1HQUA

Human immunodeficiency virus type 1
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Lys103Asn mutation of HIV-1 RT: a novel mechanism of drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords POL POLYPROTEIN
total genus 125
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hquA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hquA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hquA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hquA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hquA05
5KFTA 3IS9A 1N4LA 1IG9A 5I3UA 3CG7A 4W5OA 1C1BA 4FBTA 4FW2A 5CYMB 1RT3A 1RTIB 3RB0A 4YR0A 3NH0A 3JYTB 1TL1A 3DLHA 1C2PA 3OL9A 4JS4A 1XR7A 2W8KA 1QAJA 3TWHA 2D0BA 3PW4A 1YTUA 3TAQA 2YNGA 1T94A 5L1KA 1TK8A 5KG3A 4ED8A 4M3TA 3MEDA 3KJVB 1NHUA 1NKBA 4NCAA 1N48A 4Q5VA 4O3SA 2ZD1B 4KTZA 4KKOA 3ZSWA 5KI6A 2XRIA 3QIOA 1HQEB 1REVA 1J53A 3VQQA 3DYAB 4KFBA 1CSJA 1HNVA 1XHZA 3NMAA 3S3MA 3BREA 3OLBA 4CJ5A 2ITGA 1RTDA 3H4BA 1RT5A 4WFZA 4ID5B 5FRMA 4CFAA 4TY9A 3OSPA 3MFHA 4Y2CA 1VSMA 1X9MA 1DLOB 1CXQA 1EETA 4LH5A 1J54A 3DYAA 4IFVA 1IKYB 2DFEA 2J6TA 3M8PB 1RT3B 2JEJA 1RDCA 4KHNA 4TSXA 2VA3A 4CJ3A 5KFUA 4OLBA 1G15A 1EXQA 5HRPA 2VWJA 4GC7A 4RNMA 3L2RA 3EPIA 1BQNA 4OGCA 1KRPA 2O4IA 4J9MA 1BCMA 4HKQA 1CLQA 2FLPA 1L3VA 4F3TA 4IH7A 4ECXA 2FVPA 3MEEB 5FROA 3VQ8A 1BI4B 5L9XA 1C6VA 1QE1B 3DM2B 4B9VA 4O4GA 3T5KA 1L5UA 2HHXA 3NGDA 4O55A 1TAQA 1JLBA 3WNEA 1TVRA 3BGRB 5I42A 2FBTA 2WRMA 3QO9B 4NLQA 5KG4A 5KG7A 3NF8A 4FLYA 4CJRA 2VA2A 4ECWA 4Y2AA 1TKDA 3OYMA 4DTRA 4RW4A 1JLGA 4ED1A 1RILA 2UVWA 3QEPA 1U04A 4O3PA 5T7BA 3HXMA 4QWCA 1L3UA 3ZT1A 1ASVA 4DQSA 4ID5A 4CJSA 5F8HA 1TV6A 3U3YA 3I0RB 1RT2A 3HM9A 3LZJA 4KB1A 5HROB 2FLLA 2G8WA 3PR5B 4CEOA 4M3XA 5HP1A 4KI4A 4CIFA 3WNFA 3KLVA 3WNHA 4J9LA 1VRUB 4ECUA 2YNHB 1KLNA 2G8VA 3LDSA 1QS4A 3NE6A 5EWFA 1XI1A 2OPSB 1SL1A 1FKOA 4KHWA 5F8JA 4JRQA 3AVBA 4H4OB 3ZSQA 4Q0BB 1S6PA 1RBSA 3G6VA 1TV6B 1B9DA 3NH2A 4FK4A 4NZ0A 3NGYA 4CIEA 1S1UA 1IKXA 3SNNA 4I2QA 3QINA 2UVRA 2BANA 4KV8A 2OYQA 4DL4A 3ZSRA 1S1WA 3MAQA 2XGPA 2D3ZA 2DPIA 4DSLA 4ID1A 4DL3A 2HNZA 5KFWA 4DG1A 3EY1A 3OL6A 4F4YA 4ZTFA 3IGNA 4FBUA 4CHZA 1SKRA 4N56A 1S97A 4OKJA 3DLEA 3AVAA 1VSHA 3BGRA 1HPZA 4ZTJA 3RBEA 4RNFA 2D3UA 4DSEA 1S9EA 2YKMA 4RG8A 4CGHA 2IJNA 3VQ6A 2G8IA 1IKXB 1KHVA 1VRTB 3MEDB 3SUOA 5F8GA 4AHTA 2YKNA 4DL6A 4AHCA 2JEIA 4WE1A 5KFQA 3RR7A 3OHBA 1JLEA 4FLXA 4EZ6A 4B3OA 1TL3A 3SI6A 4ZHRA 2HNZB 3NFAA 1C0MA 5KT6A 4NLPA 4B9MA 2XC9A 2AU0A 1UAXA 4EBCA 5F8LA 2IDOA 3SPYA 4CJWA 3IRXB 4DQQA 4RW8B 3DOKB 3UQSA 2WB4A 1FKOB 4LSNB 4MK8A 5KRTA 5JS2A 1RT4B 4ED0A 4B3OB 3CIZA 4CHOA 3KKSA 3S3NA 4EP5A 4BACA 4K4XA 1JLFB 3TAMB 1TL1B 1HYZA 5DQIA 2ZKUA 1TKTB 2IM2A 4JLHA 4CFCA 3GV7B 5C24A 3BSAA 2RKIA 4IRKA 3HP9A 5DG8A 2R8KA 2UUTA 3E01A 4H4OA 2IM0A 4C8MA 4FJHA 2IAJB 4KO0B 3CFOA 3PO4A 3CQ8A 3HHKA 3OYEA 3DRRB 3KLFA 4F4KA 4FJ8A 3FDSA 1A5XA 3IG1B 2AWZA 4GW6A 4CCHA 3CWJA 3KIOA 3ICLA 2YKNB 4R5PA 1RA7A 3K58A 4C8OA 2W7OA 3F73A 3QGHA 5HRNA 2X78A 3SUQA 4DL7A 3I0RA 1DTTA 4O3NA 3RMDA 4DL2A 2DTUA 2XY8A 5KG1A 2R8HA 4H8KA 2IM1A 1HMVA 1UWBA 1IH7A 2BDPA 4CF0A 4JS5A 2OPQB 3H59A 5KFVA 4WFXA 1VRUA 3P5JA 2C28A 3MECA 1HARA 3C6UB 2B43A 4NLYA 4CFBA 1C1BB 4ED2A 1X9WA 1LWEA 4H54A 4MIAA 3EYZA 5KRSA 1HJRA 4M3UA 5CY4A 1MMLA 1LW0B 2HWIA 3IGVA 3SZ2A 1EX4A 3OYBA 1IKYA 1SKSA 1SH0A 4FS2A 5CZ2A 3PV8A 4BWJA 3NAEA 3K5OA 2J6UA 4B9UA 1HMVB 4MK9A 3NCIA 1ZTWA 4B9SA 4F3OA 4CJEA 1ZYQA 4Q8FA 2DFHA 3AVMA 4IRCA 4F4WA 1IKVA 4DFMA 2E9TA 4CJVA 1KLMA 2Z1GA 1SH2A 5CZ1A 3OS2A 4OVLA 1RT4A 1X9SA 2C22A 4CJTA 4O44B 3M9NB 4URQU 3D0PA 4FCYA 1EETB 4DWIA 4CGIA 1REVB 4NLDA 3GYNA 3BSCA 2FVCA 3OL7A 4CJKA 3NAHA 4ZP8A 5I42B 3TAFA 4BE1A 4DTUA 3OVNA 1J5OB 1SL0A 3SQ4A 4DL5A 4N5SA 3DOLA 2PZSA 1VSDA 5J2MA 1WSHA 2OPSA 2OPPB 2I5JA 4IH5A 1U4BA 4NLWA 2VG6B 4O44A 2HNYB 2HW3A 3PJWA 3SUNA 3LP3A 3TABA 1BQMA 1RNHA 5EDWA 5K14A 1TP7A 1SH3A 3NF6A 4BDYA 4E7IA 4I2PB 2E9ZA 2BQ3A 3QIDA 3V9ZA 3KD5E 5KFZA 4K4UA 4MFBB 2YNFB 4J9SA 3KHGA 2X6SA 4C8KA 3O4QA 1TVRB 2G8HA 4CECA 4JUZA 2AGQA 1LAVA 4FJ7A 3HPGA 1CZ9A 3PVXA 1S6QB 1NJYA 4B9TA 4I7FA 1S48A 3SI8A 1S1XB 3OYCA 1VSKA 4M3RA 1JIHA 4CF2A 2AX1A 1Z25A 2BGGA 2HMIB 4J9NA 4TYAA 3NGZA 4FJ9A 3CDEA 2HHTA 2HHUA 4DTOA 3FFIA 3QEWA 4QWAA 4FLZA 4K4YA 4EBEA 3LP2A 4B8AB 3L2QA 5KG5A 4ECZA 4F2RA 1KFSA 3C95A 1D9DA 3L3UA 2DFFA 4MQ3A 1U48A 4E89A 4EO6A 3M8QB 2WTFA 4WXOA 2Q3SA 3K2PA 2BE2A 4KRFA 1L3SA 3EPGA 1KLMB 4RNNA 1NOZA 3K57A 1NK0A 3DLRA 4KHYA 1BISA 1C0UA 3AO3A 5E41A 3M9MB 3OYFA 3ISND 4OKKA 3THVA 1JL2A 2RDJA 5J2PA 4KE5A 2V4QA 4NLXA 4ZMMA 2ZQBA 4M41A 3MR5A 3IN5A 4QWDA 1Z26A 4ZPAA 4CERA 4DSKA 4ECRA 3G86A 3KLEB 2V9WA 1RTDB 5KFAA 1RTHB 4FW1A 1S9EB 3AVJA 4QPXA 5DG9A 4DU1A 4RNHA 3V4IA 2HHQA 4I2PA 1LWFA 3TR8A 3OS0A 1BIZA 2RPIA 3RB3A 2PYLA 2IOCA 1RT6B 4YMEA 4J9QA 3H5SA 3D5MA 2EX3A 3I0SA 4ZVGA 1RTHA 4AH9A 2WOMB 1TKZA 4EP4A 3RWUA 4KHSA 3UIQA 5JUMA 2E9RX 4O4RA 4WZMA 3C6TB 3RMAA 1FK9B 3AO2A 3VA0A 1GOCA 1WSFA 3MR6A 4PWDA 1XWLA 4J2BA 3PR4A 3Q8SB 3VQ9A 3KMSA 3SPZA 4ZHRB 4CGFA 5HP1B 5F9LA 4ECTA 3DMJA 1B92A 5KT2A 4DLEA 4I9QA 1VSJA 3ZSZA 1JLCA 4ECSA 3RB6A 3MFIA 1UA0A 5JS1A 3V9XA 3HKWA 3AVCA 4DMNA 2IJFA 2JEGA 1HNVB 2Z1IA 1K1SA 4M94A 3MR3A 5L1LA 3OYJA 3KOAA 4G1QA 3JSMA 3CJ3A 1WNEA 3UR0A 4KHUA 4NCBA 1RYSA 5FRNA 1RT5B 2YNFA 5KFGA 4DTSA 4CHYA 4OLAA 2HNDA 1JLQB 4O4GB 4TY8A 4E1MA 1MU2A 4KAIA 4EBDA 2AX0A 2OPRB 3SQ2A 4MFBA 2XY6A 3CJ5A 2QXFA 4ZP6A 3EZUA 1S1XA 4FJIA 3OJUA 3LP1A 1TKXA 1RT1B 2B5JB 3DLKA 4CEBA 4LSNA 2UVUA 3V9UA 2YHBA 1KVBA 4E1NA 2G8UA 4CHQA 3CM5A 1GX5A 3L2WA 5EWEA 4DFKA 3E51A 2D0AA 4IBNA 4NRUA 1RT7A 3OYLA 1Q9YA 4Y1CA 2VG5A 3N6LA 4QOZB 1VSIA 1CZBA 3AO1A 1J5OA 4ECVA 1C1CA 3V81A 5HLFA 3VQPA 5J1EA 2HAIA 4ED6A 4WXWA 5J2PB 1QAIA 4PQUB 5KFJA 2XCAA 3RMBA 5KFNA 4CGGA 1JLBB 5FDLB 2VG6A 4DQRA 4F2SA 3QETA 2O5DA 1Q8IA 2KW4A 4Y3CA 2E6MA 3DLKB 1LW2B 1SL2A 3MXJA 1VSLA 4KREA 1WSEA 4RUCA 4IRDA 5C42B 4J9KA 5DQHA 1TKTA 4HTUA 5C5JA 3OJSA 1LWCA 1R0AB 5KG2A 1ZTTA 2R2RA 1JLEB 4J2AA 5HBMB 3QNOA 2WK4A 2XWYA 1BL3A 3TARA 4TYBA 3E01B 2KFNA 2XGQA 3ZSYA 1RTJA 4CHNA 4FZZA 3HT3A 2W7PA 4Z4GA 3G6XA 4NLUA 4DF4A 3I0SB 2YKMB 3H5XA 3KJVA 1RTJB 1NK8A 2WONB 1IKVB 3HPOA 3LALA 2BE2B 3DDKA 4DSFA 3SCXA 1RT1A 2B5JA 1X1PA 1J9AA 3FRZA 1WAFA 4QW8A 2LSNA 4RW6B 2Y1JA 4E7HA 1TGOA 1NK5A 4NLOA 1SV5A 2OPRA 4B08A 3RTVA 4DFPA 3L3VA 1FKPB 1F21A 3PZPA 1D8YA 5EUHA 1NK9A 4CF1A 4FS1A 3NHGA 4J9RA 3CM6A 3LP0B 3GV8B 4K4SA 3IG1A 5JXSA 3TAEA 3QGIA 4E7KA 1T8EA 1VRTA 3K5MA 3UDLA 1ASUA 3AV9A 5DLGA 3D45A 3AVFA 5F8NA 3LPTA 3DLEB 3OY9A 5FDLA 4QW9A 3QYYA 4EYIB 4UQGA 3GIJA 4N47A 2P51A 4CJLA 4PQUA 2IA6A 4RW4B 4PUOA 3KKRA 2OA8A 4IKAA 2YNHA 3DRRA 4AILC 2RF2A 2I5JB 3LWMA 2IBKA 2QV6A 3KLGA 5HROA 4CJFA 4Z4IA 3FFIB 1YVUA 3DM2A 4CJ4A 5K14B 3RBDA 4KBIA 3KHLA 1O1WA 1N5YA 4IH6A 3ZT0A 4RW6A 3SFUA 5HLFB 2KQ2A 4OGEA 4J2EA 3JYTA 2FJXA 5C25B 4Y1DA 2X74A 3OYKA 3TANA 4TXSA 1Z4UA 2YHAA 3V1QA 2FC0A 4CESA 3QERA 3QZ8A 1LWEB 5KT3A 2VG7B 4X2BA 3D28A 5KFLA 4LD0A 2A1RA 2ETJA 3AVKA 2B6AA 3ISNC 4DTJA 1I6JA 3MEGA 4WZQA 4ZP7A 2FBVA 1RBVA 4HHTA 4IOBA 4CEQA 1HYSB 4AHUA 4DEZA 4DU3A 5DK5A 4M3ZA 3DOLB 1VSEA 2WOMA 1QUVA 2PY5A 2OZMA 4MH8A 1HYSA 1QQCA 3DLGA 4IKFA 3F9KA 3RRHA 4YR3A 2W9AA 3S9HA 2CKWA 4BE2A 1LWCB 2ASLA 5EU7A 4PWDB 4F4ZA 4O3OA 4OJRA 5D3GA 3SFGA 4E19A 4EZ9A 4KAZA 3V6HA 3V1OA 4DG1B 4BWMA 4KKOB 4OPKA 3VA3A 4ELTA 2BQUA 4M3YA 5DGAA 1N6QA 3LZIA 4IFYB 3ZSVA 4GC6A 1JX4A 2HVHA 2RKIB 4NLRA 4YP3A 1N6QB 5KT4A 4KB0A 3BQ1A 4FJ5A 2D7SA 3PO5A 3LAKA 2ILYA 5KFRA 4FJNA 3PW5A 2V0NA 3OHAA 5KT5A 1N56A 1RBRA 3H5UA 3V9WA 4QWEA 1TL3B 3NDKA 2HHSA 1T03B 3VQBA 4URGA 3HVTA 3RB4A 1C0TA 3T1AA 1WNSA 1ZBLA 3TVKA 1HRHA 4K8XA 4EYHB 2IS3A 3V9SA 2FJWA 3KLIA 2JC1A 4C8LA 3VN5A 1GX6A 4NLVA 1D9FA 2FBXA 3LPUA 3DRSB 1ZBUA 4BE0A 3TAGA 2ZE2B 3OYHA 1QTMA 1EP4A 1S10A 2W9BA 1GOAA 1WSIA 3VQAA 2R2SA 3U3GA 2RDIA 4IG0A 4RW8A 1RDAA 4DLGA 1UOCA 2GIQA 3FSIA 1LV5A 3SV4A 1W25A 3AA4A 4PY5A 3H40A 1S1UB 2C2DA 3NAIA 4TY8B 4ELUA 3TAMA 5DGBA 1QSLA 3M9OB 4PUOB 5DLFA 4FK0A 5DG7A 1S1TA 2C2EA 3VQ7A 4ZVEA 3S3OA 1JL1A 3DOKA 1JXEA 1GOBA 3DI6A 3KHHA 2GBZA 4O0IA 2WONA 3RAXA 3HVWA 1I3AA 3PW0A 4DS5A 1U47A 3SQ0A 4B9LA 5KFCA 3OYGA 3DRPA 3G0ZA 4FLVA 2KFZA 4YR2A 2RN2A 5KTQA 3SYZA 1SUQB 2W8LA 1TQLA 2KZMA 4DSIA 3BDPA 2R7YA 2WHOA 4JV2A 2QK9A 3MEGB 1T05A 3EZ5A 4NYNA 4M45A 2BRLA 4YFUA 1NJXA 4KO0A 4IQXA 3BQ2A 3PUFA 5KFMA 2X6NA 4IDKA 3TQ1A 3VQ5A 4L8RB 1WAJA 3HVTB 2ASJA 1BI4A 3ZSOA 3L2VA 4CIGA 1A5WA 3MTKA 1RAJA 4FM0A 5J2NA 3HSTB 4CJUA 2XO7A 5KGWA 4I9LA 1NJWA 2B6AB 5CYMA 2NUBA 2IC3A 3H4DA 1C1AA 1LAWA 3RAQA 1S0OA 2FVQA 3QLHB 3ZT4A 2ZE2A 4HYKA 3QNNA 5C24B 2C2RA 4NRTA 4DTPA 1TKZB 4BDZA 3HVRA 3PX4A 3ITHA 5KFPA 4Z4CA 4N41A 4R0EA 3BR9A 1FXXA 4U6PA 2Y1IA 1RYRA 4ZPBA 3DI6B 4RW9B 1TK0A 5L1IA 4NCGB 5D3GB 1HQUA 1D0EA 3NKYA 4FZXC 4FZYA 3T5LA 3N6MA 1N5YB 3GIIA 1W9HA 3Q8PB 4KTWA 3I5BA 4I2QB 4FK2A 3T19A 4IFYA 1RT2B 2VWKA 2F8SA 3GQCA 3KK1B 1S5JA 4DU4A 4E7JA 3KLIB 1JLAB 4E3SA 4NLSA 4M42A 3ZT2A 3B6OA 1KTQA 5F8MA 4J9PA 1S9GB 3V6JA 2KTQA 4YNQA 3H5YA 4NCGA 3KLHB 1Y97A 3LP0A 2W9BB 4KTQA 4H4MB 1WSGA 1TK5A 2UVVA 4RW7A 1JKHA 1RCHA 3I8DA 3I5CA 2F96A 3DRPB 4WYLA 1U09A 3KLGB 1DTQA 3MXIA 1RDRA 4TQSA 4R5PB 2HWHA 1RBTA 1ZBHA 1QSSA 1JXLA 4WYWA 3ASMA 3QEXA 4LQ9A 2AGPA 2OZSA 4FM1A 2XY5A 4FXDA 2ATLA 4XO0A 5CYQA 2ATQA 3SUPA 3Q8QB 4E7LA 3ULDA 4WE1B 4EEYA 3VQDA 2F8EX 4DTNA 2FVSA 3CJ4A 1Q9XA 1LW0A 2E4LA 3QIPB 2IC3B 4ZP9A 5EWGA 1JLQA 4CHPA 1C0TB 4HCCA 2XI2A 2F8TA 1KVCA 1RBUA 3LAMA 2CJQA 3NBPA 3G10A 4KHRA 5C25A 2A1SA 4K4ZA 4OPJA 1K1QA 4RUAA 4LQ3A 2Z1JA 2D41A 1ZBFA 1W0HA 1T05B 3L8BA 4FJJA 2J6SA 3UPFA 3DRSA 1S1VB 4F50A 4ED3A 3L2UA 4DSJA 2XY7A 2V4RA 2OPPA 4J9OA 3MXMA 2IM3A 1KFDA 4CJQA 2KZZA 1RDDA 3DLGB 2FLNA 4EO8A 4ZPCA 5J2QA 3CDWA 4U7CA 3OYNA 5KFKA 4IR9A 1BCOA 2G8KA 4HVJA 1IM4A 4W5RA 3MEEA 1WLJA 4QAGA 3RMCA 3NBPB 4Z0UA 3AA5X 4CEAA 3PW2A 1S4FA 2BRKA 4XIUA 4HUFA 4J2DA 4LSLA 3OS1A 4JRPA 1DTTB 1XHXA 2QKKA 4Z4EA 3HPHA 1VSFA 4AHVA 1FKPA 4CK1A 1NHVA 4Z4HA 4ZVFA 3QO9A 3OYDA 4IG0B 4KSEB 1S0MA 4G3IA 4O3QA 2PYJA 4MIBA 2E6LA 1NKEA 4M3WA 5KFDA 3NGIA 3O3FA 3LWLA 1QSYA 1BQMB 1U49A 3O4NA 2JGUA 3VQEA 4AHRA 1S9FA 4ZPDA 4R8UA 4CGJA 1LW2A 1UWBB 3QIPA 3P83D 1CXUA 4CF8A 4CK3A 1LWFB 4ICLB 3NL0A 1IKWA 2JEFA 4BDPA 1YTAA 2HNDB 3QEVA 3PJXA 3I5AA 3KHRA 3T5JA 3OYAA 3MECB 2Z1HA 1HNIA 5HBMA 4KB7A 3TI0A 3H2LA 1TKXB 4NYZA 4DF8A 5DMRA 1NNDA 5KG0A 2HNYA 2ALZA 2AGOA 1D5AA 1S6QA 3BJYA 4KHMA 1S1WB 4TQRA 4FJLA 4URSA 4FLWA 3KTQA 5L1JA 2DPJA 2GV9A 3AA3A 3OYIA 1SKWA 1DTQB 1T3NA 1EKEA 2R2UA 4NLGA 3V6KA 2P1JA 4KFBB 4CEEA 3U6FA 1NOYA 4LSLB 1TAUA 3OLAA 1B9FA 3KMQA 3QESA 5F8IA 4DQIA 3AVLA 3QZ7A 3V1RA 1S0NA 1L3TA 4Y34A 2YNGB 3KK3B 4TN2A 4Q44A 3C94A 4RW7B 3QLHA 5KT7A 4K4VA 5HRSA 4KI6A 3OL8A 1RT6A 3CFPA 3OSNA 3PW7A 3CYMA 1KSPA 4GMJB 3KNAA 2IGIA 4ELVA 1OS5A 4WFYA 1S1TB 1NK7A 1HQEA 3PY8A 3B6PA 3HO1A 1JLAA 1S49A 1XR6A 3SJJA 3T3FA 3RR8A 1S6PB 3AVGA 5KG6A 5I3UB 1K6YA 3G6YA 3KK2A 1JLFA 4MKAA 1NK4A 2EHGA 5KFHA 3A2FA 4FJXA 3V81B 3FQLA 3K5LA 4FJGA 1NJZA 1NK6A 1RTIA 4HUEA 2R8JA 5KFSA 4Z4FA 4RNOA 4FYDA 4YQWA 2ASDA 3HK2A 5KFOA 1KCFA 4CEZA 1YT3A 4ECQA 2YNIB 5J2NB 3KLFB 4CE9A 4H4MA 1HQUB 4O3RA 5KFBA 3ZT3A 2IMWP 2AJQA 2JLEA 3CJ2A 3HP6A 1BHLA 1ZBIA 2BR0A 4DFJA 3GV5B 3ALYA 4NYFA 1UA1A 3SQ1A 3DMJB 4ICLA 3CO9A 2ILZA 3C6UA 1JLCB 4CEFA 2QKBA 3V6DB 1ASWA 2OH2A 1S1VA 4OL8A 4IDKB 3JSMB 5CYQB 2XCPA 4IG3A 3M8QA 4K4WA 3HYFA 4FVMA 2O4GA 3AVIA 2FVRA 2YNIA 1IO2A 1ZETA 5J2QB 2JC0A 4JV1A 4CF9A 1FK9A 4KPYA 3V4IB 2BANB 4KV8B 1IKWB 3CFRA 1SUQA 4LY7A 2P5OA 4NLTA 1WSJA 1WN7A 3IS9B 2VG5B 3VQSA 2UUWA 3M8PA 4HCBA 3KK1A 3CDUA 4IFVB 4QWBA 2W9CA 4CEDA 4CGDA 3BSNA 3SV3A 4PA1A 2OPQA 4IG3B 2EC0A 3AO4A 4K50A 1ITGA 5KGXA 1NKCA 1U45A 5SWMA 1JLGB 4FM2A 3GIKA 4F4XA 3V6DA 4O0JA 4C8NA 3LANA 2D0CA 4RW9A 3HJFA 3MR2A 3FQKA 2R8GA 2XI3A 4W5QA 2I1RA 4W5NA 3P1GA 3GILA 4KHQA 1RDBA 1R0AA 4K8ZA 1RA6A 3PX6A 3K59A 5J1EB 1BQNB 4DS4A 1S9GA 4Q8EA 1EP4B 4E0DA 3AA2A 1HNIB 5J2MB 3H98A 4XPCA 2R2TA 3TAPA 4W5TA 3KK3A 2VG7A 2QE5A 1RT7B 3PX0A 2WCXA 1HYVA 3PHEA 1BGXT 1T03A 5KFYA 5KFEA 5F9NA 3ZSXA 3NH1A 1XC9A 2GUIA 3IAYA 3CVKA 2BQRA 4R8UB 2FBYA 2HHWA 1DLOA 1QHTA 4JV0A 3LP2B 2YV0X 5KFIA 2W42A 5HRRA 3M8SA 2DY4A 5T14A 1JXBA 4N76A 3AO5A 4RU9A 5KFFA 3WNGA 4FLTA 2HB5A 4GVMA 3HL8A 2B4JA 4Q43A 2GIRA 3VQCA 3M8RA 3NF9A 4K4TA 1VK0A 3BSOA 4ZVHA 2AQ4A 3VQ4A 2HHVA 5DQGA 3DLBA 1I39A 4MKBA 1T7PA 3NF7A 2W9CB 3AVNA 3HVAA 1KHWA 3H08A 1MU2B 2XHBA 2P5GA 2G8FA 1KVAA 4DTMA 1QE1A 4M95A 3T5HA 3O3HA 3QEIA 1XR5A 1SV5B 4F8RA 5SZTA 5KFXA 3Q8RB 2RF2B 4Q45A 3QGGA 3KLEA 4Q0BA 3KLHA 4TLRA 3AVHA 4QCLA 3LP1B 2R8IA 4I7FB 4ECYA 4MK7A 3CJ0A 2IAJA 3K5NA 4LH4A 4ED7A 2GC8A 1C1CB 4HUGA 1BIUA 3RRGA 3KK2B 1C0UB 5C42A 4RZRA 4OKEA 3ZCMA 1JKHB 4O5BA 3KD1E 1HPZB 4CK2A 4XPEA 3MF5A 4DQPA 2FJVA 3O3GA 3BQ0A 4G1QB 4CFDA 2HMIA 4AHSA 1D1UA 4FLUA 4IR1A 4B8CA 4DTXA 4FJKA 1YVFA 3GIMA 2HVIA 2D5RA 3ITHB 4CJPA 4FJMA 3IRXA 2ZD1A 3N6NA 1A5VA 3C6TA 4B9NA
chains in the Genus database with same CATH superfamily
4CBXA 3CG7A 1HBOB 1YJWS 1SJ1A 4FW2A 4E8UA 4KGXB 2MSSA 1YGYA 2DK2A 1TL1A 1RZMA 2GJ2A 3B4DA 3ZTQA 3OL9A 1XR7A 2LQJA 1IN0A 3OXFA 1JJCB 3TWHA 2IIRA 3G71S 5CXTA 1FWPA 1T94A 1IWGA 4ED8A 4M3TA 3KJVB 1NPRA 4AE5A 4LRAA 5A6PA 9RUBA 2OFGX 3MURP 4JI5F 2E66A 1MWKA 1UVJA 2FC9A 3L4IA 4KH4A 4DMZA 1REVA 3DDIA 4D3GA 5KPRA 2VIHA 4HL9A 3HHDA 2U1AA 4EHUA 2DISA 3CQXA 2KL8A 3OLBA 3UD3P 3D2EB 2AYMA 5GIOA 4EUVA 4WU2A 4AUKA 4WFZA 4Q7AA 3L6QA 2CWKA 4C8YA 4FWPA 3OSPA 2RDDA 5AZJB 4DXLA 3J7Z5 3MD3A 2OD6A 1CXQA 3LPYA 3EX7B 4LF7K 1J54A 3DYAA 2FQQB 9ATCB 4CLYA 3W63A 3M8PB 3A5NC 1RDCA 5ETVA 5K8PA 4CJ3A 5KFUA 4OLBA 1G15A 2VWJA 2UXDF 3L2RA 2RT3A 2V52B 1BQNA 1XNRK 2DH8A 1BCMA 4QR1A 2YPZA 3FLCO 1OVQA 4C3LA 2HF3A 2BE7D 2CDRB 3VZHA 1Q78A 3HI9A 2VF3A 2CPYA 2NSCA 3ZEUA 6AT1B 2DNRA 4QIWD 3PRDA 3ZZZA 3DM2B 2G4BA 4DV7K 5AJ3J 2DHHA 1LXNA 2K2PA 5BRFA 1VQ7N 3THXA 4FLYA 3SAHA 4GV6A 4A8SA 4Y2AA 3OYMA 2VPXB 1DZ5A 5AQTA 4Q2LA 4RW4A 1RLDA 1JLGA 3N4QA 1HW8A 1CBKA 5HK4A 4O3PA 1RWKB 3O2IA 3C0BA 3AFGA 4ID5A 3ENQA 1ZM9A 2HQFA 3HM9A 3TEHB 4KB1A 3PR5B 4DUZK 3FZ2A 3CERA 4CIFA 3KLVA 2YNHB 4ZPVR 2G8VA 3LDSA 3R9LA 3HHLC 3NE6A 2PA3A 2H4YB 3GFXA 2OPSB 4KHWA 2Z0GA 5C2GA 1X7VA 1XIQA 1YF5L 4ZPTR 3ZZPA 4FF4A 4UUWA 3OV7A 4LF9F 4M5IA 1N32K 3FBCA 2UUCF 3ZSRA 1VQ4N 5CH7B 2D3ZA 4DSLA 5E3RA 3EKSA 1YJ7A 3SSSA 3OL6A 4F4YA 4ZTFA 3MMJA 1WG5A 1SKRA 4N56A 3DLEA 3AVAA 2BE9B 3G96A 4ZTJA 3G6EN 3RBEA 1A9NB 1S9EA 1NZAA 3P39A 4CGHA 4CO5A 4ETZA 1IKXB 1PCAA 4B3SF 4WE1A 3ZYYX 2PO4A 1BE4A 1T6CA 3OHBA 1JLEA 4EZ6A 2ZJQL 4ZHRA 3GJQB 5GAHU 3U1LA 1Q86O 2G1HA 3QSYB 3NMRA 2HEKA 3CO0P 2XMVA 1VQ6S 5AZIB 5D4OA 4N7TA 3VV2B 5DETA 2V5HG 3Q2SC 2CJAA 2KVQE 2RHKA 2Y9HA 2IDOA 3G82A 4JKDA 3SPYA 4CJWA 1RJJA 3H0PA 4LJMA 4GV3A 4P71A 3EM1A 4C0OC 2BVZA 1ESVA 3MAAB 4OYZA 2GO9A 1QZ6A 4B3OB 3CIZA 2QFJA 1KD1T 4PCQA 4OI0A 1RU2A 4JI1J 3NY0A 3VPZA 2EG2A 3HZEA 1YG0A 3AB4B 2RKIA 4I6AA 4LFCJ 2P9LA 4JKBA 4WIQA 3OVSA 2QWOA 4DR5K 3BY5A 5CAAA 5DG8A 2ZEJA 3I9V9 3E01A 2OTJS 4K7QA 2PSZA 1V6HA 1F9HA 1YHQS 3AXKA 1HJOA 1YK9A 3PO4A 2C2ZB 3OYEA 1Q8KA 5C7PA 1X4EA 3N79A 3HT0A 3FDSA 4CCHA 2VPZB 2UXBK 3ZX3A 1HLWA 4KH0B 2QL5B 3K58A 4LF4K 2W7OA 1XMOJ 2CGLA 3I0RA 4QYZK 1VQ5S 1WG4A 4FYYB 4H8KA 2YY3A 1UVMA 4WQ5A 4CF0A 1M0SA 4CP5A 2NZ4A 1E6YB 3H59A 5L8RC 4WFXA 1VRUA 3NCQA 1UETA 3MECA 1LQ9A 2HWTA 3LA0A 3VWSA 4YB1P 2XYHB 2DNHA 1GH8A 4NLYA 1C1BB 3R5JB 1X9WA 2PN6A 1ATSA 4MIAA 4M3UA 2V8PA 3BM7A 2FJDB 3SZ2A 2MKKA 2YQ3A 4X4SA 3M7VA 1KAXA 3L3CA 2M8DB 4MYTA 4NI2B 4FS2A 4BWJA 1HBMB 2GA7A 2J6UA 4B9UA 3G6ES 1KS2A 4PQAA 3VF2A 3NCIA 4F3OA 2C2NA 4FWSA 2F8HA 3TX0A 4EIAA 4DV5J 3VEXA 4ZLJA 3BV8A 4IRCA 1SJRA 3A5MC 1KLMA 2M52A 2A6OA 3PYDA 3OS2A 3BF3A 3J80Y 2CA9A 1RT4A 4CJTA 3H2UB 4FCYA 1X5TA 4OJ3A 4CGIA 3HFZB 2O8EA 2FVCA 3OL7A 4USJC 5I42B 1J5OB 1BWVA 3TR5A 2FF3B 3UDEA 3VAIA 3EZOA 4DL5A 3BBFA 3O9QA 1H72C 2I5JA 4B02A 4C11B 1U4BA 4Y6IA 1O0PA 2XULA 2HIQA 3MCSA 1NDKA 3LP3A 4DR6F 1RNHA 1UFWA 4OHZA 2DO4A 2B56A 3NF6A 4BDYA 3EDRB 4I2PB 1N5QA 2BQ3A 4UY8O 3KD5E 3T9NA 3G2XA 2YNFB 4C8KA 3G82B 4W90B 3O4QA 2Q97A 3FGUA 4CECA 3LL3A 3MX2A 2AGQA 4B1XB 1R8BA 4BRMA 3JTOA 3MUMP 1S6QB 1NJYA 4B9TA 4I7FA 1SCJB 2G0CA 4CF2A 4ZKAA 4WPAA 4DV1K 2BGGA 3F5TA 2HHTA 2RD5C 2DRDA 5IOLA 2KM8C 3L09A 2Q79A 3FFIA 5FD1A 3QEWA 2WSCC 1N36F 3EE9A 4GKJK 1OH5A 4EBEA 4U9RA 1D9DA 5B8HA 2AP1A 1P90A 2R4FA 4X4UA 4ALZA 4RBVA 1U48A 4B3MF 3AGKA 3NCPA 4WXOA 2CJBA 3K2PA 3N0VA 5CZVA 1HQ2A 2ZKTA 1L3SA 4YB6A 3K57A 1NJIO 2QL9B 1FTCA 1C0UA 3GONA 1QVFM 4LF9J 3ISND 3UN2A 3THVA 4BG9A 2D3OR 5LSRA 5J2PA 4KE5A 2V4QA 4I0WA 2MQNA 4NLXA 4ZMMA 1PYOB 1FXRA 2VUGA 4CERA 3G86A 4IEIA 2V9WA 3I56N 1RTDB 1GXUA 1S9EB 3O9UA 2HGMA 2D69A 2MQMA 3AVJA 4RNHA 5GAEP 3VTIA 4OYBA 5L38A 4I2PA 1R8HA 4CO2A 5A6WA 3TWZA 1W26A 3RU0A 1MW7A 1BIZA 2P9KA 3M05A 2PYLA 3CJ1A 2IOCA 4GKKK 3US5A 2EX3A 4DN0A 5F1XA 4ZVGA 2DRAA 3D1HA 3PG9A 4Y65A 1TKZA 2ZOMA 4P74A 2ACYA 2F9JA 4X66F 1SAZA 1SIZA 5HOOA 2KRRA 2QFIA 4OYAA 1NLKL 1WBDA 1JNRB 5JUMA 3KHYA 4DOZA 4F26A 4K0KF 1KXPA 4DR3F 3HSZA 3L7UA 4J2BA 3PR4A 2VB6A 5DRKA 4KHPK 4LRBA 1FX2A 5F9LA 2VH7A 3VCDA 4DLEA 4I9QA 1VSJA 1LFPA 2CNKB 2O8DB 1NZ8A 2B9XA 3GMGA 2R7WA 2DJWA 4GO5X 3V9XA 4PEOA 1GLCG 3HKWA 3WT0A 3AVCA 4DMNA 2B7CB 2JEGA 8ATCB 1F5CA 5M1QA 1V5VA 3EKUA 3GYGA 4KHUA 3LDLA 4BRFA 1K0TA 4E1MA 4EBDA 2AX0A 1Y0HA 2VJUA 4PWWA 4ANCA 4X4OA 3CULA 4UZBA 3FNNA 3I96A 4FJIA 1E6VB 3OJUA 4GKKF 3N28A 3VEZA 2B5JB 3M6VA 3DLKA 1U6BA 2UVUA 4KYZA 2NR0A 2YHBA 3W60A 2G8UA 2KFYA 3DNCA 3IP0A 3CM5A 3L2WA 1RWWB 3E51A 4CLUA 3FGVA 4CLLA 3TUZC 1VSIA 1CZBA 2RQCA 2DGWA 4O5FA 1C1CA 1YJRA 2UXDJ 4KHPF 5KFJA 2AYEA 3RMBA 4FF2A 2VG6A 2GGPA 4DQRA 4F2SA 1HR0J 4PXBA 1AXQA 2H1YA 4NXMF 1Q8IA 2KW4A 3BF1A 4OYPA 1LW2B 1SL2A 2WVCA 3I33A 4I64A 1WSEA 4RUCA 2JWLA 3CJSA 5THWA 4HTUA 1R0AB 5I3QA 2UUCK 1KBRA 2A0FB 4FP9A 3G71N 1UL3A 2NXEA 1VBYA 3QNOA 5EY4A 1BL3A 3DLJA 4TYBA 3TARA 3R3LA 2KFNA 3ZSYA 1XERA 2FHJD 2GELA 1RTJA 4LFCK 1FW6A 3HT3A 5GAGI 2W7PA 4Z4GA 4ISGA 3I0SB 2YKMB 3BEXA 3KDOA 3KJVA 2XSJB 2WW4A 2WONB 3ATUA 2MQ8A 3B4MA 3NGKA 4WQ4A 2BE2B 3SCXA 1JMTA 1SKUB 2GWJA 1VGYA 1RT1A 3SMPA 2W1BA 1X1PA 3VQTA 3TEGA 3S6EA 3AH6A 4NX9A 4YY3J 1R27B 1NK5A 4JI0J 4NLOA 2XG8A 3WIVA 2NNWA 3JQJA 1Y00A 2V2KA 4P2SA 4DFPA 3NP5A 4A2AA 2ROPA 1D8YA 2YH0A 4CF1A 2AZ3A 4ZPWR 3NHGA 3I4PA 3UKUA 4J9RA 3CM6A 2R7SA 3PYEA 4ZVTB 3IG1A 2R9LA 3TAEA 2QWMA 3KJQB 4E7KA 2DB1A 1OKJA 2JWNA 3K8WA 1K44A 3A3PB 4ZVRB 5HVFA 3CCVS 4FXWA 4P9SA 2HK2A 1JCEA 3C6HA 4GVBB 3PSIA 3D45A 5AJ3K 3HX9A 1RQ0A 3OY9A 2GHPA 4DR7J 3QYYA 4EYIB 4UQGA 4F4AA 3NWRA 2YNHA 1DRZA 3UFCX 4AILC 4ZLNA 2LP4A 5BPMA 1R8CA 1DHMA 3G4SS 5HI7A 4BY9C 2F63A 4DV3K 1V3RA 3LUYA 4CDIA 2BKNA 3BO3A 3MM7A 3MAHA 1UVIA 1JNZB 5L9NA 1GTHA 3TA2A 3GR0A 4BR2A 5HLFB 3JYTA 3MM9B 1SQKA 1KDNA 2X74A 3THXB 1VQMN 5F3ZA 1NO8A 3TOQA 3KK7A 1UP1A 1VQNN 1LWEB 3R8EA 2VBXA 4I1TA 5IWAK 1P1LA 2SXLA 5KT3A 2VDIA 2MY7A 2RRAA 3WXLA 5AQRA 3BZQA 2A1RA 4ZN1A 2V4JB 3ISNC 2E5LF 2DNMA 5F3TA 4YN3B 4ZP7A 4DU7A 5M2RA 4HHTA 4DCHA 2ZGZA 4BRCA 1Z05A 1B70B 4ZK7M 1HNZK 2PY5A 1K0VA 2OZMA 3AJ2A 4U67L 2GMHA 1KEKA 4YOEA 4M7XA 1FRJA 3RRHA 4HTIA 2XZTB 2W9AA 3J80U 3FZMA 1Q81T 1LWCB 4PWDB 2XZWA 4EZ9A 3AB2B 3V1OA 1YKWA 3FEZA 4OPKA 4WWSA 2BQUA 4DCPB 1SQFA 1WUAA 2FB0A 5DGAA 2O3DA 1N6QA 3CCSS 3LZIA 4RR5A 2NYIA 4NLRA 5BN8A 4B1ZA 2ZBCA 4KPCA 2GAHC 4PXCA 3LAKA 1KOOA 1LOTB 5KFRA 3N9UC 4FJNA 3PW5A 5D8HB 5KT5A 1RBRA 1NGCA 3H5UA 3NDKA 2BZ2A 5EX5A 1T03B 4URGA 2ALYB 2Y3YA 1C0TA 3T1AA 1ZBLA 4LBIA 4IOCL 1FDDA 2FJWA 3KLIA 5DDQC 1T9UA 1NDLA 2Y0BB 3HZGA 4CM2A 3DRSB 4DJBA 2HSTA 1IR2A 4DB3A 4NXNK 1IBKF 4AXJA 1GOAA 2V7ZA 5IT9Y 1F3VA 3UVJA 4LFAJ 3VQAA 2R2SA 3HSCA 2RDIA 4CO0A 1FO1A 1H1VA 4CWBA 4X4PA 3FSIA 5AXLA 1LV5A 3CDBA 2OTJN 3FFKB 3NAIA 1SC3B 4AXIA 3Q22A 2QRRA 2Q0UA 3OFFA 2OP5A 2AEMA 3JTNA 5AQZA 1GOBA 2EFQA 3DI6A 5AQHA 3KHHA 1VMBA 2MTLA 3R8YA 1N34J 3BH6B 3BN7A 4FYWB 3MN6A 1SJ3P 4EAHD 3DRPA 3MZIA 2KFZA 4KGZB 2RN2A 4DV5K 3SYZA 1Q4RA 1TQLA 2QW9A 2AKWB 2OI2A 2QK9A 3MEGB 1IJJA 1T05A 2N3OA 2UUBF 1NJXA 3NS6A 2QC3A 4G1IA 2EXUA 5M1FA 4B1UB 1RDWX 3DU5A 4RWWA 4M5DA 3MDQA 4L8RB 3ID6A 3D66A 1JCGA 5ETQA 2ASJA 1BI4A 4NXNJ 2DKOB 3O9TA 3KDNA 3MTKA 4FWMA 4FM0A 1UCNA 1G99A 3HSTB 5CYMA 1F60B 2E5JA 2IC3A 3VETA 4OZLA 4HYKA 4H5NA 3V5RA 1Y10A 4DTPA 5IT9U 1TKZB 2EPIA 4U7UK 4Z4CA 3BR9A 1FXXA 3TJ8A 1TK0A 2HRUA 1D0EA 5DJBA 1ZA2B 3T5LA 3N6MA 3C14A 4A48A 1W9HA 2P9NB 4BRPA 4KTWA 4I2QB 4QYRA 4DZ6A 2YKAA 2VWKA 1SB6A 2RB7A 2AMCB 4N77A 1VQLS 3EXCX 1JLAB 1GLEG 3IRWP 3EGVA 4M42A 1IV0A 1KTQA 5A8RA 3CCQN 3H5YA 3HDSA 4NCGA 4QZVB 4A8QA 1KONA 4U8VA 4CZMA 1ACMB 1AYEA 2WC9A 4ERDA 1UEVA 1U09A 2YHXA 2CH6A 3CGIA 1X3MA 3ENHA 5A0YA 5AXKA 3G87A 5A8KB 3ASMA 3ZNUA 2AGPA 1SQGA 2OZSA 2JNJA 1F3FA 4Z94A 5CYQA 4FOEA 3SUPA 4WK1A 2ZVIA 1AT1B 4L75A 1XBWA 3ETMA 4DTNA 4DR3J 3W9JA 5IZHA 3Q83A 2ZWHA 1FRXA 3BGLA 5TKWA 4CHPA 2ASYA 5IT4A 1N36K 2AYBA 4OPJA 1RAIB 4RUAA 4LQ3A 1DY3A 2LDIA 2D41A 1ZBFA 1R8AA 4BROA 4DSJA 1X31C 3MXMA 1GMUA 4PL7A 4BREA 2CPHA 3X3UA 2AEJA 1CJTA 2BV3A 1IJFB 5GINA 2OANA 1VISA 3OUYA 2Z58B 3O4WA 4CZLA 4JD2B 2ZITA 4BR0A 2E7VA 4LSLA 5JMVA 4JRPA 1DTTB 1XHXA 1W2BR 1XMOF 1NHVA 3AXMA 2WFBA 3QO9A 1YBAA 2V7YA 4J37A 4IG0B 4KSEB 1S0MA 4O3QA 3BZCA 4MIBA 1NKEA 3M4XA 3RUBL 3LWLA 1RWOB 1B99A 2UXCF 3AOCA 2PA8D 1P9QC 2DGUA 1S9FA 4ZPDA 5GADI 2WBMA 1NGDA 3EUNA 1WELA 1H73A 1CXUA 4CF8A 4UY8T 4RJVA 3NL0A 2WB1D 4ZCLA 2JEFA 1YTAA 2CQIA 3PJXA 3T5JA 3OYAA 1ZM2A 3OD2A 5M2UA 4B3SJ 2YHYA 2Z1HA 2HRYA 3TPQA 5FPNA 2I7NA 2DR9A 2DHSA 3ONQA 3VERA 2ALZA 1AFIA 2AGOA 3NS7B 1T9TA 1NGJA 4RKUC 3KWIA 4FWRA 5E0OA 1TMMA 4DL0C 1S77D 1VQPS 4NYPA 1G2EA 2IRXA 4B17A 1WDDA 1DTQB 2RSQA 4LF6F 1Q7YO 1EKEA 3NGSA 4I67A 4NLGA 1ZZFA 2YWHA 3LTOA 7AT1B 4IO1A 3AD8C 2H5EA 4ZVQB 3ENWA 2HQIA 4LSLB 2YJEA 1TAUA 3AOAA 1KVKA 3QESA 1F0XA 3UDVA 1BU6O 3DWLA 1HR0K 3QZ7A 6FD1A 4QIVA 3MMBB 3ZETA 3OXLA 3KK3B 4RW7B 2DR7A 1U1RA 2JLFA 5KT7A 2HMPA 3T41A 5HRSA 4KI6A 3FBFA 3SBTA 1KSPA 4GMJB 4NOHA 2IGIA 4ELVA 4CVNE 2E5HA 2YX7A 1S1TB 3ZO7A 1NK7A 4LMZA 1HQEA 3HO1A 3AA8A 2L9DA 4NO7A 3LOUA 3W2WA 5A8RB 1S22A 5EHHA 1U0HB 2QSWA 3C16A 5B0CA 3AGRA 3VVUA 4YB7A 1I3OB 5AE3A 5I3UB 3NMUA 2O8FB 3CDAA 3CUNA 2GHWA 2EHGA 4OZ5A 3A2FA 4KGMA 4YDDB 4WFNL 3VAGA 4RU2A 2CQ3A 2QA4G 5CR4A 3C15A 4OZ1A 5C0YA 2OIHA 3K5LA 3IDHA 2IA0A 4JYAJ 4KIAA 3BKFA 2LA6A 1UJ4A 1AROP 3H45C 4DPWA 4FYDA 4YQWA 2ASDA 2HBLA 2NRVA 3HK2A 5TKYA 1KCFA 1PILA 5GAEU 3G8QA 4ECQA 3L4QA 5CHIA 1EX8A 1HQUB 1VHXA 3ZT3A 2AJQA 2JLEA 2H3EB 3CJ2A 1NH8A 3HP6A 3BP8A 1ZBIA 2BR0A 3ALYA 4JI6J 5C2FA 4ES3A 1NSAA 1YJ9N 1N34K 2O1PA 2HZVA 3DMJB 4ICLA 3CO9A 2ILZA 5IC6B 1JLCB 1RAHB 4V19J 1EQ0A 2OH2A 1S1VA 4OL8A 1HI8A 5CYQB 2IVYA 5IT9O 3G9CA 2QWQA 4LRFA 3HYFA 4CT9A 2YNIA 2JC0A 4JV1A 1F5BA 3JS9A 4EFAC 3AJDA 3CCLN 5K8NA 1WSJA 2M3DA 3R1XA 3KK1A 2H9ZA 5EX3A 4CEDA 2UUCJ 3R6MA 4K50A 3WHIA 4K5RA 4FM2A 3GIKA 3V6DA 1S7IA 4C8NA 3I8BA 4LF7J 3R7SB 4HI1A 2V67A 4G6VB 2O8BA 3OTBA 5F0WA 4WTYA 2LA4A 2R8GA 3GILA 3KYLA 1RDBA 4K8ZA 4DR1J 5A8KA 4JOUA 3K59A 2W6LA 5J1EB 2RE2A 3AA2A 3H98A 2XHWA 3PX0A 3C8YA 5HANA 3PEJA 5F9NA 1FVSA 4LFBK 1CJVB 2NXJA 5F0UA 2JLGA 2F9WA 3M3ZA 1FNXH 2V51B 5BRHA 4JD2A 2LQ8A 2DPNA 2E29A 3LP2B 3H2VE 4P7TA 2GMLA 1HNZJ 1HWKA 2LQBA 2QA4S 3SAFA 4BRIA 4RU9A 2M0GB 1VQON 2DNPA 3M6XA 2HB5A 3BYRA 4X65J 2EFOA 1Y64A 2KHDA 3R5CA 3M8RA 2NRHA 3CD6N 4C4WA 2NXCA 3QJLA 1VK0A 2HHVA 1KKHA 2BJDA 2JJ4D 1T7PA 3K7RA 3OTOJ 2WSEC 2F65A 1KHWA 3H20A 2DNKA 2JZ5A 1KVAA 3O3HA 3WX4A 2XSFA 1HX1A 3QB0A 1SV5B 1OMSA 4ILGB 4QCLA 3KLEA 4TLRA 2BM0A 4I7FB 4HH0A 2MKHA 2ASPA 2IAJA 5A2QY 3CMES 2XMWA 4XH5A 4ED7A 4HUGA 3RRGA 3H8YA 1BY9A 4KY3A 3P49B 5C42A 4RZRA 4CLFA 2L3MA 5G0RB 4OZ0A 1JKHB 4ILHA 2UU9F 3CMQA 3KD1E 1HPZB 1KQFB 2VFVA 4XPEA 3W0LA 2FJVA 3O3GA 3QICA 4G1QB 3MPWA 2HMIA 2RU3A 1NU0A 3TSUA 1R8PA 3R6LB 2P2CB 2CNNB 1UVLA 4B8CA 3HD1A 3CCQS 3MCNA 4WTOB 1M5HA 2VKRA 2IDEA 2B0GA 5KFTA 3IS9A 2CPIA 3EO3A 3QBWA 4W5OA 1C1BA 1UKUA 5CYMB 1RTIB 2WUSA 2P9IA 4YR0A 2VGNA 1PSDA 4ZJOA 2YVSA 1SPBP 2ZM6J 1QAJA 3VESA 2EK6A 3ENBA 3PW4A 3SBGA 4R0JA 3W3DA 2Q36A 2P5VA 5BREA 1NKBA 4NCAA 1BC6A 1RWNB 1N48A 4O0NA 4V1Ak 4LR7A 4I68A 4BRNA 3ZSWA 3CC4N 1URNA 5KI6A 1J53A 2K7JA 2B8PA 4QYZJ 2LU1A 3D0IE 2DD8S 1SBRA 3ENVA 1HNVA 2WSFC 3D2EA 3NMAA 4BCAA 4L72B 3UKUB 5JJBA 8RUCA 1JJHA 4QJVA 2QG9B 5H1SV 3DXKB 4K2JA 2VONA 4PPDA 2VDHA 5LMUF 4JK8A 4ID5B 5ADXH 5FRMA 4OYXA 3VEYA 3QFHA 2N7CA 1NLVA 1X9MA 1EETA 4LH5A 2QSFA 4IFVA 5C10A 1QHAA 1IKYB 1OSDA 1HD0A 2WAQD 2J6TA 5FLXO 4KHNA 1WF0A 4PKDB 1F2HA 1G4CA 1X9JA 4RNMA 3OHRA 3HHNB 1YJWN 1WUUA 1KVJA 5LJ5Y 2W2OP 5FPMA 4B3RJ 4YDUC 4K59A 4J9MA 2XMKA 2OAUA 4HKQA 4MYUA 2GHVC 5AQYA 1HWJA 5KAKA 1LXJA 3CCJS 2L08A 1L3VA 3SBMA 4F3TA 4IH7A 3ZFVA 2ATCB 3MEEB 5FROA 4KGVB 5AE1A 1BI4B 5L9XA 4U8YA 3D3CJ 3QAEA 3OBYA 1QE1B 2HHXA 3NGDA 2B4OA 4O55A 3T69A 1JLBA 3WNEA 1TVRA 1PC5A 4BGAA 1TKDA 1H7XA 4LSZB 4UT4A 1P6TA 3EE8A 2UVWA 4P7VA 4QOTA 4QWCA 1L3UA 1S3XA 1RWUA 4DQSA 3ZT1A 5F8HA 1KQSR 2CPXA 4ZVUB 3U3YA 1RT2A 4C8ZA 3QQCD 1VOMA 2FLLA 2G8WA 2V68A 3GG0A 5CD4H 5D4NA 1FJGF 3WNFA 4IEEA 3VAFA 4P2XA 1FKOA 5F8JA 3VGMA 3VMFB 3J7A1 3B8AX 3P4IA 3G6VA 5T41A 2CNLB 3NGYA 3MR7A 4I2QA 2AJ4A 2VFRA 4KV8A 2DEIA 4DUYF 1S1WA 3MAQA 3ISZA 1R89A 4F9OA 2DPIA 3BGUA 3CJQA 3QMQA 3AARA 3VAHA 4IQMA 2WVDA 3ETOA 4PPZA 3IGNA 4JI8J 4CHZA 3IM8A 1SIWB 1HPZA 2NPFA 4RNFA 2X1BA 4WBFA 1VQ5N 2D3UA 3OW2R 2YKMA 4MKVA 2HBKA 4RG8A 4F0KA 5AQKA 2EK1A 3VQ6A 2G8IA 3SUOA 1KHVA 4DUTA 1Y7PA 4A59A 4AHTA 2YKNA 3TA1A 5CZXA 4CI0B 2F4VJ 3BO2A 3KG4A 2HNZB 3TUJC 5KT6A 1WEZA 4OPHA 4Y2KA 4B9MA 2XC9A 2ZBIA 3DXSX 4DR5J 2BJ7A 2ZDOA 4Z37A 1A6LA 1QQOA 3GTYX 1RWVB 3W5YA 1E4GT 2VOOA 4YY3K 4LUBA 3ZTRA 1S72N 5HL7L 3UQSA 1B64A 1HL6A 4UQTA 3B82A 4ED0A 4LF9K 4B3SK 3S3NA 3KKSA 4BACA 3HHLA 3TAMB 5U47A 1TL1B 2ZKUA 2IM2A 1J5EF 4OHWA 4JLHA 4CFCA 3I6PA 3KUEA 4DU8A 3GV7B 3VAKA 3MM6A 2J8AA 3OTCA 4C48A 2OEMA 1T11A 1YAGA 1PAEX 3EDQB 4QS8A 3ZZYA 2IAJB 4EHTA 4KO0B 3RBXA 2DCLA 4BC4A 1XQIA 1A5XA 1M1HA 5HAOA 4C6AA 3ZC4A 2YKNB 1CJVA 4R5PA 1Q5VA 2XTJP 3NVKA 4P2FA 2X78A 5E3CA 3C7NB 4CD3A 4O3NA 3RMDA 1FD8A 2XY8A 4H03B 3N5BA 1LFWA 1IH7A 4JS5A 2OPQB 4HLBA 2A18A 1UPMB 2AT1B 3CMAS 3TQEA 1HARA 2E1PA 4BR9A 4QU6A 1FJ7A 2POKA 5HO4A 3WBZA 5E5NA 2P9EA 4ED2A 2Y8WA 3RW7A 3EYZA 1BA1A 1PYTA 3TZZA 1HIYA 2ZH8A 3MWTA 5CY4A 2AZ1A 2HWIA 3IGVA 1RB0A 3EICA 1U2RA 3V4MA 2YWGA 5ETNA 3A12A 3OYBA 1QVFR 1N36J 3GL1A 1SKSA 3PV8A 4FPIA 1VBXA 2QT7A 4L3NA 5DM6Q 2RUSA 1DGKN 2N4DA 1HMVB 3MM6B 3NVMA 4DPXA 4DR3K 4LIRA 4B9SA 4Q8FA 3AVMA 5DO2A 2ASMA 2Z1GA 1NGHA 1SH2A 3QNWB 5LL6d 2P9UB 1X9SA 4Y00A 4PG8A 4H0VB 1GXTA 4JI6K 3C46A 4URQU 3D0PA 1ZOTA 1EETB 3HM8A 4DWIA 2VC0A 2CAJA 2QZ8A 3MN9A 3M32A 5H9FJ 2UUBJ 3DXBA 4JI7J 4M63A 4ZP8A 3TAFA 5CD4A 4BE1A 4DTUA 4F04B 2NRRA 1FFGB 4PABA 4N5SA 2ZNYA 1ZAVA 4OYWA 4DR2F 3CQYA 5AXNA 4YHHJ 5J2MA 1WSHA 1RSCA 2VU5A 2Z57B 2BMBA 4F25A 5ETMA 3CT9A 4NLWA 4IO9Q 2VG6B 4O44A 2HNYB 3CJRA 5BJRA 2ZZTA 1CQMA 3CC4S 3TABA 3DOMA 5EDWA 1X4HA 5K14A 1TP7A 4JI0F 1S0VA 2DNGA 1ZH5A 5KFZA 4MFBB 1NB7A 3M6WA 2ITMA 2KJVA 1WI8A 3CE8A 1N32J 1BO5O 2DNLA 3KNGA 4JUZA 2H54B 5EX0A 1CZ9A 2NRTA 2B8QA 2HBZB 4CZHA 4ISEA 1S48A 3SI8A 3OYCA 5CYJA 3OFGA 4DV1J 1J2VA 1FWKA 4J9NA 4BR7A 4JI5K 3NGZA 4ID8A 4FJ9A 3A13A 3CDEA 1U2VB 2HHUA 1M5KC 4C23A 4M5NA 5A2QU 3CMEN 4QWAA 2M2BA 4M5KA 4FLZA 3P96A 4JKGA 1DT9A 1Y3KA 3LP2A 5GMEA 2W41A 4F2RA 3N4WA 1KFSA 2BX6A 3L3UA 3POTA 2JOQA 1WC3A 4CM0A 4MJKA 4MQ3A 2W7AA 1BUPA 3M8QB 3FZBA 5B0EA 4ZJLA 2Q3SA 1T02A 3VEVA 3MHYA 2BE2A 1WTFA 2I0XA 3IR6B 2YH1A 3JAMY 1BDGA 3SK3A 1KLMB 2DR6A 1NOZA 3R1HA 1GAOA 2CPZA 1O5JA 3M9MB 1X0FA 4B3RK 2JRSA 1VC5A 4BQZA 2H5JB 4DUZF 5ETRA 4M41A 3MR5A 4NI2A 4QWDA 1CC7A 1X0PA 2YQ1A 4DSKA 3KLEB 4B3MK 3CC7S 3DHXA 2QTDA 4LBPA 2X51A 1CC8A 1QQMA 4DU1A 4FOIA 3V4IA 2PMHA 2WZ1A 3U4LA 5B0FA 5LXRA 1N5TA 1LWFA 2WBNA 4PZVA 5GMKa 4BVPA 3FRYA 3GSIA 4YMEA 3WC0A 2G0IA 1H2TZ 3I0SA 1RTHA 4K0KJ 4AH9A 4EP4A 4KHSA 1S6UA 3M2VA 4DV3J 2CNOB 2E9RX 2LXIA 4O4RA 2HQDA 1M90O 1FK9B 1SJQA 1WSFA 3MR6A 3ET6B 2M4MA 1FT8A 4Z7CA 1P1TA 3T6BA 3Q8SB 3SPZA 4ZHRB 4LFAF 1EKSA 3DMJA 3IFEA 1GK8A 1VLOA 1S76D 3FSYA 4ECSA 4DHVA 2X1GA 4ES2A 3TJAA 2WVBA 4ED4A 2E2OA 5JS1A 3I32A 2FD2A 4CZIA 1K1SA 3CPWR 3M2RB 4G1QA 1GLJO 1OJ4A 1GNKA 3UI3A 5AQSA 3UKRA 2MGZA 3QT5A 4HHHA 3VAMA 1WNEA 1RT5B 1U7LA 2YNFA 1MLAA 4CHYA 4OLAA 3R2DJ 1FVQA 3FUYA 4O4GB 2PFFB 4P10A 2DHAA 2CJXB 4MFBA 2ZUGA 2DIUA 3EZUA 1S1XA 2GQQA 4G1PA 5M2PA 3VAJA 2A10A 5K9FA 3HULA 3S1TA 4LSNA 3V9UA 1W7AA 1J6ZA 1FEHA 4LFCF 5EWEA 4DFKA 2D0AA 4NRUA 3UWTA 2IHR1 3FCHA 4DPTA 4KHPJ 4FL9A 3BKUA 5M1PA 2JVRA 3T1HJ 4BC3A 5J1EA 2HAIA 3SJHA 4LFAK 2C2MB 3BR8A 2R7OA 3TSQA 5FDLB 1RAOA 4GRSA 3Q8VA 3JXUA 2A2CA 2COLA 2O5DA 2E6MA 3LPEA 3DLKB 1TKTA 1Q82O 4DI6A 1VQOS 2RS2A 3O9RA 3DOMB 1ZTTA 3M1VA 4YHHF 1RGVA 1JLEB 3A4TA 4J2AA 4IO8A 2ZFHA 2NRXA 3E01B 1U1KA 2XGQA 2W6KA 3DKDA 4JI7F 2U2FA 2VFSA 1MN7A 3U8XA 1Q81O 2J0WA 4V19X 3BYPA 3LALA 2PT0A 4DSFA 1FDAA 1X4CA 3M32B 3KWGA 3MWPA 1J9AA 1GMWA 2XS2A 2G1DA 2JHEA 1WAFA 1OYEA 5LJ3Y 2LSNA 4A8MP 3TU5A 4E7HA 5AQUA 3NGUA 3K9JA 2OPRA 3RTVA 3L3VA 1F21A 2VQEF 3PZPA 2X1AA 3CXCR 5EUHA 1NK9A 1AA1B 4JKAA 3ZXWA 2LECA 4P72A 2FSJA 1ICEB 3DXMB 3OR1B 3KG1A 4DUYK 3B8HA 3GV8B 1YJNS 1QQNA 3OTEA 1G1XA 1EAYC 3ADAC 3MI7X 5EVZA 3IMQJ 4FYVB 3UDLA 2KT5A 2BABA 2K8GA 2QL7B 3DLEB 5FDLA 3F2KA 3HKZD 2RIJA 3GIJA 4N47A 4CJLA 4PG5A 2HS4A 3TTDA 2IA6A 4RW4B 3DGPA 1XNQF 2OA8A 4IKAA 1Y11A 2IBOA 1YVNA 1T95A 2I5JB 2KXHA 1WI6A 2IBKA 5FJ4A 2MZJA 4ZS6A 2N4CA 5FIIA 3LM2A 3FFIB 3DM2A 4OZNA 3RSEA 3MMCA 5K14B 1K8AO 2GS8A 4KBIA 4WFBQ 2P9LB 2GQ2A 3KHLA 4DBQA 1N5YA 4IH6A 3ZT0A 1TTHB 4RW6A 4DX5A 1SZ2A 2HAFA 2J76E 2KQ2A 2VPYB 2APOA 2CPEA 3OYKA 4TXSA 1Z4UA 3V1QA 2FC0A 4M1KA 3QZ8A 1F1BB 3M1FA 2Q66A 5AQIA 3FCVA 4PG7A 2VG7B 4C0BA 2P9NA 3D28A 2UXDK 2YCHA 5KFLA 1NM1A 1YRXA 4LD0A 1QM9A 1B3TA 2MHEA 1Z2LA 2B6AA 4DTJA 1I6JA 3MEGA 1HWUA 1HBNA 2E8AA 3BBBA 4WZQA 1F9EB 4DDFA 1N8RO 4AHUA 4M3ZA 1WHWA 2WOMA 4YOTA 4HDGA 4MH8A 2GJIA 3LDPA 2MPUA 3P6YC 2MEWA 2VFTA 4DV3F 3S9HA 4HI2A 2ASLA 1U2VA 5EU7A 2KH9A 4JK9A 3SFGA 3PIOL 3CCWA 2E2QA 3Q7BA 2FTRA 1FTRA 2OJ3A 3D6FB 4FF3A 2V4JA 1XNQK 1XMQK 4M3YA 1JK9B 1CPZA 4GC6A 1WB9A 4YP3A 4YOYA 5JICA 1WKLA 3SLCA 1N6QB 1YSJA 2OEKA 3PO5A 1H74A 1T6DA 2V0NA 3FBBA 1Q18A 2FF6A 2UXBF 3V9WA 3HOSA 1HW9A 3HSJA 4QWEA 1QUPA 2HHSA 1YQHA 3O3LA 3VQBA 3RAMA 4OX9F 3QT8A 1HRHA 1IBMJ 5EXWA 3BO4A 4FVCA 1WF1A 4WQ5C 4IO9L 2R7TA 4DR6K 2C3MA 1AB8A 1D9FA 2FYXA 3WIUA 1EKRA 1WG1A 1FCAA 3OYHA 1K8KA 3OT9A 3CPWM 1S10A 3H1QA 1WSIA 1MWYA 2BJ9A 4PKHA 4DLGA 3ZETB 2A2DA 1UOCA 2GEMA 1CJUA 2R7UA 1W25A 3MXHP 3BH7B 2C2DA 2IJRA 4MMOA 1YLXA 4F0MA 3H25A 4DV1F 4TY8B 3TAMA 4J91A 2DGTA 2E1YA 4DV0F 3M9OB 4PUOB 4FK0A 1UJ5A 3S3OA 1WC4A 3QFUA 3EGNA 3D7SB 1N33F 2YHWA 3HTVA 2GBZA 2OELA 4O0IA 2MB0B 2AJ2A 3D68A 2CH5A 3PW0A 1HBOA 1U47A 4DS5A 2NPIA 3I87A 1I94F 2ZZMA 2XZDB 3SSQA 2O67A 3H90A 2YBVA 2W8LA 4DSIA 4ZVOB 4M45A 2BRLA 1HA1A 4I56A 5HMZA 3BQ2A 3PUFA 1IJEB 2BACA 3D6MB 3IO1A 2NRWA 2FY8A 2OSQA 3UB5A 1WTBA 1ULRA 3HVTB 1S79A 3F9MA 3ZSOA 4CIGA 4KJIA 4FWNA 2X3GA 3MM8B 5J2NA 2D9OA 1NJWA 3A8YA 4FSVA 4IOCQ 1LAWA 2FVQA 3QLHB 3AY9A 2D3O1 1LK5A 2BW7A 4BDZA 3PX4A 1RWMB 4L3QA 4R0EA 4ILRA 1RYRA 4RW9B 1T9WA 1PO6A 5FPDA 3EWGA 1HI1A 1CJTB 1VS3A 3CJ9A 5A2QO 3T19A 2HURA 4JI6F 1RT2B 4PL8A 4A8OA 2MZ1A 2RRNA 3PYGA 4XTTA 3C7NA 3VGSA 4E7JA 3KLIB 4X4RA 3EMTA 2ZVSA 4NLSA 1I51B 2FHMA 5D0RA 4J9PA 5AFUA 2V8GA 1S9GB 3V6JA 4JKHA 3ENAA 2KTQA 3GP9A 4LREA 4YNQA 3U7JA 3POTB 2D1CA 4NB4A 4FO0A 1Y97A 4JKCA 4KTQA 1CULA 1FRHA 1NSPA 2BJEA 3EVMA 1RCHA 1IG8A 2FGOA 3FMWA 5IM0A 4TQSA 1MA9B 2ZF5O 3O8MA 3R2CJ 1VJQA 2KT2A 1ZBHA 4OLPA 1JXLA 4F3MA 3QEXA 5ETKA 4LQ9A 3EVOA 3TUPA 1V3ZA 3IAM9 2V8DA 2C2KB 2ATQA 4ZCIA 5GADP 4LF7F 3H7HB 4EEYA 4A8XA 2AIRB 4ENOA 1U2CA 2FVSA 2GNKA 3K0SA 4FWQA 3CD6S 2IC3B 4KH5A 4NLBA 4X65F 1NMEB 3LQVA 3AQPA 1C0TB 2ZDPA 5BYRA 2F8TA 1KVCA 2XBPA 1RBUA 2CJQA 1JB0C 3G10A 4KHRA 1RAAB 1S5ZA 2BUPA 1K1QA 3FBEA 1W0HA 3AAQA 5K8OA 3CETA 1R6YA 2FHKA 5HN0A 2V69A 4PR6A 2V4RA 2K1RA 1VQKS 2OPPA 4J9OA 1KFDA 3O8WA 4CJQA 2KZZA 4XAKA 1RDDA 2D0OA 3FEXB 2FLNA 4QR0A 3CDWA 4IR9A 4OHXA 3WC2A 3RMCA 2FSKA 4AL7A 3NBPB 2P9UA 3CCUN 4CEAA 2V8VA 5IC4B 2YKPA 4U7UD 1S4FA 5ELZA 3OS1A 2ZH6A 3HPHA 1UJ6A 1FKPA 4CK1A 4Z4HA 4ZVFA 4FN5A 3DCAA 2GWKA 2PFUA 2KHCA 2UXBJ 4DUZJ 3N01A 3KFWX 2Q31A 3ZTSA 4YOWA 2PYJA 2Z56B 2FC8A 2Y0SD 3NGIA 2J8SA 1QSYA 1BQMB 1RAEB 1SJ4P 4CIOA 3ILLA 3MGJA 1VYAA 4CGJA 1LW2A 2A3ZA 4CBUA 3P83D 3CC2S 4DR4K 5LMNK 3IBWA 2IRUA 3I5AA 5FLXU 2E1CA 3R97A 5HBMA 4KB7A 1TKXB 1MWQA 1N5SA 2QMWA 4NYZA 5KG0A 4H5WA 2Z2LA 3BJYA 1S1WB 2P9PB 3TP2A 2XSJA 4GNIA 3SXLA 4URSA 3UE5A 2XNRA 4FLWA 3KTQA 2DPJA 2GV9A 5KOXA 2VOPA 1SKWA 1TL7A 3CCSN 4A2BA 1UVNA 1D9AA 1HKGA 3U6FA 5CQGA 4GY2B 4BS2A 4OMFG 2HHHJ 1H2VZ 4DQIA 2YKOA 2VQFK 3V1RA 1S0NA 3NXZA 2CPJA 1C4AA 2EWHA 3I31A 3M2UA 3KJNB 2PGCA 3HHLB 4IXCA 1FERA 2GTDA 2JFDA 3PFEA 4A4JA 3PW7A 3CYMA 3HSDA 3KVGA 2VQEJ 2ZC4A 1OS5A 4WFYA 4ITSA 5L46A 4A5BA 1WHXA 2DYAA 1S49A 4YUDA 4C11A 2W01A 3SJJA 1VQ9N 3UD5A 2A5XA 1GXLA 2O8BB 3AVGA 3A8EA 2FGCA 2Q43A 5KG6A 1K6YA 3WQTA 3TTCA 3KK2A 5CA5A 4MKAA 5KFHA 3SCJE 3V81B 4DHYA 3QJJA 1FD2A 1VQ9S 2OMOA 2C1EB 1NJZA 3LM9A 1NK6A 1M5PC 4HUEA 1Y4ZB 4Z4FA 4RNOA 1X8DA 5C2DA 2VBYA 3KJFB 3ID8A 4DCJB 1FJEB 3EL2A 2YNIB 1G7CB 2AA4A 4H4MA 5KFBA 1RKJA 1BHLA 5IT0A 3MM7B 3GV5B 1GEHA 5IV3A 2MJNA 4CI6A 5DZ7A 3SQ1A 3F56A 3C6UA 1XK8A 2OUGA 4CEFA 3V6DB 6FDRA 4IDKB 3JSMB 2OEJA 2J4RA 2XCPA 4JYAK 4DKWA 4K4WA 4FVMA 4WFAL 1RHMB 1H38A 2FVRA 5BN9A 2JH3A 1ZETA 5J2QB 1HWIA 3KKFA 1FK9A 2BANB 1FRIA 2H3GX 1IKWB 4I6WA 3CFRA 1VK3A 2P5OA 3Q89A 4HCBA 2E2NA 1U1NA 2GFFA 3IBFB 3FCWA 2DHGA 4IFVB 2E44A 4CNZA 3SV3A 3VGLA 1RE1B 2PEBA 2EC0A 1ITGA 2C3UA 1HNWK 5SWMA 2VICA 5JVGQ 2ZH5A 2D0CA 3CCRN 3O44A 5LSLA 2GX8A 4KC5A 3MMCB 3MR2A 3FQKA 3I4HX 2XI3A 4W5QA 2I1RA 3P1GA 1FJCA 3PX6A 2CGJA 4JNEA 4F36A 3PM9A 4DS4A 4Q8EA 1EP4B 1X4FA 2IFXA 1CLFA 2M88A 3KK3A 2VG7A 2ZH4A 2DGXA 2WCXA 1HYVA 2ZHBA 4L73A 3UKRB 4Y0FA 1HBMA 3ZNJ1 4CQ1A 4JI0K 2CQ1A 1NBEB 1DLOA 4YOXA 2YV0X 4JI3K 5ADXA 2ZGYA 1IM6A 5HRRA 2W42A 2IY5B 4CT8A 2DY4A 5T14A 4I4BA 3AO5A 2E20A 2MMYA 5FPEA 2W40A 1WD6A 3VGVA 4MO5A 2HHPA 1OH8A 4K4TA 2KG0A 2AQ4A 1U6FA 5B08A 3OVAA 3MAAA 3NF7A 2DY9A 4L76A 4CLZA 3HVAA 4DZDA 1IR1A 2E5IA 2G8FA 3TJ9A 3EJMA 1N33J 4JI8K 1XR5A 1H7WA 2RHSB 3CCMN 4ZLLA 2RF2B 4Q45A 3T1HK 4XK8C 2KHOA 2VZ9A 3MX5A 2AW0A 3UE2A 4MK7A 4JI4F 4HTJA 1WOPA 2I6WA 4OPAA 3KK2B 1GQEA 1C0UB 2RUGA 5EN1A 3ZCMA 1KR4A 5BR8F 5G4DA 1PBUA 5DS7A 4O5BA 3L7OA 3C2PA 2M9KA 3MF5A 1U02A 5AQLA 3CHWA 3BQ0A 5E33A 4WKRA 2A42A 1YHQN 4NXMJ 2UU9J 4DTXA 1YVFA 1H6KX 3GIMA 2HVIA 3ITHB 4FJMA 4OX6A 1QLNA 5B0AA 2ZD1A 1A5VA 1CEZA 3C6TA 1IG9A 1N4LA 5I3UA 3M2UB 1KQSM 2V94A 3NRBA 1G6BA 1RT3A 2E1AA 2DXDA 1NMDA 3RB0A 1NB2A 2W4PA 5FLXY 1DFDA 3U9DA 1C2PA 3VF0B 4JI3J 2PI5A 1YTUA 1HNWF 3NS5A 3TAQA 3A5LC 2BA9A 2YNGA 1TK8A 5L1KA 1IQZA 4AYBD 4CZFA 3HF5A 4MLEA 1VBKA 4M5DB 2AHOB 4MAKA 5ETTA 4M5LA 2ZD1B 4KKOA 4USHA 2IVOA 3P3DA 3D1OA 2MKYA 3VQQA 5GAGP 3D0GE 2PD1A 3DYAB 4TNOA 5DDOC 4KFBA 3S3MA 1K73O 3BREA 3CJKA 4CJ5A 1Q0NA 1RTDA 1HI0P 1ILYA 4RLEA 3U9ZA 1CJKB 3J81U 4BVOA 2DH7A 3HCXA 3MFHA 1VSMA 4PRFA 1DLOB 1I94J 3R6GB 1UW4A 3CD5A 2YX1A 2HVEA 2ZBPA 2JEJA 1RT3B 4OZJA 1OO0B 4TSXA 3D1QA 2VCPA 1EXQA 5HRPA 4DV2K 2BEFA 1ZBSA 4X64J 4OGCA 3ZLJA 3WXMB 1MWZA 2O4IA 2ZBQA 2B9WA 2Q0RA 4CW7B 2I2YA 1PJ6A 2V50A 1XTZA 4ECXA 3FR0A 3VQ8A 5BPLA 4MTPA 2CJ9A 1R59O 1C6VA 3T5KA 1L5UA 3I55S 3BGRB 5I42A 3H3OB 4HH1A 2BKOA 3QO9B 4NLQA 4DV7F 5KG4A 3NF8A 3CW2C 4CJRA 2QLXA 4W98A 2F7VA 5KPZA 1M1KO 2OGUA 4DTRA 4CTAA 2BYCA 4OI1A 4ED1A 1RILA 3MK6A 2OLWA 3RVCA 4DR1K 1XJWB 5T7BA 2QMXA 1MDUB 1RXOB 4GO7X 1ASVA 4P73A 4CJSA 1TV6A 3CD0A 5E3AA 3I0RB 1YJ9S 3LZJA 5HROB 3O6WA 3WEEA 4DV6K 1LOUA 2DEJA 4CEOA 4M3XA 5HP1A 3DLLL 4OI4A 4KI4A 4GKJJ 4MO4A 3OR2A 3CCMS 3WNHA 4H5RA 2BBEA 4USIA 4ECUA 3R7BB 1KLNA 4CBWA 3EXYA 1PGZA 2XYGB 1XI1A 1SL1A 2Q1LA 3MCMA 4JRQA 4B1WB 4Q0BB 4A8YA 1P8GA 3AY0A 2JDJA 4FK4A 3NH2A 4NZ0A 4CIEA 1IKXA 3THYA 3SNNA 3JQKA 3QINA 2XGPA 5J1PA 3J81j 1YRUA 2V63A 2HNZA 4DG1A 3EY1A 3IAS9 3OFHA 4C2MA 4FBUA 3VALA 5HMWA 2V34A 4ZCKA 4OKJA 4BR4A 2A6AA 2XEXA 1DQAA 3M6GA 2CQHA 2QA1A 1YITS 3PSFA 3VR1A 1ZAWA 2HQCA 4JK7A 2CQDA 4DSEA 1M90T 4GKKJ 1VRTB 5F8GA 2P9PA 5IQQA 4DL6A 4F02A 1VBZA 4AQYJ 5KFQA 3FZKA 4JI2K 1TL3A 1HNXJ 4BC7A 1W2BM 4ANDA 5M1OA 5KOWA 2GVDA 2W2NP 5AQQA 1UAXA 1NRKA 4EBCA 3AT1B 2GAGC 5F8LA 4WU3A 3SCLE 2MHNA 3O5TB 1IBLJ 1OY8A 1RCOB 3IRXB 2FPHX 3GSDA 4DQQA 3SCKE 2WB4A 1FKOB 3WXJA 5KRTA 3PXGa 2VC1A 1RT4B 4EP5A 4K4XA 1JLFB 4MDAA 1HYZA 3W64A 4KH6A 3IBCB 1U1LA 2ZHOA 5C24A 3BSAA 4IRKA 3VF4A 1FXDA 3HP9A 2YWKA 2MQOA 2R8KA 2UUTA 2J7UA 1HPMA 4X64K 3WQUA 2IM0A 1AUSL 4FJHA 3D2WA 3CFOA 2DIVA 3CQ8A 3HHKA 3QRQA 2GVZA 4FYXB 3KLFA 4FJ8A 3IG1B 4GW6A 3CC2N 3KIOA 4OX9J 4XDCA 1UPPA 4CZJA 4AFFA 3F73A 3QGHA 2QWPA 5HRNA 2DY1A 2R7QA 3AJ1A 2QTWA 4DL7A 1DTTA 4DL2A 2DTUA 4YOUA 2A3JA 3CJ8A 2IM1A 1UWBA 1FKAF 5AQWA 2CWXA 2LU2A 3P5JA 2GVZB 1R43A 3Q24A 1W2IA 2RAQA 4F67A 4KR0B 4M5GA 1LWEA 1HHSA 1SQEA 1HJRA 2EFNA 3RG6A 1LW0B 3ULHA 1EX4A 2QWNA 1IKYA 3SDEB 3JB9k 5CHCB 1JJ4A 1YWXA 1SH0A 3GE9A 5CZ2A 5AT1B 3NAEA 4JI1K 3H3NO 3LO3A 1BHNA 3MWBA 3J7AP 4MK9A 2FJBB 4USMA 1ZYQA 5BPNA 3J7AN 3HD2A 3IC1A 3MPDA 5HL7Q 4KH1B 4F4WA 2CRLA 4DFMA 4CJVA 3AODA 1WF2A 5CZ1A 1VJWA 3CPEA 3M6UA 2K3IA 1HR0F 4X64F 4OYOA 4IOAL 4NLDA 3GYNA 3M30B 1Q7YT 3BSCA 4CJKA 4HHJA 2O8CB 4OIXA 3MN7A 3TVYA 1VC6A 2FZCB 3PRVA 4MLHA 2FJEB 3PACA 4RX6A 2OPSA 4TU9A 2OPPB 2P9SA 4B3RF 2DXEA 5DDPC 2HW3A 3FK4A 3MMAA 5LMUK 4NZ7A 3CC7N 1NUEA 1BQMA 5D0EA 2QMUB 4WCEL 1SH3A 4E7IA 2E9ZA 2P9IB 1TU0B 3V9ZA 3S7RA 3TW0A 3PJ9A 4BLGA 3KHGA 1RABB 4XDDA 2G2ZA 3PLAA 3K2YA 3UD4P 5IQ6A 4FJ7A 1HKBA 3DGVA 3HPGA 1AZSB 1FA0A 3PVXA 1FXLA 1RTZA 4FPAA 4PXEA 4NMXA 1VSKA 4IWVA 1JIHA 2ZH3A 1Z25A 2HMIB 1WHVA 4LF5F 3TZWA 4JYAF 1XMOK 4DTOA 4NA1A 3A5OC 2HZCA 2BM1A 1DAXA 3THWA 3WEEB 4K4YA 3L2QA 2CIMA 4M5MA 4J90A 4FWKA 3H1VX 4EWTA 2DFFA 2Z2YB 2JWKA 4EO6A 1K8KB 3CB4A 3K5PA 2NS1B 4KRFA 4PHTX 1WC6A 3LH2S 1MG7A 1NK0A 3DJCA 4KHYA 4WYBA 3TO8A 2DR8A 4OZ3A 2PE8A 3KXDA 4WJBA 2IPOB 4HT7A 4CLSA 2RS8A 2RDJA 4LF8F 1EZZB 1N52B 3M30A 3W1YC 2ZWOA 7FD1A 1U8WA 4LC9B 2G13A 1Q5YA 4JI8F 1Z26A 2YWWA 4ZPAA 4ECRA 1RWXB 3UN5A 1ZPVA 2CQ4A 3BZKA 2F5GA 2ABYA 4O8UA 1R31A 1S72S 2J9CA 5DG9A 2R7RA 4OHYA 3S8SA 4FKXA 4AQYF 3Q2TC 3TR8A 1VDHA 3TZYA 5AQVA 1QD1A 3RB3A 2Y8YA 1GLDG 3T6JA 2QGFB 4J9QA 3D5MA 1IVZA 2Q2RA 3QJPA 2V8HA 4TVAB 2WOMB 1UFLA 2ZH9A 1F6TA 3RWUA 3QT7A 2D74B 5H9EJ 2PMZD 5IWAF 4WZMA 3C6TB 1MNEA 5AZJA 3VA0A 1H98A 3S01A 4PWDA 3MCAB 1ZM3A 1VQMS 4B3TJ 2K7KA 3KMSA 4CYUA 2RU9A 4CGFA 5HP1B 1VAZA 1B92A 5KT2A 4DX8H 2QO3A 2O8DA 1QVGR 3CXCM 3ZSZA 1JLCA 2UP1A 4JI3F 4I6MA 4UW2A 5J1NA 5B7WA 1UA0A 1H3DA 2MKSA 4EFHA 2UYTA 1HNVB 2Z1IA 3W9IA 3BPDA 3MR3A 2BUNA 3OYJA 1TYQA 2C3OA 4AM7A 1KC8O 3CJ3A 2P9SB 2HFSA 2RHQB 1SI9A 4LF4F 1RYSA 5KFGA 4DTSA 1NHKL 1JLQB 3P5TL 4TY8A 1WC0A 1BWEA 2OPRB 4CH1A 3SQ2A 2V2VA 2P6SA 1YJVA 3CJ5A 1Y5NB 1KTVA 3K9KA 2B9YA 2QXFA 4ZP6A 3W66A 4X62J 1NGGA 4E1JA 3LP1A 2W24A 2L9WA 2YI1A 1EWQA 2MY8A 3MUVP 2O8FA 1KVBA 4E1NA 4CHQA 2H51B 2LDYA 1RT7A 3O1BA 3OYLA 4Y1CA 3E66A 2W4CA 1IBLK 2QA4N 2G2YA 3CF5L 1J5OA 4ECVA 4XH1A 2XMAA 5J2PB 3FE1A 3J7YU 3SAGA 2KB2A 5KFNA 4CGGA 3QRRA 2F9DA 1N34F 1URRA 2FHOB 2NYHA 3OTOK 1IBCB 1NCLA 3MXJA 3SMSA 1VSLA 3P8BB 4IRDA 5C42B 3A1YG 1JQGA 4J9KA 3FMBA 1LWCA 3OJSA 3PNIA 5D6GA 4OYIA 4MIWA 2R2RA 1NSQA 3VF6A 1PJ5A 1P9YA 2WK4A 2WW8A 2XMUA 3U1MA 4RWTA 5M1NA 4FNIA 5JVHL 3G6XA 2UXCJ 3DXKA 3CCTA 2NUHA 3GFZA 3TZXA 1NK8A 3NLCA 3HFVA 1IKVB 4RBTA 5E26A 3ZX0A 4ZN3A 2GGPB 3IUCA 3D67A 1N8RT 5JLFA 4QS9A 4OV6A 1A0OB 4DV6F 2EC2A 1TGOA 2QM1A 2FUG9 3SSRA 3ZZOA 4B1VA 4B08A 1R0CB 4NWBA 1PJ7A 4RCHA 2VPWB 4ZOSA 2NZCA 3QATA 2GJFA 2EBGA 4DR4J 4OLOA 3GBTA 5JMNA 3M2RA 3QGIA 2MZRA 2CZVC 3GR1A 1T8EA 4A62A 2DGOA 3K5MA 4ZDNA 2MLZA 2KJWA 3W62A 2XS7A 2I38A 5DLGA 1FHTA 3GPAA 3A0IX 2HBJA 3PIOQ 2NCKL 5T7LB 4FWOA 3LPTA 1K8AT 3BEGB 4NA3A 4DPUA 3J81Y 3E3XA 2B4UA 3C3LA 4RWXA 2P51A 3HRGA 4PUOA 3KKRA 3AQOA 3UDCA 1ATRA 3DRRA 1T3VA 2RF2A 1FE0A 2JSXA 2CGKA 2QV6A 5E2QA 3KLGA 1VC0A 5HROA 1H0HB 1YVUA 4CJ4A 3RBDA 4BRAA 3T1YK 4A47A 1N54B 1O1WA 4Z7YA 4R25A 3SFUA 2E7XA 4BRDA 3LGMA 3MCPA 3NG8A 4JN4A 1CJKA 2R7VA 2XNQA 4CESA 1WEXA 3G25A 2KM8B 3MMVA 4X2BA 4G9ZA 4L6V3 5IS2A 1U1PA 3OBWA 5C15A 2B4PA 4BC5A 3O1LA 1T9YA 2CZ9A 3RJMB 1BG3A 3TX8A 2P9KB 3S41A 3R5DA 1NPPA 1KOHA 2FBVA 1RBVA 1X5PA 2XWXA 1W97L 2DCUB 1TR0A 4IOBA 4CEQA 1HYSB 3HLUA 4DEZA 4DU3A 1XC3A 5LMNF 3DOLB 1VHIA 1OY6A 1QUVA 1VHFA 1HYSA 1QQCA 4IKFA 3F9KA 4YR3A 4ZIWA 3K17A 4BE2A 4IYQA 2UV8A 4LT6A 4F4ZA 5D3GA 4ED5A 4E19A 1ZBTA 2YWEA 1I5OB 4J9VA 3ULEA 1RHJB 3FZFA 2DO0A 2DNYA 2BOPA 4X4QA 2O01C 3JSYA 4WCEQ 5LMNJ 4IFYB 2BH1A 3VEOA 2RKIB 2MKCA 2PEHA 3GU0A 2VWBA 1UEKA 5KT4A 2XMMA 1NXIA 3BQ1A 4FJ5A 2D7SA 2J9EA 2ILYA 4AL5A 4DV0K 1NGAA 1CS4B 4MKYA 3OHAA 2B3TB 1EJ7L 7