3M8PA

Hiv-1 rt with nnrti tmc-125
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
555
structure length
551
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of piperidin-4-yl-aminopyrimidines as HIV-1 reverse transcriptase inhibitors. N-benzyl derivatives with broad potency against resistant mutant viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 162
structure length 551
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3m8pA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8pA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8pA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8pA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3m8pA05
2GBZA 2OPPB 5T14A 4FLYA 2G8IA 3DOKB 3DYAB 1LWFA 1NKBA 4DWIA 3DI6B 1RBRA 2DFHA 4F4WA 5J2QB 3QEIA 3V6DB 4KO0B 3OS2A 4M95A 1VSLA 3OYMA 3KHLA 4KHRA 2E9ZA 1BIZA 4R8UB 5KRTA 2ETJA 4O5BA 4FM0A 3OY9A 4MFBB 3P83D 4OVLA 3NH0A 3DOLB 2QXFA 2ALZA 3K5LA 2FJXA 4JS4A 2FLNA 1A5XA 1SV5B 4ICLA 3H40A 1N5YA 3G10A 4J2DA 4E1NA 2J6UA 1TKZA 4FLTA 2ASLA 1BQNA 3RTVA 4J9QA 4FZXC 2HNYA 2J6SA 4KAZA 1GX5A 3HVAA 1TV6A 2UVRA 1Q9YA 5HBMB 4O55A 3V81A 2BR0A 2WHOA 1TAUA 2I5JB 1JLEA 3TQ1A 1RDAA 2D7SA 1S1WA 3KKSA 2CJQA 4ED6A 1WSFA 1C6VA 4DF4A 1RBUA 3PO5A 3ZSWA 5F8GA 2KFNA 3E01B 2YNGB 1TKTB 4NZ0A 3RMCA 5KFYA 1HJRA 1SKSA 4J9NA 5HLFB 5DQIA 1XR7A 1NJWA 1SUQB 1HARA 1SKRA 1LAWA 4GC6A 4NLXA 1J9AA 4O4RA 1ZBHA 3QGGA 3AVLA 3GIJA 4Z4GA 5L1KA 5F8HA 3FDSA 4EO6A 1WSGA 4DTUA 2AU0A 4K50A 2E6LA 1L3SA 5DK5A 1XC9A 3UDLA 4J9PA 4Z4FA 4CHNA 2IM2A 1S1TA 5KG2A 2P1JA 4EBDA 4IKAA 2FBYA 3AVAA 3I8DA 3JYTB 4ECXA 1LW0A 1TKDA 4Y2CA 4Q0BB 2UUTA 4XO0A 4ZPBA 4PUOA 4O0IA 3BGRA 3QZ7A 3RBDA 4DL5A 4NCBA 2W7OA 3ZT2A 3CM5A 4F2RA 1S1VA 3SUQA 4CHQA 4NCAA 4WXWA 5KFXA 1XHZA 2JEJA 2E9RX 1RT6B 4CERA 4ZPAA 2B6AB 3SPZA 3T3FA 1KVAA 2XY6A 1S1UA 1VSJA 3PY8A 5HP1A 3LP0A 3VQ6A 3OLBA 1YTAA 1N56A 1I39A 1RDDA 3ASMA 1RTIA 1ZBLA 2VG6A 5JS2A 5KTQA 2XHBA 3TAEA 3CJ2A 1JLCA 5C5JA 3M9OB 3VQPA 3HSTB 5KFBA 5F8NA 4QCLA 1NJZA 3O3FA 5KG1A 2ASDA 1BHLA 1VRUB 1NNDA 2VG7A 4B08A 1TKXA 2W9AA 1BQMB 1S9GB 3C6TB 4DQIA 2OPPA 3DOKA 4CGHA 4O44B 3DYAA 3VQ8A 4DS5A 4B9MA 1REVB 2G8HA 3DI6A 3KLIB 5J2QA 3V6DA 4KO0A 3KK2B 3HVWA 2RN2A 3OSPA 1RT3B 4R8UA 3V9SA 3QIPB 2QKBA 4EBCA 4MFBA 1SH2A 4J9LA 4E19A 3RAXA 3QINA 4M45A 1T05B 3AO5A 3L2QA 3DOLA 4NYZA 3UPFA 1FKOB 2ZD1B 2B5JB 3AVCA 4F4XA 4HKQA 1RTHB 3PW0A 4Q44A 3PV8A 4ZTJA 2XI2A 4BDZA 2R7YA 4O3OA 4ELVA 4EYIB 3O3HA 2BE2B 1RDBA 3LP2B 1IKYB 2KTQA 2HHTA 3VQAA 3N6MA 1EETB 5HBMA 3ZT0A 1NHUA 3ZT1A 1J5OB 3ZSVA 3MAQA 3SZ2A 4ECTA 2I5JA 3SFUA 4H8KA 2PY5A 1WAFA 4HUFA 4DTMA 4RNFA 1RYRA 4FK2A 3E01A 1T7PA 2YNGA 1TKTA 3H98A 1QSLA 4OJRA 1JLBB 5HLFA 3PJXA 1SUQA 1TK8A 3SJJA 4EEYA 2V4RA 4ED3A 2Z1HA 2C2DA 3CWJA 5KFRA 3HXMA 1NK4A 3I0SB 3LANA 3HPGA 3RWUA 4EBEA 1JL1A 3L2RA 1X9WA 2DTUA 5FDLB 1NOZA 3HPOA 1GOAA 5KFKA 4KHYA 4PWDB 4DS4A 3KD1E 1Z26A 3PHEA 3KIOA 4KHUA 2JLEA 4ID5B 3JYTA 4K4ZA 4Y34A 4G1QB 5KT6A 4Q0BA 1RILA 5KFUA 1YVFA 4I2QB 4NLQA 3CM6A 1S1XB 4J9SA 4QOZB 4I2PB 2VWKA 4CESA 4DSKA 2RF2B 1O1WA 4FLXA 4DTRA 3S3NA 3ZCMA 2OPSB 4OL8A 2YNFB 1S6QB 1QTMA 3SI6A 4J9RA 1KFSA 4XPCA 4ZP8A 1RT6A 2AGOA 2B6AA 4MQ3A 4N56A 2GC8A 4RNHA 2DPIA 5CZ1A 5JS1A 5DQGA 3QZ8A 1HNVB 4ZTFA 2Z1IA 4ZVGA 4LD0A 4W5OA 3ZSYA 3PR5B 1QS4A 3AVKA 1JXEA 1HMVB 5KFVA 2P5GA 2FBXA 1MU2B 4LY7A 1B9DA 5KGWA 2XC9A 4FS1A 4DFMA 4RW7B 1VRUA 3CJ4A 3VN5A 3HT3A 1U09A 5J2PB 3S3OA 4H4OA 1BQMA 1S9GA 3C6TA 2OZMA 4E3SA 4O44A 2QE5A 2X6SA 4ZP7A 4MK8A 1REVA 5KG6A 1TL1B 4CFAA 4IBNA 1ITGA 3KLIA 5DGBA 4E7KA 2WOMB 4TYBA 2O4GA 3H5UA 2WTFA 3KK2A 4IRKA 3BR9A 2AGQA 3PX6A 1RT3A 3K2PA 3QIPA 2Y1IA 1ASUA 4RUAA 3WNHA 4CK3A 4DSEA 1NK5A 2B43A 4F4ZA 4ZVFA 3MR2A 1T05A 4K8XA 2HVHA 1OS5A 3PX4A 1FKOA 4NLUA 2ZD1A 2B5JA 1RTHA 1S9EB 4QWBA 3QIDA 4AHUA 4IG0B 4FZYA 1Z4UA 3PO4A 3KK3B 5KI6A 5CY4A 2CKWA 4FJIA 4O0JA 2BE2A 4Q43A 3LP2A 1IKYA 3SV3A 2BGGA 4CECA 4ZPCA 3HPHA 4MH8A 1EETA 1D5AA 1J5OA 3LDSA 3DMJB 4BACA 2G8WA 3DRRA 1VSFA 1LWCB 4ECQA 3MEDB 4I7FB 3V1RA 3BSCA 1C1AA 4CF8A 4FJ7A 1TP7A 4AHSA 3RRGA 4FK0A 4H4MB 3L2WA 4DL3A 2W8KA 1JLBA 4DFPA 4N5SA 1KLMB 4FJKA 3OSNA 3OYAA 3QGHA 1EP4B 2XY7A 5J2NB 4HUGA 1QAIA 3I0SA 4F4YA 5KT2A 3HP9A 4CGFA 1BIUA 5FDLA 1C0TB 3NGZA 3K57A 1Z25A 4RW9B 3AO2A 4FJNA 4HCBA 4KFBB 3L2UA 4PWDA 5C24B 4ID5A 1DLOB 1C1BB 4DTNA 4GW6A 4G1QA 4FXDA 1HPZB 4CJ3A 1S0MA 4IRDA 4I2QA 1QSYA 5CYQB 1NHVA 1I3AA 2F8EX 1SL0A 3GIKA 4ECYA 2FBTA 1S1XA 5F8IA 3EZUA 4I2PA 1BL3A 3H5XA 5KT5A 1WSJA 2RF2A 4M3WA 4ED0A 1NJXA 3K59A 3NGYA 4O3QA 2HHWA 1JLFA 4LQ9A 4FLZA 2OPSA 1S6QA 1FKPB 1T3NA 3V9ZA 2KW4A 4FK4A 1JIHA 2HAIA 1JLGB 3Q8SB 3OL7A 1D9DA 4ED8A 1HNVA 2IMWP 3VQ5A 1EXQA 3BSAA 2R2UA 4NLGA 5T7BA 4XIUA 1QE1B 1HMVA 1MU2A 3LZJA 2ZKUA 3QETA 4BDYA 4B9VA 1NK6A 4DL2A 3NBPB 4CJWA 4RW7A 4KV8B 2YNHB 3DRSB 4Y1CA 5J2PA 5KFZA 4WZQA 1DTTB 3G0ZA 2WRMA 4B9LA 4M3ZA 1XHXA 1TL1A 4MIBA 4QPXA 4Z4HA 2HHSA 2FVCA 1U04A 2HHVA 1KHVA 4ECSA 2WOMA 5J1EB 4KB0A 2G8UA 2G8FA 3CQ8A 3KD5E 3OYKA 1KVCA 2WB4A 4HVJA 4E1MA 4LSNB 1SKWA 1S6PB 3PZPA 4EZ6A 3T5JA 3IN5A 3AO1A 1D9FA 1NK8A 4ZP6A 1TVRB 3KMSA 1Q8IA 3HK2A 1S9EA 3EPIA 2HNZB 3H59A 2D0BA 5FRNA 4TN2A 4IG0A 4O3SA 1K1SA 1LW2B 3B6OA 3KK3A 3IG1B 2QKKA 4HUEA 4FM2A 5I3UB 1G15A 1WSIA 1ZBFA 3SUOA 3E51A 4TY8B 3VQ7A 4Q8EA 3T5KA 4JLHA 3T5HA 1IKVB 3DMJA 3JSMB 1VSIA 2IGIA 1LWCA 4KHNA 3MEDA 4I7FA 2IOCA 4C8NA 2HMIB 3PVXA 4WZMA 1W9HA 4CEFA 4KBIA 4H4MA 1ZTWA 1RBTA 4W5NA 4HYKA 4DTJA 3M8RA 2XCPA 4FLWA 1KLMA 5EWGA 3RR8A 4E0DA 1EP4A 2G8KA 4LSLB 5J2NA 4TQRA 2FBVA 1S0NA 4DSJA 2W9BB 4FJ5A 3MR6A 5KFCA 1N4LA 5C25B 3ZT3A 4IKFA 2IM3A 3H5SA 4TSXA 3C94A 4C8MA 2UVWA 1C0TA 4O4GB 3CDEA 4EYHB 4RW9A 3MF5A 3OHBA 3SCXA 4KFBA 4OPJA 2R2RA 4ZPDA 4Y1DA 4CJ4A 4FVMA 5C24A 3KOAA 3U3YA 1SH0A 1DLOA 4Y3CA 1C1BA 4K4WA 1RT7B 3ZSXA 1SL2A 1HPZA 1XR5A 3QNNA 4FJLA 5CYQA 2Y1JA 3H4BA 3S9HA 2D0AA 2O4IA 1KRPA 4CF2A 2GIRA 3NCIA 3IGVA 1WNSA 2D3UA 2IS3A 3V6KA 1IM4A 5C42B 1FKPA 2HWHA 3KKRA 2ZE2B 5DGAA 3L3VA 4FZZA 1JLGA 1C1CB 3L8BA 2LSNA 2HHQA 1QAJA 3NE6A 4RW8B 4E7IA 4KPYA 4CIFA 3CO9A 3OYCA 3V6JA 3A2FA 3QEVA 3DDKA 1QE1A 3OL8A 1JX4A 3L3UA 4RU9A 1GOCA 3LAKA 4KI6A 3NBPA 3IRXB 3NL0A 4KV8A 5KFSA 4K4XA 1S10A 2YNHA 3DRSA 4KB1A 4N41A 1VSEA 1DTTA 2AJQA 1J53A 1TK5A 3M9NB 5J1EA 2FVRA 4FJMA 4LH4A 3OVNA 2R8GA 3LP3A 4LSNA 4M3RA 3BQ2A 1S6PA 2A1SA 3K5NA 1FK9B 1RDRA 1U4BA 3V9UA 4N76A 1TVRA 1ASVA 3VA0A 3ZSQA 1U45A 3HO1A 1RT4B 2ILYA 2HNZA 1JKHB 2IM1A 1RNHA 4FS2A 3AVBA 4CGIA 4F2SA 3CJ3A 1W25A 1LW2A 3EZ5A 3NH1A 1YT3A 3IG1A 5I3UA 1X9MA 3LPTA 4NLRA 4DSFA 5F8LA 3OYLA 1U48A 2JEFA 4TY8A 1RAJA 3PW5A 4J9MA 3QIOA 5SZTA 3HJFA 4CEEA 1IKVA 2RKIB 3JSMA 4ID1A 1SV5A 3FFIB 4CJLA 2R8HA 3N6LA 3UQSA 2HMIA 4J9KA 4FM1A 3MEGB 3NF8A 1BCOA 1JLQB 1UOCA 3AVMA 4DU3A 4CJQA 3RBEA 3FRZA 2DPJA 4CCHA 3T5LA 1WAJA 4LH5A 3NMAA 3M8SA 4U6PA 2XY8A 3HP6A 1GOBA 3DLRA 2HNDB 1QHTA 1CXUA 4LSLA 2XI3A 3OYFA 3EPGA 4C8LA 4ED7A 2W9BA 1RCHA 1BCMA 4M3UA 5KG5A 3AA3A 4KTZA 2R8JA 4CIGA 5C25A 4M42A 3FQLA 4CFDA 1S5JA 5HRPA 2FVQA 4MKBA 1RT1B 2KZMA 4O4GA 3RB6A 4URGA 2FLLA 3TAMB 2Z1JA 3P1GA 5L1LA 4IFVB 2IJNA 4DLGA 2KQ2A 3BQ0A 4B9NA 1RT7A 1NOYA 4NCGB 3KHHA 5KFAA 4J2EA 4I9LA 3OYBA 2IC3B 4KREA 1B9FA 3T1AA 5FRMA 1N48A 2AWZA 4KKOB 1CXQA 3ZT4A 4CHZA 1KSPA 5C42A 4DSLA 4DQRA 2ZE2A 3Q8RB 5KFFA 3NAEA 4URSA 4M94A 4DU1A 3QERA 2ITGA 1C1CA 4MIAA 4F3TA 5KFWA 4RW8A 1LV5A 2IJFA 2BQUA 1NK9A 3OYIA 2PYLA 4OGEA 2D5RA 1UA0A 4FW2A 1KVBA 3SQ2A 3GV8B 5KFDA 3IRXA 4IH7A 3PUFA 3OYEA 3OYHA 3WNGA 3D28A 3MFHA 3OYJA 2BRKA 3QEXA 3OYGA 1S48A 2HWIA 2HHXA 4DSIA 2KZZA 3SUPA 3QO9B 3ISND 4GMJB 4W5RA 3PW2A 4HCCA 1DTQB 5KFHA 1UWBB 3OL9A 4PQUB 4B9TA 1FK9A 2I1RA 4OPKA 4FYDA 4CHPA 5KFLA 1S9FA 4RNMA 1RT4A 3AA5X 2WK4A 1JKHA 1IKXB 4JUZA 2X78A 1JLAB 3PX0A 3QYYA 1MMLA 4KI4A 4TY9A 4DTOA 4R5PB 1KFDA 4WYWA 3D0PA 4JV0A 3HM9A 3SQ0A 3OL6A 4NLTA 1JL2A 2Z1GA 3FFIA 3NHGA 4YP3A 3ZSOA 2V4QA 3DLBA 2NUBA 4AHRA 1JLQA 3C95A 4KTQA 4C8OA 1HYZA 4ECRA 3O4QA 3TI0A 2YHAA 2UVUA 4Z0UA 2HNDA 3THVA 3QGIA 2AX1A 1RA6A 2HB5A 2XGQA 4Z4IA 3AVJA 1D8YA 5L9XA 1S97A 3GQCA 2BDPA 4YR3A 1RT1A 1W0HA 1XWLA 3TAMA 2GUIA 3ZSZA 3VQBA 4DFJA 4IFVA 4CHYA 1T94A 1X9SA 3EY1A 4NLDA 4CJVA 3NH2A 4CHOA 1BI4B 4IR1A 4KHMA 4OKJA 5KT3A 4QAGA 4QWAA 4NCGA 4W5TA 5D3GB 1JXLA 2DFEA 4CJFA 1A5WA 1XR6A 2IC3A 5KT7A 3MXJA 4CK2A 4KKOA 1N6QB 1RT2B 4AHVA 4FW1A 1EKEA 1IKWB 1HQEB 1RBSA 2X6NA 2IAJB 2AQ4A 2FLPA 4NLPA 4NYFA 4CGGA 1IH7A 3WNFA 4NRUA 1S49A 2B4JA 3HHKA 5KFEA 4KAIA 3AA4A 4MK9A 1BISA 4IDKB 5L1JA 2IBKA 4F50A 4O3NA 3D45A 4FLUA 3V9XA 1WSEA 2YNFA 3AVHA 2A1RA 2BQRA 2GV9A 4CEDA 4ZHRB 3QLHB 4OKKA 5KFOA 3MR5A 3F9KA 3FSIA 4YQWA 4ZMMA 1R0AB 4ECWA 3VQ9A 1B92A 4KRFA 3QO9A 1IG9A 1RA7A 1HQUB 3SQ4A 4YMEA 1KTQA 4DF8A 3DM2B 3LAMA 1J54A 2XO7A 4M3XA 3H2LA 3NF6A 1DTQA 1RTDB 4GC7A 4NLYA 4B8AB 1UWBA 4DL6A 4PQUA 4BWJA 3M9MB 4F4KA 2IDOA 3AO4A 1BGXT 1IO2A 4CJUA 1NK7A 5I42B 4J2BA 3SPYA 5L1IA 2C22A 3RB0A 1S1VB 4CJ5A 1IKXA 3SUNA 2C2EA 3TANA 1JLAA 2YKMB 4O3RA 2OH2A 4GVMA 2BQ3A 2WONB 2FJWA 2D3ZA 3M8PB 4CE9A 2EX3A 4R5PA 1C0MA 3NDKA 4EZ9A 4F3OA 4QWCA 1VRTB 4BWMA 4FJHA 4EP5A 4RNOA 3BSOA 3CFPA 5SWMA 4QWEA 4JRPA 4FBUA 1VSDA 4AHTA 1D1UA 2XGPA 3O3GA 2J6TA 4FJJA 4NLOA 3ZSRA 1S0OA 3MXMA 2YHBA 4DL4A 4RW4B 2JC1A 3G6YA 1A5VA 3LZIA 3KLFB 4B9SA 4CJEA 5F8MA 4B8CA 2HW3A 1X1PA 1RTJB 2P51A 3LPUA 4CGJA 3C6UB 4OGCA 4E7LA 3V9WA 4OKEA 1WSHA 3GYNA 2O5DA 1UA1A 3KTQA 1U49A 1QQCA 1VSHA 4NLSA 2AGPA 4RNNA 3DLKB 1CLQA 1D0EA 4J2AA 5EWEA 1BI4A 4CEOA 5DQHA 4DQPA 4WXOA 3V1QA 5D3GA 4PA1A 1NJYA 4DQQA 3TVKA 3P5JA 1NKCA 1CZBA 4DMNA 4DLEA 4KHWA 1N6QA 3AVNA 5KRSA 4KTWA 4M3YA 4BE0A 1RT2A 4U7CA 2F96A 3AO3A 2Q3SA 3Q8PB 3V1OA 1IKWA 2R2SA 4E7JA 1HQEA 2IAJA 4BE2A 2W9CB 4W5QA 1WNEA 1WLJA 5HROB 4AILC 4NYNA 1ZBUA 1ZTTA 3ULDA 5E41A 5DLFA 1RBVA 4B3OB 4EP4A 5K14B 4Z4EA 4RZRA 1SH3A 2XRIA 4TQSA 4IDKA 3KJVB 2F8SA 3I0RB 1TGOA 5KG3A 3KHGA 2YKNB 1HRHA 4ZHRA 3QLHA 4JRQA 4ED2A 1L3VA 1S4FA 3CDWA 4DFKA 3OJUA 3SV4A 3OYNA 3OJSA 4DL7A 2OA8A 1R0AA 3CDUA 4QW8A 1HQUA 3IGNA 3MECB 2AX0A 4L8RB 4DTXA 4K4VA 4RW6B 2ILZA 3DM2A 1RTDA 3DLEB 4FJ9A 4KHQA 3HVTB 5I42A 3TAGA 4TYAA 3ALYA 4DEZA 4BE1A 2R8KA 3BSNA 1ZETA 3LP1B 1T8EA 3MTKA 4ZP9A 2YKMA 3TABA 4CIEA 3B6PA 4M3TA 4CGDA 4UQGA 1K1QA 2WONA 3M8PA 5F8JA 3M8QB 4WFXA 1RT5B 4ECZA 1TAQA 5JXSA 2RDIA 3T19A 1VRTA 3CYMA 4OLAA 2PZSA 4NLVA 3CIZA 4FJXA 2OZSA 1K6YA 2BRLA 4N47A 3RMAA 3SYZA 3GIMA 3V6HA 4HHTA 2VG5B 5DG8A 4K4UA 4IR9A 4H4OB 1HNIB 3H4DA 3Q8QB 4F8RA 4RW4A 3CJ5A 3RMDA 2D41A 3KLFA 2P5OA 3AVFA 3FQKA 3NAIA 5DG7A 3DLHA 1RTJA 4K4SA 3KMQA 3NF7A 3C6UA 3LWMA 3TARA 3IS9B 4Q45A 3CVKA 4J9OA 4I9QA 1CZ9A 2E6MA 2C2RA 3KLHB 4IFYB 3TAQA 3PR4A 3KLGB 1EX4A 3KK1B 5F9LA 2HVIA 3RB4A 2OPQB 3DLKA 2E4LA 4QWDA 3WNEA 5DG9A 1ZYQA 3MFIA 2UUWA 3MEEB 2YNIB 1C0UB 3QEPA 1YTUA 4Y2AA 4AH9A 4WFYA 2C28A 4E7HA 1ASWA 3NGDA 1VSKA 5KG0A 4KSEB 4DG1B 5J2MB 3TAFA 4CJKA 3I5CA 3U6FA 3DRRB 4IH5A 1NK0A 3PW7A 4KB7A 3GIIA 1TQLA 2W9CA 4TXSA 5HROA 4CEBA 4IG3B 3RB3A 1JXBA 2IM0A 2JGUA 3RR7A 4B3OA 4IRCA 5K14A 3MXIA 3UIQA 4ELUA 5DMRA 5HRSA 2KFZA 2BANB 3VQDA 3KJVA 3HYFA 3I0RA 3BREA 4R0EA 2YKNA 1C2PA 4FBTA 4RG8A 2QV6A 3OHAA 4CFBA 2DFFA 4KE5A 3G86A 2FVPA 4BDPA 3RMBA 3LALA 4Z4CA 3SNNA 4JV1A 4FLVA 3O4NA 4CEAA 2ASJA 3MECA 4HTUA 4KHSA 4CEQA 2X74A 4Q8FA 4RW6A 2XCAA 1KHWA 1HYVA 5KGXA 4EO8A 3TWHA 2OPRB 4FJGA 4X2BA 3DRPB 3DLEA 1QUVA 3K5OA 3V4IB 3HVTA 3VQSA 2ZQBA 2V9WA 4CJSA 3RRHA 2EC0A 5HRNA 1KLNA 4DU4A 2FVSA 3HVRA 2W8LA 1RYSA 1JLFB 2JEIA 3LP1A 5KFIA 3L2VA 4IQXA 1TL3B 3OYDA 3NF9A 3QNOA 3ISNC 4K4YA 4YR2A 1WN7A 4ZVEA 3H08A 1U47A 3VA3A 3ITHB 3M8QA 5KFNA 1RT5A 3KLEB 3G6VA 5KFQA 2R8IA 1CSJA 4WFZA 5KFTA 2ATLA 2YV0X 4CF1A 3BDPA 4TLRA 5KG4A 4YR0A 4CFCA 1YVUA 4CJPA 4K4TA 4OLBA 2VA2A 1LWEB 2VG5A 5KFPA 4XPEA 2XY5A 1FXXA 3G6XA 4DTPA 5EUHA 1HNIA 5CYMB 5FROA 3QEWA 3RAQA 2RKIA 4WE1B 3GV7B 1HYSB 1RDCA 1L3UA 3KLVA 3OS1A 1T03B 4WYLA 3IS9A 5EWFA 3MEGA 4B9UA 4ZVHA 3S3MA 3KLHA 4IFYA 3DLGB 4IOBA 4ECVA 2VWJA 4JS5A 1L5UA 3KLGA 3CFOA 3KK1A 4O3PA 1F21A 1LWFB 2OPQA 5F9NA 3NAHA 1VK0A 4FJ8A 3H5YA 3MEEA 1GX6A 2YNIA 3SQ1A 1C0UA 3TAPA 2WCXA 3OS0A 4DTSA 2XWYA 3ICLA 4DG1A 5J2MA 3GILA 3NGIA 3GV5B 3PJWA 4NRTA 4RUCA 4ICLB 1N5YB 4LQ3A 4K8ZA 5HRRA 3K5MA 3PW4A 1TKZB 2JEGA 4CJRA 1BQNB 4ED1A 4YNQA 2FC0A 2HNYB 3NFAA 4IG3A 3EYZA 3VQCA 4CF0A 2V0NA 3U3GA 1TV6B 3N6NA 5CZ2A 3MR3A 3SI8A 4Q5VA 3I5BA 5JUMA 3I5AA 2BANA 3BJYA 3V81B 3K58A 1LAVA 1JLEB 2GIQA 1S1WB 4QW9A 5KG7A 2D0CA 5DLGA 2W42A 4YFUA 3BQ1A 2OYQA 2FJVA 1KCFA 4FCYA 3VQ4A 3VQQA 3NKYA 3AV9A 4ECUA 3AVIA 3AVGA 2OPRA 2IA6A 3DRPA 3D5MA 4E89A 3CJ0A 3V4IA 2HHUA 1TK0A 5EDWA 3SFGA 1SL1A 4PY5A 5KFJA 2G8VA 1XI1A 1S1TB 4URQU 1TL3A 1LW0B 3TR8A 5KFGA 4NLWA 1UAXA 3ITHA 3KLEA 3AA2A 5KFMA 2PYJA 2ATQA 2UVVA 2F8TA 4PUOB 4DQSA 3BGRB 4H54A 2R2TA 4JV2A 3IAYA 3OLAA 1L3TA 3CFRA 4M41A 3F73A 1Y97A 2JC0A 2W7PA 1Q9XA 2DY4A 4C8KA 2RDJA 1QSSA 4IH6A 1LWEA 1S1UB 5HP1B 3LP0B 1NKEA 3HKWA 3QESA 1I6JA 3KNAA 3CG7A 3UR0A 5CYMA 2VA3A 1RTIB 2VG6B 3HL8A 1VSMA 2EHGA 4MKAA 4WE1A 4CJTA 2QK9A 4CF9A 1JLCB 1HYSA 3LWLA 4MK7A 3VQEA 2E9TA 2RPIA 4ELTA 1T03A 5KT4A 1ZBIA 4CEZA 2VG7B 4AHCA 4CK1A 3KHRA 1TKXB 5EU7A 4G3IA 3DLGA
chains in the Genus database with same CATH superfamily
2OPPB 5T14A 4FLYA 3DOKB 1IBLF 1JJHA 2ZKTA 1DY3A 1NKBA 2HVEA 2NZ4A 1RAHB 1RBRA 2DFHA 2KL8A 5J2QB 1FRJA 1YJ9N 2WVBA 2E9ZA 1BIZA 3MM9B 4R8UB 2NSBA 2ETJA 2HQ3A 4H0XB 2F7TA 1GEHA 4DXLA 3HHDA 3DOLB 3MX5A 3J7YU 4C3MA 2NXCA 3G10A 3FZ2A 4ZVTB 2XMVA 1JMTA 4KGZB 1TKZA 4FLTA 2AZ3A 2XLIA 1FT8A 3RTVA 3J80O 4FZXC 2HNYA 2ZWHA 2BX6A 3HI0A 4KAZA 4MDAA 1R0CB 3N01A 3D2WA 1XTZA 4G1IA 2UVRA 3UCZP 1I1GA 3LM2A 2OFGX 4EIAA 3V81A 1RDAA 1S1WA 3KKSA 3IR7B 4LFAF 3PO5A 5F8GA 3E01B 4IOAQ 1TKTB 4NZ0A 1HJRA 4WBFA 3HLUA 4DV4F 3SEOA 1YJVA 4JI3F 3TJ8A 2MZQA 3AOCA 4E8UA 1LAWA 1F60B 1J9AA 3QGGA 1T44A 2O8FA 3IR5B 1SB6A 4Z4GA 1U8WA 3L6QA 3VF4A 3FDSA 4C6AA 1WG1A 1L3SA 2E6LA 4BRAA 3PKMA 4CZLA 1XC9A 3VEVA 3RG6A 4Z4FA 2HQFA 4EBDA 1XNRJ 2DPNA 3AXMA 3FCVA 1K73T 3MM7A 1DKGD 1LFPA 4Q0BB 2CYYA 4NOHA 1HNXJ 3R7NB 4I64A 4DL5A 1OYEA 2I7NA 1IBMJ 5IWAK 2B7BB 3GFXA 4NEYA 4WXWA 2M0GB 5KFXA 2JEJA 2QZ8A 3SPZA 1TYQA 5HP1A 2DIUA 4FXWA 1SKUB 2M8DB 1I39A 1RTIA 2K3IA 3VALA 2VG6A 2F7VA 1CQMA 1PJ6A 2YWGA 5F8NA 5A76A 2VFSA 1JQGA 1GFWB 3F44A 2JZ5A 1WOSA 5D4NA 2RS8A 2RILA 5BYRA 2KM8B 1NMDA 2G8HA 1XNRK 2K3KA 3V6DA 4KO0A 3KK2B 3HVWA 1R27B 3TPQA 1CS4B 1RT3B 2ZM6F 3QIPB 1HNXK 3SSQA 1G3OA 4EBCA 3DOMB 3LA0A 4MFBA 4BRFA 4E19A 4A8OA 2HYIB 3RAXA 3D1QA 3QINA 4JHDA 3ZYYX 2ZD1B 2W1BA 3PW0A 4FYXB 1R6VA 4ZN1A 4USMA 3EVOA 3PRVA 5AJ3J 4EYIB 2GO8A 3O3HA 1RDBA 1UVLA 1H1VA 2JHEA 1IKYB 3OR1B 3VQAA 3N6MA 5L38A 3ZT0A 3RW7A 1ITPA 1J5OB 4H4KA 3MAQA 3SZ2A 3GSIA 5JICA 4ECTA 3IMXA 1KC8T 3SFUA 5AQYA 1YIJN 4JI2J 4H8KA 2E44A 1KKHA 2P9GA 4HTIA 4FK2A 2CJKA 1JLBB 5HLFA 3SQGA 1CJTA 3JTOA 3P38A 2AKWB 2C2DA 4W90B 4K59A 1VQPS 3I0SB 2GHPA 5GAHU 1QZ5A 4KYZA 4LREA 5FDLB 1WEZA 1NOZA 3AODA 1K8AT 1Z26A 3PHEA 2ZH7A 3S7RA 4HHJA 3C6AA 5BREA 2NLXA 1J6ZA 3JYTA 3C15A 3V2UC 4BC9A 1AFJA 5KT6A 1X4AA 4A8YA 4ZIWA 1RILA 4AT1B 5KFUA 1YVFA 2P2CB 2E5IA 5AJ3K 4I4BA 4CESA 4DSKA 1O1WA 5LJ5Y 1NNEA 4J9RA 2PGCA 3ZTSA 1KFSA 2VGNA 1U1PA 1ESVA 4ZP8A 3NNCA 4JI2K 2AGOA 2B6AA 4I67A 4HACB 3GWCA 5CZ1A 1V3RA 3PDNA 2ZH5A 1S99A 5D6GA 4ED5A 3M5RA 2DRAA 3J7AN 2Q2RA 3T7ZA 1JXEA 3N4WA 3VF6A 1QTNB 4LY7A 3MAAA 2P9NA 2ZWPA 3FGVA 1QDUB 5F0WA 2XC9A 3N0VA 1U25A 4DFMA 2YX1A 2GWKA 5J2PB 1S9GA 3FJ2A 3EGNA 4ZP7A 4MK8A 5LT5A 2C2ZB 2YY3A 4E7KA 4DCPB 2MB0B 3BZCA 2A3ZA 3BR9A 3W1YC 3K2PA 5LMUF 1EB0A 1P9YA 2LQJA 2B43A 2HF4A 4F4ZA 1UVJA 3MR2A 1T05A 3TVZA 3M6XA 2V34A 2HSEB 3PX4A 4KGVB 2B5JA 1RTHA 2BE7D 4AHUA 1Z4UA 2QSFA 2QM1A 2LDYA 2GTDA 1RTZA 5CY4A 5B09A 2BE2A 4OI4A 4O0JA 4Q43A 3OFFA 4KY3A 3LP2A 4A62A 4JI1F 2RU9A 2GUPA 2Y1LB 3LDSA 1VQ6S 4BACA 2G8WA 2B4PA 1VSFA 1LWCB 3S01A 1SJRA 1XIQA 3VESA 3BSCA 2PA8D 2VQFJ 1HBNB 1NJIT 2ZC3A 2QJ3A 2V5HG 4N8NA 3VMFB 4W92B 1DQ8A 3QGHA 3THYB 4OI3A 4HUGA 1QAIA 2JNJA 4F4YA 3CCVN 1IV0A 3ZZZA 2UXBK 2NRTA 3UD3P 1KOHA 4BHQA 3K57A 1S0VA 5IS2A 4FJNA 1IXKA 4HCBA 2P9UA 2DH7A 1FO1A 4P2SA 5C24B 2A42A 4DDFA 4ID5A 4G1QA 1DHMA 1Q1KA 4OYOA 2XM3A 5AXNA 1HPZB 4CJ3A 2QFIA 5HO4A 2N7CA 2HF3A 1SL0A 1I3AA 3J7A1 2F8EX 1HBMA 1RJJA 5AZJA 5GIPA 4DPWA 1HBUB 2A5XA 4M3WA 2CQBA 4O3QA 2UU9F 2OPSA 2CQDA 2BW7A 2ZUAA 4WYBA 4FK4A 1JIHA 1JLGB 3OVBA 4P9SA 4RCHA 4JKBA 4HDHA 1HNVA 5ETTA 1EXQA 2GVDB 2R2UA 3G4SS 1J5EJ 3X3UA 4XIUA 4PXBA 1S79A 4M7YA 3MN9A 1K8KB 1RAOA 1RBLA 2ZUGA 2NLWA 4RW7A 3DRSB 3W2VB 5BRFA 4PHTX 3HHLC 4M5MA 2VFVA 4QPXA 5MAOA 2FVCA 1KHVA 4ECSA 2WOMA 4TU8A 1VC0A 2NR0A 1KVCA 4IOCL 2UUAF 2MMYA 1D9FA 4ZP6A 1FXRA 1JNZB 4JI6F 4ZVUB 3H59A 1Q79A 3EZWA 3PSFA 5FRNA 1LW2B 3B6OA 3KK3A 3IG1B 1RDWX 2QKKA 5A8WA 1R31A 4XAKA 1G15A 3E51A 5D77A 3FZLA 5T7LB 1FJGK 3T5HA 2GZOA 3JSMB 2J8SA 4DV1J 1N36F 4F9OA 2A3JA 3GPAA 4KHNA 4C8NA 5D0EA 2HMIB 5L46A 2ZH1A 4WZMA 1W9HA 4LFBF 2B3TB 4CEFA 1ZTWA 5DM7Q 4W5NA 3OV7A 2CH5A 1FTCA 1UWAA 2PI5A 2HHHJ 4FLWA 2CWXA 1EP4A 3JSBA 1VQLN 4JI4K 3VEOA 4KH6A 3CJRA 4OHWA 4FJ5A 4FN5A 5FPDA 2Q1LA 2BKPA 5C25B 2V2QA 2EEYA 3C94A 2UVWA 3HX9A 2FHMA 2O8CB 3CJQA 3Q22A 4RW9A 2HGLA 2KG0A 4BQLA 4JKHA 2FJDB 4DV5F 4BR9A 4CJ4A 3AA8A 3TOQA 1TMMA 4K4WA 1RT7B 2QWOA 3ZSXA 2FSKA 2ZNZA 1M5HA 3D68A 2Y1JA 1T3VA 2R9LA 1UVIA 1U8SA 1IBLJ 4RL1A 3QPIA 2K2PA 3C16A 2Z2YB 3IGVA 1NGEA 2CQIA 2IS3A 2LXUA 1QVGR 1EKSA 1FKPA 3KKRA 4DV1K 5DGAA 2CGLA 2Z56B 4FZZA 4DV7F 2BA9A 3FBEA 2LSNA 3MDFA 5CE3A 2YKAA 3NE6A 2G0CA 4E7IA 3WXMB 3KDNA 3QEVA 4UZCA 1U2RA 2HHHK 4O0NA 2HG4A 3OL8A 1ZZFA 2BM1A 3NGRA 1GOCA 2FY1A 3NBPA 2GX8A 2FGOA 4OZNA 3NL0A 2RHSB 3M6VA 5KFSA 2YNHA 1V4TA 4KB1A 4ZK7M 2HK2A 3A8EA 3SCIE 1ZM9A 3NRBA 3M1VA 1AXQA 1J53A 4LF4F 4PXEA 3DN9A 5KOWA 3M9NB 5J1EA 4LFAJ 3L7OA 4LH4A 3LP3A 5AQFA 1VQ7N 3AJ2A 1VJQA 4L73A 2ZVIA 5ETKA 1WSRA 3K5NA 1FK9B 2CJBA 1IBLK 4UZBA 4OYWA 1U4BA 3V9UA 1TVRA 2JJ4D 4DV4J 2ZGYA 2L9WA 4CGIA 4F2SA 3O9UA 5AZIB 3CJ3A 4J7CA 2GQQA 4LR7A 3FEZA 1URNA 4NLRA 1U02A 3E3XA 2O66A 3MTJA 1U48A 3QT5A 3PW5A 1KXPA 4J9MA 8ATCB 3WEEB 4CEEA 4EFHA 1PCAA 3FFIB 4CJLA 2UYTA 1R8BA 3SAFA 4DN0A 3KG4A 2PO4A 3ENAA 3GJRB 1JLQB 2E5JA 4CJQA 4CCHA 3FRZA 1RSCA 4DV2J 3T5LA 1WAJA 4LH5A 3AGRA 4U6PA 2XY8A 3HP6A 3DLRA 2MQ8A 2DGUA 3OYFA 4DQ8A 2UXDF 4LFAK 4L3NA 1BUXA 2R8JA 1H2UX 4CLLA 1VHXA 2OMOA 1RT1B 2KZMA 3ZTQA 4URGA 3TAMB 3RZAA 1M1HA 5L1LA 4DV4K 2B9EA 3GFYA 3D2FB 3BQ0A 4JI3K 4BR0A 5HJYA 1JXVA 1X5SA 3A3NB 2IYIA 4JNEA 2BH1A 2XLKA 4DR4F 1D8ZA 4Q7AA 4MLHA 3M8WA 3O9QA 3CTRA 4NYOA 1B9FA 5FRMA 2CQ3A 2AWZA 4KKOB 2FC9A 1CXQA 3ZT4A 4CHZA 1KSPA 2MQQA 1WOQA 4ES3A 2NSCA 5KFFA 2ZJPL 1FESA 3NAEA 6FD1A 4DU1A 3AARA 2ZM6J 4MIAA 2QA2A 4F3TA 4RW8A 2W4DA 3ZEUA 1ILYA 2IJFA 2BQUA 3OYIA 5LSRA 1YGYA 1UA0A 2MQNA 3OUYA 3GV8B 3EO3A 4RR5A 3IRXA 3PHTA 1PAEX 4IDHA 1QAXA 4WIIA 3KKFA 3QMLA 4CZHA 3DGVA 2BRKA 4WWSA 3MHYA 3OFHA 1S48A 2HWIA 2HHXA 2L3MA 1XMQF 1HBOB 3LF0A 3FR0A 4JKFA 1W2BM 2MEWA 4GMJB 4W5RA 1WG5A 1OY8A 3TUJC 3VAFA 4HCCA 3HCXA 3KNGA 5ELZA 1UWBB 1YXQA 4PQUB 4NZ7A 4QYRA 2MPUA 5KFLA 3F41A 3AA5X 2XSFA 4K0KF 1JKHA 2W25A 2F1FA 1G4CA 4YS2A 3K0SA 3PX0A 3CIPA 1OQ3A 4FPRA 2ZM6K 1SCJB 4QR2A 4KI4A 4XDDA 4AM7A 1GMWD 4ZLJA 1ATSA 1NGFA 1N32F 3SQ0A 2ZBQA 1IN0A 1JL2A 1WBDA 2Z1GA 5AQKA 3ZSOA 3L7UA 2QIFA 4HTJA 5DDOC 4IQMA 2DB1A 1FWPA 2Q36A 3C95A 4DX6A 1HYZA 5AQIA 4ER8A 2YHAA 2UVUA 2WVDA 1VQOS 3THVA 1K0VA 2AX1A 5SUHA 3R5CA 3B82A 2XGQA 3IAM9 4Z4IA 4BR2A 1S97A 2DR5A 4NPOA 2BDPA 2QFJA 2F9JA 4DFJA 3ZSZA 1LXJA 3FC9A 2COLA 3TA1A 4CHYA 1UCNA 4DJBA 3WIUA 4CJVA 4LF8F 3CXCM 5F3TA 4CHOA 2HFVA 1VFJA 1XMOF 3VHQA 2V8VA 2YQ0A 4NCGA 5D3GB 1XK8A 4OHZA 4CJFA 1JJ4A 2XYGB 3W7BA 4A8XA 2ZH9A 2XEXA 1Y0HA 2H5EA 1KAYA 4A5BA 5BYQA 1EKEA 4H0OA 4ILJA 1IKWB 3VZIA 2RQKA 1HQEB 3N5BA 1FRIA 4NYFA 3C0BA 1RZMA 1YJWN 3ATUA 1BC6A 4NRUA 3HHKA 1DRZA 2WTUA 4KAIA 1Z05A 3GYXB 3J7Z5 4LRDA 4MK9A 3T9NA 4EGLA 2DTJA 4DZDA 4DHYA 3D45A 2KVQE 2A1RA 4LVOP 4F36A 2ZDPA 2B9XA 5GAGI 4JI0F 4I56A 3QLHB 2D1KA 3F9KA 1WG4A 4JI1J 3R3TA 2QEXS 3A8YA 1IVZA 4ECWA 3R5DA 3QO9A 2QA4G 2ADCA 2X3DA 2R7TA 1WD6A 2LQ8A 3POTA 2G0IA 1YBTA 2CPXA 1JWWA 3E66A 1M1KO 3HSDA 1RHMB 4F4KA 4AUKA 1BGXT 1IBCB 3U02A 4J2BA 3IR6B 4JKGA 2DYAA 3RB0A 4CJ5A 2Q79A 4FNIA 3GR1A 4DV6F 2JH3A 5LMUK 3MR7A 4GVMA 1UPPA 1AFIA 3M8PB 1N0VC 4CE9A 4ENOA 2EX3A 4R5PA 5BRHA 1FNOA 4EZ9A 1I5OB 3DGPA 4F3OA 2R7WA 5M2PA 2ZITA 2W2PP 5SWMA 4ES2A 3TTDA 4JRPA 2QLXA 4FBUA 4AHTA 1UZHA 3CJ7A 5GIOA 3GL1A 3CD5A 3VGKA 4ETZA 4FJJA 1VQ5N 2D9OA 2DNNA 3UWTA 4JI1K 1S0OA 3J81j 5IQ6A 2UU9J 3G6YA 1A5VA 1X4GA 5F8MA 1VQ8N 4LC9B 4B8CA 5LJ3Y 1RTJB 2P51A 2BJ1A 4CGJA 5BPNA 3V9WA 1UEVA 1OYDA 1JK9B 4J5OA 1U49A 4CTAB 2CJAA 5AQVA 3SAGA 1FE0A 1D0EA 2DNYA 2IVMA 5GADU 1BI4A 3LL3A 4CEOA 3FEYB 1F0XA 2ZOMA 4L72B 1NJYA 4LUBA 2O8BB 1NDPA 4F4AA 3AVNA 4LF7F 3G25A 3GU0A 4GVBA 4UW2A 3W3SA 1YSJA 5GAHP 4LRBA 4CO5A 2BE9B 2X3GA 2IAJA 5B7WA 5BYSA 2W9CB 2CQGA 4PPDA 4GKKF 4W5QA 1WLJA 5HROB 5HI7A 3HF5A 2UUAJ 4NYNA 1ZTTA 2L9DA 4OJHA 4JI6J 1XNQF 1X4BA 3R5GA 4RZRA 1SH3A 2UU9K 2XRIA 2ZNYA 3T9ZA 4BQZA 2GO9A 5JLHA 1BWVA 2YI1A 4JRQA 2GCFA 1M0SA 4ED2A 1VQ9N 1PILA 3CDWA 4Z2XA 4DFKA 3OJUA 3SV4A 4MMOA 3QFWA 4ZJOA 1DARA 3CCJN 3CDUA 1HQUA 1N36J 2DY9A 4F0HA 4L8RB 2QYCA 4OMFG 4RW6B 2ILZA 4BRDA 2RD5C 4M5DA 5T41A 4LFBJ 4WP8A 4DHVA 3M8YA 3D67A 5I42A 1XQSC 4Q2MA 3TEHB 3KWMA 2Y0SD 3UD5A 4BE1A 1WTFA 2H65B 4USTA 5LJWA 3TVYA 1ZETA 3LP1B 2DGTA 4ZP9A 4C98A 3TABA 4ANDA 2EWSA 4CIEA 3ILLA 2LEBA 2EFOA 4AL7A 3G8QA 4DR7J 4NLBA 1U2VA 4ZS6A 2QWRA 2UUAK 1YZ6A 4NA1A 1U6FA 2CPDA 4JI6K 4DV5J 4X4RA 3T19A 3JSYA 3R7BB 3M2UA 4J8FA 2OZSA 3UN2A 3GE9A 3GIMA 4DR3F 2LCWA 1GLBG 4LBPA 4P10A 1KWMA 1HNIB 3Q8QB 1FFGB 2I6WA 2FYXA 1N36K 3CJ5A 3KLFA 1RWKB 2P5OA 3PFEA 3FQKA 1FDNA 4CZFA 5IM0B 2RHKA 4LFBK 2FDNA 5KOXA 3LWMA 1MN7A 2EC2A 3TSPA 4CW7B 1WORA 2FHOB 2C2MB 2E6MA 4JK7A 1LOUA 4IJAA 2M9KA 4L76A 3TAQA 3PR4A 2HRTA 1U1MA 2IRYA 2OPQB 3DLKA 1K47A 1VS3A 4NI2B 1NMNA 2V68A 5AE1A 3S8SA 3GCWP 1NZAA 1FD8A 4ERDA 4AH9A 3MCOA 5G0RB 4CT9A 1WTBA 4E7HA 2F4FA 5CHCB 4DV5K 4C23A 4LF4J 1N52B 3U6FA 2AEFA 1YIJS 4O8UA 4CM0A 2MQOA 4B1YB 2EFNA 3RB3A 2VFUA 1HUXA 2IM0A 1WSVA 5J1PA 1C4CA 2ZH2A 4IRCA 3GIRA 3UIQA 4ELUA 5DMRA 4P52A 3P49B 5HRSA 3V5RA 2HFSA 3HYFA 2C2NA 2DGXA 4DV7K 3BREA 4PXDA 1C2PA 2BZ2A 3QJLA 1C0GA 2K7KA 2LFVA 3J81U 4DR2F 3RYLA 1VOMA 2KYZA 4A2BA 1Y3JA 3SNNA 2H5JB 3CULA 2YQ3A 1MDUB 3IMQJ 4C3LA 1VIOA 4X4UA 4HTUA 3D9BA 3C19A 2XCAA 4YB7A 1X5PA 1N8RT 1YRUA 3OBIA 3HTVA 4X2BA 2NXNA 5BRDA 3O1WA 2ATCB 2CPYA 2DCLA 3IBFB 2ZDOA 4OQJA 3V4IB 4M5KA 1MWKA 3C14B 2FVSA 2PSZA 3HVRA 4LF4K 1GXTA 1T11A 1ZS6A 2UXDJ 4IQXA 2A18A 1TL3B 1NG9A 1IQTA 3QSIA 5IFMA 1X7VA 3H08A 1U47A 3VA3A 1RT5A 2R8IA 2HBMA 4HHUA 2ATLA 5AQSA 3MM8B 3CCZA 2ZOFA 3BS9A 1VQNN 3BDPA 5M1NA 4YR0A 1Y64A 4RBUA 4DR4J 4CJPA 4K4TA 4YHHF 4OLBA 1LWEB 3GB0A 4BG9A 2CPEA 4XPEA 5EUHA 5D0HA 1RAAB 4BGBA 5CYMB 2YKOA 3QSYB 4CZMA 5FROA 1EJ7L 1Y11A 3RAQA 3UKRB 2ZH3A 4B3RF 3GV7B 4A5AA 1TL5A 3QBCA 1L3UA 3KLVA 2NNWA 3OS1A 4WYLA 4MLEA 3MEGA 5A0YB 3S3MA 1VLOA 1R3NA 3MM5B 1DFDA 3CCQS 4JS5A 4B3SF 4FWPA 4O5FA 1QQNA 1F21A 1LWFB 5AQZA 4FVUA 3VTIA 2UXDK 3NAHA 5BR8F 1VK0A 4FJ8A 3UN5A 2YNIA 3SQ1A 1C0UA 3CO0P 5IC4B 4LR9A 4ZITA 2I38A 5AQGA 2KKZA 1XMQJ 4DG1A 3GV5B 2VH7A 1RWOB 3WQTA 4ICLB 1YJNN 5IV4A 3K5MA 1PC4A 4FNHA 4OLOA 4F67A 2AHOB 4DR4K 1IUJA 3O44A 3GFHA 2FC0A 5LY3A 2CG8A 4DUZJ 3VQCA 2HS3A 1TV6B 2ZGZA 3SI8A 2VKZG 1RDUA 3BJYA 1U1QA 4NYPA 3HMJG 1JLEB 1JCGA 3B78A 3QQCD 2D0CA 1OIAA 4YFUA 3BQ1A 2KJVA 4YY3F 4UY85 2FJVA 1N32J 2LXFA 1WOOA 3VQ4A 3VQQA 1YZ7A 2WUSA 3OBWA 4EU0A 4IO8A 3AVGA 3G96A 3K8WA 5GMEA 3RJMB 1QQMA 3J81Y 1YITS 1AYEA 3FSYA 1GLEG 1HI8A 2WBNA 1XMQK 4DL0C 3EGWB 4URQU 4DMZA 2Y9HA 3HD2A 2V2KA 2A2CA 3LDPA 1SS6A 1P27B 5KFGA 2LLZA 4BGAA 3KLEA 2PYJA 5AFUH 2Z4PA 2ZJRL 1PC5A 3G6EN 3T6JA 1WC0A 4H54A 3ONQA 4DU7A 4K0KK 2FSJA 2MZTA 3OTOJ 5A2QO 3D3BJ 2CQPA 5F0XA 4M41A 1XMOJ 1N54B 1Y97A 5A8KA 3A5NC 4FF3A 4BC2A 3QFPA 1IR1A 1CJUB 1UAWA 1Y7PA 3W9JA 1CLFA 1OJ4A 3R6GB 2DH9A 3UR0A 2O8DB 1N32K 2V7ZA 1ZM2A 5LXRA 2EHGA 2QK9A 1VRQC 1JLCB 3LWLA 2A40A 3DXKA 3VQEA 2RPIA 1T03A 3UVJA 2MYFA 2GJFA 4AHCA 3WC2A 3BF1A 3DLGA 3R1LA 4RBVA 3DYAB 1TR0A 2GW8A 4ALZA 3MOZA 5KAKA 2CNLB 5AQUA 3ZC4A 3DI6B 3DHXA 4JI0J 3SSRA 1UFWA 2DCUB 4PKDB 3G9CA 3ZO7A 3EEQA 1DBDA 4KHRA 3TUIC 5KRTA 5IT9Y 1TUGB 4FM0A 3P83D 2EK6A 4MAKA 2RT3A 4OVLA 1FTRA 1DQAA 4OYPA 2QXFA 3EE8A 2Q97A 4LF8K 2FJXA 1RHQB 4L75A 1KNZA 4JS4A 2OEJA 1N5YA 1XMOK 3CNQP 4J9QA 3TA2A 2BBEA 1GX5A 3FBFA 2KI2A 2WC9A 1N34F 5HBMB 1MW7A 4O55A 2WHOA 3BGLA 1HKBA 4BLGA 2CJQA 4ED6A 4B1UB 4RWTA 4B17A 4JK9A 2KFNA 1GAOA 4USIA 4DCHA 2OHDA 3G71S 1XR7A 4USVA 3D3CJ 3NWRA 1SKRA 4JI0K 4WF9Q 1PSDA 4NLXA 1ZBHA 3GIJA 3GFZA 3QT6A 3OFGA 3H42A 2FZCB 1WSGA 1V3ZA 4F7VA 3DC2A 4K50A 1B70B 2G2ZA 5H9FK 3ULEA 4HEA9 5KG2A 4I6MA 4IO9L 2FBYA 3I8DA 4ECXA 1FCAA 1X31C 4Y2CA 4OZLA 4PG6A 4QIGA 3GG0A 1QD1A 1G6BA 3D0HE 1WC6A 1FXLA 2ZEJA 4XO0A 3TTFA 4PUOA 4O0IA 3QZ7A 4OHYA 4A2AA 3QFUA 4F2RA 5HVGA 1UTAA 1S1VA 3THPA 3SUQA 1CJVA 2JRSA 4CHQA 4NCAA 1SBRA 4DV6K 2Q66A 1S6UA 2XSJA 3CJAA 3T3FA 1TL7A 1KVAA 2XY6A 3FFKB 5BN9A 3MMBB 2DK2A 4U95A 3PTWA 3ZZTA 1X4DA 3BO3A 1WUAA 4LF7J 1N56A 2QL7B 5CYJA 5H1SV 2YXLA 5KTQA 3TAEA 1Q8KA 3OR2A 3SDEB 2KXFA 3M9OB 3VQPA 4NA2A 2Q3PA 3O3FA 2AJ4A 5KG1A 3M32A 1BHLA 1VRUB 1FF2A 2VG7A 1TKXA 1UPMB 2W9AA 2ZBIA 4CZEA 3C6TB 4Y2MA 2OPPA 5HOOA 3DOKA 4CGHA 4O44B 1BU6O 2JWKA 1REVB 2Z30B 1GH8A 3KLIB 3DRYA 1GXLA 5J2QA 3K9JA 2MJNA 1N5QA 3VAIA 2RN2A 3OSPA 3DHWC 2OANA 2R7UA 3MM9A 4R8UA 1NGJA 3AH6A 5HMWA 2JVOA 3LTOA 3P8BB 1DURA 3GMGA 3BB5A 2D0OA 3AO5A 3DOLA 1FKOB 3ENWA 4Q44A 3PV8A 3GG4A 2XZTB 3LOUA 4BVPA 4OV1A 1RHRB 3EM1A 2JDJA 2DR8A 3NGUA 3TEGA 2BKOA 4YOTA 4LF7K 2KTQA 3M6GA 5F1XA 5K9FA 4QS8A 1X4EA 1HD1A 3M30B 2PY5A 4GKKK 1WAFA 4DTMA 1RYRA 3E01A 5D15A 3R97A 1T7PA 1XNQK 4A8QA 1TKTA 4J90A 1QSLA 3FMBA 4JAXA 3PJXA 4HDGA 4K7QA 4DUYF 4DR5F 1TK8A 2BJ7A 1S22A 3W5ZA 3CWJA 4DR3J 2XWXA 3HPGA 1BXNA 5B0DA 3MWPA 5HATA 1JL1A 3L2RA 1X9WA 4LFCF 4P2XA 2AA4A 2HS4A 4WTOB 4KHYA 4BC5A 1JJ2R 3UCGA 4MKYA 4F3MA 2WBMA 4X4PA 4ZCIA 4Q0BA 2BJ8A 4I2QB 3VAKA 1FRHA 3U8XA 1NM2A 3IKMA 4QOZB 2RF2B 4FLXA 3PG9A 4DTRA 2BOAA 2BMBA 5EGYA 1V5IB 1S6QB 4MYTA 4BR5A 4OYXA 5IZHA 1XN9A 2GC8A 2DPIA 3MCMA 1E6YB 5DQGA 2KVIA 4BRCA 2Z1IA 4ZVGA 3WT0A 1AUDA 3DLJA 3AVKA 3A4TA 4BRKA 1PGZA 2FJAB 5EXWA 5KFVA 1MU2B 2HMPA 1NSKL 4DR3K 4FS1A 1F3FA 1PBUA 5L39A 2OELA 2F9DA 1U09A 3OTDA 4NASA 1T9TA 2X6SA 3VERA 1FE4A 2YWEA 5DGBA 4TYBA 2WTFA 3KK2A 1C0FA 3ZX0A 1CS4A 2R7QA 3PX6A 2AGQA 1RT3A 4BRNA 3QIPA 3WNHA 3DOMA 1PO6A 4DSEA 4ZVFA 3IO1A 1SJFA 4K8XA 4CM2A 1LWXA 3P6YC 2YX4A 5EN1A 2ZD1A 3MMAB 4LBHA 2AYGA 4QWBA 2GELA 3QIDA 3FZFA 1R59O 2VFRA 2CKWA 2WB1D 5BR9A 1FRLA 4UY8O 3Q24A 1IKYA 1HL6A 3QWPA 3OR1A 5GADP 2MKIA 5DM6L 4MH8A 3ET6B 1D5AA 1YAGA 1J5OA 1VQ6N 1LXNA 2RQMA 3V4MA 4ECQA 3MEDB 4I7FB 2RQCA 1C1AA 4CF8A 3BKTA 1K44A 1JLBA 1B4SA 1UP1A 2RVJA 4FJKA 3PIPL 2CNKB 4YHHJ 3I0SA 4DR2K 2MZ1A 4BRMA 4CH1A 3HP9A 1BIUA 5FDLA 1C0TB 2OMLA 2RE2A 2MJUA 2QTDA 4KFBB 1Q86O 1QVGM 4ZDNA 4B3RJ 4YB5A 2VPWB 3WZ0A 3M1FA 4FXDA 1S59A 1WDTA 4IRDA 2QC3A 4WJBA 3GIKA 2HIQA 4ECYA 4X62J 5F8IA 2HFNA 4GKJF 2YWKA 2WSCC 5CABA 3K59A 3NGYA 2AT1B 4LQ9A 4EK2A 5BR8J 3LGNA 1F3VA 1T3NA 5AFUA 3V9ZA 5AQTA 3IWNC 3SBTA 3W60A 1R8AA 4YDXA 2HOEA 4HACA 4F0KA 3Q8SB 4FPBA 1D9DA 2IMWP 2A0FB 5LSOA 3G4SN 4CO0A 1WOPA 3FNNA 2KDOA 3NGTA 4NLGA 4FO0A 3ILIA 4C11B 3LZJA 5B0AA 3CERA 3FK4A 2ZKUA 3D1HA 4QPTA 3QETA 2D1CA 4YHHK 4KV8B 2DHAA 2DY1A 5LXYA 1O5JA 4Y1CA 5J2PA 5KFZA 2GV1A 2HK3A 2WRMA 3TU5A 1S4EA 3MN5A 4ID8A 2DGVA 4M3ZA 4PWUA 4B3RK 4MIBA 1VR6A 1U04A 1YTYA 2GQCA 3BO2A 4KB0A 5E0OA 3CCSN 3L3CA 2WB4A 4EMDA 4LSNB 4DV0J 3OVAA 1CULB 2JSXA 1WC1A 2MHEA 4B3SK 5CH7B 3R8YA 5B0GA 3HK2A 5BR8K 1P8ZA 4TN2A 4ZOSA 1VQSA 2QLWA 1SAZA 3CPWR 2P5VA 5K8OA 5I3UB 1Q82O 2HQDA 3AGKA 1VQKN 4QS7A 3SUOA 2GAGC 1GLJO 2W2NP 3RU0A 1ZA2B 4WFNL 3T5KA 3EJMA 4CLKA 1VSIA 3QMQA 1UVMA 1LWCA 4CLTA 3J7YI 1VQ8S 1OO0B 1HBNA 3PVXA 4XK8C 3PYDA 4IOCQ 3CETA 1RBTA 4HYKA 2H4WB 4R0JA 3PSIA 3TA0A 3GLJA 4DCJB 1IBMF 3THYA 4LSLB 2QRRA 2W9BB 1N4LA 1NHKL 4IKFA 3H5SA 4TSXA 4YY3K 5E7OB 3H1QA 5IT4A 4O4GB 1FFSB 1MROB 1ZBSA 5EOYA 3OHBA 3UW1A 2R2RA 4ZPDA 4CIOA 4FVMA 5C24A 4UT4A 3U3YA 3ZFVA 3UI3A 2R7XA 5JMVA 1SH0A 2U1AA 2HHPA 4Y3CA 3UR3C 2LP4A 2VKRA 2KU7A 2J5AA 4OYIA 1HPZA 1J2VA 4FJLA 3H4BA 3N4QA 2D0AA 2O4IA 1KRPA 4CF2A 4ATNA 2VICA 3NCIA 3OA9A 1HBUA 1NLKL 4LJMA 1VQMS 1WHXA 4RU2A 2D4WA 2LU1A 2ZE2B 3L3VA 3VEZA 3ZLJA 3FZHA 1B3TA 3IXQA 3N4PA 2XS7A 1JLGA 1C1CB 5E84A 3JQKA 1NB7A 2KJWA 4CZIA 3CD6S 3CO9A 2GVDA 3OYCA 3V6JA 4X64K 4X4OA 3CCJS 3DDKA 5I3PA 1JX4A 3W8GA 3TUPA 3DXMB 3MX2A 1K8KA 3H0PA 5H9EK 2YHWA 3DRSA 3W2VA 4N41A 3DXBA 3ADAC 2D9PA 1MG7A 4UUWA 3JAMY 1RWMB 5CD4A 2J0WA 1GLAG 4CI0B 2FVRA 4JB8B 2YWWA 4V19X 3AXKA 2R8GA 3CT9A 4M3RA 2PI4A 3Q7CA 4FZVA 2A1SA 2NXJA 4OZ3A 3UCUP 1ASVA 3VA0A 2F3JA 1U45A 4N77A 1HLUA 4FS2A 3AVBA 4L74A 3OD2A 2YKQA 1LW2A 2CA9A 3IG1A 1VQ4S 1NBWA 4C3KA 5CZXA 2BEFA 5ETSA 3OYLA 2JEFA 1RAJA 1R6YA 5C15A 5T7LA 4KBOA 3JSMA 3FRYA 1SV5A 2H1YA 1RKIA 1T3OA 1MNEA 4XH1A 2HMIA 2CGJA 3MEGB 2DGQA 2DNHA 2IHR1 3VAHA 2DPJA 3BBFA 3RBEA 1N34K 3NMAA 1CJKB 1QHTA 1YRXA 2C1EB 1Z1ZA 4C0OC 2XI3A 3CQXA 4ED7A 3O3LA 1RCHA 1RWVB 4QYZJ 3AA3A 3U9DA 5C25A 3FQLA 4BVOA 5HRPA 3UDVA 2FVQA 3ID6A 3CJTA 3CEDA 2O8CA 5LOQA 3CB4A 2L08A 1X4FA 2DRBA 2JFKA 2EXUA 1XQIA 3ZX3A 2J9CA 4IFVB 4CNYA 4DLGA 2CQ2A 3CSKA 1BWEA 1OH5A 4LMZA 5AXLA 4RLEA 1RT7A 3VVUA 2PBDA 4USJC 1T02A 1NOYA 3WQUA 3KHHA 5KFAA 1H72C 3EE3A 4M5JA 3CMES 4I9LA 3OYBA 3GP9A 3VCDA 3T1AA 1KD1T 2V4JB 5GAHI 1M5SA 1KN6A 2HAFA 4QIVA 2E1YA 1T9VA 4HI2A 4M94A 2HEKA 3QERA 3P3DA 2V67A 3VAGA 1TFYA 4YB6A 1S77D 3BKUA 2KG1A 2QLBB 2D5RA 4WTYA 3U27A 2H54B 2KT3A 1KVBA 3L0QA 3CCMN 1ROFA 5KFDA 2PEBA 2POKA 4IH7A 5HAOA 2PFDA 3OYEA 3OYHA 3WNGA 1N33F 1HNWF 3OYJA 2OIHA 3TX0A 2F65A 3MCNA 3HI9A 3MMVA 4YORA 3SUPA 3QICA 3ISND 1PAUB 2N3LA 4OIXA 3OT9A 2GWJA 2LMIA 2B9WA 4JI7F 1O8BA 2ZJPQ 1BOTO 1DTQB 2VQFF 2VJVA 1FK9A 4FYDA 3J7AP 1UJ6A 3DNCA 2O3DA 1ICEB 7FD1A 2MKSA 2WK4A 1VQNS 5AZIA 1IQZA 2DGWA 2VQEF 1NPKA 2GHVC 4LFCJ 4DTOA 2A2DA 2HGMA 3CC7S 1F5AA 4Z37A 1GMWA 2MDAA 2V9KA 1NAQA 2O01C 2QT7A 5K8NA 4JV0A 4IEEA 3WEEA 3Q8UA 4OX9J 3VR1A 2F4VF 3FFIA 3FKBA 3CMAS 2K1RB 4DUTA 4KPCA 2G9OA 2MQLA 4AHRA 1JLQA 2AYEA 3B6BA 3ZTRA 4KTQA 1RACB 2V8PA 3GZ7A 4C7QA 1R8CA 3TI0A 1T9YA 1VQON 1YHQN 2EG1A 2XMUA 3EGVA 1ZPWX 3UNYA 1RA6A 1TUYA 4F02A 4CJ7A 2LYVA 4BC7A 1ACMB 3MGJA 3QGPA 1EIYB 4QIWD 3L09A 1TTHB 4YR3A 1RT1A 4JK8A 3GBTA 1GLLO 1Q81O 5ETLA 3W2WB 3TAMA 2GUIA 4DUYK 1J5EF 1T94A 1X9SA 3D2FA 4IXCA 4DR5K 4NLDA 2EFPA 4AFFA 4CDIA 3EDQB 3UB5A 3UD4P 1O6XA 2A10A 3ZX2A 4QWAA 4HH1A 2DFEA 4BR7A 4LFCK 1A5WA 2RRNA 1XR6A 4RX6A 3J80Y 1YI2S 4KKOA 1S3XA 1HA1A 1RT2B 4PL8A 1QLNA 5ETVA 3HSZA 2VONA 3MOJB 2OTJS 1RBSA 2X51A 5C7PA 5AQNA 2ZOGA 2CPJA 1Q7LB 1MN9A 1X0FA 3BDEA 1HFEL 2ZHAA 1NEEA 4C1NI 5L1JA 3AAQA 4F50A 1WSEA 2YNFA 3IUCA 2FUG9 1G1XA 1YVNA 2BQRA 4CEDA 2P8IA 5KFOA 3TSQA 1HKAA 3MR5A 2FLOA 1JNRB 2VHGA 2QEXN 4ZMMA 4ILLA 1WKJA 3VQ9A 2BJ9A 1HBOA 4H5WA 1IG9A 5EY4A 3DM2B 1U0SA 4GC7A 3SJHA 4B8AB 1UWBA 4CBWA 4PQUA 2IVFB 2V8GA 1IO2A 4CJUA 1SI9A 2GJ2A 2XBPA 2UV8A 4YOVA 2C22A 1S1VB 5C2CA 3IFRA 3TANA 3BZQA 3QDKA 4O3RA 4PAAA 1MWYA 2BQ3A 2WONB 2FJWA 2VU5A 1FDDA 3FCWA 3BSOA 2E20A 4DR6F 4OV6A 1UFKA 1EWRA 2AD9A 3UO0A 2RMLA 2XYHB 5AXMA 1H0HB 1VSDA 2EKNA 3FMWA 4XH4A 3O3GA 3W9HA 2J6TA 3BN7A 4FOIA 4OI1A 2J9DE 4GKJJ 3ZSRA 4NO7A 3QBWA 4FYYB 4DL4A 4RW4B 4EI2A 3TQEA 2RRBA 3LPUA 2O8EB 2ACMA 3Q23A 3C6UB 4OGCA 4USUA 3GYNA 3RBZA 6AT1B 1QQCA 1VSHA 2NRRA 2AGPA 4ISEA 1B64A 2B4UA 2HVDA 1Q78A 3HFKA 3QT8A 2BACA 5D3GA 3JB9k 4CNZA 3P5JA 1RAFB 2N4DA 4DLEA 5F2RA 3HFZB 4KHWA 3CCTA 2UUCJ 1P90A 2FSNA 5KRSA 1EQMA 5BPLA 1QHAA 1V6HA 1JJCB 1IKWA 3SLCA 2R2SA 1Q5YA 4E7JA 1HQEA 3H45C 1M5PC 1WNEA 2W6LA 3DJCA 4GKJK 5HMYA 4B3OB 2DT9A 4DV3J 2GMLA 3LW5C 2P9LB 2CIMA 4CO2A 3KJVB 3I0RB 4FF4A 4CLWA 2ZWOA 3SBGA 3KHGA 2YKNB 3QLHA 4A47A 2LA6A 1AUSL 4WQ5A 1S4FA 5ETMA 1J27A 4DL7A 2OA8A 3DFEA 3MUTP 4QW8A 1WHVA 5C2DA 2XO6A 1FWLA 2P6SA 2R7RA 4YB1P 1U7LA 4DPOA 1BD6A 1FVQA 1SC1B 4JI5F 3I31A 5E26A 4ZPWR 2FIUA 3CE8A 4DV2F 2CNOB 4TYAA 3BSNA 4BRHA 5DZ6A 2XG8A 3T1YJ 4M3TA 4I69A 5AXKA 1KC8O 3M8PA 5F8JA 3BH7B 3M8QB 2P9PB 4WFXA 4ECZA 2VFTA 3CCUS 2QWNA 2QL5B 2ZHBA 1D3WA 4GVLA 2JLGA 2BRLA 4N47A 4L3QA 3RMAA 2E29A 2VG5B 3TUZC 3R5JB 5DG8A 3B4MA 4K4UA 2DNGA 1IJEB 3A5MC 1OH7A 2M8HA 5DRKA 4WIQA 3H4DA 1FFWB 3UDCA 2AYBA 3F0NA 3M4XA 3RMDA 5H1SQ 3AVFA 2P9CA 4OO1J 3I32A 3GCXP 1RTJA 3DLHA 3NS5A 4K4SA 4DN9A 3E9LA 3NF7A 5RUBA 2RHQB 4BR4A 4I9QA 2C2RA 1L3KA 1VHFA 1M5KC 3R9LA 4IFYB 2LEPA 1YJTA 1IBMK 4CTAA 1EX4A 3KK1B 3K5PA 3WX4A 5F9LA 2HVIA 3HDSA 1KEKA 3M6UA 1H3DA 2FTRA 2QI2A 1B0TA 3QEPA 5D0RA 2MY8A 2C28A 3AQOA 2O8BA 4JBCA 3NGDA 1VSKA 1ATRA 3W62A 5KG0A 3DKDA 2XS2A 5E5NA 4KHPJ 3TAFA 4CJKA 3CI5A 1VHIA 4IH5A 1GLCG 3PW7A 4C8ZA 2W9CA 2ADBA 2K8GA 1RADB 5HROA 1WJ9A 2PDAA 1WWHA 1JXBA 5E3CA 2JGUA 2CQHA 1R0BG 3MXIA 3C7NB 4C0HA 2HLTA 2E1AA 3HSJA 3IA0A 4QR1A 2CPFA 1QQOA 2YTCA 4R0EA 2BUPA 3HZ6A 4PWWA 3A3OB 1UEUA 4K5SA 4FBTA 2E5LF 4CFBA 4ZPTR 2FVPA 4BDPA 3RMBA 3LALA 4Z4CA 3E9PA 4FLVA 3O4NA 2VCPA 3LUYA 2A1BA 4CEQA 4Q8FA 4RW6A 4A8MP 1M90O 2OPRB 1VLYA 2Z58B 1P1LA 4BBYA 1OSDA 3LDOA 3O1LA 1ZC6A 2ZQBA 2V9WA 2D69A 3BEGB 5HRNA 1PG5B 5AQPA 1S12A 2W8LA 2JEIA 3LP1A 4B1VA 2Q0RA 2DO4A 3OYDA 3NF9A 3QNOA 4K4YA 1WN7A 3NOCA 2R7SA 4K41A 2HFZA 3ITHB 5KFNA 1WACA 1UVKA 4PEOA 3TNVA 3WDOA 1UEKA 4CH0S 1IWGA 4A57A 1KOOA 1NXIA 5FLXU 1KVKA 3D6TB 3L95X 4DPYA 2AYMA 5KG4A 3H46O 2ZC4A 1SJ3P 2BABA 3G6XA 1HNIA 2KT2A 2PFUA 3CF5Q 5AE3A 1RFQA 1MLAA 3BF4A 4WE1B 4X65J 1WDDA 2ZBPA 1RDCA 5IM0A 2UXCJ 1XEZA 4YOYA 3CCQN 4IOBA 4ECVA 2VWJA 1W26A 6FDRA 2QTWA 5GMDA 4O3PA 2OPQA 5F9NA 4M8LA 3VGLA 4NI2A 3H5YA 4BC4A 1CEZA 5G0RA 1N33J 1HNWJ 4UOFA 4YDDB 2VPYB 3EICA 5FPNA 4MO4A 2XWYA 3VGMA 2GS8A 2UZAA 1EARA 2V94A 4L3KA 3GILA 1KBRA 4H0VB 1WI6A 2QLJB 5F41A 4JI7J 2XMWA 1OVQA 3D7EO 2E1PA 2JEGA 4CJRA 1BQNB 4YNQA 4ZVPB 4B02A 2NRHA 4CF0A 4Y00A 4OFZA 3N6NA 4P2MA 3NGSA 3I5AA 4NXNF 2N82B 4USWA 3K58A 4U7BA 1HW8A 1P9QC 2VQEJ 4QW9A 2NZCA 2Y1RI 4CD3A 4PL7A 4D3HA 2OYQA 4FCYA 2MLXA 2MZSA 2P9KB 2LXIA 3NKYA 2F4VJ 3NMRA 3P96A 1VBYA 4IO1A 4UY8T 1AZSB 3WUHA 1I94F 1N33K 1HNWK 3V4IA 1YITN 3VEYA 1KS2A 2HHUA 4LT6A 1TK0A 5EDWA 1RWNB 3WXKA 1SL1A 4YOUA 2HURA 4FYVB 3VQTA 2YHXA 3C14A 5TKYA 1XI1A 1S1TB 5KPZA 1HJOA 5HL7L 4OJ1A 4JI7K 1TL3A 1LW0B 2H3EB 3R5AA 3TR8A 2VQFK 1YQHA 5BPMA 1QZ6A 2E2OA 3AA2A 5KFMA 2OEKA 2UVVA 2F8TA 3BGRB 3ETOA 2Q6BA 3C2PA 3MM8A 3IAYA 3MN6A 1FDBA 2E7VA 2VQEK 3H25A 5TKWA 3QWUA 5JJBA 1K9MO 2DHHA 1QSSA 3BKFA 1LWEA 1S1UB 2NRZA 2CQ4A 4AD6A 4LRFA 3LP0B 1AROP 3QESA 1I6JA 1Q86T 2BVZA 3KNAA 3CG7A 5CYMA 4NX9A 2VA3A 3MCPA 3A13A 3HL8A 1VK8A 2QGFB 1EWQA 4TNOA 3UKRA 2F4VK 3MUMP 2X1BA 2W24A 3CCSS 3QJPA 4MK7A 2YH1A 2E9TA 5KT4A 1ZBIA 4CEZA 5A0YA 4OPHA 3KHRA 2ASPA 5EU7A 4QR0A 3MM5A 2V69A 5B8HA 3D66A 4WCEL 5K8MA 2ZJRQ 4AQYF 1LWFA 1LK5A 4DWIA 3MM6B 4JI8J 1NGAA 4M95A 3OYMA 3MCSA 4O5BA 3OY9A 1VQKS 1RWWB 4A4JA 2ZFHA 3NH0A 3WC0A 1J5EK 1EQYA 2ALZA 1NDLA 5IOLA 1S6OA 1SQFA 1FNXH 1YDLA 1SV5B 4ICLA 3NCPA 1A5XA 2NRXA 4E1NA 1WUUA 3MK6A 5GADI 2ZZMA 2FPHX 2PC6A 5C2GA 3CCRN 2GFFA 2V2ZA 4FWRA 3HVAA 4C0BA 1TV6A 3HOSA 1SQEA 2HKEA 2I8EA 2BR0A 1TAUA 2I5JB 1JLEA 2D7SA 4GO5X 2OI2A 3CMQA 1WSFA 1C6VA 4DF4A 2KHOA 4GO7X 2DR9A 1RBUA 4DR7F 2QG9B 3ZSWA 4JYAJ 2YNGB 2QA4N 4ZJQA 2ROGA 1SKSA 4J9NA 3G71N 1JJ2M 1UW9A 4DR6J 3A0IX 5DQIA 1WC4A 1NJWA 1ZZNA 1SUQB 3EN9A 4GC6A 1XJWB 4O4RA 2EBGA 1Q82T 3AVLA 2AP6A 3S41A 5L1KA 3CUNA 3KJNB 1T0TV 5A6PA 3AD8C 5F8HA 1RK8A 4DR1J 4WQ5C 2AU0A 4KC5A 5GVQA 4C2MA 2IM2A 4IKAA 4QIFA 1OH6A 1TKDA 2MY7A 2C3PA 1E6VB 2J7UA 2UUTA 3GG1A 1FRMA 3RBDA 1FDAA 1S72N 2M3DA 3NP5A 1U2FA 3HD1A 2MKJA 3MPUB 1XHZA 1FEEA 1RT6B 4CERA 2CPIA 2BV3A 1CJUA 1VSJA 3PY8A 3CJ1A 5M1FA 1ZM4A 2H9ZA 3O8WA 3OLBA 1YTAA 2O8DA 4LF9F 1RDDA 3ASMA 4LVNP 1ZBLA 5FLXO 4DR6K 5JS2A 1QM9A 2QLFB 5A6WA 3CJ2A 1JLCA 5C5JA 3ENBA 3HSTB 1F6TA 4QCLA 1UVNA 1NJZA 1B0PA 1NNDA 2VC1A 1BQMB 1A0OB 1IJFB 1B7YB 2RDDA 3VOVA 3DYAA 3VQ8A 4AF1A 4DS5A 2M5YA 3NNAA 2HRUA 3CW2C 4OHXA 3WXLA 3DI6A 1EX8A 2D3O1 5MLCV 1MMNA 2VC0A 3N79A 2V2VA 1SH2A 4ES1A 4J9LA 4JKAA 3NNHA 1FJEB 3THTA 4M45A 3L2QA 3UPFA 4LF6J 1VBXA 5D8HB 2J8AA 3LO3A 5L9NA 1PBAA 2LKZA 3UFCX 2XI2A 4BDZA 4JI5J 3SCJE 2HSTA 1ZOTA 2AV5A 1RCOB 3KJFB 2EK1A 2HHTA 5D4OA 1KQSR 1EETB 5HBMA 1NHUA 3ZT1A 3CD0A 3O9SA 4UUXA 4H4KC 3K8VA 3SXLA 2CAJA 3JS9A 4U67L 1GTEA 4HUFA 5M1KA 4RNFA 3DLLL 1T95A 2W40A 2IPOB 1U1KA 3W5XA 2ERRA 2E8AA 2ASYA 2R4FA 3LH2S 1V3SA 2V4RA 4ED3A 1WC3A 5KFRA 3HBTA 3HXMA 2DXFA 4MKVA 3LANA 4EBEA 5DO2A 4JKEA 4DX8H 4PPZA 5C0YA 1RAIB 4HT7A 1GOAA 1YJUA 3OVSA 4PWDB 3PYFA 3KD1E 4KHUA 2JLEA 1BUPA 4J9UE 4Y34A 2YCHA 1KQFB 4JI5K 1HNZF 4NLQA 3A1YG 5BJRA 2OSRA 1S1XB 1Q18A 4DV2K 4J9SA 4I2PB 3W8PA 2VWKA 2VPXB 3S3NA 1SQGA 3ZCMA 1Y5IB 1QTMA 2YNFB 1UETA 2K7JA 4IZ9A 3CCMS 4XPCA 4I6YA 5A8RB 2ZBRA 3NCRA 4RNHA 3MMBA 3ZETB 3IRWP 2OKQA 3QZ8A 4ZTFA 1VYAA 4FWKA 4B3MF 5F0UA 4W5OA 4Z7YA 3KK7A 3I55N 3JQJA 3PR5B 1QS4A 3JSRA 4I1TA 1HMVB 2P5GA 2FBXA 2M4MA 3SDEA 2C3MA 1NPPA 2AEMA 1B9DA 2MTLA 1X60A 1VRUA 3CJ4A 3VN5A 4FXVA 4JD2B 4H4OA 3C6TA 4DUZF 3B4DA 2OZMA 4O44A 1CQNA 2Y0BB 1OKJA 3CJ9A 1REVA 2PMWA 1TL1B 4IBNA 4OYAA 3KLIA 3BUZB 1ZAVA 3U9ZA 3H5UA 4IRKA 2E5LJ 2JVRA 3CPWM 2A41A 2PEHA 4RUAA 4CK3A 1ZM3A 4X4SA 2FGCA 4BRIA 3W63A 1OS5A 4RWWA 1FKOA 1S9EB 4GNIA 2XNQA 4M5LA 1FNMA 4IG0B 2HFOA 3ILJA 3TX8A 5KI6A 1V4SA 4FJIA 4QQBA 3J7YP 4WFBL 3KUGA 3K89A 3SV3A 5IQQA 3MDQA 7AT1B 4ZPCA 1EHWA 3HPHA 2IA0A 1YHQS 1Q5VA 3DMJB 2D0PA 3M30A 3V1RA 1UFLA 1TP7A 4AHSA 3RRGA 4FK0A 4H4MB 3L2WA 4DL3A 3O6WA 2BJDA 2W8KA 4DFPA 2DNQA 1KLMB 4N5SA 3OSNA 3OTOF 2KXHA 4FL9A 2XY7A 5J2NB 4LF1A 2E5LK 5C2FA 2E7WA 4OX6A 5KPRA 2VGMA 5ITHA 3NGZA 4BRLA 4WU3A 2V6AA 2MGZB 5DM6Q 1DLOB 3PIOL 1C1BB 2B9YA 4DTNA 4GW6A 1HWUA 1S0MA 3GR0A 3KYLA 4I2QA 1QSYA 5CYQB 1NHVA 3AJ1A 3HULA 2FBTA 5AQXA 1U6BA 1X5TA 1RWXB 2RF2A 1NJXA 4AXJA 1JLFA 4FLZA 1S6QA 2Q6CA 3N5FA 3G8SA 4C48A 5B0CA 3H20A 3PIPQ 1X0PA 2HAIA 1E6YA 1UJ5A 3OL7A 3VQ5A 2VUGA 1KONA 1F5BA 2FB0A 3Q89A 4KH4A 1QE1B 4NLCA 1MU2A 1VCTA 1KVJA 2KLAA 1T6CA 4BDYA 4ZVRB 4J37A 4B9VA 4DL2A 5HQ8A 1ULRA 2DGSA 4FPIA 3EVMA 2DIVA 2U2FA 4IUFA 4WZQA 1DTTB 4RUHA 3BEXA 2XZDB 2R3VA 4B9LA 1GTHA 1XHXA 4NXNJ 2AJ2A 2CUYA 2VBZA 4YOXA 4Z4HA 2HHSA 2G8UA 5E2QA 2GMHA 3HSGA 3CQ8A 3L4IA 3OYKA 3GJQB 4HVJA 4E1MA 1SKWA 3VWSA 1S6PB 3PZPA 1Q8LA 4EZ6A 3A8JA 4OYBA 3IN5A 2E66A 3AO1A 3KMSA 3HRGA 2BTFA 3MMAA 2HNZB 2VBYA 5I3QA 5AE2A 4HL9A 2P9SB 1RWUA 1I94J 2VBWA 4FM2A 1ZBFA 3NVKA 4TY8B 4FWMA 3VQ7A 3ET6A 3VETA 1IKVB 3NXZA 4WF9L 1NLVA 2IGIA 3MEDA 4I7FA 3DDNA 2CXEA 4USHA 2IOCA 3LGMA 1RI7A 4KBIA 3TJAA 1CPZA 4DTJA 3M8RA 3R27A 2XCPA 3SAHA 2WW4A 5IWAJ 4NXNK 3O08A 5EWGA 3RR8A 1RUSA 4CO3A 4TQRA 4KJIA 2FBVA 3JQMA 3MR6A 5KFCA 3T69A 3SCLE 1M5OC 5M1OA 1RGIA 4C8MA 2UUBF 1C0TA 4CP5A 1WI8A 3U1MA 2V8DA 4KFBA 4OPJA 1GMVA 2BJ3A 2MKYA 2Y8WA 3FLCO 4WFNQ 3KOAA 2MSSA 3FUYA 1E4GT 2HZCA 4BRGA 4P7TA 1XR5A 1I94K 3QNNA 3AD9C 3A8IA 3HJVA 3S9HA 1MA9B 4AQYJ 3W61A 4Y0FA 3BGFA 1H2VZ 1VQMN 1WNSA 2D3UA 2GX9A 3V6KA 1IM4A 5C42B 2VD3A 2HWHA 1XBWA 1NCLA 4M5IA 2E2NA 1HHSA 4H5VA 3L8BA 2YJEA 3P45B 3Q0AA 4KPYA 4CIFA 3CD6N 5FIIA 3T6BA 3AHPA 3ENQA 2ASMA 4C11A 2MLYA 2DKOB 2IVPA 4RU9A 5IXUA 2HQCA 1JCFA 4KV8A 4K4XA 1FD2A 3BYRA 2FZGB 1S10A 1VSEA 2B8PA 4GY2B 3HT0A 4CZKA 4MJKA 1UW4A 2ITMA 4H0TB 5A2QU 2XMJA 1P1TA 4ZN3A 2CWKA 3QRQA 4AL6A 2RQ4A 3MURP 3IBCB 4LSNA 1FX2A 2NPIA 3K7RA 1CULA 4AQYK 4P6QA 2QMWA 3ZSQA 3HO1A 2LU2A 4FYWB 1RT4B 2IM1A 1RNHA 4QIEA 1S57A 1RISA 4CYUB 4X4TA 3EZ5A 3NH1A 4NWBA 1YT3A 2EPIA 1YLXA 1VQ4N 1H38A 5I3UA 1X9MA 4DSFA 2NZTA 5F8LA 3OFEA 5AQQA 3QIOA 3HJFA 2IJRA 3KZBA 4ID1A 3MWTA 3WXJA 3MN7A 2CNNB 3KUHA 3N6LA 1SC4B 3UQSA 1NZ8A 3PYGA 4J9KA 1N8RO 1EAYC 3THWB 3CC2S 1UOCA 3AVMA 3A5OC 4DU3A 4CLUA 2GIFA 3GOIA 2OTLN 2CJXB 2HNDB 3R6LB 3KJQB 1CXUA 3D0IE 4LSLA 2W9BA 1BCMA 4M3UA 5KG5A 4CIGA 4IYQA 2FJBB 4DR7K 1NSPA 2YPYA 5DZ7A 4CLPA 2E2PA 4O4GA 1MROA 2QWPA 4LF9J 2Z1JA 3P1GA 3EZOA 4CZGA 2IJNA 4FPAA 1WF1A 2CDQA 1CVJA 2CPHA 3NS6A 3CMEN 4ILHA 3MMCB 1HLWA 2IC3B 1N48A 3G2XA 3R5BA 5AT1B 2WSEC 3TR5A 4DQRA 2ZE2A 1BO5O 4URSA 1C1CA 4CO1A 5KFWA 1LV5A 2GEMA 3SCKE 1NK9A 2VYPA 1XMBA 3VGUA 4KGMA 3ELHA 3QRPA 3A3PB 4KGXB 5GAEI 5AQRA 4RPFA 4CVNE 3E1YA 1D09B 3DXMA 1VBKA 4EUVA 1PIEA 2E1ZA 2R42A 4KH1B 1X4CA 3BYPA 3PUFA 4B1XB 3IDHA 3D28A 3MFHA 4LF9K 3AA9A 1U0HB 4W98A 2MZJA 3OYGA 1SPBP 4DSIA 2KZZA 3U1NA 1OY9A 1PYOB 2PN6A 4GV9A 2YWHA 5L8RC 1TMJA 3M2VB 2F63A 2L9NA 5I9EB 2B8QA 3OL9A 4FKYA 1NH8A 4B9TA 3SMZA 1YJRA 4CHPA 2WW8A 1S9FA 2LEAA 1IKXB 4JUZA 1JLAB 2F9WA 5A2QY 3QYYA 4U8YA 1NU4A 2E88A 2MQPA 3B8HA 1MMLA 3GTYX 2VBXA 3QT7A 3TZZA 1ZPVA 2UXBJ 4WYWA 3CC7N 3D0PA 3TJ9A 4DI6A 4LF5F 5HQMA 2ZJQQ 2RSQA 3R2CJ 1WKLA 3HM9A 3OL6A 1OMSA 1M90T 3NWGA 5M1PA 4NLTA 3P4IA 4M63A 3NHGA 3CMAN 5D4LA 3DLBA 4C9DA 1HNZJ 4ITSA 4NE9C 4CZJA 1HWLA 1HHTP 5E33A 4Y28C 4X62F 3CC4N 4ECRA 3CQYA 2W4PA 3O4QA 1CJKA 3CCLS 3H6EA 2HB5A 3SIPB 1Q95G 3DU5A 3BZKA 3WXIA 2HQIA 3BGOP 4B3MJ 3M8ZA 3HHNB 1W0HA 3PNIA 1BA0A