3LP3A

P15 hiv rnaseh domain with inhibitor mk3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
SYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords p15
publication title Structural basis for the inhibition of RNase H activity of HIV-1 reverse transcriptase by RNase H active site-directed inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 37
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lp3A00
1XWLA 1U4BA 3JYTA 1KVBA 1EX4A 4FLUA 3OJUA 3KLGA 3SCXA 4W5OA 1O1WA 3OYHA 3NGYA 4LD0A 2G8VA 3ZSZA 3P83D 3QINA 4PA1A 4O44A 4AHSA 3HJFA 2RKIA 1CZBA 3RMBA 4E7KA 3LPTA 2IS3A 3WNEA 4CE9A 4CGGA 4DF4A 4DWIA 5FRNA 2HHSA 5CZ1A 4PUOA 1RT4A 3K57A 4DFMA 1TK5A 4AH9A 4CJ5A 2KZMA 4RW6A 1T7PA 3CM5A 3VQDA 4E3SA 1JL2A 3L2VA 4DTRA 3PX4A 1I39A 4F8RA 4CCHA 5I3UA 4KB1A 3AV9A 4FLXA 2IOCA 3C6TA 1X1PA 4M45A 3SI6A 3IS9A 4JRPA 1VSJA 4CJQA 4IG0A 4CK2A 3QESA 3U3GA 3O4QA 3B6PA 1KCFA 4CJTA 2D0BA 1XHZA 3RRGA 2QK9A 1BL3A 1RNHA 1WN7A 1S6PA 1TVRA 5CZ2A 3KLEA 3IRXA 4E7JA 1VSKA 4KV8A 3VN5A 1QE1A 1RDBA 1GOBA 4CEOA 1S1TA 3D0PA 3T19A 4Z4FA 2HHTA 4OVLA 4N5SA 2PZSA 1NJWA 3RR7A 1HYZA 3V9SA 1B9FA 3QETA 1LWFA 3ZT3A 3AVIA 2QXFA 4QCLA 4LSNA 3QEPA 2B4JA 1LW2A 1L3TA 1RTJA 4Z4CA 3SNNA 3NF9A 4IFYA 4RW9A 1NK9A 3ZSVA 1L5UA 1U48A 4B8CA 5CYQA 4FLVA 1RT1A 1VSFA 4EP4A 1S6QA 3HXMA 4LY7A 1S1WA 1KLMA 1C0MA 3ULDA 4DQQA 4DTPA 4FJGA 4FK4A 1JLGA 2ATQA 2O4IA 1NKCA 3SQ2A 3VA0A 1T8EA 4OPJA 2W42A 3CYMA 3NH0A 4H8KA 4FZYA 4N47A 4C8KA 4PQUA 1YTAA 2RF2A 3QNNA 3SPZA 2R7YA 4DMNA 1SKSA 4Y1DA 2GBZA 4I2QA 1XC9A 2OA8A 4OLBA 4OLAA 4DU1A 3EY1A 3LDSA 1BIZA 1DLOA 3NBPA 2BDPA 4KTWA 3LAMA 3VQPA 2XO7A 3U3YA 1WAJA 3KD5E 4KB0A 2QKBA 3WNHA 2YHAA 4C8NA 1TK0A 2E4LA 2IDOA 4K8ZA 2OPPA 4EZ9A 4DQPA 2XY5A 4DSKA 2XHBA 2KFZA 3HSTB 1HPZA 4DFPA 1SL2A 1WAFA 1VSEA 1NKEA 4E89A 3RTVA 3QEIA 3KTQA 4B9LA 4CFBA 3VQ4A 4M41A 2O4GA 2RN2A 2WONA 4FM0A 5J2NA 2DFHA 4N41A 4CF8A 4I2PA 1VSMA 4TSXA 5HRRA 1BQNA 4Z0UA 3EZ5A 2FBVA 4CEFA 3AA5X 2D0AA 1ZBLA 4FJLA 3AVGA 4CJ4A 4DQIA 1NJZA 1BCOA 2OZSA 3DLGA 3PUFA 1C1CA 1FKPA 4KKOA 4CJEA 4G1QA 4CJ3A 3NH2A 4DS4A 1UA1A 3AVBA 4HUFA 3E01A 3TWHA 4FCYA 4BDPA 1S1VA 3DRSA 4FJ5A 4BE1A 3OYMA 1S9GA 2XY8A 3AVAA 3DOLA 3DLBA 3AVJA 4LSLA 1T03A 4OKEA 1Z25A 3OYIA 1IKYA 3VQ7A 4RW7A 4DSEA 3HL8A 3O4NA 4IBNA 1K6YA 3C95A 1QTMA 4C8OA 4KHYA 5E41A 1WSEA 2ZQBA 1NOZA 1JL1A 5C24A 1J9AA 3TAGA 1YTUA 3DI6A 3F9KA 4JS5A 1JLEA 2OPSA 1FK9A 2ZD1A 3TAMA 2XRIA 3SUQA 4ELUA 5FDLA 1QSYA 2VG7A 1KVCA 3VQ5A 1RBVA 1LWCA 3NHGA 4NYFA 1RTHA 1IKXA 4DQRA 3QEVA 4FJJA 4W5QA 1TL3A 3M8QA 5K14A 3VQCA 3L2QA 1B9DA 3VQ6A 5HRPA 3HM9A 3OJSA 3HPHA 1HYVA 3MAQA 3F73A 1UA0A 3AVMA 1HNIA 2BANA 4DTSA 4FJXA 3L3VA 3L8BA 1L3UA 1TAUA 3KKRA 4N56A 1WSIA 2B6AA 3ITHA 4DU4A 4CEAA 1RDDA 1Q9XA 4KHSA 4IDKA 2G8KA 1TV6A 1A5VA 3AO1A 5C42A 1U47A 1W9HA 3B6OA 5HP1A 1R0AA 4Z4HA 4M3YA 2HHQA 1UWBA 3I0SA 5C25A 4DSFA 3V4IA 3SUPA 4DSLA 2EX3A 4CHQA 4XIUA 1GOAA 1LAWA 2KW4A 3AO5A 4DQSA 3V6DA 4FJIA 2F8TA 4CGHA 4AHUA 4FLWA 4AILC 3LAKA 4CJUA 4FVMA 1TL1A 4AHVA 3L2UA 3DLHA 2YNIA 4OKKA 3HP9A 2HW3A 3OS0A 3RMAA 3THVA 3NF7A 1SUQA 3TAEA 3PO4A 2DY4A 3HPGA 2PYJA 4R5PA 1A5WA 3ZSWA 3DRPA 3KK3A 4CEBA 2FBYA 3PV8A 3SUNA 3HYFA 2VWKA 4M42A 3ALYA 3OYFA 4ZTJA 2IC3A 5KGXA 1JLCA 3V81A 4J2AA 1L3SA 1VRTA 4O4GA 2X74A 4CF2A 2F8SA 1WNSA 1RBUA 2BE2A 2G8HA 4KRFA 1NK4A 4FJHA 3M8RA 2HMIA 3RWUA 2P5GA 3AO4A 4ICLA 5SZTA 4B8AB 1SKWA 4OGCA 4IG3A 3O3HA 4FM1A 1BI4B 4NCBA 3ASMA 4DLGA 3ZT4A 1RTDA 2DFEA 3DMJA 3VQAA 3SV4A 2ITGA 1JKHA 3ZT1A 3OS1A 3CFPA 4EZ6A 3I0RA 2D5RA 3AVFA 2VG5A 1Q9YA 4W5RA 4B9MA 4KHQA 4PY5A 3QEWA 4N76A 4KFBA 3HVRA 2KTQA 3OYAA 3AO3A 3S9HA 4DSJA 3O3GA 4B3OA 3V1OA 4DF8A 5HLFA 1LV5A 1KFSA 3OYLA 3HP6A 3NGIA 3LP0A 3OY9A 4QAGA 1X9SA 1SL0A 1BQMA 4KREA 1WSFA 3L2WA 1YT3A 1NJXA 4HCBA 2VWJA 2YNGA 3L2RA 1RDAA 3NFAA 3ZSOA 4E19A 4K8XA 4JRQA 3QIOA 4DTOA 1CXQA 5DK5A 4CGDA 4MFBA 3DYAA 4CIGA 3K58A 4NYNA 4KI6A 1C0UA 1S1UA 1UOCA 2G8UA 4ELVA 3SJJA 5D3GA 1CZ9A 5CYMA 1N6QA 4L8RB 5FRMA 1C0TA 3NAEA 1HQEA 1TKZA 3ISNC 2AJQA 4E1MA 4BDYA 1RILA 2GV9A 3NF8A 4DTMA 4MQ3A 1FXXA 4E0DA 3P5JA 3KK1A 3LP3A 4CFDA 3CM6A 3OYGA 1ZYQA 3MECA 2KQ2A 4NCGA 1Z26A 4CJSA 2HVIA 2KZZA 5KI6A 1F21A 3V9ZA 4FLTA 1RBRA 1IG9A 2KFNA 1ASWA 5SWMA 4YFUA 4PWDA 4C8LA 3KD1E 1WSHA 3V1QA 4GW6A 1J53A 3MXJA 2P1JA 3ZSYA 4DS5A 4M3ZA 4FYDA 4IFVA 4FZZA 4GMJB 1FKOA 3HVTA 4I9LA 1J5OA 3S3NA 1WSJA 2Y1IA 2YV0X 4C8MA 3NDKA 1TKTA 3AVLA 2HVHA 3CG7A 4LH4A 3CFOA 5KGWA 2Z1JA 3AA2A 5J1EA 4F3OA 1BGXT 1KVAA 2IAJA 4CF1A 5KRSA 1NKBA 1S1XA 1BI4A 3DLRA 1HNVA 5HRSA 1TKXA 1NK5A 4NCAA 2HHWA 1U49A 1ITGA 2EHGA 1UAXA 1RT6A 2D0CA 2HNYA 4CHOA 4CJKA 4JLHA 3IG1A 3OYKA 2G8WA 4CECA 2DFFA 1C1AA 3AVCA 3OYNA 4ZHRA 5J2PA 1BIUA 4AHCA 3VA3A 4H4MA 4FK2A 1MU2A 1LAVA 4FLZA 4FZXC 4UQGA 2FBXA 4CESA 4M3XA 3CFRA 4M3UA 1HQUA 3QIPA 1JLQA 1QHTA 4ELTA 4KPYA 1HMVA 4BWMA 2OZMA 3AA4A 4FLYA 1C6VA 1A5XA 2Z1IA 4F4KA 4M3WA 2VG6A 1IKWA 3OVNA 4CJLA 1W0HA 4HUEA 4DFKA 4I9QA 4Q0BA 1VSLA 3NCIA 3SPYA 3ZCMA 4KHUA 3DLKA 4O5BA 4HCCA 3TARA 3G10A 3HT3A 3T1AA 4AHRA 1YVUA 1RT7A 4EP5A 4KTZA 4DTUA 4B08A 4OKJA 2B5JA 4KAZA 4CIFA 3WNFA 4CHZA 1XHXA 4ID1A 2JLEA 4O0IA 4YNQA 1NJYA 2LSNA 3K59A 1SKRA 4CGIA 1TGOA 4DTNA 1X9MA 3KJVA 5JS2A 2X78A 4CF9A 3IAYA 1I3AA 4O55A 3WNGA 1U45A 2Y1JA 1NK6A 4CJWA 2DTUA 4J2BA 1BHLA 4CIEA 3K5LA 3I8DA 4DTXA 1KLNA 3EYZA 3KKSA 2HNDA 2HNZA 3AVKA 3VQQA 1QQCA 3DM2A 3AO2A 5T7BA 1VK0A 5KTQA 1L3VA 1N5YA 2YNFA 2XY6A 3TANA 3LANA 2X6SA 1G15A 1U04A 3MXIA 1D5AA 1TK8A 2P5OA 1QSSA 3PX6A 4CF0A 4OPKA 1JXEA 2E6LA 4OGEA 3SUOA 1C1BA 4DSIA 4FXDA 4FJ7A 3KLHA 2Z1HA 3NE6A 1HJRA 2HHVA 3BGRA 4CFCA 3SV3A 2Z1GA 5HROA 3C6UA 4RW4A 3VQBA 3JSMA 4B9NA 4WE1A 2WOMA 4FJKA 3V1RA 1RCHA 4CHYA 2OPRA 3OYCA 4CEEA 3VQEA 3AA3A 3V9UA 3V9WA 1IKVA 3D45A 4DFJA 4Y1CA 3C94A 3KIOA 2YKMA 2P51A 3SZ2A 3SYZA 3V9XA 1X9WA 4Z4EA 3QEXA 1WLJA 1BCMA 1RT2A 3S3MA 1TKDA 2E6MA 1KSPA 1VRUA 1DTQA 3QNOA 4Z4GA 3K2PA 4DTJA 1B92A 1D9FA 4CJPA 3UIQA 4FJNA 3PO5A 4GVMA 2IGIA 1IH7A 4FM2A 4FK0A 1KTQA 1XI1A 4FJMA 4LH5A 4RG8A 2PY5A 4CGFA 3K5NA 2ZE2A 1Q8IA 1ZBUA 4CEQA 3TI0A 4F2RA 3HK2A 2PYLA 3VQ9A 3OYDA 1NOYA 4KI4A 4BACA 4BWJA 1JLAA 3HO1A 2GUIA 4DU3A 5JS1A 4ID5A 3T3FA 3M8SA 1DTTA 3SQ4A 1HRHA 3M8PA 3QLHA 2BGGA 2FC0A 1QS4A 3A2FA 3VQ8A 4CGJA 3TAQA 1NK7A 4B9TA 4KHNA 4F3TA 4QOZB 1JLBA 1VSIA 1GOCA 4CJRA 4J2EA 2F96A 3DLEA 1T05A 1REVA 3OS2A 4BE2A 4FW1A 4KHWA 1BISA 3OYJA 2Q3SA 3ZT2A 3NF6A 4CERA 4BDZA 3TAPA 2A1RA 3HPOA 3MXMA 1JLFA 3G0ZA 3MEDA 3ZSRA 4CK1A 1RBTA 3DOKA 1EKEA 1SV5A 4CJVA 4E7IA 2QKKA 2YKNA 3ZSQA 1KRPA 4AHTA 4HHTA 1RBSA 3LP1A 3RR8A 3MEEA 2OPQA 4KTQA 2RPIA 4O0JA 2FBTA 2HHUA 4CFAA 3S3OA 3K5MA 1NK8A 1QSLA 5EU7A 4E1NA 1NK0A 3TAFA 3BDPA 4OJRA 4J2DA 2OYQA 3TR8A 3LZJA 2NUBA 1EP4A 3ZSXA 4E7HA 4B9SA 1VSDA 5DMRA 4RW8A 3MEGA 4CJFA 3RRHA 1VSHA 3O3FA 1ASUA 2X6NA 2YHBA 5CY4A 5FROA 3AVHA 1RDCA 3LPUA 5HRNA 3NGZA 5J2MA 5J2QA 4H4OA 1HYSA 1CLQA 1RT5A 1CXUA 1ASVA 4KO0A 4CHNA 4BE0A 1D8YA 4FJ8A 3LWMA 2ETJA 3P1GA 3U6FA 3KLIA 4M3TA 4W5NA 1J54A 4FW2A 4M3RA 1LWEA 1S5JA 4B9UA 3RMCA 2G8IA 3TABA 3LWLA 3NH1A 4ZTFA 4F2SA 3QERA 3LZIA 1JXBA 3ZT0A 4E7LA 2XY7A 2A1SA 4CHPA 4FJ9A 1EXQA 5KRTA 2I5JA 4CEZA 3RMDA 1KFDA 1RTIA 1TAQA 4JS4A 3H08A 4CK3A 1ZBIA 4B9VA 1S9EA 3KLFA 4Q5VA 3SQ0A 4I7FA 1EETA 3QO9A 5I42A 1WSGA 1IO2A 3DRRA 2JGUA 2YNHA 4HVJA 2HHXA 3AVNA 4HUGA 3OYEA 3K5OA 3PX0A 3OYBA 3KK2A 1Y97A 3LP2A 1ZBFA 4Z4IA 3L3UA 4W5TA 3CQ8A 4HTUA 5HBMA 1ZBHA 2G8FA 4IKFA 4DLEA 3SQ1A 3LALA 1SL1A 3PY8A 4DG1A 1RT3A 2HB5A 1D9DA 1LW0A 3FFIA 4CEDA
chains in the Genus database with same CATH superfamily
4C23A 3DLLL 3JYTA 4FLUA 3SCXA 4LD0A 4CVNE 3QINA 4AHSA 2AJQA 1CZBA 1DGKN 4E7KA 3MCPA 4CGGA 4DF4A 3GE1A 5CZ1A 4AH9A 3CM5A 2A42A 2FF6A 3VQDA 4E3SA 1JL2A 4ISGA 3PX4A 3B8AX 3PIPL 4M45A 4BQLA 3SI6A 3IS9A 1VSJA 4CJQA 4IG0A 3MN7A 3EO3A 3EE8A 4FL9A 1RNHA 1S6PA 2P9LA 4G9ZA 4E7JA 5AZIB 4H5RA 3D0PA 1S1TA 3RR7A 2PZSA 4BRKA 3ID6A 3L4QA 2QXFA 2B4JA 1SQKA 5EY4A 1VAZA 4RW9A 3VEXA 4LY7A 5AZJB 3TSUA 3VGKA 2W6LA 2ATQA 2O4IA 1NKCA 3HOTA 1T8EA 4OPJA 3CYMA 4H5TA 3NH0A 4H8KA 4FZYA 4C8KA 4H03B 3SPZA 4OLBA 1SKSA 2GBZA 4I2QA 4RWTA 1BDGA 1EQYA 3NBPA 3KD5E 3EE9A 2YHAA 4IEEA 2E4LA 3PLAA 4EZ9A 3ENBA 4DQ8A 5AQXA 2F9TA 2KFZA 3HSTB 3I56N 5AQGA 1HPZA 4DFPA 4KAZA 4B9LA 1NKEA 2O4GA 2RN2A 4FM0A 4JHDA 4N41A 5AQVA 3MN6A 4TSXA 3TU5A 5GADP 3EZ5A 2FBVA 1ZBLA 3VEOA 3O08A 1NJZA 5KQ8A 4NLBA 1C1CA 4B1YB 4G1QA 4DS4A 1UA1A 1DKGD 1YF5L 1HX1A 2P9NA 3DLBA 2XY8A 5AQLA 4DV4K 2PFUA 3OYIA 4RW7A 4DSEA 3KHYA 1K6YA 1QTMA 5GAEP 5M1PA 1WSEA 2NRHA 2ZQBA 3FZKA 3HOSA 1J9AA 3TAGA 4AF1A 3DI6A 2NLXA 3CF5L 4B3MK 3F9KA 4JS5A 2ZD1A 3TAMA 4ELUA 2VG7A 1KVCA 3VQ5A 1OH6A 1LWCA 4K25A 2YCHA 3CJBA 3T1YK 3IFRA 3VF2A 1SAZA 5HRPA 3OJSA 3F73A 2O8CB 3AVMA 4DTSA 2BANA 3KKRA 4N56A 4DV5K 2ZGZA 3ITHA 4DU4A 4CEAA 1RDDA 4OX9K 1TV6A 1A5VA 2EWSA 3DXKB 5C42A 1W9HA 5KQDA 3I0SA 3P39A 4L3QA 2F8TA 4DQSA 4FVMA 4JKFA 4CBUA 1SUQA 3R1XA 2PYJA 3SUNA 3DRPA 3M3ZA 3PV8A 4DV2K 1T3VA 3ALYA 4GVEA 5JLHA 1OH7A 1JLCA 2QWOA 1VQON 1GLJO 1YVNA 3QFUA 1VRTA 3PIOL 5BN8A 2BE2A 4BGAA 4KRFA 1QVGM 3F5TA 3RWUA 3AO4A 1VQMN 4B8AB 1SKWA 1BI4B 1KXPA 5AFUH 1RTDA 2DFEA 3VQAA 1EO1A 4BC2A 3OS1A 3CFPA 4W5RA 2P9PA 2QWQA 2HOEA 4N76A 4KFBA 3HVRA 2KTQA 5IWAK 5BN9A 3KK7A 3O3GA 4PKHA 1LV5A 5HLFA 3HP6A 3NGIA 4QAGA 1X9SA 1BQMA 3VF4A 4H5WA 3D2EB 2VWJA 3BF3A 1RDAA 4E19A 4JRQA 2QTDA 5E26A 4MFBA 3DYAA 4CIGA 4C1NK 1NNEA 2G8UA 1C0FA 3SJJA 2I7PA 3AAQA 4OPAA 3W3DA 1N6QA 5FRMA 1C0TA 2HBJA 4BDYA 1NMDA 3NF8A 1FXXA 4YHHK 3U9DA 3MECA 4IO9L 4NCGA 4CJSA 2WFBA 1G99A 5KI6A 3V9ZA 3NVKA 1RBRA 5CHIA 1IG9A 2QW9A 4JV5K 1QQNA 4YFUA 1OH8A 3CCEN 3GOIA 4DR6K 1XC3A 1X3MA 4A5AA 4RTFD 4GMJB 4JI4K 1FKOA 3HVTA 2YV0X 3AVLA 2HVHA 3PSIA 5J1EA 3J8AA 4WQ5C 1W7AA 1NJIO 1RFQA 3DLRA 3W0LA 1NK5A 2V7YA 4CHOA 3OYKA 4MLHA 4ZHRA 4BRNA 5BREA 1VQKN 4FLZA 2W41A 4FZXC 4UQGA 2FBXA 3WT0A 4CESA 2CGLA 4ELTA 5LMUK 4DV1K 5FPNA 1XQSC 3CCUN 2ASOA 4DR2K 4E1JA 3SAHA 3CMEN 3LDPA 4F4KA 4M3WA 1IV0A 2VG6A 3VPZA 3OVNA 3D2FA 1VSLA 2D0OA 3NCIA 4HWIA 5F0XA 4HCCA 3TARA 3HT3A 4AHRA 1RT7A 4EP5A 4I6MA 2GTDA 5AQNA 4M63C 2A6AA 2E20A 3NVMA 4CIFA 3BF1A 4CHZA 1XHXA 4WYBA 3GL1A 4A59A 4H0OA 4FWRA 3U9ZA 3G25A 3JAMO 4A61A 1E4GT 1X9MA 3VMFB 4GKKK 1ZC6A 3KJVA 3IAYA 2CH5A 1I3AA 4O55A 1NK6A 2Y1JA 4CJWA 4DTXA 1KLNA 3BY5A 3KKSA 1JJ2M 5AQZA 5C0YA 2O8BA 3CJ7A 4NB4A 2XY6A 3TANA 1U04A 3JXUA 3AY9A 1TK8A 4CF0A 3SUOA 1JXEA 4ISEA 3HZ6A 1C1BA 3EKSA 1HJRA 5LL6Z 3NE6A 2HHVA 4CFCA 4B9NA 3C6UA 4DR4K 3P4IA 1EWQA 3H3NO 4CEEA 3VQEA 1IKVA 2Q97A 3D45A 3HBTA 1GLAG 3DJCA 3VEVA 3SYZA 2KKZA 3MN5A 4IJAA 4CZHA 5JMVA 4KHPK 5AQQA 5AQUA 3CPEA 4O8UA 2QWMA 1ATNA 1B92A 5FPMA 4CJPA 1HKBA 4EFHA 4Y0WA 2YX6A 1YXQA 2PY5A 4CGFA 2CH6A 3K5NA 4CEQA 4CZEA 3TI0A 2O8EA 5AQWA 5LJVA 5BRDA 4KI4A 3OYDA 4BWJA 2FSNA 1JLAA 2Q1NA 4BVOA 3DAWA 4YORA 2VGMA 5JS1A 4DU3A 2A3ZA 3M8SA 3WXIA 3QLHA 4QOZB 4B9TA 4YOYA 3MK6A 4CJRA 4J2EA 4PKIA 3DLEA 4BE2A 4FW1A 5ELZA 4KHWA 3ZX0A 4PL7A 2Q3SA 4BDZA 3K9KA 3NF6A 3G0ZA 3MEDA 4B1VA 4CJVA 2O8BB 3ZSQA 1KRPA 4AHTA 4HHTA 3AARA 4RCHA 5AQFA 3RR8A 3UB5A 2HHUA 2FBTA 3S3OA 4LFCK 2YHYA 5EU7A 4E1NA 3VEWA 3O9TA 4J8FA 5EXWA 3BDPA 3P38A 3BEXA 1EP4A 4B9SA 1KAXA 1VSDA 1VQ4N 3CC2N 3MEGA 2HBLA 4B3SK 1Q82O 1BA1A 3MX2A 1GLDG 4JK8A 4FPBA 1OKJA 1RT5A 1NGFA 4KO0A 4CHNA 3CC7N 1NGHA 3MX5A 4W5NA 4M3RA 3LWLA 4ZTFA 4F2SA 4IDHA 2UXDK 2P9IA 1JXBA 4E7LA 1VQPN 4BGBA 2I5JA 2O8EB 2VYPA 3CQYA 4I7FA 5I42A 1IO2A 3VTIA 2JGUA 5E84A 4HVJA 2HHXA 3AVNA 3WQTA 4QS8A 3FFKB 4JD2A 4Z4IA 4W5TA 5HBMA 4IKFA 1NGIA 1U4BA 2E2NA 4YOWA 3OJUA 3KLGA 2Q31A 1R59O 3H1QA 3LPTA 2UUBK 4H0XB 3QICA 4BC5A 1TK5A 4CJ5A 3BUZB 3O1BA 4DTRA 3THWA 4CCHA 5I3UA 3C6TA 4NO7A 4CK2A 3GDQA 3QESA 3BZCA 2D0BA 1BL3A 4WQ4A 4FVUA 1H1VA 3GG4A 3IRXA 4JKGA 4KV8A 3VN5A 4CEOA 3T19A 2P9IB 4N5SA 1NJWA 1HYZA 3QETA 1NM1A 2OCEA 1LWFA 3QEPA 5C2FA 1LW2A 5AQHA 5ADXH 1NK9A 3ZSVA 4B8CA 4FLVA 2ZM6K 1VQ6N 5CR4A 5EVZA 1HNZK 1S1WA 3ULDA 4DQQA 4FJGA 5MLCQ 4XH5A 2NNWA 3MMVA 4JD2B 1K9MO 4IOCL 2HSTA 1V4TA 4BRHA 3ZYYX 3CC4N 4PQUA 2RF2A 2V51B 2R7YA 2O8FA 4Y1DA 1RGIA 2OA8A 3C6HA 1BIZA 3VQPA 3LAMA 4KB0A 1WAJA 2GUPA 3IDHA 4C8NA 1TK0A 4K8ZA 1X3NA 3F9MA 3LM9A 2H3GX 2QEXN 2VWBA 3RTVA 3KTQA 4DR3K 4CFBA 4M41A 2DFHA 1RDUA 4CF8A 5F1XA 1IG8A 1QHAA 5HRRA 3A8YA 5C2DA 2D0AA 2OZSA 3DLGA 3OA9A 3PUFA 4CJ3A 3E01A 4BDPA 3OYMA 4CI6A 1VQ5N 1MWMA 1Z25A 3C0BA 3VQ7A 4JKGB 4IBNA 4C8OA 3C95A 4KHYA 1NOZA 5C24A 4M7YA 4WF9L 2Q36A 2OPSA 4BY9C 2XRIA 1QSYA 1NBWA 4NYFA 4FJJA 2OANA 1TL3A 4IFEA 3E9LA 3M8QA 4BQZA 5K14A 3VQCA 3L2QA 1S72N 4LF4K 4XH4A 3HM9A 1HUXA 3F2KA 2FSJA 1GLBG 3T7ZA 3L3VA 1L3UA 1TAUA 5GIPA 4H0PA 2YHXA 3I8BA 2G8KA 3A5NC 3AO1A 2GX9A 4JN4A 1U2VA 1U47A 2VQFK 5HP1A 1R0AA 4LF7K 3R8EA 4M3YA 2HHQA 1UWBA 1X9JA 3V4IA 2V52B 1YI2N 4DSLA 2EX3A 1M1KO 1GOAA 1LAWA 4AILC 2FSKA 3LAKA 3DLHA 3EZWA 3RMAA 3THVA 3NF7A 3HPGA 3ZSWA 3LDQA 3KK3A 4CEBA 5AQTA 2VWKA 2RE2A 3OYFA 4JI3K 3V81A 4ILGB 1L3SA 4J2AA 4DR7K 4O4GA 4B1UB 2F8SA 1MDUB 4YDUC 4FSVA 5AQSA 1NK4A 5M1NA 2HMIA 4JI6K 4WFBL 4ICLA 4FM1A 3TTDA 2NRZA 3ZT1A 3SK3A 3I0RA 4K0KK 2D5RA 3AVFA 5AQIA 1NMNA 3QEWA 4FWLA 3AO3A 3FGUA 3S9HA 3V1OA 3VERA 1NGJA 1P90A 3J7YP 1NGGA 3H3OB 1E3MA 2O8CA 5GAGP 4DUZK 3QIOA 5B8HA 1NGEA 1U2VB 3DXKA 1C0UA 2NRTA 4CD1A 5DM6L 4GKJK 4LF8K 4L8RB 3NAEA 1TKZA 1RILA 2GV9A 4DTMA 1N32K 3LP3A 2KQ2A 4R79A 4JK9A 2HVIA 1F21A 2PAVA 4FLTA 2KFNA 2ZJRL 1HNWK 4GV9A 4BRQA 5JICA 1WSHA 4GW6A 2O8DA 3CJ9A 3M6GA 1HNXK 4IFVA 4FZZA 3NMUA 4DKWA 4BRPA 1J5OA 3A5LC 3NDKA 4C8MA 1TKTA 3CG7A 3CFOA 2Z1JA 4B1WB 1K8AO 2GWJA 4CF1A 4B3RK 1S1XA 1BI4A 3C6AA 2HHWA 2HNYA 3O8MA 2D0CA 4CJKA 1SS6A 1LCUA 3AVCA 3L6QA 3C7NB 3VA3A 1NGAA 2BH1A 1MU2A 5AQRA 3O9RA 4M3UA 3QIPA 4DB3A 1W2BM 4KPYA 2ZGYA 1QZ5A 3KVGA 3D2EA 1D4XA 3LDNA 4BWMA 5FPDA 4FLYA 4Z94A 1NGCA 4O8KA 4DFKA 1W0HA 4I9QA 3DLKA 3E1YA 3T1AA 3O80A 1YVUA 3TSQA 2IVOA 4KTZA 4DTUA 4OKJA 3OBYA 1XMOK 3ENHA 4O0IA 4LF6K 5BRHA 1TGOA 5KPTA 4H0VB 2DTUA 1BHLA 3K5LA 2O8DB 3EYZA 2HNDA 2HNZA 4DCHA 4BVPA 5KTQA 1L3VA 2UU9K 1YHQN 2YNFA 4FWPA 1G15A 3MXIA 1D5AA 3QMLA 4OPKA 4OGEA 2E6LA 4DSIA 1J6ZA 4XEIA 3KLHA 5LY3A 3UE5A 5C15A 4RW4A 3JSMA 2WOMA 2QWPA 5GIOA 3TPQA 3OYCA 3V9WA 4DFJA 4IJNA 1WLJA 5M1QA 4CBWA 3S3MA 2E6MA 4ISFA 4WCEL 2W40A 3CIPA 4FJNA 4OPHA 4B1XB 2IGIA 1KTQA 1XI1A 4FJMA 4LH5A 4DR1K 3HK2A 1NOYA 3CHWA 2D1KA 4AM6A 4JI2K 3HO1A 2GUIA 3VGMA 3T3FA 2BGGA 2HMPA 1IBKK 1NK7A 5A2QO 5LMNK 1JLBA 1VSIA 2AA4A 1REVA 2CGJA 4YOVA 4BRDA 4BR5A 4E7IA 1XNQK 1VQ8N 1QQMA 1BG3A 4BG9A 3MEEA 1S22A 2OPQA 4KTQA 1ILYA 2UYTA 4QS9A 3K5MA 3CJ1A 1DEJA 5LJWA 3THYB 4J2DA 4V19S 2OYQA 4BR2A 3R6MA 5FPEA 4IOAL 4RW8A 1VSHA 3O3FA 1ASUA 5CY4A 4B9QA 3AVHA 4YY3K 3NGZA 5J2MA 4H4OA 1HYSA 1CXUA 4BE0A 3CPWM 1ZXOA 3CCRN 1OVQA 4DV3K 3U6FA 4FW2A 3AAPA 1NU0A 3QERA 2XY7A 2Q0UA 2A1SA 4FJ9A 4A5BA 1TAQA 4CK3A 4BRIA 3KLFA 1EETA 2YJFA 4LF9K 4BRCA 4JKEA 3OYEA 2V7ZA 3K5OA 3PX0A 2A41A 3OYBA 3LP2A 1ZBFA 2G8FA 3SAFA 3SQ1A 1VQLN 4DG1A 1RT3A 3FFIA 1XWLA 1KVBA 4XH1A 2NRWA 3J7AP 1O1WA 1Z05A 3OYHA 2G8VA 3ZSZA 4PA1A 4O44A 3HJFA 1JCFA 2IS3A 3EN9A 1FW6A 4DWIA 4PUOA 1RT4A 3WUHA 3J7ZO 2KZMA 4JK7A 3R3LA 4RW6A 3H6EA 3L2VA 2J4RA 1I39A 4F8RA 3J80O 4KB1A 3AV9A 5TKYA 2AP1A 4JRPA 4A2AA 1KD1O 2QA4N 4HTLA 3O4QA 3B6PA 1KCFA 3WXLA 3RRGA 4M7XA 5JLFA 4BR0A 1QZ6A 1TVRA 5CZ2A 1HLUA 1QE1A 1RDBA 4NXNK 4Z4FA 3CETA 1B9FA 3V9SA 4LSNA 1L3TA 2HF3A 1RTJA 3J81O 1U48A 1RT1A 1VSFA 4EP4A 1S6QA 4JAXA 1JLGA 3I55N 3SQ2A 1GLCG 4JKAA 2ZJQL 4N47A 3IKMA 1YTAA 3QNNA 4DMNA 4OLAA 3FE1A 4EAHD 1N34K 4DU1A 3EY1A 1HPMA 4KTWA 4DUYK 3HRGA 1JCGA 2XO7A 1BA0A 1I94K 4GY2B 2GWKA 4DQPA 4CZMA 4DSKA 2XHBA 1N36K 1WAFA 1VSEA 3WQUA 3VQ4A 5J2NA 2NRVA 2WONA 2F9WA 1BQNA 4Z0UA 3AA5X 4FJLA 3AVGA 1NG9A 5BPNA 4DQIA 2GELA 3O1WA 3MN9A 4KKOA 4CJEA 3U8XA 3AVBA 3TWHA 1Q86O 1S1VA 3DRSA 1S9GA 3AVAA 3DOLA 4JEPA 1IKYA 1SZ2A 3O4NA 2HBKA 3H45C 3G6EN 4ILJA 1YTUA 1TYQA 3CJCA 1JLEA 2E1ZA 1YITN 4BR4A 5AQMA 3CMAN 1RBVA 1RTHA 4DQRA 3QEVA 2UUCK 3O9SA 4BRAA 2QWRA 3I33A 3CXCM 1GLLO 3T69A 4B1ZA 2QXLA 1HYVA 3MAQA 5HL7L 2RHKA 1HNIA 3M1FA 4FJXA 1JCEA 1C0GA 1Q9XA 5DM7L 1WOQA 2QWLA 4Z4HA 5C25A 4DSFA 4WFNL 4CHQA 4XIUA 3V6DA 1BOTO 2KW4A 4FJIA 4FLWA 1T6CA 3PSFA 4CJUA 1TL1A 2HW3A 1HR0K 3OS0A 3TAEA 2DY4A 1A5WA 3HYFA 2ASMA 2IC3A 3KWGA 3N4QA 4ZTJA 3L0QA 2X74A 1GLEG 4CF2A 2YJEA 1WNSA 2JWKA 3SMSA 2ZWHA 3D6RA 1M90O 2P5GA 4BROA 4OGCA 4IG3A 3O3HA 4NCBA 3ZT4A 1TYQB 3DMJA 2ITGA 1JKHA 3EL2A 2VG5A 4B3OA 3OYLA 3OY9A 1SL0A 1NJXA 4HCBA 5KPZA 2YNGA 4K8XA 3ZSOA 2FF3B 5M1OA 3A5MC 1CXQA 4BREA 5DK5A 4CGDA 3K58A 1ZBSA 4KH6A 1HJOA 4ELVA 1S1UA 1UOCA 4KH4A 1CZ9A 3ISNC 1FJGK 1WBDA 2A5XA 4E0DA 4MQ3A 3P5JA 3KK1A 4CFDA 1ZYQA 3CM6A 4JI5K 2WUSA 4BRMA 1Z26A 2KZZA 2NRRA 3L4IA 1KQSM 4CBXA 2P9UA 3FZMA 5SWMA 4YOTA 5FLXO 3CI5A 4QS7A 3QFPA 2OTJN 4C8LA 3V1QA 4M3ZA 3MXJA 2P1JA 2I7NA 4X62K 1K8KA 2BUPA 2Y1IA 3Q7CA 4LH4A 4F3OA 3AA2A 4CW7B 4CZIA 2IAJA 4NCAA 2NZTA 2WC9A 1HNVA 1TKXA 1U49A 3O9UA 4JLHA 3IG1A 3VENA 4CECA 3OYNA 1C1AA 5JVHL 4FK2A 1LAVA 1NWKA 3O9QA 3CFRA 1TUUA 1JLQA 1QHTA 3SJHA 1HMVA 4AM7A 1EWRA 1LOTB 4U7BA 4DV7K 3AA4A 4BG8A 1C6VA 4CZFA 1Q18A 2Z1IA 3SAGA 1QQOA 4CJLA 3ENOA 4HUEA 4DHYA 4O5BA 1TUYA 2E1YA 4NXMK 3G10A 1OVYA 4B08A 3CCVN 2F4VK 2ZF5O 3WNFA 4ID1A 2JLEA 1NJYA 1SKRA 2P9UB 1ATRA 4CGIA 3E9PA 4LF5K 4DTNA 1VQ9N 4CJ7A 3KZBA 4CF9A 4FOEA 4K42A 1U45A 1IBMK 1ESVA 1YJWN 3LDOA 3RSEA 1K8KB 2QM1A 3AO2A 3DXMA 5T7BA 1N5YA 2X6SA 2P5OA 3PX6A 4WQ5A 3P31A 4H5NA 5F2RA 4FXDA 5AFUA 4MO4A 3FZHA 4FJKA 4WE1A 2ITMA 2OPRA 5BR8K 3C7NA 3V9UA 3VEZA 3C94A 3KIOA 2P51A 1X9WA 4Z4EA 1BO5O 3QEXA 1BCMA 1RT2A 3ZLJA 3QNOA 4LC9B 4Z4GA 3K2PA 3FR0A 1YJNN 3CCSN 1D9FA 4FOIA 3VTHA 1HKGA 3UIQA 2QWNA 3PO5A 4GVMA 1IH7A 4FM2A 4FK0A 1WB9A 4RG8A 4DR5K 4U67L 1Q8IA 3VQ9A 4LFBK 4BACA 4NLCA 2HF4A 3ZEUB 4UY8O 4ID5A 1DTTA 3VEYA 1QS4A 3VQ8A 4KHNA 4F3TA 3IUCA 1T44A 4AQYK 4FPAA 1T05A 4GV3A 4X65K 4MO5A 3HPOA 3MXMA 3ZSRA 5IT9O 1EKEA 3ATVA 3RSEB 2YKNA 3DXMB 3O6WA 3LP1A 4B3TK 4O0JA 5C12A 4KBOA 4CFAA 3ULEA 3R9PA 4JKHA 2OTLN 1NK0A 3TAFA 3G4SN 3HI0A 2A40A 3HSCA 3DWLA 3ZSXA 4E7HA 3WXJA 5DMRA 4CJFA 3RRHA 5H1SQ 3QBXA 4FWMA 4ILHA 2X6NA 1RDCA 3ZX3A 5J2QA 2KLAA 3A5OC 1IBLK 1WBBA 1ASVA 2P9LB 5C10A 4WQ4C 2ETJA 3P1GA 4M3TA 1J54A 2G8IA 1S5JA 4BRLA 3RMCA 1E4FT 4IO8A 4BRFA 3LZIA 5I9EB 2IVNA 4CHPA 1EXQA 4CZJA 5KRTA 3RMDA 1RTIA 1ZBIA 1S9EA 4Q5VA 3QO9A 1WSGA 3UKRA 2YNHA 3CCQN 4HUGA 4IXCA 3L3UA 4CZGA 1T6DA 1VHXA 1D9DA 2HBMA 1XNRK 5EOYA 1EX4A 4YOUA 4W5OA 4H0YB 4CZKA 3NGYA 3P83D 2RKIA 3RMBA 3WNEA 4CE9A 2ZJPL 5FRNA 2HHSA 4JHDB 3ULEB 1N8RO 2UUAK 4FWOA 3K57A 4DFMA 1Z6RA 2E2QA 1VQNN 2VCPA 1T7PA 3FLCO 3THYA 5CE3A 3K0SA 4DV6K 1GLFO 4FLXA 2IOCA 3SMPA 1X1PA 1YIJN 2P9NB 2FXUA 3U3GA 4CJTA 1XHZA 2QK9A 1WN7A 2UXBK 3KLEA 2NRXA 1VSKA 3CJAA 4H5VA 2HHTA 1GOBA 3OHRA 4OVLA 3OW2M 1QVFM 3CCLN 3ZX2A 3ZT3A 3AVIA 4QCLA 4Z4CA 3SNNA 3NF9A 4IFYA 1L5UA 3EKUA 2IIRA 5CYQA 4H0TB 3HXMA 5AR0A 4JI8K 4DTPA 1C0MA 1KLMA 3UKRB 4FK4A 3VA0A 2F7TA 3CERA 2W42A 2E5LK 3AGKA 1XC9A 3LDSA 1DLOA 2BDPA 3TTCA 3U3YA 2QKBA 1Q7YO 3WNHA 2IDOA 2OPPA 3WXMB 4X64K 1HKCA 4GV6A 2XY5A 1BU6O 4IEIA 1WUAA 5BPLA 1SL2A 4E89A 2KHOA 3QEIA 4I2PA 1VSMA 3ZETA 4CEFA 4CJ4A 4C1NI 1BCOA 1FKPA 3NH2A 4HUFA 4FCYA 1MWKA 4IWVA 4FJ5A 4BE1A 2D4WA 3AVJA 4LSLA 4WFAL 4OKEA 1T03A 4A57A 4JKBA 3HL8A 2P9KA 5AQJA 5E41A 1S3XA 1JL1A 3WEEA 1N33K 1YAGA 4K41A 1FK9A 2P9PB 3SUQA 4MLEA 1IJJA 5FDLA 5AQOA 1VQ7N 3NHGA 4FO0A 2VQEK 2ASPA 1IKXA 3A0IX 3E9OA 3OBWA 4W5QA 3SLCA 2Q2RA 1B9DA 3VQ6A 3IMXA 3HPHA 3MWTA 1UA0A 3L8BA 1WSIA 2B6AA 4PHTX 4JNEA 4KHSA 4IDKA 2Q0RA 3B6OA 3VGLA 3SUPA 4BRGA 3BZKA 3AO5A 4CGHA 4AHUA 4EHUA 5JVGL 5AQYA 3ZETB 2VGNA 3O5BA 2JWLA 4AHVA 2YNIA 3MCAB 4OKKA 3L2UA 3HP9A 1RDWX 3PO4A 3VOVA 4R5PA 1YUWA 2FBYA 4JKCA 5BPMA 4M42A 3AGRA 5KGXA 3KWIA 4BC3A 1KC8O 1RBUA 2G8HA 2QI2A 4FJHA 3M8RA 4BR9A 3FZLA 4YOXA 2P9KB 5SZTA 3TSPA 3WEEB 4BC4A 4JYAK 3ASMA 4DLGA 5BR9A 3CCMN 2YHWA 3SV4A 1DT9A 4OO1J 4EZ6A 1Q9YA 4B9MA 4KHQA 4PY5A 1XUPO 3OYAA 4DSJA 5ADXA 1XMQK 4DF8A 1KFSA 4FWSA 3LP0A 4KREA 1WSFA 3L2WA 1YT3A 3QBWA 3LL3A 3VETA 3L2RA 3NFAA 2W6KA 4DTOA 3D2FB 2E2PA 4NYNA 1J5EK 4KI6A 4IZ9A 5D3GA 3D7EO 5KPRA 4A2BA 5AQKA 5CYMA 4I6MB 4CD3A 1HQEA 1NLVA 3SBGA 4E1MA 5EX5A 1YJ9N 3OYGA 2DPNA 3LDLA 2HHHK 2P9SA 2WBNA 1ASWA 3SBTA 4PL8A 4PWDA 1V4SA 3KD1E 4FYDA 1J53A 4DS5A 3ZSYA 3MDQA 4YDUA 3QB0A 4I9LA 3THXA 1WSJA 4MDBA 3S3NA 5KGWA 3VESA 1BGXT 1KVAA 5KRSA 1NKBA 5HRSA 1ITGA 2EHGA 1UAXA 1RT6A 4A62A 2G8WA 3Q7BA 5TKWA 2DFFA 5M1FA 4K43A 5J2PA 1BIUA 4AHCA 4H4MA 4X66K 1NGBA 3CQXA 2WTUA 4GNIA 4LFAK 3WXKA 4M3XA 1HQUA 3T1HK 4BR7A 5M1KA 1ATSA 4JKDA 4FWNA 2OZMA 3GBTA 4IOXA 4EHTA 1A5XA 3MWPA 3BP8A 1IKWA 4Q0BA 3H46O 3SPYA 3ZCMA 4KHUA 3E66A 1MA9B 3OTOK 4PKGA 2CGKA 2B5JA 5AQPA 4YNQA 2LSNA 3K59A 2P9SB 4FWQA 1KAZA 2X78A 5JS2A 2UXCK 3WNGA 3HTVA 4J2BA 4CIEA 3I8DA 3HM8A 3N4PA 3VQQA 3AVKA 1QQCA 5GINA 3DM2A 1VK0A 2GEMA 3THXB 3LANA 3K9JA 1OH5A 1QSSA 2E2OA 3EEQA 4FJ7A 2Z1HA 3RVCA 1W97L 3BGRA 1BUPA 2Z1GA 3SV3A 5HROA 3VQBA 3V1RA 1RCHA 1BWFO 3LM2A 4CHYA 3AA3A 4Y1CA 2YKMA 3SZ2A 3V9XA 3TTFA 4JI0K 1NGDA 4FWKA 4DV0K 1TKDA 1KSPA 5GAHP 1VRUA 1DTQA 3FZFA 4DTJA 3JS6A 1U6ZA 1Y64A 2ZE2A 3S41A 1ZBUA 4F2RA 2PYLA 3QDKA 4MDAA 4KH5A 3UKUA 5HOOA 3SQ4A 1HRHA 3M8PA 2FC0A 3TAQA 3A2FA 3ID8A 4CGJA 4CZLA 3M5RA 3G71N 1GOCA 2F96A 4EIAA 3CD6N 5AJ3K 3OS2A 1P8ZA 1BISA 3OYJA 3ZT2A 4CERA 3TAPA 2A1RA 1JLFA 4CK1A 3U4LA 1RBTA 3DOKA 1SV5A 2PBDA 3H1VX 1RBSA 2BTFA 1Q81O 2RPIA 2FLOA 1NK8A 3O4WA 1QSLA 4OJRA 3TR8A 3LZJA 2NUBA 3THWB 4F9OA 4O5FA 5BRFA 2YI1A 1K73O 2YHBA 5FROA 5HRNA 3LPUA 1CLQA 3C65A 1CZAN 3CCJN 1D8YA 4FJ8A 2D0PA 3LWMA 3VF6A 3KLIA 1LWEA 4B9UA 5AZIA 3TABA 3NH1A 1KAYA 2E8AA 3ZT0A 2E88A 1O13A 4CEZA 1KFDA 4JS4A 3H08A 4B9VA 3UKUB 3SQ0A 5AZJA 3DRRA 2IVPA 4JI1K 3ZEUA 3ATUA 3KK2A 1Y97A 3CQ8A 4HTUA 1ZBHA 4DLEA 2O8FB 3LALA 1SL1A 3PY8A 2HB5A 1LW0A 4JI7K 2QKKA 4CEDA
chains in the Genus database with same CATH topology
1XWLA 1U4BA 3JYTA 1KVBA 1EX4A 4FLUA 3OJUA 3KLGA 3SCXA 4W5OA 1O1WA 3OYHA 3NGYA 4LD0A 2G8VA 3ZSZA 3P83D 3QINA 4PA1A 4O44A 4AHSA 3HJFA 2RKIA 1CZBA 3RMBA 4E7KA 3LPTA 2IS3A 3WNEA 4CE9A 4CGGA 4DF4A 4DWIA 5FRNA 2HHSA 5CZ1A 4PUOA 1RT4A 3K57A 4DFMA 1TK5A 4AH9A 4CJ5A 2KZMA 4RW6A 1T7PA 3CM5A 3VQDA 4E3SA 1JL2A 3L2VA 4DTRA 3PX4A 1I39A 4F8RA 4CCHA 5I3UA 4KB1A 3AV9A 4FLXA 2IOCA 3C6TA 1X1PA 4M45A 3SI6A 3IS9A 4JRPA 1VSJA 4CJQA 4IG0A 4CK2A 3QESA 3U3GA 3O4QA 3B6PA 1KCFA 4CJTA 2D0BA 1XHZA 3RRGA 2QK9A 1BL3A 1RNHA 1WN7A 1S6PA 1TVRA 5CZ2A 3KLEA 3IRXA 4E7JA 1VSKA 4KV8A 3VN5A 1QE1A 1RDBA 1GOBA 4CEOA 1S1TA 3D0PA 3T19A 4Z4FA 2HHTA 4OVLA 4N5SA 2PZSA 1NJWA 3RR7A 1HYZA 3V9SA 1B9FA 3QETA 1LWFA 3ZT3A 3AVIA 2QXFA 4QCLA 4LSNA 3QEPA 2B4JA 1LW2A 1L3TA 1RTJA 4Z4CA 3SNNA 3NF9A 4IFYA 4RW9A 1NK9A 3ZSVA 1L5UA 1U48A 4B8CA 5CYQA 4FLVA 1RT1A 1VSFA 4EP4A 1S6QA 3HXMA 4LY7A 1S1WA 1KLMA 1C0MA 3ULDA 4DQQA 4DTPA 4FJGA 4FK4A 1JLGA 2ATQA 2O4IA 1NKCA 3SQ2A 3VA0A 1T8EA 4OPJA 2W42A 3CYMA 3NH0A 4H8KA 4FZYA 4N47A 4C8KA 4PQUA 1YTAA 2RF2A 3QNNA 3SPZA 2R7YA 4DMNA 1SKSA 4Y1DA 2GBZA 4I2QA 1XC9A 2OA8A 4OLBA 4OLAA 4DU1A 3EY1A 3LDSA 1BIZA 1DLOA 3NBPA 2BDPA 4KTWA 3LAMA 3VQPA 2XO7A 3U3YA 1WAJA 3KD5E 4KB0A 2QKBA 3WNHA 2YHAA 4C8NA 1TK0A 2E4LA 2IDOA 4K8ZA 2OPPA 4EZ9A 4DQPA 2XY5A 4DSKA 2XHBA 2KFZA 3HSTB 1HPZA 4DFPA 1SL2A 1WAFA 1VSEA 1NKEA 4E89A 3RTVA 3QEIA 3KTQA 4B9LA 4CFBA 3VQ4A 4M41A 2O4GA 2RN2A 2WONA 4FM0A 5J2NA 2DFHA 4N41A 4CF8A 4I2PA 1VSMA 4TSXA 5HRRA 1BQNA 4Z0UA 3EZ5A 2FBVA 4CEFA 3AA5X 2D0AA 1ZBLA 4FJLA 3AVGA 4CJ4A 4DQIA 1NJZA 1BCOA 2OZSA 3DLGA 3PUFA 1C1CA 1FKPA 4KKOA 4CJEA 4G1QA 4CJ3A 3NH2A 4DS4A 1UA1A 3AVBA 4HUFA 3E01A 3TWHA 4FCYA 4BDPA 1S1VA 3DRSA 4FJ5A 4BE1A 3OYMA 1S9GA 2XY8A 3AVAA 3DOLA 3DLBA 3AVJA 4LSLA 1T03A 4OKEA 1Z25A 3OYIA 1IKYA 3VQ7A 4RW7A 4DSEA 3HL8A 3O4NA 4IBNA 1K6YA 3C95A 1QTMA 4C8OA 4KHYA 5E41A 1WSEA 2ZQBA 1NOZA 1JL1A 5C24A 1J9AA 3TAGA 1YTUA 3DI6A 3F9KA 4JS5A 1JLEA 2OPSA 1FK9A 2ZD1A 3TAMA 2XRIA 3SUQA 4ELUA 5FDLA 1QSYA 2VG7A 1KVCA 3VQ5A 1RBVA 1LWCA 3NHGA 4NYFA 1RTHA 1IKXA 4DQRA 3QEVA 4FJJA 4W5QA 1TL3A 3M8QA 5K14A 3VQCA 3L2QA 1B9DA 3VQ6A 5HRPA 3HM9A 3OJSA 3HPHA 1HYVA 3MAQA 3F73A 1UA0A 3AVMA 1HNIA 2BANA 4DTSA 4FJXA 3L3VA 3L8BA 1L3UA 1TAUA 3KKRA 4N56A 1WSIA 2B6AA 3ITHA 4DU4A 4CEAA 1RDDA 1Q9XA 4KHSA 4IDKA 2G8KA 1TV6A 1A5VA 3AO1A 5C42A 1U47A 1W9HA 3B6OA 5HP1A 1R0AA 4Z4HA 4M3YA 2HHQA 1UWBA 3I0SA 5C25A 4DSFA 3V4IA 3SUPA 4DSLA 2EX3A 4CHQA 4XIUA 1GOAA 1LAWA 2KW4A 3AO5A 4DQSA 3V6DA 4FJIA 2F8TA 4CGHA 4AHUA 4FLWA 4AILC 3LAKA 4CJUA 4FVMA 1TL1A 4AHVA 3L2UA 3DLHA 2YNIA 4OKKA 3HP9A 2HW3A 3OS0A 3RMAA 3THVA 3NF7A 1SUQA 3TAEA 3PO4A 2DY4A 3HPGA 2PYJA 4R5PA 1A5WA 3ZSWA 3DRPA 3KK3A 4CEBA 2FBYA 3PV8A 3SUNA 3HYFA 2VWKA 4M42A 3ALYA 3OYFA 4ZTJA 2IC3A 5KGXA 1JLCA 3V81A 4J2AA 1L3SA 1VRTA 4O4GA 2X74A 4CF2A 2F8SA 1WNSA 1RBUA 2BE2A 2G8HA 4KRFA 1NK4A 4FJHA 3M8RA 2HMIA 3RWUA 2P5GA 3AO4A 4ICLA 5SZTA 4B8AB 1SKWA 4OGCA 4IG3A 3O3HA 4FM1A 1BI4B 4NCBA 3ASMA 4DLGA 3ZT4A 1RTDA 2DFEA 3DMJA 3VQAA 3SV4A 2ITGA 1JKHA 3ZT1A 3OS1A 3CFPA 4EZ6A 3I0RA 2D5RA 3AVFA 2VG5A 1Q9YA 4W5RA 4B9MA 4KHQA 4PY5A 3QEWA 4N76A 4KFBA 3HVRA 2KTQA 3OYAA 3AO3A 3S9HA 4DSJA 3O3GA 4B3OA 3V1OA 4DF8A 5HLFA 1LV5A 1KFSA 3OYLA 3HP6A 3NGIA 3LP0A 3OY9A 4QAGA 1X9SA 1SL0A 1BQMA 4KREA 1WSFA 3L2WA 1YT3A 1NJXA 4HCBA 2VWJA 2YNGA 3L2RA 1RDAA 3NFAA 3ZSOA 4E19A 4K8XA 4JRQA 3QIOA 4DTOA 1CXQA 5DK5A 4CGDA 4MFBA 3DYAA 4CIGA 3K58A 4NYNA 4KI6A 1C0UA 1S1UA 1UOCA 2G8UA 4ELVA 3SJJA 5D3GA 1CZ9A 5CYMA 1N6QA 4L8RB 5FRMA 1C0TA 3NAEA 1HQEA 1TKZA 3ISNC 2AJQA 4E1MA 4BDYA 1RILA 2GV9A 3NF8A 4DTMA 4MQ3A 1FXXA 4E0DA 3P5JA 3KK1A 3LP3A 4CFDA 3CM6A 3OYGA 1ZYQA 3MECA 2KQ2A 4NCGA 1Z26A 4CJSA 2HVIA 2KZZA 5KI6A 1F21A 3V9ZA 4FLTA 1RBRA 1IG9A 2KFNA 1ASWA 5SWMA 4YFUA 4PWDA 4C8LA 3KD1E 1WSHA 3V1QA 4GW6A 1J53A 3MXJA 2P1JA 3ZSYA 4DS5A 4M3ZA 4FYDA 4IFVA 4FZZA 4GMJB 1FKOA 3HVTA 4I9LA 1J5OA 3S3NA 1WSJA 2Y1IA 2YV0X 4C8MA 3NDKA 1TKTA 3AVLA 2HVHA 3CG7A 4LH4A 3CFOA 5KGWA 2Z1JA 3AA2A 5J1EA 4F3OA 1BGXT 1KVAA 2IAJA 4CF1A 5KRSA 1NKBA 1S1XA 1BI4A 3DLRA 1HNVA 5HRSA 1TKXA 1NK5A 4NCAA 2HHWA 1U49A 1ITGA 2EHGA 1UAXA 1RT6A 2D0CA 2HNYA 4CHOA 4CJKA 4JLHA 3IG1A 3OYKA 2G8WA 4CECA 2DFFA 1C1AA 3AVCA 3OYNA 4ZHRA 5J2PA 1BIUA 4AHCA 3VA3A 4H4MA 4FK2A 1MU2A 1LAVA 4FLZA 4FZXC 4UQGA 2FBXA 4CESA 4M3XA 3CFRA 4M3UA 1HQUA 3QIPA 1JLQA 1QHTA 4ELTA 4KPYA 1HMVA 4BWMA 2OZMA 3AA4A 4FLYA 1C6VA 1A5XA 2Z1IA 4F4KA 4M3WA 2VG6A 1IKWA 3OVNA 4CJLA 1W0HA 4HUEA 4DFKA 4I9QA 4Q0BA 1VSLA 3NCIA 3SPYA 3ZCMA 4KHUA 3DLKA 4O5BA 4HCCA 3TARA 3G10A 3HT3A 3T1AA 4AHRA 1YVUA 1RT7A 4EP5A 4KTZA 4DTUA 4B08A 4OKJA 2B5JA 4KAZA 4CIFA 3WNFA 4CHZA 1XHXA 4ID1A 2JLEA 4O0IA 4YNQA 1NJYA 2LSNA 3K59A 1SKRA 4CGIA 1TGOA 4DTNA 1X9MA 3KJVA 5JS2A 2X78A 4CF9A 3IAYA 1I3AA 4O55A 3WNGA 1U45A 2Y1JA 1NK6A 4CJWA 2DTUA 4J2BA 1BHLA 4CIEA 3K5LA 3I8DA 4DTXA 1KLNA 3EYZA 3KKSA 2HNDA 2HNZA 3AVKA 3VQQA 1QQCA 3DM2A 3AO2A 5T7BA 1VK0A 5KTQA 1L3VA 1N5YA 2YNFA 2XY6A 3TANA 3LANA 2X6SA 1G15A 1U04A 3MXIA 1D5AA 1TK8A 2P5OA 1QSSA 3PX6A 4CF0A 4OPKA 1JXEA 2E6LA 4OGEA 3SUOA 1C1BA 4DSIA 4FXDA 4FJ7A 3KLHA 2Z1HA 3NE6A 1HJRA 2HHVA 3BGRA 4CFCA 3SV3A 2Z1GA 5HROA 3C6UA 4RW4A 3VQBA 3JSMA 4B9NA 4WE1A 2WOMA 4FJKA 3V1RA 1RCHA 4CHYA 2OPRA 3OYCA 4CEEA 3VQEA 3AA3A 3V9UA 3V9WA 1IKVA 3D45A 4DFJA 4Y1CA 3C94A 3KIOA 2YKMA 2P51A 3SZ2A 3SYZA 3V9XA 1X9WA 4Z4EA 3QEXA 1WLJA 1BCMA 1RT2A 3S3MA 1TKDA 2E6MA 1KSPA 1VRUA 1DTQA 3QNOA 4Z4GA 3K2PA 4DTJA 1B92A 1D9FA 4CJPA 3UIQA 4FJNA 3PO5A 4GVMA 2IGIA 1IH7A 4FM2A 4FK0A 1KTQA 1XI1A 4FJMA 4LH5A 4RG8A 2PY5A 4CGFA 3K5NA 2ZE2A 1Q8IA 1ZBUA 4CEQA 3TI0A 4F2RA 3HK2A 2PYLA 3VQ9A 3OYDA 1NOYA 4KI4A 4BACA 4BWJA 1JLAA 3HO1A 2GUIA 4DU3A 5JS1A 4ID5A 3T3FA 3M8SA 1DTTA 3SQ4A 1HRHA 3M8PA 3QLHA 2BGGA 2FC0A 1QS4A 3A2FA 3VQ8A 4CGJA 3TAQA 1NK7A 4B9TA 4KHNA 4F3TA 4QOZB 1JLBA 1VSIA 1GOCA 4CJRA 4J2EA 2F96A 3DLEA 1T05A 1REVA 3OS2A 4BE2A 4FW1A 4KHWA 1BISA 3OYJA 2Q3SA 3ZT2A 3NF6A 4CERA 4BDZA 3TAPA 2A1RA 3HPOA 3MXMA 1JLFA 3G0ZA 3MEDA 3ZSRA 4CK1A 1RBTA 3DOKA 1EKEA 1SV5A 4CJVA 4E7IA 2QKKA 2YKNA 3ZSQA 1KRPA 4AHTA 4HHTA 1RBSA 3LP1A 3RR8A 3MEEA 2OPQA 4KTQA 2RPIA 4O0JA 2FBTA 2HHUA 4CFAA 3S3OA 3K5MA 1NK8A 1QSLA 5EU7A 4E1NA 1NK0A 3TAFA 3BDPA 4OJRA 4J2DA 2OYQA 3TR8A 3LZJA 2NUBA 1EP4A 3ZSXA 4E7HA 4B9SA 1VSDA 5DMRA 4RW8A 3MEGA 4CJFA 3RRHA 1VSHA 3O3FA 1ASUA 2X6NA 2YHBA 5CY4A 5FROA 3AVHA 1RDCA 3LPUA 5HRNA 3NGZA 5J2MA 5J2QA 4H4OA 1HYSA 1CLQA 1RT5A 1CXUA 1ASVA 4KO0A 4CHNA 4BE0A 1D8YA 4FJ8A 3LWMA 2ETJA 3P1GA 3U6FA 3KLIA 4M3TA 4W5NA 1J54A 4FW2A 4M3RA 1LWEA 1S5JA 4B9UA 3RMCA 2G8IA 3TABA 3LWLA 3NH1A 4ZTFA 4F2SA 3QERA 3LZIA 1JXBA 3ZT0A 4E7LA 2XY7A 2A1SA 4CHPA 4FJ9A 1EXQA 5KRTA 2I5JA 4CEZA 3RMDA 1KFDA 1RTIA 1TAQA 4JS4A 3H08A 4CK3A 1ZBIA 4B9VA 1S9EA 3KLFA 4Q5VA 3SQ0A 4I7FA 1EETA 3QO9A 5I42A 1WSGA 1IO2A 3DRRA 2JGUA 2YNHA 4HVJA 2HHXA 3AVNA 4HUGA 3OYEA 3K5OA 3PX0A 3OYBA 3KK2A 1Y97A 3LP2A 1ZBFA 4Z4IA 3L3UA 4W5TA 3CQ8A 4HTUA 5HBMA 1ZBHA 2G8FA 4IKFA 4DLEA 3SQ1A 3LALA 1SL1A 3PY8A 4DG1A 1RT3A 2HB5A 1D9DA 1LW0A 3FFIA 4CEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XWL A;  1U4B A;  3JYT A;  1KVB A;  1EX4 A;  4FLU A;  3OJU A;  3KLG A;  3SCX A;  4W5O A;  1O1W A;  3OYH A;  3NGY A;  4LD0 A;  2G8V A;  3ZSZ A;  3P83 D;  3QIN A;  4PA1 A;  4O44 A;  4AHS A;  3HJF A;  2RKI A;  1CZB A;  3RMB A;  4E7K A;  3LPT A;  2IS3 A;  3WNE A;  4CE9 A;  4CGG A;  4DF4 A;  4DWI A;  5FRN A;  2HHS A;  5CZ1 A;  4PUO A;  1RT4 A;  3K57 A;  4DFM A;  1TK5 A;  4AH9 A;  4CJ5 A;  2KZM A;  4RW6 A;  1T7P A;  3CM5 A;  3VQD A;  4E3S A;  1JL2 A;  3L2V A;  4DTR A;  3PX4 A;  1I39 A;  4F8R A;  4CCH A;  5I3U A;  4KB1 A;  3AV9 A;  4FLX A;  2IOC A;  3C6T A;  1X1P A;  4M45 A;  3SI6 A;  3IS9 A;  4JRP A;  1VSJ A;  4CJQ A;  4IG0 A;  4CK2 A;  3QES A;  3U3G A;  3O4Q A;  3B6P A;  1KCF A;  4CJT A;  2D0B A;  1XHZ A;  3RRG A;  2QK9 A;  1BL3 A;  1RNH A;  1WN7 A;  1S6P A;  1TVR A;  5CZ2 A;  3KLE A;  3IRX A;  4E7J A;  1VSK A;  4KV8 A;  3VN5 A;  1QE1 A;  1RDB A;  1GOB A;  4CEO A;  1S1T A;  3D0P A;  3T19 A;  4Z4F A;  2HHT A;  4OVL A;  4N5S A;  2PZS A;  1NJW A;  3RR7 A;  1HYZ A;  3V9S A;  1B9F A;  3QET A;  1LWF A;  3ZT3 A;  3AVI A;  2QXF A;  4QCL A;  4LSN A;  3QEP A;  2B4J A;  1LW2 A;  1L3T A;  1RTJ A;  4Z4C A;  3SNN A;  3NF9 A;  4IFY A;  4RW9 A;  1NK9 A;  3ZSV A;  1L5U A;  1U48 A;  4B8C A;  5CYQ A;  4FLV A;  1RT1 A;  1VSF A;  4EP4 A;  1S6Q A;  3HXM A;  4LY7 A;  1S1W A;  1KLM A;  1C0M A;  3ULD A;  4DQQ A;  4DTP A;  4FJG A;  4FK4 A;  1JLG A;  2ATQ A;  2O4I A;  1NKC A;  3SQ2 A;  3VA0 A;  1T8E A;  4OPJ A;  2W42 A;  3CYM A;  3NH0 A;  4H8K A;  4FZY A;  4N47 A;  4C8K A;  4PQU A;  1YTA A;  2RF2 A;  3QNN A;  3SPZ A;  2R7Y A;  4DMN A;  1SKS A;  4Y1D A;  2GBZ A;  4I2Q A;  1XC9 A;  2OA8 A;  4OLB A;  4OLA A;  4DU1 A;  3EY1 A;  3LDS A;  1BIZ A;  1DLO A;  3NBP A;  2BDP A;  4KTW A;  3LAM A;  3VQP A;  2XO7 A;  3U3Y A;  1WAJ A;  3KD5 E;  4KB0 A;  2QKB A;  3WNH A;  2YHA A;  4C8N A;  1TK0 A;  2E4L A;  2IDO A;  4K8Z A;  2OPP A;  4EZ9 A;  4DQP A;  2XY5 A;  4DSK A;  2XHB A;  2KFZ A;  3HST B;  1HPZ A;  4DFP A;  1SL2 A;  1WAF A;  1VSE A;  1NKE A;  4E89 A;  3RTV A;  3QEI A;  3KTQ A;  4B9L A;  4CFB A;  3VQ4 A;  4M41 A;  2O4G A;  2RN2 A;  2WON A;  4FM0 A;  5J2N A;  2DFH A;  4N41 A;  4CF8 A;  4I2P A;  1VSM A;  4TSX A;  5HRR A;  1BQN A;  4Z0U A;  3EZ5 A;  2FBV A;  4CEF A;  3AA5 X;  2D0A A;  1ZBL A;  4FJL A;  3AVG A;  4CJ4 A;  4DQI A;  1NJZ A;  1BCO A;  2OZS A;  3DLG A;  3PUF A;  1C1C A;  1FKP A;  4KKO A;  4CJE A;  4G1Q A;  4CJ3 A;  3NH2 A;  4DS4 A;  1UA1 A;  3AVB A;  4HUF A;  3E01 A;  3TWH A;  4FCY A;  4BDP A;  1S1V A;  3DRS A;  4FJ5 A;  4BE1 A;  3OYM A;  1S9G A;  2XY8 A;  3AVA A;  3DOL A;  3DLB A;  3AVJ A;  4LSL A;  1T03 A;  4OKE A;  1Z25 A;  3OYI A;  1IKY A;  3VQ7 A;  4RW7 A;  4DSE A;  3HL8 A;  3O4N A;  4IBN A;  1K6Y A;  3C95 A;  1QTM A;  4C8O A;  4KHY A;  5E41 A;  1WSE A;  2ZQB A;  1NOZ A;  1JL1 A;  5C24 A;  1J9A A;  3TAG A;  1YTU A;  3DI6 A;  3F9K A;  4JS5 A;  1JLE A;  2OPS A;  1FK9 A;  2ZD1 A;  3TAM A;  2XRI A;  3SUQ A;  4ELU A;  5FDL A;  1QSY A;  2VG7 A;  1KVC A;  3VQ5 A;  1RBV A;  1LWC A;  3NHG A;  4NYF A;  1RTH A;  1IKX A;  4DQR A;  3QEV A;  4FJJ A;  4W5Q A;  1TL3 A;  3M8Q A;  5K14 A;  3VQC A;  3L2Q A;  1B9D A;  3VQ6 A;  5HRP A;  3HM9 A;  3OJS A;  3HPH A;  1HYV A;  3MAQ A;  3F73 A;  1UA0 A;  3AVM A;  1HNI A;  2BAN A;  4DTS A;  4FJX A;  3L3V A;  3L8B A;  1L3U A;  1TAU A;  3KKR A;  4N56 A;  1WSI A;  2B6A A;  3ITH A;  4DU4 A;  4CEA A;  1RDD A;  1Q9X A;  4KHS A;  4IDK A;  2G8K A;  1TV6 A;  1A5V A;  3AO1 A;  5C42 A;  1U47 A;  1W9H A;  3B6O A;  5HP1 A;  1R0A A;  4Z4H A;  4M3Y A;  2HHQ A;  1UWB A;  3I0S A;  5C25 A;  4DSF A;  3V4I A;  3SUP A;  4DSL A;  2EX3 A;  4CHQ A;  4XIU A;  1GOA A;  1LAW A;  2KW4 A;  3AO5 A;  4DQS A;  3V6D A;  4FJI A;  2F8T A;  4CGH A;  4AHU A;  4FLW A;  4AIL C;  3LAK A;  4CJU A;  4FVM A;  1TL1 A;  4AHV A;  3L2U A;  3DLH A;  2YNI A;  4OKK A;  3HP9 A;  2HW3 A;  3OS0 A;  3RMA A;  3THV A;  3NF7 A;  1SUQ A;  3TAE A;  3PO4 A;  2DY4 A;  3HPG A;  2PYJ A;  4R5P A;  1A5W A;  3ZSW A;  3DRP A;  3KK3 A;  4CEB A;  2FBY A;  3PV8 A;  3SUN A;  3HYF A;  2VWK A;  4M42 A;  3ALY A;  3OYF A;  4ZTJ A;  2IC3 A;  5KGX A;  1JLC A;  3V81 A;  4J2A A;  1L3S A;  1VRT A;  4O4G A;  2X74 A;  4CF2 A;  2F8S A;  1WNS A;  1RBU A;  2BE2 A;  2G8H A;  4KRF A;  1NK4 A;  4FJH A;  3M8R A;  2HMI A;  3RWU A;  2P5G A;  3AO4 A;  4ICL A;  5SZT A;  4B8A B;  1SKW A;  4OGC A;  4IG3 A;  3O3H A;  4FM1 A;  1BI4 B;  4NCB A;  3ASM A;  4DLG A;  3ZT4 A;  1RTD A;  2DFE A;  3DMJ A;  3VQA A;  3SV4 A;  2ITG A;  1JKH A;  3ZT1 A;  3OS1 A;  3CFP A;  4EZ6 A;  3I0R A;  2D5R A;  3AVF A;  2VG5 A;  1Q9Y A;  4W5R A;  4B9M A;  4KHQ A;  4PY5 A;  3QEW A;  4N76 A;  4KFB A;  3HVR A;  2KTQ A;  3OYA A;  3AO3 A;  3S9H A;  4DSJ A;  3O3G A;  4B3O A;  3V1O A;  4DF8 A;  5HLF A;  1LV5 A;  1KFS A;  3OYL A;  3HP6 A;  3NGI A;  3LP0 A;  3OY9 A;  4QAG A;  1X9S A;  1SL0 A;  1BQM A;  4KRE A;  1WSF A;  3L2W A;  1YT3 A;  1NJX A;  4HCB A;  2VWJ A;  2YNG A;  3L2R A;  1RDA A;  3NFA A;  3ZSO A;  4E19 A;  4K8X A;  4JRQ A;  3QIO A;  4DTO A;  1CXQ A;  5DK5 A;  4CGD A;  4MFB A;  3DYA A;  4CIG A;  3K58 A;  4NYN A;  4KI6 A;  1C0U A;  1S1U A;  1UOC A;  2G8U A;  4ELV A;  3SJJ A;  5D3G A;  1CZ9 A;  5CYM A;  1N6Q A;  4L8R B;  5FRM A;  1C0T A;  3NAE A;  1HQE A;  1TKZ A;  3ISN C;  2AJQ A;  4E1M A;  4BDY A;  1RIL A;  2GV9 A;  3NF8 A;  4DTM A;  4MQ3 A;  1FXX A;  4E0D A;  3P5J A;  3KK1 A;  3LP3 A;  4CFD A;  3CM6 A;  3OYG A;  1ZYQ A;  3MEC A;  2KQ2 A;  4NCG A;  1Z26 A;  4CJS A;  2HVI A;  2KZZ A;  5KI6 A;  1F21 A;  3V9Z A;  4FLT A;  1RBR A;  1IG9 A;  2KFN A;  1ASW A;  5SWM A;  4YFU A;  4PWD A;  4C8L A;  3KD1 E;  1WSH A;  3V1Q A;  4GW6 A;  1J53 A;  3MXJ A;  2P1J A;  3ZSY A;  4DS5 A;  4M3Z A;  4FYD A;  4IFV A;  4FZZ A;  4GMJ B;  1FKO A;  3HVT A;  4I9L A;  1J5O A;  3S3N A;  1WSJ A;  2Y1I A;  2YV0 X;  4C8M A;  3NDK A;  1TKT A;  3AVL A;  2HVH A;  3CG7 A;  4LH4 A;  3CFO A;  5KGW A;  2Z1J A;  3AA2 A;  5J1E A;  4F3O A;  1BGX T;  1KVA A;  2IAJ A;  4CF1 A;  5KRS A;  1NKB A;  1S1X A;  1BI4 A;  3DLR A;  1HNV A;  5HRS A;  1TKX A;  1NK5 A;  4NCA A;  2HHW A;  1U49 A;  1ITG A;  2EHG A;  1UAX A;  1RT6 A;  2D0C A;  2HNY A;  4CHO A;  4CJK A;  4JLH A;  3IG1 A;  3OYK A;  2G8W A;  4CEC A;  2DFF A;  1C1A A;  3AVC A;  3OYN A;  4ZHR A;  5J2P A;  1BIU A;  4AHC A;  3VA3 A;  4H4M A;  4FK2 A;  1MU2 A;  1LAV A;  4FLZ A;  4FZX C;  4UQG A;  2FBX A;  4CES A;  4M3X A;  3CFR A;  4M3U A;  1HQU A;  3QIP A;  1JLQ A;  1QHT A;  4ELT A;  4KPY A;  1HMV A;  4BWM A;  2OZM A;  3AA4 A;  4FLY A;  1C6V A;  1A5X A;  2Z1I A;  4F4K A;  4M3W A;  2VG6 A;  1IKW A;  3OVN A;  4CJL A;  1W0H A;  4HUE A;  4DFK A;  4I9Q A;  4Q0B A;  1VSL A;  3NCI A;  3SPY A;  3ZCM A;  4KHU A;  3DLK A;  4O5B A;  4HCC A;  3TAR A;  3G10 A;  3HT3 A;  3T1A A;  4AHR A;  1YVU A;  1RT7 A;  4EP5 A;  4KTZ A;  4DTU A;  4B08 A;  4OKJ A;  2B5J A;  4KAZ A;  4CIF A;  3WNF A;  4CHZ A;  1XHX A;  4ID1 A;  2JLE A;  4O0I A;  4YNQ A;  1NJY A;  2LSN A;  3K59 A;  1SKR A;  4CGI A;  1TGO A;  4DTN A;  1X9M A;  3KJV A;  5JS2 A;  2X78 A;  4CF9 A;  3IAY A;  1I3A A;  4O55 A;  3WNG A;  1U45 A;  2Y1J A;  1NK6 A;  4CJW A;  2DTU A;  4J2B A;  1BHL A;  4CIE A;  3K5L A;  3I8D A;  4DTX A;  1KLN A;  3EYZ A;  3KKS A;  2HND A;  2HNZ A;  3AVK A;  3VQQ A;  1QQC A;  3DM2 A;  3AO2 A;  5T7B A;  1VK0 A;  5KTQ A;  1L3V A;  1N5Y A;  2YNF A;  2XY6 A;  3TAN A;  3LAN A;  2X6S A;  1G15 A;  1U04 A;  3MXI A;  1D5A A;  1TK8 A;  2P5O A;  1QSS A;  3PX6 A;  4CF0 A;  4OPK A;  1JXE A;  2E6L A;  4OGE A;  3SUO A;  1C1B A;  4DSI A;  4FXD A;  4FJ7 A;  3KLH A;  2Z1H A;  3NE6 A;  1HJR A;  2HHV A;  3BGR A;  4CFC A;  3SV3 A;  2Z1G A;  5HRO A;  3C6U A;  4RW4 A;  3VQB A;  3JSM A;  4B9N A;  4WE1 A;  2WOM A;  4FJK A;  3V1R A;  1RCH A;  4CHY A;  2OPR A;  3OYC A;  4CEE A;  3VQE A;  3AA3 A;  3V9U A;  3V9W A;  1IKV A;  3D45 A;  4DFJ A;  4Y1C A;  3C94 A;  3KIO A;  2YKM A;  2P51 A;  3SZ2 A;  3SYZ A;  3V9X A;  1X9W A;  4Z4E A;  3QEX A;  1WLJ A;  1BCM A;  1RT2 A;  3S3M A;  1TKD A;  2E6M A;  1KSP A;  1VRU A;  1DTQ A;  3QNO A;  4Z4G A;  3K2P A;  4DTJ A;  1B92 A;  1D9F A;  4CJP A;  3UIQ A;  4FJN A;  3PO5 A;  4GVM A;  2IGI A;  1IH7 A;  4FM2 A;  4FK0 A;  1KTQ A;  1XI1 A;  4FJM A;  4LH5 A;  4RG8 A;  2PY5 A;  4CGF A;  3K5N A;  2ZE2 A;  1Q8I A;  1ZBU A;  4CEQ A;  3TI0 A;  4F2R A;  3HK2 A;  2PYL A;  3VQ9 A;  3OYD A;  1NOY A;  4KI4 A;  4BAC A;  4BWJ A;  1JLA A;  3HO1 A;  2GUI A;  4DU3 A;  5JS1 A;  4ID5 A;  3T3F A;  3M8S A;  1DTT A;  3SQ4 A;  1HRH A;  3M8P A;  3QLH A;  2BGG A;  2FC0 A;  1QS4 A;  3A2F A;  3VQ8 A;  4CGJ A;  3TAQ A;  1NK7 A;  4B9T A;  4KHN A;  4F3T A;  4QOZ B;  1JLB A;  1VSI A;  1GOC A;  4CJR A;  4J2E A;  2F96 A;  3DLE A;  1T05 A;  1REV A;  3OS2 A;  4BE2 A;  4FW1 A;  4KHW A;  1BIS A;  3OYJ A;  2Q3S A;  3ZT2 A;  3NF6 A;  4CER A;  4BDZ A;  3TAP A;  2A1R A;  3HPO A;  3MXM A;  1JLF A;  3G0Z A;  3MED A;  3ZSR A;  4CK1 A;  1RBT A;  3DOK A;  1EKE A;  1SV5 A;  4CJV A;  4E7I A;  2QKK A;  2YKN A;  3ZSQ A;  1KRP A;  4AHT A;  4HHT A;  1RBS A;  3LP1 A;  3RR8 A;  3MEE A;  2OPQ A;  4KTQ A;  2RPI A;  4O0J A;  2FBT A;  2HHU A;  4CFA A;  3S3O A;  3K5M A;  1NK8 A;  1QSL A;  5EU7 A;  4E1N A;  1NK0 A;  3TAF A;  3BDP A;  4OJR A;  4J2D A;  2OYQ A;  3TR8 A;  3LZJ A;  2NUB A;  1EP4 A;  3ZSX A;  4E7H A;  4B9S A;  1VSD A;  5DMR A;  4RW8 A;  3MEG A;  4CJF A;  3RRH A;  1VSH A;  3O3F A;  1ASU A;  2X6N A;  2YHB A;  5CY4 A;  5FRO A;  3AVH A;  1RDC A;  3LPU A;  5HRN A;  3NGZ A;  5J2M A;  5J2Q A;  4H4O A;  1HYS A;  1CLQ A;  1RT5 A;  1CXU A;  1ASV A;  4KO0 A;  4CHN A;  4BE0 A;  1D8Y A;  4FJ8 A;  3LWM A;  2ETJ A;  3P1G A;  3U6F A;  3KLI A;  4M3T A;  4W5N A;  1J54 A;  4FW2 A;  4M3R A;  1LWE A;  1S5J A;  4B9U A;  3RMC A;  2G8I A;  3TAB A;  3LWL A;  3NH1 A;  4ZTF A;  4F2S A;  3QER A;  3LZI A;  1JXB A;  3ZT0 A;  4E7L A;  2XY7 A;  2A1S A;  4CHP A;  4FJ9 A;  1EXQ A;  5KRT A;  2I5J A;  4CEZ A;  3RMD A;  1KFD A;  1RTI A;  1TAQ A;  4JS4 A;  3H08 A;  4CK3 A;  1ZBI A;  4B9V A;  1S9E A;  3KLF A;  4Q5V A;  3SQ0 A;  4I7F A;  1EET A;  3QO9 A;  5I42 A;  1WSG A;  1IO2 A;  3DRR A;  2JGU A;  2YNH A;  4HVJ A;  2HHX A;  3AVN A;  4HUG A;  3OYE A;  3K5O A;  3PX0 A;  3OYB A;  3KK2 A;  1Y97 A;  3LP2 A;  1ZBF A;  4Z4I A;  3L3U A;  4W5T A;  3CQ8 A;  4HTU A;  5HBM A;  1ZBH A;  2G8F A;  4IKF A;  4DLE A;  3SQ1 A;  3LAL A;  1SL1 A;  3PY8 A;  4DG1 A;  1RT3 A;  2HB5 A;  1D9D A;  1LW0 A;  3FFI A;  4CED A; 
#chains in the Genus database with same CATH topology
 4C23 A;  3DLL L;  3JYT A;  4FLU A;  3SCX A;  4LD0 A;  4CVN E;  3QIN A;  4AHS A;  2AJQ A;  1CZB A;  1DGK N;  4E7K A;  3MCP A;  4CGG A;  4DF4 A;  3GE1 A;  5CZ1 A;  4AH9 A;  3CM5 A;  2A42 A;  2FF6 A;  3VQD A;  4E3S A;  1JL2 A;  4ISG A;  3PX4 A;  3B8A X;  3PIP L;  4M45 A;  4BQL A;  3SI6 A;  3IS9 A;  1VSJ A;  4CJQ A;  4IG0 A;  3MN7 A;  3EO3 A;  3EE8 A;  4FL9 A;  1RNH A;  1S6P A;  2P9L A;  4G9Z A;  4E7J A;  5AZI B;  4H5R A;  3D0P A;  1S1T A;  3RR7 A;  2PZS A;  4BRK A;  3ID6 A;  3L4Q A;  2QXF A;  2B4J A;  1SQK A;  5EY4 A;  1VAZ A;  4RW9 A;  3VEX A;  4LY7 A;  5AZJ B;  3TSU A;  3VGK A;  2W6L A;  2ATQ A;  2O4I A;  1NKC A;  3HOT A;  1T8E A;  4OPJ A;  3CYM A;  4H5T A;  3NH0 A;  4H8K A;  4FZY A;  4C8K A;  4H03 B;  3SPZ A;  4OLB A;  1SKS A;  2GBZ A;  4I2Q A;  4RWT A;  1BDG A;  1EQY A;  3NBP A;  3KD5 E;  3EE9 A;  2YHA A;  4IEE A;  2E4L A;  3PLA A;  4EZ9 A;  3ENB A;  4DQ8 A;  5AQX A;  2F9T A;  2KFZ A;  3HST B;  3I56 N;  5AQG A;  1HPZ A;  4DFP A;  4KAZ A;  4B9L A;  1NKE A;  2O4G A;  2RN2 A;  4FM0 A;  4JHD A;  4N41 A;  5AQV A;  3MN6 A;  4TSX A;  3TU5 A;  5GAD P;  3EZ5 A;  2FBV A;  1ZBL A;  3VEO A;  3O08 A;  1NJZ A;  5KQ8 A;  4NLB A;  1C1C A;  4B1Y B;  4G1Q A;  4DS4 A;  1UA1 A;  1DKG D;  1YF5 L;  1HX1 A;  2P9N A;  3DLB A;  2XY8 A;  5AQL A;  4DV4 K;  2PFU A;  3OYI A;  4RW7 A;  4DSE A;  3KHY A;  1K6Y A;  1QTM A;  5GAE P;  5M1P A;  1WSE A;  2NRH A;  2ZQB A;  3FZK A;  3HOS A;  1J9A A;  3TAG A;  4AF1 A;  3DI6 A;  2NLX A;  3CF5 L;  4B3M K;  3F9K A;  4JS5 A;  2ZD1 A;  3TAM A;  4ELU A;  2VG7 A;  1KVC A;  3VQ5 A;  1OH6 A;  1LWC A;  4K25 A;  2YCH A;  3CJB A;  3T1Y K;  3IFR A;  3VF2 A;  1SAZ A;  5HRP A;  3OJS A;  3F73 A;  2O8C B;  3AVM A;  4DTS A;  2BAN A;  3KKR A;  4N56 A;  4DV5 K;  2ZGZ A;  3ITH A;  4DU4 A;  4CEA A;  1RDD A;  4OX9 K;  1TV6 A;  1A5V A;  2EWS A;  3DXK B;  5C42 A;  1W9H A;  5KQD A;  3I0S A;  3P39 A;  4L3Q A;  2F8T A;  4DQS A;  4FVM A;  4JKF A;  4CBU A;  1SUQ A;  3R1X A;  2PYJ A;  3SUN A;  3DRP A;  3M3Z A;  3PV8 A;  4DV2 K;  1T3V A;  3ALY A;  4GVE A;  5JLH A;  1OH7 A;  1JLC A;  2QWO A;  1VQO N;  1GLJ O;  1YVN A;  3QFU A;  1VRT A;  3PIO L;  5BN8 A;  2BE2 A;  4BGA A;  4KRF A;  1QVG M;  3F5T A;  3RWU A;  3AO4 A;  1VQM N;  4B8A B;  1SKW A;  1BI4 B;  1KXP A;  5AFU H;  1RTD A;  2DFE A;  3VQA A;  1EO1 A;  4BC2 A;  3OS1 A;  3CFP A;  4W5R A;  2P9P A;  2QWQ A;  2HOE A;  4N76 A;  4KFB A;  3HVR A;  2KTQ A;  5IWA K;  5BN9 A;  3KK7 A;  3O3G A;  4PKH A;  1LV5 A;  5HLF A;  3HP6 A;  3NGI A;  4QAG A;  1X9S A;  1BQM A;  3VF4 A;  4H5W A;  3D2E B;  2VWJ A;  3BF3 A;  1RDA A;  4E19 A;  4JRQ A;  2QTD A;  5E26 A;  4MFB A;  3DYA A;  4CIG A;  4C1N K;  1NNE A;  2G8U A;  1C0F A;  3SJJ A;  2I7P A;  3AAQ A;  4OPA A;  3W3D A;  1N6Q A;  5FRM A;  1C0T A;  2HBJ A;  4BDY A;  1NMD A;  3NF8 A;  1FXX A;  4YHH K;  3U9D A;  3MEC A;  4IO9 L;  4NCG A;  4CJS A;  2WFB A;  1G99 A;  5KI6 A;  3V9Z A;  3NVK A;  1RBR A;  5CHI A;  1IG9 A;  2QW9 A;  4JV5 K;  1QQN A;  4YFU A;  1OH8 A;  3CCE N;  3GOI A;  4DR6 K;  1XC3 A;  1X3M A;  4A5A A;  4RTF D;  4GMJ B;  4JI4 K;  1FKO A;  3HVT A;  2YV0 X;  3AVL A;  2HVH A;  3PSI A;  5J1E A;  3J8A A;  4WQ5 C;  1W7A A;  1NJI O;  1RFQ A;  3DLR A;  3W0L A;  1NK5 A;  2V7Y A;  4CHO A;  3OYK A;  4MLH A;  4ZHR A;  4BRN A;  5BRE A;  1VQK N;  4FLZ A;  2W41 A;  4FZX C;  4UQG A;  2FBX A;  3WT0 A;  4CES A;  2CGL A;  4ELT A;  5LMU K;  4DV1 K;  5FPN A;  1XQS C;  3CCU N;  2ASO A;  4DR2 K;  4E1J A;  3SAH A;  3CME N;  3LDP A;  4F4K A;  4M3W A;  1IV0 A;  2VG6 A;  3VPZ A;  3OVN A;  3D2F A;  1VSL A;  2D0O A;  3NCI A;  4HWI A;  5F0X A;  4HCC A;  3TAR A;  3HT3 A;  4AHR A;  1RT7 A;  4EP5 A;  4I6M A;  2GTD A;  5AQN A;  4M63 C;  2A6A A;  2E20 A;  3NVM A;  4CIF A;  3BF1 A;  4CHZ A;  1XHX A;  4WYB A;  3GL1 A;  4A59 A;  4H0O A;  4FWR A;  3U9Z A;  3G25 A;  3JAM O;  4A61 A;  1E4G T;  1X9M A;  3VMF B;  4GKK K;  1ZC6 A;  3KJV A;  3IAY A;  2CH5 A;  1I3A A;  4O55 A;  1NK6 A;  2Y1J A;  4CJW A;  4DTX A;  1KLN A;  3BY5 A;  3KKS A;  1JJ2 M;  5AQZ A;  5C0Y A;  2O8B A;  3CJ7 A;  4NB4 A;  2XY6 A;  3TAN A;  1U04 A;  3JXU A;  3AY9 A;  1TK8 A;  4CF0 A;  3SUO A;  1JXE A;  4ISE A;  3HZ6 A;  1C1B A;  3EKS A;  1HJR A;  5LL6 Z;  3NE6 A;  2HHV A;  4CFC A;  4B9N A;  3C6U A;  4DR4 K;  3P4I A;  1EWQ A;  3H3N O;  4CEE A;  3VQE A;  1IKV A;  2Q97 A;  3D45 A;  3HBT A;  1GLA G;  3DJC A;  3VEV A;  3SYZ A;  2KKZ A;  3MN5 A;  4IJA A;  4CZH A;  5JMV A;  4KHP K;  5AQQ A;  5AQU A;  3CPE A;  4O8U A;  2QWM A;  1ATN A;  1B92 A;  5FPM A;  4CJP A;  1HKB A;  4EFH A;  4Y0W A;  2YX6 A;  1YXQ A;  2PY5 A;  4CGF A;  2CH6 A;  3K5N A;  4CEQ A;  4CZE A;  3TI0 A;  2O8E A;  5AQW A;  5LJV A;  5BRD A;  4KI4 A;  3OYD A;  4BWJ A;  2FSN A;  1JLA A;  2Q1N A;  4BVO A;  3DAW A;  4YOR A;  2VGM A;  5JS1 A;  4DU3 A;  2A3Z A;  3M8S A;  3WXI A;  3QLH A;  4QOZ B;  4B9T A;  4YOY A;  3MK6 A;  4CJR A;  4J2E A;  4PKI A;  3DLE A;  4BE2 A;  4FW1 A;  5ELZ A;  4KHW A;  3ZX0 A;  4PL7 A;  2Q3S A;  4BDZ A;  3K9K A;  3NF6 A;  3G0Z A;  3MED A;  4B1V A;  4CJV A;  2O8B B;  3ZSQ A;  1KRP A;  4AHT A;  4HHT A;  3AAR A;  4RCH A;  5AQF A;  3RR8 A;  3UB5 A;  2HHU A;  2FBT A;  3S3O A;  4LFC K;  2YHY A;  5EU7 A;  4E1N A;  3VEW A;  3O9T A;  4J8F A;  5EXW A;  3BDP A;  3P38 A;  3BEX A;  1EP4 A;  4B9S A;  1KAX A;  1VSD A;  1VQ4 N;  3CC2 N;  3MEG A;  2HBL A;  4B3S K;  1Q82 O;  1BA1 A;  3MX2 A;  1GLD G;  4JK8 A;  4FPB A;  1OKJ A;  1RT5 A;  1NGF A;  4KO0 A;  4CHN A;  3CC7 N;  1NGH A;  3MX5 A;  4W5N A;  4M3R A;  3LWL A;  4ZTF A;  4F2S A;  4IDH A;  2UXD K;  2P9I A;  1JXB A;  4E7L A;  1VQP N;  4BGB A;  2I5J A;  2O8E B;  2VYP A;  3CQY A;  4I7F A;  5I42 A;  1IO2 A;  3VTI A;  2JGU A;  5E84 A;  4HVJ A;  2HHX A;  3AVN A;  3WQT A;  4QS8 A;  3FFK B;  4JD2 A;  4Z4I A;  4W5T A;  5HBM A;  4IKF A;  1NGI A;  1U4B A;  2E2N A;  4YOW A;  3OJU A;  3KLG A;  2Q31 A;  1R59 O;  3H1Q A;  3LPT A;  2UUB K;  4H0X B;  3QIC A;  4BC5 A;  1TK5 A;  4CJ5 A;  3BUZ B;  3O1B A;  4DTR A;  3THW A;  4CCH A;  5I3U A;  3C6T A;  4NO7 A;  4CK2 A;  3GDQ A;  3QES A;  3BZC A;  2D0B A;  1BL3 A;  4WQ4 A;  4FVU A;  1H1V A;  3GG4 A;  3IRX A;  4JKG A;  4KV8 A;  3VN5 A;  4CEO A;  3T19 A;  2P9I B;  4N5S A;  1NJW A;  1HYZ A;  3QET A;  1NM1 A;  2OCE A;  1LWF A;  3QEP A;  5C2F A;  1LW2 A;  5AQH A;  5ADX H;  1NK9 A;  3ZSV A;  4B8C A;  4FLV A;  2ZM6 K;  1VQ6 N;  5CR4 A;  5EVZ A;  1HNZ K;  1S1W A;  3ULD A;  4DQQ A;  4FJG A;  5MLC Q;  4XH5 A;  2NNW A;  3MMV A;  4JD2 B;  1K9M O;  4IOC L;  2HST A;  1V4T A;  4BRH A;  3ZYY X;  3CC4 N;  4PQU A;  2RF2 A;  2V51 B;  2R7Y A;  2O8F A;  4Y1D A;  1RGI A;  2OA8 A;  3C6H A;  1BIZ A;  3VQP A;  3LAM A;  4KB0 A;  1WAJ A;  2GUP A;  3IDH A;  4C8N A;  1TK0 A;  4K8Z A;  1X3N A;  3F9M A;  3LM9 A;  2H3G X;  2QEX N;  2VWB A;  3RTV A;  3KTQ A;  4DR3 K;  4CFB A;  4M41 A;  2DFH A;  1RDU A;  4CF8 A;  5F1X A;  1IG8 A;  1QHA A;  5HRR A;  3A8Y A;  5C2D A;  2D0A A;  2OZS A;  3DLG A;  3OA9 A;  3PUF A;  4CJ3 A;  3E01 A;  4BDP A;  3OYM A;  4CI6 A;  1VQ5 N;  1MWM A;  1Z25 A;  3C0B A;  3VQ7 A;  4JKG B;  4IBN A;  4C8O A;  3C95 A;  4KHY A;  1NOZ A;  5C24 A;  4M7Y A;  4WF9 L;  2Q36 A;  2OPS A;  4BY9 C;  2XRI A;  1QSY A;  1NBW A;  4NYF A;  4FJJ A;  2OAN A;  1TL3 A;  4IFE A;  3E9L A;  3M8Q A;  4BQZ A;  5K14 A;  3VQC A;  3L2Q A;  1S72 N;  4LF4 K;  4XH4 A;  3HM9 A;  1HUX A;  3F2K A;  2FSJ A;  1GLB G;  3T7Z A;  3L3V A;  1L3U A;  1TAU A;  5GIP A;  4H0P A;  2YHX A;  3I8B A;  2G8K A;  3A5N C;  3AO1 A;  2GX9 A;  4JN4 A;  1U2V A;  1U47 A;  2VQF K;  5HP1 A;  1R0A A;  4LF7 K;  3R8E A;  4M3Y A;  2HHQ A;  1UWB A;  1X9J A;  3V4I A;  2V52 B;  1YI2 N;  4DSL A;  2EX3 A;  1M1K O;  1GOA A;  1LAW A;  4AIL C;  2FSK A;  3LAK A;  3DLH A;  3EZW A;  3RMA A;  3THV A;  3NF7 A;  3HPG A;  3ZSW A;  3LDQ A;  3KK3 A;  4CEB A;  5AQT A;  2VWK A;  2RE2 A;  3OYF A;  4JI3 K;  3V81 A;  4ILG B;  1L3S A;  4J2A A;  4DR7 K;  4O4G A;  4B1U B;  2F8S A;  1MDU B;  4YDU C;  4FSV A;  5AQS A;  1NK4 A;  5M1N A;  2HMI A;  4JI6 K;  4WFB L;  4ICL A;  4FM1 A;  3TTD A;  2NRZ A;  3ZT1 A;  3SK3 A;  3I0R A;  4K0K K;  2D5R A;  3AVF A;  5AQI A;  1NMN A;  3QEW A;  4FWL A;  3AO3 A;  3FGU A;  3S9H A;  3V1O A;  3VER A;  1NGJ A;  1P90 A;  3J7Y P;  1NGG A;  3H3O B;  1E3M A;  2O8C A;  5GAG P;  4DUZ K;  3QIO A;  5B8H A;  1NGE A;  1U2V B;  3DXK A;  1C0U A;  2NRT A;  4CD1 A;  5DM6 L;  4GKJ K;  4LF8 K;  4L8R B;  3NAE A;  1TKZ A;  1RIL A;  2GV9 A;  4DTM A;  1N32 K;  3LP3 A;  2KQ2 A;  4R79 A;  4JK9 A;  2HVI A;  1F21 A;  2PAV A;  4FLT A;  2KFN A;  2ZJR L;  1HNW K;  4GV9 A;  4BRQ A;  5JIC A;  1WSH A;  4GW6 A;  2O8D A;  3CJ9 A;  3M6G A;  1HNX K;  4IFV A;  4FZZ A;  3NMU A;  4DKW A;  4BRP A;  1J5O A;  3A5L C;  3NDK A;  4C8M A;  1TKT A;  3CG7 A;  3CFO A;  2Z1J A;  4B1W B;  1K8A O;  2GWJ A;  4CF1 A;  4B3R K;  1S1X A;  1BI4 A;  3C6A A;  2HHW A;  2HNY A;  3O8M A;  2D0C A;  4CJK A;  1SS6 A;  1LCU A;  3AVC A;  3L6Q A;  3C7N B;  3VA3 A;  1NGA A;  2BH1 A;  1MU2 A;  5AQR A;  3O9R A;  4M3U A;  3QIP A;  4DB3 A;  1W2B M;  4KPY A;  2ZGY A;  1QZ5 A;  3KVG A;  3D2E A;  1D4X A;  3LDN A;  4BWM A;  5FPD A;  4FLY A;  4Z94 A;  1NGC A;  4O8K A;  4DFK A;  1W0H A;  4I9Q A;  3DLK A;  3E1Y A;  3T1A A;  3O80 A;  1YVU A;  3TSQ A;  2IVO A;  4KTZ A;  4DTU A;  4OKJ A;  3OBY A;  1XMO K;  3ENH A;  4O0I A;  4LF6 K;  5BRH A;  1TGO A;  5KPT A;  4H0V B;  2DTU A;  1BHL A;  3K5L A;  2O8D B;  3EYZ A;  2HND A;  2HNZ A;  4DCH A;  4BVP A;  5KTQ A;  1L3V A;  2UU9 K;  1YHQ N;  2YNF A;  4FWP A;  1G15 A;  3MXI A;  1D5A A;  3QML A;  4OPK A;  4OGE A;  2E6L A;  4DSI A;  1J6Z A;  4XEI A;  3KLH A;  5LY3 A;  3UE5 A;  5C15 A;  4RW4 A;  3JSM A;  2WOM A;  2QWP A;  5GIO A;  3TPQ A;  3OYC A;  3V9W A;  4DFJ A;  4IJN A;  1WLJ A;  5M1Q A;  4CBW A;  3S3M A;  2E6M A;  4ISF A;  4WCE L;  2W40 A;  3CIP A;  4FJN A;  4OPH A;  4B1X B;  2IGI A;  1KTQ A;  1XI1 A;  4FJM A;  4LH5 A;  4DR1 K;  3HK2 A;  1NOY A;  3CHW A;  2D1K A;  4AM6 A;  4JI2 K;  3HO1 A;  2GUI A;  3VGM A;  3T3F A;  2BGG A;  2HMP A;  1IBK K;  1NK7 A;  5A2Q O;  5LMN K;  1JLB A;  1VSI A;  2AA4 A;  1REV A;  2CGJ A;  4YOV A;  4BRD A;  4BR5 A;  4E7I A;  1XNQ K;  1VQ8 N;  1QQM A;  1BG3 A;  4BG9 A;  3MEE A;  1S22 A;  2OPQ A;  4KTQ A;  1ILY A;  2UYT A;  4QS9 A;  3K5M A;  3CJ1 A;  1DEJ A;  5LJW A;  3THY B;  4J2D A;  4V19 S;  2OYQ A;  4BR2 A;  3R6M A;  5FPE A;  4IOA L;  4RW8 A;  1VSH A;  3O3F A;  1ASU A;  5CY4 A;  4B9Q A;  3AVH A;  4YY3 K;  3NGZ A;  5J2M A;  4H4O A;  1HYS A;  1CXU A;  4BE0 A;  3CPW M;  1ZXO A;  3CCR N;  1OVQ A;  4DV3 K;  3U6F A;  4FW2 A;  3AAP A;  1NU0 A;  3QER A;  2XY7 A;  2Q0U A;  2A1S A;  4FJ9 A;  4A5B A;  1TAQ A;  4CK3 A;  4BRI A;  3KLF A;  1EET A;  2YJF A;  4LF9 K;  4BRC A;  4JKE A;  3OYE A;  2V7Z A;  3K5O A;  3PX0 A;  2A41 A;  3OYB A;  3LP2 A;  1ZBF A;  2G8F A;  3SAF A;  3SQ1 A;  1VQL N;  4DG1 A;  1RT3 A;  3FFI A;  1XWL A;  1KVB A;  4XH1 A;  2NRW A;  3J7A P;  1O1W A;  1Z05 A;  3OYH A;  2G8V A;  3ZSZ A;  4PA1 A;  4O44 A;  3HJF A;  1JCF A;  2IS3 A;  3EN9 A;  1FW6 A;  4DWI A;  4PUO A;  1RT4 A;  3WUH A;  3J7Z O;  2KZM A;  4JK7 A;  3R3L A;  4RW6 A;  3H6E A;  3L2V A;  2J4R A;  1I39 A;  4F8R A;  3J80 O;  4KB1 A;  3AV9 A;  5TKY A;  2AP1 A;  4JRP A;  4A2A A;  1KD1 O;  2QA4 N;  4HTL A;  3O4Q A;  3B6P A;  1KCF A;  3WXL A;  3RRG A;  4M7X A;  5JLF A;  4BR0 A;  1QZ6 A;  1TVR A;  5CZ2 A;  1HLU A;  1QE1 A;  1RDB A;  4NXN K;  4Z4F A;  3CET A;  1B9F A;  3V9S A;  4LSN A;  1L3T A;  2HF3 A;  1RTJ A;  3J81 O;  1U48 A;  1RT1 A;  1VSF A;  4EP4 A;  1S6Q A;  4JAX A;  1JLG A;  3I55 N;  3SQ2 A;  1GLC G;  4JKA A;  2ZJQ L;  4N47 A;  3IKM A;  1YTA A;  3QNN A;  4DMN A;  4OLA A;  3FE1 A;  4EAH D;  1N34 K;  4DU1 A;  3EY1 A;  1HPM A;  4KTW A;  4DUY K;  3HRG A;  1JCG A;  2XO7 A;  1BA0 A;  1I94 K;  4GY2 B;  2GWK A;  4DQP A;  4CZM A;  4DSK A;  2XHB A;  1N36 K;  1WAF A;  1VSE A;  3WQU A;  3VQ4 A;  5J2N A;  2NRV A;  2WON A;  2F9W A;  1BQN A;  4Z0U A;  3AA5 X;  4FJL A;  3AVG A;  1NG9 A;  5BPN A;  4DQI A;  2GEL A;  3O1W A;  3MN9 A;  4KKO A;  4CJE A;  3U8X A;  3AVB A;  3TWH A;  1Q86 O;  1S1V A;  3DRS A;  1S9G A;  3AVA A;  3DOL A;  4JEP A;  1IKY A;  1SZ2 A;  3O4N A;  2HBK A;  3H45 C;  3G6E N;  4ILJ A;  1YTU A;  1TYQ A;  3CJC A;  1JLE A;  2E1Z A;  1YIT N;  4BR4 A;  5AQM A;  3CMA N;  1RBV A;  1RTH A;  4DQR A;  3QEV A;  2UUC K;  3O9S A;  4BRA A;  2QWR A;  3I33 A;  3CXC M;  1GLL O;  3T69 A;  4B1Z A;  2QXL A;  1HYV A;  3MAQ A;  5HL7 L;  2RHK A;  1HNI A;  3M1F A;  4FJX A;  1JCE A;  1C0G A;  1Q9X A;  5DM7 L;  1WOQ A;  2QWL A;  4Z4H A;  5C25 A;  4DSF A;  4WFN L;  4CHQ A;  4XIU A;  3V6D A;  1BOT O;  2KW4 A;  4FJI A;  4FLW A;  1T6C A;  3PSF A;  4CJU A;  1TL1 A;  2HW3 A;  1HR0 K;  3OS0 A;  3TAE A;  2DY4 A;  1A5W A;  3HYF A;  2ASM A;  2IC3 A;  3KWG A;  3N4Q A;  4ZTJ A;  3L0Q A;  2X74 A;  1GLE G;  4CF2 A;  2YJE A;  1WNS A;  2JWK A;  3SMS A;  2ZWH A;  3D6R A;  1M90 O;  2P5G A;  4BRO A;  4OGC A;  4IG3 A;  3O3H A;  4NCB A;  3ZT4 A;  1TYQ B;  3DMJ A;  2ITG A;  1JKH A;  3EL2 A;  2VG5 A;  4B3O A;  3OYL A;  3OY9 A;  1SL0 A;  1NJX A;  4HCB A;  5KPZ A;  2YNG A;  4K8X A;  3ZSO A;  2FF3 B;  5M1O A;  3A5M C;  1CXQ A;  4BRE A;  5DK5 A;  4CGD A;  3K58 A;  1ZBS A;  4KH6 A;  1HJO A;  4ELV A;  1S1U A;  1UOC A;  4KH4 A;  1CZ9 A;  3ISN C;  1FJG K;  1WBD A;  2A5X A;  4E0D A;  4MQ3 A;  3P5J A;  3KK1 A;  4CFD A;  1ZYQ A;  3CM6 A;  4JI5 K;  2WUS A;  4BRM A;  1Z26 A;  2KZZ A;  2NRR A;  3L4I A;  1KQS M;  4CBX A;  2P9U A;  3FZM A;  5SWM A;  4YOT A;  5FLX O;  3CI5 A;  4QS7 A;  3QFP A;  2OTJ N;  4C8L A;  3V1Q A;  4M3Z A;  3MXJ A;  2P1J A;  2I7N A;  4X62 K;  1K8K A;  2BUP A;  2Y1I A;  3Q7C A;  4LH4 A;  4F3O A;  3AA2 A;  4CW7 B;  4CZI A;  2IAJ A;  4NCA A;  2NZT A;  2WC9 A;  1HNV A;  1TKX A;  1U49 A;  3O9U A;  4JLH A;  3IG1 A;  3VEN A;  4CEC A;  3OYN A;  1C1A A;  5JVH L;  4FK2 A;  1LAV A;  1NWK A;  3O9Q A;  3CFR A;  1TUU A;  1JLQ A;  1QHT A;  3SJH A;  1HMV A;  4AM7 A;  1EWR A;  1LOT B;  4U7B A;  4DV7 K;  3AA4 A;  4BG8 A;  1C6V A;  4CZF A;  1Q18 A;  2Z1I A;  3SAG A;  1QQO A;  4CJL A;  3ENO A;  4HUE A;  4DHY A;  4O5B A;  1TUY A;  2E1Y A;  4NXM K;  3G10 A;  1OVY A;  4B08 A;  3CCV N;  2F4V K;  2ZF5 O;  3WNF A;  4ID1 A;  2JLE A;  1NJY A;  1SKR A;  2P9U B;  1ATR A;  4CGI A;  3E9P A;  4LF5 K;  4DTN A;  1VQ9 N;  4CJ7 A;  3KZB A;  4CF9 A;  4FOE A;  4K42 A;  1U45 A;  1IBM K;  1ESV A;  1YJW N;  3LDO A;  3RSE A;  1K8K B;  2QM1 A;  3AO2 A;  3DXM A;  5T7B A;  1N5Y A;  2X6S A;  2P5O A;  3PX6 A;  4WQ5 A;  3P31 A;  4H5N A;  5F2R A;  4FXD A;  5AFU A;  4MO4 A;  3FZH A;  4FJK A;  4WE1 A;  2ITM A;  2OPR A;  5BR8 K;  3C7N A;  3V9U A;  3VEZ A;  3C94 A;  3KIO A;  2P51 A;  1X9W A;  4Z4E A;  1BO5 O;  3QEX A;  1BCM A;  1RT2 A;  3ZLJ A;  3QNO A;  4LC9 B;  4Z4G A;  3K2P A;  3FR0 A;  1YJN N;  3CCS N;  1D9F A;  4FOI A;  3VTH A;  1HKG A;  3UIQ A;  2QWN A;  3PO5 A;  4GVM A;  1IH7 A;  4FM2 A;  4FK0 A;  1WB9 A;  4RG8 A;  4DR5 K;  4U67 L;  1Q8I A;  3VQ9 A;  4LFB K;  4BAC A;  4NLC A;  2HF4 A;  3ZEU B;  4UY8 O;  4ID5 A;  1DTT A;  3VEY A;  1QS4 A;  3VQ8 A;  4KHN A;  4F3T A;  3IUC A;  1T44 A;  4AQY K;  4FPA A;  1T05 A;  4GV3 A;  4X65 K;  4MO5 A;  3HPO A;  3MXM A;  3ZSR A;  5IT9 O;  1EKE A;  3ATV A;  3RSE B;  2YKN A;  3DXM B;  3O6W A;  3LP1 A;  4B3T K;  4O0J A;  5C12 A;  4KBO A;  4CFA A;  3ULE A;  3R9P A;  4JKH A;  2OTL N;  1NK0 A;  3TAF A;  3G4S N;  3HI0 A;  2A40 A;  3HSC A;  3DWL A;  3ZSX A;  4E7H A;  3WXJ A;  5DMR A;  4CJF A;  3RRH A;  5H1S Q;  3QBX A;  4FWM A;  4ILH A;  2X6N A;  1RDC A;  3ZX3 A;  5J2Q A;  2KLA A;  3A5O C;  1IBL K;  1WBB A;  1ASV A;  2P9L B;  5C10 A;  4WQ4 C;  2ETJ A;  3P1G A;  4M3T A;  1J54 A;  2G8I A;  1S5J A;  4BRL A;  3RMC A;  1E4F T;  4IO8 A;  4BRF A;  3LZI A;  5I9E B;  2IVN A;  4CHP A;  1EXQ A;  4CZJ A;  5KRT A;  3RMD A;  1RTI A;  1ZBI A;  1S9E A;  4Q5V A;  3QO9 A;  1WSG A;  3UKR A;  2YNH A;  3CCQ N;  4HUG A;  4IXC A;  3L3U A;  4CZG A;  1T6D A;  1VHX A;  1D9D A;  2HBM A;  1XNR K;  5EOY A;  1EX4 A;  4YOU A;  4W5O A;  4H0Y B;  4CZK A;  3NGY A;  3P83 D;  2RKI A;  3RMB A;  3WNE A;  4CE9 A;  2ZJP L;  5FRN A;  2HHS A;  4JHD B;  3ULE B;  1N8R O;  2UUA K;  4FWO A;  3K57 A;  4DFM A;  1Z6R A;  2E2Q A;  1VQN N;  2VCP A;  1T7P A;  3FLC O;  3THY A;  5CE3 A;  3K0S A;  4DV6 K;  1GLF O;  4FLX A;  2IOC A;  3SMP A;  1X1P A;  1YIJ N;  2P9N B;  2FXU A;  3U3G A;  4CJT A;  1XHZ A;  2QK9 A;  1WN7 A;  2UXB K;  3KLE A;  2NRX A;  1VSK A;  3CJA A;  4H5V A;  2HHT A;  1GOB A;  3OHR A;  4OVL A;  3OW2 M;  1QVF M;  3CCL N;  3ZX2 A;  3ZT3 A;  3AVI A;  4QCL A;  4Z4C A;  3SNN A;  3NF9 A;  4IFY A;  1L5U A;  3EKU A;  2IIR A;  5CYQ A;  4H0T B;  3HXM A;  5AR0 A;  4JI8 K;  4DTP A;  1C0M A;  1KLM A;  3UKR B;  4FK4 A;  3VA0 A;  2F7T A;  3CER A;  2W42 A;  2E5L K;  3AGK A;  1XC9 A;  3LDS A;  1DLO A;  2BDP A;  3TTC A;  3U3Y A;  2QKB A;  1Q7Y O;  3WNH A;  2IDO A;  2OPP A;  3WXM B;  4X64 K;  1HKC A;  4GV6 A;  2XY5 A;  1BU6 O;  4IEI A;  1WUA A;  5BPL A;  1SL2 A;  4E89 A;  2KHO A;  3QEI A;  4I2P A;  1VSM A;  3ZET A;  4CEF A;  4CJ4 A;  4C1N I;  1BCO A;  1FKP A;  3NH2 A;  4HUF A;  4FCY A;  1MWK A;  4IWV A;  4FJ5 A;  4BE1 A;  2D4W A;  3AVJ A;  4LSL A;  4WFA L;  4OKE A;  1T03 A;  4A57 A;  4JKB A;  3HL8 A;  2P9K A;  5AQJ A;  5E41 A;  1S3X A;  1JL1 A;  3WEE A;  1N33 K;  1YAG A;  4K41 A;  1FK9 A;  2P9P B;  3SUQ A;  4MLE A;  1IJJ A;  5FDL A;  5AQO A;  1VQ7 N;  3NHG A;  4FO0 A;  2VQE K;  2ASP A;  1IKX A;  3A0I X;  3E9O A;  3OBW A;  4W5Q A;  3SLC A;  2Q2R A;  1B9D A;  3VQ6 A;  3IMX A;  3HPH A;  3MWT A;  1UA0 A;  3L8B A;  1WSI A;  2B6A A;  4PHT X;  4JNE A;  4KHS A;  4IDK A;  2Q0R A;  3B6O A;  3VGL A;  3SUP A;  4BRG A;  3BZK A;  3AO5 A;  4CGH A;  4AHU A;  4EHU A;  5JVG L;  5AQY A;  3ZET B;  2VGN A;  3O5B A;  2JWL A;  4AHV A;  2YNI A;  3MCA B;  4OKK A;  3L2U A;  3HP9 A;  1RDW X;  3PO4 A;  3VOV A;  4R5P A;  1YUW A;  2FBY A;  4JKC A;  5BPM A;  4M42 A;  3AGR A;  5KGX A;  3KWI A;  4BC3 A;  1KC8 O;  1RBU A;  2G8H A;  2QI2 A;  4FJH A;  3M8R A;  4BR9 A;  3FZL A;  4YOX A;  2P9K B;  5SZT A;  3TSP A;  3WEE B;  4BC4 A;  4JYA K;  3ASM A;  4DLG A;  5BR9 A;  3CCM N;  2YHW A;  3SV4 A;  1DT9 A;  4OO1 J;  4EZ6 A;  1Q9Y A;  4B9M A;  4KHQ A;  4PY5 A;  1XUP O;  3OYA A;  4DSJ A;  5ADX A;  1XMQ K;  4DF8 A;  1KFS A;  4FWS A;  3LP0 A;  4KRE A;  1WSF A;  3L2W A;  1YT3 A;  3QBW A;  3LL3 A;  3VET A;  3L2R A;  3NFA A;  2W6K A;  4DTO A;  3D2F B;  2E2P A;  4NYN A;  1J5E K;  4KI6 A;  4IZ9 A;  5D3G A;  3D7E O;  5KPR A;  4A2B A;  5AQK A;  5CYM A;  4I6M B;  4CD3 A;  1HQE A;  1NLV A;  3SBG A;  4E1M A;  5EX5 A;  1YJ9 N;  3OYG A;  2DPN A;  3LDL A;  2HHH K;  2P9S A;  2WBN A;  1ASW A;  3SBT A;  4PL8 A;  4PWD A;  1V4S A;  3KD1 E;  4FYD A;  1J53 A;  4DS5 A;  3ZSY A;  3MDQ A;  4YDU A;  3QB0 A;  4I9L A;  3THX A;  1WSJ A;  4MDB A;  3S3N A;  5KGW A;  3VES A;  1BGX T;  1KVA A;  5KRS A;  1NKB A;  5HRS A;  1ITG A;  2EHG A;  1UAX A;  1RT6 A;  4A62 A;  2G8W A;  3Q7B A;  5TKW A;  2DFF A;  5M1F A;  4K43 A;  5J2P A;  1BIU A;  4AHC A;  4H4M A;  4X66 K;  1NGB A;  3CQX A;  2WTU A;  4GNI A;  4LFA K;  3WXK A;  4M3X A;  1HQU A;  3T1H K;  4BR7 A;  5M1K A;  1ATS A;  4JKD A;  4FWN A;  2OZM A;  3GBT A;  4IOX A;  4EHT A;  1A5X A;  3MWP A;  3BP8 A;  1IKW A;  4Q0B A;  3H46 O;  3SPY A;  3ZCM A;  4KHU A;  3E66 A;  1MA9 B;  3OTO K;  4PKG A;  2CGK A;  2B5J A;  5AQP A;  4YNQ A;  2LSN A;  3K59 A;  2P9S B;  4FWQ A;  1KAZ A;  2X78 A;  5JS2 A;  2UXC K;  3WNG A;  3HTV A;  4J2B A;  4CIE A;  3I8D A;  3HM8 A;  3N4P A;  3VQQ A;  3AVK A;  1QQC A;  5GIN A;  3DM2 A;  1VK0 A;  2GEM A;  3THX B;  3LAN A;  3K9J A;  1OH5 A;  1QSS A;  2E2O A;  3EEQ A;  4FJ7 A;  2Z1H A;  3RVC A;  1W97 L;  3BGR A;  1BUP A;  2Z1G A;  3SV3 A;  5HRO A;  3VQB A;  3V1R A;  1RCH A;  1BWF O;  3LM2 A;  4CHY A;  3AA3 A;  4Y1C A;  2YKM A;  3SZ2 A;  3V9X A;  3TTF A;  4JI0 K;  1NGD A;  4FWK A;  4DV0 K;  1TKD A;  1KSP A;  5GAH P;  1VRU A;  1DTQ A;  3FZF A;  4DTJ A;  3JS6 A;  1U6Z A;  1Y64 A;  2ZE2 A;  3S41 A;  1ZBU A;  4F2R A;  2PYL A;  3QDK A;  4MDA A;  4KH5 A;  3UKU A;  5HOO A;  3SQ4 A;  1HRH A;  3M8P A;  2FC0 A;  3TAQ A;  3A2F A;  3ID8 A;  4CGJ A;  4CZL A;  3M5R A;  3G71 N;  1GOC A;  2F96 A;  4EIA A;  3CD6 N;  5AJ3 K;  3OS2 A;  1P8Z A;  1BIS A;  3OYJ A;  3ZT2 A;  4CER A;  3TAP A;  2A1R A;  1JLF A;  4CK1 A;  3U4L A;  1RBT A;  3DOK A;  1SV5 A;  2PBD A;  3H1V X;  1RBS A;  2BTF A;  1Q81 O;  2RPI A;  2FLO A;  1NK8 A;  3O4W A;  1QSL A;  4OJR A;  3TR8 A;  3LZJ A;  2NUB A;  3THW B;  4F9O A;  4O5F A;  5BRF A;  2YI1 A;  1K73 O;  2YHB A;  5FRO A;  5HRN A;  3LPU A;  1CLQ A;  3C65 A;  1CZA N;  3CCJ N;  1D8Y A;  4FJ8 A;  2D0P A;  3LWM A;  3VF6 A;  3KLI A;  1LWE A;  4B9U A;  5AZI A;  3TAB A;  3NH1 A;  1KAY A;  2E8A A;  3ZT0 A;  2E88 A;  1O13 A;  4CEZ A;  1KFD A;  4JS4 A;  3H08 A;  4B9V A;  3UKU B;  3SQ0 A;  5AZJ A;  3DRR A;  2IVP A;  4JI1 K;  3ZEU A;  3ATU A;  3KK2 A;  1Y97 A;  3CQ8 A;  4HTU A;  1ZBH A;  4DLE A;  2O8F B;  3LAL A;  1SL1 A;  3PY8 A;  2HB5 A;  1LW0 A;  4JI7 K;  2QKK A;  4CED A; 
#chains in the Genus database with same CATH homology
 1XWL A;  1U4B A;  3JYT A;  1KVB A;  1EX4 A;  4FLU A;  3OJU A;  3KLG A;  3SCX A;  4W5O A;  1O1W A;  3OYH A;  3NGY A;  4LD0 A;  2G8V A;  3ZSZ A;  3P83 D;  3QIN A;  4PA1 A;  4O44 A;  4AHS A;  3HJF A;  2RKI A;  1CZB A;  3RMB A;  4E7K A;  3LPT A;  2IS3 A;  3WNE A;  4CE9 A;  4CGG A;  4DF4 A;  4DWI A;  5FRN A;  2HHS A;  5CZ1 A;  4PUO A;  1RT4 A;  3K57 A;  4DFM A;  1TK5 A;  4AH9 A;  4CJ5 A;  2KZM A;  4RW6 A;  1T7P A;  3CM5 A;  3VQD A;  4E3S A;  1JL2 A;  3L2V A;  4DTR A;  3PX4 A;  1I39 A;  4F8R A;  4CCH A;  5I3U A;  4KB1 A;  3AV9 A;  4FLX A;  2IOC A;  3C6T A;  1X1P A;  4M45 A;  3SI6 A;  3IS9 A;  4JRP A;  1VSJ A;  4CJQ A;  4IG0 A;  4CK2 A;  3QES A;  3U3G A;  3O4Q A;  3B6P A;  1KCF A;  4CJT A;  2D0B A;  1XHZ A;  3RRG A;  2QK9 A;  1BL3 A;  1RNH A;  1WN7 A;  1S6P A;  1TVR A;  5CZ2 A;  3KLE A;  3IRX A;  4E7J A;  1VSK A;  4KV8 A;  3VN5 A;  1QE1 A;  1RDB A;  1GOB A;  4CEO A;  1S1T A;  3D0P A;  3T19 A;  4Z4F A;  2HHT A;  4OVL A;  4N5S A;  2PZS A;  1NJW A;  3RR7 A;  1HYZ A;  3V9S A;  1B9F A;  3QET A;  1LWF A;  3ZT3 A;  3AVI A;  2QXF A;  4QCL A;  4LSN A;  3QEP A;  2B4J A;  1LW2 A;  1L3T A;  1RTJ A;  4Z4C A;  3SNN A;  3NF9 A;  4IFY A;  4RW9 A;  1NK9 A;  3ZSV A;  1L5U A;  1U48 A;  4B8C A;  5CYQ A;  4FLV A;  1RT1 A;  1VSF A;  4EP4 A;  1S6Q A;  3HXM A;  4LY7 A;  1S1W A;  1KLM A;  1C0M A;  3ULD A;  4DQQ A;  4DTP A;  4FJG A;  4FK4 A;  1JLG A;  2ATQ A;  2O4I A;  1NKC A;  3SQ2 A;  3VA0 A;  1T8E A;  4OPJ A;  2W42 A;  3CYM A;  3NH0 A;  4H8K A;  4FZY A;  4N47 A;  4C8K A;  4PQU A;  1YTA A;  2RF2 A;  3QNN A;  3SPZ A;  2R7Y A;  4DMN A;  1SKS A;  4Y1D A;  2GBZ A;  4I2Q A;  1XC9 A;  2OA8 A;  4OLB A;  4OLA A;  4DU1 A;  3EY1 A;  3LDS A;  1BIZ A;  1DLO A;  3NBP A;  2BDP A;  4KTW A;  3LAM A;  3VQP A;  2XO7 A;  3U3Y A;  1WAJ A;  3KD5 E;  4KB0 A;  2QKB A;  3WNH A;  2YHA A;  4C8N A;  1TK0 A;  2E4L A;  2IDO A;  4K8Z A;  2OPP A;  4EZ9 A;  4DQP A;  2XY5 A;  4DSK A;  2XHB A;  2KFZ A;  3HST B;  1HPZ A;  4DFP A;  1SL2 A;  1WAF A;  1VSE A;  1NKE A;  4E89 A;  3RTV A;  3QEI A;  3KTQ A;  4B9L A;  4CFB A;  3VQ4 A;  4M41 A;  2O4G A;  2RN2 A;  2WON A;  4FM0 A;  5J2N A;  2DFH A;  4N41 A;  4CF8 A;  4I2P A;  1VSM A;  4TSX A;  5HRR A;  1BQN A;  4Z0U A;  3EZ5 A;  2FBV A;  4CEF A;  3AA5 X;  2D0A A;  1ZBL A;  4FJL A;  3AVG A;  4CJ4 A;  4DQI A;  1NJZ A;  1BCO A;  2OZS A;  3DLG A;  3PUF A;  1C1C A;  1FKP A;  4KKO A;  4CJE A;  4G1Q A;  4CJ3 A;  3NH2 A;  4DS4 A;  1UA1 A;  3AVB A;  4HUF A;  3E01 A;  3TWH A;  4FCY A;  4BDP A;  1S1V A;  3DRS A;  4FJ5 A;  4BE1 A;  3OYM A;  1S9G A;  2XY8 A;  3AVA A;  3DOL A;  3DLB A;  3AVJ A;  4LSL A;  1T03 A;  4OKE A;  1Z25 A;  3OYI A;  1IKY A;  3VQ7 A;  4RW7 A;  4DSE A;  3HL8 A;  3O4N A;  4IBN A;  1K6Y A;  3C95 A;  1QTM A;  4C8O A;  4KHY A;  5E41 A;  1WSE A;  2ZQB A;  1NOZ A;  1JL1 A;  5C24 A;  1J9A A;  3TAG A;  1YTU A;  3DI6 A;  3F9K A;  4JS5 A;  1JLE A;  2OPS A;  1FK9 A;  2ZD1 A;  3TAM A;  2XRI A;  3SUQ A;  4ELU A;  5FDL A;  1QSY A;  2VG7 A;  1KVC A;  3VQ5 A;  1RBV A;  1LWC A;  3NHG A;  4NYF A;  1RTH A;  1IKX A;  4DQR A;  3QEV A;  4FJJ A;  4W5Q A;  1TL3 A;  3M8Q A;  5K14 A;  3VQC A;  3L2Q A;  1B9D A;  3VQ6 A;  5HRP A;  3HM9 A;  3OJS A;  3HPH A;  1HYV A;  3MAQ A;  3F73 A;  1UA0 A;  3AVM A;  1HNI A;  2BAN A;  4DTS A;  4FJX A;  3L3V A;  3L8B A;  1L3U A;  1TAU A;  3KKR A;  4N56 A;  1WSI A;  2B6A A;  3ITH A;  4DU4 A;  4CEA A;  1RDD A;  1Q9X A;  4KHS A;  4IDK A;  2G8K A;  1TV6 A;  1A5V A;  3AO1 A;  5C42 A;  1U47 A;  1W9H A;  3B6O A;  5HP1 A;  1R0A A;  4Z4H A;  4M3Y A;  2HHQ A;  1UWB A;  3I0S A;  5C25 A;  4DSF A;  3V4I A;  3SUP A;  4DSL A;  2EX3 A;  4CHQ A;  4XIU A;  1GOA A;  1LAW A;  2KW4 A;  3AO5 A;  4DQS A;  3V6D A;  4FJI A;  2F8T A;  4CGH A;  4AHU A;  4FLW A;  4AIL C;  3LAK A;  4CJU A;  4FVM A;  1TL1 A;  4AHV A;  3L2U A;  3DLH A;  2YNI A;  4OKK A;  3HP9 A;  2HW3 A;  3OS0 A;  3RMA A;  3THV A;  3NF7 A;  1SUQ A;  3TAE A;  3PO4 A;  2DY4 A;  3HPG A;  2PYJ A;  4R5P A;  1A5W A;  3ZSW A;  3DRP A;  3KK3 A;  4CEB A;  2FBY A;  3PV8 A;  3SUN A;  3HYF A;  2VWK A;  4M42 A;  3ALY A;  3OYF A;  4ZTJ A;  2IC3 A;  5KGX A;  1JLC A;  3V81 A;  4J2A A;  1L3S A;  1VRT A;  4O4G A;  2X74 A;  4CF2 A;  2F8S A;  1WNS A;  1RBU A;  2BE2 A;  2G8H A;  4KRF A;  1NK4 A;  4FJH A;  3M8R A;  2HMI A;  3RWU A;  2P5G A;  3AO4 A;  4ICL A;  5SZT A;  4B8A B;  1SKW A;  4OGC A;  4IG3 A;  3O3H A;  4FM1 A;  1BI4 B;  4NCB A;  3ASM A;  4DLG A;  3ZT4 A;  1RTD A;  2DFE A;  3DMJ A;  3VQA A;  3SV4 A;  2ITG A;  1JKH A;  3ZT1 A;  3OS1 A;  3CFP A;  4EZ6 A;  3I0R A;  2D5R A;  3AVF A;  2VG5 A;  1Q9Y A;  4W5R A;  4B9M A;  4KHQ A;  4PY5 A;  3QEW A;  4N76 A;  4KFB A;  3HVR A;  2KTQ A;  3OYA A;  3AO3 A;  3S9H A;  4DSJ A;  3O3G A;  4B3O A;  3V1O A;  4DF8 A;  5HLF A;  1LV5 A;  1KFS A;  3OYL A;  3HP6 A;  3NGI A;  3LP0 A;  3OY9 A;  4QAG A;  1X9S A;  1SL0 A;  1BQM A;  4KRE A;  1WSF A;  3L2W A;  1YT3 A;  1NJX A;  4HCB A;  2VWJ A;  2YNG A;  3L2R A;  1RDA A;  3NFA A;  3ZSO A;  4E19 A;  4K8X A;  4JRQ A;  3QIO A;  4DTO A;  1CXQ A;  5DK5 A;  4CGD A;  4MFB A;  3DYA A;  4CIG A;  3K58 A;  4NYN A;  4KI6 A;  1C0U A;  1S1U A;  1UOC A;  2G8U A;  4ELV A;  3SJJ A;  5D3G A;  1CZ9 A;  5CYM A;  1N6Q A;  4L8R B;  5FRM A;  1C0T A;  3NAE A;  1HQE A;  1TKZ A;  3ISN C;  2AJQ A;  4E1M A;  4BDY A;  1RIL A;  2GV9 A;  3NF8 A;  4DTM A;  4MQ3 A;  1FXX A;  4E0D A;  3P5J A;  3KK1 A;  3LP3 A;  4CFD A;  3CM6 A;  3OYG A;  1ZYQ A;  3MEC A;  2KQ2 A;  4NCG A;  1Z26 A;  4CJS A;  2HVI A;  2KZZ A;  5KI6 A;  1F21 A;  3V9Z A;  4FLT A;  1RBR A;  1IG9 A;  2KFN A;  1ASW A;  5SWM A;  4YFU A;  4PWD A;  4C8L A;  3KD1 E;  1WSH A;  3V1Q A;  4GW6 A;  1J53 A;  3MXJ A;  2P1J A;  3ZSY A;  4DS5 A;  4M3Z A;  4FYD A;  4IFV A;  4FZZ A;  4GMJ B;  1FKO A;  3HVT A;  4I9L A;  1J5O A;  3S3N A;  1WSJ A;  2Y1I A;  2YV0 X;  4C8M A;  3NDK A;  1TKT A;  3AVL A;  2HVH A;  3CG7 A;  4LH4 A;  3CFO A;  5KGW A;  2Z1J A;  3AA2 A;  5J1E A;  4F3O A;  1BGX T;  1KVA A;  2IAJ A;  4CF1 A;  5KRS A;  1NKB A;  1S1X A;  1BI4 A;  3DLR A;  1HNV A;  5HRS A;  1TKX A;  1NK5 A;  4NCA A;  2HHW A;  1U49 A;  1ITG A;  2EHG A;  1UAX A;  1RT6 A;  2D0C A;  2HNY A;  4CHO A;  4CJK A;  4JLH A;  3IG1 A;  3OYK A;  2G8W A;  4CEC A;  2DFF A;  1C1A A;  3AVC A;  3OYN A;  4ZHR A;  5J2P A;  1BIU A;  4AHC A;  3VA3 A;  4H4M A;  4FK2 A;  1MU2 A;  1LAV A;  4FLZ A;  4FZX C;  4UQG A;  2FBX A;  4CES A;  4M3X A;  3CFR A;  4M3U A;  1HQU A;  3QIP A;  1JLQ A;  1QHT A;  4ELT A;  4KPY A;  1HMV A;  4BWM A;  2OZM A;  3AA4 A;  4FLY A;  1C6V A;  1A5X A;  2Z1I A;  4F4K A;  4M3W A;  2VG6 A;  1IKW A;  3OVN A;  4CJL A;  1W0H A;  4HUE A;  4DFK A;  4I9Q A;  4Q0B A;  1VSL A;  3NCI A;  3SPY A;  3ZCM A;  4KHU A;  3DLK A;  4O5B A;  4HCC A;  3TAR A;  3G10 A;  3HT3 A;  3T1A A;  4AHR A;  1YVU A;  1RT7 A;  4EP5 A;  4KTZ A;  4DTU A;  4B08 A;  4OKJ A;  2B5J A;  4KAZ A;  4CIF A;  3WNF A;  4CHZ A;  1XHX A;  4ID1 A;  2JLE A;  4O0I A;  4YNQ A;  1NJY A;  2LSN A;  3K59 A;  1SKR A;  4CGI A;  1TGO A;  4DTN A;  1X9M A;  3KJV A;  5JS2 A;  2X78 A;  4CF9 A;  3IAY A;  1I3A A;  4O55 A;  3WNG A;  1U45 A;  2Y1J A;  1NK6 A;  4CJW A;  2DTU A;  4J2B A;  1BHL A;  4CIE A;  3K5L A;  3I8D A;  4DTX A;  1KLN A;  3EYZ A;  3KKS A;  2HND A;  2HNZ A;  3AVK A;  3VQQ A;  1QQC A;  3DM2 A;  3AO2 A;  5T7B A;  1VK0 A;  5KTQ A;  1L3V A;  1N5Y A;  2YNF A;  2XY6 A;  3TAN A;  3LAN A;  2X6S A;  1G15 A;  1U04 A;  3MXI A;  1D5A A;  1TK8 A;  2P5O A;  1QSS A;  3PX6 A;  4CF0 A;  4OPK A;  1JXE A;  2E6L A;  4OGE A;  3SUO A;  1C1B A;  4DSI A;  4FXD A;  4FJ7 A;  3KLH A;  2Z1H A;  3NE6 A;  1HJR A;  2HHV A;  3BGR A;  4CFC A;  3SV3 A;  2Z1G A;  5HRO A;  3C6U A;  4RW4 A;  3VQB A;  3JSM A;  4B9N A;  4WE1 A;  2WOM A;  4FJK A;  3V1R A;  1RCH A;  4CHY A;  2OPR A;  3OYC A;  4CEE A;  3VQE A;  3AA3 A;  3V9U A;  3V9W A;  1IKV A;  3D45 A;  4DFJ A;  4Y1C A;  3C94 A;  3KIO A;  2YKM A;  2P51 A;  3SZ2 A;  3SYZ A;  3V9X A;  1X9W A;  4Z4E A;  3QEX A;  1WLJ A;  1BCM A;  1RT2 A;  3S3M A;  1TKD A;  2E6M A;  1KSP A;  1VRU A;  1DTQ A;  3QNO A;  4Z4G A;  3K2P A;  4DTJ A;  1B92 A;  1D9F A;  4CJP A;  3UIQ A;  4FJN A;  3PO5 A;  4GVM A;  2IGI A;  1IH7 A;  4FM2 A;  4FK0 A;  1KTQ A;  1XI1 A;  4FJM A;  4LH5 A;  4RG8 A;  2PY5 A;  4CGF A;  3K5N A;  2ZE2 A;  1Q8I A;  1ZBU A;  4CEQ A;  3TI0 A;  4F2R A;  3HK2 A;  2PYL A;  3VQ9 A;  3OYD A;  1NOY A;  4KI4 A;  4BAC A;  4BWJ A;  1JLA A;  3HO1 A;  2GUI A;  4DU3 A;  5JS1 A;  4ID5 A;  3T3F A;  3M8S A;  1DTT A;  3SQ4 A;  1HRH A;  3M8P A;  3QLH A;  2BGG A;  2FC0 A;  1QS4 A;  3A2F A;  3VQ8 A;  4CGJ A;  3TAQ A;  1NK7 A;  4B9T A;  4KHN A;  4F3T A;  4QOZ B;  1JLB A;  1VSI A;  1GOC A;  4CJR A;  4J2E A;  2F96 A;  3DLE A;  1T05 A;  1REV A;  3OS2 A;  4BE2 A;  4FW1 A;  4KHW A;  1BIS A;  3OYJ A;  2Q3S A;  3ZT2 A;  3NF6 A;  4CER A;  4BDZ A;  3TAP A;  2A1R A;  3HPO A;  3MXM A;  1JLF A;  3G0Z A;  3MED A;  3ZSR A;  4CK1 A;  1RBT A;  3DOK A;  1EKE A;  1SV5 A;  4CJV A;  4E7I A;  2QKK A;  2YKN A;  3ZSQ A;  1KRP A;  4AHT A;  4HHT A;  1RBS A;  3LP1 A;  3RR8 A;  3MEE A;  2OPQ A;  4KTQ A;  2RPI A;  4O0J A;  2FBT A;  2HHU A;  4CFA A;  3S3O A;  3K5M A;  1NK8 A;  1QSL A;  5EU7 A;  4E1N A;  1NK0 A;  3TAF A;  3BDP A;  4OJR A;  4J2D A;  2OYQ A;  3TR8 A;  3LZJ A;  2NUB A;  1EP4 A;  3ZSX A;  4E7H A;  4B9S A;  1VSD A;  5DMR A;  4RW8 A;  3MEG A;  4CJF A;  3RRH A;  1VSH A;  3O3F A;  1ASU A;  2X6N A;  2YHB A;  5CY4 A;  5FRO A;  3AVH A;  1RDC A;  3LPU A;  5HRN A;  3NGZ A;  5J2M A;  5J2Q A;  4H4O A;  1HYS A;  1CLQ A;  1RT5 A;  1CXU A;  1ASV A;  4KO0 A;  4CHN A;  4BE0 A;  1D8Y A;  4FJ8 A;  3LWM A;  2ETJ A;  3P1G A;  3U6F A;  3KLI A;  4M3T A;  4W5N A;  1J54 A;  4FW2 A;  4M3R A;  1LWE A;  1S5J A;  4B9U A;  3RMC A;  2G8I A;  3TAB A;  3LWL A;  3NH1 A;  4ZTF A;  4F2S A;  3QER A;  3LZI A;  1JXB A;  3ZT0 A;  4E7L A;  2XY7 A;  2A1S A;  4CHP A;  4FJ9 A;  1EXQ A;  5KRT A;  2I5J A;  4CEZ A;  3RMD A;  1KFD A;  1RTI A;  1TAQ A;  4JS4 A;  3H08 A;  4CK3 A;  1ZBI A;  4B9V A;  1S9E A;  3KLF A;  4Q5V A;  3SQ0 A;  4I7F A;  1EET A;  3QO9 A;  5I42 A;  1WSG A;  1IO2 A;  3DRR A;  2JGU A;  2YNH A;  4HVJ A;  2HHX A;  3AVN A;  4HUG A;  3OYE A;  3K5O A;  3PX0 A;  3OYB A;  3KK2 A;  1Y97 A;  3LP2 A;  1ZBF A;  4Z4I A;  3L3U A;  4W5T A;  3CQ8 A;  4HTU A;  5HBM A;  1ZBH A;  2G8F A;  4IKF A;  4DLE A;  3SQ1 A;  3LAL A;  1SL1 A;  3PY8 A;  4DG1 A;  1RT3 A;  2HB5 A;  1D9D A;  1LW0 A;  3FFI A;  4CED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...