A 2Z57B 5GIPA 2P9SB 2NYHA 2G0IA 4P52A 3PKMA 3R27A 4Z0UA 4B3SK 4FWKA 3WEEA 4CEOA 1N5YB 5L38A 2G9OA 1TKXA 1BI4A 3VQ7A 4CLTA 3UD4P 1SUQA 2KYZA 2P5VA 4DTXA 5C15A 4CLWA 2RRNA 1TKZB 3L2UA 3VQ9A 2AWZA 2AW0A 2D3ZA 3W8GA 4CF9A 3V4IA 4NYPA 3DLKA 4OZJA 4X4QA 3P5JA 2CPIA 4B9TA 3VR1A 2VJUA 1CZAN 3TOQA 2EFVA 1C1BA 1CS4A 4DUTA 1Y5IB 2Q2RA 3TQEA 3MPUB 2IMOA 2DGXA 3CCJS 4CLKA 3KHYA 3WQTA 3E9LA 3D6FB 4KSEB 1EO1A 1HNVB 2HVIA 1WNSA 3ZETB 4PUOA 3B6OA 1XR7A 5DDPC 4AH9A 1E6YB 1HPMA 3KYLA 2E4LA 3QSYB 3LP2B 1BIUA 4M5IA 1JJCB 2I5JA 3G8TA 3VAIA 4LF2A 2EX3A 1WEYA 4CM0A 3DCAA 2GBZA 1GXTA 2GNKA 3DM2A 3ULEA 1NKCA 3UIQA 5CZVA 1HX1A 3SXLA 2P9UA 2OO4A 3EE3A 4CWBA 1WI8A 1Q81T 1R7IA 2A6AA 4B1WB 4DV6K 5AQNA 4CZJA 3G4SN 3LDPA 5HRSA 5IT0A 1L3TA 4I1TA 1NGDA 1EETA 2YHBA 1FJGJ 1SI9A 3T1HF 4GVBB 3AA4A 5KFSA 4NE9C 2CWXA 4DV7J 1NWKA 1TKDA 3JSYA 4DQQA 1RYRA 1XEZA 4GV3A 2OEKA 2ZJQL 2E2PA 3W5XA 2IFXA 3JTNA 1CJUB 4OYXA 2D4WA 2IBKA 1O5JA 3QRQA 4WFBQ 5E84A 3ISZA 4CH0S 4DV1J 4PWUA 2OANA 1YDLA 3CCMS 1B99A 2BM1A 4KC5A 1WHVA 3SSQA 3I96A 3M2VA 4WE1A 3SMSA 4ZS6A 3BSCA 2OUGA 3KLHA 4WYLA 2ZD1B 1TTHB 1WOSA 2PEBA 4X64K 2V8PA 2GS8A 3R97A 5BN8A 2GVZB 5KG1A 3JAMY 2MKYA 1NJZA 1Y5NB 4DDFA 2UVVA 3ONQA 4ANCA 5KPTA 3TVYA 4WYBA 1X4FA 1HMVB 4X64J 2GGPA 2W2QP 3DLJA 3CQYA 2RRAA 1HYZA 4QU7A 2P6TA 4MMOA 4IFVA 3DLLQ 2AA4A 4Y0FA 1SC1B 4ELVA 3BGRA 3M32A 3IR6B 4CI6A 4J9KA 3UVJB 1KR4A 2FSJA 4CE9A 3GIJA 1GTEA 3T6BA 3M8WA 1ROFA 1HNZJ 4U9RA 3L8BA 4YNQA 1WUAA 4DR2J 3CCJN 1VRUB 5BRFA 1U7LA 3MCNA 5AXNA 2BUPA 4JYAF 2RU9A 4NYFA 1ZC6A 4OJGA 5KT4A 1VRQC 3BUZB 3HOSA 5BJRA 1P8ZA 1N32K 3VTHA 2W9BA 1V5VA 3PRDA 3BP8A 3KFWX 1LXJA 1MDUB 1R3NA 2G0CA 4ETXA 4NEZA 1YLXA 1FWKA 3N6NA 4LFAF 3NVMA 1CQMA 5J2QA 3HVAA 1EAYC 2BV3A 4DQRA 4FVCA 4CGJA 4OZ5A 5HMYA 5AQZA 3DM2B 3KDOA 1VR6A 1VQNN 1QVFR 2JFDA 4OHVA 2CQ2A 1Q18A 4OX9K 2IYGA 2V63A 3HJVA 4ZVOB 2AP6A 1Q5VA 1QQCA 4FJGA 3WXKA 3C6UB 5IT9O 3TAMB 3VAFA 2LVWA 1N36F 3BF3A 3C16A 2O01C 3KHRA 1ITPA 3BV8A 5ETSA 4BREA 3KWMA 1S0OA 4FP9A 2DNRA 3QNNA 5EVZA 1B0PA 4KY3A 4UY8T 1RT3A 2ROGA 4P6QA 3BS9A 1R6VA 3BZQA 2F4FA 3FVYA 3LANA 3ZT2A 2IM1A 2ASLA 3P5TL 2RD5C 3DRPA 2DGVA 1N5TA 4C6AA 4I69A 4P7VA 2AT1B 5BR8J 1TUUA 3IMXA 1IKYA 1YJNS 2GMJA 2LFVA 2EFPA 2NSBA 4JBCA 1UVLA 1RTIB 1JLCA 3MR2A 1B3TA 5KGXA 1NG9A 1NDPA 4NXNK 2LA4A 2NCKL 3CIZA 5GMDA 3VAGA 5KFCA 1W7AA 3R5JB 4Z4GA 3HM9A 4DV2K 3FCVA 2OD6A 1SL1A 1D8YA 1T9UA 1KDNA 3PW5A 3QATA 3DMJB 1ZA2B 4DSJA 4DU8A 4QWAA 2HNYA 1NO8A 3NS5A 4TU7A 3VEVA 4J2BA 2ZWPA 5B0EA 2CJYB 4G1QA 1NB7A 4DL6A 4FYWB 3KIOA 3FZBA 1IBLK 3MWPA 1RDDA 2D0AA 1N33J 2XHCA 2GV9A 3NOGA 1NBEB 1J5OB 2ATLA 3PEJA 2NRRA 3W61A 5AQVA 2XMWA 1UJ4A 5AQKA 2JGUA 4ES3A 3U1LA 3NF7A 2KZZA 3NAIA 4D3HA 5HQ8A 3QO9A 4YOEA 2DNPA 2IJRA 5LJ3Y 2W8KA 4YB7A 3VAJA 2MHNA 3D6TB 3AVJA 4ZVSB 2O66A 3CFRA 4ZJQA 3QAUA 4QWDA 1JJ4A 4FLZA 3DOKB 1TL1B 4IOCL 3M3ZA 1YJWS 2C42A 2RPIA 2DTJA 4PQAA 2C3PA 2N3OA 5AZJA 5K14A 1RT7A 1V9OA 2KT2A 4BR9A 2YX7A 3QGHA 3IS9A 3WNFA 3AO5A 1TUGB 2OTLS 1KAZA 4LBIA 2DYAA 2W40A 4DCPB 4CEAA 2OPPA 1Q4RA 2JH3A 2G8FA 1RB0A 1FVQA 4OJRA 4GO7X 5BPLA 4FWOA 2WVFA 2UUAJ 3C16B 2X74A 2BBEA 3JQMA 1U2CA 1K8AT 4BC3A 4DQIA 4A59A 5C25A 2AD9A 5B0CA 2VGMA 2D1KA 3L4QA 4MFBB 3L2QA 1HWUA 4LSZB 2WW4A 4Z94A 5C7PA 3IAM9 2VFRA 1XMQJ 2KN4A 3LDOA 1XUPO 1SIWB 5JMNA 1RDBA 4JNEA 1CJKA 3E01B 3W64A 1I3AA 4GVMA 2ZH7A 2ALZA 2NQPA 4F67A 2VODA 1F5BA 1GAOA 1REVB 2HAIA 2R7OA 3G25A 1RLDA 4BDZA 2V8DA 4QR0A 2HBLA 5IC6B 4JKHA 1OH5A 2EWHA 3DRRA 2GJIA 1BHNA 3HT3A 2DH7A 2P9LB 4K4XA 3R2DJ 1TYQA 3OL8A 2W42A 2FVPA 5KFUA 4DQ8A 4DV6J 1X4GA 4DS4A 4WQ5A 3MEKA 3C66A 3T19A 2C2KB 3V4IB 3PJWA 1Z6RA 1PBAA 3LPEA 3F56A 3K0SA 2VBYA 3MUTP 1RAEB 2QKKA 1RDRA 2DGUA 2IDOA 1F21A 4JKCA 1ZBIA 4D3GA 2UUAK 3GCXP 3FCWA 3G6XA 3DLHA 2BMBA 3FZ2A 4FK4A 2OSQA 1FRXA 2IA0A 5HATA 3CC7N 1HNWF 2ZH6A 4B8AB 3CMQA 3THWB 4LF8J 2ZH9A 2ZBQA 1VMBA 2DHHA 2YJEA 3O5TB 4LY7A 5KFBA 1PSDA 3T1HJ 1FJGF 3NP5A 1RWNB 1S1TA 3DOKA 5MLCV 1L3VA 2F8EX 4K8XA 3IC1A 3UKRA 3CC2S 3CJ4A 5FD1A 3H5YA 1ZTWA 4RUCA 3ATUA 4IOXA 4NLOA 4OV1A 3KG4A 4QOTA 3IXQA 2GFFA 4BGAA 4A8YA 2IS3A 3F9MA 2UXBK 1VQYA 4PL7A 5JLFA 3CC2N 1BOTO 4NLQA 4YHHJ 3SSSA 4F4AA 1D0EA 3BR8A 4FPRA 5CZ1A 3ZFVA 4M5HA 1K8KB 3AQPA 4IEIA 3KDNA 3THPA 3RAMA 5T14A 3BR9A 4A47A 2GC8A 3ETMA 3IG1B 1Q8IA 4B17A 1F5CA 3UKUA 3LDNA 3T1YF 3T5JA 5C25B