3LP3A

P15 hiv rnaseh domain with inhibitor mk3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
b'SYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords p15
publication title Structural basis for the inhibition of RNase H activity of HIV-1 reverse transcriptase by RNase H active site-directed inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
total genus 37
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lp3A00
2HW3A 4E89A 3VA3A 5SZTA 1TKZA 4B8CA 3OYDA 2XRIA 1TKXA 4ELUA 3ZSQA 4RW7A 4NCBA 1LWEA 3OS1A 3NF9A 4KKOA 1QHTA 3OYHA 3OS2A 2YKMA 1C1AA 1FKPA 2OPPA 4FJKA 5DK5A 3SI6A 4FJ7A 4FJ8A 3PX4A 3KD1E 4RW6A 2R7YA 3LP1A 3NE6A 4DTMA 1W9HA 2G8WA 3DRSA 4R5PA 4BDPA 1U47A 1VSLA 4Y1DA 3SPZA 1NK8A 3HPGA 3SQ4A 4B8AB 4CFAA 3ZT1A 5I3UA 3TWHA 1X1PA 4O0IA 1QSYA 3RWUA 3LWLA 1YT3A 3DLRA 3V1RA 1JKHA 3OYCA 3U6FA 4DQSA 3V4IA 4CGJA 1L5UA 2EHGA 4FM1A 5J2PA 1VSJA 2EX3A 5FDLA 3CM5A 3NFAA 4E19A 3K57A 2DY4A 4I7FA 3V1OA 1Z25A 3H08A 1EX4A 2YNGA 4ID5A 3ZSXA 1HRHA 3OYMA 3HL8A 4OKJA 3AA3A 4QAGA 3ZT4A 4CJTA 3CYMA 2FBYA 3VN5A 4CJQA 2QK9A 4CFDA 3HM9A 2D0AA 3IS9A 4E7LA 3HPOA 1D8YA 1XHXA 3OYBA 2HNDA 1ZBUA 4C8LA 1L3TA 3HO1A 2PZSA 3A2FA 3AVBA 3VQ6A 1KLNA 3VQ4A 3RMAA 2KFZA 4NYFA 3B6OA 4FK2A 3O3HA 3CG7A 4KV8A 4E7HA 3AA4A 3AVHA 1HJRA 1BHLA 2QXFA 4ZTJA 3MXIA 1NK0A 3PO4A 2ZQBA 4I2PA 4F3TA 2PY5A 4IKFA 2W42A 3NF7A 4FJIA 4AHCA 1N5YA 3DYAA 3PX0A 1FKOA 1LW2A 1B9DA 3HP9A 1RT4A 5HP1A 3HPHA 4BDZA 4B9MA 4CECA 2HHSA 4GMJB 4WE1A 3LP0A 1VSDA 2ZE2A 4IFYA 4CK2A 3SZ2A 4DS5A 3WNEA 4GVMA 1SL2A 1HMVA 3ZSWA 3AV9A 4JRQA 1ZBLA 3T1AA 1IKXA 4CIEA 1WAFA 4KHYA 1J53A 1RILA 4CF2A 1CXQA 4CGHA 4HUGA 4DFMA 3DOLA 1C0UA 1X9WA 2E6LA 1HYZA 2X6NA 1XC9A 5K14A 1L3UA 4W5TA 1TV6A 2KQ2A 1BIUA 1YVUA 3SUOA 2XY8A 1REVA 1Y97A 1SL0A 4CE9A 3LAMA 3PY8A 2BDPA 1JLAA 2IDOA 4F2SA 2X78A 4DF8A 1U48A 3KLFA 3V6DA 1VSIA 4NCGA 4FLZA 4L8RB 4CJ5A 2G8KA 1SUQA 1X9SA 4KO0A 1S6QA 3WNHA 3RR8A 2HHWA 2XO7A 4BWJA 2GV9A 1JLQA 3BGRA 1BGXT 3O3GA 1CZBA 1WSFA 3S3NA 3DOKA 4HTUA 4CIGA 1T8EA 2JGUA 1NOZA 3L2WA 4DTUA 4DSLA 4DLEA 2KTQA 2FC0A 4CJRA 1TAUA 1C0MA 2Y1JA 1LWCA 4H4OA 5HRNA 3KJVA 4DF4A 4DFPA 4W5NA 2ITGA 3DRPA 4OGEA 4ZHRA 1RT5A 1EETA 2KZMA 4FXDA 3NGIA 5KI6A 2HHVA 4DQIA 3AO5A 1TKDA 4DSFA 2VWKA 4B08A 4XIUA 1JLEA 2Y1IA 4H4MA 5CZ1A 5J2MA 4CJLA 4Z4FA 4CHPA 3F9KA 3OYLA 3LDSA 4ID1A 4KREA 2DFFA 4B9UA 2Z1GA 3TAMA 2HMIA 2DFHA 1ZYQA 4E0DA 3ITHA 1IKVA 1KVCA 1NJZA 1RT6A 3SUNA 4KB0A 4FJMA 2HVHA 4QOZB 3U3YA 4CHYA 2B6AA 4EZ9A 3G10A 1NKBA 3C6TA 4FVMA 4IBNA 1RBVA 5HRRA 4FM0A 1LWFA 4CGFA 1K6YA 1BISA 3OJSA 1HQEA 4FLTA 2P5GA 1KVAA 2Z1HA 4FLWA 4K8XA 2OPQA 1BCOA 4BWMA 1NJYA 1RT3A 4CHQA 5KRTA 4FK0A 3OYEA 1U4BA 3K2PA 4AHVA 4LSNA 2FBXA 1O1WA 3AA2A 3AVJA 4YFUA 5JS1A 4LD0A 5J1EA 1A5XA 1HYSA 3KLHA 3LPTA 1U49A 4J2AA 1S1XA 4GW6A 3DLHA 3BDPA 4E7IA 3OS0A 1NK5A 1Q9YA 3DRRA 4G1QA 3S9HA 4B3OA 2D0BA 2B5JA 1U04A 4KRFA 3OVNA 4HUEA 4FZZA 1IO2A 1WSIA 4MFBA 3NF6A 2HVIA 1J9AA 1IH7A 1JLCA 4E3SA 3SQ0A 1C1BA 4DTJA 1TVRA 3DLEA 3KK1A 3AO3A 3I0RA 3VQ9A 4E7JA 4LH4A 3DM2A 4CEQA 1VSKA 4J2BA 3QERA 3QINA 1QS4A 5KGXA 1JXBA 3RR7A 4DSIA 1HNVA 4HVJA 4FLXA 3T19A 2NUBA 4KAZA 4IDKA 4CJSA 1DTTA 3QEIA 4CF0A 1BI4A 4NCAA 5HRSA 4DU1A 4CHNA 1N6QA 4KI4A 4N56A 1J54A 4KTWA 3L2UA 1KVBA 4I2QA 3IRXA 4RW4A 3SUQA 4N47A 4M3ZA 2OPSA 3HVRA 1YTUA 2QKBA 3NGYA 1SL1A 1CLQA 1FXXA 1WNSA 3RRHA 1S9GA 2XY7A 3RMBA 4CESA 3DLGA 3NAEA 4CEZA 3NBPA 2XY6A 1UA0A 4N76A 4PA1A 3KD5E 2OPRA 3O4NA 2VG7A 1SKRA 2HHXA 1JXEA 4O4GA 4ZTFA 4J2EA 4CGGA 1EKEA 2HHUA 1JLGA 1SKWA 3V1QA 4M3TA 4B9NA 1TK0A 4BACA 2HNYA 3AVGA 3SPYA 5HROA 1LAVA 4C8OA 1WSGA 4DSEA 1SKSA 1TAQA 4CCHA 4DU4A 1BIZA 2G8FA 4FJHA 5JS2A 4M3RA 1B92A 3QETA 1ZBIA 4CHOA 4F2RA 4CEAA 3ZCMA 4H8KA 4E1NA 1TK5A 1RTJA 3OYFA 3K59A 4FLVA 4DS4A 3K5LA 3CFRA 4BE1A 4FJGA 2KW4A 4UQGA 1WSHA 1WSEA 1RTHA 2IAJA 3M8QA 1KLMA 4RW9A 3QEWA 1KRPA 4KTQA 4Q5VA 2G8HA 3T3FA 3CFOA 3D0PA 1KFSA 1DLOA 5C25A 1S1TA 3QNNA 5EU7A 1J5OA 5D3GA 3LP3A 1KSPA 5C24A 3PV8A 2F96A 4JRPA 3AVMA 3NGZA 4M3WA 1EXQA 1Z26A 4Z4GA 1ZBFA 4E1MA 1A5WA 1BL3A 5FROA 1QE1A 2YNFA 1VSFA 3RTVA 1NJXA 3KTQA 2G8VA 2AJQA 2ETJA 4O5BA 4DQPA 2YHAA 5C42A 1L3VA 4OKKA 4CIFA 3QO9A 1I39A 1JL1A 3KLEA 3DMJA 3K58A 1UA1A 3QEVA 3TAPA 5CZ2A 3TAQA 3QIPA 1RNHA 4B9VA 4F8RA 1I3AA 2OYQA 4DLGA 4FLUA 4LSLA 3U3GA 1ASWA 2E6MA 4AHTA 4EP4A 3SQ1A 3SJJA 3ZT0A 3AO2A 4OKEA 2OA8A 4O0JA 4CGIA 4Z4EA 2LSNA 3TABA 3C95A 3VQ8A 4I9LA 4CFBA 3P5JA 1D9FA 1TL1A 5CYMA 5KGWA 1A5VA 4OPKA 3OYAA 2VG5A 1R0AA 2A1SA 4AHUA 1BI4B 2Q3SA 3EYZA 1IG9A 2O4IA 1GOCA 4CJFA 1JLFA 1VSEA 2RPIA 3LP2A 3WNFA 3OYNA 3OYGA 1FK9A 2YNHA 4RW8A 3THVA 4M42A 4DG1A 3MEGA 3P1GA 4W5OA 1RDBA 4RG8A 1TK8A 3PX6A 3ZSRA 1WLJA 1C6VA 1QSLA 4FW2A 3QLHA 1S9EA 4B9LA 4KHSA 1XHZA 2YHBA 1RBSA 3MEEA 4CEEA 4DFKA 2D0CA 1WN7A 1YTAA 4DTOA 1DTQA 1JLBA 2ATQA 1S1WA 4F3OA 4M3XA 3V9XA 2HB5A 2KZZA 2XY5A 4C8KA 3LZIA 1HYVA 2G8IA 1GOBA 2G8UA 2OZMA 1RBRA 1RT1A 1NK7A 1S1UA 4DSKA 2DFEA 4FJXA 1WAJA 3D45A 4CFCA 4KFBA 3V9UA 1L3SA 4LH5A 3LPUA 3V9SA 3TI0A 4CJVA 3LWMA 4DWIA 3UIQA 3S3OA 1RDCA 1HNIA 3VQAA 3L2VA 2HHTA 4CJKA 3ZT2A 3SYZA 1TGOA 1UAXA 3HVTA 4BE2A 5SWMA 1LV5A 1RT2A 3LAKA 3MXMA 2IC3A 2PYJA 1NOYA 2Z1JA 4AHSA 4BE0A 3MXJA 4PQUA 4KI6A 4Z4IA 5HRPA 1U45A 3L3VA 3JYTA 3HK2A 4CJEA 3WNGA 2ZD1A 1VRUA 4OJRA 3MEDA 4BDYA 3QEPA 1RDDA 4KB1A 4AH9A 1JL2A 1S5JA 1VSMA 3M8PA 3O4QA 3E01A 1UOCA 4LY7A 1RTIA 3TAGA 1LW0A 1NKCA 4J2DA 2E4LA 4CHZA 3NHGA 4E7KA 1VSHA 4HHTA 4IFVA 4FJNA 1F21A 4FJLA 1WSJA 3HT3A 4FJ9A 3ZSVA 3NH0A 1RDAA 4OPJA 3HJFA 3VQPA 3VQCA 3V81A 2QKKA 3C94A 1SV5A 3G0ZA 3RRGA 4Y1CA 3OYKA 3VQ5A 4DTPA 3ZSYA 4DU3A 3LALA 3KKRA 4CJUA 1IKYA 2YV0X 1HQUA 4HCBA 3K5MA 3DLBA 1TKTA 1XI1A 1TL3A 4EP5A 2D5RA 5DMRA 3V9ZA 3SUPA 2HHQA 3OYIA 2BGGA 3L2QA 3AVAA 1QQCA 4JS5A 1NJWA 3ZSOA 4PUOA 3SCXA 2GBZA 5HBMA 4FZXC 3M8RA 4QCLA 4DQRA 1RCHA 3M8SA 1B9FA 1C1CA 1CXUA 3AO1A 4CJPA 4CEOA 4Z4HA 4CK3A 3HP6A 5J2NA 4DTSA 3HYFA 3MAQA 3PO5A 5J2QA 4KHQA 3IG1A 4DFJA 3EZ5A 3I8DA 1HPZA 3OY9A 4JLHA 4ELVA 4IG3A 1C0TA 1BQNA 2O4GA 3ALYA 4CGDA 3CQ8A 3TAFA 1Q9XA 2KFNA 5FRMA 1S1VA 3KKSA 4FM2A 3AVFA 1X9MA 4ELTA 2P1JA 1NK6A 4FJ5A 4ICLA 4CF9A 5KRSA 4CEDA 1MU2A 1ZBHA 4PWDA 2WONA 4O55A 2YKNA 3ZT3A 1W0HA 4YNQA 4CF8A 1CZ9A 4DTNA 3QESA 2PYLA 2YNIA 4C8MA 3SV3A 1G15A 1VRTA 4M45A 1D9DA 3KLIA 4O44A 1GOAA 4TSXA 3HXMA 4KHNA 4OLBA 2WOMA 4HUFA 3LZJA 3TAEA 2A1RA 4FYDA 3VQQA 2X74A 1LAWA 4DMNA 4DTXA 3QNOA 2BANA 3NH2A 4K8ZA 1VK0A 3SNNA 3KIOA 5T7BA 4OVLA 4EZ6A 3CM6A 2HNZA 3ASMA 5HLFA 3RMCA 2RKIA 1NK9A 4F4KA 1ASUA 3AVIA 3DI6A 4KHWA 1ITGA 2FBVA 4N5SA 3QIOA 4W5RA 1KCFA 5I42A 1RT7A 4CJ4A 2BE2A 4FJJA 3TR8A 1UWBA 4CJWA 1D5AA 3VQ7A 3B6PA 1KFDA 4AHRA 5KTQA 3L8BA 3AVCA 2VWJA 3AVNA 2Z1IA 4Z0UA 2RN2A 1RBUA 1T05A 1QSSA 3IAYA 3NF8A 2P5OA 1KTQA 4M3UA 4CERA 1NKEA 2DTUA 1RTDA 3NDKA 4CK1A 3OYJA 4MQ3A 3EY1A 1T7PA 4DQQA 4JS4A 3TARA 4I9QA 3S3MA 3O3FA 4OGCA 4AILC 3ULDA 2VG6A 3AA5X 3P83D 3CFPA 2OZSA 3AO4A 3L2RA 3FFIA 4CEFA 3C6UA 3ISNC 3QEXA 2P51A 1RBTA 4HCCA 3AVLA 1ASVA 3VQEA 4DSJA 4B9SA 4Z4CA 1Q8IA 4Q0BA 1EP4A 2RF2A 5CY4A 4NYNA 3TANA 4CEBA 3SQ2A 4FCYA 3RMDA 1NK4A 4B9TA 3L3UA 4C8NA 3KK3A 4W5QA 4FW1A 4DTRA 1BCMA 1S6PA 2FBTA 3VQBA 3ZSZA 4FLYA 3K5OA 4N41A 3I0SA 4OLAA 4CF1A 3NH1A 3KLGA 3MECA 2I5JA 3K5NA 4IG0A 3VA0A 2XHBA 1BQMA 4FZYA 2F8SA 2B4JA 3OJUA 3V9WA 3JSMA 4M41A 3NCIA 3F73A 4M3YA 1XWLA 4PY5A 2IOCA 3LANA 3SV4A 2GUIA 1IKWA 4FK4A 4KHUA 3VQDA 4CJ3A 3HSTB 1QTMA 2IS3A 3PUFA 4KTZA 3AVKA 4KPYA 5E41A 5FRNA 5CYQA 2F8TA 2JLEA 2X6SA 3KK2A 2IGIA 1T03A 3DLKA
chains in the Genus database with same CATH superfamily
3QICA 4LFBK 4U67L 3OYDA 1TKXA 4RW7A 3ENBA 1LWEA 3NF9A 4FWOA 4FJKA 1QQMA 4DTMA 3VEVA 4BDPA 1U47A 4CD1A 1VSLA 1NK8A 3THYA 1VQNN 4B8AB 3ZT1A 4XH4A 3TWHA 1X1PA 4O0IA 3RWUA 4JHDA 2VQFK 1JKHA 5AQHA 2CGLA 3U9DA 1VSJA 2EX3A 3MN9A 4H03B 2ITMA 4HTLA 5FDLA 3K57A 2HBKA 4B1VA 3H08A 3OBWA 3ZSXA 1QVFM 3CQYA 2FBYA 4K0KK 3FFKB 3ZEUA 1LOTB 1MWMA 3CIPA 1ZBUA 4CBWA 3A5NC 5CR4A 3HO1A 3AVBA 2BUPA 4BC4A 3O1WA 4BRKA 2P9PA 1H1VA 5AQFA 4E7HA 3AVHA 3VMFB 1HJRA 3LDNA 2CGKA 4MDAA 2ZQBA 3KZBA 4I2PA 4CZLA 4F3TA 2E2QA 4AM6A 4X64K 1LW2A 5LJVA 3HP9A 4B9MA 1TUYA 4WE1A 1HMVA 1VQ6N 3BF1A 3AV9A 4JRQA 1ZBLA 4DR3K 1NGIA 1CXQA 4HUGA 3NMUA 1X9WA 2E6LA 4XEIA 1BIUA 3J81O 2XY8A 1SL0A 3LAMA 1JLAA 4DF8A 2O8CB 3KLFA 4NCGA 1W97L 2GV9A 3O3GA 1CZBA 2F4VK 4CIGA 3ATVA 1T8EA 1NOZA 4DTUA 1W2BM 4DSLA 4DLEA 2FC0A 1LWCA 3H3NO 3C0BA 3KJVA 4DF4A 5LMUK 2ITGA 3DRPA 3D2FA 5KI6A 4B08A 2F9TA 5AQZA 2O8EA 3W3DA 4Z4FA 3VENA 2V52B 3TAMA 4WQ5A 2HVHA 1Q82O 4CHYA 3K9JA 5HRRA 4B1UB 1LWFA 4DHYA 4XH1A 4FLWA 2P9NB 4YHHK 3L4IA 1U4BA 2P9SB 2FBXA 4LSNA 4YFUA 5J1EA 1A5XA 3KLHA 1S22A 5H1SQ 4GW6A 5LJWA 3BDPA 4B3OA 4G1QA 4LF8K 2D0BA 4FWSA 3P39A 4HUEA 1W7AA 4MFBA 1VQ8N 3TTCA 4E3SA 3SQ0A 1TUUA 2E5LK 1TVRA 1EO1A 3DLEA 3THXA 3O1BA 3VQ9A 1GLLO 4LF9K 4DSIA 1HNVA 4FLXA 1E4GT 4IZ9A 2NUBA 3T19A 4LF6K 4CF0A 2OTJN 1N6QA 1J54A 4UY8O 4M3ZA 3IRXA 5TKWA 3HVRA 4PHTX 3THWA 1SL1A 2EWSA 1QQNA 1FXXA 2XY7A 1S9GA 4K43A 4BG9A 4BR2A 3RMBA 4CESA 1GLEG 2NRRA 3U4LA 3O4NA 4ZTFA 1JLGA 1N8RO 1Z05A 3AVGA 5HROA 4BGAA 4C8OA 1WSGA 1TAQA 4NLCA 1WBBA 2KHOA 4F2RA 3ZCMA 4H8KA 4E1NA 3PIPL 2JWLA 1NMDA 3K59A 2FSNA 2VQEK 3K5LA 2Q36A 4DS4A 2KW4A 2FF3B 1WSEA 3CCEN 4YOTA 4WYBA 2GELA 1DLOA 1S1TA 3QNNA 5EU7A 4NLBA 4CW7B 5C24A 1EXQA 3KK7A 3VGLA 2YNFA 5JVHL 1HKCA 4O5BA 2YHAA 3QO9A 1I39A 3O6WA 3KLEA 3K58A 3EZWA 3QIPA 1RNHA 4BC3A 4DLGA 4FLUA 2FSJA 3U3GA 2E6MA 3SJJA 4X65K 2UU9K 2GEMA 4O0JA 3VQ8A 2P5OA 4B3SK 5CYMA 3OYAA 1R0AA 1A5VA 4FO0A 4JD2A 2ASPA 4AHUA 1BI4B 2O4IA 1JLFA 3OYNA 1FK9A 4M42A 4DG1A 4W5OA 1VQ4N 3VF4A 2WBNA 1QSLA 2YJEA 4CEEA 3MEEA 4CZHA 1WN7A 1YTAA 4DTOA 1DTQA 1S1WA 3AAPA 4H0TB 2HB5A 4BVPA 5F1XA 1BU6O 2G8IA 2G8UA 3SJHA 3O8MA 4EIAA 2QW9A 1WAJA 1ATRA 3LWMA 2HSTA 3SYZA 1TGOA 1UAXA 3HVTA 4AM7A 1JCEA 4A59A 1N34K 2HF3A 4BR0A 1NOYA 4PQUA 4KI6A 1KC8O 1U45A 4WCEL 3CPWM 3MEDA 3QEPA 1RDDA 4M7XA 1JL2A 3O9TA 4AH9A 1VSMA 4RWTA 3M8PA 3BZKA 2KKZA 3W0LA 3TAGA 1LW0A 1NKCA 2O8BA 5F0XA 3HT3A 3T1YK 3ZSVA 3MWPA 3HJFA 3VQCA 2QKKA 3RRGA 1XC3A 4Y1CA 1KQSM 2I7NA 4MDBA 4LC9B 3LALA 4CJUA 4HCBA 3K5MA 1HLUA 4EP5A 3CQXA 3EE8A 3L0QA 2P9IA 5AZIB 4FZXC 5HBMA 3M8RA 1VQ9N 3P4IA 4DQRA 3HP6A 4CD3A 4CZGA 4Z4HA 4JI5K 3PO5A 5GAEP 3EZ5A 4H5TA 1HPZA 4GNIA 3ALYA 2Q0RA 4DR2K 2QM1A 3KKSA 4JK9A 1X9MA 4ELTA 2HOEA 4FJ5A 5M1FA 3SBGA 2WONA 5AQSA 4CF8A 2PYLA 3MN5A 4C8MA 4M45A 3CJAA 3OBYA 3D2EB 4KHNA 3HXMA 3VQQA 4DMNA 4BG8A 3QNOA 5T7BA 1VQLN 2HNZA 1NK9A 2RKIA 4N5SA 2E1YA 4B1WB 3VETA 2NLXA 1RT7A 2BE2A 4FJJA 1D5AA 3JXUA 3VQ7A 3BUZB 4AHRA 5KTQA 3L8BA 3AVCA 2VWJA 2RN2A 3TSUA 2ZJQL 4RTFD 1YI2N 3OYJA 4BVOA 3EY1A 1T7PA 3O3FA 5AQUA 4AILC 3ULDA 2OZSA 3L2RA 3JS6A 3C6UA 2QWQA 3ISNC 2P51A 4MO4A 1BA0A 4KHPK 2YJFA 1HJOA 1T44A 4Z4CA 4IWVA 1E4FT 2RF2A 3TANA 3E9OA 1K73O 4B9TA 3KK3A 1BCMA 1S6PA 4YORA 3VQBA 1M1KO 3KLGA 4IG0A 4FZYA 2B4JA 4DR7K 4M3YA 1XWLA 4PY5A 2GUIA 4KHUA 3VQDA 4H0OA 3PUFA 5FRNA 2X6SA 4FK2A 1C0FA 3N4QA 3KK2A 1LV5A 2A6AA 5GINA 3ENHA 4B8CA 2XRIA 3AAQA 3P31A 4ELUA 4FSVA 5GIOA 4KKOA 3OYHA 4FJ7A 1FKPA 1NJIO 4FJ8A 5DK5A 3PX4A 3KD1E 4RW6A 1W9HA 4X66K 3CF5L 2E88A 2O8CA 4Y1DA 3SPZA 4DUYK 3SQ4A 4JK8A 5I3UA 3DLRA 3V1RA 4CGJA 1NGFA 3I56N 4FM1A 5J2PA 3CM5A 2DY4A 1Z25A 4BR7A 4ID5A 1HRHA 3VEZA 3OYMA 3EN9A 3ZT4A 3HBTA 3H6EA 3CYMA 5JLFA 4CFDA 3HM9A 1NGBA 3FZMA 2D0AA 3HPOA 4NB4A 3OYBA 1J5EK 2GX9A 4R79A 4C8LA 2PZSA 3VQ6A 2AA4A 2KFZA 3H45C 3CG7A 4KV8A 2CH5A 2QXFA 4ZTJA 3JAMO 1NK0A 3CC2N 3NF7A 2P9NA 3MMVA 4AHCA 1N5YA 3DJCA 1B9DA 1WBDA 4BDZA 2P9SA 3A5OC 2UUAK 4CK2A 4IFYA 4FPAA 1SL2A 4GVMA 3ZSWA 1JCFA 3BP8A 4CIEA 1WAFA 1J53A 3TTDA 1M90O 1HYZA 4IEEA 2X6NA 1XC9A 1TV6A 3WEEB 1REVA 4CE9A 2BDPA 2X78A 1U48A 2Q0UA 1NGJA 5C0YA 1VSIA 5BPLA 4FLZA 2G8KA 1SUQA 2HHWA 4BWJA 4C1NK 4H0XB 1OVYA 4CZEA 1YXQA 3DOKA 4JNEA 4BRIA 2KTQA 2YHXA 2Y1JA 4H4OA 3R6MA 4JKDA 5HRNA 4W5NA 2E2PA 4OGEA 5AQKA 4ZHRA 1HPMA 4OX9K 1EETA 2NZTA 4FXDA 3NGIA 3HOTA 3H1VX 2VWKA 5KPZA 4XIUA 2Y1IA 5CZ1A 5J2MA 4CJLA 3L4QA 4CHPA 3F9KA 4ID1A 2Z1GA 4FOEA 4JKAA 4E0DA 3ITHA 1IKVA 1RT6A 4BRMA 4FJMA 4CZJA 4EZ9A 2WFBA 2HHHK 3N4PA 1RBVA 2RE2A 4CGFA 4B3RK 3OJSA 1HQEA 2OPQA 1BCOA 1RGIA 4BWMA 5BRFA 1NJYA 4CHQA 1EWRA 4AQYK 3AA2A 1NGDA 4LD0A 3CCQN 5AQTA 2IVNA 3C7NB 4BRGA 4DKWA 1U49A 4E7IA 1NK5A 3DRRA 3S9HA 2NRWA 2HVIA 4FZZA 1IO2A 1MDUB 5IWAK 1ESVA 1JLCA 4HWIA 3AO3A 4LH4A 3HOSA 1VSKA 4IJAA 4BREA 3OA9A 3AY9A 1QS4A 3TPQA 5AQIA 4HVJA 5KPRA 3SBTA 3QEIA 1BI4A 4FL9A 1YJNN 4CHNA 3UB5A 4I2QA 4RW4A 4N47A 1QHAA 3LL3A 3LDLA 4KH5A 1I94K 4B1XB 1G99A 2P9LB 3M5RA 3NAEA 4CEZA 4EAHD 2XY6A 3VGKA 4PA1A 2VG7A 1SKRA 2HHXA 1JXEA 4O4GA 1EKEA 2HHUA 3V1QA 1OH8A 4B9NA 2HNYA 4BROA 3SPYA 1FJGK 1LAVA 3IFRA 2G8FA 1BIZA 5JS2A 1IBKK 4M3RA 1OKJA 4CHOA 4JI8K 2YHYA 1DT9A 3OYFA 4FWLA 3SLCA 5ADXA 2QWRA 4O8KA 1N32K 1KLMA 1KRPA 4KTQA 1Q18A 5BRDA 5C25A 3VERA 3TU5A 5D3GA 1KSPA 3FZHA 3CCRN 4Z4GA 1ZBFA 4AF1A 1A5WA 2HF4A 3RSEA 1VSFA 5AQWA 3RTVA 3KTQA 2QI2A 2G8VA 4L3QA 4JK7A 5JMVA 5A2QO 4YY3K 1UA1A 3QEVA 1K8KB 3TAPA 4B9VA 1I3AA 2OYQA 4EP4A 4WF9L 3ZT0A 3EEQA 4Z4EA 4I9LA 3P5JA 1D9FA 5KGWA 4OPKA 2HMPA 3TSQA 3EYZA 1QVGM 2V51B 1VSEA 3LP2A 3OYGA 4CBXA 4RW8A 2YNHA 3IUCA 1NNEA 5GIPA 3MEGA 4RG8A 4ISFA 3PX6A 2YX6A 4FW2A 5AZIA 4KHSA 4BC5A 2D0PA 2HBJA 4M3XA 3DWLA 4DV5K 2KZZA 2XY5A 4RCHA 4C8KA 1RT1A 3SK3A 4DSKA 2DFEA 3H1QA 4DR5K 4FJXA 4CFCA 3D45A 3V9UA 4LH5A 3LPUA 3V9SA 4CJVA 1DGKN 4DWIA 4YOWA 3ZT2A 3HRGA 4K25A 5SWMA 1DEJA 5AQRA 1RT2A 4DV7K 2IC3A 3L6QA 1HX1A 4A2BA 3D2EA 3OW2M 2D1KA 3JYTA 3HK2A 4IXCA 1VQKN 3WNGA 2ZD1A 2ASOA 4I6MB 4GV6A 3E01A 1UOCA 4JI4K 3CCLN 2V7YA 4J2DA 2E4LA 4CHZA 3NHGA 1VSHA 4HHTA 4FJLA 4GV3A 4QS9A 1P8ZA 2A40A 3V81A 1SV5A 3VTIA 3OYKA 4DTPA 3ZSYA 2QXLA 4DU3A 1T3VA 3KKRA 5CHIA 1IKYA 4DV0K 5IT9O 3AGRA 4FWKA 5M1OA 4YDUA 1XI1A 5M1QA 4DR6K 3M3ZA 2HHQA 1U6ZA 2BGGA 1NLVA 1QQCA 2J4RA 3ZSOA 3ZYYX 3SCXA 5KQDA 2P9UA 1NGCA 4QCLA 1B9FA 2FXUA 3SQ1A 4CJPA 4CEOA 3U8XA 3MAQA 3TTFA 3F9MA 4FOIA 1CZAN 3E9PA 4JLHA 4CGDA 1Q9XA 1YVNA 4FM2A 3WXIA 3VF2A 4Z94A 3QFUA 2P1JA 3GE1A 5KRSA 4CEDA 4OPAA 2YKNA 1RDWX 4DTNA 2YNIA 1G15A 5AFUH 1BO5O 4M63C 1D9DA 3KLIA 4BQLA 3ATUA 4OLBA 4HUFA 3LZJA 3FZFA 3B8AX 3NH2A 3FZKA 4FVUA 3KIOA 2VCPA 4OVLA 2QWLA 3CM6A 5AQMA 4JI3K 1NGEA 1ASUA 3DI6A 4KHWA 1KCFA 4E1JA 5I42A 3ZX0A 1UWBA 3ID8A 4CJWA 1NBWA 3B6PA 1KFDA 3AVNA 2Z1IA 1T05A 4A62A 1RBUA 2QWMA 2DPNA 1LCUA 1QZ5A 1X9JA 3NDKA 4ISGA 4CK1A 5BR8K 2ASMA 2VG6A 3CC7N 3CFPA 4O8UA 2A42A 4IOXA 4C1NI 4JKCA 4LF7K 3GG4A 3SAHA 1V4TA 4IO8A 4JKHA 4C8NA 1C0GA 4DTRA 4FW1A 3G4SN 4OLAA 3MECA 2D4WA 2UXCK 3DLLL 3O9QA 2XHBA 3SMPA 4M41A 1ATSA 2IOCA 4FK4A 5C2FA 4CJ3A 3NVKA 1QTMA 3AVKA 4KPYA 4A2AA 5CYQA 3L3VA 3O80A 1IG9A 2HW3A 4E89A 1XQSC 3WQTA 4NCBA 3SI6A 3FGUA 3NE6A 2IIRA 3DRSA 1N33K 5BREA 2OANA 2F7TA 3J7YP 3P38A 5LL6Z 3PIOL 5DM7L 3F5TA 3LWLA 3U6FA 4DQSA 4KH4A 3V4IA 1L5UA 2EHGA 4LFCK 3A5LC 4Y0WA 3ZX2A 3NFAA 4GKJK 1BWFO 3V1OA 1EX4A 2YNGA 4OKJA 3AA3A 1ZBSA 4QAGA 4H0YB 3VN5A 1JJ2M 2WC9A 3IS9A 1XMQK 2P9KA 3OHRA 5JVGL 1D8YA 4H0VB 2HNDA 1KLNA 5TKYA 4JKGB 5FPMA 3A0IX 3O3HA 3AA4A 1OVQA 2NNWA 3PO4A 3SAFA 2PY5A 1IBMK 4IKFA 2E8AA 4FJIA 1VQ5N 2O8DB 3DYAA 3QB0A 1WB9A 1RT4A 1HNWK 4CECA 4GMJB 1VSDA 2ZE2A 4DS5A 3WNEA 3C7NA 4DUZK 4A5BA 3QFPA 2YI1A 4IEIA 5B8HA 5C10A 4WFNL 4CGHA 2QA4N 4B9QA 2UYTA 5K14A 4W5TA 3PY8A 4F2SA 2IDOA 2Q1NA 4CJ5A 1X9SA 1HNZK 4JAXA 3WNHA 4H5NA 1JLQA 3BGRA 1KAXA 1WSFA 5AQPA 3S3NA 4HTUA 4G9ZA 3QBWA 2JGUA 3T7ZA 1T6CA 1GLJO 4CJRA 3QMLA 5AQXA 3LDOA 2QEXN 3C65A 4DFPA 3R1XA 2QWNA 4F9OA 1RT5A 2P9LA 3AO5A 4JKFA 1JLEA 4H4MA 1SS6A 4WQ5C 3LDSA 2DFFA 4B9UA 2HMIA 1KVCA 2E20A 4K42A 1NJZA 3VTHA 4FWMA 4QOZB 3U3YA 3C6TA 1Z6RA 4BGBA 4JI0K 4IBNA 4FM0A 3GOIA 4IOCL 1K6YA 1BISA 4OO1J 4FLTA 2P5GA 2Z1HA 4WFAL 4K8XA 1RT3A 4FK0A 4AHVA 2ZGYA 3EKUA 2GTDA 3R8EA 1HYSA 4J2AA 1S1XA 4EFHA 3DLHA 5AQQA 1Q9YA 3Q7BA 1U04A 4MLHA 3FR0A 4FWQA 3NF6A 1QZ6A 1C1BA 4DTJA 4C23A 1K8KA 3KK1A 4E7JA 4DR1K 3CMAN 4J2BA 5AZJB 3QERA 4IFEA 3RR7A 4KAZA 1MA9B 1QQOA 4IDKA 3ZETB 4CJSA 4BR9A 1XMOK 4NCAA 5HRSA 5FPDA 4KI4A 4N56A 4BRPA 1KVBA 1YTUA 2QKBA 1CLQA 3VESA 1WNSA 1NGAA 4GVEA 3NBPA 1E3MA 3KD5E 2OPRA 4IDHA 4J2EA 4CGGA 1Q81O 4M3TA 1TK0A 4BACA 4FJHA 4YOUA 5EY4A 1ZBIA 3VF6A 1TK5A 1OH5A 3PLAA 4FLVA 4BR5A 4BE1A 1HR0K 2IAJA 1RTHA 2E1ZA 3QEWA 2W41A 3CFOA 1U2VB 3HI0A 5BN9A 1N36K 2JWKA 2FSKA 3LP3A 5AFUA 2O8FB 2F96A 3AVMA 4M3WA 2VYPA 1Z26A 4JN4A 4E1MA 4I6MA 3QDKA 2IVPA 4A5AA 1NJXA 1IG8A 2AJQA 2ETJA 4DQPA 4CIFA 1JL1A 5CZ2A 4BRDA 4F8RA 1ASWA 4AHTA 4DV3K 3TABA 1TL1A 2VG5A 5AQJA 2Q3SA 2NRHA 3VEYA 1YITN 1KXPA 4GKKK 3WNFA 2NRVA 3RVCA 1TK8A 4YOXA 3EL2A 4JYAK 3ZSRA 1WLJA 4DQ8A 1C6VA 1DKGD 3CMEN 3QLHA 5M1KA 1XHZA 1RBSA 3MCAB 2D0CA 2GWJA 2ATQA 4F3OA 3WXKA 3V9XA 3IKMA 4PKGA 1BG3A 1HYVA 3U9ZA 3G71N 2OZMA 1S1UA 1XNQK 4KFBA 1L3SA 1TYQB 1RDUA 3ULEB 3S3OA 2AP1A 1HNIA 1HNXK 4CJKA 3I8BA 2F9WA 1S72N 3D6RA 2PYJA 3MXMA 4CVNE 4OJRA 2W40A 1FW6A 3CJ7A 4KB1A 3E9LA 1WUAA 4WFBL 3AGKA 3K0SA 2RHKA 2ZWHA 3CCMN 3O4WA 4IFVA 2WTUA 3O5BA 4FJ9A 3NH0A 1RDAA 3C94A 2W6LA 3WUHA 4A57A 2YV0X 1HQUA 2A5XA 3DLBA 3CETA 3HSCA 3MX5A 3V9ZA 3SUPA 1VQ7N 3OYIA 2FLOA 3VPZA 4BRAA 3L2QA 4JS5A 1NJWA 5AJ3K 4PUOA 2GBZA 4B3TK 5BPNA 5KPTA 1CXUA 3DXMB 3AO1A 4CK3A 3G6EN 5J2NA 4DTSA 3HYFA 4B3MK 5LMNK 4KHQA 3IG1A 3I8DA 2OTLN 1ZXOA 1BUPA 3OY9A 4ELVA 1C0TA 2O4GA 3TAFA 3HTVA 4U7BA 1S1VA 3R3LA 1BOTO 1NK6A 2UUCK 3QBXA 2CH6A 2QWPA 3C6HA 1MU2A 4BRLA 5GADP 1ZBHA 4O55A 3WXJA 1W0HA 4YNQA 2ZJPL 1CZ9A 3SAGA 3SV3A 1VRTA 1J6ZA 2PAVA 3NVMA 4O44A 1GOAA 2WOMA 2VGNA 4FYDA 1LAWA 2BANA 4FPBA 3J7AP 3UKRB 3ASMA 5HLFA 4F4KA 3AVIA 1ITGA 2FBVA 4BR4A 2OCEA 1K9MO 3KWGA 4CJ4A 3FLCO 3IAYA 1VQON 1QSSA 4M3UA 2DTUA 3NF8A 1KTQA 4CERA 1NKEA 3T69A 1RTDA 4WQ4A 3LDPA 4I9QA 3J80O 5BRHA 4MLEA 2GUPA 1KAZA 3EO3A 1VQPN 1K8AO 3AA5X 3P83D 3AO4A 4QS7A 4DV1K 4BRFA 4HCCA 3AVLA 1ASVA 3VQEA 3DXKB 1Q8IA 2VWBA 2UUBK 4Q0BA 4DCHA 1EP4A 5FLXO 5CY4A 4JI1K 3HM8A 4CEBA 3SQ2A 3KWIA 1GLAG 4JKGA 4FCYA 1NK4A 3L3UA 4N41A 2FBTA 3ZSZA 2H3GX 4FWPA 3NH1A 2I5JA 5M1PA 1BQMA 2F8SA 3M1FA 1YJ9N 2O8DA 3NCIA 1NWKA 3SV4A 1HKGA 1R59O 1KD1O 3UKUB 4MO5A 3E1YA 3WT0A 5E41A 2F8TA 2JLEA 3VA3A 5SZTA 2VGMA 1TKZA 1EWQA 1NMNA 3ZSQA 3CCVN 4BRCA 3OS1A 1QHTA 4Z4IA 3OS2A 2YKMA 1C1AA 2OPPA 5AQOA 4DB3A 2R7YA 3LP1A 2Q97A 3WXMB 4CZFA 2G8WA 4R5PA 4K41A 3ZLJA 3HPGA 3CHWA 4CFAA 1QSYA 1YT3A 2ZJRL 3OYCA 1Y64A 4E19A 4I7FA 4XH5A 3HL8A 4CJTA 5FPEA 4CJQA 2QK9A 2A3ZA 2NRZA 5C2DA 1VQMN 1YHQN 4E7LA 1T6DA 3DAWA 1XHXA 3WQUA 1S3XA 4NXNK 5AQYA 1XUPO 5LY3A 2ZGZA 1L3TA 5F2RA 3A2FA 3VQ4A 3RMAA 4NYFA 3B6OA 1VHXA 3O9SA 1Q7YO 4BRNA 1BHLA 3MXIA 3T1HK 3LDQA 2W42A 4PKHA 3O08A 4YOYA 1NGHA 3PX0A 1FKOA 3CCJN 5HP1A 3HPHA 2HHSA 3LP0A 1SQKA 3CC4N 5ELZA 3SZ2A 5AQLA 3A5MC 4JI6K 3S41A 3D7EO 4LF4K 3T1AA 1IKXA 4KHYA 1RILA 4CF2A 4DFMA 3DOLA 1C0UA 1L3UA 2KQ2A 3SUOA 1YVUA 1Y97A 1YJWN 1NGGA 3V6DA 4L8RB 5AZJA 3CERA 3THYB 4KO0A 1S6QA 4CJ7A 2GWKA 3RR8A 2XO7A 1XNRK 1BGXT 3WXLA 4JHDB 4B1YB 4IO9L 1X3NA 3ZETA 5E26A 4LF5K 3L2WA 3FZLA 4EHTA 2NRTA 1TAUA 1C0MA 5E84A 4OPHA 3I33A 1JCGA 1OH6A 3MWTA 2W6KA 2KZMA 2HHVA 4DQIA 4LFAK 1EQYA 5AQVA 1NU0A 3G25A 4DSFA 1TKDA 3ZEUB 3J8AA 1BA1A 2QWOA 3OYLA 4KREA 2DFHA 1ZYQA 1NM1A 2P9PB 2A41A 3MCPA 3SUNA 4KB0A 2B6AA 1YF5L 3H3OB 3MN7A 3G10A 3IMXA 4YOVA 4FVMA 1NKBA 2CGJA 3VEWA 5AQGA 1KVAA 3MN6A 2D0OA 2ZM6K 2NRXA 2KLAA 5KRTA 1U2VA 3OYEA 3K2PA 1O1WA 4BQZA 3CXCM 3AVJA 4JI7K 5JS1A 5BN8A 2O8FA 5I9EB 3LPTA 3WEEA 5C12A 2Q31A 3OS0A 2B5JA 4KRFA 3OVNA 4JKEA 1WSIA 4ILJA 2UXBK 1J9AA 1IH7A 2QTDA 5C15A 3E66A 3RSEB 1Q86O 4B1ZA 3I0RA 4GV9A 2E2NA 3DM2A 4CEQA 3QINA 3C6AA 3O9UA 5KGXA 1JXBA 2I7PA 5AR0A 1DTTA 3PSFA 4DU1A 2BTFA 4KTWA 3L2UA 1IBLK 3LM2A 4CZKA 3SUQA 2OPSA 1VAZA 3NGYA 4DR4K 3RRHA 1SZ2A 3D2FB 4CZMA 3VEXA 3SMSA 3DLGA 1UA0A 4N76A 2WUSA 2O8EB 1SKWA 1SKSA 4DSEA 4CCHA 4DU4A 1B92A 3QETA 3J7ZO 4CEAA 1RTJA 1TYQA 4JI2K 4M7YA 3ULEA 1MWKA 3CFRA 4FJGA 4UQGA 1GLDG 1WSHA 3ZX3A 3M8QA 3GBTA 4RW9A 5BR9A 3BEXA 4Q5VA 2G8HA 3T3FA 3VGMA 3D0PA 1KFSA 5ADXH 5DM6L 1J5OA 3A8YA 3Q7CA 3PV8A 4JRPA 3NGZA 3VEOA 3O9RA 1BL3A 5FROA 4IOAL 1QE1A 5C42A 1L3VA 4OKKA 3DMJA 4H0PA 3THXB 1BDGA 2Q2RA 3CJBA 3TAQA 4LSLA 3MDQA 4CI6A 3AO2A 4OKEA 2OA8A 4CGIA 1GLCG 2LSNA 3CJ1A 4J8FA 3C95A 4CFBA 3CJ9A 3M6GA 1WOQA 2A1SA 5GAGP 1YUWA 5FPNA 1GOCA 4CJFA 5GAHP 2RPIA 3KVGA 1ILYA 3CCUN 4WQ4C 4A61A 3THWB 3THVA 3P1GA 1RDBA 5EVZA 3K9KA 3PSIA 3VOVA 5AQNA 1GLBG 1S9EA 4B9LA 2YHBA 4DFKA 1JLBA 4FWRA 3DXMA 3GDQA 3LZIA 3CJCA 4NXMK 1GOBA 2P9UB 4BC2A 1RBRA 1IJJA 1NK7A 1YAGA 1ZC6A 3OTOK 4PL7A 3TI0A 3KHYA 5HL7L 3UIQA 2HBMA 4BRHA 1RDCA 3VQAA 3L2VA 2HHTA 3AARA 4BE2A 1YIJN 3GL1A 3LAKA 2IVOA 1GLFO 2Z1JA 4AHSA 4BE0A 3MXJA 5HRPA 2ZF5O 4CJEA 1VRUA 2PFUA 4BDYA 3LM9A 1S5JA 4JV5K 3O4QA 3UKRA 4LY7A 1RTIA 4ISEA 2YHWA 1O13A 3I55N 4E7KA 5MLCQ 3CPEA 4FJNA 1F21A 2BH1A 1WSJA 3ENOA 4OPJA 3VQPA 3G0ZA 3UE5A 4JD2B 5JLHA 4YDUC 3VQ5A 4PKIA 3EE9A 1NG9A 1TKTA 3BF3A 1TL3A 4DV6K 2D5RA 3EKSA 5DMRA 4DV4K 3AVAA 4EHUA 2V7ZA 4KH6A 3DXKA 1X3MA 4H5VA 1RCHA 3M8SA 4CZIA 1C1CA 3SNNA 4EZ6A 5J2QA 3BY5A 3CD6N 4DFJA 4IJNA 4X62K 3F2KA 5JICA 4IG3A 1BQNA 3CQ8A 2KFNA 5FRMA 3CCSN 3CI5A 3AVFA 4ICLA 4CF9A 3UKUA 4PWDA 2E2OA 3ZT3A 4GY2B 3QESA 4PL8A 5M1NA 1P90A 4TSXA 4ILGB 4DV2K 3TAEA 5EX5A 3R9PA 2A1RA 3FE1A 2X74A 3IDHA 4DTXA 4K8ZA 2HBLA 1VK0A 1D4XA 5EOYA 4O5FA 3RMCA 4V19S 1HUXA 3BZCA 1IV0A 3QIOA 4W5RA 2O8BB 3ID6A 4FWNA 4QS8A 5CE3A 3TR8A 2UXDK 4Z0UA 1ATNA 5BPMA 5EXWA 1RFQA 4MQ3A 4H5RA 4DQQA 4BRQA 4JS4A 3TARA 3S3MA 4OGCA 5KQ8A 1SAZA 2YCHA 4BY9C 3H46O 5HOOA 3FFIA 4CEFA 4JEPA 2P9IB 3QEXA 2FF6A 1RBTA 3TSPA 4DSJA 4B9SA 4ILHA 3HZ6A 3MK6A 1KAYA 2P9KB 4NYNA 3RMDA 4NO7A 4W5QA 4FLYA 4H5WA 3K5OA 1HKBA 3I0SA 2PBDA 4CF1A 4CBUA 4KBOA 3K5NA 3VA0A 3OJUA 3V9WA 3JSMA 3F73A 3MX2A 3LANA 1IKWA 1OH7A 1V4SA 3HSTB 2IS3A 4KTZA 4JKBA 2IGIA 1T03A 3DLKA
chains in the Genus database with same CATH topology
2HW3A 4E89A 3VA3A 5SZTA 1TKZA 4B8CA 3OYDA 2XRIA 1TKXA 4ELUA 3ZSQA 4RW7A 4NCBA 1LWEA 3OS1A 3NF9A 4KKOA 1QHTA 3OYHA 3OS2A 2YKMA 1C1AA 1FKPA 2OPPA 4FJKA 5DK5A 3SI6A 4FJ7A 4FJ8A 3PX4A 3KD1E 4RW6A 2R7YA 3LP1A 3NE6A 4DTMA 1W9HA 2G8WA 3DRSA 4R5PA 4BDPA 1U47A 1VSLA 4Y1DA 3SPZA 1NK8A 3HPGA 3SQ4A 4B8AB 4CFAA 3ZT1A 5I3UA 3TWHA 1X1PA 4O0IA 1QSYA 3RWUA 3LWLA 1YT3A 3DLRA 3V1RA 1JKHA 3OYCA 3U6FA 4DQSA 3V4IA 4CGJA 1L5UA 2EHGA 4FM1A 5J2PA 1VSJA 2EX3A 5FDLA 3CM5A 3NFAA 4E19A 3K57A 2DY4A 4I7FA 3V1OA 1Z25A 3H08A 1EX4A 2YNGA 4ID5A 3ZSXA 1HRHA 3OYMA 3HL8A 4OKJA 3AA3A 4QAGA 3ZT4A 4CJTA 3CYMA 2FBYA 3VN5A 4CJQA 2QK9A 4CFDA 3HM9A 2D0AA 3IS9A 4E7LA 3HPOA 1D8YA 1XHXA 3OYBA 2HNDA 1ZBUA 4C8LA 1L3TA 3HO1A 2PZSA 3A2FA 3AVBA 3VQ6A 1KLNA 3VQ4A 3RMAA 2KFZA 4NYFA 3B6OA 4FK2A 3O3HA 3CG7A 4KV8A 4E7HA 3AA4A 3AVHA 1HJRA 1BHLA 2QXFA 4ZTJA 3MXIA 1NK0A 3PO4A 2ZQBA 4I2PA 4F3TA 2PY5A 4IKFA 2W42A 3NF7A 4FJIA 4AHCA 1N5YA 3DYAA 3PX0A 1FKOA 1LW2A 1B9DA 3HP9A 1RT4A 5HP1A 3HPHA 4BDZA 4B9MA 4CECA 2HHSA 4GMJB 4WE1A 3LP0A 1VSDA 2ZE2A 4IFYA 4CK2A 3SZ2A 4DS5A 3WNEA 4GVMA 1SL2A 1HMVA 3ZSWA 3AV9A 4JRQA 1ZBLA 3T1AA 1IKXA 4CIEA 1WAFA 4KHYA 1J53A 1RILA 4CF2A 1CXQA 4CGHA 4HUGA 4DFMA 3DOLA 1C0UA 1X9WA 2E6LA 1HYZA 2X6NA 1XC9A 5K14A 1L3UA 4W5TA 1TV6A 2KQ2A 1BIUA 1YVUA 3SUOA 2XY8A 1REVA 1Y97A 1SL0A 4CE9A 3LAMA 3PY8A 2BDPA 1JLAA 2IDOA 4F2SA 2X78A 4DF8A 1U48A 3KLFA 3V6DA 1VSIA 4NCGA 4FLZA 4L8RB 4CJ5A 2G8KA 1SUQA 1X9SA 4KO0A 1S6QA 3WNHA 3RR8A 2HHWA 2XO7A 4BWJA 2GV9A 1JLQA 3BGRA 1BGXT 3O3GA 1CZBA 1WSFA 3S3NA 3DOKA 4HTUA 4CIGA 1T8EA 2JGUA 1NOZA 3L2WA 4DTUA 4DSLA 4DLEA 2KTQA 2FC0A 4CJRA 1TAUA 1C0MA 2Y1JA 1LWCA 4H4OA 5HRNA 3KJVA 4DF4A 4DFPA 4W5NA 2ITGA 3DRPA 4OGEA 4ZHRA 1RT5A 1EETA 2KZMA 4FXDA 3NGIA 5KI6A 2HHVA 4DQIA 3AO5A 1TKDA 4DSFA 2VWKA 4B08A 4XIUA 1JLEA 2Y1IA 4H4MA 5CZ1A 5J2MA 4CJLA 4Z4FA 4CHPA 3F9KA 3OYLA 3LDSA 4ID1A 4KREA 2DFFA 4B9UA 2Z1GA 3TAMA 2HMIA 2DFHA 1ZYQA 4E0DA 3ITHA 1IKVA 1KVCA 1NJZA 1RT6A 3SUNA 4KB0A 4FJMA 2HVHA 4QOZB 3U3YA 4CHYA 2B6AA 4EZ9A 3G10A 1NKBA 3C6TA 4FVMA 4IBNA 1RBVA 5HRRA 4FM0A 1LWFA 4CGFA 1K6YA 1BISA 3OJSA 1HQEA 4FLTA 2P5GA 1KVAA 2Z1HA 4FLWA 4K8XA 2OPQA 1BCOA 4BWMA 1NJYA 1RT3A 4CHQA 5KRTA 4FK0A 3OYEA 1U4BA 3K2PA 4AHVA 4LSNA 2FBXA 1O1WA 3AA2A 3AVJA 4YFUA 5JS1A 4LD0A 5J1EA 1A5XA 1HYSA 3KLHA 3LPTA 1U49A 4J2AA 1S1XA 4GW6A 3DLHA 3BDPA 4E7IA 3OS0A 1NK5A 1Q9YA 3DRRA 4G1QA 3S9HA 4B3OA 2D0BA 2B5JA 1U04A 4KRFA 3OVNA 4HUEA 4FZZA 1IO2A 1WSIA 4MFBA 3NF6A 2HVIA 1J9AA 1IH7A 1JLCA 4E3SA 3SQ0A 1C1BA 4DTJA 1TVRA 3DLEA 3KK1A 3AO3A 3I0RA 3VQ9A 4E7JA 4LH4A 3DM2A 4CEQA 1VSKA 4J2BA 3QERA 3QINA 1QS4A 5KGXA 1JXBA 3RR7A 4DSIA 1HNVA 4HVJA 4FLXA 3T19A 2NUBA 4KAZA 4IDKA 4CJSA 1DTTA 3QEIA 4CF0A 1BI4A 4NCAA 5HRSA 4DU1A 4CHNA 1N6QA 4KI4A 4N56A 1J54A 4KTWA 3L2UA 1KVBA 4I2QA 3IRXA 4RW4A 3SUQA 4N47A 4M3ZA 2OPSA 3HVRA 1YTUA 2QKBA 3NGYA 1SL1A 1CLQA 1FXXA 1WNSA 3RRHA 1S9GA 2XY7A 3RMBA 4CESA 3DLGA 3NAEA 4CEZA 3NBPA 2XY6A 1UA0A 4N76A 4PA1A 3KD5E 2OPRA 3O4NA 2VG7A 1SKRA 2HHXA 1JXEA 4O4GA 4ZTFA 4J2EA 4CGGA 1EKEA 2HHUA 1JLGA 1SKWA 3V1QA 4M3TA 4B9NA 1TK0A 4BACA 2HNYA 3AVGA 3SPYA 5HROA 1LAVA 4C8OA 1WSGA 4DSEA 1SKSA 1TAQA 4CCHA 4DU4A 1BIZA 2G8FA 4FJHA 5JS2A 4M3RA 1B92A 3QETA 1ZBIA 4CHOA 4F2RA 4CEAA 3ZCMA 4H8KA 4E1NA 1TK5A 1RTJA 3OYFA 3K59A 4FLVA 4DS4A 3K5LA 3CFRA 4BE1A 4FJGA 2KW4A 4UQGA 1WSHA 1WSEA 1RTHA 2IAJA 3M8QA 1KLMA 4RW9A 3QEWA 1KRPA 4KTQA 4Q5VA 2G8HA 3T3FA 3CFOA 3D0PA 1KFSA 1DLOA 5C25A 1S1TA 3QNNA 5EU7A 1J5OA 5D3GA 3LP3A 1KSPA 5C24A 3PV8A 2F96A 4JRPA 3AVMA 3NGZA 4M3WA 1EXQA 1Z26A 4Z4GA 1ZBFA 4E1MA 1A5WA 1BL3A 5FROA 1QE1A 2YNFA 1VSFA 3RTVA 1NJXA 3KTQA 2G8VA 2AJQA 2ETJA 4O5BA 4DQPA 2YHAA 5C42A 1L3VA 4OKKA 4CIFA 3QO9A 1I39A 1JL1A 3KLEA 3DMJA 3K58A 1UA1A 3QEVA 3TAPA 5CZ2A 3TAQA 3QIPA 1RNHA 4B9VA 4F8RA 1I3AA 2OYQA 4DLGA 4FLUA 4LSLA 3U3GA 1ASWA 2E6MA 4AHTA 4EP4A 3SQ1A 3SJJA 3ZT0A 3AO2A 4OKEA 2OA8A 4O0JA 4CGIA 4Z4EA 2LSNA 3TABA 3C95A 3VQ8A 4I9LA 4CFBA 3P5JA 1D9FA 1TL1A 5CYMA 5KGWA 1A5VA 4OPKA 3OYAA 2VG5A 1R0AA 2A1SA 4AHUA 1BI4B 2Q3SA 3EYZA 1IG9A 2O4IA 1GOCA 4CJFA 1JLFA 1VSEA 2RPIA 3LP2A 3WNFA 3OYNA 3OYGA 1FK9A 2YNHA 4RW8A 3THVA 4M42A 4DG1A 3MEGA 3P1GA 4W5OA 1RDBA 4RG8A 1TK8A 3PX6A 3ZSRA 1WLJA 1C6VA 1QSLA 4FW2A 3QLHA 1S9EA 4B9LA 4KHSA 1XHZA 2YHBA 1RBSA 3MEEA 4CEEA 4DFKA 2D0CA 1WN7A 1YTAA 4DTOA 1DTQA 1JLBA 2ATQA 1S1WA 4F3OA 4M3XA 3V9XA 2HB5A 2KZZA 2XY5A 4C8KA 3LZIA 1HYVA 2G8IA 1GOBA 2G8UA 2OZMA 1RBRA 1RT1A 1NK7A 1S1UA 4DSKA 2DFEA 4FJXA 1WAJA 3D45A 4CFCA 4KFBA 3V9UA 1L3SA 4LH5A 3LPUA 3V9SA 3TI0A 4CJVA 3LWMA 4DWIA 3UIQA 3S3OA 1RDCA 1HNIA 3VQAA 3L2VA 2HHTA 4CJKA 3ZT2A 3SYZA 1TGOA 1UAXA 3HVTA 4BE2A 5SWMA 1LV5A 1RT2A 3LAKA 3MXMA 2IC3A 2PYJA 1NOYA 2Z1JA 4AHSA 4BE0A 3MXJA 4PQUA 4KI6A 4Z4IA 5HRPA 1U45A 3L3VA 3JYTA 3HK2A 4CJEA 3WNGA 2ZD1A 1VRUA 4OJRA 3MEDA 4BDYA 3QEPA 1RDDA 4KB1A 4AH9A 1JL2A 1S5JA 1VSMA 3M8PA 3O4QA 3E01A 1UOCA 4LY7A 1RTIA 3TAGA 1LW0A 1NKCA 4J2DA 2E4LA 4CHZA 3NHGA 4E7KA 1VSHA 4HHTA 4IFVA 4FJNA 1F21A 4FJLA 1WSJA 3HT3A 4FJ9A 3ZSVA 3NH0A 1RDAA 4OPJA 3HJFA 3VQPA 3VQCA 3V81A 2QKKA 3C94A 1SV5A 3G0ZA 3RRGA 4Y1CA 3OYKA 3VQ5A 4DTPA 3ZSYA 4DU3A 3LALA 3KKRA 4CJUA 1IKYA 2YV0X 1HQUA 4HCBA 3K5MA 3DLBA 1TKTA 1XI1A 1TL3A 4EP5A 2D5RA 5DMRA 3V9ZA 3SUPA 2HHQA 3OYIA 2BGGA 3L2QA 3AVAA 1QQCA 4JS5A 1NJWA 3ZSOA 4PUOA 3SCXA 2GBZA 5HBMA 4FZXC 3M8RA 4QCLA 4DQRA 1RCHA 3M8SA 1B9FA 1C1CA 1CXUA 3AO1A 4CJPA 4CEOA 4Z4HA 4CK3A 3HP6A 5J2NA 4DTSA 3HYFA 3MAQA 3PO5A 5J2QA 4KHQA 3IG1A 4DFJA 3EZ5A 3I8DA 1HPZA 3OY9A 4JLHA 4ELVA 4IG3A 1C0TA 1BQNA 2O4GA 3ALYA 4CGDA 3CQ8A 3TAFA 1Q9XA 2KFNA 5FRMA 1S1VA 3KKSA 4FM2A 3AVFA 1X9MA 4ELTA 2P1JA 1NK6A 4FJ5A 4ICLA 4CF9A 5KRSA 4CEDA 1MU2A 1ZBHA 4PWDA 2WONA 4O55A 2YKNA 3ZT3A 1W0HA 4YNQA 4CF8A 1CZ9A 4DTNA 3QESA 2PYLA 2YNIA 4C8MA 3SV3A 1G15A 1VRTA 4M45A 1D9DA 3KLIA 4O44A 1GOAA 4TSXA 3HXMA 4KHNA 4OLBA 2WOMA 4HUFA 3LZJA 3TAEA 2A1RA 4FYDA 3VQQA 2X74A 1LAWA 4DMNA 4DTXA 3QNOA 2BANA 3NH2A 4K8ZA 1VK0A 3SNNA 3KIOA 5T7BA 4OVLA 4EZ6A 3CM6A 2HNZA 3ASMA 5HLFA 3RMCA 2RKIA 1NK9A 4F4KA 1ASUA 3AVIA 3DI6A 4KHWA 1ITGA 2FBVA 4N5SA 3QIOA 4W5RA 1KCFA 5I42A 1RT7A 4CJ4A 2BE2A 4FJJA 3TR8A 1UWBA 4CJWA 1D5AA 3VQ7A 3B6PA 1KFDA 4AHRA 5KTQA 3L8BA 3AVCA 2VWJA 3AVNA 2Z1IA 4Z0UA 2RN2A 1RBUA 1T05A 1QSSA 3IAYA 3NF8A 2P5OA 1KTQA 4M3UA 4CERA 1NKEA 2DTUA 1RTDA 3NDKA 4CK1A 3OYJA 4MQ3A 3EY1A 1T7PA 4DQQA 4JS4A 3TARA 4I9QA 3S3MA 3O3FA 4OGCA 4AILC 3ULDA 2VG6A 3AA5X 3P83D 3CFPA 2OZSA 3AO4A 3L2RA 3FFIA 4CEFA 3C6UA 3ISNC 3QEXA 2P51A 1RBTA 4HCCA 3AVLA 1ASVA 3VQEA 4DSJA 4B9SA 4Z4CA 1Q8IA 4Q0BA 1EP4A 2RF2A 5CY4A 4NYNA 3TANA 4CEBA 3SQ2A 4FCYA 3RMDA 1NK4A 4B9TA 3L3UA 4C8NA 3KK3A 4W5QA 4FW1A 4DTRA 1BCMA 1S6PA 2FBTA 3VQBA 3ZSZA 4FLYA 3K5OA 4N41A 3I0SA 4OLAA 4CF1A 3NH1A 3KLGA 3MECA 2I5JA 3K5NA 4IG0A 3VA0A 2XHBA 1BQMA 4FZYA 2F8SA 2B4JA 3OJUA 3V9WA 3JSMA 4M41A 3NCIA 3F73A 4M3YA 1XWLA 4PY5A 2IOCA 3LANA 3SV4A 2GUIA 1IKWA 4FK4A 4KHUA 3VQDA 4CJ3A 3HSTB 1QTMA 2IS3A 3PUFA 4KTZA 3AVKA 4KPYA 5E41A 5FRNA 5CYQA 2F8TA 2JLEA 2X6SA 3KK2A 2IGIA 1T03A 3DLKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HW3 A;  4E89 A;  3VA3 A;  5SZT A;  1TKZ A;  4B8C A;  3OYD A;  2XRI A;  1TKX A;  4ELU A;  3ZSQ A;  4RW7 A;  4NCB A;  1LWE A;  3OS1 A;  3NF9 A;  4KKO A;  1QHT A;  3OYH A;  3OS2 A;  2YKM A;  1C1A A;  1FKP A;  2OPP A;  4FJK A;  5DK5 A;  3SI6 A;  4FJ7 A;  4FJ8 A;  3PX4 A;  3KD1 E;  4RW6 A;  2R7Y A;  3LP1 A;  3NE6 A;  4DTM A;  1W9H A;  2G8W A;  3DRS A;  4R5P A;  4BDP A;  1U47 A;  1VSL A;  4Y1D A;  3SPZ A;  1NK8 A;  3HPG A;  3SQ4 A;  4B8A B;  4CFA A;  3ZT1 A;  5I3U A;  3TWH A;  1X1P A;  4O0I A;  1QSY A;  3RWU A;  3LWL A;  1YT3 A;  3DLR A;  3V1R A;  1JKH A;  3OYC A;  3U6F A;  4DQS A;  3V4I A;  4CGJ A;  1L5U A;  2EHG A;  4FM1 A;  5J2P A;  1VSJ A;  2EX3 A;  5FDL A;  3CM5 A;  3NFA A;  4E19 A;  3K57 A;  2DY4 A;  4I7F A;  3V1O A;  1Z25 A;  3H08 A;  1EX4 A;  2YNG A;  4ID5 A;  3ZSX A;  1HRH A;  3OYM A;  3HL8 A;  4OKJ A;  3AA3 A;  4QAG A;  3ZT4 A;  4CJT A;  3CYM A;  2FBY A;  3VN5 A;  4CJQ A;  2QK9 A;  4CFD A;  3HM9 A;  2D0A A;  3IS9 A;  4E7L A;  3HPO A;  1D8Y A;  1XHX A;  3OYB A;  2HND A;  1ZBU A;  4C8L A;  1L3T A;  3HO1 A;  2PZS A;  3A2F A;  3AVB A;  3VQ6 A;  1KLN A;  3VQ4 A;  3RMA A;  2KFZ A;  4NYF A;  3B6O A;  4FK2 A;  3O3H A;  3CG7 A;  4KV8 A;  4E7H A;  3AA4 A;  3AVH A;  1HJR A;  1BHL A;  2QXF A;  4ZTJ A;  3MXI A;  1NK0 A;  3PO4 A;  2ZQB A;  4I2P A;  4F3T A;  2PY5 A;  4IKF A;  2W42 A;  3NF7 A;  4FJI A;  4AHC A;  1N5Y A;  3DYA A;  3PX0 A;  1FKO A;  1LW2 A;  1B9D A;  3HP9 A;  1RT4 A;  5HP1 A;  3HPH A;  4BDZ A;  4B9M A;  4CEC A;  2HHS A;  4GMJ B;  4WE1 A;  3LP0 A;  1VSD A;  2ZE2 A;  4IFY A;  4CK2 A;  3SZ2 A;  4DS5 A;  3WNE A;  4GVM A;  1SL2 A;  1HMV A;  3ZSW A;  3AV9 A;  4JRQ A;  1ZBL A;  3T1A A;  1IKX A;  4CIE A;  1WAF A;  4KHY A;  1J53 A;  1RIL A;  4CF2 A;  1CXQ A;  4CGH A;  4HUG A;  4DFM A;  3DOL A;  1C0U A;  1X9W A;  2E6L A;  1HYZ A;  2X6N A;  1XC9 A;  5K14 A;  1L3U A;  4W5T A;  1TV6 A;  2KQ2 A;  1BIU A;  1YVU A;  3SUO A;  2XY8 A;  1REV A;  1Y97 A;  1SL0 A;  4CE9 A;  3LAM A;  3PY8 A;  2BDP A;  1JLA A;  2IDO A;  4F2S A;  2X78 A;  4DF8 A;  1U48 A;  3KLF A;  3V6D A;  1VSI A;  4NCG A;  4FLZ A;  4L8R B;  4CJ5 A;  2G8K A;  1SUQ A;  1X9S A;  4KO0 A;  1S6Q A;  3WNH A;  3RR8 A;  2HHW A;  2XO7 A;  4BWJ A;  2GV9 A;  1JLQ A;  3BGR A;  1BGX T;  3O3G A;  1CZB A;  1WSF A;  3S3N A;  3DOK A;  4HTU A;  4CIG A;  1T8E A;  2JGU A;  1NOZ A;  3L2W A;  4DTU A;  4DSL A;  4DLE A;  2KTQ A;  2FC0 A;  4CJR A;  1TAU A;  1C0M A;  2Y1J A;  1LWC A;  4H4O A;  5HRN A;  3KJV A;  4DF4 A;  4DFP A;  4W5N A;  2ITG A;  3DRP A;  4OGE A;  4ZHR A;  1RT5 A;  1EET A;  2KZM A;  4FXD A;  3NGI A;  5KI6 A;  2HHV A;  4DQI A;  3AO5 A;  1TKD A;  4DSF A;  2VWK A;  4B08 A;  4XIU A;  1JLE A;  2Y1I A;  4H4M A;  5CZ1 A;  5J2M A;  4CJL A;  4Z4F A;  4CHP A;  3F9K A;  3OYL A;  3LDS A;  4ID1 A;  4KRE A;  2DFF A;  4B9U A;  2Z1G A;  3TAM A;  2HMI A;  2DFH A;  1ZYQ A;  4E0D A;  3ITH A;  1IKV A;  1KVC A;  1NJZ A;  1RT6 A;  3SUN A;  4KB0 A;  4FJM A;  2HVH A;  4QOZ B;  3U3Y A;  4CHY A;  2B6A A;  4EZ9 A;  3G10 A;  1NKB A;  3C6T A;  4FVM A;  4IBN A;  1RBV A;  5HRR A;  4FM0 A;  1LWF A;  4CGF A;  1K6Y A;  1BIS A;  3OJS A;  1HQE A;  4FLT A;  2P5G A;  1KVA A;  2Z1H A;  4FLW A;  4K8X A;  2OPQ A;  1BCO A;  4BWM A;  1NJY A;  1RT3 A;  4CHQ A;  5KRT A;  4FK0 A;  3OYE A;  1U4B A;  3K2P A;  4AHV A;  4LSN A;  2FBX A;  1O1W A;  3AA2 A;  3AVJ A;  4YFU A;  5JS1 A;  4LD0 A;  5J1E A;  1A5X A;  1HYS A;  3KLH A;  3LPT A;  1U49 A;  4J2A A;  1S1X A;  4GW6 A;  3DLH A;  3BDP A;  4E7I A;  3OS0 A;  1NK5 A;  1Q9Y A;  3DRR A;  4G1Q A;  3S9H A;  4B3O A;  2D0B A;  2B5J A;  1U04 A;  4KRF A;  3OVN A;  4HUE A;  4FZZ A;  1IO2 A;  1WSI A;  4MFB A;  3NF6 A;  2HVI A;  1J9A A;  1IH7 A;  1JLC A;  4E3S A;  3SQ0 A;  1C1B A;  4DTJ A;  1TVR A;  3DLE A;  3KK1 A;  3AO3 A;  3I0R A;  3VQ9 A;  4E7J A;  4LH4 A;  3DM2 A;  4CEQ A;  1VSK A;  4J2B A;  3QER A;  3QIN A;  1QS4 A;  5KGX A;  1JXB A;  3RR7 A;  4DSI A;  1HNV A;  4HVJ A;  4FLX A;  3T19 A;  2NUB A;  4KAZ A;  4IDK A;  4CJS A;  1DTT A;  3QEI A;  4CF0 A;  1BI4 A;  4NCA A;  5HRS A;  4DU1 A;  4CHN A;  1N6Q A;  4KI4 A;  4N56 A;  1J54 A;  4KTW A;  3L2U A;  1KVB A;  4I2Q A;  3IRX A;  4RW4 A;  3SUQ A;  4N47 A;  4M3Z A;  2OPS A;  3HVR A;  1YTU A;  2QKB A;  3NGY A;  1SL1 A;  1CLQ A;  1FXX A;  1WNS A;  3RRH A;  1S9G A;  2XY7 A;  3RMB A;  4CES A;  3DLG A;  3NAE A;  4CEZ A;  3NBP A;  2XY6 A;  1UA0 A;  4N76 A;  4PA1 A;  3KD5 E;  2OPR A;  3O4N A;  2VG7 A;  1SKR A;  2HHX A;  1JXE A;  4O4G A;  4ZTF A;  4J2E A;  4CGG A;  1EKE A;  2HHU A;  1JLG A;  1SKW A;  3V1Q A;  4M3T A;  4B9N A;  1TK0 A;  4BAC A;  2HNY A;  3AVG A;  3SPY A;  5HRO A;  1LAV A;  4C8O A;  1WSG A;  4DSE A;  1SKS A;  1TAQ A;  4CCH A;  4DU4 A;  1BIZ A;  2G8F A;  4FJH A;  5JS2 A;  4M3R A;  1B92 A;  3QET A;  1ZBI A;  4CHO A;  4F2R A;  4CEA A;  3ZCM A;  4H8K A;  4E1N A;  1TK5 A;  1RTJ A;  3OYF A;  3K59 A;  4FLV A;  4DS4 A;  3K5L A;  3CFR A;  4BE1 A;  4FJG A;  2KW4 A;  4UQG A;  1WSH A;  1WSE A;  1RTH A;  2IAJ A;  3M8Q A;  1KLM A;  4RW9 A;  3QEW A;  1KRP A;  4KTQ A;  4Q5V A;  2G8H A;  3T3F A;  3CFO A;  3D0P A;  1KFS A;  1DLO A;  5C25 A;  1S1T A;  3QNN A;  5EU7 A;  1J5O A;  5D3G A;  3LP3 A;  1KSP A;  5C24 A;  3PV8 A;  2F96 A;  4JRP A;  3AVM A;  3NGZ A;  4M3W A;  1EXQ A;  1Z26 A;  4Z4G A;  1ZBF A;  4E1M A;  1A5W A;  1BL3 A;  5FRO A;  1QE1 A;  2YNF A;  1VSF A;  3RTV A;  1NJX A;  3KTQ A;  2G8V A;  2AJQ A;  2ETJ A;  4O5B A;  4DQP A;  2YHA A;  5C42 A;  1L3V A;  4OKK A;  4CIF A;  3QO9 A;  1I39 A;  1JL1 A;  3KLE A;  3DMJ A;  3K58 A;  1UA1 A;  3QEV A;  3TAP A;  5CZ2 A;  3TAQ A;  3QIP A;  1RNH A;  4B9V A;  4F8R A;  1I3A A;  2OYQ A;  4DLG A;  4FLU A;  4LSL A;  3U3G A;  1ASW A;  2E6M A;  4AHT A;  4EP4 A;  3SQ1 A;  3SJJ A;  3ZT0 A;  3AO2 A;  4OKE A;  2OA8 A;  4O0J A;  4CGI A;  4Z4E A;  2LSN A;  3TAB A;  3C95 A;  3VQ8 A;  4I9L A;  4CFB A;  3P5J A;  1D9F A;  1TL1 A;  5CYM A;  5KGW A;  1A5V A;  4OPK A;  3OYA A;  2VG5 A;  1R0A A;  2A1S A;  4AHU A;  1BI4 B;  2Q3S A;  3EYZ A;  1IG9 A;  2O4I A;  1GOC A;  4CJF A;  1JLF A;  1VSE A;  2RPI A;  3LP2 A;  3WNF A;  3OYN A;  3OYG A;  1FK9 A;  2YNH A;  4RW8 A;  3THV A;  4M42 A;  4DG1 A;  3MEG A;  3P1G A;  4W5O A;  1RDB A;  4RG8 A;  1TK8 A;  3PX6 A;  3ZSR A;  1WLJ A;  1C6V A;  1QSL A;  4FW2 A;  3QLH A;  1S9E A;  4B9L A;  4KHS A;  1XHZ A;  2YHB A;  1RBS A;  3MEE A;  4CEE A;  4DFK A;  2D0C A;  1WN7 A;  1YTA A;  4DTO A;  1DTQ A;  1JLB A;  2ATQ A;  1S1W A;  4F3O A;  4M3X A;  3V9X A;  2HB5 A;  2KZZ A;  2XY5 A;  4C8K A;  3LZI A;  1HYV A;  2G8I A;  1GOB A;  2G8U A;  2OZM A;  1RBR A;  1RT1 A;  1NK7 A;  1S1U A;  4DSK A;  2DFE A;  4FJX A;  1WAJ A;  3D45 A;  4CFC A;  4KFB A;  3V9U A;  1L3S A;  4LH5 A;  3LPU A;  3V9S A;  3TI0 A;  4CJV A;  3LWM A;  4DWI A;  3UIQ A;  3S3O A;  1RDC A;  1HNI A;  3VQA A;  3L2V A;  2HHT A;  4CJK A;  3ZT2 A;  3SYZ A;  1TGO A;  1UAX A;  3HVT A;  4BE2 A;  5SWM A;  1LV5 A;  1RT2 A;  3LAK A;  3MXM A;  2IC3 A;  2PYJ A;  1NOY A;  2Z1J A;  4AHS A;  4BE0 A;  3MXJ A;  4PQU A;  4KI6 A;  4Z4I A;  5HRP A;  1U45 A;  3L3V A;  3JYT A;  3HK2 A;  4CJE A;  3WNG A;  2ZD1 A;  1VRU A;  4OJR A;  3MED A;  4BDY A;  3QEP A;  1RDD A;  4KB1 A;  4AH9 A;  1JL2 A;  1S5J A;  1VSM A;  3M8P A;  3O4Q A;  3E01 A;  1UOC A;  4LY7 A;  1RTI A;  3TAG A;  1LW0 A;  1NKC A;  4J2D A;  2E4L A;  4CHZ A;  3NHG A;  4E7K A;  1VSH A;  4HHT A;  4IFV A;  4FJN A;  1F21 A;  4FJL A;  1WSJ A;  3HT3 A;  4FJ9 A;  3ZSV A;  3NH0 A;  1RDA A;  4OPJ A;  3HJF A;  3VQP A;  3VQC A;  3V81 A;  2QKK A;  3C94 A;  1SV5 A;  3G0Z A;  3RRG A;  4Y1C A;  3OYK A;  3VQ5 A;  4DTP A;  3ZSY A;  4DU3 A;  3LAL A;  3KKR A;  4CJU A;  1IKY A;  2YV0 X;  1HQU A;  4HCB A;  3K5M A;  3DLB A;  1TKT A;  1XI1 A;  1TL3 A;  4EP5 A;  2D5R A;  5DMR A;  3V9Z A;  3SUP A;  2HHQ A;  3OYI A;  2BGG A;  3L2Q A;  3AVA A;  1QQC A;  4JS5 A;  1NJW A;  3ZSO A;  4PUO A;  3SCX A;  2GBZ A;  5HBM A;  4FZX C;  3M8R A;  4QCL A;  4DQR A;  1RCH A;  3M8S A;  1B9F A;  1C1C A;  1CXU A;  3AO1 A;  4CJP A;  4CEO A;  4Z4H A;  4CK3 A;  3HP6 A;  5J2N A;  4DTS A;  3HYF A;  3MAQ A;  3PO5 A;  5J2Q A;  4KHQ A;  3IG1 A;  4DFJ A;  3EZ5 A;  3I8D A;  1HPZ A;  3OY9 A;  4JLH A;  4ELV A;  4IG3 A;  1C0T A;  1BQN A;  2O4G A;  3ALY A;  4CGD A;  3CQ8 A;  3TAF A;  1Q9X A;  2KFN A;  5FRM A;  1S1V A;  3KKS A;  4FM2 A;  3AVF A;  1X9M A;  4ELT A;  2P1J A;  1NK6 A;  4FJ5 A;  4ICL A;  4CF9 A;  5KRS A;  4CED A;  1MU2 A;  1ZBH A;  4PWD A;  2WON A;  4O55 A;  2YKN A;  3ZT3 A;  1W0H A;  4YNQ A;  4CF8 A;  1CZ9 A;  4DTN A;  3QES A;  2PYL A;  2YNI A;  4C8M A;  3SV3 A;  1G15 A;  1VRT A;  4M45 A;  1D9D A;  3KLI A;  4O44 A;  1GOA A;  4TSX A;  3HXM A;  4KHN A;  4OLB A;  2WOM A;  4HUF A;  3LZJ A;  3TAE A;  2A1R A;  4FYD A;  3VQQ A;  2X74 A;  1LAW A;  4DMN A;  4DTX A;  3QNO A;  2BAN A;  3NH2 A;  4K8Z A;  1VK0 A;  3SNN A;  3KIO A;  5T7B A;  4OVL A;  4EZ6 A;  3CM6 A;  2HNZ A;  3ASM A;  5HLF A;  3RMC A;  2RKI A;  1NK9 A;  4F4K A;  1ASU A;  3AVI A;  3DI6 A;  4KHW A;  1ITG A;  2FBV A;  4N5S A;  3QIO A;  4W5R A;  1KCF A;  5I42 A;  1RT7 A;  4CJ4 A;  2BE2 A;  4FJJ A;  3TR8 A;  1UWB A;  4CJW A;  1D5A A;  3VQ7 A;  3B6P A;  1KFD A;  4AHR A;  5KTQ A;  3L8B A;  3AVC A;  2VWJ A;  3AVN A;  2Z1I A;  4Z0U A;  2RN2 A;  1RBU A;  1T05 A;  1QSS A;  3IAY A;  3NF8 A;  2P5O A;  1KTQ A;  4M3U A;  4CER A;  1NKE A;  2DTU A;  1RTD A;  3NDK A;  4CK1 A;  3OYJ A;  4MQ3 A;  3EY1 A;  1T7P A;  4DQQ A;  4JS4 A;  3TAR A;  4I9Q A;  3S3M A;  3O3F A;  4OGC A;  4AIL C;  3ULD A;  2VG6 A;  3AA5 X;  3P83 D;  3CFP A;  2OZS A;  3AO4 A;  3L2R A;  3FFI A;  4CEF A;  3C6U A;  3ISN C;  3QEX A;  2P51 A;  1RBT A;  4HCC A;  3AVL A;  1ASV A;  3VQE A;  4DSJ A;  4B9S A;  4Z4C A;  1Q8I A;  4Q0B A;  1EP4 A;  2RF2 A;  5CY4 A;  4NYN A;  3TAN A;  4CEB A;  3SQ2 A;  4FCY A;  3RMD A;  1NK4 A;  4B9T A;  3L3U A;  4C8N A;  3KK3 A;  4W5Q A;  4FW1 A;  4DTR A;  1BCM A;  1S6P A;  2FBT A;  3VQB A;  3ZSZ A;  4FLY A;  3K5O A;  4N41 A;  3I0S A;  4OLA A;  4CF1 A;  3NH1 A;  3KLG A;  3MEC A;  2I5J A;  3K5N A;  4IG0 A;  3VA0 A;  2XHB A;  1BQM A;  4FZY A;  2F8S A;  2B4J A;  3OJU A;  3V9W A;  3JSM A;  4M41 A;  3NCI A;  3F73 A;  4M3Y A;  1XWL A;  4PY5 A;  2IOC A;  3LAN A;  3SV4 A;  2GUI A;  1IKW A;  4FK4 A;  4KHU A;  3VQD A;  4CJ3 A;  3HST B;  1QTM A;  2IS3 A;  3PUF A;  4KTZ A;  3AVK A;  4KPY A;  5E41 A;  5FRN A;  5CYQ A;  2F8T A;  2JLE A;  2X6S A;  3KK2 A;  2IGI A;  1T03 A;  3DLK A; 
#chains in the Genus database with same CATH topology
 3QIC A;  4LFB K;  4U67 L;  3OYD A;  1TKX A;  4RW7 A;  3ENB A;  1LWE A;  3NF9 A;  4FWO A;  4FJK A;  1QQM A;  4DTM A;  3VEV A;  4BDP A;  1U47 A;  4CD1 A;  1VSL A;  1NK8 A;  3THY A;  1VQN N;  4B8A B;  3ZT1 A;  4XH4 A;  3TWH A;  1X1P A;  4O0I A;  3RWU A;  4JHD A;  2VQF K;  1JKH A;  5AQH A;  2CGL A;  3U9D A;  1VSJ A;  2EX3 A;  3MN9 A;  4H03 B;  2ITM A;  4HTL A;  5FDL A;  3K57 A;  2HBK A;  4B1V A;  3H08 A;  3OBW A;  3ZSX A;  1QVF M;  3CQY A;  2FBY A;  4K0K K;  3FFK B;  3ZEU A;  1LOT B;  1MWM A;  3CIP A;  1ZBU A;  4CBW A;  3A5N C;  5CR4 A;  3HO1 A;  3AVB A;  2BUP A;  4BC4 A;  3O1W A;  4BRK A;  2P9P A;  1H1V A;  5AQF A;  4E7H A;  3AVH A;  3VMF B;  1HJR A;  3LDN A;  2CGK A;  4MDA A;  2ZQB A;  3KZB A;  4I2P A;  4CZL A;  4F3T A;  2E2Q A;  4AM6 A;  4X64 K;  1LW2 A;  5LJV A;  3HP9 A;  4B9M A;  1TUY A;  4WE1 A;  1HMV A;  1VQ6 N;  3BF1 A;  3AV9 A;  4JRQ A;  1ZBL A;  4DR3 K;  1NGI A;  1CXQ A;  4HUG A;  3NMU A;  1X9W A;  2E6L A;  4XEI A;  1BIU A;  3J81 O;  2XY8 A;  1SL0 A;  3LAM A;  1JLA A;  4DF8 A;  2O8C B;  3KLF A;  4NCG A;  1W97 L;  2GV9 A;  3O3G A;  1CZB A;  2F4V K;  4CIG A;  3ATV A;  1T8E A;  1NOZ A;  4DTU A;  1W2B M;  4DSL A;  4DLE A;  2FC0 A;  1LWC A;  3H3N O;  3C0B A;  3KJV A;  4DF4 A;  5LMU K;  2ITG A;  3DRP A;  3D2F A;  5KI6 A;  4B08 A;  2F9T A;  5AQZ A;  2O8E A;  3W3D A;  4Z4F A;  3VEN A;  2V52 B;  3TAM A;  4WQ5 A;  2HVH A;  1Q82 O;  4CHY A;  3K9J A;  5HRR A;  4B1U B;  1LWF A;  4DHY A;  4XH1 A;  4FLW A;  2P9N B;  4YHH K;  3L4I A;  1U4B A;  2P9S B;  2FBX A;  4LSN A;  4YFU A;  5J1E A;  1A5X A;  3KLH A;  1S22 A;  5H1S Q;  4GW6 A;  5LJW A;  3BDP A;  4B3O A;  4G1Q A;  4LF8 K;  2D0B A;  4FWS A;  3P39 A;  4HUE A;  1W7A A;  4MFB A;  1VQ8 N;  3TTC A;  4E3S A;  3SQ0 A;  1TUU A;  2E5L K;  1TVR A;  1EO1 A;  3DLE A;  3THX A;  3O1B A;  3VQ9 A;  1GLL O;  4LF9 K;  4DSI A;  1HNV A;  4FLX A;  1E4G T;  4IZ9 A;  2NUB A;  3T19 A;  4LF6 K;  4CF0 A;  2OTJ N;  1N6Q A;  1J54 A;  4UY8 O;  4M3Z A;  3IRX A;  5TKW A;  3HVR A;  4PHT X;  3THW A;  1SL1 A;  2EWS A;  1QQN A;  1FXX A;  2XY7 A;  1S9G A;  4K43 A;  4BG9 A;  4BR2 A;  3RMB A;  4CES A;  1GLE G;  2NRR A;  3U4L A;  3O4N A;  4ZTF A;  1JLG A;  1N8R O;  1Z05 A;  3AVG A;  5HRO A;  4BGA A;  4C8O A;  1WSG A;  1TAQ A;  4NLC A;  1WBB A;  2KHO A;  4F2R A;  3ZCM A;  4H8K A;  4E1N A;  3PIP L;  2JWL A;  1NMD A;  3K59 A;  2FSN A;  2VQE K;  3K5L A;  2Q36 A;  4DS4 A;  2KW4 A;  2FF3 B;  1WSE A;  3CCE N;  4YOT A;  4WYB A;  2GEL A;  1DLO A;  1S1T A;  3QNN A;  5EU7 A;  4NLB A;  4CW7 B;  5C24 A;  1EXQ A;  3KK7 A;  3VGL A;  2YNF A;  5JVH L;  1HKC A;  4O5B A;  2YHA A;  3QO9 A;  1I39 A;  3O6W A;  3KLE A;  3K58 A;  3EZW A;  3QIP A;  1RNH A;  4BC3 A;  4DLG A;  4FLU A;  2FSJ A;  3U3G A;  2E6M A;  3SJJ A;  4X65 K;  2UU9 K;  2GEM A;  4O0J A;  3VQ8 A;  2P5O A;  4B3S K;  5CYM A;  3OYA A;  1R0A A;  1A5V A;  4FO0 A;  4JD2 A;  2ASP A;  4AHU A;  1BI4 B;  2O4I A;  1JLF A;  3OYN A;  1FK9 A;  4M42 A;  4DG1 A;  4W5O A;  1VQ4 N;  3VF4 A;  2WBN A;  1QSL A;  2YJE A;  4CEE A;  3MEE A;  4CZH A;  1WN7 A;  1YTA A;  4DTO A;  1DTQ A;  1S1W A;  3AAP A;  4H0T B;  2HB5 A;  4BVP A;  5F1X A;  1BU6 O;  2G8I A;  2G8U A;  3SJH A;  3O8M A;  4EIA A;  2QW9 A;  1WAJ A;  1ATR A;  3LWM A;  2HST A;  3SYZ A;  1TGO A;  1UAX A;  3HVT A;  4AM7 A;  1JCE A;  4A59 A;  1N34 K;  2HF3 A;  4BR0 A;  1NOY A;  4PQU A;  4KI6 A;  1KC8 O;  1U45 A;  4WCE L;  3CPW M;  3MED A;  3QEP A;  1RDD A;  4M7X A;  1JL2 A;  3O9T A;  4AH9 A;  1VSM A;  4RWT A;  3M8P A;  3BZK A;  2KKZ A;  3W0L A;  3TAG A;  1LW0 A;  1NKC A;  2O8B A;  5F0X A;  3HT3 A;  3T1Y K;  3ZSV A;  3MWP A;  3HJF A;  3VQC A;  2QKK A;  3RRG A;  1XC3 A;  4Y1C A;  1KQS M;  2I7N A;  4MDB A;  4LC9 B;  3LAL A;  4CJU A;  4HCB A;  3K5M A;  1HLU A;  4EP5 A;  3CQX A;  3EE8 A;  3L0Q A;  2P9I A;  5AZI B;  4FZX C;  5HBM A;  3M8R A;  1VQ9 N;  3P4I A;  4DQR A;  3HP6 A;  4CD3 A;  4CZG A;  4Z4H A;  4JI5 K;  3PO5 A;  5GAE P;  3EZ5 A;  4H5T A;  1HPZ A;  4GNI A;  3ALY A;  2Q0R A;  4DR2 K;  2QM1 A;  3KKS A;  4JK9 A;  1X9M A;  4ELT A;  2HOE A;  4FJ5 A;  5M1F A;  3SBG A;  2WON A;  5AQS A;  4CF8 A;  2PYL A;  3MN5 A;  4C8M A;  4M45 A;  3CJA A;  3OBY A;  3D2E B;  4KHN A;  3HXM A;  3VQQ A;  4DMN A;  4BG8 A;  3QNO A;  5T7B A;  1VQL N;  2HNZ A;  1NK9 A;  2RKI A;  4N5S A;  2E1Y A;  4B1W B;  3VET A;  2NLX A;  1RT7 A;  2BE2 A;  4FJJ A;  1D5A A;  3JXU A;  3VQ7 A;  3BUZ B;  4AHR A;  5KTQ A;  3L8B A;  3AVC A;  2VWJ A;  2RN2 A;  3TSU A;  2ZJQ L;  4RTF D;  1YI2 N;  3OYJ A;  4BVO A;  3EY1 A;  1T7P A;  3O3F A;  5AQU A;  4AIL C;  3ULD A;  2OZS A;  3L2R A;  3JS6 A;  3C6U A;  2QWQ A;  3ISN C;  2P51 A;  4MO4 A;  1BA0 A;  4KHP K;  2YJF A;  1HJO A;  1T44 A;  4Z4C A;  4IWV A;  1E4F T;  2RF2 A;  3TAN A;  3E9O A;  1K73 O;  4B9T A;  3KK3 A;  1BCM A;  1S6P A;  4YOR A;  3VQB A;  1M1K O;  3KLG A;  4IG0 A;  4FZY A;  2B4J A;  4DR7 K;  4M3Y A;  1XWL A;  4PY5 A;  2GUI A;  4KHU A;  3VQD A;  4H0O A;  3PUF A;  5FRN A;  2X6S A;  4FK2 A;  1C0F A;  3N4Q A;  3KK2 A;  1LV5 A;  2A6A A;  5GIN A;  3ENH A;  4B8C A;  2XRI A;  3AAQ A;  3P31 A;  4ELU A;  4FSV A;  5GIO A;  4KKO A;  3OYH A;  4FJ7 A;  1FKP A;  1NJI O;  4FJ8 A;  5DK5 A;  3PX4 A;  3KD1 E;  4RW6 A;  1W9H A;  4X66 K;  3CF5 L;  2E88 A;  2O8C A;  4Y1D A;  3SPZ A;  4DUY K;  3SQ4 A;  4JK8 A;  5I3U A;  3DLR A;  3V1R A;  4CGJ A;  1NGF A;  3I56 N;  4FM1 A;  5J2P A;  3CM5 A;  2DY4 A;  1Z25 A;  4BR7 A;  4ID5 A;  1HRH A;  3VEZ A;  3OYM A;  3EN9 A;  3ZT4 A;  3HBT A;  3H6E A;  3CYM A;  5JLF A;  4CFD A;  3HM9 A;  1NGB A;  3FZM A;  2D0A A;  3HPO A;  4NB4 A;  3OYB A;  1J5E K;  2GX9 A;  4R79 A;  4C8L A;  2PZS A;  3VQ6 A;  2AA4 A;  2KFZ A;  3H45 C;  3CG7 A;  4KV8 A;  2CH5 A;  2QXF A;  4ZTJ A;  3JAM O;  1NK0 A;  3CC2 N;  3NF7 A;  2P9N A;  3MMV A;  4AHC A;  1N5Y A;  3DJC A;  1B9D A;  1WBD A;  4BDZ A;  2P9S A;  3A5O C;  2UUA K;  4CK2 A;  4IFY A;  4FPA A;  1SL2 A;  4GVM A;  3ZSW A;  1JCF A;  3BP8 A;  4CIE A;  1WAF A;  1J53 A;  3TTD A;  1M90 O;  1HYZ A;  4IEE A;  2X6N A;  1XC9 A;  1TV6 A;  3WEE B;  1REV A;  4CE9 A;  2BDP A;  2X78 A;  1U48 A;  2Q0U A;  1NGJ A;  5C0Y A;  1VSI A;  5BPL A;  4FLZ A;  2G8K A;  1SUQ A;  2HHW A;  4BWJ A;  4C1N K;  4H0X B;  1OVY A;  4CZE A;  1YXQ A;  3DOK A;  4JNE A;  4BRI A;  2KTQ A;  2YHX A;  2Y1J A;  4H4O A;  3R6M A;  4JKD A;  5HRN A;  4W5N A;  2E2P A;  4OGE A;  5AQK A;  4ZHR A;  1HPM A;  4OX9 K;  1EET A;  2NZT A;  4FXD A;  3NGI A;  3HOT A;  3H1V X;  2VWK A;  5KPZ A;  4XIU A;  2Y1I A;  5CZ1 A;  5J2M A;  4CJL A;  3L4Q A;  4CHP A;  3F9K A;  4ID1 A;  2Z1G A;  4FOE A;  4JKA A;  4E0D A;  3ITH A;  1IKV A;  1RT6 A;  4BRM A;  4FJM A;  4CZJ A;  4EZ9 A;  2WFB A;  2HHH K;  3N4P A;  1RBV A;  2RE2 A;  4CGF A;  4B3R K;  3OJS A;  1HQE A;  2OPQ A;  1BCO A;  1RGI A;  4BWM A;  5BRF A;  1NJY A;  4CHQ A;  1EWR A;  4AQY K;  3AA2 A;  1NGD A;  4LD0 A;  3CCQ N;  5AQT A;  2IVN A;  3C7N B;  4BRG A;  4DKW A;  1U49 A;  4E7I A;  1NK5 A;  3DRR A;  3S9H A;  2NRW A;  2HVI A;  4FZZ A;  1IO2 A;  1MDU B;  5IWA K;  1ESV A;  1JLC A;  4HWI A;  3AO3 A;  4LH4 A;  3HOS A;  1VSK A;  4IJA A;  4BRE A;  3OA9 A;  3AY9 A;  1QS4 A;  3TPQ A;  5AQI A;  4HVJ A;  5KPR A;  3SBT A;  3QEI A;  1BI4 A;  4FL9 A;  1YJN N;  4CHN A;  3UB5 A;  4I2Q A;  4RW4 A;  4N47 A;  1QHA A;  3LL3 A;  3LDL A;  4KH5 A;  1I94 K;  4B1X B;  1G99 A;  2P9L B;  3M5R A;  3NAE A;  4CEZ A;  4EAH D;  2XY6 A;  3VGK A;  4PA1 A;  2VG7 A;  1SKR A;  2HHX A;  1JXE A;  4O4G A;  1EKE A;  2HHU A;  3V1Q A;  1OH8 A;  4B9N A;  2HNY A;  4BRO A;  3SPY A;  1FJG K;  1LAV A;  3IFR A;  2G8F A;  1BIZ A;  5JS2 A;  1IBK K;  4M3R A;  1OKJ A;  4CHO A;  4JI8 K;  2YHY A;  1DT9 A;  3OYF A;  4FWL A;  3SLC A;  5ADX A;  2QWR A;  4O8K A;  1N32 K;  1KLM A;  1KRP A;  4KTQ A;  1Q18 A;  5BRD A;  5C25 A;  3VER A;  3TU5 A;  5D3G A;  1KSP A;  3FZH A;  3CCR N;  4Z4G A;  1ZBF A;  4AF1 A;  1A5W A;  2HF4 A;  3RSE A;  1VSF A;  5AQW A;  3RTV A;  3KTQ A;  2QI2 A;  2G8V A;  4L3Q A;  4JK7 A;  5JMV A;  5A2Q O;  4YY3 K;  1UA1 A;  3QEV A;  1K8K B;  3TAP A;  4B9V A;  1I3A A;  2OYQ A;  4EP4 A;  4WF9 L;  3ZT0 A;  3EEQ A;  4Z4E A;  4I9L A;  3P5J A;  1D9F A;  5KGW A;  4OPK A;  2HMP A;  3TSQ A;  3EYZ A;  1QVG M;  2V51 B;  1VSE A;  3LP2 A;  3OYG A;  4CBX A;  4RW8 A;  2YNH A;  3IUC A;  1NNE A;  5GIP A;  3MEG A;  4RG8 A;  4ISF A;  3PX6 A;  2YX6 A;  4FW2 A;  5AZI A;  4KHS A;  4BC5 A;  2D0P A;  2HBJ A;  4M3X A;  3DWL A;  4DV5 K;  2KZZ A;  2XY5 A;  4RCH A;  4C8K A;  1RT1 A;  3SK3 A;  4DSK A;  2DFE A;  3H1Q A;  4DR5 K;  4FJX A;  4CFC A;  3D45 A;  3V9U A;  4LH5 A;  3LPU A;  3V9S A;  4CJV A;  1DGK N;  4DWI A;  4YOW A;  3ZT2 A;  3HRG A;  4K25 A;  5SWM A;  1DEJ A;  5AQR A;  1RT2 A;  4DV7 K;  2IC3 A;  3L6Q A;  1HX1 A;  4A2B A;  3D2E A;  3OW2 M;  2D1K A;  3JYT A;  3HK2 A;  4IXC A;  1VQK N;  3WNG A;  2ZD1 A;  2ASO A;  4I6M B;  4GV6 A;  3E01 A;  1UOC A;  4JI4 K;  3CCL N;  2V7Y A;  4J2D A;  2E4L A;  4CHZ A;  3NHG A;  1VSH A;  4HHT A;  4FJL A;  4GV3 A;  4QS9 A;  1P8Z A;  2A40 A;  3V81 A;  1SV5 A;  3VTI A;  3OYK A;  4DTP A;  3ZSY A;  2QXL A;  4DU3 A;  1T3V A;  3KKR A;  5CHI A;  1IKY A;  4DV0 K;  5IT9 O;  3AGR A;  4FWK A;  5M1O A;  4YDU A;  1XI1 A;  5M1Q A;  4DR6 K;  3M3Z A;  2HHQ A;  1U6Z A;  2BGG A;  1NLV A;  1QQC A;  2J4R A;  3ZSO A;  3ZYY X;  3SCX A;  5KQD A;  2P9U A;  1NGC A;  4QCL A;  1B9F A;  2FXU A;  3SQ1 A;  4CJP A;  4CEO A;  3U8X A;  3MAQ A;  3TTF A;  3F9M A;  4FOI A;  1CZA N;  3E9P A;  4JLH A;  4CGD A;  1Q9X A;  1YVN A;  4FM2 A;  3WXI A;  3VF2 A;  4Z94 A;  3QFU A;  2P1J A;  3GE1 A;  5KRS A;  4CED A;  4OPA A;  2YKN A;  1RDW X;  4DTN A;  2YNI A;  1G15 A;  5AFU H;  1BO5 O;  4M63 C;  1D9D A;  3KLI A;  4BQL A;  3ATU A;  4OLB A;  4HUF A;  3LZJ A;  3FZF A;  3B8A X;  3NH2 A;  3FZK A;  4FVU A;  3KIO A;  2VCP A;  4OVL A;  2QWL A;  3CM6 A;  5AQM A;  4JI3 K;  1NGE A;  1ASU A;  3DI6 A;  4KHW A;  1KCF A;  4E1J A;  5I42 A;  3ZX0 A;  1UWB A;  3ID8 A;  4CJW A;  1NBW A;  3B6P A;  1KFD A;  3AVN A;  2Z1I A;  1T05 A;  4A62 A;  1RBU A;  2QWM A;  2DPN A;  1LCU A;  1QZ5 A;  1X9J A;  3NDK A;  4ISG A;  4CK1 A;  5BR8 K;  2ASM A;  2VG6 A;  3CC7 N;  3CFP A;  4O8U A;  2A42 A;  4IOX A;  4C1N I;  4JKC A;  4LF7 K;  3GG4 A;  3SAH A;  1V4T A;  4IO8 A;  4JKH A;  4C8N A;  1C0G A;  4DTR A;  4FW1 A;  3G4S N;  4OLA A;  3MEC A;  2D4W A;  2UXC K;  3DLL L;  3O9Q A;  2XHB A;  3SMP A;  4M41 A;  1ATS A;  2IOC A;  4FK4 A;  5C2F A;  4CJ3 A;  3NVK A;  1QTM A;  3AVK A;  4KPY A;  4A2A A;  5CYQ A;  3L3V A;  3O80 A;  1IG9 A;  2HW3 A;  4E89 A;  1XQS C;  3WQT A;  4NCB A;  3SI6 A;  3FGU A;  3NE6 A;  2IIR A;  3DRS A;  1N33 K;  5BRE A;  2OAN A;  2F7T A;  3J7Y P;  3P38 A;  5LL6 Z;  3PIO L;  5DM7 L;  3F5T A;  3LWL A;  3U6F A;  4DQS A;  4KH4 A;  3V4I A;  1L5U A;  2EHG A;  4LFC K;  3A5L C;  4Y0W A;  3ZX2 A;  3NFA A;  4GKJ K;  1BWF O;  3V1O A;  1EX4 A;  2YNG A;  4OKJ A;  3AA3 A;  1ZBS A;  4QAG A;  4H0Y B;  3VN5 A;  1JJ2 M;  2WC9 A;  3IS9 A;  1XMQ K;  2P9K A;  3OHR A;  5JVG L;  1D8Y A;  4H0V B;  2HND A;  1KLN A;  5TKY A;  4JKG B;  5FPM A;  3A0I X;  3O3H A;  3AA4 A;  1OVQ A;  2NNW A;  3PO4 A;  3SAF A;  2PY5 A;  1IBM K;  4IKF A;  2E8A A;  4FJI A;  1VQ5 N;  2O8D B;  3DYA A;  3QB0 A;  1WB9 A;  1RT4 A;  1HNW K;  4CEC A;  4GMJ B;  1VSD A;  2ZE2 A;  4DS5 A;  3WNE A;  3C7N A;  4DUZ K;  4A5B A;  3QFP A;  2YI1 A;  4IEI A;  5B8H A;  5C10 A;  4WFN L;  4CGH A;  2QA4 N;  4B9Q A;  2UYT A;  5K14 A;  4W5T A;  3PY8 A;  4F2S A;  2IDO A;  2Q1N A;  4CJ5 A;  1X9S A;  1HNZ K;  4JAX A;  3WNH A;  4H5N A;  1JLQ A;  3BGR A;  1KAX A;  1WSF A;  5AQP A;  3S3N A;  4HTU A;  4G9Z A;  3QBW A;  2JGU A;  3T7Z A;  1T6C A;  1GLJ O;  4CJR A;  3QML A;  5AQX A;  3LDO A;  2QEX N;  3C65 A;  4DFP A;  3R1X A;  2QWN A;  4F9O A;  1RT5 A;  2P9L A;  3AO5 A;  4JKF A;  1JLE A;  4H4M A;  1SS6 A;  4WQ5 C;  3LDS A;  2DFF A;  4B9U A;  2HMI A;  1KVC A;  2E20 A;  4K42 A;  1NJZ A;  3VTH A;  4FWM A;  4QOZ B;  3U3Y A;  3C6T A;  1Z6R A;  4BGB A;  4JI0 K;  4IBN A;  4FM0 A;  3GOI A;  4IOC L;  1K6Y A;  1BIS A;  4OO1 J;  4FLT A;  2P5G A;  2Z1H A;  4WFA L;  4K8X A;  1RT3 A;  4FK0 A;  4AHV A;  2ZGY A;  3EKU A;  2GTD A;  3R8E A;  1HYS A;  4J2A A;  1S1X A;  4EFH A;  3DLH A;  5AQQ A;  1Q9Y A;  3Q7B A;  1U04 A;  4MLH A;  3FR0 A;  4FWQ A;  3NF6 A;  1QZ6 A;  1C1B A;  4DTJ A;  4C23 A;  1K8K A;  3KK1 A;  4E7J A;  4DR1 K;  3CMA N;  4J2B A;  5AZJ B;  3QER A;  4IFE A;  3RR7 A;  4KAZ A;  1MA9 B;  1QQO A;  4IDK A;  3ZET B;  4CJS A;  4BR9 A;  1XMO K;  4NCA A;  5HRS A;  5FPD A;  4KI4 A;  4N56 A;  4BRP A;  1KVB A;  1YTU A;  2QKB A;  1CLQ A;  3VES A;  1WNS A;  1NGA A;  4GVE A;  3NBP A;  1E3M A;  3KD5 E;  2OPR A;  4IDH A;  4J2E A;  4CGG A;  1Q81 O;  4M3T A;  1TK0 A;  4BAC A;  4FJH A;  4YOU A;  5EY4 A;  1ZBI A;  3VF6 A;  1TK5 A;  1OH5 A;  3PLA A;  4FLV A;  4BR5 A;  4BE1 A;  1HR0 K;  2IAJ A;  1RTH A;  2E1Z A;  3QEW A;  2W41 A;  3CFO A;  1U2V B;  3HI0 A;  5BN9 A;  1N36 K;  2JWK A;  2FSK A;  3LP3 A;  5AFU A;  2O8F B;  2F96 A;  3AVM A;  4M3W A;  2VYP A;  1Z26 A;  4JN4 A;  4E1M A;  4I6M A;  3QDK A;  2IVP A;  4A5A A;  1NJX A;  1IG8 A;  2AJQ A;  2ETJ A;  4DQP A;  4CIF A;  1JL1 A;  5CZ2 A;  4BRD A;  4F8R A;  1ASW A;  4AHT A;  4DV3 K;  3TAB A;  1TL1 A;  2VG5 A;  5AQJ A;  2Q3S A;  2NRH A;  3VEY A;  1YIT N;  1KXP A;  4GKK K;  3WNF A;  2NRV A;  3RVC A;  1TK8 A;  4YOX A;  3EL2 A;  4JYA K;  3ZSR A;  1WLJ A;  4DQ8 A;  1C6V A;  1DKG D;  3CME N;  3QLH A;  5M1K A;  1XHZ A;  1RBS A;  3MCA B;  2D0C A;  2GWJ A;  2ATQ A;  4F3O A;  3WXK A;  3V9X A;  3IKM A;  4PKG A;  1BG3 A;  1HYV A;  3U9Z A;  3G71 N;  2OZM A;  1S1U A;  1XNQ K;  4KFB A;  1L3S A;  1TYQ B;  1RDU A;  3ULE B;  3S3O A;  2AP1 A;  1HNI A;  1HNX K;  4CJK A;  3I8B A;  2F9W A;  1S72 N;  3D6R A;  2PYJ A;  3MXM A;  4CVN E;  4OJR A;  2W40 A;  1FW6 A;  3CJ7 A;  4KB1 A;  3E9L A;  1WUA A;  4WFB L;  3AGK A;  3K0S A;  2RHK A;  2ZWH A;  3CCM N;  3O4W A;  4IFV A;  2WTU A;  3O5B A;  4FJ9 A;  3NH0 A;  1RDA A;  3C94 A;  2W6L A;  3WUH A;  4A57 A;  2YV0 X;  1HQU A;  2A5X A;  3DLB A;  3CET A;  3HSC A;  3MX5 A;  3V9Z A;  3SUP A;  1VQ7 N;  3OYI A;  2FLO A;  3VPZ A;  4BRA A;  3L2Q A;  4JS5 A;  1NJW A;  5AJ3 K;  4PUO A;  2GBZ A;  4B3T K;  5BPN A;  5KPT A;  1CXU A;  3DXM B;  3AO1 A;  4CK3 A;  3G6E N;  5J2N A;  4DTS A;  3HYF A;  4B3M K;  5LMN K;  4KHQ A;  3IG1 A;  3I8D A;  2OTL N;  1ZXO A;  1BUP A;  3OY9 A;  4ELV A;  1C0T A;  2O4G A;  3TAF A;  3HTV A;  4U7B A;  1S1V A;  3R3L A;  1BOT O;  1NK6 A;  2UUC K;  3QBX A;  2CH6 A;  2QWP A;  3C6H A;  1MU2 A;  4BRL A;  5GAD P;  1ZBH A;  4O55 A;  3WXJ A;  1W0H A;  4YNQ A;  2ZJP L;  1CZ9 A;  3SAG A;  3SV3 A;  1VRT A;  1J6Z A;  2PAV A;  3NVM A;  4O44 A;  1GOA A;  2WOM A;  2VGN A;  4FYD A;  1LAW A;  2BAN A;  4FPB A;  3J7A P;  3UKR B;  3ASM A;  5HLF A;  4F4K A;  3AVI A;  1ITG A;  2FBV A;  4BR4 A;  2OCE A;  1K9M O;  3KWG A;  4CJ4 A;  3FLC O;  3IAY A;  1VQO N;  1QSS A;  4M3U A;  2DTU A;  3NF8 A;  1KTQ A;  4CER A;  1NKE A;  3T69 A;  1RTD A;  4WQ4 A;  3LDP A;  4I9Q A;  3J80 O;  5BRH A;  4MLE A;  2GUP A;  1KAZ A;  3EO3 A;  1VQP N;  1K8A O;  3AA5 X;  3P83 D;  3AO4 A;  4QS7 A;  4DV1 K;  4BRF A;  4HCC A;  3AVL A;  1ASV A;  3VQE A;  3DXK B;  1Q8I A;  2VWB A;  2UUB K;  4Q0B A;  4DCH A;  1EP4 A;  5FLX O;  5CY4 A;  4JI1 K;  3HM8 A;  4CEB A;  3SQ2 A;  3KWI A;  1GLA G;  4JKG A;  4FCY A;  1NK4 A;  3L3U A;  4N41 A;  2FBT A;  3ZSZ A;  2H3G X;  4FWP A;  3NH1 A;  2I5J A;  5M1P A;  1BQM A;  2F8S A;  3M1F A;  1YJ9 N;  2O8D A;  3NCI A;  1NWK A;  3SV4 A;  1HKG A;  1R59 O;  1KD1 O;  3UKU B;  4MO5 A;  3E1Y A;  3WT0 A;  5E41 A;  2F8T A;  2JLE A;  3VA3 A;  5SZT A;  2VGM A;  1TKZ A;  1EWQ A;  1NMN A;  3ZSQ A;  3CCV N;  4BRC A;  3OS1 A;  1QHT A;  4Z4I A;  3OS2 A;  2YKM A;  1C1A A;  2OPP A;  5AQO A;  4DB3 A;  2R7Y A;  3LP1 A;  2Q97 A;  3WXM B;  4CZF A;  2G8W A;  4R5P A;  4K41 A;  3ZLJ A;  3HPG A;  3CHW A;  4CFA A;  1QSY A;  1YT3 A;  2ZJR L;  3OYC A;  1Y64 A;  4E19 A;  4I7F A;  4XH5 A;  3HL8 A;  4CJT A;  5FPE A;  4CJQ A;  2QK9 A;  2A3Z A;  2NRZ A;  5C2D A;  1VQM N;  1YHQ N;  4E7L A;  1T6D A;  3DAW A;  1XHX A;  3WQU A;  1S3X A;  4NXN K;  5AQY A;  1XUP O;  5LY3 A;  2ZGZ A;  1L3T A;  5F2R A;  3A2F A;  3VQ4 A;  3RMA A;  4NYF A;  3B6O A;  1VHX A;  3O9S A;  1Q7Y O;  4BRN A;  1BHL A;  3MXI A;  3T1H K;  3LDQ A;  2W42 A;  4PKH A;  3O08 A;  4YOY A;  1NGH A;  3PX0 A;  1FKO A;  3CCJ N;  5HP1 A;  3HPH A;  2HHS A;  3LP0 A;  1SQK A;  3CC4 N;  5ELZ A;  3SZ2 A;  5AQL A;  3A5M C;  4JI6 K;  3S41 A;  3D7E O;  4LF4 K;  3T1A A;  1IKX A;  4KHY A;  1RIL A;  4CF2 A;  4DFM A;  3DOL A;  1C0U A;  1L3U A;  2KQ2 A;  3SUO A;  1YVU A;  1Y97 A;  1YJW N;  1NGG A;  3V6D A;  4L8R B;  5AZJ A;  3CER A;  3THY B;  4KO0 A;  1S6Q A;  4CJ7 A;  2GWK A;  3RR8 A;  2XO7 A;  1XNR K;  1BGX T;  3WXL A;  4JHD B;  4B1Y B;  4IO9 L;  1X3N A;  3ZET A;  5E26 A;  4LF5 K;  3L2W A;  3FZL A;  4EHT A;  2NRT A;  1TAU A;  1C0M A;  5E84 A;  4OPH A;  3I33 A;  1JCG A;  1OH6 A;  3MWT A;  2W6K A;  2KZM A;  2HHV A;  4DQI A;  4LFA K;  1EQY A;  5AQV A;  1NU0 A;  3G25 A;  4DSF A;  1TKD A;  3ZEU B;  3J8A A;  1BA1 A;  2QWO A;  3OYL A;  4KRE A;  2DFH A;  1ZYQ A;  1NM1 A;  2P9P B;  2A41 A;  3MCP A;  3SUN A;  4KB0 A;  2B6A A;  1YF5 L;  3H3O B;  3MN7 A;  3G10 A;  3IMX A;  4YOV A;  4FVM A;  1NKB A;  2CGJ A;  3VEW A;  5AQG A;  1KVA A;  3MN6 A;  2D0O A;  2ZM6 K;  2NRX A;  2KLA A;  5KRT A;  1U2V A;  3OYE A;  3K2P A;  1O1W A;  4BQZ A;  3CXC M;  3AVJ A;  4JI7 K;  5JS1 A;  5BN8 A;  2O8F A;  5I9E B;  3LPT A;  3WEE A;  5C12 A;  2Q31 A;  3OS0 A;  2B5J A;  4KRF A;  3OVN A;  4JKE A;  1WSI A;  4ILJ A;  2UXB K;  1J9A A;  1IH7 A;  2QTD A;  5C15 A;  3E66 A;  3RSE B;  1Q86 O;  4B1Z A;  3I0R A;  4GV9 A;  2E2N A;  3DM2 A;  4CEQ A;  3QIN A;  3C6A A;  3O9U A;  5KGX A;  1JXB A;  2I7P A;  5AR0 A;  1DTT A;  3PSF A;  4DU1 A;  2BTF A;  4KTW A;  3L2U A;  1IBL K;  3LM2 A;  4CZK A;  3SUQ A;  2OPS A;  1VAZ A;  3NGY A;  4DR4 K;  3RRH A;  1SZ2 A;  3D2F B;  4CZM A;  3VEX A;  3SMS A;  3DLG A;  1UA0 A;  4N76 A;  2WUS A;  2O8E B;  1SKW A;  1SKS A;  4DSE A;  4CCH A;  4DU4 A;  1B92 A;  3QET A;  3J7Z O;  4CEA A;  1RTJ A;  1TYQ A;  4JI2 K;  4M7Y A;  3ULE A;  1MWK A;  3CFR A;  4FJG A;  4UQG A;  1GLD G;  1WSH A;  3ZX3 A;  3M8Q A;  3GBT A;  4RW9 A;  5BR9 A;  3BEX A;  4Q5V A;  2G8H A;  3T3F A;  3VGM A;  3D0P A;  1KFS A;  5ADX H;  5DM6 L;  1J5O A;  3A8Y A;  3Q7C A;  3PV8 A;  4JRP A;  3NGZ A;  3VEO A;  3O9R A;  1BL3 A;  5FRO A;  4IOA L;  1QE1 A;  5C42 A;  1L3V A;  4OKK A;  3DMJ A;  4H0P A;  3THX B;  1BDG A;  2Q2R A;  3CJB A;  3TAQ A;  4LSL A;  3MDQ A;  4CI6 A;  3AO2 A;  4OKE A;  2OA8 A;  4CGI A;  1GLC G;  2LSN A;  3CJ1 A;  4J8F A;  3C95 A;  4CFB A;  3CJ9 A;  3M6G A;  1WOQ A;  2A1S A;  5GAG P;  1YUW A;  5FPN A;  1GOC A;  4CJF A;  5GAH P;  2RPI A;  3KVG A;  1ILY A;  3CCU N;  4WQ4 C;  4A61 A;  3THW B;  3THV A;  3P1G A;  1RDB A;  5EVZ A;  3K9K A;  3PSI A;  3VOV A;  5AQN A;  1GLB G;  1S9E A;  4B9L A;  2YHB A;  4DFK A;  1JLB A;  4FWR A;  3DXM A;  3GDQ A;  3LZI A;  3CJC A;  4NXM K;  1GOB A;  2P9U B;  4BC2 A;  1RBR A;  1IJJ A;  1NK7 A;  1YAG A;  1ZC6 A;  3OTO K;  4PL7 A;  3TI0 A;  3KHY A;  5HL7 L;  3UIQ A;  2HBM A;  4BRH A;  1RDC A;  3VQA A;  3L2V A;  2HHT A;  3AAR A;  4BE2 A;  1YIJ N;  3GL1 A;  3LAK A;  2IVO A;  1GLF O;  2Z1J A;  4AHS A;  4BE0 A;  3MXJ A;  5HRP A;  2ZF5 O;  4CJE A;  1VRU A;  2PFU A;  4BDY A;  3LM9 A;  1S5J A;  4JV5 K;  3O4Q A;  3UKR A;  4LY7 A;  1RTI A;  4ISE A;  2YHW A;  1O13 A;  3I55 N;  4E7K A;  5MLC Q;  3CPE A;  4FJN A;  1F21 A;  2BH1 A;  1WSJ A;  3ENO A;  4OPJ A;  3VQP A;  3G0Z A;  3UE5 A;  4JD2 B;  5JLH A;  4YDU C;  3VQ5 A;  4PKI A;  3EE9 A;  1NG9 A;  1TKT A;  3BF3 A;  1TL3 A;  4DV6 K;  2D5R A;  3EKS A;  5DMR A;  4DV4 K;  3AVA A;  4EHU A;  2V7Z A;  4KH6 A;  3DXK A;  1X3M A;  4H5V A;  1RCH A;  3M8S A;  4CZI A;  1C1C A;  3SNN A;  4EZ6 A;  5J2Q A;  3BY5 A;  3CD6 N;  4DFJ A;  4IJN A;  4X62 K;  3F2K A;  5JIC A;  4IG3 A;  1BQN A;  3CQ8 A;  2KFN A;  5FRM A;  3CCS N;  3CI5 A;  3AVF A;  4ICL A;  4CF9 A;  3UKU A;  4PWD A;  2E2O A;  3ZT3 A;  4GY2 B;  3QES A;  4PL8 A;  5M1N A;  1P90 A;  4TSX A;  4ILG B;  4DV2 K;  3TAE A;  5EX5 A;  3R9P A;  2A1R A;  3FE1 A;  2X74 A;  3IDH A;  4DTX A;  4K8Z A;  2HBL A;  1VK0 A;  1D4X A;  5EOY A;  4O5F A;  3RMC A;  4V19 S;  1HUX A;  3BZC A;  1IV0 A;  3QIO A;  4W5R A;  2O8B B;  3ID6 A;  4FWN A;  4QS8 A;  5CE3 A;  3TR8 A;  2UXD K;  4Z0U A;  1ATN A;  5BPM A;  5EXW A;  1RFQ A;  4MQ3 A;  4H5R A;  4DQQ A;  4BRQ A;  4JS4 A;  3TAR A;  3S3M A;  4OGC A;  5KQ8 A;  1SAZ A;  2YCH A;  4BY9 C;  3H46 O;  5HOO A;  3FFI A;  4CEF A;  4JEP A;  2P9I B;  3QEX A;  2FF6 A;  1RBT A;  3TSP A;  4DSJ A;  4B9S A;  4ILH A;  3HZ6 A;  3MK6 A;  1KAY A;  2P9K B;  4NYN A;  3RMD A;  4NO7 A;  4W5Q A;  4FLY A;  4H5W A;  3K5O A;  1HKB A;  3I0S A;  2PBD A;  4CF1 A;  4CBU A;  4KBO A;  3K5N A;  3VA0 A;  3OJU A;  3V9W A;  3JSM A;  3F73 A;  3MX2 A;  3LAN A;  1IKW A;  1OH7 A;  1V4S A;  3HST B;  2IS3 A;  4KTZ A;  4JKB A;  2IGI A;  1T03 A;  3DLK A; 
#chains in the Genus database with same CATH homology
 2HW3 A;  4E89 A;  3VA3 A;  5SZT A;  1TKZ A;  4B8C A;  3OYD A;  2XRI A;  1TKX A;  4ELU A;  3ZSQ A;  4RW7 A;  4NCB A;  1LWE A;  3OS1 A;  3NF9 A;  4KKO A;  1QHT A;  3OYH A;  3OS2 A;  2YKM A;  1C1A A;  1FKP A;  2OPP A;  4FJK A;  5DK5 A;  3SI6 A;  4FJ7 A;  4FJ8 A;  3PX4 A;  3KD1 E;  4RW6 A;  2R7Y A;  3LP1 A;  3NE6 A;  4DTM A;  1W9H A;  2G8W A;  3DRS A;  4R5P A;  4BDP A;  1U47 A;  1VSL A;  4Y1D A;  3SPZ A;  1NK8 A;  3HPG A;  3SQ4 A;  4B8A B;  4CFA A;  3ZT1 A;  5I3U A;  3TWH A;  1X1P A;  4O0I A;  1QSY A;  3RWU A;  3LWL A;  1YT3 A;  3DLR A;  3V1R A;  1JKH A;  3OYC A;  3U6F A;  4DQS A;  3V4I A;  4CGJ A;  1L5U A;  2EHG A;  4FM1 A;  5J2P A;  1VSJ A;  2EX3 A;  5FDL A;  3CM5 A;  3NFA A;  4E19 A;  3K57 A;  2DY4 A;  4I7F A;  3V1O A;  1Z25 A;  3H08 A;  1EX4 A;  2YNG A;  4ID5 A;  3ZSX A;  1HRH A;  3OYM A;  3HL8 A;  4OKJ A;  3AA3 A;  4QAG A;  3ZT4 A;  4CJT A;  3CYM A;  2FBY A;  3VN5 A;  4CJQ A;  2QK9 A;  4CFD A;  3HM9 A;  2D0A A;  3IS9 A;  4E7L A;  3HPO A;  1D8Y A;  1XHX A;  3OYB A;  2HND A;  1ZBU A;  4C8L A;  1L3T A;  3HO1 A;  2PZS A;  3A2F A;  3AVB A;  3VQ6 A;  1KLN A;  3VQ4 A;  3RMA A;  2KFZ A;  4NYF A;  3B6O A;  4FK2 A;  3O3H A;  3CG7 A;  4KV8 A;  4E7H A;  3AA4 A;  3AVH A;  1HJR A;  1BHL A;  2QXF A;  4ZTJ A;  3MXI A;  1NK0 A;  3PO4 A;  2ZQB A;  4I2P A;  4F3T A;  2PY5 A;  4IKF A;  2W42 A;  3NF7 A;  4FJI A;  4AHC A;  1N5Y A;  3DYA A;  3PX0 A;  1FKO A;  1LW2 A;  1B9D A;  3HP9 A;  1RT4 A;  5HP1 A;  3HPH A;  4BDZ A;  4B9M A;  4CEC A;  2HHS A;  4GMJ B;  4WE1 A;  3LP0 A;  1VSD A;  2ZE2 A;  4IFY A;  4CK2 A;  3SZ2 A;  4DS5 A;  3WNE A;  4GVM A;  1SL2 A;  1HMV A;  3ZSW A;  3AV9 A;  4JRQ A;  1ZBL A;  3T1A A;  1IKX A;  4CIE A;  1WAF A;  4KHY A;  1J53 A;  1RIL A;  4CF2 A;  1CXQ A;  4CGH A;  4HUG A;  4DFM A;  3DOL A;  1C0U A;  1X9W A;  2E6L A;  1HYZ A;  2X6N A;  1XC9 A;  5K14 A;  1L3U A;  4W5T A;  1TV6 A;  2KQ2 A;  1BIU A;  1YVU A;  3SUO A;  2XY8 A;  1REV A;  1Y97 A;  1SL0 A;  4CE9 A;  3LAM A;  3PY8 A;  2BDP A;  1JLA A;  2IDO A;  4F2S A;  2X78 A;  4DF8 A;  1U48 A;  3KLF A;  3V6D A;  1VSI A;  4NCG A;  4FLZ A;  4L8R B;  4CJ5 A;  2G8K A;  1SUQ A;  1X9S A;  4KO0 A;  1S6Q A;  3WNH A;  3RR8 A;  2HHW A;  2XO7 A;  4BWJ A;  2GV9 A;  1JLQ A;  3BGR A;  1BGX T;  3O3G A;  1CZB A;  1WSF A;  3S3N A;  3DOK A;  4HTU A;  4CIG A;  1T8E A;  2JGU A;  1NOZ A;  3L2W A;  4DTU A;  4DSL A;  4DLE A;  2KTQ A;  2FC0 A;  4CJR A;  1TAU A;  1C0M A;  2Y1J A;  1LWC A;  4H4O A;  5HRN A;  3KJV A;  4DF4 A;  4DFP A;  4W5N A;  2ITG A;  3DRP A;  4OGE A;  4ZHR A;  1RT5 A;  1EET A;  2KZM A;  4FXD A;  3NGI A;  5KI6 A;  2HHV A;  4DQI A;  3AO5 A;  1TKD A;  4DSF A;  2VWK A;  4B08 A;  4XIU A;  1JLE A;  2Y1I A;  4H4M A;  5CZ1 A;  5J2M A;  4CJL A;  4Z4F A;  4CHP A;  3F9K A;  3OYL A;  3LDS A;  4ID1 A;  4KRE A;  2DFF A;  4B9U A;  2Z1G A;  3TAM A;  2HMI A;  2DFH A;  1ZYQ A;  4E0D A;  3ITH A;  1IKV A;  1KVC A;  1NJZ A;  1RT6 A;  3SUN A;  4KB0 A;  4FJM A;  2HVH A;  4QOZ B;  3U3Y A;  4CHY A;  2B6A A;  4EZ9 A;  3G10 A;  1NKB A;  3C6T A;  4FVM A;  4IBN A;  1RBV A;  5HRR A;  4FM0 A;  1LWF A;  4CGF A;  1K6Y A;  1BIS A;  3OJS A;  1HQE A;  4FLT A;  2P5G A;  1KVA A;  2Z1H A;  4FLW A;  4K8X A;  2OPQ A;  1BCO A;  4BWM A;  1NJY A;  1RT3 A;  4CHQ A;  5KRT A;  4FK0 A;  3OYE A;  1U4B A;  3K2P A;  4AHV A;  4LSN A;  2FBX A;  1O1W A;  3AA2 A;  3AVJ A;  4YFU A;  5JS1 A;  4LD0 A;  5J1E A;  1A5X A;  1HYS A;  3KLH A;  3LPT A;  1U49 A;  4J2A A;  1S1X A;  4GW6 A;  3DLH A;  3BDP A;  4E7I A;  3OS0 A;  1NK5 A;  1Q9Y A;  3DRR A;  4G1Q A;  3S9H A;  4B3O A;  2D0B A;  2B5J A;  1U04 A;  4KRF A;  3OVN A;  4HUE A;  4FZZ A;  1IO2 A;  1WSI A;  4MFB A;  3NF6 A;  2HVI A;  1J9A A;  1IH7 A;  1JLC A;  4E3S A;  3SQ0 A;  1C1B A;  4DTJ A;  1TVR A;  3DLE A;  3KK1 A;  3AO3 A;  3I0R A;  3VQ9 A;  4E7J A;  4LH4 A;  3DM2 A;  4CEQ A;  1VSK A;  4J2B A;  3QER A;  3QIN A;  1QS4 A;  5KGX A;  1JXB A;  3RR7 A;  4DSI A;  1HNV A;  4HVJ A;  4FLX A;  3T19 A;  2NUB A;  4KAZ A;  4IDK A;  4CJS A;  1DTT A;  3QEI A;  4CF0 A;  1BI4 A;  4NCA A;  5HRS A;  4DU1 A;  4CHN A;  1N6Q A;  4KI4 A;  4N56 A;  1J54 A;  4KTW A;  3L2U A;  1KVB A;  4I2Q A;  3IRX A;  4RW4 A;  3SUQ A;  4N47 A;  4M3Z A;  2OPS A;  3HVR A;  1YTU A;  2QKB A;  3NGY A;  1SL1 A;  1CLQ A;  1FXX A;  1WNS A;  3RRH A;  1S9G A;  2XY7 A;  3RMB A;  4CES A;  3DLG A;  3NAE A;  4CEZ A;  3NBP A;  2XY6 A;  1UA0 A;  4N76 A;  4PA1 A;  3KD5 E;  2OPR A;  3O4N A;  2VG7 A;  1SKR A;  2HHX A;  1JXE A;  4O4G A;  4ZTF A;  4J2E A;  4CGG A;  1EKE A;  2HHU A;  1JLG A;  1SKW A;  3V1Q A;  4M3T A;  4B9N A;  1TK0 A;  4BAC A;  2HNY A;  3AVG A;  3SPY A;  5HRO A;  1LAV A;  4C8O A;  1WSG A;  4DSE A;  1SKS A;  1TAQ A;  4CCH A;  4DU4 A;  1BIZ A;  2G8F A;  4FJH A;  5JS2 A;  4M3R A;  1B92 A;  3QET A;  1ZBI A;  4CHO A;  4F2R A;  4CEA A;  3ZCM A;  4H8K A;  4E1N A;  1TK5 A;  1RTJ A;  3OYF A;  3K59 A;  4FLV A;  4DS4 A;  3K5L A;  3CFR A;  4BE1 A;  4FJG A;  2KW4 A;  4UQG A;  1WSH A;  1WSE A;  1RTH A;  2IAJ A;  3M8Q A;  1KLM A;  4RW9 A;  3QEW A;  1KRP A;  4KTQ A;  4Q5V A;  2G8H A;  3T3F A;  3CFO A;  3D0P A;  1KFS A;  1DLO A;  5C25 A;  1S1T A;  3QNN A;  5EU7 A;  1J5O A;  5D3G A;  3LP3 A;  1KSP A;  5C24 A;  3PV8 A;  2F96 A;  4JRP A;  3AVM A;  3NGZ A;  4M3W A;  1EXQ A;  1Z26 A;  4Z4G A;  1ZBF A;  4E1M A;  1A5W A;  1BL3 A;  5FRO A;  1QE1 A;  2YNF A;  1VSF A;  3RTV A;  1NJX A;  3KTQ A;  2G8V A;  2AJQ A;  2ETJ A;  4O5B A;  4DQP A;  2YHA A;  5C42 A;  1L3V A;  4OKK A;  4CIF A;  3QO9 A;  1I39 A;  1JL1 A;  3KLE A;  3DMJ A;  3K58 A;  1UA1 A;  3QEV A;  3TAP A;  5CZ2 A;  3TAQ A;  3QIP A;  1RNH A;  4B9V A;  4F8R A;  1I3A A;  2OYQ A;  4DLG A;  4FLU A;  4LSL A;  3U3G A;  1ASW A;  2E6M A;  4AHT A;  4EP4 A;  3SQ1 A;  3SJJ A;  3ZT0 A;  3AO2 A;  4OKE A;  2OA8 A;  4O0J A;  4CGI A;  4Z4E A;  2LSN A;  3TAB A;  3C95 A;  3VQ8 A;  4I9L A;  4CFB A;  3P5J A;  1D9F A;  1TL1 A;  5CYM A;  5KGW A;  1A5V A;  4OPK A;  3OYA A;  2VG5 A;  1R0A A;  2A1S A;  4AHU A;  1BI4 B;  2Q3S A;  3EYZ A;  1IG9 A;  2O4I A;  1GOC A;  4CJF A;  1JLF A;  1VSE A;  2RPI A;  3LP2 A;  3WNF A;  3OYN A;  3OYG A;  1FK9 A;  2YNH A;  4RW8 A;  3THV A;  4M42 A;  4DG1 A;  3MEG A;  3P1G A;  4W5O A;  1RDB A;  4RG8 A;  1TK8 A;  3PX6 A;  3ZSR A;  1WLJ A;  1C6V A;  1QSL A;  4FW2 A;  3QLH A;  1S9E A;  4B9L A;  4KHS A;  1XHZ A;  2YHB A;  1RBS A;  3MEE A;  4CEE A;  4DFK A;  2D0C A;  1WN7 A;  1YTA A;  4DTO A;  1DTQ A;  1JLB A;  2ATQ A;  1S1W A;  4F3O A;  4M3X A;  3V9X A;  2HB5 A;  2KZZ A;  2XY5 A;  4C8K A;  3LZI A;  1HYV A;  2G8I A;  1GOB A;  2G8U A;  2OZM A;  1RBR A;  1RT1 A;  1NK7 A;  1S1U A;  4DSK A;  2DFE A;  4FJX A;  1WAJ A;  3D45 A;  4CFC A;  4KFB A;  3V9U A;  1L3S A;  4LH5 A;  3LPU A;  3V9S A;  3TI0 A;  4CJV A;  3LWM A;  4DWI A;  3UIQ A;  3S3O A;  1RDC A;  1HNI A;  3VQA A;  3L2V A;  2HHT A;  4CJK A;  3ZT2 A;  3SYZ A;  1TGO A;  1UAX A;  3HVT A;  4BE2 A;  5SWM A;  1LV5 A;  1RT2 A;  3LAK A;  3MXM A;  2IC3 A;  2PYJ A;  1NOY A;  2Z1J A;  4AHS A;  4BE0 A;  3MXJ A;  4PQU A;  4KI6 A;  4Z4I A;  5HRP A;  1U45 A;  3L3V A;  3JYT A;  3HK2 A;  4CJE A;  3WNG A;  2ZD1 A;  1VRU A;  4OJR A;  3MED A;  4BDY A;  3QEP A;  1RDD A;  4KB1 A;  4AH9 A;  1JL2 A;  1S5J A;  1VSM A;  3M8P A;  3O4Q A;  3E01 A;  1UOC A;  4LY7 A;  1RTI A;  3TAG A;  1LW0 A;  1NKC A;  4J2D A;  2E4L A;  4CHZ A;  3NHG A;  4E7K A;  1VSH A;  4HHT A;  4IFV A;  4FJN A;  1F21 A;  4FJL A;  1WSJ A;  3HT3 A;  4FJ9 A;  3ZSV A;  3NH0 A;  1RDA A;  4OPJ A;  3HJF A;  3VQP A;  3VQC A;  3V81 A;  2QKK A;  3C94 A;  1SV5 A;  3G0Z A;  3RRG A;  4Y1C A;  3OYK A;  3VQ5 A;  4DTP A;  3ZSY A;  4DU3 A;  3LAL A;  3KKR A;  4CJU A;  1IKY A;  2YV0 X;  1HQU A;  4HCB A;  3K5M A;  3DLB A;  1TKT A;  1XI1 A;  1TL3 A;  4EP5 A;  2D5R A;  5DMR A;  3V9Z A;  3SUP A;  2HHQ A;  3OYI A;  2BGG A;  3L2Q A;  3AVA A;  1QQC A;  4JS5 A;  1NJW A;  3ZSO A;  4PUO A;  3SCX A;  2GBZ A;  5HBM A;  4FZX C;  3M8R A;  4QCL A;  4DQR A;  1RCH A;  3M8S A;  1B9F A;  1C1C A;  1CXU A;  3AO1 A;  4CJP A;  4CEO A;  4Z4H A;  4CK3 A;  3HP6 A;  5J2N A;  4DTS A;  3HYF A;  3MAQ A;  3PO5 A;  5J2Q A;  4KHQ A;  3IG1 A;  4DFJ A;  3EZ5 A;  3I8D A;  1HPZ A;  3OY9 A;  4JLH A;  4ELV A;  4IG3 A;  1C0T A;  1BQN A;  2O4G A;  3ALY A;  4CGD A;  3CQ8 A;  3TAF A;  1Q9X A;  2KFN A;  5FRM A;  1S1V A;  3KKS A;  4FM2 A;  3AVF A;  1X9M A;  4ELT A;  2P1J A;  1NK6 A;  4FJ5 A;  4ICL A;  4CF9 A;  5KRS A;  4CED A;  1MU2 A;  1ZBH A;  4PWD A;  2WON A;  4O55 A;  2YKN A;  3ZT3 A;  1W0H A;  4YNQ A;  4CF8 A;  1CZ9 A;  4DTN A;  3QES A;  2PYL A;  2YNI A;  4C8M A;  3SV3 A;  1G15 A;  1VRT A;  4M45 A;  1D9D A;  3KLI A;  4O44 A;  1GOA A;  4TSX A;  3HXM A;  4KHN A;  4OLB A;  2WOM A;  4HUF A;  3LZJ A;  3TAE A;  2A1R A;  4FYD A;  3VQQ A;  2X74 A;  1LAW A;  4DMN A;  4DTX A;  3QNO A;  2BAN A;  3NH2 A;  4K8Z A;  1VK0 A;  3SNN A;  3KIO A;  5T7B A;  4OVL A;  4EZ6 A;  3CM6 A;  2HNZ A;  3ASM A;  5HLF A;  3RMC A;  2RKI A;  1NK9 A;  4F4K A;  1ASU A;  3AVI A;  3DI6 A;  4KHW A;  1ITG A;  2FBV A;  4N5S A;  3QIO A;  4W5R A;  1KCF A;  5I42 A;  1RT7 A;  4CJ4 A;  2BE2 A;  4FJJ A;  3TR8 A;  1UWB A;  4CJW A;  1D5A A;  3VQ7 A;  3B6P A;  1KFD A;  4AHR A;  5KTQ A;  3L8B A;  3AVC A;  2VWJ A;  3AVN A;  2Z1I A;  4Z0U A;  2RN2 A;  1RBU A;  1T05 A;  1QSS A;  3IAY A;  3NF8 A;  2P5O A;  1KTQ A;  4M3U A;  4CER A;  1NKE A;  2DTU A;  1RTD A;  3NDK A;  4CK1 A;  3OYJ A;  4MQ3 A;  3EY1 A;  1T7P A;  4DQQ A;  4JS4 A;  3TAR A;  4I9Q A;  3S3M A;  3O3F A;  4OGC A;  4AIL C;  3ULD A;  2VG6 A;  3AA5 X;  3P83 D;  3CFP A;  2OZS A;  3AO4 A;  3L2R A;  3FFI A;  4CEF A;  3C6U A;  3ISN C;  3QEX A;  2P51 A;  1RBT A;  4HCC A;  3AVL A;  1ASV A;  3VQE A;  4DSJ A;  4B9S A;  4Z4C A;  1Q8I A;  4Q0B A;  1EP4 A;  2RF2 A;  5CY4 A;  4NYN A;  3TAN A;  4CEB A;  3SQ2 A;  4FCY A;  3RMD A;  1NK4 A;  4B9T A;  3L3U A;  4C8N A;  3KK3 A;  4W5Q A;  4FW1 A;  4DTR A;  1BCM A;  1S6P A;  2FBT A;  3VQB A;  3ZSZ A;  4FLY A;  3K5O A;  4N41 A;  3I0S A;  4OLA A;  4CF1 A;  3NH1 A;  3KLG A;  3MEC A;  2I5J A;  3K5N A;  4IG0 A;  3VA0 A;  2XHB A;  1BQM A;  4FZY A;  2F8S A;  2B4J A;  3OJU A;  3V9W A;  3JSM A;  4M41 A;  3NCI A;  3F73 A;  4M3Y A;  1XWL A;  4PY5 A;  2IOC A;  3LAN A;  3SV4 A;  2GUI A;  1IKW A;  4FK4 A;  4KHU A;  3VQD A;  4CJ3 A;  3HST B;  1QTM A;  2IS3 A;  3PUF A;  4KTZ A;  3AVK A;  4KPY A;  5E41 A;  5FRN A;  5CYQ A;  2F8T A;  2JLE A;  2X6S A;  3KK2 A;  2IGI A;  1T03 A;  3DLK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...