3M8PA

Hiv-1 rt with nnrti tmc-125
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
555
structure length
551
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of piperidin-4-yl-aminopyrimidines as HIV-1 reverse transcriptase inhibitors. N-benzyl derivatives with broad potency against resistant mutant viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 162
structure length 551
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3m8pA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8pA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8pA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8pA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3m8pA05
3NGIA 4DMNA 2X6NA 2Z1GA 3AA5X 5EU7A 3NCIA 4MFBA 4IDKB 4NLRA 4M94A 4Y2AA 5CYMA 4KB0A 3G0ZA 3OYKA 4I2PA 3KHLA 2UVVA 4EZ9A 1VSKA 5F8MA 4DQRA 4FZXC 4AHCA 2F96A 4M45A 3PHEA 4ELVA 2FVSA 4Q8FA 2XWYA 3RB6A 4MKBA 1NK0A 4NLWA 5F9LA 3MR6A 3PZPA 3PO4A 3RB3A 4H8KA 4O3SA 3L2RA 3NE6A 1WLJA 4B9TA 3V6HA 3ZSZA 4DTRA 3BSCA 2B5JB 3FQKA 2GV9A 4Y1DA 3CFPA 4FK0A 3KLHB 2GC8A 2AGPA 3SUOA 4FJXA 3CO9A 1KVBA 4HKQA 4DU4A 2OH2A 1RT1B 5HROB 3L2QA 4PQUA 2Y1IA 3QETA 3OSPA 4QW9A 2D5RA 3O3GA 3QZ7A 4MK7A 4PUOB 4F50A 5KGWA 4KAIA 4IBNA 4BACA 4DTOA 1IKYB 3V9ZA 2LSNA 1BIUA 1S1TA 2DFHA 3NH2A 1N6QB 4TSXA 4R8UB 4HTUA 1X1PA 4DQIA 3RMCA 4ECWA 5DGAA 4OL8A 3P83D 3T5KA 5HRPA 2YNIB 1JLEB 3VQ9A 5KFKA 3NHGA 2AU0A 3SPYA 2W9CA 1S1UA 3VQ4A 2R8IA 3OYFA 1J5OB 1RT2B 1U45A 3T1AA 4M95A 4FJMA 4AHRA 4FLZA 1LW0B 4FLYA 3SCXA 5KFBA 4BDPA 2Z1HA 1JLAB 3CM6A 4RU9A 2ASJA 4IRDA 3UDLA 2AQ4A 3UR0A 1RBUA 2G8UA 1JKHA 1BHLA 3DLGB 2BR0A 1TKZB 2FBXA 3B6OA 4CHQA 3HT3A 3OHBA 5KI6A 4CFDA 4NLTA 2EX3A 4KV8B 4GC7A 4IG3B 1VSFA 1NHUA 4CJVA 1QHTA 4WFXA 3QINA 4EP5A 4DF8A 4C8MA 3F9KA 4IH7A 3CVKA 5DK5A 2R2UA 2NUBA 2BE2B 1ITGA 5DMRA 4NCGB 5HRRA 3PR4A 4KHMA 4EO6A 1TAUA 1D9FA 4MIBA 1LW2A 1LWCA 4F4ZA 4J9LA 1RTDA 4U6PA 3HPGA 5KFOA 3EPIA 2R8HA 4ECXA 3AO2A 4I2QA 3VQCA 1IKXB 4Q8EA 2FLPA 4R0EA 4K4UA 4F4WA 2HW3A 2W9CB 4CJFA 3RB0A 4YFUA 1N4LA 3PW2A 4KB7A 1T03A 3LP1A 5F8HA 3MEDB 3MEGB 3HKWA 1YVUA 5EUHA 3KLGA 1WSJA 4C8NA 1NK6A 4KKOB 3OYBA 3NH0A 1SKSA 5KFVA 2BQ3A 4OKEA 1RT1A 4GW6A 4DQSA 1MU2B 2IJNA 3DRRA 1S1XA 4N76A 3HL8A 4DWIA 4DSEA 1IKVA 2HHXA 3ZSVA 4RW6B 3HVWA 1LV5A 1BIZA 4CF1A 3LPUA 2KQ2A 2OPQA 3LALA 2YKMB 1BI4A 4ECUA 3V9SA 4WFYA 1L3TA 5DG7A 2BANA 4E3SA 1RDBA 1TV6B 2KW4A 4ZPCA 4MK9A 4LH5A 4ZMMA 4JRPA 3SV3A 3DLKB 3KLFA 4IFYA 4DSJA 4YR0A 5C5JA 1S0NA 3VQSA 3OL9A 4R5PA 4FJNA 3LAKA 3MEEA 3DOKA 2IM2A 2FLNA 3HPOA 4YMEA 2YNIA 4B3OA 3DLBA 2G8WA 4FW1A 3ITHB 3CIZA 4CFAA 4TQRA 5F8LA 4IH5A 1BCOA 1RT4B 2ILZA 4I2QB 1SH0A 2BRKA 4QWCA 1S6PA 4RNFA 4IKAA 5KFCA 3TI0A 1DTQB 4I9QA 3CJ4A 3H5UA 2I5JA 1HJRA 4EO8A 2R7YA 1ZTTA 3AO5A 5J1EA 4ELTA 3MEDA 3H98A 3NGZA 1IKWB 1HNIB 2UUTA 3BJYA 1CLQA 4CJEA 3I0SA 3MXIA 1S1WB 3B6PA 4M3UA 5FDLA 3RMBA 4XO0A 2JEIA 1MU2A 3UPFA 1U49A 5JXSA 3DYAA 5KT7A 2B6AA 1EP4B 4URQU 3NF9A 3AVGA 4Q0BB 1A5VA 4JS5A 3T19A 3QGGA 4B08A 5CYMB 1GX6A 2IA6A 4CK1A 3TABA 1RNHA 2J6UA 3OY9A 2JGUA 1TKXB 1RTIA 2F8EX 5DQIA 1JIHA 5KFGA 3SYZA 2IAJB 4RNOA 2WHOA 3BDPA 4AHTA 2BE2A 3O4QA 2PYJA 4DFPA 3DRSB 4RNNA 3HSTB 2E9ZA 3KD5E 1RA7A 4FJLA 3KKRA 2W9AA 3FSIA 4OPKA 2VG6A 4EYIB 4E7KA 4DLEA 4F2RA 1SL1A 4I7FA 4BDZA 4B9UA 3QNOA 2G8FA 3QESA 2QK9A 3IAYA 4RW4B 1BL3A 3PY8A 3I8DA 1W9HA 3V6DB 3HP9A 3SV4A 4NLVA 5KG6A 3ZT3A 1VRUA 1T03B 3H4BA 1RDCA 2XRIA 5KFZA 2FBYA 2Z1IA 1FK9B 2FJVA 4KO0B 1JLFB 3MXJA 3O3FA 3KK1A 4CEBA 1HPZB 2HAIA 4KI4A 2ZD1B 3JYTA 4R8UA 3M9MB 1FXXA 1QSLA 4ICLB 5KFDA 4CJQA 4FS2A 2D41A 3KTQA 3V81B 4DTXA 4K8ZA 3QYYA 4K4ZA 2WOMA 2OPSA 4IFVA 3RR8A 2HHSA 1RAJA 1RT2A 1CZ9A 3DLKA 2JLEA 4IFYB 4PWDA 3N6LA 5K14A 4TYBA 3QZ8A 4XIUA 1SV5B 2W8KA 2JC0A 1S9EB 2R2TA 5HLFA 3SJJA 1JL1A 4ZTFA 2F8SA 5CYQA 4OVLA 3IS9A 4Z0UA 1TVRA 2FLLA 5KFHA 4NCBA 2V4QA 1JKHB 3OSNA 4RW7A 3C94A 4J9QA 3GILA 4N5SA 3VQ8A 4DL3A 1TK8A 3HP6A 4NLPA 3CDUA 2IJFA 3RWUA 3I0RB 5KG1A 2ILYA 5I3UA 2C2DA 1X9WA 4KV8A 1DTQA 4NRTA 5F8IA 3OJSA 3DLRA 1HNVA 3SQ0A 5KT5A 2DPIA 1JX4A 4FJJA 2O5DA 4O44A 4ZHRB 4CF9A 3SZ2A 3JYTB 1D5AA 2RDIA 4ECYA 3KD1E 5DLFA 4CFBA 1EP4A 3VQPA 4NYFA 4JUZA 4CE9A 4IG0A 5HRSA 1T94A 1BQMA 4ECVA 1MMLA 2ETJA 5F8GA 3V6JA 3BGRB 1TKXA 3H2LA 2V9WA 4DSIA 1HYSA 4HCBA 3CJ3A 4CF2A 3K2PA 3VQ6A 1Y97A 1C6VA 4KKOA 4PA1A 3MFHA 1S9FA 3BSNA 1KHVA 2BDPA 4FW2A 4CJTA 3QO9B 1HYVA 3DLGA 2F8TA 3F73A 3H59A 3ICLA 4EZ6A 3IN5A 3GV7B 4MQ3A 3QIPA 3KMQA 1NK7A 4RNMA 4CHYA 1JLCB 4MKAA 5DQGA 2HNZB 4NYZA 2Z1JA 3EY1A 2V4RA 1C1AA 2D3ZA 1B9FA 5L1JA 4Q44A 3IG1B 4PUOA 3QGHA 3LWMA 3G6YA 1FK9A 2EC0A 4CHPA 3SUNA 1XC9A 4CEDA 2FBTA 3CQ8A 3VQQA 4NLQA 4HCCA 2WK4A 4K4YA 3KLFB 4RUCA 4DSFA 1N56A 5KFIA 3GV8B 4K4SA 1VSLA 4FJHA 1C0TB 4FYDA 1NOYA 5F9NA 3M9NB 4I9LA 4BDYA 5KG7A 1RTJB 5DLGA 3ZT2A 3ZSWA 3H5YA 3H40A 1YTAA 4DS4A 4FLTA 4B3OB 4B9SA 4M3TA 1FKPA 5J2PA 1YVFA 4DU3A 2WOMB 4X2BA 1SKWA 4KE5A 3RAXA 5J2QB 4M3XA 1C0UB 5EWFA 3K57A 1SUQA 3OYLA 4O3NA 4ECRA 3FDSA 3KHHA 1FKOB 4CK2A 3U3GA 1EETA 2J6SA 1DLOB 1X9SA 3TAGA 1WAJA 1W25A 4ED1A 3AVCA 1NKCA 3RRGA 3AO1A 4FM1A 4MIAA 3FFIB 1Z25A 5KT6A 2XGQA 4FK4A 3S3MA 1WSHA 4CJSA 2P51A 5KGXA 5EDWA 2G8IA 3C6TA 3ALYA 2HHTA 2YKNA 3NGYA 1BQNA 4NLDA 1NJYA 4FK2A 2ASLA 3CFOA 2HVIA 2ZKUA 1LWEB 4QWEA 1N48A 2W9BA 4OJRA 4ZHRA 3KHRA 3CDWA 4H4OA 3I5CA 1ZYQA 4CFCA 4XPEA 4R5PB 4GVMA 3VQ5A 4BE2A 3AO4A 1X9MA 1EKEA 2W8LA 4TLRA 1UAXA 3D0PA 1RT5A 3I5AA 3TAEA 2UVWA 1S97A 4LY7A 4IQXA 4WXOA 4J9OA 1GOCA 4RZRA 2FJXA 4M41A 3BGRA 1GOAA 1EX4A 4FZYA 4ID5A 5L1KA 4E89A 4DQPA 5J1EB 3MTKA 5FROA 2CJQA 4OGEA 1WAFA 3PW5A 2ALZA 2KZZA 5HBMB 3RMDA 5T7BA 4KO0A 2JEFA 3OYIA 3NAHA 3CFRA 1L3UA 2WONB 4WE1B 1IO2A 4KHUA 2W7OA 1RBVA 4FXDA 4GMJB 4CEFA 2VWJA 2RN2A 4IRCA 1JXEA 2OYQA 1WNEA 3TWHA 1RT3B 1A5XA 4ICLA 2P5OA 3KK3B 4KBIA 1IKVB 5KFJA 1D9DA 2G8KA 3CM5A 3MFIA 4DTJA 3E51A 3QGIA 2C2EA 1BQNB 3VQEA 4IFVB 5KTQA 3TR8A 1JLGA 4LSNA 1HMVB 4JRQA 3V9UA 3FQLA 1WSIA 2D3UA 3DRSA 4B9LA 3DM2A 3DDKA 1TL3B 1VK0A 1CSJA 5KFWA 1TP7A 4Z4HA 1J9AA 5CYQB 4Q45A 4CCHA 1W0HA 4HUFA 4KREA 4WZQA 3MEEB 4TY8B 3MR2A 3EZUA 3LDSA 4CJUA 2YNFA 1S0OA 2HWHA 3KLEB 1HQUA 4E19A 4PQUB 4ZPBA 1VRTB 5J2QA 2ZE2B 4EEYA 1L3SA 5EWGA 4YQWA 1S6PB 4K4WA 1VSHA 4YNQA 1REVA 3DMJA 3SQ1A 2C2RA 1VSEA 5C24A 4KHNA 2XC9A 3PW7A 3PO5A 2ATLA 3M8QA 4O44B 2AX0A 3AO3A 3CJ5A 4O3OA 2WONA 4WE1A 4HUGA 3DI6A 2R8JA 4E7HA 5CZ2A 3DLHA 4H4MB 2KFNA 3FFIA 1XR5A 5SWMA 3HJFA 4FVMA 1JLQA 3PV8A 4U7CA 2Q3SA 3RAQA 3LZIA 1TKDA 3ZCMA 4E0DA 3CG7A 4CEAA 3DLEA 1Q8IA 4KHYA 3KHGA 1TKTB 4BWJA 2XY7A 1IH7A 4WYLA 2G8HA 1NJZA 4F3OA 3KLVA 2UVRA 1RTIB 2GIQA 3DM2B 1UWBB 3HVTB 3TANA 1QSYA 3TQ1A 1LWFA 3OS2A 3OJUA 4DQQA 1QTMA 3AVBA 4LSLA 4FLVA 4J9KA 4TY8A 5KFLA 1G15A 3IGVA 4KTZA 4CERA 3P1GA 5C42A 4DL5A 4M42A 3C6UA 1HNVB 4FS1A 2I5JB 3IG1A 1S1VB 5KG2A 3AVJA 5HBMA 1RYRA 2RF2A 3H5XA 5KG0A 4K4TA 1JL2A 1C1BB 4Q5VA 1S1TB 2HHUA 1HARA 4C8KA 5KFFA 2E9RX 1JLBB 1R0AA 4Y1CA 1RILA 1RBSA 3QEXA 3AVHA 4NLSA 3KLIB 3V9XA 1C0TA 4NRUA 4FCYA 2XY6A 4EBEA 1SL0A 1WNSA 3ZSQA 1JLEA 4CJWA 2AGOA 2E6MA 1JLQB 2UVUA 5HP1B 3IRXB 5KT3A 1Q9XA 1S1UB 4LD0A 4KSEB 5HRNA 3DLEB 3MR5A 3KK2A 4URSA 3TAPA 1VSMA 3TAFA 4ED6A 5E41A 3PX0A 3VQDA 4TQSA 1TQLA 3EPGA 4NZ0A 5HLFB 4DTUA 2VWKA 2XO7A 3AVMA 3QLHB 5KFTA 3T5HA 4Q43A 1HQUB 4JLHA 4QAGA 1TKZA 1T7PA 2YNGB 2A1RA 3LPTA 4E1NA 4ZVHA 5C42B 5J2NB 3DMJB 2RKIB 4OGCA 3VQAA 1HQEB 4BWMA 4JV2A 4CGJA 1ASUA 2YKMA 2C28A 3UQSA 4CEQA 4J2AA 4QCLA 4CESA 4B9MA 1IM4A 4IR1A 1VSJA 2YNHB 1KLMB 3ZSRA 4CIEA 3SUPA 1TK0A 1DTTA 3Q8SB 4K50A 1LW2B 1LWCB 3QERA 3PJWA 3BQ0A 3GIJA 1FKPB 3GV5B 3NF6A 1K1QA 4MFBB 1RYSA 3THVA 1YT3A 3MR3A 4IG0B 4ED2A 3U6FA 1SUQB 5DGBA 4KTQA 4JS4A 5DG8A 5L9XA 4FLWA 3DOLB 3ZT1A 3RTVA 5K14B 2HNYB 1UWBA 4Z4CA 3WNEA 3ASMA 4KFBA 4FJ9A 4O5BA 3CJ0A 1I3AA 5I42A 2P1JA 1T8EA 3CWJA 1S4FA 4HHTA 1TVRB 4XPCA 2B5JA 3GYNA 5KFQA 1UOCA 1K1SA 4IRKA 3DRRB 2IM1A 2XY5A 2GUIA 1RT3A 4CHOA 4CJKA 3SI8A 3SQ2A 1XI1A 3OYHA 1Z4UA 5CZ1A 2YNGA 4W5NA 3E01A 1T3NA 3KOAA 5I3UB 1GOBA 4G3IA 2WTFA 1ZBLA 2RDJA 2AGQA 2HB5A 4CEEA 4WZMA 1RDRA 4CGGA 3SFGA 2RF2B 1QE1A 3PW4A 3G86A 3NDKA 1NOZA 4J2EA 4OKJA 3RB4A 4QWDA 4E7JA 4H4OB 3OL7A 1S10A 3VN5A 4FBTA 2XCAA 4Y3CA 4FLXA 3D45A 3DOKB 2BGGA 1RBTA 5KT4A 1TL1A 1JXLA 4QOZB 1KVAA 5HP1A 2FBVA 1NHVA 3KNAA 4WYWA 1J53A 3T5LA 4I2PB 3RRHA 4F4XA 4AHSA 3LAMA 3VA0A 2D7SA 2E6LA 4W5OA 2AWZA 4FJ5A 1U48A 4IOBA 2WB4A 3H5SA 3U3YA 4DG1B 4YR2A 2FVCA 3I0SB 4ZPAA 3VQ7A 3PJXA 4B9VA 4DL6A 4OLAA 4DL7A 3OVNA 3RBEA 3A2FA 2ZD1A 3SUQA 2VA3A 3L3VA 2YHAA 4ZP8A 3OLBA 5KFAA 3OYNA 4NLYA 4N41A 3BSOA 4CIFA 2AJQA 2DFFA 4HYKA 4CEOA 1JLCA 4G1QA 4MK8A 4NLGA 4CF8A 4BE0A 1KTQA 4KTWA 3D5MA 4CGDA 3BREA 1HMVA 3ZT0A 2IS3A 3SQ4A 4DF4A 4W5TA 3O3HA 3KJVA 4ECTA 1RT7A 3V6KA 2IC3B 3CDEA 3NAEA 2JEGA 4O0IA 3QNNA 4J9RA 1LAVA 4Z4IA 5SZTA 1F21A 3DRPB 4F8RA 3LP2A 1RA6A 3PVXA 1QAJA 4LSLB 1ZBHA 1QQCA 4IH6A 2AX1A 3V6DA 1IKXA 2IMWP 3BQ2A 1REVB 4CK3A 3S9HA 4KHQA 2XGPA 2QKBA 1BCMA 2HNYA 4J9MA 5C25B 3OYJA 4FZZA 4DL4A 4DG1A 2D0CA 3KKSA 4RW9B 1NK9A 4OKKA 3M8PA 2DPJA 4C8LA 3NF7A 3NBPB 3M8RA 1EETB 1R0AB 5DG9A 4OLBA 3MECB 2IM3A 4ZVGA 2W7PA 4F4KA 4FJIA 4IR9A 4DU1A 1KCFA 3V4IA 3C95A 2JEJA 1CZBA 3OLAA 4ZP6A 1I39A 5DQHA 4M3WA 4IDKA 3C6TB 3K59A 4B9NA 3GQCA 2EHGA 2HVHA 4J2BA 4J2DA 5FRMA 1TKTA 4TY9A 3IGNA 4W5RA 2ATQA 1BI4B 3AA2A 1LWEA 5D3GA 5F8NA 1RDDA 3S3NA 3G10A 1NJWA 2D0BA 5KFMA 3Q8PB 3OL8A 3ISNC 1S9EA 5KG5A 1NJXA 2IGIA 1LWFB 1U4BA 4DS5A 1TL3A 3IS9B 4LQ3A 3WNHA 3DRPA 3S3OA 4YP3A 1RTDB 1TL1B 1C2PA 3SPZA 3KLHA 4ZP9A 1QUVA 4DFMA 4JV0A 3ZSOA 1RT6A 1RDAA 3SNNA 5KFEA 5JS2A 3OYAA 2HHVA 2YNFB 3P5JA 4FJKA 4Z4EA 3QIPB 4DTSA 4EYHB 4ED3A 3MEGA 2ZE2A 1KRPA 2E9TA 4NYNA 3LP3A 3AV9A 3K5LA 4KRFA 2KTQA 4EBDA 1HNIA 1RCHA 4J9NA 1L3VA 3OYEA 4F4YA 2YNHA 1DTTB 4K4XA 4FBUA 2JC1A 4F3TA 3HM9A 1GX5A 3NMAA 1NK5A 3KK3A 1KHWA 2O4IA 4G1QB 3OYGA 2FC0A 1BQMB 3CJ2A 2FJWA 3KK2B 4WXWA 5L1IA 4ZVFA 3VQBA 3KJVB 1U09A 1T05B 4LSNB 1Q9YA 4EP4A 1VSDA 1D8YA 2IDOA 5KFNA 3O4NA 1LW0A 2O4GA 2ZQBA 4Z4GA 3HO1A 1QAIA 3I5BA 3AVAA 4FJ8A 1S9GA 1BGXT 3M8SA 2HMIA 4MH8A 3AVKA 4ECSA 1FKOA 4DTMA 3QO9A 1CXQA 4CJLA 3T5JA 4ID1A 4O0JA 1RT6B 4J9SA 4O3PA 5F8JA 3PUFA 3V1QA 3NH1A 2XCPA 2XY8A 4WFZA 2WCXA 3JSMA 4DEZA 4CEZA 3LZJA 4QWAA 4KAZA 3L8BA 1KFDA 3AVFA 3C6UB 4ECZA 1WSGA 2FVRA 5CY4A 2W9BB 1C1BA 2BQRA 1HRHA 1ZETA 2ITGA 3NFAA 3KMSA 2X74A 4M3RA 4H4MA 2OZSA 3DYAB 3K5NA 1K6YA 5L1LA 2V0NA 2J6TA 4YR3A 3H08A 5JS1A 4Q0BA 1XR6A 3ISND 2B4JA 3LANA 1SKRA 4ZVEA 3RR7A 3MF5A 3PX4A 3K5MA 4NLUA 2KZMA 4O4GA 3OYCA 2QV6A 4CECA 4FJ7A 1C1CA 5D3GB 4F2SA 1YTUA 2HNDB 2OPRB 3L2UA 2IAJA 3LP1B 3EZ5A 3KIOA 4CGIA 4B8AB 4KFBB 1UA1A 3BSAA 4AHUA 1SV5A 3HPHA 5I42B 3OYMA 1S9GB 4Y2CA 3HYFA 1WSFA 4M3ZA 2VG6B 1DLOA 1RTHA 3VA3A 1B92A 1XHXA 4HUEA 2FVPA 4ZP7A 4KPYA 2VA2A 3QLHA 2QKKA 3E01B 1S5JA 1ZBFA 3OHAA 4CJ4A 1QSSA 4K8XA 2YKNB 1TAQA 4FLUA 2OPQB 5KFXA 4IG3A 2HHQA 3N6MA 1QE1B 2R2RA 2BRLA 4Z4FA 4K4VA 4O55A 3OYDA 3HHKA 1A5WA 5KFUA 4LH4A 1U04A 4B8CA 4FM0A 1TV6A 1JLFA 3RBDA 3L2WA 2Y1JA 1RT7B 1JLGB 1HPZA 2IC3A 2WRMA 2ASDA 2CKWA 1IKYA 3OS1A 2GBZA 3KLIA 1S49A 3SFUA 3H4DA 3G6XA 3HXMA 2KFZA 1I6JA 3PR5B 1RT5B 3V81A 4KI6A 1OS5A 4CGFA 3GIMA 4CJRA 4CIGA 4UQGA 4CJ3A 4AHVA 1TK5A 1ASVA 1WN7A 3IRXA 4GC6A 2OPSB 4CJ5A 3QEWA 5KT2A 3SI6A 1WSEA 4PWDB 3RMAA 2I1RA 1HYSB 1J5OA 2D0AA 2XI2A 3G6VA 3NL0A 3L3UA 4N47A 1S48A 3M8PB 3M8QB 4OPJA 4AH9A 1O1WA 4Y34A 2VG7B 5KRSA 1JLAA 3LP0B 4QWBA 4ED7A 2R8KA 1KVCA 3MECA 1N5YA 4DSKA 5HROA 4BE1A 4EBCA 4DSLA 2B6AB 3TAQA 3I0RA 1S6QB 2B43A 4URGA 1NNDA 4CHNA 3JSMB 3FRZA 5KG3A 4RG8A 4O3QA 1HYZA 2HNZA 5J2NA 3MXMA 4H54A 2PYLA 4TYAA 4W5QA 4E7LA 3ZSXA 1XR7A 2YHBA 2BQUA 4C8OA 4M3YA 2A1SA 5KFRA 4RUAA 4CJPA 3QEVA 3ZSYA 2XI3A 1KLNA 3V9WA 3NGDA 3MAQA 3HVTA 3OS0A 5J2MA 4KHSA 3QIDA 2X78A 4HVJA 1SH3A 3HK2A 3KLEA 4N56A 4O4GB 3HVAA 3BQ1A 4TXSA 5J2PB 4IKFA 1J54A 3M9OB 1C1CB 4CGHA 4DLGA 2HNDA 2OPRA 1VRUB 1C0MA 1C0UA 2VG5B 4DFKA 5C24B 1CXUA 1IKWA 1S1VA 4LQ9A 3WNGA 4FM2A 1SH2A 3KK1B 1UA0A 3UIQA 1RTHB 3DI6B 3KLGB 3AA4A 3TARA 4O3RA 2R2SA 3LP0A 4E7IA 4KHWA 3V4IB 1N5YB 4PY5A 3V1RA 2C22A 2PZSA 2OZMA 1NKBA 1IG9A 2R8GA 1L5UA 4DFJA 1S0MA 2P5GA 1RBRA 4RW6A 2IOCA 1EXQA 4KHRA 1U47A 3NAIA 2X6SA 2QXFA 1T05A 5KFYA 3OL6A 1Z26A 4DTNA 2BANB 4ZPDA 2OA8A 5EWEA 3K58A 2PY5A 4NCGA 1KFSA 1NK4A 4NLOA 4KB1A 1RTJA 2XHBA 1B9DA 3LP2B 5KFSA 4I7FB 1VSIA 3QEIA 4RW8B 3AVNA 4RW4A 3D28A 1XWLA 1JXBA 1QS4A 1NK8A 4ELUA 3QEPA 1TGOA 2W42A 2YV0X 3Q8QB 4E1MA 3TAMA 5FRNA 1SL2A 3PW0A 3T3FA 4ECQA 4ID5B 2IBKA 1HQEA 2VG5A 3BR9A 3QIOA 3EYZA 1ZBIA 2VG7A 1LAWA 3NF8A 4RW9A 1JLBA 4RNHA 2HWIA 2E4LA 4CHZA 2OPPB 4QPXA 4ZTJA 4NCAA 2G8VA 1S1WA 1KLMA 4L8RB 1N6QA 3ULDA 2DFEA 3V1OA 5T14A 3K5OA 1S1XB 4QW8A 4CF0A 1S6QA 5KFPA 4DTPA 3AA3A 3WNFA 1NKEA 3Q8RB 4NLXA 5JUMA 3HVRA 2DY4A 5KRTA 3LWLA 3DOLA 2HMIB 4JV1A 3TVKA 4J9PA 2IM0A 1BISA 1D1UA 5J2MB 3ZT4A 4ED8A 4TN2A 4FJGA 4RW7B 3PX6A 3ITHA 2HHWA 4RW8A 4O4RA 1RT4A 3CYMA 1KSPA 4AILC 1ZTWA 1ZBUA 1XHZA 3GIKA 1VRTA 2RKIA 4ED0A 2DTUA 2QE5A 2RPIA 3TAMB 2GIRA 3GIIA 3N6NA 5C25A 1D0EA 3AVIA 3AVLA 1ASWA 2UUWA 4DL2A 3NKYA 3L2VA 2FVQA 5KG4A 3NBPA 5FDLB 2OPPA
chains in the Genus database with same CATH superfamily
1IBLJ 4DMNA 1NO8A 2HFZA 3AA5X 2OTJN 3WQTA 4IDKB 1T9YA 4Y2AA 2OGUA 4B1XB 2LXUA 2B3TB 4HDGA 4KB0A 3C14B 4JI0K 4J37A 4EZ9A 4DQRA 4ELVA 2FVSA 4Q8FA 2AP6A 2XWYA 1JWWA 4MKBA 1NJIO 2VFRA 2YX6A 2FYXA 2UUCK 4PHTX 2KLAA 3J80U 5A8KB 2R7RA 1RHRB 4B9TA 3V6HA 4DTRA 3BSCA 2B5JB 2GV9A 4B1ZA 3SUOA 3GG0A 2AGPA 3DNCA 5BYRA 1HUXA 1RT1B 4JYAK 4NL5A 1WC4A 2Y1IA 3IR5B 3QETA 2CVIA 4IO1A 4P52A 4LF5F 5K8NA 1WACA 4DV3F 3QZ7A 3SBMA 4NLCA 2AYEA 4F50A 3MMAA 2QWQA 3QJPA 3EO3A 4KRWA 3R1LA 1TFYA 1BE4A 2J4RA 3ATUA 2GWJA 1S1TA 5LMNK 2MGZB 1BQXA 3CC4S 1N6QB 4TSXA 5HJYA 4R8UB 4HTUA 2M70A 4OMFG 2W41A 4UY8O 1N5VA 1NMEB 4DR4J 4OL8A 3P83D 3JAMU 4OZNA 2YNIB 1JLEB 4DU8A 3H46O 1J5EJ 5HOOA 3NHGA 2AU0A 4PWUA 2BW7A 3FZHA 3SPYA 4XH4A 3VQ4A 1X4DA 1VLOA 4NWBA 3AJDA 5AQFA 3UDVA 4X4QA 1VQMN 4FJMA 4M95A 3HHLA 4FLYA 3SCXA 4GV9A 1O6XA 2WB1D 1TL7A 3ZX3A 2Z1HA 3IFEA 3HKZD 4IRDA 4ALZA 2KVIA 2LQ9A 1U6ZA 3IRWP 4PKDB 3TUPA 1RBUA 1R0BG 2XYGB 1JKHA 1Q53A 3MUVP 2I6WA 2OFGX 1A7GE 1BHLA 1WHYA 5AQSA 2BR0A 3HTVA 3CMAN 4WQ4C 2DNZA 5EGYA 3SCKE 2F1FA 4OJGA 4E2FB 3MMCA 3WIVA 3PFEA 2NXUA 2EKNA 3QINA 4DR1K 4EP5A 1V4SA 2M2BA 2DYAA 3M30A 3CDBA 1ITGA 5DMRA 4LFCJ 4LF4F 5HRRA 3VEZA 4A2BA 2UXCJ 1QTNB 2FJDB 4P73A 4U6PA 1HA1A 3HPGA 3EPIA 1RAOA 2HIQA 2R8HA 4ECXA 4Q8EA 2CQIA 4K4UA 5K9FA 3TA2A 2W9CB 4CP5A 4ZPVR 3RBXA 1NZAA 3PW2A 1SJFA 2ZHAA 1YJ9S 3CNQP 3N28A 3L7OA 3FZ2A 2WTUA 1W2BR 4TNOA 3OYBA 5HJXA 3NH0A 5KFVA 2PFFB 1RT1A 4DQSA 4N76A 4K0KF 5F0UA 1IKVA 4RW6B 2HFVA 4I6MB 3LPUA 2KQ2A 4PL7A 2OPQA 3ET6B 3LALA 3TSPA 4DR2J 3V9SA 4WFYA 1TV6B 4ZPCA 3SV3A 2ZM6K 3DLKB 1G1XA 1XMOK 2H9ZA 4YR0A 1S0NA 1FCAA 4WF9L 2ZH8A 1K0VA 4PKHA 3MPDA 3B6BA 3WDOA 3HPOA 2CDRB 3C15A 1NDPA 3TOQA 3GR0A 2YY3A 3N4PA 3K89A 4DPTA 4OZ5A 2IVMA 2BE7D 3BDEA 3UN3A 2C42A 1S6PA 4I4BA 4IKAA 2XM3A 4NYPA 3BGOP 2VBYA 1DTQB 2I5JA 3L4IA 3O6WA 2XSFA 5J1EA 4QS8A 1IKWB 2UUTA 2CQDA 2MHEA 3B6PA 3BV8A 4GRSA 2DNNA 5FDLA 1XERA 3UKRB 3FE1A 3C7NA 5C2DA 4OZ0A 3UPFA 2HZAA 5H9FK 1RWPB 1UFLA 2BUPA 1N5QA 3NF9A 3A13A 2GJFA 2H3GX 4B08A 4K2XA 2IA6A 1K0TA 4EFAC 4I69A 1K73T 5AQYA 3C14A 4FNHA 1MROB 2RDDA 4HTJA 3TQEA 2MJUA 2ZGZA 1FRKA 2GJIA 2F8EX 5DQIA 1JIHA 1TELA 2E1YA 5I3QA 2IAJB 3BDPA 5D0RA 2BE2A 5DO2A 2PYJA 3WUHA 3PYDA 2W9AA 3IKMA 2ZBRA 1NGGA 3VEOA 2DCLA 4JI8K 2VG6A 2DNRA 4EYIB 1I1GA 4GNIA 5AQPA 3R8EA 4DLEA 4F2RA 3PRDA 5H1SQ 1M1KO 2P9IA 2PA8D 5GAGU 2ERRA 1RU1A 1W9HA 3VTIA 3SV4A 5M1NA 3M2UA 4Y2KA 4YY3K 1T03B 4P74A 1RDCA 2XRIA 3TJ8A 3HSDA 2FBYA 2GVZB 1HBMA 2FJVA 4LF5J 1JLFB 4PR6A 2HAFA 2IVNA 3EJMA 5HL7Q 2BJDA 2DKOB 5A0YA 3M9MB 3UN2A 1FJGK 3VTHA 3MM7A 2D41A 1QVGR 3Q8VA 4DPUA 2CQ2A 1XQSC 3VAJA 4X4PA 4DTXA 2C1EB 5GIPA 3I96A 1FRLA 2EFNA 4BC7A 4CO2A 3GFZA 2HHSA 2VJVA 1RT2A 4A8MP 1ZM4A 1ACMB 2MKYA 3L4BC 3H0PA 2AZ1A 1Q81T 1S9EB 5HLFA 1HBNB 3TSQA 4PRFA 1KWMA 2F8SA 3LUYA 2FLLA 4W90B 1PC5A 1JKHB 2E1MC 3OSNA 4DL3A 4FVUA 3CMQA 3HP6A 3D6FB 4WPAA 2OEKA 1YSJA 2GMJA 3CDUA 4AQYJ 5E2QA 4CZCA 3I0RB 5C10A 1XNQK 3CTRA 1X9WA 4KV8A 4IDHA 3OJSA 1HNVA 3PIPQ 1FRIA 3SQ0A 2DPIA 2DJWA 5IM0A 4O44A 3IC1A 4I64A 3IXQA 2FZKB 1JK9B 3M30B 2YI1A 1Q8KA 2K7KA 3O1BA 2Q3PA 2D1CA 4A2AA 1D5AA 2YKQA 1S22A 3VVTA 5JVGL 3F0NA 2LLZA 2JH3A 5BPMA 4I1TA 2RILA 3RU0A 1H6KX 2B4OA 5IT9O 1MMLA 1RUSA 3KJFB 2AYGA 2E7VA 4NA2A 1HYSA 4JI6F 1YQHA 3SQGB 3KVGA 4DKWA 2WUSA 4TU8A 1YBAA 5LJWA 3TUIC 5ETOA 4YS2A 4WWSA 3K2PA 3VQ6A 2ZF5O 1N36F 2FF3B 3EE3A 1S9FA 1D4XA 3BSNA 5C2FA 2E8AA 4FW2A 3BF1A 5K5MA 2F8TA 4WTYA 3ZEUB 3OV7A 4EZ6A 2YX7A 3IMXA 1QQOA 3BBFA 4AT1B 3GV7B 3KMQA 3QICA 4JKDA 1JLCB 4MKAA 2HZVA 3W0LA 3W5XA 1YJUA 5MAOA 3G82B 3CCJN 3LWMA 1A0OB 2FBTA 3VQQA 4NLQA 1YRTA 4HCCA 2MKHA 1YGYA 2RUSA 1MWZA 2DR7A 2DEIA 4K4SA 2Q0RA 3OVBA 4FJHA 4FYDA 5F9NA 2F65A 4BDYA 1ZBTA 2UUBF 2GAGC 1YTAA 4DS4A 3TA0A 1CJVB 2J9DA 1VQLN 1VQ7N 4ZCIA 4X2BA 3MCPA 4E8UA 5TKYA 3JQKA 1C0UB 3IAM9 3H3NO 1SUQA 4DR6F 4WFAQ 3HHLB 2QIFA 2MEWA 2CPXA 2E7WA 3Q2SC 1JNZB 2QI2A 5C15A 2PO4A 1IQTA 2GNKA 2DGVA 2CJAA 3KHHA 3M7VA 3U3GA 2FGOA 1EETA 1VQPS 4G9ZA 3TAGA 4JYAJ 3QJJA 4DR6K 1WG4A 2AJ2A 4B3TF 1D09B 2RQCA 1QQMA 3HD2A 1W2IA 3S3MA 2UUAF 5EDWA 3MD3A 3CQXA 3AOCA 1QVFM 1NJYA 4FK2A 4ZVUB 2ASLA 3CFOA 3VEVA 1HKAA 4U7BA 2QRRA 2MKSA 4OJRA 3WQPA 4ZHRA 1ZH5A 3BH7B 5E5NA 4X64K 4B3SJ 3SBGA 3TWZA 3AQPA 4D3HA 4DN0A 2W8LA 1LKZA 3BH6B 1UAXA 1UEUA 1K8KB 5CQGA 3I5AA 2HFNA 2G4BA 4IQXA 4C97A 4WXOA 3FBCA 5T7LB 3BGRA 1RAIB 1EX4A 2ATCB 4UF4A 1RJJA 4ID5A 1Z2ZA 5L1KA 4E89A 1WKKA 2J76E 1WAFA 3D2EA 2Z58B 2UUCJ 3PW5A 2KZZA 5HBMB 3PYEA 2JEFA 4M5KA 1PC4A 4X4OA 4WF9Q 4IRCA 4F0HA 1A5XA 4ICLA 3P8BB 4NASA 3NVMA 3KK3B 5HQMA 4XH1A 4K2JA 1GLLO 4DTJA 3MFIA 4IFVB 3VGSA 2D3UA 1EWQA 1SQGA 2N3OA 3DM2A 4DV5F 3DDKA 1EAYC 2AA4A 3SLCA 2W7AA 3QQCD 4WCEQ 2ZKTA 2DEJA 4QS7A 3MM8A 1G4CA 3GMGA 5CYQB 5B0FA 4Q45A 1RSCA 4CCHA 4HUFA 1VQ5N 2P9LA 4WZQA 3GR1A 4F26A 3LDSA 4I0WA 3IR7B 1MWYA 2NR0A 2RS8A 2XULA 4ZPBA 4F9OA 3BKUA 2CQ1A 4EEYA 1L3SA 1BUXA 4YNQA 2F9JA 1REVA 2NPIA 3SQ1A 1HBMB 2HIYA 1FE4A 5B0AA 3CJ8A 3ID8A 4UT4A 2AX0A 3ULEA 2OIHA 2WONA 4WE1A 4HUGA 2O1PA 2R8JA 1GXUA 1Q86T 3MM5A 4RTFD 5CZ2A 3ETMA 3DLHA 4H4MB 3VF2A 3FFIA 1XR5A 3DXMB 2WVBA 2X1AA 3O9UA 3CC4N 1JLQA 3OFHA 1W26A 4MDBA 4F4AA 5C2CA 2PFUA 5GINA 3ZCMA 4HACA 2R42A 1PCAA 4OZJA 2O8FA 1S72N 1UEVA 1GMWA 3A8KA 5LXYA 2B56A 3IWLA 4A5BA 4XK8C 4YOVA 2XZDB 1X5PA 4MAKA 5FIIA 3IWNC 2P9GA 1LWFA 1VGYA 4ILMA 2PDAA 3OJUA 1IG8A 3AVBA 3FUYA 1SKUB 3PHTA 2EKYA 4RUBA 2DNKA 4ZKAA 4JN4A 2XEXA 4YDDB 4TY8A 1RISA 1HW8A 3MM6A 3CT9A 2HF4A 3Q86A 2VD3A 5C42A 1HJOA 1JCFA 2MQPA 3P38A 2CH6A 1X4HA 4O8UA 4FS1A 2I5JB 3IG1A 1FRJA 1HI1A 1JL2A 1C1BB 4Q5VA 9ATCB 3UI3A 4FF4A 4BRPA 2E9RX 1R0AA 3OBYA 1RILA 4Y1CA 2FJBB 1MA9B 4H0YB 3V9XA 4N8OA 4EBEA 5ETLA 5JVGQ 2O8DA 2V94A 4CJWA 3DKDA 4DUTA 1RWKB 2AGOA 2MKKA 3PKYA 5HP1B 3IRXB 4LD0A 4KSEB 3MMJA 3DLEB 1Y64A 1T3OA 2KT2A 4URSA 4U7UK 2NRTA 2L9DA 3MN9A 3D6TB 2Z0GA 4OYMA 1ZA2B 1N33F 5HLFB 2HGNA 4DV6J 3IUCA 5D78A 2HBLA 3AVMA 4W98A 3T5HA 1P27B 2E1CA 2A1RA 3LPTA 1HWKA 4E1NA 1KVIA 5C42B 3W2WA 1V4TA 3GIRA 4MDAA 3A12A 3HI0A 3W1YC 2R7VA 2LU2A 2RMLA 1P8GA 3A0IX 3P49B 1LCUA 3KG4A 5D8HB 4CESA 2V2KA 2XMKA 1IM4A 1VK3A 1VSJA 3EDQB 3SUPA 3ENQA 3G71N 4DB3A 2RRNA 3PJWA 2Z2MA 1DQ8A 1VMBA 1FKPB 1AUDA 4HVZA 3GV5B 4UZBA 4OYZA 2EFVA 1BMQB 4S0MA 3NGKA 4H0VB 3J7YP 3VEXA 1BWEA 1U8SA 5M1QA 4KTQA 4JS4A 5L9XA 1NHKL 3DOLB 3ZT1A 5K14B 4QS9A 2HNYB 3ASMA 1RGVA 4KFBA 4DV1K 3L0QA 4X65K 4O5BA 3CJ0A 1U1QA 4OZ3A 2P1JA 2HWTA 3CWJA 2F9WA 2L41A 4TVAB 1SQFA 1UOCA 2GQQA 3UKUB 1YRUA 3SQ2A 1H7WA 1Z4UA 1ELOA 2YNGA 3C2PA 2DTJA 4ILGB 1GOBA 1RAAB 2ZUAA 3AXKA 3CDAA 2QM1A 2AJFE 2RQMA 3SFGA 2RF2B 3VZHA 2ROPA 2AF6A 3PW4A 1NU4A 3G82A 1EX8A 5F1XA 4J2EA 2MQOA 4H4OB 2XMWA 2E66A 3VN5A 3KDNA 3D45A 3ZLJA 3CHWA 2OCEA 3T7ZA 2VB6A 2C2NA 3THPA 2JHEA 4LF1A 1JXLA 2WVCA 4QOZB 2VJUA 3DFEA 3M6XA 5HP1A 3KNAA 2FBVA 1J53A 1SC1B 3VAGA 3GPAA 2D7SA 1GLFO 4N7TA 1U48A 2H48B 4BS2A 2B4PA 2DNHA 2DGTA 3H5SA 3D1HA 3MDQA 2DT9A 2FVCA 3I0SB 3CJ7A 2JFKA 3P3DA 1NGCA 3ZZUA 1CS4A 4L3KA 4USUA 1K8AT 4B9VA 2YWFA 3V5RA 1WEZA 2H5JB 4D3GA 1U7LA 4ZPTR 3RBEA 3LDOA 3SUQA 4CLTA 3SDEA 1OY9A 1O0PA 4ZP8A 2K1RA 5KFAA 2QYCA 4NLYA 2UXDJ 5FPNA 1UTAA 1WDDA 5JVHL 3G71S 1JLCA 4IJNA 4CF8A 3TJAA 4AL7A 4CH7A 2G1HA 4KTWA 1HMVA 2IS3A 3O3HA 3KJVA 4ECTA 3V6KA 4RCHA 4O0IA 2JEGA 1NWKA 2B51A 2PGCA 1FXLA 5IZHA 1XQIA 1OYDA 4B3RF 3FZBA 3OQ2A 4C8YA 5M1FA 3PVXA 3FR0A 4L6V3 3WXKA 1HBOB 4GO5X 4BC4A 4LSLB 4P10A 1U1MA 1Y00A 4KGMA 5E3PA 4OX9F 4DCJB 1RKIA 1QQCA 4IH6A 4OHWA 1IKXA 3SMZA 2IYGA 3TZWA 2QA4S 3VAFA 4HI1A 3UNYA 3CGIA 3W9IA 1TUWA 2HNYA 3Q2TC 2ASOA 2IVFB 1Z6RA 4DG1A 3OFGA 2D0CA 2FDNA 1UJ4A 3R7BB 4BRQA 2L9NA 2DPJA 1ICEB 2E5HA 2G1DA 3NBPB 1U0HA 3M8RA 2ZZTA 4NMXA 3CEDA 1T9WA 5DS7A 1KCFA 2P9NB 3V4IA 3C95A 1M5HA 1VR6A 2OKQA 1T6DA 5IFMA 4M3WA 4RBVA 3C6TB 3L3CA 2HVHA 2WSEC 2QX0A 3U1MA 3SSQA 1BI4B 3TZXA 1LWEA 3DCAA 4YB7A 2D0BA 3ZZYA 3GE1A 5KFMA 4B02A 2V8GA 3ISNC 5F3TA 3O5BA 2EFQA 2ZOGA 3WNHA 1U8WA 2GELA 1T02A 3NCRA 3I33A 4DFMA 3G6ES 2MLZA 3HULA 4KC5A 1RDAA 5JS2A 1T9TA 2YX1A 3JQMA 5CZVA 3NCPA 3H2VE 2Z30B 4DTSA 1Q7YO 3MWBA 3O44A 4ED3A 1F5AA 4OYXA 3BR8A 3RJMB 4DQ8A 4NYNA 4X65J 1VIXA 2KO1A 4MYUA 2GV1A 2M9KA 2LEPA 1HNIA 2E29A 5B08A 3CCLN 2HSTA 5LSLA 3QFPA 2MGZA 5C0YA 1PYOB 4K4XA 4ER8A 4FBUA 3OTOJ 3C7NB 2OHDA 1W7AA 2NRZA 2O8DB 1N34F 3UFCX 4LF6K 3QATA 2FC0A 1BQMB 2A42A 3UDCA 4QBUA 3THYB 3PSFA 3W3SA 4GVEA 1VQON 4ZVFA 3VQBA 1U09A 4LSNB 1Q9YA 1S6OA 3OXLA 3ENWA 4Z4GA 3I5BA 2QA4N 3M8SA 3DXSX 2NQPA 5G0RB 4GKKJ 5A76A 1MWKA 1ULRA 3W60A 1CXQA 4JKHA 1SI9A 4ILJA 1RT6B 1UMJA 3HX9A 4F3QA 5F8JA 2H5IB 2XY8A 3GSDA 2ASMA 4CEZA 4BY9C 3QPIA 1KFDA 3AVFA 3C6UB 1OYEA 1WSGA 2FVRA 2W9BB 4QU7A 4V19J 2VPWB 4FKXA 1P6TA 2XMTA 2COLA 1S59A 2HHHJ 4M3RA 1DKGD 1NLKL 3TUJC 3H08A 4Q0BA 1XR6A 2B4JA 2Z8QA 4YB5A 1P1TA 3BY5A 2JRSA 3MF5A 4NLUA 4WKYA 4ES1A 4NI2B 1XMQF 4OX8A 2OPRB 4KH5A 2CQHA 2IAJA 4FDFA 3KIOA 4CGIA 3E2EA 3E66A 1VJWA 4B8AB 3VEYA 1TL7B 1SV5A 5I42B 1KXPA 3CJCA 1VJQA 4NLBA 2EPIA 2DXDA 2E2OA 1B92A 2B4UA 2E2PA 4KPYA 4LIRA 3CCLS 2QKKA 1X4AA 3ZTQA 1QSSA 4LF7F 4K8XA 1YJ7A 2HHHK 4X4TA 4I6MA 1DHMA 2ZHOA 4CQ1A 2DRBA 1TAQA 4WK1A 4NEYA 2OPQB 3A5NC 1KOHA 3ZZPA 3N5BA 6FD1A 2M5YA 5B0EA 2EK6A 1KQSM 1SJ1A 2Y1JA 3Q8UA 4DUZK 2WRMA 3D3CJ 2ASDA 3OS1A 4Y65A 2W6LA 1S49A 3KNGA 1QUPA 2F9TA 1HBOA 2MY8A 8ATCB 3HXMA 3JSBA 2JLGA 3KUGA 4KI6A 1OS5A 3GIMA 1VQNS 4CJ3A 1GXTA 2V8HA 5GAEI 1G3OA 1WN7A 4AD6A 5AQTA 4OYOA 2ZDPA 2OPSB 3QEWA 3SI6A 1C4AA 2UXBF 3I87A 1WEYA 2D0AA 2XI2A 1LOTB 2EG1A 1UVNA 3NL0A 2P9KB 1S48A 3ADAC 4OHZA 3M8QB 1U6BA 5AQOA 3P96A 5KOXA 5KRSA 2RE2A 1JLAA 3LP0B 1KVCA 2H4YB 1N5YA 4DR1F 1BA1A 4C0BA 5L8RC 3MWPA 1UW9A 3I0RA 4URGA 2VQFK 2QXLA 4CHNA 3JSMB 3FRZA 4RG8A 4DX8H 4O3QA 5B09A 1B7FA 4H54A 4W5QA 4E7LA 1XR7A 8RUCA 5BN9A 1KQKA 2BQUA 3H25A 3AGKA 1S12A 4FZVA 2ZWHA 1UZHA 2KRBA 1MN7A 4KH1B 4RUAA 4ZVTB 2XI3A 5AQNA 2ZH6A 4Q2MA 4KHSA 5MLCQ 3QIDA 3B8AX 4HVJA 1SH3A 3W3DA 3KLEA 2J5AA 4OO1J 2IVPA 2C3MA 1WTFA 1C1CB 4CGHA 3OBIA 3NOGA 3FNNA 3LH2S 3JTNA 1J5EK 5C24B 1CXUA 2NUHA 2KYZA 4FM2A 3K2YA 1RTHB 1I5OB 3KLGB 3TARA 4LF6J 2R2SA 3P5BP 4E7IA 1VK8A 4RWWA 4KHWA 4KY3A 3QBWA 4JHDB 4QIWD 3KG0A 4DFJA 5KPRA 5IV3A 4CH1A 1R6YA 4NO7A 5CR4A 2CQ4A 2H54B 2HS4A 1P9YA 2X6SA 1T05A 2GZOA 3OL6A 3VR1A 3CJRA 4DOZA 5B7WA 2MZ1A 3KWGA 1KFSA 5LMUK 2E5LF 3NCQA 2MKCA 3LF0A 3TA1A 4RW4A 4OHYA 4ELUA 1TGOA 5JJBA 2YV0X 3Q8QB 2VPXB 1O5JA 1WHVA 2HVZA 1SL2A 2CZ9A 1VYAA 3PW0A 3OUYB 1YX2A 1ZM2A 2VG5A 3BR9A 4NA1A 4BRDA 1ZBIA 2IDEA 3VVUA 1LAWA 1JLBA 1S1WA 1MDUB 5EY4A 1KLMA 2APOA 1UVMA 4AQYK 3HD1A 3BN4A 3GWCA 4JI1J 7FDRA 2N7YA 2XS5A 3FBBA 2ZH7A 3UVJB 1OY6A 5KFPA 2ZJRQ 2P9SB 1T3VA 2KT5A 1Q5YA 1CPZA 1CEZA 3H45C 1RB0A 3TO8A 2I38A 1CJKB 2CJXB 4NLXA 4CM2A 2VQFJ 1DJ0A 1VC5A 3I56N 3LWLA 3MAHA 4TU7A 3WEEB 1G6BA 2HMIB 4ES3A 1ILYA 4WP8A 1SJQA 5HANA 1E4FT 4LRDA 4E98A 3ZT4A 1DBDA 4BRMA 1SJ3P 2O8EA 2W2OP 3ITHA 4OZLA 4RW8A 4B1YB 2HGLA 4O4RA 1RBLA 4AILC 2EW9A 4CTAA 4DJBA 2NYHA 4KT0C 5CHIA 1WHXA 4P9SA 2BV3A 3MMCB 3N6NA 4QZVB 4WBFA 4DR7J 3D66A 1D0EA 3AVIA 3AVLA 4ZLLA 3MN6A 1IXKA 5HSPA 2W40A 4B1WB 2WVFA 2OANA 4USJC 3A5LC 2G8WA 3AAQA 2CWKA 3NGIA 3D67A 1E6VA 2ZBCA 2HHPA 3H1QA 3NCIA 4M94A 5AQHA 2QLFB 5CYMA 2EBGA 5BPLA 3B4MA 1VQ6N 1A9NB 3E9LA 4IOAQ 5G4DA 4FZXC 1S7IA 3AGRA 2O8FB 3MMBA 1GAOA 5F9LA 4JI3F 2XLIA 4MYTA 3CE8A 3OR1A 3NE6A 3R3LA 5RUBA 3HBTA 4I6YA 1B99A 2VDHA 3VAMA 3M6VA 1DY3A 4GY2B 4HKQA 5HROB 2D3OR 3CUNA 4DX6A 5HO4A 3J81O 2HFOA 1N8RT 1M5VC 2ZC3A 4YEAA 1JCGA 1N36K 5AXLA 4J9UE 3JTPA 4KAIA 4IBNA 2LDYA 1C0FA 4DTOA 1GLAG 1UWAA 2LSNA 2DFHA 1KAXA 2GWKA 3PNIA 4LVOP 5A0YB 3Q89A 4JI3K 4DQIA 4L74A 4ZVPB 2MZQA 4JI8J 1CJVA 4PAAA 3BPSP 1EZZB 4XAKA 4FYWB 4MJKA 4JI5F 1YWXA 2WBRA 1RT2B 4AHRA 1U0SA 1R3NA 3OBWA 1GTEA 3J7AN 5BRHA 1CQMA 3PXGa 1HLWA 2DR6A 3FJ2A 1FEHA 1VHFA 2GQ2A 4Y0WA 3DLGB 3N4WA 4DMZA 1YJTA 1TKZB 3B6OA 4CHQA 3HT3A 3U8XA 5AJ3K 4CFDA 5ETQA 4IG3B 2KFYA 4ZDNA 3F9KA 3M8YA 4Z37A 2J9CA 2NUBA 3RW6A 3OTOK 1JNRB 3G87A 3US5A 4Q2LA 4YHHJ 1TAUA 4MIBA 4F4ZA 3MOZA 1FFGB 2PMHA 2JNJA 3MEKA 3VQCA 1IKXB 3N9UC 2AHOB 2VBXA 3CD7A 4CJFA 1SJ4P 3RB0A 2WW4A 3H1VX 2ZUGA 2AD9A 3SQGA 3K9JA 3MEDB 3MEGB 3ENVA 4QYZK 4DR2K 1FFSB 3A3NB 5EUHA 3KLGA 4JI1K 4GKKK 1WSJA 3SCLE 3U7JA 4YOUA 1J27A 1SKSA 3NGUA 1IBMJ 3HOTA 2FHJA 2O01C 4YB1P 1I51B 1MU2B 3DRRA 3HL8A 1Y9OA 2D74B 2CYYA 2HHXA 3ZSVA 3HVWA 1HBUB 1RHUB 3U9DA 2W2QP 4KHPF 3CIPA 2K8GA 1K47A 2X7IA 2BANA 4E3SA 2KW4A 3KLFA 4IFYA 5C5JA 4AM7A 4FF2A 1B0TA 2DNYA 1TUGB 2CPIA 3OL9A 4FJNA 1NB2A 4KR0B 4JI2J 3PEJA 4A8YA 3DLBA 3ITHB 4JKCA 5F8LA 1BCOA 4ED5A 2FHJD 1NGAA 3UR3C 4QWCA 3UD5A 1UAWA 4JP8A 3DXKA 4CZGA 3ONQA 3CJ4A 1YVNA 2YPZA 2VWBA 1HJRA 1GMVA 1NSKL 3AO5A 4ELTA 3NGZA 3CCUS 4DCOB 1CLQA 1NSAA 4JI5K 2GA7A 1Y0HA 3DJCA 5D77A 1FWKA 4XO0A 2RIJA 2JEIA 2HQ3A 3ZNJ1 1MU2A 5JXSA 1GFWB 2K1RB 5KT7A 1EP4B 4EMDA 3AVGA 4Q0BB 4JS5A 3QGGA 3CI5A 3UN5A 3BYRA 2J6UA 2ZOMA 5DZ7A 3T1HF 1NEEA 2ZM6F 1NDKA 5AJ3J 5KFGA 3SYZA 4RNOA 3UD3P 2WHOA 4AHTA 3O4QA 1VLYA 4QYRA 3DRSB 3HSTB 3O1LA 3ZYYX 3FSIA 2OMOA 2Q6BA 2OP5A 3MGJA 2CJYB 1HNXJ 4I7FA 1NBEB 4OI4A 2J7WA 2BJEA 2QK9A 1SS6A 4C11A 3BUZB 1OSCA 4RW4B 2HG4A 1BL3A 4PG7A 3F2KA 1RXOB 3V6DB 2HFUA 1E6YB 3ZT3A 5H9EK 2RHSB 4BBYA 1QJHA 4ISEA 1FW6A 5A6WA 1V3ZA 5E3RA 5KFZA 2Z1IA 4PPZA 4KBOA 1ROFA 3R7SB 3O3FA 2DRDA 4CEBA 1HPZB 2HAIA 2UXCK 4L76A 2E5LK 1SQEA 1N32J 3JYTA 4R8UA 4CLLA 4YB6A 4NXNJ 4PXCA 2MYFA 4ITSA 1QSLA 4QOTA 5KFDA 4OZ1A 3PIOL 1IR1A 1CC8A 2Q1LA 3GG4A 3T1YF 2C2ZB 4NE9C 1MN9A 4IFVA 1UW4A 2JSXA 1RAJA 1T6CA 2JLEA 4IFYB 1OQ6A 1VQNN 5K14A 4DUYJ 3ENAA 2JC0A 3HLUA 4P6QA 5JVHQ 3SJHA 1ZAVA 5AQXA 2DNPA 4OVLA 1APSA 3ILLA 4LR7A 4OI0A 4NCBA 1P9QC 4L3NA 3SK3A 4FPBA 3FEXB 1AFJA 1TK8A 1KQFB 4BR2A 4LUBA 3RWUA 3IBCB 3W2VB 1SIZA 3D4JA 2XQCA 1KD1T 5ETKA 3PLAA 3DLRA 3VGMA 5LOQA 5DM6Q 1M90T 1JX4A 2DNOA 1OPZA 3L7UA 2O5DA 1QM9A 4DV4K 2HVDA 4ZHRB 2FZCB 1VCTA 3SZ2A 1NGFA 4QIGA 2HQGA 4FKYA 4ECYA 5DLFA 3H8YA 3W8PA 4H5VA 3FK4A 4JUZA 1YLXA 4CE9A 5HRSA 4I6WA 1AXQA 3U4LA 1BQMA 4A8OA 2ETJA 2H5EA 3RUBL 3THYA 2GQCA 4M8LA 2V9WA 2IA0A 4NZ7A 2X51A 4BG9A 5AQLA 4HCBA 5CAAA 5AR0A 3J7YU 4LFAK 3DLJA 3O4WA 4U8YA 2HLTA 1J6ZA 2OFHX 2YKPA 1C6VA 3CJQA 5BXIA 3MUMP 1V6HA 2NYIA 5A8RA 2DNQA 4DV4J 3DLGA 3IN5A 4OJ3A 1NK7A 2UP1A 4N8NA 3E8OA 4RNMA 2HNZB 2Z1JA 5BN8A 2V4RA 4Q44A 3IG1B 4PG8A 3VPZA 3NS5A 3F44A 1FK9A 3CCQS 4X66K 5DDPC 2AYBA 3GTYX 3KLFB 3FVYA 4DSFA 1MG7A 5KFIA 3GV8B 3ZX2A 1VSLA 2D69A 1C0TB 1FJGF 3CERA 4HH0A 4LMZA 4M3TA 2CPJA 5F0WA 2W2NP 3ZXWA 2CPYA 5GAEU 4BRGA 1SKWA 3H3OB 1Q79A 3R1XA 5J2QB 1UETA 4M3XA 4EU0A 3SXLA 3VAIA 3ZNUA 3EGNA 3OYLA 2YWWA 4X62K 4ECRA 4K43A 3PSIA 2DXFA 1FKOB 4CK2A 2J6SA 1DLOB 1F0XA 2GGPA 3MDFA 1W25A 5D0HA 3AVCA 2MHNA 1C0GA 4B17A 3AO1A 4MIAA 3FFIB 1F1BB 5KT6A 2XGQA 4FK4A 4DPXA 5KGXA 2G8IA 2QW9A 4BRCA 4BRAA 2VDIA 3MPVA 2YWEA 5HN0A 1RWOB 4LF9F 1NPRA 2HHTA 2YKNA 1BQNA 1AUSL 4NLDA 3BYPA 2V69A 1VQ9N 1HWUA 1LWEB 2E7XA 3PIOQ 5IM0B 2W9BA 1ZBSA 4WP9A 3I5CA 4CWBA 4X64J 2CPHA 4XPEA 4BE2A 4BR0A 5KOWA 3AO4A 1EKEA 1X5SA 4FXWA 2BXJA 4Q7AA 3UD4P 5I4MA 1X60A 3TAEA 2UVWA 1S97A 5EX0A 4J9OA 2D0PA 4RZRA 2FJXA 1HL6A 1GOAA 1DRZA 2ZH1A 2E5IA 4FZYA 3D6MB 1WJ9A 1F5CA 5J1EB 2RU9A 4C1NI 4FOEA 5LSRA 2CJQA 4UOGA 2WFBA 5DDOC 4K7QA 5HMZA 1BA0A 3EE8A 2WONB 4WE1B 1GK8A 4KHUA 2W7OA 3VCDA 1KS2A 1UPPA 3UWTA 3TWHA 3HHNB 2DHSA 2CWXA 3LO3A 5KFJA 1D9DA 2G8KA 1TYQA 3E51A 2ZEJA 3VQEA 5KTQA 4FL9A 1HMVB 4JRQA 3GJQB 4I67A 4B9LA 3CJBA 1S3XA 4USIA 1VK0A 1F9FA 1R8PA 4Z4HA 3PIPL 1W0HA 3BEXA 3MEEB 4TU9A 2P9IB 4C11B 2HWHA 3BPDA 3C3LA 2VQEF 3KLEB 2B9EA 1BOTO 1YIJN 2KVQE 1H73A 3CO0P 2ITMA 5EWGA 2A6AA 1VSHA 1WUUA 2QSWA 4GKJF 2DD8S 3MUTP 2KXFA 3ENBA 4DDFA 4HT7A 5ADZA 1NGJA 1RCXB 2QEXN 2HQCA 2Z4PA 4DHVA 1QVFR 4FVMA 1CZAN 4U7CA 2NSCA 1XNRF 2CQCA 3LM9A 3SQOP 3RAQA 4CO5A 3CG7A 4CEAA 3KXDA 3DLEA 2ROEA 1FEEA 3KHGA 3F56A 1Q1KA 2G8HA 4HDHA 3RRKA 4F3OA 1AFIA 2GIQA 2GFFA 1UWBB 2MLYA 3ZTOA 4DCPB 3TANA 1VQKN 1LEOA 1FDAA 2GX9A 1OIAA 3NRBA 2XHWA 4LREA 1WB9A 2MLXA 1WOQA 3ENHA 1MNEA 5KFLA 1HR0F 4KTZA 1V5IB 3NY0A 2OELA 3C6UA 3R5BA 4IUFA 3MXHP 1UP1A 5KG2A 3R5CA 1RYRA 4KH0B 2MZSA 4DR5K 2HHUA 2MSTA 3JSYA 2N4CA 1RWUA 3QEXA 3AVHA 1IV0A 3O8MA 4NRUA 4OPAA 2XY6A 4FPRA 1SL0A 3LDLA 4JI4K 1JLEA 4IOCQ 3PTWA 1DQ9A 4LFBF 3FZKA 4QIFA 2UVUA 5KT3A 4Z94A 2A18A 3IM8A 1JCEA 1HR0K 4C48A 1FD8A 1H2UX 3MR5A 4HHUA 4ZJLA 1VSMA 1H1VA 3TAFA 1TZ0A 1X8DA 4TQSA 3GJSB 3KDOA 4JI7F 2EEYA 4NZ0A 1XMOJ 5GMDA 4DTUA 1SC3B 3P6YC 3HF5A 4LF7K 1RWNB 2XO7A 1KC8T 3QLHB 4A46A 1VBYA 6AT1B 2C2MB 4KPCA 4QAGA 3TP2A 3VEWA 3J81Y 1N0UA 4ZVHA 2X1BA 2QWNA 2SXLA 1Y3JA 3SCJE 4PQAA 3TTFA 4JV2A 3TVZA 1MLAA 3IA0A 1URRA 2AEFA 4J2AA 4IR1A 3E9OA 3ZSRA 2P5VA 3Q8SB 3I8BA 4GKJK 3GIJA 3CF5L 1VQKS 5FLXO 3THVA 4CZHA 1GQEA 3BKFA 1NSQA 1D3WA 4ZLJA 1IBKF 4FLWA 2J0SD 1RAEB 3CCTA 5LJVA 1F5BA 3WNEA 4X62J 3CCMN 3ZZ0A 4FWNA 1UVJA 2RAQA 4BVOA 3R8YA 5B0CA 1TVRB 4CBWA 4WFBQ 1FI4A 5KFQA 2GS8A 4IRKA 2XY5A 4A8FA 2F3JA 5IOLA 1T3NA 2GO8A 1M90O 5HL7L 1K44A 4WZMA 3QSIA 1GXLA 5DDQC 4FWOA 1RAGB 1RHKB 3THXB 5M1KA 3G86A 5KPZA 1PSDA 3RB4A 4X4NA 3OL7A 2ZHBA 1S10A 4FBTA 2XCAA 4Y3CA 3P4UB 1U2RA 2FLOA 1RBTA 1K8KA 2V5HG 2W01A 4P2XA 4C7QA 2P9CA 2D1KA 3T5LA 1VBKA 3CC2N 4FXVA 2MJNA 4I2PB 2J0WA 3J81U 3RRHA 3WIUA 1XJWB 1IUJA 1VFJA 2AWZA 2VGMA 3QSYB 4DR3F 1WORA 1FRHA 3M05A 3R6GB 4H5NA 4NMLA 4ZITA 4DL7A 3HOSA 4X4UA 3VAHA 4JI4J 2FXUA 5GAHI 3PYFA 2V7YA 4YY3F 4QR0A 2VA3A 4CD1A 3OLBA 3Q8YA 3OYNA 4N41A 2YKOA 1B0VA 4CIFA 2I7NA 4XEIA 4DPOA 4HYKA 4ZIVA 2GCFA 3ZFVA 7FD1A 4FF3A 5AQWA 4Y00A 3QT6A 3T9NA 4DV0K 4Z2XA 4CGDA 4CIOA 3ZT0A 1TMMA 3SQ4A 4W5TA 1RT7A 3NAEA 5GAGP 4CLPA 4Z4IA 3OW2R 4AFFA 4F8RA 3LP2A 3QJLA 2EXUA 4ENOA 2CGLA 2JOQA 5ADXH 2R7QA 4JK9A 3AOAA 3QAUA 4EFHA 5CCLA 2LU1A 3J81j 1REVB 3S7RA 1XBWA 4CK3A 3S9HA 4KHQA 1BCMA 4B3MJ 1HKBA 4J9MA 5C25B 3OYJA 3ZZRA 4DL4A 3KKSA 2CJKA 4OKKA 2DIUA 1R43A 4FWRA 5GVQA 2MZRA 1EETB 4LF2A 2RRAA 2RJZA 5DG9A 4ZVGA 2FHMA 3THTA 4H5WA 1E6VB 5CH7B 2MSSA 1I94J 2JEJA 1CZBA 1ZC6A 4IDKA 3D0IE 3K59A 1YBUA 2YJFA 3GQCA 2EHGA 3BB5A 1IVZA 5FRMA 4KGXB 1TKTA 4YY3J 3M8WA 4TY9A 5CD4A 3IGNA 2OSQA 3AA2A 5F8NA 3MOJB 4OYAA 3GSIA 3LOUA 1NJWA 2Y8YA 1XK8A 1F3VA 1RI7A 3Q8PB 3OL8A 1S9EA 1M0SA 5KG5A 3QRRA 4TLQA 2E20A 4LRAA 4X65F 2D9PA 2JZ5A 1W2BM 1TL3A 2N4DA 3I55S 1OWXA 1IWGA 1OSDA 1J2VA 5KFEA 3OFFA 1CBKA 4ISGA 4A8XA 2V52B 5LL6Z 3J80Y 3S8SA 5EHHA 3CJ1A 4EYHB 2ZE2A 4CNZA 4W92B 3NGTA 4DZ6A 4KRFA 2KTQA 1RCHA 1VDHA 2YCHA 1L3VA 3OYEA 4DV4F 1X4BA 1R27B 3NXZA 1S6UA 5DM7L 2JC1A 4BHQA 1GX5A 3KZBA 2POKA 2ZBIA 3HJVA 1JB0C 3KK3A 1KHWA 1FNXH 1U2CA 4G1QB 2QLJB 3OYGA 1U1KA 1RGIA 3KJVB 4UOHA 1R8CA 1Q7LB 5EN1A 4EP4A 2IDOA 1R8BA 1FX2A 5KFNA 2O4GA 2AP1A 2L3MA 1WHWA 2ZQBA 3CD0A 5A2QY 3EVWA 2HS0A 2HMIA 4MH8A 1TL4A 2W25A 2V50A 1VAZA 2ZVSA 2VQEK 4JKFA 4ZLNA 1VC0A 2XMAA 4B1VA 2PMWA 1GT8A 3JXOA 3ZX0A 4O3PA 4RWXA 4OX9K 1SPBP 3NH1A 4ILHA 1VHIA 4WFZA 2ZWOA 3QDKA 2V6AA 4JKGB 2VOOA 5GMEA 3O5TB 5CY4A 1K9MO 2YHWA 1C1BA 1BC6A 4RU2A 4NXMK 3CJTA 1LK5A 1NU0A 3KYLA 1ZETA 3NFAA 3KMSA 2NS1B 2NZTA 4H4MA 5IT0A 1NJIT 2W2PP 5H9EJ 2J6TA 5JS1A 3LANA 1SKRA 4ZVEA 3O1WA 3DRXA 3JAMO 4X66F 3OYCA 4DV2J 1FVQA 1QVGM 4CECA 5IT9Y 1C1CA 3KWMA 4FWKA 3LL3A 2ZJQL 1S5ZA 3MPUB 3LP1B 1UA1A 1Y5IB 1WSVA 3W64A 3FZLA 4Y2CA 3HYFA 3TVYA 2IMOA 3DGPA 2PA3A 1WC0A 2GHWA 4LF6F 5FPMA 3VGTA 4DCHA 1FJCA 3QLHA 2XNQA 2Y8WA 4CJ4A 2UU9J 2YKNB 3DHXA 4FLUA 3DLLL 5KFXA 3TPQA 1QE1B 2BRLA 4Z4FA 3OXGA 3OYDA 4LH4A 1U04A 1B7YB 1F6TA 3RBDA 4CH0S 3CD6S 1RT7B 1JLGB 1HPZA 1FDBA 1IKYA 3CMES 3HHDA 4CZJA 2NXNA 3A3OB 3KLIA 2GO9A 2KRRA 1KVJA 2KFZA 3S1TA 1I6JA 4DV1J 1RT5B 2UU9F 5BRFA 4QYZJ 4CGFA 4UQGA 3C16B 3M6UA 1TK5A 1ASVA 3IRXA 3SAGA 3EX7B 5KT2A 4XDCA 3O9QA 1WSEA 3DXKB 2I1RA 4BRKA 3HI9A 2OEJA 2FHOB 3ZZTA 1J5OA 1YRXA 4DZDA 4RBTA 1CJUB 3W63A 4ZN3A 5GADP 4AH9A 3FFKB 4QWBA 1HD1A 3MECA 4HTLA 3THWA 4JAXA 3J80O 4DV2F 5HROA 4BE1A 4DSLA 2B6AB 3TAQA 2B43A 3W2VA 2ZJRL 4JV5F 2HNZA 5J2NA 3MXMA 2PYLA 2E5LJ 4TYAA 3GCWP 2NRHA 4C8OA 5C2GA 5I9EB 2FJEB 4ANEA 1VRQC 2HSEB 4CLWA 3G2XA 4CJPA 1PAEX 1YK9A 2QWRA 1HNWF 1HHTP 4O23A 3V9WA 1KNZA 1HNXF 3NGDA 4V19X 3HSZA 1RQ0A 2X78A 1PBUA 4CO1A 2AMCB 2Y0BB 1YI2N 2DBBA 3HK2A 3HHEA 2KI2A 2QMXA 3IM9A 5CD4H 3BQ1A 4TXSA 2FF6A 4IKFA 1CC7A 2K2PA 3OR2A 3R3TA 2R7OA 2OPRA 3D3BJ 2M88A 3HFZB 2HEKA 1C0UA 4KHPJ 4DFKA 1IKWA 3QT8A 4LQ9A 1RWMB 3WNGA 4WIQA 3L95X 1BO5O 4LJMA 2V63A 3KK1B 3UIQA 2ZWPA 3DI6B 3EKSA 2DHAA 2OTJS 2KJVA 1N5YB 4HL9A 2C22A 2LCWA 4YDXA 2HVEA 3Q0AA 1C4CA 2IOCA 2EFPA 3V4MA 3M5RA 4CO0A 1YAGA 5D4PA 3THXA 4CNYA 4ZPDA 3K58A 1Q86O 4UUXA 4MO4A 1FNMA 1NK4A 1JJ2R 4KB1A 4WQ5A 2XHBA 1B9DA 3LP2B 2F7TA 4I7FB 1GLJO 1VSIA 3GOIA 3QEIA 1V3RA 3G25A 1XWLA 3C8YA 1QS4A 3QEPA 1OH7A 3TR5A 3RSEB 2F4FA 2DNLA 3S01A 4JKBA 2X3DA 1FWLA 3DRYA 1F9EB 1WI6A 1PO6A 3QIOA 3OTEA 1VQ7S 3EVMA 4A57A 4RNHA 5ETPA 4ZTJA 2E2NA 2G8VA 4ID8A 4A48A 3ULDA 2DFEA 1UEKA 3MM7B 3TU5A 3V1OA 5T14A 1G2EA 1S1XB 4LF9J 4QW8A 2B9WA 3W65A 1HNZF 2HBYB 2YH0A 4ZIWA 3BKTA 2BYCA 4L3QA 3ET6A 1H38A 3WNFA 4YOEA 3NS6A 2B9YA 2BX6A 4WYBA 2DISA 4BGBA 3W61A 1PILA 5KRTA 4CRJA 4F0KA 2IRXA 2JWLA 2CNLB 1JQGA 2DIVA 3TVKA 3IBFB 2IM0A 3C65A 1UL3A 2I2YA 4FJGA 2UU9K 4C2MA 3CPWR 2DGQA 4A62A 2PAVA 2VFUA 2X3GA 2JWNA 5J1NA 1FJ7A 2ZVIA 4OJHA 3CYMA 5IT4A 3R7NB 9RUBA 5D4LA 1XHZA 2RKIA 1XEZA 2QE5A 2RPIA 2GIRA 2MQ8A 3D2EB 2U1AA 3GFHA 2LQ8A 2BA9A 4DL2A 1HHSA 4V1Ak 4ED4A 4QU6A 5AQIA 1NM2A 2FVQA 5E3CA 2R7XA 2FQQB 3PYGA 3M1VB 3TUZC 1B3TA 4MFBA 2FC8A 3UVJA 3VQTA 5FPEA 2HPUA 3TTCA 2RQ4A 1I94F 4KHPK 4PYDA 3OYKA 4I2PA 4LBIA 4J8FA 2UVVA 1VSKA 5F8MA 3CCQN 3K17A 4P2SA 3GZ7A 3T1YK 4KH6A 3RB6A 3FSYA 4NLWA 3MR6A 2VCPA 3PZPA 2P2CB 2KH9A 3RB3A 3OTDA 2B0GA 1QY7A 2W4DA 1WLJA 5A2QO 2DH7A 3BGLA 1HBNA 3ZSZA 4DR3J 4B3MF 3FQKA 2VYPA 4Y1DA 4FK0A 3KLHB 2GC8A 4FJXA 3CO9A 4G1IA 5EVZA 1U1LA 5GAHP 2L08A 4ZVRB 2OH2A 4DU4A 3FGVA 3L2QA 3VHQA 1HI8A 4JI0J 3OSPA 2ZC4A 2D5RA 2V9KA 1EHWA 1YZ6A 4J5OA 4EI2A 3MK6A 4OHVA 1HNWK 4PUOB 2FTRA 3T69A 3B8HA 4IO9Q 4ZJQA 4OX9J 4FPAA 3NMRA 4HWIA 4UUWA 2YX4A 3A4TA 3CXCR 4MO5A 3R5GA 4LR8A 3R97A 1NLVA 5HK4A 1X1PA 1WOOA 3RMCA 2FHKA 4BR4A 3QMLA 3NP5A 3CB4A 3T5KA 2NRWA 1MMDA 2Z2YB 2KG0A 5JLHA 3M8ZA 3VQ9A 4H0TB 4M63A 5KFKA 1HWJA 2R7TA 1S1UA 1NG9A 2KG1A 3EZWA 3OYFA 3T1AA 5E0OA 4FLZA 4PZVA 4WP3A 1LW0B 4Y6IA 1KOOA 4DX5A 1UJ5A 1WG5A 5KFBA 2GEMA 1FESA 2A10A 3DU6A 2XTJP 4MKYA 3SAHA 1JLAB 3FCWA 4JKAA 3WXIA 2RQKA 3L9ZA 2W6KA 2GGPB 4RU9A 2ASJA 2CG8A 3UDLA 1VC6A 2AQ4A 3UR0A 4C4WA 5BPNA 2G8UA 2FPHX 2J7UA 1B64A 4H0XB 1KDNA 1QHAA 4CT9A 1N52B 2FBXA 2MY7A 1RABB 5KI6A 4NLTA 2EX3A 4KV8B 1H98A 3F9MA 4FP9A 2J9DE 4IEEA 3IP0A 1VSFA 1NHUA 3V2UC 4CJVA 2E44A 1Q81O 3O6QA 3TTDA 4IH7A 5DK5A 3Q7CA 5LY3A 3KFWX 4EK2A 4NCGB 1REGX 4KHMA 3KHYA 1U24A 1LW2A 5F2RA 1X4FA 2YQ3A 4J9LA 1RTDA 2QLXA 2RNEA 1AZSB 7AT1B 4PXBA 1M1GA 3AO2A 4IQMA 2HW3A 4F4WA 2VC0A 3VMFB 1T95A 2HMPA 3R6LB 1N4LA 5CA5A 2I7PA 3HKWA 1URNA 1NAQA 1YVUA 1FERA 3R9PA 1PG5B 3M2RB 1VBXA 2V4JB 2HQIA 2F9DA 1GLDG 3MTJA 4WTOB 2N82B 2A2CA 2BQ3A 3SSRA 4GW6A 2IJNA 2E1RA 3SMSA 2AT1B 1G7CB 1S1XA 4DSEA 1BG3A 4KGKA 2M4MA 1TYQB 2QGFB 2GVDB 5M2UA 2J0QD 4ECUA 2MDAA 5DG7A 8AT1B 3GU0A 1RDBA 3HHLC 3PG9A 1HNWJ 3VAKA 1CVJA 3WQUA 1GMWD 2R3VA 4WKRA 4R5PA 2EFOA 1DZ5A 3LAKA 4BRFA 3MEEA 2IM2A 2FLNA 5E3AA 4YMEA 3CIZA 4TQRA 2LVWA 2ILZA 1H2TZ 1WC1A 2KT3A 2DR8A 1SH0A 2BRKA 2QWMA 3HSCA 6FDRA 3W9HA 4I9QA 3NGSA 5GAGI 3LTOA 4EO8A 2R7YA 1ZTTA 2GVZA 1SC4B 3EUNA 3E9PA 1HNIB 3BJYA 3BF3A 4CJEA 3MXIA 3WC0A 1CS4B 4M3UA 4QIVA 1F2GA 1U49A 2B6AA 4H4KC 1A5VA 2DY1A 4OX6A 3T19A 1GX6A 2IYIA 1RBOB 1U2VB 1FA0A 4USTA 3OY9A 5C12A 2JGUA 5FD1A 1Q8BA 4MMOA 3KJNB 1TKXB 5AZJA 2WW8A 1RTIA 3ETOA 3O9SA 2YPYA 2P9PA 1R59O 1NCLA 2GJ2A 1P1LA 1TL5A 4RNNA 2E9ZA 4FJLA 1RA7A 3KKRA 4IZ9A 3WX4A 4U9RA 5H9FJ 4E7KA 1M5KC 1SL1A 4UQTA 4BDZA 3QNOA 2P9LB 1FNOA 2PE8A 3QESA 3IAYA 5IC4B 3PY8A 3I8DA 2QZ8A 3GYXB 4ZA1A 4NLVA 5KG6A 2Z2ZA 2LQJA 5AZIB 5ETRA 3H4BA 3QBXA 1SZ2A 4P2FA 2FIUA 4LIWA 2JL9A 1FK9B 4LF7J 4KO0B 3OD2A 1TR0A 3MXJA 4UW2A 3OXFA 3ULEB 4KI4A 2ZD1B 4RKUC 1FVSA 2MQNA 4ES2A 4JHDA 3CD6N 4BC2A 4ICLB 4U8VA 4FS2A 1JJ4A 1S57A 2GVDA 3V81B 2JDJA 3PDNA 2QA1A 5ADXA 1B70B 3QYYA 3LGHA 1NUEA 2WOMA 1SIWB 3RR8A 2PT0A 3CCRN 3DLKA 2HRTA 3N6LA 1CZ9A 3QZ8A 1S72S 5HMYA 4XIUA 1S7HA 4PG5A 4IEIA 4JKEA 2R2TA 1PJ7A 2KU7A 1JL1A 4BRHA 5CYQA 3IS9A 4Z0UA 4K5RA 2OSRA 1RHQB 4EGLA 2G0IA 3ZEUA 4RW7A 3WXMB 4J9QA 3GILA 3LW5C 1Y5NB 1RAHB 2Q1NA 1OY8A 2IBOA 4NLPA 2H1YA 3T1HK 5KG1A 2ILYA 4TKTA 2GMLA 1YF5L 1DTQA 3Q22A 2VUGA 1TUUA 2FGCA 1OH6A 1F3FA 1NGEA 2H51B 1UKUA 2K7JA 4AF1A 1FXRA 2MQMA 4OI2A 2ADBA 4CJ7A 4CF9A 1T11A 3MM9A 2HQFA 5M2PA 3R9LA 4H0OA 2VF3A 2RDIA 4WJBA 1EP4A 2B8PA 1M1HA 4DV5J 4M5GA 4C98A 4ECVA 3D0GE 4ZN1A 5F8GA 2C3YA 1GNKA 4C0OC 3BGRB 1KAYA 1KAZA 1YKWA 1FKAF 4DSIA 5KAKA 1D8ZA 2PEHA 3I9ZA 1X9JA 4UY8T 3G9CA 3T6JA 1CJTA 1NPKA 4CF2A 1OO0B 2CPEA 2R7SA 4XTTA 1VOMA 1QZ5A 1T9UA 2EC2A 2PEBA 1Y97A 2ZZNA 3QWPA 4PA1A 2ADCA 5U47A 4AL5A 4OLOA 1KHVA 5B0GA 3THWB 2BDPA 4IOAL 2V2QA 2XZTB 4JI4F 4CJTA 3QO9B 3H59A 2BKNA 3ICLA 4F04B 2BH1A 5MLCV 3HSGA 4MQ3A 1EKRA 3A3PB 5DQGA 3EY1A 4R0JA 3J8AA 1C1AA 2D3ZA 5L1JA 3QGHA 4JKGA 3ILIA 3G6YA 4CHPA 2EC0A 2JVRA 1XC9A 2W2MP 2WK4A 3FMBA 3POTA 4K4YA 1LQ9A 4RUCA 1HHQA 2M7SA 1N56A 3Q7BA 4DR7F 1HX1A 4ZVOB 3AH6A 3M9NB 5KG7A 1RTJB 2AKWB 3ZT2A 4A8KA 4FLTA 4B3OB 5CABA 4B9SA 2LEAA 1FKPA 2W1BA 5AQUA 1YVFA 3KUEA 4DU3A 2WOMB 2YHYA 2LQ5A 5I3PA 3AY9A 4KE5A 2RS2A 4MLEA 1QQNA 1YJ9N 2M52A 5BREA 2A3JA 3K57A 5DM6L 1HKCA 4O3NA 4JK7A 3FDSA 5G0RA 2GIFA 3QFWA 3UDEA 1NGHA 1TUYA 2R7UA 1N5SA 3DDIA 3FKBA 3VALA 4JYAF 1X9SA 4PABA 2XZWA 1NKCA 2MXYA 2DB1A 3W5ZA 4LF5K 2FC9A 3SIPB 3HZGA 2QC3A 2HZCA 2QT7A 2A6OA 1WSHA 2P51A 4C9DA 3CW2C 2FB0A 3IBWA 3ALYA 3LDNA 2HVIA 2ZKUA 1U1NA 1SCJB 3GFXA 4DN9A 1AT1B 2ROGA 4HT5A 2KHOA 3CDWA 3SMPA 4H4OA 1ZYQA 4CFCA 4R5PB 2NZCA 3VQ5A 2UUBJ 2BACA 2M0GB 4AM6A 4P71A 4PPDA 4B3MK 4Y2IA 3D0PA 4OYWA 1RT5A 4M5DA 1MWMA 2K06A 1V9OA 2O8CB 1OH8A 5K8PA 2RD5C 1HIYA 4H0PA 3KJQB 1HKGA 2XMVA 3MTKA 4OGEA 3G8QA 2ALZA 4H5RA 5D4OA 3RMDA 5T7BA 2E5GA 4KO0A 3DGPB 3BZQA 1TFWA 2UXDF 5LJ3Y 4JD2A 1IO2A 4M1KA 3CPWM 1SJRA 2G2OA 3BS9A 5IQQA 1WNEA 1RT3B 3QWUA 4U67Q 1ESVA 2P5OA 5A8WB 3LPYA 1IBLK 3QFHA 4IJAA 1KR4A 3TR8A 4JOUA 5HVHA 1JLGA 3FQLA 5BYSA 3H90A 3ELHA 5E3QA 3GDQA 1TL3B 4B1UB 3BF4A 4DV1F 3CD5A 3IDHA 4EIAA 1AW0A 4KREA 4J90A 4OIXA 3MR2A 2MKJA 4B3RJ 4YDUA 4E19A 2CA9A 3FBEA 2D9OA 1VRTB 3R27A 3WXJA 2ZE2B 2MKIA 4JI6K 1YBTA 4K4WA 1S6PB 3Q24A 3DMJA 2LEBA 5AQQA 2DY9A 3BO3A 4JV5J 5C24A 4KHNA 3UCGA 4USMA 2DGSA 3PW7A 2ATLA 3M8QA 4O44B 4X62F 3AO3A 2LECA 1X4EA 1S99A 5LSOA 1NGBA 3I56S 1CG2A 4K8RA 3D2WA 3PV8A 2Q3SA 1JMTA 3FLCO 3LZIA 2R4FA 4L73A 3CJAA 3CPEA 1Y7PA 1DGKN 4E0DA 3UW1A 4KHYA 1TKTB 4BWJA 4F36A 3O9RA 1NJZA 4CLKA 2J0XA 1RTIB 3DGVA 1K8AO 4CZIA 3DM2B 2KHDA 3RZAA 1QSYA 4DX7A 1UFKA 3M3ZA 3J7ZO 3CMAS 3OS2A 2V7ZA 1BLUA 4DQQA 1QTMA 4LSLA 4FLVA 3C15B 3JTOA 3T9ZA 1SQKA 1G15A 3ISZA 4FWPA 3LQVA 3OR2B 4CERA 3P1GA 1I3OB 2IDLA 3D1OA 4H03B 5HBMA 4K41A 2RF2A 1T9VA 5KG0A 5AE3A 1S1TB 1HARA 4C8KA 1RBSA 3UKRA 3AD8C 4NLSA 3KLIB 2YKAA 1C0TA 1N33J 4Y28C 1DAXA 3K8WA 3M32A 3DXMA 2BBEA 2RRBA 1Y5LB 3CSKA 2P9SA 1AZSA 1JLQB 2QG9B 1S1UB 1LOUA 2LXIA 3N5FA 5C7PA 3I32A 3KKFA 4GVLA 5BYQA 5AT1B 3JSRA 3EKUA 3KK2A 3TAPA 5LXRA 4KGVB 2Y0SD 4ED6A 5E41A 3PX0A 1MWQA 1TQLA 2V51B 2UUAK 4CBUA 1KTVA 3M6WA 1N54B 4BC9A 3PRBA 5ETVA 1MMNA 2VWKA 5KFTA 3FMWA 1Q95G 2NSBA 4Q43A 2EVZA 4OYPA 2IFXA 4JLHA 3MAAB 4HI2A 2KKZA 2HK3A 1Z2LA 3PKMA 5J2NB 3D54A 4QIEA 4H5TA 1HQEB 4BWMA 1NB7A 3L09A 2C28A 3UQSA 5GAHU 4CEQA 2G9OA 3EICA 1KEKA 4RBUA 4KJIA 4QCLA 4USKA 2B8QA 2BM1A 2XLJA 2OEMA 5EOYA 4YOXA 1KLMB 3NS7B 4CIEA 1DARA 3MM5B 4ZS6A 1DTTA 3EGZA 4BREA 2OMLA 4K50A 1LWCB 3QERA 3BP8A 3VWSA 1U1RA 1VHXA 2RHKA 3M32B 4BR9A 3NF6A 1K1QA 1HD0A 1YT3A 4NXNK 2UXBJ 3U6FA 3PCOB 5DGBA 5DG8A 3VETA 3RTVA 2F5GA 2DHXA 1UWBA 4Z4CA 2QFJA 2Q31A 4FJ9A 4RPFA 1I3AA 2PMZD 1S4FA 5EX5A 4BGAA 4XPCA 2B5JA 2J7KA 4K42A