3M8PA

Hiv-1 rt with nnrti tmc-125
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
555
structure length
551
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of piperidin-4-yl-aminopyrimidines as HIV-1 reverse transcriptase inhibitors. N-benzyl derivatives with broad potency against resistant mutant viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 162
structure length 551
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3m8pA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8pA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8pA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8pA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3m8pA05
5EUHA 3VQEA 2KFZA 5EWGA 4O3QA 4LH4A 4F2RA 3HPOA 3V9XA 2AX1A 1L3UA 1F21A 2C2EA 4E3SA 5KFGA 3LWLA 1O1WA 4ZPDA 3AVAA 1RT5A 1J5OB 2C2DA 1N6QA 3OYGA 1Q8IA 4IFVB 1KSPA 1MU2B 3OJUA 4K4SA 5J2MB 3OYJA 4DF8A 3V9SA 1I39A 4M3ZA 4OVLA 4LH5A 3KK2A 1RNHA 4CK2A 4M45A 4CIEA 2XCAA 5KGWA 5HLFA 1TP7A 3QIPB 3PZPA 4KKOA 3QZ7A 4ED1A 5KFRA 2OPQB 1OS5A 3EYZA 3ZT2A 4J9MA 3FFIB 3IRXB 4DQSA 2ITGA 3QIOA 1U45A 4G1QA 1HNIA 3CDWA 4ID5A 3U6FA 4CEEA 3PUFA 4Z4CA 2F8EX 4E89A 4Q5VA 1EKEA 2I1RA 3HPGA 3RWUA 5D3GB 3GYNA 4N47A 1S0OA 1HRHA 5F8GA 4EYIB 1C0TB 5HBMB 4DF4A 2YKMB 4KHYA 2FVCA 3RMBA 4CJFA 4X2BA 1SH3A 3QYYA 4FJGA 1HQUB 3L2WA 4DL6A 5HP1B 4DL4A 3SPYA 1JLFB 4NZ0A 4NLOA 4CHNA 4ICLB 3ZSXA 4FJLA 5HRNA 4WFYA 4RW6B 2R8GA 5HRSA 4IRDA 3NL0A 1LV5A 5J1EA 2PY5A 4B9SA 3TQ1A 4H4MA 4RG8A 3F9KA 1TAQA 2ILZA 3VQ4A 1JL1A 3MR5A 1UAXA 3V6KA 2P51A 3ZT3A 4CGHA 4M42A 2QV6A 3GILA 3VQDA 4ZPBA 4FJJA 4NLYA 4OPJA 3NKYA 3LDSA 1T05A 1IKWA 1U49A 4R8UB 1S1VB 4CGFA 4DL2A 5KFZA 1VSFA 3MFHA 4RW8B 3UQSA 1FXXA 1SH2A 1S6QA 1TL3B 2Y1JA 2WOMA 3DOLB 4TN2A 3LZIA 4PQUB 3IN5A 1RBVA 3VQBA 3OY9A 1TL1A 3FDSA 3OJSA 5L1IA 5KRTA 2O4GA 3OYAA 4DSLA 2V4RA 1ZBUA 4CJVA 3MEGA 4N41A 5KFQA 4ELUA 3DRRB 2ILYA 3NF8A 1JLBA 2FBYA 4DL5A 4HUGA 1ASWA 4PUOB 3AVGA 3GV7B 4CEQA 4J9SA 4O3RA 4CF8A 4JLHA 3TARA 3RRHA 1VSJA 2XI3A 1JX4A 3G6YA 2O4IA 4DQRA 3BQ2A 3T3FA 1RDBA 3DDKA 1NHUA 1RTJA 3KK3A 1JIHA 1HYSB 2BE2B 2P5GA 3AVBA 4F4YA 1SL2A 2YV0X 1LW0A 2IJFA 4BDYA 4CERA 1VSEA 2YNGB 3I0SB 4KFBA 1KCFA 3CJ0A 4NYZA 2X78A 4O4RA 3KLGB 1ZETA 2I5JB 2RPIA 3QLHB 1HNVA 3M8QB 3GQCA 1KVCA 2F96A 2Z1JA 5C42B 1T8EA 3GV8B 4PY5A 1GOCA 2OPSB 1HPZB 4M3TA 4CJPA 4XO0A 4FS1A 4FM0A 4E0DA 1DLOB 3QNOA 2DPJA 4E7JA 5I42B 1VRTA 2FJXA 5J2QA 3LWMA 2DTUA 1NK7A 2IGIA 3P1GA 1EETA 4J2DA 4IFYA 3FQLA 3PX0A 2JEIA 1L5UA 1S1TB 2FJVA 5JXSA 3QEXA 4ZP8A 1IG9A 4EP4A 1IKYB 5HROA 1BIZA 3HJFA 3CJ4A 1D9DA 3KD5E 3V6DA 4R5PA 4XIUA 2NUBA 3OL7A 5KFJA 2G8FA 1S10A 4WXOA 5F8HA 3MR3A 3FQKA 3AO5A 4Y3CA 5KG1A 3KLFB 4AH9A 4O5BA 4NLSA 4M3XA 3TAMA 4Z4HA 2D5RA 4YQWA 4WFXA 3VQQA 3LP2B 3HKWA 1WAJA 3ISNC 3BJYA 4H8KA 4BWJA 2W9CB 1S6PB 1FKOA 3B6PA 3DYAB 1SKSA 3RB0A 3CM5A 3H5UA 4DSEA 2FLPA 3HM9A 3OYBA 4O55A 3NGYA 3HSTB 1XC9A 4CF2A 1NJYA 3L2UA 2IC3B 3NGIA 2HHQA 3IG1A 4R0EA 4ZP7A 5JS2A 4CEFA 4NCGA 3OYLA 1S1UB 4WZMA 4KI6A 4M41A 4CESA 1RBUA 1NHVA 4NLXA 1REVA 3G10A 3NBPB 5F8IA 1JLCB 2X6SA 4B8AB 1QE1B 3TANA 1JLQB 3KLHA 4JRPA 4KV8A 3QGHA 3HP9A 3S3NA 3NFAA 4LY7A 3QGIA 4C8OA 3PO4A 4I2PA 3P83D 4CF0A 5KFSA 4Q0BB 4DTSA 1BHLA 5CZ1A 3PW0A 2XGPA 3KNAA 2XHBA 3H59A 4KPYA 3LALA 2AX0A 2HMIB 4DG1B 1MMLA 3ITHB 1WSFA 3C6TA 3K58A 4F50A 4Z4IA 1JLAA 1KTQA 4KAZA 2ASJA 4DFJA 1NJXA 1S9EB 4KREA 4DL7A 4ECWA 4QWEA 4RNOA 1B9FA 3NE6A 2DFHA 2B43A 5L1JA 1TV6B 4ED7A 4J9OA 3C94A 1WNSA 1GOBA 1I3AA 1U4BA 2IA6A 4CJTA 3NH2A 1LWCA 3CFRA 3MTKA 1KHWA 1VSMA 2VWJA 3QEVA 4K4XA 5C25B 4CK3A 5FRNA 4K4WA 3ZT0A 2C2RA 1DTTB 1UWBB 3RAXA 2VG6B 1Z25A 4ELTA 4M3WA 2RKIA 1LW2B 2W8KA 2UVRA 3KLEA 1WSGA 2Z1HA 3L3UA 4O0JA 4O44B 4IH5A 1D8YA 3V4IA 4N76A 2BQ3A 1S49A 3RTVA 1K6YA 3AA3A 2WONA 3IS9A 2W42A 1IKVA 5KFYA 3B6OA 3SZ2A 1S97A 4U7CA 3KLIB 4M3RA 3RMDA 3L3VA 1ZTWA 4IKAA 1LWFB 1S9GA 4H54A 1XWLA 2JEJA 4FJXA 2Q3SA 4CJ5A 4GC6A 2B5JA 3F73A 4KI4A 3ICLA 4CHQA 4RW7B 3OYEA 1BQMA 2W9BA 2AU0A 3AVMA 2GV9A 1JKHB 4KHSA 5KFTA 2FVQA 4KRFA 3H98A 5J2PA 4O3NA 2HNZA 3GIMA 4CCHA 1VSLA 4CJWA 3NCIA 1B9DA 1S1WB 3PW5A 4OKJA 3DLHA 4RW9A 2R8IA 2OZSA 2WK4A 2P1JA 3KMSA 1RT5B 1KRPA 3PR5B 1N6QB 4ZHRA 3BSCA 4DU1A 2AJQA 2B4JA 4CF1A 2VA3A 3NH0A 2W9AA 1RA6A 1B92A 3OL9A 4CGGA 3HVAA 4DL3A 1QTMA 5KFOA 2EX3A 2G8VA 3C6UA 5CYQA 3AA5X 4TY9A 5HLFB 2GUIA 3K5LA 1CSJA 2IMWP 4NLGA 1QAIA 1VSHA 2DPIA 2FVRA 3K2PA 2BQUA 3SV3A 2GC8A 4FXDA 2FC0A 2ZD1A 3PR4A 2HB5A 4G1QB 1HNIB 4ZMMA 1KLMA 2ETJA 4ID5B 2XY6A 1W25A 4B3OB 5KG0A 4PWDA 3G86A 1LWEA 3OSNA 1KFDA 2VG5B 5KRSA 3AA2A 4HYKA 4QW8A 3KOAA 3IAYA 4J2EA 1S48A 4Q8EA 1UA1A 3EZUA 1BI4A 3AV9A 2X74A 3NF9A 3OLBA 2YNIA 1L3SA 5FRMA 2D3UA 4URQU 2ALZA 3O4QA 1RDRA 3ZSYA 2ASLA 4C8LA 3VQPA 3LP1A 4C8NA 4O3OA 3WNEA 2HHXA 3ZT1A 1JLGB 1TKXA 4RW4A 1C1BA 4CJSA 1CZ9A 3UPFA 2E9TA 3LP0A 1BQNA 4H4OA 4CHOA 3T1AA 5KFUA 2BRKA 3VQSA 2PYJA 4AHSA 4KHQA 3DLGA 1TKZA 2FBXA 3FSIA 5HRPA 1NKEA 1RAJA 3V6JA 4EZ6A 5I3UA 4HHTA 1WSHA 1R0AB 3OS1A 4B9LA 4J9LA 4J9QA 1T05B 1IKWB 1J9AA 1EP4A 3OYNA 4KAIA 3ALYA 4O0IA 3G6XA 4MIAA 4GC7A 1ZBIA 2WOMB 2ASDA 4AHCA 3QO9B 2UUWA 1RYRA 3UIQA 3NAIA 4ZTFA 5KI6A 2B6AB 1VK0A 4RZRA 3MEDA 3CO9A 4CEOA 3H4DA 4FJKA 4Q44A 2E9ZA 3SV4A 3I5CA 3SNNA 3AVKA 1QSLA 3MECA 1C1CA 4GVMA 3CQ8A 3MEGB 4JS5A 1YTUA 1HMVB 4DEZA 2Y1IA 3KD1E 3OYDA 1TVRB 1JLBB 3E01A 4CJEA 1RDDA 4LQ3A 4DFMA 3EPIA 4ZP9A 2BGGA 3AVLA 1JLEA 4NCAA 3PHEA 1RTDA 1BISA 2LSNA 4FS2A 5KFPA 4KHWA 4FJ7A 3HK2A 5KG7A 5KFHA 3KK3B 2D3ZA 4I7FA 3KHHA 4KO0A 3KK1A 4QWAA 2WTFA 4O4GA 4FW1A 4IBNA 1LW0B 4IRKA 4FLZA 4ECSA 3H5XA 3PW7A 1RA7A 3DRSA 3QEWA 4KFBB 3T19A 1QAJA 1TQLA 5KT5A 2AQ4A 1S0NA 2YNHA 1HNVB 4CFCA 1U48A 4Z4GA 2R8HA 4EO6A 4NYNA 2PZSA 4URSA 1RT4A 5KT7A 4QCLA 5EWEA 2A1RA 4QWBA 1W0HA 4HCBA 1RT1A 2BDPA 2HHSA 2HW3A 1VRUA 1VRTB 5J2QB 1X9WA 2QKBA 2BRLA 4ECZA 1MU2A 1EETB 3DOKA 3QINA 3SI8A 1RT7A 4TY8A 2HHTA 1QQCA 2KZZA 3OYIA 2IBKA 3RAQA 4B9VA 3NGDA 4ZVGA 3V6DB 3EZ5A 4R5PB 3ZT4A 5KT6A 3U3GA 3QIPA 3OYFA 2IOCA 2GIQA 1FKPB 2OPQA 4ECRA 2JEGA 3I5AA 4IR9A 4F4KA 2IDOA 2BANA 4E7HA 4FLYA 4K8XA 1N48A 5EU7A 4M3UA 4CJRA 1WAFA 3HHKA 3KIOA 4ECQA 2OYQA 1VSDA 3N6LA 5DLFA 3S3MA 1C0TA 1KLNA 3H5SA 3L2QA 4DMNA 2KTQA 1RDAA 1NK8A 3WNFA 3V9WA 1HQUA 3HXMA 1FK9A 1T03A 3LANA 2JLEA 4W5NA 4NCGB 3DLEB 2FJWA 2WB4A 4LSLB 4DSKA 3SUOA 3GIKA 3LAMA 1REVB 3OL8A 3VQ9A 1QHTA 2OPRB 4MFBB 4YR3A 2E6LA 2OA8A 1BIUA 3KLHB 3NAEA 1TAUA 2D0AA 4BDZA 4KV8B 4CHPA 1IO2A 4KHRA 3M8PA 3NAHA 4J9KA 3OYCA 4NLQA 3M8SA 3K5NA 4E1NA 2UUTA 3PV8A 2YNFA 4WE1A 4ECYA 4DTOA 5KT3A 1WN7A 2HNYB 4DSFA 1S1VA 3C6TB 3V1RA 3CJ5A 3TAEA 4RW8A 3SQ0A 2FVSA 2JC0A 1BCMA 4CEZA 1JLAB 3JSMB 4OLBA 4BACA 3HP6A 1NOYA 3KHLA 2IM3A 1NK9A 3CJ2A 5DLGA 3PJXA 3DI6B 4WYWA 3MFIA 2ZE2A 1ITGA 3I8DA 1RBSA 4KB7A 3D28A 1T3NA 5L9XA 3KTQA 2VG7B 1N4LA 3WNGA 4IDKB 4AILC 1GX6A 4TLRA 4KTWA 1NKBA 1A5WA 4CEDA 4FJMA 4EBDA 2BQRA 5T14A 4ZP6A 3KLEB 4YR2A 4IKFA 5EWFA 1BGXT 1DTQA 3V4IB 3IS9B 4ED8A 1HYSA 5L1LA 3OSPA 4FJHA 2BE2A 1ASUA 3ISND 4LSNB 3RMAA 2BR0A 5FDLA 4DTUA 3QESA 3M9OB 4DTJA 1S9GB 3CVKA 3QETA 3MAQA 3KJVA 4CE9A 5DMRA 2WCXA 2B5JB 4ZPAA 1RT3A 3KLGA 4TYBA 3L2RA 4FLUA 1BQMB 1TK5A 3M8QA 1RTIA 4W5OA 4EZ9A 4DU4A 1HQEA 3BSNA 4CEAA 5FROA 4EYHB 2HNZB 5HRRA 2F8TA 4CECA 4KSEB 4IG3B 2RN2A 2YHBA 3KHGA 3T5LA 2J6TA 2AWZA 2XC9A 3VQ5A 4RW9B 4E1MA 2A1SA 4Q43A 1DLOA 3DM2A 3RMCA 4F2SA 3QEPA 3SQ2A 4ZHRB 5KT4A 1CXUA 3PO5A 1WLJA 4YMEA 3OLAA 3DLRA 3ZSWA 1S1TA 4DS4A 3SUNA 4FW2A 1RT6B 3AVJA 4E7KA 5KFEA 3NH1A 3RB3A 3DRPA 1CXQA 3C6UB 5CYQB 4GW6A 4BE0A 2GBZA 1SUQB 1GX5A 1KVBA 2G8UA 3AA4A 4L8RB 3N6NA 4HUFA 5CZ2A 2HHWA 5C24A 2R2SA 3NMAA 4LD0A 4PA1A 2ZQBA 3O3HA 3KLFA 2ZD1B 1C0UA 1S4FA 4WXWA 2FVPA 2GIRA 1KLMB 2RF2A 3DMJA 4CJKA 4G3IA 1CZBA 4PWDB 4DU3A 1LWEB 5KFWA 3TABA 1EXQA 4JV1A 3MXMA 1TKDA 4RUCA 2UVVA 4CIFA 1Z26A 3EY1A 4M3YA 1IM4A 4MKAA 4MKBA 4GMJB 2R8JA 1BCOA 3TVKA 4QWCA 2QK9A 2C22A 5J2NA 2R7YA 1ZTTA 2R2UA 1C6VA 2ATLA 4I2QA 2G8HA 2IC3A 1SV5B 4J9RA 4DS5A 1YVFA 2RDIA 4DFKA 1S1UA 2HWIA 1L3TA 3LP1B 1D0EA 1C2PA 2EC0A 3CYMA 4ECUA 3GV5B 2FBTA 4QW9A 1TKXB 5KG2A 1A5XA 4RW4B 4MK9A 1C1BB 3MEEA 4ZVFA 4ED3A 4QOZB 4CFDA 4B9NA 1WSEA 4Q0BA 3OHBA 1D9FA 3QIDA 4N5SA 3DLGB 1TKZB 4FYDA 4CK1A 1RTHA 2WRMA 3VQ6A 4JS4A 1J53A 3NDKA 3SFGA 1C1AA 5I3UB 4QPXA 4OL8A 5KG5A 4JV2A 2ATQA 1Q9YA 3HT3A 2XWYA 1JL2A 4WZQA 5KFFA 5SZTA 3O4NA 3KK2B 3VQAA 2KW4A 5KGXA 2XGQA 3FRZA 3IGNA 1VSIA 4KKOB 4AHTA 4J9PA 2XY7A 4RNFA 3HVTA 1S1XA 3PW2A 4FLTA 1NKCA 3PW4A 3MEDB 3DLKA 4B08A 3LZJA 4NRTA 5CYMA 3BQ0A 1KVAA 3TWHA 3KKSA 2FBVA 1NJWA 3T5KA 4J2AA 4FZZA 3JYTA 5C25A 3D5MA 4RNNA 5KG3A 1C1CB 3MR6A 2YKNA 4NLUA 4IRCA 4IR1A 2VG6A 4HTUA 3RR8A 4FJ8A 3UDLA 2FLLA 4CGIA 1LW2A 1S5JA 1IH7A 2KQ2A 4HVJA 5KFLA 3HYFA 4NLDA 4CJLA 4CIGA 3HVWA 4OKEA 4DSIA 1U09A 2XRIA 4C8MA 1RTDB 3HO1A 3VQ7A 4EP5A 3OS0A 3I0RA 2HHUA 2G8IA 2KFNA 4FK4A 2D0CA 3UR0A 1QSSA 4F4XA 4I7FB 3KK1B 4F8RA 1NJZA 1CLQA 1S9FA 4RNHA 4O4GB 3HPHA 1LWFA 2HNDA 1NOZA 1D1UA 1IKXA 4NLTA 3HL8A 3G6VA 3WNHA 3DRSB 5J1EB 2CKWA 4QAGA 4H4MB 3ASMA 1RILA 4ZVEA 1NK6A 2YNHB 1YVUA 4JV0A 3LP3A 2R8KA 4U6PA 4CJQA 2AGOA 3Q8QB 3MXIA 4EO8A 5SWMA 4W5RA 1RT4B 5F9NA 2OPPA 1RT2A 5K14A 3TAGA 1S1WA 4YR0A 2X6NA 3QEIA 2E4LA 4OLAA 4K4YA 1RT1B 1QUVA 1HYVA 3L8BA 1VRUB 3V81A 4MQ3A 3VA3A 1TKTA 1S6QB 3SPZA 3MF5A 1KHVA 4OGEA 3T5JA 4TYAA 1W9HA 3CDUA 1TGOA 1LAWA 3SFUA 4OJRA 4EBEA 3DOKB 1RT7B 1N5YA 4TY8B 3D45A 3QZ8A 1TL1B 3PJWA 1KFSA 2P5OA 2OH2A 1Y97A 3MXJA 5KFDA 2OZMA 1XR5A 1XI1A 3BDPA 3CFOA 4M95A 3RRGA 4FM1A 3N6MA 2QXFA 4MIBA 4AHRA 1SL1A 2BANB 3H40A 4B3OA 5DGBA 3Q8RB 4DQIA 1YTAA 5KG4A 4CJ3A 2VG5A 3D0PA 3DLBA 4E7LA 4OGCA 4DFPA 4BE1A 4BDPA 1ZBHA 3IGVA 3ZCMA 1RTJB 1ZBLA 1Q9XA 4QWDA 3LPUA 3VQCA 1N56A 4NCBA 4TQRA 3AO1A 2IS3A 5JS1A 4J9NA 4F4WA 2PYLA 3H08A 4IG0A 3BSAA 5KFCA 3H4BA 3V6HA 4NRUA 3ZSVA 3H2LA 4DLEA 4K4UA 1FK9B 1T03B 4Y1CA 2F8SA 3BGRA 4Q45A 2V9WA 4FVMA 2IAJA 2HVIA 4J2BA 4CHZA 4ECVA 1JLGA 3KHRA 4FZYA 4HKQA 4O3SA 4CEBA 2UVUA 3K5OA 3K5MA 1JXLA 4TSXA 4Z4EA 3THVA 4KE5A 2D7SA 2IM0A 3M8PB 1T94A 2AGQA 1RYSA 1X9SA 1J5OA 4K4TA 1S0MA 4K4ZA 1XR7A 4FCYA 2D41A 4Y34A 4FK2A 2YNFB 4IFVA 4EBCA 4WE1B 4Z4FA 1R0AA 5J2MA 3CM6A 1NK4A 4IFYB 5KG6A 3AO2A 5HROB 2R2RA 4KTZA 3BREA 3L2VA 1BL3A 4KHMA 2D0BA 3QO9A 5F8LA 4W5QA 2QE5A 4HCCA 5CY4A 4Y2CA 4URGA 2B6AA 2O5DA 3FFIA 3IRXA 2W7OA 1J54A 3TAMB 1JXEA 3NF7A 1RDCA 2ZE2B 4NLVA 1U04A 4FLXA 2XY8A 3KKRA 3ZSOA 1LAVA 5JUMA 2ZKUA 5D3GA 4TXSA 4ZPCA 1HMVA 2WHOA 1FKOB 1TK0A 1QSYA 1TVRA 4E7IA 3LPTA 4BE2A 5HBMA 4WFZA 2YKMA 4YP3A 5C5JA 2HWHA 4LQ9A 4IQXA 4DQQA 4KBIA 3SI6A 2W8LA 3S3OA 3BSOA 1A5VA 1DTQB 4C8KA 3IG1B 3BQ1A 5HP1A 5KT2A 1G15A 1JLFA 1ZYQA 3E51A 4XPEA 5DG7A 4NLWA 4ICLA 4YFUA 4F3OA 4ZVHA 5FDLB 4RW6A 4RNMA 3LAKA 3KJVB 1X1PA 3TAFA 3SYZA 3K57A 3OHAA 3M8RA 4I2PB 1X9MA 4FLWA 3VA0A 4CGDA 1RT3B 3AVFA 5DGAA 5KFVA 1GOAA 4UQGA 4MH8A 1RTIB 5DQIA 2E9RX 3OYMA 1K1QA 1HQEB 4KHUA 2RDJA 3GIIA 1UOCA 2IJNA 1SKWA 3OVNA 4R8UA 2C28A 3CJ3A 3DM2B 1TL3A 3RR7A 3DOLA 4ECTA 3KLVA 4PQUA 3NF6A 5KFIA 4K4VA 3VQ8A 4ED6A 2G8WA 5T7BA 4RU9A 1XHXA 5F8MA 5F9LA 4N56A 3DRPB 1LWCB 1TK8A 4Q8FA 1FKPA 5C24B 2JGUA 4I9LA 3MR2A 4B8CA 3DRRA 3QERA 1HJRA 3CG7A 3AVHA 3QNNA 1C0UB 4PUOA 2RKIB 2KZMA 4FJ5A 4WYLA 4FJIA 2RF2B 3DMJB 4ZTJA 4JUZA 2HHVA 2IM2A 5E41A 3I5BA 3O3GA 2WONB 4KB1A 2HVHA 1IKVB 2R2TA 4CFAA 1XR6A 3P5JA 3CIZA 5J2NB 1T7PA 4DLGA 4I9QA 1SKRA 4I2QB 2YNGA 3I0SA 4DSJA 3OL6A 3S9HA 3SCXA 1NNDA 2JC1A 3DLEA 4HUEA 3TI0A 2I5JA 3QLHA 2CJQA 4LSLA 2W9BB 4OKKA 3K59A 3V9UA 2XI2A 4F4ZA 2OPRA 4MFBA 4CF9A 5C42A 5J2PB 3MEEB 4KHNA 2V4QA 4NLPA 2OPSA 3AVIA 1HPZA 1QS4A 2DY4A 2VWKA 1YT3A 5F8JA 3SJJA 4CJUA 4EEYA 1NK0A 5I42A 3OYHA 1RTHB 1C0MA 4K8ZA 2E6MA 5KTQA 3OS2A 3TAQA 4OPKA 1U47A 1SL0A 3TR8A 4DTNA 1SH0A 4IOBA 5EDWA 4B9TA 2EHGA 2HNYA 4E19A 2V0NA 3RB6A 3ZSZA 1IKYA 4DTXA 4FM2A 3AVNA 3JSMA 2QKKA 4XPCA 3U3YA 2XCPA 3HVTB 1VSKA 1S1XB 2AGPA 3H5YA 4IH7A 4FJ9A 3DI6A 3DLKB 5DK5A 5CYMB 3V9ZA 3AO4A 3JYTB 3ZSRA 3LP2A 3M9MB 3ULDA 2VG7A 5L1KA 4DQPA 4IDKA 3SQ1A 2W9CA 1S6PA 5KFBA 3PY8A 2YKNB 2G8KA 5KFXA 4TQSA 3DYAA 4MK8A 1BI4B 4ED2A 3BR9A 2YNIB 4AHUA 3ZSQA 5KFKA 1RBRA 3C95A 5KFNA 3RBEA 5DQHA 4CGJA 3I0RB 1I6JA 5DG9A 4FK0A 3SQ4A 2XY5A 4LSNA 3V1OA 3NBPA 2YHAA 4ED0A 3T5HA 4O3PA 1JLCA 5DQGA 3Q8SB 2HNDB 2JEFA 1QE1A 4NYFA 1IKXB 3NHGA 1JLQA 1EX4A 3G0ZA 3LP0B 4DTRA 1BQNB 2XO7A 3SUPA 4DTMA 4H4OB 1RCHA 4K50A 5KFMA 4FJNA 1WNEA 3Q8PB 4Z0UA 4CJ4A 3PX6A 4RUAA 4Y2AA 3VN5A 4M94A 2OPPB 1RT2B 5K14B 2HAIA 4IG3A 2HMIA 5KFAA 3CDEA 4FLVA 4DG1A 3ITHA 3O3FA 3AO3A 1EP4B 4ELVA 4DTPA 3V81B 4B9UA 4B9MA 1Z4UA 2DFEA 4CHYA 1TKTB 1L3VA 4BWMA 3SUQA 1S9EA 1D5AA 4CFBA 4IH6A 1WSIA 3PVXA 4MK7A 3PX4A 1TV6A 4KTQA 3KMQA 1RBTA 4FBTA 1N5YB 1RT6A 1JXBA 4DWIA 3NGZA 3QGGA 1NK5A 1SUQA 1HYZA 4F3TA 3MECB 2IM1A 3OYKA 2UVWA 1DTTA 2J6UA 1UA0A 1UWBA 4KB0A 3V1QA 3GIJA 3E01B 4ECXA 3M9NB 4NLRA 1ASVA 1JLEB 2J6SA 5F8NA 3AVCA 4O44A 4ID1A 3A2FA 3CFPA 1HARA 1ZBFA 3EPGA 4Y1DA 4YNQA 2Z1IA 4KO0B 3KLIA 3TAPA 4AHVA 1WSJA 2W7PA 4FBUA 1K1SA 2DFFA 3HVRA 4IG0B 3RB4A 2FLNA 3CWJA 1SV5A 3RBDA 4FZXC 3BGRB 4RW7A 4W5TA 4JRQA 2IAJB 2Z1GA 2VA2A 1XHZA 5DG8A 1JKHA
chains in the Genus database with same CATH superfamily
4WFNL 5EUHA 2KFZA 1FEEA 4O3QA 2BVZA 4LH4A 2DH7A 3GP9A 3R7NB 4F2RA 2MGZB 1UVIA 1K8KB 2AX1A 3GCXP 3ET6B 4BGAA 1L3UA 1VHFA 3RW7A 3OTOF 1HKAA 5KFGA 3LWLA 4ZPDA 3AVAA 3ZX3A 4NYPA 4C8ZA 1F2GA 1N6QA 4EIAA 3QRRA 4OZJA 4IFVB 2XQCA 5J2MB 2HBLA 3MCSA 2A1BA 4M3ZA 3NLCA 4OVLA 4LH5A 4DUYK 4CK2A 2XCAA 1HUXA 4BC3A 3H20A 4OLPA 5GINA 3EICA 3QWPA 4KKOA 3BEXA 2IJRA 4GKKK 2OPQB 1OS5A 4K2XA 3SCLE 2LDYA 3FFIB 2BBEA 3ZZOA 1HHSA 2ITGA 3QIOA 4G1QA 3TZXA 3JSBA 2PC6A 4CEEA 9ATCB 4Z4CA 1VGYA 2F8EX 2I1RA 3HPGA 1HJOA 3K8WA 1S0OA 1X4AA 5F8GA 1DHMA 2QT7A 3BGFA 4KH1B 3RW6A 3WXLA 4DF4A 2QLJB 2MKYA 2FVCA 3RMBA 3CDBA 1Y3KA 5GADP 5BRDA 3MM5A 1LCUA 1WC5A 5HP1B 2KU7A 3FGVA 3SPYA 2IA0A 1KBRA 1SZ2A 4NZ0A 4NLOA 2XWXA 4F7VA 4M63C 3P8BB 5HRNA 2QWPA 2R7UA 3A3NB 4IRDA 1RJJA 3VTIA 1NG9A 1LV5A 4DV6J 4B9SA 4WP9A 1M5OC 4RG8A 4IO9Q 2CQ1A 1JJ4A 3HFVA 1VBZA 3MR5A 3V6KA 4OYWA 1P90A 1WELA 3M05A 3GILA 1K0TA 4OFZA 3CF5L 4FPRA 3AJDA 2IVNA 2GV1A 1B0TA 4R8UB 1SPBP 4DL2A 1HBMB 4RW8B 1FXXA 1SH2A 1Q7YO 1F3FA 4TN2A 2YI1A 2GQQA 3D2EB 3T1YF 5IV3A 1RBVA 3M6WA 1HW9A 2HBYB 3FDSA 3OJSA 3BO3A 5L1IA 5KRTA 4PXEA 3G71N 2V8DA 4CJVA 2O8DA 3CCZA 2ILYA 3NG8A 3X3UA 3EKUA 2MKHA 5BN9A 4DL5A 4XTTA 3BB5A 1RHJB 1SAZA 4FXVA 2RH3A 1JX4A 2X51A 4FWQA 1IG8A 1WBBA 5CZXA 3NGRA 2IVPA 3KVGA 2RHQB 2QO3A 2BE2B 3AVBA 3GR1A 4ILJA 3HI0A 4DUTA 3H2UB 3ILOA 1YKWA 2IJFA 4CERA 1K9MO 4JHDB 3ZC4A 2YNGB 4KH0B 4ZLJA 3CJ0A 4O23A 2V2VA 4O4RA 1ZETA 2ROPA 2V68A 3CMQA 2DR9A 3R5JB 4FWOA 2Z1JA 4B3TK 1T8EA 1RISA 4DX7A 3LDNA 1Z05A 3RBZA 3ZETA 1DLOB 5J2QA 2DTUA 4ETXA 1NK7A 3CERA 2IGIA 3P1GA 1EETA 3FQLA 5AQTA 2JEIA 2FJVA 4ZP8A 5I4MA 4EP4A 5AQVA 5HROA 1BIZA 3CJ4A 1JQGA 3V6DA 2KM8C 4KGVB 4JI8J 2GJIA 2L41A 4A8QA 2CH6A 2AKWB 2P6SA 5KG1A 4FDFA 3KLFB 2RQMA 4O5BA 2YH1A 2CQ0A 2JX2A 1ROFA 3TA2A 1VQYA 5BPMA 2KXHA 2D5RA 3H25A 2QWLA 3RJMB 4MTPA 3GIRA 1NB7A 3CCES 3VQQA 3LP2B 4WIQA 1WAJA 5AQUA 4ZVQB 3OR2B 2CJKA 2CPHA 3C6AA 1SXLA 4JYAK 1OPIA 5ADXA 3P39A 1KAYA 2DGSA 1Y3JA 1QJHA 2FLPA 3OYBA 3NGYA 8AT1B 1NJYA 3UE5A 3O1BA 3O1LA 2EI5A 5EGYA 4NCGA 1BE4A 1N8RO 3LDQA 4WIIA 2XMUA 1WSVA 2J0WA 3DN9A 4DCPB 4NLXA 3G10A 1CC8A 3AHPA 1RDUA 1Y5LB 3GBTA 2DY1A 3U9DA 4OIXA 3QGIA 4NI2A 4C8OA 3PO4A 4EFHA 2WFBA 1D4XA 1WF0A 5F0UA 4QS8A 4CF0A 2Y8WA 3HKZD 2O8CB 2KM8B 3BO2A 4JI6J 1KVJA 3BBBA 1RWXB 3LALA 4WU2A 3D1OA 3WEEA 1UW9A 3A13A 3ITHB 5D0HA 2FGOA 3C6TA 2ZF5O 2AYGA 1ILYA 3GOIA 2Q31A 1JLAA 1KTQA 2DVIA 2ZBPA 4DFJA 2DTJA 4DL7A 4ECWA 4QWEA 4RNOA 2F4VJ 2DFHA 5CA5A 3C94A 1GOBA 3FZ2A 4TKTA 4DPXA 1LWCA 3CFRA 1DBDA 4LR8A 5DDOC 3ZYYX 2U1AA 4GVBB 3RAXA 2XTJP 5GAHU 4M3WA 3OVSA 2JLFA 2VGNA 5ADXH 1LW2B 1K73T 3LW5C 3W61A 1VQ9N 2XNRA 4ZJQA 4O44B 4IH5A 5SUHA 3IMXA 4CBUA 4N76A 2VIHA 3IS9A 2W42A 2ZVSA 2B9WA 2DEJA 1NMNA 3I4HX 3PHTA 5IT9U 1ZTWA 4BC9A 2CJBA 4A8YA 4FJXA 2GX8A 3HM8A 5TKWA 2UU9J 4GC6A 2KG1A 3TA1A 4CHQA 4LF2A 2DT9A 2EBGA 5AZIB 2WZ1A 2VFRA 5GADI 3CE8A 2CQBA 3N79A 4B02A 3SCIE 4LRDA 1WUUA 5BRHA 4I68A 3NCIA 4WP8A 1B9DA 1U0HA 4WYBA 4XK8C 2WK4A 1UWAA 1S72N 2RQKA 3L7OA 4CF1A 2VA3A 5RUBA 1MWKA 2EX3A 2G8VA 5CYQA 4TY9A 4H0PA 2EWHA 4NLGA 1YZ6A 1QAIA 2FVRA 3K2PA 4FXDA 1OY8A 2ZD1A 3SCKE 2VUGA 3LDLA 3W66A 1KLMA 1TYQB 2XY6A 2QWRA 3A0IX 5KG0A 2GWKA 3FZLA 3IAYA 3G25A 4Q8EA 1UA1A 2QA4N 4B3TF 2ZWOA 1BI4A 2UXCF 2YCHA 3VEYA 3OLBA 2YNIA 1L3SA 4AD6A 5L8RC 4C9DA 3O4QA 2DGQA 2ASLA 5A8RB 1FJCA 1Y5IB 3TP2A 2V8GA 4QOTA 1NU0A 4QIVA 2ZH3A 1TKXA 2ZJPL 4QZVB 1DQ8A 1FJGK 2QWNA 3FCVA 2ZM6F 4CJSA 3IMQJ 3R6LB 2VOPA 2MY8A 2ZGYA 3MZIA 3CC7S 4KHQA 2GQCA 1TKZA 1JCEA 5HRPA 1NU4A 2D9OA 4WFNQ 5EOYA 3THXA 5I3UA 4C0OC 2HURA 2XMAA 2CQPA 4BR9A 5E3CA 2CDRB 4FF2A 4J9LA 4J9QA 1KP6A 1J9AA 1IKWB 1EP4A 3ALYA 2BUNA 1ZBIA 2ZVIA 4AHCA 2UXDJ 4JYAF 5BREA 2Z30B 2Q2RA 5IWAJ 4A48A 1VK0A 3MEDA 2L08A 3H4DA 4FJKA 2AJFE 4LREA 2RHSB 1S79A 3CJSA 2N3OA 2E9ZA 3LA0A 3MECA 1C1CA 1XMOJ 1WTFA 1YRXA 4NMLA 3GG0A 2V7YA 2NRXA 1TVRB 1JLBB 3E01A 4HEA9 1P9YA 1NUEA 2XHCA 4DFMA 4IFEA 3QT6A 1JLEA 4NCAA 3HZGA 4CM2A 1VQ8N 1MN7A 1RGVA 4KIAA 2UUBK 4KHWA 3HK2A 5KG7A 4DCJB 3QATA 1B64A 4I7FA 3KHHA 4QWAA 2QMUB 1CZAN 1LW0B 3JQMA 3P4UB 3H5XA 4FLZA 1RA7A 4B1XB 3RSEA 3T19A 2RS8A 2E5LK 2QYCA 1ITPA 2RE1A 2YNHA 2NPIA 4O5FA 4FO0A 3MWTA 1HFEL 3LL3A 4EO6A 3I56S 3VZIA 1FT8A 2DGOA 1UZHA 5KT7A 4QCLA 5EWEA 3BUZB 3R3TA 2I9SA 1X0PA 2GVDB 3HSGA 1VOMA 2BDPA 3GU0A 2P9SA 4M5LA 2I2YA 3H1QA 4ENOA 1KONA 2O8EB 2AT1B 3PYDA 1Q8KA 2VQFK 2P9CA 3I6PA 3QINA 3SI8A 5GAGU 2VKZG 1X4EA 1YVNA 3U3GA 4IJAA 4OHXA 4IR9A 3IKMA 2VJUA 4F4KA 3ZXWA 3P5TL 2BANA 3WDOA 2CIMA 5K5MA 3HSCA 3L7UA 5EU7A 1X3NA 3CMEN 5H9EJ 2ZJRL 1WAFA 3KIOA 3TSPA 3TYTA 1S5ZA 4ECQA 2D1CA 1TR0A 1OKJA 2OYQA 1HLUA 2EFVA 3F41A 4DR5K 2ROGA 4BY9C 3FBEA 1N34J 2KTQA 3J8AA 1NK8A 4MIWA 4DPWA 3W64A 4USVA 2RB7A 1HQUA 4E2FB 5DZ7A 3UW1A 1XK8A 2KRRA 3NGTA 1HLWA 3GIKA 1VQLN 1MSWD 3OL8A 1JJ2M 4MFBB 2ZOFA 3JXUA 4YR3A 2OA8A 1BIUA 2CXEA 1TAUA 5AQNA 3J80Y 1WBDA 1KAZA 4BCAA 4HI1A 1Q86O 2P9KA 2L48A 1IO2A 2YX1A 2OANA 5AXLA 4DZDA 3M8SA 3K5NA 3SSSA 5B0GA 1YDLA 3OR1B 2YNFA 3MCPA 4WE1A 1N5SA 2ZNYA 1N54B 4DV4J 4UY8T 2V4JB 4X4SA 4DR6J 1WN7A 1X31C 1M1KO 3HDSA 1G1XA 3JQKA 5LT5A 5FPNA 3DXKB 4CBWA 4EUVA 3KHLA 5HL7L 1YITS 3HSZA 3PJXA 3DI6B 1BDGA 4WYWA 4MYTA 1XMBA 2E44A 2Y1RI 4CBXA 3MM8B 4UF4A 4KB7A 2D74B 3CCSS 2HFOA 3D28A 1T3NA 5L9XA 1DFDA 1IBKJ 1U0SA 1IXKA 2L9WA 3WNGA 4IDKB 1FJGF 4CEDA 4LFAF 3EVOA 3SCJE 2BQRA 4KQZA 1UFLA 3TZWA 4DUZJ 5EWFA 4UTGA 3DOMB 2PSZA 2YH0A 5L1LA 3FCWA 2NS1B 3RMAA 4OZ2A 1SJ3P 2VQEK 5FDLA 2YHXA 4DTUA 4PKHA 1U25A 2ZZNA 4JI1J 1UFWA 2GZOA 3MAQA 3I4PA 2DK2A 4CE9A 2WCXA 2B5JB 3WC2A 3Q7BA 1TK5A 1H2UX 2Q79A 2EWSA 4Y28C 3JXOA 1HQEA 1YIJN 4DZ6A 5FROA 2R7VA 4KSEB 4IG3B 4BVPA 3M2UA 2A5XA 2PMWA 4EAHD 4RW9B 2VB6A 4E1MA 2A1SA 3UVJA 3W2VB 3DM2A 3THYB 3DXMB 4WQ5A 1KC8O 4F2SA 1EX8A 4ZHRB 4USTA 3NY0A 2HFVA 3T6JA 3HSJA 1OH6A 4YMEA 3VENA 2XS7A 5LY3A 4ES1A 2UUBF 4MMOA 4BE0A 4I6YA 4OHWA 1U2VB 1KVBA 3OTCA 2GMHA 2HHWA 2ZOMA 1R3NA 4Z7YA 3Q23A 4PA1A 4HACB 2E1YA 2PI4A 4FWKA 3THWA 4CJKA 4G3IA 1CZBA 2JWKA 1LWEB 5KFWA 3HCXA 2HQIA 2CPZA 3H2VE 1JB0C 3MXMA 4BBYA 3K0JA 4M5KA 3AGRA 2UVVA 1Z26A 1YJVA 3EY1A 4GMJB 2EFNA 3VAGA 1Y0HA 2E1RA 4CZGA 3J81O 5J2NA 2R7YA 2V94A 2ATLA 1H6KX 2VPYB 3ATVA 1UPMB 4J9RA 2YX7A 1ZXOA 1YLXA 3GR0A 1K0VA 2P9UA 2KT3A 2HWIA 3MMJA 3P96A 5DETA 2DNOA 3LP1B 2VQFF 1C2PA 5C12A 3GV5B 2ZEJA 1A5XA 5DM6Q 4RW4B 2YWFA 3O9SA 3MEEA 5CYJA 4ED3A 3GSIA 4QOZB 1H2TZ 4OJHA 2H3GX 2GMLA 4ANEA 5JLHA 2CNLB 4K5SA 4USKA 1AA1B 3VVTA 3CHWA 3DLGB 1T9YA 4GVEA 3MM9B 2XSFA 3C15A 2PFFB 1HX1A 1PKUA 4JV2A 1DY3A 3PDNA 2XWYA 4WZQA 1ZAWA 1QDUB 2DR8A 1RZMA 2VBZA 1GQEA 2FSJA 1V4TA 5ETNA 3TX0A 1N32K 4J9PA 3FNNA 4DR5F 2H5EA 3PW2A 3KJNB 4MT1A 4UUXA 1ZA2B 1CULA 5CYMA 4RJVA 2DNKA 4CO3A 3G82A 3E2EA 5C2FA 1HI0P 5C25A 4GVLA 2JZ5A 2WBMA 2N7CA 2HYIB 2P9IB 4NLUA 4IR1A 4HTUA 3MPUB 4V19J 3RR8A 2BE7D 2H54B 3UDLA 2FLLA 1N52B 4CGIA 3SMSA 1XJWB 5KFLA 3C7NB 1YJ7A 4L76A 3EX7B 1RAAB 3WQPA 4OKEA 4UW2A 4C8MA 1RTDB 1E4GT 4EP5A 3OS0A 1IJFB 4B1ZA 2KHOA 3ZZTA 4DPOA 1LWFA 3PIPQ 4U8YA 1IKXA 1FXDA 4N8OA 2RT3A 5MLCQ 3BZKA 2ZDPA 2FHOB 3KZBA 4H4MB 2NZ4A 3ULHA 2DCLA 4ZVEA 3VHQA 1YVUA 2HBJA 3LP3A 4UOHA 3N4PA 4X4PA 2OPPA 5K14A 1IBMK 3VETA 3FEZA 3TAGA 3OUYA 1S1WA 4YR0A 1P8ZA 3PFOA 1RT1B 1QUVA 1HYVA 4G65A 4JKAA 4MQ3A 4RPFA 1SJFA 3SPZA 1S7IA 3SQGA 3T5JA 1UL3A 1LAWA 3M8YA 3SFUA 1GLJO 3T1HJ 1WEYA 2XMTA 3VCDA 4E1JA 2G9OA 4C11A 3FEYB 3U4LA 1AUSL 1HA1A 3J81Y 3L9ZA 2HFNA 4J5OA 5M1FA 2UUCF 2O66A 3EGNA 3TUJC 2OZMA 4CI0B 2VQEF 3BDPA 1PBUA 1GMWD 2MZRA 2MQOA 1T9WA 5HN0A 2OEMA 3AD7C 4B3OA 3Q8RB 2VG5A 4BQZA 4E7LA 1TUVA 3OW2R 1TU0B 4CZLA 1CJUB 1ATSA 3FVYA 2FJAB 4DQ8A 4F4WA 1YBTA 5KFCA 3H4BA 2O8FB 4FL9A 2YVSA 2G2OA 4K4UA 4U8VA 2AJ0A 2ZWPA 3C19A 4DV1K 4CHZA 4ECVA 3GJTB 4B17A 1JLGA 1N36K 4N77A 4HKQA 2RDDA 4LBPA 4O3SA 2GMJA 4X4UA 4CEBA 2V2KA 3K5MA 2MGZA 4IJNA 3ZX0A 1K8KA 3ET6A 4KC5A 4OLOA 1T94A 2AGQA 1RYSA 2J4RA 1ZZNA 1S0MA 1C0GA 2CFXA 4BRPA 4IFVA 1V3ZA 4CLFA 1R0AA 5J2MA 4IFYB 5C10A 4JI2K 4P71A 2C2NA 1P9QC 3P3DA 2AD9A 3BREA 4LIRA 3L2VA 4IUFA 4KHMA 2D0BA 3QO9A 3M6UA 5F8LA 2DXFA 2QE5A 4FYXB 4YB6A 2YTCA 4URGA 2B6AA 3GSDA 3FFIA 2MY7A 2W7OA 3J7ZT 4V19S 3PRDA 2C3OA 1J54A 4WF9L 3CO0P 2IVMA 2XS5A 4ZPCA 1QM9A 4LF4J 2JWLA 2P2CB 4E7IA 4Y2KA 3TQEA 4NLBA 3AT1B 1GXUA 4YP3A 2HWHA 1M0SA 1RK8A 1X5SA 3MCAB 3SI6A 2W8LA 3UN2A 4KRWA 2WW4A 4C0HA 3ZLJA 2FZGB 1QVGM 5HP1A 3R2DJ 3NOGA 4XPEA 3SIPB 2RVJA 4CIOA 4NXMF 4F3OA 1WUAA 1TUUA 2A0FB 3KJVB 1X1PA 3SYZA 1N32F 3O80A 1QQOA 4CGDA 1NGFA 4X65F 3OQ2A 1MWZA 4JI0J 4CH7A 2Q6CA 4UQGA 1RTIB 4RBUA 5DQIA 2E9RX 2VFVA 4DR4J 3D0HE 3Q2TC 1UOCA 4ZIWA 3GJRB 1DEJA 4R8UA 2HK2A 4DR2K 1U6ZA 1HBMA 2FZCB 4H4KC 1IBLJ 4OYZA 3RR7A 4M5HA 5J1PA 3DDIA 3KLVA 1FI4A 4IOCL 3AODA 1FFWB 7AT1B 1MWYA 3KWIA 3CCUS 1RAFB 4K4VA 3DDNA 3EE3A 3VQ8A 2CPDA 4ED6A 2LXFA 2OUGA 5F8MA 4N56A 4WBFA 3DRPB 1V3RA 2GFFA 4PPDA 2B9EA 1TK8A 4Q8FA 1EO1A 5C24B 4I9LA 1X0FA 5HL7Q 3LF0A 3CCRN 2QA2A 3QERA 1HJRA 3QNNA 2JJ4D 1C0UB 2QWQA 2FUG9 3IAS9 2RF2B 2R7RA 4M63A 2KKHA 2LA6A 3GYXB 3RBXA 3I5BA 2HVHA 1NPPA 1IM6A 1IBMF 2EXUA 4I9QA 4CZCA 4DUYJ 4I2QB 5T41A 2YNGA 4DSJA 2LCWA 3CNQP 3JTOA 3UB5A 4ZPVR 2NNWA 3TO8A 2JC1A 3NRBA 4JNEA 2W9BB 4GKKJ 3DHXA 3JSYA 1CJTA 2XI2A 2GAGC 3MTJA 1CJVB 4LT6A 4LRCA 4WPAA 3US5A 1QS4A 5B7WA 4NA3A 4CJUA 2CQCA 3ZTRA 4CTAB 2V7ZA 2RUSA 1YHQS 1HKBA 4OPKA 3CD6S 2ZBQA 3TR8A 4U67Q 3ADAC 4DTNA 1G99A 3VALA 3AD9C 5A8KB 3MX5A 3NWRA 4PYAA 2QSFA 4FM2A 3U3YA 4ZPTR 3CJ1A 3W9IA 3RYLA 4A46A 1S1XB 1BWEA 3ENAA 4A47A 4DV7F 3CUNA 3BYPA 5IS2A 2IRUA 3GG1A 1CC7A 1LFWA 2OELA 4J9VA 4YS2A 3JYTB 3ZSRA 3LP2A 4NXNK 1KQSM 5L1KA 4DV1F 2CYYA 2G8KA 5KFXA 1GLDG 5A2QO 1W7WA 4MK8A 2V2ZA 4ED2A 2UXBJ 1NB2A 2M0GB 5GMEA 3SLCA 1P1TA 5KFKA 1WHYA 4DV3K 2A41A 5KFNA 3MXHP 5EX5A 5DQHA 3MM6B 5B0BA 1I6JA 4PWWA 2ASPA 3CJCA 1LWXA 2VWBA 4DV5F 4ED0A 3T5HA 1HNWK 3IRWP 2HNDB 2BX6A 3NHGA 2MKIA 3D3BJ 3LP0B 4Y0WA 3N5BA 5U47A 4PG4A 4DTMA 1E6YB 3SQOP 4A61A 1S57A 5KFMA 3D0GE 2O8CA 4CJ4A 3VN5A 1MMNA 4FWRA 3B54A 1HWKA 3ETMA 3MHYA 2IVYA 4ZVOB 3ITHA 3O3FA 4LVOP 3AO3A 1LKZA 4PRFA 2JL9A 2A10A 1U6BA 5DO2A 4CHYA 1TKTB 2PFDA 5BR9A 4BWMA 3SUQA 1D5AA 4IH6A 3PVXA 4KTQA 4KBOA 3NGZA 3SSQA 1FNXH 2B7CB 1NK5A 3T9NA 2GWJA 2D9PA 3FZBA 3CCMS 1E6VB 4XDCA 4GVBA 3S6EA 4KB0A 5E2QA 3G96A 3I55N 2YJEA 2WVFA 1VQ7N 1KR4A 2E88A 3OVBA 3M9NB 4ANDA 4FYVB 1ASVA 1SQKA 3KXDA 4V19X 4O44A 1KWMA 3ILJA 3Q0AA 1SJRA 1JMTA 2YQ3A 1QQNA 4YNQA 2C2OB 2VF3A 4FBUA 1K1SA 3FC9A 3HVRA 4IG0B 4ISGA 4BRDA 4DR2F 1N0VC 4FNHA 5KPZA 2GQ2A 3CWJA 1SV5A 4C3MA 3KUGA 5AQZA 4PG8A 4W5TA 3HF5A 2DR7A 4JRQA 5LMUF 3MMVA 1EZZB 4L74A 3O9RA 3G8SA 3VQEA 2KVQE 2MEWA 2DHGA 2PEHA 2ZDOA 3MM7B 3DRXA 3ZZ0A 3HPOA 2EK6A 3V9XA 3OFFA 4WQ4C 2W2OP 5B09A 1F21A 3PRBA 3AQOA 4E3SA 2YX4A 5GAEU 2MQMA 4CLPA 2KJVA 1Q8IA 3OJUA 5A2QY 1Q81O 3OYJA 1I39A 1RHUB 1FERA 2QI2A 4JK7A 3KK2A 3U8XA 4GO7X 1Q1KA 3M30B 1QQMA 4M45A 4CIEA 2BV3A 3MD3A 5D0EA 5KGWA 3PZPA 5AR0A 1S3XA 3Q89A 4PYDA 5ADZA 1VK3A 3ZT2A 4CT9A 2PMHA 3IRXB 4CH0S 5B08A 2ZZTA 2ZH1A 2NUHA 4H5VA 3U6FA 1NSKL 4E89A 1VFJA 2CPJA 3AQPA 3RWUA 1D3WA 2B4UA 2B51A 5M1NA 1WKLA 2PD1A 1HRHA 2B56A 1B7YB 3VESA 1C0TB 3FCHA 3OPKA 2GJFA 4CJFA 1XC3A 1RHRB 3M3ZA 3UI3A 3CTRA 2OAUA 5A8RA 3EDQB 3NS7B 1RAHB 4B3SK 3W63A 2ZJQL 3NMUA 5K8NA 4ICLB 1MNEA 3UNGC 1U1PA 2R8GA 4JV5K 1T02A 1O8BA 4FXWA 1QVGR 4KHPJ 1OSCA 4QU7A 5CZVA 5J1EA 2DYAA 2PY5A 3TQ1A 3F9KA 1TAQA 2ILZA 3VQ4A 1X4BA 3C0BA 1NZ8A 1UAXA 4CGHA 3ZT3A 4QYZK 4M42A 4QIGA 1I3OB 2QV6A 4USMA 4ZPBA 4FJJA 4DV6F 3RGIA 1FJEB 2XMVA 4NXNF 1N5QA 1U49A 1IKWA 2BKPA 4RWXA 1KS2A 3MFHA 1S6QA 3TVZA 1F60B 1TL3B 1IWGA 2P9LB 4PKGA 2Y1JA 2KXFA 1HBOB 5DM7Q 2ACYA 2QJ3A 1AXQA 3PKYA 5A6WA 2F7TA 2E8AA 4JB8B 3VQBA 3OY9A 4A2BA 4DV3F 3N01A 1SKUB 3OYAA 1RWMB 2UV8G 1ZBUA 2LXUA 5M2PA 4N41A 4L3NA 5AQIA 3NF8A 1JLBA 4W98A 4HTIA 1TELA 4LF9K 4PUOB 4KJIA 3AVGA 3S41A 4UZCA 3RAMA 3IFRA 2J7UA 4J9SA 1HWUA 3IWLA 3P5BP 4CZJA 4B1VA 2IVFB 1T44A 1ZM3A 3RRHA 4B1YB 2XI3A 3F0NA 4YOUA 1JNRB 2O4IA 3T3FA 3BQ2A 1RDBA 2J9EA 3VF0B 7FD1A 2P5GA 4F4YA 2XYPB 2V51B 3FKBA 2YV0X 3TSQA 2ATCB 3ZZZA 1LW0A 3MPDA 2D0OA 5LXRA 5HSPA 3JQJA 1FRHA 2MXYA 1QD1A 5AQYA 3KLGB 3HTVA 3QLHB 5AE2A 3M8QB 3GQCA 1KVCA 1GMWA 3RG6A 1G6BA 2BXJA 4PY5A 2GVDA 3SMZA 2OPSB 3AFGA 1HNZK 1HPZB 1Q95G 4M3TA 1WDDA 4XO0A 1IR2A 1SC3B 1WC1A 3QNOA 5HATA 4E7JA 2O8EA 2LEPA 2L9DA 5H1SV 1N33K 3CPEA 1WHWA 1L5UA 1S1TB 3HJFA 3D6MB 3T41A 2ZITA 4A8WA 3QSIA 3OL7A 2W7AA 5KFJA 1YXQA 2G8FA 1S10A 3ZZUA 5AQGA 3OFGA 1WEXA 2F65A 3FQKA 3VEVA 3TAMA 4USHA 1U2FA 4Z4HA 2KHCA 4WFXA 4MO4A 1RU1A 1S22A 3HKWA 3LM9A 3ISNC 4BWJA 4H8KA 4BC4A 1CJKA 2MTLA 1FKOA 1QTNB 1GXTA 1IJJA 5DZ6A 2CQGA 1SKSA 5LMNK 3H3NO 3RB0A 1ULRA 3H5UA 4CD1A 4HHUA 2Y3YA 3HSTB 2IC3B 2DGXA 3IG1A 1M5SA 1U1NA 5JS2A 3OYLA 1S1UB 1RU2A 4M41A 4CESA 2MB0B 3F44A 1NHVA 2WBRA 4JAXA 2FY8A 3QFPA 2YXLA 1JLCB 2CWXA 4P2SA 1GEHA 3TANA 1JLQB 4OHZA 3HP9A 3S3NA 3NFAA 1UMJA 3CULA 4LY7A 3E9PA 4I2PA 1RKIA 3P83D 1RWOB 1VIOA 3AXMA 5KFSA 1OSDA 3X1LB 2WB1D 1M5PC 3PW0A 2BACA 4PHTX 2AHOB 1X7VA 4PZVA 3OR1A 1HD0A 4BRQA 1Y4ZB 3H59A 1BD6A 2HFSA 2HMIB 2FJEB 4B3MK 2V4JA 4DG1B 2MKSA 3MOJB 2FZKB 2KH9A 3CQXA 4I6MB 4F67A 4F50A 3DXKA 4PL8A 1C4AA 5HVFA 1NJXA 1OH5A 3H3OB 3KYLA 3M2VB 2B43A 3UCUP 3PYGA 1WNSA 4JI5K 1U4BA 3NGKA 4XH1A 3W5ZA 4CJTA 4B3RK 2E5LJ 1VSMA 3QEVA 2A3ZA 4K4XA 1QVFM 3BF1A 4AQYK 2F4VF 3ZT0A 2DEIA 1UWBB 4ELTA 3M1VB 3CEDA 6FD1A 1BO5O 1KEKA 2UVRA 4J9UE 3HBTA 3VEXA 4O0JA 4NYOA 4U96A 1X5TA 1LQ9A 3DOMA 3AA3A 1T9VA 2WONA 3SZ2A 3B6OA 1X4FA 2GW8A 1R89A 2W4CA 4OZLA 4X4OA 1F3VA 2WSCC 3CJBA 3SBTA 4BR5A 1Q18A 3ZZRA 4M5DB 2B5JA 3F73A 5JLFA 1Q4RA 3ICLA 3B8HA 4RW7B 4WKRA 4F02A 3EM1A 1EKSA 1T3VA 4MDBA 2GV9A 1JKHB 3IA0A 5KFTA 1X5PA 4CCHA 1VSLA 2EVZA 3R7SB 5K9FA 2K8GA 5IC4B 1U2RA 2IYGA 2WVEA 3A8JA 4RW9A 4L72B 5DDRC 2OZSA 2P1JA 3W2VA 3DXMA 4WCEQ 2W6LA 3OHRA 1RT5B 4ZHRA 4DU1A 1KD1T 4LF9F 2B4JA 2W9AA 1RA6A 1WI6A 3AOAA 3POTA 1U2VA 2KXNB 3QFUA 2P9NB 3K5LA 2X7IA 2IMWP 2QW9A 3AD8C 3SV3A 2BQUA 4PQAA 5AXKA 3Q8UA 1QY7A 4OI4A 3PR4A 2GO9A 1VQMN 1HNIB 4ZMMA 4ID5B 4DR1K 5HQLA 4ZA1A 4RBTA 3G86A 1LWEA 1KFDA 4HYKA 4QW8A 4I69A 2DR5A 3KOAA 3H1VX 3BP8A 2M8HA 4DHYA 4A4JA 5K8MA 3CPWR 4GKJK 1F5CA 3EZUA 1HQ2A 2YWHA 2HQFA 3M8ZA 1ICEB 3O2IA 5FRMA 4DV4K 2D3UA 4URQU 5AQMA 4R0JA 1M5HA 1MMDA 4C8LA 2LLZA 3FEXB 1AZSB 2NUUG 3LP1A 1Y7PA 1N33F 3ZT1A 1ZM4A 1KN6A 4RW4A 4ATNA 1X3MA 4LFBK 1FNOA 3A8KA 2F1FA 1YQHA 4H4OA 4LFCK 3DLGA 1NKEA 2FBXA 1RAJA 3MM9A 4M5GA 3V6JA 4JEPA 4EZ6A 2VDHA 3R7BB 3T7ZA 4HHTA 3Q7CA 1NDCA 1CS4A 1FVSA 4ZLPA 2HMPA 1T05B 4JBCA 4PKIA 1D09B 4D3GA 4O0IA 3G6XA 5EN1A 4MIAA 4GC7A 3BKTA 2ASDA 2OEJA 1PGZA 3UIQA 1Y10A 2VQEJ 3D7EO 3IR7B 4FN5A 5KI6A 4RWTA 4RZRA 4A8XA 2SXLA 4QR0A 5M1KA 4LR9A 4Q44A 2RU9A 3I5CA 3CJ8A 1QSLA 4PABA 3H46O 5D4LA 4LF6K 2P9IA 1HMVB 3PACA 1V3SA 1ELOA 4LQ3A 2GCFA 3AVLA 3PHEA 1RTDA 1XMOF 1BISA 2LSNA 4FS2A 1NBEB 1YSJA 1WC0A 4FYYB 3KK3B 4YOXA 2M7SA 8RUCA 2G0CA 3TUPA 2WTFA 1KNZA 4B3MF 3PW7A 1Q53A 3AXKA 1ZBTA 5AZJB 1QAJA 3HOSA 1RWUA 2Y0BB 2F7VA 1K8AO 2ZJQQ 1S0NA 2DNYA 1HNVB 4Z4GA 2NR0A 1R27B 2AEJA 4NYNA 3IR6B 4JI7K 4URSA 4DV0K 1RBAA 1ZZFA 2GHVC 1WG5A 2A1RA 2OSQA 4QWBA 1RT1A 1TFWA 2HW3A 4C97A 3EKSA 1KQKA 1MU2A 3ZTOA 3HOTA 1EWRA 3G71S 1QQCA 1V4SA 3OYIA 2IBKA 4L3QA 2LYVA 4HH1A 5GAHP 4U7UK 2CNKB 3UR3C 3EZ5A 4R5PB 4YOYA 3QIPA 2AMCB 2IPOB 3I5AA 1YK9A 2QGFB 2P9PB 5KOWA 4NL5A 2IDOA 4DX6A 4C4WA 4A8MP 4FLYA 4CZHA 1RBLA 4I1TA 3HHLC 4M3UA 3FZKA 2Q36A 1DURA 3HHKA 1OH7A 3DLLQ 1R31A 4Y6IA 1WI8A 3N6LA 1GTEA 2BW2A 3H5SA 3ZEUA 3L2QA 2FJDB 1EAYC 1FKAF 1WC3A 1UEUA 3OBYA 3LH2S 1J2VA 1N32J 3TTFA 3DLEB 2H5IB 2WB4A 2HIYA 1SJ4P 4I4BA 1YI2N 4BR2A 1REVB 2JHEA 1U8SA 3A12A 3NAEA 3KLHB 4HHHA 2D0AA 4BDZA 4KYZA 4ZCMA 2ZH9A 1M5VC 2DRBA 4M5IA 1Q82T 4DR7J 3NAHA 2JWNA 4NLQA 2E7WA 2C2KB 1VHIA 4WJBA 2UUTA 1NBWA 4FF3A 3IR5B 3PV8A 3DHWC 4OHVA 4DTOA 2IIRA 1VBXA 5KT3A 2GX9A 2LMIA 3R5GA 2HNYB 1S1VA 3V1RA 3CJ5A 3TAEA 4K59A 1X4CA 2CPEA 2DNLA 4GKJF 4DCHA 3JSMB 1ZPVA 2PEBA 3MOZA 4BACA 2IMOA 3HHLB 2IM3A 2K1RB 3O6WA 2FIUA 5DLGA 4DV4F 2F3JA 4DR6F 1YITN 2CQDA 3HRGA 3W0LA 1ITGA 1O13A 1REGX 3EO3A 3RVCA 2VG7B 1N4LA 1VQ5N 4DR3K 1XUPO 3D2FB 2OMLA 1NKBA 1A5WA 2XO6A 4CI6A 2KG0A 1FRIA 1IBMJ 4LFBF 4ZP6A 1QVFR 3KLEB 2X3DA 2GO8A 1VC6A 3OFHA 3EXYA 1IBKF 4IKFA 5BYRA 3D9BA 3V4IB 2CJXB 2UUAK 1VQON 1HYSA 3BH6B 4FJHA 1RHQB 3ISND 2BR0A 3QBXA 4FWLA 2PFUA 2DXEA 3M9OB 4ID8A 1PYSB 1S9GB 4DDFA 4DUZF 4HTLA 3P45B 3QETA 3KJVA 5JVGL 5FJ4A 2DNRA 4TYBA 2COLA 1BQMB 2J0SD 4P6QA 2GIFA 3GCWP 2FQQB 4NB4A 5BYSA 3MN7A 1RTIA 2CNNB 4W5OA 4Y2IA 2OD6A 4EZ9A 4AUKA 4K41A 4DU4A 3BSNA 4JI1F 3MAAA 2F8TA 4DXLA 3GFYA 3G87A 2RN2A 2YHBA 3KHGA 3T5LA 1YBAA 2J6TA 2AWZA 2NXJA 4Q43A 4LF6F 1UEVA 1AROP 2V67A 1XNQK 3ENVA 3SQ2A 5KT4A 1OY6A 1CXUA 3D1HA 5KOXA 1FX2A 3SK3A 4K2JA 4FW2A 4NO7A 1RT6B 3AVJA 2HZCA 3ZTPA 3DRPA 3C6UB 2OP5A 1P27B 2DY9A 5FPEA 1S0VA 4L8RB 4HUFA 2Z56B 5B8HA 4LF5K 5C24A 4OX8A 4DV1J 4LD0A 2FHKA 3M2RB 1N36J 3VEZA 2FC8A 4KGKA 1C0UA 2FVPA 2RF2A 2FB0A 3QT7A 1RWPB 4PWDB 2LXIA 3TABA 4WFBL 2EPIA 1H1VA 2XYHB 4JI7F 4DV0F 4MKAA 4MKBA 1WSRA 2R8JA 1B0VA 5ELZA 2B9YA 2C22A 2DIVA 4JI2J 2OHDA 4I2QA 2ZOGA 2XZDB 5L46A 1KOHA 4J90A 4DFKA 2RDIA 3N9UC 4CO0A 3A3PB 1L3TA 5D78A 4HR2A 2EC0A 3IC1A 1EQMA 4H4KA 1YJWS 1CJVA 4ZVFA 3I8BA 4A8KA 3TTCA 3UFCX 4Q0BA 1BHNA 2XMKA 4CTAA 4JS4A 1J53A 2J8AA 1C1AA 2ASMA 3VERA 2DIUA 4QPXA 2WSFC 2XMJA 2ATQA 2W2NP 3R97A 5A8KA 3O4NA 4AM7A 4KGMA 3MN5A 2B4PA 2B8QA 3FRZA 1QHAA 3PLAA 2MDAA 2QWMA 4KKOB 3SSRA 2XY7A 4RNFA 1S1XA 5AJ3K 4FLTA 2DH8A 3PW4A 1KKHA 4B08A 5CCMA 3LZJA 3VGKA 2LP4A 4WFAL 4F3QA 2CZVC 4J2AA 3JYTA 2F63A 2MZTA 2QA4S 2W1BA 2DNMA 5KG3A 3GDQA 2UV8A 3PM9A 3FE1A 2VG6A 5GAHI 3MPYA 4FWMA 2OFHX 1IH7A 2KQ2A 2NRZA 4HVJA 1WF1A 4CIGA 3VZHA 3HVWA 2ZH2A 3MM5B 2MQQA 3MM6A 1XIQA 2H48B 1Z1ZA 1IBLK 1VS3A 1M5KC 3KK1B 3W8PA 4F8RA 1ZBSA 1I5OB 3H42A 1S9FA 2E1CA 4O4GB 5A6PA 2HNDA 3NEKA 4NLTA 3G6VA 3TSUA 4W90B 1OIAA 4QAGA 2E5JA 2HEKA 4LVNP 3I9V9 1E6YA 2G1DA 4CJQA 2AGOA 3Q8QB 3MXIA 4EO8A 1RT4B 2IVOA 1T9UA 4BQLA 3QEIA 2E4LA 4OYMA 2BJDA 1VRUB 2G0JA 3QB0A 1TKTA 3MF5A 2ZKTA 3CDUA 2RE2A 1TGOA 3J80U 2BJ1A 1NZAA 4EBEA 4TY8B 3D45A 1QUPA 1KFSA 1R59O 3A5MC 2UUAF 1WACA 4YOEA 2P5OA 5KFDA 1XR5A 4NPOA 3T1HF 1UVNA 4FM1A 1FWPA 2QXFA 2JFDA 3H0PA 3QFHA 5DGBA 1NM1A 1TUWA 3VGUA 4CJ3A 2MYFA 4U95A 4BDPA 2DRAA 4NX9A 3ZCMA 1ZBLA 1NJIT 3EVMA 1YJ9N 1MA9B 3LPUA 3CCLS 1MG7A 4TQRA 3CJAA 1RTZA 5JS1A 1U1QA 3BDEA 1Z2LA 3GB0A 3H08A 4IG0A 2N82B 2HZAA 2HLUA 4NRUA 4C8YA 3R2CJ 2QC3A 3NGSA 3H2LA 2VZ9A 2OIHA 4DLEA 1FK9B 1KQGB 3IM8A 3PIOQ 4J7CA 4FVMA 1LK7A 1TL4A 2GNKA 4JI3J 4M5MA 2M8DB 2VBWA 4JI4K 2RS2A 4FZYA 3TA0A 3MM7A 4X4VA 2UVUA 3THVA 2JFKA 5D8HB 2IM0A 3K0SA 3OBWA 5EXWA 4NXNJ 2V6AA 2ZUAA 5ETOA 4DOZA 4K4TA 3PEJA 1BLUA 1XR7A 2D41A 1NPKA 2BW7A 9RUBA 1VQ4S 3CI5A 2UXBK 5E3QA 1X9JA 1OYEA 4KY3A 3AO2A 4DV3J 2R7WA 5HROB 4KTZA 5LM7E 2CDQA 3RU0A 5F2RA 1NDLA 1HNWJ 1VI7A 3WBZA 3IRXA 1KVIA 5E84A 2EC2A 1JXEA 3RRKA 3NF7A 1RAEB 5B0DA 4LRAA 4FLXA 3I9ZA 1R8PA 1NEEA 5JUMA 5AT1B 4Y0FA 1Q8BA 1RBOB 5KAKA 4FVCA 1SJQA 2KDOA 4FWNA 1HHTP 2IHR1 5C5JA 1MDUB 4DQQA 2A2DA 3L3CA 1F0XA 2CADA 3S3OA 2OTJN 1DTQB 4YOWA 3BQ1A 4ER8A 4LF4F 2FPHX 3W9JA 2BOPA 3HHLD 3E51A 5DG7A 4NLWA 4ICLA 1IUJA 4YFUA 4H5NA 4ZVHA 2W4PA 3G6EN 1OWXA 1RABB 5F3ZA 2DGVA 4USWA 4E98A 2ZZMA 2ROEA 3ATUA 3K57A 4FLWA 3VA0A 1RT3B 3AVFA 1IR0A 5KFVA 2CGKA 1RWNB 1GOAA 3ZNJ1 2CQIA 4BRIA 2CPXA 1BMQB 2RDJA 2E1ZA 2IJNA 1WF2A 3ZNUA 3WEEB 2C28A 2KT5A 4JI0F 3ZFVA 1T6CA 4X62K 4NLCA 5HMYA 3BYRA 2PMZD 1TL3A 1UTAA 5I3PA 2KYZA 1HBOA 4ILGB 2I8EA 1SC4B 2MQNA 4DR4F 2XSJB 1KTVA 3IBCB 2ZGZA 3I32A 3GFHA 1RHMB 2G8WA 1NGIA 5T7BA 2AW0A 5F9LA 1LWCB 1IBLF 5A8WB 4OI1A 3D6TB 1FKPA 3MR2A 3SJHA 3ZX2A 4UOGA 1RWVB 3CG7A 4AXJA 5CCLA 2VDIA 4PUOA 3DMJB 3ULEB 3OXGA 4LRFA 4ZTJA 5LJ5Y 2QRRA 5LL6Z 2HGLA 3NNHA 2W2PP 2R2TA 2XZWA 3UO0A 4CFAA 1IQTA 1EARA 1SQGA 2ADCA 3DXBA 5D15A 3P5JA 3CIZA 3F9MA 4PXDA 5FLXO 1SKRA 2VPZB 3OL6A 1RHKB 3S9HA 3SCXA 4HDGA 3LTOA 1N5TA 5CR4A 4HUEA 3QLHA 4LSLA 1MLAA 3W65A 1YIJS 4OKKA 1RLCL 3R6GB 5FIIA 3KUHA 1RE1B 2D4WA 2OPRA 3M32A 4DUYF 2CJYB 1NPRA 1BUXA 1TL7B 4RO0A 2OPSA 1YJUA 4BREA 1HPZA 1K44A 5L9NA 1U1OA 3L0QA 5IM0A 3K5PA 4GKKF 4IQMA 3SJJA 5LSRA 2NXUA 4IOAQ 3O8MA 1NK0A 2BM1A 3BZCA 3D3CJ 3TOQA 2QYGA 2E6MA 2GS8A 1IR1A 3OS2A 1SL0A 3BGLA 1YHQN 4E19A 3RB6A 3TR5A 2XBPA 2K3KA 4J91A 1GMVA 5HMZA 4B3SJ 3C66A 2HHPA 2FHJD 2QKKA 3FK4A 3UKUB 4X66K 2E2NA 2AGPA 2XB2D 4JV5J 4OX7A 4RU2A 1O0PA 1S7HA 3MWPA 1CVJA 2J7WA 4KHPK 3AJ2A 3J7YU 5G0RB 4AXIA 3AO4A 2VL1A 2L3MA 5KQDA 3A4TA 1BXNA 1VR6A 2BUPA 1K73O 2HVEA 1BC6A 2MZQA 1DZ5A 2BYCA 4QYZJ 2YKNB 4ZVUB 1BI4B 1HHQA 2YNIB 4AHUA 2M5YA 2Q1LA 3ZSQA 3CIMA 1RBRA 3C95A 5DDQC 4FOIA 5BR8K 1T11A 2AA4A 5LSLA 3I0RB 3WQUA 5DG9A 1YZ7A 3SQ4A 4LSNA 4L6V3 5M2RA 2UXBF 3T9ZA 4O3PA 1JLCA 1XMQJ 2QTDA 2JEFA 1JLQA 2OLWA 4DTRA 3QMQA 5CH7B 1URRA 3W5XA 1MN9A 1RCHA 2W24A 1NSQA 1XQSC 5AQHA 4RUAA 1B3TA 4LF9J 3QAUA 5FPDA 4HL9A 4M94A 1DAXA 2A40A 2CAJA 1RT2B 2HMIA 3E1YA 4FLVA 4DG1A 2KB2A 4BVOA 1EP4B 4R25A 1O5JA 3UD4P 5IOLA 4I6MA 1UP1A 4IWVA 5AQJA 1L3VA 2VH7A 1TFYA 2QMWA 4TU7A 1UVLA 1APSA 2MKJA 1U24A 3R8EA 1FTRA 1OJ4A 3PX4A 3M2VA 3MN6A 1KDNA 1RBTA 1N5YB 3N28A 2LQ9A 4DWIA 5FLXY 3EXCX 2PBDA 1SUQA 5FPMA 3Q86A 2AP6A 3MECB 4OZ3A 3SDEB 4FKYA 1UWBA 3CCMN 3E01B 3PYEA 4PCQA 3BY5A 2YQ1A 3M1VA 1T9TA 5AXMA 3OT9A 4QYRA 1HNZJ 1IWAA 2EKNA 4U9RA 1JLEB 2J6SA 3AVCA 4ID1A 4DV2K 3TNVA 2Q0RA 3EPGA 4FPAA 2DITA 2WC9A 3FZMA 5JICA 3TAPA 2HHHK 1RAGB 1WSJA 2W7PA 2P9GA 1N33J 3MN9A 2WW8A 3HLUA 2Z0GA 3O9UA 1EB0A 4L75A 4X62F 2N3LA 1HPMA 1SQFA 5AQPA 1KQFB 3RBDA 4M5DA 4U7BA 3M5RA 4RW7A 2WTUA 2QLFB 2VA2A 1JKHA 3JAMO 5EWGA 2VCPA 3EUNA 3DGPB 4YORA 2YHWA 3AOBA 3ILIA 2BJ8A 4OI2A 1RT5A 1PAEX 5HI7A 3CJKA 2C2DA 3LM2A 3OD2A 1UAWA 3OYGA 4CT8A 1T6DA 5LMNJ 1PCAA 2M3DA 4K4SA 1EQYA 1RNHA 3SBGA 2DKOB 3AARA 2ITMA 1E4FT 2P9NA 1CPZA 3QZ7A 3CJTA 1R0BG 5GMKa 2XLKA 5I3QA 3BGUA 4P73A 3EYZA 5JMNA 4CZFA 1KAXA 4DQSA 4MKYA 4C1NI 1HNIA 3CDWA 3ID8A 4ID5A 4I56A 1FF2A 3AH6A 4EFAC 1EKEA 3GYNA 3A8EA 3AAWB 1YJTA 3MMCB 3K9JA 4QIWD 5E7OB 4EYIB 4BRCA 2C3MA 5HBMB 4B3MJ 4KHYA 2RHKA 5M1PA 2NLWA 2CGJA 1YRTA 3PRVA 2DNZA 4X2BA 2AYBA 1OYDA 3QYYA 1HQUB 2QMXA 4IO9L 1Q5VA 1AZSA 3NGUA 3PSFA 4OPHA 2PAVA 2KL8A 4CHNA 1OH8A 3ZSXA 4FJLA 4WFYA 4RW6B 4E8UA 5HRSA 2K2PA 4JI5J 4B3RJ 3QAEA 5E3PA 1WHXA 1R7IA 1HNXJ 2KYXA 4AQYJ 3FMWA 2RSQA 1JCFA 1JL1A 1WB9A 5HMXA 4ED4A 2P51A 1NGCA 4KHPF 2BJEA 2UP1A 4W92B 4NLYA 4OPJA 3LDSA 2J9DE 1T05A 2ZC4A 3C14B 4YOVA 1VSFA 3UQSA 3CDAA 3AA9A 5D4NA 4OQJA 4PQUB 3W5YA 1VAZA 2IFXA 3IN5A 3CD5A 3CF5Q 1TL1A 2O4GA 4DSLA 2HRTA 1U6FA 5HANA 2ADBA 4CW7B 2MKCA 3IWXA 3ZZPA 4EHUA 5KFQA 3KG0A 4P2FA 4ELUA 3OW2M 2FBYA 2MZSA 1ASWA 5AQXA 3JAMY 5MLCV 4O3RA 1SJ1A 3BGOP 4CVNE 4ILLA 3TARA 4FSVA 3JTPA 3G6YA 4DQRA 3DDKA 1NHUA 1RTJA 3KK3A 3MCMA 2VGMA 4OZNA 5D4PA 1VRQC 4IDHA 1SL2A 4BDYA 1IBCB 3TJ8A 1VSEA 3I0SB 1NGJA 4ZS6A 5AZJA 1KCFA 2E66A 3EJMA 2RRNA 2I5JB 2CPYA 1HNVA 2V8PA 1ACMB 4BC2A 4HLBA 4B1WB 3TU5A 1M90T 5C42B 3GTYX 5H9FJ 3KHYA 2VU5A 1GOCA 2HQGA 4DR1J 2BMBA 1I94K 4CJPA 3M2UB 4QR1A 3W1YC 3GMGA 5AQFA 5KPRA 3UVJB 3W62A 5KPTA 3UCZP 5I42B 3LWMA 4UY8O 4GKJJ 1OQ3A 5J1NA 2DJWA 4GV9A 4LC9B 3PX0A 2QA4G 4LF7K 2NXNA 1Y9OA 1BA1A 4Y00A 1IKYB 4AL6A 3KD5E 3CCWA 2NSCA 4R5PA 4XIUA 3O4WA 3LO3A 4RR5A 3CCRS 2NUBA 2HHHF 4JD2A 3D0IE 3OTOK 1P8GA 3MR3A 3C16A 2HSEB 4Y3CA 4YEAA 4ETZA 2P9PA 3AA8A 1WOSA 4PWUA 1R8BA 4YQWA 1WD6A 3THWB 4LFBJ 1B4SA 4X4TA 3BBFA 4C3LA 1D9AA 4LFCJ 2KKZA 3LDPA 1EIYB 1S6PB 2IIHA 2ZH6A 1NO8A 4ZN1A 4BRGA 3DYAB 1QAXA 2LU1A 5EX0A 1R6YA 2XNQA 4M1KA 5D0RA 4DSEA 1XC9A 2NXEA 4CF2A 3S7RA 5D0GA 3NGIA 2HHQA 4R0EA 4CEFA 4WZMA 2NRRA 1M1HA 1REVA 3NBPB 5F8IA 3O08A 5GAEP 2LEAA 2X6SA 4B8AB 3MMAA 3KLHA 4GMKA 3G4SS 3AAPA 4GY2B 3QGHA 1Q16B 3NCRA 5AFUA 1JNZB 4LF6J 3ZZYA 1BHLA 5CZ1A 4DTSA 5BPNA 2YWGA 2XGPA 3C46A 3KNAA 2XHBA 3P6YC 4KPYA 2AX0A 4TU8A 5K20B 1MMLA 2LEBA 4YB7A 3GJSB 4PEOA 2DPNA 1XNRK 4NEYA 2BJ7A 2ASJA 4ZITA 4WU3A 1S9EB 3NNCA 4KREA 2K1RA 2H65B 2M88A 5IC6B 2CVEA 5L1JA 1CULB 4J9OA 1I3AA 4BROA 5AQOA 3MTKA 1KHWA 5C25B 3BEGB 2LQJA 2A6MA 5A2QU 3D2FA 1DJ0A 2C2RA 3CD0A 4P75A 4JI7J 1Z25A 4BRKA 3R27A 4DV0J 2RKIA 1VC5A 3CCJN 3KLEA 3K17A 2E5LF 3T1YK 1WSGA 2Z1HA 1D8YA 3V4IA 1NMEB 3UNYA 2HZVA 2Q97A 1IKVA 5KFYA 3J7AP 4DU7A 1S97A 2M52A 2Q6BA 4WTOB 3KLIB 3MEKA 5DJBA 2BTFA 1S99A 3DJCA 3ENWA 4IKAA 1LWFB 1FXLA 2ASYA 1S9GA 2JEJA 2Q3SA 4CJ5A 2MPUA 4F04B 3QRQA 4KI4A 4KH5A 2HIQA 5AFUH 2J8SA 1BQMA 2AU0A 4USJC 3AVMA 1UJ4A 4KHSA 2LVWA 3VWSA 5LXYA 2FVQA 4KRFA 5J2PA 4O3NA 4OJ1A 3GIMA 4CLYA 3WIUA 1XERA 2QTWA 3OTDA 3N4QA 1S1WB 3KG4A 5C7PA 5HMWA 3PW5A 4OKJA 4BC5A 1PJ7A 3AB4B 5HVHA 2R8IA 1G3OA 2VONA 2C2ZB 3KMSA 3FUYA 3PR5B 3SQGB 2AJQA 2RAQA 1AB8A 3NH0A 1VK8A 5JVHL 2LQ5A 2P6TA 4C11B 2KFYA 1NSPA 1SVDA 3GZ7A 3QWUA 4LUBA 1QTMA 2Z2MA 3C6UA 3AA5X 5HLFB 1UFKA 4RCHA 1HI8A 1VSHA 2DPIA 3M2RA 3Q2SC 1RWKB 2F9JA 2FXUA 2KLAA 3BO4A 2HB5A 1YF5L 1FDNA 2ETJA 3RUBL 4B3OB 4PWDA 5KRSA 2VG5B 3LPYA 3AA2A 4DR7K 3JB9k 4CLKA 4J2EA 1S48A 3QJJA 3BF4A 4PKDB 3AV9A 4ZIVA 2X74A 2MZJA 1I94F 2CZ4A 5BYQA 1KXPA 3FRYA 4HDHA 3WX4A 3MDFA 2ALZA 3WUHA 3JTNA 3ZSYA 3HHEA 3HHDA 2A2CA 1Q8LA 5LL6d 3O6QA 2BH1A 4AT1B 2HBRB 1QZ6A 1H72C 2LQBA 2EKYA 4C8NA 2HHXA 1ESVA 1JLGB 1I51B 4LF7F 4Q2LA 4O8UA 2KVIA 4IYQA 1VCTA 1CZ9A 1NGEA 1BQNA 1BG3A 3TUIC 1G7CB 3VQSA 4DR3J 1SB6A 1VQ6S 1OQ6A 3O8WA 3FSIA 1A7GE 4H0OA 2OGUA 2ZJPQ 2FLOA 3K8VA 3BN4A 1R0AB 1WSHA 3CCVN 4FP9A 4B9LA 1N5VA 2Q0UA 4MYUA 4ZPWR 4OHYA 2UUAJ 3BKUA 2JRSA 2PO4A 2XEXA 2WOMB 3QO9B 2OI2A 1XN9A 1RYRA 4ZTFA 4OX6A 2B6AB 2IYIA 2OEKA 3FGUA 4NA1A 2Z4PA 3CO9A 4CEOA 3PCOB 2O8BB 3KFWX 3SV4A 2G2ZA 3UD5A 2P8IA 4HWIA 4CO2A 3AVKA 2KJWA 3P4IA 4H0TB 3CQ8A 3MEGB 4JS5A 1YTUA 2Y1IA 5AQKA 3KD1E 1HWJA 4CJEA 4K7QA 2V52B 3L09A 1RDDA 3LGMA 3EPIA 3UKRB 4ZP9A 2KHDA 1RP5A 3OXFA 2DO0A 3J7AN 2MHNA 5KFPA 5AQRA 3FLCO 4FJ7A 1ZM9A 3AY0A 5KFHA 1XNQJ 2DHXA 3VPZA 2D3ZA 4KO0A 3KK1A 1GFWB 2YWWA 3HFKA 4CQ1A 4O4GA 4FW1A 1AFIA 4CO4A 2HOEA 3A5NC 4IRKA 5F1XA 4ECSA 1XNRF 4LBIA 1RSCA 3QEWA 4KFBB 4AE5A 3CSKA 3K2YA 2V69A 4LF5J 2X1BA 2C1EB 2YBVA 4CFCA 3LPEA 3QT8A 2PZSA 1RT4A 2OFGX 2G1HA 4CLLA 2VPWB 4AYBD 2EK1A 4OO1J 4ZCIA 1W0HA 4G6VB 1PC4A 5GAEI 1VRUA 2EG2A 3WHIA 4QPTA 3N4WA 1VRTB 1H7XA 3L4IA 1OMSA 2BRLA 4ECZA 4PG6A 1TUYA 1GT8A 1Q7YT 4TY8A 1DRZA 3QJLA 2BABA 4B9VA 3NGDA 4ZVGA 1NHKL 1NWKA 3A8IA 3J7ZO 5KT6A 2YJFA 2RRBA 2D69A 3OYFA 4JK8A 2GIQA 3OBIA 2OPQA 3WQTA 4OI3A 5I9EB 2P5VA 3CQYA 1N48A 2RQ4A 2E20A 2QN6B 1TMJA 4C98A 1UEKA 2FSNA 5GMDA 1VQPS 2CQHA 3N0VA 4ZVTB 1GLCG 2PGCA 1FRXA 3EEQA 5E5NA 1RADB 2CQ4A 1KLNA 2DCUB 3MI7X 1RDAA 5D6GA 5IZHA 5CQGA 2YKPA 1C4CA 2XMMA 3V9WA 3TJ9A 2ZJRQ 1FK9A 3LANA 2NYIA 1K9MT 3DU6A 4NMXA 2G4BA 2F40A 5AJ3J 1J5EJ 6AT1B 1CJTB 2MZ1A 1QHTA 2HF3A 4PPZA 1V9OA 5ETRA 2UXCK 4KV8B 2F8MA 1VDHA 4XDDA 3GFXA 4E1NA 2VC0A 3QSYB 1YJNN 1NDPA 3MD1A 1GAOA 2OTLS 4HHJA 2GVZB 4ZDNA 4DR7F 3D1QA 3PFEA 5T7LB 2ZM6K 4RW8A 3SQ0A 1HR0K 5C15A 2FVSA 2JC0A 3I82A 1BCMA 3L4BC 4CEZA 2CVIA 2AP1A 3HP6A 2YKQA 2OMOA 1NK9A 3D2EA 3WXMB 2J9CA 2Z58B 4K0KJ 5E26A 3VAKA 3M7VA 3Q83A 2XS2A 3KTQA 3EE8A 2HSTA 2VFTA 4AILC 2YX6A 4TLRA 4KTWA 4RUHA 4LBHA 4FJMA 3WX8A 2Z2ZA 3FZHA 4PG7A 4YDXA 2OKQA 5FD1A 5T14A 3BZQA 3HMJG 5HJXA 2LA4A 1BU6O 1BGXT 1DTQA 2AZ3A 1GMUA 4OZ0A 3O5BA 2ZFHA 2BE2A 1ASUA 4CH1A 2R4FA 3BKFA 1FD2A 1YG0A 4O8KA 2EW9A 3M6XA 3QESA 1VJWA 3K89A 3OV7A 1IV0A 1N8RT 4DTJA 1VC0A 3CVKA 4JHDA 4OZ1A 1ATRA 3GFZA 8ATCB 4P10A 2JDJA 3QPIA 1RT3A 3MCOA 3AJ1A 3L2RA 4FLUA 1WKJA 1X4HA 1VLOA 4EYHB 2HNZB 4CECA 1U26A 4FKXA 1P1LA 1AUDA 1VJQA 3VQ5A 5AQQA 3FSYA 1DLOA 1U1KA 2EFQA 3NCPA 3RMCA 3VAFA 2XSJA 3EDRB 3PO5A 1LOUA 5DRKA 3O44A 3OLAA 3DLRA 3ZSWA 1FXRA 3T6BA 1RCXB 5KFEA 3NH1A 3RB3A 5A8WA 5BJRA 4USUA 2GBZA 1GX5A 2G8UA 3AA4A 3N6NA 4JI3K 3K7RA 1RI7A 3B4MA 4BHQA 4JI4J 2D1KA 4G1IA 3KLFA 1RWWB 2OSRA 3U9ZA 4FPBA 2AZ1A 2GIRA 3DMJA 3ULEA 1SC6A 5C0YA 4JKHA 2EEYA 4DU3A 1B0PA 4JV1A 4FOE