2G8IA

B. halodurans rnase h catalytic domain d192n mutant in complex with mn2+ and rna/dna hybrid (non-p nick at the active site)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
134
structure length
134
Chain Sequence
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKANYGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna/dna
molecule keywords 5'-R(*UP*CP*GP*AP*CP*A)-3'
publication title Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
pubmed doi rcsb
source organism Bacillus halodurans
total genus 39
structure length 134
sequence length 134
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2g8iA00
3T1AA 3VQPA 3BDPA 4L8RB 1NOYA 3EY1A 4KTQA 1EP4A 1RT5A 3VQ6A 3RRHA 3LP1A 4CF8A 3KJVA 4FJLA 1SV5A 4JRPA 4FZZA 1XWLA 4FM2A 2YHAA 1NK0A 3SV4A 4ZTJA 4N76A 1ZYQA 2OZMA 3LZIA 1C1BA 3A2FA 3CFPA 4OJRA 1KFDA 3AVNA 4KB0A 4AHVA 2RN2A 2GBZA 1HNIA 5K14A 4FJ7A 1JLBA 3QEVA 1BGXT 1MU2A 2KW4A 1XHXA 3LWLA 4KFBA 5FRNA 4FXDA 1Z25A 4M41A 3V1QA 3AVLA 1ZBUA 1HRHA 1QSSA 3PO4A 3T19A 5CZ1A 2PYJA 2KFZA 1J9AA 4OKJA 3LPUA 3NF7A 3OYBA 4I7FA 3SZ2A 2G8VA 5HRPA 4FZXC 3OYFA 1HYZA 2Q3SA 5KGXA 2DTUA 2XY5A 2B6AA 5J1EA 4IFVA 1JXBA 4DFJA 2BANA 4FJ9A 1S6QA 1Q9YA 5C24A 1L5UA 1DTQA 2FBYA 2ZQBA 5FROA 4FJXA 3C95A 1VRTA 3OYAA 3NBPA 1WSGA 2F8TA 1W9HA 4K8ZA 1ITGA 4DU1A 4B8AB 1K6YA 1KVCA 4ZHRA 4W5OA 3FFIA 3OY9A 4N5SA 1LAWA 2E6LA 4O4GA 1RT3A 1VSLA 1IKWA 4E89A 4FM1A 3AVGA 1D8YA 2XY7A 4YNQA 1FXXA 4W5NA 4CFAA 1KLNA 4B3OA 2IOCA 4I2QA 3OYGA 3OYIA 4FJJA 1TK5A 2KZZA 1KTQA 1DLOA 1VSIA 2VG6A 4CHNA 1XI1A 1QQCA 3LANA 1XHZA 2IGIA 1BHLA 2XY8A 5I3UA 3PX0A 4FZYA 3RR7A 3P5JA 4CF2A 4HUFA 3SPYA 1A5XA 3TANA 2OA8A 4HUEA 3DLBA 4KPYA 4FK0A 4AILC 4BE0A 1IKXA 1RBRA 4CEQA 4DSFA 2B5JA 4MQ3A 4DSLA 3VQ8A 2FBTA 4QOZB 4CEEA 5T7BA 3C6TA 1XC9A 1X9SA 3HT3A 3SV3A 4H4OA 1O1WA 2JLEA 4B08A 1VSDA 1RT2A 4DFMA 3VQ4A 3U3YA 1TKDA 4R5PA 3ALYA 3RMCA 4M3YA 4CEOA 4CHOA 2VWKA 2D0CA 4Q5VA 1ASWA 4F2RA 3K2PA 4BDZA 2PY5A 1IG9A 4Q0BA 4DLGA 4AHCA 3OJUA 1RTJA 4CGGA 2HVIA 3MXJA 5J2MA 5CYMA 3DLHA 4B9SA 3KD5E 3AO5A 2QK9A 3AA4A 4DTXA 1VSHA 1BL3A 3VN5A 3HPGA 3RR8A 4KRFA 1R0AA 3AA3A 3ZCMA 1S6PA 3AO2A 3L2RA 3TAPA 2YNGA 3CYMA 1HJRA 4CF9A 2BDPA 3ULDA 4DU4A 1U49A 4CIEA 1EKEA 1CZ9A 3DLRA 3DM2A 1YTAA 4CESA 4XIUA 5FDLA 2HW3A 3IAYA 3SQ0A 2GUIA 4CECA 3O3GA 4DWIA 4FYDA 3QESA 4KHWA 4LH5A 1F21A 2HB5A 1WAFA 3CFRA 5HRNA 4F3TA 2OZSA 3M8PA 4FLWA 1TV6A 3OYMA 3WNFA 3VQAA 2Y1IA 1L3VA 5JS1A 3AVFA 3OYKA 3NFAA 3NAEA 3AVAA 4B9VA 4CJ5A 4FLXA 2NUBA 4LH4A 4OVLA 1EETA 4DFKA 5J2NA 3HYFA 3V81A 2KQ2A 4HCBA 2G8IA 4ID5A 2XO7A 4CEFA 3RMDA 5HP1A 2BGGA 4OPKA 3SCXA 1YVUA 4E7IA 1GOBA 5J2QA 3OYJA 3SJJA 3NF9A 4DLEA 1S1TA 2W42A 4CGJA 1TKXA 3QERA 4CJVA 4FJNA 3VA0A 3B6OA 2HMIA 3RMBA 1BCMA 4C8MA 4J2AA 4Y1DA 3ZT0A 4CIFA 4DSIA 2ATQA 1WSHA 3K59A 3PO5A 4DQRA 4DSEA 3SI6A 5CYQA 1ZBLA 2G8HA 1RDBA 5J2PA 3S9HA 5C25A 1TAUA 3TAFA 1NK5A 1BQNA 3KLGA 3DLGA 3SNNA 4J2EA 1RTIA 2QXFA 4CERA 5FRMA 5DMRA 3PY8A 3V6DA 3QNNA 1RNHA 1TAQA 4KB1A 4M3WA 5SWMA 2YNHA 4O0IA 1TVRA 1RT6A 1YTUA 3ITHA 3AVJA 4FW1A 4CK2A 2HVHA 4KHSA 2ZE2A 4CJUA 4OGCA 3HP9A 3CQ8A 1VSKA 1NJZA 4BWMA 3VQBA 4CK1A 3LDSA 1QTMA 2E6MA 3C94A 3LP3A 4KO0A 4DQSA 1U47A 4DQIA 3L2VA 4M3ZA 4OLAA 3ASMA 1L3SA 3NGIA 3DOKA 3HK2A 1SL2A 4FVMA 4FW2A 3ZSZA 3KD1E 4CJLA 3MEEA 3NF6A 3KKRA 3S3OA 4B9MA 3TABA 3S3NA 3KKSA 4FLYA 1FK9A 1WSIA 3HPHA 1UWBA 3RMAA 4DF8A 4M3UA 3SUPA 4FJMA 4GW6A 1U04A 3AO1A 4DQQA 4OKEA 4BDPA 3I0SA 1SKRA 1HYVA 3LALA 3LZJA 3RTVA 3AO4A 3LAKA 3QLHA 4Z4CA 1HPZA 3NH2A 1RDAA 1X9MA 3L8BA 4FM0A 2XHBA 1ZBHA 3NE6A 4PY5A 3SUQA 4F3OA 3DOLA 2HNDA 2ZD1A 3KK1A 1BI4B 4DTJA 3OJSA 3HVTA 3AVKA 5HRRA 4OPJA 3THVA 4E1MA 3VQQA 2RF2A 2YKMA 4JS5A 3HP6A 5KRTA 3OYNA 4NYNA 4CHPA 4ELVA 4CEBA 2YNIA 4E7HA 3PX6A 1NK8A 4IG3A 3VQCA 5C42A 1BQMA 4CE9A 1RCHA 3QNOA 4M3RA 4BDYA 2ETJA 1I3AA 4DU3A 4EZ6A 3OYHA 3TAEA 1J5OA 4LSLA 3L2WA 1VSEA 2EX3A 3ZSRA 1BCOA 3K5NA 3NCIA 1Z26A 4C8LA 2DY4A 3TAMA 3MXIA 1TGOA 1SUQA 3DI6A 3ZSWA 1ZBIA 4I9LA 3QIPA 4O44A 3M8RA 3MAQA 4YFUA 2YNFA 1C1CA 4PUOA 3OS2A 3V1OA 1FKPA 3QEIA 1U48A 1DTTA 4KHUA 4CJ4A 3KTQA 3KLFA 1C0UA 4H8KA 1WAJA 3TR8A 3V9ZA 4FCYA 1UA0A 4KI4A 2HHTA 3ZSOA 4CJPA 5E41A 3VQEA 1YT3A 4FLUA 3NF8A 1HNVA 4DTNA 4RW6A 3M8SA 5D3GA 4DTMA 3O3HA 1NJXA 3S3MA 1L3UA 4M42A 2HHWA 3DRSA 3QIOA 4DMNA 1S9GA 2VWJA 5KTQA 1NK6A 1TK8A 4H4MA 4F2SA 3DLKA 4OGEA 3RWUA 3CM5A 3K5OA 2G8FA 4C8NA 2A1SA 3ZT3A 2DFFA 5KGWA 1VSJA 1D5AA 4I2PA 3UIQA 1LWFA 2P51A 2YKNA 3PV8A 1WN7A 4HUGA 1Q9XA 4K8XA 3MXMA 2HNYA 3QETA 4DG1A 3NH0A 2E4LA 4RW8A 1N5YA 3MECA 3L3UA 4B8CA 4CFCA 1BISA 4HTUA 3ZT1A 1S1UA 4EP5A 3OYDA 4HCCA 2HNZA 4FLTA 2A1RA 4FJ8A 3HSTB 3C6UA 1NKCA 1REVA 2D0AA 2VG7A 3SUNA 2G8WA 4C8KA 1NJYA 3V9WA 3LAMA 4M3XA 1J53A 3VQDA 1L3TA 3HO1A 3O3FA 1QSLA 1T03A 3QEWA 1BIZA 4Z4IA 2LSNA 3B6PA 4HHTA 1NKEA 2GV9A 1RTDA 4DTPA 4GVMA 3DLEA 4BACA 4CJSA 3LWMA 3QINA 4E7JA 3QEPA 5HBMA 3TARA 4E3SA 4KHYA 4AHSA 3OS0A 3AVIA 4Z4FA 1U4BA 4NCGA 3JYTA 1VSFA 2RKIA 4FLVA 4F4KA 4NCAA 3AA2A 4Z4HA 4W5QA 5SZTA 2AJQA 2D5RA 2KTQA 3HJFA 3T3FA 3KK3A 1T8EA 5EU7A 1KFSA 5JS2A 2HHXA 3AVHA 3OYEA 2KZMA 1LW0A 3I0RA 4CEDA 3MEDA 4CJFA 1ZBFA 2FBVA 1B92A 1C0MA 5KRSA 1JLGA 3NGYA 1IO2A 3DRRA 3O4NA 4E7KA 4KI6A 3KLIA 4O5BA 4CF0A 3F9KA 3MEGA 4AHTA 1D9DA 3L2UA 5HRSA 4CJ3A 3SPZA 3SYZA 4OKKA 1JL2A 1UA1A 1A5WA 4QCLA 4E7LA 2F8SA 2YHBA 3U6FA 1NKBA 1RBSA 1WLJA 1J54A 1C0TA 2HHUA 3DRPA 2Z1IA 3KLEA 3NGZA 2DFHA 1X9WA 1IKYA 4UQGA 4KHQA 4KREA 4ID1A 1S9EA 2X6NA 3L2QA 3HXMA 3AV9A 4AH9A 3IRXA 4RW9A 3OYLA 4DF4A 1SL1A 4KHNA 3AVCA 2HHSA 3WNEA 3PX4A 1B9DA 4JLHA 4CFDA 2OPRA 1I39A 2XRIA 4FLZA 4ELTA 2QKBA 1CXQA 4DS5A 4CCHA 2IC3A 2G8KA 1JLEA 1QE1A 4M45A 4CJWA 4B9UA 1ASUA 1TKZA 3KLHA 5CZ2A 3G10A 3KK2A 4E1NA 3V1RA 4ICLA 3LPTA 3NH1A 1RDDA 2X74A 4KTWA 1NOZA 5I42A 1T7PA 4LD0A 3VA3A 1QSYA 1LWCA 1VK0A 5HLFA 4EZ9A 1CZBA 1X1PA 4N41A 1RT4A 1JLCA 3ZT2A 1TKTA 2YV0X 4KAZA 2Y1JA 4LY7A 4AHUA 1TL3A 3ZSQA 4W5TA 4ELUA 4FJGA 4PA1A 4NCBA 1LAVA 2F96A 1HQUA 4WE1A 3D0PA 4AHRA 4RG8A 2FBXA 4JS4A 1W0HA 2OPPA 3G0ZA 3H08A 3AVBA 3KIOA 4IBNA 1VSMA 4Y1CA 2IDOA 4CGIA 4Z4GA 2HHQA 1SL0A 1RBUA 5KI6A 4DSKA 4N56A 1BI4A 1KSPA 4DFPA 2JGUA 3V9XA 1BIUA 3BGRA 4Z0UA 1WNSA 4BE1A 4E0DA 3V4IA 1RT7A 1QHTA 5CY4A 3ZSVA 1RT1A 1TL1A 1RBVA 3EYZA 1GOAA 1EX4A 3U3GA 3I8DA 3M8QA 3HVRA 4M3TA 4DSJA 3LP0A 4CEZA 3JSMA 3NHGA 1S1VA 3K57A 2QKKA 3IG1A 3V9SA 1LW2A 1Q8IA 3TWHA 4KTZA 4CHZA 3QEXA 4PWDA 2OPQA 3P1GA 1SKSA 1D9FA 1S5JA 2P1JA 1HMVA 4G1QA 3ZSYA 4HVJA 3HM9A 4CF1A 1Y97A 2KFNA 4O0JA 1U45A 3P83D 3E01A 4CIGA 4DTUA 2FC0A 1NK9A 3IS9A 1KVAA 4IDKA 4J2BA 3PUFA 4CJQA 2PYLA 3TI0A 2O4GA 3NDKA 2EHGA 1CLQA 1C1AA 4CHYA 1ASVA 3CM6A 3ZSXA 4CHQA 5HROA 4BE2A 2DFEA 3DMJA 4F8RA 1FKOA 3ISNC 4CGDA 3OS1A 4CJRA 1C6VA 1B9FA 1JXEA 2IS3A 3HL8A 4CFBA 3EZ5A 3OYCA 4FK2A 4GMJB 3HPOA 1TK0A 1WSJA 3SUOA 1KCFA 2Z1JA 4LSNA 4B9TA 3VQ7A 1GOCA 2P5GA 3WNGA 3TAGA 3K5MA 4B9NA 3WNHA 4NYFA 3DYAA 3ZT4A 4CEAA 1UOCA 4PQUA 4FJ5A 1NK4A 4JRQA 4CGHA 1KLMA 3LP2A 4N47A 4KV8A 2Z1HA 1S1WA 4QAGA 2RPIA 4DTOA 2I5JA 3CFOA 1RBTA 4O55A 4DTRA 3SQ4A 4OLBA 1JL1A 2O4IA 2WOMA 1VRUA 4CJEA 1KRPA 4E19A 4KKOA 4EP4A 4FJKA 1JLQA 1HQEA 3VQ5A 3SQ2A 4MFBA 4C8OA 4DTSA 2OYQA 1A5VA 1LWEA 4B9LA 4W5RA 2WONA 2BE2A 4ZTFA 3SQ1A 1S1XA 1UAXA 1WSEA 2Z1GA 4Z4EA 3K58A 4DS4A 3K5LA 4RW4A 2OPSA 3D45A 1NK7A 3AO3A 3OVNA 1JLFA 1RDCA 4I9QA 4CK3A 4RW7A 3RRGA 1WSFA 3V9UA 2XY6A 4BWJA 2P5OA 2HHVA 2ITGA 1QS4A 2B4JA 1G15A 3AA5X 1SKWA 3TAQA 1IKVA 3QO9A 4FJHA 1JKHA 1T05A 1HYSA 4IG0A 1EXQA 1KVBA 2IAJA 4CGFA 3L3VA 3F73A 4J2DA 4FK4A 4CJTA 4DQPA 3AVMA 2D0BA 4TSXA 5DK5A 4CJKA 1RILA 4IKFA 1JLAA 1RTHA 1LV5A 1IH7A 2X6SA 3O4QA 2VG5A 3VQ9A 2R7YA 1NJWA 1N6QA 2G8UA 2PZSA 4FJIA 4IFYA 3CG7A 2X78A 1CXUA
chains in the Genus database with same CATH superfamily
3VQPA 3BDPA 4L8RB 2YHWA 4DKWA 1EP4A 3MWTA 5AQXA 1RT5A 3KJVA 2YX6A 2QWOA 4ZTJA 1WB9A 4N76A 1C1BA 1WOQA 3A2FA 3CFPA 1ZXOA 4FWKA 3AVNA 4BR5A 4FPAA 4AHVA 3AARA 2E8AA 1HJOA 4FJ7A 1JLBA 1BGXT 1XHXA 4KFBA 5IT9O 2O8FB 1Z25A 4M41A 1ZBUA 5GAGP 3PO4A 3T19A 2PYJA 1J9AA 4OKJA 5C10A 4BG9A 4FOEA 3VETA 2W6LA 1NWKA 2PAVA 4CJ7A 4BRQA 1IBMK 2DTUA 4IFVA 1O13A 3TSQA 2FBYA 1QQOA 5FROA 3C95A 4IXCA 3OYAA 3NBPA 1W7AA 1W9HA 4FL9A 1KQSM 4JI5K 1K6YA 1KVCA 2E6LA 1NGGA 1VSLA 4G9ZA 4XH1A 4CFAA 3FR0A 3I8BA 4B3OA 4NB4A 4B1XB 4YOVA 3OYGA 2KZZA 4B1WB 2WC9A 1DLOA 4CHNA 1XI1A 1QQCA 4AF1A 1XHZA 4FZYA 3RR7A 2ZGZA 3P5JA 2QWMA 4JI4K 4KPYA 3KVGA 1VQ8N 2CH5A 3CJ7A 3CI5A 4JYAK 3C6TA 4WF9L 3SV3A 1O1WA 2JLEA 3B8AX 3WXIA 4FVUA 2HBLA 2Q36A 3ULEB 3FZMA 4CZKA 2YJEA 4CEOA 1BO5O 1X3NA 1ASWA 1BU6O 4AM6A 4Q0BA 3ULEA 2Q1NA 4DLGA 1Z05A 2VGMA 3L4IA 4AHCA 3OJUA 5JMVA 4IFEA 4B9SA 2QK9A 3CQXA 3WXMB 4C23A 3HPGA 4KRFA 1R0AA 1GLFO 3N4QA 4BROA 3AO2A 3L2RA 1HJRA 2Q0UA 4DU4A 2Q2RA 3HZ6A 4CIEA 3THXA 3U8XA 1WAFA 2BH1A 3O1WA 2OZSA 4FLWA 5CE3A 3SMPA 2GUPA 4HCBA 3QFPA 2O8BA 1VQNN 4CEFA 5HP1A 2BGGA 3T69A 3NF9A 4BQZA 3QERA 3IDHA 4H5VA 4Y1DA 1NGAA 4DSIA 3BY5A 3PO5A 5CYQA 1TAUA 1KAZA 3SBGA 3DLGA 4YY3K 1W2BM 4JKFA 5FRMA 5DMRA 3PY8A 3THYB 2IVNA 2AA4A 2NZTA 5SWMA 1NJIO 2YNHA 4O0IA 4NXMK 1RT6A 3THYA 1SAZA 3U4LA 3HP9A 3H1QA 3HM8A 2UYTA 4OLAA 2WBNA 2ZGYA 1TYQB 3DOKA 5AFUH 1TYQA 2A6AA 4B9MA 1QZ5A 1W97L 3J8AA 3TABA 3S3NA 2UXBK 4CD1A 3RMAA 3PIOL 4DF8A 4M3UA 3TSUA 1SKRA 1HYVA 3LALA 5AFUA 3RSEA 1HPZA 2GELA 1RDAA 1X9MA 4FM0A 3NE6A 3SUQA 2ZD1A 1BI4B 4E1JA 3KWIA 3CHWA 4MDBA 3BP8A 4YOXA 3W0LA 5KRTA 2A42A 4NYNA 4CHPA 4ELVA 5C42A 1SZ2A 1XMOK 1BA0A 1I3AA 2A5XA 4LSLA 4XEIA 3L2WA 3ZSRA 3DWLA 1YJNN 3ZSWA 1H1VA 2E2OA 1ZBIA 4BRIA 1NGFA 1C1CA 4PUOA 1XMQK 2UXDK 3OBWA 4CJ4A 3KTQA 3KLFA 1C0UA 3TR8A 1T6CA 5ELZA 1NJXA 3DRSA 3M1FA 2E20A 4DMNA 1S9GA 2VWJA 4BRNA 1TK8A 4H4MA 2P9KB 2NLXA 4C1NI 3DLKA 2UUBK 5KGWA 2P9KA 5GINA 1LWFA 1Q9XA 1Q86O 2QWLA 5TKYA 3L3UA 4CFCA 3HSTB 2VG7A 3EO3A 3HTVA 3K9KA 1L3TA 4M3XA 3HO1A 2OTLN 5LL6Z 4EHUA 3O3FA 4CZJA 1T03A 3WQTA 2FF6A 2LSNA 1BWFO 1NKEA 3DLEA 3QINA 3WXJA 5GAEP 1GLBG 4AHSA 3ENBA 4Z4FA 3JYTA 2QA4N 2AJQA 4FLVA 1MA9B 4W5QA 3T3FA 1T8EA 2F7TA 3I0RA 4JI3K 4CJFA 3DRRA 2P9IB 4H5NA 4DR1K 1QVGM 3F9KA 4FPBA 4AHTA 4F9OA 3U9DA 2P9IA 4JI6K 4BC5A 3OTOK 4QCLA 3EE8A 3QBXA 2Z1IA 3KLEA 1IKYA 2KKZA 4ID1A 2X6NA 4BREA 1HNWK 4RW9A 3H1VX 4BGAA 4DF4A 1I39A 2XRIA 1V4TA 1CXQA 4DS5A 1JLEA 2NRXA 3E9PA 3VEWA 5AZIB 4E1NA 3V1RA 3BUZB 1RDDA 4KTWA 1T7PA 4LD0A 5HLFA 1HKCA 4EZ9A 4N41A 1KD1O 1BA1A 2YV0X 2Y1JA 4LY7A 4FJGA 1TL3A 4ELUA 1ATNA 1LAVA 2F96A 5LMUK 4RG8A 2QWNA 4BR4A 2IDOA 3ZLJA 1RBUA 4DSKA 4FWSA 2JGUA 1VQ9N 3BGRA 1YHQN 4Z0UA 5FPMA 4J8FA 4JKBA 5KPTA 3SAGA 5CY4A 1RBVA 3U3GA 3I8DA 3G71N 3HVRA 4DSJA 3LP0A 1VQMN 3JSMA 1GLLO 3NHGA 3ZX0A 1LW2A 4KTZA 3VPZA 1SKSA 1S5JA 4CF1A 4LFCK 4GKJK 1NU0A 1RGIA 4PL8A 4BRMA 4JKEA 3LM2A 2O4GA 2EHGA 3WT0A 5HROA 3CM6A 4CHQA 4CGDA 3OS1A 5GIOA 1C6VA 1JXEA 3C7NB 4NLCA 4GMJB 4X65K 3C7NA 2QW9A 3IKMA 4B9TA 1GOCA 3VEZA 2P5GA 3K5MA 3MCAB 1UOCA 4N47A 3ZEUB 3ZETB 4NO7A 4DTOA 2I5JA 4JKGB 1JL1A 4CJEA 3ZETA 3SMSA 2E2QA 4FJKA 1HQEA 3PIPL 1KAYA 3VESA 4W5RA 2WONA 3CCUN 2E2PA 5DM7L 2F9TA 1BUPA 4DS4A 1NGJA 4I9QA 4MLHA 2XY6A 2HBMA 1VAZA 4CI6A 2E1YA 4FWRA 3THWA 4FJHA 3QO9A 5LJVA 3I55N 1EXQA 2YHYA 1U2VB 3F73A 4DQPA 2KFZA 3J7ZO 3C6HA 1IH7A 2X6SA 3O4QA 2R7YA 5EVZA 4FJIA 3CG7A 3CD6N 4H8KA 3KHYA 4FJLA 1SV5A 4JRPA 2YHAA 4WFAL 3SV4A 1ZYQA 2OZMA 2QTDA 3LZIA 3H3OB 4OJRA 3M3ZA 2RN2A 2GBZA 2Q31A 1HNIA 3VERA 5FRNA 4JI1K 1OH8A 3V1QA 1VQ7N 3OYBA 4I7FA 2G8VA 4MO5A 4LFAK 3LM9A 5DM6L 2Q3SA 3OYFA 2FSKA 1Q9YA 3J80O 2ZQBA 4FJXA 4QS9A 2F8TA 4BGBA 4N5SA 5GIPA 4E89A 2GTDA 4FM1A 4K0KK 2XY7A 4BR0A 2GEMA 4X62K 1KLNA 1NGIA 4I2QA 3AAPA 1KTQA 2VG6A 3LANA 5BPMA 2XY8A 2P9NB 3VF4A 1BDGA 4CF2A 4HUFA 3TTFA 3SPYA 4FK0A 3TANA 4MLEA 4BE0A 1NMDA 1IKXA 1RBRA 4CEQA 2B5JA 3VQ8A 3O9QA 4CEEA 3J7YP 4QOZB 3H46O 3O9RA 4DFMA 1NGDA 4R79A 3VQ4A 4LF6K 2WUSA 3ALYA 4Q5VA 4IOXA 2PY5A 1IG9A 3UKUA 4JI0K 4DV7K 1RTJA 1IBLK 4CGGA 1IV0A 3LDQA 2YHXA 4MO4A 3DLHA 3KD5E 3AA4A 1VSHA 1BL3A 5AQGA 3VN5A 3DXMA 3AA3A 3ZCMA 4BY9C 3TPQA 1S6PA 1SQKA 3MN6A 3VEYA 4KH6A 4CESA 1CZ9A 3DM2A 2FSJA 1DKGD 4DWIA 3FZKA 4KHWA 4LH5A 2HB5A 2O8EA 5HRNA 4F3TA 3M8PA 3VQAA 4K43A 2FSNA 2NUBA 4LH4A 1EETA 3O80A 5J2NA 3HYFA 3V81A 1NLVA 2KQ2A 2P9PB 4DHYA 3OYJA 3LL3A 4DLEA 2P9PA 2W42A 4CGJA 1TKXA 4B3MK 4CJVA 4FJNA 3VA0A 3AY9A 5BR9A 4CBWA 1VQON 3C65A 1BCMA 2NRZA 1S3XA 4J2AA 3CCMN 1N32K 5MLCQ 1WSHA 3K59A 2AP1A 1HLUA 4DQRA 2VWBA 3VTHA 5FLXO 5AQJA 3V6DA 2ASMA 3QNNA 4M3WA 3AGKA 5C15A 1N33K 2HVHA 3ITHA 3AVJA 2ZM6K 4CK2A 2ZE2A 4H0VB 4A61A 4CJUA 4OGCA 3EKUA 4CK1A 3LDSA 1QTMA 2E6MA 3LP3A 4JKHA 1U47A 4H5TA 3ASMA 1L3SA 3HK2A 1I94K 4FVMA 3M6GA 4FW2A 3O5BA 2O8FA 4CJLA 3KKRA 1JCFA 4L3QA 3ENOA 4FLYA 1FK9A 1WSIA 3SUPA 5AQFA 2HBJA 4UY8O 5GAHP 2BUPA 5M1KA 3LDPA 3CPWM 4DTJA 1ATRA 3TTDA 4IJAA 5HRRA 5AQWA 3CMAN 2YKMA 3PSIA 3OYNA 3CC7N 4BRDA 3SK3A 1GLCG 4E7HA 3CCEN 4IG3A 1RCHA 3HI0A 3CJCA 1VQ4N 4FWPA 4BDYA 2ETJA 5AQNA 2P9UB 1VSEA 2EX3A 3NCIA 3K5NA 3TAMA 2WTUA 4A2BA 1SUQA 4FWOA 4KBOA 4B1UB 4I9LA 3QIPA 1P90A 1IJJA 4CBXA 4DV3K 1U48A 1DTTA 4A57A 4KHUA 2WFBA 1WAJA 2HF3A 4RTFD 4FCYA 3V9ZA 4KI4A 2A3ZA 3OBYA 3VQEA 1BOTO 1YT3A 4FLUA 3J7AP 2UXCK 3NF8A 3FGUA 4DTMA 4DCHA 1L3UA 3K0SA 2HHHK 5IWAK 3EEQA 1NK6A 3VGMA 4F2SA 3D2FB 3RWUA 1RDUA 3CM5A 2G8FA 3ZT3A 3EE9A 3UIQA 5FPEA 2YKNA 3PV8A 1WN7A 3ZYYX 5BRHA 3CF5L 2HNYA 3QETA 1NGCA 4HTUA 3R6MA 4HCCA 4FLTA 1KC8O 3C6UA 1REVA 4WCEL 3SUNA 4C8KA 4FO0A 3LAMA 3VQDA 2YCHA 1BIZA 4GV9A 3B6PA 1HUXA 2GV9A 2CGLA 3CERA 4E7JA 3LWMA 1WBDA 5HBMA 4E3SA 2Q97A 4NXNK 3AVIA 4NLBA 4MDAA 3AA2A 4X66K 3PLAA 3AVHA 3OYEA 2KZMA 3H3NO 5KRSA 1ILYA 4M7YA 4KI6A 4CZEA 1D9DA 3L2UA 5HRSA 4JKAA 1IG8A 3SPZA 3SYZA 4OKKA 1VQLN 1A5WA 2IIRA 4C1NK 4LF4K 1RBSA 1WLJA 4GV3A 1C0TA 4KH4A 2DFHA 1S9EA 2O8DB 3O6WA 3AVCA 2HHSA 3WNEA 3PX4A 4JLHA 4IO9L 1P8ZA 2IC3A 4M63C 3I56N 4LF5K 3G10A 5EY4A 2I7NA 3NH1A 3LPTA 2X74A 1NOZA 5I42A 3SBTA 1N34K 3UE5A 1LWCA 1CZBA 1X1PA 4OPHA 1JLCA 1TKTA 3A5NC 4AHUA 4H0XB 3ZSQA 1HQUA 3D0PA 1NGBA 4JS4A 1HKGA 2OPPA 1V4SA 3H08A 3KIOA 4IBNA 1NG9A 1VSMA 4CGIA 2HHQA 1SL0A 5KI6A 1J5EK 3MMVA 4N56A 1BI4A 1QHAA 4DR4K 3EN9A 5AQSA 1WNSA 4FWNA 3E9OA 4XH5A 4AM7A 5AQKA 2YI1A 4M3TA 1EX4A 3M8QA 3CXCM 4YORA 3TWHA 3O8MA 3QEXA 2HSTA 4CZIA 3HM9A 2OANA 2A40A 3CJBA 1Y97A 4O0JA 3A5MC 3Q7BA 3E01A 4O5FA 4DTUA 2FC0A 3IS9A 1KVAA 4K41A 4J2BA 4CJQA 2PYLA 3ZX3A 1C0GA 3NDKA 4CHYA 1ASVA 4IOCL 1FKOA 3L0QA 4CZFA 1B9FA 4FK2A 5HL7L 4EHTA 2IVOA 3HPOA 5AR0A 3P4IA 1VQ5N 3SUOA 3A8YA 2D1KA 4NYFA 1BG3A 4IJNA 2NNWA 1MWMA 4FJ5A 1NK4A 4KHPK 2Z1HA 1RBTA 4O55A 4PKHA 5CR4A 3T1YK 3SQ4A 2WOMA 1VRUA 3SLCA 4JV5K 3VQ5A 4MFBA 4JD2B 3OHRA 2OYQA 3SJHA 4K42A 2BE2A 1KXPA 5BREA 1WSEA 2NRRA 3P39A 2F9WA 4RW4A 2ZJQL 3AO3A 3V9UA 3OA9A 1QS4A 1G15A 4WYBA 2JWKA 1SKWA 3TAQA 2W40A 4H0PA 4H0TB 2IAJA 1G99A 2ASOA 3AVMA 4TSXA 1RTHA 1LV5A 2UU9K 3VQ9A 2VG5A 1NJWA 1X3MA 1NMNA 3MN5A 3CCRN 3VGLA 3CC2N 1NOYA 3EY1A 1EQYA 1YF5L 3VQ6A 3WEEB 4FZZA 4FM2A 2VQFK 3D2EB 5GADP 4KB0A 5AZIA 3D2EA 5AZJB 3EZWA 3UKRB 1MU2A 2KW4A 1S22A 4FXDA 4ISGA 3U9ZA 4BR7A 1QSSA 1T44A 5CZ1A 2NRWA 3AAQA 1DGKN 4CZLA 1HYZA 5KGXA 2QWPA 2B6AA 1JXBA 4DFJA 4FJ9A 1S6QA 1XQSC 1T6DA 5C24A 5JLFA 1VRTA 3P38A 1GLJO 4K8ZA 1ITGA 4DU1A 3P31A 4ZHRA 2P9SB 3OY9A 1LAWA 1HPMA 1K8KB 4O4GA 1RT3A 4W5NA 4YNQA 4IOAL 3MN7A 4V19S 2IOCA 3OYIA 1TK5A 3D7EO 2ZJPL 1VSIA 1BHLA 5I3UA 3PX0A 3DLBA 4AILC 5C0YA 4IWVA 4DSFA 1ATSA 4DSLA 2FBTA 5T7BA 1X9SA 4BRHA 3WQUA 4B08A 1RT2A 1YIJN 3U3YA 3GL1A 1TKDA 4R5PA 1HNZK 3RMCA 5BPLA 2D0CA 2FF3B 2V7ZA 5M1QA 3CCJN 4B9QA 3ZEUA 3MXJA 4BRFA 5CYMA 3CJAA 4YOTA 5ADXH 4DV0K 4JKGA 2IVPA 2YNGA 5AJ3K 2BDPA 3ULDA 4I6MB 4XIUA 5FDLA 3IAYA 3SQ0A 3O3GA 4FYDA 4H0OA 3QESA 1YJ9N 5CHIA 1F21A 5ADXA 3CJ9A 3CFRA 4CBUA 5JS1A 4JHDB 3WNFA 1L3VA 3AVFA 3IMXA 3NAEA 4B9VA 4CJ5A 4FLXA 4X64K 3A5LC 2G8IA 2GX9A 3J81O 3SCXA 4E7IA 3BEXA 5J2QA 1JJ2M 3SJJA 2F4VK 1U2VA 3B6OA 1NGHA 2HMIA 2H3GX 3RMBA 4B1YB 4C8MA 4BRKA 4CIFA 3ZT0A 3CCVN 2G8HA 1RDBA 3S9HA 5C25A 3TAFA 1NK5A 1BQNA 3KLGA 3SNNA 1RTIA 3O9UA 5AQLA 4KB1A 2YJFA 4FW1A 4LC9B 3R1XA 5LMNK 1VSKA 3W3DA 3VQBA 3C94A 4KO0A 3MX5A 3RVCA 3H6EA 2D0OA 2NRVA 1UWBA 3HPHA 3VTIA 4GKKK 2E2NA 1EWRA 1KAXA 4GW6A 1U04A 3AO1A 1YUWA 4U67L 4DQQA 4BDPA 1OVQA 3E9LA 4BG8A 3LZJA 1GLEG 1XC3A 5M1PA 3CCLN 3L8BA 4M7XA 2XHBA 4DR5K 1ZBHA 4PY5A 4F3OA 3KK1A 4LF7K 1IBKK 1S72N 3OJSA 1JCEA 3HVTA 4DR3K 5BRDA 2RF2A 4WFNL 3HP6A 3O9SA 1NM1A 2CGKA 3ATVA 1K9MO 4CEBA 1QVFM 3KZBA 1QZ6A 2QWRA 1NK8A 3NMUA 3VQCA 1BQMA 3QMLA 3OYHA 3TAEA 1J5OA 2P9NA 3H45C 2VGNA 1BCOA 2VCPA 5JICA 2DY4A 1GLDG 3MXIA 2E88A 4JK7A 3DI6A 2BTFA 3M8RA 2YNFA 2QXLA 3V1OA 3KWGA 3QEIA 3SAHA 3QB0A 4BVPA 2KHOA 1UA0A 2HHTA 4CJPA 2QM1A 1HNVA 4DTNA 5D3GA 3O3HA 4M42A 2ZWHA 3QIOA 5KTQA 4OGEA 4C8NA 2A1SA 1VSJA 1D5AA 4I2PA 2QEXN 4HUGA 2JWLA 3MXMA 1CZAN 2E4LA 2HOEA 1LOTB 4RW8A 1BISA 4DUZK 1S1UA 3OYDA 2HNZA 2A1RA 4JKDA 4FWQA 4FJ8A 1NKCA 4DV4K 5JVGL 2D0AA 2G8WA 1NJYA 3V9WA 3F2KA 1QSLA 3QEWA 4QS8A 4Z4IA 3HSCA 2O8CB 1QQNA 3TSPA 3T7ZA 4Z94A 5F2RA 4CJSA 5H1SQ 4DTPA 4IEIA 3QEPA 4AQYK 4GY2B 5AQTA 3DXKB 3OS0A 4GNIA 1VSFA 4JI7K 5SZTA 5A2QO 2D5RA 3HJFA 3O4WA 3DXKA 3KK3A 4O8UA 4FWMA 1KFSA 5JVHL 2HHXA 5LJWA 2I7PA 3MEDA 1ZBFA 1C0MA 5AQYA 1JLGA 4ISFA 4E7KA 4O5BA 3F9MA 5TKWA 3MEGA 4BRPA 5AQMA 4CW7B 1YXQA 1VQPN 1JL2A 1UA1A 4E7LA 2YHBA 3EL2A 4RWTA 3U6FA 1XNQK 2NRTA 2HHUA 3DRPA 2VYPA 4JN4A 3NGZA 1X9WA 4UQGA 1OH5A 4KREA 1OH7A 3AV9A 3IRXA 2Q0RA 3VGKA 3OYLA 3T1HK 1SL1A 4KHNA 1B9DA 4CFDA 4ELTA 2QKBA 4CCHA 2G8KA 1QE1A 4M45A 4CJWA 3LDNA 1ASUA 1TKZA 4B9UA 3KK2A 3R9PA 3VA3A 4O8KA 1VK0A 1DT9A 2E1ZA 1RT4A 3ZT2A 4W5TA 4NCBA 4PA1A 5KQDA 4WE1A 2CH6A 1EWQA 1W0HA 3G0ZA 4Z4GA 4Y1CA 4CZMA 5BRFA 3V9XA 3G4SN 4E0DA 1RT7A 2FXUA 3GOIA 1N36K 3EYZA 1GOAA 4EAHD 4CEZA 3K57A 5BPNA 4A5AA 3V9SA 4FSVA 4CHZA 4PWDA 3TTCA 3MN9A 1D9FA 1HMVA 3ZSYA 2P9UA 4HVJA 1SS6A 2KFNA 1RFQA 1JCGA 1U45A 3P83D 2A41A 4CIGA 4IDKA 2RHKA 1M1KO 5M1NA 3VF2A 3TI0A 4CZHA 1C1AA 3VF6A 3ZSXA 3FZFA 5AQVA 3DMJA 3CJ1A 3VEXA 3HL8A 3OYCA 4BR2A 4JAXA 4YOWA 2OCEA 4DB3A 3VQ7A 3G25A 3D2FA 4OPAA 4B9NA 3DYAA 4CEAA 3VENA 4CVNE 1D4XA 4IDHA 4CGHA 3SAFA 2D4WA 5I9EB 1S1WA 4QAGA 2RPIA 2J4RA 4DTRA 3S41A 2O4IA 1KRPA 4KKOA 4EP4A 2P9LB 4DUYK 4IEEA 1A5VA 1LWEA 2ITMA 3M5RA 2P9LA 4ZTFA 3THXB 1S1XA 1UAXA 4Z4EA 1TUUA 3CIPA 3GBTA 1JLFA 1RDCA 4CK3A 1WBBA 3RRGA 1WSFA 4BWJA 5AQZA 2P5OA 4QS7A 2O8BB 1IKVA 2ZF5O 1JKHA 1T05A 1ZBSA 3L4QA 1KVBA 3L3VA 4J2DA 1YVNA 4CJTA 2D0BA 1JLAA 5AQPA 4DV2K 2G8UA 2PZSA 2EWSA 1CXUA 3T1AA 5KPZA 4KTQA 4B3TK 5EXWA 3RRHA 3LP1A 2O8DA 4CF8A 1FW6A 3FFKB 1XWLA 4BVOA 1NK0A 1OH6A 1HNXK 4GV6A 1TUYA 3GDQA 1KFDA 1K8AO 5K14A 4YOYA 4BRAA 3QEVA 3LWLA 5C2FA 3AVLA 1HRHA 3OW2M 3ID6A 3LPUA 3NF7A 3QICA 1Q81O 3SZ2A 3C6AA 5HRPA 4CD3A 4EIAA 4FZXC 2XY5A 5J1EA 1T3VA 2BANA 3RSEB 4WQ5C 1Q82O 4JK9A 1L5UA 1DTQA 3MK6A 1MWKA 3QDKA 3ATUA 1WSGA 4B8AB 4W5OA 3FFIA 3MX2A 4LF9K 3PSFA 1IKWA 1D8YA 3AVGA 1FXXA 3F5TA 2UUCK 4H0YB 1YAGA 4FJJA 1EO1A 2IGIA 3IUCA 1A5XA 2OA8A 4HUEA 4BC2A 4MQ3A 5BN9A 2ZJRL 1XC9A 3HT3A 3O08A 4H5WA 4H4OA 3MDQA 1VSDA 3NVKA 4GVEA 5JLHA 4PHTX 5AQQA 4M3YA 4RCHA 4CHOA 2VWKA 3EKSA 4JKCA 4F2RA 3K2PA 4BDZA 3WUHA 5B8HA 2HVIA 5J2MA 3AO5A 4BRLA 4DTXA 3RR8A 3DJCA 3TAPA 3DAWA 3CYMA 5LY3A 4CF9A 3QBWA 4JD2A 3HRGA 1U49A 4WQ5A 1EKEA 3DLRA 3FZLA 1YTAA 3HOTA 2HW3A 2GUIA 4CECA 3JAMO 2OTJN 1TV6A 3OYMA 1VQKN 4DV1K 2Y1IA 3OYKA 3NFAA 3AVAA 4OVLA 4DFKA 3Q7CA 5FPDA 4ID5A 2XO7A 5F1XA 3RMDA 4LFBK 4OPKA 1YVUA 1GOBA 2RE2A 1S1TA 3I33A 2E5LK 1Y64A 2ATQA 3A0IX 1J6ZA 1YI2N 3WXLA 4DSEA 3SI6A 4BRCA 1ZBLA 5J2PA 1E4FT 3LDOA 4J2EA 2QXFA 4CERA 2CGJA 1RNHA 1TAQA 4BR9A 3WEEA 1TVRA 1YTUA 4DR7K 1MDUB 3E66A 4KHSA 2D0PA 3CQ8A 1NJZA 4BWMA 5F0XA 4M3ZA 4DQIA 4DQSA 3L2VA 4ILGB 5AZJA 3NGIA 1SL2A 3UKRA 3ZSZA 3KD1E 4OX9K 3MEEA 1U6ZA 3NF6A 3TU5A 3S3OA 4BQLA 3KKSA 3N4PA 3KK7A 4FJMA 2QI2A 4OKEA 3I0SA 3RTVA 3AO4A 3LAKA 3QLHA 5M1OA 4Z4CA 3NH2A 3O1BA 4A62A 3DOLA 2HNDA 5EOYA 2P9SA 3AVKA 1GLAG 4OPJA 3THVA 1K8KA 3VQQA 4E1MA 2ASPA 3VMFB 4JS5A 1HKBA 4JK8A 2YNIA 3PX6A 3LDLA 4PKIA 4CE9A 3QNOA 2DPNA 2V51B 3IFRA 4M3RA 3BF3A 3CCQN 4DU3A 4EZ6A 1HX1A 1K73O 4B1ZA 5BN8A 1QQMA 1Z26A 3K9JA 4C8LA 1TGOA 4KH5A 3MWPA 5AQUA 3QFUA 3JXUA 4O44A 3MAQA 2W6KA 4YFUA 4PKGA 3OS2A 4JI2K 3A5OC 1FKPA 3GE1A 4DV6K 3ZSOA 5E41A 1HR0K 4ISEA 3JS6A 5AQOA 4RW6A 3M8SA 2QWQA 2V52B 3S3MA 2HHWA 3CMEN 3G6EN 4IZ9A 3MCPA 3K5OA 2HF4A 2DFFA 2P51A 4YDUC 4K8XA 3NVMA 5E26A 1WUAA 4DG1A 3NH0A 3VEOA 1N8RO 1N5YA 3MECA 4B8CA 1NGEA 1X9JA 3CPEA 4I6MA 3ZT1A 3UB5A 4EP5A 4A2AA 1YITN 2FLOA 1J53A 4JEPA 4JNEA 4JHDA 1LCUA 4HHTA 1NNEA 1E4GT 4B1VA 1RTDA 4GVMA 3TARA 4BACA 4KHYA 1VHXA 1XUPO 5AQRA 1U4BA 3BZCA 4NCGA 4F4KA 2RKIA 4NCAA 4Z4HA 2KTQA 5EU7A 5JS2A 3R8EA 1LW0A 4CEDA 4WQ4C 4OO1J 3THWB 5AQIA 2FBVA 1B92A 3NGYA 1IO2A 3O4NA 4Y0WA 3KLIA 4JI8K 4K25A 4CF0A 4A59A 2W41A 1YJWN 4CJ3A 5AQHA 2F8SA 1NKBA 4A5BA 1J54A 5E84A 5M1FA 4KHQA 3L2QA 3HXMA 1DEJA 4AH9A 1ZC6A 4DR2K 2OPRA 4FLZA 3E1YA 2GWKA 3KLHA 2HMPA 2PFUA 5CZ2A 3VOVA 2PBDA 2NRHA 4ICLA 4FWLA 4YDUA 4LF8K 5FPNA 3CC4N 1OKJA 1NBWA 1QSYA 4KAZA 3VEVA 4AHRA 2FBXA 4IO8A 3CCSN 2HBKA 3AVBA 3ENHA 4BRGA 1ESVA 3L6QA 1KSPA 4DFPA 2GWJA 1BIUA 1FJGK 3AGRA 1Q18A 3HBTA 4BE1A 3V4IA 3GG4A 1QHTA 3DLLL 3C0BA 1RT1A 1TL1A 3ZSVA 4CZGA 4EFHA 2KLAA 1Q7YO 1S1VA 2QKKA 3IG1A 1Q8IA 4DQ8A 4WQ4A 1VQ6N 5EX5A 2OPQA 1XNRK 3P1GA 4YOUA 2P1JA 4G1QA 2V7YA 3CETA 4DR6K 1OVYA 1NK9A 3HOSA 3PUFA 2UUAK 1CLQA 4FOIA 3FE1A 4BE2A 2DFEA 4F8RA 3ISNC 4CJRA 5HOOA 3EZ5A 2IS3A 4CFBA 1TK0A 3FZHA 1WSJA 1KCFA 2Z1JA 4LSNA 1R59O 3R3LA 3WNGA 1M90O 3TAGA 4HWIA 3WNHA 3ZT4A 4HTLA 1C0FA 4PQUA 3UKUB 3D6RA 4PL7A 4JRQA 1KLMA 3LP2A 4KV8A 1Z6RA 3CFOA 4YHHK 4OLBA 4DV5K 3DXMB 3ID8A 4E19A 1E3MA 1JLQA 3SQ2A 2VQEK 4C8OA 4ILHA 5KQ8A 4DTSA 4ILJA 4B9LA 4BC3A 3WXKA 2O8CA 4XH4A 5C12A 4U7BA 3SQ1A 5KPRA 3BZKA 2O8EB 2Z1GA 3FLCO 3K58A 4BC4A 3K5LA 2OPSA 3D45A 3ZX2A 1NK7A 3OVNA 4RW7A 3BF1A 2HHVA 2ITGA 4B3RK 2B4JA 1RDWX 4H03B 3AA5X 4WFBL 4B3SK 3O9TA 1HYSA 5BR8K 4IG0A 4H5RA 4CGFA 4FK4A 5C2DA 5DK5A 4IKFA 4CJKA 1RILA 1N6QA 4IFYA 2X78A 3CQYA
chains in the Genus database with same CATH topology
3T1AA 3VQPA 3BDPA 4L8RB 1NOYA 3EY1A 4KTQA 1EP4A 1RT5A 3VQ6A 3RRHA 3LP1A 4CF8A 3KJVA 4FJLA 1SV5A 4JRPA 4FZZA 1XWLA 4FM2A 2YHAA 1NK0A 3SV4A 4ZTJA 4N76A 1ZYQA 2OZMA 3LZIA 1C1BA 3A2FA 3CFPA 4OJRA 1KFDA 3AVNA 4KB0A 4AHVA 2RN2A 2GBZA 1HNIA 5K14A 4FJ7A 1JLBA 3QEVA 1BGXT 1MU2A 2KW4A 1XHXA 3LWLA 4KFBA 5FRNA 4FXDA 1Z25A 4M41A 3V1QA 3AVLA 1ZBUA 1HRHA 1QSSA 3PO4A 3T19A 5CZ1A 2PYJA 2KFZA 1J9AA 4OKJA 3LPUA 3NF7A 3OYBA 4I7FA 3SZ2A 2G8VA 5HRPA 4FZXC 3OYFA 1HYZA 2Q3SA 5KGXA 2DTUA 2XY5A 2B6AA 5J1EA 4IFVA 1JXBA 4DFJA 2BANA 4FJ9A 1S6QA 1Q9YA 5C24A 1L5UA 1DTQA 2FBYA 2ZQBA 5FROA 4FJXA 3C95A 1VRTA 3OYAA 3NBPA 1WSGA 2F8TA 1W9HA 4K8ZA 1ITGA 4DU1A 4B8AB 1K6YA 1KVCA 4ZHRA 4W5OA 3FFIA 3OY9A 4N5SA 1LAWA 2E6LA 4O4GA 1RT3A 1VSLA 1IKWA 4E89A 4FM1A 3AVGA 1D8YA 2XY7A 4YNQA 1FXXA 4W5NA 4CFAA 1KLNA 4B3OA 2IOCA 4I2QA 3OYGA 3OYIA 4FJJA 1TK5A 2KZZA 1KTQA 1DLOA 1VSIA 2VG6A 4CHNA 1XI1A 1QQCA 3LANA 1XHZA 2IGIA 1BHLA 2XY8A 5I3UA 3PX0A 4FZYA 3RR7A 3P5JA 4CF2A 4HUFA 3SPYA 1A5XA 3TANA 2OA8A 4HUEA 3DLBA 4KPYA 4FK0A 4AILC 4BE0A 1IKXA 1RBRA 4CEQA 4DSFA 2B5JA 4MQ3A 4DSLA 3VQ8A 2FBTA 4QOZB 4CEEA 5T7BA 3C6TA 1XC9A 1X9SA 3HT3A 3SV3A 4H4OA 1O1WA 2JLEA 4B08A 1VSDA 1RT2A 4DFMA 3VQ4A 3U3YA 1TKDA 4R5PA 3ALYA 3RMCA 4M3YA 4CEOA 4CHOA 2VWKA 2D0CA 4Q5VA 1ASWA 4F2RA 3K2PA 4BDZA 2PY5A 1IG9A 4Q0BA 4DLGA 4AHCA 3OJUA 1RTJA 4CGGA 2HVIA 3MXJA 5J2MA 5CYMA 3DLHA 4B9SA 3KD5E 3AO5A 2QK9A 3AA4A 4DTXA 1VSHA 1BL3A 3VN5A 3HPGA 3RR8A 4KRFA 1R0AA 3AA3A 3ZCMA 1S6PA 3AO2A 3L2RA 3TAPA 2YNGA 3CYMA 1HJRA 4CF9A 2BDPA 3ULDA 4DU4A 1U49A 4CIEA 1EKEA 1CZ9A 3DLRA 3DM2A 1YTAA 4CESA 4XIUA 5FDLA 2HW3A 3IAYA 3SQ0A 2GUIA 4CECA 3O3GA 4DWIA 4FYDA 3QESA 4KHWA 4LH5A 1F21A 2HB5A 1WAFA 3CFRA 5HRNA 4F3TA 2OZSA 3M8PA 4FLWA 1TV6A 3OYMA 3WNFA 3VQAA 2Y1IA 1L3VA 5JS1A 3AVFA 3OYKA 3NFAA 3NAEA 3AVAA 4B9VA 4CJ5A 4FLXA 2NUBA 4LH4A 4OVLA 1EETA 4DFKA 5J2NA 3HYFA 3V81A 2KQ2A 4HCBA 2G8IA 4ID5A 2XO7A 4CEFA 3RMDA 5HP1A 2BGGA 4OPKA 3SCXA 1YVUA 4E7IA 1GOBA 5J2QA 3OYJA 3SJJA 3NF9A 4DLEA 1S1TA 2W42A 4CGJA 1TKXA 3QERA 4CJVA 4FJNA 3VA0A 3B6OA 2HMIA 3RMBA 1BCMA 4C8MA 4J2AA 4Y1DA 3ZT0A 4CIFA 4DSIA 2ATQA 1WSHA 3K59A 3PO5A 4DQRA 4DSEA 3SI6A 5CYQA 1ZBLA 2G8HA 1RDBA 5J2PA 3S9HA 5C25A 1TAUA 3TAFA 1NK5A 1BQNA 3KLGA 3DLGA 3SNNA 4J2EA 1RTIA 2QXFA 4CERA 5FRMA 5DMRA 3PY8A 3V6DA 3QNNA 1RNHA 1TAQA 4KB1A 4M3WA 5SWMA 2YNHA 4O0IA 1TVRA 1RT6A 1YTUA 3ITHA 3AVJA 4FW1A 4CK2A 2HVHA 4KHSA 2ZE2A 4CJUA 4OGCA 3HP9A 3CQ8A 1VSKA 1NJZA 4BWMA 3VQBA 4CK1A 3LDSA 1QTMA 2E6MA 3C94A 3LP3A 4KO0A 4DQSA 1U47A 4DQIA 3L2VA 4M3ZA 4OLAA 3ASMA 1L3SA 3NGIA 3DOKA 3HK2A 1SL2A 4FVMA 4FW2A 3ZSZA 3KD1E 4CJLA 3MEEA 3NF6A 3KKRA 3S3OA 4B9MA 3TABA 3S3NA 3KKSA 4FLYA 1FK9A 1WSIA 3HPHA 1UWBA 3RMAA 4DF8A 4M3UA 3SUPA 4FJMA 4GW6A 1U04A 3AO1A 4DQQA 4OKEA 4BDPA 3I0SA 1SKRA 1HYVA 3LALA 3LZJA 3RTVA 3AO4A 3LAKA 3QLHA 4Z4CA 1HPZA 3NH2A 1RDAA 1X9MA 3L8BA 4FM0A 2XHBA 1ZBHA 3NE6A 4PY5A 3SUQA 4F3OA 3DOLA 2HNDA 2ZD1A 3KK1A 1BI4B 4DTJA 3OJSA 3HVTA 3AVKA 5HRRA 4OPJA 3THVA 4E1MA 3VQQA 2RF2A 2YKMA 4JS5A 3HP6A 5KRTA 3OYNA 4NYNA 4CHPA 4ELVA 4CEBA 2YNIA 4E7HA 3PX6A 1NK8A 4IG3A 3VQCA 5C42A 1BQMA 4CE9A 1RCHA 3QNOA 4M3RA 4BDYA 2ETJA 1I3AA 4DU3A 4EZ6A 3OYHA 3TAEA 1J5OA 4LSLA 3L2WA 1VSEA 2EX3A 3ZSRA 1BCOA 3K5NA 3NCIA 1Z26A 4C8LA 2DY4A 3TAMA 3MXIA 1TGOA 1SUQA 3DI6A 3ZSWA 1ZBIA 4I9LA 3QIPA 4O44A 3M8RA 3MAQA 4YFUA 2YNFA 1C1CA 4PUOA 3OS2A 3V1OA 1FKPA 3QEIA 1U48A 1DTTA 4KHUA 4CJ4A 3KTQA 3KLFA 1C0UA 4H8KA 1WAJA 3TR8A 3V9ZA 4FCYA 1UA0A 4KI4A 2HHTA 3ZSOA 4CJPA 5E41A 3VQEA 1YT3A 4FLUA 3NF8A 1HNVA 4DTNA 4RW6A 3M8SA 5D3GA 4DTMA 3O3HA 1NJXA 3S3MA 1L3UA 4M42A 2HHWA 3DRSA 3QIOA 4DMNA 1S9GA 2VWJA 5KTQA 1NK6A 1TK8A 4H4MA 4F2SA 3DLKA 4OGEA 3RWUA 3CM5A 3K5OA 2G8FA 4C8NA 2A1SA 3ZT3A 2DFFA 5KGWA 1VSJA 1D5AA 4I2PA 3UIQA 1LWFA 2P51A 2YKNA 3PV8A 1WN7A 4HUGA 1Q9XA 4K8XA 3MXMA 2HNYA 3QETA 4DG1A 3NH0A 2E4LA 4RW8A 1N5YA 3MECA 3L3UA 4B8CA 4CFCA 1BISA 4HTUA 3ZT1A 1S1UA 4EP5A 3OYDA 4HCCA 2HNZA 4FLTA 2A1RA 4FJ8A 3HSTB 3C6UA 1NKCA 1REVA 2D0AA 2VG7A 3SUNA 2G8WA 4C8KA 1NJYA 3V9WA 3LAMA 4M3XA 1J53A 3VQDA 1L3TA 3HO1A 3O3FA 1QSLA 1T03A 3QEWA 1BIZA 4Z4IA 2LSNA 3B6PA 4HHTA 1NKEA 2GV9A 1RTDA 4DTPA 4GVMA 3DLEA 4BACA 4CJSA 3LWMA 3QINA 4E7JA 3QEPA 5HBMA 3TARA 4E3SA 4KHYA 4AHSA 3OS0A 3AVIA 4Z4FA 1U4BA 4NCGA 3JYTA 1VSFA 2RKIA 4FLVA 4F4KA 4NCAA 3AA2A 4Z4HA 4W5QA 5SZTA 2AJQA 2D5RA 2KTQA 3HJFA 3T3FA 3KK3A 1T8EA 5EU7A 1KFSA 5JS2A 2HHXA 3AVHA 3OYEA 2KZMA 1LW0A 3I0RA 4CEDA 3MEDA 4CJFA 1ZBFA 2FBVA 1B92A 1C0MA 5KRSA 1JLGA 3NGYA 1IO2A 3DRRA 3O4NA 4E7KA 4KI6A 3KLIA 4O5BA 4CF0A 3F9KA 3MEGA 4AHTA 1D9DA 3L2UA 5HRSA 4CJ3A 3SPZA 3SYZA 4OKKA 1JL2A 1UA1A 1A5WA 4QCLA 4E7LA 2F8SA 2YHBA 3U6FA 1NKBA 1RBSA 1WLJA 1J54A 1C0TA 2HHUA 3DRPA 2Z1IA 3KLEA 3NGZA 2DFHA 1X9WA 1IKYA 4UQGA 4KHQA 4KREA 4ID1A 1S9EA 2X6NA 3L2QA 3HXMA 3AV9A 4AH9A 3IRXA 4RW9A 3OYLA 4DF4A 1SL1A 4KHNA 3AVCA 2HHSA 3WNEA 3PX4A 1B9DA 4JLHA 4CFDA 2OPRA 1I39A 2XRIA 4FLZA 4ELTA 2QKBA 1CXQA 4DS5A 4CCHA 2IC3A 2G8KA 1JLEA 1QE1A 4M45A 4CJWA 4B9UA 1ASUA 1TKZA 3KLHA 5CZ2A 3G10A 3KK2A 4E1NA 3V1RA 4ICLA 3LPTA 3NH1A 1RDDA 2X74A 4KTWA 1NOZA 5I42A 1T7PA 4LD0A 3VA3A 1QSYA 1LWCA 1VK0A 5HLFA 4EZ9A 1CZBA 1X1PA 4N41A 1RT4A 1JLCA 3ZT2A 1TKTA 2YV0X 4KAZA 2Y1JA 4LY7A 4AHUA 1TL3A 3ZSQA 4W5TA 4ELUA 4FJGA 4PA1A 4NCBA 1LAVA 2F96A 1HQUA 4WE1A 3D0PA 4AHRA 4RG8A 2FBXA 4JS4A 1W0HA 2OPPA 3G0ZA 3H08A 3AVBA 3KIOA 4IBNA 1VSMA 4Y1CA 2IDOA 4CGIA 4Z4GA 2HHQA 1SL0A 1RBUA 5KI6A 4DSKA 4N56A 1BI4A 1KSPA 4DFPA 2JGUA 3V9XA 1BIUA 3BGRA 4Z0UA 1WNSA 4BE1A 4E0DA 3V4IA 1RT7A 1QHTA 5CY4A 3ZSVA 1RT1A 1TL1A 1RBVA 3EYZA 1GOAA 1EX4A 3U3GA 3I8DA 3M8QA 3HVRA 4M3TA 4DSJA 3LP0A 4CEZA 3JSMA 3NHGA 1S1VA 3K57A 2QKKA 3IG1A 3V9SA 1LW2A 1Q8IA 3TWHA 4KTZA 4CHZA 3QEXA 4PWDA 2OPQA 3P1GA 1SKSA 1D9FA 1S5JA 2P1JA 1HMVA 4G1QA 3ZSYA 4HVJA 3HM9A 4CF1A 1Y97A 2KFNA 4O0JA 1U45A 3P83D 3E01A 4CIGA 4DTUA 2FC0A 1NK9A 3IS9A 1KVAA 4IDKA 4J2BA 3PUFA 4CJQA 2PYLA 3TI0A 2O4GA 3NDKA 2EHGA 1CLQA 1C1AA 4CHYA 1ASVA 3CM6A 3ZSXA 4CHQA 5HROA 4BE2A 2DFEA 3DMJA 4F8RA 1FKOA 3ISNC 4CGDA 3OS1A 4CJRA 1C6VA 1B9FA 1JXEA 2IS3A 3HL8A 4CFBA 3EZ5A 3OYCA 4FK2A 4GMJB 3HPOA 1TK0A 1WSJA 3SUOA 1KCFA 2Z1JA 4LSNA 4B9TA 3VQ7A 1GOCA 2P5GA 3WNGA 3TAGA 3K5MA 4B9NA 3WNHA 4NYFA 3DYAA 3ZT4A 4CEAA 1UOCA 4PQUA 4FJ5A 1NK4A 4JRQA 4CGHA 1KLMA 3LP2A 4N47A 4KV8A 2Z1HA 1S1WA 4QAGA 2RPIA 4DTOA 2I5JA 3CFOA 1RBTA 4O55A 4DTRA 3SQ4A 4OLBA 1JL1A 2O4IA 2WOMA 1VRUA 4CJEA 1KRPA 4E19A 4KKOA 4EP4A 4FJKA 1JLQA 1HQEA 3VQ5A 3SQ2A 4MFBA 4C8OA 4DTSA 2OYQA 1A5VA 1LWEA 4B9LA 4W5RA 2WONA 2BE2A 4ZTFA 3SQ1A 1S1XA 1UAXA 1WSEA 2Z1GA 4Z4EA 3K58A 4DS4A 3K5LA 4RW4A 2OPSA 3D45A 1NK7A 3AO3A 3OVNA 1JLFA 1RDCA 4I9QA 4CK3A 4RW7A 3RRGA 1WSFA 3V9UA 2XY6A 4BWJA 2P5OA 2HHVA 2ITGA 1QS4A 2B4JA 1G15A 3AA5X 1SKWA 3TAQA 1IKVA 3QO9A 4FJHA 1JKHA 1T05A 1HYSA 4IG0A 1EXQA 1KVBA 2IAJA 4CGFA 3L3VA 3F73A 4J2DA 4FK4A 4CJTA 4DQPA 3AVMA 2D0BA 4TSXA 5DK5A 4CJKA 1RILA 4IKFA 1JLAA 1RTHA 1LV5A 1IH7A 2X6SA 3O4QA 2VG5A 3VQ9A 2R7YA 1NJWA 1N6QA 2G8UA 2PZSA 4FJIA 4IFYA 3CG7A 2X78A 1CXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1A A;  3VQP A;  3BDP A;  4L8R B;  1NOY A;  3EY1 A;  4KTQ A;  1EP4 A;  1RT5 A;  3VQ6 A;  3RRH A;  3LP1 A;  4CF8 A;  3KJV A;  4FJL A;  1SV5 A;  4JRP A;  4FZZ A;  1XWL A;  4FM2 A;  2YHA A;  1NK0 A;  3SV4 A;  4ZTJ A;  4N76 A;  1ZYQ A;  2OZM A;  3LZI A;  1C1B A;  3A2F A;  3CFP A;  4OJR A;  1KFD A;  3AVN A;  4KB0 A;  4AHV A;  2RN2 A;  2GBZ A;  1HNI A;  5K14 A;  4FJ7 A;  1JLB A;  3QEV A;  1BGX T;  1MU2 A;  2KW4 A;  1XHX A;  3LWL A;  4KFB A;  5FRN A;  4FXD A;  1Z25 A;  4M41 A;  3V1Q A;  3AVL A;  1ZBU A;  1HRH A;  1QSS A;  3PO4 A;  3T19 A;  5CZ1 A;  2PYJ A;  2KFZ A;  1J9A A;  4OKJ A;  3LPU A;  3NF7 A;  3OYB A;  4I7F A;  3SZ2 A;  2G8V A;  5HRP A;  4FZX C;  3OYF A;  1HYZ A;  2Q3S A;  5KGX A;  2DTU A;  2XY5 A;  2B6A A;  5J1E A;  4IFV A;  1JXB A;  4DFJ A;  2BAN A;  4FJ9 A;  1S6Q A;  1Q9Y A;  5C24 A;  1L5U A;  1DTQ A;  2FBY A;  2ZQB A;  5FRO A;  4FJX A;  3C95 A;  1VRT A;  3OYA A;  3NBP A;  1WSG A;  2F8T A;  1W9H A;  4K8Z A;  1ITG A;  4DU1 A;  4B8A B;  1K6Y A;  1KVC A;  4ZHR A;  4W5O A;  3FFI A;  3OY9 A;  4N5S A;  1LAW A;  2E6L A;  4O4G A;  1RT3 A;  1VSL A;  1IKW A;  4E89 A;  4FM1 A;  3AVG A;  1D8Y A;  2XY7 A;  4YNQ A;  1FXX A;  4W5N A;  4CFA A;  1KLN A;  4B3O A;  2IOC A;  4I2Q A;  3OYG A;  3OYI A;  4FJJ A;  1TK5 A;  2KZZ A;  1KTQ A;  1DLO A;  1VSI A;  2VG6 A;  4CHN A;  1XI1 A;  1QQC A;  3LAN A;  1XHZ A;  2IGI A;  1BHL A;  2XY8 A;  5I3U A;  3PX0 A;  4FZY A;  3RR7 A;  3P5J A;  4CF2 A;  4HUF A;  3SPY A;  1A5X A;  3TAN A;  2OA8 A;  4HUE A;  3DLB A;  4KPY A;  4FK0 A;  4AIL C;  4BE0 A;  1IKX A;  1RBR A;  4CEQ A;  4DSF A;  2B5J A;  4MQ3 A;  4DSL A;  3VQ8 A;  2FBT A;  4QOZ B;  4CEE A;  5T7B A;  3C6T A;  1XC9 A;  1X9S A;  3HT3 A;  3SV3 A;  4H4O A;  1O1W A;  2JLE A;  4B08 A;  1VSD A;  1RT2 A;  4DFM A;  3VQ4 A;  3U3Y A;  1TKD A;  4R5P A;  3ALY A;  3RMC A;  4M3Y A;  4CEO A;  4CHO A;  2VWK A;  2D0C A;  4Q5V A;  1ASW A;  4F2R A;  3K2P A;  4BDZ A;  2PY5 A;  1IG9 A;  4Q0B A;  4DLG A;  4AHC A;  3OJU A;  1RTJ A;  4CGG A;  2HVI A;  3MXJ A;  5J2M A;  5CYM A;  3DLH A;  4B9S A;  3KD5 E;  3AO5 A;  2QK9 A;  3AA4 A;  4DTX A;  1VSH A;  1BL3 A;  3VN5 A;  3HPG A;  3RR8 A;  4KRF A;  1R0A A;  3AA3 A;  3ZCM A;  1S6P A;  3AO2 A;  3L2R A;  3TAP A;  2YNG A;  3CYM A;  1HJR A;  4CF9 A;  2BDP A;  3ULD A;  4DU4 A;  1U49 A;  4CIE A;  1EKE A;  1CZ9 A;  3DLR A;  3DM2 A;  1YTA A;  4CES A;  4XIU A;  5FDL A;  2HW3 A;  3IAY A;  3SQ0 A;  2GUI A;  4CEC A;  3O3G A;  4DWI A;  4FYD A;  3QES A;  4KHW A;  4LH5 A;  1F21 A;  2HB5 A;  1WAF A;  3CFR A;  5HRN A;  4F3T A;  2OZS A;  3M8P A;  4FLW A;  1TV6 A;  3OYM A;  3WNF A;  3VQA A;  2Y1I A;  1L3V A;  5JS1 A;  3AVF A;  3OYK A;  3NFA A;  3NAE A;  3AVA A;  4B9V A;  4CJ5 A;  4FLX A;  2NUB A;  4LH4 A;  4OVL A;  1EET A;  4DFK A;  5J2N A;  3HYF A;  3V81 A;  2KQ2 A;  4HCB A;  2G8I A;  4ID5 A;  2XO7 A;  4CEF A;  3RMD A;  5HP1 A;  2BGG A;  4OPK A;  3SCX A;  1YVU A;  4E7I A;  1GOB A;  5J2Q A;  3OYJ A;  3SJJ A;  3NF9 A;  4DLE A;  1S1T A;  2W42 A;  4CGJ A;  1TKX A;  3QER A;  4CJV A;  4FJN A;  3VA0 A;  3B6O A;  2HMI A;  3RMB A;  1BCM A;  4C8M A;  4J2A A;  4Y1D A;  3ZT0 A;  4CIF A;  4DSI A;  2ATQ A;  1WSH A;  3K59 A;  3PO5 A;  4DQR A;  4DSE A;  3SI6 A;  5CYQ A;  1ZBL A;  2G8H A;  1RDB A;  5J2P A;  3S9H A;  5C25 A;  1TAU A;  3TAF A;  1NK5 A;  1BQN A;  3KLG A;  3DLG A;  3SNN A;  4J2E A;  1RTI A;  2QXF A;  4CER A;  5FRM A;  5DMR A;  3PY8 A;  3V6D A;  3QNN A;  1RNH A;  1TAQ A;  4KB1 A;  4M3W A;  5SWM A;  2YNH A;  4O0I A;  1TVR A;  1RT6 A;  1YTU A;  3ITH A;  3AVJ A;  4FW1 A;  4CK2 A;  2HVH A;  4KHS A;  2ZE2 A;  4CJU A;  4OGC A;  3HP9 A;  3CQ8 A;  1VSK A;  1NJZ A;  4BWM A;  3VQB A;  4CK1 A;  3LDS A;  1QTM A;  2E6M A;  3C94 A;  3LP3 A;  4KO0 A;  4DQS A;  1U47 A;  4DQI A;  3L2V A;  4M3Z A;  4OLA A;  3ASM A;  1L3S A;  3NGI A;  3DOK A;  3HK2 A;  1SL2 A;  4FVM A;  4FW2 A;  3ZSZ A;  3KD1 E;  4CJL A;  3MEE A;  3NF6 A;  3KKR A;  3S3O A;  4B9M A;  3TAB A;  3S3N A;  3KKS A;  4FLY A;  1FK9 A;  1WSI A;  3HPH A;  1UWB A;  3RMA A;  4DF8 A;  4M3U A;  3SUP A;  4FJM A;  4GW6 A;  1U04 A;  3AO1 A;  4DQQ A;  4OKE A;  4BDP A;  3I0S A;  1SKR A;  1HYV A;  3LAL A;  3LZJ A;  3RTV A;  3AO4 A;  3LAK A;  3QLH A;  4Z4C A;  1HPZ A;  3NH2 A;  1RDA A;  1X9M A;  3L8B A;  4FM0 A;  2XHB A;  1ZBH A;  3NE6 A;  4PY5 A;  3SUQ A;  4F3O A;  3DOL A;  2HND A;  2ZD1 A;  3KK1 A;  1BI4 B;  4DTJ A;  3OJS A;  3HVT A;  3AVK A;  5HRR A;  4OPJ A;  3THV A;  4E1M A;  3VQQ A;  2RF2 A;  2YKM A;  4JS5 A;  3HP6 A;  5KRT A;  3OYN A;  4NYN A;  4CHP A;  4ELV A;  4CEB A;  2YNI A;  4E7H A;  3PX6 A;  1NK8 A;  4IG3 A;  3VQC A;  5C42 A;  1BQM A;  4CE9 A;  1RCH A;  3QNO A;  4M3R A;  4BDY A;  2ETJ A;  1I3A A;  4DU3 A;  4EZ6 A;  3OYH A;  3TAE A;  1J5O A;  4LSL A;  3L2W A;  1VSE A;  2EX3 A;  3ZSR A;  1BCO A;  3K5N A;  3NCI A;  1Z26 A;  4C8L A;  2DY4 A;  3TAM A;  3MXI A;  1TGO A;  1SUQ A;  3DI6 A;  3ZSW A;  1ZBI A;  4I9L A;  3QIP A;  4O44 A;  3M8R A;  3MAQ A;  4YFU A;  2YNF A;  1C1C A;  4PUO A;  3OS2 A;  3V1O A;  1FKP A;  3QEI A;  1U48 A;  1DTT A;  4KHU A;  4CJ4 A;  3KTQ A;  3KLF A;  1C0U A;  4H8K A;  1WAJ A;  3TR8 A;  3V9Z A;  4FCY A;  1UA0 A;  4KI4 A;  2HHT A;  3ZSO A;  4CJP A;  5E41 A;  3VQE A;  1YT3 A;  4FLU A;  3NF8 A;  1HNV A;  4DTN A;  4RW6 A;  3M8S A;  5D3G A;  4DTM A;  3O3H A;  1NJX A;  3S3M A;  1L3U A;  4M42 A;  2HHW A;  3DRS A;  3QIO A;  4DMN A;  1S9G A;  2VWJ A;  5KTQ A;  1NK6 A;  1TK8 A;  4H4M A;  4F2S A;  3DLK A;  4OGE A;  3RWU A;  3CM5 A;  3K5O A;  2G8F A;  4C8N A;  2A1S A;  3ZT3 A;  2DFF A;  5KGW A;  1VSJ A;  1D5A A;  4I2P A;  3UIQ A;  1LWF A;  2P51 A;  2YKN A;  3PV8 A;  1WN7 A;  4HUG A;  1Q9X A;  4K8X A;  3MXM A;  2HNY A;  3QET A;  4DG1 A;  3NH0 A;  2E4L A;  4RW8 A;  1N5Y A;  3MEC A;  3L3U A;  4B8C A;  4CFC A;  1BIS A;  4HTU A;  3ZT1 A;  1S1U A;  4EP5 A;  3OYD A;  4HCC A;  2HNZ A;  4FLT A;  2A1R A;  4FJ8 A;  3HST B;  3C6U A;  1NKC A;  1REV A;  2D0A A;  2VG7 A;  3SUN A;  2G8W A;  4C8K A;  1NJY A;  3V9W A;  3LAM A;  4M3X A;  1J53 A;  3VQD A;  1L3T A;  3HO1 A;  3O3F A;  1QSL A;  1T03 A;  3QEW A;  1BIZ A;  4Z4I A;  2LSN A;  3B6P A;  4HHT A;  1NKE A;  2GV9 A;  1RTD A;  4DTP A;  4GVM A;  3DLE A;  4BAC A;  4CJS A;  3LWM A;  3QIN A;  4E7J A;  3QEP A;  5HBM A;  3TAR A;  4E3S A;  4KHY A;  4AHS A;  3OS0 A;  3AVI A;  4Z4F A;  1U4B A;  4NCG A;  3JYT A;  1VSF A;  2RKI A;  4FLV A;  4F4K A;  4NCA A;  3AA2 A;  4Z4H A;  4W5Q A;  5SZT A;  2AJQ A;  2D5R A;  2KTQ A;  3HJF A;  3T3F A;  3KK3 A;  1T8E A;  5EU7 A;  1KFS A;  5JS2 A;  2HHX A;  3AVH A;  3OYE A;  2KZM A;  1LW0 A;  3I0R A;  4CED A;  3MED A;  4CJF A;  1ZBF A;  2FBV A;  1B92 A;  1C0M A;  5KRS A;  1JLG A;  3NGY A;  1IO2 A;  3DRR A;  3O4N A;  4E7K A;  4KI6 A;  3KLI A;  4O5B A;  4CF0 A;  3F9K A;  3MEG A;  4AHT A;  1D9D A;  3L2U A;  5HRS A;  4CJ3 A;  3SPZ A;  3SYZ A;  4OKK A;  1JL2 A;  1UA1 A;  1A5W A;  4QCL A;  4E7L A;  2F8S A;  2YHB A;  3U6F A;  1NKB A;  1RBS A;  1WLJ A;  1J54 A;  1C0T A;  2HHU A;  3DRP A;  2Z1I A;  3KLE A;  3NGZ A;  2DFH A;  1X9W A;  1IKY A;  4UQG A;  4KHQ A;  4KRE A;  4ID1 A;  1S9E A;  2X6N A;  3L2Q A;  3HXM A;  3AV9 A;  4AH9 A;  3IRX A;  4RW9 A;  3OYL A;  4DF4 A;  1SL1 A;  4KHN A;  3AVC A;  2HHS A;  3WNE A;  3PX4 A;  1B9D A;  4JLH A;  4CFD A;  2OPR A;  1I39 A;  2XRI A;  4FLZ A;  4ELT A;  2QKB A;  1CXQ A;  4DS5 A;  4CCH A;  2IC3 A;  2G8K A;  1JLE A;  1QE1 A;  4M45 A;  4CJW A;  4B9U A;  1ASU A;  1TKZ A;  3KLH A;  5CZ2 A;  3G10 A;  3KK2 A;  4E1N A;  3V1R A;  4ICL A;  3LPT A;  3NH1 A;  1RDD A;  2X74 A;  4KTW A;  1NOZ A;  5I42 A;  1T7P A;  4LD0 A;  3VA3 A;  1QSY A;  1LWC A;  1VK0 A;  5HLF A;  4EZ9 A;  1CZB A;  1X1P A;  4N41 A;  1RT4 A;  1JLC A;  3ZT2 A;  1TKT A;  2YV0 X;  4KAZ A;  2Y1J A;  4LY7 A;  4AHU A;  1TL3 A;  3ZSQ A;  4W5T A;  4ELU A;  4FJG A;  4PA1 A;  4NCB A;  1LAV A;  2F96 A;  1HQU A;  4WE1 A;  3D0P A;  4AHR A;  4RG8 A;  2FBX A;  4JS4 A;  1W0H A;  2OPP A;  3G0Z A;  3H08 A;  3AVB A;  3KIO A;  4IBN A;  1VSM A;  4Y1C A;  2IDO A;  4CGI A;  4Z4G A;  2HHQ A;  1SL0 A;  1RBU A;  5KI6 A;  4DSK A;  4N56 A;  1BI4 A;  1KSP A;  4DFP A;  2JGU A;  3V9X A;  1BIU A;  3BGR A;  4Z0U A;  1WNS A;  4BE1 A;  4E0D A;  3V4I A;  1RT7 A;  1QHT A;  5CY4 A;  3ZSV A;  1RT1 A;  1TL1 A;  1RBV A;  3EYZ A;  1GOA A;  1EX4 A;  3U3G A;  3I8D A;  3M8Q A;  3HVR A;  4M3T A;  4DSJ A;  3LP0 A;  4CEZ A;  3JSM A;  3NHG A;  1S1V A;  3K57 A;  2QKK A;  3IG1 A;  3V9S A;  1LW2 A;  1Q8I A;  3TWH A;  4KTZ A;  4CHZ A;  3QEX A;  4PWD A;  2OPQ A;  3P1G A;  1SKS A;  1D9F A;  1S5J A;  2P1J A;  1HMV A;  4G1Q A;  3ZSY A;  4HVJ A;  3HM9 A;  4CF1 A;  1Y97 A;  2KFN A;  4O0J A;  1U45 A;  3P83 D;  3E01 A;  4CIG A;  4DTU A;  2FC0 A;  1NK9 A;  3IS9 A;  1KVA A;  4IDK A;  4J2B A;  3PUF A;  4CJQ A;  2PYL A;  3TI0 A;  2O4G A;  3NDK A;  2EHG A;  1CLQ A;  1C1A A;  4CHY A;  1ASV A;  3CM6 A;  3ZSX A;  4CHQ A;  5HRO A;  4BE2 A;  2DFE A;  3DMJ A;  4F8R A;  1FKO A;  3ISN C;  4CGD A;  3OS1 A;  4CJR A;  1C6V A;  1B9F A;  1JXE A;  2IS3 A;  3HL8 A;  4CFB A;  3EZ5 A;  3OYC A;  4FK2 A;  4GMJ B;  3HPO A;  1TK0 A;  1WSJ A;  3SUO A;  1KCF A;  2Z1J A;  4LSN A;  4B9T A;  3VQ7 A;  1GOC A;  2P5G A;  3WNG A;  3TAG A;  3K5M A;  4B9N A;  3WNH A;  4NYF A;  3DYA A;  3ZT4 A;  4CEA A;  1UOC A;  4PQU A;  4FJ5 A;  1NK4 A;  4JRQ A;  4CGH A;  1KLM A;  3LP2 A;  4N47 A;  4KV8 A;  2Z1H A;  1S1W A;  4QAG A;  2RPI A;  4DTO A;  2I5J A;  3CFO A;  1RBT A;  4O55 A;  4DTR A;  3SQ4 A;  4OLB A;  1JL1 A;  2O4I A;  2WOM A;  1VRU A;  4CJE A;  1KRP A;  4E19 A;  4KKO A;  4EP4 A;  4FJK A;  1JLQ A;  1HQE A;  3VQ5 A;  3SQ2 A;  4MFB A;  4C8O A;  4DTS A;  2OYQ A;  1A5V A;  1LWE A;  4B9L A;  4W5R A;  2WON A;  2BE2 A;  4ZTF A;  3SQ1 A;  1S1X A;  1UAX A;  1WSE A;  2Z1G A;  4Z4E A;  3K58 A;  4DS4 A;  3K5L A;  4RW4 A;  2OPS A;  3D45 A;  1NK7 A;  3AO3 A;  3OVN A;  1JLF A;  1RDC A;  4I9Q A;  4CK3 A;  4RW7 A;  3RRG A;  1WSF A;  3V9U A;  2XY6 A;  4BWJ A;  2P5O A;  2HHV A;  2ITG A;  1QS4 A;  2B4J A;  1G15 A;  3AA5 X;  1SKW A;  3TAQ A;  1IKV A;  3QO9 A;  4FJH A;  1JKH A;  1T05 A;  1HYS A;  4IG0 A;  1EXQ A;  1KVB A;  2IAJ A;  4CGF A;  3L3V A;  3F73 A;  4J2D A;  4FK4 A;  4CJT A;  4DQP A;  3AVM A;  2D0B A;  4TSX A;  5DK5 A;  4CJK A;  1RIL A;  4IKF A;  1JLA A;  1RTH A;  1LV5 A;  1IH7 A;  2X6S A;  3O4Q A;  2VG5 A;  3VQ9 A;  2R7Y A;  1NJW A;  1N6Q A;  2G8U A;  2PZS A;  4FJI A;  4IFY A;  3CG7 A;  2X78 A;  1CXU A; 
#chains in the Genus database with same CATH topology
 3VQP A;  3BDP A;  4L8R B;  2YHW A;  4DKW A;  1EP4 A;  3MWT A;  5AQX A;  1RT5 A;  3KJV A;  2YX6 A;  2QWO A;  4ZTJ A;  1WB9 A;  4N76 A;  1C1B A;  1WOQ A;  3A2F A;  3CFP A;  1ZXO A;  4FWK A;  3AVN A;  4BR5 A;  4FPA A;  4AHV A;  3AAR A;  2E8A A;  1HJO A;  4FJ7 A;  1JLB A;  1BGX T;  1XHX A;  4KFB A;  5IT9 O;  2O8F B;  1Z25 A;  4M41 A;  1ZBU A;  5GAG P;  3PO4 A;  3T19 A;  2PYJ A;  1J9A A;  4OKJ A;  5C10 A;  4BG9 A;  4FOE A;  3VET A;  2W6L A;  1NWK A;  2PAV A;  4CJ7 A;  4BRQ A;  1IBM K;  2DTU A;  4IFV A;  1O13 A;  3TSQ A;  2FBY A;  1QQO A;  5FRO A;  3C95 A;  4IXC A;  3OYA A;  3NBP A;  1W7A A;  1W9H A;  4FL9 A;  1KQS M;  4JI5 K;  1K6Y A;  1KVC A;  2E6L A;  1NGG A;  1VSL A;  4G9Z A;  4XH1 A;  4CFA A;  3FR0 A;  3I8B A;  4B3O A;  4NB4 A;  4B1X B;  4YOV A;  3OYG A;  2KZZ A;  4B1W B;  2WC9 A;  1DLO A;  4CHN A;  1XI1 A;  1QQC A;  4AF1 A;  1XHZ A;  4FZY A;  3RR7 A;  2ZGZ A;  3P5J A;  2QWM A;  4JI4 K;  4KPY A;  3KVG A;  1VQ8 N;  2CH5 A;  3CJ7 A;  3CI5 A;  4JYA K;  3C6T A;  4WF9 L;  3SV3 A;  1O1W A;  2JLE A;  3B8A X;  3WXI A;  4FVU A;  2HBL A;  2Q36 A;  3ULE B;  3FZM A;  4CZK A;  2YJE A;  4CEO A;  1BO5 O;  1X3N A;  1ASW A;  1BU6 O;  4AM6 A;  4Q0B A;  3ULE A;  2Q1N A;  4DLG A;  1Z05 A;  2VGM A;  3L4I A;  4AHC A;  3OJU A;  5JMV A;  4IFE A;  4B9S A;  2QK9 A;  3CQX A;  3WXM B;  4C23 A;  3HPG A;  4KRF A;  1R0A A;  1GLF O;  3N4Q A;  4BRO A;  3AO2 A;  3L2R A;  1HJR A;  2Q0U A;  4DU4 A;  2Q2R A;  3HZ6 A;  4CIE A;  3THX A;  3U8X A;  1WAF A;  2BH1 A;  3O1W A;  2OZS A;  4FLW A;  5CE3 A;  3SMP A;  2GUP A;  4HCB A;  3QFP A;  2O8B A;  1VQN N;  4CEF A;  5HP1 A;  2BGG A;  3T69 A;  3NF9 A;  4BQZ A;  3QER A;  3IDH A;  4H5V A;  4Y1D A;  1NGA A;  4DSI A;  3BY5 A;  3PO5 A;  5CYQ A;  1TAU A;  1KAZ A;  3SBG A;  3DLG A;  4YY3 K;  1W2B M;  4JKF A;  5FRM A;  5DMR A;  3PY8 A;  3THY B;  2IVN A;  2AA4 A;  2NZT A;  5SWM A;  1NJI O;  2YNH A;  4O0I A;  4NXM K;  1RT6 A;  3THY A;  1SAZ A;  3U4L A;  3HP9 A;  3H1Q A;  3HM8 A;  2UYT A;  4OLA A;  2WBN A;  2ZGY A;  1TYQ B;  3DOK A;  5AFU H;  1TYQ A;  2A6A A;  4B9M A;  1QZ5 A;  1W97 L;  3J8A A;  3TAB A;  3S3N A;  2UXB K;  4CD1 A;  3RMA A;  3PIO L;  4DF8 A;  4M3U A;  3TSU A;  1SKR A;  1HYV A;  3LAL A;  5AFU A;  3RSE A;  1HPZ A;  2GEL A;  1RDA A;  1X9M A;  4FM0 A;  3NE6 A;  3SUQ A;  2ZD1 A;  1BI4 B;  4E1J A;  3KWI A;  3CHW A;  4MDB A;  3BP8 A;  4YOX A;  3W0L A;  5KRT A;  2A42 A;  4NYN A;  4CHP A;  4ELV A;  5C42 A;  1SZ2 A;  1XMO K;  1BA0 A;  1I3A A;  2A5X A;  4LSL A;  4XEI A;  3L2W A;  3ZSR A;  3DWL A;  1YJN N;  3ZSW A;  1H1V A;  2E2O A;  1ZBI A;  4BRI A;  1NGF A;  1C1C A;  4PUO A;  1XMQ K;  2UXD K;  3OBW A;  4CJ4 A;  3KTQ A;  3KLF A;  1C0U A;  3TR8 A;  1T6C A;  5ELZ A;  1NJX A;  3DRS A;  3M1F A;  2E20 A;  4DMN A;  1S9G A;  2VWJ A;  4BRN A;  1TK8 A;  4H4M A;  2P9K B;  2NLX A;  4C1N I;  3DLK A;  2UUB K;  5KGW A;  2P9K A;  5GIN A;  1LWF A;  1Q9X A;  1Q86 O;  2QWL A;  5TKY A;  3L3U A;  4CFC A;  3HST B;  2VG7 A;  3EO3 A;  3HTV A;  3K9K A;  1L3T A;  4M3X A;  3HO1 A;  2OTL N;  5LL6 Z;  4EHU A;  3O3F A;  4CZJ A;  1T03 A;  3WQT A;  2FF6 A;  2LSN A;  1BWF O;  1NKE A;  3DLE A;  3QIN A;  3WXJ A;  5GAE P;  1GLB G;  4AHS A;  3ENB A;  4Z4F A;  3JYT A;  2QA4 N;  2AJQ A;  4FLV A;  1MA9 B;  4W5Q A;  3T3F A;  1T8E A;  2F7T A;  3I0R A;  4JI3 K;  4CJF A;  3DRR A;  2P9I B;  4H5N A;  4DR1 K;  1QVG M;  3F9K A;  4FPB A;  4AHT A;  4F9O A;  3U9D A;  2P9I A;  4JI6 K;  4BC5 A;  3OTO K;  4QCL A;  3EE8 A;  3QBX A;  2Z1I A;  3KLE A;  1IKY A;  2KKZ A;  4ID1 A;  2X6N A;  4BRE A;  1HNW K;  4RW9 A;  3H1V X;  4BGA A;  4DF4 A;  1I39 A;  2XRI A;  1V4T A;  1CXQ A;  4DS5 A;  1JLE A;  2NRX A;  3E9P A;  3VEW A;  5AZI B;  4E1N A;  3V1R A;  3BUZ B;  1RDD A;  4KTW A;  1T7P A;  4LD0 A;  5HLF A;  1HKC A;  4EZ9 A;  4N41 A;  1KD1 O;  1BA1 A;  2YV0 X;  2Y1J A;  4LY7 A;  4FJG A;  1TL3 A;  4ELU A;  1ATN A;  1LAV A;  2F96 A;  5LMU K;  4RG8 A;  2QWN A;  4BR4 A;  2IDO A;  3ZLJ A;  1RBU A;  4DSK A;  4FWS A;  2JGU A;  1VQ9 N;  3BGR A;  1YHQ N;  4Z0U A;  5FPM A;  4J8F A;  4JKB A;  5KPT A;  3SAG A;  5CY4 A;  1RBV A;  3U3G A;  3I8D A;  3G71 N;  3HVR A;  4DSJ A;  3LP0 A;  1VQM N;  3JSM A;  1GLL O;  3NHG A;  3ZX0 A;  1LW2 A;  4KTZ A;  3VPZ A;  1SKS A;  1S5J A;  4CF1 A;  4LFC K;  4GKJ K;  1NU0 A;  1RGI A;  4PL8 A;  4BRM A;  4JKE A;  3LM2 A;  2O4G A;  2EHG A;  3WT0 A;  5HRO A;  3CM6 A;  4CHQ A;  4CGD A;  3OS1 A;  5GIO A;  1C6V A;  1JXE A;  3C7N B;  4NLC A;  4GMJ B;  4X65 K;  3C7N A;  2QW9 A;  3IKM A;  4B9T A;  1GOC A;  3VEZ A;  2P5G A;  3K5M A;  3MCA B;  1UOC A;  4N47 A;  3ZEU B;  3ZET B;  4NO7 A;  4DTO A;  2I5J A;  4JKG B;  1JL1 A;  4CJE A;  3ZET A;  3SMS A;  2E2Q A;  4FJK A;  1HQE A;  3PIP L;  1KAY A;  3VES A;  4W5R A;  2WON A;  3CCU N;  2E2P A;  5DM7 L;  2F9T A;  1BUP A;  4DS4 A;  1NGJ A;  4I9Q A;  4MLH A;  2XY6 A;  2HBM A;  1VAZ A;  4CI6 A;  2E1Y A;  4FWR A;  3THW A;  4FJH A;  3QO9 A;  5LJV A;  3I55 N;  1EXQ A;  2YHY A;  1U2V B;  3F73 A;  4DQP A;  2KFZ A;  3J7Z O;  3C6H A;  1IH7 A;  2X6S A;  3O4Q A;  2R7Y A;  5EVZ A;  4FJI A;  3CG7 A;  3CD6 N;  4H8K A;  3KHY A;  4FJL A;  1SV5 A;  4JRP A;  2YHA A;  4WFA L;  3SV4 A;  1ZYQ A;  2OZM A;  2QTD A;  3LZI A;  3H3O B;  4OJR A;  3M3Z A;  2RN2 A;  2GBZ A;  2Q31 A;  1HNI A;  3VER A;  5FRN A;  4JI1 K;  1OH8 A;  3V1Q A;  1VQ7 N;  3OYB A;  4I7F A;  2G8V A;  4MO5 A;  4LFA K;  3LM9 A;  5DM6 L;  2Q3S A;  3OYF A;  2FSK A;  1Q9Y A;  3J80 O;  2ZQB A;  4FJX A;  4QS9 A;  2F8T A;  4BGB A;  4N5S A;  5GIP A;  4E89 A;  2GTD A;  4FM1 A;  4K0K K;  2XY7 A;  4BR0 A;  2GEM A;  4X62 K;  1KLN A;  1NGI A;  4I2Q A;  3AAP A;  1KTQ A;  2VG6 A;  3LAN A;  5BPM A;  2XY8 A;  2P9N B;  3VF4 A;  1BDG A;  4CF2 A;  4HUF A;  3TTF A;  3SPY A;  4FK0 A;  3TAN A;  4MLE A;  4BE0 A;  1NMD A;  1IKX A;  1RBR A;  4CEQ A;  2B5J A;  3VQ8 A;  3O9Q A;  4CEE A;  3J7Y P;  4QOZ B;  3H46 O;  3O9R A;  4DFM A;  1NGD A;  4R79 A;  3VQ4 A;  4LF6 K;  2WUS A;  3ALY A;  4Q5V A;  4IOX A;  2PY5 A;  1IG9 A;  3UKU A;  4JI0 K;  4DV7 K;  1RTJ A;  1IBL K;  4CGG A;  1IV0 A;  3LDQ A;  2YHX A;  4MO4 A;  3DLH A;  3KD5 E;  3AA4 A;  1VSH A;  1BL3 A;  5AQG A;  3VN5 A;  3DXM A;  3AA3 A;  3ZCM A;  4BY9 C;  3TPQ A;  1S6P A;  1SQK A;  3MN6 A;  3VEY A;  4KH6 A;  4CES A;  1CZ9 A;  3DM2 A;  2FSJ A;  1DKG D;  4DWI A;  3FZK A;  4KHW A;  4LH5 A;  2HB5 A;  2O8E A;  5HRN A;  4F3T A;  3M8P A;  3VQA A;  4K43 A;  2FSN A;  2NUB A;  4LH4 A;  1EET A;  3O80 A;  5J2N A;  3HYF A;  3V81 A;  1NLV A;  2KQ2 A;  2P9P B;  4DHY A;  3OYJ A;  3LL3 A;  4DLE A;  2P9P A;  2W42 A;  4CGJ A;  1TKX A;  4B3M K;  4CJV A;  4FJN A;  3VA0 A;  3AY9 A;  5BR9 A;  4CBW A;  1VQO N;  3C65 A;  1BCM A;  2NRZ A;  1S3X A;  4J2A A;  3CCM N;  1N32 K;  5MLC Q;  1WSH A;  3K59 A;  2AP1 A;  1HLU A;  4DQR A;  2VWB A;  3VTH A;  5FLX O;  5AQJ A;  3V6D A;  2ASM A;  3QNN A;  4M3W A;  3AGK A;  5C15 A;  1N33 K;  2HVH A;  3ITH A;  3AVJ A;  2ZM6 K;  4CK2 A;  2ZE2 A;  4H0V B;  4A61 A;  4CJU A;  4OGC A;  3EKU A;  4CK1 A;  3LDS A;  1QTM A;  2E6M A;  3LP3 A;  4JKH A;  1U47 A;  4H5T A;  3ASM A;  1L3S A;  3HK2 A;  1I94 K;  4FVM A;  3M6G A;  4FW2 A;  3O5B A;  2O8F A;  4CJL A;  3KKR A;  1JCF A;  4L3Q A;  3ENO A;  4FLY A;  1FK9 A;  1WSI A;  3SUP A;  5AQF A;  2HBJ A;  4UY8 O;  5GAH P;  2BUP A;  5M1K A;  3LDP A;  3CPW M;  4DTJ A;  1ATR A;  3TTD A;  4IJA A;  5HRR A;  5AQW A;  3CMA N;  2YKM A;  3PSI A;  3OYN A;  3CC7 N;  4BRD A;  3SK3 A;  1GLC G;  4E7H A;  3CCE N;  4IG3 A;  1RCH A;  3HI0 A;  3CJC A;  1VQ4 N;  4FWP A;  4BDY A;  2ETJ A;  5AQN A;  2P9U B;  1VSE A;  2EX3 A;  3NCI A;  3K5N A;  3TAM A;  2WTU A;  4A2B A;  1SUQ A;  4FWO A;  4KBO A;  4B1U B;  4I9L A;  3QIP A;  1P90 A;  1IJJ A;  4CBX A;  4DV3 K;  1U48 A;  1DTT A;  4A57 A;  4KHU A;  2WFB A;  1WAJ A;  2HF3 A;  4RTF D;  4FCY A;  3V9Z A;  4KI4 A;  2A3Z A;  3OBY A;  3VQE A;  1BOT O;  1YT3 A;  4FLU A;  3J7A P;  2UXC K;  3NF8 A;  3FGU A;  4DTM A;  4DCH A;  1L3U A;  3K0S A;  2HHH K;  5IWA K;  3EEQ A;  1NK6 A;  3VGM A;  4F2S A;  3D2F B;  3RWU A;  1RDU A;  3CM5 A;  2G8F A;  3ZT3 A;  3EE9 A;  3UIQ A;  5FPE A;  2YKN A;  3PV8 A;  1WN7 A;  3ZYY X;  5BRH A;  3CF5 L;  2HNY A;  3QET A;  1NGC A;  4HTU A;  3R6M A;  4HCC A;  4FLT A;  1KC8 O;  3C6U A;  1REV A;  4WCE L;  3SUN A;  4C8K A;  4FO0 A;  3LAM A;  3VQD A;  2YCH A;  1BIZ A;  4GV9 A;  3B6P A;  1HUX A;  2GV9 A;  2CGL A;  3CER A;  4E7J A;  3LWM A;  1WBD A;  5HBM A;  4E3S A;  2Q97 A;  4NXN K;  3AVI A;  4NLB A;  4MDA A;  3AA2 A;  4X66 K;  3PLA A;  3AVH A;  3OYE A;  2KZM A;  3H3N O;  5KRS A;  1ILY A;  4M7Y A;  4KI6 A;  4CZE A;  1D9D A;  3L2U A;  5HRS A;  4JKA A;  1IG8 A;  3SPZ A;  3SYZ A;  4OKK A;  1VQL N;  1A5W A;  2IIR A;  4C1N K;  4LF4 K;  1RBS A;  1WLJ A;  4GV3 A;  1C0T A;  4KH4 A;  2DFH A;  1S9E A;  2O8D B;  3O6W A;  3AVC A;  2HHS A;  3WNE A;  3PX4 A;  4JLH A;  4IO9 L;  1P8Z A;  2IC3 A;  4M63 C;  3I56 N;  4LF5 K;  3G10 A;  5EY4 A;  2I7N A;  3NH1 A;  3LPT A;  2X74 A;  1NOZ A;  5I42 A;  3SBT A;  1N34 K;  3UE5 A;  1LWC A;  1CZB A;  1X1P A;  4OPH A;  1JLC A;  1TKT A;  3A5N C;  4AHU A;  4H0X B;  3ZSQ A;  1HQU A;  3D0P A;  1NGB A;  4JS4 A;  1HKG A;  2OPP A;  1V4S A;  3H08 A;  3KIO A;  4IBN A;  1NG9 A;  1VSM A;  4CGI A;  2HHQ A;  1SL0 A;  5KI6 A;  1J5E K;  3MMV A;  4N56 A;  1BI4 A;  1QHA A;  4DR4 K;  3EN9 A;  5AQS A;  1WNS A;  4FWN A;  3E9O A;  4XH5 A;  4AM7 A;  5AQK A;  2YI1 A;  4M3T A;  1EX4 A;  3M8Q A;  3CXC M;  4YOR A;  3TWH A;  3O8M A;  3QEX A;  2HST A;  4CZI A;  3HM9 A;  2OAN A;  2A40 A;  3CJB A;  1Y97 A;  4O0J A;  3A5M C;  3Q7B A;  3E01 A;  4O5F A;  4DTU A;  2FC0 A;  3IS9 A;  1KVA A;  4K41 A;  4J2B A;  4CJQ A;  2PYL A;  3ZX3 A;  1C0G A;  3NDK A;  4CHY A;  1ASV A;  4IOC L;  1FKO A;  3L0Q A;  4CZF A;  1B9F A;  4FK2 A;  5HL7 L;  4EHT A;  2IVO A;  3HPO A;  5AR0 A;  3P4I A;  1VQ5 N;  3SUO A;  3A8Y A;  2D1K A;  4NYF A;  1BG3 A;  4IJN A;  2NNW A;  1MWM A;  4FJ5 A;  1NK4 A;  4KHP K;  2Z1H A;  1RBT A;  4O55 A;  4PKH A;  5CR4 A;  3T1Y K;  3SQ4 A;  2WOM A;  1VRU A;  3SLC A;  4JV5 K;  3VQ5 A;  4MFB A;  4JD2 B;  3OHR A;  2OYQ A;  3SJH A;  4K42 A;  2BE2 A;  1KXP A;  5BRE A;  1WSE A;  2NRR A;  3P39 A;  2F9W A;  4RW4 A;  2ZJQ L;  3AO3 A;  3V9U A;  3OA9 A;  1QS4 A;  1G15 A;  4WYB A;  2JWK A;  1SKW A;  3TAQ A;  2W40 A;  4H0P A;  4H0T B;  2IAJ A;  1G99 A;  2ASO A;  3AVM A;  4TSX A;  1RTH A;  1LV5 A;  2UU9 K;  3VQ9 A;  2VG5 A;  1NJW A;  1X3M A;  1NMN A;  3MN5 A;  3CCR N;  3VGL A;  3CC2 N;  1NOY A;  3EY1 A;  1EQY A;  1YF5 L;  3VQ6 A;  3WEE B;  4FZZ A;  4FM2 A;  2VQF K;  3D2E B;  5GAD P;  4KB0 A;  5AZI A;  3D2E A;  5AZJ B;  3EZW A;  3UKR B;  1MU2 A;  2KW4 A;  1S22 A;  4FXD A;  4ISG A;  3U9Z A;  4BR7 A;  1QSS A;  1T44 A;  5CZ1 A;  2NRW A;  3AAQ A;  1DGK N;  4CZL A;  1HYZ A;  5KGX A;  2QWP A;  2B6A A;  1JXB A;  4DFJ A;  4FJ9 A;  1S6Q A;  1XQS C;  1T6D A;  5C24 A;  5JLF A;  1VRT A;  3P38 A;  1GLJ O;  4K8Z A;  1ITG A;  4DU1 A;  3P31 A;  4ZHR A;  2P9S B;  3OY9 A;  1LAW A;  1HPM A;  1K8K B;  4O4G A;  1RT3 A;  4W5N A;  4YNQ A;  4IOA L;  3MN7 A;  4V19 S;  2IOC A;  3OYI A;  1TK5 A;  3D7E O;  2ZJP L;  1VSI A;  1BHL A;  5I3U A;  3PX0 A;  3DLB A;  4AIL C;  5C0Y A;  4IWV A;  4DSF A;  1ATS A;  4DSL A;  2FBT A;  5T7B A;  1X9S A;  4BRH A;  3WQU A;  4B08 A;  1RT2 A;  1YIJ N;  3U3Y A;  3GL1 A;  1TKD A;  4R5P A;  1HNZ K;  3RMC A;  5BPL A;  2D0C A;  2FF3 B;  2V7Z A;  5M1Q A;  3CCJ N;  4B9Q A;  3ZEU A;  3MXJ A;  4BRF A;  5CYM A;  3CJA A;  4YOT A;  5ADX H;  4DV0 K;  4JKG A;  2IVP A;  2YNG A;  5AJ3 K;  2BDP A;  3ULD A;  4I6M B;  4XIU A;  5FDL A;  3IAY A;  3SQ0 A;  3O3G A;  4FYD A;  4H0O A;  3QES A;  1YJ9 N;  5CHI A;  1F21 A;  5ADX A;  3CJ9 A;  3CFR A;  4CBU A;  5JS1 A;  4JHD B;  3WNF A;  1L3V A;  3AVF A;  3IMX A;  3NAE A;  4B9V A;  4CJ5 A;  4FLX A;  4X64 K;  3A5L C;  2G8I A;  2GX9 A;  3J81 O;  3SCX A;  4E7I A;  3BEX A;  5J2Q A;  1JJ2 M;  3SJJ A;  2F4V K;  1U2V A;  3B6O A;  1NGH A;  2HMI A;  2H3G X;  3RMB A;  4B1Y B;  4C8M A;  4BRK A;  4CIF A;  3ZT0 A;  3CCV N;  2G8H A;  1RDB A;  3S9H A;  5C25 A;  3TAF A;  1NK5 A;  1BQN A;  3KLG A;  3SNN A;  1RTI A;  3O9U A;  5AQL A;  4KB1 A;  2YJF A;  4FW1 A;  4LC9 B;  3R1X A;  5LMN K;  1VSK A;  3W3D A;  3VQB A;  3C94 A;  4KO0 A;  3MX5 A;  3RVC A;  3H6E A;  2D0O A;  2NRV A;  1UWB A;  3HPH A;  3VTI A;  4GKK K;  2E2N A;  1EWR A;  1KAX A;  4GW6 A;  1U04 A;  3AO1 A;  1YUW A;  4U67 L;  4DQQ A;  4BDP A;  1OVQ A;  3E9L A;  4BG8 A;  3LZJ A;  1GLE G;  1XC3 A;  5M1P A;  3CCL N;  3L8B A;  4M7X A;  2XHB A;  4DR5 K;  1ZBH A;  4PY5 A;  4F3O A;  3KK1 A;  4LF7 K;  1IBK K;  1S72 N;  3OJS A;  1JCE A;  3HVT A;  4DR3 K;  5BRD A;  2RF2 A;  4WFN L;  3HP6 A;  3O9S A;  1NM1 A;  2CGK A;  3ATV A;  1K9M O;  4CEB A;  1QVF M;  3KZB A;  1QZ6 A;  2QWR A;  1NK8 A;  3NMU A;  3VQC A;  1BQM A;  3QML A;  3OYH A;  3TAE A;  1J5O A;  2P9N A;  3H45 C;  2VGN A;  1BCO A;  2VCP A;  5JIC A;  2DY4 A;  1GLD G;  3MXI A;  2E88 A;  4JK7 A;  3DI6 A;  2BTF A;  3M8R A;  2YNF A;  2QXL A;  3V1O A;  3KWG A;  3QEI A;  3SAH A;  3QB0 A;  4BVP A;  2KHO A;  1UA0 A;  2HHT A;  4CJP A;  2QM1 A;  1HNV A;  4DTN A;  5D3G A;  3O3H A;  4M42 A;  2ZWH A;  3QIO A;  5KTQ A;  4OGE A;  4C8N A;  2A1S A;  1VSJ A;  1D5A A;  4I2P A;  2QEX N;  4HUG A;  2JWL A;  3MXM A;  1CZA N;  2E4L A;  2HOE A;  1LOT B;  4RW8 A;  1BIS A;  4DUZ K;  1S1U A;  3OYD A;  2HNZ A;  2A1R A;  4JKD A;  4FWQ A;  4FJ8 A;  1NKC A;  4DV4 K;  5JVG L;  2D0A A;  2G8W A;  1NJY A;  3V9W A;  3F2K A;  1QSL A;  3QEW A;  4QS8 A;  4Z4I A;  3HSC A;  2O8C B;  1QQN A;  3TSP A;  3T7Z A;  4Z94 A;  5F2R A;  4CJS A;  5H1S Q;  4DTP A;  4IEI A;  3QEP A;  4AQY K;  4GY2 B;  5AQT A;  3DXK B;  3OS0 A;  4GNI A;  1VSF A;  4JI7 K;  5SZT A;  5A2Q O;  2D5R A;  3HJF A;  3O4W A;  3DXK A;  3KK3 A;  4O8U A;  4FWM A;  1KFS A;  5JVH L;  2HHX A;  5LJW A;  2I7P A;  3MED A;  1ZBF A;  1C0M A;  5AQY A;  1JLG A;  4ISF A;  4E7K A;  4O5B A;  3F9M A;  5TKW A;  3MEG A;  4BRP A;  5AQM A;  4CW7 B;  1YXQ A;  1VQP N;  1JL2 A;  1UA1 A;  4E7L A;  2YHB A;  3EL2 A;  4RWT A;  3U6F A;  1XNQ K;  2NRT A;  2HHU A;  3DRP A;  2VYP A;  4JN4 A;  3NGZ A;  1X9W A;  4UQG A;  1OH5 A;  4KRE A;  1OH7 A;  3AV9 A;  3IRX A;  2Q0R A;  3VGK A;  3OYL A;  3T1H K;  1SL1 A;  4KHN A;  1B9D A;  4CFD A;  4ELT A;  2QKB A;  4CCH A;  2G8K A;  1QE1 A;  4M45 A;  4CJW A;  3LDN A;  1ASU A;  1TKZ A;  4B9U A;  3KK2 A;  3R9P A;  3VA3 A;  4O8K A;  1VK0 A;  1DT9 A;  2E1Z A;  1RT4 A;  3ZT2 A;  4W5T A;  4NCB A;  4PA1 A;  5KQD A;  4WE1 A;  2CH6 A;  1EWQ A;  1W0H A;  3G0Z A;  4Z4G A;  4Y1C A;  4CZM A;  5BRF A;  3V9X A;  3G4S N;  4E0D A;  1RT7 A;  2FXU A;  3GOI A;  1N36 K;  3EYZ A;  1GOA A;  4EAH D;  4CEZ A;  3K57 A;  5BPN A;  4A5A A;  3V9S A;  4FSV A;  4CHZ A;  4PWD A;  3TTC A;  3MN9 A;  1D9F A;  1HMV A;  3ZSY A;  2P9U A;  4HVJ A;  1SS6 A;  2KFN A;  1RFQ A;  1JCG A;  1U45 A;  3P83 D;  2A41 A;  4CIG A;  4IDK A;  2RHK A;  1M1K O;  5M1N A;  3VF2 A;  3TI0 A;  4CZH A;  1C1A A;  3VF6 A;  3ZSX A;  3FZF A;  5AQV A;  3DMJ A;  3CJ1 A;  3VEX A;  3HL8 A;  3OYC A;  4BR2 A;  4JAX A;  4YOW A;  2OCE A;  4DB3 A;  3VQ7 A;  3G25 A;  3D2F A;  4OPA A;  4B9N A;  3DYA A;  4CEA A;  3VEN A;  4CVN E;  1D4X A;  4IDH A;  4CGH A;  3SAF A;  2D4W A;  5I9E B;  1S1W A;  4QAG A;  2RPI A;  2J4R A;  4DTR A;  3S41 A;  2O4I A;  1KRP A;  4KKO A;  4EP4 A;  2P9L B;  4DUY K;  4IEE A;  1A5V A;  1LWE A;  2ITM A;  3M5R A;  2P9L A;  4ZTF A;  3THX B;  1S1X A;  1UAX A;  4Z4E A;  1TUU A;  3CIP A;  3GBT A;  1JLF A;  1RDC A;  4CK3 A;  1WBB A;  3RRG A;  1WSF A;  4BWJ A;  5AQZ A;  2P5O A;  4QS7 A;  2O8B B;  1IKV A;  2ZF5 O;  1JKH A;  1T05 A;  1ZBS A;  3L4Q A;  1KVB A;  3L3V A;  4J2D A;  1YVN A;  4CJT A;  2D0B A;  1JLA A;  5AQP A;  4DV2 K;  2G8U A;  2PZS A;  2EWS A;  1CXU A;  3T1A A;  5KPZ A;  4KTQ A;  4B3T K;  5EXW A;  3RRH A;  3LP1 A;  2O8D A;  4CF8 A;  1FW6 A;  3FFK B;  1XWL A;  4BVO A;  1NK0 A;  1OH6 A;  1HNX K;  4GV6 A;  1TUY A;  3GDQ A;  1KFD A;  1K8A O;  5K14 A;  4YOY A;  4BRA A;  3QEV A;  3LWL A;  5C2F A;  3AVL A;  1HRH A;  3OW2 M;  3ID6 A;  3LPU A;  3NF7 A;  3QIC A;  1Q81 O;  3SZ2 A;  3C6A A;  5HRP A;  4CD3 A;  4EIA A;  4FZX C;  2XY5 A;  5J1E A;  1T3V A;  2BAN A;  3RSE B;  4WQ5 C;  1Q82 O;  4JK9 A;  1L5U A;  1DTQ A;  3MK6 A;  1MWK A;  3QDK A;  3ATU A;  1WSG A;  4B8A B;  4W5O A;  3FFI A;  3MX2 A;  4LF9 K;  3PSF A;  1IKW A;  1D8Y A;  3AVG A;  1FXX A;  3F5T A;  2UUC K;  4H0Y B;  1YAG A;  4FJJ A;  1EO1 A;  2IGI A;  3IUC A;  1A5X A;  2OA8 A;  4HUE A;  4BC2 A;  4MQ3 A;  5BN9 A;  2ZJR L;  1XC9 A;  3HT3 A;  3O08 A;  4H5W A;  4H4O A;  3MDQ A;  1VSD A;  3NVK A;  4GVE A;  5JLH A;  4PHT X;  5AQQ A;  4M3Y A;  4RCH A;  4CHO A;  2VWK A;  3EKS A;  4JKC A;  4F2R A;  3K2P A;  4BDZ A;  3WUH A;  5B8H A;  2HVI A;  5J2M A;  3AO5 A;  4BRL A;  4DTX A;  3RR8 A;  3DJC A;  3TAP A;  3DAW A;  3CYM A;  5LY3 A;  4CF9 A;  3QBW A;  4JD2 A;  3HRG A;  1U49 A;  4WQ5 A;  1EKE A;  3DLR A;  3FZL A;  1YTA A;  3HOT A;  2HW3 A;  2GUI A;  4CEC A;  3JAM O;  2OTJ N;  1TV6 A;  3OYM A;  1VQK N;  4DV1 K;  2Y1I A;  3OYK A;  3NFA A;  3AVA A;  4OVL A;  4DFK A;  3Q7C A;  5FPD A;  4ID5 A;  2XO7 A;  5F1X A;  3RMD A;  4LFB K;  4OPK A;  1YVU A;  1GOB A;  2RE2 A;  1S1T A;  3I33 A;  2E5L K;  1Y64 A;  2ATQ A;  3A0I X;  1J6Z A;  1YI2 N;  3WXL A;  4DSE A;  3SI6 A;  4BRC A;  1ZBL A;  5J2P A;  1E4F T;  3LDO A;  4J2E A;  2QXF A;  4CER A;  2CGJ A;  1RNH A;  1TAQ A;  4BR9 A;  3WEE A;  1TVR A;  1YTU A;  4DR7 K;  1MDU B;  3E66 A;  4KHS A;  2D0P A;  3CQ8 A;  1NJZ A;  4BWM A;  5F0X A;  4M3Z A;  4DQI A;  4DQS A;  3L2V A;  4ILG B;  5AZJ A;  3NGI A;  1SL2 A;  3UKR A;  3ZSZ A;  3KD1 E;  4OX9 K;  3MEE A;  1U6Z A;  3NF6 A;  3TU5 A;  3S3O A;  4BQL A;  3KKS A;  3N4P A;  3KK7 A;  4FJM A;  2QI2 A;  4OKE A;  3I0S A;  3RTV A;  3AO4 A;  3LAK A;  3QLH A;  5M1O A;  4Z4C A;  3NH2 A;  3O1B A;  4A62 A;  3DOL A;  2HND A;  5EOY A;  2P9S A;  3AVK A;  1GLA G;  4OPJ A;  3THV A;  1K8K A;  3VQQ A;  4E1M A;  2ASP A;  3VMF B;  4JS5 A;  1HKB A;  4JK8 A;  2YNI A;  3PX6 A;  3LDL A;  4PKI A;  4CE9 A;  3QNO A;  2DPN A;  2V51 B;  3IFR A;  4M3R A;  3BF3 A;  3CCQ N;  4DU3 A;  4EZ6 A;  1HX1 A;  1K73 O;  4B1Z A;  5BN8 A;  1QQM A;  1Z26 A;  3K9J A;  4C8L A;  1TGO A;  4KH5 A;  3MWP A;  5AQU A;  3QFU A;  3JXU A;  4O44 A;  3MAQ A;  2W6K A;  4YFU A;  4PKG A;  3OS2 A;  4JI2 K;  3A5O C;  1FKP A;  3GE1 A;  4DV6 K;  3ZSO A;  5E41 A;  1HR0 K;  4ISE A;  3JS6 A;  5AQO A;  4RW6 A;  3M8S A;  2QWQ A;  2V52 B;  3S3M A;  2HHW A;  3CME N;  3G6E N;  4IZ9 A;  3MCP A;  3K5O A;  2HF4 A;  2DFF A;  2P51 A;  4YDU C;  4K8X A;  3NVM A;  5E26 A;  1WUA A;  4DG1 A;  3NH0 A;  3VEO A;  1N8R O;  1N5Y A;  3MEC A;  4B8C A;  1NGE A;  1X9J A;  3CPE A;  4I6M A;  3ZT1 A;  3UB5 A;  4EP5 A;  4A2A A;  1YIT N;  2FLO A;  1J53 A;  4JEP A;  4JNE A;  4JHD A;  1LCU A;  4HHT A;  1NNE A;  1E4G T;  4B1V A;  1RTD A;  4GVM A;  3TAR A;  4BAC A;  4KHY A;  1VHX A;  1XUP O;  5AQR A;  1U4B A;  3BZC A;  4NCG A;  4F4K A;  2RKI A;  4NCA A;  4Z4H A;  2KTQ A;  5EU7 A;  5JS2 A;  3R8E A;  1LW0 A;  4CED A;  4WQ4 C;  4OO1 J;  3THW B;  5AQI A;  2FBV A;  1B92 A;  3NGY A;  1IO2 A;  3O4N A;  4Y0W A;  3KLI A;  4JI8 K;  4K25 A;  4CF0 A;  4A59 A;  2W41 A;  1YJW N;  4CJ3 A;  5AQH A;  2F8S A;  1NKB A;  4A5B A;  1J54 A;  5E84 A;  5M1F A;  4KHQ A;  3L2Q A;  3HXM A;  1DEJ A;  4AH9 A;  1ZC6 A;  4DR2 K;  2OPR A;  4FLZ A;  3E1Y A;  2GWK A;  3KLH A;  2HMP A;  2PFU A;  5CZ2 A;  3VOV A;  2PBD A;  2NRH A;  4ICL A;  4FWL A;  4YDU A;  4LF8 K;  5FPN A;  3CC4 N;  1OKJ A;  1NBW A;  1QSY A;  4KAZ A;  3VEV A;  4AHR A;  2FBX A;  4IO8 A;  3CCS N;  2HBK A;  3AVB A;  3ENH A;  4BRG A;  1ESV A;  3L6Q A;  1KSP A;  4DFP A;  2GWJ A;  1BIU A;  1FJG K;  3AGR A;  1Q18 A;  3HBT A;  4BE1 A;  3V4I A;  3GG4 A;  1QHT A;  3DLL L;  3C0B A;  1RT1 A;  1TL1 A;  3ZSV A;  4CZG A;  4EFH A;  2KLA A;  1Q7Y O;  1S1V A;  2QKK A;  3IG1 A;  1Q8I A;  4DQ8 A;  4WQ4 A;  1VQ6 N;  5EX5 A;  2OPQ A;  1XNR K;  3P1G A;  4YOU A;  2P1J A;  4G1Q A;  2V7Y A;  3CET A;  4DR6 K;  1OVY A;  1NK9 A;  3HOS A;  3PUF A;  2UUA K;  1CLQ A;  4FOI A;  3FE1 A;  4BE2 A;  2DFE A;  4F8R A;  3ISN C;  4CJR A;  5HOO A;  3EZ5 A;  2IS3 A;  4CFB A;  1TK0 A;  3FZH A;  1WSJ A;  1KCF A;  2Z1J A;  4LSN A;  1R59 O;  3R3L A;  3WNG A;  1M90 O;  3TAG A;  4HWI A;  3WNH A;  3ZT4 A;  4HTL A;  1C0F A;  4PQU A;  3UKU B;  3D6R A;  4PL7 A;  4JRQ A;  1KLM A;  3LP2 A;  4KV8 A;  1Z6R A;  3CFO A;  4YHH K;  4OLB A;  4DV5 K;  3DXM B;  3ID8 A;  4E19 A;  1E3M A;  1JLQ A;  3SQ2 A;  2VQE K;  4C8O A;  4ILH A;  5KQ8 A;  4DTS A;  4ILJ A;  4B9L A;  4BC3 A;  3WXK A;  2O8C A;  4XH4 A;  5C12 A;  4U7B A;  3SQ1 A;  5KPR A;  3BZK A;  2O8E B;  2Z1G A;  3FLC O;  3K58 A;  4BC4 A;  3K5L A;  2OPS A;  3D45 A;  3ZX2 A;  1NK7 A;  3OVN A;  4RW7 A;  3BF1 A;  2HHV A;  2ITG A;  4B3R K;  2B4J A;  1RDW X;  4H03 B;  3AA5 X;  4WFB L;  4B3S K;  3O9T A;  1HYS A;  5BR8 K;  4IG0 A;  4H5R A;  4CGF A;  4FK4 A;  5C2D A;  5DK5 A;  4IKF A;  4CJK A;  1RIL A;  1N6Q A;  4IFY A;  2X78 A;  3CQY A; 
#chains in the Genus database with same CATH homology
 3T1A A;  3VQP A;  3BDP A;  4L8R B;  1NOY A;  3EY1 A;  4KTQ A;  1EP4 A;  1RT5 A;  3VQ6 A;  3RRH A;  3LP1 A;  4CF8 A;  3KJV A;  4FJL A;  1SV5 A;  4JRP A;  4FZZ A;  1XWL A;  4FM2 A;  2YHA A;  1NK0 A;  3SV4 A;  4ZTJ A;  4N76 A;  1ZYQ A;  2OZM A;  3LZI A;  1C1B A;  3A2F A;  3CFP A;  4OJR A;  1KFD A;  3AVN A;  4KB0 A;  4AHV A;  2RN2 A;  2GBZ A;  1HNI A;  5K14 A;  4FJ7 A;  1JLB A;  3QEV A;  1BGX T;  1MU2 A;  2KW4 A;  1XHX A;  3LWL A;  4KFB A;  5FRN A;  4FXD A;  1Z25 A;  4M41 A;  3V1Q A;  3AVL A;  1ZBU A;  1HRH A;  1QSS A;  3PO4 A;  3T19 A;  5CZ1 A;  2PYJ A;  2KFZ A;  1J9A A;  4OKJ A;  3LPU A;  3NF7 A;  3OYB A;  4I7F A;  3SZ2 A;  2G8V A;  5HRP A;  4FZX C;  3OYF A;  1HYZ A;  2Q3S A;  5KGX A;  2DTU A;  2XY5 A;  2B6A A;  5J1E A;  4IFV A;  1JXB A;  4DFJ A;  2BAN A;  4FJ9 A;  1S6Q A;  1Q9Y A;  5C24 A;  1L5U A;  1DTQ A;  2FBY A;  2ZQB A;  5FRO A;  4FJX A;  3C95 A;  1VRT A;  3OYA A;  3NBP A;  1WSG A;  2F8T A;  1W9H A;  4K8Z A;  1ITG A;  4DU1 A;  4B8A B;  1K6Y A;  1KVC A;  4ZHR A;  4W5O A;  3FFI A;  3OY9 A;  4N5S A;  1LAW A;  2E6L A;  4O4G A;  1RT3 A;  1VSL A;  1IKW A;  4E89 A;  4FM1 A;  3AVG A;  1D8Y A;  2XY7 A;  4YNQ A;  1FXX A;  4W5N A;  4CFA A;  1KLN A;  4B3O A;  2IOC A;  4I2Q A;  3OYG A;  3OYI A;  4FJJ A;  1TK5 A;  2KZZ A;  1KTQ A;  1DLO A;  1VSI A;  2VG6 A;  4CHN A;  1XI1 A;  1QQC A;  3LAN A;  1XHZ A;  2IGI A;  1BHL A;  2XY8 A;  5I3U A;  3PX0 A;  4FZY A;  3RR7 A;  3P5J A;  4CF2 A;  4HUF A;  3SPY A;  1A5X A;  3TAN A;  2OA8 A;  4HUE A;  3DLB A;  4KPY A;  4FK0 A;  4AIL C;  4BE0 A;  1IKX A;  1RBR A;  4CEQ A;  4DSF A;  2B5J A;  4MQ3 A;  4DSL A;  3VQ8 A;  2FBT A;  4QOZ B;  4CEE A;  5T7B A;  3C6T A;  1XC9 A;  1X9S A;  3HT3 A;  3SV3 A;  4H4O A;  1O1W A;  2JLE A;  4B08 A;  1VSD A;  1RT2 A;  4DFM A;  3VQ4 A;  3U3Y A;  1TKD A;  4R5P A;  3ALY A;  3RMC A;  4M3Y A;  4CEO A;  4CHO A;  2VWK A;  2D0C A;  4Q5V A;  1ASW A;  4F2R A;  3K2P A;  4BDZ A;  2PY5 A;  1IG9 A;  4Q0B A;  4DLG A;  4AHC A;  3OJU A;  1RTJ A;  4CGG A;  2HVI A;  3MXJ A;  5J2M A;  5CYM A;  3DLH A;  4B9S A;  3KD5 E;  3AO5 A;  2QK9 A;  3AA4 A;  4DTX A;  1VSH A;  1BL3 A;  3VN5 A;  3HPG A;  3RR8 A;  4KRF A;  1R0A A;  3AA3 A;  3ZCM A;  1S6P A;  3AO2 A;  3L2R A;  3TAP A;  2YNG A;  3CYM A;  1HJR A;  4CF9 A;  2BDP A;  3ULD A;  4DU4 A;  1U49 A;  4CIE A;  1EKE A;  1CZ9 A;  3DLR A;  3DM2 A;  1YTA A;  4CES A;  4XIU A;  5FDL A;  2HW3 A;  3IAY A;  3SQ0 A;  2GUI A;  4CEC A;  3O3G A;  4DWI A;  4FYD A;  3QES A;  4KHW A;  4LH5 A;  1F21 A;  2HB5 A;  1WAF A;  3CFR A;  5HRN A;  4F3T A;  2OZS A;  3M8P A;  4FLW A;  1TV6 A;  3OYM A;  3WNF A;  3VQA A;  2Y1I A;  1L3V A;  5JS1 A;  3AVF A;  3OYK A;  3NFA A;  3NAE A;  3AVA A;  4B9V A;  4CJ5 A;  4FLX A;  2NUB A;  4LH4 A;  4OVL A;  1EET A;  4DFK A;  5J2N A;  3HYF A;  3V81 A;  2KQ2 A;  4HCB A;  2G8I A;  4ID5 A;  2XO7 A;  4CEF A;  3RMD A;  5HP1 A;  2BGG A;  4OPK A;  3SCX A;  1YVU A;  4E7I A;  1GOB A;  5J2Q A;  3OYJ A;  3SJJ A;  3NF9 A;  4DLE A;  1S1T A;  2W42 A;  4CGJ A;  1TKX A;  3QER A;  4CJV A;  4FJN A;  3VA0 A;  3B6O A;  2HMI A;  3RMB A;  1BCM A;  4C8M A;  4J2A A;  4Y1D A;  3ZT0 A;  4CIF A;  4DSI A;  2ATQ A;  1WSH A;  3K59 A;  3PO5 A;  4DQR A;  4DSE A;  3SI6 A;  5CYQ A;  1ZBL A;  2G8H A;  1RDB A;  5J2P A;  3S9H A;  5C25 A;  1TAU A;  3TAF A;  1NK5 A;  1BQN A;  3KLG A;  3DLG A;  3SNN A;  4J2E A;  1RTI A;  2QXF A;  4CER A;  5FRM A;  5DMR A;  3PY8 A;  3V6D A;  3QNN A;  1RNH A;  1TAQ A;  4KB1 A;  4M3W A;  5SWM A;  2YNH A;  4O0I A;  1TVR A;  1RT6 A;  1YTU A;  3ITH A;  3AVJ A;  4FW1 A;  4CK2 A;  2HVH A;  4KHS A;  2ZE2 A;  4CJU A;  4OGC A;  3HP9 A;  3CQ8 A;  1VSK A;  1NJZ A;  4BWM A;  3VQB A;  4CK1 A;  3LDS A;  1QTM A;  2E6M A;  3C94 A;  3LP3 A;  4KO0 A;  4DQS A;  1U47 A;  4DQI A;  3L2V A;  4M3Z A;  4OLA A;  3ASM A;  1L3S A;  3NGI A;  3DOK A;  3HK2 A;  1SL2 A;  4FVM A;  4FW2 A;  3ZSZ A;  3KD1 E;  4CJL A;  3MEE A;  3NF6 A;  3KKR A;  3S3O A;  4B9M A;  3TAB A;  3S3N A;  3KKS A;  4FLY A;  1FK9 A;  1WSI A;  3HPH A;  1UWB A;  3RMA A;  4DF8 A;  4M3U A;  3SUP A;  4FJM A;  4GW6 A;  1U04 A;  3AO1 A;  4DQQ A;  4OKE A;  4BDP A;  3I0S A;  1SKR A;  1HYV A;  3LAL A;  3LZJ A;  3RTV A;  3AO4 A;  3LAK A;  3QLH A;  4Z4C A;  1HPZ A;  3NH2 A;  1RDA A;  1X9M A;  3L8B A;  4FM0 A;  2XHB A;  1ZBH A;  3NE6 A;  4PY5 A;  3SUQ A;  4F3O A;  3DOL A;  2HND A;  2ZD1 A;  3KK1 A;  1BI4 B;  4DTJ A;  3OJS A;  3HVT A;  3AVK A;  5HRR A;  4OPJ A;  3THV A;  4E1M A;  3VQQ A;  2RF2 A;  2YKM A;  4JS5 A;  3HP6 A;  5KRT A;  3OYN A;  4NYN A;  4CHP A;  4ELV A;  4CEB A;  2YNI A;  4E7H A;  3PX6 A;  1NK8 A;  4IG3 A;  3VQC A;  5C42 A;  1BQM A;  4CE9 A;  1RCH A;  3QNO A;  4M3R A;  4BDY A;  2ETJ A;  1I3A A;  4DU3 A;  4EZ6 A;  3OYH A;  3TAE A;  1J5O A;  4LSL A;  3L2W A;  1VSE A;  2EX3 A;  3ZSR A;  1BCO A;  3K5N A;  3NCI A;  1Z26 A;  4C8L A;  2DY4 A;  3TAM A;  3MXI A;  1TGO A;  1SUQ A;  3DI6 A;  3ZSW A;  1ZBI A;  4I9L A;  3QIP A;  4O44 A;  3M8R A;  3MAQ A;  4YFU A;  2YNF A;  1C1C A;  4PUO A;  3OS2 A;  3V1O A;  1FKP A;  3QEI A;  1U48 A;  1DTT A;  4KHU A;  4CJ4 A;  3KTQ A;  3KLF A;  1C0U A;  4H8K A;  1WAJ A;  3TR8 A;  3V9Z A;  4FCY A;  1UA0 A;  4KI4 A;  2HHT A;  3ZSO A;  4CJP A;  5E41 A;  3VQE A;  1YT3 A;  4FLU A;  3NF8 A;  1HNV A;  4DTN A;  4RW6 A;  3M8S A;  5D3G A;  4DTM A;  3O3H A;  1NJX A;  3S3M A;  1L3U A;  4M42 A;  2HHW A;  3DRS A;  3QIO A;  4DMN A;  1S9G A;  2VWJ A;  5KTQ A;  1NK6 A;  1TK8 A;  4H4M A;  4F2S A;  3DLK A;  4OGE A;  3RWU A;  3CM5 A;  3K5O A;  2G8F A;  4C8N A;  2A1S A;  3ZT3 A;  2DFF A;  5KGW A;  1VSJ A;  1D5A A;  4I2P A;  3UIQ A;  1LWF A;  2P51 A;  2YKN A;  3PV8 A;  1WN7 A;  4HUG A;  1Q9X A;  4K8X A;  3MXM A;  2HNY A;  3QET A;  4DG1 A;  3NH0 A;  2E4L A;  4RW8 A;  1N5Y A;  3MEC A;  3L3U A;  4B8C A;  4CFC A;  1BIS A;  4HTU A;  3ZT1 A;  1S1U A;  4EP5 A;  3OYD A;  4HCC A;  2HNZ A;  4FLT A;  2A1R A;  4FJ8 A;  3HST B;  3C6U A;  1NKC A;  1REV A;  2D0A A;  2VG7 A;  3SUN A;  2G8W A;  4C8K A;  1NJY A;  3V9W A;  3LAM A;  4M3X A;  1J53 A;  3VQD A;  1L3T A;  3HO1 A;  3O3F A;  1QSL A;  1T03 A;  3QEW A;  1BIZ A;  4Z4I A;  2LSN A;  3B6P A;  4HHT A;  1NKE A;  2GV9 A;  1RTD A;  4DTP A;  4GVM A;  3DLE A;  4BAC A;  4CJS A;  3LWM A;  3QIN A;  4E7J A;  3QEP A;  5HBM A;  3TAR A;  4E3S A;  4KHY A;  4AHS A;  3OS0 A;  3AVI A;  4Z4F A;  1U4B A;  4NCG A;  3JYT A;  1VSF A;  2RKI A;  4FLV A;  4F4K A;  4NCA A;  3AA2 A;  4Z4H A;  4W5Q A;  5SZT A;  2AJQ A;  2D5R A;  2KTQ A;  3HJF A;  3T3F A;  3KK3 A;  1T8E A;  5EU7 A;  1KFS A;  5JS2 A;  2HHX A;  3AVH A;  3OYE A;  2KZM A;  1LW0 A;  3I0R A;  4CED A;  3MED A;  4CJF A;  1ZBF A;  2FBV A;  1B92 A;  1C0M A;  5KRS A;  1JLG A;  3NGY A;  1IO2 A;  3DRR A;  3O4N A;  4E7K A;  4KI6 A;  3KLI A;  4O5B A;  4CF0 A;  3F9K A;  3MEG A;  4AHT A;  1D9D A;  3L2U A;  5HRS A;  4CJ3 A;  3SPZ A;  3SYZ A;  4OKK A;  1JL2 A;  1UA1 A;  1A5W A;  4QCL A;  4E7L A;  2F8S A;  2YHB A;  3U6F A;  1NKB A;  1RBS A;  1WLJ A;  1J54 A;  1C0T A;  2HHU A;  3DRP A;  2Z1I A;  3KLE A;  3NGZ A;  2DFH A;  1X9W A;  1IKY A;  4UQG A;  4KHQ A;  4KRE A;  4ID1 A;  1S9E A;  2X6N A;  3L2Q A;  3HXM A;  3AV9 A;  4AH9 A;  3IRX A;  4RW9 A;  3OYL A;  4DF4 A;  1SL1 A;  4KHN A;  3AVC A;  2HHS A;  3WNE A;  3PX4 A;  1B9D A;  4JLH A;  4CFD A;  2OPR A;  1I39 A;  2XRI A;  4FLZ A;  4ELT A;  2QKB A;  1CXQ A;  4DS5 A;  4CCH A;  2IC3 A;  2G8K A;  1JLE A;  1QE1 A;  4M45 A;  4CJW A;  4B9U A;  1ASU A;  1TKZ A;  3KLH A;  5CZ2 A;  3G10 A;  3KK2 A;  4E1N A;  3V1R A;  4ICL A;  3LPT A;  3NH1 A;  1RDD A;  2X74 A;  4KTW A;  1NOZ A;  5I42 A;  1T7P A;  4LD0 A;  3VA3 A;  1QSY A;  1LWC A;  1VK0 A;  5HLF A;  4EZ9 A;  1CZB A;  1X1P A;  4N41 A;  1RT4 A;  1JLC A;  3ZT2 A;  1TKT A;  2YV0 X;  4KAZ A;  2Y1J A;  4LY7 A;  4AHU A;  1TL3 A;  3ZSQ A;  4W5T A;  4ELU A;  4FJG A;  4PA1 A;  4NCB A;  1LAV A;  2F96 A;  1HQU A;  4WE1 A;  3D0P A;  4AHR A;  4RG8 A;  2FBX A;  4JS4 A;  1W0H A;  2OPP A;  3G0Z A;  3H08 A;  3AVB A;  3KIO A;  4IBN A;  1VSM A;  4Y1C A;  2IDO A;  4CGI A;  4Z4G A;  2HHQ A;  1SL0 A;  1RBU A;  5KI6 A;  4DSK A;  4N56 A;  1BI4 A;  1KSP A;  4DFP A;  2JGU A;  3V9X A;  1BIU A;  3BGR A;  4Z0U A;  1WNS A;  4BE1 A;  4E0D A;  3V4I A;  1RT7 A;  1QHT A;  5CY4 A;  3ZSV A;  1RT1 A;  1TL1 A;  1RBV A;  3EYZ A;  1GOA A;  1EX4 A;  3U3G A;  3I8D A;  3M8Q A;  3HVR A;  4M3T A;  4DSJ A;  3LP0 A;  4CEZ A;  3JSM A;  3NHG A;  1S1V A;  3K57 A;  2QKK A;  3IG1 A;  3V9S A;  1LW2 A;  1Q8I A;  3TWH A;  4KTZ A;  4CHZ A;  3QEX A;  4PWD A;  2OPQ A;  3P1G A;  1SKS A;  1D9F A;  1S5J A;  2P1J A;  1HMV A;  4G1Q A;  3ZSY A;  4HVJ A;  3HM9 A;  4CF1 A;  1Y97 A;  2KFN A;  4O0J A;  1U45 A;  3P83 D;  3E01 A;  4CIG A;  4DTU A;  2FC0 A;  1NK9 A;  3IS9 A;  1KVA A;  4IDK A;  4J2B A;  3PUF A;  4CJQ A;  2PYL A;  3TI0 A;  2O4G A;  3NDK A;  2EHG A;  1CLQ A;  1C1A A;  4CHY A;  1ASV A;  3CM6 A;  3ZSX A;  4CHQ A;  5HRO A;  4BE2 A;  2DFE A;  3DMJ A;  4F8R A;  1FKO A;  3ISN C;  4CGD A;  3OS1 A;  4CJR A;  1C6V A;  1B9F A;  1JXE A;  2IS3 A;  3HL8 A;  4CFB A;  3EZ5 A;  3OYC A;  4FK2 A;  4GMJ B;  3HPO A;  1TK0 A;  1WSJ A;  3SUO A;  1KCF A;  2Z1J A;  4LSN A;  4B9T A;  3VQ7 A;  1GOC A;  2P5G A;  3WNG A;  3TAG A;  3K5M A;  4B9N A;  3WNH A;  4NYF A;  3DYA A;  3ZT4 A;  4CEA A;  1UOC A;  4PQU A;  4FJ5 A;  1NK4 A;  4JRQ A;  4CGH A;  1KLM A;  3LP2 A;  4N47 A;  4KV8 A;  2Z1H A;  1S1W A;  4QAG A;  2RPI A;  4DTO A;  2I5J A;  3CFO A;  1RBT A;  4O55 A;  4DTR A;  3SQ4 A;  4OLB A;  1JL1 A;  2O4I A;  2WOM A;  1VRU A;  4CJE A;  1KRP A;  4E19 A;  4KKO A;  4EP4 A;  4FJK A;  1JLQ A;  1HQE A;  3VQ5 A;  3SQ2 A;  4MFB A;  4C8O A;  4DTS A;  2OYQ A;  1A5V A;  1LWE A;  4B9L A;  4W5R A;  2WON A;  2BE2 A;  4ZTF A;  3SQ1 A;  1S1X A;  1UAX A;  1WSE A;  2Z1G A;  4Z4E A;  3K58 A;  4DS4 A;  3K5L A;  4RW4 A;  2OPS A;  3D45 A;  1NK7 A;  3AO3 A;  3OVN A;  1JLF A;  1RDC A;  4I9Q A;  4CK3 A;  4RW7 A;  3RRG A;  1WSF A;  3V9U A;  2XY6 A;  4BWJ A;  2P5O A;  2HHV A;  2ITG A;  1QS4 A;  2B4J A;  1G15 A;  3AA5 X;  1SKW A;  3TAQ A;  1IKV A;  3QO9 A;  4FJH A;  1JKH A;  1T05 A;  1HYS A;  4IG0 A;  1EXQ A;  1KVB A;  2IAJ A;  4CGF A;  3L3V A;  3F73 A;  4J2D A;  4FK4 A;  4CJT A;  4DQP A;  3AVM A;  2D0B A;  4TSX A;  5DK5 A;  4CJK A;  1RIL A;  4IKF A;  1JLA A;  1RTH A;  1LV5 A;  1IH7 A;  2X6S A;  3O4Q A;  2VG5 A;  3VQ9 A;  2R7Y A;  1NJW A;  1N6Q A;  2G8U A;  2PZS A;  4FJI A;  4IFY A;  3CG7 A;  2X78 A;  1CXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...