3MXJA

Crystal structure of the mtrex1 apoprotein
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
229
structure length
210
Chain Sequence
LPHGHMQTLIFLDLEATGLPSSRPEVTELCLLAVHRRALEPPVPRPPRVVDKLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAALKALEQKSYSLGSIYTRLYWQAPTDSHTAEGDVLTLLSICQWKPQALLQWVDEHARPFSTVKPMYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Three prime repair exonuclease 1
publication title X-ray Crystal Structures of TREX1 3' Exonuclease Autoimmune Disease Mutants
rcsb
source organism Mus musculus
total genus 71
structure length 210
sequence length 229
chains with identical sequence B
ec nomenclature ec 3.1.11.2: Exodeoxyribonuclease III.
pdb deposition date 2010-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3mxjA01
3WNHA 1LWFA 4Q5VA 5HLFA 4BACA 4B3OA 4CJPA 1C0TA 1IO2A 4BE0A 4E89A 1TK8A 4ELVA 1RNHA 1Q9XA 5J2PA 4W5NA 1TL1A 3V6DA 4F2SA 4O4GA 1JKHA 4CEAA 1S1UA 3PV8A 2KFZA 4CESA 2DTUA 4DQIA 1UOCA 3PX6A 1IKWA 2Z1HA 1VSJA 4Q0BA 1CXQA 1QQCA 1J9AA 3QEIA 1J5OA 4N76A 4Z4CA 4DU4A 3AVIA 3OYGA 4B9LA 1ASWA 3NH2A 4ZTJA 1S6PA 1C6VA 3U3YA 3K2PA 1G15A 4CHNA 2W42A 4CJQA 3MXMA 1LAWA 1T05A 4J2AA 4CGGA 2IS3A 2YV0X 5CZ2A 4KHYA 4KHSA 3IAYA 4PA1A 1RT5A 3LP3A 2FBXA 3ZT4A 2HVHA 2HHXA 3TI0A 4PUOA 3LP0A 4FVMA 4RW6A 4HUGA 4BDZA 3QETA 3PX0A 3CG7A 4ICLA 2GV9A 3MXJA 4Z4IA 2VG6A 4CFBA 1TVRA 2DFFA 4BE2A 1RTHA 2QXFA 3L3VA 3OS0A 1CZ9A 3LALA 4B9VA 4N41A 1XHZA 3PO4A 1JLGA 1TKXA 4OGCA 4FJ8A 4RG8A 2D0BA 4CJLA 4KI4A 2DY4A 2XY8A 3AO3A 2Y1JA 1U4BA 2X6SA 1NKCA 4DU3A 1EKEA 4EP5A 3DOKA 3VQ6A 3MECA 2XO7A 1I39A 2Z1IA 2KW4A 3VQAA 1VRTA 2VG5A 3TAEA 4M42A 4YFUA 4J2BA 4PQUA 3ZSVA 4O0IA 3CFPA 3V1QA 2QKKA 3OYLA 5DK5A 3HO1A 4DFJA 3PX4A 1L5UA 4CEOA 4KHQA 2IGIA 4DSLA 1BL3A 3SQ2A 4NCBA 4QOZB 4ELUA 3VA0A 3EYZA 3RRGA 3KK3A 1LAVA 4E1MA 2VG7A 1L3TA 1BGXT 1SKSA 1SL1A 1RT4A 5KRSA 3IRXA 3SQ1A 1FXXA 2GBZA 4HUFA 4FW2A 4C8NA 1RTIA 2RN2A 2ETJA 4HVJA 4E7LA 3AVBA 1RILA 2G8VA 4EZ9A 5CYMA 4E19A 2WOMA 5K14A 4Z4GA 2RPIA 1EETA 1TGOA 2F8TA 4E0DA 2XRIA 2ZD1A 1JXBA 1XHXA 5CYQA 4CJWA 4C8OA 4FZYA 1ASUA 3LDSA 1CLQA 4CGJA 4E3SA 3HSTB 3OVNA 3VQCA 2IOCA 3VQ8A 3TAPA 1Q8IA 3OS2A 3HT3A 1A5VA 3C6UA 5C24A 3HVTA 2FC0A 1FKPA 2VWKA 2RF2A 3I8DA 3DLGA 3QLHA 1KFDA 3ZSQA 1J54A 1NK9A 1ZYQA 1TAUA 2D0CA 3ZT1A 4B9TA 3TARA 2B5JA 1QHTA 4MFBA 3KD5E 2OPSA 3RMDA 1BCOA 3OS1A 2XHBA 3KTQA 1GOCA 1SL0A 1NKBA 3PO5A 1JLEA 4CF2A 1C1BA 4G1QA 1RBSA 4B08A 4CEFA 4R5PA 1SKRA 1C0MA 2D0AA 1IG9A 1QSYA 3L3UA 1JLFA 3ALYA 4CERA 3OYFA 3ZSXA 3PUFA 3M8RA 3L2UA 3S3NA 3VQEA 2HNDA 2OPPA 3VQQA 1XC9A 4DTMA 1D5AA 4NYFA 3RMBA 4AHRA 4CJKA 3VQ4A 2Y1IA 2AJQA 1W0HA 4W5QA 4DWIA 3LWMA 3S3OA 4OGEA 1HQUA 1REVA 1WSFA 3VQPA 2JGUA 1C0UA 1WNSA 5C25A 1EP4A 1LW0A 4DLGA 3SQ0A 4JS4A 2HHSA 3O3HA 1L3UA 3HPGA 3CM6A 4EP4A 2KZMA 4Z0UA 3KLIA 3KK1A 4OLAA 3D45A 3DRSA 5J2MA 4CEQA 4C8KA 4BDYA 1S1XA 2LSNA 5D3GA 1LV5A 1RT7A 2FBTA 2YNFA 3SV4A 4CCHA 4KHWA 3M8PA 3K58A 3SUPA 4DF8A 2P5OA 2Z1JA 3HP9A 4M3TA 4DU1A 1ZBUA 3M8QA 1UWBA 4TSXA 4GMJB 1LW2A 3RTVA 3SI6A 4J2EA 4GW6A 4CK3A 3NH1A 4FLXA 2PYLA 4F8RA 4HCCA 4M41A 2PY5A 3AVJA 1SL2A 3EZ5A 3KD1E 3CYMA 4CEZA 1RCHA 5FRNA 5FROA 4IG3A 3SPZA 2OYQA 4E1NA 4B8CA 4K8ZA 3K5MA 3P5JA 3AVAA 2E4LA 2YNHA 3A2FA 1L3SA 2HHVA 3NBPA 4HHTA 1X9MA 1CZBA 1HYSA 3QEPA 1XI1A 3RMAA 3S9HA 2HNZA 4JLHA 5J2NA 2A1SA 1BHLA 1JXEA 4C8MA 3NDKA 3VQDA 2XY7A 3TABA 3KJVA 3DRPA 1KLNA 3K5NA 4DSKA 1ASVA 3ZSWA 3C95A 4Y1DA 2QKBA 1QSSA 3DLRA 3I0SA 3NF6A 5EU7A 5E41A 3OYIA 3LPTA 4CHZA 4OPJA 3OJUA 5FDLA 3RR7A 3SUQA 3VQBA 1N5YA 4QAGA 4ID5A 2R7YA 1D8YA 4W5OA 3AO5A 4M3UA 1RT6A 3TAMA 4Z4HA 4B9MA 1C1CA 4H4MA 3KK2A 3AA3A 3AVNA 1TKTA 4O0JA 1SKWA 5SZTA 1U45A 4CJRA 3MEDA 3QINA 1WLJA 3DOLA 3UIQA 3MEEA 3CFRA 2KQ2A 4CECA 3V1RA 1RDAA 4RW8A 1KRPA 5CY4A 2A1RA 4KTQA 1JLQA 4DTXA 1EXQA 3KKSA 4MQ3A 4DSJA 1Z25A 2B6AA 3ULDA 4E7IA 4CEBA 1VK0A 2X78A 4CJEA 5DMRA 1HMVA 4FLTA 2OPRA 3OY9A 2EX3A 1LWCA 3WNFA 3V9SA 1BIUA 4IG0A 3OJSA 4F3TA 2HVIA 3C94A 1YTUA 5KTQA 3KLEA 4FLYA 2BE2A 3V81A 3KIOA 4FJJA 1RDCA 4KTWA 2I5JA 3EY1A 4CE9A 1WSHA 3H08A 4LD0A 3TR8A 4IKFA 4KHUA 1RTJA 3AVGA 4CGFA 4YNQA 4DSFA 4RW9A 3HPOA 4OLBA 3WNGA 2WONA 5HRPA 4FZXC 1ZBIA 3AVMA 4H8KA 4FJMA 4BDPA 3C6TA 4F2RA 3RMCA 3T1AA 4CHOA 1RBUA 3DLBA 4I2PA 3SPYA 2G8KA 4J2DA 4FJ5A 2P51A 3VQ9A 2HW3A 4KV8A 2ZE2A 3CQ8A 1KFSA 3AVFA 4KKOA 4DTJA 1WSEA 4LY7A 3SQ4A 1U48A 2Z1GA 4CIEA 4KHNA 3T3FA 1BISA 3HVRA 3O4QA 3AVHA 4OPKA 4CF1A 4F4KA 1NJYA 3QO9A 3DLKA 4FLUA 4DTSA 4RW7A 3DMJA 2P5GA 1WAJA 4OJRA 1WN7A 1XWLA 4CFDA 4M3ZA 1RTDA 4LSLA 3OYDA 4LSNA 4FK2A 4M3RA 4CJ4A 2VWJA 4LH4A 5HBMA 1QSLA 1S1VA 3ISNC 4M3XA 4Z4FA 4LH5A 4KI6A 3ZT0A 3L2RA 1O1WA 5HRNA 4B8AB 3M8SA 4DTUA 1QTMA 2BDPA 1MU2A 4GVMA 2JLEA 3JSMA 4QCLA 1KSPA 3NE6A 3NCIA 3VQ5A 3O3FA 4O44A 1BCMA 3ZCMA 3IG1A 4ID1A 4Z4EA 4DTOA 2YNGA 3ASMA 3QNNA 3O4NA 4FXDA 1B92A 3K59A 4I9LA 3QEXA 3I0RA 4CJFA 1SUQA 2GUIA 1B9DA 3QIPA 2KFNA 3BGRA 1N6QA 4OKKA 2E6MA 1TV6A 4BWJA 4E7JA 4DFKA 2F8SA 4IFVA 1TK5A 1TK0A 2OA8A 3THVA 3DLEA 3O3GA 4CIFA 1JL1A 4DTNA 1NK8A 1S6QA 2FBVA 3HM9A 3AA4A 4FJ7A 4WE1A 1SV5A 4OKJA 3LWLA 1DTTA 2YHAA 2ZQBA 3OYHA 1Q9YA 3DYAA 2PZSA 3HK2A 2HMIA 3HXMA 4CHQA 3SUOA 3L2VA 3OYNA 3AA2A 3AVLA 1T7PA 4CK2A 1DTQA 4DQQA 3MAQA 1UA1A 4FYDA 3AV9A 4CFCA 4CJTA 3V9XA 1BIZA 2F96A 3LPUA 2DFEA 3U3GA 2IDOA 2G8UA 4CJ5A 4FJIA 3ZSYA 1RBRA 4DG1A 5J1EA 4DSIA 1HNVA 2B4JA 1U49A 4CJ3A 4O55A 1LWEA 1WAFA 1GOAA 4AH9A 4CGHA 3V9UA 3QERA 1NJZA 2D5RA 4AHUA 4DS4A 1S9GA 1KCFA 3RWUA 1VRUA 4NCGA 4FJXA 2YHBA 3WNEA 1BQMA 1IKYA 3P1GA 2P1JA 5C42A 3AVCA 3TWHA 1JL2A 4OVLA 4B9SA 4AHSA 4DFMA 1X9SA 3OYKA 1FK9A 4EZ6A 4FCYA 1KVBA 1RT1A 1KVCA 1NJWA 4K8XA 1QS4A 4FK0A 4ELTA 4KTZA 5JS1A 1S1TA 2HB5A 1KTQA 1T8EA 2G8IA 3B6PA 4ZHRA 4HUEA 3RR8A 5KRTA 3LANA 1S9EA 3ZSOA 5HRRA 1QE1A 4KB0A 3ZSZA 3CFOA 3QNOA 4N5SA 1VSKA 4H4OA 4CGDA 4CIGA 4DQPA 3IS9A 3DRRA 1L3VA 5J2QA 3K57A 1NKEA 1WSJA 3KLFA 1RDDA 4B9NA 3NGYA 3AO4A 3HPHA 1BQNA 1HQEA 1VSDA 4CEEA 1T03A 4CHYA 5JS2A 2G8WA 3DM2A 1YT3A 4PWDA 4FK4A 1RBVA 2HHUA 1GOBA 3OYCA 2IC3A 3V4IA 2PYJA 1TKDA 5T7BA 1ZBHA 4I9QA 1NOZA 2X6NA 4FLWA 4CJVA 4N56A 5KGXA 5HRSA 3QEWA 3V9WA 3TAQA 3OYMA 4NYNA 4W5TA 4FJHA 1NK4A 1KLMA 3NHGA 1VSLA 3RRHA 3SUNA 3ZSRA 2KZZA 3QESA 1HNIA 5HP1A 3P83D 1NK6A 4DFPA 4M45A 1IKXA 3AA5X 3QIOA 4BWMA 1HYVA 3G10A 3VN5A 3E01A 1RT3A 3L8BA 4C8LA 2BGGA 3TANA 4FW1A 4KREA 3L2QA 3U6FA 4CFAA 1HYZA 3VA3A 1WSIA 1W9HA 3NFAA 4DQRA 1RT2A 2NUBA 1CXUA 3SJJA 4BE1A 4FZZA 4DF4A 5HROA 4DQSA 1X1PA 5I42A 3VQ7A 3HP6A 3CM5A 1UAXA 2ATQA 3SNNA 4O5BA 1TAQA 4FLVA 3L2WA 1FKOA 1Y97A 2IAJA 3DLHA 3QEVA 1NOYA 4M3WA 4DLEA 3ZT2A 1VSFA 1VSEA 4ZTFA 1UA0A 4FJNA 1VSHA 1JLCA 1TL3A 4L8RB 4FM0A 3MEGA 4FM2A 4KRFA 4E7KA 1JLAA 4AHVA 3LP1A 2ITGA 2O4IA 2DFHA 3NF8A 3NF9A 4CF0A 2OPQA 4KB1A 3V9ZA 4CEDA 1BI4B 4KPYA 4FJKA 4PY5A 3NGZA 4AHTA 4E7HA 2KTQA 4B9UA 3OYBA 3K5LA 1J53A 1R0AA 4CHPA 2XY6A 3JYTA 3ZT3A 3KKRA 3DI6A 4IDKA 4JRQA 1HRHA 1B9FA 3TAFA 1A5WA 1YVUA 1VSIA 3V1OA 3AVKA 3NGIA 4FJ9A 3FFIA 4XIUA 1RDBA 1WSGA 2RKIA 5I3UA 2QK9A 3HL8A 2HHWA 3LP2A 3KLHA 5SWMA 2O4GA 4DSEA 4W5RA 2YKNA 3B6OA 3AO2A 1TKZA 4FJGA 3HYFA 4NCAA 1C1AA 3G0ZA 4KAZA 3OYEA 3LAMA 1S1WA 5KI6A 4AHCA 4CJUA 3KLGA 3F73A 4HCBA 3T19A 2FBYA 1X9WA 4N47A 3SCXA 3PY8A 3S3MA 4DTPA 2BANA 2OZMA 2HHTA 1Z26A 2HHQA 3F9KA 2G8HA 1U04A 4JS5A 1HJRA 4I7FA 3LAKA 4DTRA 4UQGA 1IKVA 1U47A 1S5JA 1NK5A 1A5XA 2HNYA 1I3AA 3OYJA 4AILC 3OYAA 1F21A 3BDPA 4F3OA 1NJXA 2G8FA 3SZ2A 3ITHA 1EX4A 2EHGA 5CZ1A 2XY5A 4CF8A 4CGIA 2X74A 1JLBA 1DLOA 4KFBA 4DMNA 3NH0A 4DS5A 2YNIA 4FJLA 1K6YA 4Y1CA 5FRMA 1RBTA 1BI4A 4IFYA 4M3YA 1IH7A 1ZBFA 3NF7A 4KO0A 3LZIA 4HTUA 1D9FA 3NAEA 1YTAA 2Q3SA 2YKMA 3LZJA 3SYZA 1ZBLA 1NK7A 3SV3A 4OKEA 1ITGA 4I2QA 4FM1A 4JRPA 4IBNA 5KGWA 3D0PA 4CJSA 3MXIA 3HJFA 2OZSA 1VSMA 3K5OA 4RW4A 1HPZA 3TAGA 1D9DA 1NK0A 4FLZA 1KVAA 2E6LA 4CK1A 4CF9A 3AO1A
chains in the Genus database with same CATH superfamily
2WTUA 3WNHA 1LWFA 4H0VB 4LF9K 4Q5VA 4CJPA 2YCHA 1C0TA 3CQYA 1VQMN 1Q9XA 3MX2A 3CPWM 1JKHA 3VESA 4CEAA 4CESA 3EE9A 3CI5A 3QBXA 1IKWA 4JD2A 1CXQA 4DU4A 1ASWA 4JKBA 4ZTJA 5BN9A 4KH6A 4GKKK 1Q82O 1G15A 4B3MK 2YV0X 4KHSA 3OW2M 1RT5A 3ZT4A 4CW7B 3ID8A 4RW6A 4BDZA 1RTHA 4FOIA 3OS0A 1TKXA 4RG8A 4KI4A 3C7NB 3DLLL 2D4WA 1J6ZA 2Y1JA 2GTDA 1NKCA 3L6QA 3MECA 2XO7A 1I39A 4PHTX 2KW4A 3TAEA 1XQSC 4J2BA 3MWTA 3UE5A 4JKAA 3V1QA 3U9DA 1L5UA 3HO1A 4QS8A 1NLVA 1Q18A 4ELUA 3RRGA 3GOIA 2VG7A 3PIOL 1BGXT 1SKSA 1L3TA 1RT4A 2AP1A 3IRXA 1FXXA 5AQRA 4HVJA 2FLOA 3ZX3A 2UUCK 3J8AA 2P9PB 3PSIA 5CYMA 5C0YA 5K14A 4Z4GA 1EETA 3SAHA 3TSQA 1ASUA 3LDSA 3VQ8A 2HHHK 5C24A 4DV6K 2RF2A 1BWFO 4BR4A 1KFDA 1NK9A 2D0CA 3U9ZA 3KD5E 4XEIA 4EIAA 4OPHA 2ITMA 3OS1A 1MWMA 2P9LA 4CF2A 1T44A 2D0AA 1NWKA 3S3NA 3ZSXA 3VQEA 2HNDA 4WFAL 1XC9A 4BRFA 4AHRA 5C2DA 2P9PA 1GLBG 3EKSA 3MN5A 4FWSA 1REVA 4OGEA 4DR7K 1C0UA 1WNSA 4LF4K 4ILGB 3SQ0A 3ZETB 4JS4A 1YI2N 3HM8A 3VF6A 4RTFD 3R9PA 3MCPA 1YAGA 5J2MA 4CEQA 3AGRA 4BDYA 5D3GA 4JKHA 3WXJA 1LV5A 2YNFA 3M8PA 2A40A 4H0OA 3SUPA 4K0KK 1VQ8N 4BRNA 3H46O 2P5OA 5IT9O 4M3TA 4DU1A 4TSXA 4GMJB 4A57A 4GW6A 2PYLA 4HCCA 4M41A 2PY5A 3F9MA 5C12A 2UYTA 1SL2A 4V19S 4CEZA 1OVYA 3O5BA 3SPZA 4C23A 4U7BA 3K5MA 4HTLA 2YNHA 1L3SA 5M1OA 2HHVA 1X9MA 1XC3A 5AQUA 3RMAA 3S9HA 2HNZA 4IOXA 5J2NA 3RVCA 3CCLN 3ZEUB 3EN9A 3TABA 5FPMA 4PL8A 3ZSWA 2UUAK 3NF6A 3QICA 4J8FA 3OYIA 3MDQA 3ZETA 3OJUA 1SS6A 3SUQA 2P9KB 4ID5A 5HL7L 3AO5A 2Q2RA 4FPAA 4FL9A 1C1CA 3R1XA 4JI5K 1J5EK 3O1WA 1WLJA 2KQ2A 4NO7A 1RDAA 4RW8A 5CY4A 2A1RA 4KTQA 1JLQA 3KKSA 2X78A 5DMRA 4YHHK 1LWCA 2O8EB 2Q97A 1YTUA 4FLYA 4LFAK 4Z94A 3ZEUA 3H08A 4IKFA 3I8BA 3HBTA 5MLCQ 3WNGA 1ZBIA 3AVMA 4FJMA 3C6TA 3T1AA 4CHOA 2P9KA 3DLBA 4I2PA 2EWSA 3EKUA 4B1UB 4CBWA 2ZE2A 1KFSA 3AVFA 4KKOA 4CIEA 2CGLA 3WXIA 3AVHA 1NGBA 4OPKA 3CJ9A 3MN9A 4GKJK 4FLUA 4RW7A 3DMJA 4ISGA 1WAJA 1FW6A 1WN7A 3TTCA 4DV2K 4CFDA 4M3RA 2O8DB 3TPQA 4M3XA 2IVOA 4KI6A 1XUPO 4KHPK 1O1WA 3CCSN 2O8EA 1C0FA 1RGIA 2JLEA 3VQ5A 4O44A 3ZCMA 3IG1A 4DTOA 3G71N 4B9QA 1B92A 3QEXA 2E20A 1HX1A 3I0RA 4CJFA 1Q86O 2GUIA 1VHXA 4CZEA 4CZIA 5AQGA 2E6MA 3P4IA 2V7ZA 2BUPA 4BWJA 2ZJQL 4DFKA 2F8SA 5BR9A 4BR9A 3EE8A 3AA4A 4FJ7A 2KKZA 3VETA 3FZKA 2YHAA 3OYHA 2VQEK 4CZFA 4AM6A 4PKIA 3AA2A 4DQQA 4FYDA 4FSVA 3SLCA 3AV9A 4FJIA 3LPUA 2A41A 2G8UA 1ZC6A 3ZSYA 4XH1A 3CC4N 3QERA 1NJZA 3V9UA 5AQJA 4FVUA 1S9GA 5LJVA 3RWUA 4FJXA 2YHBA 2ZJPL 1NGCA 5AQLA 3P1GA 2P1JA 5C42A 3AVCA 4RWTA 4OVLA 1TUUA 3GG4A 4AHSA 4OX9K 2JWKA 2W40A 2GUPA 1KVCA 2NLXA 4C1NK 4UY8O 4PL7A 3J81O 1QS4A 4H5TA 4BQLA 3SAFA 4KTZA 1S1TA 2HB5A 1KTQA 4BRIA 4BY9C 4JV5K 4WQ4C 3SMPA 1MWKA 5HRRA 4JN4A 4N5SA 1VSKA 3ZLJA 4CIGA 1LCUA 1WSJA 1RDDA 3O8MA 4B9NA 2P9UB 4CEEA 1HQEA 4JKCA 2G8WA 5JS2A 4PWDA 3FE1A 4I6MB 4LFBK 2HHUA 3OYCA 4CVNE 4FLWA 4CJVA 5KGXA 4O8UA 3UB5A 4W5TA 1NK4A 1KLMA 2P9SB 5HP1A 3P83D 3G10A 4IEEA 5AJ3K 1RT3A 4BROA 2BGGA 4FW1A 3G4SN 3T69A 2IVNA 4DQRA 3N4PA 1P90A 2NUBA 4BRDA 3WEEB 1QZ6A 3QEVA 4DLEA 1UA0A 4FM0A 3AY9A 4AHVA 2ITGA 2DFHA 4BGBA 4I6MA 3GBTA 3V9ZA 4CEDA 3E9LA 4PY5A 1C0GA 3IKMA 2KTQA 4B9UA 1J53A 1R0AA 1WOQA 3A5MC 1HNXK 1A5WA 4H5WA 1VSIA 2P9SA 1EWQA 3VF4A 1OH6A 1RDBA 5M1KA 2RKIA 3D2EB 2YKNA 3B6OA 4W5RA 3AO2A 1TKZA 2FF3B 4NCAA 3G0ZA 3BZKA 3LAMA 4CJUA 3O4WA 3SCXA 2HHTA 2OZMA 2ASPA 2G8HA 1HJRA 3H45C 1DEJA 4FWNA 2HNYA 3BDPA 3GDQA 4B1XB 4EHUA 3ITHA 2EHGA 2WC9A 4A62A 1JLBA 4CGIA 1DLOA 1IBKK 4DMNA 5ELZA 3L4QA 4FJLA 4IFEA 1K6YA 5FRMA 1RDUA 5GAGP 3LZIA 2Q0RA 2YKMA 3LZJA 5GIPA 3SV3A 4OKEA 1ITGA 3H1QA 3LM9A 4I2QA 4IBNA 5KGWA 3RSEB 5M1FA 2OZSA 3VGLA 4BRLA 2RE2A 4RW4A 3T1YK 1KVAA 3VTIA 1XMQK 4CF9A 1ZBSA 3AO1A 5E84A 4BE0A 1TK8A 4DR2K 3CC2N 2A5XA 3TU5A 3ZX0A 4BC2A 3CCVN 5J2PA 3V6DA 1N36K 4B1YB 3O6WA 3PV8A 2KFZA 4JKEA 4JK9A 4EAHD 1J9AA 3QEIA 4N76A 4Z4CA 3AVIA 2GWJA 3IUCA 5BPMA 2FSJA 2Q0UA 4CHNA 3MXMA 1LAWA 1T05A 3C65A 2IS3A 5CZ2A 2HVHA 2HHXA 3TSPA 3PX0A 3QETA 3MXJA 2W6LA 1TVRA 4CFBA 5BPLA 1NG9A 1CZ9A 4B9VA 4N41A 1XHZA 5M1PA 4OGCA 2BTFA 2D0BA 4B1ZA 3VEVA 3OHRA 1H1VA 2X6SA 1MA9B 4DU3A 3DOKA 3VQ6A 4JI1K 4JKDA 1VRTA 2VG5A 5KPRA 1M90O 2P9NB 4PQUA 2Q31A 1NGAA 4H0PA 4O0IA 2YHXA 4DR1K 2QKKA 4GNIA 5DK5A 1NGDA 3PX4A 4KHQA 4CEOA 1N34K 3DXKB 3SMSA 3I55N 3O9TA 4QOZB 1HUXA 2NRXA 1OKJA 2F9WA 2F4VK 2GBZA 4C8NA 4FW2A 1RTIA 2QTDA 3SBGA 4E7LA 4K25A 4O5FA 4E19A 3R8EA 4FPBA 2RPIA 2ZGZA 3THXB 1TGOA 4E0DA 2XRIA 3WXLA 1QQMA 1SZ2A 4CJWA 3IFRA 4C8OA 1VQ5N 4E3SA 3HT3A 1U2VB 3C6UA 4U67L 1O13A 2VWKA 5GIOA 3I8DA 1TAUA 3ZSQA 3CCQN 1HLUA 1ZYQA 2P9NA 2B5JA 4MFBA 1YHQN 5KQDA 3DXKA 3RMDA 2XHBA 3PO5A 1SL0A 3GL1A 1V4SA 3D7EO 1X3MA 4JD2B 1NMDA 4H0YB 1SKRA 1C0MA 1QSYA 4CERA 3PUFA 2GX9A 4CZHA 1EO1A 2VGNA 4DTMA 1Q7YO 4NYFA 2Y1IA 4W5QA 4DWIA 1WSFA 3THXA 2YHYA 1W2BM 1LW0A 3FGUA 1L3UA 4LF7K 2KZMA 2UU9K 2V52B 1VQON 3KLIA 4BRGA 4X65K 4C8KA 2O8FB 1T3VA 2LSNA 1RT7A 4H0XB 4CCHA 4QS7A 4L3QA 1YJ9N 1HPMA 3LL3A 4DF8A 2Z1JA 3HP9A 3RTVA 1LW2A 3L4IA 3MK6A 4J2EA 3NH1A 1YXQA 3AVJA 4IO9L 4FWMA 2OYQA 2O8BB 2GWKA 2VCPA 4IZ9A 4JK8A 1XNQK 4A59A 1HYSA 3AAPA 1XI1A 3HOSA 4JLHA 3NDKA 2XY7A 3K5NA 2QKBA 1ASVA 3C95A 4B1VA 4MDAA 5E41A 3HSCA 3EEQA 1IJJA 3VQBA 1N5YA 2R7YA 3R6MA 3EO3A 3CPEA 3CJ1A 4W5OA 2O8FA 5CE3A 4B9MA 3KK2A 3CF5L 1EWRA 1SKWA 3MEDA 3VEZA 1W7AA 3UIQA 3MEEA 1BO5O 3JAMO 1I94K 1ESVA 3U4LA 1KRPA 1IG8A 3A5LC 2O8BA 1VK0A 2P9LB 3NVKA 4IOAL 3C94A 2E5LK 4WCEL 3V81A 4FJJA 4KTWA 2I5JA 3EY1A 3PIPL 4LD0A 5AQFA 1NBWA 4YNQA 1GLAG 4RW9A 3HPOA 3MN6A 4BC5A 3ENOA 4PKGA 4F2RA 3VF2A 2WBNA 3KK7A 3CETA 4CBXA 2ZM6K 3SPYA 4J2DA 1ILYA 2QW9A 2H3GX 4A5BA 1WSEA 2Z1GA 4YY3K 3O4QA 4CF1A 3F5TA 2CGKA 4BRPA 1N33K 4M3ZA 4LSLA 3A8YA 1S1VA 3ISNC 4Z4FA 4LH5A 3ZT0A 3L2RA 4IEIA 5TKWA 4DTUA 2BDPA 3JSMA 2V51B 1KSPA 4Z4EA 1DGKN 2YNGA 3ASMA 4DCHA 4FXDA 3M5RA 3SAGA 1SUQA 1B9DA 2KFNA 3BGRA 4JHDB 1TV6A 4E7JA 3K9JA 3THVA 1JL1A 1TUYA 3HOTA 2FBVA 2CH5A 3LWLA 4DQ8A 1Q9YA 1DT9A 4DV7K 2HMIA 3OTOK 3ZX2A 3AVLA 1DTQA 1UA1A 4C1NI 4CFCA 3V9XA 3U3GA 2DFEA 2IDOA 4IWVA 1RBRA 1W97L 5J1EA 1U49A 5C2FA 4O55A 3CJAA 4AHUA 4DS4A 1TYQB 4ISEA 2YJFA 5E26A 3WNEA 2IIRA 3A0IX 1IKYA 3TWHA 1EQYA 3WUHA 1X9SA 4FCYA 1RT1A 4JHDA 1NJWA 4K8XA 4KH4A 4BG8A 5B8HA 3B6PA 3BY5A 3ENBA 1QE1A 3CFOA 1K9MO 1YITN 3WXKA 1L3VA 4WYBA 1X9JA 3KLFA 4A2AA 3B8AX 1T03A 4CHYA 4LF8K 4FK4A 3PSFA 3V4IA 2IC3A 2PYJA 3CXCM 5AQWA 1ZBHA 1NOZA 2X6NA 3O08A 1TYQA 4DKWA 5AFUA 3QEWA 3A5NC 3ZSRA 3QESA 1HNIA 1NK6A 3AA5X 4BWMA 4KREA 3U6FA 2DPNA 4BR5A 1RT2A 5AQNA 3SJJA 4BE1A 2NRZA 4DF4A 2W6KA 4YDUA 1X1PA 4DQSA 5I42A 1YJWN 3VQ7A 3HP6A 3SBTA 1YVNA 3I33A 4FLVA 3L2WA 2IAJA 3DLHA 4CD1A 3CD6N 1VQ6N 4ZTFA 1VSEA 3UKRA 4BG9A 4E7KA 3CC7N 3CERA 3NF8A 3NF9A 4KB1A 4FJKA 4GV9A 1GLFO 2ZGYA 1VQPN 4BREA 3OYBA 3WQUA 3BF1A 4BC4A 2FSNA 4CHPA 3EZWA 1NGFA 3V1OA 2VYPA 5AQHA 4FJ9A 3OBYA 4K43A 3CMEN 5M1QA 3HL8A 3LP2A 2P9IB 2O4GA 4BQZA 4FJGA 2ASOA 3HYFA 5FPNA 4KAZA 3OYEA 5CHIA 1S1WA 3F73A 1KD1O 3QFPA 1U04A 4JI2K 4JS5A 1VQ4N 2UXBK 2QI2A 4DTRA 4UQGA 1U47A 1A5XA 3LDOA 5F1XA 4KBOA 3OYJA 1KAZA 1F21A 4FWKA 4JI4K 4MLEA 4CF8A 2X74A 4X64K 4DS5A 4KFBA 3NH0A 2E1YA 3KWGA 4Y1CA 1RBTA 4IFYA 4M3YA 1IH7A 4KO0A 3T1HK 2Q3SA 3CCEN 3H3OB 4E1JA 4JRPA 3D0PA 2Q1NA 5KPTA 5KPZA 1WBDA 3CCUN 4CBUA 3LDPA 3H3NO 2E6LA 3L8BA 5FPDA 2A3ZA 2P9IA 3L0QA 5LY3A 4ELVA 3NMUA 4W5NA 4NLCA 1KQSM 4DQIA 1UOCA 3P31A 1QQCA 4B9LA 1KAXA 1S6PA 1C6VA 2HF3A 3K2PA 4K42A 4CJQA 4J2AA 4IDHA 3M6GA 4IO8A 4FVMA 4HUGA 4Z4IA 2KZZA 1S22A 4BE2A 1T6DA 2QXFA 4CZGA 5JLFA 4DR4K 4JI6K 4YORA 4IXCA 3PO4A 1JLGA 2WUSA 1YIJN 2XY8A 3AO3A 4BRMA 3G6EN 4EP5A 3LDQA 2Z1IA 3VQAA 2UUBK 3CHWA 4YFUA 3CFPA 3OYLA 2HF4A 2W41A 2IGIA 5JLHA 1BL3A 3VA0A 3EYZA 1LAVA 4E1MA 1BA1A 4BRAA 5KRSA 5DM7L 1HNZK 3SQ1A 4HUFA 2ETJA 1MDUB 3E66A 3AVBA 5AQMA 4AF1A 4YOUA 4EZ9A 3PLAA 1ATSA 1VQNN 1GLDG 2ZD1A 1JXBA 1XHXA 5CYQA 5A2QO 2YJEA 1CLQA 4NB4A 1FJGK 2IOCA 2HBKA 5C15A 1Q8IA 3O9RA 5BPNA 3HVTA 3KHYA 2QA4N 4MO5A 3E9PA 5AQZA 3DLGA 1J54A 3CQXA 4B9TA 3TARA 1NJIO 2OPSA 3WXMB 1C1BA 4G1QA 1D4XA 5I9EB 2HVIA 3M8RA 3ALYA 3L2UA 3THWA 4NXMK 3VQQA 2YHWA 3VQ4A 2AJQA 1W0HA 3S3OA 1HQUA 1NGHA 5JMVA 2JGUA 3FLCO 2HHSA 3F2KA 5BRDA 3O3HA 4AM7A 1BA0A 3VENA 1S1XA 3SV4A 4KHWA 4AQYK 4WQ5A 3K58A 1OH5A 3VEXA 3M8QA 3BUZB 3SI6A 3K0SA 1ATRA 3CYMA 4BR7A 5FRNA 2UXDK 4E1NA 4B8CA 4K8ZA 2ZJRL 2E4LA 3A2FA 3NBPA 5AQTA 4R79A 3M1FA 1CZBA 4MLHA 2F7TA 3O9QA 4KH5A 1JXEA 4C8MA 4B3RK 4LC9B 5FPEA 4DSKA 1BUPA 3DLRA 3I0SA 5EU7A 4A5AA 4GVEA 3LPTA 4B3TK 3J7AP 4MDBA 5FDLA 1D8YA 3TAMA 1K8KA 4H4MA 3AA3A 1TKTA 4CJRA 1HJOA 3QINA 4CECA 4F9OA 1HKCA 4MQ3A 4EHTA 1Z25A 1ZXOA 3CJCA 5AZIA 4CEBA 4CJEA 4FLTA 3QB0A 2AA4A 5LMNK 3WNFA 3V9SA 3OJSA 2I7PA 2QWQA 3KLEA 3P39A 3KIOA 3HZ6A 2UXCK 4CGFA 3CJBA 3CIPA 4FZXC 2QEXN 4H8KA 5GAEP 4BDPA 3J7ZO 3RMCA 1GLJO 1RBUA 3THYB 5AQIA 4JEPA 4H5VA 4FJ5A 5EX5A 4KV8A 5M1NA 3VEOA 4LY7A 4KHNA 4F4KA 1NJYA 3QO9A 2KHOA 4CZMA 3DLKA 4LF6K 2HBLA 2P5GA 4OJRA 2E88A 1XWLA 3OYDA 4LSNA 4YDUC 4LF5K 4FK2A 5AZJB 5AFUH 2VWJA 4LH4A 5HBMA 5KQ8A 5HRNA 4B8AB 5ADXH 4RCHA 1QTMA 1XNRK 4GVMA 4QCLA 3NE6A 3O3FA 1BCMA 4CZJA 3ATVA 3VGKA 1N6QA 5AQOA 5AQVA 2GELA 3S41A 3THYA 3DLEA 1NK8A 5GADP 1SV5A 4BC3A 3SK3A 4OKJA 2PZSA 2OTLN 3HXMA 3SUOA 3OYNA 2VWBA 3BF3A 4CK2A 3MAQA 5F0XA 1NGEA 4CJTA 1GLLO 2F96A 2ZWHA 3U8XA 4CJ5A 5AZJA 4DG1A 2KLAA 2B4JA 2QWPA 1WAFA 4CGHA 4M7XA 1LOTB 4JAXA 1KCFA 1VRUA 3IMXA 4NCGA 3ATUA 3UKUB 2QM1A 3VMFB 1JL2A 5AQSA 4DFMA 3OYKA 1FK9A 5BRHA 5JICA 4YOWA 1JCFA 1OH8A 1VAZA 2YX6A 1T8EA 2G8IA 4ZHRA 3LANA 1S9EA 4KB0A 3EL2A 4H4OA 4DQPA 3IS9A 5GINA 3AO4A 3HPHA 1VSDA 3TSUA 1YUWA 3DM2A 1RBVA 1GOBA 1IBMK 4JKGB 5EOYA 4EFHA 5HOOA 1IBLK 3VTHA 1VQKN 5H1SQ 4BRQA 4N56A 3UKUA 3V9WA 3TAQA 3A5OC 3OYMA 4NYNA 4FJHA 1HNWK 1GLEG 4ILJA 1VSLA 1S3XA 3DJCA 3MWPA 4DFPA 4H5NA 3E01A 4C8LA 3TANA 4JI8K 3AGKA 3L2QA 2E1ZA 1HYZA 3NFAA 2NRVA 2QWOA 1RDWX 2QWNA 2ZF5O 5HROA 1SAZA 4PKHA 5BREA 3CM5A 2ATQA 3SNNA 2HOEA 4K41A 4O5BA 1NMNA 1Y97A 1NOYA 4M3WA 1VSFA 4H0TB 4FJNA 1VSHA 1JLCA 5EVZA 1V4TA 4KRFA 3NVMA 2O4IA 3LP1A 4CF0A 2OPQA 4KPYA 1BI4B 1Z05A 4CZLA 5LL6Z 4AHTA 3K5LA 4JKGA 2XY6A 3KKRA 3DI6A 3OBWA 4DV0K 1HRHA 1B9FA 3C7NA 4CZKA 1YVUA 3AVKA 4DUZK 1XMOK 3QBWA 3WQTA 3FFIA 5EXWA 5I3UA 3DXMB 4CI6A 3W3DA 4ILHA 4FWOA 1ATNA 5AQKA 1C1AA 4AHCA 3KLGA 4HCBA 2A42A 3M3ZA 3JXUA 3T19A 3S3MA 5AQYA 4DTPA 1Z26A 2HHQA 1VQ9N 3R3LA 3J80O 1IKVA 1NK5A 4JI7K 3D2FB 4F3OA 1NJXA 2G8FA 5CZ1A 1EX4A 5JVHL 2PBDA 2FSKA 1BI4A 4BRCA 1ZBFA 3NF7A 5JVGL 3CJ7A 4HTUA 1D9FA 1YTAA 3H6EA 3SYZA 1ZBLA 1YJNN 3MXIA 3HJFA 4HWIA 1VSMA 3K5OA 3TAGA 1HPZA 1QZ5A 3AAQA 4FLZA 3DXMA 4Y0WA 1QQOA 5HLFA 4BACA 1QHAA 4B3OA 3K9KA 1IO2A 4E89A 1RNHA 1TL1A 4F2SA 4O4GA 1S1UA 4WQ5C 2DTUA 3PX6A 4YOVA 4XH4A 2O8CB 2Z1HA 1VSJA 4Q0BA 1J5OA 3D2FA 3OYGA 3E1YA 4MO4A 3D6RA 3ID6A 3NH2A 3CCJN 3MX5A 3U3YA 3AARA 5F2RA 4NXNK 2W42A 2HMPA 4JNEA 4CGGA 3KVGA 4KHYA 2D1KA 4PA1A 3IAYA 3LP3A 2FBXA 3UKRB 5LJWA 3TI0A 4PUOA 2FF6A 3LP0A 3CG7A 4ICLA 2GV9A 2VG6A 2DFFA 3FFKB 3L3VA 2OTJN 3LALA 4DR5K 3Q7CA 4FJ8A 4CJLA 2DY4A 1U4BA 5ADXA 1EKEA 1JCGA 1N32K 4DB3A 3FZHA 3SJHA 3FZMA 4M42A 3VEYA 3ZSVA 3BEXA 5DM6L 4DFJA 3W0LA 4DSLA 2NRRA 3SQ2A 4NCBA 3LDNA 4DR3K 2O8CA 2BH1A 5AQXA 3KK3A 4IOCL 5EY4A 1SL1A 3BP8A 5BR8K 4JYAK 5TKYA 2RN2A 1RILA 2G8VA 2WFBA 2WOMA 2F8TA 4FZYA 4A2BA 3KWIA 4CGJA 3HSTB 3OVNA 3VQCA 3J7YP 3O9SA 2QXLA 1RFQA 3OS2A 3TAPA 1A5VA 3TTFA 2FC0A 1WBBA 1FKPA 4H03B 3ZYYX 2V7YA 3N4QA 3QLHA 2JWLA 3ZT1A 1Z6RA 1QHTA 3ULEB 1WUAA 1DKGD 3ENHA 1BCOA 1CZAN 2HBMA 3KTQA 1GOCA 1NKBA 1JLEA 4FWRA 1RBSA 4B08A 4CEFA 4FO0A 4R5PA 1IG9A 3L3UA 1JLFA 1BDGA 3OYFA 3MN7A 4O8KA 2OPPA 1D5AA 3RMBA 4CJKA 3LWMA 3VQPA 1VQ7N 4B1WB 5C25A 1IV0A 1EP4A 4DLGA 2A6AA 1QQNA 3HPGA 3CM6A 4EP4A 4Z0UA 3KK1A 2E8AA 3G25A 3D45A 3DRSA 1WB9A 2OANA 4OLAA 1E4FT 2FBTA 2OCEA 1BOTO 4BRKA 1ZBUA 1UWBA 3O9UA 3ULEA 4CK3A 4FLXA 4F8RA 3EZ5A 3KD1E 2O8DA 1RCHA 5FROA 4IG3A 2VQFK 3P5JA 3AVAA 3BZCA 3P38A 2NNWA 4HHTA 3E9OA 2NZTA 3QEPA 1M1KO 2A1SA 1R59O 1BHLA 3VQDA 3Q7BA 3KJVA 4BVOA 3DRPA 1KLNA 4Y1DA 1QSSA 4CHZA 4OPJA 3RR7A 3CCRN 4QAGA 4B3SK 2F9TA 4M3UA 4WFBL 4JI3K 1RT6A 3GE1A 4Z4HA 4X62K 3AVNA 4FOEA 4O0JA 5SZTA 1U45A 3DOLA 3HRGA 3CFRA 3V1RA 3CMAN 4DTXA 1EXQA 4DSJA 2B6AA 3ULDA 4E7IA 4LFCK 1T6CA 1HMVA 4CD3A 2OPRA 3OY9A 2EX3A 2E2QA 4JKFA 1BIUA 3MMVA 4IG0A 4F3TA 5GAHP 5KTQA 2BE2A 5AR0A 4DHYA 1SQKA 1RDCA 3THWB 1U6ZA 4FWQA 1WSHA 4CE9A 3TR8A 4KHUA 1RTJA 3AVGA 4DSFA 4DV1K 4DUYK 1Q81O 4OLBA 5HRPA 2WONA 5LMUK 1BU6O 1KAYA 1QVFM 2G8KA 4XH5A 2P51A 3VQ9A 4M7YA 2HW3A 3CQ8A 4DTJA 5CR4A 3SQ4A 1U48A 1OVQA 3T3FA 1BISA 3HVRA 2QWMA 4GY2B 5BN8A 5C10A 4DV3K 2P9UA 1N8RO 4DTSA 1RTDA 1BG3A 1KC8O 4CJ4A 2D0OA 1QSLA 5AQPA 3LDLA 2IVPA 3IDHA 3O1BA 4FWLA 3M8SA 1K73O 1Y64A 1MU2A 1G99A 5FLXO 4WF9L 3NCIA 2QWRA 4ID1A 1HKGA 4FWPA 3QNNA 3O4NA 3K59A 4I9LA 1NGGA 4IJAA 4BGAA 3QIPA 2CGJA 4OKKA 2FXUA 4IFVA 2PFUA 1TK5A 1TK0A 2OA8A 4JK7A 3O3GA 4GV3A 4CIFA 4DTNA 1S6QA 3HM9A 4DV4K 3WEEA 4WE1A 1K8KB 4M63C 1DTTA 2ZQBA 1QVGM 3FZFA 3HK2A 3DYAA 4CHQA 3L2VA 1T7PA 4IJNA 1BIZA 1K8AO 4X66K 1S72N 4DSIA 1HNVA 4YOXA 2PAVA 4CJ3A 1LWEA 3QMLA 1GOAA 4AH9A 5AZIB 3FR0A 1OH7A 2HBJA 2D5RA 4G9ZA 4OPAA 2GEMA 1BQMA 3O80A 1HR0K 4ISFA 4B9SA 1P8ZA 3D2EA 4EZ6A 1KVBA 2QWLA 3VERA 5BRFA 3WT0A 4FK0A 2CH6A 4ELTA 5JS1A 4YOYA 4HUEA 3RR8A 3VGMA 5KRTA 3ZSOA 3C6AA 4H5RA 3ZSZA 3QNOA 4CGDA 1NNEA 5AQQA 3DRRA 5J2QA 3K57A 1NKEA 1X3NA 2NRTA 3NGYA 2E2NA 1BQNA 2RHKA 1YT3A 4YOTA 1TKDA 5T7BA 4I9QA 3DWLA 3RSEA 1NU0A 5HRSA 2NRHA 3NHGA 3RRHA 3SUNA 4M45A 1IKXA 3QIOA 1HYVA 3VN5A 1VQLN 2VGMA 3TTDA 4CFAA 3VA3A 1WSIA 1KXPA 1W9HA 1CXUA 1GLCG 1JCEA 4FZZA 2D0PA 3DAWA 3CCMN 2YI1A 4BVPA 2NRWA 1UAXA 2E2OA 1TAQA 1FKOA 3ZT2A 4CJ7A 3VOVA 3JS6A 1TL3A 4QS9A 4L8RB 3MEGA 4FM2A 1JLAA 2E2PA 3NGZA 4BR2A 4E7HA 1JJ2M 3LM2A 3VPZA 1NGIA 3JYTA 3ZT3A 4NLBA 4IDKA 4JRQA 4A61A 3TAFA 1NM1A 3NGIA 4XIUA 1WSGA 2Q36A 2QK9A 2HHWA 2ASMA 3KLHA 5SWMA 3FZLA 4DV5K 4DSEA 2J4RA 3HI0A 3QFUA 4DR6K 5KI6A 1E3MA 2FBYA 1X9WA 4N47A 3PY8A 2BANA 3C0BA 3F9KA 4I7FA 3LAKA 2I7NA 1S5JA 1I3AA 4BR0A 1HKBA 4AILC 3OYAA 3SZ2A 1YF5L 3KZBA 2XY5A 3QDKA 3T7ZA 2YNIA 1E4GT 4WFNL 3OA9A 2HSTA 4OO1J 3NAEA 1NK7A 3H1VX 3VEWA 3C6HA 4JI0K 3I56N 4FM1A 1NGJA 5IWAK 1U2VA 4CJSA 4GV6A 3HTVA 3MCAB 1D9DA 1NK0A 4BRHA 4CK1A 4WQ4A
chains in the Genus database with same CATH topology
3WNHA 1LWFA 4Q5VA 5HLFA 4BACA 4B3OA 4CJPA 1C0TA 1IO2A 4BE0A 4E89A 1TK8A 4ELVA 1RNHA 1Q9XA 5J2PA 4W5NA 1TL1A 3V6DA 4F2SA 4O4GA 1JKHA 4CEAA 1S1UA 3PV8A 2KFZA 4CESA 2DTUA 4DQIA 1UOCA 3PX6A 1IKWA 2Z1HA 1VSJA 4Q0BA 1CXQA 1QQCA 1J9AA 3QEIA 1J5OA 4N76A 4Z4CA 4DU4A 3AVIA 3OYGA 4B9LA 1ASWA 3NH2A 4ZTJA 1S6PA 1C6VA 3U3YA 3K2PA 1G15A 4CHNA 2W42A 4CJQA 3MXMA 1LAWA 1T05A 4J2AA 4CGGA 2IS3A 2YV0X 5CZ2A 4KHYA 4KHSA 3IAYA 4PA1A 1RT5A 3LP3A 2FBXA 3ZT4A 2HVHA 2HHXA 3TI0A 4PUOA 3LP0A 4FVMA 4RW6A 4HUGA 4BDZA 3QETA 3PX0A 3CG7A 4ICLA 2GV9A 3MXJA 4Z4IA 2VG6A 4CFBA 1TVRA 2DFFA 4BE2A 1RTHA 2QXFA 3L3VA 3OS0A 1CZ9A 3LALA 4B9VA 4N41A 1XHZA 3PO4A 1JLGA 1TKXA 4OGCA 4FJ8A 4RG8A 2D0BA 4CJLA 4KI4A 2DY4A 2XY8A 3AO3A 2Y1JA 1U4BA 2X6SA 1NKCA 4DU3A 1EKEA 4EP5A 3DOKA 3VQ6A 3MECA 2XO7A 1I39A 2Z1IA 2KW4A 3VQAA 1VRTA 2VG5A 3TAEA 4M42A 4YFUA 4J2BA 4PQUA 3ZSVA 4O0IA 3CFPA 3V1QA 2QKKA 3OYLA 5DK5A 3HO1A 4DFJA 3PX4A 1L5UA 4CEOA 4KHQA 2IGIA 4DSLA 1BL3A 3SQ2A 4NCBA 4QOZB 4ELUA 3VA0A 3EYZA 3RRGA 3KK3A 1LAVA 4E1MA 2VG7A 1L3TA 1BGXT 1SKSA 1SL1A 1RT4A 5KRSA 3IRXA 3SQ1A 1FXXA 2GBZA 4HUFA 4FW2A 4C8NA 1RTIA 2RN2A 2ETJA 4HVJA 4E7LA 3AVBA 1RILA 2G8VA 4EZ9A 5CYMA 4E19A 2WOMA 5K14A 4Z4GA 2RPIA 1EETA 1TGOA 2F8TA 4E0DA 2XRIA 2ZD1A 1JXBA 1XHXA 5CYQA 4CJWA 4C8OA 4FZYA 1ASUA 3LDSA 1CLQA 4CGJA 4E3SA 3HSTB 3OVNA 3VQCA 2IOCA 3VQ8A 3TAPA 1Q8IA 3OS2A 3HT3A 1A5VA 3C6UA 5C24A 3HVTA 2FC0A 1FKPA 2VWKA 2RF2A 3I8DA 3DLGA 3QLHA 1KFDA 3ZSQA 1J54A 1NK9A 1ZYQA 1TAUA 2D0CA 3ZT1A 4B9TA 3TARA 2B5JA 1QHTA 4MFBA 3KD5E 2OPSA 3RMDA 1BCOA 3OS1A 2XHBA 3KTQA 1GOCA 1SL0A 1NKBA 3PO5A 1JLEA 4CF2A 1C1BA 4G1QA 1RBSA 4B08A 4CEFA 4R5PA 1SKRA 1C0MA 2D0AA 1IG9A 1QSYA 3L3UA 1JLFA 3ALYA 4CERA 3OYFA 3ZSXA 3PUFA 3M8RA 3L2UA 3S3NA 3VQEA 2HNDA 2OPPA 3VQQA 1XC9A 4DTMA 1D5AA 4NYFA 3RMBA 4AHRA 4CJKA 3VQ4A 2Y1IA 2AJQA 1W0HA 4W5QA 4DWIA 3LWMA 3S3OA 4OGEA 1HQUA 1REVA 1WSFA 3VQPA 2JGUA 1C0UA 1WNSA 5C25A 1EP4A 1LW0A 4DLGA 3SQ0A 4JS4A 2HHSA 3O3HA 1L3UA 3HPGA 3CM6A 4EP4A 2KZMA 4Z0UA 3KLIA 3KK1A 4OLAA 3D45A 3DRSA 5J2MA 4CEQA 4C8KA 4BDYA 1S1XA 2LSNA 5D3GA 1LV5A 1RT7A 2FBTA 2YNFA 3SV4A 4CCHA 4KHWA 3M8PA 3K58A 3SUPA 4DF8A 2P5OA 2Z1JA 3HP9A 4M3TA 4DU1A 1ZBUA 3M8QA 1UWBA 4TSXA 4GMJB 1LW2A 3RTVA 3SI6A 4J2EA 4GW6A 4CK3A 3NH1A 4FLXA 2PYLA 4F8RA 4HCCA 4M41A 2PY5A 3AVJA 1SL2A 3EZ5A 3KD1E 3CYMA 4CEZA 1RCHA 5FRNA 5FROA 4IG3A 3SPZA 2OYQA 4E1NA 4B8CA 4K8ZA 3K5MA 3P5JA 3AVAA 2E4LA 2YNHA 3A2FA 1L3SA 2HHVA 3NBPA 4HHTA 1X9MA 1CZBA 1HYSA 3QEPA 1XI1A 3RMAA 3S9HA 2HNZA 4JLHA 5J2NA 2A1SA 1BHLA 1JXEA 4C8MA 3NDKA 3VQDA 2XY7A 3TABA 3KJVA 3DRPA 1KLNA 3K5NA 4DSKA 1ASVA 3ZSWA 3C95A 4Y1DA 2QKBA 1QSSA 3DLRA 3I0SA 3NF6A 5EU7A 5E41A 3OYIA 3LPTA 4CHZA 4OPJA 3OJUA 5FDLA 3RR7A 3SUQA 3VQBA 1N5YA 4QAGA 4ID5A 2R7YA 1D8YA 4W5OA 3AO5A 4M3UA 1RT6A 3TAMA 4Z4HA 4B9MA 1C1CA 4H4MA 3KK2A 3AA3A 3AVNA 1TKTA 4O0JA 1SKWA 5SZTA 1U45A 4CJRA 3MEDA 3QINA 1WLJA 3DOLA 3UIQA 3MEEA 3CFRA 2KQ2A 4CECA 3V1RA 1RDAA 4RW8A 1KRPA 5CY4A 2A1RA 4KTQA 1JLQA 4DTXA 1EXQA 3KKSA 4MQ3A 4DSJA 1Z25A 2B6AA 3ULDA 4E7IA 4CEBA 1VK0A 2X78A 4CJEA 5DMRA 1HMVA 4FLTA 2OPRA 3OY9A 2EX3A 1LWCA 3WNFA 3V9SA 1BIUA 4IG0A 3OJSA 4F3TA 2HVIA 3C94A 1YTUA 5KTQA 3KLEA 4FLYA 2BE2A 3V81A 3KIOA 4FJJA 1RDCA 4KTWA 2I5JA 3EY1A 4CE9A 1WSHA 3H08A 4LD0A 3TR8A 4IKFA 4KHUA 1RTJA 3AVGA 4CGFA 4YNQA 4DSFA 4RW9A 3HPOA 4OLBA 3WNGA 2WONA 5HRPA 4FZXC 1ZBIA 3AVMA 4H8KA 4FJMA 4BDPA 3C6TA 4F2RA 3RMCA 3T1AA 4CHOA 1RBUA 3DLBA 4I2PA 3SPYA 2G8KA 4J2DA 4FJ5A 2P51A 3VQ9A 2HW3A 4KV8A 2ZE2A 3CQ8A 1KFSA 3AVFA 4KKOA 4DTJA 1WSEA 4LY7A 3SQ4A 1U48A 2Z1GA 4CIEA 4KHNA 3T3FA 1BISA 3HVRA 3O4QA 3AVHA 4OPKA 4CF1A 4F4KA 1NJYA 3QO9A 3DLKA 4FLUA 4DTSA 4RW7A 3DMJA 2P5GA 1WAJA 4OJRA 1WN7A 1XWLA 4CFDA 4M3ZA 1RTDA 4LSLA 3OYDA 4LSNA 4FK2A 4M3RA 4CJ4A 2VWJA 4LH4A 5HBMA 1QSLA 1S1VA 3ISNC 4M3XA 4Z4FA 4LH5A 4KI6A 3ZT0A 3L2RA 1O1WA 5HRNA 4B8AB 3M8SA 4DTUA 1QTMA 2BDPA 1MU2A 4GVMA 2JLEA 3JSMA 4QCLA 1KSPA 3NE6A 3NCIA 3VQ5A 3O3FA 4O44A 1BCMA 3ZCMA 3IG1A 4ID1A 4Z4EA 4DTOA 2YNGA 3ASMA 3QNNA 3O4NA 4FXDA 1B92A 3K59A 4I9LA 3QEXA 3I0RA 4CJFA 1SUQA 2GUIA 1B9DA 3QIPA 2KFNA 3BGRA 1N6QA 4OKKA 2E6MA 1TV6A 4BWJA 4E7JA 4DFKA 2F8SA 4IFVA 1TK5A 1TK0A 2OA8A 3THVA 3DLEA 3O3GA 4CIFA 1JL1A 4DTNA 1NK8A 1S6QA 2FBVA 3HM9A 3AA4A 4FJ7A 4WE1A 1SV5A 4OKJA 3LWLA 1DTTA 2YHAA 2ZQBA 3OYHA 1Q9YA 3DYAA 2PZSA 3HK2A 2HMIA 3HXMA 4CHQA 3SUOA 3L2VA 3OYNA 3AA2A 3AVLA 1T7PA 4CK2A 1DTQA 4DQQA 3MAQA 1UA1A 4FYDA 3AV9A 4CFCA 4CJTA 3V9XA 1BIZA 2F96A 3LPUA 2DFEA 3U3GA 2IDOA 2G8UA 4CJ5A 4FJIA 3ZSYA 1RBRA 4DG1A 5J1EA 4DSIA 1HNVA 2B4JA 1U49A 4CJ3A 4O55A 1LWEA 1WAFA 1GOAA 4AH9A 4CGHA 3V9UA 3QERA 1NJZA 2D5RA 4AHUA 4DS4A 1S9GA 1KCFA 3RWUA 1VRUA 4NCGA 4FJXA 2YHBA 3WNEA 1BQMA 1IKYA 3P1GA 2P1JA 5C42A 3AVCA 3TWHA 1JL2A 4OVLA 4B9SA 4AHSA 4DFMA 1X9SA 3OYKA 1FK9A 4EZ6A 4FCYA 1KVBA 1RT1A 1KVCA 1NJWA 4K8XA 1QS4A 4FK0A 4ELTA 4KTZA 5JS1A 1S1TA 2HB5A 1KTQA 1T8EA 2G8IA 3B6PA 4ZHRA 4HUEA 3RR8A 5KRTA 3LANA 1S9EA 3ZSOA 5HRRA 1QE1A 4KB0A 3ZSZA 3CFOA 3QNOA 4N5SA 1VSKA 4H4OA 4CGDA 4CIGA 4DQPA 3IS9A 3DRRA 1L3VA 5J2QA 3K57A 1NKEA 1WSJA 3KLFA 1RDDA 4B9NA 3NGYA 3AO4A 3HPHA 1BQNA 1HQEA 1VSDA 4CEEA 1T03A 4CHYA 5JS2A 2G8WA 3DM2A 1YT3A 4PWDA 4FK4A 1RBVA 2HHUA 1GOBA 3OYCA 2IC3A 3V4IA 2PYJA 1TKDA 5T7BA 1ZBHA 4I9QA 1NOZA 2X6NA 4FLWA 4CJVA 4N56A 5KGXA 5HRSA 3QEWA 3V9WA 3TAQA 3OYMA 4NYNA 4W5TA 4FJHA 1NK4A 1KLMA 3NHGA 1VSLA 3RRHA 3SUNA 3ZSRA 2KZZA 3QESA 1HNIA 5HP1A 3P83D 1NK6A 4DFPA 4M45A 1IKXA 3AA5X 3QIOA 4BWMA 1HYVA 3G10A 3VN5A 3E01A 1RT3A 3L8BA 4C8LA 2BGGA 3TANA 4FW1A 4KREA 3L2QA 3U6FA 4CFAA 1HYZA 3VA3A 1WSIA 1W9HA 3NFAA 4DQRA 1RT2A 2NUBA 1CXUA 3SJJA 4BE1A 4FZZA 4DF4A 5HROA 4DQSA 1X1PA 5I42A 3VQ7A 3HP6A 3CM5A 1UAXA 2ATQA 3SNNA 4O5BA 1TAQA 4FLVA 3L2WA 1FKOA 1Y97A 2IAJA 3DLHA 3QEVA 1NOYA 4M3WA 4DLEA 3ZT2A 1VSFA 1VSEA 4ZTFA 1UA0A 4FJNA 1VSHA 1JLCA 1TL3A 4L8RB 4FM0A 3MEGA 4FM2A 4KRFA 4E7KA 1JLAA 4AHVA 3LP1A 2ITGA 2O4IA 2DFHA 3NF8A 3NF9A 4CF0A 2OPQA 4KB1A 3V9ZA 4CEDA 1BI4B 4KPYA 4FJKA 4PY5A 3NGZA 4AHTA 4E7HA 2KTQA 4B9UA 3OYBA 3K5LA 1J53A 1R0AA 4CHPA 2XY6A 3JYTA 3ZT3A 3KKRA 3DI6A 4IDKA 4JRQA 1HRHA 1B9FA 3TAFA 1A5WA 1YVUA 1VSIA 3V1OA 3AVKA 3NGIA 4FJ9A 3FFIA 4XIUA 1RDBA 1WSGA 2RKIA 5I3UA 2QK9A 3HL8A 2HHWA 3LP2A 3KLHA 5SWMA 2O4GA 4DSEA 4W5RA 2YKNA 3B6OA 3AO2A 1TKZA 4FJGA 3HYFA 4NCAA 1C1AA 3G0ZA 4KAZA 3OYEA 3LAMA 1S1WA 5KI6A 4AHCA 4CJUA 3KLGA 3F73A 4HCBA 3T19A 2FBYA 1X9WA 4N47A 3SCXA 3PY8A 3S3MA 4DTPA 2BANA 2OZMA 2HHTA 1Z26A 2HHQA 3F9KA 2G8HA 1U04A 4JS5A 1HJRA 4I7FA 3LAKA 4DTRA 4UQGA 1IKVA 1U47A 1S5JA 1NK5A 1A5XA 2HNYA 1I3AA 3OYJA 4AILC 3OYAA 1F21A 3BDPA 4F3OA 1NJXA 2G8FA 3SZ2A 3ITHA 1EX4A 2EHGA 5CZ1A 2XY5A 4CF8A 4CGIA 2X74A 1JLBA 1DLOA 4KFBA 4DMNA 3NH0A 4DS5A 2YNIA 4FJLA 1K6YA 4Y1CA 5FRMA 1RBTA 1BI4A 4IFYA 4M3YA 1IH7A 1ZBFA 3NF7A 4KO0A 3LZIA 4HTUA 1D9FA 3NAEA 1YTAA 2Q3SA 2YKMA 3LZJA 3SYZA 1ZBLA 1NK7A 3SV3A 4OKEA 1ITGA 4I2QA 4FM1A 4JRPA 4IBNA 5KGWA 3D0PA 4CJSA 3MXIA 3HJFA 2OZSA 1VSMA 3K5OA 4RW4A 1HPZA 3TAGA 1D9DA 1NK0A 4FLZA 1KVAA 2E6LA 4CK1A 4CF9A 3AO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WNH A;  1LWF A;  4Q5V A;  5HLF A;  4BAC A;  4B3O A;  4CJP A;  1C0T A;  1IO2 A;  4BE0 A;  4E89 A;  1TK8 A;  4ELV A;  1RNH A;  1Q9X A;  5J2P A;  4W5N A;  1TL1 A;  3V6D A;  4F2S A;  4O4G A;  1JKH A;  4CEA A;  1S1U A;  3PV8 A;  2KFZ A;  4CES A;  2DTU A;  4DQI A;  1UOC A;  3PX6 A;  1IKW A;  2Z1H A;  1VSJ A;  4Q0B A;  1CXQ A;  1QQC A;  1J9A A;  3QEI A;  1J5O A;  4N76 A;  4Z4C A;  4DU4 A;  3AVI A;  3OYG A;  4B9L A;  1ASW A;  3NH2 A;  4ZTJ A;  1S6P A;  1C6V A;  3U3Y A;  3K2P A;  1G15 A;  4CHN A;  2W42 A;  4CJQ A;  3MXM A;  1LAW A;  1T05 A;  4J2A A;  4CGG A;  2IS3 A;  2YV0 X;  5CZ2 A;  4KHY A;  4KHS A;  3IAY A;  4PA1 A;  1RT5 A;  3LP3 A;  2FBX A;  3ZT4 A;  2HVH A;  2HHX A;  3TI0 A;  4PUO A;  3LP0 A;  4FVM A;  4RW6 A;  4HUG A;  4BDZ A;  3QET A;  3PX0 A;  3CG7 A;  4ICL A;  2GV9 A;  3MXJ A;  4Z4I A;  2VG6 A;  4CFB A;  1TVR A;  2DFF A;  4BE2 A;  1RTH A;  2QXF A;  3L3V A;  3OS0 A;  1CZ9 A;  3LAL A;  4B9V A;  4N41 A;  1XHZ A;  3PO4 A;  1JLG A;  1TKX A;  4OGC A;  4FJ8 A;  4RG8 A;  2D0B A;  4CJL A;  4KI4 A;  2DY4 A;  2XY8 A;  3AO3 A;  2Y1J A;  1U4B A;  2X6S A;  1NKC A;  4DU3 A;  1EKE A;  4EP5 A;  3DOK A;  3VQ6 A;  3MEC A;  2XO7 A;  1I39 A;  2Z1I A;  2KW4 A;  3VQA A;  1VRT A;  2VG5 A;  3TAE A;  4M42 A;  4YFU A;  4J2B A;  4PQU A;  3ZSV A;  4O0I A;  3CFP A;  3V1Q A;  2QKK A;  3OYL A;  5DK5 A;  3HO1 A;  4DFJ A;  3PX4 A;  1L5U A;  4CEO A;  4KHQ A;  2IGI A;  4DSL A;  1BL3 A;  3SQ2 A;  4NCB A;  4QOZ B;  4ELU A;  3VA0 A;  3EYZ A;  3RRG A;  3KK3 A;  1LAV A;  4E1M A;  2VG7 A;  1L3T A;  1BGX T;  1SKS A;  1SL1 A;  1RT4 A;  5KRS A;  3IRX A;  3SQ1 A;  1FXX A;  2GBZ A;  4HUF A;  4FW2 A;  4C8N A;  1RTI A;  2RN2 A;  2ETJ A;  4HVJ A;  4E7L A;  3AVB A;  1RIL A;  2G8V A;  4EZ9 A;  5CYM A;  4E19 A;  2WOM A;  5K14 A;  4Z4G A;  2RPI A;  1EET A;  1TGO A;  2F8T A;  4E0D A;  2XRI A;  2ZD1 A;  1JXB A;  1XHX A;  5CYQ A;  4CJW A;  4C8O A;  4FZY A;  1ASU A;  3LDS A;  1CLQ A;  4CGJ A;  4E3S A;  3HST B;  3OVN A;  3VQC A;  2IOC A;  3VQ8 A;  3TAP A;  1Q8I A;  3OS2 A;  3HT3 A;  1A5V A;  3C6U A;  5C24 A;  3HVT A;  2FC0 A;  1FKP A;  2VWK A;  2RF2 A;  3I8D A;  3DLG A;  3QLH A;  1KFD A;  3ZSQ A;  1J54 A;  1NK9 A;  1ZYQ A;  1TAU A;  2D0C A;  3ZT1 A;  4B9T A;  3TAR A;  2B5J A;  1QHT A;  4MFB A;  3KD5 E;  2OPS A;  3RMD A;  1BCO A;  3OS1 A;  2XHB A;  3KTQ A;  1GOC A;  1SL0 A;  1NKB A;  3PO5 A;  1JLE A;  4CF2 A;  1C1B A;  4G1Q A;  1RBS A;  4B08 A;  4CEF A;  4R5P A;  1SKR A;  1C0M A;  2D0A A;  1IG9 A;  1QSY A;  3L3U A;  1JLF A;  3ALY A;  4CER A;  3OYF A;  3ZSX A;  3PUF A;  3M8R A;  3L2U A;  3S3N A;  3VQE A;  2HND A;  2OPP A;  3VQQ A;  1XC9 A;  4DTM A;  1D5A A;  4NYF A;  3RMB A;  4AHR A;  4CJK A;  3VQ4 A;  2Y1I A;  2AJQ A;  1W0H A;  4W5Q A;  4DWI A;  3LWM A;  3S3O A;  4OGE A;  1HQU A;  1REV A;  1WSF A;  3VQP A;  2JGU A;  1C0U A;  1WNS A;  5C25 A;  1EP4 A;  1LW0 A;  4DLG A;  3SQ0 A;  4JS4 A;  2HHS A;  3O3H A;  1L3U A;  3HPG A;  3CM6 A;  4EP4 A;  2KZM A;  4Z0U A;  3KLI A;  3KK1 A;  4OLA A;  3D45 A;  3DRS A;  5J2M A;  4CEQ A;  4C8K A;  4BDY A;  1S1X A;  2LSN A;  5D3G A;  1LV5 A;  1RT7 A;  2FBT A;  2YNF A;  3SV4 A;  4CCH A;  4KHW A;  3M8P A;  3K58 A;  3SUP A;  4DF8 A;  2P5O A;  2Z1J A;  3HP9 A;  4M3T A;  4DU1 A;  1ZBU A;  3M8Q A;  1UWB A;  4TSX A;  4GMJ B;  1LW2 A;  3RTV A;  3SI6 A;  4J2E A;  4GW6 A;  4CK3 A;  3NH1 A;  4FLX A;  2PYL A;  4F8R A;  4HCC A;  4M41 A;  2PY5 A;  3AVJ A;  1SL2 A;  3EZ5 A;  3KD1 E;  3CYM A;  4CEZ A;  1RCH A;  5FRN A;  5FRO A;  4IG3 A;  3SPZ A;  2OYQ A;  4E1N A;  4B8C A;  4K8Z A;  3K5M A;  3P5J A;  3AVA A;  2E4L A;  2YNH A;  3A2F A;  1L3S A;  2HHV A;  3NBP A;  4HHT A;  1X9M A;  1CZB A;  1HYS A;  3QEP A;  1XI1 A;  3RMA A;  3S9H A;  2HNZ A;  4JLH A;  5J2N A;  2A1S A;  1BHL A;  1JXE A;  4C8M A;  3NDK A;  3VQD A;  2XY7 A;  3TAB A;  3KJV A;  3DRP A;  1KLN A;  3K5N A;  4DSK A;  1ASV A;  3ZSW A;  3C95 A;  4Y1D A;  2QKB A;  1QSS A;  3DLR A;  3I0S A;  3NF6 A;  5EU7 A;  5E41 A;  3OYI A;  3LPT A;  4CHZ A;  4OPJ A;  3OJU A;  5FDL A;  3RR7 A;  3SUQ A;  3VQB A;  1N5Y A;  4QAG A;  4ID5 A;  2R7Y A;  1D8Y A;  4W5O A;  3AO5 A;  4M3U A;  1RT6 A;  3TAM A;  4Z4H A;  4B9M A;  1C1C A;  4H4M A;  3KK2 A;  3AA3 A;  3AVN A;  1TKT A;  4O0J A;  1SKW A;  5SZT A;  1U45 A;  4CJR A;  3MED A;  3QIN A;  1WLJ A;  3DOL A;  3UIQ A;  3MEE A;  3CFR A;  2KQ2 A;  4CEC A;  3V1R A;  1RDA A;  4RW8 A;  1KRP A;  5CY4 A;  2A1R A;  4KTQ A;  1JLQ A;  4DTX A;  1EXQ A;  3KKS A;  4MQ3 A;  4DSJ A;  1Z25 A;  2B6A A;  3ULD A;  4E7I A;  4CEB A;  1VK0 A;  2X78 A;  4CJE A;  5DMR A;  1HMV A;  4FLT A;  2OPR A;  3OY9 A;  2EX3 A;  1LWC A;  3WNF A;  3V9S A;  1BIU A;  4IG0 A;  3OJS A;  4F3T A;  2HVI A;  3C94 A;  1YTU A;  5KTQ A;  3KLE A;  4FLY A;  2BE2 A;  3V81 A;  3KIO A;  4FJJ A;  1RDC A;  4KTW A;  2I5J A;  3EY1 A;  4CE9 A;  1WSH A;  3H08 A;  4LD0 A;  3TR8 A;  4IKF A;  4KHU A;  1RTJ A;  3AVG A;  4CGF A;  4YNQ A;  4DSF A;  4RW9 A;  3HPO A;  4OLB A;  3WNG A;  2WON A;  5HRP A;  4FZX C;  1ZBI A;  3AVM A;  4H8K A;  4FJM A;  4BDP A;  3C6T A;  4F2R A;  3RMC A;  3T1A A;  4CHO A;  1RBU A;  3DLB A;  4I2P A;  3SPY A;  2G8K A;  4J2D A;  4FJ5 A;  2P51 A;  3VQ9 A;  2HW3 A;  4KV8 A;  2ZE2 A;  3CQ8 A;  1KFS A;  3AVF A;  4KKO A;  4DTJ A;  1WSE A;  4LY7 A;  3SQ4 A;  1U48 A;  2Z1G A;  4CIE A;  4KHN A;  3T3F A;  1BIS A;  3HVR A;  3O4Q A;  3AVH A;  4OPK A;  4CF1 A;  4F4K A;  1NJY A;  3QO9 A;  3DLK A;  4FLU A;  4DTS A;  4RW7 A;  3DMJ A;  2P5G A;  1WAJ A;  4OJR A;  1WN7 A;  1XWL A;  4CFD A;  4M3Z A;  1RTD A;  4LSL A;  3OYD A;  4LSN A;  4FK2 A;  4M3R A;  4CJ4 A;  2VWJ A;  4LH4 A;  5HBM A;  1QSL A;  1S1V A;  3ISN C;  4M3X A;  4Z4F A;  4LH5 A;  4KI6 A;  3ZT0 A;  3L2R A;  1O1W A;  5HRN A;  4B8A B;  3M8S A;  4DTU A;  1QTM A;  2BDP A;  1MU2 A;  4GVM A;  2JLE A;  3JSM A;  4QCL A;  1KSP A;  3NE6 A;  3NCI A;  3VQ5 A;  3O3F A;  4O44 A;  1BCM A;  3ZCM A;  3IG1 A;  4ID1 A;  4Z4E A;  4DTO A;  2YNG A;  3ASM A;  3QNN A;  3O4N A;  4FXD A;  1B92 A;  3K59 A;  4I9L A;  3QEX A;  3I0R A;  4CJF A;  1SUQ A;  2GUI A;  1B9D A;  3QIP A;  2KFN A;  3BGR A;  1N6Q A;  4OKK A;  2E6M A;  1TV6 A;  4BWJ A;  4E7J A;  4DFK A;  2F8S A;  4IFV A;  1TK5 A;  1TK0 A;  2OA8 A;  3THV A;  3DLE A;  3O3G A;  4CIF A;  1JL1 A;  4DTN A;  1NK8 A;  1S6Q A;  2FBV A;  3HM9 A;  3AA4 A;  4FJ7 A;  4WE1 A;  1SV5 A;  4OKJ A;  3LWL A;  1DTT A;  2YHA A;  2ZQB A;  3OYH A;  1Q9Y A;  3DYA A;  2PZS A;  3HK2 A;  2HMI A;  3HXM A;  4CHQ A;  3SUO A;  3L2V A;  3OYN A;  3AA2 A;  3AVL A;  1T7P A;  4CK2 A;  1DTQ A;  4DQQ A;  3MAQ A;  1UA1 A;  4FYD A;  3AV9 A;  4CFC A;  4CJT A;  3V9X A;  1BIZ A;  2F96 A;  3LPU A;  2DFE A;  3U3G A;  2IDO A;  2G8U A;  4CJ5 A;  4FJI A;  3ZSY A;  1RBR A;  4DG1 A;  5J1E A;  4DSI A;  1HNV A;  2B4J A;  1U49 A;  4CJ3 A;  4O55 A;  1LWE A;  1WAF A;  1GOA A;  4AH9 A;  4CGH A;  3V9U A;  3QER A;  1NJZ A;  2D5R A;  4AHU A;  4DS4 A;  1S9G A;  1KCF A;  3RWU A;  1VRU A;  4NCG A;  4FJX A;  2YHB A;  3WNE A;  1BQM A;  1IKY A;  3P1G A;  2P1J A;  5C42 A;  3AVC A;  3TWH A;  1JL2 A;  4OVL A;  4B9S A;  4AHS A;  4DFM A;  1X9S A;  3OYK A;  1FK9 A;  4EZ6 A;  4FCY A;  1KVB A;  1RT1 A;  1KVC A;  1NJW A;  4K8X A;  1QS4 A;  4FK0 A;  4ELT A;  4KTZ A;  5JS1 A;  1S1T A;  2HB5 A;  1KTQ A;  1T8E A;  2G8I A;  3B6P A;  4ZHR A;  4HUE A;  3RR8 A;  5KRT A;  3LAN A;  1S9E A;  3ZSO A;  5HRR A;  1QE1 A;  4KB0 A;  3ZSZ A;  3CFO A;  3QNO A;  4N5S A;  1VSK A;  4H4O A;  4CGD A;  4CIG A;  4DQP A;  3IS9 A;  3DRR A;  1L3V A;  5J2Q A;  3K57 A;  1NKE A;  1WSJ A;  3KLF A;  1RDD A;  4B9N A;  3NGY A;  3AO4 A;  3HPH A;  1BQN A;  1HQE A;  1VSD A;  4CEE A;  1T03 A;  4CHY A;  5JS2 A;  2G8W A;  3DM2 A;  1YT3 A;  4PWD A;  4FK4 A;  1RBV A;  2HHU A;  1GOB A;  3OYC A;  2IC3 A;  3V4I A;  2PYJ A;  1TKD A;  5T7B A;  1ZBH A;  4I9Q A;  1NOZ A;  2X6N A;  4FLW A;  4CJV A;  4N56 A;  5KGX A;  5HRS A;  3QEW A;  3V9W A;  3TAQ A;  3OYM A;  4NYN A;  4W5T A;  4FJH A;  1NK4 A;  1KLM A;  3NHG A;  1VSL A;  3RRH A;  3SUN A;  3ZSR A;  2KZZ A;  3QES A;  1HNI A;  5HP1 A;  3P83 D;  1NK6 A;  4DFP A;  4M45 A;  1IKX A;  3AA5 X;  3QIO A;  4BWM A;  1HYV A;  3G10 A;  3VN5 A;  3E01 A;  1RT3 A;  3L8B A;  4C8L A;  2BGG A;  3TAN A;  4FW1 A;  4KRE A;  3L2Q A;  3U6F A;  4CFA A;  1HYZ A;  3VA3 A;  1WSI A;  1W9H A;  3NFA A;  4DQR A;  1RT2 A;  2NUB A;  1CXU A;  3SJJ A;  4BE1 A;  4FZZ A;  4DF4 A;  5HRO A;  4DQS A;  1X1P A;  5I42 A;  3VQ7 A;  3HP6 A;  3CM5 A;  1UAX A;  2ATQ A;  3SNN A;  4O5B A;  1TAQ A;  4FLV A;  3L2W A;  1FKO A;  1Y97 A;  2IAJ A;  3DLH A;  3QEV A;  1NOY A;  4M3W A;  4DLE A;  3ZT2 A;  1VSF A;  1VSE A;  4ZTF A;  1UA0 A;  4FJN A;  1VSH A;  1JLC A;  1TL3 A;  4L8R B;  4FM0 A;  3MEG A;  4FM2 A;  4KRF A;  4E7K A;  1JLA A;  4AHV A;  3LP1 A;  2ITG A;  2O4I A;  2DFH A;  3NF8 A;  3NF9 A;  4CF0 A;  2OPQ A;  4KB1 A;  3V9Z A;  4CED A;  1BI4 B;  4KPY A;  4FJK A;  4PY5 A;  3NGZ A;  4AHT A;  4E7H A;  2KTQ A;  4B9U A;  3OYB A;  3K5L A;  1J53 A;  1R0A A;  4CHP A;  2XY6 A;  3JYT A;  3ZT3 A;  3KKR A;  3DI6 A;  4IDK A;  4JRQ A;  1HRH A;  1B9F A;  3TAF A;  1A5W A;  1YVU A;  1VSI A;  3V1O A;  3AVK A;  3NGI A;  4FJ9 A;  3FFI A;  4XIU A;  1RDB A;  1WSG A;  2RKI A;  5I3U A;  2QK9 A;  3HL8 A;  2HHW A;  3LP2 A;  3KLH A;  5SWM A;  2O4G A;  4DSE A;  4W5R A;  2YKN A;  3B6O A;  3AO2 A;  1TKZ A;  4FJG A;  3HYF A;  4NCA A;  1C1A A;  3G0Z A;  4KAZ A;  3OYE A;  3LAM A;  1S1W A;  5KI6 A;  4AHC A;  4CJU A;  3KLG A;  3F73 A;  4HCB A;  3T19 A;  2FBY A;  1X9W A;  4N47 A;  3SCX A;  3PY8 A;  3S3M A;  4DTP A;  2BAN A;  2OZM A;  2HHT A;  1Z26 A;  2HHQ A;  3F9K A;  2G8H A;  1U04 A;  4JS5 A;  1HJR A;  4I7F A;  3LAK A;  4DTR A;  4UQG A;  1IKV A;  1U47 A;  1S5J A;  1NK5 A;  1A5X A;  2HNY A;  1I3A A;  3OYJ A;  4AIL C;  3OYA A;  1F21 A;  3BDP A;  4F3O A;  1NJX A;  2G8F A;  3SZ2 A;  3ITH A;  1EX4 A;  2EHG A;  5CZ1 A;  2XY5 A;  4CF8 A;  4CGI A;  2X74 A;  1JLB A;  1DLO A;  4KFB A;  4DMN A;  3NH0 A;  4DS5 A;  2YNI A;  4FJL A;  1K6Y A;  4Y1C A;  5FRM A;  1RBT A;  1BI4 A;  4IFY A;  4M3Y A;  1IH7 A;  1ZBF A;  3NF7 A;  4KO0 A;  3LZI A;  4HTU A;  1D9F A;  3NAE A;  1YTA A;  2Q3S A;  2YKM A;  3LZJ A;  3SYZ A;  1ZBL A;  1NK7 A;  3SV3 A;  4OKE A;  1ITG A;  4I2Q A;  4FM1 A;  4JRP A;  4IBN A;  5KGW A;  3D0P A;  4CJS A;  3MXI A;  3HJF A;  2OZS A;  1VSM A;  3K5O A;  4RW4 A;  1HPZ A;  3TAG A;  1D9D A;  1NK0 A;  4FLZ A;  1KVA A;  2E6L A;  4CK1 A;  4CF9 A;  3AO1 A; 
#chains in the Genus database with same CATH topology
 2WTU A;  3WNH A;  1LWF A;  4H0V B;  4LF9 K;  4Q5V A;  4CJP A;  2YCH A;  1C0T A;  3CQY A;  1VQM N;  1Q9X A;  3MX2 A;  3CPW M;  1JKH A;  3VES A;  4CEA A;  4CES A;  3EE9 A;  3CI5 A;  3QBX A;  1IKW A;  4JD2 A;  1CXQ A;  4DU4 A;  1ASW A;  4JKB A;  4ZTJ A;  5BN9 A;  4KH6 A;  4GKK K;  1Q82 O;  1G15 A;  4B3M K;  2YV0 X;  4KHS A;  3OW2 M;  1RT5 A;  3ZT4 A;  4CW7 B;  3ID8 A;  4RW6 A;  4BDZ A;  1RTH A;  4FOI A;  3OS0 A;  1TKX A;  4RG8 A;  4KI4 A;  3C7N B;  3DLL L;  2D4W A;  1J6Z A;  2Y1J A;  2GTD A;  1NKC A;  3L6Q A;  3MEC A;  2XO7 A;  1I39 A;  4PHT X;  2KW4 A;  3TAE A;  1XQS C;  4J2B A;  3MWT A;  3UE5 A;  4JKA A;  3V1Q A;  3U9D A;  1L5U A;  3HO1 A;  4QS8 A;  1NLV A;  1Q18 A;  4ELU A;  3RRG A;  3GOI A;  2VG7 A;  3PIO L;  1BGX T;  1SKS A;  1L3T A;  1RT4 A;  2AP1 A;  3IRX A;  1FXX A;  5AQR A;  4HVJ A;  2FLO A;  3ZX3 A;  2UUC K;  3J8A A;  2P9P B;  3PSI A;  5CYM A;  5C0Y A;  5K14 A;  4Z4G A;  1EET A;  3SAH A;  3TSQ A;  1ASU A;  3LDS A;  3VQ8 A;  2HHH K;  5C24 A;  4DV6 K;  2RF2 A;  1BWF O;  4BR4 A;  1KFD A;  1NK9 A;  2D0C A;  3U9Z A;  3KD5 E;  4XEI A;  4EIA A;  4OPH A;  2ITM A;  3OS1 A;  1MWM A;  2P9L A;  4CF2 A;  1T44 A;  2D0A A;  1NWK A;  3S3N A;  3ZSX A;  3VQE A;  2HND A;  4WFA L;  1XC9 A;  4BRF A;  4AHR A;  5C2D A;  2P9P A;  1GLB G;  3EKS A;  3MN5 A;  4FWS A;  1REV A;  4OGE A;  4DR7 K;  1C0U A;  1WNS A;  4LF4 K;  4ILG B;  3SQ0 A;  3ZET B;  4JS4 A;  1YI2 N;  3HM8 A;  3VF6 A;  4RTF D;  3R9P A;  3MCP A;  1YAG A;  5J2M A;  4CEQ A;  3AGR A;  4BDY A;  5D3G A;  4JKH A;  3WXJ A;  1LV5 A;  2YNF A;  3M8P A;  2A40 A;  4H0O A;  3SUP A;  4K0K K;  1VQ8 N;  4BRN A;  3H46 O;  2P5O A;  5IT9 O;  4M3T A;  4DU1 A;  4TSX A;  4GMJ B;  4A57 A;  4GW6 A;  2PYL A;  4HCC A;  4M41 A;  2PY5 A;  3F9M A;  5C12 A;  2UYT A;  1SL2 A;  4V19 S;  4CEZ A;  1OVY A;  3O5B A;  3SPZ A;  4C23 A;  4U7B A;  3K5M A;  4HTL A;  2YNH A;  1L3S A;  5M1O A;  2HHV A;  1X9M A;  1XC3 A;  5AQU A;  3RMA A;  3S9H A;  2HNZ A;  4IOX A;  5J2N A;  3RVC A;  3CCL N;  3ZEU B;  3EN9 A;  3TAB A;  5FPM A;  4PL8 A;  3ZSW A;  2UUA K;  3NF6 A;  3QIC A;  4J8F A;  3OYI A;  3MDQ A;  3ZET A;  3OJU A;  1SS6 A;  3SUQ A;  2P9K B;  4ID5 A;  5HL7 L;  3AO5 A;  2Q2R A;  4FPA A;  4FL9 A;  1C1C A;  3R1X A;  4JI5 K;  1J5E K;  3O1W A;  1WLJ A;  2KQ2 A;  4NO7 A;  1RDA A;  4RW8 A;  5CY4 A;  2A1R A;  4KTQ A;  1JLQ A;  3KKS A;  2X78 A;  5DMR A;  4YHH K;  1LWC A;  2O8E B;  2Q97 A;  1YTU A;  4FLY A;  4LFA K;  4Z94 A;  3ZEU A;  3H08 A;  4IKF A;  3I8B A;  3HBT A;  5MLC Q;  3WNG A;  1ZBI A;  3AVM A;  4FJM A;  3C6T A;  3T1A A;  4CHO A;  2P9K A;  3DLB A;  4I2P A;  2EWS A;  3EKU A;  4B1U B;  4CBW A;  2ZE2 A;  1KFS A;  3AVF A;  4KKO A;  4CIE A;  2CGL A;  3WXI A;  3AVH A;  1NGB A;  4OPK A;  3CJ9 A;  3MN9 A;  4GKJ K;  4FLU A;  4RW7 A;  3DMJ A;  4ISG A;  1WAJ A;  1FW6 A;  1WN7 A;  3TTC A;  4DV2 K;  4CFD A;  4M3R A;  2O8D B;  3TPQ A;  4M3X A;  2IVO A;  4KI6 A;  1XUP O;  4KHP K;  1O1W A;  3CCS N;  2O8E A;  1C0F A;  1RGI A;  2JLE A;  3VQ5 A;  4O44 A;  3ZCM A;  3IG1 A;  4DTO A;  3G71 N;  4B9Q A;  1B92 A;  3QEX A;  2E20 A;  1HX1 A;  3I0R A;  4CJF A;  1Q86 O;  2GUI A;  1VHX A;  4CZE A;  4CZI A;  5AQG A;  2E6M A;  3P4I A;  2V7Z A;  2BUP A;  4BWJ A;  2ZJQ L;  4DFK A;  2F8S A;  5BR9 A;  4BR9 A;  3EE8 A;  3AA4 A;  4FJ7 A;  2KKZ A;  3VET A;  3FZK A;  2YHA A;  3OYH A;  2VQE K;  4CZF A;  4AM6 A;  4PKI A;  3AA2 A;  4DQQ A;  4FYD A;  4FSV A;  3SLC A;  3AV9 A;  4FJI A;  3LPU A;  2A41 A;  2G8U A;  1ZC6 A;  3ZSY A;  4XH1 A;  3CC4 N;  3QER A;  1NJZ A;  3V9U A;  5AQJ A;  4FVU A;  1S9G A;  5LJV A;  3RWU A;  4FJX A;  2YHB A;  2ZJP L;  1NGC A;  5AQL A;  3P1G A;  2P1J A;  5C42 A;  3AVC A;  4RWT A;  4OVL A;  1TUU A;  3GG4 A;  4AHS A;  4OX9 K;  2JWK A;  2W40 A;  2GUP A;  1KVC A;  2NLX A;  4C1N K;  4UY8 O;  4PL7 A;  3J81 O;  1QS4 A;  4H5T A;  4BQL A;  3SAF A;  4KTZ A;  1S1T A;  2HB5 A;  1KTQ A;  4BRI A;  4BY9 C;  4JV5 K;  4WQ4 C;  3SMP A;  1MWK A;  5HRR A;  4JN4 A;  4N5S A;  1VSK A;  3ZLJ A;  4CIG A;  1LCU A;  1WSJ A;  1RDD A;  3O8M A;  4B9N A;  2P9U B;  4CEE A;  1HQE A;  4JKC A;  2G8W A;  5JS2 A;  4PWD A;  3FE1 A;  4I6M B;  4LFB K;  2HHU A;  3OYC A;  4CVN E;  4FLW A;  4CJV A;  5KGX A;  4O8U A;  3UB5 A;  4W5T A;  1NK4 A;  1KLM A;  2P9S B;  5HP1 A;  3P83 D;  3G10 A;  4IEE A;  5AJ3 K;  1RT3 A;  4BRO A;  2BGG A;  4FW1 A;  3G4S N;  3T69 A;  2IVN A;  4DQR A;  3N4P A;  1P90 A;  2NUB A;  4BRD A;  3WEE B;  1QZ6 A;  3QEV A;  4DLE A;  1UA0 A;  4FM0 A;  3AY9 A;  4AHV A;  2ITG A;  2DFH A;  4BGB A;  4I6M A;  3GBT A;  3V9Z A;  4CED A;  3E9L A;  4PY5 A;  1C0G A;  3IKM A;  2KTQ A;  4B9U A;  1J53 A;  1R0A A;  1WOQ A;  3A5M C;  1HNX K;  1A5W A;  4H5W A;  1VSI A;  2P9S A;  1EWQ A;  3VF4 A;  1OH6 A;  1RDB A;  5M1K A;  2RKI A;  3D2E B;  2YKN A;  3B6O A;  4W5R A;  3AO2 A;  1TKZ A;  2FF3 B;  4NCA A;  3G0Z A;  3BZK A;  3LAM A;  4CJU A;  3O4W A;  3SCX A;  2HHT A;  2OZM A;  2ASP A;  2G8H A;  1HJR A;  3H45 C;  1DEJ A;  4FWN A;  2HNY A;  3BDP A;  3GDQ A;  4B1X B;  4EHU A;  3ITH A;  2EHG A;  2WC9 A;  4A62 A;  1JLB A;  4CGI A;  1DLO A;  1IBK K;  4DMN A;  5ELZ A;  3L4Q A;  4FJL A;  4IFE A;  1K6Y A;  5FRM A;  1RDU A;  5GAG P;  3LZI A;  2Q0R A;  2YKM A;  3LZJ A;  5GIP A;  3SV3 A;  4OKE A;  1ITG A;  3H1Q A;  3LM9 A;  4I2Q A;  4IBN A;  5KGW A;  3RSE B;  5M1F A;  2OZS A;  3VGL A;  4BRL A;  2RE2 A;  4RW4 A;  3T1Y K;  1KVA A;  3VTI A;  1XMQ K;  4CF9 A;  1ZBS A;  3AO1 A;  5E84 A;  4BE0 A;  1TK8 A;  4DR2 K;  3CC2 N;  2A5X A;  3TU5 A;  3ZX0 A;  4BC2 A;  3CCV N;  5J2P A;  3V6D A;  1N36 K;  4B1Y B;  3O6W A;  3PV8 A;  2KFZ A;  4JKE A;  4JK9 A;  4EAH D;  1J9A A;  3QEI A;  4N76 A;  4Z4C A;  3AVI A;  2GWJ A;  3IUC A;  5BPM A;  2FSJ A;  2Q0U A;  4CHN A;  3MXM A;  1LAW A;  1T05 A;  3C65 A;  2IS3 A;  5CZ2 A;  2HVH A;  2HHX A;  3TSP A;  3PX0 A;  3QET A;  3MXJ A;  2W6L A;  1TVR A;  4CFB A;  5BPL A;  1NG9 A;  1CZ9 A;  4B9V A;  4N41 A;  1XHZ A;  5M1P A;  4OGC A;  2BTF A;  2D0B A;  4B1Z A;  3VEV A;  3OHR A;  1H1V A;  2X6S A;  1MA9 B;  4DU3 A;  3DOK A;  3VQ6 A;  4JI1 K;  4JKD A;  1VRT A;  2VG5 A;  5KPR A;  1M90 O;  2P9N B;  4PQU A;  2Q31 A;  1NGA A;  4H0P A;  4O0I A;  2YHX A;  4DR1 K;  2QKK A;  4GNI A;  5DK5 A;  1NGD A;  3PX4 A;  4KHQ A;  4CEO A;  1N34 K;  3DXK B;  3SMS A;  3I55 N;  3O9T A;  4QOZ B;  1HUX A;  2NRX A;  1OKJ A;  2F9W A;  2F4V K;  2GBZ A;  4C8N A;  4FW2 A;  1RTI A;  2QTD A;  3SBG A;  4E7L A;  4K25 A;  4O5F A;  4E19 A;  3R8E A;  4FPB A;  2RPI A;  2ZGZ A;  3THX B;  1TGO A;  4E0D A;  2XRI A;  3WXL A;  1QQM A;  1SZ2 A;  4CJW A;  3IFR A;  4C8O A;  1VQ5 N;  4E3S A;  3HT3 A;  1U2V B;  3C6U A;  4U67 L;  1O13 A;  2VWK A;  5GIO A;  3I8D A;  1TAU A;  3ZSQ A;  3CCQ N;  1HLU A;  1ZYQ A;  2P9N A;  2B5J A;  4MFB A;  1YHQ N;  5KQD A;  3DXK A;  3RMD A;  2XHB A;  3PO5 A;  1SL0 A;  3GL1 A;  1V4S A;  3D7E O;  1X3M A;  4JD2 B;  1NMD A;  4H0Y B;  1SKR A;  1C0M A;  1QSY A;  4CER A;  3PUF A;  2GX9 A;  4CZH A;  1EO1 A;  2VGN A;  4DTM A;  1Q7Y O;  4NYF A;  2Y1I A;  4W5Q A;  4DWI A;  1WSF A;  3THX A;  2YHY A;  1W2B M;  1LW0 A;  3FGU A;  1L3U A;  4LF7 K;  2KZM A;  2UU9 K;  2V52 B;  1VQO N;  3KLI A;  4BRG A;  4X65 K;  4C8K A;  2O8F B;  1T3V A;  2LSN A;  1RT7 A;  4H0X B;  4CCH A;  4QS7 A;  4L3Q A;  1YJ9 N;  1HPM A;  3LL3 A;  4DF8 A;  2Z1J A;  3HP9 A;  3RTV A;  1LW2 A;  3L4I A;  3MK6 A;  4J2E A;  3NH1 A;  1YXQ A;  3AVJ A;  4IO9 L;  4FWM A;  2OYQ A;  2O8B B;  2GWK A;  2VCP A;  4IZ9 A;  4JK8 A;  1XNQ K;  4A59 A;  1HYS A;  3AAP A;  1XI1 A;  3HOS A;  4JLH A;  3NDK A;  2XY7 A;  3K5N A;  2QKB A;  1ASV A;  3C95 A;  4B1V A;  4MDA A;  5E41 A;  3HSC A;  3EEQ A;  1IJJ A;  3VQB A;  1N5Y A;  2R7Y A;  3R6M A;  3EO3 A;  3CPE A;  3CJ1 A;  4W5O A;  2O8F A;  5CE3 A;  4B9M A;  3KK2 A;  3CF5 L;  1EWR A;  1SKW A;  3MED A;  3VEZ A;  1W7A A;  3UIQ A;  3MEE A;  1BO5 O;  3JAM O;  1I94 K;  1ESV A;  3U4L A;  1KRP A;  1IG8 A;  3A5L C;  2O8B A;  1VK0 A;  2P9L B;  3NVK A;  4IOA L;  3C94 A;  2E5L K;  4WCE L;  3V81 A;  4FJJ A;  4KTW A;  2I5J A;  3EY1 A;  3PIP L;  4LD0 A;  5AQF A;  1NBW A;  4YNQ A;  1GLA G;  4RW9 A;  3HPO A;  3MN6 A;  4BC5 A;  3ENO A;  4PKG A;  4F2R A;  3VF2 A;  2WBN A;  3KK7 A;  3CET A;  4CBX A;  2ZM6 K;  3SPY A;  4J2D A;  1ILY A;  2QW9 A;  2H3G X;  4A5B A;  1WSE A;  2Z1G A;  4YY3 K;  3O4Q A;  4CF1 A;  3F5T A;  2CGK A;  4BRP A;  1N33 K;  4M3Z A;  4LSL A;  3A8Y A;  1S1V A;  3ISN C;  4Z4F A;  4LH5 A;  3ZT0 A;  3L2R A;  4IEI A;  5TKW A;  4DTU A;  2BDP A;  3JSM A;  2V51 B;  1KSP A;  4Z4E A;  1DGK N;  2YNG A;  3ASM A;  4DCH A;  4FXD A;  3M5R A;  3SAG A;  1SUQ A;  1B9D A;  2KFN A;  3BGR A;  4JHD B;  1TV6 A;  4E7J A;  3K9J A;  3THV A;  1JL1 A;  1TUY A;  3HOT A;  2FBV A;  2CH5 A;  3LWL A;  4DQ8 A;  1Q9Y A;  1DT9 A;  4DV7 K;  2HMI A;  3OTO K;  3ZX2 A;  3AVL A;  1DTQ A;  1UA1 A;  4C1N I;  4CFC A;  3V9X A;  3U3G A;  2DFE A;  2IDO A;  4IWV A;  1RBR A;  1W97 L;  5J1E A;  1U49 A;  5C2F A;  4O55 A;  3CJA A;  4AHU A;  4DS4 A;  1TYQ B;  4ISE A;  2YJF A;  5E26 A;  3WNE A;  2IIR A;  3A0I X;  1IKY A;  3TWH A;  1EQY A;  3WUH A;  1X9S A;  4FCY A;  1RT1 A;  4JHD A;  1NJW A;  4K8X A;  4KH4 A;  4BG8 A;  5B8H A;  3B6P A;  3BY5 A;  3ENB A;  1QE1 A;  3CFO A;  1K9M O;  1YIT N;  3WXK A;  1L3V A;  4WYB A;  1X9J A;  3KLF A;  4A2A A;  3B8A X;  1T03 A;  4CHY A;  4LF8 K;  4FK4 A;  3PSF A;  3V4I A;  2IC3 A;  2PYJ A;  3CXC M;  5AQW A;  1ZBH A;  1NOZ A;  2X6N A;  3O08 A;  1TYQ A;  4DKW A;  5AFU A;  3QEW A;  3A5N C;  3ZSR A;  3QES A;  1HNI A;  1NK6 A;  3AA5 X;  4BWM A;  4KRE A;  3U6F A;  2DPN A;  4BR5 A;  1RT2 A;  5AQN A;  3SJJ A;  4BE1 A;  2NRZ A;  4DF4 A;  2W6K A;  4YDU A;  1X1P A;  4DQS A;  5I42 A;  1YJW N;  3VQ7 A;  3HP6 A;  3SBT A;  1YVN A;  3I33 A;  4FLV A;  3L2W A;  2IAJ A;  3DLH A;  4CD1 A;  3CD6 N;  1VQ6 N;  4ZTF A;  1VSE A;  3UKR A;  4BG9 A;  4E7K A;  3CC7 N;  3CER A;  3NF8 A;  3NF9 A;  4KB1 A;  4FJK A;  4GV9 A;  1GLF O;  2ZGY A;  1VQP N;  4BRE A;  3OYB A;  3WQU A;  3BF1 A;  4BC4 A;  2FSN A;  4CHP A;  3EZW A;  1NGF A;  3V1O A;  2VYP A;  5AQH A;  4FJ9 A;  3OBY A;  4K43 A;  3CME N;  5M1Q A;  3HL8 A;  3LP2 A;  2P9I B;  2O4G A;  4BQZ A;  4FJG A;  2ASO A;  3HYF A;  5FPN A;  4KAZ A;  3OYE A;  5CHI A;  1S1W A;  3F73 A;  1KD1 O;  3QFP A;  1U04 A;  4JI2 K;  4JS5 A;  1VQ4 N;  2UXB K;  2QI2 A;  4DTR A;  4UQG A;  1U47 A;  1A5X A;  3LDO A;  5F1X A;  4KBO A;  3OYJ A;  1KAZ A;  1F21 A;  4FWK A;  4JI4 K;  4MLE A;  4CF8 A;  2X74 A;  4X64 K;  4DS5 A;  4KFB A;  3NH0 A;  2E1Y A;  3KWG A;  4Y1C A;  1RBT A;  4IFY A;  4M3Y A;  1IH7 A;  4KO0 A;  3T1H K;  2Q3S A;  3CCE N;  3H3O B;  4E1J A;  4JRP A;  3D0P A;  2Q1N A;  5KPT A;  5KPZ A;  1WBD A;  3CCU N;  4CBU A;  3LDP A;  3H3N O;  2E6L A;  3L8B A;  5FPD A;  2A3Z A;  2P9I A;  3L0Q A;  5LY3 A;  4ELV A;  3NMU A;  4W5N A;  4NLC A;  1KQS M;  4DQI A;  1UOC A;  3P31 A;  1QQC A;  4B9L A;  1KAX A;  1S6P A;  1C6V A;  2HF3 A;  3K2P A;  4K42 A;  4CJQ A;  4J2A A;  4IDH A;  3M6G A;  4IO8 A;  4FVM A;  4HUG A;  4Z4I A;  2KZZ A;  1S22 A;  4BE2 A;  1T6D A;  2QXF A;  4CZG A;  5JLF A;  4DR4 K;  4JI6 K;  4YOR A;  4IXC A;  3PO4 A;  1JLG A;  2WUS A;  1YIJ N;  2XY8 A;  3AO3 A;  4BRM A;  3G6E N;  4EP5 A;  3LDQ A;  2Z1I A;  3VQA A;  2UUB K;  3CHW A;  4YFU A;  3CFP A;  3OYL A;  2HF4 A;  2W41 A;  2IGI A;  5JLH A;  1BL3 A;  3VA0 A;  3EYZ A;  1LAV A;  4E1M A;  1BA1 A;  4BRA A;  5KRS A;  5DM7 L;  1HNZ K;  3SQ1 A;  4HUF A;  2ETJ A;  1MDU B;  3E66 A;  3AVB A;  5AQM A;  4AF1 A;  4YOU A;  4EZ9 A;  3PLA A;  1ATS A;  1VQN N;  1GLD G;  2ZD1 A;  1JXB A;  1XHX A;  5CYQ A;  5A2Q O;  2YJE A;  1CLQ A;  4NB4 A;  1FJG K;  2IOC A;  2HBK A;  5C15 A;  1Q8I A;  3O9R A;  5BPN A;  3HVT A;  3KHY A;  2QA4 N;  4MO5 A;  3E9P A;  5AQZ A;  3DLG A;  1J54 A;  3CQX A;  4B9T A;  3TAR A;  1NJI O;  2OPS A;  3WXM B;  1C1B A;  4G1Q A;  1D4X A;  5I9E B;  2HVI A;  3M8R A;  3ALY A;  3L2U A;  3THW A;  4NXM K;  3VQQ A;  2YHW A;  3VQ4 A;  2AJQ A;  1W0H A;  3S3O A;  1HQU A;  1NGH A;  5JMV A;  2JGU A;  3FLC O;  2HHS A;  3F2K A;  5BRD A;  3O3H A;  4AM7 A;  1BA0 A;  3VEN A;  1S1X A;  3SV4 A;  4KHW A;  4AQY K;  4WQ5 A;  3K58 A;  1OH5 A;  3VEX A;  3M8Q A;  3BUZ B;  3SI6 A;  3K0S A;  1ATR A;  3CYM A;  4BR7 A;  5FRN A;  2UXD K;  4E1N A;  4B8C A;  4K8Z A;  2ZJR L;  2E4L A;  3A2F A;  3NBP A;  5AQT A;  4R79 A;  3M1F A;  1CZB A;  4MLH A;  2F7T A;  3O9Q A;  4KH5 A;  1JXE A;  4C8M A;  4B3R K;  4LC9 B;  5FPE A;  4DSK A;  1BUP A;  3DLR A;  3I0S A;  5EU7 A;  4A5A A;  4GVE A;  3LPT A;  4B3T K;  3J7A P;  4MDB A;  5FDL A;  1D8Y A;  3TAM A;  1K8K A;  4H4M A;  3AA3 A;  1TKT A;  4CJR A;  1HJO A;  3QIN A;  4CEC A;  4F9O A;  1HKC A;  4MQ3 A;  4EHT A;  1Z25 A;  1ZXO A;  3CJC A;  5AZI A;  4CEB A;  4CJE A;  4FLT A;  3QB0 A;  2AA4 A;  5LMN K;  3WNF A;  3V9S A;  3OJS A;  2I7P A;  2QWQ A;  3KLE A;  3P39 A;  3KIO A;  3HZ6 A;  2UXC K;  4CGF A;  3CJB A;  3CIP A;  4FZX C;  2QEX N;  4H8K A;  5GAE P;  4BDP A;  3J7Z O;  3RMC A;  1GLJ O;  1RBU A;  3THY B;  5AQI A;  4JEP A;  4H5V A;  4FJ5 A;  5EX5 A;  4KV8 A;  5M1N A;  3VEO A;  4LY7 A;  4KHN A;  4F4K A;  1NJY A;  3QO9 A;  2KHO A;  4CZM A;  3DLK A;  4LF6 K;  2HBL A;  2P5G A;  4OJR A;  2E88 A;  1XWL A;  3OYD A;  4LSN A;  4YDU C;  4LF5 K;  4FK2 A;  5AZJ B;  5AFU H;  2VWJ A;  4LH4 A;  5HBM A;  5KQ8 A;  5HRN A;  4B8A B;  5ADX H;  4RCH A;  1QTM A;  1XNR K;  4GVM A;  4QCL A;  3NE6 A;  3O3F A;  1BCM A;  4CZJ A;  3ATV A;  3VGK A;  1N6Q A;  5AQO A;  5AQV A;  2GEL A;  3S41 A;  3THY A;  3DLE A;  1NK8 A;  5GAD P;  1SV5 A;  4BC3 A;  3SK3 A;  4OKJ A;  2PZS A;  2OTL N;  3HXM A;  3SUO A;  3OYN A;  2VWB A;  3BF3 A;  4CK2 A;  3MAQ A;  5F0X A;  1NGE A;  4CJT A;  1GLL O;  2F96 A;  2ZWH A;  3U8X A;  4CJ5 A;  5AZJ A;  4DG1 A;  2KLA A;  2B4J A;  2QWP A;  1WAF A;  4CGH A;  4M7X A;  1LOT B;  4JAX A;  1KCF A;  1VRU A;  3IMX A;  4NCG A;  3ATU A;  3UKU B;  2QM1 A;  3VMF B;  1JL2 A;  5AQS A;  4DFM A;  3OYK A;  1FK9 A;  5BRH A;  5JIC A;  4YOW A;  1JCF A;  1OH8 A;  1VAZ A;  2YX6 A;  1T8E A;  2G8I A;  4ZHR A;  3LAN A;  1S9E A;  4KB0 A;  3EL2 A;  4H4O A;  4DQP A;  3IS9 A;  5GIN A;  3AO4 A;  3HPH A;  1VSD A;  3TSU A;  1YUW A;  3DM2 A;  1RBV A;  1GOB A;  1IBM K;  4JKG B;  5EOY A;  4EFH A;  5HOO A;  1IBL K;  3VTH A;  1VQK N;  5H1S Q;  4BRQ A;  4N56 A;  3UKU A;  3V9W A;  3TAQ A;  3A5O C;  3OYM A;  4NYN A;  4FJH A;  1HNW K;  1GLE G;  4ILJ A;  1VSL A;  1S3X A;  3DJC A;  3MWP A;  4DFP A;  4H5N A;  3E01 A;  4C8L A;  3TAN A;  4JI8 K;  3AGK A;  3L2Q A;  2E1Z A;  1HYZ A;  3NFA A;  2NRV A;  2QWO A;  1RDW X;  2QWN A;  2ZF5 O;  5HRO A;  1SAZ A;  4PKH A;  5BRE A;  3CM5 A;  2ATQ A;  3SNN A;  2HOE A;  4K41 A;  4O5B A;  1NMN A;  1Y97 A;  1NOY A;  4M3W A;  1VSF A;  4H0T B;  4FJN A;  1VSH A;  1JLC A;  5EVZ A;  1V4T A;  4KRF A;  3NVM A;  2O4I A;  3LP1 A;  4CF0 A;  2OPQ A;  4KPY A;  1BI4 B;  1Z05 A;  4CZL A;  5LL6 Z;  4AHT A;  3K5L A;  4JKG A;  2XY6 A;  3KKR A;  3DI6 A;  3OBW A;  4DV0 K;  1HRH A;  1B9F A;  3C7N A;  4CZK A;  1YVU A;  3AVK A;  4DUZ K;  1XMO K;  3QBW A;  3WQT A;  3FFI A;  5EXW A;  5I3U A;  3DXM B;  4CI6 A;  3W3D A;  4ILH A;  4FWO A;  1ATN A;  5AQK A;  1C1A A;  4AHC A;  3KLG A;  4HCB A;  2A42 A;  3M3Z A;  3JXU A;  3T19 A;  3S3M A;  5AQY A;  4DTP A;  1Z26 A;  2HHQ A;  1VQ9 N;  3R3L A;  3J80 O;  1IKV A;  1NK5 A;  4JI7 K;  3D2F B;  4F3O A;  1NJX A;  2G8F A;  5CZ1 A;  1EX4 A;  5JVH L;  2PBD A;  2FSK A;  1BI4 A;  4BRC A;  1ZBF A;  3NF7 A;  5JVG L;  3CJ7 A;  4HTU A;  1D9F A;  1YTA A;  3H6E A;  3SYZ A;  1ZBL A;  1YJN N;  3MXI A;  3HJF A;  4HWI A;  1VSM A;  3K5O A;  3TAG A;  1HPZ A;  1QZ5 A;  3AAQ A;  4FLZ A;  3DXM A;  4Y0W A;  1QQO A;  5HLF A;  4BAC A;  1QHA A;  4B3O A;  3K9K A;  1IO2 A;  4E89 A;  1RNH A;  1TL1 A;  4F2S A;  4O4G A;  1S1U A;  4WQ5 C;  2DTU A;  3PX6 A;  4YOV A;  4XH4 A;  2O8C B;  2Z1H A;  1VSJ A;  4Q0B A;  1J5O A;  3D2F A;  3OYG A;  3E1Y A;  4MO4 A;  3D6R A;  3ID6 A;  3NH2 A;  3CCJ N;  3MX5 A;  3U3Y A;  3AAR A;  5F2R A;  4NXN K;  2W42 A;  2HMP A;  4JNE A;  4CGG A;  3KVG A;  4KHY A;  2D1K A;  4PA1 A;  3IAY A;  3LP3 A;  2FBX A;  3UKR B;  5LJW A;  3TI0 A;  4PUO A;  2FF6 A;  3LP0 A;  3CG7 A;  4ICL A;  2GV9 A;  2VG6 A;  2DFF A;  3FFK B;  3L3V A;  2OTJ N;  3LAL A;  4DR5 K;  3Q7C A;  4FJ8 A;  4CJL A;  2DY4 A;  1U4B A;  5ADX A;  1EKE A;  1JCG A;  1N32 K;  4DB3 A;  3FZH A;  3SJH A;  3FZM A;  4M42 A;  3VEY A;  3ZSV A;  3BEX A;  5DM6 L;  4DFJ A;  3W0L A;  4DSL A;  2NRR A;  3SQ2 A;  4NCB A;  3LDN A;  4DR3 K;  2O8C A;  2BH1 A;  5AQX A;  3KK3 A;  4IOC L;  5EY4 A;  1SL1 A;  3BP8 A;  5BR8 K;  4JYA K;  5TKY A;  2RN2 A;  1RIL A;  2G8V A;  2WFB A;  2WOM A;  2F8T A;  4FZY A;  4A2B A;  3KWI A;  4CGJ A;  3HST B;  3OVN A;  3VQC A;  3J7Y P;  3O9S A;  2QXL A;  1RFQ A;  3OS2 A;  3TAP A;  1A5V A;  3TTF A;  2FC0 A;  1WBB A;  1FKP A;  4H03 B;  3ZYY X;  2V7Y A;  3N4Q A;  3QLH A;  2JWL A;  3ZT1 A;  1Z6R A;  1QHT A;  3ULE B;  1WUA A;  1DKG D;  3ENH A;  1BCO A;  1CZA N;  2HBM A;  3KTQ A;  1GOC A;  1NKB A;  1JLE A;  4FWR A;  1RBS A;  4B08 A;  4CEF A;  4FO0 A;  4R5P A;  1IG9 A;  3L3U A;  1JLF A;  1BDG A;  3OYF A;  3MN7 A;  4O8K A;  2OPP A;  1D5A A;  3RMB A;  4CJK A;  3LWM A;  3VQP A;  1VQ7 N;  4B1W B;  5C25 A;  1IV0 A;  1EP4 A;  4DLG A;  2A6A A;  1QQN A;  3HPG A;  3CM6 A;  4EP4 A;  4Z0U A;  3KK1 A;  2E8A A;  3G25 A;  3D45 A;  3DRS A;  1WB9 A;  2OAN A;  4OLA A;  1E4F T;  2FBT A;  2OCE A;  1BOT O;  4BRK A;  1ZBU A;  1UWB A;  3O9U A;  3ULE A;  4CK3 A;  4FLX A;  4F8R A;  3EZ5 A;  3KD1 E;  2O8D A;  1RCH A;  5FRO A;  4IG3 A;  2VQF K;  3P5J A;  3AVA A;  3BZC A;  3P38 A;  2NNW A;  4HHT A;  3E9O A;  2NZT A;  3QEP A;  1M1K O;  2A1S A;  1R59 O;  1BHL A;  3VQD A;  3Q7B A;  3KJV A;  4BVO A;  3DRP A;  1KLN A;  4Y1D A;  1QSS A;  4CHZ A;  4OPJ A;  3RR7 A;  3CCR N;  4QAG A;  4B3S K;  2F9T A;  4M3U A;  4WFB L;  4JI3 K;  1RT6 A;  3GE1 A;  4Z4H A;  4X62 K;  3AVN A;  4FOE A;  4O0J A;  5SZT A;  1U45 A;  3DOL A;  3HRG A;  3CFR A;  3V1R A;  3CMA N;  4DTX A;  1EXQ A;  4DSJ A;  2B6A A;  3ULD A;  4E7I A;  4LFC K;  1T6C A;  1HMV A;  4CD3 A;  2OPR A;  3OY9 A;  2EX3 A;  2E2Q A;  4JKF A;  1BIU A;  3MMV A;  4IG0 A;  4F3T A;  5GAH P;  5KTQ A;  2BE2 A;  5AR0 A;  4DHY A;  1SQK A;  1RDC A;  3THW B;  1U6Z A;  4FWQ A;  1WSH A;  4CE9 A;  3TR8 A;  4KHU A;  1RTJ A;  3AVG A;  4DSF A;  4DV1 K;  4DUY K;  1Q81 O;  4OLB A;  5HRP A;  2WON A;  5LMU K;  1BU6 O;  1KAY A;  1QVF M;  2G8K A;  4XH5 A;  2P51 A;  3VQ9 A;  4M7Y A;  2HW3 A;  3CQ8 A;  4DTJ A;  5CR4 A;  3SQ4 A;  1U48 A;  1OVQ A;  3T3F A;  1BIS A;  3HVR A;  2QWM A;  4GY2 B;  5BN8 A;  5C10 A;  4DV3 K;  2P9U A;  1N8R O;  4DTS A;  1RTD A;  1BG3 A;  1KC8 O;  4CJ4 A;  2D0O A;  1QSL A;  5AQP A;  3LDL A;  2IVP A;  3IDH A;  3O1B A;  4FWL A;  3M8S A;  1K73 O;  1Y64 A;  1MU2 A;  1G99 A;  5FLX O;  4WF9 L;  3NCI A;  2QWR A;  4ID1 A;  1HKG A;  4FWP A;  3QNN A;  3O4N A;  3K59 A;  4I9L A;  1NGG A;  4IJA A;  4BGA A;  3QIP A;  2CGJ A;  4OKK A;  2FXU A;  4IFV A;  2PFU A;  1TK5 A;  1TK0 A;  2OA8 A;  4JK7 A;  3O3G A;  4GV3 A;  4CIF A;  4DTN A;  1S6Q A;  3HM9 A;  4DV4 K;  3WEE A;  4WE1 A;  1K8K B;  4M63 C;  1DTT A;  2ZQB A;  1QVG M;  3FZF A;  3HK2 A;  3DYA A;  4CHQ A;  3L2V A;  1T7P A;  4IJN A;  1BIZ A;  1K8A O;  4X66 K;  1S72 N;  4DSI A;  1HNV A;  4YOX A;  2PAV A;  4CJ3 A;  1LWE A;  3QML A;  1GOA A;  4AH9 A;  5AZI B;  3FR0 A;  1OH7 A;  2HBJ A;  2D5R A;  4G9Z A;  4OPA A;  2GEM A;  1BQM A;  3O80 A;  1HR0 K;  4ISF A;  4B9S A;  1P8Z A;  3D2E A;  4EZ6 A;  1KVB A;  2QWL A;  3VER A;  5BRF A;  3WT0 A;  4FK0 A;  2CH6 A;  4ELT A;  5JS1 A;  4YOY A;  4HUE A;  3RR8 A;  3VGM A;  5KRT A;  3ZSO A;  3C6A A;  4H5R A;  3ZSZ A;  3QNO A;  4CGD A;  1NNE A;  5AQQ A;  3DRR A;  5J2Q A;  3K57 A;  1NKE A;  1X3N A;  2NRT A;  3NGY A;  2E2N A;  1BQN A;  2RHK A;  1YT3 A;  4YOT A;  1TKD A;  5T7B A;  4I9Q A;  3DWL A;  3RSE A;  1NU0 A;  5HRS A;  2NRH A;  3NHG A;  3RRH A;  3SUN A;  4M45 A;  1IKX A;  3QIO A;  1HYV A;  3VN5 A;  1VQL N;  2VGM A;  3TTD A;  4CFA A;  3VA3 A;  1WSI A;  1KXP A;  1W9H A;  1CXU A;  1GLC G;  1JCE A;  4FZZ A;  2D0P A;  3DAW A;  3CCM N;  2YI1 A;  4BVP A;  2NRW A;  1UAX A;  2E2O A;  1TAQ A;  1FKO A;  3ZT2 A;  4CJ7 A;  3VOV A;  3JS6 A;  1TL3 A;  4QS9 A;  4L8R B;  3MEG A;  4FM2 A;  1JLA A;  2E2P A;  3NGZ A;  4BR2 A;  4E7H A;  1JJ2 M;  3LM2 A;  3VPZ A;  1NGI A;  3JYT A;  3ZT3 A;  4NLB A;  4IDK A;  4JRQ A;  4A61 A;  3TAF A;  1NM1 A;  3NGI A;  4XIU A;  1WSG A;  2Q36 A;  2QK9 A;  2HHW A;  2ASM A;  3KLH A;  5SWM A;  3FZL A;  4DV5 K;  4DSE A;  2J4R A;  3HI0 A;  3QFU A;  4DR6 K;  5KI6 A;  1E3M A;  2FBY A;  1X9W A;  4N47 A;  3PY8 A;  2BAN A;  3C0B A;  3F9K A;  4I7F A;  3LAK A;  2I7N A;  1S5J A;  1I3A A;  4BR0 A;  1HKB A;  4AIL C;  3OYA A;  3SZ2 A;  1YF5 L;  3KZB A;  2XY5 A;  3QDK A;  3T7Z A;  2YNI A;  1E4G T;  4WFN L;  3OA9 A;  2HST A;  4OO1 J;  3NAE A;  1NK7 A;  3H1V X;  3VEW A;  3C6H A;  4JI0 K;  3I56 N;  4FM1 A;  1NGJ A;  5IWA K;  1U2V A;  4CJS A;  4GV6 A;  3HTV A;  3MCA B;  1D9D A;  1NK0 A;  4BRH A;  4CK1 A;  4WQ4 A; 
#chains in the Genus database with same CATH homology
 3WNH A;  1LWF A;  4Q5V A;  5HLF A;  4BAC A;  4B3O A;  4CJP A;  1C0T A;  1IO2 A;  4BE0 A;  4E89 A;  1TK8 A;  4ELV A;  1RNH A;  1Q9X A;  5J2P A;  4W5N A;  1TL1 A;  3V6D A;  4F2S A;  4O4G A;  1JKH A;  4CEA A;  1S1U A;  3PV8 A;  2KFZ A;  4CES A;  2DTU A;  4DQI A;  1UOC A;  3PX6 A;  1IKW A;  2Z1H A;  1VSJ A;  4Q0B A;  1CXQ A;  1QQC A;  1J9A A;  3QEI A;  1J5O A;  4N76 A;  4Z4C A;  4DU4 A;  3AVI A;  3OYG A;  4B9L A;  1ASW A;  3NH2 A;  4ZTJ A;  1S6P A;  1C6V A;  3U3Y A;  3K2P A;  1G15 A;  4CHN A;  2W42 A;  4CJQ A;  3MXM A;  1LAW A;  1T05 A;  4J2A A;  4CGG A;  2IS3 A;  2YV0 X;  5CZ2 A;  4KHY A;  4KHS A;  3IAY A;  4PA1 A;  1RT5 A;  3LP3 A;  2FBX A;  3ZT4 A;  2HVH A;  2HHX A;  3TI0 A;  4PUO A;  3LP0 A;  4FVM A;  4RW6 A;  4HUG A;  4BDZ A;  3QET A;  3PX0 A;  3CG7 A;  4ICL A;  2GV9 A;  3MXJ A;  4Z4I A;  2VG6 A;  4CFB A;  1TVR A;  2DFF A;  4BE2 A;  1RTH A;  2QXF A;  3L3V A;  3OS0 A;  1CZ9 A;  3LAL A;  4B9V A;  4N41 A;  1XHZ A;  3PO4 A;  1JLG A;  1TKX A;  4OGC A;  4FJ8 A;  4RG8 A;  2D0B A;  4CJL A;  4KI4 A;  2DY4 A;  2XY8 A;  3AO3 A;  2Y1J A;  1U4B A;  2X6S A;  1NKC A;  4DU3 A;  1EKE A;  4EP5 A;  3DOK A;  3VQ6 A;  3MEC A;  2XO7 A;  1I39 A;  2Z1I A;  2KW4 A;  3VQA A;  1VRT A;  2VG5 A;  3TAE A;  4M42 A;  4YFU A;  4J2B A;  4PQU A;  3ZSV A;  4O0I A;  3CFP A;  3V1Q A;  2QKK A;  3OYL A;  5DK5 A;  3HO1 A;  4DFJ A;  3PX4 A;  1L5U A;  4CEO A;  4KHQ A;  2IGI A;  4DSL A;  1BL3 A;  3SQ2 A;  4NCB A;  4QOZ B;  4ELU A;  3VA0 A;  3EYZ A;  3RRG A;  3KK3 A;  1LAV A;  4E1M A;  2VG7 A;  1L3T A;  1BGX T;  1SKS A;  1SL1 A;  1RT4 A;  5KRS A;  3IRX A;  3SQ1 A;  1FXX A;  2GBZ A;  4HUF A;  4FW2 A;  4C8N A;  1RTI A;  2RN2 A;  2ETJ A;  4HVJ A;  4E7L A;  3AVB A;  1RIL A;  2G8V A;  4EZ9 A;  5CYM A;  4E19 A;  2WOM A;  5K14 A;  4Z4G A;  2RPI A;  1EET A;  1TGO A;  2F8T A;  4E0D A;  2XRI A;  2ZD1 A;  1JXB A;  1XHX A;  5CYQ A;  4CJW A;  4C8O A;  4FZY A;  1ASU A;  3LDS A;  1CLQ A;  4CGJ A;  4E3S A;  3HST B;  3OVN A;  3VQC A;  2IOC A;  3VQ8 A;  3TAP A;  1Q8I A;  3OS2 A;  3HT3 A;  1A5V A;  3C6U A;  5C24 A;  3HVT A;  2FC0 A;  1FKP A;  2VWK A;  2RF2 A;  3I8D A;  3DLG A;  3QLH A;  1KFD A;  3ZSQ A;  1J54 A;  1NK9 A;  1ZYQ A;  1TAU A;  2D0C A;  3ZT1 A;  4B9T A;  3TAR A;  2B5J A;  1QHT A;  4MFB A;  3KD5 E;  2OPS A;  3RMD A;  1BCO A;  3OS1 A;  2XHB A;  3KTQ A;  1GOC A;  1SL0 A;  1NKB A;  3PO5 A;  1JLE A;  4CF2 A;  1C1B A;  4G1Q A;  1RBS A;  4B08 A;  4CEF A;  4R5P A;  1SKR A;  1C0M A;  2D0A A;  1IG9 A;  1QSY A;  3L3U A;  1JLF A;  3ALY A;  4CER A;  3OYF A;  3ZSX A;  3PUF A;  3M8R A;  3L2U A;  3S3N A;  3VQE A;  2HND A;  2OPP A;  3VQQ A;  1XC9 A;  4DTM A;  1D5A A;  4NYF A;  3RMB A;  4AHR A;  4CJK A;  3VQ4 A;  2Y1I A;  2AJQ A;  1W0H A;  4W5Q A;  4DWI A;  3LWM A;  3S3O A;  4OGE A;  1HQU A;  1REV A;  1WSF A;  3VQP A;  2JGU A;  1C0U A;  1WNS A;  5C25 A;  1EP4 A;  1LW0 A;  4DLG A;  3SQ0 A;  4JS4 A;  2HHS A;  3O3H A;  1L3U A;  3HPG A;  3CM6 A;  4EP4 A;  2KZM A;  4Z0U A;  3KLI A;  3KK1 A;  4OLA A;  3D45 A;  3DRS A;  5J2M A;  4CEQ A;  4C8K A;  4BDY A;  1S1X A;  2LSN A;  5D3G A;  1LV5 A;  1RT7 A;  2FBT A;  2YNF A;  3SV4 A;  4CCH A;  4KHW A;  3M8P A;  3K58 A;  3SUP A;  4DF8 A;  2P5O A;  2Z1J A;  3HP9 A;  4M3T A;  4DU1 A;  1ZBU A;  3M8Q A;  1UWB A;  4TSX A;  4GMJ B;  1LW2 A;  3RTV A;  3SI6 A;  4J2E A;  4GW6 A;  4CK3 A;  3NH1 A;  4FLX A;  2PYL A;  4F8R A;  4HCC A;  4M41 A;  2PY5 A;  3AVJ A;  1SL2 A;  3EZ5 A;  3KD1 E;  3CYM A;  4CEZ A;  1RCH A;  5FRN A;  5FRO A;  4IG3 A;  3SPZ A;  2OYQ A;  4E1N A;  4B8C A;  4K8Z A;  3K5M A;  3P5J A;  3AVA A;  2E4L A;  2YNH A;  3A2F A;  1L3S A;  2HHV A;  3NBP A;  4HHT A;  1X9M A;  1CZB A;  1HYS A;  3QEP A;  1XI1 A;  3RMA A;  3S9H A;  2HNZ A;  4JLH A;  5J2N A;  2A1S A;  1BHL A;  1JXE A;  4C8M A;  3NDK A;  3VQD A;  2XY7 A;  3TAB A;  3KJV A;  3DRP A;  1KLN A;  3K5N A;  4DSK A;  1ASV A;  3ZSW A;  3C95 A;  4Y1D A;  2QKB A;  1QSS A;  3DLR A;  3I0S A;  3NF6 A;  5EU7 A;  5E41 A;  3OYI A;  3LPT A;  4CHZ A;  4OPJ A;  3OJU A;  5FDL A;  3RR7 A;  3SUQ A;  3VQB A;  1N5Y A;  4QAG A;  4ID5 A;  2R7Y A;  1D8Y A;  4W5O A;  3AO5 A;  4M3U A;  1RT6 A;  3TAM A;  4Z4H A;  4B9M A;  1C1C A;  4H4M A;  3KK2 A;  3AA3 A;  3AVN A;  1TKT A;  4O0J A;  1SKW A;  5SZT A;  1U45 A;  4CJR A;  3MED A;  3QIN A;  1WLJ A;  3DOL A;  3UIQ A;  3MEE A;  3CFR A;  2KQ2 A;  4CEC A;  3V1R A;  1RDA A;  4RW8 A;  1KRP A;  5CY4 A;  2A1R A;  4KTQ A;  1JLQ A;  4DTX A;  1EXQ A;  3KKS A;  4MQ3 A;  4DSJ A;  1Z25 A;  2B6A A;  3ULD A;  4E7I A;  4CEB A;  1VK0 A;  2X78 A;  4CJE A;  5DMR A;  1HMV A;  4FLT A;  2OPR A;  3OY9 A;  2EX3 A;  1LWC A;  3WNF A;  3V9S A;  1BIU A;  4IG0 A;  3OJS A;  4F3T A;  2HVI A;  3C94 A;  1YTU A;  5KTQ A;  3KLE A;  4FLY A;  2BE2 A;  3V81 A;  3KIO A;  4FJJ A;  1RDC A;  4KTW A;  2I5J A;  3EY1 A;  4CE9 A;  1WSH A;  3H08 A;  4LD0 A;  3TR8 A;  4IKF A;  4KHU A;  1RTJ A;  3AVG A;  4CGF A;  4YNQ A;  4DSF A;  4RW9 A;  3HPO A;  4OLB A;  3WNG A;  2WON A;  5HRP A;  4FZX C;  1ZBI A;  3AVM A;  4H8K A;  4FJM A;  4BDP A;  3C6T A;  4F2R A;  3RMC A;  3T1A A;  4CHO A;  1RBU A;  3DLB A;  4I2P A;  3SPY A;  2G8K A;  4J2D A;  4FJ5 A;  2P51 A;  3VQ9 A;  2HW3 A;  4KV8 A;  2ZE2 A;  3CQ8 A;  1KFS A;  3AVF A;  4KKO A;  4DTJ A;  1WSE A;  4LY7 A;  3SQ4 A;  1U48 A;  2Z1G A;  4CIE A;  4KHN A;  3T3F A;  1BIS A;  3HVR A;  3O4Q A;  3AVH A;  4OPK A;  4CF1 A;  4F4K A;  1NJY A;  3QO9 A;  3DLK A;  4FLU A;  4DTS A;  4RW7 A;  3DMJ A;  2P5G A;  1WAJ A;  4OJR A;  1WN7 A;  1XWL A;  4CFD A;  4M3Z A;  1RTD A;  4LSL A;  3OYD A;  4LSN A;  4FK2 A;  4M3R A;  4CJ4 A;  2VWJ A;  4LH4 A;  5HBM A;  1QSL A;  1S1V A;  3ISN C;  4M3X A;  4Z4F A;  4LH5 A;  4KI6 A;  3ZT0 A;  3L2R A;  1O1W A;  5HRN A;  4B8A B;  3M8S A;  4DTU A;  1QTM A;  2BDP A;  1MU2 A;  4GVM A;  2JLE A;  3JSM A;  4QCL A;  1KSP A;  3NE6 A;  3NCI A;  3VQ5 A;  3O3F A;  4O44 A;  1BCM A;  3ZCM A;  3IG1 A;  4ID1 A;  4Z4E A;  4DTO A;  2YNG A;  3ASM A;  3QNN A;  3O4N A;  4FXD A;  1B92 A;  3K59 A;  4I9L A;  3QEX A;  3I0R A;  4CJF A;  1SUQ A;  2GUI A;  1B9D A;  3QIP A;  2KFN A;  3BGR A;  1N6Q A;  4OKK A;  2E6M A;  1TV6 A;  4BWJ A;  4E7J A;  4DFK A;  2F8S A;  4IFV A;  1TK5 A;  1TK0 A;  2OA8 A;  3THV A;  3DLE A;  3O3G A;  4CIF A;  1JL1 A;  4DTN A;  1NK8 A;  1S6Q A;  2FBV A;  3HM9 A;  3AA4 A;  4FJ7 A;  4WE1 A;  1SV5 A;  4OKJ A;  3LWL A;  1DTT A;  2YHA A;  2ZQB A;  3OYH A;  1Q9Y A;  3DYA A;  2PZS A;  3HK2 A;  2HMI A;  3HXM A;  4CHQ A;  3SUO A;  3L2V A;  3OYN A;  3AA2 A;  3AVL A;  1T7P A;  4CK2 A;  1DTQ A;  4DQQ A;  3MAQ A;  1UA1 A;  4FYD A;  3AV9 A;  4CFC A;  4CJT A;  3V9X A;  1BIZ A;  2F96 A;  3LPU A;  2DFE A;  3U3G A;  2IDO A;  2G8U A;  4CJ5 A;  4FJI A;  3ZSY A;  1RBR A;  4DG1 A;  5J1E A;  4DSI A;  1HNV A;  2B4J A;  1U49 A;  4CJ3 A;  4O55 A;  1LWE A;  1WAF A;  1GOA A;  4AH9 A;  4CGH A;  3V9U A;  3QER A;  1NJZ A;  2D5R A;  4AHU A;  4DS4 A;  1S9G A;  1KCF A;  3RWU A;  1VRU A;  4NCG A;  4FJX A;  2YHB A;  3WNE A;  1BQM A;  1IKY A;  3P1G A;  2P1J A;  5C42 A;  3AVC A;  3TWH A;  1JL2 A;  4OVL A;  4B9S A;  4AHS A;  4DFM A;  1X9S A;  3OYK A;  1FK9 A;  4EZ6 A;  4FCY A;  1KVB A;  1RT1 A;  1KVC A;  1NJW A;  4K8X A;  1QS4 A;  4FK0 A;  4ELT A;  4KTZ A;  5JS1 A;  1S1T A;  2HB5 A;  1KTQ A;  1T8E A;  2G8I A;  3B6P A;  4ZHR A;  4HUE A;  3RR8 A;  5KRT A;  3LAN A;  1S9E A;  3ZSO A;  5HRR A;  1QE1 A;  4KB0 A;  3ZSZ A;  3CFO A;  3QNO A;  4N5S A;  1VSK A;  4H4O A;  4CGD A;  4CIG A;  4DQP A;  3IS9 A;  3DRR A;  1L3V A;  5J2Q A;  3K57 A;  1NKE A;  1WSJ A;  3KLF A;  1RDD A;  4B9N A;  3NGY A;  3AO4 A;  3HPH A;  1BQN A;  1HQE A;  1VSD A;  4CEE A;  1T03 A;  4CHY A;  5JS2 A;  2G8W A;  3DM2 A;  1YT3 A;  4PWD A;  4FK4 A;  1RBV A;  2HHU A;  1GOB A;  3OYC A;  2IC3 A;  3V4I A;  2PYJ A;  1TKD A;  5T7B A;  1ZBH A;  4I9Q A;  1NOZ A;  2X6N A;  4FLW A;  4CJV A;  4N56 A;  5KGX A;  5HRS A;  3QEW A;  3V9W A;  3TAQ A;  3OYM A;  4NYN A;  4W5T A;  4FJH A;  1NK4 A;  1KLM A;  3NHG A;  1VSL A;  3RRH A;  3SUN A;  3ZSR A;  2KZZ A;  3QES A;  1HNI A;  5HP1 A;  3P83 D;  1NK6 A;  4DFP A;  4M45 A;  1IKX A;  3AA5 X;  3QIO A;  4BWM A;  1HYV A;  3G10 A;  3VN5 A;  3E01 A;  1RT3 A;  3L8B A;  4C8L A;  2BGG A;  3TAN A;  4FW1 A;  4KRE A;  3L2Q A;  3U6F A;  4CFA A;  1HYZ A;  3VA3 A;  1WSI A;  1W9H A;  3NFA A;  4DQR A;  1RT2 A;  2NUB A;  1CXU A;  3SJJ A;  4BE1 A;  4FZZ A;  4DF4 A;  5HRO A;  4DQS A;  1X1P A;  5I42 A;  3VQ7 A;  3HP6 A;  3CM5 A;  1UAX A;  2ATQ A;  3SNN A;  4O5B A;  1TAQ A;  4FLV A;  3L2W A;  1FKO A;  1Y97 A;  2IAJ A;  3DLH A;  3QEV A;  1NOY A;  4M3W A;  4DLE A;  3ZT2 A;  1VSF A;  1VSE A;  4ZTF A;  1UA0 A;  4FJN A;  1VSH A;  1JLC A;  1TL3 A;  4L8R B;  4FM0 A;  3MEG A;  4FM2 A;  4KRF A;  4E7K A;  1JLA A;  4AHV A;  3LP1 A;  2ITG A;  2O4I A;  2DFH A;  3NF8 A;  3NF9 A;  4CF0 A;  2OPQ A;  4KB1 A;  3V9Z A;  4CED A;  1BI4 B;  4KPY A;  4FJK A;  4PY5 A;  3NGZ A;  4AHT A;  4E7H A;  2KTQ A;  4B9U A;  3OYB A;  3K5L A;  1J53 A;  1R0A A;  4CHP A;  2XY6 A;  3JYT A;  3ZT3 A;  3KKR A;  3DI6 A;  4IDK A;  4JRQ A;  1HRH A;  1B9F A;  3TAF A;  1A5W A;  1YVU A;  1VSI A;  3V1O A;  3AVK A;  3NGI A;  4FJ9 A;  3FFI A;  4XIU A;  1RDB A;  1WSG A;  2RKI A;  5I3U A;  2QK9 A;  3HL8 A;  2HHW A;  3LP2 A;  3KLH A;  5SWM A;  2O4G A;  4DSE A;  4W5R A;  2YKN A;  3B6O A;  3AO2 A;  1TKZ A;  4FJG A;  3HYF A;  4NCA A;  1C1A A;  3G0Z A;  4KAZ A;  3OYE A;  3LAM A;  1S1W A;  5KI6 A;  4AHC A;  4CJU A;  3KLG A;  3F73 A;  4HCB A;  3T19 A;  2FBY A;  1X9W A;  4N47 A;  3SCX A;  3PY8 A;  3S3M A;  4DTP A;  2BAN A;  2OZM A;  2HHT A;  1Z26 A;  2HHQ A;  3F9K A;  2G8H A;  1U04 A;  4JS5 A;  1HJR A;  4I7F A;  3LAK A;  4DTR A;  4UQG A;  1IKV A;  1U47 A;  1S5J A;  1NK5 A;  1A5X A;  2HNY A;  1I3A A;  3OYJ A;  4AIL C;  3OYA A;  1F21 A;  3BDP A;  4F3O A;  1NJX A;  2G8F A;  3SZ2 A;  3ITH A;  1EX4 A;  2EHG A;  5CZ1 A;  2XY5 A;  4CF8 A;  4CGI A;  2X74 A;  1JLB A;  1DLO A;  4KFB A;  4DMN A;  3NH0 A;  4DS5 A;  2YNI A;  4FJL A;  1K6Y A;  4Y1C A;  5FRM A;  1RBT A;  1BI4 A;  4IFY A;  4M3Y A;  1IH7 A;  1ZBF A;  3NF7 A;  4KO0 A;  3LZI A;  4HTU A;  1D9F A;  3NAE A;  1YTA A;  2Q3S A;  2YKM A;  3LZJ A;  3SYZ A;  1ZBL A;  1NK7 A;  3SV3 A;  4OKE A;  1ITG A;  4I2Q A;  4FM1 A;  4JRP A;  4IBN A;  5KGW A;  3D0P A;  4CJS A;  3MXI A;  3HJF A;  2OZS A;  1VSM A;  3K5O A;  4RW4 A;  1HPZ A;  3TAG A;  1D9D A;  1NK0 A;  4FLZ A;  1KVA A;  2E6L A;  4CK1 A;  4CF9 A;  3AO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...