1HQUA

Human immunodeficiency virus type 1
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Lys103Asn mutation of HIV-1 RT: a novel mechanism of drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords POL POLYPROTEIN
total genus 125
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hquA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hquA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hquA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hquA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hquA05
3RMBA 4ZPBA 3OSPA 4BE0A 4M3WA 1QSYA 4RU9A 1JLGA 5DQIA 1WN7A 3HO1A 4ECSA 1ZTWA 5KFOA 1RT3A 3MR2A 3OYBA 1S0NA 1C1CA 3QEPA 1N48A 3RMAA 3KOAA 4FJJA 4O3RA 2PZSA 4O3NA 2JLEA 2DTUA 2JGUA 1XC9A 5CYMB 3BGRB 3Q8SB 3HPOA 3DLBA 3T1AA 4K4XA 4AH9A 3FQLA 3HKWA 2OPPB 3OL9A 4R5PA 3V6JA 3TARA 4K4WA 5HRPA 4I2QB 4F8RA 1NK9A 4TYBA 4Z4EA 4ECYA 4NLWA 3ALYA 3OHAA 3NBPB 1BL3A 1WSEA 2XY7A 1J5OA 5KT6A 3OL7A 4KKOB 3VQ6A 3N6NA 3RAXA 3Q8QB 3H98A 2FLPA 1VSDA 4F50A 1VRUA 1WSHA 2D41A 4M3ZA 3T5KA 4NLQA 4KBIA 3M8PB 1RT4A 5KFWA 3NGDA 2AU0A 4BACA 3VQDA 4KFBB 4RNNA 1Z26A 2HVHA 5KG4A 4DTPA 1KLMB 3NBPA 1IKVA 3QEWA 4CGDA 1SL1A 4DL3A 3QLHB 5DG8A 1J9AA 3O4QA 5C5JA 4KTZA 2HNYA 3OYFA 1W9HA 4DFPA 3AV9A 4QWBA 3NHGA 4NLXA 4TQSA 2V0NA 4M41A 3QGIA 1UWBA 1T03A 1G15A 3BDPA 3ZSWA 1IG9A 4EEYA 2Y1IA 1IO2A 3RRHA 1C0TA 1HPZB 3RB6A 5HP1A 4ECVA 3KLVA 3KK1B 4MKBA 1A5VA 2YNHA 3KLEB 4Z4IA 4JLHA 3AVCA 3LP2B 4Q45A 4CEEA 5FRMA 1IKYB 3PW0A 4QPXA 2VG5A 3K5OA 3VQCA 4IQXA 3D45A 4ED1A 1MMLA 4RW6B 2R2UA 2ASLA 1C2PA 3TWHA 1TAUA 3K57A 1JIHA 4E7LA 1S5JA 4DG1B 5D3GB 4KFBA 5DQGA 4WZQA 3N6LA 3K59A 1RBSA 4EYIB 2B6AA 5HRRA 3KLFB 4CGJA 5KFZA 2YHAA 1EX4A 1BHLA 4CJPA 3G86A 1TV6A 3WNGA 1IKYA 2FJXA 5JS1A 2DFFA 1TGOA 1HYZA 4PQUA 3VA0A 1NOZA 2HHSA 3BSAA 3TR8A 4NLOA 5KG1A 2BRLA 4Q5VA 1YVFA 4WXOA 3DM2B 5I42A 3PJWA 5DGAA 3KHRA 4CIFA 1LWFB 5HBMA 2XCPA 1O1WA 4URGA 1ZTTA 4IRCA 1JL2A 1EKEA 3KK1A 5JXSA 4Z4GA 2C22A 3LPTA 1TV6B 4K4YA 4O4GB 4K8XA 3JYTA 5KRSA 2FBTA 4DF8A 1YTUA 2BQ3A 2GBZA 3ZSVA 5KG5A 5KI6A 4CFAA 4W5QA 2VWJA 3DLEA 2VG6B 2IA6A 2ILYA 5F9NA 5EWGA 5CYQA 4L8RB 1S1WB 3RWUA 5EUHA 1JLCB 3SUPA 4EBEA 2DFEA 2LSNA 1TK0A 2WK4A 1NK0A 1B9DA 1RDBA 2R2TA 1KVCA 4OGCA 1SH3A 4G3IA 1DLOA 4N41A 3H59A 4EO8A 4FJ5A 5KFYA 3HM9A 1SV5A 5KG3A 3V6DB 5KT5A 4RW4B 3SUNA 4ED2A 4F4WA 3G0ZA 1C0MA 1NK5A 3BR9A 3V9SA 3NAEA 2FVSA 4H54A 4KHRA 1FXXA 4HVJA 4F2RA 4OPJA 4CIGA 4RW7A 3AO5A 4CJEA 1SKWA 2KFZA 4E19A 3SPYA 2UUTA 4KB7A 2XI3A 3I0SA 3E51A 2GIRA 4ECQA 3DLEB 1NKBA 1HNIA 4B9NA 4CK3A 3AA2A 1XWLA 3NKYA 3JSMB 1VSLA 5F8GA 1JXBA 4QCLA 3WNEA 2P1JA 2IDOA 3NFAA 3M8QA 3V9UA 1T05B 1DLOB 1S1XA 3HK2A 1RA7A 3HJFA 3DLKB 2X6NA 4N76A 1JLEA 4IH5A 2WTFA 4XPEA 4EYHB 1QHTA 4GMJB 3ZSYA 3EPGA 2EHGA 2UUWA 4Y1CA 1REVA 2E9RX 2W9AA 3TAEA 2E4LA 1RT5A 3MEDB 5KFRA 1SL0A 2XRIA 4I7FA 4NCGB 5KT4A 4CJFA 2IM3A 4J9RA 3RBDA 4AHUA 5J2MA 2RF2B 4WE1B 4ZPAA 1T8EA 3VQQA 2IM2A 3I0RB 4DTNA 3KD1E 1S1VA 1RT7A 3KNAA 4DEZA 3ZSXA 3K2PA 4FK2A 1S1TA 4CHNA 4XIUA 2AJQA 3ZT2A 5DLFA 4NCBA 3AA5X 1QSSA 2FBVA 3IS9B 3M9OB 3LP3A 4JRPA 3DYAA 4ZVHA 3SFUA 3EZ5A 2WOMA 4DSJA 4CEFA 1S1XB 2OH2A 4OGEA 3KK2A 2ALZA 4CEAA 4DSFA 4HHTA 3QEIA 1JX4A 2HHTA 3ZT1A 5EWFA 4N5SA 4GW6A 3S9HA 2JC1A 4CEBA 3SQ0A 5CZ1A 4K4UA 3IG1B 3AVIA 3ZT3A 4MFBA 1C6VA 2W8LA 3WNHA 4FLVA 4TY8B 3CG7A 2QE5A 2KW4A 1WNSA 3AA3A 2UVUA 4JV2A 1XR5A 1BGXT 1DTTB 4CJUA 5KFCA 3GQCA 1WLJA 1R0AB 1BI4A 3DLHA 3SJJA 3LAKA 1U4BA 5KFVA 2R8JA 1BQNB 4AHCA 3PVXA 4J9KA 5HRSA 4I9QA 4IDKB 2OPQA 1EP4B 1D8YA 4GC6A 5L1IA 3V6KA 3SI8A 4JRQA 5F9LA 3CJ3A 5J1EB 2O4IA 3OJSA 4IBNA 4OKJA 4DU4A 4E7HA 1X1PA 5F8HA 2GC8A 1I3AA 3CO9A 3O4NA 3DMJA 2YNGA 4M95A 2UVWA 3EZUA 3HT3A 1IKWA 1L3UA 4MH8A 4CHQA 4FBTA 1VSIA 1HMVA 3OYEA 3OYKA 4FW2A 4IFYB 3PZPA 2W7OA 3C6TA 3RB4A 4CJ5A 1NK7A 4OLAA 2P51A 3IGVA 3LANA 5HROA 5KT7A 2VG7A 2ASJA 4FJNA 2DFHA 3QERA 2XC9A 1RT3B 4FJHA 4KRFA 1RCHA 3E01A 3BJYA 5KFMA 4CF2A 3QIPA 2IC3B 4DSKA 3SQ1A 4FS1A 3ULDA 4I2QA 1CZ9A 4C8NA 3M8SA 3OYNA 2F8SA 4RNFA 2XWYA 1UOCA 4OVLA 4JUZA 1K1QA 1LWCB 2ILZA 1T05A 5KFHA 1XR6A 1FKPB 1TKZA 3I5AA 3MXJA 4O0JA 3CYMA 5F8IA 4FZZA 3L3VA 4X2BA 4DS4A 2Q3SA 3GIKA 1F21A 4FJMA 4CK1A 2BANB 2E6MA 3LP1B 2J6SA 1YT3A 2QKBA 2G8VA 1JKHB 4WYLA 4DTJA 1ZBIA 5SZTA 1RT5B 4J2EA 3FQKA 1N4LA 3O3GA 4W5NA 3CWJA 4M3UA 1QAJA 5KFIA 4AILC 4XO0A 1C1BB 4LSNA 3H40A 4KKOA 4DF4A 1TKZB 3QEVA 4FK0A 2DY4A 4CERA 4HTUA 1S9GB 2IC3A 2HW3A 3UQSA 1S9EA 4ZP6A 3ASMA 1GOBA 4Q43A 4WFXA 3NF8A 3GYNA 4EP4A 3MEDA 3CQ8A 1KFDA 1RDAA 3AVAA 3LAMA 3HL8A 3IRXB 4NRTA 1BIUA 5KFUA 4NLSA 1SL2A 2DPJA 3GV5B 4ZVGA 1VRTA 4PA1A 3F73A 3G6XA 5C25B 3SV4A 2ITGA 3M9NB 1QS4A 2BANA 4F4YA 2OPPA 4DSIA 4KSEB 1D9DA 1WSGA 4YFUA 4MFBB 3DLRA 2IOCA 3MAQA 3L2RA 3JSMA 4IG0A 3ITHA 3FRZA 3IS9A 2FJVA 1BCOA 1JLAA 4DL4A 4CJ3A 4F3TA 3LP2A 1HQEA 3I5BA 4CF0A 3HYFA 4H4OA 4DSLA 2C28A 3LZIA 4WFYA 2QK9A 2XY5A 4CGGA 3HVTA 3SNNA 3CVKA 2OPSB 2UVRA 3ISNC 4FBUA 1N5YB 3OJUA 4I2PB 1N6QB 3ZSQA 3WNFA 4IKAA 2BQUA 3QIOA 3PV8A 1LWEA 1MU2B 2IBKA 3BSNA 1BQMB 2BE2A 4MIAA 2D3ZA 3H2LA 4EBCA 3KLGA 5C24B 4KTQA 1W0HA 5KG2A 4DFJA 4C8OA 5J2NA 4O4GA 3S3MA 2ZD1B 3CFRA 5J2MB 5DGBA 2G8FA 4M45A 1VK0A 5CZ2A 2ATLA 1NK4A 4FLYA 2VG6A 2WRMA 3C6TB 1S1VB 3NDKA 2KFNA 4CFDA 5K14A 4W5RA 3P83D 4KHUA 3LPUA 1LWEB 1MU2A 4CE9A 3PX4A 3KKSA 3KLFA 3UDLA 2HAIA 3K5LA 4AHTA 2JEJA 4HCCA 3OS2A 2FLNA 1Y97A 2ASDA 1ZBFA 3DOKB 4IOBA 4ZPDA 1N5YA 1TL3A 4MIBA 1RBRA 4DU1A 5KFEA 4YMEA 5D3GA 4FJXA 3DRRB 4PWDB 3MFHA 2R8KA 5J2QA 4CHZA 2BE2B 2RN2A 5KTQA 1RTDB 1L3VA 1UA1A 5KG7A 2YKMA 4KHYA 5F8NA 5KRTA 4ECTA 3KK3B 4R0EA 1LW0B 2RDIA 4DQQA 3HVRA 3MXMA 3OY9A 1HRHA 4CF1A 1L3TA 4H8KA 3D5MA 2QXFA 3L2VA 4ZP8A 2W42A 3Q8RB 2X74A 4BE1A 2AGPA 4IFVA 1JLCA 4F3OA 1JLFA 2AWZA 4FS2A 3MR3A 1QUVA 3QO9B 2YNGB 3H5YA 2GIQA 1S9GA 3V9XA 1KRPA 4NCAA 2FJWA 1S10A 2Z1IA 2R7YA 4Q0BB 3PW7A 4E0DA 5KFBA 2GUIA 3NAHA 2D7SA 4GVMA 5CY4A 2XHBA 4PUOB 3NH1A 4URSA 4QWCA 4NLTA 5EDWA 3CIZA 3ZT0A 4KHWA 4HKQA 5F8MA 3IGNA 1GOCA 3OLAA 3E01B 3SV3A 1ZETA 3QGHA 2AX0A 1UAXA 4WXWA 4Z4CA 3CFOA 3V4IB 3MR5A 3AO3A 5HLFB 1RT4B 4M42A 3PR5B 4IH7A 1TKTA 4IG0B 4QWAA 4BE2A 1WSIA 1IKVB 4BDYA 5F8LA 3VA3A 1KHVA 3K58A 3FFIB 2V4RA 4LY7A 3BSOA 1NK6A 2HB5A 4J9OA 3M8QB 4TYAA 5FDLB 2D3UA 5SWMA 2XY8A 2Z1GA 4RW9B 1N6QA 3AVKA 3IG1A 2XGPA 5DMRA 4O5BA 2R8IA 4G1QA 4Y3CA 3MFIA 3MR6A 4GC7A 1REVB 3CDUA 1JLQA 3KLHB 5L9XA 2BGGA 4ECRA 3M9MB 4IG3B 5J2NB 1T3NA 5C42B 1ZBUA 1ASVA 2ZQBA 3DLKA 4E1MA 2NUBA 1OS5A 3QINA 3OS1A 5CYMA 4CEOA 1TVRA 1FK9B 2IM0A 5I42B 1C0TB 2F8TA 5JS2A 1Z25A 4KPYA 3GILA 4PY5A 3KLGB 2KTQA 1CXQA 2YNFB 3KLHA 1CZBA 4KHMA 3NF9A 4ZP9A 4KV8A 3DMJB 3UPFA 3QLHA 5C42A 3ISND 4KI4A 1LW2B 2IMWP 2G8HA 4YNQA 3KK2B 4B3OB 1YTAA 3OHBA 1S49A 3V1RA 3THVA 5L1LA 1FK9A 2A1SA 3EYZA 1KVAA 3OYCA 1HPZA 3IN5A 4K4VA 5F8JA 3D28A 2IJNA 2GV9A 4KAZA 1D9FA 3RB0A 1VSJA 5FRNA 5C24A 2J6UA 5KFTA 2YKMB 5KG0A 4NLPA 1RTJA 2R8HA 4CJVA 4KB1A 5KFXA 2ZE2A 1LW0A 5J2PA 1NK8A 3I8DA 1TKXA 4IFYA 2ZKUA 4DSEA 4B8AB 1RA6A 4B3OA 1JLBA 2OPQB 1VSHA 4DTMA 2B43A 3ZSOA 3OYDA 2Y1JA 2HHXA 3SUOA 2CJQA 5KT3A 3KLEA 4DL2A 2WOMB 3CM6A 4FZYA 4ID1A 4RW7B 1S6QA 4XPCA 3MEGB 3TQ1A 3V81A 4DQRA 4RW6A 2CKWA 3G6VA 3TAGA 1RT6A 4DG1A 5K14B 2IM1A 5KFKA 4DFMA 2FVRA 1J53A 1RT2B 1A5WA 1S9FA 4BWJA 3V9WA 5J1EA 4O3QA 3TAMB 2I5JA 1SUQA 3SZ2A 4YP3A 3OL6A 5KFPA 3LZJA 3NCIA 2OA8A 2JEGA 1VSEA 5E41A 3U6FA 4CHYA 3OYMA 1I39A 3QIDA 4QW9A 2ZE2B 3T5LA 2WHOA 4KO0A 1RDRA 4TQRA 4QW8A 1RDDA 1JLEB 4CJLA 1TL3B 2FVPA 4KHNA 1WSJA 4DL5A 3QEXA 3RR7A 1S1WA 2VG7B 3HP9A 4BDZA 4FJIA 1LWFA 4NRUA 4TN2A 4CJ4A 3LDSA 1QE1B 4O3OA 4ELVA 4BDPA 3MEGA 2YNIA 1U45A 4CJTA 1EXQA 4ICLB 2IAJB 3DRSB 4RZRA 4CEZA 2OYQA 3KJVA 3RBEA 1KSPA 3CDEA 3L8BA 1EETA 3OLBA 1TKDA 4J9NA 4EBDA 5FROA 1SKRA 3C6UA 4LH5A 2XGQA 2HNZB 1SUQB 2ATQA 3GV7B 3UR0A 4Z0UA 4ED0A 4DTSA 4CGFA 4B8CA 2V4QA 3MEEA 5L1JA 5EWEA 3OVNA 2KQ2A 3L2WA 1HYVA 4MK8A 5C25A 4BWMA 5KFDA 4RUAA 1T03B 1KFSA 3H5UA 4J9PA 2EX3A 1KLMA 4DS5A 4ZVFA 4ECUA 4J9SA 3SYZA 5I3UB 2F8EX 3DYAB 4KV8B 3PUFA 1U48A 4H4MB 1DTTA 2WONA 2ZD1A 3ICLA 2YNIB 2DPIA 4ECWA 2OPSA 4WZMA 2X6SA 3OYGA 4K4TA 1Z4UA 1TK5A 4OKEA 1NHVA 3QNOA 3MTKA 3T19A 5T7BA 4JS5A 1JKHA 2W7PA 3DLGA 5HP1B 5KFAA 3KIOA 4DTUA 2VA2A 5KFQA 1RBTA 2P5OA 4TY8A 4JV0A 4M3XA 3LWLA 4R8UB 3OL8A 1TL1B 2C2DA 3ZT4A 4JV1A 4FM1A 1S6PA 4ID5B 1D1UA 3MECB 4O44B 1ASUA 2HNYB 1NKCA 4B9SA 2HMIB 3SQ4A 1TVRB 4NLYA 5HROB 4G1QB 4ZHRB 3DRPB 1JLAB 4R8UA 4IG3A 2HHWA 1RYRA 3JYTB 3OYJA 3MF5A 4CF9A 4PQUB 2HWIA 1C0UA 3QGGA 3H4DA 4O4RA 3KHGA 3B6PA 3NE6A 1RBVA 4ZPCA 3SFGA 3CJ2A 1JLBB 3BSCA 2AGQA 4FJGA 1JXLA 3BQ0A 3G10A 2HVIA 2I5JB 4QAGA 3PX6A 5DK5A 4IKFA 3DRPA 3HHKA 3NMAA 4OLBA 1U09A 4W5OA 1ZBLA 2IS3A 4DTXA 1RTIB 3DOLB 3KK3A 4C8MA 4O0IA 2YV0X 4F4XA 4CGIA 2HHQA 3EPIA 4NYZA 4QOZB 5L1KA 3P1GA 1UA0A 5KG6A 1XR7A 2PYJA 1A5XA 1TP7A 4FK4A 4IDKA 1IKXB 1DTQA 4K4ZA 3DRRA 2C2RA 3RMCA 4FJ8A 5HBMB 4C8KA 3SUQA 3RTVA 1CSJA 1N56A 3H4BA 2EC0A 4FLTA 5DG7A 3DOKA 3NL0A 1NJYA 3I0SB 4NLDA 4M3YA 3L3UA 1WAJA 4DFKA 3AVNA 3IAYA 1EP4A 4LH4A 3PJXA 5KFGA 4DL6A 2B6AB 4CJQA 3G6YA 4Q44A 3K5MA 2QKKA 1HARA 1QTMA 5DLGA 4DLGA 3NGYA 3T3FA 2HHVA 3TANA 1IM4A 1LV5A 4EO6A 3ZCMA 3DI6B 2E6LA 2PYLA 4J9MA 4FW1A 3QZ7A 4EP5A 1S4FA 4LSLA 3T5JA 2RDJA 4DQSA 2FLLA 4CJKA 3V9ZA 4OPKA 4KTWA 4EZ6A 3TVKA 3FFIA 4DMNA 4NYNA 1HQEB 4YR3A 5DQHA 2WONB 1TK8A 3QNNA 4O3SA 4NLRA 3TAPA 3AO2A 2RKIA 4HYKA 2Z1JA 3QIPB 4K50A 3I0RA 1S9EB 3V6DA 2BDPA 4HCBA 3EY1A 3V4IA 1JXEA 1YVUA 1QAIA 4CJSA 5KFJA 4K4SA 1S1TB 3P5JA 1TAQA 2HNDB 2JEIA 1LAWA 1ZBHA 3K5NA 4CHPA 4RUCA 4F4KA 4RNOA 1HYSA 1IH7A 5KGWA 4KAIA 3CJ4A 2OZSA 4F2SA 2XCAA 3QO9A 2JC0A 1VRTB 3KKRA 4CEQA 2RKIB 4B9TA 4OKKA 3S3NA 4WFZA 3GV8B 1SH2A 3LP1A 3V1QA 2W9BA 4E7IA 3AVJA 3GIIA 2AGOA 2E9ZA 1BQMA 3OS0A 3VQ4A 1Q8IA 4RW8B 4H4OB 1K1SA 3PW4A 3ZSRA 2E9TA 1J5OB 4Y2CA 3LWMA 4H4MA 4CHOA 1R0AA 3GIMA 3HVTB 4HUEA 1RILA 4M3TA 3BGRA 5KFFA 1XHZA 4E3SA 3CDWA 4RNMA 3DM2A 3HPGA 2KZMA 3KTQA 3KHLA 3SCXA 2BR0A 3KMQA 3PHEA 3DLGB 1RYSA 1XI1A 2YNHB 1VSFA 1NJWA 1RTDA 4HUFA 2G8WA 2BRKA 2FVQA 2W9CB 1S0MA 1TL1A 4B9MA 4HUGA 1X9MA 1S6PB 4ID5A 2D0AA 2XY6A 4UQGA 1BCMA 4CF8A 1QSLA 5FDLA 4FM2A 3NF7A 3VQBA 1TKXB 1NHUA 1ASWA 3CFPA 3FSIA 3AVMA 4FM0A 3Q8PB 2OPRB 2HMIA 2YHBA 1VSMA 3TABA 2O4GA 4YR2A 2V9WA 1RT6B 1IKXA 2BQRA 3OYAA 4E1NA 4QWDA 1DTQB 4AHRA 4FJLA 3KD5E 4ED8A 1JLFB 3VQ5A 3NGIA 3VQPA 1Q9YA 1BISA 1RTIA 3DOLA 4DU3A 4YQWA 4RG8A 1GX5A 4KB0A 4MQ3A 3RR8A 3LP0A 4WYWA 1S1UB 3V6HA 4KE5A 4DQIA 2AX1A 2OPRA 4I2PA 4NLVA 3AO4A 4Y1DA 4CECA 4PUOA 3TAMA 4N47A 3KMSA 2UVVA 1LWCA 1RT1A 2YKNA 2YNFA 1D0EA 3AVFA 3CJ5A 4MK9A 4B08A 3HVAA 3KHHA 1CXUA 2VG5B 3H5XA 4CEDA 1S6QB 1C0UB 3TAFA 1LW2A 1HQUA 3HVWA 3NF6A 3V81B 3O3HA 4FJ7A 4B9UA 2FBYA 1D5AA 4YR0A 3A2FA 4J9LA 2ETJA 4IRKA 3C94A 4IR9A 3C6UB 4K8ZA 2B5JB 5HRNA 1ZYQA 1L5UA 2VWKA 1FKPA 3H08A 1HNVB 1WSFA 4DL7A 5KGXA 4FXDA 1RTJB 4NLGA 4NYFA 1BI4B 3PO5A 3DI6A 5HLFA 4RW9A 4DTOA 4Q0BA 3MXIA 2VA3A 4CESA 2G8UA 3TI0A 2G8IA 4DWIA 4PWDA 1JLQB 4ED6A 1S97A 2WB4A 4I7FB 3QZ8A 3S3OA 3IRXA 2A1RA 4FYDA 1T7PA 1C1CB 2XO7A 2X78A 4MKAA 2O5DA 4CFBA 2RF2A 4WE1A 4CIEA 3FDSA 2I1RA 3L2QA 3AVBA 4FVMA 3PW5A 3QETA 1SV5B 4LQ9A 5JUMA 1SKSA 1J54A 4RW4A 1HNIB 2AQ4A 4ZTFA 3PO4A 4IH6A 4E7JA 3H5SA 3CM5A 4FCYA 4ZVEA 2W9BB 3NAIA 5EU7A 3UIQA 4ECXA 4DLEA 4KHQA 2KZZA 4RW8A 1I6JA 2R2SA 4Q8FA 3PX0A 1NJZA 3NH2A 3VN5A 1KTQA 3MECA 4O44A 3U3GA 4EZ9A 4FLZA 4E89A 3MEEB 4ECZA 2FVCA 3M8PA 4Y34A 2Z1HA 2HWHA 1B92A 3RAQA 4TXSA 3NGZA 3PW2A 2D0BA 3SQ2A 4ZP7A 3KLIB 1EETB 4B9VA 3QYYA 2FC0A 5KFSA 3BQ1A 4CK2A 1FKOB 4ZHRA 1QQCA 1GX6A 1HYSB 2HNZA 4DTRA 1C1BA 4LSNB 4U7CA 4ELUA 1S48A 4IR1A 1BQNA 4CJWA 4ICLA 2R2RA 1U47A 3AA4A 3HSTB 4TSXA 3KJVB 3LALA 3AVLA 4NZ0A 1SH0A 5DG9A 3OSNA 4M3RA 4Y2AA 3B6OA 4QWEA 3OYHA 3VQSA 3SI6A 3KLIA 1VSKA 1Q9XA 3VQ9A 3D0PA 4KHSA 1NNDA 1GOAA 3C95A 2J6TA 3ITHB 1FKOA 4O3PA 2G8KA 3OYLA 4URQU 3VQ7A 4NLUA 3ZSZA 3HP6A 3BREA 3LP0B 4FJKA 3VQAA 3T5HA 3GIJA 3L2UA 4OL8A 3I5CA 2IGIA 5KT2A 1RT7B 1UWBB 1NJXA 3RRGA 4FLWA 4DQPA 1KHWA 4LD0A 2JEFA 4FJ9A 5J2QB 1RT1B 2YKNB 4ED3A 5I3UA 4RNHA 3CJ0A 4O55A 2OZMA 3M8RA 4FZXC 4NCGA 4CFCA 3HXMA 3HPHA 1U49A 1WAFA 2R8GA 2XI2A 1IKWB 1S1UA 4CJRA 4KO0B 3BQ2A 4W5TA 2P5GA 1KLNA 1X9WA 4FLXA 4M94A 4IRDA 4C8LA 1W25A 3U3YA 2FBXA 3RB3A 1ITGA 4IFVB 4U6PA 4JS4A 2B5JA 4MK7A 1RTHB 1JL1A 4I9LA 4Z4HA 4Q8EA 1HJRA 4E7KA 2W9CA 4KI6A 3NH0A 3AVGA 1HQUB 3V1OA 4J2DA 1HMVB 1S0OA 3TAQA 5KFLA 4J2BA 1K6YA 2HHUA 2C2EA 3N6MA 1U04A 1KVBA 1B9FA 4ZMMA 3PR4A 3F9KA 5CYQB 5T14A 3AO1A 4FLUA 4LSLB 1JLGB 2IJFA 2W8KA 2RPIA 4AHSA 3OYIA 3PY8A 3QESA 1XHXA 1HNVA 1BIZA 1RNHA 1RTHA 3VQEA 4ELTA 4LQ3A 3AVHA 2F96A 3VQ8A 4CGHA 4B9LA 4J9QA 2QV6A 1WNEA 4ED7A 2D5RA 1TQLA 2D0CA 4N56A 1T94A 4KREA 1CLQA 5J2PB 4AHVA 4CCHA 2IAJA 3DRSA 4OJRA 1NOYA 4TY9A 1TKTB 2HNDA 3O3FA 1RAJA 4ZTJA 2WCXA 3DDKA 1RT2A 5KFNA 3RMDA 3SPZA 1C1AA 1QE1A 1LAVA 1RDCA 1NKEA 4J2AA 2PY5A 4F4ZA 1X9SA 1RBUA 1KCFA 1VRUB 4TLRA 4Z4FA 1L3SA 4R5PB 2B4JA
chains in the Genus database with same CATH superfamily
1R8CA 3OSPA 2BW2A 4LFBF 4NYOA 2K1RA 2HVZA 3WZ0A 1M90T 3P38A 1U7LA 3HO1A 2WW4A 1NRKA 5KFOA 4DR1F 4NWBA 3JSBA 2EFOA 2Q97A 3MR2A 4DR6F 3RMAA 2G9OA 1WHXA 2UUBF 4O3NA 4DPUA 4H0XB 3Q8SB 4K4XA 2E5JA 4AH9A 1DRZA 5LL6Z 3C16B 5LY3A 4F8RA 1DARA 4Z4EA 1XERA 3DLLQ 4AUKA 5LXYA 4RX6A 3PNIA 2XY7A 2MKCA 4C3MA 3DJCA 2R7RA 1OIAA 3HF5A 1MN9A 2MYFA 3VOVA 5GAEP 3FZMA 4F50A 1CJKB 1VRUA 1WSHA 1EKSA 4DUZK 4A5AA 3FVYA 2W4DA 4KBIA 3CQYA 2KU7A 4RCHA 4X4SA 2OMOA 2CIMA 1X4EA 5KG4A 2VQFF 4LF4J 4DTPA 3QB0A 3NBPA 5KPRA 2F9JA 3VEXA 2YJFA 5D0HA 3O4QA 2P6SA 4QIFA 5GMEA 3OYFA 3N0VA 3BH7B 3NOGA 4NLXA 2HBZB 1YTYA 3W0LA 3MM9B 1DZ5A 2A2CA 2V0NA 3EZOA 1T03A 3JTOA 1G15A 2YWEA 3BDPA 3ZSWA 4BG8A 2Y1IA 1XIQA 3RB6A 5HP1A 2F4FA 2K3KA 1NDKA 4C2MA 3PFEA 4RTFD 4MKBA 2M8HA 4LT6A 2D3O1 4NPOA 3AVCA 2VBXA 4C9DA 4C1NK 3VQCA 2R2UA 1FNMA 1BWEA 1N33K 4KH4A 1RHUB 2NLXA 3OPKA 3TWHA 3K57A 1YJUA 5K20B 1WC1A 1JIHA 3KKFA 1V4TA 3GJRB 4F26A 3N6LA 4C6AA 4NXMK 4EYIB 4USWA 5HRRA 4CGJA 4A8MP 5KFZA 1ZA1B 1EX4A 1BHLA 4PKIA 3B78A 1FRKA 1HKGA 3WNGA 4ERDA 1RJJA 4FWMA 1S5ZA 3QBXA 1VQPN 1PSDA 2KYZA 1HYZA 3H2VE 4ILHA 4Q5VA 4CLLA 5CH7B 3SXLA 5AXMA 2HGNA 1GTHA 3PJWA 5DGAA 4PYDA 4ZJLA 4URGA 1ZTTA 5JXSA 2C22A 3EX7B 2VASA 1HWKA 4BS2A 2QG9B 1RU1A 4O4GB 1HKAA 1SJ3P 1RAFB 2BQ3A 3BPSP 5KG5A 1JJHA 1HWUA 2IA6A 1KN6A 4Y28C 1S1WB 3DHXA 3RWUA 2BH1A 4LF5F 4KGZB 2ZGYA 4OZ5A 4LF7J 5FPNA 2FZCB 1NK0A 3MM6A 4H0PA 3EVOA 1SH3A 1DLOA 2JFKA 4EO8A 5AZIA 5G4DA 1SV5A 4OX9F 1X4GA 4RW4B 1Y4ZB 1Y11A 1HBOA 2FY1A 2C1EB 3MDQA 3V4MA 2XBPA 3ZZ0A 5ETOA 4ANDA 5DDQC 1NK5A 1FTRA 2U1AA 3HRGA 5AQTA 4M63C 2GJFA 3B6BA 3AXMA 3V9SA 4KHRA 2HBKA 4HVJA 4CIGA 4JI4J 3AO5A 2P8IA 2DB1A 1SKWA 2KFZA 3NCRA 1VQ9N 3MN9A 1J5EJ 2R7UA 2GIRA 2LXUA 4OYAA 3ZZOA 1HNIA 4B9NA 2Y0SD 2V5HG 3S6EA 3GJSB 3NKYA 4QCLA 1JXBA 4EGLA 4LR7A 4DR7F 2EFVA 3ILLA 4KPCA 4A48A 1VQNN 3V9UA 1T05B 1DLOB 4DU8A 1RA7A 3HJFA 1EIYB 1ZBTA 2A6OA 1JLEA 2WTFA 4XPEA 1QHTA 1RWUA 4ED4A 3MMBA 2ZH5A 1S22A 2B9YA 2EHGA 4Y1CA 4Y2KA 3OFGA 3TAEA 2E4LA 4OI1A 3MEDB 3NS6A 3U9DA 5TKWA 2WVEA 4NCGB 4CJFA 2IM3A 1DJ0A 4BR2A 4AHUA 2IDEA 2CJXB 4WE1B 1XMOK 2KO1A 3VQQA 3O1LA 2XYGB 4DTNA 4DR5F 4U7BA 1WDDA 4LFCF 3K2PA 1IBKK 4P2MA 1XNRK 2ZUGA 2ALYB 4CIOA 1N5QA 1QSSA 2FBVA 2QI2A 3FBEA 3IS9B 2NXCA 3LP3A 1CQNA 4MLEA 3EZ5A 2WOMA 2LEBA 2NPIA 2OH2A 4WU3A 4Y0FA 3HZGA 3QEIA 4DPXA 3H42A 2HHTA 1JWWA 2F7TA 4GW6A 4CEBA 2DISA 3VEWA 4BC9A 4WTYA 2VIHA 5A0YA 3TWZA 2W8LA 3WNHA 1CLFA 3EWGA 1DTTB 3MWTA 4R0JA 3KZBA 3EDRB 1BI4A 3NMUA 4USHA 3SJJA 5KFVA 3N28A 4EFAC 2B4UA 1WOPA 1TUYA 2DXEA 4I9QA 1AA1B 4PHTX 3OVBA 4OO1J 3H46O 3SI8A 5F9LA 3Q24A 5GMDA 3AJ2A 5F8HA 5ETMA 2W2NP 2QWOA 2GHWA 2LP4A 4M95A 1W2IA 2NSBA 1IKWA 1SJQA 4P74A 1L3UA 4CHQA 1ZAWA 2SXLA 4FBTA 1VSIA 3BBBA 3F0NA 3C6TA 3RB4A 4Z7CA 5E33A 4ZVQB 3KUHA 2ASJA 4FJNA 3H1QA 2QWRA 2W2PP 1PC4A 1GXTA 2IY5B 4KHPK 4FJHA 4QYZJ 1RCHA 3E01A 3R6MA 4YS2A 4A8QA 5KFMA 4FVUA 1TTHB 3EGVA 3CI5A 2IC3B 3RW6A 1MWKA 5FPEA 3SQ1A 4J90A 1W2BR 1WG5A 1HJOA 4DX5A 1X7VA 1CZ9A 3DRYA 3OFFA 3L4QA 3HHEA 5F2RA 3PIOL 1KVJA 2F8SA 4B3TJ 3BN4A 3D2FA 1K1QA 1U8WA 2RRNA 3J7YP 1XR6A 4OZ3A 3I5AA 4CO1A 3NLCA 3MXJA 4ISEA 4O0JA 2DCUB 2Q31A 4M1KA 3CJQA 3ZXWA 1RDWX 3LDLA 1F21A 4B3RF 3LP1B 4IOCQ 4AQYF 4WYLA 3VEOA 5DM6L 3M6UA 3O3GA 4W5NA 3CWJA 4NI2A 4MT1A 2RSQA 4CLKA 3EGZA 2HF3A 4XO0A 3WC2A 4L73A 2DYAA 3R8EA 4FK0A 4NLBA 4ZS6A 2IC3A 4K0KF 3HOSA 5HVFA 2VV5A 3TJAA 4BR9A 2G13A 1UAWA 4W92B 1CG2A 3WXMB 3QMQA 4IJNA 3OUYA 3CQ8A 2NR0A 2VPZB 1RDAA 4WFNL 2ROGA 3LGHA 4K25A 3HL8A 4K0KJ 1WC5A 4NRTA 5KFUA 5T41A 1SL2A 2L08A 5HO4A 3UKRA 2AMCB 1N52B 1QDUB 3GV5B 4ZVGA 1YI2S 2EWSA 3CD0A 3M9NB 1QS4A 2OPPA 4BRDA 2B9XA 1VQ7S 1Y3KA 3DLRA 4KH5A 3QPIA 1FNXH 4LF8J 4OZLA 4KHPF 1KD1O 5IQQA 4PAAA 3QATA 4XAKA 2HRYA 2ZBRA 1JLAA 5EXWA 3I5BA 3HYFA 3PXGa 3O80A 5F0WA 1XNRJ 2WVFA 2LFVA 1U24A 3WUHA 1FRXA 3HVTA 4FBUA 4ZN3A 4ZJQA 1N5YB 2HVEA 5E2QA 3QIOA 1CVJA 3NVMA 3CPWR 3WEEB 4JI7J 2BE2A 1WI8A 2D3ZA 4YHHJ 3KLGA 2OD6A 1AB8A 2E7VA 3GJTB 4C8OA 2VFRA 4O4GA 5IC4B 3S3MA 2NRWA 4BRMA 3UDVA 1JK9B 4CYUA 4X4OA 2WRMA 2FJDB 1S1VB 2Z56B 4DZDA 4JKDA 3F5TA 3EMTA 2DR7A 3DC2A 2VCPA 3P83D 4KHUA 2O8FB 1WKLA 5DDRC 1LWEB 3AD9C 5HMZA 2HURA 2JEJA 4Y6IA 1E3MA 5IT9U 4DXLA 2OP5A 3BV8A 2VODA 2RB7A 4BRGA 2BKOA 1ZBFA 3AAQA 2FC8A 3UKUB 1N5YA 2GAHC 4DV3J 4MIBA 1FWLA 1U25A 4WQ4C 4L72B 2A3ZA 3DRRB 3MFHA 4CHZA 2BE2B 3KJNB 2LKZA 1RTDB 3I56N 4PPDA 1L3VA 2A42A 1SIWB 3T1YF 1TL5A 4JI4F 3SSSA 3NGUA 4CP5A 4DV5K 1LW0B 3OY9A 4PKDB 4CF1A 3W3DA 2MB0B 1L3TA 4ZCMA 2XZTB 2LDYA 1U1QA 4WP8A 3BUZB 2AWZA 5A2QU 3MR3A 3IR5B 2UP1A 1LXJA 4KT0C 1KRPA 4L3NA 1GLLO 2CA9A 2C3UA 2W2MP 3KNGA 3MMJA 3AT1B 1S10A 2C2OB 3MCPA 2R7YA 5JVGQ 2ROPA 5H9FK 3ZTOA 3MWPA 3WXLA 5KFBA 4NEZA 3GCXP 4H03B 4PUOB 4URSA 5BR9A 4LF6J 2M70A 3NEKA 4KHWA 3QFPA 1FE0A 4G6VB 2AEJA 2VHGA 2O1PA 3M5RA 1NAQA 4Z4CA 2OELA 5AQQA 4NMLA 3GL1A 1URRA 5JLHA 1RLDA 3OTEA 1KC8T 3E9OA 4IH7A 3OTCA 3ZFVA 4BE2A 2OFGX 1IKVB 4BDYA 2AJ0A 4PL8A 4B3MJ 1KHVA 3MCAB 3K58A 2JWNA 2XHCA 4LY7A 2U2FA 3CJ9A 3RYLA 4IJAA 2XWXA 2PMWA 1NGIA 1NHKL 4TYAA 5SWMA 2FZKB 2HZVA 2XY8A 4E98A 3I31A 2I8EA 2NYIA 4UOGA 4DUTA 2DNYA 4UF4A 5F41A 5AQUA 2R8IA 4G1QA 4X4QA 5M1OA 4AQYJ 1HNXF 3MR6A 5L9XA 2KVQE 1YJWN 2BJ1A 2A0FB 1SQEA 4YB7A 3TYTA 2GFFA 3DLKA 1HBMB 4E1MA 2NUBA 3OS1A 4KH1B 4NXMF 4L75A 5B0DA 3AD7C 1FK9B 2IM0A 5I42B 3K5PA 3W9HA 1C0TB 2VOPA 2OEJA 2F8TA 5JS2A 1GMUA 4BRAA 1G7CB 3TRGA 3N4QA 4GVBA 4KV8A 3D2WA 3MD1A 4M5DA 2E5GA 4H5RA 4KY3A 3M8YA 2KHDA 4KI4A 1NB2A 2OHDA 3SJHA 3I96A 2IMWP 2E1ZA 4YNQA 1HNXK 1S49A 3THVA 2Z57B 3B54A 1Y64A 2IRUA 2JL9A 2JVRA 3CGIA 3P96A 2XMVA 3MDFA 3ZZZA 2I6WA 3SIPB 5FRNA 2VOOA 1JNRB 4NLPA 1RTJA 4KB1A 3VAKA 1JJ2M 2HFSA 5J2PA 1NK8A 4I4BA 1TFWA 4IFYA 3MPVA 4DSEA 1IG8A 4B8AB 4WIQA 4B3OA 4CM2A 1JLBA 4DTMA 4RPFA 3ZSOA 3MI7X 2WZ1A 3HOTA 2BKNA 2B4OA 2WOMB 2EFNA 3GBTA 3BP8A 4DQRA 4FL9A 1ZM4A 1S0VA 1V5VA 2BJ7A 1U8SA 2QA4N 5K14B 2IM1A 2O3DA 4DFMA 2FVRA 2DNNA 4BWJA 5BRFA 5J1EA 2I5JA 1FWKA 1N32J 3SZ2A 3RW7A 4ZCIA 2APOA 3CD6N 1VSEA 3DXMA 4IYQA 3U6FA 4CHYA 4DN9A 1B3TA 1UVIA 1Y0HA 4TQRA 1NSQA 3TP2A 2FVPA 4KHNA 4HI1A 1EO1A 3QEXA 2DIUA 3WX4A 1FNOA 1ULRA 3FK4A 4MKVA 1PG5B 5E3AA 1W97L 1LWFA 2A18A 4CJ4A 1NCLA 3LDSA 2F5GA 1GQEA 2P9NA 2HHHK 2UUBK 1X4HA 5K8NA 4RZRA 3QFUA 3U4LA 3OW2M 3L8BA 1U0HA 1TKDA 2NXJA 2F7VA 4EBDA 2AKWB 3SQOP 4LH5A 3UR0A 4Z0UA 3VGVA 3QFWA 2MGZB 3C6AA 3MEEA 1FFSB 5EWEA 1RBOB 4TVAB 1NMEB 2J8AA 1HYVA 4JI6J 4EI2A 1T03B 1F6TA 3FZLA 1KDNA 3OXLA 1SC1B 3WQTA 5M1PA 2O01C 3SYZA 4YOTA 5I3UB 2KXFA 1Q86O 2ASMA 1N36K 1NWKA 1Q5YA 3NGTA 2V50A 3E9LA 4EMDA 4K4TA 2B8QA 3A3PB 1HNXJ 3QNOA 3A8YA 3MTKA 2PT0A 3JQKA 3T19A 2UUCJ 2F9TA 3DLGA 3P45B 2E44A 2G1DA 4OLOA 2ZGZA 3BO3A 4M3XA 1OY9A 3E9PA 2C2DA 3VGKA 4JV1A 4FM1A 4Y65A 2ZH4A 3SCJE 3TVZA 3VAHA 1IBKF 1Q81O 1NKCA 5I9EB 4B9SA 5IV4A 5RUBA 2HQFA 2OSQA 2QT7A 3T9NA 3FSXA 4BRNA 1RHJB 4KGVB 3R6GB 3GYXB 3P4IA 3VEVA 2XS7A 5AQWA 3DRPB 4RUHA 2RMLA 1VFJA 4IG3A 2BUNA 4DKWA 4AM6A 3MWBA 1OH6A 3GFZA 3R97A 4ANEA 3CJ2A 2MMYA 1MG7A 3CDBA 2CNLB 3UE5A 3BQ0A 2GUPA 3D1QA 3CMES 3RVCA 2OIHA 1DT9A 4DV6K 1RTIB 2YV0X 4F4XA 4CGIA 3I56S 3GMGA 4QU7A 1ZXOA 2P6TA 3F41A 1UA0A 3GP9A 3EDQB 3G96A 1IKXB 1PO6A 4JI1F 5FIIA 2Q6BA 3WEEA 3IWLA 3DRRA 3MAAA 3DAWA 1FJCA 3RTVA 4NXMJ 3H4BA 1FVSA 5HQ8A 2EBEA 1UPMB 5LM7E 1WEXA 3G9CA 2J8SA 2D0PA 4NA3A 2DGQA 3NL0A 2W6KA 4NLDA 4JI5J 1FRJA 4DFKA 3LM2A 3AVNA 3A13A 1R8PA 3PJXA 4B3RJ 1ATRA 2G0JA 1D4XA 3IUCA 2CPYA 3B4MA 4DLGA 4BC7A 4CNZA 1EARA 3GTYX 4QBUA 3A4TA 1IM4A 1LV5A 4P71A 4H0VB 3DI6B 3T69A 4J9MA 2ZH8A 1S4FA 1S7IA 4LSLA 3MM5B 1F9EB 3T7ZA 3T5JA 4DQSA 4FYVB 2FLLA 4KYZA 3O2IA 4EZ6A 4TU8A 1WACA 3FFIA 4BRCA 5E7OB 4YR3A 5ETSA 1VQ5S 5DQHA 3O08A 2AEMA 4NLRA 3CCMS 3AO2A 4CZCA 1XK8A 2DNRA 1KQGB 2W25A 5LT5A 4HCBA 2CNNB 4YN3B 5ETNA 4L3KA 1QAIA 1VQKN 1QZ5A 3WXJA 1LAWA 2BTFA 4CHPA 4F4KA 2HQDA 1AFJA 1RGVA 4YB6A 4LRBA 4F2SA 2IJRA 2DHHA 2N4DA 3UNYA 4HHJA 2O8BB 2HKEA 4QR0A 2G0CA 3W5XA 1XN9A 2G1HA 4CEQA 3GSDA 1VRQC 4OKKA 4M5IA 3DLLL 2HBJA 4CTAA 3V1QA 4YUDA 2JLGA 3AVJA 1NGFA 4J7CA 1Z2ZA 3F56A 2Z2YB 3N4PA 1FDNA 4H4OB 3C3LA 4YHHK 3G25A 3VETA 1K1SA 5BPMA 3PW4A 4B3SJ 2NRVA 3LWMA 4H4MA 4YOWA 4ZKAA 3SAFA 4HUEA 5D77A 1RILA 4DV3K 3OR1A 4M3TA 3BGRA 4JI0J 3GG1A 2ZBIA 4MAKA 3KHLA 2DD8S 1RWNB 3M6VA 1VSFA 3J81O 3CJKA 1PJ5A 2BRKA 2QWNA 2FD2A 2CWKA 1X9MA 1VIXA 1P9QC 3VR1A 2PD1A 3CFPA 1ASWA 2YX6A 3R1XA 3AVMA 4PWWA 2YHBA 4Q2LA 2P2CB 3H3OB 2CZVC 4CZEA 2CPIA 2V9WA 2OGUA 4DZ6A 2PFFB 2ZOFA 1BHNA 1LEOA 1Y5IB 2CQIA 1R6VA 5EVZA 4DPWA 2HFVA 3Q83A 1B0PA 1RUSA 3DOLA 1QD1A 4DU3A 1FRMA 1V4SA 1KOOA 1WEZA 2WVBA 1EQ0A 1WORA 4WYWA 3I4PA 1S1UB 4USKA 3V6HA 1WC6A 3C7NA 4E8UA 2AX1A 1EQYA 4X4UA 1Y7PA 2OPRA 4I2PA 2DNPA 3AB4B 4NLVA 4RBTA 4CECA 5D8HB 3DXBA 3TAMA 1SVDA 4JI8F 3K17A 4JD2A 2PO4A 1X4DA 4WFBQ 1MN7A 3AVFA 4KRWA 3HVAA 2VG5B 5D6GA 4DUYJ 3CF5Q 5BN8A 1HQUA 1KP6A 2CPHA 4CVNE 4H4KA 1A7GE 1UKUA 3BS9A 2PMZD 1BG3A 5ETPA 1DQ9A 4CRJA 2MQPA 4K8ZA 5M1NA 4FXVA 1L5UA 2VWKA 1WSFA 3KVGA 4PRFA 1XEZA 4FXDA 2I9SA 2ZDOA 1RTJB 4OYOA 1BI4B 2V69A 3D0GE 3BDEA 2F4VJ 3RU0A 4JI1J 2HG4A 1Q1KA 2G8IA 2WB4A 2Y1LB 2X78A 2O5DA 4CFBA 2RQMA 3VAIA 2RF2A 4IWVA 3VEZA 1B99A 2BV3A 3PO4A 1LQ9A 3H0PA 2E2NA 4ZVEA 1NZAA 4XH4A 3VTIA 4ECXA 2P9KA 4DLEA 2EFPA 3SMPA 2KVIA 3MAHA 4RW8A 2A5XA 4HTIA 1VQ4N 2VQEF 4DR4J 2P9GA 1KTQA 2PA8D 4CZHA 3ELHA 3U3GA 1BWFO 4FLZA 1AFIA 4E89A 2Y1RI 3MEEB 2FVCA 4FF1A 4X4TA 1N34K 1B92A 5A2QO 3NGZA 3R1HA 3SQ2A 4EHTA 2CVIA 4B9VA 2FB0A 4WKRA 1X5PA 3B8AX 2FC0A 1K9MO 3BQ1A 4H0OA 4JNEA 2YWHA 4LF8K 3UDEA 1GX6A 2HNZA 1REGX 1R8AA 4BQZA 1KTVA 5LSRA 1FT8A 1RI7A 1C1BA 4U7CA 1S48A 1ZPWX 1NSAA 3R5JB 4IR1A 3BO2A 2UUAF 1CEZA 3U7JA 2RHQB 5AE1A 4JI7F 2RU3A 6FD1A 2GIFA 3AA4A 2RQKA 3HSTB 4MTPA 1RFQA 4W98A 1VSKA 4ILLA 2P9KB 2V2QA 3VZHA 2NUUG 1CPZA 3VQ7A 4CLUA 1FXLA 3A8JA 2HEKA 2RIJA 3LP0B 2QRRA 1FDAA 3GIRA 3GIJA 5B0EA 1Q79A 2IPOB 1NJXA 3CJ7A 3RRGA 2PSZA 4FLWA 1LFPA 1RT1B 1VLOA 5I3UA 4O55A 4U8YA 1WJ9A 3EGWB 4FZXC 3AJDA 1JMTA 3DNCA 5M1KA 3UKRB 4CJRA 2Z30B 4KO0B 1P90A 1VQON 3G4SS 4C8YA 1DFDA 3NY0A 3IM9A 3RAMA 3RB3A 4F36A 3MURP 4MK7A 1RTHB 1JL1A 1UZDA 1JCGA 4KI6A 1FXRA 1GTEA 3W62A 3HM8A 3W2WB 3MOZA 3AVGA 2IVOA 2HBRB 5HJYA 4LF7F 3FBBA 1RZMA 1KOHA 4N7TA 4C0BA 2I7NA 4LSLB 3MM5A 1LK7A 1JLGB 2B51A 2RPIA 2WBMA 4AHSA 2HZCA 2DEJA 1H0HB 3PY8A 1YHQN 4IEIA 2W2OP 1IXKA 3VAFA 4I69A 3CCVN 3A5MC 2IRYA 1UEVA 2YWGA 1M0SA 4B9LA 3ETOA 2G2ZA 4DR7K 4RR5A 1MSWD 2D0CA 4KREA 2XS5A 4LRFA 1BOTO 3DRSA 4QU6A 3GCWP 5A8RB 4WFAQ 3W8PA 4ZTJA 2WCXA 3M32A 1C1AA 1HWLA 1LAVA 1RDCA 1GLAG 4J2AA 2PY5A 4CLFA 3Q23A 2FHJA 4R5PB 1RWVB 2D9PA 2ZOMA 4K2JA 4ZPBA 4BE0A 4M3WA 1JLGA 2HAFA 3CTRA 1X8DA 4FF4A 4ECSA 4TU9A 3A8IA 4OX9K 3E66A 3L09A 3A3OB 3OYBA 3GPAA 4KGXB 1C1CA 1FESA 3U1NA 1N48A 2J4RA 4LREA 3KOAA 4OYWA 5DZ7A 4FJJA 2JLEA 3THXB 4OHXA 4M7XA 4JK7A 3BGRB 3HPOA 4JI8J 4LUBA 3OL9A 3V6JA 3N5BA 3K8WA 2DR6A 5HRPA 4I2QB 1NK9A 4TYBA 4ECYA 3ZX3A 1XQIA 5B7WA 2BJ9A 5JMNA 3HHLA 4OPAA 3OL7A 4KKOB 4OYPA 4JI7K 2FLPA 1VSDA 1R6YA 2D41A 2DCLA 2C3YA 4JI5K 4CZFA 1FF2A 1Q95G 3NGDA 2OJ3A 1RQ0A 3O8WA 2FJAB 3GFYA 1ZA2B 1T95A 2D3OR 3KFWX 4OV1A 1VHIA 1F3VA 4CZMA 2XG8A 1KKHA 2L3MA 3LH2S 3ZZUA 3T1HJ 2VFVA 3CC7S 4DL3A 3GWCA 3QLHB 2R7XA 2LXIA 4KTZA 1RTZA 4DFPA 3AV9A 5EGYA 2KT2A 2PI4A 3O9UA 1UTAA 2DXDA 3H90A 1F5BA 1C0TA 2Q3PA 5LMUK 4KR0B 3AOCA 3KLVA 1A5VA 1UJ5A 1R0CB 3HHLB 2VKRA 4CEEA 3PW0A 2GTDA 1N34J 2VG5A 4NASA 2ASLA 2OTJS 4X66J 1TAUA 2QYGA 4PCQA 1S5JA 1Q0NA 5D3GB 4WZQA 3OTOK 4BRQA 2B6AA 3KLFB 1RLCL 1N88A 5C0YA 1IBCB 1BWVA 1FDDA 1IKYA 2ZZTA 2FJXA 4PQUA 3VA0A 1N0VC 4I6YA 5KG1A 5LSOA 3EE9A 2MTLA 5I42A 1ZS6A 5C2CA 3S8SA 1HNZJ 3M2VA 4F3QA 4RKUC 1CJVB 1LWFB 5AQXA 1O1WA 1NBEB 4NXNF 1EKEA 1UVLA 4Z4GA 4WWSA 1S6OA 1HX1A 1TV6B 3HKZD 7FDRA 1CS4B 4K8XA 3W2VB 3JYTA 4G65A 5KRSA 4DF8A 1YJNN 2AYBA 1GLJO 5CYJA 3L7UA 3DLEA 2VG6B 1UMJA 2DNMA 3NS7B 4FZVA 4I6WA 3HSJA 1G3OA 2K1RB 5CYQA 1ZZFA 3MCSA 5EUHA 2YKAA 2DY1A 4GO7X 1YK9A 1EKRA 2E1AA 1RDBA 4YOVA 2R2TA 4OGCA 1WELA 4N41A 4G3IA 2QL5B 1T6CA 3HM9A 1FD8A 1NDPA 2BVZA 1SJFA 3SUNA 1IQTA 4NOHA 1VQYA 1AZSB 1RK8A 5IT4A 2QLWA 2RAQA 5CR4A 4DR5J 2AYGA 3UI3A 2KJVA 2FVSA 4H54A 4F2RA 2P9PB 3HSZA 3Q89A 4CJEA 4TKTA 1M5VC 5DZ6A 1IBMF 4KB7A 4F0HA 2OSRA 3E51A 3DLEB 1CC7A 3Q7CA 3EKSA 3U02A 1XWLA 3CC4S 4DHVA 1PJ6A 4JI0F 3SBMA 2ZH1A 1QHAA 1NXIA 3WNEA 1YJNS 2IDOA 1IN0A 5B09A 3M8QA 3TUPA 3MEKA 1C0GA 1LCUA 1YITS 1TUVA 2XO6A 2HGLA 5AZJB 3NNHA 4N8OA 1TYQA 2ABYA 2UUWA 2W9AA 4LRAA 2QN6B 2B7BB 3U9ZA 4ZCKA 2XRIA 4FNIA 1QVGM 2HRTA 1IBKJ 3OW2R 1IV0A 5KT4A 5T7LB 3S41A 3I6PA 5M2PA 2AIRB 4MO4A 2QXLA 2RF2B 4ZPAA 1T8EA 2BX6A 1TL7A 2VH7A 1VC0A 4OPHA 2M5YA 1KNZA 4DL0C 1S1VA 1RT7A 4DEZA 3ZSXA 2VDHA 4FK2A 1H73A 5MLCQ 2L9WA 3IFRA 3ZT2A 5DLFA 2UYTA 3BYRA 3CULA 2MKJA 5M2UA 3KG0A 2OTLS 3DYAA 2HHHF 1VQMS 3VGMA 4P2XA 2G4BA 2MGZA 3GDQA 3PYFA 2ASPA 3MX5A 3KK2A 2ALZA 1NJIT 4CEAA 1JX4A 2FIUA 3P49B 1FD2A 3S9HA 1HR0K 3IG1B 3AVIA 4K5RA 1OH7A 1C6VA 4WK3A 4TY8B 4LVNP 4C8ZA 5DS7A 3DDIA 2UUBJ 3ZO7A 2CQ1A 3ET6A 4WU2A 1SZ2A 3LAKA 3AOBA 1U4BA 4DV1F 3IKMA 2QEXN 1HL6A 4J9KA 2MHNA 2V68A 4IDKB 2OPQA 2QMWA 3W65A 4AYBD 5L1IA 4LR8A 3CJ3A 3GB0A 2O4IA 4OKJA 1SJ1A 3FGUA 3VGUA 3JTNA 3KUEA 1MA9B 2GC8A 1I3AA 1IUJA 5AZIB 3QWPA 1NDCA 3L95X 2UXCK 3PRVA 4DV2J 2AJFE 2X1BA 4MH8A 1MDUB 2IVFB 2DR5A 3QRQA 3J8AA 3OYKA 3OVSA 3QICA 3MK6A 1NK7A 4O0NA 1X4CA 2VG7A 3T6BA 1NH8A 2IMOA 2RS2A 2XC9A 4KRFA 3EXYA 4ZITA 2COLA 1ROFA 2R7SA 3D1HA 3I87A 1R59O 4DSKA 4HH1A 4FS1A 4JKHA 3ULDA 4I2QA 4C8NA 1YUWA 4X64K 1P6TA 2QMUB 3NNCA 4BY9C 2AJ2A 5AT1B 4OVLA 1SC3B 4DR3F 2ILZA 4LJMA 1NSKL 4I0WA 2ZNYA 1T05A 1FKPB 1QQNA 4X4PA 3CYMA 3ENWA 3ULEB 1VQ4S 2VQEJ 4DS4A 3FCWA 1X4FA 4JKFA 4CK1A 2BANB 1D8ZA 2E6MA 1YT3A 2QKBA 4MLHA 5SZTA 4J2EA 3FQKA 3ID8A 4AXIA 1IJFB 2Q1LA 2O8EA 1QAJA 5KFIA 1FRIA 1VLYA 4LSNA 1MWQA 3H40A 4AL6A 2X1AA 1TKZB 1MW7A 3QEVA 2DY4A 4X64J 1FW6A 4CERA 4HTUA 3UD5A 1DKGD 4OYBA 1W7AA 3QJLA 1V9OA 2CJAA 2IVMA 5ADXH 1NEEA 4Q43A 5ADXA 2OCEA 4WFXA 2LCWA 4F9OA 4DU7A 4DCOB 2ZKTA 4CD1A 3M1FA 3LAMA 3ZX0A 5EOYA 3IRXB 1JJCB 2OEMA 2OTJN 3PEHA 3QNWB 4NLSA 3W63A 1NGDA 5LMUJ 3D2EB 4JI8K 3CQXA 3IBWA 2VQEK 4PA1A 3F73A 2ZH3A 3G6XA 5C25B 1T0TV 2ITGA 4ZN1A 4LF9K 2BANA 4F4YA 3AY9A 1AYEA 1SJRA 2K2PA 2IOCA 3MAQA 3JSMA 3R2CJ 4IG0A 3BEXA 2J76E 2ZVIA 4DL4A 3LP2A 3CERA 4H4OA 3TO8A 2GGPA 2XMAA 4PG7A 4WFYA 3VF4A 2QK9A 2XY5A 4CGGA 1YXQA 3I55S 5GADP 2OPSB 3UW1A 2DO0A 2UV8A 4I2PB 1N6QB 1IR2A 3ZSQA 4BGAA 3WNFA 4IKAA 1MU2B 3NVKA 1BQMB 4MIAA 2PFDA 4KTQA 2E88A 3MTJA 3AFGA 2ACMA 4WKYA 2HK2A 4CH0S 3GOIA 2KXHA 3LGNA 5J2MB 1WI6A 1NG9A 2CZ4A 5FPMA 1XNRF 2E2OA 4X65J 1VK0A 2ZDPA 4Q2MA 2VG6A 3EVMA 3C6TB 2CQGA 2BYCA 5K14A 4W5RA 2GQCA 3V5RA 3O4WA 3TU5A 4JHDA 2XLKA 2MKIA 3PX4A 3KKSA 1X3MA 1XMOF 3KLFA 4WPAA 3K5LA 2V8GA 3MN5A 2FLNA 2HHHJ 3J80Y 4IOBA 3EE8A 2WB1D 1UPPA 1O51A 3ATUA 3O9RA 2DY9A 4YMEA 5ADZA 2R7QA 2R8KA 3D2FB 2JNJA 3CJ8A 1CJVA 2XSFA 1U6FA 1UA1A 2C2NA 3C15B 2QLJB 1YRXA 4B1WB 5KG7A 5I4MA 3CCUS 9ATCB 3KK3B 1EQMA 1RACB 4R0EA 3HVRA 1KAYA 2XB2D 2NUHA 2Y0BB 3D5MA 2QXFA 2P9SB 2QLFB 1NPPA 2MLYA 2PDAA 3Q8RB 2X74A 4IFVA 4F3OA 4CQ1A 5AJ3J 1UW9A 1RWWB 4CZGA 2P9IA 2LU1A 1QUVA 3QO9B 1WG1A 2YNGB 4C11B 3QJJA 3DU6A 2GIQA 5K8OA 1FRHA 3V9XA 1B70B 2QIFA 5AJ3F 2B7CB 2ZC3A 3RJMB 2MY7A 3AH6A 3HSCA 4B1ZA 2WAQD 4USUA 4DV5F 4E0DA 3EICA 4CH7A 4I6AA 2GUIA 4BQLA 5CY4A 3OBWA 1CJTA 2CZ9A 2ZC4A 4NLTA 2DIVA 3IGNA 4RWWA 3M2RA 1GOCA 2DHAA 4KH6A 3OLAA 1WB9A 2CQBA 5DETA 3SV3A 1ZETA 4DN0A 5IQ6A 3W2VA 2XULA 1UAXA 1CJKA 4BRIA 4LF5K 2DNQA 3LTOA 3CFOA 1VISA 3V4IB 4OYIA 3MR5A 4Y0WA 4M42A 4UZCA 1YVNA 1MROA 4DMZA 2IYIA 2PC6A 2WSFC 1WSIA 3MM8A 1QTNB 2QWQA 1VS3A 2DRAA 4LF9F 3D6FB 4UOCA 1U2FA 3L4IA 3FCHA 1NK6A 2HB5A 4J9OA 3CCQS 3M8QB 1Z2LA 3HI0A 2JX2A 3PHTA 2Z1GA 4ZPWR 4OZ0A 4ID8A 4Q7AA 3OXGA 3AVKA 2C2KB 4MYUA 3D6HB 3AHPA 3C16A 3IG1A 5IWAJ 1RAAB 2XGPA 4C97A 4O5BA 1K0VA 3ZTQA 1LKZA 2DXFA 3QFHA 3NMRA 3ULHA 4GV6A 3S01A 4K42A 3M9MB 4IG3B 1VBKA 1F3FA 1QVFM 5DRKA 5C42B 2JRSA 1ASVA 1P1LA 4PQAA 2ZQBA 4OX6A 4M5LA 1QLNA 3ILOA 1TVRA 5G0RB 1NPRA 3IFEA 2M4MA 3J80O 4KPYA 3BF4A 1S6UA 2KTQA 2YNFB 3KLHA 5F3TA 4B3RK 4KHMA 4I6MB 1YJRA 2AV5A 4DB3A 5BN9A 4IOXA 3RSEB 2C2MB 1LW2B 4M5HA 3KK2B 5FPDA 3V1RA 1RU2A 5L1LA 2RILA 1NB7A 1S59A 2QL7B 4H4KC 1KQSR 4WCEL 4ZIWA 1HNWJ 3UD4P 3L6QA 1IJJA 1S72N 5JMVA 3G82A 5T7LA 2YHYA 2QM1A 4OHYA 4CJ7A 5KG0A 5KFXA 2ZE2A 1LW0A 3A3NB 3ET6B 1TKXA 1RA6A 2L48A 2XMJA 1HNWF 1FKAF 5A8RA 1ATNA 3ZLJA 2OPQB 1S7HA 1TELA 4LF1A 4Z37A 3HFZB 3OYDA 2Y1JA 2W2QP 3C66A 1M5KC 1V6HA 3LQVA 1OY8A 4DL2A 4ID1A 4RWTA 4RW7B 4XPCA 3TQ1A 2H3EB 4X62K 5BR8J 4Z7YA 5CZVA 3KDOA 2ADBA 4RW6A 3R8YA 3CJCA 3RUBL 2E8AA 4CWBA 2CKWA 1S3XA 4FWNA 5LMNJ 1XUPO 1S9FA 1LOUA 3V9WA 4DR2J 1GFWB 1SUQA 2H4WB 3CCRS 5E26A 4YP3A 3OL6A 5KFPA 3LZJA 2JEGA 5E41A 2VPWB 4F25A 1YJ7A 2F65A 1YG0A 3OYMA 1NUEA 1I39A 3QIDA 4QW9A 4AL5A 2ZE2B 4KO0A 5D4NA 1KC8O 3CJRA 1NGAA 3R5BA 5LMNF 2A41A 3C19A 3IA0A 4DL5A 5C12A 2MSSA 1S1WA 4BDZA 4DJBA 1H38A 2JFDA 3IAS9 4NRUA 3OHRA 4TN2A 4ELVA 3OFEA 2X3DA 2V6AA 4CJTA 4LRCA 2YQ3A 2YQ0A 3UD3P 3ID6A 2IAJB 3AODA 2OYQA 3KJVA 1KSPA 2WC9A 2X3GA 2LYVA 4J9NA 4IFEA 2UZAA 3CCEN 3IDHA 2XSJB 1QQMA 5KOXA 2CQ0A 1SUQB 5FLXO 2ZH9A 2L9DA 3OVNA 4BVPA 3DGVA 4YY3F 4I56A 2HLTA 4MK8A 2HIYA 3FZ2A 5KFDA 1KFSA 3H5UA 1Q8KA 5HK4A 2XS2A 3IAM9 4YORA 1KLMA 2Z58B 4DS5A 3BPDA 5AQYA 4ECUA 1VI7A 4UUXA 1RWPB 4X84A 4KV8B 2LVWA 3R7BB 4HI2A 3G87A 2HS0A 3L4BC 1H2VZ 3UN3A 3OT9A 2VD3A 3KXDA 1Y00A 2DPIA 4ECWA 3OYGA 2X6SA 2M0GB 4OKEA 3H2UB 1NHVA 3M05A 5T7BA 2W6LA 1FCAA 3B4DA 2AZ3A 1VQLN 3S7RA 5KFQA 1RBTA 2P5OA 3IRWP 4JI2F 1WSVA 2WUSA 4AM7A 4R8UB 5IOLA 3OL8A 1TL1B 1R8BA 3VHQA 1RKJA 3ZT4A 1O0PA 1S6PA 3IBFB 3MN7A 1WOQA 4O44B 3D3BJ 1ASUA 2XM3A 3EEQA 5DM7L 5GAGI 4BC3A 2HMIB 4OZJA 5GIPA 2HFNA 4J37A 2QZ8A 2N4CA 4NLYA 1U0SA 3FLCO 5HROB 1HKCA 1RDUA 1VHFA 4QPTA 3UB5A 1AUSL 2MXYA 1KVIA 2A6MA 2PAVA 2E5LF 3CW2C 2HS4A 1FWPA 1SCJB 2XLJA 1RYRA 3JYTB 3CCZA 4UUWA 2J7KA 3D2EA 3TTDA 3H4DA 3KHGA 3B6PA 5AQNA 1N33J 3THWA 2J9DE 3QT8A 2AGQA 2CJBA 2GVDB 1JXLA 2EPIA 4W90B 1BMQB 2HVIA 4GVLA 4OYMA 2I5JB 3BZCA 5MAOA 2MQQA 3TSUA 3TQEA 3BR8A 4OLBA 4W5OA 1C4AA 3SQGB 1ZBLA 3OTOF 2GGPB 4DTXA 3DOLB 1S77D 3NOCA 1FVQA 2YKQA 2EI5A 2HHQA 2MEWA 3LGMA 4QOZB 3QAEA 3R5DA 4TNOA 1A5XA 2F8HA 4P7VA 3VENA 1N32K 1DTQA 1N54B 3FRYA 1XMBA 5ETRA 4C8KA 2EVZA 3M2RB 1DQ8A 3EE3A 2ZJPQ 5LMUF 2DEIA 2EC0A 1JB0C 1CS4A 2QLBB 5DG7A 1QM9A 3DOKA 1NJYA 1HD0A 1HBUB 2K7JA 3CB4A 1OH5A 3FGVA 3KWGA 2NZCA 3IAYA 1EP4A 5IV3A 3W3SA 1KR4A 4LH4A 4HTLA 5KFGA 2B6AB 1M5OC 3K5MA 2RUGA 2DR8A 2P9UA 3W1YC 4QZVB 4UT4A 1TFYA 7FD1A 2J0XA 3NGYA 3T3FA 1N32F 3ZCMA 2PYLA 2Q0UA 1VOMA 1WC0A 3AAWB 4EP5A 5A8WB 4CJKA 4KTWA 3ATVA 3GE1A 3HFVA 2UXDK 4NYNA 1HQEB 1WC3A 1SQGA 1FTCA 3QNNA 3AB2B 3EM1A 4FKYA 3QT7A 3TZYA 4JI1K 5HSPA 3CT9A 3QIPB 4JI3J 1QAYA 1J27A 3V6DA 3EKUA 2UU9J 4FWQA 1HHQA 5K8MA 4B17A 2XMUA 3V4IA 3KWMA 4K4SA 1Y9OA 4EIAA 1GAOA 3P5JA 5GAEU 3CC2N 4CT8A 4L76A 4RNOA 1HYSA 5KGWA 4FWOA 1E6YA 4LFCK 4MKYA 2AJ1A 5IC6B 3FZHA 3QO9A 1N5TA 4HWIA 4P6QA 1VRTB 2RKIB 2V7ZA 1UCNA 3P4UB 3ZNJ1 2B0GA 1ESVA 3S3NA 4HL9A 1WG4A 8RUCA 2DNHA 3GV8B 1SH2A 2QMXA 2HQCA 4E7IA 4FVCA 4DBQA 2AGOA 2E9ZA 1H7WA 3CXCM 4PEOA 1Q8IA 5C10A 3IO1A 4L74A 4UY8T 5IWAK 4NLCA 2E9TA 4Y2CA 3CXCR 1Z05A 1WHWA 1FO1A 2ZJRQ 4DR6K 4RNMA 4HLBA 4RBUA 5HL7Q 2A3JA 1YRTA 5CCMA 2E1PA 3DLGB 5H9EJ 2YNHB 1UW4A 4ZDNA 4HUFA 3TNVA 3FBCA 2FVQA 4I6MA 4JK9A 5HATA 4HH0A 2D0AA 2XY6A 1X4AA 4UQGA 4CF8A 1HR0J 3VQBA 1FE4A 3UKUA 3CC2S 3Q8PB 1VSMA 2O4GA 3EJMA 3MPWA 3DXKB 1CZAN 5CXTA 1IKXA 4DPYA 3LA0A 4E1NA 1SB6A 4LBPA 1N36F 1JLFB 3RGIA 3MUVP 3VQ5A 1QQOA 2V4JB 3HSGA 2VONA 4JKBA 1PCAA 3WQUA 2YHXA 1BISA 3C65A 3ISZA 1GX5A 4CH1A 4KB0A 3VTHA 3LF0A 4MQ3A 2LQ9A 3RR8A 5DO2A 3GG4A 4A8YA 4X62J 4DQIA 2IVYA 5HJXA 3G71S 3AO4A 1HNZF 3IWXA 2V94A 4N47A 1V3RA 2DBBA 3MHYA 1VQ8S 2KB2A 2YKNA 2YNFA 2ZHBA 4QS7A 2C3MA 3GU0A 3A5NC 3P5BP 3H3NO 5AXNA 2RT3A 1C0UB 3PCOB 1LW2A 1CJUB 3O3HA 2W41A 1GMWA 3A2FA 4J9LA 4F7VA 2ETJA 3C94A 3JQJA 4OJHA 1F5CA 2GZOA 2B5JB 1VQ6N 3H08A 3D54A 2IVPA 4B9QA 3TA1A 4I67A 1DEJA 1T6DA 1RISA 4NLGA 2RE1A 2HSEB 3DWLA 4DTOA 4Q0BA 5LL6d 4GKJF 5AQPA 3P6YC 3H6EA 5M2RA 4CESA 3W66A 1G99A 3TI0A 3PRDA 2AJ4A 4PWDA 1S97A 4I7FB 3IRXA 2ZWHA 1T7PA 3GJQB 2A2DA 4GV3A 1H6KX 4MKAA 3FDSA 2I1RA 3L2QA 4FVMA 3PW5A 3QETA 1SV5B 4JYAF 4LQ9A 5JUMA 4OIXA 4I68A 4YOYA 4RW4A 4ZTFA 3M30B 5BRDA 2DGUA 3CM5A 4FCYA 4WYBA 2BOPA 1X5SA 3Q2TC 2DT9A 1K73T 1QAXA 3CETA 5HVHA 1X5TA 3RRKA 5L8RC 1U26A 2Q43A 3VN5A 3SLCA 3H20A 4O44A 4WP3A 2FSKA 1X60A 3JAMU 4ECZA 2Z1HA 3M8PA 3RAQA 2E7WA 3PW2A 1EETB 1XBWA 2OFHX 3CJKB 4CK2A 1PBAA 2VJUA 2GHVC 2FHMA 3I33A 1U1NA 1N0UA 3CCQN 5SUHA 4B3MF 4CI0B 3ENBA 3EO3A 1BQNA 2W4PA 2CQHA 4Y2IA 2HBMA 3KJVB 3LALA 2LQ8A 3OSNA 5CHCB 1RP5A 2LA6A 2W24A 4CTAB 2ZM6K 4CBWA 3OYHA 1F9HA 3SI6A 3KLIA 4J5OA 3VQ9A 2GWKA 2NPFA 4O23A 1NNDA 5HANA 1GOAA 4AQYK 1FKOA 3Q8VA 4O3PA 2GVZA 2G8KA 2QTDA 4URQU 4NLUA 3SQGA 2OKQA 3ZSZA 1FHTA 4DUZJ 3GE9A 4ED5A 3T5HA 2GA7A 1YKWA 1W7WA 2YKOA 2J0WA 3TUIC 1YIJS 1YHQS 4BBYA 4EUVA 1KHWA 3ZZYA 1X5OA 2Q36A 2CGJA 1J5EF 4A59A 2KKZA 2JDJA 2QTWA 1SQKA 4BHQA 4M63A 2R8GA 2XI2A 4BC4A 1IKWB 3POTA 4NE9C 2UXBK 5AQFA 4NXNJ 4YEAA 5IM0B 3BQ2A 4H0YB 1V3SA 1VC6A 1Q5VA 1W25A 4U7UK 4LF6K 3T9ZA 4IFVB 4U6PA 4JS4A 3DKDA 5A0YB 2UUAJ 4I9LA 1OQ3A 4Q8EA 3PEJA 2RRBA 2PEHA 4ZVTB 3SDEB 4OX9J 3AQPA 3V1OA 4J2DA 1HMVB 2CQ4A 1S0OA 5ETTA 3TAQA 3AGRA 5HMXA 4J2BA 2C2EA 3JXOA 1OYEA 3PR4A 1LOTB 4FLUA 2IJFA 2W8KA 3A1YG 3U1MA 1TU0B 3P3DA 2N3LA 2LLZA 8AT1B 3QESA 2UV8G 3W61A 4ELTA 2DNLA 4LQ3A 3VQ8A 2QV6A 3JS6A 1V5IB 1TQLA 1T94A 1VQ6S 3THWB 1IM6A 3IMXA 3O3FA 1NLKL 4U67Q 4NI2B 3R1LA 3DDKA 4JHDB 4OHZA 3RMDA 3D1OA 2P9LA 1NKEA 1SBRA 2XYPB 4F4ZA 1VCTA 2PMHA 2KDOA 3WXIA 4DR1J 1UVJA 1IBLK 2MJUA 1L3SA 2Q66A 1HW9A 3SCKE 1QSYA 3UR3C 4LRDA 5DQIA 1P1TA 2ZH6A 2M3DA 1RT3A 3CCMN 1WF2A 1S0NA 3QEPA 2WSCC 4D3GA 2FSJA 4O3RA 2PZSA 2DTUA 2JGUA 4JI6K 2LDIA 1U1RA 4GMKA 1YZ7A 3DLBA 5H1SQ 3FQLA 3HKWA 2OPPB 2ZJQQ 3J81j 3TARA 4K4WA 4JKCA 3JAMO 4LFCJ 2XZDB 3ALYA 3NBPB 3THTA 4X66F 2IIRA 2D69A 3P31A 2GEMA 1WSEA 4RBVA 4YY3J 3K0JA 1J5OA 2P9UB 2HGMA 5KT6A 3ZTRA 5A6PA 1IR0A 3CUNA 1K8KB 3N6NA 3RAXA 3Q8QB 2IBOA 1J5EK 5HQLA 3T5KA 3QT6A 4NLQA 2FC9A 5KFWA 1RT4A 1T9VA 2AU0A 4KIAA 3VQDA 4KFBB 2NQPA 3GR0A 2HVHA 1TYQB 2YTCA 3OUYB 5EX0A 5DDPC 1F60B 3QEWA 3OVAA 4FNHA 1SL1A 3LDOA 2K7KA 5DG8A 3JSRA 2F40A 1J9AA 2HNYA 1EWRA 2ZH2A 4RU2A 4QWBA 2YVSA 4OLPA 4CYUB 1Q82T 1HWJA 4ETXA 3QGIA 1UWBA 1JXVA 4ZOSA 2EXUA 2R7OA 1IO2A 1HPZB 1UFWA 4DV1J 4ECVA 4BG9A 2UU9F 4DCJB 1YX2A 2YNHA 4A47A 1N34F 4Z4IA 1E6YB 4JLHA 3JB9k 2O66A 1VIOA 4QPXA 1Q78A 1R3NA 3M4XA 3D45A 4ED1A 1MMLA 4RW6B 1C2PA 5ETVA 3VGLA 3QWUA 4HTJA 4BGBA 4DR4K 4CW7B 4KFBA 5DQGA 5BYRA 3K59A 1NU0A 4FN5A 1RBSA 2MZTA 4IOAQ 2YHAA 3M6XA 5BR8F 4CJPA 3G86A 2ZF5O 3HDSA 4XEIA 4IQMA 1Q18A 2MQNA 1WUAA 2RE2A 5JS1A 2DFFA 1TGOA 2E2PA 1NOZA 2VQFK 3BSAA 3TR8A 1OO0B 2ROEA 3BEGB 2DR9A 4NLOA 4NL5A 4WXOA 3P5TL 2V52B 3HSDA 2JVOA 4YDUA 3HJVA 3L7OA 3O44A 5E84A 3ZETA 3KHRA 2O8FA 5HBMA 2XCPA 3T1HK 1M5SA 2D9OA 3FZKA 5FLXU 4K4YA 3M1VB 3J7YI 2DHGA 1YTUA 4RWXA 1JJ4A 4W5QA 2VWJA 6FDRA 4FWSA 2QSFA 1VQ7N 1UVMA 5K8PA 4USVA 4GKJK 4O8UA 3VZIA 1IWAA 1R7IA 2O8EB 2HWTA 4EBEA 2LSNA 1HQ2A 2XNQA 4PYAA 2WK4A 4F04B 1PIEA 3HZ6A 2VBYA 4K2XA 1KVCA 5L38A 3QRPA 2B9WA 1RABB 5KFYA 3RBXA 5KG3A 1GMVA 1FFWB 4ED2A 4FOIA 4F4WA 3G0ZA 4DV5J 1LFWA 1C0MA 3BR9A 3ZX2A 3NAEA 1IBMJ 1FXXA 3TTFA 2D74B 3Q0AA 4RW7A 3SPYA 2UUTA 3LW5C 4AD6A 3I0SA 2POKA 1NKBA 4MDBA 5LJ5Y 2G0IA 3JSMB 2J7WA 3BM7A 2VKZG 4HHUA 2ATCB 1B7YB 2P1JA 4M8LA 3NFAA 1S1XA 3HK2A 3DLKB 1HBMA 2WBRA 2J9CA 2X6NA 4N76A 2LQJA 1BC6A 1EX8A 1M1KT 4EYHB 2E9RX 1REVA 2G2YA 2HPUA 5D15A 1RT5A 2RDDA 5KFRA 4WJBA 2O8CB 4I7FA 3GSIA 2YH1A 1VMBA 3OA9A 4X4VA 4J9RA 5E0OA 2JWLA 2ERRA 5J2MA 1HBNA 3N01A 2IM2A 3I0RB 1B0TA 3M30A 2BEFA 5A6WA 3VWSA 4OI6A 1NZ8A 2FJBB 2BW7A 1S1TA 4XIUA 2AJQA 2XSJA 1AROP 5AR0A 1Q8LA 2VC1A 3M9OB 2E20A 3SDEA 4ZVHA 3SFUA 2GS8A 4DSJA 4E1JA 4OI0A 3U8XA 4CEFA 1S1XB 2RVJA 3K7RA 3J7AN 2CJ9A 2JHEA 4OGEA 2CPDA 3BBFA 4DSFA 4HHTA 4G9ZA 1D09B 5EWFA 4N5SA 2GMJA 2JC1A 2A6AA 4JB8B 5CZ1A 4K4UA 1PYOB 5DM6Q 4MFBA 1ACMB 2PFUA 4LMZA 4FLVA 3PKYA 2HFUA 9RUBA 4DUYF 1WNSA 5TKYA 2UVUA 4JV2A 3IWNC 1XR5A 1BGXT 4F02A 4M5DB 3GQCA 4WFAL 2KRRA 1VQNS 3DLHA 1VK8A 3R9LA 4YDUC 4XDDA 1BQNB 2LU2A 5HRSA 1EP4B 1D8YA 2UXDJ 3DOMB 3D7EO 5J1EB 2VGNA 3WC0A 2Q2RA 4E7HA 1X1PA 3VF0B 1S4EA 3O4NA 3DXMB 3CO9A 4A8FA 5AQRA 2YNGA 4C11A 1VDHA 3HT3A 2CG4A 2ZEJA 2X1FA 3VPZA 1HMVA 2YX7A 3BGLA 4HHHA 3J80U 3OYEA 4ZA1A 4YB1P 5C2FA 4IFYB 3PZPA 3M2UA 4C98A 1GLCG 5A8WA 3TEHB 3LANA 5IWAF 5HROA 5KT7A 2ZWOA 2DFHA 2NRRA 2FUG9 2PN6A 1RT3B 3C8YA 1DGKN 3TUJC 2QA1A 3BJYA 4IXCA 1SC6A 4CF2A 3HMJG 3QIPA 1N8RT 1L3KA 3DRXA 2CAJA 2HSTA 3SBTA 4E2FB 1HW8A 3D9BA 3FKBA 3M8SA 3OYNA 2DRDA 4GKKF 4RNFA 5J1PA 2XWYA 3DGPA 4JUZA 1XQSC 1LWCB 4D3HA 2MKSA 5AQJA 5B0AA 4QIGA 1RHRB 2AYMA 4WCEQ 4NXNK 3L3VA 1PJ7A 2J9EA 3GIKA 4FJMA 3ENQA 2J6SA 4IO9L 2QFIA 4DTJA 4KGKA 4DHYA 1ZBIA 4CZJA 2GQ2A 4M3UA 4AILC 1Q16B 1J2VA 4DPOA 1C1BB 3D6RA 3I55N 4M5JA 4DF4A 2FZGB 3BY5A 3O1BA 2EC2A 1S9GB 2E29A 3TZZA 2HW3A 1XNQF 2Z2LA 3P8BB 3AY0A 2QA4G 2OI2A 3CCJS 4UW2A 1NMNA 4BR0A 3Q8UA 5AQHA 2AZ1A 3AVAA 4ZK7M 4CZKA 1BUXA 5D0RA 2P9LB 4OJ3A 3QAUA 2RU9A 2VUGA 3MMCB 1VRTA 3Q7BA 3VVUA 2RRAA 4ZIVA 4EHUA 2KH9A 2E1MC 1WOSA 4DSIA 1HD1A 4KSEB 1D9DA 1WSGA 4YFUA 4LSZB 3L2RA 3A12A 3ITHA 5DDOC 3G82B 1BCOA 4CJ3A 5F1XA 3U1LA 1HQEA 4N8NA 4CF0A 4DSLA 2C28A 3LZIA 1PILA 3OTDA 2ACYA 2PE8A 2V51B 3JXUA 3CVKA 2UVRA 3ISNC 5GAHU 3J7A1 3OJUA 2KG0A 2ZH7A 4HACA 2E1CA 4DV6F 3CJSA 4RO0A 2BQUA 2IA0A 3PV8A 1LWEA 4BRKA 2BE7D 2YY3A 1OVQA 5C24B 3O1WA 1PGZA 1UL3A 4DFJA 5IFMA 5J2NA 2CADA 1WDTA 2ZD1B 4WQ5A 3CFRA 1S76D 3MMCA 2G8FA 4M45A 1EZZB 3RSEA 1U2CA 5CZ2A 4H5VA 4FLYA 5KAKA 4OZ1A 3OXFA 2HF4A 3NDKA 2KFNA 4CFDA 2RHKA 3PSFA 2GMHA 2DNKA 3DXKA 2GAGC 3LPUA 1NM1A 3MAAB 4JI6F 1VBYA 2C3PA 4ZVSB 5GAHI 1K8AO 4DV4K 1O8BA 1NLVA 1RAOA 4BC2A 4HVZA 1N5VA 4DDFA 2MDAA 2D4WA 3AXKA 2Z2ZA 3DFEA 4ZPDA 2CJYB 2V67A 2EFQA 1RBRA 4DU1A 4ZLLA 5KFEA 1DURA 2H5IB 4PWDB 5J2QA 2RN2A 1HHTP 3KG4A 4FYWB 3FEYB 2CQPA 3MPYA 4FWRA 2YKMA 2EEYA 2NSCA 3EZWA 4ECTA 2Z4PA 2JZ5A 2RDIA 4DQQA 3BGFA 1HRHA 3BZKA 4H8KA 5KOWA 3L2VA 4MJKA 1BUPA 4QR1A 4R79A 3CJAA 2W42A 2F4VF 1JLFA 2H48B 3VAJA 3W8GA 3TX0A 4BR5A 3H5YA 3THXA 3VGSA 3G8TA 4Q0BB 2J0SD 5FJ4A 3PW7A 3BBCA 4GVMA 3NH1A 3G8QA 4QWCA 1UP1A 4X62F 5EDWA 4HKQA 5F8MA 1OJ4A 2ADCA 2AX0A 3M1VA 4WXWA 3ULEA 4A2AA 1UVNA 2HBLA 5HLFB 3MMBB 3A5OC 3PR5B 1WKJA 1P8GA 2QSWA 1TKTA 3VAMA 4IG0B 4K8RA 3HHDA 2M7SA 3FEXB 3FFIB 1BXNA 2V4RA 3BSOA 5LMNK 2A1BA 1N6QA 4KQZA 2E7XA 2EG2A 5JLFA 2M9KA 5DMRA 3MFIA 2J5AA 1REVB 4MMOA 2CQCA 1KWMA 5AFUA 2NS1B 3E1YA 2DTJA 2H51B 1FXDA 1MWMA 2GO8A 2O67A 3I9V9 2O8BA 3GYGA 3DXSX 1BU6O 3QINA 5CYMA 2PA3A 4B3TF 3THPA 4QS9A 4LF8F 1BE4A 2ZITA 3WDOA 4CO0A 4V19J 3HD1A 3OV7A 2M2BA 4PY5A 5DM7Q 1VAZA 1WTBA 3NF9A 1OQ6A 4USIA 4ES1A 4ZP9A 3UPFA 1U6ZA 2MZQA 3QLHA 3WQPA 1ELOA 2IFXA 5AQIA 3THYA 1OPZA 2UU9K 2Y8WA 2G8HA 4B3OB 3WT0A 1YTAA 3OHBA 3G8SA 2WFBA 1FK9A 2UXCF 1ZM9A 4A5BA 1K73O 1TUUA 4K4VA 1H2TZ 2GV9A 4KAZA 3K89A 1D9FA 4LFBK 3RB0A 2J6UA 2FGCA 5KFTA 4JKGB 5L9NA 4DR4F 2AA4A 5GVQA 3Q2SC 4CJVA 4OI2A 4OHVA 1R0BG 4B02A 2ZKUA 2VYPA 2XZWA 4P72A 1T3OA 1Y10A 1K44A 1M90O 1XNQK 2B43A 2G2OA 2GVDA 3P39A 4CLPA 1YITN 2HHXA 3SUOA 2CJQA 5KT3A 3KLEA 1YJVA 1DBDA 4FZYA 2EKYA 2MQMA 3N5FA 3V81A 3I8BA 1I3OB 1RAHB 5F0XA 2A10A 1TUGB 5DJBA 1T9WA 3G6VA 1RT6A 4DG1A 1AT1B 2VDIA 2H54B 2I38A 1Q86T 5AJ3K 1RT2B 1FEHA 3TAMB 1VR6A 2HK3A 2ZUAA 2CPEA 3F44A 3NCIA 2OA8A 3BH6B 2K06A 4NYPA 2IHR1 3T5LA 5I3PA 1RDRA 2DH7A 4CJLA 2J0QD 3K9KA 1TL3B 3UO0A 1WSJA 5JICA 4P9SA 3HLUA 3RR7A 1HHSA 3RZAA 3HP9A 1HI8A 5H9EK 3VF6A 4ENOA 4HEA9 4JV5K 1OWXA 4O3OA 1KQFB 5KPZA 4ZVOB 2E66A 5AZJA 4A8KA 3O5BA 4ICLB 1H74A 2BJ3A 2B8PA 4PXCA 2DO4A 3CDEA 4CNYA 3VV2B 1