1HQUA

Human immunodeficiency virus type 1
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
556
structure length
556
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL POLYPROTEIN
publication title The Lys103Asn mutation of HIV-1 RT: a novel mechanism of drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 125
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hquA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hquA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hquA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hquA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hquA05
1NOZA 4DLGA 2F8EX 1KHWA 1RBSA 3TAGA 2P5OA 1KLMA 3U6FA 3QYYA 3CIZA 2HW3A 3E01A 1K1QA 4JV2A 2UVRA 4G1QB 2FBYA 4ID5A 2XI2A 1VSLA 4TSXA 4KHNA 4FJNA 2F8SA 4KPYA 1NK4A 4DTUA 3QIPB 5KT2A 5JS1A 4NLPA 4ELVA 4FLZA 4CK1A 4B3OB 5FRNA 4WXOA 1ASUA 1BIUA 4I9QA 4H4MB 1T7PA 2D0BA 4WE1B 3TAQA 1TL3B 4QOZB 1C1CA 4IG3A 3BGRA 3DDKA 1EETA 3DOLB 3GYNA 1JLQB 4CFBA 4B9UA 3KLIA 2OPQA 1QAJA 2P5GA 1HNVA 1HPZB 3CVKA 4NCGB 3VQ8A 1NOYA 1I6JA 2YNGA 3NKYA 4TQRA 3PY8A 3V4IB 3OL6A 5JS2A 3WNGA 5F8LA 4M3RA 2XC9A 4ZP9A 5K14B 3RAXA 2XCAA 3AO4A 3D5MA 4YP3A 2FLLA 4B9SA 3GIKA 4C8KA 3V6DB 1VRTB 2FVQA 4DU1A 4BWMA 1IKVB 4CJUA 3M8SA 1ZTWA 4Z4GA 1IG9A 1RT7B 3G0ZA 4NYZA 4CEBA 4O44A 4RNFA 2WONB 3T5JA 4ZPAA 3H08A 4DEZA 3DMJA 3SV3A 3PX6A 5DQHA 3SUOA 1YVFA 4O3PA 3RR7A 4RUAA 4HUGA 3NCIA 4KTQA 1GOBA 2JLEA 4RW6A 4FW2A 4CJQA 3QEXA 3RTVA 1OS5A 1S9GB 2C2EA 2I5JA 1C1AA 4N47A 5D3GA 5F8MA 2CJQA 1U47A 4H4OA 4RW7B 1B92A 1SKWA 4RW8B 3V9XA 4OL8A 1T03A 4DQSA 1TAQA 1MU2A 5C24A 3LDSA 3SFUA 3LWLA 4AHUA 3S3NA 4XPEA 2GV9A 4F4YA 2VG5A 3MXMA 4IKFA 1RT2B 4FBUA 3KD5E 3FDSA 4PUOA 3ZSZA 4YR0A 5CYMB 2JC0A 4HCCA 4OPJA 2OPPB 2W7PA 4CERA 3TVKA 1N5YB 2BQ3A 4ECVA 1D1UA 4ZTFA 2G8KA 4FZYA 4ELUA 1WNSA 3AO1A 3HVTB 4EYHB 5C42A 3KD1E 3KMQA 3M8PB 4DF4A 5J2NB 2ITGA 4NRUA 1KLNA 1CLQA 3I0SA 3GIJA 4IFVA 3KHHA 2OZSA 3RB6A 4E7HA 2Z1GA 1HQUB 1LWEB 1R0AB 4WYWA 1HJRA 4ID1A 4CEQA 1XI1A 4AHTA 4M42A 4MK9A 2GBZA 1S0MA 2AX0A 2G8HA 2WOMB 1JLAB 1A5WA 2KFZA 5KFJA 1IKYA 2B6AA 1BI4B 3MFIA 4CFDA 1BISA 4EEYA 3ZT1A 3VQ4A 4KFBA 4RNNA 4EP5A 2P51A 3C94A 1VSFA 3BQ1A 1S9EA 1N4LA 4DU4A 4CCHA 4R8UB 3OYHA 2V4RA 3ASMA 3RMBA 3EPIA 1KLMB 3IN5A 2XCPA 3E01B 5C25A 1QHTA 2OYQA 4ID5B 3VQEA 3CJ0A 1IKWA 1NK0A 4AHSA 4DS5A 3KLEA 3NGDA 3H4DA 4ED6A 4J2DA 1S0NA 3TAEA 4RUCA 5L1IA 4BACA 1X9SA 1CXUA 4O4GA 3P5JA 3K5OA 1C1CB 1KVCA 3SI8A 4FM0A 4IG3B 2B43A 3CFPA 3BGRB 2VG6A 3ICLA 1EETB 4FZZA 4CEOA 3PX4A 3KLIB 1NHVA 2OPQB 2D7SA 2RKIA 1U4BA 4CHNA 3MR6A 1HNVB 4CEEA 3AA2A 4IKAA 4QWDA 3PR4A 1S1VA 4QWEA 4GMJB 3RRHA 3I5AA 2W7OA 2YNGB 1RT1A 1CSJA 4K4XA 3V1RA 4E7LA 4R0EA 1VSMA 4FYDA 1SH0A 4PY5A 3QGIA 1X9WA 3MF5A 5L9XA 2HWHA 4BDZA 1RCHA 4LQ3A 4RG8A 1QE1A 4JLHA 4CJ4A 2QXFA 3OYMA 3KHGA 1ZBIA 4E1NA 1VSIA 3HHKA 1TKZA 4K4WA 4EBCA 3KNAA 2ATLA 4ECYA 4O44B 1S9FA 1L3VA 1Q8IA 4LD0A 5KT3A 4E89A 5KFDA 1C1BA 3ALYA 3L8BA 3DMJB 4YR2A 5DMRA 3DRSA 3VQPA 2KTQA 3TABA 4RW6B 2IA6A 4ZVHA 4CHOA 3L3VA 4ZVGA 4CECA 4FZXC 2I5JB 4LH5A 3ZSOA 5D3GB 2IAJA 4KV8A 5KT4A 5F8IA 3PJWA 4H4OB 4F4KA 4O55A 3I5CA 2IDOA 2ASDA 1T03B 3L3UA 2IBKA 1Q9XA 1MU2B 4W5QA 4KHQA 5C24B 3QEWA 3OS0A 1RDDA 3KKRA 1UOCA 1U45A 3CQ8A 4DL3A 2QE5A 3RBDA 2EC0A 2XO7A 3T1AA 2VG5B 4KSEB 4ICLA 4N76A 3PHEA 4PUOB 3UQSA 4CK2A 5KG4A 4M3ZA 1JLEA 3MEEA 1KHVA 3SYZA 4KB7A 1KSPA 3QIDA 1NJWA 2JGUA 4NLOA 4ED0A 5C42B 1GOAA 1NJYA 1Y97A 1ZTTA 2UVUA 5J2QA 4CF8A 3I0SB 3OVNA 2EHGA 4IFVB 4KTWA 4X2BA 3SUNA 4FS1A 1TP7A 3QINA 4B9MA 3O3GA 1L3UA 3KIOA 2RDIA 1RBTA 3BQ2A 2ETJA 4DTMA 3H2LA 5HROA 4KHWA 1IKYB 2B6AB 4IRCA 1RDBA 1MMLA 4PQUA 1RDCA 3IRXA 3N6LA 4KFBB 2Z1JA 4O5BA 4YFUA 2RDJA 4CGGA 4I9LA 4ED7A 3QEIA 3V1QA 1S9EB 5FDLA 4HTUA 4ZP8A 3LP3A 2R2SA 5KFNA 3OYEA 5C25B 1ASVA 4CGIA 1IKWB 2PYJA 3M9MB 4DL5A 2FBTA 4JS4A 1LWFA 3KLEB 4CK3A 3SJJA 2G8FA 3RB0A 2ZD1A 3RR8A 1WSGA 4LSNA 4DG1A 3V9UA 4ED1A 3GV7B 4AILC 4O4GB 3V9WA 3ZT0A 2W9BA 3JSMA 2VG6B 3H5SA 3AVMA 4J9QA 4IQXA 4DTXA 3HO1A 5KFFA 4GC6A 4DTNA 2RKIB 4J9PA 3NH1A 4Z0UA 1TV6A 3QZ8A 4MK8A 3ZSRA 1KVBA 3SQ2A 2VG7A 2IGIA 5DG8A 1S1VB 1EX4A 1NK5A 2AGQA 3Q8SB 4EP4A 2D41A 3AVBA 1RT1B 4NZ0A 1RYRA 4CESA 1TKXA 3DI6A 2R8HA 2E4LA 1IH7A 2DFHA 3HXMA 2QKBA 4J9MA 4ZPBA 2YKNA 4FJIA 3OYDA 2HVIA 5KGWA 1QE1B 4DSJA 4AH9A 4FS2A 2D5RA 3VQAA 1TKZB 3SFGA 4O4RA 1FK9A 2IOCA 1N6QA 1L3TA 1JLFA 4URGA 4TLRA 5KT7A 2BE2A 3I5BA 1C1BB 4Z4FA 2HHUA 3LZJA 1N48A 4F2RA 3DRSB 4LY7A 2KQ2A 3HYFA 2WRMA 4E3SA 3BSCA 4CFAA 4CJ3A 4DL4A 3K57A 3PZPA 5EDWA 3OS1A 1G15A 1HQUA 3G86A 1TGOA 4Y1DA 3G6YA 2R2UA 2IAJB 4KV8B 2CKWA 2RPIA 2DPJA 4KHRA 5DQGA 4Q44A 2KFNA 3PW0A 1I39A 3P83D 3PW5A 2OZMA 4ICLB 2JEGA 3QGHA 1YTUA 5T14A 5KTQA 4O3QA 1JLEB 1RTIA 3MEEB 1J53A 1JLBA 4Q8EA 3AVNA 2HNDA 1IO2A 4J9OA 1TKTA 1SL1A 5KFYA 2IC3A 2AGPA 3QEVA 4CF2A 4QPXA 1ZBFA 5J2QB 4CF1A 4DWIA 4Z4CA 1T8EA 1KVAA 3HP9A 1D9FA 3RMDA 4Q0BA 4M45A 2EX3A 3OHBA 3HVWA 4E19A 5SWMA 3K5MA 4HVJA 5KFLA 5HROB 4TXSA 4NRTA 2FVCA 1J9AA 4AHVA 3HT3A 4PQUB 4ZP7A 1S1TA 3IRXB 4NLXA 4YNQA 1BQMA 1TK5A 5KFTA 2DTUA 1DTQA 4YQWA 2YV0X 3VQCA 4F8RA 1QSLA 1VSEA 5FDLB 5EWFA 3MR2A 1WSHA 5F8GA 5KFIA 4GVMA 4K50A 4URSA 4B9LA 4MKAA 4GC7A 5HRNA 5FRMA 2HVHA 1Z4UA 1RT4A 3AVJA 3CDEA 1LWFB 1HYZA 3KLGA 2ZD1B 3CWJA 4WFYA 2G8IA 4LSNB 4DG1B 5DGAA 2Z1IA 4DU3A 4ECXA 3MEGA 2J6SA 3MR3A 2W9CA 1QSSA 2W9BB 2R8KA 3JSMB 4MKBA 3MTKA 1RYSA 1WN7A 4DSKA 2W42A 3AVAA 4K4TA 2YNHA 4O0IA 2FVPA 3NFAA 4FBTA 3ZSVA 3IAYA 1TV6B 5KRTA 5KFZA 3TQ1A 5EWEA 2X6NA 2HNYA 1SV5A 3ULDA 2VG7B 3QGGA 3HVAA 5I42A 4QWCA 1W25A 4KKOA 4JS5A 1TKXB 3DI6B 2C2RA 1FKOA 3OYJA 3OY9A 3UDLA 4C8LA 3NGIA 1HMVA 2YKNB 3H4BA 5CY4A 1JXBA 2LSNA 4DSIA 1XR6A 3AVGA 3SUQA 2GIRA 4FJLA 3BJYA 1B9FA 4MQ3A 3HP6A 3U3GA 4OKKA 3SNNA 3HVRA 3KLFA 4FK0A 3D45A 3SPZA 3Q8RB 2V9WA 1FK9B 4UQGA 3BSNA 5DK5A 1N6QB 3MECA 3OL9A 3HJFA 1JLFB 3DLGA 3OLBA 1IM4A 3VQBA 2BE2B 4B9VA 4F4XA 2WK4A 3M9NB 4G3IA 4Y2AA 1VRUA 4QAGA 3MFHA 2HB5A 2ASLA 2GIQA 1BGXT 5KRSA 3FQLA 5I3UA 3G6VA 4YMEA 3MR5A 2BQRA 4ECSA 3PUFA 1SUQA 1C0UA 3T19A 3D28A 3D0PA 5KG7A 4C8NA 3NF8A 1S6PA 1TVRA 2WHOA 4CIEA 1SL2A 2BGGA 3QLHA 2FJWA 5F8JA 4I7FA 4CF0A 1ZBLA 4KI4A 1D9DA 1DTTA 1JXEA 3V9SA 1RTIB 2FC0A 3GV5B 1S4FA 1JLBB 4KRFA 3NMAA 4CHPA 4CEZA 2HNDB 1YTAA 4TYBA 4NLTA 4DTJA 1TKTB 1Q9YA 2HMIA 3WNFA 2IC3B 2D3UA 2E6LA 3NF7A 5F9NA 5L1KA 3OJUA 4JUZA 3KMSA 1S1XA 1T05A 3OYLA 3C95A 3HSTB 3EPGA 2O5DA 4Q0BB 3SPYA 1KRPA 3BSAA 5JXSA 2F8TA 4J2AA 4FJ7A 3OHAA 3LWMA 3CO9A 1RTHA 2X78A 4JV1A 5KG0A 1O1WA 4W5OA 4M41A 2BANA 4RU9A 1JXLA 1NK8A 4ELTA 5HRRA 3C6UA 4KAIA 1S1TB 1UA1A 5KFGA 1BQMB 2VA3A 1F21A 2JEIA 3QEPA 3L2VA 1QTMA 4OVLA 1DTQB 4K4VA 4C8OA 4LSLA 3BDPA 1U04A 2RF2A 4NLWA 3Q8PB 1BCMA 2B5JA 3KK2A 2XY8A 4O0JA 2FBXA 4W5NA 4CJ5A 1BCOA 4W5TA 3BR9A 3SQ1A 1RT4B 5J2PA 2FJXA 3ZT2A 3OYIA 2XY6A 4CHZA 1ZETA 5KFCA 4W5RA 1RNHA 3RRGA 5KFHA 3KLGB 4EZ9A 4EO6A 4ZMMA 2I1RA 3ISNC 2WTFA 4KE5A 3NE6A 3ZT3A 4CJSA 3MEGB 3KLHA 4DL2A 2W9CB 3H40A 1RBVA 5HBMA 3OYCA 4N5SA 2YNHB 4O3NA 2JEFA 4U7CA 1W9HA 2PYLA 3DLEA 1UWBA 1KFSA 2G8UA 2XWYA 4CGDA 2J6TA 1TL1A 2HNYB 1SV5B 5I42B 4KHUA 4ZHRA 4KKOB 1U09A 1JL2A 4HUEA 3K59A 4CJKA 2HNZA 4ED3A 1FKOB 4M95A 2HHWA 4DFJA 2HHSA 2A1RA 4FK2A 1HMVB 4CHQA 4ECTA 1XC9A 4RW4B 3IGVA 4DTOA 5KFUA 4FCYA 3DYAA 2AX1A 3F73A 2FJVA 1IKXA 2Y1JA 2C22A 3KLFB 3HK2A 4NLYA 5HLFA 4RNOA 3MECB 4F2SA 4CJRA 4KHSA 1RILA 4DSFA 3DLGB 5DLGA 5FROA 3RWUA 3KKSA 2P1JA 3VA3A 2UVVA 4BWJA 4AHRA 1VK0A 4FM1A 1VRUB 3QO9A 3UR0A 3GIMA 4K4ZA 4DTPA 5I3UB 4BE1A 4I2QA 2ILZA 4IBNA 5HP1A 3CJ5A 1EXQA 1FKPA 3S3MA 1SUQB 3NGYA 1C0UB 3CFRA 3HKWA 3V6HA 1HYVA 4IH7A 1S6PB 1TVRB 1VSHA 3QLHB 3VQQA 2FVSA 2DFEA 4I7FB 4OLBA 1NK9A 4C8MA 1DTTB 4WFXA 1WAFA 2KZMA 3PO5A 1NKCA 3TAMA 2YNIA 3HPHA 2XI3A 1S1WA 5F9LA 1QAIA 1S1UA 4F4ZA 2VWKA 2HMIB 3T5KA 4FLVA 4HUFA 2V0NA 4Z4EA 1RT5A 2O4GA 3EZUA 4ZPCA 3FQKA 4ZP6A 3ZSYA 3NH0A 3AA4A 4DSLA 1JLGA 4CJPA 1SH2A 1S1XB 1T05B 3CDUA 4ECRA 3K2PA 2XGQA 1LW2A 3RB3A 4O3OA 2R7YA 1XR5A 1WSJA 2Z1HA 3NHGA 3RB4A 2R2RA 4DQRA 3OYAA 5C5JA 1RTHB 1HQEA 1D0EA 3WNHA 3H59A 5KFQA 4CGFA 1TK0A 2BANB 4DS4A 2D0CA 4Q5VA 1REVA 3C6UB 3P1GA 2W8LA 2IM3A 1VSJA 2RN2A 4DSEA 4LSLB 1QQCA 1NK6A 1ZYQA 2RF2B 4DLEA 4J9LA 2B5JB 2Y1IA 3KK2B 2BRKA 1KFDA 3SI6A 3T3FA 2D0AA 1RBUA 2C28A 4JRQA 4EBDA 3OYBA 4DTSA 4E7KA 4KB1A 4L8RB 1NJZA 1EP4A 5J2PB 4TQSA 4DQPA 4CEDA 3F9KA 3QETA 3AVIA 2XY5A 4WZQA 1C2PA 4Q43A 3IS9A 1WSFA 3CM5A 3KLHB 3NL0A 3IG1A 3IGNA 4DFKA 5HBMB 3LP2A 4CJTA 3OL8A 5KFPA 2YKMA 3OSNA 3DLEB 1UWBB 1EKEA 3DLBA 4CE9A 4E0DA 1RDRA 4CHYA 4FJHA 1B9DA 1TL1B 3MXIA 4K4SA 4KTZA 5CZ1A 4MFBA 4ZHRB 5J1EA 5KFXA 3OLAA 3RMAA 4KBIA 4U6PA 2HNZB 4ED8A 4WFZA 2JEJA 1LW0A 4EBEA 4IDKA 1WSEA 4EYIB 4DL6A 4B08A 3RBEA 3ZCMA 3EY1A 3I0RA 3OYFA 3RMCA 4RW9A 3DYAB 3SUPA 2G8VA 2ALZA 1IKXB 3DRRA 3U3YA 4XPCA 3AO5A 3M8QA 4FJ8A 4TN2A 3HL8A 5DLFA 2AQ4A 4N56A 3VQ9A 4JV0A 5HLFB 1GX5A 3V6JA 2DFFA 2ATQA 1D8YA 3KJVA 1TQLA 3V81A 2B4JA 3O4QA 1RT3B 4TYAA 2X6SA 1X9MA 2E6MA 5JUMA 1YT3A 4O3RA 3B6PA 3B6OA 4J2EA 3QO9B 3LP0A 3NBPA 5L1LA 1S6QA 3PR5B 4H8KA 3MEDA 2JC1A 4BDYA 4I2QB 3NH2A 5HP1B 2HWIA 4Z4HA 3KTQA 3VQ6A 1FKPB 5EWGA 3EZ5A 1HNIA 4EO8A 3O4NA 4IOBA 2R2TA 3EYZA 4CGJA 1CZBA 3L2UA 4FLTA 4J2BA 2OPSA 1J5OA 3KK3A 4M3TA 1T3NA 2XHBA 4DTRA 4JRPA 2IM2A 1RAJA 4HYKA 4CJFA 5CZ2A 3VQDA 4F50A 1T94A 4FVMA 3AVLA 4IFYA 3TAMB 2YNIB 2IMWP 1TK8A 3KLVA 2E9ZA 1SKRA 2AJQA 1JKHA 4Y34A 4NLGA 4PA1A 1S1WB 1S1UB 3LPTA 4M94A 4F3TA 4FJMA 2IJNA 4FM2A 5KG3A 2AU0A 4CJVA 1RT5B 4FJ5A 5J2MA 4J9SA 2KZZA 2UUTA 3AVCA 4IR1A 3QZ7A 5DG9A 1JLGB 3DLKA 3OSPA 4DQIA 4NCBA 1LW2B 3DRPA 3VN5A 5KFSA 1UAXA 3NGZA 3AVFA 1FXXA 1JLCA 4E7JA 1GOCA 4ECWA 5KT5A 3H5UA 4NLVA 2KW4A 3SQ4A 1NKBA 4M3YA 1HQEB 1JL1A 3V9ZA 2F96A 3AO3A 4MIBA 3LP1A 1REVB 3JYTA 2J6UA 4M3WA 4LH4A 2W9AA 5KT6A 1W0HA 1NKEA 3N6MA 5KG6A 2FLPA 3DOKA 1NK7A 4RZRA 3E51A 1N56A 3TWHA 3S3OA 4URQU 3ZSXA 4M3XA 2ZE2A 1BIZA 4N41A 5DGBA 3VA0A 2GUIA 4FXDA 4IRKA 4QWAA 3KK1A 5DG7A 1EP4B 5KI6A 5KGXA 3NF6A 4AHCA 3K5NA 2IM0A 3M8RA 4Y2CA 2XY7A 4I2PA 1VSKA 4XIUA 4KB0A 4IH5A 3IS9B 5KFAA 3QNNA 4PWDA 4FJGA 2BR0A 4DF8A 3IG1B 3CM6A 3LP2B 3DLRA 4B8CA 4FLXA 2YKMB 3PJXA 3TANA 3AVKA 2V4QA 4KO0A 4K8ZA 1BQNA 2OH2A 2PY5A 3QESA 3SZ2A 2GC8A 4NYNA 1WLJA 4KI6A 4MFBB 5J1EB 2OA8A 4FLYA 4BE2A 4CFCA 3KOAA 2HAIA 4OGCA 1YVUA 3H98A 3OJSA 4OPKA 1LW0B 1XHZA 1HRHA 4WXWA 4K4YA 4ECUA 3T5LA 1RA6A 4CGHA 4IDKB 4F4WA 4CJEA 3K58A 1QUVA 3I0RB 3MAQA 2C2DA 4RW9B 4IRDA 3NAIA 3QERA 3CJ4A 3SCXA 3DRRB 1ZBHA 1A5VA 3M8QB 3CJ3A 3KJVB 2IJFA 3V81B 1RBRA 3OS2A 3LAMA 1QSYA 4QW8A 3L2QA 3OYGA 3L2RA 3PW7A 3LANA 3SV4A 1CZ9A 2FVRA 1KTQA 2YHAA 3NAHA 4MIAA 3OYKA 2HHTA 2R8IA 1CXQA 3AA3A 3LP0B 3NBPB 1HYSA 3TARA 1S6QB 3MEDB 2E9RX 1S10A 5HRSA 4LQ9A 4ED2A 4R5PA 1HNIB 5CYQA 2WCXA 1L5UA 1RTJA 3LZIA 4DFPA 1X1PA 4RNMA 4DFMA 2OPSB 1D5AA 1J5OB 1JIHA 3KK3B 4K8XA 2G8WA 4F3OA 3CG7A 5KG2A 4Q8FA 2OPRA 2HHXA 5KFWA 1C0TA 1LWCA 4WZMA 4DMNA 1RT6A 2YNFA 3GV8B 4WYLA 3AO2A 4IFYB 4TY9A 1DLOA 3NAEA 3BQ0A 3H5YA 1JKHB 3DM2A 3Q8QB 2WB4A 4TY8A 4NLUA 4BE0A 5J2MB 2QK9A 1RTDA 4H54A 3DLKB 4CJWA 2NUBA 3FSIA 3GILA 3DRPB 2HHQA 2IM1A 3ZSQA 1JLCB 3LAKA 4KREA 1WNEA 1C6VA 4FLUA 4HKQA 5E41A 4O3SA 4FJ9A 1ITGA 4BDPA 2XGPA 2R8JA 4FLWA 4B8AB 1Z25A 1U48A 3LP1B 1S48A 4ECZA 3K5LA 3JYTB 4J9KA 2BRLA 3DOKB 4KHYA 4E7IA 5EUHA 4IG0A 3PW2A 4YR3A 3I8DA 2X74A 3L2WA 2ZKUA 3C6TA 4MH8A 3UPFA 5KFEA 4Y3CA 1A5XA 4M3UA 4NLQA 2ZE2B 2DPIA 1C0MA 3M9OB 4IR9A 3KK1B 3HPOA 3KHRA 2UUWA 3FFIA 4CF9A 5L1JA 1UA0A 3ITHA 2BQUA 4E1MA 4FW1A 3AVHA 1U49A 2YHBA 3TAPA 4I2PB 4CEFA 1RT3A 3OL7A 4PWDB 4RNHA 2PZSA 3TAFA 1S5JA 4RW4A 4NLDA 4HCBA 3NDKA 4KO0B 2VWJA 4DQQA 1GX6A 4J9NA 3OYNA 1ASWA 3LPUA 1BQNB 4G1QA 3RAQA 3TR8A 1RDAA 2ZQBA 4Q45A 4IH6A 4ZVEA 2IS3A 3UIQA 4DL7A 3AA5X 3QIPA 4OGEA 5DQIA 3ISND 2ASJA 3BREA 3V1OA 2O4IA 4B3OA 3BSOA 5EU7A 4H4MA 4QWBA 1K1SA 4Y1CA 3H5XA 4OKJA 4WE1A 1K6YA 1TL3A 1HARA 4OJRA 3ZT4A 3DOLA 1JLQA 3THVA 1J54A 3QNOA 4NCAA 4MK7A 3CJ2A 3PVXA 3PO4A 3T5HA 4OKEA 1HPZA 4NCGA 3S9HA 5KFRA 2UVWA 2ILYA 3GIIA 2VA2A 1S49A 1BL3A 4K4UA 4OLAA 5KFVA 3V4IA 3WNEA 2HHVA 1SKSA 5K14A 4QCLA 4J9RA 1ZBUA 3TI0A 4KAZA 5HRPA 1XWLA 1HYSB 3V6DA 1LAWA 1VRTA 3ZSWA 4B9NA 1IKVA 2AWZA 4R5PB 5CYQB 1LV5A 1RT7A 1RTJB 1NHUA 3A2FA 3HPGA 2WONA 1JX4A 1XR7A 3N6NA 5SZTA 1TAUA 2OPRB 3G6XA 1SL0A 1C0TB 1LWCB 3VQ5A 1RT6B 3MXJA 2FLNA 2YNFB 4FK4A 1DLOB 3KHLA 1S9GA 1RA7A 4FJXA 3VQ7A 3DLHA 3DM2B 3VQSA 4NYFA 4TY8B 4RW7A 4RW8A 3O3HA 2QKKA 1Z26A 3G10A 2DY4A 1RTDB 5F8HA 4NLSA 5F8NA 1WAJA 2Q3SA 4XO0A 2QV6A 3V6KA 4Z4IA 4ZPDA 2R8GA 1RT2A 3PW4A 4CEAA 5KFBA 5CYMA 5KFMA 4FJKA 3LALA 2FBVA 2W8KA 5KFKA 2OPPA 2A1SA 5KG1A 1N5YA 1WSIA 1KCFA 5KFOA 1QS4A 5KG5A 3CDWA 3SQ0A 4FJJA 3HVTA 3HM9A 4HHTA 3QIOA 3M8PA 1TKDA 5J2NA 4KHMA 3CYMA 4B9TA 4ZVFA 1NJXA 4NLRA 3GQCA 3FRZA 4IG0B 3PV8A 3C6TB 1BHLA 4EZ6A 1LWEA 3AV9A 1R0AA 1I3AA 1NNDA 2BDPA 3CFOA 1L3SA 3PX0A 2AGOA 5T7BA 3FFIB 4ECQA 1XHXA 4GW6A 4ZTJA 2WOMA 1JLAA 3ITHB 4QW9A 1S97A 4CIGA 1BI4A 1S0OA 4CJLA 3O3FA 2E9TA 4R8UA 2XRIA 1SH3A 4CIFA 1LAVA 1VSDA 3NF9A 2D3ZA
chains in the Genus database with same CATH superfamily
2F8EX 1Q53A 1KHWA 3GB0A 3THXB 1HL6A 1HNZJ 5LOQA 3QYYA 3BR8A 2HW3A 3E01A 2UVRA 4ID5A 1H2TZ 4N8NA 4TSXA 3D54A 2G4BA 4KHNA 2IYIA 3ZEUB 1MROA 4IOXA 3QIPB 5KT2A 5JS1A 1V4TA 4HLBA 4NLPA 4ELVA 4BCAA 3MUMP 4BR7A 3JXOA 3TQEA 4CI0B 2J0SD 4IG3A 1LOUA 4ZLJA 1RACB 2ZH3A 3DOLB 3GYNA 4CFBA 5K8MA 2ZM6F 2AF6A 4PEOA 3HHDA 3H42A 1HPZB 4NCGB 4PYDA 3FGVA 3M8ZA 1T9VA 3T1YF 1X4DA 1B7YB 2B7BB 2GGPB 3OL6A 5F8LA 2XC9A 4ZP9A 3H45C 5JICA 4LFCK 2XCAA 1BUXA 2OMOA 3D5MA 5CCLA 4ZLNA 4OYOA 2BV3A 1WG4A 3OTCA 3ZFVA 4NX9A 1FFWB 3VAHA 4CJUA 2KB2A 3M8SA 1YZ6A 1IG9A 3ZTSA 4JBCA 1RT7B 4WU3A 2ZVIA 1FVQA 3DHWC 5THWA 3H08A 2ZJRL 3PX6A 4YY3J 2E2QA 3R27A 1WKJA 4RW6A 4CJQA 3L4BC 4QR0A 3GMGA 1OS5A 1WC3A 2AZ3A 5AQXA 2UXBF 3KVGA 1Q86O 4H4OA 3U02A 1HNWJ 4RW8B 1HKAA 4Y0WA 5C24A 1UKUA 3WBZA 3SFUA 4BS2A 1OQ6A 4TNOA 1MWZA 1RT2B 4KRWA 1ZOTA 3FRYA 4PUOA 3ZSZA 4YR0A 4WP9A 2BQ3A 4ECVA 4KQZA 3HVTB 4UZBA 2QL9B 3KD1E 1CZAN 3KMQA 4XDCA 3M8PB 4K5SA 5GAEU 5KPTA 1S3XA 3C2PA 3O1WA 3U9ZA 3HHNB 2A10A 1PAEX 5GAHP 4A61A 4OYAA 1CULA 2V2VA 3D3CJ 3ZLJA 4I56A 3UNGC 2QWPA 1DJ0A 4H03B 4C9DA 3NCRA 1S0MA 1FEEA 2MKJA 2KJVA 1JLAB 2LCWA 4LRFA 5KFJA 2F8HA 3CD7A 3MFIA 1BDGA 4I64A 1FJGF 1N32K 2HHHK 2LYVA 1GK8A 4KFBA 4RNNA 4EP5A 3TZYA 4R79A 3C94A 3GG0A 3BQ1A 5E33A 3DLJA 4CCHA 1P9QC 2V4RA 3ASMA 2A2CA 3EPIA 4JK9A 3IN5A 1T9YA 2XCPA 3QRRA 5C25A 3CJ0A 3J80Y 1IKWA 5GADU 5FIIA 3ZTRA 2QN6B 2ZFHA 3NGDA 3CCQS 1S0NA 3WXIA 5L1IA 3I8BA 3FCHA 1VBYA 4B1UB 5IWAF 3ZNUA 4O4GA 1SC3B 3SI8A 3KG4A 1SC6A 4AL6A 3ICLA 1XEZA 4FZZA 1FD8A 3PX4A 3KLIB 3HZGA 1U4BA 4CHNA 3I96A 4FF1A 3D0GE 3AA2A 2UXDJ 3R7NB 2XBPA 1WBDA 3UKUA 4UQTA 3POTB 4FYDA 1SH0A 4PY5A 2GWJA 1NCLA 3OW2M 3R7SB 1HR0K 4BDZA 1OH8A 1NZ8A 3OYMA 5E3CA 4FSVA 4E1NA 1TKZA 4IQMA 1Q8IA 2EFPA 5BN9A 1YJ7A 5IZHA 1C1BA 3VZHA 3MPWA 4YR2A 2OHDA 5L9NA 1VQMS 3KWMA 2W2MP 3W1YC 1BA0A 3TSPA 2IAJA 1Y3KA 4I69A 1I5OB 3J81U 4IYQA 4F4KA 2IDOA 2ZDPA 2IBKA 2HS0A 3FLCO 2ZZMA 4DI6A 2Y8YA 2QLXA 3VPZA 4DL3A 3PG9A 3M6GA 3G2XA 1Q18A 3T1AA 4KSEB 1XMQJ 2W7AA 3AGKA 2KM8B 2CWXA 3MCPA 2M7SA 3UQSA 2JWLA 1FRHA 1H73A 1NB7A 3ENOA 4AFFA 2CJBA 3RUBL 3SYZA 1RHQB 2BACA 2WSEC 4KB7A 2DISA 1KSPA 3FBEA 2JGUA 4A2AA 4BC7A 5C42B 1GOAA 3A0IX 4BRIA 2UVUA 5J2QA 1O13A 3PIOQ 2Y0BB 1Z2LA 4CF8A 4B1WB 2ZWOA 1QVFR 1LK5A 3SMZA 4X2BA 3SUNA 4USHA 1TP7A 2WW4A 2H9ZA 3QINA 1BMQB 1NAQA 3Q7BA 3K89A 3M2VB 5IQQA 2ZOGA 3I82A 3KIOA 3PRBA 3J81j 2XMTA 4V19X 1RBTA 1ZXOA 1RHUB 2WSCC 1VQNN 4BLGA 5AQHA 3GU0A 3H2LA 5F0UA 3C46A 1IKYB 1RDBA 1MMLA 1UVMA 4PQUA 1J5EK 2CQ3A 2IVFB 2XO6A 3ZTOA 4CLKA 2RDJA 4CGGA 2MJNA 4GO7X 4ED7A 1WB9A 3V1QA 2QL7B 1S9EB 4DR7J 5FDLA 4BRGA 4LMZA 1TL4A 2B51A 1CJKB 3IDHA 3NCPA 1T3VA 3CCMS 1EHWA 4OPHA 2I6WA 3CC2S 4DL5A 3TA1A 4CBWA 2ZD1A 3RR8A 2G2OA 4LSNA 1NM2A 3V9UA 4W4MA 4KH1B 3CC4S 1OYDA 3K9JA 3VENA 3SSRA 3V9WA 3JSMA 1M5KC 2CQPA 3O9UA 1QUPA 2VG6B 5GIOA 3H5SA 4YS2A 3E66A 4DTXA 4BRQA 4WFAL 4DHVA 3NEKA 1FE0A 2UUBJ 2Y0SD 2V2QA 2VFTA 3ZSRA 1EX4A 1NK5A 2AGQA 3J7ZO 1RYRA 1A9NB 1S22A 1TKXA 2XS2A 2XYGB 2R8HA 2Z2MA 4EAHD 2Q3PA 4PG5A 4JKGA 1MN7A 4J9MA 3C16A 2YKNA 3RJMB 2H5EA 2ZH2A 4LR7A 2RB7A 1O0PA 3FSYA 2F40A 1Y11A 4O4RA 4KHPJ 2VQFJ 2ASYA 4HR2A 1FK9A 5GAGU 4DR3J 2OFGX 3EL2A 1N6QA 3ZZYA 2KO1A 3M3ZA 1JLFA 4TLRA 4LF6F 1VBZA 2XS7A 3I5BA 4Z4FA 2ZBPA 3LZJA 2R42A 2CNNB 7FDRA 4FPBA 2CA9A 1N5QA 4X4QA 1XNQK 2F8MA 4CJ3A 2DY9A 3S8SA 1RCOB 3K57A 3OS1A 2GJ2A 4GKJJ 4NMXA 2RPIA 1Y3JA 2KFNA 2XZTB 4BVOA 1I39A 3U27A 2OANA 4NE9C 4OZNA 2E5IA 2MZJA 3SAGA 4X4VA 1NGBA 1VQ7S 3WHIA 2CNLB 5T14A 4FZVA 5KTQA 4JYAJ 2DHSA 1JLEB 3MEEB 2YVSA 5ITHA 3CJKA 1D9AA 1LK7A 4FOIA 2HNDA 1IO2A 2F4FA 2YKPA 1TKTA 3FEZA 3FUYA 3UDVA 3PYEA 1TFWA 2IC3A 2AGPA 2NREA 3QEVA 1K44A 2V51B 3TUIC 2MKYA 1SJ1A 4DWIA 4LF9K 4A46A 4K2JA 1KVAA 1FA0A 5B0BA 1H1VA 3DXKA 3HP9A 1KAYA 5A8WB 3NVKA 2EX3A 4Z2XA 2ZVSA 3OHBA 3T1HJ 2KRBA 2RS8A 3K5MA 5BN8A 1FWKA 3M8YA 3BUZB 3TTDA 5KFLA 1MMNA 3G82A 4P7VA 2DRAA 4TXSA 3UKRB 4NLXA 2E2OA 1HHTP 1Y64A 5LXYA 1W2BM 3MWTA 1EQ0A 3AHPA 4YQWA 3VQCA 2JOQA 2HAFA 3R6LB 2WBMA 4QR1A 1WSHA 5F8GA 1VQ8N 1X4CA 2QGFB 5HSPA 4MKAA 4CLLA 5HRNA 2P9SA 2IMOA 2V4JB 1PIEA 4K59A 3VQTA 3U1NA 3VAJA 2FSKA 1RBAA 3KLGA 2F4VJ 2G8IA 1G2EA 4DG1B 5DGAA 2Z1IA 1U1MA 1JNRB 3L3CA 3ENQA 1QSSA 1WC6A 4P71A 1NSKL 2QC3A 3BEGB 3HHLD 1RYSA 1WN7A 1FJEB 4DSKA 3EN9A 5A6PA 4K4TA 3O2IA 4O0IA 2FVPA 3QT5A 2X6NA 2HNYA 2K3IA 2VG7B 1BLUA 4QWCA 3OQ2A 4KKOA 3H20A 1EARA 1PKUA 3HD2A 1UW9A 3OY9A 5KAKA 3UDLA 2DEIA 1BO5O 2V68A 3DAWA 2G2YA 2PSZA 4MJKA 5CY4A 1YZ7A 1JCGA 1JXBA 4L3NA 1XR6A 4F26A 2MYFA 3QT6A 3SUQA 4FJLA 4MQ3A 3DRYA 5EX5A 3Q8RB 3VWSA 2BA9A 2PFDA 3UCUP 4C98A 1OWXA 3OL9A 3HTVA 4JI7K 3DLGA 4A8YA 1PBUA 3BO2A 4EU0A 4F4XA 3M9NB 3C15B 1V5VA 4Y2AA 5HL7L 1R89A 3MFHA 3AY9A 1BGXT 2QA4G 3MD1A 3R2DJ 3CCJN 3FQLA 5B0EA 3R5AA 3W7BA 2W2NP 2DGTA 3OUYA 2ZZNA 2HF4A 3PUFA 2CPYA 4O5FA 4UY8O 3VAMA 3VVUA 3D0PA 3NY0A 5KG7A 1U1KA 1S6PA 5LMNF 4NOHA 4CIEA 1SL2A 4HT5A 5LJVA 5AQPA 3ULEA 2FJWA 2IHR1 4LSZB 2RILA 5BXIA 1N33F 4KI4A 5HMYA 1RTIB 1R6VA 2LLZA 2FC0A 3GV5B 1JLBB 4CEZA 2CPIA 4FVUA 1YTAA 4TYBA 5F41A 3CJRA 2XMWA 3IBWA 1YI2S 3O5BA 3CCES 8ATCB 1I94F 3OJUA 4UTGA 4JUZA 3GP9A 1IUJA 3KMSA 2NPIA 3CCWA 5CD4H 4BROA 1Q8BA 1KRPA 2VBWA 3L7OA 3THYB 4J2AA 1ZPVA 4FJ7A 3OHAA 1R27B 2E2PA 3TU5A 2XYHB 4HTJA 2X78A 2N4DA 2OEKA 3SLCA 4U95A 2J9DE 4JV1A 1O1WA 3Q2SC 8AT1B 2P9UA 1SZ2A 2PI4A 4ELTA 5HRRA 4B3MJ 3MMAA 3L2VA 3QEPA 4OVLA 4JV5K 4X65K 3CJ8A 1DTQB 4OZ5A 4C8OA 3C14B 3CMES 3DHXA 1AA1B 2HRTA 2B5JA 4IJAA 1IR0A 2R7TA 1E6YB 4CZKA 1X5TA 2VKRA 4IO9Q 5DM6Q 4QIWD 2HBQB 1V3ZA 3H46O 2L3MA 5AQIA 3CHWA 4M63C 1K8AT 5KFCA 3QNWB 1N0UA 1TL7A 2EK6A 2I1RA 3ISNC 3NE6A 3ZT3A 3MEGB 3KLHA 4X66J 4YOWA 4M5MA 5HBMA 4X4NA 6FDRA 5IV3A 4O3NA 1W9HA 2UYTA 2G0IA 1UWBA 4CGDA 1QQOA 3W60A 3UI3A 4KC5A 4ZHRA 4LR9A 1REGX 1U09A 4FP9A 2NYHA 3IBFB 4M95A 5AQOA 4USVA 4J5OA 3FK4A 4CHQA 1TFYA 2YQ3A 1X3MA 4B3TJ 2GQ2A 2QTWA 1JJCB 1VLOA 3H2UB 4L73A 2BKNA 1NJIT 5KFUA 3MCMA 3FR0A 4DX8H 2DR5A 4PYAA 4DR4F 2EXUA 1N36K 4NLYA 2HBRB 5HVGA 1S76D 4KHSA 4FWRA 2W24A 3THWB 3ENHA 3KKSA 2CGJA 2P9IA 5LXRA 1UVLA 2UVVA 4NXNJ 1VK0A 1VRUB 4O23A 4ZLPA 1VQ5S 4AQYJ 1WHXA 2WUSA 4DTPA 5I3UB 3AA9A 4ZN3A 2V52B 1HLWA 3NMUA 4I68A 4WJBA 3PNIA 4D3HA 2LQ5A 2HGNA 1TVRB 1YITS 2QG9B 5BPLA 1HWIA 3BZKA 3G6ES 4G1IA 2V8DA 4DR2F 1DTTB 1NGJA 3I55S 1HUXA 3TZWA 1NKCA 1YJNS 4GVLA 1QAIA 1KQGB 1X4BA 4LT6A 4U7UD 4HUFA 4FF3A 2O4GA 2V50A 3M7VA 2QL5B 1ZZNA 2EEYA 1U26A 2CPHA 2HQCA 3CDUA 2XGQA 3NCQA 4O3OA 4KBOA 2R7YA 4F02A 1WSJA 2O8CA 3CCRS 2RQMA 2VQEK 3HMJG 1R43A 1FNMA 2KHCA 3ILIA 3WNHA 4CGFA 1TK0A 1KBRA 1CJUB 5F3TA 4BC4A 1HWJA 4Q5VA 5CZXA 4DPTA 1U6FA 2M0GB 2EG1A 3TVYA 2B3TB 2IM3A 3KDNA 2RF2B 4DLEA 4J9LA 4O8UA 4GVBA 1IBKF 3R3LA 4ZKAA 2N82B 1RBUA 3J7YI 3W2VB 4DTSA 4L8RB 3GR0A 4YORA 1NJZA 3ZC4A 2WVFA 1UJ6A 3QETA 3ETOA 3KWIA 2CZ4A 2J7WA 4Q43A 3IS9A 1MLAA 4RBTA 1UJ4A 3NL0A 1RKIA 4DFKA 3BPSP 4LRCA 1BD6A 3OL8A 3KUGA 1ZAWA 3DLEB 3KJFB 3DLBA 1RDRA 2XQCA 1F2HA 3R5CA 2I9SA 1NSQA 1VR6A 3FBFA 3OFFA 4DV4J 4CNYA 3A3OB 3HHLB 4WBFA 4KBIA 4U6PA 2VPWB 2HNZB 2PO4A 4GKKF 4ED8A 3EMTA 1X7VA 5HANA 4A47A 4WFZA 2JEJA 3A12A 3JSBA 1VQKS 4FYWB 1WSEA 4EYIB 3SAHA 3A8JA 3ZCMA 1Y5IB 3OYFA 4QIEA 2VBZA 1WKLA 4RW9A 2HS4A 2G8VA 1UVIA 2V2KA 3U3YA 3B4DA 3AO5A 2ZZTA 5JLHA 1CVJA 3HL8A 4JNEA 4WFNL 3VQ9A 3V6JA 5HLFB 5AFUA 1TQLA 4NZ6A 1RT3B 4TYAA 2E6MA 3LUYA 5JUMA 4FNIA 1XBWA 2ASMA 1HBOB 4J2EA 4TU7A 3QO9B 3BDEA 4LVOP 3NBPA 4DR1J 2MQ8A 4XEIA 3NH2A 4BC9A 5HP1B 3KTQA 4EO8A 3O4NA 2CYYA 2R2TA 4CGJA 1TMMA 4J2BA 3EX7B 3WZ0A 2MDAA 2XHBA 4OO1J 1YJUA 4JI8J 2IM2A 4HYKA 5C10A 2UUAK 2HF3A 2YNIB 1SKRA 4LF8F 2E9ZA 1JKHA 3VEOA 4DUYK 3THPA 4FJMA 5KG3A 1R8HA 4CJVA 2WVCA 4IR1A 4P2SA 1U1QA 3MAAB 2PEHA 1LW2B 3DRPA 5LJ5Y 3K7RA 1UAXA 1D8ZA 3O4WA 2BOPA 2HFUA 5H1SQ 5CQGA 5KT5A 5BYRA 1OIAA 4X4TA 2KW4A 1JL1A 1KC8O 5EY4A 3FZHA 4B9QA 4RJVA 4CYUB 3O8MA 2XHWA 3VGUA 3LP1A 1REVB 1X4FA 3JYTA 5AXMA 4M3WA 1IJEB 3GWCA 2O3DA 2Q36A 4LH4A 2W9AA 5KOXA 1NKEA 4BQZA 3C7NB 1IQTA 3DGPB 3SDEB 4URQU 4H4KC 4HHUA 4C11A 4LF7F 4AL5A 2GW8A 2ZE2A 1RAFB 2DH9A 2IRUA 4LF2A 4C0HA 1VC5A 5KGXA 4ER8A 3E1YA 3ZETA 4PRFA 2FF3B 4I2PA 1R8PA 5H9FJ 4KB0A 1WOOA 4IH5A 5IV4A 3UE2A 3QNNA 5IS2A 2PFUA 1JXVA 2AJ0A 1XN9A 3CM6A 4LFCJ 3B82A 3BPDA 1LXJA 3OR1A 4KH0B 3TA0A 4DV7K 2PBDA 1VGYA 3FZFA 2NXUA 4WK3A 4F25A 2IIHA 4FLYA 3KOAA 1SB6A 5AZIB 4JKAA 2UP1A 2M70A 1LW0B 1NRKA 3UFCX 4WXWA 1HRHA 4K4YA 3T5LA 2AIRB 4ECUA 3R9PA 4IDKB 2W25A 1TUVA 1UEKA 1CJVA 5A8KB 3PSIA 3TJAA 2ASOA 2JVOA 2NXJA 4NWBA 1ZBHA 1JCFA 3CULA 5LM7E 4WQ4A 3CJ3A 2OIHA 4F0KA 1EKSA 3LAMA 4MKVA 2PFFB 3L2RA 4ATNA 2R3VA 3A8KA 3LANA 3GFZA 3CCSN 1KTQA 4FDFA 4BRMA 4PABA 2M9KA 2R8IA 2HHTA 2MLZA 3AA3A 3ETMA 4C0OC 5HMWA 1S6QB 3MEDB 4KGXB 2E9RX 3LDLA 1ZBTA 2W01A 4DDFA 2H4YB 1RHMB 5CYQA 2WCXA 3LZIA 4TU9A 3FBBA 2OPSB 3TVZA 1J5OB 4WCEQ 3A4TA 2CJYB 5HVHA 4JP8A 2CQIA 4ES3A 4CZJA 2OPRA 2HHXA 3UW1A 3TUJC 2YNFA 3NAEA 3X3UA 1LEOA 3H5YA 4Z7CA 4X4RA 4IO9L 1M1GA 3A5MC 1CJTA 3QJPA 4U96A 1PSDA 5J2MB 2FD2A 2ERRA 4Y65A 2E2NA 1OMSA 2C3PA 2HHHJ 4PG7A 2J9EA 4QBUA 4ZA1A 3LAKA 1IVZA 4O3SA 1ITGA 4BDPA 2AJ2A 2A3JA 2XGPA 2OCEA 1BA1A 4ILJA 4HACA 3VEXA 4B8AB 1Z25A 1S48A 2KT5A 4LJMA 3T41A 4L6V3 3DOKB 2VU5A 1P1LA 4JI0K 4YOXA 4KHYA 1RZMA 3RAMA 4IG0A 3PW2A 4YR3A 3L9ZA 1CC8A 1O51A 1J2VA 1MWKA 1A5XA 3H7HB 2C2ZB 3BN7A 4DV6K 1M0SA 2XZWA 2Z8QA 3KK1B 2MJUA 3AOAA 3P45B 1T11A 4CZLA 2UUWA 3FFIA 2DGXA 3PXGa 4M7XA 5D4NA 3TAPA 1IWGA 2FGCA 2YQ1A 1RT3A 3OL7A 1WI6A 1OVYA 2NXCA 4RNHA 4X64K 1H0HB 3AAPA 3TAFA 2PMWA 2GUPA 1S5JA 1T9TA 3FGUA 2YQ0A 4DV3K 4KO0B 2VWJA 7AT1B 1GX6A 1RAEB 4J9NA 2Q6CA 2WW8A 2Z2YB 3RAQA 3R2CJ 4IOCQ 1RDAA 2ZQBA 4IH6A 2YKOA 1Q78A 3BREA 3IXQA 4H4MA 2DCLA 1HARA 5IQ6A 3CDBA 2RE1A 3NWRA 3A5NC 2EBGA 3HCXA 3H2VE 3GFXA 1VC6A 2ZGYA 1LWXA 3TRGA 4OJ1A 2PDAA 2M88A 5KFRA 2A3ZA 3CCVN 3O1LA 3HBTA 3GIIA 5L46A 1N5TA 5E2QA 2LXFA 3W66A 5M2RA 4OLAA 3UVJB 5KFVA 3V4IA 3WNEA 2ZH4A 4PL8A 1DZ5A 3M2RB 5D4OA 1WF2A 1XWLA 2ZM6K 2OLWA 2B4OA 4OX6A 3JAMY 4LBHA 2HEKA 2GS8A 4B9NA 1IKVA 2AV5A 5AQKA 2AWZA 3T1YK 4R5PB 2XLJA 1H7XA 3GSDA 1RTJB 5B0CA 3AGRA 4WP8A 2E20A 5ETSA 1GT8A 3FE1A 5D4PA 3HRGA 1XR7A 4F0HA 5SZTA 1TAUA 2HGLA 3I4PA 3G6XA 1ZAVA 1C0TB 3BO3A 3MDQA 1F9EB 1YX2A 3DGVA 1Q16B 3GBTA 4FK4A 1DLOB 1S9GA 3CC7S 2UU9F 3VQ7A 2QFIA 4C3KA 3Q8YA 4X4PA 1VQ4S 3VQSA 4TY8B 4RW7A 4UY8T 1Z26A 4MAKA 1RTDB 3EICA 1J5EJ 1WAJA 4CH1A 3JAMO 3CCLS 2P9NB 4IEIA 3EKUA 4K5RA 3BO4A 5CYMA 2UXBK 2HIQA 2RUSA 5KFKA 1H6KX 5KG1A 1N5YA 1WSIA 5GMKa 1OPIA 3SQ0A 4Y0FA 2ASPA 2DR7A 1A0OB 4LFBF 1PBAA 3WXKA 1VQ6N 3ADAC 2VHGA 2VDHA 5B8HA 4NLRA 3FRZA 4ZJLA 1HWUA 1WG5A 3CCUN 1SJFA 3J7AN 3C6TB 2YWGA 2FUG9 5BPMA 3CFOA 1ZAXA 2GAHC 3MPYA 2IY5B 4ECQA 3D9BA 3CMAS 4GW6A 3NP5A 1ZM3A 2LEBA 2UUBF 2DO0A 1S0OA 2MB0B 1KQSM 4DV2J 3EZWA 4OI0A 1ILYA 2MKSA 4DQ8A 4CIFA 4PAAA 1LAVA 1VOMA 1B4SA 3NF9A 2D3ZA 4RW4B 3A8YA 2QTDA 2Q0UA 1IBLF 3U6FA 4C1NI 3N4QA 3SBGA 1VSLA 1VK8A 5A0YB 1OSDA 1FJGK 3D7EO 4KIAA 4FLZA 4B3OB 4I9QA 3OD2A 4QOZB 1XNQJ 1RABB 2OP5A 2M8DB 3DDKA 1EETA 2MLYA 2OPQA 3MM7B 2Q2RA 2P5GA 1HNVA 1H98A 3VQ8A 4K42A 3OVSA 1NOYA 3U7JA 1RJJA 2YNGA 5IWAK 3NKYA 4TQRA 3PY8A 3D6TB 4DV5F 3MHYA 1SPBP 5CXTA 1UETA 2Q1LA 1O6XA 2DNMA 2LEAA 3RAXA 3AO4A 1XMOK 4YP3A 1HBMA 3Q2TC 4B9SA 2JFDA 3V6DB 1RB0A 2OD6A 1M5PC 2ZBQA 3VGLA 4Z4GA 4YDDB 4JYAF 3N28A 3G0ZA 4KGMA 4NYZA 4WIQA 4O44A 1V3SA 4RNFA 3J7YP 4Q2LA 2WONB 5C2CA 3SV3A 3SUOA 4LF9J 2C3UA 4O3PA 2DXEA 4BR5A 4HUGA 1GOBA 2JLEA 3M32B 1I3OB 3MM8B 1GLLO 3QEXA 5K8PA 1MA9B 2C2EA 2I5JA 1C1AA 2F9JA 5D3GA 2RHQB 5ETPA 5JVHQ 3T1HF 1T03A 4WP3A 4DQSA 1OY6A 1MU2A 1OSCA 2W1BA 4K7QA 3LWLA 4YDUA 4AHUA 3S3NA 4NA2A 4XPEA 2K8GA 3RSEA 4F4YA 2VG5A 5M1FA 1FTRA 4IKFA 4FBUA 3KD5E 2CH5A 4P2FA 4K41A 3PFOA 2HQFA 1GMWA 2W7PA 2LU2A 4ZTFA 2RT3A 2N4CA 2DGUA 1EAYC 4RKUC 5J2NB 2ITGA 4IOAQ 1HW9A 1NGDA 2L9WA 5AE3A 3GIJA 2WVBA 4UW2A 4IFVA 1UMJA 3RB6A 2Z1GA 1DY3A 1HQUB 1LWEB 3VF0B 4K0KF 4ZVPB 3W3DA 4CEQA 1XI1A 2GBZA 3C66A 4Z94A 2B9XA 2R7OA 1K9MO 2B6AA 3T9NA 4CFDA 4JI5J 4ISGA 5LL6Z 4EEYA 1U24A 3ZT1A 2A40A 3U1MA 3PLAA 3VQ4A 4CWBA 2P51A 5AZJB 1DARA 2V34A 1N4LA 4DU4A 2KXNB 1VJWA 3OYHA 3RMBA 1KLMB 3BN4A 1F3VA 3ZTPA 2DD8S 2F5GA 1O8BA 2ZKTA 2OO4A 2A6AA 2P5VA 1VC0A 3KLEA 4J2DA 2VGMA 3O6WA 4RUCA 4WCEL 5TKWA 1E4FT 4BACA 2XMUA 3VAKA 4A8XA 4PKDB 4IJNA 5LSRA 1C1CB 2LDIA 4FM0A 3CFPA 2B43A 4ZVTB 3BGRB 1C4CA 1H3DA 3HSJA 1WC4A 4LC9B 4PWUA 2RKIA 3C3LA 3PYGA 3MR6A 3H25A 2HRYA 4KJIA 3JS9A 1SCJB 4IKAA 3NNAA 5KPZA 4QWDA 4GMJB 3AH6A 4QWEA 3I5AA 5C2DA 1ZA1B 4E7LA 2FTRA 4R0EA 3NWGA 2GELA 5HK4A 3MF5A 5L9XA 4LF4J 1FFSB 4BRAA 4M5HA 4LQ3A 1QE1A 5DDOC 3CQXA 1Q81O 1VSIA 3HHKA 4P74A 2GCFA 1FRXA 3LGHA 4K4WA 1GXUA 3MURP 1S9FA 3QFPA 1U0HA 5KT3A 2RH3A 3E8OA 2QWNA 1RWXB 3L8BA 3DMJB 2GVZA 3DRSA 2A6MA 5AQYA 4A8SA 4ZVHA 5BREA 1Z6RA 3LL3A 4KV8A 1N0VC 3PJWA 2JFKA 4LF6K 3IA0A 4JD2B 5LMUF 3F9MA 3MX5A 4W5QA 1YJTA 3TYTA 2A18A 1OJ4A 1U45A 1C0GA 1OKJA 3RBDA 2MPUA 2XO7A 4JV5J 1K73T 2DNPA 3PHEA 3C19A 1F5BA 1RHJB 2DNHA 1KHVA 2FJDB 2LDYA 2HRUA 2W4DA 1F3FA 4JI3J 1IBCB 4NLOA 2POKA 3D2EB 3I0SB 3MMCA 4QYZK 1VQLN 3BH6B 3N9UC 2B9WA 2VFRA 5D0EA 2VOOA 3D1OA 4Y00A 4B3SF 4A5BA 1QVGM 2XB2D 4FOEA 1KC8T 1JJ4A 2JWNA 4JHDB 2RDDA 3D68A 1RWWB 1K8KB 4IRCA 2EKYA 3QFUA 3D6MB 1RDCA 3ZZRA 4K25A 4QIGA 1A7GE 3M6UA 4I6MB 2WTUA 2FXUA 2Z1JA 1J6ZA 2RHSB 5CABA 4H5TA 3V5RA 4CO2A 3O6QA 3LP3A 1HD0A 2RNEA 3NLCA 2C2NA 3CJAA 2QEXS 4CGIA 2CADA 1N36J 2O8BB 4JS4A 2VJUA 1XTZA 3SJJA 2G8FA 2WVEA 3CMQA 3RB0A 1WSGA 3RVCA 2KVQE 4FYYB 3GV7B 4AILC 4OYBA 2LP4A 4J9QA 4OHWA 1NM1A 5KFFA 3NVMA 2J0XA 4DTNA 2M3DA 2OTJN 3BP8A 4YN3B 2IGIA 5EX3A 5DG8A 1S1VB 3DNCA 1RT1B 1SIWB 2BVZA 4NZ0A 3DI6A 3PFEA 1UVJA 1J27A 5LL6d 4LVNP 3HXMA 2VICA 1GMWD 1VHIA 1X5OA 3GE1A 4WYBA 3F2KA 2HVIA 3Q83A 4DSJA 4AH9A 3UD3P 1PC5A 4FS2A 1TUYA 3I4HX 3OW2R 4AXIA 2D5RA 3MI7X 2J0WA 1UVKA 3VQAA 2UV8G 2IPOB 1X4AA 4PL7A 5AQWA 4DX6A 2HHUA 1KVJA 1N48A 4F2RA 4IFEA 2KQ2A 2WRMA 3MPDA 2A1BA 4ZIVA 5IM0B 2QA4N 4DL4A 1S12A 2HFVA 2A6OA 3SQGB 3BGFA 2HQDA 1HQUA 1VHFA 1WF0A 4AT1B 2R2UA 2K2PA 1H74A 1KS2A 4Q44A 2XYPB 2K7KA 1NNEA 3OFEA 1ATNA 3G8QA 1G99A 4C2MA 4ICLB 1R8BA 4DCPB 1QM9A 3MM9B 2I38A 4BR2A 3FSXA 2ZJQL 2V7YA 3DOMA 1UPMB 1RAGB 3CEDA 5GAHI 1B0PA 4KH5A 5LMNK 1RWNB 5KFYA 3R8EA 2CNOB 1T6DA 4ILHA 5LJ3Y 4CF1A 4AD6A 4BQLA 5T7LB 2FF6A 1N33K 1T8EA 1F1BB 3FKBA 3RMDA 3G4SS 4Q0BA 4RL1A 1Q79A 3MN5A 4ES2A 2FHJA 1EIYB 4XDDA 3Q22A 4OI3A 4E19A 3A3NB 5SWMA 1WOQA 1I94K 5HROB 4NRTA 4B3RJ 4YDXA 4AHVA 3HT3A 2HBYB 1S1TA 3TZXA 3GIRA 1H7WA 3IRXB 2UUCF 3SMSA 3QFWA 1TK5A 5KFTA 2CQGA 1Y00A 2AJ1A 1VSEA 5EWFA 3JAMU 3GL1A 3D7SB 4FO0A 5E3QA 5AQTA 2GFFA 2NZ4A 1GTHA 4K50A 5M1KA 1NLKL 4B9LA 2HBLA 2HVHA 4CO0A 5AQVA 1BU6O 1LWFB 1HYZA 3Q8VA 1TMJA 2O8FA 5FPDA 5B0GA 2XSJA 5CZVA 4ECXA 4DU3A 2N7YA 2V67A 2VD3A 2W9CA 2IA0A 2W9BB 3AB2B 5DM7Q 3MTKA 4P2XA 2YNHA 3FEXB 3EGWB 3GFYA 2EKNA 3UB5A 2CPJA 4FBTA 1JCEA 3ZSVA 1TV6B 1HA1A 5KFZA 3TQ1A 4DR1F 3QGGA 2DGVA 4JI2F 3RU0A 4QPTA 4JS5A 1Z05A 3PM9A 3OYJA 4C8LA 3NGIA 1FNOA 3H4BA 5AXNA 3BZQA 4DSIA 2WSFC 1Q95G 4U7UK 2GIRA 4WFBQ 3TA2A 4OKKA 3KLFA 4OV6A 4FK0A 3I56N 1GTEA 3SPZA 2V9WA 1E3MA 3BSNA 1BE4A 1WDDA 4I67A 4DL0C 1RWKB 4A8OA 2BE2B 2O1PA 2YKQA 4B9VA 2CUYA 4IOAL 3W2WB 2CIMA 3ZX2A 1VQ9S 1OH7A 2WK4A 3MN7A 4B1YB 1Q5VA 3VF2A 4QAGA 5CCMA 1N52B 4BRKA 2VKZG 5M1NA 3MMBA 5AQRA 4BVPA 1M5VC 3T19A 3D28A 4G9ZA 4C8NA 3VGSA 3BKTA 2ZC3A 9ATCB 3NXZA 2D69A 4HH1A 2BGGA 2DXFA 3O9RA 1R31A 2E66A 4I7FA 2KLAA 2EWHA 1V9OA 4CF0A 1ZBLA 3PDNA 4XH5A 2EWSA 2MQOA 4OYIA 1AUSL 1H2UX 4CHPA 3AODA 2P9KB 4NLTA 1AROP 3WT0A 2LXIA 2W2PP 3WNFA 2D3UA 2E6LA 2DTJA 4MYTA 2VV5A 3VGVA 3F5TA 1S1XA 3C95A 2GHPA 4DR2K 2MZSA 2X7IA 4LBIA 5ETKA 1LKZA 4ETXA 3LWMA 1HPMA 4JI6K 4M41A 1TYQA 4DU7A 1WEXA 4RU9A 1JXLA 3GG4A 1NK8A 2F7VA 4KAIA 1BQMB 1F21A 1T44A 1QTMA 1DQ8A 1FTCA 1FKAF 4LSLA 5B0AA 2B8QA 3Q8PB 1BCMA 1NBEB 2GQQA 2MTLA 4QJVA 5H1SV 2NSCA 3KK2A 3QMLA 2XY8A 1W2BR 2W40A 2VC1A 1E6VA 2FBXA 4W5NA 3AOCA 4DKWA 2PIIA 3SQ1A 1RT4B 2FJXA 2O8EB 3DXSX 3RRGA 4EZ9A 4EO6A 4I6AA 4LF5F 1FCAA 4GVEA 5AE2A 4KE5A 3CUNA 4BRPA 4RUHA 4EI2A 1TELA 1Q7YO 1IBKK 3OYCA 2ZOFA 2E5LF 1B99A 3RG6A 4NA1A 2PYLA 4U7CA 3GR1A 4LFAJ 1KFSA 1CQMA 3TJ9A 2XWYA 3MM5B 2J6TA 1VQYA 1SV5B 3PJ9A 2AYMA 2Y3YA 5I42B 1WC1A 4I6YA 5AQGA 4FKYA 7FD1A 3K59A 4DXLA 3G71S 1KWMA 1FKOB 4H0XB 2HHWA 4CH7A 2HHSA 1M1KT 1HMVB 4ECTA 4OZ3A 3IGVA 4FWPA 4DTOA 1EO1A 1NH7A 5FLXO 3GPAA 5C0YA 4K8RA 1RADB 5BYQA 4FWKA 3D2FB 1GLAG 1YJWN 1IBMJ 3MECB 1RILA 4FWLA 4GKKK 3L7PA 2P1JA 2W6LA 2HBJA 3VHQA 5HVFA 3VA3A 4OZJA 3QT7A 4A5AA 4J9UE 5G0RA 4FM1A 1Q7LB 1Q1KA 2DYAA 2R7RA 1D4XA 2D3OR 2XLKA 1F60B 4BE1A 3ID8A 1JJ2M 2ILZA 2AYEA 2IVYA 3I31A 2VODA 5BR9A 4ES1A 2OEMA 3R9LA 1SUQB 3NGYA 1C0UB 3H3NO 2C3YA 2ZH1A 4IH7A 3P49B 3KNGA 2OSRA 3QLHB 2C2KB 5JMNA 5IOLA 5D0RA 4OLBA 1NK9A 4UZCA 4FF2A 2FY1A 4OFZA 2KFYA 4RCHA 4JKCA 3M1VA 5E3PA 1S1WA 1W26A 5F9LA 3A1YG 2HMIB 2GX8A 3T5KA 2ADBA 2L9NA 2V0NA 3MM6B 3EZUA 4OX9K 2XWXA 2YHXA 4ZP6A 3ILJA 4R25A 3ZSYA 3V2UC 4DSLA 1JLGA 4CJPA 5JMVA 1T05B 3AJ2A 2O8DB 4FVCA 3BGOP 4X64J 2KRRA 2I0XA 2KHOA 4N7TA 4NASA 5ETMA 4LF8K 2NRZA 1B64A 2R2RA 2WB1D 5ELZA 4DV3J 5F0XA 2XHCA 1RTHB 3H59A 5KFQA 1X8DA 4FXVA 2BANB 2D0CA 2ZF5O 1YIJN 4ZOSA 3C6UB 4CLZA 3IBCB 2ZHBA 3N5BA 4CTAA 3P1GA 1VSJA 4A8WA 4LIWA 2H3GX 4MYUA 2CDQA 4EBDA 1URRA 5AXKA 2P9PB 4KB1A 4CZEA 5J2PB 1ZM2A 4JKBA 3TPQA 3ET6B 3F9KA 4OPAA 1C2PA 4BGAA 5B09A 2FDNA 3CPWM 4M5GA 4JI0F 5CAAA 4LF7K 2H5IB 1HI8A 1GLEG 3I87A 3BZCA 2E5GA 2PGCA 3LP2A 2OMLA 2YKMA 3I33A 1EKEA 4P10A 2JNJA 4E0DA 1TL1B 3T1YJ 4K4SA 3AD8C 2X1GA 4CO3A 5CZ1A 3BB5A 1WI8A 2DGOA 3M6WA 1WBBA 1K0VA 3DCAA 1MNEA 4B08A 3MMVA 3EY1A 3I0RA 2ROGA 3DYAB 3C0BA 2BW7A 1IKXB 3DRRA 4XPCA 3ONQA 4S0MA 2RJZA 3M8QA 4FJ8A 4OYWA 2DVIA 4JV0A 2DFFA 2ATQA 1D8YA 2X1BA 3KJVA 3V81A 5HQLA 2LFVA 2X6SA 3KJQB 4M8LA 3W5XA 1RGIA 1YT3A 2P9LB 2PN6A 4O3RA 4JI1F 2BMBA 3ZZUA 2M5YA 3M30A 2UXBJ 4JK8A 2V8HA 3PR5B 3K5PA 4H8KA 4I2QB 2FHOB 2YX1A 2HWIA 1Q81T 2HQGA 1FKPB 5EWGA 3DDNA 2RRNA 1HNIA 5C7PA 3MXHP 4USKA 1BQXA 1HNWK 2UXCF 2HZVA 4FYVB 1CZBA 3L2UA 4FLTA 1RAIB 3KK3A 4M3TA 3PKMA 1TUGB 1F5CA 1HBUA 1FNXH 4M63A 4DTRA 3QQCD 1QD1A 4JRPA 5AXLA 4LF1A 1AB8A 2KHDA 4DUZJ 3AY0A 4F50A 2ZJPQ 4IFYA 3CDAA 3TAMB 2HFOA 4TVAB 3D3BJ 2AJQA 2BABA 4Y34A 1S1UB 3LPTA 4F3TA 1GLJO 1U6ZA 4FWOA 4FM2A 2XMMA 2CQDA 1RT5B 2KZZA 4A8FA 5E3AA 2ITMA 2E8AA 2QYCA 2DGQA 1PYOB 4J90A 3DLKA 2AHOB 3ZZTA 3MK6A 4BG9A 3VN5A 5DM7L 4QIFA 2J9CA 3NGZA 3FEYB 4CM0A 1FXXA 1JLCA 4DV2F 4MO4A 4LUBA 4E7JA 3MCNA 2XM3A 1HQEB 1RBOB 1HBNA 3UD4P 4TU8A 2AA4A 4CM2A 3IMQJ 3S1TA 5BRDA 1FJGJ 1FW6A 2HLUA 2BM1A 3DKDA 1YLXA 5KT6A 1W0HA 5HMXA 1UTAA 3N6MA 5AQJA 1UJ5A 1BC6A 2K06A 1ZM9A 3ZSXA 4BG8A 4M5DA 1JB0C 1NGIA 1A6LA 2QWOA 4M5IA 3FMBA 2LKZA 4WFBL 3B6BA 3EO3A 2AT1B 4FXDA 3P96A 4IRKA 4DV0J 5DG7A 1EP4B 2DIUA 3JTOA 2J8SA 4YB1P 5DJBA 3OXGA 2IM0A 4Y2CA 2AP1A 1VSKA 5IWAJ 2IRXA 5L39A 4PWDA 4DF8A 3IG1B 3EE9A 1IJJA 2YHWA 3DLRA 3BKUA 1R59O 1F9HA 4HVZA 5B08A 2IYGA 5D0HA 3WEEA 3L09A 4K8ZA 1VQNS 1BQNA 4MFBB 5J1EB 5D8HB 2JSXA 1YVUA 2CG4A 3H98A 3OJSA 4M5LA 1UCNA 1U25A 4FF4A 1RA6A 4F4WA 4KT0C 1RHKB 4CGHA 4F4AA 4UOFA 3K58A 3F56A 2C2DA 5E84A 2NUUG 2ZH7A 3CJ4A 2D4WA 3R1HA 3GTYX 2C3OA 2LXUA 1RBRA 1CEZA 4K43A 2A5XA 2XS5A 3NGRA 1WEYA 4DZDA 3PW7A 4EWTA 1CZ9A 1EX8A 4EMDA 2DNQA 3MAHA 3SJHA 3NAHA 4MIAA 3OYKA 4ZN1A 2VFSA 3LP0B 1HYSA 4ILMA 4NLBA 1V5IB 2ZBIA 2H51B 4ED2A 1WF1A 1YJ9N 1ATRA 4OHXA 3A13A 4YB7A 3VR1A 4DFMA 1D5AA 1JIHA 1R6YA 3NG8A 4DN9A 4K8XA 1RBLA 5JJBA 2HK3A 5KG2A 4RX6A 5GAHU 4Q8FA 4DR5F 1XMQK 1XMOF 2H54B 4WYLA 1WJ9A 3EGZA 1KVKA 1WOPA 3MD3A 1DURA 3Q8QB 2GO9A 4DJBA 4KGVB 1P9YA 3MUVP 4NLUA 1ULRA 3T69A 4H54A 4NL5A 3ZTQA 2LECA 4USJC 4BRFA 3M6XA 2OI2A 2HHQA 3M5RA 3DU6A 4JI5F 2UU9K 3EM1A 2K1RB 3HLUA 4W92B 1XNRJ 4C8YA 3QBXA 3CD6N 4C0BA 2OTLN 3BGLA 2R8JA 3OR2B 4HI2A 4ECZA 5C2FA 1FRJA 4GV3A 3MR7A 4E7IA 5HO4A 3I8DA 3L2WA 1WSVA 5BPNA 1M1HA 2KI2A 4M3UA 4NLQA 3QJLA 4J91A 2DPIA 4BRCA 1C0MA 4G6VB 2ZHAA 4LFBK 2FC9A 3LDOA 4CF9A 5L1JA 4E1MA 3TR5A 3SSSA 3M2UA 3QSIA 3D6HB 5E5NA 4CJ7A 4BRDA 3CJBA 2XTJP 4DN0A 4HCBA 4GV6A 3THXA 3OYNA 1ASWA 4LF4F 2UUBK 3TR8A 3HSCA 1HX1A 3N01A 4ZVEA 3GYGA 3ZEUA 3UIQA 3H6EA 1LFWA 2KKHA 3QIPA 4OGEA 3ISND 3QSYB 3T9ZA 3V1OA 2O4IA 5EU7A 3UN3A 1K1SA 1KOOA 4Y1CA 4OKJA 4FWSA 3M05A 1K6YA 1IBLK 1VQ8S 4OJRA 1XMBA 3DOLA 2WC9A 3QNOA 2ZH8A 1OY9A 2DIVA 3P3DA 3PO4A 4YOEA 4OKEA 1HPZA 4LF6J 4NCGA 2UVWA 2ILYA 2CVIA 4NI2B 4DOZA 2NNWA 4B1VA 2GGPA 2M52A 2ZHOA 4PG8A 3ELHA 5AQFA 2HHVA 1SKSA 1ZBUA 2JH3A 4P73A 2QJ3A 1LAWA 1OQ3A 4H4KA 3MPUB 1LV5A 3CB4A 3BV8A 1RTZA 1RT7A 2YY3A 1HHQA 2X1FA 4DV5K 2KDOA 5D78A 4JI3F 4HHJA 4D3GA 4QYZJ 4H0TB 2VJVA 2G0JA 3TOQA 3PTWA 1LWCB 3OHRA 4U9RA 2FPHX 1RT6B 5GAEI 5HMZA 4JN4A 3VV2B 3KHLA 4JYAK 2FJEB 3DM2B 3OXLA 1NB2A 3CE8A 2I7PA 4CT8A 5FLXU 1RWOB 4RW8A 4NZ7A 1YBUA 2QKKA 4ZVSB 1HKCA 5F8HA 1PO6A 1BY9A 1VI7A 2QV6A 4WK1A 1U1RA 2Q66A 3DXMB 4Z4IA 1YJVA 1RT2A 3PW4A 3GLJA 3CCJS 4CEAA 2ZH9A 3W3SA 1B70B 2CFXA 5IT9O 4DCJB 3T1HK 2GWKA 2G13A 1AZSB 5KG5A 2KYZA 1LOTB 3TTFA 3WQUA 3HVTA 3R7BB 4HHTA 2P9EA 3M8PA 4RWWA 1U2RA 3WX4A 4B9TA 4ZVFA 1NJXA 5E7OB 3GQCA 1WTFA 2FY8A 3EGVA 4NXMF 5GADI 4EZ6A 1WD6A 4FPIA 3AV9A 2EI5A 1I3AA 4ENOA 2Q43A 3KG1A 1F9FA 2CZVC 3P5TL 3PX0A 1L3SA 3AARA 2BKPA 2FSJA 1GAOA 2MZRA 4YOTA 3SAFA 4DCOB 2XLIA 3ITHB 1JLAA 3ULHA 2MHEA 2YTCA 2LA6A 5M2UA 2J7KA 4ZCMA 4K0KK 1SH3A 3ZYYX 5HQMA 4JK7A 1KAXA 4DCHA 1YRUA 5M1QA 1NOZA 4DLGA 1UW4A 1RBSA 4QR2A 2P5OA 4JV2A 2IVNA 4G1QB 5CYJA 1FXRA 3KUEA 2FBYA 4FJNA 2F8SA 1NK4A 4DTUA 4DV1J 2Z2ZA 2ZC4A 4C6AA 1SQEA 3CNQP 3D0IE 2YWHA 2QMUB 3JSRA 5FRNA 4CK1A 3B8HA 1ASUA 1BIUA 3OBYA 2BW2A 1T7PA 2D0BA 4WE1B 1TL3B 2YH0A 1KONA 5BRFA 3P38A 4E1JA 1GQEA 2F1FA 3Q23A 3S01A 2ZJPL 1JLQB 3KLIA 3LH2S 3KDOA 2B8PA 3CVKA 2D3O1 1M90O 2ZOMA 4CQ1A 1QDUB 4ZITA 2MGZB 3OBWA 2MZ1A 2HFZA 3M4XA 1VQON 2W2QP 1VMBA 4JI4J 5JS2A 2O01C 3WNGA 1VFJA 4YHHJ 1R7IA 4M3RA 2BBEA 5K14B 3POTA 2VFUA 2DNYA 1NGHA 2FLLA 1HNXF 3BYPA 1VRTB 4BWMA 1RE1B 1NU4A 2PD1A 3L4QA 2BTFA 3JQJA 5LMNJ 1V3RA 1ROFA 1UFKA 3OR2A 4NB4A 2VGNA 3T5JA 5SUHA 4ZPAA 2VONA 2AEMA 2Z2LA 4DEZA 3D1QA 2O66A 5DQHA 3EEQA 1YVFA 1S59A 1N33J 1UP1A 1HLUA 3MN9A 3VAFA 5A8RB 1BUPA 4FW2A 1WG1A 1YF5L 4N47A 4CO5A 4B1XB 3B8AX 5F8MA 2CJQA 1I94J 1SKWA 1B92A 1DGKN 2GNKA 3PRVA 2V5HG 4LBPA 1IG8A 2ZDOA 1ZA2B 4BC5A 2GV9A 1F2GA 4DR6J 3MXMA 2CJAA 1F0XA 2R7QA 4HCCA 2OPPB 2QA1A 4CERA 3H90A 4X62J 5AQSA 5LMUK 1Q4RA 4CLTA 4FZYA 5LSOA 4ELUA 4MMOA 5AE1A 3HZEA 1WNSA 4EYHB 5C42A 1VJQA 3VETA 4R0JA 1FX2A 3D66A 1CLQA 2HMPA 2RHKA 4WQ5C 3LGNA 3EE3A 3EXCX 2E1RA 3T6BA 1R0AB 2DT9A 3O08A 5MLCQ 1S5ZA 4P9SA 1HJRA 4V19J 3M2VA 1GLDG 1CS4B 3CTRA 2G8HA 2JLFA 3P8BB 2WOMB 2KFZA 1GMVA 2MMYA 2QT7A 3LGMA 1IKYA 1BI4B 2NUHA 1BISA 1RAOA 2B4UA 2I8EA 2APOA 2AKWB 3GONA 2R7WA 4B3SK 1LCUA 3FVYA 4Z7YA 1VSFA 3NNCA 1S9EA 1MWYA 1KQSR 2FZGB 4R8UB 3AAWB 2BUNA 3AT1B 4FXWA 2DB1A 3Q86A 1CJKA 3E01B 1S57A 1QHTA 1YRTA 4ID5B 3VQEA 4AHSA 1MROB 5L8RC 4DS5A 2HBZB 3IAS9 3H4DA 1SC4B 2J76E 3TAEA 1PILA 1UVNA 2DNKA 3VGKA 2GHWA 2KVIA 1RKJA 1X9SA 3M1FA 3P4IA 4QZVB 3K5OA 4IG3B 3GJQB 1CPZA 3ILOA 2VG6A 4DR4J 3TEHB 4WKRA 2D7SA 2E7VA 1ZC6A 4CZMA 2ZUAA 3QAUA 3EUNA 5ETVA 1URNA 2D0PA 2V69A 2QA2A 5EHHA 4WF9Q 3CJ9A 2W7OA 2W41A 3P39A 1NO8A 3ZX0A 1QZ5A 3V1RA 1VSMA 4NXNK 3QGIA 5KQDA 2HWHA 5CHCB 1RCHA 4RG8A 4CJ4A 2CPDA 2QXFA 3KHGA 2KT3A 4EBCA 3HX9A 1FDNA 1D3WA 4ECYA 1L3VA 5I3PA 1DFDA 4LD0A 2OJ3A 2IRYA 5KFDA 2JRSA 5ETTA 1OH5A 3CD5A 4DR2J 2KTQA 1MSWD 4OYZA 2P6SA 3TABA 4NLCA 5BR8J 4RW6B 4CHOA 4CECA 2DHAA 2DCUB 2P6TA 5AQQA 4FL9A 5KT4A 3J7Z5 1FD2A 4H4OB 4O55A 3I5CA 3MN6A 3T7ZA 5C24B 4DBQA 3QEWA 2MKKA 3IAM9 1RK8A 1RDDA 3OS0A 3VGMA 1UOCA 4YOUA 1AT1B 2QE5A 3BGUA 3PIPQ 2D1KA 1H38A 3S41A 4CI6A 4N76A 4I1TA 4PUOB 1BG3A 4JKEA 4LRDA 1JLEA 3MEEA 3KWGA 4RU2A 1NJWA 1PJ6A 4ED0A 2HOEA 3O5TB 2DGWA 1Y97A 3PIOL 3A5OC 4ZK7M 1OVQA 1HWLA 4PPZA 4EIAA 4WU2A 2YX6A 3OVNA 4KTWA 1CULB 2MZTA 5A8WA 4B9MA 2I2YA 5F3ZA 5ETOA 1L3UA 4ANDA 1B7FA 3KG0A 2RDIA 3BQ2A 1KOHA 3U4LA 3EZOA 4DTMA 4LFAF 4TKTA 2FYXA 1U2FA 4KHWA 3UKRA 1NU0A 2VASA 3IWXA 2J8AA 9RUBA 4KFBB 4I9LA 3HI0A 3QEIA 1MWMA 4HTUA 1HKBA 2E29A 3OYEA 5C25B 2XG8A 4PXBA 1Q86T 1GXTA 1IKWB 2PYJA 2V4JA 3M9MB 2UUCK 4JI6F 2E5JA 4GKKJ 4MDAA 3HFVA 2G9OA 3UDCA 1YDLA 5M1PA 3NMRA 2JZ5A 4DG1A 2D1CA 1YHQN 3DJCA 4ED1A 1P8GA 6AT1B 4O4GB 3ZT0A 5A2QY 1G3OA 3EJMA 4KGKA 4QIVA 4GC6A 3O9SA 5AQZA 5GIPA 3LF0A 3EVMA 4MO5A 4MK8A 1VBKA 4USUA 2VG7A 2Q1NA 4EP4A 2D41A 2GEMA 3UKUB 4CESA 4NEZA 2YWWA 2E4LA 1S79A 3E2EA 2QKBA 4ZPBA 1EWQA 5LSLA 1GLCG 5KGWA 1VLYA 4DR1K 3WX8A 4JI2K 3MPVA 1TKZB 2CPFA 1DBDA 4ED5A 5AJ3F 3K2YA 2R9LA 1L3TA 3EXYA 4URGA 5A2QO 1HHSA 1Y4ZB 1C1BB 2SXLA 5FD1A 2ZBCA 1DRZA 2B9EA 4F0MA 3J7A1 1S4EA 3C15A 4LY7A 3BSCA 4CFAA 4LF8J 3PZPA 1SJ3P 5EDWA 1G15A 3G86A 2K3KA 3G6YA 1DEJA 2IAJB 2OSQA 2ABYA 2RSQA 2CKWA 3GJRB 2DPJA 5DQGA 1X0PA 2V7ZA 3P83D 1L3KA 4X84A 3CCSS 4DB3A 4IUFA 2Z0GA 1XERA 3PW5A 2MZQA 2DNRA 3FBCA 2Q0RA 2JEGA 3QGHA 1T95A 1YTUA 1H2VZ 2ACYA 4O3QA 1RTIA 1JLBA 5D15A 3AVNA 3JTNA 3IO1A 1AUDA 3SCKE 2LQ9A 3CQYA 1WWHA 5DDRC 2BJ9A 3OTOF 4QPXA 5J2QB 3TWZA 3VZIA 3H8YA 4Z4CA 2QWRA 2MKHA 3CJ7A 4LF7J 1HD1A 1VQPN 3VEZA 2PI5A 4UY85 3FZBA 1U8SA 2Q97A 1NJIO 1N34J 1GNKA 3THYA 2ZGZA 1KTVA 4FKXA 1QVGR 4HVJA 4AYBD 3K9KA 2FVCA 4PQUB 4ZP7A 4OX9F 3C6AA 4YNQA 5H9FK 2FZCB 1DTQA 3C14A 3W8GA 4F8RA 2YV0X 1OY8A 1QSLA 4OZ1A 5FDLB 3JB9k 2HGMA 3D2WA 3MR2A 1E6YA 3BF3A 4URSA 4GC7A 1IWAA 4EUVA 5IT9U 1Z4UA 4M5JA 3CDEA 1KXPA 5GAEP 3FNNA 2ZD1B 4LSNB 3ISZA 5LT5A 3MEGA 1V4SA 4PXEA 2J6SA 3MX2A 1U2CA 3X1LB 2R8KA 3JSMB 2ATCB 5H9EK 2W42A 3AVAA 4H5VA 3AFGA 1CBKA 3NFAA 5CHIA 1FX4A 3SCJE 3A5LC 3OA9A 5F2RA 2HWTA 3IAYA 5KRTA 1HNZF 3ULDA 1UEUA 3H1QA 4LF5K 3MGJA 1UFLA 1SAZA 1W25A 1TKXB 1Y9OA 3NS6A 4BBYA 1Q5YA 4JKGB 1NGCA 2E5LK 3C16B 2YKNB 1FEHA 4CP5A 1NG9A 1QZ6A 5IC4B 2QWMA 2LSNA 4FWMA 2GO8A 2IVMA 4GRSA 1EKRA 2Z4PA 3ATUA 2GAGC 3BJYA 1B9FA 3U3GA 3SNNA 3HVRA 3D45A 4DUZF 2P9CA 1FDAA 5GADP 1FK9B 4UQGA 5DK5A 1N6QB 3LW5C 3TO8A 4OZ0A 2H48B 3THWA 1JLFB 2VL1A 3OLBA 1IM4A 4L3QA 2F9DA 2IFXA 4G3IA 2H1YA 4OV1A 5M1OA 1VRUA 5HL7Q 3JS6A 2ASLA 2GIQA 5I3UA 4P6QA 4PG6A 4E8UA 4YMEA 3MR5A 3DLLQ 3FZLA 4ANCA 3BY5A 4ECSA 3IUCA 3CCVS 1KKHA 1FXDA 2CNKB 3HF5A 1TVRA 1KVIA 3E3XA 5K5MA 5F8JA 1N8RO 3UWTA 1YG0A 2CQ0A 4YY3F 1DTTA 5DDPC 4AUKA 2C2MB 1IR2A 2MXYA 3I9ZA 3CJKB 4KRFA 4ZCKA 2HNDB 4EFHA 3TEGA 1WC0A 1TKTB 2BKOA 1Q9YA 4QYRA 4OI6A 4EHUA 4CLFA 4NYPA 2IC3B 1QY7A 8RUCA 5F9NA 3NF7A 3J7ZT 4DV0F 5L1KA 1HNWF 1N5VA 3EE8A 3UCGA 2F3JA 3HSTB 3DXKB 2O5DA 4Q7AA 1NEEA 4WTYA 1UWAA 3CO9A 2IIRA 5D0GA 4OQJA 1CJUA 3TX8A 1VK3A 3G82B 3RBXA 3TNVA 2EK1A 1RDUA 4O8KA 2KG0A 4WF9L 1UA1A 5KFGA 4ZVQB 2J0QD 3BDPA 2RF2A 4OZLA 3VVTA 3HFZB 3J80O 4O0JA 4KR0B 4DX5A 3P31A 3R8YA 4CJ5A 3W2VA 5DM6L 4W5TA 2W4PA 2KU7A 2P9SB 3ZT2A 1VQ6S 1OO0B 3R6MA 3OYIA 3HSZA 2XY6A 4CHZA 4HH0A 1PYSB 3I6PA 4W5RA 2GTDA 3KLGB 2GQCA 3CIMA 1N32J 2WTFA 5EOYA 3CCUS 4BY9C 2P2CB 4DL2A 3H40A 3H1VX 4IO8A 3GE9A 4BR9A 2L9DA 2HVZA 5HJYA 4N5SA 2JEFA 5ETLA 3DLEA 1EWRA 3G96A 2LU1A 5JVGQ 2QFJA 3KK7A 2HNYB 3FZMA 4KHUA 4CLPA 4NYOA 4KKOB 3HHLA 4X4UA 1JL2A 4CJKA 2W4CA 2HNZA 4ED3A 4DFJA 2L08A 2NLXA 4FK2A 4C8ZA 1XC9A 3PIPL 4PWWA 3A8IA 3GJTB 1BOTO 1CG2A 3F73A 2FJVA 3THTA 2Y1JA 1FE4A 1MG7A 3KUHA 5M2PA 3GG1A 5HLFA 1S77D 4RNOA 4CJRA 3QBCA 2D0OA 3DLGB 1M90T 1HKGA 5FROA 1Q82O 3RWUA 3CXCM 1DAXA 2A0FB 5AFUH 2UXDF 3IR5B 1FHTA 4RWXA 1XQSC 4AHRA 2NSBA 4KGZB 1HBOA 2DITA 3R5JB 1HR0J 3QO9A 3BBFA 3UR0A 2UU9J 1FDDA 3GIMA 4K4ZA 2XULA 4QU7A 3OUYB 1BWEA 5HP1A 4OI1A 1EXQA 3R1XA 4ZVRB 3SK3A 2KM8C 3HKWA 2DNLA 1XNRF 3V6HA 1S6PB 2DNGA 3D0HE 4JI1K 3ULEB 3V4MA 3TTCA 2DFEA 4W98A 3BBCA 3SSQA 4KH4A 3OT9A 4WFXA 3WC0A 1WORA 4BRLA 3PO5A 2YNIA 4OZ2A 3HPHA 4LFBJ 2UXCK 5GAGP 3QJJA 4F4ZA 4FLVA 4Z4EA 1U1OA 3GFHA 4ZPCA 3CERA 3FQKA 3DU5A 2BE9B 4AM7A 2E7WA 5CD4A 2LMIA 1SH2A 3MAAA 4ECRA 3K2PA 4QS7A 1LW2A 1VIOA 1XR5A 2Z1HA 3RB4A 1XMQF 4DQRA