2G8IA

B. halodurans rnase h catalytic domain d192n mutant in complex with mn2+ and rna/dna hybrid (non-p nick at the active site)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
134
structure length
134
Chain Sequence
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKANYGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*UP*CP*GP*AP*CP*A)-3'
publication title Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
total genus 39
structure length 134
sequence length 134
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2g8iA00
1BIUA 3AVKA 2HVIA 2ITGA 1IG9A 3THVA 4NYFA 3V1OA 2HW3A 2ZE2A 1BL3A 3E01A 2G8FA 1BCOA 1WSGA 4OGCA 5CY4A 4CJEA 5I3UA 3TARA 3KLFA 4B8CA 3S3OA 4CJVA 3VQPA 3U3GA 5J1EA 4W5QA 4JRPA 2IC3A 3TWHA 2HHSA 4C8OA 4ID5A 5JS2A 1QSYA 4B9UA 2OA8A 1QTMA 4FCYA 2RF2A 1J5OA 3KD1E 4IG0A 4GW6A 2HB5A 4DTSA 1QSSA 4ZTFA 5J2PA 3CFOA 3LP3A 4CJPA 5C42A 4F3OA 4I9LA 3QEVA 4PQUA 3TAEA 4ICLA 3D45A 3T1AA 1TKTA 1ZBIA 4AHVA 1EX4A 2YHBA 3RMAA 1CZ9A 1WSIA 3PX0A 3NGZA 3PY8A 5FDLA 4B9VA 3VA3A 5HRRA 3WNHA 3SZ2A 2IS3A 1QHTA 1JLCA 1DTQA 2IDOA 3M8PA 1ASVA 3AV9A 1J53A 3AVNA 4OKJA 1LAVA 3RMBA 4N56A 2RKIA 4DU3A 4DTXA 1ZYQA 4OJRA 1VSDA 4GMJB 1SKWA 2OZMA 4Z4IA 4CJ5A 3LPUA 4OLBA 5J2QA 3K58A 4DFMA 2X78A 3QIPA 4FJXA 4B3OA 4DSLA 2HNYA 4CF9A 3MECA 1KCFA 4AHTA 1JXEA 4I7FA 5KI6A 2BDPA 2XHBA 4B9NA 4J2BA 4E1MA 3TAQA 2AJQA 3SPZA 1NK9A 4OGEA 2YHAA 1QQCA 1WSHA 3V9ZA 1QSLA 1IO2A 1HQUA 2OYQA 4FJMA 2D0AA 1RTIA 3OS1A 3MXIA 2RPIA 1U45A 3NGYA 3NF6A 1O1WA 1FXXA 2W42A 3V9XA 4CFDA 1HYZA 4FJJA 4N5SA 1JKHA 5I42A 1CLQA 2X6NA 4KKOA 4CJWA 1RT5A 3DLBA 5HLFA 4FJHA 3AVHA 4CJLA 4GVMA 3C6TA 4CJTA 4BDPA 3AA4A 2HHWA 2OPSA 3G0ZA 1NJXA 3L3VA 1C0TA 5K14A 3L2VA 1A5XA 2HHQA 3PX6A 4CF2A 1X1PA 3CG7A 3NH1A 3L8BA 3KD5E 3LWLA 5HRNA 2YKMA 3S9HA 3AO5A 1RTDA 2NUBA 3F9KA 3LDSA 2I5JA 1W9HA 3AVJA 1C1AA 1GOCA 1S1XA 2D0CA 4IG3A 4HUFA 3HL8A 3RTVA 4ZHRA 1DTTA 5KGWA 1XHXA 4E7HA 5CZ2A 1TKDA 3M8RA 3SNNA 4HHTA 1UA1A 4FLUA 2KZMA 3MXJA 3K57A 4DTPA 1BI4B 3IAYA 1WLJA 2YV0X 3AO4A 1TAQA 4OPKA 1S1UA 3OJSA 4FJLA 3KK2A 2FC0A 4CEZA 1TGOA 3LP0A 3NF8A 3OYKA 4DU4A 3DOKA 2X74A 4LH5A 3TAFA 4AH9A 2IAJA 3AVBA 2ATQA 4BE1A 4PY5A 3AO1A 3VQDA 4AHCA 3PO4A 3K5NA 1NJYA 1L5UA 4IFVA 1KRPA 3ITHA 2VG6A 1RCHA 1T05A 4KI4A 4K8XA 2HNZA 3DLHA 1GOBA 4CEFA 4RW6A 1TKXA 3I0RA 3EYZA 3O4QA 3KLGA 1HJRA 4W5TA 1RDBA 4KB0A 3VQ5A 1WSJA 4AHSA 4KO0A 4BE0A 3HJFA 3OYLA 3FFIA 1SL1A 4CF1A 2ZQBA 3AO2A 3RR8A 1U04A 1F21A 5HROA 1S1TA 4HCBA 4L8RB 2BANA 2XY5A 4FM1A 4I9QA 2KTQA 2OPQA 3NFAA 2GUIA 3ALYA 5SZTA 3DRRA 1ASUA 4Q5VA 2VG7A 2VWJA 3QNOA 4HCCA 4FK4A 3EZ5A 2KZZA 2IOCA 1YT3A 3BGRA 3CQ8A 2QKKA 1KVAA 3ZT2A 3DLGA 4DQSA 4FJGA 3IRXA 1EXQA 3OYEA 3PO5A 3OYJA 4CHNA 2WONA 3ASMA 3HP6A 3SYZA 1TKZA 2E4LA 4CCHA 4FZXC 4M3UA 2DTUA 3D0PA 3KK3A 3L2UA 2VWKA 3AA5X 4BE2A 4CJFA 2B4JA 3L2RA 3G10A 1HPZA 1SV5A 4DTJA 3VQBA 3LZIA 4DU1A 4PUOA 4OVLA 1CZBA 3V9UA 4NCGA 4K8ZA 4B8AB 4CJKA 2XY7A 2G8WA 4HUGA 1X9WA 3C94A 4CJ3A 1JLEA 4KTWA 4E89A 3OYCA 1ZBLA 4I2QA 4O4GA 2GV9A 2YNHA 1BGXT 1WAFA 3ZSYA 1UOCA 2FBTA 3SJJA 3TAPA 2ZD1A 4E7JA 4HVJA 1A5VA 2KW4A 1LW2A 1ZBUA 4CE9A 1SKRA 4DSJA 4EZ6A 5HP1A 4W5NA 1ASWA 1BHLA 1NK0A 3M8SA 4ELTA 1YVUA 1TK8A 4AILC 4O5BA 3MEEA 3V9SA 2KFZA 4DLGA 1NOYA 4FK0A 4HUEA 3K5LA 1KTQA 3M8QA 4CK3A 1RBUA 4CGIA 5DK5A 4M3WA 5FRNA 3KLHA 3KJVA 3RWUA 4DFJA 3ZT1A 4FJNA 4FJ7A 3ZSVA 3MXMA 4KHUA 1JLBA 5E41A 4F4KA 1ZBHA 3V1QA 2R7YA 3V1RA 3DLRA 1LW0A 4LH4A 3OYBA 3VQ7A 4BWJA 4CEQA 4Z4EA 4LSLA 4KRFA 3MEGA 1L3VA 5JS1A 4FJ8A 4Z4HA 3L2WA 4FYDA 1NKCA 1NOZA 1D5AA 4FZYA 1LWCA 3QINA 4RG8A 3T3FA 1RDDA 2D0BA 3RRGA 3NBPA 1SL0A 1Q9YA 3WNGA 3HM9A 4KB1A 3B6PA 1LAWA 4B9LA 4FLVA 1Z26A 3QO9A 3ZSRA 4IDKA 4CJRA 2PYJA 4DSKA 1TV6A 3H08A 4FLXA 3LZJA 4DTRA 3S3MA 2VG5A 1ITGA 3DM2A 1KVBA 1ZBFA 4KI6A 5FRMA 4Z4GA 3HXMA 1SL2A 2HHVA 1HNVA 3RMDA 4H4MA 5CZ1A 4F8RA 3OYIA 4I2PA 4KPYA 4CEDA 4KV8A 1DLOA 3TI0A 4JLHA 3QEPA 2QK9A 2F96A 4Y1CA 3OYFA 1RDCA 1EP4A 3ZSQA 3JYTA 3NE6A 4CFBA 1BI4A 1VSLA 3U3YA 4KHWA 1EKEA 1IH7A 3B6OA 2Z1GA 4N47A 2B6AA 3TANA 4UQGA 2HHXA 3LPTA 4AHUA 1S6QA 4LY7A 1NK4A 3T19A 3DRPA 3QEWA 1SKSA 4OLAA 4M41A 4CHZA 4B9TA 2EX3A 3OVNA 4FLZA 1L3UA 4FK2A 2G8IA 3WNEA 2OPRA 2YKNA 2QXFA 4DQIA 4DFPA 4Q0BA 3U6FA 1K6YA 3NH0A 5C25A 1LWFA 3JSMA 3ZSXA 1RBRA 3DYAA 1VSIA 1REVA 3VQ9A 4DF8A 4J2AA 2F8TA 1RNHA 3AVCA 1XI1A 2F8SA 3SUPA 4R5PA 4M3XA 1TL1A 1S5JA 3VA0A 4IKFA 3PX4A 1C0UA 4E0DA 1NK8A 2OZSA 4FJKA 1X9MA 3LAKA 4E7LA 4MQ3A 4DF4A 3DRSA 1Q9XA 4O0JA 2YNGA 1N5YA 4DSEA 1CXQA 3SUOA 2DY4A 4N76A 3MAQA 4FJ9A 1C1CA 3VQ8A 3SQ4A 4F3TA 1D8YA 4DWIA 3NF9A 2BGGA 4CJSA 4CK1A 4M42A 3QERA 4DTOA 2HHUA 3TABA 1NKBA 4NYNA 4RW4A 4JRQA 4CEBA 2G8HA 1VSJA 3AA3A 2Z1HA 5KGXA 3SUQA 1S1VA 3PV8A 3O4NA 3OY9A 1RBVA 4B9MA 1IKWA 4M3YA 3OYDA 2LSNA 3I0SA 4CFCA 3ULDA 1RBSA 4LSNA 1WN7A 4RW9A 3ZSZA 5KRSA 4YNQA 3NF7A 4OPJA 3SI6A 1C6VA 1SUQA 4FM0A 2E6MA 1NK7A 3K2PA 4CECA 3OYMA 4HTUA 1FKPA 4H8KA 3ZT0A 3L2QA 5EU7A 4DSFA 1I39A 4OKEA 4QCLA 1X9SA 1VSKA 3DLEA 3BDPA 1B9FA 4H4OA 1T03A 2P1JA 3IG1A 4CGHA 4CEAA 1U4BA 1L3TA 4KREA 4E7IA 3P83D 1TVRA 3PUFA 3QIOA 3VQ4A 1BQMA 4DFKA 5J2NA 3SQ2A 3V9WA 4JS5A 3SPYA 2XO7A 1UWBA 4PA1A 3AVAA 4M3TA 4QOZB 1YTUA 2PZSA 2D5RA 4KHQA 1MU2A 4CF8A 2DFHA 3VQAA 3VQQA 3K59A 2KFNA 1WAJA 1WNSA 3OJUA 5KTQA 3OYNA 4Y1DA 1Z25A 4CGDA 3V6DA 1VSMA 2Y1JA 2FBVA 3HVRA 1BCMA 3SCXA 4EZ9A 4NCBA 2G8UA 4J2DA 4FLWA 2ETJA 3EY1A 4CJ4A 4CHQA 1VRTA 1R0AA 1NK6A 4F2SA 5J2MA 3HPGA 2G8VA 1VSEA 1FKOA 4FW1A 3AVFA 4B08A 4DG1A 5HRPA 5T7BA 3HPOA 2PY5A 3RR7A 3A2FA 4CF0A 4DSIA 2A1SA 5KRTA 2X6SA 4FJIA 4WE1A 1KVCA 4EP4A 3NCIA 1JLQA 3QETA 4CHYA 3KK1A 1NK5A 4TSXA 1IKVA 4M45A 1D9FA 4BDZA 3KTQA 1U47A 4KHYA 3CM5A 1KFDA 1RBTA 2JLEA 3HP9A 3ZT4A 4E3SA 1JL2A 3KLIA 1J9AA 1UAXA 4CGJA 3K5MA 4CEOA 3HVTA 1RILA 3O3GA 2HHTA 3CFPA 1B92A 4O44A 1Q8IA 3V4IA 1U48A 1JL1A 1S1WA 3C6UA 4KHNA 4CJUA 3V81A 1JLAA 3ZT3A 1HMVA 3ZSWA 4JS4A 1N6QA 3KKSA 4FM2A 1NJZA 3HT3A 3AO3A 1U49A 3VQCA 3K5OA 2WOMA 1HRHA 1RT4A 3DI6A 4IFYA 5DMRA 2JGUA 3DOLA 4BWMA 4CFAA 1A5WA 3NDKA 2DFEA 3NH2A 4BACA 2G8KA 4Z4FA 4XIUA 1LV5A 3O3HA 1WSFA 4QAGA 1C0MA 1WSEA 2P5GA 3P5JA 3LAMA 1JLGA 4W5OA 2FBXA 4O0IA 1QE1A 4FZZA 2HVHA 3VQ6A 2A1RA 1JXBA 2FBYA 3DMJA 1EETA 1XC9A 4J2EA 2Z1IA 3KIOA 4CIGA 4DTUA 1RDAA 5SWMA 4F2RA 4C8LA 4CK2A 1CXUA 4DQPA 1T8EA 5FROA 1RTHA 1FK9A 1KLNA 4KFBA 4KAZA 2BE2A 1I3AA 4G1QA 4MFBA 4DS4A 4DTNA 3QESA 3KLEA 3VQEA 4CIFA 1JLFA 2O4IA 1D9DA 3QEIA 3OYHA 3SUNA 1BISA 1G15A 4CESA 3OYAA 3L3UA 4CJQA 3HPHA 3OS0A 3NGIA 3ISNC 3F73A 3NAEA 4DQQA 2QKBA 1VSHA 1RT7A 3LP1A 2GBZA 2O4GA 2XRIA 1LWEA 1HQEA 5D3GA 2B5JA 3KKRA 1HYSA 3VN5A 3OYGA 2YNFA 3MEDA 2RN2A 3HYFA 4W5RA 4CHPA 1L3SA 4CHOA 4E19A 3RMCA 3LWMA 4M3ZA 4OKKA 5CYMA 1RT2A 4DQRA 3AVLA 4FW2A 4RW7A 1S9EA 3HO1A 3SQ0A 2Z1JA 1TAUA 1RT6A 1HNIA 1BIZA 3QLHA 3SV4A 4DS5A 2Y1IA 1S9GA 3S3NA 1IKYA 4ELUA 1IKXA 2XY8A 4FLYA 2IGIA 4FLTA 4RW8A 4C8MA 3LP2A 4KHSA 1VRUA 3HK2A 3AVGA 4ELVA 2HMIA 4DMNA 2Q3SA 1NJWA 1BQNA 3DLKA 1KFSA 1RTJA 2EHGA 2P5OA 3CM6A 4IBNA 3C95A 3OS2A 3P1GA 1T7PA 3NHGA 1S6PA 4EP5A 4DTMA 5C24A 4PWDA 4C8KA 3TAMA 2XY6A 1TK0A 1J54A 3TR8A 1NKEA 3CFRA 4AHRA 1HYVA 4CERA 4DLEA 4FJ5A 1VK0A 3WNFA 4E1NA 3SV3A 4KTZA 3LALA 2KQ2A 4FVMA 1XWLA 4KTQA 4CIEA 4CEEA 3TAGA 2OPPA 5HRSA 1UA0A 4C8NA 1TK5A 1RT1A 4LD0A 4ZTJA 2P51A 3AVMA 1B9DA 2DFFA 3ZCMA 4Z4CA 3UIQA 1W0HA 4NCAA 3SQ1A 1Y97A 1GOAA 4YFUA 4N41A 1TL3A 3I8DA 3HSTB 4FXDA 3AA2A 4CGGA 1XHZA 2PYLA 1QS4A 1C1BA 1RT3A 1YTAA 4E7KA 3CYMA 3ZSOA 3AVIA 5CYQA 4B9SA 3O3FA 3QEXA 4ID1A 4CGFA 4M3RA 1KSPA 1KLMA 2HNDA 3LANA 4O55A 1VSFA 5HBMA 3RRHA 4BDYA 3QNNA 3IS9A 4Z0UA 2E6LA 2YNIA
chains in the Genus database with same CATH superfamily
4CI6A 5C2DA 2HVIA 2ITGA 4DV3K 4WFNL 4OPHA 1BCOA 4KPYA 1BO5O 2O8CA 3U3GA 1GLAG 4ID5A 1QSYA 4NLCA 2E1YA 2OA8A 1QTMA 4OO1J 2RF2A 4IG0A 1XC3A 2HB5A 1QSSA 4F3OA 3QEVA 1XUPO 4PQUA 2VWBA 4AHVA 4A59A 5EX5A 1CZ9A 1WSIA 4B9VA 5JICA 3QMLA 3CD6N 1YI2N 1J53A 3RMBA 4BR9A 4GV9A 4X64K 5JLHA 4BVPA 1K8KA 2OZMA 2NLXA 3K58A 4JI5K 2X78A 4B3OA 5AQKA 3O9SA 1JCGA 4AHTA 2XHBA 2ZGYA 5BPMA 4E1MA 2AJQA 1NK9A 3I8BA 3A5NC 2OYQA 1X9JA 2D0AA 1RTIA 4FOIA 4G9ZA 2YX6A 1O1WA 1EWRA 1FXXA 2V7YA 4CFDA 4JD2B 1JKHA 5AQXA 2YI1A 2W40A 4GVMA 3C6TA 2O8BA 3G0ZA 3L2VA 1CZAN 2HHQA 3NH1A 1X1PA 1XMOK 4JKEA 5JMVA 3LWLA 5HRNA 3VF2A 3S9HA 1QQNA 2NUBA 3F9KA 3LDSA 3AVJA 1GOCA 3GOIA 2Q1NA 2A41A 3TTCA 1TKDA 5BRHA 2FF3B 4H5VA 4HHTA 2KZMA 3K57A 4DTPA 2YV0X 1TAQA 4OPKA 4YOWA 4FJLA 5FLXO 1MWMA 4H0OA 3O1BA 3NF8A 4DV7K 4BG9A 3DOKA 1K73O 4LH5A 5LMNK 3R8EA 4PY5A 1S22A 2VG6A 1RCHA 3BEXA 4BRFA 1NGEA 5BN9A 2D0OA 1HJRA 1WSJA 4BE0A 3HSCA 3MN6A 1ZC6A 3KWGA 4BR4A 4HCBA 1OVQA 3Q7CA 1S1TA 4L8RB 2BANA 2GUIA 4A5BA 3DRRA 4HCCA 4Q5VA 2VG7A 3QNOA 3EL2A 4UY8O 1YT3A 3BGRA 1KVAA 3DLGA 4DQSA 3OYEA 2KKZA 2V7ZA 3AGRA 2WONA 3D2FB 4JAXA 3SYZA 1TKZA 3CJ7A 3BY5A 3G10A 2WTUA 4M7YA 1OH5A 1RGIA 3A0IX 1JLEA 4KTWA 1NGDA 5F2RA 4JKHA 2ASMA 2IVNA 4PL8A 1UOCA 4Y0WA 3TAPA 2ZD1A 1QHAA 1A5VA 1O13A 2KW4A 3CCUN 3H1QA 2O8EB 4O5BA 4FK0A 3M8QA 4CK3A 1ATSA 2JWLA 4I6MA 3ZT1A 3MXMA 4KHUA 4FO0A 4FSVA 5E41A 1VQ8N 3WUHA 2E2PA 3OYBA 4BWJA 3O4WA 4Z4EA 4Z4HA 3VEOA 4BY9C 1YUWA 1NOZA 4FWLA 2E2QA 5KPTA 3T3FA 2D0BA 5AQMA 4CVNE 2QXLA 4H0PA 4CJRA 4B1VA 1XNQK 3LZJA 4DTRA 3DM2A 1YJWN 1JJ2M 3C6HA 1SL2A 1DGKN 4I2PA 4CEDA 3TI0A 4CZEA 2QK9A 4A61A 4BRLA 1NU0A 4BC5A 4JK9A 1SAZA 1VSLA 2AA4A 3MX2A 3U3YA 4KHWA 2UXDK 1M90O 4AHUA 4YOUA 4A5AA 1NK4A 1SKSA 4M41A 3FZFA 3FZMA 2G8IA 2QW9A 1K8KB 5C25A 1LWFA 3JSMA 3ZSXA 5BRDA 1VSIA 1RNHA 5AQGA 3PX4A 2P9NA 5M1OA 1X9MA 3CCVN 5LJVA 4JI2K 1N5YA 3ATVA 4DSEA 4WQ5C 2E8AA 4FJ9A 3OTOK 4DR7K 4A2BA 3MN5A 2BGGA 3TSUA 4IJNA 3P39A 2HBKA 1BOTO 3AA3A 4ILJA 2O8BB 4B9MA 2E2OA 3I0SA 3NF7A 3EZWA 4DSFA 4BRPA 3H3OB 1VSKA 3ATUA 5LL6Z 1B9FA 2O8DA 4BRIA 4KREA 1L3TA 5AQHA 3P83D 3QIOA 5JVHL 3QBXA 1UWBA 4PA1A 3DWLA 4C23A 4QOZB 2D5RA 2ITMA 2P9KB 5AZIB 3K59A 1WAJA 5AQTA 3MWPA 5KTQA 3ZLJA 4Y1DA 1Z25A 4DV1K 4RCHA 2Y1JA 3O9RA 2ETJA 1VRTA 2FSJA 4LC9B 5J2MA 1VSEA 4FW1A 4B9QA 3CJAA 5T7BA 2A1SA 3IKMA 1NGAA 4BRDA 3CCSN 2P9SA 3MMVA 1NGIA 4BRHA 1VQLN 4CHYA 3DXMB 1KFDA 1RBTA 3TTDA 1JL2A 1IG8A 1UAXA 3K5MA 4CEOA 1VQ9N 1RILA 1NMNA 3O3GA 1NG9A 3H45C 4O44A 1Q8IA 5GAHP 2PFUA 1S1WA 4BREA 5BR9A 4HTLA 4JS4A 3CMEN 4JKCA 4FM2A 2YCHA 3UKUA 3AO3A 4M63C 3VQCA 1U2VA 3ZETB 2WOMA 3DOLA 2YJFA 4Z4FA 3SMPA 2H3GX 1U6ZA 3JS6A 4IO8A 2HVHA 3VQ6A 2A1RA 1JXBA 2FBYA 3DMJA 1XC9A 4J2EA 3KIOA 4DTUA 4KH4A 4F2RA 1BU6O 4C8LA 1IJJA 1T8EA 2Q97A 4JI6K 4KFBA 4KAZA 3QESA 2E5LK 3L0QA 2FXUA 4WYBA 1D9DA 1JCEA 3OYAA 1S3XA 3L3UA 4CJQA 3HPHA 3OS0A 3NGIA 3ISNC 1VSHA 3QDKA 5D3GA 2QEXN 4U67L 5AQJA 4CHPA 1OH6A 4E19A 3LWMA 4M3ZA 5EY4A 4DQRA 2Z1JA 4PKGA 2Y1IA 3VF6A 4DS5A 3S3NA 1IKYA 3PIOL 2CGJA 2ZGZA 4FLYA 4FLTA 3SLCA 4C8MA 3LP2A 4KHSA 3HK2A 3AVGA 4GV3A 2HMIA 2Q3SA 1BQNA 4DCHA 1KFSA 1RTJA 2EHGA 2HBMA 3CM6A 4CZLA 2UUBK 2P5OA 3QB0A 1S6PA 4DTMA 3J7AP 3TAMA 4H0TB 1TK0A 3I55N 1HYVA 3WXLA 4PL7A 4FJ5A 2IIRA 3WNFA 4JV5K 5HRSA 1UA0A 5AQNA 4C8NA 1TK5A 4RWTA 5AFUH 4LD0A 2P51A 4NCAA 2ZWHA 4N41A 3I8DA 3HSTB 4FXDA 3OBWA 4CGGA 4CD3A 1XHZA 4BQZA 1XNRK 5JLFA 4B9SA 3CI5A 3O3FA 3QEXA 1KSPA 1VSFA 4BRCA 5HBMA 2P9IB 5AQWA 4Z0UA 2KLAA 2YNIA 2E6LA 4YDUC 5IWAK 1IG9A 3KWIA 2HW3A 1YITN 5CY4A 4EIAA 1RDUA 4W5QA 4JRPA 3WXJA 2ASPA 4C8OA 5JS2A 4B9UA 3VERA 3CJBA 5GIPA 4FCYA 1J5OA 3KD1E 5AQQA 5AZJA 3U4LA 4DTSA 4ZTFA 3CFOA 3FGUA 2IVPA 3LP3A 4I9LA 5ADXH 3D45A 1TKTA 1EX4A 2YHBA 3RMAA 4KHPK 3T69A 1DTQA 4YHHK 4ISFA 1ASVA 1RDWX 3LDLA 1ZYQA 2Q2RA 1VSDA 2QWQA 4WQ4C 5J2QA 4DR6K 3DXKB 4IEEA 3C6AA 4CF9A 1EWQA 4H03B 1N36K 3TAQA 5AQZA 3UKRB 1IO2A 1HQUA 4JI1K 1OVYA 4FJMA 3C7NB 1U45A 5ELZA 1SZ2A 1CLQA 5I42A 3RSEB 3LDNA 2X6NA 2OTJN 3F9MA 3AVHA 2F9TA 4BDPA 1X3MA 3AA4A 4WFBL 1NJXA 3L3VA 1C0TA 1A5XA 4EAHD 1HKBA 2YKMA 3AO5A 1W9HA 3THWA 2D0CA 3RTVA 4HUFA 1WB9A 1DTTA 3KVGA 4IFEA 2WBNA 3MXJA 4H0VB 1BI4B 3KZBA 3OJSA 1WOQA 3KK2A 4CEZA 3J80O 4DU4A 2X74A 5H1SQ 4AH9A 2IAJA 1LOTB 1QQOA 4WQ5A 4BE1A 3MWTA 3ITHA 4KI4A 4H0YB 4CEFA 3G4SN 2QI2A 3I0RA 4JN4A 3AAPA 3KLGA 4W5TA 4KO0A 3HJFA 3FFIA 5C10A 4CF1A 4LF6K 3AO2A 2GWJA 3RR8A 2KTQA 2OPQA 3ALYA 3GDQA 4FK4A 4BROA 3CCMN 2QKKA 3ZX3A 3ZT2A 3MK6A 4CHNA 1HX1A 3ASMA 4CCHA 4FZXC 4M3UA 3D0PA 3L2UA 3PLAA 3AA5X 4X62K 3L2RA 3ENBA 1HPZA 4DTJA 4K41A 4PUOA 1NGHA 1Y64A 4OVLA 3ID8A 4CJKA 3A5LC 3IMXA 3L6QA 4CJ3A 1ZBLA 4I2QA 4FJIA 2GV9A 3ZSYA 2FBTA 3VGMA 1HKGA 4QS9A 1LW2A 4XH5A 4B1UB 1BHLA 1YVUA 1TK8A 4HUEA 4FWNA 1RBUA 3CJCA 4CGIA 5DK5A 4X66K 3KLHA 3RWUA 1D4XA 3ULEA 3AY9A 5EXWA 5BREA 4FJ7A 1JLBA 4F4KA 1VQ6N 4LH4A 3BZCA 3HOTA 1YVNA 3M1FA 4LFAK 4FJ8A 5KQDA 2VYPA 3QINA 3RRGA 4H5RA 1Q9YA 4DUYK 1LAWA 3ZSRA 4DSKA 4IDKA 3H08A 3S3MA 2ZJPL 4CZMA 1KVBA 3VEWA 1IV0A 5FRMA 2HHVA 4PKHA 3RMDA 5CZ1A 1VQKN 3W3DA 5AZJB 4KV8A 2PAVA 1DLOA 3CCRN 3RVCA 3OYFA 1EP4A 4CZJA 1VQMN 4BRMA 5BPNA 1GLDG 3ZX0A 4R79A 3W0LA 4N47A 2B6AA 2HHXA 1S6QA 4OLAA 4CHZA 3OVNA 3VESA 4FLZA 4FK2A 3WNEA 3NVKA 2QXFA 3HOSA 1NGGA 4DFPA 1QZ5A 3UB5A 3U6FA 3CJ9A 3BUZB 3DAWA 1XI1A 3EE9A 4R5PA 4M3XA 3WXKA 1YF5L 3VA0A 4IKFA 4E0DA 4DF4A 4MQ3A 3MN9A 2A42A 4FL9A 3VQ8A 3OHRA 4JNEA 2A3ZA 3NF9A 4DR2K 4CJSA 2HHUA 4M42A 4V19S 3TABA 3O9TA 4NYNA 2OCEA 4RW4A 1TYQB 3O4NA 3OY9A 1IKWA 4M3YA 2P9LA 1D8YA 4YOVA 4KI6A 4BR7A 2G8WA 1E3MA 4FOEA 1NWKA 4FM0A 1KQSM 3K2PA 3OYMA 4HTUA 4H8KA 3ZT0A 3L2QA 1ATRA 3OA9A 3VEZA 4IWVA 1T03A 2NNWA 3IG1A 2NRTA 4CGHA 1U4BA 3ZEUB 4DFKA 3PUFA 4CZKA 5J2NA 3SQ2A 4JS5A 4EHUA 1YTUA 4KHQA 2QWMA 5A2QO 4B3MK 2DPNA 3VQQA 3VTIA 2KFNA 3U9DA 4H0XB 4JHDA 1VSMA 3A5MC 3HVRA 3SCXA 3SBTA 4NCBA 3VMFB 4BR5A 4BRKA 4CJ4A 4CHQA 4JKGB 1NK6A 1DT9A 3AVFA 4B08A 5TKWA 4A57A 5HRPA 3HPOA 2PY5A 4DSIA 5KRTA 4IO9L 4XEIA 1NMDA 4WE1A 2WFBA 1KVCA 3PSFA 3QETA 1IKVA 1D9FA 3K0SA 4BDZA 4ILGB 1U47A 4KHYA 3HP9A 3ZT4A 4E3SA 4CZGA 3THYA 5KPZA 2YHYA 2O8FA 2I7PA 2HHTA 2HBLA 4KHNA 4B3RK 1JLAA 1G99A 2UYTA 3ZSWA 3WXMB 5FPEA 4JKBA 3K5OA 2O8CB 4B3SK 2JGUA 4BWMA 2GEMA 4CFAA 1A5WA 3NH2A 4BACA 4WF9L 4XIUA 1LV5A 1C0MA 1JLGA 3J8AA 4WQ4A 4GY2B 3HTVA 2Z1IA 1WBDA 2Q0UA 3LDPA 1CXUA 4DQPA 4DR4K 1FK9A 1KLNA 1HNXK 4MFBA 3KLEA 1KC8O 1EQYA 3MCAB 3EE8A 2O4IA 3QICA 2WC9A 1G15A 4CESA 3NVMA 1GLBG 1NGJA 4NO7A 4JYAK 3NAEA 4DQQA 2QKBA 3LP1A 2O4GA 2WUSA 4BRGA 1NNEA 3VEVA 3MEDA 4W5RA 3HYFA 1RFQA 4CHOA 3RMCA 3BP8A 5CYMA 3AVLA 1S9EA 3HO1A 1TAUA 1RT6A 1HNIA 3HI0A 3QLHA 3R3LA 3CCLN 2XY8A 3K9KA 4WFAL 3CJ1A 3FZHA 1VRUA 3E9LA 4DMNA 1C0GA 5M1QA 1VQPN 3E66A 3C95A 3OS2A 3P1GA 4EP5A 4PWDA 4H5WA 5GADP 3M6GA 2XY6A 4JI7K 4BC3A 4CERA 3CC4N 4H5TA 1W7AA 2KQ2A 4FWOA 4CIEA 4LF5K 3TAGA 3A5OC 5M1NA 4C1NI 1Z05A 2HSTA 4Z4CA 1B9DA 2DFFA 1IBMK 4BRQA 4DR5K 5BPLA 3SQ1A 1Y97A 4YFUA 1TL3A 4ILHA 5C15A 2PYLA 1QS4A 1SS6A 3F2KA 4ID1A 4CGFA 2HNDA 4O55A 5E26A 4BDYA 4B1YB 2GTDA 3N4PA 3CERA 4EP4A 3AVKA 2A5XA 3THVA 4NYFA 4MO4A 3LDQA 2ZE2A 1BL3A 4J8FA 1WSGA 4CJEA 5I3UA 3KLFA 4B8CA 3S3OA 4CJVA 3VQPA 1VHXA 3WEEA 1KAXA 2IC3A 2HHSA 1H1VA 4AF1A 1BDGA 4B1WB 1DKGD 4BG8A 4GW6A 2NRVA 4NLBA 5MLCQ 4CZHA 2ZF5O 3GG4A 3TAEA 3CMAN 3T1AA 1ZBIA 4MDBA 4WCEL 3PX0A 3PY8A 4MLEA 4YY3K 3VA3A 3WNHA 3SZ2A 1QHTA 1N8RO 2IDOA 3THXA 4OKJA 4DHYA 3P31A 4N56A 4DU3A 4DTXA 4Z4IA 4GMJB 4CJ5A 3LPUA 4IXCA 5M1FA 4DFMA 4I6MB 3HM8A 4DSLA 2HNYA 3MECA 4IOCL 1JXEA 2BDPA 4B9NA 2VCPA 4OGEA 2YHAA 3OW2M 1QSLA 5HOOA 3OS1A 3NF6A 1T44A 3V9XA 2VGMA 4KKOA 3DLBA 4IOXA 4CJLA 4CJTA 4PHTX 2HHWA 5LY3A 2V52B 1VQNN 3KD5E 1HPMA 4FWSA 2I5JA 3BF3A 1XQSC 1C1AA 5AQPA 1QVFM 3HL8A 4BRNA 4ZHRA 5KGWA 2FF6A 3O1WA 1UA1A 1WLJA 3AO4A 3WT0A 3J7YP 1W2BM 1V4TA 2F9WA 2A6AA 2CGLA 2FC0A 1TGOA 3D2EA 2F4VK 1ATNA 3TAFA 5AQYA 1NGCA 3ZX2A 3VQDA 3K5NA 1NJYA 4IFVA 1KRPA 4LF4K 4JI3K 3NMUA 4K8XA 4FWKA 3DLHA 2E20A 1TKXA 3EYZA 3O4QA 4AM6A 3VETA 2YHWA 2JWKA 4LF9K 2P9NB 1F21A 5HROA 2OTLN 4FM1A 1ASUA 4A62A 2KZZA 2IOCA 3P38A 4BGAA 2V51B 5HL7L 3PO5A 3OYJA 3J81O 4EHTA 1VQ5N 4K43A 2DTUA 2W6LA 4K42A 2CH6A 2B4JA 1OH8A 1SV5A 3VQBA 3LZIA 5FPDA 5F0XA 4K8ZA 1CZBA 4NCGA 4B8AB 1N33K 4HUGA 3C94A 3OYCA 3FZLA 3HZ6A 3J7ZO 2O8DB 2YNHA 1BGXT 4YORA 4E7JA 3T7ZA 4HVJA 3VPZA 1ZBUA 1SKRA 4DSJA 5HP1A 3LM9A 1NK0A 3M8SA 4ELTA 2Q31A 3M5RA 3V9SA 1NOYA 1ZBSA 2QWOA 3K5LA 4HWIA 4M3WA 3KJVA 1P90A 3ZSVA 2J4RA 3CQYA 4KH6A 4BGBA 1ZBHA 2UXBK 1K9MO 4LF8K 3V1QA 3V1RA 1T3VA 1DEJA 3DLRA 4CBWA 3VQ7A 3O6WA 4CEQA 4LSLA 3L2WA 1FW6A 4FYDA 1NKCA 4FZYA 4RG8A 1RDDA 2P9SB 1SL0A 3HM9A 4B9LA 4OPAA 4FLVA 4IDHA 1YIJN 2UUCK 1TV6A 4FLXA 3T1HK 1ITGA 5CE3A 3WEEB 4Z4GA 3HXMA 1HR0K 4JLHA 2F96A 4Y1CA 5FPNA 1RDCA 3NE6A 5CR4A 3R1XA 2D4WA 4CFBA 2NRWA 1EKEA 1IH7A 3UKUB 4H5NA 1U2VB 3TANA 3LPTA 3CCQN 3DRPA 4IZ9A 3O80A 4B9TA 4BR2A 2P9UA 3SMSA 3HRGA 3SAGA 1GLEG 2OPRA 2YKNA 4DQIA 3H6EA 4JK7A 4KBOA 1RBRA 3N4QA 3VQ9A 1REVA 2GUPA 2F8TA 1YAGA 2F8SA 4KH5A 5BR8K 5KQ8A 1C0UA 4FJKA 2OZSA 1VQ4N 3DRSA 3TPQA 3QFUA 5AFUA 1C1CA 2IVOA 3SQ4A 5AQIA 5C12A 1YXQA 3QERA 1Q86O 3D2FA 2UXCK 2G8HA 3KHYA 3SUQA 2Z1HA 2HOEA 3L4QA 3OYDA 2RHKA 3ULDA 1RBSA 1I94K 1WN7A 4RW9A 3SI6A 2E6MA 4CECA 3CQXA 5BN8A 1ESVA 1KAYA 3DLEA 4YOYA 2P1JA 3OBYA 4CEAA 4E7IA 1TVRA 4DKWA 5AQRA 4FWQA 2XO7A 3AVAA 4DR1K 2O8EA 1MU2A 3OJUA 1R0AA 5AQFA 3V6DA 5C0YA 5AQOA 5F1XA 4EZ9A 2G8UA 4J2DA 4F2SA 4GV6A 2NRXA 3EN9A 1FKOA 4DG1A 3U8XA 5KPRA 1HNWK 4CW7B 3A2FA 4CF0A 4CD1A 4MDAA 3VF4A 2X6SA 3MDQA 3NCIA 4X65K 3VENA 2ZM6K 3KTQA 3DJCA 3CM5A 3WQUA 4GNIA 1LCUA 3KLIA 1HUXA 4CBUA 4CGJA 3HVTA 1M1KO 3CFPA 1B92A 1U48A 4CJUA 4M7XA 4GKJK 4BC4A 1N6QA 3KKSA 1NJIO 1T6CA 2GX9A 1HJOA 1RT4A 3O8MA 1NM1A 3ENHA 4OX9K 4JKAA 3NDKA 3SJHA 2DFEA 1WSFA 3AAQA 1J5EK 2D0PA 2P5GA 3P5JA 3LAMA 4W5OA 2CGKA 1QE1A 2E2NA 3QFPA 3WQTA 2YHXA 4CIGA 2I7NA 5SWMA 1KD1O 4CK2A 3MX5A 5FROA 2BE2A 2UUAK 4CIFA 1JLFA 1QZ6A 1BISA 3C65A 5AQSA 1RT7A 1QVGM 1IBKK 3EKSA 1T6DA 2XRIA 1LWEA 2B5JA 1HYSA 3OYGA 2YNFA 3U9ZA 5GAEP 4O8KA 1L3SA 1MDUB 3LL3A 4OKKA 4XH1A 1RT2A 4QS8A 5C2FA 4RW7A 5E84A 3G6EN 1S9GA 1IKXA 4K0KK 3CPWM 4RW8A 2KHOA 4ELVA 1NJWA 1N32K 2P9KA 5LMUK 1Q18A 2P9UB 5AZIA 3PIPL 2NRZA 3THWB 1BA0A 5C24A 1VQ7N 1BA1A 4C8KA 1NKEA 4AHRA 4DLEA 5GIOA 1VK0A 2QM1A 4E1NA 4KTZA 4F9OA 3TSQA 3LALA 4KTQA 3FLCO 2VQEK 1P8ZA 1RT1A 4ZTJA 3M3ZA 2Q36A 3DXMA 1GOAA 4BRAA 3AA2A 1W97L 1HNZK 1C1BA 1RT3A 4JK8A 4E7KA 3CYMA 3ZSOA 3AVIA 5CYQA 2BH1A 3SBGA 1KLMA 3TU5A 3RRHA 3QNNA 3IS9A 4YDUA 2HF4A 1W0HA 3JYTA 1BIUA 2E1ZA 2VQFK 3V1OA 3E01A 2G8FA 4OGCA 3ZETA 4DWIA 3TARA 3PSIA 5JVGL 3VGKA 3CCEN 5J1EA 3TWHA 4DV6K 2GWKA 2W6KA 4DUZK 3VEYA 3H3NO 2HF3A 3B8AX 5J2PA 4CJPA 5C42A 1JCFA 4ICLA 5AQLA 3ENOA 1C0FA 1OH7A 3NGZA 5FDLA 4MO5A 5HRRA 4AQYK 2IS3A 1JLCA 3M8PA 3AV9A 3AVNA 1LAVA 1SKWA 2RKIA 2CH5A 4OJRA 4RTFD 4OLBA 4CBXA 3QIPA 4FJXA 3QBWA 3ULEB 1KCFA 2HHHK 4I7FA 5KI6A 3CHWA 5EVZA 4J2BA 4PKIA 3SPZA 4O8UA 1QQCA 1WSHA 3V9ZA 1K8AO 2YJEA 3MXIA 2RPIA 3NGYA 1FJGK 2W42A 2QWPA 4DR3K 1HYZA 4FJJA 4N5SA 4DV5K 4CJWA 5B8HA 1RT5A 5HLFA 4FJHA 3EO3A 2OPSA 4E1JA 5K14A 3EEQA 3PX6A 4CF2A 3CG7A 3L8BA 1RTDA 1S1XA 4IG3A 1YJNN 1XHXA 3BZKA 4E7HA 3AGKA 5CZ2A 3M8RA 3SNNA 5DM6L 4FLUA 3H46O 4XH4A 4FVUA 3IAYA 2QTDA 4ISGA 3JXUA 1S1UA 2BUPA 3LP0A 3OYKA 1GLJO 2HMPA 3AVBA 2ATQA 5AJ3K 5LJWA 3AO1A 4AHCA 3PO4A 1L5UA 1TUUA 1T05A 1Z6RA 2AP1A 2HNZA 3R9PA 1GOBA 4RW6A 3E9PA 5AR0A 1RDBA 4KB0A 3VQ5A 2E88A 4AHSA 3OYLA 1SL1A 5I9EB 2ZQBA 2FSNA 2W41A 1U04A 2P9IA 3UE5A 5IT9O 2XY5A 4I9QA 3NFAA 4BC2A 3CC2N 5SZTA 2VWJA 3EZ5A 1X3NA 4LFCK 3F5TA 5GAGP 3CQ8A 4FJGA 3IRXA 1EXQA 4CZIA 3FR0A 3HP6A 2E4LA 4JI8K 1IBLK 3KK3A 3G71N 2VWKA 3WXIA 4CJFA 4BE2A 3GBTA 2P9LB 2Q0RA 4DU1A 3V9UA 2XY7A 4CZFA 1X9WA 3VTHA 4E89A 3CPEA 3GE1A 4O4GA 1WAFA 3SJJA 1BG3A 2QWRA 4DV2K 3ZYYX 4EZ6A 4CE9A 4W5NA 1ZXOA 1ASWA 3D7EO 3CCJN 5AQUA 4AILC 3MEEA 2KFZA 4DLGA 1BUPA 3LDOA 1KTQA 4BQLA 3I33A 4YOTA 2NRHA 5FRNA 4JHDB 3G25A 3DXKA 4DFJA 1VQON 2QWNA 4FJNA 5EOYA 2F7TA 2R7YA 3UKRA 1LW0A 3C0BA 4KRFA 3CC7N 3MEGA 3C7NA 4JI0K 1L3VA 5JS1A 3IDHA 1D5AA 1LWCA 3A8YA 1GLLO 3RSEA 3NBPA 3WNGA 2FLOA 4KB1A 3B6PA 1MWKA 1Z26A 3QO9A 2PYJA 1HLUA 2VG5A 3THYB 1ZBFA 1KAZA 2O8FB 1HNVA 5GINA 4H4MA 4F8RA 2PBDA 3OYIA 1HKCA 1N34K 3QEPA 3ZSQA 4B1XB 1BI4A 3B6OA 3L4IA 2Z1GA 4UQGA 3FZKA 4DV4K 4LY7A 3T19A 3QEWA 5CHIA 4IEIA 3SK3A 2EX3A 2BTFA 4L3QA 3LM2A 1L3UA 4LFBK 3IFRA 3EKUA 4Q0BA 1K6YA 3NH0A 1J6ZA 3DYAA 4J2AA 4DF8A 3AVCA 4Z94A 3SUPA 1TL1A 1S5JA 1XMQK 2D1KA 1NK8A 3LAKA 4DB3A 4E7LA 1Q9XA 4O0JA 2YNGA 1CXQA 3SUOA 1TUYA 2DY4A 4N76A 3MAQA 4F3TA 3TSPA 4BR0A 4CK1A 4DTOA 1NGFA 1NKBA 3E9OA 4JRQA 4DQ8A 4CEBA 1VSJA 4U7BA 5KGXA 3H1VX 1S1VA 3PV8A 1RBVA 2P9PA 2LSNA 4CFCA 4LSNA 2VGNA 3ZSZA 5KRSA 4YNQA 4OPJA 1C6VA 1SUQA 3KK7A 1NK7A 5M1PA 1FKPA 5EU7A 1I39A 4OKEA 4QCLA 1X9SA 3BDPA 4H4OA 3SAFA 3IUCA 3VQ4A 4K25A 1BQMA 2ZJQL 3V9WA 4FPBA 3SPYA 4M3TA 2PZSA 4CF8A 2DFHA 3VQAA 1E4GT 4NXMK 1WNSA 4FWPA 3OYNA 4CGDA 4GKKK 2FBVA 1BCMA 3S41A 1V4SA 1YHQN 1WUAA 4ISEA 4FLWA 3EY1A 3GL1A 3HPGA 2G8VA 3FE1A 4JI4K 3O08A 1S72N 1NLVA 3RR7A 4YOXA 4BVOA 3O9UA 4FWRA 4FWMA 1OKJA 1GLFO 3JAMO 4JKDA 1JLQA 4JKFA 3KK1A 1NK5A 1EO1A 4TSXA 3O9QA 4M45A 2JLEA 3AARA 1J9AA 2OANA 3V4IA 1JL1A 3C6UA 2FSKA 4JD2A 3HBTA 3V81A 4QS7A 3ZT3A 1HMVA 1Q81O 1ILYA 1NJZA 3HT3A 1U49A 1NBWA 4LF7K 2GELA 4IFYA 1HRHA 5DMRA 3T1YK 3E1YA 2G8KA 2NZTA 3O3HA 4QAGA 1WSEA 5FPMA 2FBXA 4O0IA 4FZZA 1YJ9N 2EWSA 1WBBA 1EETA 2NRRA 3TTFA 1RDAA 2ZJRL 4B3TK 3P4IA 1RTHA 3CETA 1I3AA 4G1QA 4DS4A 4DTNA 1SQKA 3BF1A 3VQEA 3O5BA 3THXB 3QEIA 3OYHA 3SUNA 2ASOA 1GLCG 3MCPA 1Q82O 1NGBA 3R6MA 3F73A 2A40A 3ID6A 1TYQA 2GBZA 4MLHA 1HQEA 3KKRA 3VN5A 2RN2A 1E4FT 3VOVA 1QQMA 1Q7YO 3SAHA 1BWFO 3Q7BA 3CXCM 4FW2A 4IOAL 4B1ZA 1BIZA 2HBJA 3SV4A 4ELUA 3ZEUA 2IGIA 1KXPA 4EFHA 3D6RA 3DLKA 1VAZA 5TKYA 4IBNA 5M1KA 3VEXA 4GVEA 1T7PA 3K9JA 4FPAA 3I56N 3NHGA 4NXNK 4IJAA 2UU9K 1J54A 3TR8A 4CJ7A 3CFRA 4JKGA 3SV3A 4FVMA 1R59O 3FFKB 1XWLA 4C1NK 3D2EB 4CEEA 4O5FA 2OPPA 5BRFA 3CF5L 5AQVA 2QWLA 1MA9B 3AVMA 5ADXA 3ZCMA 3MN7A 3UIQA 4JEPA 3CIPA 4NB4A 4AM7A 5DM7L 2RE2A 1YTAA 2QA4N 3DLLL 2P9PB 4M3RA 3LANA 3VGLA 4DV0K 4A2AA 3SQ0A 3DI6A
chains in the Genus database with same CATH topology
1BIUA 3AVKA 2HVIA 2ITGA 1IG9A 3THVA 4NYFA 3V1OA 2HW3A 2ZE2A 1BL3A 3E01A 2G8FA 1BCOA 1WSGA 4OGCA 5CY4A 4CJEA 5I3UA 3TARA 3KLFA 4B8CA 3S3OA 4CJVA 3VQPA 3U3GA 5J1EA 4W5QA 4JRPA 2IC3A 3TWHA 2HHSA 4C8OA 4ID5A 5JS2A 1QSYA 4B9UA 2OA8A 1QTMA 4FCYA 2RF2A 1J5OA 3KD1E 4IG0A 4GW6A 2HB5A 4DTSA 1QSSA 4ZTFA 5J2PA 3CFOA 3LP3A 4CJPA 5C42A 4F3OA 4I9LA 3QEVA 4PQUA 3TAEA 4ICLA 3D45A 3T1AA 1TKTA 1ZBIA 4AHVA 1EX4A 2YHBA 3RMAA 1CZ9A 1WSIA 3PX0A 3NGZA 3PY8A 5FDLA 4B9VA 3VA3A 5HRRA 3WNHA 3SZ2A 2IS3A 1QHTA 1JLCA 1DTQA 2IDOA 3M8PA 1ASVA 3AV9A 1J53A 3AVNA 4OKJA 1LAVA 3RMBA 4N56A 2RKIA 4DU3A 4DTXA 1ZYQA 4OJRA 1VSDA 4GMJB 1SKWA 2OZMA 4Z4IA 4CJ5A 3LPUA 4OLBA 5J2QA 3K58A 4DFMA 2X78A 3QIPA 4FJXA 4B3OA 4DSLA 2HNYA 4CF9A 3MECA 1KCFA 4AHTA 1JXEA 4I7FA 5KI6A 2BDPA 2XHBA 4B9NA 4J2BA 4E1MA 3TAQA 2AJQA 3SPZA 1NK9A 4OGEA 2YHAA 1QQCA 1WSHA 3V9ZA 1QSLA 1IO2A 1HQUA 2OYQA 4FJMA 2D0AA 1RTIA 3OS1A 3MXIA 2RPIA 1U45A 3NGYA 3NF6A 1O1WA 1FXXA 2W42A 3V9XA 4CFDA 1HYZA 4FJJA 4N5SA 1JKHA 5I42A 1CLQA 2X6NA 4KKOA 4CJWA 1RT5A 3DLBA 5HLFA 4FJHA 3AVHA 4CJLA 4GVMA 3C6TA 4CJTA 4BDPA 3AA4A 2HHWA 2OPSA 3G0ZA 1NJXA 3L3VA 1C0TA 5K14A 3L2VA 1A5XA 2HHQA 3PX6A 4CF2A 1X1PA 3CG7A 3NH1A 3L8BA 3KD5E 3LWLA 5HRNA 2YKMA 3S9HA 3AO5A 1RTDA 2NUBA 3F9KA 3LDSA 2I5JA 1W9HA 3AVJA 1C1AA 1GOCA 1S1XA 2D0CA 4IG3A 4HUFA 3HL8A 3RTVA 4ZHRA 1DTTA 5KGWA 1XHXA 4E7HA 5CZ2A 1TKDA 3M8RA 3SNNA 4HHTA 1UA1A 4FLUA 2KZMA 3MXJA 3K57A 4DTPA 1BI4B 3IAYA 1WLJA 2YV0X 3AO4A 1TAQA 4OPKA 1S1UA 3OJSA 4FJLA 3KK2A 2FC0A 4CEZA 1TGOA 3LP0A 3NF8A 3OYKA 4DU4A 3DOKA 2X74A 4LH5A 3TAFA 4AH9A 2IAJA 3AVBA 2ATQA 4BE1A 4PY5A 3AO1A 3VQDA 4AHCA 3PO4A 3K5NA 1NJYA 1L5UA 4IFVA 1KRPA 3ITHA 2VG6A 1RCHA 1T05A 4KI4A 4K8XA 2HNZA 3DLHA 1GOBA 4CEFA 4RW6A 1TKXA 3I0RA 3EYZA 3O4QA 3KLGA 1HJRA 4W5TA 1RDBA 4KB0A 3VQ5A 1WSJA 4AHSA 4KO0A 4BE0A 3HJFA 3OYLA 3FFIA 1SL1A 4CF1A 2ZQBA 3AO2A 3RR8A 1U04A 1F21A 5HROA 1S1TA 4HCBA 4L8RB 2BANA 2XY5A 4FM1A 4I9QA 2KTQA 2OPQA 3NFAA 2GUIA 3ALYA 5SZTA 3DRRA 1ASUA 4Q5VA 2VG7A 2VWJA 3QNOA 4HCCA 4FK4A 3EZ5A 2KZZA 2IOCA 1YT3A 3BGRA 3CQ8A 2QKKA 1KVAA 3ZT2A 3DLGA 4DQSA 4FJGA 3IRXA 1EXQA 3OYEA 3PO5A 3OYJA 4CHNA 2WONA 3ASMA 3HP6A 3SYZA 1TKZA 2E4LA 4CCHA 4FZXC 4M3UA 2DTUA 3D0PA 3KK3A 3L2UA 2VWKA 3AA5X 4BE2A 4CJFA 2B4JA 3L2RA 3G10A 1HPZA 1SV5A 4DTJA 3VQBA 3LZIA 4DU1A 4PUOA 4OVLA 1CZBA 3V9UA 4NCGA 4K8ZA 4B8AB 4CJKA 2XY7A 2G8WA 4HUGA 1X9WA 3C94A 4CJ3A 1JLEA 4KTWA 4E89A 3OYCA 1ZBLA 4I2QA 4O4GA 2GV9A 2YNHA 1BGXT 1WAFA 3ZSYA 1UOCA 2FBTA 3SJJA 3TAPA 2ZD1A 4E7JA 4HVJA 1A5VA 2KW4A 1LW2A 1ZBUA 4CE9A 1SKRA 4DSJA 4EZ6A 5HP1A 4W5NA 1ASWA 1BHLA 1NK0A 3M8SA 4ELTA 1YVUA 1TK8A 4AILC 4O5BA 3MEEA 3V9SA 2KFZA 4DLGA 1NOYA 4FK0A 4HUEA 3K5LA 1KTQA 3M8QA 4CK3A 1RBUA 4CGIA 5DK5A 4M3WA 5FRNA 3KLHA 3KJVA 3RWUA 4DFJA 3ZT1A 4FJNA 4FJ7A 3ZSVA 3MXMA 4KHUA 1JLBA 5E41A 4F4KA 1ZBHA 3V1QA 2R7YA 3V1RA 3DLRA 1LW0A 4LH4A 3OYBA 3VQ7A 4BWJA 4CEQA 4Z4EA 4LSLA 4KRFA 3MEGA 1L3VA 5JS1A 4FJ8A 4Z4HA 3L2WA 4FYDA 1NKCA 1NOZA 1D5AA 4FZYA 1LWCA 3QINA 4RG8A 3T3FA 1RDDA 2D0BA 3RRGA 3NBPA 1SL0A 1Q9YA 3WNGA 3HM9A 4KB1A 3B6PA 1LAWA 4B9LA 4FLVA 1Z26A 3QO9A 3ZSRA 4IDKA 4CJRA 2PYJA 4DSKA 1TV6A 3H08A 4FLXA 3LZJA 4DTRA 3S3MA 2VG5A 1ITGA 3DM2A 1KVBA 1ZBFA 4KI6A 5FRMA 4Z4GA 3HXMA 1SL2A 2HHVA 1HNVA 3RMDA 4H4MA 5CZ1A 4F8RA 3OYIA 4I2PA 4KPYA 4CEDA 4KV8A 1DLOA 3TI0A 4JLHA 3QEPA 2QK9A 2F96A 4Y1CA 3OYFA 1RDCA 1EP4A 3ZSQA 3JYTA 3NE6A 4CFBA 1BI4A 1VSLA 3U3YA 4KHWA 1EKEA 1IH7A 3B6OA 2Z1GA 4N47A 2B6AA 3TANA 4UQGA 2HHXA 3LPTA 4AHUA 1S6QA 4LY7A 1NK4A 3T19A 3DRPA 3QEWA 1SKSA 4OLAA 4M41A 4CHZA 4B9TA 2EX3A 3OVNA 4FLZA 1L3UA 4FK2A 2G8IA 3WNEA 2OPRA 2YKNA 2QXFA 4DQIA 4DFPA 4Q0BA 3U6FA 1K6YA 3NH0A 5C25A 1LWFA 3JSMA 3ZSXA 1RBRA 3DYAA 1VSIA 1REVA 3VQ9A 4DF8A 4J2AA 2F8TA 1RNHA 3AVCA 1XI1A 2F8SA 3SUPA 4R5PA 4M3XA 1TL1A 1S5JA 3VA0A 4IKFA 3PX4A 1C0UA 4E0DA 1NK8A 2OZSA 4FJKA 1X9MA 3LAKA 4E7LA 4MQ3A 4DF4A 3DRSA 1Q9XA 4O0JA 2YNGA 1N5YA 4DSEA 1CXQA 3SUOA 2DY4A 4N76A 3MAQA 4FJ9A 1C1CA 3VQ8A 3SQ4A 4F3TA 1D8YA 4DWIA 3NF9A 2BGGA 4CJSA 4CK1A 4M42A 3QERA 4DTOA 2HHUA 3TABA 1NKBA 4NYNA 4RW4A 4JRQA 4CEBA 2G8HA 1VSJA 3AA3A 2Z1HA 5KGXA 3SUQA 1S1VA 3PV8A 3O4NA 3OY9A 1RBVA 4B9MA 1IKWA 4M3YA 3OYDA 2LSNA 3I0SA 4CFCA 3ULDA 1RBSA 4LSNA 1WN7A 4RW9A 3ZSZA 5KRSA 4YNQA 3NF7A 4OPJA 3SI6A 1C6VA 1SUQA 4FM0A 2E6MA 1NK7A 3K2PA 4CECA 3OYMA 4HTUA 1FKPA 4H8KA 3ZT0A 3L2QA 5EU7A 4DSFA 1I39A 4OKEA 4QCLA 1X9SA 1VSKA 3DLEA 3BDPA 1B9FA 4H4OA 1T03A 2P1JA 3IG1A 4CGHA 4CEAA 1U4BA 1L3TA 4KREA 4E7IA 3P83D 1TVRA 3PUFA 3QIOA 3VQ4A 1BQMA 4DFKA 5J2NA 3SQ2A 3V9WA 4JS5A 3SPYA 2XO7A 1UWBA 4PA1A 3AVAA 4M3TA 4QOZB 1YTUA 2PZSA 2D5RA 4KHQA 1MU2A 4CF8A 2DFHA 3VQAA 3VQQA 3K59A 2KFNA 1WAJA 1WNSA 3OJUA 5KTQA 3OYNA 4Y1DA 1Z25A 4CGDA 3V6DA 1VSMA 2Y1JA 2FBVA 3HVRA 1BCMA 3SCXA 4EZ9A 4NCBA 2G8UA 4J2DA 4FLWA 2ETJA 3EY1A 4CJ4A 4CHQA 1VRTA 1R0AA 1NK6A 4F2SA 5J2MA 3HPGA 2G8VA 1VSEA 1FKOA 4FW1A 3AVFA 4B08A 4DG1A 5HRPA 5T7BA 3HPOA 2PY5A 3RR7A 3A2FA 4CF0A 4DSIA 2A1SA 5KRTA 2X6SA 4FJIA 4WE1A 1KVCA 4EP4A 3NCIA 1JLQA 3QETA 4CHYA 3KK1A 1NK5A 4TSXA 1IKVA 4M45A 1D9FA 4BDZA 3KTQA 1U47A 4KHYA 3CM5A 1KFDA 1RBTA 2JLEA 3HP9A 3ZT4A 4E3SA 1JL2A 3KLIA 1J9AA 1UAXA 4CGJA 3K5MA 4CEOA 3HVTA 1RILA 3O3GA 2HHTA 3CFPA 1B92A 4O44A 1Q8IA 3V4IA 1U48A 1JL1A 1S1WA 3C6UA 4KHNA 4CJUA 3V81A 1JLAA 3ZT3A 1HMVA 3ZSWA 4JS4A 1N6QA 3KKSA 4FM2A 1NJZA 3HT3A 3AO3A 1U49A 3VQCA 3K5OA 2WOMA 1HRHA 1RT4A 3DI6A 4IFYA 5DMRA 2JGUA 3DOLA 4BWMA 4CFAA 1A5WA 3NDKA 2DFEA 3NH2A 4BACA 2G8KA 4Z4FA 4XIUA 1LV5A 3O3HA 1WSFA 4QAGA 1C0MA 1WSEA 2P5GA 3P5JA 3LAMA 1JLGA 4W5OA 2FBXA 4O0IA 1QE1A 4FZZA 2HVHA 3VQ6A 2A1RA 1JXBA 2FBYA 3DMJA 1EETA 1XC9A 4J2EA 2Z1IA 3KIOA 4CIGA 4DTUA 1RDAA 5SWMA 4F2RA 4C8LA 4CK2A 1CXUA 4DQPA 1T8EA 5FROA 1RTHA 1FK9A 1KLNA 4KFBA 4KAZA 2BE2A 1I3AA 4G1QA 4MFBA 4DS4A 4DTNA 3QESA 3KLEA 3VQEA 4CIFA 1JLFA 2O4IA 1D9DA 3QEIA 3OYHA 3SUNA 1BISA 1G15A 4CESA 3OYAA 3L3UA 4CJQA 3HPHA 3OS0A 3NGIA 3ISNC 3F73A 3NAEA 4DQQA 2QKBA 1VSHA 1RT7A 3LP1A 2GBZA 2O4GA 2XRIA 1LWEA 1HQEA 5D3GA 2B5JA 3KKRA 1HYSA 3VN5A 3OYGA 2YNFA 3MEDA 2RN2A 3HYFA 4W5RA 4CHPA 1L3SA 4CHOA 4E19A 3RMCA 3LWMA 4M3ZA 4OKKA 5CYMA 1RT2A 4DQRA 3AVLA 4FW2A 4RW7A 1S9EA 3HO1A 3SQ0A 2Z1JA 1TAUA 1RT6A 1HNIA 1BIZA 3QLHA 3SV4A 4DS5A 2Y1IA 1S9GA 3S3NA 1IKYA 4ELUA 1IKXA 2XY8A 4FLYA 2IGIA 4FLTA 4RW8A 4C8MA 3LP2A 4KHSA 1VRUA 3HK2A 3AVGA 4ELVA 2HMIA 4DMNA 2Q3SA 1NJWA 1BQNA 3DLKA 1KFSA 1RTJA 2EHGA 2P5OA 3CM6A 4IBNA 3C95A 3OS2A 3P1GA 1T7PA 3NHGA 1S6PA 4EP5A 4DTMA 5C24A 4PWDA 4C8KA 3TAMA 2XY6A 1TK0A 1J54A 3TR8A 1NKEA 3CFRA 4AHRA 1HYVA 4CERA 4DLEA 4FJ5A 1VK0A 3WNFA 4E1NA 3SV3A 4KTZA 3LALA 2KQ2A 4FVMA 1XWLA 4KTQA 4CIEA 4CEEA 3TAGA 2OPPA 5HRSA 1UA0A 4C8NA 1TK5A 1RT1A 4LD0A 4ZTJA 2P51A 3AVMA 1B9DA 2DFFA 3ZCMA 4Z4CA 3UIQA 1W0HA 4NCAA 3SQ1A 1Y97A 1GOAA 4YFUA 4N41A 1TL3A 3I8DA 3HSTB 4FXDA 3AA2A 4CGGA 1XHZA 2PYLA 1QS4A 1C1BA 1RT3A 1YTAA 4E7KA 3CYMA 3ZSOA 3AVIA 5CYQA 4B9SA 3O3FA 3QEXA 4ID1A 4CGFA 4M3RA 1KSPA 1KLMA 2HNDA 3LANA 4O55A 1VSFA 5HBMA 3RRHA 4BDYA 3QNNA 3IS9A 4Z0UA 2E6LA 2YNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIU A;  3AVK A;  2HVI A;  2ITG A;  1IG9 A;  3THV A;  4NYF A;  3V1O A;  2HW3 A;  2ZE2 A;  1BL3 A;  3E01 A;  2G8F A;  1BCO A;  1WSG A;  4OGC A;  5CY4 A;  4CJE A;  5I3U A;  3TAR A;  3KLF A;  4B8C A;  3S3O A;  4CJV A;  3VQP A;  3U3G A;  5J1E A;  4W5Q A;  4JRP A;  2IC3 A;  3TWH A;  2HHS A;  4C8O A;  4ID5 A;  5JS2 A;  1QSY A;  4B9U A;  2OA8 A;  1QTM A;  4FCY A;  2RF2 A;  1J5O A;  3KD1 E;  4IG0 A;  4GW6 A;  2HB5 A;  4DTS A;  1QSS A;  4ZTF A;  5J2P A;  3CFO A;  3LP3 A;  4CJP A;  5C42 A;  4F3O A;  4I9L A;  3QEV A;  4PQU A;  3TAE A;  4ICL A;  3D45 A;  3T1A A;  1TKT A;  1ZBI A;  4AHV A;  1EX4 A;  2YHB A;  3RMA A;  1CZ9 A;  1WSI A;  3PX0 A;  3NGZ A;  3PY8 A;  5FDL A;  4B9V A;  3VA3 A;  5HRR A;  3WNH A;  3SZ2 A;  2IS3 A;  1QHT A;  1JLC A;  1DTQ A;  2IDO A;  3M8P A;  1ASV A;  3AV9 A;  1J53 A;  3AVN A;  4OKJ A;  1LAV A;  3RMB A;  4N56 A;  2RKI A;  4DU3 A;  4DTX A;  1ZYQ A;  4OJR A;  1VSD A;  4GMJ B;  1SKW A;  2OZM A;  4Z4I A;  4CJ5 A;  3LPU A;  4OLB A;  5J2Q A;  3K58 A;  4DFM A;  2X78 A;  3QIP A;  4FJX A;  4B3O A;  4DSL A;  2HNY A;  4CF9 A;  3MEC A;  1KCF A;  4AHT A;  1JXE A;  4I7F A;  5KI6 A;  2BDP A;  2XHB A;  4B9N A;  4J2B A;  4E1M A;  3TAQ A;  2AJQ A;  3SPZ A;  1NK9 A;  4OGE A;  2YHA A;  1QQC A;  1WSH A;  3V9Z A;  1QSL A;  1IO2 A;  1HQU A;  2OYQ A;  4FJM A;  2D0A A;  1RTI A;  3OS1 A;  3MXI A;  2RPI A;  1U45 A;  3NGY A;  3NF6 A;  1O1W A;  1FXX A;  2W42 A;  3V9X A;  4CFD A;  1HYZ A;  4FJJ A;  4N5S A;  1JKH A;  5I42 A;  1CLQ A;  2X6N A;  4KKO A;  4CJW A;  1RT5 A;  3DLB A;  5HLF A;  4FJH A;  3AVH A;  4CJL A;  4GVM A;  3C6T A;  4CJT A;  4BDP A;  3AA4 A;  2HHW A;  2OPS A;  3G0Z A;  1NJX A;  3L3V A;  1C0T A;  5K14 A;  3L2V A;  1A5X A;  2HHQ A;  3PX6 A;  4CF2 A;  1X1P A;  3CG7 A;  3NH1 A;  3L8B A;  3KD5 E;  3LWL A;  5HRN A;  2YKM A;  3S9H A;  3AO5 A;  1RTD A;  2NUB A;  3F9K A;  3LDS A;  2I5J A;  1W9H A;  3AVJ A;  1C1A A;  1GOC A;  1S1X A;  2D0C A;  4IG3 A;  4HUF A;  3HL8 A;  3RTV A;  4ZHR A;  1DTT A;  5KGW A;  1XHX A;  4E7H A;  5CZ2 A;  1TKD A;  3M8R A;  3SNN A;  4HHT A;  1UA1 A;  4FLU A;  2KZM A;  3MXJ A;  3K57 A;  4DTP A;  1BI4 B;  3IAY A;  1WLJ A;  2YV0 X;  3AO4 A;  1TAQ A;  4OPK A;  1S1U A;  3OJS A;  4FJL A;  3KK2 A;  2FC0 A;  4CEZ A;  1TGO A;  3LP0 A;  3NF8 A;  3OYK A;  4DU4 A;  3DOK A;  2X74 A;  4LH5 A;  3TAF A;  4AH9 A;  2IAJ A;  3AVB A;  2ATQ A;  4BE1 A;  4PY5 A;  3AO1 A;  3VQD A;  4AHC A;  3PO4 A;  3K5N A;  1NJY A;  1L5U A;  4IFV A;  1KRP A;  3ITH A;  2VG6 A;  1RCH A;  1T05 A;  4KI4 A;  4K8X A;  2HNZ A;  3DLH A;  1GOB A;  4CEF A;  4RW6 A;  1TKX A;  3I0R A;  3EYZ A;  3O4Q A;  3KLG A;  1HJR A;  4W5T A;  1RDB A;  4KB0 A;  3VQ5 A;  1WSJ A;  4AHS A;  4KO0 A;  4BE0 A;  3HJF A;  3OYL A;  3FFI A;  1SL1 A;  4CF1 A;  2ZQB A;  3AO2 A;  3RR8 A;  1U04 A;  1F21 A;  5HRO A;  1S1T A;  4HCB A;  4L8R B;  2BAN A;  2XY5 A;  4FM1 A;  4I9Q A;  2KTQ A;  2OPQ A;  3NFA A;  2GUI A;  3ALY A;  5SZT A;  3DRR A;  1ASU A;  4Q5V A;  2VG7 A;  2VWJ A;  3QNO A;  4HCC A;  4FK4 A;  3EZ5 A;  2KZZ A;  2IOC A;  1YT3 A;  3BGR A;  3CQ8 A;  2QKK A;  1KVA A;  3ZT2 A;  3DLG A;  4DQS A;  4FJG A;  3IRX A;  1EXQ A;  3OYE A;  3PO5 A;  3OYJ A;  4CHN A;  2WON A;  3ASM A;  3HP6 A;  3SYZ A;  1TKZ A;  2E4L A;  4CCH A;  4FZX C;  4M3U A;  2DTU A;  3D0P A;  3KK3 A;  3L2U A;  2VWK A;  3AA5 X;  4BE2 A;  4CJF A;  2B4J A;  3L2R A;  3G10 A;  1HPZ A;  1SV5 A;  4DTJ A;  3VQB A;  3LZI A;  4DU1 A;  4PUO A;  4OVL A;  1CZB A;  3V9U A;  4NCG A;  4K8Z A;  4B8A B;  4CJK A;  2XY7 A;  2G8W A;  4HUG A;  1X9W A;  3C94 A;  4CJ3 A;  1JLE A;  4KTW A;  4E89 A;  3OYC A;  1ZBL A;  4I2Q A;  4O4G A;  2GV9 A;  2YNH A;  1BGX T;  1WAF A;  3ZSY A;  1UOC A;  2FBT A;  3SJJ A;  3TAP A;  2ZD1 A;  4E7J A;  4HVJ A;  1A5V A;  2KW4 A;  1LW2 A;  1ZBU A;  4CE9 A;  1SKR A;  4DSJ A;  4EZ6 A;  5HP1 A;  4W5N A;  1ASW A;  1BHL A;  1NK0 A;  3M8S A;  4ELT A;  1YVU A;  1TK8 A;  4AIL C;  4O5B A;  3MEE A;  3V9S A;  2KFZ A;  4DLG A;  1NOY A;  4FK0 A;  4HUE A;  3K5L A;  1KTQ A;  3M8Q A;  4CK3 A;  1RBU A;  4CGI A;  5DK5 A;  4M3W A;  5FRN A;  3KLH A;  3KJV A;  3RWU A;  4DFJ A;  3ZT1 A;  4FJN A;  4FJ7 A;  3ZSV A;  3MXM A;  4KHU A;  1JLB A;  5E41 A;  4F4K A;  1ZBH A;  3V1Q A;  2R7Y A;  3V1R A;  3DLR A;  1LW0 A;  4LH4 A;  3OYB A;  3VQ7 A;  4BWJ A;  4CEQ A;  4Z4E A;  4LSL A;  4KRF A;  3MEG A;  1L3V A;  5JS1 A;  4FJ8 A;  4Z4H A;  3L2W A;  4FYD A;  1NKC A;  1NOZ A;  1D5A A;  4FZY A;  1LWC A;  3QIN A;  4RG8 A;  3T3F A;  1RDD A;  2D0B A;  3RRG A;  3NBP A;  1SL0 A;  1Q9Y A;  3WNG A;  3HM9 A;  4KB1 A;  3B6P A;  1LAW A;  4B9L A;  4FLV A;  1Z26 A;  3QO9 A;  3ZSR A;  4IDK A;  4CJR A;  2PYJ A;  4DSK A;  1TV6 A;  3H08 A;  4FLX A;  3LZJ A;  4DTR A;  3S3M A;  2VG5 A;  1ITG A;  3DM2 A;  1KVB A;  1ZBF A;  4KI6 A;  5FRM A;  4Z4G A;  3HXM A;  1SL2 A;  2HHV A;  1HNV A;  3RMD A;  4H4M A;  5CZ1 A;  4F8R A;  3OYI A;  4I2P A;  4KPY A;  4CED A;  4KV8 A;  1DLO A;  3TI0 A;  4JLH A;  3QEP A;  2QK9 A;  2F96 A;  4Y1C A;  3OYF A;  1RDC A;  1EP4 A;  3ZSQ A;  3JYT A;  3NE6 A;  4CFB A;  1BI4 A;  1VSL A;  3U3Y A;  4KHW A;  1EKE A;  1IH7 A;  3B6O A;  2Z1G A;  4N47 A;  2B6A A;  3TAN A;  4UQG A;  2HHX A;  3LPT A;  4AHU A;  1S6Q A;  4LY7 A;  1NK4 A;  3T19 A;  3DRP A;  3QEW A;  1SKS A;  4OLA A;  4M41 A;  4CHZ A;  4B9T A;  2EX3 A;  3OVN A;  4FLZ A;  1L3U A;  4FK2 A;  2G8I A;  3WNE A;  2OPR A;  2YKN A;  2QXF A;  4DQI A;  4DFP A;  4Q0B A;  3U6F A;  1K6Y A;  3NH0 A;  5C25 A;  1LWF A;  3JSM A;  3ZSX A;  1RBR A;  3DYA A;  1VSI A;  1REV A;  3VQ9 A;  4DF8 A;  4J2A A;  2F8T A;  1RNH A;  3AVC A;  1XI1 A;  2F8S A;  3SUP A;  4R5P A;  4M3X A;  1TL1 A;  1S5J A;  3VA0 A;  4IKF A;  3PX4 A;  1C0U A;  4E0D A;  1NK8 A;  2OZS A;  4FJK A;  1X9M A;  3LAK A;  4E7L A;  4MQ3 A;  4DF4 A;  3DRS A;  1Q9X A;  4O0J A;  2YNG A;  1N5Y A;  4DSE A;  1CXQ A;  3SUO A;  2DY4 A;  4N76 A;  3MAQ A;  4FJ9 A;  1C1C A;  3VQ8 A;  3SQ4 A;  4F3T A;  1D8Y A;  4DWI A;  3NF9 A;  2BGG A;  4CJS A;  4CK1 A;  4M42 A;  3QER A;  4DTO A;  2HHU A;  3TAB A;  1NKB A;  4NYN A;  4RW4 A;  4JRQ A;  4CEB A;  2G8H A;  1VSJ A;  3AA3 A;  2Z1H A;  5KGX A;  3SUQ A;  1S1V A;  3PV8 A;  3O4N A;  3OY9 A;  1RBV A;  4B9M A;  1IKW A;  4M3Y A;  3OYD A;  2LSN A;  3I0S A;  4CFC A;  3ULD A;  1RBS A;  4LSN A;  1WN7 A;  4RW9 A;  3ZSZ A;  5KRS A;  4YNQ A;  3NF7 A;  4OPJ A;  3SI6 A;  1C6V A;  1SUQ A;  4FM0 A;  2E6M A;  1NK7 A;  3K2P A;  4CEC A;  3OYM A;  4HTU A;  1FKP A;  4H8K A;  3ZT0 A;  3L2Q A;  5EU7 A;  4DSF A;  1I39 A;  4OKE A;  4QCL A;  1X9S A;  1VSK A;  3DLE A;  3BDP A;  1B9F A;  4H4O A;  1T03 A;  2P1J A;  3IG1 A;  4CGH A;  4CEA A;  1U4B A;  1L3T A;  4KRE A;  4E7I A;  3P83 D;  1TVR A;  3PUF A;  3QIO A;  3VQ4 A;  1BQM A;  4DFK A;  5J2N A;  3SQ2 A;  3V9W A;  4JS5 A;  3SPY A;  2XO7 A;  1UWB A;  4PA1 A;  3AVA A;  4M3T A;  4QOZ B;  1YTU A;  2PZS A;  2D5R A;  4KHQ A;  1MU2 A;  4CF8 A;  2DFH A;  3VQA A;  3VQQ A;  3K59 A;  2KFN A;  1WAJ A;  1WNS A;  3OJU A;  5KTQ A;  3OYN A;  4Y1D A;  1Z25 A;  4CGD A;  3V6D A;  1VSM A;  2Y1J A;  2FBV A;  3HVR A;  1BCM A;  3SCX A;  4EZ9 A;  4NCB A;  2G8U A;  4J2D A;  4FLW A;  2ETJ A;  3EY1 A;  4CJ4 A;  4CHQ A;  1VRT A;  1R0A A;  1NK6 A;  4F2S A;  5J2M A;  3HPG A;  2G8V A;  1VSE A;  1FKO A;  4FW1 A;  3AVF A;  4B08 A;  4DG1 A;  5HRP A;  5T7B A;  3HPO A;  2PY5 A;  3RR7 A;  3A2F A;  4CF0 A;  4DSI A;  2A1S A;  5KRT A;  2X6S A;  4FJI A;  4WE1 A;  1KVC A;  4EP4 A;  3NCI A;  1JLQ A;  3QET A;  4CHY A;  3KK1 A;  1NK5 A;  4TSX A;  1IKV A;  4M45 A;  1D9F A;  4BDZ A;  3KTQ A;  1U47 A;  4KHY A;  3CM5 A;  1KFD A;  1RBT A;  2JLE A;  3HP9 A;  3ZT4 A;  4E3S A;  1JL2 A;  3KLI A;  1J9A A;  1UAX A;  4CGJ A;  3K5M A;  4CEO A;  3HVT A;  1RIL A;  3O3G A;  2HHT A;  3CFP A;  1B92 A;  4O44 A;  1Q8I A;  3V4I A;  1U48 A;  1JL1 A;  1S1W A;  3C6U A;  4KHN A;  4CJU A;  3V81 A;  1JLA A;  3ZT3 A;  1HMV A;  3ZSW A;  4JS4 A;  1N6Q A;  3KKS A;  4FM2 A;  1NJZ A;  3HT3 A;  3AO3 A;  1U49 A;  3VQC A;  3K5O A;  2WOM A;  1HRH A;  1RT4 A;  3DI6 A;  4IFY A;  5DMR A;  2JGU A;  3DOL A;  4BWM A;  4CFA A;  1A5W A;  3NDK A;  2DFE A;  3NH2 A;  4BAC A;  2G8K A;  4Z4F A;  4XIU A;  1LV5 A;  3O3H A;  1WSF A;  4QAG A;  1C0M A;  1WSE A;  2P5G A;  3P5J A;  3LAM A;  1JLG A;  4W5O A;  2FBX A;  4O0I A;  1QE1 A;  4FZZ A;  2HVH A;  3VQ6 A;  2A1R A;  1JXB A;  2FBY A;  3DMJ A;  1EET A;  1XC9 A;  4J2E A;  2Z1I A;  3KIO A;  4CIG A;  4DTU A;  1RDA A;  5SWM A;  4F2R A;  4C8L A;  4CK2 A;  1CXU A;  4DQP A;  1T8E A;  5FRO A;  1RTH A;  1FK9 A;  1KLN A;  4KFB A;  4KAZ A;  2BE2 A;  1I3A A;  4G1Q A;  4MFB A;  4DS4 A;  4DTN A;  3QES A;  3KLE A;  3VQE A;  4CIF A;  1JLF A;  2O4I A;  1D9D A;  3QEI A;  3OYH A;  3SUN A;  1BIS A;  1G15 A;  4CES A;  3OYA A;  3L3U A;  4CJQ A;  3HPH A;  3OS0 A;  3NGI A;  3ISN C;  3F73 A;  3NAE A;  4DQQ A;  2QKB A;  1VSH A;  1RT7 A;  3LP1 A;  2GBZ A;  2O4G A;  2XRI A;  1LWE A;  1HQE A;  5D3G A;  2B5J A;  3KKR A;  1HYS A;  3VN5 A;  3OYG A;  2YNF A;  3MED A;  2RN2 A;  3HYF A;  4W5R A;  4CHP A;  1L3S A;  4CHO A;  4E19 A;  3RMC A;  3LWM A;  4M3Z A;  4OKK A;  5CYM A;  1RT2 A;  4DQR A;  3AVL A;  4FW2 A;  4RW7 A;  1S9E A;  3HO1 A;  3SQ0 A;  2Z1J A;  1TAU A;  1RT6 A;  1HNI A;  1BIZ A;  3QLH A;  3SV4 A;  4DS5 A;  2Y1I A;  1S9G A;  3S3N A;  1IKY A;  4ELU A;  1IKX A;  2XY8 A;  4FLY A;  2IGI A;  4FLT A;  4RW8 A;  4C8M A;  3LP2 A;  4KHS A;  1VRU A;  3HK2 A;  3AVG A;  4ELV A;  2HMI A;  4DMN A;  2Q3S A;  1NJW A;  1BQN A;  3DLK A;  1KFS A;  1RTJ A;  2EHG A;  2P5O A;  3CM6 A;  4IBN A;  3C95 A;  3OS2 A;  3P1G A;  1T7P A;  3NHG A;  1S6P A;  4EP5 A;  4DTM A;  5C24 A;  4PWD A;  4C8K A;  3TAM A;  2XY6 A;  1TK0 A;  1J54 A;  3TR8 A;  1NKE A;  3CFR A;  4AHR A;  1HYV A;  4CER A;  4DLE A;  4FJ5 A;  1VK0 A;  3WNF A;  4E1N A;  3SV3 A;  4KTZ A;  3LAL A;  2KQ2 A;  4FVM A;  1XWL A;  4KTQ A;  4CIE A;  4CEE A;  3TAG A;  2OPP A;  5HRS A;  1UA0 A;  4C8N A;  1TK5 A;  1RT1 A;  4LD0 A;  4ZTJ A;  2P51 A;  3AVM A;  1B9D A;  2DFF A;  3ZCM A;  4Z4C A;  3UIQ A;  1W0H A;  4NCA A;  3SQ1 A;  1Y97 A;  1GOA A;  4YFU A;  4N41 A;  1TL3 A;  3I8D A;  3HST B;  4FXD A;  3AA2 A;  4CGG A;  1XHZ A;  2PYL A;  1QS4 A;  1C1B A;  1RT3 A;  1YTA A;  4E7K A;  3CYM A;  3ZSO A;  3AVI A;  5CYQ A;  4B9S A;  3O3F A;  3QEX A;  4ID1 A;  4CGF A;  4M3R A;  1KSP A;  1KLM A;  2HND A;  3LAN A;  4O55 A;  1VSF A;  5HBM A;  3RRH A;  4BDY A;  3QNN A;  3IS9 A;  4Z0U A;  2E6L A;  2YNI A; 
#chains in the Genus database with same CATH topology
 4CI6 A;  5C2D A;  2HVI A;  2ITG A;  4DV3 K;  4WFN L;  4OPH A;  1BCO A;  4KPY A;  1BO5 O;  2O8C A;  3U3G A;  1GLA G;  4ID5 A;  1QSY A;  4NLC A;  2E1Y A;  2OA8 A;  1QTM A;  4OO1 J;  2RF2 A;  4IG0 A;  1XC3 A;  2HB5 A;  1QSS A;  4F3O A;  3QEV A;  1XUP O;  4PQU A;  2VWB A;  4AHV A;  4A59 A;  5EX5 A;  1CZ9 A;  1WSI A;  4B9V A;  5JIC A;  3QML A;  3CD6 N;  1YI2 N;  1J53 A;  3RMB A;  4BR9 A;  4GV9 A;  4X64 K;  5JLH A;  4BVP A;  1K8K A;  2OZM A;  2NLX A;  3K58 A;  4JI5 K;  2X78 A;  4B3O A;  5AQK A;  3O9S A;  1JCG A;  4AHT A;  2XHB A;  2ZGY A;  5BPM A;  4E1M A;  2AJQ A;  1NK9 A;  3I8B A;  3A5N C;  2OYQ A;  1X9J A;  2D0A A;  1RTI A;  4FOI A;  4G9Z A;  2YX6 A;  1O1W A;  1EWR A;  1FXX A;  2V7Y A;  4CFD A;  4JD2 B;  1JKH A;  5AQX A;  2YI1 A;  2W40 A;  4GVM A;  3C6T A;  2O8B A;  3G0Z A;  3L2V A;  1CZA N;  2HHQ A;  3NH1 A;  1X1P A;  1XMO K;  4JKE A;  5JMV A;  3LWL A;  5HRN A;  3VF2 A;  3S9H A;  1QQN A;  2NUB A;  3F9K A;  3LDS A;  3AVJ A;  1GOC A;  3GOI A;  2Q1N A;  2A41 A;  3TTC A;  1TKD A;  5BRH A;  2FF3 B;  4H5V A;  4HHT A;  2KZM A;  3K57 A;  4DTP A;  2YV0 X;  1TAQ A;  4OPK A;  4YOW A;  4FJL A;  5FLX O;  1MWM A;  4H0O A;  3O1B A;  3NF8 A;  4DV7 K;  4BG9 A;  3DOK A;  1K73 O;  4LH5 A;  5LMN K;  3R8E A;  4PY5 A;  1S22 A;  2VG6 A;  1RCH A;  3BEX A;  4BRF A;  1NGE A;  5BN9 A;  2D0O A;  1HJR A;  1WSJ A;  4BE0 A;  3HSC A;  3MN6 A;  1ZC6 A;  3KWG A;  4BR4 A;  4HCB A;  1OVQ A;  3Q7C A;  1S1T A;  4L8R B;  2BAN A;  2GUI A;  4A5B A;  3DRR A;  4HCC A;  4Q5V A;  2VG7 A;  3QNO A;  3EL2 A;  4UY8 O;  1YT3 A;  3BGR A;  1KVA A;  3DLG A;  4DQS A;  3OYE A;  2KKZ A;  2V7Z A;  3AGR A;  2WON A;  3D2F B;  4JAX A;  3SYZ A;  1TKZ A;  3CJ7 A;  3BY5 A;  3G10 A;  2WTU A;  4M7Y A;  1OH5 A;  1RGI A;  3A0I X;  1JLE A;  4KTW A;  1NGD A;  5F2R A;  4JKH A;  2ASM A;  2IVN A;  4PL8 A;  1UOC A;  4Y0W A;  3TAP A;  2ZD1 A;  1QHA A;  1A5V A;  1O13 A;  2KW4 A;  3CCU N;  3H1Q A;  2O8E B;  4O5B A;  4FK0 A;  3M8Q A;  4CK3 A;  1ATS A;  2JWL A;  4I6M A;  3ZT1 A;  3MXM A;  4KHU A;  4FO0 A;  4FSV A;  5E41 A;  1VQ8 N;  3WUH A;  2E2P A;  3OYB A;  4BWJ A;  3O4W A;  4Z4E A;  4Z4H A;  3VEO A;  4BY9 C;  1YUW A;  1NOZ A;  4FWL A;  2E2Q A;  5KPT A;  3T3F A;  2D0B A;  5AQM A;  4CVN E;  2QXL A;  4H0P A;  4CJR A;  4B1V A;  1XNQ K;  3LZJ A;  4DTR A;  3DM2 A;  1YJW N;  1JJ2 M;  3C6H A;  1SL2 A;  1DGK N;  4I2P A;  4CED A;  3TI0 A;  4CZE A;  2QK9 A;  4A61 A;  4BRL A;  1NU0 A;  4BC5 A;  4JK9 A;  1SAZ A;  1VSL A;  2AA4 A;  3MX2 A;  3U3Y A;  4KHW A;  2UXD K;  1M90 O;  4AHU A;  4YOU A;  4A5A A;  1NK4 A;  1SKS A;  4M41 A;  3FZF A;  3FZM A;  2G8I A;  2QW9 A;  1K8K B;  5C25 A;  1LWF A;  3JSM A;  3ZSX A;  5BRD A;  1VSI A;  1RNH A;  5AQG A;  3PX4 A;  2P9N A;  5M1O A;  1X9M A;  3CCV N;  5LJV A;  4JI2 K;  1N5Y A;  3ATV A;  4DSE A;  4WQ5 C;  2E8A A;  4FJ9 A;  3OTO K;  4DR7 K;  4A2B A;  3MN5 A;  2BGG A;  3TSU A;  4IJN A;  3P39 A;  2HBK A;  1BOT O;  3AA3 A;  4ILJ A;  2O8B B;  4B9M A;  2E2O A;  3I0S A;  3NF7 A;  3EZW A;  4DSF A;  4BRP A;  3H3O B;  1VSK A;  3ATU A;  5LL6 Z;  1B9F A;  2O8D A;  4BRI A;  4KRE A;  1L3T A;  5AQH A;  3P83 D;  3QIO A;  5JVH L;  3QBX A;  1UWB A;  4PA1 A;  3DWL A;  4C23 A;  4QOZ B;  2D5R A;  2ITM A;  2P9K B;  5AZI B;  3K59 A;  1WAJ A;  5AQT A;  3MWP A;  5KTQ A;  3ZLJ A;  4Y1D A;  1Z25 A;  4DV1 K;  4RCH A;  2Y1J A;  3O9R A;  2ETJ A;  1VRT A;  2FSJ A;  4LC9 B;  5J2M A;  1VSE A;  4FW1 A;  4B9Q A;  3CJA A;  5T7B A;  2A1S A;  3IKM A;  1NGA A;  4BRD A;  3CCS N;  2P9S A;  3MMV A;  1NGI A;  4BRH A;  1VQL N;  4CHY A;  3DXM B;  1KFD A;  1RBT A;  3TTD A;  1JL2 A;  1IG8 A;  1UAX A;  3K5M A;  4CEO A;  1VQ9 N;  1RIL A;  1NMN A;  3O3G A;  1NG9 A;  3H45 C;  4O44 A;  1Q8I A;  5GAH P;  2PFU A;  1S1W A;  4BRE A;  5BR9 A;  4HTL A;  4JS4 A;  3CME N;  4JKC A;  4FM2 A;  2YCH A;  3UKU A;  3AO3 A;  4M63 C;  3VQC A;  1U2V A;  3ZET B;  2WOM A;  3DOL A;  2YJF A;  4Z4F A;  3SMP A;  2H3G X;  1U6Z A;  3JS6 A;  4IO8 A;  2HVH A;  3VQ6 A;  2A1R A;  1JXB A;  2FBY A;  3DMJ A;  1XC9 A;  4J2E A;  3KIO A;  4DTU A;  4KH4 A;  4F2R A;  1BU6 O;  4C8L A;  1IJJ A;  1T8E A;  2Q97 A;  4JI6 K;  4KFB A;  4KAZ A;  3QES A;  2E5L K;  3L0Q A;  2FXU A;  4WYB A;  1D9D A;  1JCE A;  3OYA A;  1S3X A;  3L3U A;  4CJQ A;  3HPH A;  3OS0 A;  3NGI A;  3ISN C;  1VSH A;  3QDK A;  5D3G A;  2QEX N;  4U67 L;  5AQJ A;  4CHP A;  1OH6 A;  4E19 A;  3LWM A;  4M3Z A;  5EY4 A;  4DQR A;  2Z1J A;  4PKG A;  2Y1I A;  3VF6 A;  4DS5 A;  3S3N A;  1IKY A;  3PIO L;  2CGJ A;  2ZGZ A;  4FLY A;  4FLT A;  3SLC A;  4C8M A;  3LP2 A;  4KHS A;  3HK2 A;  3AVG A;  4GV3 A;  2HMI A;  2Q3S A;  1BQN A;  4DCH A;  1KFS A;  1RTJ A;  2EHG A;  2HBM A;  3CM6 A;  4CZL A;  2UUB K;  2P5O A;  3QB0 A;  1S6P A;  4DTM A;  3J7A P;  3TAM A;  4H0T B;  1TK0 A;  3I55 N;  1HYV A;  3WXL A;  4PL7 A;  4FJ5 A;  2IIR A;  3WNF A;  4JV5 K;  5HRS A;  1UA0 A;  5AQN A;  4C8N A;  1TK5 A;  4RWT A;  5AFU H;  4LD0 A;  2P51 A;  4NCA A;  2ZWH A;  4N41 A;  3I8D A;  3HST B;  4FXD A;  3OBW A;  4CGG A;  4CD3 A;  1XHZ A;  4BQZ A;  1XNR K;  5JLF A;  4B9S A;  3CI5 A;  3O3F A;  3QEX A;  1KSP A;  1VSF A;  4BRC A;  5HBM A;  2P9I B;  5AQW A;  4Z0U A;  2KLA A;  2YNI A;  2E6L A;  4YDU C;  5IWA K;  1IG9 A;  3KWI A;  2HW3 A;  1YIT N;  5CY4 A;  4EIA A;  1RDU A;  4W5Q A;  4JRP A;  3WXJ A;  2ASP A;  4C8O A;  5JS2 A;  4B9U A;  3VER A;  3CJB A;  5GIP A;  4FCY A;  1J5O A;  3KD1 E;  5AQQ A;  5AZJ A;  3U4L A;  4DTS A;  4ZTF A;  3CFO A;  3FGU A;  2IVP A;  3LP3 A;  4I9L A;  5ADX H;  3D45 A;  1TKT A;  1EX4 A;  2YHB A;  3RMA A;  4KHP K;  3T69 A;  1DTQ A;  4YHH K;  4ISF A;  1ASV A;  1RDW X;  3LDL A;  1ZYQ A;  2Q2R A;  1VSD A;  2QWQ A;  4WQ4 C;  5J2Q A;  4DR6 K;  3DXK B;  4IEE A;  3C6A A;  4CF9 A;  1EWQ A;  4H03 B;  1N36 K;  3TAQ A;  5AQZ A;  3UKR B;  1IO2 A;  1HQU A;  4JI1 K;  1OVY A;  4FJM A;  3C7N B;  1U45 A;  5ELZ A;  1SZ2 A;  1CLQ A;  5I42 A;  3RSE B;  3LDN A;  2X6N A;  2OTJ N;  3F9M A;  3AVH A;  2F9T A;  4BDP A;  1X3M A;  3AA4 A;  4WFB L;  1NJX A;  3L3V A;  1C0T A;  1A5X A;  4EAH D;  1HKB A;  2YKM A;  3AO5 A;  1W9H A;  3THW A;  2D0C A;  3RTV A;  4HUF A;  1WB9 A;  1DTT A;  3KVG A;  4IFE A;  2WBN A;  3MXJ A;  4H0V B;  1BI4 B;  3KZB A;  3OJS A;  1WOQ A;  3KK2 A;  4CEZ A;  3J80 O;  4DU4 A;  2X74 A;  5H1S Q;  4AH9 A;  2IAJ A;  1LOT B;  1QQO A;  4WQ5 A;  4BE1 A;  3MWT A;  3ITH A;  4KI4 A;  4H0Y B;  4CEF A;  3G4S N;  2QI2 A;  3I0R A;  4JN4 A;  3AAP A;  3KLG A;  4W5T A;  4KO0 A;  3HJF A;  3FFI A;  5C10 A;  4CF1 A;  4LF6 K;  3AO2 A;  2GWJ A;  3RR8 A;  2KTQ A;  2OPQ A;  3ALY A;  3GDQ A;  4FK4 A;  4BRO A;  3CCM N;  2QKK A;  3ZX3 A;  3ZT2 A;  3MK6 A;  4CHN A;  1HX1 A;  3ASM A;  4CCH A;  4FZX C;  4M3U A;  3D0P A;  3L2U A;  3PLA A;  3AA5 X;  4X62 K;  3L2R A;  3ENB A;  1HPZ A;  4DTJ A;  4K41 A;  4PUO A;  1NGH A;  1Y64 A;  4OVL A;  3ID8 A;  4CJK A;  3A5L C;  3IMX A;  3L6Q A;  4CJ3 A;  1ZBL A;  4I2Q A;  4FJI A;  2GV9 A;  3ZSY A;  2FBT A;  3VGM A;  1HKG A;  4QS9 A;  1LW2 A;  4XH5 A;  4B1U B;  1BHL A;  1YVU A;  1TK8 A;  4HUE A;  4FWN A;  1RBU A;  3CJC A;  4CGI A;  5DK5 A;  4X66 K;  3KLH A;  3RWU A;  1D4X A;  3ULE A;  3AY9 A;  5EXW A;  5BRE A;  4FJ7 A;  1JLB A;  4F4K A;  1VQ6 N;  4LH4 A;  3BZC A;  3HOT A;  1YVN A;  3M1F A;  4LFA K;  4FJ8 A;  5KQD A;  2VYP A;  3QIN A;  3RRG A;  4H5R A;  1Q9Y A;  4DUY K;  1LAW A;  3ZSR A;  4DSK A;  4IDK A;  3H08 A;  3S3M A;  2ZJP L;  4CZM A;  1KVB A;  3VEW A;  1IV0 A;  5FRM A;  2HHV A;  4PKH A;  3RMD A;  5CZ1 A;  1VQK N;  3W3D A;  5AZJ B;  4KV8 A;  2PAV A;  1DLO A;  3CCR N;  3RVC A;  3OYF A;  1EP4 A;  4CZJ A;  1VQM N;  4BRM A;  5BPN A;  1GLD G;  3ZX0 A;  4R79 A;  3W0L A;  4N47 A;  2B6A A;  2HHX A;  1S6Q A;  4OLA A;  4CHZ A;  3OVN A;  3VES A;  4FLZ A;  4FK2 A;  3WNE A;  3NVK A;  2QXF A;  3HOS A;  1NGG A;  4DFP A;  1QZ5 A;  3UB5 A;  3U6F A;  3CJ9 A;  3BUZ B;  3DAW A;  1XI1 A;  3EE9 A;  4R5P A;  4M3X A;  3WXK A;  1YF5 L;  3VA0 A;  4IKF A;  4E0D A;  4DF4 A;  4MQ3 A;  3MN9 A;  2A42 A;  4FL9 A;  3VQ8 A;  3OHR A;  4JNE A;  2A3Z A;  3NF9 A;  4DR2 K;  4CJS A;  2HHU A;  4M42 A;  4V19 S;  3TAB A;  3O9T A;  4NYN A;  2OCE A;  4RW4 A;  1TYQ B;  3O4N A;  3OY9 A;  1IKW A;  4M3Y A;  2P9L A;  1D8Y A;  4YOV A;  4KI6 A;  4BR7 A;  2G8W A;  1E3M A;  4FOE A;  1NWK A;  4FM0 A;  1KQS M;  3K2P A;  3OYM A;  4HTU A;  4H8K A;  3ZT0 A;  3L2Q A;  1ATR A;  3OA9 A;  3VEZ A;  4IWV A;  1T03 A;  2NNW A;  3IG1 A;  2NRT A;  4CGH A;  1U4B A;  3ZEU B;  4DFK A;  3PUF A;  4CZK A;  5J2N A;  3SQ2 A;  4JS5 A;  4EHU A;  1YTU A;  4KHQ A;  2QWM A;  5A2Q O;  4B3M K;  2DPN A;  3VQQ A;  3VTI A;  2KFN A;  3U9D A;  4H0X B;  4JHD A;  1VSM A;  3A5M C;  3HVR A;  3SCX A;  3SBT A;  4NCB A;  3VMF B;  4BR5 A;  4BRK A;  4CJ4 A;  4CHQ A;  4JKG B;  1NK6 A;  1DT9 A;  3AVF A;  4B08 A;  5TKW A;  4A57 A;  5HRP A;  3HPO A;  2PY5 A;  4DSI A;  5KRT A;  4IO9 L;  4XEI A;  1NMD A;  4WE1 A;  2WFB A;  1KVC A;  3PSF A;  3QET A;  1IKV A;  1D9F A;  3K0S A;  4BDZ A;  4ILG B;  1U47 A;  4KHY A;  3HP9 A;  3ZT4 A;  4E3S A;  4CZG A;  3THY A;  5KPZ A;  2YHY A;  2O8F A;  2I7P A;  2HHT A;  2HBL A;  4KHN A;  4B3R K;  1JLA A;  1G99 A;  2UYT A;  3ZSW A;  3WXM B;  5FPE A;  4JKB A;  3K5O A;  2O8C B;  4B3S K;  2JGU A;  4BWM A;  2GEM A;  4CFA A;  1A5W A;  3NH2 A;  4BAC A;  4WF9 L;  4XIU A;  1LV5 A;  1C0M A;  1JLG A;  3J8A A;  4WQ4 A;  4GY2 B;  3HTV A;  2Z1I A;  1WBD A;  2Q0U A;  3LDP A;  1CXU A;  4DQP A;  4DR4 K;  1FK9 A;  1KLN A;  1HNX K;  4MFB A;  3KLE A;  1KC8 O;  1EQY A;  3MCA B;  3EE8 A;  2O4I A;  3QIC A;  2WC9 A;  1G15 A;  4CES A;  3NVM A;  1GLB G;  1NGJ A;  4NO7 A;  4JYA K;  3NAE A;  4DQQ A;  2QKB A;  3LP1 A;  2O4G A;  2WUS A;  4BRG A;  1NNE A;  3VEV A;  3MED A;  4W5R A;  3HYF A;  1RFQ A;  4CHO A;  3RMC A;  3BP8 A;  5CYM A;  3AVL A;  1S9E A;  3HO1 A;  1TAU A;  1RT6 A;  1HNI A;  3HI0 A;  3QLH A;  3R3L A;  3CCL N;  2XY8 A;  3K9K A;  4WFA L;  3CJ1 A;  3FZH A;  1VRU A;  3E9L A;  4DMN A;  1C0G A;  5M1Q A;  1VQP N;  3E66 A;  3C95 A;  3OS2 A;  3P1G A;  4EP5 A;  4PWD A;  4H5W A;  5GAD P;  3M6G A;  2XY6 A;  4JI7 K;  4BC3 A;  4CER A;  3CC4 N;  4H5T A;  1W7A A;  2KQ2 A;  4FWO A;  4CIE A;  4LF5 K;  3TAG A;  3A5O C;  5M1N A;  4C1N I;  1Z05 A;  2HST A;  4Z4C A;  1B9D A;  2DFF A;  1IBM K;  4BRQ A;  4DR5 K;  5BPL A;  3SQ1 A;  1Y97 A;  4YFU A;  1TL3 A;  4ILH A;  5C15 A;  2PYL A;  1QS4 A;  1SS6 A;  3F2K A;  4ID1 A;  4CGF A;  2HND A;  4O55 A;  5E26 A;  4BDY A;  4B1Y B;  2GTD A;  3N4P A;  3CER A;  4EP4 A;  3AVK A;  2A5X A;  3THV A;  4NYF A;  4MO4 A;  3LDQ A;  2ZE2 A;  1BL3 A;  4J8F A;  1WSG A;  4CJE A;  5I3U A;  3KLF A;  4B8C A;  3S3O A;  4CJV A;  3VQP A;  1VHX A;  3WEE A;  1KAX A;  2IC3 A;  2HHS A;  1H1V A;  4AF1 A;  1BDG A;  4B1W B;  1DKG D;  4BG8 A;  4GW6 A;  2NRV A;  4NLB A;  5MLC Q;  4CZH A;  2ZF5 O;  3GG4 A;  3TAE A;  3CMA N;  3T1A A;  1ZBI A;  4MDB A;  4WCE L;  3PX0 A;  3PY8 A;  4MLE A;  4YY3 K;  3VA3 A;  3WNH A;  3SZ2 A;  1QHT A;  1N8R O;  2IDO A;  3THX A;  4OKJ A;  4DHY A;  3P31 A;  4N56 A;  4DU3 A;  4DTX A;  4Z4I A;  4GMJ B;  4CJ5 A;  3LPU A;  4IXC A;  5M1F A;  4DFM A;  4I6M B;  3HM8 A;  4DSL A;  2HNY A;  3MEC A;  4IOC L;  1JXE A;  2BDP A;  4B9N A;  2VCP A;  4OGE A;  2YHA A;  3OW2 M;  1QSL A;  5HOO A;  3OS1 A;  3NF6 A;  1T44 A;  3V9X A;  2VGM A;  4KKO A;  3DLB A;  4IOX A;  4CJL A;  4CJT A;  4PHT X;  2HHW A;  5LY3 A;  2V52 B;  1VQN N;  3KD5 E;  1HPM A;  4FWS A;  2I5J A;  3BF3 A;  1XQS C;  1C1A A;  5AQP A;  1QVF M;  3HL8 A;  4BRN A;  4ZHR A;  5KGW A;  2FF6 A;  3O1W A;  1UA1 A;  1WLJ A;  3AO4 A;  3WT0 A;  3J7Y P;  1W2B M;  1V4T A;  2F9W A;  2A6A A;  2CGL A;  2FC0 A;  1TGO A;  3D2E A;  2F4V K;  1ATN A;  3TAF A;  5AQY A;  1NGC A;  3ZX2 A;  3VQD A;  3K5N A;  1NJY A;  4IFV A;  1KRP A;  4LF4 K;  4JI3 K;  3NMU A;  4K8X A;  4FWK A;  3DLH A;  2E20 A;  1TKX A;  3EYZ A;  3O4Q A;  4AM6 A;  3VET A;  2YHW A;  2JWK A;  4LF9 K;  2P9N B;  1F21 A;  5HRO A;  2OTL N;  4FM1 A;  1ASU A;  4A62 A;  2KZZ A;  2IOC A;  3P38 A;  4BGA A;  2V51 B;  5HL7 L;  3PO5 A;  3OYJ A;  3J81 O;  4EHT A;  1VQ5 N;  4K43 A;  2DTU A;  2W6L A;  4K42 A;  2CH6 A;  2B4J A;  1OH8 A;  1SV5 A;  3VQB A;  3LZI A;  5FPD A;  5F0X A;  4K8Z A;  1CZB A;  4NCG A;  4B8A B;  1N33 K;  4HUG A;  3C94 A;  3OYC A;  3FZL A;  3HZ6 A;  3J7Z O;  2O8D B;  2YNH A;  1BGX T;  4YOR A;  4E7J A;  3T7Z A;  4HVJ A;  3VPZ A;  1ZBU A;  1SKR A;  4DSJ A;  5HP1 A;  3LM9 A;  1NK0 A;  3M8S A;  4ELT A;  2Q31 A;  3M5R A;  3V9S A;  1NOY A;  1ZBS A;  2QWO A;  3K5L A;  4HWI A;  4M3W A;  3KJV A;  1P90 A;  3ZSV A;  2J4R A;  3CQY A;  4KH6 A;  4BGB A;  1ZBH A;  2UXB K;  1K9M O;  4LF8 K;  3V1Q A;  3V1R A;  1T3V A;  1DEJ A;  3DLR A;  4CBW A;  3VQ7 A;  3O6W A;  4CEQ A;  4LSL A;  3L2W A;  1FW6 A;  4FYD A;  1NKC A;  4FZY A;  4RG8 A;  1RDD A;  2P9S B;  1SL0 A;  3HM9 A;  4B9L A;  4OPA A;  4FLV A;  4IDH A;  1YIJ N;  2UUC K;  1TV6 A;  4FLX A;  3T1H K;  1ITG A;  5CE3 A;  3WEE B;  4Z4G A;  3HXM A;  1HR0 K;  4JLH A;  2F96 A;  4Y1C A;  5FPN A;  1RDC A;  3NE6 A;  5CR4 A;  3R1X A;  2D4W A;  4CFB A;  2NRW A;  1EKE A;  1IH7 A;  3UKU B;  4H5N A;  1U2V B;  3TAN A;  3LPT A;  3CCQ N;  3DRP A;  4IZ9 A;  3O80 A;  4B9T A;  4BR2 A;  2P9U A;  3SMS A;  3HRG A;  3SAG A;  1GLE G;  2OPR A;  2YKN A;  4DQI A;  3H6E A;  4JK7 A;  4KBO A;  1RBR A;  3N4Q A;  3VQ9 A;  1REV A;  2GUP A;  2F8T A;  1YAG A;  2F8S A;  4KH5 A;  5BR8 K;  5KQ8 A;  1C0U A;  4FJK A;  2OZS A;  1VQ4 N;  3DRS A;  3TPQ A;  3QFU A;  5AFU A;  1C1C A;  2IVO A;  3SQ4 A;  5AQI A;  5C12 A;  1YXQ A;  3QER A;  1Q86 O;  3D2F A;  2UXC K;  2G8H A;  3KHY A;  3SUQ A;  2Z1H A;  2HOE A;  3L4Q A;  3OYD A;  2RHK A;  3ULD A;  1RBS A;  1I94 K;  1WN7 A;  4RW9 A;  3SI6 A;  2E6M A;  4CEC A;  3CQX A;  5BN8 A;  1ESV A;  1KAY A;  3DLE A;  4YOY A;  2P1J A;  3OBY A;  4CEA A;  4E7I A;  1TVR A;  4DKW A;  5AQR A;  4FWQ A;  2XO7 A;  3AVA A;  4DR1 K;  2O8E A;  1MU2 A;  3OJU A;  1R0A A;  5AQF A;  3V6D A;  5C0Y A;  5AQO A;  5F1X A;  4EZ9 A;  2G8U A;  4J2D A;  4F2S A;  4GV6 A;  2NRX A;  3EN9 A;  1FKO A;  4DG1 A;  3U8X A;  5KPR A;  1HNW K;  4CW7 B;  3A2F A;  4CF0 A;  4CD1 A;  4MDA A;  3VF4 A;  2X6S A;  3MDQ A;  3NCI A;  4X65 K;  3VEN A;  2ZM6 K;  3KTQ A;  3DJC A;  3CM5 A;  3WQU A;  4GNI A;  1LCU A;  3KLI A;  1HUX A;  4CBU A;  4CGJ A;  3HVT A;  1M1K O;  3CFP A;  1B92 A;  1U48 A;  4CJU A;  4M7X A;  4GKJ K;  4BC4 A;  1N6Q A;  3KKS A;  1NJI O;  1T6C A;  2GX9 A;  1HJO A;  1RT4 A;  3O8M A;  1NM1 A;  3ENH A;  4OX9 K;  4JKA A;  3NDK A;  3SJH A;  2DFE A;  1WSF A;  3AAQ A;  1J5E K;  2D0P A;  2P5G A;  3P5J A;  3LAM A;  4W5O A;  2CGK A;  1QE1 A;  2E2N A;  3QFP A;  3WQT A;  2YHX A;  4CIG A;  2I7N A;  5SWM A;  1KD1 O;  4CK2 A;  3MX5 A;  5FRO A;  2BE2 A;  2UUA K;  4CIF A;  1JLF A;  1QZ6 A;  1BIS A;  3C65 A;  5AQS A;  1RT7 A;  1QVG M;  1IBK K;  3EKS A;  1T6D A;  2XRI A;  1LWE A;  2B5J A;  1HYS A;  3OYG A;  2YNF A;  3U9Z A;  5GAE P;  4O8K A;  1L3S A;  1MDU B;  3LL3 A;  4OKK A;  4XH1 A;  1RT2 A;  4QS8 A;  5C2F A;  4RW7 A;  5E84 A;  3G6E N;  1S9G A;  1IKX A;  4K0K K;  3CPW M;  4RW8 A;  2KHO A;  4ELV A;  1NJW A;  1N32 K;  2P9K A;  5LMU K;  1Q18 A;  2P9U B;  5AZI A;  3PIP L;  2NRZ A;  3THW B;  1BA0 A;  5C24 A;  1VQ7 N;  1BA1 A;  4C8K A;  1NKE A;  4AHR A;  4DLE A;  5GIO A;  1VK0 A;  2QM1 A;  4E1N A;  4KTZ A;  4F9O A;  3TSQ A;  3LAL A;  4KTQ A;  3FLC O;  2VQE K;  1P8Z A;  1RT1 A;  4ZTJ A;  3M3Z A;  2Q36 A;  3DXM A;  1GOA A;  4BRA A;  3AA2 A;  1W97 L;  1HNZ K;  1C1B A;  1RT3 A;  4JK8 A;  4E7K A;  3CYM A;  3ZSO A;  3AVI A;  5CYQ A;  2BH1 A;  3SBG A;  1KLM A;  3TU5 A;  3RRH A;  3QNN A;  3IS9 A;  4YDU A;  2HF4 A;  1W0H A;  3JYT A;  1BIU A;  2E1Z A;  2VQF K;  3V1O A;  3E01 A;  2G8F A;  4OGC A;  3ZET A;  4DWI A;  3TAR A;  3PSI A;  5JVG L;  3VGK A;  3CCE N;  5J1E A;  3TWH A;  4DV6 K;  2GWK A;  2W6K A;  4DUZ K;  3VEY A;  3H3N O;  2HF3 A;  3B8A X;  5J2P A;  4CJP A;  5C42 A;  1JCF A;  4ICL A;  5AQL A;  3ENO A;  1C0F A;  1OH7 A;  3NGZ A;  5FDL A;  4MO5 A;  5HRR A;  4AQY K;  2IS3 A;  1JLC A;  3M8P A;  3AV9 A;  3AVN A;  1LAV A;  1SKW A;  2RKI A;  2CH5 A;  4OJR A;  4RTF D;  4OLB A;  4CBX A;  3QIP A;  4FJX A;  3QBW A;  3ULE B;  1KCF A;  2HHH K;  4I7F A;  5KI6 A;  3CHW A;  5EVZ A;  4J2B A;  4PKI A;  3SPZ A;  4O8U A;  1QQC A;  1WSH A;  3V9Z A;  1K8A O;  2YJE A;  3MXI A;  2RPI A;  3NGY A;  1FJG K;  2W42 A;  2QWP A;  4DR3 K;  1HYZ A;  4FJJ A;  4N5S A;  4DV5 K;  4CJW A;  5B8H A;  1RT5 A;  5HLF A;  4FJH A;  3EO3 A;  2OPS A;  4E1J A;  5K14 A;  3EEQ A;  3PX6 A;  4CF2 A;  3CG7 A;  3L8B A;  1RTD A;  1S1X A;  4IG3 A;  1YJN N;  1XHX A;  3BZK A;  4E7H A;  3AGK A;  5CZ2 A;  3M8R A;  3SNN A;  5DM6 L;  4FLU A;  3H46 O;  4XH4 A;  4FVU A;  3IAY A;  2QTD A;  4ISG A;  3JXU A;  1S1U A;  2BUP A;  3LP0 A;  3OYK A;  1GLJ O;  2HMP A;  3AVB A;  2ATQ A;  5AJ3 K;  5LJW A;  3AO1 A;  4AHC A;  3PO4 A;  1L5U A;  1TUU A;  1T05 A;  1Z6R A;  2AP1 A;  2HNZ A;  3R9P A;  1GOB A;  4RW6 A;  3E9P A;  5AR0 A;  1RDB A;  4KB0 A;  3VQ5 A;  2E88 A;  4AHS A;  3OYL A;  1SL1 A;  5I9E B;  2ZQB A;  2FSN A;  2W41 A;  1U04 A;  2P9I A;  3UE5 A;  5IT9 O;  2XY5 A;  4I9Q A;  3NFA A;  4BC2 A;  3CC2 N;  5SZT A;  2VWJ A;  3EZ5 A;  1X3N A;  4LFC K;  3F5T A;  5GAG P;  3CQ8 A;  4FJG A;  3IRX A;  1EXQ A;  4CZI A;  3FR0 A;  3HP6 A;  2E4L A;  4JI8 K;  1IBL K;  3KK3 A;  3G71 N;  2VWK A;  3WXI A;  4CJF A;  4BE2 A;  3GBT A;  2P9L B;  2Q0R A;  4DU1 A;  3V9U A;  2XY7 A;  4CZF A;  1X9W A;  3VTH A;  4E89 A;  3CPE A;  3GE1 A;  4O4G A;  1WAF A;  3SJJ A;  1BG3 A;  2QWR A;  4DV2 K;  3ZYY X;  4EZ6 A;  4CE9 A;  4W5N A;  1ZXO A;  1ASW A;  3D7E O;  3CCJ N;  5AQU A;  4AIL C;  3MEE A;  2KFZ A;  4DLG A;  1BUP A;  3LDO A;  1KTQ A;  4BQL A;  3I33 A;  4YOT A;  2NRH A;  5FRN A;  4JHD B;  3G25 A;  3DXK A;  4DFJ A;  1VQO N;  2QWN A;  4FJN A;  5EOY A;  2F7T A;  2R7Y A;  3UKR A;  1LW0 A;  3C0B A;  4KRF A;  3CC7 N;  3MEG A;  3C7N A;  4JI0 K;  1L3V A;  5JS1 A;  3IDH A;  1D5A A;  1LWC A;  3A8Y A;  1GLL O;  3RSE A;  3NBP A;  3WNG A;  2FLO A;  4KB1 A;  3B6P A;  1MWK A;  1Z26 A;  3QO9 A;  2PYJ A;  1HLU A;  2VG5 A;  3THY B;  1ZBF A;  1KAZ A;  2O8F B;  1HNV A;  5GIN A;  4H4M A;  4F8R A;  2PBD A;  3OYI A;  1HKC A;  1N34 K;  3QEP A;  3ZSQ A;  4B1X B;  1BI4 A;  3B6O A;  3L4I A;  2Z1G A;  4UQG A;  3FZK A;  4DV4 K;  4LY7 A;  3T19 A;  3QEW A;  5CHI A;  4IEI A;  3SK3 A;  2EX3 A;  2BTF A;  4L3Q A;  3LM2 A;  1L3U A;  4LFB K;  3IFR A;  3EKU A;  4Q0B A;  1K6Y A;  3NH0 A;  1J6Z A;  3DYA A;  4J2A A;  4DF8 A;  3AVC A;  4Z94 A;  3SUP A;  1TL1 A;  1S5J A;  1XMQ K;  2D1K A;  1NK8 A;  3LAK A;  4DB3 A;  4E7L A;  1Q9X A;  4O0J A;  2YNG A;  1CXQ A;  3SUO A;  1TUY A;  2DY4 A;  4N76 A;  3MAQ A;  4F3T A;  3TSP A;  4BR0 A;  4CK1 A;  4DTO A;  1NGF A;  1NKB A;  3E9O A;  4JRQ A;  4DQ8 A;  4CEB A;  1VSJ A;  4U7B A;  5KGX A;  3H1V X;  1S1V A;  3PV8 A;  1RBV A;  2P9P A;  2LSN A;  4CFC A;  4LSN A;  2VGN A;  3ZSZ A;  5KRS A;  4YNQ A;  4OPJ A;  1C6V A;  1SUQ A;  3KK7 A;  1NK7 A;  5M1P A;  1FKP A;  5EU7 A;  1I39 A;  4OKE A;  4QCL A;  1X9S A;  3BDP A;  4H4O A;  3SAF A;  3IUC A;  3VQ4 A;  4K25 A;  1BQM A;  2ZJQ L;  3V9W A;  4FPB A;  3SPY A;  4M3T A;  2PZS A;  4CF8 A;  2DFH A;  3VQA A;  1E4G T;  4NXM K;  1WNS A;  4FWP A;  3OYN A;  4CGD A;  4GKK K;  2FBV A;  1BCM A;  3S41 A;  1V4S A;  1YHQ N;  1WUA A;  4ISE A;  4FLW A;  3EY1 A;  3GL1 A;  3HPG A;  2G8V A;  3FE1 A;  4JI4 K;  3O08 A;  1S72 N;  1NLV A;  3RR7 A;  4YOX A;  4BVO A;  3O9U A;  4FWR A;  4FWM A;  1OKJ A;  1GLF O;  3JAM O;  4JKD A;  1JLQ A;  4JKF A;  3KK1 A;  1NK5 A;  1EO1 A;  4TSX A;  3O9Q A;  4M45 A;  2JLE A;  3AAR A;  1J9A A;  2OAN A;  3V4I A;  1JL1 A;  3C6U A;  2FSK A;  4JD2 A;  3HBT A;  3V81 A;  4QS7 A;  3ZT3 A;  1HMV A;  1Q81 O;  1ILY A;  1NJZ A;  3HT3 A;  1U49 A;  1NBW A;  4LF7 K;  2GEL A;  4IFY A;  1HRH A;  5DMR A;  3T1Y K;  3E1Y A;  2G8K A;  2NZT A;  3O3H A;  4QAG A;  1WSE A;  5FPM A;  2FBX A;  4O0I A;  4FZZ A;  1YJ9 N;  2EWS A;  1WBB A;  1EET A;  2NRR A;  3TTF A;  1RDA A;  2ZJR L;  4B3T K;  3P4I A;  1RTH A;  3CET A;  1I3A A;  4G1Q A;  4DS4 A;  4DTN A;  1SQK A;  3BF1 A;  3VQE A;  3O5B A;  3THX B;  3QEI A;  3OYH A;  3SUN A;  2ASO A;  1GLC G;  3MCP A;  1Q82 O;  1NGB A;  3R6M A;  3F73 A;  2A40 A;  3ID6 A;  1TYQ A;  2GBZ A;  4MLH A;  1HQE A;  3KKR A;  3VN5 A;  2RN2 A;  1E4F T;  3VOV A;  1QQM A;  1Q7Y O;  3SAH A;  1BWF O;  3Q7B A;  3CXC M;  4FW2 A;  4IOA L;  4B1Z A;  1BIZ A;  2HBJ A;  3SV4 A;  4ELU A;  3ZEU A;  2IGI A;  1KXP A;  4EFH A;  3D6R A;  3DLK A;  1VAZ A;  5TKY A;  4IBN A;  5M1K A;  3VEX A;  4GVE A;  1T7P A;  3K9J A;  4FPA A;  3I56 N;  3NHG A;  4NXN K;  4IJA A;  2UU9 K;  1J54 A;  3TR8 A;  4CJ7 A;  3CFR A;  4JKG A;  3SV3 A;  4FVM A;  1R59 O;  3FFK B;  1XWL A;  4C1N K;  3D2E B;  4CEE A;  4O5F A;  2OPP A;  5BRF A;  3CF5 L;  5AQV A;  2QWL A;  1MA9 B;  3AVM A;  5ADX A;  3ZCM A;  3MN7 A;  3UIQ A;  4JEP A;  3CIP A;  4NB4 A;  4AM7 A;  5DM7 L;  2RE2 A;  1YTA A;  2QA4 N;  3DLL L;  2P9P B;  4M3R A;  3LAN A;  3VGL A;  4DV0 K;  4A2A A;  3SQ0 A;  3DI6 A; 
#chains in the Genus database with same CATH homology
 1BIU A;  3AVK A;  2HVI A;  2ITG A;  1IG9 A;  3THV A;  4NYF A;  3V1O A;  2HW3 A;  2ZE2 A;  1BL3 A;  3E01 A;  2G8F A;  1BCO A;  1WSG A;  4OGC A;  5CY4 A;  4CJE A;  5I3U A;  3TAR A;  3KLF A;  4B8C A;  3S3O A;  4CJV A;  3VQP A;  3U3G A;  5J1E A;  4W5Q A;  4JRP A;  2IC3 A;  3TWH A;  2HHS A;  4C8O A;  4ID5 A;  5JS2 A;  1QSY A;  4B9U A;  2OA8 A;  1QTM A;  4FCY A;  2RF2 A;  1J5O A;  3KD1 E;  4IG0 A;  4GW6 A;  2HB5 A;  4DTS A;  1QSS A;  4ZTF A;  5J2P A;  3CFO A;  3LP3 A;  4CJP A;  5C42 A;  4F3O A;  4I9L A;  3QEV A;  4PQU A;  3TAE A;  4ICL A;  3D45 A;  3T1A A;  1TKT A;  1ZBI A;  4AHV A;  1EX4 A;  2YHB A;  3RMA A;  1CZ9 A;  1WSI A;  3PX0 A;  3NGZ A;  3PY8 A;  5FDL A;  4B9V A;  3VA3 A;  5HRR A;  3WNH A;  3SZ2 A;  2IS3 A;  1QHT A;  1JLC A;  1DTQ A;  2IDO A;  3M8P A;  1ASV A;  3AV9 A;  1J53 A;  3AVN A;  4OKJ A;  1LAV A;  3RMB A;  4N56 A;  2RKI A;  4DU3 A;  4DTX A;  1ZYQ A;  4OJR A;  1VSD A;  4GMJ B;  1SKW A;  2OZM A;  4Z4I A;  4CJ5 A;  3LPU A;  4OLB A;  5J2Q A;  3K58 A;  4DFM A;  2X78 A;  3QIP A;  4FJX A;  4B3O A;  4DSL A;  2HNY A;  4CF9 A;  3MEC A;  1KCF A;  4AHT A;  1JXE A;  4I7F A;  5KI6 A;  2BDP A;  2XHB A;  4B9N A;  4J2B A;  4E1M A;  3TAQ A;  2AJQ A;  3SPZ A;  1NK9 A;  4OGE A;  2YHA A;  1QQC A;  1WSH A;  3V9Z A;  1QSL A;  1IO2 A;  1HQU A;  2OYQ A;  4FJM A;  2D0A A;  1RTI A;  3OS1 A;  3MXI A;  2RPI A;  1U45 A;  3NGY A;  3NF6 A;  1O1W A;  1FXX A;  2W42 A;  3V9X A;  4CFD A;  1HYZ A;  4FJJ A;  4N5S A;  1JKH A;  5I42 A;  1CLQ A;  2X6N A;  4KKO A;  4CJW A;  1RT5 A;  3DLB A;  5HLF A;  4FJH A;  3AVH A;  4CJL A;  4GVM A;  3C6T A;  4CJT A;  4BDP A;  3AA4 A;  2HHW A;  2OPS A;  3G0Z A;  1NJX A;  3L3V A;  1C0T A;  5K14 A;  3L2V A;  1A5X A;  2HHQ A;  3PX6 A;  4CF2 A;  1X1P A;  3CG7 A;  3NH1 A;  3L8B A;  3KD5 E;  3LWL A;  5HRN A;  2YKM A;  3S9H A;  3AO5 A;  1RTD A;  2NUB A;  3F9K A;  3LDS A;  2I5J A;  1W9H A;  3AVJ A;  1C1A A;  1GOC A;  1S1X A;  2D0C A;  4IG3 A;  4HUF A;  3HL8 A;  3RTV A;  4ZHR A;  1DTT A;  5KGW A;  1XHX A;  4E7H A;  5CZ2 A;  1TKD A;  3M8R A;  3SNN A;  4HHT A;  1UA1 A;  4FLU A;  2KZM A;  3MXJ A;  3K57 A;  4DTP A;  1BI4 B;  3IAY A;  1WLJ A;  2YV0 X;  3AO4 A;  1TAQ A;  4OPK A;  1S1U A;  3OJS A;  4FJL A;  3KK2 A;  2FC0 A;  4CEZ A;  1TGO A;  3LP0 A;  3NF8 A;  3OYK A;  4DU4 A;  3DOK A;  2X74 A;  4LH5 A;  3TAF A;  4AH9 A;  2IAJ A;  3AVB A;  2ATQ A;  4BE1 A;  4PY5 A;  3AO1 A;  3VQD A;  4AHC A;  3PO4 A;  3K5N A;  1NJY A;  1L5U A;  4IFV A;  1KRP A;  3ITH A;  2VG6 A;  1RCH A;  1T05 A;  4KI4 A;  4K8X A;  2HNZ A;  3DLH A;  1GOB A;  4CEF A;  4RW6 A;  1TKX A;  3I0R A;  3EYZ A;  3O4Q A;  3KLG A;  1HJR A;  4W5T A;  1RDB A;  4KB0 A;  3VQ5 A;  1WSJ A;  4AHS A;  4KO0 A;  4BE0 A;  3HJF A;  3OYL A;  3FFI A;  1SL1 A;  4CF1 A;  2ZQB A;  3AO2 A;  3RR8 A;  1U04 A;  1F21 A;  5HRO A;  1S1T A;  4HCB A;  4L8R B;  2BAN A;  2XY5 A;  4FM1 A;  4I9Q A;  2KTQ A;  2OPQ A;  3NFA A;  2GUI A;  3ALY A;  5SZT A;  3DRR A;  1ASU A;  4Q5V A;  2VG7 A;  2VWJ A;  3QNO A;  4HCC A;  4FK4 A;  3EZ5 A;  2KZZ A;  2IOC A;  1YT3 A;  3BGR A;  3CQ8 A;  2QKK A;  1KVA A;  3ZT2 A;  3DLG A;  4DQS A;  4FJG A;  3IRX A;  1EXQ A;  3OYE A;  3PO5 A;  3OYJ A;  4CHN A;  2WON A;  3ASM A;  3HP6 A;  3SYZ A;  1TKZ A;  2E4L A;  4CCH A;  4FZX C;  4M3U A;  2DTU A;  3D0P A;  3KK3 A;  3L2U A;  2VWK A;  3AA5 X;  4BE2 A;  4CJF A;  2B4J A;  3L2R A;  3G10 A;  1HPZ A;  1SV5 A;  4DTJ A;  3VQB A;  3LZI A;  4DU1 A;  4PUO A;  4OVL A;  1CZB A;  3V9U A;  4NCG A;  4K8Z A;  4B8A B;  4CJK A;  2XY7 A;  2G8W A;  4HUG A;  1X9W A;  3C94 A;  4CJ3 A;  1JLE A;  4KTW A;  4E89 A;  3OYC A;  1ZBL A;  4I2Q A;  4O4G A;  2GV9 A;  2YNH A;  1BGX T;  1WAF A;  3ZSY A;  1UOC A;  2FBT A;  3SJJ A;  3TAP A;  2ZD1 A;  4E7J A;  4HVJ A;  1A5V A;  2KW4 A;  1LW2 A;  1ZBU A;  4CE9 A;  1SKR A;  4DSJ A;  4EZ6 A;  5HP1 A;  4W5N A;  1ASW A;  1BHL A;  1NK0 A;  3M8S A;  4ELT A;  1YVU A;  1TK8 A;  4AIL C;  4O5B A;  3MEE A;  3V9S A;  2KFZ A;  4DLG A;  1NOY A;  4FK0 A;  4HUE A;  3K5L A;  1KTQ A;  3M8Q A;  4CK3 A;  1RBU A;  4CGI A;  5DK5 A;  4M3W A;  5FRN A;  3KLH A;  3KJV A;  3RWU A;  4DFJ A;  3ZT1 A;  4FJN A;  4FJ7 A;  3ZSV A;  3MXM A;  4KHU A;  1JLB A;  5E41 A;  4F4K A;  1ZBH A;  3V1Q A;  2R7Y A;  3V1R A;  3DLR A;  1LW0 A;  4LH4 A;  3OYB A;  3VQ7 A;  4BWJ A;  4CEQ A;  4Z4E A;  4LSL A;  4KRF A;  3MEG A;  1L3V A;  5JS1 A;  4FJ8 A;  4Z4H A;  3L2W A;  4FYD A;  1NKC A;  1NOZ A;  1D5A A;  4FZY A;  1LWC A;  3QIN A;  4RG8 A;  3T3F A;  1RDD A;  2D0B A;  3RRG A;  3NBP A;  1SL0 A;  1Q9Y A;  3WNG A;  3HM9 A;  4KB1 A;  3B6P A;  1LAW A;  4B9L A;  4FLV A;  1Z26 A;  3QO9 A;  3ZSR A;  4IDK A;  4CJR A;  2PYJ A;  4DSK A;  1TV6 A;  3H08 A;  4FLX A;  3LZJ A;  4DTR A;  3S3M A;  2VG5 A;  1ITG A;  3DM2 A;  1KVB A;  1ZBF A;  4KI6 A;  5FRM A;  4Z4G A;  3HXM A;  1SL2 A;  2HHV A;  1HNV A;  3RMD A;  4H4M A;  5CZ1 A;  4F8R A;  3OYI A;  4I2P A;  4KPY A;  4CED A;  4KV8 A;  1DLO A;  3TI0 A;  4JLH A;  3QEP A;  2QK9 A;  2F96 A;  4Y1C A;  3OYF A;  1RDC A;  1EP4 A;  3ZSQ A;  3JYT A;  3NE6 A;  4CFB A;  1BI4 A;  1VSL A;  3U3Y A;  4KHW A;  1EKE A;  1IH7 A;  3B6O A;  2Z1G A;  4N47 A;  2B6A A;  3TAN A;  4UQG A;  2HHX A;  3LPT A;  4AHU A;  1S6Q A;  4LY7 A;  1NK4 A;  3T19 A;  3DRP A;  3QEW A;  1SKS A;  4OLA A;  4M41 A;  4CHZ A;  4B9T A;  2EX3 A;  3OVN A;  4FLZ A;  1L3U A;  4FK2 A;  2G8I A;  3WNE A;  2OPR A;  2YKN A;  2QXF A;  4DQI A;  4DFP A;  4Q0B A;  3U6F A;  1K6Y A;  3NH0 A;  5C25 A;  1LWF A;  3JSM A;  3ZSX A;  1RBR A;  3DYA A;  1VSI A;  1REV A;  3VQ9 A;  4DF8 A;  4J2A A;  2F8T A;  1RNH A;  3AVC A;  1XI1 A;  2F8S A;  3SUP A;  4R5P A;  4M3X A;  1TL1 A;  1S5J A;  3VA0 A;  4IKF A;  3PX4 A;  1C0U A;  4E0D A;  1NK8 A;  2OZS A;  4FJK A;  1X9M A;  3LAK A;  4E7L A;  4MQ3 A;  4DF4 A;  3DRS A;  1Q9X A;  4O0J A;  2YNG A;  1N5Y A;  4DSE A;  1CXQ A;  3SUO A;  2DY4 A;  4N76 A;  3MAQ A;  4FJ9 A;  1C1C A;  3VQ8 A;  3SQ4 A;  4F3T A;  1D8Y A;  4DWI A;  3NF9 A;  2BGG A;  4CJS A;  4CK1 A;  4M42 A;  3QER A;  4DTO A;  2HHU A;  3TAB A;  1NKB A;  4NYN A;  4RW4 A;  4JRQ A;  4CEB A;  2G8H A;  1VSJ A;  3AA3 A;  2Z1H A;  5KGX A;  3SUQ A;  1S1V A;  3PV8 A;  3O4N A;  3OY9 A;  1RBV A;  4B9M A;  1IKW A;  4M3Y A;  3OYD A;  2LSN A;  3I0S A;  4CFC A;  3ULD A;  1RBS A;  4LSN A;  1WN7 A;  4RW9 A;  3ZSZ A;  5KRS A;  4YNQ A;  3NF7 A;  4OPJ A;  3SI6 A;  1C6V A;  1SUQ A;  4FM0 A;  2E6M A;  1NK7 A;  3K2P A;  4CEC A;  3OYM A;  4HTU A;  1FKP A;  4H8K A;  3ZT0 A;  3L2Q A;  5EU7 A;  4DSF A;  1I39 A;  4OKE A;  4QCL A;  1X9S A;  1VSK A;  3DLE A;  3BDP A;  1B9F A;  4H4O A;  1T03 A;  2P1J A;  3IG1 A;  4CGH A;  4CEA A;  1U4B A;  1L3T A;  4KRE A;  4E7I A;  3P83 D;  1TVR A;  3PUF A;  3QIO A;  3VQ4 A;  1BQM A;  4DFK A;  5J2N A;  3SQ2 A;  3V9W A;  4JS5 A;  3SPY A;  2XO7 A;  1UWB A;  4PA1 A;  3AVA A;  4M3T A;  4QOZ B;  1YTU A;  2PZS A;  2D5R A;  4KHQ A;  1MU2 A;  4CF8 A;  2DFH A;  3VQA A;  3VQQ A;  3K59 A;  2KFN A;  1WAJ A;  1WNS A;  3OJU A;  5KTQ A;  3OYN A;  4Y1D A;  1Z25 A;  4CGD A;  3V6D A;  1VSM A;  2Y1J A;  2FBV A;  3HVR A;  1BCM A;  3SCX A;  4EZ9 A;  4NCB A;  2G8U A;  4J2D A;  4FLW A;  2ETJ A;  3EY1 A;  4CJ4 A;  4CHQ A;  1VRT A;  1R0A A;  1NK6 A;  4F2S A;  5J2M A;  3HPG A;  2G8V A;  1VSE A;  1FKO A;  4FW1 A;  3AVF A;  4B08 A;  4DG1 A;  5HRP A;  5T7B A;  3HPO A;  2PY5 A;  3RR7 A;  3A2F A;  4CF0 A;  4DSI A;  2A1S A;  5KRT A;  2X6S A;  4FJI A;  4WE1 A;  1KVC A;  4EP4 A;  3NCI A;  1JLQ A;  3QET A;  4CHY A;  3KK1 A;  1NK5 A;  4TSX A;  1IKV A;  4M45 A;  1D9F A;  4BDZ A;  3KTQ A;  1U47 A;  4KHY A;  3CM5 A;  1KFD A;  1RBT A;  2JLE A;  3HP9 A;  3ZT4 A;  4E3S A;  1JL2 A;  3KLI A;  1J9A A;  1UAX A;  4CGJ A;  3K5M A;  4CEO A;  3HVT A;  1RIL A;  3O3G A;  2HHT A;  3CFP A;  1B92 A;  4O44 A;  1Q8I A;  3V4I A;  1U48 A;  1JL1 A;  1S1W A;  3C6U A;  4KHN A;  4CJU A;  3V81 A;  1JLA A;  3ZT3 A;  1HMV A;  3ZSW A;  4JS4 A;  1N6Q A;  3KKS A;  4FM2 A;  1NJZ A;  3HT3 A;  3AO3 A;  1U49 A;  3VQC A;  3K5O A;  2WOM A;  1HRH A;  1RT4 A;  3DI6 A;  4IFY A;  5DMR A;  2JGU A;  3DOL A;  4BWM A;  4CFA A;  1A5W A;  3NDK A;  2DFE A;  3NH2 A;  4BAC A;  2G8K A;  4Z4F A;  4XIU A;  1LV5 A;  3O3H A;  1WSF A;  4QAG A;  1C0M A;  1WSE A;  2P5G A;  3P5J A;  3LAM A;  1JLG A;  4W5O A;  2FBX A;  4O0I A;  1QE1 A;  4FZZ A;  2HVH A;  3VQ6 A;  2A1R A;  1JXB A;  2FBY A;  3DMJ A;  1EET A;  1XC9 A;  4J2E A;  2Z1I A;  3KIO A;  4CIG A;  4DTU A;  1RDA A;  5SWM A;  4F2R A;  4C8L A;  4CK2 A;  1CXU A;  4DQP A;  1T8E A;  5FRO A;  1RTH A;  1FK9 A;  1KLN A;  4KFB A;  4KAZ A;  2BE2 A;  1I3A A;  4G1Q A;  4MFB A;  4DS4 A;  4DTN A;  3QES A;  3KLE A;  3VQE A;  4CIF A;  1JLF A;  2O4I A;  1D9D A;  3QEI A;  3OYH A;  3SUN A;  1BIS A;  1G15 A;  4CES A;  3OYA A;  3L3U A;  4CJQ A;  3HPH A;  3OS0 A;  3NGI A;  3ISN C;  3F73 A;  3NAE A;  4DQQ A;  2QKB A;  1VSH A;  1RT7 A;  3LP1 A;  2GBZ A;  2O4G A;  2XRI A;  1LWE A;  1HQE A;  5D3G A;  2B5J A;  3KKR A;  1HYS A;  3VN5 A;  3OYG A;  2YNF A;  3MED A;  2RN2 A;  3HYF A;  4W5R A;  4CHP A;  1L3S A;  4CHO A;  4E19 A;  3RMC A;  3LWM A;  4M3Z A;  4OKK A;  5CYM A;  1RT2 A;  4DQR A;  3AVL A;  4FW2 A;  4RW7 A;  1S9E A;  3HO1 A;  3SQ0 A;  2Z1J A;  1TAU A;  1RT6 A;  1HNI A;  1BIZ A;  3QLH A;  3SV4 A;  4DS5 A;  2Y1I A;  1S9G A;  3S3N A;  1IKY A;  4ELU A;  1IKX A;  2XY8 A;  4FLY A;  2IGI A;  4FLT A;  4RW8 A;  4C8M A;  3LP2 A;  4KHS A;  1VRU A;  3HK2 A;  3AVG A;  4ELV A;  2HMI A;  4DMN A;  2Q3S A;  1NJW A;  1BQN A;  3DLK A;  1KFS A;  1RTJ A;  2EHG A;  2P5O A;  3CM6 A;  4IBN A;  3C95 A;  3OS2 A;  3P1G A;  1T7P A;  3NHG A;  1S6P A;  4EP5 A;  4DTM A;  5C24 A;  4PWD A;  4C8K A;  3TAM A;  2XY6 A;  1TK0 A;  1J54 A;  3TR8 A;  1NKE A;  3CFR A;  4AHR A;  1HYV A;  4CER A;  4DLE A;  4FJ5 A;  1VK0 A;  3WNF A;  4E1N A;  3SV3 A;  4KTZ A;  3LAL A;  2KQ2 A;  4FVM A;  1XWL A;  4KTQ A;  4CIE A;  4CEE A;  3TAG A;  2OPP A;  5HRS A;  1UA0 A;  4C8N A;  1TK5 A;  1RT1 A;  4LD0 A;  4ZTJ A;  2P51 A;  3AVM A;  1B9D A;  2DFF A;  3ZCM A;  4Z4C A;  3UIQ A;  1W0H A;  4NCA A;  3SQ1 A;  1Y97 A;  1GOA A;  4YFU A;  4N41 A;  1TL3 A;  3I8D A;  3HST B;  4FXD A;  3AA2 A;  4CGG A;  1XHZ A;  2PYL A;  1QS4 A;  1C1B A;  1RT3 A;  1YTA A;  4E7K A;  3CYM A;  3ZSO A;  3AVI A;  5CYQ A;  4B9S A;  3O3F A;  3QEX A;  4ID1 A;  4CGF A;  4M3R A;  1KSP A;  1KLM A;  2HND A;  3LAN A;  4O55 A;  1VSF A;  5HBM A;  3RRH A;  4BDY A;  3QNN A;  3IS9 A;  4Z0U A;  2E6L A;  2YNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...