1RCHA

Solution nmr structure of ribonuclease hi from escherichia coli, 8 structures
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE HI
publication title Solution Structure of Ribonuclease Hi from Escherichia Coli
pubmed rcsb
molecule tags Endonuclease
total genus 35
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1995-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rchA00
3OS1A 3IRXA 1RT3A 1J9AA 4NYFA 3LANA 2P51A 3V9XA 1NJWA 3L3UA 5CZ2A 4B8CA 2OZMA 4FLUA 4FZZA 4M3ZA 4O0JA 5HBMA 4FM0A 1HYZA 3BGRA 3K57A 3ZSYA 1T7PA 1KCFA 3KIOA 1NK7A 1RDDA 3ZSXA 1RT2A 4G1QA 3PX0A 1BQMA 4J2DA 3G10A 3ZSZA 1SKWA 1L3SA 4CJ5A 3V1RA 1SL1A 1VSDA 3OYHA 4LY7A 4BE1A 3AVKA 3NF7A 4NYNA 5DMRA 4I2QA 4CGGA 1TKXA 3TR8A 4CEDA 3QERA 1HQEA 4CIEA 1C1BA 2HVHA 1J54A 3NDKA 3PO4A 3L8BA 1JLAA 3AVCA 4CIGA 3SUOA 1NJZA 3RMCA 4PWDA 4F3OA 4AHCA 1S1VA 2IDOA 5HRNA 3SJJA 1EXQA 2BE2A 4C8NA 4OKKA 1NKEA 5J2NA 1VSHA 3VQQA 3ZSOA 1UWBA 5KGWA 1NK8A 4FCYA 3NF6A 3PO5A 3QETA 2G8WA 1YVUA 3PUFA 1B92A 3LP0A 4I9QA 1ZBLA 2F8SA 5SWMA 3ZCMA 2E6LA 1ITGA 4CHYA 3OYDA 3SCXA 2A1SA 2OPRA 4FJ7A 4LH4A 1JLCA 4LH5A 5CYQA 3OYJA 1EKEA 2KQ2A 4L8RB 4B3OA 4B9UA 1VSLA 1ZYQA 3ZT0A 2HHVA 3AA4A 3VQAA 1RBTA 4Z4CA 3HM9A 2FBXA 3IAYA 1JLGA 3OYMA 4UQGA 3OVNA 4FJJA 2D5RA 4ID5A 4KB0A 5HP1A 2KW4A 3DLGA 5FDLA 1IG9A 4KHQA 1BHLA 3P5JA 4CF1A 1S6PA 4DTMA 3KKSA 1JL2A 4C8LA 3SV4A 3ITHA 4H4MA 2GBZA 1RBSA 5J2MA 3U3YA 1JLEA 2PYJA 4CJPA 3NGZA 3MEEA 1CZ9A 2ETJA 2Z1IA 4CJWA 3CM6A 1G15A 5C25A 4IG3A 2O4IA 2DTUA 4M3XA 4CJLA 2IAJA 4DTSA 4PUOA 4KHSA 3O4NA 3IS9A 2KFNA 4N5SA 3AVHA 1RBVA 1VK0A 1Z26A 3OYFA 4KO0A 1BCOA 4IDKA 4AH9A 3DRSA 1IKVA 3AO1A 1KSPA 4CGJA 1RDCA 2E4LA 2I5JA 3MEDA 2P1JA 1KRPA 2ZE2A 3NAEA 1XHXA 3VQ5A 3RRHA 1U48A 3K59A 4DSLA 2D0BA 3VQDA 1XI1A 5JS2A 4CIFA 1IKYA 4CEOA 3NHGA 4DLGA 1SL2A 4DSIA 1S1UA 1S1XA 3WNFA 3LPUA 3MECA 1SKSA 1IKXA 1FK9A 2HNYA 3KTQA 4HCCA 3QEPA 1LW0A 1D8YA 2VG5A 3M8RA 3TAPA 3ZT3A 1IH7A 1RDBA 4M3TA 4AHTA 4MFBA 1I39A 4DFMA 1Q9XA 4HCBA 1S9EA 2PY5A 1QSSA 1LW2A 4ZHRA 4OPKA 2E6MA 4PA1A 3DI6A 1XHZA 1LWFA 4CJFA 4FM2A 3T3FA 5FRNA 2ATQA 3OYGA 1TL1A 4CHZA 4AHSA 3OYLA 3TARA 3SNNA 3K5LA 3ZT2A 3TAFA 2FC0A 3SQ2A 3P1GA 1WLJA 4KB1A 3CM5A 3L2WA 1X9WA 4IFYA 2EHGA 1L3UA 4DMNA 4W5QA 1Q9YA 2DFEA 4O4GA 4DTJA 3QNNA 1QSLA 3TAMA 4BWJA 3RMAA 4M3RA 4ID1A 1NJXA 1TV6A 1MU2A 3T1AA 3NH2A 3KLFA 4DSFA 1ZBHA 1BCMA 1RILA 5HRRA 3F9KA 4KFBA 4Q5VA 3SV3A 1S1TA 3OYAA 1T03A 4FJXA 3O4QA 2QXFA 3LPTA 2XRIA 3SZ2A 1U4BA 1U47A 1QHTA 2PYLA 2G8VA 2OPPA 4KHUA 3QIOA 3VN5A 3S3OA 3CYMA 4E89A 3VQ4A 4BE2A 4H8KA 4W5RA 3CG7A 4AHVA 1RCHA 5KGXA 2YNFA 1A5WA 2RKIA 2IOCA 2VG7A 3H08A 4QAGA 4M45A 3VQ8A 3CFPA 4FLYA 1KVCA 3AVFA 3LDSA 1GOAA 1RT7A 4DS4A 4IKFA 3AO4A 2D0AA 3HYFA 3VQ7A 2B6AA 2A1RA 4OKEA 4CK3A 3AA2A 3V1OA 4CJ4A 2VWKA 1BIZA 3EY1A 2XO7A 5HROA 4B8AB 4EP4A 4DU4A 1U49A 4DWIA 3KKRA 4O5BA 1NK9A 3QIPA 4HHTA 1VRUA 2ZD1A 3ZSRA 1HJRA 5I3UA 4ELTA 4KTQA 5CZ1A 1L5UA 4E3SA 3V81A 3AO5A 3LP2A 5SZTA 3DOKA 4FVMA 3RMDA 4FM1A 5C42A 4F4KA 4KI4A 1QE1A 2W42A 3RWUA 1C1AA 4HUEA 4DF8A 1QS4A 4CHOA 4KPYA 3L2UA 3HT3A 3I8DA 4NCGA 4OGEA 4DFPA 2QKKA 1B9DA 5KRTA 3VA0A 3WNGA 3QNOA 4KI6A 1HYVA 5J1EA 3OS0A 3CFRA 3DLHA 4OJRA 4FJKA 4B9TA 4ELUA 2HHWA 4CJUA 3F73A 4FK4A 3O3GA 4DQRA 4Y1DA 1UAXA 4FZXC 1KTQA 1HNIA 1ZBFA 4FW2A 3D0PA 4GVMA 2HMIA 4EZ6A 1BI4B 4DTOA 4HUFA 3PY8A 4E7IA 1LWEA 2P5GA 1DTQA 1RTDA 4FJGA 4IBNA 1KVAA 4XIUA 1TAQA 3UIQA 4FYDA 2ZQBA 4DFKA 3TAEA 3C95A 4IFVA 4DSJA 4F8RA 1X1PA 3KK2A 2GUIA 4Z4GA 3ASMA 3LWLA 3HK2A 2HW3A 1WSHA 4B9NA 4E1NA 2G8KA 2FBTA 3HP9A 3IG1A 4CEEA 3WNEA 1HPZA 3AO2A 3PX6A 4Z4FA 5D3GA 4JS4A 2HNDA 4W5TA 1WAJA 2YV0X 3AA5X 4CECA 4CK1A 4K8ZA 3LP1A 4KREA 3NF8A 1U04A 1KFDA 3CQ8A 4B9MA 2HHTA 4BDYA 4YFUA 3AVMA 4CF2A 1HNVA 2Z1JA 3DMJA 4KHYA 4N76A 3BDPA 3KD5E 3QEVA 1BQNA 5J2PA 3O3HA 1WAFA 3OYCA 3V4IA 4CHNA 3RMBA 4HVJA 2PZSA 4OKJA 1EX4A 3HXMA 3AVGA 2YHBA 3L3VA 1Q8IA 3TAQA 1U45A 3QEWA 4E1MA 4BE0A 3V6DA 4J2AA 5J2QA 2KTQA 2BDPA 3DOLA 2KFZA 3SUPA 1A5XA 2OPQA 3SI6A 2YNGA 1REVA 3KLHA 4BDZA 3LZIA 4I2PA 1SUQA 5HLFA 2RPIA 4CESA 4H4OA 2IS3A 3T19A 3VQBA 2VWJA 4R5PA 1QSYA 1KLNA 2KZZA 3RTVA 3SPZA 4QOZB 4CE9A 4TSXA 2FBYA 4DSEA 1J5OA 4CF8A 1ASUA 3AVBA 4BWMA 4JS5A 4DQQA 1CXUA 3LZJA 1NOYA 1RTJA 1VSMA 4RW4A 3JYTA 3RRGA 1HYSA 1BISA 1GOCA 3AVJA 3HPHA 1HMVA 3NGYA 2G8FA 1TVRA 4CEBA 3OYEA 4FJ9A 4CGIA 4B9LA 4ELVA 4FZYA 5KRSA 3DRRA 4FJ5A 5KI6A 1W9HA 4CEQA 1NK6A 4M3WA 3V9SA 1TK5A 4C8KA 1JLBA 1LAVA 2OZSA 3ZSWA 3HVTA 1CZBA 4ZTFA 4LSLA 1QQCA 1BL3A 2B5JA 3NFAA 4C8MA 4DU1A 3E01A 1TAUA 5E41A 2DY4A 3A2FA 3B6OA 1RBRA 4KRFA 1X9MA 4Z4IA 3KK3A 1C0MA 1D5AA 1GOBA 4CERA 5I42A 4KHNA 2HHUA 1C1CA 1RBUA 2QK9A 3K2PA 4NCAA 4GW6A 4RW6A 4CJEA 3QEXA 4CJ3A 4DTPA 1HQUA 1UA1A 3I0RA 1RT6A 1SL0A 3V9ZA 1C0UA 3DM2A 4B08A 4CHQA 4DTRA 4FLZA 1Y97A 2DFFA 3HL8A 5HRSA 2IC3A 1IO2A 3NH0A 3HVRA 4FJNA 1CLQA 3C6UA 4M3UA 1S1WA 1DLOA 1WSEA 2HVIA 4J2BA 1KLMA 5FROA 3KD1E 1TK8A 3THVA 2OA8A 4EP5A 1NOZA 3V9WA 4DLEA 2Y1IA 3HSTB 3V1QA 1RTHA 4NCBA 4FXDA 1DTTA 2Y1JA 1JLFA 1XC9A 2XY8A 1S6QA 3LAKA 4FLVA 4N56A 1S9GA 2HHXA 1TGOA 1SKRA 1KFSA 3LWMA 4FJLA 1C0TA 2F96A 4Y1CA 1FXXA 4B9VA 3V9UA 1LWCA 3RR8A 3OYBA 1IKWA 5FRMA 2DFHA 2Z1GA 4CFBA 1WNSA 2O4GA 4CGFA 3C6TA 3AVAA 3MEGA 3OYIA 2X6SA 3DRPA 3TAGA 1UA0A 4OLBA 3HO1A 3ISNC 3U3GA 4E7KA 4DTXA 4OLAA 4J2EA 2G8HA 3LAMA 4KHWA 2OYQA 3DLEA 4E7JA 2YNIA 5K14A 5JS1A 4KTWA 3D45A 3DYAA 4F2RA 3MAQA 3ZT1A 2XY6A 1X9SA 4DSKA 3CFOA 2OPSA 4DG1A 1R0AA 2QKBA 4CJVA 1N6QA 4I9LA 3AVLA 4RW8A 2XHBA 3AO3A 3WNHA 2RF2A 4CJQA 1L3VA 3P83D 3MXMA 4FJMA 1LV5A 4K8XA 2YKMA 3DLRA 2X6NA 4AHUA 4BDPA 4CGHA 4OVLA 4F2SA 3DLBA 1FKOA 4AHRA 4CJSA 1VSKA 3OY9A 3OYNA 4M3YA 5C24A 1RT4A 4E19A 3S3MA 4Q0BA 3S9HA 3NBPA 4KAZA 1FKPA 1YTUA 2WOMA 4F3TA 4OPJA 3AV9A 2VG6A 3OYKA 2FBVA 3K58A 3I0SA 2XY5A 3VQ9A 4KTZA 4N41A 1WSFA 4FW1A 1NK4A 4BACA 1T8EA 2AJQA 4WE1A 1VSJA 3SUNA 1ASWA 1TKTA 1YT3A 4CJRA 2BANA 3KK1A 3MXJA 4O0IA 5T7BA 3OJSA 1S5JA 3HJFA 1T05A 1D9FA 1EP4A 3VQCA 3K5MA 4DTUA 3QO9A 4ZTJA 1RDAA 2LSNA 3K5NA 3KLIA 4DU3A 1N5YA 1NKBA 4M41A 4FK0A 4Z4EA 1C6VA 4I7FA 1HRHA 1UOCA 3O3FA 1TKZA 1J53A 3SPYA 1BI4A 4FLWA 3L2VA 2F8TA 4DQSA 1RNHA 3LALA 1LAWA 4O55A 4M42A 4W5OA 3NF9A 4JLHA 1BGXT 3DLKA 2Q3SA 4CF9A 4QCLA 4LD0A 1Z25A 4CEAA 1F21A 3QINA 3L2QA 4E0DA 2JGUA 3M8SA 4DQPA 1CXQA 1A5VA 1WSGA 4CJTA 3EYZA 2KZMA 3PX4A 2BGGA 2XY7A 1I3AA 3M8PA 1K6YA 3PV8A 3ALYA 4PY5A 4DTNA 3QEIA 4DF4A 2RN2A 3SUQA 3KLGA 3VQPA 1XWLA 3G0ZA 3M8QA 4YNQA 1L3TA 5CY4A 1TK0A 4FJIA 2IGIA 5KTQA 3L2RA 4CCHA 2HB5A 2WONA 3TWHA 3QESA 1RT1A 1VRTA 4ICLA 1EETA 4CFAA 4CFDA 3LP3A 1RTIA 1YTAA 4RW7A 3SYZA 2X74A 5EU7A 4CK2A 1B9FA 1TL3A 1NK0A 3VA3A 2G8UA 2ITGA 3KLEA 4LSNA 1NJYA 4PQUA 3HPGA 2HHQA 1SV5A 3AVNA 4B9SA 4MQ3A 4FLXA 4AILC 3TANA 4JRPA 1ZBUA 2HNZA 3AA3A 4EZ9A 4W5NA 3ZSQA 3MXIA 1WSJA 1BIUA 1W0HA 3JSMA 3ULDA 1NKCA 1RT5A 5CYMA 1JXBA 4CHPA 4DFJA 3SQ4A 5DK5A 2HHSA 4CJKA 4GMJB 3U6FA 4JRQA 3KJVA 3ZT4A 4HUGA 3VQEA 4FJHA 3OJUA 2YKNA 3ZSVA 4CGDA 2X78A 4Z4HA 3EZ5A 1VSFA 1WN7A 1JKHA 4DS5A 4DQIA 3TABA 2B4JA 3HP6A 1VSEA 5HRPA 1JLQA 2YHAA 4HTUA 3S3NA 1JXEA 1NK5A 4RG8A 3NGIA 2P5OA 2G8IA 4FK2A 4RW9A 3NCIA 2NUBA 4E7LA 3K5OA 3QLHA 3AVIA 3NE6A 3FFIA 3OS2A 1D9DA 4CEZA 1KVBA 2Z1HA 4FLTA 1JL1A 1ZBIA 3VQ6A 4CEFA 1QTMA 2D0CA 2EX3A 4O44A 1ASVA 4KV8A 4KKOA 2GV9A 3C94A 2R7YA 3SQ0A 4OGCA 4IG0A 4CFCA 4FJ8A 3SQ1A 3NH1A 2YNHA 4N47A 1WSIA 4C8OA 4Z0UA 1VSIA 2JLEA 1TKDA 3B6PA 4E7HA 4CF0A 3HPOA 3TI0A 1O1WA 3RR7A
chains in the Genus database with same CATH superfamily
1RT3A 1J9AA 2P51A 4B1XB 2OZMA 1K73O 4HWIA 4O0JA 4FM0A 2KHOA 1HYZA 2UXCK 1BA1A 3K57A 3MN6A 1OVQA 3UKUB 4CBWA 4K0KK 4DR2K 3V1RA 1SL1A 4EIAA 4LY7A 3AVKA 2OANA 4I2QA 1MWKA 1C1BA 3NDKA 2O8FA 3SUOA 3AVCA 4X62K 3QICA 3DWLA 4AHCA 2IDOA 4LF8K 1CZAN 3CCEN 2BE2A 2QXLA 4B1YB 1VSHA 3VQQA 3ZSOA 5KGWA 4FCYA 3PO5A 4LFAK 1VQ5N 2G8WA 2F8SA 3D2FB 3ZX2A 3ZLJA 1XNRK 2OPRA 4LH5A 4B3OA 4BR0A 4B9UA 1E3MA 2H3GX 1ZYQA 1RBTA 5EXWA 3R9PA 5AR0A 3OVNA 3L4QA 5HP1A 4CF1A 4DTMA 1QZ6A 1W2BM 2I7NA 4BRIA 3SV4A 2GBZA 4WFAL 2UUBK 2ETJA 2Z1IA 4K25A 1BOTO 3VESA 4IG3A 2O4IA 3OBYA 4CJLA 2IAJA 4KHSA 3O4NA 5LJWA 3IS9A 4JI5K 4N5SA 3OYFA 5F0XA 4AH9A 2NRTA 3AO1A 1RDCA 1KRPA 2ZE2A 1WUAA 4ISEA 1EWRA 2F9WA 3BZCA 3SMPA 1U48A 1JCFA 1XI1A 5JS2A 1S1UA 1S1XA 3WNFA 3LPUA 1IKXA 3N4QA 4CI6A 4JKAA 3KTQA 1D8YA 3ZT3A 1RDBA 4MFBA 4CBXA 3SAFA 4ZHRA 4JKCA 2ZJPL 4FM2A 4JD2A 4JI6K 1TL1A 4CHZA 3ZT2A 2QWNA 3FLCO 1WLJA 4DMNA 1KQSM 4W5QA 2DFEA 4BWJA 1YAGA 4DV7K 1H1VA 3DXMA 4FJXA 4BROA 3VEVA 2HBJA 3ZEUA 2G8VA 1IBLK 3CYMA 3LM2A 3VQ4A 4E89A 3P38A 4W5RA 5CR4A 4XEIA 5KGXA 2YNFA 1A5WA 4QAGA 2VG7A 3PIOL 2EWSA 1NGAA 3VQ8A 3CI5A 3CJ7A 4QS9A 3JXUA 3V1OA 3RSEA 3UKRB 4MLHA 4B8AB 1U49A 4F9OA 3KKRA 3HOTA 4DWIA 5I3UA 1HJRA 4B1WB 1L5UA 2V51B 4E3SA 2RE2A 1V4TA 4B1VA 4FM1A 4KI4A 2OCEA 3VOVA 1VQ6N 3HT3A 4NCGA 1ATNA 5GIPA 1HNZK 5KRTA 4MO5A 3QNOA 4KI6A 3OS0A 1GLFO 2F9TA 3DLHA 4B9TA 3U8XA 2HHWA 2D4WA 4JAXA 1YXQA 5BREA 3BZKA 1WBDA 1HNIA 1BUPA 4GVMA 4QS8A 4BG8A 4RWTA 3K9JA 5C2DA 1KVAA 4FJGA 1TAQA 3UKUA 2P9KB 2ZQBA 3C95A 1WBBA 1K9MO 4F8RA 1X1PA 4FWLA 5C12A 3LWLA 2GUPA 1OH8A 4DR7K 4CEEA 3O9SA 4B1UB 4Z4FA 5JICA 4W5TA 3AA5X 4CK1A 3LP1A 3VERA 3NF8A 2QWOA 1HNVA 3BDPA 2ZJRL 1IG8A 3O3HA 3D2FA 2PZSA 3HXMA 2YHBA 3L3VA 3TAQA 1U45A 3QEWA 2YHXA 2KLAA 3DOLA 2W40A 1A5XA 3TTFA 1FW6A 3GDQA 1REVA 3KLHA 4BDZA 3LZIA 4I2PA 1SUQA 3O4WA 3OW2M 4TSXA 1J5OA 4K41A 4CF8A 4DQQA 3MK6A 5I9EB 1CXUA 4WCEL 1RTJA 3RRGA 1GOCA 4XH4A 2UXDK 1HMVA 1TVRA 3OYEA 3JS6A 4B9LA 4NXNK 5M1FA 3EN9A 5AQYA 4CEQA 1NK6A 1TK5A 4PKIA 1JLBA 1LAVA 3ZSWA 2E2OA 4ZTFA 1D4XA 1QQCA 2B5JA 1VQKN 2O8CB 3E01A 2P9IB 4KRFA 3KK3A 2HHUA 1C1CA 2QK9A 3VEOA 4BC2A 4GW6A 3QEXA 4CJ3A 4DTPA 1HQUA 3I0RA 1RT6A 4CW7B 3V9ZA 2NRVA 1SL0A 2FSKA 5AQIA 4RTFD 4EHTA 4CHQA 2IC3A 4FJNA 3C6UA 1S1WA 3SK3A 3WEEB 2Y1IA 1NOZA 4IOXA 4NCBA 1W97L 3R8EA 3QFPA 1S6QA 3LAKA 4FLVA 1KFSA 3LWMA 3TTCA 3M3ZA 1LWCA 4A62A 3RR8A 3OYBA 4IEEA 5FRMA 2DFHA 3CC7N 5AZIA 3TAGA 3HO1A 4OLBA 4DTXA 4OLAA 3DLEA 2CGLA 5CE3A 3D45A 3DYAA 4F2RA 4PKHA 3ZT1A 4UY8O 1X9SA 1NM1A 2OPSA 3WUHA 4CZKA 1R0AA 4CJVA 4I9LA 3BY5A 1YITN 3AO3A 1BG3A 5E84A 3UKRA 3P83D 3MXMA 3DAWA 3DLRA 3ULEB 4AHUA 1YJWN 4BDPA 1X3NA 3BP8A 4CGHA 1U6ZA 1VSKA 3OYNA 4BRQA 3G6EN 4E19A 3S3MA 3S9HA 5AQKA 2WOMA 4OPJA 1J6ZA 2XY5A 1WSFA 4H0VB 5AQVA 3A5OC 1NK4A 2IVOA 3OHRA 4DKWA 3F2KA 1TKTA 4B1ZA 2ZJQL 3VEZA 1EP4A 4DTUA 4DU3A 4FK0A 4I7FA 1HRHA 4FLWA 3L2VA 4BGAA 2F8TA 4IOCL 5BRHA 4JLHA 1NGDA 4NXMK 2P9KA 3QINA 3WXLA 2HSTA 3QMLA 1CXQA 4CZLA 1GLAG 4OPAA 3PX4A 2AP1A 4ISFA 3QEIA 3VQPA 4YNQA 1RGIA 3O08A 4DHYA 3QESA 3LP3A 1KAZA 1YTAA 2X74A 1NK0A 3KLEA 1SV5A 3AVNA 3P31A 3TANA 1X3MA 1JCEA 4JRPA 4W5NA 3MN5A 1BIUA 1W0HA 3JSMA 3WXMB 4CHPA 2ASPA 5CYMA 4DFJA 1VQ9N 3ZT4A 1NG9A 4FJHA 4CGDA 4Z4HA 5EOYA 3EZ5A 3O9RA 5GAEP 5FPNA 1EQYA 2YHAA 1JXEA 4RG8A 2G8IA 4FK2A 4E7LA 4IJNA 3R6MA 3NE6A 5AQTA 1JL1A 2FSJA 4CEFA 1QTMA 1ASVA 4KV8A 3IMXA 2PAVA 4H5NA 3SQ1A 4CZMA 3NH1A 1S3XA 2O8CA 3MCAB 5F1XA 4C8OA 2P9IA 3B6PA 2QWLA 1Q81O 3QFUA 3M6GA 3CCVN 3F73A 3RR7A 4NYFA 3LANA 5M1PA 1KAYA 3L6QA 2HOEA 4B8CA 4FLUA 4A2BA 5AQSA 4CBUA 5B8HA 5C15A 3L4IA 3ZSYA 4WF9L 2WBNA 3ZSXA 1BQMA 1SKWA 5KPRA 1VSDA 1ATSA 3NF7A 5DMRA 2NZTA 2YJEA 4CEDA 3QERA 1HQEA 3WEEA 2HVHA 5JLFA 1J54A 2NRHA 4L3QA 4I6MA 3CC2N 4PL7A 3RMCA 4PWDA 1NKEA 4C8NA 4OKKA 3IUCA 2UUCK 3LDLA 5GINA 3QETA 3NVMA 1YVUA 1ZBLA 2QW9A 4H03B 3CMAN 4CHYA 2A1SA 4LH4A 5CYQA 3C6AA 1EKEA 4L8RB 3ZT0A 3VQAA 4Z4CA 4DV6K 4ILHA 4KH4A 3QBWA 4UQGA 2QTDA 4ID5A 2DPNA 4CZJA 1JL2A 4LF9K 3SBTA 3C65A 1GLBG 1RBSA 3ULEA 1JLEA 1HJOA 3R1XA 3NGZA 3MEEA 3PIPL 4CJWA 3J7YP 2DTUA 4DTSA 2KFNA 1Z26A 4IDKA 1Q86O 1IKVA 2VYPA 4CGJA 3MEDA 2P1JA 3KHYA 3NAEA 3VQ5A 1ZXOA 4JN4A 3K59A 3VQDA 4CIFA 2NLXA 1IKYA 4DLGA 4WQ4A 1SL2A 4DSIA 5E26A 2YCHA 2NRXA 5EX5A 3QEPA 1GLJO 4IDHA 2VG5A 2HF4A 3TAPA 4JKGB 1I39A 1TYQB 1Q9XA 1S9EA 2P9SB 3ENOA 2E6MA 3DXKB 5FRNA 2ATQA 3OYLA 2NRZA 1YUWA 3P1GA 4O4GA 4DTJA 3TAMA 4JKEA 3H6EA 4M3RA 4ID1A 4DB3A 1TV6A 3T1AA 2QWQA 1ZBHA 1BCMA 4Q5VA 2Q36A 3PSFA 3O4QA 1U4BA 2PYLA 1QHTA 5EY4A 3T7ZA 4KHUA 4FSVA 3QIOA 3S3OA 4BE2A 4H8KA 2IOCA 3FGUA 3BF3A 1KVCA 1SAZA 3AVFA 5HL7L 4DS4A 3AO4A 2D0AA 3FZKA 2A1RA 4O5FA 1OH5A 4JV5K 4LC9B 2QWRA 4CJ4A 2VWKA 3EY1A 1VAZA 4EP4A 4DU4A 5HROA 2D1KA 1VRUA 2ZD1A 3WQUA 3ZSRA 2VCPA 2KKZA 3TSUA 3V81A 2WFBA 4A57A 4A59A 4BC3A 4FVMA 4F4KA 3VENA 3EO3A 1MA9B 2W42A 1C1AA 4HUEA 3I8DA 1LOTB 3AGRA 2A42A 4IJAA 2QKKA 1IV0A 3CFRA 2P9NB 3H1QA 4H5RA 4FK4A 5IT9O 3K0SA 3CCQN 2HMIA 4HUFA 2CGJA 4GV6A 2HF3A 3UIQA 3SMSA 4DFKA 3WXIA 1E4FT 4Z4GA 4BRDA 2IVNA 1WSHA 4B9NA 3LDNA 2G8KA 3QBXA 3C0BA 3J81O 1T6DA 5D3GA 2HNDA 1WAJA 4CECA 3P4IA 2E1YA 3CQ8A 4B9MA 4BDYA 3AVMA 5LMNK 4N76A 4KHYA 5AFUH 3QEVA 2P9PB 3V4IA 4CHNA 3RMBA 4M7XA 2YHYA 2OTLN 3G25A 2ZGYA 4BRAA 4E1MA 4BE0A 2W6LA 2KFZA 2OPQA 2YNGA 2D0PA 5M1NA 1QHAA 5HLFA 4DV5K 1GLLO 2E88A 3VQBA 2KZZA 4QOZB 1HKGA 2F7TA 1Q7YO 4AF1A 4DV2K 4DSEA 1QVGM 3AVBA 1XNQK 4BQLA 3K9KA 4K43A 1NOYA 1VSMA 1HYSA 3EZWA 3CJ9A 2FF3B 2UU9K 3NGYA 1Q18A 1XMQK 2G8FA 3C6HA 2IVPA 5KRSA 3CD6N 3IDHA 4M3WA 1NGGA 2P9LB 1BL3A 2DY4A 4BREA 4H0PA 4JI0K 3O1BA 3J7ZO 4M7YA 4CZGA 4KHNA 1C0GA 1DT9A 1RBUA 4JKGA 4XH1A 3ID8A 1UA1A 1VQPN 1TYQA 1C0UA 3FZLA 2P9SA 4B3RK 2DFFA 5TKYA 1XC3A 5HRSA 3DXKA 1DLOA 2HVIA 5FROA 5BR8K 1TK8A 4DLEA 3HSTB 3V1QA 1HNWK 1RTHA 1Z05A 1S9GA 1SKRA 3V9UA 1XMOK 1SZ2A 2YJFA 4CZEA 1IKWA 4DQ8A 4DR6K 4IO9L 1DEJA 2Z1GA 4CFBA 4CJ7A 5ELZA 3C6TA 2X6SA 5M1OA 5BPMA 3ISNC 2J4RA 2ZGZA 4CVNE 5AQHA 4A61A 2OYQA 5AJ3K 4GNIA 4DSKA 4DG1A 2QKBA 3LDQA 1N6QA 1M1KO 2RF2A 4FJMA 1LV5A 5AQJA 2ZWHA 3A5LC 5BPLA 4OVLA 4JK9A 4YOVA 3OY9A 3VEXA 3CPWM 1RT4A 1VHXA 1NU0A 4KAZA 4F3TA 3AV9A 3K58A 2FBVA 3VQ9A 4KTZA 4N41A 3WXKA 4BRHA 3TPQA 4BACA 1T8EA 3EL2A 3KWGA 2BTFA 1MWMA 4ILGB 3NVKA 1S5JA 4YOXA 3HJFA 2P9NA 4BC5A 1T05A 4ZTJA 1D9FA 1RDAA 4Z4EA 5KQDA 3KLIA 1N5YA 1NKBA 1C6VA 4WFBL 3WQTA 3O3FA 3H46O 1NGHA 4DQSA 1RNHA 3BF1A 3NF9A 1BGXT 2Q3SA 1Z25A 4E0DA 4AM7A 2V7YA 1A5VA 1WSGA 4BRLA 3J80O 3Q7BA 2BGGA 4MLEA 2CGKA 3UE5A 2XY7A 1K6YA 3G71N 3PV8A 4PY5A 4FWSA 1JJ2M 4FJIA 3G0ZA 5KTQA 3L2RA 4CCHA 2P9PA 3HZ6A 1N8RO 4BR5A 4ICLA 1RTIA 3E9OA 4CZIA 3AGKA 4LSNA 5BRDA 4B3SK 3CCMN 1KD1O 4B9SA 1HNXK 2HNZA 3AAPA 4DCHA 3ZSQA 3MXIA 3ULDA 3KVGA 1NNEA 1RT5A 3SQ4A 4LF5K 5LY3A 3FR0A 2QM1A 4JI2K 4GMJB 4JRQA 2CH5A 4CZFA 3KJVA 3VQEA 3OJUA 2X78A 1VSFA 3HP6A 1VSEA 4FWKA 5HRPA 4IEIA 5BN9A 4U67L 4HTUA 1T3VA 3NGIA 2E2PA 3NCIA 2NUBA 3OA9A 1ATRA 4GY2B 3FFIA 4H5TA 3OS2A 4LFCK 1D9DA 2Z1HA 1N33K 3VQ6A 2D0CA 4O44A 4OGCA 4IG0A 4CFCA 4FJ8A 4GV9A 4NB4A 4N47A 1C0FA 2P9LA 2VQEK 3VF2A 3E9PA 5BR9A 4FWNA 1EWQA 4CF0A 3HPOA 3CG7A 4BRKA 3OS1A 3IRXA 1NJWA 3L3UA 4FZZA 4M3ZA 4WQ5A 3TU5A 4CZHA 3DLLL 4JI3K 1T7PA 1KCFA 3KIOA 1NK7A 1RDDA 2ITMA 1RT2A 1YI2N 1P8ZA 2D0OA 3G10A 5LJVA 4YDUA 3OYHA 3LM9A 4NYNA 4CGGA 1P90A 1TKXA 3TR8A 3VGLA 1QQOA 3PO4A 3L8BA 1JLAA 1NJZA 1S22A 1KAXA 3SAGA 4F3OA 5HRNA 3SJJA 1EXQA 1YHQN 4EHUA 5J2NA 4DV0K 1NK8A 5AQUA 2O8EB 2F4VK 3PUFA 5GAHP 5AQNA 3ZCMA 1ITGA 3SCXA 4FJ7A 5JMVA 3CHWA 3H3NO 2O8BB 1VSLA 2HHVA 2HBLA 3AA4A 5AQFA 2FBXA 3IAYA 3THXB 2D5RA 2KW4A 3DLGA 1HR0K 3KKSA 1GLCG 3ZYYX 3ITHA 1VQ7N 5J2MA 1KXPA 2E2NA 2GWJA 2PYJA 2NRWA 3CM6A 1IBKK 3ZETB 5C25A 3EE8A 4M3XA 4PUOA 2O8DB 2E20A 4H0TB 1RBVA 1VK0A 4KO0A 1BCOA 3HOSA 1GLEG 3A8YA 3CCSN 2FLOA 4DSLA 3CJBA 2D0BA 1QQMA 5KPTA 4GKKK 3NHGA 4HCCA 1SKSA 4GV3A 4X64K 1NGBA 2PFUA 3F9MA 5ADXH 1NBWA 4JHDB 1W7AA 4BRMA 3ATVA 3KZBA 4DUYK 1ZBSA 1QSSA 4BY9C 4OPKA 1OVYA 3DI6A 1XHZA 3EKSA 1LWFA 3T3FA 1RDUA 3HSCA 2HBMA 4BGBA 1LCUA 3O5BA 2FC0A 1ESVA 3SQ2A 4YOWA 2UUAK 4G9ZA 3CM5A 1X9WA 5A2QO 4FO0A 3VGKA 4H0YB 4BVOA 3VTIA 5FPEA 4KFBA 1S1TA 1T03A 2XRIA 3Q7CA 4H0OA 4FWRA 3SZ2A 2OPPA 4FOIA 3I33A 1RCHA 3H08A 3TSPA 3VEYA 3CFPA 1GOAA 1M90O 3HYFA 3VQ7A 1NGFA 5EVZA 4CK3A 3AA2A 1BIZA 3SLCA 2XO7A 4K42A 3MN9A 2VWBA 4ELTA 5CZ1A 1RFQA 4KTQA 1HUXA 3AO5A 3R3LA 3RMDA 1T6CA 3O80A 1QE1A 3RWUA 4R79A 4DF8A 4CHOA 3L2UA 3ID6A 4OGEA 4DFPA 5IWAK 1YVNA 4IXCA 4MO4A 3WNGA 3VA0A 4FJKA 4OJRA 2Q0RA 4B3TK 4CJUA 3W3DA 3BUZB 4DQRA 4Y1DA 4FZXC 3LDPA 1HKCA 3A5NC 3EKUA 2E2QA 4DTOA 3PY8A 1LWEA 1DTQA 4XIUA 4FYDA 5M1QA 3ENBA 3N4PA 3THWB 3I8BA 2E8AA 3CCLN 3HK2A 2HW3A 1V4SA 4E1NA 2FBTA 3IG1A 3PX6A 1YJ9N 4MDBA 2YV0X 4KREA 1VQLN 2HHTA 3KWIA 4CF2A 2O8EA 4CD1A 3CCUN 3KD5E 5J2PA 1WAFA 3OYCA 4DV4K 2VGNA 4HVJA 4BRGA 4OKJA 1YJNN 1Q8IA 2O8BA 5AQOA 4YDUC 3CIPA 4J2AA 2KTQA 4JKDA 2Q0UA 2BDPA 3SUPA 5AQLA 1HKBA 5AQPA 4AQYK 3THXA 2RPIA 3T69A 4CESA 2IS3A 4IZ9A 2VWJA 1SS6A 3RTVA 3SPZA 4JKFA 2FBYA 4DR4K 3CQYA 4BWMA 4JS5A 4PL8A 3CQXA 3JYTA 3HPHA 1K8KB 3ZETA 2GWKA 4CEBA 4BR2A 3E66A 2O8DA 3O1WA 5C2FA 4FJ5A 1W9HA 3NMUA 2OZSA 3HVTA 1CZBA 4LSLA 4PKGA 4C8MA 5E41A 3A2FA 3T1HK 1RBRA 1X9MA 3LL3A 1C0MA 1D5AA 1GOBA 4FWOA 5I42A 1NLVA 3K2PA 4QS7A 4JHDA 4O8UA 4RW6A 1IJJA 4B08A 3O6WA 4DTRA 4FLZA 1Y97A 3HL8A 3NH0A 1IO2A 1QZ5A 3HVRA 1CLQA 4FL9A 4M3UA 1WSEA 3GL1A 4J2BA 3KD1E 3THVA 2OA8A 4V19S 3O9UA 4EP5A 4E1JA 2A3ZA 1DTTA 1XC9A 1OH7A 1HX1A 2XY8A 4Z94A 3B8AX 4HTLA 4FJLA 2F96A 2I7PA 1FXXA 2Q97A 3P39A 5AQZA 2ZM6K 2O4GA 3VF4A 4CGFA 3OYIA 3AVAA 3MEGA 2HHSA 3DRPA 4LFBK 3CPEA 4J2EA 2G8HA 4E7JA 2YNIA 3MWTA 5JS1A 4KTWA 5LL6Z 1VQNN 3MAQA 4JNEA 3CFOA 3IKMA 3AVLA 4RW8A 5FPMA 2JWKA 3CXCM 3WNHA 1L3VA 2E5LK 3LDOA 4F2SA 3DLBA 3THYB 1FKOA 4NLBA 4AHRA 2E1ZA 3MDQA 4M3YA 4OO1J 1BDGA 1FKPA 1YTUA 3OYKA 3I0SA 3O9TA 3M5RA 4FW1A 5M1KA 4J8FA 2AJQA 4WE1A 1VSJA 4BG9A 3SUNA 1YT3A 3MXJA 4O0IA 3EEQA 1QQNA 3K5MA 3CCJN 2LSNA 5GIOA 4M41A 1UOCA 1TKZA 3SPYA 4M42A 3LALA 1LAWA 4ILJA 4W5OA 3DLKA 2QA4N 1BU6O 4CF9A 4QCLA 4LD0A 1NGEA 1F21A 3THWA 3M8SA 4DQPA 2ASMA 4FPAA 3HM8A 1HPMA 1I3AA 3ALYA 3MX5A 2FF6A 4Y0WA 4A2AA 2RN2A 3FE1A 1XWLA 3M8QA 1L3TA 4JYAK 1TK0A 4JEPA 2HB5A 4BRCA 3TWHA 4JI1K 5AQQA 1VRTA 4CFAA 4OPHA 1Q82O 4KH5A 5EU7A 1B9FA 1TL3A 2G8UA 4MDAA 2ITGA 1NJYA 4AM6A 4FLXA 4AILC 3E1YA 1ZBUA 3AA3A 4EZ9A 1R59O 1WSJA 1JXBA 3CMEN 4CJKA 3U6FA 4HUGA 3AY9A 5MLCQ 1KC8O 2A40A 2YKNA 3ZSVA 3SBGA 5KPZA 5DM7L 1JKHA 4DS5A 3H1VX 2B4JA 2GX9A 3G4SN 1K8KA 1NK5A 2P5OA 3OBWA 4RW9A 4FOEA 3QLHA 1BWFO 2V7ZA 3H3OB 4CEZA 1KVBA 4FLTA 2R7YA 5AZIB 2GV9A 3C94A 4YY3K 3J8AA 4WQ4C 4U7BA 4YHHK 1N32K 3O9QA 2NNWA 1N34K 5DM6L 4BC4A 2JLEA 4JKBA 4E7HA 2PBDA 1NGCA 1O1WA 4XH5A 3V9XA 4KH6A 5CZ2A 3ENHA 4IO8A 2QWMA 5HBMA 3BGRA 3WT0A 3GOIA 1DGKN 4G1QA 3PX0A 1WB9A 2Q1NA 4J2DA 2BUPA 2NRRA 3ZSZA 1L3SA 2VGMA 4CJ5A 3VF6A 3VEWA 3OTOK 4BE1A 5BPNA 1NGIA 4CIEA 3L0QA 4CIGA 3C7NB 1S1VA 4WYBA 1UWBA 3MX2A 4JI4K 3NF6A 4DR3K 4H0XB 2ZF5O 4I9QA 1B92A 3LP0A 5SWMA 2E6LA 3OYDA 3OYJA 1JLCA 2KQ2A 3T1YK 5ADXA 3HM9A 3UB5A 1JLGA 3OYMA 1XQSC 3VGMA 5AQWA 4FJJA 4KB0A 5FDLA 1IG9A 4KHQA 3SAHA 1BHLA 3P5JA 1S6PA 4KBOA 1I94K 4C8LA 2QEXN 4H4MA 3U3YA 4H5WA 3THYA 4CJPA 1CZ9A 4WFNL 1DKGD 1G15A 3D2EB 3PSIA 3AVHA 3DRSA 1NJIO 1KSPA 2E4LA 2I5JA 3O8MA 4DV1K 3F5TA 1XHXA 3RRHA 1Y64A 5BRFA 4CEOA 5AZJB 3VMFB 1X9JA 3MECA 1FK9A 2HNYA 1LW0A 2W6KA 1TUYA 3M8RA 1IH7A 4M3TA 5F2RA 4AHTA 1VQMN 4DFMA 4HCBA 4JI7K 4DV3K 2QI2A 2PY5A 4B3MK 3FZMA 1LW2A 4PA1A 2UXBK 5FPDA 1OH6A 4CJFA 3TARA 3OYGA 3SNNA 1EO1A 4AHSA 1VQ4N 3K5LA 3TAFA 5C0YA 3S41A 4KB1A 3MWPA 3L2WA 4BR7A 1G99A 4IFYA 2EHGA 2YX6A 5HOOA 1L3UA 1Q9YA 3QNNA 1QSLA 3VPZA 3RMAA 1NJXA 1MU2A 3NH2A 3KLFA 4DSFA 4JK8A 1RILA 5HRRA 3HTVA 3F9KA 3SV3A 2A5XA 4IFEA 3OYAA 4NO7A 2QXFA 3LPTA 3AARA 4BRNA 1U47A 5JLHA 2GELA 4RCHA 3VN5A 2JWLA 3WXJA 4AHVA 2RKIA 4PHTX 3QDKA 4M45A 1WOQA 4FLYA 3A0IX 3LDSA 1RT7A 4IKFA 2ASOA 4EFHA 4M63C 2W41A 2B6AA 4OKEA 3CF5L 1MDUB 4FWMA 4CD3A 4I6MB 4O5BA 3TTDA 3W0LA 1NK9A 3QIPA 1BA0A 4HHTA 1ZC6A 3LP2A 5SZTA 3DOKA 1IBMK 5GAGP 5C42A 3ZX3A 2A41A 1QS4A 4KPYA 4A5BA 4JKHA 5C10A 1T44A 1B9DA 1NGJA 1HYVA 5J1EA 4ELUA 1K8AO 3O3GA 2P9UB 2OTJN 1UAXA 1TUUA 3IFRA 1KTQA 3D6RA 1ZBFA 4FW2A 3D0PA 2UYTA 4EZ6A 1BI4B 4E7IA 2P5GA 4YOYA 4NLCA 1RTDA 4IBNA 3GBTA 3TAEA 4IFVA 4DSJA 3KK2A 2FSNA 2GUIA 3ASMA 4BQZA 3JAMO 4FVUA 3HP9A 3WNEA 1HPZA 3AO2A 4JS4A 3C7NA 4JI8K 4K8ZA 2WTUA 4DR1K 1BO5O 1U04A 1KFDA 2A6AA 2V52B 3TSQA 3PLAA 4YFUA 2Z1JA 3DMJA 4FWQA 5AQGA 3U9ZA 5AQXA 4EAHD 1BQNA 3FZHA 3U9DA 2CH6A 1EX4A 3AVGA 5BN8A 3HI0A 3V6DA 5J2QA 2HHHK 4FWPA 3SI6A 5JVGL 4H4OA 3CJCA 3T19A 1SQKA 4YOTA 4R5PA 1QSYA 1KLNA 4CE9A 1ASUA 1YF5L 2HMPA 3LZJA 5AQRA 3RVCA 4RW4A 5H1SQ 1BISA 3M1FA 3AVJA 1OKJA 3HRGA 4DR5K 2BH1A 3I56N 1N36K 2WC9A 4CGIA 3D2EA 4ELVA 4FJ9A 4FZYA 4JK7A 3DRRA 5KI6A 5FLXO 2RHKA 3V9SA 4C8KA 4BR9A 2AA4A 4IOAL 3NFAA 4DU1A 3VETA 1VQON 1TAUA 3B6OA 1U2VB 5TKWA 5AZJA 1ILYA 4Z4IA 4ISGA 5GADP 4CERA 4YOUA 4GKJK 5KQ8A 4NCAA 4CJEA 1E4GT 3DM2A 4X65K 3SJHA 4C23A 3VTHA 3U4LA 3CJAA 4BVPA 1KLMA 4DUZK 3E9LA 1JCGA 3V9WA 3J7AP 2O8FB 4FXDA 3MN7A 2Y1JA 1JLFA 4BR4A 4N56A 5LMUK 2HHXA 1TGOA 4O8KA 1C0TA 4Y1CA 1NMDA 4B9VA 2YHWA 2IIRA 5AFUA 1WNSA 3HBTA 5JVHL 4LF6K 3FZFA 1XUPO 1UA0A 3A5MC 2FXUA 3U3GA 4E7KA 3LAMA 4KHWA 3CERA 5K14A 4H5VA 2Q2RA 2XY6A 3D7EO 3GE1A 4YORA 2XHBA 4CJQA 3CJ1A 4K8XA 2YKMA 5CHIA 2X6NA 4CJSA 4Q0BA 5C24A 3I55N 3NBPA 3ATUA 4B9QA 2VG6A 1NWKA 4X66K 1ASWA 4CJRA 1QVFM 2BANA 4C1NI 3KK1A 4WQ5C 5T7BA 3OJSA 3VQCA 3QO9A 2P9UA 5AQMA 3K5NA 3KK7A 3AAQA 1J53A 4C1NK 1BI4A 1VQ8N 4O55A 3ZX0A 2GTDA 4CEAA 2WUSA 1S72N 3L2QA 2JGUA 1Z6RA 4CJTA 3EYZA 2KZMA 4OX9K 1FJGK 1HLUA 3M8PA 4BRPA 4JD2B 4DTNA 4DF4A 3CETA 3SUQA 3KLGA 2HBKA 4BRFA 1RDWX 5CY4A 2IGIA 4A5AA 2WONA 4LF4K 1RT1A 3BEXA 1EETA 4CFDA 3CC4N 1NMNA 1GLDG 4RW7A 3SYZA 4CK2A 3DXMB 3VA3A 4PQUA 2HHQA 3HPGA 3ZEUB 4MQ3A 2Q31A 2GEMA 1NKCA 4LF7K 4KHPK 1YIJN 5DK5A 4FPBA 3CCRN 3FFKB 3RSEB 3MMVA 4GVEA 1WN7A 4DQIA 2QWPA 3TABA 1J5EK 3QB0A 3H45C 1JLQA 3S3NA 3EE9A 3GG4A 3K5OA 3AVIA 2VQFK 3MCPA 4IWVA 1ZBIA 2EX3A 3SQ0A 1O13A 4KKOA 2YI1A 2YNHA 1WSIA 4Z0UA 1VSIA 1TKDA 1U2VA 3TI0A 3DJCA
chains in the Genus database with same CATH topology
3OS1A 3IRXA 1RT3A 1J9AA 4NYFA 3LANA 2P51A 3V9XA 1NJWA 3L3UA 5CZ2A 4B8CA 2OZMA 4FLUA 4FZZA 4M3ZA 4O0JA 5HBMA 4FM0A 1HYZA 3BGRA 3K57A 3ZSYA 1T7PA 1KCFA 3KIOA 1NK7A 1RDDA 3ZSXA 1RT2A 4G1QA 3PX0A 1BQMA 4J2DA 3G10A 3ZSZA 1SKWA 1L3SA 4CJ5A 3V1RA 1SL1A 1VSDA 3OYHA 4LY7A 4BE1A 3AVKA 3NF7A 4NYNA 5DMRA 4I2QA 4CGGA 1TKXA 3TR8A 4CEDA 3QERA 1HQEA 4CIEA 1C1BA 2HVHA 1J54A 3NDKA 3PO4A 3L8BA 1JLAA 3AVCA 4CIGA 3SUOA 1NJZA 3RMCA 4PWDA 4F3OA 4AHCA 1S1VA 2IDOA 5HRNA 3SJJA 1EXQA 2BE2A 4C8NA 4OKKA 1NKEA 5J2NA 1VSHA 3VQQA 3ZSOA 1UWBA 5KGWA 1NK8A 4FCYA 3NF6A 3PO5A 3QETA 2G8WA 1YVUA 3PUFA 1B92A 3LP0A 4I9QA 1ZBLA 2F8SA 5SWMA 3ZCMA 2E6LA 1ITGA 4CHYA 3OYDA 3SCXA 2A1SA 2OPRA 4FJ7A 4LH4A 1JLCA 4LH5A 5CYQA 3OYJA 1EKEA 2KQ2A 4L8RB 4B3OA 4B9UA 1VSLA 1ZYQA 3ZT0A 2HHVA 3AA4A 3VQAA 1RBTA 4Z4CA 3HM9A 2FBXA 3IAYA 1JLGA 3OYMA 4UQGA 3OVNA 4FJJA 2D5RA 4ID5A 4KB0A 5HP1A 2KW4A 3DLGA 5FDLA 1IG9A 4KHQA 1BHLA 3P5JA 4CF1A 1S6PA 4DTMA 3KKSA 1JL2A 4C8LA 3SV4A 3ITHA 4H4MA 2GBZA 1RBSA 5J2MA 3U3YA 1JLEA 2PYJA 4CJPA 3NGZA 3MEEA 1CZ9A 2ETJA 2Z1IA 4CJWA 3CM6A 1G15A 5C25A 4IG3A 2O4IA 2DTUA 4M3XA 4CJLA 2IAJA 4DTSA 4PUOA 4KHSA 3O4NA 3IS9A 2KFNA 4N5SA 3AVHA 1RBVA 1VK0A 1Z26A 3OYFA 4KO0A 1BCOA 4IDKA 4AH9A 3DRSA 1IKVA 3AO1A 1KSPA 4CGJA 1RDCA 2E4LA 2I5JA 3MEDA 2P1JA 1KRPA 2ZE2A 3NAEA 1XHXA 3VQ5A 3RRHA 1U48A 3K59A 4DSLA 2D0BA 3VQDA 1XI1A 5JS2A 4CIFA 1IKYA 4CEOA 3NHGA 4DLGA 1SL2A 4DSIA 1S1UA 1S1XA 3WNFA 3LPUA 3MECA 1SKSA 1IKXA 1FK9A 2HNYA 3KTQA 4HCCA 3QEPA 1LW0A 1D8YA 2VG5A 3M8RA 3TAPA 3ZT3A 1IH7A 1RDBA 4M3TA 4AHTA 4MFBA 1I39A 4DFMA 1Q9XA 4HCBA 1S9EA 2PY5A 1QSSA 1LW2A 4ZHRA 4OPKA 2E6MA 4PA1A 3DI6A 1XHZA 1LWFA 4CJFA 4FM2A 3T3FA 5FRNA 2ATQA 3OYGA 1TL1A 4CHZA 4AHSA 3OYLA 3TARA 3SNNA 3K5LA 3ZT2A 3TAFA 2FC0A 3SQ2A 3P1GA 1WLJA 4KB1A 3CM5A 3L2WA 1X9WA 4IFYA 2EHGA 1L3UA 4DMNA 4W5QA 1Q9YA 2DFEA 4O4GA 4DTJA 3QNNA 1QSLA 3TAMA 4BWJA 3RMAA 4M3RA 4ID1A 1NJXA 1TV6A 1MU2A 3T1AA 3NH2A 3KLFA 4DSFA 1ZBHA 1BCMA 1RILA 5HRRA 3F9KA 4KFBA 4Q5VA 3SV3A 1S1TA 3OYAA 1T03A 4FJXA 3O4QA 2QXFA 3LPTA 2XRIA 3SZ2A 1U4BA 1U47A 1QHTA 2PYLA 2G8VA 2OPPA 4KHUA 3QIOA 3VN5A 3S3OA 3CYMA 4E89A 3VQ4A 4BE2A 4H8KA 4W5RA 3CG7A 4AHVA 1RCHA 5KGXA 2YNFA 1A5WA 2RKIA 2IOCA 2VG7A 3H08A 4QAGA 4M45A 3VQ8A 3CFPA 4FLYA 1KVCA 3AVFA 3LDSA 1GOAA 1RT7A 4DS4A 4IKFA 3AO4A 2D0AA 3HYFA 3VQ7A 2B6AA 2A1RA 4OKEA 4CK3A 3AA2A 3V1OA 4CJ4A 2VWKA 1BIZA 3EY1A 2XO7A 5HROA 4B8AB 4EP4A 4DU4A 1U49A 4DWIA 3KKRA 4O5BA 1NK9A 3QIPA 4HHTA 1VRUA 2ZD1A 3ZSRA 1HJRA 5I3UA 4ELTA 4KTQA 5CZ1A 1L5UA 4E3SA 3V81A 3AO5A 3LP2A 5SZTA 3DOKA 4FVMA 3RMDA 4FM1A 5C42A 4F4KA 4KI4A 1QE1A 2W42A 3RWUA 1C1AA 4HUEA 4DF8A 1QS4A 4CHOA 4KPYA 3L2UA 3HT3A 3I8DA 4NCGA 4OGEA 4DFPA 2QKKA 1B9DA 5KRTA 3VA0A 3WNGA 3QNOA 4KI6A 1HYVA 5J1EA 3OS0A 3CFRA 3DLHA 4OJRA 4FJKA 4B9TA 4ELUA 2HHWA 4CJUA 3F73A 4FK4A 3O3GA 4DQRA 4Y1DA 1UAXA 4FZXC 1KTQA 1HNIA 1ZBFA 4FW2A 3D0PA 4GVMA 2HMIA 4EZ6A 1BI4B 4DTOA 4HUFA 3PY8A 4E7IA 1LWEA 2P5GA 1DTQA 1RTDA 4FJGA 4IBNA 1KVAA 4XIUA 1TAQA 3UIQA 4FYDA 2ZQBA 4DFKA 3TAEA 3C95A 4IFVA 4DSJA 4F8RA 1X1PA 3KK2A 2GUIA 4Z4GA 3ASMA 3LWLA 3HK2A 2HW3A 1WSHA 4B9NA 4E1NA 2G8KA 2FBTA 3HP9A 3IG1A 4CEEA 3WNEA 1HPZA 3AO2A 3PX6A 4Z4FA 5D3GA 4JS4A 2HNDA 4W5TA 1WAJA 2YV0X 3AA5X 4CECA 4CK1A 4K8ZA 3LP1A 4KREA 3NF8A 1U04A 1KFDA 3CQ8A 4B9MA 2HHTA 4BDYA 4YFUA 3AVMA 4CF2A 1HNVA 2Z1JA 3DMJA 4KHYA 4N76A 3BDPA 3KD5E 3QEVA 1BQNA 5J2PA 3O3HA 1WAFA 3OYCA 3V4IA 4CHNA 3RMBA 4HVJA 2PZSA 4OKJA 1EX4A 3HXMA 3AVGA 2YHBA 3L3VA 1Q8IA 3TAQA 1U45A 3QEWA 4E1MA 4BE0A 3V6DA 4J2AA 5J2QA 2KTQA 2BDPA 3DOLA 2KFZA 3SUPA 1A5XA 2OPQA 3SI6A 2YNGA 1REVA 3KLHA 4BDZA 3LZIA 4I2PA 1SUQA 5HLFA 2RPIA 4CESA 4H4OA 2IS3A 3T19A 3VQBA 2VWJA 4R5PA 1QSYA 1KLNA 2KZZA 3RTVA 3SPZA 4QOZB 4CE9A 4TSXA 2FBYA 4DSEA 1J5OA 4CF8A 1ASUA 3AVBA 4BWMA 4JS5A 4DQQA 1CXUA 3LZJA 1NOYA 1RTJA 1VSMA 4RW4A 3JYTA 3RRGA 1HYSA 1BISA 1GOCA 3AVJA 3HPHA 1HMVA 3NGYA 2G8FA 1TVRA 4CEBA 3OYEA 4FJ9A 4CGIA 4B9LA 4ELVA 4FZYA 5KRSA 3DRRA 4FJ5A 5KI6A 1W9HA 4CEQA 1NK6A 4M3WA 3V9SA 1TK5A 4C8KA 1JLBA 1LAVA 2OZSA 3ZSWA 3HVTA 1CZBA 4ZTFA 4LSLA 1QQCA 1BL3A 2B5JA 3NFAA 4C8MA 4DU1A 3E01A 1TAUA 5E41A 2DY4A 3A2FA 3B6OA 1RBRA 4KRFA 1X9MA 4Z4IA 3KK3A 1C0MA 1D5AA 1GOBA 4CERA 5I42A 4KHNA 2HHUA 1C1CA 1RBUA 2QK9A 3K2PA 4NCAA 4GW6A 4RW6A 4CJEA 3QEXA 4CJ3A 4DTPA 1HQUA 1UA1A 3I0RA 1RT6A 1SL0A 3V9ZA 1C0UA 3DM2A 4B08A 4CHQA 4DTRA 4FLZA 1Y97A 2DFFA 3HL8A 5HRSA 2IC3A 1IO2A 3NH0A 3HVRA 4FJNA 1CLQA 3C6UA 4M3UA 1S1WA 1DLOA 1WSEA 2HVIA 4J2BA 1KLMA 5FROA 3KD1E 1TK8A 3THVA 2OA8A 4EP5A 1NOZA 3V9WA 4DLEA 2Y1IA 3HSTB 3V1QA 1RTHA 4NCBA 4FXDA 1DTTA 2Y1JA 1JLFA 1XC9A 2XY8A 1S6QA 3LAKA 4FLVA 4N56A 1S9GA 2HHXA 1TGOA 1SKRA 1KFSA 3LWMA 4FJLA 1C0TA 2F96A 4Y1CA 1FXXA 4B9VA 3V9UA 1LWCA 3RR8A 3OYBA 1IKWA 5FRMA 2DFHA 2Z1GA 4CFBA 1WNSA 2O4GA 4CGFA 3C6TA 3AVAA 3MEGA 3OYIA 2X6SA 3DRPA 3TAGA 1UA0A 4OLBA 3HO1A 3ISNC 3U3GA 4E7KA 4DTXA 4OLAA 4J2EA 2G8HA 3LAMA 4KHWA 2OYQA 3DLEA 4E7JA 2YNIA 5K14A 5JS1A 4KTWA 3D45A 3DYAA 4F2RA 3MAQA 3ZT1A 2XY6A 1X9SA 4DSKA 3CFOA 2OPSA 4DG1A 1R0AA 2QKBA 4CJVA 1N6QA 4I9LA 3AVLA 4RW8A 2XHBA 3AO3A 3WNHA 2RF2A 4CJQA 1L3VA 3P83D 3MXMA 4FJMA 1LV5A 4K8XA 2YKMA 3DLRA 2X6NA 4AHUA 4BDPA 4CGHA 4OVLA 4F2SA 3DLBA 1FKOA 4AHRA 4CJSA 1VSKA 3OY9A 3OYNA 4M3YA 5C24A 1RT4A 4E19A 3S3MA 4Q0BA 3S9HA 3NBPA 4KAZA 1FKPA 1YTUA 2WOMA 4F3TA 4OPJA 3AV9A 2VG6A 3OYKA 2FBVA 3K58A 3I0SA 2XY5A 3VQ9A 4KTZA 4N41A 1WSFA 4FW1A 1NK4A 4BACA 1T8EA 2AJQA 4WE1A 1VSJA 3SUNA 1ASWA 1TKTA 1YT3A 4CJRA 2BANA 3KK1A 3MXJA 4O0IA 5T7BA 3OJSA 1S5JA 3HJFA 1T05A 1D9FA 1EP4A 3VQCA 3K5MA 4DTUA 3QO9A 4ZTJA 1RDAA 2LSNA 3K5NA 3KLIA 4DU3A 1N5YA 1NKBA 4M41A 4FK0A 4Z4EA 1C6VA 4I7FA 1HRHA 1UOCA 3O3FA 1TKZA 1J53A 3SPYA 1BI4A 4FLWA 3L2VA 2F8TA 4DQSA 1RNHA 3LALA 1LAWA 4O55A 4M42A 4W5OA 3NF9A 4JLHA 1BGXT 3DLKA 2Q3SA 4CF9A 4QCLA 4LD0A 1Z25A 4CEAA 1F21A 3QINA 3L2QA 4E0DA 2JGUA 3M8SA 4DQPA 1CXQA 1A5VA 1WSGA 4CJTA 3EYZA 2KZMA 3PX4A 2BGGA 2XY7A 1I3AA 3M8PA 1K6YA 3PV8A 3ALYA 4PY5A 4DTNA 3QEIA 4DF4A 2RN2A 3SUQA 3KLGA 3VQPA 1XWLA 3G0ZA 3M8QA 4YNQA 1L3TA 5CY4A 1TK0A 4FJIA 2IGIA 5KTQA 3L2RA 4CCHA 2HB5A 2WONA 3TWHA 3QESA 1RT1A 1VRTA 4ICLA 1EETA 4CFAA 4CFDA 3LP3A 1RTIA 1YTAA 4RW7A 3SYZA 2X74A 5EU7A 4CK2A 1B9FA 1TL3A 1NK0A 3VA3A 2G8UA 2ITGA 3KLEA 4LSNA 1NJYA 4PQUA 3HPGA 2HHQA 1SV5A 3AVNA 4B9SA 4MQ3A 4FLXA 4AILC 3TANA 4JRPA 1ZBUA 2HNZA 3AA3A 4EZ9A 4W5NA 3ZSQA 3MXIA 1WSJA 1BIUA 1W0HA 3JSMA 3ULDA 1NKCA 1RT5A 5CYMA 1JXBA 4CHPA 4DFJA 3SQ4A 5DK5A 2HHSA 4CJKA 4GMJB 3U6FA 4JRQA 3KJVA 3ZT4A 4HUGA 3VQEA 4FJHA 3OJUA 2YKNA 3ZSVA 4CGDA 2X78A 4Z4HA 3EZ5A 1VSFA 1WN7A 1JKHA 4DS5A 4DQIA 3TABA 2B4JA 3HP6A 1VSEA 5HRPA 1JLQA 2YHAA 4HTUA 3S3NA 1JXEA 1NK5A 4RG8A 3NGIA 2P5OA 2G8IA 4FK2A 4RW9A 3NCIA 2NUBA 4E7LA 3K5OA 3QLHA 3AVIA 3NE6A 3FFIA 3OS2A 1D9DA 4CEZA 1KVBA 2Z1HA 4FLTA 1JL1A 1ZBIA 3VQ6A 4CEFA 1QTMA 2D0CA 2EX3A 4O44A 1ASVA 4KV8A 4KKOA 2GV9A 3C94A 2R7YA 3SQ0A 4OGCA 4IG0A 4CFCA 4FJ8A 3SQ1A 3NH1A 2YNHA 4N47A 1WSIA 4C8OA 4Z0UA 1VSIA 2JLEA 1TKDA 3B6PA 4E7HA 4CF0A 3HPOA 3TI0A 1O1WA 3RR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OS1 A;  3IRX A;  1RT3 A;  1J9A A;  4NYF A;  3LAN A;  2P51 A;  3V9X A;  1NJW A;  3L3U A;  5CZ2 A;  4B8C A;  2OZM A;  4FLU A;  4FZZ A;  4M3Z A;  4O0J A;  5HBM A;  4FM0 A;  1HYZ A;  3BGR A;  3K57 A;  3ZSY A;  1T7P A;  1KCF A;  3KIO A;  1NK7 A;  1RDD A;  3ZSX A;  1RT2 A;  4G1Q A;  3PX0 A;  1BQM A;  4J2D A;  3G10 A;  3ZSZ A;  1SKW A;  1L3S A;  4CJ5 A;  3V1R A;  1SL1 A;  1VSD A;  3OYH A;  4LY7 A;  4BE1 A;  3AVK A;  3NF7 A;  4NYN A;  5DMR A;  4I2Q A;  4CGG A;  1TKX A;  3TR8 A;  4CED A;  3QER A;  1HQE A;  4CIE A;  1C1B A;  2HVH A;  1J54 A;  3NDK A;  3PO4 A;  3L8B A;  1JLA A;  3AVC A;  4CIG A;  3SUO A;  1NJZ A;  3RMC A;  4PWD A;  4F3O A;  4AHC A;  1S1V A;  2IDO A;  5HRN A;  3SJJ A;  1EXQ A;  2BE2 A;  4C8N A;  4OKK A;  1NKE A;  5J2N A;  1VSH A;  3VQQ A;  3ZSO A;  1UWB A;  5KGW A;  1NK8 A;  4FCY A;  3NF6 A;  3PO5 A;  3QET A;  2G8W A;  1YVU A;  3PUF A;  1B92 A;  3LP0 A;  4I9Q A;  1ZBL A;  2F8S A;  5SWM A;  3ZCM A;  2E6L A;  1ITG A;  4CHY A;  3OYD A;  3SCX A;  2A1S A;  2OPR A;  4FJ7 A;  4LH4 A;  1JLC A;  4LH5 A;  5CYQ A;  3OYJ A;  1EKE A;  2KQ2 A;  4L8R B;  4B3O A;  4B9U A;  1VSL A;  1ZYQ A;  3ZT0 A;  2HHV A;  3AA4 A;  3VQA A;  1RBT A;  4Z4C A;  3HM9 A;  2FBX A;  3IAY A;  1JLG A;  3OYM A;  4UQG A;  3OVN A;  4FJJ A;  2D5R A;  4ID5 A;  4KB0 A;  5HP1 A;  2KW4 A;  3DLG A;  5FDL A;  1IG9 A;  4KHQ A;  1BHL A;  3P5J A;  4CF1 A;  1S6P A;  4DTM A;  3KKS A;  1JL2 A;  4C8L A;  3SV4 A;  3ITH A;  4H4M A;  2GBZ A;  1RBS A;  5J2M A;  3U3Y A;  1JLE A;  2PYJ A;  4CJP A;  3NGZ A;  3MEE A;  1CZ9 A;  2ETJ A;  2Z1I A;  4CJW A;  3CM6 A;  1G15 A;  5C25 A;  4IG3 A;  2O4I A;  2DTU A;  4M3X A;  4CJL A;  2IAJ A;  4DTS A;  4PUO A;  4KHS A;  3O4N A;  3IS9 A;  2KFN A;  4N5S A;  3AVH A;  1RBV A;  1VK0 A;  1Z26 A;  3OYF A;  4KO0 A;  1BCO A;  4IDK A;  4AH9 A;  3DRS A;  1IKV A;  3AO1 A;  1KSP A;  4CGJ A;  1RDC A;  2E4L A;  2I5J A;  3MED A;  2P1J A;  1KRP A;  2ZE2 A;  3NAE A;  1XHX A;  3VQ5 A;  3RRH A;  1U48 A;  3K59 A;  4DSL A;  2D0B A;  3VQD A;  1XI1 A;  5JS2 A;  4CIF A;  1IKY A;  4CEO A;  3NHG A;  4DLG A;  1SL2 A;  4DSI A;  1S1U A;  1S1X A;  3WNF A;  3LPU A;  3MEC A;  1SKS A;  1IKX A;  1FK9 A;  2HNY A;  3KTQ A;  4HCC A;  3QEP A;  1LW0 A;  1D8Y A;  2VG5 A;  3M8R A;  3TAP A;  3ZT3 A;  1IH7 A;  1RDB A;  4M3T A;  4AHT A;  4MFB A;  1I39 A;  4DFM A;  1Q9X A;  4HCB A;  1S9E A;  2PY5 A;  1QSS A;  1LW2 A;  4ZHR A;  4OPK A;  2E6M A;  4PA1 A;  3DI6 A;  1XHZ A;  1LWF A;  4CJF A;  4FM2 A;  3T3F A;  5FRN A;  2ATQ A;  3OYG A;  1TL1 A;  4CHZ A;  4AHS A;  3OYL A;  3TAR A;  3SNN A;  3K5L A;  3ZT2 A;  3TAF A;  2FC0 A;  3SQ2 A;  3P1G A;  1WLJ A;  4KB1 A;  3CM5 A;  3L2W A;  1X9W A;  4IFY A;  2EHG A;  1L3U A;  4DMN A;  4W5Q A;  1Q9Y A;  2DFE A;  4O4G A;  4DTJ A;  3QNN A;  1QSL A;  3TAM A;  4BWJ A;  3RMA A;  4M3R A;  4ID1 A;  1NJX A;  1TV6 A;  1MU2 A;  3T1A A;  3NH2 A;  3KLF A;  4DSF A;  1ZBH A;  1BCM A;  1RIL A;  5HRR A;  3F9K A;  4KFB A;  4Q5V A;  3SV3 A;  1S1T A;  3OYA A;  1T03 A;  4FJX A;  3O4Q A;  2QXF A;  3LPT A;  2XRI A;  3SZ2 A;  1U4B A;  1U47 A;  1QHT A;  2PYL A;  2G8V A;  2OPP A;  4KHU A;  3QIO A;  3VN5 A;  3S3O A;  3CYM A;  4E89 A;  3VQ4 A;  4BE2 A;  4H8K A;  4W5R A;  3CG7 A;  4AHV A;  1RCH A;  5KGX A;  2YNF A;  1A5W A;  2RKI A;  2IOC A;  2VG7 A;  3H08 A;  4QAG A;  4M45 A;  3VQ8 A;  3CFP A;  4FLY A;  1KVC A;  3AVF A;  3LDS A;  1GOA A;  1RT7 A;  4DS4 A;  4IKF A;  3AO4 A;  2D0A A;  3HYF A;  3VQ7 A;  2B6A A;  2A1R A;  4OKE A;  4CK3 A;  3AA2 A;  3V1O A;  4CJ4 A;  2VWK A;  1BIZ A;  3EY1 A;  2XO7 A;  5HRO A;  4B8A B;  4EP4 A;  4DU4 A;  1U49 A;  4DWI A;  3KKR A;  4O5B A;  1NK9 A;  3QIP A;  4HHT A;  1VRU A;  2ZD1 A;  3ZSR A;  1HJR A;  5I3U A;  4ELT A;  4KTQ A;  5CZ1 A;  1L5U A;  4E3S A;  3V81 A;  3AO5 A;  3LP2 A;  5SZT A;  3DOK A;  4FVM A;  3RMD A;  4FM1 A;  5C42 A;  4F4K A;  4KI4 A;  1QE1 A;  2W42 A;  3RWU A;  1C1A A;  4HUE A;  4DF8 A;  1QS4 A;  4CHO A;  4KPY A;  3L2U A;  3HT3 A;  3I8D A;  4NCG A;  4OGE A;  4DFP A;  2QKK A;  1B9D A;  5KRT A;  3VA0 A;  3WNG A;  3QNO A;  4KI6 A;  1HYV A;  5J1E A;  3OS0 A;  3CFR A;  3DLH A;  4OJR A;  4FJK A;  4B9T A;  4ELU A;  2HHW A;  4CJU A;  3F73 A;  4FK4 A;  3O3G A;  4DQR A;  4Y1D A;  1UAX A;  4FZX C;  1KTQ A;  1HNI A;  1ZBF A;  4FW2 A;  3D0P A;  4GVM A;  2HMI A;  4EZ6 A;  1BI4 B;  4DTO A;  4HUF A;  3PY8 A;  4E7I A;  1LWE A;  2P5G A;  1DTQ A;  1RTD A;  4FJG A;  4IBN A;  1KVA A;  4XIU A;  1TAQ A;  3UIQ A;  4FYD A;  2ZQB A;  4DFK A;  3TAE A;  3C95 A;  4IFV A;  4DSJ A;  4F8R A;  1X1P A;  3KK2 A;  2GUI A;  4Z4G A;  3ASM A;  3LWL A;  3HK2 A;  2HW3 A;  1WSH A;  4B9N A;  4E1N A;  2G8K A;  2FBT A;  3HP9 A;  3IG1 A;  4CEE A;  3WNE A;  1HPZ A;  3AO2 A;  3PX6 A;  4Z4F A;  5D3G A;  4JS4 A;  2HND A;  4W5T A;  1WAJ A;  2YV0 X;  3AA5 X;  4CEC A;  4CK1 A;  4K8Z A;  3LP1 A;  4KRE A;  3NF8 A;  1U04 A;  1KFD A;  3CQ8 A;  4B9M A;  2HHT A;  4BDY A;  4YFU A;  3AVM A;  4CF2 A;  1HNV A;  2Z1J A;  3DMJ A;  4KHY A;  4N76 A;  3BDP A;  3KD5 E;  3QEV A;  1BQN A;  5J2P A;  3O3H A;  1WAF A;  3OYC A;  3V4I A;  4CHN A;  3RMB A;  4HVJ A;  2PZS A;  4OKJ A;  1EX4 A;  3HXM A;  3AVG A;  2YHB A;  3L3V A;  1Q8I A;  3TAQ A;  1U45 A;  3QEW A;  4E1M A;  4BE0 A;  3V6D A;  4J2A A;  5J2Q A;  2KTQ A;  2BDP A;  3DOL A;  2KFZ A;  3SUP A;  1A5X A;  2OPQ A;  3SI6 A;  2YNG A;  1REV A;  3KLH A;  4BDZ A;  3LZI A;  4I2P A;  1SUQ A;  5HLF A;  2RPI A;  4CES A;  4H4O A;  2IS3 A;  3T19 A;  3VQB A;  2VWJ A;  4R5P A;  1QSY A;  1KLN A;  2KZZ A;  3RTV A;  3SPZ A;  4QOZ B;  4CE9 A;  4TSX A;  2FBY A;  4DSE A;  1J5O A;  4CF8 A;  1ASU A;  3AVB A;  4BWM A;  4JS5 A;  4DQQ A;  1CXU A;  3LZJ A;  1NOY A;  1RTJ A;  1VSM A;  4RW4 A;  3JYT A;  3RRG A;  1HYS A;  1BIS A;  1GOC A;  3AVJ A;  3HPH A;  1HMV A;  3NGY A;  2G8F A;  1TVR A;  4CEB A;  3OYE A;  4FJ9 A;  4CGI A;  4B9L A;  4ELV A;  4FZY A;  5KRS A;  3DRR A;  4FJ5 A;  5KI6 A;  1W9H A;  4CEQ A;  1NK6 A;  4M3W A;  3V9S A;  1TK5 A;  4C8K A;  1JLB A;  1LAV A;  2OZS A;  3ZSW A;  3HVT A;  1CZB A;  4ZTF A;  4LSL A;  1QQC A;  1BL3 A;  2B5J A;  3NFA A;  4C8M A;  4DU1 A;  3E01 A;  1TAU A;  5E41 A;  2DY4 A;  3A2F A;  3B6O A;  1RBR A;  4KRF A;  1X9M A;  4Z4I A;  3KK3 A;  1C0M A;  1D5A A;  1GOB A;  4CER A;  5I42 A;  4KHN A;  2HHU A;  1C1C A;  1RBU A;  2QK9 A;  3K2P A;  4NCA A;  4GW6 A;  4RW6 A;  4CJE A;  3QEX A;  4CJ3 A;  4DTP A;  1HQU A;  1UA1 A;  3I0R A;  1RT6 A;  1SL0 A;  3V9Z A;  1C0U A;  3DM2 A;  4B08 A;  4CHQ A;  4DTR A;  4FLZ A;  1Y97 A;  2DFF A;  3HL8 A;  5HRS A;  2IC3 A;  1IO2 A;  3NH0 A;  3HVR A;  4FJN A;  1CLQ A;  3C6U A;  4M3U A;  1S1W A;  1DLO A;  1WSE A;  2HVI A;  4J2B A;  1KLM A;  5FRO A;  3KD1 E;  1TK8 A;  3THV A;  2OA8 A;  4EP5 A;  1NOZ A;  3V9W A;  4DLE A;  2Y1I A;  3HST B;  3V1Q A;  1RTH A;  4NCB A;  4FXD A;  1DTT A;  2Y1J A;  1JLF A;  1XC9 A;  2XY8 A;  1S6Q A;  3LAK A;  4FLV A;  4N56 A;  1S9G A;  2HHX A;  1TGO A;  1SKR A;  1KFS A;  3LWM A;  4FJL A;  1C0T A;  2F96 A;  4Y1C A;  1FXX A;  4B9V A;  3V9U A;  1LWC A;  3RR8 A;  3OYB A;  1IKW A;  5FRM A;  2DFH A;  2Z1G A;  4CFB A;  1WNS A;  2O4G A;  4CGF A;  3C6T A;  3AVA A;  3MEG A;  3OYI A;  2X6S A;  3DRP A;  3TAG A;  1UA0 A;  4OLB A;  3HO1 A;  3ISN C;  3U3G A;  4E7K A;  4DTX A;  4OLA A;  4J2E A;  2G8H A;  3LAM A;  4KHW A;  2OYQ A;  3DLE A;  4E7J A;  2YNI A;  5K14 A;  5JS1 A;  4KTW A;  3D45 A;  3DYA A;  4F2R A;  3MAQ A;  3ZT1 A;  2XY6 A;  1X9S A;  4DSK A;  3CFO A;  2OPS A;  4DG1 A;  1R0A A;  2QKB A;  4CJV A;  1N6Q A;  4I9L A;  3AVL A;  4RW8 A;  2XHB A;  3AO3 A;  3WNH A;  2RF2 A;  4CJQ A;  1L3V A;  3P83 D;  3MXM A;  4FJM A;  1LV5 A;  4K8X A;  2YKM A;  3DLR A;  2X6N A;  4AHU A;  4BDP A;  4CGH A;  4OVL A;  4F2S A;  3DLB A;  1FKO A;  4AHR A;  4CJS A;  1VSK A;  3OY9 A;  3OYN A;  4M3Y A;  5C24 A;  1RT4 A;  4E19 A;  3S3M A;  4Q0B A;  3S9H A;  3NBP A;  4KAZ A;  1FKP A;  1YTU A;  2WOM A;  4F3T A;  4OPJ A;  3AV9 A;  2VG6 A;  3OYK A;  2FBV A;  3K58 A;  3I0S A;  2XY5 A;  3VQ9 A;  4KTZ A;  4N41 A;  1WSF A;  4FW1 A;  1NK4 A;  4BAC A;  1T8E A;  2AJQ A;  4WE1 A;  1VSJ A;  3SUN A;  1ASW A;  1TKT A;  1YT3 A;  4CJR A;  2BAN A;  3KK1 A;  3MXJ A;  4O0I A;  5T7B A;  3OJS A;  1S5J A;  3HJF A;  1T05 A;  1D9F A;  1EP4 A;  3VQC A;  3K5M A;  4DTU A;  3QO9 A;  4ZTJ A;  1RDA A;  2LSN A;  3K5N A;  3KLI A;  4DU3 A;  1N5Y A;  1NKB A;  4M41 A;  4FK0 A;  4Z4E A;  1C6V A;  4I7F A;  1HRH A;  1UOC A;  3O3F A;  1TKZ A;  1J53 A;  3SPY A;  1BI4 A;  4FLW A;  3L2V A;  2F8T A;  4DQS A;  1RNH A;  3LAL A;  1LAW A;  4O55 A;  4M42 A;  4W5O A;  3NF9 A;  4JLH A;  1BGX T;  3DLK A;  2Q3S A;  4CF9 A;  4QCL A;  4LD0 A;  1Z25 A;  4CEA A;  1F21 A;  3QIN A;  3L2Q A;  4E0D A;  2JGU A;  3M8S A;  4DQP A;  1CXQ A;  1A5V A;  1WSG A;  4CJT A;  3EYZ A;  2KZM A;  3PX4 A;  2BGG A;  2XY7 A;  1I3A A;  3M8P A;  1K6Y A;  3PV8 A;  3ALY A;  4PY5 A;  4DTN A;  3QEI A;  4DF4 A;  2RN2 A;  3SUQ A;  3KLG A;  3VQP A;  1XWL A;  3G0Z A;  3M8Q A;  4YNQ A;  1L3T A;  5CY4 A;  1TK0 A;  4FJI A;  2IGI A;  5KTQ A;  3L2R A;  4CCH A;  2HB5 A;  2WON A;  3TWH A;  3QES A;  1RT1 A;  1VRT A;  4ICL A;  1EET A;  4CFA A;  4CFD A;  3LP3 A;  1RTI A;  1YTA A;  4RW7 A;  3SYZ A;  2X74 A;  5EU7 A;  4CK2 A;  1B9F A;  1TL3 A;  1NK0 A;  3VA3 A;  2G8U A;  2ITG A;  3KLE A;  4LSN A;  1NJY A;  4PQU A;  3HPG A;  2HHQ A;  1SV5 A;  3AVN A;  4B9S A;  4MQ3 A;  4FLX A;  4AIL C;  3TAN A;  4JRP A;  1ZBU A;  2HNZ A;  3AA3 A;  4EZ9 A;  4W5N A;  3ZSQ A;  3MXI A;  1WSJ A;  1BIU A;  1W0H A;  3JSM A;  3ULD A;  1NKC A;  1RT5 A;  5CYM A;  1JXB A;  4CHP A;  4DFJ A;  3SQ4 A;  5DK5 A;  2HHS A;  4CJK A;  4GMJ B;  3U6F A;  4JRQ A;  3KJV A;  3ZT4 A;  4HUG A;  3VQE A;  4FJH A;  3OJU A;  2YKN A;  3ZSV A;  4CGD A;  2X78 A;  4Z4H A;  3EZ5 A;  1VSF A;  1WN7 A;  1JKH A;  4DS5 A;  4DQI A;  3TAB A;  2B4J A;  3HP6 A;  1VSE A;  5HRP A;  1JLQ A;  2YHA A;  4HTU A;  3S3N A;  1JXE A;  1NK5 A;  4RG8 A;  3NGI A;  2P5O A;  2G8I A;  4FK2 A;  4RW9 A;  3NCI A;  2NUB A;  4E7L A;  3K5O A;  3QLH A;  3AVI A;  3NE6 A;  3FFI A;  3OS2 A;  1D9D A;  4CEZ A;  1KVB A;  2Z1H A;  4FLT A;  1JL1 A;  1ZBI A;  3VQ6 A;  4CEF A;  1QTM A;  2D0C A;  2EX3 A;  4O44 A;  1ASV A;  4KV8 A;  4KKO A;  2GV9 A;  3C94 A;  2R7Y A;  3SQ0 A;  4OGC A;  4IG0 A;  4CFC A;  4FJ8 A;  3SQ1 A;  3NH1 A;  2YNH A;  4N47 A;  1WSI A;  4C8O A;  4Z0U A;  1VSI A;  2JLE A;  1TKD A;  3B6P A;  4E7H A;  4CF0 A;  3HPO A;  3TI0 A;  1O1W A;  3RR7 A; 
#chains in the Genus database with same CATH topology
 1RT3 A;  1J9A A;  2P51 A;  4B1X B;  2OZM A;  1K73 O;  4HWI A;  4O0J A;  4FM0 A;  2KHO A;  1HYZ A;  2UXC K;  1BA1 A;  3K57 A;  3MN6 A;  1OVQ A;  3UKU B;  4CBW A;  4K0K K;  4DR2 K;  3V1R A;  1SL1 A;  4EIA A;  4LY7 A;  3AVK A;  2OAN A;  4I2Q A;  1MWK A;  1C1B A;  3NDK A;  2O8F A;  3SUO A;  3AVC A;  4X62 K;  3QIC A;  3DWL A;  4AHC A;  2IDO A;  4LF8 K;  1CZA N;  3CCE N;  2BE2 A;  2QXL A;  4B1Y B;  1VSH A;  3VQQ A;  3ZSO A;  5KGW A;  4FCY A;  3PO5 A;  4LFA K;  1VQ5 N;  2G8W A;  2F8S A;  3D2F B;  3ZX2 A;  3ZLJ A;  1XNR K;  2OPR A;  4LH5 A;  4B3O A;  4BR0 A;  4B9U A;  1E3M A;  2H3G X;  1ZYQ A;  1RBT A;  5EXW A;  3R9P A;  5AR0 A;  3OVN A;  3L4Q A;  5HP1 A;  4CF1 A;  4DTM A;  1QZ6 A;  1W2B M;  2I7N A;  4BRI A;  3SV4 A;  2GBZ A;  4WFA L;  2UUB K;  2ETJ A;  2Z1I A;  4K25 A;  1BOT O;  3VES A;  4IG3 A;  2O4I A;  3OBY A;  4CJL A;  2IAJ A;  4KHS A;  3O4N A;  5LJW A;  3IS9 A;  4JI5 K;  4N5S A;  3OYF A;  5F0X A;  4AH9 A;  2NRT A;  3AO1 A;  1RDC A;  1KRP A;  2ZE2 A;  1WUA A;  4ISE A;  1EWR A;  2F9W A;  3BZC A;  3SMP A;  1U48 A;  1JCF A;  1XI1 A;  5JS2 A;  1S1U A;  1S1X A;  3WNF A;  3LPU A;  1IKX A;  3N4Q A;  4CI6 A;  4JKA A;  3KTQ A;  1D8Y A;  3ZT3 A;  1RDB A;  4MFB A;  4CBX A;  3SAF A;  4ZHR A;  4JKC A;  2ZJP L;  4FM2 A;  4JD2 A;  4JI6 K;  1TL1 A;  4CHZ A;  3ZT2 A;  2QWN A;  3FLC O;  1WLJ A;  4DMN A;  1KQS M;  4W5Q A;  2DFE A;  4BWJ A;  1YAG A;  4DV7 K;  1H1V A;  3DXM A;  4FJX A;  4BRO A;  3VEV A;  2HBJ A;  3ZEU A;  2G8V A;  1IBL K;  3CYM A;  3LM2 A;  3VQ4 A;  4E89 A;  3P38 A;  4W5R A;  5CR4 A;  4XEI A;  5KGX A;  2YNF A;  1A5W A;  4QAG A;  2VG7 A;  3PIO L;  2EWS A;  1NGA A;  3VQ8 A;  3CI5 A;  3CJ7 A;  4QS9 A;  3JXU A;  3V1O A;  3RSE A;  3UKR B;  4MLH A;  4B8A B;  1U49 A;  4F9O A;  3KKR A;  3HOT A;  4DWI A;  5I3U A;  1HJR A;  4B1W B;  1L5U A;  2V51 B;  4E3S A;  2RE2 A;  1V4T A;  4B1V A;  4FM1 A;  4KI4 A;  2OCE A;  3VOV A;  1VQ6 N;  3HT3 A;  4NCG A;  1ATN A;  5GIP A;  1HNZ K;  5KRT A;  4MO5 A;  3QNO A;  4KI6 A;  3OS0 A;  1GLF O;  2F9T A;  3DLH A;  4B9T A;  3U8X A;  2HHW A;  2D4W A;  4JAX A;  1YXQ A;  5BRE A;  3BZK A;  1WBD A;  1HNI A;  1BUP A;  4GVM A;  4QS8 A;  4BG8 A;  4RWT A;  3K9J A;  5C2D A;  1KVA A;  4FJG A;  1TAQ A;  3UKU A;  2P9K B;  2ZQB A;  3C95 A;  1WBB A;  1K9M O;  4F8R A;  1X1P A;  4FWL A;  5C12 A;  3LWL A;  2GUP A;  1OH8 A;  4DR7 K;  4CEE A;  3O9S A;  4B1U B;  4Z4F A;  5JIC A;  4W5T A;  3AA5 X;  4CK1 A;  3LP1 A;  3VER A;  3NF8 A;  2QWO A;  1HNV A;  3BDP A;  2ZJR L;  1IG8 A;  3O3H A;  3D2F A;  2PZS A;  3HXM A;  2YHB A;  3L3V A;  3TAQ A;  1U45 A;  3QEW A;  2YHX A;  2KLA A;  3DOL A;  2W40 A;  1A5X A;  3TTF A;  1FW6 A;  3GDQ A;  1REV A;  3KLH A;  4BDZ A;  3LZI A;  4I2P A;  1SUQ A;  3O4W A;  3OW2 M;  4TSX A;  1J5O A;  4K41 A;  4CF8 A;  4DQQ A;  3MK6 A;  5I9E B;  1CXU A;  4WCE L;  1RTJ A;  3RRG A;  1GOC A;  4XH4 A;  2UXD K;  1HMV A;  1TVR A;  3OYE A;  3JS6 A;  4B9L A;  4NXN K;  5M1F A;  3EN9 A;  5AQY A;  4CEQ A;  1NK6 A;  1TK5 A;  4PKI A;  1JLB A;  1LAV A;  3ZSW A;  2E2O A;  4ZTF A;  1D4X A;  1QQC A;  2B5J A;  1VQK N;  2O8C B;  3E01 A;  2P9I B;  4KRF A;  3KK3 A;  2HHU A;  1C1C A;  2QK9 A;  3VEO A;  4BC2 A;  4GW6 A;  3QEX A;  4CJ3 A;  4DTP A;  1HQU A;  3I0R A;  1RT6 A;  4CW7 B;  3V9Z A;  2NRV A;  1SL0 A;  2FSK A;  5AQI A;  4RTF D;  4EHT A;  4CHQ A;  2IC3 A;  4FJN A;  3C6U A;  1S1W A;  3SK3 A;  3WEE B;  2Y1I A;  1NOZ A;  4IOX A;  4NCB A;  1W97 L;  3R8E A;  3QFP A;  1S6Q A;  3LAK A;  4FLV A;  1KFS A;  3LWM A;  3TTC A;  3M3Z A;  1LWC A;  4A62 A;  3RR8 A;  3OYB A;  4IEE A;  5FRM A;  2DFH A;  3CC7 N;  5AZI A;  3TAG A;  3HO1 A;  4OLB A;  4DTX A;  4OLA A;  3DLE A;  2CGL A;  5CE3 A;  3D45 A;  3DYA A;  4F2R A;  4PKH A;  3ZT1 A;  4UY8 O;  1X9S A;  1NM1 A;  2OPS A;  3WUH A;  4CZK A;  1R0A A;  4CJV A;  4I9L A;  3BY5 A;  1YIT N;  3AO3 A;  1BG3 A;  5E84 A;  3UKR A;  3P83 D;  3MXM A;  3DAW A;  3DLR A;  3ULE B;  4AHU A;  1YJW N;  4BDP A;  1X3N A;  3BP8 A;  4CGH A;  1U6Z A;  1VSK A;  3OYN A;  4BRQ A;  3G6E N;  4E19 A;  3S3M A;  3S9H A;  5AQK A;  2WOM A;  4OPJ A;  1J6Z A;  2XY5 A;  1WSF A;  4H0V B;  5AQV A;  3A5O C;  1NK4 A;  2IVO A;  3OHR A;  4DKW A;  3F2K A;  1TKT A;  4B1Z A;  2ZJQ L;  3VEZ A;  1EP4 A;  4DTU A;  4DU3 A;  4FK0 A;  4I7F A;  1HRH A;  4FLW A;  3L2V A;  4BGA A;  2F8T A;  4IOC L;  5BRH A;  4JLH A;  1NGD A;  4NXM K;  2P9K A;  3QIN A;  3WXL A;  2HST A;  3QML A;  1CXQ A;  4CZL A;  1GLA G;  4OPA A;  3PX4 A;  2AP1 A;  4ISF A;  3QEI A;  3VQP A;  4YNQ A;  1RGI A;  3O08 A;  4DHY A;  3QES A;  3LP3 A;  1KAZ A;  1YTA A;  2X74 A;  1NK0 A;  3KLE A;  1SV5 A;  3AVN A;  3P31 A;  3TAN A;  1X3M A;  1JCE A;  4JRP A;  4W5N A;  3MN5 A;  1BIU A;  1W0H A;  3JSM A;  3WXM B;  4CHP A;  2ASP A;  5CYM A;  4DFJ A;  1VQ9 N;  3ZT4 A;  1NG9 A;  4FJH A;  4CGD A;  4Z4H A;  5EOY A;  3EZ5 A;  3O9R A;  5GAE P;  5FPN A;  1EQY A;  2YHA A;  1JXE A;  4RG8 A;  2G8I A;  4FK2 A;  4E7L A;  4IJN A;  3R6M A;  3NE6 A;  5AQT A;  1JL1 A;  2FSJ A;  4CEF A;  1QTM A;  1ASV A;  4KV8 A;  3IMX A;  2PAV A;  4H5N A;  3SQ1 A;  4CZM A;  3NH1 A;  1S3X A;  2O8C A;  3MCA B;  5F1X A;  4C8O A;  2P9I A;  3B6P A;  2QWL A;  1Q81 O;  3QFU A;  3M6G A;  3CCV N;  3F73 A;  3RR7 A;  4NYF A;  3LAN A;  5M1P A;  1KAY A;  3L6Q A;  2HOE A;  4B8C A;  4FLU A;  4A2B A;  5AQS A;  4CBU A;  5B8H A;  5C15 A;  3L4I A;  3ZSY A;  4WF9 L;  2WBN A;  3ZSX A;  1BQM A;  1SKW A;  5KPR A;  1VSD A;  1ATS A;  3NF7 A;  5DMR A;  2NZT A;  2YJE A;  4CED A;  3QER A;  1HQE A;  3WEE A;  2HVH A;  5JLF A;  1J54 A;  2NRH A;  4L3Q A;  4I6M A;  3CC2 N;  4PL7 A;  3RMC A;  4PWD A;  1NKE A;  4C8N A;  4OKK A;  3IUC A;  2UUC K;  3LDL A;  5GIN A;  3QET A;  3NVM A;  1YVU A;  1ZBL A;  2QW9 A;  4H03 B;  3CMA N;  4CHY A;  2A1S A;  4LH4 A;  5CYQ A;  3C6A A;  1EKE A;  4L8R B;  3ZT0 A;  3VQA A;  4Z4C A;  4DV6 K;  4ILH A;  4KH4 A;  3QBW A;  4UQG A;  2QTD A;  4ID5 A;  2DPN A;  4CZJ A;  1JL2 A;  4LF9 K;  3SBT A;  3C65 A;  1GLB G;  1RBS A;  3ULE A;  1JLE A;  1HJO A;  3R1X A;  3NGZ A;  3MEE A;  3PIP L;  4CJW A;  3J7Y P;  2DTU A;  4DTS A;  2KFN A;  1Z26 A;  4IDK A;  1Q86 O;  1IKV A;  2VYP A;  4CGJ A;  3MED A;  2P1J A;  3KHY A;  3NAE A;  3VQ5 A;  1ZXO A;  4JN4 A;  3K59 A;  3VQD A;  4CIF A;  2NLX A;  1IKY A;  4DLG A;  4WQ4 A;  1SL2 A;  4DSI A;  5E26 A;  2YCH A;  2NRX A;  5EX5 A;  3QEP A;  1GLJ O;  4IDH A;  2VG5 A;  2HF4 A;  3TAP A;  4JKG B;  1I39 A;  1TYQ B;  1Q9X A;  1S9E A;  2P9S B;  3ENO A;  2E6M A;  3DXK B;  5FRN A;  2ATQ A;  3OYL A;  2NRZ A;  1YUW A;  3P1G A;  4O4G A;  4DTJ A;  3TAM A;  4JKE A;  3H6E A;  4M3R A;  4ID1 A;  4DB3 A;  1TV6 A;  3T1A A;  2QWQ A;  1ZBH A;  1BCM A;  4Q5V A;  2Q36 A;  3PSF A;  3O4Q A;  1U4B A;  2PYL A;  1QHT A;  5EY4 A;  3T7Z A;  4KHU A;  4FSV A;  3QIO A;  3S3O A;  4BE2 A;  4H8K A;  2IOC A;  3FGU A;  3BF3 A;  1KVC A;  1SAZ A;  3AVF A;  5HL7 L;  4DS4 A;  3AO4 A;  2D0A A;  3FZK A;  2A1R A;  4O5F A;  1OH5 A;  4JV5 K;  4LC9 B;  2QWR A;  4CJ4 A;  2VWK A;  3EY1 A;  1VAZ A;  4EP4 A;  4DU4 A;  5HRO A;  2D1K A;  1VRU A;  2ZD1 A;  3WQU A;  3ZSR A;  2VCP A;  2KKZ A;  3TSU A;  3V81 A;  2WFB A;  4A57 A;  4A59 A;  4BC3 A;  4FVM A;  4F4K A;  3VEN A;  3EO3 A;  1MA9 B;  2W42 A;  1C1A A;  4HUE A;  3I8D A;  1LOT B;  3AGR A;  2A42 A;  4IJA A;  2QKK A;  1IV0 A;  3CFR A;  2P9N B;  3H1Q A;  4H5R A;  4FK4 A;  5IT9 O;  3K0S A;  3CCQ N;  2HMI A;  4HUF A;  2CGJ A;  4GV6 A;  2HF3 A;  3UIQ A;  3SMS A;  4DFK A;  3WXI A;  1E4F T;  4Z4G A;  4BRD A;  2IVN A;  1WSH A;  4B9N A;  3LDN A;  2G8K A;  3QBX A;  3C0B A;  3J81 O;  1T6D A;  5D3G A;  2HND A;  1WAJ A;  4CEC A;  3P4I A;  2E1Y A;  3CQ8 A;  4B9M A;  4BDY A;  3AVM A;  5LMN K;  4N76 A;  4KHY A;  5AFU H;  3QEV A;  2P9P B;  3V4I A;  4CHN A;  3RMB A;  4M7X A;  2YHY A;  2OTL N;  3G25 A;  2ZGY A;  4BRA A;  4E1M A;  4BE0 A;  2W6L A;  2KFZ A;  2OPQ A;  2YNG A;  2D0P A;  5M1N A;  1QHA A;  5HLF A;  4DV5 K;  1GLL O;  2E88 A;  3VQB A;  2KZZ A;  4QOZ B;  1HKG A;  2F7T A;  1Q7Y O;  4AF1 A;  4DV2 K;  4DSE A;  1QVG M;  3AVB A;  1XNQ K;  4BQL A;  3K9K A;  4K43 A;  1NOY A;  1VSM A;  1HYS A;  3EZW A;  3CJ9 A;  2FF3 B;  2UU9 K;  3NGY A;  1Q18 A;  1XMQ K;  2G8F A;  3C6H A;  2IVP A;  5KRS A;  3CD6 N;  3IDH A;  4M3W A;  1NGG A;  2P9L B;  1BL3 A;  2DY4 A;  4BRE A;  4H0P A;  4JI0 K;  3O1B A;  3J7Z O;  4M7Y A;  4CZG A;  4KHN A;  1C0G A;  1DT9 A;  1RBU A;  4JKG A;  4XH1 A;  3ID8 A;  1UA1 A;  1VQP N;  1TYQ A;  1C0U A;  3FZL A;  2P9S A;  4B3R K;  2DFF A;  5TKY A;  1XC3 A;  5HRS A;  3DXK A;  1DLO A;  2HVI A;  5FRO A;  5BR8 K;  1TK8 A;  4DLE A;  3HST B;  3V1Q A;  1HNW K;  1RTH A;  1Z05 A;  1S9G A;  1SKR A;  3V9U A;  1XMO K;  1SZ2 A;  2YJF A;  4CZE A;  1IKW A;  4DQ8 A;  4DR6 K;  4IO9 L;  1DEJ A;  2Z1G A;  4CFB A;  4CJ7 A;  5ELZ A;  3C6T A;  2X6S A;  5M1O A;  5BPM A;  3ISN C;  2J4R A;  2ZGZ A;  4CVN E;  5AQH A;  4A61 A;  2OYQ A;  5AJ3 K;  4GNI A;  4DSK A;  4DG1 A;  2QKB A;  3LDQ A;  1N6Q A;  1M1K O;  2RF2 A;  4FJM A;  1LV5 A;  5AQJ A;  2ZWH A;  3A5L C;  5BPL A;  4OVL A;  4JK9 A;  4YOV A;  3OY9 A;  3VEX A;  3CPW M;  1RT4 A;  1VHX A;  1NU0 A;  4KAZ A;  4F3T A;  3AV9 A;  3K58 A;  2FBV A;  3VQ9 A;  4KTZ A;  4N41 A;  3WXK A;  4BRH A;  3TPQ A;  4BAC A;  1T8E A;  3EL2 A;  3KWG A;  2BTF A;  1MWM A;  4ILG B;  3NVK A;  1S5J A;  4YOX A;  3HJF A;  2P9N A;  4BC5 A;  1T05 A;  4ZTJ A;  1D9F A;  1RDA A;  4Z4E A;  5KQD A;  3KLI A;  1N5Y A;  1NKB A;  1C6V A;  4WFB L;  3WQT A;  3O3F A;  3H46 O;  1NGH A;  4DQS A;  1RNH A;  3BF1 A;  3NF9 A;  1BGX T;  2Q3S A;  1Z25 A;  4E0D A;  4AM7 A;  2V7Y A;  1A5V A;  1WSG A;  4BRL A;  3J80 O;  3Q7B A;  2BGG A;  4MLE A;  2CGK A;  3UE5 A;  2XY7 A;  1K6Y A;  3G71 N;  3PV8 A;  4PY5 A;  4FWS A;  1JJ2 M;  4FJI A;  3G0Z A;  5KTQ A;  3L2R A;  4CCH A;  2P9P A;  3HZ6 A;  1N8R O;  4BR5 A;  4ICL A;  1RTI A;  3E9O A;  4CZI A;  3AGK A;  4LSN A;  5BRD A;  4B3S K;  3CCM N;  1KD1 O;  4B9S A;  1HNX K;  2HNZ A;  3AAP A;  4DCH A;  3ZSQ A;  3MXI A;  3ULD A;  3KVG A;  1NNE A;  1RT5 A;  3SQ4 A;  4LF5 K;  5LY3 A;  3FR0 A;  2QM1 A;  4JI2 K;  4GMJ B;  4JRQ A;  2CH5 A;  4CZF A;  3KJV A;  3VQE A;  3OJU A;  2X78 A;  1VSF A;  3HP6 A;  1VSE A;  4FWK A;  5HRP A;  4IEI A;  5BN9 A;  4U67 L;  4HTU A;  1T3V A;  3NGI A;  2E2P A;  3NCI A;  2NUB A;  3OA9 A;  1ATR A;  4GY2 B;  3FFI A;  4H5T A;  3OS2 A;  4LFC K;  1D9D A;  2Z1H A;  1N33 K;  3VQ6 A;  2D0C A;  4O44 A;  4OGC A;  4IG0 A;  4CFC A;  4FJ8 A;  4GV9 A;  4NB4 A;  4N47 A;  1C0F A;  2P9L A;  2VQE K;  3VF2 A;  3E9P A;  5BR9 A;  4FWN A;  1EWQ A;  4CF0 A;  3HPO A;  3CG7 A;  4BRK A;  3OS1 A;  3IRX A;  1NJW A;  3L3U A;  4FZZ A;  4M3Z A;  4WQ5 A;  3TU5 A;  4CZH A;  3DLL L;  4JI3 K;  1T7P A;  1KCF A;  3KIO A;  1NK7 A;  1RDD A;  2ITM A;  1RT2 A;  1YI2 N;  1P8Z A;  2D0O A;  3G10 A;  5LJV A;  4YDU A;  3OYH A;  3LM9 A;  4NYN A;  4CGG A;  1P90 A;  1TKX A;  3TR8 A;  3VGL A;  1QQO A;  3PO4 A;  3L8B A;  1JLA A;  1NJZ A;  1S22 A;  1KAX A;  3SAG A;  4F3O A;  5HRN A;  3SJJ A;  1EXQ A;  1YHQ N;  4EHU A;  5J2N A;  4DV0 K;  1NK8 A;  5AQU A;  2O8E B;  2F4V K;  3PUF A;  5GAH P;  5AQN A;  3ZCM A;  1ITG A;  3SCX A;  4FJ7 A;  5JMV A;  3CHW A;  3H3N O;  2O8B B;  1VSL A;  2HHV A;  2HBL A;  3AA4 A;  5AQF A;  2FBX A;  3IAY A;  3THX B;  2D5R A;  2KW4 A;  3DLG A;  1HR0 K;  3KKS A;  1GLC G;  3ZYY X;  3ITH A;  1VQ7 N;  5J2M A;  1KXP A;  2E2N A;  2GWJ A;  2PYJ A;  2NRW A;  3CM6 A;  1IBK K;  3ZET B;  5C25 A;  3EE8 A;  4M3X A;  4PUO A;  2O8D B;  2E20 A;  4H0T B;  1RBV A;  1VK0 A;  4KO0 A;  1BCO A;  3HOS A;  1GLE G;  3A8Y A;  3CCS N;  2FLO A;  4DSL A;  3CJB A;  2D0B A;  1QQM A;  5KPT A;  4GKK K;  3NHG A;  4HCC A;  1SKS A;  4GV3 A;  4X64 K;  1NGB A;  2PFU A;  3F9M A;  5ADX H;  1NBW A;  4JHD B;  1W7A A;  4BRM A;  3ATV A;  3KZB A;  4DUY K;  1ZBS A;  1QSS A;  4BY9 C;  4OPK A;  1OVY A;  3DI6 A;  1XHZ A;  3EKS A;  1LWF A;  3T3F A;  1RDU A;  3HSC A;  2HBM A;  4BGB A;  1LCU A;  3O5B A;  2FC0 A;  1ESV A;  3SQ2 A;  4YOW A;  2UUA K;  4G9Z A;  3CM5 A;  1X9W A;  5A2Q O;  4FO0 A;  3VGK A;  4H0Y B;  4BVO A;  3VTI A;  5FPE A;  4KFB A;  1S1T A;  1T03 A;  2XRI A;  3Q7C A;  4H0O A;  4FWR A;  3SZ2 A;  2OPP A;  4FOI A;  3I33 A;  1RCH A;  3H08 A;  3TSP A;  3VEY A;  3CFP A;  1GOA A;  1M90 O;  3HYF A;  3VQ7 A;  1NGF A;  5EVZ A;  4CK3 A;  3AA2 A;  1BIZ A;  3SLC A;  2XO7 A;  4K42 A;  3MN9 A;  2VWB A;  4ELT A;  5CZ1 A;  1RFQ A;  4KTQ A;  1HUX A;  3AO5 A;  3R3L A;  3RMD A;  1T6C A;  3O80 A;  1QE1 A;  3RWU A;  4R79 A;  4DF8 A;  4CHO A;  3L2U A;  3ID6 A;  4OGE A;  4DFP A;  5IWA K;  1YVN A;  4IXC A;  4MO4 A;  3WNG A;  3VA0 A;  4FJK A;  4OJR A;  2Q0R A;  4B3T K;  4CJU A;  3W3D A;  3BUZ B;  4DQR A;  4Y1D A;  4FZX C;  3LDP A;  1HKC A;  3A5N C;  3EKU A;  2E2Q A;  4DTO A;  3PY8 A;  1LWE A;  1DTQ A;  4XIU A;  4FYD A;  5M1Q A;  3ENB A;  3N4P A;  3THW B;  3I8B A;  2E8A A;  3CCL N;  3HK2 A;  2HW3 A;  1V4S A;  4E1N A;  2FBT A;  3IG1 A;  3PX6 A;  1YJ9 N;  4MDB A;  2YV0 X;  4KRE A;  1VQL N;  2HHT A;  3KWI A;  4CF2 A;  2O8E A;  4CD1 A;  3CCU N;  3KD5 E;  5J2P A;  1WAF A;  3OYC A;  4DV4 K;  2VGN A;  4HVJ A;  4BRG A;  4OKJ A;  1YJN N;  1Q8I A;  2O8B A;  5AQO A;  4YDU C;  3CIP A;  4J2A A;  2KTQ A;  4JKD A;  2Q0U A;  2BDP A;  3SUP A;  5AQL A;  1HKB A;  5AQP A;  4AQY K;  3THX A;  2RPI A;  3T69 A;  4CES A;  2IS3 A;  4IZ9 A;  2VWJ A;  1SS6 A;  3RTV A;  3SPZ A;  4JKF A;  2FBY A;  4DR4 K;  3CQY A;  4BWM A;  4JS5 A;  4PL8 A;  3CQX A;  3JYT A;  3HPH A;  1K8K B;  3ZET A;  2GWK A;  4CEB A;  4BR2 A;  3E66 A;  2O8D A;  3O1W A;  5C2F A;  4FJ5 A;  1W9H A;  3NMU A;  2OZS A;  3HVT A;  1CZB A;  4LSL A;  4PKG A;  4C8M A;  5E41 A;  3A2F A;  3T1H K;  1RBR A;  1X9M A;  3LL3 A;  1C0M A;  1D5A A;  1GOB A;  4FWO A;  5I42 A;  1NLV A;  3K2P A;  4QS7 A;  4JHD A;  4O8U A;  4RW6 A;  1IJJ A;  4B08 A;  3O6W A;  4DTR A;  4FLZ A;  1Y97 A;  3HL8 A;  3NH0 A;  1IO2 A;  1QZ5 A;  3HVR A;  1CLQ A;  4FL9 A;  4M3U A;  1WSE A;  3GL1 A;  4J2B A;  3KD1 E;  3THV A;  2OA8 A;  4V19 S;  3O9U A;  4EP5 A;  4E1J A;  2A3Z A;  1DTT A;  1XC9 A;  1OH7 A;  1HX1 A;  2XY8 A;  4Z94 A;  3B8A X;  4HTL A;  4FJL A;  2F96 A;  2I7P A;  1FXX A;  2Q97 A;  3P39 A;  5AQZ A;  2ZM6 K;  2O4G A;  3VF4 A;  4CGF A;  3OYI A;  3AVA A;  3MEG A;  2HHS A;  3DRP A;  4LFB K;  3CPE A;  4J2E A;  2G8H A;  4E7J A;  2YNI A;  3MWT A;  5JS1 A;  4KTW A;  5LL6 Z;  1VQN N;  3MAQ A;  4JNE A;  3CFO A;  3IKM A;  3AVL A;  4RW8 A;  5FPM A;  2JWK A;  3CXC M;  3WNH A;  1L3V A;  2E5L K;  3LDO A;  4F2S A;  3DLB A;  3THY B;  1FKO A;  4NLB A;  4AHR A;  2E1Z A;  3MDQ A;  4M3Y A;  4OO1 J;  1BDG A;  1FKP A;  1YTU A;  3OYK A;  3I0S A;  3O9T A;  3M5R A;  4FW1 A;  5M1K A;  4J8F A;  2AJQ A;  4WE1 A;  1VSJ A;  4BG9 A;  3SUN A;  1YT3 A;  3MXJ A;  4O0I A;  3EEQ A;  1QQN A;  3K5M A;  3CCJ N;  2LSN A;  5GIO A;  4M41 A;  1UOC A;  1TKZ A;  3SPY A;  4M42 A;  3LAL A;  1LAW A;  4ILJ A;  4W5O A;  3DLK A;  2QA4 N;  1BU6 O;  4CF9 A;  4QCL A;  4LD0 A;  1NGE A;  1F21 A;  3THW A;  3M8S A;  4DQP A;  2ASM A;  4FPA A;  3HM8 A;  1HPM A;  1I3A A;  3ALY A;  3MX5 A;  2FF6 A;  4Y0W A;  4A2A A;  2RN2 A;  3FE1 A;  1XWL A;  3M8Q A;  1L3T A;  4JYA K;  1TK0 A;  4JEP A;  2HB5 A;  4BRC A;  3TWH A;  4JI1 K;  5AQQ A;  1VRT A;  4CFA A;  4OPH A;  1Q82 O;  4KH5 A;  5EU7 A;  1B9F A;  1TL3 A;  2G8U A;  4MDA A;  2ITG A;  1NJY A;  4AM6 A;  4FLX A;  4AIL C;  3E1Y A;  1ZBU A;  3AA3 A;  4EZ9 A;  1R59 O;  1WSJ A;  1JXB A;  3CME N;  4CJK A;  3U6F A;  4HUG A;  3AY9 A;  5MLC Q;  1KC8 O;  2A40 A;  2YKN A;  3ZSV A;  3SBG A;  5KPZ A;  5DM7 L;  1JKH A;  4DS5 A;  3H1V X;  2B4J A;  2GX9 A;  3G4S N;  1K8K A;  1NK5 A;  2P5O A;  3OBW A;  4RW9 A;  4FOE A;  3QLH A;  1BWF O;  2V7Z A;  3H3O B;  4CEZ A;  1KVB A;  4FLT A;  2R7Y A;  5AZI B;  2GV9 A;  3C94 A;  4YY3 K;  3J8A A;  4WQ4 C;  4U7B A;  4YHH K;  1N32 K;  3O9Q A;  2NNW A;  1N34 K;  5DM6 L;  4BC4 A;  2JLE A;  4JKB A;  4E7H A;  2PBD A;  1NGC A;  1O1W A;  4XH5 A;  3V9X A;  4KH6 A;  5CZ2 A;  3ENH A;  4IO8 A;  2QWM A;  5HBM A;  3BGR A;  3WT0 A;  3GOI A;  1DGK N;  4G1Q A;  3PX0 A;  1WB9 A;  2Q1N A;  4J2D A;  2BUP A;  2NRR A;  3ZSZ A;  1L3S A;  2VGM A;  4CJ5 A;  3VF6 A;  3VEW A;  3OTO K;  4BE1 A;  5BPN A;  1NGI A;  4CIE A;  3L0Q A;  4CIG A;  3C7N B;  1S1V A;  4WYB A;  1UWB A;  3MX2 A;  4JI4 K;  3NF6 A;  4DR3 K;  4H0X B;  2ZF5 O;  4I9Q A;  1B92 A;  3LP0 A;  5SWM A;  2E6L A;  3OYD A;  3OYJ A;  1JLC A;  2KQ2 A;  3T1Y K;  5ADX A;  3HM9 A;  3UB5 A;  1JLG A;  3OYM A;  1XQS C;  3VGM A;  5AQW A;  4FJJ A;  4KB0 A;  5FDL A;  1IG9 A;  4KHQ A;  3SAH A;  1BHL A;  3P5J A;  1S6P A;  4KBO A;  1I94 K;  4C8L A;  2QEX N;  4H4M A;  3U3Y A;  4H5W A;  3THY A;  4CJP A;  1CZ9 A;  4WFN L;  1DKG D;  1G15 A;  3D2E B;  3PSI A;  3AVH A;  3DRS A;  1NJI O;  1KSP A;  2E4L A;  2I5J A;  3O8M A;  4DV1 K;  3F5T A;  1XHX A;  3RRH A;  1Y64 A;  5BRF A;  4CEO A;  5AZJ B;  3VMF B;  1X9J A;  3MEC A;  1FK9 A;  2HNY A;  1LW0 A;  2W6K A;  1TUY A;  3M8R A;  1IH7 A;  4M3T A;  5F2R A;  4AHT A;  1VQM N;  4DFM A;  4HCB A;  4JI7 K;  4DV3 K;  2QI2 A;  2PY5 A;  4B3M K;  3FZM A;  1LW2 A;  4PA1 A;  2UXB K;  5FPD A;  1OH6 A;  4CJF A;  3TAR A;  3OYG A;  3SNN A;  1EO1 A;  4AHS A;  1VQ4 N;  3K5L A;  3TAF A;  5C0Y A;  3S41 A;  4KB1 A;  3MWP A;  3L2W A;  4BR7 A;  1G99 A;  4IFY A;  2EHG A;  2YX6 A;  5HOO A;  1L3U A;  1Q9Y A;  3QNN A;  1QSL A;  3VPZ A;  3RMA A;  1NJX A;  1MU2 A;  3NH2 A;  3KLF A;  4DSF A;  4JK8 A;  1RIL A;  5HRR A;  3HTV A;  3F9K A;  3SV3 A;  2A5X A;  4IFE A;  3OYA A;  4NO7 A;  2QXF A;  3LPT A;  3AAR A;  4BRN A;  1U47 A;  5JLH A;  2GEL A;  4RCH A;  3VN5 A;  2JWL A;  3WXJ A;  4AHV A;  2RKI A;  4PHT X;  3QDK A;  4M45 A;  1WOQ A;  4FLY A;  3A0I X;  3LDS A;  1RT7 A;  4IKF A;  2ASO A;  4EFH A;  4M63 C;  2W41 A;  2B6A A;  4OKE A;  3CF5 L;  1MDU B;  4FWM A;  4CD3 A;  4I6M B;  4O5B A;  3TTD A;  3W0L A;  1NK9 A;  3QIP A;  1BA0 A;  4HHT A;  1ZC6 A;  3LP2 A;  5SZT A;  3DOK A;  1IBM K;  5GAG P;  5C42 A;  3ZX3 A;  2A41 A;  1QS4 A;  4KPY A;  4A5B A;  4JKH A;  5C10 A;  1T44 A;  1B9D A;  1NGJ A;  1HYV A;  5J1E A;  4ELU A;  1K8A O;  3O3G A;  2P9U B;  2OTJ N;  1UAX A;  1TUU A;  3IFR A;  1KTQ A;  3D6R A;  1ZBF A;  4FW2 A;  3D0P A;  2UYT A;  4EZ6 A;  1BI4 B;  4E7I A;  2P5G A;  4YOY A;  4NLC A;  1RTD A;  4IBN A;  3GBT A;  3TAE A;  4IFV A;  4DSJ A;  3KK2 A;  2FSN A;  2GUI A;  3ASM A;  4BQZ A;  3JAM O;  4FVU A;  3HP9 A;  3WNE A;  1HPZ A;  3AO2 A;  4JS4 A;  3C7N A;  4JI8 K;  4K8Z A;  2WTU A;  4DR1 K;  1BO5 O;  1U04 A;  1KFD A;  2A6A A;  2V52 B;  3TSQ A;  3PLA A;  4YFU A;  2Z1J A;  3DMJ A;  4FWQ A;  5AQG A;  3U9Z A;  5AQX A;  4EAH D;  1BQN A;  3FZH A;  3U9D A;  2CH6 A;  1EX4 A;  3AVG A;  5BN8 A;  3HI0 A;  3V6D A;  5J2Q A;  2HHH K;  4FWP A;  3SI6 A;  5JVG L;  4H4O A;  3CJC A;  3T19 A;  1SQK A;  4YOT A;  4R5P A;  1QSY A;  1KLN A;  4CE9 A;  1ASU A;  1YF5 L;  2HMP A;  3LZJ A;  5AQR A;  3RVC A;  4RW4 A;  5H1S Q;  1BIS A;  3M1F A;  3AVJ A;  1OKJ A;  3HRG A;  4DR5 K;  2BH1 A;  3I56 N;  1N36 K;  2WC9 A;  4CGI A;  3D2E A;  4ELV A;  4FJ9 A;  4FZY A;  4JK7 A;  3DRR A;  5KI6 A;  5FLX O;  2RHK A;  3V9S A;  4C8K A;  4BR9 A;  2AA4 A;  4IOA L;  3NFA A;  4DU1 A;  3VET A;  1VQO N;  1TAU A;  3B6O A;  1U2V B;  5TKW A;  5AZJ A;  1ILY A;  4Z4I A;  4ISG A;  5GAD P;  4CER A;  4YOU A;  4GKJ K;  5KQ8 A;  4NCA A;  4CJE A;  1E4G T;  3DM2 A;  4X65 K;  3SJH A;  4C23 A;  3VTH A;  3U4L A;  3CJA A;  4BVP A;  1KLM A;  4DUZ K;  3E9L A;  1JCG A;  3V9W A;  3J7A P;  2O8F B;  4FXD A;  3MN7 A;  2Y1J A;  1JLF A;  4BR4 A;  4N56 A;  5LMU K;  2HHX A;  1TGO A;  4O8K A;  1C0T A;  4Y1C A;  1NMD A;  4B9V A;  2YHW A;  2IIR A;  5AFU A;  1WNS A;  3HBT A;  5JVH L;  4LF6 K;  3FZF A;  1XUP O;  1UA0 A;  3A5M C;  2FXU A;  3U3G A;  4E7K A;  3LAM A;  4KHW A;  3CER A;  5K14 A;  4H5V A;  2Q2R A;  2XY6 A;  3D7E O;  3GE1 A;  4YOR A;  2XHB A;  4CJQ A;  3CJ1 A;  4K8X A;  2YKM A;  5CHI A;  2X6N A;  4CJS A;  4Q0B A;  5C24 A;  3I55 N;  3NBP A;  3ATU A;  4B9Q A;  2VG6 A;  1NWK A;  4X66 K;  1ASW A;  4CJR A;  1QVF M;  2BAN A;  4C1N I;  3KK1 A;  4WQ5 C;  5T7B A;  3OJS A;  3VQC A;  3QO9 A;  2P9U A;  5AQM A;  3K5N A;  3KK7 A;  3AAQ A;  1J53 A;  4C1N K;  1BI4 A;  1VQ8 N;  4O55 A;  3ZX0 A;  2GTD A;  4CEA A;  2WUS A;  1S72 N;  3L2Q A;  2JGU A;  1Z6R A;  4CJT A;  3EYZ A;  2KZM A;  4OX9 K;  1FJG K;  1HLU A;  3M8P A;  4BRP A;  4JD2 B;  4DTN A;  4DF4 A;  3CET A;  3SUQ A;  3KLG A;  2HBK A;  4BRF A;  1RDW X;  5CY4 A;  2IGI A;  4A5A A;  2WON A;  4LF4 K;  1RT1 A;  3BEX A;  1EET A;  4CFD A;  3CC4 N;  1NMN A;  1GLD G;  4RW7 A;  3SYZ A;  4CK2 A;  3DXM B;  3VA3 A;  4PQU A;  2HHQ A;  3HPG A;  3ZEU B;  4MQ3 A;  2Q31 A;  2GEM A;  1NKC A;  4LF7 K;  4KHP K;  1YIJ N;  5DK5 A;  4FPB A;  3CCR N;  3FFK B;  3RSE B;  3MMV A;  4GVE A;  1WN7 A;  4DQI A;  2QWP A;  3TAB A;  1J5E K;  3QB0 A;  3H45 C;  1JLQ A;  3S3N A;  3EE9 A;  3GG4 A;  3K5O A;  3AVI A;  2VQF K;  3MCP A;  4IWV A;  1ZBI A;  2EX3 A;  3SQ0 A;  1O13 A;  4KKO A;  2YI1 A;  2YNH A;  1WSI A;  4Z0U A;  1VSI A;  1TKD A;  1U2V A;  3TI0 A;  3DJC A; 
#chains in the Genus database with same CATH homology
 3OS1 A;  3IRX A;  1RT3 A;  1J9A A;  4NYF A;  3LAN A;  2P51 A;  3V9X A;  1NJW A;  3L3U A;  5CZ2 A;  4B8C A;  2OZM A;  4FLU A;  4FZZ A;  4M3Z A;  4O0J A;  5HBM A;  4FM0 A;  1HYZ A;  3BGR A;  3K57 A;  3ZSY A;  1T7P A;  1KCF A;  3KIO A;  1NK7 A;  1RDD A;  3ZSX A;  1RT2 A;  4G1Q A;  3PX0 A;  1BQM A;  4J2D A;  3G10 A;  3ZSZ A;  1SKW A;  1L3S A;  4CJ5 A;  3V1R A;  1SL1 A;  1VSD A;  3OYH A;  4LY7 A;  4BE1 A;  3AVK A;  3NF7 A;  4NYN A;  5DMR A;  4I2Q A;  4CGG A;  1TKX A;  3TR8 A;  4CED A;  3QER A;  1HQE A;  4CIE A;  1C1B A;  2HVH A;  1J54 A;  3NDK A;  3PO4 A;  3L8B A;  1JLA A;  3AVC A;  4CIG A;  3SUO A;  1NJZ A;  3RMC A;  4PWD A;  4F3O A;  4AHC A;  1S1V A;  2IDO A;  5HRN A;  3SJJ A;  1EXQ A;  2BE2 A;  4C8N A;  4OKK A;  1NKE A;  5J2N A;  1VSH A;  3VQQ A;  3ZSO A;  1UWB A;  5KGW A;  1NK8 A;  4FCY A;  3NF6 A;  3PO5 A;  3QET A;  2G8W A;  1YVU A;  3PUF A;  1B92 A;  3LP0 A;  4I9Q A;  1ZBL A;  2F8S A;  5SWM A;  3ZCM A;  2E6L A;  1ITG A;  4CHY A;  3OYD A;  3SCX A;  2A1S A;  2OPR A;  4FJ7 A;  4LH4 A;  1JLC A;  4LH5 A;  5CYQ A;  3OYJ A;  1EKE A;  2KQ2 A;  4L8R B;  4B3O A;  4B9U A;  1VSL A;  1ZYQ A;  3ZT0 A;  2HHV A;  3AA4 A;  3VQA A;  1RBT A;  4Z4C A;  3HM9 A;  2FBX A;  3IAY A;  1JLG A;  3OYM A;  4UQG A;  3OVN A;  4FJJ A;  2D5R A;  4ID5 A;  4KB0 A;  5HP1 A;  2KW4 A;  3DLG A;  5FDL A;  1IG9 A;  4KHQ A;  1BHL A;  3P5J A;  4CF1 A;  1S6P A;  4DTM A;  3KKS A;  1JL2 A;  4C8L A;  3SV4 A;  3ITH A;  4H4M A;  2GBZ A;  1RBS A;  5J2M A;  3U3Y A;  1JLE A;  2PYJ A;  4CJP A;  3NGZ A;  3MEE A;  1CZ9 A;  2ETJ A;  2Z1I A;  4CJW A;  3CM6 A;  1G15 A;  5C25 A;  4IG3 A;  2O4I A;  2DTU A;  4M3X A;  4CJL A;  2IAJ A;  4DTS A;  4PUO A;  4KHS A;  3O4N A;  3IS9 A;  2KFN A;  4N5S A;  3AVH A;  1RBV A;  1VK0 A;  1Z26 A;  3OYF A;  4KO0 A;  1BCO A;  4IDK A;  4AH9 A;  3DRS A;  1IKV A;  3AO1 A;  1KSP A;  4CGJ A;  1RDC A;  2E4L A;  2I5J A;  3MED A;  2P1J A;  1KRP A;  2ZE2 A;  3NAE A;  1XHX A;  3VQ5 A;  3RRH A;  1U48 A;  3K59 A;  4DSL A;  2D0B A;  3VQD A;  1XI1 A;  5JS2 A;  4CIF A;  1IKY A;  4CEO A;  3NHG A;  4DLG A;  1SL2 A;  4DSI A;  1S1U A;  1S1X A;  3WNF A;  3LPU A;  3MEC A;  1SKS A;  1IKX A;  1FK9 A;  2HNY A;  3KTQ A;  4HCC A;  3QEP A;  1LW0 A;  1D8Y A;  2VG5 A;  3M8R A;  3TAP A;  3ZT3 A;  1IH7 A;  1RDB A;  4M3T A;  4AHT A;  4MFB A;  1I39 A;  4DFM A;  1Q9X A;  4HCB A;  1S9E A;  2PY5 A;  1QSS A;  1LW2 A;  4ZHR A;  4OPK A;  2E6M A;  4PA1 A;  3DI6 A;  1XHZ A;  1LWF A;  4CJF A;  4FM2 A;  3T3F A;  5FRN A;  2ATQ A;  3OYG A;  1TL1 A;  4CHZ A;  4AHS A;  3OYL A;  3TAR A;  3SNN A;  3K5L A;  3ZT2 A;  3TAF A;  2FC0 A;  3SQ2 A;  3P1G A;  1WLJ A;  4KB1 A;  3CM5 A;  3L2W A;  1X9W A;  4IFY A;  2EHG A;  1L3U A;  4DMN A;  4W5Q A;  1Q9Y A;  2DFE A;  4O4G A;  4DTJ A;  3QNN A;  1QSL A;  3TAM A;  4BWJ A;  3RMA A;  4M3R A;  4ID1 A;  1NJX A;  1TV6 A;  1MU2 A;  3T1A A;  3NH2 A;  3KLF A;  4DSF A;  1ZBH A;  1BCM A;  1RIL A;  5HRR A;  3F9K A;  4KFB A;  4Q5V A;  3SV3 A;  1S1T A;  3OYA A;  1T03 A;  4FJX A;  3O4Q A;  2QXF A;  3LPT A;  2XRI A;  3SZ2 A;  1U4B A;  1U47 A;  1QHT A;  2PYL A;  2G8V A;  2OPP A;  4KHU A;  3QIO A;  3VN5 A;  3S3O A;  3CYM A;  4E89 A;  3VQ4 A;  4BE2 A;  4H8K A;  4W5R A;  3CG7 A;  4AHV A;  1RCH A;  5KGX A;  2YNF A;  1A5W A;  2RKI A;  2IOC A;  2VG7 A;  3H08 A;  4QAG A;  4M45 A;  3VQ8 A;  3CFP A;  4FLY A;  1KVC A;  3AVF A;  3LDS A;  1GOA A;  1RT7 A;  4DS4 A;  4IKF A;  3AO4 A;  2D0A A;  3HYF A;  3VQ7 A;  2B6A A;  2A1R A;  4OKE A;  4CK3 A;  3AA2 A;  3V1O A;  4CJ4 A;  2VWK A;  1BIZ A;  3EY1 A;  2XO7 A;  5HRO A;  4B8A B;  4EP4 A;  4DU4 A;  1U49 A;  4DWI A;  3KKR A;  4O5B A;  1NK9 A;  3QIP A;  4HHT A;  1VRU A;  2ZD1 A;  3ZSR A;  1HJR A;  5I3U A;  4ELT A;  4KTQ A;  5CZ1 A;  1L5U A;  4E3S A;  3V81 A;  3AO5 A;  3LP2 A;  5SZT A;  3DOK A;  4FVM A;  3RMD A;  4FM1 A;  5C42 A;  4F4K A;  4KI4 A;  1QE1 A;  2W42 A;  3RWU A;  1C1A A;  4HUE A;  4DF8 A;  1QS4 A;  4CHO A;  4KPY A;  3L2U A;  3HT3 A;  3I8D A;  4NCG A;  4OGE A;  4DFP A;  2QKK A;  1B9D A;  5KRT A;  3VA0 A;  3WNG A;  3QNO A;  4KI6 A;  1HYV A;  5J1E A;  3OS0 A;  3CFR A;  3DLH A;  4OJR A;  4FJK A;  4B9T A;  4ELU A;  2HHW A;  4CJU A;  3F73 A;  4FK4 A;  3O3G A;  4DQR A;  4Y1D A;  1UAX A;  4FZX C;  1KTQ A;  1HNI A;  1ZBF A;  4FW2 A;  3D0P A;  4GVM A;  2HMI A;  4EZ6 A;  1BI4 B;  4DTO A;  4HUF A;  3PY8 A;  4E7I A;  1LWE A;  2P5G A;  1DTQ A;  1RTD A;  4FJG A;  4IBN A;  1KVA A;  4XIU A;  1TAQ A;  3UIQ A;  4FYD A;  2ZQB A;  4DFK A;  3TAE A;  3C95 A;  4IFV A;  4DSJ A;  4F8R A;  1X1P A;  3KK2 A;  2GUI A;  4Z4G A;  3ASM A;  3LWL A;  3HK2 A;  2HW3 A;  1WSH A;  4B9N A;  4E1N A;  2G8K A;  2FBT A;  3HP9 A;  3IG1 A;  4CEE A;  3WNE A;  1HPZ A;  3AO2 A;  3PX6 A;  4Z4F A;  5D3G A;  4JS4 A;  2HND A;  4W5T A;  1WAJ A;  2YV0 X;  3AA5 X;  4CEC A;  4CK1 A;  4K8Z A;  3LP1 A;  4KRE A;  3NF8 A;  1U04 A;  1KFD A;  3CQ8 A;  4B9M A;  2HHT A;  4BDY A;  4YFU A;  3AVM A;  4CF2 A;  1HNV A;  2Z1J A;  3DMJ A;  4KHY A;  4N76 A;  3BDP A;  3KD5 E;  3QEV A;  1BQN A;  5J2P A;  3O3H A;  1WAF A;  3OYC A;  3V4I A;  4CHN A;  3RMB A;  4HVJ A;  2PZS A;  4OKJ A;  1EX4 A;  3HXM A;  3AVG A;  2YHB A;  3L3V A;  1Q8I A;  3TAQ A;  1U45 A;  3QEW A;  4E1M A;  4BE0 A;  3V6D A;  4J2A A;  5J2Q A;  2KTQ A;  2BDP A;  3DOL A;  2KFZ A;  3SUP A;  1A5X A;  2OPQ A;  3SI6 A;  2YNG A;  1REV A;  3KLH A;  4BDZ A;  3LZI A;  4I2P A;  1SUQ A;  5HLF A;  2RPI A;  4CES A;  4H4O A;  2IS3 A;  3T19 A;  3VQB A;  2VWJ A;  4R5P A;  1QSY A;  1KLN A;  2KZZ A;  3RTV A;  3SPZ A;  4QOZ B;  4CE9 A;  4TSX A;  2FBY A;  4DSE A;  1J5O A;  4CF8 A;  1ASU A;  3AVB A;  4BWM A;  4JS5 A;  4DQQ A;  1CXU A;  3LZJ A;  1NOY A;  1RTJ A;  1VSM A;  4RW4 A;  3JYT A;  3RRG A;  1HYS A;  1BIS A;  1GOC A;  3AVJ A;  3HPH A;  1HMV A;  3NGY A;  2G8F A;  1TVR A;  4CEB A;  3OYE A;  4FJ9 A;  4CGI A;  4B9L A;  4ELV A;  4FZY A;  5KRS A;  3DRR A;  4FJ5 A;  5KI6 A;  1W9H A;  4CEQ A;  1NK6 A;  4M3W A;  3V9S A;  1TK5 A;  4C8K A;  1JLB A;  1LAV A;  2OZS A;  3ZSW A;  3HVT A;  1CZB A;  4ZTF A;  4LSL A;  1QQC A;  1BL3 A;  2B5J A;  3NFA A;  4C8M A;  4DU1 A;  3E01 A;  1TAU A;  5E41 A;  2DY4 A;  3A2F A;  3B6O A;  1RBR A;  4KRF A;  1X9M A;  4Z4I A;  3KK3 A;  1C0M A;  1D5A A;  1GOB A;  4CER A;  5I42 A;  4KHN A;  2HHU A;  1C1C A;  1RBU A;  2QK9 A;  3K2P A;  4NCA A;  4GW6 A;  4RW6 A;  4CJE A;  3QEX A;  4CJ3 A;  4DTP A;  1HQU A;  1UA1 A;  3I0R A;  1RT6 A;  1SL0 A;  3V9Z A;  1C0U A;  3DM2 A;  4B08 A;  4CHQ A;  4DTR A;  4FLZ A;  1Y97 A;  2DFF A;  3HL8 A;  5HRS A;  2IC3 A;  1IO2 A;  3NH0 A;  3HVR A;  4FJN A;  1CLQ A;  3C6U A;  4M3U A;  1S1W A;  1DLO A;  1WSE A;  2HVI A;  4J2B A;  1KLM A;  5FRO A;  3KD1 E;  1TK8 A;  3THV A;  2OA8 A;  4EP5 A;  1NOZ A;  3V9W A;  4DLE A;  2Y1I A;  3HST B;  3V1Q A;  1RTH A;  4NCB A;  4FXD A;  1DTT A;  2Y1J A;  1JLF A;  1XC9 A;  2XY8 A;  1S6Q A;  3LAK A;  4FLV A;  4N56 A;  1S9G A;  2HHX A;  1TGO A;  1SKR A;  1KFS A;  3LWM A;  4FJL A;  1C0T A;  2F96 A;  4Y1C A;  1FXX A;  4B9V A;  3V9U A;  1LWC A;  3RR8 A;  3OYB A;  1IKW A;  5FRM A;  2DFH A;  2Z1G A;  4CFB A;  1WNS A;  2O4G A;  4CGF A;  3C6T A;  3AVA A;  3MEG A;  3OYI A;  2X6S A;  3DRP A;  3TAG A;  1UA0 A;  4OLB A;  3HO1 A;  3ISN C;  3U3G A;  4E7K A;  4DTX A;  4OLA A;  4J2E A;  2G8H A;  3LAM A;  4KHW A;  2OYQ A;  3DLE A;  4E7J A;  2YNI A;  5K14 A;  5JS1 A;  4KTW A;  3D45 A;  3DYA A;  4F2R A;  3MAQ A;  3ZT1 A;  2XY6 A;  1X9S A;  4DSK A;  3CFO A;  2OPS A;  4DG1 A;  1R0A A;  2QKB A;  4CJV A;  1N6Q A;  4I9L A;  3AVL A;  4RW8 A;  2XHB A;  3AO3 A;  3WNH A;  2RF2 A;  4CJQ A;  1L3V A;  3P83 D;  3MXM A;  4FJM A;  1LV5 A;  4K8X A;  2YKM A;  3DLR A;  2X6N A;  4AHU A;  4BDP A;  4CGH A;  4OVL A;  4F2S A;  3DLB A;  1FKO A;  4AHR A;  4CJS A;  1VSK A;  3OY9 A;  3OYN A;  4M3Y A;  5C24 A;  1RT4 A;  4E19 A;  3S3M A;  4Q0B A;  3S9H A;  3NBP A;  4KAZ A;  1FKP A;  1YTU A;  2WOM A;  4F3T A;  4OPJ A;  3AV9 A;  2VG6 A;  3OYK A;  2FBV A;  3K58 A;  3I0S A;  2XY5 A;  3VQ9 A;  4KTZ A;  4N41 A;  1WSF A;  4FW1 A;  1NK4 A;  4BAC A;  1T8E A;  2AJQ A;  4WE1 A;  1VSJ A;  3SUN A;  1ASW A;  1TKT A;  1YT3 A;  4CJR A;  2BAN A;  3KK1 A;  3MXJ A;  4O0I A;  5T7B A;  3OJS A;  1S5J A;  3HJF A;  1T05 A;  1D9F A;  1EP4 A;  3VQC A;  3K5M A;  4DTU A;  3QO9 A;  4ZTJ A;  1RDA A;  2LSN A;  3K5N A;  3KLI A;  4DU3 A;  1N5Y A;  1NKB A;  4M41 A;  4FK0 A;  4Z4E A;  1C6V A;  4I7F A;  1HRH A;  1UOC A;  3O3F A;  1TKZ A;  1J53 A;  3SPY A;  1BI4 A;  4FLW A;  3L2V A;  2F8T A;  4DQS A;  1RNH A;  3LAL A;  1LAW A;  4O55 A;  4M42 A;  4W5O A;  3NF9 A;  4JLH A;  1BGX T;  3DLK A;  2Q3S A;  4CF9 A;  4QCL A;  4LD0 A;  1Z25 A;  4CEA A;  1F21 A;  3QIN A;  3L2Q A;  4E0D A;  2JGU A;  3M8S A;  4DQP A;  1CXQ A;  1A5V A;  1WSG A;  4CJT A;  3EYZ A;  2KZM A;  3PX4 A;  2BGG A;  2XY7 A;  1I3A A;  3M8P A;  1K6Y A;  3PV8 A;  3ALY A;  4PY5 A;  4DTN A;  3QEI A;  4DF4 A;  2RN2 A;  3SUQ A;  3KLG A;  3VQP A;  1XWL A;  3G0Z A;  3M8Q A;  4YNQ A;  1L3T A;  5CY4 A;  1TK0 A;  4FJI A;  2IGI A;  5KTQ A;  3L2R A;  4CCH A;  2HB5 A;  2WON A;  3TWH A;  3QES A;  1RT1 A;  1VRT A;  4ICL A;  1EET A;  4CFA A;  4CFD A;  3LP3 A;  1RTI A;  1YTA A;  4RW7 A;  3SYZ A;  2X74 A;  5EU7 A;  4CK2 A;  1B9F A;  1TL3 A;  1NK0 A;  3VA3 A;  2G8U A;  2ITG A;  3KLE A;  4LSN A;  1NJY A;  4PQU A;  3HPG A;  2HHQ A;  1SV5 A;  3AVN A;  4B9S A;  4MQ3 A;  4FLX A;  4AIL C;  3TAN A;  4JRP A;  1ZBU A;  2HNZ A;  3AA3 A;  4EZ9 A;  4W5N A;  3ZSQ A;  3MXI A;  1WSJ A;  1BIU A;  1W0H A;  3JSM A;  3ULD A;  1NKC A;  1RT5 A;  5CYM A;  1JXB A;  4CHP A;  4DFJ A;  3SQ4 A;  5DK5 A;  2HHS A;  4CJK A;  4GMJ B;  3U6F A;  4JRQ A;  3KJV A;  3ZT4 A;  4HUG A;  3VQE A;  4FJH A;  3OJU A;  2YKN A;  3ZSV A;  4CGD A;  2X78 A;  4Z4H A;  3EZ5 A;  1VSF A;  1WN7 A;  1JKH A;  4DS5 A;  4DQI A;  3TAB A;  2B4J A;  3HP6 A;  1VSE A;  5HRP A;  1JLQ A;  2YHA A;  4HTU A;  3S3N A;  1JXE A;  1NK5 A;  4RG8 A;  3NGI A;  2P5O A;  2G8I A;  4FK2 A;  4RW9 A;  3NCI A;  2NUB A;  4E7L A;  3K5O A;  3QLH A;  3AVI A;  3NE6 A;  3FFI A;  3OS2 A;  1D9D A;  4CEZ A;  1KVB A;  2Z1H A;  4FLT A;  1JL1 A;  1ZBI A;  3VQ6 A;  4CEF A;  1QTM A;  2D0C A;  2EX3 A;  4O44 A;  1ASV A;  4KV8 A;  4KKO A;  2GV9 A;  3C94 A;  2R7Y A;  3SQ0 A;  4OGC A;  4IG0 A;  4CFC A;  4FJ8 A;  3SQ1 A;  3NH1 A;  2YNH A;  4N47 A;  1WSI A;  4C8O A;  4Z0U A;  1VSI A;  2JLE A;  1TKD A;  3B6P A;  4E7H A;  4CF0 A;  3HPO A;  3TI0 A;  1O1W A;  3RR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...