1HQUA

Human immunodeficiency virus type 1
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL POLYPROTEIN
publication title The Lys103Asn mutation of HIV-1 RT: a novel mechanism of drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 125
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hquA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hquA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hquA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hquA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hquA05
3D28A 3H98A 3NAEA 5HLFA 4XIUA 4Y2AA 3KK1A 3ASMA 4OKKA 3IG1A 4LQ3A 1NKEA 2GV9A 4B9TA 3AVCA 3H4BA 4CEZA 2HNYB 2FLPA 4KE5A 4B9VA 1FKOB 2YNIB 4Q0BA 5KG0A 4C8MA 3RR8A 4ZP6A 4IFVA 2WB4A 2YKMA 3ISND 1TP7A 3AVMA 4WFXA 1U47A 3OS2A 1IKYB 5JS2A 3LAKA 1RYRA 3O3HA 3KLEB 3CFRA 1VSLA 3OHAA 3OS1A 4E7KA 3KHLA 2BQ3A 3BSNA 3HVWA 2R8IA 1D1UA 1QE1B 4ZVFA 5KTQA 3RB6A 4WFYA 1KTQA 2Z1GA 4FJNA 1JLQA 4FJKA 5T7BA 1MU2A 2V4RA 4OLAA 1NK9A 2A1SA 2HHVA 1KSPA 4FK2A 3QNOA 2FBVA 2KZZA 2KFZA 3CDWA 2R2TA 3FFIA 2O4IA 1DLOA 4FCYA 5HLFB 3TAMA 4CJUA 3LDSA 4BDZA 3KK1B 3TVKA 3WNGA 3KTQA 3P5JA 3IG1B 4ECTA 3M8QA 3F9KA 2W7PA 3V9SA 2XY7A 1XWLA 3M9NB 4ZVEA 4I2QB 2QK9A 3T3FA 1HNVA 1S48A 2YNFA 3DRRA 3SUNA 4NYZA 2GIRA 3LAMA 2O5DA 2YKMB 1S0OA 4M3TA 1Q9XA 4ZTFA 3DLRA 1KLMA 1NJZA 4KO0A 4CE9A 2JEIA 4ZP7A 2XRIA 4DSEA 3L3VA 4PWDA 4CGGA 5KG6A 2HHSA 2DFFA 4ECXA 4CIEA 5KFXA 3QEXA 3MXIA 2FJWA 1JLEA 1RDAA 5EWEA 4JS5A 3AV9A 2W8KA 3TAFA 1ZETA 1JLQB 1QHTA 1X9MA 4NLYA 2YNHB 1WNEA 3OYIA 1HQUA 4DQPA 2OPPB 4JV2A 3PHEA 1TKDA 4EP4A 5JXSA 4E7LA 3FFIB 4JUZA 3RB3A 4CEOA 1DLOB 4E89A 4H4OA 3TAMB 3CJ5A 4OPJA 3PX0A 4EYHB 3V81A 5T14A 1RTIA 2W7OA 4CJ5A 4CGHA 3M8QB 3NH2A 5JUMA 1U09A 4O4RA 4DSLA 2G8IA 1HQEA 1A5VA 1HNVB 1KVBA 2IM3A 4F2SA 2YNFB 5HRRA 3DRRB 3HP6A 4ZPDA 2OPQA 4I2PB 4M41A 4MQ3A 4KO0B 4JV0A 2ASDA 3MTKA 1I3AA 4AHTA 3OYBA 4ECSA 2PZSA 2HNZA 3PUFA 3AA5X 2E9TA 4O0JA 4MKAA 1ASUA 2F96A 2KW4A 4PWDB 2C2DA 2VG6A 4BWJA 3SJJA 3PR5B 3U6FA 1N6QA 4AHUA 2F8SA 2UUWA 3ICLA 1JLEB 3LP3A 1Z4UA 2ITGA 2F8TA 1Z25A 1GOBA 4DTXA 2OPRA 2R8KA 5L1JA 2XC9A 3HVRA 3B6OA 3ISNC 2QKBA 5J2MA 1BQMA 1HQUB 4DTRA 2A1RA 4DQSA 5F9NA 3GV7B 1YTUA 3ZT1A 3S3MA 3O3FA 1UWBB 3KLVA 4H4OB 3V81B 5KFRA 1WSEA 1TL3A 2CKWA 1T7PA 1RTIB 3OLBA 3MXMA 4KFBA 3QEPA 4CFCA 5L9XA 1CZ9A 3AO1A 1NOZA 2IAJA 3KD1E 1A5WA 1HQEB 3NBPB 5C5JA 4J2BA 2OPQB 4ZPBA 1HYVA 3TARA 3QLHA 2C22A 1NK4A 2HNZB 2HHXA 1XR6A 3H5UA 2FLLA 2D0AA 3QINA 1RTHA 2RKIA 5EWFA 1WSFA 4W5NA 2VG6B 2WTFA 1N6QB 3BR9A 3CDEA 2IDOA 3I5BA 1C0MA 4M94A 3ITHA 2GBZA 4CJPA 2OPRB 5KT2A 4R5PA 4NLVA 2B6AA 3CJ0A 2XI3A 2XGQA 3TWHA 4ED3A 4BACA 4CERA 5J2MB 4GVMA 4CEFA 1BQMB 2NUBA 3DMJA 4M95A 1SV5B 2FVRA 3ZSZA 3DDKA 1JLAA 3RBDA 1VSFA 3E51A 2KZMA 1WLJA 1KVCA 4URQU 3TAEA 4TQRA 1NNDA 4PUOA 1ZBUA 1DTQA 1TL3B 3HXMA 4K4XA 4LSLA 1LAWA 5HBMA 3OJSA 4J9KA 4KFBB 1TK5A 3KLIA 4ED6A 5KRSA 1CXUA 2IMWP 4EBDA 3NF9A 4EEYA 4IRDA 4DTSA 4KI6A 2WOMA 2Y1IA 3G6VA 4M42A 1ZTWA 3QLHB 3ZSVA 3AA3A 1HMVA 3CG7A 3WNHA 2D3ZA 2P5OA 4I9QA 1RTHB 2RKIB 5JS1A 3VQCA 2QV6A 1YVFA 1RT2A 4MH8A 2AWZA 4F4XA 1KFSA 3LPTA 4Q44A 4CGDA 2ZKUA 3ITHB 3QGHA 2ZE2A 1EKEA 1L3VA 3KMQA 2B6AB 1U48A 4O44A 1ZBFA 3QGIA 4Y2CA 4Z0UA 4Q8EA 4CFBA 1RT6A 4ZTJA 1S49A 5F8IA 3QETA 3KMSA 4Q8FA 4IKFA 3L3UA 3DMJB 4CK2A 4HCBA 1KFDA 5E41A 3OYHA 3KNAA 1S0NA 1JLAB 4W5QA 1RBRA 2W9CA 4DS4A 1RT3A 4KKOB 1DTQB 3H4DA 1Y97A 1B92A 3PJWA 4LSLB 2FLNA 4TYBA 5F8MA 4CJFA 1JKHA 3KLIB 4CHOA 3QZ8A 1IKXA 3UQSA 4B9LA 4F4WA 4NLQA 4ED1A 2Y1JA 1S1VB 2ATQA 3T1AA 1QS4A 5DG7A 2WOMB 4MKBA 1BHLA 4B8CA 4OLBA 4M3WA 1NK7A 4HUGA 3PX4A 1HMVB 3K5MA 4IH7A 1TK8A 4JLHA 4FK4A 3HKWA 3K58A 4PQUA 2D41A 4HKQA 4CFDA 5C24A 5K14A 4NCGA 1RDRA 3VQ8A 1RT2B 4CGFA 2OA8A 3KD5E 2DY4A 3SUQA 3RB4A 1D9FA 5F8HA 1LV5A 4F8RA 4WYLA 4DFKA 4NLDA 2ZE2B 3DM2A 2XHBA 2AQ4A 4FJHA 3C94A 1BQNA 4O44B 2RF2A 3M9OB 1RT6B 3K5OA 1TQLA 4DTUA 3MFIA 4U6PA 2RN2A 4DQQA 4FJ7A 3HPOA 1SH3A 1RBTA 2W9CB 4O4GA 2FVCA 1RT3B 1S6PA 1Q9YA 1ZBLA 2AU0A 4IG0A 1REVA 2HNYA 1RBVA 1JKHB 1S10A 4K4ZA 1IKXB 1NOYA 4FK0A 2P51A 2DPJA 4E19A 3I8DA 1WSGA 4O3NA 4I9LA 1WSHA 4MIAA 4IH5A 1SUQA 4KSEB 3TAGA 4M3ZA 4PQUB 1W0HA 1J5OA 5C24B 3OL6A 4N41A 5K14B 4Y1DA 1QSYA 3V1OA 4C8KA 1YVUA 2HB5A 5DG9A 3HHKA 3T19A 1J54A 4DSKA 2W9BA 3DM2B 1S1TB 5DMRA 3NF8A 1BQNB 2R8HA 4CJLA 4E3SA 2RF2B 1VSMA 4N47A 5I42A 1BL3A 4CGJA 2WHOA 3QEWA 1JX4A 2E4LA 1O1WA 3HVTA 3EYZA 5CYMA 3LP1A 2ASJA 3KLGA 5KT5A 4CESA 4QOZB 1VRTA 1SH0A 1U4BA 4O4GB 3H5XA 1S6PB 2E9ZA 4URSA 4IG0B 1REVB 4KTQA 3SUPA 4YP3A 3CYMA 4O3QA 3DOLB 3TAPA 1CXQA 3ZT4A 5KFNA 3DLGA 4I2QA 4L8RB 1JIHA 4FYDA 4WZMA 4EP5A 4NYNA 5KT3A 3O4NA 3OYKA 4MIBA 3NAHA 4J9RA 4DWIA 1UOCA 1SUQB 2JLEA 1WNSA 2XY5A 1J5OB 2G8HA 1HPZA 3HJFA 4Y3CA 2PYJA 1IKWA 4O0IA 3DRSA 2HHUA 3LP0A 3AVBA 5KFOA 4DL7A 2W9BB 3C95A 3FDSA 4Y34A 4DF8A 2OYQA 3OYGA 2YNHA 3K59A 3SUOA 4LH5A 4K8ZA 4B9MA 1EP4A 5I42B 2OPPA 5KG4A 1HJRA 5J1EB 3HVTB 4DMNA 4QWAA 3PW0A 3Q8SB 1IKVA 5CYMB 2Q3SA 2FVPA 3QERA 3OS0A 3LP1B 3KLGB 1K1QA 1VRTB 3VN5A 4M45A 5F8GA 2BRKA 4J9MA 1S0MA 3DLKA 3MF5A 4F4KA 4NLTA 4EZ9A 3AVGA 3DI6A 1QQCA 3DLGB 1TK0A 4AHVA 1J53A 3AO3A 4CGIA 4I2PA 3L2VA 3V6JA 3AA4A 2JC0A 4CJSA 3OHBA 3N6LA 1FXXA 4F3OA 2W42A 2ZD1A 4EYIB 3CM5A 2OZSA 5C42A 4TN2A 2G8FA 4FS1A 4KHQA 3ZSYA 1HPZB 1OS5A 4FZXC 3V9UA 4KHUA 2FC0A 1IKWB 3VQ7A 4NRTA 2P5GA 4MK8A 5DK5A 3DRSB 2BANB 3LP0B 4MFBA 3ZSRA 5KFZA 1S9GA 1T8EA 2V0NA 4W5TA 1DTTA 3MR5A 4OGEA 2CJQA 4M3RA 3Q8QB 3LZIA 3RR7A 1EP4B 3LP2A 2R7YA 1IKVB 3CJ3A 1UWBA 3SNNA 4FLXA 3SPZA 5FDLA 1MMLA 3UPFA 4IQXA 4KB1A 4IFYA 1G15A 4TY9A 3RMBA 1HNIA 5KFLA 3P1GA 2HWIA 4BE2A 3DLKB 1LWEA 4NCAA 1JXEA 3AO5A 4KHYA 1GOAA 3V9ZA 2VA3A 3DI6B 3AO2A 3MEGB 1QSSA 3NBPA 2Z1HA 1NK8A 3G6YA 1Z26A 3LZJA 5KG3A 4O3OA 5DLGA 5HP1A 3QEIA 2G8VA 4KRFA 3Q8RB 2OPSA 4ECYA 4E0DA 4JV1A 4E1NA 3AVFA 5CYQA 1L5UA 1K1SA 3AVAA 2ZD1B 5C42B 1T94A 4XPEA 2HMIA 1XR7A 1RCHA 4WZQA 4HTUA 3VQ6A 4F50A 2UVVA 4BE0A 4DLGA 3MXJA 2GUIA 4K8XA 5F9LA 4CIGA 2ALZA 4MFBB 1S9GB 4QWDA 5KFTA 1DTTB 3RRHA 3VQ4A 3IS9A 1HRHA 4M3UA 1SV5A 4HVJA 3LP2B 4DEZA 4ZPAA 4LSNA 3HL8A 4B9SA 5FDLB 3CQ8A 2XGPA 2BDPA 4HUEA 3GQCA 3H2LA 4FJ5A 4IFYB 1RT5A 3BDPA 5KG1A 1HNIB 4DL5A 5KFSA 4KAZA 4DFPA 1LWEB 4K4SA 4KTWA 2HW3A 2QKKA 3GYNA 3BQ2A 1SKWA 5KI6A 1K6YA 3NL0A 4F4ZA 5HP1B 4RW7A 3CM6A 4FVMA 4ID5A 4CJQA 2OPSB 5I3UA 4MK7A 1D9DA 5CYQB 1LWCA 3TI0A 1ZYQA 3L2QA 1X1PA 3V1QA 1IM4A 3DOKB 4FS2A 2HMIB 3G86A 2B4JA 4OL8A 2JEJA 3BQ0A 1TKZB 3M8RA 2X78A 3HM9A 1RA6A 3MR6A 2BGGA 3KKRA 5D3GA 4O3RA 4CEDA 3TR8A 2GC8A 2VA2A 5KFIA 4RUAA 1TAUA 3OJUA 3NH0A 4CECA 1RTJA 2D3UA 4ZVHA 3IS9B 3BJYA 2E9RX 1BIZA 1BISA 3VQDA 4CEEA 4FJXA 4O3SA 5HRPA 3BGRA 3QIDA 3QYYA 2D5RA 3TANA 3NGIA 3MAQA 1C6VA 4G3IA 3ZCMA 4LSNB 4TYAA 1T3NA 2HAIA 3EPIA 4KKOA 4NYFA 3WNEA 4N76A 2ILYA 3FRZA 2ZQBA 4IG3A 1RT5B 4BDPA 4RW8A 2I5JA 4R8UA 4B08A 4ZP8A 1QUVA 4ECUA 1EETA 3NDKA 4ECWA 5DQIA 3AVHA 4URGA 1BIUA 4OPKA 1S1VA 2X74A 4DL3A 4KREA 3HK2A 3V9XA 2I1RA 4RW7B 2AX0A 4ID5B 2G8UA 1C0TB 5I3UB 1LWCB 5KT4A 4HUFA 5FRNA 1NK5A 4ECVA 1RT4A 1CSJA 4ECQA 2AGQA 4DG1B 1LW2A 2OZMA 5KFYA 4BE1A 4B8AB 2HNDA 1UA1A 2BRLA 4CF8A 2E6MA 3DYAA 1TVRA 5D3GB 1XI1A 2DTUA 1TGOA 3DLEA 1NKCA 2QE5A 4CK1A 4CJEA 3GIJA 2XWYA 2VG7A 1B9DA 4CHZA 4CJRA 1GOCA 1WAJA 4IKAA 4DSFA 1RTJB 4DTJA 4C8NA 2JEGA 3NMAA 2V4QA 3L8BA 1J9AA 3BGRB 4RNOA 4QAGA 3PW5A 3SV4A 1TKXA 4FW2A 1NJXA 5DQHA 3KLFA 4NLWA 3L2WA 2BR0A 2DFEA 3OSPA 2RPIA 3HYFA 3UIQA 1JLFA 4DFMA 4IG3B 4PY5A 4RW8B 2I5JB 1RDDA 5SZTA 4R8UB 4FJ9A 1HYSB 4ELVA 1C1AA 1EETB 4QPXA 4LY7A 3SZ2A 4IOBA 4KBIA 4RNMA 3RBEA 2C2EA 3VQBA 2R8JA 2B43A 5KRTA 4OKEA 3H40A 1S4FA 3T5JA 3KOAA 3OL9A 4IH6A 3QEVA 4J2EA 3NHGA 1CZBA 4I7FA 4WXOA 4RUCA 5KFMA 5KFUA 4K4VA 1LWFB 3RTVA 4YR3A 4KB7A 3NGZA 1XC9A 3L2UA 1TKTA 4J9OA 3VQEA 1RILA 2E6LA 4RNNA 1RT4B 3KKSA 4F3TA 1I39A 5EU7A 1KCFA 4FLZA 3IN5A 1LW2B 3CJ2A 3SQ4A 2HNDB 1QAJA 5SWMA 3MEDA 1KVAA 3NE6A 3DYAB 1TVRB 1VSIA 2J6SA 3K57A 4DLEA 1S1TA 3DLEB 2IJNA 2RDIA 2BQRA 5C25A 2IGIA 4FBUA 4FBTA 4N56A 2VG7B 4FM2A 1Q8IA 3VQ5A 4CF2A 3ZSXA 4OVLA 1S9EA 3AO4A 4OJRA 3SI6A 1S1UB 4IR1A 4KHMA 1TKXB 2AGPA 2QXFA 4LH4A 2D0BA 3KLFB 4Q5VA 5J2QA 4GMJB 1JLFB 2D0CA 1IG9A 1FK9A 4BDYA 5J2NA 3FQKA 3DOLA 4DTPA 1XR5A 4J9SA 5KFBA 4CEAA 5FRMA 2XY8A 1T03A 1VK0A 3FSIA 1JXBA 1ASWA 4I7FB 4F4YA 4M3YA 5KFKA 1D8YA 2R2UA 4ED8A 2WRMA 1TKTB 5KG2A 3G6XA 3ULDA 1B9FA 3THVA 5KFWA 4FJIA 3PW7A 3IAYA 4ZVGA 1BCMA 4E7HA 4NLUA 1TL1A 3I0RA 1S9FA 4WE1A 4K4WA 3MEDB 1JL2A 1KLNA 3KHRA 5KG7A 4NZ0A 1ZTTA 1W9HA 4ED0A 1S6QA 1NHVA 3OL7A 4FLYA 2G8KA 5C25B 4KHNA 4JRQA 3LPUA 1S9EB 1GX5A 4JS4A 1N5YA 3HSTB 3GILA 4RNFA 5J1EA 4EBCA 3PX6A 2YNGB 3SQ0A 3U3GA 1C1BA 3OYDA 2UVUA 4LD0A 5J2QB 3M8PA 4XO0A 4J9LA 1YTAA 4TY8A 3QIPA 3OL8A 2EC0A 1FK9B 1NK6A 5J2NB 1X9WA 1S1XB 2OH2A 3S9HA 1JXLA 1JLBB 1JL1A 3KLHA 2W8LA 1RNHA 3GV8B 2WCXA 4AH9A 3V1RA 1CLQA 4ICLA 2Z1IA 1T03B 4FM0A 1N4LA 4CFAA 5EDWA 2JC1A 3E01A 4YNQA 4NRUA 1GX6A 4FZZA 4Z4CA 3VQ9A 3IGNA 3NF6A 1FKPA 3VQSA 1WSJA 4H4MA 2DFHA 4QCLA 2PY5A 1VSEA 3ZSQA 4F2RA 3CO9A 3KK3A 4Z4EA 3D0PA 4DQRA 1TL1B 3I0RB 4JRPA 5F8JA 2ILZA 4WE1B 5DGAA 2BANA 1IH7A 5KFAA 3B6PA 1S6QB 5KFHA 4ZP9A 4KTZA 1N5YB 3I5AA 4C8LA 4FM1A 3O4QA 2VWKA 4G1QA 2VG5A 4HCCA 2J6TA 2X6SA 2IS3A 3AVKA 4CK3A 3RWUA 2Z1JA 1C1BB 4EO6A 3RAQA 3M8PB 3T5HA 4CJWA 3MR3A 1JLGA 2F8EX 4GC7A 4DSJA 3KK2A 2B5JA 4TY8B 4CHYA 3IGVA 3QIPB 3TQ1A 1VSKA 3Q8PB 3MEGA 3KLHB 3SYZA 4ICLB 5EWGA 1D0EA 4ECRA 4YQWA 2HHQA 3E01B 4ELUA 3AA2A 4ZHRA 1FKPB 3NGDA 4RNHA 4H4MB 1XHXA 4Q0BB 1C2PA 3PY8A 1QSLA 5DQGA 4IFVB 4FLVA 3KK3B 2IM0A 4GC6A 4CHQA 3QESA 1BGXT 4DSIA 2AX1A 5KFFA 1WAFA 3O3GA 1ZBIA 3V4IA 3VQAA 3BSAA 4N5SA 4G1QB 2VG5B 4CIFA 1X9SA 3UR0A 4DL4A 4H54A 4RZRA 4KV8A 1WSIA 4KAIA 2IBKA 1U04A 3AVJA 5HROA 2LSNA 1MU2B 4EO8A 4CF0A 1N48A 5FROA 3IRXA 2IM2A 4IR9A 3HPGA 1JLGB 1ASVA 4CEBA 3KK2B 2B5JB 3T5KA 3CJ4A 2FVQA 2V9WA 3OYMA 2EHGA 4H8KA 4QW8A 5KT6A 5KFQA 4K4YA 3TAQA 3BREA 3V6KA 3RMDA 1TV6A 3I5CA 2XO7A 3GV5B 3MR2A 1VSDA 4TLRA 3HO1A 4ZHRB 3SI8A 3QO9A 4FW1A 3GIIA 3ZSWA 3RMCA 1NKBA 1R0AA 4WYWA 3DOKA 4C8OA 1C0UA 3CWJA 3S3NA 2C28A 4ED2A 3CFOA 3TABA 4ID1A 1JLCA 1TKZA 4NCBA 4RW4A 3L2RA 1KLMB 3OYCA 3P83D 1EXQA 4DS5A 4YR2A 3WNFA 3AVNA 1D5AA 2FJXA 2YKNA 1UA0A 1RAJA 4QWBA 4Z4IA 1SL2A 1VRUA 3V4IB 4WXWA 4U7CA 4FLTA 3OYEA 4DU1A 5CZ2A 1RBSA 2WK4A 4FLWA 4DTNA 3DRPA 4KV8B 3PV8A 2HVIA 5J2PA 4J9NA 4AHSA 3OSNA 3CIZA 5HROB 4NLGA 3HT3A 3IRXB 4TQSA 3H5YA 4ED7A 4FJMA 2J6UA 3SV3A 2UVRA 2XCAA 2ATLA 3NFAA 4HYKA 3GIMA 2RDJA 3ZT3A 4KHSA 3DLHA 2KFNA 3F73A 4QWCA 3PO4A 4TSXA 4OGCA 4DTMA 1SL0A 4M3XA 3GIKA 2UUTA 4HHTA 3KHGA 1TV6B 3V9WA 3EPGA 1C0TA 3QO9B 4DL6A 1S1WA 4CJ4A 1RT7A 4O5BA 1R0AB 1QTMA 4TXSA 5F8NA 3LWMA 1C0UB 4DG1A 4DF4A 3QNNA 1RTDA 5KFCA 4CJKA 4YFUA 5DGBA 4B3OA 1A5XA 4CHPA 3M9MB 1JLCB 2FBYA 4RW4B 3QZ7A 3HP9A 4MK9A 3G0ZA 3KHHA 3C6TA 1ITGA 4KB0A 5KFVA 2HVHA 1BCOA 4YMEA 2YKNB 4IDKA 3MEEA 3AVIA 1VRUB 1SKRA 5DG8A 1KHVA 3OVNA 3H5SA 3JSMA 3MECA 2HHWA 4E1MA 2AJQA 4XPCA 3DRPB 4WFZA 3PZPA 1SKSA 3NKYA 2XCPA 3OYFA 4J2AA 2HWHA 5J2PB 2IA6A 3CVKA 4GW6A 3HPHA 3BSCA 4IRKA 4FZYA 4ECZA 3RB0A 4Z4HA 1HYSA 1NJWA 1F21A 3ZT2A 3CFPA 4FXDA 5L1KA 5KFJA 1C1CA 4E7JA 4CCHA 2C2RA 3LALA 2FBTA 3NGYA 3H59A 4W5OA 1UAXA 4PA1A 1LWFA 2D7SA 4DFJA 3OLAA 3ZT0A 3EY1A 3D5MA 4CHNA 1RA7A 2WONA 4FJLA 4FJ8A 2IAJB 1HYZA 3NF7A 1S1WB 2FJVA 5KFDA 3OY9A 1RT7B 3D45A 4ELTA 1RDBA 1I6JA 5HRSA 1RBUA 3MFHA 4FJJA 4RG8A 3OYNA 1RTDB 4DL2A 3A2FA 1NJYA 4B3OB 2UVWA 1S97A 3I0SA 1XHZA 3N6MA 2G8WA 3C6TB 1VSJA 2GIQA 1RDCA 2YHBA 1U45A 2R8GA 5KFPA 2EX3A 4IDKB 3RMAA 3LANA 3MEEB 5KFEA 3EZ5A 1S1UA 3JYTA 3N6NA 3T5LA 5CZ1A 1NK0A 3JSMB 3MECB 3OYAA 2ASLA 1L3UA 2ETJA 1RYSA 2O4GA 2KQ2A 4Q43A 4R5PB 4J9QA 4NLSA 1VSHA 4EZ6A 3DLBA 5DLFA 4B9UA 1ZBHA 4W5RA 4E7IA 3V6DA 4CEQA 4IRCA 4DU3A 2W9AA 1BI4A 1C1CB 3UDLA 4KPYA 1N56A 5CY4A 4PUOB 4UQGA 3H08A 3NAIA 3SQ1A 5HBMB 3SPYA 1YT3A 4QW9A 2IJFA 3BQ1A 2WONB 3S3OA 2IOCA 1RT1A 2JEFA 4CF1A 3U3YA 2X6NA 4RW9A 2XI2A 5F8LA 1HARA 4J2DA 1NHUA 3M8SA 4LQ9A 4FLUA 4ZPCA 4B9NA 3FQLA 4CJVA 3I0SB 1KRPA 4AHCA 4RW6A 1LW0A 4YR0A 3NH1A 2BE2A 4NLXA 2YV0X 4KI4A 1T05A 2VWJA 3SQ2A 1QAIA 2BQUA 4EBEA 2DPIA 3ALYA 4FJGA 3JYTB 3RRGA 3SFUA 5L1LA 2IC3A 3PR4A 2PYLA 2YNGA 4X2BA 4BWMA 3CDUA 3C6UA 2AGOA 4Z4FA 3KJVA 1EX4A 5EUHA 2FBXA 4Y1CA 4QWEA 1IO2A 4DQIA 1S1XA 3V6DB 5KG5A 3VQQA 2P1JA 4J9PA 1L3TA 4O3PA 1JLBA 3PW4A 1BI4B 3QIOA 4NLPA 3PVXA 3AVLA 4KHWA 4KHRA 5KT7A 1W25A 3V6HA 3OYLA 4AILC 1S5JA 5HRNA 3LWLA 3NCIA 2HHTA 4R0EA 5KFGA 1FKOA 3HVAA 1RT1B 3OYJA 2YNIA 4K50A 1LAVA 3VA3A 2R2SA 1TAQA 3PO5A 4RW9B 3BSOA 1U49A 3K5NA 4Z4GA 3VQPA 3RAXA 2IM1A 3PJXA 3SCXA 4OKJA 1IKYA 4O55A 4CJTA 4RW6B 4K4TA 1LW0B 4RU9A 3KLEA 2BE2B 3ZSOA 1T05B 2KTQA 4K4UA 4Q45A 4AHRA 4DU4A 1L3SA 4IBNA 3K5LA 3G10A 1SH2A 4NCGB 1QE1A 2R2RA 3K2PA 2IC3B 3EZUA 3SFGA 4CJ3A 3VA0A 1SL1A 4NLRA 3PW2A 3C6UB 5L1IA 5KGWA 1WN7A 1KHWA 2XY6A 5KGXA 3KJVB 4ZMMA 4NLOA 2FVSA 3QGGA 2YHAA 4CF9A 3KIOA 2JGUA 4DTOA
chains in the Genus database with same CATH superfamily
1OY6A 1RU2A 3BO3A 5ITHA 4LRCA 2D0OA 5T41A 1NKEA 1HW8A 4PABA 4OHZA 3H4BA 2MQ8A 4OJGA 1M5KC 2YNIB 1F3FA 3RR8A 3VALA 3CCQS 1V3SA 4ES2A 2CUYA 4ZVSB 1U47A 3RU0A 4P2XA 4CLSA 1GLAG 3KHLA 1QVGM 1UFWA 3R1LA 2E5IA 2VPXB 3WXIA 1NGBA 3T1YJ 4PL7A 3RB6A 4WFYA 4CM0A 4FJNA 1JLQA 3GCWP 4DR4F 2QLXA 1GLBG 1M0SA 2V4RA 2ASMA 3G71N 5TKWA 3QNOA 2KZZA 2MGZB 3W1YC 4KRWA 3CDWA 2E1ZA 1VQPN 3LM2A 5C0YA 4CLYA 1DLOA 2F9WA 1ZM2A 2LEPA 3J80O 4OYXA 1ITPA 4JOUA 2ZH1A 4CJUA 3ELHA 4YY3K 4BDZA 1FWLA 3F9KA 3FZLA 3V9SA 2B4OA 4X62K 3Q2SC 2ZOGA 4C1NK 3M9NB 1UCNA 2UXBF 1EO1A 2QK9A 1LCUA 1HNVA 2YNFA 4ED5A 4JI6J 1VQKN 4NYZA 2GIRA 2YKMB 1S0OA 2E44A 2ZHOA 1FNOA 1VQYA 2JEIA 2HFZA 4ZP7A 4DPUA 5GAGP 2XRIA 3L3VA 2HHHF 2GS8A 1CS4A 1FA0A 3S41A 2ZH9A 5KG6A 4M5HA 3L0QA 3MMCA 3QEXA 3WIVA 1JLEA 3DN9A 4I6AA 5LJWA 3CXCR 1X9MA 3R1HA 2YNHB 3CCQN 5BJRA 4A47A 1SXLA 2EG1A 3MM5A 1C4AA 3FNNA 3PHEA 4EP4A 2AEFA 4LRDA 3FFIB 2C2NA 1Y3JA 1VIOA 2FPHX 2XWXA 3UKUB 3FGUA 4H4OA 3PX0A 1PCAA 2HFOA 2BJDA 1FD2A 2FJDB 2F63A 3AJ2A 2WW8A 4BGBA 2MKKA 4CJ5A 2Q1NA 2IVMA 4OZLA 4HI2A 3NY0A 4DUYJ 1Y0HA 4LF6K 5JUMA 4WK3A 4USWA 1WG1A 1HBOA 1A5VA 3RSEA 2IM3A 2ZJRL 3HP6A 3UWTA 1X5TA 5IWAF 2MB0B 2YWWA 1VJWA 1HKBA 3AOAA 9ATCB 4ECSA 3HHLD 3AA5X 3HHLB 2FHKA 4MKAA 2KW4A 5ADZA 5CCLA 4BWJA 1S72S 1AZSB 4UUWA 4AHUA 2F8SA 4OIXA 1KAYA 3KJFB 4BVPA 4DTXA 3THXB 4Z37A 3SLCA 3HVRA 3IXQA 3B6OA 4HH1A 2AYGA 3THYA 1PJ7A 3S6EA 2RH3A 4DQSA 1GEHA 3CHWA 3S3MA 2YWEA 1UWBB 4F36A 2N3LA 3H1QA 4ISGA 1JQGA 3V81B 3TEHB 4CZLA 1WSEA 2CKWA 1W7AA 3BDEA 1RTIB 3MXMA 4KFBA 4Q2LA 3TW0A 2NNWA 2QWQA 2IAJA 2M9KA 2XYHB 3KD1E 1TU0B 2F5GA 1ATRA 1CZAN 4LIRA 4J2BA 4OQJA 2G2ZA 4ZPBA 2E7XA 3GL1A 2ZH5A 5HL7Q 3K0SA 1OVQA 2NRTA 3CMES 1MW7A 2CDRB 2VUGA 4JEPA 2MKYA 2YWGA 3H5UA 3JSBA 4KIAA 2D0AA 2EG2A 2RKIA 1LXJA 5GAHI 5CE3A 3MM6B 2ZH3A 4EFHA 2LMIA 4IO1A 3MHYA 3SAFA 4M94A 1OJ4A 5KT2A 2F4FA 3CJ0A 2UU9K 2XI3A 3GG4A 3OXLA 2CQCA 4BACA 4KY3A 2AYEA 4AE5A 4GVMA 3EICA 4CEFA 4HLBA 1VBKA 4JYAJ 1E4GT 3DMJA 1FFSB 2FVRA 3ZSZA 4CZIA 4FVUA 4ILHA 1S72N 2O8BB 2GGPB 3TAEA 1NNDA 4LSLA 1M5PC 4C3LA 4KC5A 2OJ3A 3KLIA 3DCAA 3W5ZA 4ED6A 3QATA 3Q0AA 4EBDA 1YITS 1RTZA 4DTSA 4KI6A 3MUVP 5F1XA 2OIHA 5C7PA 3G6VA 3QLHB 3EDQB 3AA3A 5BPNA 4DX5A 5B0DA 4I9QA 5HL7L 1WDDA 1V6HA 1RTHB 2O66A 5JS1A 3WC0A 2RU3A 3VQCA 1KAXA 2UV8G 2AWZA 2W2QP 3H3OB 4LRBA 2A1BA 4CGDA 2ZKUA 2DCLA 3W64A 5IZHA 4HACB 4O44A 1HR0K 2C2ZB 4Y2CA 4Z0UA 4Q8EA 4CFBA 1RT6A 3OTEA 3T6BA 2WBRA 5LT5A 3P6YC 3CMEN 3DXSX 4HCBA 5HJYA 3KNAA 2QWOA 1OY8A 3HHLC 1JLAB 8RUCA 3UD5A 1RBRA 1BA0A 3EVWA 3B6BA 2W9CA 2CJKA 5FPEA 3GLJA 4DR5K 2ZOFA 4K7QA 4TYBA 1PO6A 4F3MA 3UQSA 4B9LA 3X1LB 4NLQA 5G0RA 3MN9A 1S1VB 2DIVA 1QS4A 2AF6A 3NNHA 2WOMB 3J7YU 3FBCA 3CD7A 4FYXB 2CVIA 2YJEA 4P7VA 4OHXA 4DV0K 4DR7J 1UVIA 5ETOA 1Z1ZA 4BROA 2A41A 5K14A 3SUQA 1CC8A 1D9FA 2VQEF 1G3OA 5F8HA 4F8RA 5F0UA 1YITN 4WYLA 2VQFK 1NPRA 4DR1K 2CIMA 1Q78A 1TQLA 4CH7A 5CA5A 2KL8A 4U6PA 3FK4A 4Y0WA 3PIPQ 5DO2A 4G65A 1N36F 1SH3A 2FVCA 2AP1A 1S6PA 4IG0A 3BPSP 5HO4A 1IKXB 3PRDA 2KT5A 1NOYA 1AA1B 1VC0A 4FK0A 2A42A 3GE9A 2DPJA 4NX9A 3A8IA 4DUZF 1WSGA 2GVZB 4O3NA 4K43A 1WSHA 3CD0A 1LXNA 1NGJA 1D09B 4KSEB 1B64A 4PQUB 2QO3A 1M90O 4F4AA 4X64J 5C24B 3LGNA 3OR1A 2HB5A 4MKVA 2O8DB 4B3TJ 3T19A 1J54A 3A5NC 3VHQA 3TWZA 3MGJA 3DM2B 1S1TB 5DMRA 1BQNB 3ZZTA 4CJLA 4E3SA 1BE4A 2E20A 4OYAA 3FMBA 4N47A 4CGJA 1ZA2B 1JX4A 1O1WA 4JI0K 2DGTA 3EYZA 1NGCA 2CJXB 2YQ0A 2DYAA 1VRTA 1U4BA 4O4GB 3PIPL 3H5XA 4OYOA 2B9EA 1CEZA 2LQ5A 2D1KA 1IBMJ 4HHJA 3TAPA 2ZM6K 4DUTA 3QICA 3DLGA 3R5BA 2OD6A 4XH4A 1VIXA 2HF4A 3EGZA 2V8PA 4RX6A 4OI2A 3PYGA 3DXKA 4NYNA 3LA0A 2WC9A 1U25A 5BREA 3TVYA 3H25A 1UOCA 3KYLA 1WNSA 1MROB 4U7UK 1P1LA 2P9SB 2G8HA 1HPZA 2N4CA 1IKWA 1V4SA 3EXCX 3AVBA 5KFOA 2W9BB 3C95A 1WHVA 4DV1J 3BEGB 4DF8A 3LL3A 4CIOA 1X9JA 2BBEA 3OR2B 4IOCL 1LFPA 2W2NP 2RE1A 1RBLA 4L3QA 3SCJE 1YJRA 1YBTA 2CQBA 2VC1A 1T9TA 5KG4A 4RJVA 2GW8A 2QSWA 1F2GA 3VAKA 4DMNA 4I4BA 4QWAA 3PW0A 2VJUA 3MMVA 2QWPA 2FVPA 1EQMA 1EWRA 3OA9A 3KLGB 2KJVA 2V7YA 4CVNE 3VN5A 4F67A 5F8GA 1VQ4S 3DXMA 1S0MA 3DLKA 2IYIA 2EFGA 4EZ9A 3AVGA 2GQ2A 1M1GA 2QRRA 1IJFB 2DNHA 1QQCA 3ATVA 1TK0A 2Y1LB 3D67A 4ZA1A 3TTFA 2YX4A 1RAOA 3T1HF 1J53A 3I56S 2VFVA 4CGIA 4PCQA 5GAEI 1PBUA 3CQYA 2HLTA 3HMJG 4M7YA 2HPUA 2QZ8A 1KQGB 3AA4A 1WBBA 2K3KA 1BD6A 4UOGA 1XNQJ 3N6LA 2YXLA 3ULEB 2W42A 2ZD1A 1X7VA 5C42A 5IM0A 2G8FA 4KHQA 4UQTA 2NRZA 1WC5A 4CZGA 4ISEA 1DTTA 3WIUA 1NGAA 1NBEB 1KONA 3EDRB 2N7YA 4PG7A 4OGEA 4M3RA 2ZHAA 1UFKA 4LJMA 1IBKK 2GWJA 2V8GA 4X66F 2C3YA 2BABA 1HBMA 2MEWA 3SPZA 2PA3A 4ZJQA 3DC2A 3H8YA 3UN3A 2HBJA 1MMLA 3I33A 2NZTA 4KB1A 4IFYA 4LF8F 1HNIA 4JI8K 1LWEA 3MCSA 1NH8A 3MEGB 1CLFA 3MOJB 2L41A 3G6YA 4ILGB 1UWAA 4LIWA 1RP5A 2UXCK 4O3OA 5DLGA 3AD9C 2DY9A 4E0DA 1Q8LA 3L09A 3LTOA 3AVAA 3J8AA 2G13A 1T94A 1R8CA 2NUHA 1VQ4N 3D2FA 2O67A 4K8XA 1CJVB 4CIGA 1S9GB 2OFGX 1DHMA 2UXDF 1HRHA 4FO0A 1SV5A 4X4QA 3W5XA 4ITSA 1LK7A 2K1RB 2Q36A 3HL8A 1SC6A 3PACA 1TR0A 3GFZA 2BDPA 3CCLS 2MKHA 3PYDA 3GQCA 1J5EF 4BLGA 3VENA 2DNKA 4MYTA 1RT5A 5B08A 3BDPA 2ZF5O 1WELA 2BV3A 3PM9A 2NSBA 4BR4A 2QKKA 3LH2S 3GYNA 3UB5A 3QT6A 4DV2J 4B1UB 4F4ZA 3GFHA 1HNXF 5AQHA 2DR8A 5IT9U 3T7ZA 4X4TA 1D9DA 3M8WA 3TI0A 3L2QA 1KWMA 3V1QA 5A76A 3ZZPA 1ATSA 2HMIB 2CGLA 2HK2A 3HD1A 3DGVA 2B4JA 2JEJA 1E6VB 2FC9A 2M4MA 1TKZB 3M8RA 3HM9A 1NO8A 4I6MA 1XK8A 3AXKA 4O3RA 4CEDA 2GC8A 2PI4A 3M6UA 4NZ6A 3OJUA 1FJGF 3QFPA 3N0VA 1FTCA 1RTJA 2D3UA 2E9RX 3IS9B 2HQCA 4JP8A 2JOQA 5AJ3F 4YOXA 4X84A 4G3IA 4LSNB 4TYAA 3SAHA 2JH3A 2Y1RI 4KGXB 1YJVA 1BY9A 2DY1A 4FWLA 4BDPA 3D68A 4B08A 1QUVA 1XEZA 4ECWA 1FD8A 1R8PA 1BIUA 4OPKA 3R1XA 5BPMA 2X74A 4JI4J 2MHNA 2V69A 3EJMA 1T3VA 2KB2A 3QBWA 2G8UA 5D0RA 1C0TB 1AFIA 1PSDA 2D69A 1LWCB 1JB0C 4ECVA 2BVZA 1W2BR 1F9HA 2R7TA 5IC4B 4DG1B 2B4UA 2QMUB 2C2KB 2OZMA 2Q3PA 2KHDA 3N4WA 4X65J 1H2TZ 2BJ8A 3DYAA 5D3GB 1XI1A 2QL5B 2DTUA 3D2EA 5HN0A 4CJEA 4EK2A 2XWYA 3JQMA 3B8AX 1GOCA 3I82A 1WAJA 2KLAA 4C8NA 2O8EB 2V4QA 2DO4A 2CNOB 2OTLS 2UUCK 4DX6A 3CJRA 3KLFA 4DV4K 4NLWA 2BR0A 2DFEA 2P8IA 3MMAB 4G6VB 1A9NB 5L38A 2I5JB 1MWZA 1RDDA 4N7TA 1HYSB 1C1AA 1H0HB 4P2FA 2C2EA 4F25A 3VQBA 3H40A 1IBLK 1S4FA 4IH6A 4J2EA 3NHGA 1CZBA 2AA4A 5ADXH 4GO5X 5L8RC 4RUCA 3HDSA 3NGZA 2PD1A 1GMWA 1KXPA 1SQFA 4F3TA 4JI1J 1KCFA 5HVHA 4MLHA 3L7OA 2BA9A 1JJHA 5AXMA 1XMQJ 1TVRB 4DLEA 3DLEB 5BN9A 5AXNA 4FBTA 4N56A 2VG7B 2K7KA 1NWKA 3AO4A 4OJRA 3SI6A 1S1UB 4IR1A 3CE8A 4BBYA 3I9ZA 3SK3A 1I94K 4X62J 2QXFA 1XMOJ 1RWXB 3IBCB 2IVYA 3MMBA 1EX8A 4M7XA 4OX9F 3MN5A 1Q0NA 3HULA 4BRMA 5M2PA 5J2NA 1HUXA 3HRGA 2PFDA 3ID6A 4J9SA 1C0GA 3BKUA 5FRMA 2MLZA 5FLXO 3TTCA 3I32A 4I7FB 2CJYB 1TUYA 2DEJA 1D8YA 2R2UA 4IO9Q 1TKTB 2OTLN 4OZNA 1VYAA 4KH4A 2JFDA 5H9FJ 4HDGA 5B0FA 5KFWA 3Q7CA 4FJIA 3IAYA 4ZVGA 3FJ2A 1VFJA 5AFUH 4CH1A 2O8FB 3KHRA 4FWKA 1QQMA 4YUDA 4ED0A 1NHVA 1B99A 5C25B 5DETA 4JRQA 3PSFA 2VH7A 4MTPA 5H1SQ 2D3O1 2HS0A 3GILA 4B3RF 4PL8A 5J1EA 4EBCA 4IXCA 3RBZA 1WEYA 2HFUA 3U3GA 3MCNA 3NEKA 1SJ3P 1HD0A 1S7HA 1YTAA 3V5RA 5HVFA 5EN1A 3OL8A 4P73A 3TJ8A 1FWPA 4LF9K 3S9HA 2NRVA 1JL1A 3JTNA 3KLHA 2W8LA 3GV8B 1SJFA 4FM0A 2J0QD 4CFAA 2JC1A 2E2PA 2CJBA 1IV0A 3VQ9A 3NF6A 5D4LA 2DR9A 1XC3A 4ILMA 4H4MA 3CCES 4UOFA 3ZSQA 2RRBA 3CO9A 4IO9L 3FLCO 4I64A 3V4MA 2QLWA 3KK3A 5HMXA 3D0PA 4JKFA 1OH8A 1ZC6A 4JRPA 3TUPA 4WE1B 1W26A 1OY9A 2UUBJ 3O2IA 1NU4A 1TFYA 5KFAA 4BRGA 1LWXA 3TX0A 2J4RA 5M1QA 5EX0A 2V50A 1N5YB 1ZM9A 4FM1A 3O4QA 4G1QA 3FUYA 2VBYA 1P8ZA 3RWUA 2PMZD 1K8AT 4JV5J 2KJWA 3T5HA 2F8EX 4GC7A 2VDHA 3KK2A 4TY8B 3QIPB 2DD8S 3D6RA 1IJJA 1GLJO 1RGVA 2V67A 2HZAA 3KNGA 5GINA 3D6MB 4TU9A 4AL6A 2E5LF 2LFVA 1DQ8A 4RR5A 3L7PA 5AR0A 2AJ1A 1NU0A 2E1PA 3E01B 1N32J 3Q86A 3WUHA 2DGUA 3LO3A 1NGHA 2ZC3A 3EUNA 2H3GX 2VB6A 4FLVA 2CQIA 2A10A 5GMEA 1XERA 3UDCA 4GKJF 5ELZA 5AQGA 4DN9A 2HKEA 3W5YA 2DXEA 4LF4F 4ILLA 4YHHK 3W0LA 1WAFA 2CWXA 4ZN3A 4A8KA 3V4IA 1TZ0A 4CIFA 1X9SA 3UR0A 1SC3B 4DL4A 4CLKA 4RZRA 3CCEN 3R7SB 3M32B 3ZZUA 8AT1B 3CIPA 2EK6A 3GWCA 5HROA 2LSNA 1JK9B 2ROPA 4EO8A 1N48A 3IRXA 4ZLNA 3O8MA 2XZWA 2EHGA 4QW8A 2DGQA 1ZM3A 4K4YA 3DGPB 4KBOA 3TAQA 4OLPA 3KKFA 4EMDA 5BR8J 2YBVA 4P52A 3I5CA 4J90A 3MR2A 1VSDA 3QO9A 3T6JA 4CW7B 3VEXA 1WKKA 4LF1A 1IWAA 1RUSA 2C28A 3CFOA 1VC5A 4O5FA 1JLCA 3IUCA 2AJ2A 1F60B 4NCBA 2XNRA 3L2RA 1Q16B 3W2WB 1GH8A 2GX9A 2YKNA 1UA0A 1RAJA 2HSTA 1SL2A 4Y6IA 4WXWA 4U7CA 2WUSA 2OHDA 1DRZA 4DTNA 3CCTA 4KV8B 1F1BB 2V4JA 3PV8A 2P9KB 3ZFVA 1EQ0A 3CIZA 1YK9A 2AV5A 4Y00A 3BEXA 3HT3A 3NGKA 4OV6A 2VWBA 4LFAK 3G87A 2CH6A 2QT7A 5LM7E 4EHUA 3M6XA 2RDJA 3HHEA 4BC5A 3DLHA 2O3DA 4H0OA 1KEKA 1NEEA 3PO4A 4M3XA 3TOQA 4DB3A 2UUTA 3KHGA 3V9WA 2HQFA 5AQTA 4KHPK 1QQOA 2OMOA 4DV6K 3IWXA 4NXMJ 2JHEA 4CJ4A 4ILRA 1RACB 4O5BA 5KAKA 1MWYA 4WPAA 4JD2B 4DR1J 3UN5A 3JQKA 1RTDA 4CJKA 4JI7F 4YFUA 5DGBA 3GU0A 4JI5K 1NH7A 4RW4B 4FPRA 3HP9A 3TYTA 3KHHA 3C6TA 4KPCA 2V8VA 1ITGA 1OSDA 4KB0A 1BCOA 2XMKA 2ZH8A 1TMMA 4FP9A 3BZQA 4IDKA 2QLBB 2HRYA 3ZYYX 5DG8A 3OVNA 2ZJPQ 4MAKA 3MECA 1OQ6A 4XPCA 3DRPB 3R7BB 4LBHA 2C1EB 4DMZA 3NLCA 4I67A 4J2AA 5J2PB 2C2OB 3U8XA 2DR7A 3BN7A 1WI8A 5DDRC 3HPHA 4FL9A 3PHTA 3Q8VA 3KXDA 2JWNA 1ZZNA 2Z58B 1C1CA 4EUVA 5GADI 2VBWA 4CCHA 1LEOA 2FBTA 2IDLA 1LWFA 4G1PA 3OLAA 3EY1A 5BRHA 4CHNA 3HSZA 2CRLA 1Y64A 2FJVA 4FOIA 1RT7B 2V34A 3C15B 1RBUA 1KD1T 3BM7A 2V94A 2UVWA 3N6MA 2G8WA 1K44A 4ER8A 3CJCA 2HAFA 2YHBA 3NGTA 2C3UA 5CAAA 3N6NA 5CZ1A 3JSMB 1HKGA 4WP3A 2XZTB 3CC4S 2O4GA 1H73A 2KQ2A 3L6QA 2QL9B 4CZCA 2W24A 4R5PB 2ZJPL 3DLBA 4B9UA 1CJKA 2HS4A 1GFWB 2GNKA 2YX1A 2CQ1A 3AY9A 4IRCA 3DAWA 4DV5K 2O01C 3AD7C 4B3SK 3VF4A 1UJ4A 3OW2R 4PUOB 1FW6A 2VJVA 2IJFA 1VQOS 2DTJA 3BQ1A 2LKZA 4FWSA 1NNEA 2CQPA 3WHIA 1RT1A 4AF1A 4WFNQ 4YB5A 4JKGA 1EKRA 2X1BA 5F8LA 4EIAA 2B7BB 3AOBA 4ZPCA 1Y4ZB 3FQLA 4RW6A 1SQGA 1T05A 3SQ2A 1RKIA 4W90B 1QAIA 5BYSA 1KC8O 3JYTB 5D15A 3RUBL 2VODA 1GXLA 2BKOA 4X4NA 2YTCA 4Z4FA 2FHJD 4DI6A 1EX4A 4Y1CA 2MQOA 4CTAA 3EVOA 4QWEA 4CNZA 4X4RA 2E2QA 3P96A 4GV3A 3QAUA 4J9PA 1L3TA 3NCPA 3PW4A 3PVXA 2V8HA 5GAEU 1GXTA 1T3OA 1EB0A 4Y28C 2B0GA 1ICEB 3OYLA 3NCIA 3CPWM 4PKHA 3CC4N 3OYJA 4K50A 1LAVA 3VA3A 1HNWK 1FX2A 1U49A 3R6GB 3VQPA 1QQNA 2IM1A 3EO3A 4WFNL 3D9BA 1IKYA 4O55A 1IBKJ 1JJCB 4K4TA 1LW0B 3P5TL 3MI7X 1EIYB 3HSJA 5E33A 2RS2A 3OVBA 4IBNA 4YOEA 4CQ1A 2RE2A 1SH2A 3K17A 4PAAA 1VQON 1RZMA 2ACMA 2OGUA 5JICA 4DR4J 1HD1A 1FNMA 2WSCC 5M1NA 4NLRA 3MX5A 1KHWA 2DRDA 3UCZP 2XY6A 4ETZA 4A8XA 1K9MO 2YHAA 4CF9A 3KIOA 2JGUA 2V2KA 3WZ0A 5IFMA 3SBMA 2C2MB 1RADB 1NZAA 1N33K 4H5RA 3KK1A 2GO9A 4LQ3A 3J7YP 3AVCA 3UNGC 1IN0A 4YHHF 4QQBA 2GVDA 2FLPA 2UXBJ 1T95A 3A8EA 2PO4A 4USIA 4C8MA 3M7VA 2UUAK 1N5TA 5HMZA 2B8QA 1VBXA 4IFVA 2WB4A 2XMUA 4PPZA 1WWHA 1FT8A 3OS2A 5JS2A 4UT4A 3R27A 4GRSA 4X4VA 3KLEB 2HHHJ 1N5VA 3MWBA 2RVJA 3WQUA 3ZZZA 2A5XA 2N7CA 2BQ3A 4H0XB 4ZCIA 2YWHA 3HVWA 1NXIA 2R8IA 2QJ3A 2EPIA 2MXYA 1YG0A 5KTQA 2R3VA 4RPFA 2ZH4A 2QWNA 4RCHA 2R7UA 4BRDA 1MU2A 4DJBA 4OLAA 2XM3A 1Q82T 1TL5A 1HHTP 2HHVA 4YOYA 4A8FA 1KSPA 2H5JB 4FK2A 4GO7X 2H5IB 3HLUA 2KFZA 4MKYA 1GLCG 2VDIA 5G4DA 1WOQA 3MAHA 2ZVIA 3LDSA 5BRFA 3TVKA 3WNGA 3KTQA 3P5JA 4DR3F 3MPUB 5AQUA 1T9YA 4JKDA 3P49B 1X4BA 3GJTB 2XY7A 1XWLA 3AFGA 1RWPB 3J7ZO 3PCOB 4ZVEA 1C4CA 3DRRA 3F2KA 3LAMA 3THTA 2HBKA 3MN6A 4ZTFA 3IC1A 1UVMA 1NJZA 4KO0A 4P72A 4CE9A 3GR0A 3CDBA 1PIEA 4E2FB 2LLZA 1GLEG 4DSEA 4CM2A 2ALYB 5IQQA 4PWDA 1WOSA 4CGGA 2H51B 3W9HA 2HHSA 1D4XA 3BV8A 5AZJB 5ADXA 2NSCA 1FDNA 2FJWA 5B0CA 1NDLA 1WBDA 5E0OA 4JS5A 2W8KA 1QLNA 1JLQB 4Z2XA 4NA3A 3QAEA 4NLYA 3W2VB 2V68A 3D7SB 3MM8A 2M5YA 3LPEA 4DR2K 2BJEA 1HQUA 2BACA 4DQPA 2PA8D 2F4VK 1M5SA 3G9CA 3RW6A 2DR6A 4E7LA 3R7NB 1YIJS 3N01A 3T9ZA 3RB3A 5HK4A 1DLOB 2EC2A 4CEOA 2G1DA 2GJFA 2B9WA 3ETMA 3GSIA 4LRAA 3ILLA 3ZZ0A 2V6AA 1RAEB 3FE1A 1OPZA 2HEKA 1HNVB 3LW5C 2YNFB 3PSIA 4ZPDA 4E98A 1X31C 2OPQA 3M1VA 4I2PB 3K89A 3HFKA 4MQ3A 4LBPA 1NUEA 4AHTA 2HNZA 1YJ9S 2I6WA 4ES3A 3AB2B 5LJ5Y 2KG0A 4DV4J 1CS4B 3FMWA 2BUPA 3AGRA 5AQQA 3BKTA 3MMCB 2UUWA 4GKKF 1YBAA 1JLEB 3LP3A 1Z4UA 2HIYA 1RCXB 2JX2A 3TRGA 1RXOB 2DGXA 4CO1A 3LGMA 1BQMA 2G0IA 4DTRA 3MM5B 5AFUA 2E1RA 3GV7B 2RUGA 1FCAA 3CGIA 2B3TB 3O3FA 2VPWB 4NASA 1TMJA 4A5BA 2NS1B 4H4OB 4A5AA 5KFRA 2ZZNA 2EFQA 3OLBA 3T1YK 4CFCA 5L9XA 1CZ9A 1XBWA 3AO1A 1NOZA 1H6KX 1KS2A 1A5WA 1GLFO 1RSCA 1HBOB 2ITMA 2LA4A 2OTJS 3RSEB 2KO1A 1N54B 2IBOA 1HYVA 3CJQA 4WIQA 1YIJN 2CPIA 1UETA 2ADCA 1I94J 2FLLA 4DV5F 5EWFA 3BF4A 4W5NA 3KWGA 5IT4A 2AMCB 5EGYA 3KDOA 3BR9A 3QMQA 4RWWA 4DL0C 4JHDA 3CDEA 1CJUA 4LF5K 4LR8A 3ITHA 4YOWA 4ZVRB 4CJPA 1EARA 2B6AA 3C6HA 2XGQA 3KK7A 1JJ4A 4JI6K 1ZM4A 3TWHA 4KH1B 3THYB 4CERA 1YJ9N 3CW2C 3FCVA 2PIIA 2KXNB 1WC1A 3FZMA 2GCFA 3VZIA 4TQRA 4FXWA 4HEA9 1ZBUA 3UVJA 3HXMA 3N4QA 1LAWA 1KBRA 2FZCB 4J9KA 4KFBB 4B1YB 1CXUA 2ZGYA 3IBFB 1M1KO 3WC2A 2PI5A 1DARA 1OVYA 4KGVB 1VC6A 4EEYA 5A6WA 1NRKA 2Y1IA 1F9EB 4UW2A 5HMWA 3W8PA 3DFEA 3ZSVA 2P5OA 2XBPA 2KVQE 2RKIB 3C14A 2QV6A 4OX6A 5H1SV 2VQEJ 3E9LA 2XYPB 4HR2A 2FC8A 4DUYK 3IR7B 1KFSA 1N5SA 3LPTA 3QGHA 1RK8A 2BM0A 4MLEA 2OTJN 1L3VA 2F7TA 1ZBFA 3QGIA 1S0VA 4ZN1A 3MXHP 5AQPA 4ZTJA 1S49A 3OTOK 3QETA 4IKFA 2OANA 3DMJB 4CK2A 1ZAVA 1HBUA 2N82B 1JCFA 1S0NA 1N36J 1SZ2A 4W5QA 1DKGD 4I0WA 2MYFA 3LF0A 4ZCKA 4C9DA 1PJ6A 2V51B 2CQGA 4KKOB 4FF2A 3M2UB 4LSLB 5CABA 5CZXA 4CJFA 4ZOSA 1JKHA 3KLIB 4AL5A 3QZ8A 1BUXA 4WKRA 5DM7Q 2DHXA 4DUZJ 2RQ4A 2Y1JA 3WEEA 2CAJA 4ZVQB 3T1AA 5DG7A 4BRKA 1Y9OA 1APSA 3PX4A 1PJ5A 4S0MA 1KAZA 1H7XA 3I6PA 3K5MA 3QMLA 4JLHA 1XNRK 1SAZA 2QEXS 3W66A 3HF5A 4HKQA 4NCGA 6AT1B 1UW4A 1P6TA 1SQEA 1T9XA 4DFKA 4FJHA 2BEFA 4O44B 4USMA 1Q7YO 3M9OB 3J7AN 2IRXA 1RT6B 3N5BA 4DTUA 1F5CA 2KN4A 3ILJA 5CD4H 3W3SA 2QXLA 2RN2A 1I5OB 4ZPTR 2EFPA 3VV2B 3AOCA 3KHYA 2W9CB 2VBZA 4AL7A 5DM6L 3EKUA 3FR0A 1Q9YA 4CWBA 1REVA 4PXDA 3G96A 2QWRA 3QJPA 4K4ZA 2AD9A 1YI2N 1YKWA 3ZTOA 1H2VZ 5G0RB 3CSKA 2A0FB 3ENVA 3I8DA 5DM7L 2DNPA 3CJ9A 4JYAK 2IY5B 3LDOA 1GQEA 3VAIA 5LMUF 4IH5A 2NXCA 3NWGA 4M3ZA 3L95X 1VDHA 1J5OA 2QYCA 3RVCA 4N41A 5K14B 1QSYA 2QN6B 3HHKA 3N9UC 2RILA 2BKPA 2I9SA 2OI2A 4DSKA 3GCXP 1WHWA 4AXIA 4RL1A 3NF8A 2R8HA 4OPAA 3CB4A 3DDIA 4B1ZA 1H98A 1BL3A 2MGZA 1UZHA 3MAAA 2E4LA 3HVTA 4P10A 2QEXN 5CYMA 4CYUB 2K2PA 1WUAA 5D6GA 3F56A 3LP1A 3D3BJ 1WEZA 2APOA 4QOZB 1F6TA 4L74A 2HWTA 1TYQA 1NPKA 1S6PB 2EBGA 4ANEA 2E9ZA 3D6TB 2V2ZA 4IG0B 4J5OA 4KTQA 3SUPA 2ZWOA 5IXUA 3DOLB 5AE2A 4RO0A 5KFNA 3EEQA 1TUVA 5AQFA 3FZBA 1SC4B 4DBQA 1SS6A 1ULRA 1VHIA 1BU6O 3CT9A 2Z8QA 3PEJA 3O4NA 3Q2TC 2RQCA 3DKDA 1XQSC 2GAHC 4J9RA 4DWIA 1UEKA 5A8KA 3CJ8A 3O5TB 2RHSB 2QMXA 3HJFA 2ZBCA 3A8JA 1X8DA 3OR1B 2F40A 1YZ6A 3SMSA 3DRSA 3QNWB 2ZUGA 3LP0A 4DL7A 2QWMA 4BQZA 2YNHA 3W9JA 3MCMA 4LH5A 4K8ZA 3M2VA 3HSDA 1UEUA 1EP4A 4WFBQ 1YHQS 2R4FA 4N8OA 1HJRA 5B09A 4FYYB 2VV5A 1WF2A 4UZCA 2YY3A 4XDDA 3O9TA 3ZX3A 2CPHA 3TA1A 1VQ7S 4DR7K 5DZ6A 4LF8J 2RUSA 4U96A 1VRTB 1NG9A 5HANA 3KJNB 4M45A 3VGMA 1TL7A 4K0KF 3VZHA 4F4KA 5AQLA 1KR4A 5GIOA 3DI6A 4UOHA 3Q89A 3DLGB 5BR9A 5I3QA 1BWFO 4BQLA 5LSLA 1WACA 3O3LA 3FZHA 3DXKB 2J0XA 3L2VA 3HKZD 1EWQA 2ZNZA 4EFAC 3M8ZA 4BY9C 5JLHA 2X1AA 1WTBA 1RHQB 2VONA 1HI1A 3MMJA 2NZCA 4TN2A 2YKAA 4M5GA 4OYPA 3VAJA 1HPZB 3V9UA 3BGLA 2FC0A 1IKWB 3VQ7A 1X4DA 2Y8YA 2P5GA 5DK5A 3NGSA 1QVFM 2BANB 4MFBA 1T8EA 4W5TA 3G25A 2PBDA 3MR5A 3CQXA 1M90T 3LP2A 5GADU 4H0PA 1UWBA 4U9RA 4WFBL 1J5EJ 5FDLA 4X64K 1B70B 2CADA 4ZJLA 3LM9A 3AB4B 4TY9A 4QS9A 5LOQA 3DXMB 4UUXA 3DLKB 4B3TK 4NCAA 1GOAA 2CXEA 2Z30B 2QIFA 2Q0RA 3MPVA 3CC2N 4JI3F 1HNXJ 5KG3A 1T6CA 1YHQN 3ENAA 2G8VA 3KDNA 4JI6F 4RKUC 5A2QY 4UZBA 5LMNF 4WTOB 4JV1A 3AQOA 1ZBTA 5CYQA 1VQ7N 2J7KA 2ZD1B 1TFWA 5C42B 1E4FT 5IM0B 4WZQA 2ASPA 4F50A 3B4DA 3KG0A 4IWVA 3MXJA 3O1BA 2E5HA 5JMNA 1IBMK 1FJGJ 1P1TA 4BHQA 3JAMO 4QWDA 1FF2A 1DTTB 2MZQA 2VFRA 3WXMB 5RUBA 5LJVA 5AJ3J 4M3UA 4Z7YA 1Q86T 4HVJA 4CBWA 1LOTB 4BC3A 4ZPAA 1U2VA 2I2YA 1HBMB 3CCZA 4USUA 2HBLA 3ZTRA 4IFYB 4QU7A 1Z05A 4FXVA 1HNIB 4OZ2A 4J7CA 1U1PA 1LWEB 2J8SA 3AJDA 2MKIA 4K4SA 4KTWA 4DV1K 3BQ2A 1SKWA 5GAHP 3HFVA 3QBXA 2FSNA 1UVKA 2HBMA 1K6YA 2YHYA 5CZVA 3NL0A 1DY3A 4RW7A 4FVMA 2HYIB 4CJQA 2K06A 3TX8A 1RHKB 7FD1A 4FVCA 4FS2A 3G86A 1RI7A 1G7CB 3D2FB 4A8WA 1RKJA 2FQQB 3F44A 3GONA 3LDNA 3NG8A 4M5DA 3MR6A 1VQ6S 2BGGA 4L76A 3VTIA 4DPOA 4HACA 5AE3A 5KFIA 2RSQA 1FRXA 2FIUA 4YS2A 4FJXA 3IO1A 1BIZA 3D66A 3GG0A 1E3MA 3QIDA 2IYGA 3QYYA 1XNQK 3BO2A 3TANA 3NGIA 3MAQA 5EXWA 3ZCMA 1T3NA 3QBCA 3MPWA 1RU1A 1WG5A 2MMYA 1FFWB 2FJEB 2P9LA 4NXNK 3KUEA 3WNEA 2ILYA 1ZAXA 2ZQBA 4IG3A 1RT5B 3CF5Q 1H38A 4JI2K 4R8UA 4ECUA 2CWKA 3UD3P 3IFEA 4OX8A 1EETA 3AVHA 4DV3F 4URGA 1V3ZA 1S1VA 1Q8KA 5AQJA 1DBDA 3HK2A 1A7GE 3BS9A 3BUZB 1FXDA 2MZTA 4B3MF 2AX0A 5ETMA 4HHUA 1IJEB 1LFWA 1IVZA 2QL7B 1U26A 2Q79A 3DLLQ 1CJTA 1CSJA 2JZ5A 2AGQA 2QGFB 3GJRB 1LW2A 4OI6A 1BXNA 4BRCA 4BE1A 1FI4A 2HNDA 1UA1A 3HSGA 4CF8A 4OI3A 4X4UA 2E6MA 3VAGA 1S76D 4I6MB 3EX7B 4DKWA 4K59A 3CJBA 4PHTX 3C3LA 1X60A 2CZVC 4D3HA 4DSFA 2A3ZA 1Q1KA 1RTJB 4DTJA 2L3MA 1J9AA 3UO0A 4RNOA 4QAGA 4FW2A 1FJEB 3GYGA 2VFTA 4H0TB 3ID8A 5EHHA 3L2WA 4C0BA 1UVJA 2H3EB 2ZGZA 4Q2MA 1CG2A 3PFEA 4A8QA 1VQ6N 2OEKA 5SZTA 1NZ8A 3NRBA 4FJ9A 2IRYA 4RNMA 3ZETA 2KRRA 2MQNA 2AIRB 2B43A 4OKEA 5KRTA 4LR9A 3T5JA 1Q5VA 1M5HA 1FE0A 2EKYA 4FYVB 5KOXA 5KFMA 3C2PA 1XC9A 4KB7A 3L2UA 3TZZA 4J9OA 5AQVA 4GMKA 2XYGB 2YPYA 4U7UD 4RNNA 3DOMA 3WQPA 3KKSA 3GP9A 1N5QA 1I39A 5EU7A 3CJ2A 4WF9L 3A13A 3D1QA 1CVJA 2R7VA 1QAJA 2AJ0A 2ZOMA 3DYAB 1FRLA 4PG8A 5ETVA 1S1TA 3D2EB 4BRAA 3J81Y 2CG4A 4A8YA 4DV2K 3VQ5A 3ZSXA 4OVLA 2XZDB 2YPZA 3QSIA 3QRQA 4FKYA 4HDHA 1Q8BA 4FNHA 2PSZA 5C2GA 1KOOA 5D4NA 5EX3A 1RE1B 3KLFB 4A2BA 5J2QA 4D3GA 2D0CA 4DR6F 1VK8A 3FQKA 1ILYA 4GVLA 1XR5A 3DRYA 5KFBA 5LXYA 2P6TA 2PAVA 1RABB 3M6GA 1JCGA 3VPZA 1ASWA 3G6ES 1SKUB 4F4YA 1R6VA 2PDAA 2CYYA 2CQ2A 4M3YA 1GMWD 2LXIA 2WRMA 3AODA 4B1XB 1IQZA 2A6MA 2RRNA 4EGLA 4DU7A 5KG2A 1JJ2R 1ELOA 2L48A 1H3DA 3PW7A 4NLUA 1TL1A 3I0RA 2KT2A 5K8MA 1QY7A 1JL2A 4NL5A 3ILIA 5GAGU 1OIAA 1XMBA 5AQZA 4BG9A 1W9HA 5ETQA 4NI2A 2DHGA 4JI4K 3LPUA 4WWSA 1D3WA 1DURA 4A8OA 3HSTB 1X4CA 4RUHA 3HM8A 1HL6A 2YNGB 1N8RO 3CCVS 1Y11A 1C1BA 1HHSA 4B17A 2OFHX 4AM7A 4LD0A 3MMBB 4J9LA 1KP6A 1IWGA 3QT7A 1WF1A 3ETOA 1FNXH 2AEJA 2EC0A 3EVMA 4X65K 1NK6A 3UD4P 3OD2A 5J2NB 2FD2A 3US5A 2E5LJ 3AQPA 4BC9A 3SMZA 4AH9A 1FXLA 1MNEA 1CLQA 2D1CA 1N4LA 1MMDA 4YNQA 4EU0A 3O1LA 4Z4CA 3LDLA 3IGNA 1FKPA 4CLPA 4AYBD 5F2RA 2KVIA 2DFHA 4QCLA 4F2RA 2QTWA 3IA0A 3OBIA 1QAYA 5A8WA 2A6OA 5F0XA 4GKJJ 4BRPA 2ILZA 5U47A 1OH7A 1NGGA 1IH7A 4HVZA 4LF4J 3K9JA 3G6EN 2N3OA 4ZP9A 3UW1A 5B0EA 4KTZA 3CJKA 2NZ4A 3BGFA 5HI7A 4DV7F 4HCCA 3MD3A 2VG5A 1XUPO 2IS3A 3H2VE 4BGAA 3JXUA 3O9SA 3ENHA 5D0EA 5BPLA 3CO0P 5GAEP 2CZ4A 4JI1K 2CG8A 3JQJA 3WBZA 2B5JA 4CHYA 4AQYF 3TQ1A 1XMQK 2BMBA 4QU6A 4I68A 1QUPA 1FERA 3MEGA 3KLHB 2VIHA 3KWMA 1B7YB 2IDEA 3SYZA 5EWGA 1D0EA 3UFCX 2MQMA 2B8PA 3IWNC 2RU9A 2GA7A 3GDQA 4ZHRA 2ZJRQ 3SAGA 4LF5J 3CCVN 5EOYA 1IBCB 4RNHA 4H4MB 4Q0BB 3VF0B 2YKOA 1PILA 4Q7AA 1XMOK 2QC3A 3TA0A 1RWKB 2W2MP 3KK3B 2IM0A 3J81O 1HNZF 4V19S 2FZKB 9RUBA 2W25A 3F5TA 2XS2A 1S7IA 4YOTA 3QESA 3L4BC 4P75A 4KYZA 3HZEA 4DV1F 2GUPA 4OJHA 1YJWS 3VQAA 3U7JA 2AYMA 4G1QB 2ZEJA 2J9DE 4NMXA 5H9FK 1SCJB 2IBKA 1U04A 2YCHA 2IM2A 4IR9A 4CEBA 2W4PA 3KK2B 3T5KA 1Z6RA 2FVQA 2ZZMA 4H8KA 3GJQB 2I8EA 2VKRA 4IDHA 2MY8A 3O8WA 4H5TA 2XO7A 3GV5B 5HQLA 3GG1A 1VHXA 3RZAA 1DQAA 2E5GA 3SI8A 2Y3YA 2F9JA 5CD4A 3U9ZA 5EX5A 3ZSWA 3RMCA 1R0AA 4WYWA 3M2RA 1C0UA 4LFCF 2AT1B 2EKNA 3OTOJ 4ID1A 1TKZA 2WTUA 1KLMB 4ZLJA 3FEZA 1EXQA 4YR2A 2L9DA 1D5AA 2E1CA 2H65B 4OYMA 3J7A1 3V4IB 4M1KA 5I9EB 1RWUA 1RBSA 2WK4A 4FLWA 2HVIA 2WBNA 4J9NA 2BM1A 5AQNA 4ZLPA 5HROB 3TU5A 2ZUAA 1KQFB 3IRXB 4ED7A 1SJRA 4H0VB 4FPIA 2UVRA 1FX4A 4NYOA 2XCAA 2H5EA 3GIMA 2UUBK 1IUJA 3UDVA 2M52A 3MM9A 1YRTA 1XNRJ 5DRKA 4OJ1A 4QWCA 4TSXA 2J9EA 3IAM9 4ERDA 3GIKA 1FWKA 2FF3B 5ETSA 5B8HA 1C0TA 5DDOC 2B9XA 3QO9B 4MMOA 4JV5K 1WF0A 1SBRA 1JMTA 4K8RA 4DG1A 3QNNA 5KFCA 2XB2D 4MT1A 2UV8A 1NDCA 1A5XA 3PDNA 2HQ3A 3M9MB 1JLCB 3VERA 4CO3A 4GNIA 3CTRA 3J7Z5 2RRAA 2YKNB 1N32K 3RYLA 1NPPA 1KHVA 1HWIA 3H5SA 3ULHA 4E1MA 2HFVA 2V4JB 2GZOA 2XCPA 2W7AA 1JNRB 2VPZB 3CVKA 3BSCA 4FZYA 4PQAA 1HQ2A 1HYSA 2CDQA 4U8YA 1ACMB 1UL3A 1NJWA 3ZT2A 4CO0A 1WC6A 2G9OA 4ZLLA 3NGYA 3HZGA 4W5OA 4Y65A 2YI1A 3K2YA 1RA7A 2WONA 4C3KA 4LFBF 3Q22A 3IR6B 3T41A 1RDBA 1I6JA 2OAUA 2DK2A 2PE8A 3ZNJ1 4RG8A 1RTDB 2QFIA 1RQ0A 3OT9A 5HVGA 2W41A 3B78A 1QVGR 2P9GA 3R5AA 4Z94A 1CQNA 1Y5IB 3C6TB 5BR8K 1U45A 2R8GA 4LF7F 4IDKB 1VHFA 2WVDA 5KFEA 3EZ5A 4HTIA 1S1UA 1KQSM 4LMZA 1RFQA 2ADBA 2XSFA 1NK0A 3MECB 3I4HX 3SDEB 2DNNA 1B4SA 3EE9A 2LXUA 4CLLA 3CCMS 1OYEA 3F41A 5CXTA 4E7IA 4CEQA 2MJUA 5ETKA 2R7WA 4XDCA 2VOPA 2KKHA 4BR0A 1C1CB 3UDEA 3CJ7A 5CY4A 4ENOA 3H08A 3NAIA 3SQ1A 3IP0A 5HBMB 2DXFA 4QW9A 2F3JA 1NGEA 3S3OA 2K8GA 1N34F 4RW9A 3AA8A 4RWTA 4IQMA 2YWKA 3PIOL 4J2DA 4IO8A 3QT8A 1NHUA 3D3CJ 4LQ9A 4FLUA 2J9DA 2G2YA 4AHCA 3NVKA 3MTJA 4YR0A 4X4OA 4NLXA 2MDAA 4UF4A 3ENQA 1ESVA 3VMFB 3ALYA 3T9NA 2EVZA 4CDIA 4GVBA 1ZH5A 4F0HA 5E26A 3QFWA 3G4SS 3BZCA 3BGOP 3PR4A 3I87A 4NXMK 1CQMA 2VICA 3CDUA 3VEYA 2AGOA 3D7EO 3MDFA 4UY8O 1CJKB 3KJVA 5EUHA 1Q7LB 2FBXA 3NS5A 1IO2A 4DQIA 1UW9A 2QMWA 1SVDA 2E7WA 1IR1A 4KHWA 3AVLA 4KHRA 5LY3A 4W4MA 4UOCA 1P27B 4OO1J 1HHQA 3E8OA 2VF3A 3FCHA 2GWKA 1EJ7L 5E7OB 2NUUG 5KFGA 1FRJA 1CULA 2HG4A 1FKOA 3HVAA 1RT1B 4MO4A 3CCMN 3BSOA 1V9OA 3G2XA 4JKGB 7FDRA 2FY1A 3RAXA 3AARA 3PJXA 3SCXA 2HVEA 4CD1A 3UCGA 4ZVTB 2C3OA 4CJTA 1S99A 4RW6B 3ZSOA 2V5HG 1FDDA 2LVWA 2R7OA 1RWMB 1T05B 4BRNA 4Y2KA 2CZ9A 5M1OA 2DKOB 3P8BB 2E1YA 4QJVA 4YY3F 2OELA 1QE1A 3EE8A 2HIQA 4IOCQ 4CJ3A 3CMQA 3PW2A 1VCTA 2DH9A 4X62F 4B02A 5KGWA 1WN7A 5KPZA 5KGXA 2WW4A 3RBXA 3D54A 3LUYA 3W61A 4CTAB 4RU2A 4NB4A 4KJIA 1YRUA 3AD8C 5HLFA 3RG6A 4DR3J 4Y2AA 3BH7B 3IM8A 2L9WA 3G4SN 3IG1A 4B9TA 2GV9A 2O1PA 2HNYB 1WDTA 1T9WA 4B9VA 2NLWA 3BO4A 3ZEUA 4H0YB 1X3NA 1WUUA 2LU2A 2HLUA 5DS7A 1S57A 4M5IA 2ERRA 2JSXA 4ZP6A 3F9MA 1HKCA 4OZ1A 3I55S 3LGHA 1TP7A 3AVMA 4P2MA 5AQYA 4WFXA 2GJIA 1IKYB 3LAKA 2QLJB 4I56A 2X1FA 1REGX 1RYRA 4WBFA 2HOEA 1VQNS 3PKYA 2YX7A 3OHAA 4E7KA 2RIJA 4QR0A 5D4OA 4DPTA 4ZVFA 3BB5A 3IMXA 1KTQA 3HT0A 5AZIA 2MKCA 4FNIA 4LF6F 4FJKA 5T7BA 2KYXA 2E66A 4F9OA 4C8ZA 4FDFA 5L39A 2MLYA 3OVAA 2FBVA 1K0VA 3E66A 5HMYA 1SJ4P 4OPHA 3PEHA 4DHYA 3TPQA 5KQDA 3GSDA 1MWMA 2NRRA 3TAMA 4P2SA 3KK1B 3M8QA 2GVDB 2ROGA 3TSUA 3UKRA 2R42A 3PRVA 1SIZA 1VR6A 3PLAA 4I2QB 3BPDA 1S48A 1NSPA 1GTEA 4PZVA 3BBCA 1R0CB 1PG5B 2E2OA 2F1FA 2HQGA 5F3TA 1R0BG 2GMJA 2WBMA 4NXNJ 4GKKJ 2P9UA 2DFFA 4CIEA 5KFXA 2FB0A 1WC0A 1GNKA 4NZ7A 3MXIA 2JVOA 4LC9B 4JI2J 1RDAA 2U1AA 4ZKAA 3AV9A 5E3PA 2ZITA 3TAFA 1ZETA 1QHTA 2P9NB 2NR0A 2OMLA 4DXLA 4I1TA 5BYRA 3I55N 5B7WA 4JV5F 1I3OB 1J2VA 4BC4A 4I6WA 1RAIB 2OPPB 3R97A 1VQNN 4JUZA 1FESA 2IVPA 1RAAB 2W40A 1NLVA 4E89A 3CJ5A 4OPJA 3O1WA 5T14A 1S6UA 3ET6B 3VAMA 3CUNA 4CGHA 3BY5A 4DR4K 5AQKA 1U09A 2ZWPA 5TKYA 1HQEA 1YVNA 3TZWA 2ZKTA 1KVBA 4F2SA 4JKHA 2POKA 2YX6A 5HRRA 4FSVA 3DRRB 4YEAA 1K8KA 2UU9F 3VVUA 5BRDA 2LU1A 3G8TA 4KO0B 1I3AA 3MTKA 2C42A 1WOPA 4DTOA 2XMWA 4NPOA 2RDDA 1S22A 2QTDA 1H72C 2E9TA 4O0JA 2F96A 4PWDB 2JFKA 1R27B 2C2DA 2VG6A 3U6FA 3NOCA 4V19X 5K8NA 1N6QA 3CCWA 2UXBK 2CA9A 1GOBA 1E6YA 2OPRA 2R8KA 3VCDA 3I56N 1UP1A 5L1JA 2IPOB 2XC9A 4WK1A 5A2QU 3MM8B 3TJAA 5J2MA 1HQUB 2YWFA 1XQIA 2NXEA 2A1RA 4H5VA 5F9NA 1BMQB 3H45C 1YTUA 2HHHK 3K7RA 2L9NA 2WVBA 4H03B 3KLVA 3THWA 2H9ZA 1OSCA 2P6SA 4WYBA 1KDNA 4C0HA 1TL3A 1T7PA 3QEPA 1OO0B 1MN9A 1KN6A 3E9OA 4M8LA 2ZBRA 2JLFA 1WG4A 3EN9A 2FUG9 4L3KA 2E8AA 3NBPB 1UPPA 2P5VA 5C5JA 3Q24A 4K41A 3G82A 2J8AA 2OPQB 3M1VB 1HR0F 5E3QA 1NK4A 3ZTSA 2XLJA 2HNZB 5FLXY 3W9IA 2XHWA 1GTHA 1IM6A 3J7ZT 2WTFA 1SQKA 5ETTA 2IDOA 4DR5F 3I5BA 3QQCD 1C0MA 1DGKN 4KH5A 4DU8A 4CZKA 2GBZA 2IFXA 3HZ6A 4R5PA 3DWLA 5IWAK 4ZVUB 1URNA 2GQCA 2X51A 4BR5A 4BRHA 1NDPA 4CD3A 5L46A 3SQGA 1BQMB 1X0FA 4M95A 2CGJA 1VQ5S 2A2DA 4JB8B 1WHXA 1WC3A 2KZMA 1KVCA 4URQU 2LQJA 2IIRA 4PUOA 1DTQA 3DNCA 1NB2A 4DV0F 1QDUB 4K4XA 2JDJA 4QIEA 5KRSA 3SBTA 3OXGA 3NF9A 4IRDA 3CNQP 2VQFF 3BYRA 4FWPA 1S59A 3VEVA 2HRUA 1U8WA 4DR1F 3L3CA 4M42A 1PBAA 1ZTWA 3H90A 1HMVA 1Y5NB 4FWNA 3WNHA 2D3ZA 2O8CA 1RAFB 3CCLN 2XMVA 2YKPA 2Y0SD 1RAHB 4OHWA 1YVFA 1RT2A 4MH8A 4JHDB 1CJUB 4F4XA 3SXLA 4WQ4A 3ITHB 3R8YA 2ZE2A 3KMQA 2B6AB 1FXRA 3W3DA 2DEIA 2HSEB 2HBQB 3S8SA 2FHJA 4OFZA 3D0HE 4Q8FA 3CXCM 3OUYA 1AW0A 2ZH2A 1O5JA 2J7UA 3U1LA 2XG8A 4PG5A 1RT3A 4I69A 3UVJB 3H4DA 1Y97A 2Q97A 3PJWA 2FLNA 3MM7A 5FPNA 1IXKA 3MWTA 1GLLO 2NCKL 1NMNA 2HQIA 4CHOA 2DNMA 3SCKE 3EWGA 4F4WA 5CHIA 5J1NA 4MKBA 3H3NO 3TEGA 1NK7A 2HF3A 1VQ5N 5LMUJ 4IH7A 3P38A 2XHCA 3G8SA 3K58A 4JI0F 1SJ1A 4C2MA 4XH1A 5IT9O 2A3JA 3C14B 4UTGA 4CGFA 3VQ8A 2OA8A 3KD5E 3E9PA 3VGUA 4J8FA 1FVQA 1YLXA 1U1QA 2XHBA 3A4TA 1M5OC 2AQ4A 3C94A 2ZM6F 2RF2A 1VQ8S 3R3LA 3MFIA 3J80U 1VQ9S 5EY4A 3H20A 1HBUB 4FJ7A 3TR5A 2H48B 3HPOA 2DGVA 4PYDA 1RBTA 2WFBA 2EFVA 1ZBLA 2RQMA 1JKHB 4ID8A 3ONQA 2XMMA 4IUFA 2P51A 3WEEB 2XSJA 4I9LA 4MIAA 3IMQJ 1SUQA 1W0HA 1JWWA 5KQ8A 1M1KT 2W4CA 4C8KA 1YVUA 4IFEA 3C46A 3I4PA 2V9KA 3SCIE 1KVJA 4PWUA 1VSMA 4ZPWR 3C6AA 5I42A 4AT1B 1U1MA 3QEWA 5AQXA 2FF6A 1FRIA 4BR2A 2KFYA 4JAXA 2OSQA 1U7LA 4ZS6A 4K0KJ 5AQWA 3CCRS 2VQEK 5HAOA 2CPJA 4URSA 2WSEC 1REVB 1JXVA 1VQLS 1FJCA 1CXQA 3ZT4A 4TKTA 3A3OB 4L8RB 4HTJA 2Z0GA 1VQ8N 1JIHA 4KGZB 4WU3A 1WHYA 1VQ9N 3QFHA 1NHKL 4HI1A 5KT3A 2CGKA 2W6LA 3OYKA 5IC6B 4MIBA 2P9PA 1N36K 3QWPA 1IBKF 5JVHL 4A2AA 1P9YA 2XY5A 1J5OB 4JKAA 5AZJA 3TO8A 5KPTA 4CZFA 4O0IA 2M70A 4MJKA 1X0PA 2RAQA 4CLFA 4DUZK 2GO8A 4JI8F 3T69A 2WVCA 2Q2RA 4Y34A 3HHNB 2DRBA 3W2VA 3DU6A 3OYGA 2I0XA 3K8WA 2DIUA 1BDGA 3EXYA 3ZZRA 4L73A 3QSYB 1RLDA 2UXCF 3MAAB 3HVTB 5H9EJ 4CLUA 3Q8SB 1IKVA 2BH1A 1RHJB 5CYMB 2DNZA 2Q3SA 2VPYB 2AZ1A 3OS0A 3LP1B 4A59A 2Z57B 2QG9B 1K1QA 3C66A 1TYQB 5AXLA 1ROFA 3MF5A 4W98A 4G1IA 1Q7YT 1YGYA 4JI3J 3I96A 5D0GA 4AHVA 4I2PA 4OHVA 5LMNJ 1DQ9A 2A6AA 2JC0A 4BRLA 4CJSA 2IRUA 1NSQA 4WTYA 5HQ8A 2OZSA 5A8KB 3AJ1A 3CCRN 3CJAA 2GMHA 5GVQA 1Y3KA 3ZSYA 4KHUA 1VQLN 1FFGB 4N77A 4NRTA 3KG1A 3VEZA 3DRSB 3TNVA 3LP0B 3DHXA 4BVOA 3ZSRA 4K5SA 5KFZA 2V0NA 3O9UA 3QGPA 4IZ9A 3M2VB 1TELA 3LZIA 3Q8QB 5MLCQ 4CRJA 1EP4B 2BE9B 1G1XA 3GOIA 4WKYA 2R7YA 2P9EA 4TVAB 3CJ3A 2QA4S 3SNNA 3UE2A 2HRTA 3UPFA 4AFFA 1VLOA 1TL7B 3P1GA 2HWIA 3KUGA 5C2DA 4BE2A 1TUUA 3WXLA 1JXEA 4KHYA 3BBFA 4NEZA 3V9ZA 2VA3A 3DI6B 3OFHA 3AO2A 3CERA 4PPDA 1Z26A 3L7UA 2OSRA 1R7IA 5HP1A 1R31A 4BRQA 1Q18A 3HSCA 3Q8RB 2OPSA 1EKSA 4E1NA 3QT5A 4CO2A 3AVFA 2E2NA 1L5UA 1U6ZA 3C7NA 2VYPA 2AW0A 5IS2A 5FJ4A 4DLGA 1RWNB 2GUIA 5F9LA 4MFBB 4NEYA 3T1HK 3O5BA 2EW9A 1S77D 5KFTA 3VQ4A 1WTFA 2J5AA 3AAWB 4CLWA 2HK3A 1IR2A 3VETA 3M05A 1FEHA 3LP2B 4DEZA 3CD6S 3FFKB 1WB9A 1RDWX 4B9SA 5FDLB 3CQ8A 1GT8A 2XGPA 2HBYB 3R8EA 2HGNA 3H2LA 3OTDA 3K9KA 5GMDA 1H2UX 4DQ8A 5KFSA 4DFPA 4DV3J 2YH0A 4DN0A 1UVNA 5D0HA 4C4WA 1BA1A 1SI9A 1SC1B 4U67Q 1DFDA 4B3MJ 3WDOA 3I8BA 1A6LA 2BKNA 2GHVC 3CM6A 4ID5A 1G2EA 4X66K 2QA4N 2KH9A 1UPMB 5I3UA 1FHTA 5CYQB 2ASYA 1ZYQA 4JNEA 5A6PA 3GB0A 1IM4A 4LF8K 3DOKB 2UUCF 4KR0B 3UNYA 4DV4F 3LPYA 1WI6A 2NYHA 1QHAA 1VISA 3BQ0A 4NMLA 1JNZB 3D0GE 4KT0C 3O6WA 3KKRA 5I3PA 2E7VA 3TR8A 4RUAA 3TZXA 1TAUA 4H4KC 3P3DA 2M8DB 1F0XA 3EZOA 3NH0A 4YORA 4CECA 3OTBA 1IBLF 3VQDA 3BJYA 1BISA 2PC6A 4O3SA 3BGRA 3IWLA 2GIFA 3NWRA 4U7BA 1C6VA 1U2VB 3C65A 3W60A 3VGVA 4TU7A 4ZK7M 2HAIA 4KKOA 4NYFA 3M2UA 1RDUA 1A0OB 4RW8A 4WP9A 3P5BP 3NDKA 2UXDK 4KREA 3V9XA 2I1RA 4RW7B 2ZHBA 3CD6N 4U67L 2MQLA 5KT4A 5FRNA 1NK5A 1J5EK 5CH7B 1RT4A 1I94F 1NBWA 5CHCB 5CQGA 2PEHA 3SBGA 1YRXA 4B8AB 2W01A 4LSZB 4M5DB 3N79A 1UZDA 1TGOA 1NKCA 2QE5A 3GIJA 2ATCB 1HNXK 1B9DA 4CHZA 3X3UA 3CC7S 2FSKA 1MMNA 2FDNA 4AXJA 3L8BA 3NVMA 2RD5C 3FBFA 3SV4A 1TKXA 3VVTA 2Z2YB 1NJXA 1RLCL 3H1VX 3WT0A 2VBXA 2CNKB 2MY7A 3IRWP 2P9LB 2RPIA 2OP5A 2E1MC 3HYFA 4QIWD 3UIQA 1JLFA 4DR6J 4DFMA 1FE4A 4PXCA 4IG3B 2XS7A