1RCHA

Solution nmr structure of ribonuclease hi from escherichia coli, 8 structures
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endonuclease
molecule keywords RIBONUCLEASE HI
publication title Solution Structure of Ribonuclease Hi from Escherichia Coli
pubmed rcsb
total genus 35
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1995-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rchA00
3NFAA 1HJRA 3OYCA 1WAJA 3KKRA 3B6PA 2KZMA 1CXQA 3M8SA 3M8RA 3VQ5A 5E41A 4NCAA 3RMDA 1EETA 4OGEA 3LWMA 2XY8A 3S9HA 2ITGA 3DLKA 4OJRA 3DMJA 4FW1A 3O3GA 4AHVA 1BIUA 4W5QA 3H08A 3HPGA 4CF8A 2FBTA 3RMBA 4Z4IA 3KD1E 3K5LA 2NUBA 4MFBA 3ALYA 4H4MA 3OYNA 4E7JA 4FJMA 3VA0A 4ELTA 5I42A 4KPYA 3QIPA 4CJWA 4HUGA 4L8RB 4B9VA 4Z4EA 4KB0A 4LH4A 4PUOA 4J2EA 1IKVA 3LZIA 2RF2A 2YHAA 5C25A 3SQ1A 1TKDA 1NK6A 2OYQA 1BHLA 3OVNA 3ZCMA 3K58A 1QSYA 1ZBIA 3D0PA 1BCMA 5KGWA 3VQ8A 5HRNA 3SNNA 2HHXA 3AVJA 1S5JA 1WSGA 2ETJA 5DK5A 4OPJA 1C0MA 3QEWA 4DU3A 3UIQA 3V1RA 4CGDA 5I3UA 4BDZA 1Q8IA 1Y97A 3V9SA 3HJFA 3NBPA 1TGOA 1JXEA 1BL3A 4BWMA 3KLEA 5KTQA 4CFAA 1WSEA 2LSNA 4CJSA 3V1QA 3AVBA 4W5RA 1HYSA 3KLGA 4KHSA 1GOCA 4FJ8A 3P1GA 4TSXA 4HTUA 5JS1A 4DTOA 3VQPA 4N76A 1BI4B 3TR8A 2HHVA 4I2PA 3LANA 4CHNA 1KCFA 1UA0A 5C24A 3KK2A 2OPPA 3DLGA 4LD0A 4B8AB 4F3OA 4OLBA 3RRGA 2YNFA 4CJTA 4F3TA 4J2AA 4NYFA 4CJVA 4BDPA 3HSTB 1B9FA 1ITGA 4CEFA 3AVMA 1GOAA 1S9GA 4I7FA 1L3VA 5J2MA 2G8UA 1J54A 1KTQA 1VSFA 4FM2A 3PO4A 1XI1A 3OYGA 3PV8A 4KREA 4FJNA 1Q9YA 4M41A 2E6MA 5DMRA 3LDSA 3SZ2A 4AHSA 1RDBA 5HP1A 1RDDA 5HRSA 2X6SA 4E7IA 3B6OA 5CYQA 3OYHA 1VSEA 1U45A 4DSLA 2Z1GA 1XHXA 1VSKA 1TV6A 4M3XA 1JLQA 4CK1A 2JLEA 3P83D 3SUNA 3RR7A 4B08A 1JLCA 4DQQA 4IFVA 4OKEA 4M42A 4FJLA 1VSLA 4RW9A 1RCHA 3V4IA 3ZSWA 3CFRA 3LAKA 1RTIA 3P5JA 4CF2A 3AVKA 3M8PA 3NF8A 1KVAA 3TAPA 3LP3A 3ISNC 1JLAA 3AV9A 4FJHA 3PX4A 1QTMA 5HRRA 3TI0A 3OY9A 4LSNA 4R5PA 2G8KA 4CEAA 1EXQA 4DU4A 3TAQA 3V1OA 1I39A 1KFDA 3RMAA 1TK8A 4CJUA 3BDPA 5FRNA 3U6FA 1U4BA 3CM5A 1FXXA 3AVHA 1NK8A 1JLGA 2HHQA 3LP2A 4FJGA 4K8ZA 3OYJA 3C94A 3VQ6A 1ZYQA 3L2WA 3KIOA 3SQ0A 2B6AA 4M3RA 1KVBA 2HMIA 3VQAA 1LWFA 4BE0A 3ZSRA 4HVJA 3QETA 3DM2A 3QEVA 1CZBA 5JS2A 4NCBA 3AO4A 3PUFA 3EZ5A 3K5MA 1SKWA 2VG7A 3CFOA 3HVTA 4CECA 4BACA 2XRIA 4CK3A 3AA3A 3A2FA 4CJPA 4DTUA 1KFSA 3QNOA 4J2DA 1WSFA 4QAGA 4WE1A 1NJZA 4CEBA 2BE2A 4E19A 1C6VA 2G8VA 3M8QA 4CEQA 4QOZB 3V9ZA 3I8DA 3G10A 2VWJA 3L2UA 3SPYA 3OJSA 1HNIA 1ZBUA 1RBRA 4KHUA 3QERA 4OKJA 5C42A 1X9WA 4GMJB 1RTHA 4FVMA 2HHTA 1ASWA 2KFZA 3AA4A 3QLHA 3OYEA 4DSKA 4F8RA 2P1JA 4HCBA 3K59A 4FLZA 4HUFA 1ASVA 3AA2A 3SI6A 4C8OA 4B9NA 3HO1A 3MXMA 3AVGA 3ZSQA 4M3WA 1XC9A 2WONA 3DYAA 4JS4A 3KLHA 3CQ8A 1RBVA 2Z1JA 4O5BA 3U3YA 3VN5A 1QSSA 3AO1A 4DFJA 3O3FA 1RT2A 3MEEA 1TK5A 4OPKA 4KB1A 2BGGA 4FJ9A 1NK4A 1KVCA 4N47A 4DS5A 4DTPA 1HNVA 4KI4A 4I9QA 5HBMA 4JS5A 1S1WA 4Z4GA 4FXDA 4Q0BA 2X6NA 1IKXA 1ASUA 1B9DA 1S6QA 3RR8A 2WOMA 3ZT1A 4DLGA 3PX6A 2B5JA 4FW2A 4C8KA 4KHNA 2FC0A 1F21A 3IS9A 3LP0A 4ZTJA 1VRTA 3TAEA 5K14A 2A1SA 2E6LA 4XIUA 2FBYA 2HNDA 2YNHA 4C8MA 1W0HA 2YNIA 2A1RA 3THVA 4W5NA 2Y1JA 4FLVA 1QS4A 1UWBA 3LALA 2VG6A 3QINA 2RN2A 1S1XA 3NH1A 3HPOA 1Z25A 4CCHA 3NH2A 3L3VA 3AO2A 2KQ2A 3NGYA 1X9MA 2ZD1A 4HHTA 5KRTA 2RKIA 2HNYA 1JL2A 2OPRA 1HRHA 1C1CA 1NJYA 5HLFA 4ELUA 4E0DA 3CYMA 4CJKA 1U04A 2QK9A 2Z1IA 3AVFA 4OVLA 4CGGA 3KK1A 3G0ZA 4FZYA 2DY4A 4CERA 4FCYA 2OPSA 3TWHA 1IG9A 2AJQA 4LY7A 3NF7A 3NDKA 1VRUA 3MAQA 4DQIA 1HYVA 3V81A 2Z1HA 3VQEA 3SPZA 1NOZA 1C0UA 1RT7A 1VSJA 4EZ6A 5J2PA 2DTUA 3DRRA 4LSLA 4AHUA 4H4OA 4IBNA 2OZMA 4CGJA 2QKBA 4N56A 2BDPA 3IAYA 4GW6A 1XWLA 4JRQA 1J53A 3T19A 2KW4A 4PY5A 4CHPA 2ATQA 4DF4A 1B92A 1JLEA 2IC3A 4FLYA 1KSPA 2D0BA 4FLXA 4AILC 2KTQA 3MEGA 3AVLA 4YFUA 4CJ3A 4FYDA 4HCCA 1WSIA 4CFBA 1QHTA 3CFPA 1WNSA 3ULDA 4FK0A 1D5AA 3AO5A 4I9LA 3AO3A 1BCOA 1GOBA 3SQ4A 3T3FA 3VQDA 3O4NA 1C1BA 3WNEA 1T8EA 4QCLA 1DTQA 1S9EA 3K5OA 3DRSA 2RPIA 3ASMA 3AVAA 2FBXA 4BDYA 2IGIA 4H8KA 1G15A 3CM6A 4CF0A 4CFDA 1N5YA 4EP4A 1RT1A 4KHWA 4B8CA 1U47A 1SV5A 4O55A 1REVA 5CY4A 2P51A 4O0JA 1HPZA 4KO0A 4DTMA 2YV0X 4N5SA 4DFPA 3EY1A 4NCGA 4EZ9A 4FK4A 1DTTA 1RT5A 2HNZA 1TKTA 1SKRA 3NAEA 1YTAA 3HK2A 3C95A 1NK9A 4E1MA 4M3UA 4DQSA 5HRPA 2X74A 1WLJA 4B9UA 3K5NA 3WNGA 1NK7A 2OPQA 3QEIA 3KLFA 3I0RA 4Y1CA 1J5OA 4DSJA 3NCIA 4PWDA 3KD5E 4CHOA 1JKHA 3S3MA 1KRPA 3V9UA 2HVIA 1IH7A 1RT4A 3ZSXA 3V9WA 4DQRA 1QSLA 4DG1A 2W42A 4FJIA 1TAQA 1Z26A 3OS2A 1CZ9A 4CJ4A 4CEOA 3LZJA 3OS0A 4W5TA 3TAMA 4CF9A 1L3SA 2R7YA 4MQ3A 1S6PA 3ZSOA 5KI6A 4CFCA 1BIZA 4NYNA 1SL1A 1DLOA 4IDKA 3ZSZA 5T7BA 1J9AA 1LWEA 1WSJA 4AH9A 3OYIA 4E7LA 5D3GA 2HHWA 3OYAA 2IAJA 3SCXA 1IKYA 4KTWA 3WNHA 5J1EA 3PO5A 3SV4A 4CIFA 3AVCA 3K2PA 3SJJA 3RWUA 3JYTA 1NKCA 2HVHA 1BI4A 4CHYA 1BGXT 1YT3A 1YTUA 1SUQA 1RILA 3JSMA 2OZSA 4CHQA 3AVNA 1L3TA 1L5UA 2VG5A 2XHBA 3SUOA 1RT6A 4CGFA 3V6DA 1RTJA 1WSHA 2BANA 3RTVA 1NKEA 4BE2A 2EX3A 1D9FA 4B9LA 1JLFA 2QXFA 5CZ2A 2IDOA 1TVRA 4J2BA 4KHQA 1BQNA 4ID5A 3SV3A 4KTQA 3OYMA 2B4JA 3NF9A 4E7KA 3DLBA 1TL3A 1LW2A 3EYZA 3QNNA 3KLIA 1D9DA 2KZZA 1MU2A 2F96A 3CG7A 4Z4CA 1SL0A 1LW0A 3DLEA 1HMVA 2P5OA 1RDCA 3NE6A 4FLUA 1RTDA 4DFKA 1SL2A 4OLAA 3L3UA 4B9TA 3FFIA 2XY6A 1NKBA 1EKEA 1TKXA 1RNHA 4KAZA 4FJXA 4LH5A 4UQGA 4DTNA 3OYBA 1O1WA 4DFMA 4FM0A 4DTSA 1RBTA 3F73A 4KFBA 4HUEA 2VWKA 4DS4A 4RW6A 1NJWA 4CEDA 1NK0A 3HPHA 3K57A 1IKWA 3MXJA 2JGUA 4Z4FA 4B3OA 5CZ1A 1KLNA 3OYLA 3MEDA 3OS1A 3QESA 3SQ2A 3KTQA 1CLQA 1ZBHA 4CJLA 1VSIA 1JL1A 4IG0A 4KKOA 4CJQA 4CIGA 5SWMA 4DTXA 3OYKA 1Q9XA 4PA1A 4C8LA 4CIEA 1T7PA 1QE1A 1FK9A 3VQQA 2YHBA 3ZT3A 2G8WA 4FJ7A 4RG8A 1T03A 3VQCA 2G8HA 2D5RA 3HP6A 4CEZA 5FROA 3D45A 4I2QA 2XY7A 4ZTFA 2G8FA 2ZE2A 1KLMA 4E3SA 4DQPA 4AHRA 5HROA 4B9MA 1A5WA 1VSHA 1RT3A 4DU1A 1X9SA 5J2NA 3U3GA 1R0AA 4CJEA 3DOKA 4CJRA 4O4GA 1A5XA 3AA5X 4CEEA 4DMNA 4E1NA 3NHGA 3ZSYA 1UA1A 2X78A 3L8BA 1VSMA 2D0AA 3OYDA 2DFEA 4F4KA 3HT3A 1T05A 3AVIA 4ELVA 1U49A 2YKNA 4JLHA 3RRHA 1TL1A 2HHSA 3KJVA 3QEXA 4AHCA 1QQCA 2YNGA 1BQMA 1W9HA 1JXBA 2ZQBA 3I0SA 3LWLA 4O44A 3S3NA 2OA8A 1C0TA 4C8NA 2DFFA 4G1QA 4F2SA 4CESA 3DLRA 4Y1DA 5KGXA 3LAMA 4CJ5A 4CK2A 2Y1IA 4FLWA 1CXUA 1XHZA 3O4QA 1NK5A 2PYJA 1LAVA 5SZTA 4Q5VA 5EU7A 3HYFA 1S1UA 4BE1A 4Z0UA 2XY5A 1L3UA 1S1TA 2IOCA 1WN7A 3HL8A 4B9SA 4GVMA 1BISA 1EX4A 1C1AA 3RMCA 4W5OA 3VQ7A 3VQBA 4OGCA 3O3HA 4FZZA 1TKZA 4CF1A 4KRFA 1LAWA 4FLTA 4K8XA 3HXMA 3L2QA 1SKSA 1ZBFA 3IRXA 4RW4A 2F8SA 4DLEA 2GUIA 2PY5A 3KKSA 4E89A 4M45A 3VQ4A 1JLBA 4IFYA 1RDAA 1UOCA 2Q3SA 4O0IA 4IKFA 1NOYA 1RBSA 3LP1A 3QIOA 4M3YA 1U48A 1K6YA 1A5VA 4FJ5A 3PY8A 3ZT4A 3MECA 3L2RA 5FDLA 3LPTA 3SYZA 4M3ZA 4RW7A 4CHZA 4JRPA 3DI6A 3V9XA 3E01A 1FKOA 4CGHA 4E7HA 4FJKA 3TAGA 2XO7A 2PYLA 2QKKA 3NGIA 4DTRA 2FBVA 4ICLA 1TAUA 2O4GA 4N41A 2G8IA 1EP4A 1HQUA 5CYMA 4DTJA 3KK3A 3DOLA 1NJXA 2P5GA 4CJFA 3LPUA 4EP5A 4F2RA 4FK2A 2HB5A 2IS3A 1YVUA 3SUPA 3QEPA 3TARA 3HVRA 1RBUA 2EHGA 3C6UA 3ZT2A 3L2VA 3PX0A 5FRMA 1TK0A 3TABA 2KFNA 5KRSA 1WAFA 4DSIA 4KHYA 4PQUA 4RW8A 3C6TA 1LWCA 1VK0A 4CGIA 3OJUA 1HYZA 3HM9A 3SUQA 4DWIA 2O4IA 2DFHA 1X1PA 3QO9A 4FJJA 1S1VA 3WNFA 2HHUA 2D0CA 2F8TA 1D8YA 3DLHA 1FKPA 3MXIA 1LV5A 2I5JA 3T1AA 1IO2A 4KI6A 4FZXC 2HW3A 2GV9A 4IG3A 3TAFA 4OKKA 1UAXA 3BGRA 3S3OA 5J2QA 4DF8A 2PZSA 4ID1A 4DSEA 1VSDA 4DSFA 3VA3A 4KV8A 2YKMA 3IG1A 4M3TA 3NH0A 4YNQA 4CE9A 1ZBLA 3HP9A 4BWJA 3ZT0A 4Z4HA 3NGZA 4AHTA 1N6QA 4KTZA 1HQEA 2E4LA 3VQ9A 3ZSVA 4FM1A 3DRPA 3F9KA 3NF6A 2GBZA 3TANA 3OYFA 4ZHRA 1I3AA 3ITHA
chains in the Genus database with same CATH superfamily
3EKUA 4YY3K 1HJRA 1KD1O 1WAJA 3KKRA 3B6PA 1VQ6N 3RMDA 3D2FB 3S9HA 5AQMA 3O3GA 2QI2A 1XNQK 4FW1A 5A2QO 4W5QA 1M90O 2FBTA 3CXCM 3K5LA 1HR0K 3OYNA 4H4MA 1GLEG 3ENHA 5I42A 2OANA 1IKVA 3LZIA 2RF2A 2ZF5O 4H0PA 4A5AA 4IJNA 2OYQA 3OVNA 1QQOA 3K58A 5KQ8A 1NGIA 3SBTA 5KGWA 3VEXA 3SNNA 3AVJA 4MDBA 3Q7BA 3QEWA 1HLUA 4H5WA 3P38A 1XC3A 1Q8IA 3V9SA 4BWMA 3DLLL 3EO3A 3IUCA 5AJ3K 1VQMN 4CJSA 4W5RA 3KLGA 3SBGA 4FJ8A 3P1GA 2HHVA 1BI4B 3TR8A 2HF4A 2E2NA 1UA0A 5C24A 1NGBA 4BRFA 4DQ8A 4LD0A 3PLAA 4CJTA 2FF3B 4ILGB 4BDPA 3O1WA 4MLHA 2I7NA 1VSFA 4KREA 3CCSN 4M41A 2E6MA 3LDSA 3SZ2A 5HP1A 5JVHL 3UKRA 1RDDA 2YJFA 3ENBA 3C7NB 4WFAL 4A59A 3OYHA 1U45A 4DSLA 5FPNA 3MK6A 3ZEUA 4V19S 3NVKA 5LL6Z 2JLEA 3SUNA 4OKEA 4BRIA 2KHOA 3ZETB 1RCHA 3V4IA 2V52B 4FWOA 3P5JA 3D2EB 4RWTA 3AVKA 3M8PA 4BREA 5EX5A 3AV9A 1VQ8N 1OH5A 4BY9C 5HRRA 3TI0A 4BGAA 4R5PA 1I39A 3RMAA 5FRNA 1FXXA 3LP2A 2RE2A 4WCEL 1ZYQA 3VQAA 3THWA 1LWFA 3CCJN 3QETA 2V51B 2NRRA 3PUFA 3H3OB 3MN6A 3K5MA 2VG7A 1KFSA 4BC3A 5FPDA 1HNXK 1WSFA 4QAGA 1EWQA 4CEBA 2G8VA 1C6VA 3I8DA 3G10A 3DXKA 2NZTA 1ZBUA 1C0GA 4GNIA 1X9WA 4JI6K 4GMJB 4DV4K 5EOYA 4FO0A 3QLHA 2EWSA 3OYEA 4F8RA 2P1JA 2WTUA 4FLZA 3AA2A 4H5NA 2UU9K 4BC2A 4FVUA 3KLHA 1RFQA 1RBVA 3QFPA 3AO1A 3O3FA 3MEEA 4OPKA 3CQXA 1MDUB 5FPEA 4FJ9A 1NK4A 5AQZA 4DTPA 4KI4A 1HNVA 1V4SA 3VEOA 3A5MC 1S1WA 5C10A 3CC2N 3BEXA 2X6NA 1NNEA 3OHRA 2WOMA 4DLGA 1N33K 1T6DA 4FW2A 3PX6A 2YX6A 3HSCA 4B1ZA 1ATNA 4ZTJA 1X3NA 1VRTA 3TAEA 4XIUA 2FBYA 2YNHA 2P9KA 2IIRA 1QS4A 3BF3A 2VG6A 2UUAK 3H45C 2RN2A 4CCHA 1X9MA 4G9ZA 3G25A 5KRTA 4EIAA 1JL2A 2OPRA 5AZIA 1HKCA 1HX1A 4ELUA 3CYMA 4OVLA 1FJGK 3TWHA 2AJQA 3NF7A 5IWAK 1VRUA 2QXLA 2Z1HA 3KWGA 5DM6L 5M1QA 1GLBG 1C0UA 1VSJA 2YI1A 3N4QA 4WQ5A 4H4OA 4K25A 4CGJA 3WUHA 2QKBA 4N56A 2BDPA 3IAYA 1P8ZA 4IXCA 4MDAA 1VQNN 3MDQA 1G99A 5AQQA 4CHPA 2ATQA 4DF4A 1ZXOA 1NMDA 2D0BA 4FLXA 1VQ7N 1KSPA 4YFUA 2GUPA 4CJ3A 3SAGA 3D7EO 2O8CA 5GAEP 3CMAN 1YI2N 3O4NA 4H0VB 3WNEA 4QCLA 4JI3K 1DTQA 3CCMN 2NRZA 1GLAG 3DRSA 3AVAA 1NG9A 2IGIA 2NRXA 4H8KA 3PSFA 4CFDA 4EP4A 4BVPA 2NRHA 1U47A 3D2FA 1REVA 4O55A 3A5NC 4O0JA 4DFPA 4KO0A 4B3TK 4FK4A 4KH6A 4N5SA 1MWMA 3EY1A 1DTTA 1RT5A 2QWPA 1X3MA 1SKRA 5EY4A 1YTAA 5BR9A 1NK9A 2FSNA 2ZJPL 3K5NA 3EKSA 5AQOA 1NK7A 3QEIA 3KLFA 5GIPA 3NCIA 1JKHA 2HVIA 1WBBA 4MLEA 3V9WA 4FJIA 2PAVA 4DG1A 2W42A 2GEMA 1CZ9A 1NGHA 4Z94A 3LZJA 2OTJN 3MN7A 2R7YA 3ZSOA 5AQYA 4CBUA 3WXMB 3HI0A 1J9AA 1LWEA 4JKDA 4AH9A 3SV4A 4CIFA 3ATVA 3EE9A 3K2PA 3RWUA 2HVHA 1BI4A 1NGAA 4QS9A 3R3LA 3O9TA 4BG8A 3KWIA 2VG5A 1K8KA 2XHBA 4CGFA 1RTJA 1WSHA 1NKEA 4BE2A 1TVRA 2WUSA 4WQ4A 2P9PA 4J2BA 3J81O 3OYMA 2A3ZA 4E7KA 3DLBA 1HNZK 4JI4K 1MU2A 4Z4CA 1SL0A 1WOQA 5M1FA 1HMVA 3C7NA 2CGLA 4DFKA 3U4LA 3FFIA 3ZX0A 3H46O 4LH5A 4DTNA 3OYBA 3Q7CA 3F73A 1RDUA 2D0PA 4CEDA 5EVZA 2A6AA 2HHHK 3ZETA 1IKWA 2JGUA 3OBYA 3OW2M 3D2EA 3GDQA 1KLNA 3SQ2A 3QESA 5GAHP 2O8BB 4CJLA 1JL1A 4C8LA 1SZ2A 2CGKA 1C0FA 1FK9A 3VQQA 2YHBA 2G8WA 2VQFK 2Q2RA 4CBWA 2A42A 5J2NA 1BWFO 1NGGA 4CJEA 3DOKA 1R0AA 4O4GA 4DMNA 3KZBA 4XEIA 2X78A 1VSMA 4CZMA 2DFEA 2YHXA 1T05A 1U49A 2HOEA 2HHSA 3KJVA 1DGKN 4FSVA 2GWJA 1BQMA 5B8HA 2OA8A 3S3NA 4C8NA 5E26A 4JK7A 4Y1DA 3LAMA 1CXUA 1NK5A 3O4QA 4NXNK 4M7YA 1LAVA 3CCRN 3GL1A 4Q5VA 3BF1A 5ELZA 2XY5A 2UXCK 3TSQA 4O8UA 1WN7A 1YUWA 2Q97A 4C1NK 1NGDA 5AQTA 1LAWA 3VF6A 4A57A 4K8XA 2CH6A 4DLEA 4DR5K 3CQYA 3WXLA 4M45A 1JLBA 1RDAA 4IKFA 4O0IA 1NOYA 4YHHK 3O6WA 4M3YA 1VAZA 3PY8A 3ZT4A 1Z6RA 3LPTA 3SYZA 1N34K 2O8EB 3DI6A 3E01A 4CGHA 2PYLA 4DTRA 2FBVA 2O4GA 2QEXN 5CYMA 3DOLA 3KHYA 3LPUA 4OPHA 4F2RA 4FK2A 4E1JA 3J80O 1RBUA 5FRMA 1TK0A 3FLCO 4DSIA 3CCVN 2QWLA 4A2AA 4KHYA 1LWCA 3OJUA 2P9LB 2DFHA 4FJJA 4B9QA 3K0SA 3DLHA 2VGMA 3CMEN 3AAQA 3MXIA 2I5JA 4KI6A 4FZXC 3O08A 3FFKB 4OKKA 1UAXA 3BUZB 4KV8A 2YKMA 1QZ5A 1J6ZA 4UY8O 4BR2A 2E4LA 3ZSVA 3WT0A 4ZHRA 1I3AA 3ITHA 5H1SQ 3R1XA 4FWKA 2Q0RA 1CXQA 3M8SA 5M1KA 5E41A 4NCAA 3LWMA 4OGEA 2XY8A 2ITGA 3DLKA 1KXPA 3HPGA 3RMBA 4Z4IA 3O9RA 3P31A 4ELTA 4CBXA 3QIPA 4Z4EA 4PUOA 1Q82O 1NK6A 3L4IA 3EL2A 3SQ1A 1TKDA 1BHLA 3ZCMA 2NLXA 5GINA 4EHUA 1BCMA 4IDHA 5HRNA 2ETJA 5DK5A 4OPJA 4DU3A 5AQXA 1YJ9N 4BDZA 3HJFA 3NBPA 1JXEA 3KLEA 3V1QA 1HYSA 4KHSA 1GOCA 4DTOA 3LANA 3G6EN 4B8AB 4K42A 2Q0UA 4OLBA 4GVEA 4DV7K 4J2AA 3AGKA 4CEFA 4I7FA 2G8UA 5J2MA 1BA0A 2E2OA 1TUUA 4LF8K 1RDBA 5HRSA 2X6SA 1HKBA 3EEQA 3F2KA 5CYQA 4E7IA 4KBOA 4JKGB 4CZEA 1P90A 3CJ1A 2Z1GA 1VSKA 1TV6A 4IEEA 1QVFM 1IBKK 4GY2B 2PBDA 2ZM6K 4B08A 1JLCA 4FWRA 1WBDA 3MWTA 2HBJA 5AZJB 4CF2A 1KVAA 3TAPA 1JLAA 4FJHA 1QTMA 3FZLA 3CC4N 2G8KA 2ZGZA 4H0OA 4BR7A 1IG8A 4DU4A 3HRGA 1KFDA 1TK8A 5C15A 3F5TA 1U4BA 1JLGA 2BH1A 3VEWA 2O8BA 4XH1A 3L2WA 1KVBA 3CF5L 2HMIA 3J7AP 4WQ5C 3SJHA 3MWPA 4NLBA 4NCBA 3EZ5A 1SKWA 1Q18A 3E9OA 3CFOA 3AA3A 1VQPN 4J2DA 3FR0A 4CEQA 4QOZB 4C23A 3E1YA 2Q36A 3A8YA 1OH7A 3QERA 2FSJA 4OKJA 3TTFA 2VGNA 1RTHA 3SMSA 1ASWA 2UXBK 3AA4A 2CGJA 2ZGYA 4HCBA 4HUFA 4JK8A 1JCGA 4B9NA 3HO1A 3AVGA 4DV2K 1XC9A 2QWQA 4JS4A 3CQ8A 1BO5O 2Z1JA 4O5BA 4A62A 1QSSA 3MX5A 1RT2A 3CERA 4KB1A 3L0QA 2BGGA 3I56N 1KVCA 4N47A 4I9QA 5HBMA 4JS5A 4FXDA 1B9DA 3VGMA 4FL9A 3ZT1A 5AQJA 5KQDA 3QBXA 4C8KA 3WXJA 3HTVA 2FC0A 1F21A 3LP0A 5C0YA 3RSEB 5K14A 2A1SA 2HNDA 2YNIA 3THVA 5F2RA 2Y1JA 4FLVA 1UWBA 2FF6A 2O8EA 3CC7N 1S1XA 1XMOK 3NH2A 3AO2A 2QWOA 2ZD1A 2W40A 4YDUA 2RKIA 3VERA 4E0DA 1U04A 2QK9A 4CGGA 3G0ZA 4A61A 4FZYA 4CERA 2J4RA 2VWBA 4FWSA 3FE1A 3NDKA 5HOOA 1HYVA 3SPZA 3DAWA 4WQ4C 1GLDG 4DV3K 2P9LA 1ILYA 4EZ6A 4AF1A 3DRRA 3E9PA 4AHUA 1NMNA 3FGUA 4GW6A 1J53A 2KW4A 4PY5A 3UE5A 2W41A 4BROA 4AILC 3MEGA 3AVLA 4FYDA 4YOYA 1LOTB 3WXIA 1V4TA 3VEZA 1WSIA 4X66K 4CFBA 1QHTA 3ULDA 4FK0A 4I9LA 4B3RK 2F9TA 1GOBA 4X64K 4KHPK 1C1BA 3KK7A 3TPQA 1VQ4N 1NLVA 1OVQA 3K5OA 3E66A 2RPIA 4BDYA 4CF0A 4CZJA 5JMVA 1N5YA 4KHWA 1SV5A 4DTMA 4H0TB 2JWKA 1TKTA 1DKGD 3C95A 3C6AA 5LJVA 3DXMB 4B9UA 3WNGA 5TKYA 5LJWA 4AM6A 1VQ5N 4BR0A 4CHOA 3S3MA 1KRPA 4JI5K 1IH7A 3ZSXA 1QSLA 3VEVA 4LF6K 3O8MA 3QBWA 2PFUA 3O4WA 3TAMA 1L3SA 4RCHA 1BIZA 1YITN 4FWLA 3ZSZA 1SAZA 3OYAA 3PO5A 2QWRA 1YJNN 1SUQA 5JICA 4CHQA 1L3TA 3V6DA 4B9LA 1D9FA 3AARA 5CZ2A 4BRKA 1I94K 3O9SA 4PKGA 2FXUA 3NF9A 4CZLA 3R9PA 4F9OA 4B3SK 3WEEA 2P5OA 1LW0A 3DLEA 3QFUA 1KQSM 3U8XA 4JKGA 4A5BA 3CD6N 4FWPA 2XY6A 4CD3A 1EKEA 1RNHA 4FJXA 3D6RA 4FM0A 3BP8A 3LDLA 2VWKA 1NJWA 3H1QA 1NK0A 3K57A 5AQHA 3MEDA 3KTQA 1ZBHA 4CIGA 5SWMA 4RG8A 4DR3K 2D5RA 4CEZA 3L6QA 4I2QA 2G8FA 2ZE2A 3W0LA 4AHRA 1A5WA 4BRQA 1A5XA 3AA5X 3NHGA 3ZSYA 1K8AO 3OYDA 4F4KA 3RRHA 3QEXA 4AHCA 4JN4A 2HF3A 1VQLN 2A40A 4BRNA 3SMPA 2DFFA 3DLRA 3VGLA 2Y1IA 4FLWA 4JKEA 2PYJA 4BRDA 3HYFA 1S1UA 2P9NB 4B9SA 3HL8A 1YIJN 1EX4A 4LC9B 1C1AA 3RMCA 4W5OA 4GKJK 3VQ7A 4OGCA 2E20A 2DPNA 2YHWA 4FLTA 1ZBFA 3VQ4A 4IFYA 3IKMA 1UOCA 2WFBA 1RBSA 3LP1A 2NRVA 4IO8A 4MO5A 1A5VA 3L2RA 4HTLA 2HBKA 4CHZA 4JRPA 4E7HA 2E2PA 2XO7A 1H1VA 3AY9A 1Y64A 2P5GA 3RSEA 5LMNK 4EP5A 1N8RO 3CJ7A 3TARA 1YVUA 3QEPA 4LFAK 3ZT2A 3PX0A 3TABA 2KFNA 5KRSA 4RW8A 3C6TA 4CGIA 3HM9A 1HYZA 4DWIA 2HMPA 1X1PA 3QO9A 1S1VA 2D0CA 3QICA 1D8YA 1X9JA 2AP1A 3T1AA 1NGJA 2HW3A 3TAFA 2W6LA 3S3OA 3TU5A 4B1UB 2PZSA 3W3DA 4DSEA 4U67L 4NXMK 4JAXA 4JK9A 3IG1A 4WFNL 4CE9A 1ZBLA 4I6MB 3HP9A 2GBZA 3ZYYX 4IOXA 2O4IA 3VPZA 2FSKA 3OYCA 2Q31A 1YF5L 2KZMA 3M8RA 3VQ5A 5AQVA 1S72N 1EETA 4DR4K 4JEPA 3DMJA 1BIUA 3H08A 4CF8A 5JVGL 3KD1E 2HBMA 5AQFA 3ALYA 4EHTA 3VA0A 2V7ZA 4CJWA 4HUGA 3HBTA 1KAYA 4Y0WA 3OTOK 3VEYA 4IO9L 3O80A 3HOSA 1QSYA 1ZBIA 3H6EA 4FWQA 1WSGA 3ENOA 1C0MA 3DXMA 5MLCQ 3UIQA 4CGDA 4CZHA 4JKFA 1T44A 3CIPA 1NM1A 3C6HA 1TGOA 4AM7A 5KTQA 4RTFD 1WSEA 2LSNA 3AVBA 4HTUA 4TSXA 5JS1A 3JXUA 3VF2A 3LDQA 3VQPA 4I2PA 3ULEB 1KCFA 3DLGA 1VQKN 3RRGA 2QWMA 3HSTB 1ITGA 3AVMA 1S9GA 5E84A 4H0YB 1L3VA 5AFUH 1J54A 4FM2A 2GTDA 3PO4A 2ZJQL 3PV8A 4FJNA 1Q9YA 5DMRA 4YOWA 4LF4K 1VSEA 5EXWA 1XHXA 3FZHA 3G71N 4CK1A 4BGBA 4IFVA 4M42A 5DM7L 4FJLA 4RW9A 1OVYA 3ZSWA 3CFRA 1RTIA 4YDUC 4YOXA 1BU6O 3NF8A 4B1WB 3LP3A 2A5XA 4CEAA 3V1OA 3BDPA 1NK8A 2HHQA 5BPLA 4K8ZA 4CI6A 3VQ6A 3KIOA 3SQ0A 2GELA 4M3RA 4DUZK 4BE0A 3DM2A 3QEVA 1CZBA 1SS6A 3AO4A 3AGRA 3VENA 4JD2B 3HVTA 2W6KA 4CECA 2XRIA 3A2FA 4DTUA 3QNOA 4WE1A 1NJZA 2BE2A 4IOCL 2RHKA 3JS6A 2VWJA 3SPYA 3OJSA 5BPNA 3CCQN 1E4GT 1VHXA 4ISGA 4KHUA 2OCEA 2HHTA 1GLLO 4DSKA 4FWMA 4LF5K 3SI6A 4C8OA 5BRHA 4A2BA 3ZSQA 4GV3A 1JCFA 3VN5A 2P9NA 4CJ7A 5M1PA 1NWKA 1TK5A 2A41A 2UYTA 3M6GA 5BPMA 4BC5A 3CPEA 5AR0A 4H03B 4Z4GA 4Q0BA 2P9SB 1S6QA 3RR8A 4DUYK 1ATRA 1W2BM 1KC8O 4HWIA 2NRTA 1EWRA 2E6LA 3J7YP 1W0HA 1VQ9N 1QZ6A 5C2DA 3CJCA 3LALA 1XNRK 3NH1A 3HPOA 3L3VA 2KQ2A 3NGYA 1OH8A 2E88A 2HNYA 4PL7A 1HRHA 3M1FA 1C1CA 1NJYA 5HLFA 1U2VB 3FZMA 2DY4A 2Z1IA 3AVFA 4FCYA 4DCHA 2OPSA 3VMFB 2ASMA 3JAMO 3CCUN 5KPRA 2QA4N 3V81A 3VQEA 5AQKA 1RT7A 1R59O 5J2PA 2DTUA 4IJAA 1XQSC 4IBNA 5AQSA 4JRQA 3T19A 1YJWN 1YHQN 4M63C 1CZAN 2UUBK 4WF9L 2BUPA 1JLEA 2IC3A 3HOTA 3MX2A 3MMVA 2GX9A 2KTQA 4GV9A 4IWVA 3CFPA 4I6MA 3AO3A 3T1HK 3T3FA 3VQDA 2P9UB 3NVMA 1BOTO 3ASMA 4KB0A 2FBXA 5CHIA 3HM8A 1RT1A 2WBNA 5CY4A 1KAZA 2P51A 1HPZA 5F0XA 2YV0X 4NCGA 3I33A 3NAEA 5AQLA 1Z05A 1K73O 3SAHA 4E1MA 5HRPA 2X74A 3I0RA 4DSJA 3EE8A 4JI0K 5AZIB 3V9UA 1RT4A 3K9JA 3OS2A 2HSTA 4CJ4A 3OS0A 4IEIA 3QDKA 4MQ3A 1S6PA 5JLHA 4CFCA 4BG9A 1NGEA 1SL1A 1DLOA 4IDKA 5T7BA 1WSJA 3OYIA 5D3GA 4NO7A 4E7LA 1QHAA 2IAJA 2D1KA 3SCXA 1IKYA 4KTWA 2FLOA 3WNHA 3QMLA 4YORA 3AVCA 3A0IX 3JYTA 4CHYA 1BGXT 2E1YA 3ULEA 4DV1K 3JSMA 2OZSA 1L5UA 2P9IB 2BANA 4LFBK 3CI5A 2EX3A 1JLFA 2QXFA 2HBLA 2IDOA 4M7XA 1Q81O 3EN9A 4KTQA 5BN9A 1TL3A 3QNNA 3KLIA 4J8FA 4U7BA 1D9DA 2F96A 1T6CA 3CG7A 1OKJA 1RDCA 3NE6A 1SL2A 1EO1A 3L3UA 1HPMA 4B9TA 1NKBA 4KAZA 4NLCA 5JLFA 4UQGA 3LM9A 1RBTA 4KFBA 4HUEA 4DS4A 4RW6A 3E9LA 3HPHA 3ZX3A 1NU0A 5CZ1A 3OS1A 1ZC6A 4R79A 1CLQA 4FOIA 4JV5K 5TKWA 4IG0A 4KKOA 2Q1NA 4BRGA 4CJQA 2QTDA 4DTXA 1Q9XA 4PA1A 3MN5A 1T7PA 1QE1A 4FJ7A 2G8HA 1T03A 3VQCA 4PKIA 4BRPA 2E5LK 3D45A 4ZTFA 3PSIA 1KLMA 5HROA 2F7TA 1VSHA 4DU1A 1N32K 4AQYK 4E1NA 2QWNA 3L8BA 2D0AA 3LM2A 2ITMA 3HT3A 4ELVA 2YKNA 4JLHA 4JD2A 1QQCA 2YNGA 3R8EA 3I0SA 4B1XB 1C0TA 2QM1A 4F2SA 4CESA 5KGXA 4CJ5A 1K8KB 1XHZA 3R6MA 5SZTA 5EU7A 5M1NA 4BE1A 1K9MO 2P9PB 3UKUB 1S1TA 2IOCA 2QW9A 1L3UA 1BISA 2NNWA 3VQBA 3EZWA 3O3HA 1T3VA 1IJJA 3P39A 1E4FT 3TSPA 1TYQB 4JNEA 1SKSA 2F8SA 4RW4A 4DR6K 2GUIA 2PY5A 3J8AA 1O13A 2D4WA 2IVNA 2VYPA 1BG3A 2Q3SA 1IV0A 3QIOA 1U48A 1K6YA 4FJ5A 4ISFA 3MECA 5FDLA 2ZJRL 3THXB 3IDHA 2P9SA 1FKOA 4FJKA 4JYAK 1S22A 1TAUA 1QVGM 1HQUA 1NJXA 4DTJA 2G8IA 3KK3A 1ZBSA 2HB5A 3SUPA 3HVRA 2WC9A 2KKZA 1Q86O 4KH4A 1WAFA 4PQUA 4B3MK 3CCLN 3SUQA 3O5BA 3H1VX 1U2VA 2F8TA 3T1YK 4WYBA 1FKPA 3TTDA 1IO2A 3CJAA 2VQEK 3BGRA 5AFUA 1GLFO 2YJEA 5J2QA 4ID1A 3VF4A 3VA3A 3NH0A 4YNQA 4BWJA 3ZT0A 3VTHA 3GG4A 4Z4HA 5M1OA 3NGZA 1YXQA 2KLAA 1N6QA 1HQEA 4FM1A 3DRPA 2NRWA 3P4IA 3NF6A 3TANA 3S41A 1XUPO 3OYFA 2UUCK 1N36K 3NFAA 3ZLJA 1BDGA 4EAHD 4OJRA 4AHVA 5CE3A 2P9UA 2YCHA 3MCAB 4CW7B 2NUBA 4MFBA 5AZJA 4FJMA 4E7JA 4X65K 3SAFA 4KPYA 4L8RB 4CD1A 3C65A 4B9VA 3ID8A 4LH4A 4C1NI 4FWNA 4J2EA 5C25A 2YHAA 1IBMK 3QB0A 4CVNE 3D0PA 3VQ8A 2HHXA 3CJ9A 1S5JA 4XH5A 3SK3A 1JJ2M 3V1RA 5I3UA 1Y97A 4O5FA 1MWKA 1BL3A 2ASOA 2E1ZA 4CFAA 5I9EB 4FPAA 5AQWA 4BR4A 3MN9A 3WQTA 4N76A 4WFBL 4YOUA 4CHNA 3O1BA 5GADP 4JKCA 4OPAA 3KK2A 2OPPA 1IBLK 4DV5K 4F3OA 3F9MA 2YNFA 4F3TA 4NYFA 3VOVA 4CJVA 1MA9B 4LF9K 1B9FA 5ADXH 1GOAA 3I55N 1KTQA 1XI1A 3OYGA 1GLCG 4AHSA 5AQIA 4DV6K 5IT9O 2P9IA 3B6OA 1GLJO 4JI2K 3T7ZA 3AAPA 1Q7YO 1DEJA 4M3XA 1JLQA 2O8DB 5FLXO 3P83D 3RR7A 4DQQA 1W7AA 2F4VK 1VSLA 1D4XA 2BTFA 3LAKA 1E3MA 5GIOA 4JKBA 4DR7K 5AQGA 3GE1A 3ISNC 1JCEA 3PX4A 3OY9A 4LSNA 4OX9K 1XMQK 2OTLN 3U9DA 1EXQA 4BR9A 3TAQA 4CJUA 3U6FA 3CM5A 3AVHA 3THYB 2CH5A 4FJGA 3OYJA 3VETA 4KH5A 3C94A 5C2FA 2B6AA 1WUAA 3ZSRA 4HVJA 5JS2A 5BRFA 5BRDA 4BACA 2F9WA 3MCPA 4CK3A 4CJPA 2VCPA 3VESA 4BRAA 4E19A 3M8QA 2AA4A 4FPBA 3TSUA 3V9ZA 1RGIA 3L2UA 1HNIA 4BR5A 1RBRA 5C42A 3M5RA 4FVMA 3IFRA 2KFZA 4BQLA 3K59A 1ASVA 3MXMA 1KAXA 4M3WA 2WONA 4K41A 3DYAA 3U3YA 3UKUA 4DFJA 3DJCA 4DS5A 1TYQA 3B8AX 4BQZA 1IKXA 1ASUA 2B5JA 1QQNA 1HKGA 4KHNA 3IS9A 3GBTA 4EFHA 3V9XA 4C8MA 4MO4A 5BN8A 2A1RA 4W5NA 4ILHA 1U6ZA 3QINA 3THXA 1Z25A 3BZKA 4OO1J 1LCUA 4HHTA 1TUYA 3U9ZA 4CJKA 4QS8A 3C0BA 3KK1A 4DHYA 5BR8K 1HJOA 4LY7A 1QQMA 3RVCA 4BRHA 3MAQA 4DQIA 1YVNA 3WXKA 1NOZA 4LSLA 4NB4A 2OZMA 3O9QA 1XWLA 3CPWM 2O8FB 4ILJA 4BVOA 2ASPA 4BRLA 1NGCA 1B92A 4JHDB 4FLYA 2E8AA 3LDNA 4JKHA 4HCCA 5AQPA 4PL8A 1WNSA 2ZWHA 1D5AA 3AO5A 1BCOA 3I8BA 3SQ4A 1W97L 1T8EA 1S9EA 4B1VA 4IOAL 1G15A 3CM6A 3FZKA 4CZGA 4B8CA 1S3XA 4EZ9A 2HNZA 4H5VA 3VGKA 5AQUA 3HK2A 1M1KO 3OA9A 4M3UA 3K9KA 4DQSA 4XH4A 1WLJA 5FPMA 3T69A 5AQRA 2OPQA 4Y1CA 1J5OA 4IFEA 1RDWX 4PWDA 3KD5E 4CZIA 4DB3A 3HZ6A 2JWLA 4DQRA 4K0KK 5C12A 1TAQA 1Z26A 4DR2K 4CEOA 4W5TA 4BC4A 4CF9A 3LL3A 1FW6A 5KI6A 2E2QA 3DWLA 4NYNA 3NMUA 2HHWA 3A5OC 4B1YB 3OBWA 5J1EA 3LDPA 4O8KA 3SJJA 4H5TA 1NKCA 1YT3A 1WB9A 1YTUA 1HUXA 3UKRB 1RILA 1NBWA 3AVNA 5F1XA 3SUOA 4GKKK 1IG9A 1RT6A 3RTVA 4JI8K 4KHQA 1BQNA 3ZEUB 4ID5A 3ID6A 3SV3A 3GOIA 3BY5A 2B4JA 3UB5A 1LW2A 3EYZA 1NJIO 2KZZA 4FLUA 1RTDA 1OH6A 4QS7A 4OLAA 4IZ9A 4PKHA 4ISEA 1TKXA 3CJBA 2O8DA 1O1WA 4DFMA 4DTSA 3MXJA 5CR4A 4Z4FA 3SLCA 4B3OA 3OYLA 1VSIA 3OYKA 3THWB 4CIEA 5GAGP 4PHTX 3ZT3A 3J7ZO 5FROA 3THYA 2XY7A 4K43A 4E3SA 4DQPA 4B9MA 1BUPA 1X9SA 1RT3A 3U3GA 4CJRA 3M3ZA 4CEEA 2GWKA 5KPTA 1UA1A 1HNWK 1DT9A 3DXKB 4BRMA 1J5EK 3AVIA 1TL1A 4CZKA 2V7YA 4JI7K 1W9HA 1JXBA 2ZQBA 1SQKA 3LWLA 4O44A 2D0OA 4G1QA 2IVPA 4CZFA 3PIPL 4CK2A 3CETA 3CHWA 3H3NO 1ATSA 3ZX2A 4Z0UA 3L4QA 1EQYA 3VTIA 4BRCA 3FZFA 4GVMA 4FZZA 1TKZA 4CF1A 1ESVA 5AQNA 4KRFA 4JI1K 3WEEB 5LY3A 3HXMA 3L2QA 2UXDK 3IRXA 4DV0K 3KKSA 4E89A 3G4SN 5HL7L 3WQUA 2P9KB 3IMXA 1NGFA 4DKWA 3LDOA 4M3ZA 4RW7A 3CCEN 4H0XB 5KPZA 3TAGA 2QKKA 3NGIA 4LF7K 4ICLA 3A5LC 4N41A 1EP4A 4CJFA 3ATUA 4FOEA 2IS3A 2YHYA 4YOVA 4JKAA 2EHGA 3C6UA 3L2VA 4L3QA 3KVGA 1YAGA 1VQON 1VK0A 2IVOA 4X62K 3WNFA 2HHUA 4H5RA 1LV5A 2GV9A 4IG3A 3TTCA 5ADXA 4DF8A 4DR1K 4GV6A 1VSDA 4DSFA 3BZCA 3N4PA 4M3TA 1BA1A 5BREA 3O9UA 2O8CB 2O8FA 2I7PA 4AHTA 4KTZA 4YOTA 5LMUK 3VQ9A 4LFCK 3F9KA 2H3GX 3PIOL 4JHDA 3HP6A
chains in the Genus database with same CATH topology
3NFAA 1HJRA 3OYCA 1WAJA 3KKRA 3B6PA 2KZMA 1CXQA 3M8SA 3M8RA 3VQ5A 5E41A 4NCAA 3RMDA 1EETA 4OGEA 3LWMA 2XY8A 3S9HA 2ITGA 3DLKA 4OJRA 3DMJA 4FW1A 3O3GA 4AHVA 1BIUA 4W5QA 3H08A 3HPGA 4CF8A 2FBTA 3RMBA 4Z4IA 3KD1E 3K5LA 2NUBA 4MFBA 3ALYA 4H4MA 3OYNA 4E7JA 4FJMA 3VA0A 4ELTA 5I42A 4KPYA 3QIPA 4CJWA 4HUGA 4L8RB 4B9VA 4Z4EA 4KB0A 4LH4A 4PUOA 4J2EA 1IKVA 3LZIA 2RF2A 2YHAA 5C25A 3SQ1A 1TKDA 1NK6A 2OYQA 1BHLA 3OVNA 3ZCMA 3K58A 1QSYA 1ZBIA 3D0PA 1BCMA 5KGWA 3VQ8A 5HRNA 3SNNA 2HHXA 3AVJA 1S5JA 1WSGA 2ETJA 5DK5A 4OPJA 1C0MA 3QEWA 4DU3A 3UIQA 3V1RA 4CGDA 5I3UA 4BDZA 1Q8IA 1Y97A 3V9SA 3HJFA 3NBPA 1TGOA 1JXEA 1BL3A 4BWMA 3KLEA 5KTQA 4CFAA 1WSEA 2LSNA 4CJSA 3V1QA 3AVBA 4W5RA 1HYSA 3KLGA 4KHSA 1GOCA 4FJ8A 3P1GA 4TSXA 4HTUA 5JS1A 4DTOA 3VQPA 4N76A 1BI4B 3TR8A 2HHVA 4I2PA 3LANA 4CHNA 1KCFA 1UA0A 5C24A 3KK2A 2OPPA 3DLGA 4LD0A 4B8AB 4F3OA 4OLBA 3RRGA 2YNFA 4CJTA 4F3TA 4J2AA 4NYFA 4CJVA 4BDPA 3HSTB 1B9FA 1ITGA 4CEFA 3AVMA 1GOAA 1S9GA 4I7FA 1L3VA 5J2MA 2G8UA 1J54A 1KTQA 1VSFA 4FM2A 3PO4A 1XI1A 3OYGA 3PV8A 4KREA 4FJNA 1Q9YA 4M41A 2E6MA 5DMRA 3LDSA 3SZ2A 4AHSA 1RDBA 5HP1A 1RDDA 5HRSA 2X6SA 4E7IA 3B6OA 5CYQA 3OYHA 1VSEA 1U45A 4DSLA 2Z1GA 1XHXA 1VSKA 1TV6A 4M3XA 1JLQA 4CK1A 2JLEA 3P83D 3SUNA 3RR7A 4B08A 1JLCA 4DQQA 4IFVA 4OKEA 4M42A 4FJLA 1VSLA 4RW9A 1RCHA 3V4IA 3ZSWA 3CFRA 3LAKA 1RTIA 3P5JA 4CF2A 3AVKA 3M8PA 3NF8A 1KVAA 3TAPA 3LP3A 3ISNC 1JLAA 3AV9A 4FJHA 3PX4A 1QTMA 5HRRA 3TI0A 3OY9A 4LSNA 4R5PA 2G8KA 4CEAA 1EXQA 4DU4A 3TAQA 3V1OA 1I39A 1KFDA 3RMAA 1TK8A 4CJUA 3BDPA 5FRNA 3U6FA 1U4BA 3CM5A 1FXXA 3AVHA 1NK8A 1JLGA 2HHQA 3LP2A 4FJGA 4K8ZA 3OYJA 3C94A 3VQ6A 1ZYQA 3L2WA 3KIOA 3SQ0A 2B6AA 4M3RA 1KVBA 2HMIA 3VQAA 1LWFA 4BE0A 3ZSRA 4HVJA 3QETA 3DM2A 3QEVA 1CZBA 5JS2A 4NCBA 3AO4A 3PUFA 3EZ5A 3K5MA 1SKWA 2VG7A 3CFOA 3HVTA 4CECA 4BACA 2XRIA 4CK3A 3AA3A 3A2FA 4CJPA 4DTUA 1KFSA 3QNOA 4J2DA 1WSFA 4QAGA 4WE1A 1NJZA 4CEBA 2BE2A 4E19A 1C6VA 2G8VA 3M8QA 4CEQA 4QOZB 3V9ZA 3I8DA 3G10A 2VWJA 3L2UA 3SPYA 3OJSA 1HNIA 1ZBUA 1RBRA 4KHUA 3QERA 4OKJA 5C42A 1X9WA 4GMJB 1RTHA 4FVMA 2HHTA 1ASWA 2KFZA 3AA4A 3QLHA 3OYEA 4DSKA 4F8RA 2P1JA 4HCBA 3K59A 4FLZA 4HUFA 1ASVA 3AA2A 3SI6A 4C8OA 4B9NA 3HO1A 3MXMA 3AVGA 3ZSQA 4M3WA 1XC9A 2WONA 3DYAA 4JS4A 3KLHA 3CQ8A 1RBVA 2Z1JA 4O5BA 3U3YA 3VN5A 1QSSA 3AO1A 4DFJA 3O3FA 1RT2A 3MEEA 1TK5A 4OPKA 4KB1A 2BGGA 4FJ9A 1NK4A 1KVCA 4N47A 4DS5A 4DTPA 1HNVA 4KI4A 4I9QA 5HBMA 4JS5A 1S1WA 4Z4GA 4FXDA 4Q0BA 2X6NA 1IKXA 1ASUA 1B9DA 1S6QA 3RR8A 2WOMA 3ZT1A 4DLGA 3PX6A 2B5JA 4FW2A 4C8KA 4KHNA 2FC0A 1F21A 3IS9A 3LP0A 4ZTJA 1VRTA 3TAEA 5K14A 2A1SA 2E6LA 4XIUA 2FBYA 2HNDA 2YNHA 4C8MA 1W0HA 2YNIA 2A1RA 3THVA 4W5NA 2Y1JA 4FLVA 1QS4A 1UWBA 3LALA 2VG6A 3QINA 2RN2A 1S1XA 3NH1A 3HPOA 1Z25A 4CCHA 3NH2A 3L3VA 3AO2A 2KQ2A 3NGYA 1X9MA 2ZD1A 4HHTA 5KRTA 2RKIA 2HNYA 1JL2A 2OPRA 1HRHA 1C1CA 1NJYA 5HLFA 4ELUA 4E0DA 3CYMA 4CJKA 1U04A 2QK9A 2Z1IA 3AVFA 4OVLA 4CGGA 3KK1A 3G0ZA 4FZYA 2DY4A 4CERA 4FCYA 2OPSA 3TWHA 1IG9A 2AJQA 4LY7A 3NF7A 3NDKA 1VRUA 3MAQA 4DQIA 1HYVA 3V81A 2Z1HA 3VQEA 3SPZA 1NOZA 1C0UA 1RT7A 1VSJA 4EZ6A 5J2PA 2DTUA 3DRRA 4LSLA 4AHUA 4H4OA 4IBNA 2OZMA 4CGJA 2QKBA 4N56A 2BDPA 3IAYA 4GW6A 1XWLA 4JRQA 1J53A 3T19A 2KW4A 4PY5A 4CHPA 2ATQA 4DF4A 1B92A 1JLEA 2IC3A 4FLYA 1KSPA 2D0BA 4FLXA 4AILC 2KTQA 3MEGA 3AVLA 4YFUA 4CJ3A 4FYDA 4HCCA 1WSIA 4CFBA 1QHTA 3CFPA 1WNSA 3ULDA 4FK0A 1D5AA 3AO5A 4I9LA 3AO3A 1BCOA 1GOBA 3SQ4A 3T3FA 3VQDA 3O4NA 1C1BA 3WNEA 1T8EA 4QCLA 1DTQA 1S9EA 3K5OA 3DRSA 2RPIA 3ASMA 3AVAA 2FBXA 4BDYA 2IGIA 4H8KA 1G15A 3CM6A 4CF0A 4CFDA 1N5YA 4EP4A 1RT1A 4KHWA 4B8CA 1U47A 1SV5A 4O55A 1REVA 5CY4A 2P51A 4O0JA 1HPZA 4KO0A 4DTMA 2YV0X 4N5SA 4DFPA 3EY1A 4NCGA 4EZ9A 4FK4A 1DTTA 1RT5A 2HNZA 1TKTA 1SKRA 3NAEA 1YTAA 3HK2A 3C95A 1NK9A 4E1MA 4M3UA 4DQSA 5HRPA 2X74A 1WLJA 4B9UA 3K5NA 3WNGA 1NK7A 2OPQA 3QEIA 3KLFA 3I0RA 4Y1CA 1J5OA 4DSJA 3NCIA 4PWDA 3KD5E 4CHOA 1JKHA 3S3MA 1KRPA 3V9UA 2HVIA 1IH7A 1RT4A 3ZSXA 3V9WA 4DQRA 1QSLA 4DG1A 2W42A 4FJIA 1TAQA 1Z26A 3OS2A 1CZ9A 4CJ4A 4CEOA 3LZJA 3OS0A 4W5TA 3TAMA 4CF9A 1L3SA 2R7YA 4MQ3A 1S6PA 3ZSOA 5KI6A 4CFCA 1BIZA 4NYNA 1SL1A 1DLOA 4IDKA 3ZSZA 5T7BA 1J9AA 1LWEA 1WSJA 4AH9A 3OYIA 4E7LA 5D3GA 2HHWA 3OYAA 2IAJA 3SCXA 1IKYA 4KTWA 3WNHA 5J1EA 3PO5A 3SV4A 4CIFA 3AVCA 3K2PA 3SJJA 3RWUA 3JYTA 1NKCA 2HVHA 1BI4A 4CHYA 1BGXT 1YT3A 1YTUA 1SUQA 1RILA 3JSMA 2OZSA 4CHQA 3AVNA 1L3TA 1L5UA 2VG5A 2XHBA 3SUOA 1RT6A 4CGFA 3V6DA 1RTJA 1WSHA 2BANA 3RTVA 1NKEA 4BE2A 2EX3A 1D9FA 4B9LA 1JLFA 2QXFA 5CZ2A 2IDOA 1TVRA 4J2BA 4KHQA 1BQNA 4ID5A 3SV3A 4KTQA 3OYMA 2B4JA 3NF9A 4E7KA 3DLBA 1TL3A 1LW2A 3EYZA 3QNNA 3KLIA 1D9DA 2KZZA 1MU2A 2F96A 3CG7A 4Z4CA 1SL0A 1LW0A 3DLEA 1HMVA 2P5OA 1RDCA 3NE6A 4FLUA 1RTDA 4DFKA 1SL2A 4OLAA 3L3UA 4B9TA 3FFIA 2XY6A 1NKBA 1EKEA 1TKXA 1RNHA 4KAZA 4FJXA 4LH5A 4UQGA 4DTNA 3OYBA 1O1WA 4DFMA 4FM0A 4DTSA 1RBTA 3F73A 4KFBA 4HUEA 2VWKA 4DS4A 4RW6A 1NJWA 4CEDA 1NK0A 3HPHA 3K57A 1IKWA 3MXJA 2JGUA 4Z4FA 4B3OA 5CZ1A 1KLNA 3OYLA 3MEDA 3OS1A 3QESA 3SQ2A 3KTQA 1CLQA 1ZBHA 4CJLA 1VSIA 1JL1A 4IG0A 4KKOA 4CJQA 4CIGA 5SWMA 4DTXA 3OYKA 1Q9XA 4PA1A 4C8LA 4CIEA 1T7PA 1QE1A 1FK9A 3VQQA 2YHBA 3ZT3A 2G8WA 4FJ7A 4RG8A 1T03A 3VQCA 2G8HA 2D5RA 3HP6A 4CEZA 5FROA 3D45A 4I2QA 2XY7A 4ZTFA 2G8FA 2ZE2A 1KLMA 4E3SA 4DQPA 4AHRA 5HROA 4B9MA 1A5WA 1VSHA 1RT3A 4DU1A 1X9SA 5J2NA 3U3GA 1R0AA 4CJEA 3DOKA 4CJRA 4O4GA 1A5XA 3AA5X 4CEEA 4DMNA 4E1NA 3NHGA 3ZSYA 1UA1A 2X78A 3L8BA 1VSMA 2D0AA 3OYDA 2DFEA 4F4KA 3HT3A 1T05A 3AVIA 4ELVA 1U49A 2YKNA 4JLHA 3RRHA 1TL1A 2HHSA 3KJVA 3QEXA 4AHCA 1QQCA 2YNGA 1BQMA 1W9HA 1JXBA 2ZQBA 3I0SA 3LWLA 4O44A 3S3NA 2OA8A 1C0TA 4C8NA 2DFFA 4G1QA 4F2SA 4CESA 3DLRA 4Y1DA 5KGXA 3LAMA 4CJ5A 4CK2A 2Y1IA 4FLWA 1CXUA 1XHZA 3O4QA 1NK5A 2PYJA 1LAVA 5SZTA 4Q5VA 5EU7A 3HYFA 1S1UA 4BE1A 4Z0UA 2XY5A 1L3UA 1S1TA 2IOCA 1WN7A 3HL8A 4B9SA 4GVMA 1BISA 1EX4A 1C1AA 3RMCA 4W5OA 3VQ7A 3VQBA 4OGCA 3O3HA 4FZZA 1TKZA 4CF1A 4KRFA 1LAWA 4FLTA 4K8XA 3HXMA 3L2QA 1SKSA 1ZBFA 3IRXA 4RW4A 2F8SA 4DLEA 2GUIA 2PY5A 3KKSA 4E89A 4M45A 3VQ4A 1JLBA 4IFYA 1RDAA 1UOCA 2Q3SA 4O0IA 4IKFA 1NOYA 1RBSA 3LP1A 3QIOA 4M3YA 1U48A 1K6YA 1A5VA 4FJ5A 3PY8A 3ZT4A 3MECA 3L2RA 5FDLA 3LPTA 3SYZA 4M3ZA 4RW7A 4CHZA 4JRPA 3DI6A 3V9XA 3E01A 1FKOA 4CGHA 4E7HA 4FJKA 3TAGA 2XO7A 2PYLA 2QKKA 3NGIA 4DTRA 2FBVA 4ICLA 1TAUA 2O4GA 4N41A 2G8IA 1EP4A 1HQUA 5CYMA 4DTJA 3KK3A 3DOLA 1NJXA 2P5GA 4CJFA 3LPUA 4EP5A 4F2RA 4FK2A 2HB5A 2IS3A 1YVUA 3SUPA 3QEPA 3TARA 3HVRA 1RBUA 2EHGA 3C6UA 3ZT2A 3L2VA 3PX0A 5FRMA 1TK0A 3TABA 2KFNA 5KRSA 1WAFA 4DSIA 4KHYA 4PQUA 4RW8A 3C6TA 1LWCA 1VK0A 4CGIA 3OJUA 1HYZA 3HM9A 3SUQA 4DWIA 2O4IA 2DFHA 1X1PA 3QO9A 4FJJA 1S1VA 3WNFA 2HHUA 2D0CA 2F8TA 1D8YA 3DLHA 1FKPA 3MXIA 1LV5A 2I5JA 3T1AA 1IO2A 4KI6A 4FZXC 2HW3A 2GV9A 4IG3A 3TAFA 4OKKA 1UAXA 3BGRA 3S3OA 5J2QA 4DF8A 2PZSA 4ID1A 4DSEA 1VSDA 4DSFA 3VA3A 4KV8A 2YKMA 3IG1A 4M3TA 3NH0A 4YNQA 4CE9A 1ZBLA 3HP9A 4BWJA 3ZT0A 4Z4HA 3NGZA 4AHTA 1N6QA 4KTZA 1HQEA 2E4LA 3VQ9A 3ZSVA 4FM1A 3DRPA 3F9KA 3NF6A 2GBZA 3TANA 3OYFA 4ZHRA 1I3AA 3ITHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NFA A;  1HJR A;  3OYC A;  1WAJ A;  3KKR A;  3B6P A;  2KZM A;  1CXQ A;  3M8S A;  3M8R A;  3VQ5 A;  5E41 A;  4NCA A;  3RMD A;  1EET A;  4OGE A;  3LWM A;  2XY8 A;  3S9H A;  2ITG A;  3DLK A;  4OJR A;  3DMJ A;  4FW1 A;  3O3G A;  4AHV A;  1BIU A;  4W5Q A;  3H08 A;  3HPG A;  4CF8 A;  2FBT A;  3RMB A;  4Z4I A;  3KD1 E;  3K5L A;  2NUB A;  4MFB A;  3ALY A;  4H4M A;  3OYN A;  4E7J A;  4FJM A;  3VA0 A;  4ELT A;  5I42 A;  4KPY A;  3QIP A;  4CJW A;  4HUG A;  4L8R B;  4B9V A;  4Z4E A;  4KB0 A;  4LH4 A;  4PUO A;  4J2E A;  1IKV A;  3LZI A;  2RF2 A;  2YHA A;  5C25 A;  3SQ1 A;  1TKD A;  1NK6 A;  2OYQ A;  1BHL A;  3OVN A;  3ZCM A;  3K58 A;  1QSY A;  1ZBI A;  3D0P A;  1BCM A;  5KGW A;  3VQ8 A;  5HRN A;  3SNN A;  2HHX A;  3AVJ A;  1S5J A;  1WSG A;  2ETJ A;  5DK5 A;  4OPJ A;  1C0M A;  3QEW A;  4DU3 A;  3UIQ A;  3V1R A;  4CGD A;  5I3U A;  4BDZ A;  1Q8I A;  1Y97 A;  3V9S A;  3HJF A;  3NBP A;  1TGO A;  1JXE A;  1BL3 A;  4BWM A;  3KLE A;  5KTQ A;  4CFA A;  1WSE A;  2LSN A;  4CJS A;  3V1Q A;  3AVB A;  4W5R A;  1HYS A;  3KLG A;  4KHS A;  1GOC A;  4FJ8 A;  3P1G A;  4TSX A;  4HTU A;  5JS1 A;  4DTO A;  3VQP A;  4N76 A;  1BI4 B;  3TR8 A;  2HHV A;  4I2P A;  3LAN A;  4CHN A;  1KCF A;  1UA0 A;  5C24 A;  3KK2 A;  2OPP A;  3DLG A;  4LD0 A;  4B8A B;  4F3O A;  4OLB A;  3RRG A;  2YNF A;  4CJT A;  4F3T A;  4J2A A;  4NYF A;  4CJV A;  4BDP A;  3HST B;  1B9F A;  1ITG A;  4CEF A;  3AVM A;  1GOA A;  1S9G A;  4I7F A;  1L3V A;  5J2M A;  2G8U A;  1J54 A;  1KTQ A;  1VSF A;  4FM2 A;  3PO4 A;  1XI1 A;  3OYG A;  3PV8 A;  4KRE A;  4FJN A;  1Q9Y A;  4M41 A;  2E6M A;  5DMR A;  3LDS A;  3SZ2 A;  4AHS A;  1RDB A;  5HP1 A;  1RDD A;  5HRS A;  2X6S A;  4E7I A;  3B6O A;  5CYQ A;  3OYH A;  1VSE A;  1U45 A;  4DSL A;  2Z1G A;  1XHX A;  1VSK A;  1TV6 A;  4M3X A;  1JLQ A;  4CK1 A;  2JLE A;  3P83 D;  3SUN A;  3RR7 A;  4B08 A;  1JLC A;  4DQQ A;  4IFV A;  4OKE A;  4M42 A;  4FJL A;  1VSL A;  4RW9 A;  1RCH A;  3V4I A;  3ZSW A;  3CFR A;  3LAK A;  1RTI A;  3P5J A;  4CF2 A;  3AVK A;  3M8P A;  3NF8 A;  1KVA A;  3TAP A;  3LP3 A;  3ISN C;  1JLA A;  3AV9 A;  4FJH A;  3PX4 A;  1QTM A;  5HRR A;  3TI0 A;  3OY9 A;  4LSN A;  4R5P A;  2G8K A;  4CEA A;  1EXQ A;  4DU4 A;  3TAQ A;  3V1O A;  1I39 A;  1KFD A;  3RMA A;  1TK8 A;  4CJU A;  3BDP A;  5FRN A;  3U6F A;  1U4B A;  3CM5 A;  1FXX A;  3AVH A;  1NK8 A;  1JLG A;  2HHQ A;  3LP2 A;  4FJG A;  4K8Z A;  3OYJ A;  3C94 A;  3VQ6 A;  1ZYQ A;  3L2W A;  3KIO A;  3SQ0 A;  2B6A A;  4M3R A;  1KVB A;  2HMI A;  3VQA A;  1LWF A;  4BE0 A;  3ZSR A;  4HVJ A;  3QET A;  3DM2 A;  3QEV A;  1CZB A;  5JS2 A;  4NCB A;  3AO4 A;  3PUF A;  3EZ5 A;  3K5M A;  1SKW A;  2VG7 A;  3CFO A;  3HVT A;  4CEC A;  4BAC A;  2XRI A;  4CK3 A;  3AA3 A;  3A2F A;  4CJP A;  4DTU A;  1KFS A;  3QNO A;  4J2D A;  1WSF A;  4QAG A;  4WE1 A;  1NJZ A;  4CEB A;  2BE2 A;  4E19 A;  1C6V A;  2G8V A;  3M8Q A;  4CEQ A;  4QOZ B;  3V9Z A;  3I8D A;  3G10 A;  2VWJ A;  3L2U A;  3SPY A;  3OJS A;  1HNI A;  1ZBU A;  1RBR A;  4KHU A;  3QER A;  4OKJ A;  5C42 A;  1X9W A;  4GMJ B;  1RTH A;  4FVM A;  2HHT A;  1ASW A;  2KFZ A;  3AA4 A;  3QLH A;  3OYE A;  4DSK A;  4F8R A;  2P1J A;  4HCB A;  3K59 A;  4FLZ A;  4HUF A;  1ASV A;  3AA2 A;  3SI6 A;  4C8O A;  4B9N A;  3HO1 A;  3MXM A;  3AVG A;  3ZSQ A;  4M3W A;  1XC9 A;  2WON A;  3DYA A;  4JS4 A;  3KLH A;  3CQ8 A;  1RBV A;  2Z1J A;  4O5B A;  3U3Y A;  3VN5 A;  1QSS A;  3AO1 A;  4DFJ A;  3O3F A;  1RT2 A;  3MEE A;  1TK5 A;  4OPK A;  4KB1 A;  2BGG A;  4FJ9 A;  1NK4 A;  1KVC A;  4N47 A;  4DS5 A;  4DTP A;  1HNV A;  4KI4 A;  4I9Q A;  5HBM A;  4JS5 A;  1S1W A;  4Z4G A;  4FXD A;  4Q0B A;  2X6N A;  1IKX A;  1ASU A;  1B9D A;  1S6Q A;  3RR8 A;  2WOM A;  3ZT1 A;  4DLG A;  3PX6 A;  2B5J A;  4FW2 A;  4C8K A;  4KHN A;  2FC0 A;  1F21 A;  3IS9 A;  3LP0 A;  4ZTJ A;  1VRT A;  3TAE A;  5K14 A;  2A1S A;  2E6L A;  4XIU A;  2FBY A;  2HND A;  2YNH A;  4C8M A;  1W0H A;  2YNI A;  2A1R A;  3THV A;  4W5N A;  2Y1J A;  4FLV A;  1QS4 A;  1UWB A;  3LAL A;  2VG6 A;  3QIN A;  2RN2 A;  1S1X A;  3NH1 A;  3HPO A;  1Z25 A;  4CCH A;  3NH2 A;  3L3V A;  3AO2 A;  2KQ2 A;  3NGY A;  1X9M A;  2ZD1 A;  4HHT A;  5KRT A;  2RKI A;  2HNY A;  1JL2 A;  2OPR A;  1HRH A;  1C1C A;  1NJY A;  5HLF A;  4ELU A;  4E0D A;  3CYM A;  4CJK A;  1U04 A;  2QK9 A;  2Z1I A;  3AVF A;  4OVL A;  4CGG A;  3KK1 A;  3G0Z A;  4FZY A;  2DY4 A;  4CER A;  4FCY A;  2OPS A;  3TWH A;  1IG9 A;  2AJQ A;  4LY7 A;  3NF7 A;  3NDK A;  1VRU A;  3MAQ A;  4DQI A;  1HYV A;  3V81 A;  2Z1H A;  3VQE A;  3SPZ A;  1NOZ A;  1C0U A;  1RT7 A;  1VSJ A;  4EZ6 A;  5J2P A;  2DTU A;  3DRR A;  4LSL A;  4AHU A;  4H4O A;  4IBN A;  2OZM A;  4CGJ A;  2QKB A;  4N56 A;  2BDP A;  3IAY A;  4GW6 A;  1XWL A;  4JRQ A;  1J53 A;  3T19 A;  2KW4 A;  4PY5 A;  4CHP A;  2ATQ A;  4DF4 A;  1B92 A;  1JLE A;  2IC3 A;  4FLY A;  1KSP A;  2D0B A;  4FLX A;  4AIL C;  2KTQ A;  3MEG A;  3AVL A;  4YFU A;  4CJ3 A;  4FYD A;  4HCC A;  1WSI A;  4CFB A;  1QHT A;  3CFP A;  1WNS A;  3ULD A;  4FK0 A;  1D5A A;  3AO5 A;  4I9L A;  3AO3 A;  1BCO A;  1GOB A;  3SQ4 A;  3T3F A;  3VQD A;  3O4N A;  1C1B A;  3WNE A;  1T8E A;  4QCL A;  1DTQ A;  1S9E A;  3K5O A;  3DRS A;  2RPI A;  3ASM A;  3AVA A;  2FBX A;  4BDY A;  2IGI A;  4H8K A;  1G15 A;  3CM6 A;  4CF0 A;  4CFD A;  1N5Y A;  4EP4 A;  1RT1 A;  4KHW A;  4B8C A;  1U47 A;  1SV5 A;  4O55 A;  1REV A;  5CY4 A;  2P51 A;  4O0J A;  1HPZ A;  4KO0 A;  4DTM A;  2YV0 X;  4N5S A;  4DFP A;  3EY1 A;  4NCG A;  4EZ9 A;  4FK4 A;  1DTT A;  1RT5 A;  2HNZ A;  1TKT A;  1SKR A;  3NAE A;  1YTA A;  3HK2 A;  3C95 A;  1NK9 A;  4E1M A;  4M3U A;  4DQS A;  5HRP A;  2X74 A;  1WLJ A;  4B9U A;  3K5N A;  3WNG A;  1NK7 A;  2OPQ A;  3QEI A;  3KLF A;  3I0R A;  4Y1C A;  1J5O A;  4DSJ A;  3NCI A;  4PWD A;  3KD5 E;  4CHO A;  1JKH A;  3S3M A;  1KRP A;  3V9U A;  2HVI A;  1IH7 A;  1RT4 A;  3ZSX A;  3V9W A;  4DQR A;  1QSL A;  4DG1 A;  2W42 A;  4FJI A;  1TAQ A;  1Z26 A;  3OS2 A;  1CZ9 A;  4CJ4 A;  4CEO A;  3LZJ A;  3OS0 A;  4W5T A;  3TAM A;  4CF9 A;  1L3S A;  2R7Y A;  4MQ3 A;  1S6P A;  3ZSO A;  5KI6 A;  4CFC A;  1BIZ A;  4NYN A;  1SL1 A;  1DLO A;  4IDK A;  3ZSZ A;  5T7B A;  1J9A A;  1LWE A;  1WSJ A;  4AH9 A;  3OYI A;  4E7L A;  5D3G A;  2HHW A;  3OYA A;  2IAJ A;  3SCX A;  1IKY A;  4KTW A;  3WNH A;  5J1E A;  3PO5 A;  3SV4 A;  4CIF A;  3AVC A;  3K2P A;  3SJJ A;  3RWU A;  3JYT A;  1NKC A;  2HVH A;  1BI4 A;  4CHY A;  1BGX T;  1YT3 A;  1YTU A;  1SUQ A;  1RIL A;  3JSM A;  2OZS A;  4CHQ A;  3AVN A;  1L3T A;  1L5U A;  2VG5 A;  2XHB A;  3SUO A;  1RT6 A;  4CGF A;  3V6D A;  1RTJ A;  1WSH A;  2BAN A;  3RTV A;  1NKE A;  4BE2 A;  2EX3 A;  1D9F A;  4B9L A;  1JLF A;  2QXF A;  5CZ2 A;  2IDO A;  1TVR A;  4J2B A;  4KHQ A;  1BQN A;  4ID5 A;  3SV3 A;  4KTQ A;  3OYM A;  2B4J A;  3NF9 A;  4E7K A;  3DLB A;  1TL3 A;  1LW2 A;  3EYZ A;  3QNN A;  3KLI A;  1D9D A;  2KZZ A;  1MU2 A;  2F96 A;  3CG7 A;  4Z4C A;  1SL0 A;  1LW0 A;  3DLE A;  1HMV A;  2P5O A;  1RDC A;  3NE6 A;  4FLU A;  1RTD A;  4DFK A;  1SL2 A;  4OLA A;  3L3U A;  4B9T A;  3FFI A;  2XY6 A;  1NKB A;  1EKE A;  1TKX A;  1RNH A;  4KAZ A;  4FJX A;  4LH5 A;  4UQG A;  4DTN A;  3OYB A;  1O1W A;  4DFM A;  4FM0 A;  4DTS A;  1RBT A;  3F73 A;  4KFB A;  4HUE A;  2VWK A;  4DS4 A;  4RW6 A;  1NJW A;  4CED A;  1NK0 A;  3HPH A;  3K57 A;  1IKW A;  3MXJ A;  2JGU A;  4Z4F A;  4B3O A;  5CZ1 A;  1KLN A;  3OYL A;  3MED A;  3OS1 A;  3QES A;  3SQ2 A;  3KTQ A;  1CLQ A;  1ZBH A;  4CJL A;  1VSI A;  1JL1 A;  4IG0 A;  4KKO A;  4CJQ A;  4CIG A;  5SWM A;  4DTX A;  3OYK A;  1Q9X A;  4PA1 A;  4C8L A;  4CIE A;  1T7P A;  1QE1 A;  1FK9 A;  3VQQ A;  2YHB A;  3ZT3 A;  2G8W A;  4FJ7 A;  4RG8 A;  1T03 A;  3VQC A;  2G8H A;  2D5R A;  3HP6 A;  4CEZ A;  5FRO A;  3D45 A;  4I2Q A;  2XY7 A;  4ZTF A;  2G8F A;  2ZE2 A;  1KLM A;  4E3S A;  4DQP A;  4AHR A;  5HRO A;  4B9M A;  1A5W A;  1VSH A;  1RT3 A;  4DU1 A;  1X9S A;  5J2N A;  3U3G A;  1R0A A;  4CJE A;  3DOK A;  4CJR A;  4O4G A;  1A5X A;  3AA5 X;  4CEE A;  4DMN A;  4E1N A;  3NHG A;  3ZSY A;  1UA1 A;  2X78 A;  3L8B A;  1VSM A;  2D0A A;  3OYD A;  2DFE A;  4F4K A;  3HT3 A;  1T05 A;  3AVI A;  4ELV A;  1U49 A;  2YKN A;  4JLH A;  3RRH A;  1TL1 A;  2HHS A;  3KJV A;  3QEX A;  4AHC A;  1QQC A;  2YNG A;  1BQM A;  1W9H A;  1JXB A;  2ZQB A;  3I0S A;  3LWL A;  4O44 A;  3S3N A;  2OA8 A;  1C0T A;  4C8N A;  2DFF A;  4G1Q A;  4F2S A;  4CES A;  3DLR A;  4Y1D A;  5KGX A;  3LAM A;  4CJ5 A;  4CK2 A;  2Y1I A;  4FLW A;  1CXU A;  1XHZ A;  3O4Q A;  1NK5 A;  2PYJ A;  1LAV A;  5SZT A;  4Q5V A;  5EU7 A;  3HYF A;  1S1U A;  4BE1 A;  4Z0U A;  2XY5 A;  1L3U A;  1S1T A;  2IOC A;  1WN7 A;  3HL8 A;  4B9S A;  4GVM A;  1BIS A;  1EX4 A;  1C1A A;  3RMC A;  4W5O A;  3VQ7 A;  3VQB A;  4OGC A;  3O3H A;  4FZZ A;  1TKZ A;  4CF1 A;  4KRF A;  1LAW A;  4FLT A;  4K8X A;  3HXM A;  3L2Q A;  1SKS A;  1ZBF A;  3IRX A;  4RW4 A;  2F8S A;  4DLE A;  2GUI A;  2PY5 A;  3KKS A;  4E89 A;  4M45 A;  3VQ4 A;  1JLB A;  4IFY A;  1RDA A;  1UOC A;  2Q3S A;  4O0I A;  4IKF A;  1NOY A;  1RBS A;  3LP1 A;  3QIO A;  4M3Y A;  1U48 A;  1K6Y A;  1A5V A;  4FJ5 A;  3PY8 A;  3ZT4 A;  3MEC A;  3L2R A;  5FDL A;  3LPT A;  3SYZ A;  4M3Z A;  4RW7 A;  4CHZ A;  4JRP A;  3DI6 A;  3V9X A;  3E01 A;  1FKO A;  4CGH A;  4E7H A;  4FJK A;  3TAG A;  2XO7 A;  2PYL A;  2QKK A;  3NGI A;  4DTR A;  2FBV A;  4ICL A;  1TAU A;  2O4G A;  4N41 A;  2G8I A;  1EP4 A;  1HQU A;  5CYM A;  4DTJ A;  3KK3 A;  3DOL A;  1NJX A;  2P5G A;  4CJF A;  3LPU A;  4EP5 A;  4F2R A;  4FK2 A;  2HB5 A;  2IS3 A;  1YVU A;  3SUP A;  3QEP A;  3TAR A;  3HVR A;  1RBU A;  2EHG A;  3C6U A;  3ZT2 A;  3L2V A;  3PX0 A;  5FRM A;  1TK0 A;  3TAB A;  2KFN A;  5KRS A;  1WAF A;  4DSI A;  4KHY A;  4PQU A;  4RW8 A;  3C6T A;  1LWC A;  1VK0 A;  4CGI A;  3OJU A;  1HYZ A;  3HM9 A;  3SUQ A;  4DWI A;  2O4I A;  2DFH A;  1X1P A;  3QO9 A;  4FJJ A;  1S1V A;  3WNF A;  2HHU A;  2D0C A;  2F8T A;  1D8Y A;  3DLH A;  1FKP A;  3MXI A;  1LV5 A;  2I5J A;  3T1A A;  1IO2 A;  4KI6 A;  4FZX C;  2HW3 A;  2GV9 A;  4IG3 A;  3TAF A;  4OKK A;  1UAX A;  3BGR A;  3S3O A;  5J2Q A;  4DF8 A;  2PZS A;  4ID1 A;  4DSE A;  1VSD A;  4DSF A;  3VA3 A;  4KV8 A;  2YKM A;  3IG1 A;  4M3T A;  3NH0 A;  4YNQ A;  4CE9 A;  1ZBL A;  3HP9 A;  4BWJ A;  3ZT0 A;  4Z4H A;  3NGZ A;  4AHT A;  1N6Q A;  4KTZ A;  1HQE A;  2E4L A;  3VQ9 A;  3ZSV A;  4FM1 A;  3DRP A;  3F9K A;  3NF6 A;  2GBZ A;  3TAN A;  3OYF A;  4ZHR A;  1I3A A;  3ITH A; 
#chains in the Genus database with same CATH topology
 3EKU A;  4YY3 K;  1HJR A;  1KD1 O;  1WAJ A;  3KKR A;  3B6P A;  1VQ6 N;  3RMD A;  3D2F B;  3S9H A;  5AQM A;  3O3G A;  2QI2 A;  1XNQ K;  4FW1 A;  5A2Q O;  4W5Q A;  1M90 O;  2FBT A;  3CXC M;  3K5L A;  1HR0 K;  3OYN A;  4H4M A;  1GLE G;  3ENH A;  5I42 A;  2OAN A;  1IKV A;  3LZI A;  2RF2 A;  2ZF5 O;  4H0P A;  4A5A A;  4IJN A;  2OYQ A;  3OVN A;  1QQO A;  3K58 A;  5KQ8 A;  1NGI A;  3SBT A;  5KGW A;  3VEX A;  3SNN A;  3AVJ A;  4MDB A;  3Q7B A;  3QEW A;  1HLU A;  4H5W A;  3P38 A;  1XC3 A;  1Q8I A;  3V9S A;  4BWM A;  3DLL L;  3EO3 A;  3IUC A;  5AJ3 K;  1VQM N;  4CJS A;  4W5R A;  3KLG A;  3SBG A;  4FJ8 A;  3P1G A;  2HHV A;  1BI4 B;  3TR8 A;  2HF4 A;  2E2N A;  1UA0 A;  5C24 A;  1NGB A;  4BRF A;  4DQ8 A;  4LD0 A;  3PLA A;  4CJT A;  2FF3 B;  4ILG B;  4BDP A;  3O1W A;  4MLH A;  2I7N A;  1VSF A;  4KRE A;  3CCS N;  4M41 A;  2E6M A;  3LDS A;  3SZ2 A;  5HP1 A;  5JVH L;  3UKR A;  1RDD A;  2YJF A;  3ENB A;  3C7N B;  4WFA L;  4A59 A;  3OYH A;  1U45 A;  4DSL A;  5FPN A;  3MK6 A;  3ZEU A;  4V19 S;  3NVK A;  5LL6 Z;  2JLE A;  3SUN A;  4OKE A;  4BRI A;  2KHO A;  3ZET B;  1RCH A;  3V4I A;  2V52 B;  4FWO A;  3P5J A;  3D2E B;  4RWT A;  3AVK A;  3M8P A;  4BRE A;  5EX5 A;  3AV9 A;  1VQ8 N;  1OH5 A;  4BY9 C;  5HRR A;  3TI0 A;  4BGA A;  4R5P A;  1I39 A;  3RMA A;  5FRN A;  1FXX A;  3LP2 A;  2RE2 A;  4WCE L;  1ZYQ A;  3VQA A;  3THW A;  1LWF A;  3CCJ N;  3QET A;  2V51 B;  2NRR A;  3PUF A;  3H3O B;  3MN6 A;  3K5M A;  2VG7 A;  1KFS A;  4BC3 A;  5FPD A;  1HNX K;  1WSF A;  4QAG A;  1EWQ A;  4CEB A;  2G8V A;  1C6V A;  3I8D A;  3G10 A;  3DXK A;  2NZT A;  1ZBU A;  1C0G A;  4GNI A;  1X9W A;  4JI6 K;  4GMJ B;  4DV4 K;  5EOY A;  4FO0 A;  3QLH A;  2EWS A;  3OYE A;  4F8R A;  2P1J A;  2WTU A;  4FLZ A;  3AA2 A;  4H5N A;  2UU9 K;  4BC2 A;  4FVU A;  3KLH A;  1RFQ A;  1RBV A;  3QFP A;  3AO1 A;  3O3F A;  3MEE A;  4OPK A;  3CQX A;  1MDU B;  5FPE A;  4FJ9 A;  1NK4 A;  5AQZ A;  4DTP A;  4KI4 A;  1HNV A;  1V4S A;  3VEO A;  3A5M C;  1S1W A;  5C10 A;  3CC2 N;  3BEX A;  2X6N A;  1NNE A;  3OHR A;  2WOM A;  4DLG A;  1N33 K;  1T6D A;  4FW2 A;  3PX6 A;  2YX6 A;  3HSC A;  4B1Z A;  1ATN A;  4ZTJ A;  1X3N A;  1VRT A;  3TAE A;  4XIU A;  2FBY A;  2YNH A;  2P9K A;  2IIR A;  1QS4 A;  3BF3 A;  2VG6 A;  2UUA K;  3H45 C;  2RN2 A;  4CCH A;  1X9M A;  4G9Z A;  3G25 A;  5KRT A;  4EIA A;  1JL2 A;  2OPR A;  5AZI A;  1HKC A;  1HX1 A;  4ELU A;  3CYM A;  4OVL A;  1FJG K;  3TWH A;  2AJQ A;  3NF7 A;  5IWA K;  1VRU A;  2QXL A;  2Z1H A;  3KWG A;  5DM6 L;  5M1Q A;  1GLB G;  1C0U A;  1VSJ A;  2YI1 A;  3N4Q A;  4WQ5 A;  4H4O A;  4K25 A;  4CGJ A;  3WUH A;  2QKB A;  4N56 A;  2BDP A;  3IAY A;  1P8Z A;  4IXC A;  4MDA A;  1VQN N;  3MDQ A;  1G99 A;  5AQQ A;  4CHP A;  2ATQ A;  4DF4 A;  1ZXO A;  1NMD A;  2D0B A;  4FLX A;  1VQ7 N;  1KSP A;  4YFU A;  2GUP A;  4CJ3 A;  3SAG A;  3D7E O;  2O8C A;  5GAE P;  3CMA N;  1YI2 N;  3O4N A;  4H0V B;  3WNE A;  4QCL A;  4JI3 K;  1DTQ A;  3CCM N;  2NRZ A;  1GLA G;  3DRS A;  3AVA A;  1NG9 A;  2IGI A;  2NRX A;  4H8K A;  3PSF A;  4CFD A;  4EP4 A;  4BVP A;  2NRH A;  1U47 A;  3D2F A;  1REV A;  4O55 A;  3A5N C;  4O0J A;  4DFP A;  4KO0 A;  4B3T K;  4FK4 A;  4KH6 A;  4N5S A;  1MWM A;  3EY1 A;  1DTT A;  1RT5 A;  2QWP A;  1X3M A;  1SKR A;  5EY4 A;  1YTA A;  5BR9 A;  1NK9 A;  2FSN A;  2ZJP L;  3K5N A;  3EKS A;  5AQO A;  1NK7 A;  3QEI A;  3KLF A;  5GIP A;  3NCI A;  1JKH A;  2HVI A;  1WBB A;  4MLE A;  3V9W A;  4FJI A;  2PAV A;  4DG1 A;  2W42 A;  2GEM A;  1CZ9 A;  1NGH A;  4Z94 A;  3LZJ A;  2OTJ N;  3MN7 A;  2R7Y A;  3ZSO A;  5AQY A;  4CBU A;  3WXM B;  3HI0 A;  1J9A A;  1LWE A;  4JKD A;  4AH9 A;  3SV4 A;  4CIF A;  3ATV A;  3EE9 A;  3K2P A;  3RWU A;  2HVH A;  1BI4 A;  1NGA A;  4QS9 A;  3R3L A;  3O9T A;  4BG8 A;  3KWI A;  2VG5 A;  1K8K A;  2XHB A;  4CGF A;  1RTJ A;  1WSH A;  1NKE A;  4BE2 A;  1TVR A;  2WUS A;  4WQ4 A;  2P9P A;  4J2B A;  3J81 O;  3OYM A;  2A3Z A;  4E7K A;  3DLB A;  1HNZ K;  4JI4 K;  1MU2 A;  4Z4C A;  1SL0 A;  1WOQ A;  5M1F A;  1HMV A;  3C7N A;  2CGL A;  4DFK A;  3U4L A;  3FFI A;  3ZX0 A;  3H46 O;  4LH5 A;  4DTN A;  3OYB A;  3Q7C A;  3F73 A;  1RDU A;  2D0P A;  4CED A;  5EVZ A;  2A6A A;  2HHH K;  3ZET A;  1IKW A;  2JGU A;  3OBY A;  3OW2 M;  3D2E A;  3GDQ A;  1KLN A;  3SQ2 A;  3QES A;  5GAH P;  2O8B B;  4CJL A;  1JL1 A;  4C8L A;  1SZ2 A;  2CGK A;  1C0F A;  1FK9 A;  3VQQ A;  2YHB A;  2G8W A;  2VQF K;  2Q2R A;  4CBW A;  2A42 A;  5J2N A;  1BWF O;  1NGG A;  4CJE A;  3DOK A;  1R0A A;  4O4G A;  4DMN A;  3KZB A;  4XEI A;  2X78 A;  1VSM A;  4CZM A;  2DFE A;  2YHX A;  1T05 A;  1U49 A;  2HOE A;  2HHS A;  3KJV A;  1DGK N;  4FSV A;  2GWJ A;  1BQM A;  5B8H A;  2OA8 A;  3S3N A;  4C8N A;  5E26 A;  4JK7 A;  4Y1D A;  3LAM A;  1CXU A;  1NK5 A;  3O4Q A;  4NXN K;  4M7Y A;  1LAV A;  3CCR N;  3GL1 A;  4Q5V A;  3BF1 A;  5ELZ A;  2XY5 A;  2UXC K;  3TSQ A;  4O8U A;  1WN7 A;  1YUW A;  2Q97 A;  4C1N K;  1NGD A;  5AQT A;  1LAW A;  3VF6 A;  4A57 A;  4K8X A;  2CH6 A;  4DLE A;  4DR5 K;  3CQY A;  3WXL A;  4M45 A;  1JLB A;  1RDA A;  4IKF A;  4O0I A;  1NOY A;  4YHH K;  3O6W A;  4M3Y A;  1VAZ A;  3PY8 A;  3ZT4 A;  1Z6R A;  3LPT A;  3SYZ A;  1N34 K;  2O8E B;  3DI6 A;  3E01 A;  4CGH A;  2PYL A;  4DTR A;  2FBV A;  2O4G A;  2QEX N;  5CYM A;  3DOL A;  3KHY A;  3LPU A;  4OPH A;  4F2R A;  4FK2 A;  4E1J A;  3J80 O;  1RBU A;  5FRM A;  1TK0 A;  3FLC O;  4DSI A;  3CCV N;  2QWL A;  4A2A A;  4KHY A;  1LWC A;  3OJU A;  2P9L B;  2DFH A;  4FJJ A;  4B9Q A;  3K0S A;  3DLH A;  2VGM A;  3CME N;  3AAQ A;  3MXI A;  2I5J A;  4KI6 A;  4FZX C;  3O08 A;  3FFK B;  4OKK A;  1UAX A;  3BUZ B;  4KV8 A;  2YKM A;  1QZ5 A;  1J6Z A;  4UY8 O;  4BR2 A;  2E4L A;  3ZSV A;  3WT0 A;  4ZHR A;  1I3A A;  3ITH A;  5H1S Q;  3R1X A;  4FWK A;  2Q0R A;  1CXQ A;  3M8S A;  5M1K A;  5E41 A;  4NCA A;  3LWM A;  4OGE A;  2XY8 A;  2ITG A;  3DLK A;  1KXP A;  3HPG A;  3RMB A;  4Z4I A;  3O9R A;  3P31 A;  4ELT A;  4CBX A;  3QIP A;  4Z4E A;  4PUO A;  1Q82 O;  1NK6 A;  3L4I A;  3EL2 A;  3SQ1 A;  1TKD A;  1BHL A;  3ZCM A;  2NLX A;  5GIN A;  4EHU A;  1BCM A;  4IDH A;  5HRN A;  2ETJ A;  5DK5 A;  4OPJ A;  4DU3 A;  5AQX A;  1YJ9 N;  4BDZ A;  3HJF A;  3NBP A;  1JXE A;  3KLE A;  3V1Q A;  1HYS A;  4KHS A;  1GOC A;  4DTO A;  3LAN A;  3G6E N;  4B8A B;  4K42 A;  2Q0U A;  4OLB A;  4GVE A;  4DV7 K;  4J2A A;  3AGK A;  4CEF A;  4I7F A;  2G8U A;  5J2M A;  1BA0 A;  2E2O A;  1TUU A;  4LF8 K;  1RDB A;  5HRS A;  2X6S A;  1HKB A;  3EEQ A;  3F2K A;  5CYQ A;  4E7I A;  4KBO A;  4JKG B;  4CZE A;  1P90 A;  3CJ1 A;  2Z1G A;  1VSK A;  1TV6 A;  4IEE A;  1QVF M;  1IBK K;  4GY2 B;  2PBD A;  2ZM6 K;  4B08 A;  1JLC A;  4FWR A;  1WBD A;  3MWT A;  2HBJ A;  5AZJ B;  4CF2 A;  1KVA A;  3TAP A;  1JLA A;  4FJH A;  1QTM A;  3FZL A;  3CC4 N;  2G8K A;  2ZGZ A;  4H0O A;  4BR7 A;  1IG8 A;  4DU4 A;  3HRG A;  1KFD A;  1TK8 A;  5C15 A;  3F5T A;  1U4B A;  1JLG A;  2BH1 A;  3VEW A;  2O8B A;  4XH1 A;  3L2W A;  1KVB A;  3CF5 L;  2HMI A;  3J7A P;  4WQ5 C;  3SJH A;  3MWP A;  4NLB A;  4NCB A;  3EZ5 A;  1SKW A;  1Q18 A;  3E9O A;  3CFO A;  3AA3 A;  1VQP N;  4J2D A;  3FR0 A;  4CEQ A;  4QOZ B;  4C23 A;  3E1Y A;  2Q36 A;  3A8Y A;  1OH7 A;  3QER A;  2FSJ A;  4OKJ A;  3TTF A;  2VGN A;  1RTH A;  3SMS A;  1ASW A;  2UXB K;  3AA4 A;  2CGJ A;  2ZGY A;  4HCB A;  4HUF A;  4JK8 A;  1JCG A;  4B9N A;  3HO1 A;  3AVG A;  4DV2 K;  1XC9 A;  2QWQ A;  4JS4 A;  3CQ8 A;  1BO5 O;  2Z1J A;  4O5B A;  4A62 A;  1QSS A;  3MX5 A;  1RT2 A;  3CER A;  4KB1 A;  3L0Q A;  2BGG A;  3I56 N;  1KVC A;  4N47 A;  4I9Q A;  5HBM A;  4JS5 A;  4FXD A;  1B9D A;  3VGM A;  4FL9 A;  3ZT1 A;  5AQJ A;  5KQD A;  3QBX A;  4C8K A;  3WXJ A;  3HTV A;  2FC0 A;  1F21 A;  3LP0 A;  5C0Y A;  3RSE B;  5K14 A;  2A1S A;  2HND A;  2YNI A;  3THV A;  5F2R A;  2Y1J A;  4FLV A;  1UWB A;  2FF6 A;  2O8E A;  3CC7 N;  1S1X A;  1XMO K;  3NH2 A;  3AO2 A;  2QWO A;  2ZD1 A;  2W40 A;  4YDU A;  2RKI A;  3VER A;  4E0D A;  1U04 A;  2QK9 A;  4CGG A;  3G0Z A;  4A61 A;  4FZY A;  4CER A;  2J4R A;  2VWB A;  4FWS A;  3FE1 A;  3NDK A;  5HOO A;  1HYV A;  3SPZ A;  3DAW A;  4WQ4 C;  1GLD G;  4DV3 K;  2P9L A;  1ILY A;  4EZ6 A;  4AF1 A;  3DRR A;  3E9P A;  4AHU A;  1NMN A;  3FGU A;  4GW6 A;  1J53 A;  2KW4 A;  4PY5 A;  3UE5 A;  2W41 A;  4BRO A;  4AIL C;  3MEG A;  3AVL A;  4FYD A;  4YOY A;  1LOT B;  3WXI A;  1V4T A;  3VEZ A;  1WSI A;  4X66 K;  4CFB A;  1QHT A;  3ULD A;  4FK0 A;  4I9L A;  4B3R K;  2F9T A;  1GOB A;  4X64 K;  4KHP K;  1C1B A;  3KK7 A;  3TPQ A;  1VQ4 N;  1NLV A;  1OVQ A;  3K5O A;  3E66 A;  2RPI A;  4BDY A;  4CF0 A;  4CZJ A;  5JMV A;  1N5Y A;  4KHW A;  1SV5 A;  4DTM A;  4H0T B;  2JWK A;  1TKT A;  1DKG D;  3C95 A;  3C6A A;  5LJV A;  3DXM B;  4B9U A;  3WNG A;  5TKY A;  5LJW A;  4AM6 A;  1VQ5 N;  4BR0 A;  4CHO A;  3S3M A;  1KRP A;  4JI5 K;  1IH7 A;  3ZSX A;  1QSL A;  3VEV A;  4LF6 K;  3O8M A;  3QBW A;  2PFU A;  3O4W A;  3TAM A;  1L3S A;  4RCH A;  1BIZ A;  1YIT N;  4FWL A;  3ZSZ A;  1SAZ A;  3OYA A;  3PO5 A;  2QWR A;  1YJN N;  1SUQ A;  5JIC A;  4CHQ A;  1L3T A;  3V6D A;  4B9L A;  1D9F A;  3AAR A;  5CZ2 A;  4BRK A;  1I94 K;  3O9S A;  4PKG A;  2FXU A;  3NF9 A;  4CZL A;  3R9P A;  4F9O A;  4B3S K;  3WEE A;  2P5O A;  1LW0 A;  3DLE A;  3QFU A;  1KQS M;  3U8X A;  4JKG A;  4A5B A;  3CD6 N;  4FWP A;  2XY6 A;  4CD3 A;  1EKE A;  1RNH A;  4FJX A;  3D6R A;  4FM0 A;  3BP8 A;  3LDL A;  2VWK A;  1NJW A;  3H1Q A;  1NK0 A;  3K57 A;  5AQH A;  3MED A;  3KTQ A;  1ZBH A;  4CIG A;  5SWM A;  4RG8 A;  4DR3 K;  2D5R A;  4CEZ A;  3L6Q A;  4I2Q A;  2G8F A;  2ZE2 A;  3W0L A;  4AHR A;  1A5W A;  4BRQ A;  1A5X A;  3AA5 X;  3NHG A;  3ZSY A;  1K8A O;  3OYD A;  4F4K A;  3RRH A;  3QEX A;  4AHC A;  4JN4 A;  2HF3 A;  1VQL N;  2A40 A;  4BRN A;  3SMP A;  2DFF A;  3DLR A;  3VGL A;  2Y1I A;  4FLW A;  4JKE A;  2PYJ A;  4BRD A;  3HYF A;  1S1U A;  2P9N B;  4B9S A;  3HL8 A;  1YIJ N;  1EX4 A;  4LC9 B;  1C1A A;  3RMC A;  4W5O A;  4GKJ K;  3VQ7 A;  4OGC A;  2E20 A;  2DPN A;  2YHW A;  4FLT A;  1ZBF A;  3VQ4 A;  4IFY A;  3IKM A;  1UOC A;  2WFB A;  1RBS A;  3LP1 A;  2NRV A;  4IO8 A;  4MO5 A;  1A5V A;  3L2R A;  4HTL A;  2HBK A;  4CHZ A;  4JRP A;  4E7H A;  2E2P A;  2XO7 A;  1H1V A;  3AY9 A;  1Y64 A;  2P5G A;  3RSE A;  5LMN K;  4EP5 A;  1N8R O;  3CJ7 A;  3TAR A;  1YVU A;  3QEP A;  4LFA K;  3ZT2 A;  3PX0 A;  3TAB A;  2KFN A;  5KRS A;  4RW8 A;  3C6T A;  4CGI A;  3HM9 A;  1HYZ A;  4DWI A;  2HMP A;  1X1P A;  3QO9 A;  1S1V A;  2D0C A;  3QIC A;  1D8Y A;  1X9J A;  2AP1 A;  3T1A A;  1NGJ A;  2HW3 A;  3TAF A;  2W6L A;  3S3O A;  3TU5 A;  4B1U B;  2PZS A;  3W3D A;  4DSE A;  4U67 L;  4NXM K;  4JAX A;  4JK9 A;  3IG1 A;  4WFN L;  4CE9 A;  1ZBL A;  4I6M B;  3HP9 A;  2GBZ A;  3ZYY X;  4IOX A;  2O4I A;  3VPZ A;  2FSK A;  3OYC A;  2Q31 A;  1YF5 L;  2KZM A;  3M8R A;  3VQ5 A;  5AQV A;  1S72 N;  1EET A;  4DR4 K;  4JEP A;  3DMJ A;  1BIU A;  3H08 A;  4CF8 A;  5JVG L;  3KD1 E;  2HBM A;  5AQF A;  3ALY A;  4EHT A;  3VA0 A;  2V7Z A;  4CJW A;  4HUG A;  3HBT A;  1KAY A;  4Y0W A;  3OTO K;  3VEY A;  4IO9 L;  3O80 A;  3HOS A;  1QSY A;  1ZBI A;  3H6E A;  4FWQ A;  1WSG A;  3ENO A;  1C0M A;  3DXM A;  5MLC Q;  3UIQ A;  4CGD A;  4CZH A;  4JKF A;  1T44 A;  3CIP A;  1NM1 A;  3C6H A;  1TGO A;  4AM7 A;  5KTQ A;  4RTF D;  1WSE A;  2LSN A;  3AVB A;  4HTU A;  4TSX A;  5JS1 A;  3JXU A;  3VF2 A;  3LDQ A;  3VQP A;  4I2P A;  3ULE B;  1KCF A;  3DLG A;  1VQK N;  3RRG A;  2QWM A;  3HST B;  1ITG A;  3AVM A;  1S9G A;  5E84 A;  4H0Y B;  1L3V A;  5AFU H;  1J54 A;  4FM2 A;  2GTD A;  3PO4 A;  2ZJQ L;  3PV8 A;  4FJN A;  1Q9Y A;  5DMR A;  4YOW A;  4LF4 K;  1VSE A;  5EXW A;  1XHX A;  3FZH A;  3G71 N;  4CK1 A;  4BGB A;  4IFV A;  4M42 A;  5DM7 L;  4FJL A;  4RW9 A;  1OVY A;  3ZSW A;  3CFR A;  1RTI A;  4YDU C;  4YOX A;  1BU6 O;  3NF8 A;  4B1W B;  3LP3 A;  2A5X A;  4CEA A;  3V1O A;  3BDP A;  1NK8 A;  2HHQ A;  5BPL A;  4K8Z A;  4CI6 A;  3VQ6 A;  3KIO A;  3SQ0 A;  2GEL A;  4M3R A;  4DUZ K;  4BE0 A;  3DM2 A;  3QEV A;  1CZB A;  1SS6 A;  3AO4 A;  3AGR A;  3VEN A;  4JD2 B;  3HVT A;  2W6K A;  4CEC A;  2XRI A;  3A2F A;  4DTU A;  3QNO A;  4WE1 A;  1NJZ A;  2BE2 A;  4IOC L;  2RHK A;  3JS6 A;  2VWJ A;  3SPY A;  3OJS A;  5BPN A;  3CCQ N;  1E4G T;  1VHX A;  4ISG A;  4KHU A;  2OCE A;  2HHT A;  1GLL O;  4DSK A;  4FWM A;  4LF5 K;  3SI6 A;  4C8O A;  5BRH A;  4A2B A;  3ZSQ A;  4GV3 A;  1JCF A;  3VN5 A;  2P9N A;  4CJ7 A;  5M1P A;  1NWK A;  1TK5 A;  2A41 A;  2UYT A;  3M6G A;  5BPM A;  4BC5 A;  3CPE A;  5AR0 A;  4H03 B;  4Z4G A;  4Q0B A;  2P9S B;  1S6Q A;  3RR8 A;  4DUY K;  1ATR A;  1W2B M;  1KC8 O;  4HWI A;  2NRT A;  1EWR A;  2E6L A;  3J7Y P;  1W0H A;  1VQ9 N;  1QZ6 A;  5C2D A;  3CJC A;  3LAL A;  1XNR K;  3NH1 A;  3HPO A;  3L3V A;  2KQ2 A;  3NGY A;  1OH8 A;  2E88 A;  2HNY A;  4PL7 A;  1HRH A;  3M1F A;  1C1C A;  1NJY A;  5HLF A;  1U2V B;  3FZM A;  2DY4 A;  2Z1I A;  3AVF A;  4FCY A;  4DCH A;  2OPS A;  3VMF B;  2ASM A;  3JAM O;  3CCU N;  5KPR A;  2QA4 N;  3V81 A;  3VQE A;  5AQK A;  1RT7 A;  1R59 O;  5J2P A;  2DTU A;  4IJA A;  1XQS C;  4IBN A;  5AQS A;  4JRQ A;  3T19 A;  1YJW N;  1YHQ N;  4M63 C;  1CZA N;  2UUB K;  4WF9 L;  2BUP A;  1JLE A;  2IC3 A;  3HOT A;  3MX2 A;  3MMV A;  2GX9 A;  2KTQ A;  4GV9 A;  4IWV A;  3CFP A;  4I6M A;  3AO3 A;  3T1H K;  3T3F A;  3VQD A;  2P9U B;  3NVM A;  1BOT O;  3ASM A;  4KB0 A;  2FBX A;  5CHI A;  3HM8 A;  1RT1 A;  2WBN A;  5CY4 A;  1KAZ A;  2P51 A;  1HPZ A;  5F0X A;  2YV0 X;  4NCG A;  3I33 A;  3NAE A;  5AQL A;  1Z05 A;  1K73 O;  3SAH A;  4E1M A;  5HRP A;  2X74 A;  3I0R A;  4DSJ A;  3EE8 A;  4JI0 K;  5AZI B;  3V9U A;  1RT4 A;  3K9J A;  3OS2 A;  2HST A;  4CJ4 A;  3OS0 A;  4IEI A;  3QDK A;  4MQ3 A;  1S6P A;  5JLH A;  4CFC A;  4BG9 A;  1NGE A;  1SL1 A;  1DLO A;  4IDK A;  5T7B A;  1WSJ A;  3OYI A;  5D3G A;  4NO7 A;  4E7L A;  1QHA A;  2IAJ A;  2D1K A;  3SCX A;  1IKY A;  4KTW A;  2FLO A;  3WNH A;  3QML A;  4YOR A;  3AVC A;  3A0I X;  3JYT A;  4CHY A;  1BGX T;  2E1Y A;  3ULE A;  4DV1 K;  3JSM A;  2OZS A;  1L5U A;  2P9I B;  2BAN A;  4LFB K;  3CI5 A;  2EX3 A;  1JLF A;  2QXF A;  2HBL A;  2IDO A;  4M7X A;  1Q81 O;  3EN9 A;  4KTQ A;  5BN9 A;  1TL3 A;  3QNN A;  3KLI A;  4J8F A;  4U7B A;  1D9D A;  2F96 A;  1T6C A;  3CG7 A;  1OKJ A;  1RDC A;  3NE6 A;  1SL2 A;  1EO1 A;  3L3U A;  1HPM A;  4B9T A;  1NKB A;  4KAZ A;  4NLC A;  5JLF A;  4UQG A;  3LM9 A;  1RBT A;  4KFB A;  4HUE A;  4DS4 A;  4RW6 A;  3E9L A;  3HPH A;  3ZX3 A;  1NU0 A;  5CZ1 A;  3OS1 A;  1ZC6 A;  4R79 A;  1CLQ A;  4FOI A;  4JV5 K;  5TKW A;  4IG0 A;  4KKO A;  2Q1N A;  4BRG A;  4CJQ A;  2QTD A;  4DTX A;  1Q9X A;  4PA1 A;  3MN5 A;  1T7P A;  1QE1 A;  4FJ7 A;  2G8H A;  1T03 A;  3VQC A;  4PKI A;  4BRP A;  2E5L K;  3D45 A;  4ZTF A;  3PSI A;  1KLM A;  5HRO A;  2F7T A;  1VSH A;  4DU1 A;  1N32 K;  4AQY K;  4E1N A;  2QWN A;  3L8B A;  2D0A A;  3LM2 A;  2ITM A;  3HT3 A;  4ELV A;  2YKN A;  4JLH A;  4JD2 A;  1QQC A;  2YNG A;  3R8E A;  3I0S A;  4B1X B;  1C0T A;  2QM1 A;  4F2S A;  4CES A;  5KGX A;  4CJ5 A;  1K8K B;  1XHZ A;  3R6M A;  5SZT A;  5EU7 A;  5M1N A;  4BE1 A;  1K9M O;  2P9P B;  3UKU B;  1S1T A;  2IOC A;  2QW9 A;  1L3U A;  1BIS A;  2NNW A;  3VQB A;  3EZW A;  3O3H A;  1T3V A;  1IJJ A;  3P39 A;  1E4F T;  3TSP A;  1TYQ B;  4JNE A;  1SKS A;  2F8S A;  4RW4 A;  4DR6 K;  2GUI A;  2PY5 A;  3J8A A;  1O13 A;  2D4W A;  2IVN A;  2VYP A;  1BG3 A;  2Q3S A;  1IV0 A;  3QIO A;  1U48 A;  1K6Y A;  4FJ5 A;  4ISF A;  3MEC A;  5FDL A;  2ZJR L;  3THX B;  3IDH A;  2P9S A;  1FKO A;  4FJK A;  4JYA K;  1S22 A;  1TAU A;  1QVG M;  1HQU A;  1NJX A;  4DTJ A;  2G8I A;  3KK3 A;  1ZBS A;  2HB5 A;  3SUP A;  3HVR A;  2WC9 A;  2KKZ A;  1Q86 O;  4KH4 A;  1WAF A;  4PQU A;  4B3M K;  3CCL N;  3SUQ A;  3O5B A;  3H1V X;  1U2V A;  2F8T A;  3T1Y K;  4WYB A;  1FKP A;  3TTD A;  1IO2 A;  3CJA A;  2VQE K;  3BGR A;  5AFU A;  1GLF O;  2YJE A;  5J2Q A;  4ID1 A;  3VF4 A;  3VA3 A;  3NH0 A;  4YNQ A;  4BWJ A;  3ZT0 A;  3VTH A;  3GG4 A;  4Z4H A;  5M1O A;  3NGZ A;  1YXQ A;  2KLA A;  1N6Q A;  1HQE A;  4FM1 A;  3DRP A;  2NRW A;  3P4I A;  3NF6 A;  3TAN A;  3S41 A;  1XUP O;  3OYF A;  2UUC K;  1N36 K;  3NFA A;  3ZLJ A;  1BDG A;  4EAH D;  4OJR A;  4AHV A;  5CE3 A;  2P9U A;  2YCH A;  3MCA B;  4CW7 B;  2NUB A;  4MFB A;  5AZJ A;  4FJM A;  4E7J A;  4X65 K;  3SAF A;  4KPY A;  4L8R B;  4CD1 A;  3C65 A;  4B9V A;  3ID8 A;  4LH4 A;  4C1N I;  4FWN A;  4J2E A;  5C25 A;  2YHA A;  1IBM K;  3QB0 A;  4CVN E;  3D0P A;  3VQ8 A;  2HHX A;  3CJ9 A;  1S5J A;  4XH5 A;  3SK3 A;  1JJ2 M;  3V1R A;  5I3U A;  1Y97 A;  4O5F A;  1MWK A;  1BL3 A;  2ASO A;  2E1Z A;  4CFA A;  5I9E B;  4FPA A;  5AQW A;  4BR4 A;  3MN9 A;  3WQT A;  4N76 A;  4WFB L;  4YOU A;  4CHN A;  3O1B A;  5GAD P;  4JKC A;  4OPA A;  3KK2 A;  2OPP A;  1IBL K;  4DV5 K;  4F3O A;  3F9M A;  2YNF A;  4F3T A;  4NYF A;  3VOV A;  4CJV A;  1MA9 B;  4LF9 K;  1B9F A;  5ADX H;  1GOA A;  3I55 N;  1KTQ A;  1XI1 A;  3OYG A;  1GLC G;  4AHS A;  5AQI A;  4DV6 K;  5IT9 O;  2P9I A;  3B6O A;  1GLJ O;  4JI2 K;  3T7Z A;  3AAP A;  1Q7Y O;  1DEJ A;  4M3X A;  1JLQ A;  2O8D B;  5FLX O;  3P83 D;  3RR7 A;  4DQQ A;  1W7A A;  2F4V K;  1VSL A;  1D4X A;  2BTF A;  3LAK A;  1E3M A;  5GIO A;  4JKB A;  4DR7 K;  5AQG A;  3GE1 A;  3ISN C;  1JCE A;  3PX4 A;  3OY9 A;  4LSN A;  4OX9 K;  1XMQ K;  2OTL N;  3U9D A;  1EXQ A;  4BR9 A;  3TAQ A;  4CJU A;  3U6F A;  3CM5 A;  3AVH A;  3THY B;  2CH5 A;  4FJG A;  3OYJ A;  3VET A;  4KH5 A;  3C94 A;  5C2F A;  2B6A A;  1WUA A;  3ZSR A;  4HVJ A;  5JS2 A;  5BRF A;  5BRD A;  4BAC A;  2F9W A;  3MCP A;  4CK3 A;  4CJP A;  2VCP A;  3VES A;  4BRA A;  4E19 A;  3M8Q A;  2AA4 A;  4FPB A;  3TSU A;  3V9Z A;  1RGI A;  3L2U A;  1HNI A;  4BR5 A;  1RBR A;  5C42 A;  3M5R A;  4FVM A;  3IFR A;  2KFZ A;  4BQL A;  3K59 A;  1ASV A;  3MXM A;  1KAX A;  4M3W A;  2WON A;  4K41 A;  3DYA A;  3U3Y A;  3UKU A;  4DFJ A;  3DJC A;  4DS5 A;  1TYQ A;  3B8A X;  4BQZ A;  1IKX A;  1ASU A;  2B5J A;  1QQN A;  1HKG A;  4KHN A;  3IS9 A;  3GBT A;  4EFH A;  3V9X A;  4C8M A;  4MO4 A;  5BN8 A;  2A1R A;  4W5N A;  4ILH A;  1U6Z A;  3QIN A;  3THX A;  1Z25 A;  3BZK A;  4OO1 J;  1LCU A;  4HHT A;  1TUY A;  3U9Z A;  4CJK A;  4QS8 A;  3C0B A;  3KK1 A;  4DHY A;  5BR8 K;  1HJO A;  4LY7 A;  1QQM A;  3RVC A;  4BRH A;  3MAQ A;  4DQI A;  1YVN A;  3WXK A;  1NOZ A;  4LSL A;  4NB4 A;  2OZM A;  3O9Q A;  1XWL A;  3CPW M;  2O8F B;  4ILJ A;  4BVO A;  2ASP A;  4BRL A;  1NGC A;  1B92 A;  4JHD B;  4FLY A;  2E8A A;  3LDN A;  4JKH A;  4HCC A;  5AQP A;  4PL8 A;  1WNS A;  2ZWH A;  1D5A A;  3AO5 A;  1BCO A;  3I8B A;  3SQ4 A;  1W97 L;  1T8E A;  1S9E A;  4B1V A;  4IOA L;  1G15 A;  3CM6 A;  3FZK A;  4CZG A;  4B8C A;  1S3X A;  4EZ9 A;  2HNZ A;  4H5V A;  3VGK A;  5AQU A;  3HK2 A;  1M1K O;  3OA9 A;  4M3U A;  3K9K A;  4DQS A;  4XH4 A;  1WLJ A;  5FPM A;  3T69 A;  5AQR A;  2OPQ A;  4Y1C A;  1J5O A;  4IFE A;  1RDW X;  4PWD A;  3KD5 E;  4CZI A;  4DB3 A;  3HZ6 A;  2JWL A;  4DQR A;  4K0K K;  5C12 A;  1TAQ A;  1Z26 A;  4DR2 K;  4CEO A;  4W5T A;  4BC4 A;  4CF9 A;  3LL3 A;  1FW6 A;  5KI6 A;  2E2Q A;  3DWL A;  4NYN A;  3NMU A;  2HHW A;  3A5O C;  4B1Y B;  3OBW A;  5J1E A;  3LDP A;  4O8K A;  3SJJ A;  4H5T A;  1NKC A;  1YT3 A;  1WB9 A;  1YTU A;  1HUX A;  3UKR B;  1RIL A;  1NBW A;  3AVN A;  5F1X A;  3SUO A;  4GKK K;  1IG9 A;  1RT6 A;  3RTV A;  4JI8 K;  4KHQ A;  1BQN A;  3ZEU B;  4ID5 A;  3ID6 A;  3SV3 A;  3GOI A;  3BY5 A;  2B4J A;  3UB5 A;  1LW2 A;  3EYZ A;  1NJI O;  2KZZ A;  4FLU A;  1RTD A;  1OH6 A;  4QS7 A;  4OLA A;  4IZ9 A;  4PKH A;  4ISE A;  1TKX A;  3CJB A;  2O8D A;  1O1W A;  4DFM A;  4DTS A;  3MXJ A;  5CR4 A;  4Z4F A;  3SLC A;  4B3O A;  3OYL A;  1VSI A;  3OYK A;  3THW B;  4CIE A;  5GAG P;  4PHT X;  3ZT3 A;  3J7Z O;  5FRO A;  3THY A;  2XY7 A;  4K43 A;  4E3S A;  4DQP A;  4B9M A;  1BUP A;  1X9S A;  1RT3 A;  3U3G A;  4CJR A;  3M3Z A;  4CEE A;  2GWK A;  5KPT A;  1UA1 A;  1HNW K;  1DT9 A;  3DXK B;  4BRM A;  1J5E K;  3AVI A;  1TL1 A;  4CZK A;  2V7Y A;  4JI7 K;  1W9H A;  1JXB A;  2ZQB A;  1SQK A;  3LWL A;  4O44 A;  2D0O A;  4G1Q A;  2IVP A;  4CZF A;  3PIP L;  4CK2 A;  3CET A;  3CHW A;  3H3N O;  1ATS A;  3ZX2 A;  4Z0U A;  3L4Q A;  1EQY A;  3VTI A;  4BRC A;  3FZF A;  4GVM A;  4FZZ A;  1TKZ A;  4CF1 A;  1ESV A;  5AQN A;  4KRF A;  4JI1 K;  3WEE B;  5LY3 A;  3HXM A;  3L2Q A;  2UXD K;  3IRX A;  4DV0 K;  3KKS A;  4E89 A;  3G4S N;  5HL7 L;  3WQU A;  2P9K B;  3IMX A;  1NGF A;  4DKW A;  3LDO A;  4M3Z A;  4RW7 A;  3CCE N;  4H0X B;  5KPZ A;  3TAG A;  2QKK A;  3NGI A;  4LF7 K;  4ICL A;  3A5L C;  4N41 A;  1EP4 A;  4CJF A;  3ATU A;  4FOE A;  2IS3 A;  2YHY A;  4YOV A;  4JKA A;  2EHG A;  3C6U A;  3L2V A;  4L3Q A;  3KVG A;  1YAG A;  1VQO N;  1VK0 A;  2IVO A;  4X62 K;  3WNF A;  2HHU A;  4H5R A;  1LV5 A;  2GV9 A;  4IG3 A;  3TTC A;  5ADX A;  4DF8 A;  4DR1 K;  4GV6 A;  1VSD A;  4DSF A;  3BZC A;  3N4P A;  4M3T A;  1BA1 A;  5BRE A;  3O9U A;  2O8C B;  2O8F A;  2I7P A;  4AHT A;  4KTZ A;  4YOT A;  5LMU K;  3VQ9 A;  4LFC K;  3F9K A;  2H3G X;  3PIO L;  4JHD A;  3HP6 A; 
#chains in the Genus database with same CATH homology
 3NFA A;  1HJR A;  3OYC A;  1WAJ A;  3KKR A;  3B6P A;  2KZM A;  1CXQ A;  3M8S A;  3M8R A;  3VQ5 A;  5E41 A;  4NCA A;  3RMD A;  1EET A;  4OGE A;  3LWM A;  2XY8 A;  3S9H A;  2ITG A;  3DLK A;  4OJR A;  3DMJ A;  4FW1 A;  3O3G A;  4AHV A;  1BIU A;  4W5Q A;  3H08 A;  3HPG A;  4CF8 A;  2FBT A;  3RMB A;  4Z4I A;  3KD1 E;  3K5L A;  2NUB A;  4MFB A;  3ALY A;  4H4M A;  3OYN A;  4E7J A;  4FJM A;  3VA0 A;  4ELT A;  5I42 A;  4KPY A;  3QIP A;  4CJW A;  4HUG A;  4L8R B;  4B9V A;  4Z4E A;  4KB0 A;  4LH4 A;  4PUO A;  4J2E A;  1IKV A;  3LZI A;  2RF2 A;  2YHA A;  5C25 A;  3SQ1 A;  1TKD A;  1NK6 A;  2OYQ A;  1BHL A;  3OVN A;  3ZCM A;  3K58 A;  1QSY A;  1ZBI A;  3D0P A;  1BCM A;  5KGW A;  3VQ8 A;  5HRN A;  3SNN A;  2HHX A;  3AVJ A;  1S5J A;  1WSG A;  2ETJ A;  5DK5 A;  4OPJ A;  1C0M A;  3QEW A;  4DU3 A;  3UIQ A;  3V1R A;  4CGD A;  5I3U A;  4BDZ A;  1Q8I A;  1Y97 A;  3V9S A;  3HJF A;  3NBP A;  1TGO A;  1JXE A;  1BL3 A;  4BWM A;  3KLE A;  5KTQ A;  4CFA A;  1WSE A;  2LSN A;  4CJS A;  3V1Q A;  3AVB A;  4W5R A;  1HYS A;  3KLG A;  4KHS A;  1GOC A;  4FJ8 A;  3P1G A;  4TSX A;  4HTU A;  5JS1 A;  4DTO A;  3VQP A;  4N76 A;  1BI4 B;  3TR8 A;  2HHV A;  4I2P A;  3LAN A;  4CHN A;  1KCF A;  1UA0 A;  5C24 A;  3KK2 A;  2OPP A;  3DLG A;  4LD0 A;  4B8A B;  4F3O A;  4OLB A;  3RRG A;  2YNF A;  4CJT A;  4F3T A;  4J2A A;  4NYF A;  4CJV A;  4BDP A;  3HST B;  1B9F A;  1ITG A;  4CEF A;  3AVM A;  1GOA A;  1S9G A;  4I7F A;  1L3V A;  5J2M A;  2G8U A;  1J54 A;  1KTQ A;  1VSF A;  4FM2 A;  3PO4 A;  1XI1 A;  3OYG A;  3PV8 A;  4KRE A;  4FJN A;  1Q9Y A;  4M41 A;  2E6M A;  5DMR A;  3LDS A;  3SZ2 A;  4AHS A;  1RDB A;  5HP1 A;  1RDD A;  5HRS A;  2X6S A;  4E7I A;  3B6O A;  5CYQ A;  3OYH A;  1VSE A;  1U45 A;  4DSL A;  2Z1G A;  1XHX A;  1VSK A;  1TV6 A;  4M3X A;  1JLQ A;  4CK1 A;  2JLE A;  3P83 D;  3SUN A;  3RR7 A;  4B08 A;  1JLC A;  4DQQ A;  4IFV A;  4OKE A;  4M42 A;  4FJL A;  1VSL A;  4RW9 A;  1RCH A;  3V4I A;  3ZSW A;  3CFR A;  3LAK A;  1RTI A;  3P5J A;  4CF2 A;  3AVK A;  3M8P A;  3NF8 A;  1KVA A;  3TAP A;  3LP3 A;  3ISN C;  1JLA A;  3AV9 A;  4FJH A;  3PX4 A;  1QTM A;  5HRR A;  3TI0 A;  3OY9 A;  4LSN A;  4R5P A;  2G8K A;  4CEA A;  1EXQ A;  4DU4 A;  3TAQ A;  3V1O A;  1I39 A;  1KFD A;  3RMA A;  1TK8 A;  4CJU A;  3BDP A;  5FRN A;  3U6F A;  1U4B A;  3CM5 A;  1FXX A;  3AVH A;  1NK8 A;  1JLG A;  2HHQ A;  3LP2 A;  4FJG A;  4K8Z A;  3OYJ A;  3C94 A;  3VQ6 A;  1ZYQ A;  3L2W A;  3KIO A;  3SQ0 A;  2B6A A;  4M3R A;  1KVB A;  2HMI A;  3VQA A;  1LWF A;  4BE0 A;  3ZSR A;  4HVJ A;  3QET A;  3DM2 A;  3QEV A;  1CZB A;  5JS2 A;  4NCB A;  3AO4 A;  3PUF A;  3EZ5 A;  3K5M A;  1SKW A;  2VG7 A;  3CFO A;  3HVT A;  4CEC A;  4BAC A;  2XRI A;  4CK3 A;  3AA3 A;  3A2F A;  4CJP A;  4DTU A;  1KFS A;  3QNO A;  4J2D A;  1WSF A;  4QAG A;  4WE1 A;  1NJZ A;  4CEB A;  2BE2 A;  4E19 A;  1C6V A;  2G8V A;  3M8Q A;  4CEQ A;  4QOZ B;  3V9Z A;  3I8D A;  3G10 A;  2VWJ A;  3L2U A;  3SPY A;  3OJS A;  1HNI A;  1ZBU A;  1RBR A;  4KHU A;  3QER A;  4OKJ A;  5C42 A;  1X9W A;  4GMJ B;  1RTH A;  4FVM A;  2HHT A;  1ASW A;  2KFZ A;  3AA4 A;  3QLH A;  3OYE A;  4DSK A;  4F8R A;  2P1J A;  4HCB A;  3K59 A;  4FLZ A;  4HUF A;  1ASV A;  3AA2 A;  3SI6 A;  4C8O A;  4B9N A;  3HO1 A;  3MXM A;  3AVG A;  3ZSQ A;  4M3W A;  1XC9 A;  2WON A;  3DYA A;  4JS4 A;  3KLH A;  3CQ8 A;  1RBV A;  2Z1J A;  4O5B A;  3U3Y A;  3VN5 A;  1QSS A;  3AO1 A;  4DFJ A;  3O3F A;  1RT2 A;  3MEE A;  1TK5 A;  4OPK A;  4KB1 A;  2BGG A;  4FJ9 A;  1NK4 A;  1KVC A;  4N47 A;  4DS5 A;  4DTP A;  1HNV A;  4KI4 A;  4I9Q A;  5HBM A;  4JS5 A;  1S1W A;  4Z4G A;  4FXD A;  4Q0B A;  2X6N A;  1IKX A;  1ASU A;  1B9D A;  1S6Q A;  3RR8 A;  2WOM A;  3ZT1 A;  4DLG A;  3PX6 A;  2B5J A;  4FW2 A;  4C8K A;  4KHN A;  2FC0 A;  1F21 A;  3IS9 A;  3LP0 A;  4ZTJ A;  1VRT A;  3TAE A;  5K14 A;  2A1S A;  2E6L A;  4XIU A;  2FBY A;  2HND A;  2YNH A;  4C8M A;  1W0H A;  2YNI A;  2A1R A;  3THV A;  4W5N A;  2Y1J A;  4FLV A;  1QS4 A;  1UWB A;  3LAL A;  2VG6 A;  3QIN A;  2RN2 A;  1S1X A;  3NH1 A;  3HPO A;  1Z25 A;  4CCH A;  3NH2 A;  3L3V A;  3AO2 A;  2KQ2 A;  3NGY A;  1X9M A;  2ZD1 A;  4HHT A;  5KRT A;  2RKI A;  2HNY A;  1JL2 A;  2OPR A;  1HRH A;  1C1C A;  1NJY A;  5HLF A;  4ELU A;  4E0D A;  3CYM A;  4CJK A;  1U04 A;  2QK9 A;  2Z1I A;  3AVF A;  4OVL A;  4CGG A;  3KK1 A;  3G0Z A;  4FZY A;  2DY4 A;  4CER A;  4FCY A;  2OPS A;  3TWH A;  1IG9 A;  2AJQ A;  4LY7 A;  3NF7 A;  3NDK A;  1VRU A;  3MAQ A;  4DQI A;  1HYV A;  3V81 A;  2Z1H A;  3VQE A;  3SPZ A;  1NOZ A;  1C0U A;  1RT7 A;  1VSJ A;  4EZ6 A;  5J2P A;  2DTU A;  3DRR A;  4LSL A;  4AHU A;  4H4O A;  4IBN A;  2OZM A;  4CGJ A;  2QKB A;  4N56 A;  2BDP A;  3IAY A;  4GW6 A;  1XWL A;  4JRQ A;  1J53 A;  3T19 A;  2KW4 A;  4PY5 A;  4CHP A;  2ATQ A;  4DF4 A;  1B92 A;  1JLE A;  2IC3 A;  4FLY A;  1KSP A;  2D0B A;  4FLX A;  4AIL C;  2KTQ A;  3MEG A;  3AVL A;  4YFU A;  4CJ3 A;  4FYD A;  4HCC A;  1WSI A;  4CFB A;  1QHT A;  3CFP A;  1WNS A;  3ULD A;  4FK0 A;  1D5A A;  3AO5 A;  4I9L A;  3AO3 A;  1BCO A;  1GOB A;  3SQ4 A;  3T3F A;  3VQD A;  3O4N A;  1C1B A;  3WNE A;  1T8E A;  4QCL A;  1DTQ A;  1S9E A;  3K5O A;  3DRS A;  2RPI A;  3ASM A;  3AVA A;  2FBX A;  4BDY A;  2IGI A;  4H8K A;  1G15 A;  3CM6 A;  4CF0 A;  4CFD A;  1N5Y A;  4EP4 A;  1RT1 A;  4KHW A;  4B8C A;  1U47 A;  1SV5 A;  4O55 A;  1REV A;  5CY4 A;  2P51 A;  4O0J A;  1HPZ A;  4KO0 A;  4DTM A;  2YV0 X;  4N5S A;  4DFP A;  3EY1 A;  4NCG A;  4EZ9 A;  4FK4 A;  1DTT A;  1RT5 A;  2HNZ A;  1TKT A;  1SKR A;  3NAE A;  1YTA A;  3HK2 A;  3C95 A;  1NK9 A;  4E1M A;  4M3U A;  4DQS A;  5HRP A;  2X74 A;  1WLJ A;  4B9U A;  3K5N A;  3WNG A;  1NK7 A;  2OPQ A;  3QEI A;  3KLF A;  3I0R A;  4Y1C A;  1J5O A;  4DSJ A;  3NCI A;  4PWD A;  3KD5 E;  4CHO A;  1JKH A;  3S3M A;  1KRP A;  3V9U A;  2HVI A;  1IH7 A;  1RT4 A;  3ZSX A;  3V9W A;  4DQR A;  1QSL A;  4DG1 A;  2W42 A;  4FJI A;  1TAQ A;  1Z26 A;  3OS2 A;  1CZ9 A;  4CJ4 A;  4CEO A;  3LZJ A;  3OS0 A;  4W5T A;  3TAM A;  4CF9 A;  1L3S A;  2R7Y A;  4MQ3 A;  1S6P A;  3ZSO A;  5KI6 A;  4CFC A;  1BIZ A;  4NYN A;  1SL1 A;  1DLO A;  4IDK A;  3ZSZ A;  5T7B A;  1J9A A;  1LWE A;  1WSJ A;  4AH9 A;  3OYI A;  4E7L A;  5D3G A;  2HHW A;  3OYA A;  2IAJ A;  3SCX A;  1IKY A;  4KTW A;  3WNH A;  5J1E A;  3PO5 A;  3SV4 A;  4CIF A;  3AVC A;  3K2P A;  3SJJ A;  3RWU A;  3JYT A;  1NKC A;  2HVH A;  1BI4 A;  4CHY A;  1BGX T;  1YT3 A;  1YTU A;  1SUQ A;  1RIL A;  3JSM A;  2OZS A;  4CHQ A;  3AVN A;  1L3T A;  1L5U A;  2VG5 A;  2XHB A;  3SUO A;  1RT6 A;  4CGF A;  3V6D A;  1RTJ A;  1WSH A;  2BAN A;  3RTV A;  1NKE A;  4BE2 A;  2EX3 A;  1D9F A;  4B9L A;  1JLF A;  2QXF A;  5CZ2 A;  2IDO A;  1TVR A;  4J2B A;  4KHQ A;  1BQN A;  4ID5 A;  3SV3 A;  4KTQ A;  3OYM A;  2B4J A;  3NF9 A;  4E7K A;  3DLB A;  1TL3 A;  1LW2 A;  3EYZ A;  3QNN A;  3KLI A;  1D9D A;  2KZZ A;  1MU2 A;  2F96 A;  3CG7 A;  4Z4C A;  1SL0 A;  1LW0 A;  3DLE A;  1HMV A;  2P5O A;  1RDC A;  3NE6 A;  4FLU A;  1RTD A;  4DFK A;  1SL2 A;  4OLA A;  3L3U A;  4B9T A;  3FFI A;  2XY6 A;  1NKB A;  1EKE A;  1TKX A;  1RNH A;  4KAZ A;  4FJX A;  4LH5 A;  4UQG A;  4DTN A;  3OYB A;  1O1W A;  4DFM A;  4FM0 A;  4DTS A;  1RBT A;  3F73 A;  4KFB A;  4HUE A;  2VWK A;  4DS4 A;  4RW6 A;  1NJW A;  4CED A;  1NK0 A;  3HPH A;  3K57 A;  1IKW A;  3MXJ A;  2JGU A;  4Z4F A;  4B3O A;  5CZ1 A;  1KLN A;  3OYL A;  3MED A;  3OS1 A;  3QES A;  3SQ2 A;  3KTQ A;  1CLQ A;  1ZBH A;  4CJL A;  1VSI A;  1JL1 A;  4IG0 A;  4KKO A;  4CJQ A;  4CIG A;  5SWM A;  4DTX A;  3OYK A;  1Q9X A;  4PA1 A;  4C8L A;  4CIE A;  1T7P A;  1QE1 A;  1FK9 A;  3VQQ A;  2YHB A;  3ZT3 A;  2G8W A;  4FJ7 A;  4RG8 A;  1T03 A;  3VQC A;  2G8H A;  2D5R A;  3HP6 A;  4CEZ A;  5FRO A;  3D45 A;  4I2Q A;  2XY7 A;  4ZTF A;  2G8F A;  2ZE2 A;  1KLM A;  4E3S A;  4DQP A;  4AHR A;  5HRO A;  4B9M A;  1A5W A;  1VSH A;  1RT3 A;  4DU1 A;  1X9S A;  5J2N A;  3U3G A;  1R0A A;  4CJE A;  3DOK A;  4CJR A;  4O4G A;  1A5X A;  3AA5 X;  4CEE A;  4DMN A;  4E1N A;  3NHG A;  3ZSY A;  1UA1 A;  2X78 A;  3L8B A;  1VSM A;  2D0A A;  3OYD A;  2DFE A;  4F4K A;  3HT3 A;  1T05 A;  3AVI A;  4ELV A;  1U49 A;  2YKN A;  4JLH A;  3RRH A;  1TL1 A;  2HHS A;  3KJV A;  3QEX A;  4AHC A;  1QQC A;  2YNG A;  1BQM A;  1W9H A;  1JXB A;  2ZQB A;  3I0S A;  3LWL A;  4O44 A;  3S3N A;  2OA8 A;  1C0T A;  4C8N A;  2DFF A;  4G1Q A;  4F2S A;  4CES A;  3DLR A;  4Y1D A;  5KGX A;  3LAM A;  4CJ5 A;  4CK2 A;  2Y1I A;  4FLW A;  1CXU A;  1XHZ A;  3O4Q A;  1NK5 A;  2PYJ A;  1LAV A;  5SZT A;  4Q5V A;  5EU7 A;  3HYF A;  1S1U A;  4BE1 A;  4Z0U A;  2XY5 A;  1L3U A;  1S1T A;  2IOC A;  1WN7 A;  3HL8 A;  4B9S A;  4GVM A;  1BIS A;  1EX4 A;  1C1A A;  3RMC A;  4W5O A;  3VQ7 A;  3VQB A;  4OGC A;  3O3H A;  4FZZ A;  1TKZ A;  4CF1 A;  4KRF A;  1LAW A;  4FLT A;  4K8X A;  3HXM A;  3L2Q A;  1SKS A;  1ZBF A;  3IRX A;  4RW4 A;  2F8S A;  4DLE A;  2GUI A;  2PY5 A;  3KKS A;  4E89 A;  4M45 A;  3VQ4 A;  1JLB A;  4IFY A;  1RDA A;  1UOC A;  2Q3S A;  4O0I A;  4IKF A;  1NOY A;  1RBS A;  3LP1 A;  3QIO A;  4M3Y A;  1U48 A;  1K6Y A;  1A5V A;  4FJ5 A;  3PY8 A;  3ZT4 A;  3MEC A;  3L2R A;  5FDL A;  3LPT A;  3SYZ A;  4M3Z A;  4RW7 A;  4CHZ A;  4JRP A;  3DI6 A;  3V9X A;  3E01 A;  1FKO A;  4CGH A;  4E7H A;  4FJK A;  3TAG A;  2XO7 A;  2PYL A;  2QKK A;  3NGI A;  4DTR A;  2FBV A;  4ICL A;  1TAU A;  2O4G A;  4N41 A;  2G8I A;  1EP4 A;  1HQU A;  5CYM A;  4DTJ A;  3KK3 A;  3DOL A;  1NJX A;  2P5G A;  4CJF A;  3LPU A;  4EP5 A;  4F2R A;  4FK2 A;  2HB5 A;  2IS3 A;  1YVU A;  3SUP A;  3QEP A;  3TAR A;  3HVR A;  1RBU A;  2EHG A;  3C6U A;  3ZT2 A;  3L2V A;  3PX0 A;  5FRM A;  1TK0 A;  3TAB A;  2KFN A;  5KRS A;  1WAF A;  4DSI A;  4KHY A;  4PQU A;  4RW8 A;  3C6T A;  1LWC A;  1VK0 A;  4CGI A;  3OJU A;  1HYZ A;  3HM9 A;  3SUQ A;  4DWI A;  2O4I A;  2DFH A;  1X1P A;  3QO9 A;  4FJJ A;  1S1V A;  3WNF A;  2HHU A;  2D0C A;  2F8T A;  1D8Y A;  3DLH A;  1FKP A;  3MXI A;  1LV5 A;  2I5J A;  3T1A A;  1IO2 A;  4KI6 A;  4FZX C;  2HW3 A;  2GV9 A;  4IG3 A;  3TAF A;  4OKK A;  1UAX A;  3BGR A;  3S3O A;  5J2Q A;  4DF8 A;  2PZS A;  4ID1 A;  4DSE A;  1VSD A;  4DSF A;  3VA3 A;  4KV8 A;  2YKM A;  3IG1 A;  4M3T A;  3NH0 A;  4YNQ A;  4CE9 A;  1ZBL A;  3HP9 A;  4BWJ A;  3ZT0 A;  4Z4H A;  3NGZ A;  4AHT A;  1N6Q A;  4KTZ A;  1HQE A;  2E4L A;  3VQ9 A;  3ZSV A;  4FM1 A;  3DRP A;  3F9K A;  3NF6 A;  2GBZ A;  3TAN A;  3OYF A;  4ZHR A;  1I3A A;  3ITH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...