3MXJA

Crystal structure of the mtrex1 apoprotein
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
229
structure length
210
Chain Sequence
b'LPHGHMQTLIFLDLEATGLPSSRPEVTELCLLAVHRRALEPPVPRPPRVVDKLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAALKALEQKSYSLGSIYTRLYWQAPTDSHTAEGDVLTLLSICQWKPQALLQWVDEHARPFSTVKPMYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Three prime repair exonuclease 1
publication title X-ray Crystal Structures of TREX1 3' Exonuclease Autoimmune Disease Mutants
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 71
structure length 210
sequence length 229
chains with identical sequence B
ec nomenclature ec 3.1.11.2: Exodeoxyribonuclease III.
pdb deposition date 2010-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3mxjA01
1HJRA 1LWFA 1S1UA 3HSTB 3AO4A 3LP1A 3C6TA 2DFHA 1D8YA 3PO5A 4PY5A 4EZ6A 3S3NA 1WSIA 4CGFA 1B9DA 4KPYA 3DRRA 1X9MA 3DRSA 2YNIA 4CFAA 1L3TA 4E7KA 4ELUA 4CEBA 4KHWA 3ZSXA 4KTZA 3QNOA 1LV5A 1C6VA 4N47A 4BE1A 4HTUA 3TAQA 4DFKA 4CHQA 5FRMA 4N41A 1HPZA 2GUIA 2HNDA 3EZ5A 4FK0A 5HRRA 3QESA 3SUQA 1NJYA 1T7PA 1RT5A 4CEQA 1TVRA 3NCIA 3ZT0A 1HYSA 4F2SA 1RBUA 4LD0A 4BE2A 1LW0A 2ITGA 3ZSWA 3U6FA 4B9TA 1S1WA 4AHRA 1FK9A 4CCHA 4KTQA 1RTJA 3OYBA 3VQ8A 3RMDA 2WONA 3ZT1A 4CHYA 2RKIA 1JLGA 5FDLA 1D5AA 4KREA 3I0SA 4OLBA 4KHYA 4FJ5A 4EP4A 2HHVA 2KQ2A 4CJLA 1FKPA 1U49A 1W0HA 4OGCA 1NK7A 1WSEA 3IRXA 4O0JA 4CK1A 4BE0A 3AVBA 1R0AA 1ZYQA 3BGRA 3DLHA 4KRFA 1NKEA 3ITHA 3EY1A 1CXQA 3V81A 5J2MA 3MXMA 5E41A 3OYHA 1TK5A 2OPPA 1RNHA 3AVJA 3K5OA 2XY6A 1KTQA 1XC9A 3ZSZA 3U3GA 1TL1A 1B92A 3TAPA 4CESA 3B6OA 1SV5A 3TABA 3SJJA 4O4GA 4IFYA 2RN2A 4KI4A 1TAUA 4CFDA 2LSNA 4LH5A 4CEFA 3HT3A 4PWDA 4HUEA 2HW3A 3SZ2A 4Z4CA 4IBNA 1RT6A 1RT2A 4FM0A 1TK0A 5SWMA 3KLHA 3TAEA 4BDPA 4JLHA 5KTQA 1EXQA 4DTUA 1LAWA 3AVIA 3P5JA 4Y1CA 3L2RA 3QIPA 4FXDA 1QQCA 5FROA 5C25A 1Z26A 4DSKA 1ZBFA 4M3RA 4CHZA 2O4IA 1Y97A 4ELVA 4E7JA 1QHTA 4KB0A 3CFPA 3QEIA 1VRUA 4CJFA 4DTXA 1IKWA 1JLFA 4DG1A 1VK0A 5CYQA 4CJUA 2FBVA 2Z1JA 4B08A 3K5MA 4CFCA 3RMCA 3I8DA 2IS3A 5CYMA 2E6LA 2Q3SA 1A5WA 3AVMA 3OYFA 4KHUA 1QTMA 2VWJA 4AHCA 1HQUA 4BACA 3L3VA 1GOBA 1TKZA 2RPIA 1VSMA 3LWMA 3OYMA 1BI4B 1TL3A 1FXXA 3LP0A 1SKSA 1CLQA 4RW4A 4DLEA 4NYNA 1WSHA 1SUQA 2KZMA 3AA2A 3VQPA 3KK3A 2B4JA 3C6UA 3D0PA 1C1CA 4FLTA 1TKTA 4DSEA 1VSKA 1TKDA 3OYGA 1NK5A 3OY9A 3QERA 2PYJA 4CECA 1NKCA 5HP1A 4C8LA 3O4QA 4AHVA 3KKSA 4YFUA 2Z1IA 3HPGA 1CZ9A 3KLGA 3PX6A 5HBMA 3AVLA 2OYQA 4KHQA 3QEPA 2G8VA 2OZSA 3AVFA 2P51A 2A1RA 1ZBHA 4CEEA 4KAZA 3V9XA 3LAKA 3MXIA 4CGHA 4IG3A 5I42A 3VA3A 2YHBA 3OYKA 3AO1A 4C8NA 4J2AA 1BCOA 1TKXA 4CGDA 3O4NA 3S3MA 3RMAA 2G8IA 3SYZA 3AVHA 5HRPA 3AV9A 1NJXA 4FZYA 4FK2A 3K59A 4DQIA 2EX3A 3MAQA 3SUOA 3SQ1A 3L2VA 3MEDA 1RDBA 2XRIA 4DWIA 2AJQA 4CGGA 3ZT2A 2G8UA 4L8RB 1WSGA 5C42A 3HM9A 1SL1A 3RR7A 3EYZA 3HXMA 1ZBLA 2G8KA 2HHSA 1Q9XA 3FFIA 4B9LA 4DF8A 2QKKA 1KVBA 4E0DA 1GOAA 4NCAA 3PO4A 4M3WA 1EKEA 2RF2A 2ZE2A 1ASVA 4I2QA 3V4IA 3MEGA 1NJWA 4F3OA 2F8TA 3VQBA 1YTUA 4FW1A 4TSXA 3OJSA 1IG9A 4CK3A 2DFFA 4B3OA 3KJVA 1EP4A 4QAGA 1S6QA 4CEZA 1C0TA 1G15A 3L2UA 1NK9A 2HHUA 4NCGA 4KB1A 1I39A 4W5RA 3P83D 3HP6A 3JYTA 3AA5X 3AVNA 4Y1DA 4B9MA 3MXJA 4CHPA 3SPZA 4KI6A 3LZJA 4H4MA 1Q9YA 3ZSYA 3VQAA 2HHXA 4CK2A 5I3UA 3QO9A 3F73A 3PV8A 1RBSA 1DLOA 4DS5A 2VG5A 3K5NA 3PX4A 3TAMA 3IAYA 4KHSA 1WLJA 4N56A 3HPHA 4IKFA 4DSJA 3PUFA 1YVUA 1RDAA 3T19A 1JL1A 1RT7A 1BL3A 2IOCA 3CQ8A 3TR8A 3M8RA 4K8ZA 1JLBA 3ZSQA 4O44A 4OPJA 4OPKA 4LSNA 3ASMA 4M3TA 2OPSA 4G1QA 5T7BA 3NGZA 4EZ9A 2BE2A 1IH7A 5HRSA 1RBRA 1CZBA 4CJVA 4B9UA 1RBVA 2O4GA 3V1QA 3SI6A 1DTQA 1QE1A 3G10A 1BGXT 3KD1E 2IC3A 4GVMA 3NHGA 1C0MA 3OJUA 3LP2A 4BWMA 2ZD1A 5KGWA 3TWHA 1BHLA 3OS1A 4K8XA 3RMBA 3ZCMA 1UA1A 4N5SA 4RG8A 2XY8A 1U48A 4ELTA 2DTUA 1XWLA 4AHUA 4J2DA 1KCFA 1VSFA 4DU4A 4CJSA 4HHTA 3B6PA 1QSSA 1I3AA 1YT3A 4E1MA 4BDZA 2IDOA 4DTMA 4ID5A 1JL2A 3IG1A 2OA8A 1QSYA 3ALYA 3NF8A 1S9EA 1VSDA 4OVLA 4OKEA 2G8FA 4JS5A 4CF0A 4M41A 4C8OA 4WE1A 1KSPA 4H4OA 4CJQA 4FZZA 4OLAA 1C1AA 1ZBUA 3DRPA 4O5BA 4RW6A 3NDKA 3OS0A 4ZHRA 4FLUA 1NJZA 3OYDA 2G8HA 4ZTFA 1T03A 5CZ1A 3DMJA 3WNGA 4FJHA 4FM2A 1TK8A 4OKJA 4DTRA 2HVHA 3SQ2A 2KTQA 4DTOA 4HCBA 3HVTA 3DLRA 3JSMA 3DLBA 2Z1HA 4CEAA 1BI4A 1L3VA 4B9VA 3SPYA 4DF4A 1WSFA 2PY5A 3OYLA 1BIUA 4FJIA 4KV8A 3VQ6A 3ULDA 1WSJA 4AHTA 2XY7A 3SV4A 4FYDA 1BQNA 4Z4HA 1KLMA 1U45A 1VSIA 1HYZA 1S1XA 4H8KA 1ASUA 1JLAA 2ZQBA 1KFDA 4CJWA 1NK8A 3TANA 3T3FA 1LWEA 3VN5A 3DM2A 1S1VA 4Z4IA 5JS1A 2OPRA 3OYCA 3SQ0A 3V1OA 1MU2A 2HMIA 2BGGA 1JXBA 2JLEA 1LW2A 1RT4A 3HK2A 3L2QA 3QETA 1K6YA 2HHQA 3TI0A 4F2RA 2FBTA 1UWBA 1NOZA 4NYFA 4CE9A 3WNEA 3KTQA 3CFOA 3K58A 1KVCA 3CM5A 4FCYA 4CIGA 3PX0A 4DTJA 1WNSA 2QXFA 1UA0A 1RTDA 2KFNA 2VWKA 3CG7A 4DQPA 1XHZA 3OS2A 1QS4A 3O3GA 3ZSVA 4E3SA 1NK4A 2YNFA 2R7YA 4M3YA 4Z4GA 2A1SA 3K5LA 3K2PA 2F96A 4UQGA 3HPOA 1T05A 1L5UA 2PZSA 4B9SA 2HHWA 2E6MA 1HMVA 1O1WA 3DI6A 4CF9A 1SKWA 1A5XA 2HB5A 2VG6A 1IO2A 4I7FA 1NK6A 3VQEA 1XHXA 2QK9A 5D3GA 5J2QA 3VQCA 4Q0BA 1BISA 4DU1A 4DTNA 1ZBIA 3LP3A 4FJJA 3BDPA 4AHSA 5CY4A 1N6QA 2QKBA 2E4LA 2EHGA 4YNQA 3NGIA 2FC0A 3O3HA 3LAMA 3VQ7A 4FVMA 1LAVA 2XHBA 5JS2A 4CIFA 3RR8A 4GW6A 1S1TA 4RW7A 3HYFA 1L3UA 4XIUA 1IKXA 4CHNA 4FK4A 1BCMA 2YV0X 1UAXA 2OPQA 3CM6A 3E01A 3M8QA 4CJ5A 2IGIA 4CJKA 3KIOA 3C94A 1L3SA 3NF7A 2W42A 1NOYA 4FJKA 3LALA 3DLGA 5K14A 1JLQA 4KHNA 2WOMA 2YNHA 4E7LA 2D0CA 3AA3A 2FBXA 3G0ZA 3IS9A 3L2WA 1C1BA 4IFVA 3NH2A 3HL8A 1QSLA 4DLGA 3LANA 2X78A 4J2EA 4FJXA 1RILA 3LPTA 4DQQA 1JKHA 1JXEA 4E19A 4FJLA 4CJEA 4GMJB 5KGXA 4HUFA 3TAGA 4M3XA 4JRPA 4HUGA 3ZT4A 4FJGA 3O3FA 1X9WA 4FJNA 1ASWA 3LZIA 4E7IA 3SNNA 2HNZA 3NBPA 4CGIA 4CJ3A 3CFRA 2D0BA 3DOLA 1Q8IA 1Z25A 3V9ZA 3UIQA 4HCCA 4DU3A 1KVAA 3LDSA 1RTIA 3NGYA 4I2PA 2KZZA 3NF6A 4CF1A 3F9KA 3AVKA 1F21A 4W5OA 4DTSA 1J53A 3DLKA 5DMRA 3KLIA 1HRHA 3ZSRA 2GBZA 2VG7A 2X6SA 5SZTA 2YKMA 3L3UA 2DY4A 1EETA 4FLYA 1RTHA 4KKOA 4LSLA 1KLNA 4DFJA 4ID1A 4FLWA 5C24A 3KK1A 2F8SA 3OYAA 3SCXA 3I0RA 1IKVA 3D45A 5FRNA 1JLEA 2KW4A 3ISNC 3NH1A 4AH9A 1T8EA 4RW9A 3RRGA 4E1NA 5KRSA 3V9SA 2BDPA 4N76A 3NE6A 3HP9A 3DLEA 4CFBA 1KRPA 3TAFA 4E7HA 3V6DA 1RT1A 2X6NA 2P5GA 4B9NA 3SUPA 4JRQA 3SQ4A 3VQ5A 4DSIA 5HRNA 2HNYA 4Z0UA 1S9GA 5KRTA 3MECA 2DFEA 3T1AA 4PQUA 3AO2A 3RRHA 1D9DA 3NF9A 4AILC 1S5JA 1S6PA 3KKRA 2PYLA 5KI6A 3RTVA 3QLHA 4DMNA 4B8AB 4W5QA 1LWCA 1IKYA 2GV9A 4O0IA 4DQSA 4IG0A 1U4BA 3OYIA 4CJ4A 1U47A 2OZMA 4C8MA 1X1PA 4CEOA 2YNGA 4DTPA 2G8WA 4FJ7A 3HVRA 5EU7A 2B6AA 4LY7A 4CEDA 1VSJA 3HJFA 3U3YA 3SV3A 4CGJA 3LWLA 4BDYA 4E89A 1VSHA 4CF2A 5DK5A 4FLXA 4DFMA 1VSLA 4I9LA 4OKKA 3OYJA 1VRTA 4O55A 3RWUA 2D0AA 1RDCA 4I9QA 3SUNA 2Y1JA 2P5OA 4CIEA 3S9HA 4M3ZA 1RT3A 2JGUA 4DQRA 3VQ4A 1WAJA 4Z4FA 1RDDA 3TARA 3AO3A 1HNVA 4DS4A 4RW8A 1TV6A 4M3UA 3C95A 2Z1GA 4B8CA 4M42A 3OYNA 2XY5A 2XO7A 1BQMA 1TAQA 4ZTJA 4OJRA 3KK2A 5J2NA 1JLCA 4NCBA 4QCLA 4LH4A 1J5OA 3VQQA 3QIOA 4CJTA 2NUBA 2YKNA 1J54A 4FLZA 3PY8A 2P1JA 3WNFA 5HLFA 4CJRA 3DYAA 2I5JA 4IDKA 3S3OA 3NAEA 1A5VA 4FJ9A 2HVIA 2ATQA 2HHTA 4FM1A 1ITGA 3OYEA 4C8KA 1UOCA 5J1EA 1WAFA 4F4KA 4Q5VA 1YTAA 3ZSOA 3L8BA 4FZXC 3QNNA 1DTTA 2FBYA 1FKOA 4MQ3A 4CJPA 4CF8A 1HNIA 3ZT3A 1J9AA 2Y1IA 3CYMA 4M45A 1N5YA 4CHOA 4JS4A 3AVGA 3M8SA 1VSEA 4FJ8A 3NFAA 1KFSA 1SKRA 1SL2A 2X74A 1NKBA 3HO1A 3P1GA 3AVAA 4CERA 4KFBA 1X9SA 1SL0A 3AVCA 4PA1A 3KLFA 1EX4A 1RCHA 1HYVA 3NH0A 1HQEA 1GOCA 4BWJA 1TGOA 3KD5E 3DOKA 2B5JA 4FLVA 1REVA 1RBTA 4W5TA 1C0UA 4OGEA 2KFZA 2YHAA 4FW2A 1D9FA 3VA0A 3A2FA 3QEXA 2ETJA 4R5PA 4KTWA 4QOZB 3M8PA 4MFBA 4KO0A 5CZ2A 4F8RA 1WN7A 2IAJA 4DSFA 3QINA 3VQDA 3H08A 3V1RA 3WNHA 1B9FA 3QEWA 4DSLA 4HVJA 3K57A 1XI1A 4Z4EA 3AO5A 3THVA 4DFPA 3V9UA 5HROA 1NK0A 4PUOA 4ICLA 3LPUA 1W9HA 3MEEA 3VQ9A 3V9WA 3KLEA 5J2PA 4FJMA 4EP5A 3AA4A 3OVNA 1U04A 2BANA 4W5NA 4J2BA 4F3TA 1CXUA 1BIZA 3QEVA 2D5RA
chains in the Genus database with same CATH superfamily
4YORA 2DFHA 1WOQA 3S3NA 1B9DA 3CJAA 4KPYA 4A5BA 3GBTA 4PL7A 4CEBA 3MN5A 1LV5A 1C6VA 3VF2A 3A8YA 4N41A 4DR1K 2HNDA 1T7PA 1TVRA 4A5AA 1ATNA 3ZSWA 4B9TA 3ZETB 4AHRA 4CCHA 2E2OA 5M1NA 5FDLA 3LDNA 2HHVA 3M6GA 1U49A 1W0HA 1NK7A 1K8KB 4BE0A 1XMOK 5M1QA 2HBJA 3EY1A 1CXQA 5J2MA 2ZJQL 3MXMA 4MO4A 2XY6A 4Z94A 3C7NA 1B92A 3TAPA 3VF4A 3B6OA 1SV5A 3CCUN 4O4GA 2H3GX 1TYQA 3VERA 1XQSC 4IBNA 1NGFA 1NGEA 3TAEA 3UE5A 4Y1CA 3AVIA 5FPDA 4FXDA 3TTDA 5BPLA 1Y97A 2VQFK 4DQ8A 4ELVA 4JHDA 4E7JA 3CFPA 5AZIB 3T7ZA 3WQTA 3R6MA 1KRPA 4C8KA 2FBVA 4B08A 3RMCA 3KZBA 1A5WA 3T69A 4AHCA 4JN4A 1TKZA 1S22A 2HF3A 3SMPA 1T6CA 1CLQA 2OCEA 4NYNA 4FOIA 3VQPA 1TKTA 4JNEA 4F9OA 3QERA 2UUBK 4B1YB 4C8LA 4BC4A 3PX6A 5HBMA 3AVLA 2OYQA 2G8VA 1OVYA 2P51A 3AVFA 2QTDA 3V9XA 3LAKA 3GL1A 5HL7L 3VA3A 2YHBA 3OYKA 1N36K 4CGDA 4JKAA 3RMAA 3SYZA 3AVHA 5HRPA 1QHAA 4FK2A 3AGRA 4DQIA 1BUPA 3SQ1A 4K41A 5AQPA 3L0QA 4BRDA 2P9PB 2QI2A 1RGIA 2E8AA 4CGGA 3ZT2A 1HNWK 4L8RB 3ENHA 3I33A 4U67L 1M1KO 1ZBLA 2G8KA 3ZLJA 3R1XA 2BTFA 3CCQN 4DF8A 2QKKA 3PO4A 2ZE2A 3MN7A 1N32K 5EOYA 3VQBA 4FW1A 4WFNL 2VQEK 2DFFA 3E9OA 4BY9C 5C10A 2HHUA 4KH5A 4KB1A 2O8BB 4H5VA 3CC2N 2HHHK 3MXJA 4KI6A 3LZJA 1VQKN 3PV8A 4DS5A 4JV5K 3HPHA 4DUZK 1YVUA 1Q18A 3OBYA 3M8RA 3CD6N 4LSNA 2OPSA 4CZJA 3S41A 1IH7A 5HRSA 1G99A 4Y0WA 1Z6RA 3V1QA 3H1VX 4HTLA 1BA1A 1DTQA 3G10A 5AQIA 3KD1E 2QWLA 2QEXN 1Z05A 3O9TA 3O9SA 4GVMA 4BWMA 5KGWA 3TWHA 4BR9A 1UA1A 2OTLN 1VSFA 4HHTA 4E1MA 4FPAA 4DTMA 5AQLA 4DR5K 4OKEA 4JS5A 4BROA 4CJQA 4L3QA 3OYDA 2HBLA 1T03A 4DV6K 3O5BA 4OKJA 4DTRA 3CPWM 2OANA 4HCBA 4DV2K 4X62K 1BI4A 1BG3A 4MDBA 3SPYA 4DF4A 2ZWHA 4CZIA 1BIUA 4FJIA 3C7NB 3R3LA 1HPMA 4Z4HA 4H8KA 2ZQBA 1KFDA 1TYQB 3TANA 4LF5K 3CMAN 4FPBA 4I6MA 3DM2A 2E20A 4JKDA 4BR0A 4IO9L 2BGGA 2JLEA 3TPQA 3QETA 4JHDB 3NMUA 1NMNA 3J7ZO 3BY5A 3TI0A 4F2RA 2FBTA 4NYFA 2A40A 4DTJA 3PIPL 3HI0A 3CG7A 3SJHA 3O3GA 1NK4A 4M3YA 4NLBA 1T05A 1L5UA 2HHWA 3G6EN 2HB5A 2VG6A 5KQ8A 1XHXA 4LFCK 5AQTA 4DTNA 2QWNA 3BDPA 3O08A 2HMPA 4GV6A 1LAVA 3BF3A 2O8EA 3HYFA 1L3UA 4XIUA 4CHNA 2YV0X 2OPQA 3M8QA 4LC9B 1SS6A 4X64K 3LALA 3DLGA 5K14A 1JLQA 3VOVA 2WOMA 2YNHA 3VGKA 1NGDA 2FF6A 3G0ZA 1C1BA 4IFVA 3HL8A 3MWPA 5ADXA 4DQQA 3LPTA 1JKHA 4HUFA 1JCEA 4FJGA 3O3FA 4FJNA 4E7IA 2HNZA 1QZ6A 3CFRA 4CJ3A 2CH6A 5ADXH 4DU3A 3M3ZA 1RTIA 4O5FA 3SBGA 4ILJA 3ENBA 4CF1A 5DMRA 1V4SA 4H0YB 1RTHA 3N4PA 4KKOA 4FLWA 3QBWA 3DAWA 3T1YK 3ISNC 3TTCA 3HSCA 2D0OA 1T8EA 5KRSA 3DJCA 2BDPA 4CZMA 1MWMA 1GLLO 4WQ4C 2O8FB 1KXPA 1YF5L 3K0SA 3KHYA 2HNYA 4NLCA 2DFEA 4AILC 1S6PA 2PYLA 5KI6A 1HR0K 1YAGA 2QWPA 2GV9A 4DQSA 4CJ4A 3VMFB 4C8MA 2G8WA 2YNGA 4DTPA 4CEDA 3D2EA 4E89A 1GLDG 4ILGB 4O55A 3ZX3A 2D0AA 4I9QA 3SUNA 4CIEA 2EWSA 1RT3A 1HX1A 3VQ4A 1WAJA 4O8KA 3TARA 4RW8A 3HZ6A 5AFUH 4WQ4A 4M3UA 4B8CA 4M42A 1OH7A 3OYNA 5HOOA 1TAQA 1KD1O 4KH4A 4LH4A 1J5EK 1J5OA 3VQQA 5FPMA 3QIOA 4CJTA 2YKNA 2P1JA 3EE8A 3WUHA 1U2VA 3S3OA 1T3VA 3CPEA 4PKGA 3FFKB 4Q5VA 3L8BA 4JAXA 4FZXC 2FBYA 1FKOA 4CJPA 1HNXK 4C1NI 3EZWA 1J9AA 3EKUA 4UY8O 3VENA 1VQPN 4DV1K 2ZF5O 3PSIA 1SKRA 5GAGP 4JKHA 1DKGD 1SL0A 4PA1A 5BN9A 4BR4A 1EX4A 1HYVA 2QWRA 5C12A 4BWJA 1GOCA 5F0XA 4BRNA 3DOKA 1P8ZA 1REVA 2QM1A 4OGEA 2YHAA 3QEXA 2ETJA 4CZFA 4KTWA 3J81O 4QOZB 4KO0A 2E2PA 4DSFA 3H08A 3V1RA 3WNHA 1B9FA 1E4FT 4HVJA 1VQ9N 4Z4EA 1WUAA 3ID8A 3V9UA 3C6HA 1NK0A 2V52B 4BRLA 4KH6A 4F3TA 1CXUA 2D5RA 1D8YA 1S1UA 3CJCA 4B1ZA 3AO4A 4PY5A 2UU9K 2VGNA 3UKUA 4EZ6A 3FE1A 5AQGA 2O8EB 4CFAA 3CC4N 1Q82O 1L3TA 1K9MO 4ELUA 4KHWA 4H5TA 4X66K 4HTUA 1ZC6A 3DWLA 4DFKA 4JKCA 4BR7A 4FK0A 5HRRA 3QESA 3SUQA 5EVZA 3J7YP 4JYAK 1K73O 1V4TA 4F2SA 2YHWA 3VTHA 1LW0A 4ISEA 1S1WA 1FK9A 1BWFO 3ZT1A 4CHYA 1ATRA 4OLBA 1N34K 4FJ5A 3GOIA 3JS6A 2ZJRL 4O0JA 4CK1A 3DLHA 4B3MK 1NKEA 1XMQK 2ZGZA 3V81A 1ZXOA 3AVJA 4YDUA 1XC9A 4KBOA 5AQXA 4IFEA 3FR0A 2FSKA 1TAUA 4LH5A 3HT3A 2HW3A 1YVNA 4HUEA 3SZ2A 4Z4CA 4X65K 2ASMA 5SWMA 1EXQA 4B3SK 1LAWA 5LJWA 1QQCA 4K43A 5C25A 2E88A 4CHZA 2NZTA 5FPEA 4KB0A 4CJFA 4JK9A 3K5MA 4DG1A 2Z1JA 1C0GA 4CFCA 3I8DA 2IS3A 5CYMA 2E6LA 2Q3SA 5C2DA 3AVMA 3OYFA 1HQUA 3D2EB 1M90O 3LWMA 3GDQA 3OYMA 4FVUA 1FXXA 1SKSA 5JLFA 1VQ6N 5IWAK 1SUQA 3AA2A 3KK3A 4DSEA 1TKDA 1VSKA 3MCPA 3E66A 4CECA 4CI6A 1HKGA 2Z1IA 2AP1A 3HPGA 2PBDA 1LOTB 1MWKA 4BG8A 3TSPA 1Q7YO 3MXIA 5BPMA 3AO1A 4BRGA 5EY4A 3O4NA 3S3MA 1U2VB 4EFHA 2ZM6K 3JXUA 4FZYA 3K59A 1IG8A 3J8AA 5EX5A 1RDBA 2AJQA 2G8UA 4CZGA 1TUUA 1HLUA 4K42A 1WB9A 4FWNA 1SL1A 3RR7A 2HHSA 3HOTA 4E0DA 1NGCA 4JK8A 5AQKA 1ASVA 3V4IA 3OTOK 4JKFA 1YTUA 4DV3K 1IG9A 2HBKA 1NNEA 4B3OA 4CZLA 1EP4A 4QAGA 3DXMA 2YJEA 1C0TA 1G15A 1NK9A 3TU5A 3JYTA 4JKGA 3HP6A 3AA5X 4YOWA 3FZLA 3LL3A 2HHXA 4FWQA 4CK2A 5I3UA 3QO9A 3MX2A 1RBSA 3IAYA 3PX4A 4MLHA 4N56A 4DSJA 3THXB 3O9UA 1RDAA 1RT7A 2IOCA 1X3NA 2GUPA 3WQUA 4M3TA 4G1QA 3UKUB 1SZ2A 4A62A 2BE2A 3SLCA 1CZBA 4CJVA 1RBVA 4DR2K 3SI6A 1QE1A 3U9DA 3CCLN 5TKWA 3VEOA 2IC3A 3NHGA 4OPHA 5AQQA 3OJUA 3K9KA 2ZD1A 3OS1A 4K8XA 3ZCMA 3H3OB 4N5SA 1U48A 4ELTA 3ATVA 3B6PA 3KK7A 4BDZA 4DB3A 4BRPA 2OA8A 1QSYA 3ALYA 2IVPA 3WXIA 3OW2M 2G8FA 1J6ZA 1Y64A 4FWPA 1KSPA 4H4OA 3IDHA 4RW6A 3DRPA 4WCEL 4ZHRA 4ZTFA 5CZ1A 2FF3B 3DMJA 3WNGA 2QXLA 4JEPA 2NRWA 2KTQA 1NGGA 4AF1A 2YJFA 3HVTA 3DLRA 3JSMA 1L3VA 1ATSA 1WSFA 1YJNN 5AJ3K 3ULDA 4AHTA 4H0PA 2XY7A 3SV4A 4FYDA 2GX9A 1ASUA 4CJWA 4H0VB 4IOXA 2GTDA 5DM7L 4B1VA 4GKKK 3HK2A 1LW2A 1RT4A 3L2QA 5KPRA 3F5TA 3Q7BA 1K6YA 2HHQA 3WNEA 3CFOA 4LFAK 3CM5A 1UA0A 3ENOA 3IFRA 3RSEB 2VWKA 3VEXA 3ZSVA 2E5LK 2YNFA 5GINA 4Z4GA 5M1KA 1NGJA 4G9ZA 2E6MA 5JMVA 3R8EA 1IBKK 4FWLA 3VQEA 3WXJA 4V19S 5D3GA 3O6WA 4Q0BA 5AQNA 4FJJA 1YJWN 3WXLA 1N6QA 1QZ5A 2E4LA 3O3HA 2XHBA 4CIFA 2E2NA 4CJKA 4JI4K 3CM6A 3E01A 4CJ5A 5KPTA 3C94A 4A2AA 4C23A 1NOYA 4KHNA 5AR0A 4M7YA 2CGLA 2FBXA 3IMXA 3Q7CA 3IS9A 3AY9A 1QSLA 4J2EA 2X78A 1RILA 4FJLA 1N33K 4GMJB 1TUYA 3TAGA 2O8DA 3AARA 1VQ8N 1YI2N 3NBPA 3UIQA 3PSFA 1Q8IA 3CCEN 1KVAA 3LDSA 4I2PA 2KZZA 2JWKA 4W5OA 4CBUA 3ZSRA 2GBZA 2VG7A 2X6SA 4B1WB 3DXMB 5C2FA 3OA9A 5JVGL 3D2FA 4ID1A 4JKGB 4CBXA 3KK1A 2F8SA 1GLJO 3CJBA 3VEVA 1IKVA 3O8MA 5FLXO 4AH9A 2BH1A 4RW9A 3RRGA 4IXCA 4E1NA 5GAEP 4N76A 3NE6A 5CR4A 1NGAA 4JI8K 1XUPO 3TAFA 3V6DA 2P5GA 3SQ4A 1NBWA 3DXKA 5AQHA 3T1AA 5JVHL 4PQUA 1S5JA 1JCFA 3KKRA 2WC9A 2RHKA 3W3DA 3B8AX 4JI6K 4DMNA 5ELZA 4W5QA 4YOXA 1IKYA 4DUYK 4JD2A 2OZMA 1X1PA 3HVRA 3VEZA 1VSJA 3U3YA 1JJ2M 3SV3A 3LWLA 4BDYA 3QICA 4CF2A 4BC5A 5DK5A 4FLXA 3FZFA 3BUZB 4OKKA 3SK3A 2KKZA 1VRTA 2NRZA 2QW9A 5BR8K 3RWUA 1RDCA 5AQJA 2P5OA 3S9HA 2JGUA 4DQRA 1RDDA 1NGBA 3AO3A 4DS4A 1NGHA 4YOYA 1TV6A 3C95A 3VGMA 2Z1GA 4B1XB 1BQMA 3M5RA 3G71N 4NCBA 3KK2A 1HUXA 1JLCA 1OKJA 3VETA 5AZJA 3DYAA 4IDKA 4FJ9A 2HHTA 2ATQA 3OYEA 1UOCA 1N8RO 1K8AO 4F4KA 1DTTA 3CYMA 1FW6A 4CHOA 2CGJA 4JS4A 3AVGA 1KFSA 5LY3A 4B9QA 4B3RK 4KFBA 3MN6A 4FOEA 5M1OA 4CZKA 3TSQA 2Q1NA 3U8XA 4FLVA 1VQ5N 4W5TA 3FZMA 1C0UA 2KFZA 2BUPA 3VA0A 3A2FA 1RDUA 3M8PA 1KAZA 2GELA 4K0KK 3VQDA 3H3NO 4WYBA 3QEWA 2W40A 1QVGM 3THVA 3MK6A 3LPUA 3BEXA 3V9WA 5J2PA 4FJMA 4FWKA 4J2BA 2NNWA 1EWRA 1LWFA 3C6TA 4OO1J 1WSIA 4CGFA 3DRRA 3F2KA 4E7KA 4KTZA 3H46O 3QNOA 1X9JA 5AQUA 4N47A 4BE1A 3TAQA 3LDLA 4DR6K 1HPZA 3EZ5A 2A41A 1NJYA 1RT5A 3CF5L 2ITMA 3SMSA 1HYSA 4MO5A 2I7NA 3EEQA 1RBUA 5FPNA 3U6FA 2A3ZA 5LL6Z 1KAYA 4C1NK 2O8DB 3VQ8A 4A61A 2RKIA 1JLGA 3I0SA 3I55N 4EP4A 2KQ2A 1FKPA 2NLXA 1WSEA 3IRXA 4DCHA 3AVBA 3HM8A 1ZYQA 3BGRA 2ASPA 4CD3A 4KRFA 4CZHA 3ITHA 2UXCK 1OH8A 2W6KA 4BRMA 3LDPA 4AM6A 4RCHA 3HOSA 1TK5A 1KTQA 3U3GA 3D2FB 1BOTO 4KI4A 2P9LA 2RN2A 2LSNA 4B1UB 4CEFA 5AFUA 2QA4N 1TK0A 1RT2A 4JLHA 4JI1K 5KTQA 2ZJPL 3EE9A 3P5JA 4FSVA 3L2RA 5FROA 1Z26A 3VEYA 2O4IA 5KQDA 2O8CA 3DXKB 4BRAA 3QEIA 2V51B 3P4IA 4DTXA 1JLFA 3LZIA 4XH1A 3WEEA 4CJUA 4JD2B 4KHUA 2VWJA 3L3VA 1GOBA 2RPIA 1VSMA 1BI4B 1TL3A 3LP0A 4XH5A 4H0TB 1WSHA 3FZHA 4CW7B 4WFAL 3T1HK 2VCPA 1HJOA 1BA0A 1X3MA 4EIAA 4YY3K 1NK5A 3OY9A 2PYJA 4AHVA 4YFUA 3KLGA 5AQVA 4KHQA 4I6MB 2V7YA 1ZBHA 4BRHA 4CEEA 5A2QO 4CGHA 3I56N 1E4GT 4C8NA 4J2AA 4DR4K 1BCOA 1TKXA 2VWBA 4LF9K 2FLOA 3MAQA 3SUOA 2HOEA 3MEDA 1NMDA 4JI3K 1ESVA 4PKHA 2XRIA 4E1JA 4CVNE 4CBWA 3HM9A 3EYZA 3HXMA 3FFIA 4B9LA 1KVBA 1YJ9N 4NCAA 2RF2A 4I2QA 3MEGA 1NJWA 2F8TA 1LCUA 4TSXA 3OJSA 3LDQA 4CK3A 1NGIA 3KJVA 4BRQA 1S6QA 4CEZA 1VAZA 3L2UA 1I39A 1IBLK 4CZEA 3AVNA 4B9MA 4H4MA 3O80A 1Q9YA 3ZSYA 3VQAA 3F73A 4KHSA 3K5NA 3EN9A 1RDWX 1WLJA 2NRXA 4KHPK 3PUFA 3T19A 1BL3A 3TR8A 4K8ZA 4BR2A 3ZSQA 4O44A 5LJVA 3AAQA 3ASMA 5T7BA 3NGZA 4PKIA 3BP8A 4HWIA 4BC3A 4O8UA 1BHLA 2XY8A 1BU6O 1XWLA 4AHUA 3P31A 1E3MA 5BRDA 4XH4A 1I3AA 3A5LC 3CIPA 2IDOA 4ID5A 3AGKA 3EKSA 3NF8A 1S9EA 1VSDA 2PAVA 2P9IA 4M41A 4C8OA 4WE1A 5E84A 4FZZA 1C1AA 1ZBUA 4MLEA 1NJZA 4FLUA 3CERA 5AQRA 3ZX2A 4FM2A 1TK8A 5I9EB 4LF8K 3SQ2A 2HVHA 1W2BM 2CGKA 4BC2A 3DLBA 4DV0K 4LF7K 3DLLL 4CEAA 3LM9A 4KV8A 3VQ6A 1WSJA 1YITN 1EWQA 1BQNA 1KLMA 5BRFA 3QB0A 2P9LB 1S1XA 1JLAA 5LMUK 3VN5A 3SAHA 4QS9A 1ZBSA 4BRIA 5JS1A 3OYCA 3SQ0A 1VQON 4YOVA 2HMIA 5H1SQ 2NRRA 2QWMA 3O4WA 4EHUA 4PHTX 2O8CB 1GLEG 3K9JA 3CC7N 3HBTA 1UWBA 4FCYA 3PX0A 3WEEB 3FGUA 1WNSA 1RTDA 4NB4A 3NVKA 3FZKA 1QS4A 2P9PA 4E3SA 2A1SA 2F96A 4UQGA 2PZSA 4B9SA 3DI6A 3H1QA 1A5XA 1NK6A 4GY2B 1SKWA 2YHXA 4DV7K 4GKJK 2QK9A 1YIJN 4H0XB 5J2QA 4BRFA 1BISA 4DU1A 1ZBIA 3LP3A 4AHSA 5CY4A 3CHWA 2FC0A 4WFBL 4FVMA 3IKMA 4GW6A 1S1TA 4BVPA 1WBBA 4ILHA 4FK4A 1OH6A 1BCMA 1FJGK 2IGIA 3U9ZA 2E1ZA 4BVOA 1L3SA 5BR9A 2W42A 4IZ9A 3L4IA 1MA9B 2F9TA 2E1YA 2Q31A 2D0CA 3UKRA 4E7LA 2UYTA 3MDQA 3QDKA 3L2WA 3CMEN 4DLGA 3LANA 3D7EO 1KC8O 4IJAA 4YOUA 4E19A 4H5NA 1EQYA 4M3XA 2IVOA 4JRPA 3ZT4A 3J80O 1X9WA 1CZAN 1OH5A 3DOLA 1Z25A 3PLAA 2YX6A 3NGYA 1HKBA 1J53A 3H6EA 3KLIA 3CCMN 3A5OC 5SZTA 1HNZK 3WXKA 4FLYA 4DFJA 5JICA 3SCXA 2VGMA 2W6LA 3D45A 5FRNA 4QS7A 1R59O 4CFBA 3VGLA 1D4XA 3HRGA 1DEJA 4FWMA 4DSIA 4Z0UA 5KRTA 3MECA 1ILYA 2HBMA 3RRHA 1D9DA 2Q36A 4H5WA 3QLHA 4B8AB 5F2RA 1LWCA 3A5NC 4O0IA 1YUWA 5BPNA 1U4BA 3QMLA 4CEOA 2DPNA 2B6AA 2CH5A 3IUCA 1GLCG 4CGJA 1S72N 4DFMA 4IJNA 1SQKA 4I9LA 1VSLA 3ZX0A 3OYJA 3KWGA 1NU0A 2A5XA 3AAPA 4M3ZA 2D4WA 4Z4FA 2ASOA 1HNVA 5AQMA 4IWVA 3OBWA 2P9IB 2XY5A 5J2NA 1JCGA 4QCLA 5AQWA 4BQZA 1XNQK 4FLZA 3PY8A 3WNFA 4CJRA 3NAEA 3BF1A 1QQMA 1GLFO 5J1EA 3THWA 3ZSOA 3QNNA 4DV4K 1NLVA 2E2QA 4MDAA 4MQ3A 2QWOA 1HNIA 4GNIA 4M45A 1KQSM 2F9WA 1QQNA 2V7ZA 1VSEA 1OVQA 2X74A 3RVCA 3QFPA 1NKBA 3P1GA 4CERA 5CE3A 3AVCA 5AQSA 3CJ9A 2UXDK 3NH0A 4K25A 1HQEA 1TGOA 4JI2K 3O9RA 2B5JA 1XNRK 3O1WA 1O13A 4FW2A 4R5PA 5CZ2A 4F8RA 3QINA 2AA4A 5AQOA 3K57A 1XI1A 3L6QA 4DFPA 1W9HA 3O9QA 4EP5A 3AA4A 2BANA 3W0LA 4W5NA 2I7PA 1BIZA 3QEVA 1HJRA 3HSTB 4DSLA 3PO5A 3LP1A 1VQMN 3PIOL 1X9MA 3DRSA 2P9SA 2YNIA 5M1PA 3ZSXA 1SAZA 2IIRA 4H0OA 4RWTA 3MMVA 4CHQA 2YHYA 2NRHA 5FRMA 3CCJN 2GUIA 2NRVA 5E26A 4NO7A 4CEQA 3UKRB 3NCIA 3ZT0A 1EO1A 2O8FA 3HTVA 1IBMK 4LD0A 5GIOA 4BE2A 4OPAA 2ITGA 3CCRN 1DGKN 4KTQA 1RTJA 3OYBA 3RMDA 2WONA 2Q2RA 1NG9A 1D5AA 4KREA 3LM2A 4KHYA 4IEIA 4CJLA 5LMNK 4OGCA 4CD1A 2KLAA 1R0AA 4BGAA 2UUCK 4YOTA 5BN8A 3P38A 2ZGYA 4B3TK 5E41A 3OYHA 2OPPA 1RNHA 3K5OA 5GIPA 3ZSZA 2P9NA 3G25A 1TL1A 4CESA 2A6AA 3TABA 3SJJA 4IFYA 4CFDA 3KVGA 4PWDA 3E1YA 4CJ7A 2YCHA 3VESA 1RT6A 3MX5A 4FM0A 3KLHA 4BDPA 4DTUA 1S3XA 3QIPA 3I8BA 4DSKA 1ZBFA 4EHTA 4M3RA 5GADP 2PFUA 4GVEA 1QHTA 4OX9K 1VRUA 1IKWA 1VK0A 1GLAG 5CYQA 1QTMA 4BACA 3CXCM 3KWIA 1QVFM 4RW4A 4DLEA 2WUSA 2VYPA 2KZMA 2WFBA 5TKYA 2B4JA 3C6UA 4XEIA 1C1CA 3D0PA 4FLTA 3OYGA 5JLHA 1NKCA 5HP1A 2NRTA 3O4QA 3R9PA 3KKSA 4ISGA 1CZ9A 3QEPA 1T6DA 2OZSA 2A1RA 1Q81O 4KAZA 2OTJN 4R79A 4IG3A 3WXMB 5I42A 4BGBA 1GLBG 2G8IA 3AV9A 1NJXA 1P90A 2QWQA 2EX3A 2Q0RA 5DM6L 3L2VA 3THWB 4BRKA 4IEEA 4U7BA 4DWIA 1DT9A 3CQYA 3CJ1A 1WSGA 5C42A 3E9LA 3FLCO 1Q9XA 4FWRA 4DR7K 4AQYK 1GOAA 4M3WA 3WT0A 1EKEA 4F3OA 5AQYA 3ULEA 1KAXA 2FSNA 4NCGA 4W5RA 3P83D 4GV3A 4Y1DA 4CHPA 3SPZA 4JKBA 3CJ7A 5CHIA 4JI7K 1DLOA 2VG5A 3TAMA 3TTFA 4IKFA 1JL1A 3E9PA 4BQLA 2A42A 2GWKA 3CQ8A 1JLBA 4OPJA 4OPKA 4A57A 1QQOA 2HF4A 4EZ9A 4IOCL 3CQXA 4FO0A 2P9SB 1RBRA 4B9UA 2O4GA 3THYA 1VQNN 1BGXT 1NM1A 1VQ7N 1C0MA 3LP2A 2GEMA 3RMBA 4RG8A 2DTUA 4J2DA 1KCFA 4DU4A 5MLCQ 1C0FA 4CJSA 4JI0K 4QS8A 1QSSA 1YT3A 3J7AP 3VPZA 3ZEUA 1JL2A 3C65A 3IG1A 4AM7A 4OVLA 4IO8A 5AQZA 3LDOA 4DHYA 4CF0A 1IV0A 4OLAA 3KD5E 3BZCA 4O5BA 3VTIA 3NDKA 3OS0A 2G8HA 3EL2A 4YHHK 3QFUA 4FJHA 3C0BA 4DTOA 3SAGA 1NJIO 2Z1HA 3TSUA 3GG4A 3L4QA 4H03B 4B9VA 4DR3K 2WTUA 2PY5A 3OYLA 1Q86O 2P9NB 1U45A 1VSIA 1HYZA 1NK8A 3T3FA 1LWEA 4NXMK 1S1VA 4Z4IA 2OPRA 4J8FA 4M63C 2P9KA 1MU2A 4FL9A 3V1OA 1JXBA 2P9UA 2W41A 1NOZA 1H1VA 4CE9A 3KTQA 5AZJB 2WBNA 1HKCA 2D0PA 1KVCA 3K58A 4CIGA 2QXFA 4LF4K 2KFNA 3MCAB 4DQPA 1XHZA 3OS2A 2RE2A 2R7YA 3K5LA 3K2PA 3HPOA 4IDHA 5AQFA 4BREA 1HMVA 1O1WA 4CF9A 2FSJA 4I7FA 1IO2A 1XC3A 5F1XA 3VQCA 3M1FA 2QKBA 2EHGA 4YNQA 2F7TA 3NGIA 3LAMA 3VQ7A 5JS2A 3RR8A 4RW7A 4FWSA 1IKXA 1UAXA 2HSTA 3KIOA 3QBXA 3NF7A 4FJKA 3D6RA 5BRHA 3GE1A 3O1BA 2YI1A 2IVNA 4DKWA 3AA3A 3ATUA 4A2BA 3MWTA 3SAFA 3THXA 3NH2A 1U6ZA 4M7XA 3ZETA 4FJXA 1JXEA 4RTFD 4CJEA 5KGXA 4HUGA 1BDGA 1ASWA 3SNNA 3JAMO 4CGIA 4HCCA 2D0BA 3V9ZA 3EO3A 3ID6A 2FXUA 1I94K 3CCSN 3NF6A 1K8KA 3F9KA 3AVKA 2GWJA 1F21A 4DTSA 3DLKA 4IOAL 1HRHA 4YDUC 3ULEB 2Q0UA 5IT9O 5KPZA 2YKMA 4BR5A 3L3UA 2DY4A 1EETA 4LSLA 1KLNA 5C24A 3OYAA 3G4SN 2J4RA 1JLEA 2KW4A 3NH1A 3V9SA 1YXQA 3A0IX 3HP9A 3DLEA 1NWKA 4BG9A 4E7HA 1RT1A 2X6NA 1W7AA 4B9NA 3SUPA 3CETA 4JRQA 3A5MC 4FWOA 2UXBK 3VQ5A 5HRNA 1S9GA 4WF9L 3AO2A 3NF9A 3U4LA 5AZIA 1BO5O 3RTVA 1YHQN 4A59A 4LFBK 5C15A 4IG0A 4NXNK 3OYIA 1U47A 3THYB 4FJ7A 5EU7A 1VQLN 4LY7A 3HJFA 1W97L 3NVMA 3H45C 2UUAK 3N4QA 5EXWA 1VSHA 4JK7A 3CCVN 1T44A 2Y1JA 4BRCA 1WBDA 3F9MA 3ZEUB 2D1KA 4JKEA 2KHOA 2XO7A 4ZTJA 4OJRA 5BREA 1MDUB 2NUBA 3RSEA 1J54A 5HLFA 4GV9A 2I5JA 1A5VA 1VHXA 4WQ5C 2F4VK 2HVIA 3UB5A 4FM1A 1ITGA 1WAFA 1YTAA 5B8HA 5GAHP 3CI5A 4CF8A 2Q97A 3ZT3A 2Y1IA 3VF6A 3ZYYX 1VQ4N 1N5YA 3M8SA 4FJ8A 4JI5K 3NFAA 1SL2A 1IJJA 3HO1A 3AVAA 3VEWA 1X9SA 3MN9A 3KLFA 2P9KB 3P39A 1RCHA 3BZKA 2P9UB 3OHRA 5M1FA 1RBTA 1D9FA 1RFQA 5C0YA 2JWLA 4WQ5A 2O8BA 4MFBA 3SBTA 1WN7A 2IAJA 4PL8A 3C6AA 4H5RA 3AO5A 5HROA 4EAHD 4LF6K 4PUOA 4ICLA 3MEEA 3VQ9A 3KLEA 4ISFA 3OVNA 1U04A 3I0RA 4DV5K
chains in the Genus database with same CATH topology
1HJRA 1LWFA 1S1UA 3HSTB 3AO4A 3LP1A 3C6TA 2DFHA 1D8YA 3PO5A 4PY5A 4EZ6A 3S3NA 1WSIA 4CGFA 1B9DA 4KPYA 3DRRA 1X9MA 3DRSA 2YNIA 4CFAA 1L3TA 4E7KA 4ELUA 4CEBA 4KHWA 3ZSXA 4KTZA 3QNOA 1LV5A 1C6VA 4N47A 4BE1A 4HTUA 3TAQA 4DFKA 4CHQA 5FRMA 4N41A 1HPZA 2GUIA 2HNDA 3EZ5A 4FK0A 5HRRA 3QESA 3SUQA 1NJYA 1T7PA 1RT5A 4CEQA 1TVRA 3NCIA 3ZT0A 1HYSA 4F2SA 1RBUA 4LD0A 4BE2A 1LW0A 2ITGA 3ZSWA 3U6FA 4B9TA 1S1WA 4AHRA 1FK9A 4CCHA 4KTQA 1RTJA 3OYBA 3VQ8A 3RMDA 2WONA 3ZT1A 4CHYA 2RKIA 1JLGA 5FDLA 1D5AA 4KREA 3I0SA 4OLBA 4KHYA 4FJ5A 4EP4A 2HHVA 2KQ2A 4CJLA 1FKPA 1U49A 1W0HA 4OGCA 1NK7A 1WSEA 3IRXA 4O0JA 4CK1A 4BE0A 3AVBA 1R0AA 1ZYQA 3BGRA 3DLHA 4KRFA 1NKEA 3ITHA 3EY1A 1CXQA 3V81A 5J2MA 3MXMA 5E41A 3OYHA 1TK5A 2OPPA 1RNHA 3AVJA 3K5OA 2XY6A 1KTQA 1XC9A 3ZSZA 3U3GA 1TL1A 1B92A 3TAPA 4CESA 3B6OA 1SV5A 3TABA 3SJJA 4O4GA 4IFYA 2RN2A 4KI4A 1TAUA 4CFDA 2LSNA 4LH5A 4CEFA 3HT3A 4PWDA 4HUEA 2HW3A 3SZ2A 4Z4CA 4IBNA 1RT6A 1RT2A 4FM0A 1TK0A 5SWMA 3KLHA 3TAEA 4BDPA 4JLHA 5KTQA 1EXQA 4DTUA 1LAWA 3AVIA 3P5JA 4Y1CA 3L2RA 3QIPA 4FXDA 1QQCA 5FROA 5C25A 1Z26A 4DSKA 1ZBFA 4M3RA 4CHZA 2O4IA 1Y97A 4ELVA 4E7JA 1QHTA 4KB0A 3CFPA 3QEIA 1VRUA 4CJFA 4DTXA 1IKWA 1JLFA 4DG1A 1VK0A 5CYQA 4CJUA 2FBVA 2Z1JA 4B08A 3K5MA 4CFCA 3RMCA 3I8DA 2IS3A 5CYMA 2E6LA 2Q3SA 1A5WA 3AVMA 3OYFA 4KHUA 1QTMA 2VWJA 4AHCA 1HQUA 4BACA 3L3VA 1GOBA 1TKZA 2RPIA 1VSMA 3LWMA 3OYMA 1BI4B 1TL3A 1FXXA 3LP0A 1SKSA 1CLQA 4RW4A 4DLEA 4NYNA 1WSHA 1SUQA 2KZMA 3AA2A 3VQPA 3KK3A 2B4JA 3C6UA 3D0PA 1C1CA 4FLTA 1TKTA 4DSEA 1VSKA 1TKDA 3OYGA 1NK5A 3OY9A 3QERA 2PYJA 4CECA 1NKCA 5HP1A 4C8LA 3O4QA 4AHVA 3KKSA 4YFUA 2Z1IA 3HPGA 1CZ9A 3KLGA 3PX6A 5HBMA 3AVLA 2OYQA 4KHQA 3QEPA 2G8VA 2OZSA 3AVFA 2P51A 2A1RA 1ZBHA 4CEEA 4KAZA 3V9XA 3LAKA 3MXIA 4CGHA 4IG3A 5I42A 3VA3A 2YHBA 3OYKA 3AO1A 4C8NA 4J2AA 1BCOA 1TKXA 4CGDA 3O4NA 3S3MA 3RMAA 2G8IA 3SYZA 3AVHA 5HRPA 3AV9A 1NJXA 4FZYA 4FK2A 3K59A 4DQIA 2EX3A 3MAQA 3SUOA 3SQ1A 3L2VA 3MEDA 1RDBA 2XRIA 4DWIA 2AJQA 4CGGA 3ZT2A 2G8UA 4L8RB 1WSGA 5C42A 3HM9A 1SL1A 3RR7A 3EYZA 3HXMA 1ZBLA 2G8KA 2HHSA 1Q9XA 3FFIA 4B9LA 4DF8A 2QKKA 1KVBA 4E0DA 1GOAA 4NCAA 3PO4A 4M3WA 1EKEA 2RF2A 2ZE2A 1ASVA 4I2QA 3V4IA 3MEGA 1NJWA 4F3OA 2F8TA 3VQBA 1YTUA 4FW1A 4TSXA 3OJSA 1IG9A 4CK3A 2DFFA 4B3OA 3KJVA 1EP4A 4QAGA 1S6QA 4CEZA 1C0TA 1G15A 3L2UA 1NK9A 2HHUA 4NCGA 4KB1A 1I39A 4W5RA 3P83D 3HP6A 3JYTA 3AA5X 3AVNA 4Y1DA 4B9MA 3MXJA 4CHPA 3SPZA 4KI6A 3LZJA 4H4MA 1Q9YA 3ZSYA 3VQAA 2HHXA 4CK2A 5I3UA 3QO9A 3F73A 3PV8A 1RBSA 1DLOA 4DS5A 2VG5A 3K5NA 3PX4A 3TAMA 3IAYA 4KHSA 1WLJA 4N56A 3HPHA 4IKFA 4DSJA 3PUFA 1YVUA 1RDAA 3T19A 1JL1A 1RT7A 1BL3A 2IOCA 3CQ8A 3TR8A 3M8RA 4K8ZA 1JLBA 3ZSQA 4O44A 4OPJA 4OPKA 4LSNA 3ASMA 4M3TA 2OPSA 4G1QA 5T7BA 3NGZA 4EZ9A 2BE2A 1IH7A 5HRSA 1RBRA 1CZBA 4CJVA 4B9UA 1RBVA 2O4GA 3V1QA 3SI6A 1DTQA 1QE1A 3G10A 1BGXT 3KD1E 2IC3A 4GVMA 3NHGA 1C0MA 3OJUA 3LP2A 4BWMA 2ZD1A 5KGWA 3TWHA 1BHLA 3OS1A 4K8XA 3RMBA 3ZCMA 1UA1A 4N5SA 4RG8A 2XY8A 1U48A 4ELTA 2DTUA 1XWLA 4AHUA 4J2DA 1KCFA 1VSFA 4DU4A 4CJSA 4HHTA 3B6PA 1QSSA 1I3AA 1YT3A 4E1MA 4BDZA 2IDOA 4DTMA 4ID5A 1JL2A 3IG1A 2OA8A 1QSYA 3ALYA 3NF8A 1S9EA 1VSDA 4OVLA 4OKEA 2G8FA 4JS5A 4CF0A 4M41A 4C8OA 4WE1A 1KSPA 4H4OA 4CJQA 4FZZA 4OLAA 1C1AA 1ZBUA 3DRPA 4O5BA 4RW6A 3NDKA 3OS0A 4ZHRA 4FLUA 1NJZA 3OYDA 2G8HA 4ZTFA 1T03A 5CZ1A 3DMJA 3WNGA 4FJHA 4FM2A 1TK8A 4OKJA 4DTRA 2HVHA 3SQ2A 2KTQA 4DTOA 4HCBA 3HVTA 3DLRA 3JSMA 3DLBA 2Z1HA 4CEAA 1BI4A 1L3VA 4B9VA 3SPYA 4DF4A 1WSFA 2PY5A 3OYLA 1BIUA 4FJIA 4KV8A 3VQ6A 3ULDA 1WSJA 4AHTA 2XY7A 3SV4A 4FYDA 1BQNA 4Z4HA 1KLMA 1U45A 1VSIA 1HYZA 1S1XA 4H8KA 1ASUA 1JLAA 2ZQBA 1KFDA 4CJWA 1NK8A 3TANA 3T3FA 1LWEA 3VN5A 3DM2A 1S1VA 4Z4IA 5JS1A 2OPRA 3OYCA 3SQ0A 3V1OA 1MU2A 2HMIA 2BGGA 1JXBA 2JLEA 1LW2A 1RT4A 3HK2A 3L2QA 3QETA 1K6YA 2HHQA 3TI0A 4F2RA 2FBTA 1UWBA 1NOZA 4NYFA 4CE9A 3WNEA 3KTQA 3CFOA 3K58A 1KVCA 3CM5A 4FCYA 4CIGA 3PX0A 4DTJA 1WNSA 2QXFA 1UA0A 1RTDA 2KFNA 2VWKA 3CG7A 4DQPA 1XHZA 3OS2A 1QS4A 3O3GA 3ZSVA 4E3SA 1NK4A 2YNFA 2R7YA 4M3YA 4Z4GA 2A1SA 3K5LA 3K2PA 2F96A 4UQGA 3HPOA 1T05A 1L5UA 2PZSA 4B9SA 2HHWA 2E6MA 1HMVA 1O1WA 3DI6A 4CF9A 1SKWA 1A5XA 2HB5A 2VG6A 1IO2A 4I7FA 1NK6A 3VQEA 1XHXA 2QK9A 5D3GA 5J2QA 3VQCA 4Q0BA 1BISA 4DU1A 4DTNA 1ZBIA 3LP3A 4FJJA 3BDPA 4AHSA 5CY4A 1N6QA 2QKBA 2E4LA 2EHGA 4YNQA 3NGIA 2FC0A 3O3HA 3LAMA 3VQ7A 4FVMA 1LAVA 2XHBA 5JS2A 4CIFA 3RR8A 4GW6A 1S1TA 4RW7A 3HYFA 1L3UA 4XIUA 1IKXA 4CHNA 4FK4A 1BCMA 2YV0X 1UAXA 2OPQA 3CM6A 3E01A 3M8QA 4CJ5A 2IGIA 4CJKA 3KIOA 3C94A 1L3SA 3NF7A 2W42A 1NOYA 4FJKA 3LALA 3DLGA 5K14A 1JLQA 4KHNA 2WOMA 2YNHA 4E7LA 2D0CA 3AA3A 2FBXA 3G0ZA 3IS9A 3L2WA 1C1BA 4IFVA 3NH2A 3HL8A 1QSLA 4DLGA 3LANA 2X78A 4J2EA 4FJXA 1RILA 3LPTA 4DQQA 1JKHA 1JXEA 4E19A 4FJLA 4CJEA 4GMJB 5KGXA 4HUFA 3TAGA 4M3XA 4JRPA 4HUGA 3ZT4A 4FJGA 3O3FA 1X9WA 4FJNA 1ASWA 3LZIA 4E7IA 3SNNA 2HNZA 3NBPA 4CGIA 4CJ3A 3CFRA 2D0BA 3DOLA 1Q8IA 1Z25A 3V9ZA 3UIQA 4HCCA 4DU3A 1KVAA 3LDSA 1RTIA 3NGYA 4I2PA 2KZZA 3NF6A 4CF1A 3F9KA 3AVKA 1F21A 4W5OA 4DTSA 1J53A 3DLKA 5DMRA 3KLIA 1HRHA 3ZSRA 2GBZA 2VG7A 2X6SA 5SZTA 2YKMA 3L3UA 2DY4A 1EETA 4FLYA 1RTHA 4KKOA 4LSLA 1KLNA 4DFJA 4ID1A 4FLWA 5C24A 3KK1A 2F8SA 3OYAA 3SCXA 3I0RA 1IKVA 3D45A 5FRNA 1JLEA 2KW4A 3ISNC 3NH1A 4AH9A 1T8EA 4RW9A 3RRGA 4E1NA 5KRSA 3V9SA 2BDPA 4N76A 3NE6A 3HP9A 3DLEA 4CFBA 1KRPA 3TAFA 4E7HA 3V6DA 1RT1A 2X6NA 2P5GA 4B9NA 3SUPA 4JRQA 3SQ4A 3VQ5A 4DSIA 5HRNA 2HNYA 4Z0UA 1S9GA 5KRTA 3MECA 2DFEA 3T1AA 4PQUA 3AO2A 3RRHA 1D9DA 3NF9A 4AILC 1S5JA 1S6PA 3KKRA 2PYLA 5KI6A 3RTVA 3QLHA 4DMNA 4B8AB 4W5QA 1LWCA 1IKYA 2GV9A 4O0IA 4DQSA 4IG0A 1U4BA 3OYIA 4CJ4A 1U47A 2OZMA 4C8MA 1X1PA 4CEOA 2YNGA 4DTPA 2G8WA 4FJ7A 3HVRA 5EU7A 2B6AA 4LY7A 4CEDA 1VSJA 3HJFA 3U3YA 3SV3A 4CGJA 3LWLA 4BDYA 4E89A 1VSHA 4CF2A 5DK5A 4FLXA 4DFMA 1VSLA 4I9LA 4OKKA 3OYJA 1VRTA 4O55A 3RWUA 2D0AA 1RDCA 4I9QA 3SUNA 2Y1JA 2P5OA 4CIEA 3S9HA 4M3ZA 1RT3A 2JGUA 4DQRA 3VQ4A 1WAJA 4Z4FA 1RDDA 3TARA 3AO3A 1HNVA 4DS4A 4RW8A 1TV6A 4M3UA 3C95A 2Z1GA 4B8CA 4M42A 3OYNA 2XY5A 2XO7A 1BQMA 1TAQA 4ZTJA 4OJRA 3KK2A 5J2NA 1JLCA 4NCBA 4QCLA 4LH4A 1J5OA 3VQQA 3QIOA 4CJTA 2NUBA 2YKNA 1J54A 4FLZA 3PY8A 2P1JA 3WNFA 5HLFA 4CJRA 3DYAA 2I5JA 4IDKA 3S3OA 3NAEA 1A5VA 4FJ9A 2HVIA 2ATQA 2HHTA 4FM1A 1ITGA 3OYEA 4C8KA 1UOCA 5J1EA 1WAFA 4F4KA 4Q5VA 1YTAA 3ZSOA 3L8BA 4FZXC 3QNNA 1DTTA 2FBYA 1FKOA 4MQ3A 4CJPA 4CF8A 1HNIA 3ZT3A 1J9AA 2Y1IA 3CYMA 4M45A 1N5YA 4CHOA 4JS4A 3AVGA 3M8SA 1VSEA 4FJ8A 3NFAA 1KFSA 1SKRA 1SL2A 2X74A 1NKBA 3HO1A 3P1GA 3AVAA 4CERA 4KFBA 1X9SA 1SL0A 3AVCA 4PA1A 3KLFA 1EX4A 1RCHA 1HYVA 3NH0A 1HQEA 1GOCA 4BWJA 1TGOA 3KD5E 3DOKA 2B5JA 4FLVA 1REVA 1RBTA 4W5TA 1C0UA 4OGEA 2KFZA 2YHAA 4FW2A 1D9FA 3VA0A 3A2FA 3QEXA 2ETJA 4R5PA 4KTWA 4QOZB 3M8PA 4MFBA 4KO0A 5CZ2A 4F8RA 1WN7A 2IAJA 4DSFA 3QINA 3VQDA 3H08A 3V1RA 3WNHA 1B9FA 3QEWA 4DSLA 4HVJA 3K57A 1XI1A 4Z4EA 3AO5A 3THVA 4DFPA 3V9UA 5HROA 1NK0A 4PUOA 4ICLA 3LPUA 1W9HA 3MEEA 3VQ9A 3V9WA 3KLEA 5J2PA 4FJMA 4EP5A 3AA4A 3OVNA 1U04A 2BANA 4W5NA 4J2BA 4F3TA 1CXUA 1BIZA 3QEVA 2D5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJR A;  1LWF A;  1S1U A;  3HST B;  3AO4 A;  3LP1 A;  3C6T A;  2DFH A;  1D8Y A;  3PO5 A;  4PY5 A;  4EZ6 A;  3S3N A;  1WSI A;  4CGF A;  1B9D A;  4KPY A;  3DRR A;  1X9M A;  3DRS A;  2YNI A;  4CFA A;  1L3T A;  4E7K A;  4ELU A;  4CEB A;  4KHW A;  3ZSX A;  4KTZ A;  3QNO A;  1LV5 A;  1C6V A;  4N47 A;  4BE1 A;  4HTU A;  3TAQ A;  4DFK A;  4CHQ A;  5FRM A;  4N41 A;  1HPZ A;  2GUI A;  2HND A;  3EZ5 A;  4FK0 A;  5HRR A;  3QES A;  3SUQ A;  1NJY A;  1T7P A;  1RT5 A;  4CEQ A;  1TVR A;  3NCI A;  3ZT0 A;  1HYS A;  4F2S A;  1RBU A;  4LD0 A;  4BE2 A;  1LW0 A;  2ITG A;  3ZSW A;  3U6F A;  4B9T A;  1S1W A;  4AHR A;  1FK9 A;  4CCH A;  4KTQ A;  1RTJ A;  3OYB A;  3VQ8 A;  3RMD A;  2WON A;  3ZT1 A;  4CHY A;  2RKI A;  1JLG A;  5FDL A;  1D5A A;  4KRE A;  3I0S A;  4OLB A;  4KHY A;  4FJ5 A;  4EP4 A;  2HHV A;  2KQ2 A;  4CJL A;  1FKP A;  1U49 A;  1W0H A;  4OGC A;  1NK7 A;  1WSE A;  3IRX A;  4O0J A;  4CK1 A;  4BE0 A;  3AVB A;  1R0A A;  1ZYQ A;  3BGR A;  3DLH A;  4KRF A;  1NKE A;  3ITH A;  3EY1 A;  1CXQ A;  3V81 A;  5J2M A;  3MXM A;  5E41 A;  3OYH A;  1TK5 A;  2OPP A;  1RNH A;  3AVJ A;  3K5O A;  2XY6 A;  1KTQ A;  1XC9 A;  3ZSZ A;  3U3G A;  1TL1 A;  1B92 A;  3TAP A;  4CES A;  3B6O A;  1SV5 A;  3TAB A;  3SJJ A;  4O4G A;  4IFY A;  2RN2 A;  4KI4 A;  1TAU A;  4CFD A;  2LSN A;  4LH5 A;  4CEF A;  3HT3 A;  4PWD A;  4HUE A;  2HW3 A;  3SZ2 A;  4Z4C A;  4IBN A;  1RT6 A;  1RT2 A;  4FM0 A;  1TK0 A;  5SWM A;  3KLH A;  3TAE A;  4BDP A;  4JLH A;  5KTQ A;  1EXQ A;  4DTU A;  1LAW A;  3AVI A;  3P5J A;  4Y1C A;  3L2R A;  3QIP A;  4FXD A;  1QQC A;  5FRO A;  5C25 A;  1Z26 A;  4DSK A;  1ZBF A;  4M3R A;  4CHZ A;  2O4I A;  1Y97 A;  4ELV A;  4E7J A;  1QHT A;  4KB0 A;  3CFP A;  3QEI A;  1VRU A;  4CJF A;  4DTX A;  1IKW A;  1JLF A;  4DG1 A;  1VK0 A;  5CYQ A;  4CJU A;  2FBV A;  2Z1J A;  4B08 A;  3K5M A;  4CFC A;  3RMC A;  3I8D A;  2IS3 A;  5CYM A;  2E6L A;  2Q3S A;  1A5W A;  3AVM A;  3OYF A;  4KHU A;  1QTM A;  2VWJ A;  4AHC A;  1HQU A;  4BAC A;  3L3V A;  1GOB A;  1TKZ A;  2RPI A;  1VSM A;  3LWM A;  3OYM A;  1BI4 B;  1TL3 A;  1FXX A;  3LP0 A;  1SKS A;  1CLQ A;  4RW4 A;  4DLE A;  4NYN A;  1WSH A;  1SUQ A;  2KZM A;  3AA2 A;  3VQP A;  3KK3 A;  2B4J A;  3C6U A;  3D0P A;  1C1C A;  4FLT A;  1TKT A;  4DSE A;  1VSK A;  1TKD A;  3OYG A;  1NK5 A;  3OY9 A;  3QER A;  2PYJ A;  4CEC A;  1NKC A;  5HP1 A;  4C8L A;  3O4Q A;  4AHV A;  3KKS A;  4YFU A;  2Z1I A;  3HPG A;  1CZ9 A;  3KLG A;  3PX6 A;  5HBM A;  3AVL A;  2OYQ A;  4KHQ A;  3QEP A;  2G8V A;  2OZS A;  3AVF A;  2P51 A;  2A1R A;  1ZBH A;  4CEE A;  4KAZ A;  3V9X A;  3LAK A;  3MXI A;  4CGH A;  4IG3 A;  5I42 A;  3VA3 A;  2YHB A;  3OYK A;  3AO1 A;  4C8N A;  4J2A A;  1BCO A;  1TKX A;  4CGD A;  3O4N A;  3S3M A;  3RMA A;  2G8I A;  3SYZ A;  3AVH A;  5HRP A;  3AV9 A;  1NJX A;  4FZY A;  4FK2 A;  3K59 A;  4DQI A;  2EX3 A;  3MAQ A;  3SUO A;  3SQ1 A;  3L2V A;  3MED A;  1RDB A;  2XRI A;  4DWI A;  2AJQ A;  4CGG A;  3ZT2 A;  2G8U A;  4L8R B;  1WSG A;  5C42 A;  3HM9 A;  1SL1 A;  3RR7 A;  3EYZ A;  3HXM A;  1ZBL A;  2G8K A;  2HHS A;  1Q9X A;  3FFI A;  4B9L A;  4DF8 A;  2QKK A;  1KVB A;  4E0D A;  1GOA A;  4NCA A;  3PO4 A;  4M3W A;  1EKE A;  2RF2 A;  2ZE2 A;  1ASV A;  4I2Q A;  3V4I A;  3MEG A;  1NJW A;  4F3O A;  2F8T A;  3VQB A;  1YTU A;  4FW1 A;  4TSX A;  3OJS A;  1IG9 A;  4CK3 A;  2DFF A;  4B3O A;  3KJV A;  1EP4 A;  4QAG A;  1S6Q A;  4CEZ A;  1C0T A;  1G15 A;  3L2U A;  1NK9 A;  2HHU A;  4NCG A;  4KB1 A;  1I39 A;  4W5R A;  3P83 D;  3HP6 A;  3JYT A;  3AA5 X;  3AVN A;  4Y1D A;  4B9M A;  3MXJ A;  4CHP A;  3SPZ A;  4KI6 A;  3LZJ A;  4H4M A;  1Q9Y A;  3ZSY A;  3VQA A;  2HHX A;  4CK2 A;  5I3U A;  3QO9 A;  3F73 A;  3PV8 A;  1RBS A;  1DLO A;  4DS5 A;  2VG5 A;  3K5N A;  3PX4 A;  3TAM A;  3IAY A;  4KHS A;  1WLJ A;  4N56 A;  3HPH A;  4IKF A;  4DSJ A;  3PUF A;  1YVU A;  1RDA A;  3T19 A;  1JL1 A;  1RT7 A;  1BL3 A;  2IOC A;  3CQ8 A;  3TR8 A;  3M8R A;  4K8Z A;  1JLB A;  3ZSQ A;  4O44 A;  4OPJ A;  4OPK A;  4LSN A;  3ASM A;  4M3T A;  2OPS A;  4G1Q A;  5T7B A;  3NGZ A;  4EZ9 A;  2BE2 A;  1IH7 A;  5HRS A;  1RBR A;  1CZB A;  4CJV A;  4B9U A;  1RBV A;  2O4G A;  3V1Q A;  3SI6 A;  1DTQ A;  1QE1 A;  3G10 A;  1BGX T;  3KD1 E;  2IC3 A;  4GVM A;  3NHG A;  1C0M A;  3OJU A;  3LP2 A;  4BWM A;  2ZD1 A;  5KGW A;  3TWH A;  1BHL A;  3OS1 A;  4K8X A;  3RMB A;  3ZCM A;  1UA1 A;  4N5S A;  4RG8 A;  2XY8 A;  1U48 A;  4ELT A;  2DTU A;  1XWL A;  4AHU A;  4J2D A;  1KCF A;  1VSF A;  4DU4 A;  4CJS A;  4HHT A;  3B6P A;  1QSS A;  1I3A A;  1YT3 A;  4E1M A;  4BDZ A;  2IDO A;  4DTM A;  4ID5 A;  1JL2 A;  3IG1 A;  2OA8 A;  1QSY A;  3ALY A;  3NF8 A;  1S9E A;  1VSD A;  4OVL A;  4OKE A;  2G8F A;  4JS5 A;  4CF0 A;  4M41 A;  4C8O A;  4WE1 A;  1KSP A;  4H4O A;  4CJQ A;  4FZZ A;  4OLA A;  1C1A A;  1ZBU A;  3DRP A;  4O5B A;  4RW6 A;  3NDK A;  3OS0 A;  4ZHR A;  4FLU A;  1NJZ A;  3OYD A;  2G8H A;  4ZTF A;  1T03 A;  5CZ1 A;  3DMJ A;  3WNG A;  4FJH A;  4FM2 A;  1TK8 A;  4OKJ A;  4DTR A;  2HVH A;  3SQ2 A;  2KTQ A;  4DTO A;  4HCB A;  3HVT A;  3DLR A;  3JSM A;  3DLB A;  2Z1H A;  4CEA A;  1BI4 A;  1L3V A;  4B9V A;  3SPY A;  4DF4 A;  1WSF A;  2PY5 A;  3OYL A;  1BIU A;  4FJI A;  4KV8 A;  3VQ6 A;  3ULD A;  1WSJ A;  4AHT A;  2XY7 A;  3SV4 A;  4FYD A;  1BQN A;  4Z4H A;  1KLM A;  1U45 A;  1VSI A;  1HYZ A;  1S1X A;  4H8K A;  1ASU A;  1JLA A;  2ZQB A;  1KFD A;  4CJW A;  1NK8 A;  3TAN A;  3T3F A;  1LWE A;  3VN5 A;  3DM2 A;  1S1V A;  4Z4I A;  5JS1 A;  2OPR A;  3OYC A;  3SQ0 A;  3V1O A;  1MU2 A;  2HMI A;  2BGG A;  1JXB A;  2JLE A;  1LW2 A;  1RT4 A;  3HK2 A;  3L2Q A;  3QET A;  1K6Y A;  2HHQ A;  3TI0 A;  4F2R A;  2FBT A;  1UWB A;  1NOZ A;  4NYF A;  4CE9 A;  3WNE A;  3KTQ A;  3CFO A;  3K58 A;  1KVC A;  3CM5 A;  4FCY A;  4CIG A;  3PX0 A;  4DTJ A;  1WNS A;  2QXF A;  1UA0 A;  1RTD A;  2KFN A;  2VWK A;  3CG7 A;  4DQP A;  1XHZ A;  3OS2 A;  1QS4 A;  3O3G A;  3ZSV A;  4E3S A;  1NK4 A;  2YNF A;  2R7Y A;  4M3Y A;  4Z4G A;  2A1S A;  3K5L A;  3K2P A;  2F96 A;  4UQG A;  3HPO A;  1T05 A;  1L5U A;  2PZS A;  4B9S A;  2HHW A;  2E6M A;  1HMV A;  1O1W A;  3DI6 A;  4CF9 A;  1SKW A;  1A5X A;  2HB5 A;  2VG6 A;  1IO2 A;  4I7F A;  1NK6 A;  3VQE A;  1XHX A;  2QK9 A;  5D3G A;  5J2Q A;  3VQC A;  4Q0B A;  1BIS A;  4DU1 A;  4DTN A;  1ZBI A;  3LP3 A;  4FJJ A;  3BDP A;  4AHS A;  5CY4 A;  1N6Q A;  2QKB A;  2E4L A;  2EHG A;  4YNQ A;  3NGI A;  2FC0 A;  3O3H A;  3LAM A;  3VQ7 A;  4FVM A;  1LAV A;  2XHB A;  5JS2 A;  4CIF A;  3RR8 A;  4GW6 A;  1S1T A;  4RW7 A;  3HYF A;  1L3U A;  4XIU A;  1IKX A;  4CHN A;  4FK4 A;  1BCM A;  2YV0 X;  1UAX A;  2OPQ A;  3CM6 A;  3E01 A;  3M8Q A;  4CJ5 A;  2IGI A;  4CJK A;  3KIO A;  3C94 A;  1L3S A;  3NF7 A;  2W42 A;  1NOY A;  4FJK A;  3LAL A;  3DLG A;  5K14 A;  1JLQ A;  4KHN A;  2WOM A;  2YNH A;  4E7L A;  2D0C A;  3AA3 A;  2FBX A;  3G0Z A;  3IS9 A;  3L2W A;  1C1B A;  4IFV A;  3NH2 A;  3HL8 A;  1QSL A;  4DLG A;  3LAN A;  2X78 A;  4J2E A;  4FJX A;  1RIL A;  3LPT A;  4DQQ A;  1JKH A;  1JXE A;  4E19 A;  4FJL A;  4CJE A;  4GMJ B;  5KGX A;  4HUF A;  3TAG A;  4M3X A;  4JRP A;  4HUG A;  3ZT4 A;  4FJG A;  3O3F A;  1X9W A;  4FJN A;  1ASW A;  3LZI A;  4E7I A;  3SNN A;  2HNZ A;  3NBP A;  4CGI A;  4CJ3 A;  3CFR A;  2D0B A;  3DOL A;  1Q8I A;  1Z25 A;  3V9Z A;  3UIQ A;  4HCC A;  4DU3 A;  1KVA A;  3LDS A;  1RTI A;  3NGY A;  4I2P A;  2KZZ A;  3NF6 A;  4CF1 A;  3F9K A;  3AVK A;  1F21 A;  4W5O A;  4DTS A;  1J53 A;  3DLK A;  5DMR A;  3KLI A;  1HRH A;  3ZSR A;  2GBZ A;  2VG7 A;  2X6S A;  5SZT A;  2YKM A;  3L3U A;  2DY4 A;  1EET A;  4FLY A;  1RTH A;  4KKO A;  4LSL A;  1KLN A;  4DFJ A;  4ID1 A;  4FLW A;  5C24 A;  3KK1 A;  2F8S A;  3OYA A;  3SCX A;  3I0R A;  1IKV A;  3D45 A;  5FRN A;  1JLE A;  2KW4 A;  3ISN C;  3NH1 A;  4AH9 A;  1T8E A;  4RW9 A;  3RRG A;  4E1N A;  5KRS A;  3V9S A;  2BDP A;  4N76 A;  3NE6 A;  3HP9 A;  3DLE A;  4CFB A;  1KRP A;  3TAF A;  4E7H A;  3V6D A;  1RT1 A;  2X6N A;  2P5G A;  4B9N A;  3SUP A;  4JRQ A;  3SQ4 A;  3VQ5 A;  4DSI A;  5HRN A;  2HNY A;  4Z0U A;  1S9G A;  5KRT A;  3MEC A;  2DFE A;  3T1A A;  4PQU A;  3AO2 A;  3RRH A;  1D9D A;  3NF9 A;  4AIL C;  1S5J A;  1S6P A;  3KKR A;  2PYL A;  5KI6 A;  3RTV A;  3QLH A;  4DMN A;  4B8A B;  4W5Q A;  1LWC A;  1IKY A;  2GV9 A;  4O0I A;  4DQS A;  4IG0 A;  1U4B A;  3OYI A;  4CJ4 A;  1U47 A;  2OZM A;  4C8M A;  1X1P A;  4CEO A;  2YNG A;  4DTP A;  2G8W A;  4FJ7 A;  3HVR A;  5EU7 A;  2B6A A;  4LY7 A;  4CED A;  1VSJ A;  3HJF A;  3U3Y A;  3SV3 A;  4CGJ A;  3LWL A;  4BDY A;  4E89 A;  1VSH A;  4CF2 A;  5DK5 A;  4FLX A;  4DFM A;  1VSL A;  4I9L A;  4OKK A;  3OYJ A;  1VRT A;  4O55 A;  3RWU A;  2D0A A;  1RDC A;  4I9Q A;  3SUN A;  2Y1J A;  2P5O A;  4CIE A;  3S9H A;  4M3Z A;  1RT3 A;  2JGU A;  4DQR A;  3VQ4 A;  1WAJ A;  4Z4F A;  1RDD A;  3TAR A;  3AO3 A;  1HNV A;  4DS4 A;  4RW8 A;  1TV6 A;  4M3U A;  3C95 A;  2Z1G A;  4B8C A;  4M42 A;  3OYN A;  2XY5 A;  2XO7 A;  1BQM A;  1TAQ A;  4ZTJ A;  4OJR A;  3KK2 A;  5J2N A;  1JLC A;  4NCB A;  4QCL A;  4LH4 A;  1J5O A;  3VQQ A;  3QIO A;  4CJT A;  2NUB A;  2YKN A;  1J54 A;  4FLZ A;  3PY8 A;  2P1J A;  3WNF A;  5HLF A;  4CJR A;  3DYA A;  2I5J A;  4IDK A;  3S3O A;  3NAE A;  1A5V A;  4FJ9 A;  2HVI A;  2ATQ A;  2HHT A;  4FM1 A;  1ITG A;  3OYE A;  4C8K A;  1UOC A;  5J1E A;  1WAF A;  4F4K A;  4Q5V A;  1YTA A;  3ZSO A;  3L8B A;  4FZX C;  3QNN A;  1DTT A;  2FBY A;  1FKO A;  4MQ3 A;  4CJP A;  4CF8 A;  1HNI A;  3ZT3 A;  1J9A A;  2Y1I A;  3CYM A;  4M45 A;  1N5Y A;  4CHO A;  4JS4 A;  3AVG A;  3M8S A;  1VSE A;  4FJ8 A;  3NFA A;  1KFS A;  1SKR A;  1SL2 A;  2X74 A;  1NKB A;  3HO1 A;  3P1G A;  3AVA A;  4CER A;  4KFB A;  1X9S A;  1SL0 A;  3AVC A;  4PA1 A;  3KLF A;  1EX4 A;  1RCH A;  1HYV A;  3NH0 A;  1HQE A;  1GOC A;  4BWJ A;  1TGO A;  3KD5 E;  3DOK A;  2B5J A;  4FLV A;  1REV A;  1RBT A;  4W5T A;  1C0U A;  4OGE A;  2KFZ A;  2YHA A;  4FW2 A;  1D9F A;  3VA0 A;  3A2F A;  3QEX A;  2ETJ A;  4R5P A;  4KTW A;  4QOZ B;  3M8P A;  4MFB A;  4KO0 A;  5CZ2 A;  4F8R A;  1WN7 A;  2IAJ A;  4DSF A;  3QIN A;  3VQD A;  3H08 A;  3V1R A;  3WNH A;  1B9F A;  3QEW A;  4DSL A;  4HVJ A;  3K57 A;  1XI1 A;  4Z4E A;  3AO5 A;  3THV A;  4DFP A;  3V9U A;  5HRO A;  1NK0 A;  4PUO A;  4ICL A;  3LPU A;  1W9H A;  3MEE A;  3VQ9 A;  3V9W A;  3KLE A;  5J2P A;  4FJM A;  4EP5 A;  3AA4 A;  3OVN A;  1U04 A;  2BAN A;  4W5N A;  4J2B A;  4F3T A;  1CXU A;  1BIZ A;  3QEV A;  2D5R A; 
#chains in the Genus database with same CATH topology
 4YOR A;  2DFH A;  1WOQ A;  3S3N A;  1B9D A;  3CJA A;  4KPY A;  4A5B A;  3GBT A;  4PL7 A;  4CEB A;  3MN5 A;  1LV5 A;  1C6V A;  3VF2 A;  3A8Y A;  4N41 A;  4DR1 K;  2HND A;  1T7P A;  1TVR A;  4A5A A;  1ATN A;  3ZSW A;  4B9T A;  3ZET B;  4AHR A;  4CCH A;  2E2O A;  5M1N A;  5FDL A;  3LDN A;  2HHV A;  3M6G A;  1U49 A;  1W0H A;  1NK7 A;  1K8K B;  4BE0 A;  1XMO K;  5M1Q A;  2HBJ A;  3EY1 A;  1CXQ A;  5J2M A;  2ZJQ L;  3MXM A;  4MO4 A;  2XY6 A;  4Z94 A;  3C7N A;  1B92 A;  3TAP A;  3VF4 A;  3B6O A;  1SV5 A;  3CCU N;  4O4G A;  2H3G X;  1TYQ A;  3VER A;  1XQS C;  4IBN A;  1NGF A;  1NGE A;  3TAE A;  3UE5 A;  4Y1C A;  3AVI A;  5FPD A;  4FXD A;  3TTD A;  5BPL A;  1Y97 A;  2VQF K;  4DQ8 A;  4ELV A;  4JHD A;  4E7J A;  3CFP A;  5AZI B;  3T7Z A;  3WQT A;  3R6M A;  1KRP A;  4C8K A;  2FBV A;  4B08 A;  3RMC A;  3KZB A;  1A5W A;  3T69 A;  4AHC A;  4JN4 A;  1TKZ A;  1S22 A;  2HF3 A;  3SMP A;  1T6C A;  1CLQ A;  2OCE A;  4NYN A;  4FOI A;  3VQP A;  1TKT A;  4JNE A;  4F9O A;  3QER A;  2UUB K;  4B1Y B;  4C8L A;  4BC4 A;  3PX6 A;  5HBM A;  3AVL A;  2OYQ A;  2G8V A;  1OVY A;  2P51 A;  3AVF A;  2QTD A;  3V9X A;  3LAK A;  3GL1 A;  5HL7 L;  3VA3 A;  2YHB A;  3OYK A;  1N36 K;  4CGD A;  4JKA A;  3RMA A;  3SYZ A;  3AVH A;  5HRP A;  1QHA A;  4FK2 A;  3AGR A;  4DQI A;  1BUP A;  3SQ1 A;  4K41 A;  5AQP A;  3L0Q A;  4BRD A;  2P9P B;  2QI2 A;  1RGI A;  2E8A A;  4CGG A;  3ZT2 A;  1HNW K;  4L8R B;  3ENH A;  3I33 A;  4U67 L;  1M1K O;  1ZBL A;  2G8K A;  3ZLJ A;  3R1X A;  2BTF A;  3CCQ N;  4DF8 A;  2QKK A;  3PO4 A;  2ZE2 A;  3MN7 A;  1N32 K;  5EOY A;  3VQB A;  4FW1 A;  4WFN L;  2VQE K;  2DFF A;  3E9O A;  4BY9 C;  5C10 A;  2HHU A;  4KH5 A;  4KB1 A;  2O8B B;  4H5V A;  3CC2 N;  2HHH K;  3MXJ A;  4KI6 A;  3LZJ A;  1VQK N;  3PV8 A;  4DS5 A;  4JV5 K;  3HPH A;  4DUZ K;  1YVU A;  1Q18 A;  3OBY A;  3M8R A;  3CD6 N;  4LSN A;  2OPS A;  4CZJ A;  3S41 A;  1IH7 A;  5HRS A;  1G99 A;  4Y0W A;  1Z6R A;  3V1Q A;  3H1V X;  4HTL A;  1BA1 A;  1DTQ A;  3G10 A;  5AQI A;  3KD1 E;  2QWL A;  2QEX N;  1Z05 A;  3O9T A;  3O9S A;  4GVM A;  4BWM A;  5KGW A;  3TWH A;  4BR9 A;  1UA1 A;  2OTL N;  1VSF A;  4HHT A;  4E1M A;  4FPA A;  4DTM A;  5AQL A;  4DR5 K;  4OKE A;  4JS5 A;  4BRO A;  4CJQ A;  4L3Q A;  3OYD A;  2HBL A;  1T03 A;  4DV6 K;  3O5B A;  4OKJ A;  4DTR A;  3CPW M;  2OAN A;  4HCB A;  4DV2 K;  4X62 K;  1BI4 A;  1BG3 A;  4MDB A;  3SPY A;  4DF4 A;  2ZWH A;  4CZI A;  1BIU A;  4FJI A;  3C7N B;  3R3L A;  1HPM A;  4Z4H A;  4H8K A;  2ZQB A;  1KFD A;  1TYQ B;  3TAN A;  4LF5 K;  3CMA N;  4FPB A;  4I6M A;  3DM2 A;  2E20 A;  4JKD A;  4BR0 A;  4IO9 L;  2BGG A;  2JLE A;  3TPQ A;  3QET A;  4JHD B;  3NMU A;  1NMN A;  3J7Z O;  3BY5 A;  3TI0 A;  4F2R A;  2FBT A;  4NYF A;  2A40 A;  4DTJ A;  3PIP L;  3HI0 A;  3CG7 A;  3SJH A;  3O3G A;  1NK4 A;  4M3Y A;  4NLB A;  1T05 A;  1L5U A;  2HHW A;  3G6E N;  2HB5 A;  2VG6 A;  5KQ8 A;  1XHX A;  4LFC K;  5AQT A;  4DTN A;  2QWN A;  3BDP A;  3O08 A;  2HMP A;  4GV6 A;  1LAV A;  3BF3 A;  2O8E A;  3HYF A;  1L3U A;  4XIU A;  4CHN A;  2YV0 X;  2OPQ A;  3M8Q A;  4LC9 B;  1SS6 A;  4X64 K;  3LAL A;  3DLG A;  5K14 A;  1JLQ A;  3VOV A;  2WOM A;  2YNH A;  3VGK A;  1NGD A;  2FF6 A;  3G0Z A;  1C1B A;  4IFV A;  3HL8 A;  3MWP A;  5ADX A;  4DQQ A;  3LPT A;  1JKH A;  4HUF A;  1JCE A;  4FJG A;  3O3F A;  4FJN A;  4E7I A;  2HNZ A;  1QZ6 A;  3CFR A;  4CJ3 A;  2CH6 A;  5ADX H;  4DU3 A;  3M3Z A;  1RTI A;  4O5F A;  3SBG A;  4ILJ A;  3ENB A;  4CF1 A;  5DMR A;  1V4S A;  4H0Y B;  1RTH A;  3N4P A;  4KKO A;  4FLW A;  3QBW A;  3DAW A;  3T1Y K;  3ISN C;  3TTC A;  3HSC A;  2D0O A;  1T8E A;  5KRS A;  3DJC A;  2BDP A;  4CZM A;  1MWM A;  1GLL O;  4WQ4 C;  2O8F B;  1KXP A;  1YF5 L;  3K0S A;  3KHY A;  2HNY A;  4NLC A;  2DFE A;  4AIL C;  1S6P A;  2PYL A;  5KI6 A;  1HR0 K;  1YAG A;  2QWP A;  2GV9 A;  4DQS A;  4CJ4 A;  3VMF B;  4C8M A;  2G8W A;  2YNG A;  4DTP A;  4CED A;  3D2E A;  4E89 A;  1GLD G;  4ILG B;  4O55 A;  3ZX3 A;  2D0A A;  4I9Q A;  3SUN A;  4CIE A;  2EWS A;  1RT3 A;  1HX1 A;  3VQ4 A;  1WAJ A;  4O8K A;  3TAR A;  4RW8 A;  3HZ6 A;  5AFU H;  4WQ4 A;  4M3U A;  4B8C A;  4M42 A;  1OH7 A;  3OYN A;  5HOO A;  1TAQ A;  1KD1 O;  4KH4 A;  4LH4 A;  1J5E K;  1J5O A;  3VQQ A;  5FPM A;  3QIO A;  4CJT A;  2YKN A;  2P1J A;  3EE8 A;  3WUH A;  1U2V A;  3S3O A;  1T3V A;  3CPE A;  4PKG A;  3FFK B;  4Q5V A;  3L8B A;  4JAX A;  4FZX C;  2FBY A;  1FKO A;  4CJP A;  1HNX K;  4C1N I;  3EZW A;  1J9A A;  3EKU A;  4UY8 O;  3VEN A;  1VQP N;  4DV1 K;  2ZF5 O;  3PSI A;  1SKR A;  5GAG P;  4JKH A;  1DKG D;  1SL0 A;  4PA1 A;  5BN9 A;  4BR4 A;  1EX4 A;  1HYV A;  2QWR A;  5C12 A;  4BWJ A;  1GOC A;  5F0X A;  4BRN A;  3DOK A;  1P8Z A;  1REV A;  2QM1 A;  4OGE A;  2YHA A;  3QEX A;  2ETJ A;  4CZF A;  4KTW A;  3J81 O;  4QOZ B;  4KO0 A;  2E2P A;  4DSF A;  3H08 A;  3V1R A;  3WNH A;  1B9F A;  1E4F T;  4HVJ A;  1VQ9 N;  4Z4E A;  1WUA A;  3ID8 A;  3V9U A;  3C6H A;  1NK0 A;  2V52 B;  4BRL A;  4KH6 A;  4F3T A;  1CXU A;  2D5R A;  1D8Y A;  1S1U A;  3CJC A;  4B1Z A;  3AO4 A;  4PY5 A;  2UU9 K;  2VGN A;  3UKU A;  4EZ6 A;  3FE1 A;  5AQG A;  2O8E B;  4CFA A;  3CC4 N;  1Q82 O;  1L3T A;  1K9M O;  4ELU A;  4KHW A;  4H5T A;  4X66 K;  4HTU A;  1ZC6 A;  3DWL A;  4DFK A;  4JKC A;  4BR7 A;  4FK0 A;  5HRR A;  3QES A;  3SUQ A;  5EVZ A;  3J7Y P;  4JYA K;  1K73 O;  1V4T A;  4F2S A;  2YHW A;  3VTH A;  1LW0 A;  4ISE A;  1S1W A;  1FK9 A;  1BWF O;  3ZT1 A;  4CHY A;  1ATR A;  4OLB A;  1N34 K;  4FJ5 A;  3GOI A;  3JS6 A;  2ZJR L;  4O0J A;  4CK1 A;  3DLH A;  4B3M K;  1NKE A;  1XMQ K;  2ZGZ A;  3V81 A;  1ZXO A;  3AVJ A;  4YDU A;  1XC9 A;  4KBO A;  5AQX A;  4IFE A;  3FR0 A;  2FSK A;  1TAU A;  4LH5 A;  3HT3 A;  2HW3 A;  1YVN A;  4HUE A;  3SZ2 A;  4Z4C A;  4X65 K;  2ASM A;  5SWM A;  1EXQ A;  4B3S K;  1LAW A;  5LJW A;  1QQC A;  4K43 A;  5C25 A;  2E88 A;  4CHZ A;  2NZT A;  5FPE A;  4KB0 A;  4CJF A;  4JK9 A;  3K5M A;  4DG1 A;  2Z1J A;  1C0G A;  4CFC A;  3I8D A;  2IS3 A;  5CYM A;  2E6L A;  2Q3S A;  5C2D A;  3AVM A;  3OYF A;  1HQU A;  3D2E B;  1M90 O;  3LWM A;  3GDQ A;  3OYM A;  4FVU A;  1FXX A;  1SKS A;  5JLF A;  1VQ6 N;  5IWA K;  1SUQ A;  3AA2 A;  3KK3 A;  4DSE A;  1TKD A;  1VSK A;  3MCP A;  3E66 A;  4CEC A;  4CI6 A;  1HKG A;  2Z1I A;  2AP1 A;  3HPG A;  2PBD A;  1LOT B;  1MWK A;  4BG8 A;  3TSP A;  1Q7Y O;  3MXI A;  5BPM A;  3AO1 A;  4BRG A;  5EY4 A;  3O4N A;  3S3M A;  1U2V B;  4EFH A;  2ZM6 K;  3JXU A;  4FZY A;  3K59 A;  1IG8 A;  3J8A A;  5EX5 A;  1RDB A;  2AJQ A;  2G8U A;  4CZG A;  1TUU A;  1HLU A;  4K42 A;  1WB9 A;  4FWN A;  1SL1 A;  3RR7 A;  2HHS A;  3HOT A;  4E0D A;  1NGC A;  4JK8 A;  5AQK A;  1ASV A;  3V4I A;  3OTO K;  4JKF A;  1YTU A;  4DV3 K;  1IG9 A;  2HBK A;  1NNE A;  4B3O A;  4CZL A;  1EP4 A;  4QAG A;  3DXM A;  2YJE A;  1C0T A;  1G15 A;  1NK9 A;  3TU5 A;  3JYT A;  4JKG A;  3HP6 A;  3AA5 X;  4YOW A;  3FZL A;  3LL3 A;  2HHX A;  4FWQ A;  4CK2 A;  5I3U A;  3QO9 A;  3MX2 A;  1RBS A;  3IAY A;  3PX4 A;  4MLH A;  4N56 A;  4DSJ A;  3THX B;  3O9U A;  1RDA A;  1RT7 A;  2IOC A;  1X3N A;  2GUP A;  3WQU A;  4M3T A;  4G1Q A;  3UKU B;  1SZ2 A;  4A62 A;  2BE2 A;  3SLC A;  1CZB A;  4CJV A;  1RBV A;  4DR2 K;  3SI6 A;  1QE1 A;  3U9D A;  3CCL N;  5TKW A;  3VEO A;  2IC3 A;  3NHG A;  4OPH A;  5AQQ A;  3OJU A;  3K9K A;  2ZD1 A;  3OS1 A;  4K8X A;  3ZCM A;  3H3O B;  4N5S A;  1U48 A;  4ELT A;  3ATV A;  3B6P A;  3KK7 A;  4BDZ A;  4DB3 A;  4BRP A;  2OA8 A;  1QSY A;  3ALY A;  2IVP A;  3WXI A;  3OW2 M;  2G8F A;  1J6Z A;  1Y64 A;  4FWP A;  1KSP A;  4H4O A;  3IDH A;  4RW6 A;  3DRP A;  4WCE L;  4ZHR A;  4ZTF A;  5CZ1 A;  2FF3 B;  3DMJ A;  3WNG A;  2QXL A;  4JEP A;  2NRW A;  2KTQ A;  1NGG A;  4AF1 A;  2YJF A;  3HVT A;  3DLR A;  3JSM A;  1L3V A;  1ATS A;  1WSF A;  1YJN N;  5AJ3 K;  3ULD A;  4AHT A;  4H0P A;  2XY7 A;  3SV4 A;  4FYD A;  2GX9 A;  1ASU A;  4CJW A;  4H0V B;  4IOX A;  2GTD A;  5DM7 L;  4B1V A;  4GKK K;  3HK2 A;  1LW2 A;  1RT4 A;  3L2Q A;  5KPR A;  3F5T A;  3Q7B A;  1K6Y A;  2HHQ A;  3WNE A;  3CFO A;  4LFA K;  3CM5 A;  1UA0 A;  3ENO A;  3IFR A;  3RSE B;  2VWK A;  3VEX A;  3ZSV A;  2E5L K;  2YNF A;  5GIN A;  4Z4G A;  5M1K A;  1NGJ A;  4G9Z A;  2E6M A;  5JMV A;  3R8E A;  1IBK K;  4FWL A;  3VQE A;  3WXJ A;  4V19 S;  5D3G A;  3O6W A;  4Q0B A;  5AQN A;  4FJJ A;  1YJW N;  3WXL A;  1N6Q A;  1QZ5 A;  2E4L A;  3O3H A;  2XHB A;  4CIF A;  2E2N A;  4CJK A;  4JI4 K;  3CM6 A;  3E01 A;  4CJ5 A;  5KPT A;  3C94 A;  4A2A A;  4C23 A;  1NOY A;  4KHN A;  5AR0 A;  4M7Y A;  2CGL A;  2FBX A;  3IMX A;  3Q7C A;  3IS9 A;  3AY9 A;  1QSL A;  4J2E A;  2X78 A;  1RIL A;  4FJL A;  1N33 K;  4GMJ B;  1TUY A;  3TAG A;  2O8D A;  3AAR A;  1VQ8 N;  1YI2 N;  3NBP A;  3UIQ A;  3PSF A;  1Q8I A;  3CCE N;  1KVA A;  3LDS A;  4I2P A;  2KZZ A;  2JWK A;  4W5O A;  4CBU A;  3ZSR A;  2GBZ A;  2VG7 A;  2X6S A;  4B1W B;  3DXM B;  5C2F A;  3OA9 A;  5JVG L;  3D2F A;  4ID1 A;  4JKG B;  4CBX A;  3KK1 A;  2F8S A;  1GLJ O;  3CJB A;  3VEV A;  1IKV A;  3O8M A;  5FLX O;  4AH9 A;  2BH1 A;  4RW9 A;  3RRG A;  4IXC A;  4E1N A;  5GAE P;  4N76 A;  3NE6 A;  5CR4 A;  1NGA A;  4JI8 K;  1XUP O;  3TAF A;  3V6D A;  2P5G A;  3SQ4 A;  1NBW A;  3DXK A;  5AQH A;  3T1A A;  5JVH L;  4PQU A;  1S5J A;  1JCF A;  3KKR A;  2WC9 A;  2RHK A;  3W3D A;  3B8A X;  4JI6 K;  4DMN A;  5ELZ A;  4W5Q A;  4YOX A;  1IKY A;  4DUY K;  4JD2 A;  2OZM A;  1X1P A;  3HVR A;  3VEZ A;  1VSJ A;  3U3Y A;  1JJ2 M;  3SV3 A;  3LWL A;  4BDY A;  3QIC A;  4CF2 A;  4BC5 A;  5DK5 A;  4FLX A;  3FZF A;  3BUZ B;  4OKK A;  3SK3 A;  2KKZ A;  1VRT A;  2NRZ A;  2QW9 A;  5BR8 K;  3RWU A;  1RDC A;  5AQJ A;  2P5O A;  3S9H A;  2JGU A;  4DQR A;  1RDD A;  1NGB A;  3AO3 A;  4DS4 A;  1NGH A;  4YOY A;  1TV6 A;  3C95 A;  3VGM A;  2Z1G A;  4B1X B;  1BQM A;  3M5R A;  3G71 N;  4NCB A;  3KK2 A;  1HUX A;  1JLC A;  1OKJ A;  3VET A;  5AZJ A;  3DYA A;  4IDK A;  4FJ9 A;  2HHT A;  2ATQ A;  3OYE A;  1UOC A;  1N8R O;  1K8A O;  4F4K A;  1DTT A;  3CYM A;  1FW6 A;  4CHO A;  2CGJ A;  4JS4 A;  3AVG A;  1KFS A;  5LY3 A;  4B9Q A;  4B3R K;  4KFB A;  3MN6 A;  4FOE A;  5M1O A;  4CZK A;  3TSQ A;  2Q1N A;  3U8X A;  4FLV A;  1VQ5 N;  4W5T A;  3FZM A;  1C0U A;  2KFZ A;  2BUP A;  3VA0 A;  3A2F A;  1RDU A;  3M8P A;  1KAZ A;  2GEL A;  4K0K K;  3VQD A;  3H3N O;  4WYB A;  3QEW A;  2W40 A;  1QVG M;  3THV A;  3MK6 A;  3LPU A;  3BEX A;  3V9W A;  5J2P A;  4FJM A;  4FWK A;  4J2B A;  2NNW A;  1EWR A;  1LWF A;  3C6T A;  4OO1 J;  1WSI A;  4CGF A;  3DRR A;  3F2K A;  4E7K A;  4KTZ A;  3H46 O;  3QNO A;  1X9J A;  5AQU A;  4N47 A;  4BE1 A;  3TAQ A;  3LDL A;  4DR6 K;  1HPZ A;  3EZ5 A;  2A41 A;  1NJY A;  1RT5 A;  3CF5 L;  2ITM A;  3SMS A;  1HYS A;  4MO5 A;  2I7N A;  3EEQ A;  1RBU A;  5FPN A;  3U6F A;  2A3Z A;  5LL6 Z;  1KAY A;  4C1N K;  2O8D B;  3VQ8 A;  4A61 A;  2RKI A;  1JLG A;  3I0S A;  3I55 N;  4EP4 A;  2KQ2 A;  1FKP A;  2NLX A;  1WSE A;  3IRX A;  4DCH A;  3AVB A;  3HM8 A;  1ZYQ A;  3BGR A;  2ASP A;  4CD3 A;  4KRF A;  4CZH A;  3ITH A;  2UXC K;  1OH8 A;  2W6K A;  4BRM A;  3LDP A;  4AM6 A;  4RCH A;  3HOS A;  1TK5 A;  1KTQ A;  3U3G A;  3D2F B;  1BOT O;  4KI4 A;  2P9L A;  2RN2 A;  2LSN A;  4B1U B;  4CEF A;  5AFU A;  2QA4 N;  1TK0 A;  1RT2 A;  4JLH A;  4JI1 K;  5KTQ A;  2ZJP L;  3EE9 A;  3P5J A;  4FSV A;  3L2R A;  5FRO A;  1Z26 A;  3VEY A;  2O4I A;  5KQD A;  2O8C A;  3DXK B;  4BRA A;  3QEI A;  2V51 B;  3P4I A;  4DTX A;  1JLF A;  3LZI A;  4XH1 A;  3WEE A;  4CJU A;  4JD2 B;  4KHU A;  2VWJ A;  3L3V A;  1GOB A;  2RPI A;  1VSM A;  1BI4 B;  1TL3 A;  3LP0 A;  4XH5 A;  4H0T B;  1WSH A;  3FZH A;  4CW7 B;  4WFA L;  3T1H K;  2VCP A;  1HJO A;  1BA0 A;  1X3M A;  4EIA A;  4YY3 K;  1NK5 A;  3OY9 A;  2PYJ A;  4AHV A;  4YFU A;  3KLG A;  5AQV A;  4KHQ A;  4I6M B;  2V7Y A;  1ZBH A;  4BRH A;  4CEE A;  5A2Q O;  4CGH A;  3I56 N;  1E4G T;  4C8N A;  4J2A A;  4DR4 K;  1BCO A;  1TKX A;  2VWB A;  4LF9 K;  2FLO A;  3MAQ A;  3SUO A;  2HOE A;  3MED A;  1NMD A;  4JI3 K;  1ESV A;  4PKH A;  2XRI A;  4E1J A;  4CVN E;  4CBW A;  3HM9 A;  3EYZ A;  3HXM A;  3FFI A;  4B9L A;  1KVB A;  1YJ9 N;  4NCA A;  2RF2 A;  4I2Q A;  3MEG A;  1NJW A;  2F8T A;  1LCU A;  4TSX A;  3OJS A;  3LDQ A;  4CK3 A;  1NGI A;  3KJV A;  4BRQ A;  1S6Q A;  4CEZ A;  1VAZ A;  3L2U A;  1I39 A;  1IBL K;  4CZE A;  3AVN A;  4B9M A;  4H4M A;  3O80 A;  1Q9Y A;  3ZSY A;  3VQA A;  3F73 A;  4KHS A;  3K5N A;  3EN9 A;  1RDW X;  1WLJ A;  2NRX A;  4KHP K;  3PUF A;  3T19 A;  1BL3 A;  3TR8 A;  4K8Z A;  4BR2 A;  3ZSQ A;  4O44 A;  5LJV A;  3AAQ A;  3ASM A;  5T7B A;  3NGZ A;  4PKI A;  3BP8 A;  4HWI A;  4BC3 A;  4O8U A;  1BHL A;  2XY8 A;  1BU6 O;  1XWL A;  4AHU A;  3P31 A;  1E3M A;  5BRD A;  4XH4 A;  1I3A A;  3A5L C;  3CIP A;  2IDO A;  4ID5 A;  3AGK A;  3EKS A;  3NF8 A;  1S9E A;  1VSD A;  2PAV A;  2P9I A;  4M41 A;  4C8O A;  4WE1 A;  5E84 A;  4FZZ A;  1C1A A;  1ZBU A;  4MLE A;  1NJZ A;  4FLU A;  3CER A;  5AQR A;  3ZX2 A;  4FM2 A;  1TK8 A;  5I9E B;  4LF8 K;  3SQ2 A;  2HVH A;  1W2B M;  2CGK A;  4BC2 A;  3DLB A;  4DV0 K;  4LF7 K;  3DLL L;  4CEA A;  3LM9 A;  4KV8 A;  3VQ6 A;  1WSJ A;  1YIT N;  1EWQ A;  1BQN A;  1KLM A;  5BRF A;  3QB0 A;  2P9L B;  1S1X A;  1JLA A;  5LMU K;  3VN5 A;  3SAH A;  4QS9 A;  1ZBS A;  4BRI A;  5JS1 A;  3OYC A;  3SQ0 A;  1VQO N;  4YOV A;  2HMI A;  5H1S Q;  2NRR A;  2QWM A;  3O4W A;  4EHU A;  4PHT X;  2O8C B;  1GLE G;  3K9J A;  3CC7 N;  3HBT A;  1UWB A;  4FCY A;  3PX0 A;  3WEE B;  3FGU A;  1WNS A;  1RTD A;  4NB4 A;  3NVK A;  3FZK A;  1QS4 A;  2P9P A;  4E3S A;  2A1S A;  2F96 A;  4UQG A;  2PZS A;  4B9S A;  3DI6 A;  3H1Q A;  1A5X A;  1NK6 A;  4GY2 B;  1SKW A;  2YHX A;  4DV7 K;  4GKJ K;  2QK9 A;  1YIJ N;  4H0X B;  5J2Q A;  4BRF A;  1BIS A;  4DU1 A;  1ZBI A;  3LP3 A;  4AHS A;  5CY4 A;  3CHW A;  2FC0 A;  4WFB L;  4FVM A;  3IKM A;  4GW6 A;  1S1T A;  4BVP A;  1WBB A;  4ILH A;  4FK4 A;  1OH6 A;  1BCM A;  1FJG K;  2IGI A;  3U9Z A;  2E1Z A;  4BVO A;  1L3S A;  5BR9 A;  2W42 A;  4IZ9 A;  3L4I A;  1MA9 B;  2F9T A;  2E1Y A;  2Q31 A;  2D0C A;  3UKR A;  4E7L A;  2UYT A;  3MDQ A;  3QDK A;  3L2W A;  3CME N;  4DLG A;  3LAN A;  3D7E O;  1KC8 O;  4IJA A;  4YOU A;  4E19 A;  4H5N A;  1EQY A;  4M3X A;  2IVO A;  4JRP A;  3ZT4 A;  3J80 O;  1X9W A;  1CZA N;  1OH5 A;  3DOL A;  1Z25 A;  3PLA A;  2YX6 A;  3NGY A;  1HKB A;  1J53 A;  3H6E A;  3KLI A;  3CCM N;  3A5O C;  5SZT A;  1HNZ K;  3WXK A;  4FLY A;  4DFJ A;  5JIC A;  3SCX A;  2VGM A;  2W6L A;  3D45 A;  5FRN A;  4QS7 A;  1R59 O;  4CFB A;  3VGL A;  1D4X A;  3HRG A;  1DEJ A;  4FWM A;  4DSI A;  4Z0U A;  5KRT A;  3MEC A;  1ILY A;  2HBM A;  3RRH A;  1D9D A;  2Q36 A;  4H5W A;  3QLH A;  4B8A B;  5F2R A;  1LWC A;  3A5N C;  4O0I A;  1YUW A;  5BPN A;  1U4B A;  3QML A;  4CEO A;  2DPN A;  2B6A A;  2CH5 A;  3IUC A;  1GLC G;  4CGJ A;  1S72 N;  4DFM A;  4IJN A;  1SQK A;  4I9L A;  1VSL A;  3ZX0 A;  3OYJ A;  3KWG A;  1NU0 A;  2A5X A;  3AAP A;  4M3Z A;  2D4W A;  4Z4F A;  2ASO A;  1HNV A;  5AQM A;  4IWV A;  3OBW A;  2P9I B;  2XY5 A;  5J2N A;  1JCG A;  4QCL A;  5AQW A;  4BQZ A;  1XNQ K;  4FLZ A;  3PY8 A;  3WNF A;  4CJR A;  3NAE A;  3BF1 A;  1QQM A;  1GLF O;  5J1E A;  3THW A;  3ZSO A;  3QNN A;  4DV4 K;  1NLV A;  2E2Q A;  4MDA A;  4MQ3 A;  2QWO A;  1HNI A;  4GNI A;  4M45 A;  1KQS M;  2F9W A;  1QQN A;  2V7Z A;  1VSE A;  1OVQ A;  2X74 A;  3RVC A;  3QFP A;  1NKB A;  3P1G A;  4CER A;  5CE3 A;  3AVC A;  5AQS A;  3CJ9 A;  2UXD K;  3NH0 A;  4K25 A;  1HQE A;  1TGO A;  4JI2 K;  3O9R A;  2B5J A;  1XNR K;  3O1W A;  1O13 A;  4FW2 A;  4R5P A;  5CZ2 A;  4F8R A;  3QIN A;  2AA4 A;  5AQO A;  3K57 A;  1XI1 A;  3L6Q A;  4DFP A;  1W9H A;  3O9Q A;  4EP5 A;  3AA4 A;  2BAN A;  3W0L A;  4W5N A;  2I7P A;  1BIZ A;  3QEV A;  1HJR A;  3HST B;  4DSL A;  3PO5 A;  3LP1 A;  1VQM N;  3PIO L;  1X9M A;  3DRS A;  2P9S A;  2YNI A;  5M1P A;  3ZSX A;  1SAZ A;  2IIR A;  4H0O A;  4RWT A;  3MMV A;  4CHQ A;  2YHY A;  2NRH A;  5FRM A;  3CCJ N;  2GUI A;  2NRV A;  5E26 A;  4NO7 A;  4CEQ A;  3UKR B;  3NCI A;  3ZT0 A;  1EO1 A;  2O8F A;  3HTV A;  1IBM K;  4LD0 A;  5GIO A;  4BE2 A;  4OPA A;  2ITG A;  3CCR N;  1DGK N;  4KTQ A;  1RTJ A;  3OYB A;  3RMD A;  2WON A;  2Q2R A;  1NG9 A;  1D5A A;  4KRE A;  3LM2 A;  4KHY A;  4IEI A;  4CJL A;  5LMN K;  4OGC A;  4CD1 A;  2KLA A;  1R0A A;  4BGA A;  2UUC K;  4YOT A;  5BN8 A;  3P38 A;  2ZGY A;  4B3T K;  5E41 A;  3OYH A;  2OPP A;  1RNH A;  3K5O A;  5GIP A;  3ZSZ A;  2P9N A;  3G25 A;  1TL1 A;  4CES A;  2A6A A;  3TAB A;  3SJJ A;  4IFY A;  4CFD A;  3KVG A;  4PWD A;  3E1Y A;  4CJ7 A;  2YCH A;  3VES A;  1RT6 A;  3MX5 A;  4FM0 A;  3KLH A;  4BDP A;  4DTU A;  1S3X A;  3QIP A;  3I8B A;  4DSK A;  1ZBF A;  4EHT A;  4M3R A;  5GAD P;  2PFU A;  4GVE A;  1QHT A;  4OX9 K;  1VRU A;  1IKW A;  1VK0 A;  1GLA G;  5CYQ A;  1QTM A;  4BAC A;  3CXC M;  3KWI A;  1QVF M;  4RW4 A;  4DLE A;  2WUS A;  2VYP A;  2KZM A;  2WFB A;  5TKY A;  2B4J A;  3C6U A;  4XEI A;  1C1C A;  3D0P A;  4FLT A;  3OYG A;  5JLH A;  1NKC A;  5HP1 A;  2NRT A;  3O4Q A;  3R9P A;  3KKS A;  4ISG A;  1CZ9 A;  3QEP A;  1T6D A;  2OZS A;  2A1R A;  1Q81 O;  4KAZ A;  2OTJ N;  4R79 A;  4IG3 A;  3WXM B;  5I42 A;  4BGB A;  1GLB G;  2G8I A;  3AV9 A;  1NJX A;  1P90 A;  2QWQ A;  2EX3 A;  2Q0R A;  5DM6 L;  3L2V A;  3THW B;  4BRK A;  4IEE A;  4U7B A;  4DWI A;  1DT9 A;  3CQY A;  3CJ1 A;  1WSG A;  5C42 A;  3E9L A;  3FLC O;  1Q9X A;  4FWR A;  4DR7 K;  4AQY K;  1GOA A;  4M3W A;  3WT0 A;  1EKE A;  4F3O A;  5AQY A;  3ULE A;  1KAX A;  2FSN A;  4NCG A;  4W5R A;  3P83 D;  4GV3 A;  4Y1D A;  4CHP A;  3SPZ A;  4JKB A;  3CJ7 A;  5CHI A;  4JI7 K;  1DLO A;  2VG5 A;  3TAM A;  3TTF A;  4IKF A;  1JL1 A;  3E9P A;  4BQL A;  2A42 A;  2GWK A;  3CQ8 A;  1JLB A;  4OPJ A;  4OPK A;  4A57 A;  1QQO A;  2HF4 A;  4EZ9 A;  4IOC L;  3CQX A;  4FO0 A;  2P9S B;  1RBR A;  4B9U A;  2O4G A;  3THY A;  1VQN N;  1BGX T;  1NM1 A;  1VQ7 N;  1C0M A;  3LP2 A;  2GEM A;  3RMB A;  4RG8 A;  2DTU A;  4J2D A;  1KCF A;  4DU4 A;  5MLC Q;  1C0F A;  4CJS A;  4JI0 K;  4QS8 A;  1QSS A;  1YT3 A;  3J7A P;  3VPZ A;  3ZEU A;  1JL2 A;  3C65 A;  3IG1 A;  4AM7 A;  4OVL A;  4IO8 A;  5AQZ A;  3LDO A;  4DHY A;  4CF0 A;  1IV0 A;  4OLA A;  3KD5 E;  3BZC A;  4O5B A;  3VTI A;  3NDK A;  3OS0 A;  2G8H A;  3EL2 A;  4YHH K;  3QFU A;  4FJH A;  3C0B A;  4DTO A;  3SAG A;  1NJI O;  2Z1H A;  3TSU A;  3GG4 A;  3L4Q A;  4H03 B;  4B9V A;  4DR3 K;  2WTU A;  2PY5 A;  3OYL A;  1Q86 O;  2P9N B;  1U45 A;  1VSI A;  1HYZ A;  1NK8 A;  3T3F A;  1LWE A;  4NXM K;  1S1V A;  4Z4I A;  2OPR A;  4J8F A;  4M63 C;  2P9K A;  1MU2 A;  4FL9 A;  3V1O A;  1JXB A;  2P9U A;  2W41 A;  1NOZ A;  1H1V A;  4CE9 A;  3KTQ A;  5AZJ B;  2WBN A;  1HKC A;  2D0P A;  1KVC A;  3K58 A;  4CIG A;  2QXF A;  4LF4 K;  2KFN A;  3MCA B;  4DQP A;  1XHZ A;  3OS2 A;  2RE2 A;  2R7Y A;  3K5L A;  3K2P A;  3HPO A;  4IDH A;  5AQF A;  4BRE A;  1HMV A;  1O1W A;  4CF9 A;  2FSJ A;  4I7F A;  1IO2 A;  1XC3 A;  5F1X A;  3VQC A;  3M1F A;  2QKB A;  2EHG A;  4YNQ A;  2F7T A;  3NGI A;  3LAM A;  3VQ7 A;  5JS2 A;  3RR8 A;  4RW7 A;  4FWS A;  1IKX A;  1UAX A;  2HST A;  3KIO A;  3QBX A;  3NF7 A;  4FJK A;  3D6R A;  5BRH A;  3GE1 A;  3O1B A;  2YI1 A;  2IVN A;  4DKW A;  3AA3 A;  3ATU A;  4A2B A;  3MWT A;  3SAF A;  3THX A;  3NH2 A;  1U6Z A;  4M7X A;  3ZET A;  4FJX A;  1JXE A;  4RTF D;  4CJE A;  5KGX A;  4HUG A;  1BDG A;  1ASW A;  3SNN A;  3JAM O;  4CGI A;  4HCC A;  2D0B A;  3V9Z A;  3EO3 A;  3ID6 A;  2FXU A;  1I94 K;  3CCS N;  3NF6 A;  1K8K A;  3F9K A;  3AVK A;  2GWJ A;  1F21 A;  4DTS A;  3DLK A;  4IOA L;  1HRH A;  4YDU C;  3ULE B;  2Q0U A;  5IT9 O;  5KPZ A;  2YKM A;  4BR5 A;  3L3U A;  2DY4 A;  1EET A;  4LSL A;  1KLN A;  5C24 A;  3OYA A;  3G4S N;  2J4R A;  1JLE A;  2KW4 A;  3NH1 A;  3V9S A;  1YXQ A;  3A0I X;  3HP9 A;  3DLE A;  1NWK A;  4BG9 A;  4E7H A;  1RT1 A;  2X6N A;  1W7A A;  4B9N A;  3SUP A;  3CET A;  4JRQ A;  3A5M C;  4FWO A;  2UXB K;  3VQ5 A;  5HRN A;  1S9G A;  4WF9 L;  3AO2 A;  3NF9 A;  3U4L A;  5AZI A;  1BO5 O;  3RTV A;  1YHQ N;  4A59 A;  4LFB K;  5C15 A;  4IG0 A;  4NXN K;  3OYI A;  1U47 A;  3THY B;  4FJ7 A;  5EU7 A;  1VQL N;  4LY7 A;  3HJF A;  1W97 L;  3NVM A;  3H45 C;  2UUA K;  3N4Q A;  5EXW A;  1VSH A;  4JK7 A;  3CCV N;  1T44 A;  2Y1J A;  4BRC A;  1WBD A;  3F9M A;  3ZEU B;  2D1K A;  4JKE A;  2KHO A;  2XO7 A;  4ZTJ A;  4OJR A;  5BRE A;  1MDU B;  2NUB A;  3RSE A;  1J54 A;  5HLF A;  4GV9 A;  2I5J A;  1A5V A;  1VHX A;  4WQ5 C;  2F4V K;  2HVI A;  3UB5 A;  4FM1 A;  1ITG A;  1WAF A;  1YTA A;  5B8H A;  5GAH P;  3CI5 A;  4CF8 A;  2Q97 A;  3ZT3 A;  2Y1I A;  3VF6 A;  3ZYY X;  1VQ4 N;  1N5Y A;  3M8S A;  4FJ8 A;  4JI5 K;  3NFA A;  1SL2 A;  1IJJ A;  3HO1 A;  3AVA A;  3VEW A;  1X9S A;  3MN9 A;  3KLF A;  2P9K B;  3P39 A;  1RCH A;  3BZK A;  2P9U B;  3OHR A;  5M1F A;  1RBT A;  1D9F A;  1RFQ A;  5C0Y A;  2JWL A;  4WQ5 A;  2O8B A;  4MFB A;  3SBT A;  1WN7 A;  2IAJ A;  4PL8 A;  3C6A A;  4H5R A;  3AO5 A;  5HRO A;  4EAH D;  4LF6 K;  4PUO A;  4ICL A;  3MEE A;  3VQ9 A;  3KLE A;  4ISF A;  3OVN A;  1U04 A;  3I0R A;  4DV5 K; 
#chains in the Genus database with same CATH homology
 1HJR A;  1LWF A;  1S1U A;  3HST B;  3AO4 A;  3LP1 A;  3C6T A;  2DFH A;  1D8Y A;  3PO5 A;  4PY5 A;  4EZ6 A;  3S3N A;  1WSI A;  4CGF A;  1B9D A;  4KPY A;  3DRR A;  1X9M A;  3DRS A;  2YNI A;  4CFA A;  1L3T A;  4E7K A;  4ELU A;  4CEB A;  4KHW A;  3ZSX A;  4KTZ A;  3QNO A;  1LV5 A;  1C6V A;  4N47 A;  4BE1 A;  4HTU A;  3TAQ A;  4DFK A;  4CHQ A;  5FRM A;  4N41 A;  1HPZ A;  2GUI A;  2HND A;  3EZ5 A;  4FK0 A;  5HRR A;  3QES A;  3SUQ A;  1NJY A;  1T7P A;  1RT5 A;  4CEQ A;  1TVR A;  3NCI A;  3ZT0 A;  1HYS A;  4F2S A;  1RBU A;  4LD0 A;  4BE2 A;  1LW0 A;  2ITG A;  3ZSW A;  3U6F A;  4B9T A;  1S1W A;  4AHR A;  1FK9 A;  4CCH A;  4KTQ A;  1RTJ A;  3OYB A;  3VQ8 A;  3RMD A;  2WON A;  3ZT1 A;  4CHY A;  2RKI A;  1JLG A;  5FDL A;  1D5A A;  4KRE A;  3I0S A;  4OLB A;  4KHY A;  4FJ5 A;  4EP4 A;  2HHV A;  2KQ2 A;  4CJL A;  1FKP A;  1U49 A;  1W0H A;  4OGC A;  1NK7 A;  1WSE A;  3IRX A;  4O0J A;  4CK1 A;  4BE0 A;  3AVB A;  1R0A A;  1ZYQ A;  3BGR A;  3DLH A;  4KRF A;  1NKE A;  3ITH A;  3EY1 A;  1CXQ A;  3V81 A;  5J2M A;  3MXM A;  5E41 A;  3OYH A;  1TK5 A;  2OPP A;  1RNH A;  3AVJ A;  3K5O A;  2XY6 A;  1KTQ A;  1XC9 A;  3ZSZ A;  3U3G A;  1TL1 A;  1B92 A;  3TAP A;  4CES A;  3B6O A;  1SV5 A;  3TAB A;  3SJJ A;  4O4G A;  4IFY A;  2RN2 A;  4KI4 A;  1TAU A;  4CFD A;  2LSN A;  4LH5 A;  4CEF A;  3HT3 A;  4PWD A;  4HUE A;  2HW3 A;  3SZ2 A;  4Z4C A;  4IBN A;  1RT6 A;  1RT2 A;  4FM0 A;  1TK0 A;  5SWM A;  3KLH A;  3TAE A;  4BDP A;  4JLH A;  5KTQ A;  1EXQ A;  4DTU A;  1LAW A;  3AVI A;  3P5J A;  4Y1C A;  3L2R A;  3QIP A;  4FXD A;  1QQC A;  5FRO A;  5C25 A;  1Z26 A;  4DSK A;  1ZBF A;  4M3R A;  4CHZ A;  2O4I A;  1Y97 A;  4ELV A;  4E7J A;  1QHT A;  4KB0 A;  3CFP A;  3QEI A;  1VRU A;  4CJF A;  4DTX A;  1IKW A;  1JLF A;  4DG1 A;  1VK0 A;  5CYQ A;  4CJU A;  2FBV A;  2Z1J A;  4B08 A;  3K5M A;  4CFC A;  3RMC A;  3I8D A;  2IS3 A;  5CYM A;  2E6L A;  2Q3S A;  1A5W A;  3AVM A;  3OYF A;  4KHU A;  1QTM A;  2VWJ A;  4AHC A;  1HQU A;  4BAC A;  3L3V A;  1GOB A;  1TKZ A;  2RPI A;  1VSM A;  3LWM A;  3OYM A;  1BI4 B;  1TL3 A;  1FXX A;  3LP0 A;  1SKS A;  1CLQ A;  4RW4 A;  4DLE A;  4NYN A;  1WSH A;  1SUQ A;  2KZM A;  3AA2 A;  3VQP A;  3KK3 A;  2B4J A;  3C6U A;  3D0P A;  1C1C A;  4FLT A;  1TKT A;  4DSE A;  1VSK A;  1TKD A;  3OYG A;  1NK5 A;  3OY9 A;  3QER A;  2PYJ A;  4CEC A;  1NKC A;  5HP1 A;  4C8L A;  3O4Q A;  4AHV A;  3KKS A;  4YFU A;  2Z1I A;  3HPG A;  1CZ9 A;  3KLG A;  3PX6 A;  5HBM A;  3AVL A;  2OYQ A;  4KHQ A;  3QEP A;  2G8V A;  2OZS A;  3AVF A;  2P51 A;  2A1R A;  1ZBH A;  4CEE A;  4KAZ A;  3V9X A;  3LAK A;  3MXI A;  4CGH A;  4IG3 A;  5I42 A;  3VA3 A;  2YHB A;  3OYK A;  3AO1 A;  4C8N A;  4J2A A;  1BCO A;  1TKX A;  4CGD A;  3O4N A;  3S3M A;  3RMA A;  2G8I A;  3SYZ A;  3AVH A;  5HRP A;  3AV9 A;  1NJX A;  4FZY A;  4FK2 A;  3K59 A;  4DQI A;  2EX3 A;  3MAQ A;  3SUO A;  3SQ1 A;  3L2V A;  3MED A;  1RDB A;  2XRI A;  4DWI A;  2AJQ A;  4CGG A;  3ZT2 A;  2G8U A;  4L8R B;  1WSG A;  5C42 A;  3HM9 A;  1SL1 A;  3RR7 A;  3EYZ A;  3HXM A;  1ZBL A;  2G8K A;  2HHS A;  1Q9X A;  3FFI A;  4B9L A;  4DF8 A;  2QKK A;  1KVB A;  4E0D A;  1GOA A;  4NCA A;  3PO4 A;  4M3W A;  1EKE A;  2RF2 A;  2ZE2 A;  1ASV A;  4I2Q A;  3V4I A;  3MEG A;  1NJW A;  4F3O A;  2F8T A;  3VQB A;  1YTU A;  4FW1 A;  4TSX A;  3OJS A;  1IG9 A;  4CK3 A;  2DFF A;  4B3O A;  3KJV A;  1EP4 A;  4QAG A;  1S6Q A;  4CEZ A;  1C0T A;  1G15 A;  3L2U A;  1NK9 A;  2HHU A;  4NCG A;  4KB1 A;  1I39 A;  4W5R A;  3P83 D;  3HP6 A;  3JYT A;  3AA5 X;  3AVN A;  4Y1D A;  4B9M A;  3MXJ A;  4CHP A;  3SPZ A;  4KI6 A;  3LZJ A;  4H4M A;  1Q9Y A;  3ZSY A;  3VQA A;  2HHX A;  4CK2 A;  5I3U A;  3QO9 A;  3F73 A;  3PV8 A;  1RBS A;  1DLO A;  4DS5 A;  2VG5 A;  3K5N A;  3PX4 A;  3TAM A;  3IAY A;  4KHS A;  1WLJ A;  4N56 A;  3HPH A;  4IKF A;  4DSJ A;  3PUF A;  1YVU A;  1RDA A;  3T19 A;  1JL1 A;  1RT7 A;  1BL3 A;  2IOC A;  3CQ8 A;  3TR8 A;  3M8R A;  4K8Z A;  1JLB A;  3ZSQ A;  4O44 A;  4OPJ A;  4OPK A;  4LSN A;  3ASM A;  4M3T A;  2OPS A;  4G1Q A;  5T7B A;  3NGZ A;  4EZ9 A;  2BE2 A;  1IH7 A;  5HRS A;  1RBR A;  1CZB A;  4CJV A;  4B9U A;  1RBV A;  2O4G A;  3V1Q A;  3SI6 A;  1DTQ A;  1QE1 A;  3G10 A;  1BGX T;  3KD1 E;  2IC3 A;  4GVM A;  3NHG A;  1C0M A;  3OJU A;  3LP2 A;  4BWM A;  2ZD1 A;  5KGW A;  3TWH A;  1BHL A;  3OS1 A;  4K8X A;  3RMB A;  3ZCM A;  1UA1 A;  4N5S A;  4RG8 A;  2XY8 A;  1U48 A;  4ELT A;  2DTU A;  1XWL A;  4AHU A;  4J2D A;  1KCF A;  1VSF A;  4DU4 A;  4CJS A;  4HHT A;  3B6P A;  1QSS A;  1I3A A;  1YT3 A;  4E1M A;  4BDZ A;  2IDO A;  4DTM A;  4ID5 A;  1JL2 A;  3IG1 A;  2OA8 A;  1QSY A;  3ALY A;  3NF8 A;  1S9E A;  1VSD A;  4OVL A;  4OKE A;  2G8F A;  4JS5 A;  4CF0 A;  4M41 A;  4C8O A;  4WE1 A;  1KSP A;  4H4O A;  4CJQ A;  4FZZ A;  4OLA A;  1C1A A;  1ZBU A;  3DRP A;  4O5B A;  4RW6 A;  3NDK A;  3OS0 A;  4ZHR A;  4FLU A;  1NJZ A;  3OYD A;  2G8H A;  4ZTF A;  1T03 A;  5CZ1 A;  3DMJ A;  3WNG A;  4FJH A;  4FM2 A;  1TK8 A;  4OKJ A;  4DTR A;  2HVH A;  3SQ2 A;  2KTQ A;  4DTO A;  4HCB A;  3HVT A;  3DLR A;  3JSM A;  3DLB A;  2Z1H A;  4CEA A;  1BI4 A;  1L3V A;  4B9V A;  3SPY A;  4DF4 A;  1WSF A;  2PY5 A;  3OYL A;  1BIU A;  4FJI A;  4KV8 A;  3VQ6 A;  3ULD A;  1WSJ A;  4AHT A;  2XY7 A;  3SV4 A;  4FYD A;  1BQN A;  4Z4H A;  1KLM A;  1U45 A;  1VSI A;  1HYZ A;  1S1X A;  4H8K A;  1ASU A;  1JLA A;  2ZQB A;  1KFD A;  4CJW A;  1NK8 A;  3TAN A;  3T3F A;  1LWE A;  3VN5 A;  3DM2 A;  1S1V A;  4Z4I A;  5JS1 A;  2OPR A;  3OYC A;  3SQ0 A;  3V1O A;  1MU2 A;  2HMI A;  2BGG A;  1JXB A;  2JLE A;  1LW2 A;  1RT4 A;  3HK2 A;  3L2Q A;  3QET A;  1K6Y A;  2HHQ A;  3TI0 A;  4F2R A;  2FBT A;  1UWB A;  1NOZ A;  4NYF A;  4CE9 A;  3WNE A;  3KTQ A;  3CFO A;  3K58 A;  1KVC A;  3CM5 A;  4FCY A;  4CIG A;  3PX0 A;  4DTJ A;  1WNS A;  2QXF A;  1UA0 A;  1RTD A;  2KFN A;  2VWK A;  3CG7 A;  4DQP A;  1XHZ A;  3OS2 A;  1QS4 A;  3O3G A;  3ZSV A;  4E3S A;  1NK4 A;  2YNF A;  2R7Y A;  4M3Y A;  4Z4G A;  2A1S A;  3K5L A;  3K2P A;  2F96 A;  4UQG A;  3HPO A;  1T05 A;  1L5U A;  2PZS A;  4B9S A;  2HHW A;  2E6M A;  1HMV A;  1O1W A;  3DI6 A;  4CF9 A;  1SKW A;  1A5X A;  2HB5 A;  2VG6 A;  1IO2 A;  4I7F A;  1NK6 A;  3VQE A;  1XHX A;  2QK9 A;  5D3G A;  5J2Q A;  3VQC A;  4Q0B A;  1BIS A;  4DU1 A;  4DTN A;  1ZBI A;  3LP3 A;  4FJJ A;  3BDP A;  4AHS A;  5CY4 A;  1N6Q A;  2QKB A;  2E4L A;  2EHG A;  4YNQ A;  3NGI A;  2FC0 A;  3O3H A;  3LAM A;  3VQ7 A;  4FVM A;  1LAV A;  2XHB A;  5JS2 A;  4CIF A;  3RR8 A;  4GW6 A;  1S1T A;  4RW7 A;  3HYF A;  1L3U A;  4XIU A;  1IKX A;  4CHN A;  4FK4 A;  1BCM A;  2YV0 X;  1UAX A;  2OPQ A;  3CM6 A;  3E01 A;  3M8Q A;  4CJ5 A;  2IGI A;  4CJK A;  3KIO A;  3C94 A;  1L3S A;  3NF7 A;  2W42 A;  1NOY A;  4FJK A;  3LAL A;  3DLG A;  5K14 A;  1JLQ A;  4KHN A;  2WOM A;  2YNH A;  4E7L A;  2D0C A;  3AA3 A;  2FBX A;  3G0Z A;  3IS9 A;  3L2W A;  1C1B A;  4IFV A;  3NH2 A;  3HL8 A;  1QSL A;  4DLG A;  3LAN A;  2X78 A;  4J2E A;  4FJX A;  1RIL A;  3LPT A;  4DQQ A;  1JKH A;  1JXE A;  4E19 A;  4FJL A;  4CJE A;  4GMJ B;  5KGX A;  4HUF A;  3TAG A;  4M3X A;  4JRP A;  4HUG A;  3ZT4 A;  4FJG A;  3O3F A;  1X9W A;  4FJN A;  1ASW A;  3LZI A;  4E7I A;  3SNN A;  2HNZ A;  3NBP A;  4CGI A;  4CJ3 A;  3CFR A;  2D0B A;  3DOL A;  1Q8I A;  1Z25 A;  3V9Z A;  3UIQ A;  4HCC A;  4DU3 A;  1KVA A;  3LDS A;  1RTI A;  3NGY A;  4I2P A;  2KZZ A;  3NF6 A;  4CF1 A;  3F9K A;  3AVK A;  1F21 A;  4W5O A;  4DTS A;  1J53 A;  3DLK A;  5DMR A;  3KLI A;  1HRH A;  3ZSR A;  2GBZ A;  2VG7 A;  2X6S A;  5SZT A;  2YKM A;  3L3U A;  2DY4 A;  1EET A;  4FLY A;  1RTH A;  4KKO A;  4LSL A;  1KLN A;  4DFJ A;  4ID1 A;  4FLW A;  5C24 A;  3KK1 A;  2F8S A;  3OYA A;  3SCX A;  3I0R A;  1IKV A;  3D45 A;  5FRN A;  1JLE A;  2KW4 A;  3ISN C;  3NH1 A;  4AH9 A;  1T8E A;  4RW9 A;  3RRG A;  4E1N A;  5KRS A;  3V9S A;  2BDP A;  4N76 A;  3NE6 A;  3HP9 A;  3DLE A;  4CFB A;  1KRP A;  3TAF A;  4E7H A;  3V6D A;  1RT1 A;  2X6N A;  2P5G A;  4B9N A;  3SUP A;  4JRQ A;  3SQ4 A;  3VQ5 A;  4DSI A;  5HRN A;  2HNY A;  4Z0U A;  1S9G A;  5KRT A;  3MEC A;  2DFE A;  3T1A A;  4PQU A;  3AO2 A;  3RRH A;  1D9D A;  3NF9 A;  4AIL C;  1S5J A;  1S6P A;  3KKR A;  2PYL A;  5KI6 A;  3RTV A;  3QLH A;  4DMN A;  4B8A B;  4W5Q A;  1LWC A;  1IKY A;  2GV9 A;  4O0I A;  4DQS A;  4IG0 A;  1U4B A;  3OYI A;  4CJ4 A;  1U47 A;  2OZM A;  4C8M A;  1X1P A;  4CEO A;  2YNG A;  4DTP A;  2G8W A;  4FJ7 A;  3HVR A;  5EU7 A;  2B6A A;  4LY7 A;  4CED A;  1VSJ A;  3HJF A;  3U3Y A;  3SV3 A;  4CGJ A;  3LWL A;  4BDY A;  4E89 A;  1VSH A;  4CF2 A;  5DK5 A;  4FLX A;  4DFM A;  1VSL A;  4I9L A;  4OKK A;  3OYJ A;  1VRT A;  4O55 A;  3RWU A;  2D0A A;  1RDC A;  4I9Q A;  3SUN A;  2Y1J A;  2P5O A;  4CIE A;  3S9H A;  4M3Z A;  1RT3 A;  2JGU A;  4DQR A;  3VQ4 A;  1WAJ A;  4Z4F A;  1RDD A;  3TAR A;  3AO3 A;  1HNV A;  4DS4 A;  4RW8 A;  1TV6 A;  4M3U A;  3C95 A;  2Z1G A;  4B8C A;  4M42 A;  3OYN A;  2XY5 A;  2XO7 A;  1BQM A;  1TAQ A;  4ZTJ A;  4OJR A;  3KK2 A;  5J2N A;  1JLC A;  4NCB A;  4QCL A;  4LH4 A;  1J5O A;  3VQQ A;  3QIO A;  4CJT A;  2NUB A;  2YKN A;  1J54 A;  4FLZ A;  3PY8 A;  2P1J A;  3WNF A;  5HLF A;  4CJR A;  3DYA A;  2I5J A;  4IDK A;  3S3O A;  3NAE A;  1A5V A;  4FJ9 A;  2HVI A;  2ATQ A;  2HHT A;  4FM1 A;  1ITG A;  3OYE A;  4C8K A;  1UOC A;  5J1E A;  1WAF A;  4F4K A;  4Q5V A;  1YTA A;  3ZSO A;  3L8B A;  4FZX C;  3QNN A;  1DTT A;  2FBY A;  1FKO A;  4MQ3 A;  4CJP A;  4CF8 A;  1HNI A;  3ZT3 A;  1J9A A;  2Y1I A;  3CYM A;  4M45 A;  1N5Y A;  4CHO A;  4JS4 A;  3AVG A;  3M8S A;  1VSE A;  4FJ8 A;  3NFA A;  1KFS A;  1SKR A;  1SL2 A;  2X74 A;  1NKB A;  3HO1 A;  3P1G A;  3AVA A;  4CER A;  4KFB A;  1X9S A;  1SL0 A;  3AVC A;  4PA1 A;  3KLF A;  1EX4 A;  1RCH A;  1HYV A;  3NH0 A;  1HQE A;  1GOC A;  4BWJ A;  1TGO A;  3KD5 E;  3DOK A;  2B5J A;  4FLV A;  1REV A;  1RBT A;  4W5T A;  1C0U A;  4OGE A;  2KFZ A;  2YHA A;  4FW2 A;  1D9F A;  3VA0 A;  3A2F A;  3QEX A;  2ETJ A;  4R5P A;  4KTW A;  4QOZ B;  3M8P A;  4MFB A;  4KO0 A;  5CZ2 A;  4F8R A;  1WN7 A;  2IAJ A;  4DSF A;  3QIN A;  3VQD A;  3H08 A;  3V1R A;  3WNH A;  1B9F A;  3QEW A;  4DSL A;  4HVJ A;  3K57 A;  1XI1 A;  4Z4E A;  3AO5 A;  3THV A;  4DFP A;  3V9U A;  5HRO A;  1NK0 A;  4PUO A;  4ICL A;  3LPU A;  1W9H A;  3MEE A;  3VQ9 A;  3V9W A;  3KLE A;  5J2P A;  4FJM A;  4EP5 A;  3AA4 A;  3OVN A;  1U04 A;  2BAN A;  4W5N A;  4J2B A;  4F3T A;  1CXU A;  1BIZ A;  3QEV A;  2D5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...