2G8IA

B. halodurans rnase h catalytic domain d192n mutant in complex with mn2+ and rna/dna hybrid (non-p nick at the active site)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
134
structure length
134
Chain Sequence
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKANYGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*UP*CP*GP*AP*CP*A)-3'
publication title Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
total genus 39
structure length 134
sequence length 134
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2g8iA00
3LP2A 3SQ0A 2HVHA 2Z1JA 1NK6A 4IG0A 3L2RA 2RKIA 4CHZA 1QSLA 3AVIA 4KHNA 1MU2A 2D0AA 3M8RA 1RDCA 3CM6A 5I3UA 4CF2A 2EX3A 2D0CA 1ASWA 4FCYA 1HQEA 2IS3A 1VSLA 4CGGA 4CIFA 4CEEA 1D9DA 4O55A 1FKOA 1KTQA 3RMAA 3IG1A 2P51A 3VQ6A 1TVRA 1NK4A 4CF1A 1JLFA 4CJFA 3TAQA 2XY6A 4Z4EA 2HHSA 1Q8IA 2YHBA 4HVJA 5KGXA 4HUEA 3JSMA 3HO1A 1JLCA 1F21A 2E4LA 4NCAA 4PQUA 1B92A 3G10A 1R0AA 3CFPA 4N56A 2X6SA 2BDPA 1BI4A 3I8DA 5HLFA 2GUIA 2X74A 1EXQA 2HMIA 1NJXA 4C8LA 4DS4A 2HVIA 2HHTA 3KLHA 2ETJA 1S6PA 4RW6A 3NF6A 3QEIA 1WAJA 3DM2A 1T05A 1X1PA 4FM1A 3DLBA 4FJ7A 1C0MA 4OVLA 4F3TA 1N5YA 1J54A 2X78A 5J2PA 4FK2A 4H4MA 4B08A 4CGJA 5FRMA 3I0RA 4CJWA 1Q9XA 3L8BA 4CJQA 1KLMA 4KHWA 4W5RA 1CLQA 5I42A 3S3MA 3PX6A 2ATQA 3WNEA 3PX4A 1LW0A 3A2FA 1RBUA 3ZSWA 3ZSVA 2KFNA 2XY7A 4FZZA 3S3OA 2FBVA 3KD1E 3EYZA 1NJWA 2HHXA 2WOMA 3DLKA 1G15A 1D5AA 3VQ9A 4FK0A 3QINA 1JLBA 1IKVA 5HRRA 1RBSA 1HMVA 1SKWA 3NE6A 2A1SA 5EU7A 4Z0UA 3KLFA 3JYTA 4BDZA 3QO9A 1D8YA 2E6LA 3AVJA 3MEEA 4NYNA 1EETA 1XWLA 4O4GA 2PYLA 4CK2A 5KRSA 1CXUA 1BL3A 3KD5E 5HRNA 3KK1A 1WSIA 3AO2A 4FM2A 5HROA 1TK5A 4DU1A 3SCXA 4NCBA 3NGIA 3M8SA 4FLXA 4DQSA 1HQUA 2O4GA 4M42A 4QAGA 3KK3A 4CHNA 1JLEA 4B9MA 4DTJA 4YFUA 4KPYA 1BISA 3NH2A 1RT6A 1TAQA 4I9LA 3VQ7A 4YNQA 2ZE2A 3VQEA 3SV4A 1TV6A 2Y1JA 3O3FA 4CJUA 1XI1A 4B9LA 3LANA 4FW1A 4BACA 4AHVA 1VSMA 3AVMA 1KFDA 1JXEA 4RW8A 1RBTA 2HNYA 1RBRA 3RMDA 3HSTB 3EY1A 2EHGA 1RBVA 1KRPA 2F8TA 1C1CA 4CJPA 3NFAA 4E1NA 4BWJA 3V6DA 3VQPA 4CGIA 4N5SA 4M3UA 3V81A 4ELUA 3KLGA 1LV5A 4FZXC 1L3UA 1RDAA 3ZSYA 1S1TA 5CZ1A 1C1BA 4CF9A 1L3TA 3NHGA 2YV0X 1SUQA 3PY8A 3BDPA 3MAQA 4CGHA 4I2QA 3HP9A 4B9TA 1KLNA 1HPZA 5CZ2A 4EP5A 4DFJA 1RT7A 2FC0A 4JLHA 4DTPA 4FJIA 4DF4A 3SUOA 3WNFA 4FYDA 1VSJA 3ALYA 1ZBUA 1UWBA 1C0TA 4CJVA 4CJKA 3SUNA 2PY5A 4KTQA 4AH9A 3KK2A 3AVGA 1RT4A 1U48A 1JLQA 1S5JA 2G8UA 3VQCA 4E7IA 3AVAA 4DWIA 3OS0A 4BDPA 1LWCA 3L3VA 3ZT3A 3WNHA 1UA1A 1SV5A 3PX0A 2QK9A 1RT3A 1YTUA 3QEPA 1ZBLA 2YNFA 4FLWA 4QOZB 2DFEA 2YNHA 4FW2A 4DSEA 1XHXA 5HRSA 1NOZA 3HVRA 2AJQA 3HYFA 3SPYA 4OLAA 2KZMA 2QXFA 4E1MA 3LZIA 2BGGA 4CK3A 2OZSA 2IGIA 1IH7A 3TWHA 3OS2A 3VQ8A 3LAMA 4H8KA 4EZ6A 1NJZA 2VG7A 3AVLA 3ITHA 3DYAA 1S9EA 4CHPA 3NH0A 1RDDA 2YNGA 2DTUA 4B9SA 1YTAA 3SUPA 1JKHA 4CF8A 1RTDA 1HNIA 2JGUA 1U47A 4TSXA 4Y1DA 1VK0A 3OYAA 1RT2A 4FJLA 3IRXA 4FJ5A 2HHWA 4BE2A 2P1JA 4GW6A 5J2QA 4F4KA 4AILC 3T3FA 1VRUA 4HTUA 4LSNA 2P5OA 2OPPA 3AV9A 4ID5A 4CESA 3TAFA 2ZD1A 3PUFA 4IBNA 3RR7A 2Q3SA 1YVUA 1SKSA 4KO0A 3DOKA 3HP6A 4KB1A 1EKEA 1VSHA 3TAGA 3RRGA 4CFAA 4CHYA 4NYFA 3QNOA 2VWKA 3OVNA 1NKBA 3F9KA 3OYFA 3NH1A 2FBTA 4M3RA 4CFCA 3OYBA 3V1QA 4DSKA 4G1QA 3QEXA 4B9VA 2F8SA 1D9FA 4PWDA 3C6TA 3VQBA 4CFDA 4Z4HA 5T7BA 1W9HA 2YNIA 1T7PA 2OZMA 1JLAA 4ICLA 1T8EA 3QEVA 4IFVA 1WAFA 4DSJA 4M3ZA 5D3GA 2IAJA 1TKXA 1WSHA 1BCOA 3OYHA 3OYIA 1U49A 2XHBA 1JLGA 3MEGA 5HBMA 2QKBA 3HJFA 3G0ZA 3V1OA 4CJTA 2XY5A 4DSFA 3SI6A 4B3OA 2B4JA 3M8PA 3ULDA 4PUOA 2RF2A 4O0JA 2F96A 1TKZA 4RG8A 3DRPA 1S1WA 3LP3A 4E89A 1Z25A 2OA8A 1X9SA 1J9AA 2I5JA 1FK9A 3AO3A 4HUFA 2Y1IA 2XRIA 4CEBA 3DLGA 1KVCA 1GOBA 5E41A 4AHUA 1IKXA 3TABA 1KFSA 3KJVA 4LH5A 1NK0A 4OKKA 4CJ5A 4KTZA 3L2QA 1JXBA 2G8HA 3HL8A 4ZHRA 1I39A 2NUBA 4DG1A 3LDSA 2KZZA 3LALA 1NKCA 1B9FA 4Z4FA 3KKSA 3OY9A 1J5OA 3OYMA 2G8IA 4CEOA 4E0DA 4KAZA 1KSPA 3SQ2A 4DTOA 2HNZA 4WE1A 4CERA 3S9HA 1B9DA 3LAKA 1RNHA 4RW9A 4FLTA 1NK5A 4EP4A 4CCHA 3RR8A 4HCCA 3VQ5A 3WNGA 1FKPA 4DFKA 3NF9A 3ZT2A 5SZTA 1TGOA 3ZSZA 4FLVA 3K5OA 4NCGA 1LWFA 5J1EA 3OYGA 3PO4A 2KTQA 3DRRA 2QKKA 4E19A 4F8RA 5FRNA 2HHQA 4KV8A 3O4QA 1EP4A 2PZSA 2HHUA 3DMJA 2GV9A 1BQNA 2OPSA 3U3YA 1QSYA 3C95A 1DTTA 5KI6A 1WSJA 5SWMA 4LY7A 3VA0A 2BANA 3D45A 3AVKA 3TAEA 1J53A 4Q0BA 1IO2A 3DOLA 4DTSA 4JRQA 4E7LA 3MXIA 3CYMA 3NBPA 1TL1A 1SL0A 2KW4A 2LSNA 4HHTA 1NK7A 4F2RA 4Z4IA 3SZ2A 4K8ZA 3CFOA 3DI6A 4CJEA 3LPTA 3OJSA 1GOCA 3K59A 4DFMA 1JL1A 2FBXA 3RRHA 4OGCA 1FXXA 3LP1A 3MEDA 4AHRA 2B6AA 4AHTA 1U04A 3OS1A 4CJSA 2DFFA 1NOYA 4ID1A 3DLHA 1HYSA 5DK5A 3RMBA 2WONA 3P5JA 3VQAA 2JLEA 4W5TA 1RCHA 4DTXA 3LPUA 3MXMA 3QNNA 3S3NA 4J2BA 1RT1A 4CEAA 4ELVA 4FJMA 2HHVA 4OJRA 4W5OA 3NAEA 4B9NA 4DMNA 1VSDA 3DLEA 4R5PA 3B6OA 2ITGA 4UQGA 1QTMA 3OYNA 1U4BA 3TANA 1T03A 4FLUA 1RILA 1TK0A 3VQ4A 4KB0A 1K6YA 3LWMA 1Y97A 4E7HA 1S1XA 4IFYA 4CHOA 1Z26A 1ZYQA 5KRTA 3AO5A 3QIPA 4CEQA 4OKEA 1WNSA 3NF7A 3V9WA 4JS5A 1ZBFA 1XC9A 1TK8A 1BQMA 4C8NA 4CIEA 4ELTA 3LP0A 5DMRA 3CFRA 3TI0A 1RT5A 5K14A 3VN5A 4KKOA 3SV3A 3SJJA 1TL3A 2G8WA 1QSSA 2O4IA 4CJRA 2IOCA 3OYEA 2PYJA 1ZBIA 1KVAA 3AVHA 4BWMA 4DU3A 2GBZA 3ZT1A 3ZSXA 3VQDA 2YKMA 3HPGA 4QCLA 4CK1A 3EZ5A 1BI4B 4DTMA 2G8FA 4M41A 2KQ2A 4DFPA 3OYLA 5CY4A 3V9SA 3SUQA 3V9UA 5KGWA 3T1AA 3V1RA 4JRPA 2YKNA 1EX4A 4KFBA 1WLJA 4IG3A 1WSFA 3TAPA 4FK4A 1DLOA 4DU4A 3IAYA 4C8MA 1BHLA 1HYVA 4FLZA 3NDKA 4ZTJA 1TKDA 3ASMA 3I0SA 3V9XA 3VQQA 3KIOA 4XIUA 2R7YA 4DTRA 1IKYA 3QETA 3RWUA 4KI6A 4K8XA 2IDOA 3OYDA 3NF8A 3V9ZA 3SYZA 5HP1A 5FROA 1WN7A 3AO4A 1REVA 3H08A 1S1UA 3KLIA 2OPQA 3HPOA 1WSGA 1C6VA 3SQ4A 1IKWA 2RN2A 4AHCA 3U3GA 2BE2A 3AA2A 4CEFA 1QS4A 1L3VA 2W42A 4CEDA 5FDLA 4O5BA 5HRPA 2DY4A 4F3OA 4CIGA 4HCBA 1L3SA 4CFBA 3P83D 4B9UA 3OYKA 3LZJA 4M45A 3IS9A 2D0BA 4N41A 1CXQA 4DF8A 4FJJA 3ZSQA 4FXDA 1Q9YA 1I3AA 1TAUA 1VRTA 2RPIA 3HPHA 3TAMA 4FM0A 5KTQA 1SL2A 4FJNA 5JS1A 3L3UA 1UAXA 4W5QA 3ZT0A 1O1WA 4GVMA 3SPZA 4HUGA 4DSLA 2B5JA 3KKRA 3T19A 1S6QA 1VSEA 4CJLA 3HVTA 3OYCA 2HNDA 2XO7A 4DQQA 1N6QA 3VA3A 3UIQA 3B6PA 3L2UA 3ZCMA 3RMCA 4M3WA 4Z4GA 1HRHA 1QHTA 4CGDA 3O3GA 2D5RA 1KCFA 2OYQA 1SL1A 2XY8A 4KHQA 1LAWA 4ZTFA 3PO5A 5JS2A 3NCIA 2HW3A 1W0HA 2VG6A 4OGEA 3FFIA 4N47A 1UA0A 3KTQA 3D0PA 4M3YA 3CM5A 4OPJA 4C8OA 1XHZA 4BE1A 1NJYA 1DTQA 3MECA 2Z1IA 1X9MA 4J2DA 3AA5X 3ZSOA 4C8KA 4MFBA 4DQPA 3F73A 2VG5A 4FJGA 3TARA 1HYZA 1BGXT 2FBYA 4O0IA 5J2NA 3QIOA 4RW7A 5CYQA 1ITGA 4CE9A 4E3SA 4FJ8A 4PY5A 4L8RB 1ZBHA 3DLRA 1CZ9A 3U6FA 1A5WA 4I7FA 4LSLA 3SNNA 3NGZA 3HT3A 1IG9A 1CZBA 3K5MA 3QERA 3AVNA 1HNVA 2OPRA 3NGYA 3ZSRA 4DLGA 3DRSA 1VSFA 1VSKA 4O44A 2DFHA 1LAVA 2KFZA 4KHYA 2IC3A 4CJ3A 3THVA 4FJKA 4OLBA 4OPKA 2YHAA 3TR8A 5J2MA 1C0UA 1HJRA 3KLEA 4CGFA 4KHUA 4CF0A 3L2VA 3V4IA 1NKEA 4E7JA 1JL2A 3C6UA 1LW2A 2G8VA 4GMJB 4AHSA 4KTWA 4Q5VA 4BE0A 3K5NA 4JS4A 1KVBA 3BGRA 4KI4A 1S9GA 4F2SA 1ASUA 1BCMA 2X6NA 3K2PA 3K57A 3LWLA 1TKTA 4CECA 4DLEA 4DSIA 1RDBA 4H4OA 2Z1GA 1BIUA 3O3HA 4EZ9A 4DQIA 4BDYA 1S1VA 4J2EA 4Z4CA 1GOAA 3QEWA 1VSIA 4B8CA 4CJ4A 3M8QA 4E7KA 4N76A 1YT3A 5C24A 3O4NA 3K58A 2G8KA 4W5NA 3ZT4A 3AVBA 4KREA 4I9QA 4Y1CA 3CG7A 4FLYA 5CYMA 3RTVA 3HM9A 1NK8A 1SKRA 4DTUA 4MQ3A 3L2WA 3HXMA 2A1RA 4M3TA 2VWJA 1QE1A 4DS5A 4CEZA 3MXJA 3QLHA 2E6MA 4RW4A 3OYJA 4DTNA 4PA1A 3QESA 3HK2A 3AVCA 1RTHA 1LWEA 4FZYA 4LH4A 3CQ8A 4IKFA 4KRFA 4DQRA 3AO1A 3PV8A 1BIZA 1L5UA 2ZQBA 4OKJA 1A5XA 4IDKA 1ASVA 3E01A 4B8AB 3OJUA 1WSEA 2HB5A 4KHSA 3ISNC 2Z1HA 3P1GA 1X9WA 1C1AA 1UOCA 5C42A 1NK9A 3AA3A 1RTJA 3AA4A 1U45A 1QQCA 1RTIA 3AVFA 4FVMA 4I2PA 3K5LA 3C94A 4FJ9A 4FJXA 4J2AA 4CHQA 5C25A 4FJHA 4M3XA 3SQ1A 4LD0A 2P5GA 1A5VA
chains in the Genus database with same CATH superfamily
3LP2A 2Z1JA 4XH1A 4BG8A 1NK6A 4IG0A 4KHNA 2RKIA 3MCAB 2D0AA 3ATVA 3CM6A 2EX3A 3WUHA 1NG9A 2D0CA 1ASWA 4FWSA 3O9RA 2IS3A 4CIFA 4CEEA 2A6AA 5BREA 3WXMB 1YI2N 4FWKA 4BVOA 4CJFA 4Z4EA 1XUPO 5CE3A 4HVJA 4JI0K 3HO1A 1JLCA 3T1YK 1ILYA 1B92A 1NLVA 5AQNA 2HVIA 4C8LA 3CC2N 3ID8A 3QEIA 4FWPA 3VPZA 1VQON 1C0MA 1VQKN 4YOXA 2X78A 1IJJA 5J2PA 4FK2A 4CZIA 4CJWA 1Q9XA 3VETA 3Q7BA 4KHWA 3A2FA 4CZFA 3ULEA 1U2VB 4NO7A 4DUZK 4JKGB 3S3OA 3ZLJA 3I33A 3KD1E 1FW6A 2HHXA 1NBWA 2WOMA 2OANA 1D5AA 1G15A 3L4QA 2ASPA 4M7XA 1M90O 4WQ4C 3T69A 2J4RA 3FE1A 5LJVA 3CETA 4BDZA 1D8YA 2E6LA 4FVUA 3MEEA 3LDOA 4BRCA 3EKUA 2ZJRL 3SCXA 2ASOA 2NRRA 4FLXA 4M42A 4QAGA 1QQOA 5B8HA 4IO8A 4YORA 1MA9B 4DTJA 4KPYA 1W2BM 3VF2A 4YDUA 3E1YA 3VQ7A 4I9LA 2UXBK 4YNQA 3VQEA 3VEYA 1TV6A 4CJUA 3LANA 2V7ZA 3EZWA 1MWMA 4RW8A 4ILGB 2EHGA 1KRPA 1C1CA 3VQPA 4CGIA 3V81A 4ELUA 2P9NB 1LOTB 4CF9A 4GVEA 1HLUA 1QVFM 3MAQA 1IBLK 3SBGA 5BPNA 1KLNA 2FC0A 3PSIA 4JNEA 2FF6A 3QB0A 3ALYA 1ZBUA 1C0TA 3JS6A 4AH9A 3KK2A 1RT4A 2W40A 1S5JA 3CCQN 4E7IA 3AVAA 1UA1A 1SV5A 4B1ZA 2VGNA 3VGKA 3QEPA 1JCFA 4FLWA 3KVGA 1XMQK 4FW2A 1XHXA 1NOZA 3J7YP 4LC9B 2WBNA 4CK3A 3ZX3A 3VQ8A 3LAMA 2FSKA 3ITHA 3TTFA 1YUWA 1S9EA 3DYAA 5AQOA 2DTUA 3SAFA 1VK0A 4FJLA 4FJ5A 5ADXA 2FXUA 4GKKK 3L0QA 5J2QA 2HHHK 5M1NA 4F4KA 4AILC 1VRUA 4HTUA 4LSNA 3JAMO 4JD2B 2OPPA 3AV9A 3O1BA 4CESA 2QWMA 3PUFA 2WUSA 1YVUA 4KB1A 3DOKA 3HP6A 1EKEA 4CHYA 2ZGZA 5KQDA 3QNOA 2O8EB 3OVNA 3OYFA 3N4QA 2FBTA 1NGAA 5AQQA 3V1QA 3QEXA 4PWDA 4Y0WA 1KQSM 3J7ZO 2GELA 3VQBA 4CFDA 2HMPA 4WFNL 3VEOA 3W3DA 4FSVA 2IAJA 1JLGA 2QWQA 3G0ZA 3WXJA 4CJTA 4DSFA 2O8FB 4B1WB 5M1QA 1U6ZA 3ZX2A 2VCPA 4BRDA 3NVMA 2XRIA 1KVCA 2E1ZA 4AHUA 4LH5A 4NXMK 4OKKA 3L2QA 2NRWA 1GLDG 3UKRB 3LDSA 4Z4FA 1RDWX 1MWKA 1T44A 3OY9A 2G8IA 4BRMA 2UUBK 1NGDA 4GNIA 1EO1A 1YJ9N 4FLTA 1NK5A 3IKMA 3VQ5A 3WNGA 1FKPA 3NF9A 1TGOA 4FLVA 2VQEK 3WEEB 2KTQA 3O6WA 4AM6A 4KV8A 3O4QA 2Q0RA 2HHUA 3DMJA 1BQNA 1DTTA 3UKUB 2E88A 4LY7A 2BANA 3D45A 2F4VK 2NNWA 4LF4K 3DOLA 3BY5A 4DTSA 1JCGA 1SL0A 1BUPA 2KW4A 4HHTA 4Z4IA 5E26A 3CFOA 3OJSA 3K59A 3DXKA 2BTFA 4DFMA 4LFBK 3RRHA 4OGCA 3ZX0A 3LP1A 3MEDA 4PQUA 3CJCA 4WYBA 2ZWHA 2DFFA 4IWVA 4ID1A 4XH5A 5DK5A 4DHYA 1VQPN 2HHQA 1RT1A 4CEAA 3NAEA 4DMNA 3CMAN 1VSDA 1QTMA 4UQGA 3TANA 1V4TA 3VQ4A 4KB0A 1Y97A 2P9SB 4E7HA 1S1XA 4IFYA 3QIPA 1WNSA 1TK8A 4C8NA 4CIEA 4QS8A 3VTIA 1RT5A 3SV3A 4CZJA 2O4IA 2IOCA 2KHOA 1DEJA 3OYEA 1J5EK 1KVAA 3T7ZA 4DR1K 2AA4A 1NU0A 4DTMA 4FOEA 1EX4A 4KFBA 1VHXA 5HL7L 2YHXA 2UYTA 3IAYA 1BHLA 4ISEA 3M1FA 4XIUA 1IKYA 3CCRN 3OYDA 3V9ZA 5HP1A 1WOQA 3KWGA 1REVA 3H08A 2OPQA 2W6LA 2IVOA 1C6VA 4AHCA 5C2DA 3VEVA 2W42A 4YHHK 4O5BA 5HRPA 3P83D 3HOTA 3QDKA 2D0BA 1D4XA 4HTLA 3OBWA 2FLOA 1ESVA 1Z6RA 3CI5A 4GVMA 4HUGA 2B5JA 4IEEA 3IUCA 1S6QA 5JICA 2HNDA 2XO7A 3L2UA 3VMFB 4CGDA 3O3GA 2D5RA 2OYQA 2XY8A 3BUZB 4WFAL 5JS2A 3VF4A 1NM1A 1W0HA 4JYAK 4JI5K 4OX9K 1XHZA 2A3ZA 3CJ1A 1YJWN 4J2DA 4K41A 4DQPA 3F73A 2VG5A 1C0GA 1BGXT 4RW7A 5CYQA 4CE9A 5IT9O 4E3SA 3DLRA 4BC4A 3TSQA 1SQKA 4I7FA 4LSLA 1IG9A 3QERA 3NGYA 3DRSA 1VSKA 4JKFA 2ZJPL 4CZMA 4OPKA 4BC5A 1GLAG 4CF0A 4CJ7A 4FWQA 4BE0A 1KVBA 2HBLA 3BGRA 2D0OA 4KI4A 4CZLA 3LWLA 1W7AA 4U7BA 5BRFA 1BIUA 1HJOA 1GOAA 3QEWA 1VSIA 4CJ4A 3W0LA 2G8KA 5AQJA 4W5NA 4DV4K 4Y1CA 3GG4A 5CYMA 3RTVA 4M3TA 1QE1A 5AQFA 4CEZA 3MXJA 1VQ5N 5M1OA 4PA1A 3AVCA 1RTHA 1LWEA 4B3SK 4YY3K 4LF7K 4KRFA 1WUAA 4DQRA 3P39A 5F1XA 1BIZA 4DKWA 4WFBL 3O9UA 3MN6A 3P1GA 3HI0A 1NK9A 1UOCA 1U45A 4FVMA 4FJ9A 4FJXA 4CHQA 3OA9A 4BR9A 3SQ0A 3D2FB 3K9KA 4H5NA 3UE5A 1MU2A 4B1YB 3A5OC 4JI3K 2DPNA 3PSFA 4YOTA 4FCYA 4UY8O 1VSLA 5H1SQ 1D9DA 3TTCA 4M7YA 3VOVA 3VQ6A 1TVRA 4PHTX 4CF1A 3TAQA 2XY6A 1Q8IA 3WQTA 1F21A 2E4LA 1SS6A 3FZMA 3CFPA 4N56A 4DV7K 3I8DA 5HLFA 1NGGA 4DS4A 3NF6A 1T05A 1WAJA 3I55N 3BF1A 4FJ7A 5FPDA 4EIAA 5FRMA 4LFCK 3I0RA 4CZGA 3SAGA 4CJQA 5EY4A 3JXUA 1CLQA 5I42A 3QBWA 3S3MA 4JI1K 2ATQA 3PX6A 1LW0A 4AF1A 4AQYK 3ZSVA 2KFNA 2XY7A 3D2EB 2FBVA 3EYZA 2QXLA 3CC7N 4FK0A 3QINA 1IKVA 5HRRA 1RBSA 1SKWA 3NE6A 3HM8A 5EU7A 3SK3A 2PBDA 3KLFA 3JYTA 3G71N 1EETA 4O4GA 5KRSA 3TSUA 5HROA 3AO2A 4B3RK 2YX6A 3NGIA 2O4GA 3U9ZA 3KK3A 4CHNA 4BQZA 1NGIA 1T6DA 3FLCO 3SV4A 2Y1JA 3A8YA 3O3FA 1XI1A 4GV3A 3R1XA 1VSMA 5C15A 1KFDA 3C7NA 1JXEA 2HNYA 3HSTB 3NFAA 4E1NA 4H5TA 3WT0A 4M3UA 3CCEN 4FZXC 1L3UA 1RDAA 4ISGA 3KK7A 3PY8A 4CGHA 3C6AA 3K9JA 5CZ2A 4CBWA 1RT7A 4DF4A 3SUOA 4FYDA 3SUNA 1UWBA 4CJKA 4BQLA 5AQSA 3U8XA 2G8UA 1U48A 3PLAA 3FFKB 1LWCA 1S3XA 2W41A 3ZT3A 2WC9A 3PX0A 2P9IA 1GLBG 2DFEA 3HVRA 2AJQA 1HPMA 4KH6A 2HOEA 1LCUA 3VEZA 2ZM6K 2YI1A 2D0PA 5GAEP 4DCHA 2JWLA 5GADP 2IGIA 3CD6N 4A2AA 3OS2A 1NJZA 2VG7A 5JVGL 3OW2M 5AR0A 1RDDA 3NH0A 1YTAA 1RTDA 2JGUA 3E9LA 1Q86O 1K8AO 2IVNA 1RT2A 4IJAA 1FJGK 4JHDB 2ZJQL 1BDGA 1QQNA 5C2FA 4JI8K 5KPTA 4ID5A 3SAHA 3CMEN 2ZD1A 3EKSA 4IBNA 3MN5A 4FWNA 4K0KK 3VESA 3G25A 4O5FA 5AQPA 4XEIA 1NKBA 4X66K 3QMLA 4M3RA 4KHPK 3A5LC 4IZ9A 4B9VA 4Z4HA 1W9HA 2YNIA 1T7PA 4DR6K 1WAFA 5AQYA 2NRHA 3OYHA 3ZYYX 3N4PA 4BRQA 1KAZA 4DV3K 3EE9A 3SI6A 2B4JA 5TKWA 3FGUA 1QHAA 4IEIA 4RG8A 2QWNA 1IV0A 2OA8A 2I5JA 3CJBA 2HVHA 5AQRA 4MO4A 5E41A 3KJVA 5AFUA 2G8HA 1Q81O 3HL8A 4JHDA 1RDUA 4ZHRA 1OH8A 3VGMA 1ZBSA 2UUCK 4KAZA 2P9UB 4DTOA 2UUAK 5JMVA 1B9DA 4RW9A 4EP4A 5AQWA 4BROA 4JK8A 2O8BB 4DFKA 3C65A 4BRPA 3H1QA 4NCGA 1LWFA 1SZ2A 3R8EA 5J1EA 3OYGA 4BRAA 5DM6L 3L6QA 2QKKA 3OHRA 4F8RA 2BUPA 2PZSA 1NWKA 4XH4A 2OPSA 3G6EN 4YOYA 4BGAA 4DR4K 1WSJA 3VA0A 1U2VA 4Q0BA 3THWB 3A5MC 4JKGA 1ATSA 3K0SA 1TL1A 2NRTA 4K8ZA 4CJEA 3LPTA 1GOCA 4BG9A 1N8RO 3RMDA 3TSPA 4AHRA 2B6AA 2QI2A 4CJSA 4F9OA 5GAHP 3P5JA 3RMBA 2JLEA 3MXMA 1OH5A 3QNNA 3S3NA 4ELVA 4NLBA 2HHVA 4H0OA 4BR2A 1E4FT 4KBOA 1U4BA 1T03A 3EO3A 3IMXA 3H1VX 3LWMA 2E2NA 4CHOA 3ZETB 5C0YA 4OKEA 3NF7A 1BQMA 3M5RA 3O08A 4FWRA 3TI0A 3O1WA 2G8WA 1TL3A 1NGEA 4CJRA 2QWOA 3DLLL 2QM1A 1ZBIA 3AVHA 4DV0K 4DU3A 3ZSXA 3VQDA 3OBYA 3A0IX 3CCJN 1BI4B 3PIOL 1YITN 5CY4A 3BEXA 3V1RA 1P90A 2YKNA 4JRPA 2P9NA 4IG3A 1VQ6N 3TAPA 1SAZA 5MLCQ 2WTUA 1VQ9N 3I0SA 3VQQA 4K8XA 4OO1J 3G4SN 4MLHA 1KXPA 2PAVA 3AO4A 3E9OA 3SMSA 3KLIA 3HOSA 3HPOA 3LDQA 1I94K 3AA2A 5KPZA 4H5VA 1L3VA 4CEDA 4BRFA 2DY4A 4HCBA 1L3SA 4JAXA 5KQ8A 4N41A 4DF8A 4FJJA 3ZSQA 2A40A 3KHYA 4NXNK 2RPIA 4JN4A 1SL2A 3M3ZA 2CGJA 3T19A 3THYB 3OYCA 3ZCMA 2E20A 5GINA 1HRHA 1QHTA 4EFHA 4E1JA 1SL1A 4YOWA 4ZTFA 1Q18A 2HW3A 2F7TA 2VG6A 3FFIA 3GOIA 4JD2A 4B3MK 4N47A 1ATNA 4OPJA 5AZJB 4DQ8A 1EWRA 1DTQA 1YHQN 3AA5X 2O8EA 4MO5A 4MFBA 3ZEUB 3TARA 1HYZA 4L3QA 5J2NA 3QIOA 2D1KA 4FJ8A 1ZBHA 3O8MA 5F2RA 3NMUA 5AQLA 3CCUN 3MN9A 3K5MA 2Q36A 1LAVA 3I56N 3HTVA 4CJ3A 3CF5L 3THVA 2GWKA 2O8FA 1WBBA 1C0UA 3KLEA 4CBXA 3L2VA 3V4IA 1NKEA 1XNQK 1JL2A 4FPAA 4JI7K 3C6UA 3CC4N 2G8VA 5AQZA 5A2QO 4BC3A 1YXQA 4WQ5C 3SMPA 1S9GA 4F2SA 1NGCA 4WF9L 2X6NA 3K57A 3UKRA 3F2KA 1RDBA 2Z1GA 1R59O 1S1VA 4J2EA 3U4LA 2GUPA 3M6GA 3M8QA 5AQHA 5C24A 3K58A 4JKCA 3ZT4A 4I9QA 3CG7A 4FLYA 4JK7A 2A1RA 1O13A 4A57A 3WEEA 4DS5A 4Z94A 4C1NK 4PKHA 1JJ2M 2E6MA 4DTNA 4FZYA 3DXMB 2CH6A 3IFRA 4H0TB 3UKUA 3PV8A 1L5UA 4OKJA 1A5XA 3E01A 3ISNC 1E4GT 2Z1HA 4IOXA 1X9WA 1C1AA 3AA3A 1RTJA 1GLFO 3AA4A 2E2QA 3AVFA 1RTIA 4GY2B 4H0YB 3K5LA 5C25A 4B3OA 3SQ1A 2P5GA 4E89A 3H45C 1RDCA 3OTOK 5I3UA 4CF2A 2P9SA 4CGGA 4O55A 1FKOA 3RMAA 3IG1A 3RSEB 1NK4A 3P31A 1JLFA 2HHSA 4BR0A 2YHBA 3LM9A 4M63C 3H3OB 1EWQA 5AZIB 4NCAA 1QZ5A 3UB5A 3WXIA 2GUIA 1EXQA 4LFAK 2HHTA 3DM2A 5AQMA 3SLCA 1X1PA 4B1VA 4FM1A 3DLBA 4OVLA 4F3TA 1N5YA 4YDUC 3VEWA 3R6MA 5AQXA 4JKBA 1KLMA 1G99A 1TYQB 2Q2RA 3PX4A 5LJWA 1NJWA 2QW9A 4BREA 3VQ9A 5JVHL 1JLBA 4GKJK 1HMVA 3P38A 2A1SA 2YJFA 2RE2A 4Z0UA 5GAGP 1V4SA 4NYNA 2PYLA 1CXUA 2F9TA 1WSIA 5I9EB 4FM2A 1TK5A 4JI4K 3M8SA 1HQUA 4B9MA 1X3NA 4B9QA 4JI6K 1BISA 3NH2A 1RT6A 2O8CB 1GLJO 4R79A 3LDPA 5BR9A 1XC3A 4FW1A 4BACA 3AVMA 1HKBA 2FSJA 1RBTA 1RBRA 3EY1A 2F8TA 4BWJA 3AAPA 1VQ8N 1HKCA 3KLGA 1LV5A 4WQ4A 5CZ1A 1L3TA 1SUQA 3TU5A 3HP9A 4A59A 1HPZA 3FR0A 4EP5A 4DFJA 4DTPA 4JLHA 4FJIA 2Q1NA 3WNFA 4BR4A 2P9KB 1VSJA 2PY5A 5AQVA 3AVGA 1JLQA 3VQCA 4DWIA 3OS0A 2UXDK 5FPEA 2VYPA 5F0XA 2QK9A 1ZBLA 3QFPA 4DSEA 4FWLA 5HRSA 3MCPA 4B3TK 1CZAN 3MMVA 2KZMA 1J6ZA 2QXFA 3MK6A 2BGGA 4EHTA 1OKJA 5CHIA 3TWHA 4H8KA 4ILJA 4PKIA 3J8AA 4H5WA 3WXLA 1C0FA 4B9SA 3SUPA 4G9ZA 1KAYA 1U47A 3OYAA 5M1KA 3R3LA 5AQUA 1OH6A 4MLEA 2HHWA 2A41A 4BE2A 4GW6A 4BVPA 3I8BA 1VQ7N 3TTDA 1BA1A 4LF9K 3GBTA 3TAFA 3GL1A 2Q3SA 2V7YA 1SKSA 3IDHA 3D7EO 1VSHA 4CFAA 4FOIA 4NYFA 3THXB 4RTFD 1Q7YO 3F5TA 3F9KA 3NH1A 4CFCA 1QQMA 4DSKA 4G1QA 1D9FA 1QVGM 3C6TA 4DV1K 3QEVA 4M3ZA 1TKXA 1WSHA 2QTDA 4JK9A 3HJFA 2P9LB 2XY5A 2VWBA 5E84A 4PUOA 3SBTA 2QWRA 4O0JA 3D2FA 1TKZA 3DRPA 3ENBA 3LP3A 3WXKA 1Z25A 1J9AA 3AO3A 1FK9A 4HUFA 4JEPA 4CEBA 3TABA 1KFSA 1IKXA 4DR3K 1TUUA 1NGJA 1JXBA 1VQNN 3P4IA 1JCEA 2NUBA 4DG1A 3LALA 4PL7A 1B9FA 3NVKA 1J5OA 4ISFA 4E0DA 2P9PB 2FSNA 3LAKA 1TUYA 1RNHA 4CCHA 4HCCA 3ENOA 3QICA 2O8DB 3PO4A 1NJIO 5FRNA 1YAGA 1P8ZA 3ENHA 4WCEL 3U3YA 1QSYA 3CCLN 1X3MA 3C95A 3AGKA 3AVKA 1IO2A 3D2EA 4E7LA 3MXIA 4I6MB 2PFUA 4BR5A 1NK7A 2IVPA 4IFEA 1IG8A 3DI6A 2GX9A 1JL1A 2FBXA 2V52B 2F9WA 1FXXA 1YVNA 3OS1A 2GEMA 3LL3A 2WONA 2NRZA 3E66A 4W5TA 3SJHA 1NGHA 3DLEA 4R5PA 4H0VB 2ITGA 3DWLA 3J7AP 1TK0A 1RILA 2BH1A 1K6YA 1WBDA 1Z26A 4CZKA 4DV6K 4CEQA 3EN9A 1XC9A 2UXCK 4K42A 2QWLA 3LP0A 5DMRA 5K14A 4KKOA 2JWKA 3AGRA 2PYJA 3MX5A 2GBZA 3LDNA 2HF3A 5EXWA 2YKMA 3HPGA 4ILHA 4QCLA 4CK1A 2G8FA 3O5BA 2KQ2A 4DFPA 4JKHA 3H6EA 3SUQA 5KGWA 3T1AA 2NRXA 3U9DA 1WLJA 5AJ3K 2YHYA 4FK4A 3RVCA 4DU4A 2Q0UA 4C8MA 1HYVA 3J81O 1TKDA 5BR8K 3V9XA 3KIOA 1DKGD 2R7YA 4DTRA 2IDOA 3VERA 3NF8A 4A62A 5BN8A 3SYZA 5FROA 1WN7A 4JKAA 3ULEB 1S1UA 3CCSN 2E8AA 1IKWA 2RN2A 3EL2A 3U3GA 4CEFA 4AM7A 3T1HK 3FZLA 4EAHD 4QS7A 1NMDA 4GV6A 5FDLA 4CIGA 4PKGA 3LZJA 4IJNA 1CXQA 1DT9A 1Q9YA 1I3AA 3FZKA 3HPHA 1NGFA 4FM0A 4HWIA 1T3VA 5KTQA 4FJNA 3L3UA 1UAXA 4W5QA 1O1WA 3SPZA 4DSLA 2E2PA 3KKRA 5LMUK 3HVTA 1N6QA 4DQQA 4CD3A 3UIQA 3RMCA 4C1NI 1NNEA 4KHQA 4LF8K 2KLAA 4OGEA 1UA0A 4CBUA 5IWAK 3C6HA 3KTQA 3CM5A 1NGBA 2WFBA 3CJAA 1MDUB 2Z1IA 1X9MA 5EOYA 4FJGA 1N36K 2FBYA 4O0IA 1ITGA 1CZ9A 1A5WA 3EE8A 3SNNA 1CZBA 3AVNA 1HNVA 2OPRA 3ZSRA 2A5XA 4O44A 2DFHA 2HBKA 2KFZA 4H03B 4KHYA 4FJKA 5M1FA 4OLBA 3TR8A 1HJRA 4CGFA 2KKZA 3VGLA 1BO5O 4OPAA 1LW2A 4KTWA 3K5NA 4JS4A 4BRHA 1HKGA 1BCMA 4LF6K 2NLXA 1TKTA 4CECA 4DLEA 4DSIA 3VTHA 2P9UA 3A5NC 4Z4CA 4A2BA 4E7KA 2YJEA 1YT3A 1ATRA 2YCHA 3AVBA 2O8BA 5DM7L 1HX1A 2HBJA 1NK8A 1SKRA 4MQ3A 3L2WA 3HXMA 1GLCG 5C12A 4O8KA 3QLHA 3R9PA 3C0BA 2I7PA 4BRNA 3THWA 4IDKA 1ASVA 3OJUA 1WSEA 2HB5A 2H3GX 5C42A 5HOOA 1XNRK 3ID6A 1QQCA 3KZBA 4O8UA 3AARA 4FJHA 4LD0A 4CFBA 3L2RA 1QSLA 4CHZA 3AVIA 3M8RA 5JLFA 4K43A 1HQEA 2QWPA 3ZETA 2YHWA 4IO9L 1KTQA 2P51A 4JKEA 1DGKN 3KWIA 5KGXA 3JSMA 4HUEA 4CVNE 3G10A 1R0AA 3DJCA 1Q82O 2X6SA 2BDPA 1BI4A 2X74A 2HMIA 1NJXA 4U67L 3KLHA 1OVYA 1S6PA 2ETJA 4RW6A 2D4WA 4KH5A 1J54A 5FLXO 4H4MA 4B08A 4CGJA 3L8BA 3O80A 4W5RA 4KH4A 3WNEA 1RBUA 3O9SA 3ZSWA 4FZZA 4FPBA 4NLCA 3O9QA 4IOAL 3DLKA 3TPQA 3DXKB 4RWTA 1N34K 3QO9A 1XQSC 3AVJA 3CQXA 1XWLA 3KD5E 4CK2A 1BL3A 5HRNA 3KK1A 4DU1A 4NCBA 4CI6A 4DQSA 1JLEA 5LMNK 3ATUA 3THYA 3LDLA 1H1VA 4YFUA 2CH5A 5GIPA 3CPEA 1TAQA 3QFUA 2ZE2A 3CJ9A 1HR0K 1HUXA 4B9LA 1OVQA 4AHVA 1RBVA 5AZJA 4CJPA 3V6DA 2V51B 1ZC6A 4N5SA 3BP8A 3ZEUA 2Q97A 3ZSYA 1S1TA 2EWSA 1C1BA 3NHGA 2YV0X 5GIOA 3BDPA 4I2QA 1K8KB 4B9TA 4A5AA 3MWTA 4CJVA 4KTQA 3HZ6A 4BDPA 1HNWK 3L3VA 3WNHA 3HBTA 2UU9K 2NRVA 1RT3A 1YTUA 2HBMA 2YNFA 4QOZB 2YNHA 4CD1A 3HYFA 3SPYA 5AQTA 4OLAA 5BRDA 4E1MA 3LZIA 1VQMN 2OZSA 4DV5K 1IH7A 3CIPA 4EZ6A 3AVLA 4LF5K 4QS9A 3WQUA 4CHPA 2YNGA 3HRGA 1JKHA 4CF8A 3E9PA 1HNIA 4TSXA 4Y1DA 3CCMN 3IRXA 3CQYA 2P1JA 3MN7A 1K8KA 2NZTA 3T3FA 2P5OA 2ASMA 4CZHA 1T6CA 3RR7A 3LM2A 5AFUH 3CJ7A 4KO0A 4JV5K 3TAGA 3RRGA 4MDAA 2RHKA 3DXMA 4CW7B 2VWKA 4BRLA 3VEXA 3D6RA 3OYBA 2F8SA 3CHWA 5T7BA 2OZMA 1JLAA 4ICLA 1T8EA 4IFVA 4DSJA 1ZXOA 2HF4A 5D3GA 2OTJN 3OYIA 1BCOA 1U49A 3BF3A 2XHBA 2FF3B 3MEGA 5HBMA 2QKBA 1WB9A 3V1OA 3M8PA 3ULDA 3FZFA 2RF2A 5CR4A 2F96A 4DR5K 1S1WA 5AQKA 1X9SA 2Y1IA 2ZGYA 4BRIA 2QA4N 3DLGA 1GOBA 4CZEA 1N32K 1NK0A 1BA0A 4CJ5A 4KTZA 4YOUA 3RSEA 1I39A 2KZZA 1NKCA 4BY9C 4FO0A 3KKSA 3OYMA 4CEOA 4DUYK 1KSPA 5AZIA 3SQ2A 5M1PA 2HNZA 4WE1A 4CERA 3S9HA 4EHUA 2ZF5O 2QEXN 3RR8A 3ZT2A 5SZTA 3ZSZA 3Q7CA 4BR7A 3K5OA 4A5BA 4YOVA 1XMOK 3CCVN 2IIRA 3DRRA 4E19A 3MWPA 2CGLA 1EP4A 5EVZA 3S41A 1YJNN 2GV9A 1K9MO 5KI6A 1TYQA 5SWMA 1HNXK 4B1UB 3TAEA 1J53A 3GDQA 3O4WA 2GWJA 4JRQA 3CYMA 3DAWA 3NBPA 2LSNA 4H0PA 2E5LK 4F2RA 3SZ2A 2OTLN 4IOCL 4AHTA 1U04A 1VQ4N 4PL8A 1NOYA 3DLHA 1HYSA 3VQAA 5BN9A 5ADXH 1RCHA 4DTXA 3LPUA 3CPWM 4J2BA 4FJMA 2W6KA 4OJRA 4W5OA 4B9NA 3B6OA 5BRHA 3OYNA 4FLUA 2HSTA 4JKDA 1ZYQA 4DR2K 5KRTA 3AO5A 3V9WA 4JS5A 1ZBFA 2O8CA 1BG3A 4ELTA 3CFRA 3VN5A 3MDQA 3SJJA 4FWOA 1QSSA 1KD1O 4IDHA 4BWMA 3ZT1A 1IBMK 1VAZA 3EZ5A 3FZHA 4BRGA 4M41A 5BPLA 3AY9A 3OYLA 4A61A 4NB4A 3V9SA 4J8FA 5FPNA 3V9UA 3MX2A 1QZ6A 1WSFA 1DLOA 3GE1A 5AQGA 3QBXA 4H0XB 1KAXA 4FLZA 3NDKA 4ZTJA 3ASMA 3QETA 4RCHA 2P9KA 3RWUA 4KI6A 1GLLO 1W97L 2CGKA 4X65K 1WSGA 3SQ4A 1OH7A 2BE2A 4GV9A 1QS4A 1BOTO 1M1KO 4X64K 4F3OA 4B9UA 3OYKA 3CERA 3F9MA 4M45A 3IS9A 1K73O 1YF5L 4FXDA 4K25A 1TAUA 3L4IA 1VRTA 3TAMA 5JS1A 3ZT0A 4B1XB 3AAQA 3H3NO 5BPMA 1VSEA 4CJLA 1BU6O 1BWFO 3VA3A 4M3WA 3B6PA 2E1YA 1VQLN 4Z4GA 5LL6Z 5ELZA 1KCFA 4DR7K 1LAWA 1RGIA 4FWMA 3PIPL 3PO5A 4OPHA 3NCIA 4BRKA 3C7NB 3D0PA 4M3YA 4C8OA 4BE1A 1NJYA 3MECA 3THXA 5C10A 2I7NA 3ZSOA 5TKYA 4C8KA 4JI2K 4C23A 4PY5A 4L8RB 5LY3A 3U6FA 3NGZA 5AQIA 3HT3A 1X9JA 2GTDA 2E2OA 1N33K 3EEQA 4BGBA 4DLGA 1VSFA 2P9LA 1S22A 2IC3A 2YHAA 5J2MA 2P9IB 4KHUA 2VQFK 4E7JA 4V19S 4GMJB 4AHSA 2Q31A 4Q5VA 1HNZK 3B8AX 3J80O 1ASUA 1RFQA 3K2PA 3CXCM 3BZKA 4H4OA 2ITMA 3O3HA 4EZ9A 4DQIA 4BDYA 2P9PA 4B8CA 4N76A 3O4NA 1KC8O 4X62K 4KREA 4DV2K 3HM9A 3H46O 4DTUA 2O8DA 2VWJA 4MDBA 2VGMA 3OYJA 4RW4A 4DB3A 1IBKK 3QESA 2AP1A 4FL9A 3HK2A 4H5RA 1S72N 3VENA 4LH4A 3BZCA 2OCEA 1Y64A 1NMNA 1YIJN 3CQ8A 4IKFA 3AO1A 1E3MA 3VF6A 5KPRA 3O9TA 2ZQBA 4I6MA 4WQ5A 4B8AB 4KHSA 5FPMA 1Z05A 1GLEG 4IXCA 2A42A 4BC2A 5EX5A 4I2PA 3C94A 4M3XA 1EQYA 4J2AA 3HSCA 5JLHA 1A5VA
chains in the Genus database with same CATH topology
3LP2A 3SQ0A 2HVHA 2Z1JA 1NK6A 4IG0A 3L2RA 2RKIA 4CHZA 1QSLA 3AVIA 4KHNA 1MU2A 2D0AA 3M8RA 1RDCA 3CM6A 5I3UA 4CF2A 2EX3A 2D0CA 1ASWA 4FCYA 1HQEA 2IS3A 1VSLA 4CGGA 4CIFA 4CEEA 1D9DA 4O55A 1FKOA 1KTQA 3RMAA 3IG1A 2P51A 3VQ6A 1TVRA 1NK4A 4CF1A 1JLFA 4CJFA 3TAQA 2XY6A 4Z4EA 2HHSA 1Q8IA 2YHBA 4HVJA 5KGXA 4HUEA 3JSMA 3HO1A 1JLCA 1F21A 2E4LA 4NCAA 4PQUA 1B92A 3G10A 1R0AA 3CFPA 4N56A 2X6SA 2BDPA 1BI4A 3I8DA 5HLFA 2GUIA 2X74A 1EXQA 2HMIA 1NJXA 4C8LA 4DS4A 2HVIA 2HHTA 3KLHA 2ETJA 1S6PA 4RW6A 3NF6A 3QEIA 1WAJA 3DM2A 1T05A 1X1PA 4FM1A 3DLBA 4FJ7A 1C0MA 4OVLA 4F3TA 1N5YA 1J54A 2X78A 5J2PA 4FK2A 4H4MA 4B08A 4CGJA 5FRMA 3I0RA 4CJWA 1Q9XA 3L8BA 4CJQA 1KLMA 4KHWA 4W5RA 1CLQA 5I42A 3S3MA 3PX6A 2ATQA 3WNEA 3PX4A 1LW0A 3A2FA 1RBUA 3ZSWA 3ZSVA 2KFNA 2XY7A 4FZZA 3S3OA 2FBVA 3KD1E 3EYZA 1NJWA 2HHXA 2WOMA 3DLKA 1G15A 1D5AA 3VQ9A 4FK0A 3QINA 1JLBA 1IKVA 5HRRA 1RBSA 1HMVA 1SKWA 3NE6A 2A1SA 5EU7A 4Z0UA 3KLFA 3JYTA 4BDZA 3QO9A 1D8YA 2E6LA 3AVJA 3MEEA 4NYNA 1EETA 1XWLA 4O4GA 2PYLA 4CK2A 5KRSA 1CXUA 1BL3A 3KD5E 5HRNA 3KK1A 1WSIA 3AO2A 4FM2A 5HROA 1TK5A 4DU1A 3SCXA 4NCBA 3NGIA 3M8SA 4FLXA 4DQSA 1HQUA 2O4GA 4M42A 4QAGA 3KK3A 4CHNA 1JLEA 4B9MA 4DTJA 4YFUA 4KPYA 1BISA 3NH2A 1RT6A 1TAQA 4I9LA 3VQ7A 4YNQA 2ZE2A 3VQEA 3SV4A 1TV6A 2Y1JA 3O3FA 4CJUA 1XI1A 4B9LA 3LANA 4FW1A 4BACA 4AHVA 1VSMA 3AVMA 1KFDA 1JXEA 4RW8A 1RBTA 2HNYA 1RBRA 3RMDA 3HSTB 3EY1A 2EHGA 1RBVA 1KRPA 2F8TA 1C1CA 4CJPA 3NFAA 4E1NA 4BWJA 3V6DA 3VQPA 4CGIA 4N5SA 4M3UA 3V81A 4ELUA 3KLGA 1LV5A 4FZXC 1L3UA 1RDAA 3ZSYA 1S1TA 5CZ1A 1C1BA 4CF9A 1L3TA 3NHGA 2YV0X 1SUQA 3PY8A 3BDPA 3MAQA 4CGHA 4I2QA 3HP9A 4B9TA 1KLNA 1HPZA 5CZ2A 4EP5A 4DFJA 1RT7A 2FC0A 4JLHA 4DTPA 4FJIA 4DF4A 3SUOA 3WNFA 4FYDA 1VSJA 3ALYA 1ZBUA 1UWBA 1C0TA 4CJVA 4CJKA 3SUNA 2PY5A 4KTQA 4AH9A 3KK2A 3AVGA 1RT4A 1U48A 1JLQA 1S5JA 2G8UA 3VQCA 4E7IA 3AVAA 4DWIA 3OS0A 4BDPA 1LWCA 3L3VA 3ZT3A 3WNHA 1UA1A 1SV5A 3PX0A 2QK9A 1RT3A 1YTUA 3QEPA 1ZBLA 2YNFA 4FLWA 4QOZB 2DFEA 2YNHA 4FW2A 4DSEA 1XHXA 5HRSA 1NOZA 3HVRA 2AJQA 3HYFA 3SPYA 4OLAA 2KZMA 2QXFA 4E1MA 3LZIA 2BGGA 4CK3A 2OZSA 2IGIA 1IH7A 3TWHA 3OS2A 3VQ8A 3LAMA 4H8KA 4EZ6A 1NJZA 2VG7A 3AVLA 3ITHA 3DYAA 1S9EA 4CHPA 3NH0A 1RDDA 2YNGA 2DTUA 4B9SA 1YTAA 3SUPA 1JKHA 4CF8A 1RTDA 1HNIA 2JGUA 1U47A 4TSXA 4Y1DA 1VK0A 3OYAA 1RT2A 4FJLA 3IRXA 4FJ5A 2HHWA 4BE2A 2P1JA 4GW6A 5J2QA 4F4KA 4AILC 3T3FA 1VRUA 4HTUA 4LSNA 2P5OA 2OPPA 3AV9A 4ID5A 4CESA 3TAFA 2ZD1A 3PUFA 4IBNA 3RR7A 2Q3SA 1YVUA 1SKSA 4KO0A 3DOKA 3HP6A 4KB1A 1EKEA 1VSHA 3TAGA 3RRGA 4CFAA 4CHYA 4NYFA 3QNOA 2VWKA 3OVNA 1NKBA 3F9KA 3OYFA 3NH1A 2FBTA 4M3RA 4CFCA 3OYBA 3V1QA 4DSKA 4G1QA 3QEXA 4B9VA 2F8SA 1D9FA 4PWDA 3C6TA 3VQBA 4CFDA 4Z4HA 5T7BA 1W9HA 2YNIA 1T7PA 2OZMA 1JLAA 4ICLA 1T8EA 3QEVA 4IFVA 1WAFA 4DSJA 4M3ZA 5D3GA 2IAJA 1TKXA 1WSHA 1BCOA 3OYHA 3OYIA 1U49A 2XHBA 1JLGA 3MEGA 5HBMA 2QKBA 3HJFA 3G0ZA 3V1OA 4CJTA 2XY5A 4DSFA 3SI6A 4B3OA 2B4JA 3M8PA 3ULDA 4PUOA 2RF2A 4O0JA 2F96A 1TKZA 4RG8A 3DRPA 1S1WA 3LP3A 4E89A 1Z25A 2OA8A 1X9SA 1J9AA 2I5JA 1FK9A 3AO3A 4HUFA 2Y1IA 2XRIA 4CEBA 3DLGA 1KVCA 1GOBA 5E41A 4AHUA 1IKXA 3TABA 1KFSA 3KJVA 4LH5A 1NK0A 4OKKA 4CJ5A 4KTZA 3L2QA 1JXBA 2G8HA 3HL8A 4ZHRA 1I39A 2NUBA 4DG1A 3LDSA 2KZZA 3LALA 1NKCA 1B9FA 4Z4FA 3KKSA 3OY9A 1J5OA 3OYMA 2G8IA 4CEOA 4E0DA 4KAZA 1KSPA 3SQ2A 4DTOA 2HNZA 4WE1A 4CERA 3S9HA 1B9DA 3LAKA 1RNHA 4RW9A 4FLTA 1NK5A 4EP4A 4CCHA 3RR8A 4HCCA 3VQ5A 3WNGA 1FKPA 4DFKA 3NF9A 3ZT2A 5SZTA 1TGOA 3ZSZA 4FLVA 3K5OA 4NCGA 1LWFA 5J1EA 3OYGA 3PO4A 2KTQA 3DRRA 2QKKA 4E19A 4F8RA 5FRNA 2HHQA 4KV8A 3O4QA 1EP4A 2PZSA 2HHUA 3DMJA 2GV9A 1BQNA 2OPSA 3U3YA 1QSYA 3C95A 1DTTA 5KI6A 1WSJA 5SWMA 4LY7A 3VA0A 2BANA 3D45A 3AVKA 3TAEA 1J53A 4Q0BA 1IO2A 3DOLA 4DTSA 4JRQA 4E7LA 3MXIA 3CYMA 3NBPA 1TL1A 1SL0A 2KW4A 2LSNA 4HHTA 1NK7A 4F2RA 4Z4IA 3SZ2A 4K8ZA 3CFOA 3DI6A 4CJEA 3LPTA 3OJSA 1GOCA 3K59A 4DFMA 1JL1A 2FBXA 3RRHA 4OGCA 1FXXA 3LP1A 3MEDA 4AHRA 2B6AA 4AHTA 1U04A 3OS1A 4CJSA 2DFFA 1NOYA 4ID1A 3DLHA 1HYSA 5DK5A 3RMBA 2WONA 3P5JA 3VQAA 2JLEA 4W5TA 1RCHA 4DTXA 3LPUA 3MXMA 3QNNA 3S3NA 4J2BA 1RT1A 4CEAA 4ELVA 4FJMA 2HHVA 4OJRA 4W5OA 3NAEA 4B9NA 4DMNA 1VSDA 3DLEA 4R5PA 3B6OA 2ITGA 4UQGA 1QTMA 3OYNA 1U4BA 3TANA 1T03A 4FLUA 1RILA 1TK0A 3VQ4A 4KB0A 1K6YA 3LWMA 1Y97A 4E7HA 1S1XA 4IFYA 4CHOA 1Z26A 1ZYQA 5KRTA 3AO5A 3QIPA 4CEQA 4OKEA 1WNSA 3NF7A 3V9WA 4JS5A 1ZBFA 1XC9A 1TK8A 1BQMA 4C8NA 4CIEA 4ELTA 3LP0A 5DMRA 3CFRA 3TI0A 1RT5A 5K14A 3VN5A 4KKOA 3SV3A 3SJJA 1TL3A 2G8WA 1QSSA 2O4IA 4CJRA 2IOCA 3OYEA 2PYJA 1ZBIA 1KVAA 3AVHA 4BWMA 4DU3A 2GBZA 3ZT1A 3ZSXA 3VQDA 2YKMA 3HPGA 4QCLA 4CK1A 3EZ5A 1BI4B 4DTMA 2G8FA 4M41A 2KQ2A 4DFPA 3OYLA 5CY4A 3V9SA 3SUQA 3V9UA 5KGWA 3T1AA 3V1RA 4JRPA 2YKNA 1EX4A 4KFBA 1WLJA 4IG3A 1WSFA 3TAPA 4FK4A 1DLOA 4DU4A 3IAYA 4C8MA 1BHLA 1HYVA 4FLZA 3NDKA 4ZTJA 1TKDA 3ASMA 3I0SA 3V9XA 3VQQA 3KIOA 4XIUA 2R7YA 4DTRA 1IKYA 3QETA 3RWUA 4KI6A 4K8XA 2IDOA 3OYDA 3NF8A 3V9ZA 3SYZA 5HP1A 5FROA 1WN7A 3AO4A 1REVA 3H08A 1S1UA 3KLIA 2OPQA 3HPOA 1WSGA 1C6VA 3SQ4A 1IKWA 2RN2A 4AHCA 3U3GA 2BE2A 3AA2A 4CEFA 1QS4A 1L3VA 2W42A 4CEDA 5FDLA 4O5BA 5HRPA 2DY4A 4F3OA 4CIGA 4HCBA 1L3SA 4CFBA 3P83D 4B9UA 3OYKA 3LZJA 4M45A 3IS9A 2D0BA 4N41A 1CXQA 4DF8A 4FJJA 3ZSQA 4FXDA 1Q9YA 1I3AA 1TAUA 1VRTA 2RPIA 3HPHA 3TAMA 4FM0A 5KTQA 1SL2A 4FJNA 5JS1A 3L3UA 1UAXA 4W5QA 3ZT0A 1O1WA 4GVMA 3SPZA 4HUGA 4DSLA 2B5JA 3KKRA 3T19A 1S6QA 1VSEA 4CJLA 3HVTA 3OYCA 2HNDA 2XO7A 4DQQA 1N6QA 3VA3A 3UIQA 3B6PA 3L2UA 3ZCMA 3RMCA 4M3WA 4Z4GA 1HRHA 1QHTA 4CGDA 3O3GA 2D5RA 1KCFA 2OYQA 1SL1A 2XY8A 4KHQA 1LAWA 4ZTFA 3PO5A 5JS2A 3NCIA 2HW3A 1W0HA 2VG6A 4OGEA 3FFIA 4N47A 1UA0A 3KTQA 3D0PA 4M3YA 3CM5A 4OPJA 4C8OA 1XHZA 4BE1A 1NJYA 1DTQA 3MECA 2Z1IA 1X9MA 4J2DA 3AA5X 3ZSOA 4C8KA 4MFBA 4DQPA 3F73A 2VG5A 4FJGA 3TARA 1HYZA 1BGXT 2FBYA 4O0IA 5J2NA 3QIOA 4RW7A 5CYQA 1ITGA 4CE9A 4E3SA 4FJ8A 4PY5A 4L8RB 1ZBHA 3DLRA 1CZ9A 3U6FA 1A5WA 4I7FA 4LSLA 3SNNA 3NGZA 3HT3A 1IG9A 1CZBA 3K5MA 3QERA 3AVNA 1HNVA 2OPRA 3NGYA 3ZSRA 4DLGA 3DRSA 1VSFA 1VSKA 4O44A 2DFHA 1LAVA 2KFZA 4KHYA 2IC3A 4CJ3A 3THVA 4FJKA 4OLBA 4OPKA 2YHAA 3TR8A 5J2MA 1C0UA 1HJRA 3KLEA 4CGFA 4KHUA 4CF0A 3L2VA 3V4IA 1NKEA 4E7JA 1JL2A 3C6UA 1LW2A 2G8VA 4GMJB 4AHSA 4KTWA 4Q5VA 4BE0A 3K5NA 4JS4A 1KVBA 3BGRA 4KI4A 1S9GA 4F2SA 1ASUA 1BCMA 2X6NA 3K2PA 3K57A 3LWLA 1TKTA 4CECA 4DLEA 4DSIA 1RDBA 4H4OA 2Z1GA 1BIUA 3O3HA 4EZ9A 4DQIA 4BDYA 1S1VA 4J2EA 4Z4CA 1GOAA 3QEWA 1VSIA 4B8CA 4CJ4A 3M8QA 4E7KA 4N76A 1YT3A 5C24A 3O4NA 3K58A 2G8KA 4W5NA 3ZT4A 3AVBA 4KREA 4I9QA 4Y1CA 3CG7A 4FLYA 5CYMA 3RTVA 3HM9A 1NK8A 1SKRA 4DTUA 4MQ3A 3L2WA 3HXMA 2A1RA 4M3TA 2VWJA 1QE1A 4DS5A 4CEZA 3MXJA 3QLHA 2E6MA 4RW4A 3OYJA 4DTNA 4PA1A 3QESA 3HK2A 3AVCA 1RTHA 1LWEA 4FZYA 4LH4A 3CQ8A 4IKFA 4KRFA 4DQRA 3AO1A 3PV8A 1BIZA 1L5UA 2ZQBA 4OKJA 1A5XA 4IDKA 1ASVA 3E01A 4B8AB 3OJUA 1WSEA 2HB5A 4KHSA 3ISNC 2Z1HA 3P1GA 1X9WA 1C1AA 1UOCA 5C42A 1NK9A 3AA3A 1RTJA 3AA4A 1U45A 1QQCA 1RTIA 3AVFA 4FVMA 4I2PA 3K5LA 3C94A 4FJ9A 4FJXA 4J2AA 4CHQA 5C25A 4FJHA 4M3XA 3SQ1A 4LD0A 2P5GA 1A5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LP2 A;  3SQ0 A;  2HVH A;  2Z1J A;  1NK6 A;  4IG0 A;  3L2R A;  2RKI A;  4CHZ A;  1QSL A;  3AVI A;  4KHN A;  1MU2 A;  2D0A A;  3M8R A;  1RDC A;  3CM6 A;  5I3U A;  4CF2 A;  2EX3 A;  2D0C A;  1ASW A;  4FCY A;  1HQE A;  2IS3 A;  1VSL A;  4CGG A;  4CIF A;  4CEE A;  1D9D A;  4O55 A;  1FKO A;  1KTQ A;  3RMA A;  3IG1 A;  2P51 A;  3VQ6 A;  1TVR A;  1NK4 A;  4CF1 A;  1JLF A;  4CJF A;  3TAQ A;  2XY6 A;  4Z4E A;  2HHS A;  1Q8I A;  2YHB A;  4HVJ A;  5KGX A;  4HUE A;  3JSM A;  3HO1 A;  1JLC A;  1F21 A;  2E4L A;  4NCA A;  4PQU A;  1B92 A;  3G10 A;  1R0A A;  3CFP A;  4N56 A;  2X6S A;  2BDP A;  1BI4 A;  3I8D A;  5HLF A;  2GUI A;  2X74 A;  1EXQ A;  2HMI A;  1NJX A;  4C8L A;  4DS4 A;  2HVI A;  2HHT A;  3KLH A;  2ETJ A;  1S6P A;  4RW6 A;  3NF6 A;  3QEI A;  1WAJ A;  3DM2 A;  1T05 A;  1X1P A;  4FM1 A;  3DLB A;  4FJ7 A;  1C0M A;  4OVL A;  4F3T A;  1N5Y A;  1J54 A;  2X78 A;  5J2P A;  4FK2 A;  4H4M A;  4B08 A;  4CGJ A;  5FRM A;  3I0R A;  4CJW A;  1Q9X A;  3L8B A;  4CJQ A;  1KLM A;  4KHW A;  4W5R A;  1CLQ A;  5I42 A;  3S3M A;  3PX6 A;  2ATQ A;  3WNE A;  3PX4 A;  1LW0 A;  3A2F A;  1RBU A;  3ZSW A;  3ZSV A;  2KFN A;  2XY7 A;  4FZZ A;  3S3O A;  2FBV A;  3KD1 E;  3EYZ A;  1NJW A;  2HHX A;  2WOM A;  3DLK A;  1G15 A;  1D5A A;  3VQ9 A;  4FK0 A;  3QIN A;  1JLB A;  1IKV A;  5HRR A;  1RBS A;  1HMV A;  1SKW A;  3NE6 A;  2A1S A;  5EU7 A;  4Z0U A;  3KLF A;  3JYT A;  4BDZ A;  3QO9 A;  1D8Y A;  2E6L A;  3AVJ A;  3MEE A;  4NYN A;  1EET A;  1XWL A;  4O4G A;  2PYL A;  4CK2 A;  5KRS A;  1CXU A;  1BL3 A;  3KD5 E;  5HRN A;  3KK1 A;  1WSI A;  3AO2 A;  4FM2 A;  5HRO A;  1TK5 A;  4DU1 A;  3SCX A;  4NCB A;  3NGI A;  3M8S A;  4FLX A;  4DQS A;  1HQU A;  2O4G A;  4M42 A;  4QAG A;  3KK3 A;  4CHN A;  1JLE A;  4B9M A;  4DTJ A;  4YFU A;  4KPY A;  1BIS A;  3NH2 A;  1RT6 A;  1TAQ A;  4I9L A;  3VQ7 A;  4YNQ A;  2ZE2 A;  3VQE A;  3SV4 A;  1TV6 A;  2Y1J A;  3O3F A;  4CJU A;  1XI1 A;  4B9L A;  3LAN A;  4FW1 A;  4BAC A;  4AHV A;  1VSM A;  3AVM A;  1KFD A;  1JXE A;  4RW8 A;  1RBT A;  2HNY A;  1RBR A;  3RMD A;  3HST B;  3EY1 A;  2EHG A;  1RBV A;  1KRP A;  2F8T A;  1C1C A;  4CJP A;  3NFA A;  4E1N A;  4BWJ A;  3V6D A;  3VQP A;  4CGI A;  4N5S A;  4M3U A;  3V81 A;  4ELU A;  3KLG A;  1LV5 A;  4FZX C;  1L3U A;  1RDA A;  3ZSY A;  1S1T A;  5CZ1 A;  1C1B A;  4CF9 A;  1L3T A;  3NHG A;  2YV0 X;  1SUQ A;  3PY8 A;  3BDP A;  3MAQ A;  4CGH A;  4I2Q A;  3HP9 A;  4B9T A;  1KLN A;  1HPZ A;  5CZ2 A;  4EP5 A;  4DFJ A;  1RT7 A;  2FC0 A;  4JLH A;  4DTP A;  4FJI A;  4DF4 A;  3SUO A;  3WNF A;  4FYD A;  1VSJ A;  3ALY A;  1ZBU A;  1UWB A;  1C0T A;  4CJV A;  4CJK A;  3SUN A;  2PY5 A;  4KTQ A;  4AH9 A;  3KK2 A;  3AVG A;  1RT4 A;  1U48 A;  1JLQ A;  1S5J A;  2G8U A;  3VQC A;  4E7I A;  3AVA A;  4DWI A;  3OS0 A;  4BDP A;  1LWC A;  3L3V A;  3ZT3 A;  3WNH A;  1UA1 A;  1SV5 A;  3PX0 A;  2QK9 A;  1RT3 A;  1YTU A;  3QEP A;  1ZBL A;  2YNF A;  4FLW A;  4QOZ B;  2DFE A;  2YNH A;  4FW2 A;  4DSE A;  1XHX A;  5HRS A;  1NOZ A;  3HVR A;  2AJQ A;  3HYF A;  3SPY A;  4OLA A;  2KZM A;  2QXF A;  4E1M A;  3LZI A;  2BGG A;  4CK3 A;  2OZS A;  2IGI A;  1IH7 A;  3TWH A;  3OS2 A;  3VQ8 A;  3LAM A;  4H8K A;  4EZ6 A;  1NJZ A;  2VG7 A;  3AVL A;  3ITH A;  3DYA A;  1S9E A;  4CHP A;  3NH0 A;  1RDD A;  2YNG A;  2DTU A;  4B9S A;  1YTA A;  3SUP A;  1JKH A;  4CF8 A;  1RTD A;  1HNI A;  2JGU A;  1U47 A;  4TSX A;  4Y1D A;  1VK0 A;  3OYA A;  1RT2 A;  4FJL A;  3IRX A;  4FJ5 A;  2HHW A;  4BE2 A;  2P1J A;  4GW6 A;  5J2Q A;  4F4K A;  4AIL C;  3T3F A;  1VRU A;  4HTU A;  4LSN A;  2P5O A;  2OPP A;  3AV9 A;  4ID5 A;  4CES A;  3TAF A;  2ZD1 A;  3PUF A;  4IBN A;  3RR7 A;  2Q3S A;  1YVU A;  1SKS A;  4KO0 A;  3DOK A;  3HP6 A;  4KB1 A;  1EKE A;  1VSH A;  3TAG A;  3RRG A;  4CFA A;  4CHY A;  4NYF A;  3QNO A;  2VWK A;  3OVN A;  1NKB A;  3F9K A;  3OYF A;  3NH1 A;  2FBT A;  4M3R A;  4CFC A;  3OYB A;  3V1Q A;  4DSK A;  4G1Q A;  3QEX A;  4B9V A;  2F8S A;  1D9F A;  4PWD A;  3C6T A;  3VQB A;  4CFD A;  4Z4H A;  5T7B A;  1W9H A;  2YNI A;  1T7P A;  2OZM A;  1JLA A;  4ICL A;  1T8E A;  3QEV A;  4IFV A;  1WAF A;  4DSJ A;  4M3Z A;  5D3G A;  2IAJ A;  1TKX A;  1WSH A;  1BCO A;  3OYH A;  3OYI A;  1U49 A;  2XHB A;  1JLG A;  3MEG A;  5HBM A;  2QKB A;  3HJF A;  3G0Z A;  3V1O A;  4CJT A;  2XY5 A;  4DSF A;  3SI6 A;  4B3O A;  2B4J A;  3M8P A;  3ULD A;  4PUO A;  2RF2 A;  4O0J A;  2F96 A;  1TKZ A;  4RG8 A;  3DRP A;  1S1W A;  3LP3 A;  4E89 A;  1Z25 A;  2OA8 A;  1X9S A;  1J9A A;  2I5J A;  1FK9 A;  3AO3 A;  4HUF A;  2Y1I A;  2XRI A;  4CEB A;  3DLG A;  1KVC A;  1GOB A;  5E41 A;  4AHU A;  1IKX A;  3TAB A;  1KFS A;  3KJV A;  4LH5 A;  1NK0 A;  4OKK A;  4CJ5 A;  4KTZ A;  3L2Q A;  1JXB A;  2G8H A;  3HL8 A;  4ZHR A;  1I39 A;  2NUB A;  4DG1 A;  3LDS A;  2KZZ A;  3LAL A;  1NKC A;  1B9F A;  4Z4F A;  3KKS A;  3OY9 A;  1J5O A;  3OYM A;  2G8I A;  4CEO A;  4E0D A;  4KAZ A;  1KSP A;  3SQ2 A;  4DTO A;  2HNZ A;  4WE1 A;  4CER A;  3S9H A;  1B9D A;  3LAK A;  1RNH A;  4RW9 A;  4FLT A;  1NK5 A;  4EP4 A;  4CCH A;  3RR8 A;  4HCC A;  3VQ5 A;  3WNG A;  1FKP A;  4DFK A;  3NF9 A;  3ZT2 A;  5SZT A;  1TGO A;  3ZSZ A;  4FLV A;  3K5O A;  4NCG A;  1LWF A;  5J1E A;  3OYG A;  3PO4 A;  2KTQ A;  3DRR A;  2QKK A;  4E19 A;  4F8R A;  5FRN A;  2HHQ A;  4KV8 A;  3O4Q A;  1EP4 A;  2PZS A;  2HHU A;  3DMJ A;  2GV9 A;  1BQN A;  2OPS A;  3U3Y A;  1QSY A;  3C95 A;  1DTT A;  5KI6 A;  1WSJ A;  5SWM A;  4LY7 A;  3VA0 A;  2BAN A;  3D45 A;  3AVK A;  3TAE A;  1J53 A;  4Q0B A;  1IO2 A;  3DOL A;  4DTS A;  4JRQ A;  4E7L A;  3MXI A;  3CYM A;  3NBP A;  1TL1 A;  1SL0 A;  2KW4 A;  2LSN A;  4HHT A;  1NK7 A;  4F2R A;  4Z4I A;  3SZ2 A;  4K8Z A;  3CFO A;  3DI6 A;  4CJE A;  3LPT A;  3OJS A;  1GOC A;  3K59 A;  4DFM A;  1JL1 A;  2FBX A;  3RRH A;  4OGC A;  1FXX A;  3LP1 A;  3MED A;  4AHR A;  2B6A A;  4AHT A;  1U04 A;  3OS1 A;  4CJS A;  2DFF A;  1NOY A;  4ID1 A;  3DLH A;  1HYS A;  5DK5 A;  3RMB A;  2WON A;  3P5J A;  3VQA A;  2JLE A;  4W5T A;  1RCH A;  4DTX A;  3LPU A;  3MXM A;  3QNN A;  3S3N A;  4J2B A;  1RT1 A;  4CEA A;  4ELV A;  4FJM A;  2HHV A;  4OJR A;  4W5O A;  3NAE A;  4B9N A;  4DMN A;  1VSD A;  3DLE A;  4R5P A;  3B6O A;  2ITG A;  4UQG A;  1QTM A;  3OYN A;  1U4B A;  3TAN A;  1T03 A;  4FLU A;  1RIL A;  1TK0 A;  3VQ4 A;  4KB0 A;  1K6Y A;  3LWM A;  1Y97 A;  4E7H A;  1S1X A;  4IFY A;  4CHO A;  1Z26 A;  1ZYQ A;  5KRT A;  3AO5 A;  3QIP A;  4CEQ A;  4OKE A;  1WNS A;  3NF7 A;  3V9W A;  4JS5 A;  1ZBF A;  1XC9 A;  1TK8 A;  1BQM A;  4C8N A;  4CIE A;  4ELT A;  3LP0 A;  5DMR A;  3CFR A;  3TI0 A;  1RT5 A;  5K14 A;  3VN5 A;  4KKO A;  3SV3 A;  3SJJ A;  1TL3 A;  2G8W A;  1QSS A;  2O4I A;  4CJR A;  2IOC A;  3OYE A;  2PYJ A;  1ZBI A;  1KVA A;  3AVH A;  4BWM A;  4DU3 A;  2GBZ A;  3ZT1 A;  3ZSX A;  3VQD A;  2YKM A;  3HPG A;  4QCL A;  4CK1 A;  3EZ5 A;  1BI4 B;  4DTM A;  2G8F A;  4M41 A;  2KQ2 A;  4DFP A;  3OYL A;  5CY4 A;  3V9S A;  3SUQ A;  3V9U A;  5KGW A;  3T1A A;  3V1R A;  4JRP A;  2YKN A;  1EX4 A;  4KFB A;  1WLJ A;  4IG3 A;  1WSF A;  3TAP A;  4FK4 A;  1DLO A;  4DU4 A;  3IAY A;  4C8M A;  1BHL A;  1HYV A;  4FLZ A;  3NDK A;  4ZTJ A;  1TKD A;  3ASM A;  3I0S A;  3V9X A;  3VQQ A;  3KIO A;  4XIU A;  2R7Y A;  4DTR A;  1IKY A;  3QET A;  3RWU A;  4KI6 A;  4K8X A;  2IDO A;  3OYD A;  3NF8 A;  3V9Z A;  3SYZ A;  5HP1 A;  5FRO A;  1WN7 A;  3AO4 A;  1REV A;  3H08 A;  1S1U A;  3KLI A;  2OPQ A;  3HPO A;  1WSG A;  1C6V A;  3SQ4 A;  1IKW A;  2RN2 A;  4AHC A;  3U3G A;  2BE2 A;  3AA2 A;  4CEF A;  1QS4 A;  1L3V A;  2W42 A;  4CED A;  5FDL A;  4O5B A;  5HRP A;  2DY4 A;  4F3O A;  4CIG A;  4HCB A;  1L3S A;  4CFB A;  3P83 D;  4B9U A;  3OYK A;  3LZJ A;  4M45 A;  3IS9 A;  2D0B A;  4N41 A;  1CXQ A;  4DF8 A;  4FJJ A;  3ZSQ A;  4FXD A;  1Q9Y A;  1I3A A;  1TAU A;  1VRT A;  2RPI A;  3HPH A;  3TAM A;  4FM0 A;  5KTQ A;  1SL2 A;  4FJN A;  5JS1 A;  3L3U A;  1UAX A;  4W5Q A;  3ZT0 A;  1O1W A;  4GVM A;  3SPZ A;  4HUG A;  4DSL A;  2B5J A;  3KKR A;  3T19 A;  1S6Q A;  1VSE A;  4CJL A;  3HVT A;  3OYC A;  2HND A;  2XO7 A;  4DQQ A;  1N6Q A;  3VA3 A;  3UIQ A;  3B6P A;  3L2U A;  3ZCM A;  3RMC A;  4M3W A;  4Z4G A;  1HRH A;  1QHT A;  4CGD A;  3O3G A;  2D5R A;  1KCF A;  2OYQ A;  1SL1 A;  2XY8 A;  4KHQ A;  1LAW A;  4ZTF A;  3PO5 A;  5JS2 A;  3NCI A;  2HW3 A;  1W0H A;  2VG6 A;  4OGE A;  3FFI A;  4N47 A;  1UA0 A;  3KTQ A;  3D0P A;  4M3Y A;  3CM5 A;  4OPJ A;  4C8O A;  1XHZ A;  4BE1 A;  1NJY A;  1DTQ A;  3MEC A;  2Z1I A;  1X9M A;  4J2D A;  3AA5 X;  3ZSO A;  4C8K A;  4MFB A;  4DQP A;  3F73 A;  2VG5 A;  4FJG A;  3TAR A;  1HYZ A;  1BGX T;  2FBY A;  4O0I A;  5J2N A;  3QIO A;  4RW7 A;  5CYQ A;  1ITG A;  4CE9 A;  4E3S A;  4FJ8 A;  4PY5 A;  4L8R B;  1ZBH A;  3DLR A;  1CZ9 A;  3U6F A;  1A5W A;  4I7F A;  4LSL A;  3SNN A;  3NGZ A;  3HT3 A;  1IG9 A;  1CZB A;  3K5M A;  3QER A;  3AVN A;  1HNV A;  2OPR A;  3NGY A;  3ZSR A;  4DLG A;  3DRS A;  1VSF A;  1VSK A;  4O44 A;  2DFH A;  1LAV A;  2KFZ A;  4KHY A;  2IC3 A;  4CJ3 A;  3THV A;  4FJK A;  4OLB A;  4OPK A;  2YHA A;  3TR8 A;  5J2M A;  1C0U A;  1HJR A;  3KLE A;  4CGF A;  4KHU A;  4CF0 A;  3L2V A;  3V4I A;  1NKE A;  4E7J A;  1JL2 A;  3C6U A;  1LW2 A;  2G8V A;  4GMJ B;  4AHS A;  4KTW A;  4Q5V A;  4BE0 A;  3K5N A;  4JS4 A;  1KVB A;  3BGR A;  4KI4 A;  1S9G A;  4F2S A;  1ASU A;  1BCM A;  2X6N A;  3K2P A;  3K57 A;  3LWL A;  1TKT A;  4CEC A;  4DLE A;  4DSI A;  1RDB A;  4H4O A;  2Z1G A;  1BIU A;  3O3H A;  4EZ9 A;  4DQI A;  4BDY A;  1S1V A;  4J2E A;  4Z4C A;  1GOA A;  3QEW A;  1VSI A;  4B8C A;  4CJ4 A;  3M8Q A;  4E7K A;  4N76 A;  1YT3 A;  5C24 A;  3O4N A;  3K58 A;  2G8K A;  4W5N A;  3ZT4 A;  3AVB A;  4KRE A;  4I9Q A;  4Y1C A;  3CG7 A;  4FLY A;  5CYM A;  3RTV A;  3HM9 A;  1NK8 A;  1SKR A;  4DTU A;  4MQ3 A;  3L2W A;  3HXM A;  2A1R A;  4M3T A;  2VWJ A;  1QE1 A;  4DS5 A;  4CEZ A;  3MXJ A;  3QLH A;  2E6M A;  4RW4 A;  3OYJ A;  4DTN A;  4PA1 A;  3QES A;  3HK2 A;  3AVC A;  1RTH A;  1LWE A;  4FZY A;  4LH4 A;  3CQ8 A;  4IKF A;  4KRF A;  4DQR A;  3AO1 A;  3PV8 A;  1BIZ A;  1L5U A;  2ZQB A;  4OKJ A;  1A5X A;  4IDK A;  1ASV A;  3E01 A;  4B8A B;  3OJU A;  1WSE A;  2HB5 A;  4KHS A;  3ISN C;  2Z1H A;  3P1G A;  1X9W A;  1C1A A;  1UOC A;  5C42 A;  1NK9 A;  3AA3 A;  1RTJ A;  3AA4 A;  1U45 A;  1QQC A;  1RTI A;  3AVF A;  4FVM A;  4I2P A;  3K5L A;  3C94 A;  4FJ9 A;  4FJX A;  4J2A A;  4CHQ A;  5C25 A;  4FJH A;  4M3X A;  3SQ1 A;  4LD0 A;  2P5G A;  1A5V A; 
#chains in the Genus database with same CATH topology
 3LP2 A;  2Z1J A;  4XH1 A;  4BG8 A;  1NK6 A;  4IG0 A;  4KHN A;  2RKI A;  3MCA B;  2D0A A;  3ATV A;  3CM6 A;  2EX3 A;  3WUH A;  1NG9 A;  2D0C A;  1ASW A;  4FWS A;  3O9R A;  2IS3 A;  4CIF A;  4CEE A;  2A6A A;  5BRE A;  3WXM B;  1YI2 N;  4FWK A;  4BVO A;  4CJF A;  4Z4E A;  1XUP O;  5CE3 A;  4HVJ A;  4JI0 K;  3HO1 A;  1JLC A;  3T1Y K;  1ILY A;  1B92 A;  1NLV A;  5AQN A;  2HVI A;  4C8L A;  3CC2 N;  3ID8 A;  3QEI A;  4FWP A;  3VPZ A;  1VQO N;  1C0M A;  1VQK N;  4YOX A;  2X78 A;  1IJJ A;  5J2P A;  4FK2 A;  4CZI A;  4CJW A;  1Q9X A;  3VET A;  3Q7B A;  4KHW A;  3A2F A;  4CZF A;  3ULE A;  1U2V B;  4NO7 A;  4DUZ K;  4JKG B;  3S3O A;  3ZLJ A;  3I33 A;  3KD1 E;  1FW6 A;  2HHX A;  1NBW A;  2WOM A;  2OAN A;  1D5A A;  1G15 A;  3L4Q A;  2ASP A;  4M7X A;  1M90 O;  4WQ4 C;  3T69 A;  2J4R A;  3FE1 A;  5LJV A;  3CET A;  4BDZ A;  1D8Y A;  2E6L A;  4FVU A;  3MEE A;  3LDO A;  4BRC A;  3EKU A;  2ZJR L;  3SCX A;  2ASO A;  2NRR A;  4FLX A;  4M42 A;  4QAG A;  1QQO A;  5B8H A;  4IO8 A;  4YOR A;  1MA9 B;  4DTJ A;  4KPY A;  1W2B M;  3VF2 A;  4YDU A;  3E1Y A;  3VQ7 A;  4I9L A;  2UXB K;  4YNQ A;  3VQE A;  3VEY A;  1TV6 A;  4CJU A;  3LAN A;  2V7Z A;  3EZW A;  1MWM A;  4RW8 A;  4ILG B;  2EHG A;  1KRP A;  1C1C A;  3VQP A;  4CGI A;  3V81 A;  4ELU A;  2P9N B;  1LOT B;  4CF9 A;  4GVE A;  1HLU A;  1QVF M;  3MAQ A;  1IBL K;  3SBG A;  5BPN A;  1KLN A;  2FC0 A;  3PSI A;  4JNE A;  2FF6 A;  3QB0 A;  3ALY A;  1ZBU A;  1C0T A;  3JS6 A;  4AH9 A;  3KK2 A;  1RT4 A;  2W40 A;  1S5J A;  3CCQ N;  4E7I A;  3AVA A;  1UA1 A;  1SV5 A;  4B1Z A;  2VGN A;  3VGK A;  3QEP A;  1JCF A;  4FLW A;  3KVG A;  1XMQ K;  4FW2 A;  1XHX A;  1NOZ A;  3J7Y P;  4LC9 B;  2WBN A;  4CK3 A;  3ZX3 A;  3VQ8 A;  3LAM A;  2FSK A;  3ITH A;  3TTF A;  1YUW A;  1S9E A;  3DYA A;  5AQO A;  2DTU A;  3SAF A;  1VK0 A;  4FJL A;  4FJ5 A;  5ADX A;  2FXU A;  4GKK K;  3L0Q A;  5J2Q A;  2HHH K;  5M1N A;  4F4K A;  4AIL C;  1VRU A;  4HTU A;  4LSN A;  3JAM O;  4JD2 B;  2OPP A;  3AV9 A;  3O1B A;  4CES A;  2QWM A;  3PUF A;  2WUS A;  1YVU A;  4KB1 A;  3DOK A;  3HP6 A;  1EKE A;  4CHY A;  2ZGZ A;  5KQD A;  3QNO A;  2O8E B;  3OVN A;  3OYF A;  3N4Q A;  2FBT A;  1NGA A;  5AQQ A;  3V1Q A;  3QEX A;  4PWD A;  4Y0W A;  1KQS M;  3J7Z O;  2GEL A;  3VQB A;  4CFD A;  2HMP A;  4WFN L;  3VEO A;  3W3D A;  4FSV A;  2IAJ A;  1JLG A;  2QWQ A;  3G0Z A;  3WXJ A;  4CJT A;  4DSF A;  2O8F B;  4B1W B;  5M1Q A;  1U6Z A;  3ZX2 A;  2VCP A;  4BRD A;  3NVM A;  2XRI A;  1KVC A;  2E1Z A;  4AHU A;  4LH5 A;  4NXM K;  4OKK A;  3L2Q A;  2NRW A;  1GLD G;  3UKR B;  3LDS A;  4Z4F A;  1RDW X;  1MWK A;  1T44 A;  3OY9 A;  2G8I A;  4BRM A;  2UUB K;  1NGD A;  4GNI A;  1EO1 A;  1YJ9 N;  4FLT A;  1NK5 A;  3IKM A;  3VQ5 A;  3WNG A;  1FKP A;  3NF9 A;  1TGO A;  4FLV A;  2VQE K;  3WEE B;  2KTQ A;  3O6W A;  4AM6 A;  4KV8 A;  3O4Q A;  2Q0R A;  2HHU A;  3DMJ A;  1BQN A;  1DTT A;  3UKU B;  2E88 A;  4LY7 A;  2BAN A;  3D45 A;  2F4V K;  2NNW A;  4LF4 K;  3DOL A;  3BY5 A;  4DTS A;  1JCG A;  1SL0 A;  1BUP A;  2KW4 A;  4HHT A;  4Z4I A;  5E26 A;  3CFO A;  3OJS A;  3K59 A;  3DXK A;  2BTF A;  4DFM A;  4LFB K;  3RRH A;  4OGC A;  3ZX0 A;  3LP1 A;  3MED A;  4PQU A;  3CJC A;  4WYB A;  2ZWH A;  2DFF A;  4IWV A;  4ID1 A;  4XH5 A;  5DK5 A;  4DHY A;  1VQP N;  2HHQ A;  1RT1 A;  4CEA A;  3NAE A;  4DMN A;  3CMA N;  1VSD A;  1QTM A;  4UQG A;  3TAN A;  1V4T A;  3VQ4 A;  4KB0 A;  1Y97 A;  2P9S B;  4E7H A;  1S1X A;  4IFY A;  3QIP A;  1WNS A;  1TK8 A;  4C8N A;  4CIE A;  4QS8 A;  3VTI A;  1RT5 A;  3SV3 A;  4CZJ A;  2O4I A;  2IOC A;  2KHO A;  1DEJ A;  3OYE A;  1J5E K;  1KVA A;  3T7Z A;  4DR1 K;  2AA4 A;  1NU0 A;  4DTM A;  4FOE A;  1EX4 A;  4KFB A;  1VHX A;  5HL7 L;  2YHX A;  2UYT A;  3IAY A;  1BHL A;  4ISE A;  3M1F A;  4XIU A;  1IKY A;  3CCR N;  3OYD A;  3V9Z A;  5HP1 A;  1WOQ A;  3KWG A;  1REV A;  3H08 A;  2OPQ A;  2W6L A;  2IVO A;  1C6V A;  4AHC A;  5C2D A;  3VEV A;  2W42 A;  4YHH K;  4O5B A;  5HRP A;  3P83 D;  3HOT A;  3QDK A;  2D0B A;  1D4X A;  4HTL A;  3OBW A;  2FLO A;  1ESV A;  1Z6R A;  3CI5 A;  4GVM A;  4HUG A;  2B5J A;  4IEE A;  3IUC A;  1S6Q A;  5JIC A;  2HND A;  2XO7 A;  3L2U A;  3VMF B;  4CGD A;  3O3G A;  2D5R A;  2OYQ A;  2XY8 A;  3BUZ B;  4WFA L;  5JS2 A;  3VF4 A;  1NM1 A;  1W0H A;  4JYA K;  4JI5 K;  4OX9 K;  1XHZ A;  2A3Z A;  3CJ1 A;  1YJW N;  4J2D A;  4K41 A;  4DQP A;  3F73 A;  2VG5 A;  1C0G A;  1BGX T;  4RW7 A;  5CYQ A;  4CE9 A;  5IT9 O;  4E3S A;  3DLR A;  4BC4 A;  3TSQ A;  1SQK A;  4I7F A;  4LSL A;  1IG9 A;  3QER A;  3NGY A;  3DRS A;  1VSK A;  4JKF A;  2ZJP L;  4CZM A;  4OPK A;  4BC5 A;  1GLA G;  4CF0 A;  4CJ7 A;  4FWQ A;  4BE0 A;  1KVB A;  2HBL A;  3BGR A;  2D0O A;  4KI4 A;  4CZL A;  3LWL A;  1W7A A;  4U7B A;  5BRF A;  1BIU A;  1HJO A;  1GOA A;  3QEW A;  1VSI A;  4CJ4 A;  3W0L A;  2G8K A;  5AQJ A;  4W5N A;  4DV4 K;  4Y1C A;  3GG4 A;  5CYM A;  3RTV A;  4M3T A;  1QE1 A;  5AQF A;  4CEZ A;  3MXJ A;  1VQ5 N;  5M1O A;  4PA1 A;  3AVC A;  1RTH A;  1LWE A;  4B3S K;  4YY3 K;  4LF7 K;  4KRF A;  1WUA A;  4DQR A;  3P39 A;  5F1X A;  1BIZ A;  4DKW A;  4WFB L;  3O9U A;  3MN6 A;  3P1G A;  3HI0 A;  1NK9 A;  1UOC A;  1U45 A;  4FVM A;  4FJ9 A;  4FJX A;  4CHQ A;  3OA9 A;  4BR9 A;  3SQ0 A;  3D2F B;  3K9K A;  4H5N A;  3UE5 A;  1MU2 A;  4B1Y B;  3A5O C;  4JI3 K;  2DPN A;  3PSF A;  4YOT A;  4FCY A;  4UY8 O;  1VSL A;  5H1S Q;  1D9D A;  3TTC A;  4M7Y A;  3VOV A;  3VQ6 A;  1TVR A;  4PHT X;  4CF1 A;  3TAQ A;  2XY6 A;  1Q8I A;  3WQT A;  1F21 A;  2E4L A;  1SS6 A;  3FZM A;  3CFP A;  4N56 A;  4DV7 K;  3I8D A;  5HLF A;  1NGG A;  4DS4 A;  3NF6 A;  1T05 A;  1WAJ A;  3I55 N;  3BF1 A;  4FJ7 A;  5FPD A;  4EIA A;  5FRM A;  4LFC K;  3I0R A;  4CZG A;  3SAG A;  4CJQ A;  5EY4 A;  3JXU A;  1CLQ A;  5I42 A;  3QBW A;  3S3M A;  4JI1 K;  2ATQ A;  3PX6 A;  1LW0 A;  4AF1 A;  4AQY K;  3ZSV A;  2KFN A;  2XY7 A;  3D2E B;  2FBV A;  3EYZ A;  2QXL A;  3CC7 N;  4FK0 A;  3QIN A;  1IKV A;  5HRR A;  1RBS A;  1SKW A;  3NE6 A;  3HM8 A;  5EU7 A;  3SK3 A;  2PBD A;  3KLF A;  3JYT A;  3G71 N;  1EET A;  4O4G A;  5KRS A;  3TSU A;  5HRO A;  3AO2 A;  4B3R K;  2YX6 A;  3NGI A;  2O4G A;  3U9Z A;  3KK3 A;  4CHN A;  4BQZ A;  1NGI A;  1T6D A;  3FLC O;  3SV4 A;  2Y1J A;  3A8Y A;  3O3F A;  1XI1 A;  4GV3 A;  3R1X A;  1VSM A;  5C15 A;  1KFD A;  3C7N A;  1JXE A;  2HNY A;  3HST B;  3NFA A;  4E1N A;  4H5T A;  3WT0 A;  4M3U A;  3CCE N;  4FZX C;  1L3U A;  1RDA A;  4ISG A;  3KK7 A;  3PY8 A;  4CGH A;  3C6A A;  3K9J A;  5CZ2 A;  4CBW A;  1RT7 A;  4DF4 A;  3SUO A;  4FYD A;  3SUN A;  1UWB A;  4CJK A;  4BQL A;  5AQS A;  3U8X A;  2G8U A;  1U48 A;  3PLA A;  3FFK B;  1LWC A;  1S3X A;  2W41 A;  3ZT3 A;  2WC9 A;  3PX0 A;  2P9I A;  1GLB G;  2DFE A;  3HVR A;  2AJQ A;  1HPM A;  4KH6 A;  2HOE A;  1LCU A;  3VEZ A;  2ZM6 K;  2YI1 A;  2D0P A;  5GAE P;  4DCH A;  2JWL A;  5GAD P;  2IGI A;  3CD6 N;  4A2A A;  3OS2 A;  1NJZ A;  2VG7 A;  5JVG L;  3OW2 M;  5AR0 A;  1RDD A;  3NH0 A;  1YTA A;  1RTD A;  2JGU A;  3E9L A;  1Q86 O;  1K8A O;  2IVN A;  1RT2 A;  4IJA A;  1FJG K;  4JHD B;  2ZJQ L;  1BDG A;  1QQN A;  5C2F A;  4JI8 K;  5KPT A;  4ID5 A;  3SAH A;  3CME N;  2ZD1 A;  3EKS A;  4IBN A;  3MN5 A;  4FWN A;  4K0K K;  3VES A;  3G25 A;  4O5F A;  5AQP A;  4XEI A;  1NKB A;  4X66 K;  3QML A;  4M3R A;  4KHP K;  3A5L C;  4IZ9 A;  4B9V A;  4Z4H A;  1W9H A;  2YNI A;  1T7P A;  4DR6 K;  1WAF A;  5AQY A;  2NRH A;  3OYH A;  3ZYY X;  3N4P A;  4BRQ A;  1KAZ A;  4DV3 K;  3EE9 A;  3SI6 A;  2B4J A;  5TKW A;  3FGU A;  1QHA A;  4IEI A;  4RG8 A;  2QWN A;  1IV0 A;  2OA8 A;  2I5J A;  3CJB A;  2HVH A;  5AQR A;  4MO4 A;  5E41 A;  3KJV A;  5AFU A;  2G8H A;  1Q81 O;  3HL8 A;  4JHD A;  1RDU A;  4ZHR A;  1OH8 A;  3VGM A;  1ZBS A;  2UUC K;  4KAZ A;  2P9U B;  4DTO A;  2UUA K;  5JMV A;  1B9D A;  4RW9 A;  4EP4 A;  5AQW A;  4BRO A;  4JK8 A;  2O8B B;  4DFK A;  3C65 A;  4BRP A;  3H1Q A;  4NCG A;  1LWF A;  1SZ2 A;  3R8E A;  5J1E A;  3OYG A;  4BRA A;  5DM6 L;  3L6Q A;  2QKK A;  3OHR A;  4F8R A;  2BUP A;  2PZS A;  1NWK A;  4XH4 A;  2OPS A;  3G6E N;  4YOY A;  4BGA A;  4DR4 K;  1WSJ A;  3VA0 A;  1U2V A;  4Q0B A;  3THW B;  3A5M C;  4JKG A;  1ATS A;  3K0S A;  1TL1 A;  2NRT A;  4K8Z A;  4CJE A;  3LPT A;  1GOC A;  4BG9 A;  1N8R O;  3RMD A;  3TSP A;  4AHR A;  2B6A A;  2QI2 A;  4CJS A;  4F9O A;  5GAH P;  3P5J A;  3RMB A;  2JLE A;  3MXM A;  1OH5 A;  3QNN A;  3S3N A;  4ELV A;  4NLB A;  2HHV A;  4H0O A;  4BR2 A;  1E4F T;  4KBO A;  1U4B A;  1T03 A;  3EO3 A;  3IMX A;  3H1V X;  3LWM A;  2E2N A;  4CHO A;  3ZET B;  5C0Y A;  4OKE A;  3NF7 A;  1BQM A;  3M5R A;  3O08 A;  4FWR A;  3TI0 A;  3O1W A;  2G8W A;  1TL3 A;  1NGE A;  4CJR A;  2QWO A;  3DLL L;  2QM1 A;  1ZBI A;  3AVH A;  4DV0 K;  4DU3 A;  3ZSX A;  3VQD A;  3OBY A;  3A0I X;  3CCJ N;  1BI4 B;  3PIO L;  1YIT N;  5CY4 A;  3BEX A;  3V1R A;  1P90 A;  2YKN A;  4JRP A;  2P9N A;  4IG3 A;  1VQ6 N;  3TAP A;  1SAZ A;  5MLC Q;  2WTU A;  1VQ9 N;  3I0S A;  3VQQ A;  4K8X A;  4OO1 J;  3G4S N;  4MLH A;  1KXP A;  2PAV A;  3AO4 A;  3E9O A;  3SMS A;  3KLI A;  3HOS A;  3HPO A;  3LDQ A;  1I94 K;  3AA2 A;  5KPZ A;  4H5V A;  1L3V A;  4CED A;  4BRF A;  2DY4 A;  4HCB A;  1L3S A;  4JAX A;  5KQ8 A;  4N41 A;  4DF8 A;  4FJJ A;  3ZSQ A;  2A40 A;  3KHY A;  4NXN K;  2RPI A;  4JN4 A;  1SL2 A;  3M3Z A;  2CGJ A;  3T19 A;  3THY B;  3OYC A;  3ZCM A;  2E20 A;  5GIN A;  1HRH A;  1QHT A;  4EFH A;  4E1J A;  1SL1 A;  4YOW A;  4ZTF A;  1Q18 A;  2HW3 A;  2F7T A;  2VG6 A;  3FFI A;  3GOI A;  4JD2 A;  4B3M K;  4N47 A;  1ATN A;  4OPJ A;  5AZJ B;  4DQ8 A;  1EWR A;  1DTQ A;  1YHQ N;  3AA5 X;  2O8E A;  4MO5 A;  4MFB A;  3ZEU B;  3TAR A;  1HYZ A;  4L3Q A;  5J2N A;  3QIO A;  2D1K A;  4FJ8 A;  1ZBH A;  3O8M A;  5F2R A;  3NMU A;  5AQL A;  3CCU N;  3MN9 A;  3K5M A;  2Q36 A;  1LAV A;  3I56 N;  3HTV A;  4CJ3 A;  3CF5 L;  3THV A;  2GWK A;  2O8F A;  1WBB A;  1C0U A;  3KLE A;  4CBX A;  3L2V A;  3V4I A;  1NKE A;  1XNQ K;  1JL2 A;  4FPA A;  4JI7 K;  3C6U A;  3CC4 N;  2G8V A;  5AQZ A;  5A2Q O;  4BC3 A;  1YXQ A;  4WQ5 C;  3SMP A;  1S9G A;  4F2S A;  1NGC A;  4WF9 L;  2X6N A;  3K57 A;  3UKR A;  3F2K A;  1RDB A;  2Z1G A;  1R59 O;  1S1V A;  4J2E A;  3U4L A;  2GUP A;  3M6G A;  3M8Q A;  5AQH A;  5C24 A;  3K58 A;  4JKC A;  3ZT4 A;  4I9Q A;  3CG7 A;  4FLY A;  4JK7 A;  2A1R A;  1O13 A;  4A57 A;  3WEE A;  4DS5 A;  4Z94 A;  4C1N K;  4PKH A;  1JJ2 M;  2E6M A;  4DTN A;  4FZY A;  3DXM B;  2CH6 A;  3IFR A;  4H0T B;  3UKU A;  3PV8 A;  1L5U A;  4OKJ A;  1A5X A;  3E01 A;  3ISN C;  1E4G T;  2Z1H A;  4IOX A;  1X9W A;  1C1A A;  3AA3 A;  1RTJ A;  1GLF O;  3AA4 A;  2E2Q A;  3AVF A;  1RTI A;  4GY2 B;  4H0Y B;  3K5L A;  5C25 A;  4B3O A;  3SQ1 A;  2P5G A;  4E89 A;  3H45 C;  1RDC A;  3OTO K;  5I3U A;  4CF2 A;  2P9S A;  4CGG A;  4O55 A;  1FKO A;  3RMA A;  3IG1 A;  3RSE B;  1NK4 A;  3P31 A;  1JLF A;  2HHS A;  4BR0 A;  2YHB A;  3LM9 A;  4M63 C;  3H3O B;  1EWQ A;  5AZI B;  4NCA A;  1QZ5 A;  3UB5 A;  3WXI A;  2GUI A;  1EXQ A;  4LFA K;  2HHT A;  3DM2 A;  5AQM A;  3SLC A;  1X1P A;  4B1V A;  4FM1 A;  3DLB A;  4OVL A;  4F3T A;  1N5Y A;  4YDU C;  3VEW A;  3R6M A;  5AQX A;  4JKB A;  1KLM A;  1G99 A;  1TYQ B;  2Q2R A;  3PX4 A;  5LJW A;  1NJW A;  2QW9 A;  4BRE A;  3VQ9 A;  5JVH L;  1JLB A;  4GKJ K;  1HMV A;  3P38 A;  2A1S A;  2YJF A;  2RE2 A;  4Z0U A;  5GAG P;  1V4S A;  4NYN A;  2PYL A;  1CXU A;  2F9T A;  1WSI A;  5I9E B;  4FM2 A;  1TK5 A;  4JI4 K;  3M8S A;  1HQU A;  4B9M A;  1X3N A;  4B9Q A;  4JI6 K;  1BIS A;  3NH2 A;  1RT6 A;  2O8C B;  1GLJ O;  4R79 A;  3LDP A;  5BR9 A;  1XC3 A;  4FW1 A;  4BAC A;  3AVM A;  1HKB A;  2FSJ A;  1RBT A;  1RBR A;  3EY1 A;  2F8T A;  4BWJ A;  3AAP A;  1VQ8 N;  1HKC A;  3KLG A;  1LV5 A;  4WQ4 A;  5CZ1 A;  1L3T A;  1SUQ A;  3TU5 A;  3HP9 A;  4A59 A;  1HPZ A;  3FR0 A;  4EP5 A;  4DFJ A;  4DTP A;  4JLH A;  4FJI A;  2Q1N A;  3WNF A;  4BR4 A;  2P9K B;  1VSJ A;  2PY5 A;  5AQV A;  3AVG A;  1JLQ A;  3VQC A;  4DWI A;  3OS0 A;  2UXD K;  5FPE A;  2VYP A;  5F0X A;  2QK9 A;  1ZBL A;  3QFP A;  4DSE A;  4FWL A;  5HRS A;  3MCP A;  4B3T K;  1CZA N;  3MMV A;  2KZM A;  1J6Z A;  2QXF A;  3MK6 A;  2BGG A;  4EHT A;  1OKJ A;  5CHI A;  3TWH A;  4H8K A;  4ILJ A;  4PKI A;  3J8A A;  4H5W A;  3WXL A;  1C0F A;  4B9S A;  3SUP A;  4G9Z A;  1KAY A;  1U47 A;  3OYA A;  5M1K A;  3R3L A;  5AQU A;  1OH6 A;  4MLE A;  2HHW A;  2A41 A;  4BE2 A;  4GW6 A;  4BVP A;  3I8B A;  1VQ7 N;  3TTD A;  1BA1 A;  4LF9 K;  3GBT A;  3TAF A;  3GL1 A;  2Q3S A;  2V7Y A;  1SKS A;  3IDH A;  3D7E O;  1VSH A;  4CFA A;  4FOI A;  4NYF A;  3THX B;  4RTF D;  1Q7Y O;  3F5T A;  3F9K A;  3NH1 A;  4CFC A;  1QQM A;  4DSK A;  4G1Q A;  1D9F A;  1QVG M;  3C6T A;  4DV1 K;  3QEV A;  4M3Z A;  1TKX A;  1WSH A;  2QTD A;  4JK9 A;  3HJF A;  2P9L B;  2XY5 A;  2VWB A;  5E84 A;  4PUO A;  3SBT A;  2QWR A;  4O0J A;  3D2F A;  1TKZ A;  3DRP A;  3ENB A;  3LP3 A;  3WXK A;  1Z25 A;  1J9A A;  3AO3 A;  1FK9 A;  4HUF A;  4JEP A;  4CEB A;  3TAB A;  1KFS A;  1IKX A;  4DR3 K;  1TUU A;  1NGJ A;  1JXB A;  1VQN N;  3P4I A;  1JCE A;  2NUB A;  4DG1 A;  3LAL A;  4PL7 A;  1B9F A;  3NVK A;  1J5O A;  4ISF A;  4E0D A;  2P9P B;  2FSN A;  3LAK A;  1TUY A;  1RNH A;  4CCH A;  4HCC A;  3ENO A;  3QIC A;  2O8D B;  3PO4 A;  1NJI O;  5FRN A;  1YAG A;  1P8Z A;  3ENH A;  4WCE L;  3U3Y A;  1QSY A;  3CCL N;  1X3M A;  3C95 A;  3AGK A;  3AVK A;  1IO2 A;  3D2E A;  4E7L A;  3MXI A;  4I6M B;  2PFU A;  4BR5 A;  1NK7 A;  2IVP A;  4IFE A;  1IG8 A;  3DI6 A;  2GX9 A;  1JL1 A;  2FBX A;  2V52 B;  2F9W A;  1FXX A;  1YVN A;  3OS1 A;  2GEM A;  3LL3 A;  2WON A;  2NRZ A;  3E66 A;  4W5T A;  3SJH A;  1NGH A;  3DLE A;  4R5P A;  4H0V B;  2ITG A;  3DWL A;  3J7A P;  1TK0 A;  1RIL A;  2BH1 A;  1K6Y A;  1WBD A;  1Z26 A;  4CZK A;  4DV6 K;  4CEQ A;  3EN9 A;  1XC9 A;  2UXC K;  4K42 A;  2QWL A;  3LP0 A;  5DMR A;  5K14 A;  4KKO A;  2JWK A;  3AGR A;  2PYJ A;  3MX5 A;  2GBZ A;  3LDN A;  2HF3 A;  5EXW A;  2YKM A;  3HPG A;  4ILH A;  4QCL A;  4CK1 A;  2G8F A;  3O5B A;  2KQ2 A;  4DFP A;  4JKH A;  3H6E A;  3SUQ A;  5KGW A;  3T1A A;  2NRX A;  3U9D A;  1WLJ A;  5AJ3 K;  2YHY A;  4FK4 A;  3RVC A;  4DU4 A;  2Q0U A;  4C8M A;  1HYV A;  3J81 O;  1TKD A;  5BR8 K;  3V9X A;  3KIO A;  1DKG D;  2R7Y A;  4DTR A;  2IDO A;  3VER A;  3NF8 A;  4A62 A;  5BN8 A;  3SYZ A;  5FRO A;  1WN7 A;  4JKA A;  3ULE B;  1S1U A;  3CCS N;  2E8A A;  1IKW A;  2RN2 A;  3EL2 A;  3U3G A;  4CEF A;  4AM7 A;  3T1H K;  3FZL A;  4EAH D;  4QS7 A;  1NMD A;  4GV6 A;  5FDL A;  4CIG A;  4PKG A;  3LZJ A;  4IJN A;  1CXQ A;  1DT9 A;  1Q9Y A;  1I3A A;  3FZK A;  3HPH A;  1NGF A;  4FM0 A;  4HWI A;  1T3V A;  5KTQ A;  4FJN A;  3L3U A;  1UAX A;  4W5Q A;  1O1W A;  3SPZ A;  4DSL A;  2E2P A;  3KKR A;  5LMU K;  3HVT A;  1N6Q A;  4DQQ A;  4CD3 A;  3UIQ A;  3RMC A;  4C1N I;  1NNE A;  4KHQ A;  4LF8 K;  2KLA A;  4OGE A;  1UA0 A;  4CBU A;  5IWA K;  3C6H A;  3KTQ A;  3CM5 A;  1NGB A;  2WFB A;  3CJA A;  1MDU B;  2Z1I A;  1X9M A;  5EOY A;  4FJG A;  1N36 K;  2FBY A;  4O0I A;  1ITG A;  1CZ9 A;  1A5W A;  3EE8 A;  3SNN A;  1CZB A;  3AVN A;  1HNV A;  2OPR A;  3ZSR A;  2A5X A;  4O44 A;  2DFH A;  2HBK A;  2KFZ A;  4H03 B;  4KHY A;  4FJK A;  5M1F A;  4OLB A;  3TR8 A;  1HJR A;  4CGF A;  2KKZ A;  3VGL A;  1BO5 O;  4OPA A;  1LW2 A;  4KTW A;  3K5N A;  4JS4 A;  4BRH A;  1HKG A;  1BCM A;  4LF6 K;  2NLX A;  1TKT A;  4CEC A;  4DLE A;  4DSI A;  3VTH A;  2P9U A;  3A5N C;  4Z4C A;  4A2B A;  4E7K A;  2YJE A;  1YT3 A;  1ATR A;  2YCH A;  3AVB A;  2O8B A;  5DM7 L;  1HX1 A;  2HBJ A;  1NK8 A;  1SKR A;  4MQ3 A;  3L2W A;  3HXM A;  1GLC G;  5C12 A;  4O8K A;  3QLH A;  3R9P A;  3C0B A;  2I7P A;  4BRN A;  3THW A;  4IDK A;  1ASV A;  3OJU A;  1WSE A;  2HB5 A;  2H3G X;  5C42 A;  5HOO A;  1XNR K;  3ID6 A;  1QQC A;  3KZB A;  4O8U A;  3AAR A;  4FJH A;  4LD0 A;  4CFB A;  3L2R A;  1QSL A;  4CHZ A;  3AVI A;  3M8R A;  5JLF A;  4K43 A;  1HQE A;  2QWP A;  3ZET A;  2YHW A;  4IO9 L;  1KTQ A;  2P51 A;  4JKE A;  1DGK N;  3KWI A;  5KGX A;  3JSM A;  4HUE A;  4CVN E;  3G10 A;  1R0A A;  3DJC A;  1Q82 O;  2X6S A;  2BDP A;  1BI4 A;  2X74 A;  2HMI A;  1NJX A;  4U67 L;  3KLH A;  1OVY A;  1S6P A;  2ETJ A;  4RW6 A;  2D4W A;  4KH5 A;  1J54 A;  5FLX O;  4H4M A;  4B08 A;  4CGJ A;  3L8B A;  3O80 A;  4W5R A;  4KH4 A;  3WNE A;  1RBU A;  3O9S A;  3ZSW A;  4FZZ A;  4FPB A;  4NLC A;  3O9Q A;  4IOA L;  3DLK A;  3TPQ A;  3DXK B;  4RWT A;  1N34 K;  3QO9 A;  1XQS C;  3AVJ A;  3CQX A;  1XWL A;  3KD5 E;  4CK2 A;  1BL3 A;  5HRN A;  3KK1 A;  4DU1 A;  4NCB A;  4CI6 A;  4DQS A;  1JLE A;  5LMN K;  3ATU A;  3THY A;  3LDL A;  1H1V A;  4YFU A;  2CH5 A;  5GIP A;  3CPE A;  1TAQ A;  3QFU A;  2ZE2 A;  3CJ9 A;  1HR0 K;  1HUX A;  4B9L A;  1OVQ A;  4AHV A;  1RBV A;  5AZJ A;  4CJP A;  3V6D A;  2V51 B;  1ZC6 A;  4N5S A;  3BP8 A;  3ZEU A;  2Q97 A;  3ZSY A;  1S1T A;  2EWS A;  1C1B A;  3NHG A;  2YV0 X;  5GIO A;  3BDP A;  4I2Q A;  1K8K B;  4B9T A;  4A5A A;  3MWT A;  4CJV A;  4KTQ A;  3HZ6 A;  4BDP A;  1HNW K;  3L3V A;  3WNH A;  3HBT A;  2UU9 K;  2NRV A;  1RT3 A;  1YTU A;  2HBM A;  2YNF A;  4QOZ B;  2YNH A;  4CD1 A;  3HYF A;  3SPY A;  5AQT A;  4OLA A;  5BRD A;  4E1M A;  3LZI A;  1VQM N;  2OZS A;  4DV5 K;  1IH7 A;  3CIP A;  4EZ6 A;  3AVL A;  4LF5 K;  4QS9 A;  3WQU A;  4CHP A;  2YNG A;  3HRG A;  1JKH A;  4CF8 A;  3E9P A;  1HNI A;  4TSX A;  4Y1D A;  3CCM N;  3IRX A;  3CQY A;  2P1J A;  3MN7 A;  1K8K A;  2NZT A;  3T3F A;  2P5O A;  2ASM A;  4CZH A;  1T6C A;  3RR7 A;  3LM2 A;  5AFU H;  3CJ7 A;  4KO0 A;  4JV5 K;  3TAG A;  3RRG A;  4MDA A;  2RHK A;  3DXM A;  4CW7 B;  2VWK A;  4BRL A;  3VEX A;  3D6R A;  3OYB A;  2F8S A;  3CHW A;  5T7B A;  2OZM A;  1JLA A;  4ICL A;  1T8E A;  4IFV A;  4DSJ A;  1ZXO A;  2HF4 A;  5D3G A;  2OTJ N;  3OYI A;  1BCO A;  1U49 A;  3BF3 A;  2XHB A;  2FF3 B;  3MEG A;  5HBM A;  2QKB A;  1WB9 A;  3V1O A;  3M8P A;  3ULD A;  3FZF A;  2RF2 A;  5CR4 A;  2F96 A;  4DR5 K;  1S1W A;  5AQK A;  1X9S A;  2Y1I A;  2ZGY A;  4BRI A;  2QA4 N;  3DLG A;  1GOB A;  4CZE A;  1N32 K;  1NK0 A;  1BA0 A;  4CJ5 A;  4KTZ A;  4YOU A;  3RSE A;  1I39 A;  2KZZ A;  1NKC A;  4BY9 C;  4FO0 A;  3KKS A;  3OYM A;  4CEO A;  4DUY K;  1KSP A;  5AZI A;  3SQ2 A;  5M1P A;  2HNZ A;  4WE1 A;  4CER A;  3S9H A;  4EHU A;  2ZF5 O;  2QEX N;  3RR8 A;  3ZT2 A;  5SZT A;  3ZSZ A;  3Q7C A;  4BR7 A;  3K5O A;  4A5B A;  4YOV A;  1XMO K;  3CCV N;  2IIR A;  3DRR A;  4E19 A;  3MWP A;  2CGL A;  1EP4 A;  5EVZ A;  3S41 A;  1YJN N;  2GV9 A;  1K9M O;  5KI6 A;  1TYQ A;  5SWM A;  1HNX K;  4B1U B;  3TAE A;  1J53 A;  3GDQ A;  3O4W A;  2GWJ A;  4JRQ A;  3CYM A;  3DAW A;  3NBP A;  2LSN A;  4H0P A;  2E5L K;  4F2R A;  3SZ2 A;  2OTL N;  4IOC L;  4AHT A;  1U04 A;  1VQ4 N;  4PL8 A;  1NOY A;  3DLH A;  1HYS A;  3VQA A;  5BN9 A;  5ADX H;  1RCH A;  4DTX A;  3LPU A;  3CPW M;  4J2B A;  4FJM A;  2W6K A;  4OJR A;  4W5O A;  4B9N A;  3B6O A;  5BRH A;  3OYN A;  4FLU A;  2HST A;  4JKD A;  1ZYQ A;  4DR2 K;  5KRT A;  3AO5 A;  3V9W A;  4JS5 A;  1ZBF A;  2O8C A;  1BG3 A;  4ELT A;  3CFR A;  3VN5 A;  3MDQ A;  3SJJ A;  4FWO A;  1QSS A;  1KD1 O;  4IDH A;  4BWM A;  3ZT1 A;  1IBM K;  1VAZ A;  3EZ5 A;  3FZH A;  4BRG A;  4M41 A;  5BPL A;  3AY9 A;  3OYL A;  4A61 A;  4NB4 A;  3V9S A;  4J8F A;  5FPN A;  3V9U A;  3MX2 A;  1QZ6 A;  1WSF A;  1DLO A;  3GE1 A;  5AQG A;  3QBX A;  4H0X B;  1KAX A;  4FLZ A;  3NDK A;  4ZTJ A;  3ASM A;  3QET A;  4RCH A;  2P9K A;  3RWU A;  4KI6 A;  1GLL O;  1W97 L;  2CGK A;  4X65 K;  1WSG A;  3SQ4 A;  1OH7 A;  2BE2 A;  4GV9 A;  1QS4 A;  1BOT O;  1M1K O;  4X64 K;  4F3O A;  4B9U A;  3OYK A;  3CER A;  3F9M A;  4M45 A;  3IS9 A;  1K73 O;  1YF5 L;  4FXD A;  4K25 A;  1TAU A;  3L4I A;  1VRT A;  3TAM A;  5JS1 A;  3ZT0 A;  4B1X B;  3AAQ A;  3H3N O;  5BPM A;  1VSE A;  4CJL A;  1BU6 O;  1BWF O;  3VA3 A;  4M3W A;  3B6P A;  2E1Y A;  1VQL N;  4Z4G A;  5LL6 Z;  5ELZ A;  1KCF A;  4DR7 K;  1LAW A;  1RGI A;  4FWM A;  3PIP L;  3PO5 A;  4OPH A;  3NCI A;  4BRK A;  3C7N B;  3D0P A;  4M3Y A;  4C8O A;  4BE1 A;  1NJY A;  3MEC A;  3THX A;  5C10 A;  2I7N A;  3ZSO A;  5TKY A;  4C8K A;  4JI2 K;  4C23 A;  4PY5 A;  4L8R B;  5LY3 A;  3U6F A;  3NGZ A;  5AQI A;  3HT3 A;  1X9J A;  2GTD A;  2E2O A;  1N33 K;  3EEQ A;  4BGB A;  4DLG A;  1VSF A;  2P9L A;  1S22 A;  2IC3 A;  2YHA A;  5J2M A;  2P9I B;  4KHU A;  2VQF K;  4E7J A;  4V19 S;  4GMJ B;  4AHS A;  2Q31 A;  4Q5V A;  1HNZ K;  3B8A X;  3J80 O;  1ASU A;  1RFQ A;  3K2P A;  3CXC M;  3BZK A;  4H4O A;  2ITM A;  3O3H A;  4EZ9 A;  4DQI A;  4BDY A;  2P9P A;  4B8C A;  4N76 A;  3O4N A;  1KC8 O;  4X62 K;  4KRE A;  4DV2 K;  3HM9 A;  3H46 O;  4DTU A;  2O8D A;  2VWJ A;  4MDB A;  2VGM A;  3OYJ A;  4RW4 A;  4DB3 A;  1IBK K;  3QES A;  2AP1 A;  4FL9 A;  3HK2 A;  4H5R A;  1S72 N;  3VEN A;  4LH4 A;  3BZC A;  2OCE A;  1Y64 A;  1NMN A;  1YIJ N;  3CQ8 A;  4IKF A;  3AO1 A;  1E3M A;  3VF6 A;  5KPR A;  3O9T A;  2ZQB A;  4I6M A;  4WQ5 A;  4B8A B;  4KHS A;  5FPM A;  1Z05 A;  1GLE G;  4IXC A;  2A42 A;  4BC2 A;  5EX5 A;  4I2P A;  3C94 A;  4M3X A;  1EQY A;  4J2A A;  3HSC A;  5JLH A;  1A5V A; 
#chains in the Genus database with same CATH homology
 3LP2 A;  3SQ0 A;  2HVH A;  2Z1J A;  1NK6 A;  4IG0 A;  3L2R A;  2RKI A;  4CHZ A;  1QSL A;  3AVI A;  4KHN A;  1MU2 A;  2D0A A;  3M8R A;  1RDC A;  3CM6 A;  5I3U A;  4CF2 A;  2EX3 A;  2D0C A;  1ASW A;  4FCY A;  1HQE A;  2IS3 A;  1VSL A;  4CGG A;  4CIF A;  4CEE A;  1D9D A;  4O55 A;  1FKO A;  1KTQ A;  3RMA A;  3IG1 A;  2P51 A;  3VQ6 A;  1TVR A;  1NK4 A;  4CF1 A;  1JLF A;  4CJF A;  3TAQ A;  2XY6 A;  4Z4E A;  2HHS A;  1Q8I A;  2YHB A;  4HVJ A;  5KGX A;  4HUE A;  3JSM A;  3HO1 A;  1JLC A;  1F21 A;  2E4L A;  4NCA A;  4PQU A;  1B92 A;  3G10 A;  1R0A A;  3CFP A;  4N56 A;  2X6S A;  2BDP A;  1BI4 A;  3I8D A;  5HLF A;  2GUI A;  2X74 A;  1EXQ A;  2HMI A;  1NJX A;  4C8L A;  4DS4 A;  2HVI A;  2HHT A;  3KLH A;  2ETJ A;  1S6P A;  4RW6 A;  3NF6 A;  3QEI A;  1WAJ A;  3DM2 A;  1T05 A;  1X1P A;  4FM1 A;  3DLB A;  4FJ7 A;  1C0M A;  4OVL A;  4F3T A;  1N5Y A;  1J54 A;  2X78 A;  5J2P A;  4FK2 A;  4H4M A;  4B08 A;  4CGJ A;  5FRM A;  3I0R A;  4CJW A;  1Q9X A;  3L8B A;  4CJQ A;  1KLM A;  4KHW A;  4W5R A;  1CLQ A;  5I42 A;  3S3M A;  3PX6 A;  2ATQ A;  3WNE A;  3PX4 A;  1LW0 A;  3A2F A;  1RBU A;  3ZSW A;  3ZSV A;  2KFN A;  2XY7 A;  4FZZ A;  3S3O A;  2FBV A;  3KD1 E;  3EYZ A;  1NJW A;  2HHX A;  2WOM A;  3DLK A;  1G15 A;  1D5A A;  3VQ9 A;  4FK0 A;  3QIN A;  1JLB A;  1IKV A;  5HRR A;  1RBS A;  1HMV A;  1SKW A;  3NE6 A;  2A1S A;  5EU7 A;  4Z0U A;  3KLF A;  3JYT A;  4BDZ A;  3QO9 A;  1D8Y A;  2E6L A;  3AVJ A;  3MEE A;  4NYN A;  1EET A;  1XWL A;  4O4G A;  2PYL A;  4CK2 A;  5KRS A;  1CXU A;  1BL3 A;  3KD5 E;  5HRN A;  3KK1 A;  1WSI A;  3AO2 A;  4FM2 A;  5HRO A;  1TK5 A;  4DU1 A;  3SCX A;  4NCB A;  3NGI A;  3M8S A;  4FLX A;  4DQS A;  1HQU A;  2O4G A;  4M42 A;  4QAG A;  3KK3 A;  4CHN A;  1JLE A;  4B9M A;  4DTJ A;  4YFU A;  4KPY A;  1BIS A;  3NH2 A;  1RT6 A;  1TAQ A;  4I9L A;  3VQ7 A;  4YNQ A;  2ZE2 A;  3VQE A;  3SV4 A;  1TV6 A;  2Y1J A;  3O3F A;  4CJU A;  1XI1 A;  4B9L A;  3LAN A;  4FW1 A;  4BAC A;  4AHV A;  1VSM A;  3AVM A;  1KFD A;  1JXE A;  4RW8 A;  1RBT A;  2HNY A;  1RBR A;  3RMD A;  3HST B;  3EY1 A;  2EHG A;  1RBV A;  1KRP A;  2F8T A;  1C1C A;  4CJP A;  3NFA A;  4E1N A;  4BWJ A;  3V6D A;  3VQP A;  4CGI A;  4N5S A;  4M3U A;  3V81 A;  4ELU A;  3KLG A;  1LV5 A;  4FZX C;  1L3U A;  1RDA A;  3ZSY A;  1S1T A;  5CZ1 A;  1C1B A;  4CF9 A;  1L3T A;  3NHG A;  2YV0 X;  1SUQ A;  3PY8 A;  3BDP A;  3MAQ A;  4CGH A;  4I2Q A;  3HP9 A;  4B9T A;  1KLN A;  1HPZ A;  5CZ2 A;  4EP5 A;  4DFJ A;  1RT7 A;  2FC0 A;  4JLH A;  4DTP A;  4FJI A;  4DF4 A;  3SUO A;  3WNF A;  4FYD A;  1VSJ A;  3ALY A;  1ZBU A;  1UWB A;  1C0T A;  4CJV A;  4CJK A;  3SUN A;  2PY5 A;  4KTQ A;  4AH9 A;  3KK2 A;  3AVG A;  1RT4 A;  1U48 A;  1JLQ A;  1S5J A;  2G8U A;  3VQC A;  4E7I A;  3AVA A;  4DWI A;  3OS0 A;  4BDP A;  1LWC A;  3L3V A;  3ZT3 A;  3WNH A;  1UA1 A;  1SV5 A;  3PX0 A;  2QK9 A;  1RT3 A;  1YTU A;  3QEP A;  1ZBL A;  2YNF A;  4FLW A;  4QOZ B;  2DFE A;  2YNH A;  4FW2 A;  4DSE A;  1XHX A;  5HRS A;  1NOZ A;  3HVR A;  2AJQ A;  3HYF A;  3SPY A;  4OLA A;  2KZM A;  2QXF A;  4E1M A;  3LZI A;  2BGG A;  4CK3 A;  2OZS A;  2IGI A;  1IH7 A;  3TWH A;  3OS2 A;  3VQ8 A;  3LAM A;  4H8K A;  4EZ6 A;  1NJZ A;  2VG7 A;  3AVL A;  3ITH A;  3DYA A;  1S9E A;  4CHP A;  3NH0 A;  1RDD A;  2YNG A;  2DTU A;  4B9S A;  1YTA A;  3SUP A;  1JKH A;  4CF8 A;  1RTD A;  1HNI A;  2JGU A;  1U47 A;  4TSX A;  4Y1D A;  1VK0 A;  3OYA A;  1RT2 A;  4FJL A;  3IRX A;  4FJ5 A;  2HHW A;  4BE2 A;  2P1J A;  4GW6 A;  5J2Q A;  4F4K A;  4AIL C;  3T3F A;  1VRU A;  4HTU A;  4LSN A;  2P5O A;  2OPP A;  3AV9 A;  4ID5 A;  4CES A;  3TAF A;  2ZD1 A;  3PUF A;  4IBN A;  3RR7 A;  2Q3S A;  1YVU A;  1SKS A;  4KO0 A;  3DOK A;  3HP6 A;  4KB1 A;  1EKE A;  1VSH A;  3TAG A;  3RRG A;  4CFA A;  4CHY A;  4NYF A;  3QNO A;  2VWK A;  3OVN A;  1NKB A;  3F9K A;  3OYF A;  3NH1 A;  2FBT A;  4M3R A;  4CFC A;  3OYB A;  3V1Q A;  4DSK A;  4G1Q A;  3QEX A;  4B9V A;  2F8S A;  1D9F A;  4PWD A;  3C6T A;  3VQB A;  4CFD A;  4Z4H A;  5T7B A;  1W9H A;  2YNI A;  1T7P A;  2OZM A;  1JLA A;  4ICL A;  1T8E A;  3QEV A;  4IFV A;  1WAF A;  4DSJ A;  4M3Z A;  5D3G A;  2IAJ A;  1TKX A;  1WSH A;  1BCO A;  3OYH A;  3OYI A;  1U49 A;  2XHB A;  1JLG A;  3MEG A;  5HBM A;  2QKB A;  3HJF A;  3G0Z A;  3V1O A;  4CJT A;  2XY5 A;  4DSF A;  3SI6 A;  4B3O A;  2B4J A;  3M8P A;  3ULD A;  4PUO A;  2RF2 A;  4O0J A;  2F96 A;  1TKZ A;  4RG8 A;  3DRP A;  1S1W A;  3LP3 A;  4E89 A;  1Z25 A;  2OA8 A;  1X9S A;  1J9A A;  2I5J A;  1FK9 A;  3AO3 A;  4HUF A;  2Y1I A;  2XRI A;  4CEB A;  3DLG A;  1KVC A;  1GOB A;  5E41 A;  4AHU A;  1IKX A;  3TAB A;  1KFS A;  3KJV A;  4LH5 A;  1NK0 A;  4OKK A;  4CJ5 A;  4KTZ A;  3L2Q A;  1JXB A;  2G8H A;  3HL8 A;  4ZHR A;  1I39 A;  2NUB A;  4DG1 A;  3LDS A;  2KZZ A;  3LAL A;  1NKC A;  1B9F A;  4Z4F A;  3KKS A;  3OY9 A;  1J5O A;  3OYM A;  2G8I A;  4CEO A;  4E0D A;  4KAZ A;  1KSP A;  3SQ2 A;  4DTO A;  2HNZ A;  4WE1 A;  4CER A;  3S9H A;  1B9D A;  3LAK A;  1RNH A;  4RW9 A;  4FLT A;  1NK5 A;  4EP4 A;  4CCH A;  3RR8 A;  4HCC A;  3VQ5 A;  3WNG A;  1FKP A;  4DFK A;  3NF9 A;  3ZT2 A;  5SZT A;  1TGO A;  3ZSZ A;  4FLV A;  3K5O A;  4NCG A;  1LWF A;  5J1E A;  3OYG A;  3PO4 A;  2KTQ A;  3DRR A;  2QKK A;  4E19 A;  4F8R A;  5FRN A;  2HHQ A;  4KV8 A;  3O4Q A;  1EP4 A;  2PZS A;  2HHU A;  3DMJ A;  2GV9 A;  1BQN A;  2OPS A;  3U3Y A;  1QSY A;  3C95 A;  1DTT A;  5KI6 A;  1WSJ A;  5SWM A;  4LY7 A;  3VA0 A;  2BAN A;  3D45 A;  3AVK A;  3TAE A;  1J53 A;  4Q0B A;  1IO2 A;  3DOL A;  4DTS A;  4JRQ A;  4E7L A;  3MXI A;  3CYM A;  3NBP A;  1TL1 A;  1SL0 A;  2KW4 A;  2LSN A;  4HHT A;  1NK7 A;  4F2R A;  4Z4I A;  3SZ2 A;  4K8Z A;  3CFO A;  3DI6 A;  4CJE A;  3LPT A;  3OJS A;  1GOC A;  3K59 A;  4DFM A;  1JL1 A;  2FBX A;  3RRH A;  4OGC A;  1FXX A;  3LP1 A;  3MED A;  4AHR A;  2B6A A;  4AHT A;  1U04 A;  3OS1 A;  4CJS A;  2DFF A;  1NOY A;  4ID1 A;  3DLH A;  1HYS A;  5DK5 A;  3RMB A;  2WON A;  3P5J A;  3VQA A;  2JLE A;  4W5T A;  1RCH A;  4DTX A;  3LPU A;  3MXM A;  3QNN A;  3S3N A;  4J2B A;  1RT1 A;  4CEA A;  4ELV A;  4FJM A;  2HHV A;  4OJR A;  4W5O A;  3NAE A;  4B9N A;  4DMN A;  1VSD A;  3DLE A;  4R5P A;  3B6O A;  2ITG A;  4UQG A;  1QTM A;  3OYN A;  1U4B A;  3TAN A;  1T03 A;  4FLU A;  1RIL A;  1TK0 A;  3VQ4 A;  4KB0 A;  1K6Y A;  3LWM A;  1Y97 A;  4E7H A;  1S1X A;  4IFY A;  4CHO A;  1Z26 A;  1ZYQ A;  5KRT A;  3AO5 A;  3QIP A;  4CEQ A;  4OKE A;  1WNS A;  3NF7 A;  3V9W A;  4JS5 A;  1ZBF A;  1XC9 A;  1TK8 A;  1BQM A;  4C8N A;  4CIE A;  4ELT A;  3LP0 A;  5DMR A;  3CFR A;  3TI0 A;  1RT5 A;  5K14 A;  3VN5 A;  4KKO A;  3SV3 A;  3SJJ A;  1TL3 A;  2G8W A;  1QSS A;  2O4I A;  4CJR A;  2IOC A;  3OYE A;  2PYJ A;  1ZBI A;  1KVA A;  3AVH A;  4BWM A;  4DU3 A;  2GBZ A;  3ZT1 A;  3ZSX A;  3VQD A;  2YKM A;  3HPG A;  4QCL A;  4CK1 A;  3EZ5 A;  1BI4 B;  4DTM A;  2G8F A;  4M41 A;  2KQ2 A;  4DFP A;  3OYL A;  5CY4 A;  3V9S A;  3SUQ A;  3V9U A;  5KGW A;  3T1A A;  3V1R A;  4JRP A;  2YKN A;  1EX4 A;  4KFB A;  1WLJ A;  4IG3 A;  1WSF A;  3TAP A;  4FK4 A;  1DLO A;  4DU4 A;  3IAY A;  4C8M A;  1BHL A;  1HYV A;  4FLZ A;  3NDK A;  4ZTJ A;  1TKD A;  3ASM A;  3I0S A;  3V9X A;  3VQQ A;  3KIO A;  4XIU A;  2R7Y A;  4DTR A;  1IKY A;  3QET A;  3RWU A;  4KI6 A;  4K8X A;  2IDO A;  3OYD A;  3NF8 A;  3V9Z A;  3SYZ A;  5HP1 A;  5FRO A;  1WN7 A;  3AO4 A;  1REV A;  3H08 A;  1S1U A;  3KLI A;  2OPQ A;  3HPO A;  1WSG A;  1C6V A;  3SQ4 A;  1IKW A;  2RN2 A;  4AHC A;  3U3G A;  2BE2 A;  3AA2 A;  4CEF A;  1QS4 A;  1L3V A;  2W42 A;  4CED A;  5FDL A;  4O5B A;  5HRP A;  2DY4 A;  4F3O A;  4CIG A;  4HCB A;  1L3S A;  4CFB A;  3P83 D;  4B9U A;  3OYK A;  3LZJ A;  4M45 A;  3IS9 A;  2D0B A;  4N41 A;  1CXQ A;  4DF8 A;  4FJJ A;  3ZSQ A;  4FXD A;  1Q9Y A;  1I3A A;  1TAU A;  1VRT A;  2RPI A;  3HPH A;  3TAM A;  4FM0 A;  5KTQ A;  1SL2 A;  4FJN A;  5JS1 A;  3L3U A;  1UAX A;  4W5Q A;  3ZT0 A;  1O1W A;  4GVM A;  3SPZ A;  4HUG A;  4DSL A;  2B5J A;  3KKR A;  3T19 A;  1S6Q A;  1VSE A;  4CJL A;  3HVT A;  3OYC A;  2HND A;  2XO7 A;  4DQQ A;  1N6Q A;  3VA3 A;  3UIQ A;  3B6P A;  3L2U A;  3ZCM A;  3RMC A;  4M3W A;  4Z4G A;  1HRH A;  1QHT A;  4CGD A;  3O3G A;  2D5R A;  1KCF A;  2OYQ A;  1SL1 A;  2XY8 A;  4KHQ A;  1LAW A;  4ZTF A;  3PO5 A;  5JS2 A;  3NCI A;  2HW3 A;  1W0H A;  2VG6 A;  4OGE A;  3FFI A;  4N47 A;  1UA0 A;  3KTQ A;  3D0P A;  4M3Y A;  3CM5 A;  4OPJ A;  4C8O A;  1XHZ A;  4BE1 A;  1NJY A;  1DTQ A;  3MEC A;  2Z1I A;  1X9M A;  4J2D A;  3AA5 X;  3ZSO A;  4C8K A;  4MFB A;  4DQP A;  3F73 A;  2VG5 A;  4FJG A;  3TAR A;  1HYZ A;  1BGX T;  2FBY A;  4O0I A;  5J2N A;  3QIO A;  4RW7 A;  5CYQ A;  1ITG A;  4CE9 A;  4E3S A;  4FJ8 A;  4PY5 A;  4L8R B;  1ZBH A;  3DLR A;  1CZ9 A;  3U6F A;  1A5W A;  4I7F A;  4LSL A;  3SNN A;  3NGZ A;  3HT3 A;  1IG9 A;  1CZB A;  3K5M A;  3QER A;  3AVN A;  1HNV A;  2OPR A;  3NGY A;  3ZSR A;  4DLG A;  3DRS A;  1VSF A;  1VSK A;  4O44 A;  2DFH A;  1LAV A;  2KFZ A;  4KHY A;  2IC3 A;  4CJ3 A;  3THV A;  4FJK A;  4OLB A;  4OPK A;  2YHA A;  3TR8 A;  5J2M A;  1C0U A;  1HJR A;  3KLE A;  4CGF A;  4KHU A;  4CF0 A;  3L2V A;  3V4I A;  1NKE A;  4E7J A;  1JL2 A;  3C6U A;  1LW2 A;  2G8V A;  4GMJ B;  4AHS A;  4KTW A;  4Q5V A;  4BE0 A;  3K5N A;  4JS4 A;  1KVB A;  3BGR A;  4KI4 A;  1S9G A;  4F2S A;  1ASU A;  1BCM A;  2X6N A;  3K2P A;  3K57 A;  3LWL A;  1TKT A;  4CEC A;  4DLE A;  4DSI A;  1RDB A;  4H4O A;  2Z1G A;  1BIU A;  3O3H A;  4EZ9 A;  4DQI A;  4BDY A;  1S1V A;  4J2E A;  4Z4C A;  1GOA A;  3QEW A;  1VSI A;  4B8C A;  4CJ4 A;  3M8Q A;  4E7K A;  4N76 A;  1YT3 A;  5C24 A;  3O4N A;  3K58 A;  2G8K A;  4W5N A;  3ZT4 A;  3AVB A;  4KRE A;  4I9Q A;  4Y1C A;  3CG7 A;  4FLY A;  5CYM A;  3RTV A;  3HM9 A;  1NK8 A;  1SKR A;  4DTU A;  4MQ3 A;  3L2W A;  3HXM A;  2A1R A;  4M3T A;  2VWJ A;  1QE1 A;  4DS5 A;  4CEZ A;  3MXJ A;  3QLH A;  2E6M A;  4RW4 A;  3OYJ A;  4DTN A;  4PA1 A;  3QES A;  3HK2 A;  3AVC A;  1RTH A;  1LWE A;  4FZY A;  4LH4 A;  3CQ8 A;  4IKF A;  4KRF A;  4DQR A;  3AO1 A;  3PV8 A;  1BIZ A;  1L5U A;  2ZQB A;  4OKJ A;  1A5X A;  4IDK A;  1ASV A;  3E01 A;  4B8A B;  3OJU A;  1WSE A;  2HB5 A;  4KHS A;  3ISN C;  2Z1H A;  3P1G A;  1X9W A;  1C1A A;  1UOC A;  5C42 A;  1NK9 A;  3AA3 A;  1RTJ A;  3AA4 A;  1U45 A;  1QQC A;  1RTI A;  3AVF A;  4FVM A;  4I2P A;  3K5L A;  3C94 A;  4FJ9 A;  4FJX A;  4J2A A;  4CHQ A;  5C25 A;  4FJH A;  4M3X A;  3SQ1 A;  4LD0 A;  2P5G A;  1A5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...