1F21A

Divalent metal cofactor binding in the kinetic folding trajectory of e. coli ribonuclease hi
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
152
structure length
152
Chain Sequence
KQVEIFTDGSALGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHAEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERADELARAAAMNPTLEDTGYQVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RIBONUCLEASE HI
publication title Divalent metal cofactor binding in the kinetic folding trajectory of Escherichia coli ribonuclease HI.
pubmed rcsb
source organism Escherichia coli
total genus 44
structure length 152
sequence length 152
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2000-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1f21A00
4CEBA 3NGZA 3VQPA 4DTXA 5JS2A 3PX6A 3KKRA 4KHUA 3WNFA 3LP1A 2DTUA 4CEFA 4R5PA 4CF8A 4CHQA 2HHXA 1QSSA 4CGFA 2HB5A 4JLHA 3V1QA 2YKMA 3ZCMA 5KRTA 4OPKA 4CJ5A 2YKNA 3RMDA 4C8NA 4CEOA 3AA5X 1WSEA 3NHGA 3DMJA 3DRRA 5SZTA 1WAJA 3DYAA 3OYJA 3CM5A 1BI4B 1T7PA 3HP9A 4JRQA 2G8HA 1X1PA 4KPYA 3A2FA 4CGHA 3ZSXA 4FJ7A 4HTUA 3AVIA 4DTMA 3AVHA 1KLNA 1W9HA 4JS4A 3PO5A 4FJ9A 4I7FA 5J2PA 2GUIA 4J2AA 4DSIA 2GV9A 4F2RA 3K2PA 3SUQA 3IAYA 3VQEA 4L8RB 3QIPA 3WNGA 1REVA 2FC0A 2O4GA 3L3VA 4LSLA 3OY9A 1GOCA 4FM1A 4KREA 2HW3A 2OPSA 2F8SA 3TAPA 3HXMA 2IOCA 4RW8A 1TGOA 4NCAA 3ZSWA 4MFBA 3TANA 4DTPA 2YHAA 2OA8A 2P5GA 4G1QA 3KLFA 5J1EA 3ASMA 1W0HA 4FK4A 1JLEA 4M42A 1VSDA 2HHWA 2LSNA 4PQUA 5SWMA 2VG5A 5C24A 4LY7A 1X9MA 3NE6A 3ITHA 4FLWA 1D5AA 2Z1JA 3H08A 4ZTFA 1BL3A 4B9UA 3AO5A 3QIOA 4CHNA 1HRHA 1HMVA 3O3FA 2PZSA 4O4GA 2X74A 2A1RA 3AA3A 1U04A 4KB0A 4DMNA 1IG9A 3V9XA 3AVBA 1RBVA 2WOMA 4DU3A 2XY7A 2KZMA 2HNYA 4FJJA 4KHWA 4E1MA 2GBZA 4ID1A 4KTZA 4CJEA 3O3GA 2JGUA 4EP5A 4KHQA 1CXQA 3PX0A 3QNNA 3RMBA 1VSIA 4B9NA 5DMRA 4H8KA 4FZYA 1VRTA 3K57A 3B6OA 1BI4A 2D0CA 3QEIA 2E6MA 2XY5A 3PY8A 4ELTA 2ZQBA 1TVRA 4OKKA 3QO9A 1Z25A 4CHYA 3MXMA 4BE1A 5J2MA 1NK8A 3C94A 3VQQA 4BE2A 4CE9A 1RTJA 5KGWA 4E1NA 3KIOA 3DLBA 3DLRA 3OYNA 2KFNA 2P51A 3OYEA 3THVA 3RTVA 3NH1A 3F9KA 3OYAA 4KI4A 4QCLA 1BQMA 4CEDA 3IRXA 3L2WA 4B9TA 2QKBA 1S1VA 3ZT1A 1JLQA 3VQAA 1L3VA 4PY5A 4KO0A 4OLAA 4NCBA 4CHZA 3TAEA 1SKWA 4N56A 1RDCA 2Z1HA 1S1WA 4WE1A 4Y1DA 4FLYA 2HVIA 1A5VA 1IH7A 1DTTA 1UOCA 3DRSA 1RBRA 3U3GA 1RBTA 1B9DA 1BCMA 3ZT0A 4OPJA 4Z4CA 3QERA 3LPTA 4DSFA 4E7HA 1BISA 4BACA 3KK2A 3HPOA 4FM0A 4DF4A 3AVNA 2OYQA 1QS4A 4FW1A 1ZBLA 4EP4A 3HO1A 4Q0BA 3LZJA 3OYIA 1TK0A 4CJKA 3TI0A 4RW4A 4IBNA 2R7YA 4B9MA 4F2SA 4Z4EA 1ZBIA 2BANA 4AH9A 3KLEA 1I39A 3VQ8A 4DQSA 2G8WA 2G8UA 2NUBA 2FBYA 1TKZA 3ZT3A 3HP6A 4HHTA 5CZ1A 1TL1A 4DTRA 4HCBA 4CGIA 4FCYA 3S3MA 1U45A 1QSYA 4O55A 1RT5A 5KI6A 1Y97A 3DRPA 4DS4A 4FJGA 4DQPA 4DQRA 4B08A 3I0SA 4DWIA 4KHNA 1DLOA 5DK5A 4ELVA 1X9WA 4DFJA 4K8XA 3OYKA 1Q9XA 1WSFA 4CFBA 1ITGA 3SZ2A 2BDPA 1LW2A 4E7JA 1F21A 3AA4A 3AVAA 3SQ1A 4CJ4A 1WAFA 4M3TA 1WSIA 1HYVA 5CY4A 3E01A 4M3YA 4RW7A 3MAQA 3SYZA 1TKDA 4CGDA 3U3YA 3NF7A 2OZSA 5FRNA 1ZYQA 4FLTA 4Q5VA 5E41A 1SKRA 2G8FA 5CZ2A 3OJSA 1VSEA 3M8RA 4DFMA 3IS9A 4QAGA 1NK4A 3VN5A 3K59A 3K58A 3HPHA 2PYLA 3ZSZA 3KLIA 5J2NA 1RT3A 2BE2A 4W5TA 3QEVA 3AVLA 2VG6A 4B3OA 1T05A 1QSLA 4EZ6A 1ASVA 1JLFA 1MU2A 1CZ9A 2PY5A 1HYSA 1LWCA 4N76A 4FJIA 4CECA 3EY1A 4E7IA 1SL1A 4HCCA 4J2BA 4M45A 4QOZB 1XI1A 3AVFA 4KRFA 3G0ZA 5HRRA 4GMJB 2Y1JA 3O3HA 4LH5A 3NGYA 3T19A 3MEEA 4K8ZA 4DTNA 4PUOA 2QXFA 3V4IA 3I0RA 1QTMA 2DY4A 4DQQA 2DFFA 3AVCA 3CQ8A 5C42A 3K5OA 2Z1IA 1J54A 3LAKA 1JLGA 5K14A 4CJVA 1NKCA 3AVMA 1B9FA 4ZHRA 3QETA 1IKYA 3CFOA 3DI6A 1TKTA 5HRPA 1ZBHA 4AHUA 3JYTA 3HT3A 1RTHA 3NF8A 1TK8A 1B92A 4E3SA 4M3XA 4DU4A 3SQ2A 3RR7A 2HNZA 4KAZA 2O4IA 1HNIA 1U4BA 1BHLA 5KRSA 2G8KA 4FZXC 3S9HA 5FROA 1XWLA 3RRHA 3QEPA 2QK9A 3P1GA 4CJRA 3NCIA 1XHXA 3PV8A 3HL8A 4BWMA 4LH4A 4FJLA 2RPIA 4N41A 4FJ5A 3LPUA 1RT7A 1J9AA 4FLZA 4FJKA 4FLXA 2YNHA 3I8DA 1NKEA 4FK2A 4IFYA 4B8AB 3TABA 1SKSA 1YTUA 2YNGA 4CEAA 4CF9A 1LAWA 3NAEA 3KLGA 3DOLA 3NGIA 1NJXA 4C8KA 3DOKA 4CFDA 3B6PA 3ISNC 4HUEA 4KKOA 4PWDA 2RN2A 4YFUA 4CFAA 1KTQA 4FYDA 4KTQA 1YT3A 3DM2A 3VQ7A 2XY8A 1C1CA 4CERA 2YV0X 4KB1A 1TV6A 3OYDA 3OYCA 3MEGA 1HQEA 1S1UA 3M8PA 1TK5A 4E7LA 5HP1A 3OYMA 1S1XA 2X6NA 2EHGA 2F96A 1A5WA 4CIEA 2PYJA 3LP0A 5I3UA 1FK9A 4AHCA 1HJRA 4IG0A 4E7KA 2X6SA 2XY6A 1HPZA 3NDKA 1RNHA 3OS1A 1NJZA 1U48A 3SUNA 1X9SA 3M8SA 4FJ8A 3L3UA 1TL3A 1WN7A 4H4OA 1NOYA 2P5OA 4EZ9A 1J53A 4BDZA 3BGRA 4Z4HA 4DTJA 1LV5A 3VA0A 3V9UA 3OYFA 1NK6A 4ELUA 1CLQA 3SV4A 1S6QA 2KQ2A 3DLKA 3HSTB 1C6VA 3VQ6A 4DFPA 2JLEA 3ZT4A 3LWLA 4E0DA 3C6UA 2ZD1A 3L8BA 3AVJA 4DG1A 4CGGA 1FKPA 4CJPA 3CFRA 3CG7A 3MXJA 3TAFA 4CK3A 3VA3A 1KVBA 1IKVA 1BIUA 4CJTA 1LWFA 1JKHA 4BE0A 1I3AA 3KKSA 1S9EA 3V9SA 1RT2A 4B8CA 1J5OA 4FW2A 3V1RA 4Z4FA 4W5OA 4ZTJA 5CYMA 1BCOA 2B6AA 3L2QA 4CESA 3ZSOA 1EXQA 3S3OA 2I5JA 3P83D 4KTWA 4CCHA 4ID5A 5JS1A 4OJRA 2KTQA 2A1SA 3NFAA 3RWUA 3QEXA 4RW6A 3EZ5A 4IG3A 3SV3A 4O5BA 4LD0A 4FLUA 4M41A 3SQ4A 2QKKA 1NJWA 4NYFA 4JRPA 4FK0A 4XIUA 4CEZA 1ASUA 1RDDA 3TWHA 4DS5A 1TAQA 4CFCA 3MEDA 4OGCA 3OYGA 1NJYA 3SUPA 1RDBA 4IFVA 5HRNA 2VWJA 3RR8A 4CJWA 3VQBA 4J2EA 1WNSA 1CZBA 2FBTA 3EYZA 5CYQA 3KK1A 3IG1A 1KRPA 4B9LA 4BWJA 3OYBA 2IC3A 3SCXA 3RRGA 2P1JA 4PA1A 3M8QA 1R0AA 5T7BA 1L5UA 3AV9A 2YHBA 2HVHA 4IKFA 4GW6A 3ZSYA 2IDOA 2ETJA 3AVGA 3PUFA 4YNQA 3U6FA 2G8IA 1YTAA 4DLGA 1ASWA 4CK1A 4DU1A 1TKXA 3KLHA 2EX3A 3QLHA 3KD5E 2HHTA 3NBPA 4OVLA 1NKBA 2KFZA 3G10A 4TSXA 5EU7A 3TARA 1Q8IA 1WSJA 1JLAA 2X78A 3NH2A 2RKIA 1KLMA 2D0AA 1WSHA 3UIQA 2BGGA 1JXEA 1D9DA 3NF6A 4GVMA 3V9ZA 1TAUA 1QHTA 1C1BA 2ZE2A 3CM6A 4C8MA 4N47A 4CF2A 1ZBUA 1EKEA 3ZSQA 1DTQA 3OJUA 4KFBA 1C1AA 2OPQA 4LSNA 4BDYA 1RTIA 1VRUA 3KJVA 4AILC 3V81A 4C8OA 4KV8A 1SL0A 2XRIA 1EX4A 1IKXA 1S1TA 2E6LA 4DF8A 4B9SA 1C0MA 2Y1IA 5FDLA 4BDPA 4KHYA 4CIFA 3AA2A 1RTDA 3HVTA 2DFHA 3T1AA 4CF1A 4HUGA 1JXBA 2HNDA 3AO1A 3L2RA 3VQCA 3JSMA 3K5MA 3V1OA 2B4JA 5KGXA 4JS5A 4M3UA 3SI6A 1T03A 1Q9YA 1VK0A 3P5JA 5FRMA 1FKOA 4DSLA 2IGIA 3CYMA 3NH0A 3RMAA 4CJUA 3SUOA 3HPGA 1LW0A 1QQCA 1JL1A 2IAJA 1XHZA 3DLHA 4KHSA 4ICLA 2Z1GA 4O44A 4OLBA 2HHQA 2OZMA 5KTQA 4M3ZA 2KZZA 4W5RA 3HM9A 1RT4A 3KD1E 1VSLA 1QE1A 3SPZA 5I42A 1XC9A 1RBUA 4E19A 4FJMA 4M3RA 3LALA 3AO2A 1LAVA 3LZIA 3AVKA 4FM2A 1ZBFA 3LP3A 4F4KA 4Z0UA 2VWKA 3DLEA 1JLCA 4I9LA 2XHBA 3BDPA 1N6QA 1N5YA 3TR8A 4HUFA 1G15A 1KSPA 4N5SA 2HHSA 1L3TA 1BIZA 1FXXA 4RG8A 4DQIA 1VSFA 5HLFA 3LP2A 4DSEA 4I9QA 1KVAA 1D9FA 3VQ4A 4CJLA 2Q3SA 1JLBA 4CJFA 2RF2A 1KFDA 1GOBA 4DFKA 1JL2A 2VG7A 5C25A 3VQDA 1C0UA 3LAMA 1L3SA 1EP4A 4HVJA 3QNOA 4CIGA 3OS2A 4CHPA 1YVUA 5J2QA 2E4LA 3WNEA 4CJ3A 3MXIA 4C8LA 1KCFA 2F8TA 4AHSA 3SPYA 4NCGA 1K6YA 4Z4GA 2W42A 5D3GA 3OVNA 1IKWA 4DSJA 1RDAA 3S3NA 1BQNA 3TAMA 4CJSA 1D8YA 2XO7A 1UWBA 3ZT2A 3KK3A 1SUQA 3V9WA 2KW4A 3TAQA 3PO4A 4MQ3A 3HJFA 2HHVA 3SNNA 4Y1CA 1GOAA 4CJQA 2FBXA 1HNVA 3SJJA 4RW9A 4H4MA 5HROA 3ZSVA 1T8EA 1RT1A 4AHRA 4OKEA 2D0BA 4OKJA 4FJHA 3O4QA 4DSKA 4M3WA 2YNIA 3OYHA 4CEQA 3L2UA 1KVCA 5HBMA 4FXDA 3ALYA 3AO3A 3KTQA 3T3FA 3TAGA 4FZZA 2WONA 1BGXT 1S9GA 1SL2A 1S6PA 2YNFA 1S5JA 1RILA 1WLJA 3K5LA 4AHVA 1KFSA 4FJNA 1O1WA 1U47A 1RCHA 3DLGA 2HHUA 2FBVA 4CGJA 3AO4A 3V6DA 2OPPA 1U49A 1A5XA 1IO2A 3D0PA 4DTSA 1NK5A 3VQ9A 3LWMA 1RT6A 3LDSA 1VSHA 4I2PA 3VQ5A 4F8RA 1CXUA 1LWEA 3HVRA 4F3OA 2OPRA 3CFPA 4O0JA 3QESA 4B9VA 1VSJA 1HYZA 3PX4A 4NYNA 4DTUA 1VSKA 1UAXA 1NK9A 2G8VA 3HYFA 1UA0A 2D5RA 1HQUA 2HMIA 3F73A 4FJXA 3RMCA 4I2QA 1NK0A 3HK2A 3D45A 1RBSA 3L2VA 1L3UA 4FVMA 4AHTA 3FFIA 4O0IA 1EETA 1UA1A 1WSGA 2B5JA 2IS3A 4CHOA 3LANA 4IDKA 3OYLA 4F3TA 4KI6A 1SV5A 2ATQA 3MECA 2AJQA 4DLEA 1Z26A 4E89A 4OGEA 4CK2A 5HRSA 3OS0A 3ULDA 4J2DA 3O4NA 4W5NA 4W5QA 3C95A 4UQGA 3SQ0A 3C6TA 3WNHA 3NF9A 1NK7A 1VSMA 1C0TA 2DFEA 3ZSRA 4DTOA 4Z4IA 4CEEA 3QEWA 1NOZA 2ITGA 3K5NA 4CF0A 4FLVA 3QINA
chains in the Genus database with same CATH superfamily
3VQPA 5JS2A 1VQLN 5C2DA 4BY9C 1EQYA 4R5PA 1Q18A 3DJCA 4CGFA 4JLHA 5CHIA 4CJ5A 4YOVA 3DMJA 4BRHA 3DYAA 4CZFA 1BI4B 1T7PA 3HP9A 4JRQA 5FPMA 3ZSXA 1RGIA 1ILYA 2O8DA 1T6CA 1NGDA 5AQVA 1NBWA 2BUPA 1NGBA 5J2PA 2Q36A 4BRLA 2GV9A 3IAYA 3VQEA 3OY9A 2HW3A 4LSLA 1GOCA 1ZXOA 4FM1A 5M1QA 2IOCA 4RW8A 3LM2A 3TSQA 3ZSWA 3EL2A 3ZX3A 3A8YA 2YHAA 4C23A 4U7BA 4AF1A 2E8AA 4FK4A 1DEJA 1W0HA 2I7NA 3H46O 2HHWA 2LSNA 5SWMA 4LFAK 4HWIA 1I94K 3H08A 4B9UA 1HRHA 4IXCA 4O4GA 1BA0A 4JD2A 3AA3A 4M63C 4KB0A 1IG9A 1NGJA 3AVBA 4DU3A 1VQNN 1J6ZA 5AQYA 4E1MA 4AM6A 4KTZA 2IVPA 3N4PA 3PX0A 5DMRA 4JHDB 4ELTA 2D0CA 3KVGA 2E6MA 3CQYA 2CGJA 3WXKA 4BE2A 5KGWA 3OYNA 2P51A 3THVA 3F9KA 3IRXA 4B1VA 3ZT1A 4KO0A 3H3OB 5CE3A 5IT9O 4NCBA 4WE1A 1K9MO 4CZIA 2HVIA 1A5VA 1UOCA 4OPJA 1RBRA 3SAHA 3QERA 3LPTA 4DSFA 3KK2A 1BU6O 4FW1A 3HO1A 3MCPA 4CJKA 4Z4EA 4IBNA 2R7YA 4B9MA 3M5RA 4F2SA 1NU0A 3BUZB 3QFUA 1BOTO 3KLEA 2G8UA 4MDBA 5AQNA 3ZT3A 2FBYA 1TKZA 3NVKA 1TL1A 3PSIA 1XC3A 4FCYA 3S3MA 1QSYA 4O55A 1RT5A 3C7NB 3I0SA 5FPDA 1X9WA 4DFJA 5C12A 4H5WA 3WQTA 1WSIA 3E01A 4M3YA 1WUAA 4RW7A 3T1YK 4CGDA 3SMSA 3THXA 4Q5VA 1SKRA 3TSPA 3OJSA 4MLEA 1BWFO 1S72N 4FPBA 4PHTX 4JKHA 3QEVA 1GLEG 3AVLA 5F0XA 4BVOA 2O8BB 4N76A 4DV0K 1VQKN 4FJIA 4HCCA 2O8FB 2HOEA 4M45A 3CC4N 3WXIA 4LH5A 4DTNA 4PUOA 3I0RA 3J8AA 4DQQA 2DFFA 5C42A 3K5OA 2Z1IA 3DXKA 3WQUA 1OVQA 3MN7A 1IKYA 1JCFA 1TKTA 5AJ3K 4OX9K 3JYTA 1TK8A 2HNZA 4KAZA 2O4IA 5JVGL 1SS6A 2G8KA 1HUXA 5FROA 2FF3B 4BG8A 2QK9A 2A5XA 3HL8A 4BWMA 2QW9A 2RPIA 5AQZA 4JI1K 4FK2A 4B8AB 1SKSA 1VAZA 1EWQA 5GADP 4CF9A 3NGIA 4PWDA 4KKOA 3CPEA 2UXBK 4IDHA 1V4SA 2YV0X 3D6RA 3OYDA 3MEGA 1HQEA 1S1UA 3M8PA 4WCEL 1IBKK 1D4XA 3L6QA 3OYMA 4KPYA 4H0YB 5I3UA 1FK9A 2P9UA 2XY6A 1Z05A 1YF5L 4FJ8A 4EFHA 3L3UA 3VEWA 4EZ9A 4BDZA 4Z4HA 3V9UA 4CI6A 3VEOA 1CLQA 4A5BA 3DLKA 4E0DA 4B3SK 3JS6A 3C6UA 3CFRA 4CJPA 1FKPA 3K9JA 2KHOA 4CK3A 5GAHP 3RSEA 4CJTA 3KKSA 5AQPA 4B8CA 3DXMB 1C0FA 2P9NB 5A2QO 3VOVA 3L2QA 2QM1A 1ESVA 3VF2A 1WB9A 3QEXA 4IG3A 1GLDG 2AA4A 4O5BA 4FLUA 5HOOA 4FK0A 4XIUA 1ASUA 3KWIA 4JN4A 1GLCG 4FWNA 3MEDA 4OGCA 1NJYA 4IFVA 5HRNA 2NRZA 4JKGB 3MN9A 5AQTA 4K0KK 2WC9A 3VQBA 3CD6N 1WNSA 1WBDA 4WFBL 4B9LA 4BWJA 1OH5A 4PA1A 2CH5A 3M8QA 2W6KA 3CHWA 3AV9A 2YHBA 2HVHA 2E1ZA 3PIOL 2ETJA 3U6FA 1E3MA 3AARA 1YTAA 4DLGA 4BRIA 5ADXA 1TKXA 4BR4A 1HLUA 4OVLA 3U8XA 1YJWN 3G10A 1NKBA 2KFZA 1KLMA 2BGGA 5KQ8A 3NF6A 4YDUA 3BF1A 2VGNA 2ZE2A 4N47A 1YVNA 3KZBA 2OPQA 4BDYA 1RTIA 1IKXA 2E6LA 5BN8A 1C0MA 5FDLA 3CCMN 3AA2A 3JAMO 4JI6K 4CF1A 1JXBA 3VQCA 2B4JA 3THYA 1Q9YA 5FRMA 3L4IA 4B3MK 4DSLA 2P9SA 2IGIA 3CYMA 3RMAA 2HSTA 3DLHA 1QHAA 3OBWA 4FWKA 4O44A 4C1NK 4DR7K 3LM9A 2OZMA 1N34K 3HM9A 1RT4A 3SPZA 1XC9A 4FJMA 1P8ZA 3H1VX 3AVKA 1ZBFA 4DCHA 3ZETB 3DLEA 1JLCA 3BDPA 4X64K 1GLBG 3ZLJA 1KSPA 5AZIA 4DSEA 3CCVN 4DV7K 4FL9A 1HJOA 4CJLA 2Q3SA 4CJFA 2RF2A 4GV9A 4IEIA 4X62K 3MWPA 4ISEA 3M3ZA 4DKWA 3BF3A 3CCQN 1YVUA 2E4LA 3WNEA 2Q2RA 1HKBA 2BTFA 1KCFA 2GUPA 3SPYA 4Z4GA 4OPHA 1QVFM 4DSJA 4YORA 1BQNA 3TAMA 1UWBA 2P9LB 3F9MA 5B8HA 1SUQA 3TAQA 3R6MA 5FLXO 3CC7N 3WEEB 1HNVA 3QFPA 3CQXA 5HROA 4CZLA 4XEIA 4AHRA 2Q0UA 4OKJA 4MLHA 1RFQA 4CEQA 3L2UA 3ALYA 3T69A 3K9KA 4FWLA 4KH5A 4FZZA 4FOIA 3CCSN 2RHKA 2ZGYA 1RILA 3I56N 4BREA 4LF8K 4NLCA 4JI0K 3SBGA 2GEMA 3E66A 2WBNA 3QDKA 3O4WA 3D0PA 1NMDA 3IFRA 3LWMA 4DV4K 3CMEN 3EKUA 2OPRA 1Q7YO 4BRMA 1WBBA 1VSKA 2G8VA 3HYFA 4IZ9A 1NK0A 3HK2A 4AHTA 4O0IA 1J5EK 3OYLA 1QZ5A 4KI6A 2ATQA 4DLEA 1Z26A 4E89A 4OGEA 1XNQK 4OPAA 3C95A 4DUYK 3SQ0A 3C6TA 1NK7A 3NF9A 5JVHL 1VSMA 5BR9A 3FZFA 3A5NC 3C65A 1NOZA 2GBZA 4CZHA 3K5NA 4FLVA 3QINA 4CEBA 4KHUA 5AQHA 3WNFA 2GX9A 3O80A 1K8KA 3O9RA 2YKMA 3ZCMA 2YKNA 4JKDA 4JK9A 4C8NA 3RMDA 2DPNA 4H5VA 1R59O 4DTMA 1KLNA 1W9HA 1P90A 4FJ9A 3UB5A 4Z94A 4J2AA 4DSIA 3K2PA 3SUQA 1RDUA 4L8RB 3WNGA 2O4GA 3L3VA 2ZWHA 3Q7CA 4H0XB 2OPSA 2F8SA 4MFBA 4G1QA 4DR1K 3H45C 3ULEB 4M42A 4GKKK 3R1XA 1HX1A 4H5TA 3NE6A 3FLCO 1D5AA 2Z1JA 4ZTFA 1HNWK 3AO5A 4ILJA 4CHNA 3OA9A 2NZTA 2XY7A 2WOMA 2HNYA 3QBWA 4KHWA 4ID1A 2JGUA 4FOEA 4EP5A 4KHQA 4DR5K 1VSIA 1U2VB 4H8KA 3PY8A 3A0IX 4BR7A 1BDGA 1NK8A 3VQQA 4CE9A 2CGKA 1RTJA 3DLBA 3I33A 2KFNA 4QCLA 1GLAG 4MO4A 4B9TA 4PY5A 1VQ6N 3VQAA 4BRDA 1BUPA 4CHZA 3FZMA 3TAEA 1RDCA 1DTTA 4CZKA 1HNXK 1RBTA 1B9DA 3CIPA 4Z4CA 3O6WA 4J8FA 3HPOA 4FM0A 4DF4A 3AVNA 1QS4A 1ZBLA 4Q0BA 1G99A 1TK0A 1ZBIA 4O8KA 3TI0A 2YI1A 1N33K 2G8WA 2NUBA 2E1YA 5CZ1A 5LMUK 4FWOA 3SLCA 1U45A 5KI6A 3DRPA 4DQRA 1DLOA 5DK5A 1YI2N 2UUCK 4LF9K 3OYKA 4YDUC 3SMPA 2BDPA 5C15A 1F21A 5DM6L 4CJ4A 2OCEA 3MAQA 3EEQA 2GWKA 4RTFD 3U3YA 1TKDA 2OZSA 5FRNA 4FLTA 1VSEA 5BPNA 4DFMA 4WQ4A 3K59A 2HMPA 2F9WA 2PYLA 4NXMK 5ADXH 3SAFA 4JI5K 2BE2A 3FZKA 1T05A 3VF4A 2CH6A 2PY5A 4ISFA 4CECA 4J2BA 1XI1A 3AVFA 4KRFA 3G0ZA 5HRRA 4GMJB 2Y1JA 3NGYA 3V4IA 3QMLA 3AVCA 1JLGA 1NKCA 3AVMA 4FO0A 2O8CB 3CFOA 3BP8A 3DI6A 4JI3K 1GLFO 2NRWA 3ZX0A 2VGMA 3WUHA 4AHUA 5HRPA 3HT3A 1RTHA 4JEPA 2O8EB 3AGKA 2GTDA 3D7EO 3E9LA 4JKAA 4GKJK 3H3NO 1W7AA 1BHLA 4MO5A 3DLLL 4E1JA 3RRHA 3AY9A 4LH4A 4FJ5A 4FJKA 2QWOA 4FLXA 3I8DA 2YNGA 4JI2K 1LAWA 3NAEA 1NJXA 1VQ7N 4C8KA 2QWPA 4YHHK 2W40A 2QWMA 2RN2A 4YFUA 4CFAA 3DM2A 3VQ7A 3MX2A 4CERA 3H1QA 1TK5A 4FPAA 1IG8A 2X6NA 2PYJA 2EHGA 5E84A 5M1KA 1HJRA 4ILGB 1TYQB 1QQMA 3C6AA 3QBXA 1HPZA 3NDKA 1E4FT 3D2EA 3SUNA 1X9SA 3NVMA 2Q0RA 4H4OA 2P5OA 3I8BA 1J53A 3BGRA 3VA0A 2Q97A 2PFUA 4K43A 4ELUA 3SV4A 1C6VA 3LWLA 2ZD1A 4A5AA 1T6DA 3MXJA 1ATSA 3VA3A 1BIUA 3L4QA 4UY8O 3P38A 1QVGM 1J5OA 3V1RA 4Z4FA 4W5OA 4ZTJA 5CYMA 2IVNA 1BCOA 3S3OA 4CESA 3MK6A 3P83D 2V7ZA 5JS1A 2WFBA 4OJRA 3EO3A 1HNZK 2A1SA 3NFAA 3RWUA 4RW6A 3SV3A 3ENBA 5H1SQ 2QKKA 1NGHA 1NJWA 4JRPA 4IEEA 1RDDA 3R9PA 2A3ZA 4CFCA 3OYGA 4PKIA 1RDBA 3SUPA 1N8RO 3RR8A 4CJWA 2W6LA 4XH4A 5TKYA 1NGAA 3N4QA 3THWA 3W0LA 3IG1A 5BRDA 4DV5K 1Y64A 4YOTA 3FR0A 4BR5A 1L5UA 3ZSYA 2IDOA 2E2PA 4YNQA 1NGCA 2G8IA 5AQXA 3FZHA 5BREA 3KLHA 3KD5E 4TSXA 3TARA 1Q8IA 3UIQA 2GWJA 4JYAK 3CJ1A 3HOTA 1C1BA 3WT0A 1EKEA 4KFBA 1C1AA 4LSNA 4CW7B 4C8OA 3K0SA 2XRIA 3O08A 4JNEA 1S1TA 4CIFA 4HUGA 2HNDA 3L2RA 1OVYA 1VK0A 1SQKA 5AQKA 4CJUA 1QQCA 2IAJA 2YCHA 4DV2K 4M3ZA 3ZX2A 3KD1E 4BC2A 3UKUB 4CBUA 3LZIA 3AO2A 4FM2A 4F4KA 1OKJA 1N6QA 1N5YA 2UUBK 1NG9A 3T1HK 1NGFA 1M1KO 4RG8A 4BRQA 1VSFA 4I9QA 1KVAA 1D9FA 3E1YA 5JLHA 4DFKA 2VG7A 5C25A 3VQDA 3D2FA 3CCLN 3CC2N 1EP4A 2QA4N 3OS2A 4CHPA 3B8AX 2QXLA 4CJ3A 5C0YA 2P9IA 3OVNA 3MCAB 1Q86O 3S3NA 3LL3A 3ZEUA 3HRGA 4I6MA 2XO7A 4XH1A 3KK3A 1SZ2A 2WTUA 3V9WA 3PO4A 2HHVA 4MQ3A 2QI2A 4GY2B 3TTDA 3EE9A 4LFBK 3MN5A 3IDHA 1T8EA 4X65K 4OKEA 4M3WA 4DSKA 3A5MC 1NNEA 1KVCA 4KHPK 3ID6A 2YHXA 3TAGA 1BGXT 3IMXA 3CJAA 4EHTA 3UKRA 1IV0A 1SAZA 2E2NA 1KFSA 4WQ4C 1XMOK 1RCHA 1U47A 2FBVA 5CR4A 3V6DA 1MDUB 1EO1A 1A5XA 1IO2A 3DAWA 1NK5A 3VTIA 3LDSA 4I2PA 4F8RA 1CXUA 2O8DB 4U67L 2FSNA 4F3OA 3CFPA 4IJAA 3QESA 3H6EA 1YUWA 1HYZA 4FSVA 4BVPA 3PX4A 1YAGA 4NLBA 2HMIA 1HQUA 2E5LK 2I7PA 5GAGP 3F73A 1YITN 4I2QA 4BR9A 4FJXA 3BY5A 1IBMK 4FVMA 1UA1A 2IS3A 2D4WA 4B1XB 4CZGA 3ULDA 3O4NA 4NXNK 4W5NA 4LF7K 3ATUA 1X3NA 1Q82O 3EZWA 4ISGA 3ZSRA 1DGKN 4A59A 3QEWA 2ITGA 1W97L 4DTXA 3PX6A 3KKRA 4JD2B 4M7XA 4A62A 4CZMA 4CEFA 3M1FA 4CF8A 2HHXA 1VQ5N 4FVUA 2UUAK 1BO5O 1WSEA 2QWNA 3DRRA 5SZTA 1JCGA 1WAJA 3HI0A 3OYJA 3CM5A 2P9PA 2G8HA 2H3GX 3A2FA 4HTUA 3AVIA 5JLFA 3PO5A 3GG4A 3E9OA 2GUIA 3CCRN 3D2EB 1XMQK 2A41A 4CVNE 3SK3A 3TAPA 4FWPA 3TANA 5MLCQ 4DR2K 2QWLA 5J1EA 2P9KA 3VEVA 1JLEA 2D0OA 3A5LC 5C2FA 4PQUA 5C24A 4LY7A 5HL7L 1X9MA 4FLWA 3QB0A 5AQUA 1BL3A 4KH4A 1TUYA 2PZSA 2WUSA 2X74A 4DV3K 2A1RA 4DMNA 3V9XA 2A6AA 4Y0WA 5E26A 3O3GA 3JXUA 2F4VK 5GAEP 1CXQA 2JWLA 3QNNA 4PKGA 3RMBA 3O8MA 4PKHA 1VRTA 2OANA 2VQEK 1BI4A 5LY3A 3QEIA 4IWVA 2NNWA 3ENOA 4OKKA 3MXMA 4EHUA 4BE1A 5J2MA 3C94A 1KAXA 4WQ5A 4E1NA 5F2RA 4H5RA 4IO9L 3DLRA 4LF4K 3OYEA 3THXB 3NH1A 3OYAA 4KI4A 2QKBA 1S1VA 3GDQA 1JLQA 3MX5A 2ASPA 3DWLA 4OLAA 3TTCA 3KK7A 1SKWA 2Z1HA 1S1WA 4FLYA 3NH0A 3U3GA 3WXLA 4E7HA 2NRHA 4BRPA 1KD1O 4WFAL 2OYQA 5AR0A 3O9SA 4EP4A 3S41A 4DHYA 2F7TA 2BANA 5GIPA 4AH9A 3M6GA 1I39A 3VQ8A 4DQSA 3DXKB 4JKBA 4HHTA 3FFKB 4DQ8A 4QS9A 3VGKA 4DS4A 4B08A 4WF9L 4DWIA 4ELVA 5AQQA 1LOTB 4JHDA 1WSFA 4CFBA 1ITGA 3SZ2A 4E7JA 3AA4A 3SQ1A 3LDPA 5CY4A 1RDWX 3SYZA 1ZC6A 3NF7A 3SAGA 5JMVA 5CZ2A 2G8FA 5AQOA 3M8RA 3IS9A 4QAGA 3K58A 5BRFA 3O9QA 1RT3A 2HF4A 2ASMA 4M7YA 4W5TA 4QS8A 3O9UA 1VQON 2VG6A 2NRTA 4EZ6A 1ASVA 3RVCA 5BR8K 1HYSA 3VMFB 2ZM6K 3G6EN 1SL1A 3EY1A 4QOZB 1MA9B 2UYTA 3BZCA 4QS7A 1O13A 3MEEA 4K8ZA 1QTMA 5BRHA 3L0QA 2DY4A 1VQ4N 1J54A 1HKCA 3LAKA 3QETA 2P9UB 3C7NA 1ZBHA 2YHWA 4X66K 4E3SA 4M3XA 4DU4A 2VQFK 1HNIA 4RCHA 5KRSA 2FSKA 3ZEUB 1XWLA 3QEPA 5C10A 4JV5K 3P1GA 4CJRA 1KAZA 3NCIA 3PV8A 1C0GA 3LPUA 1RT7A 1J9AA 3RSEB 4FLZA 3OW2M 1NMNA 2HBLA 3KLGA 2HBMA 4F9OA 2HBJA 4CFDA 4HUEA 3KWGA 1DKGD 4H0VB 2O8BA 4FYDA 4A2BA 2O8FA 2XY8A 1C1CA 4KB1A 2OTJN 1KXPA 3IUCA 3U9ZA 5EVZA 4R79A 4CIEA 1A5WA 4KH6A 3PLAA 3LP0A 4AHCA 1XUPO 1VQ8N 3MMVA 4E7KA 1OH6A 4AQYK 4G9ZA 1NJZA 2QTDA 3OS1A 1YJNN 1U48A 3M8SA 1TL3A 4JAXA 1LV5A 4DTJA 4KBOA 4BRKA 5FPEA 3OYFA 4XH5A 5AQJA 3HSTB 3VQ6A 4AM7A 2JLEA 2ASOA 1GLJO 4BRGA 3AVJA 4DG1A 4CGGA 3TAFA 1IKVA 2ITMA 1JKHA 3F2KA 4H03B 4BE0A 1RT2A 2RE2A 4FW2A 3R8EA 1NGEA 2B6AA 2HF3A 3CMAN 3ZSOA 4KTWA 4ID5A 2KTQA 1GLLO 4BQZA 1JCEA 3EZ5A 2J4RA 3SQ4A 2W41A 1VQ9N 4BRFA 4DS5A 3THYB 2QWQA 4C1NI 2P9SB 2VWJA 2NRVA 3CF5L 4J2EA 3LDNA 1CZBA 3CI5A 5CYQA 3EYZA 5LL6Z 3T7ZA 1KRPA 4JI7K 2P1JA 4B9QA 2ZJPL 5T7BA 4GW6A 3AVGA 3PUFA 1ASWA 4GVEA 5AQIA 5BN9A 5AQFA 2EX3A 3QLHA 2D1KA 3NBPA 1QZ6A 1WSJA 1JLAA 5AZIB 4IJNA 5LMNK 1WSHA 3DXMA 1D9DA 3V9ZA 1TAUA 4C8MA 1QHTA 2P9NA 1S3XA 1ZBUA 1DTQA 1T44A 4AILC 3V81A 4KV8A 1SL0A 4B9SA 1NJIO 2DFHA 2FSJA 3V1OA 5KGXA 4M3UA 3SI6A 4JKEA 1N32K 3CETA 3SUOA 4JKGA 3HZ6A 1NWKA 1XHZA 4ICLA 3TPQA 5KTQA 2ZJRL 3O1WA 2KZZA 4W5RA 1VSLA 1QE1A 4EAHD 4O8UA 4E19A 1LAVA 3LP3A 2VWKA 3VEYA 4WQ5C 2XHBA 2OTLN 3TR8A 1G15A 3ID8A 5AQRA 5M1NA 1BIZA 4YOWA 3LDOA 4DUZK 3VQ4A 1JLBA 1GOBA 1NGIA 1JL2A 1N36K 3A5OC 4DV6K 1C0UA 4A61A 4HVJA 1X3MA 5J2QA 1QQOA 3MXIA 2F8TA 3J80O 3O5BA 4AHSA 3QICA 4NCGA 1K6YA 2V7YA 5GINA 5D3GA 2JWKA 3WXMB 1RDAA 3ZYYX 1CZAN 4CJSA 2KW4A 5JICA 3HJFA 5EOYA 4Y1CA 3W3DA 4CJQA 2FBXA 3SJJA 4RW9A 4H4MA 3ZSVA 2D0BA 4JI8K 5HBMA 4FWSA 3HSCA 3VESA 2FXUA 3ZETA 3J7AP 3R3LA 1S6PA 1K8KB 1MWMA 1VHXA 1Z6RA 3DLGA 2HHUA 3CJ9A 4CD1A 3VERA 2OPPA 4RWTA 5FPNA 3VQ9A 1W2BM 1VSHA 4BRCA 4O0JA 3TTFA 4B9VA 4NYNA 4DTUA 1UAXA 2F9TA 5IWAK 1UA0A 2D5RA 3OTOK 4CBXA 3L2VA 1XQSC 5AZJA 3FFIA 1EETA 2P9LA 4IDKA 4F3TA 1VQMN 3CCJN 1SV5A 3MECA 1E4GT 1X9JA 4CK2A 3OS0A 3WEEA 3WNHA 4GV3A 1OH7A 1C0TA 4DTOA 3U4LA 4CF0A 2W42A 3NGZA 3LP1A 4CD3A 2DTUA 4CHQA 2KLAA 1QSSA 2HB5A 3V1QA 5KRTA 4OPKA 3G71N 1VQPN 4CEOA 3AA5X 3NHGA 3EN9A 4BG9A 3UE5A 4FWMA 4FJ7A 4BC5A 1X1PA 4PL8A 4CGHA 4CJ7A 3AVHA 1ZBSA 4JS4A 4I7FA 5F1XA 1K73O 2HHHK 3P4IA 4F2RA 3QIPA 3O9TA 1REVA 2FC0A 4KREA 3SJHA 4B1YB 3HXMA 4V19S 1TGOA 4NCAA 5AQWA 5AQGA 4DTPA 2OA8A 2P5GA 3KLFA 3ASMA 5AFUA 4DV1K 1VSDA 2CGLA 4LC9B 2VG5A 4DR4K 2PBDA 3ITHA 1M90O 4B1ZA 3VTHA 3QIOA 5I9EB 2D0PA 1HMVA 3O3FA 1U04A 4JI4K 2KZMA 1RBVA 4A57A 4FJJA 4MDAA 4NO7A 4CJEA 4LF5K 3C0BA 4WYBA 3CJCA 4B9NA 4FZYA 3K57A 3B6OA 3CJBA 4DB3A 2XY5A 2ZQBA 1TVRA 3QO9A 1Z25A 3GL1A 3LDQA 5AQMA 4B1UB 4CHYA 3I55N 3PIPL 1K8AO 3HTVA 4BROA 3KIOA 1YHQN 3O1BA 3J81O 3RTVA 1BQMA 4CEDA 4K25A 3L2WA 1L3VA 5TKWA 3Q7BA 2V52B 4N56A 4Y1DA 1IH7A 3DRSA 3ZT0A 3CCEN 1BCMA 3ULEA 3J7YP 3HBTA 5EX5A 1BISA 4BACA 3J7ZO 4BRAA 3LDLA 2E2OA 3LZJA 3ENHA 3OYIA 4RW4A 1WOQA 2E20A 3CCUN 1YIJN 1TUUA 2NRXA 3HP6A 4HCBA 4DTRA 4CGIA 4CZEA 1Y97A 4FJGA 4DQPA 4KHNA 1U2VA 2AP1A 4K8XA 3VEXA 1Q9XA 2ZJQL 1LW2A 3AVAA 1WAFA 4M3TA 1HYVA 4BRNA 1ZYQA 5E41A 1ATRA 2PAVA 5BPMA 1NK4A 3VN5A 3HPHA 1KQSM 4ILHA 4BR2A 3ZSZA 3KLIA 5J2NA 1OH8A 5EY4A 2QWRA 4B3TK 2VWBA 4B3OA 1QSLA 1JLFA 1MU2A 1CZ9A 3P39A 1LWCA 4E7IA 5AQSA 3TU5A 1HKGA 3O3HA 3T19A 2NRRA 2QXFA 1S22A 1NLVA 4WFNL 3CQ8A 4LF6K 5K14A 4CJVA 4ZHRA 1B9FA 4H5NA 3CPWM 4CBWA 4OO1J 1V4TA 3NF8A 2HBKA 1B92A 5M1PA 3SQ2A 3CXCM 3RR7A 1LCUA 1U4BA 3FE1A 4FZXC 3S9HA 3VEZA 3VENA 2FF6A 1XHXA 4FJLA 4N41A 2YNHA 1NKEA 4IFYA 3TABA 1YTUA 4CEAA 4IOCL 3DOLA 3DOKA 3B6PA 3ISNC 5KPTA 1XNRK 3FGUA 1KTQA 4KTQA 1YT3A 2KKZA 1TV6A 3OYCA 4BGBA 4GV6A 4JK7A 4E7LA 5ELZA 5HP1A 3FZLA 1S1XA 2F96A 4IG0A 3GOIA 4EIAA 2O8CA 4JKCA 2X6SA 1RNHA 2O8EA 1WN7A 3THWB 1NOYA 4H0PA 4CZJA 4B1WB 2YJFA 1KC8O 3OBYA 3C6HA 1NK6A 5AZJB 1S6QA 2KQ2A 4DFPA 3ZT4A 3IKMA 4K42A 3L8BA 2A40A 1YJ9N 3CG7A 1KVBA 2NLXA 1LWFA 2Q1NA 1I3AA 3V9SA 1S9EA 3MDQA 2YHYA 4BQLA 3GBTA 1ATNA 4H0OA 5LJWA 1EXQA 2I5JA 4CCHA 1BG3A 5M1FA 4FWRA 4LD0A 4M41A 4NYFA 4YOYA 3KHYA 4BR0A 4CEZA 2Q31A 5AQLA 4IO8A 3TWHA 1TAQA 5KPRA 4IOXA 1IJJA 1TYQA 2UU9K 5KPZA 1T3VA 2FBTA 3KK1A 3OYBA 2IC3A 3SCXA 4YOUA 3PSFA 2VCPA 3RRGA 2A42A 3AGRA 1R0AA 5DM7L 4IKFA 3BEXA 2IVOA 3HOSA 1NM1A 4CK1A 4DU1A 2HHTA 5EU7A 2X78A 3VPZA 3NH2A 2RKIA 2D0AA 1BA1A 1JXEA 1QQNA 4GVMA 3SBTA 4DR6K 3CM6A 1MWKA 4CF2A 3ZSQA 3OJUA 3G25A 3WXJA 3KJVA 1VRUA 3D2FB 1NGGA 2YX6A 1EX4A 3VETA 4O5FA 4DF8A 4KHYA 2Y1IA 4BDPA 5KQDA 4NB4A 3EE8A 1RTDA 3HVTA 3T1AA 3AO1A 3JSMA 3K5MA 1KAYA 2P9IB 4JS5A 1T03A 3P5JA 4GNIA 3E9PA 1FKOA 4I6MB 3G4SN 3GE1A 2BH1A 4A2AA 3HPGA 1LW0A 4KHSA 1JL1A 2Z1GA 2HHQA 1JJ2M 2FLOA 3CJ7A 3CERA 4H0TB 5M1OA 5I42A 1RBUA 4M3RA 5AFUH 1EWRA 3LALA 4LFCK 3VF6A 4Z0UA 4IFEA 4I9LA 4B3RK 3TSUA 4HUFA 3HM8A 3UKRB 4N5SA 2HHSA 1DT9A 1L3TA 1FXXA 3U9DA 2QEXN 4DQIA 5HLFA 3LP2A 4BC4A 2GELA 4BGAA 4JKFA 1KFDA 3ATVA 3LAMA 1L3SA 3AAPA 3QNOA 4CIGA 1Q81O 4C8LA 3MN6A 2E88A 1IBLK 4IOAL 2YJEA 1IKWA 5LJVA 1D8YA 3ZT2A 4BC3A 2ZGZA 3SNNA 1GOAA 1FJGK 1YXQA 1HR0K 3OHRA 5BPLA 2UXCK 1RT1A 2IIRA 3EKSA 4FJHA 3O4QA 2YNIA 3UKUA 3OYHA 2UXDK 4FXDA 2E2QA 3AO3A 4FWQA 3KTQA 3T3FA 2WONA 4JK8A 5GIOA 1S9GA 1SL2A 2YNFA 1S5JA 1WLJA 4YOXA 3P31A 4K41A 4AHVA 3K5LA 4DR3K 3VGMA 4FJNA 1O1WA 3VGLA 4CGJA 3AO4A 1U49A 4DTSA 1FW6A 2P9PB 1RT6A 1H1VA 3VQ5A 1LWEA 3HVRA 3BZKA 1VSJA 3F5TA 1NK9A 4YY3K 3RMCA 5EXWA 3D45A 1RBSA 1L3UA 2V51B 1WSGA 2B5JA 4CHOA 3LANA 4HTLA 2AJQA 3AAQA 4L3QA 3NMUA 5HRSA 3MWTA 2ZF5O 4J2DA 4W5QA 2P9KB 4PL7A 4UQGA 2EWSA 2DFEA 1HPMA 1U6ZA 4Z4IA 4CEEA 4OLBA 2VYPA
chains in the Genus database with same CATH topology
4CEBA 3NGZA 3VQPA 4DTXA 5JS2A 3PX6A 3KKRA 4KHUA 3WNFA 3LP1A 2DTUA 4CEFA 4R5PA 4CF8A 4CHQA 2HHXA 1QSSA 4CGFA 2HB5A 4JLHA 3V1QA 2YKMA 3ZCMA 5KRTA 4OPKA 4CJ5A 2YKNA 3RMDA 4C8NA 4CEOA 3AA5X 1WSEA 3NHGA 3DMJA 3DRRA 5SZTA 1WAJA 3DYAA 3OYJA 3CM5A 1BI4B 1T7PA 3HP9A 4JRQA 2G8HA 1X1PA 4KPYA 3A2FA 4CGHA 3ZSXA 4FJ7A 4HTUA 3AVIA 4DTMA 3AVHA 1KLNA 1W9HA 4JS4A 3PO5A 4FJ9A 4I7FA 5J2PA 2GUIA 4J2AA 4DSIA 2GV9A 4F2RA 3K2PA 3SUQA 3IAYA 3VQEA 4L8RB 3QIPA 3WNGA 1REVA 2FC0A 2O4GA 3L3VA 4LSLA 3OY9A 1GOCA 4FM1A 4KREA 2HW3A 2OPSA 2F8SA 3TAPA 3HXMA 2IOCA 4RW8A 1TGOA 4NCAA 3ZSWA 4MFBA 3TANA 4DTPA 2YHAA 2OA8A 2P5GA 4G1QA 3KLFA 5J1EA 3ASMA 1W0HA 4FK4A 1JLEA 4M42A 1VSDA 2HHWA 2LSNA 4PQUA 5SWMA 2VG5A 5C24A 4LY7A 1X9MA 3NE6A 3ITHA 4FLWA 1D5AA 2Z1JA 3H08A 4ZTFA 1BL3A 4B9UA 3AO5A 3QIOA 4CHNA 1HRHA 1HMVA 3O3FA 2PZSA 4O4GA 2X74A 2A1RA 3AA3A 1U04A 4KB0A 4DMNA 1IG9A 3V9XA 3AVBA 1RBVA 2WOMA 4DU3A 2XY7A 2KZMA 2HNYA 4FJJA 4KHWA 4E1MA 2GBZA 4ID1A 4KTZA 4CJEA 3O3GA 2JGUA 4EP5A 4KHQA 1CXQA 3PX0A 3QNNA 3RMBA 1VSIA 4B9NA 5DMRA 4H8KA 4FZYA 1VRTA 3K57A 3B6OA 1BI4A 2D0CA 3QEIA 2E6MA 2XY5A 3PY8A 4ELTA 2ZQBA 1TVRA 4OKKA 3QO9A 1Z25A 4CHYA 3MXMA 4BE1A 5J2MA 1NK8A 3C94A 3VQQA 4BE2A 4CE9A 1RTJA 5KGWA 4E1NA 3KIOA 3DLBA 3DLRA 3OYNA 2KFNA 2P51A 3OYEA 3THVA 3RTVA 3NH1A 3F9KA 3OYAA 4KI4A 4QCLA 1BQMA 4CEDA 3IRXA 3L2WA 4B9TA 2QKBA 1S1VA 3ZT1A 1JLQA 3VQAA 1L3VA 4PY5A 4KO0A 4OLAA 4NCBA 4CHZA 3TAEA 1SKWA 4N56A 1RDCA 2Z1HA 1S1WA 4WE1A 4Y1DA 4FLYA 2HVIA 1A5VA 1IH7A 1DTTA 1UOCA 3DRSA 1RBRA 3U3GA 1RBTA 1B9DA 1BCMA 3ZT0A 4OPJA 4Z4CA 3QERA 3LPTA 4DSFA 4E7HA 1BISA 4BACA 3KK2A 3HPOA 4FM0A 4DF4A 3AVNA 2OYQA 1QS4A 4FW1A 1ZBLA 4EP4A 3HO1A 4Q0BA 3LZJA 3OYIA 1TK0A 4CJKA 3TI0A 4RW4A 4IBNA 2R7YA 4B9MA 4F2SA 4Z4EA 1ZBIA 2BANA 4AH9A 3KLEA 1I39A 3VQ8A 4DQSA 2G8WA 2G8UA 2NUBA 2FBYA 1TKZA 3ZT3A 3HP6A 4HHTA 5CZ1A 1TL1A 4DTRA 4HCBA 4CGIA 4FCYA 3S3MA 1U45A 1QSYA 4O55A 1RT5A 5KI6A 1Y97A 3DRPA 4DS4A 4FJGA 4DQPA 4DQRA 4B08A 3I0SA 4DWIA 4KHNA 1DLOA 5DK5A 4ELVA 1X9WA 4DFJA 4K8XA 3OYKA 1Q9XA 1WSFA 4CFBA 1ITGA 3SZ2A 2BDPA 1LW2A 4E7JA 1F21A 3AA4A 3AVAA 3SQ1A 4CJ4A 1WAFA 4M3TA 1WSIA 1HYVA 5CY4A 3E01A 4M3YA 4RW7A 3MAQA 3SYZA 1TKDA 4CGDA 3U3YA 3NF7A 2OZSA 5FRNA 1ZYQA 4FLTA 4Q5VA 5E41A 1SKRA 2G8FA 5CZ2A 3OJSA 1VSEA 3M8RA 4DFMA 3IS9A 4QAGA 1NK4A 3VN5A 3K59A 3K58A 3HPHA 2PYLA 3ZSZA 3KLIA 5J2NA 1RT3A 2BE2A 4W5TA 3QEVA 3AVLA 2VG6A 4B3OA 1T05A 1QSLA 4EZ6A 1ASVA 1JLFA 1MU2A 1CZ9A 2PY5A 1HYSA 1LWCA 4N76A 4FJIA 4CECA 3EY1A 4E7IA 1SL1A 4HCCA 4J2BA 4M45A 4QOZB 1XI1A 3AVFA 4KRFA 3G0ZA 5HRRA 4GMJB 2Y1JA 3O3HA 4LH5A 3NGYA 3T19A 3MEEA 4K8ZA 4DTNA 4PUOA 2QXFA 3V4IA 3I0RA 1QTMA 2DY4A 4DQQA 2DFFA 3AVCA 3CQ8A 5C42A 3K5OA 2Z1IA 1J54A 3LAKA 1JLGA 5K14A 4CJVA 1NKCA 3AVMA 1B9FA 4ZHRA 3QETA 1IKYA 3CFOA 3DI6A 1TKTA 5HRPA 1ZBHA 4AHUA 3JYTA 3HT3A 1RTHA 3NF8A 1TK8A 1B92A 4E3SA 4M3XA 4DU4A 3SQ2A 3RR7A 2HNZA 4KAZA 2O4IA 1HNIA 1U4BA 1BHLA 5KRSA 2G8KA 4FZXC 3S9HA 5FROA 1XWLA 3RRHA 3QEPA 2QK9A 3P1GA 4CJRA 3NCIA 1XHXA 3PV8A 3HL8A 4BWMA 4LH4A 4FJLA 2RPIA 4N41A 4FJ5A 3LPUA 1RT7A 1J9AA 4FLZA 4FJKA 4FLXA 2YNHA 3I8DA 1NKEA 4FK2A 4IFYA 4B8AB 3TABA 1SKSA 1YTUA 2YNGA 4CEAA 4CF9A 1LAWA 3NAEA 3KLGA 3DOLA 3NGIA 1NJXA 4C8KA 3DOKA 4CFDA 3B6PA 3ISNC 4HUEA 4KKOA 4PWDA 2RN2A 4YFUA 4CFAA 1KTQA 4FYDA 4KTQA 1YT3A 3DM2A 3VQ7A 2XY8A 1C1CA 4CERA 2YV0X 4KB1A 1TV6A 3OYDA 3OYCA 3MEGA 1HQEA 1S1UA 3M8PA 1TK5A 4E7LA 5HP1A 3OYMA 1S1XA 2X6NA 2EHGA 2F96A 1A5WA 4CIEA 2PYJA 3LP0A 5I3UA 1FK9A 4AHCA 1HJRA 4IG0A 4E7KA 2X6SA 2XY6A 1HPZA 3NDKA 1RNHA 3OS1A 1NJZA 1U48A 3SUNA 1X9SA 3M8SA 4FJ8A 3L3UA 1TL3A 1WN7A 4H4OA 1NOYA 2P5OA 4EZ9A 1J53A 4BDZA 3BGRA 4Z4HA 4DTJA 1LV5A 3VA0A 3V9UA 3OYFA 1NK6A 4ELUA 1CLQA 3SV4A 1S6QA 2KQ2A 3DLKA 3HSTB 1C6VA 3VQ6A 4DFPA 2JLEA 3ZT4A 3LWLA 4E0DA 3C6UA 2ZD1A 3L8BA 3AVJA 4DG1A 4CGGA 1FKPA 4CJPA 3CFRA 3CG7A 3MXJA 3TAFA 4CK3A 3VA3A 1KVBA 1IKVA 1BIUA 4CJTA 1LWFA 1JKHA 4BE0A 1I3AA 3KKSA 1S9EA 3V9SA 1RT2A 4B8CA 1J5OA 4FW2A 3V1RA 4Z4FA 4W5OA 4ZTJA 5CYMA 1BCOA 2B6AA 3L2QA 4CESA 3ZSOA 1EXQA 3S3OA 2I5JA 3P83D 4KTWA 4CCHA 4ID5A 5JS1A 4OJRA 2KTQA 2A1SA 3NFAA 3RWUA 3QEXA 4RW6A 3EZ5A 4IG3A 3SV3A 4O5BA 4LD0A 4FLUA 4M41A 3SQ4A 2QKKA 1NJWA 4NYFA 4JRPA 4FK0A 4XIUA 4CEZA 1ASUA 1RDDA 3TWHA 4DS5A 1TAQA 4CFCA 3MEDA 4OGCA 3OYGA 1NJYA 3SUPA 1RDBA 4IFVA 5HRNA 2VWJA 3RR8A 4CJWA 3VQBA 4J2EA 1WNSA 1CZBA 2FBTA 3EYZA 5CYQA 3KK1A 3IG1A 1KRPA 4B9LA 4BWJA 3OYBA 2IC3A 3SCXA 3RRGA 2P1JA 4PA1A 3M8QA 1R0AA 5T7BA 1L5UA 3AV9A 2YHBA 2HVHA 4IKFA 4GW6A 3ZSYA 2IDOA 2ETJA 3AVGA 3PUFA 4YNQA 3U6FA 2G8IA 1YTAA 4DLGA 1ASWA 4CK1A 4DU1A 1TKXA 3KLHA 2EX3A 3QLHA 3KD5E 2HHTA 3NBPA 4OVLA 1NKBA 2KFZA 3G10A 4TSXA 5EU7A 3TARA 1Q8IA 1WSJA 1JLAA 2X78A 3NH2A 2RKIA 1KLMA 2D0AA 1WSHA 3UIQA 2BGGA 1JXEA 1D9DA 3NF6A 4GVMA 3V9ZA 1TAUA 1QHTA 1C1BA 2ZE2A 3CM6A 4C8MA 4N47A 4CF2A 1ZBUA 1EKEA 3ZSQA 1DTQA 3OJUA 4KFBA 1C1AA 2OPQA 4LSNA 4BDYA 1RTIA 1VRUA 3KJVA 4AILC 3V81A 4C8OA 4KV8A 1SL0A 2XRIA 1EX4A 1IKXA 1S1TA 2E6LA 4DF8A 4B9SA 1C0MA 2Y1IA 5FDLA 4BDPA 4KHYA 4CIFA 3AA2A 1RTDA 3HVTA 2DFHA 3T1AA 4CF1A 4HUGA 1JXBA 2HNDA 3AO1A 3L2RA 3VQCA 3JSMA 3K5MA 3V1OA 2B4JA 5KGXA 4JS5A 4M3UA 3SI6A 1T03A 1Q9YA 1VK0A 3P5JA 5FRMA 1FKOA 4DSLA 2IGIA 3CYMA 3NH0A 3RMAA 4CJUA 3SUOA 3HPGA 1LW0A 1QQCA 1JL1A 2IAJA 1XHZA 3DLHA 4KHSA 4ICLA 2Z1GA 4O44A 4OLBA 2HHQA 2OZMA 5KTQA 4M3ZA 2KZZA 4W5RA 3HM9A 1RT4A 3KD1E 1VSLA 1QE1A 3SPZA 5I42A 1XC9A 1RBUA 4E19A 4FJMA 4M3RA 3LALA 3AO2A 1LAVA 3LZIA 3AVKA 4FM2A 1ZBFA 3LP3A 4F4KA 4Z0UA 2VWKA 3DLEA 1JLCA 4I9LA 2XHBA 3BDPA 1N6QA 1N5YA 3TR8A 4HUFA 1G15A 1KSPA 4N5SA 2HHSA 1L3TA 1BIZA 1FXXA 4RG8A 4DQIA 1VSFA 5HLFA 3LP2A 4DSEA 4I9QA 1KVAA 1D9FA 3VQ4A 4CJLA 2Q3SA 1JLBA 4CJFA 2RF2A 1KFDA 1GOBA 4DFKA 1JL2A 2VG7A 5C25A 3VQDA 1C0UA 3LAMA 1L3SA 1EP4A 4HVJA 3QNOA 4CIGA 3OS2A 4CHPA 1YVUA 5J2QA 2E4LA 3WNEA 4CJ3A 3MXIA 4C8LA 1KCFA 2F8TA 4AHSA 3SPYA 4NCGA 1K6YA 4Z4GA 2W42A 5D3GA 3OVNA 1IKWA 4DSJA 1RDAA 3S3NA 1BQNA 3TAMA 4CJSA 1D8YA 2XO7A 1UWBA 3ZT2A 3KK3A 1SUQA 3V9WA 2KW4A 3TAQA 3PO4A 4MQ3A 3HJFA 2HHVA 3SNNA 4Y1CA 1GOAA 4CJQA 2FBXA 1HNVA 3SJJA 4RW9A 4H4MA 5HROA 3ZSVA 1T8EA 1RT1A 4AHRA 4OKEA 2D0BA 4OKJA 4FJHA 3O4QA 4DSKA 4M3WA 2YNIA 3OYHA 4CEQA 3L2UA 1KVCA 5HBMA 4FXDA 3ALYA 3AO3A 3KTQA 3T3FA 3TAGA 4FZZA 2WONA 1BGXT 1S9GA 1SL2A 1S6PA 2YNFA 1S5JA 1RILA 1WLJA 3K5LA 4AHVA 1KFSA 4FJNA 1O1WA 1U47A 1RCHA 3DLGA 2HHUA 2FBVA 4CGJA 3AO4A 3V6DA 2OPPA 1U49A 1A5XA 1IO2A 3D0PA 4DTSA 1NK5A 3VQ9A 3LWMA 1RT6A 3LDSA 1VSHA 4I2PA 3VQ5A 4F8RA 1CXUA 1LWEA 3HVRA 4F3OA 2OPRA 3CFPA 4O0JA 3QESA 4B9VA 1VSJA 1HYZA 3PX4A 4NYNA 4DTUA 1VSKA 1UAXA 1NK9A 2G8VA 3HYFA 1UA0A 2D5RA 1HQUA 2HMIA 3F73A 4FJXA 3RMCA 4I2QA 1NK0A 3HK2A 3D45A 1RBSA 3L2VA 1L3UA 4FVMA 4AHTA 3FFIA 4O0IA 1EETA 1UA1A 1WSGA 2B5JA 2IS3A 4CHOA 3LANA 4IDKA 3OYLA 4F3TA 4KI6A 1SV5A 2ATQA 3MECA 2AJQA 4DLEA 1Z26A 4E89A 4OGEA 4CK2A 5HRSA 3OS0A 3ULDA 4J2DA 3O4NA 4W5NA 4W5QA 3C95A 4UQGA 3SQ0A 3C6TA 3WNHA 3NF9A 1NK7A 1VSMA 1C0TA 2DFEA 3ZSRA 4DTOA 4Z4IA 4CEEA 3QEWA 1NOZA 2ITGA 3K5NA 4CF0A 4FLVA 3QINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CEB A;  3NGZ A;  3VQP A;  4DTX A;  5JS2 A;  3PX6 A;  3KKR A;  4KHU A;  3WNF A;  3LP1 A;  2DTU A;  4CEF A;  4R5P A;  4CF8 A;  4CHQ A;  2HHX A;  1QSS A;  4CGF A;  2HB5 A;  4JLH A;  3V1Q A;  2YKM A;  3ZCM A;  5KRT A;  4OPK A;  4CJ5 A;  2YKN A;  3RMD A;  4C8N A;  4CEO A;  3AA5 X;  1WSE A;  3NHG A;  3DMJ A;  3DRR A;  5SZT A;  1WAJ A;  3DYA A;  3OYJ A;  3CM5 A;  1BI4 B;  1T7P A;  3HP9 A;  4JRQ A;  2G8H A;  1X1P A;  4KPY A;  3A2F A;  4CGH A;  3ZSX A;  4FJ7 A;  4HTU A;  3AVI A;  4DTM A;  3AVH A;  1KLN A;  1W9H A;  4JS4 A;  3PO5 A;  4FJ9 A;  4I7F A;  5J2P A;  2GUI A;  4J2A A;  4DSI A;  2GV9 A;  4F2R A;  3K2P A;  3SUQ A;  3IAY A;  3VQE A;  4L8R B;  3QIP A;  3WNG A;  1REV A;  2FC0 A;  2O4G A;  3L3V A;  4LSL A;  3OY9 A;  1GOC A;  4FM1 A;  4KRE A;  2HW3 A;  2OPS A;  2F8S A;  3TAP A;  3HXM A;  2IOC A;  4RW8 A;  1TGO A;  4NCA A;  3ZSW A;  4MFB A;  3TAN A;  4DTP A;  2YHA A;  2OA8 A;  2P5G A;  4G1Q A;  3KLF A;  5J1E A;  3ASM A;  1W0H A;  4FK4 A;  1JLE A;  4M42 A;  1VSD A;  2HHW A;  2LSN A;  4PQU A;  5SWM A;  2VG5 A;  5C24 A;  4LY7 A;  1X9M A;  3NE6 A;  3ITH A;  4FLW A;  1D5A A;  2Z1J A;  3H08 A;  4ZTF A;  1BL3 A;  4B9U A;  3AO5 A;  3QIO A;  4CHN A;  1HRH A;  1HMV A;  3O3F A;  2PZS A;  4O4G A;  2X74 A;  2A1R A;  3AA3 A;  1U04 A;  4KB0 A;  4DMN A;  1IG9 A;  3V9X A;  3AVB A;  1RBV A;  2WOM A;  4DU3 A;  2XY7 A;  2KZM A;  2HNY A;  4FJJ A;  4KHW A;  4E1M A;  2GBZ A;  4ID1 A;  4KTZ A;  4CJE A;  3O3G A;  2JGU A;  4EP5 A;  4KHQ A;  1CXQ A;  3PX0 A;  3QNN A;  3RMB A;  1VSI A;  4B9N A;  5DMR A;  4H8K A;  4FZY A;  1VRT A;  3K57 A;  3B6O A;  1BI4 A;  2D0C A;  3QEI A;  2E6M A;  2XY5 A;  3PY8 A;  4ELT A;  2ZQB A;  1TVR A;  4OKK A;  3QO9 A;  1Z25 A;  4CHY A;  3MXM A;  4BE1 A;  5J2M A;  1NK8 A;  3C94 A;  3VQQ A;  4BE2 A;  4CE9 A;  1RTJ A;  5KGW A;  4E1N A;  3KIO A;  3DLB A;  3DLR A;  3OYN A;  2KFN A;  2P51 A;  3OYE A;  3THV A;  3RTV A;  3NH1 A;  3F9K A;  3OYA A;  4KI4 A;  4QCL A;  1BQM A;  4CED A;  3IRX A;  3L2W A;  4B9T A;  2QKB A;  1S1V A;  3ZT1 A;  1JLQ A;  3VQA A;  1L3V A;  4PY5 A;  4KO0 A;  4OLA A;  4NCB A;  4CHZ A;  3TAE A;  1SKW A;  4N56 A;  1RDC A;  2Z1H A;  1S1W A;  4WE1 A;  4Y1D A;  4FLY A;  2HVI A;  1A5V A;  1IH7 A;  1DTT A;  1UOC A;  3DRS A;  1RBR A;  3U3G A;  1RBT A;  1B9D A;  1BCM A;  3ZT0 A;  4OPJ A;  4Z4C A;  3QER A;  3LPT A;  4DSF A;  4E7H A;  1BIS A;  4BAC A;  3KK2 A;  3HPO A;  4FM0 A;  4DF4 A;  3AVN A;  2OYQ A;  1QS4 A;  4FW1 A;  1ZBL A;  4EP4 A;  3HO1 A;  4Q0B A;  3LZJ A;  3OYI A;  1TK0 A;  4CJK A;  3TI0 A;  4RW4 A;  4IBN A;  2R7Y A;  4B9M A;  4F2S A;  4Z4E A;  1ZBI A;  2BAN A;  4AH9 A;  3KLE A;  1I39 A;  3VQ8 A;  4DQS A;  2G8W A;  2G8U A;  2NUB A;  2FBY A;  1TKZ A;  3ZT3 A;  3HP6 A;  4HHT A;  5CZ1 A;  1TL1 A;  4DTR A;  4HCB A;  4CGI A;  4FCY A;  3S3M A;  1U45 A;  1QSY A;  4O55 A;  1RT5 A;  5KI6 A;  1Y97 A;  3DRP A;  4DS4 A;  4FJG A;  4DQP A;  4DQR A;  4B08 A;  3I0S A;  4DWI A;  4KHN A;  1DLO A;  5DK5 A;  4ELV A;  1X9W A;  4DFJ A;  4K8X A;  3OYK A;  1Q9X A;  1WSF A;  4CFB A;  1ITG A;  3SZ2 A;  2BDP A;  1LW2 A;  4E7J A;  1F21 A;  3AA4 A;  3AVA A;  3SQ1 A;  4CJ4 A;  1WAF A;  4M3T A;  1WSI A;  1HYV A;  5CY4 A;  3E01 A;  4M3Y A;  4RW7 A;  3MAQ A;  3SYZ A;  1TKD A;  4CGD A;  3U3Y A;  3NF7 A;  2OZS A;  5FRN A;  1ZYQ A;  4FLT A;  4Q5V A;  5E41 A;  1SKR A;  2G8F A;  5CZ2 A;  3OJS A;  1VSE A;  3M8R A;  4DFM A;  3IS9 A;  4QAG A;  1NK4 A;  3VN5 A;  3K59 A;  3K58 A;  3HPH A;  2PYL A;  3ZSZ A;  3KLI A;  5J2N A;  1RT3 A;  2BE2 A;  4W5T A;  3QEV A;  3AVL A;  2VG6 A;  4B3O A;  1T05 A;  1QSL A;  4EZ6 A;  1ASV A;  1JLF A;  1MU2 A;  1CZ9 A;  2PY5 A;  1HYS A;  1LWC A;  4N76 A;  4FJI A;  4CEC A;  3EY1 A;  4E7I A;  1SL1 A;  4HCC A;  4J2B A;  4M45 A;  4QOZ B;  1XI1 A;  3AVF A;  4KRF A;  3G0Z A;  5HRR A;  4GMJ B;  2Y1J A;  3O3H A;  4LH5 A;  3NGY A;  3T19 A;  3MEE A;  4K8Z A;  4DTN A;  4PUO A;  2QXF A;  3V4I A;  3I0R A;  1QTM A;  2DY4 A;  4DQQ A;  2DFF A;  3AVC A;  3CQ8 A;  5C42 A;  3K5O A;  2Z1I A;  1J54 A;  3LAK A;  1JLG A;  5K14 A;  4CJV A;  1NKC A;  3AVM A;  1B9F A;  4ZHR A;  3QET A;  1IKY A;  3CFO A;  3DI6 A;  1TKT A;  5HRP A;  1ZBH A;  4AHU A;  3JYT A;  3HT3 A;  1RTH A;  3NF8 A;  1TK8 A;  1B92 A;  4E3S A;  4M3X A;  4DU4 A;  3SQ2 A;  3RR7 A;  2HNZ A;  4KAZ A;  2O4I A;  1HNI A;  1U4B A;  1BHL A;  5KRS A;  2G8K A;  4FZX C;  3S9H A;  5FRO A;  1XWL A;  3RRH A;  3QEP A;  2QK9 A;  3P1G A;  4CJR A;  3NCI A;  1XHX A;  3PV8 A;  3HL8 A;  4BWM A;  4LH4 A;  4FJL A;  2RPI A;  4N41 A;  4FJ5 A;  3LPU A;  1RT7 A;  1J9A A;  4FLZ A;  4FJK A;  4FLX A;  2YNH A;  3I8D A;  1NKE A;  4FK2 A;  4IFY A;  4B8A B;  3TAB A;  1SKS A;  1YTU A;  2YNG A;  4CEA A;  4CF9 A;  1LAW A;  3NAE A;  3KLG A;  3DOL A;  3NGI A;  1NJX A;  4C8K A;  3DOK A;  4CFD A;  3B6P A;  3ISN C;  4HUE A;  4KKO A;  4PWD A;  2RN2 A;  4YFU A;  4CFA A;  1KTQ A;  4FYD A;  4KTQ A;  1YT3 A;  3DM2 A;  3VQ7 A;  2XY8 A;  1C1C A;  4CER A;  2YV0 X;  4KB1 A;  1TV6 A;  3OYD A;  3OYC A;  3MEG A;  1HQE A;  1S1U A;  3M8P A;  1TK5 A;  4E7L A;  5HP1 A;  3OYM A;  1S1X A;  2X6N A;  2EHG A;  2F96 A;  1A5W A;  4CIE A;  2PYJ A;  3LP0 A;  5I3U A;  1FK9 A;  4AHC A;  1HJR A;  4IG0 A;  4E7K A;  2X6S A;  2XY6 A;  1HPZ A;  3NDK A;  1RNH A;  3OS1 A;  1NJZ A;  1U48 A;  3SUN A;  1X9S A;  3M8S A;  4FJ8 A;  3L3U A;  1TL3 A;  1WN7 A;  4H4O A;  1NOY A;  2P5O A;  4EZ9 A;  1J53 A;  4BDZ A;  3BGR A;  4Z4H A;  4DTJ A;  1LV5 A;  3VA0 A;  3V9U A;  3OYF A;  1NK6 A;  4ELU A;  1CLQ A;  3SV4 A;  1S6Q A;  2KQ2 A;  3DLK A;  3HST B;  1C6V A;  3VQ6 A;  4DFP A;  2JLE A;  3ZT4 A;  3LWL A;  4E0D A;  3C6U A;  2ZD1 A;  3L8B A;  3AVJ A;  4DG1 A;  4CGG A;  1FKP A;  4CJP A;  3CFR A;  3CG7 A;  3MXJ A;  3TAF A;  4CK3 A;  3VA3 A;  1KVB A;  1IKV A;  1BIU A;  4CJT A;  1LWF A;  1JKH A;  4BE0 A;  1I3A A;  3KKS A;  1S9E A;  3V9S A;  1RT2 A;  4B8C A;  1J5O A;  4FW2 A;  3V1R A;  4Z4F A;  4W5O A;  4ZTJ A;  5CYM A;  1BCO A;  2B6A A;  3L2Q A;  4CES A;  3ZSO A;  1EXQ A;  3S3O A;  2I5J A;  3P83 D;  4KTW A;  4CCH A;  4ID5 A;  5JS1 A;  4OJR A;  2KTQ A;  2A1S A;  3NFA A;  3RWU A;  3QEX A;  4RW6 A;  3EZ5 A;  4IG3 A;  3SV3 A;  4O5B A;  4LD0 A;  4FLU A;  4M41 A;  3SQ4 A;  2QKK A;  1NJW A;  4NYF A;  4JRP A;  4FK0 A;  4XIU A;  4CEZ A;  1ASU A;  1RDD A;  3TWH A;  4DS5 A;  1TAQ A;  4CFC A;  3MED A;  4OGC A;  3OYG A;  1NJY A;  3SUP A;  1RDB A;  4IFV A;  5HRN A;  2VWJ A;  3RR8 A;  4CJW A;  3VQB A;  4J2E A;  1WNS A;  1CZB A;  2FBT A;  3EYZ A;  5CYQ A;  3KK1 A;  3IG1 A;  1KRP A;  4B9L A;  4BWJ A;  3OYB A;  2IC3 A;  3SCX A;  3RRG A;  2P1J A;  4PA1 A;  3M8Q A;  1R0A A;  5T7B A;  1L5U A;  3AV9 A;  2YHB A;  2HVH A;  4IKF A;  4GW6 A;  3ZSY A;  2IDO A;  2ETJ A;  3AVG A;  3PUF A;  4YNQ A;  3U6F A;  2G8I A;  1YTA A;  4DLG A;  1ASW A;  4CK1 A;  4DU1 A;  1TKX A;  3KLH A;  2EX3 A;  3QLH A;  3KD5 E;  2HHT A;  3NBP A;  4OVL A;  1NKB A;  2KFZ A;  3G10 A;  4TSX A;  5EU7 A;  3TAR A;  1Q8I A;  1WSJ A;  1JLA A;  2X78 A;  3NH2 A;  2RKI A;  1KLM A;  2D0A A;  1WSH A;  3UIQ A;  2BGG A;  1JXE A;  1D9D A;  3NF6 A;  4GVM A;  3V9Z A;  1TAU A;  1QHT A;  1C1B A;  2ZE2 A;  3CM6 A;  4C8M A;  4N47 A;  4CF2 A;  1ZBU A;  1EKE A;  3ZSQ A;  1DTQ A;  3OJU A;  4KFB A;  1C1A A;  2OPQ A;  4LSN A;  4BDY A;  1RTI A;  1VRU A;  3KJV A;  4AIL C;  3V81 A;  4C8O A;  4KV8 A;  1SL0 A;  2XRI A;  1EX4 A;  1IKX A;  1S1T A;  2E6L A;  4DF8 A;  4B9S A;  1C0M A;  2Y1I A;  5FDL A;  4BDP A;  4KHY A;  4CIF A;  3AA2 A;  1RTD A;  3HVT A;  2DFH A;  3T1A A;  4CF1 A;  4HUG A;  1JXB A;  2HND A;  3AO1 A;  3L2R A;  3VQC A;  3JSM A;  3K5M A;  3V1O A;  2B4J A;  5KGX A;  4JS5 A;  4M3U A;  3SI6 A;  1T03 A;  1Q9Y A;  1VK0 A;  3P5J A;  5FRM A;  1FKO A;  4DSL A;  2IGI A;  3CYM A;  3NH0 A;  3RMA A;  4CJU A;  3SUO A;  3HPG A;  1LW0 A;  1QQC A;  1JL1 A;  2IAJ A;  1XHZ A;  3DLH A;  4KHS A;  4ICL A;  2Z1G A;  4O44 A;  4OLB A;  2HHQ A;  2OZM A;  5KTQ A;  4M3Z A;  2KZZ A;  4W5R A;  3HM9 A;  1RT4 A;  3KD1 E;  1VSL A;  1QE1 A;  3SPZ A;  5I42 A;  1XC9 A;  1RBU A;  4E19 A;  4FJM A;  4M3R A;  3LAL A;  3AO2 A;  1LAV A;  3LZI A;  3AVK A;  4FM2 A;  1ZBF A;  3LP3 A;  4F4K A;  4Z0U A;  2VWK A;  3DLE A;  1JLC A;  4I9L A;  2XHB A;  3BDP A;  1N6Q A;  1N5Y A;  3TR8 A;  4HUF A;  1G15 A;  1KSP A;  4N5S A;  2HHS A;  1L3T A;  1BIZ A;  1FXX A;  4RG8 A;  4DQI A;  1VSF A;  5HLF A;  3LP2 A;  4DSE A;  4I9Q A;  1KVA A;  1D9F A;  3VQ4 A;  4CJL A;  2Q3S A;  1JLB A;  4CJF A;  2RF2 A;  1KFD A;  1GOB A;  4DFK A;  1JL2 A;  2VG7 A;  5C25 A;  3VQD A;  1C0U A;  3LAM A;  1L3S A;  1EP4 A;  4HVJ A;  3QNO A;  4CIG A;  3OS2 A;  4CHP A;  1YVU A;  5J2Q A;  2E4L A;  3WNE A;  4CJ3 A;  3MXI A;  4C8L A;  1KCF A;  2F8T A;  4AHS A;  3SPY A;  4NCG A;  1K6Y A;  4Z4G A;  2W42 A;  5D3G A;  3OVN A;  1IKW A;  4DSJ A;  1RDA A;  3S3N A;  1BQN A;  3TAM A;  4CJS A;  1D8Y A;  2XO7 A;  1UWB A;  3ZT2 A;  3KK3 A;  1SUQ A;  3V9W A;  2KW4 A;  3TAQ A;  3PO4 A;  4MQ3 A;  3HJF A;  2HHV A;  3SNN A;  4Y1C A;  1GOA A;  4CJQ A;  2FBX A;  1HNV A;  3SJJ A;  4RW9 A;  4H4M A;  5HRO A;  3ZSV A;  1T8E A;  1RT1 A;  4AHR A;  4OKE A;  2D0B A;  4OKJ A;  4FJH A;  3O4Q A;  4DSK A;  4M3W A;  2YNI A;  3OYH A;  4CEQ A;  3L2U A;  1KVC A;  5HBM A;  4FXD A;  3ALY A;  3AO3 A;  3KTQ A;  3T3F A;  3TAG A;  4FZZ A;  2WON A;  1BGX T;  1S9G A;  1SL2 A;  1S6P A;  2YNF A;  1S5J A;  1RIL A;  1WLJ A;  3K5L A;  4AHV A;  1KFS A;  4FJN A;  1O1W A;  1U47 A;  1RCH A;  3DLG A;  2HHU A;  2FBV A;  4CGJ A;  3AO4 A;  3V6D A;  2OPP A;  1U49 A;  1A5X A;  1IO2 A;  3D0P A;  4DTS A;  1NK5 A;  3VQ9 A;  3LWM A;  1RT6 A;  3LDS A;  1VSH A;  4I2P A;  3VQ5 A;  4F8R A;  1CXU A;  1LWE A;  3HVR A;  4F3O A;  2OPR A;  3CFP A;  4O0J A;  3QES A;  4B9V A;  1VSJ A;  1HYZ A;  3PX4 A;  4NYN A;  4DTU A;  1VSK A;  1UAX A;  1NK9 A;  2G8V A;  3HYF A;  1UA0 A;  2D5R A;  1HQU A;  2HMI A;  3F73 A;  4FJX A;  3RMC A;  4I2Q A;  1NK0 A;  3HK2 A;  3D45 A;  1RBS A;  3L2V A;  1L3U A;  4FVM A;  4AHT A;  3FFI A;  4O0I A;  1EET A;  1UA1 A;  1WSG A;  2B5J A;  2IS3 A;  4CHO A;  3LAN A;  4IDK A;  3OYL A;  4F3T A;  4KI6 A;  1SV5 A;  2ATQ A;  3MEC A;  2AJQ A;  4DLE A;  1Z26 A;  4E89 A;  4OGE A;  4CK2 A;  5HRS A;  3OS0 A;  3ULD A;  4J2D A;  3O4N A;  4W5N A;  4W5Q A;  3C95 A;  4UQG A;  3SQ0 A;  3C6T A;  3WNH A;  3NF9 A;  1NK7 A;  1VSM A;  1C0T A;  2DFE A;  3ZSR A;  4DTO A;  4Z4I A;  4CEE A;  3QEW A;  1NOZ A;  2ITG A;  3K5N A;  4CF0 A;  4FLV A;  3QIN A; 
#chains in the Genus database with same CATH topology
 3VQP A;  5JS2 A;  1VQL N;  5C2D A;  4BY9 C;  1EQY A;  4R5P A;  1Q18 A;  3DJC A;  4CGF A;  4JLH A;  5CHI A;  4CJ5 A;  4YOV A;  3DMJ A;  4BRH A;  3DYA A;  4CZF A;  1BI4 B;  1T7P A;  3HP9 A;  4JRQ A;  5FPM A;  3ZSX A;  1RGI A;  1ILY A;  2O8D A;  1T6C A;  1NGD A;  5AQV A;  1NBW A;  2BUP A;  1NGB A;  5J2P A;  2Q36 A;  4BRL A;  2GV9 A;  3IAY A;  3VQE A;  3OY9 A;  2HW3 A;  4LSL A;  1GOC A;  1ZXO A;  4FM1 A;  5M1Q A;  2IOC A;  4RW8 A;  3LM2 A;  3TSQ A;  3ZSW A;  3EL2 A;  3ZX3 A;  3A8Y A;  2YHA A;  4C23 A;  4U7B A;  4AF1 A;  2E8A A;  4FK4 A;  1DEJ A;  1W0H A;  2I7N A;  3H46 O;  2HHW A;  2LSN A;  5SWM A;  4LFA K;  4HWI A;  1I94 K;  3H08 A;  4B9U A;  1HRH A;  4IXC A;  4O4G A;  1BA0 A;  4JD2 A;  3AA3 A;  4M63 C;  4KB0 A;  1IG9 A;  1NGJ A;  3AVB A;  4DU3 A;  1VQN N;  1J6Z A;  5AQY A;  4E1M A;  4AM6 A;  4KTZ A;  2IVP A;  3N4P A;  3PX0 A;  5DMR A;  4JHD B;  4ELT A;  2D0C A;  3KVG A;  2E6M A;  3CQY A;  2CGJ A;  3WXK A;  4BE2 A;  5KGW A;  3OYN A;  2P51 A;  3THV A;  3F9K A;  3IRX A;  4B1V A;  3ZT1 A;  4KO0 A;  3H3O B;  5CE3 A;  5IT9 O;  4NCB A;  4WE1 A;  1K9M O;  4CZI A;  2HVI A;  1A5V A;  1UOC A;  4OPJ A;  1RBR A;  3SAH A;  3QER A;  3LPT A;  4DSF A;  3KK2 A;  1BU6 O;  4FW1 A;  3HO1 A;  3MCP A;  4CJK A;  4Z4E A;  4IBN A;  2R7Y A;  4B9M A;  3M5R A;  4F2S A;  1NU0 A;  3BUZ B;  3QFU A;  1BOT O;  3KLE A;  2G8U A;  4MDB A;  5AQN A;  3ZT3 A;  2FBY A;  1TKZ A;  3NVK A;  1TL1 A;  3PSI A;  1XC3 A;  4FCY A;  3S3M A;  1QSY A;  4O55 A;  1RT5 A;  3C7N B;  3I0S A;  5FPD A;  1X9W A;  4DFJ A;  5C12 A;  4H5W A;  3WQT A;  1WSI A;  3E01 A;  4M3Y A;  1WUA A;  4RW7 A;  3T1Y K;  4CGD A;  3SMS A;  3THX A;  4Q5V A;  1SKR A;  3TSP A;  3OJS A;  4MLE A;  1BWF O;  1S72 N;  4FPB A;  4PHT X;  4JKH A;  3QEV A;  1GLE G;  3AVL A;  5F0X A;  4BVO A;  2O8B B;  4N76 A;  4DV0 K;  1VQK N;  4FJI A;  4HCC A;  2O8F B;  2HOE A;  4M45 A;  3CC4 N;  3WXI A;  4LH5 A;  4DTN A;  4PUO A;  3I0R A;  3J8A A;  4DQQ A;  2DFF A;  5C42 A;  3K5O A;  2Z1I A;  3DXK A;  3WQU A;  1OVQ A;  3MN7 A;  1IKY A;  1JCF A;  1TKT A;  5AJ3 K;  4OX9 K;  3JYT A;  1TK8 A;  2HNZ A;  4KAZ A;  2O4I A;  5JVG L;  1SS6 A;  2G8K A;  1HUX A;  5FRO A;  2FF3 B;  4BG8 A;  2QK9 A;  2A5X A;  3HL8 A;  4BWM A;  2QW9 A;  2RPI A;  5AQZ A;  4JI1 K;  4FK2 A;  4B8A B;  1SKS A;  1VAZ A;  1EWQ A;  5GAD P;  4CF9 A;  3NGI A;  4PWD A;  4KKO A;  3CPE A;  2UXB K;  4IDH A;  1V4S A;  2YV0 X;  3D6R A;  3OYD A;  3MEG A;  1HQE A;  1S1U A;  3M8P A;  4WCE L;  1IBK K;  1D4X A;  3L6Q A;  3OYM A;  4KPY A;  4H0Y B;  5I3U A;  1FK9 A;  2P9U A;  2XY6 A;  1Z05 A;  1YF5 L;  4FJ8 A;  4EFH A;  3L3U A;  3VEW A;  4EZ9 A;  4BDZ A;  4Z4H A;  3V9U A;  4CI6 A;  3VEO A;  1CLQ A;  4A5B A;  3DLK A;  4E0D A;  4B3S K;  3JS6 A;  3C6U A;  3CFR A;  4CJP A;  1FKP A;  3K9J A;  2KHO A;  4CK3 A;  5GAH P;  3RSE A;  4CJT A;  3KKS A;  5AQP A;  4B8C A;  3DXM B;  1C0F A;  2P9N B;  5A2Q O;  3VOV A;  3L2Q A;  2QM1 A;  1ESV A;  3VF2 A;  1WB9 A;  3QEX A;  4IG3 A;  1GLD G;  2AA4 A;  4O5B A;  4FLU A;  5HOO A;  4FK0 A;  4XIU A;  1ASU A;  3KWI A;  4JN4 A;  1GLC G;  4FWN A;  3MED A;  4OGC A;  1NJY A;  4IFV A;  5HRN A;  2NRZ A;  4JKG B;  3MN9 A;  5AQT A;  4K0K K;  2WC9 A;  3VQB A;  3CD6 N;  1WNS A;  1WBD A;  4WFB L;  4B9L A;  4BWJ A;  1OH5 A;  4PA1 A;  2CH5 A;  3M8Q A;  2W6K A;  3CHW A;  3AV9 A;  2YHB A;  2HVH A;  2E1Z A;  3PIO L;  2ETJ A;  3U6F A;  1E3M A;  3AAR A;  1YTA A;  4DLG A;  4BRI A;  5ADX A;  1TKX A;  4BR4 A;  1HLU A;  4OVL A;  3U8X A;  1YJW N;  3G10 A;  1NKB A;  2KFZ A;  1KLM A;  2BGG A;  5KQ8 A;  3NF6 A;  4YDU A;  3BF1 A;  2VGN A;  2ZE2 A;  4N47 A;  1YVN A;  3KZB A;  2OPQ A;  4BDY A;  1RTI A;  1IKX A;  2E6L A;  5BN8 A;  1C0M A;  5FDL A;  3CCM N;  3AA2 A;  3JAM O;  4JI6 K;  4CF1 A;  1JXB A;  3VQC A;  2B4J A;  3THY A;  1Q9Y A;  5FRM A;  3L4I A;  4B3M K;  4DSL A;  2P9S A;  2IGI A;  3CYM A;  3RMA A;  2HST A;  3DLH A;  1QHA A;  3OBW A;  4FWK A;  4O44 A;  4C1N K;  4DR7 K;  3LM9 A;  2OZM A;  1N34 K;  3HM9 A;  1RT4 A;  3SPZ A;  1XC9 A;  4FJM A;  1P8Z A;  3H1V X;  3AVK A;  1ZBF A;  4DCH A;  3ZET B;  3DLE A;  1JLC A;  3BDP A;  4X64 K;  1GLB G;  3ZLJ A;  1KSP A;  5AZI A;  4DSE A;  3CCV N;  4DV7 K;  4FL9 A;  1HJO A;  4CJL A;  2Q3S A;  4CJF A;  2RF2 A;  4GV9 A;  4IEI A;  4X62 K;  3MWP A;  4ISE A;  3M3Z A;  4DKW A;  3BF3 A;  3CCQ N;  1YVU A;  2E4L A;  3WNE A;  2Q2R A;  1HKB A;  2BTF A;  1KCF A;  2GUP A;  3SPY A;  4Z4G A;  4OPH A;  1QVF M;  4DSJ A;  4YOR A;  1BQN A;  3TAM A;  1UWB A;  2P9L B;  3F9M A;  5B8H A;  1SUQ A;  3TAQ A;  3R6M A;  5FLX O;  3CC7 N;  3WEE B;  1HNV A;  3QFP A;  3CQX A;  5HRO A;  4CZL A;  4XEI A;  4AHR A;  2Q0U A;  4OKJ A;  4MLH A;  1RFQ A;  4CEQ A;  3L2U A;  3ALY A;  3T69 A;  3K9K A;  4FWL A;  4KH5 A;  4FZZ A;  4FOI A;  3CCS N;  2RHK A;  2ZGY A;  1RIL A;  3I56 N;  4BRE A;  4LF8 K;  4NLC A;  4JI0 K;  3SBG A;  2GEM A;  3E66 A;  2WBN A;  3QDK A;  3O4W A;  3D0P A;  1NMD A;  3IFR A;  3LWM A;  4DV4 K;  3CME N;  3EKU A;  2OPR A;  1Q7Y O;  4BRM A;  1WBB A;  1VSK A;  2G8V A;  3HYF A;  4IZ9 A;  1NK0 A;  3HK2 A;  4AHT A;  4O0I A;  1J5E K;  3OYL A;  1QZ5 A;  4KI6 A;  2ATQ A;  4DLE A;  1Z26 A;  4E89 A;  4OGE A;  1XNQ K;  4OPA A;  3C95 A;  4DUY K;  3SQ0 A;  3C6T A;  1NK7 A;  3NF9 A;  5JVH L;  1VSM A;  5BR9 A;  3FZF A;  3A5N C;  3C65 A;  1NOZ A;  2GBZ A;  4CZH A;  3K5N A;  4FLV A;  3QIN A;  4CEB A;  4KHU A;  5AQH A;  3WNF A;  2GX9 A;  3O80 A;  1K8K A;  3O9R A;  2YKM A;  3ZCM A;  2YKN A;  4JKD A;  4JK9 A;  4C8N A;  3RMD A;  2DPN A;  4H5V A;  1R59 O;  4DTM A;  1KLN A;  1W9H A;  1P90 A;  4FJ9 A;  3UB5 A;  4Z94 A;  4J2A A;  4DSI A;  3K2P A;  3SUQ A;  1RDU A;  4L8R B;  3WNG A;  2O4G A;  3L3V A;  2ZWH A;  3Q7C A;  4H0X B;  2OPS A;  2F8S A;  4MFB A;  4G1Q A;  4DR1 K;  3H45 C;  3ULE B;  4M42 A;  4GKK K;  3R1X A;  1HX1 A;  4H5T A;  3NE6 A;  3FLC O;  1D5A A;  2Z1J A;  4ZTF A;  1HNW K;  3AO5 A;  4ILJ A;  4CHN A;  3OA9 A;  2NZT A;  2XY7 A;  2WOM A;  2HNY A;  3QBW A;  4KHW A;  4ID1 A;  2JGU A;  4FOE A;  4EP5 A;  4KHQ A;  4DR5 K;  1VSI A;  1U2V B;  4H8K A;  3PY8 A;  3A0I X;  4BR7 A;  1BDG A;  1NK8 A;  3VQQ A;  4CE9 A;  2CGK A;  1RTJ A;  3DLB A;  3I33 A;  2KFN A;  4QCL A;  1GLA G;  4MO4 A;  4B9T A;  4PY5 A;  1VQ6 N;  3VQA A;  4BRD A;  1BUP A;  4CHZ A;  3FZM A;  3TAE A;  1RDC A;  1DTT A;  4CZK A;  1HNX K;  1RBT A;  1B9D A;  3CIP A;  4Z4C A;  3O6W A;  4J8F A;  3HPO A;  4FM0 A;  4DF4 A;  3AVN A;  1QS4 A;  1ZBL A;  4Q0B A;  1G99 A;  1TK0 A;  1ZBI A;  4O8K A;  3TI0 A;  2YI1 A;  1N33 K;  2G8W A;  2NUB A;  2E1Y A;  5CZ1 A;  5LMU K;  4FWO A;  3SLC A;  1U45 A;  5KI6 A;  3DRP A;  4DQR A;  1DLO A;  5DK5 A;  1YI2 N;  2UUC K;  4LF9 K;  3OYK A;  4YDU C;  3SMP A;  2BDP A;  5C15 A;  1F21 A;  5DM6 L;  4CJ4 A;  2OCE A;  3MAQ A;  3EEQ A;  2GWK A;  4RTF D;  3U3Y A;  1TKD A;  2OZS A;  5FRN A;  4FLT A;  1VSE A;  5BPN A;  4DFM A;  4WQ4 A;  3K59 A;  2HMP A;  2F9W A;  2PYL A;  4NXM K;  5ADX H;  3SAF A;  4JI5 K;  2BE2 A;  3FZK A;  1T05 A;  3VF4 A;  2CH6 A;  2PY5 A;  4ISF A;  4CEC A;  4J2B A;  1XI1 A;  3AVF A;  4KRF A;  3G0Z A;  5HRR A;  4GMJ B;  2Y1J A;  3NGY A;  3V4I A;  3QML A;  3AVC A;  1JLG A;  1NKC A;  3AVM A;  4FO0 A;  2O8C B;  3CFO A;  3BP8 A;  3DI6 A;  4JI3 K;  1GLF O;  2NRW A;  3ZX0 A;  2VGM A;  3WUH A;  4AHU A;  5HRP A;  3HT3 A;  1RTH A;  4JEP A;  2O8E B;  3AGK A;  2GTD A;  3D7E O;  3E9L A;  4JKA A;  4GKJ K;  3H3N O;  1W7A A;  1BHL A;  4MO5 A;  3DLL L;  4E1J A;  3RRH A;  3AY9 A;  4LH4 A;  4FJ5 A;  4FJK A;  2QWO A;  4FLX A;  3I8D A;  2YNG A;  4JI2 K;  1LAW A;  3NAE A;  1NJX A;  1VQ7 N;  4C8K A;  2QWP A;  4YHH K;  2W40 A;  2QWM A;  2RN2 A;  4YFU A;  4CFA A;  3DM2 A;  3VQ7 A;  3MX2 A;  4CER A;  3H1Q A;  1TK5 A;  4FPA A;  1IG8 A;  2X6N A;  2PYJ A;  2EHG A;  5E84 A;  5M1K A;  1HJR A;  4ILG B;  1TYQ B;  1QQM A;  3C6A A;  3QBX A;  1HPZ A;  3NDK A;  1E4F T;  3D2E A;  3SUN A;  1X9S A;  3NVM A;  2Q0R A;  4H4O A;  2P5O A;  3I8B A;  1J53 A;  3BGR A;  3VA0 A;  2Q97 A;  2PFU A;  4K43 A;  4ELU A;  3SV4 A;  1C6V A;  3LWL A;  2ZD1 A;  4A5A A;  1T6D A;  3MXJ A;  1ATS A;  3VA3 A;  1BIU A;  3L4Q A;  4UY8 O;  3P38 A;  1QVG M;  1J5O A;  3V1R A;  4Z4F A;  4W5O A;  4ZTJ A;  5CYM A;  2IVN A;  1BCO A;  3S3O A;  4CES A;  3MK6 A;  3P83 D;  2V7Z A;  5JS1 A;  2WFB A;  4OJR A;  3EO3 A;  1HNZ K;  2A1S A;  3NFA A;  3RWU A;  4RW6 A;  3SV3 A;  3ENB A;  5H1S Q;  2QKK A;  1NGH A;  1NJW A;  4JRP A;  4IEE A;  1RDD A;  3R9P A;  2A3Z A;  4CFC A;  3OYG A;  4PKI A;  1RDB A;  3SUP A;  1N8R O;  3RR8 A;  4CJW A;  2W6L A;  4XH4 A;  5TKY A;  1NGA A;  3N4Q A;  3THW A;  3W0L A;  3IG1 A;  5BRD A;  4DV5 K;  1Y64 A;  4YOT A;  3FR0 A;  4BR5 A;  1L5U A;  3ZSY A;  2IDO A;  2E2P A;  4YNQ A;  1NGC A;  2G8I A;  5AQX A;  3FZH A;  5BRE A;  3KLH A;  3KD5 E;  4TSX A;  3TAR A;  1Q8I A;  3UIQ A;  2GWJ A;  4JYA K;  3CJ1 A;  3HOT A;  1C1B A;  3WT0 A;  1EKE A;  4KFB A;  1C1A A;  4LSN A;  4CW7 B;  4C8O A;  3K0S A;  2XRI A;  3O08 A;  4JNE A;  1S1T A;  4CIF A;  4HUG A;  2HND A;  3L2R A;  1OVY A;  1VK0 A;  1SQK A;  5AQK A;  4CJU A;  1QQC A;  2IAJ A;  2YCH A;  4DV2 K;  4M3Z A;  3ZX2 A;  3KD1 E;  4BC2 A;  3UKU B;  4CBU A;  3LZI A;  3AO2 A;  4FM2 A;  4F4K A;  1OKJ A;  1N6Q A;  1N5Y A;  2UUB K;  1NG9 A;  3T1H K;  1NGF A;  1M1K O;  4RG8 A;  4BRQ A;  1VSF A;  4I9Q A;  1KVA A;  1D9F A;  3E1Y A;  5JLH A;  4DFK A;  2VG7 A;  5C25 A;  3VQD A;  3D2F A;  3CCL N;  3CC2 N;  1EP4 A;  2QA4 N;  3OS2 A;  4CHP A;  3B8A X;  2QXL A;  4CJ3 A;  5C0Y A;  2P9I A;  3OVN A;  3MCA B;  1Q86 O;  3S3N A;  3LL3 A;  3ZEU A;  3HRG A;  4I6M A;  2XO7 A;  4XH1 A;  3KK3 A;  1SZ2 A;  2WTU A;  3V9W A;  3PO4 A;  2HHV A;  4MQ3 A;  2QI2 A;  4GY2 B;  3TTD A;  3EE9 A;  4LFB K;  3MN5 A;  3IDH A;  1T8E A;  4X65 K;  4OKE A;  4M3W A;  4DSK A;  3A5M C;  1NNE A;  1KVC A;  4KHP K;  3ID6 A;  2YHX A;  3TAG A;  1BGX T;  3IMX A;  3CJA A;  4EHT A;  3UKR A;  1IV0 A;  1SAZ A;  2E2N A;  1KFS A;  4WQ4 C;  1XMO K;  1RCH A;  1U47 A;  2FBV A;  5CR4 A;  3V6D A;  1MDU B;  1EO1 A;  1A5X A;  1IO2 A;  3DAW A;  1NK5 A;  3VTI A;  3LDS A;  4I2P A;  4F8R A;  1CXU A;  2O8D B;  4U67 L;  2FSN A;  4F3O A;  3CFP A;  4IJA A;  3QES A;  3H6E A;  1YUW A;  1HYZ A;  4FSV A;  4BVP A;  3PX4 A;  1YAG A;  4NLB A;  2HMI A;  1HQU A;  2E5L K;  2I7P A;  5GAG P;  3F73 A;  1YIT N;  4I2Q A;  4BR9 A;  4FJX A;  3BY5 A;  1IBM K;  4FVM A;  1UA1 A;  2IS3 A;  2D4W A;  4B1X B;  4CZG A;  3ULD A;  3O4N A;  4NXN K;  4W5N A;  4LF7 K;  3ATU A;  1X3N A;  1Q82 O;  3EZW A;  4ISG A;  3ZSR A;  1DGK N;  4A59 A;  3QEW A;  2ITG A;  1W97 L;  4DTX A;  3PX6 A;  3KKR A;  4JD2 B;  4M7X A;  4A62 A;  4CZM A;  4CEF A;  3M1F A;  4CF8 A;  2HHX A;  1VQ5 N;  4FVU A;  2UUA K;  1BO5 O;  1WSE A;  2QWN A;  3DRR A;  5SZT A;  1JCG A;  1WAJ A;  3HI0 A;  3OYJ A;  3CM5 A;  2P9P A;  2G8H A;  2H3G X;  3A2F A;  4HTU A;  3AVI A;  5JLF A;  3PO5 A;  3GG4 A;  3E9O A;  2GUI A;  3CCR N;  3D2E B;  1XMQ K;  2A41 A;  4CVN E;  3SK3 A;  3TAP A;  4FWP A;  3TAN A;  5MLC Q;  4DR2 K;  2QWL A;  5J1E A;  2P9K A;  3VEV A;  1JLE A;  2D0O A;  3A5L C;  5C2F A;  4PQU A;  5C24 A;  4LY7 A;  5HL7 L;  1X9M A;  4FLW A;  3QB0 A;  5AQU A;  1BL3 A;  4KH4 A;  1TUY A;  2PZS A;  2WUS A;  2X74 A;  4DV3 K;  2A1R A;  4DMN A;  3V9X A;  2A6A A;  4Y0W A;  5E26 A;  3O3G A;  3JXU A;  2F4V K;  5GAE P;  1CXQ A;  2JWL A;  3QNN A;  4PKG A;  3RMB A;  3O8M A;  4PKH A;  1VRT A;  2OAN A;  2VQE K;  1BI4 A;  5LY3 A;  3QEI A;  4IWV A;  2NNW A;  3ENO A;  4OKK A;  3MXM A;  4EHU A;  4BE1 A;  5J2M A;  3C94 A;  1KAX A;  4WQ5 A;  4E1N A;  5F2R A;  4H5R A;  4IO9 L;  3DLR A;  4LF4 K;  3OYE A;  3THX B;  3NH1 A;  3OYA A;  4KI4 A;  2QKB A;  1S1V A;  3GDQ A;  1JLQ A;  3MX5 A;  2ASP A;  3DWL A;  4OLA A;  3TTC A;  3KK7 A;  1SKW A;  2Z1H A;  1S1W A;  4FLY A;  3NH0 A;  3U3G A;  3WXL A;  4E7H A;  2NRH A;  4BRP A;  1KD1 O;  4WFA L;  2OYQ A;  5AR0 A;  3O9S A;  4EP4 A;  3S41 A;  4DHY A;  2F7T A;  2BAN A;  5GIP A;  4AH9 A;  3M6G A;  1I39 A;  3VQ8 A;  4DQS A;  3DXK B;  4JKB A;  4HHT A;  3FFK B;  4DQ8 A;  4QS9 A;  3VGK A;  4DS4 A;  4B08 A;  4WF9 L;  4DWI A;  4ELV A;  5AQQ A;  1LOT B;  4JHD A;  1WSF A;  4CFB A;  1ITG A;  3SZ2 A;  4E7J A;  3AA4 A;  3SQ1 A;  3LDP A;  5CY4 A;  1RDW X;  3SYZ A;  1ZC6 A;  3NF7 A;  3SAG A;  5JMV A;  5CZ2 A;  2G8F A;  5AQO A;  3M8R A;  3IS9 A;  4QAG A;  3K58 A;  5BRF A;  3O9Q A;  1RT3 A;  2HF4 A;  2ASM A;  4M7Y A;  4W5T A;  4QS8 A;  3O9U A;  1VQO N;  2VG6 A;  2NRT A;  4EZ6 A;  1ASV A;  3RVC A;  5BR8 K;  1HYS A;  3VMF B;  2ZM6 K;  3G6E N;  1SL1 A;  3EY1 A;  4QOZ B;  1MA9 B;  2UYT A;  3BZC A;  4QS7 A;  1O13 A;  3MEE A;  4K8Z A;  1QTM A;  5BRH A;  3L0Q A;  2DY4 A;  1VQ4 N;  1J54 A;  1HKC A;  3LAK A;  3QET A;  2P9U B;  3C7N A;  1ZBH A;  2YHW A;  4X66 K;  4E3S A;  4M3X A;  4DU4 A;  2VQF K;  1HNI A;  4RCH A;  5KRS A;  2FSK A;  3ZEU B;  1XWL A;  3QEP A;  5C10 A;  4JV5 K;  3P1G A;  4CJR A;  1KAZ A;  3NCI A;  3PV8 A;  1C0G A;  3LPU A;  1RT7 A;  1J9A A;  3RSE B;  4FLZ A;  3OW2 M;  1NMN A;  2HBL A;  3KLG A;  2HBM A;  4F9O A;  2HBJ A;  4CFD A;  4HUE A;  3KWG A;  1DKG D;  4H0V B;  2O8B A;  4FYD A;  4A2B A;  2O8F A;  2XY8 A;  1C1C A;  4KB1 A;  2OTJ N;  1KXP A;  3IUC A;  3U9Z A;  5EVZ A;  4R79 A;  4CIE A;  1A5W A;  4KH6 A;  3PLA A;  3LP0 A;  4AHC A;  1XUP O;  1VQ8 N;  3MMV A;  4E7K A;  1OH6 A;  4AQY K;  4G9Z A;  1NJZ A;  2QTD A;  3OS1 A;  1YJN N;  1U48 A;  3M8S A;  1TL3 A;  4JAX A;  1LV5 A;  4DTJ A;  4KBO A;  4BRK A;  5FPE A;  3OYF A;  4XH5 A;  5AQJ A;  3HST B;  3VQ6 A;  4AM7 A;  2JLE A;  2ASO A;  1GLJ O;  4BRG A;  3AVJ A;  4DG1 A;  4CGG A;  3TAF A;  1IKV A;  2ITM A;  1JKH A;  3F2K A;  4H03 B;  4BE0 A;  1RT2 A;  2RE2 A;  4FW2 A;  3R8E A;  1NGE A;  2B6A A;  2HF3 A;  3CMA N;  3ZSO A;  4KTW A;  4ID5 A;  2KTQ A;  1GLL O;  4BQZ A;  1JCE A;  3EZ5 A;  2J4R A;  3SQ4 A;  2W41 A;  1VQ9 N;  4BRF A;  4DS5 A;  3THY B;  2QWQ A;  4C1N I;  2P9S B;  2VWJ A;  2NRV A;  3CF5 L;  4J2E A;  3LDN A;  1CZB A;  3CI5 A;  5CYQ A;  3EYZ A;  5LL6 Z;  3T7Z A;  1KRP A;  4JI7 K;  2P1J A;  4B9Q A;  2ZJP L;  5T7B A;  4GW6 A;  3AVG A;  3PUF A;  1ASW A;  4GVE A;  5AQI A;  5BN9 A;  5AQF A;  2EX3 A;  3QLH A;  2D1K A;  3NBP A;  1QZ6 A;  1WSJ A;  1JLA A;  5AZI B;  4IJN A;  5LMN K;  1WSH A;  3DXM A;  1D9D A;  3V9Z A;  1TAU A;  4C8M A;  1QHT A;  2P9N A;  1S3X A;  1ZBU A;  1DTQ A;  1T44 A;  4AIL C;  3V81 A;  4KV8 A;  1SL0 A;  4B9S A;  1NJI O;  2DFH A;  2FSJ A;  3V1O A;  5KGX A;  4M3U A;  3SI6 A;  4JKE A;  1N32 K;  3CET A;  3SUO A;  4JKG A;  3HZ6 A;  1NWK A;  1XHZ A;  4ICL A;  3TPQ A;  5KTQ A;  2ZJR L;  3O1W A;  2KZZ A;  4W5R A;  1VSL A;  1QE1 A;  4EAH D;  4O8U A;  4E19 A;  1LAV A;  3LP3 A;  2VWK A;  3VEY A;  4WQ5 C;  2XHB A;  2OTL N;  3TR8 A;  1G15 A;  3ID8 A;  5AQR A;  5M1N A;  1BIZ A;  4YOW A;  3LDO A;  4DUZ K;  3VQ4 A;  1JLB A;  1GOB A;  1NGI A;  1JL2 A;  1N36 K;  3A5O C;  4DV6 K;  1C0U A;  4A61 A;  4HVJ A;  1X3M A;  5J2Q A;  1QQO A;  3MXI A;  2F8T A;  3J80 O;  3O5B A;  4AHS A;  3QIC A;  4NCG A;  1K6Y A;  2V7Y A;  5GIN A;  5D3G A;  2JWK A;  3WXM B;  1RDA A;  3ZYY X;  1CZA N;  4CJS A;  2KW4 A;  5JIC A;  3HJF A;  5EOY A;  4Y1C A;  3W3D A;  4CJQ A;  2FBX A;  3SJJ A;  4RW9 A;  4H4M A;  3ZSV A;  2D0B A;  4JI8 K;  5HBM A;  4FWS A;  3HSC A;  3VES A;  2FXU A;  3ZET A;  3J7A P;  3R3L A;  1S6P A;  1K8K B;  1MWM A;  1VHX A;  1Z6R A;  3DLG A;  2HHU A;  3CJ9 A;  4CD1 A;  3VER A;  2OPP A;  4RWT A;  5FPN A;  3VQ9 A;  1W2B M;  1VSH A;  4BRC A;  4O0J A;  3TTF A;  4B9V A;  4NYN A;  4DTU A;  1UAX A;  2F9T A;  5IWA K;  1UA0 A;  2D5R A;  3OTO K;  4CBX A;  3L2V A;  1XQS C;  5AZJ A;  3FFI A;  1EET A;  2P9L A;  4IDK A;  4F3T A;  1VQM N;  3CCJ N;  1SV5 A;  3MEC A;  1E4G T;  1X9J A;  4CK2 A;  3OS0 A;  3WEE A;  3WNH A;  4GV3 A;  1OH7 A;  1C0T A;  4DTO A;  3U4L A;  4CF0 A;  2W42 A;  3NGZ A;  3LP1 A;  4CD3 A;  2DTU A;  4CHQ A;  2KLA A;  1QSS A;  2HB5 A;  3V1Q A;  5KRT A;  4OPK A;  3G71 N;  1VQP N;  4CEO A;  3AA5 X;  3NHG A;  3EN9 A;  4BG9 A;  3UE5 A;  4FWM A;  4FJ7 A;  4BC5 A;  1X1P A;  4PL8 A;  4CGH A;  4CJ7 A;  3AVH A;  1ZBS A;  4JS4 A;  4I7F A;  5F1X A;  1K73 O;  2HHH K;  3P4I A;  4F2R A;  3QIP A;  3O9T A;  1REV A;  2FC0 A;  4KRE A;  3SJH A;  4B1Y B;  3HXM A;  4V19 S;  1TGO A;  4NCA A;  5AQW A;  5AQG A;  4DTP A;  2OA8 A;  2P5G A;  3KLF A;  3ASM A;  5AFU A;  4DV1 K;  1VSD A;  2CGL A;  4LC9 B;  2VG5 A;  4DR4 K;  2PBD A;  3ITH A;  1M90 O;  4B1Z A;  3VTH A;  3QIO A;  5I9E B;  2D0P A;  1HMV A;  3O3F A;  1U04 A;  4JI4 K;  2KZM A;  1RBV A;  4A57 A;  4FJJ A;  4MDA A;  4NO7 A;  4CJE A;  4LF5 K;  3C0B A;  4WYB A;  3CJC A;  4B9N A;  4FZY A;  3K57 A;  3B6O A;  3CJB A;  4DB3 A;  2XY5 A;  2ZQB A;  1TVR A;  3QO9 A;  1Z25 A;  3GL1 A;  3LDQ A;  5AQM A;  4B1U B;  4CHY A;  3I55 N;  3PIP L;  1K8A O;  3HTV A;  4BRO A;  3KIO A;  1YHQ N;  3O1B A;  3J81 O;  3RTV A;  1BQM A;  4CED A;  4K25 A;  3L2W A;  1L3V A;  5TKW A;  3Q7B A;  2V52 B;  4N56 A;  4Y1D A;  1IH7 A;  3DRS A;  3ZT0 A;  3CCE N;  1BCM A;  3ULE A;  3J7Y P;  3HBT A;  5EX5 A;  1BIS A;  4BAC A;  3J7Z O;  4BRA A;  3LDL A;  2E2O A;  3LZJ A;  3ENH A;  3OYI A;  4RW4 A;  1WOQ A;  2E20 A;  3CCU N;  1YIJ N;  1TUU A;  2NRX A;  3HP6 A;  4HCB A;  4DTR A;  4CGI A;  4CZE A;  1Y97 A;  4FJG A;  4DQP A;  4KHN A;  1U2V A;  2AP1 A;  4K8X A;  3VEX A;  1Q9X A;  2ZJQ L;  1LW2 A;  3AVA A;  1WAF A;  4M3T A;  1HYV A;  4BRN A;  1ZYQ A;  5E41 A;  1ATR A;  2PAV A;  5BPM A;  1NK4 A;  3VN5 A;  3HPH A;  1KQS M;  4ILH A;  4BR2 A;  3ZSZ A;  3KLI A;  5J2N A;  1OH8 A;  5EY4 A;  2QWR A;  4B3T K;  2VWB A;  4B3O A;  1QSL A;  1JLF A;  1MU2 A;  1CZ9 A;  3P39 A;  1LWC A;  4E7I A;  5AQS A;  3TU5 A;  1HKG A;  3O3H A;  3T19 A;  2NRR A;  2QXF A;  1S22 A;  1NLV A;  4WFN L;  3CQ8 A;  4LF6 K;  5K14 A;  4CJV A;  4ZHR A;  1B9F A;  4H5N A;  3CPW M;  4CBW A;  4OO1 J;  1V4T A;  3NF8 A;  2HBK A;  1B92 A;  5M1P A;  3SQ2 A;  3CXC M;  3RR7 A;  1LCU A;  1U4B A;  3FE1 A;  4FZX C;  3S9H A;  3VEZ A;  3VEN A;  2FF6 A;  1XHX A;  4FJL A;  4N41 A;  2YNH A;  1NKE A;  4IFY A;  3TAB A;  1YTU A;  4CEA A;  4IOC L;  3DOL A;  3DOK A;  3B6P A;  3ISN C;  5KPT A;  1XNR K;  3FGU A;  1KTQ A;  4KTQ A;  1YT3 A;  2KKZ A;  1TV6 A;  3OYC A;  4BGB A;  4GV6 A;  4JK7 A;  4E7L A;  5ELZ A;  5HP1 A;  3FZL A;  1S1X A;  2F96 A;  4IG0 A;  3GOI A;  4EIA A;  2O8C A;  4JKC A;  2X6S A;  1RNH A;  2O8E A;  1WN7 A;  3THW B;  1NOY A;  4H0P A;  4CZJ A;  4B1W B;  2YJF A;  1KC8 O;  3OBY A;  3C6H A;  1NK6 A;  5AZJ B;  1S6Q A;  2KQ2 A;  4DFP A;  3ZT4 A;  3IKM A;  4K42 A;  3L8B A;  2A40 A;  1YJ9 N;  3CG7 A;  1KVB A;  2NLX A;  1LWF A;  2Q1N A;  1I3A A;  3V9S A;  1S9E A;  3MDQ A;  2YHY A;  4BQL A;  3GBT A;  1ATN A;  4H0O A;  5LJW A;  1EXQ A;  2I5J A;  4CCH A;  1BG3 A;  5M1F A;  4FWR A;  4LD0 A;  4M41 A;  4NYF A;  4YOY A;  3KHY A;  4BR0 A;  4CEZ A;  2Q31 A;  5AQL A;  4IO8 A;  3TWH A;  1TAQ A;  5KPR A;  4IOX A;  1IJJ A;  1TYQ A;  2UU9 K;  5KPZ A;  1T3V A;  2FBT A;  3KK1 A;  3OYB A;  2IC3 A;  3SCX A;  4YOU A;  3PSF A;  2VCP A;  3RRG A;  2A42 A;  3AGR A;  1R0A A;  5DM7 L;  4IKF A;  3BEX A;  2IVO A;  3HOS A;  1NM1 A;  4CK1 A;  4DU1 A;  2HHT A;  5EU7 A;  2X78 A;  3VPZ A;  3NH2 A;  2RKI A;  2D0A A;  1BA1 A;  1JXE A;  1QQN A;  4GVM A;  3SBT A;  4DR6 K;  3CM6 A;  1MWK A;  4CF2 A;  3ZSQ A;  3OJU A;  3G25 A;  3WXJ A;  3KJV A;  1VRU A;  3D2F B;  1NGG A;  2YX6 A;  1EX4 A;  3VET A;  4O5F A;  4DF8 A;  4KHY A;  2Y1I A;  4BDP A;  5KQD A;  4NB4 A;  3EE8 A;  1RTD A;  3HVT A;  3T1A A;  3AO1 A;  3JSM A;  3K5M A;  1KAY A;  2P9I B;  4JS5 A;  1T03 A;  3P5J A;  4GNI A;  3E9P A;  1FKO A;  4I6M B;  3G4S N;  3GE1 A;  2BH1 A;  4A2A A;  3HPG A;  1LW0 A;  4KHS A;  1JL1 A;  2Z1G A;  2HHQ A;  1JJ2 M;  2FLO A;  3CJ7 A;  3CER A;  4H0T B;  5M1O A;  5I42 A;  1RBU A;  4M3R A;  5AFU H;  1EWR A;  3LAL A;  4LFC K;  3VF6 A;  4Z0U A;  4IFE A;  4I9L A;  4B3R K;  3TSU A;  4HUF A;  3HM8 A;  3UKR B;  4N5S A;  2HHS A;  1DT9 A;  1L3T A;  1FXX A;  3U9D A;  2QEX N;  4DQI A;  5HLF A;  3LP2 A;  4BC4 A;  2GEL A;  4BGA A;  4JKF A;  1KFD A;  3ATV A;  3LAM A;  1L3S A;  3AAP A;  3QNO A;  4CIG A;  1Q81 O;  4C8L A;  3MN6 A;  2E88 A;  1IBL K;  4IOA L;  2YJE A;  1IKW A;  5LJV A;  1D8Y A;  3ZT2 A;  4BC3 A;  2ZGZ A;  3SNN A;  1GOA A;  1FJG K;  1YXQ A;  1HR0 K;  3OHR A;  5BPL A;  2UXC K;  1RT1 A;  2IIR A;  3EKS A;  4FJH A;  3O4Q A;  2YNI A;  3UKU A;  3OYH A;  2UXD K;  4FXD A;  2E2Q A;  3AO3 A;  4FWQ A;  3KTQ A;  3T3F A;  2WON A;  4JK8 A;  5GIO A;  1S9G A;  1SL2 A;  2YNF A;  1S5J A;  1WLJ A;  4YOX A;  3P31 A;  4K41 A;  4AHV A;  3K5L A;  4DR3 K;  3VGM A;  4FJN A;  1O1W A;  3VGL A;  4CGJ A;  3AO4 A;  1U49 A;  4DTS A;  1FW6 A;  2P9P B;  1RT6 A;  1H1V A;  3VQ5 A;  1LWE A;  3HVR A;  3BZK A;  1VSJ A;  3F5T A;  1NK9 A;  4YY3 K;  3RMC A;  5EXW A;  3D45 A;  1RBS A;  1L3U A;  2V51 B;  1WSG A;  2B5J A;  4CHO A;  3LAN A;  4HTL A;  2AJQ A;  3AAQ A;  4L3Q A;  3NMU A;  5HRS A;  3MWT A;  2ZF5 O;  4J2D A;  4W5Q A;  2P9K B;  4PL7 A;  4UQG A;  2EWS A;  2DFE A;  1HPM A;  1U6Z A;  4Z4I A;  4CEE A;  4OLB A;  2VYP A; 
#chains in the Genus database with same CATH homology
 4CEB A;  3NGZ A;  3VQP A;  4DTX A;  5JS2 A;  3PX6 A;  3KKR A;  4KHU A;  3WNF A;  3LP1 A;  2DTU A;  4CEF A;  4R5P A;  4CF8 A;  4CHQ A;  2HHX A;  1QSS A;  4CGF A;  2HB5 A;  4JLH A;  3V1Q A;  2YKM A;  3ZCM A;  5KRT A;  4OPK A;  4CJ5 A;  2YKN A;  3RMD A;  4C8N A;  4CEO A;  3AA5 X;  1WSE A;  3NHG A;  3DMJ A;  3DRR A;  5SZT A;  1WAJ A;  3DYA A;  3OYJ A;  3CM5 A;  1BI4 B;  1T7P A;  3HP9 A;  4JRQ A;  2G8H A;  1X1P A;  4KPY A;  3A2F A;  4CGH A;  3ZSX A;  4FJ7 A;  4HTU A;  3AVI A;  4DTM A;  3AVH A;  1KLN A;  1W9H A;  4JS4 A;  3PO5 A;  4FJ9 A;  4I7F A;  5J2P A;  2GUI A;  4J2A A;  4DSI A;  2GV9 A;  4F2R A;  3K2P A;  3SUQ A;  3IAY A;  3VQE A;  4L8R B;  3QIP A;  3WNG A;  1REV A;  2FC0 A;  2O4G A;  3L3V A;  4LSL A;  3OY9 A;  1GOC A;  4FM1 A;  4KRE A;  2HW3 A;  2OPS A;  2F8S A;  3TAP A;  3HXM A;  2IOC A;  4RW8 A;  1TGO A;  4NCA A;  3ZSW A;  4MFB A;  3TAN A;  4DTP A;  2YHA A;  2OA8 A;  2P5G A;  4G1Q A;  3KLF A;  5J1E A;  3ASM A;  1W0H A;  4FK4 A;  1JLE A;  4M42 A;  1VSD A;  2HHW A;  2LSN A;  4PQU A;  5SWM A;  2VG5 A;  5C24 A;  4LY7 A;  1X9M A;  3NE6 A;  3ITH A;  4FLW A;  1D5A A;  2Z1J A;  3H08 A;  4ZTF A;  1BL3 A;  4B9U A;  3AO5 A;  3QIO A;  4CHN A;  1HRH A;  1HMV A;  3O3F A;  2PZS A;  4O4G A;  2X74 A;  2A1R A;  3AA3 A;  1U04 A;  4KB0 A;  4DMN A;  1IG9 A;  3V9X A;  3AVB A;  1RBV A;  2WOM A;  4DU3 A;  2XY7 A;  2KZM A;  2HNY A;  4FJJ A;  4KHW A;  4E1M A;  2GBZ A;  4ID1 A;  4KTZ A;  4CJE A;  3O3G A;  2JGU A;  4EP5 A;  4KHQ A;  1CXQ A;  3PX0 A;  3QNN A;  3RMB A;  1VSI A;  4B9N A;  5DMR A;  4H8K A;  4FZY A;  1VRT A;  3K57 A;  3B6O A;  1BI4 A;  2D0C A;  3QEI A;  2E6M A;  2XY5 A;  3PY8 A;  4ELT A;  2ZQB A;  1TVR A;  4OKK A;  3QO9 A;  1Z25 A;  4CHY A;  3MXM A;  4BE1 A;  5J2M A;  1NK8 A;  3C94 A;  3VQQ A;  4BE2 A;  4CE9 A;  1RTJ A;  5KGW A;  4E1N A;  3KIO A;  3DLB A;  3DLR A;  3OYN A;  2KFN A;  2P51 A;  3OYE A;  3THV A;  3RTV A;  3NH1 A;  3F9K A;  3OYA A;  4KI4 A;  4QCL A;  1BQM A;  4CED A;  3IRX A;  3L2W A;  4B9T A;  2QKB A;  1S1V A;  3ZT1 A;  1JLQ A;  3VQA A;  1L3V A;  4PY5 A;  4KO0 A;  4OLA A;  4NCB A;  4CHZ A;  3TAE A;  1SKW A;  4N56 A;  1RDC A;  2Z1H A;  1S1W A;  4WE1 A;  4Y1D A;  4FLY A;  2HVI A;  1A5V A;  1IH7 A;  1DTT A;  1UOC A;  3DRS A;  1RBR A;  3U3G A;  1RBT A;  1B9D A;  1BCM A;  3ZT0 A;  4OPJ A;  4Z4C A;  3QER A;  3LPT A;  4DSF A;  4E7H A;  1BIS A;  4BAC A;  3KK2 A;  3HPO A;  4FM0 A;  4DF4 A;  3AVN A;  2OYQ A;  1QS4 A;  4FW1 A;  1ZBL A;  4EP4 A;  3HO1 A;  4Q0B A;  3LZJ A;  3OYI A;  1TK0 A;  4CJK A;  3TI0 A;  4RW4 A;  4IBN A;  2R7Y A;  4B9M A;  4F2S A;  4Z4E A;  1ZBI A;  2BAN A;  4AH9 A;  3KLE A;  1I39 A;  3VQ8 A;  4DQS A;  2G8W A;  2G8U A;  2NUB A;  2FBY A;  1TKZ A;  3ZT3 A;  3HP6 A;  4HHT A;  5CZ1 A;  1TL1 A;  4DTR A;  4HCB A;  4CGI A;  4FCY A;  3S3M A;  1U45 A;  1QSY A;  4O55 A;  1RT5 A;  5KI6 A;  1Y97 A;  3DRP A;  4DS4 A;  4FJG A;  4DQP A;  4DQR A;  4B08 A;  3I0S A;  4DWI A;  4KHN A;  1DLO A;  5DK5 A;  4ELV A;  1X9W A;  4DFJ A;  4K8X A;  3OYK A;  1Q9X A;  1WSF A;  4CFB A;  1ITG A;  3SZ2 A;  2BDP A;  1LW2 A;  4E7J A;  1F21 A;  3AA4 A;  3AVA A;  3SQ1 A;  4CJ4 A;  1WAF A;  4M3T A;  1WSI A;  1HYV A;  5CY4 A;  3E01 A;  4M3Y A;  4RW7 A;  3MAQ A;  3SYZ A;  1TKD A;  4CGD A;  3U3Y A;  3NF7 A;  2OZS A;  5FRN A;  1ZYQ A;  4FLT A;  4Q5V A;  5E41 A;  1SKR A;  2G8F A;  5CZ2 A;  3OJS A;  1VSE A;  3M8R A;  4DFM A;  3IS9 A;  4QAG A;  1NK4 A;  3VN5 A;  3K59 A;  3K58 A;  3HPH A;  2PYL A;  3ZSZ A;  3KLI A;  5J2N A;  1RT3 A;  2BE2 A;  4W5T A;  3QEV A;  3AVL A;  2VG6 A;  4B3O A;  1T05 A;  1QSL A;  4EZ6 A;  1ASV A;  1JLF A;  1MU2 A;  1CZ9 A;  2PY5 A;  1HYS A;  1LWC A;  4N76 A;  4FJI A;  4CEC A;  3EY1 A;  4E7I A;  1SL1 A;  4HCC A;  4J2B A;  4M45 A;  4QOZ B;  1XI1 A;  3AVF A;  4KRF A;  3G0Z A;  5HRR A;  4GMJ B;  2Y1J A;  3O3H A;  4LH5 A;  3NGY A;  3T19 A;  3MEE A;  4K8Z A;  4DTN A;  4PUO A;  2QXF A;  3V4I A;  3I0R A;  1QTM A;  2DY4 A;  4DQQ A;  2DFF A;  3AVC A;  3CQ8 A;  5C42 A;  3K5O A;  2Z1I A;  1J54 A;  3LAK A;  1JLG A;  5K14 A;  4CJV A;  1NKC A;  3AVM A;  1B9F A;  4ZHR A;  3QET A;  1IKY A;  3CFO A;  3DI6 A;  1TKT A;  5HRP A;  1ZBH A;  4AHU A;  3JYT A;  3HT3 A;  1RTH A;  3NF8 A;  1TK8 A;  1B92 A;  4E3S A;  4M3X A;  4DU4 A;  3SQ2 A;  3RR7 A;  2HNZ A;  4KAZ A;  2O4I A;  1HNI A;  1U4B A;  1BHL A;  5KRS A;  2G8K A;  4FZX C;  3S9H A;  5FRO A;  1XWL A;  3RRH A;  3QEP A;  2QK9 A;  3P1G A;  4CJR A;  3NCI A;  1XHX A;  3PV8 A;  3HL8 A;  4BWM A;  4LH4 A;  4FJL A;  2RPI A;  4N41 A;  4FJ5 A;  3LPU A;  1RT7 A;  1J9A A;  4FLZ A;  4FJK A;  4FLX A;  2YNH A;  3I8D A;  1NKE A;  4FK2 A;  4IFY A;  4B8A B;  3TAB A;  1SKS A;  1YTU A;  2YNG A;  4CEA A;  4CF9 A;  1LAW A;  3NAE A;  3KLG A;  3DOL A;  3NGI A;  1NJX A;  4C8K A;  3DOK A;  4CFD A;  3B6P A;  3ISN C;  4HUE A;  4KKO A;  4PWD A;  2RN2 A;  4YFU A;  4CFA A;  1KTQ A;  4FYD A;  4KTQ A;  1YT3 A;  3DM2 A;  3VQ7 A;  2XY8 A;  1C1C A;  4CER A;  2YV0 X;  4KB1 A;  1TV6 A;  3OYD A;  3OYC A;  3MEG A;  1HQE A;  1S1U A;  3M8P A;  1TK5 A;  4E7L A;  5HP1 A;  3OYM A;  1S1X A;  2X6N A;  2EHG A;  2F96 A;  1A5W A;  4CIE A;  2PYJ A;  3LP0 A;  5I3U A;  1FK9 A;  4AHC A;  1HJR A;  4IG0 A;  4E7K A;  2X6S A;  2XY6 A;  1HPZ A;  3NDK A;  1RNH A;  3OS1 A;  1NJZ A;  1U48 A;  3SUN A;  1X9S A;  3M8S A;  4FJ8 A;  3L3U A;  1TL3 A;  1WN7 A;  4H4O A;  1NOY A;  2P5O A;  4EZ9 A;  1J53 A;  4BDZ A;  3BGR A;  4Z4H A;  4DTJ A;  1LV5 A;  3VA0 A;  3V9U A;  3OYF A;  1NK6 A;  4ELU A;  1CLQ A;  3SV4 A;  1S6Q A;  2KQ2 A;  3DLK A;  3HST B;  1C6V A;  3VQ6 A;  4DFP A;  2JLE A;  3ZT4 A;  3LWL A;  4E0D A;  3C6U A;  2ZD1 A;  3L8B A;  3AVJ A;  4DG1 A;  4CGG A;  1FKP A;  4CJP A;  3CFR A;  3CG7 A;  3MXJ A;  3TAF A;  4CK3 A;  3VA3 A;  1KVB A;  1IKV A;  1BIU A;  4CJT A;  1LWF A;  1JKH A;  4BE0 A;  1I3A A;  3KKS A;  1S9E A;  3V9S A;  1RT2 A;  4B8C A;  1J5O A;  4FW2 A;  3V1R A;  4Z4F A;  4W5O A;  4ZTJ A;  5CYM A;  1BCO A;  2B6A A;  3L2Q A;  4CES A;  3ZSO A;  1EXQ A;  3S3O A;  2I5J A;  3P83 D;  4KTW A;  4CCH A;  4ID5 A;  5JS1 A;  4OJR A;  2KTQ A;  2A1S A;  3NFA A;  3RWU A;  3QEX A;  4RW6 A;  3EZ5 A;  4IG3 A;  3SV3 A;  4O5B A;  4LD0 A;  4FLU A;  4M41 A;  3SQ4 A;  2QKK A;  1NJW A;  4NYF A;  4JRP A;  4FK0 A;  4XIU A;  4CEZ A;  1ASU A;  1RDD A;  3TWH A;  4DS5 A;  1TAQ A;  4CFC A;  3MED A;  4OGC A;  3OYG A;  1NJY A;  3SUP A;  1RDB A;  4IFV A;  5HRN A;  2VWJ A;  3RR8 A;  4CJW A;  3VQB A;  4J2E A;  1WNS A;  1CZB A;  2FBT A;  3EYZ A;  5CYQ A;  3KK1 A;  3IG1 A;  1KRP A;  4B9L A;  4BWJ A;  3OYB A;  2IC3 A;  3SCX A;  3RRG A;  2P1J A;  4PA1 A;  3M8Q A;  1R0A A;  5T7B A;  1L5U A;  3AV9 A;  2YHB A;  2HVH A;  4IKF A;  4GW6 A;  3ZSY A;  2IDO A;  2ETJ A;  3AVG A;  3PUF A;  4YNQ A;  3U6F A;  2G8I A;  1YTA A;  4DLG A;  1ASW A;  4CK1 A;  4DU1 A;  1TKX A;  3KLH A;  2EX3 A;  3QLH A;  3KD5 E;  2HHT A;  3NBP A;  4OVL A;  1NKB A;  2KFZ A;  3G10 A;  4TSX A;  5EU7 A;  3TAR A;  1Q8I A;  1WSJ A;  1JLA A;  2X78 A;  3NH2 A;  2RKI A;  1KLM A;  2D0A A;  1WSH A;  3UIQ A;  2BGG A;  1JXE A;  1D9D A;  3NF6 A;  4GVM A;  3V9Z A;  1TAU A;  1QHT A;  1C1B A;  2ZE2 A;  3CM6 A;  4C8M A;  4N47 A;  4CF2 A;  1ZBU A;  1EKE A;  3ZSQ A;  1DTQ A;  3OJU A;  4KFB A;  1C1A A;  2OPQ A;  4LSN A;  4BDY A;  1RTI A;  1VRU A;  3KJV A;  4AIL C;  3V81 A;  4C8O A;  4KV8 A;  1SL0 A;  2XRI A;  1EX4 A;  1IKX A;  1S1T A;  2E6L A;  4DF8 A;  4B9S A;  1C0M A;  2Y1I A;  5FDL A;  4BDP A;  4KHY A;  4CIF A;  3AA2 A;  1RTD A;  3HVT A;  2DFH A;  3T1A A;  4CF1 A;  4HUG A;  1JXB A;  2HND A;  3AO1 A;  3L2R A;  3VQC A;  3JSM A;  3K5M A;  3V1O A;  2B4J A;  5KGX A;  4JS5 A;  4M3U A;  3SI6 A;  1T03 A;  1Q9Y A;  1VK0 A;  3P5J A;  5FRM A;  1FKO A;  4DSL A;  2IGI A;  3CYM A;  3NH0 A;  3RMA A;  4CJU A;  3SUO A;  3HPG A;  1LW0 A;  1QQC A;  1JL1 A;  2IAJ A;  1XHZ A;  3DLH A;  4KHS A;  4ICL A;  2Z1G A;  4O44 A;  4OLB A;  2HHQ A;  2OZM A;  5KTQ A;  4M3Z A;  2KZZ A;  4W5R A;  3HM9 A;  1RT4 A;  3KD1 E;  1VSL A;  1QE1 A;  3SPZ A;  5I42 A;  1XC9 A;  1RBU A;  4E19 A;  4FJM A;  4M3R A;  3LAL A;  3AO2 A;  1LAV A;  3LZI A;  3AVK A;  4FM2 A;  1ZBF A;  3LP3 A;  4F4K A;  4Z0U A;  2VWK A;  3DLE A;  1JLC A;  4I9L A;  2XHB A;  3BDP A;  1N6Q A;  1N5Y A;  3TR8 A;  4HUF A;  1G15 A;  1KSP A;  4N5S A;  2HHS A;  1L3T A;  1BIZ A;  1FXX A;  4RG8 A;  4DQI A;  1VSF A;  5HLF A;  3LP2 A;  4DSE A;  4I9Q A;  1KVA A;  1D9F A;  3VQ4 A;  4CJL A;  2Q3S A;  1JLB A;  4CJF A;  2RF2 A;  1KFD A;  1GOB A;  4DFK A;  1JL2 A;  2VG7 A;  5C25 A;  3VQD A;  1C0U A;  3LAM A;  1L3S A;  1EP4 A;  4HVJ A;  3QNO A;  4CIG A;  3OS2 A;  4CHP A;  1YVU A;  5J2Q A;  2E4L A;  3WNE A;  4CJ3 A;  3MXI A;  4C8L A;  1KCF A;  2F8T A;  4AHS A;  3SPY A;  4NCG A;  1K6Y A;  4Z4G A;  2W42 A;  5D3G A;  3OVN A;  1IKW A;  4DSJ A;  1RDA A;  3S3N A;  1BQN A;  3TAM A;  4CJS A;  1D8Y A;  2XO7 A;  1UWB A;  3ZT2 A;  3KK3 A;  1SUQ A;  3V9W A;  2KW4 A;  3TAQ A;  3PO4 A;  4MQ3 A;  3HJF A;  2HHV A;  3SNN A;  4Y1C A;  1GOA A;  4CJQ A;  2FBX A;  1HNV A;  3SJJ A;  4RW9 A;  4H4M A;  5HRO A;  3ZSV A;  1T8E A;  1RT1 A;  4AHR A;  4OKE A;  2D0B A;  4OKJ A;  4FJH A;  3O4Q A;  4DSK A;  4M3W A;  2YNI A;  3OYH A;  4CEQ A;  3L2U A;  1KVC A;  5HBM A;  4FXD A;  3ALY A;  3AO3 A;  3KTQ A;  3T3F A;  3TAG A;  4FZZ A;  2WON A;  1BGX T;  1S9G A;  1SL2 A;  1S6P A;  2YNF A;  1S5J A;  1RIL A;  1WLJ A;  3K5L A;  4AHV A;  1KFS A;  4FJN A;  1O1W A;  1U47 A;  1RCH A;  3DLG A;  2HHU A;  2FBV A;  4CGJ A;  3AO4 A;  3V6D A;  2OPP A;  1U49 A;  1A5X A;  1IO2 A;  3D0P A;  4DTS A;  1NK5 A;  3VQ9 A;  3LWM A;  1RT6 A;  3LDS A;  1VSH A;  4I2P A;  3VQ5 A;  4F8R A;  1CXU A;  1LWE A;  3HVR A;  4F3O A;  2OPR A;  3CFP A;  4O0J A;  3QES A;  4B9V A;  1VSJ A;  1HYZ A;  3PX4 A;  4NYN A;  4DTU A;  1VSK A;  1UAX A;  1NK9 A;  2G8V A;  3HYF A;  1UA0 A;  2D5R A;  1HQU A;  2HMI A;  3F73 A;  4FJX A;  3RMC A;  4I2Q A;  1NK0 A;  3HK2 A;  3D45 A;  1RBS A;  3L2V A;  1L3U A;  4FVM A;  4AHT A;  3FFI A;  4O0I A;  1EET A;  1UA1 A;  1WSG A;  2B5J A;  2IS3 A;  4CHO A;  3LAN A;  4IDK A;  3OYL A;  4F3T A;  4KI6 A;  1SV5 A;  2ATQ A;  3MEC A;  2AJQ A;  4DLE A;  1Z26 A;  4E89 A;  4OGE A;  4CK2 A;  5HRS A;  3OS0 A;  3ULD A;  4J2D A;  3O4N A;  4W5N A;  4W5Q A;  3C95 A;  4UQG A;  3SQ0 A;  3C6T A;  3WNH A;  3NF9 A;  1NK7 A;  1VSM A;  1C0T A;  2DFE A;  3ZSR A;  4DTO A;  4Z4I A;  4CEE A;  3QEW A;  1NOZ A;  2ITG A;  3K5N A;  4CF0 A;  4FLV A;  3QIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...