3M8PA

Hiv-1 rt with nnrti tmc-125
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
555
structure length
551
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of piperidin-4-yl-aminopyrimidines as HIV-1 reverse transcriptase inhibitors. N-benzyl derivatives with broad potency against resistant mutant viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 162
structure length 551
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3m8pA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8pA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8pA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8pA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3m8pA05
3M9NB 1RT2A 1CSJA 2WCXA 4CHOA 3IRXA 2B43A 1QE1B 2VG5B 3NGIA 3UR0A 5I3UA 3VN5A 1ZETA 4KHNA 3BSNA 3L8BA 4O4GB 3FQKA 3QIPB 1T8EA 5KTQA 1G15A 3H4BA 2KQ2A 2FVQA 5K14A 3V9WA 1D1UA 3AVHA 2FBVA 3IRXB 5KFDA 1WSJA 1K1QA 4Z4IA 4TN2A 4BDYA 1XI1A 3DMJA 2ZD1B 3UQSA 4KB0A 4QAGA 3OYJA 1Z25A 1NKBA 4EO6A 3SQ1A 2ZE2A 4HCBA 3CVKA 4M41A 3F9KA 3KD5E 3SQ4A 3IS9B 4KAIA 3GQCA 1HQEA 2WOMB 1L3TA 4CIFA 4H4MB 3PW7A 1LW2A 3GYNA 5JS1A 4ZP8A 1VRUA 4DL6A 3FSIA 4WYLA 4N47A 4KAZA 4WYWA 1KTQA 1A5WA 5KG0A 1S0NA 4TQSA 4FJ8A 3PX6A 2HNYA 2DFFA 2GIRA 4J2BA 4CF0A 3KMSA 2PYJA 4E1NA 4CGFA 3OS0A 5KFXA 2BRLA 4HHTA 3HXMA 2YNFB 3Q8SB 1SL1A 4ECRA 4CEDA 4GMJB 1HQUB 1FKPA 3AA5X 4FM1A 4EEYA 1SL2A 1RT1B 3QYYA 3DOLA 2V0NA 4DL7A 4MKBA 3TABA 3DRSB 3N6MA 1LWFB 4C8NA 4NLUA 3QEWA 2PY5A 4WXWA 5J2QA 3PX4A 4B9SA 5EDWA 4URSA 4IRDA 3ZSVA 4ICLA 2OZSA 1S10A 4DSEA 4YFUA 4BWJA 1DTTB 5L1IA 4RW9A 4F8RA 2AX1A 2X6SA 4QCLA 4IG3A 2YKMB 4Y1CA 1HRHA 2BDPA 3ZT4A 4Q43A 4RW7A 3IG1A 4RNHA 1U45A 4CHNA 1KVAA 2C2RA 3MFIA 2R8KA 3MEEA 1UAXA 3O3FA 1RAJA 3KIOA 3OYNA 2RN2A 3CWJA 3D0PA 1T05A 3QNOA 1W9HA 3NAEA 5J2MB 3PW4A 3PV8A 4F4YA 3FFIB 5DGBA 1QS4A 2YKNA 4KI6A 4QWBA 4K4VA 2DTUA 1JLFB 3KK2B 4RNOA 4CJSA 5HRSA 3SUPA 3NL0A 2IAJA 2OA8A 5D3GB 1KFSA 1SUQA 5KT6A 3OLAA 1T05B 3CFOA 3ZSZA 1BGXT 2RPIA 3AVFA 2BANA 3MEGB 3M9OB 5F8MA 3HM9A 3F73A 3L3UA 1IKXB 5KFGA 3T5LA 4OLAA 4O4RA 4CJ4A 3PVXA 2IM1A 2BQUA 3V6DA 2D3UA 4ED2A 4R5PB 3KLFA 3KLEA 3P83D 1TKXB 2Z1JA 5F9LA 4B3OB 4RNMA 3K57A 4E19A 1UWBB 4O3OA 5FRNA 4EZ6A 3P5JA 4H8KA 4KHUA 3ZT3A 1IKWB 1N6QB 4F2RA 2O5DA 1BQMB 3LP0A 4DQPA 1VSKA 3TAGA 1NKEA 3I5CA 1RTIA 4G1QB 4TQRA 4TY8B 2AGPA 1B9DA 4O3QA 4CFDA 1SL0A 2B5JB 2J6UA 2QXFA 3CQ8A 2OZMA 4Q45A 3V9ZA 4I9LA 1JLGB 3T19A 3HVRA 4O3SA 5EUHA 3NE6A 3NMAA 3MEEB 2OYQA 4IR9A 3QEIA 4CJRA 3ULDA 4IDKA 2PYLA 3MR6A 3SV3A 5DQIA 3GIIA 1NJZA 2W9CB 3LZJA 1TL1B 3QO9A 3H59A 5KG5A 1DTQB 2FVSA 4W5NA 3LPUA 3CG7A 2E6LA 2W9BA 1A5XA 1HMVA 3DMJB 1BQNA 3MR5A 1U48A 4AHVA 4F50A 5DK5A 4I7FB 3LANA 5KFKA 4DF4A 4ELVA 2ETJA 5KFVA 4FJ9A 2GBZA 1FK9B 1RILA 3VQDA 1IKXA 4ID5A 4PUOB 3AVCA 1VSLA 5JUMA 3C94A 4ZVEA 4YQWA 3G6XA 2RKIB 5KFNA 3LAKA 4O55A 4NLRA 3T5JA 4CEZA 1LV5A 2J6SA 3QZ7A 3AVNA 1QSLA 1S6QA 1ZBUA 1X9SA 2HNZA 4XPCA 1TKDA 1NOZA 2YKMA 1S0OA 4CF1A 3V9XA 4HCCA 4U7CA 4ZTJA 1VRTB 2OH2A 3O4QA 1ASVA 4K4TA 3T5KA 3BQ1A 2Z1GA 3K2PA 4NZ0A 3C6TB 4IKAA 4FJNA 4CESA 4O0IA 2V4RA 1IKWA 1BHLA 3MECA 2YV0X 4FZYA 2O4IA 3RB0A 3DLGB 5CY4A 4OKJA 2X6NA 2IM0A 3DRSA 4J9LA 1SH0A 1NK0A 5HP1A 3KJVB 4I2QB 4E7JA 2R2UA 1SUQB 1T94A 1J53A 1JX4A 4MIBA 3LP1B 5L1JA 3K58A 3VA3A 3HL8A 4N76A 4HVJA 1W0HA 4NYZA 1C1CB 1YVFA 2IMWP 2AQ4A 2FLPA 1HYVA 4ED0A 3T1AA 1HPZB 4ECYA 1GOBA 4HUGA 1RT6A 3T3FA 3QIPA 3SQ0A 1IO2A 2B6AA 3Q8PB 4J9KA 4GC7A 3OYAA 4CEBA 5C5JA 2IC3B 5I42A 4M3YA 3DM2A 4KKOA 2FJVA 1RDAA 4IG0A 3QLHB 4F2SA 4AHUA 3L2WA 3NF7A 2XCPA 3VQBA 2QKBA 2HMIA 4ED8A 3S3OA 3KLVA 4E3SA 2ASJA 2YNHA 4K4YA 1NK7A 1C1CA 3LP0B 1FKOB 4R5PA 3KLFB 3PO5A 4K8ZA 3BREA 3DRRA 5DMRA 3WNGA 1HARA 1VRUB 2B6AB 4K50A 1KVBA 3P1GA 4L8RB 3V9UA 4FM2A 3MEGA 3U3YA 2HNYB 4RW9B 4DLGA 1GOAA 3V1QA 4CJ3A 4MK9A 4M95A 2XO7A 1ZBIA 3BSOA 2BE2B 1JLCB 1NHUA 1DLOA 1KRPA 4QWAA 3AV9A 3ZSWA 4NLGA 4CJWA 4PA1A 3AVIA 5KT2A 4RW4A 4K4XA 1RBVA 4B8CA 5J2MA 1ITGA 1RTHA 3PR5B 3VA0A 3NF6A 4CJEA 4KHMA 3KK3B 4DSLA 3LP2A 1NJXA 2F8EX 1T3NA 1HNIB 4CECA 5F8GA 4Z4EA 2IM2A 3EYZA 4R8UB 2HHUA 1TKTB 5KFYA 1Y97A 4FS1A 4KTQA 3V1OA 4CJLA 5J1EB 2BE2A 2YHBA 3V1RA 4Z4GA 4OVLA 1OS5A 4ID5B 3ITHA 1J54A 5HRPA 1WSEA 1BI4A 2G8IA 4CGDA 1YTUA 3QESA 3TAEA 3O3HA 3OLBA 3K5MA 4CEEA 4K4SA 1U09A 2Z1HA 1GOCA 4Z0UA 3M8RA 2ITGA 4JUZA 4FJ7A 4ICLB 1Z4UA 2VG6B 3RR7A 2XY7A 4NLXA 2C28A 3RMDA 4NLWA 3OYFA 4JRQA 3IGNA 4KHWA 4PY5A 3DRPA 3RRHA 1IM4A 2VWKA 1KFDA 3IAYA 4KO0A 4DL5A 3OJUA 4NRTA 4DTMA 3N6NA 1JLBA 4RZRA 3GILA 3BSCA 2IBKA 3K5OA 1ZBLA 1TAUA 2YNGA 3ISND 4ECXA 3EZ5A 2OPRB 1C0UB 2JGUA 4M3TA 1TK0A 4E7LA 5DLFA 1X9MA 1RYRA 2YNFA 2IJFA 4JV1A 3QINA 3AA2A 4DTNA 1VSFA 1RA6A 4K4UA 3TAMB 1C6VA 3OHBA 1ASWA 3NH2A 2F96A 2HNZB 1IKVB 3BGRB 3SNNA 1RT5B 4FLXA 4H54A 3EPIA 3KLHA 3BSAA 1RT6B 4YP3A 1S48A 2C22A 3VQ4A 1UWBA 4B9MA 3B6PA 3KJVA 1B9FA 1SV5A 4N5SA 3OVNA 4CF9A 3SV4A 4FBUA 4H4MA 2AGQA 1X9WA 5KFOA 4HKQA 1RYSA 3C6TA 3DI6B 2GC8A 4OJRA 3NCIA 1QTMA 5HROB 3NGDA 4ECTA 1S1TB 1IH7A 1JL1A 1TV6A 2ASLA 3H5SA 3AO3A 2YHAA 3RB4A 1Q8IA 4C8MA 4E7IA 3N6LA 2JLEA 3SPZA 3KK2A 1W25A 5F8LA 2XY8A 4FK2A 4FJ5A 4ED1A 3LALA 3LWMA 4DTPA 4WXOA 2RDJA 4CHPA 4F4KA 3AO1A 1RT4B 4CGGA 4J9NA 1NJWA 1EP4B 1BIZA 3PW0A 1BISA 4MKAA 4FW1A 4EBCA 4CGIA 1MU2A 4B9TA 3AO2A 4I9QA 4RU9A 5DQGA 5KFWA 2IDOA 2E9ZA 4ZTFA 2R8GA 2XI2A 1UA0A 3OYLA 4ZP6A 4KPYA 2JEIA 4ECSA 3VQ6A 2ATLA 4KTWA 1S1UA 1NK9A 1DLOB 1FK9A 3TR8A 4B8AB 4F4ZA 5SWMA 4LH5A 3OYIA 4J9MA 3DLRA 4NLSA 2BRKA 4GW6A 2ILZA 1TKXA 4KB7A 3HO1A 4E1MA 1EP4A 4BE2A 4BE0A 1RT3A 4JS4A 4LD0A 3HVTB 1TVRA 1S1UB 4CGJA 2JC0A 1KHVA 3OYMA 3HJFA 1IKYB 3OYHA 5KFAA 2X74A 3AVJA 1RT1A 4I2PA 1C2PA 3LP3A 4DLEA 3SZ2A 1VSMA 4BACA 3QERA 5C25A 4IFVB 3S9HA 3QGIA 4MK7A 4O3NA 3HPGA 5KI6A 4LSLB 4RW4B 3OL7A 5KGXA 3DYAB 5CYMA 5L1LA 5KG6A 4I7FA 4LQ9A 2DFEA 2KFZA 5J2PA 3LAMA 4CF2A 3KK1B 5CZ2A 1EETA 1JLAB 4CK1A 2QK9A 4DQRA 1RDBA 4TY9A 1TVRB 4ED3A 3MXJA 5EWGA 3S3NA 4IR1A 3DLHA 3M8PB 3PW5A 5KFTA 4XIUA 4DFJA 4CFCA 1C1BA 5KRTA 4Y34A 2CKWA 4LQ3A 1JLBB 4DQSA 1N48A 1TKZB 4AILC 4IRKA 4O5BA 4O0JA 1IKVA 3BGRA 2C2DA 3KKRA 4J9RA 3CYMA 1JXEA 4ECVA 3SFUA 5DG9A 2D5RA 1YT3A 1S9EA 3TAFA 1JLAA 4PWDA 4CJUA 3HP6A 4OL8A 3CJ0A 4KTZA 4NRUA 2EX3A 1S6QB 3OL9A 1RT5A 3QEVA 3KOAA 5KG2A 2Y1IA 4ECWA 4B9VA 3DM2B 4WZQA 2LSNA 1FKOA 4R8UA 3RB6A 3RWUA 1VRTA 1NK6A 3SI8A 3I0SB 1C0UA 1ZBHA 5J1EA 3PR4A 4QWDA 4FBTA 4KFBA 4ED7A 2IAJB 2FC0A 3VQPA 2XC9A 3GIMA 1WN7A 3DRPB 3SUNA 3ZSRA 4KB1A 3CM6A 3AO5A 4DSIA 1QE1A 2VG5A 1CZ9A 3PHEA 4M3RA 3ISNC 5E41A 4Y2AA 1RT3B 4IFYB 4AH9A 2J6TA 2KFNA 4E89A 5HLFB 4B9NA 2ZKUA 4IRCA 4CEFA 5HROA 4R0EA 1RDDA 4ZVFA 3L2UA 3D28A 4ZVHA 1YTAA 4E7KA 4M94A 3NH1A 4RW7B 2Y1JA 3SCXA 3V81A 3KLEB 3WNEA 3QETA 1J5OB 4DU4A 2XY5A 3LPTA 2P5OA 3JSMB 3SI6A 4MIAA 1JLQB 3KTQA 1S6PA 1VSEA 4RW6A 4AHRA 2W8LA 1C0MA 2XRIA 3O3GA 4NCBA 2D0CA 2FLNA 3RAQA 3RRGA 1TL3A 3FFIA 1VSHA 4W5RA 1NOYA 5J2NA 4GVMA 3QZ8A 5D3GA 2OPPB 3E01B 1HNIA 4CGHA 1BI4B 2C2EA 4ECQA 4CF8A 3M9MB 3V6HA 3I5AA 3QLHA 4ECUA 5F8IA 1JLEA 2ZQBA 4CJTA 2HMIB 4DTXA 4Q0BA 4O4GA 2KW4A 4FLTA 3TVKA 1NK4A 3D5MA 2NUBA 1TK5A 5L9XA 3ZSQA 2XY6A 2D41A 3OSNA 3RR8A 1WSGA 3CDUA 4I2PB 4M45A 4HUEA 1LW0A 3IG1B 3BQ2A 4PWDB 1R0AB 3BR9A 5FRMA 4I2QA 1C1AA 3HHKA 1SKRA 3NHGA 1LW2B 5CYQA 1JXLA 2FLLA 2UVWA 3I5BA 2R8JA 2IJNA 1LAVA 4ZPDA 2R2TA 3OY9A 1RT7A 1EETB 3HVWA 3HT3A 4NLYA 3S3MA 3DYAA 2IS3A 4CJ5A 3AVLA 3HK2A 4KKOB 3OSPA 1RA7A 5I42B 3G6YA 4H4OB 3KHHA 2E9RX 2AJQA 5DQHA 2RF2B 5KGWA 2G8WA 3SFGA 1RTHB 1SH3A 4NLVA 1I39A 4RNFA 3DDKA 4Q44A 2HB5A 5C42B 1TQLA 1IKYA 4IFVA 2YNHB 1X1PA 4W5TA 2E6MA 5KT5A 3JYTB 1QHTA 3L2RA 4OLBA 1SKWA 5DG8A 4M3ZA 4M42A 5T14A 4ZPCA 2IOCA 3KLIB 3G86A 5F8HA 3PUFA 1DTTA 4EYIB 1EXQA 4JLHA 3E01A 3K5NA 1BQNB 3T5HA 3BDPA 4Q8EA 1BQMA 4JV2A 3KHRA 2OPSA 4DU1A 4K4ZA 4WZMA 4W5QA 3RB3A 3RBEA 1HPZA 4CIGA 4CJVA 4Y2CA 5HP1B 4C8OA 4XO0A 3VQQA 3LWLA 4FCYA 4ZHRA 3H2LA 4QW9A 3GIJA 1S5JA 3NFAA 2P5GA 1JL2A 4J2AA 1RBRA 2WONA 4Q5VA 1S9GA 3AO4A 2A1RA 2OPSB 3KK1A 1RTJA 2DY4A 3DLEA 4IFYA 4JV0A 5KG7A 3NDKA 4UQGA 4NCGA 2DPJA 1RT4A 3ALYA 4CK2A 3A2FA 4ECZA 4F3OA 4TYAA 2HNDB 3NAIA 1NJYA 4QWEA 1L5UA 2AU0A 2OPQA 4CEOA 2ILYA 4O3PA 1KLMB 1TK8A 2UUWA 4OKEA 1LWCA 3ZSOA 4PQUB 3QIDA 2ALZA 1QQCA 3AA4A 3NGZA 4WE1B 3AVKA 3MEDA 4EO8A 4B3OA 4KRFA 3FRZA 4URQU 4QW8A 3DI6A 3HSTB 3H5UA 1S1TA 4PUOA 5FDLB 1WAJA 1RBSA 2E4LA 4AHCA 2VWJA 2ZD1A 1HNVB 5KG1A 3V4IA 1VSDA 3OJSA 4BDPA 4DEZA 4X2BA 2I5JA 3DLKB 5KT3A 4K8XA 2GV9A 1JXBA 4CHYA 4CK3A 4O44A 1LWEA 1U47A 1RDCA 2R7YA 1NNDA 4CCHA 1VSJA 3UPFA 4WE1A 4FK0A 4TY8A 4KE5A 2XI3A 3FDSA 1RCHA 1N56A 2IC3A 1NK5A 1S1VB 1Q9XA 1WSIA 4KBIA 4NYNA 1RTDB 3CJ5A 3CFPA 1D5AA 1MMLA 1UOCA 1HQUA 3M8QA 5J2PB 4KV8B 4J9OA 4GC6A 1WLJA 5KFUA 4Z4CA 1S6PB 5HBMA 1S1XB 1RT2B 2KZZA 2QV6A 3PJXA 2E9TA 2HHVA 2GUIA 5KFCA 3TANA 5F8JA 4OKKA 4BWMA 4H4OA 3AVMA 5FROA 1D9FA 4EZ9A 4ZMMA 3QO9B 4NLTA 1J9AA 3G6VA 3C95A 4OGCA 1C1BB 5C24A 4YR3A 2W7PA 3AA3A 2PZSA 3QEXA 1RDRA 1L3VA 5KFMA 2ASDA 3OHAA 1N4LA 1DTQA 4DTJA 2G8KA 3CJ2A 2AGOA 2XCAA 3CDEA 2WTFA 4E0DA 2EC0A 1BCOA 5C24B 1U4BA 3VQ7A 4DMNA 5CZ1A 4FLUA 1S1XA 2B5JA 4IBNA 4FZXC 4KHQA 1KHWA 2G8HA 2IA6A 1IG9A 2G8VA 3NAHA 4B9UA 3OYDA 4QPXA 1QUVA 3G10A 2JEJA 1XHXA 4CFAA 4FLWA 4Q0BB 1NKCA 4AHSA 3MTKA 2WB4A 3SUOA 4CJQA 3I8DA 3MXMA 2WONB 3EPGA 2WK4A 3OYKA 1WAFA 1N5YA 1D9DA 1A5VA 4ZP7A 4DL2A 5SZTA 1JLCA 3TAQA 2W9BB 4HUFA 2HNDA 3I0RB 1JKHA 5KFRA 3HPOA 4Y3CA 4ED6A 4CE9A 4DSJA 3EY1A 5KT4A 3MECB 3IGVA 2ZE2B 1NK8A 4FLZA 2VG6A 2DPIA 4ZP9A 1WNEA 4CIEA 3TAPA 4AHTA 2HWIA 1CXUA 3HVAA 1U04A 2JEGA 2O4GA 2YNIA 1HQEB 3QGHA 1N5YB 3MEDB 3M8QB 4TLRA 1WSFA 4NLQA 4MK8A 4DL3A 3AVGA 3CIZA 5HLFA 3CFRA 2KTQA 4DS4A 4LSNA 4PQUA 3ITHB 3ZSXA 3MXIA 3Q8RB 2HHXA 1QAIA 3NBPB 3V6KA 1S1WA 1JIHA 3EZUA 4F4WA 5HRNA 2G8FA 3HKWA 4U6PA 3CO9A 3TARA 3BQ0A 3U6FA 4QWCA 1BCMA 3NF9A 4IG0B 4EBDA 2AWZA 2XGPA 4WFZA 1BIUA 3GV8B 1LWEB 4IQXA 3KK3A 4O44B 3U3GA 3OS2A 2X78A 4IKFA 3THVA 1KVCA 1HJRA 5I3UB 3VQ8A 1TL3B 2HAIA 5CYQB 3SUQA 2P1JA 4XPEA 3Q8QB 4IOBA 3OS1A 1HYSB 3D45A 4OPJA 4YR0A 4NCGB 3OYCA 4QOZB 3OYGA 3E51A 1T03A 1ASUA 4LSNB 1EKEA 5KFLA 2I5JB 3DLKA 1TGOA 3JSMA 1TV6B 2R8IA 4RG8A 4FK4A 4MH8A 5KFQA 4EP4A 3PX0A 3MFHA 5EWEA 4O3RA 3MR3A 1I6JA 4KI4A 1HNVA 3ASMA 2BR0A 1QSYA 4CHQA 5HBMB 4ZVGA 4C8LA 5FDLA 2WOMA 4Z4HA 2QKKA 3MAQA 3UDLA 3OL8A 3NF8A 4NLOA 1CXQA 4OPKA 3NKYA 3CJ3A 1R0AA 2D0AA 1CLQA 5KFPA 1KCFA 3CJ4A 1GX6A 2RF2A 4N41A 3I0SA 3ZCMA 3IN5A 5C25B 2W8KA 4KFBB 1FXXA 4FM0A 2FVPA 2OPPA 3L2QA 3H98A 2UVRA 1S0MA 4W5OA 1SKSA 5KFEA 5CYMB 3GV7B 4KHRA 1I3AA 1ZBFA 3NGYA 1NHVA 3B6OA 1TKTA 3QNNA 4FJIA 4IH6A 4CERA 1J5OA 1XR7A 1ZTWA 4FJHA 3QIOA 2FBXA 3RBDA 3PJWA 2D0BA 4FJXA 3RMAA 4ELUA 3TI0A 1Q9YA 4KO0B 3ZT0A 3ZT2A 1KLNA 3KHGA 4M3UA 4TSXA 3HVTA 3VQAA 1HYZA 2BANB 4N56A 3AVAA 4MQ3A 2CJQA 3ZT1A 3M8SA 3RTVA 4RW6B 4DWIA 4CJPA 1C0TA 4EYHB 2HHQA 4F4XA 3WNHA 4FLVA 4RUAA 4DFKA 1S97A 4FW2A 4TYBA 4IH5A 4J9QA 1ZYQA 5EWFA 4DG1A 2KZMA 4LSLA 4DFMA 4HTUA 3H5YA 4C8KA 2VG7B 4G1QA 3TAMA 4FJLA 3DOKA 4B08A 3KMQA 1N6QA 2BQRA 2XWYA 2HVHA 2DFHA 2I1RA 4DSKA 5DG7A 4ZPAA 3SYZA 4DU3A 4FJMA 1TKZA 2F8TA 2FJXA 5JXSA 1JLQA 3NBPA 4YR2A 4FVMA 3UIQA 3I0RA 5DLGA 1REVA 4M3WA 3V6DB 3DRRB 2W9CA 4WFXA 3AVBA 3GIKA 4M3XA 3GV5B 3PY8A 4EBEA 4J9PA 3SJJA 4FZZA 3IS9A 4FXDA 2G8UA 3LDSA 3KLGB 5KFBA 1HYSA 3V6JA 1LAWA 1REVB 2VA3A 3ZSYA 1T03B 5L1KA 1S4FA 5C42A 1KLMA 1WSHA 2HHWA 1XR6A 3VQ9A 3ICLA 3SQ2A 2R8HA 4ELTA 5KFSA 1RTDA 2UVUA 4J9SA 2OPQB 1JLEB 2RKIA 2FVCA 1O1WA 4DS5A 1JLFA 1XC9A 5HRRA 4FLYA 2BQ3A 5KT7A 1S1WB 3KLGA 3QEPA 5KFIA 4J2EA 4CFBA 3V81B 1S9GB 1S49A 2ATQA 1TAQA 3PW2A 4KHSA 2HWHA 1QAJA 3RMBA 4Y1DA 4KREA 2HHTA 1K6YA 5KFJA 3OL6A 4ZHRB 4DL4A 4IDKB 4NCAA 1HMVB 4E7HA 4YMEA 2W42A 4JS5A 2A1SA 2F8SA 3L3VA 4DTUA 2P51A 4FS2A 5EU7A 4B9LA 1JLGA 1QSSA 1L3UA 3V9SA 4F3TA 1BL3A 4TXSA 4DQIA 4CJKA 3C6UB 3H5XA 1B92A 2R2RA 4YNQA 1CZBA 4G3IA 1D0EA 1GX5A 1S1VA 2V4QA 3CDWA 2B4JA 4RUCA 1RTIB 2EHGA 1D8YA 4BE1A 4EP5A 5F9NA 5J2NB 4DTOA 4KV8A 1XR5A 2QE5A 4FJJA 1Z26A 4OGEA 3C6UA 1FKPB 3KNAA 1F21A 2IGIA 5KG4A 4JRPA 3KHLA 2OPRA 3MF5A 3CM5A 3HP9A 4BDZA 4Z4FA 5KFFA 4CEAA 2V9WA 4KSEB 2FVRA 1S9FA 4NYFA 4RW8A 4MFBA 2UUTA 1SH2A 1YVUA 4DQQA 3KD1E 1XHZA 5F8NA 2Q3SA 3VQSA 2WHOA 4IG3B 3DLGA 2D3ZA 2XGQA 1C0TB 1EX4A 5KG3A 4FJGA 3TQ1A 2WRMA 3H08A 1T7PA 1KSPA 2GIQA 4ID1A 4LY7A 1L3SA 1MU2B 1SV5B 2Z1IA 4RNNA 3QGGA 1LWFA 1TL1A 3VQCA 3PO4A 2XHBA 1VSIA 4LH4A 3DOLB 4CJFA 1JKHB 3K5LA 4DTRA 4MFBB 4K4WA 3FQLA 3VQ5A 4DFPA 4J2DA 1UA1A 3WNFA 4DTSA 4URGA 2FJWA 3L2VA 3LZIA 4NLPA 5JS2A 3KLIA 3TWHA 2FBYA 1RBUA 2VG7A 2R2SA 2AX0A 2W7OA 4FYDA 1S9EB 4IH7A 4DG1B 2YNGB 3JYTA 4DSFA 4CEQA 5KFHA 3DOKB 3HPHA 5KFZA 5KRSA 3G0ZA 2YKNB 3LP1A 1WNSA 3V4IB 1RT7B 4KHYA 2HHSA 4ZPBA 3LP2B 4Q8FA 4CHZA 1TP7A 2BGGA 3VQEA 2IM3A 2HVIA 1RBTA 1RNHA 3OYBA 1XWLA 3MR2A 4HYKA 2RDIA 2FBTA 4FJKA 3M8PA 2D7SA 2YNIB 3DLEB 1RTJB 1U49A 3O4NA 2HW3A 3KLHB 5T7BA 1VK0A 3H4DA 1LW0B 3DLBA 3BJYA 1K1SA 4NLDA 2W9AA 2VA2A 3PZPA 3NH0A 3K59A 5DGAA 3HYFA 3H40A 3RMCA 3OYEA 1ZTTA 4DF8A 5J2QB 3RAXA 3SPYA 2JC1A 1LWCB 5K14B 3KKSA 2UVVA 4RW8B 2JEFA 4WFYA
chains in the Genus database with same CATH superfamily
2Z2MA 1RT2A 3P31A 2HS3A 5KAKA 1QE1B 2VG5B 3SCJE 3VN5A 5AZIA 3M6UA 1T8EA 5BYSA 3FGVA 3AFGA 1CVJA 2KQ2A 2DRAA 4S0MA 4CH0S 2UXBK 4K5SA 5KFDA 4LF4J 4BRAA 2DXFA 1XI1A 3UVJB 2VOOA 3UQSA 1S79A 2BMBA 2B8QA 2R9LA 2O8EA 1Z25A 4WFBL 2PA3A 2ZOMA 4DV7K 3VGMA 4HCBA 4KY3A 5IC4B 3J7A1 4IO1A 4FP9A 3IS9B 4V19S 3DXMB 2RMLA 2WOMB 1L3TA 2EK1A 3GYNA 1FKAF 4ZP8A 4NB4A 1DAXA 5LXYA 2GIRA 5D15A 4J2BA 1XMQF 2OKQA 2FHKA 2WB1D 4CF0A 4AF1A 3KMSA 1GLAG 3W0LA 2NCKL 5C2GA 2YHWA 3H46O 3BKTA 4ZCKA 5KFXA 3EGZA 4HHTA 1HD0A 2YNFB 3OR1B 3Q8SB 4NXMF 2PMHA 3M32A 4JKDA 4LF4F 1JCGA 1VYAA 2QWPA 3VCDA 4Z7YA 1F5AA 3EDRB 2HVDA 3PYDA 3R5BA 4EEYA 5J1PA 2V0NA 3TABA 2CQHA 1VI7A 2GMLA 4BG9A 1X5TA 2BJ8A 2P9SA 1BMQB 3C15B 3W2WB 1SQFA 1LWFB 5MAOA 3K7RA 3I56N 1NM1A 4JHDB 1TFYA 3K5PA 1ZXOA 2Y1LB 2OZSA 4NX9A 4CWBA 1WG4A 2AX1A 2X6SA 2HQ3A 1VQYA 4Y1CA 2RE2A 2BDPA 1TUUA 4GV6A 3EWGA 4CHNA 2AYBA 2XZWA 2C2RA 1WOOA 2AEFA 2XEXA 2CIMA 1UAXA 3OYNA 2RN2A 1FXRA 1IJFB 3GJTB 1T05A 3AXKA 1W9HA 3NAEA 3PV8A 3R7BB 1CS4B 2DTUA 3LF0A 1WC5A 3L3CA 4OHZA 2IAJA 3K9JA 2RHQB 2EFVA 5CZXA 1KFSA 3ZETB 1SUQA 1T05B 4DCOB 1DEJA 3ZSZA 1X7VA 2ZH1A 2VQFK 2KXNB 3F73A 1TMJA 3L3UA 3T5LA 3LL3A 4UTGA 3PVXA 4Z37A 4ED2A 1CC8A 1NUEA 2VODA 1HHSA 4R5PB 3KLFA 4GV3A 1HNZK 1KXPA 2FHOB 4B3OB 4O3OA 4H0VB 2OSRA 4HI2A 4K42A 2DR6A 5LL6Z 3MM7A 4JKHA 3JSRA 4OYIA 2Q97A 1WOQA 1NKEA 1U24A 2ZF5O 1RTIA 4G1QB 5CD4A 4TQRA 4DR5K 4JK8A 1E6YA 1B9DA 4AM7A 1KAXA 2W2OP 1T9WA 1M5VC 1PO6A 4Q45A 4WQ4C 4UOFA 3PCOB 1JLGB 5H9EK 4ILLA 3NMAA 2A41A 3QEIA 1S7IA 2AKWB 4FPIA 5DQIA 1W97L 5BXIA 4KHPK 2GHPA 4NEZA 1CJKA 3D1OA 4W5NA 3JAMY 1IR0A 2W9BA 4DR2J 1HMVA 3DMJB 4WFNQ 4RPFA 2DR5A 2YQ1A 3R3TA 2U2FA 2MY7A 4TU7A 2YKOA 4USVA 3NNHA 5IWAJ 3C15A 2YWEA 4B17A 1UFKA 4ID5A 2LKZA 3C94A 1SAZA 4LRBA 5A8RB 2ZM6J 3MCNA 2RKIB 2BH1A 5HI7A 4AUKA 1DZ5A 3T5JA 4DV6K 2ZH4A 5D8HB 4JI5K 3AVNA 1QSLA 3DXKA 4B3RJ 1RHKB 1S0OA 3VGSA 2IRUA 1U7LA 3G9CA 2ZEJA 1VRTB 2OH2A 1PIEA 1UPMB 1ASVA 4K4TA 2O8DB 4CLFA 4IKAA 4FJNA 5IV3A 2G2ZA 5AE1A 1WSRA 2LEPA 1IKWA 2O4IA 5AQNA 1N54B 3DLGB 4B9QA 3ELHA 2WBRA 5E3CA 1YHQS 1NRKA 3HSDA 2R4FA 2EFPA 4I2QB 1SUQB 1T94A 4KQZA 1JX4A 2QX0A 3VA3A 1FJGJ 4N76A 1YKWA 3L4BC 3G96A 3W60A 2AQ4A 5CR4A 3BGUA 4JI4J 1HYVA 2ZM6K 2E1MC 1HPZB 5AQVA 3SMSA 4JI1K 4YUDA 1F6TA 4HUGA 1Q53A 3QIPA 3T3FA 2BM1A 2B6AA 1XQIA 3Q8PB 3OYAA 3WZ0A 4XH4A 2GO9A 2ZDPA 5C5JA 4DV0F 4HI1A 4M3YA 2ZUAA 4CLKA 1RDAA 3R5JB 3T1HF 1JJCB 2A3ZA 2LYVA 3L2WA 3NF7A 2HMIA 3S3OA 2H4WB 3DLJA 2DR8A 4AT1B 4K4YA 3CMEN 5HVGA 3AOCA 3PO5A 3WNGA 2B6AB 1KVBA 2AD9A 4CBXA 1IBMK 4D3GA 3L0QA 4GKJF 2O01C 3MEGA 3TUJC 4RW9B 4DLGA 4YY3K 2XO7A 4J8FA 4M8LA 1N8RO 3BH6B 4NPOA 1X9JA 1JLCB 1UETA 5ETVA 2CNOB 4DV0J 2O8FB 2YH1A 3ZSWA 4BR5A 1HQ2A 4CJWA 5IV4A 1U02A 2GZOA 5KT2A 4RW4A 2FY8A 5F3TA 1RBVA 4XTTA 1VIXA 4YHHJ 4PABA 3KK3B 4DSLA 2P9LA 1FNXH 4DN0A 2Q6BA 4GKKJ 1WHXA 4X4PA 1XMOJ 2RILA 4AQYK 3L7OA 1YIJS 4FS1A 4KTQA 4CZLA 2BE2A 2Y0BB 2YHBA 4OVLA 2CPHA 4DX8H 1FVSA 1OS5A 4JKAA 4ID5B 5HRPA 2VFVA 3QRQA 2MXYA 2JOQA 3OLBA 1N33K 1Q0NA 1HBNA 2M3DA 4L3QA 1FX4A 4ICLB 1P1LA 1SQKA 2VG6B 3RR7A 2C28A 3MM6B 3RMDA 2AJ1A 1LCUA 4MO5A 1OH7A 1IM4A 1G7CB 4BQZA 1KFDA 3SCLE 4DL5A 4CLUA 2YX6A 4DTMA 4BBYA 3N6NA 4CM2A 1JLBA 4NWBA 4OYAA 2IBKA 1CS4A 3KG0A 2YNGA 1YJ7A 2HF3A 4ISFA 2YVSA 3D6FB 1C0UB 4M3TA 5LJVA 1Z1ZA 4YOYA 3BPSP 5GINA 1X9MA 2PBDA 4NMLA 2YNFA 2IJFA 3OR1A 4JV1A 2F9WA 2WSFC 4Y0WA 3TAMB 2HNZB 1IKVB 3ILIA 3OD2A 3BKUA 4H54A 3EPIA 3KLHA 1YBAA 3HSGA 4K0KJ 2UXDF 3CD6N 1AT1B 3VQ4A 2B9XA 3A1YG 4B9MA 3B6PA 4XAKA 3KJVA 1SV5A 3OVNA 1VQ4N 3VEVA 1F0XA 3SV4A 3S8SA 2Q43A 4HKQA 3QBWA 3AAQA 4H5TA 2GC8A 3D0GE 5BJRA 3AGKA 3NGDA 5HMYA 4ECTA 2ROPA 3H2UB 3W1YC 4JEPA 3RB4A 5ADZA 2R7TA 4WWSA 1J27A 4LF7F 1OKJA 5A8WB 5HL7Q 2NUUG 3MM9A 1FO1A 3KK2A 4FK2A 4BGAA 4CLZA 3NMRA 3LALA 3CQXA 3HHLD 5AZIB 4WXOA 1KQSR 4DUYK 3SBMA 1NWKA 4CGGA 5FIIA 1W7WA 1VQSA 2BW2A 1UJ6A 3PW0A 3K8WA 2E1RA 1XNRJ 4MKAA 1IWAA 3WX8A 2YX1A 4RU9A 4YHHK 4ZA1A 2M2BA 3NNAA 3OBWA 1QAYA 4LFBJ 1UP1A 2IDOA 4C48A 2R8GA 2XI2A 1Q5VA 1V4SA 2V6AA 2FIUA 4ZP6A 5MLCQ 3BDEA 4ECSA 4KTWA 3MXHP 3OA9A 4LH5A 2XWXA 2E7XA 1FE0A 1KBRA 1WEYA 1QVFR 2GIFA 1E4FT 3C7NA 2DK2A 4BE0A 5F0WA 2V7ZA 3HVTB 3WIUA 4L74A 1MLAA 5F41A 4CGJA 4CI6A 1ZC6A 1C2PA 1U26A 4BACA 3J80O 2MQPA 2F63A 1FESA 4YOXA 4A46A 3RJMB 2NZCA 3HPGA 1HJOA 2YWGA 3J80Y 4NA2A 1EO1A 2KFZA 2DFEA 3X1LB 4OI2A 3ILJA 3MN7A 4ENOA 3LAMA 4H03B 5HVHA 4CF2A 3M2VA 3KK1B 1JLAB 1S72S 2XSJA 4DQRA 4TY9A 1R89A 4MO4A 1XC3A 3S3NA 1OH8A 3M8PB 3PW5A 4LFCJ 1FRKA 2KHDA 4CFCA 1C1BA 3DXSX 2O66A 3BY5A 4A8QA 4O23A 3RVCA 4B3MF 1P27B 2KKHA 3CTRA 3DOMB 4CLLA 4X64J 4IRKA 4O5BA 1SIWB 4O0JA 3D7EO 2V7YA 3C14A 2I7NA 3BGRA 2HRUA 3MUVP 3CYMA 1JXEA 1HNWJ 2V4JB 5H1SV 2F65A 3SFUA 4DR1F 1JCFA 1YT3A 3MI7X 3TAFA 1CJUA 1YZ6A 2HURA 4NRUA 4OJ1A 4OX6A 5EY4A 2BJEA 1RT5A 2QSFA 4JP8A 2H4YB 4WIQA 2Q36A 1NPRA 4R8UA 2WW4A 1D9AA 3RWUA 2MYFA 3ENVA 3QT5A 2IAJB 3GIMA 3DRPB 1VR6A 3HJVA 3ZSRA 5ADXH 3BEXA 4NA1A 5LJ3Y 3SAHA 4BR2A 3ISNC 2RU3A 3GYGA 4E89A 5D6GA 5HMWA 4CEFA 5HROA 2KHCA 4GVEA 2FSJA 2CH5A 4NEYA 1MWMA 4E7KA 2EI5A 4ISGA 4M94A 2G0JA 1R8CA 3NWGA 2FY1A 3EVWA 3QETA 2UXCK 4ZLLA 2V63A 1JLQB 2DNNA 1UVLA 4PG6A 1VSEA 2P9CA 4RW6A 3KWGA 3HOTA 3O3GA 4NL5A 2Q1NA 2FLNA 2XMKA 1XK8A 3RAQA 3ATUA 3IAS9 4W5RA 2DYAA 4USIA 4USHA 3ID6A 2OTLS 2BABA 5FPNA 3M3ZA 1NOYA 3IAM9 4M5MA 4GVMA 3E01B 2XZDB 1M90T 2QSWA 3FEYB 1KDNA 3I5AA 5KQ8A 8AT1B 1JLEA 1KS2A 3O9RA 4CJTA 1H2TZ 2OJ3A 4J37A 3FFKB 4FLTA 1A0OB 1YBTA 3GSDA 1VQMN 5CCLA 2XY6A 2V52B 4WTYA 2ACMA 1RFQA 4I2PB 5BREA 4I69A 4W98A 4HUEA 1LW0A 3MN9A 3H20A 3TOQA 4DUTA 2NRRA 4PWDB 2ROEA 3TP2A 5ETNA 2E2QA 4I2QA 3PSIA 2YJEA 1C1AA 3HHKA 2G9OA 3NHGA 1J6ZA 1YJUA 3IXQA 2Q3PA 2CJKA 2UVWA 4DV6F 1LAVA 2B8PA 2R2TA 3FCWA 1LFWA 1WI6A 3HVWA 1RWPB 4NLYA 4CDIA 4UQTA 1GT8A 3AVLA 4ZLJA 5I42B 4DR6J 4L72B 1I94F 3W9HA 3AD9C 1RTHB 4NLVA 1DRZA 2WTUA 5A6WA 4Q44A 1QAXA 2EWHA 2GJ2A 2LP4A 4JN4A 1IKYA 4IFVA 1X1PA 2YNHB 3P5TL 3IFEA 4W5TA 1DT9A 2ERRA 2FGOA 4M5IA 1BA1A 5DG8A 3GJQB 5T14A 4ZPCA 2R7SA 1FE4A 3TYTA 4JKBA 3PEHA 3BO2A 3U1NA 2EPIA 5F8HA 3RBZA 3DXMA 5GMDA 2UUCJ 2DNGA 2K8GA 2JNJA 1Y64A 3T5HA 1T0TV 2IMOA 3VHQA 2CDRB 4JV2A 3T69A 2JH3A 5AQGA 4K4ZA 3SSQA 2QLBB 4CIGA 4CJVA 1GLFO 1EIYB 1YHQN 3VQQA 1R0BG 5D0HA 3TNVA 4FCYA 1S5JA 3HOSA 4QIEA 5T7LB 3W63A 4CI0B 2ZDOA 3AO4A 1E6VB 4CTAB 5GAEP 2A1RA 5LOQA 3KK1A 1RTJA 4P7TA 3HF5A 2FYXA 4UQGA 4NCGA 3ALYA 2CDQA 2FZCB 3W65A 4H0XB 2MKYA 4ECZA 1ITPA 2M8DB 2HVZA 4EU0A 1L5UA 2MQOA 3ZLJA 4O3PA 4NOHA 1NLKL 3MPUB 2ZJRQ 1CQMA 1LOUA 4OKEA 1LWCA 4WKYA 3ZSOA 1NSQA 1OYDA 1XTZA 3EM1A 3T1YJ 1S22A 4WE1B 3AVKA 4EO8A 5L9NA 4QYZK 4B3OA 1OYEA 4KRFA 2I7PA 4DV7J 3NGKA 1T3VA 3OTBA 3TX0A 4C0OC 1H98A 3HSTB 1GXUA 2VFRA 4JI1J 1X5PA 5FDLB 1WAJA 1RBSA 1DQAA 2G1DA 4PG5A 2KG1A 3DU5A 4MAKA 2RQKA 1HNVB 4DEZA 1U1LA 2GV9A 3EE9A 1BG3A 3VMFB 1GMWD 4CK3A 2MDAA 4O44A 2NLWA 1LWEA 3NP5A 3D68A 1FJ7A 1NNDA 3T7ZA 2DEIA 3IMQJ 3MURP 2QLFB 2IVOA 2UUAF 4FK0A 4TY8A 2YX4A 4N8NA 3FDSA 4DV2K 4LF9K 1EQYA 2UU9F 1GTHA 2IC3A 1YJWS 3D0HE 2YCHA 4X66K 1U6ZA 5CHIA 1S1VB 1Q9XA 1NU0A 2Z8QA 2HFVA 4KBIA 4MIWA 1YXQA 1RTDB 1D5AA 6AT1B 1ZOTA 3O2IA 3M8QA 5J2PB 4WP8A 3I56S 4J9OA 5KFUA 4Z4CA 1S6PB 3ZTSA 3GIRA 2KZZA 3PJXA 4RBTA 2GUIA 3MN5A 2Z57B 4OKKA 4BWMA 1D9FA 4EZ9A 2IA0A 2GVZA 3QO9B 4XDCA 3BN4A 4MTPA 2V4JA 3QEXA 1XNRF 2DGQA 4DV5K 2V69A 1DKGD 3Q0AA 3OHAA 1M0SA 3V4MA 1TU0B 1U2CA 2F7VA 2LQJA 3OTCA 2C3PA 5DRKA 2HHHJ 3B8AX 3J7AN 2F4VK 1NSKL 2EC0A 3CCJN 2LMIA 3JS9A 4OV1A 1OWXA 4WK3A 1HKBA 1WEXA 1KHWA 2G8HA 2DXEA 1VCTA 3EGWB 3CJ7A 4B9UA 1S12A 1AW0A 2E7WA 3R27A 2JEJA 3ENAA 2H3EB 4CFAA 2WB4A 4ILJA 4JI6J 2CWKA 3VGTA 4CJQA 3CGIA 1LQ9A 4FYXB 2EFNA 3W3SA 4YB5A 2M5YA 1D9DA 3VGLA 4DL2A 3HMJG 3MD1A 5M1QA 2E29A 2YBVA 4B3RK 3O1LA 5L46A 3EUNA 3H3NO 4DSJA 5KT4A 1M1KO 5EN1A 1CJTB 4ZVPB 4ZK7M 3OR2B 2Z58B 1RBOB 3KJQB 3HVAA 4BRQA 1U04A 4DUYF 1HQEB 3HSZA 2CAJA 1T9TA 4DL3A 3AVGA 1NDPA 4JHDA 4BRLA 1B7YB 2KTQA 3ITHB 2EWSA 1WBBA 3MXIA 3M6WA 2HGNA 1HKGA 4X4NA 1QAIA 4ES1A 1S1WA 3CC2N 1JIHA 4F4WA 1Z2ZA 2ZBCA 5EOYA 3TARA 4G65A 4QWCA 3MCOA 4AXIA 4DU7A 3PRVA 2MJNA 1QQOA 1CLFA 3U3GA 5CE3A 3CCMN 1KVCA 1HJRA 1GEHA 4X62J 1TL3B 4IEIA 3D2FA 3OYGA 3QICA 1UEUA 1ASUA 4UW2A 3M4XA 3KJFB 1TGOA 3JSMA 4JI3F 2R7UA 4FNHA 4OZ1A 3LDQA 2C2MB 2HIYA 9ATCB 5B8HA 2KRBA 4O3RA 1S4EA 2CPFA 2F9DA 3ASMA 4JI6K 3VAGA 1KOOA 4CHQA 4J9UE 4CRJA 3HULA 3TUZC 1N0UA 3THPA 3OL8A 3NF8A 1KNZA 4NLOA 4X4QA 2OEMA 3CJ3A 1M5KC 2GWJA 2D0AA 1CLQA 1GX6A 2JDJA 2RF2A 2ZBIA 5E3PA 1SI9A 2BZ2A 3PIPL 4KFBB 5EX3A 1HNZF 2FVPA 4DKWA 4C1NI 2UVRA 3CJRA 4FKXA 1QZ5A 3F56A 1YJVA 4W5OA 2W2NP 5RUBA 1YDLA 4KHRA 4DX6A 1VK8A 1HR0K 1TKTA 1YRXA 4PXEA 4IH6A 1XR7A 4KH4A 4F02A 4FJHA 3QIOA 5IT0A 5GAHU 3RMAA 3TI0A 1UVIA 3TSQA 1BD6A 1IR2A 3JQKA 3BZKA 3T6BA 1Q86T 1KLNA 4M3UA 3C2PA 3Q8VA 3HVTA 3VQAA 4M5DA 5HK4A 3PRBA 1HBOB 1KKHA 4DWIA 5E2QA 2HHQA 5AJ3K 3WNHA 4RUAA 4DFKA 1YJ9S 1NM2A 1TUVA 4FW2A 4A8MP 4DV3J 3U1MA 4CNZA 4DG1A 3K17A 4O8UA 2ABYA 1VJQA 3TA2A 3W8GA 4C8KA 1C0FA 1XUPO 2B4UA 4WFBQ 1WC4A 4WCEQ 4G1QA 2MZ1A 1OVQA 2CH6A 4JI0K 4FJLA 5HOOA 1LXJA 2HS4A 2CVEA 3KMQA 4JAXA 4DR7F 2GS8A 1MNEA 3N4PA 4LFAK 4ZCLA 3VPZA 4ZPAA 2LXFA 1KR4A 3QPIA 2RH3A 3IM9A 2DGSA 3AQPA 4YR2A 3ZO7A 4V19X 3UIQA 2P2CB 5HJYA 2YX7A 1VJWA 2ACYA 5T7LA 3CB4A 3AVBA 2AP6A 1V3SA 3JXUA 4EBEA 1K9MO 3IS9A 4FXDA 2J9DA 3BUZB 3KLGB 3D2FB 3V6JA 1LAWA 1Q1KA 5E0OA 1CULB 3ZSYA 3MPYA 2ZJRL 1KVJA 4X65F 5L1KA 2UUBK 3OW2R 3MX2A 5C42A 2HHWA 4HH1A 3CHWA 4CBWA 5IQ6A 1X8DA 1Q86O 4DHVA 1JLEB 1MROA 3NOGA 5K8NA 4BRPA 5IC6B 2HZVA 3HHLC 4U96A 1YRUA 4DUZF 5KFIA 3G8QA 3V81B 1BE4A 4JI7F 3D66A 1AZSA 4EMDA 3RMBA 1VFJA 4KREA 4C9DA 5GAHP 2B9WA 3UDEA 5KFJA 4GVBB 3OL6A 3H6EA 4Y2KA 4ZKAA 4GY2B 1CJVB 3ZTRA 2MKHA 2FGCA 2A1SA 4EK2A 4JI7J 2V8GA 3GCWP 1TTHB 3QFPA 4A2AA 2R3VA 3M1FA 1L3UA 1DBDA 4LF9J 1BL3A 5K8OA 4CJKA 1L3KA 2HQCA 2R2RA 2CPXA 4YNQA 4BC4A 1GX5A 2C3OA 1S1VA 2OD4A 4OX9J 2VQEF 1KQGB 1FD2A 2LEBA 4EP5A 4X4SA 5J2NB 4LIWA 3EICA 2MGZB 1Z26A 1FKPB 3FBBA 4JRPA 2A3JA 2OPRA 3MF5A 2CQIA 3CM5A 3HP9A 4Z4FA 4CEAA 4BRIA 4QS8A 2RU9A 4NYFA 3F0NA 2QLXA 1U2VB 1YVUA 2GGPA 1SH2A 4DQQA 3TSUA 4LRAA 1HUXA 2Q3SA 4QIWD 3LDOA 3S01A 2GX9A 2D3ZA 2XGQA 3KUGA 2HFSA 5KG3A 3H08A 4DZDA 1RHRB 1RDWX 1KSPA 4LRFA 2ZH2A 2C3MA 3HHNB 4C3KA 3AY0A 4RNNA 2D4WA 1TL1A 1HX1A 1VSIA 4LH4A 1N33F 4PAAA 4QYRA 3K5LA 5GADU 4MFBB 2OCEA 3KUHA 2CQBA 2VC0A 1FFWB 2KVQE 3FK4A 4DV1K 3L2VA 2KKZA 3GLJA 3TO8A 2V50A 4FWSA 1RBUA 1FRIA 2W7OA 1S9EB 4IH7A 2YNGB 3TA1A 5GADI 2VFUA 3DOKB 3BM7A 3BZQA 4PXCA 5KFZA 1XMOK 4P72A 2W41A 3LP1A 3V4IB 4F9OA 4DR6K 2LEAA 3LDNA 2BGGA 2WFBA 3U4LA 3VQEA 2HVIA 3AXMA 1VC6A 4HYKA 2RDIA 4DV2F 2HW3A 4OYPA 3KLHB 2FXUA 5T7BA 1VK0A 4X66F 3BJYA 2W9AA 2VA2A 2CGKA 3CERA 3OTOF 1FRHA 3OYEA 1S99A 2M88A 4ILHA 2PEHA 2IVFB 3O44A 4X66J 1LWCB 4AFFA 1IKYB 4OHXA 1RE1B 3NVMA 5BN8A 2KJWA 3BF3A 5EX5A 1TZ0A 3IRXA 2B43A 3FSYA 3UR0A 2DH9A 5I3UA 4KHNA 4JKFA 4O4GB 3FQKA 4JV5J 4JNEA 5KTQA 1PG5B 5ETLA 1JNZB 3H4BA 2CJAA 2C3UA 2FVQA 4LF7K 3MM5B 1VQ8S 5H9EJ 2GAGC 3AVHA 3IRXB 1WSJA 5D4NA 2BTFA 4OYBA 2R7WA 1JNRB 1YITS 4KB0A 4QAGA 3OYJA 4ZVUB 4EO6A 2ZE2A 4BLGA 2QL7B 3EZOA 3IO1A 1QY7A 3CVKA 2DNMA 2HRTA 1SQEA 4M41A 3F9KA 3ET6B 1HQEA 3AA9A 3UD4P 2F4VJ 2L08A 1RDUA 1LW2A 5JS1A 1VRUA 4WYLA 4WYWA 1KTQA 1Q81O 2CUYA 2Y1RI 1REGX 1WB9A 4TQSA 2GHVC 3SMZA 4Y2IA 1F5CA 4BRGA 3GCXP 2YI1A 2DFFA 1VBZA 1R6YA 2VONA 2G0CA 2GJIA 4LC9B 5C2FA 4NZ7A 1JWWA 4E1NA 2HFUA 4Z7CA 1ZZFA 4ECRA 4CW7B 4GMJB 4ZITA 3UE2A 1DFDA 4NE9C 3AA5X 4JD2A 3QYYA 1X4DA 3DOLA 4DL7A 4JI3J 2ZZMA 4CD3A 3TR5A 1SC3B 4KJIA 2BXJA 3N6MA 3MOZA 3KNGA 3WT0A 3DRXA 2GHWA 4PKIA 2PY5A 1W2BM 3FKBA 3LH2S 5GAEI 4LF2A 4IRDA 2AYMA 2ZH6A 4ICLA 1S10A 2QWOA 4M7YA 3BP8A 4DV3K 1DTTB 2QTWA 4ZN1A 5L1IA 4F8RA 4HTLA 2ZUGA 2C2NA 4LBPA 4IG3A 2YKMB 3A13A 2VL1A 2ATCB 1VQ9S 1KVAA 1S77D 4H0YB 2M8HA 4M5GA 3MEEA 5IWAK 3O3FA 1RAJA 2ZWHA 4KC5A 2Q66A 4OI0A 3NLCA 2Q79A 4AE5A 2DHSA 3ZZUA 4Q2LA 5J2MB 2V8VA 3PW4A 2KHOA 3VVUA 4K4VA 1YLXA 4EFHA 2P9IA 3MPDA 3KK2B 1IBCB 1T9VA 3WX4A 5HRSA 2WC9A 2CRLA 3O1BA 1M5SA 4UY85 3ETOA 5FLXY 3CFOA 5CCMA 2DR9A 4YDDB 1H0HB 1M90O 1VBKA 3AVFA 1YIJN 3BPDA 3C16A 4PKGA 2UV8G 4UT4A 3KDOA 3FVYA 3TVZA 5F8MA 2WVDA 5D77A 3HM9A 4DPTA 1M1GA 5KFGA 4OLAA 1E6VA 4CTAA 4C7QA 2ZH5A 2IM1A 4DPXA 4BRHA 1VQ5N 3KLEA 1YZ7A 2C2KB 2Z1JA 4E19A 1UWBB 3KDNA 1SPBP 3P5JA 4LRDA 1QQNA 4H8KA 3M6GA 3ZETA 4CT9A 4FVCA 4F2RA 1SCJB 5B0EA 3CEDA 4OI3A 4DQPA 1VSKA 2JRSA 5ETRA 3TAGA 4LBHA 3PYEA 1NPKA 4TVAB 4DV4K 2HMPA 5I3PA 5AQLA 1N5TA 1RK8A 2B5JB 1X4FA 3CJQA 1RAIB 2RB7A 2OTJS 2DB1A 3T19A 2V34A 3HVRA 1F9FA 1OIAA 1HIYA 2OYQA 2JWLA 2XS2A 4IDKA 2PYLA 2QG9B 3SV3A 1Y00A 1NJZA 2L9WA 3A8IA 2XG8A 1H7WA 3IP0A 4X62F 2W9CB 3H3OB 1TL1B 3LZJA 3QO9A 2FVSA 3R7NB 3LPUA 1PKUA 3CG7A 1T11A 5EXWA 4YEAA 3MR5A 3R2DJ 4V1Ak 5HN0A 4AHVA 4I7FB 4ELVA 2ETJA 5KFVA 3K0SA 2GBZA 2XMTA 1FK9B 1JJ2R 2JSXA 4ZVRB 3VQDA 1IKXA 4CO0A 1Z05A 2Y3YA 2FJAB 2VYPA 1VSLA 2Q0RA 3AVCA 5JUMA 1RLCL 3UD5A 5KFNA 4JKGA 4MDBA 2SXLA 2HBYB 4J7CA 1LV5A 2J6SA 4NXNF 4BREA 2I2YA 3GFZA 2HNZA 1NOZA 3NGTA 4GKJJ 3V9XA 4ZTJA 1VQ6N 2HFZA 2Z1GA 1O13A 1V3ZA 3N01A 3NMUA 4C11B 2DJWA 1SS6A 2QO3A 1BHLA 3OXGA 3MECA 3OTEA 1UWAA 5CY4A 1V6HA 2HBJA 4CLYA 4AL5A 3PSFA 3J7ZO 1HHQA 2W2PP 3R8YA 3LP1B 5L1JA 3AA8A 3HL8A 5AQUA 2AZ1A 4K43A 2OMOA 3UCGA 3CC7N 3B4DA 4B3MJ 3G4SN 4HT5A 4ECYA 1GOBA 1RT6A 3KJNB 3M6XA 1TUWA 4J9KA 1HNXF 2L9NA 1ZPVA 2IC3B 2E20A 3G87A 2W4CA 4KKOA 1FW6A 2XCPA 2CJ9A 4ED8A 2BJDA 2E2NA 2YNHA 3LP0B 3PRDA 1FKOB 4G1IA 1X5SA 3R5CA 5DZ7A 3DRRA 1VRUB 5H1SQ 1UPPA 4QU6A 3P1GA 3C3LA 2M70A 4OYOA 1GMWA 4RCHA 3P6YC 2DD8S 3I4PA 3C65A 3O3LA 7AT1B 1GOAA 3V1QA 2OD6A 4CJ3A 2YQ0A 4MK9A 2OELA 4E98A 2NYHA 3BSOA 2BE2B 4OJGA 3J81Y 3QATA 4KH5A 2NXNA 1KRPA 4JKCA 5C0YA 3AV9A 3ZC4A 4NLGA 4KH6A 2PSZA 3J81O 1E4GT 1KOHA 3Q2TC 1FWPA 1IR1A 2QIFA 3JTOA 1SZ2A 4B8CA 3NCQA 1ITGA 3IBFB 3PR5B 2DPNA 1PILA 4IOCQ 2DH8A 1T3NA 4IJAA 4X65J 2PGCA 2E5LK 1CBKA 3PG9A 5AQYA 4R8UB 2HHUA 4OZJA 5KFYA 5AQPA 2JJ4D 3RBXA 1KN6A 4CJLA 5DM6L 2F4FA 3ITHA 2PAVA 4ANEA 4U9RA 2DNLA 3K5MA 3TZWA 4ZLNA 2Z1HA 1O8BA 4JOUA 1Y5LB 4ZDNA 1GOCA 3GWCA 1Y10A 3ZX2A 5ITHA 3HFVA 1EKRA 3MDQA 2CPDA 3CCRN 4NLWA 3ENBA 3OYFA 1W7AA 4LF6J 1XN9A 4WP3A 2VWKA 1DY3A 3UNGC 4XH5A 1LOTB 1KVIA 4H0OA 4M63C 2HQIA 3K5OA 1TAUA 4JBCA 5AXMA 2IYGA 3M6VA 1SXLA 3LM9A 4ILRA 4BRNA 2G2YA 2O8CA 1F3FA 4GVLA 3EZ5A 3RYLA 4NA3A 3M1VA 1TK0A 3A4TA 5LM7E 1X4CA 3FJ2A 4E7LA 4JYAK 3L95X 2VASA 3AA2A 4DTNA 3ZZRA 1AB8A 3K2YA 1RA6A 1XNQJ 4K4UA 1ASWA 2O1PA 2R7RA 3SNNA 2B7CB 3R6MA 1RT5B 4FLXA 2KFYA 3KUEA 3KXDA 2D9OA 4YP3A 4DI6A 3CF5Q 2JFDA 4BQLA 1N5QA 3JB9k 1B9FA 3RW6A 3A5MC 5KFOA 3CCTA 2GTDA 1QTMA 1T6CA 2ZHAA 5ELZA 3C6AA 5LXRA 3D6MB 5AXLA 3NXZA 4MYTA 4PR6A 4C8MA 2UYTA 3S7RA 3N6LA 1YX2A 5IM0B 2CG4A 2XY8A 5IQQA 4ED1A 2FZGB 4JD2B 3UNYA 4DV7F 3AO1A 4J9NA 1NJWA 1EP4B 5CZVA 1IWGA 1SVDA 2POKA 4C8YA 5IZHA 1WC0A 4CGIA 2NPIA 2DEJA 4WIIA 4B9TA 3AO2A 4I9QA 5DQGA 3G6ES 2G13A 5KFWA 2E9ZA 4G9ZA 5IM0A 4A59A 3OYLA 1IV0A 1WOSA 1M5OC 2ATLA 1S1UA 4USUA 3EGVA 3TR8A 4Y0FA 4F4ZA 5SWMA 2J4RA 3MMBB 2ASYA 1IG8A 4OX7A 2ZVSA 5LMUK 4GW6A 1TKXA 4KB7A 1VQ8N 1RAEB 4X4RA 2DO0A 1RHQB 1RT3A 2Y8WA 1TVRA 2D9PA 3DGVA 2RAQA 3GFYA 4OJHA 5B0GA 2J0SD 5F0XA 3HJFA 2QWQA 2ZOGA 1F9HA 1JJHA 1T44A 1T95A 3TZZA 4LRCA 3D2WA 4KGXB 3W62A 4HVZA 4IOCL 4DLEA 3WDOA 3QERA 1MG7A 4AD6A 2WVFA 5C25A 2HWTA 3SDEA 4IFVB 2IY5B 3S9HA 1RGVA 4MK7A 3GB0A 1M1HA 4H4KC 3JXOA 5L1LA 5KG6A 5J2PA 1KAZA 1FWKA 3CDBA 3VETA 4CK1A 3THYA 4ED3A 3MXJA 5EWGA 1PYSB 4IR1A 3JTPA 3DLHA 4FF1A 4OZ2A 4G6VB 4A8OA 2GVDB 2CKWA 4LQ3A 1JLBB 3IA0A 5IWAF 1N48A 1TKZB 4QU7A 3O1WA 1HR0F 1XMBA 4QS7A 3CJ8A 4AILC 1WTBA 5KPRA 1U1QA 3SIPB 1WF0A 2FDNA 2DNZA 3E8OA 3HHEA 4ECVA 2YY3A 3N5FA 5DG9A 4NZ6A 2BUPA 4UZCA 5C10A 1JLAA 2QMXA 4CJUA 4M7XA 2JZ5A 2EX3A 1VQ9N 3W9JA 4ALZA 3OL9A 3KOAA 4HT7A 5KG2A 2CQCA 3MMVA 4LMZA 4B9VA 3DM2B 4WZQA 2PI4A 2LSNA 1FKOA 4Q2MA 5ADXA 3SI8A 2QEXS 1ZBHA 1XQSC 3GE9A 5AJ3F 3PM9A 2E2PA 1UL3A 3CO0P 1RHUB 3TUIC 4ED7A 3MCMA 2XC9A 2NXUA 1WN7A 3SUNA 4KB1A 3O08A 4F3QA 3JS6A 1MWZA 3AO5A 1QE1A 2VG5A 3GMGA 5JMNA 4I67A 3QDKA 1B4SA 3FEZA 4M3RA 1RT3B 3I9V9 4IFYB 4WF9Q 4B9NA 4IRCA 1D4XA 4R0EA 4OI4A 4PPDA 4ZVFA 4JI0F 3CCUN 1FDAA 2HHHF 3CD7A 1UVKA 3M05A 3HZ6A 1EQ0A 3NH1A 2Z2YB 4DV4F 4DR7K 1VQPS 2YWKA 1VBYA 3KLEB 1KWMA 1FEEA 1J5OB 4LFAF 3K0JA 1KD1T 3SI6A 2N82B 3BR8A 3CJKB 2AV5A 3FUYA 2NXEA 3TSPA 4AHRA 2OSQA 3NGUA 2D0CA 2ZZTA 2IRXA 1NSPA 1XIQA 3QRRA 2H3GX 3CCVN 2X3DA 2P9KB 1HNIA 2K1RA 5KOXA 2DGWA 4CGHA 4CF8A 2OHDA 1SIZA 3M9MB 4KHPF 5E7OB 1QZ6A 1G3OA 3H7HB 1NJIO 4DTXA 3MR7A 3U8XA 1NK4A 2NUBA 1RWUA 1NDKA 2UUBF 4LUBA 1TK5A 5L9XA 3H8YA 1YTYA 3H42A 2W40A 3IG1B 1X5OA 3BQ2A 5CABA 3VENA 1Y3KA 1R0AB 5FRMA 5ETOA 4K7QA 3HHLB 1SKRA 1JXLA 1FHTA 2OTJN 3F2KA 2IJNA 5F3ZA 4ZPDA 4DUZK 1C4AA 1H7XA 1HNXJ 1MW7A 3OY9A 5TKWA 2QEXN 2XLIA 5HSPA 3KFWX 4GVBA 2HGLA 4B3TF 2OEJA 2IS3A 4RU2A 1SC4B 2CVIA 4KKOB 4KHPJ 3VZHA 3F9MA 5DQHA 3VEXA 2LLZA 1UVNA 3UW1A 4FF2A 4NLBA 4U8VA 2J9EA 2RQMA 3B78A 3LA0A 3L4QA 3JYTB 2DVIA 1SKWA 1EJ7L 4M3ZA 2QC3A 4ED5A 3KLIB 2COLA 3G86A 2KXFA 2EVZA 4LVNP 4EYIB 1EXQA 3E01A 3UO0A 1BQNB 2CQ3A 3RRKA 1E3MA 2DHHA 1HW9A 3KHRA 2E5IA 4DU1A 4U67L 4W5QA 1HPZA 1GFWB 2XHCA 4C8OA 1U1MA 2KB2A 3FR0A 4ZHRA 4J2AA 3NVKA 3I33A 2WONA 2UP1A 5HQMA 1S9GA 2OPSB 1I3OB 2XMMA 3DLEA 3BF1A 2BM0A 1WACA 1PC4A 3A2FA 1AROP 4CZHA 1HKAA 1D09B 2HNDB 4KYZA 3NAIA 2QA4N 4QWEA 4JV5K 3AJ1A 1KLMB 2RQCA 1QTNB 4LFBF 3N4QA 2HBMA 4F7VA 2ZZNA 2N3OA 4PQUB 5BR8K 5DDRC 1QQCA 4FKYA 3NGZA 3VZIA 3GOIA 1FJGK 1Q18A 3O9QA 4BGBA 4PCQA 3CXCM 2DHAA 4L73A 4BY9C 3CETA 4LBIA 5LSOA 3M2UA 2DNKA 2VWJA 4LF6K 4CLSA 4ZVSB 3W8PA 2ZD1A 2XM3A 2YKQA 3DLKB 2AT1B 3VESA 1RHMB 4TNOA 1JXBA 4CHYA 4GNIA 1N36K 5ETPA 3TPQA 1U47A 2QYCA 1RDCA 2GV1A 4DR4F 2R7OA 3KG1A 4CCHA 1U8WA 3UPFA 5C2CA 1NNEA 4KE5A 2PMWA 1RCHA 4ZVOB 1N56A 3P96A 1HWJA 1NK5A 1NHKL 1URRA 3ZTQA 2F7TA 4NYNA 4CZEA 1SJRA 2IVYA 4GC6A 1R3NA 1WEZA 1VQMS 1S7HA 4DZ6A 3CJKA 5HBMA 1S1XB 3UN2A 2JWNA 1TYQA 2E9TA 2O67A 3TANA 5F8JA 4H4OA 5FROA 4NLTA 2JX2A 1EZZB 2XMAA 1RWKB 4YR3A 5C24A 2QYGA 2W7PA 2PZSA 3B4MA 5KFMA 2ASDA 5JVHL 4B1YB 3CMES 2G8KA 3CJ2A 1MSWD 4QIFA 4IO9Q 5H9FJ 1BU6O 2AZ3A 3IBWA 4E0DA 4FWPA 5C24B 3VQ7A 2QMWA 3CC4N 2X7IA 2GX8A 2GQQA 4DMNA 2X1AA 4FLUA 4A5BA 4LF8K 1R8AA 2EFOA 1K73T 2B5JA 4FZXC 2IA6A 3TVYA 2DGVA 1S3XA 3E1YA 4BR4A 2XYPB 1YSJA 4ES3A 2C3YA 3N0VA 3B6BA 1S0VA 2QJ3A 2UXDK 1SB6A 4FLWA 4Q0BB 3MTKA 4TLQA 3RU0A 3I8DA 3MXMA 1MWYA 3OYKA 2ZJPQ 1KC8O 1N5YA 5SZTA 1JLCA 3HSJA 4H4KA 1VBXA 5HATA 5SUHA 1JKHA 3ULEB 3OXLA 3HPOA 3CCZA 4Y3CA 4DQ8A 1ILYA 5K20B 2VG6A 3PDNA 4CH7A 4ZP9A 4CIEA 3LOUA 3AJ2A 3HM8A 3SSSA 1N5YB 2UU9J 1WSFA 4NLQA 1P6TA 4CZMA 4LSNA 3B8HA 4RUHA 1T9YA 3I6PA 3MK6A 5FLXO 3Q8RB 5K8PA 2QWMA 2HHXA 3NBPB 2VQFJ 3V6KA 3QNWB 3MTJA 3WC2A 5HRNA 1C4CA 2P9PB 2X1BA 4U6PA 1N33J 3U6FA 1BCMA 4RLEA 3NF9A 3PKMA 4EBDA 1NLVA 2AWZA 4B1UB 4CO1A 1Y4ZB 4WFZA 1BIUA 2MGZA 3KK3A 2P9LB 3U9DA 4IKFA 2E8AA 3THVA 3SAGA 1FDDA 2NUHA 5I3UB 1HBOA 4I6MB 2P1JA 3Q8QB 3AD8C 5LT5A 3EDQB 4YR0A 1T03A 3MAAB 2PI5A 4IUFA 1EKEA 2I5JB 4RG8A 4BC3A 4MH8A 5KFQA 3PX0A 3AY9A 4FYVB 4F25A 2ADBA 1EQMA 4KBOA 2QFIA 3OVAA 4KI4A 1HNVA 3SMPA 4C8LA 3J80U 2V2VA 3TJAA 2VQFF 5FDLA 2WOMA 1HPMA 2PEBA 2CADA 3UDLA 4GMKA 3SQGA 4OPKA 1R0AA 1ZAXA 3CJ4A 3ZCMA 3IN5A 5C25B 2W8KA 3IMXA 1FXXA 3K89A 4FM0A 1OQ6A 1ZBTA 3H98A 5KFEA 1KEKA 2J8SA 4OI1A 4JKGB 1I3AA 1ZBFA 1AUDA 3B6OA 4XK8C 2PDAA 1J5EF 2K7JA 4CERA 1TR0A 5KQDA 3PJWA 2D0BA 4DR5F 4FJXA 4ELUA 1Q9YA 4DR1K 3FBCA 3ZT2A 1CEZA 2CJYB 2GA7A 4OQJA 2BVZA 5GVQA 3R7SB 3ZT1A 4JI5J 2E1YA 1C0TA 4LJMA 4EYHB 4K5RA 2FSKA 4IDHA 1GAOA 2FZKB 3DFEA 4F4XA 1SJ1A 3HD2A 5D0GA 3NNCA 2DIVA 1U6BA 2QA2A 4ISEA 2KZMA 1O0PA 3UKRB 4QJVA 1FD8A 2BEFA 1LWXA 3J7ZT 1M5HA 4HTUA 2DKOB 2MZJA 2FPHX 2XMVA 4BRDA 1OSDA 5JLHA 2VG7B 3IR6B 3SK3A 4UY8O 5JLFA 3PNIA 3MMCA 1O51A 2QLJB 4B08A 1NH7A 2V94A 3WQUA 2BQRA 2HVHA 3IC1A 4FF4A 2UXCF 2XNRA 3VGKA 5DG7A 2JHEA 1CJTA 3E2EA 3SYZA 4DU3A 4FJMA 1YJTA 5AQWA 2F8TA 2VHGA 3NBPA 3DLLL 4FVMA 4FWLA 2MHEA 2R7XA 3UN5A 2NSCA 1EWQA 4I1TA 3DRRB 3EE8A 5LSLA 1TUGB 4WFXA 1NGEA 3GV5B 1S5ZA 5K5MA 2UXDJ 4QR0A 1Q8KA 3LDSA 3QT7A 1YBUA 4B3SF 3BV8A 3P5BP 1F2HA 1T03B 2Q1LA 1FJEB 3GP9A 2Q0UA 1S4FA 1KLMA 1WSHA 3CC2S 1XR6A 3VQ9A 3HTVA 3ZZTA 3SQ2A 1YF5L 4ELTA 4OYZA 3DNCA 1GLCG 4KT0C 2OPQB 2FVCA 3AODA 4I6WA 3DKDA 4DS5A 2ZM6F 3FNNA 1XC9A 5HRRA 3QSYB 3T9ZA 3X3UA 3CDAA 1Y0HA 2CQDA 2BQ3A 1T9UA 1S1WB 4N8OA 3P4UB 3O6WA 1R43A 1KONA 1ESVA 1AFIA 3GDQA 2GAHC 2V51B 4ETZA 2ATQA 4ZPTR 1BWFO 4C3MA 3LDLA 2ZH3A 3I4HX 2HHTA 5GAGI 1GXLA 5I3QA 3EEQA 4IDKB 5AQIA 1HMVB 1RU2A 4E7HA 4DPUA 3QSIA 3UB5A 4CZKA 5A8KA 4RWWA 1RISA 4E1JA 4K0KF 2P51A 4FS2A 2BW7A 3Q83A 4HR2A 4B9LA 2KYZA 1QSSA 3M7VA 4Y2MA 3R5AA 1N32J 4TXSA 2ZVIA 2LDIA 3C6UB 4LFAJ 1B92A 2BJ1A 4G3IA 1UW9A 4ID8A 2V4QA 1NSAA 1Q7YO 3EKUA 2M9KA 1D8YA 2L9DA 3CCMS 3D54A 1XR5A 1VOMA 2EFQA 1WHWA 2QE5A 2NNWA 3ULHA 2XS7A 1H73A 4OGEA 4M5HA 3GBTA 2CJBA 4OIXA 2ALYB 1VGYA 4BDZA 5KFFA 1BA0A 2OFHX 4KSEB 3SEOA 5DZ6A 1NGCA 3QWUA 2APOA 1VQKS 2I6WA 5AJ3J 1BHNA 3G82A 3KD1E 1XHZA 1VC5A 5F8NA 2IYIA 2E5LF 2HBKA 3KVGA 1VRQC 4IG3B 3DLGA 4OHYA 3TA0A 1EX4A 5JVGQ 1T7PA 2YH0A 1HKCA 2WW8A 3C14B 3AB4B 2GIQA 3EZWA 1YJNS 3CJCA 2E1CA 1MU2B 1N0VC 1FFGB 4YS2A 4K59A 5T41A 1SV5B 2OUGA 2EG1A 4W92B 2LQ5A 5L39A 1MWKA 4FZVA 4A8WA 3HT0A 1JKHB 5BR8F 3ULEA 2VBZA 4X64F 2CPZA 3FZKA 1A7GE 1WUUA 4RBUA 3VQ5A 1KTVA 1M1KT 4DTSA 4FXWA 2FJWA 3GR0A 1WORA 1TMMA 3LZIA 3TWHA 3VAHA 2FBYA 2N7CA 3EGNA 1YI2N 4FYDA 4DG1B 2BBEA 4CEQA 1FDBA 3HPHA 3QB0A 1R31A 2I8EA 3A8YA 4PG4A 5CHCB 3T41A 2CA9A 2HHSA 3PHTA 3LP2B 2Z56B 4Q8FA 4WQ4A 4EAHD 1TP7A 2IM3A 5BN9A 3GYXB 3OYBA 2KU7A 2UUAK 2OP5A 1ACMB 1MDUB 2YNIB 3DLEB 3GR1A 4LF9F 2UU9K 3O4NA 4H5RA 1FRLA 1F1BB 2MLYA 1LW0B 4DN9A 1K1SA 2RJZA 1B70B 4ZN3A 1HNZJ 2IBOA 5L38A 4GKKF 4CZJA 3W5ZA 1UFLA 4WFAL 2JC1A 3KKSA 1X4BA 1GMUA 2VPWB 1P90A 3GSIA 1N5VA 1RBLA 3FZHA 1ZETA 3BSNA 1S57A 3L8BA 4FPRA 3V2UC 4DV5F 3QIPB 3LPYA 1G15A 4R0JA 1JJ2M 4M1KA 2XO6A 4IOAL 4U7UD 5K14A 1YG0A 1RKJA 3V9WA 1Q81T 4OX9K 2FBVA 3SLCA 1K1QA 3BEGB 4TN2A 4BDYA 3I9ZA 3PFOA 3O4WA 1NKBA 1BXNA 1ULRA 2DH7A 1BQXA 3E66A 3KD5E 3SQ4A 4KAIA 1UVMA 4H4MB 2AF6A 3PW7A 4OHWA 3W2VB 3CJ9A 3FSIA 1H6KX 4N47A 4X84A 2XLKA 3I31A 1A5WA 5KG0A 4YOEA 1S0NA 1RI7A 4FJ8A 3PX6A 3QWPA 1TL7A 3KKFA 2HNYA 1N34F 4JI4K 3W2WA 2E5GA 2DITA 4DX5A 2Q31A 3Q89A 4UOCA 5DS7A 4CGFA 3OS0A 2BRLA 3HXMA 2ZGZA 3NGSA 2W6LA 1VK3A 2ZH7A 1SL1A 4CEDA 2MB0B 1GH8A 2LQ8A 2YPYA 4IQMA 1FKPA 5F0UA 2OEKA 1DQ9A 2QA4G 1S72N 4MKBA 5C2DA 3DRSB 2A2DA 4FF3A 3N4WA 1RABB 3CNQP 1QHAA 4M5DB 2DNOA 2P9KA 3GG4A 5EVZA 4C8NA 3PX4A 1G99A 5M2PA 4B9SA 1NDLA 5A2QO 4URSA 2CPYA 3ZSVA 2YPZA 4YFUA 4BWJA 4BROA 2MLXA 5AQOA 5A2QY 4ZIWA 4DR3F 3CQYA 3CPWM 3ZT4A 4RW7A 3IG1A 4TKTA 2W4DA 1ATNA 2C42A 3MFIA 2R8KA 1SBRA 3KIOA 4B3MK 3R5DA 3GE1A 1RJJA 1BWEA 2YHXA 2ZITA 2HFOA 3CT9A 3D0PA 2D3OR 3QNOA 2RS8A 1PJ5A 4ITSA 3FFIB 3PYFA 1Z6RA 2YKNA 1G6BA 4QWBA 4ED4A 4DOZA 2VF3A 1P1TA 4CJSA 1YVNA 3J81U 3NL0A 2OA8A 3BH7B 3GFXA 2V68A 1FRJA 5KT6A 3OLAA 4K8RA 3EXCX 1BGXT 2G2OA 4QOTA 1B0TA 5JMVA 1WG1A 2BANA 2NXJA 4JI8J 4ZIVA 3M9OB 3D2EB 2VJVA 2YHYA 1IKXB 2YXLA 3DRYA 4O4RA 4CJ4A 4FOEA 3DCAA 5J1NA 2BQUA 4FO0A 3V6DA 2D3UA 2XTJP 2HF4A 2ASPA 3P83D 2J7UA 5B7WA 4DR5J 5M2UA 5F9LA 4RNMA 2RD5C 3K57A 3BBBA 3MUTP 4UUWA 4EZ6A 1GK8A 1SC1B 2GO8A 3ZT3A 1IKWB 1BQMB 2FD2A 1J5EK 2IVPA 4YDUA 3I5CA 1UW4A 3U27A 1UFWA 2AGPA 3MWPA 2B4OA 4CFDA 1SL0A 2J6UA 1RCOB 3CQ8A 2OZMA 3AHPA 1X3NA 2BJ9A 3LDPA 3FBEA 4NYOA 3WIVA 1VQLN 2RUGA 3LM2A 3I8BA 4O3SA 1NGHA 3OT9A 5EUHA 3MEEB 2VUGA 3CCUS 4IR9A 3FSXA 4HHUA 3MR6A 2D3O1 1V9OA 3DU6A 1X4EA 2B9YA 2EC2A 3ZFVA 4KIAA 3HFKA 2XBPA 3TU5A 2ZC4A 2E6LA 4DMZA 3C8YA 3BKFA 1A5XA 5DETA 1VHFA 3POTB 1D8ZA 3WQTA 4Y00A 3Q86A 3OXFA 3C16B 4DF4A 4IFEA 1OO0B 4FJ9A 1RILA 4BR0A 4PUOB 1Y7PA 3MUMP 2IDLA 4YQWA 3H1VX 3G6XA 3LAKA 2BKPA 3FRYA 4NLRA 1AXQA 4CQ1A 4CEZA 3GPAA 1XNQK 3QZ7A 1S6QA 1X9SA 4XPCA 3T9NA 2IIRA 4CF1A 2MKCA 2L48A 3OBYA 2VKZG 1RU1A 4ETXA 5AQRA 2VB6A 1I94K 3C6TB 2VBYA 4HTJA 4O0IA 1FT8A 2D1CA 2F40A 1U8SA 4FZYA 4BR7A 5B0DA 2QXLA 4OKJA 3VEOA 2MKKA 3OV7A 4J9LA 1SH0A 1EAYC 1NK0A 5HP1A 3KJVB 4LF8J 2R2UA 3VTIA 1J53A 2EXUA 4ANDA 4PRFA 1VC0A 4OHVA 1PAUB 1KQFB 1Y5NB 4HVJA 2NSBA 4NYZA 1YVFA 2K06A 2IMWP 5A0YB 1B99A 4ED0A 3T1AA 1RUSA 1IO2A 3SSRA 4KGVB 1HW8A 1WWHA 4CEBA 1X0PA 4NI2B 2LECA 3DM2A 3HLUA 4JI7K 3QLHB 4P10A 4F2SA 1NDCA 1N32F 2HZCA 1JCEA 2AYGA 2C2ZB 1T02A 3QJPA 2NS1B 4F3MA 4ILMA 3HCXA 1CC7A 4MKVA 1ICEB 4K8ZA 3BREA 5AFUH 5DMRA 4P2FA 1IBLF 1HARA 4JV5F 3D0IE 4DB3A 2UXCJ 3HI9A 3D6TB 4LFBK 4FM2A 1WKLA 3U3YA 2HNYB 3OBIA 2X51A 3J7YU 2XB2D 5AQSA 4M95A 1ZBIA 2NRWA 1NGFA 1SJ3P 4QWAA 1Q16B 4FPAA 1VQNN 1Q8LA 4LR9A 1H1VA 1RWNB 4A47A 1NMDA 4NXNJ 4K4XA 5J2MA 1RTHA 2LCWA 3FCHA 3HFZB 3NF6A 4CJEA 3VA0A 3LP2A 2F8EX 5FPEA 1HNIB 1EWRA 1GNKA 2P5VA 3U9ZA 3EYZA 2V2KA 2JWKA 2KO1A 1TKTB 1H2UX 1NXIA 2UV8A 3V1OA 3CW2C 2M4MA 4Z4GA 2HBQB 1BI4A 2QI2A 4CGDA 1YTUA 2HEKA 3QESA 3VAIA 2AHOB 4K4SA 1U09A 4PWUA 2YWWA 2RQ4A 4I64A 3M8RA 5DO2A 4X64K 1WHVA 2VC1A 2ITGA 4U8YA 4JUZA 2GQ2A 3O9UA 2EKYA 3I82A 3ENQA 4YDXA 2J5AA 4P6QA 2KL8A 3QQCD 5LMNK 4YOVA 2CZVC 3IGNA 3THXA 4KHWA 3DRPA 3RRHA 2LQ9A 3IAYA 3QFUA 2KDOA 1S76D 3OJUA 2LU2A 4RZRA 1ZBLA 2VD3A 1XNRK 3CCES 1XMOF 1WG5A 3JQMA 4IXCA 4HWIA 4DV5J 3ISND 3A5NC 4ECXA 4B3SJ 2OPRB 2N4DA 2JGUA 2H9ZA 3QINA 4DCPB 4CIOA 4ZOSA 1F3VA 4X4UA 2LQBA 1U25A 2F96A 1HWLA 3MN6A 1GLDG 1D3WA 2QL9B 3BSAA 2MKJA 3M30B 1RT6B 1TELA 5BRDA 3MWTA 1QUPA 2C22A 4A8YA 1PC5A 1VLYA 4CO3A 3R1LA 1VQNS 4FBUA 5A2QU 2AGQA 1X9WA 5AQJA 4RKUC 4WQ5C 4Z94A 3DI6B 2ZNYA 1N52B 3NCIA 5HROB 3BBCA 3M2VB 4M5NA 2VIHA 4FOIA 1S1TB 1IH7A 1JL1A 1TV6A 2ASLA 2V5HG 1WC1A 4ZLPA 3AO3A 4B3RF 2O8DA 3DDNA 4BRKA 2OGUA 2JLEA 3NCPA 4DV6J 3FZLA 5F8LA 3Q8UA 3TTFA 3MDFA 2YQ3A 2AJ2A 4ZPWR 3T1YK 2OFGX 1SJFA 3I55N 4CHPA 5M1PA 1RT4B 3PEJA 1BIZA 5IS2A 3LGNA 4EBCA 2ZJPL 3D4JA 2CGLA 4QR1A 2VICA 3LTOA 2EBEA 2IFXA 2CYYA 2ZHBA 4ZTFA 3CCVS 5CXTA 2QWLA 1WKJA 4KPYA 5G4DA 4JI4F 2FTRA 3RAMA 1UZDA 1HWKA 1H2VZ 5AQHA 4B8AB 3VGUA 5BPLA 3OYIA 4NLSA 2WBNA 2ILZA 3HO1A 4E1MA 1EP4A 4LF4K 3N28A 4LD0A 4IO9L 3BN7A 2XSJB 4WP9A 3PYGA 3WXLA 4UOHA 2JC0A 1KHVA 3OYMA 3OYHA 2CPEA 3WUHA 5KFAA 1BO5O 1RT1A 4I2PA 3LP3A 3W7BA 4MKYA 1VSMA 1RXOB 1E6YB 3ATVA 5KI6A 4LSLB 1R8HA 1X31C 2B4VA 5JICA 3DYAB 5CYMA 1RAHB 3F44A 4USWA 1HA1A 4GO5X 2VH7A 5CZ2A 1EETA 1TVRB 3AD7C 4ZS6A 1LEOA 4HHJA 5AE2A 4Y34A 2V2QA 4FYWB 4DPOA 4DQSA 1IJEB 1BWVA 3T6JA 3CCRS 3LW5C 5AQKA 1CJVA 3KKRA 5A6PA 1HBMA 4RWTA 5KPTA 3IRWP 2VU5A 2VZ9A 5E33A 1RB0A 1ZA2B 2YJFA 4PWDA 3D3BJ 4OL8A 2YWFA 2CZ4A 1JXVA 2DHXA 3P8BB 4QIVA 1S6QB 4KTZA 1U1KA 4DCJB 3QEVA 5LJWA 2MQMA 3OPKA 1T6DA 2KJVA 3RB6A 2ZBPA 2XMWA 2NPFA 1VRTA 1NK6A 3I0SB 2QL5B 3HKZD 5J1EA 3PR4A 2IJRA 4QWDA 4KFBA 4CLWA 4OMFG 3CM6A 2P9PA 1WSVA 1TL5A 3MAHA 4YN3B 3ZZOA 1F2GA 3POTA 2K7KA 4MJKA 2A1BA 2V9KA 4Y2AA 1M5PC 2KI2A 2OI2A 2J6TA 4HH0A 5HLFB 2ZKUA 4P9SA 1RDDA 3D28A 4ZVHA 1YTAA 5HL7L 1OVYA 4RW7B 1YJRA 2Y1JA 3SCXA 3V81A 3WNEA 2XY5A 4DU4A 3LPTA 2LXUA 3JSMB 4MIAA 2KM8B 3S41A 3BGFA 1S6PA 5THWA 3P3DA 3A3NB 1UEKA 2W8LA 2XRIA 4JK7A 1B0VA 4NCBA 2ZNZA 2HK3A 1TL3A 1VSHA 1YAGA 1B0PA 3WXJA 1XERA 2FF6A 3FZMA 4L3KA 1GLLO 2DCUB 2KRRA 2Z4PA 2OPPB 4K25A 4NI2A 3CULA 1BI4B 3FZFA 4X62K 3QLHA 4ECUA 1B3TA 4OV6A 5F8IA 2H1YA 2H48B 3TTDA 2HMIB 1RKIA 4Q0BA 2KW4A 1VQLS 3D5MA 2D41A 1WSGA 4M45A 2IRYA 3EVOA 3W61A 3MEKA 5A0YA 2XHWA 1G2EA 1FTRA 1JQGA 4UF4A 1EHWA 4LT6A 1A9NB 3OHRA 4I0WA 4ANCA 8RUCA 1LW2B 5CYQA 3R97A 3CD0A 2GVZB 2FLLA 1HNWK 5BPNA 3E9OA 3FZ2A 9RUBA 3LPEA 2RVJA 5AE3A 2IIHA 2E5HA 2JVOA 5IT9Y 3HT3A 1Y3JA 1AA1B 3A3PB 3HK2A 3OSPA 5IT9O 2GELA 4H4OB 4DR7J 2AJQA 4DR3J 2DY9A 5KGWA 3CF5L 3SFGA 1SH3A 1I39A 4P2SA 1WDDA 3E9PA 2HB5A 5C42B 1V3RA 3F5TA 2RHSB 2Z30B 2WSEC 2JLGA 3NEKA 2KYXA 2E6MA 5KT5A 3BO3A 1JB0C 1FVQA 1Q7LB