3M8PA

Hiv-1 rt with nnrti tmc-125
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
555
structure length
551
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of piperidin-4-yl-aminopyrimidines as HIV-1 reverse transcriptase inhibitors. N-benzyl derivatives with broad potency against resistant mutant viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 162
structure length 551
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3m8pA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8pA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8pA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8pA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3m8pA05
4Y2AA 2Q3SA 1IKWB 5HRRA 1BISA 3SQ1A 4E0DA 1VSKA 2FJVA 4O4GA 5F8JA 1NHVA 1C1BB 4WE1A 3TAMA 1TV6A 1N5YA 4IH7A 4FZXC 3L2VA 4RW4B 4NLOA 1TK0A 2HNYB 2JC1A 1RBTA 3ZCMA 3OS0A 1GOBA 2G8FA 5DGBA 2R7YA 1J53A 1RTDB 3PZPA 5F8HA 2R2TA 1S1UA 3KLGB 1NJZA 2DFHA 3H5SA 4OKKA 2A1RA 1HJRA 4EP5A 3LPUA 3H5YA 4HVJA 4M3ZA 4TQRA 3HPOA 3RBEA 3L2RA 1QSLA 1Q8IA 1HNVB 2HAIA 4AHUA 3AVLA 3I5AA 4TQSA 4XIUA 1HYVA 1S1VA 1VSEA 3RMAA 3MEDA 2E6MA 4F4KA 4IFVA 1WLJA 1HMVA 3MEGB 1CLQA 4CIEA 2V4QA 1KTQA 2IC3A 3OLAA 4CJWA 3IS9A 4IFYA 4G1QB 1EETB 4KRFA 5HROA 3SZ2A 4E3SA 3BQ0A 4FYDA 4NLWA 3CG7A 1NOYA 1GOCA 3RR7A 1REVB 1EKEA 1S6PB 1S97A 1MMLA 4ZMMA 1NK4A 4ZP7A 5K14A 3KMSA 2R2RA 4RW8B 1IKXA 3KK2B 1XHXA 4DTNA 5KFJA 3DRSA 4E7JA 1QSYA 1EP4B 2BDPA 4CGIA 4FJIA 4JV1A 4ZP9A 1N6QB 4KFBB 2QE5A 2WRMA 3NF7A 3S3MA 4HYKA 4EBCA 2B6AB 3F73A 3KK1A 4MK8A 2KZMA 3AO1A 4URSA 2YNHB 5KG4A 4EYHB 3H2LA 5FDLA 5HRSA 4HUEA 5CZ1A 3CFOA 2B5JB 4AHSA 4B9VA 3CM6A 4B9SA 3TVKA 4DL7A 2VWKA 2ATLA 4RNOA 5KG1A 4TN2A 4C8OA 2HVIA 2BQUA 3KTQA 3NH0A 4J9MA 3NHGA 4FXDA 4DU3A 1RDCA 1XR7A 2G8WA 2WHOA 4OGEA 5DQIA 4Q0BA 3PX4A 4B8AB 2VG6A 5HBMA 3T5KA 4EZ6A 2R2UA 4M3RA 4J2AA 2LSNA 4PA1A 4DQQA 2P1JA 4OKEA 4M3XA 4ECWA 4YFUA 1RT4B 3LP0B 4HUFA 4NLSA 4R8UA 1JLEB 2UUTA 1U09A 3MXJA 4WXWA 4CJLA 4B9TA 5KG6A 2D0CA 2W7PA 1FKPB 1NK6A 5KFTA 5DG8A 3KHHA 5FRNA 3GILA 5D3GB 4J2EA 3ZSVA 1HNIB 3ULDA 4E1NA 3SNNA 3NGDA 3I0RA 1SL1A 3DLEB 3GV5B 3GQCA 4ELTA 4DL5A 4CIGA 4FJNA 3OYEA 4KREA 3Q8RB 4LQ9A 1HQUB 4OL8A 1TKZB 2FJXA 3NCIA 2W9AA 1JLCB 5KFMA 3M9MB 2FVPA 2WONB 2GC8A 3G6YA 1D9DA 3G6VA 5DQGA 2I5JB 2PYLA 2ZD1B 2XGQA 5JXSA 2C28A 3L8BA 3HJFA 3AA5X 3T5HA 2VWJA 4O3QA 1T05A 2G8IA 2HNDA 2GBZA 5JUMA 3H4DA 4KHRA 4EP4A 4F4XA 3CVKA 4TY8B 4JLHA 2R8KA 3VA0A 3K59A 4WXOA 2VA2A 4E7KA 4LSLB 2C2EA 1OS5A 1L3SA 1TV6B 1Z26A 3VQ6A 1TQLA 2RDIA 2J6TA 3LP2A 1TL3A 4E7IA 4FJ5A 4ICLA 4DU4A 4GW6A 3ISND 3CJ2A 3KHGA 4U7CA 1Z25A 1S1UB 3G86A 2HHWA 1K6YA 4Y1CA 1BL3A 3ZT4A 4F8RA 4B9MA 4FM1A 1D0EA 1RTIA 4Z0UA 4MKBA 3IN5A 3QINA 1SUQA 1BGXT 1TKXA 1K1SA 1UWBA 3CJ4A 4ED8A 5J2NA 4DQSA 1HMVB 2JEIA 3GV8B 4Y1DA 3DM2A 1XC9A 2OPQA 2JEFA 3PW2A 2XO7A 5KT2A 3AO5A 4H4OA 4AHCA 4NLVA 1LW2A 4EYIB 4WFYA 4MFBA 4I7FB 5KFHA 4ECYA 2Z1GA 1KLMB 3OJUA 3V4IA 1U48A 4CE9A 1FKOA 4B8CA 4Q44A 1HPZA 3GIMA 4K50A 2ITGA 4YP3A 5CYMA 2IAJB 1JIHA 1SH3A 2V0NA 4CJKA 4IRKA 2HHSA 4YR3A 3D45A 1LV5A 3VA3A 3KK1B 1IM4A 4OLBA 1VRUA 5FDLB 4EZ9A 2HHUA 1Q9YA 3HVWA 2BANA 4ELVA 3AVCA 4QOZB 4CEFA 2DFFA 3CWJA 2R8JA 1C1CA 3E01A 4CJPA 1ZTWA 4DTMA 3OYAA 4N5SA 1YTAA 3VQEA 4WFZA 2X6SA 3H40A 3CJ5A 4DTPA 1QSSA 2VG6B 1RILA 3OYGA 5HBMB 4H54A 2AWZA 3BSOA 3QNNA 4NCGA 1NOZA 1TK5A 3NGYA 3DLKA 2PY5A 2GIQA 5C25B 4EBEA 3ZSOA 3JSMB 3D0PA 2J6SA 3CM5A 1LW0B 2QV6A 1IKVA 4KO0A 1QUVA 3ZT2A 4MIAA 4CJSA 1S6QA 3M8SA 1J54A 4DS5A 4KB7A 3HT3A 2FLLA 3SFUA 2I1RA 1ZYQA 4B3OB 3BREA 3L3UA 1IG9A 3QGHA 3SI8A 3KJVA 2P51A 4DFJA 4O3RA 3UDLA 3S3NA 1HRHA 5KG7A 3ISNC 1RDDA 5L9XA 4ID5A 5L1KA 2Z1HA 1JL1A 4CJQA 3QETA 4PY5A 4F3TA 1RAJA 1L3TA 1K1QA 4FW1A 3SUPA 4H8KA 4DTRA 5HRNA 1SL0A 2IM3A 3M9OB 4DSLA 1DTQA 1JLGA 3RB0A 1HARA 1JLBA 5CYQA 3TR8A 4CEBA 3SI6A 2ZQBA 1RTHB 3QEVA 3AA3A 3AVKA 3QEIA 2XI3A 2OH2A 1NK9A 4GC7A 4AH9A 5J2MA 3HM9A 1QHTA 2Z1IA 3NL0A 5EWGA 4K4ZA 3HVRA 1C0UA 5KG0A 3UPFA 3I5BA 4J9PA 4ED6A 2IJFA 1BCMA 4AILC 4F50A 3OYCA 4DSEA 4FLWA 3MXIA 3QLHA 4U6PA 4DQIA 4IH5A 3ICLA 3LP2B 4BDPA 1TL3B 3RWUA 4ICLB 3KLEB 2RDJA 1RTJA 3ITHA 3QIOA 4K4TA 3B6OA 5KFWA 3UIQA 5KFDA 1ZBFA 1SUQB 2WCXA 3L2QA 3OL7A 3V6JA 3AVFA 3EPGA 3Q8QB 3QERA 1TKXB 4FJ9A 1UWBB 2G8VA 3PHEA 3TAFA 3IG1A 1YT3A 3VQ4A 2ILYA 1XR6A 3GIKA 4PQUB 2PYJA 3OYBA 2XI2A 1NJWA 3DM2B 4IDKA 2XCAA 3VN5A 1S9EA 3VQCA 3PJWA 2D3ZA 5KFAA 2R8HA 4URQU 3K5NA 4I9LA 4RUCA 1TAQA 3WNEA 1LW2B 4EO8A 2FVSA 4FJJA 4CHQA 5C24A 2QKKA 2ALZA 3JYTA 3C6TB 1JLFA 4IG3A 3BGRA 2HMIA 4KKOB 1RA7A 4XO0A 3V4IB 1JXEA 1X9MA 2B4JA 3KK3A 1FKOB 4IR9A 2C2RA 4IG0B 1VSLA 3PUFA 1J5OA 4FBTA 1HPZB 1GOAA 5KFNA 3O3FA 4FJMA 3RBDA 3ZSQA 5J2QA 2OPRA 3OSNA 4KI6A 4RW6B 3AVJA 2W8LA 3OYLA 1VSIA 3PX6A 4ZHRA 4O3OA 4KTQA 4FZZA 1SL2A 2AU0A 1GX6A 4DF8A 1I3AA 3AVGA 1T8EA 3AVNA 1WSFA 2RKIA 3QEWA 2BRLA 1SV5A 1NKBA 3KLHB 1DLOA 2KTQA 3M8QA 4HUGA 1T03B 4BE2A 3MXMA 5JS2A 3U3YA 2BR0A 1JX4A 2D5RA 3NH2A 2C2DA 1LWEB 4DL6A 4CF2A 1S1WB 3HPHA 1Q9XA 3DI6B 4B9LA 4I2QB 4F4YA 1LWCB 3WNGA 4FJXA 3LPTA 4FLYA 4XPEA 3H98A 3F9KA 3HVTA 3IGNA 4NCGB 4YQWA 2R2SA 2HHXA 2HB5A 1S5JA 2OZMA 2YKMA 2JEJA 4GVMA 4CHOA 4O3SA 4E7LA 3U6FA 4CGDA 4KTZA 3PVXA 1N56A 4ECQA 3NGIA 1IKVB 4KO0B 4FM2A 3EYZA 3VQQA 2CJQA 5KGWA 2OPSA 1JKHA 3S3OA 1TGOA 1SKWA 4ZP6A 3DRRA 2GIRA 3AVAA 3OYJA 1NKCA 4NLUA 1CZBA 1B92A 3NDKA 4H4MA 2F96A 3P1GA 3MR5A 4CK1A 3MEEB 4K8ZA 4AHTA 5CY4A 4M41A 1LWFB 1TVRB 1HQEA 2DPIA 1JLQA 4ECZA 3KLFB 4N41A 1JLBB 5CYQB 3MFIA 4HHTA 1S0OA 4FS1A 4JRQA 2W9BB 3M8RA 2OZSA 2D41A 1R0AB 3TAEA 3V9SA 3DMJA 3V81B 2RN2A 4EBDA 2YNFA 5SWMA 1L3UA 3IRXB 3QIPA 3LALA 1CZ9A 4J2DA 1YTUA 1RYSA 1SH0A 4QWCA 3DRPB 1N4LA 4JUZA 3NGZA 1S9GB 4NYFA 3AA4A 5I42B 4JV0A 3NF9A 2YNGA 4IOBA 2OPPA 4NLTA 4CHPA 3NAEA 2AJQA 1A5XA 2VG7B 4CGGA 5F8IA 3OYMA 3KMQA 1QE1A 4KHSA 1RTJB 4FLZA 4Y3CA 2WOMB 3ITHB 2YKNA 2G8HA 2QXFA 2AGQA 4PWDB 3SV4A 1U04A 4CK2A 1QTMA 2F8TA 1U47A 3DYAA 3VQ8A 5KRSA 5C42A 1FK9A 3QO9A 3MR6A 3DLGA 1ITGA 3BDPA 4C8KA 1QS4A 3BQ1A 3IG1B 4RW9A 4URGA 2YHAA 1D9FA 4FJLA 1RBSA 4FS2A 1GX5A 1Z4UA 2O4GA 4IDKB 3A2FA 1WAJA 3TWHA 3HP9A 4NLGA 1ZTTA 1S4FA 4KTWA 3AO2A 2FVCA 4NZ0A 5KFYA 5EWFA 4LD0A 4IG3B 4CFBA 3OY9A 5DG9A 4LH4A 1S1TB 3CYMA 3D5MA 2HMIB 1DTTB 4FZYA 4OVLA 1D8YA 3ZSWA 3OL8A 3QYYA 2W9CB 2JLEA 1CXQA 4DG1A 1BQMA 4ECRA 4CEAA 4NLPA 1KVCA 5F8GA 2OPRB 3OSPA 4DLGA 4TY9A 3RRGA 3ASMA 3DOLA 4CF9A 1RT1B 1TKTA 3M8PA 1RT3B 5JS1A 1KLNA 2ZE2A 1JLAA 3VQAA 5T7BA 3P5JA 4I2PA 4FJHA 4FLUA 4O4GB 3CDWA 3KHRA 3M8QB 4ID1A 4WE1B 3TAMB 1N5YB 4KB1A 4O4RA 2JGUA 4KAZA 5HP1A 3SCXA 3SV3A 3KLVA 1IH7A 3PY8A 3HK2A 5KGXA 4ZVHA 1W0HA 5SZTA 2IM0A 3I5CA 1WSGA 4W5QA 1BIZA 5HLFA 1VSMA 4NYZA 3LAMA 4MH8A 2XCPA 4M3TA 1JXBA 3GIIA 1W9HA 2FBXA 3KKRA 2FLNA 4CFCA 4CJVA 3L2WA 3HKWA 3DLRA 3VQ5A 3TI0A 3CFPA 4WZQA 2IMWP 5KFXA 2AQ4A 2BQ3A 1S1VB 3MEDB 4IFVB 1QAIA 2JEGA 4KV8A 1BQNA 3BSNA 4FCYA 2IC3B 3IS9B 4IFYB 2D7SA 2D0AA 5HROB 1YVUA 4CJUA 2B43A 4TXSA 3OYKA 2XHBA 4IH6A 4QWDA 3AVMA 1RT7A 4CEEA 2ASDA 4H4MB 4UQGA 4L8RB 2ETJA 4LSNA 5K14B 1C0TA 3V9UA 1IKXB 5KFSA 3MECA 3PW4A 5KTQA 3DRSB 2F8SA 4KHYA 1HQEB 1KFSA 2DPJA 1JLQB 3RR8A 5FRMA 3PW0A 4Z4FA 3FFIA 3KLIA 2IDOA 1KHVA 1RCHA 3L2UA 3ZT1A 4J9NA 3SJJA 2W8KA 2R8GA 2P5OA 5KI6A 4KPYA 3BQ2A 2VA3A 2YNFB 2XRIA 2HNZA 3H5UA 2IM1A 4ZVFA 1CSJA 3K5LA 2BE2A 4J9OA 2V4RA 1X9WA 4JS4A 2IS3A 2RPIA 2D3UA 3S9HA 2XY5A 5KFOA 3QEPA 3SPYA 4GMJB 4FJKA 2NUBA 3MR2A 4Q0BB 1IKWA 5DLGA 3I8DA 4RNHA 4RNFA 1C1BA 3HYFA 2HHVA 1QE1B 3K2PA 4RW4A 2YKNB 3EZUA 3N6MA 4Z4EA 4DL2A 2X78A 3SYZA 3FSIA 1RBRA 4R8UB 4QW8A 2KW4A 4OPJA 1TAUA 3LANA 4NRTA 3P83D 1SKSA 4DSKA 4K4UA 3N6NA 3U3GA 4CHZA 5KFLA 1S0MA 4DF4A 3I0RB 5KG3A 3CJ0A 1RYRA 3MEGA 4YMEA 3UR0A 1UA0A 4M3YA 1RBVA 4DTXA 4G1QA 1EETA 4ZTFA 3KNAA 1VSDA 2W7OA 4Q8EA 1UA1A 4QWBA 4YR0A 4ZPBA 5C5JA 4FJGA 1O1WA 1REVA 3CJ3A 3H08A 3NAHA 4DLEA 2XY7A 5KFZA 4KI4A 2X6NA 4YNQA 2ILZA 1XWLA 3T19A 1VSFA 4RW8A 3BJYA 3PV8A 3SUNA 3IAYA 2E6LA 3WNFA 3WNHA 2UVRA 3NH1A 3CIZA 4KHMA 1EP4A 3DOKA 4IRDA 4J9SA 1T05B 2HNDB 3OHBA 3DOLB 1N6QA 3I0SA 4KFBA 4B08A 3OLBA 1TKTB 2UVVA 2KZZA 2B6AA 1XI1A 4CF0A 2ZE2B 1JLAB 4DSJA 2O4IA 2YNHA 3LDSA 4FBUA 3OS2A 4O55A 4RG8A 5E41A 4WZMA 2OYQA 1S1XA 3V9XA 1IKYA 1ZBUA 3ALYA 4CECA 2HW3A 5KT3A 1RNHA 2KFNA 5FROA 3NF8A 4F3OA 3OYHA 4ZTJA 4J9QA 4CHNA 3AO4A 1NK8A 4HCBA 5I3UA 3SQ2A 1RTIB 4NLXA 4K4VA 4EO6A 3RMCA 1RDBA 5EWEA 3ZSYA 3QEXA 1WAFA 5J2NB 5KFPA 3QIDA 4DTOA 1RT4A 3LP0A 3K57A 4KV8B 2YHBA 5CZ2A 3VQDA 1JLEA 3RB4A 3RMDA 3RMBA 2OPQB 4QWEA 1A5VA 3RRHA 1NK7A 3V9ZA 4KSEB 4BE0A 5KFBA 3Q8SB 4H4OB 4WYLA 2V9WA 4R5PA 1RT7B 4WYWA 3V1RA 4NCBA 1FKPA 4MFBB 1XR5A 3RB3A 5D3GA 1KVBA 1C0TB 2E9RX 3C6UA 4DFKA 3ZSXA 2IA6A 3FQLA 1RDAA 1C2PA 3SUOA 4ZPCA 4CJRA 5CYMB 1S9FA 3LZJA 5DLFA 1ZETA 1HQUA 4RW7A 1TKZA 3PX0A 4CGJA 4MQ3A 2WONA 1WNEA 4YR2A 5J2PA 2FVRA 2X74A 4DU1A 1VRUB 4O0IA 1IO2A 2BGGA 4Q5VA 2BANB 5F8LA 2ZD1A 4CEOA 4ZVGA 2QK9A 3LP3A 1FXXA 3V6DA 1U4BA 3TAGA 4IR1A 3OJSA 3O4QA 4O3NA 1BI4A 5KFEA 4AHRA 1C1CB 3E01B 2EC0A 4PUOA 1TL1A 3IGVA 4TY8A 5KFRA 3HHKA 5J1EA 4K4XA 1TK8A 5F9NA 3RAQA 3KKSA 1VRTA 4LSLA 1ZBLA 4DTJA 3V6KA 4E7HA 3UQSA 1NK0A 2XWYA 5F8NA 4CGFA 2GUIA 2IBKA 3DLKB 4FJ8A 4LQ3A 3AO3A 4DTUA 2HHTA 4Q43A 4QW9A 3ZT3A 3H59A 3OVNA 4MKAA 3MTKA 3PR5B 2XGPA 4CEZA 4FW2A 4IKFA 4N76A 2IJNA 4E1MA 4W5NA 4KHQA 2WK4A 4F2SA 4AHVA 1S6QB 4ED1A 2AGOA 3TAPA 3KOAA 1KVAA 1RBUA 3G0ZA 3KJVB 3CDEA 1Y97A 3N6LA 2ATQA 2UUWA 1ZBIA 4BDYA 1RA6A 5F8MA 1L3VA 4ID5B 4ZVEA 4DL4A 3OYIA 1NHUA 4Q45A 4CESA 2FC0A 4M45A 1VSJA 4ELUA 1KCFA 2FBTA 3SPZA 4O44A 4N47A 1DTQB 3LAKA 1JLGB 4I7FA 5KT7A 3SQ0A 4FLXA 3QZ8A 2BRKA 2AGPA 4NRUA 5KT5A 1KLMA 3CFRA 2ASJA 1MU2A 3LP1A 5J2MB 3DOKB 3GV7B 3ZT0A 3MR3A 4LH5A 4CEQA 1T94A 2IAJA 4Z4IA 3I0SB 3M9NB 1C0UB 2W42A 4DQRA 3RAXA 3KD5E 2P5GA 4OJRA 4O0JA 1WSIA 1W25A 4WFXA 4Y2CA 2EHGA 4NLRA 4M3WA 4CJEA 3EY1A 2XY8A 3QLHB 1JXLA 3VQBA 4MK9A 1S1XB 1IKYB 4CJTA 3PW7A 2EX3A 4K8XA 4BWMA 1KSPA 3NFAA 4NCAA 4ED2A 3TABA 3CDUA 1ZBHA 4JRPA 3PO5A 3L3VA 2F8EX 1I6JA 3TARA 5I3UB 4DSFA 3O3GA 2VG5A 1S0NA 4CJ3A 4CERA 1RT6A 3OYDA 2IGIA 4KAIA 4J9KA 4FK4A 4JS5A 5C25A 4MIBA 5KFGA 4K4YA 4FLTA 3JSMA 2PZSA 1S9EB 3OL9A 1UOCA 3FRZA 3BSCA 1LW0A 2IM2A 2KFZA 4ECTA 5KFFA 4KHWA 5DQHA 5L1LA 4IKAA 4R5PB 2XY6A 5C24B 3JYTB 4QWAA 4M94A 4NYNA 4OLAA 1JLFB 3BGRB 3DDKA 4B3OA 1RDRA 3NE6A 4CIFA 3C6UB 3Q8PB 3KK3B 4DMNA 1J5OB 4XPCA 4BACA 4CJ5A 2Y1IA 5KFVA 4ED3A 5J2QB 4I9QA 5L1JA 2G8UA 4RW7B 4E89A 3KD1E 2RF2A 3OHAA 4ZHRB 1TKDA 1BHLA 5J2PB 3NBPA 2G8KA 4DTSA 2Z1JA 4NLDA 2RKIB 1RTHA 1N48A 3NAIA 3V6HA 1SV5B 4ED7A 3SQ4A 2HVHA 4ECVA 3V6DB 1DLOB 1KHWA 1C1AA 1BI4B 3T5LA 3AVBA 4QPXA 4TLRA 3PJXA 3CQ8A 4PUOB 2FLPA 1TL1B 4MK7A 4M95A 4CF8A 2UVUA 1HYSA 5J1EB 4NLQA 3QZ7A 3HSTB 1B9DA 1VRTB 4KE5A 2FVQA 1XHZA 5T14A 3HVTB 4HTUA 3V9WA 4E19A 2JC0A 2YKMB 3HP6A 3KLEA 1C6VA 4DQPA 3OS1A 1VSHA 4DSIA 2D0BA 4N56A 1X1PA 4IRCA 2OPSB 3EPIA 4M42A 1JKHB 1UAXA 1S10A 3DRRB 1L5UA 5KG2A 1WSEA 5HRPA 1D1UA 2XC9A 1ASUA 4LY7A 3NKYA 3BSAA 3DLHA 2BQRA 4M3UA 1RT5A 4F4ZA 1JL2A 4BE1A 3LZIA 5KFUA 4PQUA 3AVHA 3GYNA 4KHUA 4CFDA 2E4LA 2O5DA 3HL8A 5KFQA 3G10A 1F21A 3EZ5A 4O44B 4DEZA 3PR4A 3C6TA 5DGAA 3AV9A 4KKOA 4OPKA 4CEDA 2AX0A 2Y1JA 4IG0A 1MU2B 2YNIA 1B9FA 3DMJB 3LP1B 5F9LA 3KIOA 3V1OA 3QIPB 4B9NA 4X2BA 4ZPAA 4RW6A 3MF5A 3H5XA 1SKRA 1S48A 1RT2A 1T3NA 4CJ4A 3QESA 4KB0A 2YNGB 2OPPB 2FJWA 1D5AA 3MFHA 5DK5A 2KQ2A 3BR9A 1ASVA 1LAWA 3OL6A 4DFPA 3KLHA 4FK2A 4Y34A 2AX1A 3T3FA 1T03A 3RTVA 3H4BA 4CCHA 4TSXA 3K5OA 4RU9A 5EDWA 2HNYA 1LWEA 2UVWA 4NLYA 1S1WA 1SH2A 3SUQA 4F2RA 3DI6A 4I2QA 3ZSRA 4BDZA 1LWCA 3GIJA 1RTDA 2VG5B 4KBIA 3DYAB 3HXMA 3KLGA 5C42B 1FK9B 3QO9B 1A5WA 4CF1A 1BIUA 2GV9A 4HCCA 1NKEA 3DLGB 4RNMA 4CFAA 3C94A 1RT6B 4RW9B 5KG5A 4IQXA 1U45A 5EUHA 1HNVA 1EX4A 2A1SA 1QAJA 5EU7A 3O3HA 4G3IA 3HVAA 4W5OA 1VK0A 1BCOA 4C8LA 4C8NA 3OYFA 4R0EA 4TYBA 4OGCA 4CGHA 4ZP8A 3DLBA 2R8IA 4F4WA 4FVMA 1S6PA 3VQPA 1KRPA 1NJXA 3E51A 4DG1B 3KK2A 2HWIA 1BQMB 3T1AA 3MEEA 4W5RA 4GC6A 1I39A 1HYZA 4DWIA 3V1QA 2HWHA 1LWFA 2FBVA 1TVRA 4TYAA 4Z4HA 1NJYA 5DG7A 2RF2B 3TQ1A 2DY4A 1C0MA 4CHYA 5KFIA 4B9UA 3PW5A 3KLFA 3NF6A 3NBPB 2OA8A 4BWJA 2J6UA 1NK5A 5KFKA 3M8PB 3QGGA 2E9TA 2W9BA 5KFCA 3T5JA 1R0AA 4O3PA 4I2PB 4ECSA 4J2BA 3V81A 4RUAA 4DFMA 4FLVA 2B5JA 2WB4A 3IRXA 5HP1B 3PO4A 1WN7A 3RB6A 4C8MA 1WSHA 3DRPA 3LWLA 1HYSB 3VQSA 1S9GA 5DMRA 3VQ9A 4Z4CA 3FDSA 4DS4A 5HLFB 4ECXA 5I42A 1EXQA 2IOCA 1ASWA 1NNDA 4CJFA 4RZRA 3ZSZA 3D28A 4J9LA 2ASLA 2DTUA 4HKQA 3AA2A 2FBYA 1S49A 2VG7A 1CXUA 3HO1A 4ZPDA 4Q8FA 3B6PA 3LWMA 3MAQA 1G15A 4RNNA 2WOMA 4FK0A 1U49A 3NMAA 2C22A 1BQNB 4PWDA 1QQCA 2YV0X 2QKBA 2CKWA 5KT4A 1TP7A 3C95A 4FJ7A 3OYNA 4IBNA 1WSJA 4OKJA 2DFEA 2E9ZA 4DL3A 3QNOA 4KHNA 3AVIA 1RT5B 4LSNB 3VQ7A 1HNIA 3MECB 1T7PA 3SFGA 4K4WA 3FQKA 4CK3A 1YVFA 3DLEA 4ED0A 3CO9A 3THVA 1J9AA 4FM0A 5L1IA 4EEYA 4O5BA 3FFIB 3KLIB 2ZKUA 1S1TA 1JLCA 1KFDA 1X9SA 3K5MA 2WTFA 1DTTA 3QGIA 1WNSA 4W5TA 2YNIB 4QAGA 4K4SA 2W9CA 4Z4GA 2I5JA 3G6XA 5KRTA 3K58A 3HPGA 2HNZB 3TANA 1LAVA 3O4NA 3TAQA 2HHQA 2BE2B 3KHLA 1RT2B 4JV2A 4J9RA 4QCLA 1RT1A 4ECUA 1RT3A 5KT6A
chains in the Genus database with same CATH superfamily
1IKWB 5HRRA 2XULA 1VSKA 2FJVA 3CDBA 4JN4A 1NHVA 3FZBA 3MM6B 4IH7A 2P9LB 2MZJA 3G82A 3EVOA 2QSWA 3MMJA 4RW4B 2DHSA 1NGFA 3I82A 2HNYB 1RBTA 4JI0F 2G8FA 1J53A 4PWUA 1LNQA 3CEDA 2DFHA 1F3VA 4OKKA 3VF4A 1P90A 3HRGA 5BXIA 4HVJA 3RBEA 4LRCA 3L2RA 3T6JA 1QSLA 1Q8IA 3I5AA 1K8KA 1VSEA 3RMAA 2MZTA 4F4KA 1WLJA 2R7RA 3PEJA 3MEGB 4N7TA 3NVKA 4PXEA 2IC3A 4C48A 4CJWA 2C3MA 1EETB 4KRFA 3SZ2A 4E3SA 5FD1A 3BQ0A 3SMPA 2IHR1 5CR4A 2CDQA 3P4UB 3QT7A 1R0CB 4QS9A 4X66K 1REVB 4WFNQ 1S97A 1MMLA 4CYUA 4ZP7A 1BXNA 5K14A 1VQ7N 2CIMA 2OCEA 3KK2B 1U1NA 4IOCL 1XHXA 5AQMA 4CJ7A 3FCHA 4DV3J 2XMUA 1KD1O 4DUYJ 5AQFA 4JV1A 3KZBA 1S99A 2PFFB 2YWHA 1NGEA 3E9LA 2DNMA 4HYKA 3S3MA 3NS5A 1PCAA 1HI1A 3KK1A 2HG4A 2F4VK 4CLZA 1CLFA 5KG4A 1E4FT 4ANCA 1HHQA 4PCQA 2B5JB 3BN7A 3H20A 3TVKA 3EE8A 1XBWA 4B3MF 1YRXA 1FX4A 4UW2A 2BOAA 4TN2A 4W4MA 2HVIA 4O8UA 2BQUA 2VWBA 3NH0A 5A2QY 3DXMB 3LGMA 4DU3A 4YHHK 2WVEA 2G8WA 1Q1KA 2ZOFA 1FHTA 4Q0BA 4GKKF 4B8AB 3OW2M 1R6VA 3WXMB 2O8EB 2GEMA 5JVHL 3T5KA 1K73O 4M3RA 2XB2D 2DRBA 4JD2B 1HNXK 3M6VA 1SJFA 4OKEA 1P8GA 4ECWA 5LMUJ 5M2RA 2FZGB 1E6YA 4PPZA 2YX6A 1ZAVA 2K1RA 2Z57B 5C12A 1EO1A 1OY8A 2CPIA 3EEQA 4DV2F 3BKUA 2KM8C 1NK6A 1RZMA 3KHHA 5D3GB 4J2EA 3ULDA 4E1NA 3PNIA 3L7UA 4BVOA 1SL1A 3DLEB 4WFNL 4OYOA 3AT1B 3OYEA 3Q8RB 1TKZB 2FJXA 1WG5A 1VBKA 3RW6A 2KHOA 3CMEN 1FA0A 3B4DA 3A8EA 3G6YA 3G6VA 5DQGA 3VAGA 2ZD1B 2A6AA 5M1FA 3HJFA 3DOMA 4ERDA 2WC9A 2G8IA 2HNDA 3NOCA 1AUSL 2RAQA 7FDRA 2WBRA 3CVKA 5FJ4A 4JLHA 4QQBA 4HTJA 5AFUA 4DV7K 4O0NA 2HQDA 3W1YC 3K59A 2VA2A 2D3OR 2N4CA 4E7KA 4LSLB 4HL9A 2IFXA 3CJBA 3G82B 4DV0F 1XC3A 4B1VA 1TQLA 2UU9F 4WKRA 4PHTX 4FJ5A 1BWEA 1Q7LB 4ICLA 1TTHB 1IWAA 2JSXA 2AEJA 2HHPA 3ISND 4LF8K 3KHGA 5BYSA 5AQTA 1X5PA 1U1KA 2C2ZB 1BL3A 2HBLA 2ROEA 1D0EA 2RU3A 2CVEA 3DXBA 4WCEQ 3OV7A 1WG1A 2MJUA 1K8KB 2I7PA 2JJ4D 3BYPA 1SB6A 2E29A 4Y0WA 4FWLA 3MR7A 3DM2A 5HQLA 2OPQA 2BW7A 1XMQJ 4MO4A 2VASA 3O80A 4H4OA 1O6XA 4NLVA 4EYIB 3OFFA 4MFBA 5KFHA 3QBWA 3CXCR 1KLMB 3DLJA 4H4KA 2V2ZA 1C4AA 4NA2A 5F0UA 3MAHA 4Q44A 3GIMA 3FSXA 2BX6A 2IAJB 5KAKA 2DGSA 3CPEA 1SH3A 3IMQJ 2V0NA 3DN9A 4IRKA 4ED5A 3KK1B 2DGQA 5AQGA 5E26A 1KQGB 5KQDA 2HHUA 4ILGB 3BPSP 4QOZB 3KG1A 4GVBA 2BH1A 1FE0A 1SQEA 2U2FA 2DFFA 2R8JA 1C1CA 2CQCA 4WFZA 3H40A 3CJ5A 2K3KA 3O1BA 1QSSA 3OR2A 3CJKB 3H0PA 4JI3K 1U02A 4H54A 2MYFA 3IXQA 2AYMA 2MQOA 4CWBA 3RAMA 5DM6Q 1TK5A 2E8AA 4BC3A 2PY5A 2NRTA 2KI2A 2ZZMA 1TZ0A 3D0PA 1M5HA 4DR6F 1LW0B 3SBGA 4KO0A 1HA1A 4MIAA 4IDHA 2IVYA 3MOJB 4J90A 2KT3A 3ETOA 3SJHA 3HHLD 3M8SA 2RB7A 5BREA 2FLLA 3SFUA 2I1RA 1GTHA 4B3OB 1FWKA 3BKTA 3L3UA 2MQPA 2X51A 2MZSA 5B0GA 3ENOA 1NZAA 5L9XA 4X66J 5THWA 3TJ9A 2RRNA 1YJWN 1OKJA 2E2NA 1K1QA 4Q7AA 5EHHA 4DTRA 3K5PA 1DTQA 4NA3A 4JI5K 3TR8A 4FVCA 1YBTA 5JLFA 4YB5A 3AA3A 4F7VA 3AVKA 2GO8A 1VHIA 4GC7A 3T1HF 4AH9A 4E1JA 4LF7J 1MLAA 1S4EA 4ZVUB 1VQ6N 4RPFA 3KG4A 3UPFA 1NLKL 4AILC 4OZNA 1HNWJ 1SIWB 1SJRA 5D4PA 5FPDA 3TA1A 3H3NO 3QLHA 2F9TA 1GXTA 2E5LJ 2V6AA 1FDAA 3MM5A 3ICLA 3IA0A 4BDPA 1NSPA 1Y3JA 1WEXA 4YHHJ 4ICLB 4EIAA 3VAFA 4AXIA 5AQUA 1T0TV 1N34J 5DM6L 3MN6A 4K4TA 2JX2A 3B6OA 3CCJN 3P45B 4UUXA 3A5NC 3OL7A 2UUBF 4M5JA 4CTAA 3QERA 2G8VA 2DGUA 4UOCA 2ILYA 3UDCA 3DDNA 2DK2A 4CQ1A 2PYJA 3VTIA 3OYBA 3DM2B 2XCAA 5GAHU 1X4GA 3PJWA 1WI6A 5K8MA 3CCSN 3GIRA 3ZX2A 5DS7A 3MPVA 2KJWA 2ALZA 1Q81T 2O8DA 3C6TB 3EE9A 4CI0B 1HHSA 1JLFA 3T41A 1Q86O 1RAFB 2HMIA 4KKOB 2H9ZA 4XO0A 3VCDA 1S0VA 3KK3A 1QVGR 5ETQA 1VSLA 3PUFA 5HOOA 3A3OB 3W9JA 2WVBA 1RACB 2NYHA 3VHQA 1ZAWA 4NYPA 2OPRA 3R3TA 4JI8F 2HSTA 4LRDA 4KI6A 3DU5A 4RW6B 1CC7A 1BE4A 2W8LA 1VSIA 1NM1A 2VF3A 2HVDA 3ENWA 1SL2A 1RBLA 1YJNN 3UW1A 1GQEA 3B54A 3AVNA 2ZITA 1FW6A 4GVBB 1NKBA 1DLOA 2KTQA 3M8QA 1U6BA 4B3RK 5AE2A 4BE2A 4IYQA 2AMCB 2VBWA 1JX4A 3A8KA 2C2DA 2CVIA 4CF2A 3GJQB 2QIFA 1LWCB 3I55S 2W01A 1NHKL 4ZPWR 2BJ1A 5AQSA 2CPFA 1N52B 4XPEA 4OI1A 1SJQA 4HT7A 2R2SA 2YX4A 2HB5A 1KWMA 1FNOA 4BRKA 3U02A 3D3BJ 2YKMA 2JEJA 3VOVA 4E7LA 4KTZA 3FZFA 1N56A 1WSVA 2DXEA 2Q31A 2E7XA 4KO0B 3D6RA 1URNA 5KGWA 3LDPA 2AJFE 1JKHA 1X4BA 1TGOA 3O8WA 3ZTOA 1U2CA 2GIRA 1G6BA 1MNEA 1NKCA 4NLUA 4H4MA 1RADB 1WWHA 1A9NB 3FUYA 2F96A 2ZH5A 3O8MA 5C2GA 2B8QA 3GCWP 3FLCO 1WG4A 1HQEA 2J8AA 4N41A 4DCPB 3FC9A 2FHOB 5BRFA 4AXJA 4CM0A 4GV9A 1TL7A 2V2KA 3TAEA 2W7AA 2PT0A 2AZ1A 4RTFD 3V81B 3PEHA 5HO4A 3TO8A 4WTOB 4Y00A 4OHYA 3O6QA 3DRPB 2H1YA 5AXKA 1S9GB 1KBRA 4FNHA 3NF9A 2P6TA 1FDDA 4QYRA 3NAEA 2FUG9 3KNGA 3MM5B 2BTFA 5B0AA 3AD7C 4NYOA 3VGUA 1QE1A 4Y3CA 2WOMB 4LFCK 2NZCA 1WACA 2BM0A 5GADP 2CNNB 5AQJA 1U47A 2HHHK 1LFPA 1HIYA 4C8KA 2OMLA 4URGA 1VQLS 4M5DA 3R5CA 3TWHA 2CXEA 2BKPA 4LRFA 4U7UD 2XS2A 4KTWA 4A8YA 3SCKE 2XNRA 5DJBA 4X65F 2O8DB 4TNOA 5KFYA 4IXCA 1N32F 4LD0A 1KDNA 1K0TA 4JI0K 4NEYA 8ATCB 5DG9A 2QL5B 5LOQA 2HMIB 2HLTA 5HVHA 1DTTB 2NUHA 2UUAF 1D8YA 3M2VB 3VAMA 5AQWA 3OL8A 2JLEA 4CEAA 4JNEA 2FD2A 1KVCA 6AT1B 2OPRB 5C2FA 4DLGA 3QMLA 4TY9A 4JI5J 3FJ2A 2BKOA 5I4MA 4OZ0A 2E5GA 4CF9A 3M8PA 5JS1A 2A5XA 1GLCG 3AOCA 2ZE2A 1JLAA 4JEPA 4FJHA 4QS7A 4FLUA 3M8QB 4WE1B 4ZVOB 2HURA 1VQNN 1T44A 2JGUA 2QMWA 4KAZA 2Y8WA 3PY8A 4P10A 4AQYJ 1NU4A 1M5KC 4ZVHA 3GYXB 5SZTA 4EHTA 4CZEA 3I5CA 2XBPA 1WSGA 4W5QA 4M7XA 4BC2A 2JRSA 2GJIA 4OI4A 3IR5B 5BRHA 4M3TA 2Z8QA 1W9HA 3GIIA 1GFWB 2FLNA 4AYBD 4CFCA 3VGLA 2D9OA 3TI0A 2QC3A 2OMOA 2R7TA 2HF4A 1S1VB 1DJ0A 3MUTP 4FCYA 5GAEI 2DNYA 2FY1A 3P3DA 1NGGA 4CJUA 4TXSA 1VCTA 4B3MK 1VQMS 4H4MB 2FY8A 3C19A 2WFBA 1IKXB 4IUFA 4GKKK 4WFAQ 4H5VA 3C14A 2VOPA 4G1IA 3HOSA 1HQEB 1KFSA 2DPJA 4QOTA 3MWPA 4CBUA 3RR8A 1EB0A 3I32A 1GTEA 1MW7A 1SJ3P 4YDUA 1LK7A 3PW0A 2E88A 3CHWA 3KLIA 1RCHA 1TL7B 4KBOA 3L2UA 3ZT1A 4WU3A 5JICA 4J9NA 3SJJA 4DV2K 2VA3A 2HNZA 3BO3A 3VQTA 1CSJA 3G8SA 2BE2A 1V9OA 4XH1A 3RU0A 2RPIA 3ILOA 1N5QA 2A3JA 1X4AA 6FDRA 5KFOA 3SPYA 4FJKA 3SCIE 1YWXA 2X1BA 3AXMA 2DHHA 4K43A 4CO0A 4P72A 1LFWA 2PBDA 4RNHA 2Y9HA 1Q7YO 1QE1B 3AY0A 3K2PA 1WOPA 2NQPA 4F67A 2ZH8A 3EZUA 1S3XA 4KH4A 2RQMA 3N4WA 1ATSA 4Z4EA 2K8GA 2GS8A 3GWCA 3MURP 2QTWA 2FPHX 3SIPB 3VVTA 5ETMA 3O9SA 2KW4A 4OPJA 3U27A 4NRTA 2QN6B 2A40A 4DSKA 1RJJA 1V6HA 5E2QA 4M5DB 1Z2LA 4CLUA 4QZVB 1VQ4S 3QBXA 3CJ0A 1RYRA 2R7QA 4M3YA 4DV0K 1JNZB 4A8QA 4IWVA 4RKUC 2UU9K 1VSDA 3B8HA 4QWBA 4ZPBA 4DPYA 5C5JA 1EWRA 4FJGA 4DLEA 2XY7A 4KI4A 3DRYA 1XWLA 2ILZA 4WQ5C 3JQJA 2P9PB 3ZZUA 3SUNA 3IP0A 3IAYA 4NZ6A 1W7AA 2E6LA 2XQCA 5EN1A 3BF4A 2F7VA 1WORA 1EP4A 3MAAA 4RUBA 4J9SA 1N6QA 3C6HA 3O2IA 4R79A 2ZJRQ 1RCOB 2KZZA 4FSVA 2CQ3A 2ZE2B 1JLAB 2YNHA 4OI6A 3LDSA 2JFKA 4HWIA 1YK9A 1R27B 1FJGF 1GT8A 2CNLB 5B0CA 1IXKA 1YHQN 3ALYA 2J5AA 2VZ9A 4FXVA 1FRLA 3TR5A 2AZ3A 2GNKA 1ZXOA 2MPUA 4ZTJA 3UN3A 4J9QA 4MKVA 1S12A 3AFGA 2DR9A 1F5BA 5GAGU 5GMKa 4K4VA 3R6GB 4KY3A 4C11A 1WAFA 5A8RB 5J2NB 2I6WA 3QIDA 3L4QA 1RT4A 4P74A 2YHBA 5CZ2A 3QRQA 2C3PA 1JLEA 3RB4A 3RMDA 3RMBA 1A5VA 1NK7A 4BE0A 5KFBA 4LJMA 3SCJE 2V9WA 1W7WA 4WYWA 2HIYA 4NCBA 1FKPA 2X3DA 1NBWA 1RWVB 5CZVA 5L38A 1RLDA 4F4AA 3PACA 1NSQA 1T95A 2IA6A 4DZ6A 1S9FA 5CE3A 1ZETA 2L9NA 3CJQA 1B64A 4MQ3A 2J0QD 1WNEA 5J2PA 4DR6K 1FE4A 1VRUB 2ZJRL 4Q5VA 4FYXB 3KJQB 5F8LA 2P9KA 2M3DA 1UCNA 1RP5A 3VEXA 1U4BA 3BUZB 5KFEA 3U9DA 2FHJA 2Q0UA 3ATUA 4L73A 3M6GA 3IGVA 4KC5A 4K2XA 4OHXA 4M5IA 2D1CA 5J1EA 1TK8A 4GKJF 3CC4N 1BLUA 3H3OB 3J80U 3RAQA 1VRTA 3Q2TC 1ZBLA 3DNCA 4DTJA 3AXKA 3D6HB 2XYGB 4BQLA 4I6WA 2GUIA 3DLKB 1VQ7S 5HMXA 2Z0GA 1JWWA 3T1HK 4N76A 4E1MA 2QMXA 2CADA 5CYJA 2WK4A 4ED1A 2AGOA 2KJVA 1T6CA 3TAPA 2CQHA 3KOAA 1J5EJ 1F2GA 2UXCF 1HLWA 2F63A 5AJ3K 4TU9A 4CLTA 2UUWA 2VDHA 4OI0A 4MT1A 2J9DA 1RA6A 1ROFA 5F8MA 1HWJA 1NHUA 4CESA 1REGX 4ELUA 2FBTA 3W3DA 4FF4A 1F6TA 1ZM2A 4N47A 2R4FA 2D9PA 3LAKA 4I7FA 2GMHA 3G71N 2DR8A 1Q4RA 3QZ8A 2FJEB 3GFYA 1SI9A 3CFRA 1GLEG 3WC2A 2ASJA 1WD6A 4P7TA 2UUBK 1UPPA 4LH5A 1T94A 1C0UB 2W42A 1RGIA 3FRYA 4RR5A 4JHDB 1ZA2B 2ITMA 1RISA 4GO7X 2LXUA 2XLJA 4DV2J 1BD6A 3KKFA 5HK4A 4M5NA 2WSCC 3V2UC 1BUPA 2EW9A 4S0MA 1NEEA 1FXDA 4MIWA 2JOQA 3FBFA 1KSPA 4ED2A 4KYZA 3ELHA 4H4KC 1M5PC 2F8EX 3M2UA 1PBUA 1UFWA 3KUHA 1HR0J 3MX5A 1SAZA 1DQ9A 2FZKB 1S0NA 4YN3B 4JI8K 3C0BA 2O8CA 3ENAA 1AFJA 5IC6B 3CMES 4F9OA 3O9TA 4QJVA 4KHPF 2V8GA 1Q95G 4C1NI 1CJVB 2GWJA 4FLTA 3JSMA 1Y5NB 1UOCA 1UVMA 2KFZA 2IM2A 1AA1B 1FO1A 5E5NA 5DQHA 2ACMA 2BACA 4JV5J 5C24B 4I56A 1KD1T 4R0JA 4OLAA 1NUEA 3BGRB 4C3KA 4E8UA 4Y2MA 3M2RB 4CW7B 4WP9A 2QLJB 4F3MA 4DMNA 1KAZA 1J5OB 1M5OC 4NO7A 4OPAA 4CJ5A 1SC6A 4BCAA 3TP2A 5J2QB 1HNZJ 4I9QA 4E2FB 1NPRA 4F26A 2P6SA 5L1JA 1NH7A 1IJJA 2EFOA 2YXLA 2XZTB 1T11A 4YOTA 2RHKA 1BHLA 5J2PB 2EEYA 5F0XA 4DTSA 3NY0A 4QPTA 1RTHA 2PMHA 2NRRA 4ECVA 1I51B 2DPNA 3OXGA 3T5LA 1N36F 3O44A 2FHMA 1K73T 2L9DA 5JVGQ 2CPHA 4M95A 1F9EB 2D69A 2MSSA 1KQSR 1HYSA 5J1EB 3BKFA 3W61A 3G6EN 4NI2B 4JI1J 1FWLA 1VRTB 1XHZA 3J7AN 3P96A 2F7TA 1XMOF 2JNJA 4BLGA 5LXYA 4E19A 3CQYA 3L4IA 4CZFA 4TU7A 2WTUA 2JC0A 1LWXA 4L72B 3R1LA 4ZS6A 2D0BA 1X0PA 1RU2A 1TFWA 4CO4A 2OPSB 5C15A 2OELA 1S10A 3EXCX 1HKGA 1WSEA 5HRPA 3A3PB 1D1UA 1T6DA 1ASUA 3V4MA 2HRTA 2NLXA 5CQGA 1BO5O 2OFHX 4KHUA 3A12A 3L09A 3H6EA 2O5DA 4FPAA 1JXVA 2VPZB 3LUYA 1F5CA 3JAMU 5KPZA 3H2VE 4DEZA 4H0PA 2A6MA 4X4UA 2P9NB 4A47A 2CJ9A 5IOLA 3LDLA 3AV9A 3TZXA 4CEDA 2Y1JA 2IRYA 3EVWA 4YB7A 1OO0B 2P2CB 5F9LA 4X4VA 4B3SF 4B9NA 4X2BA 1EHWA 3EMTA 4KGMA 3WQPA 4CJ4A 1AZSB 4KB0A 4HHHA 2GTDA 1KXPA 2FGCA 5A8KB 2DCUB 2YNGB 4ANDA 5JVGL 2KQ2A 3OVBA 3KJNB 1Y4ZB 1VFJA 4X65K 1VQKN 3Q8YA 1NMEB 1N32K 2AX1A 4U67L 3T3FA 4GMKA 3THWB 4I6AA 4TSXA 3K5OA 2UUAK 2HEKA 3TRGA 5BJRA 2QWPA 3M2UB 1S1WA 4HHJA 1SH2A 4I6MB 3SUQA 4ZOSA 1WC4A 1ICEB 4I2QA 2HQIA 3ZSRA 4KBIA 3DYAB 1YJWS 1FK9B 3QO9B 5EOYA 3P39A 3IBWA 3DLGB 1U6ZA 2M0GB 1X0FA 4RW9B 1U45A 4IQXA 3T1HJ 1DFDA 5EUHA 1NZ8A 1RWXB 1W2IA 2P9SA 1FXRA 3TW0A 4O23A 3U1NA 3R5DA 3HVAA 3MK6A 1P1LA 1VQ6S 2O8FA 3JQMA 1PYOB 4C8NA 1IBMF 4K0KJ 5JMNA 3EM1A 5BPNA 2R8IA 5ADXH 1FRXA 3PM9A 1MSWD 3J7YI 2UXDF 1X5TA 3MEEA 4DWIA 3Q89A 2HWHA 1TVRA 1NJYA 5DG7A 4P6QA 2E1AA 2F5GA 3FKBA 3TQ1A 2O66A 4CHYA 5KFIA 2OA8A 2GHPA 4USUA 1NK5A 1ZC6A 2FSNA 2E9TA 5M2UA 2UUBJ 2W9BA 3CCJS 4J2BA 4RUAA 2Y1LB 4FLVA 2QA2A 2H5EA 3ULEB 3PO4A 1BY9A 1EQYA 3MWTA 3VEOA 3N01A 3G25A 2C42A 3FK4A 2HFUA 4CZMA 3AHPA 3BGOP 1XNQJ 3LWLA 1HYSB 3VQ9A 1FF2A 1RAOA 4DS4A 5HLFB 4P52A 3CCSS 1QY7A 2JL9A 2EBGA 1IG8A 1ASWA 2LQ5A 1NNDA 5GIOA 4OLPA 2ASLA 2DTUA 1S49A 4QYZK 1HBOB 4OZ1A 3IRWP 5ETPA 3D1HA 3MAQA 4QIEA 1U49A 3CCVN 3IMXA 3NMAA 5D0RA 2C22A 4PWDA 4QR2A 4MTPA 2CKWA 3MX2A 3WIVA 5LJWA 3HSCA 5EX3A 4OKJA 2H54B 2E9ZA 4DL3A 3BN4A 2Z30B 1YJNS 2DNHA 1IVZA 3IWNC 1VMBA 3LDNA 3MECB 1T7PA 1SVDA 1S57A 3SK3A 5D15A 2COLA 1J9AA 4FM0A 3LF0A 1X9SA 2ZKUA 3K5MA 2WTFA 4ZKAA 3QGIA 4ZA1A 1WNSA 1F2HA 1JK9B 3QATA 1FRKA 3K58A 2AJ2A 3O4NA 4CDIA 4Z7CA 3KHLA 2EWSA 2QLWA 1VJQA 4QCLA 3Q22A 4ECUA 3IFRA 3ZLJA 2CWKA 1NMNA 2DHGA 5KT6A 2BOPA 1PYTA 3W8GA 3A8YA 1VC5A 2NNWA 3SQ1A 2DBBA 2ZJQQ 4O4GA 3T6BA 1TUVA 1NB2A 1YZ7A 2DNLA 4FZXC 1FJCA 3QDKA 4B02A 3EN9A 3BPDA 4OZ3A 3OS0A 1VQ5N 1FT8A 2R7YA 1HKBA 2A18A 3PZPA 2NXCA 2ROGA 2B51A 1NJZA 2A1RA 3OXFA 4EP5A 3LPUA 2LDIA 4TQRA 4TVAB 4DX5A 2FXUA 2HAIA 1ZPVA 4A5BA 4I64A 2V51B 2W24A 4XIUA 1HYVA 4KIAA 3MEDA 1FJGK 1CLQA 1VK3A 1YJVA 1FJ7A 3MGJA 1KTQA 3EX7B 3T1YJ 3OLAA 3E66A 1WF0A 4IFYA 4G1QB 3PIOQ 3VEYA 1N8RT 4NLWA 3CG7A 1X4DA 1GOCA 3SEOA 3RR7A 2QEXN 4PYDA 3A0IX 2VQEF 2E20A 4ZMMA 5CABA 1NK4A 2R2RA 1UVIA 2CPEA 1HBNA 5KFJA 4JI6J 2PC6A 1GAOA 3D66A 2BDPA 4DX8H 2KYXA 3RRKA 4ZP9A 3G8TA 5AQKA 2YJEA 2QJ3A 4EBCA 3ID6A 5DO2A 4ITSA 4MK8A 3GSIA 1Y10A 2VPWB 3H2LA 5FDLA 3MUVP 4AD6A 2V8PA 4PABA 3CFOA 4B9VA 3AQOA 5K8PA 1VHFA 2ALYB 2ZJQL 2AW0A 4YDXA 4DL7A 4G1PA 2ATLA 2VKZG 2VWKA 4EK2A 2HZVA 1WKLA 4I6YA 3NHGA 2J7WA 2EC2A 3ZEUA 4X65J 2WHOA 4OGEA 5DQIA 3PX4A 4FWRA 5HBMA 1P8ZA 2DYAA 4FWQA 2R2UA 2LSNA 2P1JA 4U9RA 3JTOA 1FTCA 4YFUA 3LP0B 3W5XA 2LECA 4NLSA 4HUFA 4R8UA 2UUTA 1U09A 4JK9A 2W2OP 4B9TA 3MMAA 4X4SA 1V5IB 2L9WA 2H48B 2GJFA 2QYCA 1Q8LA 4ILHA 1SS6A 4BRNA 1SQGA 1X9JA 3MWBA 1ZAXA 4YUDA 5KFTA 3UB5A 2NYIA 3PIOL 4GKJK 1DT9A 3LL3A 5CD4A 3I0RA 1RHKB 1NGDA 3GV5B 3GQCA 5H9FK 5AQOA 1VQNS 2X1FA 3J7Z5 4DUZF 4KREA 2R7XA 1F1BB 4LFAJ 2NREA 4OL8A 1Z6RA 2W9AA 4LMZA 2FVPA 1X5SA 4M5GA 4OZLA 3I56N 3FZLA 3X1LB 2PYLA 3SSSA 4F36A 4C8YA 1RKIA 3R7SB 3DHXA 2UXCK 2NRHA 4O3QA 1EQMA 4HR2A 1WHWA 3AAWB 4EP4A 3RSEB 4F4XA 1KC8O 4Y2IA 2BM1A 2CH5A 2N3OA 4DI6A 1V4TA 5AZJA 1JMTA 2C2EA 4JOUA 3HF5A 2XSFA 2HGMA 4Y28C 2OTJN 3NLCA 3M6XA 5EXWA 2RDIA 2J6TA 3LP2A 2NZ4A 3MM9A 1TL3A 2MMYA 3DFEA 4L75A 4DV5F 3O4WA 1S59A 2ASYA 1UWAA 4OZJA 2ZHOA 4DU4A 4GW6A 1YKWA 4X64J 4UF4A 3CJ2A 3BV8A 2AD9A 4BR4A 3G86A 1K6YA 4Y1CA 2G4BA 3ZT4A 1D3WA 5CHIA 1S5ZA 1RTIA 1BA1A 4ALZA 1GLJO 1SUQA 3F5TA 2GV1A 1M90O 1NH8A 1UWBA 2E1PA 4DQSA 4U7BA 2CFXA 3PYEA 4CRJA 2FC8A 3MEKA 4DPOA 5B0EA 2UP1A 2JEFA 3PW2A 5DZ6A 3GB0A 1NDKA 2XMKA 2MDAA 2ZUGA 4OJHA 4WFYA 4I0WA 4ECYA 4LBHA 4ZLJA 1FVQA 2ZH6A 2UUCJ 3AY9A 4P2FA 2MKYA 4CE9A 3N28A 1WC5A 4DHYA 4K50A 2OIHA 1SC4B 4KHPK 1HI0P 4YR3A 4CH1A 1BG3A 1RWWB 2DTJA 3D6MB 2JWNA 5FDLB 1CJUB 4F02A 5D4NA 4KR0B 4CBWA 5F41A 2YQ1A 2QWRA 3IAM9 5T7LB 3IR7B 3E01A 4USKA 4CJPA 4PQAA 3OYAA 3VR1A 2OTLN 3VQEA 4I68A 3U9ZA 2AKWB 1YX2A 3BH7B 2DNZA 4DTPA 5BRDA 2HS0A 4PXBA 1RILA 5HBMB 4BC5A 5A0YB 3BSOA 3QNNA 4NCGA 2GFFA 4G6VB 1NOZA 3NGYA 2C2MB 2J9DE 4M63C 2GIQA 5LMNJ 4BRGA 3AOAA 4EBEA 1GLLO 2FLOA 3LPEA 4MYTA 2J9CA 3CM5A 1VLOA 1S6QA 1O5JA 1N36K 4RX6A 4KB7A 3G96A 5F1XA 1ZYQA 3BREA 1X3MA 3KJVA 2P51A 5KOXA 3S8SA 3OT9A 3UDLA 1UVNA 4V1Ak 3W3SA 4CZIA 1XMOK 3GYGA 2Z1HA 1YHQS 4CJQA 1CC8A 4LSZB 4PY5A 1L3TA 1GMWA 2O1PA 2IM3A 3M9OB 1YZ6A 4DSLA 1JLBA 5CYQA 4JAXA 3SI6A 3QEVA 2KL8A 4CIOA 2XI3A 3HJVA 3O5BA 4DR2J 3HM9A 3Q2SC 3AH6A 2Z1IA 3FBEA 3HVRA 4FYWB 3OPKA 1RGVA 1Q7YT 3I5BA 2B7CB 2VJUA 1BCMA 2CA9A 3MXIA 4XDDA 2XMMA 5AZJB 3I96A 2BKNA 3UI3A 4IFEA 2GZOA 2YHWA 2VU5A 4DQIA 4OYIA 3LP2B 2LXIA 1TL3B 3F9MA 3UWTA 3ID8A 3JSBA 4EFAC 2RDJA 1R43A 1U25A 4YB6A 3QBCA 1Q16B 3BGUA 4JI2F 4B3SK 3POTA 2DEJA 2KHDA 2LEPA 3UIQA 3GTYX 1SUQB 2WCXA 3V6JA 3Q8QB 1UW9A 2GIFA 1UWBB 3IG1A 3VQ4A 1IBLF 4F0MA 1XR6A 2XI2A 3UD5A 3VN5A 1S9EA 3VQCA 3NWRA 2R8HA 4URQU 1H2VZ 1XQSC 1H38A 1TAQA 2DGTA 3VGVA 2FVSA 4LF9F 4FYVB 3S7RA 4FJJA 2QKKA 2M8DB 3W2VA 4GKJJ 4YOVA 3UNYA 3ZZOA 2Q97A 4IG3A 5C2CA 3WXKA 4O5FA 5H9FJ 3CC4S 4XAKA 4CLFA 5TKWA 1QM9A 5FIIA 1X9MA 3PHTA 2N3LA 3W2WA 2CNKB 4X4TA 1GOAA 5KFNA 3IBCB 1VC6A 4FJMA 1A0OB 5H1SV 1WOOA 1HD0A 4ZHRA 4KTQA 2B0GA 4DF8A 1GX6A 2CZ4A 1T8EA 1Z1ZA 5ETLA 4JYAF 2ZH2A 1RKJA 3R5JB 2BRLA 1EAYC 1QJHA 2HBYB 3HTVA 1IBMK 1Z2ZA 4HUGA 1E3MA 2CRLA 3QJJA 3U3YA 3MN9A 4IQMA 2QL7B 2VHGA 4LUBA 3HPHA 1Q9XA 2UXDK 4B9LA 4F4YA 2GGPA 4C0OC 1VISA 3WNGA 1W2BR 4FJXA 3WX4A 4FLYA 4Z7YA 3IKMA 3HVTA 1F5AA 4NCGB 4YQWA 4GO5X 1QVFR 4DX6A 4OV6A 3G71S 1HWUA 4NWBA 4GVMA 1I1GA 1U8WA 2WB1D 3PVXA 4B3TF 2ZVSA 4ECQA 3BBFA 3QSIA 2CPXA 4FM2A 3VZHA 4BRDA 2MZRA 3CPWR 4MDBA 3TPQA 4ZP6A 1LCUA 3THXA 3M30B 1IBKF 2ZWPA 1RWOB 1RHMB 1VBXA 3HSGA 3P1GA 3U1MA 3F0NA 4CK1A 3MM8A 3T7ZA 4AHTA 1YF5L 5CY4A 4M41A 3E2EA 1LWFB 2E1ZA 3HD1A 1BUXA 2FTRA 5M1KA 1JLQA 4V19S 2DKOB 2ZBCA 1JLBB 5CYQB 3OVSA 3NS7B 2IDLA 2PI4A 4ISEA 4JRQA 2D41A 2K3IA 4WKYA 1HI8A 1IR2A 1E6VA 3ATVA 4QR1A 1I94J 3W5YA 3AJ1A 2YNFA 1L3UA 3WC0A 2NRXA 1CZ9A 1YTUA 2W2QP 1SH0A 2V4JA 1N4LA 3NGZA 1NGJA 5I42B 4JV0A 1FXLA 4ETXA 2OPPA 4NLTA 3GL1A 4USIA 2Q3PA 3J81j 2DNRA 4M5HA 4DN0A 2LDYA 3NMUA 1BDGA 2ZH3A 1NB7A 4AL7A 1M5SA 4KHSA 2ZOGA 1FDBA 4FLZA 2PIIA 3AGKA 2YKNA 1U04A 3KVGA 3THYA 3CCLN 2F8TA 3POTB 3MTJA 2H4WB 2ZWHA 3VQ8A 2CJBA 5C42A 1UEVA 3C66A 2RS8A 2DXDA 3K8VA 3BDPA 5E3RA 1QS4A 1CZAN 3IG1B 1NPPA 4C6AA 4U8YA 3AODA 2YHAA 2KFYA 2WSEC 1RBSA 2H65B 5GVQA 4DR3J 1UTAA 1Z4UA 2YQ3A 2G0CA 1FD8A 2QG9B 3ISZA 3JSYA 4QU7A 2FVCA 4CZGA 4NZ0A 4RWWA 5DDQC 4IG3B 3BP8A 3C16B 1S1TB 4YY3F 3CYMA 1OPZA 1S6UA 3D5MA 4BG8A 4UZBA 4OX7A 5B0DA 3G6ES 3WEEB 2ZWOA 3D7SB 2W9CB 1CXQA 4JKGA 1K9MO 1BQMA 1HD1A 1ZOTA 4F04B 2EFVA 3OSPA 3K89A 2E2PA 1KTVA 3RRGA 4A4JA 3F44A 2Q36A 2AP6A 1RT1B 1APSA 2G2OA 4J91A 4GY2B 1KLNA 2Z2ZA 3FMWA 4USJC 2LU1A 3IDHA 3VQAA 3P5JA 2FHJD 3KHRA 1GLDG 3TAMB 1N5YB 1UFKA 3QSYB 5HP1A 1RAIB 2VQEK 3HK2A 2QA1A 5KGXA 1VS3A 3T9NA 4OPHA 2IM0A 1U24A 4HH1A 4USHA 1Y0HA 3LAMA 1OPIA 4IO9L 1EZZB 2FBXA 3JXUA 4CJVA 4Z37A 3VQ5A 4JI4F 2A42A 2GAHC 1HW8A 3R5BA 4FWMA 2EFPA 4IFVB 1QAIA 4KV8A 1B4SA 3B82A 3SCLE 2AJ4A 4DR5J 4WWSA 3IS9B 5EVZA 5HROB 2NCKL 1JJCB 5HATA 2XHBA 4IH6A 4QWDA 2RUGA 3AVMA 1RT7A 4CEEA 3BO2A 4UQGA 4LSNA 1IJEB 1C0TA 2W4CA 3V9UA 3TUIC 2VFRA 2Z2LA 4MLEA 3VENA 1LOTB 1VQKS 3DRSB 1WUUA 2V5HG 2CQBA 1JLQB 1OJ4A 5FRMA 2WUSA 1N5VA 2V67A 4Z4FA 4K8RA 3C2PA 1YDLA 3R5AA 2VIHA 1VQYA 1U0HA 2W8KA 5IT4A 3N9UC 3BQ2A 4A8MP 3H45C 4W92B 2YNFB 2R7OA 3O6WA 5FPNA 4ZVFA 3K5LA 1SJ1A 4JS4A 2D3UA 2OGUA 3C7NA 2HYIB 3K9JA 3MR2A 2VQFF 1R3NA 4WJBA 4DUZK 1IKWA 1HL6A 4USMA 1QUPA 4UOHA 3HYFA 4DHVA 3MM6A 3FGVA 1KAXA 2P9LA 4RW4A 2OEKA 4LF1A 2FF3B 2YKNB 4H0XB 2CQ4A 3N6MA 2V52B 2X78A 4QR0A 2VL1A 4QW8A 1VDHA 5ADZA 2K06A 3GJSB 3IWXA 4LF4F 4F25A 3GBTA 2M4MA 5KFLA 1S0MA 2VKRA 1RSCA 3K9KA 4C9DA 3MEGA 4FWKA 4DR4J 1XMBA 1PKUA 3A8JA 1M0SA 1EETA 4ZTFA 1IR1A 4DV5K 4DR1F 3CERA 2W7OA 4YR0A 3OD2A 1REVA 3CJ3A 5A76A 3W8PA 2HWTA 3KDNA 3WNFA 3WNHA 1RWPB 3W62A 3CIZA 2QA4N 2VD3A 2IIRA 1O8BA 1VOMA 4IRDA 1H1VA 5J1PA 1T05B 1LEOA 3OHBA 3CJTA 4B08A 3OLBA 3CCVS 5E84A 3FVYA 1U1OA 2YPYA 2FHKA 4FBUA 5ETTA 4O55A 3DCAA 4WZMA 1T9WA 2NXEA 1S1XA 2VODA 1JQGA 5AQIA 1YITN 2KFNA 2PEHA 3NF8A 4F3OA 3OYHA 4M5LA 3DXMA 3S01A 3AO4A 2MHNA 1NK8A 1BMQB 4CD1A 4HCBA 5I3UA 3BH6B 3NGTA 4NLXA 1RDBA 5GAHP 2YKQA 1F60B 1UL3A 2O8EA 5EWEA 2HIQA 4JD2A 3LTOA 3MUMP 5KFPA 4DTOA 2E44A 3HDSA 3OUYA 2CZ9A 3K57A 4NOHA 3UCGA 5CD4H 4KV8B 3VQDA 4ETZA 4JKCA 2LQ9A 4LFBF 5HQMA 1X4HA 4WYLA 4R5PA 1RT7B 3PIPQ 1HW9A 1IBCB 2ACYA 3H1VX 1XR5A 2ZH7A 3UDEA 3DGPB 5D3GA 1C0TB 2CQDA 2YKAA 2KN4A 1GNKA 1HJOA 2I2YA 2HZAA 1C2PA 4K5SA 3SUOA 4CJRA 4YDDB 5CYMB 3M6UA 2MKSA 1Q0NA 3EJMA 1TKZA 3PX0A 1VQ5S 3I31A 2P9IA 4YR2A 5U47A 1GLBG 1U0HB 5RUBA 2BGGA 2IVMA 3ULHA 3WXJA 1WEZA 2BANB 3ETMA 2ZD1A 4CEOA 2CAJA 3LP3A 1EIYB 4PL7A 2W2PP 3FEYB 2IVPA 3V6DA 3TAGA 4IR1A 5BR8J 1BI4A 2EC0A 4PUOA 1TL1A 5CCLA 3PKYA 3C7NB 3PYFA 2EXUA 4NLCA 4DR7J 1UVLA 4LSLA 5ITHA 4FWOA 3UQSA 2MQ8A 3ZZYA 2QEXS 2DISA 5EX0A 5F8NA 3CIPA 3HZ6A 4PKGA 2KHCA 5D0EA 1PGZA 4FJ8A 4LQ3A 1Q18A 2OUGA 3A5MC 3ZT3A 3OVNA 5C0YA 2XGPA 2IA0A 4H5RA 4WQ5A 2CG4A 1S76D 1T9TA 4F2SA 4AHVA 2PE8A 1IN0A 9ATCB 2MKJA 3VF0B 4P2XA 2QWMA 4U95A 2YKPA 3B6BA 2ATQA 3EXYA 5AT1B 4BDYA 1HKAA 4DV1J 4DUTA 3TZYA 1L3VA 3TJAA 4ID5B 4ZVEA 3HFKA 4YOXA 4RWTA 2HBZB 3Q86A 3C65A 1KCFA 3SPZA 4XH4A 4O44A 3UD4P 3VAJA 3IBFB 3TA2A 1JLGB 2B4VA 3SQ0A 1YBAA 2F4FA 1G1XA 4JI2K 5KT5A 1KLMA 4PG7A 3CC7N 5GADI 2H5JB 2VBXA 2N82B 5J2MB 1PILA 1VR6A 3GV7B 3ZT0A 3MR3A 4CEQA 2IAJA 4DB3A 3DLLQ 2QWNA 3OXLA 4OYAA 3RAXA 1IBLK 3C15B 2P5GA 1MWMA 1F9HA 1QVFM 4HEA9 4Y2CA 2EHGA 1JJ2R 4DCOB 4CJEA 3EY1A 4A8OA 1JXLA 2HS3A 4MK9A 4LF9K 4FKXA 1S1XB 1T9UA 2CJYB 2WBMA 1CVJA 1ILYA 4NCAA 1CJKB 1ZBHA 4DV3F 2BA9A 2PA3A 4KT0C 2Y3YA 3L3VA 2NSCA 3GFXA 2LYVA 1WJ9A 2DY1A 3HMJG 5I3UB 3AOBA 4DSFA 4NXMF 3O3GA 3CJKA 1PAEX 3GDQA 3M1VB 4HH0A 3UVJB 4C98A 1KNZA 2DEIA 2YQ0A 5IT9Y 3UR3C 2B9XA 3LDQA 4J9KA 3OUYB 5AQYA 4JYAK 2BZ2A 5KFGA 3TTFA 2XZDB 2O8BB 2BMBA 3FRZA 1LW0A 4ECTA 1X3NA 4KHWA 1MN9A 5L1LA 4IKAA 3VF2A 4R5PB 4DQ8A 3JYTB 4AM6A 5CAAA 4B3OA 4CIFA 2DVIA 2RD5C 2SXLA 3N4QA 4PL8A 3J7ZT 3JAMO 4XPCA 4BACA 2B4UA 4DDFA 4E98A 2OTJS 4ED3A 2KG1A 5LMUF 2M88A 2LXFA 4E89A 2WW8A 1TKDA 1B99A 2P9IB 1KAYA 4B3TK 3NBPA 2QO3A 3DLLL 4NLBA 1RLCL 2GVDB 2CQPA 2RKIB 2XMAA 2NSBA 1SV5B 1IBKK 3SQ4A 3M7VA 3V6DB 1KHWA 3QB0A 1C1AA 3H46O 1YJUA 1H72C 5DZ7A 3DAWA 1BI4B 3AVBA 2HKEA 3CSKA 3PJXA 4PUOB 1TL1B 4HDHA 4CF8A 3P6YC 3NGRA 5DETA 3U8XA 4NLQA 2HBQB 3AQPA 3QZ7A 1MWZA 4LF6J 4KE5A 5HANA 4Z2XA 4TLQA 3SAFA 5T14A 3M8YA 3ADAC 5D0HA 3PSIA 4HTUA 2K2PA 3V9WA 2ZBQA 2JVOA 2ZM6J 1KVKA 3RGIA 3HP6A 5E3AA 4DQPA 5GMEA 4DSIA 1U26A 4N56A 4RBUA 3Q7CA 5K8NA 4IRCA 4YORA 3EPIA 4DV6J 1UAXA 3UKRA 3DRRB 4BBYA 3D1OA 4X4QA 3OTCA 2XC9A 3NKYA 3TVYA 2BQRA 3MD1A 4F4ZA 2DH8A 1CJTB 3OTOF 4OYBA 1EARA 3D0IE 2BJ3A 1ZS6A 5A8WB 1QHAA 2F9JA 5KFQA 1RXOB 4O44B 2VFUA 3C6TA 1AXQA 2OTLS 2GA7A 4KKOA 1KC8T 4A2BA 3SQGB 5KPRA 1IR0A 4P73A 2YNIA 1B9FA 3DMJB 3EGZA 2RHSB 1U2VA 3I33A 1RBAA 4DKWA 4PRFA 4CH0S 3V1OA 3QIPB 2EFGA 2ZC3A 3VVUA 4J9UE 4RW6A 3H5XA 1XMQF 4U8VA 2ZC4A 5MLCV 3O1WA 3BR9A 1ASVA 1LAWA 4FKYA 4FK2A 2NXUA 4J9VA 4YY3K 2QWLA 4CCHA 4MO5A 3H1QA 3ZTQA 5GAEU 1M90T 5EDWA 2UVWA 2XHCA 2QRRA 1DGKN 2Q43A 3RUBL 1LWCA 1HX1A 3HXMA 3P5TL 3CCMN 2Z2YB 4CF1A 3MI7X 1BIUA 2GV9A 4HCCA 1NKEA 4RUHA 1NSAA 3C94A 3CD7A 3UNGC 1Z05A 1YI2N 3HHLB 3O9QA 4WCEL 2BBEA 1HNVA 3D67A 3PCOB 3UFCX 3P38A 4HACA 4D3GA 3O3HA 4G3IA 3F41A 1QAYA 1VK0A 1M5VC 1C4CA 1OQ3A 4ZP8A 1R31A 4FVMA 1S6PA 4I4BA 1KRPA 1YSJA 4DG1B 2HWIA 3T1AA 1DARA 4GC6A 2AEMA 3QFPA 4Z4HA 1R8CA 3ZFVA 2L41A 2DY4A 4JI4K 1C0MA 1PO6A 1YIJN 2CGKA 4JI2J 3NBPB 3CNQP 4BWJA 2J6UA 1E4GT 2GMJA 3VWSA 3RBZA 5GINA 2GWKA 4I2PB 2AT1B 2WW4A 4ECSA 3V81A 4LVOP 1IBLJ 1GXLA 1DKGD 4CLYA 4GNIA 5GAGP 2F4VJ 3DDIA 2C2KB 4ILLA 3S1TA 3DRPA 4JKHA 1S9GA 1VBZA 5DMRA 4ZK7M 3FDSA 5AJ3F 1FKAF 1EXQA 2Z4PA 2W25A 2R7VA 4CJFA 5BPLA 3D28A 3MOZA 1WI8A 1X31C 2ZVIA 3QFWA 3H8YA 1U1MA 3LWMA 4PR6A 2VV5A 4ANEA 2DR7A 2WOMA 4FK0A 4ZN1A 1QQCA 4LF7F 1BQNB 4EI2A 5KT4A 2CJAA 1TP7A 5AQNA 1K0VA 2PMZD 3UKRB 1HNXJ 4FJ7A 3OYNA 4IBNA 1WSJA 2ZHAA 1HNWF 1BU6O 3NP5A 5HQ8A 1FVSA 1RBOB 1X60A 2M70A 3NCQA 2E5LF 3W64A 2VQFK 1HNIA 3G2XA 4P7VA 3SFGA 4K4WA 4CK3A 1WUAA 4IO8A 4ED0A 1N34F 1UW4A 1P9QC 4R25A 5KOWA 2NPFA 2QZ8A 4EEYA 3VGKA 4CO1A 3CW2C 3FFIB 1JLCA 3AJ2A 2APOA 1DTTA 4DXLA 2PMWA 4W5TA 3M2VA 2YNIB 4QAGA 4K4SA 2MZ1A 2GELA 1T3VA 2XLIA 1U2VB 4DBQA 4LF4K 4YOEA 2CPDA 3GE1A 5ETKA 2RS2A 3D2FB 4OMFG 2KM8B 3QWUA 1OQ6A 4J9RA 4Y2KA 4CZCA 2WZ1A 3THPA 1V4SA 3VEZA 5DDRC 1EX8A 1BISA 4E0DA 4U96A 3PRVA 5F8JA 4DR1K 1C1BB 3RZAA 4WE1A 4BC4A 2CQ0A 3D4JA 2DIUA 4DV7J 1TK0A 3M6WA 1FNXH 3ZTRA 2RT3A 3EUNA 3ZCMA 1GOBA 4V19X 3UKUB 5B8HA 3R9LA 3QRRA 5F8HA 1S1UA 5IT9U 1HJRA 5ELZA 1WF2A 2E66A 4BRQA 2J0XA 3HPOA 1BWFO 4LF8J 1HNVB 1HKCA 3AVLA 2W40A 1T02A 4CZLA 4TQSA 4HACB 1S1VA 3BB5A 3L6QA 5FLXU 1HMVA 3OW2R 3F2KA 2XZWA 4C0HA 1T9XA 4OI2A 2DNNA 4CLWA 1NU0A 2MQQA 5TKYA 2WVFA 1S6PB 2ZDOA 1WKKA 1RAAB 1VIXA 1KS2A 2VBYA 2Z58B 3KMSA 4RW8B 1IKXA 2HSEB 5E3PA 4YS2A 1GMWD 2MKHA 4CO5A 4CGIA 4FJIA 2RHQB 1PJ5A 2B8PA 4KFBB 3WT0A 1UZDA 2EFQA 2PFUA 4DV4F 3NF7A 2B6AB 3F73A 5ADXA 1EJ7L 3W7BA 4HT5A 2KZMA 3CCLS 3AO1A 4LFBK 4JK7A 2CNOB 3CJ1A 1B0VA 3WQUA 3FCVA 3ZXWA 4HUEA 4N8OA 3HCXA 4AHSA 4OFZA 3SSRA 4RNOA 5KG1A 4C8OA 4ZLNA 5E3CA 4J9MA 3P49B 1XR7A 3ET6B 1OH7A 1VYAA 2WBNA 3UE5A 4ISFA 3J80Y 2NUUG 4CLPA 4PA1A 4F0HA 2YH1A 2M52A 1KOOA 2AHOB 4M3XA 5T41A 4WIQA 1F3FA 2MEWA 4JI3J 4M5KA 4LIRA 3MXJA 3TJ8A 4EMDA 2CPYA 2D0CA 1NWKA 2W7PA 4DZDA 1BQXA 5DG8A 2YHYA 1N5TA 3KWMA 1HNIB 1G2EA 4NL5A 4ELTA 4DL5A 1T9YA 1JJ2M 4CIGA 4FJNA 1Y00A 4LQ9A 1HQUB 2ADCA 5M1PA 3NCIA 1JLCB 5KFMA 3M9MB 2WONB 2M8HA 4LIWA 1U1PA 1D9DA 2P9PA 4Y6IA 3EDQB 5JXSA 3SLCA 4JI4J 4OV1A 2C28A 3L8BA 3T5HA 5C2DA 1NGIA 2GBZA 5JUMA 3H4DA 4TY8B 2R8KA 3VA0A 2ZUAA 2OAUA 2KG0A 4CBXA 2DGOA 3UCUP 4WF9Q 2FIUA 2ABYA 3CF5Q 1LOUA 5K5MA 2DGWA 4EWTA 1TMJA 2IIHA 3BGFA 3SDEA 4BC7A 2GX9A 1FFGB 4NASA 4U7CA 5HJXA 1S1UB 1RE1B 1Z25A 1WC3A 4B9MA 4FM1A 3W66A 4I69A 4Z0UA 1RABB 1V3ZA 4MKBA 4FF1A 3QINA 2HQFA 1TKXA 5A8RA 4ES1A 5J2NA 3TSUA 2BW2A 4CO2A 3CCRS 2XSJA 1JCEA 1HMVB 1LXJA 3GV8B 2XTJP 4C3LA 2D1KA 4Y1DA 3D2EB 1XC9A 1YAGA 5AZIB 4AQYF 4OO1J 5KT2A 4AHCA 1LW2A 2VBZA 1XJWB 4DU8A 2RDDA 1NGHA 3HI0A 4B9QA 4DV3K 2RSQA 1X7VA 4RCHA 4CZKA 3WXIA 2Z1GA 1X5OA 2D0OA 4NXMK 3CCTA 3V4IA 2RMLA 5HL7Q 2PAVA 4YOUA 1JIHA 3RVCA 2GUPA 4EGLA 3D45A 1LV5A 3VA3A 4YOYA 4DX7A 3PRBA 1IM4A 2VH7A 2FB0A 1VRUA 1JCGA 1Q9YA 3HVWA 3AVCA 2V34A 4WYBA 4CEFA 4WF9L 3KDOA 2DD8S 2BUNA 3CWJA 1WSRA 3R5GA 3KK7A 4OX6A 4N5SA 1YTAA 5IV4A 3DKDA 4DR1J 4FF3A 3NCPA 4B3RJ 3FZHA 4BGBA 5LMUK 3OTBA 2EKNA 4Q2MA 3CTRA 3DLKA 5C25B 2HFZA 2I38A 2HQ3A 3GR0A 3CXCM 1H3DA 2J6SA 4DPUA 2QA4S 2BVZA 2QV6A 1IKVA 1QUVA 3CB4A 2FDNA 1J54A 2JWKA 3HT3A 2D74B 1R0BG 3BY5A 1SQFA 2C3YA 2DB1A 4ZJOA 4C1NK 4O3RA 2LP4A 4KQZA 3I9V9 4Q2LA 3VTHA 4ZVRB 1HRHA 3ISNC 4WFAL 1WKJA 1YITS 3QETA 3ZZ0A 4F3TA 1Y9OA 2N7YA 1YJ7A 4FW1A 3JAMY 3SUPA 4H8KA 5HRNA 1SL0A 1HBMA 3RB0A 4A8XA 3JSRA 5C10A 4CEBA 3JXOA 2ZQBA 4C97A 4PXCA 3QEIA 3A5LC 2OH2A 1Q5YA 2GQQA 5JMVA 3G9CA 2NR0A 3GU0A 4CT9A 2AP1A 4K4ZA 2B9EA 1KVJA 1C0UA 2A2DA 5KG0A 4JHDA 2IJFA 4F50A 4EFHA 3OTOK 3OYCA 4RBVA 4DSEA 4FLWA 1GEHA 5M1QA 4ATNA 2W2NP 3OBYA 4FPRA 4ZITA 2H3EB 1HBUB 4BRFA 4IH5A 2IBOA 4MLHA 1MWYA 3HLUA 2IVFB 1FJEB 3RWUA 3SDEB 2PN6A 3KLEB 3PYDA 2DNGA 3BBBA 3HHEA 4NMXA 3ITHA 4FOIA 2MLYA 4CO3A 4A61A 1QQOA 5G0RB 2HGNA 3ENHA 2HMPA 4XH5A 4FNIA 1QAXA 3EPGA 4LFCJ 3Q23A 1XMQK 1VQSA 2ASPA 1TKXB 2ZH1A 4FJ9A 3J7YU 3PHEA 3TAFA 4ZPVR 5E33A 2XSJB 3CIMA 3OR1B 1YT3A 2HHHJ 3GIKA 4PQUB 1CJVA 2CGLA 1NJWA 2Z56B 2D3ZA 5KFAA 2FZCB 3QPIA 1XQIA 3O08A 3WNEA 2DRDA 1LW2B 4EO8A 4CHQA 5C24A 3CD5A 3BGRA 3WIUA 3M2RA 2VPXB 1MROA 1S72N 2QWOA 3V4IB 1JXEA 3R8YA 3QAUA 1UVKA 1RB0A 1ITPA 4IR9A 2C2RA 4IG0B 1OIAA 1J5OA 3U1LA 1WDDA 4ER8A 3O3FA 3RBDA 4JI0J 3ZSQA 5J2QA 3OSNA 1H74A 4TU8A 4FN5A 3AVJA 4KH5A 2QTDA 3ZZRA 4O3OA 4FZZA 5B09A 4M63A 3LQVA 2G13A 2O01C 4YEAA 3QEWA 2MKKA 3CI5A 1B0TA 3KLHB 1AUDA 3MMVA 5SUHA 5HMWA 1T03B 3MXMA 3W9IA 2IVNA 3JQKA 5JS2A 1D09B 2D5RA 3NH2A 5IWAF 1LWEB 2FGOA 4DL6A 4BR7A 2OD4A 3DI6B 3CQXA 3M8WA 2IDEA 1H73A 3WXLA 4NI2A 5AR0A 5JVHQ 3UN2A 4IEEA 2IYIA 3H98A 2HHXA 5HI7A 3LPYA 4X4RA 3Q8VA 2HLUA 3CC7S 5GIPA 4A48A 3GOIA 3FE1A 1IKVB 2E5IA 2AV5A 3VQQA 1QVGM 2CJQA 2OPSA 3S3OA 1VHXA 2JVRA 1TU0B 1YBUA 2I0XA 3BR8A 2KT2A 2FYXA 3AVAA 1NSKL 5F3TA 1UEUA 2CUYA 1CZBA 3VERA 1B92A 3NDKA 1EKRA 4KJIA 3MMBA 4ZVQB 3OBWA 4O8KA 3TSQA 2KXFA 2GVZB 4B3MJ 4K8ZA 3GG4A 3FEZA 5K20B 2MXYA 2DPIA 3O1LA 3GJRB 2YBVA 3KLFB 2P9NA 1HBMB 1Y11A 4GKKJ 1A7GE 4B1XB 4NXMJ 3M8ZA 4HHTA 4LF7K 4QIGA 2ZEJA 1AYEA 3QNWB 3M8RA 2OZSA 1R0AB 1RU1A 1J5EF 3R2DJ 3V9SA 2OSRA 2F9WA 1HNWK 2CQ1A 5ETRA 4EBDA 4LVNP 5SWMA 2M5YA 3IRXB 2ZF5O 4K5RA 2E5LK 1DURA 2B56A 2PA8D 3ZNJ1 1AZSA 4LF5F 3AA4A 2CPJA 5A8KA 2A3ZA 2YNGA 4IOBA 4USWA 1SBRA 2Q6CA 2B4OA 1N34K 2AJQA 2G1HA 1NDCA 2XEXA 2VG7B 5F8IA 3OYMA 3KMQA 1MDUB 4K59A 5AQQA 3THWA 1IQTA 2QFIA 3ITHB 2G8HA 1V3RA 2QXFA 2AGQA 2V2QA 2Q1LA 4I6MA 1FNMA 4CK2A 5E7OB 3DYAA 1TUUA 1FK9A 3QO9A 2KRBA 4C2MA 3TUZC 2MTLA 2J0SD 3DLGA 1ITGA 4BRLA 2G0IA 3BQ1A 4RW9A 2B4PA 3MXHP 4FS2A 4DPXA 1GX5A 3TZZA 3A2FA 1WTBA 1GMUA 3R2CJ 1WAJA 4FWNA 4PG4A 1X4CA 1ZZFA 4H0VB 5EWFA 4RJVA 1HR0F 4BY9C 1MROB 3I9ZA 1NPKA 5HMYA 4DV0J 1T9VA 1M1HA 3Q0AA 4BHQA 2UU9J 4BS2A 2VFVA 4ECRA 3L7OA 2GJ2A 2KXHA 5F8GA 5LJ3Y 3ASMA 2OEJA 2LFVA 2YWEA 5M1OA 4NXNF 1EQ0A 2JDJA 2ZH4A 1RT3B 4ES2A 3GJTB 4JV5F 4X4OA 3GMGA 3LGHA 1S77D 3CDWA 4ID1A 1HWLA 4KB1A 2QYGA 3ULEA 3SCXA 3KLVA 1YUWA 3OTOJ 1W0HA 2E2QA 2O67A 2ZOMA 4ZJQA 1HNZF 1SJ4P 2MJNA 5HLFA 1A6LA 4HHUA 1VSMA 2VOOA 1Y5LB 3ILIA 3LDOA 4MH8A 3PDNA 2XCPA 4OX9F 3KKRA 4HDGA 3EL2A 4DV4K 3J81Y 2NRWA 5DM7Q 1HBOA 3HKWA 3OTDA 2NXJA 3CFPA 2ZGYA 3FBBA 4WZQA 5DDOC 4LRAA 2UV8A 4A57A 2JEGA 2YCHA 1TFYA 2IC3B 2D7SA 1JJ4A 1YVUA 3OYKA 1D9AA 3SMSA 3M05A 2RIJA 4BRHA 3PXGa 3O5TB 4JI1F 1H7XA 1NLVA 3P31A 2ASDA 3MMBB 4CYUB 2ETJA 5K14B 2E7VA 4RWXA 1HWIA 2DGVA 2NPIA 5LL6Z 2X1AA 3MECA 3PW4A 4QBUA 2K7JA 2GHWA 5KTQA 3H7HB 3GE9A 2J7UA 4AF1A 1ATRA 1O51A 5IV3A 2IDOA 2DHAA 3NRBA 1KHVA 2LU2A 2WSFC 2LKZA 1QTNB 3E9OA 3CCMS 4KPYA 1RUSA 5KI6A 2P5OA 5D78A 4HTLA 5D6GA 2XRIA 3HSJA 3C3LA 1R8HA 1UJ6A 4DR6J 1YI2S 4J9OA 3OVAA 1VLYA 2IS3A 3S9HA 1KP6A 3OHRA 5JLHA 1J6ZA 2NUBA 3NXZA 2NXNA 4Q0BB 1PYSB 3I8DA 2KKZA 4RNFA 1R6YA 1XNRF 2GMLA 1FDNA 2HHVA 3FZ2A 5CCMA 2V63A 3IM8A 4P2MA 3RJMB 5DM7L 3SYZA 1E6YB 3FSIA 2HFNA 2QLXA 1RBRA 5LSLA 4BRIA 2K1RB 1TAUA 3DWLA 3LANA 3JS9A 3G8QA 5D77A 4Y65A 4ZJLA 3H2UB 1R8AA