1RT1A

Crystal structure of hiv-1 reverse transcriptase complexed with mkc-442
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
539
structure length
538
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Complexes of HIV-1 reverse transcriptase with inhibitors of the HEPT series reveal conformational changes relevant to the design of potent non-nucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 147
structure length 538
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt1A05
4IBNA 5F8HA 2Z1HA 3RRGA 3H08A 1CZBA 4FK2A 1HNVB 4YQWA 4M3WA 4H4OB 4Z4FA 4JV0A 2ILYA 4NLDA 2GIQA 3HKWA 3IRXB 2HHVA 3LP0A 1HNIA 4Y2CA 2W9BB 2FVPA 1CLQA 4JS5A 3KD5E 3WNGA 3TAEA 2QV6A 3DLKB 3RAXA 1S10A 3U3YA 2YKNB 3IN5A 2OZMA 2OPRB 4DSLA 4OL8A 4TXSA 4O4GB 3AO3A 3CJ5A 4URQU 4ED8A 1S0NA 4XPCA 4XO0A 4ID1A 5DQGA 3AA4A 2O4GA 5HBMB 4W5QA 2VG5B 1S1TA 4B9MA 2B4JA 3S9HA 4KO0A 1SH0A 3SQ4A 3MEGA 2R2UA 1GOAA 4CEEA 4B9UA 2RDIA 4U7CA 3HSTB 4FM0A 1WSJA 4QPXA 4KI6A 3HVAA 4ZP8A 3H5XA 3NGZA 4MIBA 3B6PA 4CJ4A 4TN2A 3LWLA 3G6XA 3EYZA 5J2QA 1S49A 3M9NB 1RTJB 5EDWA 1N48A 4YNQA 3LANA 5DG7A 1WAJA 5KFXA 4ELVA 1YTAA 4XIUA 1QE1B 3Q8QB 2Z1GA 3IGVA 3L2UA 3H4DA 1ITGA 3K57A 5KFTA 3S3NA 3UQSA 1XHZA 4DL4A 5KFVA 1LWFB 3OYDA 4LSLB 1JLGA 4B8CA 1VRUB 1KVAA 2D0CA 4K4WA 5T7BA 1J53A 3QEPA 1EXQA 3SUQA 4QWAA 4BWJA 3SV3A 1LW2A 5HRSA 1TKTA 1RBUA 3ISND 2WHOA 4EBCA 4AHCA 4GW6A 1RDRA 2ALZA 1U49A 3OS2A 2OPQB 2HHSA 3NF6A 3U6FA 3ZT4A 1QAIA 2C22A 2IDOA 2XGQA 2BANA 2WCXA 3TAPA 3KLGA 1KLMA 4W5TA 2YNGB 1J54A 2NUBA 5SWMA 4OKEA 3I0SA 3H2LA 4Q0BA 5KFAA 4CJPA 2HNZA 3AA2A 2BQ3A 3OHAA 2E9RX 1IKXB 3PJXA 3HL8A 3PR4A 3MFIA 3SI6A 3DRPB 4K4VA 3BGRA 3NH0A 3QEWA 3DLEB 3V4IB 4B9NA 4J9OA 3NF7A 1Y97A 1JLAA 4IFYA 4FZXC 2VA3A 4CJLA 4O0IA 2R2RA 1XR7A 4EYIB 2D3ZA 1ZETA 5J2PA 4OGEA 1HQEB 2OPPB 3BQ2A 4LH5A 2HB5A 3KK3B 3SQ1A 1TK5A 2OPSA 1S4FA 1C0UA 2Y1IA 3EPIA 2JEJA 4B9VA 2E6LA 1HYSB 3CG7A 4CK3A 2AGPA 1RBRA 1SV5B 3N6MA 3GIMA 4ED6A 1JLFA 5DK5A 3VQ7A 1QSYA 4HHTA 4NYZA 3QLHB 1C1BA 4AHSA 4NLVA 4F2SA 3BDPA 4PQUB 2D0BA 3PZPA 4FLUA 5F8NA 4IG0B 1RT3B 2X74A 5KFJA 2HMIB 3NDKA 3V6HA 3DMJA 2XCAA 2WONA 3ZSVA 4F4ZA 4EYHB 3EZ5A 3HPOA 5C42A 3ITHB 4NLGA 5J1EA 3NGYA 4TY8A 1EX4A 4HCBA 3GIIA 1DTQB 3ZSRA 4BE2A 2DPIA 3VQ8A 3K5LA 3Q8RB 5KT7A 1GOBA 2JEFA 4DS5A 2GIRA 3HVTA 2HNYB 3PW0A 3HK2A 4KB0A 4RW4A 3DRRB 3JYTA 1DLOA 4FK0A 2BGGA 4WXOA 5HRNA 3AO1A 3RB4A 3DOKA 1ZYQA 5CYMA 2R8IA 1W0HA 4Z4EA 2ZE2A 3I0RB 5HROB 3TI0A 1NK4A 2HHWA 1RA6A 4IRDA 3LP1A 5K14B 1TL3B 2W9CB 3M8RA 1XC9A 3TANA 1C1CA 3OL8A 2YNFA 4F4XA 1LWCB 4M3YA 2C2EA 4NCGA 1ASWA 1TVRB 3KLEB 2IM3A 1EKEA 3BSCA 4QAGA 2AWZA 4TY9A 3HJFA 3VQAA 4M3UA 3OYNA 3I8DA 4O44A 4KFBB 5EWFA 2AQ4A 5KFUA 3TARA 4FJHA 1RT4A 1WN7A 3VQBA 1ZTTA 3NBPB 3M8SA 1YVFA 4E3SA 4J2AA 3C6TB 4DLGA 2FVQA 3SZ2A 2KZZA 1IKYB 2FJVA 1JIHA 4DTMA 3OSPA 3MEDA 3KK1A 3H5UA 2B43A 4BE1A 4DTOA 4DFKA 1ZBHA 4RNMA 4KHNA 3I5BA 2YNIB 1TGOA 3JSMB 3UPFA 2JEGA 1X1PA 4EZ9A 4DFMA 3GV5B 4KHYA 3QGHA 4FS2A 3DLHA 4KB7A 3C6UA 4RW9B 1UWBA 5F8JA 2KQ2A 5DMRA 4CGDA 3K5MA 3DI6B 3ASMA 3PW4A 3KLFA 4Y3CA 1LAVA 3OYKA 3SPZA 4CJRA 1LWEA 2BE2A 3QETA 1BIZA 3E01B 5HLFB 2YV0X 1NOZA 3BQ0A 4K8XA 5KT4A 3AVCA 4F3TA 4CIEA 2D41A 1CXUA 4M42A 1U09A 2WOMB 5D3GB 3K59A 2R2SA 3OLAA 1RTDB 3D45A 4RW8A 4E1MA 4DTJA 2DPJA 4U6PA 4DFJA 4IDKB 4CESA 1BQMA 1NJXA 1S1VB 3RRHA 3ZT1A 1S1XB 1T03B 4OPJA 4C8KA 1NJWA 4ED2A 3THVA 3PV8A 1SKRA 1RTIB 2JC0A 2XI2A 3QO9A 3NH2A 3L3VA 2KTQA 4C8NA 1N5YA 1NK9A 3NGDA 2E9ZA 1S9EA 1ZBIA 4ZHRB 3QEIA 4ZP7A 4QWDA 4KV8B 3L2QA 1IKWA 2GC8A 3QZ7A 2R8KA 2B6AA 2Z1JA 1VK0A 4O55A 4N47A 4ZPCA 1WSGA 5F9LA 3P83D 1KHWA 5L1KA 4J2BA 2P5GA 3H4BA 3L2WA 1KCFA 3DOLB 5KT5A 3LPUA 1SH2A 2IJNA 5KFLA 1VSKA 1B9DA 1KFDA 3DM2B 5DGBA 3CFPA 1FKPA 4EZ6A 2YNHA 4NCAA 5J2MA 4CFAA 2BQUA 4K4XA 1FK9B 3OYAA 4FJNA 1S1WA 4ECUA 3ZSYA 3A2FA 2VWJA 4Q44A 4WYWA 3MAQA 3TVKA 3QYYA 4CEBA 4NRTA 5KT6A 5L1JA 3AVHA 3MECA 5L9XA 1YT3A 4DF8A 3DRSA 1NK8A 4CERA 4DQQA 4CJFA 4TSXA 5FRMA 4NZ0A 2FBXA 1JXBA 2G8IA 1CZ9A 2AX0A 1IO2A 1JLQB 4H4MB 4DQRA 2XY5A 4F4YA 3RBDA 3TAMB 3GYNA 1TV6B 1L3TA 5HRPA 4B3OB 3T5HA 2V9WA 1RT1A 1XR5A 4O3PA 1T94A 2IAJB 4QWCA 1WAFA 2FLLA 1WNEA 4DG1A 2D0AA 3DLGB 3KLIA 4IRCA 1I6JA 1NJZA 4ICLB 4WE1B 4JV1A 4QCLA 1RTHB 2OH2A 3NAIA 4N41A 3CJ2A 4Z4CA 4C8OA 4EBEA 2B5JB 3NHGA 2I5JA 1VSMA 1HNVA 3I5CA 2ZD1A 3IS9A 3V9UA 3MFHA 1BQNA 2EHGA 4N76A 4CJEA 4PUOA 3V6DA 3CJ4A 4RW7B 4Y2AA 5CYQA 3KLHB 2W8KA 4CIGA 2G8HA 2W9BA 2VG7B 4BDPA 4QWBA 3CDEA 3G6YA 3DLKA 1JXEA 3AVNA 4WFZA 1WSIA 3VQQA 4RNOA 4I9LA 4M94A 3CQ8A 2G8WA 1BIUA 2OPRA 3QIPB 5KFMA 1U47A 3OYIA 4O4GA 3Q8SB 3NF8A 3OYBA 4NLUA 4J2DA 2FLPA 4DQIA 1S1UA 5HBMA 2BRKA 2VG5A 3DDKA 3ISNC 5KFCA 4ECYA 5KG4A 4HTUA 1SL0A 1KHVA 1KFSA 5KFSA 2QE5A 3G10A 5KFOA 4M3TA 2P51A 5KFDA 1YVUA 4RNFA 2ATQA 2BDPA 3CJ3A 1SKWA 1RTJA 4MFBB 1RDDA 2DTUA 3QIDA 2W9AA 3OL9A 5KFPA 3SFGA 3RTVA 3CFRA 4TYAA 3QNNA 4GC6A 1VSLA 2WTFA 3GILA 4I2QB 2VG6B 4JRQA 3PR5B 4DQPA 4DWIA 4ECXA 4Y1CA 1IH7A 1LWFA 3AVMA 4EP4A 4RNHA 3UR0A 4LSLA 4IFVB 4WXWA 3V9XA 3AVIA 4MH8A 4E7LA 4K8ZA 1QSSA 3MR5A 1D0EA 1OS5A 5EWEA 3KJVA 4E7HA 4KO0B 3MEGB 2OYQA 2XRIA 3V1QA 1J5OA 3O3GA 4LH4A 5F8MA 4QW9A 4BWMA 4EBDA 1S0MA 1D8YA 1N4LA 3CDUA 1KTQA 2RF2A 2V4RA 3AVAA 4Z4HA 3HHKA 4CJKA 4MK7A 4E19A 4URSA 3HPGA 3D0PA 5J2QB 3KKSA 4R8UA 1U4BA 1ZBFA 3NF9A 4KHWA 4K4YA 2V4QA 4J9NA 3G0ZA 3D28A 3MXJA 4DTUA 5J2NB 3S3MA 4FW2A 2C2RA 4DU3A 2YNGA 3N6LA 1TL1A 1A5XA 1JLCA 3EZUA 4Q8FA 4NLOA 4DTPA 5L1LA 4ZPDA 5F8IA 1IKXA 4CHOA 2A1RA 4RU9A 1TKZA 3GV7B 3OSNA 4QOZB 3FSIA 5KG5A 1TKTB 4IG3B 3QGIA 3OYFA 1A5VA 1VSHA 4EEYA 2W7OA 3NAHA 5DG9A 3RB0A 1NOYA 1BCOA 1RT5B 4CIFA 5HP1A 5DQIA 4CHZA 5FROA 4LSNB 3KK3A 4CJQA 2FJXA 2BANB 4DQSA 4HVJA 4FLVA 4MQ3A 2AU0A 1ASUA 3AA3A 4MK9A 3GQCA 3I0SB 3FQKA 4DTRA 4Q0BB 3RB3A 2AGQA 1WSEA 3TWHA 1C0MA 5KG6A 3MEEA 3RR7A 2G8UA 1C0TA 1EETA 2D5RA 3OVNA 1C1AA 4RUCA 4K4ZA 4KI4A 3BGRB 2ILZA 4FJGA 2YHBA 3SQ2A 4K4SA 2OZSA 3UIQA 2KW4A 1JLAB 1K6YA 3NAEA 3KMQA 2HW3A 4C8LA 1ZTWA 3PX4A 4NLXA 2DFEA 3NFAA 4FZYA 2HMIA 3QIOA 2ITGA 3DYAB 3ZSQA 5KFNA 2DFHA 3P1GA 1L3UA 4FXDA 1QS4A 5T14A 1IKVA 2OPSB 3TAQA 5DGAA 1C0UB 2VA2A 2UVVA 4KTQA 1DTQA 3K2PA 1RBTA 2RDJA 4ZVGA 5KTQA 2FVCA 2RKIA 3OYCA 3FFIB 1TKDA 4Z4GA 3M8PA 3AO5A 5KFFA 2HNYA 1JXLA 4KKOA 1JLFB 2HWHA 4O3RA 1NHUA 1S6PA 2AJQA 4MKAA 1W9HA 1C1BB 4J9SA 1UAXA 4WZMA 1I3AA 2F96A 1HPZA 4WFYA 4ID5A 1VSDA 1FKOA 1REVA 3DMJB 3V81B 3I0RA 4RW6A 2WONB 1SH3A 1Z4UA 2W42A 4FVMA 4O4RA 1TL3A 2W9CA 3TR8A 4DL3A 4LD0A 4DEZA 5C42B 2XC9A 1XR6A 3TABA 5J1EB 4Q45A 4TY8B 4CFCA 3NMAA 4WZQA 2GV9A 2PYLA 4CJ3A 3V1RA 1RDAA 1C6VA 2ASJA 3AVLA 4W5RA 2E6MA 3HVTB 3CFOA 3CDWA 4RW4B 1Z25A 3K5NA 3JYTB 1R0AA 1T05A 1DLOB 3KLVA 1K1QA 1L5UA 3NBPA 3ZSXA 1U04A 3AVKA 5CYMB 5I42A 4HYKA 2ZE2B 3HP6A 1KVBA 4RZRA 2F8SA 4K4TA 3LP3A 3PHEA 5FDLB 5C24A 3M8QB 4NCGB 3JSMA 3O4QA 3BJYA 2XWYA 5F9NA 3OYJA 4DMNA 4LY7A 2HNDA 4O44B 3TQ1A 4I9QA 1Z26A 1X9MA 4FJIA 4KHUA 1W25A 1RT4B 4NCBA 4KREA 4MKBA 4IKAA 3SQ0A 3LZIA 2J6TA 1MU2A 4HKQA 4M3RA 4M41A 3PX0A 4IH7A 4IH5A 4FJJA 2WK4A 4O0JA 3MEDB 4G3IA 4HCCA 3KK1B 4QWEA 4FBTA 2WRMA 3MR3A 4N56A 4C8MA 2F8EX 2XGPA 3BSAA 4KSEB 1RT7B 3GIJA 1NK6A 3PO4A 3UDLA 1JLBA 4YR2A 4FJ8A 3GV8B 2KZMA 3TAGA 3KOAA 3C94A 1RTDA 3BR9A 4PA1A 4F8RA 3BSNA 2X6NA 3QEXA 4KHQA 1NNDA 4Z4IA 3IG1A 4ECZA 1UWBB 4CGFA 1KRPA 3VQ9A 4R5PA 1T03A 4FLYA 3KD1E 4N5SA 4OGCA 3WNHA 4E7IA 4GVMA 2FBTA 3QINA 1HQUA 1EP4A 4DSEA 3PW5A 4DSIA 3KLFB 1JL1A 4HUEA 4I2PB 3SFUA 4B8AB 4ZP6A 3MR2A 1VRTB 5DLFA 1LWEB 3C95A 3NKYA 4ECVA 4IKFA 3NGIA 1VSIA 5I3UB 2IMWP 1SL1A 1DTTB 4J9MA 4QW8A 3LDSA 3PY8A 4I7FA 4R0EA 3L2VA 3OJSA 4M3XA 4IH6A 4LQ3A 4FJMA 4ZPBA 2C2DA 2RPIA 3OJUA 1BISA 1RYRA 3CYMA 1RT2A 4KTZA 1XHXA 5C25A 2QKBA 1JLEA 1F21A 1SUQA 1S6QB 3SNNA 1S97A 4NLQA 1ZBUA 2X6SA 4NLYA 2UVUA 4CFBA 4DU4A 3G6VA 3T19A 4J9QA 3NCIA 4M3ZA 4F50A 3RR8A 2IM2A 3HXMA 1FK9A 3PUFA 3HT3A 1RT6B 3KK2B 5KFGA 4CHYA 2A1SA 2HAIA 1TKXB 5KFQA 1LW0B 1XI1A 3DLRA 4NLPA 1BI4A 1QTMA 4PWDA 3CM5A 3VQDA 3LP2B 2Y1JA 3N6NA 4X2BA 4Y34A 3LPTA 2HWIA 2ETJA 2XHBA 4FLTA 4GC7A 4ZTFA 1N6QA 1BHLA 3PVXA 2FJWA 2IC3B 4B3OA 2FVSA 1JKHA 4ECQA 3LAMA 3RAQA 2Q3SA 4ZMMA 4ED1A 4DFPA 5KT2A 1X9SA 3G86A 1FKPB 2YNHB 1JX4A 4G1QA 5J2MB 4E0DA 3T3FA 3H59A 1HMVA 1S9GA 4KHSA 1RAJA 4CGGA 1KSPA 5EWGA 5KG0A 3BSOA 4IR1A 4OKJA 2KFZA 2W7PA 1L3VA 4CJSA 4ECWA 2E9TA 2FC0A 3HM9A 2ASLA 3DRSB 5KFBA 1NKEA 2XY8A 5KFRA 4PY5A 1GX5A 1IM4A 4L8RB 3L3UA 4JS4A 4KAZA 3KLHA 4CF1A 4H4OA 4ZP9A 4F4WA 3EY1A 3S3OA 1RT1B 4FS1A 3IRXA 1T3NA 4DSJA 3KLIB 3QIPA 2QK9A 4CEZA 4J9LA 3QGGA 2EX3A 2YKNA 4CEDA 4KBIA 1U48A 2I5JB 2G8VA 3VQCA 3OHBA 4FW1A 2UUWA 2YKMB 4NLTA 3SI8A 2AX1A 2ZD1B 3IS9B 2PYJA 4B9TA 1TQLA 4DS4A 3LWMA 4IQXA 1BQNB 1KVCA 1UA0A 5KRSA 2GBZA 4PUOB 1UOCA 3V6DB 4ELUA 4CF2A 5CYQB 2XCPA 3B6OA 4MFBA 3OLBA 3RWUA 4F2RA 2AGOA 3QNOA 3AVBA 3LP0B 1HNIB 3LALA 3SUPA 4I2QA 2VG6A 4FJ7A 3BREA 2VWKA 4K50A 1BGXT 3KHRA 5KG1A 4IFVA 4AHRA 1QE1A 3KHLA 2DY4A 2J6UA 1RBSA 3I5AA 1RNHA 3CM6A 1S1UB 3H5YA 5SZTA 3H98A 4YR0A 3PJWA 1RDCA 3VN5A 3AVGA 5KGXA 5KGWA 3V9WA 1VRUA 1VSEA 2JGUA 2I1RA 1S1TB 4J9PA 1A5WA 3K58A 4E7JA 1LV5A 4KTWA 4FLXA 2F8TA 4Z0UA 1IG9A 4CF9A 4J2EA 3IGNA 3VQ4A 3M9MB 1UA1A 3KKRA 5DLGA 2Z1IA 2XY7A 5KRTA 5J2NA 2OPQA 4BACA 1BL3A 4ZVHA 1TK8A 4XPEA 1SL2A 2CKWA 2KFNA 2XI3A 3NL0A 2WB4A 3HVWA 2JEIA 2IGIA 5F8LA 4KHMA 3Q8PB 3KJVB 3KHHA 3ZT0A 4GMJB 1JLGB 4ED3A 1J5OB 3L8BA 4IG3A 4MIAA 2HVIA 4FYDA 2RF2B 4FM2A 1RILA 1D1UA 3RMDA 4CJ5A 3DRPA 2ZKUA 4R8UB 1RT5A 4TLRA 3DLEA 3VA0A 1LW2B 4K4UA 3V4IA 5EU7A 4LSNA 2IM0A 4JV2A 3MR6A 3SYZA 3OYLA 4OLAA 5KFWA 4CCHA 4DSFA 1TL1B 1NHVA 4O3QA 1HQEA 2OPPA 1JLCB 3QEVA 4TQRA 2R8JA 2G8KA 2QKKA 3O3HA 4DSKA 3KLGB 1TAUA 1KLMB 4CEQA 1HARA 4NLSA 4OPKA 1HYSA 4WFXA 1TKZB 3CVKA 3QZ8A 4CEAA 2HNZB 4CE9A 3AO2A 4MK8A 4F3OA 5L1IA 1RYSA 1SV5A 2HHUA 1RBVA 3RMCA 4RG8A 4CHQA 1T8EA 2FBYA 4KAIA 2EC0A 5KT3A 3DYAA 1I39A 2DFFA 1WNSA 5KG2A 1MMLA 3QLHA 1RDBA 5HP1B 5KFZA 5JS2A 4Q8EA 4FZZA 4OVLA 4PQUA 4IFYB 3T5LA 4IG0A 1RT3A 2RN2A 3RMAA 2CJQA 2GUIA 3KNAA 5J2PB 1NKCA 4E7KA 1ASVA 3VQSA 3MXMA 4B9LA 4YR3A 4FM1A 4CK2A 1S0OA 3FFIA 3ITHA 3SUOA 1S5JA 3MEEB 1RCHA 1C0TB 1EETB 4JUZA 3V9ZA 4NLWA 1QQCA 3H5SA 2V0NA 3AA5X 4YFUA 4E89A 1S48A 1CSJA 3P5JA 3PX6A 2G8FA 3KTQA 2ZQBA 4CGHA 4ECTA 3H40A 3DRRA 2PZSA 3V81A 4KRFA 4FK4A 2UVWA 1D9DA 3ZSOA 1O1WA 1IKVB 1NK7A 1S9FA 3PO5A 4O3OA 5HROA 4FLZA 4OJRA 3PW7A 4DL6A 3ALYA 4Q5VA 5K14A 2RKIB 3T5KA 5EUHA 3VQPA 4TYBA 3M8PB 3V6KA 5KG3A 4CJVA 4DTXA 4FJLA 4NRUA 1LWCA 4KKOB 3AO4A 1RA7A 1NK5A 3WNEA 1S6PB 1TVRA 3KLEA 3HO1A 3AV9A 5KI6A 3CO9A 4FJ9A 1D5AA 4KFBA 1HYVA 2FVRA 4DF4A 1HPZB 2BR0A 3QESA 4ID5B 3VQEA 3QERA 2O5DA 1FKOB 1REVB 4FJKA 4RW6B 4IRKA 3F9KA 2YHAA 4AHUA 4B9SA 4EO8A 3CWJA 1X9WA 3SJJA 3OYEA 3C6TA 5FDLA 3DOKB 3VQ6A 3SUNA 1IKYA 2P5OA 3M8QA 3CIZA 5HRRA 4BDZA 4FJ5A 4DTSA 4CJTA 3LP1B 1Q8IA 4CK1A 3V1OA 4BDYA 1NK0A 4KPYA 1YTUA 1C1CB 2YNFB 4CJUA 1JL2A 4O3SA 3DLBA 2YNIA 4CHNA 1HYZA 1R0AB 1T05B 1WSHA 1WSFA 3RMBA 1B92A 1FXXA 4AHTA 4DU1A 3MF5A 2IS3A 2HVHA 4RW9A 4O5BA 3LAKA 5I42B 3EPGA 3OY9A 3DI6A 5KFEA 4ECSA 3F73A 1NJYA 1D9FA 2JLEA 4ELTA 3MXIA 2JC1A 5C24B 1XWLA 4CEFA 1SKSA 3OL6A 4YMEA 3E01A 5DQHA 5HLFA 4AHVA 1RT7A 3O3FA 5KFKA 4HUGA 5KG7A 4CFDA 3OS1A 1KLNA 4NYFA 2R8GA 4AILC 2HNDB 1HJRA 2WOMA 5D3GA 1GOCA 3O4NA 3KHGA 3OL7A 4KE5A 1TK0A 5JXSA 3HPHA 4NLRA 5JUMA 3ZCMA 4H8KA 4Y1DA 4IDKA 5KFIA 3C6UB 4F4KA 4I2PA 3K5OA 1S1VA 1MU2B 1S1XA 1TAQA 3VQ5A 3ZSZA 2X78A 1VRTA 3KIOA 2PY5A 1BCMA 5I3UA 1DTTA 1RTIA 2LSNA 4URGA 3LZJA 2D3UA 1Q9XA 4CF0A 2R7YA 2XO7A 4CGJA 5KFYA 2BE2B 2W8LA 1N56A 3M9OB 3U3GA 2ATLA 4M95A 1JLBB 4ZHRA 3BQ1A 2UVRA 3FDSA 4KV8A 1S6QA 4RNNA 3KMSA 1Q9YA 2ASDA 3GIKA 3IG1B 5CZ2A 5JS1A 4R5PB 4M45A 4W5NA 3DOLA 3V6JA 4JLHA 4RW8B 1HQUB 1EP4B 5E41A 4FLWA 1RT6A 2O4IA 3ZT3A 3AVFA 2BQRA 3KK2A 2IJFA 1VSJA 1C2PA 1BQMB 3DM2A 3T1AA 3IAYA 3ZT2A 4ZTJA 5FRNA 3SCXA 2R8HA 4CGIA 4ECRA 1TKXA 1VSFA 4ED0A 1LW0A 3WNFA 2IA6A 1WLJA 4EP5A 4FCYA 3L2RA 5CZ1A 3OYMA 3QO9B 4I7FB 4BE0A 3LP2A 1N5YB 3AVJA 3TAFA 4B08A 4CJWA 1L3SA 1S9EB 3E51A 1RT2B 4DTNA 4WYLA 5C25B 1JLEB 2IC3A 1SUQB 1IKWB 2IBKA 2B6AB 4CEOA 4FJXA 4FBUA 4AH9A 1JLQA 4H4MA 4KB1A 5KFHA 3PW2A 3TAMA 3CJ0A 1TV6A 4DL2A 4IR9A 4JRPA 3HVRA 2IOCA 4HUFA 5C5JA 3ICLA 2IAJA 1QAJA 2FLNA 3OYHA 2XY6A 3DLGA 4ICLA 4WE1A 2IM1A 3SV4A 3FRZA 1RTHA 4IOBA 2UUTA 3OS0A 5CY4A 1ZBLA 4TQSA 4E1NA 1S1WB 3T5JA 4H54A 1BI4B 3SPYA 4PWDB 3OYGA 4UQGA 2B5JA 4W5OA 2OA8A 4RUAA 5F8GA 4CECA 4YP3A 3HYFA 3MTKA 4ZVFA 3MECB 3RBEA 1N6QB 4J9KA 1LAWA 1U45A 4DLEA 3NH1A 3NE6A 1QSLA 1JKHB 3VA3A 2BRLA 4DL5A 2J6SA 4RW7A 4CHPA 2HHTA 1G15A 2VG7A 4G1QB 2R2TA 1T7PA 2HHXA 2D7SA 1QUVA 2C28A 2QXFA 1TP7A 3ZSWA 2HHQA 1HMVB 1S9GB 1QHTA 2P1JA 4CF8A 3FQLA 3V9SA 4ED7A 4NYNA 4ZPAA 5DG8A 2FBVA 3HP9A 4DG1B 1NKBA 4OKKA 4LQ9A 4ZVEA 2YKMA 3D5MA 4J9RA 3ULDA 4KHRA 4DL7A 4EO6A 4Q43A 1B9FA 1GX6A 1J9AA 1CXQA 4OLBA 4O3NA 2E4LA 3RB6A 1HRHA 1K1SA
chains in the Genus database with same CATH superfamily
4X4VA 3GR0A 4ZJOA 3H08A 1CZBA 4FK2A 4MYUA 1HNVB 3CCRN 2DHXA 4Z4FA 2IJRA 4JV0A 4FKXA 2YY3A 4C23A 2X1GA 2HHVA 3LDNA 1HNIA 3OFEA 2AV5A 1YZ7A 3ILLA 1W2BM 2MB0B 2ZZMA 3PHTA 2CJKA 3J81Y 4O4GB 1MMNA 2D4WA 2Q1LA 3R5JB 4XO0A 3MOZA 1RTZA 2YWKA 1YRXA 4Z94A 5H9FK 2ITMA 2VG5B 3I96A 4B9MA 2B4JA 4KO0A 1NDKA 1SH0A 2R2UA 4CEEA 5E0OA 4U7CA 2YH1A 3HSTB 5L9NA 1B0PA 4FM0A 4KI6A 5C2CA 1FJ7A 3GB0A 4BC2A 3G6XA 3EYZA 3Q7CA 4DV3F 5JMNA 4DR5K 3LANA 1HBNB 3CCVN 5DG7A 1SQFA 2AP6A 2UXCF 4ES1A 1SBRA 4Y6IA 3S3NA 3TRGA 4ITSA 1Q5YA 3QT6A 3THYB 3UQSA 3EICA 1XHZA 4DL4A 1LWFB 2A2CA 3MM7A 1HNXF 2JLGA 3IBCB 2D0PA 3ELHA 4K4WA 5T7BA 4IWVA 1EXQA 4JI7J 3SUQA 3GP9A 2ZH1A 4JI1J 1R0CB 1QDUB 2DJWA 4WU2A 4FPRA 5HRSA 1RCXB 3OS2A 3TZYA 3NF6A 1A9NB 3FMWA 3D0IE 2VCPA 2MHEA 1QAIA 2C22A 2IDOA 2ZKTA 1U1QA 2MXYA 3RBZA 4J90A 2XGQA 4LF8J 5L39A 4JP8A 1U8SA 2B4UA 4BRNA 5E26A 3NLCA 4W5TA 2F9DA 4DCPB 5SWMA 1G2EA 4OKEA 2V8PA 1MWKA 2XHWA 4CJPA 3K0SA 2LLZA 1LXNA 3PJXA 2DT9A 2VJUA 3LQVA 2MJUA 2LQBA 3LO3A 5C7PA 3BGRA 3NH0A 3QEWA 3HT0A 5AQWA 2MZRA 4B9NA 2AA4A 1RAAB 4UTGA 1S72S 4DX5A 2G2YA 4EYIB 2D3ZA 2HLUA 1ZETA 5J2PA 1T9TA 5D4PA 1KOHA 2J7WA 3FNNA 1MN9A 3Q83A 1TK5A 3CCUN 1CJUA 2KXHA 1C0UA 2JEJA 2MTLA 5K8MA 2YPYA 1S5ZA 2AGPA 1SV5B 4FXVA 1YI2N 1F1BB 2DRAA 5DK5A 4Z37A 3VQ7A 3HTVA 3QLHB 4AHSA 4NLVA 3BDPA 4BVOA 1BLUA 5F8NA 2E2NA 2XSJB 5K8NA 4IG0B 3QBXA 2X74A 4A5BA 3MZIA 4M7XA 2HMIB 1TL7A 3EVMA 1RHQB 3VESA 3ZSVA 4CZCA 1UZHA 2UUAF 3EZ5A 4EYHB 4AQYK 4CIOA 3ZX3A 4TY8A 4LFAJ 1EQMA 4HCBA 3GIIA 1PAEX 1DTQB 4CBUA 2K8GA 2ZGYA 2DPIA 1ZM4A 3K5LA 3Q8RB 3ENBA 5KT7A 1GOBA 2P9UA 2ASPA 1WF2A 2E5IA 2CJYB 4UUWA 3HK2A 4LMZA 2PT0A 2CVEA 3NMUA 2DEIA 3T6BA 2GEMA 4FYVB 4M5DA 3RB4A 4M5HA 3D0GE 2J9EA 5CYMA 2R8IA 1HBMB 1W0HA 3O4WA 3JTOA 1AA1B 1U25A 3GG4A 1N8RT 5HROB 1T95A 1NK4A 4K25A 5AR0A 1RA6A 4ZLLA 2W2QP 3Q86A 1TL3B 3M8RA 5HOOA 4FWOA 1XC9A 4DR2K 2DISA 4CZHA 4OYPA 3WZ0A 1PJ7A 3AA8A 1SQGA 2IM3A 3TX8A 4QAGA 2AZ1A 5CABA 4M3UA 2DYAA 4EMDA 2C2MB 2AQ4A 4KJIA 4DB3A 3PYEA 1X9JA 5HMYA 5H9FJ 5DM6Q 3AY9A 3CCQS 1NO8A 2V8VA 3GIRA 2EI5A 3NBPB 2QLBB 3H45C 4J2AA 3JTPA 3N9UC 4P2SA 3CCJN 3IBFB 3SZ2A 3ZEUB 3A8YA 2FJVA 1Y0HA 5AXLA 4DTMA 1WOPA 5DS7A 5IM0B 4AFFA 3MXHP 1O51A 1URRA 5LJ3Y 3H5UA 2B43A 4DR5J 4W98A 2BKNA 4JNEA 5JMVA 2CIMA 3NS5A 3WQTA 4KHNA 3OXFA 5IT9O 4ISEA 4JHDB 3SQGA 4EZ9A 3QSYB 8AT1B 4KHYA 4Y0FA 3DLHA 3C6UA 3D6RA 1VQON 3M2UA 3I6PA 4IOXA 2KQ2A 1GMUA 1OY6A 3K5MA 2QN6B 1CG2A 3THTA 2LU1A 5MLCQ 1VQ8S 2AP1A 4Y3CA 1LAVA 4ZITA 3HFZB 2IRUA 5A8KA 2YV0X 4HT7A 3BQ0A 2FUG9 3DOMB 2CPJA 3AJ1A 1FE0A 5KT4A 2WVBA 2RRAA 4CIEA 1PKUA 3AA9A 1CXUA 1FKAF 1CS4B 1MA9B 2FY8A 2Z2ZA 1U09A 2R7VA 3S41A 3K59A 3ZETA 2R2SA 5HATA 4JI6F 3D45A 1FJCA 1UVMA 2M3DA 2F63A 3T41A 4OZJA 1S1VB 4ZDNA 3RRHA 5HO4A 1F2GA 3ZT1A 4O0NA 3THVA 2HRTA 4LVNP 2MQLA 3ZTQA 4WYBA 1SKRA 2JC0A 2XI2A 3QO9A 5DM7Q 2WVDA 3NH2A 1A6LA 1Y4ZB 2KTQA 3IMQJ 3NGDA 3JSRA 2HZAA 2D74B 1CVJA 2BZ2A 1S9EA 1HIYA 4YHHK 5D4NA 2MLXA 1WC0A 2W01A 4KH0B 3HHEA 4FNIA 1DFDA 1GEHA 2BV3A 2LQJA 1EARA 2Z1JA 5F9LA 1KR4A 5B7WA 1KHWA 4CZJA 4OV1A 1FXRA 1SJ4P 1MWMA 3ET6B 5KFLA 4K5SA 3UR3C 4OX6A 3IM9A 4XAKA 3VMFB 4PKDB 5J2MA 1KQGB 4K4XA 2NRWA 1B7FA 2F7TA 3BDEA 3ENOA 4ECUA 5E3CA 4Q44A 4WYWA 4PQAA 3MAQA 1E6YA 2DNLA 3TVKA 2KB2A 2YWFA 2NNWA 3AVHA 5L9XA 3A3PB 3DRSA 2EG2A 1NK8A 4DQQA 4CERA 4CJFA 1IBMF 2D0OA 4TSXA 4H0YB 2BJ1A 3EEQA 4C98A 1RWXB 4EK2A 4K41A 2GUPA 4H0VB 3VPZA 1IO2A 1JLQB 2V63A 1Q1KA 3TAMB 5LXRA 1J6ZA 1CC7A 3DN9A 4AQYJ 1RT1A 4O3PA 4CJ7A 2IAJB 5JLFA 1WNEA 4DG1A 2D0AA 1I6JA 5ADXA 4HI2A 4KIAA 2H5IB 4P74A 4U7UD 1RTHB 3NAIA 3DGVA 4N41A 2BEFA 3SMSA 5FPEA 2J7UA 5IWAK 1BC6A 2I5JA 3R8EA 4ZCMA 3FBBA 4JYAK 3IS9A 4ZCLA 2F4VF 3V9UA 1BQNA 2EHGA 1Q82O 1X3MA 4RBVA 1VC0A 3V6DA 4Y2AA 5CYQA 4YN3B 2RAQA 2VG7B 3CW2C 4DR2J 2QYCA 2GWKA 3WUHA 2VPWB 1ROFA 3CDEA 3DLKA 2DKOB 2ZHOA 3QJJA 1WHVA 4RNOA 4I9LA 1AZSB 3VGSA 3WX4A 3NVKA 1Q7YT 1U47A 1XQIA 1VHXA 3OYIA 3Q8SB 3NF8A 2WSEC 2OELA 1TR0A 5B08A 4NLUA 2FLPA 4H5NA 1UP1A 2X3GA 4HH0A 4CLKA 5CAAA 2C42A 3FGVA 5KFCA 3FUYA 3CC2S 1WD6A 1HQ2A 1KHVA 1DQAA 2HRYA 3CQXA 3J80O 3ILIA 5KFOA 4M3TA 2IYGA 5KFDA 2CQ0A 2PSZA 4RNFA 2VBXA 3GWCA 3PFOA 4NXMF 2HZVA 2BVZA 3VCDA 5IT9U 3OTDA 2E1ZA 2DTUA 3ZNJ1 3SFGA 3CC4N 4TYAA 4ZCIA 4GC6A 2WTFA 3QFWA 3NWGA 3PR5B 1H1VA 4ECXA 4WP3A 2J8AA 4Y1CA 2A5XA 3MD1A 3AVMA 4RNHA 2OGUA 4WXWA 4H5VA 3MCSA 3NRBA 4K8ZA 2AYMA 1QSSA 1D0EA 2WVCA 4E7HA 4KO0B 2CAJA 3N79A 4HR2A 3MCPA 3ZZPA 5F8MA 4QW9A 4BWMA 1S0MA 1NSQA 1KTQA 2RF2A 2VJVA 2CGJA 4HH1A 4Z4HA 3HHKA 2CPIA 3HPGA 3D0PA 3KKSA 3FR0A 1R8HA 4R8UA 5JVHL 1ZBFA 2LEBA 2VASA 3CJRA 2V4QA 2XEXA 5J2NB 3S3MA 4FW2A 2C2RA 3CF5Q 1WDDA 3U27A 1X4CA 4WIIA 4DU3A 1KQSM 2DGSA 2Y1RI 3QB0A 4QBUA 4B3MK 2G2ZA 3EZUA 2GJIA 3MM7B 3J7ZO 5KAKA 5C0YA 5F8IA 3VZHA 2A1RA 3IAM9 4FWPA 2HLTA 3NXZA 1X3NA 2MZTA 3CCSS 3D7EO 3OYFA 1RU1A 4YHHJ 3EKSA 1VSHA 3M7VA 4EEYA 3NAHA 1BCOA 1C0FA 3PEJA 4LUBA 2CQGA 2MZQA 4DZ6A 2YQ3A 4YB5A 3GR1A 3HLUA 4CJQA 3K9JA 4HACA 2JZ5A 2V5HG 4DQSA 1ASUA 3AA3A 1JMTA 4DTRA 3RB3A 1TZ0A 3ZZOA 3MN7A 1G99A 3MEEA 2QEXN 4K4ZA 3MM5A 3BGRB 1U6BA 2PC6A 5GAHP 4QS8A 1CJKB 1Q8KA 1U0HA 3T1HJ 3M6WA 3NAEA 2HW3A 1AXQA 2B3TB 2DFEA 3EWGA 3ZTPA 1KXPA 3DYAB 4OPHA 5KFNA 1N36K 5GAGP 2AHOB 2LA4A 2V34A 2OKQA 3TAQA 1C0UB 3K2PA 1FDBA 2RKIA 2Y9HA 1YF5L 2Y8YA 8RUCA 2XMWA 3TSPA 4NMLA 4HI1A 4BRMA 5IWAJ 3EM1A 1HNWF 4MKAA 4UW2A 2P8IA 4OX8A 4RTFD 4JYAJ 3KJNB 3WXMB 1N8RO 1VSDA 3BO3A 3WEEA 2QRRA 1TL7B 1REVA 2RIJA 4RW6A 1KEKA 1Z4UA 2DY1A 3TR8A 1N5QA 4DEZA 1XR6A 2CPHA 4NEZA 3TJAA 4TY8B 4CFCA 3SDEA 2GV9A 3HSCA 2HWTA 1HLWA 2P9UB 1RDAA 3H1QA 3DLJA 3IWNC 4LVOP 3CFOA 4JV5K 2JFDA 2X3DA 3AY0A 3CDWA 1NG9A 1HBOB 2VKZG 1S57A 1K1QA 4P52A 4B1UB 3H2VE 5GADU 5CYMB 2PO4A 2QWQA 4WP8A 1Q18A 2A10A 4RZRA 2F8SA 4K4TA 3LP3A 4HHUA 3MDFA 3R5GA 5FDLB 1BXNA 1ZAVA 4FPAA 1NGAA 3GYGA 2OEKA 1YBAA 1DQ9A 3H20A 1N0VC 2DEJA 2Q79A 3M8WA 4OYZA 4DR6F 2RJZA 3TQEA 3UCZP 4DMNA 3SSSA 3AAPA 1VLYA 1FJGF 5FLXU 4I9QA 4KHPK 3GJTB 1X9MA 1LOUA 2QWMA 2UXBF 2EWHA 3AQOA 4GVLA 3VF6A 2BH1A 2U2FA 1RB0A 3LZIA 3QJLA 3A8EA 2AJ1A 4M41A 4IH7A 4IH5A 4DPTA 2QTDA 1NAQA 2GO9A 4K0KF 4FBTA 4M8LA 1Q0NA 3NGTA 4BVPA 1RT7B 2E1RA 2YPZA 1JLBA 2KZMA 4E8UA 4YDDB 3TAGA 1VBXA 4PA1A 4F8RA 4B3MJ 3CTRA 2X6NA 2XYHB 2D3OR 1NNDA 1ZXOA 1KRPA 3M2UB 5IFMA 3VQ9A 4R5PA 1T03A 4OGCA 3WNHA 1X7VA 2O66A 1Y5NB 4CLLA 5IC4B 4YDUA 3OR2B 1X0FA 4BGAA 3SFUA 1P9QC 3C95A 3CCLS 5AQKA 5A8KB 4ECVA 4IKFA 3GJSB 3W2VA 2NSBA 1NGIA 4QW8A 4RUBA 3LDSA 2JJ4D 1KVKA 2D1KA 4IH6A 2QTWA 3TW0A 4LQ3A 3SAGA 2RPIA 2YJEA 4L76A 3KDOA 2CUYA 1G3OA 5C25A 2NXJA 3DRYA 4FPIA 1K0VA 3F2KA 1F21A 1SUQA 1ATSA 1S97A 2NYHA 1YHQN 4USVA 3T19A 1K73T 4C9DA 4QPTA 4C1NI 4F50A 1FK9A 3HT3A 2PFDA 3GLJA 4FWSA 2Z30B 4A57A 1JJCB 2HAIA 1LW0B 2YXLA 3T1YK 3DXMA 1KBRA 3J7AP 1RHUB 1FWLA 1H0HB 2CWXA 4YDUC 2Y1JA 3CD6S 2BOAA 3N6NA 5JLHA 2HWIA 1N36J 1VFJA 4U67L 3BKTA 3H1VX 1QTNB 4GC7A 3A5OC 2IRXA 3R1HA 2E66A 1S7IA 2QL9B 4ECQA 2FJEB 3MCMA 5M1OA 2X1BA 4BREA 3D6TB 1A0OB 2DIVA 3T1HF 1PJ6A 4KC5A 4ATNA 3G6ES 1RI7A 5J2MB 1B0TA 2CDRB 3PRDA 1ZM9A 3T3FA 1S9GA 5CXTA 4CGGA 3Q7BA 3OFFA 5EWGA 2V2QA 3BSOA 2W7PA 4CJSA 2NLWA 2FC0A 2HGLA 3WQUA 3SCIE 3DRSB 1NKEA 3V2UC 2ATCB 4OHWA 2M5YA 5AQRA 3KG0A 3KLHA 4CF1A 2ZH8A 1UVJA 4H4OA 1YBUA 3CCRS 3OVAA 4F4WA 3EY1A 1RT1B 1DARA 4FS1A 1U2FA 1HNZK 5KPRA 3IRXA 2NZTA 1Q86T 3ENQA 4DSJA 3FBCA 2XNRA 3AARA 1Q7YO 4BHQA 3QIPA 1ZM3A 2QK9A 3S01A 4JV5J 3O9SA 3C65A 4KBIA 1U48A 2I5JB 4L3QA 3VQCA 4DUYK 5C15A 3OXLA 3H90A 4NEYA 4NLTA 2PYJA 3IS9B 4IO1A 1BQNB 3JXOA 1QZ6A 1Y64A 3SSQA 3V6DB 4CF2A 5CYQB 2MQOA 5HI7A 4OHZA 4WCEQ 3D1QA 4LF6F 1VC6A 2KHDA 3AVBA 4HHJA 3LP0B 2A1BA 3ENHA 2BKPA 3A13A 4DR3F 2DR9A 3O9RA 1BGXT 1YXQA 3CCVS 3KHRA 2VHGA 4KHPJ 2EPIA 1PG5B 1RNHA 4LFBK 3VETA 2Q2RA 3ZC4A 3C66A 3H98A 3TEHB 2DD8S 4YR0A 2LP4A 3N28A 4RU2A 3AVGA 3OBYA 5KGWA 1VQ9N 2CQHA 5BR8F 1VSEA 4YOXA 1A5WA 4NLCA 3K58A 4E7JA 1LV5A 5KPZA 3DU5A 4CBWA 2F8TA 2I7PA 4WFNQ 3T7ZA 1X4AA 4JI2F 3VQ4A 2VUGA 5IT4A 4X4SA 2Z1IA 3A5NC 1NLVA 2OPQA 2VQEJ 1TK8A 4XPEA 1SL2A 3HJVA 2VH7A 2IVPA 3AB2B 4O8KA 3NL0A 1U1MA 2WB4A 2QX0A 5GMEA 1T6CA 2VFSA 2JEIA 3ENVA 2CFXA 1XBWA 4O5FA 4IG3A 5DM6L 1MDUB 2RF2B 4FM2A 5KOXA 1RILA 2ABYA 5D4OA 4CJ5A 4UF4A 4R8UB 4DDFA 1RT5A 3MM8B 3P3DA 2IM0A 4EU0A 2N7YA 2CG4A 1ZPVA 4ZA1A 2P9PA 3SIPB 4CCHA 4DSFA 4AE5A 1UEVA 4L74A 4O3QA 5DDPC 4LR8A 3QEVA 2V6AA 2PEHA 2N7CA 2AJFE 4ZVOB 1HARA 5H1SQ 3GCXP 4LF5K 5CQGA 5E3PA 1HYSA 3CVKA 2POKA 4CE9A 3QT7A 2UU9F 3BN7A 3EKUA 2HHUA 1RBVA 3RMCA 3T1YJ 3L6QA 2H3EB 9ATCB 1YI2S 3I55N 3L9ZA 3PYGA 4JBCA 5E3QA 4KAIA 2EC0A 4XH4A 1FE4A 2NPIA 4PQUA 3J7YI 4IFYB 4HACB 1RT3A 4OYMA 1SKUB 2MLYA 3RMAA 2GUIA 2QLWA 4WJBA 4QYRA 4CD3A 1MMDA 4YR3A 1YRUA 1FVQA 3ZTSA 1ZA2B 4M5NA 1S5JA 3MEEB 3D6FB 3V9ZA 3CMES 3H5SA 2D9PA 4YFUA 2ASMA 5LJVA 3U9DA 1U0HB 4DZDA 4AF1A 2CH6A 2OTLN 3H40A 2A40A 3JS9A 1U1LA 4GVBB 3ZZTA 2ZVSA 4A2AA 1GXTA 4WKYA 4JK7A 2ZHAA 3HSGA 5D0GA 5G4DA 1HNZJ 2Q97A 4O3OA 2KT3A 4DUZJ 4X4OA 4DL6A 1N52B 2RKIB 4BC7A 3VQPA 2R7WA 4PRFA 1NH7A 5KG3A 1Q81T 4CJVA 1LWCA 2DBBA 1N34F 3WXKA 3VF2A 4CNYA 4A8SA 3W5XA 1K8AT 4LIWA 1N33F 2H48B 1RAOA 3IWXA 4PG7A 4H0XB 3R6LB 3FCVA 2VBYA 4YB1P 4FJ9A 4DUYJ 1D5AA 5AQUA 4WPAA 3ZO7A 2FVRA 4DF4A 2BR0A 2K3IA 3QNWB 2E8AA 3RUBL 3WEEB 1REVB 1DEJA 4RW6B 2DNQA 4F36A 5IXUA 1CPZA 1X9WA 3TX0A 3DXBA 3MMVA 2CQDA 3DOKB 2A41A 4CI0B 3VQ6A 3PKYA 1XNQK 5H9EK 3O1LA 3K5PA 4ID8A 4BRLA 3M8QA 3SDEB 5HRRA 4BDZA 4CJTA 3LP1B 2I0XA 3V1OA 2HHHJ 1HWJA 2EFVA 1NK0A 2D9OA 1C1CB 3POTB 5AQFA 3GYXB 1JL2A 1Z6RA 4P2XA 3A1YG 1NUEA 4LFBJ 2P9EA 2WUSA 2XLIA 1WSFA 2YX1A 3MF5A 2HVHA 2IS3A 3LDQA 2BX6A 1VQOS 4M5JA 4QIFA 3A0IX 4GV6A 1I5OB 4JI3F 4JI5J 2HQ3A 1NJYA 1YIJN 2JLEA 4Y65A 4CEFA 1PGZA 3E01A 3O1BA 4HUGA 2CQIA 2G2OA 2JH3A 4CO0A 4AILC 1WG4A 3L7UA 2AJ4A 1GLEG 1X8DA 2HBKA 2WOMA 4BRQA 1ELOA 2O1PA 2X1AA 3OBWA 1WELA 4LFCK 3O4NA 4KE5A 3ZCMA 3CPWR 5AJ3F 3CDBA 4IDKA 2R7RA 3CPWM 2VQEF 3VQ5A 1VRTA 1BCMA 5I3UA 4UT4A 1RJJA 1DTTA 4KGKA 5I9EB 2R7YA 2PMZD 4DV7K 5KFYA 3IFEA 2BE2B 2W8LA 3MX5A 4PAAA 2ZJRQ 3MWTA 2NQPA 4GVEA 1JLBB 3BQ1A 3FDSA 4KV8A 3QMQA 4X64F 5E84A 1CQMA 2AD9A 2MGZB 3CD7A 2N4DA 4EUVA 5JS1A 1WI6A 4R5PB 4Y2MA 3VEXA 4CLWA 1KKHA 2F4FA 3DOLA 3DWLA 4FLWA 1RT6A 2O4IA 1VGYA 1RZMA 1BQMB 3T1AA 2VFVA 2WVFA 3C6AA 4ZTJA 2DO4A 2DR8A 1TKXA 1VSFA 2GFFA 3W2VB 2XYGB 2IA6A 5FJ4A 4EP5A 3NCRA 5SUHA 4P75A 2KFYA 1V9OA 3I33A 1MLAA 1EAYC 1N5YB 1GAOA 3AVJA 4B1YB 1PIEA 4B08A 1FRLA 3M1VA 4I0WA 3SCJE 1GXLA 1VLOA 2OI2A 2NREA 4DV4K 4QR0A 1VRQC 5C25B 1SUQB 1UW4A 2BJ7A 4KR0B 2B4OA 4FJXA 3Q2TC 3OXGA 1U7LA 4H4MA 3CF5L 2HQFA 2FGOA 1WHWA 1TV6A 3HVRA 4ZCKA 4OI3A 2FLNA 1BE4A 1U1NA 3CJBA 3J7Z5 5FPMA 2XY6A 3CJ7A 4ICLA 2CZ9A 2Y0SD 1FW6A 4DR1K 4IOBA 3DXMB 5CY4A 5C10A 4E1NA 3SPYA 2FXUA 2OA8A 4CECA 4BY9C 4YP3A 1X5TA 4KBOA 1NZAA 4NWBA 3KWIA 3US5A 1B70B 2RE2A 3MECB 1LAWA 1VAZA 3NE6A 2GQCA 3BYPA 2GA7A 1TYQA 4LR7A 1BQXA 3E8OA 4U7BA 3G25A 2J6SA 4J9VA 4F3QA 2QL5B 1IR0A 1RXOB 2HHXA 1QUVA 2PE8A 4CH7A 1S9GB 3FQLA 1R43A 1HL6A 4AM7A 2R7SA 3TTDA 3W62A 3HP9A 3BO4A 1LWXA 4OKKA 4LQ9A 4O23A 2W2NP 4ZVEA 3H25A 4DUZF 3ULDA 3L4QA 2YX4A 1GX6A 2ROGA 2XS7A 2ERRA 4IBNA 5F8HA 3T9ZA 4DN9A 1J5EF 4H4OB 1XNQJ 5H9EJ 3HKWA 3IRXB 4ED4A 2M9KA 1VK3A 1V3SA 1RWUA 4FOEA 1IBKK 4Y2CA 1X60A 4UOHA 2W9BB 2FVPA 4EFAC 4NXNK 4JS5A 4V19S 3PSFA 3CCEN 4A8FA 4CLFA 2BE9B 4OL8A 2DGWA 3AO3A 3CJ5A 3WBZA 4BG8A 4ED8A 4F25A 1XMOF 3PM9A 1EX8A 5GMKa 3AA4A 5HBMB 1N88A 4W5QA 1S1TA 3GFXA 3MEGA 1FTRA 4AL5A 1WORA 1WSJA 4QPXA 4ZP8A 3H5XA 3NGZA 3B6PA 2CJAA 4KT0C 4B02A 5J2QA 1GXUA 1RTJB 1X4EA 1RDWX 3UO0A 3DHXA 3VALA 3TVZA 5KFXA 2LEAA 5EVZA 4XIUA 1NGCA 3IGVA 3DGPA 1ITGA 3K57A 4PG8A 1HHQA 2MPUA 2FSNA 4BRIA 1HUXA 3HFKA 4KY3A 2DR5A 3BUZB 2QWPA 4LSLB 1Y9OA 2LU2A 2D0CA 3C7NB 2HURA 3AGKA 3TZWA 2JLFA 2DHHA 2V67A 4QWAA 1HX1A 4A62A 5LJ5Y 2DNKA 1YJ7A 2J9DE 4BWJA 1GQEA 2O01C 4DV7J 1TKTA 2WHOA 4EBCA 4DV6K 1RDRA 2MEWA 2VPXB 4NA3A 2M8HA 2ALZA 1U49A 1ZAWA 2MSSA 3AAQA 2OPQB 4Y2IA 1B64A 1V5IB 2NRTA 1FI4A 1LFWA 1NGBA 3ATUA 2ZZNA 3GPAA 3PNIA 2WCXA 4QOTA 1E4FT 3HOTA 3KLGA 1J54A 2NUBA 1CJTA 2E1MC 4DPWA 1F2HA 5F0UA 3H2LA 4Q0BA 2HNZA 3AA2A 4CBXA 3OHAA 2E9RX 1IKXB 4OJGA 1WC6A 3W1YC 4UY8O 3PFEA 3QICA 4K4VA 1NNEA 2VICA 4LT6A 4DX8H 3GBTA 5KOWA 4J9OA 1Y97A 1JLAA 4OI1A 4DV4J 2FY1A 3V4MA 4FZXC 2VA3A 1DZ5A 4I4BA 2P9PB 1VHFA 2R2RA 1ZM2A 4RL1A 4C1NK 4OGEA 2X7IA 3ZFVA 3OTOK 2F65A 3KK3B 4V19J 4BRKA 5LMNK 2C2ZB 4PXBA 1S4FA 4XH1A 4GO5X 2Y1IA 1WOQA 2E6LA 2P9NA 2LXIA 1HYSB 4LRFA 3CG7A 1RLDA 2F8HA 4ZKAA 1OPIA 1RBRA 4L75A 2HQGA 2JX2A 3GIMA 4DR1J 1S72N 2ZM6K 1WEXA 4LF4K 2E7VA 3H3NO 3CPEA 1DURA 3RZAA 1B3TA 5EOYA 2QA4G 3K8WA 1QSYA 3SJHA 3EXCX 4HHTA 3A4TA 4C3KA 2EFOA 4F2SA 1UVNA 4YY3K 4PQUB 2D0BA 1U1PA 3PZPA 4YOYA 4NE9C 2ACMA 1RT3B 3RW6A 2EXUA 1IR1A 3DMJA 4FXWA 2XYPB 2IVMA 2C1EB 1HWLA 5C42A 4H0OA 4JKHA 1XIQA 2YWHA 4ISFA 4DR4K 2AYBA 2MKCA 4ILRA 1K8AO 4CQ1A 3ZNUA 4BE2A 1QUPA 1WBDA 2G4BA 4N77A 2JEFA 1OWXA 4I56A 2RD5C 4KB0A 1JWWA 4K7QA 3TA0A 1K9MO 4DPYA 4ZVUB 4FK0A 3D67A 3NGKA 2BGGA 4WXOA 2PMWA 3NS6A 4OYAA 1KVIA 5AQMA 1FTCA 3K89A 2KU7A 2ZE2A 3CD5A 3BF3A 3I0RB 3J7A1 2N82B 3CJTA 1IBKJ 4NXNJ 2E1PA 3TANA 1K47A 4DKWA 1LWCB 1FX2A 4NCGA 5A2QY 2F3JA 3DCAA 4G1PA 3KK7A 4X4UA 1EKEA 4O44A 4WWSA 5CZXA 1FERA 1C0GA 1RHJB 2U1AA 2W6KA 4YB7A 1YVFA 4E3SA 3UE5A 2YKQA 4DLGA 1KS2A 2OD6A 3IXQA 3M6UA 2QLXA 3MM6B 3BO2A 2LKZA 4YOVA 4DFKA 3UCGA 2DNYA 4CLZA 3FE1A 3UPFA 2JEGA 1X1PA 4J8FA 4DFMA 4UZBA 1VQLN 2D3O1 2RU9A 1HA1A 2UV8A 4YOTA 1UWBA 1HHSA 5GAGU 3ULEA 3VTHA 3PW4A 3T6JA 3JQJA 1KOOA 1VJQA 3SPZA 4DV6J 3E01B 5GAEU 4G6VB 2M7SA 3VF0B 1IM6A 5HQ8A 2A3JA 7FDRA 3AVCA 4WQ5A 2WOMB 2PFFB 1YJTA 1JXVA 1WBBA 2FSJA 3TZZA 4FDFA 3VR1A 4U6PA 4DFJA 4IDKB 3RBXA 1GMVA 2F7VA 5CHCB 2EKYA 2Q6CA 1FCAA 4ED2A 4LIRA 3IRWP 3OR1A 3LM2A 3SEOA 3F9MA 4C8NA 3I82A 3DU6A 2E9ZA 3VVTA 2Z58B 2BJEA 3QEIA 1AFIA 2GX9A 4KV8B 4PPDA 3L2QA 1IKWA 2GC8A 2R8KA 3KDNA 4BG9A 3PIOL 5LSLA 3OTOJ 1WSGA 4J2BA 3MPWA 3L2WA 3IA0A 1SQKA 5LMNJ 5HJXA 1KCFA 3DOLB 3LPUA 3FZMA 4WQ5C 3WIVA 3CFPA 4DV5K 1FKPA 2QFJA 1XNRK 5AXMA 3DXSX 4CFAA 5DZ7A 3GSDA 3VEVA 2QW9A 4LF4J 2ZM6J 1S1WA 3MMAB 2MKYA 4W90B 3ZSYA 5GMDA 1F3VA 3M1VB 3GZ7A 4YY3J 5L1JA 5D8HB 4P7TA 3OV7A 2RE1A 3CCMS 2KHOA 2N3OA 1HW9A 4WFAQ 1CZ9A 5CHIA 2AX0A 2B9YA 4H4MB 3P5TL 2XY5A 3GYNA 1TV6B 4ENOA 3Q8UA 4B3OB 2V9WA 4X65F 4DR4J 4QWCA 1T3OA 2FLLA 1R7IA 2PGCA 2EFQA 4IRCA 4CT8A 4ICLB 1SQEA 3NNCA 4JV1A 5EX3A 1FWPA 4DJBA 3A3NB 3AB4B 3CJ2A 4Z4CA 1Y5IB 2ZNYA 5M1QA 1L3KA 1I94F 3NHGA 1IG8A 1HNVA 3MAAA 1VQMN 4IO8A 3IP0A 4B3RK 2MKSA 2QIFA 1TYQB 1A7GE 2QM1A 2O8BA 2EBEA 1VQ5N 1IV0A 2G8HA 2CQ2A 3TYTA 1UVLA 4QWBA 1XUPO 1EIYB 3G6YA 3C0BA 5A8WA 4KH1B 3AVNA 4DXLA 1WSIA 3VQQA 4M94A 3CQ8A 4CNZA 2G8WA 5ETPA 2ZH5A 3MAHA 2IVFB 4O4GA 4MT1A 2EEYA 4MO4A 4ZVTB 2GS8A 1TL5A 2ZITA 3OYBA 2AYEA 4LC9B 1S1UA 1QVFM 3A8JA 1FRHA 4DL0C 2VG5A 2YVSA 3CJ8A 3L7PA 3ISNC 2KDOA 1SL0A 3U4LA 2GGPA 2YHWA 1VQ9S 3TTFA 4L3NA 2QE5A 3VV2B 3IR7B 2NRVA 3CJ9A 2CNKB 4NB4A 2GZOA 2CPYA 2CADA 3QBCA 1SKWA 3FSXA 1TUWA 4CM0A 2UYTA 2LQ9A 4HDHA 3QIDA 4FZVA 5KFPA 1F0XA 4HWIA 2DGXA 3RTVA 1SJQA 3TWZA 3CFRA 2NSCA 3G87A 3GILA 3FZLA 4JRQA 3MI7X 4DQPA 4M7YA 1HD0A 4DWIA 3UN2A 4KYZA 5EHHA 3G82A 4CH0S 3DC2A 1LWFA 3UR0A 4DV3K 4IFVB 3AVIA 5BYRA 2RDDA 4OHXA 5EWEA 4ZVQB 3MEGB 2J9CA 4CLUA 2UXCK 2FF6A 3CCZA 4QR1A 3VEZA 3O3GA 2MZSA 4Q2MA 4EBDA 1D8YA 4K42A 4FVCA 3THXA 4NZ6A 4ILHA 1UAWA 4CJKA 1HNXK 2F9WA 5B0AA 1YUWA 5J2QB 1U4BA 2P6TA 4KHWA 3I9ZA 1OVQA 1H98A 5C2DA 1VQPN 4BR4A 3THPA 1MG7A 1WSVA 4NL5A 2VC1A 3SBGA 1M1KT 1A5XA 5FPNA 1PSDA 1R8CA 5L1LA 2FC9A 4WF9L 1WEZA 4CHOA 1JNRB 4P2MA 2KRRA 1TUGB 2ZEJA 5BXIA 2GVZA 2BACA 3OSNA 4QOZB 5KG5A 1TKTB 3DXKA 3IBWA 3QGIA 5F2RA 3I55S 1WC3A 2CDQA 4CIFA 4CHZA 4LSNB 4ZN3A 1N32F 4FYXB 3MURP 4FLVA 2AU0A 2XZTB 4X4RA 3GQCA 3KUEA 4Q0BB 1Z2LA 4DV5J 1XNRJ 1WSEA 1C0MA 5KG6A 1OSDA 4LR9A 3RR7A 2D5RA 4RUCA 4KI4A 2ILZA 3VAMA 3SQ2A 3MEKA 3SMZA 5K9FA 4K4SA 2WTUA 2W1BA 1GK8A 3B54A 1WF1A 1JLAB 1K6YA 1FD2A 4CO5A 3KMQA 4C8LA 3PX4A 3NFAA 1RAFB 4FZYA 2HMIA 1TUUA 1J2VA 2ZJRL 1PYOB 2HQIA 4FXDA 4LF2A 2H3GX 4ZJQA 4F0KA 1IKVA 1WHXA 3TA2A 5HQMA 3VF4A 2VA2A 2UVVA 4KTQA 2P9NB 1DTQA 1RBTA 3L4IA 3FFIB 3M8PA 5KFFA 5AQGA 6FD1A 5AZJA 4KKOA 2HWHA 2UUAK 1T44A 1CULA 1NHUA 1Q8BA 2AJQA 1W9HA 2ZH2A 3J7YP 1UAXA 2JRSA 1I3AA 3FVYA 4WFYA 4DI6A 1HBMA 2IPOB 4B3RJ 1FKOA 3DMJB 1SH3A 2B9EA 1YK9A 1TL3A 1YRTA 3R1LA 1H2VZ 4NPOA 4LD0A 5C42B 2XC9A 3D1HA 4Q45A 3UVJB 4LF9J 2RT3A 2CRLA 1RABB 5JJBA 1C6VA 5JICA 4W5RA 3HHLA 2E6MA 4RJVA 4YORA 3QAEA 2KI2A 1F60B 5M2UA 3AD8C 1Z25A 3IR6B 1VMBA 1T05A 3KLVA 3NBPA 3D68A 3Q2SC 2D1CA 1X31C 1U04A 1N54B 2Q0RA 2ZE2B 3HP6A 1VR6A 4QIWD 4XK8C 3PLAA 5BRDA 1DRZA 5IM0A 2FJDB 2B8QA 3FZ2A 3S6EA 2IFXA 3H3OB 3AJDA 2H54B 2W4PA 5IZHA 2ROPA 4ZPVR 4NCGB 2GQQA 3O4QA 1WEYA 2DGVA 2J9DA 5F9NA 2DCUB 2HFZA 1EQYA 1H2UX 3ULHA 3PG9A 4O44B 1F5AA 2DXDA 2GIFA 3O2IA 4NCBA 3UI3A 4IKAA 1XK8A 2UXCJ 3HHLC 3EGVA 4X62F 2GAGC 1S79A 1MU2A 4WK3A 4HKQA 4BR7A 4FJJA 2FPHX 1HNXJ 1GLLO 4QS9A 4G3IA 4HCCA 4QWEA 4C8MA 4OIXA 3AD9C 3ADAC 4CWBA 2XGPA 3BSAA 4KSEB 3MM9A 2E1YA 4YR2A 4FJ8A 1K44A 3WXLA 1LFPA 4JKEA 2LXUA 1QHAA 3M32A 2HRUA 1NRKA 1TMJA 4Z4IA 4ECZA 4F67A 1UWBB 2VDIA 1F6TA 3LH2S 3QGPA 5AQXA 1KONA 3SK3A 3M2RB 3ULEB 2VOPA 2W2OP 1X4GA 3C14B 3VWSA 2EVZA 3KWMA 1U1RA 1DKGD 3VQTA 1UJ5A 1JL1A 4C6AA 4JI6K 1DJ0A 4USIA 3MR2A 1G1XA 4IJAA 4CI6A 3NKYA 5HQLA 4P73A 3NGIA 1EHWA 5A6PA 3A8IA 4B1ZA 2BUPA 4R25A 3L2VA 5L38A 4FJMA 4KGMA 3QAUA 1RYRA 1PAUB 4GO7X 2J0SD 2CG8A 4MDAA 2QKBA 4I68A 3SNNA 1SC1B 1DGKN 1OIAA 4E1JA 3OW2R 3OW2M 2X6SA 4NLYA 2UVUA 3GL1A 4CFBA 4DU4A 4USJC 4LJMA 4X4NA 3CCLN 4IOAQ 4M3ZA 2PN6A 3OR1B 3PUFA 4ANCA 2UP1A 2IIHA 5L46A 4CHYA 2A1SA 4OJHA 1CC8A 4LF7F 3U8XA 1XI1A 4M63C 2V2ZA 2HHPA 3VQDA 3LP2B 4X2BA 4CO1A 4ED5A 1P27B 2HK3A 2DNNA 2XHBA 2Y3YA 1N6QA 3L0QA 1E6VA 2FJWA 2IC3B 2PBDA 1JKHA 2Q3SA 3CB4A 4ZMMA 5AQLA 4ED1A 4OX9F 1WC1A 4G1IA 1IVZA 3NOGA 2W2MP 3BGOP 2GELA 1IBMK 1XMQF 1FKPB 2CXEA 3QFHA 3DRXA 4E0DA 5TKWA 4YS2A 3BBFA 4Y28C 2UUAJ 1KSPA 3CD6N 5BYSA 4IR1A 4UY85 4HT5A 4A47A 2FC8A 2OMLA 4CLPA 2E9TA 3JQKA 4OZ3A 2M52A 2ASLA 3DLLQ 2Z56B 2UUCF 1MWQA 5KFBA 2KVIA 2DCLA 3I9V9 3L3UA 4KAZA 1RAHB 3SAFA 2R7XA 2ROEA 4KH5A 1LCUA 2YTCA 4JI8F 4CO4A 1T3NA 2B9XA 2QA2A 1VYAA 2F4VK 1TTHB 3JAMU 4C0HA 3OUYB 2NXCA 1WC4A 2OSQA 2EX3A 1I1GA 4BR2A 2B4PA 2ZH9A 2QLJB 3ENAA 3QSIA 2G8VA 5B0BA 4FW1A 4U8VA 2YKMB 3MAAB 3SI8A 4LF9F 4B9TA 4IQXA 1KVCA 1UA0A 2V7YA 2O8BB 5KRSA 2GBZA 1CBKA 4RBUA 3UDEA 1UOCA 2A3ZA 4ELUA 2HZCA 3UE2A 2XCPA 2ZWHA 3WXJA 5HN0A 1WB9A 1UVKA 2DK2A 5A8WB 4JD2A 4OZ0A 1M5OC 2P9GA 2XMJA 2QWLA 1NBWA 4P10A 2OEMA 3BREA 2VWKA 2WSCC 4BRFA 5KG1A 1QE1A 2J6UA 4NXMK 1S1UB 4ALZA 2J8SA 1JJ2R 3L4BC 5D4LA 5B0CA 2GGPB 1CQNA 1H6KX 2N4CA 2XBPA 5HAOA 3CEDA 1EKRA 2JGUA 2VL1A 2WAQD 2ZDPA 4FLXA 2HYIB 1GLDG 1VQ6S 2B9WA 4IEIA 3R5AA 3M9MB 2BJ8A 3KKRA 4DX6A 4WIQA 5J2NA 4ZVHA 5B0GA 3G82B 2XI3A 2RQ4A 5BREA 3P8BB 1X4DA 3M8ZA 5F8LA 3FLCO 3Q8PB 3VAFA 4ZIVA 2GCFA 4U7UK 4EIAA 3NCQA 4D3GA 4JI6J 4BC3A 1JLGB 4ED3A 3TU5A 1VS3A 3L8BA 3TP2A 1U8WA 3GJRB 2HVIA 3THXB 5FIIA 3D7SB 4U67Q 1UJ4A 3DRPA 1ZS6A 3MK6A 2W6LA 3BP8A 3O9QA 5RUBA 4TLRA 3DLEA 2HBLA 1LW2B 4K4UA 3V4IA 1XQSC 5EU7A 5J1NA 3SYZA 3FBFA 4R0JA 2W4DA 3IUCA 3G8TA 3TVYA 4L6V3 3QQCD 2ZOMA 5KFWA 1JJ4A 1JCGA 3CC7N 2OPPA 4DV1F 4TQRA 4LF5F 5CD4A 2R8JA 2G8KA 3W9JA 4CZEA 1KLMB 4CEQA 2GVZB 3MMBA 2HMPA 3R2CJ 1UL3A 3QZ8A 3AO2A 1CJKA 3Q24A 3DXKB 3ZX0A 5L1IA 2PMHA 2C2NA 3K9KA 3G9CA 3DYAA 1AUDA 4EAHD 4Q8EA 3BPDA 1BHNA 3T5LA 3PXGa 1OYDA 1FT8A 2QWRA 4I67A 2VD3A 2MQQA 3T69A 4E7KA 1ASVA 3VQSA 1IBMJ 1VQYA 4CK2A 3ITHA 1DHMA 4B3SF 4QIEA 4JUZA 4JI0F 3U1NA 2I2YA 1QQCA 3SXLA 3D2FB 2UV8G 5AQNA 2XO6A 3W8GA 1WHYA 2OSRA 3GFYA 3W3SA 2ZQBA 3IKMA 5HSPA 2PZSA 1MROA 3C2PA 2UVWA 3ZSOA 1H2TZ 4C7QA 4IJNA 1O1WA 1IKVB 1VHIA 1NK7A 3HRGA 4JKCA 1HNWK 3CMEN 2MZJA 4OJRA 3PW7A 2F4VJ 3ALYA 3FBEA 5K14A 1GTEA 3M8PB 4FF4A 4JB8B 5AZJB 4KKOB 1RA7A 3WNEA 1CULB 1RP5A 3VGVA 5FPDA 2CGLA 1TVRA 3KLEA 1VJWA 3LF0A 1HBOA 4CZGA 1RLCL 1R0BG 2PD1A 3KVGA 4KFBA 2FIUA 1D3WA 5EN1A 2O5DA 1S6UA 1FKOB 4FJKA 1KP6A 2HS3A 2IA0A 3Q8YA 4EO8A 3CWJA 5FDLA 1W7WA 1BWFO 3SUNA 3UDCA 4WFAL 1IKYA 4PXEA 2P5OA 2C2OB 4NX9A 2G0CA 3CIZA 5LL6d 1Q8IA 2XULA 4B17A 4RWTA 4BDYA 2EK1A 4A8MP 2YNFB 1FXDA 3HHLB 3CD0A 3MMJA 3CQYA 1Q8LA 4O3SA 4NXMJ 3DLBA 2YNIA 3VGLA 1R89A 5AQSA 3HSJA 1T05B 1WSHA 1WJ9A 4JKGA 1VQLS 1FXXA 2QA1A 4DR6K 4TU7A 3PACA 4B9QA 3CUNA 4HLBA 4OX7A 5F1XA 2KVQE 2V94A 3DI6A 2Z57B 2I9SA 1GFWB 3RW7A 1FJGK 2ZBPA 5AXNA 1D9FA 3MXIA 2JC1A 4M5KA 1XWLA 2UXBK 2A0FB 2UUBF 5AQHA 2HVDA 4AHVA 1RT7A 1IJFB 2P5VA 2AF6A 1NJIT 4ZLNA 4CFDA 2BKOA 2GMJA 2ACYA 4HL9A 2R8GA 4LFCF 4BRPA 1NCLA 1BUXA 1CJVB 4K0KK 1UETA 2XMMA 4JK9A 3TTCA 3OL7A 4PXCA 3HPHA 5LSRA 4Y1DA 3OR2A 5BYQA 4F4KA 1MU2B 1S1XA 1JB0C 3ZSZA 4GKJF 2PY5A 1TFYA 2G9OA 4KQZA 3LZJA 1NLKL 2CPDA 2D3UA 3W8PA 1Q9XA 4J7CA 2OP5A 1BDGA 2XO7A 1AW0A 3OTEA 3SMPA 5IT0A 4OZNA 3MM9B 5K8PA 2ATLA 2K1RB 4ZHRA 1H3DA 2CQCA 4PZVA 2UVRA 1Y3JA 1NGHA 1YAGA 1FF2A 3KMSA 3M32B 5IQ6A 2ASDA 2FQQB 1QQNA 4JEPA 2DNMA 2GMLA 2QFIA 5CA5A 4CD1A 4W5NA 4JLHA 4RW8B 2GO8A 4ZJLA 1BO5O 3AVFA 3J81O 2IJFA 1C2PA 3DM2A 2CJXB 3ZT2A 3D3BJ 4ECRA 4ED0A 1LW0A 5CE3A 4FCYA 5CZ1A 2YBVA 3VAKA 3FJ2A 5K20B 1ZOTA 4CJWA 1L3SA 3PYFA 3E51A 4UOCA 1SZ2A 2B6AB 2V51B 2BOPA 4FBUA 2MKJA 5IOLA 2NR0A 5M1KA 2EBGA 1RACB 3D0HE 2AIRB 1VQKN 4KB1A 1FWKA 3ZZUA 4DL2A 4HUFA 2XWXA 5C5JA 2OMOA 1S22A 4DHVA 1QAJA 5MLCV 4DHYA 3OYHA 1NSKL 4EHTA 1H7WA 4WE1A 2HGNA 3FRZA 3T1HK 4FVUA 4CH1A 2W40A 1ZBLA 3T5JA 4H54A 2VONA 4I6AA 3OYGA 1O6XA 2B5JA 4RUAA 3IFRA 4PR6A 3LL3A 5EX5A 1Q79A 3RBEA 1N6QB 4J9KA 4FN5A 4DLEA 1HNWJ 3UD4P 1E6VB 1VQMS 3NH1A 1JKHB 2Z2YB 4PYAA 2O8EB 4YDXA 1RWPB 2Z4PA 3M5RA 2J5AA 5LMUF 4CHPA 4OLOA 1VQ5S 5GIPA 1G15A 4CTAA 2C28A 2QXFA 1YJ9N 3ZSWA 2HHQA 3TO8A 3CT9A 2V8GA 3W3DA 3FFKB 1XN9A 4J91A 4ED7A 4BQZA 4ZPAA 2CZVC 3E3XA 3O5BA 3FCHA 3MOJB 3B4DA 5M2PA 4KHRA 4DL7A 4EO6A 3PTWA 4Q43A 1B9FA 4A46A 1CXQA 4OLBA 3EGZA 2E4LA 3C3LA 1K1SA 2Z1HA 1WC5A 3VGUA 2C3OA 4GKKF 3FEZA 4X66F 2AKWB 3LP0A 1H74A 2O3DA 1IBLF 3HFVA 1FRMA 4FF2A 3QT5A 5D6GA 3WNGA 1S10A 3MPUB 1LEOA 2W41A 2WZ1A 2DNZA 2P9SA 4LF6K 5E5NA 4BR5A 3R2DJ 2FJAB 5HVGA 2OPRB 3BF4A 2HQDA 4RKUC 4TXSA 4URQU 1S0NA 4DR6J 2HVZA 2V2VA 4DR3K 4E2FB 5DQGA 2O4GA 2M4MA 1FJGJ 3S9HA 2Z2LA 3LGNA 2P9IB 2UXBJ 4EI2A 2KJWA 2E20A 4JD2B 4MIBA 3OD2A 3LWLA 4TN2A 4CJ4A 2C2KB 2GHPA 2F9TA 2VQFF 5BR8K 3M9NB 2MQMA 5EDWA 1KNZA 4ETXA 3K17A 2A6AA 4K0KJ 3NEKA 1YTAA 1QE1B 2Z1GA 2QL7B 3L2UA 3R3TA 3H4DA 1VQPS 5FLXO 3C46A 4JI2K 2O8FB 4JAXA 4CZKA 4OYWA 5KFVA 3GE1A 3T9NA 2VDHA 5B8HA 2ASOA 1ATRA 3KKFA 3MM8A 1RKJA 1RBUA 3ISND 2H5EA 4AHCA 3GG1A 4GW6A 2JHEA 3I31A 3C8YA 2A6OA 1IQZA 5ETRA 2BJDA 4USKA 2FZKB 2DXFA 4H5RA 2BANA 2ZH7A 2GW8A 3H7HB 4OYXA 3J81U 4QYZK 2YNGB 4OO1J 3I0SA 3HOSA 5KFAA 2GWJA 2ZWPA 2BQ3A 2YHXA 3KZBA 3HL8A 2MQPA 3ONQA 2KT2A 1VQ7S 3MFIA 1ZBTA 4FOIA 3KHYA 3VHQA 3SI6A 3DRPB 2M2BA 3DLEB 3V4IB 5LY3A 1B4SA 5GAEI 4GY2B 4IFYA 2RNEA 3J8AA 2UU9K 2Q1NA 1XR7A 2FYXA 2OPPB 4LH5A 3BZKA 2HB5A 2AEFA 4XTTA 2HS0A 4GNIA 1HR0F 5LOQA 2OPSA 3MMBB 2XLJA 3QJPA 1SJFA 1XTZA 1QJHA 2QMUB 4BC5A 3VOVA 1S7HA 3UKUB 1JLFA 1R31A 2FD2A 1OKJA 4GVBA 2W7AA 2RRBA 4FLUA 5D0RA 2QA4N 3NDKA 4F04B 2LECA 2MY7A 2WONA 4F4ZA 3O9UA 3UFCX 4N7TA 3MD3A 3P31A 3HPOA 3ITHB 1HKAA 3NGYA 3DNCA 4DV0F 2QO3A 3VQ8A 3I32A 4IOAL 2ZVIA 4DS5A 3HVTA 2HNYB 3KWGA 4L73A 4RW4A 1MW7A 5K8OA 1MROB 5DJBA 3J7AN 8ATCB 3MPVA 1N34K 3OFHA 3I8BA 3O6WA 3DOKA 1N33K 1S59A 3HI9A 1P6TA 4B3TF 2HHWA 4IRDA 3LP1A 5K14B 1WWHA 2W9CB 2CH5A 4NZ7A 1C1CA 3POTA 1GMWD 3A5LC 2C3PA 4NLBA 2JVRA 1FJEB 1ASWA 4LF6J 3CJAA 1TVRB 3KLEB 3BSCA 2AWZA 3VQAA 4OZLA 3OA9A 1XJWB 3I8DA 1U24A 5U47A 1J27A 4KFBB 3M2VA 5EWFA 1Y10A 4F7VA 1RFQA 4DR3J 1CLFA 4FJHA 1ICEB 1RT4A 1N0UA 2HBYB 5B0EA 3FZFA 1WSRA 3DLLL 1WF0A 4QZVB 2KHCA 2FVQA 3LA0A 2YH0A 2K06A 3QWPA 1IKYB 5M1NA 1X4FA 1LNQA 4CZIA 2CPZA 5BR8J 1NXIA 4JI3K 4DTOA 2B7BB 3MDQA 1ZBHA 4RNMA 1O5JA 3I5BA 2YNIB 1TGOA 3JSMB 1M5VC 4JI2J 3VEOA 5M2RA 3LPYA 1KD1T 5B09A 4JKGB 1RE1B 3D6HB 3M6GA 4FS2A 4KB7A 1VC5A 5THWA 4N8OA 2DPNA 4F0MA 5IS2A 4CGDA 3AHPA 3CJ1A 2MLZA 3DI6B 1NZ8A 1AB8A 5F41A 3OBIA 4KGZB 4IEEA 1X5SA 1PC4A 3R5BA 1HJOA 2G0IA 2CNOB 3BM7A 1YJWS 1LWEA 2BE2A 3PIPL 5AJ3K 4QS7A 1H73A 4DV2F 4FO0A 1QVGR 1NOZA 2QI2A 2VQEK 3ISZA 4F3TA 2YCHA 4M42A 2MGZA 1QLNA 2HF3A 1FRKA 1S12A 3OLAA 2JSXA 1RTDB 4QYZJ 4DTJA 2V8DA 4PWWA 1WI8A 2WFBA 2RS2A 1BQMA 5ETLA 1FEEA 1NJXA 1S1XB 4X64K 3VVUA 4C8KA 1NJWA 1MWYA 4C8ZA 3PV8A 1OVYA 2HFOA 2R4FA 3OQ2A 4OZ2A 1OH6A 2Q3PA 1YGYA 3TOQA 1N5YA 2L9WA 4Y0WA 4KGXB 2VGMA 3HHLD 3D2EA 1ZBIA 4ZHRB 1O0PA 4ZP7A 4QWDA 2UU9J 4WFBL 3QZ7A 1JJHA 4IFEA 1VK0A 4O55A 3RAMA 4MJKA 4N47A 4ZPCA 3P83D 3TJ8A 4FNHA 5T41A 1SH2A 3IR5B 2E5LF 1KFDA 3QFPA 3MX2A 3DM2B 5DGBA 3HSZA 2YNHA 2RHKA 2BQUA 2HEKA 4KH6A 4C48A 4TU9A 3BKFA 1RAGB 4FJNA 4V1Ak 4ES2A 3W9HA 2VWJA 3O1WA 2KRBA 3QYYA 2HK2A 1AT1B 2XTJP 5KT6A 3DJCA 3MECA 1YT3A 4F02A 2FHJA 1V3RA 3FEYB 2PDAA 4NZ0A 2OAUA 2EK6A 2FBXA 2NZCA 2BW2A 3W63A 3HZ6A 4DQRA 4F4YA 7FD1A 2NUUG 2Z8QA 1L3TA 5HRPA 3T5HA 4Q7AA 5IT9Y 2NXNA 4W4MA 3JSYA 4KPCA 4OHVA 3TUJC 1M5KC 4KH4A 3NS7B 2E88A 1KN6A 1NJZA 4WE1B 1FRIA 4P9SA 3CCMN 4YEAA 4DCHA 3N4PA 4NOHA 1K8KB 2B5JB 5ETVA 1VSMA 1N34J 1S6OA 3I5CA 2B7CB 3MWBA 1N33J 3EE8A 4DR7F 3MFHA 4K43A 3KUGA 1R8PA 4CJEA 2PEBA 3JXUA 4DUZK 3CJ4A 2XMTA 2IRYA 2W9BA 4CTAB 4BDPA 3BY5A 1J5EK 1Q82T 5D78A 2QG9B 2AYGA 1BIUA 5KFMA 1RWWB 4QR2A 3ZTOA 1W2BR 3QFUA 3GJQB 3B78A 4DQIA 1NWKA 2CQPA 5HBMA 2BRKA 3DDKA 4TKTA 4OJ3A 1M5HA 2UXDF 2ZOGA 1YLXA 3BV8A 5KG4A 4HTUA 4JI4F 1KFSA 4JKFA 2YX6A 2KL8A 2RQCA 2P51A 2DB1A 2YQ1A 1XMOK 2ATQA 7AT1B 3CJ3A 2BDPA 2HHHK 1RTJA 4JI3J 4MFBB 1KQKA 3TA1A 1HI8A 3K0JA 4BRCA 4C0BA 2P9SB 4I2QB 2VG6B 2E7WA 3R7BB 1RQ0A 4MIWA 3MN9A 3E9PA 1EKSA 1QM9A 2RHQB 3VAJA 4LSLA 4LSZB 3V9XA 4MH8A 4E7LA 2AT1B 3C7NA 3SCKE 2R7TA 3CJQA 2H65B 1BA0A 4JI5K 4FWMA 5DRKA 3D4JA 1HWUA 3QT8A 2W24A 1J5OA 4PKHA 1YZ6A 4RX6A 4LH4A 2MKIA 2A42A 3CDUA 5AJ3J 2Z0GA 4K5RA 4CM2A 3PIOQ 1V4TA 4MK7A 2IMOA 3QRQA 1OPZA 3NF9A 3TR5A 3O9TA 1CZAN 3G0ZA 3MXJA 3D28A 2JFKA 4PYDA 3M30B 2LMIA 3N6LA 3CC7S 1JLCA 1V6HA 4Q8FA 4NLOA 4ZN1A 4DTPA 4X64J 1IKXA 2VOOA 3EL2A 1WG1A 4RU9A 1TKZA 1FO1A 3FSIA 3ID8A 1R8AA 4KGVB 3J7ZT 4U96A 1BWVA 1RWKB 2BYCA 2JL9A 2W7OA 5DG9A 4A8WA 1NOYA 4U9RA 5F0XA 1HBUB 5DQIA 3KK3A 1LK5A 4P72A 2BANB 4HVJA 4MQ3A 1RBOB 2F9JA 4MK9A 4NA2A 3I0SB 3FQKA 3FRYA 2AGQA 4HTIA 4FP9A 2G8UA 1C0TA 1EETA 1AUSL 3ZZYA 1C1AA 2RHSB 2VPZB 2YHBA 2OTJN 2EFGA 1W97L 1JCEA 4A59A 1M5PC 3R97A 1ZTWA 3J80Y 4NLXA 2W25A 1X5OA 2ITGA 3ZSQA 2WW8A 3P1GA 1L3UA 5HANA 4YB6A 1LOTB 5T14A 2GJ2A 2OPSB 2VFUA 3W9IA 2C3MA 2RDJA 4ZVGA 3PSIA 2CJBA 2FVCA 2DHSA 1IBCB 2E5HA 3H6EA 1TKDA 4ZK7M 3AO5A 3HM8A 4LF1A 1TU0B 1JLFB 5FLXY 3BPSP 4K8RA 1S6PA 1XEZA 3B8HA 1ZH5A 2G1HA 4DOZA 3W64A 4F0HA 4GV3A 4J5OA 4ID5A 1DY3A 2QC3A 3V81B 3I0RA 1OO0B 3BR8A 2WONB 1FDDA 3VEYA 2W42A 2CPFA 2I8EA 2IDLA 4AUKA 4DL3A 2BM0A 3AOAA 3TABA 3HZGA 1J5EJ 3P39A 3NMAA 5H1SV 4BLGA 2PYLA 1FNOA 4CJ3A 5JVGQ 4DPOA 1DAXA 1KDNA 2ASJA 5AE1A 2XLKA 3AJ2A 3HVTB 2SXLA 2CPEA 3D9BA 4RW4B 4RPFA 3K5NA 1R0AA 5AQIA 5HMWA 3MUTP 4LRCA 2DNPA 2ALYB 1L5UA 1UKUA 2FTRA 3EO3A 3BGUA 2CYYA 4HYKA 4JKBA 3EDRB 5F0WA 1XMOJ 5AXKA 3PHEA 2LQ8A 5C24A 3MM6A 3R7NB 3UKRA 5ETNA 4I1TA 3E9OA 4XEIA 3W7BA 3LOUA 4WF9Q 2XWYA 1KD1O 4PKGA 3OYJA 2KXFA 2ZNZA 2BW7A 3M2VB 3TQ1A 1PYSB 1NPPA 4RCHA 4KHUA 1W25A 1RT4B 4KREA 3SQ0A 4PKIA 5DZ6A 3D54A 4M3RA 1V4SA 3PX0A 3HBTA 3CCTA 3U1LA 4ILLA 3CXCR 2GX8A 4DQ8A 4MO5A 2FF3B 5ETKA 4P7VA 3CXCM 1BWEA 1Q16B 1VBZA 2WRMA 3NOCA 2HFVA 3ZZZA 2DGOA 3NVMA 3GIJA 1NK6A 1RWVB 3PO4A 3UDLA 3OVSA 3GV8B 3KOAA 3C94A 5EXWA 3BR9A 3PDNA 3N5BA 4UZCA 3BSNA 1D9AA 1FXLA 5KQ8A 3QEXA 2COLA 3SAHA 3CNQP 3PYDA 4BC9A 2JWNA 4JI7F 4FLYA 4N5SA 4JI1F 4E7IA 1EP4A 3PW5A 2NYIA 2Y8WA 2CPXA 4BRGA 1UCNA 4HUEA 4I2PB 4B8AB 4ZP6A 1DT9A 5DLFA 1LWE