3LP3A

P15 hiv rnaseh domain with inhibitor mk3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
SYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords p15
publication title Structural basis for the inhibition of RNase H activity of HIV-1 reverse transcriptase by RNase H active site-directed inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
total genus 37
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lp3A00
2EX3A 3JYTA 1CLQA 4HVJA 1RT5A 5DK5A 4C8LA 3OYGA 2KZZA 3V4IA 1WSIA 3DM2A 1K6YA 2HVIA 1LWCA 2WOMA 4NCGA 4CHNA 4HUGA 1X9WA 3IAYA 4OKEA 4FM2A 1MU2A 3ITHA 4I2PA 4CIGA 3U3GA 5I3UA 4C8KA 1NOYA 1B9FA 1ZBUA 3VQ4A 3VQEA 4FJMA 4CJRA 4OLAA 2WONA 3BGRA 3HXMA 2F96A 1UWBA 4Z4GA 4GMJB 3WNHA 5KGWA 4M3WA 2XY7A 2BANA 4DTUA 1U45A 1JLFA 1KVAA 1VK0A 4LSNA 4CIFA 1LAVA 1YVUA 4HUFA 1UOCA 4PA1A 4FCYA 4B08A 1FXXA 5HROA 3TI0A 3RR7A 4L8RB 3DRPA 1BIUA 4C8NA 2VWJA 4FM1A 4DS4A 3RMBA 4B9UA 4TSXA 2G8VA 3K5OA 2G8IA 3TR8A 4HHTA 4B9TA 1TAQA 4DTXA 4KPYA 4AHCA 4JS4A 3ASMA 3CQ8A 2HB5A 1D9FA 3CYMA 3AO2A 3AVJA 2X74A 1RTJA 4KTZA 3TAMA 3QETA 4M3XA 3PO4A 3DLBA 1S6PA 1CXQA 3KLIA 3AV9A 1Q8IA 2YHBA 3MAQA 3OVNA 4JLHA 4FW2A 2W42A 3DOKA 1L3TA 4CJPA 3OYLA 3NDKA 4E1MA 3PUFA 4DQQA 2RN2A 3K2PA 3EZ5A 3O3GA 3V9XA 1ZBFA 1KSPA 4FJHA 4CHYA 4KHUA 4FZZA 3RRHA 1YTUA 3DRSA 4E19A 5KGXA 1HRHA 3LP1A 1BIZA 2G8UA 3K59A 3KK1A 3DLRA 1VSFA 2Z1HA 4BWJA 4CEZA 1HYSA 3O3FA 3SI6A 1RBUA 5SZTA 4OPJA 4FJKA 4CK2A 3NF9A 4PQUA 2YV0X 2ZQBA 3SQ0A 4Z4EA 5JS1A 3L3UA 4N47A 3JSMA 1CXUA 1NOZA 4W5NA 1WSFA 3V9UA 4DTRA 4DLGA 4OGCA 1HQEA 4DU4A 3T1AA 4FK2A 2HHUA 3KKSA 3AVCA 2KZMA 1I39A 2Y1JA 4DQPA 1IKYA 4M41A 4UQGA 1C1AA 2GUIA 3K5LA 4B9VA 1HNVA 4E0DA 3QEXA 1ITGA 2DFEA 2X78A 4CHOA 5C42A 2QKKA 3MXMA 3OYFA 3VQ5A 3SQ1A 1NK8A 4Z4CA 2D0BA 1RBRA 3LWMA 1JL1A 3OYNA 1HPZA 3AVGA 1WAFA 3DMJA 1NK7A 4CEQA 1KVCA 4HCCA 2A1RA 3VQBA 1BISA 1RT4A 4G1QA 3SJJA 3S3OA 3ZT0A 4PUOA 4N41A 1ZBIA 3QLHA 4CJEA 3RMCA 4BWMA 4C8MA 1RDDA 1DLOA 3KTQA 4DSJA 3NH2A 4FZXC 1JLEA 3FFIA 4CGDA 3BDPA 4WE1A 3CFOA 2BE2A 2HVHA 1TK5A 3LWLA 3V1QA 3NF6A 4I7FA 3S9HA 1S1WA 2Z1GA 4K8XA 3OJSA 4GVMA 1RT2A 3OYAA 2VG6A 3CG7A 5HRRA 1VSEA 3VQCA 4DQSA 1EX4A 4FK4A 1J5OA 4B9NA 3HO1A 3AVFA 1TVRA 2XHBA 1TK0A 3ZSYA 1ASWA 1QE1A 2P5OA 2RF2A 1GOBA 4DFMA 2JLEA 1EP4A 1XWLA 4DF4A 1RTDA 3QNNA 1X1PA 4CF2A 3PX0A 2NUBA 1VSHA 5KTQA 1NK4A 4H4OA 1O1WA 1S9GA 3TARA 3RWUA 2GV9A 1C1CA 3M8SA 3QEIA 3OJUA 3S3NA 3VQ9A 3TAPA 4DSLA 1T05A 4CFAA 1IKVA 4CJWA 4RG8A 3T19A 3U6FA 1YTAA 1TL3A 3KLEA 3K5MA 1KRPA 2PY5A 1DTQA 4DTNA 2FBYA 4KHYA 4DWIA 4KHQA 2P5GA 1JXEA 3M8RA 3LANA 4CHZA 3LAMA 4Y1CA 3KLHA 3QEWA 4FLZA 4FLXA 2F8SA 3VN5A 3D0PA 1RTIA 4J2AA 2X6SA 4RW9A 4FYDA 1T7PA 3LZIA 4B9SA 3LP3A 2PZSA 2GBZA 4CIEA 3NH1A 3SZ2A 2HHVA 1JLCA 4DTOA 1C0TA 3HYFA 2DFHA 1U47A 2QK9A 5HP1A 4CJTA 4IBNA 1QSSA 3AO3A 2IAJA 1Z26A 4FJIA 3HL8A 5D3GA 4IFYA 3KK2A 3V9WA 4J2EA 3L2WA 3G0ZA 4RW8A 3VQ8A 4KREA 2D5RA 3A2FA 4QAGA 4RW4A 4BACA 5J2MA 1U04A 1BCOA 3HVTA 2IC3A 2D0CA 1KVBA 3H08A 1UA0A 1RBVA 1BI4A 3OS0A 3NE6A 4FW1A 5HRPA 4N56A 2G8KA 4CFDA 1WSGA 2E4LA 4BE1A 1BGXT 1NJWA 4FM0A 1D8YA 4FJNA 1WSHA 2DY4A 3S3MA 4IKFA 2DFFA 2YNFA 1W9HA 1BL3A 4I2QA 4M42A 4YFUA 2B6AA 4DTSA 1FKPA 3PV8A 3L3VA 4QCLA 4E7HA 1I3AA 2E6MA 3KD5E 1J54A 3NCIA 4CESA 3B6OA 4FZYA 3DOLA 3HPGA 3AA5X 2E6LA 3AO4A 1L3VA 4FJ9A 2B5JA 1WSEA 4Z4HA 3DLHA 4F2RA 1JLAA 4FVMA 5E41A 4KTWA 3LDSA 4DQRA 3PY8A 3AVHA 1RBSA 2KW4A 4KKOA 3RMAA 1SKSA 2YNIA 2OZSA 4ID5A 3TANA 4CJVA 4LH4A 2VG7A 3VQDA 4JRPA 1JLGA 3V81A 4M3TA 1HJRA 3ULDA 1S6QA 1WAJA 4CFCA 1D9DA 5J2PA 4OPKA 2G8WA 3AVBA 4O44A 3C94A 1QHTA 4E3SA 2G8FA 3PO5A 4H4MA 3OYCA 4CEDA 4BDPA 4ELUA 4F4KA 3VQPA 3EYZA 2FBTA 3MXJA 1VSJA 3ZT4A 3NHGA 4JS5A 4FJXA 3K57A 3WNEA 3C95A 1L3SA 1SL2A 1NK9A 4E7JA 4E1NA 4DQIA 3LALA 4EZ9A 3O4QA 2IOCA 1IKXA 1XC9A 2JGUA 4N76A 2P1JA 4PWDA 1BQMA 1RNHA 4KTQA 3NF7A 3V1OA 4KB0A 3QESA 1NJYA 3TAQA 4F2SA 4PY5A 1VSLA 3DLEA 3ZSZA 3ALYA 3IRXA 5EU7A 2QXFA 5HBMA 4J2DA 3VQ6A 4CEBA 4FJ5A 4M3YA 4B9LA 1XHXA 4CF1A 5K14A 3HPHA 3V1RA 4CJ4A 5HRNA 3I0SA 3TAFA 4F8RA 1W0HA 1LAWA 4CGGA 2IS3A 2I5JA 4KV8A 1NK6A 2P51A 2OPPA 1R0AA 2AJQA 3SQ4A 4M3UA 1GOCA 1GOAA 1U49A 1X9SA 3THVA 5DMRA 2XY8A 4KO0A 1RT1A 4M3ZA 3AVMA 4CJUA 2BDPA 2EHGA 4FK0A 4CE9A 1IH7A 2IGIA 1ASVA 1REVA 2B4JA 3NH0A 2HNYA 3LPTA 4ZHRA 4DFKA 3C6TA 3M8QA 5JS2A 1N5YA 3LP2A 4CJLA 5CYQA 3OYEA 4AHUA 3K58A 2VWKA 5CZ1A 1S1UA 1TGOA 2YKNA 3DRRA 4C8OA 3NGYA 1RT7A 1NKCA 4JRQA 3P5JA 3ZCMA 1HNIA 1YT3A 4BDZA 3NF8A 5FDLA 4AHRA 4M3RA 2OPQA 4FJJA 3U3YA 4CEEA 5KRTA 2XO7A 1UA1A 1Z25A 4KHWA 1NKBA 4E89A 4K8ZA 3WNGA 1WNSA 3AO1A 3KJVA 3OYMA 2FC0A 3HM9A 1SKWA 3HSTB 4OLBA 4LSLA 3AVKA 4CGHA 4CHQA 4DSEA 2HMIA 1TAUA 3MXIA 3ZSVA 4Z0UA 4Z4FA 3AVNA 4DSKA 1JL2A 1VRUA 2O4GA 2HHQA 4KB1A 2O4IA 4CGFA 3DI6A 4M45A 3VQ7A 4W5TA 1ZBHA 1TKXA 4Q0BA 1SV5A 4I9QA 3OYJA 4CK1A 3KK3A 4OVLA 3B6PA 3F9KA 4IFVA 3EY1A 2OYQA 4HCBA 5CYMA 3NFAA 4FJGA 2QKBA 1S1XA 1SKRA 3ZSOA 4O0IA 3KD1E 4KAZA 3AVIA 5T7BA 3L2QA 4FJ8A 2HHTA 4B8CA 4I9LA 4CF8A 1BI4B 3TABA 1C0MA 4Y1DA 4BE0A 1LWFA 4GW6A 2XY6A 3CM5A 1KLNA 3G10A 1RDAA 3QIOA 4DU3A 4HUEA 3HT3A 2YNHA 4CEOA 4CECA 3VA0A 4AH9A 4LD0A 3SUPA 1ZYQA 2Z1JA 2RPIA 3CFPA 5I42A 1KTQA 3NGZA 1F21A 3QEVA 1SUQA 1NJZA 4E7KA 1TKTA 3AA4A 1A5VA 2YHAA 4YNQA 2A1SA 1JLBA 2OPRA 4MQ3A 1JLQA 3SUQA 1QTMA 2G8HA 4KRFA 4FLTA 4OKKA 3L2UA 3NGIA 3VA3A 4AHTA 2YNGA 2Z1IA 3SUNA 4DTJA 4EP5A 2KFZA 1VSMA 4KI6A 5C25A 4ELTA 1NKEA 3KKRA 1JKHA 2KQ2A 5FRMA 3AVAA 1A5WA 1LWEA 4DLEA 3T3FA 4B9MA 2ETJA 4EZ6A 1KCFA 1Y97A 1RDBA 4MFBA 1EXQA 2FBVA 1J9AA 3O3HA 3MEDA 3NAEA 5J1EA 2X6NA 2BGGA 1KFDA 4R5PA 5HRSA 3ZT3A 4CEFA 4ZTFA 2ITGA 3TAGA 3DLKA 1VSDA 1TKZA 4DU1A 4AILC 3SPYA 1NJXA 3M8PA 2HHXA 1ASUA 5J2QA 3OS2A 4XIUA 3SYZA 1Q9XA 3QNOA 1BQNA 4DMNA 5C24A 3K5NA 3I8DA 3NBPA 1HQUA 3WNFA 1NK5A 3RMDA 4DSIA 4DTPA 3MECA 2D0AA 2VG5A 1WLJA 3F73A 4CJFA 1X9MA 1S5JA 4O4GA 4IG0A 3IS9A 3HP6A 2KFNA 2XRIA 1TK8A 2HNDA 4CFBA 1A5XA 1RDCA 1CZBA 3MEGA 3LZJA 3TWHA 1DTTA 3ZSXA 4NYNA 3RRGA 4KHNA 3LAKA 5J2NA 3DLGA 4IDKA 1RTHA 1C0UA 2ZE2A 3OYKA 1HMVA 3HPOA 1SL1A 3QERA 1T03A 4CF9A 1S1TA 4HTUA 4DF8A 4ICLA 1S9EA 1EETA 4O55A 1QSLA 4FXDA 1RT6A 5FRNA 3SPZA 2HNZA 3L2VA 3ZSQA 3ZSRA 3AO5A 4ZTJA 1HYZA 3KLFA 1D5AA 4CCHA 3OYBA 3L8BA 1N6QA 2OA8A 4W5QA 3D45A 3QINA 4AHSA 1ZBLA 3V6DA 1IO2A 4NCBA 2R7YA 3OS1A 5CY4A 4CJ5A 4Q5VA 4FLYA 4B3OA 1QS4A 4OGEA 4CGIA 1TV6A 4O5BA 4DG1A 5KI6A 1HYVA 4CK3A 3CFRA 3OYIA 4BDYA 1NK0A 1IG9A 1BCMA 3V9SA 1UAXA 2ZD1A 1JXBA 2OZMA 1RT3A 1RCHA 1S1VA 3ZSWA 4AHVA 4CGJA 4CEAA 1XHZA 3SV3A 1FKOA 1C1BA 4OJRA 3AVLA 4FLWA 3P83D 2Q3SA 5CZ2A 4KHSA 4KI4A 4ELVA 1L3UA 4NCAA 3TAEA 4ID1A 2HW3A 2FBXA 4E7LA 2OPSA 3VQQA 4DFJA 1T8EA 3RTVA 4CJQA 2YKMA 4BE2A 4LH5A 3SUOA 1XI1A 1U4BA 3V9ZA 3SQ2A 3AA3A 3CM6A 1KLMA 1LW0A 4W5OA 3OY9A 4FLUA 2XY5A 3HJFA 4RW7A 4CJSA 3LP0A 4B8AB 1QSYA 4F3OA 4FJ7A 4Z4IA 4KFBA 4CHPA 1L5UA 3UIQA 1QQCA 2IDOA 2PYJA 3C6UA 4DTMA 2ATQA 3SCXA 5HLFA 5FROA 1VRTA 4EP4A 1KFSA 1G15A 2HHWA 3P1GA 2DTUA 1C6VA 2LSNA 2F8TA 3L2RA 1BHLA 3HK2A 1WSJA 3DYAA 4O0JA 1Q9YA 1SL0A 1TL1A 2RKIA 3PX6A 5KRSA 4IG3A 1LW2A 4DS5A 3QIPA 5SWMA 3OYHA 3OYDA 2PYLA 4DSFA 3QEPA 3SNNA 3PX4A 1EKEA 1RILA 1B92A 4FLVA 3LPUA 4QOZB 4F3TA 3I0RA 3O4NA 1VSKA 3ZT1A 1U48A 3HVRA 4E7IA 1CZ9A 4CERA 3VQAA 4W5RA 3HP9A 1FK9A 3AA2A 4N5SA 3RR8A 2HHSA 1B9DA 4CJ3A 4DFPA 4FJLA 1RBTA 1IKWA 3ZT2A 1WN7A 4CJKA 3KIOA 3ISNC 1LV5A 3IG1A 4RW6A 1J53A 2Y1IA 1VSIA 1TKDA 3QO9A 3KLGA 2KTQA 4LY7A 4J2BA 4CF0A 4H8KA 3SV4A 3E01A 3MEEA 4NYFA 4OKJA
chains in the Genus database with same CATH superfamily
3JYTA 5DK5A 1WSIA 2HVIA 3IAYA 1GLAG 4CHNA 4E1JA 4FM2A 4I2PA 3U3GA 5I3UA 1ZBUA 3VQ4A 4CJRA 3ZX0A 4OLAA 4Z4GA 4GMJB 5KGWA 4M3WA 2QA4N 4LSNA 1LAVA 5HROA 5AZIB 4B08A 2ASMA 3VEOA 5EVZA 3G4SN 2YCHA 4TSXA 4HHTA 3B8AX 2BTFA 3EEQA 3CQ8A 3AO2A 3FZHA 3U9DA 2X74A 2I7NA 3R3LA 1S6PA 2A5XA 3CCUN 3KLIA 5AZIA 3OVNA 1QQMA 3SMSA 1KSPA 3RRHA 5BR9A 4DCHA 4E19A 3LP1A 3SBGA 3DLRA 1HYSA 3O3FA 1RBUA 1SQKA 4CK2A 3FE1A 1C0FA 4H03B 4N47A 3JSMA 1YITN 4DU4A 5AQGA 3CHWA 3A5MC 4E0DA 3ZLJA 2X78A 1T6CA 1RBRA 4JK7A 2WBNA 5KQ8A 1OKJA 4V19S 3DMJA 4EAHD 4HCCA 2I7PA 4LF4K 3SJJA 4DR3K 4N41A 1BA1A 3O8MA 4CJEA 3CIPA 4C8MA 1GLLO 3HTVA 2WTUA 5GAGP 3NVKA 3BDPA 3UKUA 3S9HA 1S1WA 3MX5A 5HRRA 3J7ZO 1VSEA 4JEPA 3THYA 3A5OC 5EOYA 3R1XA 1TVRA 2XHBA 1TK0A 1ASWA 2E2OA 4MO4A 4CZLA 3CCRN 4DF4A 3O80A 2HMPA 2NUBA 5KTQA 4BROA 4WQ4A 4U7BA 2GV9A 3M8SA 3QEIA 4DSLA 3C65A 4CJWA 4CBWA 1TL3A 3KLEA 3K5MA 1KRPA 2F7TA 3LM9A 4DTNA 2FBYA 2V7ZA 4BR4A 4NLBA 4C1NI 3LANA 4CHZA 3LAMA 1ZXOA 2X6SA 4YDUA 3NH1A 1BG3A 1JLCA 2DFHA 2CH5A 2QWOA 2IAJA 1Z26A 4BR2A 2YX6A 4IFYA 5E26A 4BACA 4QAGA 2GEMA 4X64K 3SK3A 3HVTA 2D0CA 4JHDB 4BVOA 1BI4A 3OS0A 3VGKA 5HRPA 1WSGA 3QBWA 5AQMA 5AFUH 4YFUA 3KWIA 4DTSA 2F4VK 3L3VA 4MO5A 5BPNA 1KD1O 1J54A 5AZJB 3B6OA 3SAFA 3W0LA 1N8RO 3AA5X 1L3VA 1WSEA 1Q7YO 1JLAA 4FVMA 5E41A 5BR8K 4KKOA 4FWRA 4EHTA 5H1SQ 3TANA 4DR5K 4CJVA 2VG7A 4JRPA 3CCLN 5GIPA 1G99A 1WAJA 1HR0K 3QMLA 2CH6A 3JAMO 4O8KA 4O44A 1QHTA 3IUCA 4H4MA 4BDPA 3EYZA 2FBTA 2PAVA 1VSJA 3C6AA 3BF3A 4CZIA 3C95A 1H1VA 2P9IB 3O4QA 2VWBA 3CJCA 2P1JA 4FL9A 4KTQA 1HUXA 3AGKA 1NJYA 3TU5A 1W7AA 1VQKN 3DLEA 1GLCG 1X9JA 4A2AA 1Q82O 1O13A 3D2FB 1OH8A 2E5LK 3V1RA 4JAXA 4O8UA 1W0HA 3JS6A 4CGGA 4KV8A 5HL7L 1NK6A 3TTDA 1GOCA 2O8EA 3LDNA 3THVA 4BG8A 1XC3A 4KHPK 2Q2RA 1VQNN 2BDPA 4ISEA 3D2FA 2IGIA 3PSFA 1REVA 1J5EK 3LPTA 3VEWA 3C6TA 3GE1A 3M8QA 4NXMK 4KH5A 3LP2A 3O9RA 1NGBA 3K58A 1S1UA 2YKNA 5M1OA 3DRRA 3EE8A 3VF4A 1XNRK 1HNIA 1YT3A 3NF8A 3G71N 5BPMA 1Y64A 3ENOA 3WQUA 3U3YA 1UA1A 1Z25A 1NKBA 3E9PA 3AO1A 1SKWA 2W6LA 3HSTB 3AVKA 1IG8A 4CGHA 3OBWA 3SAHA 4M7YA 3CJAA 1MDUB 1HKGA 2O4IA 4CGFA 4LFCK 3DI6A 4IJAA 4BRQA 3OYJA 1VQ5N 3CD6N 4JNEA 4OVLA 2CGLA 4IFVA 1DGKN 5CYMA 2JWLA 3NFAA 1SKRA 4WFAL 3L0QA 1C0MA 2XY6A 1ATNA 3UB5A 3CM5A 4CZJA 2WFBA 1ATRA 2YNHA 2GWKA 1KQSM 1VQ7N 4DV1K 2Z1JA 2RPIA 3L4IA 1YJ9N 1KTQA 3TSQA 1A5VA 3AAQA 1TUYA 4MQ3A 2A1SA 1JLBA 3SUQA 1JLQA 4FWMA 4DV3K 4KRFA 2A41A 3F2KA 4FLTA 2GWJA 3QFUA 3NGIA 3VA3A 2O8CA 4AHTA 1J6ZA 3CQYA 4JI4K 1K8KA 5DM7L 4CVNE 1NKEA 3KKRA 3IFRA 4B9MA 4EZ6A 1RDBA 3E9LA 4MLEA 1NJIO 2FBVA 3VEZA 1BOTO 1LOTB 4CZKA 3MEDA 4C23A 2Q36A 2BGGA 2HF3A 3WEEA 4R5PA 3ZEUA 3ZT3A 4ZTFA 4LF7K 1VSDA 1TKZA 4DU1A 3SPYA 1NJXA 3OS2A 3D6RA 5MLCQ 3NBPA 1HQUA 4DTPA 1S3XA 3F73A 1X9MA 3IS9A 2HNDA 4EIAA 3CCJN 3RRGA 4KHNA 2UU9K 1RTHA 1HMVA 3ULEA 2NRXA 4O55A 3AAPA 2V7YA 2HNZA 4BC4A 3WXKA 1D5AA 1N6QA 2FXUA 3D45A 2W40A 3C6HA 3OS1A 5CY4A 3SAGA 1RDUA 4OGEA 5AQNA 2ZF5O 1Q18A 4DG1A 1IG9A 4CK3A 4GKJK 2ZD1A 1RCHA 2HHUA 4CGJA 3SV3A 1C1BA 3AVLA 3SLCA 3K9KA 4YHHK 4ELVA 5AQVA 1L3UA 1VQ9N 1NGIA 4DFJA 3RTVA 3H1VX 5IWAK 2YKMA 1XI1A 3AA3A 3CM6A 4W5OA 1HNWK 2V51B 4CJSA 4B8AB 4PKGA 4K41A 3UIQA 1NU0A 3O9TA 1D4XA 1QVFM 3WXIA 1BHLA 5C0YA 1Q9YA 1SL0A 2RKIA 3PX6A 3HRGA 4Z94A 2FSNA 3MN7A 4PL7A 2PYLA 4DSFA 4GVEA 1YF5L 3SNNA 3PX4A 1EKEA 1MWKA 2Q1NA 3LPUA 3PSIA 1P8ZA 2KKZA 5EXWA 4F3TA 3J80O 1U48A 4CERA 4B1YB 3VQAA 1FK9A 4N5SA 4DFPA 1XUPO 1RBTA 4JI7K 3MCAB 2OTLN 4LY7A 3A8YA 4H8KA 2JWKA 4OKJA 5AQKA 4F9OA 4HVJA 1RT5A 2KZZA 3V4IA 2WOMA 5AQUA 4C8KA 1MU2A 1NOYA 1B9FA 4XH1A 3VQEA 1T3VA 2HBKA 4OPHA 2WONA 3BGRA 3GL1A 2F96A 1UWBA 3WNHA 4JKCA 2XY7A 4BC5A 1JLFA 5GIOA 3WXJA 4BRFA 1YVUA 3TI0A 5HLFA 3RR7A 1BIUA 4FM1A 2G8VA 2G8IA 4JD2B 2HBLA 3FFKB 2P9KB 3ASMA 2HB5A 3VEYA 4KTZA 3TAMA 3QETA 3PO4A 3DLBA 1R59O 1Q8IA 3MAQA 2W42A 4JLHA 4FW2A 3DOKA 4CJPA 3WQTA 4DQQA 3K2PA 3O3GA 3V9XA 4CHYA 2P9KA 1BIZA 3CCMN 1VSFA 2Z1HA 5AJ3K 4BWJA 1GLBG 4CEZA 4GV6A 3O9QA 5SZTA 4PQUA 3NF9A 4IDHA 2ZQBA 3A5LC 3L3UA 1CXUA 1NOZA 5AR0A 4BGBA 1WSFA 4CD1A 4FK2A 3T1AA 5IT9O 2KZMA 4UQGA 3ZETA 2GUIA 2D4WA 1BDGA 3CCVN 2QKKA 3HSCA 3J7AP 3BZKA 1HNXK 4KH4A 5B8HA 4B1WB 4CEQA 2A1RA 3VQBA 1RT4A 3I8BA 3ZT0A 4NB4A 3QLHA 4FVUA 4XH5A 3CJ7A 4H0PA 1RDDA 4G9ZA 4DSJA 1JLEA 3FFIA 3IMXA 3P4IA 3LWLA 3BY5A 4K8XA 2Z1GA 4GVMA 3OYAA 5FLXO 4DQSA 4BRNA 4Y0WA 4FK4A 4WQ4C 4B9NA 1VQON 4DR7K 1QE1A 1GOBA 2JLEA 1RTDA 3QNNA 4ILJA 1NK4A 4ILHA 3MWPA 4A57A 1O1WA 3RWUA 3S3NA 3TAPA 3EKSA 3LDPA 3VENA 3T19A 1JCEA 3U6FA 1BO5O 2PY5A 2YHXA 4BQZA 3ATUA 4KHYA 4A5BA 1JCGA 4KHQA 3KLHA 4YY3K 4FLXA 2F8SA 3D0PA 4J2AA 4DV6K 1YJWN 3LP3A 4IWVA 2ZJRL 1U47A 5HP1A 1QSSA 3AO3A 4FJIA 3HL8A 4J2EA 5LL6Z 1NMNA 2D5RA 4RW4A 5J2MA 1U04A 2IC3A 2G8KA 2E4LA 4BE1A 1BGXT 1WSHA 3BUZB 4IKFA 4A2BA 3PV8A 4JI2K 5CE3A 4YOYA 2P9SA 3DOLA 3HPGA 5M1KA 3MN9A 3DLHA 3LDSA 4CW7B 4KTWA 3TTFA 2KW4A 3RMAA 2BUPA 2YNIA 4ID5A 4LH4A 4M3TA 1S6QA 2ZJQL 1T6DA 4OPKA 1QZ5A 1RGIA 5C12A 4E3SA 2G8FA 3PO5A 1TUUA 2OANA 3OYCA 4CEDA 4FOEA 4ELUA 3VQPA 4JS5A 3MXJA 5AQIA 3WNEA 1L3SA 4DQIA 1XC9A 1IKXA 2OTJN 1BQMA 1RNHA 2O8FA 3TAQA 2P9PB 1VSLA 3ZSZA 3EZWA 4FJ5A 4M3YA 2H3GX 4B9LA 4CF1A 5HRNA 3TAFA 3IDHA 4XEIA 1DKGD 3UKUB 1R0AA 3SQ4A 3BP8A 3ID8A 5DMRA 2XY8A 2P9PA 3THYB 3CC4N 4B3SK 4CE9A 1IH7A 1GLJO 3NH0A 1QQOA 3BZCA 4JKBA 3AY9A 1TGOA 5F0XA 4C8OA 1RT7A 3P5JA 3ZCMA 4BRKA 5FDLA 4AHRA 1ESVA 5KRTA 3TSPA 3VESA 1JJ2M 4IO9L 4KHWA 5AQYA 4E89A 3WNGA 1WNSA 4DUYK 3VERA 4LSLA 4CHQA 2HMIA 3MXIA 3ZSVA 5AQXA 4Z0UA 3CPWM 1BA0A 4A59A 4BC2A 4BRLA 4M45A 3VQ7A 4W5TA 4Q0BA 1KAXA 5CHIA 1SV5A 2O8DA 1NG9A 4CK1A 3KK3A 3B6PA 4DV5K 1WBDA 4IOXA 4IO8A 4FJGA 2QKBA 3KD1E 4KAZA 1X3MA 5T7BA 4FJ8A 3S41A 2YJFA 5DM6L 1BI4B 1OVQA 3ENBA 3CCEN 3O5BA 3OA9A 4BE0A 3O08A 3VF6A 3N4QA 4O5FA 2VQEK 4CECA 3SUPA 1NJZA 4YNQA 1QTMA 3MX2A 4R79A 4DB3A 2RHKA 4BG9A 2YNGA 3SUNA 2NRHA 4EP5A 4YOTA 1VSMA 3VTHA 5C25A 4MDAA 3AVAA 1A5WA 5F2RA 4DLEA 1Y97A 4MFBA 4FO0A 2QWPA 1J9AA 4KH6A 1Z05A 2CGKA 4JI0K 3UKRA 3NAEA 5J1EA 2NLXA 5HRSA 4K0KK 3M6GA 4YOWA 3TAGA 3E66A 4AILC 2HHXA 4XIUA 3VMFB 1BQNA 5C24A 1BUPA 4BGAA 4DSIA 3MECA 2D0AA 2HSTA 2VG5A 1WLJA 5M1NA 2KFNA 2O8EB 1TK8A 4PKHA 1ZBSA 1GLDG 1ZC6A 2A42A 4BRIA 1EO1A 3HPOA 3QERA 4CF9A 2Q97A 4BY9C 4DF8A 1EETA 2IVNA 3HI0A 1QSLA 3M5RA 5FRNA 1HPMA 1WOQA 1RDWX 3AO5A 4CBUA 4ZTJA 1M1KO 2A3ZA 5BRFA 3GDQA 1YI2N 3LDLA 3VEXA 3C0BA 3L8BA 5BRHA 3CJBA 4AHSA 3HM8A 3V6DA 3NMUA 2R7YA 4FLYA 4B3OA 1QS4A 1S72N 1TV6A 4O5BA 3CFRA 3OYIA 3O9UA 1BCMA 1Q81O 2QWQA 5M1PA 1FKOA 4OJRA 4PL8A 4KHSA 1KAZA 4DR4K 3TAEA 2E1YA 2HW3A 2FBXA 3O9SA 1WUAA 1YUWA 3V9ZA 1U4BA 1KLMA 1VQLN 3OY9A 4H5TA 5EY4A 4U67L 4RW7A 4Z4IA 4FJ7A 4JKFA 1YVNA 1L5UA 1QZ6A 1QQCA 3DWLA 2PYJA 3SCXA 1KFSA 1G15A 3P1GA 2LSNA 2QI2A 4YOUA 1WSJA 3CC7N 3DYAA 1TL1A 4IG3A 3R9PA 3QEPA 5AQLA 3GG4A 5BRDA 1RILA 1B92A 4FLVA 4GKKK 3FR0A 3O4NA 3H1QA 4A5AA 2O8CB 4E7IA 3P31A 4W5RA 2HHSA 3RR8A 2QXLA 1K8KB 4WFNL 1IKWA 3ZT2A 1WN7A 4CJKA 3L6QA 3ISNC 2VQFK 4DV2K 1LV5A 3IG1A 4RW6A 1J53A 4LFBK 1TKDA 2KTQA 4J2BA 4CF0A 3E01A 5AQJA 3VGMA 5C2FA 3ZYYX 3O1WA 2EX3A 4WFBL 4IOAL 3WEEB 4C8LA 3OYGA 3ZEUB 3DM2A 5BPLA 1LWCA 3J81O 4IXCA 4LF6K 4HUGA 4OKEA 2F9TA 1HLUA 2PBDA 4YOXA 4ILGB 1RFQA 3HXMA 2RE2A 1YHQN 5AQOA 5LMNK 4DTUA 3RVCA 3U8XA 1U45A 4HTLA 2E2PA 2AA4A 4CIFA 4HUFA 4L8RB 2VWJA 1OH6A 3K5OA 3FZKA 4QS8A 4KPYA 4DTXA 3ULEB 3CYMA 3AVJA 4BR9A 4M63C 1RTJA 4M3XA 4DKWA 5ADXH 1L3TA 3OYLA 3NDKA 4FJHA 2RN2A 3EZ5A 1ZBFA 3CERA 1NNEA 3SBTA 4FZZA 1YTUA 3DRSA 5KGXA 1WB9A 2FF6A 4CI6A 3KK1A 3ID6A 3MCPA 3SI6A 3LDOA 4OPJA 5JS1A 4W5NA 3V9UA 3O6WA 4DLGA 4OGCA 3FZMA 4CD3A 3KKSA 3AVCA 4B1ZA 2Y1JA 4DQPA 1C1AA 1NGJA 3EKUA 3K5LA 1HNVA 2YHYA 4B9VA 3QEXA 1ITGA 2DFEA 3RSEB 5C42A 3AGRA 2Q31A 2ZGZA 3ENHA 3SQ1A 4Z4CA 2D0BA 3LWMA 1SS6A 4EHUA 4B1UB 1HPZA 1NBWA 2GELA 3AVGA 5M1FA 1NK7A 4HWIA 1BISA 4FWPA 4PUOA 3G6EN 1I94K 4AM6A 4H0XB 3RMCA 3RSEA 3KTQA 1DLOA 1HX1A 1XMQK 3NH2A 4IJNA 4CGDA 2BE2A 3O1BA 4I7FA 3M3ZA 4NO7A 1RT2A 4OX9K 3VQCA 4M7XA 1EX4A 4QS9A 4DV0K 1C0GA 3HO1A 3ZSYA 2QWMA 3M1FA 1TYQA 2RF2A 1IBLK 4DFMA 3E1YA 1XWLA 4RWTA 4JKGB 4CF2A 3THWA 4FWOA 1XQSC 1S9GA 3VQ9A 1EQYA 1V4SA 1T05A 2ASPA 1BU6O 3MWTA 4CFAA 1IKVA 1NGDA 4H5WA 4RG8A 1YTAA 2P9NB 4WYBA 1DTQA 4ISGA 4JKGA 2E1ZA 4BREA 4CBXA 3M8RA 4Y1CA 3QEWA 4FLZA 3VN5A 2ZJPL 4DR1K 4RW9A 3CCSN 4FYDA 1T7PA 5FPNA 3LZIA 4CIEA 2HHVA 2P9NA 4CJ7A 3HYFA 2QK9A 1BWFO 5JVGL 3WUHA 4IBNA 5AQZA 5D3GA 3KK2A 2AP1A 3G0ZA 4FWNA 3VQ8A 4YOVA 2GTDA 4FPAA 1U2VA 1W2BM 1MWMA 1UA0A 4L3QA 1RBVA 4BQLA 4N56A 4YORA 1NJWA 4OPAA 5ELZA 1D8YA 3S3MA 2DFFA 1BL3A 4I2QA 4M42A 3QB0A 3U4LA 1FKPA 4QCLA 4E7HA 2E6MA 3MMVA 4I6MA 3NCIA 2P9UA 4Z4HA 4LC9B 1GLFO 3PY8A 4DV4K 4DQRA 3AVHA 3DXKB 4LF8K 1JCFA 1SKSA 4JKDA 3KHYA 1N32K 3V81A 3VQDA 4WCEL 1JLGA 1HJRA 3ULDA 1D9DA 3Q7BA 3AVBA 3ZETB 4LF9K 4K25A 1CZAN 3DXKA 3VPZA 3ZT4A 5A2QO 4FJXA 4FJJA 1SL2A 4E7JA 2D0OA 4E1NA 4EZ9A 2IOCA 1NGHA 4N76A 3NF7A 3J7YP 4F2SA 5HBMA 3ALYA 3IRXA 3J8AA 4K42A 4KBOA 3C7NA 1XHXA 3VF2A 4IFEA 3WXLA 4CJ4A 5M1QA 4F8RA 1LAWA 1VQ4N 2P51A 2OPPA 3OHRA 3CXCM 1U49A 1X9SA 4KO0A 1RT1A 4M3ZA 2HBMA 4CJUA 2ASOA 3FZFA 4FK0A 1ASVA 3THXA 3LDQA 4ZHRA 2VGMA 2QTDA 5JS2A 1N5YA 1VQ6N 5JICA 5C15A 5CZ1A 3N4PA 3NGYA 4BDZA 4CEEA 2IVOA 4DQ8A 3CMEN 3PLAA 3OYMA 1TAUA 5GAEP 1JL2A 2HHQA 3TSUA 5LY3A 4I9QA 3QFPA 3IKMA 3EY1A 2IIRA 4HCBA 2E8AA 3ZSOA 4BRCA 1WBBA 3KVGA 3H45C 3L2QA 2QWRA 4I9LA 4GV3A 3TABA 4FWQA 4GW6A 1GLEG 1RDAA 4DU3A 1P90A 3D2EA 4AH9A 1ZYQA 4JKAA 5I42A 3OBYA 1F21A 3QEVA 1TKTA 2YHAA 2E88A 2OPRA 4BR0A 2P9LA 2P9SB 4OKKA 4GNIA 2Z1IA 4DTJA 3BF1A 2ITMA 2PFUA 1QHAA 1JKHA 2KQ2A 5FRMA 3LL3A 4DHYA 2OCEA 1KCFA 1EXQA 3O3HA 2FSKA 1KFDA 2J4RA 2NRRA 3WT0A 2O8FB 3DLKA 4JK8A 4RTFD 1ASUA 3SYZA 1OVYA 4JK9A 3K5NA 3CPEA 3WNFA 1NK5A 4JI6K 5LJVA 2E2QA 1S5JA 4XH4A 4O4GA 3G25A 3DLLL 4H5VA 2XRIA 3I56N 4CFBA 1XNQK 1RDCA 3LZJA 1DTTA 3ZSXA 5HOOA 3LAKA 3DLGA 4IDKA 1C0UA 2ZE2A 1SL1A 1T03A 2HBJA 2W6KA 3TPQA 1S1TA 4HTUA 1S9EA 4FXDA 1RT6A 4H0TB 3SPZA 3L2VA 3ZSQA 1MA9B 1HYZA 3NVMA 4CCHA 4LF5K 4W5QA 4DR6K 1ZBLA 1M90O 4CJ5A 4CZEA 2ZWHA 5KI6A 1NK0A 3A0IX 2OZMA 1NGGA 3CQXA 3GOIA 1JXBA 3V9SA 1S1VA 4IEEA 1XHZA 2KLAA 4H5RA 4AHVA 2QWLA 2HHHK 4FLWA 3P83D 4NCAA 4WQ5C 4ID1A 2F9WA 4E7LA 4MDBA 2OPSA 1T8EA 4IOCL 1OH7A 4CJQA 4A62A 4BE2A 1SAZA 2O8DB 5LMUK 1LW0A 1VAZA 2YI1A 1K8AO 2XY5A 1NM1A 1QSYA 3LP0A 4PHTX 4J8FA 2IDOA 1E3MA 5FROA 1VRTA 4EP4A 4B9QA 2DTUA 1C6VA 3L2RA 3UE5A 5CR4A 3VEVA 3SMPA 1EWQA 4BRDA 4CZGA 2VGNA 1LW2A 3OYHA 2UXBK 1NLVA 4QOZB 1VHXA 4K43A 4EFHA 1KXPA 4FWKA 1IBMK 3FZLA 1OH5A 4MLHA 3HZ6A 3KIOA 3F5TA 3KLGA 2QEXN 1XMOK 3MEEA 3UKRB 1CLQA 3EO3A 1VQMN 1K6YA 3GBTA 1SZ2A 4NCGA 1X9WA 3CF5L 3ITHA 4CIGA 2D1KA 4A61A 2NNWA 4FJMA 4IEIA 4BC3A 2IVPA 1K9MO 2BANA 3ATVA 1KVAA 1VK0A 1TK5A 4FCYA 1UOCA 4PA1A 3O4WA 1FXXA 3DRPA 3PIPL 4C8NA 4DS4A 4B9UA 3RMBA 4DR2K 1S22A 1NGEA 2E2NA 3TR8A 4FWSA 4B9TA 1TAQA 4AHCA 4JS4A 4JHDA 1D9FA 2QM1A 4BRMA 1VQ8N 1CXQA 3AV9A 2YHBA 1FJGK 3T7ZA 4E1MA 3PUFA 4KHUA 3EN9A 4FWLA 1NGAA 3H46O 5AZJA 1HRHA 2G8UA 4IZ9A 3K59A 2GUPA 1IJJA 3BEXA 5AQSA 3FLCO 4FJKA 2YV0X 4Z4EA 3SQ0A 4BVPA 4DTRA 1HQEA 1QQNA 2NRZA 3ZX2A 1I39A 1IKYA 2CGJA 4M41A 2BH1A 4BRGA 3PIOL 1DT9A 4CHOA 3VTIA 4BRPA 3MXMA 2D0PA 2UUCK 4X65K 3OYFA 2P9IA 2VCPA 3VQ5A 1NK8A 3HBTA 1FW6A 1K73O 1JL1A 3OYNA 2V52B 3R8EA 1WAFA 5KPZA 1KVCA 3T1YK 5KQDA 4G1QA 3S3OA 5FPDA 1ZBIA 2KHOA 4BWMA 4WQ5A 4FZXC 4H0OA 4FOIA 4WE1A 3CFOA 2HVHA 5KPTA 3WXMB 5JVHL 3T69A 3V1QA 3NF6A 3OJSA 2E20A 2VG6A 3CG7A 2UXDK 5C2DA 2NRTA 1J5OA 2WUSA 3AVFA 4CZFA 2P5OA 3DXMB 4OO1J 1EP4A 1X1PA 3PX0A 1VSHA 1Q86O 1HJOA 4JI1K 4H4OA 3TARA 2GX9A 1C1CA 4X66K 3OJUA 3E9OA 4BR5A 4H0YB 3QBXA 3DXMA 3VETA 2VYPA 4JI5K 4RCHA 4DWIA 2P5GA 5TKWA 4PKIA 1JXEA 3JXUA 5AQHA 1RTIA 4B9SA 5AFUA 2PZSA 2GBZA 3SZ2A 5BN8A 4DTOA 1C0TA 4DV7K 4CJTA 3EL2A 3I55N 1KAYA 1X3NA 3OW2M 3V9WA 3L2WA 1Z6RA 4RW8A 4KREA 3A2FA 2QWNA 1BCOA 4B1XB 3MK6A 1KVBA 1HKCA 3H08A 3CCQN 3NE6A 4FW1A 4CFDA 4FJNA 4FM0A 1YIJN 3Q7CA 2YNFA 1W9HA 2YJEA 2FLOA 2B6AA 4AM7A 1I3AA 1HKBA 1YXQA 3KD5E 1E4FT 4CESA 4FZYA 3LM2A 2E6LA 3AO4A 4FJ9A 2B5JA 4BR7A 4F2RA 1RBSA 5EX5A 1LCUA 2OZSA 4AF1A 4CFCA 1NMDA 1T44A 1NGFA 4JKEA 5J2PA 2A40A 4LFAK 5JLHA 2G8WA 4GV9A 3C94A 4B1VA 2ZGYA 4F4KA 5AQWA 3NHGA 3K57A 1NK9A 3ZX3A 3LALA 4PWDA 2JGUA 3V1OA 4KB0A 3QESA 4PY5A 5EU7A 2QXFA 4J2DA 3VQ6A 4CEBA 5K14A 4JN4A 3HPHA 5AQFA 3I0SA 5GINA 2IS3A 2I5JA 3QICA 1KC8O 2AJQA 4M3UA 1GOAA 5F1XA 3CJ1A 3HOTA 4AQYK 3AVMA 2EHGA 3MN5A 2B4JA 1YJNN 2W41A 1TYQB 2HNYA 4DFKA 4CZMA 4B3MK 2HF4A 4CJLA 3THWB 2O8BB 5CYQA 5LJWA 3OYEA 1U6ZA 4AHUA 2VWKA 5JMVA 1NKCA 4JRQA 4M3RA 2OPQA 2NZTA 4BRAA 3K9JA 3H6EA 2XO7A 3D7EO 4H0VB 3CETA 2O8BA 4K8ZA 3DAWA 3HM9A 3KJVA 2FC0A 4OLBA 4DSEA 4H5NA 4Z4FA 3AVNA 1VRUA 2O4GA 4KB1A 3L4QA 1ZBHA 1TKXA 3F9KA 1EWRA 2OYQA 5GADP 1S1XA 4O0IA 1U2VB 1ILYA 3AVIA 2NRVA 3H3OB 2HHTA 4B8CA 5FPEA 4CF8A 3SJHA 5E84A 4WF9L 4Y1DA 2ZM6K 1LWFA 1W97L 1KLNA 3G10A 3VOVA 3QIOA 4HUEA 3HT3A 4CEOA 4QS7A 3VA0A 3I33A 4LD0A 5TKYA 3CFPA 3NGZA 3QDKA 1SUQA 4I6MB 3AA4A 4E7KA 4JYAK 3KWGA 2G8HA 2P9UB 4JKHA 3KZBA 4FPBA 3L2UA 2WC9A 4B3RK 2QW9A 2KFZA 2NRWA 1ATSA 1DEJA 3U9ZA 5FPMA 4NXNK 1HNZK 4ELTA 1QVGM 4GY2B 3EE9A 1V4TA 3TTCA 1LWEA 3T3FA 4DUZK 2ETJA 3H3NO 2FF3B 3K0SA 1IV0A 1N36K 2UUAK 5ADXA 5AQQA 2X6NA 4X62K 4BRHA 4CEFA 2ITGA 1YAGA 3M8PA 5J2QA 1Q9XA 3QNOA 3CI5A 4DMNA 3C7NB 3I8DA 3RMDA 5BREA 4C1NK 5AQRA 4CJFA 4IG0A 3CMAN 3HP6A 1A5XA 3MEGA 1CZBA 3TWHA 4NYNA 3W3DA 5J2NA 4B3TK 2YHWA 4JD2A 3OYKA 3R6MA 3A5NC 3MN6A 4ICLA 3THXB 5I9EB 2EWSA 5AQPA 1VQPN 1IBKK 3ZSRA 5C10A 3KLFA 2UXCK 1N34K 4CZHA 3OYBA 2OA8A 1E4GT 3QINA 4NCBA 4ISFA 1IO2A 4Q5VA 3VGLA 4CGIA 2HOEA 4BDYA 4KI6A 1HYVA 4FSVA 4DSKA 1UAXA 1RT3A 2DY4A 3ZSWA 3FGUA 4CEAA 2Q3SA 5CZ2A 4KI4A 2UUBK 1N33K 3VQQA 2A6AA 4JI3K 4LH5A 3SUOA 3AARA 3P39A 1NGCA 5AQTA 3SQ2A 3P38A 1NWKA 3MDQA 4FLUA 3HJFA 4F3OA 4KFBA 4CHPA 5GAHP 3CC2N 3HOSA 3C6UA 4DTMA 3T1HK 2ATQA 2Q0RA 2DPNA 2HHWA 2F8TA 3HK2A 2Q0UA 3D2EB 4O0JA 3F9MA 5KRSA 4DS5A 3QIPA 5SWMA 3OYDA 2FSJA 5BN9A 4UY8O 2P9LB 3OTOK 3DJCA 3I0RA 1VSKA 3ZT1A 3HVRA 1CZ9A 5KPRA 5JLFA 3HP9A 3AA2A 4NLCA 1B9DA 4CJ3A 4FJLA 4YDUC 4JV5K 2Y1IA 2UYTA 3CJ9A 4JI8K 1VSIA 3QO9A 3KK7A 3SV4A 4NYFA
chains in the Genus database with same CATH topology
2EX3A 3JYTA 1CLQA 4HVJA 1RT5A 5DK5A 4C8LA 3OYGA 2KZZA 3V4IA 1WSIA 3DM2A 1K6YA 2HVIA 1LWCA 2WOMA 4NCGA 4CHNA 4HUGA 1X9WA 3IAYA 4OKEA 4FM2A 1MU2A 3ITHA 4I2PA 4CIGA 3U3GA 5I3UA 4C8KA 1NOYA 1B9FA 1ZBUA 3VQ4A 3VQEA 4FJMA 4CJRA 4OLAA 2WONA 3BGRA 3HXMA 2F96A 1UWBA 4Z4GA 4GMJB 3WNHA 5KGWA 4M3WA 2XY7A 2BANA 4DTUA 1U45A 1JLFA 1KVAA 1VK0A 4LSNA 4CIFA 1LAVA 1YVUA 4HUFA 1UOCA 4PA1A 4FCYA 4B08A 1FXXA 5HROA 3TI0A 3RR7A 4L8RB 3DRPA 1BIUA 4C8NA 2VWJA 4FM1A 4DS4A 3RMBA 4B9UA 4TSXA 2G8VA 3K5OA 2G8IA 3TR8A 4HHTA 4B9TA 1TAQA 4DTXA 4KPYA 4AHCA 4JS4A 3ASMA 3CQ8A 2HB5A 1D9FA 3CYMA 3AO2A 3AVJA 2X74A 1RTJA 4KTZA 3TAMA 3QETA 4M3XA 3PO4A 3DLBA 1S6PA 1CXQA 3KLIA 3AV9A 1Q8IA 2YHBA 3MAQA 3OVNA 4JLHA 4FW2A 2W42A 3DOKA 1L3TA 4CJPA 3OYLA 3NDKA 4E1MA 3PUFA 4DQQA 2RN2A 3K2PA 3EZ5A 3O3GA 3V9XA 1ZBFA 1KSPA 4FJHA 4CHYA 4KHUA 4FZZA 3RRHA 1YTUA 3DRSA 4E19A 5KGXA 1HRHA 3LP1A 1BIZA 2G8UA 3K59A 3KK1A 3DLRA 1VSFA 2Z1HA 4BWJA 4CEZA 1HYSA 3O3FA 3SI6A 1RBUA 5SZTA 4OPJA 4FJKA 4CK2A 3NF9A 4PQUA 2YV0X 2ZQBA 3SQ0A 4Z4EA 5JS1A 3L3UA 4N47A 3JSMA 1CXUA 1NOZA 4W5NA 1WSFA 3V9UA 4DTRA 4DLGA 4OGCA 1HQEA 4DU4A 3T1AA 4FK2A 2HHUA 3KKSA 3AVCA 2KZMA 1I39A 2Y1JA 4DQPA 1IKYA 4M41A 4UQGA 1C1AA 2GUIA 3K5LA 4B9VA 1HNVA 4E0DA 3QEXA 1ITGA 2DFEA 2X78A 4CHOA 5C42A 2QKKA 3MXMA 3OYFA 3VQ5A 3SQ1A 1NK8A 4Z4CA 2D0BA 1RBRA 3LWMA 1JL1A 3OYNA 1HPZA 3AVGA 1WAFA 3DMJA 1NK7A 4CEQA 1KVCA 4HCCA 2A1RA 3VQBA 1BISA 1RT4A 4G1QA 3SJJA 3S3OA 3ZT0A 4PUOA 4N41A 1ZBIA 3QLHA 4CJEA 3RMCA 4BWMA 4C8MA 1RDDA 1DLOA 3KTQA 4DSJA 3NH2A 4FZXC 1JLEA 3FFIA 4CGDA 3BDPA 4WE1A 3CFOA 2BE2A 2HVHA 1TK5A 3LWLA 3V1QA 3NF6A 4I7FA 3S9HA 1S1WA 2Z1GA 4K8XA 3OJSA 4GVMA 1RT2A 3OYAA 2VG6A 3CG7A 5HRRA 1VSEA 3VQCA 4DQSA 1EX4A 4FK4A 1J5OA 4B9NA 3HO1A 3AVFA 1TVRA 2XHBA 1TK0A 3ZSYA 1ASWA 1QE1A 2P5OA 2RF2A 1GOBA 4DFMA 2JLEA 1EP4A 1XWLA 4DF4A 1RTDA 3QNNA 1X1PA 4CF2A 3PX0A 2NUBA 1VSHA 5KTQA 1NK4A 4H4OA 1O1WA 1S9GA 3TARA 3RWUA 2GV9A 1C1CA 3M8SA 3QEIA 3OJUA 3S3NA 3VQ9A 3TAPA 4DSLA 1T05A 4CFAA 1IKVA 4CJWA 4RG8A 3T19A 3U6FA 1YTAA 1TL3A 3KLEA 3K5MA 1KRPA 2PY5A 1DTQA 4DTNA 2FBYA 4KHYA 4DWIA 4KHQA 2P5GA 1JXEA 3M8RA 3LANA 4CHZA 3LAMA 4Y1CA 3KLHA 3QEWA 4FLZA 4FLXA 2F8SA 3VN5A 3D0PA 1RTIA 4J2AA 2X6SA 4RW9A 4FYDA 1T7PA 3LZIA 4B9SA 3LP3A 2PZSA 2GBZA 4CIEA 3NH1A 3SZ2A 2HHVA 1JLCA 4DTOA 1C0TA 3HYFA 2DFHA 1U47A 2QK9A 5HP1A 4CJTA 4IBNA 1QSSA 3AO3A 2IAJA 1Z26A 4FJIA 3HL8A 5D3GA 4IFYA 3KK2A 3V9WA 4J2EA 3L2WA 3G0ZA 4RW8A 3VQ8A 4KREA 2D5RA 3A2FA 4QAGA 4RW4A 4BACA 5J2MA 1U04A 1BCOA 3HVTA 2IC3A 2D0CA 1KVBA 3H08A 1UA0A 1RBVA 1BI4A 3OS0A 3NE6A 4FW1A 5HRPA 4N56A 2G8KA 4CFDA 1WSGA 2E4LA 4BE1A 1BGXT 1NJWA 4FM0A 1D8YA 4FJNA 1WSHA 2DY4A 3S3MA 4IKFA 2DFFA 2YNFA 1W9HA 1BL3A 4I2QA 4M42A 4YFUA 2B6AA 4DTSA 1FKPA 3PV8A 3L3VA 4QCLA 4E7HA 1I3AA 2E6MA 3KD5E 1J54A 3NCIA 4CESA 3B6OA 4FZYA 3DOLA 3HPGA 3AA5X 2E6LA 3AO4A 1L3VA 4FJ9A 2B5JA 1WSEA 4Z4HA 3DLHA 4F2RA 1JLAA 4FVMA 5E41A 4KTWA 3LDSA 4DQRA 3PY8A 3AVHA 1RBSA 2KW4A 4KKOA 3RMAA 1SKSA 2YNIA 2OZSA 4ID5A 3TANA 4CJVA 4LH4A 2VG7A 3VQDA 4JRPA 1JLGA 3V81A 4M3TA 1HJRA 3ULDA 1S6QA 1WAJA 4CFCA 1D9DA 5J2PA 4OPKA 2G8WA 3AVBA 4O44A 3C94A 1QHTA 4E3SA 2G8FA 3PO5A 4H4MA 3OYCA 4CEDA 4BDPA 4ELUA 4F4KA 3VQPA 3EYZA 2FBTA 3MXJA 1VSJA 3ZT4A 3NHGA 4JS5A 4FJXA 3K57A 3WNEA 3C95A 1L3SA 1SL2A 1NK9A 4E7JA 4E1NA 4DQIA 3LALA 4EZ9A 3O4QA 2IOCA 1IKXA 1XC9A 2JGUA 4N76A 2P1JA 4PWDA 1BQMA 1RNHA 4KTQA 3NF7A 3V1OA 4KB0A 3QESA 1NJYA 3TAQA 4F2SA 4PY5A 1VSLA 3DLEA 3ZSZA 3ALYA 3IRXA 5EU7A 2QXFA 5HBMA 4J2DA 3VQ6A 4CEBA 4FJ5A 4M3YA 4B9LA 1XHXA 4CF1A 5K14A 3HPHA 3V1RA 4CJ4A 5HRNA 3I0SA 3TAFA 4F8RA 1W0HA 1LAWA 4CGGA 2IS3A 2I5JA 4KV8A 1NK6A 2P51A 2OPPA 1R0AA 2AJQA 3SQ4A 4M3UA 1GOCA 1GOAA 1U49A 1X9SA 3THVA 5DMRA 2XY8A 4KO0A 1RT1A 4M3ZA 3AVMA 4CJUA 2BDPA 2EHGA 4FK0A 4CE9A 1IH7A 2IGIA 1ASVA 1REVA 2B4JA 3NH0A 2HNYA 3LPTA 4ZHRA 4DFKA 3C6TA 3M8QA 5JS2A 1N5YA 3LP2A 4CJLA 5CYQA 3OYEA 4AHUA 3K58A 2VWKA 5CZ1A 1S1UA 1TGOA 2YKNA 3DRRA 4C8OA 3NGYA 1RT7A 1NKCA 4JRQA 3P5JA 3ZCMA 1HNIA 1YT3A 4BDZA 3NF8A 5FDLA 4AHRA 4M3RA 2OPQA 4FJJA 3U3YA 4CEEA 5KRTA 2XO7A 1UA1A 1Z25A 4KHWA 1NKBA 4E89A 4K8ZA 3WNGA 1WNSA 3AO1A 3KJVA 3OYMA 2FC0A 3HM9A 1SKWA 3HSTB 4OLBA 4LSLA 3AVKA 4CGHA 4CHQA 4DSEA 2HMIA 1TAUA 3MXIA 3ZSVA 4Z0UA 4Z4FA 3AVNA 4DSKA 1JL2A 1VRUA 2O4GA 2HHQA 4KB1A 2O4IA 4CGFA 3DI6A 4M45A 3VQ7A 4W5TA 1ZBHA 1TKXA 4Q0BA 1SV5A 4I9QA 3OYJA 4CK1A 3KK3A 4OVLA 3B6PA 3F9KA 4IFVA 3EY1A 2OYQA 4HCBA 5CYMA 3NFAA 4FJGA 2QKBA 1S1XA 1SKRA 3ZSOA 4O0IA 3KD1E 4KAZA 3AVIA 5T7BA 3L2QA 4FJ8A 2HHTA 4B8CA 4I9LA 4CF8A 1BI4B 3TABA 1C0MA 4Y1DA 4BE0A 1LWFA 4GW6A 2XY6A 3CM5A 1KLNA 3G10A 1RDAA 3QIOA 4DU3A 4HUEA 3HT3A 2YNHA 4CEOA 4CECA 3VA0A 4AH9A 4LD0A 3SUPA 1ZYQA 2Z1JA 2RPIA 3CFPA 5I42A 1KTQA 3NGZA 1F21A 3QEVA 1SUQA 1NJZA 4E7KA 1TKTA 3AA4A 1A5VA 2YHAA 4YNQA 2A1SA 1JLBA 2OPRA 4MQ3A 1JLQA 3SUQA 1QTMA 2G8HA 4KRFA 4FLTA 4OKKA 3L2UA 3NGIA 3VA3A 4AHTA 2YNGA 2Z1IA 3SUNA 4DTJA 4EP5A 2KFZA 1VSMA 4KI6A 5C25A 4ELTA 1NKEA 3KKRA 1JKHA 2KQ2A 5FRMA 3AVAA 1A5WA 1LWEA 4DLEA 3T3FA 4B9MA 2ETJA 4EZ6A 1KCFA 1Y97A 1RDBA 4MFBA 1EXQA 2FBVA 1J9AA 3O3HA 3MEDA 3NAEA 5J1EA 2X6NA 2BGGA 1KFDA 4R5PA 5HRSA 3ZT3A 4CEFA 4ZTFA 2ITGA 3TAGA 3DLKA 1VSDA 1TKZA 4DU1A 4AILC 3SPYA 1NJXA 3M8PA 2HHXA 1ASUA 5J2QA 3OS2A 4XIUA 3SYZA 1Q9XA 3QNOA 1BQNA 4DMNA 5C24A 3K5NA 3I8DA 3NBPA 1HQUA 3WNFA 1NK5A 3RMDA 4DSIA 4DTPA 3MECA 2D0AA 2VG5A 1WLJA 3F73A 4CJFA 1X9MA 1S5JA 4O4GA 4IG0A 3IS9A 3HP6A 2KFNA 2XRIA 1TK8A 2HNDA 4CFBA 1A5XA 1RDCA 1CZBA 3MEGA 3LZJA 3TWHA 1DTTA 3ZSXA 4NYNA 3RRGA 4KHNA 3LAKA 5J2NA 3DLGA 4IDKA 1RTHA 1C0UA 2ZE2A 3OYKA 1HMVA 3HPOA 1SL1A 3QERA 1T03A 4CF9A 1S1TA 4HTUA 4DF8A 4ICLA 1S9EA 1EETA 4O55A 1QSLA 4FXDA 1RT6A 5FRNA 3SPZA 2HNZA 3L2VA 3ZSQA 3ZSRA 3AO5A 4ZTJA 1HYZA 3KLFA 1D5AA 4CCHA 3OYBA 3L8BA 1N6QA 2OA8A 4W5QA 3D45A 3QINA 4AHSA 1ZBLA 3V6DA 1IO2A 4NCBA 2R7YA 3OS1A 5CY4A 4CJ5A 4Q5VA 4FLYA 4B3OA 1QS4A 4OGEA 4CGIA 1TV6A 4O5BA 4DG1A 5KI6A 1HYVA 4CK3A 3CFRA 3OYIA 4BDYA 1NK0A 1IG9A 1BCMA 3V9SA 1UAXA 2ZD1A 1JXBA 2OZMA 1RT3A 1RCHA 1S1VA 3ZSWA 4AHVA 4CGJA 4CEAA 1XHZA 3SV3A 1FKOA 1C1BA 4OJRA 3AVLA 4FLWA 3P83D 2Q3SA 5CZ2A 4KHSA 4KI4A 4ELVA 1L3UA 4NCAA 3TAEA 4ID1A 2HW3A 2FBXA 4E7LA 2OPSA 3VQQA 4DFJA 1T8EA 3RTVA 4CJQA 2YKMA 4BE2A 4LH5A 3SUOA 1XI1A 1U4BA 3V9ZA 3SQ2A 3AA3A 3CM6A 1KLMA 1LW0A 4W5OA 3OY9A 4FLUA 2XY5A 3HJFA 4RW7A 4CJSA 3LP0A 4B8AB 1QSYA 4F3OA 4FJ7A 4Z4IA 4KFBA 4CHPA 1L5UA 3UIQA 1QQCA 2IDOA 2PYJA 3C6UA 4DTMA 2ATQA 3SCXA 5HLFA 5FROA 1VRTA 4EP4A 1KFSA 1G15A 2HHWA 3P1GA 2DTUA 1C6VA 2LSNA 2F8TA 3L2RA 1BHLA 3HK2A 1WSJA 3DYAA 4O0JA 1Q9YA 1SL0A 1TL1A 2RKIA 3PX6A 5KRSA 4IG3A 1LW2A 4DS5A 3QIPA 5SWMA 3OYHA 3OYDA 2PYLA 4DSFA 3QEPA 3SNNA 3PX4A 1EKEA 1RILA 1B92A 4FLVA 3LPUA 4QOZB 4F3TA 3I0RA 3O4NA 1VSKA 3ZT1A 1U48A 3HVRA 4E7IA 1CZ9A 4CERA 3VQAA 4W5RA 3HP9A 1FK9A 3AA2A 4N5SA 3RR8A 2HHSA 1B9DA 4CJ3A 4DFPA 4FJLA 1RBTA 1IKWA 3ZT2A 1WN7A 4CJKA 3KIOA 3ISNC 1LV5A 3IG1A 4RW6A 1J53A 2Y1IA 1VSIA 1TKDA 3QO9A 3KLGA 2KTQA 4LY7A 4J2BA 4CF0A 4H8KA 3SV4A 3E01A 3MEEA 4NYFA 4OKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EX3 A;  3JYT A;  1CLQ A;  4HVJ A;  1RT5 A;  5DK5 A;  4C8L A;  3OYG A;  2KZZ A;  3V4I A;  1WSI A;  3DM2 A;  1K6Y A;  2HVI A;  1LWC A;  2WOM A;  4NCG A;  4CHN A;  4HUG A;  1X9W A;  3IAY A;  4OKE A;  4FM2 A;  1MU2 A;  3ITH A;  4I2P A;  4CIG A;  3U3G A;  5I3U A;  4C8K A;  1NOY A;  1B9F A;  1ZBU A;  3VQ4 A;  3VQE A;  4FJM A;  4CJR A;  4OLA A;  2WON A;  3BGR A;  3HXM A;  2F96 A;  1UWB A;  4Z4G A;  4GMJ B;  3WNH A;  5KGW A;  4M3W A;  2XY7 A;  2BAN A;  4DTU A;  1U45 A;  1JLF A;  1KVA A;  1VK0 A;  4LSN A;  4CIF A;  1LAV A;  1YVU A;  4HUF A;  1UOC A;  4PA1 A;  4FCY A;  4B08 A;  1FXX A;  5HRO A;  3TI0 A;  3RR7 A;  4L8R B;  3DRP A;  1BIU A;  4C8N A;  2VWJ A;  4FM1 A;  4DS4 A;  3RMB A;  4B9U A;  4TSX A;  2G8V A;  3K5O A;  2G8I A;  3TR8 A;  4HHT A;  4B9T A;  1TAQ A;  4DTX A;  4KPY A;  4AHC A;  4JS4 A;  3ASM A;  3CQ8 A;  2HB5 A;  1D9F A;  3CYM A;  3AO2 A;  3AVJ A;  2X74 A;  1RTJ A;  4KTZ A;  3TAM A;  3QET A;  4M3X A;  3PO4 A;  3DLB A;  1S6P A;  1CXQ A;  3KLI A;  3AV9 A;  1Q8I A;  2YHB A;  3MAQ A;  3OVN A;  4JLH A;  4FW2 A;  2W42 A;  3DOK A;  1L3T A;  4CJP A;  3OYL A;  3NDK A;  4E1M A;  3PUF A;  4DQQ A;  2RN2 A;  3K2P A;  3EZ5 A;  3O3G A;  3V9X A;  1ZBF A;  1KSP A;  4FJH A;  4CHY A;  4KHU A;  4FZZ A;  3RRH A;  1YTU A;  3DRS A;  4E19 A;  5KGX A;  1HRH A;  3LP1 A;  1BIZ A;  2G8U A;  3K59 A;  3KK1 A;  3DLR A;  1VSF A;  2Z1H A;  4BWJ A;  4CEZ A;  1HYS A;  3O3F A;  3SI6 A;  1RBU A;  5SZT A;  4OPJ A;  4FJK A;  4CK2 A;  3NF9 A;  4PQU A;  2YV0 X;  2ZQB A;  3SQ0 A;  4Z4E A;  5JS1 A;  3L3U A;  4N47 A;  3JSM A;  1CXU A;  1NOZ A;  4W5N A;  1WSF A;  3V9U A;  4DTR A;  4DLG A;  4OGC A;  1HQE A;  4DU4 A;  3T1A A;  4FK2 A;  2HHU A;  3KKS A;  3AVC A;  2KZM A;  1I39 A;  2Y1J A;  4DQP A;  1IKY A;  4M41 A;  4UQG A;  1C1A A;  2GUI A;  3K5L A;  4B9V A;  1HNV A;  4E0D A;  3QEX A;  1ITG A;  2DFE A;  2X78 A;  4CHO A;  5C42 A;  2QKK A;  3MXM A;  3OYF A;  3VQ5 A;  3SQ1 A;  1NK8 A;  4Z4C A;  2D0B A;  1RBR A;  3LWM A;  1JL1 A;  3OYN A;  1HPZ A;  3AVG A;  1WAF A;  3DMJ A;  1NK7 A;  4CEQ A;  1KVC A;  4HCC A;  2A1R A;  3VQB A;  1BIS A;  1RT4 A;  4G1Q A;  3SJJ A;  3S3O A;  3ZT0 A;  4PUO A;  4N41 A;  1ZBI A;  3QLH A;  4CJE A;  3RMC A;  4BWM A;  4C8M A;  1RDD A;  1DLO A;  3KTQ A;  4DSJ A;  3NH2 A;  4FZX C;  1JLE A;  3FFI A;  4CGD A;  3BDP A;  4WE1 A;  3CFO A;  2BE2 A;  2HVH A;  1TK5 A;  3LWL A;  3V1Q A;  3NF6 A;  4I7F A;  3S9H A;  1S1W A;  2Z1G A;  4K8X A;  3OJS A;  4GVM A;  1RT2 A;  3OYA A;  2VG6 A;  3CG7 A;  5HRR A;  1VSE A;  3VQC A;  4DQS A;  1EX4 A;  4FK4 A;  1J5O A;  4B9N A;  3HO1 A;  3AVF A;  1TVR A;  2XHB A;  1TK0 A;  3ZSY A;  1ASW A;  1QE1 A;  2P5O A;  2RF2 A;  1GOB A;  4DFM A;  2JLE A;  1EP4 A;  1XWL A;  4DF4 A;  1RTD A;  3QNN A;  1X1P A;  4CF2 A;  3PX0 A;  2NUB A;  1VSH A;  5KTQ A;  1NK4 A;  4H4O A;  1O1W A;  1S9G A;  3TAR A;  3RWU A;  2GV9 A;  1C1C A;  3M8S A;  3QEI A;  3OJU A;  3S3N A;  3VQ9 A;  3TAP A;  4DSL A;  1T05 A;  4CFA A;  1IKV A;  4CJW A;  4RG8 A;  3T19 A;  3U6F A;  1YTA A;  1TL3 A;  3KLE A;  3K5M A;  1KRP A;  2PY5 A;  1DTQ A;  4DTN A;  2FBY A;  4KHY A;  4DWI A;  4KHQ A;  2P5G A;  1JXE A;  3M8R A;  3LAN A;  4CHZ A;  3LAM A;  4Y1C A;  3KLH A;  3QEW A;  4FLZ A;  4FLX A;  2F8S A;  3VN5 A;  3D0P A;  1RTI A;  4J2A A;  2X6S A;  4RW9 A;  4FYD A;  1T7P A;  3LZI A;  4B9S A;  3LP3 A;  2PZS A;  2GBZ A;  4CIE A;  3NH1 A;  3SZ2 A;  2HHV A;  1JLC A;  4DTO A;  1C0T A;  3HYF A;  2DFH A;  1U47 A;  2QK9 A;  5HP1 A;  4CJT A;  4IBN A;  1QSS A;  3AO3 A;  2IAJ A;  1Z26 A;  4FJI A;  3HL8 A;  5D3G A;  4IFY A;  3KK2 A;  3V9W A;  4J2E A;  3L2W A;  3G0Z A;  4RW8 A;  3VQ8 A;  4KRE A;  2D5R A;  3A2F A;  4QAG A;  4RW4 A;  4BAC A;  5J2M A;  1U04 A;  1BCO A;  3HVT A;  2IC3 A;  2D0C A;  1KVB A;  3H08 A;  1UA0 A;  1RBV A;  1BI4 A;  3OS0 A;  3NE6 A;  4FW1 A;  5HRP A;  4N56 A;  2G8K A;  4CFD A;  1WSG A;  2E4L A;  4BE1 A;  1BGX T;  1NJW A;  4FM0 A;  1D8Y A;  4FJN A;  1WSH A;  2DY4 A;  3S3M A;  4IKF A;  2DFF A;  2YNF A;  1W9H A;  1BL3 A;  4I2Q A;  4M42 A;  4YFU A;  2B6A A;  4DTS A;  1FKP A;  3PV8 A;  3L3V A;  4QCL A;  4E7H A;  1I3A A;  2E6M A;  3KD5 E;  1J54 A;  3NCI A;  4CES A;  3B6O A;  4FZY A;  3DOL A;  3HPG A;  3AA5 X;  2E6L A;  3AO4 A;  1L3V A;  4FJ9 A;  2B5J A;  1WSE A;  4Z4H A;  3DLH A;  4F2R A;  1JLA A;  4FVM A;  5E41 A;  4KTW A;  3LDS A;  4DQR A;  3PY8 A;  3AVH A;  1RBS A;  2KW4 A;  4KKO A;  3RMA A;  1SKS A;  2YNI A;  2OZS A;  4ID5 A;  3TAN A;  4CJV A;  4LH4 A;  2VG7 A;  3VQD A;  4JRP A;  1JLG A;  3V81 A;  4M3T A;  1HJR A;  3ULD A;  1S6Q A;  1WAJ A;  4CFC A;  1D9D A;  5J2P A;  4OPK A;  2G8W A;  3AVB A;  4O44 A;  3C94 A;  1QHT A;  4E3S A;  2G8F A;  3PO5 A;  4H4M A;  3OYC A;  4CED A;  4BDP A;  4ELU A;  4F4K A;  3VQP A;  3EYZ A;  2FBT A;  3MXJ A;  1VSJ A;  3ZT4 A;  3NHG A;  4JS5 A;  4FJX A;  3K57 A;  3WNE A;  3C95 A;  1L3S A;  1SL2 A;  1NK9 A;  4E7J A;  4E1N A;  4DQI A;  3LAL A;  4EZ9 A;  3O4Q A;  2IOC A;  1IKX A;  1XC9 A;  2JGU A;  4N76 A;  2P1J A;  4PWD A;  1BQM A;  1RNH A;  4KTQ A;  3NF7 A;  3V1O A;  4KB0 A;  3QES A;  1NJY A;  3TAQ A;  4F2S A;  4PY5 A;  1VSL A;  3DLE A;  3ZSZ A;  3ALY A;  3IRX A;  5EU7 A;  2QXF A;  5HBM A;  4J2D A;  3VQ6 A;  4CEB A;  4FJ5 A;  4M3Y A;  4B9L A;  1XHX A;  4CF1 A;  5K14 A;  3HPH A;  3V1R A;  4CJ4 A;  5HRN A;  3I0S A;  3TAF A;  4F8R A;  1W0H A;  1LAW A;  4CGG A;  2IS3 A;  2I5J A;  4KV8 A;  1NK6 A;  2P51 A;  2OPP A;  1R0A A;  2AJQ A;  3SQ4 A;  4M3U A;  1GOC A;  1GOA A;  1U49 A;  1X9S A;  3THV A;  5DMR A;  2XY8 A;  4KO0 A;  1RT1 A;  4M3Z A;  3AVM A;  4CJU A;  2BDP A;  2EHG A;  4FK0 A;  4CE9 A;  1IH7 A;  2IGI A;  1ASV A;  1REV A;  2B4J A;  3NH0 A;  2HNY A;  3LPT A;  4ZHR A;  4DFK A;  3C6T A;  3M8Q A;  5JS2 A;  1N5Y A;  3LP2 A;  4CJL A;  5CYQ A;  3OYE A;  4AHU A;  3K58 A;  2VWK A;  5CZ1 A;  1S1U A;  1TGO A;  2YKN A;  3DRR A;  4C8O A;  3NGY A;  1RT7 A;  1NKC A;  4JRQ A;  3P5J A;  3ZCM A;  1HNI A;  1YT3 A;  4BDZ A;  3NF8 A;  5FDL A;  4AHR A;  4M3R A;  2OPQ A;  4FJJ A;  3U3Y A;  4CEE A;  5KRT A;  2XO7 A;  1UA1 A;  1Z25 A;  4KHW A;  1NKB A;  4E89 A;  4K8Z A;  3WNG A;  1WNS A;  3AO1 A;  3KJV A;  3OYM A;  2FC0 A;  3HM9 A;  1SKW A;  3HST B;  4OLB A;  4LSL A;  3AVK A;  4CGH A;  4CHQ A;  4DSE A;  2HMI A;  1TAU A;  3MXI A;  3ZSV A;  4Z0U A;  4Z4F A;  3AVN A;  4DSK A;  1JL2 A;  1VRU A;  2O4G A;  2HHQ A;  4KB1 A;  2O4I A;  4CGF A;  3DI6 A;  4M45 A;  3VQ7 A;  4W5T A;  1ZBH A;  1TKX A;  4Q0B A;  1SV5 A;  4I9Q A;  3OYJ A;  4CK1 A;  3KK3 A;  4OVL A;  3B6P A;  3F9K A;  4IFV A;  3EY1 A;  2OYQ A;  4HCB A;  5CYM A;  3NFA A;  4FJG A;  2QKB A;  1S1X A;  1SKR A;  3ZSO A;  4O0I A;  3KD1 E;  4KAZ A;  3AVI A;  5T7B A;  3L2Q A;  4FJ8 A;  2HHT A;  4B8C A;  4I9L A;  4CF8 A;  1BI4 B;  3TAB A;  1C0M A;  4Y1D A;  4BE0 A;  1LWF A;  4GW6 A;  2XY6 A;  3CM5 A;  1KLN A;  3G10 A;  1RDA A;  3QIO A;  4DU3 A;  4HUE A;  3HT3 A;  2YNH A;  4CEO A;  4CEC A;  3VA0 A;  4AH9 A;  4LD0 A;  3SUP A;  1ZYQ A;  2Z1J A;  2RPI A;  3CFP A;  5I42 A;  1KTQ A;  3NGZ A;  1F21 A;  3QEV A;  1SUQ A;  1NJZ A;  4E7K A;  1TKT A;  3AA4 A;  1A5V A;  2YHA A;  4YNQ A;  2A1S A;  1JLB A;  2OPR A;  4MQ3 A;  1JLQ A;  3SUQ A;  1QTM A;  2G8H A;  4KRF A;  4FLT A;  4OKK A;  3L2U A;  3NGI A;  3VA3 A;  4AHT A;  2YNG A;  2Z1I A;  3SUN A;  4DTJ A;  4EP5 A;  2KFZ A;  1VSM A;  4KI6 A;  5C25 A;  4ELT A;  1NKE A;  3KKR A;  1JKH A;  2KQ2 A;  5FRM A;  3AVA A;  1A5W A;  1LWE A;  4DLE A;  3T3F A;  4B9M A;  2ETJ A;  4EZ6 A;  1KCF A;  1Y97 A;  1RDB A;  4MFB A;  1EXQ A;  2FBV A;  1J9A A;  3O3H A;  3MED A;  3NAE A;  5J1E A;  2X6N A;  2BGG A;  1KFD A;  4R5P A;  5HRS A;  3ZT3 A;  4CEF A;  4ZTF A;  2ITG A;  3TAG A;  3DLK A;  1VSD A;  1TKZ A;  4DU1 A;  4AIL C;  3SPY A;  1NJX A;  3M8P A;  2HHX A;  1ASU A;  5J2Q A;  3OS2 A;  4XIU A;  3SYZ A;  1Q9X A;  3QNO A;  1BQN A;  4DMN A;  5C24 A;  3K5N A;  3I8D A;  3NBP A;  1HQU A;  3WNF A;  1NK5 A;  3RMD A;  4DSI A;  4DTP A;  3MEC A;  2D0A A;  2VG5 A;  1WLJ A;  3F73 A;  4CJF A;  1X9M A;  1S5J A;  4O4G A;  4IG0 A;  3IS9 A;  3HP6 A;  2KFN A;  2XRI A;  1TK8 A;  2HND A;  4CFB A;  1A5X A;  1RDC A;  1CZB A;  3MEG A;  3LZJ A;  3TWH A;  1DTT A;  3ZSX A;  4NYN A;  3RRG A;  4KHN A;  3LAK A;  5J2N A;  3DLG A;  4IDK A;  1RTH A;  1C0U A;  2ZE2 A;  3OYK A;  1HMV A;  3HPO A;  1SL1 A;  3QER A;  1T03 A;  4CF9 A;  1S1T A;  4HTU A;  4DF8 A;  4ICL A;  1S9E A;  1EET A;  4O55 A;  1QSL A;  4FXD A;  1RT6 A;  5FRN A;  3SPZ A;  2HNZ A;  3L2V A;  3ZSQ A;  3ZSR A;  3AO5 A;  4ZTJ A;  1HYZ A;  3KLF A;  1D5A A;  4CCH A;  3OYB A;  3L8B A;  1N6Q A;  2OA8 A;  4W5Q A;  3D45 A;  3QIN A;  4AHS A;  1ZBL A;  3V6D A;  1IO2 A;  4NCB A;  2R7Y A;  3OS1 A;  5CY4 A;  4CJ5 A;  4Q5V A;  4FLY A;  4B3O A;  1QS4 A;  4OGE A;  4CGI A;  1TV6 A;  4O5B A;  4DG1 A;  5KI6 A;  1HYV A;  4CK3 A;  3CFR A;  3OYI A;  4BDY A;  1NK0 A;  1IG9 A;  1BCM A;  3V9S A;  1UAX A;  2ZD1 A;  1JXB A;  2OZM A;  1RT3 A;  1RCH A;  1S1V A;  3ZSW A;  4AHV A;  4CGJ A;  4CEA A;  1XHZ A;  3SV3 A;  1FKO A;  1C1B A;  4OJR A;  3AVL A;  4FLW A;  3P83 D;  2Q3S A;  5CZ2 A;  4KHS A;  4KI4 A;  4ELV A;  1L3U A;  4NCA A;  3TAE A;  4ID1 A;  2HW3 A;  2FBX A;  4E7L A;  2OPS A;  3VQQ A;  4DFJ A;  1T8E A;  3RTV A;  4CJQ A;  2YKM A;  4BE2 A;  4LH5 A;  3SUO A;  1XI1 A;  1U4B A;  3V9Z A;  3SQ2 A;  3AA3 A;  3CM6 A;  1KLM A;  1LW0 A;  4W5O A;  3OY9 A;  4FLU A;  2XY5 A;  3HJF A;  4RW7 A;  4CJS A;  3LP0 A;  4B8A B;  1QSY A;  4F3O A;  4FJ7 A;  4Z4I A;  4KFB A;  4CHP A;  1L5U A;  3UIQ A;  1QQC A;  2IDO A;  2PYJ A;  3C6U A;  4DTM A;  2ATQ A;  3SCX A;  5HLF A;  5FRO A;  1VRT A;  4EP4 A;  1KFS A;  1G15 A;  2HHW A;  3P1G A;  2DTU A;  1C6V A;  2LSN A;  2F8T A;  3L2R A;  1BHL A;  3HK2 A;  1WSJ A;  3DYA A;  4O0J A;  1Q9Y A;  1SL0 A;  1TL1 A;  2RKI A;  3PX6 A;  5KRS A;  4IG3 A;  1LW2 A;  4DS5 A;  3QIP A;  5SWM A;  3OYH A;  3OYD A;  2PYL A;  4DSF A;  3QEP A;  3SNN A;  3PX4 A;  1EKE A;  1RIL A;  1B92 A;  4FLV A;  3LPU A;  4QOZ B;  4F3T A;  3I0R A;  3O4N A;  1VSK A;  3ZT1 A;  1U48 A;  3HVR A;  4E7I A;  1CZ9 A;  4CER A;  3VQA A;  4W5R A;  3HP9 A;  1FK9 A;  3AA2 A;  4N5S A;  3RR8 A;  2HHS A;  1B9D A;  4CJ3 A;  4DFP A;  4FJL A;  1RBT A;  1IKW A;  3ZT2 A;  1WN7 A;  4CJK A;  3KIO A;  3ISN C;  1LV5 A;  3IG1 A;  4RW6 A;  1J53 A;  2Y1I A;  1VSI A;  1TKD A;  3QO9 A;  3KLG A;  2KTQ A;  4LY7 A;  4J2B A;  4CF0 A;  4H8K A;  3SV4 A;  3E01 A;  3MEE A;  4NYF A;  4OKJ A; 
#chains in the Genus database with same CATH topology
 3JYT A;  5DK5 A;  1WSI A;  2HVI A;  3IAY A;  1GLA G;  4CHN A;  4E1J A;  4FM2 A;  4I2P A;  3U3G A;  5I3U A;  1ZBU A;  3VQ4 A;  4CJR A;  3ZX0 A;  4OLA A;  4Z4G A;  4GMJ B;  5KGW A;  4M3W A;  2QA4 N;  4LSN A;  1LAV A;  5HRO A;  5AZI B;  4B08 A;  2ASM A;  3VEO A;  5EVZ A;  3G4S N;  2YCH A;  4TSX A;  4HHT A;  3B8A X;  2BTF A;  3EEQ A;  3CQ8 A;  3AO2 A;  3FZH A;  3U9D A;  2X74 A;  2I7N A;  3R3L A;  1S6P A;  2A5X A;  3CCU N;  3KLI A;  5AZI A;  3OVN A;  1QQM A;  3SMS A;  1KSP A;  3RRH A;  5BR9 A;  4DCH A;  4E19 A;  3LP1 A;  3SBG A;  3DLR A;  1HYS A;  3O3F A;  1RBU A;  1SQK A;  4CK2 A;  3FE1 A;  1C0F A;  4H03 B;  4N47 A;  3JSM A;  1YIT N;  4DU4 A;  5AQG A;  3CHW A;  3A5M C;  4E0D A;  3ZLJ A;  2X78 A;  1T6C A;  1RBR A;  4JK7 A;  2WBN A;  5KQ8 A;  1OKJ A;  4V19 S;  3DMJ A;  4EAH D;  4HCC A;  2I7P A;  4LF4 K;  3SJJ A;  4DR3 K;  4N41 A;  1BA1 A;  3O8M A;  4CJE A;  3CIP A;  4C8M A;  1GLL O;  3HTV A;  2WTU A;  5GAG P;  3NVK A;  3BDP A;  3UKU A;  3S9H A;  1S1W A;  3MX5 A;  5HRR A;  3J7Z O;  1VSE A;  4JEP A;  3THY A;  3A5O C;  5EOY A;  3R1X A;  1TVR A;  2XHB A;  1TK0 A;  1ASW A;  2E2O A;  4MO4 A;  4CZL A;  3CCR N;  4DF4 A;  3O80 A;  2HMP A;  2NUB A;  5KTQ A;  4BRO A;  4WQ4 A;  4U7B A;  2GV9 A;  3M8S A;  3QEI A;  4DSL A;  3C65 A;  4CJW A;  4CBW A;  1TL3 A;  3KLE A;  3K5M A;  1KRP A;  2F7T A;  3LM9 A;  4DTN A;  2FBY A;  2V7Z A;  4BR4 A;  4NLB A;  4C1N I;  3LAN A;  4CHZ A;  3LAM A;  1ZXO A;  2X6S A;  4YDU A;  3NH1 A;  1BG3 A;  1JLC A;  2DFH A;  2CH5 A;  2QWO A;  2IAJ A;  1Z26 A;  4BR2 A;  2YX6 A;  4IFY A;  5E26 A;  4BAC A;  4QAG A;  2GEM A;  4X64 K;  3SK3 A;  3HVT A;  2D0C A;  4JHD B;  4BVO A;  1BI4 A;  3OS0 A;  3VGK A;  5HRP A;  1WSG A;  3QBW A;  5AQM A;  5AFU H;  4YFU A;  3KWI A;  4DTS A;  2F4V K;  3L3V A;  4MO5 A;  5BPN A;  1KD1 O;  1J54 A;  5AZJ B;  3B6O A;  3SAF A;  3W0L A;  1N8R O;  3AA5 X;  1L3V A;  1WSE A;  1Q7Y O;  1JLA A;  4FVM A;  5E41 A;  5BR8 K;  4KKO A;  4FWR A;  4EHT A;  5H1S Q;  3TAN A;  4DR5 K;  4CJV A;  2VG7 A;  4JRP A;  3CCL N;  5GIP A;  1G99 A;  1WAJ A;  1HR0 K;  3QML A;  2CH6 A;  3JAM O;  4O8K A;  4O44 A;  1QHT A;  3IUC A;  4H4M A;  4BDP A;  3EYZ A;  2FBT A;  2PAV A;  1VSJ A;  3C6A A;  3BF3 A;  4CZI A;  3C95 A;  1H1V A;  2P9I B;  3O4Q A;  2VWB A;  3CJC A;  2P1J A;  4FL9 A;  4KTQ A;  1HUX A;  3AGK A;  1NJY A;  3TU5 A;  1W7A A;  1VQK N;  3DLE A;  1GLC G;  1X9J A;  4A2A A;  1Q82 O;  1O13 A;  3D2F B;  1OH8 A;  2E5L K;  3V1R A;  4JAX A;  4O8U A;  1W0H A;  3JS6 A;  4CGG A;  4KV8 A;  5HL7 L;  1NK6 A;  3TTD A;  1GOC A;  2O8E A;  3LDN A;  3THV A;  4BG8 A;  1XC3 A;  4KHP K;  2Q2R A;  1VQN N;  2BDP A;  4ISE A;  3D2F A;  2IGI A;  3PSF A;  1REV A;  1J5E K;  3LPT A;  3VEW A;  3C6T A;  3GE1 A;  3M8Q A;  4NXM K;  4KH5 A;  3LP2 A;  3O9R A;  1NGB A;  3K58 A;  1S1U A;  2YKN A;  5M1O A;  3DRR A;  3EE8 A;  3VF4 A;  1XNR K;  1HNI A;  1YT3 A;  3NF8 A;  3G71 N;  5BPM A;  1Y64 A;  3ENO A;  3WQU A;  3U3Y A;  1UA1 A;  1Z25 A;  1NKB A;  3E9P A;  3AO1 A;  1SKW A;  2W6L A;  3HST B;  3AVK A;  1IG8 A;  4CGH A;  3OBW A;  3SAH A;  4M7Y A;  3CJA A;  1MDU B;  1HKG A;  2O4I A;  4CGF A;  4LFC K;  3DI6 A;  4IJA A;  4BRQ A;  3OYJ A;  1VQ5 N;  3CD6 N;  4JNE A;  4OVL A;  2CGL A;  4IFV A;  1DGK N;  5CYM A;  2JWL A;  3NFA A;  1SKR A;  4WFA L;  3L0Q A;  1C0M A;  2XY6 A;  1ATN A;  3UB5 A;  3CM5 A;  4CZJ A;  2WFB A;  1ATR A;  2YNH A;  2GWK A;  1KQS M;  1VQ7 N;  4DV1 K;  2Z1J A;  2RPI A;  3L4I A;  1YJ9 N;  1KTQ A;  3TSQ A;  1A5V A;  3AAQ A;  1TUY A;  4MQ3 A;  2A1S A;  1JLB A;  3SUQ A;  1JLQ A;  4FWM A;  4DV3 K;  4KRF A;  2A41 A;  3F2K A;  4FLT A;  2GWJ A;  3QFU A;  3NGI A;  3VA3 A;  2O8C A;  4AHT A;  1J6Z A;  3CQY A;  4JI4 K;  1K8K A;  5DM7 L;  4CVN E;  1NKE A;  3KKR A;  3IFR A;  4B9M A;  4EZ6 A;  1RDB A;  3E9L A;  4MLE A;  1NJI O;  2FBV A;  3VEZ A;  1BOT O;  1LOT B;  4CZK A;  3MED A;  4C23 A;  2Q36 A;  2BGG A;  2HF3 A;  3WEE A;  4R5P A;  3ZEU A;  3ZT3 A;  4ZTF A;  4LF7 K;  1VSD A;  1TKZ A;  4DU1 A;  3SPY A;  1NJX A;  3OS2 A;  3D6R A;  5MLC Q;  3NBP A;  1HQU A;  4DTP A;  1S3X A;  3F73 A;  1X9M A;  3IS9 A;  2HND A;  4EIA A;  3CCJ N;  3RRG A;  4KHN A;  2UU9 K;  1RTH A;  1HMV A;  3ULE A;  2NRX A;  4O55 A;  3AAP A;  2V7Y A;  2HNZ A;  4BC4 A;  3WXK A;  1D5A A;  1N6Q A;  2FXU A;  3D45 A;  2W40 A;  3C6H A;  3OS1 A;  5CY4 A;  3SAG A;  1RDU A;  4OGE A;  5AQN A;  2ZF5 O;  1Q18 A;  4DG1 A;  1IG9 A;  4CK3 A;  4GKJ K;  2ZD1 A;  1RCH A;  2HHU A;  4CGJ A;  3SV3 A;  1C1B A;  3AVL A;  3SLC A;  3K9K A;  4YHH K;  4ELV A;  5AQV A;  1L3U A;  1VQ9 N;  1NGI A;  4DFJ A;  3RTV A;  3H1V X;  5IWA K;  2YKM A;  1XI1 A;  3AA3 A;  3CM6 A;  4W5O A;  1HNW K;  2V51 B;  4CJS A;  4B8A B;  4PKG A;  4K41 A;  3UIQ A;  1NU0 A;  3O9T A;  1D4X A;  1QVF M;  3WXI A;  1BHL A;  5C0Y A;  1Q9Y A;  1SL0 A;  2RKI A;  3PX6 A;  3HRG A;  4Z94 A;  2FSN A;  3MN7 A;  4PL7 A;  2PYL A;  4DSF A;  4GVE A;  1YF5 L;  3SNN A;  3PX4 A;  1EKE A;  1MWK A;  2Q1N A;  3LPU A;  3PSI A;  1P8Z A;  2KKZ A;  5EXW A;  4F3T A;  3J80 O;  1U48 A;  4CER A;  4B1Y B;  3VQA A;  1FK9 A;  4N5S A;  4DFP A;  1XUP O;  1RBT A;  4JI7 K;  3MCA B;  2OTL N;  4LY7 A;  3A8Y A;  4H8K A;  2JWK A;  4OKJ A;  5AQK A;  4F9O A;  4HVJ A;  1RT5 A;  2KZZ A;  3V4I A;  2WOM A;  5AQU A;  4C8K A;  1MU2 A;  1NOY A;  1B9F A;  4XH1 A;  3VQE A;  1T3V A;  2HBK A;  4OPH A;  2WON A;  3BGR A;  3GL1 A;  2F96 A;  1UWB A;  3WNH A;  4JKC A;  2XY7 A;  4BC5 A;  1JLF A;  5GIO A;  3WXJ A;  4BRF A;  1YVU A;  3TI0 A;  5HLF A;  3RR7 A;  1BIU A;  4FM1 A;  2G8V A;  2G8I A;  4JD2 B;  2HBL A;  3FFK B;  2P9K B;  3ASM A;  2HB5 A;  3VEY A;  4KTZ A;  3TAM A;  3QET A;  3PO4 A;  3DLB A;  1R59 O;  1Q8I A;  3MAQ A;  2W42 A;  4JLH A;  4FW2 A;  3DOK A;  4CJP A;  3WQT A;  4DQQ A;  3K2P A;  3O3G A;  3V9X A;  4CHY A;  2P9K A;  1BIZ A;  3CCM N;  1VSF A;  2Z1H A;  5AJ3 K;  4BWJ A;  1GLB G;  4CEZ A;  4GV6 A;  3O9Q A;  5SZT A;  4PQU A;  3NF9 A;  4IDH A;  2ZQB A;  3A5L C;  3L3U A;  1CXU A;  1NOZ A;  5AR0 A;  4BGB A;  1WSF A;  4CD1 A;  4FK2 A;  3T1A A;  5IT9 O;  2KZM A;  4UQG A;  3ZET A;  2GUI A;  2D4W A;  1BDG A;  3CCV N;  2QKK A;  3HSC A;  3J7A P;  3BZK A;  1HNX K;  4KH4 A;  5B8H A;  4B1W B;  4CEQ A;  2A1R A;  3VQB A;  1RT4 A;  3I8B A;  3ZT0 A;  4NB4 A;  3QLH A;  4FVU A;  4XH5 A;  3CJ7 A;  4H0P A;  1RDD A;  4G9Z A;  4DSJ A;  1JLE A;  3FFI A;  3IMX A;  3P4I A;  3LWL A;  3BY5 A;  4K8X A;  2Z1G A;  4GVM A;  3OYA A;  5FLX O;  4DQS A;  4BRN A;  4Y0W A;  4FK4 A;  4WQ4 C;  4B9N A;  1VQO N;  4DR7 K;  1QE1 A;  1GOB A;  2JLE A;  1RTD A;  3QNN A;  4ILJ A;  1NK4 A;  4ILH A;  3MWP A;  4A57 A;  1O1W A;  3RWU A;  3S3N A;  3TAP A;  3EKS A;  3LDP A;  3VEN A;  3T19 A;  1JCE A;  3U6F A;  1BO5 O;  2PY5 A;  2YHX A;  4BQZ A;  3ATU A;  4KHY A;  4A5B A;  1JCG A;  4KHQ A;  3KLH A;  4YY3 K;  4FLX A;  2F8S A;  3D0P A;  4J2A A;  4DV6 K;  1YJW N;  3LP3 A;  4IWV A;  2ZJR L;  1U47 A;  5HP1 A;  1QSS A;  3AO3 A;  4FJI A;  3HL8 A;  4J2E A;  5LL6 Z;  1NMN A;  2D5R A;  4RW4 A;  5J2M A;  1U04 A;  2IC3 A;  2G8K A;  2E4L A;  4BE1 A;  1BGX T;  1WSH A;  3BUZ B;  4IKF A;  4A2B A;  3PV8 A;  4JI2 K;  5CE3 A;  4YOY A;  2P9S A;  3DOL A;  3HPG A;  5M1K A;  3MN9 A;  3DLH A;  3LDS A;  4CW7 B;  4KTW A;  3TTF A;  2KW4 A;  3RMA A;  2BUP A;  2YNI A;  4ID5 A;  4LH4 A;  4M3T A;  1S6Q A;  2ZJQ L;  1T6D A;  4OPK A;  1QZ5 A;  1RGI A;  5C12 A;  4E3S A;  2G8F A;  3PO5 A;  1TUU A;  2OAN A;  3OYC A;  4CED A;  4FOE A;  4ELU A;  3VQP A;  4JS5 A;  3MXJ A;  5AQI A;  3WNE A;  1L3S A;  4DQI A;  1XC9 A;  1IKX A;  2OTJ N;  1BQM A;  1RNH A;  2O8F A;  3TAQ A;  2P9P B;  1VSL A;  3ZSZ A;  3EZW A;  4FJ5 A;  4M3Y A;  2H3G X;  4B9L A;  4CF1 A;  5HRN A;  3TAF A;  3IDH A;  4XEI A;  1DKG D;  3UKU B;  1R0A A;  3SQ4 A;  3BP8 A;  3ID8 A;  5DMR A;  2XY8 A;  2P9P A;  3THY B;  3CC4 N;  4B3S K;  4CE9 A;  1IH7 A;  1GLJ O;  3NH0 A;  1QQO A;  3BZC A;  4JKB A;  3AY9 A;  1TGO A;  5F0X A;  4C8O A;  1RT7 A;  3P5J A;  3ZCM A;  4BRK A;  5FDL A;  4AHR A;  1ESV A;  5KRT A;  3TSP A;  3VES A;  1JJ2 M;  4IO9 L;  4KHW A;  5AQY A;  4E89 A;  3WNG A;  1WNS A;  4DUY K;  3VER A;  4LSL A;  4CHQ A;  2HMI A;  3MXI A;  3ZSV A;  5AQX A;  4Z0U A;  3CPW M;  1BA0 A;  4A59 A;  4BC2 A;  4BRL A;  4M45 A;  3VQ7 A;  4W5T A;  4Q0B A;  1KAX A;  5CHI A;  1SV5 A;  2O8D A;  1NG9 A;  4CK1 A;  3KK3 A;  3B6P A;  4DV5 K;  1WBD A;  4IOX A;  4IO8 A;  4FJG A;  2QKB A;  3KD1 E;  4KAZ A;  1X3M A;  5T7B A;  4FJ8 A;  3S41 A;  2YJF A;  5DM6 L;  1BI4 B;  1OVQ A;  3ENB A;  3CCE N;  3O5B A;  3OA9 A;  4BE0 A;  3O08 A;  3VF6 A;  3N4Q A;  4O5F A;  2VQE K;  4CEC A;  3SUP A;  1NJZ A;  4YNQ A;  1QTM A;  3MX2 A;  4R79 A;  4DB3 A;  2RHK A;  4BG9 A;  2YNG A;  3SUN A;  2NRH A;  4EP5 A;  4YOT A;  1VSM A;  3VTH A;  5C25 A;  4MDA A;  3AVA A;  1A5W A;  5F2R A;  4DLE A;  1Y97 A;  4MFB A;  4FO0 A;  2QWP A;  1J9A A;  4KH6 A;  1Z05 A;  2CGK A;  4JI0 K;  3UKR A;  3NAE A;  5J1E A;  2NLX A;  5HRS A;  4K0K K;  3M6G A;  4YOW A;  3TAG A;  3E66 A;  4AIL C;  2HHX A;  4XIU A;  3VMF B;  1BQN A;  5C24 A;  1BUP A;  4BGA A;  4DSI A;  3MEC A;  2D0A A;  2HST A;  2VG5 A;  1WLJ A;  5M1N A;  2KFN A;  2O8E B;  1TK8 A;  4PKH A;  1ZBS A;  1GLD G;  1ZC6 A;  2A42 A;  4BRI A;  1EO1 A;  3HPO A;  3QER A;  4CF9 A;  2Q97 A;  4BY9 C;  4DF8 A;  1EET A;  2IVN A;  3HI0 A;  1QSL A;  3M5R A;  5FRN A;  1HPM A;  1WOQ A;  1RDW X;  3AO5 A;  4CBU A;  4ZTJ A;  1M1K O;  2A3Z A;  5BRF A;  3GDQ A;  1YI2 N;  3LDL A;  3VEX A;  3C0B A;  3L8B A;  5BRH A;  3CJB A;  4AHS A;  3HM8 A;  3V6D A;  3NMU A;  2R7Y A;  4FLY A;  4B3O A;  1QS4 A;  1S72 N;  1TV6 A;  4O5B A;  3CFR A;  3OYI A;  3O9U A;  1BCM A;  1Q81 O;  2QWQ A;  5M1P A;  1FKO A;  4OJR A;  4PL8 A;  4KHS A;  1KAZ A;  4DR4 K;  3TAE A;  2E1Y A;  2HW3 A;  2FBX A;  3O9S A;  1WUA A;  1YUW A;  3V9Z A;  1U4B A;  1KLM A;  1VQL N;  3OY9 A;  4H5T A;  5EY4 A;  4U67 L;  4RW7 A;  4Z4I A;  4FJ7 A;  4JKF A;  1YVN A;  1L5U A;  1QZ6 A;  1QQC A;  3DWL A;  2PYJ A;  3SCX A;  1KFS A;  1G15 A;  3P1G A;  2LSN A;  2QI2 A;  4YOU A;  1WSJ A;  3CC7 N;  3DYA A;  1TL1 A;  4IG3 A;  3R9P A;  3QEP A;  5AQL A;  3GG4 A;  5BRD A;  1RIL A;  1B92 A;  4FLV A;  4GKK K;  3FR0 A;  3O4N A;  3H1Q A;  4A5A A;  2O8C B;  4E7I A;  3P31 A;  4W5R A;  2HHS A;  3RR8 A;  2QXL A;  1K8K B;  4WFN L;  1IKW A;  3ZT2 A;  1WN7 A;  4CJK A;  3L6Q A;  3ISN C;  2VQF K;  4DV2 K;  1LV5 A;  3IG1 A;  4RW6 A;  1J53 A;  4LFB K;  1TKD A;  2KTQ A;  4J2B A;  4CF0 A;  3E01 A;  5AQJ A;  3VGM A;  5C2F A;  3ZYY X;  3O1W A;  2EX3 A;  4WFB L;  4IOA L;  3WEE B;  4C8L A;  3OYG A;  3ZEU B;  3DM2 A;  5BPL A;  1LWC A;  3J81 O;  4IXC A;  4LF6 K;  4HUG A;  4OKE A;  2F9T A;  1HLU A;  2PBD A;  4YOX A;  4ILG B;  1RFQ A;  3HXM A;  2RE2 A;  1YHQ N;  5AQO A;  5LMN K;  4DTU A;  3RVC A;  3U8X A;  1U45 A;  4HTL A;  2E2P A;  2AA4 A;  4CIF A;  4HUF A;  4L8R B;  2VWJ A;  1OH6 A;  3K5O A;  3FZK A;  4QS8 A;  4KPY A;  4DTX A;  3ULE B;  3CYM A;  3AVJ A;  4BR9 A;  4M63 C;  1RTJ A;  4M3X A;  4DKW A;  5ADX H;  1L3T A;  3OYL A;  3NDK A;  4FJH A;  2RN2 A;  3EZ5 A;  1ZBF A;  3CER A;  1NNE A;  3SBT A;  4FZZ A;  1YTU A;  3DRS A;  5KGX A;  1WB9 A;  2FF6 A;  4CI6 A;  3KK1 A;  3ID6 A;  3MCP A;  3SI6 A;  3LDO A;  4OPJ A;  5JS1 A;  4W5N A;  3V9U A;  3O6W A;  4DLG A;  4OGC A;  3FZM A;  4CD3 A;  3KKS A;  3AVC A;  4B1Z A;  2Y1J A;  4DQP A;  1C1A A;  1NGJ A;  3EKU A;  3K5L A;  1HNV A;  2YHY A;  4B9V A;  3QEX A;  1ITG A;  2DFE A;  3RSE B;  5C42 A;  3AGR A;  2Q31 A;  2ZGZ A;  3ENH A;  3SQ1 A;  4Z4C A;  2D0B A;  3LWM A;  1SS6 A;  4EHU A;  4B1U B;  1HPZ A;  1NBW A;  2GEL A;  3AVG A;  5M1F A;  1NK7 A;  4HWI A;  1BIS A;  4FWP A;  4PUO A;  3G6E N;  1I94 K;  4AM6 A;  4H0X B;  3RMC A;  3RSE A;  3KTQ A;  1DLO A;  1HX1 A;  1XMQ K;  3NH2 A;  4IJN A;  4CGD A;  2BE2 A;  3O1B A;  4I7F A;  3M3Z A;  4NO7 A;  1RT2 A;  4OX9 K;  3VQC A;  4M7X A;  1EX4 A;  4QS9 A;  4DV0 K;  1C0G A;  3HO1 A;  3ZSY A;  2QWM A;  3M1F A;  1TYQ A;  2RF2 A;  1IBL K;  4DFM A;  3E1Y A;  1XWL A;  4RWT A;  4JKG B;  4CF2 A;  3THW A;  4FWO A;  1XQS C;  1S9G A;  3VQ9 A;  1EQY A;  1V4S A;  1T05 A;  2ASP A;  1BU6 O;  3MWT A;  4CFA A;  1IKV A;  1NGD A;  4H5W A;  4RG8 A;  1YTA A;  2P9N B;  4WYB A;  1DTQ A;  4ISG A;  4JKG A;  2E1Z A;  4BRE A;  4CBX A;  3M8R A;  4Y1C A;  3QEW A;  4FLZ A;  3VN5 A;  2ZJP L;  4DR1 K;  4RW9 A;  3CCS N;  4FYD A;  1T7P A;  5FPN A;  3LZI A;  4CIE A;  2HHV A;  2P9N A;  4CJ7 A;  3HYF A;  2QK9 A;  1BWF O;  5JVG L;  3WUH A;  4IBN A;  5AQZ A;  5D3G A;  3KK2 A;  2AP1 A;  3G0Z A;  4FWN A;  3VQ8 A;  4YOV A;  2GTD A;  4FPA A;  1U2V A;  1W2B M;  1MWM A;  1UA0 A;  4L3Q A;  1RBV A;  4BQL A;  4N56 A;  4YOR A;  1NJW A;  4OPA A;  5ELZ A;  1D8Y A;  3S3M A;  2DFF A;  1BL3 A;  4I2Q A;  4M42 A;  3QB0 A;  3U4L A;  1FKP A;  4QCL A;  4E7H A;  2E6M A;  3MMV A;  4I6M A;  3NCI A;  2P9U A;  4Z4H A;  4LC9 B;  1GLF O;  3PY8 A;  4DV4 K;  4DQR A;  3AVH A;  3DXK B;  4LF8 K;  1JCF A;  1SKS A;  4JKD A;  3KHY A;  1N32 K;  3V81 A;  3VQD A;  4WCE L;  1JLG A;  1HJR A;  3ULD A;  1D9D A;  3Q7B A;  3AVB A;  3ZET B;  4LF9 K;  4K25 A;  1CZA N;  3DXK A;  3VPZ A;  3ZT4 A;  5A2Q O;  4FJX A;  4FJJ A;  1SL2 A;  4E7J A;  2D0O A;  4E1N A;  4EZ9 A;  2IOC A;  1NGH A;  4N76 A;  3NF7 A;  3J7Y P;  4F2S A;  5HBM A;  3ALY A;  3IRX A;  3J8A A;  4K42 A;  4KBO A;  3C7N A;  1XHX A;  3VF2 A;  4IFE A;  3WXL A;  4CJ4 A;  5M1Q A;  4F8R A;  1LAW A;  1VQ4 N;  2P51 A;  2OPP A;  3OHR A;  3CXC M;  1U49 A;  1X9S A;  4KO0 A;  1RT1 A;  4M3Z A;  2HBM A;  4CJU A;  2ASO A;  3FZF A;  4FK0 A;  1ASV A;  3THX A;  3LDQ A;  4ZHR A;  2VGM A;  2QTD A;  5JS2 A;  1N5Y A;  1VQ6 N;  5JIC A;  5C15 A;  5CZ1 A;  3N4P A;  3NGY A;  4BDZ A;  4CEE A;  2IVO A;  4DQ8 A;  3CME N;  3PLA A;  3OYM A;  1TAU A;  5GAE P;  1JL2 A;  2HHQ A;  3TSU A;  5LY3 A;  4I9Q A;  3QFP A;  3IKM A;  3EY1 A;  2IIR A;  4HCB A;  2E8A A;  3ZSO A;  4BRC A;  1WBB A;  3KVG A;  3H45 C;  3L2Q A;  2QWR A;  4I9L A;  4GV3 A;  3TAB A;  4FWQ A;  4GW6 A;  1GLE G;  1RDA A;  4DU3 A;  1P90 A;  3D2E A;  4AH9 A;  1ZYQ A;  4JKA A;  5I42 A;  3OBY A;  1F21 A;  3QEV A;  1TKT A;  2YHA A;  2E88 A;  2OPR A;  4BR0 A;  2P9L A;  2P9S B;  4OKK A;  4GNI A;  2Z1I A;  4DTJ A;  3BF1 A;  2ITM A;  2PFU A;  1QHA A;  1JKH A;  2KQ2 A;  5FRM A;  3LL3 A;  4DHY A;  2OCE A;  1KCF A;  1EXQ A;  3O3H A;  2FSK A;  1KFD A;  2J4R A;  2NRR A;  3WT0 A;  2O8F B;  3DLK A;  4JK8 A;  4RTF D;  1ASU A;  3SYZ A;  1OVY A;  4JK9 A;  3K5N A;  3CPE A;  3WNF A;  1NK5 A;  4JI6 K;  5LJV A;  2E2Q A;  1S5J A;  4XH4 A;  4O4G A;  3G25 A;  3DLL L;  4H5V A;  2XRI A;  3I56 N;  4CFB A;  1XNQ K;  1RDC A;  3LZJ A;  1DTT A;  3ZSX A;  5HOO A;  3LAK A;  3DLG A;  4IDK A;  1C0U A;  2ZE2 A;  1SL1 A;  1T03 A;  2HBJ A;  2W6K A;  3TPQ A;  1S1T A;  4HTU A;  1S9E A;  4FXD A;  1RT6 A;  4H0T B;  3SPZ A;  3L2V A;  3ZSQ A;  1MA9 B;  1HYZ A;  3NVM A;  4CCH A;  4LF5 K;  4W5Q A;  4DR6 K;  1ZBL A;  1M90 O;  4CJ5 A;  4CZE A;  2ZWH A;  5KI6 A;  1NK0 A;  3A0I X;  2OZM A;  1NGG A;  3CQX A;  3GOI A;  1JXB A;  3V9S A;  1S1V A;  4IEE A;  1XHZ A;  2KLA A;  4H5R A;  4AHV A;  2QWL A;  2HHH K;  4FLW A;  3P83 D;  4NCA A;  4WQ5 C;  4ID1 A;  2F9W A;  4E7L A;  4MDB A;  2OPS A;  1T8E A;  4IOC L;  1OH7 A;  4CJQ A;  4A62 A;  4BE2 A;  1SAZ A;  2O8D B;  5LMU K;  1LW0 A;  1VAZ A;  2YI1 A;  1K8A O;  2XY5 A;  1NM1 A;  1QSY A;  3LP0 A;  4PHT X;  4J8F A;  2IDO A;  1E3M A;  5FRO A;  1VRT A;  4EP4 A;  4B9Q A;  2DTU A;  1C6V A;  3L2R A;  3UE5 A;  5CR4 A;  3VEV A;  3SMP A;  1EWQ A;  4BRD A;  4CZG A;  2VGN A;  1LW2 A;  3OYH A;  2UXB K;  1NLV A;  4QOZ B;  1VHX A;  4K43 A;  4EFH A;  1KXP A;  4FWK A;  1IBM K;  3FZL A;  1OH5 A;  4MLH A;  3HZ6 A;  3KIO A;  3F5T A;  3KLG A;  2QEX N;  1XMO K;  3MEE A;  3UKR B;  1CLQ A;  3EO3 A;  1VQM N;  1K6Y A;  3GBT A;  1SZ2 A;  4NCG A;  1X9W A;  3CF5 L;  3ITH A;  4CIG A;  2D1K A;  4A61 A;  2NNW A;  4FJM A;  4IEI A;  4BC3 A;  2IVP A;  1K9M O;  2BAN A;  3ATV A;  1KVA A;  1VK0 A;  1TK5 A;  4FCY A;  1UOC A;  4PA1 A;  3O4W A;  1FXX A;  3DRP A;  3PIP L;  4C8N A;  4DS4 A;  4B9U A;  3RMB A;  4DR2 K;  1S22 A;  1NGE A;  2E2N A;  3TR8 A;  4FWS A;  4B9T A;  1TAQ A;  4AHC A;  4JS4 A;  4JHD A;  1D9F A;  2QM1 A;  4BRM A;  1VQ8 N;  1CXQ A;  3AV9 A;  2YHB A;  1FJG K;  3T7Z A;  4E1M A;  3PUF A;  4KHU A;  3EN9 A;  4FWL A;  1NGA A;  3H46 O;  5AZJ A;  1HRH A;  2G8U A;  4IZ9 A;  3K59 A;  2GUP A;  1IJJ A;  3BEX A;  5AQS A;  3FLC O;  4FJK A;  2YV0 X;  4Z4E A;  3SQ0 A;  4BVP A;  4DTR A;  1HQE A;  1QQN A;  2NRZ A;  3ZX2 A;  1I39 A;  1IKY A;  2CGJ A;  4M41 A;  2BH1 A;  4BRG A;  3PIO L;  1DT9 A;  4CHO A;  3VTI A;  4BRP A;  3MXM A;  2D0P A;  2UUC K;  4X65 K;  3OYF A;  2P9I A;  2VCP A;  3VQ5 A;  1NK8 A;  3HBT A;  1FW6 A;  1K73 O;  1JL1 A;  3OYN A;  2V52 B;  3R8E A;  1WAF A;  5KPZ A;  1KVC A;  3T1Y K;  5KQD A;  4G1Q A;  3S3O A;  5FPD A;  1ZBI A;  2KHO A;  4BWM A;  4WQ5 A;  4FZX C;  4H0O A;  4FOI A;  4WE1 A;  3CFO A;  2HVH A;  5KPT A;  3WXM B;  5JVH L;  3T69 A;  3V1Q A;  3NF6 A;  3OJS A;  2E20 A;  2VG6 A;  3CG7 A;  2UXD K;  5C2D A;  2NRT A;  1J5O A;  2WUS A;  3AVF A;  4CZF A;  2P5O A;  3DXM B;  4OO1 J;  1EP4 A;  1X1P A;  3PX0 A;  1VSH A;  1Q86 O;  1HJO A;  4JI1 K;  4H4O A;  3TAR A;  2GX9 A;  1C1C A;  4X66 K;  3OJU A;  3E9O A;  4BR5 A;  4H0Y B;  3QBX A;  3DXM A;  3VET A;  2VYP A;  4JI5 K;  4RCH A;  4DWI A;  2P5G A;  5TKW A;  4PKI A;  1JXE A;  3JXU A;  5AQH A;  1RTI A;  4B9S A;  5AFU A;  2PZS A;  2GBZ A;  3SZ2 A;  5BN8 A;  4DTO A;  1C0T A;  4DV7 K;  4CJT A;  3EL2 A;  3I55 N;  1KAY A;  1X3N A;  3OW2 M;  3V9W A;  3L2W A;  1Z6R A;  4RW8 A;  4KRE A;  3A2F A;  2QWN A;  1BCO A;  4B1X B;  3MK6 A;  1KVB A;  1HKC A;  3H08 A;  3CCQ N;  3NE6 A;  4FW1 A;  4CFD A;  4FJN A;  4FM0 A;  1YIJ N;  3Q7C A;  2YNF A;  1W9H A;  2YJE A;  2FLO A;  2B6A A;  4AM7 A;  1I3A A;  1HKB A;  1YXQ A;  3KD5 E;  1E4F T;  4CES A;  4FZY A;  3LM2 A;  2E6L A;  3AO4 A;  4FJ9 A;  2B5J A;  4BR7 A;  4F2R A;  1RBS A;  5EX5 A;  1LCU A;  2OZS A;  4AF1 A;  4CFC A;  1NMD A;  1T44 A;  1NGF A;  4JKE A;  5J2P A;  2A40 A;  4LFA K;  5JLH A;  2G8W A;  4GV9 A;  3C94 A;  4B1V A;  2ZGY A;  4F4K A;  5AQW A;  3NHG A;  3K57 A;  1NK9 A;  3ZX3 A;  3LAL A;  4PWD A;  2JGU A;  3V1O A;  4KB0 A;  3QES A;  4PY5 A;  5EU7 A;  2QXF A;  4J2D A;  3VQ6 A;  4CEB A;  5K14 A;  4JN4 A;  3HPH A;  5AQF A;  3I0S A;  5GIN A;  2IS3 A;  2I5J A;  3QIC A;  1KC8 O;  2AJQ A;  4M3U A;  1GOA A;  5F1X A;  3CJ1 A;  3HOT A;  4AQY K;  3AVM A;  2EHG A;  3MN5 A;  2B4J A;  1YJN N;  2W41 A;  1TYQ B;  2HNY A;  4DFK A;  4CZM A;  4B3M K;  2HF4 A;  4CJL A;  3THW B;  2O8B B;  5CYQ A;  5LJW A;  3OYE A;  1U6Z A;  4AHU A;  2VWK A;  5JMV A;  1NKC A;  4JRQ A;  4M3R A;  2OPQ A;  2NZT A;  4BRA A;  3K9J A;  3H6E A;  2XO7 A;  3D7E O;  4H0V B;  3CET A;  2O8B A;  4K8Z A;  3DAW A;  3HM9 A;  3KJV A;  2FC0 A;  4OLB A;  4DSE A;  4H5N A;  4Z4F A;  3AVN A;  1VRU A;  2O4G A;  4KB1 A;  3L4Q A;  1ZBH A;  1TKX A;  3F9K A;  1EWR A;  2OYQ A;  5GAD P;  1S1X A;  4O0I A;  1U2V B;  1ILY A;  3AVI A;  2NRV A;  3H3O B;  2HHT A;  4B8C A;  5FPE A;  4CF8 A;  3SJH A;  5E84 A;  4WF9 L;  4Y1D A;  2ZM6 K;  1LWF A;  1W97 L;  1KLN A;  3G10 A;  3VOV A;  3QIO A;  4HUE A;  3HT3 A;  4CEO A;  4QS7 A;  3VA0 A;  3I33 A;  4LD0 A;  5TKY A;  3CFP A;  3NGZ A;  3QDK A;  1SUQ A;  4I6M B;  3AA4 A;  4E7K A;  4JYA K;  3KWG A;  2G8H A;  2P9U B;  4JKH A;  3KZB A;  4FPB A;  3L2U A;  2WC9 A;  4B3R K;  2QW9 A;  2KFZ A;  2NRW A;  1ATS A;  1DEJ A;  3U9Z A;  5FPM A;  4NXN K;  1HNZ K;  4ELT A;  1QVG M;  4GY2 B;  3EE9 A;  1V4T A;  3TTC A;  1LWE A;  3T3F A;  4DUZ K;  2ETJ A;  3H3N O;  2FF3 B;  3K0S A;  1IV0 A;  1N36 K;  2UUA K;  5ADX A;  5AQQ A;  2X6N A;  4X62 K;  4BRH A;  4CEF A;  2ITG A;  1YAG A;  3M8P A;  5J2Q A;  1Q9X A;  3QNO A;  3CI5 A;  4DMN A;  3C7N B;  3I8D A;  3RMD A;  5BRE A;  4C1N K;  5AQR A;  4CJF A;  4IG0 A;  3CMA N;  3HP6 A;  1A5X A;  3MEG A;  1CZB A;  3TWH A;  4NYN A;  3W3D A;  5J2N A;  4B3T K;  2YHW A;  4JD2 A;  3OYK A;  3R6M A;  3A5N C;  3MN6 A;  4ICL A;  3THX B;  5I9E B;  2EWS A;  5AQP A;  1VQP N;  1IBK K;  3ZSR A;  5C10 A;  3KLF A;  2UXC K;  1N34 K;  4CZH A;  3OYB A;  2OA8 A;  1E4G T;  3QIN A;  4NCB A;  4ISF A;  1IO2 A;  4Q5V A;  3VGL A;  4CGI A;  2HOE A;  4BDY A;  4KI6 A;  1HYV A;  4FSV A;  4DSK A;  1UAX A;  1RT3 A;  2DY4 A;  3ZSW A;  3FGU A;  4CEA A;  2Q3S A;  5CZ2 A;  4KI4 A;  2UUB K;  1N33 K;  3VQQ A;  2A6A A;  4JI3 K;  4LH5 A;  3SUO A;  3AAR A;  3P39 A;  1NGC A;  5AQT A;  3SQ2 A;  3P38 A;  1NWK A;  3MDQ A;  4FLU A;  3HJF A;  4F3O A;  4KFB A;  4CHP A;  5GAH P;  3CC2 N;  3HOS A;  3C6U A;  4DTM A;  3T1H K;  2ATQ A;  2Q0R A;  2DPN A;  2HHW A;  2F8T A;  3HK2 A;  2Q0U A;  3D2E B;  4O0J A;  3F9M A;  5KRS A;  4DS5 A;  3QIP A;  5SWM A;  3OYD A;  2FSJ A;  5BN9 A;  4UY8 O;  2P9L B;  3OTO K;  3DJC A;  3I0R A;  1VSK A;  3ZT1 A;  3HVR A;  1CZ9 A;  5KPR A;  5JLF A;  3HP9 A;  3AA2 A;  4NLC A;  1B9D A;  4CJ3 A;  4FJL A;  4YDU C;  4JV5 K;  2Y1I A;  2UYT A;  3CJ9 A;  4JI8 K;  1VSI A;  3QO9 A;  3KK7 A;  3SV4 A;  4NYF A; 
#chains in the Genus database with same CATH homology
 2EX3 A;  3JYT A;  1CLQ A;  4HVJ A;  1RT5 A;  5DK5 A;  4C8L A;  3OYG A;  2KZZ A;  3V4I A;  1WSI A;  3DM2 A;  1K6Y A;  2HVI A;  1LWC A;  2WOM A;  4NCG A;  4CHN A;  4HUG A;  1X9W A;  3IAY A;  4OKE A;  4FM2 A;  1MU2 A;  3ITH A;  4I2P A;  4CIG A;  3U3G A;  5I3U A;  4C8K A;  1NOY A;  1B9F A;  1ZBU A;  3VQ4 A;  3VQE A;  4FJM A;  4CJR A;  4OLA A;  2WON A;  3BGR A;  3HXM A;  2F96 A;  1UWB A;  4Z4G A;  4GMJ B;  3WNH A;  5KGW A;  4M3W A;  2XY7 A;  2BAN A;  4DTU A;  1U45 A;  1JLF A;  1KVA A;  1VK0 A;  4LSN A;  4CIF A;  1LAV A;  1YVU A;  4HUF A;  1UOC A;  4PA1 A;  4FCY A;  4B08 A;  1FXX A;  5HRO A;  3TI0 A;  3RR7 A;  4L8R B;  3DRP A;  1BIU A;  4C8N A;  2VWJ A;  4FM1 A;  4DS4 A;  3RMB A;  4B9U A;  4TSX A;  2G8V A;  3K5O A;  2G8I A;  3TR8 A;  4HHT A;  4B9T A;  1TAQ A;  4DTX A;  4KPY A;  4AHC A;  4JS4 A;  3ASM A;  3CQ8 A;  2HB5 A;  1D9F A;  3CYM A;  3AO2 A;  3AVJ A;  2X74 A;  1RTJ A;  4KTZ A;  3TAM A;  3QET A;  4M3X A;  3PO4 A;  3DLB A;  1S6P A;  1CXQ A;  3KLI A;  3AV9 A;  1Q8I A;  2YHB A;  3MAQ A;  3OVN A;  4JLH A;  4FW2 A;  2W42 A;  3DOK A;  1L3T A;  4CJP A;  3OYL A;  3NDK A;  4E1M A;  3PUF A;  4DQQ A;  2RN2 A;  3K2P A;  3EZ5 A;  3O3G A;  3V9X A;  1ZBF A;  1KSP A;  4FJH A;  4CHY A;  4KHU A;  4FZZ A;  3RRH A;  1YTU A;  3DRS A;  4E19 A;  5KGX A;  1HRH A;  3LP1 A;  1BIZ A;  2G8U A;  3K59 A;  3KK1 A;  3DLR A;  1VSF A;  2Z1H A;  4BWJ A;  4CEZ A;  1HYS A;  3O3F A;  3SI6 A;  1RBU A;  5SZT A;  4OPJ A;  4FJK A;  4CK2 A;  3NF9 A;  4PQU A;  2YV0 X;  2ZQB A;  3SQ0 A;  4Z4E A;  5JS1 A;  3L3U A;  4N47 A;  3JSM A;  1CXU A;  1NOZ A;  4W5N A;  1WSF A;  3V9U A;  4DTR A;  4DLG A;  4OGC A;  1HQE A;  4DU4 A;  3T1A A;  4FK2 A;  2HHU A;  3KKS A;  3AVC A;  2KZM A;  1I39 A;  2Y1J A;  4DQP A;  1IKY A;  4M41 A;  4UQG A;  1C1A A;  2GUI A;  3K5L A;  4B9V A;  1HNV A;  4E0D A;  3QEX A;  1ITG A;  2DFE A;  2X78 A;  4CHO A;  5C42 A;  2QKK A;  3MXM A;  3OYF A;  3VQ5 A;  3SQ1 A;  1NK8 A;  4Z4C A;  2D0B A;  1RBR A;  3LWM A;  1JL1 A;  3OYN A;  1HPZ A;  3AVG A;  1WAF A;  3DMJ A;  1NK7 A;  4CEQ A;  1KVC A;  4HCC A;  2A1R A;  3VQB A;  1BIS A;  1RT4 A;  4G1Q A;  3SJJ A;  3S3O A;  3ZT0 A;  4PUO A;  4N41 A;  1ZBI A;  3QLH A;  4CJE A;  3RMC A;  4BWM A;  4C8M A;  1RDD A;  1DLO A;  3KTQ A;  4DSJ A;  3NH2 A;  4FZX C;  1JLE A;  3FFI A;  4CGD A;  3BDP A;  4WE1 A;  3CFO A;  2BE2 A;  2HVH A;  1TK5 A;  3LWL A;  3V1Q A;  3NF6 A;  4I7F A;  3S9H A;  1S1W A;  2Z1G A;  4K8X A;  3OJS A;  4GVM A;  1RT2 A;  3OYA A;  2VG6 A;  3CG7 A;  5HRR A;  1VSE A;  3VQC A;  4DQS A;  1EX4 A;  4FK4 A;  1J5O A;  4B9N A;  3HO1 A;  3AVF A;  1TVR A;  2XHB A;  1TK0 A;  3ZSY A;  1ASW A;  1QE1 A;  2P5O A;  2RF2 A;  1GOB A;  4DFM A;  2JLE A;  1EP4 A;  1XWL A;  4DF4 A;  1RTD A;  3QNN A;  1X1P A;  4CF2 A;  3PX0 A;  2NUB A;  1VSH A;  5KTQ A;  1NK4 A;  4H4O A;  1O1W A;  1S9G A;  3TAR A;  3RWU A;  2GV9 A;  1C1C A;  3M8S A;  3QEI A;  3OJU A;  3S3N A;  3VQ9 A;  3TAP A;  4DSL A;  1T05 A;  4CFA A;  1IKV A;  4CJW A;  4RG8 A;  3T19 A;  3U6F A;  1YTA A;  1TL3 A;  3KLE A;  3K5M A;  1KRP A;  2PY5 A;  1DTQ A;  4DTN A;  2FBY A;  4KHY A;  4DWI A;  4KHQ A;  2P5G A;  1JXE A;  3M8R A;  3LAN A;  4CHZ A;  3LAM A;  4Y1C A;  3KLH A;  3QEW A;  4FLZ A;  4FLX A;  2F8S A;  3VN5 A;  3D0P A;  1RTI A;  4J2A A;  2X6S A;  4RW9 A;  4FYD A;  1T7P A;  3LZI A;  4B9S A;  3LP3 A;  2PZS A;  2GBZ A;  4CIE A;  3NH1 A;  3SZ2 A;  2HHV A;  1JLC A;  4DTO A;  1C0T A;  3HYF A;  2DFH A;  1U47 A;  2QK9 A;  5HP1 A;  4CJT A;  4IBN A;  1QSS A;  3AO3 A;  2IAJ A;  1Z26 A;  4FJI A;  3HL8 A;  5D3G A;  4IFY A;  3KK2 A;  3V9W A;  4J2E A;  3L2W A;  3G0Z A;  4RW8 A;  3VQ8 A;  4KRE A;  2D5R A;  3A2F A;  4QAG A;  4RW4 A;  4BAC A;  5J2M A;  1U04 A;  1BCO A;  3HVT A;  2IC3 A;  2D0C A;  1KVB A;  3H08 A;  1UA0 A;  1RBV A;  1BI4 A;  3OS0 A;  3NE6 A;  4FW1 A;  5HRP A;  4N56 A;  2G8K A;  4CFD A;  1WSG A;  2E4L A;  4BE1 A;  1BGX T;  1NJW A;  4FM0 A;  1D8Y A;  4FJN A;  1WSH A;  2DY4 A;  3S3M A;  4IKF A;  2DFF A;  2YNF A;  1W9H A;  1BL3 A;  4I2Q A;  4M42 A;  4YFU A;  2B6A A;  4DTS A;  1FKP A;  3PV8 A;  3L3V A;  4QCL A;  4E7H A;  1I3A A;  2E6M A;  3KD5 E;  1J54 A;  3NCI A;  4CES A;  3B6O A;  4FZY A;  3DOL A;  3HPG A;  3AA5 X;  2E6L A;  3AO4 A;  1L3V A;  4FJ9 A;  2B5J A;  1WSE A;  4Z4H A;  3DLH A;  4F2R A;  1JLA A;  4FVM A;  5E41 A;  4KTW A;  3LDS A;  4DQR A;  3PY8 A;  3AVH A;  1RBS A;  2KW4 A;  4KKO A;  3RMA A;  1SKS A;  2YNI A;  2OZS A;  4ID5 A;  3TAN A;  4CJV A;  4LH4 A;  2VG7 A;  3VQD A;  4JRP A;  1JLG A;  3V81 A;  4M3T A;  1HJR A;  3ULD A;  1S6Q A;  1WAJ A;  4CFC A;  1D9D A;  5J2P A;  4OPK A;  2G8W A;  3AVB A;  4O44 A;  3C94 A;  1QHT A;  4E3S A;  2G8F A;  3PO5 A;  4H4M A;  3OYC A;  4CED A;  4BDP A;  4ELU A;  4F4K A;  3VQP A;  3EYZ A;  2FBT A;  3MXJ A;  1VSJ A;  3ZT4 A;  3NHG A;  4JS5 A;  4FJX A;  3K57 A;  3WNE A;  3C95 A;  1L3S A;  1SL2 A;  1NK9 A;  4E7J A;  4E1N A;  4DQI A;  3LAL A;  4EZ9 A;  3O4Q A;  2IOC A;  1IKX A;  1XC9 A;  2JGU A;  4N76 A;  2P1J A;  4PWD A;  1BQM A;  1RNH A;  4KTQ A;  3NF7 A;  3V1O A;  4KB0 A;  3QES A;  1NJY A;  3TAQ A;  4F2S A;  4PY5 A;  1VSL A;  3DLE A;  3ZSZ A;  3ALY A;  3IRX A;  5EU7 A;  2QXF A;  5HBM A;  4J2D A;  3VQ6 A;  4CEB A;  4FJ5 A;  4M3Y A;  4B9L A;  1XHX A;  4CF1 A;  5K14 A;  3HPH A;  3V1R A;  4CJ4 A;  5HRN A;  3I0S A;  3TAF A;  4F8R A;  1W0H A;  1LAW A;  4CGG A;  2IS3 A;  2I5J A;  4KV8 A;  1NK6 A;  2P51 A;  2OPP A;  1R0A A;  2AJQ A;  3SQ4 A;  4M3U A;  1GOC A;  1GOA A;  1U49 A;  1X9S A;  3THV A;  5DMR A;  2XY8 A;  4KO0 A;  1RT1 A;  4M3Z A;  3AVM A;  4CJU A;  2BDP A;  2EHG A;  4FK0 A;  4CE9 A;  1IH7 A;  2IGI A;  1ASV A;  1REV A;  2B4J A;  3NH0 A;  2HNY A;  3LPT A;  4ZHR A;  4DFK A;  3C6T A;  3M8Q A;  5JS2 A;  1N5Y A;  3LP2 A;  4CJL A;  5CYQ A;  3OYE A;  4AHU A;  3K58 A;  2VWK A;  5CZ1 A;  1S1U A;  1TGO A;  2YKN A;  3DRR A;  4C8O A;  3NGY A;  1RT7 A;  1NKC A;  4JRQ A;  3P5J A;  3ZCM A;  1HNI A;  1YT3 A;  4BDZ A;  3NF8 A;  5FDL A;  4AHR A;  4M3R A;  2OPQ A;  4FJJ A;  3U3Y A;  4CEE A;  5KRT A;  2XO7 A;  1UA1 A;  1Z25 A;  4KHW A;  1NKB A;  4E89 A;  4K8Z A;  3WNG A;  1WNS A;  3AO1 A;  3KJV A;  3OYM A;  2FC0 A;  3HM9 A;  1SKW A;  3HST B;  4OLB A;  4LSL A;  3AVK A;  4CGH A;  4CHQ A;  4DSE A;  2HMI A;  1TAU A;  3MXI A;  3ZSV A;  4Z0U A;  4Z4F A;  3AVN A;  4DSK A;  1JL2 A;  1VRU A;  2O4G A;  2HHQ A;  4KB1 A;  2O4I A;  4CGF A;  3DI6 A;  4M45 A;  3VQ7 A;  4W5T A;  1ZBH A;  1TKX A;  4Q0B A;  1SV5 A;  4I9Q A;  3OYJ A;  4CK1 A;  3KK3 A;  4OVL A;  3B6P A;  3F9K A;  4IFV A;  3EY1 A;  2OYQ A;  4HCB A;  5CYM A;  3NFA A;  4FJG A;  2QKB A;  1S1X A;  1SKR A;  3ZSO A;  4O0I A;  3KD1 E;  4KAZ A;  3AVI A;  5T7B A;  3L2Q A;  4FJ8 A;  2HHT A;  4B8C A;  4I9L A;  4CF8 A;  1BI4 B;  3TAB A;  1C0M A;  4Y1D A;  4BE0 A;  1LWF A;  4GW6 A;  2XY6 A;  3CM5 A;  1KLN A;  3G10 A;  1RDA A;  3QIO A;  4DU3 A;  4HUE A;  3HT3 A;  2YNH A;  4CEO A;  4CEC A;  3VA0 A;  4AH9 A;  4LD0 A;  3SUP A;  1ZYQ A;  2Z1J A;  2RPI A;  3CFP A;  5I42 A;  1KTQ A;  3NGZ A;  1F21 A;  3QEV A;  1SUQ A;  1NJZ A;  4E7K A;  1TKT A;  3AA4 A;  1A5V A;  2YHA A;  4YNQ A;  2A1S A;  1JLB A;  2OPR A;  4MQ3 A;  1JLQ A;  3SUQ A;  1QTM A;  2G8H A;  4KRF A;  4FLT A;  4OKK A;  3L2U A;  3NGI A;  3VA3 A;  4AHT A;  2YNG A;  2Z1I A;  3SUN A;  4DTJ A;  4EP5 A;  2KFZ A;  1VSM A;  4KI6 A;  5C25 A;  4ELT A;  1NKE A;  3KKR A;  1JKH A;  2KQ2 A;  5FRM A;  3AVA A;  1A5W A;  1LWE A;  4DLE A;  3T3F A;  4B9M A;  2ETJ A;  4EZ6 A;  1KCF A;  1Y97 A;  1RDB A;  4MFB A;  1EXQ A;  2FBV A;  1J9A A;  3O3H A;  3MED A;  3NAE A;  5J1E A;  2X6N A;  2BGG A;  1KFD A;  4R5P A;  5HRS A;  3ZT3 A;  4CEF A;  4ZTF A;  2ITG A;  3TAG A;  3DLK A;  1VSD A;  1TKZ A;  4DU1 A;  4AIL C;  3SPY A;  1NJX A;  3M8P A;  2HHX A;  1ASU A;  5J2Q A;  3OS2 A;  4XIU A;  3SYZ A;  1Q9X A;  3QNO A;  1BQN A;  4DMN A;  5C24 A;  3K5N A;  3I8D A;  3NBP A;  1HQU A;  3WNF A;  1NK5 A;  3RMD A;  4DSI A;  4DTP A;  3MEC A;  2D0A A;  2VG5 A;  1WLJ A;  3F73 A;  4CJF A;  1X9M A;  1S5J A;  4O4G A;  4IG0 A;  3IS9 A;  3HP6 A;  2KFN A;  2XRI A;  1TK8 A;  2HND A;  4CFB A;  1A5X A;  1RDC A;  1CZB A;  3MEG A;  3LZJ A;  3TWH A;  1DTT A;  3ZSX A;  4NYN A;  3RRG A;  4KHN A;  3LAK A;  5J2N A;  3DLG A;  4IDK A;  1RTH A;  1C0U A;  2ZE2 A;  3OYK A;  1HMV A;  3HPO A;  1SL1 A;  3QER A;  1T03 A;  4CF9 A;  1S1T A;  4HTU A;  4DF8 A;  4ICL A;  1S9E A;  1EET A;  4O55 A;  1QSL A;  4FXD A;  1RT6 A;  5FRN A;  3SPZ A;  2HNZ A;  3L2V A;  3ZSQ A;  3ZSR A;  3AO5 A;  4ZTJ A;  1HYZ A;  3KLF A;  1D5A A;  4CCH A;  3OYB A;  3L8B A;  1N6Q A;  2OA8 A;  4W5Q A;  3D45 A;  3QIN A;  4AHS A;  1ZBL A;  3V6D A;  1IO2 A;  4NCB A;  2R7Y A;  3OS1 A;  5CY4 A;  4CJ5 A;  4Q5V A;  4FLY A;  4B3O A;  1QS4 A;  4OGE A;  4CGI A;  1TV6 A;  4O5B A;  4DG1 A;  5KI6 A;  1HYV A;  4CK3 A;  3CFR A;  3OYI A;  4BDY A;  1NK0 A;  1IG9 A;  1BCM A;  3V9S A;  1UAX A;  2ZD1 A;  1JXB A;  2OZM A;  1RT3 A;  1RCH A;  1S1V A;  3ZSW A;  4AHV A;  4CGJ A;  4CEA A;  1XHZ A;  3SV3 A;  1FKO A;  1C1B A;  4OJR A;  3AVL A;  4FLW A;  3P83 D;  2Q3S A;  5CZ2 A;  4KHS A;  4KI4 A;  4ELV A;  1L3U A;  4NCA A;  3TAE A;  4ID1 A;  2HW3 A;  2FBX A;  4E7L A;  2OPS A;  3VQQ A;  4DFJ A;  1T8E A;  3RTV A;  4CJQ A;  2YKM A;  4BE2 A;  4LH5 A;  3SUO A;  1XI1 A;  1U4B A;  3V9Z A;  3SQ2 A;  3AA3 A;  3CM6 A;  1KLM A;  1LW0 A;  4W5O A;  3OY9 A;  4FLU A;  2XY5 A;  3HJF A;  4RW7 A;  4CJS A;  3LP0 A;  4B8A B;  1QSY A;  4F3O A;  4FJ7 A;  4Z4I A;  4KFB A;  4CHP A;  1L5U A;  3UIQ A;  1QQC A;  2IDO A;  2PYJ A;  3C6U A;  4DTM A;  2ATQ A;  3SCX A;  5HLF A;  5FRO A;  1VRT A;  4EP4 A;  1KFS A;  1G15 A;  2HHW A;  3P1G A;  2DTU A;  1C6V A;  2LSN A;  2F8T A;  3L2R A;  1BHL A;  3HK2 A;  1WSJ A;  3DYA A;  4O0J A;  1Q9Y A;  1SL0 A;  1TL1 A;  2RKI A;  3PX6 A;  5KRS A;  4IG3 A;  1LW2 A;  4DS5 A;  3QIP A;  5SWM A;  3OYH A;  3OYD A;  2PYL A;  4DSF A;  3QEP A;  3SNN A;  3PX4 A;  1EKE A;  1RIL A;  1B92 A;  4FLV A;  3LPU A;  4QOZ B;  4F3T A;  3I0R A;  3O4N A;  1VSK A;  3ZT1 A;  1U48 A;  3HVR A;  4E7I A;  1CZ9 A;  4CER A;  3VQA A;  4W5R A;  3HP9 A;  1FK9 A;  3AA2 A;  4N5S A;  3RR8 A;  2HHS A;  1B9D A;  4CJ3 A;  4DFP A;  4FJL A;  1RBT A;  1IKW A;  3ZT2 A;  1WN7 A;  4CJK A;  3KIO A;  3ISN C;  1LV5 A;  3IG1 A;  4RW6 A;  1J53 A;  2Y1I A;  1VSI A;  1TKD A;  3QO9 A;  3KLG A;  2KTQ A;  4LY7 A;  4J2B A;  4CF0 A;  4H8K A;  3SV4 A;  3E01 A;  3MEE A;  4NYF A;  4OKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...