1RCHA

Solution nmr structure of ribonuclease hi from escherichia coli, 8 structures
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Ribonuclease Hi from Escherichia Coli
pubmed rcsb
molecule tags Endonuclease
molecule keywords RIBONUCLEASE HI
total genus 35
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1995-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rchA00
3K59A 3K5NA 4CHNA 3SI6A 1C1CA 4DSIA 1T05A 3SPZA 4QAGA 3NH0A 4FJ7A 3OYAA 2I5JA 4LH5A 4FVMA 4CERA 3K5MA 1JLFA 3ZSVA 4M3YA 4NYNA 1ZBLA 3VA3A 4HCBA 4F3OA 3HL8A 4AHTA 3SCXA 4ZHRA 3HXMA 5HROA 1L3UA 3AO1A 2X6NA 5FROA 3AA5X 3VQBA 4PWDA 3ASMA 2R7YA 1TAQA 1WN7A 3OJSA 3UIQA 3L2VA 4ICLA 1Q9YA 1KCFA 4KHNA 2DFFA 4CECA 1VSMA 2RN2A 1TKZA 3AVBA 1VRTA 3T1AA 4E0DA 5KRTA 1QTMA 2HHSA 2XY8A 4NCGA 5SWMA 1FKOA 3KLHA 4M3ZA 1SL0A 4FLXA 3VQPA 2AJQA 3C6UA 4CK1A 3DOKA 1U4BA 4FXDA 4DQPA 1YT3A 4EP5A 4DFMA 2ZQBA 4ZTJA 1U45A 1FKPA 2HB5A 3NFAA 3T3FA 4CJ4A 4CFCA 3OYBA 3SJJA 5C25A 3NF9A 4B9SA 1B9DA 1LW2A 1T7PA 4CJSA 2OPPA 3AV9A 1NJZA 1NK0A 3AVHA 2YKNA 3TAQA 2Q3SA 3NGZA 4Z4HA 1KVAA 1ZYQA 2YNHA 3VQ6A 4CF2A 4FK4A 1S1TA 4RW6A 3U3GA 3RR8A 4CF9A 4N47A 4W5RA 3S3OA 2VG6A 1A5VA 1BI4A 3ZT0A 3ZSZA 3QETA 3VQ9A 3OYCA 4DLEA 1U04A 3EYZA 3ZT2A 4AHRA 1YTUA 5HRRA 1NKEA 1L3SA 5KI6A 2G8HA 2ETJA 1JLAA 3LP0A 3MECA 4FJKA 2FC0A 2FBYA 2RKIA 4I2QA 4CESA 1S6QA 3TAFA 1RT7A 2OYQA 3AVAA 3LZJA 3PX0A 4KKOA 1RBTA 3ZSRA 2B4JA 4I9QA 3K58A 3SUNA 1IG9A 2XY7A 3PO5A 1BCMA 3QNNA 4HUGA 4B9MA 5K14A 4EZ9A 3KLIA 5CYMA 4PUOA 3OS0A 1JLQA 1BL3A 2WONA 1TV6A 4FJ5A 3O3GA 3OYHA 1HNIA 5CY4A 4DF8A 1UOCA 4H8KA 3DLRA 4Q5VA 4KHUA 3QLHA 4EZ6A 1KVBA 3AVJA 4DTRA 4CJTA 4LH4A 3TABA 1ASVA 4FW1A 3C94A 3VA0A 3BDPA 4CEQA 1RDBA 1GOAA 3D45A 3TI0A 3HYFA 4KHQA 5HBMA 4M3WA 4FJ8A 4JS5A 4CGDA 1UWBA 4B8AB 3DM2A 1C0TA 1UAXA 2HHVA 3A2FA 1HNVA 3NE6A 2G8WA 2KW4A 4CJUA 3NCIA 4DSFA 4B9VA 3RR7A 4DSLA 4F8RA 1JLEA 1RDAA 4DLGA 3PUFA 4J2AA 3JYTA 2A1SA 3IRXA 4DTXA 1T03A 4CCHA 1KFSA 4KB0A 3C6TA 4DS5A 2F8SA 3V1QA 1WNSA 1I39A 2HVHA 3QEPA 4FM0A 2W42A 4AHVA 1N5YA 1TK5A 4C8OA 4DTMA 1S9GA 4IFVA 4DFKA 1BQNA 1N6QA 3QEIA 4F4KA 2X6SA 4CJRA 1IKXA 4Y1DA 1D8YA 1VSJA 4GW6A 4DS4A 4DU1A 3LP3A 4B08A 4FK2A 3L8BA 2DY4A 2A1RA 3ULDA 4CJ3A 1S9EA 5C24A 1ITGA 1WAFA 4DTPA 1XI1A 4KTQA 1WSEA 3AVLA 3V9WA 3EY1A 1W9HA 3RRGA 5E41A 4ELVA 1TVRA 1X9WA 3ZSXA 1A5XA 2D0AA 4O0IA 3OYFA 1NK5A 1SL1A 3P1GA 4M3XA 1DLOA 4QCLA 1EX4A 4RG8A 2HMIA 2YV0X 3TAEA 1KFDA 4M3UA 1TKDA 5FRNA 3L2RA 2QK9A 4AHUA 1EETA 4DTOA 2Y1IA 1FXXA 1WSFA 3AA3A 3ZT3A 2JLEA 3OYLA 5SZTA 3I0SA 1JLCA 3CG7A 3MEEA 4DG1A 3KD1E 4CJEA 3DI6A 4CJQA 3G0ZA 4H4MA 4KFBA 5HP1A 4HUEA 3MEDA 4BWMA 4E7LA 4FJNA 3B6OA 1TGOA 3OYDA 3C95A 2HHXA 4DMNA 3QERA 4CFBA 3QIOA 3LAKA 5DK5A 4LY7A 1XHZA 1LV5A 1VSDA 2QKKA 4Z4IA 3SQ4A 2IC3A 3NF8A 2E4LA 1JLGA 4IG3A 4W5QA 3OYKA 1WSGA 4C8NA 4LD0A 3JSMA 1L3VA 1FK9A 4WE1A 1JXEA 3E01A 3ZCMA 1TK0A 3KTQA 4CGGA 5D3GA 4KREA 4W5NA 5FDLA 3NBPA 3LP2A 2VG5A 5T7BA 4FCYA 4DFPA 3K2PA 3AVGA 3K57A 4DFJA 1U49A 3OYJA 2YNIA 2PZSA 1NK6A 4I2PA 3SZ2A 4FK0A 1VRUA 3FFIA 3WNFA 4CEBA 3U6FA 4JRPA 3TANA 4Q0BA 1TAUA 2QKBA 3KD5E 3HO1A 2ITGA 4OGCA 4CIFA 2EHGA 2G8KA 3DMJA 4CF8A 3SNNA 1HMVA 4DF4A 1B92A 3QINA 4IKFA 2P1JA 1NJYA 4E7JA 2O4GA 4BE0A 3KLGA 3ZT1A 4C8LA 1F21A 5HRPA 4OPKA 3LWLA 1RT2A 3SV3A 4NCBA 1LAWA 2O4IA 4E1MA 1ZBFA 4CEFA 2IGIA 3ZT4A 2BDPA 4C8KA 2Y1JA 2VG7A 4I7FA 4CGFA 1QSSA 4LSNA 1BIUA 3DRPA 3RMCA 4B9LA 1WLJA 3RMDA 4CJ5A 3LPTA 1WSHA 3TWHA 3S3NA 4N76A 1Y97A 3SYZA 1SKSA 1NKCA 1D9DA 4Z0UA 1ZBUA 2IAJA 4CJLA 3HM9A 1SV5A 2VWJA 3M8RA 2XO7A 3CFOA 1SKWA 2PYJA 2OZMA 3F9KA 3PY8A 1Q8IA 3DLKA 2P5GA 1RCHA 1EP4A 3LAMA 3MAQA 2B6AA 1SL2A 4CJWA 1XWLA 2XHBA 4HHTA 1IO2A 1QSYA 2DFEA 4FLTA 1JL2A 2BE2A 4FLVA 4HVJA 4JRQA 1NK7A 4B9UA 5JS1A 4N41A 2F8TA 3PX4A 3ISNC 3LANA 4CGJA 3LDSA 3D0PA 3P83D 3RRHA 1TK8A 3O3HA 3ZSOA 4K8ZA 4CHPA 4KRFA 4KHSA 4E89A 3NDKA 4N56A 3PX6A 2BANA 4AHSA 2P5OA 1BQMA 1G15A 4B9TA 1HRHA 3PV8A 4J2BA 1C1BA 3TAGA 1JLBA 5I3UA 1J9AA 1C6VA 3LALA 3F73A 5J2PA 4CEOA 4KAZA 4F2RA 1VSFA 1XHXA 2XY5A 4CEZA 5J2NA 4KI4A 1RTHA 2EX3A 1CZ9A 4MFBA 4F2SA 4FYDA 4M41A 1TL1A 4OJRA 4CIGA 4M3TA 2YHBA 3VQQA 4YNQA 1KSPA 3AVIA 3LZIA 2OPSA 1RBSA 4FJJA 3ITHA 3HVRA 1S1UA 2OZSA 3AVNA 1QE1A 4KPYA 1LAVA 1NOYA 3RWUA 4N5SA 4FLUA 1T8EA 3HK2A 3V9SA 4CF0A 1DTQA 3O3FA 2HHWA 1S5JA 3VQDA 3VQAA 4DWIA 3V81A 1BIZA 3I0RA 4CHQA 4DU4A 1SKRA 3DLGA 4DSKA 3V9XA 1WSJA 2HHTA 3P5JA 3VQ4A 3M8QA 3DLEA 3QIPA 3OYMA 4Y1CA 4B8CA 4PQUA 4C8MA 4UQGA 3V1OA 1HPZA 3AVMA 3HT3A 4OKEA 3ZSYA 3K5OA 4E7KA 4KHYA 3L2QA 1RTDA 2ATQA 1YVUA 2NUBA 3MXJA 4E7HA 3V1RA 1GOBA 3NH2A 4DTSA 1S1VA 3V6DA 4Z4FA 3SUPA 3QESA 2DTUA 5FRMA 3LP1A 1D5AA 3HP9A 4E1NA 4HUFA 4JLHA 4ELTA 4W5TA 4HCCA 3SUOA 4AILC 1REVA 4CHZA 3M8SA 4BDZA 1C0MA 5CZ2A 4BDYA 5HLFA 1GOCA 2DFHA 1KLNA 3HPHA 4DTJA 1MU2A 3PO4A 4IG0A 4OPJA 4BACA 2G8UA 4J2EA 1QQCA 1TL3A 3ZSWA 5KGXA 3V9UA 4J2DA 4OLAA 3TAPA 2YKMA 1RT3A 1QS4A 1IKYA 3DOLA 1Q9XA 4DQRA 5CZ1A 4FLWA 4CFDA 1B9FA 1VSHA 3HSTB 3KKRA 5J2QA 4O0JA 3S9HA 4CF1A 1TKTA 4FLZA 1ASUA 3L2UA 4H4OA 1C1AA 1S1WA 4FJXA 3CQ8A 1J53A 3RMAA 3RTVA 5HRNA 3OJUA 4ID1A 1VSLA 3IS9A 1NK8A 3HJFA 2KFZA 2KQ2A 4G1QA 4KO0A 3TARA 4FZYA 3H08A 3DRRA 4AH9A 3AO2A 4E3SA 1K6YA 4ID5A 4XIUA 5DMRA 1BHLA 4RW9A 3OYNA 4CIEA 3SUQA 3V4IA 4KHWA 1WSIA 3EZ5A 4OGEA 3B6PA 3L3UA 4DSJA 3VQ5A 2KFNA 1J5OA 2IS3A 1HYVA 3O4NA 5C42A 3OYGA 3THVA 1SUQA 4BDPA 3WNEA 4DTNA 3QEVA 1LWEA 4M45A 4M3RA 1RNHA 4FM1A 3QNOA 1NJWA 3RMBA 2HNDA 1R0AA 3LWMA 4FJGA 4NCAA 4CJPA 1L3TA 4I9LA 4DQQA 1CZBA 3KK1A 1W0HA 3AA2A 2B5JA 3LPUA 1IH7A 1JL1A 5HRSA 3OS1A 3OYIA 4CK2A 1ZBIA 3KLEA 2BGGA 4LSLA 1CLQA 5KTQA 4Z4EA 3QEWA 3TAMA 1ZBHA 3OS2A 4FW2A 3DLHA 5J2MA 4CEEA 1S6PA 4KTWA 4CGIA 4CJFA 3OYEA 3CYMA 4KV8A 2HHQA 1KLMA 3AO5A 3AVFA 1J54A 4IBNA 3L2WA 2D5RA 3VQEA 3KKSA 3NGIA 3WNHA 2Z1JA 2P51A 1BGXT 2X74A 4RW8A 3OVNA 5CYQA 1S1XA 4IFYA 4MQ3A 3VQ7A 3HPGA 3HP6A 3S3MA 4TSXA 1RT5A 3SQ2A 3AVKA 2G8VA 4HTUA 3QO9A 3VQ8A 2IOCA 4E19A 4OKJA 1QSLA 4FJLA 3CFPA 1X9MA 4YFUA 1KTQA 3KIOA 3WNGA 2HNYA 4KTZA 1U47A 2G8IA 1CXUA 4CEAA 2YNFA 1NKBA 4OVLA 1KVCA 3HPOA 3SQ1A 4QOZB 3OY9A 1UA0A 4IDKA 2XRIA 2ZD1A 4CFAA 4CHOA 4FJHA 1VSIA 3ZSQA 4R5PA 1BI4B 1RDCA 3IAYA 3DLBA 2WOMA 4FZZA 1TKXA 4CGHA 4KB1A 2RPIA 2HW3A 3NH1A 4M42A 1EKEA 1JKHA 2GBZA 4GMJB 3K5LA 1X1PA 4O5BA 4FM2A 3SPYA 3IG1A 4FJIA 2KZZA 1YTAA 2GUIA 5I42A 3CM6A 3L3VA 3CFRA 3I8DA 2G8FA 4B9NA 3MXMA 3KLFA 4AHCA 4ELUA 4BWJA 4W5OA 1I3AA 4FLYA 4GVMA 4CEDA 2LSNA 3O4QA 3VQCA 2XY6A 4RW4A 4FJMA 1NOZA 1BCOA 3SQ0A 1RT1A 1RBUA 1UA1A 2HHUA 1RBVA 2E6LA 3DYAA 5KGWA 2Z1GA 4BE2A 2D0BA 1DTTA 1O1WA 3NF7A 2F96A 3HVTA 3NAEA 4NYFA 3SV4A 2X78A 4RW7A 2OA8A 1RILA 1RBRA 4PA1A 5KRSA 2QXFA 4DSEA 4OKKA 3KJVA 4KI6A 4O55A 2VWKA 1EXQA 2KZMA 1WAJA 1RTJA 1VK0A 3V9ZA 2FBXA 1LWCA 1RT4A 2E6MA 4EP4A 1A5WA 2OPRA 4CJVA 4Z4GA 3M8PA 3T19A 2D0CA 4OLBA 2Z1HA 3DRSA 4CE9A 4B3OA 2PY5A 2FBTA 1HYZA 1RDDA 3AO4A 1NK9A 4K8XA 2HNZA 2IDOA 5JS2A 1U48A 2ZE2A 4CHYA 2FBVA 4DQSA 3U3YA 3CM5A 4FJ9A 1RT6A 3AVCA 1IKWA 3MEGA 3NGYA 3AO3A 1HJRA 1RTIA 2RF2A 3NF6A 1ASWA 4Z4CA 4CJKA 3BGRA 1HQEA 1IKVA 3KK3A 4JS4A 4BE1A 2YNGA 3KK2A 1KRPA 3ALYA 4FZXC 1C0UA 3AA4A 2YHAA 5J1EA 4E7IA 3QEXA 2PYLA 4L8RB 4ZTFA 1NJXA 5EU7A 1VSKA 2HVIA 1HQUA 4DU3A 3VN5A 1QHTA 1NK4A 1BISA 4O4GA 1D9FA 3NHGA 4F3TA 2KTQA 1XC9A 3MXIA 1Z26A 1LWFA 2GV9A 2OPQA 2Z1IA 1X9SA 1Z25A 4CK3A 4O44A 1L5UA 1LW0A 1CXQA 1JXBA 1VSEA 2JGUA 3TR8A 4DTUA 4PY5A 3G10A 4DQIA 1HYSA
chains in the Genus database with same CATH superfamily
4IDHA 3SI6A 4DSIA 4IOXA 4QAGA 4FJ7A 4JKCA 4CERA 1JLFA 3ZSVA 4K43A 1M90O 1QZ5A 4F3OA 4IEIA 5HROA 3AA5X 1WN7A 3UKRA 3UIQA 4ICLA 1KCFA 2HF4A 4CECA 4J8FA 2RN2A 4B3RK 3QB0A 2KKZA 5KRTA 2HHSA 2HBKA 1OH5A 4GV3A 4FLXA 1QQNA 2ZQBA 4ZTJA 2RE2A 4CJ4A 4JEPA 1VQ7N 2P9SA 1NNEA 2CH6A 3AVHA 1HJOA 2Q3SA 1VQMN 3NGZA 4Z4HA 2YNHA 4L3QA 4CF9A 2IVNA 1A5VA 2P9SB 2E1YA 2A40A 3QETA 1YVNA 3EYZA 1YTUA 1L3SA 2ETJA 3CJBA 3LP0A 5AQGA 2FC0A 3HOSA 4I2QA 5AFUH 4EIAA 5BN8A 1RBTA 3R1XA 4JK9A 3K58A 3QNNA 1NMNA 4CZEA 4EZ9A 3KLIA 2BTFA 4PUOA 2WONA 2P9UB 4A2AA 3O3GA 4CZJA 1HNIA 5CY4A 2YCHA 1V4SA 2O8CA 5FPEA 4QS7A 5FPMA 4EZ6A 2HBMA 4DTRA 4IFEA 4H0VB 1JCEA 4FW1A 4FWMA 3TI0A 1YIJN 5EY4A 3KK7A 1UWBA 4B8AB 1HNVA 3NE6A 1EQYA 3NCIA 3CC7N 3RR7A 3ENBA 1JLEA 1RDAA 3HI0A 3PUFA 4NLBA 3JYTA 2IIRA 5M1NA 3C6TA 3O9RA 3QEPA 1W7AA 4M7XA 1S9GA 2CH5A 4K42A 4CJRA 1K8KA 5AZJB 1IKXA 3FGUA 4GW6A 4DS4A 2ITMA 4B08A 2E2QA 5AQLA 4IWVA 4WFBL 2ZJPL 3QDKA 3V9WA 5E41A 1TVRA 3QFUA 3OYFA 4O0IA 4BC3A 3P1GA 3P4IA 5FRNA 2QK9A 4AHUA 1T6DA 1YJ9N 3AA3A 3K0SA 4H5VA 3THYB 1NLVA 1JLCA 3CG7A 2E1ZA 1NGGA 3KD1E 3E66A 4H4MA 4KFBA 1T44A 5HP1A 3EEQA 3UKRB 2QWOA 4BWMA 3OYDA 3T7ZA 3UKUA 3QERA 4Z4IA 3SQ4A 4A61A 1QHAA 4IG3A 4X64K 4ILHA 5AQZA 1WSGA 3N4QA 4C8NA 5M1KA 3OYKA 1FK9A 1TK0A 1JXEA 5CR4A 5D3GA 4W5NA 4WFNL 3O80A 3ID6A 2YNIA 3GG4A 5MLCQ 2FSNA 3MK6A 1NBWA 3C7NB 2O8FB 3FFIA 4CEBA 1TAUA 4Q0BA 4JRPA 3TANA 3CPWM 2G8KA 4CF8A 3CCMN 4MO4A 4DF4A 2P1JA 3K9JA 5HRPA 3LWLA 3SV3A 1ZBFA 2IGIA 3ZT4A 4C8KA 1TUYA 1WOQA 4I7FA 3JAMO 4N76A 4HWIA 1OKJA 3SYZA 1SKSA 3TSQA 3HM9A 1SV5A 4QS8A 3WXJA 2VWJA 5JVHL 2PYJA 2OZMA 3CPEA 3L6QA 3DLKA 1EP4A 4GY2B 1EO1A 1V4TA 4BRGA 2QM1A 1XWLA 3QICA 3KHYA 4HVJA 1D4XA 4JK7A 4LF4K 3RRHA 2O8EA 4CHPA 4KHSA 4N56A 4JI5K 2BANA 2P5OA 1C1BA 1JLBA 1C6VA 4O5FA 3TSPA 2XY5A 3NMUA 4KI4A 4OO1J 1GLJO 1BU6O 4JKEA 4M41A 4OJRA 2YHBA 1KSPA 4CI6A 2OPSA 4YOYA 3LZIA 1ATRA 3HVRA 4A2BA 5BREA 1QE1A 4JHDB 3WXMB 4N5SA 4IO9L 4CF0A 3G4SN 2HHWA 3VQDA 3ZYYX 4DCHA 2H3GX 3OYMA 4FSVA 5KQ8A 3EZWA 3ZSYA 4MLEA 4H5NA 3K5OA 2FF3B 3AGKA 2ATQA 4E7HA 2NUBA 3V6DA 4UY8O 4Z4FA 3NH2A 1S1VA 3GBTA 5I9EB 3HP9A 3CCLN 3SBGA 4HUFA 4ELTA 4B1XB 2NNWA 4CHZA 4BDZA 1C0MA 5CZ2A 3F9MA 3VF2A 2YJFA 4OPJA 4BRFA 3TAPA 1IKYA 3SK3A 4DQRA 4FLWA 1XUPO 3J8AA 1B9FA 3KKRA 2UXDK 4FLZA 4A5BA 3L2UA 4FJXA 1S1WA 1P8ZA 1NGJA 3RMAA 1QZ6A 1NK8A 2Q36A 1E4GT 4KO0A 3TARA 4XEIA 4JNEA 4PKGA 4RW9A 5AQKA 2A42A 3SUQA 1YITN 4BRDA 3L3UA 2KFNA 3OYGA 1HKCA 4DR5K 3THVA 4BDPA 4FWKA 2D1KA 3VEVA 4DTNA 3IUCA 4FOIA 4M45A 3QNOA 1RNHA 1R0AA 3LWMA 4NCAA 4CJPA 1HX1A 2PFUA 1IBMK 4LF5K 4MO5A 3OYIA 3AA2A 3OS1A 1R59O 4CK2A 2BGGA 1CLQA 4CBXA 3OS2A 2Q31A 3T69A 3C6HA 2NRXA 1S6PA 4KTWA 3OYEA 2VGNA 3C0BA 3CYMA 4I6MB 5BPMA 1J54A 4IBNA 3R6MA 2P51A 2X74A 4RW8A 4XH4A 3VQ7A 4FZYA 1S1XA 4MQ3A 4DR1K 3S3MA 1EWQA 2G8VA 2P9UA 3L4IA 3QO9A 3CFPA 2HNYA 2G8IA 3HSCA 5FPDA 1UA0A 4IDKA 5JVGL 4CHOA 4B9QA 1NGAA 3ID8A 4IEEA 2IVPA 2UUBK 1KXPA 4CGHA 5GINA 2HW3A 2NLXA 2GBZA 1VHXA 3FZKA 2F9TA 2GUIA 3BZCA 3CM6A 2V52B 3CFRA 2G8FA 3KLFA 4ELUA 5IWAK 1DEJA 3EE9A 4B1UB 1N8RO 3RSEB 3Q7CA 1YJNN 2P9KA 3O4QA 4FJMA 1NOZA 4Y0WA 3A5MC 5KGWA 4DV7K 2E88A 1DTTA 1O1WA 3HVTA 4NYFA 2X78A 1RILA 5ELZA 4DSEA 2V7ZA 4KI6A 4O55A 4U7BA 3V9ZA 5AQFA 3LDNA 3IKMA 1NGFA 2D0CA 4YDUC 4JV5K 5FLXO 4CE9A 2PY5A 3O4WA 2E8AA 3DXMB 1RDDA 1VQNN 4K8XA 2HNZA 4DV4K 5JS2A 1U48A 3O9UA 4FJ9A 3AVCA 4BR7A 3O1WA 3AO3A 2ZWHA 3OBWA 4CJKA 4JS4A 4KH4A 3KK3A 1IKVA 3H45C 3PIOL 3ALYA 1C0UA 4E7IA 2YHAA 1XMOK 1T3VA 3LM2A 2HVIA 1HQUA 5AQYA 5EXWA 1IBKK 4PKHA 4O4GA 3CIPA 1Z26A 3QMLA 2OPQA 2O8FA 1NGIA 1CXQA 3KWIA 2JWKA 1VSEA 3G10A 5J2NA 3K5NA 1MWKA 1C1CA 3CCJN 1T05A 2I5JA 2E2NA 4LH5A 4JI8K 4FVMA 3VOVA 3K5MA 4BC4A 1ZBLA 4WQ4C 3HL8A 1OH8A 1L3UA 3VQBA 2R7YA 4KHNA 2DFFA 1VSMA 1MA9B 1TKZA 5JLFA 1VRTA 2BH1A 1OVQA 1QTMA 2XY8A 5SWMA 4YOVA 3C6UA 4CK1A 3DOKA 4V19S 4FXDA 2GX9A 1FKPA 3THWA 3OYBA 3T1YK 4FWOA 4B3SK 4GNIA 1T7PA 2OPPA 1NJZA 3EKUA 1NJIO 2YKNA 2A41A 5FPNA 3VQ6A 4CF2A 3THWB 4WCEL 1X3NA 1HKGA 3ZSZA 5ADXH 4DV2K 1VQ5N 2P9IB 5EX5A 2V7YA 5EOYA 1NKEA 1Q7YO 3B8AX 1JLAA 5C2DA 3MECA 4FJKA 1S6QA 4C1NI 4JYAK 3AVAA 4KKOA 3RSEA 3DWLA 1IG9A 2XY7A 2PBDA 4HUGA 1KAZA 3MWTA 2ZJRL 5CYMA 3M3ZA 4QS9A 4DF8A 2QTDA 2QWRA 3ZEUA 3AVJA 3HRGA 1ZBSA 3E9OA 3C94A 3VA0A 3BDPA 3D45A 3VEOA 5HOOA 4KHQA 3SAGA 2HHVA 2KW4A 3CI5A 4BVOA 4BRAA 5BPNA 3CJ7A 2A1SA 4AF1A 4DTXA 4KB0A 1KFSA 4RTFD 2F8SA 4DS5A 1I39A 4WYBA 5ADXA 1KQSM 1N5YA 1TK5A 4C8OA 4DR4K 3GOIA 2WFBA 3CMEN 4IFVA 4DFKA 3QEIA 2X6SA 3GL1A 2FSJA 2P9LA 1D8YA 1VSJA 4B3TK 4DU1A 2HOEA 3LP3A 2A1RA 3ULDA 4FWLA 4H5TA 1S9EA 1KAYA 4KTQA 1WSEA 2ASMA 3EY1A 1W9HA 5C15A 3RRGA 2P9LB 4M3XA 4CVNE 4AQYK 4QCLA 3K9KA 2HMIA 3O1BA 4DQ8A 3L2RA 3SBTA 3C7NA 1EETA 2Y1IA 1FXXA 3ZT3A 5JLHA 1NG9A 3I0SA 4CJEA 4CJQA 3G0ZA 4O8KA 2E20A 4FJNA 3B6OA 1GLBG 3C95A 1LV5A 4LF6K 1VSDA 2QKKA 3NF8A 2IC3A 2E4LA 1JLGA 4CZKA 1C0FA 3FZFA 3O08A 4WE1A 3ZCMA 3CCVN 3G25A 5FDLA 3MX5A 3LP2A 5T7BA 4FCYA 3OYJA 2PZSA 5JMVA 4I2PA 4LFBK 5GADP 4KBOA 2ITGA 2EHGA 5KPZA 3DMJA 1HMVA 1B92A 1NJYA 4E7JA 2O4GA 3KLGA 3ZT1A 1N33K 4EAHD 1F21A 4NCBA 1LAWA 4E1MA 4CEFA 2BDPA 2VG7A 3ULEA 1WLJA 4CJ5A 1Y97A 4BRNA 4WFAL 4M7YA 5AQRA 1D9DA 3F9KA 4EHUA 1Q8IA 3FZHA 3VTHA 3AAPA 5CE3A 3MAQA 2D0OA 1K8KB 1BDGA 2XHBA 4HHTA 1IO2A 4FLVA 4FLTA 2BE2A 3M1FA 4NB4A 3O9QA 2QXLA 1NK7A 5AQVA 3KZBA 4N41A 1LOTB 4FJGA 3LDSA 3MN7A 2HVHA 3P83D 4ISEA 4K8ZA 4DB3A 3PX6A 3DXKA 3R9PA 3THXB 1X9JA 4B9TA 1HRHA 1J9AA 3F73A 5J2PA 4CEOA 4FOEA 5AZJA 3THYA 1Q18A 4F2SA 2YHXA 3I56N 1TL1A 2HMPA 4PL8A 1VQON 3MCAB 4YNQA 1C0GA 2OTJN 2YI1A 3U4LA 1LAVA 1ZXOA 1HNXK 3IFRA 5GAHP 4FLUA 4BQZA 3V9SA 2UXCK 1S5JA 3VQAA 3V81A 4FWNA 3ZLJA 4CHQA 4DU4A 5LJVA 1K8AO 3P5JA 5LJWA 4IJAA 4XH1A 4Y1CA 3D2FA 3V1OA 1YAGA 1VQ4N 4CZFA 4BY9C 1I94K 4E7KA 4YHHK 4KHYA 3HOTA 1GOBA 5LY3A 4BR4A 4DR3K 3QESA 3LP1A 4AILC 1REVA 4BDYA 4BACA 3J7YP 3L4QA 3VTIA 3ZSWA 2QWMA 2YKMA 1QS4A 1Q9XA 5CZ1A 1VSHA 2NRTA 5J2QA 2UYTA 3S9HA 3E1YA 1C1AA 4FVUA 3CQ8A 5EVZA 5HRNA 4ID1A 1VSLA 2KQ2A 3P38A 4GV6A 1BG3A 3CQXA 4K0KK 4E3SA 3BF1A 5DMRA 4DV5K 1Q81O 4GKJK 3EN9A 5AQJA 4DSJA 3VQ5A 3A8YA 2IS3A 3O4NA 1NU0A 5C42A 4FPBA 3WNEA 3QEVA 1LWEA 2BUPA 3RMBA 2HNDA 2O8BA 1ATSA 4DQQA 5F2RA 3VEWA 3I8BA 3TTCA 3KK1A 4HTLA 1RGIA 2B5JA 2O8EB 3GE1A 1JL1A 4EFHA 3KLEA 4LSLA 3I33A 3QEWA 3TAMA 3ZETA 1N34K 3DLHA 3VEZA 4CEEA 2WC9A 4CJFA 4O8UA 4KV8A 2HHQA 4JKFA 1KLMA 3AO5A 5AQWA 4BR0A 3NGIA 4DHYA 5CYQA 1BGXT 2HF3A 4BRCA 3HPGA 3O9SA 4TSXA 1XNRK 4HTUA 3VQ8A 1MWMA 4BG8A 3BZKA 1X9MA 4CZMA 4OVLA 1KVCA 3M6GA 2HBJA 2QI2A 4CFAA 4FJHA 1VSIA 3ZSQA 4JKGA 1BI4B 2NRHA 4WQ4A 3IAYA 2GWKA 3MCPA 4GVEA 2WOMA 3DLBA 1S3XA 1TKXA 2P9PB 4KB1A 4FZZA 2GTDA 1EKEA 5KQDA 3CJ1A 3K5LA 3ATUA 4O5BA 3IG1A 4FJIA 1O13A 3L3VA 5AQPA 4BREA 4W5OA 2FLOA 4FLYA 4GVMA 2LSNA 1BCOA 3SQ0A 3DYAA 4JK8A 1L3VA 4DR6K 3NF7A 3SV4A 3CC2N 3NAEA 3MN5A 3G71N 3KVGA 1OH6A 4M63C 2VWKA 3OA9A 1LWCA 2DPNA 2E6MA 4EP4A 1MDUB 2OPRA 4NXNK 5M1OA 3M8PA 4LC9B 4BC2A 1RDUA 3DLLL 2IDOA 2ZE2A 4CHYA 4DQSA 3U3YA 3TTFA 4H0YB 3UB5A 1YXQA 3BGRA 1HQEA 2W40A 4Z94A 3PLAA 2YNGA 1KRPA 3O6WA 3AA4A 3H3OB 4BRKA 4FZXC 4L8RB 3HM8A 4DU3A 1DGKN 4F3TA 2KTQA 1X9SA 2GV9A 1BA1A 4EHTA 4BGBA 1L5UA 1JXBA 3TR8A 3SQ2A 1HYSA 5BR9A 4BR2A 2E2PA 2ASOA 3SPZA 3JSMA 4YOTA 3VMFB 3MDQA 3VETA 4HCBA 3J7AP 4AHTA 4ZHRA 4IOCL 5FROA 3JXUA 3AARA 1TAQA 4ILJA 3ULEB 3L2VA 1Q9YA 2F4VK 4U67L 1DT9A 1TUUA 2QWLA 4LFCK 4E0DA 2P9IA 4NCGA 1FKOA 3KLHA 4JHDA 1U4BA 4DR7K 4DQPA 2P9KB 4EP5A 4DFMA 3M5RA 4CZIA 2HB5A 3NFAA 5C25A 1J5EK 4B9SA 4B1VA 1LW2A 3OBYA 3VGLA 4CJSA 3AV9A 5B8HA 3J81O 2GWJA 4WQ5C 3TAQA 3HZ6A 3WQTA 1ZYQA 4FK4A 3U3GA 3RR8A 2ZM6K 4N47A 1BI4A 4BRMA 3TTDA 3OYCA 4DLEA 3ATVA 3ZT2A 4JI4K 1W2BM 4CZHA 2OTLN 3CD6N 4CESA 4B1YB 1NGEA 2OYQA 4A62A 1IJJA 5BPLA 3PX0A 3ZSRA 2B4JA 1BCMA 5K14A 1E3MA 3OS0A 4BR9A 3UKUB 3MX2A 4G9ZA 1UOCA 3DLRA 4Q5VA 4KHUA 2FSKA 1KVBA 4CJTA 1ILYA 5C12A 3TABA 3CMAN 3VGMA 5AR0A 3O5BA 3W0LA 3HYFA 1WUAA 3WEEA 1U2VB 3CXCM 3P31A 3DM2A 1C0TA 1UAXA 3A2FA 4B9VA 3O8MA 1TYQB 4CJUA 4DSLA 2RHKA 3LL3A 4DLGA 1U2VA 3IRXA 4CCHA 2QW9A 2QWQA 4CBUA 5GIOA 1BQNA 3WT0A 1N6QA 4F4KA 4Y1DA 2Q1NA 2DY4A 4CJ3A 4X62K 1ITGA 1XI1A 3AVLA 1KD1O 3J7ZO 1X9WA 1A5XA 2D0AA 1SAZA 1DLOA 5CHIA 1EX4A 4RG8A 4FWQA 4M3UA 4YOWA 1KFDA 3VPZA 4BC5A 4DUYK 4DTOA 1WSFA 3H3NO 1WB9A 4AM6A 2ZGZA 4X65K 4DG1A 1T6CA 3DI6A 1Q86O 2CGJA 3TPQA 4HUEA 3MEDA 4JKBA 1TGOA 1KAXA 2HHXA 2VQEK 5DK5A 5AZIA 4LY7A 3D7EO 4M3WA 3E01A 4CGGA 2NRZA 3ZX0A 3K2PA 3K57A 4DFJA 1U49A 1NK6A 5AZIB 3ZETB 4BG9A 1VQ9N 4FK0A 3U9DA 4XH5A 3PIPL 3CCSN 3U6FA 4CZGA 3HO1A 3SMPA 1J6ZA 4JKHA 3NVKA 3SNNA 1GLLO 1HKBA 4IKFA 4A57A 3F2KA 2A6AA 1FJGK 2FXUA 1RT2A 3A5LC 1YF5L 3WXLA 5E84A 5AQUA 3T1HK 3LDQA 4LSNA 1BIUA 4B9LA 3S3NA 3LPTA 1WSHA 3TWHA 4B3MK 4FWSA 2ZGYA 3WQUA 2YHYA 3M8RA 2XO7A 3CFOA 1SKWA 2P9PA 3PY8A 1YI2N 1RCHA 3LAMA 3HBTA 1SL2A 1N36K 2W6LA 5A2QO 3VERA 1QSYA 3GDQA 1JL2A 4JRQA 5TKWA 3G6EN 3CCRN 5AQQA 4BRPA 2F8TA 3PX4A 1TK8A 3LANA 3UE5A 3D0PA 4JI6K 1HLUA 3ZSOA 3O3HA 3NDKA 1NMDA 1G15A 4IZ9A 3TAGA 2UUAK 3LALA 1VSFA 5E26A 4CEZA 1XMQK 4ISFA 2WUSA 4DUZK 4E1JA 4M3TA 3AVIA 3IDHA 3JS6A 3ITHA 5BR8K 5KPTA 2OZSA 2Q97A 4KPYA 4K41A 1DTQA 4BVPA 3O3FA 1YJWN 4JAXA 4DWIA 4OPAA 3I0RA 3DLGA 2HHTA 3VQ4A 3M8QA 3DLEA 4PQUA 4B8CA 3SAFA 4UQGA 1HPZA 3AVMA 3FFKB 4OKEA 1WBBA 1NGCA 1NGDA 4DTSA 3MXJA 2J4RA 3V1RA 3SUPA 2DTUA 4GKKK 3S41A 4HCCA 4JLHA 3SMSA 3M8SA 5HLFA 1GOCA 2DFHA 1KLNA 4DTJA 1MU2A 3VEXA 2G8UA 4J2DA 1QQCA 1TL3A 4OLAA 3ENOA 5HL7L 2KHOA 4JN4A 3HSTB 5IT9O 1SQKA 1HNWK 1ASUA 1NM1A 1J53A 5BRFA 2YX6A 5BN9A 3OJUA 3F5TA 2KFZA 3AGRA 4G1QA 2P9NA 5BRHA 4YDUA 1Q82O 3H08A 2IVOA 1Y64A 4PL7A 4AH9A 2YJEA 1K6YA 4ID5A 4DV0K 4OX9K 3OYNA 4RWTA 4KH5A 3DXKB 3THXA 4KHWA 2GUPA 4OGEA 4DKWA 1SS6A 3ZEUB 3VGKA 1SUQA 4NO7A 4CW7B 5KPRA 4FM1A 4M3RA 3P39A 5M1FA 4H0TB 1CZBA 5AQIA 3LPUA 3CERA 1IH7A 4BRIA 5HRSA 2QA4N 5KTQA 4Z4EA 1ZBHA 3I55N 4FW2A 3D6RA 3LM9A 4CGIA 3CJ9A 3A5NC 2Q0UA 4BRQA 4LF8K 3L2WA 3KKSA 3WNHA 4DFPA 4CGJA 4B1WB 4CBWA 3HP6A 4IXCA 1RT5A 1WBDA 1OVYA 4ISGA 4E19A 4OKJA 1QSLA 4FJLA 3KIOA 3WNGA 1CXUA 4CEAA 1NKBA 2I7PA 2F7TA 3HPOA 3OY9A 2XRIA 2ZD1A 2NRRA 4R5PA 1RDCA 4LF7K 3BY5A 5DM6L 3WUHA 3NH1A 5AQTA 2UUCK 4FM2A 3SPYA 2Q2RA 3H46O 2UU9K 2KZZA 1YTAA 2OCEA 3MXMA 2QWPA 3R3LA 3QFPA 2HHUA 1CZAN 4RW4A 1GLEG 1RBUA 1RBVA 5M1PA 2E6LA 4CJ7A 4BR5A 2F96A 4FPAA 2OA8A 3C65A 1RBRA 3R8EA 4PA1A 2QXFA 4OKKA 4JI0K 1EXQA 1RTJA 2FBXA 1GLFO 4CJVA 4Z4GA 5AQNA 2Z1HA 3CQYA 3FZLA 3W3DA 2W41A 4B3OA 4PKIA 3AO4A 4I6MA 1NK9A 4CD3A 1E4FT 3FLCO 4ILGB 5GAGP 1HJRA 1RTIA 2RF2A 3NF6A 1ASWA 4BE1A 1OH7A 3D2EB 4DR2K 3QEXA 2P9NB 4ZTFA 3O9TA 1VSKA 5EU7A 5LMUK 3VN5A 1NK4A 1BISA 1ATNA 1XC9A 1BWFO 2Z1IA 4CK3A 4O44A 2JGUA 4PY5A 4DQIA 3K59A 4CHNA 3NH0A 4JKAA 3OYAA 2Q0RA 4WQ5A 4MDAA 4M3YA 4NYNA 3VA3A 2D0PA 4JKGB 1QQOA 3SCXA 3HXMA 3AO1A 2X6NA 4PWDA 3ASMA 4IO8A 3OJSA 3DAWA 1YHQN 5LL6Z 1GLDG 4K25A 3ZX2A 3AVBA 3T1AA 3FZMA 1QQMA 1SL0A 2AJQA 3VQPA 3LDPA 3A5OC 4AM7A 3J80O 1YT3A 1DKGD 3WXIA 4NLCA 3T3FA 3N4PA 1P90A 1U45A 4CFCA 3SJJA 3NF9A 1B9DA 3DJCA 1NK0A 4H0OA 3D2FB 3MWPA 1VQPN 1KVAA 3EO3A 3VF4A 2O8DA 1S1TA 4RW6A 4MLHA 4BQLA 4W5RA 2VG6A 3ZT0A 3H6EA 3S3OA 3VQ9A 4DV3K 1U04A 4AHRA 1BUPA 3MN9A 5HRRA 5KI6A 2G8HA 3BF3A 2O8DB 2V51B 3WEEB 1NGBA 3Q7BA 2FBYA 2RKIA 3TAFA 3MN6A 4JI7K 1RT7A 3VENA 3LZJA 4RCHA 4I9QA 3SAHA 3SUNA 1VQLN 3PO5A 4B9MA 4JI3K 1JCGA 1JLQA 1BL3A 1TV6A 3EKSA 4FJ5A 2A3ZA 3OYHA 5GAEP 2A5XA 4H8KA 3CHWA 3QLHA 2ZF5O 2F9WA 4LH4A 1ASVA 4X66K 1NGHA 3BEXA 4CEQA 1RDBA 1GOAA 5AQHA 5HBMA 4FJ8A 4JS5A 4CGDA 2G8WA 5BRDA 4DSFA 4F8RA 5AQMA 4OPHA 1LCUA 2AA4A 4J2AA 2GELA 1T03A 3E9PA 3V1QA 1WNSA 4FM0A 2W42A 4AHVA 3LDLA 4DTMA 1JJ2M 3C6AA 4FK2A 3BUZB 3L8BA 1QVFM 4NXMK 3EL2A 5C24A 4DTPA 1WAFA 2NRVA 2VYPA 4R79A 4ELVA 3FE1A 3ZSXA 1NK5A 1SL1A 2YV0X 3TAEA 1TKDA 4F9OA 4C23A 4BRHA 3CETA 2JLEA 3OYLA 5SZTA 3MEEA 1VQKN 1IV0A 3SLCA 4FL9A 4E7LA 4DMNA 4CFBA 3QIOA 2CGLA 3LAKA 5C2FA 1XHZA 3CJCA 2VWBA 4W5QA 4LD0A 4JKDA 3KTQA 4KREA 1K9MO 4YOUA 1XC3A 3NBPA 2VG5A 4H0XB 4JI1K 3AVGA 5C10A 3SZ2A 3CC4N 1Z6RA 1VRUA 3WNFA 2QKBA 3KD5E 4OGCA 4PHTX 1EWRA 4CIFA 1YUWA 3QINA 5H1SQ 2QEXN 4FO0A 4BE0A 1JCFA 4C8LA 2E5LK 3U8XA 4OPKA 5AQOA 2O4IA 5AQXA 3H1QA 3WXKA 4FWRA 2Y1JA 4YORA 1QSSA 4CGFA 5AQSA 3RMCA 3DRPA 3RMDA 3VF6A 1NKCA 2CGKA 4GV9A 2YHWA 4YOXA 1M1KO 4Z0UA 1ZBUA 2IAJA 4CJLA 4KH6A 1FW6A 3IMXA 2NRWA 3ENHA 1VAZA 2P5GA 2B6AA 2W6KA 4CJWA 4A5AA 2DFEA 1BOTO 3CCEN 2VCPA 4B9UA 5JS1A 3ISNC 4LF9K 4KRFA 4C1NK 4H5RA 3ZX3A 4E89A 5F1XA 4AHSA 1BQMA 3PV8A 4J2BA 1NWKA 5I3UA 4KAZA 4F2RA 1XHXA 1RTHA 2EX3A 1CZ9A 4MFBA 4FYDA 4CIGA 3VQQA 4JD2B 1RBSA 4FJJA 1XNQK 1S1UA 3AVNA 4JI2K 1N32K 1NOYA 3RWUA 3U9ZA 4H0PA 4CZLA 1T8EA 3HK2A 5DM7L 3CF5L 4JD2A 3CJAA 1BIZA 1SKRA 4DSKA 3D2EA 3V9XA 1WSJA 2O8BB 2E2OA 3QIPA 2O8CB 4C8MA 4KHPK 3HT3A 4CD1A 1HUXA 2WTUA 5GIPA 3L2QA 1RTDA 1YVUA 5FRMA 1D5AA 4E1NA 3QBXA 4W5TA 3OTOK 3SUOA 1SZ2A 2JWLA 3TSUA 2D4WA 3BP8A 4B1ZA 3HPHA 3PSIA 3PO4A 1XQSC 4IG0A 1KC8O 4J2EA 5KGXA 3E9LA 3V9UA 2OANA 2VQFK 1RT3A 3DOLA 1IG8A 4CFDA 4WF9L 4O0JA 4CF1A 1TKTA 5F0XA 4DV1K 2HSTA 4H4OA 4A59A 3RTVA 2PAVA 1G99A 3IS9A 3HJFA 1RFQA 1GLAG 3L0QA 3DRRA 3HTVA 3AO2A 3VEYA 4XIUA 1BHLA 4CIEA 3V4IA 1VQ6N 3AY9A 1WSIA 3EZ5A 2KLAA 3CCQN 3B6PA 1J5OA 1HYVA 4MDBA 1NJWA 3DXMA 1ZC6A 2EWSA 1L3TA 1BO5O 1TYQA 4I9LA 2AP1A 1W0HA 1ZBIA 5TKYA 4IOAL 3OW2M 4BGAA 5J2MA 1ESVA 3EE8A 1HNZK 3AVFA 2D5RA 3FR0A 3VQEA 4DV6K 2Z1JA 2WBNA 3OVNA 4IFYA 1H1VA 3AVKA 3KWGA 2IOCA 4YFUA 1KTQA 1U47A 1QVGM 4KTZA 1IBLK 1X3MA 1Z05A 3QBWA 2YNFA 4FWPA 3SJHA 3SQ1A 2QWNA 4QOZB 3AAQA 1S22A 1BA0A 4IJNA 2FF6A 1RDWX 2RPIA 4M42A 1JKHA 4GMJB 1X1PA 3H1VX 4BRLA 2I7NA 3RVCA 3MMVA 5JICA 5I42A 2HHHK 3I8DA 4B9NA 4AHCA 3LDOA 2ZJQL 4BWJA 1I3AA 4CEDA 1W97L 3VQCA 3CCUN 2XY6A 5M1QA 3A0IX 1RT1A 1UA1A 3VESA 1HPMA 2Z1GA 4BE2A 2NZTA 2D0BA 4LFAK 4M3ZA 4RW7A 1U6ZA 5KRSA 3KJVA 1K73O 5AFUA 2KZMA 1WAJA 1VK0A 1GLCG 1RT4A 1A5WA 3T19A 4OLBA 3DRSA 5AJ3K 2FBTA 1HYZA 3NVMA 2FBVA 3CM5A 3OHRA 1RT6A 2UXBK 2VGMA 1IKWA 3MEGA 3NGYA 4YY3K 4Z4CA 3TU5A 3KK2A 2ASPA 4H03B 3PSFA 5J1EA 2PYLA 1NJXA 1S72N 1QHTA 1HR0K 3NHGA 3MXIA 2GEMA 1LWFA 1Z25A 2HBLA 4H5WA 1LW0A 5C0YA 5LMNK 4DTUA 1VQ8N 1D9FA 4BROA
chains in the Genus database with same CATH topology
3K59A 3K5NA 4CHNA 3SI6A 1C1CA 4DSIA 1T05A 3SPZA 4QAGA 3NH0A 4FJ7A 3OYAA 2I5JA 4LH5A 4FVMA 4CERA 3K5MA 1JLFA 3ZSVA 4M3YA 4NYNA 1ZBLA 3VA3A 4HCBA 4F3OA 3HL8A 4AHTA 3SCXA 4ZHRA 3HXMA 5HROA 1L3UA 3AO1A 2X6NA 5FROA 3AA5X 3VQBA 4PWDA 3ASMA 2R7YA 1TAQA 1WN7A 3OJSA 3UIQA 3L2VA 4ICLA 1Q9YA 1KCFA 4KHNA 2DFFA 4CECA 1VSMA 2RN2A 1TKZA 3AVBA 1VRTA 3T1AA 4E0DA 5KRTA 1QTMA 2HHSA 2XY8A 4NCGA 5SWMA 1FKOA 3KLHA 4M3ZA 1SL0A 4FLXA 3VQPA 2AJQA 3C6UA 4CK1A 3DOKA 1U4BA 4FXDA 4DQPA 1YT3A 4EP5A 4DFMA 2ZQBA 4ZTJA 1U45A 1FKPA 2HB5A 3NFAA 3T3FA 4CJ4A 4CFCA 3OYBA 3SJJA 5C25A 3NF9A 4B9SA 1B9DA 1LW2A 1T7PA 4CJSA 2OPPA 3AV9A 1NJZA 1NK0A 3AVHA 2YKNA 3TAQA 2Q3SA 3NGZA 4Z4HA 1KVAA 1ZYQA 2YNHA 3VQ6A 4CF2A 4FK4A 1S1TA 4RW6A 3U3GA 3RR8A 4CF9A 4N47A 4W5RA 3S3OA 2VG6A 1A5VA 1BI4A 3ZT0A 3ZSZA 3QETA 3VQ9A 3OYCA 4DLEA 1U04A 3EYZA 3ZT2A 4AHRA 1YTUA 5HRRA 1NKEA 1L3SA 5KI6A 2G8HA 2ETJA 1JLAA 3LP0A 3MECA 4FJKA 2FC0A 2FBYA 2RKIA 4I2QA 4CESA 1S6QA 3TAFA 1RT7A 2OYQA 3AVAA 3LZJA 3PX0A 4KKOA 1RBTA 3ZSRA 2B4JA 4I9QA 3K58A 3SUNA 1IG9A 2XY7A 3PO5A 1BCMA 3QNNA 4HUGA 4B9MA 5K14A 4EZ9A 3KLIA 5CYMA 4PUOA 3OS0A 1JLQA 1BL3A 2WONA 1TV6A 4FJ5A 3O3GA 3OYHA 1HNIA 5CY4A 4DF8A 1UOCA 4H8KA 3DLRA 4Q5VA 4KHUA 3QLHA 4EZ6A 1KVBA 3AVJA 4DTRA 4CJTA 4LH4A 3TABA 1ASVA 4FW1A 3C94A 3VA0A 3BDPA 4CEQA 1RDBA 1GOAA 3D45A 3TI0A 3HYFA 4KHQA 5HBMA 4M3WA 4FJ8A 4JS5A 4CGDA 1UWBA 4B8AB 3DM2A 1C0TA 1UAXA 2HHVA 3A2FA 1HNVA 3NE6A 2G8WA 2KW4A 4CJUA 3NCIA 4DSFA 4B9VA 3RR7A 4DSLA 4F8RA 1JLEA 1RDAA 4DLGA 3PUFA 4J2AA 3JYTA 2A1SA 3IRXA 4DTXA 1T03A 4CCHA 1KFSA 4KB0A 3C6TA 4DS5A 2F8SA 3V1QA 1WNSA 1I39A 2HVHA 3QEPA 4FM0A 2W42A 4AHVA 1N5YA 1TK5A 4C8OA 4DTMA 1S9GA 4IFVA 4DFKA 1BQNA 1N6QA 3QEIA 4F4KA 2X6SA 4CJRA 1IKXA 4Y1DA 1D8YA 1VSJA 4GW6A 4DS4A 4DU1A 3LP3A 4B08A 4FK2A 3L8BA 2DY4A 2A1RA 3ULDA 4CJ3A 1S9EA 5C24A 1ITGA 1WAFA 4DTPA 1XI1A 4KTQA 1WSEA 3AVLA 3V9WA 3EY1A 1W9HA 3RRGA 5E41A 4ELVA 1TVRA 1X9WA 3ZSXA 1A5XA 2D0AA 4O0IA 3OYFA 1NK5A 1SL1A 3P1GA 4M3XA 1DLOA 4QCLA 1EX4A 4RG8A 2HMIA 2YV0X 3TAEA 1KFDA 4M3UA 1TKDA 5FRNA 3L2RA 2QK9A 4AHUA 1EETA 4DTOA 2Y1IA 1FXXA 1WSFA 3AA3A 3ZT3A 2JLEA 3OYLA 5SZTA 3I0SA 1JLCA 3CG7A 3MEEA 4DG1A 3KD1E 4CJEA 3DI6A 4CJQA 3G0ZA 4H4MA 4KFBA 5HP1A 4HUEA 3MEDA 4BWMA 4E7LA 4FJNA 3B6OA 1TGOA 3OYDA 3C95A 2HHXA 4DMNA 3QERA 4CFBA 3QIOA 3LAKA 5DK5A 4LY7A 1XHZA 1LV5A 1VSDA 2QKKA 4Z4IA 3SQ4A 2IC3A 3NF8A 2E4LA 1JLGA 4IG3A 4W5QA 3OYKA 1WSGA 4C8NA 4LD0A 3JSMA 1L3VA 1FK9A 4WE1A 1JXEA 3E01A 3ZCMA 1TK0A 3KTQA 4CGGA 5D3GA 4KREA 4W5NA 5FDLA 3NBPA 3LP2A 2VG5A 5T7BA 4FCYA 4DFPA 3K2PA 3AVGA 3K57A 4DFJA 1U49A 3OYJA 2YNIA 2PZSA 1NK6A 4I2PA 3SZ2A 4FK0A 1VRUA 3FFIA 3WNFA 4CEBA 3U6FA 4JRPA 3TANA 4Q0BA 1TAUA 2QKBA 3KD5E 3HO1A 2ITGA 4OGCA 4CIFA 2EHGA 2G8KA 3DMJA 4CF8A 3SNNA 1HMVA 4DF4A 1B92A 3QINA 4IKFA 2P1JA 1NJYA 4E7JA 2O4GA 4BE0A 3KLGA 3ZT1A 4C8LA 1F21A 5HRPA 4OPKA 3LWLA 1RT2A 3SV3A 4NCBA 1LAWA 2O4IA 4E1MA 1ZBFA 4CEFA 2IGIA 3ZT4A 2BDPA 4C8KA 2Y1JA 2VG7A 4I7FA 4CGFA 1QSSA 4LSNA 1BIUA 3DRPA 3RMCA 4B9LA 1WLJA 3RMDA 4CJ5A 3LPTA 1WSHA 3TWHA 3S3NA 4N76A 1Y97A 3SYZA 1SKSA 1NKCA 1D9DA 4Z0UA 1ZBUA 2IAJA 4CJLA 3HM9A 1SV5A 2VWJA 3M8RA 2XO7A 3CFOA 1SKWA 2PYJA 2OZMA 3F9KA 3PY8A 1Q8IA 3DLKA 2P5GA 1RCHA 1EP4A 3LAMA 3MAQA 2B6AA 1SL2A 4CJWA 1XWLA 2XHBA 4HHTA 1IO2A 1QSYA 2DFEA 4FLTA 1JL2A 2BE2A 4FLVA 4HVJA 4JRQA 1NK7A 4B9UA 5JS1A 4N41A 2F8TA 3PX4A 3ISNC 3LANA 4CGJA 3LDSA 3D0PA 3P83D 3RRHA 1TK8A 3O3HA 3ZSOA 4K8ZA 4CHPA 4KRFA 4KHSA 4E89A 3NDKA 4N56A 3PX6A 2BANA 4AHSA 2P5OA 1BQMA 1G15A 4B9TA 1HRHA 3PV8A 4J2BA 1C1BA 3TAGA 1JLBA 5I3UA 1J9AA 1C6VA 3LALA 3F73A 5J2PA 4CEOA 4KAZA 4F2RA 1VSFA 1XHXA 2XY5A 4CEZA 5J2NA 4KI4A 1RTHA 2EX3A 1CZ9A 4MFBA 4F2SA 4FYDA 4M41A 1TL1A 4OJRA 4CIGA 4M3TA 2YHBA 3VQQA 4YNQA 1KSPA 3AVIA 3LZIA 2OPSA 1RBSA 4FJJA 3ITHA 3HVRA 1S1UA 2OZSA 3AVNA 1QE1A 4KPYA 1LAVA 1NOYA 3RWUA 4N5SA 4FLUA 1T8EA 3HK2A 3V9SA 4CF0A 1DTQA 3O3FA 2HHWA 1S5JA 3VQDA 3VQAA 4DWIA 3V81A 1BIZA 3I0RA 4CHQA 4DU4A 1SKRA 3DLGA 4DSKA 3V9XA 1WSJA 2HHTA 3P5JA 3VQ4A 3M8QA 3DLEA 3QIPA 3OYMA 4Y1CA 4B8CA 4PQUA 4C8MA 4UQGA 3V1OA 1HPZA 3AVMA 3HT3A 4OKEA 3ZSYA 3K5OA 4E7KA 4KHYA 3L2QA 1RTDA 2ATQA 1YVUA 2NUBA 3MXJA 4E7HA 3V1RA 1GOBA 3NH2A 4DTSA 1S1VA 3V6DA 4Z4FA 3SUPA 3QESA 2DTUA 5FRMA 3LP1A 1D5AA 3HP9A 4E1NA 4HUFA 4JLHA 4ELTA 4W5TA 4HCCA 3SUOA 4AILC 1REVA 4CHZA 3M8SA 4BDZA 1C0MA 5CZ2A 4BDYA 5HLFA 1GOCA 2DFHA 1KLNA 3HPHA 4DTJA 1MU2A 3PO4A 4IG0A 4OPJA 4BACA 2G8UA 4J2EA 1QQCA 1TL3A 3ZSWA 5KGXA 3V9UA 4J2DA 4OLAA 3TAPA 2YKMA 1RT3A 1QS4A 1IKYA 3DOLA 1Q9XA 4DQRA 5CZ1A 4FLWA 4CFDA 1B9FA 1VSHA 3HSTB 3KKRA 5J2QA 4O0JA 3S9HA 4CF1A 1TKTA 4FLZA 1ASUA 3L2UA 4H4OA 1C1AA 1S1WA 4FJXA 3CQ8A 1J53A 3RMAA 3RTVA 5HRNA 3OJUA 4ID1A 1VSLA 3IS9A 1NK8A 3HJFA 2KFZA 2KQ2A 4G1QA 4KO0A 3TARA 4FZYA 3H08A 3DRRA 4AH9A 3AO2A 4E3SA 1K6YA 4ID5A 4XIUA 5DMRA 1BHLA 4RW9A 3OYNA 4CIEA 3SUQA 3V4IA 4KHWA 1WSIA 3EZ5A 4OGEA 3B6PA 3L3UA 4DSJA 3VQ5A 2KFNA 1J5OA 2IS3A 1HYVA 3O4NA 5C42A 3OYGA 3THVA 1SUQA 4BDPA 3WNEA 4DTNA 3QEVA 1LWEA 4M45A 4M3RA 1RNHA 4FM1A 3QNOA 1NJWA 3RMBA 2HNDA 1R0AA 3LWMA 4FJGA 4NCAA 4CJPA 1L3TA 4I9LA 4DQQA 1CZBA 3KK1A 1W0HA 3AA2A 2B5JA 3LPUA 1IH7A 1JL1A 5HRSA 3OS1A 3OYIA 4CK2A 1ZBIA 3KLEA 2BGGA 4LSLA 1CLQA 5KTQA 4Z4EA 3QEWA 3TAMA 1ZBHA 3OS2A 4FW2A 3DLHA 5J2MA 4CEEA 1S6PA 4KTWA 4CGIA 4CJFA 3OYEA 3CYMA 4KV8A 2HHQA 1KLMA 3AO5A 3AVFA 1J54A 4IBNA 3L2WA 2D5RA 3VQEA 3KKSA 3NGIA 3WNHA 2Z1JA 2P51A 1BGXT 2X74A 4RW8A 3OVNA 5CYQA 1S1XA 4IFYA 4MQ3A 3VQ7A 3HPGA 3HP6A 3S3MA 4TSXA 1RT5A 3SQ2A 3AVKA 2G8VA 4HTUA 3QO9A 3VQ8A 2IOCA 4E19A 4OKJA 1QSLA 4FJLA 3CFPA 1X9MA 4YFUA 1KTQA 3KIOA 3WNGA 2HNYA 4KTZA 1U47A 2G8IA 1CXUA 4CEAA 2YNFA 1NKBA 4OVLA 1KVCA 3HPOA 3SQ1A 4QOZB 3OY9A 1UA0A 4IDKA 2XRIA 2ZD1A 4CFAA 4CHOA 4FJHA 1VSIA 3ZSQA 4R5PA 1BI4B 1RDCA 3IAYA 3DLBA 2WOMA 4FZZA 1TKXA 4CGHA 4KB1A 2RPIA 2HW3A 3NH1A 4M42A 1EKEA 1JKHA 2GBZA 4GMJB 3K5LA 1X1PA 4O5BA 4FM2A 3SPYA 3IG1A 4FJIA 2KZZA 1YTAA 2GUIA 5I42A 3CM6A 3L3VA 3CFRA 3I8DA 2G8FA 4B9NA 3MXMA 3KLFA 4AHCA 4ELUA 4BWJA 4W5OA 1I3AA 4FLYA 4GVMA 4CEDA 2LSNA 3O4QA 3VQCA 2XY6A 4RW4A 4FJMA 1NOZA 1BCOA 3SQ0A 1RT1A 1RBUA 1UA1A 2HHUA 1RBVA 2E6LA 3DYAA 5KGWA 2Z1GA 4BE2A 2D0BA 1DTTA 1O1WA 3NF7A 2F96A 3HVTA 3NAEA 4NYFA 3SV4A 2X78A 4RW7A 2OA8A 1RILA 1RBRA 4PA1A 5KRSA 2QXFA 4DSEA 4OKKA 3KJVA 4KI6A 4O55A 2VWKA 1EXQA 2KZMA 1WAJA 1RTJA 1VK0A 3V9ZA 2FBXA 1LWCA 1RT4A 2E6MA 4EP4A 1A5WA 2OPRA 4CJVA 4Z4GA 3M8PA 3T19A 2D0CA 4OLBA 2Z1HA 3DRSA 4CE9A 4B3OA 2PY5A 2FBTA 1HYZA 1RDDA 3AO4A 1NK9A 4K8XA 2HNZA 2IDOA 5JS2A 1U48A 2ZE2A 4CHYA 2FBVA 4DQSA 3U3YA 3CM5A 4FJ9A 1RT6A 3AVCA 1IKWA 3MEGA 3NGYA 3AO3A 1HJRA 1RTIA 2RF2A 3NF6A 1ASWA 4Z4CA 4CJKA 3BGRA 1HQEA 1IKVA 3KK3A 4JS4A 4BE1A 2YNGA 3KK2A 1KRPA 3ALYA 4FZXC 1C0UA 3AA4A 2YHAA 5J1EA 4E7IA 3QEXA 2PYLA 4L8RB 4ZTFA 1NJXA 5EU7A 1VSKA 2HVIA 1HQUA 4DU3A 3VN5A 1QHTA 1NK4A 1BISA 4O4GA 1D9FA 3NHGA 4F3TA 2KTQA 1XC9A 3MXIA 1Z26A 1LWFA 2GV9A 2OPQA 2Z1IA 1X9SA 1Z25A 4CK3A 4O44A 1L5UA 1LW0A 1CXQA 1JXBA 1VSEA 2JGUA 3TR8A 4DTUA 4PY5A 3G10A 4DQIA 1HYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K59 A;  3K5N A;  4CHN A;  3SI6 A;  1C1C A;  4DSI A;  1T05 A;  3SPZ A;  4QAG A;  3NH0 A;  4FJ7 A;  3OYA A;  2I5J A;  4LH5 A;  4FVM A;  4CER A;  3K5M A;  1JLF A;  3ZSV A;  4M3Y A;  4NYN A;  1ZBL A;  3VA3 A;  4HCB A;  4F3O A;  3HL8 A;  4AHT A;  3SCX A;  4ZHR A;  3HXM A;  5HRO A;  1L3U A;  3AO1 A;  2X6N A;  5FRO A;  3AA5 X;  3VQB A;  4PWD A;  3ASM A;  2R7Y A;  1TAQ A;  1WN7 A;  3OJS A;  3UIQ A;  3L2V A;  4ICL A;  1Q9Y A;  1KCF A;  4KHN A;  2DFF A;  4CEC A;  1VSM A;  2RN2 A;  1TKZ A;  3AVB A;  1VRT A;  3T1A A;  4E0D A;  5KRT A;  1QTM A;  2HHS A;  2XY8 A;  4NCG A;  5SWM A;  1FKO A;  3KLH A;  4M3Z A;  1SL0 A;  4FLX A;  3VQP A;  2AJQ A;  3C6U A;  4CK1 A;  3DOK A;  1U4B A;  4FXD A;  4DQP A;  1YT3 A;  4EP5 A;  4DFM A;  2ZQB A;  4ZTJ A;  1U45 A;  1FKP A;  2HB5 A;  3NFA A;  3T3F A;  4CJ4 A;  4CFC A;  3OYB A;  3SJJ A;  5C25 A;  3NF9 A;  4B9S A;  1B9D A;  1LW2 A;  1T7P A;  4CJS A;  2OPP A;  3AV9 A;  1NJZ A;  1NK0 A;  3AVH A;  2YKN A;  3TAQ A;  2Q3S A;  3NGZ A;  4Z4H A;  1KVA A;  1ZYQ A;  2YNH A;  3VQ6 A;  4CF2 A;  4FK4 A;  1S1T A;  4RW6 A;  3U3G A;  3RR8 A;  4CF9 A;  4N47 A;  4W5R A;  3S3O A;  2VG6 A;  1A5V A;  1BI4 A;  3ZT0 A;  3ZSZ A;  3QET A;  3VQ9 A;  3OYC A;  4DLE A;  1U04 A;  3EYZ A;  3ZT2 A;  4AHR A;  1YTU A;  5HRR A;  1NKE A;  1L3S A;  5KI6 A;  2G8H A;  2ETJ A;  1JLA A;  3LP0 A;  3MEC A;  4FJK A;  2FC0 A;  2FBY A;  2RKI A;  4I2Q A;  4CES A;  1S6Q A;  3TAF A;  1RT7 A;  2OYQ A;  3AVA A;  3LZJ A;  3PX0 A;  4KKO A;  1RBT A;  3ZSR A;  2B4J A;  4I9Q A;  3K58 A;  3SUN A;  1IG9 A;  2XY7 A;  3PO5 A;  1BCM A;  3QNN A;  4HUG A;  4B9M A;  5K14 A;  4EZ9 A;  3KLI A;  5CYM A;  4PUO A;  3OS0 A;  1JLQ A;  1BL3 A;  2WON A;  1TV6 A;  4FJ5 A;  3O3G A;  3OYH A;  1HNI A;  5CY4 A;  4DF8 A;  1UOC A;  4H8K A;  3DLR A;  4Q5V A;  4KHU A;  3QLH A;  4EZ6 A;  1KVB A;  3AVJ A;  4DTR A;  4CJT A;  4LH4 A;  3TAB A;  1ASV A;  4FW1 A;  3C94 A;  3VA0 A;  3BDP A;  4CEQ A;  1RDB A;  1GOA A;  3D45 A;  3TI0 A;  3HYF A;  4KHQ A;  5HBM A;  4M3W A;  4FJ8 A;  4JS5 A;  4CGD A;  1UWB A;  4B8A B;  3DM2 A;  1C0T A;  1UAX A;  2HHV A;  3A2F A;  1HNV A;  3NE6 A;  2G8W A;  2KW4 A;  4CJU A;  3NCI A;  4DSF A;  4B9V A;  3RR7 A;  4DSL A;  4F8R A;  1JLE A;  1RDA A;  4DLG A;  3PUF A;  4J2A A;  3JYT A;  2A1S A;  3IRX A;  4DTX A;  1T03 A;  4CCH A;  1KFS A;  4KB0 A;  3C6T A;  4DS5 A;  2F8S A;  3V1Q A;  1WNS A;  1I39 A;  2HVH A;  3QEP A;  4FM0 A;  2W42 A;  4AHV A;  1N5Y A;  1TK5 A;  4C8O A;  4DTM A;  1S9G A;  4IFV A;  4DFK A;  1BQN A;  1N6Q A;  3QEI A;  4F4K A;  2X6S A;  4CJR A;  1IKX A;  4Y1D A;  1D8Y A;  1VSJ A;  4GW6 A;  4DS4 A;  4DU1 A;  3LP3 A;  4B08 A;  4FK2 A;  3L8B A;  2DY4 A;  2A1R A;  3ULD A;  4CJ3 A;  1S9E A;  5C24 A;  1ITG A;  1WAF A;  4DTP A;  1XI1 A;  4KTQ A;  1WSE A;  3AVL A;  3V9W A;  3EY1 A;  1W9H A;  3RRG A;  5E41 A;  4ELV A;  1TVR A;  1X9W A;  3ZSX A;  1A5X A;  2D0A A;  4O0I A;  3OYF A;  1NK5 A;  1SL1 A;  3P1G A;  4M3X A;  1DLO A;  4QCL A;  1EX4 A;  4RG8 A;  2HMI A;  2YV0 X;  3TAE A;  1KFD A;  4M3U A;  1TKD A;  5FRN A;  3L2R A;  2QK9 A;  4AHU A;  1EET A;  4DTO A;  2Y1I A;  1FXX A;  1WSF A;  3AA3 A;  3ZT3 A;  2JLE A;  3OYL A;  5SZT A;  3I0S A;  1JLC A;  3CG7 A;  3MEE A;  4DG1 A;  3KD1 E;  4CJE A;  3DI6 A;  4CJQ A;  3G0Z A;  4H4M A;  4KFB A;  5HP1 A;  4HUE A;  3MED A;  4BWM A;  4E7L A;  4FJN A;  3B6O A;  1TGO A;  3OYD A;  3C95 A;  2HHX A;  4DMN A;  3QER A;  4CFB A;  3QIO A;  3LAK A;  5DK5 A;  4LY7 A;  1XHZ A;  1LV5 A;  1VSD A;  2QKK A;  4Z4I A;  3SQ4 A;  2IC3 A;  3NF8 A;  2E4L A;  1JLG A;  4IG3 A;  4W5Q A;  3OYK A;  1WSG A;  4C8N A;  4LD0 A;  3JSM A;  1L3V A;  1FK9 A;  4WE1 A;  1JXE A;  3E01 A;  3ZCM A;  1TK0 A;  3KTQ A;  4CGG A;  5D3G A;  4KRE A;  4W5N A;  5FDL A;  3NBP A;  3LP2 A;  2VG5 A;  5T7B A;  4FCY A;  4DFP A;  3K2P A;  3AVG A;  3K57 A;  4DFJ A;  1U49 A;  3OYJ A;  2YNI A;  2PZS A;  1NK6 A;  4I2P A;  3SZ2 A;  4FK0 A;  1VRU A;  3FFI A;  3WNF A;  4CEB A;  3U6F A;  4JRP A;  3TAN A;  4Q0B A;  1TAU A;  2QKB A;  3KD5 E;  3HO1 A;  2ITG A;  4OGC A;  4CIF A;  2EHG A;  2G8K A;  3DMJ A;  4CF8 A;  3SNN A;  1HMV A;  4DF4 A;  1B92 A;  3QIN A;  4IKF A;  2P1J A;  1NJY A;  4E7J A;  2O4G A;  4BE0 A;  3KLG A;  3ZT1 A;  4C8L A;  1F21 A;  5HRP A;  4OPK A;  3LWL A;  1RT2 A;  3SV3 A;  4NCB A;  1LAW A;  2O4I A;  4E1M A;  1ZBF A;  4CEF A;  2IGI A;  3ZT4 A;  2BDP A;  4C8K A;  2Y1J A;  2VG7 A;  4I7F A;  4CGF A;  1QSS A;  4LSN A;  1BIU A;  3DRP A;  3RMC A;  4B9L A;  1WLJ A;  3RMD A;  4CJ5 A;  3LPT A;  1WSH A;  3TWH A;  3S3N A;  4N76 A;  1Y97 A;  3SYZ A;  1SKS A;  1NKC A;  1D9D A;  4Z0U A;  1ZBU A;  2IAJ A;  4CJL A;  3HM9 A;  1SV5 A;  2VWJ A;  3M8R A;  2XO7 A;  3CFO A;  1SKW A;  2PYJ A;  2OZM A;  3F9K A;  3PY8 A;  1Q8I A;  3DLK A;  2P5G A;  1RCH A;  1EP4 A;  3LAM A;  3MAQ A;  2B6A A;  1SL2 A;  4CJW A;  1XWL A;  2XHB A;  4HHT A;  1IO2 A;  1QSY A;  2DFE A;  4FLT A;  1JL2 A;  2BE2 A;  4FLV A;  4HVJ A;  4JRQ A;  1NK7 A;  4B9U A;  5JS1 A;  4N41 A;  2F8T A;  3PX4 A;  3ISN C;  3LAN A;  4CGJ A;  3LDS A;  3D0P A;  3P83 D;  3RRH A;  1TK8 A;  3O3H A;  3ZSO A;  4K8Z A;  4CHP A;  4KRF A;  4KHS A;  4E89 A;  3NDK A;  4N56 A;  3PX6 A;  2BAN A;  4AHS A;  2P5O A;  1BQM A;  1G15 A;  4B9T A;  1HRH A;  3PV8 A;  4J2B A;  1C1B A;  3TAG A;  1JLB A;  5I3U A;  1J9A A;  1C6V A;  3LAL A;  3F73 A;  5J2P A;  4CEO A;  4KAZ A;  4F2R A;  1VSF A;  1XHX A;  2XY5 A;  4CEZ A;  5J2N A;  4KI4 A;  1RTH A;  2EX3 A;  1CZ9 A;  4MFB A;  4F2S A;  4FYD A;  4M41 A;  1TL1 A;  4OJR A;  4CIG A;  4M3T A;  2YHB A;  3VQQ A;  4YNQ A;  1KSP A;  3AVI A;  3LZI A;  2OPS A;  1RBS A;  4FJJ A;  3ITH A;  3HVR A;  1S1U A;  2OZS A;  3AVN A;  1QE1 A;  4KPY A;  1LAV A;  1NOY A;  3RWU A;  4N5S A;  4FLU A;  1T8E A;  3HK2 A;  3V9S A;  4CF0 A;  1DTQ A;  3O3F A;  2HHW A;  1S5J A;  3VQD A;  3VQA A;  4DWI A;  3V81 A;  1BIZ A;  3I0R A;  4CHQ A;  4DU4 A;  1SKR A;  3DLG A;  4DSK A;  3V9X A;  1WSJ A;  2HHT A;  3P5J A;  3VQ4 A;  3M8Q A;  3DLE A;  3QIP A;  3OYM A;  4Y1C A;  4B8C A;  4PQU A;  4C8M A;  4UQG A;  3V1O A;  1HPZ A;  3AVM A;  3HT3 A;  4OKE A;  3ZSY A;  3K5O A;  4E7K A;  4KHY A;  3L2Q A;  1RTD A;  2ATQ A;  1YVU A;  2NUB A;  3MXJ A;  4E7H A;  3V1R A;  1GOB A;  3NH2 A;  4DTS A;  1S1V A;  3V6D A;  4Z4F A;  3SUP A;  3QES A;  2DTU A;  5FRM A;  3LP1 A;  1D5A A;  3HP9 A;  4E1N A;  4HUF A;  4JLH A;  4ELT A;  4W5T A;  4HCC A;  3SUO A;  4AIL C;  1REV A;  4CHZ A;  3M8S A;  4BDZ A;  1C0M A;  5CZ2 A;  4BDY A;  5HLF A;  1GOC A;  2DFH A;  1KLN A;  3HPH A;  4DTJ A;  1MU2 A;  3PO4 A;  4IG0 A;  4OPJ A;  4BAC A;  2G8U A;  4J2E A;  1QQC A;  1TL3 A;  3ZSW A;  5KGX A;  3V9U A;  4J2D A;  4OLA A;  3TAP A;  2YKM A;  1RT3 A;  1QS4 A;  1IKY A;  3DOL A;  1Q9X A;  4DQR A;  5CZ1 A;  4FLW A;  4CFD A;  1B9F A;  1VSH A;  3HST B;  3KKR A;  5J2Q A;  4O0J A;  3S9H A;  4CF1 A;  1TKT A;  4FLZ A;  1ASU A;  3L2U A;  4H4O A;  1C1A A;  1S1W A;  4FJX A;  3CQ8 A;  1J53 A;  3RMA A;  3RTV A;  5HRN A;  3OJU A;  4ID1 A;  1VSL A;  3IS9 A;  1NK8 A;  3HJF A;  2KFZ A;  2KQ2 A;  4G1Q A;  4KO0 A;  3TAR A;  4FZY A;  3H08 A;  3DRR A;  4AH9 A;  3AO2 A;  4E3S A;  1K6Y A;  4ID5 A;  4XIU A;  5DMR A;  1BHL A;  4RW9 A;  3OYN A;  4CIE A;  3SUQ A;  3V4I A;  4KHW A;  1WSI A;  3EZ5 A;  4OGE A;  3B6P A;  3L3U A;  4DSJ A;  3VQ5 A;  2KFN A;  1J5O A;  2IS3 A;  1HYV A;  3O4N A;  5C42 A;  3OYG A;  3THV A;  1SUQ A;  4BDP A;  3WNE A;  4DTN A;  3QEV A;  1LWE A;  4M45 A;  4M3R A;  1RNH A;  4FM1 A;  3QNO A;  1NJW A;  3RMB A;  2HND A;  1R0A A;  3LWM A;  4FJG A;  4NCA A;  4CJP A;  1L3T A;  4I9L A;  4DQQ A;  1CZB A;  3KK1 A;  1W0H A;  3AA2 A;  2B5J A;  3LPU A;  1IH7 A;  1JL1 A;  5HRS A;  3OS1 A;  3OYI A;  4CK2 A;  1ZBI A;  3KLE A;  2BGG A;  4LSL A;  1CLQ A;  5KTQ A;  4Z4E A;  3QEW A;  3TAM A;  1ZBH A;  3OS2 A;  4FW2 A;  3DLH A;  5J2M A;  4CEE A;  1S6P A;  4KTW A;  4CGI A;  4CJF A;  3OYE A;  3CYM A;  4KV8 A;  2HHQ A;  1KLM A;  3AO5 A;  3AVF A;  1J54 A;  4IBN A;  3L2W A;  2D5R A;  3VQE A;  3KKS A;  3NGI A;  3WNH A;  2Z1J A;  2P51 A;  1BGX T;  2X74 A;  4RW8 A;  3OVN A;  5CYQ A;  1S1X A;  4IFY A;  4MQ3 A;  3VQ7 A;  3HPG A;  3HP6 A;  3S3M A;  4TSX A;  1RT5 A;  3SQ2 A;  3AVK A;  2G8V A;  4HTU A;  3QO9 A;  3VQ8 A;  2IOC A;  4E19 A;  4OKJ A;  1QSL A;  4FJL A;  3CFP A;  1X9M A;  4YFU A;  1KTQ A;  3KIO A;  3WNG A;  2HNY A;  4KTZ A;  1U47 A;  2G8I A;  1CXU A;  4CEA A;  2YNF A;  1NKB A;  4OVL A;  1KVC A;  3HPO A;  3SQ1 A;  4QOZ B;  3OY9 A;  1UA0 A;  4IDK A;  2XRI A;  2ZD1 A;  4CFA A;  4CHO A;  4FJH A;  1VSI A;  3ZSQ A;  4R5P A;  1BI4 B;  1RDC A;  3IAY A;  3DLB A;  2WOM A;  4FZZ A;  1TKX A;  4CGH A;  4KB1 A;  2RPI A;  2HW3 A;  3NH1 A;  4M42 A;  1EKE A;  1JKH A;  2GBZ A;  4GMJ B;  3K5L A;  1X1P A;  4O5B A;  4FM2 A;  3SPY A;  3IG1 A;  4FJI A;  2KZZ A;  1YTA A;  2GUI A;  5I42 A;  3CM6 A;  3L3V A;  3CFR A;  3I8D A;  2G8F A;  4B9N A;  3MXM A;  3KLF A;  4AHC A;  4ELU A;  4BWJ A;  4W5O A;  1I3A A;  4FLY A;  4GVM A;  4CED A;  2LSN A;  3O4Q A;  3VQC A;  2XY6 A;  4RW4 A;  4FJM A;  1NOZ A;  1BCO A;  3SQ0 A;  1RT1 A;  1RBU A;  1UA1 A;  2HHU A;  1RBV A;  2E6L A;  3DYA A;  5KGW A;  2Z1G A;  4BE2 A;  2D0B A;  1DTT A;  1O1W A;  3NF7 A;  2F96 A;  3HVT A;  3NAE A;  4NYF A;  3SV4 A;  2X78 A;  4RW7 A;  2OA8 A;  1RIL A;  1RBR A;  4PA1 A;  5KRS A;  2QXF A;  4DSE A;  4OKK A;  3KJV A;  4KI6 A;  4O55 A;  2VWK A;  1EXQ A;  2KZM A;  1WAJ A;  1RTJ A;  1VK0 A;  3V9Z A;  2FBX A;  1LWC A;  1RT4 A;  2E6M A;  4EP4 A;  1A5W A;  2OPR A;  4CJV A;  4Z4G A;  3M8P A;  3T19 A;  2D0C A;  4OLB A;  2Z1H A;  3DRS A;  4CE9 A;  4B3O A;  2PY5 A;  2FBT A;  1HYZ A;  1RDD A;  3AO4 A;  1NK9 A;  4K8X A;  2HNZ A;  2IDO A;  5JS2 A;  1U48 A;  2ZE2 A;  4CHY A;  2FBV A;  4DQS A;  3U3Y A;  3CM5 A;  4FJ9 A;  1RT6 A;  3AVC A;  1IKW A;  3MEG A;  3NGY A;  3AO3 A;  1HJR A;  1RTI A;  2RF2 A;  3NF6 A;  1ASW A;  4Z4C A;  4CJK A;  3BGR A;  1HQE A;  1IKV A;  3KK3 A;  4JS4 A;  4BE1 A;  2YNG A;  3KK2 A;  1KRP A;  3ALY A;  4FZX C;  1C0U A;  3AA4 A;  2YHA A;  5J1E A;  4E7I A;  3QEX A;  2PYL A;  4L8R B;  4ZTF A;  1NJX A;  5EU7 A;  1VSK A;  2HVI A;  1HQU A;  4DU3 A;  3VN5 A;  1QHT A;  1NK4 A;  1BIS A;  4O4G A;  1D9F A;  3NHG A;  4F3T A;  2KTQ A;  1XC9 A;  3MXI A;  1Z26 A;  1LWF A;  2GV9 A;  2OPQ A;  2Z1I A;  1X9S A;  1Z25 A;  4CK3 A;  4O44 A;  1L5U A;  1LW0 A;  1CXQ A;  1JXB A;  1VSE A;  2JGU A;  3TR8 A;  4DTU A;  4PY5 A;  3G10 A;  4DQI A;  1HYS A; 
#chains in the Genus database with same CATH topology
 4IDH A;  3SI6 A;  4DSI A;  4IOX A;  4QAG A;  4FJ7 A;  4JKC A;  4CER A;  1JLF A;  3ZSV A;  4K43 A;  1M90 O;  1QZ5 A;  4F3O A;  4IEI A;  5HRO A;  3AA5 X;  1WN7 A;  3UKR A;  3UIQ A;  4ICL A;  1KCF A;  2HF4 A;  4CEC A;  4J8F A;  2RN2 A;  4B3R K;  3QB0 A;  2KKZ A;  5KRT A;  2HHS A;  2HBK A;  1OH5 A;  4GV3 A;  4FLX A;  1QQN A;  2ZQB A;  4ZTJ A;  2RE2 A;  4CJ4 A;  4JEP A;  1VQ7 N;  2P9S A;  1NNE A;  2CH6 A;  3AVH A;  1HJO A;  2Q3S A;  1VQM N;  3NGZ A;  4Z4H A;  2YNH A;  4L3Q A;  4CF9 A;  2IVN A;  1A5V A;  2P9S B;  2E1Y A;  2A40 A;  3QET A;  1YVN A;  3EYZ A;  1YTU A;  1L3S A;  2ETJ A;  3CJB A;  3LP0 A;  5AQG A;  2FC0 A;  3HOS A;  4I2Q A;  5AFU H;  4EIA A;  5BN8 A;  1RBT A;  3R1X A;  4JK9 A;  3K58 A;  3QNN A;  1NMN A;  4CZE A;  4EZ9 A;  3KLI A;  2BTF A;  4PUO A;  2WON A;  2P9U B;  4A2A A;  3O3G A;  4CZJ A;  1HNI A;  5CY4 A;  2YCH A;  1V4S A;  2O8C A;  5FPE A;  4QS7 A;  5FPM A;  4EZ6 A;  2HBM A;  4DTR A;  4IFE A;  4H0V B;  1JCE A;  4FW1 A;  4FWM A;  3TI0 A;  1YIJ N;  5EY4 A;  3KK7 A;  1UWB A;  4B8A B;  1HNV A;  3NE6 A;  1EQY A;  3NCI A;  3CC7 N;  3RR7 A;  3ENB A;  1JLE A;  1RDA A;  3HI0 A;  3PUF A;  4NLB A;  3JYT A;  2IIR A;  5M1N A;  3C6T A;  3O9R A;  3QEP A;  1W7A A;  4M7X A;  1S9G A;  2CH5 A;  4K42 A;  4CJR A;  1K8K A;  5AZJ B;  1IKX A;  3FGU A;  4GW6 A;  4DS4 A;  2ITM A;  4B08 A;  2E2Q A;  5AQL A;  4IWV A;  4WFB L;  2ZJP L;  3QDK A;  3V9W A;  5E41 A;  1TVR A;  3QFU A;  3OYF A;  4O0I A;  4BC3 A;  3P1G A;  3P4I A;  5FRN A;  2QK9 A;  4AHU A;  1T6D A;  1YJ9 N;  3AA3 A;  3K0S A;  4H5V A;  3THY B;  1NLV A;  1JLC A;  3CG7 A;  2E1Z A;  1NGG A;  3KD1 E;  3E66 A;  4H4M A;  4KFB A;  1T44 A;  5HP1 A;  3EEQ A;  3UKR B;  2QWO A;  4BWM A;  3OYD A;  3T7Z A;  3UKU A;  3QER A;  4Z4I A;  3SQ4 A;  4A61 A;  1QHA A;  4IG3 A;  4X64 K;  4ILH A;  5AQZ A;  1WSG A;  3N4Q A;  4C8N A;  5M1K A;  3OYK A;  1FK9 A;  1TK0 A;  1JXE A;  5CR4 A;  5D3G A;  4W5N A;  4WFN L;  3O80 A;  3ID6 A;  2YNI A;  3GG4 A;  5MLC Q;  2FSN A;  3MK6 A;  1NBW A;  3C7N B;  2O8F B;  3FFI A;  4CEB A;  1TAU A;  4Q0B A;  4JRP A;  3TAN A;  3CPW M;  2G8K A;  4CF8 A;  3CCM N;  4MO4 A;  4DF4 A;  2P1J A;  3K9J A;  5HRP A;  3LWL A;  3SV3 A;  1ZBF A;  2IGI A;  3ZT4 A;  4C8K A;  1TUY A;  1WOQ A;  4I7F A;  3JAM O;  4N76 A;  4HWI A;  1OKJ A;  3SYZ A;  1SKS A;  3TSQ A;  3HM9 A;  1SV5 A;  4QS8 A;  3WXJ A;  2VWJ A;  5JVH L;  2PYJ A;  2OZM A;  3CPE A;  3L6Q A;  3DLK A;  1EP4 A;  4GY2 B;  1EO1 A;  1V4T A;  4BRG A;  2QM1 A;  1XWL A;  3QIC A;  3KHY A;  4HVJ A;  1D4X A;  4JK7 A;  4LF4 K;  3RRH A;  2O8E A;  4CHP A;  4KHS A;  4N56 A;  4JI5 K;  2BAN A;  2P5O A;  1C1B A;  1JLB A;  1C6V A;  4O5F A;  3TSP A;  2XY5 A;  3NMU A;  4KI4 A;  4OO1 J;  1GLJ O;  1BU6 O;  4JKE A;  4M41 A;  4OJR A;  2YHB A;  1KSP A;  4CI6 A;  2OPS A;  4YOY A;  3LZI A;  1ATR A;  3HVR A;  4A2B A;  5BRE A;  1QE1 A;  4JHD B;  3WXM B;  4N5S A;  4IO9 L;  4CF0 A;  3G4S N;  2HHW A;  3VQD A;  3ZYY X;  4DCH A;  2H3G X;  3OYM A;  4FSV A;  5KQ8 A;  3EZW A;  3ZSY A;  4MLE A;  4H5N A;  3K5O A;  2FF3 B;  3AGK A;  2ATQ A;  4E7H A;  2NUB A;  3V6D A;  4UY8 O;  4Z4F A;  3NH2 A;  1S1V A;  3GBT A;  5I9E B;  3HP9 A;  3CCL N;  3SBG A;  4HUF A;  4ELT A;  4B1X B;  2NNW A;  4CHZ A;  4BDZ A;  1C0M A;  5CZ2 A;  3F9M A;  3VF2 A;  2YJF A;  4OPJ A;  4BRF A;  3TAP A;  1IKY A;  3SK3 A;  4DQR A;  4FLW A;  1XUP O;  3J8A A;  1B9F A;  3KKR A;  2UXD K;  4FLZ A;  4A5B A;  3L2U A;  4FJX A;  1S1W A;  1P8Z A;  1NGJ A;  3RMA A;  1QZ6 A;  1NK8 A;  2Q36 A;  1E4G T;  4KO0 A;  3TAR A;  4XEI A;  4JNE A;  4PKG A;  4RW9 A;  5AQK A;  2A42 A;  3SUQ A;  1YIT N;  4BRD A;  3L3U A;  2KFN A;  3OYG A;  1HKC A;  4DR5 K;  3THV A;  4BDP A;  4FWK A;  2D1K A;  3VEV A;  4DTN A;  3IUC A;  4FOI A;  4M45 A;  3QNO A;  1RNH A;  1R0A A;  3LWM A;  4NCA A;  4CJP A;  1HX1 A;  2PFU A;  1IBM K;  4LF5 K;  4MO5 A;  3OYI A;  3AA2 A;  3OS1 A;  1R59 O;  4CK2 A;  2BGG A;  1CLQ A;  4CBX A;  3OS2 A;  2Q31 A;  3T69 A;  3C6H A;  2NRX A;  1S6P A;  4KTW A;  3OYE A;  2VGN A;  3C0B A;  3CYM A;  4I6M B;  5BPM A;  1J54 A;  4IBN A;  3R6M A;  2P51 A;  2X74 A;  4RW8 A;  4XH4 A;  3VQ7 A;  4FZY A;  1S1X A;  4MQ3 A;  4DR1 K;  3S3M A;  1EWQ A;  2G8V A;  2P9U A;  3L4I A;  3QO9 A;  3CFP A;  2HNY A;  2G8I A;  3HSC A;  5FPD A;  1UA0 A;  4IDK A;  5JVG L;  4CHO A;  4B9Q A;  1NGA A;  3ID8 A;  4IEE A;  2IVP A;  2UUB K;  1KXP A;  4CGH A;  5GIN A;  2HW3 A;  2NLX A;  2GBZ A;  1VHX A;  3FZK A;  2F9T A;  2GUI A;  3BZC A;  3CM6 A;  2V52 B;  3CFR A;  2G8F A;  3KLF A;  4ELU A;  5IWA K;  1DEJ A;  3EE9 A;  4B1U B;  1N8R O;  3RSE B;  3Q7C A;  1YJN N;  2P9K A;  3O4Q A;  4FJM A;  1NOZ A;  4Y0W A;  3A5M C;  5KGW A;  4DV7 K;  2E88 A;  1DTT A;  1O1W A;  3HVT A;  4NYF A;  2X78 A;  1RIL A;  5ELZ A;  4DSE A;  2V7Z A;  4KI6 A;  4O55 A;  4U7B A;  3V9Z A;  5AQF A;  3LDN A;  3IKM A;  1NGF A;  2D0C A;  4YDU C;  4JV5 K;  5FLX O;  4CE9 A;  2PY5 A;  3O4W A;  2E8A A;  3DXM B;  1RDD A;  1VQN N;  4K8X A;  2HNZ A;  4DV4 K;  5JS2 A;  1U48 A;  3O9U A;  4FJ9 A;  3AVC A;  4BR7 A;  3O1W A;  3AO3 A;  2ZWH A;  3OBW A;  4CJK A;  4JS4 A;  4KH4 A;  3KK3 A;  1IKV A;  3H45 C;  3PIO L;  3ALY A;  1C0U A;  4E7I A;  2YHA A;  1XMO K;  1T3V A;  3LM2 A;  2HVI A;  1HQU A;  5AQY A;  5EXW A;  1IBK K;  4PKH A;  4O4G A;  3CIP A;  1Z26 A;  3QML A;  2OPQ A;  2O8F A;  1NGI A;  1CXQ A;  3KWI A;  2JWK A;  1VSE A;  3G10 A;  5J2N A;  3K5N A;  1MWK A;  1C1C A;  3CCJ N;  1T05 A;  2I5J A;  2E2N A;  4LH5 A;  4JI8 K;  4FVM A;  3VOV A;  3K5M A;  4BC4 A;  1ZBL A;  4WQ4 C;  3HL8 A;  1OH8 A;  1L3U A;  3VQB A;  2R7Y A;  4KHN A;  2DFF A;  1VSM A;  1MA9 B;  1TKZ A;  5JLF A;  1VRT A;  2BH1 A;  1OVQ A;  1QTM A;  2XY8 A;  5SWM A;  4YOV A;  3C6U A;  4CK1 A;  3DOK A;  4V19 S;  4FXD A;  2GX9 A;  1FKP A;  3THW A;  3OYB A;  3T1Y K;  4FWO A;  4B3S K;  4GNI A;  1T7P A;  2OPP A;  1NJZ A;  3EKU A;  1NJI O;  2YKN A;  2A41 A;  5FPN A;  3VQ6 A;  4CF2 A;  3THW B;  4WCE L;  1X3N A;  1HKG A;  3ZSZ A;  5ADX H;  4DV2 K;  1VQ5 N;  2P9I B;  5EX5 A;  2V7Y A;  5EOY A;  1NKE A;  1Q7Y O;  3B8A X;  1JLA A;  5C2D A;  3MEC A;  4FJK A;  1S6Q A;  4C1N I;  4JYA K;  3AVA A;  4KKO A;  3RSE A;  3DWL A;  1IG9 A;  2XY7 A;  2PBD A;  4HUG A;  1KAZ A;  3MWT A;  2ZJR L;  5CYM A;  3M3Z A;  4QS9 A;  4DF8 A;  2QTD A;  2QWR A;  3ZEU A;  3AVJ A;  3HRG A;  1ZBS A;  3E9O A;  3C94 A;  3VA0 A;  3BDP A;  3D45 A;  3VEO A;  5HOO A;  4KHQ A;  3SAG A;  2HHV A;  2KW4 A;  3CI5 A;  4BVO A;  4BRA A;  5BPN A;  3CJ7 A;  2A1S A;  4AF1 A;  4DTX A;  4KB0 A;  1KFS A;  4RTF D;  2F8S A;  4DS5 A;  1I39 A;  4WYB A;  5ADX A;  1KQS M;  1N5Y A;  1TK5 A;  4C8O A;  4DR4 K;  3GOI A;  2WFB A;  3CME N;  4IFV A;  4DFK A;  3QEI A;  2X6S A;  3GL1 A;  2FSJ A;  2P9L A;  1D8Y A;  1VSJ A;  4B3T K;  4DU1 A;  2HOE A;  3LP3 A;  2A1R A;  3ULD A;  4FWL A;  4H5T A;  1S9E A;  1KAY A;  4KTQ A;  1WSE A;  2ASM A;  3EY1 A;  1W9H A;  5C15 A;  3RRG A;  2P9L B;  4M3X A;  4CVN E;  4AQY K;  4QCL A;  3K9K A;  2HMI A;  3O1B A;  4DQ8 A;  3L2R A;  3SBT A;  3C7N A;  1EET A;  2Y1I A;  1FXX A;  3ZT3 A;  5JLH A;  1NG9 A;  3I0S A;  4CJE A;  4CJQ A;  3G0Z A;  4O8K A;  2E20 A;  4FJN A;  3B6O A;  1GLB G;  3C95 A;  1LV5 A;  4LF6 K;  1VSD A;  2QKK A;  3NF8 A;  2IC3 A;  2E4L A;  1JLG A;  4CZK A;  1C0F A;  3FZF A;  3O08 A;  4WE1 A;  3ZCM A;  3CCV N;  3G25 A;  5FDL A;  3MX5 A;  3LP2 A;  5T7B A;  4FCY A;  3OYJ A;  2PZS A;  5JMV A;  4I2P A;  4LFB K;  5GAD P;  4KBO A;  2ITG A;  2EHG A;  5KPZ A;  3DMJ A;  1HMV A;  1B92 A;  1NJY A;  4E7J A;  2O4G A;  3KLG A;  3ZT1 A;  1N33 K;  4EAH D;  1F21 A;  4NCB A;  1LAW A;  4E1M A;  4CEF A;  2BDP A;  2VG7 A;  3ULE A;  1WLJ A;  4CJ5 A;  1Y97 A;  4BRN A;  4WFA L;  4M7Y A;  5AQR A;  1D9D A;  3F9K A;  4EHU A;  1Q8I A;  3FZH A;  3VTH A;  3AAP A;  5CE3 A;  3MAQ A;  2D0O A;  1K8K B;  1BDG A;  2XHB A;  4HHT A;  1IO2 A;  4FLV A;  4FLT A;  2BE2 A;  3M1F A;  4NB4 A;  3O9Q A;  2QXL A;  1NK7 A;  5AQV A;  3KZB A;  4N41 A;  1LOT B;  4FJG A;  3LDS A;  3MN7 A;  2HVH A;  3P83 D;  4ISE A;  4K8Z A;  4DB3 A;  3PX6 A;  3DXK A;  3R9P A;  3THX B;  1X9J A;  4B9T A;  1HRH A;  1J9A A;  3F73 A;  5J2P A;  4CEO A;  4FOE A;  5AZJ A;  3THY A;  1Q18 A;  4F2S A;  2YHX A;  3I56 N;  1TL1 A;  2HMP A;  4PL8 A;  1VQO N;  3MCA B;  4YNQ A;  1C0G A;  2OTJ N;  2YI1 A;  3U4L A;  1LAV A;  1ZXO A;  1HNX K;  3IFR A;  5GAH P;  4FLU A;  4BQZ A;  3V9S A;  2UXC K;  1S5J A;  3VQA A;  3V81 A;  4FWN A;  3ZLJ A;  4CHQ A;  4DU4 A;  5LJV A;  1K8A O;  3P5J A;  5LJW A;  4IJA A;  4XH1 A;  4Y1C A;  3D2F A;  3V1O A;  1YAG A;  1VQ4 N;  4CZF A;  4BY9 C;  1I94 K;  4E7K A;  4YHH K;  4KHY A;  3HOT A;  1GOB A;  5LY3 A;  4BR4 A;  4DR3 K;  3QES A;  3LP1 A;  4AIL C;  1REV A;  4BDY A;  4BAC A;  3J7Y P;  3L4Q A;  3VTI A;  3ZSW A;  2QWM A;  2YKM A;  1QS4 A;  1Q9X A;  5CZ1 A;  1VSH A;  2NRT A;  5J2Q A;  2UYT A;  3S9H A;  3E1Y A;  1C1A A;  4FVU A;  3CQ8 A;  5EVZ A;  5HRN A;  4ID1 A;  1VSL A;  2KQ2 A;  3P38 A;  4GV6 A;  1BG3 A;  3CQX A;  4K0K K;  4E3S A;  3BF1 A;  5DMR A;  4DV5 K;  1Q81 O;  4GKJ K;  3EN9 A;  5AQJ A;  4DSJ A;  3VQ5 A;  3A8Y A;  2IS3 A;  3O4N A;  1NU0 A;  5C42 A;  4FPB A;  3WNE A;  3QEV A;  1LWE A;  2BUP A;  3RMB A;  2HND A;  2O8B A;  1ATS A;  4DQQ A;  5F2R A;  3VEW A;  3I8B A;  3TTC A;  3KK1 A;  4HTL A;  1RGI A;  2B5J A;  2O8E B;  3GE1 A;  1JL1 A;  4EFH A;  3KLE A;  4LSL A;  3I33 A;  3QEW A;  3TAM A;  3ZET A;  1N34 K;  3DLH A;  3VEZ A;  4CEE A;  2WC9 A;  4CJF A;  4O8U A;  4KV8 A;  2HHQ A;  4JKF A;  1KLM A;  3AO5 A;  5AQW A;  4BR0 A;  3NGI A;  4DHY A;  5CYQ A;  1BGX T;  2HF3 A;  4BRC A;  3HPG A;  3O9S A;  4TSX A;  1XNR K;  4HTU A;  3VQ8 A;  1MWM A;  4BG8 A;  3BZK A;  1X9M A;  4CZM A;  4OVL A;  1KVC A;  3M6G A;  2HBJ A;  2QI2 A;  4CFA A;  4FJH A;  1VSI A;  3ZSQ A;  4JKG A;  1BI4 B;  2NRH A;  4WQ4 A;  3IAY A;  2GWK A;  3MCP A;  4GVE A;  2WOM A;  3DLB A;  1S3X A;  1TKX A;  2P9P B;  4KB1 A;  4FZZ A;  2GTD A;  1EKE A;  5KQD A;  3CJ1 A;  3K5L A;  3ATU A;  4O5B A;  3IG1 A;  4FJI A;  1O13 A;  3L3V A;  5AQP A;  4BRE A;  4W5O A;  2FLO A;  4FLY A;  4GVM A;  2LSN A;  1BCO A;  3SQ0 A;  3DYA A;  4JK8 A;  1L3V A;  4DR6 K;  3NF7 A;  3SV4 A;  3CC2 N;  3NAE A;  3MN5 A;  3G71 N;  3KVG A;  1OH6 A;  4M63 C;  2VWK A;  3OA9 A;  1LWC A;  2DPN A;  2E6M A;  4EP4 A;  1MDU B;  2OPR A;  4NXN K;  5M1O A;  3M8P A;  4LC9 B;  4BC2 A;  1RDU A;  3DLL L;  2IDO A;  2ZE2 A;  4CHY A;  4DQS A;  3U3Y A;  3TTF A;  4H0Y B;  3UB5 A;  1YXQ A;  3BGR A;  1HQE A;  2W40 A;  4Z94 A;  3PLA A;  2YNG A;  1KRP A;  3O6W A;  3AA4 A;  3H3O B;  4BRK A;  4FZX C;  4L8R B;  3HM8 A;  4DU3 A;  1DGK N;  4F3T A;  2KTQ A;  1X9S A;  2GV9 A;  1BA1 A;  4EHT A;  4BGB A;  1L5U A;  1JXB A;  3TR8 A;  3SQ2 A;  1HYS A;  5BR9 A;  4BR2 A;  2E2P A;  2ASO A;  3SPZ A;  3JSM A;  4YOT A;  3VMF B;  3MDQ A;  3VET A;  4HCB A;  3J7A P;  4AHT A;  4ZHR A;  4IOC L;  5FRO A;  3JXU A;  3AAR A;  1TAQ A;  4ILJ A;  3ULE B;  3L2V A;  1Q9Y A;  2F4V K;  4U67 L;  1DT9 A;  1TUU A;  2QWL A;  4LFC K;  4E0D A;  2P9I A;  4NCG A;  1FKO A;  3KLH A;  4JHD A;  1U4B A;  4DR7 K;  4DQP A;  2P9K B;  4EP5 A;  4DFM A;  3M5R A;  4CZI A;  2HB5 A;  3NFA A;  5C25 A;  1J5E K;  4B9S A;  4B1V A;  1LW2 A;  3OBY A;  3VGL A;  4CJS A;  3AV9 A;  5B8H A;  3J81 O;  2GWJ A;  4WQ5 C;  3TAQ A;  3HZ6 A;  3WQT A;  1ZYQ A;  4FK4 A;  3U3G A;  3RR8 A;  2ZM6 K;  4N47 A;  1BI4 A;  4BRM A;  3TTD A;  3OYC A;  4DLE A;  3ATV A;  3ZT2 A;  4JI4 K;  1W2B M;  4CZH A;  2OTL N;  3CD6 N;  4CES A;  4B1Y B;  1NGE A;  2OYQ A;  4A62 A;  1IJJ A;  5BPL A;  3PX0 A;  3ZSR A;  2B4J A;  1BCM A;  5K14 A;  1E3M A;  3OS0 A;  4BR9 A;  3UKU B;  3MX2 A;  4G9Z A;  1UOC A;  3DLR A;  4Q5V A;  4KHU A;  2FSK A;  1KVB A;  4CJT A;  1ILY A;  5C12 A;  3TAB A;  3CMA N;  3VGM A;  5AR0 A;  3O5B A;  3W0L A;  3HYF A;  1WUA A;  3WEE A;  1U2V B;  3CXC M;  3P31 A;  3DM2 A;  1C0T A;  1UAX A;  3A2F A;  4B9V A;  3O8M A;  1TYQ B;  4CJU A;  4DSL A;  2RHK A;  3LL3 A;  4DLG A;  1U2V A;  3IRX A;  4CCH A;  2QW9 A;  2QWQ A;  4CBU A;  5GIO A;  1BQN A;  3WT0 A;  1N6Q A;  4F4K A;  4Y1D A;  2Q1N A;  2DY4 A;  4CJ3 A;  4X62 K;  1ITG A;  1XI1 A;  3AVL A;  1KD1 O;  3J7Z O;  1X9W A;  1A5X A;  2D0A A;  1SAZ A;  1DLO A;  5CHI A;  1EX4 A;  4RG8 A;  4FWQ A;  4M3U A;  4YOW A;  1KFD A;  3VPZ A;  4BC5 A;  4DUY K;  4DTO A;  1WSF A;  3H3N O;  1WB9 A;  4AM6 A;  2ZGZ A;  4X65 K;  4DG1 A;  1T6C A;  3DI6 A;  1Q86 O;  2CGJ A;  3TPQ A;  4HUE A;  3MED A;  4JKB A;  1TGO A;  1KAX A;  2HHX A;  2VQE K;  5DK5 A;  5AZI A;  4LY7 A;  3D7E O;  4M3W A;  3E01 A;  4CGG A;  2NRZ A;  3ZX0 A;  3K2P A;  3K57 A;  4DFJ A;  1U49 A;  1NK6 A;  5AZI B;  3ZET B;  4BG9 A;  1VQ9 N;  4FK0 A;  3U9D A;  4XH5 A;  3PIP L;  3CCS N;  3U6F A;  4CZG A;  3HO1 A;  3SMP A;  1J6Z A;  4JKH A;  3NVK A;  3SNN A;  1GLL O;  1HKB A;  4IKF A;  4A57 A;  3F2K A;  2A6A A;  1FJG K;  2FXU A;  1RT2 A;  3A5L C;  1YF5 L;  3WXL A;  5E84 A;  5AQU A;  3T1H K;  3LDQ A;  4LSN A;  1BIU A;  4B9L A;  3S3N A;  3LPT A;  1WSH A;  3TWH A;  4B3M K;  4FWS A;  2ZGY A;  3WQU A;  2YHY A;  3M8R A;  2XO7 A;  3CFO A;  1SKW A;  2P9P A;  3PY8 A;  1YI2 N;  1RCH A;  3LAM A;  3HBT A;  1SL2 A;  1N36 K;  2W6L A;  5A2Q O;  3VER A;  1QSY A;  3GDQ A;  1JL2 A;  4JRQ A;  5TKW A;  3G6E N;  3CCR N;  5AQQ A;  4BRP A;  2F8T A;  3PX4 A;  1TK8 A;  3LAN A;  3UE5 A;  3D0P A;  4JI6 K;  1HLU A;  3ZSO A;  3O3H A;  3NDK A;  1NMD A;  1G15 A;  4IZ9 A;  3TAG A;  2UUA K;  3LAL A;  1VSF A;  5E26 A;  4CEZ A;  1XMQ K;  4ISF A;  2WUS A;  4DUZ K;  4E1J A;  4M3T A;  3AVI A;  3IDH A;  3JS6 A;  3ITH A;  5BR8 K;  5KPT A;  2OZS A;  2Q97 A;  4KPY A;  4K41 A;  1DTQ A;  4BVP A;  3O3F A;  1YJW N;  4JAX A;  4DWI A;  4OPA A;  3I0R A;  3DLG A;  2HHT A;  3VQ4 A;  3M8Q A;  3DLE A;  4PQU A;  4B8C A;  3SAF A;  4UQG A;  1HPZ A;  3AVM A;  3FFK B;  4OKE A;  1WBB A;  1NGC A;  1NGD A;  4DTS A;  3MXJ A;  2J4R A;  3V1R A;  3SUP A;  2DTU A;  4GKK K;  3S41 A;  4HCC A;  4JLH A;  3SMS A;  3M8S A;  5HLF A;  1GOC A;  2DFH A;  1KLN A;  4DTJ A;  1MU2 A;  3VEX A;  2G8U A;  4J2D A;  1QQC A;  1TL3 A;  4OLA A;  3ENO A;  5HL7 L;  2KHO A;  4JN4 A;  3HST B;  5IT9 O;  1SQK A;  1HNW K;  1ASU A;  1NM1 A;  1J53 A;  5BRF A;  2YX6 A;  5BN9 A;  3OJU A;  3F5T A;  2KFZ A;  3AGR A;  4G1Q A;  2P9N A;  5BRH A;  4YDU A;  1Q82 O;  3H08 A;  2IVO A;  1Y64 A;  4PL7 A;  4AH9 A;  2YJE A;  1K6Y A;  4ID5 A;  4DV0 K;  4OX9 K;  3OYN A;  4RWT A;  4KH5 A;  3DXK B;  3THX A;  4KHW A;  2GUP A;  4OGE A;  4DKW A;  1SS6 A;  3ZEU B;  3VGK A;  1SUQ A;  4NO7 A;  4CW7 B;  5KPR A;  4FM1 A;  4M3R A;  3P39 A;  5M1F A;  4H0T B;  1CZB A;  5AQI A;  3LPU A;  3CER A;  1IH7 A;  4BRI A;  5HRS A;  2QA4 N;  5KTQ A;  4Z4E A;  1ZBH A;  3I55 N;  4FW2 A;  3D6R A;  3LM9 A;  4CGI A;  3CJ9 A;  3A5N C;  2Q0U A;  4BRQ A;  4LF8 K;  3L2W A;  3KKS A;  3WNH A;  4DFP A;  4CGJ A;  4B1W B;  4CBW A;  3HP6 A;  4IXC A;  1RT5 A;  1WBD A;  1OVY A;  4ISG A;  4E19 A;  4OKJ A;  1QSL A;  4FJL A;  3KIO A;  3WNG A;  1CXU A;  4CEA A;  1NKB A;  2I7P A;  2F7T A;  3HPO A;  3OY9 A;  2XRI A;  2ZD1 A;  2NRR A;  4R5P A;  1RDC A;  4LF7 K;  3BY5 A;  5DM6 L;  3WUH A;  3NH1 A;  5AQT A;  2UUC K;  4FM2 A;  3SPY A;  2Q2R A;  3H46 O;  2UU9 K;  2KZZ A;  1YTA A;  2OCE A;  3MXM A;  2QWP A;  3R3L A;  3QFP A;  2HHU A;  1CZA N;  4RW4 A;  1GLE G;  1RBU A;  1RBV A;  5M1P A;  2E6L A;  4CJ7 A;  4BR5 A;  2F96 A;  4FPA A;  2OA8 A;  3C65 A;  1RBR A;  3R8E A;  4PA1 A;  2QXF A;  4OKK A;  4JI0 K;  1EXQ A;  1RTJ A;  2FBX A;  1GLF O;  4CJV A;  4Z4G A;  5AQN A;  2Z1H A;  3CQY A;  3FZL A;  3W3D A;  2W41 A;  4B3O A;  4PKI A;  3AO4 A;  4I6M A;  1NK9 A;  4CD3 A;  1E4F T;  3FLC O;  4ILG B;  5GAG P;  1HJR A;  1RTI A;  2RF2 A;  3NF6 A;  1ASW A;  4BE1 A;  1OH7 A;  3D2E B;  4DR2 K;  3QEX A;  2P9N B;  4ZTF A;  3O9T A;  1VSK A;  5EU7 A;  5LMU K;  3VN5 A;  1NK4 A;  1BIS A;  1ATN A;  1XC9 A;  1BWF O;  2Z1I A;  4CK3 A;  4O44 A;  2JGU A;  4PY5 A;  4DQI A;  3K59 A;  4CHN A;  3NH0 A;  4JKA A;  3OYA A;  2Q0R A;  4WQ5 A;  4MDA A;  4M3Y A;  4NYN A;  3VA3 A;  2D0P A;  4JKG B;  1QQO A;  3SCX A;  3HXM A;  3AO1 A;  2X6N A;  4PWD A;  3ASM A;  4IO8 A;  3OJS A;  3DAW A;  1YHQ N;  5LL6 Z;  1GLD G;  4K25 A;  3ZX2 A;  3AVB A;  3T1A A;  3FZM A;  1QQM A;  1SL0 A;  2AJQ A;  3VQP A;  3LDP A;  3A5O C;  4AM7 A;  3J80 O;  1YT3 A;  1DKG D;  3WXI A;  4NLC A;  3T3F A;  3N4P A;  1P90 A;  1U45 A;  4CFC A;  3SJJ A;  3NF9 A;  1B9D A;  3DJC A;  1NK0 A;  4H0O A;  3D2F B;  3MWP A;  1VQP N;  1KVA A;  3EO3 A;  3VF4 A;  2O8D A;  1S1T A;  4RW6 A;  4MLH A;  4BQL A;  4W5R A;  2VG6 A;  3ZT0 A;  3H6E A;  3S3O A;  3VQ9 A;  4DV3 K;  1U04 A;  4AHR A;  1BUP A;  3MN9 A;  5HRR A;  5KI6 A;  2G8H A;  3BF3 A;  2O8D B;  2V51 B;  3WEE B;  1NGB A;  3Q7B A;  2FBY A;  2RKI A;  3TAF A;  3MN6 A;  4JI7 K;  1RT7 A;  3VEN A;  3LZJ A;  4RCH A;  4I9Q A;  3SAH A;  3SUN A;  1VQL N;  3PO5 A;  4B9M A;  4JI3 K;  1JCG A;  1JLQ A;  1BL3 A;  1TV6 A;  3EKS A;  4FJ5 A;  2A3Z A;  3OYH A;  5GAE P;  2A5X A;  4H8K A;  3CHW A;  3QLH A;  2ZF5 O;  2F9W A;  4LH4 A;  1ASV A;  4X66 K;  1NGH A;  3BEX A;  4CEQ A;  1RDB A;  1GOA A;  5AQH A;  5HBM A;  4FJ8 A;  4JS5 A;  4CGD A;  2G8W A;  5BRD A;  4DSF A;  4F8R A;  5AQM A;  4OPH A;  1LCU A;  2AA4 A;  4J2A A;  2GEL A;  1T03 A;  3E9P A;  3V1Q A;  1WNS A;  4FM0 A;  2W42 A;  4AHV A;  3LDL A;  4DTM A;  1JJ2 M;  3C6A A;  4FK2 A;  3BUZ B;  3L8B A;  1QVF M;  4NXM K;  3EL2 A;  5C24 A;  4DTP A;  1WAF A;  2NRV A;  2VYP A;  4R79 A;  4ELV A;  3FE1 A;  3ZSX A;  1NK5 A;  1SL1 A;  2YV0 X;  3TAE A;  1TKD A;  4F9O A;  4C23 A;  4BRH A;  3CET A;  2JLE A;  3OYL A;  5SZT A;  3MEE A;  1VQK N;  1IV0 A;  3SLC A;  4FL9 A;  4E7L A;  4DMN A;  4CFB A;  3QIO A;  2CGL A;  3LAK A;  5C2F A;  1XHZ A;  3CJC A;  2VWB A;  4W5Q A;  4LD0 A;  4JKD A;  3KTQ A;  4KRE A;  1K9M O;  4YOU A;  1XC3 A;  3NBP A;  2VG5 A;  4H0X B;  4JI1 K;  3AVG A;  5C10 A;  3SZ2 A;  3CC4 N;  1Z6R A;  1VRU A;  3WNF A;  2QKB A;  3KD5 E;  4OGC A;  4PHT X;  1EWR A;  4CIF A;  1YUW A;  3QIN A;  5H1S Q;  2QEX N;  4FO0 A;  4BE0 A;  1JCF A;  4C8L A;  2E5L K;  3U8X A;  4OPK A;  5AQO A;  2O4I A;  5AQX A;  3H1Q A;  3WXK A;  4FWR A;  2Y1J A;  4YOR A;  1QSS A;  4CGF A;  5AQS A;  3RMC A;  3DRP A;  3RMD A;  3VF6 A;  1NKC A;  2CGK A;  4GV9 A;  2YHW A;  4YOX A;  1M1K O;  4Z0U A;  1ZBU A;  2IAJ A;  4CJL A;  4KH6 A;  1FW6 A;  3IMX A;  2NRW A;  3ENH A;  1VAZ A;  2P5G A;  2B6A A;  2W6K A;  4CJW A;  4A5A A;  2DFE A;  1BOT O;  3CCE N;  2VCP A;  4B9U A;  5JS1 A;  3ISN C;  4LF9 K;  4KRF A;  4C1N K;  4H5R A;  3ZX3 A;  4E89 A;  5F1X A;  4AHS A;  1BQM A;  3PV8 A;  4J2B A;  1NWK A;  5I3U A;  4KAZ A;  4F2R A;  1XHX A;  1RTH A;  2EX3 A;  1CZ9 A;  4MFB A;  4FYD A;  4CIG A;  3VQQ A;  4JD2 B;  1RBS A;  4FJJ A;  1XNQ K;  1S1U A;  3AVN A;  4JI2 K;  1N32 K;  1NOY A;  3RWU A;  3U9Z A;  4H0P A;  4CZL A;  1T8E A;  3HK2 A;  5DM7 L;  3CF5 L;  4JD2 A;  3CJA A;  1BIZ A;  1SKR A;  4DSK A;  3D2E A;  3V9X A;  1WSJ A;  2O8B B;  2E2O A;  3QIP A;  2O8C B;  4C8M A;  4KHP K;  3HT3 A;  4CD1 A;  1HUX A;  2WTU A;  5GIP A;  3L2Q A;  1RTD A;  1YVU A;  5FRM A;  1D5A A;  4E1N A;  3QBX A;  4W5T A;  3OTO K;  3SUO A;  1SZ2 A;  2JWL A;  3TSU A;  2D4W A;  3BP8 A;  4B1Z A;  3HPH A;  3PSI A;  3PO4 A;  1XQS C;  4IG0 A;  1KC8 O;  4J2E A;  5KGX A;  3E9L A;  3V9U A;  2OAN A;  2VQF K;  1RT3 A;  3DOL A;  1IG8 A;  4CFD A;  4WF9 L;  4O0J A;  4CF1 A;  1TKT A;  5F0X A;  4DV1 K;  2HST A;  4H4O A;  4A59 A;  3RTV A;  2PAV A;  1G99 A;  3IS9 A;  3HJF A;  1RFQ A;  1GLA G;  3L0Q A;  3DRR A;  3HTV A;  3AO2 A;  3VEY A;  4XIU A;  1BHL A;  4CIE A;  3V4I A;  1VQ6 N;  3AY9 A;  1WSI A;  3EZ5 A;  2KLA A;  3CCQ N;  3B6P A;  1J5O A;  1HYV A;  4MDB A;  1NJW A;  3DXM A;  1ZC6 A;  2EWS A;  1L3T A;  1BO5 O;  1TYQ A;  4I9L A;  2AP1 A;  1W0H A;  1ZBI A;  5TKY A;  4IOA L;  3OW2 M;  4BGA A;  5J2M A;  1ESV A;  3EE8 A;  1HNZ K;  3AVF A;  2D5R A;  3FR0 A;  3VQE A;  4DV6 K;  2Z1J A;  2WBN A;  3OVN A;  4IFY A;  1H1V A;  3AVK A;  3KWG A;  2IOC A;  4YFU A;  1KTQ A;  1U47 A;  1QVG M;  4KTZ A;  1IBL K;  1X3M A;  1Z05 A;  3QBW A;  2YNF A;  4FWP A;  3SJH A;  3SQ1 A;  2QWN A;  4QOZ B;  3AAQ A;  1S22 A;  1BA0 A;  4IJN A;  2FF6 A;  1RDW X;  2RPI A;  4M42 A;  1JKH A;  4GMJ B;  1X1P A;  3H1V X;  4BRL A;  2I7N A;  3RVC A;  3MMV A;  5JIC A;  5I42 A;  2HHH K;  3I8D A;  4B9N A;  4AHC A;  3LDO A;  2ZJQ L;  4BWJ A;  1I3A A;  4CED A;  1W97 L;  3VQC A;  3CCU N;  2XY6 A;  5M1Q A;  3A0I X;  1RT1 A;  1UA1 A;  3VES A;  1HPM A;  2Z1G A;  4BE2 A;  2NZT A;  2D0B A;  4LFA K;  4M3Z A;  4RW7 A;  1U6Z A;  5KRS A;  3KJV A;  1K73 O;  5AFU A;  2KZM A;  1WAJ A;  1VK0 A;  1GLC G;  1RT4 A;  1A5W A;  3T19 A;  4OLB A;  3DRS A;  5AJ3 K;  2FBT A;  1HYZ A;  3NVM A;  2FBV A;  3CM5 A;  3OHR A;  1RT6 A;  2UXB K;  2VGM A;  1IKW A;  3MEG A;  3NGY A;  4YY3 K;  4Z4C A;  3TU5 A;  3KK2 A;  2ASP A;  4H03 B;  3PSF A;  5J1E A;  2PYL A;  1NJX A;  1S72 N;  1QHT A;  1HR0 K;  3NHG A;  3MXI A;  2GEM A;  1LWF A;  1Z25 A;  2HBL A;  4H5W A;  1LW0 A;  5C0Y A;  5LMN K;  4DTU A;  1VQ8 N;  1D9F A;  4BRO A; 
#chains in the Genus database with same CATH homology
 3K59 A;  3K5N A;  4CHN A;  3SI6 A;  1C1C A;  4DSI A;  1T05 A;  3SPZ A;  4QAG A;  3NH0 A;  4FJ7 A;  3OYA A;  2I5J A;  4LH5 A;  4FVM A;  4CER A;  3K5M A;  1JLF A;  3ZSV A;  4M3Y A;  4NYN A;  1ZBL A;  3VA3 A;  4HCB A;  4F3O A;  3HL8 A;  4AHT A;  3SCX A;  4ZHR A;  3HXM A;  5HRO A;  1L3U A;  3AO1 A;  2X6N A;  5FRO A;  3AA5 X;  3VQB A;  4PWD A;  3ASM A;  2R7Y A;  1TAQ A;  1WN7 A;  3OJS A;  3UIQ A;  3L2V A;  4ICL A;  1Q9Y A;  1KCF A;  4KHN A;  2DFF A;  4CEC A;  1VSM A;  2RN2 A;  1TKZ A;  3AVB A;  1VRT A;  3T1A A;  4E0D A;  5KRT A;  1QTM A;  2HHS A;  2XY8 A;  4NCG A;  5SWM A;  1FKO A;  3KLH A;  4M3Z A;  1SL0 A;  4FLX A;  3VQP A;  2AJQ A;  3C6U A;  4CK1 A;  3DOK A;  1U4B A;  4FXD A;  4DQP A;  1YT3 A;  4EP5 A;  4DFM A;  2ZQB A;  4ZTJ A;  1U45 A;  1FKP A;  2HB5 A;  3NFA A;  3T3F A;  4CJ4 A;  4CFC A;  3OYB A;  3SJJ A;  5C25 A;  3NF9 A;  4B9S A;  1B9D A;  1LW2 A;  1T7P A;  4CJS A;  2OPP A;  3AV9 A;  1NJZ A;  1NK0 A;  3AVH A;  2YKN A;  3TAQ A;  2Q3S A;  3NGZ A;  4Z4H A;  1KVA A;  1ZYQ A;  2YNH A;  3VQ6 A;  4CF2 A;  4FK4 A;  1S1T A;  4RW6 A;  3U3G A;  3RR8 A;  4CF9 A;  4N47 A;  4W5R A;  3S3O A;  2VG6 A;  1A5V A;  1BI4 A;  3ZT0 A;  3ZSZ A;  3QET A;  3VQ9 A;  3OYC A;  4DLE A;  1U04 A;  3EYZ A;  3ZT2 A;  4AHR A;  1YTU A;  5HRR A;  1NKE A;  1L3S A;  5KI6 A;  2G8H A;  2ETJ A;  1JLA A;  3LP0 A;  3MEC A;  4FJK A;  2FC0 A;  2FBY A;  2RKI A;  4I2Q A;  4CES A;  1S6Q A;  3TAF A;  1RT7 A;  2OYQ A;  3AVA A;  3LZJ A;  3PX0 A;  4KKO A;  1RBT A;  3ZSR A;  2B4J A;  4I9Q A;  3K58 A;  3SUN A;  1IG9 A;  2XY7 A;  3PO5 A;  1BCM A;  3QNN A;  4HUG A;  4B9M A;  5K14 A;  4EZ9 A;  3KLI A;  5CYM A;  4PUO A;  3OS0 A;  1JLQ A;  1BL3 A;  2WON A;  1TV6 A;  4FJ5 A;  3O3G A;  3OYH A;  1HNI A;  5CY4 A;  4DF8 A;  1UOC A;  4H8K A;  3DLR A;  4Q5V A;  4KHU A;  3QLH A;  4EZ6 A;  1KVB A;  3AVJ A;  4DTR A;  4CJT A;  4LH4 A;  3TAB A;  1ASV A;  4FW1 A;  3C94 A;  3VA0 A;  3BDP A;  4CEQ A;  1RDB A;  1GOA A;  3D45 A;  3TI0 A;  3HYF A;  4KHQ A;  5HBM A;  4M3W A;  4FJ8 A;  4JS5 A;  4CGD A;  1UWB A;  4B8A B;  3DM2 A;  1C0T A;  1UAX A;  2HHV A;  3A2F A;  1HNV A;  3NE6 A;  2G8W A;  2KW4 A;  4CJU A;  3NCI A;  4DSF A;  4B9V A;  3RR7 A;  4DSL A;  4F8R A;  1JLE A;  1RDA A;  4DLG A;  3PUF A;  4J2A A;  3JYT A;  2A1S A;  3IRX A;  4DTX A;  1T03 A;  4CCH A;  1KFS A;  4KB0 A;  3C6T A;  4DS5 A;  2F8S A;  3V1Q A;  1WNS A;  1I39 A;  2HVH A;  3QEP A;  4FM0 A;  2W42 A;  4AHV A;  1N5Y A;  1TK5 A;  4C8O A;  4DTM A;  1S9G A;  4IFV A;  4DFK A;  1BQN A;  1N6Q A;  3QEI A;  4F4K A;  2X6S A;  4CJR A;  1IKX A;  4Y1D A;  1D8Y A;  1VSJ A;  4GW6 A;  4DS4 A;  4DU1 A;  3LP3 A;  4B08 A;  4FK2 A;  3L8B A;  2DY4 A;  2A1R A;  3ULD A;  4CJ3 A;  1S9E A;  5C24 A;  1ITG A;  1WAF A;  4DTP A;  1XI1 A;  4KTQ A;  1WSE A;  3AVL A;  3V9W A;  3EY1 A;  1W9H A;  3RRG A;  5E41 A;  4ELV A;  1TVR A;  1X9W A;  3ZSX A;  1A5X A;  2D0A A;  4O0I A;  3OYF A;  1NK5 A;  1SL1 A;  3P1G A;  4M3X A;  1DLO A;  4QCL A;  1EX4 A;  4RG8 A;  2HMI A;  2YV0 X;  3TAE A;  1KFD A;  4M3U A;  1TKD A;  5FRN A;  3L2R A;  2QK9 A;  4AHU A;  1EET A;  4DTO A;  2Y1I A;  1FXX A;  1WSF A;  3AA3 A;  3ZT3 A;  2JLE A;  3OYL A;  5SZT A;  3I0S A;  1JLC A;  3CG7 A;  3MEE A;  4DG1 A;  3KD1 E;  4CJE A;  3DI6 A;  4CJQ A;  3G0Z A;  4H4M A;  4KFB A;  5HP1 A;  4HUE A;  3MED A;  4BWM A;  4E7L A;  4FJN A;  3B6O A;  1TGO A;  3OYD A;  3C95 A;  2HHX A;  4DMN A;  3QER A;  4CFB A;  3QIO A;  3LAK A;  5DK5 A;  4LY7 A;  1XHZ A;  1LV5 A;  1VSD A;  2QKK A;  4Z4I A;  3SQ4 A;  2IC3 A;  3NF8 A;  2E4L A;  1JLG A;  4IG3 A;  4W5Q A;  3OYK A;  1WSG A;  4C8N A;  4LD0 A;  3JSM A;  1L3V A;  1FK9 A;  4WE1 A;  1JXE A;  3E01 A;  3ZCM A;  1TK0 A;  3KTQ A;  4CGG A;  5D3G A;  4KRE A;  4W5N A;  5FDL A;  3NBP A;  3LP2 A;  2VG5 A;  5T7B A;  4FCY A;  4DFP A;  3K2P A;  3AVG A;  3K57 A;  4DFJ A;  1U49 A;  3OYJ A;  2YNI A;  2PZS A;  1NK6 A;  4I2P A;  3SZ2 A;  4FK0 A;  1VRU A;  3FFI A;  3WNF A;  4CEB A;  3U6F A;  4JRP A;  3TAN A;  4Q0B A;  1TAU A;  2QKB A;  3KD5 E;  3HO1 A;  2ITG A;  4OGC A;  4CIF A;  2EHG A;  2G8K A;  3DMJ A;  4CF8 A;  3SNN A;  1HMV A;  4DF4 A;  1B92 A;  3QIN A;  4IKF A;  2P1J A;  1NJY A;  4E7J A;  2O4G A;  4BE0 A;  3KLG A;  3ZT1 A;  4C8L A;  1F21 A;  5HRP A;  4OPK A;  3LWL A;  1RT2 A;  3SV3 A;  4NCB A;  1LAW A;  2O4I A;  4E1M A;  1ZBF A;  4CEF A;  2IGI A;  3ZT4 A;  2BDP A;  4C8K A;  2Y1J A;  2VG7 A;  4I7F A;  4CGF A;  1QSS A;  4LSN A;  1BIU A;  3DRP A;  3RMC A;  4B9L A;  1WLJ A;  3RMD A;  4CJ5 A;  3LPT A;  1WSH A;  3TWH A;  3S3N A;  4N76 A;  1Y97 A;  3SYZ A;  1SKS A;  1NKC A;  1D9D A;  4Z0U A;  1ZBU A;  2IAJ A;  4CJL A;  3HM9 A;  1SV5 A;  2VWJ A;  3M8R A;  2XO7 A;  3CFO A;  1SKW A;  2PYJ A;  2OZM A;  3F9K A;  3PY8 A;  1Q8I A;  3DLK A;  2P5G A;  1RCH A;  1EP4 A;  3LAM A;  3MAQ A;  2B6A A;  1SL2 A;  4CJW A;  1XWL A;  2XHB A;  4HHT A;  1IO2 A;  1QSY A;  2DFE A;  4FLT A;  1JL2 A;  2BE2 A;  4FLV A;  4HVJ A;  4JRQ A;  1NK7 A;  4B9U A;  5JS1 A;  4N41 A;  2F8T A;  3PX4 A;  3ISN C;  3LAN A;  4CGJ A;  3LDS A;  3D0P A;  3P83 D;  3RRH A;  1TK8 A;  3O3H A;  3ZSO A;  4K8Z A;  4CHP A;  4KRF A;  4KHS A;  4E89 A;  3NDK A;  4N56 A;  3PX6 A;  2BAN A;  4AHS A;  2P5O A;  1BQM A;  1G15 A;  4B9T A;  1HRH A;  3PV8 A;  4J2B A;  1C1B A;  3TAG A;  1JLB A;  5I3U A;  1J9A A;  1C6V A;  3LAL A;  3F73 A;  5J2P A;  4CEO A;  4KAZ A;  4F2R A;  1VSF A;  1XHX A;  2XY5 A;  4CEZ A;  5J2N A;  4KI4 A;  1RTH A;  2EX3 A;  1CZ9 A;  4MFB A;  4F2S A;  4FYD A;  4M41 A;  1TL1 A;  4OJR A;  4CIG A;  4M3T A;  2YHB A;  3VQQ A;  4YNQ A;  1KSP A;  3AVI A;  3LZI A;  2OPS A;  1RBS A;  4FJJ A;  3ITH A;  3HVR A;  1S1U A;  2OZS A;  3AVN A;  1QE1 A;  4KPY A;  1LAV A;  1NOY A;  3RWU A;  4N5S A;  4FLU A;  1T8E A;  3HK2 A;  3V9S A;  4CF0 A;  1DTQ A;  3O3F A;  2HHW A;  1S5J A;  3VQD A;  3VQA A;  4DWI A;  3V81 A;  1BIZ A;  3I0R A;  4CHQ A;  4DU4 A;  1SKR A;  3DLG A;  4DSK A;  3V9X A;  1WSJ A;  2HHT A;  3P5J A;  3VQ4 A;  3M8Q A;  3DLE A;  3QIP A;  3OYM A;  4Y1C A;  4B8C A;  4PQU A;  4C8M A;  4UQG A;  3V1O A;  1HPZ A;  3AVM A;  3HT3 A;  4OKE A;  3ZSY A;  3K5O A;  4E7K A;  4KHY A;  3L2Q A;  1RTD A;  2ATQ A;  1YVU A;  2NUB A;  3MXJ A;  4E7H A;  3V1R A;  1GOB A;  3NH2 A;  4DTS A;  1S1V A;  3V6D A;  4Z4F A;  3SUP A;  3QES A;  2DTU A;  5FRM A;  3LP1 A;  1D5A A;  3HP9 A;  4E1N A;  4HUF A;  4JLH A;  4ELT A;  4W5T A;  4HCC A;  3SUO A;  4AIL C;  1REV A;  4CHZ A;  3M8S A;  4BDZ A;  1C0M A;  5CZ2 A;  4BDY A;  5HLF A;  1GOC A;  2DFH A;  1KLN A;  3HPH A;  4DTJ A;  1MU2 A;  3PO4 A;  4IG0 A;  4OPJ A;  4BAC A;  2G8U A;  4J2E A;  1QQC A;  1TL3 A;  3ZSW A;  5KGX A;  3V9U A;  4J2D A;  4OLA A;  3TAP A;  2YKM A;  1RT3 A;  1QS4 A;  1IKY A;  3DOL A;  1Q9X A;  4DQR A;  5CZ1 A;  4FLW A;  4CFD A;  1B9F A;  1VSH A;  3HST B;  3KKR A;  5J2Q A;  4O0J A;  3S9H A;  4CF1 A;  1TKT A;  4FLZ A;  1ASU A;  3L2U A;  4H4O A;  1C1A A;  1S1W A;  4FJX A;  3CQ8 A;  1J53 A;  3RMA A;  3RTV A;  5HRN A;  3OJU A;  4ID1 A;  1VSL A;  3IS9 A;  1NK8 A;  3HJF A;  2KFZ A;  2KQ2 A;  4G1Q A;  4KO0 A;  3TAR A;  4FZY A;  3H08 A;  3DRR A;  4AH9 A;  3AO2 A;  4E3S A;  1K6Y A;  4ID5 A;  4XIU A;  5DMR A;  1BHL A;  4RW9 A;  3OYN A;  4CIE A;  3SUQ A;  3V4I A;  4KHW A;  1WSI A;  3EZ5 A;  4OGE A;  3B6P A;  3L3U A;  4DSJ A;  3VQ5 A;  2KFN A;  1J5O A;  2IS3 A;  1HYV A;  3O4N A;  5C42 A;  3OYG A;  3THV A;  1SUQ A;  4BDP A;  3WNE A;  4DTN A;  3QEV A;  1LWE A;  4M45 A;  4M3R A;  1RNH A;  4FM1 A;  3QNO A;  1NJW A;  3RMB A;  2HND A;  1R0A A;  3LWM A;  4FJG A;  4NCA A;  4CJP A;  1L3T A;  4I9L A;  4DQQ A;  1CZB A;  3KK1 A;  1W0H A;  3AA2 A;  2B5J A;  3LPU A;  1IH7 A;  1JL1 A;  5HRS A;  3OS1 A;  3OYI A;  4CK2 A;  1ZBI A;  3KLE A;  2BGG A;  4LSL A;  1CLQ A;  5KTQ A;  4Z4E A;  3QEW A;  3TAM A;  1ZBH A;  3OS2 A;  4FW2 A;  3DLH A;  5J2M A;  4CEE A;  1S6P A;  4KTW A;  4CGI A;  4CJF A;  3OYE A;  3CYM A;  4KV8 A;  2HHQ A;  1KLM A;  3AO5 A;  3AVF A;  1J54 A;  4IBN A;  3L2W A;  2D5R A;  3VQE A;  3KKS A;  3NGI A;  3WNH A;  2Z1J A;  2P51 A;  1BGX T;  2X74 A;  4RW8 A;  3OVN A;  5CYQ A;  1S1X A;  4IFY A;  4MQ3 A;  3VQ7 A;  3HPG A;  3HP6 A;  3S3M A;  4TSX A;  1RT5 A;  3SQ2 A;  3AVK A;  2G8V A;  4HTU A;  3QO9 A;  3VQ8 A;  2IOC A;  4E19 A;  4OKJ A;  1QSL A;  4FJL A;  3CFP A;  1X9M A;  4YFU A;  1KTQ A;  3KIO A;  3WNG A;  2HNY A;  4KTZ A;  1U47 A;  2G8I A;  1CXU A;  4CEA A;  2YNF A;  1NKB A;  4OVL A;  1KVC A;  3HPO A;  3SQ1 A;  4QOZ B;  3OY9 A;  1UA0 A;  4IDK A;  2XRI A;  2ZD1 A;  4CFA A;  4CHO A;  4FJH A;  1VSI A;  3ZSQ A;  4R5P A;  1BI4 B;  1RDC A;  3IAY A;  3DLB A;  2WOM A;  4FZZ A;  1TKX A;  4CGH A;  4KB1 A;  2RPI A;  2HW3 A;  3NH1 A;  4M42 A;  1EKE A;  1JKH A;  2GBZ A;  4GMJ B;  3K5L A;  1X1P A;  4O5B A;  4FM2 A;  3SPY A;  3IG1 A;  4FJI A;  2KZZ A;  1YTA A;  2GUI A;  5I42 A;  3CM6 A;  3L3V A;  3CFR A;  3I8D A;  2G8F A;  4B9N A;  3MXM A;  3KLF A;  4AHC A;  4ELU A;  4BWJ A;  4W5O A;  1I3A A;  4FLY A;  4GVM A;  4CED A;  2LSN A;  3O4Q A;  3VQC A;  2XY6 A;  4RW4 A;  4FJM A;  1NOZ A;  1BCO A;  3SQ0 A;  1RT1 A;  1RBU A;  1UA1 A;  2HHU A;  1RBV A;  2E6L A;  3DYA A;  5KGW A;  2Z1G A;  4BE2 A;  2D0B A;  1DTT A;  1O1W A;  3NF7 A;  2F96 A;  3HVT A;  3NAE A;  4NYF A;  3SV4 A;  2X78 A;  4RW7 A;  2OA8 A;  1RIL A;  1RBR A;  4PA1 A;  5KRS A;  2QXF A;  4DSE A;  4OKK A;  3KJV A;  4KI6 A;  4O55 A;  2VWK A;  1EXQ A;  2KZM A;  1WAJ A;  1RTJ A;  1VK0 A;  3V9Z A;  2FBX A;  1LWC A;  1RT4 A;  2E6M A;  4EP4 A;  1A5W A;  2OPR A;  4CJV A;  4Z4G A;  3M8P A;  3T19 A;  2D0C A;  4OLB A;  2Z1H A;  3DRS A;  4CE9 A;  4B3O A;  2PY5 A;  2FBT A;  1HYZ A;  1RDD A;  3AO4 A;  1NK9 A;  4K8X A;  2HNZ A;  2IDO A;  5JS2 A;  1U48 A;  2ZE2 A;  4CHY A;  2FBV A;  4DQS A;  3U3Y A;  3CM5 A;  4FJ9 A;  1RT6 A;  3AVC A;  1IKW A;  3MEG A;  3NGY A;  3AO3 A;  1HJR A;  1RTI A;  2RF2 A;  3NF6 A;  1ASW A;  4Z4C A;  4CJK A;  3BGR A;  1HQE A;  1IKV A;  3KK3 A;  4JS4 A;  4BE1 A;  2YNG A;  3KK2 A;  1KRP A;  3ALY A;  4FZX C;  1C0U A;  3AA4 A;  2YHA A;  5J1E A;  4E7I A;  3QEX A;  2PYL A;  4L8R B;  4ZTF A;  1NJX A;  5EU7 A;  1VSK A;  2HVI A;  1HQU A;  4DU3 A;  3VN5 A;  1QHT A;  1NK4 A;  1BIS A;  4O4G A;  1D9F A;  3NHG A;  4F3T A;  2KTQ A;  1XC9 A;  3MXI A;  1Z26 A;  1LWF A;  2GV9 A;  2OPQ A;  2Z1I A;  1X9S A;  1Z25 A;  4CK3 A;  4O44 A;  1L5U A;  1LW0 A;  1CXQ A;  1JXB A;  1VSE A;  2JGU A;  3TR8 A;  4DTU A;  4PY5 A;  3G10 A;  4DQI A;  1HYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...