2G8IA

B. halodurans rnase h catalytic domain d192n mutant in complex with mn2+ and rna/dna hybrid (non-p nick at the active site)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
134
structure length
134
Chain Sequence
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKANYGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
molecule keywords 5'-R(*UP*CP*GP*AP*CP*A)-3'
total genus 39
structure length 134
sequence length 134
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2g8iA00
1VSIA 1GOBA 2IAJA 4AILC 4DTUA 1WSHA 3OJUA 3MEGA 4CEBA 2Z1JA 5I42A 4J2BA 4N5SA 4C8NA 1W9HA 3WNFA 1UA1A 1VSMA 3KD5E 3G10A 2D0BA 3ZT4A 1J53A 1U48A 3I8DA 1TKDA 3L2QA 2KFNA 5T7BA 1TK5A 2IOCA 4LH4A 3S3OA 3OYHA 3VQPA 1Q8IA 3HPGA 4AHCA 1C0UA 3I0SA 3EZ5A 2OZSA 4IFYA 4IBNA 4HHTA 4DLGA 2FC0A 1RTIA 3P83D 4CJKA 1EXQA 1VSJA 1NJWA 3ZSVA 2P5OA 2W42A 2G8IA 4FLXA 2B6AA 3LDSA 4H4OA 4CHNA 3F73A 1SL0A 1QSYA 1KFSA 2ITGA 3E01A 4RW6A 1S9EA 3P5JA 4M3YA 1C1BA 1JLAA 2KZMA 4CJUA 1J9AA 1FK9A 1DLOA 2KTQA 3QNNA 1XWLA 4BDPA 4AHSA 4FJGA 1ZBFA 4KO0A 1S5JA 3V9XA 3PO5A 1NKCA 3UIQA 1RT1A 4KB1A 3JSMA 4E7KA 3HVTA 4CIGA 1VK0A 1EETA 4E7IA 3KLIA 1YT3A 4KV8A 1N5YA 1KSPA 3AA5X 4FJMA 4KHSA 4CFBA 1RILA 4CE9A 3QEVA 3ALYA 1BI4A 5CZ2A 3U3YA 4KHQA 4FJKA 3ZT2A 4FJ8A 2KZZA 1HYVA 3L3UA 3AA2A 1ASUA 4FXDA 4FW2A 5JS2A 1QHTA 3ZT1A 3OYDA 1B9FA 1S1XA 1S6PA 4CFCA 5KGXA 4QOZB 1NKEA 4Y1DA 4PUOA 3U3GA 4AHVA 1JL2A 1WSEA 1HPZA 4GMJB 4WE1A 4Z4CA 4FK4A 4PWDA 4CIEA 3TAMA 3S3MA 2WONA 4FYDA 1RDAA 3V6DA 1TVRA 4CJ4A 4B9NA 4HUGA 1XC9A 4DLEA 1SKRA 2HHTA 1WLJA 4KAZA 2ATQA 3ZSOA 4G1QA 1U4BA 2G8UA 4BDYA 3VQAA 1X9SA 3S3NA 2HMIA 2AJQA 2OYQA 1RBTA 1XHZA 1RT2A 1J54A 4DQRA 4RW4A 3KJVA 1CXQA 3DM2A 3VQEA 4FLWA 1JXBA 4Q0BA 3KLHA 3VQ5A 1QE1A 3OYGA 3WNEA 4DTRA 4I9QA 4DTSA 1VRUA 4KTQA 1JLGA 1WAFA 3HPOA 2KFZA 2Y1JA 1CZ9A 3AO2A 3CM5A 5CYMA 3TAFA 4OKEA 4M3TA 2YNGA 2JLEA 1JL1A 2G8KA 3AO4A 4OJRA 4B08A 4J2EA 2YV0X 2D5RA 2E6LA 3NFAA 4M3RA 1D9DA 3NCIA 2BGGA 2DY4A 3OYMA 4CJSA 1IKWA 4F8RA 4CF1A 1JLEA 3CFOA 2G8VA 4M41A 3LWLA 3S9HA 5D3GA 3V1QA 1WSFA 2RF2A 4N47A 2XRIA 1IO2A 1LW0A 1QSSA 2PYLA 1CLQA 2ETJA 3ZSXA 3QINA 2QK9A 4JRPA 4JLHA 1ASWA 3DRPA 3TAEA 5HLFA 3NH1A 3AO3A 1SV5A 1RT3A 1IKYA 1S6QA 3ASMA 4O0JA 4FJLA 2I5JA 1EX4A 1ZBHA 1X9MA 3LANA 3K5LA 4DF4A 1S1UA 3VQDA 4CEEA 3JYTA 1HQUA 5KTQA 3L8BA 1GOAA 5KGWA 4CHYA 4FLTA 3O4QA 1ZBIA 1RBSA 4CGHA 5SWMA 4JRQA 4PY5A 4OKKA 3VA0A 2HHXA 5CY4A 3LAMA 4IKFA 1ZYQA 4E3SA 4B9VA 4FZYA 3AO5A 4UQGA 4M42A 2Z1HA 1QS4A 2HHVA 4FJXA 3PUFA 4RG8A 3L2WA 4MFBA 1LV5A 3WNHA 4YFUA 3HSTB 4OGEA 4CJTA 1CZBA 3HO1A 3HXMA 3NH0A 2YKMA 5HRSA 1NK8A 4KPYA 1D5AA 1RCHA 2Z1IA 3AVNA 4DS4A 4PQUA 2HVIA 1TKTA 4Z0UA 3NF8A 2DFFA 3KLEA 3C6UA 5E41A 4LH5A 4O4GA 4QAGA 1IH7A 1VSDA 5KRTA 5KRSA 3V9SA 3RRGA 2VWKA 4FJ7A 3ZSZA 3SCXA 4CF2A 3LPTA 3MXJA 4F2RA 3NE6A 3SUQA 2XY8A 4ICLA 4DFMA 1U47A 3U6FA 1UOCA 4FK0A 2DFHA 4DMNA 4Q5VA 3G0ZA 3M8PA 1O1WA 1C1CA 1LAWA 3AVCA 4LSLA 3ZSRA 3HP9A 1NK9A 1LAVA 3TI0A 1TL1A 5I3UA 2HHSA 4J2AA 2HW3A 4DWIA 3C6TA 4DS5A 1S1TA 4TSXA 1S1WA 4CGFA 4FLUA 1D9FA 3V1OA 4M3UA 1RT5A 3V81A 4E0DA 1BI4B 1CXUA 4R5PA 4FK2A 2XY6A 4M3ZA 2A1RA 3AA4A 1BGXT 3VA3A 3TWHA 3EY1A 2OPQA 4AHRA 1HJRA 3L2VA 1SUQA 2YNFA 3V9UA 1UWBA 4I7FA 1DTQA 4DTPA 3VQ6A 1QTMA 4DSLA 1RBVA 4LY7A 3AVMA 3LZIA 3DOLA 1WSGA 4XIUA 3KTQA 4FLVA 4W5TA 4CGJA 3KK2A 4OGCA 2P5GA 3VN5A 5J2PA 2G8WA 5C42A 3MEDA 4ELUA 4I2PA 2O4IA 5DK5A 3MEEA 1BQNA 2B5JA 1S9GA 3VQ7A 4W5QA 1TAUA 3AVFA 3RTVA 3AVKA 3VQ8A 1JLQA 1K6YA 2RKIA 3MXMA 4E19A 2BE2A 3HP6A 4CK2A 3LP2A 4KTZA 4CGIA 4EP5A 3O3GA 1VSKA 3TABA 3DMJA 3AVAA 1YTAA 3NGYA 1JLBA 3QO9A 4NYFA 3ZSYA 4E7LA 3TAGA 3AVJA 3LZJA 4B9TA 4Z4IA 3BGRA 1T03A 4BE1A 4FJJA 4KREA 1JLFA 3VQ9A 5C25A 3OY9A 1Q9YA 3SPZA 2A1SA 3D45A 1NOYA 2G8HA 4Y1CA 2JGUA 3QEWA 4DSKA 5FROA 2P51A 4M3WA 4CERA 1IG9A 1EP4A 3PX6A 3NF9A 4BWMA 4CJRA 5HROA 3SI6A 4FJ9A 4DG1A 1J5OA 4OVLA 3OYIA 2P1JA 4ID5A 3VQ4A 2DTUA 4CGDA 2OA8A 3NHGA 4KHYA 4B9MA 4IFVA 3V9WA 2ZD1A 3V9ZA 4O55A 3DLGA 2X6NA 4B9LA 4DQIA 1SL2A 1U45A 1VSFA 1FKOA 4AHTA 3RR8A 4BWJA 4Z4HA 4DQQA 1HNIA 1TGOA 1NOZA 4ZTFA 1X1PA 2F96A 3AVGA 3AVLA 3VQBA 5J2NA 1SKWA 4AH9A 3K5NA 1NK5A 2OZMA 3RMCA 4DTXA 3QIOA 3DLEA 3MAQA 3SUPA 2FBVA 3NBPA 1NJZA 4FVMA 4CEFA 4DU1A 1TK0A 2HNYA 4JS4A 2XY7A 4ELVA 4CJWA 3DLHA 3OYFA 3ULDA 3O3FA 4BDZA 4NCBA 1VSLA 1JLCA 1RTDA 5SZTA 1A5VA 2HHUA 3L2UA 3K58A 3L2RA 3K2PA 3M8RA 1IKVA 2E4LA 3OYLA 3HM9A 2D0CA 1A5WA 2XO7A 3QNOA 3RMBA 1LWCA 2ZE2A 1YTUA 4MQ3A 2F8SA 4E89A 3I0RA 1VSEA 4CF9A 1LWEA 3OS0A 4CEDA 3LWMA 4DFJA 1XI1A 1NJXA 4M45A 4FCYA 3DOKA 4F2SA 4DSJA 2QXFA 1LWFA 2BDPA 2OPRA 3TAPA 1SKSA 3WNGA 3T3FA 1U49A 1HQEA 4YNQA 3ZCMA 3OYCA 3OYKA 4HUFA 1T05A 4DFPA 1I39A 2YNHA 3KK1A 1BISA 3DRRA 1RDCA 4BE2A 3AO1A 4FJ5A 3IAYA 4CEOA 1WNSA 4DSEA 1WSJA 4KI6A 4CJ5A 4OKJA 4DQSA 3SV3A 2VWJA 3CQ8A 4CHZA 1NK4A 1RDBA 4CHQA 4F3TA 1C0TA 3H08A 3KK3A 4IG0A 1RT4A 3HJFA 2RN2A 4CJLA 3BDPA 3KIOA 3OYNA 4DTJA 1Q9XA 1KLNA 4FLYA 3DYAA 3L3VA 1S1VA 4CJQA 3HL8A 3LP0A 3SV4A 3M8QA 4W5NA 1WN7A 2VG7A 4H8KA 4DTMA 1UA0A 1NK0A 1T7PA 1BIUA 4KFBA 2YHAA 3M8SA 1HRHA 2NUBA 4B9SA 4EZ6A 1R0AA 1MU2A 2HNZA 4HTUA 3TAQA 4OPJA 5FDLA 3RMDA 1L5UA 4DU4A 4E7HA 4CEAA 3MECA 1W0HA 4N56A 4DQPA 3DLBA 3ITHA 3LAKA 4IG3A 1Z25A 1N6QA 3RR7A 4EZ9A 2F8TA 3LP1A 2EX3A 4KB0A 1C6VA 4C8MA 2HVHA 5CZ1A 5HP1A 4ZTJA 3PY8A 1TL3A 2HHWA 1D8YA 4OLBA 1RNHA 4E1NA 1TAQA 5KI6A 2IS3A 3OYEA 4NCAA 3HVRA 1DTTA 1HYZA 1REVA 2FBYA 2O4GA 4KHWA 4FLZA 4I9LA 1SL1A 2YHBA 3TR8A 2GUIA 3A2FA 4DSFA 3PV8A 1KVCA 2IDOA 1QSLA 3CFRA 5K14A 1T8EA 3AA3A 3OYAA 1B9DA 3IRXA 1NKBA 2G8FA 1B92A 4FJNA 4CJFA 3QEIA 4FJHA 4QCLA 4F4KA 3CG7A 4C8OA 3OVNA 3SZ2A 4CFDA 2EHGA 2XY5A 5FRMA 3C94A 4HCBA 4CK1A 2DFEA 4NCGA 1VRTA 1RBRA 3OS2A 1KLMA 3O4NA 3NGZA 4DU3A 3AVIA 3PX4A 4ELTA 1KCFA 4GVMA 2VG6A 3MXIA 1FXXA 4CHPA 2B4JA 1HYSA 1Y97A 4JS5A 4L8RB 4W5RA 4K8XA 1TV6A 2VG5A 4FW1A 4GW6A 1RTHA 2OPPA 1L3UA 3KKRA 3PO4A 1JKHA 4I2QA 5DMRA 3TANA 1X9WA 4O0IA 3EYZA 3VQQA 3QERA 5HRRA 3SQ4A 3QLHA 1RBUA 3HT3A 4E1MA 4K8ZA 4CFAA 1NJYA 4CF8A 1VSHA 1RT7A 3CYMA 3TARA 3D0PA 1ZBLA 4CJ3A 2ZQBA 3SNNA 5C24A 3KLGA 3OYBA 3QIPA 3NDKA 4Z4FA 1TKZA 3PX0A 3DI6A 2PYJA 1GOCA 2RPIA 4M3XA 2Z1GA 4J2DA 1L3TA 4H4MA 1Z26A 3NAEA 1L3SA 3O3HA 3AV9A 1FKPA 3K5MA 4HUEA 4FM2A 5JS1A 4RW8A 3K5OA 3NF7A 3KLFA 4FM0A 1JXEA 2Q3SA 1G15A 1UAXA 1WSIA 5CYQA 3IG1A 1RT6A 4IDKA 3OS1A 3K57A 2R7YA 4N41A 2X78A 3NF6A 2GV9A 4KHNA 3RWUA 3SUNA 2BANA 2FBXA 3ZSWA 3HYFA 1NK7A 4FZXC 4RW7A 4AHUA 3V1RA 2KQ2A 5HBMA 3HPHA 1RTJA 4LSNA 4CJPA 3NH2A 2X74A 4B8CA 2OPSA 5HRPA 3V4IA 3SUOA 3CFPA 2XHBA 3SPYA 4DSIA 1ASVA 4C8LA 4CHOA 2HB5A 5FRNA 4CGGA 3ZT0A 2QKBA 2QKKA 4W5OA 3DLRA 3ISNC 1BHLA 4KKOA 4PA1A 4NYNA 3LPUA 3OJSA 1HNVA 3CM6A 2X6SA 4O5BA 4DTOA 5J2MA 4CESA 4CEZA 4CF0A 4RW9A 1C0MA 4LD0A 3DRSA 3ZSQA 1EKEA 2IGIA 2E6MA 3VQCA 1IKXA 1WAJA 3B6PA 3QEPA 5J2QA 4EP4A 4B8AB 3F9KA 3ZT3A 4Z4EA 4CJEA 4B3OA 4O44A 2YKNA 4DF8A 1KRPA 3SQ1A 3SQ2A 2D0AA 2KW4A 3RRHA 3SQ0A 1L3VA 1KFDA 1KVBA 4ZHRA 4FJIA 3THVA 4KHUA 4OPKA 5J1EA 1BCOA 4KI4A 4KRFA 4N76A 3HK2A 4HVJA 3B6OA 3LALA 2YNIA 4CIFA 5EU7A 4DTNA 4F3OA 1A5XA 1BCMA 1KVAA 1ITGA 1BIZA 2HHQA 1KTQA 3NGIA 3SJJA 4BE0A 1F21A 2GBZA 2WOMA 4Z4GA 2Y1IA 3P1GA 4CCHA 1I3AA 4CEQA 1BQMA 3AVHA 2HNDA 3AVBA 5HRNA 3KD1E 1TKXA 1HMVA 3T19A 1BL3A 1RDDA 4CK3A 1LW2A 2IC3A 3IS9A 4OLAA 4BACA 4C8KA 3SYZA 2PZSA 2FBTA 3K59A 4HCCA 4KTWA 1QQCA 4E7JA 4DFKA 4CECA 1YVUA 3LP3A 3OYJA 4ID1A 3QEXA 2PY5A 3RMAA 1ZBUA 3QESA 1TK8A 4B9UA 1NK6A 1C1AA 2LSNA 3T1AA 3C95A 3DLKA 1XHXA 4CJVA 4FM1A 4FZZA 1U04A 3KKSA 3FFIA 3QETA
chains in the Genus database with same CATH superfamily
4YOTA 1GOBA 4GVEA 2Z1JA 4J2BA 4N5SA 1UA1A 1W9HA 2A42A 1VSMA 1U48A 2D0BA 1TKDA 2IOCA 4LH4A 3S3OA 4BGAA 5FPEA 3EZ5A 4BRIA 1VQKN 4IBNA 1T6CA 3WXKA 4CJKA 1VSJA 2G8IA 3MWTA 4RW6A 4LF4K 1WBDA 1J9AA 1FK9A 1DLOA 4AM6A 2QI2A 3UIQA 4KB1A 4FWMA 4E7KA 3AGKA 3HVTA 4E7IA 4CD1A 4KV8A 1KSPA 5BRFA 4CE9A 4X66K 2CGLA 3ZT2A 1HYVA 3AARA 1QHTA 2QW9A 3OYDA 4JNEA 2P9KA 1S6PA 5KGXA 1Z05A 4Y1DA 3U3GA 3WXMB 4AHVA 4WE1A 4CW7B 5GADP 3J7YP 3V6DA 4M63C 4B9QA 1XC9A 3CJ9A 2HHTA 3ENHA 2ATQA 1TUYA 2G8UA 4DUZK 4BY9C 2HMIA 2OYQA 1RBTA 1RT2A 4H5NA 5BR8K 4PKIA 4RW4A 3KJVA 4FLWA 3MN5A 4I9QA 1QE1A 3WNEA 4DTRA 1JLGA 2P9NB 3HPOA 4OO1J 5AQIA 3AO2A 3M1FA 2YHXA 2YNGA 5BRDA 1HNZK 2G8KA 4J2EA 2YV0X 1E4FT 4M3RA 2BGGA 2QWOA 2G8VA 3EE8A 4DR5K 4M41A 3V1QA 2PYLA 3CCVN 5AQKA 3HOSA 5CE3A 3ZSXA 3UKRB 4PL7A 2UYTA 1ASWA 1YITN 5HLFA 3LDOA 1S6QA 4O0JA 2I5JA 1QVGM 3DWLA 1X9MA 3K5LA 1VQPN 3L8BA 1HQUA 1GOAA 4FLTA 3R9PA 4PY5A 4OKKA 3QICA 2HHXA 4E3SA 5ELZA 4B9VA 4RWTA 4UQGA 2D0OA 2Z1HA 4FJXA 3L2WA 4OGEA 4CJTA 2F4VK 1C0FA 1TYQB 1NK8A 3ULEB 1P8ZA 2Z1IA 4DS4A 5EXWA 4ISEA 1NGBA 4RCHA 4Z0UA 3NF8A 3KLEA 3CCQN 2O8DA 4DHYA 1VSDA 3MK6A 4B1YB 3V9SA 3TTDA 3AY9A 5FPNA 5BPLA 2XY8A 3CJ7A 3U6FA 1U47A 4FK0A 3NMUA 4DMNA 2KFZA 3M8PA 4LSLA 3J81O 4K43A 4J2AA 2HW3A 4DWIA 2A40A 5AQOA 3ZX2A 1D9FA 4E0DA 3C6AA 3CJ1A 4FK2A 4IEEA 3AA4A 4FPAA 3VA3A 4NXNK 4O8KA 3SLCA 3TWHA 3L2VA 3V9UA 2ZJQL 1RBVA 4LY7A 2P9IA 5AQMA 4FLVA 1BU6O 5C12A 3J8AA 1P90A 4IDHA 5J2PA 1VQ6N 2G8WA 5C42A 1GLJO 2O4IA 5DK5A 4Z94A 1RGIA 3MEEA 5AQZA 3VQ8A 5LJWA 2E2QA 4BRMA 3R6MA 3MXMA 1HKBA 3TABA 4BC5A 4NYFA 2Q31A 4Z4IA 3BGRA 3AAQA 4BE1A 1T03A 5C25A 2P9SB 2P9PA 3SPZA 2ZGZA 2JGUA 1IG9A 4B3RK 3WQUA 4DG1A 1IG8A 1J5OA 4C1NK 3CPEA 5AQSA 2P1JA 4ID5A 2DTUA 5ADXH 3NHGA 1OH8A 2X6NA 4CZHA 1BG3A 1U45A 1RFQA 1FKOA 4AHTA 4DQQA 1X1PA 4NXMK 2GTDA 2OZMA 3WUHA 3QIOA 4EFHA 2FBVA 3NBPA 4BR9A 3EE9A 2EWSA 3OYFA 4B1ZA 3O3FA 1W2BM 1KAXA 4BDZA 1RTDA 3L2RA 1ATRA 1KC8O 3M8RA 1KQSM 2D0CA 1A5WA 4H0OA 3RMBA 3KVGA 1YTUA 3O5BA 4DCHA 3I0RA 1VSEA 4DFJA 1LWEA 1XI1A 3ULEA 4CEDA 1NJXA 5AQFA 3CD6N 5JLHA 3F2KA 4BRGA 1LWFA 5JMVA 3CXCM 3T3FA 4FWQA 1T05A 3OYKA 3ZCMA 2F9WA 1MWMA 3IAYA 4DR6K 4CJ5A 3SV3A 4CHZA 1NK4A 4IG0A 3ENOA 2RN2A 4DTJA 4YDUC 4BRLA 2ZF5O 1KLNA 3HL8A 3LP0A 2YHYA 3VMFB 4DTMA 2UUBK 5B8HA 4G9ZA 2NUBA 4B9SA 2HNZA 4HTUA 3TAQA 4DU4A 4E7HA 3D2FB 3MECA 5CR4A 1NGGA 3DLBA 1N6QA 3LAKA 3KZBA 4EZ9A 2BUPA 2EX3A 2ASOA 1TL3A 5LL6Z 5AZJA 2WC9A 5AQTA 1I94K 5EX5A 4NCAA 4YDUA 1DTTA 4H5VA 2PFUA 3MCPA 4KH5A 3J7ZO 3UB5A 3PV8A 1QSLA 3CFRA 2H3GX 3EL2A 1QQNA 3AA3A 4GY2B 1B9DA 2QWQA 4IEIA 4QCLA 3CG7A 4C8OA 1SS6A 3I56N 4IJAA 3SZ2A 3VEYA 2WUSA 2XY5A 1HJOA 3P4IA 3O4NA 3NGZA 3PX4A 5CHIA 1KCFA 4YOXA 4GVMA 2VG6A 2UUAK 1YIJN 4W5RA 4K8XA 4JEPA 4I2QA 5BPMA 3QERA 5HRRA 1NGIA 3QLHA 5TKYA 1NNEA 3LM9A 5AFUH 1YHQN 5M1FA 1IBKK 3CYMA 1GLFO 2ZQBA 5C24A 2QA4N 3QIPA 3PX0A 3CHWA 3N4QA 2RPIA 1KD1O 5JICA 3K5MA 3NF7A 1QZ5A 4BRNA 1NK7A 2BANA 3BP8A 4RW7A 4AHUA 3V1RA 3HPHA 3NH2A 3V4IA 5HRPA 3SUOA 4DSIA 1ASVA 3MX2A 4CHOA 5FRNA 2JWKA 4H03B 3PSIA 2YJEA 1Q7YO 4L3QA 4BRKA 4JYAK 4GKKK 3ISNC 4PA1A 1NGEA 4BR4A 3OJSA 1HNVA 3CM6A 4WCEL 1BUPA 3DRSA 3CCRN 2IGIA 1IKXA 2E2NA 3B6PA 3F9KA 4O44A 1GLAG 2YKNA 4DF8A 1BCOA 1KAYA 3FZMA 4KI4A 3D2EB 5KPTA 1XNQK 4HVJA 5JVGL 4KHPK 5ADXA 4CIFA 4DTNA 1A5XA 1BCMA 1ITGA 4FWLA 2O8EA 1SZ2A 3NGIA 3SJJA 4WQ5A 3JXUA 2Y1IA 1I3AA 4CEQA 1BQMA 3AVBA 3KD1E 1ATNA 4CK3A 4C8KA 4LF6K 2E2OA 3K59A 4CI6A 3WEEB 3QFPA 2W40A 4ID1A 2PY5A 1ZBUA 4H5RA 4B9UA 2LSNA 1EO1A 4IZ9A 1YI2N 4YOUA 2UXDK 4DTUA 3OJUA 3MEGA 4C8NA 4IOAL 2KFNA 3ZT4A 3I8DA 5T7BA 5GAEP 3OYHA 4BRAA 3ID8A 1C0UA 3I0SA 1U2VA 4DLGA 3K9KA 1VQON 2AA4A 5EVZA 3ZSVA 1IBLK 5BPNA 4FWSA 4FLXA 4H4OA 2J4RA 1SL0A 1QSYA 1FW6A 4H0PA 4M3YA 1JLAA 2OANA 2KZMA 2O8FB 2E88A 3QNNA 1XMOK 4JI4K 4KO0A 3PO5A 3IKMA 1NKCA 3FR0A 1RT1A 3ZETA 5AQUA 1EETA 1BOTO 3B8AX 2FSJA 3MWPA 5M1OA 4FJMA 3VEXA 3CCUN 4CFBA 1RILA 4KH4A 3ALYA 1BI4A 4B3TK 4EAHD 4FJKA 4FJ8A 5BN8A 3AA2A 4FXDA 3GG4A 4FW2A 4CZJA 1JJ2M 5HOOA 1BDGA 4C23A 1JL2A 3RSEB 1WSEA 3UKRA 4FK4A 4CIEA 3TAMA 3S3MA 1K9MO 2V52B 4WFNL 4HUGA 1V4SA 4DLEA 1SKRA 4KAZA 5HL7L 1ZC6A 4G1QA 1X9SA 5FPDA 1WUAA 4DR1K 2A5XA 1XHZA 5GIOA 3ENBA 2IVPA 4JKAA 4MO5A 3KLHA 4DTSA 1N34K 3HRGA 5JLFA 2Y1JA 1CZ9A 1J6ZA 1VQ7N 3AO4A 2D5RA 2E6LA 2DY4A 4CJSA 1IKWA 4F8RA 4CF1A 2O8DB 1JLEA 4H0XB 5D3GA 4N47A 2XRIA 1IO2A 4XH5A 1XMQK 3DRPA 2P9LA 5M1NA 3NH1A 1OH5A 2QTDA 4DR2K 1IKYA 3ASMA 1ZBHA 1EX4A 3DXMB 4DF4A 3VQDA 1XUPO 3WXIA 5KTQA 2CH5A 3A5NC 5KGWA 1C0GA 4CHYA 1ZBIA 1T6DA 5SWMA 4JRQA 1TUUA 3LAMA 1ZYQA 3JAMO 4FZYA 4IKFA 4HWIA 4M42A 2P9IB 2YI1A 5JVHL 1LV5A 4MFBA 4YY3K 3WNHA 4A5AA 4BG8A 3PLAA 1CZBA 1GLEG 1GLLO 1NGDA 1HX1A 3H45C 4JI7K 3EN9A 4PQUA 2HVIA 4YOVA 2UXCK 2O8FA 4LH5A 4QAGA 2VWKA 1O13A 3SCXA 4CF2A 3LPTA 4BR7A 3VESA 4GV6A 3SUQA 4ICLA 4DFMA 1UOCA 2GWJA 3U3YA 4B9MA 1LAWA 3ZSRA 3HP9A 5AQNA 1TL1A 3O9QA 4U67L 5I3UA 3FZLA 4CGFA 3V1OA 1BI4B 4R5PA 2XY6A 2A1RA 1K73O 1XNRK 3T1HK 2OPQA 5BREA 3MN6A 1SUQA 2YNFA 4DTPA 1UWBA 4I7FA 1DTQA 4DSLA 1BWFO 3VQ6A 2NRWA 1ZXOA 3KK2A 4OGCA 4K0KK 3C7NA 2B5JA 2E8AA 1S9GA 3BF1A 4BRDA 3VQ7A 5I9EB 1TAUA 3AVFA 3RTVA 4YOWA 1K6YA 2RKIA 4CK2A 3LP2A 4KTZA 4CGIA 4EP5A 3AVAA 3QO9A 3T1YK 3LZJA 3W0LA 3VQ9A 3OY9A 4WF9L 3KWIA 4Y1CA 3QEWA 2I7NA 4DSKA 5FROA 1J5EK 4M3WA 3DXKA 3TU5A 3PX6A 5FPMA 5HROA 2PBDA 3GBTA 4FJ9A 2NRTA 3OBWA 4OVLA 4LC9B 3VQ4A 3OW2M 4KHYA 2ZD1A 3DLGA 4B9LA 1SL2A 4BWJA 4BG9A 1HNIA 1NOZA 4ZTFA 3AVGA 4DV7K 4DR7K 4AH9A 1NK5A 3RMCA 3MAQA 3SUPA 1NJZA 4FVMA 4JI6K 4M7YA 3VTHA 1YUWA 4CJWA 3DLHA 3U9ZA 5AZIB 5DM7L 2VCPA 1MWKA 3OYLA 2E4LA 3D2FA 1LWCA 1ZBSA 5AQWA 2F8SA 3OS0A 4CF9A 2KHOA 4F2SA 4M45A 3DOKA 2OPRA 1VQNN 3TAPA 1EWQA 1YF5L 5AJ3K 4DFPA 3VETA 1BISA 1RDCA 3AO1A 4FJ5A 2ZM6K 4CEOA 3NVMA 1WSJA 4KI6A 4DQSA 2VWJA 4CHQA 4F3TA 3KK3A 1FJGK 4WQ4C 4CJLA 3N4PA 3BDPA 3HJFA 4H0YB 4NLBA 4FLYA 2NRVA 3DYAA 1S1VA 4CJQA 3SV4A 3M8QA 4H8KA 1NK0A 1HPMA 3ID6A 4FSVA 4IO8A 4H0VB 4BVPA 5C2DA 4EZ6A 1R0AA 1JCGA 3BZCA 4OPJA 5FDLA 1L5UA 4JKBA 2P9UA 4IG3A 4B1XB 4C8MA 4GV9A 4BC3A 5CZ1A 2V7YA 5HP1A 4ZTJA 2HHWA 4OLBA 3S41A 5KI6A 1DEJA 3OYEA 1V4TA 3P39A 2FBYA 4KHWA 4IJNA 4BRQA 2YHBA 4MDBA 3TR8A 2GUIA 4DSFA 1KVCA 2FXUA 1DKGD 5K14A 2G8FA 1W97L 4CJFA 4JI1K 4F4KA 1N8RO 3O9RA 3OVNA 1JCEA 4EHTA 4CFDA 2EHGA 5FRMA 2I7PA 4HCBA 2RHKA 4CK1A 2DFEA 4NCGA 2P9PB 2O8CB 3OS2A 3ATVA 1DT9A 4ELTA 4DV1K 4CHPA 4FWPA 4CBXA 2B4JA 3SAHA 1Y97A 5EOYA 2FF3B 3PO4A 3L6QA 1OH7A 1QZ6A 1JKHA 3BZKA 2VQFK 4O0IA 4BRFA 3VQQA 3K9JA 1EWRA 1RBUA 2VGNA 1WBBA 3HTVA 4E1MA 1NJYA 4CF8A 1VSHA 3D0PA 5AZIA 4OPHA 4Z4FA 3CI5A 3U8XA 3M5RA 5AQRA 4JK9A 1L3TA 4H4MA 1L3SA 3NAEA 3O3HA 4HUEA 4FM2A 4ILJA 2FF6A 1G15A 1WSIA 2R7YA 3CF5L 4IDKA 3OS1A 3HI0A 4N41A 4KHNA 3A5MC 4FZXC 2Q36A 5E26A 3D6RA 4LF7K 2OPSA 3UKUA 5KPRA 3SPYA 2XHBA 1M1KO 2HB5A 2IVNA 4CZIA 3DLRA 2BTFA 1OH6A 3L4IA 2WBNA 4O5BA 3WEEA 4DTOA 4X64K 1C0MA 5AQJA 3TTFA 3T69A 4EP4A 4A5BA 1HKGA 4F9OA 3H3NO 1LOTB 1Q18A 4JI3K 3A5LC 4FPBA 5J1EA 4KRFA 4N76A 2ITMA 3B6OA 4JD2A 5KQ8A 4F3OA 1KVAA 1BIZA 1KTQA 2GBZA 2WOMA 2IVOA 4JK8A 4AF1A 2HNDA 1LW2A 3WXJA 3IS9A 3LDLA 2FBTA 3G25A 4E7JA 4JKHA 3LP3A 3MMVA 3ZETB 3QEXA 1TK8A 4FO0A 3T1AA 4FM1A 3DLKA 4CJVA 1XHXA 2GELA 1U04A 3KKSA 3CJBA 3FFIA 3QETA 4RTFD 1E3MA 4CEBA 5I42A 4BC2A 3THXA 1S22A 1TK5A 3VQPA 1N33K 1Q8IA 3HPGA 1QVFM 1Q82O 1X3NA 2OZSA 4IFYA 3VOVA 4FWNA 3TSUA 4HHTA 4DKWA 1RTIA 3P83D 1NJWA 2P5OA 2W42A 2B6AA 3CERA 1KFSA 3E01A 3P5JA 4JKGB 1C1BA 4BQLA 4CBUA 2KTQA 1RDWX 4DV6K 4BRHA 3UE5A 4WFBL 4BDPA 1ZBFA 4IFEA 2OTJN 4CIGA 1VK0A 3MN7A 3KLIA 3THYA 1YT3A 4B1WB 1N5YA 1N36K 1YXQA 2NNWA 3QEVA 1RDUA 4KHQA 2KZZA 1ASUA 5JS2A 3VGKA 1B9FA 4CFCA 1NKEA 3LDQA 4PUOA 4A57A 1LCUA 4GMJB 3KK7A 2FLOA 1NG9A 2WONA 4FYDA 2E5LK 1RDAA 4B9NA 1TVRA 3PSFA 4OX9K 3ZSOA 4CZFA 3S3NA 2QEXN 3ZEUA 3Q7BA 1J54A 1CXQA 3P31A 3VQEA 3WXLA 3VQ5A 3OYGA 3SJHA 1WAFA 1K8KB 2OTLN 4JD2B 4OKEA 2DPNA 4OJRA 4IOXA 4FOEA 3NFAA 3NCIA 2W41A 3BUZB 4BROA 3OYMA 3CFOA 3LWLA 1QQMA 1WSFA 2RF2A 2HMPA 1LW0A 2A6AA 2ETJA 2QWLA 3QINA 2QK9A 4JRPA 4DV3K 3TAEA 4PKHA 3AO3A 5DM6L 3WT0A 1SV5A 4FJLA 3LANA 1S1UA 1EQYA 4CEEA 3JYTA 4CBWA 3VA0A 4PHTX 1JCFA 2E20A 3M3ZA 1QS4A 3DJCA 1YAGA 3L0QA 2HHVA 3PUFA 4RG8A 3TSQA 4YFUA 3HO1A 2YKMA 3C7NB 1D5AA 1RCHA 5BRHA 2WFBA 4ILGB 1S72N 3IDHA 3C6UA 5AQXA 3SBGA 4FJ7A 3ZSZA 4QS7A 3MXJA 4F2RA 3NE6A 5F2RA 2GWKA 4LF8K 2RE2A 3AVCA 3TI0A 3QB0A 2HHSA 3THYB 5C10A 1S1TA 5AQPA 1ATSA 1S1WA 4TSXA 4FLUA 4M3UA 4IWVA 3V81A 5H1SQ 3H6EA 4M3ZA 3OA9A 1BGXT 2VWBA 3EY1A 4AHRA 1HJRA 1QTMA 2HF4A 3AVMA 3DOLA 1WSGA 3KTQA 4W5TA 1SAZA 4CGJA 4O5FA 3VN5A 3CC2N 4KH6A 5GIPA 2VQEK 4CZGA 3R3LA 1BQNA 3E1YA 1XQSC 5IT9O 4W5QA 1HUXA 3AVKA 1JLQA 1OKJA 4E19A 2BE2A 2VGMA 3O80A 3O3GA 3DMJA 4E7LA 3TAGA 2Q1NA 3AVJA 4KREA 3H46O 2NRXA 4LF9K 1JLFA 1Q9YA 2Q2RA 5KQDA 2A1SA 3D45A 1K8KA 1NOYA 2G8HA 2P51A 4CERA 2O8BB 4FVUA 3NF9A 4A2AA 3SI6A 5A2QO 4I6MA 4IXCA 4DB3A 3OYIA 1VQMN 2YX6A 4CZKA 1VQ8N 1NJIO 3FZHA 4CGDA 2OA8A 4JKFA 3V9WA 4DQIA 2UUCK 4HTLA 3CPWM 1YVNA 4WQ5C 1VSFA 3TPQA 4Z4HA 3VQBA 2O8EB 1SKWA 3K5NA 3BEXA 3T7ZA 3DLEA 4CEFA 4JS4A 4ELVA 2D4WA 2NLXA 1VSLA 4ISGA 1JLCA 4WQ4A 1A5VA 3TTCA 3K58A 3OTOK 4J2DA 1IKVA 2XO7A 3QNOA 4MQ3A 4A2BA 4E89A 4FCYA 2QWNA 3ZX0A 4A61A 4DSJA 2QXFA 5EY4A 3DAWA 3WNGA 1ESVA 1HQEA 4YNQA 3OYCA 2A3ZA 4IOCL 5AQVA 3A0IX 2HSTA 3CQ8A 2GEMA 1RDBA 3H08A 5BN9A 4LFBK 1IV0A 3ZX3A 1RT4A 1K8AO 1G99A 4LF5K 5AQLA 1IBMK 1VHXA 3E9OA 1YJ9N 1WN7A 2VG7A 1UA0A 3BY5A 1BIUA 1T7PA 3QBXA 3M8SA 1HRHA 4JKEA 3A5OC 3GE1A 3C6HA 4K42A 5GAGP 4CZLA 4CEAA 4DQ8A 4YORA 3IFRA 4BC4A 4DQPA 3RR7A 2HHHK 1Z25A 3LP1A 4FWRA 1T44A 2QWPA 5M1PA 1D8YA 1RNHA 1WB9A 5AQQA 1VQ5N 2W6LA 2YJFA 1BO5O 3VGLA 1HYZA 2O4GA 4FLZA 3VEWA 4UY8O 3A2FA 1T8EA 3I8BA 1QQOA 3IRXA 3MX5A 4FJNA 5LMUK 4FJHA 1GLDG 1RBRA 1SQKA 1VQLN 1NMNA 3ZYYX 3AVIA 4DU3A 1Q86O 1TYQA 4GKJK 3MXIA 3UKUB 5AQHA 3DXKB 4JS5A 2CGKA 2NRRA 4L8RB 3O8MA 3CCSN 1TV6A 3LDPA 4FW1A 1L3UA 5DMRA 1QHAA 3TANA 1X9WA 3EYZA 2CH6A 4B3MK 4GV3A 4H5TA 1KAZA 4CD3A 4K8ZA 1HKCA 3FGUA 4CFAA 1RT7A 4BQZA 2ASPA 3SNNA 2P9LB 3NDKA 1TKZA 2CGJA 2PYJA 1GOCA 4M3XA 2Z1GA 1Z26A 3DXMA 3AV9A 1FKPA 4RW8A 3K5OA 4FM0A 4V19S 4ISFA 1JXEA 1UAXA 5CYQA 3IG1A 1RT6A 2X78A 3RWUA 3SUNA 5C0YA 5HBMA 2AP1A 3VPZA 1RTJA 4BR0A 5KPZA 2X74A 3THWA 4C8LA 3ZT0A 1W7AA 2QKKA 1MDUB 2QKBA 3NVKA 4NYNA 3WQTA 3LPUA 1HR0K 4DV4K 2X6SA 3CMAN 3CCJN 3VF6A 3VEZA 5J2MA 1NLVA 4LD0A 3ZSQA 3VTIA 1EKEA 2NRHA 1WAJA 3QEPA 5J2QA 1DGKN 3ZT3A 4Z4EA 4B3OA 3SAFA 4QS8A 3W3DA 4AQYK 3SQ1A 2D0AA 3IMXA 2V51B 1KFDA 1KVBA 1HLUA 3CC7N 4OPKA 3HK2A 2A41A 3QMLA 4FWKA 2ZGYA 2HBJA 3QDKA 3AAPA 4FOIA 1M90O 4U7BA 2P9UB 4Y0WA 4NO7A 4JKGA 3P1GA 4CCHA 5HRNA 4IO9L 1TKXA 1HMVA 3DLLL 4OLAA 4H0TB 5LMNK 1OVYA 3SYZA 2PZSA 4HCCA 4JV5K 2UXBK 2IIRA 3U4LA 3F9MA 3OYJA 4DFKA 3EEQA 3RMAA 3QESA 1NK6A 4FZZA 4JK7A 2PAVA 1Z6RA 3L4QA 4WFAL 1VSIA 3LDNA 2IAJA 4AILC 3KWGA 1WSHA 1GLBG 4R79A 3WNFA 3KD5E 3G10A 1J53A 3L2QA 4AHCA 1Y64A 3MCAB 1NMDA 3EKSA 2FC0A 2YHWA 1EXQA 3O9TA 3C65A 3CJAA 4KBOA 3LDSA 5AFUA 4CHNA 1NBWA 3F73A 2ITGA 1S9EA 3PIOL 4CJUA 3C0BA 4DV0K 1N32K 2UU9K 4H5WA 1XWLA 2E1YA 4AHSA 4FJGA 1S5JA 4XH4A 3V9XA 1KXPA 3JSMA 3O9SA 4JI2K 2HOEA 3AA5X 4KHSA 2D0PA 3SMPA 5CZ2A 3QBWA 4QS9A 3L3UA 5C15A 1BA0A 3JS6A 3ZT1A 1S1XA 3D7EO 1NU0A 2FSKA 1HPZA 4Z4CA 4PWDA 2KKZA 1OVQA 2KLAA 3OHRA 1X3MA 3PIPL 3CCLN 4CJ4A 1WLJA 2P9SA 2HBMA 4PKGA 4BGBA 1U4BA 4BDYA 2GX9A 3VQAA 3H1VX 2AJQA 3J80O 4DQRA 3DM2A 1JXBA 2F7TA 1Q81O 4Q0BA 4KTQA 1VRUA 4JKDA 4B1UB 3MN9A 3CQYA 2NZTA 3CM5A 5F0XA 3I55N 5CYMA 3TAFA 4M3TA 2JLEA 4K25A 1JL1A 4B08A 2HBKA 1VQ4N 1D9DA 5M1QA 5MLCQ 3MDQA 1HNWK 3IUCA 4JN4A 3E66A 1X9JA 3S9HA 2P9KB 1QSSA 1CLQA 4JLHA 4NB4A 1NWKA 3CC4N 3G71N 1H1VA 3VF4A 3G6EN 1RT3A 4B3SK 3CMEN 4M7XA 5BR9A 1HNXK 3FLCO 3ATUA 3O4QA 1RBSA 4BREA 4CGHA 3VEOA 3R8EA 1S3XA 3CCMN 5CY4A 3AO5A 3HOTA 5TKWA 3O1BA 4XH1A 3HM8A 3HSTB 2WTUA 4OPAA 2P9NA 2O8CA 3HXMA 4JHDA 3NH0A 5HRSA 4KPYA 4DUYK 4JKCA 1NGCA 2QWRA 5GINA 1WOQA 3AVNA 3VENA 1TKTA 2DFFA 3P38A 5E41A 4O4GA 5AQGA 1IH7A 5KRTA 5KRSA 3RRGA 1E4GT 4GNIA 4NCBA 2DFHA 4Q5VA 3G0ZA 4MLEA 1O1WA 1C1CA 4KHUA 1NK9A 1LAVA 3BF3A 3C6TA 4DS5A 3HBTA 1RT5A 2F9TA 1CXUA 3KHYA 2BH1A 1GLCG 1NGFA 3E9PA 4A62A 4QOZB 2Q0RA 3GOIA 3LZIA 5AZJB 5AR0A 4XIUA 4BVOA 4CVNE 2QWMA 2P5GA 1YJNN 2ZJPL 4ELUA 3MEDA 4I2PA 1D4XA 4XEIA 3M6GA 4MLHA 1MA9B 3HP6A 3EZWA 1VSKA 3VGMA 2V7ZA 4BR5A 1YTAA 3NGYA 1JLBA 4AM7A 4B9TA 3ZSYA 4BRPA 4FJJA 3EO3A 3AGRA 3OBYA 1EP4A 3ZEUB 4BWMA 4CJRA 1IJJA 4C1NI 4WYBA 1U2VB 4IFVA 3V9ZA 4O55A 5IWAK 4NLCA 3RR8A 3CETA 1TGOA 2F96A 3AVLA 5J2NA 5F1XA 5GAHP 3O6WA 4DTXA 3FZFA 4DU1A 1TK0A 2HNYA 2XY7A 3CIPA 3VF2A 3ULDA 1R59O 5SZTA 2HHUA 3L2UA 3K2PA 3HM9A 3FFKB 3O4WA 2YCHA 4DV2K 2ZE2A 4JHDB 3SK3A 5LJVA 3LWMA 4EIAA 2QM1A 4YHHK 4J8FA 2BDPA 1NM1A 2HF3A 1SKSA 1U49A 4HUFA 4BR2A 3THXB 1I39A 2YNHA 3KK1A 2ZWHA 3DRRA 3ZLJA 4BE2A 1WNSA 4DSEA 1NGHA 3H1QA 4OKJA 1C0TA 3QFUA 3KIOA 4B1VA 3OYNA 1Q9XA 4JI0K 3L3VA 2VYPA 4W5NA 1CZAN 4KFBA 2YHAA 3VEVA 3D2EA 1MU2A 3CQXA 3R1XA 3RMDA 4JAXA 1W0HA 4N56A 4DV5K 3SMSA 3ITHA 2HVHA 2F8TA 4KB0A 1C6VA 3SBTA 3PY8A 4E1NA 1TAQA 5AQYA 2IS3A 3O08A 3HVRA 4FWOA 3Q7CA 3CCEN 1REVA 3EKUA 4A59A 4I9LA 1SL1A 3A8YA 3CJCA 2IDOA 3OYAA 5LY3A 1NKBA 1B92A 3QEIA 4CZEA 4JI5K 3GL1A 3C94A 1VRTA 3F5TA 1KLMA 4ILHA 3U9DA 5E84A 1FXXA 1HYSA 2O8BA 2Q0UA 3THWB 3TSPA 2FSNA 2VG5A 4GW6A 1RTHA 2OPPA 1XC3A 3KKRA 4I6MB 4FL9A 3O1WA 3SQ4A 2D1KA 3HT3A 3G4SN 3FZKA 3TARA 3VERA 1ZBLA 4CJ3A 5FLXO 3KLGA 3OYBA 2GUPA 3DI6A 4YOYA 5JS1A 3KLFA 4CJ7A 1VAZA 2Q3SA 4DR3K 2W6KA 3K57A 3NF6A 2GV9A 3ZSWA 2FBXA 3HYFA 3O9UA 3RSEA 2KQ2A 1ILYA 4LSNA 4CJPA 4B8CA 1T3VA 2E1ZA 3CFPA 1YJWN 5C2FA 4X62K 1BA1A 4CGGA 3LM2A 4W5OA 3RVCA 1U6ZA 1BHLA 4KKOA 5M1KA 2ZJRL 4E1JA 3J7AP 3H3OB 3E9LA 4CESA 4CEZA 4CF0A 4RW9A 3SAGA 1NGJA 2E6MA 3VQCA 4LFCK 2E2PA 4B8AB 4EHUA 4CJEA 2OCEA 3FE1A 1KRPA 3SQ2A 2KW4A 3RRHA 4PL8A 3SQ0A 4X65K 1L3VA 4ZHRA 4FJIA 2JWLA 1VQ9N 4DR4K 3THVA 3K0SA 2NRZA 4O8UA 4CZMA 2QXLA 3LALA 2YNIA 4BRCA 5EU7A 2Q97A 2ASMA 2HHQA 4MDAA 3I33A 4BE0A 1F21A 4JI8K 4Z4GA 3HZ6A 3GDQA 1NGAA 3AVHA 3LL3A 3T19A 1BL3A 1RDDA 4LFAK 2IC3A 2HBLA 3HSCA 4BACA 4KTWA 1QQCA 4CECA 1YVUA 4MO4A 1C1AA 3C95A 4K41A
chains in the Genus database with same CATH topology
1VSIA 1GOBA 2IAJA 4AILC 4DTUA 1WSHA 3OJUA 3MEGA 4CEBA 2Z1JA 5I42A 4J2BA 4N5SA 4C8NA 1W9HA 3WNFA 1UA1A 1VSMA 3KD5E 3G10A 2D0BA 3ZT4A 1J53A 1U48A 3I8DA 1TKDA 3L2QA 2KFNA 5T7BA 1TK5A 2IOCA 4LH4A 3S3OA 3OYHA 3VQPA 1Q8IA 3HPGA 4AHCA 1C0UA 3I0SA 3EZ5A 2OZSA 4IFYA 4IBNA 4HHTA 4DLGA 2FC0A 1RTIA 3P83D 4CJKA 1EXQA 1VSJA 1NJWA 3ZSVA 2P5OA 2W42A 2G8IA 4FLXA 2B6AA 3LDSA 4H4OA 4CHNA 3F73A 1SL0A 1QSYA 1KFSA 2ITGA 3E01A 4RW6A 1S9EA 3P5JA 4M3YA 1C1BA 1JLAA 2KZMA 4CJUA 1J9AA 1FK9A 1DLOA 2KTQA 3QNNA 1XWLA 4BDPA 4AHSA 4FJGA 1ZBFA 4KO0A 1S5JA 3V9XA 3PO5A 1NKCA 3UIQA 1RT1A 4KB1A 3JSMA 4E7KA 3HVTA 4CIGA 1VK0A 1EETA 4E7IA 3KLIA 1YT3A 4KV8A 1N5YA 1KSPA 3AA5X 4FJMA 4KHSA 4CFBA 1RILA 4CE9A 3QEVA 3ALYA 1BI4A 5CZ2A 3U3YA 4KHQA 4FJKA 3ZT2A 4FJ8A 2KZZA 1HYVA 3L3UA 3AA2A 1ASUA 4FXDA 4FW2A 5JS2A 1QHTA 3ZT1A 3OYDA 1B9FA 1S1XA 1S6PA 4CFCA 5KGXA 4QOZB 1NKEA 4Y1DA 4PUOA 3U3GA 4AHVA 1JL2A 1WSEA 1HPZA 4GMJB 4WE1A 4Z4CA 4FK4A 4PWDA 4CIEA 3TAMA 3S3MA 2WONA 4FYDA 1RDAA 3V6DA 1TVRA 4CJ4A 4B9NA 4HUGA 1XC9A 4DLEA 1SKRA 2HHTA 1WLJA 4KAZA 2ATQA 3ZSOA 4G1QA 1U4BA 2G8UA 4BDYA 3VQAA 1X9SA 3S3NA 2HMIA 2AJQA 2OYQA 1RBTA 1XHZA 1RT2A 1J54A 4DQRA 4RW4A 3KJVA 1CXQA 3DM2A 3VQEA 4FLWA 1JXBA 4Q0BA 3KLHA 3VQ5A 1QE1A 3OYGA 3WNEA 4DTRA 4I9QA 4DTSA 1VRUA 4KTQA 1JLGA 1WAFA 3HPOA 2KFZA 2Y1JA 1CZ9A 3AO2A 3CM5A 5CYMA 3TAFA 4OKEA 4M3TA 2YNGA 2JLEA 1JL1A 2G8KA 3AO4A 4OJRA 4B08A 4J2EA 2YV0X 2D5RA 2E6LA 3NFAA 4M3RA 1D9DA 3NCIA 2BGGA 2DY4A 3OYMA 4CJSA 1IKWA 4F8RA 4CF1A 1JLEA 3CFOA 2G8VA 4M41A 3LWLA 3S9HA 5D3GA 3V1QA 1WSFA 2RF2A 4N47A 2XRIA 1IO2A 1LW0A 1QSSA 2PYLA 1CLQA 2ETJA 3ZSXA 3QINA 2QK9A 4JRPA 4JLHA 1ASWA 3DRPA 3TAEA 5HLFA 3NH1A 3AO3A 1SV5A 1RT3A 1IKYA 1S6QA 3ASMA 4O0JA 4FJLA 2I5JA 1EX4A 1ZBHA 1X9MA 3LANA 3K5LA 4DF4A 1S1UA 3VQDA 4CEEA 3JYTA 1HQUA 5KTQA 3L8BA 1GOAA 5KGWA 4CHYA 4FLTA 3O4QA 1ZBIA 1RBSA 4CGHA 5SWMA 4JRQA 4PY5A 4OKKA 3VA0A 2HHXA 5CY4A 3LAMA 4IKFA 1ZYQA 4E3SA 4B9VA 4FZYA 3AO5A 4UQGA 4M42A 2Z1HA 1QS4A 2HHVA 4FJXA 3PUFA 4RG8A 3L2WA 4MFBA 1LV5A 3WNHA 4YFUA 3HSTB 4OGEA 4CJTA 1CZBA 3HO1A 3HXMA 3NH0A 2YKMA 5HRSA 1NK8A 4KPYA 1D5AA 1RCHA 2Z1IA 3AVNA 4DS4A 4PQUA 2HVIA 1TKTA 4Z0UA 3NF8A 2DFFA 3KLEA 3C6UA 5E41A 4LH5A 4O4GA 4QAGA 1IH7A 1VSDA 5KRTA 5KRSA 3V9SA 3RRGA 2VWKA 4FJ7A 3ZSZA 3SCXA 4CF2A 3LPTA 3MXJA 4F2RA 3NE6A 3SUQA 2XY8A 4ICLA 4DFMA 1U47A 3U6FA 1UOCA 4FK0A 2DFHA 4DMNA 4Q5VA 3G0ZA 3M8PA 1O1WA 1C1CA 1LAWA 3AVCA 4LSLA 3ZSRA 3HP9A 1NK9A 1LAVA 3TI0A 1TL1A 5I3UA 2HHSA 4J2AA 2HW3A 4DWIA 3C6TA 4DS5A 1S1TA 4TSXA 1S1WA 4CGFA 4FLUA 1D9FA 3V1OA 4M3UA 1RT5A 3V81A 4E0DA 1BI4B 1CXUA 4R5PA 4FK2A 2XY6A 4M3ZA 2A1RA 3AA4A 1BGXT 3VA3A 3TWHA 3EY1A 2OPQA 4AHRA 1HJRA 3L2VA 1SUQA 2YNFA 3V9UA 1UWBA 4I7FA 1DTQA 4DTPA 3VQ6A 1QTMA 4DSLA 1RBVA 4LY7A 3AVMA 3LZIA 3DOLA 1WSGA 4XIUA 3KTQA 4FLVA 4W5TA 4CGJA 3KK2A 4OGCA 2P5GA 3VN5A 5J2PA 2G8WA 5C42A 3MEDA 4ELUA 4I2PA 2O4IA 5DK5A 3MEEA 1BQNA 2B5JA 1S9GA 3VQ7A 4W5QA 1TAUA 3AVFA 3RTVA 3AVKA 3VQ8A 1JLQA 1K6YA 2RKIA 3MXMA 4E19A 2BE2A 3HP6A 4CK2A 3LP2A 4KTZA 4CGIA 4EP5A 3O3GA 1VSKA 3TABA 3DMJA 3AVAA 1YTAA 3NGYA 1JLBA 3QO9A 4NYFA 3ZSYA 4E7LA 3TAGA 3AVJA 3LZJA 4B9TA 4Z4IA 3BGRA 1T03A 4BE1A 4FJJA 4KREA 1JLFA 3VQ9A 5C25A 3OY9A 1Q9YA 3SPZA 2A1SA 3D45A 1NOYA 2G8HA 4Y1CA 2JGUA 3QEWA 4DSKA 5FROA 2P51A 4M3WA 4CERA 1IG9A 1EP4A 3PX6A 3NF9A 4BWMA 4CJRA 5HROA 3SI6A 4FJ9A 4DG1A 1J5OA 4OVLA 3OYIA 2P1JA 4ID5A 3VQ4A 2DTUA 4CGDA 2OA8A 3NHGA 4KHYA 4B9MA 4IFVA 3V9WA 2ZD1A 3V9ZA 4O55A 3DLGA 2X6NA 4B9LA 4DQIA 1SL2A 1U45A 1VSFA 1FKOA 4AHTA 3RR8A 4BWJA 4Z4HA 4DQQA 1HNIA 1TGOA 1NOZA 4ZTFA 1X1PA 2F96A 3AVGA 3AVLA 3VQBA 5J2NA 1SKWA 4AH9A 3K5NA 1NK5A 2OZMA 3RMCA 4DTXA 3QIOA 3DLEA 3MAQA 3SUPA 2FBVA 3NBPA 1NJZA 4FVMA 4CEFA 4DU1A 1TK0A 2HNYA 4JS4A 2XY7A 4ELVA 4CJWA 3DLHA 3OYFA 3ULDA 3O3FA 4BDZA 4NCBA 1VSLA 1JLCA 1RTDA 5SZTA 1A5VA 2HHUA 3L2UA 3K58A 3L2RA 3K2PA 3M8RA 1IKVA 2E4LA 3OYLA 3HM9A 2D0CA 1A5WA 2XO7A 3QNOA 3RMBA 1LWCA 2ZE2A 1YTUA 4MQ3A 2F8SA 4E89A 3I0RA 1VSEA 4CF9A 1LWEA 3OS0A 4CEDA 3LWMA 4DFJA 1XI1A 1NJXA 4M45A 4FCYA 3DOKA 4F2SA 4DSJA 2QXFA 1LWFA 2BDPA 2OPRA 3TAPA 1SKSA 3WNGA 3T3FA 1U49A 1HQEA 4YNQA 3ZCMA 3OYCA 3OYKA 4HUFA 1T05A 4DFPA 1I39A 2YNHA 3KK1A 1BISA 3DRRA 1RDCA 4BE2A 3AO1A 4FJ5A 3IAYA 4CEOA 1WNSA 4DSEA 1WSJA 4KI6A 4CJ5A 4OKJA 4DQSA 3SV3A 2VWJA 3CQ8A 4CHZA 1NK4A 1RDBA 4CHQA 4F3TA 1C0TA 3H08A 3KK3A 4IG0A 1RT4A 3HJFA 2RN2A 4CJLA 3BDPA 3KIOA 3OYNA 4DTJA 1Q9XA 1KLNA 4FLYA 3DYAA 3L3VA 1S1VA 4CJQA 3HL8A 3LP0A 3SV4A 3M8QA 4W5NA 1WN7A 2VG7A 4H8KA 4DTMA 1UA0A 1NK0A 1T7PA 1BIUA 4KFBA 2YHAA 3M8SA 1HRHA 2NUBA 4B9SA 4EZ6A 1R0AA 1MU2A 2HNZA 4HTUA 3TAQA 4OPJA 5FDLA 3RMDA 1L5UA 4DU4A 4E7HA 4CEAA 3MECA 1W0HA 4N56A 4DQPA 3DLBA 3ITHA 3LAKA 4IG3A 1Z25A 1N6QA 3RR7A 4EZ9A 2F8TA 3LP1A 2EX3A 4KB0A 1C6VA 4C8MA 2HVHA 5CZ1A 5HP1A 4ZTJA 3PY8A 1TL3A 2HHWA 1D8YA 4OLBA 1RNHA 4E1NA 1TAQA 5KI6A 2IS3A 3OYEA 4NCAA 3HVRA 1DTTA 1HYZA 1REVA 2FBYA 2O4GA 4KHWA 4FLZA 4I9LA 1SL1A 2YHBA 3TR8A 2GUIA 3A2FA 4DSFA 3PV8A 1KVCA 2IDOA 1QSLA 3CFRA 5K14A 1T8EA 3AA3A 3OYAA 1B9DA 3IRXA 1NKBA 2G8FA 1B92A 4FJNA 4CJFA 3QEIA 4FJHA 4QCLA 4F4KA 3CG7A 4C8OA 3OVNA 3SZ2A 4CFDA 2EHGA 2XY5A 5FRMA 3C94A 4HCBA 4CK1A 2DFEA 4NCGA 1VRTA 1RBRA 3OS2A 1KLMA 3O4NA 3NGZA 4DU3A 3AVIA 3PX4A 4ELTA 1KCFA 4GVMA 2VG6A 3MXIA 1FXXA 4CHPA 2B4JA 1HYSA 1Y97A 4JS5A 4L8RB 4W5RA 4K8XA 1TV6A 2VG5A 4FW1A 4GW6A 1RTHA 2OPPA 1L3UA 3KKRA 3PO4A 1JKHA 4I2QA 5DMRA 3TANA 1X9WA 4O0IA 3EYZA 3VQQA 3QERA 5HRRA 3SQ4A 3QLHA 1RBUA 3HT3A 4E1MA 4K8ZA 4CFAA 1NJYA 4CF8A 1VSHA 1RT7A 3CYMA 3TARA 3D0PA 1ZBLA 4CJ3A 2ZQBA 3SNNA 5C24A 3KLGA 3OYBA 3QIPA 3NDKA 4Z4FA 1TKZA 3PX0A 3DI6A 2PYJA 1GOCA 2RPIA 4M3XA 2Z1GA 4J2DA 1L3TA 4H4MA 1Z26A 3NAEA 1L3SA 3O3HA 3AV9A 1FKPA 3K5MA 4HUEA 4FM2A 5JS1A 4RW8A 3K5OA 3NF7A 3KLFA 4FM0A 1JXEA 2Q3SA 1G15A 1UAXA 1WSIA 5CYQA 3IG1A 1RT6A 4IDKA 3OS1A 3K57A 2R7YA 4N41A 2X78A 3NF6A 2GV9A 4KHNA 3RWUA 3SUNA 2BANA 2FBXA 3ZSWA 3HYFA 1NK7A 4FZXC 4RW7A 4AHUA 3V1RA 2KQ2A 5HBMA 3HPHA 1RTJA 4LSNA 4CJPA 3NH2A 2X74A 4B8CA 2OPSA 5HRPA 3V4IA 3SUOA 3CFPA 2XHBA 3SPYA 4DSIA 1ASVA 4C8LA 4CHOA 2HB5A 5FRNA 4CGGA 3ZT0A 2QKBA 2QKKA 4W5OA 3DLRA 3ISNC 1BHLA 4KKOA 4PA1A 4NYNA 3LPUA 3OJSA 1HNVA 3CM6A 2X6SA 4O5BA 4DTOA 5J2MA 4CESA 4CEZA 4CF0A 4RW9A 1C0MA 4LD0A 3DRSA 3ZSQA 1EKEA 2IGIA 2E6MA 3VQCA 1IKXA 1WAJA 3B6PA 3QEPA 5J2QA 4EP4A 4B8AB 3F9KA 3ZT3A 4Z4EA 4CJEA 4B3OA 4O44A 2YKNA 4DF8A 1KRPA 3SQ1A 3SQ2A 2D0AA 2KW4A 3RRHA 3SQ0A 1L3VA 1KFDA 1KVBA 4ZHRA 4FJIA 3THVA 4KHUA 4OPKA 5J1EA 1BCOA 4KI4A 4KRFA 4N76A 3HK2A 4HVJA 3B6OA 3LALA 2YNIA 4CIFA 5EU7A 4DTNA 4F3OA 1A5XA 1BCMA 1KVAA 1ITGA 1BIZA 2HHQA 1KTQA 3NGIA 3SJJA 4BE0A 1F21A 2GBZA 2WOMA 4Z4GA 2Y1IA 3P1GA 4CCHA 1I3AA 4CEQA 1BQMA 3AVHA 2HNDA 3AVBA 5HRNA 3KD1E 1TKXA 1HMVA 3T19A 1BL3A 1RDDA 4CK3A 1LW2A 2IC3A 3IS9A 4OLAA 4BACA 4C8KA 3SYZA 2PZSA 2FBTA 3K59A 4HCCA 4KTWA 1QQCA 4E7JA 4DFKA 4CECA 1YVUA 3LP3A 3OYJA 4ID1A 3QEXA 2PY5A 3RMAA 1ZBUA 3QESA 1TK8A 4B9UA 1NK6A 1C1AA 2LSNA 3T1AA 3C95A 3DLKA 1XHXA 4CJVA 4FM1A 4FZZA 1U04A 3KKSA 3FFIA 3QETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VSI A;  1GOB A;  2IAJ A;  4AIL C;  4DTU A;  1WSH A;  3OJU A;  3MEG A;  4CEB A;  2Z1J A;  5I42 A;  4J2B A;  4N5S A;  4C8N A;  1W9H A;  3WNF A;  1UA1 A;  1VSM A;  3KD5 E;  3G10 A;  2D0B A;  3ZT4 A;  1J53 A;  1U48 A;  3I8D A;  1TKD A;  3L2Q A;  2KFN A;  5T7B A;  1TK5 A;  2IOC A;  4LH4 A;  3S3O A;  3OYH A;  3VQP A;  1Q8I A;  3HPG A;  4AHC A;  1C0U A;  3I0S A;  3EZ5 A;  2OZS A;  4IFY A;  4IBN A;  4HHT A;  4DLG A;  2FC0 A;  1RTI A;  3P83 D;  4CJK A;  1EXQ A;  1VSJ A;  1NJW A;  3ZSV A;  2P5O A;  2W42 A;  2G8I A;  4FLX A;  2B6A A;  3LDS A;  4H4O A;  4CHN A;  3F73 A;  1SL0 A;  1QSY A;  1KFS A;  2ITG A;  3E01 A;  4RW6 A;  1S9E A;  3P5J A;  4M3Y A;  1C1B A;  1JLA A;  2KZM A;  4CJU A;  1J9A A;  1FK9 A;  1DLO A;  2KTQ A;  3QNN A;  1XWL A;  4BDP A;  4AHS A;  4FJG A;  1ZBF A;  4KO0 A;  1S5J A;  3V9X A;  3PO5 A;  1NKC A;  3UIQ A;  1RT1 A;  4KB1 A;  3JSM A;  4E7K A;  3HVT A;  4CIG A;  1VK0 A;  1EET A;  4E7I A;  3KLI A;  1YT3 A;  4KV8 A;  1N5Y A;  1KSP A;  3AA5 X;  4FJM A;  4KHS A;  4CFB A;  1RIL A;  4CE9 A;  3QEV A;  3ALY A;  1BI4 A;  5CZ2 A;  3U3Y A;  4KHQ A;  4FJK A;  3ZT2 A;  4FJ8 A;  2KZZ A;  1HYV A;  3L3U A;  3AA2 A;  1ASU A;  4FXD A;  4FW2 A;  5JS2 A;  1QHT A;  3ZT1 A;  3OYD A;  1B9F A;  1S1X A;  1S6P A;  4CFC A;  5KGX A;  4QOZ B;  1NKE A;  4Y1D A;  4PUO A;  3U3G A;  4AHV A;  1JL2 A;  1WSE A;  1HPZ A;  4GMJ B;  4WE1 A;  4Z4C A;  4FK4 A;  4PWD A;  4CIE A;  3TAM A;  3S3M A;  2WON A;  4FYD A;  1RDA A;  3V6D A;  1TVR A;  4CJ4 A;  4B9N A;  4HUG A;  1XC9 A;  4DLE A;  1SKR A;  2HHT A;  1WLJ A;  4KAZ A;  2ATQ A;  3ZSO A;  4G1Q A;  1U4B A;  2G8U A;  4BDY A;  3VQA A;  1X9S A;  3S3N A;  2HMI A;  2AJQ A;  2OYQ A;  1RBT A;  1XHZ A;  1RT2 A;  1J54 A;  4DQR A;  4RW4 A;  3KJV A;  1CXQ A;  3DM2 A;  3VQE A;  4FLW A;  1JXB A;  4Q0B A;  3KLH A;  3VQ5 A;  1QE1 A;  3OYG A;  3WNE A;  4DTR A;  4I9Q A;  4DTS A;  1VRU A;  4KTQ A;  1JLG A;  1WAF A;  3HPO A;  2KFZ A;  2Y1J A;  1CZ9 A;  3AO2 A;  3CM5 A;  5CYM A;  3TAF A;  4OKE A;  4M3T A;  2YNG A;  2JLE A;  1JL1 A;  2G8K A;  3AO4 A;  4OJR A;  4B08 A;  4J2E A;  2YV0 X;  2D5R A;  2E6L A;  3NFA A;  4M3R A;  1D9D A;  3NCI A;  2BGG A;  2DY4 A;  3OYM A;  4CJS A;  1IKW A;  4F8R A;  4CF1 A;  1JLE A;  3CFO A;  2G8V A;  4M41 A;  3LWL A;  3S9H A;  5D3G A;  3V1Q A;  1WSF A;  2RF2 A;  4N47 A;  2XRI A;  1IO2 A;  1LW0 A;  1QSS A;  2PYL A;  1CLQ A;  2ETJ A;  3ZSX A;  3QIN A;  2QK9 A;  4JRP A;  4JLH A;  1ASW A;  3DRP A;  3TAE A;  5HLF A;  3NH1 A;  3AO3 A;  1SV5 A;  1RT3 A;  1IKY A;  1S6Q A;  3ASM A;  4O0J A;  4FJL A;  2I5J A;  1EX4 A;  1ZBH A;  1X9M A;  3LAN A;  3K5L A;  4DF4 A;  1S1U A;  3VQD A;  4CEE A;  3JYT A;  1HQU A;  5KTQ A;  3L8B A;  1GOA A;  5KGW A;  4CHY A;  4FLT A;  3O4Q A;  1ZBI A;  1RBS A;  4CGH A;  5SWM A;  4JRQ A;  4PY5 A;  4OKK A;  3VA0 A;  2HHX A;  5CY4 A;  3LAM A;  4IKF A;  1ZYQ A;  4E3S A;  4B9V A;  4FZY A;  3AO5 A;  4UQG A;  4M42 A;  2Z1H A;  1QS4 A;  2HHV A;  4FJX A;  3PUF A;  4RG8 A;  3L2W A;  4MFB A;  1LV5 A;  3WNH A;  4YFU A;  3HST B;  4OGE A;  4CJT A;  1CZB A;  3HO1 A;  3HXM A;  3NH0 A;  2YKM A;  5HRS A;  1NK8 A;  4KPY A;  1D5A A;  1RCH A;  2Z1I A;  3AVN A;  4DS4 A;  4PQU A;  2HVI A;  1TKT A;  4Z0U A;  3NF8 A;  2DFF A;  3KLE A;  3C6U A;  5E41 A;  4LH5 A;  4O4G A;  4QAG A;  1IH7 A;  1VSD A;  5KRT A;  5KRS A;  3V9S A;  3RRG A;  2VWK A;  4FJ7 A;  3ZSZ A;  3SCX A;  4CF2 A;  3LPT A;  3MXJ A;  4F2R A;  3NE6 A;  3SUQ A;  2XY8 A;  4ICL A;  4DFM A;  1U47 A;  3U6F A;  1UOC A;  4FK0 A;  2DFH A;  4DMN A;  4Q5V A;  3G0Z A;  3M8P A;  1O1W A;  1C1C A;  1LAW A;  3AVC A;  4LSL A;  3ZSR A;  3HP9 A;  1NK9 A;  1LAV A;  3TI0 A;  1TL1 A;  5I3U A;  2HHS A;  4J2A A;  2HW3 A;  4DWI A;  3C6T A;  4DS5 A;  1S1T A;  4TSX A;  1S1W A;  4CGF A;  4FLU A;  1D9F A;  3V1O A;  4M3U A;  1RT5 A;  3V81 A;  4E0D A;  1BI4 B;  1CXU A;  4R5P A;  4FK2 A;  2XY6 A;  4M3Z A;  2A1R A;  3AA4 A;  1BGX T;  3VA3 A;  3TWH A;  3EY1 A;  2OPQ A;  4AHR A;  1HJR A;  3L2V A;  1SUQ A;  2YNF A;  3V9U A;  1UWB A;  4I7F A;  1DTQ A;  4DTP A;  3VQ6 A;  1QTM A;  4DSL A;  1RBV A;  4LY7 A;  3AVM A;  3LZI A;  3DOL A;  1WSG A;  4XIU A;  3KTQ A;  4FLV A;  4W5T A;  4CGJ A;  3KK2 A;  4OGC A;  2P5G A;  3VN5 A;  5J2P A;  2G8W A;  5C42 A;  3MED A;  4ELU A;  4I2P A;  2O4I A;  5DK5 A;  3MEE A;  1BQN A;  2B5J A;  1S9G A;  3VQ7 A;  4W5Q A;  1TAU A;  3AVF A;  3RTV A;  3AVK A;  3VQ8 A;  1JLQ A;  1K6Y A;  2RKI A;  3MXM A;  4E19 A;  2BE2 A;  3HP6 A;  4CK2 A;  3LP2 A;  4KTZ A;  4CGI A;  4EP5 A;  3O3G A;  1VSK A;  3TAB A;  3DMJ A;  3AVA A;  1YTA A;  3NGY A;  1JLB A;  3QO9 A;  4NYF A;  3ZSY A;  4E7L A;  3TAG A;  3AVJ A;  3LZJ A;  4B9T A;  4Z4I A;  3BGR A;  1T03 A;  4BE1 A;  4FJJ A;  4KRE A;  1JLF A;  3VQ9 A;  5C25 A;  3OY9 A;  1Q9Y A;  3SPZ A;  2A1S A;  3D45 A;  1NOY A;  2G8H A;  4Y1C A;  2JGU A;  3QEW A;  4DSK A;  5FRO A;  2P51 A;  4M3W A;  4CER A;  1IG9 A;  1EP4 A;  3PX6 A;  3NF9 A;  4BWM A;  4CJR A;  5HRO A;  3SI6 A;  4FJ9 A;  4DG1 A;  1J5O A;  4OVL A;  3OYI A;  2P1J A;  4ID5 A;  3VQ4 A;  2DTU A;  4CGD A;  2OA8 A;  3NHG A;  4KHY A;  4B9M A;  4IFV A;  3V9W A;  2ZD1 A;  3V9Z A;  4O55 A;  3DLG A;  2X6N A;  4B9L A;  4DQI A;  1SL2 A;  1U45 A;  1VSF A;  1FKO A;  4AHT A;  3RR8 A;  4BWJ A;  4Z4H A;  4DQQ A;  1HNI A;  1TGO A;  1NOZ A;  4ZTF A;  1X1P A;  2F96 A;  3AVG A;  3AVL A;  3VQB A;  5J2N A;  1SKW A;  4AH9 A;  3K5N A;  1NK5 A;  2OZM A;  3RMC A;  4DTX A;  3QIO A;  3DLE A;  3MAQ A;  3SUP A;  2FBV A;  3NBP A;  1NJZ A;  4FVM A;  4CEF A;  4DU1 A;  1TK0 A;  2HNY A;  4JS4 A;  2XY7 A;  4ELV A;  4CJW A;  3DLH A;  3OYF A;  3ULD A;  3O3F A;  4BDZ A;  4NCB A;  1VSL A;  1JLC A;  1RTD A;  5SZT A;  1A5V A;  2HHU A;  3L2U A;  3K58 A;  3L2R A;  3K2P A;  3M8R A;  1IKV A;  2E4L A;  3OYL A;  3HM9 A;  2D0C A;  1A5W A;  2XO7 A;  3QNO A;  3RMB A;  1LWC A;  2ZE2 A;  1YTU A;  4MQ3 A;  2F8S A;  4E89 A;  3I0R A;  1VSE A;  4CF9 A;  1LWE A;  3OS0 A;  4CED A;  3LWM A;  4DFJ A;  1XI1 A;  1NJX A;  4M45 A;  4FCY A;  3DOK A;  4F2S A;  4DSJ A;  2QXF A;  1LWF A;  2BDP A;  2OPR A;  3TAP A;  1SKS A;  3WNG A;  3T3F A;  1U49 A;  1HQE A;  4YNQ A;  3ZCM A;  3OYC A;  3OYK A;  4HUF A;  1T05 A;  4DFP A;  1I39 A;  2YNH A;  3KK1 A;  1BIS A;  3DRR A;  1RDC A;  4BE2 A;  3AO1 A;  4FJ5 A;  3IAY A;  4CEO A;  1WNS A;  4DSE A;  1WSJ A;  4KI6 A;  4CJ5 A;  4OKJ A;  4DQS A;  3SV3 A;  2VWJ A;  3CQ8 A;  4CHZ A;  1NK4 A;  1RDB A;  4CHQ A;  4F3T A;  1C0T A;  3H08 A;  3KK3 A;  4IG0 A;  1RT4 A;  3HJF A;  2RN2 A;  4CJL A;  3BDP A;  3KIO A;  3OYN A;  4DTJ A;  1Q9X A;  1KLN A;  4FLY A;  3DYA A;  3L3V A;  1S1V A;  4CJQ A;  3HL8 A;  3LP0 A;  3SV4 A;  3M8Q A;  4W5N A;  1WN7 A;  2VG7 A;  4H8K A;  4DTM A;  1UA0 A;  1NK0 A;  1T7P A;  1BIU A;  4KFB A;  2YHA A;  3M8S A;  1HRH A;  2NUB A;  4B9S A;  4EZ6 A;  1R0A A;  1MU2 A;  2HNZ A;  4HTU A;  3TAQ A;  4OPJ A;  5FDL A;  3RMD A;  1L5U A;  4DU4 A;  4E7H A;  4CEA A;  3MEC A;  1W0H A;  4N56 A;  4DQP A;  3DLB A;  3ITH A;  3LAK A;  4IG3 A;  1Z25 A;  1N6Q A;  3RR7 A;  4EZ9 A;  2F8T A;  3LP1 A;  2EX3 A;  4KB0 A;  1C6V A;  4C8M A;  2HVH A;  5CZ1 A;  5HP1 A;  4ZTJ A;  3PY8 A;  1TL3 A;  2HHW A;  1D8Y A;  4OLB A;  1RNH A;  4E1N A;  1TAQ A;  5KI6 A;  2IS3 A;  3OYE A;  4NCA A;  3HVR A;  1DTT A;  1HYZ A;  1REV A;  2FBY A;  2O4G A;  4KHW A;  4FLZ A;  4I9L A;  1SL1 A;  2YHB A;  3TR8 A;  2GUI A;  3A2F A;  4DSF A;  3PV8 A;  1KVC A;  2IDO A;  1QSL A;  3CFR A;  5K14 A;  1T8E A;  3AA3 A;  3OYA A;  1B9D A;  3IRX A;  1NKB A;  2G8F A;  1B92 A;  4FJN A;  4CJF A;  3QEI A;  4FJH A;  4QCL A;  4F4K A;  3CG7 A;  4C8O A;  3OVN A;  3SZ2 A;  4CFD A;  2EHG A;  2XY5 A;  5FRM A;  3C94 A;  4HCB A;  4CK1 A;  2DFE A;  4NCG A;  1VRT A;  1RBR A;  3OS2 A;  1KLM A;  3O4N A;  3NGZ A;  4DU3 A;  3AVI A;  3PX4 A;  4ELT A;  1KCF A;  4GVM A;  2VG6 A;  3MXI A;  1FXX A;  4CHP A;  2B4J A;  1HYS A;  1Y97 A;  4JS5 A;  4L8R B;  4W5R A;  4K8X A;  1TV6 A;  2VG5 A;  4FW1 A;  4GW6 A;  1RTH A;  2OPP A;  1L3U A;  3KKR A;  3PO4 A;  1JKH A;  4I2Q A;  5DMR A;  3TAN A;  1X9W A;  4O0I A;  3EYZ A;  3VQQ A;  3QER A;  5HRR A;  3SQ4 A;  3QLH A;  1RBU A;  3HT3 A;  4E1M A;  4K8Z A;  4CFA A;  1NJY A;  4CF8 A;  1VSH A;  1RT7 A;  3CYM A;  3TAR A;  3D0P A;  1ZBL A;  4CJ3 A;  2ZQB A;  3SNN A;  5C24 A;  3KLG A;  3OYB A;  3QIP A;  3NDK A;  4Z4F A;  1TKZ A;  3PX0 A;  3DI6 A;  2PYJ A;  1GOC A;  2RPI A;  4M3X A;  2Z1G A;  4J2D A;  1L3T A;  4H4M A;  1Z26 A;  3NAE A;  1L3S A;  3O3H A;  3AV9 A;  1FKP A;  3K5M A;  4HUE A;  4FM2 A;  5JS1 A;  4RW8 A;  3K5O A;  3NF7 A;  3KLF A;  4FM0 A;  1JXE A;  2Q3S A;  1G15 A;  1UAX A;  1WSI A;  5CYQ A;  3IG1 A;  1RT6 A;  4IDK A;  3OS1 A;  3K57 A;  2R7Y A;  4N41 A;  2X78 A;  3NF6 A;  2GV9 A;  4KHN A;  3RWU A;  3SUN A;  2BAN A;  2FBX A;  3ZSW A;  3HYF A;  1NK7 A;  4FZX C;  4RW7 A;  4AHU A;  3V1R A;  2KQ2 A;  5HBM A;  3HPH A;  1RTJ A;  4LSN A;  4CJP A;  3NH2 A;  2X74 A;  4B8C A;  2OPS A;  5HRP A;  3V4I A;  3SUO A;  3CFP A;  2XHB A;  3SPY A;  4DSI A;  1ASV A;  4C8L A;  4CHO A;  2HB5 A;  5FRN A;  4CGG A;  3ZT0 A;  2QKB A;  2QKK A;  4W5O A;  3DLR A;  3ISN C;  1BHL A;  4KKO A;  4PA1 A;  4NYN A;  3LPU A;  3OJS A;  1HNV A;  3CM6 A;  2X6S A;  4O5B A;  4DTO A;  5J2M A;  4CES A;  4CEZ A;  4CF0 A;  4RW9 A;  1C0M A;  4LD0 A;  3DRS A;  3ZSQ A;  1EKE A;  2IGI A;  2E6M A;  3VQC A;  1IKX A;  1WAJ A;  3B6P A;  3QEP A;  5J2Q A;  4EP4 A;  4B8A B;  3F9K A;  3ZT3 A;  4Z4E A;  4CJE A;  4B3O A;  4O44 A;  2YKN A;  4DF8 A;  1KRP A;  3SQ1 A;  3SQ2 A;  2D0A A;  2KW4 A;  3RRH A;  3SQ0 A;  1L3V A;  1KFD A;  1KVB A;  4ZHR A;  4FJI A;  3THV A;  4KHU A;  4OPK A;  5J1E A;  1BCO A;  4KI4 A;  4KRF A;  4N76 A;  3HK2 A;  4HVJ A;  3B6O A;  3LAL A;  2YNI A;  4CIF A;  5EU7 A;  4DTN A;  4F3O A;  1A5X A;  1BCM A;  1KVA A;  1ITG A;  1BIZ A;  2HHQ A;  1KTQ A;  3NGI A;  3SJJ A;  4BE0 A;  1F21 A;  2GBZ A;  2WOM A;  4Z4G A;  2Y1I A;  3P1G A;  4CCH A;  1I3A A;  4CEQ A;  1BQM A;  3AVH A;  2HND A;  3AVB A;  5HRN A;  3KD1 E;  1TKX A;  1HMV A;  3T19 A;  1BL3 A;  1RDD A;  4CK3 A;  1LW2 A;  2IC3 A;  3IS9 A;  4OLA A;  4BAC A;  4C8K A;  3SYZ A;  2PZS A;  2FBT A;  3K59 A;  4HCC A;  4KTW A;  1QQC A;  4E7J A;  4DFK A;  4CEC A;  1YVU A;  3LP3 A;  3OYJ A;  4ID1 A;  3QEX A;  2PY5 A;  3RMA A;  1ZBU A;  3QES A;  1TK8 A;  4B9U A;  1NK6 A;  1C1A A;  2LSN A;  3T1A A;  3C95 A;  3DLK A;  1XHX A;  4CJV A;  4FM1 A;  4FZZ A;  1U04 A;  3KKS A;  3FFI A;  3QET A; 
#chains in the Genus database with same CATH topology
 4YOT A;  1GOB A;  4GVE A;  2Z1J A;  4J2B A;  4N5S A;  1UA1 A;  1W9H A;  2A42 A;  1VSM A;  1U48 A;  2D0B A;  1TKD A;  2IOC A;  4LH4 A;  3S3O A;  4BGA A;  5FPE A;  3EZ5 A;  4BRI A;  1VQK N;  4IBN A;  1T6C A;  3WXK A;  4CJK A;  1VSJ A;  2G8I A;  3MWT A;  4RW6 A;  4LF4 K;  1WBD A;  1J9A A;  1FK9 A;  1DLO A;  4AM6 A;  2QI2 A;  3UIQ A;  4KB1 A;  4FWM A;  4E7K A;  3AGK A;  3HVT A;  4E7I A;  4CD1 A;  4KV8 A;  1KSP A;  5BRF A;  4CE9 A;  4X66 K;  2CGL A;  3ZT2 A;  1HYV A;  3AAR A;  1QHT A;  2QW9 A;  3OYD A;  4JNE A;  2P9K A;  1S6P A;  5KGX A;  1Z05 A;  4Y1D A;  3U3G A;  3WXM B;  4AHV A;  4WE1 A;  4CW7 B;  5GAD P;  3J7Y P;  3V6D A;  4M63 C;  4B9Q A;  1XC9 A;  3CJ9 A;  2HHT A;  3ENH A;  2ATQ A;  1TUY A;  2G8U A;  4DUZ K;  4BY9 C;  2HMI A;  2OYQ A;  1RBT A;  1RT2 A;  4H5N A;  5BR8 K;  4PKI A;  4RW4 A;  3KJV A;  4FLW A;  3MN5 A;  4I9Q A;  1QE1 A;  3WNE A;  4DTR A;  1JLG A;  2P9N B;  3HPO A;  4OO1 J;  5AQI A;  3AO2 A;  3M1F A;  2YHX A;  2YNG A;  5BRD A;  1HNZ K;  2G8K A;  4J2E A;  2YV0 X;  1E4F T;  4M3R A;  2BGG A;  2QWO A;  2G8V A;  3EE8 A;  4DR5 K;  4M41 A;  3V1Q A;  2PYL A;  3CCV N;  5AQK A;  3HOS A;  5CE3 A;  3ZSX A;  3UKR B;  4PL7 A;  2UYT A;  1ASW A;  1YIT N;  5HLF A;  3LDO A;  1S6Q A;  4O0J A;  2I5J A;  1QVG M;  3DWL A;  1X9M A;  3K5L A;  1VQP N;  3L8B A;  1HQU A;  1GOA A;  4FLT A;  3R9P A;  4PY5 A;  4OKK A;  3QIC A;  2HHX A;  4E3S A;  5ELZ A;  4B9V A;  4RWT A;  4UQG A;  2D0O A;  2Z1H A;  4FJX A;  3L2W A;  4OGE A;  4CJT A;  2F4V K;  1C0F A;  1TYQ B;  1NK8 A;  3ULE B;  1P8Z A;  2Z1I A;  4DS4 A;  5EXW A;  4ISE A;  1NGB A;  4RCH A;  4Z0U A;  3NF8 A;  3KLE A;  3CCQ N;  2O8D A;  4DHY A;  1VSD A;  3MK6 A;  4B1Y B;  3V9S A;  3TTD A;  3AY9 A;  5FPN A;  5BPL A;  2XY8 A;  3CJ7 A;  3U6F A;  1U47 A;  4FK0 A;  3NMU A;  4DMN A;  2KFZ A;  3M8P A;  4LSL A;  3J81 O;  4K43 A;  4J2A A;  2HW3 A;  4DWI A;  2A40 A;  5AQO A;  3ZX2 A;  1D9F A;  4E0D A;  3C6A A;  3CJ1 A;  4FK2 A;  4IEE A;  3AA4 A;  4FPA A;  3VA3 A;  4NXN K;  4O8K A;  3SLC A;  3TWH A;  3L2V A;  3V9U A;  2ZJQ L;  1RBV A;  4LY7 A;  2P9I A;  5AQM A;  4FLV A;  1BU6 O;  5C12 A;  3J8A A;  1P90 A;  4IDH A;  5J2P A;  1VQ6 N;  2G8W A;  5C42 A;  1GLJ O;  2O4I A;  5DK5 A;  4Z94 A;  1RGI A;  3MEE A;  5AQZ A;  3VQ8 A;  5LJW A;  2E2Q A;  4BRM A;  3R6M A;  3MXM A;  1HKB A;  3TAB A;  4BC5 A;  4NYF A;  2Q31 A;  4Z4I A;  3BGR A;  3AAQ A;  4BE1 A;  1T03 A;  5C25 A;  2P9S B;  2P9P A;  3SPZ A;  2ZGZ A;  2JGU A;  1IG9 A;  4B3R K;  3WQU A;  4DG1 A;  1IG8 A;  1J5O A;  4C1N K;  3CPE A;  5AQS A;  2P1J A;  4ID5 A;  2DTU A;  5ADX H;  3NHG A;  1OH8 A;  2X6N A;  4CZH A;  1BG3 A;  1U45 A;  1RFQ A;  1FKO A;  4AHT A;  4DQQ A;  1X1P A;  4NXM K;  2GTD A;  2OZM A;  3WUH A;  3QIO A;  4EFH A;  2FBV A;  3NBP A;  4BR9 A;  3EE9 A;  2EWS A;  3OYF A;  4B1Z A;  3O3F A;  1W2B M;  1KAX A;  4BDZ A;  1RTD A;  3L2R A;  1ATR A;  1KC8 O;  3M8R A;  1KQS M;  2D0C A;  1A5W A;  4H0O A;  3RMB A;  3KVG A;  1YTU A;  3O5B A;  4DCH A;  3I0R A;  1VSE A;  4DFJ A;  1LWE A;  1XI1 A;  3ULE A;  4CED A;  1NJX A;  5AQF A;  3CD6 N;  5JLH A;  3F2K A;  4BRG A;  1LWF A;  5JMV A;  3CXC M;  3T3F A;  4FWQ A;  1T05 A;  3OYK A;  3ZCM A;  2F9W A;  1MWM A;  3IAY A;  4DR6 K;  4CJ5 A;  3SV3 A;  4CHZ A;  1NK4 A;  4IG0 A;  3ENO A;  2RN2 A;  4DTJ A;  4YDU C;  4BRL A;  2ZF5 O;  1KLN A;  3HL8 A;  3LP0 A;  2YHY A;  3VMF B;  4DTM A;  2UUB K;  5B8H A;  4G9Z A;  2NUB A;  4B9S A;  2HNZ A;  4HTU A;  3TAQ A;  4DU4 A;  4E7H A;  3D2F B;  3MEC A;  5CR4 A;  1NGG A;  3DLB A;  1N6Q A;  3LAK A;  3KZB A;  4EZ9 A;  2BUP A;  2EX3 A;  2ASO A;  1TL3 A;  5LL6 Z;  5AZJ A;  2WC9 A;  5AQT A;  1I94 K;  5EX5 A;  4NCA A;  4YDU A;  1DTT A;  4H5V A;  2PFU A;  3MCP A;  4KH5 A;  3J7Z O;  3UB5 A;  3PV8 A;  1QSL A;  3CFR A;  2H3G X;  3EL2 A;  1QQN A;  3AA3 A;  4GY2 B;  1B9D A;  2QWQ A;  4IEI A;  4QCL A;  3CG7 A;  4C8O A;  1SS6 A;  3I56 N;  4IJA A;  3SZ2 A;  3VEY A;  2WUS A;  2XY5 A;  1HJO A;  3P4I A;  3O4N A;  3NGZ A;  3PX4 A;  5CHI A;  1KCF A;  4YOX A;  4GVM A;  2VG6 A;  2UUA K;  1YIJ N;  4W5R A;  4K8X A;  4JEP A;  4I2Q A;  5BPM A;  3QER A;  5HRR A;  1NGI A;  3QLH A;  5TKY A;  1NNE A;  3LM9 A;  5AFU H;  1YHQ N;  5M1F A;  1IBK K;  3CYM A;  1GLF O;  2ZQB A;  5C24 A;  2QA4 N;  3QIP A;  3PX0 A;  3CHW A;  3N4Q A;  2RPI A;  1KD1 O;  5JIC A;  3K5M A;  3NF7 A;  1QZ5 A;  4BRN A;  1NK7 A;  2BAN A;  3BP8 A;  4RW7 A;  4AHU A;  3V1R A;  3HPH A;  3NH2 A;  3V4I A;  5HRP A;  3SUO A;  4DSI A;  1ASV A;  3MX2 A;  4CHO A;  5FRN A;  2JWK A;  4H03 B;  3PSI A;  2YJE A;  1Q7Y O;  4L3Q A;  4BRK A;  4JYA K;  4GKK K;  3ISN C;  4PA1 A;  1NGE A;  4BR4 A;  3OJS A;  1HNV A;  3CM6 A;  4WCE L;  1BUP A;  3DRS A;  3CCR N;  2IGI A;  1IKX A;  2E2N A;  3B6P A;  3F9K A;  4O44 A;  1GLA G;  2YKN A;  4DF8 A;  1BCO A;  1KAY A;  3FZM A;  4KI4 A;  3D2E B;  5KPT A;  1XNQ K;  4HVJ A;  5JVG L;  4KHP K;  5ADX A;  4CIF A;  4DTN A;  1A5X A;  1BCM A;  1ITG A;  4FWL A;  2O8E A;  1SZ2 A;  3NGI A;  3SJJ A;  4WQ5 A;  3JXU A;  2Y1I A;  1I3A A;  4CEQ A;  1BQM A;  3AVB A;  3KD1 E;  1ATN A;  4CK3 A;  4C8K A;  4LF6 K;  2E2O A;  3K59 A;  4CI6 A;  3WEE B;  3QFP A;  2W40 A;  4ID1 A;  2PY5 A;  1ZBU A;  4H5R A;  4B9U A;  2LSN A;  1EO1 A;  4IZ9 A;  1YI2 N;  4YOU A;  2UXD K;  4DTU A;  3OJU A;  3MEG A;  4C8N A;  4IOA L;  2KFN A;  3ZT4 A;  3I8D A;  5T7B A;  5GAE P;  3OYH A;  4BRA A;  3ID8 A;  1C0U A;  3I0S A;  1U2V A;  4DLG A;  3K9K A;  1VQO N;  2AA4 A;  5EVZ A;  3ZSV A;  1IBL K;  5BPN A;  4FWS A;  4FLX A;  4H4O A;  2J4R A;  1SL0 A;  1QSY A;  1FW6 A;  4H0P A;  4M3Y A;  1JLA A;  2OAN A;  2KZM A;  2O8F B;  2E88 A;  3QNN A;  1XMO K;  4JI4 K;  4KO0 A;  3PO5 A;  3IKM A;  1NKC A;  3FR0 A;  1RT1 A;  3ZET A;  5AQU A;  1EET A;  1BOT O;  3B8A X;  2FSJ A;  3MWP A;  5M1O A;  4FJM A;  3VEX A;  3CCU N;  4CFB A;  1RIL A;  4KH4 A;  3ALY A;  1BI4 A;  4B3T K;  4EAH D;  4FJK A;  4FJ8 A;  5BN8 A;  3AA2 A;  4FXD A;  3GG4 A;  4FW2 A;  4CZJ A;  1JJ2 M;  5HOO A;  1BDG A;  4C23 A;  1JL2 A;  3RSE B;  1WSE A;  3UKR A;  4FK4 A;  4CIE A;  3TAM A;  3S3M A;  1K9M O;  2V52 B;  4WFN L;  4HUG A;  1V4S A;  4DLE A;  1SKR A;  4KAZ A;  5HL7 L;  1ZC6 A;  4G1Q A;  1X9S A;  5FPD A;  1WUA A;  4DR1 K;  2A5X A;  1XHZ A;  5GIO A;  3ENB A;  2IVP A;  4JKA A;  4MO5 A;  3KLH A;  4DTS A;  1N34 K;  3HRG A;  5JLF A;  2Y1J A;  1CZ9 A;  1J6Z A;  1VQ7 N;  3AO4 A;  2D5R A;  2E6L A;  2DY4 A;  4CJS A;  1IKW A;  4F8R A;  4CF1 A;  2O8D B;  1JLE A;  4H0X B;  5D3G A;  4N47 A;  2XRI A;  1IO2 A;  4XH5 A;  1XMQ K;  3DRP A;  2P9L A;  5M1N A;  3NH1 A;  1OH5 A;  2QTD A;  4DR2 K;  1IKY A;  3ASM A;  1ZBH A;  1EX4 A;  3DXM B;  4DF4 A;  3VQD A;  1XUP O;  3WXI A;  5KTQ A;  2CH5 A;  3A5N C;  5KGW A;  1C0G A;  4CHY A;  1ZBI A;  1T6D A;  5SWM A;  4JRQ A;  1TUU A;  3LAM A;  1ZYQ A;  3JAM O;  4FZY A;  4IKF A;  4HWI A;  4M42 A;  2P9I B;  2YI1 A;  5JVH L;  1LV5 A;  4MFB A;  4YY3 K;  3WNH A;  4A5A A;  4BG8 A;  3PLA A;  1CZB A;  1GLE G;  1GLL O;  1NGD A;  1HX1 A;  3H45 C;  4JI7 K;  3EN9 A;  4PQU A;  2HVI A;  4YOV A;  2UXC K;  2O8F A;  4LH5 A;  4QAG A;  2VWK A;  1O13 A;  3SCX A;  4CF2 A;  3LPT A;  4BR7 A;  3VES A;  4GV6 A;  3SUQ A;  4ICL A;  4DFM A;  1UOC A;  2GWJ A;  3U3Y A;  4B9M A;  1LAW A;  3ZSR A;  3HP9 A;  5AQN A;  1TL1 A;  3O9Q A;  4U67 L;  5I3U A;  3FZL A;  4CGF A;  3V1O A;  1BI4 B;  4R5P A;  2XY6 A;  2A1R A;  1K73 O;  1XNR K;  3T1H K;  2OPQ A;  5BRE A;  3MN6 A;  1SUQ A;  2YNF A;  4DTP A;  1UWB A;  4I7F A;  1DTQ A;  4DSL A;  1BWF O;  3VQ6 A;  2NRW A;  1ZXO A;  3KK2 A;  4OGC A;  4K0K K;  3C7N A;  2B5J A;  2E8A A;  1S9G A;  3BF1 A;  4BRD A;  3VQ7 A;  5I9E B;  1TAU A;  3AVF A;  3RTV A;  4YOW A;  1K6Y A;  2RKI A;  4CK2 A;  3LP2 A;  4KTZ A;  4CGI A;  4EP5 A;  3AVA A;  3QO9 A;  3T1Y K;  3LZJ A;  3W0L A;  3VQ9 A;  3OY9 A;  4WF9 L;  3KWI A;  4Y1C A;  3QEW A;  2I7N A;  4DSK A;  5FRO A;  1J5E K;  4M3W A;  3DXK A;  3TU5 A;  3PX6 A;  5FPM A;  5HRO A;  2PBD A;  3GBT A;  4FJ9 A;  2NRT A;  3OBW A;  4OVL A;  4LC9 B;  3VQ4 A;  3OW2 M;  4KHY A;  2ZD1 A;  3DLG A;  4B9L A;  1SL2 A;  4BWJ A;  4BG9 A;  1HNI A;  1NOZ A;  4ZTF A;  3AVG A;  4DV7 K;  4DR7 K;  4AH9 A;  1NK5 A;  3RMC A;  3MAQ A;  3SUP A;  1NJZ A;  4FVM A;  4JI6 K;  4M7Y A;  3VTH A;  1YUW A;  4CJW A;  3DLH A;  3U9Z A;  5AZI B;  5DM7 L;  2VCP A;  1MWK A;  3OYL A;  2E4L A;  3D2F A;  1LWC A;  1ZBS A;  5AQW A;  2F8S A;  3OS0 A;  4CF9 A;  2KHO A;  4F2S A;  4M45 A;  3DOK A;  2OPR A;  1VQN N;  3TAP A;  1EWQ A;  1YF5 L;  5AJ3 K;  4DFP A;  3VET A;  1BIS A;  1RDC A;  3AO1 A;  4FJ5 A;  2ZM6 K;  4CEO A;  3NVM A;  1WSJ A;  4KI6 A;  4DQS A;  2VWJ A;  4CHQ A;  4F3T A;  3KK3 A;  1FJG K;  4WQ4 C;  4CJL A;  3N4P A;  3BDP A;  3HJF A;  4H0Y B;  4NLB A;  4FLY A;  2NRV A;  3DYA A;  1S1V A;  4CJQ A;  3SV4 A;  3M8Q A;  4H8K A;  1NK0 A;  1HPM A;  3ID6 A;  4FSV A;  4IO8 A;  4H0V B;  4BVP A;  5C2D A;  4EZ6 A;  1R0A A;  1JCG A;  3BZC A;  4OPJ A;  5FDL A;  1L5U A;  4JKB A;  2P9U A;  4IG3 A;  4B1X B;  4C8M A;  4GV9 A;  4BC3 A;  5CZ1 A;  2V7Y A;  5HP1 A;  4ZTJ A;  2HHW A;  4OLB A;  3S41 A;  5KI6 A;  1DEJ A;  3OYE A;  1V4T A;  3P39 A;  2FBY A;  4KHW A;  4IJN A;  4BRQ A;  2YHB A;  4MDB A;  3TR8 A;  2GUI A;  4DSF A;  1KVC A;  2FXU A;  1DKG D;  5K14 A;  2G8F A;  1W97 L;  4CJF A;  4JI1 K;  4F4K A;  1N8R O;  3O9R A;  3OVN A;  1JCE A;  4EHT A;  4CFD A;  2EHG A;  5FRM A;  2I7P A;  4HCB A;  2RHK A;  4CK1 A;  2DFE A;  4NCG A;  2P9P B;  2O8C B;  3OS2 A;  3ATV A;  1DT9 A;  4ELT A;  4DV1 K;  4CHP A;  4FWP A;  4CBX A;  2B4J A;  3SAH A;  1Y97 A;  5EOY A;  2FF3 B;  3PO4 A;  3L6Q A;  1OH7 A;  1QZ6 A;  1JKH A;  3BZK A;  2VQF K;  4O0I A;  4BRF A;  3VQQ A;  3K9J A;  1EWR A;  1RBU A;  2VGN A;  1WBB A;  3HTV A;  4E1M A;  1NJY A;  4CF8 A;  1VSH A;  3D0P A;  5AZI A;  4OPH A;  4Z4F A;  3CI5 A;  3U8X A;  3M5R A;  5AQR A;  4JK9 A;  1L3T A;  4H4M A;  1L3S A;  3NAE A;  3O3H A;  4HUE A;  4FM2 A;  4ILJ A;  2FF6 A;  1G15 A;  1WSI A;  2R7Y A;  3CF5 L;  4IDK A;  3OS1 A;  3HI0 A;  4N41 A;  4KHN A;  3A5M C;  4FZX C;  2Q36 A;  5E26 A;  3D6R A;  4LF7 K;  2OPS A;  3UKU A;  5KPR A;  3SPY A;  2XHB A;  1M1K O;  2HB5 A;  2IVN A;  4CZI A;  3DLR A;  2BTF A;  1OH6 A;  3L4I A;  2WBN A;  4O5B A;  3WEE A;  4DTO A;  4X64 K;  1C0M A;  5AQJ A;  3TTF A;  3T69 A;  4EP4 A;  4A5B A;  1HKG A;  4F9O A;  3H3N O;  1LOT B;  1Q18 A;  4JI3 K;  3A5L C;  4FPB A;  5J1E A;  4KRF A;  4N76 A;  2ITM A;  3B6O A;  4JD2 A;  5KQ8 A;  4F3O A;  1KVA A;  1BIZ A;  1KTQ A;  2GBZ A;  2WOM A;  2IVO A;  4JK8 A;  4AF1 A;  2HND A;  1LW2 A;  3WXJ A;  3IS9 A;  3LDL A;  2FBT A;  3G25 A;  4E7J A;  4JKH A;  3LP3 A;  3MMV A;  3ZET B;  3QEX A;  1TK8 A;  4FO0 A;  3T1A A;  4FM1 A;  3DLK A;  4CJV A;  1XHX A;  2GEL A;  1U04 A;  3KKS A;  3CJB A;  3FFI A;  3QET A;  4RTF D;  1E3M A;  4CEB A;  5I42 A;  4BC2 A;  3THX A;  1S22 A;  1TK5 A;  3VQP A;  1N33 K;  1Q8I A;  3HPG A;  1QVF M;  1Q82 O;  1X3N A;  2OZS A;  4IFY A;  3VOV A;  4FWN A;  3TSU A;  4HHT A;  4DKW A;  1RTI A;  3P83 D;  1NJW A;  2P5O A;  2W42 A;  2B6A A;  3CER A;  1KFS A;  3E01 A;  3P5J A;  4JKG B;  1C1B A;  4BQL A;  4CBU A;  2KTQ A;  1RDW X;  4DV6 K;  4BRH A;  3UE5 A;  4WFB L;  4BDP A;  1ZBF A;  4IFE A;  2OTJ N;  4CIG A;  1VK0 A;  3MN7 A;  3KLI A;  3THY A;  1YT3 A;  4B1W B;  1N5Y A;  1N36 K;  1YXQ A;  2NNW A;  3QEV A;  1RDU A;  4KHQ A;  2KZZ A;  1ASU A;  5JS2 A;  3VGK A;  1B9F A;  4CFC A;  1NKE A;  3LDQ A;  4PUO A;  4A57 A;  1LCU A;  4GMJ B;  3KK7 A;  2FLO A;  1NG9 A;  2WON A;  4FYD A;  2E5L K;  1RDA A;  4B9N A;  1TVR A;  3PSF A;  4OX9 K;  3ZSO A;  4CZF A;  3S3N A;  2QEX N;  3ZEU A;  3Q7B A;  1J54 A;  1CXQ A;  3P31 A;  3VQE A;  3WXL A;  3VQ5 A;  3OYG A;  3SJH A;  1WAF A;  1K8K B;  2OTL N;  4JD2 B;  4OKE A;  2DPN A;  4OJR A;  4IOX A;  4FOE A;  3NFA A;  3NCI A;  2W41 A;  3BUZ B;  4BRO A;  3OYM A;  3CFO A;  3LWL A;  1QQM A;  1WSF A;  2RF2 A;  2HMP A;  1LW0 A;  2A6A A;  2ETJ A;  2QWL A;  3QIN A;  2QK9 A;  4JRP A;  4DV3 K;  3TAE A;  4PKH A;  3AO3 A;  5DM6 L;  3WT0 A;  1SV5 A;  4FJL A;  3LAN A;  1S1U A;  1EQY A;  4CEE A;  3JYT A;  4CBW A;  3VA0 A;  4PHT X;  1JCF A;  2E20 A;  3M3Z A;  1QS4 A;  3DJC A;  1YAG A;  3L0Q A;  2HHV A;  3PUF A;  4RG8 A;  3TSQ A;  4YFU A;  3HO1 A;  2YKM A;  3C7N B;  1D5A A;  1RCH A;  5BRH A;  2WFB A;  4ILG B;  1S72 N;  3IDH A;  3C6U A;  5AQX A;  3SBG A;  4FJ7 A;  3ZSZ A;  4QS7 A;  3MXJ A;  4F2R A;  3NE6 A;  5F2R A;  2GWK A;  4LF8 K;  2RE2 A;  3AVC A;  3TI0 A;  3QB0 A;  2HHS A;  3THY B;  5C10 A;  1S1T A;  5AQP A;  1ATS A;  1S1W A;  4TSX A;  4FLU A;  4M3U A;  4IWV A;  3V81 A;  5H1S Q;  3H6E A;  4M3Z A;  3OA9 A;  1BGX T;  2VWB A;  3EY1 A;  4AHR A;  1HJR A;  1QTM A;  2HF4 A;  3AVM A;  3DOL A;  1WSG A;  3KTQ A;  4W5T A;  1SAZ A;  4CGJ A;  4O5F A;  3VN5 A;  3CC2 N;  4KH6 A;  5GIP A;  2VQE K;  4CZG A;  3R3L A;  1BQN A;  3E1Y A;  1XQS C;  5IT9 O;  4W5Q A;  1HUX A;  3AVK A;  1JLQ A;  1OKJ A;  4E19 A;  2BE2 A;  2VGM A;  3O80 A;  3O3G A;  3DMJ A;  4E7L A;  3TAG A;  2Q1N A;  3AVJ A;  4KRE A;  3H46 O;  2NRX A;  4LF9 K;  1JLF A;  1Q9Y A;  2Q2R A;  5KQD A;  2A1S A;  3D45 A;  1K8K A;  1NOY A;  2G8H A;  2P51 A;  4CER A;  2O8B B;  4FVU A;  3NF9 A;  4A2A A;  3SI6 A;  5A2Q O;  4I6M A;  4IXC A;  4DB3 A;  3OYI A;  1VQM N;  2YX6 A;  4CZK A;  1VQ8 N;  1NJI O;  3FZH A;  4CGD A;  2OA8 A;  4JKF A;  3V9W A;  4DQI A;  2UUC K;  4HTL A;  3CPW M;  1YVN A;  4WQ5 C;  1VSF A;  3TPQ A;  4Z4H A;  3VQB A;  2O8E B;  1SKW A;  3K5N A;  3BEX A;  3T7Z A;  3DLE A;  4CEF A;  4JS4 A;  4ELV A;  2D4W A;  2NLX A;  1VSL A;  4ISG A;  1JLC A;  4WQ4 A;  1A5V A;  3TTC A;  3K58 A;  3OTO K;  4J2D A;  1IKV A;  2XO7 A;  3QNO A;  4MQ3 A;  4A2B A;  4E89 A;  4FCY A;  2QWN A;  3ZX0 A;  4A61 A;  4DSJ A;  2QXF A;  5EY4 A;  3DAW A;  3WNG A;  1ESV A;  1HQE A;  4YNQ A;  3OYC A;  2A3Z A;  4IOC L;  5AQV A;  3A0I X;  2HST A;  3CQ8 A;  2GEM A;  1RDB A;  3H08 A;  5BN9 A;  4LFB K;  1IV0 A;  3ZX3 A;  1RT4 A;  1K8A O;  1G99 A;  4LF5 K;  5AQL A;  1IBM K;  1VHX A;  3E9O A;  1YJ9 N;  1WN7 A;  2VG7 A;  1UA0 A;  3BY5 A;  1BIU A;  1T7P A;  3QBX A;  3M8S A;  1HRH A;  4JKE A;  3A5O C;  3GE1 A;  3C6H A;  4K42 A;  5GAG P;  4CZL A;  4CEA A;  4DQ8 A;  4YOR A;  3IFR A;  4BC4 A;  4DQP A;  3RR7 A;  2HHH K;  1Z25 A;  3LP1 A;  4FWR A;  1T44 A;  2QWP A;  5M1P A;  1D8Y A;  1RNH A;  1WB9 A;  5AQQ A;  1VQ5 N;  2W6L A;  2YJF A;  1BO5 O;  3VGL A;  1HYZ A;  2O4G A;  4FLZ A;  3VEW A;  4UY8 O;  3A2F A;  1T8E A;  3I8B A;  1QQO A;  3IRX A;  3MX5 A;  4FJN A;  5LMU K;  4FJH A;  1GLD G;  1RBR A;  1SQK A;  1VQL N;  1NMN A;  3ZYY X;  3AVI A;  4DU3 A;  1Q86 O;  1TYQ A;  4GKJ K;  3MXI A;  3UKU B;  5AQH A;  3DXK B;  4JS5 A;  2CGK A;  2NRR A;  4L8R B;  3O8M A;  3CCS N;  1TV6 A;  3LDP A;  4FW1 A;  1L3U A;  5DMR A;  1QHA A;  3TAN A;  1X9W A;  3EYZ A;  2CH6 A;  4B3M K;  4GV3 A;  4H5T A;  1KAZ A;  4CD3 A;  4K8Z A;  1HKC A;  3FGU A;  4CFA A;  1RT7 A;  4BQZ A;  2ASP A;  3SNN A;  2P9L B;  3NDK A;  1TKZ A;  2CGJ A;  2PYJ A;  1GOC A;  4M3X A;  2Z1G A;  1Z26 A;  3DXM A;  3AV9 A;  1FKP A;  4RW8 A;  3K5O A;  4FM0 A;  4V19 S;  4ISF A;  1JXE A;  1UAX A;  5CYQ A;  3IG1 A;  1RT6 A;  2X78 A;  3RWU A;  3SUN A;  5C0Y A;  5HBM A;  2AP1 A;  3VPZ A;  1RTJ A;  4BR0 A;  5KPZ A;  2X74 A;  3THW A;  4C8L A;  3ZT0 A;  1W7A A;  2QKK A;  1MDU B;  2QKB A;  3NVK A;  4NYN A;  3WQT A;  3LPU A;  1HR0 K;  4DV4 K;  2X6S A;  3CMA N;  3CCJ N;  3VF6 A;  3VEZ A;  5J2M A;  1NLV A;  4LD0 A;  3ZSQ A;  3VTI A;  1EKE A;  2NRH A;  1WAJ A;  3QEP A;  5J2Q A;  1DGK N;  3ZT3 A;  4Z4E A;  4B3O A;  3SAF A;  4QS8 A;  3W3D A;  4AQY K;  3SQ1 A;  2D0A A;  3IMX A;  2V51 B;  1KFD A;  1KVB A;  1HLU A;  3CC7 N;  4OPK A;  3HK2 A;  2A41 A;  3QML A;  4FWK A;  2ZGY A;  2HBJ A;  3QDK A;  3AAP A;  4FOI A;  1M90 O;  4U7B A;  2P9U B;  4Y0W A;  4NO7 A;  4JKG A;  3P1G A;  4CCH A;  5HRN A;  4IO9 L;  1TKX A;  1HMV A;  3DLL L;  4OLA A;  4H0T B;  5LMN K;  1OVY A;  3SYZ A;  2PZS A;  4HCC A;  4JV5 K;  2UXB K;  2IIR A;  3U4L A;  3F9M A;  3OYJ A;  4DFK A;  3EEQ A;  3RMA A;  3QES A;  1NK6 A;  4FZZ A;  4JK7 A;  2PAV A;  1Z6R A;  3L4Q A;  4WFA L;  1VSI A;  3LDN A;  2IAJ A;  4AIL C;  3KWG A;  1WSH A;  1GLB G;  4R79 A;  3WNF A;  3KD5 E;  3G10 A;  1J53 A;  3L2Q A;  4AHC A;  1Y64 A;  3MCA B;  1NMD A;  3EKS A;  2FC0 A;  2YHW A;  1EXQ A;  3O9T A;  3C65 A;  3CJA A;  4KBO A;  3LDS A;  5AFU A;  4CHN A;  1NBW A;  3F73 A;  2ITG A;  1S9E A;  3PIO L;  4CJU A;  3C0B A;  4DV0 K;  1N32 K;  2UU9 K;  4H5W A;  1XWL A;  2E1Y A;  4AHS A;  4FJG A;  1S5J A;  4XH4 A;  3V9X A;  1KXP A;  3JSM A;  3O9S A;  4JI2 K;  2HOE A;  3AA5 X;  4KHS A;  2D0P A;  3SMP A;  5CZ2 A;  3QBW A;  4QS9 A;  3L3U A;  5C15 A;  1BA0 A;  3JS6 A;  3ZT1 A;  1S1X A;  3D7E O;  1NU0 A;  2FSK A;  1HPZ A;  4Z4C A;  4PWD A;  2KKZ A;  1OVQ A;  2KLA A;  3OHR A;  1X3M A;  3PIP L;  3CCL N;  4CJ4 A;  1WLJ A;  2P9S A;  2HBM A;  4PKG A;  4BGB A;  1U4B A;  4BDY A;  2GX9 A;  3VQA A;  3H1V X;  2AJQ A;  3J80 O;  4DQR A;  3DM2 A;  1JXB A;  2F7T A;  1Q81 O;  4Q0B A;  4KTQ A;  1VRU A;  4JKD A;  4B1U B;  3MN9 A;  3CQY A;  2NZT A;  3CM5 A;  5F0X A;  3I55 N;  5CYM A;  3TAF A;  4M3T A;  2JLE A;  4K25 A;  1JL1 A;  4B08 A;  2HBK A;  1VQ4 N;  1D9D A;  5M1Q A;  5MLC Q;  3MDQ A;  1HNW K;  3IUC A;  4JN4 A;  3E66 A;  1X9J A;  3S9H A;  2P9K B;  1QSS A;  1CLQ A;  4JLH A;  4NB4 A;  1NWK A;  3CC4 N;  3G71 N;  1H1V A;  3VF4 A;  3G6E N;  1RT3 A;  4B3S K;  3CME N;  4M7X A;  5BR9 A;  1HNX K;  3FLC O;  3ATU A;  3O4Q A;  1RBS A;  4BRE A;  4CGH A;  3VEO A;  3R8E A;  1S3X A;  3CCM N;  5CY4 A;  3AO5 A;  3HOT A;  5TKW A;  3O1B A;  4XH1 A;  3HM8 A;  3HST B;  2WTU A;  4OPA A;  2P9N A;  2O8C A;  3HXM A;  4JHD A;  3NH0 A;  5HRS A;  4KPY A;  4DUY K;  4JKC A;  1NGC A;  2QWR A;  5GIN A;  1WOQ A;  3AVN A;  3VEN A;  1TKT A;  2DFF A;  3P38 A;  5E41 A;  4O4G A;  5AQG A;  1IH7 A;  5KRT A;  5KRS A;  3RRG A;  1E4G T;  4GNI A;  4NCB A;  2DFH A;  4Q5V A;  3G0Z A;  4MLE A;  1O1W A;  1C1C A;  4KHU A;  1NK9 A;  1LAV A;  3BF3 A;  3C6T A;  4DS5 A;  3HBT A;  1RT5 A;  2F9T A;  1CXU A;  3KHY A;  2BH1 A;  1GLC G;  1NGF A;  3E9P A;  4A62 A;  4QOZ B;  2Q0R A;  3GOI A;  3LZI A;  5AZJ B;  5AR0 A;  4XIU A;  4BVO A;  4CVN E;  2QWM A;  2P5G A;  1YJN N;  2ZJP L;  4ELU A;  3MED A;  4I2P A;  1D4X A;  4XEI A;  3M6G A;  4MLH A;  1MA9 B;  3HP6 A;  3EZW A;  1VSK A;  3VGM A;  2V7Z A;  4BR5 A;  1YTA A;  3NGY A;  1JLB A;  4AM7 A;  4B9T A;  3ZSY A;  4BRP A;  4FJJ A;  3EO3 A;  3AGR A;  3OBY A;  1EP4 A;  3ZEU B;  4BWM A;  4CJR A;  1IJJ A;  4C1N I;  4WYB A;  1U2V B;  4IFV A;  3V9Z A;  4O55 A;  5IWA K;  4NLC A;  3RR8 A;  3CET A;  1TGO A;  2F96 A;  3AVL A;  5J2N A;  5F1X A;  5GAH P;  3O6W A;  4DTX A;  3FZF A;  4DU1 A;  1TK0 A;  2HNY A;  2XY7 A;  3CIP A;  3VF2 A;  3ULD A;  1R59 O;  5SZT A;  2HHU A;  3L2U A;  3K2P A;  3HM9 A;  3FFK B;  3O4W A;  2YCH A;  4DV2 K;  2ZE2 A;  4JHD B;  3SK3 A;  5LJV A;  3LWM A;  4EIA A;  2QM1 A;  4YHH K;  4J8F A;  2BDP A;  1NM1 A;  2HF3 A;  1SKS A;  1U49 A;  4HUF A;  4BR2 A;  3THX B;  1I39 A;  2YNH A;  3KK1 A;  2ZWH A;  3DRR A;  3ZLJ A;  4BE2 A;  1WNS A;  4DSE A;  1NGH A;  3H1Q A;  4OKJ A;  1C0T A;  3QFU A;  3KIO A;  4B1V A;  3OYN A;  1Q9X A;  4JI0 K;  3L3V A;  2VYP A;  4W5N A;  1CZA N;  4KFB A;  2YHA A;  3VEV A;  3D2E A;  1MU2 A;  3CQX A;  3R1X A;  3RMD A;  4JAX A;  1W0H A;  4N56 A;  4DV5 K;  3SMS A;  3ITH A;  2HVH A;  2F8T A;  4KB0 A;  1C6V A;  3SBT A;  3PY8 A;  4E1N A;  1TAQ A;  5AQY A;  2IS3 A;  3O08 A;  3HVR A;  4FWO A;  3Q7C A;  3CCE N;  1REV A;  3EKU A;  4A59 A;  4I9L A;  1SL1 A;  3A8Y A;  3CJC A;  2IDO A;  3OYA A;  5LY3 A;  1NKB A;  1B92 A;  3QEI A;  4CZE A;  4JI5 K;  3GL1 A;  3C94 A;  1VRT A;  3F5T A;  1KLM A;  4ILH A;  3U9D A;  5E84 A;  1FXX A;  1HYS A;  2O8B A;  2Q0U A;  3THW B;  3TSP A;  2FSN A;  2VG5 A;  4GW6 A;  1RTH A;  2OPP A;  1XC3 A;  3KKR A;  4I6M B;  4FL9 A;  3O1W A;  3SQ4 A;  2D1K A;  3HT3 A;  3G4S N;  3FZK A;  3TAR A;  3VER A;  1ZBL A;  4CJ3 A;  5FLX O;  3KLG A;  3OYB A;  2GUP A;  3DI6 A;  4YOY A;  5JS1 A;  3KLF A;  4CJ7 A;  1VAZ A;  2Q3S A;  4DR3 K;  2W6K A;  3K57 A;  3NF6 A;  2GV9 A;  3ZSW A;  2FBX A;  3HYF A;  3O9U A;  3RSE A;  2KQ2 A;  1ILY A;  4LSN A;  4CJP A;  4B8C A;  1T3V A;  2E1Z A;  3CFP A;  1YJW N;  5C2F A;  4X62 K;  1BA1 A;  4CGG A;  3LM2 A;  4W5O A;  3RVC A;  1U6Z A;  1BHL A;  4KKO A;  5M1K A;  2ZJR L;  4E1J A;  3J7A P;  3H3O B;  3E9L A;  4CES A;  4CEZ A;  4CF0 A;  4RW9 A;  3SAG A;  1NGJ A;  2E6M A;  3VQC A;  4LFC K;  2E2P A;  4B8A B;  4EHU A;  4CJE A;  2OCE A;  3FE1 A;  1KRP A;  3SQ2 A;  2KW4 A;  3RRH A;  4PL8 A;  3SQ0 A;  4X65 K;  1L3V A;  4ZHR A;  4FJI A;  2JWL A;  1VQ9 N;  4DR4 K;  3THV A;  3K0S A;  2NRZ A;  4O8U A;  4CZM A;  2QXL A;  3LAL A;  2YNI A;  4BRC A;  5EU7 A;  2Q97 A;  2ASM A;  2HHQ A;  4MDA A;  3I33 A;  4BE0 A;  1F21 A;  4JI8 K;  4Z4G A;  3HZ6 A;  3GDQ A;  1NGA A;  3AVH A;  3LL3 A;  3T19 A;  1BL3 A;  1RDD A;  4LFA K;  2IC3 A;  2HBL A;  3HSC A;  4BAC A;  4KTW A;  1QQC A;  4CEC A;  1YVU A;  4MO4 A;  1C1A A;  3C95 A;  4K41 A; 
#chains in the Genus database with same CATH homology
 1VSI A;  1GOB A;  2IAJ A;  4AIL C;  4DTU A;  1WSH A;  3OJU A;  3MEG A;  4CEB A;  2Z1J A;  5I42 A;  4J2B A;  4N5S A;  4C8N A;  1W9H A;  3WNF A;  1UA1 A;  1VSM A;  3KD5 E;  3G10 A;  2D0B A;  3ZT4 A;  1J53 A;  1U48 A;  3I8D A;  1TKD A;  3L2Q A;  2KFN A;  5T7B A;  1TK5 A;  2IOC A;  4LH4 A;  3S3O A;  3OYH A;  3VQP A;  1Q8I A;  3HPG A;  4AHC A;  1C0U A;  3I0S A;  3EZ5 A;  2OZS A;  4IFY A;  4IBN A;  4HHT A;  4DLG A;  2FC0 A;  1RTI A;  3P83 D;  4CJK A;  1EXQ A;  1VSJ A;  1NJW A;  3ZSV A;  2P5O A;  2W42 A;  2G8I A;  4FLX A;  2B6A A;  3LDS A;  4H4O A;  4CHN A;  3F73 A;  1SL0 A;  1QSY A;  1KFS A;  2ITG A;  3E01 A;  4RW6 A;  1S9E A;  3P5J A;  4M3Y A;  1C1B A;  1JLA A;  2KZM A;  4CJU A;  1J9A A;  1FK9 A;  1DLO A;  2KTQ A;  3QNN A;  1XWL A;  4BDP A;  4AHS A;  4FJG A;  1ZBF A;  4KO0 A;  1S5J A;  3V9X A;  3PO5 A;  1NKC A;  3UIQ A;  1RT1 A;  4KB1 A;  3JSM A;  4E7K A;  3HVT A;  4CIG A;  1VK0 A;  1EET A;  4E7I A;  3KLI A;  1YT3 A;  4KV8 A;  1N5Y A;  1KSP A;  3AA5 X;  4FJM A;  4KHS A;  4CFB A;  1RIL A;  4CE9 A;  3QEV A;  3ALY A;  1BI4 A;  5CZ2 A;  3U3Y A;  4KHQ A;  4FJK A;  3ZT2 A;  4FJ8 A;  2KZZ A;  1HYV A;  3L3U A;  3AA2 A;  1ASU A;  4FXD A;  4FW2 A;  5JS2 A;  1QHT A;  3ZT1 A;  3OYD A;  1B9F A;  1S1X A;  1S6P A;  4CFC A;  5KGX A;  4QOZ B;  1NKE A;  4Y1D A;  4PUO A;  3U3G A;  4AHV A;  1JL2 A;  1WSE A;  1HPZ A;  4GMJ B;  4WE1 A;  4Z4C A;  4FK4 A;  4PWD A;  4CIE A;  3TAM A;  3S3M A;  2WON A;  4FYD A;  1RDA A;  3V6D A;  1TVR A;  4CJ4 A;  4B9N A;  4HUG A;  1XC9 A;  4DLE A;  1SKR A;  2HHT A;  1WLJ A;  4KAZ A;  2ATQ A;  3ZSO A;  4G1Q A;  1U4B A;  2G8U A;  4BDY A;  3VQA A;  1X9S A;  3S3N A;  2HMI A;  2AJQ A;  2OYQ A;  1RBT A;  1XHZ A;  1RT2 A;  1J54 A;  4DQR A;  4RW4 A;  3KJV A;  1CXQ A;  3DM2 A;  3VQE A;  4FLW A;  1JXB A;  4Q0B A;  3KLH A;  3VQ5 A;  1QE1 A;  3OYG A;  3WNE A;  4DTR A;  4I9Q A;  4DTS A;  1VRU A;  4KTQ A;  1JLG A;  1WAF A;  3HPO A;  2KFZ A;  2Y1J A;  1CZ9 A;  3AO2 A;  3CM5 A;  5CYM A;  3TAF A;  4OKE A;  4M3T A;  2YNG A;  2JLE A;  1JL1 A;  2G8K A;  3AO4 A;  4OJR A;  4B08 A;  4J2E A;  2YV0 X;  2D5R A;  2E6L A;  3NFA A;  4M3R A;  1D9D A;  3NCI A;  2BGG A;  2DY4 A;  3OYM A;  4CJS A;  1IKW A;  4F8R A;  4CF1 A;  1JLE A;  3CFO A;  2G8V A;  4M41 A;  3LWL A;  3S9H A;  5D3G A;  3V1Q A;  1WSF A;  2RF2 A;  4N47 A;  2XRI A;  1IO2 A;  1LW0 A;  1QSS A;  2PYL A;  1CLQ A;  2ETJ A;  3ZSX A;  3QIN A;  2QK9 A;  4JRP A;  4JLH A;  1ASW A;  3DRP A;  3TAE A;  5HLF A;  3NH1 A;  3AO3 A;  1SV5 A;  1RT3 A;  1IKY A;  1S6Q A;  3ASM A;  4O0J A;  4FJL A;  2I5J A;  1EX4 A;  1ZBH A;  1X9M A;  3LAN A;  3K5L A;  4DF4 A;  1S1U A;  3VQD A;  4CEE A;  3JYT A;  1HQU A;  5KTQ A;  3L8B A;  1GOA A;  5KGW A;  4CHY A;  4FLT A;  3O4Q A;  1ZBI A;  1RBS A;  4CGH A;  5SWM A;  4JRQ A;  4PY5 A;  4OKK A;  3VA0 A;  2HHX A;  5CY4 A;  3LAM A;  4IKF A;  1ZYQ A;  4E3S A;  4B9V A;  4FZY A;  3AO5 A;  4UQG A;  4M42 A;  2Z1H A;  1QS4 A;  2HHV A;  4FJX A;  3PUF A;  4RG8 A;  3L2W A;  4MFB A;  1LV5 A;  3WNH A;  4YFU A;  3HST B;  4OGE A;  4CJT A;  1CZB A;  3HO1 A;  3HXM A;  3NH0 A;  2YKM A;  5HRS A;  1NK8 A;  4KPY A;  1D5A A;  1RCH A;  2Z1I A;  3AVN A;  4DS4 A;  4PQU A;  2HVI A;  1TKT A;  4Z0U A;  3NF8 A;  2DFF A;  3KLE A;  3C6U A;  5E41 A;  4LH5 A;  4O4G A;  4QAG A;  1IH7 A;  1VSD A;  5KRT A;  5KRS A;  3V9S A;  3RRG A;  2VWK A;  4FJ7 A;  3ZSZ A;  3SCX A;  4CF2 A;  3LPT A;  3MXJ A;  4F2R A;  3NE6 A;  3SUQ A;  2XY8 A;  4ICL A;  4DFM A;  1U47 A;  3U6F A;  1UOC A;  4FK0 A;  2DFH A;  4DMN A;  4Q5V A;  3G0Z A;  3M8P A;  1O1W A;  1C1C A;  1LAW A;  3AVC A;  4LSL A;  3ZSR A;  3HP9 A;  1NK9 A;  1LAV A;  3TI0 A;  1TL1 A;  5I3U A;  2HHS A;  4J2A A;  2HW3 A;  4DWI A;  3C6T A;  4DS5 A;  1S1T A;  4TSX A;  1S1W A;  4CGF A;  4FLU A;  1D9F A;  3V1O A;  4M3U A;  1RT5 A;  3V81 A;  4E0D A;  1BI4 B;  1CXU A;  4R5P A;  4FK2 A;  2XY6 A;  4M3Z A;  2A1R A;  3AA4 A;  1BGX T;  3VA3 A;  3TWH A;  3EY1 A;  2OPQ A;  4AHR A;  1HJR A;  3L2V A;  1SUQ A;  2YNF A;  3V9U A;  1UWB A;  4I7F A;  1DTQ A;  4DTP A;  3VQ6 A;  1QTM A;  4DSL A;  1RBV A;  4LY7 A;  3AVM A;  3LZI A;  3DOL A;  1WSG A;  4XIU A;  3KTQ A;  4FLV A;  4W5T A;  4CGJ A;  3KK2 A;  4OGC A;  2P5G A;  3VN5 A;  5J2P A;  2G8W A;  5C42 A;  3MED A;  4ELU A;  4I2P A;  2O4I A;  5DK5 A;  3MEE A;  1BQN A;  2B5J A;  1S9G A;  3VQ7 A;  4W5Q A;  1TAU A;  3AVF A;  3RTV A;  3AVK A;  3VQ8 A;  1JLQ A;  1K6Y A;  2RKI A;  3MXM A;  4E19 A;  2BE2 A;  3HP6 A;  4CK2 A;  3LP2 A;  4KTZ A;  4CGI A;  4EP5 A;  3O3G A;  1VSK A;  3TAB A;  3DMJ A;  3AVA A;  1YTA A;  3NGY A;  1JLB A;  3QO9 A;  4NYF A;  3ZSY A;  4E7L A;  3TAG A;  3AVJ A;  3LZJ A;  4B9T A;  4Z4I A;  3BGR A;  1T03 A;  4BE1 A;  4FJJ A;  4KRE A;  1JLF A;  3VQ9 A;  5C25 A;  3OY9 A;  1Q9Y A;  3SPZ A;  2A1S A;  3D45 A;  1NOY A;  2G8H A;  4Y1C A;  2JGU A;  3QEW A;  4DSK A;  5FRO A;  2P51 A;  4M3W A;  4CER A;  1IG9 A;  1EP4 A;  3PX6 A;  3NF9 A;  4BWM A;  4CJR A;  5HRO A;  3SI6 A;  4FJ9 A;  4DG1 A;  1J5O A;  4OVL A;  3OYI A;  2P1J A;  4ID5 A;  3VQ4 A;  2DTU A;  4CGD A;  2OA8 A;  3NHG A;  4KHY A;  4B9M A;  4IFV A;  3V9W A;  2ZD1 A;  3V9Z A;  4O55 A;  3DLG A;  2X6N A;  4B9L A;  4DQI A;  1SL2 A;  1U45 A;  1VSF A;  1FKO A;  4AHT A;  3RR8 A;  4BWJ A;  4Z4H A;  4DQQ A;  1HNI A;  1TGO A;  1NOZ A;  4ZTF A;  1X1P A;  2F96 A;  3AVG A;  3AVL A;  3VQB A;  5J2N A;  1SKW A;  4AH9 A;  3K5N A;  1NK5 A;  2OZM A;  3RMC A;  4DTX A;  3QIO A;  3DLE A;  3MAQ A;  3SUP A;  2FBV A;  3NBP A;  1NJZ A;  4FVM A;  4CEF A;  4DU1 A;  1TK0 A;  2HNY A;  4JS4 A;  2XY7 A;  4ELV A;  4CJW A;  3DLH A;  3OYF A;  3ULD A;  3O3F A;  4BDZ A;  4NCB A;  1VSL A;  1JLC A;  1RTD A;  5SZT A;  1A5V A;  2HHU A;  3L2U A;  3K58 A;  3L2R A;  3K2P A;  3M8R A;  1IKV A;  2E4L A;  3OYL A;  3HM9 A;  2D0C A;  1A5W A;  2XO7 A;  3QNO A;  3RMB A;  1LWC A;  2ZE2 A;  1YTU A;  4MQ3 A;  2F8S A;  4E89 A;  3I0R A;  1VSE A;  4CF9 A;  1LWE A;  3OS0 A;  4CED A;  3LWM A;  4DFJ A;  1XI1 A;  1NJX A;  4M45 A;  4FCY A;  3DOK A;  4F2S A;  4DSJ A;  2QXF A;  1LWF A;  2BDP A;  2OPR A;  3TAP A;  1SKS A;  3WNG A;  3T3F A;  1U49 A;  1HQE A;  4YNQ A;  3ZCM A;  3OYC A;  3OYK A;  4HUF A;  1T05 A;  4DFP A;  1I39 A;  2YNH A;  3KK1 A;  1BIS A;  3DRR A;  1RDC A;  4BE2 A;  3AO1 A;  4FJ5 A;  3IAY A;  4CEO A;  1WNS A;  4DSE A;  1WSJ A;  4KI6 A;  4CJ5 A;  4OKJ A;  4DQS A;  3SV3 A;  2VWJ A;  3CQ8 A;  4CHZ A;  1NK4 A;  1RDB A;  4CHQ A;  4F3T A;  1C0T A;  3H08 A;  3KK3 A;  4IG0 A;  1RT4 A;  3HJF A;  2RN2 A;  4CJL A;  3BDP A;  3KIO A;  3OYN A;  4DTJ A;  1Q9X A;  1KLN A;  4FLY A;  3DYA A;  3L3V A;  1S1V A;  4CJQ A;  3HL8 A;  3LP0 A;  3SV4 A;  3M8Q A;  4W5N A;  1WN7 A;  2VG7 A;  4H8K A;  4DTM A;  1UA0 A;  1NK0 A;  1T7P A;  1BIU A;  4KFB A;  2YHA A;  3M8S A;  1HRH A;  2NUB A;  4B9S A;  4EZ6 A;  1R0A A;  1MU2 A;  2HNZ A;  4HTU A;  3TAQ A;  4OPJ A;  5FDL A;  3RMD A;  1L5U A;  4DU4 A;  4E7H A;  4CEA A;  3MEC A;  1W0H A;  4N56 A;  4DQP A;  3DLB A;  3ITH A;  3LAK A;  4IG3 A;  1Z25 A;  1N6Q A;  3RR7 A;  4EZ9 A;  2F8T A;  3LP1 A;  2EX3 A;  4KB0 A;  1C6V A;  4C8M A;  2HVH A;  5CZ1 A;  5HP1 A;  4ZTJ A;  3PY8 A;  1TL3 A;  2HHW A;  1D8Y A;  4OLB A;  1RNH A;  4E1N A;  1TAQ A;  5KI6 A;  2IS3 A;  3OYE A;  4NCA A;  3HVR A;  1DTT A;  1HYZ A;  1REV A;  2FBY A;  2O4G A;  4KHW A;  4FLZ A;  4I9L A;  1SL1 A;  2YHB A;  3TR8 A;  2GUI A;  3A2F A;  4DSF A;  3PV8 A;  1KVC A;  2IDO A;  1QSL A;  3CFR A;  5K14 A;  1T8E A;  3AA3 A;  3OYA A;  1B9D A;  3IRX A;  1NKB A;  2G8F A;  1B92 A;  4FJN A;  4CJF A;  3QEI A;  4FJH A;  4QCL A;  4F4K A;  3CG7 A;  4C8O A;  3OVN A;  3SZ2 A;  4CFD A;  2EHG A;  2XY5 A;  5FRM A;  3C94 A;  4HCB A;  4CK1 A;  2DFE A;  4NCG A;  1VRT A;  1RBR A;  3OS2 A;  1KLM A;  3O4N A;  3NGZ A;  4DU3 A;  3AVI A;  3PX4 A;  4ELT A;  1KCF A;  4GVM A;  2VG6 A;  3MXI A;  1FXX A;  4CHP A;  2B4J A;  1HYS A;  1Y97 A;  4JS5 A;  4L8R B;  4W5R A;  4K8X A;  1TV6 A;  2VG5 A;  4FW1 A;  4GW6 A;  1RTH A;  2OPP A;  1L3U A;  3KKR A;  3PO4 A;  1JKH A;  4I2Q A;  5DMR A;  3TAN A;  1X9W A;  4O0I A;  3EYZ A;  3VQQ A;  3QER A;  5HRR A;  3SQ4 A;  3QLH A;  1RBU A;  3HT3 A;  4E1M A;  4K8Z A;  4CFA A;  1NJY A;  4CF8 A;  1VSH A;  1RT7 A;  3CYM A;  3TAR A;  3D0P A;  1ZBL A;  4CJ3 A;  2ZQB A;  3SNN A;  5C24 A;  3KLG A;  3OYB A;  3QIP A;  3NDK A;  4Z4F A;  1TKZ A;  3PX0 A;  3DI6 A;  2PYJ A;  1GOC A;  2RPI A;  4M3X A;  2Z1G A;  4J2D A;  1L3T A;  4H4M A;  1Z26 A;  3NAE A;  1L3S A;  3O3H A;  3AV9 A;  1FKP A;  3K5M A;  4HUE A;  4FM2 A;  5JS1 A;  4RW8 A;  3K5O A;  3NF7 A;  3KLF A;  4FM0 A;  1JXE A;  2Q3S A;  1G15 A;  1UAX A;  1WSI A;  5CYQ A;  3IG1 A;  1RT6 A;  4IDK A;  3OS1 A;  3K57 A;  2R7Y A;  4N41 A;  2X78 A;  3NF6 A;  2GV9 A;  4KHN A;  3RWU A;  3SUN A;  2BAN A;  2FBX A;  3ZSW A;  3HYF A;  1NK7 A;  4FZX C;  4RW7 A;  4AHU A;  3V1R A;  2KQ2 A;  5HBM A;  3HPH A;  1RTJ A;  4LSN A;  4CJP A;  3NH2 A;  2X74 A;  4B8C A;  2OPS A;  5HRP A;  3V4I A;  3SUO A;  3CFP A;  2XHB A;  3SPY A;  4DSI A;  1ASV A;  4C8L A;  4CHO A;  2HB5 A;  5FRN A;  4CGG A;  3ZT0 A;  2QKB A;  2QKK A;  4W5O A;  3DLR A;  3ISN C;  1BHL A;  4KKO A;  4PA1 A;  4NYN A;  3LPU A;  3OJS A;  1HNV A;  3CM6 A;  2X6S A;  4O5B A;  4DTO A;  5J2M A;  4CES A;  4CEZ A;  4CF0 A;  4RW9 A;  1C0M A;  4LD0 A;  3DRS A;  3ZSQ A;  1EKE A;  2IGI A;  2E6M A;  3VQC A;  1IKX A;  1WAJ A;  3B6P A;  3QEP A;  5J2Q A;  4EP4 A;  4B8A B;  3F9K A;  3ZT3 A;  4Z4E A;  4CJE A;  4B3O A;  4O44 A;  2YKN A;  4DF8 A;  1KRP A;  3SQ1 A;  3SQ2 A;  2D0A A;  2KW4 A;  3RRH A;  3SQ0 A;  1L3V A;  1KFD A;  1KVB A;  4ZHR A;  4FJI A;  3THV A;  4KHU A;  4OPK A;  5J1E A;  1BCO A;  4KI4 A;  4KRF A;  4N76 A;  3HK2 A;  4HVJ A;  3B6O A;  3LAL A;  2YNI A;  4CIF A;  5EU7 A;  4DTN A;  4F3O A;  1A5X A;  1BCM A;  1KVA A;  1ITG A;  1BIZ A;  2HHQ A;  1KTQ A;  3NGI A;  3SJJ A;  4BE0 A;  1F21 A;  2GBZ A;  2WOM A;  4Z4G A;  2Y1I A;  3P1G A;  4CCH A;  1I3A A;  4CEQ A;  1BQM A;  3AVH A;  2HND A;  3AVB A;  5HRN A;  3KD1 E;  1TKX A;  1HMV A;  3T19 A;  1BL3 A;  1RDD A;  4CK3 A;  1LW2 A;  2IC3 A;  3IS9 A;  4OLA A;  4BAC A;  4C8K A;  3SYZ A;  2PZS A;  2FBT A;  3K59 A;  4HCC A;  4KTW A;  1QQC A;  4E7J A;  4DFK A;  4CEC A;  1YVU A;  3LP3 A;  3OYJ A;  4ID1 A;  3QEX A;  2PY5 A;  3RMA A;  1ZBU A;  3QES A;  1TK8 A;  4B9U A;  1NK6 A;  1C1A A;  2LSN A;  3T1A A;  3C95 A;  3DLK A;  1XHX A;  4CJV A;  4FM1 A;  4FZZ A;  1U04 A;  3KKS A;  3FFI A;  3QET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...