1HQUA

Human immunodeficiency virus type 1
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords POL POLYPROTEIN
publication title The Lys103Asn mutation of HIV-1 RT: a novel mechanism of drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 125
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hquA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hquA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hquA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hquA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hquA05
3AO1A 3GQCA 1QAIA 4O3SA 2Z1GA 3BQ1A 1NK5A 3IS9B 3BSOA 2R8HA 4WFZA 4ZVEA 2W9BB 1F21A 4IKFA 4KSEB 3I8DA 5I42A 3OSNA 2ASLA 1C1BB 1TP7A 4DTSA 4W5RA 2CKWA 1KSPA 4ED2A 3HJFA 4QAGA 3PO5A 2AGOA 4J2EA 4DFMA 4QOZB 1JLFB 3KHHA 3VQ7A 3M8SA 1YVUA 3V9UA 1X1PA 4AHSA 3ITHA 2IJFA 5JS1A 4I2QA 3ZSWA 1TKXB 3DLRA 3UIQA 4ZP7A 5CYQA 1J5OB 4IFYB 3QGGA 2HWHA 3O4QA 1U49A 3VQBA 2XGQA 3M8QA 4RW4B 4CJTA 2ZKUA 2WOMB 2ILYA 5KT7A 5J2NB 4AHRA 3DRSA 1MU2A 2V4QA 3OYDA 1FK9B 4URGA 3VQ9A 1FKOA 2AQ4A 3SUOA 3HM9A 4FJXA 5F8LA 3H4DA 4CECA 3CDUA 4CJWA 2BRKA 4DFJA 2ITGA 2VWKA 3MAQA 4CK2A 4Q0BB 3OJSA 1ZBHA 3AVGA 4O4GA 3PW5A 1ZBUA 3QO9B 3UR0A 2X6NA 3NMAA 1TL1B 2QK9A 3SZ2A 2OPQA 4IR1A 3ZT4A 4ECSA 4R5PB 3V81B 1N56A 3AVCA 3PJXA 4DSEA 4NYNA 1D8YA 3PR5B 3GV7B 3E01A 3SJJA 1C0UB 1DLOB 1JLAA 4WYWA 3L2RA 2QV6A 4O0IA 4Y1CA 1UWBB 3I0SA 3CM5A 2YNGB 1JLBA 2UVVA 4FM1A 3HL8A 3L3UA 3SQ4A 3OY9A 3NAIA 3QGIA 3MEGA 4TYAA 1DTQA 2OPPA 1NK9A 3ISNC 4IR9A 1ZTTA 4MK9A 2UVWA 3QNNA 2WHOA 3Q8PB 3GV8B 4CHPA 1TV6B 4GW6A 1RA6A 4F3TA 4OVLA 4O44A 1R0AB 4CFDA 2PYJA 2XY5A 1NKEA 1EP4B 4KKOA 3KLFA 3QEWA 4HCBA 3V4IB 4Z4GA 4Y2AA 5KG7A 3L2VA 4YMEA 2B43A 4ZMMA 4LSNA 2W42A 3AA2A 1ASWA 3M9NB 3T5LA 1S1UA 3GYNA 4FLVA 3QGHA 1XHZA 5F8GA 4NLDA 4RW8A 3OYKA 1REVB 2HMIB 1HJRA 5J1EB 1TAUA 3CM6A 4B3OA 2FBTA 4O3QA 3TARA 1IO2A 3IGNA 1S6PA 5SZTA 3CQ8A 4B9UA 3HXMA 1VRUB 3U3YA 2FJXA 4J9QA 4LD0A 3K59A 4DTXA 5KFVA 1B9DA 1X9SA 5KG2A 3Q8QB 4KHMA 5D3GB 3RB0A 3KLVA 4N5SA 4F4WA 4E7HA 5HRPA 1LWEA 4KO0B 4YNQA 3ASMA 3AVMA 4FJJA 4C8LA 4CK1A 2WCXA 1RDBA 1S0OA 2R7YA 4CHNA 1IM4A 2YNFB 4JV0A 3KK2B 3TAEA 1Y97A 1JKHA 4Q45A 3BSCA 2W9CB 4QWCA 2DPJA 4K4ZA 3FSIA 2WK4A 1A5WA 2BANB 1L3VA 4FLUA 2OPSA 1TK5A 1BCMA 2VG7A 3KNAA 4XO0A 3ULDA 3RRHA 4Q8FA 1BIUA 4L8RB 3IRXA 4KHNA 5EWFA 3MR3A 2ETJA 1W9HA 4PQUB 1LWFA 1S6QA 3VQDA 2B5JA 4IG0B 4BACA 3FFIB 1ASVA 3ICLA 1HQUA 3DLGA 4XIUA 3CWJA 5KG4A 4DQRA 2GUIA 4N47A 1KHWA 3OYFA 3KLEA 4IDKB 5HLFB 1NKCA 1S49A 5I3UA 2BGGA 4IG3A 1GX6A 1WSEA 1BIZA 3H5UA 2R2SA 1LAWA 4DU1A 4EZ6A 4NCBA 1I6JA 4KFBB 4ECUA 2XY8A 4URQU 2D5RA 3VQ4A 1U4BA 1YTAA 2EC0A 3SFGA 3NF9A 4PWDB 2GIQA 3M8PB 4DSLA 4IKAA 4E89A 3BREA 3MEDB 4FZZA 5CZ2A 2X6SA 3TQ1A 1JXLA 1X9MA 1HMVA 1D5AA 3EZ5A 1TGOA 4MK8A 4DFKA 1KVCA 1S0MA 2R8JA 4J2DA 1TKTB 3NL0A 2A1RA 1NK8A 1NK7A 3ZT1A 1IKYB 5HBMB 3CDEA 4M3RA 2CJQA 4J9LA 3KK3A 3V6DB 3LP2B 4LSLB 4ZP6A 4R8UB 2BE2B 4QW8A 3HP6A 4CGJA 4H4OA 4CERA 1J9AA 4RNMA 4KV8B 3LZIA 5DQGA 4RG8A 1XR7A 3LDSA 4CHOA 2YV0X 5KFQA 4BE0A 4FJ9A 1JL2A 5J2MA 4CJEA 4QWAA 1Z25A 4OGEA 4W5QA 4ELVA 1RT5A 4TLRA 5L1KA 5DG7A 4Z4IA 2OZSA 3UDLA 4URSA 1XI1A 2JEJA 5F9NA 1HYVA 1NNDA 1WAJA 2E9TA 3OYGA 1S1VB 1LW0B 4CEDA 3NGZA 4WXWA 1RT6B 3ZT0A 4HTUA 4M3XA 3SI8A 4FJHA 4BE1A 4F4KA 1S9EB 5EWGA 2FC0A 3LP0B 3RMBA 3SNNA 2Z1HA 4KTZA 1CZBA 3CJ3A 3NAEA 3DLHA 2ZE2B 1IKWB 3G0ZA 3NFAA 2KW4A 1RBSA 1UOCA 1RT2A 3NBPA 4CGIA 2D3UA 3OJUA 3C6UB 1RTIB 4KB7A 3KOAA 4DTRA 3HVRA 4O4RA 3PX0A 4TY8A 3HYFA 3T5KA 5T7BA 4ZTFA 4IH6A 4M3WA 4JRQA 2XI3A 4DQQA 2JEIA 2ASDA 4B9LA 2BQRA 4ECZA 4TY9A 1NKBA 2E4LA 3GILA 5C25A 3T5HA 5L1LA 3NE6A 5KT5A 3OL9A 2HNDA 4O0JA 4NLVA 2BR0A 5KFOA 4AH9A 2P5OA 4FJ7A 4ID5A 2XGPA 4E19A 3H08A 5KFCA 4W5OA 2J6UA 1FXXA 4CEAA 4HYKA 3UQSA 1NJWA 2KFNA 2I5JA 1RT3A 4RNNA 4GVMA 3M8QB 4YP3A 2ALZA 1CSJA 3D0PA 3S9HA 1RBVA 1JLQA 4G3IA 2DFEA 3L3VA 3DRSB 1MU2B 4Z4FA 3MR5A 4ZTJA 4CEOA 3QIDA 2JLEA 4CJQA 4O55A 4M3ZA 3V9WA 1FKOB 5KG0A 4KTQA 3QINA 1VSDA 5K14A 4G1QA 4CHYA 4CF1A 3OL7A 4NZ0A 1YTUA 3MF5A 2XI2A 2F96A 4K8ZA 3VQSA 1NHVA 3ZT3A 2RF2A 1T05A 1J53A 5KG1A 4NLOA 4LH5A 3HT3A 2KTQA 4ZPCA 3AO4A 4F3OA 1B92A 1RAJA 1QAJA 4KHYA 3GV5B 4OPKA 3Q8RB 2WONB 3GIIA 2QKBA 3VQEA 3E01B 1RA7A 3QZ7A 3ZSVA 1JLAB 1TVRA 5CYMA 2VA2A 1JLEA 4J9OA 4MIBA 4WE1A 1RTDA 1JLGA 2GV9A 4IRCA 3DMJB 1DTQB 4ICLB 1ZBLA 4CGFA 1RBTA 1UA1A 3KMSA 2IGIA 5HRSA 3VA0A 1YT3A 1ASUA 4FXDA 4ZPBA 3OHBA 4AHVA 2NUBA 1LW2A 4DTJA 3S3MA 3LPUA 3DLEB 4FJKA 2IM3A 3G6VA 3SYZA 2F8EX 4N76A 3H40A 3BQ0A 1S0NA 4GC7A 2VG5A 4ECRA 3M9MB 4NRTA 3DRRB 3G6YA 2YKMB 1FKPA 4DMNA 1TAQA 3KLIA 3PW0A 3KLGA 4QWDA 4EO6A 4CHQA 3DOLA 4LSNB 5C24A 5HROB 1L5UA 3AVBA 1HNVA 4EBCA 3IG1A 4O3NA 1TKZA 2ZQBA 4H54A 1S1UB 2ATQA 5J2QA 4HVJA 4RW8B 4KHRA 5L1JA 4F8RA 2B6AB 3BSAA 3PX4A 4WYLA 2P5GA 1NOZA 1KLMA 2IAJB 4YR2A 3AA3A 3PO4A 1SH2A 1G15A 1WAFA 3P1GA 4B9MA 1S6PB 5C42A 2PY5A 2KFZA 5FDLB 4RW7A 4KB0A 4DTUA 2DTUA 3UPFA 2I1RA 1RT4B 3AO5A 2XCAA 3B6PA 3DI6B 1VSLA 4RW9B 1RDCA 1LWEB 4IBNA 2VA3A 3DYAA 1Q9YA 3QEVA 2FBYA 3AO2A 1KRPA 3C94A 4DSIA 5EUHA 2IM2A 2LSNA 4CJPA 5KFFA 3AA4A 3OSPA 4DL5A 5HP1B 4N41A 1HQEA 1VRTB 3LP1A 4FM2A 1JKHB 4XPEA 1QUVA 4NLPA 3RMCA 4OPJA 3GIJA 1YVFA 3PZPA 3FDSA 2OPSB 4OJRA 2JEGA 2RKIA 3I0RA 1KTQA 2VG7B 4J9MA 4OGCA 2OH2A 3OYAA 3IRXB 3BSNA 4FJNA 3PUFA 3F73A 3C95A 1S6QB 2IOCA 1RT7A 3T1AA 4WZMA 1RBRA 2QXFA 3ZSQA 1KLNA 3RB4A 2D0BA 4JV2A 1GOCA 4U6PA 3DLGB 2D7SA 1DTTA 4CJVA 3KLEB 5KGWA 4IH5A 3M8RA 4H4MA 3MECA 1QE1A 2YNIA 4CGDA 2IM1A 2FLLA 1VSFA 1O1WA 1C0TA 4DL4A 1D9DA 4MK7A 4BWJA 1RTJA 4IRDA 4N56A 2C2DA 2AJQA 1IKXB 4CJLA 3TANA 1D9FA 1KFDA 1S9GA 3AVLA 3TAMB 4BWMA 3DRPB 1D1UA 5KT3A 1BQMA 4RZRA 1Q9XA 4DF4A 1WLJA 1Q8IA 4LQ9A 4M45A 3N6MA 2VG6B 5KFHA 4F4ZA 1CLQA 2XWYA 1BCOA 5F9LA 3QERA 3ZT2A 5L1IA 3HSTB 4DU4A 2G8FA 5F8IA 2BQUA 1N5YA 1BGXT 2YKNA 2QE5A 2XY7A 4QPXA 5F8JA 3B6OA 1C1BA 3VQQA 3SV3A 5EWEA 2DFHA 1JX4A 1L3TA 3H5YA 4CGGA 3OL6A 4W5NA 2VWJA 3BQ2A 3QZ8A 1T03B 4Y1DA 1RTHB 3KK3B 4OL8A 3OHAA 4H4OB 3QIPA 1EXQA 3NAHA 5F8MA 2RN2A 4NLUA 4ED0A 1S1TA 4B9SA 3LPTA 2KQ2A 4HUFA 2G8VA 3S3NA 3HKWA 3CVKA 4NLRA 1D0EA 3V1OA 5J2MB 4ZHRA 4IFYA 3RR7A 4NLXA 3H59A 4BDYA 4FK2A 3KJVB 4C8KA 3DOKA 1JXEA 5KFSA 2HHTA 4ED7A 4GC6A 3QLHB 1SKRA 3NCIA 4NYFA 3HP9A 3CG7A 3SQ0A 4M3TA 2D41A 1VK0A 4J9KA 2FLPA 4PUOB 1WNEA 2YNHA 3SQ1A 2PZSA 4Q0BA 4RU9A 1S1WB 3SV4A 2UVRA 3EY1A 1NJZA 5KTQA 3QO9A 4B8AB 3KHGA 3VQ8A 3MXIA 1TL1A 1HPZB 2A1SA 3CJ5A 4KAZA 4EYIB 1U04A 3AO3A 3RWUA 3K57A 3PY8A 3AVJA 1T8EA 5KFLA 5KFGA 5KRSA 3LALA 4DTNA 3NGDA 4W5TA 4ZPAA 2F8SA 1SUQA 4MKAA 3PW7A 4FJLA 1UWBA 1S48A 4IFVA 3KKRA 1SKSA 4I2PA 1L3SA 3JSMB 4IRKA 1XWLA 1RNHA 2HNZA 1CXUA 4CIFA 4E7KA 3SQ2A 2W7OA 3K5NA 1TL3A 1A5XA 1C1CB 2HNDB 3K58A 4NLTA 3OS1A 1JLCA 4DTPA 3DLBA 3TAFA 3NF8A 3VQ6A 4I7FB 4ID5B 1BL3A 2FVSA 1Z4UA 4FLYA 4ZPDA 2UUTA 4LY7A 2IA6A 1EP4A 4FK0A 4CJ4A 3U3GA 5HRRA 4DG1A 3TAQA 3F9KA 2KZZA 2WRMA 2XRIA 4NCGB 4RUAA 3SFUA 3RB6A 3NF6A 4RUCA 2O5DA 2OPRB 4J9SA 3NDKA 2XCPA 2IMWP 1RT1B 4XPCA 4B9TA 3D45A 3MR2A 1TKDA 2JGUA 4DTOA 4CIGA 1N6QB 4K4TA 1WSIA 2HMIA 4AHCA 4F2SA 4CEEA 5J1EA 2DY4A 4CEQA 5K14B 4G1QB 1VSMA 2DFFA 4JLHA 2RDIA 3EPGA 2Z1JA 5KFNA 5KFIA 4BDZA 3WNHA 5KFWA 5FRNA 2RF2B 3V9XA 1T05B 4Q5VA 4KB1A 3O3GA 3K5LA 2Z1IA 1EETB 3DM2A 5D3GA 3MEEA 3MXMA 3OLAA 4KHWA 4E7LA 5KFDA 2IC3B 1NJYA 1N4LA 1TVRB 4KO0A 4KI6A 4FW2A 5CYMB 4CEBA 4B08A 4DL2A 1JLEB 3ZSXA 1RTDB 2FJVA 1ITGA 2WTFA 1S1XA 3PW4A 2IJNA 2W9CA 3BGRB 1NHUA 1RYRA 5FROA 2BANA 2R2TA 4M3UA 3CJ4A 3KIOA 4C8OA 2JC0A 1LW2B 5KFKA 3CFRA 3MXJA 3RMAA 2BDPA 5KFYA 4J9NA 5I42B 5KGXA 4ECYA 4PQUA 4KE5A 1JXBA 1FKPB 3PHEA 4IG0A 5F8HA 4NRUA 5DG9A 1XR6A 3DOLB 5DMRA 5C24B 4DS4A 4JUZA 2AGPA 2OZMA 4CIEA 3HVWA 3IG1B 4IDKA 2HHXA 4C8MA 3OS2A 3T5JA 1OS5A 3K2PA 1HYSA 4FZYA 3ITHB 4KFBA 1VSEA 4I2QB 4FYDA 2P51A 3P5JA 1RCHA 2AGQA 5CYQB 4FBTA 3CIZA 1KLMB 4DLGA 3PV8A 2HW3A 4M42A 4LH4A 3M8PA 1WN7A 4DL6A 1RYSA 5C42B 4ED3A 3HVAA 4RW7B 4NLGA 3SUQA 4FJ5A 4HCCA 4KHSA 2UUWA 3IAYA 2FJWA 4DL7A 4ECWA 4CJ5A 4CJFA 4CK3A 3JYTA 4DSFA 3G86A 4OLAA 1TKTA 5DGAA 3K5OA 4OKJA 1XC9A 3HO1A 4MFBA 1IKYA 4ECTA 4E1NA 3HPOA 3DYAB 3FQLA 3QYYA 2FLNA 3V6DA 3LP2A 4LSLA 2E9ZA 4K4UA 4NLSA 4FLTA 1NK4A 4O4GB 5DG8A 2GBZA 2IM0A 4HKQA 3V1RA 2HHSA 2G8WA 2OPQB 4HHTA 4CF2A 4M94A 4HUGA 1UAXA 4K4YA 2G8HA 5KFAA 2RKIB 3I0RB 4Q8EA 5KFXA 4KBIA 4FBUA 4K4WA 2FVCA 1K1QA 3H5SA 5DGBA 1IKVA 3I0SB 3O3FA 4J2AA 1KVBA 1JLBB 2R8GA 1RT7B 3V6JA 1S9FA 1S5JA 4CF8A 1LW0A 1BQNA 3KK1A 3TVKA 2AX1A 3MEGB 3HK2A 2OPPB 4MH8A 1DTTB 4H8KA 5KI6A 4CEFA 1S9EA 3MECB 2YNIB 1RDRA 5KFBA 4MQ3A 4QW9A 1T7PA 3OYEA 4O44B 1C0TB 4FW1A 1QSLA 2BQ3A 4E0DA 1WSGA 4TQRA 1T3NA 4DFPA 3CDWA 1NK6A 4RNOA 2IDOA 5C5JA 3TAPA 3H2LA 1QSYA 5KFTA 3ISND 1KHVA 4KKOB 3KLFB 5KG3A 1BI4A 3C6UA 1SL1A 3OVNA 3KD5E 4ECQA 1BQMB 2E9RX 1C6VA 3THVA 3O3HA 4WXOA 4RNHA 5KFRA 4AILC 5KT2A 2E6MA 3KHRA 1LWCA 4FJMA 4TSXA 4J9PA 4YQWA 3LAMA 4PY5A 1N5YB 4QCLA 2YKNB 4KI4A 4DSJA 3PW2A 4CCHA 3IN5A 1B9FA 3RTVA 4B3OB 4ECXA 3V6HA 2P1JA 1K1SA 1IH7A 1W25A 3BJYA 3TR8A 1ZETA 1SV5A 3QIPB 1RBUA 3KKSA 2Q3SA 4Z4EA 4U7CA 1HNIA 4Z4HA 4ZVGA 3L2UA 1S1TB 1WSFA 1I3AA 3QEPA 2R2UA 5KFMA 2JC1A 5KFPA 4I9QA 4ZHRB 5JS2A 4EEYA 1BISA 4E7IA 4BE2A 3VQPA 4JRPA 4FK4A 3DOKB 3DLKA 1ZBFA 2OA8A 3OYMA 3WNEA 1X9WA 4KPYA 4DF8A 3SUNA 4ID1A 3M9OB 4DWIA 4K4XA 3CJ2A 2W9AA 1ZYQA 3MTKA 3RBDA 4E1MA 1K6YA 3EYZA 3C6TA 2HNYA 5DK5A 2JEFA 2X74A 4FS1A 5KT4A 2YNHB 3HPGA 3TWHA 1GOBA 1J54A 2G8KA 2XO7A 2QKKA 2R8IA 5J2PA 2FBVA 4FJ8A 4FS2A 1LWFB 3NGYA 5KFJA 4AHTA 5KT6A 2B5JB 4ZP8A 1WSHA 4O5BA 1JIHA 2WONA 4FM0A 1HQUB 3GIMA 4EP5A 3V6KA 2XC9A 1SUQB 4UQGA 3U6FA 4MIAA 3O4NA 4FLWA 2HAIA 5I3UB 4CJ3A 3KLHA 2ZD1A 4F4XA 4IG3B 4Y34A 4IFVB 3FRZA 1CZ9A 2GIRA 4EBEA 4HUEA 3HVTA 4I2PB 1EX4A 3DMJA 4ED1A 2HNZB 3RAQA 4ICLA 4RW6A 2IS3A 4BDPA 3KMQA 1C2PA 4O3PA 1TL3B 3OLBA 1C0MA 2YHBA 3KD1E 1JLCB 4Z4CA 4ED6A 3DLEA 1SKWA 3IS9A 2BRLA 1LV5A 4ELUA 4B8CA 1HMVB 2W9BA 1SL2A 1HARA 3T3FA 4M95A 4O3OA 5FRMA 3DRRA 2YKMA 4DG1B 4ZVFA 5HRNA 3L8BA 3RMDA 1BHLA 3P83D 5HROA 2V4RA 1S97A 3N6LA 3ZSZA 5F8NA 3SPZA 3EPIA 1JLFA 2FVRA 2AU0A 3SUPA 1VSKA 2HHQA 3VN5A 4KRFA 4NLYA 4GMJB 2B6AA 1WSJA 3NH2A 1TKXA 4Z0UA 1VSHA 4F50A 5JXSA 4B9VA 1J5OA 2IAJA 4QWBA 4YR0A 4DLEA 4J2BA 4KTWA 3ZSRA 1RT5B 4RW4A 5FDLA 5KFUA 1QS4A 4Y2CA 5EDWA 2WOMA 3MR6A 4K8XA 5DQHA 2V9WA 5J2NA 5T14A 2B4JA 4JS4A 4DTMA 2Y1JA 2EX3A 3DM2B 4JV1A 2HHVA 3NH0A 3MEEB 1RT4A 4K50A 1FK9A 2XHBA 3AVIA 3I5AA 3DI6A 1HRHA 4RW9A 4PA1A 1VSIA 4CESA 4NLWA 5DLFA 4CF0A 2R8KA 4DL3A 3NH1A 2C28A 3N6NA 3I5CA 5CY4A 3PJWA 2XY6A 5HP1A 1VRTA 3V9ZA 1S1XB 3TAGA 3OYCA 3OYHA 3QEIA 1RT2B 4FJIA 3NBPB 2W7PA 4CFBA 4R5PA 3CFOA 1KFSA 3V81A 2G8UA 4TY8B 1SL0A 1C0UA 1LAVA 1DLOA 3OYLA 4F2RA 1S4FA 2ILZA 3OS0A 3D28A 3EZUA 5CZ1A 4EZ9A 3OL8A 2YNGA 3CO9A 2D3ZA 4C8NA 2F8TA 3QIOA 4DSKA 2RPIA 1RDAA 1U09A 1TK8A 3AVNA 4FLZA 5C25B 1QSSA 3V1QA 1L3UA 2OYQA 3LWLA 3RB3A 4IQXA 5EU7A 4F4YA 2HB5A 4OKEA 1TV6A 4IH7A 3LAKA 1R0AA 1HYSB 3Q8SB 2PYLA 1NK0A 1IKXA 4J9RA 2ASJA 5KFEA 4YR3A 4KHQA 4M41A 3V4IA 3TAMA 4ZP9A 3DDKA 4EO8A 3DRPA 2FBXA 3LWMA 1N48A 2Y1IA 2I5JB 1RT3B 1UA0A 5KRTA 3RBEA 2GC8A 2WB4A 2VG6A 1VSJA 5KG6A 1JLQB 3VQCA 2O4GA 3VQ5A 4Y3CA 1REVA 3JYTB 1KCFA 3QEXA 2KZMA 4MFBB 2O4IA 2R2RA 4WFYA 4IOBA 1T03A 3BDPA 1MMLA 1RTHA 4DQIA 3KHLA 4E7JA 3OYIA 4JS5A 4TQSA 2HVIA 1EKEA 1T94A 1ZTWA 2E6LA 1VRUA 1NOYA 1CXQA 4ELTA 4CEZA 3NKYA 4R0EA 1GX5A 1QHTA 3SI6A 3QNOA 1RDDA 2HWIA 4EYHB 1SH0A 3KJVA 5DQIA 3AVAA 3K5MA 1IKVB 3QLHA 5KFZA 4WE1B 4O3RA 1JLGB 2FVPA 3TI0A 3AVHA 4KAIA 1TQLA 1NJXA 2YNFA 3KK2A 4QWEA 3CJ0A 3KK1B 1BQNB 1GOAA 1XHXA 3QETA 4ED8A 2IBKA 4FJGA 4DQSA 2V0NA 1TK0A 4M3YA 4TN2A 3RR8A 3L2WA 4E3SA 4CFAA 4KHUA 4PUOA 3BR9A 1S1WA 3NF7A 1S10A 3LZJA 2FVQA 1W0HA 4NLQA 1HPZA 1C1AA 2X78A 4I9LA 3WNFA 4OKKA 3ALYA 3G10A 3PVXA 2VG5B 4CGHA 3V9SA 1BI4B 4WFXA 3KLIB 3FFIA 4YFUA 3KLGB 2HVHA 3L2QA 5E41A 3OYBA 4Q43A 2C2RA 1HNVB 4NCAA 3S3OA 4FCYA 3PR4A 1TKZB 1LWCB 5HLFA 3IGVA 2UVUA 3OYNA 5J2QB 1QQCA 3H4BA 3TABA 2J6TA 1KVAA 4TYBA 4ZVHA 3I5BA 2D0AA 3JSMA 3LP3A 2YHAA 3SPYA 4WZQA 1XR5A 5JUMA 4KREA 2AX0A 1C1CA 4Q44A 4PWDA 2EHGA 1SV5B 2C2EA 1HNIB 1I39A 4CE9A 3MEDA 4I7FA 4FZXC 3MFIA 1U45A 3A2FA 4OLBA 1IG9A 3HHKA 2RDJA 3ZSYA 2D0CA 3H5XA 3GIKA 3KTQA 4FVMA 4CHZA 2DPIA 3NGIA 4NCGA 4NYZA 3OYJA 1U48A 3DLKB 5HBMA 2OPRA 4K4VA 3FQKA 4AHUA 3NHGA 1RT1A 1WNSA 4R8UA 2BE2A 4MKBA 1QTMA 4B9NA 4ECVA 1N6QA 3LANA 3CFPA 4KV8A 3MFHA 1HQEB 1A5VA 3LP1B 3D5MA 3C6TB 2HNYB 2J6SA 3QESA 3E51A 3CYMA 4LQ3A 3ZSOA 1Z26A 1U47A 3SCXA 4EP4A 3VA3A 2W8KA 5J2PB 5L9XA 4EBDA 4FLXA 3AA5X 3RAXA 3PX6A 1EETA 4RNFA 5SWMA 2HHWA 1S1VA 2G8IA 4CJUA 1ZBIA 4CF9A 2AWZA 2ATLA 5DLGA 1RT6A 3WNGA 3ZCMA 3AVKA 4K4SA 3AV9A 4CJKA 2IC3A 2HHUA 1JL1A 4CJSA 4DS5A 4H4MB 4DU3A 3LP0A 1QE1B 3KLHB 2ZD1B 2W8LA 4CJRA 3AVFA 3HVTB 3RRGA 1SH3A 1RTJB 4TXSA 2ZE2A 1RILA 1IKWA 4DEZA 3HPHA 2C22A 5KG5A 4X2BA 4RW6B 1HYZA 3T19A 3BGRA 3VQAA 1S9GB 1RTIA 4CFCA 3H98A 3G6XA 4DQPA
chains in the Genus database with same CATH superfamily
2P5VA 1G4CA 4O3SA 5CHIA 4LF9J 2W6KA 4AUKA 1HL6A 3CD6N 1F21A 2QMWA 5B0EA 3OSNA 3C0BA 4WFNL 2OGUA 1C1BB 1TP7A 4W5RA 2CKWA 3M8WA 3UR3C 2J0SD 2HHHF 3PO5A 4QAGA 4OI4A 1N34F 4ZK7M 5FLXU 3B82A 3MCAB 4QOZB 3I4PA 5BYQA 4YOXA 3RW7A 2DISA 3M8SA 3VQ7A 3M30A 1X1PA 2R7UA 3D3CJ 1NM2A 2BE7D 3RU0A 1YJWS 3ZSWA 5DS7A 5M2UA 4ZP7A 4OZNA 2ABYA 4ZIWA 2YX4A 4IFYB 1OPZA 1R0CB 2HWHA 3O4QA 4DUYK 4FXWA 1XMOK 3M8QA 1FWLA 5JVGL 2CJBA 4CLLA 4FOIA 3DRSA 2J0QD 1CJKA 4LF8F 5DZ6A 2GNKA 3VQ9A 2V8PA 4FJXA 3H4DA 4CECA 2DR6A 1SQGA 1NDCA 2VWKA 2NUUG 3OR2B 4CK2A 1OY9A 1N8RT 8RUCA 3QO9B 3UR0A 1CVJA 4DR3F 2QG9B 2F8MA 4WP9A 1H74A 1FO1A 1BWEA 2K8GA 2OPQA 1N33J 4MYTA 4IR1A 3ZT4A 2BJ1A 4BRQA 1OY8A 4R5PB 2VDHA 1FT8A 2MHNA 3N28A 2PFDA 3QWPA 2VHGA 2O8CB 3E01A 1C0UB 2VIHA 3L2RA 2QV6A 4O0IA 1CEZA 1WI6A 3I0SA 3BBCA 4M5JA 1JLBA 1AZSB 4FM1A 3MM8A 4OIXA 3UWTA 3Q24A 3L3UA 2V52B 3NAIA 4K7QA 3R5JB 3J7AP 1U7LA 4ZVQB 1NK9A 1RHJB 2OJ3A 2ZM6K 1ZTTA 2EBEA 3A1YG 3QFHA 3QNNA 3OR1B 2WHOA 5KOWA 5KPTA 3D9BA 4GW6A 3MN6A 4OVLA 3BS9A 3MD1A 3CT9A 2X51A 4FNIA 1VIXA 1U6ZA 1KVKA 2XY5A 1NKEA 4ZLPA 4KKOA 1R7IA 2R42A 3KG1A 3KDOA 4Y2AA 5KG7A 3BKFA 5AZJA 1HFEL 4LSNA 5CD4H 1FFGB 2O1PA 4DDFA 1KWMA 3OYKA 1P1LA 2HMIB 3T1HF 5J1EB 2Z2YB 1X4AA 3NS6A 2ZZMA 1JJ2R 2FBTA 1SJ1A 3ZZ0A 1IO2A 3L6QA 3M2RB 1FNMA 1DQAA 1S12A 4KH5A 2ASMA 3DLLQ 1MSWD 3U3YA 3UKRA 1G2EA 1V3RA 4Y2KA 1B9DA 2IY5B 3Q8QB 4OV1A 5L38A 1UVJA 4BRKA 4FWRA 4OI1A 1WC5A 3ASMA 3AVMA 4FJJA 5C2FA 3KFWX 3D6RA 3THXB 4MLEA 2BJ7A 1RDBA 3PLAA 2AA4A 2L48A 1CJVB 5LMNF 2RJZA 4AQYK 2UXBJ 2JLFA 3TAEA 2D3O1 1VYAA 3Q2TC 4QWCA 4WK3A 1T9XA 5HJYA 3FSIA 3UN5A 3M3ZA 3S7RA 1IBKF 1N36F 2DXDA 2GO9A 3Q83A 1BCMA 3TJAA 4XO0A 3ULDA 4YY3J 1YLXA 5CD4A 4C6AA 4PQUB 4OHZA 1ASVA 3HHNB 3ICLA 2OMOA 1FVQA 3SBGA 4B17A 4ILJA 3IM8A 5K8OA 1QAXA 1PJ5A 2XEXA 1KHWA 1DGKN 1RSCA 3KLEA 1S79A 1NKCA 1S49A 4LIWA 3IAS9 2GX9A 2BMBA 4EZ6A 3U1LA 3IUCA 4URQU 2D5RA 3VQ4A 3H7HB 4CZJA 2EC0A 4H5NA 1NM1A 1XEZA 2Y0SD 1I1GA 3CETA 2V63A 5AJ3K 3ENOA 3M8PB 1Q82T 2HBMA 3KKFA 2LQ5A 4OHWA 4ANDA 4KRWA 1QVGR 4DV5J 3ZO7A 3W61A 1VHFA 2XSJB 1KVCA 1S0MA 1R8HA 2HBJA 1QJHA 4BHQA 1BMQB 3AD9C 4J2DA 1TKTB 4K2JA 2BJ3A 1IKYB 2VQFK 4JI7K 1QY7A 3CD6S 4U8YA 4J9LA 4ZP6A 4QW8A 2OIHA 4RNMA 4KV8B 5DQGA 3CJ1A 2OFHX 4WTYA 1SPBP 1PJ6A 4FO0A 5KFQA 4ED4A 3R2CJ 3VTIA 1NMEB 7AT1B 2HFSA 1ZAXA 3WQUA 1RT5A 5L1KA 3N01A 5DG7A 5KQDA 4Z4IA 3UDLA 3IA0A 4GKJJ 5AQIA 3BBBA 1WAJA 2E9TA 3MM7B 1XIQA 5J1PA 1S1VB 2WBMA 5CXTA 3NGZA 3CERA 4WXWA 4OO1J 3ZT0A 3PHTA 5M2RA 4LFBF 2VUGA 2Z58B 3AD7C 1KKHA 5CA5A 2FC0A 3LP0B 2YX6A 4BR9A 3SBMA 3SNNA 1CZBA 2ZZTA 2GZOA 2GVDA 5AQSA 2AJFE 4RTFD 4JI4K 3ZEUA 4HTIA 1RTIB 3S01A 4CH1A 2AIRB 3KOAA 5JJBA 2RD5C 4M5DA 2MQLA 3WXIA 1N5QA 4DQQA 3NNCA 5IT9U 5D8HB 1X0FA 8ATCB 5AQUA 3HZ6A 2Q1LA 4A2BA 3IMXA 1U24A 1TYQB 5AE2A 3FK4A 1GTEA 1R6YA 1K44A 1JK9B 3CUNA 5KT5A 3OL9A 1NNEA 2HNDA 3CMQA 1TUUA 5F3ZA 4IXCA 1UMJA 5CAAA 2AZ1A 1SIWB 3UDCA 2N7YA 4ID5A 3F0NA 4DX5A 1U1NA 2K2PA 3OTOF 1FXXA 4M5KA 5A8WA 2PI4A 4DR6J 4LF5F 1NJWA 3M8QB 1HWKA 4YP3A 2QA1A 1CSJA 3HSCA 3D0PA 4NXMK 2VBXA 3S9HA 2HBKA 3O9UA 1JLQA 1HPMA 2UV8G 3L3VA 3TSUA 3DRSB 5I3PA 4F7VA 3Q22A 3QSIA 4CJQA 3V9WA 4NE9C 1S57A 4G1QA 4FF2A 4CHYA 4MMOA 3LDOA 3OW2R 5BN9A 2CGLA 2F96A 4ILRA 1T6DA 4Z2XA 1T05A 2VGMA 2A5XA 3MUMP 2NPFA 2KTQA 4ZPCA 4F3OA 1B92A 3SCLE 3GV5B 1H98A 2WONB 3KUHA 4J91A 2AD9A 4YDUC 3E01B 2YY3A 1M0SA 1TVRA 3TTDA 2VA2A 2UUAJ 3ZZZA 1JLGA 4CI0B 3MM8B 4FVCA 2E44A 2O66A 3DMJB 1M5VC 2N4DA 2R7RA 5I9EB 1PSDA 4JAXA 3GJSB 4FXDA 3JS6A 1P90A 4BRCA 2NUBA 2P8IA 1MWKA 4FJKA 5DRKA 3H3OB 1IBCB 4N76A 2V68A 4AL7A 4PXCA 5AQZA 2PT0A 1FKPA 3Q2SC 1D3WA 3KLIA 3PW0A 4QWDA 4EO6A 5AZJB 4LR9A 4DV3K 4LSNB 5C24A 5HROB 2AKWB 3K8VA 3AVBA 1HNVA 3UN3A 4EBCA 3K0SA 1S6UA 1CULA 3IG1A 4YUDA 1V5IB 2O3DA 2VFSA 2ZWPA 3G6EN 1UPMB 2A6MA 2OKQA 4QIFA 4BC3A 2B6AB 4QU7A 3NGKA 2UP1A 1GXTA 2IAJB 4YR2A 3AA3A 3DJCA 4BC9A 3RBZA 3P1GA 3EM1A 3DOMB 2VBYA 4KB0A 3VGUA 3F9MA 2I1RA 3MN5A 2D74B 1RT4B 2BV3A 3CO0P 2E5LF 1VSLA 5EHHA 1RDCA 1OQ6A 3BN4A 5AQYA 2LQJA 2VA3A 2A42A 1IBLJ 3WBZA 2FBYA 3AO2A 3D1HA 4W92B 3BEXA 5MLCQ 3WDOA 5AZIA 5LM7E 5EUHA 4CJPA 1U1KA 3WX4A 3AA4A 3OSPA 1HQEA 3BYRA 1K8KA 1GXUA 3RMCA 2CPHA 2XHCA 3W8GA 3GIJA 5AXKA 1WG1A 1YVFA 1RB0A 3FDSA 2RKIA 1GXLA 1H7WA 5ADZA 1WWHA 2CNOB 2E1AA 1JJHA 1UFWA 3OYAA 1AA1B 3W3SA 3PUFA 2FTRA 1N54B 2C2KB 2UXDJ 2YX7A 2CQIA 2NLXA 3ZSQA 1H38A 2QXFA 2VC1A 2IMOA 4JV2A 1S7HA 1DTTA 3VF4A 1EWQA 2CPJA 1GTHA 4CJVA 1WBBA 3KLEB 5KGWA 3GU0A 3IR6B 3MECA 2YNIA 3UD3P 1FFWB 2VQEJ 1Q81O 1O1WA 1C0TA 4RBTA 1KOOA 1U02A 4FKXA 1R31A 3DDNA 4IRDA 5HMWA 2C2DA 1B3TA 4ED5A 1VQPS 2VBWA 3AVLA 3MCSA 3D67A 4C3MA 4DF4A 2NYHA 3TTFA 3W8PA 4M45A 3MMBA 2UUCK 1NZAA 3QERA 2W7AA 4DU4A 5F8IA 3M32A 2XY7A 3P5TL 3B6OA 3VQQA 2PBDA 5FLXO 3H5YA 2KYZA 3AJ1A 4CGGA 3WC0A 4CH0S 5GAEU 3QATA 3PEHA 5BN8A 3QZ8A 2KT3A 2NS1B 2VODA 4Y1DA 3PYEA 4WQ5C 3OHAA 2J76E 3QIPA 2B56A 4B3TJ 3NAHA 5BRHA 1S1TA 4DV2F 2PE8A 1GMWA 2G8VA 1Y5LB 1NMNA 3S3NA 5GADU 3R6LB 3CVKA 2Y9HA 3LGHA 3V1OA 1OH8A 3RR7A 3K5PA 4NLXA 3H59A 4F3MA 2E29A 2Q66A 1ZAWA 2QYGA 1JXEA 2RNEA 5KFSA 2HHTA 4ED7A 2M3DA 4F02A 4GC6A 5B7WA 3QLHB 3O1LA 4WP8A 5EVZA 3H42A 5IV4A 1JCEA 1SC3B 1PO6A 2DR5A 4K42A 2VC0A 1NH7A 4Q0BA 2MPUA 5GAHP 4CBUA 5KTQA 5HVHA 3A12A 1HPZB 2GVDB 4EYIB 1MNEA 5LSOA 1Y5IB 3CW2C 3PY8A 3ZEUB 3R6GB 2DY1A 5KFGA 4CNZA 5HVFA 2W4CA 5JICA 3ENQA 4W5TA 1K8AO 1SUQA 3JTOA 4H0TB 1Z05A 4KPCA 4BRIA 4JNEA 4NXNF 4FJLA 1FTCA 1UWBA 4ETZA 2W41A 2BBEA 2J7UA 4BRLA 4AXJA 5IOLA 2HNZA 4NI2A 5H9EJ 1GQEA 1OVQA 2FQQB 1JNZB 3OVSA 3SQ2A 2MZJA 2HNDB 4L72B 3K58A 1QZ6A 1IJFB 4H5TA 1YVNA 4X65J 4FF3A 1WACA 4EU0A 3NCRA 4ID5B 1BL3A 1UVMA 2ZH5A 1Z4UA 5BPNA 2UUTA 1DAXA 1KOHA 2CG4A 3A8EA 2P9UA 4CJ4A 2XMMA 4YEAA 5A8WB 2CDQA 3M1VA 2A40A 4LF4F 2K1RB 2O5DA 4PXDA 3KDNA 2XCPA 4BGAA 2ZBRA 4MTPA 2IMWP 1RT1B 2D1CA 3QGPA 1VK8A 3UO0A 1VQ7N 5LL6d 3K8WA 5DO2A 5CZXA 4G1QB 2LYVA 1S4EA 1VBZA 5KFIA 3QDKA 4PL8A 3WNHA 3G6ES 1VGYA 1T05B 1P8ZA 3CC7S 3L4IA 2E7VA 4KB1A 2GO8A 1E6VA 1JMTA 3MCOA 4JI0K 1HQ2A 2QSFA 3OLAA 3BZQA 1GH8A 2DYAA 1TVRB 3C7NA 1PC5A 4B08A 4DL2A 1TL7B 2OD6A 4FYYB 1HHTP 4Y00A 5ETQA 4UTGA 3SIPB 1ITGA 3R6MA 5LOQA 4I1TA 4QIVA 1RYRA 5FROA 4U67Q 3AY9A 1PILA 5ETTA 4JI1J 3CJ4A 1WUAA 2JC0A 1P27B 4LRAA 1MWMA 4BR7A 5LMNJ 4J9NA 5I42B 2HRUA 1NBEB 4ECYA 4LF9K 1FKPB 4IG0A 4YOUA 5F8HA 2JH3A 1XR6A 1IBKJ 1N36J 2PFFB 5C24B 2E1ZA 1CULB 5HAOA 3IG1B 3RVCA 2NXCA 4IDKA 2CAJA 3MWBA 3ZETA 3ITHB 5A2QY 1T44A 1X4BA 1CLFA 1ZA1B 2ZBCA 1VSEA 5I4MA 1RCHA 1BG3A 5CYQB 4FBTA 3CIZA 4DLGA 3BO3A 3P4IA 1RYSA 3VOVA 4ED3A 2ZFHA 4ILLA 2Q31A 3W9IA 2UUWA 3A3PB 4ECWA 4FF1A 5E2QA 3Q0AA 2EVZA 3TW0A 2P9SA 1KD1O 2LQ8A 2LECA 2W2MP 4OLAA 3HO1A 3W65A 1BWVA 2FLNA 3V6DA 5AZIB 4WK1A 4BR5A 2GBZA 4IOCQ 4HKQA 4NLBA 2WTUA 1K8KB 4HHTA 4CF2A 4K4YA 5KFAA 2RKIB 2VFVA 3A3OB 1N33K 5KFXA 4EHTA 1K1QA 1YJNN 3TYTA 4C0HA 5GIPA 1IKVA 2EWHA 1KVBA 1MROA 2R8GA 4PYDA 1S5JA 4CF8A 5DZ7A 2M70A 2LXFA 5H9FJ 5HANA 3D4JA 3VAJA 1DTTB 1YIJN 4H8KA 5LMUJ 5BRFA 1K9MO 3MECB 2YNIB 1RDRA 2VDIA 2YHXA 4H4KA 1C0TB 1Y3KA 4FW1A 1QSLA 2BQ3A 2F9JA 1V9OA 4KHPF 2Z2LA 3QJPA 3H2LA 1QSYA 2OP5A 3U9ZA 5KG3A 3OVAA 3KD5E 2IYIA 4A4JA 3W3DA 2FXUA 1Q5YA 3O3HA 3J80U 5IT9O 4RNHA 2GVZA 3MMBB 2LDIA 1HW8A 1FD2A 3UD4P 4JYAJ 4TSXA 3JAMU 3NY0A 4XH1A 1VJQA 2JVOA 4YQWA 4DUTA 1FRKA 3X3UA 3M32B 4QCLA 4Y6IA 3GR1A 1RABB 3FZKA 2D4WA 2R7OA 1X9JA 3W5YA 1HKGA 3V6HA 2VWBA 3EE9A 4IUFA 1W25A 4HH0A 3TR8A 1ZETA 1SV5A 3QIPB 2BZ2A 3KKSA 5LT5A 3ENBA 4U7CA 1HNIA 1VCTA 1S1TB 3ZZOA 2WAQD 2HSEB 3DHWC 5KFMA 2JC1A 4ZCMA 4F4AA 5CQGA 3MAHA 1Z2LA 1BISA 4F0MA 4E7IA 4YORA 2FZCB 3DLKA 2OA8A 3CIMA 1GK8A 1Q0NA 3HFKA 3WNEA 4R25A 1SJQA 4DF8A 3FZBA 3WEEA 4A46A 1RISA 3CJ2A 3DGPA 1ZYQA 4E1MA 3IBFB 3OTOJ 3C6TA 1RCOB 2WB1D 2JEFA 4V19S 4PG4A 4FS1A 4GRSA 4ES3A 2UXBK 3HPGA 3TWHA 2XQCA 3IR5B 4K5SA 3LDNA 2CJAA 1PYTA 1VQ7S 2QKKA 4UY85 1YRUA 4DN9A 1WTBA 1LWFB 5KFJA 4AHTA 2CPZA 4HH1A 4X4OA 4YY3K 4EP5A 5E3CA 3AJ2A 1SUQB 4UQGA 2HBLA 4CJ3A 3QICA 3KLHA 1YDLA 4L3NA 4ANCA 5AXNA 4EBEA 2OANA 3O9TA 3N4PA 4FWMA 1IR1A 4ED1A 2HNZB 3RAQA 1ELOA 3EN9A 2F63A 4DCPB 3KMQA 4CD3A 4FWLA 1C0MA 1VHIA 2YHBA 1RWKB 2ZH9A 4KBOA 3DLEA 5LJ5Y 1Q81T 4NMLA 2BRLA 2V7ZA 3VWSA 1HMVB 4CD1A 2W9BA 4G9ZA 2NRHA 1N32J 4M95A 2P9UB 1F5CA 1BWFO 5B8HA 3RMDA 4BC2A 2PA8D 4DV5K 4BC7A 4P73A 1ZZNA 1XQSC 2FVRA 2AU0A 1VSKA 3SMZA 3OBWA 3FCWA 2ZOGA 2NR0A 4M5NA 3VN5A 1H0HB 3SSSA 1IXKA 3NH2A 2BUPA 4OJ3A 1VSHA 3Q7BA 4F50A 1J5OA 1IJEB 1RAFB 4GKKF 4AQYF 4B3SF 4RW4A 1XERA 3CJ9A 2F8HA 2WOMA 4U8VA 2B4JA 4JS4A 1I51B 2BA9A 2Z8QA 1E6VB 1SZ2A 3WXKA 4ID8A 2HHVA 3NH0A 1TELA 3W9JA 2PA3A 2XHBA 5ETNA 1RAEB 4HVZA 4GKJK 5IM0A 2QA4N 3THWA 1ZC6A 3C7NB 4CLTA 1FWKA 3M6XA 3JSYA 3BPSP 2DNMA 5E26A 3NH1A 2C28A 5G4DA 1YRXA 3I5CA 1NZ8A 1VRTA 3L7PA 3TAGA 3OYCA 3OYHA 2BX6A 5F0XA 4H5WA 3GMGA 4WU3A 4CLPA 4BBYA 4OJHA 3S41A 4ALZA 3OYLA 2Y3YA 2ILZA 3OS0A 3FGVA 2YNGA 2LQ9A 3LPYA 3DGVA 2EKYA 4DSKA 4DU7A 5AQWA 4BREA 4HT7A 3DLLL 1QDUB 1DHMA 2O8BB 4ZVRB 3TSQA 3JB9k 2AJ0A 1YJNS 4DBQA 1K8AT 4IQXA 5EU7A 4F4YA 1QHAA 2XMVA 3ZETB 2M0GB 4U95A 4CO5A 6AT1B 2PYLA 2A1BA 1YIJS 1IKXA 4OX7A 2V2KA 3ZTRA 2V67A 5KFEA 1U2VA 3TAMA 3QPIA 3ID8A 2WVBA 3DRPA 1WJ9A 2QA4G 2GGPA 1UA0A 1GLLO 1RUSA 1M5KC 4LFCK 2WB4A 2VG6A 4IEIA 2ZBQA 1SXLA 3A8IA 4M8LA 2ALYB 3EXCX 4Y3CA 3B4DA 4DPXA 4CZIA 2MSSA 2P9SB 4KGXB 1FE0A 1QLNA 2KZMA 4WFYA 4DMZA 1S5ZA 3BDPA 3O3LA 2RHKA 1OSCA 4UUXA 3KJFB 1YJTA 2E6LA 1VRUA 1NOYA 5MLCV 3ZLJA 2P9EA 1WI8A 2L9DA 1RDDA 5AQKA 5B0AA 2GMJA 2V5HG 2G2ZA 1EIYB 4LRBA 1IKVB 3OXLA 4O3RA 2FVPA 3TI0A 4DV2J 1NJXA 3MZIA 1Q4RA 3Q89A 5E33A 1ZAVA 3LPEA 4DHYA 2EWSA 2PEHA 3BEGB 4DQSA 4CVNE 3CD5A 2G13A 1NU4A 2DNPA 1G3OA 2BTFA 2E7WA 2DTJA 3TUZC 1S10A 4PG6A 2FVQA 4OKKA 3ALYA 3G10A 1TR0A 5AQLA 1X4FA 2H4YB 3GJQB 3V9SA 3CPEA 2HVHA 5E41A 3OYBA 2QXLA 3MAAA 2CYYA 4NCAA 3IGVA 1BY9A 2NREA 1AB8A 5J2QB 1QQCA 2J6TA 1GFWB 1ULRA 4RL1A 1KVAA 2D0AA 3JSMA 2KT5A 3LP3A 3ET6A 3SPYA 1RADB 4BS2A 4ZVTB 3GPAA 3O9SA 4PWDA 1NGHA 1SJFA 2EHGA 1SV5B 1AROP 3FNNA 1HNIB 3PXGa 4NXNJ 1I39A 3ZFVA 1RAHB 2MMYA 4I7FA 1R8CA 3N5FA 4ZOSA 2RUGA 2B8PA 1KR4A 3HHKA 2RDJA 1HNZF 1FEEA 3LGMA 2VGNA 2BEFA 2RQMA 1U6BA 4LFAJ 4O23A 3IWLA 4NCGA 4NOHA 3DLKB 5HBMA 5B08A 2MQMA 2OPRA 4WFAQ 3WQPA 3NHGA 4R8UA 5C10A 1GMWD 4P2MA 3DGPB 4DV6F 3CFPA 4DR5F 3EGZA 4K8RA 3MFHA 1A5VA 1IBLK 3LP1B 3W1YC 3D5MA 3C6TB 4A62A 1KD1T 1FA0A 1PAEX 2YWKA 2I2YA 1WEXA 4M5HA 1VQNN 2ZWHA 1W2BR 1U47A 1U8SA 2XMWA 2FB0A 4WFNQ 3SCXA 4EP4A 1Q7LB 2PO4A 3VA3A 2HIYA 2HVDA 2B9YA 3O9QA 4MT1A 3LOUA 4ISGA 3SJHA 5GAHI 2MGZA 1B0PA 4LT6A 2G8IA 4HI1A 3HHLC 1ZBIA 2ATLA 1NDLA 2ADBA 1RT6A 2K7JA 3FZHA 2IC3A 2X1FA 4DS5A 1IG8A 4NA2A 1QE1B 3KLHB 5IV3A 1NEEA 3AVFA 5BXIA 3ULHA 1CQMA 2ZE2A 1M1HA 3MN7A 1IKWA 4Z7YA 5BYSA 2QA4S 3DRYA 2VQEK 3T19A 3VQAA 3CCES 4PG5A 3G8TA 1F5BA 2WSFC 3GQCA 2QLJB 3BQ1A 2XZWA 1V6HA 2Q6BA 2E5IA 3BSOA 2W9BB 3AQPA 3RUBL 4JP8A 3CCLN 1EHWA 2ASLA 1Q78A 3UVJB 4ED2A 2QSWA 4YB6A 2YHWA 2AGOA 4DFMA 1XMQF 2ADCA 2MKYA 5HMZA 1MLAA 5DDQC 4E1JA 2KVIA 3S1TA 4AHSA 2IJFA 5JS1A 2HPUA 3ILIA 2CPDA 2CADA 3UIQA 3C14A 1HR0J 1J5OB 1HD0A 1U49A 2AT1B 3CJBA 2WVDA 4A8OA 3GCXP 4RW4B 1RBAA 2QTDA 2WOMB 3G4SN 2FF6A 3MUVP 2F1FA 4XH5A 4M5LA 1IJJA 5IM0B 3HM9A 3CDUA 2V2VA 2RMLA 3PIOQ 3U1MA 3J81U 4DFJA 4X4TA 1X3NA 2Z2MA 4N8OA 2OEMA 3AVGA 4O4GA 2W25A 3T69A 4DX8H 3CCQN 1TL1B 1WUUA 1PIEA 3SZ2A 3SQOP 3N4WA 4ECSA 2ZUAA 2ZBPA 2BW2A 1N56A 3K0JA 3PYGA 4DSEA 1EQYA 1IUJA 1D8YA 2W2QP 2O8FA 2PDAA 1MWQA 2QWOA 1OY6A 4NL5A 4RJVA 2YNGB 2W1BA 4BG9A 2YI1A 3HL8A 3SQ4A 4TYAA 4DR3K 5F2RA 2OPPA 4LF7J 3RW6A 3FZLA 5IS2A 1GT8A 1RZMA 4MK9A 2JSXA 1VQ8S 3Q8PB 4CHPA 1O8BA 1RA6A 3H2VE 4F3TA 5H9EK 4B3RF 2QLFB 4KYZA 4X62J 4CFDA 3OBYA 2AHOB 3LDQA 4LSZB 1WC6A 2Q97A 3H3NO 1R89A 3QEWA 2KVQE 4Z4GA 2LDYA 3M5RA 3L2VA 2DNOA 2GGPB 2B43A 3AA2A 2PN6A 1OKJA 1LK5A 3HKZD 3T5LA 1YRTA 4UZBA 4X4UA 1HJRA 5L9NA 1TAUA 3CM6A 4B3OA 1VRQC 2ZVIA 1NWKA 4V19J 1LEOA 3TARA 3HI9A 4MIWA 2N3OA 4DZDA 1Z1ZA 5FLXY 4G1PA 3HXMA 2P9IA 1VRUB 2V2ZA 3RGIA 4USWA 5KFVA 7FDRA 2YBVA 2H54B 5D3GB 4AM6A 1UEKA 4I68A 1RDUA 3KLVA 4E7HA 2YPYA 4NMXA 3T1HK 3BB5A 4KO0B 2A18A 2OD4A 4C8LA 2CXEA 1PAUB 4L74A 3S8SA 3H20A 1GMUA 5FPMA 1S0OA 1U1QA 3MXHP 4CHNA 2HWTA 4JV0A 1EO1A 2JNJA 2E2NA 2W9CB 3PFEA 2DPJA 2ACYA 2I7PA 2RQKA 1A5WA 2QL9B 1VHXA 5L39A 3H6EA 2OPSA 5BPLA 4I6YA 2VG7A 3NVKA 5K20B 3RRHA 4JI1K 3IRXA 3BH6B 3MR3A 3PSIA 4LIRA 5AQTA 1VQNS 3VQDA 2B5JA 5LMNK 3NNHA 1HQUA 3CWJA 3MWPA 5KG4A 3THYA 2GUIA 3MAAB 3TQEA 3OYFA 5I3UA 3P6YC 3MPVA 2GJFA 1GX6A 5F0WA 2XG8A 1IBKK 1N36K 3H5UA 4U96A 3G87A 1LAWA 1YWXA 3HOTA 1YITS 2IVYA 4DU1A 4OHYA 1I6JA 4KFBB 3ET6B 4E2FB 1SQFA 4BC4A 1HWIA 4DR1F 5E84A 4MDAA 1C4AA 2XMAA 2L9NA 4PWDB 4IKAA 4BRMA 3BREA 1HI0P 1H1VA 2ZHAA 2YXLA 1HKBA 1JXLA 4RO0A 2LXUA 1TGOA 3EL2A 3CB4A 4FPIA 4F0KA 2KH9A 3DHXA 2ZJRL 1QQNA 1HBOA 4A57A 3FE1A 5GAHU 2A1RA 1NK8A 1NK7A 5HBMB 3CDEA 4M3RA 2BOPA 2CJQA 5B0BA 4CI6A 3KK3A 3LP2B 4R8UB 4JI0F 3CCLS 4B1XB 1FRHA 1J9AA 3LZIA 1XR7A 4DKWA 2YV0X 4BE0A 4FJ9A 1FVSA 4DX6A 3HX9A 5J2MA 4CO3A 4CJEA 4ELVA 1VQSA 3K17A 1U0HA 4F9OA 4TLRA 1R3NA 4URSA 5F9NA 1NNDA 5FJ4A 1VQ4N 4CEDA 1LKZA 1RT6B 2ZUGA 4GKKJ 3ISZA 3I82A 4XAKA 3G4SS 5ITHA 3O6WA 4EMDA 4B3SJ 2CUYA 5H9FK 3RMBA 2DGOA 3R97A 3I56N 2HZCA 4KTZA 3CJ3A 5LMUK 1B64A 2ZE2B 2GCFA 1IKWB 4DCJB 3CSKA 1BA0A 3WT0A 3NBPA 4CGIA 2D3UA 4QIGA 3OJUA 3UDEA 2NXJA 4KB7A 1HI1A 3CCQS 3SAHA 4H4KC 4EUVA 2XYPB 3CE8A 3T5KA 1YJVA 5T7BA 4FZVA 1ITPA 4ZPWR 4IH6A 4M3WA 4AT1B 3ENVA 4ITSA 2ASDA 4B9LA 2BQRA 2E66A 4BVPA 2O8EA 3I31A 1AW0A 2AP1A 4JYAK 3O08A 4GVBB 2E4LA 3W2WB 3BGUA 1YTYA 2IRXA 4OZ3A 3JTPA 5KFOA 3SQGB 4XDCA 4FJ7A 2J0WA 4LVNP 1ZS6A 3H08A 2IRUA 3C8YA 2JLGA 3UQSA 3I9ZA 2I38A 2KFNA 2I5JA 1SJ4P 1J27A 4U67L 1RBVA 2BM0A 2J0XA 1OJ4A 2E5JA 5D4OA 4Z4FA 4CEOA 3QIDA 1AT1B 4O55A 4M3ZA 1I3OB 4X4PA 5KG0A 3QINA 1VSDA 5K14A 3OVBA 3VAFA 4CF1A 3DXSX 3OL7A 3MWTA 1ZA2B 3OTOK 3MURP 3VQSA 2DRBA 4LF5K 1F0XA 2RS8A 1RHQB 3AGKA 1Q79A 4EIAA 2B4UA 4NLOA 4LH5A 4JI5J 3J7YP 2HURA 2B9EA 3QT5A 2G0CA 4KHYA 4OPKA 3Q8RB 3EX7B 2RB7A 2B7CB 3MM6A 2O8FB 3W2VB 4PG8A 1HHQA 3R1XA 4KT0C 1SS6A 3HD2A 4WE1A 1RTDA 3CCRS 2UXCF 3TPQA 1HI8A 5HATA 1S76D 2XLIA 4ICLB 2XLJA 1ZBLA 1U1MA 1UA1A 5HRSA 4USKA 2EPIA 3VA0A 1HBMA 4HL9A 4ZPBA 3IXQA 1FDDA 4DTJA 3S3MA 3DNCA 4OYIA 2IM3A 4BR0A 5M1FA 3ONQA 2KHDA 3WXLA 3QAUA 1YJ9N 4PHTX 4GC7A 2VG5A 4LREA 3QWUA 2YKMB 4ZJOA 3T6JA 4CO2A 2VL1A 1EQ0A 3UNYA 4S0MA 2AJ1A 1UJ5A 2XNQA 1N32K 3OFEA 4O3NA 1TKZA 1FNOA 1RDWX 2ZQBA 3J7AN 3DXKA 2VKZG 4PWWA 3GJRB 4HVJA 1X5OA 4F8RA 3ZX0A 4LF6F 1RXOB 4HACA 1LQ9A 3BSAA 1WKLA 5IT9Y 4WYLA 1WOQA 2P5GA 1KVJA 4JV5F 3MI7X 3D1QA 4Y2MA 1NPPA 1NHKL 4GV3A 5EXWA 4H0PA 2OHDA 3S6EA 5C42A 5FDLB 2P9IB 4DTUA 4O8KA 2DTUA 3C65A 2DNRA 2MJNA 2E7XA 3WQTA 1HHSA 2XCAA 3U27A 1G1XA 4UT4A 2WSEC 1GLDG 2MQPA 5D0RA 2J8AA 4IO9Q 2MLYA 1IVZA 5HOOA 2NLWA 4DSIA 3C94A 2LSNA 2W24A 1VFJA 4DL5A 3OTDA 3CTRA 4N41A 2WW4A 2Q0RA 4MLHA 1HNZJ 1P6TA 4FM2A 1MMNA 4XPEA 3TEHB 1QUVA 5AT1B 3GZ7A 4OPJA 2KL8A 3ULEA 1IM6A 2BUNA 1YK9A 4ILHA 2OPSB 2JEGA 2XNRA 4YDUA 1VQ5N 2VG7B 1KTQA 1PKUA 2HG4A 2ZITA 1FRMA 3V2UC 2E5LK 1RAGB 3NS7B 5GAEP 3IRXB 5GVQA 4DR5J 2Y0BB 4HT5A 3CJKB 3GIRA 1KLNA 2PMWA 1RBRA 1SI9A 3RB4A 2D0BA 4PXEA 3QRRA 2AZ3A 1R0BG 3DXBA 3THYB 4ZITA 5GADP 3C66A 3CJRA 4IQMA 4NEZA 3MN9A 3MPUB 3NMUA 1BUXA 1VQ4S 2C2MB 1D9DA 3CCSN 2LEBA 2L08A 4QPTA 4WJBA 3BKUA 3TZWA 1P1TA 2YQ3A 1U8WA 1D1UA 5KT3A 3I56S 3DXMB 4RZRA 3FZMA 3TA1A 3TNVA 1Q8IA 4F4ZA 2C2OB 1NBWA 5MAOA 2XWYA 4G1IA 2BQUA 2QE5A 3VVTA 1C0FA 1C1BA 2DR8A 2DFHA 4ZDNA 2NRWA 2P2CB 3OL6A 4W5NA 2BABA 2BACA 3H1VX 1RTHB 3KK3B 1X4GA 3R27A 3BYPA 5K9FA 2RN2A 4NLUA 4ED0A 2KXHA 3TSPA 4B9SA 4ILMA 2CQ2A 4HUFA 1BXNA 6FDRA 3TP2A 4O5FA 4CH7A 3CJ7A 3B54A 5J2MB 4LR8A 4IFYA 3W5ZA 4BDYA 2AJ2A 1U0HB 3KJVB 2N7CA 4C8KA 1S77D 4FWSA 4OX8A 4DZ6A 2F9TA 1MMDA 4X64F 3EUNA 3EE8A 4JKEA 4NYFA 5GAGP 3J81O 3SQ0A 3ENWA 1MDUB 4M3TA 4K43A 1ZM2A 4X4RA 1VK0A 4LVOP 1X7VA 4J9KA 4DV2K 4PUOB 2K06A 3SQ1A 2PZSA 4OZ5A 3SV4A 2ZH3A 3OV7A 2OLWA 2QJ3A 3QO9A 4B8AB 3RG6A 4B1ZA 1KAYA 4QIWD 4UOFA 3ZX2A 1D09B 5IQQA 3G2XA 5M1QA 4JHDA 3IR7B 4DTNA 3OT9A 2F8SA 1HA1A 3HOSA 3FSYA 4HEA9 4MKAA 3H2UB 2CDRB 1G6BA 4DUZJ 2F40A 1WEYA 4IFVA 2MQ8A 3TEGA 2O8EB 4RBUA 1SKSA 7FD1A 1NB2A 1VK3A 2NRRA 1XWLA 1X4CA 4C3LA 5DDPC 2Q2RA 4DR6F 2KLAA 4CW7B 1A5XA 5HI7A 1XC3A 4NLTA 4DTPA 1N5TA 2VFRA 4GO7X 1MG7A 5CCMA 3WUHA 2FVSA 1OVYA 4LY7A 1RAIB 3J7Z5 4NXNK 2CA9A 5HRRA 4DG1A 5H1SQ 3TAQA 3F9KA 3HF5A 2M9KA 4RUCA 4CZLA 1YJ9S 3MR7A 4A5AA 2OSRA 4B3RJ 2AF6A 1TKDA 2GTDA 4IFEA 4WQ5A 2LP4A 1WSIA 4C8YA 4IZ9A 2HMIA 2MYFA 5C15A 5J1EA 2DY4A 5K14B 1FJEB 3ILJA 2QYCA 1K73O 2RDIA 3EPGA 1ATRA 4F36A 2Z1JA 2RE2A 3M2RA 4C2MA 2AEJA 2UUAF 3R7NB 4OI6A 1Q53A 1F9EB 1EETB 1HWLA 4JI3J 4WTOB 3DM2A 1MWZA 1OIAA 2RIJA 4KHWA 1WHXA 2H5EA 4E7LA 1FJGJ 1NJYA 4YOYA 4KI6A 3VGVA 4FW2A 3KWMA 5EX3A 4CEBA 2MTLA 3D1OA 2C2ZB 4ZLLA 4UOGA 1CJVA 1RTDB 2B4PA 3I9V9 2WTFA 2A6AA 3I55N 3R1LA 1REGX 2IJNA 2FHMA 1NHUA 2F4VJ 2P9PB 2DKOB 1FI4A 1HBMB 2DNYA 1UCNA 1QZ5A 2U1AA 4P74A 4ISFA 1KAXA 2BDPA 4NZ7A 3MDFA 2HBZB 1R8PA 2GAHC 3MK6A 2ZJPL 1HBUB 5KGXA 4PQUA 2QMXA 1JXBA 1KQSM 1VQ5S 4NRUA 3FEZA 2YWGA 2Y8WA 1BQXA 4I6WA 3J7ZO 2AGPA 5AQPA 2CNKB 3HVWA 3QBCA 4YOTA 2HHXA 3OS2A 3DXKB 3WX8A 3VF0B 4A8SA 2DHSA 4FZYA 1U1RA 5D15A 4I2QB 1Q16B 4P2SA 4FYDA 3NEKA 4M7XA 3AA9A 3BPDA 3PV8A 4M42A 4WWSA 4LH4A 4PKDB 3M8PA 1WN7A 3DKDA 3PNIA 4J5OA 1IBLF 4NX9A 3CCSS 2LEAA 5C42B 2LLZA 3SUQA 1AFJA 1GLJO 4HCCA 4KHSA 2MSTA 3CJQA 3IWNC 3I87A 4CQ1A 4DSFA 3JYTA 3GL1A 3G86A 4DR1J 1TKTA 5DGAA 1IKYA 4CLSA 4ECTA 3HPOA 3QYYA 4DV4J 3RJMB 4NLSA 4FN5A 2C2NA 2UXDF 4M94A 4HUGA 1UAXA 2RRAA 5KQ8A 5FPNA 3P4UB 3L4BC 2VQEF 2KHCA 4J2AA 1NGGA 4PKIA 1F60B 3ADAC 1BQNA 3TVKA 2AX1A 3MEGB 4P2XA 4CEFA 4FDFA 5KFBA 1IV0A 4MQ3A 4LF7K 1SIZA 3LTOA 4O44B 3GCWP 3BM7A 1WSGA 4WFAL 3TAPA 2ZHBA 5KFTA 1WDDA 1KHVA 4JN4A 3KLFB 3K7RA 1SL1A 4ILGB 4MKVA 3SCIE 1UAWA 1B70B 3THVA 2X1GA 2DRAA 1WELA 2ACMA 3GJTB 4AILC 4P10A 2QTWA 4B3TF 4FJMA 2IDLA 1Y00A 3KUGA 4PY5A 3CMAN 1F9FA 4DV0J 1S59A 2HGLA 4P75A 1M5HA 3IN5A 3RTVA 1YBUA 1FRXA 2QC3A 5AQHA 1RJJA 1TYQA 2KXNB 4KHPK 1KNZA 1K1SA 3BJYA 3SLCA 4YS2A 4IDHA 1JB0C 1RBUA 2RT3A 4Z4HA 4ZVGA 3HM8A 1UVNA 1I3AA 1CZAN 3US5A 3EVWA 5KFPA 1D4XA 4V1Ak 4B9QA 4JRPA 3M6UA 4X66J 1BO5O 2DGVA 3H90A 3NOGA 1X9WA 4Z37A 3UB5A 3TU5A 4OJGA 1K6YA 1AUSL 4H5RA 3R8EA 3T6BA 2X74A 4USHA 1FHTA 5KT4A 1QAYA 1FRLA 1K0TA 1J54A 1HD1A 1HIYA 1YBTA 2GAGC 1DARA 4ZN1A 4CO4A 3RYLA 3K9JA 2F7VA 2ZC4A 3NGYA 2KO1A 2NNWA 1JIHA 2WONA 1LNQA 1U2RA 4JHDB 4FM0A 4DB3A 1E6YA 3V6KA 1V5VA 2XC9A 5E3PA 1Y9OA 2WSCC 4OI2A 4FLWA 2HAIA 2OUGA 4X65F 4IG3B 4IFVB 3M8YA 5HMXA 4DQ8A 3HVTA 3ZZRA 1EX4A 2YHYA 1TUWA 3DMJA 1S22A 1Q8BA 2VICA 2DEJA 5D77A 4RW6A 2LA4A 4BDPA 1KN6A 2LVWA 4O3PA 3D2FB 2JL9A 3OLBA 5TKYA 2R7VA 3O6QA 2EW9A 2FY8A 2AV5A 4B1UB 3ZTOA 3IS9A 3I55S 3PIOL 1O5JA 2UXCJ 1SL2A 5HVGA 5IFMA 4DG1B 2H65B 5HRNA 4LUBA 4XEIA 4CZGA 3D6FB 3CI5A 3CCTA 3QFWA 5HROA 3N6LA 2Z2ZA 3G82B 1ICEB 4ZVSB 1DY3A 3VGSA 2CPIA 2HS3A 3SUPA 3J80Y 3CCZA 2X3GA 4NLYA 1OPIA 2B6AA 3JAMY 3VAKA 4Z0UA 3Q8VA 1KC8O 2B0GA 2IAJA 1GEHA 4Y0WA 3P38A 3ZSRA 2UU9F 1FXLA 2MZSA 5RUBA 1FXRA 3DOMA 3GP9A 5GIOA 5ETMA 5DQHA 5J2NA 2QIFA 3QSYB 2Y1JA 2DXFA 4LF6J 2HFOA 3DM2B 1UWAA 4JV1A 1H2UX 1RT4A 1FK9A 4JV5J 5LJ3Y 3A5MC 3HRGA 2FPHX 1NJIO 1C0GA 4JI1F 4PA1A 5A8KB 1VSIA 4CESA 2DT9A 5DLFA 1FDNA 2R8KA 4DL3A 5GMDA 4GKKK 4CLZA 1QQMA 5CY4A 2GS8A 4B3SK 3QEIA 1RT2B 4FJIA 1FJCA 2EEYA 2CQPA 2XMJA 3V81A 4RWXA 2AYGA 2CQ4A 2X1BA 1VQMS 2LU1A 4TY8B 1DRZA 2F9DA 3NGSA 1DLOA 1IR2A 5A2QU 3D28A 1X8DA 4L3QA 1U25A 2D3ZA 5M1KA 3FMBA 2ZM6J 4ZCLA 2RPIA 1RDAA 4G6VB 2JWLA 2QEXN 4FLZA 4HDGA 2ZC3A 5C25B 1L3UA 1NGAA 1UVKA 3RB3A 2KJWA 3BZKA 2DH9A 1TV6A 4DPOA 2GW8A 1R0AA 3E3XA 2BH1A 3Q8SB 3OTEA 3CCWA 4J9RA 2ASJA 4I64A 1ROFA 4YR3A 4KHQA 3ZNJ1 5EX0A 4ZP9A 1T6CA 3HULA 3WIUA 4EO8A 2FBXA 3LWMA 1RT3B 2DCLA 2PEBA 2EG1A 5KRTA 3RBEA 2CJYB 1YZ6A 3VQ5A 2ROGA 3ENHA 1B7YB 3GLJA 2DEIA 3JYTB 3LW5C 3QEXA 2R7XA 2M88A 2XSFA 1DURA 1H6KX 1GLBG 4IWVA 2O4IA 3KJQB 4IOBA 3C3LA 2HFVA 1RLDA 1TFWA 2NRXA 3CMAS 4HTJA 5D78A 4PKHA 3OQ2A 1ACMB 1T95A 2CZ4A 1I5OB 2X1AA 1K73T 1QHTA 3SI6A 1Y0HA 5LMUF 1SH0A 1I94J 2MKHA 3AVAA 3K5MA 3UDVA 2A3ZA 2VPXB 4ES1A 3QLHA 5KFZA 3DAWA 2QX0A 4Y2IA 1FWPA 3AVHA 1TQLA 3KK2A 4QWEA 3CJ0A 5GAEI 1BQNB 3BV8A 1XHXA 3QETA 2IBKA 1WEZA 2BXJA 2W2OP 1FJ7A 3G71N 4M3YA 1VQPN 4Q2MA 4KHUA 3BR9A 1FESA 2MDAA 3VEWA 2KJVA 5GADI 4JYAF 4X64J 2RSQA 1RWPB 1HPZA 1C1AA 2X78A 4N77A 3PVXA 4JI8F 2Y1RI 5JMNA 2P9LB 3KLGB 3A8YA 3L2QA 1KBRA 2RHSB 4A8WA 1QVGM 4Q43A 4ER8A 4G65A 1SKUB 2CNLB 1LWXA 3PR4A 5HLFA 4F67A 4BRDA 2MQQA 1M90O 2GFFA 4OYBA 3E2EA 5AR0A 3H4BA 3TABA 4ZVHA 3I5BA 2YHAA 4WZQA 2Y1LB 2RHQB 3JQJA 5GMEA 2YKAA 3J7ZT 3TA0A 4BRGA 2CWXA 2AX0A 4Z94A 4J8FA 2C2EA 2FZGB 3MEDA 5IWAF 2FSKA 1U45A 3QT8A 4OLBA 1HWJA 2JVRA 4M63C 3C46A 1IG9A 2VQFJ 4DCHA 3ZSYA 1VC5A 2D0CA 3GIKA 4FVMA 4TNOA 3D2EB 3FJ2A 2CPEA 1NH8A 3E9LA 4CHZA 2DPIA 1NXIA 4I4BA 2K1RA 4TU9A 4K4VA 3FQKA 3PRVA 4AHUA 4BGBA 2GHPA 1RWUA 3PSFA 1RT1A 3HSGA 1HX1A 2BE2A 2DH7A 2DHAA 3MOZA 3OTBA 4CT8A 3LANA 9RUBA 1RHMB 4LF2A 3HT0A 2LEPA 3P49B 1DZ5A 3QESA 3E51A 3CYMA 4LQ3A 1RGVA 5GAGI 5BR9A 2P9CA 1HNZK 1SVDA 4ES2A 1KDNA 3ATUA 3OTCA 4BCAA 2PFUA 2P9KA 5L9XA 2O8DA 3VEXA 2QWPA 4FLXA 4OZLA 1T9YA 2NZTA 3QMQA 2HRTA 2MHEA 1T9TA 1E6YB 3LDLA 4DV6K 4DR5K 5DLGA 3AVKA 3VGKA 3AV9A 4O0NA 4EAHD 2CPXA 2DGWA 3VALA 4CJSA 4H4MB 3RZAA 1FRIA 5B0FA 1YF5L 1TL7A 2QN6B 4JI4J 4FYXB 1FDAA 3HVTB 1SH3A 1RTJB 1HKAA 4DEZA 1N32F 2C22A 4X2BA 4RW6B 1S9GB 4GO5X 4CFCA 3AO1A 2Z1GA 5LJVA 3IS9B 2E1CA 5DJBA 4LRCA 1P8GA 4WFZA 3SCJE 5I42A 2DIUA 3GG1A 1ZH5A 4FPBA 4DTSA 2PIIA 1FW6A 2GX8A 4P9SA 4B3MJ 3QRQA 1KSPA 3IO1A 2ZF5O 2YCHA 3HHEA 3J7YU 1UVIA 3V9UA 1ZBTA 2QEXS 2BW7A 3ITHA 1RWVB 2DH8A 3JQMA 3TJ8A 3CC7N 5LJWA 3VESA 3DLRA 5CYQA 1X5PA 2NRTA 3D7EO 4OX9F 3ZNUA 3Q86A 4DV7F 3VQBA 2XGQA 4W98A 4CJTA 4LR7A 2ILYA 2NYIA 5J2NB 4AHRA 4HTLA 3BZCA 1XMQK 1MU2A 4M5IA 5FD1A 3W0LA 3OYDA 1FK9B 4NWBA 4URGA 1FKOA 2AQ4A 3SUOA 5G0RB 4CJWA 1U0SA 1UFLA 3BR8A 3F56A 1VMBA 2BRKA 2ITGA 3MAQA 3OJSA 3UI3A 3PDNA 2KRRA 3PW5A 1S6OA 3NMAA 2QK9A 4C48A 4KGZB 2KG1A 2RDDA 3MCNA 4BLGA 3V81B 3HHLA 1UZDA 3AVCA 4U7BA 3PJXA 4DR4F 2VB6A 3SJJA 4FKYA 1DLOB 2DY9A 4OYZA 4BRNA 2VYPA 1CC7A 1S7IA 2G2YA 3F5TA 1YBAA 2IRYA 3ZTPA 3QGIA 1DTQA 1YZ7A 3ISNC 4DUZK 5SUHA 2KRBA 4LBHA 4CM0A 4Q2LA 1TV6B 1R0AB 5CYJA 4CT9A 3H8YA 4Y28C 2HVZA 3G71S 1EP4B 4IO9L 2W2NP 2QWMA 1GLEG 4K25A 4CNYA 1TL4A 5BRDA 3W63A 3AXMA 3ID6A 4A8KA 4YMEA 3NLCA 4ZMMA 4CO1A 2W42A 3CD7A 2H5JB 3O4WA 3QJLA 1ASWA 4W90B 3GYNA 4FLVA 3QGHA 4CO0A 4H0OA 1CJTA 4NLDA 3AT1B 1HNWJ 4EWTA 1BHNA 4X4NA 3O80A 4B3RK 2M5YA 4FWKA 1M5OC 1X4EA 2RQ4A 4WIQA 2L3MA 4O3QA 4FWNA 1OMSA 4CTAB 2DRDA 4BG8A 1S6PA 2CVEA 5SZTA 3CQ8A 1TTHB 1M1GA 4J9QA 3ZZUA 4DTXA 1X9SA 1ATNA 3OD2A 5KG2A 4KHMA 2MJUA 2NSBA 1XQIA 3W66A 4V19X 3RB0A 1KC8T 2ATCB 4F4WA 5HRPA 3G96A 1ZPWX 4JI3K 1LWEA 3FEXB 4CK1A 4WQ4A 4U7UD 2BKOA 1FJGK 3KK2B 2DBBA 1NDKA 2DJWA 1JKHA 3QNWB 3F44A 1H72C 4K4ZA 2E1PA 1YJUA 2BANB 2AYEA 1APSA 1RWXB 3PEJA 1TK5A 3J81Y 2CNNB 2VBZA 2ZJRQ 5DM6L 4Q8FA 1W26A 2VZ9A 4KHNA 1W9HA 3TTCA 4ZA1A 1LWFA 2J5AA 4B1YB 3DLGA 4XIUA 4DQRA 4DR2J 3O2IA 1Q82O 1VISA 5HLFB 5HO4A 3IFRA 2BGGA 4QIEA 4OZ2A 2R2SA 4ZVUB 3E1YA 4NCBA 2GWKA 4IO1A 2HQCA 2HFUA 2IVPA 5GINA 3L7OA 1Y10A 1YTAA 3RBXA 4LFAF 1X60A 2NZ4A 3DLJA 1WOPA 2I8EA 4OV6A 3MM5B 4DSLA 4USTA 4E89A 2RUSA 2CZ9A 5GAGU 1KQSR 1O51A 4PYAA 3MEDB 3TQ1A 2X6SA 3U9DA 3AA8A 1HMVA 2JHEA 1D5AA 1HLUA 4MK8A 3R2DJ 4JKCA 1NGDA 1T0TV 1EQMA 2HHPA 3EVMA 3NL0A 2E8AA 3FRYA 2I9SA 1B7FA 2KFYA 2WVEA 2B4VA 2NXEA 4LSLB 3FGUA 2GWJA 2BE2B 4DR1K 4BY9C 4H4OA 4CERA 4YOWA 3V4MA 4QYZK 4RG8A 2E88A 5C2GA 2LMIA 4DV4K 3LDSA 4CHOA 3GSDA 2A2DA 2DNGA 3AODA 1SAZA 3LM9A 3VETA 2CQ0A 3AAQA 4JK7A 4OGEA 4W5QA 2XS2A 2OTLN 2P9KB 2OTJN 2O8DB 4DV1J 4FSVA 2DR7A 2JEJA 1HYVA 3JQKA 5GMKa 4JI6J 4JK8A 1LW0B 3BBFA 2HRYA 2UYTA 2HK3A 4BE1A 2UU9J 4F4KA 1S9EB 5EWGA 1V4TA 2E1YA 4HDHA 3EE3A 2Z1HA 3N5BA 4A8XA 3NAEA 3DLHA 4C9DA 3G0ZA 3VAIA 2KW4A 1RBSA 2E5HA 3C6UB 3M05A 2OSQA 3K2YA 3HVRA 3FSXA 2MY7A 1LOUA 5AQVA 1UPPA 3A0IX 3LO3A 4ZTFA 2YPZA 3L0QA 2XI3A 2ZHOA 4ECZA 4TY9A 1B4SA 1HLWA 1XNRJ 3L4QA 1HR0F 1B99A 2XHWA 4IOXA 4DOZA 2O8BA 1UFKA 4PPDA 4BRFA 3NE6A 2CRLA 4O0JA 2GJ2A 2BR0A 4AH9A 1O0PA 3OUYB 3QFPA 2P5OA 4YHHF 1M90T 2XGPA 4E19A 5KFCA 1XMBA 4CLFA 4CEAA 4HYKA 3GTYX 3MX5A 4RNNA 4GVMA 2ALZA 2YWEA 2E1MC 2H9ZA 3EDRB 2VOPA 1J6ZA 4G3IA 3PTWA 1QD1A 5A8RA 4X66K 1MU2B 2FF3B 4ZTJA 1PYSB 2JLEA 2J7WA 3BGOP 1FKOB 4KTQA 5K5MA 4OLOA 5THWA 1YTUA 3MF5A 2XI2A 2NRVA 2J7KA 2YQ1A 3C6HA 4KH4A 3ZT3A 2YWHA 2RF2A 2CH5A 3CD0A 3UE2A 1J53A 5KG1A 4KGKA 1AYEA 2HKEA 3AO4A 2QWRA 1RAJA 1HKCA 3HHLB 4LF7F 1FEHA 3GIIA 2NCKL 2QKBA 3VQEA 4JI2F 3I8BA 1SQKA 5ETKA 3OFFA 1H2TZ 5B0CA 4X62F 1ATSA 4MIBA 1MN7A 3C16A 2VU5A 2MZRA 2GV9A 4PG7A 4IRCA 4CZEA 3A5OC 1DTQB 4CGFA 4CYUA 2IGIA 2FC8A 3WIVA 2PMHA 1YT3A 3VERA 5K8MA 2EK6A 3OHBA 1SBRA 1PJ7A 1LW2A 4OYPA 1YXQA 4C97A 3SYZA 2F8EX 3BQ0A 2ZDOA 4PWUA 3M9MB 3MMCB 3DRRB 3G6YA 2QWNA 4JKDA 2UXCK 1UETA 2E5GA 1VQYA 1L5UA 3EZWA 4J37A 4H54A 2XBPA 2ATQA 1CJTB 5J2QA 4JI8J 5L1JA 3MM9A 4DPTA 3D3BJ 3PX4A 5F3TA 1S3XA 5DDRC 3PO4A 1G15A 1WOOA 3CJ8A 1WAFA 4B9MA 1S6PB 2KFZA 2PY5A 3LM2A 3CJTA 4N7TA 1TL5A 3VF6A 1T3OA 4YDDB 3AJDA 1F1BB 1FXDA 3UPFA 4CZFA 2I7NA 5ETVA 5LY3A 1YQHA 3AO5A 1WOSA 3BO4A 3DI6B 4RW9B 4LF6K 1LWEB 1B0VA 4ENOA 5D6GA 2H48B 3QEVA 1X4HA 4JV5K 4ZPTR 5IWAJ 2VH7A 5KFFA 5HP1B 3LP1A 1JKHB 3DN9A 4NLPA 2G0JA 2C3PA 2SXLA 2WUSA 5D4LA 3I0RA 3A8KA 1WKKA 4OGCA 1G99A 5EX5A 2WBNA 1NB7A 2LCWA 4K2XA 3F73A 4EK2A 2KI2A 3MCMA 2FJBB 3Q8YA 4ZJQA 2UUBJ 2CJ9A 2IOCA 1RT7A 3T1AA 1WDTA 1GOCA 4U6PA 2OTLS 3DLGB 2OTJS 1B0TA 2JRSA 1S72S 2P9NA 4IH5A 1N5VA 1QE1A 4ISEA 5EY4A 2K7KA 2DHHA 3G8QA 2NRZA 1KFDA 2V8VA 2DK2A 3VAMA 1WG5A 1VC0A 3MPYA 4TLQA 2Z4PA 1W7AA 4LQ9A 3N6MA 4NPOA 1BCOA 5L1IA 3HSTB 1XK8A 1GNKA 3PIPQ 3SMPA 2MEWA 5CH7B 5HQLA 1JX4A 1L3TA 1KQKA 4E8UA 3UVJA 3A8JA 1T03B 3EGNA 4OL8A 1V3SA 4H4OB 3DFEA 1EXQA 5F8MA 3D0IE 3IWXA 4RPFA 3O8MA 3LA0A 2KQ2A 4Y0FA 3HKWA 1IBMJ 4NLRA 4ZHRA 4FK2A 5M1NA 3P5BP 4AD6A 4FPAA 3CULA 1VLYA 3EGWB 3CDAA 3AGRA 3QT6A 4NA3A 1I94K 1VQ6N 1X5SA 3I4HX 2EXUA 4F25A 4K0KF 2D41A 1QUPA 2MKJA 4OX9J 1TU0B 4DV7J 2DCUB 3NP5A 4RU2A 3M4XA 1WNEA 3CCEN 2V7YA 1S1WB 2DO0A 2UVRA 1VOMA 1X3MA 3KHGA 3VQ8A 4FXVA 1TL1A 1OYDA 2A1SA 3CJ5A 1IQTA 1U04A 3AO3A 2CZVC 3HSDA 2GEMA 3UKUA 3AVJA 1T8EA 4X64K 2YH1A 3TVZA 2XO6A 2F9WA 2HOEA 4ZPAA 2I6WA 2LFVA 3IBCB 4JD2A 2PD1A 4JKBA 3PW7A 1DQ9A 2D69A 1Y3JA 1KONA 2R7QA 1S48A 5F1XA 4NASA 3SCKE 5T7LB 5IC6B 2VJVA 4I2PA 4IRKA 1NRKA 4DPWA 1CJUB 1IWAA 4CIFA 4DI6A 2ASYA 1R43A 2W7OA 1TL3A 3K5NA 4DR4J 1C1CB 1JCGA 1U26A 3M2UB 3OS1A 1JLCA 3DLBA 4AL5A 3NF8A 3VQ6A 3RAMA 3ELHA 4ZPDA 4P7VA 2IA6A 2J4RA 3JS9A 3POTA 4RKUC 4ATNA 3U3GA 4TU8A 2XRIA 2CWKA 3NF6A 2AEFA 4J9SA 3PKYA 3BDEA 4DR6K 4XPCA 4B9TA 3D45A 4OFZA 5A8RB 2XS7A 2JGUA 2KDOA 1N6QB 4K4TA 2Q1NA 4JI5F 4UQTA 2XWXA 4F2SA 4AHCA 4CEEA 4CEQA 3PCOB 1VSMA 4XTTA 4JLHA 4RR5A 4PKGA 1RACB 3KG4A 5C0YA 4JKFA 5KFNA 4ZKAA 1FCAA 1TMMA 2UZAA 2ZJPQ 2RQCA 1DKGD 2BKNA 5FRNA 4RCHA 2RF2B 4LC9B 4CBXA 4GVLA 2JOQA 1RE1B 2Y8YA 3EXYA 1URRA 3BF3A 5D3GA 3CF5Q 3MEEA 3QRPA 3MXMA 1WF0A 5ETRA 1N4LA 4KO0A 4FNHA 3KNGA 2EG2A 2V51B 1VQ8N 1Y5NB 3DU6A 3C16B 3KK7A 2FJVA 4J7CA 2M8DB 2M2BA 5EOYA 3HHLD 1ZM4A 3FVYA 2UUAK 4KJIA 3PW4A 3QBWA 4CYUB 2IA0A 2W9CA 3BGRB 2B7BB 2R2TA 5LXRA 1PGZA 4EI2A 3KIOA 1LW2B 3QBXA 5KFKA 3CMEN 3CFRA 1VAZA 3DU5A 2M4MA 1HWUA 2XMUA 1F6TA 5AQFA 5CZVA 2QMUB 2XM3A 2CIMA 4TKTA 2E2PA 1UW9A 2A2CA 4KE5A 4GY2B 2VFUA 3TO8A 3PG9A 2ZDPA 3FZFA 5DMRA 2RS2A 1FE4A 4RX6A 5BR8J 3DCAA 3QB0A 2KN4A 2E1RA 5C12A 3T5JA 4WYBA 4B3MK 3M30B 3K2PA 2HIQA 2XZDB 4IEEA 3MM9B 4KFBA 3P5JA 3EWGA 3ZTQA 1NGIA 2AW0A 4LFCJ 1RGIA 3CCUN 3SXLA 4C7QA 4U7UK 5K8NA 4CDIA 2RU3A 3D68A