1RCHA

Solution nmr structure of ribonuclease hi from escherichia coli, 8 structures
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Ribonuclease Hi from Escherichia Coli
pubmed rcsb
molecule tags Endonuclease
molecule keywords RIBONUCLEASE HI
total genus 35
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1995-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rchA00
2P5OA 1VSEA 2KZMA 1BHLA 1REVA 1EETA 4J2DA 4HUGA 2AJQA 3D45A 4C8KA 3G10A 4B9SA 3DLHA 3S9HA 1TK8A 1WLJA 1Z26A 1CXQA 4F2SA 3O3HA 3TAQA 4FK0A 4DLGA 3MXIA 5D3GA 3LP0A 4CEQA 1HRHA 2P51A 3OYCA 4DU4A 1NK6A 4N56A 1TKDA 3AVMA 5J2MA 1WSGA 1SKSA 2NUBA 3VQCA 2KFZA 3AVKA 4CEZA 3NE6A 5HBMA 4KFBA 1GOBA 3WNHA 1NK7A 3OYLA 4LSLA 2PYLA 3UIQA 1FK9A 1EXQA 3KLGA 4E7LA 1Q8IA 1LAWA 1X9SA 1LV5A 3M8SA 1SL0A 1N5YA 3IAYA 4KB1A 1RDCA 1TKZA 4DLEA 1TAUA 3KD5E 2GUIA 3ZSYA 4AHCA 3RWUA 2A1RA 1JXEA 4IG0A 3PO5A 4IFYA 2PYJA 1ASWA 3HSTB 1JLEA 3OYMA 3KD1E 4I9QA 1LWEA 2RF2A 3KLFA 4N41A 1B9FA 1YTAA 4CGJA 1L3UA 1LWCA 1VSLA 1JLAA 1VSMA 1HMVA 1RTIA 2B6AA 3QEVA 1S5JA 2EX3A 4RW4A 1BI4A 3EY1A 2VWKA 2X6NA 3VQ5A 4M3XA 2DFFA 4J2EA 4BDPA 2XO7A 3L2QA 3HL8A 3OJSA 3V6DA 2QK9A 2YNGA 1WAFA 4E1MA 2G8HA 1GOAA 3VQ4A 2OPPA 5HRRA 1J53A 2ZD1A 3NH0A 4DTNA 2G8UA 1ZBIA 3L3UA 3MEGA 3LWMA 4FW2A 2F96A 3CYMA 1SUQA 1LW2A 4O0JA 1KVAA 3PX6A 2YNFA 1C0UA 2F8TA 4DSKA 3AVGA 3V1OA 3AA5X 3QO9A 3KIOA 4CIGA 4CJRA 3PX0A 1IKVA 3SYZA 2YKMA 3WNFA 3ALYA 1JL2A 1HQUA 2F8SA 2Z1IA 4W5NA 3RMCA 4DG1A 3K58A 3TABA 3VQAA 3RMDA 1X9MA 1TGOA 4M3RA 5CZ2A 4XIUA 1XHXA 3F9KA 2OZMA 1G15A 4KHSA 2HB5A 1BGXT 1C1AA 4IDKA 3ITHA 2FBXA 1GOCA 4RW7A 4DS5A 4DTOA 4BACA 3TWHA 1B92A 1J9AA 1JL1A 1RBSA 3LAKA 3K2PA 4CGFA 3U3YA 1RTDA 1QTMA 4ID1A 5CY4A 3M8QA 4E3SA 2OPRA 1YTUA 4CJVA 4B9UA 4HCBA 4OPJA 3RMAA 4PUOA 4MQ3A 4DTMA 4DWIA 4CGIA 2JGUA 3HJFA 4CGGA 2PZSA 3QETA 4FJIA 3HK2A 1WSJA 1BISA 3DMJA 4ZTFA 1U49A 1Q9YA 3V4IA 4AHSA 3ZSZA 4EP5A 3QESA 3ULDA 2A1SA 3LANA 1JLQA 3LP2A 4CHQA 1S1XA 3DLGA 4ICLA 4CERA 4CF2A 3ZT4A 2Y1IA 4KI4A 4IFVA 3K59A 1W9HA 5KTQA 4FJHA 4KREA 4N76A 4KI6A 2BE2A 4Y1CA 1WSFA 1JLBA 1ASUA 3DI6A 3V9SA 3VQ7A 3O3GA 1N6QA 5C42A 4B8AB 3AO5A 4H4MA 5J2NA 4NYNA 4E7KA 4HCCA 1C0MA 3HPHA 4OVLA 4DTJA 3LP3A 3OYFA 2HW3A 4WE1A 1XC9A 5C24A 3DLEA 3PO4A 1I3AA 1TAQA 2W42A 1CXUA 1EKEA 4DQSA 4E0DA 4FJGA 2HVHA 2IAJA 4HVJA 3VN5A 3QLHA 1HYVA 4FLZA 4ZTJA 3RR7A 5FRNA 4DTXA 5HRSA 1JLCA 2FBYA 2OYQA 3V9UA 1SL1A 3NGZA 5DK5A 4CHYA 4NCGA 5JS2A 5KRTA 5CYMA 4CJWA 1U48A 1KVBA 1LWFA 1VSJA 1A5XA 1R0AA 2WOMA 3HT3A 3KLIA 2HHWA 3NH1A 1RDDA 4FLWA 1SKRA 4LD0A 4Z0UA 3QERA 4OGEA 3QNNA 1HYZA 2WONA 3TAFA 3ZSXA 4H8KA 3MXMA 4CEDA 4ZHRA 3SV3A 1X9WA 3BGRA 3I0SA 1HPZA 1L5UA 4ID5A 1BI4B 3LPUA 2RN2A 2Q3SA 4BE0A 3QNOA 4FZYA 4F2RA 3SQ2A 1KSPA 3NHGA 1QSLA 4CK1A 1RDBA 3JYTA 4HHTA 3KK1A 4W5TA 2KFNA 3K57A 3OY9A 4J2AA 4M41A 2D0BA 1UAXA 3T19A 3QEIA 1IKWA 4OKKA 5CYQA 4RW9A 1S1WA 3ZSQA 4CJTA 4DFMA 2X74A 3QEPA 4C8LA 4W5QA 3CFOA 5KGWA 1RT7A 4B9VA 1RBUA 4E7IA 3KLHA 1NOZA 4KV8A 3VQ6A 4K8ZA 5J2QA 1QHTA 4R5PA 2BGGA 4NYFA 4HUFA 4I9LA 4CF0A 3DYAA 4DSJA 4OPKA 4FJ9A 1BCOA 1JLFA 4FJKA 3VQ9A 4CFBA 1WAJA 3O4NA 4C8MA 2YNIA 3AVHA 1BCMA 3AV9A 1RT5A 2QKKA 2KTQA 3VQQA 4FLYA 4ELVA 2G8IA 2HHSA 4CFCA 4FYDA 2D5RA 4M3ZA 1RILA 4CJUA 3K5OA 3SUPA 4FJ8A 4L8RB 1CZBA 3IRXA 3P83D 3VQEA 3O3FA 1Y97A 1D9FA 1D5AA 1NJYA 3THVA 3AO1A 3DLBA 4KHNA 4FZZA 4M3TA 4W5RA 3IS9A 3NFAA 5FDLA 4CF1A 4PQUA 4KTZA 4BDYA 3AVFA 3SCXA 1RBRA 4OJRA 3VQPA 4G1QA 4B08A 3U6FA 4KHUA 1S1VA 2XY5A 4GMJB 1HQEA 3SZ2A 3PV8A 2LSNA 2JLEA 1JKHA 1IKXA 1U04A 4CF8A 3DRPA 4JS5A 3RR8A 2RKIA 1UWBA 2KZZA 3WNEA 1RT1A 5I42A 2FBTA 2OPSA 1IKYA 1BIUA 3ZT1A 3B6PA 3SUNA 3RRHA 4CJ4A 3HVRA 2YKNA 4M3WA 1LW0A 3ZSVA 1X1PA 1S1UA 4CEEA 4CJ3A 1RT2A 3NH2A 1RT4A 1Z25A 3M8RA 4PY5A 3C6UA 4Z4HA 4KAZA 3DRRA 1VRUA 1LAVA 4NCBA 4CJEA 4W5OA 1VK0A 4B9MA 4CE9A 5HROA 2I5JA 4AHRA 2P1JA 3PUFA 3AO3A 4O4GA 3ZT3A 1D9DA 2DY4A 2ZQBA 4DTRA 2G8KA 2QXFA 3OYEA 3ZSWA 4Q0BA 1IH7A 3TAPA 4FZXC 3H08A 3NGYA 5CZ1A 4CHZA 3AVIA 3AVLA 4JRQA 3NF9A 4YNQA 4FVMA 4CIFA 1C1BA 1JXBA 2VG6A 1TKXA 3KK2A 1HYSA 4JLHA 3V81A 1KVCA 3HYFA 3F73A 3NDKA 3NAEA 3C6TA 4Q5VA 4DSEA 2VG5A 1SL2A 3ZT0A 1HNIA 4CJSA 1BL3A 3QIPA 4CEOA 3OS0A 3OYAA 3AA2A 4CHPA 4M45A 1T05A 4DSIA 3B6OA 2E6MA 4FJJA 5HRNA 2DFHA 3M8PA 3OYDA 3I0RA 4GVMA 3EYZA 4IBNA 3SQ1A 3LP1A 4AHVA 4B8CA 3V9ZA 1NJZA 4O0IA 2YV0X 3V1QA 1RCHA 1A5WA 3ZSRA 2R7YA 1T7PA 1RNHA 1KTQA 1VRTA 2FBVA 4CIEA 3PY8A 1EP4A 4E89A 4AILC 4FLUA 4DFJA 1ZYQA 4Z4GA 3AVBA 4PA1A 2XY8A 3IG1A 1VSFA 3BDPA 3NBPA 1NK0A 3DLRA 1JLGA 1TVRA 3L2RA 2EHGA 1WNSA 3CM5A 3NF7A 4MFBA 3MEEA 2IGIA 4CESA 4CFAA 2ITGA 3AO4A 3TAMA 1W0HA 2HNYA 4DU3A 2P5GA 2OZSA 5KI6A 4CGDA 2HVIA 4DSLA 3LZIA 2IS3A 4CJKA 4FLXA 1VSHA 3QEXA 4HUEA 4E7JA 4CHNA 4I2QA 1S9EA 2Y1JA 2HMIA 4CEAA 3RMBA 4CECA 1IG9A 1NK5A 3HXMA 4KTWA 2HNDA 4IKFA 3S3MA 1UA1A 4CK2A 3ISNC 1QS4A 1YVUA 2XHBA 3HO1A 3ASMA 1EX4A 2G8VA 4FJMA 3KJVA 3G0ZA 4DQRA 1WN7A 4H4OA 1IO2A 2E6LA 4BDZA 1ZBLA 4I2PA 4FM0A 1HNVA 3VA0A 2XY6A 3VA3A 3JSMA 3HPOA 1NK8A 1BQNA 4CJ5A 4PWDA 4LSNA 3MECA 4FJ7A 4DTPA 4CJFA 5HLFA 4M3YA 3V1RA 4DU1A 3T3FA 4DS4A 5FROA 3LWLA 4F3OA 2O4GA 2XY7A 1D8YA 3AA3A 1A5VA 2KQ2A 4CGHA 4KHYA 1WSHA 1TL3A 2VWJA 1TL1A 3KKRA 2D0CA 2ZE2A 1RDAA 3SQ4A 3OYIA 1T8EA 1NKEA 3KKSA 3SI6A 3DRSA 1RT6A 4EZ9A 3QEWA 1FKPA 1FXXA 1QQCA 3MXJA 2BANA 4F4KA 2YNHA 4BWJA 4ELUA 4M3UA 4BE1A 4O5BA 4FLTA 4CEFA 3EZ5A 1NKCA 1C6VA 4C8NA 3L2VA 4FJ5A 3K5LA 4CJLA 5SZTA 1BIZA 2X6SA 4RG8A 1VSKA 1S6QA 4CF9A 4J2BA 1RBTA 3CG7A 4Y1DA 1I39A 1ZBUA 1CZ9A 1L3SA 2HNZA 2X78A 4DTSA 4QOZB 2HHTA 1O1WA 3AO2A 3O4QA 3OS1A 5KGXA 3OYBA 2VG7A 1QSSA 1YT3A 3LAMA 4UQGA 3TAEA 3WNGA 3TR8A 3TANA 5K14A 4K8XA 2ETJA 1FKOA 1RT3A 4FXDA 3RRGA 3K5NA 3S3NA 3OVNA 3CFPA 1U4BA 3SPYA 4DF4A 3SJJA 4Z4FA 1QE1A 4DFPA 1ASVA 3NGIA 1KFSA 3SUQA 2G8WA 3KLEA 2Z1JA 2GV9A 2GBZA 2YHAA 4GW6A 3PX4A 4NCAA 3DM2A 4CK3A 1NKBA 4CJPA 2PY5A 4C8OA 4KPYA 1XWLA 2E4LA 1S1TA 4CEBA 1QSYA 2HHQA 4TSXA 4AHUA 1KLNA 2B5JA 1RTJA 4F8RA 1TK5A 4BWMA 3C95A 1ZBFA 3QINA 5C25A 4DQQA 3OYKA 5HP1A 1XI1A 1U45A 3LDSA 3OYHA 3VQDA 3VQ8A 2Z1HA 4Z4CA 4LY7A 4BE2A 2HHXA 3S3OA 1VSDA 4FM1A 3HPGA 2DFEA 4Z4EA 1NK9A 3VQBA 3CQ8A 4CJQA 4Z4IA 1HJRA 3AVJA 3U3GA 3HP6A 5J2PA 1RTHA 5FRMA 1TV6A 2IDOA 4EP4A 1Q9XA 2OA8A 3LZJA 3T1AA 3ZSOA 3NCIA 3V9XA 2RPIA 4QAGA 1S6PA 1KRPA 1K6YA 4E1NA 1RBVA 4OGCA 3I8DA 1T03A 4OLBA 3DLKA 5T7BA 4KKOA 3CM6A 3HP9A 1NJWA 1UA0A 3HVTA 4FJLA 3TI0A 4AHTA 3MAQA 1WSEA 4OKJA 4CHOA 3DOKA 2B4JA 4ELTA 4FJXA 3AVNA 4KTQA 1WSIA 1L3VA 4B9NA 3MEDA 1ITGA 3FFIA 4CFDA 2HHUA 4IG3A 3AA4A 1VSIA 3D0PA 4KO0A 4OKEA 1BQMA 1J5OA 3SV4A 2OPQA 3CFRA 1MU2A 1F21A 2KW4A 3SPZA 4CCHA 5JS1A 4DQPA 5J1EA 2FC0A 3L3VA 4JS4A 3SUOA 3OYNA 4DQIA 4O55A 4B9TA 4KB0A 3OYGA 4LH4A 4FJNA 3E01A 5KRSA 2QKBA 1UOCA 2XRIA 2BDPA 1KFDA 2D0AA 3NF6A 4YFUA 1U47A 2G8FA 2ATQA 4KHQA 1KLMA 4FK4A 2Z1GA 1S9GA 4B9LA 3ZT2A 5E41A 2O4IA 3C94A 4N47A 3QIOA 1SV5A 1NJXA 4O44A 4HTUA 1ZBHA 4E7HA 4OLAA 2IC3A 1DTQA 4E19A 3KTQA 4KRFA 1C0TA 4M42A 1J54A 3TAGA 2HHVA 1TKTA 2DTUA 3AVCA 3L2WA 3AVAA 4DSFA 3L8BA 1L3TA 4FK2A 1SKWA 4FM2A 4F3TA 3OS2A 4B3OA 1NK4A 3ZCMA 5DMRA 4DMNA 4I7FA 1DLOA 3SQ0A 4FCYA 3P5JA 3LALA 5SWMA 3RTVA 4FLVA 5I3UA 3TARA 4DFKA 1C1CA 4FW1A 3P1GA 4RW8A 4AH9A 3SNNA 3A2FA 4EZ6A 4DTUA 5EU7A 2IOCA 2YHBA 4LH5A 4QCLA 1NOYA 1DTTA 4RW6A 4KHWA 1B9DA 3K5MA 4DF8A 1CLQA 5HRPA 3DOLA 1XHZA 3OJUA 4N5SA 1KCFA 3KK3A 3NF8A 3L2UA 3V9WA 3LPTA 1TK0A 3HM9A 3OYJA 4JRPA
chains in the Genus database with same CATH superfamily
3MX2A 2AJQA 3WQTA 4B9SA 1S72N 1OVYA 1WLJA 1Z26A 4B3MK 3FZFA 4RTFD 1CXQA 3MN9A 4DLGA 3MXIA 3FZKA 4AM6A 3RR7A 5J2MA 1WSGA 2NUBA 2KFZA 1HX1A 5AQTA 1NGDA 4MLHA 3RVCA 4A5AA 1NK7A 3OYLA 3UIQA 2O8CB 1FK9A 3KLGA 3K9JA 1X9SA 1LAWA 4KB1A 3P39A 3KD5E 3ENBA 1H1VA 3RWUA 2A1RA 3CHWA 3H6EA 4BGBA 3HSTB 3OYMA 1ATSA 5AZIA 4BC2A 4MO5A 3WXKA 4WQ5A 2E2NA 1LWCA 1QQMA 1JLAA 1GLDG 3QEVA 1NMDA 2DFFA 2HF3A 2XO7A 3L2QA 3OJSA 2QK9A 2YNGA 1GOAA 2G8UA 2ZD1A 4DTNA 2UXDK 1LW2A 4O0JA 1C0UA 4OO1J 3AVGA 3BP8A 3V1OA 1IKVA 1JCGA 3T1HK 4EFHA 1HQUA 4W5NA 3CCMN 4M3RA 2OZMA 4KHSA 2F9TA 4GKJK 3SMPA 1IV0A 4DTOA 2FBXA 1GOCA 3I8BA 2P9SA 4WQ4A 1RBSA 4BRLA 3OA9A 3K2PA 4CGFA 4ID1A 4B9UA 2PBDA 2E88A 3RMAA 5AQSA 4MQ3A 3HJFA 3VF2A 1S22A 1Q9YA 1YIJN 4EP5A 3ULDA 5JVGL 1NBWA 4KI4A 3DLGA 4CF2A 3ZT4A 2OTLN 3K59A 4KREA 4BRIA 4Y1CA 1WSFA 3DI6A 3VF6A 2AP1A 1KXPA 4IJNA 5AZJB 3LDNA 1GLLO 3AO5A 3WEEB 2P9SB 4B3SK 1YUWA 3LP3A 3OYFA 2HW3A 3CXCM 1I3AA 1CXUA 4DQSA 4E0DA 2HVHA 4HVJA 3VESA 3WEEA 4XH5A 1JLCA 2FBYA 2NRTA 2OYQA 3V9UA 5F1XA 4NCGA 5JS2A 2E1YA 3BF1A 1KVBA 4A59A 1U2VA 1VSJA 4RWTA 1R0AA 2WOMA 4BREA 3HRGA 3NH1A 2Q2RA 4LD0A 1IBKK 3TAFA 4JEPA 4UY8O 3CCEN 3W3DA 4ZHRA 3SV3A 1D4XA 5AQRA 2CGKA 3CMEN 4ID5A 2RN2A 3U4LA 3CCJN 3QNOA 5KQDA 3U8XA 3ZETB 3NHGA 5BR9A 1YJWN 3KZBA 3SBTA 3KK1A 4W5TA 3K57A 2ASPA 3T19A 5CYQA 4JI8K 4JI7K 4YDUC 3QEPA 4B9VA 3JS6A 3O80A 1NOZA 3ENOA 4EIAA 4K8ZA 4JK8A 4NYFA 4HUFA 5GINA 4DSJA 4FJ9A 5AQFA 4BG8A 4GV6A 4J8FA 3AVHA 3MDQA 3AV9A 4XH4A 4K0KK 2G8IA 5E26A 3SUPA 2FSNA 2F7TA 1IBMK 2QM1A 2HBJA 1T6CA 4KHNA 4FZZA 5AQJA 4BR0A 5F2RA 1RBRA 3VQPA 5KQ8A 3PV8A 3SZ2A 4WYBA 3CF5L 3AARA 4FVUA 3ATUA 2RKIA 3SJHA 2KZZA 1C0GA 1VQ6N 4B3RK 2FBTA 4FO0A 3SUNA 1X1PA 1YXQA 1RT4A 4DV7K 1VRUA 1LAVA 4CJEA 4DV5K 1VK0A 5BR8K 3OHRA 4H5RA 4X64K 2P1JA 4EHTA 3QB0A 1RFQA 3OYEA 2HOEA 3MMVA 4H0PA 4FZXC 2D0PA 4GV9A 5CZ1A 3ENHA 4EHUA 3NF9A 1C1BA 1TKXA 1E4GT 1HYSA 4JLHA 2ZWHA 5BRDA 3HYFA 3NAEA 1TUYA 2Q0UA 4DSEA 4A57A 1SL2A 4IOAL 1NG9A 1BL3A 4CEOA 2HHHK 3AA2A 2KKZA 1Q7YO 5CHIA 4FJJA 3M8PA 5HOOA 4B1VA 4H0VB 3D2FB 1RCHA 1A5WA 4O8KA 1QVFM 5IT9O 2FBVA 4CIEA 2RHKA 1LOTB 1N8RO 3AVBA 4JKBA 1HKGA 2IVNA 2NZTA 2O8EA 3L2RA 2EHGA 3RSEA 3VEYA 5E84A 1NMNA 4CFAA 3OYCA 2VGMA 1W0HA 4IO8A 2OZSA 3O9UA 4CJKA 4HUEA 4E7JA 4CECA 2QWPA 4CK2A 5AQWA 3WT0A 1QS4A 3CCQN 2XHBA 3G25A 4DV4K 4FJMA 3MN7A 2WBNA 3Q7BA 3O8MA 4H4OA 2E6LA 2GEMA 4FM0A 4X65K 4CJ5A 4JK7A 4CJFA 4DU1A 4DS4A 2KQ2A 2VWJA 5GADP 3KKRA 1YITN 1NKEA 4JI5K 3DRSA 1X9JA 1RT6A 2FF3B 1FKPA 3MXJA 3CI5A 4JKHA 4DV1K 3MCPA 4O5BA 4CEFA 1NKCA 1C6VA 3UE5A 1GLFO 4CJLA 2P9NA 2X6SA 3VEOA 4CF9A 4JNEA 4PKIA 1ZBUA 1NWKA 2X78A 1O1WA 5JVHL 3AO2A 3OS1A 3C65A 4JI0K 4ISFA 3TAEA 5FPDA 1RT3A 3S3NA 4B1ZA 4XEIA 4DF4A 1QE1A 2IVPA 1ASVA 3NGIA 3E9PA 3CCVN 4CJPA 2E2QA 2E4LA 4TSXA 4AHUA 1KLNA 1RTJA 4CZKA 3C95A 3N4PA 1ILYA 1QZ5A 4JV5K 4DKWA 5BPLA 4Z4CA 4BE2A 4FPBA 3IKMA 3HPGA 2DFEA 2O8DA 3VQBA 4CZHA 2GWJA 1HJRA 3OBYA 3GE1A 1ZC6A 5M1QA 1U2VB 5J2PA 4FSVA 3T1AA 4QAGA 1K6YA 1T6DA 1T03A 5T7BA 4CZMA 1KAXA 3CMAN 2ASMA 1UA0A 3HVTA 4FJLA 4AHTA 4FJXA 4OKJA 1BWFO 3G4SN 3K0SA 5GAEP 5AQXA 4B9NA 4DR2K 2HHUA 4IG3A 2VGNA 4WQ4C 3KK7A 3L0QA 1F21A 4CCHA 5JS1A 3THWA 5C15A 3THYA 4JS4A 4C23A 4O55A 4B9TA 4GKKK 3OYGA 2QWRA 5KRSA 3QICA 1KAZA 2JWKA 1VQON 2XRIA 2BDPA 1KFDA 4A2AA 2QWQA 1EWQA 1YHQN 2Z1GA 3UB5A 1S9GA 2UUCK 5E41A 4DUZK 4B9LA 2O4IA 3VEZA 3QIOA 1SV5A 4O44A 5EVZA 2W6KA 2NRRA 5BPMA 2QEXN 1J54A 1TKTA 3H1VX 1Q81O 4F3TA 1SKWA 4FM2A 3LM2A 1IG8A 4DMNA 3SQ0A 4FCYA 3P5JA 1DT9A 2IOCA 2E5LK 4H0XB 4RW6A 4KHWA 2NNWA 2UXCK 5HRPA 5JLHA 4DR5K 3H45C 3OJUA 4JK9A 4N5SA 1WBDA 3KK3A 5MLCQ 1GLEG 5DM6L 3HM9A 1TK0A 4DQRA 3LDQA 1EETA 4J2DA 3SLCA 4FWNA 3F9MA 2OCEA 2F4VK 2BUPA 3TSPA 3TAQA 1V4TA 4CEQA 2P51A 2H3GX 1HNWK 4CVNE 1SKSA 3VQCA 3AVKA 3J80O 4NO7A 3M5RA 4DR4K 2V51B 5AQKA 3NE6A 5HBMA 5AFUA 4KFBA 2QW9A 4LSLA 1EXQA 2UUAK 3TSUA 1LV5A 1P8ZA 1SL0A 1RDCA 3CERA 4DLEA 3QMLA 4AHCA 5C12A 2D4WA 4IG0A 3AAPA 3PO5A 4I9QA 2YX6A 1LWEA 4N41A 1YTAA 4CGJA 1L3UA 2YHXA 3C6HA 1S3XA 1RTIA 4H0TB 1S5JA 4RW4A 3EY1A 4M3XA 3VQ5A 5LMUK 4J2EA 3V6DA 3J8AA 3CC4N 2WUSA 3L3UA 4FW2A 3PX6A 2E1ZA 2YNFA 1JCFA 3O6WA 3ULEB 3DXMB 3KIOA 3PX0A 3CJAA 1M1KO 3K58A 3VQAA 1TGOA 1YJNN 5CZ2A 1XHXA 1G15A 4C1NI 1C1AA 3O4WA 4DS5A 4KHQA 3TWHA 1J9AA 3LAKA 3U3YA 5CY4A 2OPRA 2P9IB 4YY3K 4HCBA 3ZLJA 2JGUA 4CGGA 3WQUA 1WSJA 4IEEA 4ZTFA 3V4IA 3ZSZA 4GNIA 4JN4A 2A1SA 3HSCA 3LANA 3LP2A 4EAHD 1NGJA 2Y1IA 2YI1A 4IFVA 1W9HA 4WCEL 5M1FA 2BE2A 2O8FB 1JLBA 3VQ7A 4H4MA 3HPHA 5FPNA 1XC9A 1MWKA 2W42A 2V52B 5AZJA 1EKEA 4X66K 3GG4A 4FLZA 3VF4A 4R79A 5FRNA 4DTXA 5DK5A 5AQVA 1U48A 5CYMA 1IJJA 1LWFA 3A0IX 1GLAG 3KLIA 2HHWA 1RDDA 4KH4A 1SKRA 2O8DB 4Z0UA 1N32K 4BQLA 3MXMA 4K42A 4H8KA 2QWLA 1X9WA 4LFAK 3IFRA 3LPUA 4FZYA 2P9LB 1QSLA 4CK1A 1RDBA 1QQOA 3QDKA 3JYTA 5GIOA 1UAXA 3SAHA 3QEIA 4OKKA 4CJTA 3C7NB 4C8LA 5KGWA 1HPMA 4E7IA 3KVGA 3VQ6A 2ASOA 2BGGA 3TPQA 3DYAA 3ATVA 3E66A 3IUCA 1JLFA 2QWNA 2A42A 2IVOA 3FFKB 1VHXA 2QKKA 3VQQA 2WTUA 3ZEUA 1VQ7N 3J7YP 2VCPA 2VQFK 2D5RA 5TKYA 1CZBA 3IRXA 3P83D 4GY2B 4IJAA 4FWKA 1D9FA 3THVA 1T3VA 3H1QA 3IS9A 4CF1A 4OJRA 4G1QA 4B08A 1VQPN 3VOVA 3MWPA 3NMUA 1IKXA 4DR6K 3ID8A 3LDPA 3WXIA 1UWBA 4IEIA 5JMVA 1VQ9N 3E9OA 3B6PA 5C0YA 3WXMB 3TTFA 3O9TA 3RRHA 4YORA 3HVRA 3CCLN 1LW0A 1S1UA 3M1FA 1G99A 1Z25A 4PY5A 4FWRA 4KAZA 4CJ7A 4NCBA 4CE9A 5HROA 2HMPA 4AHRA 3ZT3A 2P9NB 4CZLA 2G8KA 1NM1A 3ZSWA 3TAPA 3H08A 2FSJA 4JKGA 4CHZA 2NRZA 3T69A 4CIFA 2QXLA 3C6TA 4Q5VA 3CCSN 1DEJA 5AQNA 1HNIA 4CJSA 4M45A 1NGFA 4YHHK 4DSIA 3B6OA 5HRNA 4YDUA 3OYDA 1V4SA 3LP1A 4HTLA 3V9ZA 1SZ2A 2YV0X 1C0FA 1RNHA 4JKEA 1VRTA 2VWBA 3G6EN 4FLUA 4DFJA 2AA4A 2ZGZA 4JKDA 2XY8A 1YI2N 3BDPA 1JLGA 1TVRA 3R9PA 3PIOL 3O9RA 3DXKA 3CM5A 3NF7A 3DAWA 3IAYA 2P5GA 3TAMA 2HNYA 4A5BA 3LZIA 1MDUB 1VSHA 4FLXA 1NLVA 2BTFA 4A2BA 2HMIA 5AQIA 4CEAA 4CZEA 4LFBK 3EE9A 2Q1NA 1YVUA 1MA9B 1EO1A 3HO1A 3EZWA 3FR0A 5CE3A 1NGEA 3KJVA 5LJWA 1Q82O 4LF4K 3VA0A 4MDBA 3HPOA 3TSQA 1BQNA 3HBTA 2YHWA 4I6MA 3LWLA 2O4GA 1WSHA 3SQ4A 3SI6A 4EZ9A 5FLXO 1QQCA 4F4KA 4IOCL 4M3UA 4BE1A 5LL6Z 3TTCA 4AF1A 3F5TA 3K5LA 3EEQA 3P4IA 4NLBA 5EX5A 1NGHA 1IBLK 5DM7L 4J2BA 1W97L 4Y1DA 1I39A 2ZM6K 1CZ9A 4QOZB 3NVMA 3OYBA 4UQGA 3TANA 5H1SQ 1OVQA 1VAZA 4NLCA 1FKOA 4FXDA 3VERA 5GAGP 2EWSA 3OVNA 4DFPA 1VQ4N 1KFSA 4JAXA 2UYTA 3LDOA 3SUQA 1QQNA 3T7ZA 2GV9A 2GBZA 1VQ5N 4GW6A 2GX9A 4O8UA 1NGAA 4NCAA 3DM2A 1NKBA 2PY5A 1S1TA 1HKBA 2B5JA 3ZX2A 4BWMA 3QINA 3OYKA 1XI1A 1U45A 4BRQA 3VQDA 3VQ8A 4LY7A 3CCUN 3S3OA 2FXUA 1VSDA 4Z94A 1NK9A 4Z4IA 4KH6A 4CJQA 4JI3K 4A61A 2P9PA 4EP4A 1OH7A 1X3NA 3LZJA 3P31A 4BRKA 3ZSOA 2Q36A 1KRPA 4E1NA 1RBVA 3I8DA 4JYAK 4KKOA 1NJWA 3O1WA 1WSEA 3DOKA 2B4JA 2DPNA 1K8AO 1WSIA 1ITGA 4CFDA 2NRWA 1VSIA 3D0PA 1BQMA 3SV4A 2OPQA 1MU2A 3SPZA 2FC0A 3QBWA 3J81O 3L3VA 3OYNA 5KPRA 3L6QA 4CZFA 2Q97A 2D0AA 3NF6A 1EWRA 1U47A 4FK4A 3BZCA 5AQUA 4N47A 3MWTA 3CIPA 1ZBHA 1XQSC 4BROA 3FE1A 4B9QA 3VEXA 4E7HA 2IC3A 3E1YA 1DTQA 3DJCA 1C0TA 3THXA 3LL3A 3L2WA 3CJ1A 4DSFA 3D2FA 5AQYA 4BC5A 3OS2A 3PIPL 4JHDB 4IOXA 4I7FA 3LALA 4DFKA 4FW1A 4RW8A 3SNNA 1HJOA 1I94K 2YHBA 4QCLA 1NOYA 1CLQA 4DF8A 5LJVA 5KPZA 3L2UA 3V9WA 1BDGA 2P9KA 1TUUA 1YTUA 1VSEA 2KZMA 4OX9K 4MO4A 3G10A 3S9HA 1TK8A 4LF6K 4H0OA 4FK0A 2P9IA 3EKUA 3LP0A 4DU4A 1NK6A 4N56A 1TKDA 2E2OA 3J7AP 4H5TA 4Y0WA 4DR3K 1GOBA 3WNHA 4E7LA 1Q8IA 1N34K 2UXBK 1RGIA 1TKZA 3FZLA 2JWLA 1JXEA 4JKFA 2YHYA 2PYJA 3KD1E 1JLEA 3FZMA 2RF2A 3KLFA 1B9FA 3VPZA 3H3OB 1VSLA 3FZHA 4QS9A 5ADXH 1HMVA 2B6AA 1KAYA 4BC4A 1BI4A 2CGJA 2X6NA 2P9LA 3CC7N 4LC9B 3HL8A 4BDPA 4E1MA 2ZGYA 1HLUA 2OPPA 2YCHA 1ZBIA 3LWMA 4BY9C 3L4IA 1QZ6A 3CYMA 1SUQA 4WQ5C 1KVAA 1YJ9N 4DSKA 3AA5X 3QO9A 4CJRA 1EQYA 3SYZA 5I9EB 3WNFA 2BH1A 3ZX0A 3ALYA 4L3QA 2W40A 1JL2A 1YAGA 1VQ8N 2Z1IA 1K9MO 3RMCA 4H0YB 1KQSM 3RMDA 1X9MA 4XIUA 4CD1A 3F9KA 1XC3A 5AR0A 3UKUB 1BGXT 4RW7A 4BACA 1B92A 1JL1A 5M1PA 1RTDA 4CJVA 4JKCA 5BREA 2GELA 4FL9A 4CGIA 1W2BM 4FJIA 5ELZA 1U49A 3SK3A 1Y64A 4CHQA 1S1XA 2UU9K 1O13A 5KTQA 1E4FT 3V9SA 5LY3A 3O3GA 5J2NA 1SQKA 4NYNA 5A2QO 4HCCA 4OVLA 3CETA 5C24A 3DLEA 3THXB 3AGKA 4FJGA 2IAJA 3VN5A 3QLHA 1HYVA 5AQQA 4CHYA 4CJWA 1DKGD 2CH6A 1XUPO 3DXMA 2WONA 4PKHA 3ZSXA 4JI2K 2O8BB 5M1NA 1KC8O 3U9DA 1P90A 3J7ZO 1HPZA 3THWB 1NGGA 3CPWM 4BE0A 4F2RA 3EE8A 4HHTA 1VQMN 2KFNA 3M6GA 4J2AA 4KH5A 4M41A 4RW9A 3ZSQA 1RBUA 3KLHA 1R59O 5J2QA 4R5PA 1CZAN 4CW7B 4ILGB 4I9LA 4WFNL 2E2PA 2A6AA 4OPKA 1BCOA 4FJKA 1WAJA 3O4NA 2I7NA 1BCMA 4JKGB 4ELVA 4CFCA 4O5FA 2VYPA 4FJ8A 5ADXA 3O3FA 2FF6A 1D5AA 3AO1A 5FPMA 4CI6A 1NU0A 2FSKA 4BDYA 3SCXA 3U6FA 2XY5A 2LSNA 4DV0K 3R6MA 1Z6RA 2A40A 5C2FA 1U04A 2PAVA 4CF8A 4JS5A 4BGAA 1RT1A 2OPSA 1IKYA 1BIUA 3ZT1A 3CJ7A 3SAGA 3MN6A 3OBWA 2YKNA 4X62K 3ZSVA 4G9ZA 4CJ3A 1RT2A 3NH2A 2V7YA 3M8RA 3C6UA 2GWKA 4B1XB 2I5JA 3PUFA 3AO3A 4O4GA 2DY4A 3SAFA 2ZQBA 1OH5A 1XMOK 4BR9A 1J5EK 2GTDA 4JI4K 4YOXA 2QXFA 4C1NK 2FLOA 3NGYA 4BRGA 3AVLA 4JRQA 3N4QA 2P9UB 1ZXOA 1JXBA 3KK2A 4IFEA 1WBBA 1KVCA 3F73A 3Q7CA 3BEXA 4H5WA 1N36K 3ZT0A 3OS0A 4F9OA 5AQLA 5AQPA 2E6MA 2DFHA 3I0RA 1NJZA 4IBNA 4AHVA 1T7PA 2R7YA 3V1QA 3ZSRA 3PY8A 1BU6O 1BOTO 4E89A 4AILC 1ZYQA 3VGLA 3IG1A 2KLAA 5C2DA 3DLRA 1TYQA 2GUPA 4FWLA 3KWGA 4MFBA 3O9QA 3MEEA 4CESA 2ITGA 5KI6A 4B1WB 4CGDA 3A5LC 4CHNA 1JJ2M 3RSEB 2CGLA 3RMBA 1IG9A 1NK5A 4KTWA 3S3MA 1UA1A 3ISNC 1OH6A 3ASMA 5FPEA 5M1KA 2G8VA 4CBUA 2QWOA 3G0ZA 1WN7A 1DGKN 2CH5A 4BDZA 1ZBLA 2XY6A 4BR7A 2QWMA 4LSNA 3GL1A 4FJ7A 5F0XA 3T3FA 5FROA 1GLBG 1RDUA 4B1UB 3BUZB 4F3OA 2XY7A 3AA3A 2E8AA 4CGHA 2NLXA 4KHYA 4AM7A 3EL2A 1TL1A 4V19S 2ZE2A 1RDAA 3VMFB 3OYIA 3FGUA 3AGRA 1FXXA 2YNHA 4BWJA 4U67L 3EZ5A 4C8NA 4FWSA 3E9LA 1HNXK 5SZTA 1BIZA 2Q31A 4RG8A 1RBTA 3I55N 2HBKA 1L3SA 2HNZA 3UKRA 1N33K 4DTSA 2HHTA 2F9WA 4DR7K 3GBTA 5KGXA 3R8EA 2VG7A 5AZIB 3LAMA 5AQOA 1GLJO 3K5NA 3I56N 3R1XA 3W0LA 1U4BA 4Z4FA 2G8WA 2Z1JA 3EO3A 3AY9A 3PX4A 3JXUA 4DUYK 4C8OA 1XWLA 3U9ZA 2HHQA 4CEBA 1Q86O 1TK5A 5C25A 4DQQA 4JI6K 1OKJA 2HBMA 3LDSA 4YOYA 3CPEA 3OYHA 2Z1HA 3VTIA 2HHXA 4FM1A 4Z4EA 3FLCO 2UUBK 3PSFA 5FRMA 2IDOA 1MWMA 3VGMA 1S6PA 3CQXA 4OGCA 4OLBA 3DLKA 2I7PA 4LF9K 3HP9A 4YOTA 1ZBSA 3TI0A 4ELTA 3MAQA 3MX5A 4CHOA 3AVNA 1XNQK 1L3VA 2HSTA 4CZIA 4OKEA 1J5OA 4IDHA 3CQYA 2KW4A 3CFRA 4BR5A 3QBXA 5J1EA 4DCHA 3O5BA 4LH4A 4H03B 2G8FA 2ATQA 1KLMA 1NJXA 3GDQA 4HTUA 3KTQA 4KRFA 4M42A 3TAGA 1ESVA 3AVCA 3L8BA 1L3TA 4FK2A 4IXCA 3ID6A 1E3MA 4B3OA 3VTHA 3LDLA 5SWMA 3RTVA 5I3UA 4FLVA 2HF4A 1C1CA 4AH9A 3P1GA 4BRPA 2ZF5O 3A2FA 4FOIA 4DTUA 5EU7A 4LH5A 1DTTA 1B9DA 3K5MA 3DOLA 1XHZA 5CR4A 4KBOA 3OYJA 4JRPA 2P5OA 1BHLA 1REVA 4HUGA 3T1YK 3D45A 4C8KA 3HTVA 3DLHA 3O9SA 4DV6K 4YOVA 4F2SA 3O3HA 1M90O 5D3GA 4DR1K 4LF7K 1HRHA 3ZEUB 1RDWX 3AVMA 4DV3K 3D2EA 4CEZA 5BRHA 4CD3A 1BO5O 4B1YB 2PYLA 3M8SA 2P9PB 1N5YA 4MDAA 5B8HA 1TAUA 3ULEA 2GUIA 3ZSYA 4B3TK 1VQNN 2O8CA 3JAMO 4FWPA 4IFYA 4U7BA 1ASWA 1NGCA 2A41A 1NJIO 1HNZK 1VSMA 2EX3A 2VWKA 2D1KA 2ZJQL 3ZETA 1WAFA 4YOUA 3L4QA 2G8HA 3K9KA 3VQ4A 5HRRA 3NH0A 1J53A 3HI0A 3MEGA 4BRMA 2ITMA 2F96A 3HZ6A 1HR0K 1LCUA 4CZGA 1WB9A 3A8YA 2F8TA 5M1OA 4I6MB 4CIGA 2YKMA 1W7AA 2F8SA 3LM9A 4DG1A 3TABA 3UKRB 1BA1A 3DWLA 2HB5A 3D2EB 4IDKA 1HUXA 3ITHA 1FJGK 2W41A 3M3ZA 4JHDA 4GV3A 1QTMA 4E3SA 3M8QA 3PLAA 4AQYK 4OPJA 4BRHA 4IO9L 4PUOA 2O8BA 3QFUA 3A5NC 4DTMA 4DWIA 4HWIA 1SS6A 2PZSA 3QETA 3ZX3A 3HK2A 1BISA 3DMJA 2ZJPL 4KHPK 4AHSA 2YJFA 3QESA 3WXLA 3DXKB 1JLQA 1YF5L 3C0BA 4CERA 4ICLA 2P9UA 4FJHA 4N76A 4KI6A 4ISGA 1ASUA 1N6QA 4LFCK 3MK6A 5C42A 4B8AB 3F2KA 4QS7A 4E7KA 3KWIA 1C0MA 3O08A 3VENA 4DTJA 1J6ZA 4WE1A 2NRXA 3GOIA 4OPAA 3PO4A 1TAQA 1ATRA 4LF8K 4ZTJA 5HRSA 4FPAA 5AQMA 4FOEA 1SL1A 3NGZA 3P38A 5KRTA 5EOYA 3HM8A 1A5XA 2NRVA 3HT3A 3IDHA 4FLWA 3QERA 4OGEA 3WUHA 1HYZA 3QNNA 4CEDA 4CBXA 2V7ZA 3BGRA 3I0SA 1L5UA 1BI4B 4M7XA 2Q3SA 1XNRK 4BQZA 1VQLN 3SQ2A 4DQ8A 1KSPA 3UKUA 4GVEA 1NGIA 3OY9A 4JD2B 2D0BA 4MLEA 3CJCA 1Z05A 1IKWA 4K41A 4PHTX 1S1WA 4A62A 1K8KB 4JKAA 4DFMA 2X74A 4W5QA 3CFOA 2ZJRL 1RT7A 1BG3A 2E20A 4KV8A 1QHTA 4H5NA 4CF0A 2WFBA 4E1JA 3OW2M 3VQ9A 4CFBA 4C8MA 2YNIA 5AQGA 2KTQA 2QI2A 1RT5A 4FLYA 3HOSA 2HHSA 3I33A 4CBWA 4IZ9A 3CJBA 4FYDA 4M3ZA 1RILA 4CJUA 3K5OA 3KHYA 4L8RB 3VQEA 5BN8A 1Y97A 1NJYA 3DLBA 1QHAA 1JCEA 4M3TA 4PKGA 3NVKA 4W5RA 3NFAA 4PQUA 5FDLA 4KTZA 2P9KB 3AVFA 4BVOA 3EKSA 1S1VA 4KHUA 4GMJB 1HQEA 3DLLL 2JLEA 1JKHA 2PFUA 3DRPA 3RR8A 3WNEA 5I42A 4BRFA 2OTJN 1Q18A 4FWOA 4M3WA 4CJ4A 4QS8A 4CEEA 1K8KA 4Z4HA 5BRFA 3DRRA 1SAZA 4W5OA 4B9MA 1D9DA 1YVNA 2QTDA 4DB3A 5KPTA 4DTRA 4BR2A 4M7YA 4Q0BA 1IH7A 5GIPA 4ISEA 3AVIA 4BG9A 3A5MC 4YNQA 4FVMA 2VG6A 3R3LA 4ILJA 3V81A 1TYQB 3NDKA 3THYB 2D0OA 5IWAK 2VG5A 4H5VA 3QIPA 2OANA 3TU5A 3MCAB 4FWQA 3SMSA 3OYAA 1T05A 4CHPA 2A3ZA 3B8AX 5BPNA 4IWVA 4GVMA 1HKCA 3EYZA 4OPHA 3AAQA 3SQ1A 4B8CA 3BZKA 4K25A 4O0IA 1GLCG 2HBLA 1KTQA 2KHOA 1EP4A 5C10A 4Z4GA 4PA1A 4JI1K 1VSFA 3NBPA 1NK0A 2WC9A 3CCRN 3CC2N 3BF3A 4WFAL 3VEVA 1WNSA 2IGIA 4DU3A 3AO4A 1T44A 2O8EB 2HVIA 4DSLA 2IS3A 2Y1JA 3QEXA 4I2QA 1S9EA 4NXNK 3HXMA 4BRCA 2HNDA 3WXJA 4IKFA 3PSIA 1EX4A 4XH1A 4BRAA 3CJ9A 1IO2A 4I2PA 1HNVA 3VA3A 3JSMA 1BA0A 4K43A 1NK8A 4PWDA 3MECA 4DTPA 5HLFA 4M3YA 3V1RA 2QA4N 1D8YA 1A5VA 1TL3A 2D0CA 3TTDA 1T8EA 3KKSA 1KD1O 4YOWA 3QEWA 4WFBL 2BANA 4BRDA 4ELUA 5HL7L 5AQZA 4FLTA 3L2VA 4BR4A 4FJ5A 5EY4A 3S41A 1U6ZA 1VSKA 1S6QA 3CG7A 1NNEA 3OTOK 3O4QA 1QVGM 3A5OC 1QSSA 1YT3A 1OH8A 3WNGA 3TR8A 2J4RA 5K14A 4K8XA 2ETJA 3RRGA 1XMQK 3CFPA 4BC3A 4FWMA 5JICA 3SPYA 3SJJA 1ATNA 1VQKN 3QFPA 4JD2A 3KLEA 2YHAA 4CK3A 4KPYA 2A5XA 1QSYA 2Q0RA 4F8RA 5LMNK 1ZBFA 5HP1A 3EN9A 3HOTA 2O8FA 2VQEK 3CQ8A 3ZYYX 3AVJA 5GAHP 3U3GA 5JLFA 3HP6A 1RTHA 3C6AA 1TV6A 3G71N 1Q9XA 2OA8A 3H46O 1K73O 3NCIA 3V9XA 2RPIA 2RE2A 4NXMK 3D6RA 3VETA 2IIRA 2NRHA 5EXWA 3CM6A 3SBGA 4KTQA 3CD6N 3MEDA 3FFIA 3AA4A 4KO0A 4RCHA 4DQPA 1WUAA 3VGKA 3BY5A 4CZJA 3SUOA 4DQIA 4KB0A 4FJNA 3E01A 4BRNA 2QKBA 1UOCA 5AQHA 3H3NO 4YFUA 4BVPA 1NGBA 1X3MA 3C7NA 3ZT2A 2W6LA 3C94A 5BN9A 5TKWA 4OLAA 4PL8A 4E19A 3IMXA 4PL7A 4M63C 2DTUA 2HHVA 5AJ3K 3AVAA 4ILHA 1FW6A 4DHYA 1NK4A 3ZCMA 5DMRA 3D7EO 1DLOA 4DV2K 3O1BA 4NB4A 1WOQA 3MN5A 4WF9L 3TARA 4EZ6A 5AFUH 1BUPA 3VEWA 2YJEA 1KCFA 3NF8A 4LF5K 3LPTA
chains in the Genus database with same CATH topology
2P5OA 1VSEA 2KZMA 1BHLA 1REVA 1EETA 4J2DA 4HUGA 2AJQA 3D45A 4C8KA 3G10A 4B9SA 3DLHA 3S9HA 1TK8A 1WLJA 1Z26A 1CXQA 4F2SA 3O3HA 3TAQA 4FK0A 4DLGA 3MXIA 5D3GA 3LP0A 4CEQA 1HRHA 2P51A 3OYCA 4DU4A 1NK6A 4N56A 1TKDA 3AVMA 5J2MA 1WSGA 1SKSA 2NUBA 3VQCA 2KFZA 3AVKA 4CEZA 3NE6A 5HBMA 4KFBA 1GOBA 3WNHA 1NK7A 3OYLA 4LSLA 2PYLA 3UIQA 1FK9A 1EXQA 3KLGA 4E7LA 1Q8IA 1LAWA 1X9SA 1LV5A 3M8SA 1SL0A 1N5YA 3IAYA 4KB1A 1RDCA 1TKZA 4DLEA 1TAUA 3KD5E 2GUIA 3ZSYA 4AHCA 3RWUA 2A1RA 1JXEA 4IG0A 3PO5A 4IFYA 2PYJA 1ASWA 3HSTB 1JLEA 3OYMA 3KD1E 4I9QA 1LWEA 2RF2A 3KLFA 4N41A 1B9FA 1YTAA 4CGJA 1L3UA 1LWCA 1VSLA 1JLAA 1VSMA 1HMVA 1RTIA 2B6AA 3QEVA 1S5JA 2EX3A 4RW4A 1BI4A 3EY1A 2VWKA 2X6NA 3VQ5A 4M3XA 2DFFA 4J2EA 4BDPA 2XO7A 3L2QA 3HL8A 3OJSA 3V6DA 2QK9A 2YNGA 1WAFA 4E1MA 2G8HA 1GOAA 3VQ4A 2OPPA 5HRRA 1J53A 2ZD1A 3NH0A 4DTNA 2G8UA 1ZBIA 3L3UA 3MEGA 3LWMA 4FW2A 2F96A 3CYMA 1SUQA 1LW2A 4O0JA 1KVAA 3PX6A 2YNFA 1C0UA 2F8TA 4DSKA 3AVGA 3V1OA 3AA5X 3QO9A 3KIOA 4CIGA 4CJRA 3PX0A 1IKVA 3SYZA 2YKMA 3WNFA 3ALYA 1JL2A 1HQUA 2F8SA 2Z1IA 4W5NA 3RMCA 4DG1A 3K58A 3TABA 3VQAA 3RMDA 1X9MA 1TGOA 4M3RA 5CZ2A 4XIUA 1XHXA 3F9KA 2OZMA 1G15A 4KHSA 2HB5A 1BGXT 1C1AA 4IDKA 3ITHA 2FBXA 1GOCA 4RW7A 4DS5A 4DTOA 4BACA 3TWHA 1B92A 1J9AA 1JL1A 1RBSA 3LAKA 3K2PA 4CGFA 3U3YA 1RTDA 1QTMA 4ID1A 5CY4A 3M8QA 4E3SA 2OPRA 1YTUA 4CJVA 4B9UA 4HCBA 4OPJA 3RMAA 4PUOA 4MQ3A 4DTMA 4DWIA 4CGIA 2JGUA 3HJFA 4CGGA 2PZSA 3QETA 4FJIA 3HK2A 1WSJA 1BISA 3DMJA 4ZTFA 1U49A 1Q9YA 3V4IA 4AHSA 3ZSZA 4EP5A 3QESA 3ULDA 2A1SA 3LANA 1JLQA 3LP2A 4CHQA 1S1XA 3DLGA 4ICLA 4CERA 4CF2A 3ZT4A 2Y1IA 4KI4A 4IFVA 3K59A 1W9HA 5KTQA 4FJHA 4KREA 4N76A 4KI6A 2BE2A 4Y1CA 1WSFA 1JLBA 1ASUA 3DI6A 3V9SA 3VQ7A 3O3GA 1N6QA 5C42A 4B8AB 3AO5A 4H4MA 5J2NA 4NYNA 4E7KA 4HCCA 1C0MA 3HPHA 4OVLA 4DTJA 3LP3A 3OYFA 2HW3A 4WE1A 1XC9A 5C24A 3DLEA 3PO4A 1I3AA 1TAQA 2W42A 1CXUA 1EKEA 4DQSA 4E0DA 4FJGA 2HVHA 2IAJA 4HVJA 3VN5A 3QLHA 1HYVA 4FLZA 4ZTJA 3RR7A 5FRNA 4DTXA 5HRSA 1JLCA 2FBYA 2OYQA 3V9UA 1SL1A 3NGZA 5DK5A 4CHYA 4NCGA 5JS2A 5KRTA 5CYMA 4CJWA 1U48A 1KVBA 1LWFA 1VSJA 1A5XA 1R0AA 2WOMA 3HT3A 3KLIA 2HHWA 3NH1A 1RDDA 4FLWA 1SKRA 4LD0A 4Z0UA 3QERA 4OGEA 3QNNA 1HYZA 2WONA 3TAFA 3ZSXA 4H8KA 3MXMA 4CEDA 4ZHRA 3SV3A 1X9WA 3BGRA 3I0SA 1HPZA 1L5UA 4ID5A 1BI4B 3LPUA 2RN2A 2Q3SA 4BE0A 3QNOA 4FZYA 4F2RA 3SQ2A 1KSPA 3NHGA 1QSLA 4CK1A 1RDBA 3JYTA 4HHTA 3KK1A 4W5TA 2KFNA 3K57A 3OY9A 4J2AA 4M41A 2D0BA 1UAXA 3T19A 3QEIA 1IKWA 4OKKA 5CYQA 4RW9A 1S1WA 3ZSQA 4CJTA 4DFMA 2X74A 3QEPA 4C8LA 4W5QA 3CFOA 5KGWA 1RT7A 4B9VA 1RBUA 4E7IA 3KLHA 1NOZA 4KV8A 3VQ6A 4K8ZA 5J2QA 1QHTA 4R5PA 2BGGA 4NYFA 4HUFA 4I9LA 4CF0A 3DYAA 4DSJA 4OPKA 4FJ9A 1BCOA 1JLFA 4FJKA 3VQ9A 4CFBA 1WAJA 3O4NA 4C8MA 2YNIA 3AVHA 1BCMA 3AV9A 1RT5A 2QKKA 2KTQA 3VQQA 4FLYA 4ELVA 2G8IA 2HHSA 4CFCA 4FYDA 2D5RA 4M3ZA 1RILA 4CJUA 3K5OA 3SUPA 4FJ8A 4L8RB 1CZBA 3IRXA 3P83D 3VQEA 3O3FA 1Y97A 1D9FA 1D5AA 1NJYA 3THVA 3AO1A 3DLBA 4KHNA 4FZZA 4M3TA 4W5RA 3IS9A 3NFAA 5FDLA 4CF1A 4PQUA 4KTZA 4BDYA 3AVFA 3SCXA 1RBRA 4OJRA 3VQPA 4G1QA 4B08A 3U6FA 4KHUA 1S1VA 2XY5A 4GMJB 1HQEA 3SZ2A 3PV8A 2LSNA 2JLEA 1JKHA 1IKXA 1U04A 4CF8A 3DRPA 4JS5A 3RR8A 2RKIA 1UWBA 2KZZA 3WNEA 1RT1A 5I42A 2FBTA 2OPSA 1IKYA 1BIUA 3ZT1A 3B6PA 3SUNA 3RRHA 4CJ4A 3HVRA 2YKNA 4M3WA 1LW0A 3ZSVA 1X1PA 1S1UA 4CEEA 4CJ3A 1RT2A 3NH2A 1RT4A 1Z25A 3M8RA 4PY5A 3C6UA 4Z4HA 4KAZA 3DRRA 1VRUA 1LAVA 4NCBA 4CJEA 4W5OA 1VK0A 4B9MA 4CE9A 5HROA 2I5JA 4AHRA 2P1JA 3PUFA 3AO3A 4O4GA 3ZT3A 1D9DA 2DY4A 2ZQBA 4DTRA 2G8KA 2QXFA 3OYEA 3ZSWA 4Q0BA 1IH7A 3TAPA 4FZXC 3H08A 3NGYA 5CZ1A 4CHZA 3AVIA 3AVLA 4JRQA 3NF9A 4YNQA 4FVMA 4CIFA 1C1BA 1JXBA 2VG6A 1TKXA 3KK2A 1HYSA 4JLHA 3V81A 1KVCA 3HYFA 3F73A 3NDKA 3NAEA 3C6TA 4Q5VA 4DSEA 2VG5A 1SL2A 3ZT0A 1HNIA 4CJSA 1BL3A 3QIPA 4CEOA 3OS0A 3OYAA 3AA2A 4CHPA 4M45A 1T05A 4DSIA 3B6OA 2E6MA 4FJJA 5HRNA 2DFHA 3M8PA 3OYDA 3I0RA 4GVMA 3EYZA 4IBNA 3SQ1A 3LP1A 4AHVA 4B8CA 3V9ZA 1NJZA 4O0IA 2YV0X 3V1QA 1RCHA 1A5WA 3ZSRA 2R7YA 1T7PA 1RNHA 1KTQA 1VRTA 2FBVA 4CIEA 3PY8A 1EP4A 4E89A 4AILC 4FLUA 4DFJA 1ZYQA 4Z4GA 3AVBA 4PA1A 2XY8A 3IG1A 1VSFA 3BDPA 3NBPA 1NK0A 3DLRA 1JLGA 1TVRA 3L2RA 2EHGA 1WNSA 3CM5A 3NF7A 4MFBA 3MEEA 2IGIA 4CESA 4CFAA 2ITGA 3AO4A 3TAMA 1W0HA 2HNYA 4DU3A 2P5GA 2OZSA 5KI6A 4CGDA 2HVIA 4DSLA 3LZIA 2IS3A 4CJKA 4FLXA 1VSHA 3QEXA 4HUEA 4E7JA 4CHNA 4I2QA 1S9EA 2Y1JA 2HMIA 4CEAA 3RMBA 4CECA 1IG9A 1NK5A 3HXMA 4KTWA 2HNDA 4IKFA 3S3MA 1UA1A 4CK2A 3ISNC 1QS4A 1YVUA 2XHBA 3HO1A 3ASMA 1EX4A 2G8VA 4FJMA 3KJVA 3G0ZA 4DQRA 1WN7A 4H4OA 1IO2A 2E6LA 4BDZA 1ZBLA 4I2PA 4FM0A 1HNVA 3VA0A 2XY6A 3VA3A 3JSMA 3HPOA 1NK8A 1BQNA 4CJ5A 4PWDA 4LSNA 3MECA 4FJ7A 4DTPA 4CJFA 5HLFA 4M3YA 3V1RA 4DU1A 3T3FA 4DS4A 5FROA 3LWLA 4F3OA 2O4GA 2XY7A 1D8YA 3AA3A 1A5VA 2KQ2A 4CGHA 4KHYA 1WSHA 1TL3A 2VWJA 1TL1A 3KKRA 2D0CA 2ZE2A 1RDAA 3SQ4A 3OYIA 1T8EA 1NKEA 3KKSA 3SI6A 3DRSA 1RT6A 4EZ9A 3QEWA 1FKPA 1FXXA 1QQCA 3MXJA 2BANA 4F4KA 2YNHA 4BWJA 4ELUA 4M3UA 4BE1A 4O5BA 4FLTA 4CEFA 3EZ5A 1NKCA 1C6VA 4C8NA 3L2VA 4FJ5A 3K5LA 4CJLA 5SZTA 1BIZA 2X6SA 4RG8A 1VSKA 1S6QA 4CF9A 4J2BA 1RBTA 3CG7A 4Y1DA 1I39A 1ZBUA 1CZ9A 1L3SA 2HNZA 2X78A 4DTSA 4QOZB 2HHTA 1O1WA 3AO2A 3O4QA 3OS1A 5KGXA 3OYBA 2VG7A 1QSSA 1YT3A 3LAMA 4UQGA 3TAEA 3WNGA 3TR8A 3TANA 5K14A 4K8XA 2ETJA 1FKOA 1RT3A 4FXDA 3RRGA 3K5NA 3S3NA 3OVNA 3CFPA 1U4BA 3SPYA 4DF4A 3SJJA 4Z4FA 1QE1A 4DFPA 1ASVA 3NGIA 1KFSA 3SUQA 2G8WA 3KLEA 2Z1JA 2GV9A 2GBZA 2YHAA 4GW6A 3PX4A 4NCAA 3DM2A 4CK3A 1NKBA 4CJPA 2PY5A 4C8OA 4KPYA 1XWLA 2E4LA 1S1TA 4CEBA 1QSYA 2HHQA 4TSXA 4AHUA 1KLNA 2B5JA 1RTJA 4F8RA 1TK5A 4BWMA 3C95A 1ZBFA 3QINA 5C25A 4DQQA 3OYKA 5HP1A 1XI1A 1U45A 3LDSA 3OYHA 3VQDA 3VQ8A 2Z1HA 4Z4CA 4LY7A 4BE2A 2HHXA 3S3OA 1VSDA 4FM1A 3HPGA 2DFEA 4Z4EA 1NK9A 3VQBA 3CQ8A 4CJQA 4Z4IA 1HJRA 3AVJA 3U3GA 3HP6A 5J2PA 1RTHA 5FRMA 1TV6A 2IDOA 4EP4A 1Q9XA 2OA8A 3LZJA 3T1AA 3ZSOA 3NCIA 3V9XA 2RPIA 4QAGA 1S6PA 1KRPA 1K6YA 4E1NA 1RBVA 4OGCA 3I8DA 1T03A 4OLBA 3DLKA 5T7BA 4KKOA 3CM6A 3HP9A 1NJWA 1UA0A 3HVTA 4FJLA 3TI0A 4AHTA 3MAQA 1WSEA 4OKJA 4CHOA 3DOKA 2B4JA 4ELTA 4FJXA 3AVNA 4KTQA 1WSIA 1L3VA 4B9NA 3MEDA 1ITGA 3FFIA 4CFDA 2HHUA 4IG3A 3AA4A 1VSIA 3D0PA 4KO0A 4OKEA 1BQMA 1J5OA 3SV4A 2OPQA 3CFRA 1MU2A 1F21A 2KW4A 3SPZA 4CCHA 5JS1A 4DQPA 5J1EA 2FC0A 3L3VA 4JS4A 3SUOA 3OYNA 4DQIA 4O55A 4B9TA 4KB0A 3OYGA 4LH4A 4FJNA 3E01A 5KRSA 2QKBA 1UOCA 2XRIA 2BDPA 1KFDA 2D0AA 3NF6A 4YFUA 1U47A 2G8FA 2ATQA 4KHQA 1KLMA 4FK4A 2Z1GA 1S9GA 4B9LA 3ZT2A 5E41A 2O4IA 3C94A 4N47A 3QIOA 1SV5A 1NJXA 4O44A 4HTUA 1ZBHA 4E7HA 4OLAA 2IC3A 1DTQA 4E19A 3KTQA 4KRFA 1C0TA 4M42A 1J54A 3TAGA 2HHVA 1TKTA 2DTUA 3AVCA 3L2WA 3AVAA 4DSFA 3L8BA 1L3TA 4FK2A 1SKWA 4FM2A 4F3TA 3OS2A 4B3OA 1NK4A 3ZCMA 5DMRA 4DMNA 4I7FA 1DLOA 3SQ0A 4FCYA 3P5JA 3LALA 5SWMA 3RTVA 4FLVA 5I3UA 3TARA 4DFKA 1C1CA 4FW1A 3P1GA 4RW8A 4AH9A 3SNNA 3A2FA 4EZ6A 4DTUA 5EU7A 2IOCA 2YHBA 4LH5A 4QCLA 1NOYA 1DTTA 4RW6A 4KHWA 1B9DA 3K5MA 4DF8A 1CLQA 5HRPA 3DOLA 1XHZA 3OJUA 4N5SA 1KCFA 3KK3A 3NF8A 3L2UA 3V9WA 3LPTA 1TK0A 3HM9A 3OYJA 4JRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P5O A;  1VSE A;  2KZM A;  1BHL A;  1REV A;  1EET A;  4J2D A;  4HUG A;  2AJQ A;  3D45 A;  4C8K A;  3G10 A;  4B9S A;  3DLH A;  3S9H A;  1TK8 A;  1WLJ A;  1Z26 A;  1CXQ A;  4F2S A;  3O3H A;  3TAQ A;  4FK0 A;  4DLG A;  3MXI A;  5D3G A;  3LP0 A;  4CEQ A;  1HRH A;  2P51 A;  3OYC A;  4DU4 A;  1NK6 A;  4N56 A;  1TKD A;  3AVM A;  5J2M A;  1WSG A;  1SKS A;  2NUB A;  3VQC A;  2KFZ A;  3AVK A;  4CEZ A;  3NE6 A;  5HBM A;  4KFB A;  1GOB A;  3WNH A;  1NK7 A;  3OYL A;  4LSL A;  2PYL A;  3UIQ A;  1FK9 A;  1EXQ A;  3KLG A;  4E7L A;  1Q8I A;  1LAW A;  1X9S A;  1LV5 A;  3M8S A;  1SL0 A;  1N5Y A;  3IAY A;  4KB1 A;  1RDC A;  1TKZ A;  4DLE A;  1TAU A;  3KD5 E;  2GUI A;  3ZSY A;  4AHC A;  3RWU A;  2A1R A;  1JXE A;  4IG0 A;  3PO5 A;  4IFY A;  2PYJ A;  1ASW A;  3HST B;  1JLE A;  3OYM A;  3KD1 E;  4I9Q A;  1LWE A;  2RF2 A;  3KLF A;  4N41 A;  1B9F A;  1YTA A;  4CGJ A;  1L3U A;  1LWC A;  1VSL A;  1JLA A;  1VSM A;  1HMV A;  1RTI A;  2B6A A;  3QEV A;  1S5J A;  2EX3 A;  4RW4 A;  1BI4 A;  3EY1 A;  2VWK A;  2X6N A;  3VQ5 A;  4M3X A;  2DFF A;  4J2E A;  4BDP A;  2XO7 A;  3L2Q A;  3HL8 A;  3OJS A;  3V6D A;  2QK9 A;  2YNG A;  1WAF A;  4E1M A;  2G8H A;  1GOA A;  3VQ4 A;  2OPP A;  5HRR A;  1J53 A;  2ZD1 A;  3NH0 A;  4DTN A;  2G8U A;  1ZBI A;  3L3U A;  3MEG A;  3LWM A;  4FW2 A;  2F96 A;  3CYM A;  1SUQ A;  1LW2 A;  4O0J A;  1KVA A;  3PX6 A;  2YNF A;  1C0U A;  2F8T A;  4DSK A;  3AVG A;  3V1O A;  3AA5 X;  3QO9 A;  3KIO A;  4CIG A;  4CJR A;  3PX0 A;  1IKV A;  3SYZ A;  2YKM A;  3WNF A;  3ALY A;  1JL2 A;  1HQU A;  2F8S A;  2Z1I A;  4W5N A;  3RMC A;  4DG1 A;  3K58 A;  3TAB A;  3VQA A;  3RMD A;  1X9M A;  1TGO A;  4M3R A;  5CZ2 A;  4XIU A;  1XHX A;  3F9K A;  2OZM A;  1G15 A;  4KHS A;  2HB5 A;  1BGX T;  1C1A A;  4IDK A;  3ITH A;  2FBX A;  1GOC A;  4RW7 A;  4DS5 A;  4DTO A;  4BAC A;  3TWH A;  1B92 A;  1J9A A;  1JL1 A;  1RBS A;  3LAK A;  3K2P A;  4CGF A;  3U3Y A;  1RTD A;  1QTM A;  4ID1 A;  5CY4 A;  3M8Q A;  4E3S A;  2OPR A;  1YTU A;  4CJV A;  4B9U A;  4HCB A;  4OPJ A;  3RMA A;  4PUO A;  4MQ3 A;  4DTM A;  4DWI A;  4CGI A;  2JGU A;  3HJF A;  4CGG A;  2PZS A;  3QET A;  4FJI A;  3HK2 A;  1WSJ A;  1BIS A;  3DMJ A;  4ZTF A;  1U49 A;  1Q9Y A;  3V4I A;  4AHS A;  3ZSZ A;  4EP5 A;  3QES A;  3ULD A;  2A1S A;  3LAN A;  1JLQ A;  3LP2 A;  4CHQ A;  1S1X A;  3DLG A;  4ICL A;  4CER A;  4CF2 A;  3ZT4 A;  2Y1I A;  4KI4 A;  4IFV A;  3K59 A;  1W9H A;  5KTQ A;  4FJH A;  4KRE A;  4N76 A;  4KI6 A;  2BE2 A;  4Y1C A;  1WSF A;  1JLB A;  1ASU A;  3DI6 A;  3V9S A;  3VQ7 A;  3O3G A;  1N6Q A;  5C42 A;  4B8A B;  3AO5 A;  4H4M A;  5J2N A;  4NYN A;  4E7K A;  4HCC A;  1C0M A;  3HPH A;  4OVL A;  4DTJ A;  3LP3 A;  3OYF A;  2HW3 A;  4WE1 A;  1XC9 A;  5C24 A;  3DLE A;  3PO4 A;  1I3A A;  1TAQ A;  2W42 A;  1CXU A;  1EKE A;  4DQS A;  4E0D A;  4FJG A;  2HVH A;  2IAJ A;  4HVJ A;  3VN5 A;  3QLH A;  1HYV A;  4FLZ A;  4ZTJ A;  3RR7 A;  5FRN A;  4DTX A;  5HRS A;  1JLC A;  2FBY A;  2OYQ A;  3V9U A;  1SL1 A;  3NGZ A;  5DK5 A;  4CHY A;  4NCG A;  5JS2 A;  5KRT A;  5CYM A;  4CJW A;  1U48 A;  1KVB A;  1LWF A;  1VSJ A;  1A5X A;  1R0A A;  2WOM A;  3HT3 A;  3KLI A;  2HHW A;  3NH1 A;  1RDD A;  4FLW A;  1SKR A;  4LD0 A;  4Z0U A;  3QER A;  4OGE A;  3QNN A;  1HYZ A;  2WON A;  3TAF A;  3ZSX A;  4H8K A;  3MXM A;  4CED A;  4ZHR A;  3SV3 A;  1X9W A;  3BGR A;  3I0S A;  1HPZ A;  1L5U A;  4ID5 A;  1BI4 B;  3LPU A;  2RN2 A;  2Q3S A;  4BE0 A;  3QNO A;  4FZY A;  4F2R A;  3SQ2 A;  1KSP A;  3NHG A;  1QSL A;  4CK1 A;  1RDB A;  3JYT A;  4HHT A;  3KK1 A;  4W5T A;  2KFN A;  3K57 A;  3OY9 A;  4J2A A;  4M41 A;  2D0B A;  1UAX A;  3T19 A;  3QEI A;  1IKW A;  4OKK A;  5CYQ A;  4RW9 A;  1S1W A;  3ZSQ A;  4CJT A;  4DFM A;  2X74 A;  3QEP A;  4C8L A;  4W5Q A;  3CFO A;  5KGW A;  1RT7 A;  4B9V A;  1RBU A;  4E7I A;  3KLH A;  1NOZ A;  4KV8 A;  3VQ6 A;  4K8Z A;  5J2Q A;  1QHT A;  4R5P A;  2BGG A;  4NYF A;  4HUF A;  4I9L A;  4CF0 A;  3DYA A;  4DSJ A;  4OPK A;  4FJ9 A;  1BCO A;  1JLF A;  4FJK A;  3VQ9 A;  4CFB A;  1WAJ A;  3O4N A;  4C8M A;  2YNI A;  3AVH A;  1BCM A;  3AV9 A;  1RT5 A;  2QKK A;  2KTQ A;  3VQQ A;  4FLY A;  4ELV A;  2G8I A;  2HHS A;  4CFC A;  4FYD A;  2D5R A;  4M3Z A;  1RIL A;  4CJU A;  3K5O A;  3SUP A;  4FJ8 A;  4L8R B;  1CZB A;  3IRX A;  3P83 D;  3VQE A;  3O3F A;  1Y97 A;  1D9F A;  1D5A A;  1NJY A;  3THV A;  3AO1 A;  3DLB A;  4KHN A;  4FZZ A;  4M3T A;  4W5R A;  3IS9 A;  3NFA A;  5FDL A;  4CF1 A;  4PQU A;  4KTZ A;  4BDY A;  3AVF A;  3SCX A;  1RBR A;  4OJR A;  3VQP A;  4G1Q A;  4B08 A;  3U6F A;  4KHU A;  1S1V A;  2XY5 A;  4GMJ B;  1HQE A;  3SZ2 A;  3PV8 A;  2LSN A;  2JLE A;  1JKH A;  1IKX A;  1U04 A;  4CF8 A;  3DRP A;  4JS5 A;  3RR8 A;  2RKI A;  1UWB A;  2KZZ A;  3WNE A;  1RT1 A;  5I42 A;  2FBT A;  2OPS A;  1IKY A;  1BIU A;  3ZT1 A;  3B6P A;  3SUN A;  3RRH A;  4CJ4 A;  3HVR A;  2YKN A;  4M3W A;  1LW0 A;  3ZSV A;  1X1P A;  1S1U A;  4CEE A;  4CJ3 A;  1RT2 A;  3NH2 A;  1RT4 A;  1Z25 A;  3M8R A;  4PY5 A;  3C6U A;  4Z4H A;  4KAZ A;  3DRR A;  1VRU A;  1LAV A;  4NCB A;  4CJE A;  4W5O A;  1VK0 A;  4B9M A;  4CE9 A;  5HRO A;  2I5J A;  4AHR A;  2P1J A;  3PUF A;  3AO3 A;  4O4G A;  3ZT3 A;  1D9D A;  2DY4 A;  2ZQB A;  4DTR A;  2G8K A;  2QXF A;  3OYE A;  3ZSW A;  4Q0B A;  1IH7 A;  3TAP A;  4FZX C;  3H08 A;  3NGY A;  5CZ1 A;  4CHZ A;  3AVI A;  3AVL A;  4JRQ A;  3NF9 A;  4YNQ A;  4FVM A;  4CIF A;  1C1B A;  1JXB A;  2VG6 A;  1TKX A;  3KK2 A;  1HYS A;  4JLH A;  3V81 A;  1KVC A;  3HYF A;  3F73 A;  3NDK A;  3NAE A;  3C6T A;  4Q5V A;  4DSE A;  2VG5 A;  1SL2 A;  3ZT0 A;  1HNI A;  4CJS A;  1BL3 A;  3QIP A;  4CEO A;  3OS0 A;  3OYA A;  3AA2 A;  4CHP A;  4M45 A;  1T05 A;  4DSI A;  3B6O A;  2E6M A;  4FJJ A;  5HRN A;  2DFH A;  3M8P A;  3OYD A;  3I0R A;  4GVM A;  3EYZ A;  4IBN A;  3SQ1 A;  3LP1 A;  4AHV A;  4B8C A;  3V9Z A;  1NJZ A;  4O0I A;  2YV0 X;  3V1Q A;  1RCH A;  1A5W A;  3ZSR A;  2R7Y A;  1T7P A;  1RNH A;  1KTQ A;  1VRT A;  2FBV A;  4CIE A;  3PY8 A;  1EP4 A;  4E89 A;  4AIL C;  4FLU A;  4DFJ A;  1ZYQ A;  4Z4G A;  3AVB A;  4PA1 A;  2XY8 A;  3IG1 A;  1VSF A;  3BDP A;  3NBP A;  1NK0 A;  3DLR A;  1JLG A;  1TVR A;  3L2R A;  2EHG A;  1WNS A;  3CM5 A;  3NF7 A;  4MFB A;  3MEE A;  2IGI A;  4CES A;  4CFA A;  2ITG A;  3AO4 A;  3TAM A;  1W0H A;  2HNY A;  4DU3 A;  2P5G A;  2OZS A;  5KI6 A;  4CGD A;  2HVI A;  4DSL A;  3LZI A;  2IS3 A;  4CJK A;  4FLX A;  1VSH A;  3QEX A;  4HUE A;  4E7J A;  4CHN A;  4I2Q A;  1S9E A;  2Y1J A;  2HMI A;  4CEA A;  3RMB A;  4CEC A;  1IG9 A;  1NK5 A;  3HXM A;  4KTW A;  2HND A;  4IKF A;  3S3M A;  1UA1 A;  4CK2 A;  3ISN C;  1QS4 A;  1YVU A;  2XHB A;  3HO1 A;  3ASM A;  1EX4 A;  2G8V A;  4FJM A;  3KJV A;  3G0Z A;  4DQR A;  1WN7 A;  4H4O A;  1IO2 A;  2E6L A;  4BDZ A;  1ZBL A;  4I2P A;  4FM0 A;  1HNV A;  3VA0 A;  2XY6 A;  3VA3 A;  3JSM A;  3HPO A;  1NK8 A;  1BQN A;  4CJ5 A;  4PWD A;  4LSN A;  3MEC A;  4FJ7 A;  4DTP A;  4CJF A;  5HLF A;  4M3Y A;  3V1R A;  4DU1 A;  3T3F A;  4DS4 A;  5FRO A;  3LWL A;  4F3O A;  2O4G A;  2XY7 A;  1D8Y A;  3AA3 A;  1A5V A;  2KQ2 A;  4CGH A;  4KHY A;  1WSH A;  1TL3 A;  2VWJ A;  1TL1 A;  3KKR A;  2D0C A;  2ZE2 A;  1RDA A;  3SQ4 A;  3OYI A;  1T8E A;  1NKE A;  3KKS A;  3SI6 A;  3DRS A;  1RT6 A;  4EZ9 A;  3QEW A;  1FKP A;  1FXX A;  1QQC A;  3MXJ A;  2BAN A;  4F4K A;  2YNH A;  4BWJ A;  4ELU A;  4M3U A;  4BE1 A;  4O5B A;  4FLT A;  4CEF A;  3EZ5 A;  1NKC A;  1C6V A;  4C8N A;  3L2V A;  4FJ5 A;  3K5L A;  4CJL A;  5SZT A;  1BIZ A;  2X6S A;  4RG8 A;  1VSK A;  1S6Q A;  4CF9 A;  4J2B A;  1RBT A;  3CG7 A;  4Y1D A;  1I39 A;  1ZBU A;  1CZ9 A;  1L3S A;  2HNZ A;  2X78 A;  4DTS A;  4QOZ B;  2HHT A;  1O1W A;  3AO2 A;  3O4Q A;  3OS1 A;  5KGX A;  3OYB A;  2VG7 A;  1QSS A;  1YT3 A;  3LAM A;  4UQG A;  3TAE A;  3WNG A;  3TR8 A;  3TAN A;  5K14 A;  4K8X A;  2ETJ A;  1FKO A;  1RT3 A;  4FXD A;  3RRG A;  3K5N A;  3S3N A;  3OVN A;  3CFP A;  1U4B A;  3SPY A;  4DF4 A;  3SJJ A;  4Z4F A;  1QE1 A;  4DFP A;  1ASV A;  3NGI A;  1KFS A;  3SUQ A;  2G8W A;  3KLE A;  2Z1J A;  2GV9 A;  2GBZ A;  2YHA A;  4GW6 A;  3PX4 A;  4NCA A;  3DM2 A;  4CK3 A;  1NKB A;  4CJP A;  2PY5 A;  4C8O A;  4KPY A;  1XWL A;  2E4L A;  1S1T A;  4CEB A;  1QSY A;  2HHQ A;  4TSX A;  4AHU A;  1KLN A;  2B5J A;  1RTJ A;  4F8R A;  1TK5 A;  4BWM A;  3C95 A;  1ZBF A;  3QIN A;  5C25 A;  4DQQ A;  3OYK A;  5HP1 A;  1XI1 A;  1U45 A;  3LDS A;  3OYH A;  3VQD A;  3VQ8 A;  2Z1H A;  4Z4C A;  4LY7 A;  4BE2 A;  2HHX A;  3S3O A;  1VSD A;  4FM1 A;  3HPG A;  2DFE A;  4Z4E A;  1NK9 A;  3VQB A;  3CQ8 A;  4CJQ A;  4Z4I A;  1HJR A;  3AVJ A;  3U3G A;  3HP6 A;  5J2P A;  1RTH A;  5FRM A;  1TV6 A;  2IDO A;  4EP4 A;  1Q9X A;  2OA8 A;  3LZJ A;  3T1A A;  3ZSO A;  3NCI A;  3V9X A;  2RPI A;  4QAG A;  1S6P A;  1KRP A;  1K6Y A;  4E1N A;  1RBV A;  4OGC A;  3I8D A;  1T03 A;  4OLB A;  3DLK A;  5T7B A;  4KKO A;  3CM6 A;  3HP9 A;  1NJW A;  1UA0 A;  3HVT A;  4FJL A;  3TI0 A;  4AHT A;  3MAQ A;  1WSE A;  4OKJ A;  4CHO A;  3DOK A;  2B4J A;  4ELT A;  4FJX A;  3AVN A;  4KTQ A;  1WSI A;  1L3V A;  4B9N A;  3MED A;  1ITG A;  3FFI A;  4CFD A;  2HHU A;  4IG3 A;  3AA4 A;  1VSI A;  3D0P A;  4KO0 A;  4OKE A;  1BQM A;  1J5O A;  3SV4 A;  2OPQ A;  3CFR A;  1MU2 A;  1F21 A;  2KW4 A;  3SPZ A;  4CCH A;  5JS1 A;  4DQP A;  5J1E A;  2FC0 A;  3L3V A;  4JS4 A;  3SUO A;  3OYN A;  4DQI A;  4O55 A;  4B9T A;  4KB0 A;  3OYG A;  4LH4 A;  4FJN A;  3E01 A;  5KRS A;  2QKB A;  1UOC A;  2XRI A;  2BDP A;  1KFD A;  2D0A A;  3NF6 A;  4YFU A;  1U47 A;  2G8F A;  2ATQ A;  4KHQ A;  1KLM A;  4FK4 A;  2Z1G A;  1S9G A;  4B9L A;  3ZT2 A;  5E41 A;  2O4I A;  3C94 A;  4N47 A;  3QIO A;  1SV5 A;  1NJX A;  4O44 A;  4HTU A;  1ZBH A;  4E7H A;  4OLA A;  2IC3 A;  1DTQ A;  4E19 A;  3KTQ A;  4KRF A;  1C0T A;  4M42 A;  1J54 A;  3TAG A;  2HHV A;  1TKT A;  2DTU A;  3AVC A;  3L2W A;  3AVA A;  4DSF A;  3L8B A;  1L3T A;  4FK2 A;  1SKW A;  4FM2 A;  4F3T A;  3OS2 A;  4B3O A;  1NK4 A;  3ZCM A;  5DMR A;  4DMN A;  4I7F A;  1DLO A;  3SQ0 A;  4FCY A;  3P5J A;  3LAL A;  5SWM A;  3RTV A;  4FLV A;  5I3U A;  3TAR A;  4DFK A;  1C1C A;  4FW1 A;  3P1G A;  4RW8 A;  4AH9 A;  3SNN A;  3A2F A;  4EZ6 A;  4DTU A;  5EU7 A;  2IOC A;  2YHB A;  4LH5 A;  4QCL A;  1NOY A;  1DTT A;  4RW6 A;  4KHW A;  1B9D A;  3K5M A;  4DF8 A;  1CLQ A;  5HRP A;  3DOL A;  1XHZ A;  3OJU A;  4N5S A;  1KCF A;  3KK3 A;  3NF8 A;  3L2U A;  3V9W A;  3LPT A;  1TK0 A;  3HM9 A;  3OYJ A;  4JRP A; 
#chains in the Genus database with same CATH topology
 3MX2 A;  2AJQ A;  3WQT A;  4B9S A;  1S72 N;  1OVY A;  1WLJ A;  1Z26 A;  4B3M K;  3FZF A;  4RTF D;  1CXQ A;  3MN9 A;  4DLG A;  3MXI A;  3FZK A;  4AM6 A;  3RR7 A;  5J2M A;  1WSG A;  2NUB A;  2KFZ A;  1HX1 A;  5AQT A;  1NGD A;  4MLH A;  3RVC A;  4A5A A;  1NK7 A;  3OYL A;  3UIQ A;  2O8C B;  1FK9 A;  3KLG A;  3K9J A;  1X9S A;  1LAW A;  4KB1 A;  3P39 A;  3KD5 E;  3ENB A;  1H1V A;  3RWU A;  2A1R A;  3CHW A;  3H6E A;  4BGB A;  3HST B;  3OYM A;  1ATS A;  5AZI A;  4BC2 A;  4MO5 A;  3WXK A;  4WQ5 A;  2E2N A;  1LWC A;  1QQM A;  1JLA A;  1GLD G;  3QEV A;  1NMD A;  2DFF A;  2HF3 A;  2XO7 A;  3L2Q A;  3OJS A;  2QK9 A;  2YNG A;  1GOA A;  2G8U A;  2ZD1 A;  4DTN A;  2UXD K;  1LW2 A;  4O0J A;  1C0U A;  4OO1 J;  3AVG A;  3BP8 A;  3V1O A;  1IKV A;  1JCG A;  3T1H K;  4EFH A;  1HQU A;  4W5N A;  3CCM N;  4M3R A;  2OZM A;  4KHS A;  2F9T A;  4GKJ K;  3SMP A;  1IV0 A;  4DTO A;  2FBX A;  1GOC A;  3I8B A;  2P9S A;  4WQ4 A;  1RBS A;  4BRL A;  3OA9 A;  3K2P A;  4CGF A;  4ID1 A;  4B9U A;  2PBD A;  2E88 A;  3RMA A;  5AQS A;  4MQ3 A;  3HJF A;  3VF2 A;  1S22 A;  1Q9Y A;  1YIJ N;  4EP5 A;  3ULD A;  5JVG L;  1NBW A;  4KI4 A;  3DLG A;  4CF2 A;  3ZT4 A;  2OTL N;  3K59 A;  4KRE A;  4BRI A;  4Y1C A;  1WSF A;  3DI6 A;  3VF6 A;  2AP1 A;  1KXP A;  4IJN A;  5AZJ B;  3LDN A;  1GLL O;  3AO5 A;  3WEE B;  2P9S B;  4B3S K;  1YUW A;  3LP3 A;  3OYF A;  2HW3 A;  3CXC M;  1I3A A;  1CXU A;  4DQS A;  4E0D A;  2HVH A;  4HVJ A;  3VES A;  3WEE A;  4XH5 A;  1JLC A;  2FBY A;  2NRT A;  2OYQ A;  3V9U A;  5F1X A;  4NCG A;  5JS2 A;  2E1Y A;  3BF1 A;  1KVB A;  4A59 A;  1U2V A;  1VSJ A;  4RWT A;  1R0A A;  2WOM A;  4BRE A;  3HRG A;  3NH1 A;  2Q2R A;  4LD0 A;  1IBK K;  3TAF A;  4JEP A;  4UY8 O;  3CCE N;  3W3D A;  4ZHR A;  3SV3 A;  1D4X A;  5AQR A;  2CGK A;  3CME N;  4ID5 A;  2RN2 A;  3U4L A;  3CCJ N;  3QNO A;  5KQD A;  3U8X A;  3ZET B;  3NHG A;  5BR9 A;  1YJW N;  3KZB A;  3SBT A;  3KK1 A;  4W5T A;  3K57 A;  2ASP A;  3T19 A;  5CYQ A;  4JI8 K;  4JI7 K;  4YDU C;  3QEP A;  4B9V A;  3JS6 A;  3O80 A;  1NOZ A;  3ENO A;  4EIA A;  4K8Z A;  4JK8 A;  4NYF A;  4HUF A;  5GIN A;  4DSJ A;  4FJ9 A;  5AQF A;  4BG8 A;  4GV6 A;  4J8F A;  3AVH A;  3MDQ A;  3AV9 A;  4XH4 A;  4K0K K;  2G8I A;  5E26 A;  3SUP A;  2FSN A;  2F7T A;  1IBM K;  2QM1 A;  2HBJ A;  1T6C A;  4KHN A;  4FZZ A;  5AQJ A;  4BR0 A;  5F2R A;  1RBR A;  3VQP A;  5KQ8 A;  3PV8 A;  3SZ2 A;  4WYB A;  3CF5 L;  3AAR A;  4FVU A;  3ATU A;  2RKI A;  3SJH A;  2KZZ A;  1C0G A;  1VQ6 N;  4B3R K;  2FBT A;  4FO0 A;  3SUN A;  1X1P A;  1YXQ A;  1RT4 A;  4DV7 K;  1VRU A;  1LAV A;  4CJE A;  4DV5 K;  1VK0 A;  5BR8 K;  3OHR A;  4H5R A;  4X64 K;  2P1J A;  4EHT A;  3QB0 A;  1RFQ A;  3OYE A;  2HOE A;  3MMV A;  4H0P A;  4FZX C;  2D0P A;  4GV9 A;  5CZ1 A;  3ENH A;  4EHU A;  3NF9 A;  1C1B A;  1TKX A;  1E4G T;  1HYS A;  4JLH A;  2ZWH A;  5BRD A;  3HYF A;  3NAE A;  1TUY A;  2Q0U A;  4DSE A;  4A57 A;  1SL2 A;  4IOA L;  1NG9 A;  1BL3 A;  4CEO A;  2HHH K;  3AA2 A;  2KKZ A;  1Q7Y O;  5CHI A;  4FJJ A;  3M8P A;  5HOO A;  4B1V A;  4H0V B;  3D2F B;  1RCH A;  1A5W A;  4O8K A;  1QVF M;  5IT9 O;  2FBV A;  4CIE A;  2RHK A;  1LOT B;  1N8R O;  3AVB A;  4JKB A;  1HKG A;  2IVN A;  2NZT A;  2O8E A;  3L2R A;  2EHG A;  3RSE A;  3VEY A;  5E84 A;  1NMN A;  4CFA A;  3OYC A;  2VGM A;  1W0H A;  4IO8 A;  2OZS A;  3O9U A;  4CJK A;  4HUE A;  4E7J A;  4CEC A;  2QWP A;  4CK2 A;  5AQW A;  3WT0 A;  1QS4 A;  3CCQ N;  2XHB A;  3G25 A;  4DV4 K;  4FJM A;  3MN7 A;  2WBN A;  3Q7B A;  3O8M A;  4H4O A;  2E6L A;  2GEM A;  4FM0 A;  4X65 K;  4CJ5 A;  4JK7 A;  4CJF A;  4DU1 A;  4DS4 A;  2KQ2 A;  2VWJ A;  5GAD P;  3KKR A;  1YIT N;  1NKE A;  4JI5 K;  3DRS A;  1X9J A;  1RT6 A;  2FF3 B;  1FKP A;  3MXJ A;  3CI5 A;  4JKH A;  4DV1 K;  3MCP A;  4O5B A;  4CEF A;  1NKC A;  1C6V A;  3UE5 A;  1GLF O;  4CJL A;  2P9N A;  2X6S A;  3VEO A;  4CF9 A;  4JNE A;  4PKI A;  1ZBU A;  1NWK A;  2X78 A;  1O1W A;  5JVH L;  3AO2 A;  3OS1 A;  3C65 A;  4JI0 K;  4ISF A;  3TAE A;  5FPD A;  1RT3 A;  3S3N A;  4B1Z A;  4XEI A;  4DF4 A;  1QE1 A;  2IVP A;  1ASV A;  3NGI A;  3E9P A;  3CCV N;  4CJP A;  2E2Q A;  2E4L A;  4TSX A;  4AHU A;  1KLN A;  1RTJ A;  4CZK A;  3C95 A;  3N4P A;  1ILY A;  1QZ5 A;  4JV5 K;  4DKW A;  5BPL A;  4Z4C A;  4BE2 A;  4FPB A;  3IKM A;  3HPG A;  2DFE A;  2O8D A;  3VQB A;  4CZH A;  2GWJ A;  1HJR A;  3OBY A;  3GE1 A;  1ZC6 A;  5M1Q A;  1U2V B;  5J2P A;  4FSV A;  3T1A A;  4QAG A;  1K6Y A;  1T6D A;  1T03 A;  5T7B A;  4CZM A;  1KAX A;  3CMA N;  2ASM A;  1UA0 A;  3HVT A;  4FJL A;  4AHT A;  4FJX A;  4OKJ A;  1BWF O;  3G4S N;  3K0S A;  5GAE P;  5AQX A;  4B9N A;  4DR2 K;  2HHU A;  4IG3 A;  2VGN A;  4WQ4 C;  3KK7 A;  3L0Q A;  1F21 A;  4CCH A;  5JS1 A;  3THW A;  5C15 A;  3THY A;  4JS4 A;  4C23 A;  4O55 A;  4B9T A;  4GKK K;  3OYG A;  2QWR A;  5KRS A;  3QIC A;  1KAZ A;  2JWK A;  1VQO N;  2XRI A;  2BDP A;  1KFD A;  4A2A A;  2QWQ A;  1EWQ A;  1YHQ N;  2Z1G A;  3UB5 A;  1S9G A;  2UUC K;  5E41 A;  4DUZ K;  4B9L A;  2O4I A;  3VEZ A;  3QIO A;  1SV5 A;  4O44 A;  5EVZ A;  2W6K A;  2NRR A;  5BPM A;  2QEX N;  1J54 A;  1TKT A;  3H1V X;  1Q81 O;  4F3T A;  1SKW A;  4FM2 A;  3LM2 A;  1IG8 A;  4DMN A;  3SQ0 A;  4FCY A;  3P5J A;  1DT9 A;  2IOC A;  2E5L K;  4H0X B;  4RW6 A;  4KHW A;  2NNW A;  2UXC K;  5HRP A;  5JLH A;  4DR5 K;  3H45 C;  3OJU A;  4JK9 A;  4N5S A;  1WBD A;  3KK3 A;  5MLC Q;  1GLE G;  5DM6 L;  3HM9 A;  1TK0 A;  4DQR A;  3LDQ A;  1EET A;  4J2D A;  3SLC A;  4FWN A;  3F9M A;  2OCE A;  2F4V K;  2BUP A;  3TSP A;  3TAQ A;  1V4T A;  4CEQ A;  2P51 A;  2H3G X;  1HNW K;  4CVN E;  1SKS A;  3VQC A;  3AVK A;  3J80 O;  4NO7 A;  3M5R A;  4DR4 K;  2V51 B;  5AQK A;  3NE6 A;  5HBM A;  5AFU A;  4KFB A;  2QW9 A;  4LSL A;  1EXQ A;  2UUA K;  3TSU A;  1LV5 A;  1P8Z A;  1SL0 A;  1RDC A;  3CER A;  4DLE A;  3QML A;  4AHC A;  5C12 A;  2D4W A;  4IG0 A;  3AAP A;  3PO5 A;  4I9Q A;  2YX6 A;  1LWE A;  4N41 A;  1YTA A;  4CGJ A;  1L3U A;  2YHX A;  3C6H A;  1S3X A;  1RTI A;  4H0T B;  1S5J A;  4RW4 A;  3EY1 A;  4M3X A;  3VQ5 A;  5LMU K;  4J2E A;  3V6D A;  3J8A A;  3CC4 N;  2WUS A;  3L3U A;  4FW2 A;  3PX6 A;  2E1Z A;  2YNF A;  1JCF A;  3O6W A;  3ULE B;  3DXM B;  3KIO A;  3PX0 A;  3CJA A;  1M1K O;  3K58 A;  3VQA A;  1TGO A;  1YJN N;  5CZ2 A;  1XHX A;  1G15 A;  4C1N I;  1C1A A;  3O4W A;  4DS5 A;  4KHQ A;  3TWH A;  1J9A A;  3LAK A;  3U3Y A;  5CY4 A;  2OPR A;  2P9I B;  4YY3 K;  4HCB A;  3ZLJ A;  2JGU A;  4CGG A;  3WQU A;  1WSJ A;  4IEE A;  4ZTF A;  3V4I A;  3ZSZ A;  4GNI A;  4JN4 A;  2A1S A;  3HSC A;  3LAN A;  3LP2 A;  4EAH D;  1NGJ A;  2Y1I A;  2YI1 A;  4IFV A;  1W9H A;  4WCE L;  5M1F A;  2BE2 A;  2O8F B;  1JLB A;  3VQ7 A;  4H4M A;  3HPH A;  5FPN A;  1XC9 A;  1MWK A;  2W42 A;  2V52 B;  5AZJ A;  1EKE A;  4X66 K;  3GG4 A;  4FLZ A;  3VF4 A;  4R79 A;  5FRN A;  4DTX A;  5DK5 A;  5AQV A;  1U48 A;  5CYM A;  1IJJ A;  1LWF A;  3A0I X;  1GLA G;  3KLI A;  2HHW A;  1RDD A;  4KH4 A;  1SKR A;  2O8D B;  4Z0U A;  1N32 K;  4BQL A;  3MXM A;  4K42 A;  4H8K A;  2QWL A;  1X9W A;  4LFA K;  3IFR A;  3LPU A;  4FZY A;  2P9L B;  1QSL A;  4CK1 A;  1RDB A;  1QQO A;  3QDK A;  3JYT A;  5GIO A;  1UAX A;  3SAH A;  3QEI A;  4OKK A;  4CJT A;  3C7N B;  4C8L A;  5KGW A;  1HPM A;  4E7I A;  3KVG A;  3VQ6 A;  2ASO A;  2BGG A;  3TPQ A;  3DYA A;  3ATV A;  3E66 A;  3IUC A;  1JLF A;  2QWN A;  2A42 A;  2IVO A;  3FFK B;  1VHX A;  2QKK A;  3VQQ A;  2WTU A;  3ZEU A;  1VQ7 N;  3J7Y P;  2VCP A;  2VQF K;  2D5R A;  5TKY A;  1CZB A;  3IRX A;  3P83 D;  4GY2 B;  4IJA A;  4FWK A;  1D9F A;  3THV A;  1T3V A;  3H1Q A;  3IS9 A;  4CF1 A;  4OJR A;  4G1Q A;  4B08 A;  1VQP N;  3VOV A;  3MWP A;  3NMU A;  1IKX A;  4DR6 K;  3ID8 A;  3LDP A;  3WXI A;  1UWB A;  4IEI A;  5JMV A;  1VQ9 N;  3E9O A;  3B6P A;  5C0Y A;  3WXM B;  3TTF A;  3O9T A;  3RRH A;  4YOR A;  3HVR A;  3CCL N;  1LW0 A;  1S1U A;  3M1F A;  1G99 A;  1Z25 A;  4PY5 A;  4FWR A;  4KAZ A;  4CJ7 A;  4NCB A;  4CE9 A;  5HRO A;  2HMP A;  4AHR A;  3ZT3 A;  2P9N B;  4CZL A;  2G8K A;  1NM1 A;  3ZSW A;  3TAP A;  3H08 A;  2FSJ A;  4JKG A;  4CHZ A;  2NRZ A;  3T69 A;  4CIF A;  2QXL A;  3C6T A;  4Q5V A;  3CCS N;  1DEJ A;  5AQN A;  1HNI A;  4CJS A;  4M45 A;  1NGF A;  4YHH K;  4DSI A;  3B6O A;  5HRN A;  4YDU A;  3OYD A;  1V4S A;  3LP1 A;  4HTL A;  3V9Z A;  1SZ2 A;  2YV0 X;  1C0F A;  1RNH A;  4JKE A;  1VRT A;  2VWB A;  3G6E N;  4FLU A;  4DFJ A;  2AA4 A;  2ZGZ A;  4JKD A;  2XY8 A;  1YI2 N;  3BDP A;  1JLG A;  1TVR A;  3R9P A;  3PIO L;  3O9R A;  3DXK A;  3CM5 A;  3NF7 A;  3DAW A;  3IAY A;  2P5G A;  3TAM A;  2HNY A;  4A5B A;  3LZI A;  1MDU B;  1VSH A;  4FLX A;  1NLV A;  2BTF A;  4A2B A;  2HMI A;  5AQI A;  4CEA A;  4CZE A;  4LFB K;  3EE9 A;  2Q1N A;  1YVU A;  1MA9 B;  1EO1 A;  3HO1 A;  3EZW A;  3FR0 A;  5CE3 A;  1NGE A;  3KJV A;  5LJW A;  1Q82 O;  4LF4 K;  3VA0 A;  4MDB A;  3HPO A;  3TSQ A;  1BQN A;  3HBT A;  2YHW A;  4I6M A;  3LWL A;  2O4G A;  1WSH A;  3SQ4 A;  3SI6 A;  4EZ9 A;  5FLX O;  1QQC A;  4F4K A;  4IOC L;  4M3U A;  4BE1 A;  5LL6 Z;  3TTC A;  4AF1 A;  3F5T A;  3K5L A;  3EEQ A;  3P4I A;  4NLB A;  5EX5 A;  1NGH A;  1IBL K;  5DM7 L;  4J2B A;  1W97 L;  4Y1D A;  1I39 A;  2ZM6 K;  1CZ9 A;  4QOZ B;  3NVM A;  3OYB A;  4UQG A;  3TAN A;  5H1S Q;  1OVQ A;  1VAZ A;  4NLC A;  1FKO A;  4FXD A;  3VER A;  5GAG P;  2EWS A;  3OVN A;  4DFP A;  1VQ4 N;  1KFS A;  4JAX A;  2UYT A;  3LDO A;  3SUQ A;  1QQN A;  3T7Z A;  2GV9 A;  2GBZ A;  1VQ5 N;  4GW6 A;  2GX9 A;  4O8U A;  1NGA A;  4NCA A;  3DM2 A;  1NKB A;  2PY5 A;  1S1T A;  1HKB A;  2B5J A;  3ZX2 A;  4BWM A;  3QIN A;  3OYK A;  1XI1 A;  1U45 A;  4BRQ A;  3VQD A;  3VQ8 A;  4LY7 A;  3CCU N;  3S3O A;  2FXU A;  1VSD A;  4Z94 A;  1NK9 A;  4Z4I A;  4KH6 A;  4CJQ A;  4JI3 K;  4A61 A;  2P9P A;  4EP4 A;  1OH7 A;  1X3N A;  3LZJ A;  3P31 A;  4BRK A;  3ZSO A;  2Q36 A;  1KRP A;  4E1N A;  1RBV A;  3I8D A;  4JYA K;  4KKO A;  1NJW A;  3O1W A;  1WSE A;  3DOK A;  2B4J A;  2DPN A;  1K8A O;  1WSI A;  1ITG A;  4CFD A;  2NRW A;  1VSI A;  3D0P A;  1BQM A;  3SV4 A;  2OPQ A;  1MU2 A;  3SPZ A;  2FC0 A;  3QBW A;  3J81 O;  3L3V A;  3OYN A;  5KPR A;  3L6Q A;  4CZF A;  2Q97 A;  2D0A A;  3NF6 A;  1EWR A;  1U47 A;  4FK4 A;  3BZC A;  5AQU A;  4N47 A;  3MWT A;  3CIP A;  1ZBH A;  1XQS C;  4BRO A;  3FE1 A;  4B9Q A;  3VEX A;  4E7H A;  2IC3 A;  3E1Y A;  1DTQ A;  3DJC A;  1C0T A;  3THX A;  3LL3 A;  3L2W A;  3CJ1 A;  4DSF A;  3D2F A;  5AQY A;  4BC5 A;  3OS2 A;  3PIP L;  4JHD B;  4IOX A;  4I7F A;  3LAL A;  4DFK A;  4FW1 A;  4RW8 A;  3SNN A;  1HJO A;  1I94 K;  2YHB A;  4QCL A;  1NOY A;  1CLQ A;  4DF8 A;  5LJV A;  5KPZ A;  3L2U A;  3V9W A;  1BDG A;  2P9K A;  1TUU A;  1YTU A;  1VSE A;  2KZM A;  4OX9 K;  4MO4 A;  3G10 A;  3S9H A;  1TK8 A;  4LF6 K;  4H0O A;  4FK0 A;  2P9I A;  3EKU A;  3LP0 A;  4DU4 A;  1NK6 A;  4N56 A;  1TKD A;  2E2O A;  3J7A P;  4H5T A;  4Y0W A;  4DR3 K;  1GOB A;  3WNH A;  4E7L A;  1Q8I A;  1N34 K;  2UXB K;  1RGI A;  1TKZ A;  3FZL A;  2JWL A;  1JXE A;  4JKF A;  2YHY A;  2PYJ A;  3KD1 E;  1JLE A;  3FZM A;  2RF2 A;  3KLF A;  1B9F A;  3VPZ A;  3H3O B;  1VSL A;  3FZH A;  4QS9 A;  5ADX H;  1HMV A;  2B6A A;  1KAY A;  4BC4 A;  1BI4 A;  2CGJ A;  2X6N A;  2P9L A;  3CC7 N;  4LC9 B;  3HL8 A;  4BDP A;  4E1M A;  2ZGY A;  1HLU A;  2OPP A;  2YCH A;  1ZBI A;  3LWM A;  4BY9 C;  3L4I A;  1QZ6 A;  3CYM A;  1SUQ A;  4WQ5 C;  1KVA A;  1YJ9 N;  4DSK A;  3AA5 X;  3QO9 A;  4CJR A;  1EQY A;  3SYZ A;  5I9E B;  3WNF A;  2BH1 A;  3ZX0 A;  3ALY A;  4L3Q A;  2W40 A;  1JL2 A;  1YAG A;  1VQ8 N;  2Z1I A;  1K9M O;  3RMC A;  4H0Y B;  1KQS M;  3RMD A;  1X9M A;  4XIU A;  4CD1 A;  3F9K A;  1XC3 A;  5AR0 A;  3UKU B;  1BGX T;  4RW7 A;  4BAC A;  1B92 A;  1JL1 A;  5M1P A;  1RTD A;  4CJV A;  4JKC A;  5BRE A;  2GEL A;  4FL9 A;  4CGI A;  1W2B M;  4FJI A;  5ELZ A;  1U49 A;  3SK3 A;  1Y64 A;  4CHQ A;  1S1X A;  2UU9 K;  1O13 A;  5KTQ A;  1E4F T;  3V9S A;  5LY3 A;  3O3G A;  5J2N A;  1SQK A;  4NYN A;  5A2Q O;  4HCC A;  4OVL A;  3CET A;  5C24 A;  3DLE A;  3THX B;  3AGK A;  4FJG A;  2IAJ A;  3VN5 A;  3QLH A;  1HYV A;  5AQQ A;  4CHY A;  4CJW A;  1DKG D;  2CH6 A;  1XUP O;  3DXM A;  2WON A;  4PKH A;  3ZSX A;  4JI2 K;  2O8B B;  5M1N A;  1KC8 O;  3U9D A;  1P90 A;  3J7Z O;  1HPZ A;  3THW B;  1NGG A;  3CPW M;  4BE0 A;  4F2R A;  3EE8 A;  4HHT A;  1VQM N;  2KFN A;  3M6G A;  4J2A A;  4KH5 A;  4M41 A;  4RW9 A;  3ZSQ A;  1RBU A;  3KLH A;  1R59 O;  5J2Q A;  4R5P A;  1CZA N;  4CW7 B;  4ILG B;  4I9L A;  4WFN L;  2E2P A;  2A6A A;  4OPK A;  1BCO A;  4FJK A;  1WAJ A;  3O4N A;  2I7N A;  1BCM A;  4JKG B;  4ELV A;  4CFC A;  4O5F A;  2VYP A;  4FJ8 A;  5ADX A;  3O3F A;  2FF6 A;  1D5A A;  3AO1 A;  5FPM A;  4CI6 A;  1NU0 A;  2FSK A;  4BDY A;  3SCX A;  3U6F A;  2XY5 A;  2LSN A;  4DV0 K;  3R6M A;  1Z6R A;  2A40 A;  5C2F A;  1U04 A;  2PAV A;  4CF8 A;  4JS5 A;  4BGA A;  1RT1 A;  2OPS A;  1IKY A;  1BIU A;  3ZT1 A;  3CJ7 A;  3SAG A;  3MN6 A;  3OBW A;  2YKN A;  4X62 K;  3ZSV A;  4G9Z A;  4CJ3 A;  1RT2 A;  3NH2 A;  2V7Y A;  3M8R A;  3C6U A;  2GWK A;  4B1X B;  2I5J A;  3PUF A;  3AO3 A;  4O4G A;  2DY4 A;  3SAF A;  2ZQB A;  1OH5 A;  1XMO K;  4BR9 A;  1J5E K;  2GTD A;  4JI4 K;  4YOX A;  2QXF A;  4C1N K;  2FLO A;  3NGY A;  4BRG A;  3AVL A;  4JRQ A;  3N4Q A;  2P9U B;  1ZXO A;  1JXB A;  3KK2 A;  4IFE A;  1WBB A;  1KVC A;  3F73 A;  3Q7C A;  3BEX A;  4H5W A;  1N36 K;  3ZT0 A;  3OS0 A;  4F9O A;  5AQL A;  5AQP A;  2E6M A;  2DFH A;  3I0R A;  1NJZ A;  4IBN A;  4AHV A;  1T7P A;  2R7Y A;  3V1Q A;  3ZSR A;  3PY8 A;  1BU6 O;  1BOT O;  4E89 A;  4AIL C;  1ZYQ A;  3VGL A;  3IG1 A;  2KLA A;  5C2D A;  3DLR A;  1TYQ A;  2GUP A;  4FWL A;  3KWG A;  4MFB A;  3O9Q A;  3MEE A;  4CES A;  2ITG A;  5KI6 A;  4B1W B;  4CGD A;  3A5L C;  4CHN A;  1JJ2 M;  3RSE B;  2CGL A;  3RMB A;  1IG9 A;  1NK5 A;  4KTW A;  3S3M A;  1UA1 A;  3ISN C;  1OH6 A;  3ASM A;  5FPE A;  5M1K A;  2G8V A;  4CBU A;  2QWO A;  3G0Z A;  1WN7 A;  1DGK N;  2CH5 A;  4BDZ A;  1ZBL A;  2XY6 A;  4BR7 A;  2QWM A;  4LSN A;  3GL1 A;  4FJ7 A;  5F0X A;  3T3F A;  5FRO A;  1GLB G;  1RDU A;  4B1U B;  3BUZ B;  4F3O A;  2XY7 A;  3AA3 A;  2E8A A;  4CGH A;  2NLX A;  4KHY A;  4AM7 A;  3EL2 A;  1TL1 A;  4V19 S;  2ZE2 A;  1RDA A;  3VMF B;  3OYI A;  3FGU A;  3AGR A;  1FXX A;  2YNH A;  4BWJ A;  4U67 L;  3EZ5 A;  4C8N A;  4FWS A;  3E9L A;  1HNX K;  5SZT A;  1BIZ A;  2Q31 A;  4RG8 A;  1RBT A;  3I55 N;  2HBK A;  1L3S A;  2HNZ A;  3UKR A;  1N33 K;  4DTS A;  2HHT A;  2F9W A;  4DR7 K;  3GBT A;  5KGX A;  3R8E A;  2VG7 A;  5AZI B;  3LAM A;  5AQO A;  1GLJ O;  3K5N A;  3I56 N;  3R1X A;  3W0L A;  1U4B A;  4Z4F A;  2G8W A;  2Z1J A;  3EO3 A;  3AY9 A;  3PX4 A;  3JXU A;  4DUY K;  4C8O A;  1XWL A;  3U9Z A;  2HHQ A;  4CEB A;  1Q86 O;  1TK5 A;  5C25 A;  4DQQ A;  4JI6 K;  1OKJ A;  2HBM A;  3LDS A;  4YOY A;  3CPE A;  3OYH A;  2Z1H A;  3VTI A;  2HHX A;  4FM1 A;  4Z4E A;  3FLC O;  2UUB K;  3PSF A;  5FRM A;  2IDO A;  1MWM A;  3VGM A;  1S6P A;  3CQX A;  4OGC A;  4OLB A;  3DLK A;  2I7P A;  4LF9 K;  3HP9 A;  4YOT A;  1ZBS A;  3TI0 A;  4ELT A;  3MAQ A;  3MX5 A;  4CHO A;  3AVN A;  1XNQ K;  1L3V A;  2HST A;  4CZI A;  4OKE A;  1J5O A;  4IDH A;  3CQY A;  2KW4 A;  3CFR A;  4BR5 A;  3QBX A;  5J1E A;  4DCH A;  3O5B A;  4LH4 A;  4H03 B;  2G8F A;  2ATQ A;  1KLM A;  1NJX A;  3GDQ A;  4HTU A;  3KTQ A;  4KRF A;  4M42 A;  3TAG A;  1ESV A;  3AVC A;  3L8B A;  1L3T A;  4FK2 A;  4IXC A;  3ID6 A;  1E3M A;  4B3O A;  3VTH A;  3LDL A;  5SWM A;  3RTV A;  5I3U A;  4FLV A;  2HF4 A;  1C1C A;  4AH9 A;  3P1G A;  4BRP A;  2ZF5 O;  3A2F A;  4FOI A;  4DTU A;  5EU7 A;  4LH5 A;  1DTT A;  1B9D A;  3K5M A;  3DOL A;  1XHZ A;  5CR4 A;  4KBO A;  3OYJ A;  4JRP A;  2P5O A;  1BHL A;  1REV A;  4HUG A;  3T1Y K;  3D45 A;  4C8K A;  3HTV A;  3DLH A;  3O9S A;  4DV6 K;  4YOV A;  4F2S A;  3O3H A;  1M90 O;  5D3G A;  4DR1 K;  4LF7 K;  1HRH A;  3ZEU B;  1RDW X;  3AVM A;  4DV3 K;  3D2E A;  4CEZ A;  5BRH A;  4CD3 A;  1BO5 O;  4B1Y B;  2PYL A;  3M8S A;  2P9P B;  1N5Y A;  4MDA A;  5B8H A;  1TAU A;  3ULE A;  2GUI A;  3ZSY A;  4B3T K;  1VQN N;  2O8C A;  3JAM O;  4FWP A;  4IFY A;  4U7B A;  1ASW A;  1NGC A;  2A41 A;  1NJI O;  1HNZ K;  1VSM A;  2EX3 A;  2VWK A;  2D1K A;  2ZJQ L;  3ZET A;  1WAF A;  4YOU A;  3L4Q A;  2G8H A;  3K9K A;  3VQ4 A;  5HRR A;  3NH0 A;  1J53 A;  3HI0 A;  3MEG A;  4BRM A;  2ITM A;  2F96 A;  3HZ6 A;  1HR0 K;  1LCU A;  4CZG A;  1WB9 A;  3A8Y A;  2F8T A;  5M1O A;  4I6M B;  4CIG A;  2YKM A;  1W7A A;  2F8S A;  3LM9 A;  4DG1 A;  3TAB A;  3UKR B;  1BA1 A;  3DWL A;  2HB5 A;  3D2E B;  4IDK A;  1HUX A;  3ITH A;  1FJG K;  2W41 A;  3M3Z A;  4JHD A;  4GV3 A;  1QTM A;  4E3S A;  3M8Q A;  3PLA A;  4AQY K;  4OPJ A;  4BRH A;  4IO9 L;  4PUO A;  2O8B A;  3QFU A;  3A5N C;  4DTM A;  4DWI A;  4HWI A;  1SS6 A;  2PZS A;  3QET A;  3ZX3 A;  3HK2 A;  1BIS A;  3DMJ A;  2ZJP L;  4KHP K;  4AHS A;  2YJF A;  3QES A;  3WXL A;  3DXK B;  1JLQ A;  1YF5 L;  3C0B A;  4CER A;  4ICL A;  2P9U A;  4FJH A;  4N76 A;  4KI6 A;  4ISG A;  1ASU A;  1N6Q A;  4LFC K;  3MK6 A;  5C42 A;  4B8A B;  3F2K A;  4QS7 A;  4E7K A;  3KWI A;  1C0M A;  3O08 A;  3VEN A;  4DTJ A;  1J6Z A;  4WE1 A;  2NRX A;  3GOI A;  4OPA A;  3PO4 A;  1TAQ A;  1ATR A;  4LF8 K;  4ZTJ A;  5HRS A;  4FPA A;  5AQM A;  4FOE A;  1SL1 A;  3NGZ A;  3P38 A;  5KRT A;  5EOY A;  3HM8 A;  1A5X A;  2NRV A;  3HT3 A;  3IDH A;  4FLW A;  3QER A;  4OGE A;  3WUH A;  1HYZ A;  3QNN A;  4CED A;  4CBX A;  2V7Z A;  3BGR A;  3I0S A;  1L5U A;  1BI4 B;  4M7X A;  2Q3S A;  1XNR K;  4BQZ A;  1VQL N;  3SQ2 A;  4DQ8 A;  1KSP A;  3UKU A;  4GVE A;  1NGI A;  3OY9 A;  4JD2 B;  2D0B A;  4MLE A;  3CJC A;  1Z05 A;  1IKW A;  4K41 A;  4PHT X;  1S1W A;  4A62 A;  1K8K B;  4JKA A;  4DFM A;  2X74 A;  4W5Q A;  3CFO A;  2ZJR L;  1RT7 A;  1BG3 A;  2E20 A;  4KV8 A;  1QHT A;  4H5N A;  4CF0 A;  2WFB A;  4E1J A;  3OW2 M;  3VQ9 A;  4CFB A;  4C8M A;  2YNI A;  5AQG A;  2KTQ A;  2QI2 A;  1RT5 A;  4FLY A;  3HOS A;  2HHS A;  3I33 A;  4CBW A;  4IZ9 A;  3CJB A;  4FYD A;  4M3Z A;  1RIL A;  4CJU A;  3K5O A;  3KHY A;  4L8R B;  3VQE A;  5BN8 A;  1Y97 A;  1NJY A;  3DLB A;  1QHA A;  1JCE A;  4M3T A;  4PKG A;  3NVK A;  4W5R A;  3NFA A;  4PQU A;  5FDL A;  4KTZ A;  2P9K B;  3AVF A;  4BVO A;  3EKS A;  1S1V A;  4KHU A;  4GMJ B;  1HQE A;  3DLL L;  2JLE A;  1JKH A;  2PFU A;  3DRP A;  3RR8 A;  3WNE A;  5I42 A;  4BRF A;  2OTJ N;  1Q18 A;  4FWO A;  4M3W A;  4CJ4 A;  4QS8 A;  4CEE A;  1K8K A;  4Z4H A;  5BRF A;  3DRR A;  1SAZ A;  4W5O A;  4B9M A;  1D9D A;  1YVN A;  2QTD A;  4DB3 A;  5KPT A;  4DTR A;  4BR2 A;  4M7Y A;  4Q0B A;  1IH7 A;  5GIP A;  4ISE A;  3AVI A;  4BG9 A;  3A5M C;  4YNQ A;  4FVM A;  2VG6 A;  3R3L A;  4ILJ A;  3V81 A;  1TYQ B;  3NDK A;  3THY B;  2D0O A;  5IWA K;  2VG5 A;  4H5V A;  3QIP A;  2OAN A;  3TU5 A;  3MCA B;  4FWQ A;  3SMS A;  3OYA A;  1T05 A;  4CHP A;  2A3Z A;  3B8A X;  5BPN A;  4IWV A;  4GVM A;  1HKC A;  3EYZ A;  4OPH A;  3AAQ A;  3SQ1 A;  4B8C A;  3BZK A;  4K25 A;  4O0I A;  1GLC G;  2HBL A;  1KTQ A;  2KHO A;  1EP4 A;  5C10 A;  4Z4G A;  4PA1 A;  4JI1 K;  1VSF A;  3NBP A;  1NK0 A;  2WC9 A;  3CCR N;  3CC2 N;  3BF3 A;  4WFA L;  3VEV A;  1WNS A;  2IGI A;  4DU3 A;  3AO4 A;  1T44 A;  2O8E B;  2HVI A;  4DSL A;  2IS3 A;  2Y1J A;  3QEX A;  4I2Q A;  1S9E A;  4NXN K;  3HXM A;  4BRC A;  2HND A;  3WXJ A;  4IKF A;  3PSI A;  1EX4 A;  4XH1 A;  4BRA A;  3CJ9 A;  1IO2 A;  4I2P A;  1HNV A;  3VA3 A;  3JSM A;  1BA0 A;  4K43 A;  1NK8 A;  4PWD A;  3MEC A;  4DTP A;  5HLF A;  4M3Y A;  3V1R A;  2QA4 N;  1D8Y A;  1A5V A;  1TL3 A;  2D0C A;  3TTD A;  1T8E A;  3KKS A;  1KD1 O;  4YOW A;  3QEW A;  4WFB L;  2BAN A;  4BRD A;  4ELU A;  5HL7 L;  5AQZ A;  4FLT A;  3L2V A;  4BR4 A;  4FJ5 A;  5EY4 A;  3S41 A;  1U6Z A;  1VSK A;  1S6Q A;  3CG7 A;  1NNE A;  3OTO K;  3O4Q A;  1QVG M;  3A5O C;  1QSS A;  1YT3 A;  1OH8 A;  3WNG A;  3TR8 A;  2J4R A;  5K14 A;  4K8X A;  2ETJ A;  3RRG A;  1XMQ K;  3CFP A;  4BC3 A;  4FWM A;  5JIC A;  3SPY A;  3SJJ A;  1ATN A;  1VQK N;  3QFP A;  4JD2 A;  3KLE A;  2YHA A;  4CK3 A;  4KPY A;  2A5X A;  1QSY A;  2Q0R A;  4F8R A;  5LMN K;  1ZBF A;  5HP1 A;  3EN9 A;  3HOT A;  2O8F A;  2VQE K;  3CQ8 A;  3ZYY X;  3AVJ A;  5GAH P;  3U3G A;  5JLF A;  3HP6 A;  1RTH A;  3C6A A;  1TV6 A;  3G71 N;  1Q9X A;  2OA8 A;  3H46 O;  1K73 O;  3NCI A;  3V9X A;  2RPI A;  2RE2 A;  4NXM K;  3D6R A;  3VET A;  2IIR A;  2NRH A;  5EXW A;  3CM6 A;  3SBG A;  4KTQ A;  3CD6 N;  3MED A;  3FFI A;  3AA4 A;  4KO0 A;  4RCH A;  4DQP A;  1WUA A;  3VGK A;  3BY5 A;  4CZJ A;  3SUO A;  4DQI A;  4KB0 A;  4FJN A;  3E01 A;  4BRN A;  2QKB A;  1UOC A;  5AQH A;  3H3N O;  4YFU A;  4BVP A;  1NGB A;  1X3M A;  3C7N A;  3ZT2 A;  2W6L A;  3C94 A;  5BN9 A;  5TKW A;  4OLA A;  4PL8 A;  4E19 A;  3IMX A;  4PL7 A;  4M63 C;  2DTU A;  2HHV A;  5AJ3 K;  3AVA A;  4ILH A;  1FW6 A;  4DHY A;  1NK4 A;  3ZCM A;  5DMR A;  3D7E O;  1DLO A;  4DV2 K;  3O1B A;  4NB4 A;  1WOQ A;  3MN5 A;  4WF9 L;  3TAR A;  4EZ6 A;  5AFU H;  1BUP A;  3VEW A;  2YJE A;  1KCF A;  3NF8 A;  4LF5 K;  3LPT A; 
#chains in the Genus database with same CATH homology
 2P5O A;  1VSE A;  2KZM A;  1BHL A;  1REV A;  1EET A;  4J2D A;  4HUG A;  2AJQ A;  3D45 A;  4C8K A;  3G10 A;  4B9S A;  3DLH A;  3S9H A;  1TK8 A;  1WLJ A;  1Z26 A;  1CXQ A;  4F2S A;  3O3H A;  3TAQ A;  4FK0 A;  4DLG A;  3MXI A;  5D3G A;  3LP0 A;  4CEQ A;  1HRH A;  2P51 A;  3OYC A;  4DU4 A;  1NK6 A;  4N56 A;  1TKD A;  3AVM A;  5J2M A;  1WSG A;  1SKS A;  2NUB A;  3VQC A;  2KFZ A;  3AVK A;  4CEZ A;  3NE6 A;  5HBM A;  4KFB A;  1GOB A;  3WNH A;  1NK7 A;  3OYL A;  4LSL A;  2PYL A;  3UIQ A;  1FK9 A;  1EXQ A;  3KLG A;  4E7L A;  1Q8I A;  1LAW A;  1X9S A;  1LV5 A;  3M8S A;  1SL0 A;  1N5Y A;  3IAY A;  4KB1 A;  1RDC A;  1TKZ A;  4DLE A;  1TAU A;  3KD5 E;  2GUI A;  3ZSY A;  4AHC A;  3RWU A;  2A1R A;  1JXE A;  4IG0 A;  3PO5 A;  4IFY A;  2PYJ A;  1ASW A;  3HST B;  1JLE A;  3OYM A;  3KD1 E;  4I9Q A;  1LWE A;  2RF2 A;  3KLF A;  4N41 A;  1B9F A;  1YTA A;  4CGJ A;  1L3U A;  1LWC A;  1VSL A;  1JLA A;  1VSM A;  1HMV A;  1RTI A;  2B6A A;  3QEV A;  1S5J A;  2EX3 A;  4RW4 A;  1BI4 A;  3EY1 A;  2VWK A;  2X6N A;  3VQ5 A;  4M3X A;  2DFF A;  4J2E A;  4BDP A;  2XO7 A;  3L2Q A;  3HL8 A;  3OJS A;  3V6D A;  2QK9 A;  2YNG A;  1WAF A;  4E1M A;  2G8H A;  1GOA A;  3VQ4 A;  2OPP A;  5HRR A;  1J53 A;  2ZD1 A;  3NH0 A;  4DTN A;  2G8U A;  1ZBI A;  3L3U A;  3MEG A;  3LWM A;  4FW2 A;  2F96 A;  3CYM A;  1SUQ A;  1LW2 A;  4O0J A;  1KVA A;  3PX6 A;  2YNF A;  1C0U A;  2F8T A;  4DSK A;  3AVG A;  3V1O A;  3AA5 X;  3QO9 A;  3KIO A;  4CIG A;  4CJR A;  3PX0 A;  1IKV A;  3SYZ A;  2YKM A;  3WNF A;  3ALY A;  1JL2 A;  1HQU A;  2F8S A;  2Z1I A;  4W5N A;  3RMC A;  4DG1 A;  3K58 A;  3TAB A;  3VQA A;  3RMD A;  1X9M A;  1TGO A;  4M3R A;  5CZ2 A;  4XIU A;  1XHX A;  3F9K A;  2OZM A;  1G15 A;  4KHS A;  2HB5 A;  1BGX T;  1C1A A;  4IDK A;  3ITH A;  2FBX A;  1GOC A;  4RW7 A;  4DS5 A;  4DTO A;  4BAC A;  3TWH A;  1B92 A;  1J9A A;  1JL1 A;  1RBS A;  3LAK A;  3K2P A;  4CGF A;  3U3Y A;  1RTD A;  1QTM A;  4ID1 A;  5CY4 A;  3M8Q A;  4E3S A;  2OPR A;  1YTU A;  4CJV A;  4B9U A;  4HCB A;  4OPJ A;  3RMA A;  4PUO A;  4MQ3 A;  4DTM A;  4DWI A;  4CGI A;  2JGU A;  3HJF A;  4CGG A;  2PZS A;  3QET A;  4FJI A;  3HK2 A;  1WSJ A;  1BIS A;  3DMJ A;  4ZTF A;  1U49 A;  1Q9Y A;  3V4I A;  4AHS A;  3ZSZ A;  4EP5 A;  3QES A;  3ULD A;  2A1S A;  3LAN A;  1JLQ A;  3LP2 A;  4CHQ A;  1S1X A;  3DLG A;  4ICL A;  4CER A;  4CF2 A;  3ZT4 A;  2Y1I A;  4KI4 A;  4IFV A;  3K59 A;  1W9H A;  5KTQ A;  4FJH A;  4KRE A;  4N76 A;  4KI6 A;  2BE2 A;  4Y1C A;  1WSF A;  1JLB A;  1ASU A;  3DI6 A;  3V9S A;  3VQ7 A;  3O3G A;  1N6Q A;  5C42 A;  4B8A B;  3AO5 A;  4H4M A;  5J2N A;  4NYN A;  4E7K A;  4HCC A;  1C0M A;  3HPH A;  4OVL A;  4DTJ A;  3LP3 A;  3OYF A;  2HW3 A;  4WE1 A;  1XC9 A;  5C24 A;  3DLE A;  3PO4 A;  1I3A A;  1TAQ A;  2W42 A;  1CXU A;  1EKE A;  4DQS A;  4E0D A;  4FJG A;  2HVH A;  2IAJ A;  4HVJ A;  3VN5 A;  3QLH A;  1HYV A;  4FLZ A;  4ZTJ A;  3RR7 A;  5FRN A;  4DTX A;  5HRS A;  1JLC A;  2FBY A;  2OYQ A;  3V9U A;  1SL1 A;  3NGZ A;  5DK5 A;  4CHY A;  4NCG A;  5JS2 A;  5KRT A;  5CYM A;  4CJW A;  1U48 A;  1KVB A;  1LWF A;  1VSJ A;  1A5X A;  1R0A A;  2WOM A;  3HT3 A;  3KLI A;  2HHW A;  3NH1 A;  1RDD A;  4FLW A;  1SKR A;  4LD0 A;  4Z0U A;  3QER A;  4OGE A;  3QNN A;  1HYZ A;  2WON A;  3TAF A;  3ZSX A;  4H8K A;  3MXM A;  4CED A;  4ZHR A;  3SV3 A;  1X9W A;  3BGR A;  3I0S A;  1HPZ A;  1L5U A;  4ID5 A;  1BI4 B;  3LPU A;  2RN2 A;  2Q3S A;  4BE0 A;  3QNO A;  4FZY A;  4F2R A;  3SQ2 A;  1KSP A;  3NHG A;  1QSL A;  4CK1 A;  1RDB A;  3JYT A;  4HHT A;  3KK1 A;  4W5T A;  2KFN A;  3K57 A;  3OY9 A;  4J2A A;  4M41 A;  2D0B A;  1UAX A;  3T19 A;  3QEI A;  1IKW A;  4OKK A;  5CYQ A;  4RW9 A;  1S1W A;  3ZSQ A;  4CJT A;  4DFM A;  2X74 A;  3QEP A;  4C8L A;  4W5Q A;  3CFO A;  5KGW A;  1RT7 A;  4B9V A;  1RBU A;  4E7I A;  3KLH A;  1NOZ A;  4KV8 A;  3VQ6 A;  4K8Z A;  5J2Q A;  1QHT A;  4R5P A;  2BGG A;  4NYF A;  4HUF A;  4I9L A;  4CF0 A;  3DYA A;  4DSJ A;  4OPK A;  4FJ9 A;  1BCO A;  1JLF A;  4FJK A;  3VQ9 A;  4CFB A;  1WAJ A;  3O4N A;  4C8M A;  2YNI A;  3AVH A;  1BCM A;  3AV9 A;  1RT5 A;  2QKK A;  2KTQ A;  3VQQ A;  4FLY A;  4ELV A;  2G8I A;  2HHS A;  4CFC A;  4FYD A;  2D5R A;  4M3Z A;  1RIL A;  4CJU A;  3K5O A;  3SUP A;  4FJ8 A;  4L8R B;  1CZB A;  3IRX A;  3P83 D;  3VQE A;  3O3F A;  1Y97 A;  1D9F A;  1D5A A;  1NJY A;  3THV A;  3AO1 A;  3DLB A;  4KHN A;  4FZZ A;  4M3T A;  4W5R A;  3IS9 A;  3NFA A;  5FDL A;  4CF1 A;  4PQU A;  4KTZ A;  4BDY A;  3AVF A;  3SCX A;  1RBR A;  4OJR A;  3VQP A;  4G1Q A;  4B08 A;  3U6F A;  4KHU A;  1S1V A;  2XY5 A;  4GMJ B;  1HQE A;  3SZ2 A;  3PV8 A;  2LSN A;  2JLE A;  1JKH A;  1IKX A;  1U04 A;  4CF8 A;  3DRP A;  4JS5 A;  3RR8 A;  2RKI A;  1UWB A;  2KZZ A;  3WNE A;  1RT1 A;  5I42 A;  2FBT A;  2OPS A;  1IKY A;  1BIU A;  3ZT1 A;  3B6P A;  3SUN A;  3RRH A;  4CJ4 A;  3HVR A;  2YKN A;  4M3W A;  1LW0 A;  3ZSV A;  1X1P A;  1S1U A;  4CEE A;  4CJ3 A;  1RT2 A;  3NH2 A;  1RT4 A;  1Z25 A;  3M8R A;  4PY5 A;  3C6U A;  4Z4H A;  4KAZ A;  3DRR A;  1VRU A;  1LAV A;  4NCB A;  4CJE A;  4W5O A;  1VK0 A;  4B9M A;  4CE9 A;  5HRO A;  2I5J A;  4AHR A;  2P1J A;  3PUF A;  3AO3 A;  4O4G A;  3ZT3 A;  1D9D A;  2DY4 A;  2ZQB A;  4DTR A;  2G8K A;  2QXF A;  3OYE A;  3ZSW A;  4Q0B A;  1IH7 A;  3TAP A;  4FZX C;  3H08 A;  3NGY A;  5CZ1 A;  4CHZ A;  3AVI A;  3AVL A;  4JRQ A;  3NF9 A;  4YNQ A;  4FVM A;  4CIF A;  1C1B A;  1JXB A;  2VG6 A;  1TKX A;  3KK2 A;  1HYS A;  4JLH A;  3V81 A;  1KVC A;  3HYF A;  3F73 A;  3NDK A;  3NAE A;  3C6T A;  4Q5V A;  4DSE A;  2VG5 A;  1SL2 A;  3ZT0 A;  1HNI A;  4CJS A;  1BL3 A;  3QIP A;  4CEO A;  3OS0 A;  3OYA A;  3AA2 A;  4CHP A;  4M45 A;  1T05 A;  4DSI A;  3B6O A;  2E6M A;  4FJJ A;  5HRN A;  2DFH A;  3M8P A;  3OYD A;  3I0R A;  4GVM A;  3EYZ A;  4IBN A;  3SQ1 A;  3LP1 A;  4AHV A;  4B8C A;  3V9Z A;  1NJZ A;  4O0I A;  2YV0 X;  3V1Q A;  1RCH A;  1A5W A;  3ZSR A;  2R7Y A;  1T7P A;  1RNH A;  1KTQ A;  1VRT A;  2FBV A;  4CIE A;  3PY8 A;  1EP4 A;  4E89 A;  4AIL C;  4FLU A;  4DFJ A;  1ZYQ A;  4Z4G A;  3AVB A;  4PA1 A;  2XY8 A;  3IG1 A;  1VSF A;  3BDP A;  3NBP A;  1NK0 A;  3DLR A;  1JLG A;  1TVR A;  3L2R A;  2EHG A;  1WNS A;  3CM5 A;  3NF7 A;  4MFB A;  3MEE A;  2IGI A;  4CES A;  4CFA A;  2ITG A;  3AO4 A;  3TAM A;  1W0H A;  2HNY A;  4DU3 A;  2P5G A;  2OZS A;  5KI6 A;  4CGD A;  2HVI A;  4DSL A;  3LZI A;  2IS3 A;  4CJK A;  4FLX A;  1VSH A;  3QEX A;  4HUE A;  4E7J A;  4CHN A;  4I2Q A;  1S9E A;  2Y1J A;  2HMI A;  4CEA A;  3RMB A;  4CEC A;  1IG9 A;  1NK5 A;  3HXM A;  4KTW A;  2HND A;  4IKF A;  3S3M A;  1UA1 A;  4CK2 A;  3ISN C;  1QS4 A;  1YVU A;  2XHB A;  3HO1 A;  3ASM A;  1EX4 A;  2G8V A;  4FJM A;  3KJV A;  3G0Z A;  4DQR A;  1WN7 A;  4H4O A;  1IO2 A;  2E6L A;  4BDZ A;  1ZBL A;  4I2P A;  4FM0 A;  1HNV A;  3VA0 A;  2XY6 A;  3VA3 A;  3JSM A;  3HPO A;  1NK8 A;  1BQN A;  4CJ5 A;  4PWD A;  4LSN A;  3MEC A;  4FJ7 A;  4DTP A;  4CJF A;  5HLF A;  4M3Y A;  3V1R A;  4DU1 A;  3T3F A;  4DS4 A;  5FRO A;  3LWL A;  4F3O A;  2O4G A;  2XY7 A;  1D8Y A;  3AA3 A;  1A5V A;  2KQ2 A;  4CGH A;  4KHY A;  1WSH A;  1TL3 A;  2VWJ A;  1TL1 A;  3KKR A;  2D0C A;  2ZE2 A;  1RDA A;  3SQ4 A;  3OYI A;  1T8E A;  1NKE A;  3KKS A;  3SI6 A;  3DRS A;  1RT6 A;  4EZ9 A;  3QEW A;  1FKP A;  1FXX A;  1QQC A;  3MXJ A;  2BAN A;  4F4K A;  2YNH A;  4BWJ A;  4ELU A;  4M3U A;  4BE1 A;  4O5B A;  4FLT A;  4CEF A;  3EZ5 A;  1NKC A;  1C6V A;  4C8N A;  3L2V A;  4FJ5 A;  3K5L A;  4CJL A;  5SZT A;  1BIZ A;  2X6S A;  4RG8 A;  1VSK A;  1S6Q A;  4CF9 A;  4J2B A;  1RBT A;  3CG7 A;  4Y1D A;  1I39 A;  1ZBU A;  1CZ9 A;  1L3S A;  2HNZ A;  2X78 A;  4DTS A;  4QOZ B;  2HHT A;  1O1W A;  3AO2 A;  3O4Q A;  3OS1 A;  5KGX A;  3OYB A;  2VG7 A;  1QSS A;  1YT3 A;  3LAM A;  4UQG A;  3TAE A;  3WNG A;  3TR8 A;  3TAN A;  5K14 A;  4K8X A;  2ETJ A;  1FKO A;  1RT3 A;  4FXD A;  3RRG A;  3K5N A;  3S3N A;  3OVN A;  3CFP A;  1U4B A;  3SPY A;  4DF4 A;  3SJJ A;  4Z4F A;  1QE1 A;  4DFP A;  1ASV A;  3NGI A;  1KFS A;  3SUQ A;  2G8W A;  3KLE A;  2Z1J A;  2GV9 A;  2GBZ A;  2YHA A;  4GW6 A;  3PX4 A;  4NCA A;  3DM2 A;  4CK3 A;  1NKB A;  4CJP A;  2PY5 A;  4C8O A;  4KPY A;  1XWL A;  2E4L A;  1S1T A;  4CEB A;  1QSY A;  2HHQ A;  4TSX A;  4AHU A;  1KLN A;  2B5J A;  1RTJ A;  4F8R A;  1TK5 A;  4BWM A;  3C95 A;  1ZBF A;  3QIN A;  5C25 A;  4DQQ A;  3OYK A;  5HP1 A;  1XI1 A;  1U45 A;  3LDS A;  3OYH A;  3VQD A;  3VQ8 A;  2Z1H A;  4Z4C A;  4LY7 A;  4BE2 A;  2HHX A;  3S3O A;  1VSD A;  4FM1 A;  3HPG A;  2DFE A;  4Z4E A;  1NK9 A;  3VQB A;  3CQ8 A;  4CJQ A;  4Z4I A;  1HJR A;  3AVJ A;  3U3G A;  3HP6 A;  5J2P A;  1RTH A;  5FRM A;  1TV6 A;  2IDO A;  4EP4 A;  1Q9X A;  2OA8 A;  3LZJ A;  3T1A A;  3ZSO A;  3NCI A;  3V9X A;  2RPI A;  4QAG A;  1S6P A;  1KRP A;  1K6Y A;  4E1N A;  1RBV A;  4OGC A;  3I8D A;  1T03 A;  4OLB A;  3DLK A;  5T7B A;  4KKO A;  3CM6 A;  3HP9 A;  1NJW A;  1UA0 A;  3HVT A;  4FJL A;  3TI0 A;  4AHT A;  3MAQ A;  1WSE A;  4OKJ A;  4CHO A;  3DOK A;  2B4J A;  4ELT A;  4FJX A;  3AVN A;  4KTQ A;  1WSI A;  1L3V A;  4B9N A;  3MED A;  1ITG A;  3FFI A;  4CFD A;  2HHU A;  4IG3 A;  3AA4 A;  1VSI A;  3D0P A;  4KO0 A;  4OKE A;  1BQM A;  1J5O A;  3SV4 A;  2OPQ A;  3CFR A;  1MU2 A;  1F21 A;  2KW4 A;  3SPZ A;  4CCH A;  5JS1 A;  4DQP A;  5J1E A;  2FC0 A;  3L3V A;  4JS4 A;  3SUO A;  3OYN A;  4DQI A;  4O55 A;  4B9T A;  4KB0 A;  3OYG A;  4LH4 A;  4FJN A;  3E01 A;  5KRS A;  2QKB A;  1UOC A;  2XRI A;  2BDP A;  1KFD A;  2D0A A;  3NF6 A;  4YFU A;  1U47 A;  2G8F A;  2ATQ A;  4KHQ A;  1KLM A;  4FK4 A;  2Z1G A;  1S9G A;  4B9L A;  3ZT2 A;  5E41 A;  2O4I A;  3C94 A;  4N47 A;  3QIO A;  1SV5 A;  1NJX A;  4O44 A;  4HTU A;  1ZBH A;  4E7H A;  4OLA A;  2IC3 A;  1DTQ A;  4E19 A;  3KTQ A;  4KRF A;  1C0T A;  4M42 A;  1J54 A;  3TAG A;  2HHV A;  1TKT A;  2DTU A;  3AVC A;  3L2W A;  3AVA A;  4DSF A;  3L8B A;  1L3T A;  4FK2 A;  1SKW A;  4FM2 A;  4F3T A;  3OS2 A;  4B3O A;  1NK4 A;  3ZCM A;  5DMR A;  4DMN A;  4I7F A;  1DLO A;  3SQ0 A;  4FCY A;  3P5J A;  3LAL A;  5SWM A;  3RTV A;  4FLV A;  5I3U A;  3TAR A;  4DFK A;  1C1C A;  4FW1 A;  3P1G A;  4RW8 A;  4AH9 A;  3SNN A;  3A2F A;  4EZ6 A;  4DTU A;  5EU7 A;  2IOC A;  2YHB A;  4LH5 A;  4QCL A;  1NOY A;  1DTT A;  4RW6 A;  4KHW A;  1B9D A;  3K5M A;  4DF8 A;  1CLQ A;  5HRP A;  3DOL A;  1XHZ A;  3OJU A;  4N5S A;  1KCF A;  3KK3 A;  3NF8 A;  3L2U A;  3V9W A;  3LPT A;  1TK0 A;  3HM9 A;  3OYJ A;  4JRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...