3MXJA

Crystal structure of the mtrex1 apoprotein
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
229
structure length
210
Chain Sequence
LPHGHMQTLIFLDLEATGLPSSRPEVTELCLLAVHRRALEPPVPRPPRVVDKLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAALKALEQKSYSLGSIYTRLYWQAPTDSHTAEGDVLTLLSICQWKPQALLQWVDEHARPFSTVKPMYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Three prime repair exonuclease 1
publication title X-ray Crystal Structures of TREX1 3' Exonuclease Autoimmune Disease Mutants
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 71
structure length 210
sequence length 229
chains with identical sequence B
ec nomenclature ec 3.1.11.2: Exodeoxyribonuclease III.
pdb deposition date 2010-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3mxjA01
1NOYA 1KRPA 1C1BA 3NBPA 1L3SA 3LANA 4AHCA 4DMNA 1X9WA 2G8IA 1RT4A 4FXDA 1X1PA 1C0TA 2KZMA 2Z1IA 2YKMA 2RN2A 2IAJA 4UQGA 4CERA 1KLNA 4B9UA 3V9UA 1IKWA 3TAFA 3PY8A 5C42A 2HHUA 4GMJB 4LH5A 1C1AA 2Z1HA 4C8MA 3ZT0A 3PO5A 3ZSZA 2Y1JA 5KRSA 3AO2A 4CIGA 4B9VA 1S9GA 4DFPA 4CFDA 1YTUA 4KHQA 4OKKA 3G10A 4Y1CA 4DSIA 1WNSA 5J2QA 5C25A 3WNHA 1NJXA 4N41A 2BGGA 3CM5A 1RCHA 4CGGA 4B9LA 4E7JA 1UOCA 2X6SA 2W42A 1JLFA 1EKEA 3AA2A 3I0RA 4M3XA 3KKSA 3AVBA 3ZT4A 4CK1A 4AILC 3NGIA 4GW6A 1D9FA 4ID5A 2EHGA 3P5JA 4QAGA 4JS5A 2G8WA 3EZ5A 1UWBA 4KB0A 2F8SA 3OJSA 1RT2A 1XWLA 2IC3A 4E1MA 2QKKA 4B8CA 3LPTA 4M3ZA 3DLGA 1ASVA 2ZQBA 3NHGA 3DMJA 2HVHA 3KD5E 1JLBA 4FZZA 5FDLA 4CGDA 3QETA 3RTVA 3VQ4A 4ZTFA 3QINA 3OYLA 3NF9A 1W9HA 2P1JA 2WONA 4DF4A 4DSLA 1WSIA 2E6MA 4M41A 3AVHA 3RRHA 3AVKA 4H8KA 3HO1A 3DLEA 5DMRA 1SUQA 1LWFA 3HT3A 3LDSA 3B6PA 3WNGA 3L3UA 2YHBA 3OYBA 3DM2A 4DTJA 1MU2A 3HM9A 1NJZA 1ZBHA 3ZSXA 4DLGA 4CJEA 1R0AA 1D5AA 4CJ3A 4FM0A 4N56A 3CFRA 1L3VA 4FJXA 3S3NA 1SKRA 3BDPA 2BDPA 4FW1A 1U04A 4QCLA 4M3YA 3NFAA 3T1AA 3VN5A 2KFZA 3HSTB 1LWCA 3RR8A 4M3UA 1B9FA 3OS0A 1VSLA 5K14A 4ELVA 2WOMA 4AH9A 3D45A 1DTQA 3KK1A 1RBTA 1Z26A 5KRTA 4FLWA 3PX0A 4DU1A 1KTQA 4ELUA 2R7YA 1L5UA 3JSMA 3NGYA 1QS4A 4ID1A 5HRRA 4CFCA 1ZBIA 5KGWA 1JXBA 2RPIA 3PO4A 4O0JA 4CJKA 3AA5X 4DTRA 1K6YA 1BI4B 4JRQA 3O4QA 3SYZA 4FW2A 4CE9A 1RT5A 4OJRA 3VQEA 3LAMA 4DFJA 2HHQA 3PX6A 3AVJA 4CHPA 2B6AA 3ISNC 2XHBA 4DFKA 1A5WA 1VSMA 5KGXA 4Z4HA 2E4LA 4CHYA 3OYIA 4AHUA 4FJJA 4FJ8A 2FC0A 5CYMA 1DTTA 4TSXA 3RRGA 4KREA 3EY1A 2P5OA 4DTSA 4HCCA 1TL1A 4F3OA 1T7PA 1CXUA 1L3UA 1ASWA 2AJQA 3QEVA 3SV3A 1RT3A 5E41A 3AVIA 3C6TA 3T19A 3NF7A 1NK4A 1KCFA 3F9KA 5J2MA 1TKTA 3VQ7A 4DTMA 4CIEA 2ZD1A 1BIUA 3U3GA 4KTQA 5J2NA 4HHTA 3TARA 2JGUA 3IG1A 4M3TA 2YV0X 2IDOA 3P83D 4N47A 3HPOA 1Q9XA 3RMAA 4W5RA 1J5OA 3IAYA 3OS2A 1CZBA 1RDAA 3I8DA 1TAUA 4HTUA 3V6DA 4KAZA 4HVJA 3SNNA 4DWIA 3CYMA 4CF9A 3DRSA 3U6FA 4FLYA 2YNGA 3OYEA 1BIZA 1SKWA 4E19A 4FLTA 1S6QA 4CJFA 3K2PA 1FKPA 4CK2A 5J2PA 1U4BA 3ZT1A 4M45A 1LWEA 4NCBA 3MEEA 4CECA 2HB5A 4J2EA 3V1OA 4N76A 2HW3A 4IBNA 1VSFA 1S9EA 4DFMA 2HNYA 1FKOA 1LW2A 3CFOA 4L8RB 2P5GA 3NH2A 4JRPA 3AO5A 4DLEA 3TAPA 1D8YA 3M8RA 4CF2A 4DTNA 1QSLA 3NF6A 3DI6A 4HUFA 4CEQA 1RTJA 3QIOA 3F73A 1CXQA 1HYVA 1S1XA 4CEOA 1TV6A 3CFPA 5HLFA 1RILA 4F2RA 1TGOA 1SKSA 2X6NA 4FJ9A 4BE2A 2Y1IA 3LP2A 3OYDA 3SZ2A 3THVA 2E6LA 1WSFA 3QNNA 5C24A 4IDKA 5HP1A 4B08A 4Z0UA 4KRFA 3IRXA 4DSEA 3VQ9A 4CHNA 5HRSA 4E7LA 3LWLA 4FJ5A 2PYLA 4B3OA 2LSNA 1NK9A 3LP3A 4MQ3A 2DY4A 3RMBA 4B8AB 3LZJA 4DG1A 3NAEA 1N6QA 3TAEA 3RMCA 4FZYA 3HVRA 4FLXA 1YTAA 1RDCA 2Z1GA 3AVAA 2A1RA 2G8HA 2HHXA 4B9SA 1RBRA 3AVLA 4Z4CA 1RBSA 2D5RA 3SQ2A 2D0AA 4RW6A 3JYTA 1FK9A 3PV8A 5KI6A 2P51A 3OYAA 1XHXA 3K57A 1GOCA 1HRHA 3TAMA 3LPUA 1C0UA 3V9WA 3V9XA 1S6PA 3DRPA 5SZTA 3SPZA 1WN7A 5CY4A 3VQAA 2OA8A 4PY5A 4RW4A 1RDDA 3OYJA 5JS2A 1VRTA 2VWJA 1TK0A 1HQEA 3SQ4A 3V81A 4KPYA 3ULDA 2BE2A 4NYFA 4CFBA 4FLZA 1NOZA 3AO3A 4DSKA 4HCBA 4KHYA 4OLAA 4CJ4A 4KHSA 4CEAA 3KIOA 4Z4GA 1BHLA 4BE0A 4C8LA 2IOCA 4CK3A 1BGXT 1XHZA 4F3TA 3SUQA 3AVGA 4KTZA 1ASUA 4R5PA 2NUBA 4RW9A 4O0IA 3I0SA 4B9TA 1YT3A 3M8QA 2RF2A 1S1UA 4M3RA 3VQBA 3SV4A 1KFDA 1VRUA 4I2QA 4ICLA 4CEDA 1I39A 3L2QA 1NK5A 1W0HA 4KHNA 2HHVA 4ELTA 3DLKA 1RTIA 1RBVA 1ZBUA 4B9MA 4KB1A 5SWMA 4EZ6A 2YNIA 1IH7A 2D0BA 5T7BA 1A5VA 1JKHA 1F21A 1EETA 1CZ9A 2ITGA 1WSHA 3KD1E 4Z4EA 3C6UA 1RTHA 2RKIA 1IKVA 4CESA 4FLUA 3SCXA 3MAQA 1NKEA 3TAQA 3RMDA 1NK7A 1A5XA 3L2RA 4F8RA 4JLHA 2HVIA 1JLCA 4BDPA 2IS3A 4PA1A 3E01A 1SL2A 2VG5A 4E7KA 3OY9A 3KLFA 3UIQA 4LSNA 4FCYA 4DU4A 4QOZB 1RTDA 1LAWA 5J1EA 5HROA 3G0ZA 3QIPA 1U45A 1WLJA 2OPPA 3NGZA 3KLGA 3P1GA 3L2WA 4CGFA 4O44A 2A1SA 1ZBLA 1VSIA 4C8OA 4CHZA 5HBMA 1EP4A 1BQMA 4CJQA 3RR7A 2D0CA 2VG7A 4IG0A 1J9AA 3FFIA 2B5JA 3OYCA 1SL1A 3QNOA 1D9DA 2G8KA 4F4KA 3SQ1A 2F96A 2OYQA 2DFEA 3KLHA 1RT6A 2X74A 1QHTA 4BACA 4BDYA 4PUOA 4IFVA 4M3WA 3DYAA 4AHSA 4KI4A 1O1WA 1TAQA 3SJJA 2PY5A 1KVCA 3AVCA 3SQ0A 2YNFA 4H4MA 4NCGA 1RT7A 4KFBA 4CJVA 1J53A 1KVBA 4E1NA 1NK6A 3DLHA 1KLMA 3ASMA 5EU7A 2DFHA 3LP1A 4CHOA 4W5TA 3LAKA 3O3GA 3AVFA 4CGJA 4DU3A 2I5JA 3HP9A 3MEDA 4CJRA 4DS5A 3C95A 3QEPA 4FJMA 3NH1A 2BANA 3L2VA 1GOBA 3V4IA 3KK3A 4KV8A 4LSLA 4KHWA 2YHAA 4ZHRA 1G15A 4Y1DA 4BDZA 1QQCA 4DF8A 4NCAA 1VSEA 2HNZA 1HJRA 4K8XA 3L8BA 2O4IA 4CGHA 1S1TA 1T03A 4DQSA 2KFNA 1NK8A 3DOLA 1S1WA 5FRNA 1JLGA 4CF8A 2G8VA 3AO4A 5CZ1A 4DS4A 4CEZA 4EP5A 3QO9A 3NDKA 3OYMA 3NCIA 3ZT2A 1HYZA 3M8SA 3MXJA 3MECA 2XRIA 1JXEA 1RT1A 1TVRA 4RW7A 2GBZA 1T05A 1BL3A 3T3FA 4CJPA 3U3YA 2KZZA 3DLRA 2VG6A 2Q3SA 4JS4A 1NKBA 3OYNA 3HK2A 1TL3A 1WSEA 2ZE2A 3V1QA 4CF1A 1ZYQA 4OGCA 5D3GA 4Z4IA 1TKZA 2HHTA 3KJVA 3NF8A 4H4OA 4FK2A 4CHQA 1Q9YA 4DQQA 2OZMA 2XY5A 4EZ9A 4O5BA 4KO0A 3O3FA 4KHUA 4O55A 1VSKA 3DOKA 4EP4A 3EYZA 1RBUA 2HNDA 3SPYA 3HJFA 2QK9A 4W5NA 1QSYA 4IKFA 1Y97A 4Q0BA 4OKJA 3VA3A 3IS9A 3VQPA 2FBXA 3QEXA 2IGIA 1QSSA 1BI4A 4CJWA 4FM2A 2G8UA 3CQ8A 3C94A 2PZSA 1C6VA 2ETJA 1C0MA 3HPHA 4BWJA 3QEIA 1X9MA 2QKBA 4FYDA 4RG8A 3TAGA 3TABA 1NK0A 4LD0A 4FM1A 3B6OA 3H08A 2XY6A 1KSPA 1UAXA 3O3HA 3KTQA 1REVA 3ZT3A 5HRPA 4DTUA 3AO1A 4J2AA 2KW4A 3ZCMA 2HHSA 4CJ5A 4CJSA 3KLEA 3RWUA 1TKXA 1DLOA 4BWMA 3HVTA 2KTQA 1BCOA 4FJ7A 5FRMA 4PQUA 4M42A 2GV9A 1HNVA 3S3MA 1EX4A 1JLEA 1HMVA 4CF0A 5HRNA 3OYHA 3ITHA 3LWMA 3NE6A 3HP6A 1NJYA 1T8EA 3HXMA 1N5YA 4IFYA 1FXXA 3HPGA 3ZSRA 1WSJA 3K5NA 1SV5A 3AV9A 4KKOA 4I9LA 4OGEA 4O4GA 3OVNA 3SUOA 5I3UA 1UA0A 1XC9A 1JLAA 2HMIA 3AVNA 4Z4FA 3OYKA 4B9NA 1HQUA 3K58A 4E3SA 2DTUA 2XY8A 2F8TA 3OS1A 3LALA 4XIUA 1LW0A 3SUPA 3CM6A 4HUGA 1XI1A 1TK8A 4OKEA 4W5QA 3WNFA 3MEGA 3ZSWA 4DTPA 3OJUA 2G8FA 3TR8A 2B4JA 3VQDA 1VSDA 3HL8A 4E7HA 4ZTJA 4C8NA 3L2UA 3QERA 5KTQA 4CGIA 2JLEA 1WSGA 3M8PA 4FZXC 4FJKA 1KFSA 3L3VA 5CYQA 1U48A 3ZSOA 2PYJA 1S5JA 2ATQA 3ALYA 3S9HA 4W5OA 1U49A 1B92A 4OPKA 1JL2A 1Q8IA 3A2FA 2YNHA 4KTWA 3TI0A 4YNQA 2XO7A 4FVMA 4DSJA 1HNIA 2KQ2A 3O4NA 4DTOA 4E7IA 4OVLA 2FBVA 3V9ZA 3VA0A 4HUEA 1NJWA 3VQ8A 3DRRA 1LAVA 4FK4A 2X78A 1HYSA 4MFBA 3LZIA 1CLQA 3MXMA 2FBYA 4FLVA 1X9SA 2OZSA 1S1VA 1Z25A 4IG3A 4BE1A 4J2BA 3MXIA 4FJNA 1IKYA 4CEBA 1I3AA 4DQIA 4DSFA 2HHWA 4K8ZA 3AVMA 3ZSQA 1ITGA 3AA3A 3WNEA 2Z1JA 4GVMA 1BISA 4LH4A 1RNHA 4FJIA 1TKDA 5JS1A 4I2PA 2EX3A 2VWKA 4YFUA 4DQPA 4CCHA 4LY7A 1VSJA 3K59A 4CEFA 4FJHA 1L3TA 3K5OA 4RW8A 1HPZA 1LV5A 3SUNA 4AHVA 4PWDA 3DLBA 2GUIA 3PUFA 4FJLA 3K5MA 3QLHA 1RDBA 2O4GA 3ZSYA 1QTMA 2DFFA 4DQRA 2OPSA 4AHTA 3S3OA 4FJGA 4OLBA 1BQNA 5FROA 1EXQA 3OYGA 1WAFA 2FBTA 4CIFA 3AA4A 4CJTA 1IKXA 1JL1A 4DTXA 3SI6A 1GOAA 1NKCA 1IG9A 3LP0A 1SL0A 1VSHA 4J2DA 3V9SA 1KVAA 1WAJA 5I42A 4C8KA 4F2SA 3NH0A 3KLIA 1ZBFA 3QEWA 4E89A 2QXFA 1U47A 4OPJA 3KKRA 3KK2A 4KI6A 1JLQA 4CFAA 4CJUA 3D0PA 3VQ5A 4CEEA 1UA1A 2OPQA 4NYNA 3BGRA 4E0DA 3QESA 1TK5A 1C1CA 4FK0A 4I9QA 3PX4A 1IO2A 4AHRA 2YKNA 1B9DA 3HYFA 4CJLA 1YVUA 4G1QA 3VQQA 5DK5A 3TWHA 3CG7A 3OYFA 1VK0A 3TANA 1J54A 2OPRA 4Q5VA 3V1RA 3K5LA 5CZ2A 4WE1A 1QE1A 4N5SA 1BCMA 4I7FA 2XY7A 3VQ6A 3VQCA 3ZSVA
chains in the Genus database with same CATH superfamily
4K42A 5BPNA 2NRRA 2F7TA 3NBPA 4BRQA 4WFAL 2KZMA 2RN2A 4UQGA 1TUYA 4O8UA 3TAFA 5C42A 3H1QA 4QS7A 4GMJB 1T6DA 2Z1HA 3ZT0A 3PO5A 3ZSZA 3AARA 3EE9A 1NGAA 5LL6Z 3G10A 4Y1CA 1WNSA 3E9OA 1TYQA 4CGGA 4E7JA 1UOCA 4PKIA 4AILC 1N34K 4BRKA 2OZSA 3P5JA 2FSJA 4H03B 2YJEA 1UWBA 2F8SA 3OJSA 1XWLA 3AY9A 4M3ZA 4LF9K 2A40A 3NHGA 4CW7B 3DMJA 3CQYA 3G25A 3KD5E 5C2FA 4PL7A 2PFUA 3QINA 4DKWA 4BC3A 4ILJA 2WONA 4IO9L 4DSLA 1WSIA 2ZGZA 4H8KA 5DMRA 3JAMO 1U2VB 2D0PA 2F9TA 3CPWM 3W3DA 4DTJA 3OYBA 1NJZA 1JCGA 1Q81O 2NRVA 3CJ1A 4H0OA 1S72N 4K0KK 4FM0A 4N56A 3CFRA 3S3NA 3BDPA 2VCPA 1QZ6A 3NFAA 2KFZA 3GL1A 3RR8A 3KWGA 4IO8A 1EWRA 5K14A 2WOMA 4BREA 4DU1A 1L5UA 3JSMA 3PSIA 4HWIA 5AQGA 2WC9A 4O0JA 3AA5X 2HF3A 1BI4B 3EKUA 3ULEB 2HHQA 4DFJA 3PX6A 3AVJA 4CHPA 2B6AA 4CZIA 1NMNA 2XHBA 1A5WA 5KGXA 4CHYA 3VEWA 3OYIA 3MCAB 1H1VA 5CYMA 4TSXA 3RRGA 3EY1A 4HCCA 4BRFA 3CCUN 1RT3A 4BGAA 3F9KA 3VTIA 5KQDA 4DTMA 1RDWX 4HHTA 3TARA 2JWKA 4M3TA 3CCQN 1NGEA 2NNWA 3RMAA 3LDQA 1J5OA 3OS2A 1RDAA 3I8DA 4HVJA 4L3QA 1IBMK 1BIZA 3K2PA 1K8AO 1U2VA 4YOVA 4JKGB 3CETA 3LDPA 5AFUA 3CC4N 4JRPA 4DLEA 3MWPA 3C65A 4RCHA 3M8RA 3D7EO 4HUFA 5HLFA 3QIOA 1CXQA 4B08A 2W41A 4KRFA 4DSEA 4E7LA 3VOVA 2LSNA 4JKDA 1HKBA 4AM7A 4B9SA 1RBRA 3AVLA 3CJBA 3ULEA 4DV3K 1RBSA 2D5RA 4IWVA 4RW6A 3JYTA 4DR1K 1FK9A 3PV8A 5IT9O 3G6EN 3E9PA 4PY5A 5CY4A 4JEPA 1VQ9N 2UYTA 4LF8K 3BY5A 3OYJA 1VQ5N 3SQ4A 1OVYA 4KHYA 4Q0BA 4FLZA 4DSKA 4X65K 4KHSA 4CEAA 4Z4GA 1NM1A 3GDQA 4Z94A 1ASUA 2VWBA 3I0SA 1XNRK 3EO3A 5MLCQ 4DR5K 3J8AA 5AQFA 1VRUA 4I2QA 4JI0K 2HHVA 3DLKA 1RBVA 3KWIA 1HPMA 1HUXA 1ZBUA 4B9MA 5BPMA 3T69A 1IH7A 3JXUA 4JKGA 4KHPK 1EETA 2CGJA 1RTHA 2RKIA 3C6UA 1NGCA 3MAQA 5HOOA 4B1ZA 4JLHA 3WQUA 1JLCA 1VHXA 3OY9A 3KLFA 4IZ9A 1RTDA 5J1EA 2CGLA 3QIPA 1U45A 3H6EA 3VGKA 4BR2A 4O44A 2A1SA 4YOWA 4C8OA 1J9AA 3RVCA 4F4KA 3WQTA 1RT6A 4PUOA 5C10A 2CGKA 4KI4A 1O1WA 4IXCA 5FPMA 1KVCA 4H5NA 3AVCA 4G9ZA 4H4MA 1YIJN 3VETA 3ENHA 4E1NA 1KLMA 5EU7A 1HKCA 3LP1A 4W5TA 3LAKA 3KVGA 3MEDA 4M7XA 3UKRA 3C95A 3T7ZA 1GOBA 3CIPA 4KV8A 4KHWA 4DQ8A 4EHTA 1QQCA 3RSEB 4NCAA 2Q0UA 3QBWA 4K8XA 1CZAN 2KFNA 4DQSA 3DOLA 3JS6A 5BN8A 5KPRA 3OYMA 3ZT2A 3C0BA 3MXJA 3MECA 2XRIA 1RT1A 3U3YA 3T3FA 5BPLA 2VG6A 3V1QA 3F5TA 4CF1A 4CZMA 5D3GA 2HHTA 4FK2A 3CJAA 3ATUA 3LM2A 2F4VK 3R6MA 1QSYA 4DR4K 1VQ7N 3VQPA 2FSKA 4FM2A 3L0QA 3CQ8A 2ETJA 4DR6K 5M1OA 4FM1A 3N4QA 4FOEA 2XY6A 3KTQA 4CBUA 1REVA 1GLJO 1Z6RA 3AO1A 3BZCA 4J2AA 4H0VB 3CD6N 4CJ5A 5AQLA 3KLEA 1SZ2A 1DLOA 5AQYA 4BWMA 1WBBA 3VF6A 1JLEA 3QBXA 3EN9A 4IFYA 3ZSRA 3K5NA 1M1KO 5M1QA 5I3UA 1XC9A 3K58A 2DTUA 3DXMB 1FW6A 3H45C 5AQXA 3WNFA 3MEGA 3MCPA 3OJUA 3TR8A 3VQDA 4E7HA 1K9MO 3L2UA 3ZX3A 5AFUH 1BU6O 3L3VA 3CCEN 1U48A 2PYJA 4OPKA 1JL2A 2YNHA 4M7YA 3TI0A 2KQ2A 4E7IA 2FBVA 2ZGYA 3VA0A 2YX6A 4HUEA 1J6ZA 3DRRA 1HYSA 1CLQA 4YORA 4BE1A 3BZKA 3MXIA 2DPNA 2HHWA 3AVMA 1ITGA 3AA3A 3WNEA 4GV9A 4DQPA 2VWKA 4H5TA 4GV6A 4DB3A 1VQ6N 3ZEUA 4WCEL 1LV5A 1XNQK 3DLBA 3K5MA 3FZKA 3QLHA 3S3OA 2P9IB 5I9EB 4DV0K 3AAQA 3SLCA 1BA0A 1EXQA 1NGHA 3VEVA 2NRZA 3AA4A 3SI6A 4J2DA 1SL0A 3DXMA 1RGIA 4E89A 2ZJRL 3LDLA 3CJ9A 4KI6A 4CJUA 1UA1A 2OPQA 2UXBK 4BRDA 1VQPN 4CBWA 3CMEN 4AHRA 2YKNA 3VEZA 4CJLA 1N8RO 3ID6A 3TWHA 1QQOA 1VK0A 3TANA 4Q5VA 3K5LA 2QWMA 4N5SA 4I7FA 2OA8A 3VQCA 4XIUA 3R9PA 2NZTA 1KRPA 2QWRA 1C1BA 4LC9B 1L3SA 1R59O 3NVKA 4FXDA 2Z1IA 1YJ9N 3CC2N 5E26A 1KLNA 4B9UA 2O8FB 2HHUA 4J8FA 3OBWA 4C8MA 3AO2A 4CIGA 1S9GA 3FZFA 4DFPA 4CFDA 4XH5A 5C25A 3WNHA 4N41A 1YAGA 4JD2A 1P90A 4B9LA 4BY9C 1E4GT 1HNXK 2P9NA 1YJWN 3I0RA 2HF4A 3KKSA 3AVBA 1DT9A 5F2RA 3ZT4A 3NGIA 1D9FA 4ID5A 4QAGA 4JS5A 3THWA 2P9IA 5CR4A 2YHYA 4B1XB 4MDBA 1WBDA 4BVPA 3AGRA 1ASVA 3HI0A 4FSVA 4IJNA 1NGIA 4CGDA 1J5EK 3WXLA 4X66K 3U4LA 4JI5K 1Q82O 2WTUA 2P9SB 4WFNL 4M41A 3BP8A 3HO1A 4DCHA 3P38A 2P9LA 1NGBA 1ATRA 2P9UB 3WNGA 5AQTA 5C2DA 1MU2A 2V52B 3HM9A 4IOXA 4LFBK 4CJEA 3IFRA 4WQ5C 4CJ3A 3LM9A 3H3NO 1EQYA 1U04A 2KHOA 4QCLA 1B9FA 4CZEA 3OS0A 4JKFA 3U9DA 1DTQA 2QEXN 5KRTA 3PX0A 4X62K 1QS4A 2O8FA 3HOTA 1GLEG 4WYBA 5KGWA 3O5BA 2RPIA 3MN7A 4CJKA 4DTRA 1K6YA 5ADXH 4H5RA 4CE9A 2Q1NA 3VQEA 3SAGA 3ISNC 2BUPA 2FC0A 5EXWA 1T7PA 1L3UA 2AJQA 1WUAA 3EKSA 4BR0A 3AVIA 5BRDA 3J7AP 1KCFA 1YITN 5M1KA 1BIUA 2ZD1A 4EIAA 5J2NA 1SQKA 2JGUA 4EAHD 3P83D 2IDOA 4N47A 3HPOA 1Q9XA 4B1UB 1VQKN 4IEIA 4BG8A 4AM6A 4HTUA 4I6MB 4KAZA 4GNIA 2HBLA 3KZBA 3ZETB 4A61A 4DHYA 3CC7N 3CYMA 3EZWA 4CF9A 1WB9A 3I33A 3U6FA 2GTDA 4FLYA 2YNGA 3OYEA 4E19A 1NG9A 3O9QA 5LMNK 1NGGA 2AP1A 2ZF5O 1GLDG 1U4BA 3ZT1A 3MEEA 2HW3A 4J2EA 4AF1A 4N76A 4IBNA 2P9UA 3SMPA 5GAEP 3CFOA 1I94K 5KQ8A 1D8YA 4M63C 4CEQA 3BF3A 3OTOK 1HYVA 3F73A 3CFPA 1TV6A 3W0LA 1SKSA 2BH1A 3LP2A 3WT0A 2ZWHA 3THVA 5C24A 1BG3A 5DM7L 5HRSA 1P8ZA 2E1ZA 4MQ3A 4B8AB 4LF7K 3L6QA 3NAEA 4B1YB 4FZYA 3J7ZO 3HVRA 4FLXA 1RDCA 4V19S 2HHXA 4FWPA 4Z4CA 3SQ2A 5AQHA 2P51A 1XHXA 1HRHA 3TAMA 1C0UA 1DEJA 5AQNA 5TKWA 3VQAA 2E8AA 4YOTA 1RDDA 4UY8O 3CJCA 3KK7A 3ID8A 2NRXA 3ULDA 2BE2A 4CFBA 4HCBA 3AO3A 3VMFB 5AQKA 4CJ4A 4YHHK 4CVNE 3HSCA 4C8LA 2IOCA 3BEXA 4DUYK 2PBDA 4CD3A 4GY2B 1HNZK 3ZETA 4DV6K 3EL2A 4FWQA 3H1VX 4M3RA 3VQBA 3SV4A 4ICLA 1I39A 3L4IA 2I7NA 4ELTA 4KB1A 5SWMA 5KPZA 3CCLN 1JKHA 1F21A 3C7NB 5AQJA 3KD1E 1WSHA 2BGGA 4CESA 4A57A 1IKVA 3TAQA 4YDUA 1NK7A 1A5XA 3A5LC 4PA1A 1SL2A 2VG5A 1LOTB 4JV5K 1XQSC 5HROA 5AQUA 3G0ZA 3QDKA 3ENBA 2OPPA 3NGZA 4ILHA 4CGFA 2E2NA 1EP4A 5EX5A 4CJQA 1ATNA 4JAXA 4IG0A 3OYCA 3QNOA 1KD1O 3DWLA 2OYQA 2DFEA 3KLHA 4BDYA 2Q2RA 4IFVA 4ISEA 3DYAA 3O8MA 3VEYA 4AHSA 3SJJA 3TSQA 3NMUA 3I55N 3VGMA 2W40A 4KFBA 1KVBA 3QMLA 1NK6A 4CHOA 4ISFA 3O3GA 4WQ4A 4NLCA 1IBLK 2FF6A 2P9PB 4BR4A 4IOAL 2BANA 1JJ2M 1RDUA 2QI2A 4ZHRA 1G15A 5GIPA 4DF8A 3PIOL 2HNZA 1HJRA 2O4IA 4CGHA 4IDHA 5AZIB 4IOCL 1S1TA 1LCUA 4Y0WA 5FRNA 1IBKK 4DS4A 3FE1A 4EP5A 3NCIA 2O8EB 1HYZA 3M8SA 4JKEA 1JXEA 4BC2A 4OX9K 2GBZA 4DR3K 4CJPA 1XC3A 1K8KB 1TL3A 1WSEA 5AZJB 3HOSA 3NF8A 4H4OA 4BRMA 3TU5A 5KPTA 3TPQA 2HHHK 2V7ZA 4KHUA 1VSKA 3DOKA 1RBUA 1YF5L 2QK9A 4IKFA 4CZGA 3VA3A 2A42A 1BI4A 4CJWA 3C94A 4BWJA 4CZHA 4FYDA 4JI6K 3TABA 3TAGA 4LD0A 3B6OA 1UAXA 3O3HA 3ZCMA 4CJSA 3RWUA 1TKXA 4C1NK 1BWFO 4PQUA 4H5WA 3FZLA 5HRNA 3LWMA 3ITHA 1OVQA 3NE6A 1YHQN 3TTCA 1N5YA 4BVOA 3HPGA 1SV5A 2P9PA 1JCFA 3P4IA 3SUOA 2HMIA 3OYKA 1HQUA 4DUZK 2XY8A 2F8TA 2HBJA 3SUPA 3CF5L 3CM6A 3WXMB 1HLUA 1KAZA 4HUGA 3O9RA 1TK8A 4OKEA 3PIPL 4OO1J 4MLHA 4DTPA 5BREA 2G8FA 2B4JA 2O8EA 3HL8A 3FLCO 4KH6A 2QWQA 3QERA 5KTQA 2JLEA 3M6GA 1K8KA 1OKJA 5AZJA 5CYQA 3ZSOA 3WXIA 1Q8IA 1V4TA 4KTWA 2XO7A 3C6HA 1OH5A 2YHXA 3MWTA 4R79A 3V9ZA 2QA4N 3VQ8A 4MFBA 3LZIA 3MXMA 3LDOA 1HKGA 2FBYA 4FLVA 4LFCK 3K0SA 2WUSA 2GEMA 3H46O 4JYAK 4K8ZA 2YHWA 4WQ5A 3ZSQA 4CZJA 1HNWK 1RNHA 3ZX2A 5JS1A 1TKDA 4YFUA 4CCHA 2A6AA 3VERA 3K59A 1D4XA 3K5OA 4FL9A 1HPZA 4GKKK 4A59A 1HX1A 3O9TA 3A8YA 4FO0A 4BQLA 4FJLA 3U9ZA 1KAXA 4XEIA 3ZSYA 2BTFA 1DGKN 3Q7CA 3CHWA 1Z05A 1OH8A 4OLBA 5FROA 4JK9A 3CMAN 4CIFA 1E4FT 3QFPA 2FSNA 4C8KA 4F2SA 4ISGA 3PSFA 3WEEB 3KKRA 4CFAA 1SS6A 3D0PA 1YJNN 4NYNA 4E0DA 3QESA 2E5LK 3WXKA 3VQQA 2NLXA 3VEXA 2VQEK 3SAHA 5LMUK 2NRHA 4WE1A 1QE1A 3VQ6A 4CECA 3ZSVA 3HJFA 1NLVA 4NLBA 2G8IA 4DMNA 1X9WA 1KXPA 3QICA 5ADXA 2YKMA 2IAJA 4CERA 1OH6A 4JI2K 5BR8K 1C1AA 2Y1JA 2HMPA 2YCHA 5EOYA 4KHQA 4OKKA 3SBTA 4FWMA 1NJXA 4FPAA 1RCHA 2X6SA 3AA2A 3C6AA 4M3XA 4BRNA 4CK1A 4GW6A 2EHGA 4DV4K 4KB0A 4JI1K 1RT2A 3RSEA 4NO7A 3LPTA 1OH7A 2QXLA 1NMDA 3M5RA 2E1YA 3O08A 2HVHA 4FZZA 5FDLA 3QETA 3VQ4A 1ZC6A 2FF3B 3OYLA 3NF9A 1W9HA 4ILGB 3AVHA 3RRHA 3AVKA 3R1XA 3DLEA 5AQZA 1LWFA 3CCVN 2FXUA 4GV3A 3ZSXA 1R0AA 1SKRA 2BDPA 2IIRA 4FW1A 4M3YA 2QWPA 1LWCA 4M3UA 4ELVA 1HJOA 4BR5A 5A2QO 4DR7K 3FZHA 1Z26A 1SAZA 5CHIA 4ELUA 2R7YA 2QW9A 2VQFK 4CFCA 5HRRA 1NNEA 2OTLN 1JXBA 1W97L 1DKGD 4JRQA 4FW2A 3F9MA 1NGFA 1VSMA 2E4LA 4AHUA 4FWSA 2E2PA 4JKAA 4FJ8A 4KREA 1TL1A 1CXUA 1ASWA 4BG9A 4BR7A 4BRLA 5E41A 4IEEA 3T19A 5J2MA 3QFUA 3T1YK 3U3GA 3IG1A 1BO5O 2OANA 4W5RA 1TAUA 3V6DA 5GIOA 1N32K 3DRSA 5E84A 2O8BB 1SKWA 1N33K 1NGDA 1S6QA 4CJFA 3VEOA 3DXKB 1QVFM 4FOIA 5J2PA 4A62A 2HB5A 3V1OA 4DR2K 2HNYA 1FKOA 1LW2A 2PAVA 4BRHA 2P5GA 4L8RB 3ZYYX 4DTNA 3NF6A 3DI6A 3CQXA 4CEOA 4F2RA 4FJ9A 1MWKA 1TGOA 3AAPA 3GBTA 3O9SA 4BE2A 2Y1IA 2ZJQL 3OYDA 5F0XA 5HP1A 4IDKA 3IMXA 3IRXA 4FJ5A 2PYLA 1NK9A 3LZJA 1T3VA 4IFEA 3RMCA 5BRFA 2A1RA 2G8HA 4MO4A 1X9JA 3THYB 2D0AA 4NXNK 5IWAK 1C0FA 5KI6A 4RWTA 3LPUA 3SPZA 1S6PA 3DRPA 4YOXA 5JS2A 5AQIA 2VWJA 1TK0A 4KPYA 5BN9A 4OLAA 2RHKA 4K41A 4CD1A 4CK3A 1HR0K 1BGXT 1XHZA 4RTFD 1XMQK 2NUBA 3CPEA 4JNEA 4RW9A 4O0IA 4B9TA 1YT3A 1NJIO 1S1UA 3D2FB 2O8BA 1KFDA 2GWKA 3O1BA 1W0HA 1NK5A 3DXKA 1RTIA 3D2EB 4EZ6A 2D0BA 1YVNA 1A5VA 4A5BA 5GAGP 2ITGA 4Z4EA 3SCXA 5LJVA 3J80O 1NKEA 4FLUA 4YOYA 2QWLA 3L2RA 2HVIA 2A5XA 3D6RA 2IS3A 3E01A 5AQOA 1NBWA 4MO5A 3UIQA 4DU4A 4QOZB 1LAWA 1GLLO 4JHDB 3KLGA 5AQWA 3L2WA 1VSIA 2D1KA 4CHZA 2V7YA 5AQPA 3RR7A 2VG7A 3HTVA 3FFIA 2B5JA 1O13A 2I7PA 1QHTA 1Q18A 4DV2K 4M3WA 5JVHL 3THYA 1YUWA 1NGJA 3GE1A 2E88A 3VGLA 4AQYK 4PKGA 3SQ0A 2YNFA 1RT7A 4F9OA 1J53A 3ZX0A 3WXJA 3CERA 3VF4A 4EHUA 1TYQB 1VQ4N 3AVFA 2YJFA 4MLEA 1MA9B 4B3TK 3HP9A 3EEQA 4CJRA 3QEPA 1ESVA 3NH1A 3V4IA 4E1JA 2YHAA 3THXB 3K9JA 2A3ZA 4Y1DA 4A5AA 5AQMA 1VSEA 4U67L 2VGMA 2UU9K 2P9SA 3L8BA 3UB5A 2HBKA 3VENA 5H1SQ 3D2FA 1S1WA 4CF8A 5LY3A 3MN6A 3NDKA 5AQSA 3QO9A 3O6WA 4U7BA 3D2EA 1TVRA 4RW7A 4B3RK 1NKBA 2Q3SA 3FZMA 1TKZA 4PL8A 4B3MK 4YOUA 4CHQA 4JI4K 4DQQA 2OZMA 4EZ9A 4JK8A 4KO0A 4EP4A 2HNDA 4KH4A 4W5NA 1Y97A 4OKJA 1BOTO 3SK3A 2IGIA 2QKBA 2Q36A 1C0MA 3QEIA 5FPEA 3CCSN 4BGBA 5FPNA 1KSPA 3H08A 4JKCA 4GVEA 2O8CB 5HRPA 4DTUA 4NXMK 2KW4A 2QM1A 2UXDK 1BCOA 5FRMA 3G71N 2GV9A 1HNVA 3OYHA 3HP6A 1NJYA 3VPZA 1W7AA 1IG8A 1GLBG 1X3MA 3AV9A 4I9LA 3J81O 4I6MA 4OPHA 4B9NA 2Q97A 4E3SA 3THXA 1N36K 1U6ZA 3OS1A 3MN5A 3CCRN 4DV5K 1VQLN 1IJJA 4W5QA 2UUBK 3ZSWA 2GELA 5GADP 1VSDA 1NU0A 4ZTJA 4C8NA 5FLXO 1K73O 3OA9A 3M8PA 4FZXC 1KFSA 4YY3K 2QWNA 1KQSM 3A2FA 1VAZA 1HNIA 3O4NA 4DTOA 1BUPA 4OVLA 1NJWA 5C15A 4FK4A 4JKHA 4IG3A 4FJNA 1BDGA 1IKYA 4CEBA 1JCEA 3OHRA 3BF1A 4GVMA 4LH4A 1VQMN 3TSPA 4FJIA 2O8CA 4I2PA 4H0XB 4LY7A 1VSJA 4FJHA 4CEFA 2KLAA 4RW8A 3DJCA 4AHVA 4PWDA 2GUIA 3PUFA 2GX9A 1QTMA 4DQRA 4PHTX 2OPSA 4AHTA 4FJGA 2ASOA 4H5VA 4BRCA 3O1WA 1BQNA 3OYGA 3WUHA 2FBTA 1NKCA 4CJTA 1IG9A 1IKXA 1JL1A 1GOAA 1VSHA 4FWKA 3V9SA 1KVAA 1WAJA 5I42A 4JK7A 3OBYA 3KLIA 4PKHA 2QXFA 1U47A 4OPJA 1GLCG 3KK2A 4BRAA 4BC4A 1JLQA 3VQ5A 2QWOA 4CEEA 3HM8A 3J7YP 2VYPA 3S41A 4CBXA 3BGRA 1TK5A 4FWLA 1C1CA 3C7NA 1KC8O 3H3OB 5HL7L 3PX4A 1IO2A 1B9DA 3HYFA 4G1QA 5LJWA 5DK5A 3CG7A 1Q86O 4IJAA 1J54A 3V1RA 2XY7A 1NOYA 2IVNA 1ZXOA 4XH1A 3VTHA 5M1NA 3LANA 4AHCA 1RT4A 1X1PA 1C0TA 4LF5K 3V9UA 3ZLJA 1IKWA 3PY8A 4LH5A 4WFBL 3UE5A 5KRSA 1X3NA 4BROA 4B9VA 1YTUA 3AGKA 4DSIA 2A41A 1Q7YO 5J2QA 3CM5A 4H0YB 2W42A 1JLFA 1EKEA 2ITMA 2G8WA 3EZ5A 1ATSA 2IC3A 4E1MA 2UUCK 2QKKA 4B8CA 2KKZA 3DLGA 5AZIA 2ZQBA 3UKRB 2CH5A 3F2KA 1JLBA 4KBOA 2NRTA 1GLFO 3Q7BA 3RTVA 4ZTFA 5B8HA 2P1JA 4DF4A 3E66A 2E6MA 2IVPA 3HT3A 1SUQA 4JI8K 3I8BA 3LDSA 3B6PA 3L3UA 2YHBA 3TTDA 3DM2A 3L4QA 1ZBHA 4DLGA 1D5AA 1L3VA 4FJXA 4H0PA 3R3LA 2J4RA 1M90O 3T1AA 3VN5A 4CJ7A 4BRPA 3HSTB 1S3XA 1VSLA 2IVOA 3R8EA 3MX2A 4AH9A 3D45A 1EWQA 3E9LA 3KK1A 3TSUA 1RBTA 4X64K 4FLWA 4JI3K 1KTQA 3NGYA 1W2BM 4ID1A 1ZBIA 3PO4A 1ZBSA 1WOQA 3GG4A 3O4QA 3SYZA 1RT5A 4OJRA 5BR9A 3LAMA 4DFKA 1RFQA 4Z4HA 4FJJA 4B1WB 1DTTA 2P5OA 5EY4A 4DTSA 4F3OA 3CCMN 3QEVA 3SV3A 3C6TA 1NK4A 3NF7A 3K9KA 1TKTA 3VQ7A 4CIEA 4CZLA 4KTQA 2YV0X 3HBTA 1S22A 3CJ7A 2E20A 3IAYA 4K25A 1CZBA 1NWKA 4BR9A 3SNNA 4DWIA 3N4PA 3P31A 4FLTA 1FKPA 4CK2A 1VQNN 4M45A 4JKBA 3HRGA 1LWEA 4NCBA 5CE3A 1VSFA 1S9EA 2W6LA 4FWOA 4DFMA 5C0YA 3NH2A 3AO5A 3TAPA 4BQZA 1KAYA 4CF2A 1QSLA 5AR0A 4LFAK 1RTJA 3UKUB 1S1XA 1RILA 4CZFA 2X6NA 4OPAA 4QS8A 1Y64A 5AJ3K 2WFBA 2D4WA 3SZ2A 2E6LA 1WSFA 3QNNA 4Z0UA 3VQ9A 4CHNA 4O5FA 3LWLA 4B3OA 4O8KA 3LP3A 2DY4A 3RMBA 4DG1A 1N6QA 3TAEA 2O8DB 2E2OA 1YTAA 3AVAA 2Z1GA 5AQRA 4DV1K 2UUAK 2GUPA 3OYAA 3K57A 4LF6K 1GOCA 3M3ZA 5C12A 3V9WA 3V9XA 1ILYA 5SZTA 1WN7A 3P39A 3MMVA 1QQNA 1V4SA 4RW4A 3MDQA 1VRTA 4A2AA 1HQEA 3ZEUB 3QB0A 2WBNA 1XUPO 3V81A 4FVUA 4NYFA 3O80A 1NOZA 3KIOA 1BHLA 4BE0A 4B3SK 3WEEA 3KHYA 4F3TA 3CI5A 1E3MA 3SUQA 4XH4A 3AVGA 4KTZA 4R5PA 1YXQA 4B1VA 4BC5A 3E1YA 3M8QA 2RF2A 5EVZA 4CEDA 3SBGA 4YDUC 3L2QA 3ATVA 4KHNA 3FGUA 2YNIA 5T7BA 1CZ9A 3A5MC 3RMDA 5F1XA 4F8RA 4BDPA 3UKUA 4E7KA 4LSNA 4FCYA 1QQMA 2F9WA 3IKMA 3O9UA 1WLJA 3P1GA 3G4SN 1ZBLA 1MDUB 5HBMA 1GLAG 3TTFA 1BQMA 4NB4A 2D0CA 1SL1A 3OW2M 1D9DA 2G8KA 3SQ1A 2F96A 3A5NC 2O8DA 3VESA 4EFHA 4WQ4C 2X74A 4BACA 1FJGK 4JN4A 4BRGA 3LL3A 1TAQA 2ZM6K 2PY5A 2P9KB 1C0GA 5DM6L 1QHAA 4NCGA 4CJVA 3DLHA 3ASMA 2HSTA 2DFHA 5JLHA 4JD2B 2EWSA 4CGJA 4DU3A 2I5JA 4DS5A 4FJMA 2P9NB 3PLAA 3L2VA 3KK3A 4DV7K 4LSLA 3THWB 4BDZA 5BRHA 2YI1A 1BA1A 1EO1A 1QVGM 1T03A 1NK8A 1TUUA 1JLGA 3CXCM 2G8VA 3AO4A 5CZ1A 4CEZA 1YI2N 1VQON 1T05A 1BL3A 2KZZA 3DLRA 4JS4A 3OYNA 3HK2A 1ZYQA 2ZE2A 3FR0A 4Z4IA 4OGCA 3A0IX 2P9LB 3KJVA 2UXCK 1Q9YA 2XY5A 1IV0A 4CI6A 3CCJN 4O5BA 5JLFA 2Q31A 3O3FA 4O55A 2HOEA 3EYZA 3SPYA 5ELZA 3IS9A 5GAHP 2FBXA 3QEXA 5M1PA 3DLLL 1QSSA 3ENOA 2G8UA 2PZSA 1C6VA 2NRWA 3HPHA 1T6CA 1MWMA 1X9MA 2QTDA 4RG8A 1NK0A 2Q0RA 2CH6A 3ZT3A 3MK6A 4FWNA 2HHSA 4K43A 3FFKB 4QS9A 2P9KA 3HVTA 2KTQA 4FJ7A 4M42A 3O4WA 3S3MA 1EX4A 1HMVA 4CF0A 4C23A 1T8EA 3HXMA 2H3GX 2ASMA 1FXXA 1WSJA 2GWJA 4OGEA 4KKOA 3T1HK 1UA0A 4O4GA 3OVNA 4Z4FA 4MDAA 3M1FA 1JLAA 3AVNA 2ASPA 4FWRA 3LALA 1LW0A 4B9QA 3B8AX 3SJHA 1XI1A 5GINA 4JI7K 3IUCA 2RE2A 2VGNA 5AQQA 4CZKA 4GKJK 2OTJN 2AA4A 4CGIA 1WSGA 2OCEA 4FJKA 3MN9A 2D0OA 1QZ5A 1S5JA 2ATQA 3ALYA 4H0TB 4W5OA 1B92A 3S9HA 1U49A 2JWLA 4YNQA 4FVMA 4DSJA 5TKYA 4A2BA 1LAVA 4WF9L 3HZ6A 2X78A 4FPBA 1X9SA 1S1VA 1Z25A 3IDHA 4J2BA 5JMVA 1I3AA 4DQIA 4DSFA 2Z1JA 1BISA 2ZJPL 3GOIA 3LDNA 2E2QA 4C1NI 2EX3A 1L3TA 3MX5A 3SUNA 3A5OC 4KH5A 1T44A 1RDBA 2O4GA 2DFFA 3NVMA 1G99A 3EE8A 1VQ8N 4HTLA 1XMOK 1WAFA 2FLOA 4DTXA 3LP0A 2W6KA 3SAFA 3NH0A 1ZBFA 3QEWA 3U8XA 3VF2A 4LF4K 3BUZB 2V51B 5JICA 3SMSA 2HBMA 5M1FA 4FK0A 5JVGL 4I9QA 1YVUA 5AQVA 4BRIA 3OYFA 5FPDA 2OPRA 3DAWA 5CZ2A 3I56N 4JHDA 1BCMA
chains in the Genus database with same CATH topology
1NOYA 1KRPA 1C1BA 3NBPA 1L3SA 3LANA 4AHCA 4DMNA 1X9WA 2G8IA 1RT4A 4FXDA 1X1PA 1C0TA 2KZMA 2Z1IA 2YKMA 2RN2A 2IAJA 4UQGA 4CERA 1KLNA 4B9UA 3V9UA 1IKWA 3TAFA 3PY8A 5C42A 2HHUA 4GMJB 4LH5A 1C1AA 2Z1HA 4C8MA 3ZT0A 3PO5A 3ZSZA 2Y1JA 5KRSA 3AO2A 4CIGA 4B9VA 1S9GA 4DFPA 4CFDA 1YTUA 4KHQA 4OKKA 3G10A 4Y1CA 4DSIA 1WNSA 5J2QA 5C25A 3WNHA 1NJXA 4N41A 2BGGA 3CM5A 1RCHA 4CGGA 4B9LA 4E7JA 1UOCA 2X6SA 2W42A 1JLFA 1EKEA 3AA2A 3I0RA 4M3XA 3KKSA 3AVBA 3ZT4A 4CK1A 4AILC 3NGIA 4GW6A 1D9FA 4ID5A 2EHGA 3P5JA 4QAGA 4JS5A 2G8WA 3EZ5A 1UWBA 4KB0A 2F8SA 3OJSA 1RT2A 1XWLA 2IC3A 4E1MA 2QKKA 4B8CA 3LPTA 4M3ZA 3DLGA 1ASVA 2ZQBA 3NHGA 3DMJA 2HVHA 3KD5E 1JLBA 4FZZA 5FDLA 4CGDA 3QETA 3RTVA 3VQ4A 4ZTFA 3QINA 3OYLA 3NF9A 1W9HA 2P1JA 2WONA 4DF4A 4DSLA 1WSIA 2E6MA 4M41A 3AVHA 3RRHA 3AVKA 4H8KA 3HO1A 3DLEA 5DMRA 1SUQA 1LWFA 3HT3A 3LDSA 3B6PA 3WNGA 3L3UA 2YHBA 3OYBA 3DM2A 4DTJA 1MU2A 3HM9A 1NJZA 1ZBHA 3ZSXA 4DLGA 4CJEA 1R0AA 1D5AA 4CJ3A 4FM0A 4N56A 3CFRA 1L3VA 4FJXA 3S3NA 1SKRA 3BDPA 2BDPA 4FW1A 1U04A 4QCLA 4M3YA 3NFAA 3T1AA 3VN5A 2KFZA 3HSTB 1LWCA 3RR8A 4M3UA 1B9FA 3OS0A 1VSLA 5K14A 4ELVA 2WOMA 4AH9A 3D45A 1DTQA 3KK1A 1RBTA 1Z26A 5KRTA 4FLWA 3PX0A 4DU1A 1KTQA 4ELUA 2R7YA 1L5UA 3JSMA 3NGYA 1QS4A 4ID1A 5HRRA 4CFCA 1ZBIA 5KGWA 1JXBA 2RPIA 3PO4A 4O0JA 4CJKA 3AA5X 4DTRA 1K6YA 1BI4B 4JRQA 3O4QA 3SYZA 4FW2A 4CE9A 1RT5A 4OJRA 3VQEA 3LAMA 4DFJA 2HHQA 3PX6A 3AVJA 4CHPA 2B6AA 3ISNC 2XHBA 4DFKA 1A5WA 1VSMA 5KGXA 4Z4HA 2E4LA 4CHYA 3OYIA 4AHUA 4FJJA 4FJ8A 2FC0A 5CYMA 1DTTA 4TSXA 3RRGA 4KREA 3EY1A 2P5OA 4DTSA 4HCCA 1TL1A 4F3OA 1T7PA 1CXUA 1L3UA 1ASWA 2AJQA 3QEVA 3SV3A 1RT3A 5E41A 3AVIA 3C6TA 3T19A 3NF7A 1NK4A 1KCFA 3F9KA 5J2MA 1TKTA 3VQ7A 4DTMA 4CIEA 2ZD1A 1BIUA 3U3GA 4KTQA 5J2NA 4HHTA 3TARA 2JGUA 3IG1A 4M3TA 2YV0X 2IDOA 3P83D 4N47A 3HPOA 1Q9XA 3RMAA 4W5RA 1J5OA 3IAYA 3OS2A 1CZBA 1RDAA 3I8DA 1TAUA 4HTUA 3V6DA 4KAZA 4HVJA 3SNNA 4DWIA 3CYMA 4CF9A 3DRSA 3U6FA 4FLYA 2YNGA 3OYEA 1BIZA 1SKWA 4E19A 4FLTA 1S6QA 4CJFA 3K2PA 1FKPA 4CK2A 5J2PA 1U4BA 3ZT1A 4M45A 1LWEA 4NCBA 3MEEA 4CECA 2HB5A 4J2EA 3V1OA 4N76A 2HW3A 4IBNA 1VSFA 1S9EA 4DFMA 2HNYA 1FKOA 1LW2A 3CFOA 4L8RB 2P5GA 3NH2A 4JRPA 3AO5A 4DLEA 3TAPA 1D8YA 3M8RA 4CF2A 4DTNA 1QSLA 3NF6A 3DI6A 4HUFA 4CEQA 1RTJA 3QIOA 3F73A 1CXQA 1HYVA 1S1XA 4CEOA 1TV6A 3CFPA 5HLFA 1RILA 4F2RA 1TGOA 1SKSA 2X6NA 4FJ9A 4BE2A 2Y1IA 3LP2A 3OYDA 3SZ2A 3THVA 2E6LA 1WSFA 3QNNA 5C24A 4IDKA 5HP1A 4B08A 4Z0UA 4KRFA 3IRXA 4DSEA 3VQ9A 4CHNA 5HRSA 4E7LA 3LWLA 4FJ5A 2PYLA 4B3OA 2LSNA 1NK9A 3LP3A 4MQ3A 2DY4A 3RMBA 4B8AB 3LZJA 4DG1A 3NAEA 1N6QA 3TAEA 3RMCA 4FZYA 3HVRA 4FLXA 1YTAA 1RDCA 2Z1GA 3AVAA 2A1RA 2G8HA 2HHXA 4B9SA 1RBRA 3AVLA 4Z4CA 1RBSA 2D5RA 3SQ2A 2D0AA 4RW6A 3JYTA 1FK9A 3PV8A 5KI6A 2P51A 3OYAA 1XHXA 3K57A 1GOCA 1HRHA 3TAMA 3LPUA 1C0UA 3V9WA 3V9XA 1S6PA 3DRPA 5SZTA 3SPZA 1WN7A 5CY4A 3VQAA 2OA8A 4PY5A 4RW4A 1RDDA 3OYJA 5JS2A 1VRTA 2VWJA 1TK0A 1HQEA 3SQ4A 3V81A 4KPYA 3ULDA 2BE2A 4NYFA 4CFBA 4FLZA 1NOZA 3AO3A 4DSKA 4HCBA 4KHYA 4OLAA 4CJ4A 4KHSA 4CEAA 3KIOA 4Z4GA 1BHLA 4BE0A 4C8LA 2IOCA 4CK3A 1BGXT 1XHZA 4F3TA 3SUQA 3AVGA 4KTZA 1ASUA 4R5PA 2NUBA 4RW9A 4O0IA 3I0SA 4B9TA 1YT3A 3M8QA 2RF2A 1S1UA 4M3RA 3VQBA 3SV4A 1KFDA 1VRUA 4I2QA 4ICLA 4CEDA 1I39A 3L2QA 1NK5A 1W0HA 4KHNA 2HHVA 4ELTA 3DLKA 1RTIA 1RBVA 1ZBUA 4B9MA 4KB1A 5SWMA 4EZ6A 2YNIA 1IH7A 2D0BA 5T7BA 1A5VA 1JKHA 1F21A 1EETA 1CZ9A 2ITGA 1WSHA 3KD1E 4Z4EA 3C6UA 1RTHA 2RKIA 1IKVA 4CESA 4FLUA 3SCXA 3MAQA 1NKEA 3TAQA 3RMDA 1NK7A 1A5XA 3L2RA 4F8RA 4JLHA 2HVIA 1JLCA 4BDPA 2IS3A 4PA1A 3E01A 1SL2A 2VG5A 4E7KA 3OY9A 3KLFA 3UIQA 4LSNA 4FCYA 4DU4A 4QOZB 1RTDA 1LAWA 5J1EA 5HROA 3G0ZA 3QIPA 1U45A 1WLJA 2OPPA 3NGZA 3KLGA 3P1GA 3L2WA 4CGFA 4O44A 2A1SA 1ZBLA 1VSIA 4C8OA 4CHZA 5HBMA 1EP4A 1BQMA 4CJQA 3RR7A 2D0CA 2VG7A 4IG0A 1J9AA 3FFIA 2B5JA 3OYCA 1SL1A 3QNOA 1D9DA 2G8KA 4F4KA 3SQ1A 2F96A 2OYQA 2DFEA 3KLHA 1RT6A 2X74A 1QHTA 4BACA 4BDYA 4PUOA 4IFVA 4M3WA 3DYAA 4AHSA 4KI4A 1O1WA 1TAQA 3SJJA 2PY5A 1KVCA 3AVCA 3SQ0A 2YNFA 4H4MA 4NCGA 1RT7A 4KFBA 4CJVA 1J53A 1KVBA 4E1NA 1NK6A 3DLHA 1KLMA 3ASMA 5EU7A 2DFHA 3LP1A 4CHOA 4W5TA 3LAKA 3O3GA 3AVFA 4CGJA 4DU3A 2I5JA 3HP9A 3MEDA 4CJRA 4DS5A 3C95A 3QEPA 4FJMA 3NH1A 2BANA 3L2VA 1GOBA 3V4IA 3KK3A 4KV8A 4LSLA 4KHWA 2YHAA 4ZHRA 1G15A 4Y1DA 4BDZA 1QQCA 4DF8A 4NCAA 1VSEA 2HNZA 1HJRA 4K8XA 3L8BA 2O4IA 4CGHA 1S1TA 1T03A 4DQSA 2KFNA 1NK8A 3DOLA 1S1WA 5FRNA 1JLGA 4CF8A 2G8VA 3AO4A 5CZ1A 4DS4A 4CEZA 4EP5A 3QO9A 3NDKA 3OYMA 3NCIA 3ZT2A 1HYZA 3M8SA 3MXJA 3MECA 2XRIA 1JXEA 1RT1A 1TVRA 4RW7A 2GBZA 1T05A 1BL3A 3T3FA 4CJPA 3U3YA 2KZZA 3DLRA 2VG6A 2Q3SA 4JS4A 1NKBA 3OYNA 3HK2A 1TL3A 1WSEA 2ZE2A 3V1QA 4CF1A 1ZYQA 4OGCA 5D3GA 4Z4IA 1TKZA 2HHTA 3KJVA 3NF8A 4H4OA 4FK2A 4CHQA 1Q9YA 4DQQA 2OZMA 2XY5A 4EZ9A 4O5BA 4KO0A 3O3FA 4KHUA 4O55A 1VSKA 3DOKA 4EP4A 3EYZA 1RBUA 2HNDA 3SPYA 3HJFA 2QK9A 4W5NA 1QSYA 4IKFA 1Y97A 4Q0BA 4OKJA 3VA3A 3IS9A 3VQPA 2FBXA 3QEXA 2IGIA 1QSSA 1BI4A 4CJWA 4FM2A 2G8UA 3CQ8A 3C94A 2PZSA 1C6VA 2ETJA 1C0MA 3HPHA 4BWJA 3QEIA 1X9MA 2QKBA 4FYDA 4RG8A 3TAGA 3TABA 1NK0A 4LD0A 4FM1A 3B6OA 3H08A 2XY6A 1KSPA 1UAXA 3O3HA 3KTQA 1REVA 3ZT3A 5HRPA 4DTUA 3AO1A 4J2AA 2KW4A 3ZCMA 2HHSA 4CJ5A 4CJSA 3KLEA 3RWUA 1TKXA 1DLOA 4BWMA 3HVTA 2KTQA 1BCOA 4FJ7A 5FRMA 4PQUA 4M42A 2GV9A 1HNVA 3S3MA 1EX4A 1JLEA 1HMVA 4CF0A 5HRNA 3OYHA 3ITHA 3LWMA 3NE6A 3HP6A 1NJYA 1T8EA 3HXMA 1N5YA 4IFYA 1FXXA 3HPGA 3ZSRA 1WSJA 3K5NA 1SV5A 3AV9A 4KKOA 4I9LA 4OGEA 4O4GA 3OVNA 3SUOA 5I3UA 1UA0A 1XC9A 1JLAA 2HMIA 3AVNA 4Z4FA 3OYKA 4B9NA 1HQUA 3K58A 4E3SA 2DTUA 2XY8A 2F8TA 3OS1A 3LALA 4XIUA 1LW0A 3SUPA 3CM6A 4HUGA 1XI1A 1TK8A 4OKEA 4W5QA 3WNFA 3MEGA 3ZSWA 4DTPA 3OJUA 2G8FA 3TR8A 2B4JA 3VQDA 1VSDA 3HL8A 4E7HA 4ZTJA 4C8NA 3L2UA 3QERA 5KTQA 4CGIA 2JLEA 1WSGA 3M8PA 4FZXC 4FJKA 1KFSA 3L3VA 5CYQA 1U48A 3ZSOA 2PYJA 1S5JA 2ATQA 3ALYA 3S9HA 4W5OA 1U49A 1B92A 4OPKA 1JL2A 1Q8IA 3A2FA 2YNHA 4KTWA 3TI0A 4YNQA 2XO7A 4FVMA 4DSJA 1HNIA 2KQ2A 3O4NA 4DTOA 4E7IA 4OVLA 2FBVA 3V9ZA 3VA0A 4HUEA 1NJWA 3VQ8A 3DRRA 1LAVA 4FK4A 2X78A 1HYSA 4MFBA 3LZIA 1CLQA 3MXMA 2FBYA 4FLVA 1X9SA 2OZSA 1S1VA 1Z25A 4IG3A 4BE1A 4J2BA 3MXIA 4FJNA 1IKYA 4CEBA 1I3AA 4DQIA 4DSFA 2HHWA 4K8ZA 3AVMA 3ZSQA 1ITGA 3AA3A 3WNEA 2Z1JA 4GVMA 1BISA 4LH4A 1RNHA 4FJIA 1TKDA 5JS1A 4I2PA 2EX3A 2VWKA 4YFUA 4DQPA 4CCHA 4LY7A 1VSJA 3K59A 4CEFA 4FJHA 1L3TA 3K5OA 4RW8A 1HPZA 1LV5A 3SUNA 4AHVA 4PWDA 3DLBA 2GUIA 3PUFA 4FJLA 3K5MA 3QLHA 1RDBA 2O4GA 3ZSYA 1QTMA 2DFFA 4DQRA 2OPSA 4AHTA 3S3OA 4FJGA 4OLBA 1BQNA 5FROA 1EXQA 3OYGA 1WAFA 2FBTA 4CIFA 3AA4A 4CJTA 1IKXA 1JL1A 4DTXA 3SI6A 1GOAA 1NKCA 1IG9A 3LP0A 1SL0A 1VSHA 4J2DA 3V9SA 1KVAA 1WAJA 5I42A 4C8KA 4F2SA 3NH0A 3KLIA 1ZBFA 3QEWA 4E89A 2QXFA 1U47A 4OPJA 3KKRA 3KK2A 4KI6A 1JLQA 4CFAA 4CJUA 3D0PA 3VQ5A 4CEEA 1UA1A 2OPQA 4NYNA 3BGRA 4E0DA 3QESA 1TK5A 1C1CA 4FK0A 4I9QA 3PX4A 1IO2A 4AHRA 2YKNA 1B9DA 3HYFA 4CJLA 1YVUA 4G1QA 3VQQA 5DK5A 3TWHA 3CG7A 3OYFA 1VK0A 3TANA 1J54A 2OPRA 4Q5VA 3V1RA 3K5LA 5CZ2A 4WE1A 1QE1A 4N5SA 1BCMA 4I7FA 2XY7A 3VQ6A 3VQCA 3ZSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NOY A;  1KRP A;  1C1B A;  3NBP A;  1L3S A;  3LAN A;  4AHC A;  4DMN A;  1X9W A;  2G8I A;  1RT4 A;  4FXD A;  1X1P A;  1C0T A;  2KZM A;  2Z1I A;  2YKM A;  2RN2 A;  2IAJ A;  4UQG A;  4CER A;  1KLN A;  4B9U A;  3V9U A;  1IKW A;  3TAF A;  3PY8 A;  5C42 A;  2HHU A;  4GMJ B;  4LH5 A;  1C1A A;  2Z1H A;  4C8M A;  3ZT0 A;  3PO5 A;  3ZSZ A;  2Y1J A;  5KRS A;  3AO2 A;  4CIG A;  4B9V A;  1S9G A;  4DFP A;  4CFD A;  1YTU A;  4KHQ A;  4OKK A;  3G10 A;  4Y1C A;  4DSI A;  1WNS A;  5J2Q A;  5C25 A;  3WNH A;  1NJX A;  4N41 A;  2BGG A;  3CM5 A;  1RCH A;  4CGG A;  4B9L A;  4E7J A;  1UOC A;  2X6S A;  2W42 A;  1JLF A;  1EKE A;  3AA2 A;  3I0R A;  4M3X A;  3KKS A;  3AVB A;  3ZT4 A;  4CK1 A;  4AIL C;  3NGI A;  4GW6 A;  1D9F A;  4ID5 A;  2EHG A;  3P5J A;  4QAG A;  4JS5 A;  2G8W A;  3EZ5 A;  1UWB A;  4KB0 A;  2F8S A;  3OJS A;  1RT2 A;  1XWL A;  2IC3 A;  4E1M A;  2QKK A;  4B8C A;  3LPT A;  4M3Z A;  3DLG A;  1ASV A;  2ZQB A;  3NHG A;  3DMJ A;  2HVH A;  3KD5 E;  1JLB A;  4FZZ A;  5FDL A;  4CGD A;  3QET A;  3RTV A;  3VQ4 A;  4ZTF A;  3QIN A;  3OYL A;  3NF9 A;  1W9H A;  2P1J A;  2WON A;  4DF4 A;  4DSL A;  1WSI A;  2E6M A;  4M41 A;  3AVH A;  3RRH A;  3AVK A;  4H8K A;  3HO1 A;  3DLE A;  5DMR A;  1SUQ A;  1LWF A;  3HT3 A;  3LDS A;  3B6P A;  3WNG A;  3L3U A;  2YHB A;  3OYB A;  3DM2 A;  4DTJ A;  1MU2 A;  3HM9 A;  1NJZ A;  1ZBH A;  3ZSX A;  4DLG A;  4CJE A;  1R0A A;  1D5A A;  4CJ3 A;  4FM0 A;  4N56 A;  3CFR A;  1L3V A;  4FJX A;  3S3N A;  1SKR A;  3BDP A;  2BDP A;  4FW1 A;  1U04 A;  4QCL A;  4M3Y A;  3NFA A;  3T1A A;  3VN5 A;  2KFZ A;  3HST B;  1LWC A;  3RR8 A;  4M3U A;  1B9F A;  3OS0 A;  1VSL A;  5K14 A;  4ELV A;  2WOM A;  4AH9 A;  3D45 A;  1DTQ A;  3KK1 A;  1RBT A;  1Z26 A;  5KRT A;  4FLW A;  3PX0 A;  4DU1 A;  1KTQ A;  4ELU A;  2R7Y A;  1L5U A;  3JSM A;  3NGY A;  1QS4 A;  4ID1 A;  5HRR A;  4CFC A;  1ZBI A;  5KGW A;  1JXB A;  2RPI A;  3PO4 A;  4O0J A;  4CJK A;  3AA5 X;  4DTR A;  1K6Y A;  1BI4 B;  4JRQ A;  3O4Q A;  3SYZ A;  4FW2 A;  4CE9 A;  1RT5 A;  4OJR A;  3VQE A;  3LAM A;  4DFJ A;  2HHQ A;  3PX6 A;  3AVJ A;  4CHP A;  2B6A A;  3ISN C;  2XHB A;  4DFK A;  1A5W A;  1VSM A;  5KGX A;  4Z4H A;  2E4L A;  4CHY A;  3OYI A;  4AHU A;  4FJJ A;  4FJ8 A;  2FC0 A;  5CYM A;  1DTT A;  4TSX A;  3RRG A;  4KRE A;  3EY1 A;  2P5O A;  4DTS A;  4HCC A;  1TL1 A;  4F3O A;  1T7P A;  1CXU A;  1L3U A;  1ASW A;  2AJQ A;  3QEV A;  3SV3 A;  1RT3 A;  5E41 A;  3AVI A;  3C6T A;  3T19 A;  3NF7 A;  1NK4 A;  1KCF A;  3F9K A;  5J2M A;  1TKT A;  3VQ7 A;  4DTM A;  4CIE A;  2ZD1 A;  1BIU A;  3U3G A;  4KTQ A;  5J2N A;  4HHT A;  3TAR A;  2JGU A;  3IG1 A;  4M3T A;  2YV0 X;  2IDO A;  3P83 D;  4N47 A;  3HPO A;  1Q9X A;  3RMA A;  4W5R A;  1J5O A;  3IAY A;  3OS2 A;  1CZB A;  1RDA A;  3I8D A;  1TAU A;  4HTU A;  3V6D A;  4KAZ A;  4HVJ A;  3SNN A;  4DWI A;  3CYM A;  4CF9 A;  3DRS A;  3U6F A;  4FLY A;  2YNG A;  3OYE A;  1BIZ A;  1SKW A;  4E19 A;  4FLT A;  1S6Q A;  4CJF A;  3K2P A;  1FKP A;  4CK2 A;  5J2P A;  1U4B A;  3ZT1 A;  4M45 A;  1LWE A;  4NCB A;  3MEE A;  4CEC A;  2HB5 A;  4J2E A;  3V1O A;  4N76 A;  2HW3 A;  4IBN A;  1VSF A;  1S9E A;  4DFM A;  2HNY A;  1FKO A;  1LW2 A;  3CFO A;  4L8R B;  2P5G A;  3NH2 A;  4JRP A;  3AO5 A;  4DLE A;  3TAP A;  1D8Y A;  3M8R A;  4CF2 A;  4DTN A;  1QSL A;  3NF6 A;  3DI6 A;  4HUF A;  4CEQ A;  1RTJ A;  3QIO A;  3F73 A;  1CXQ A;  1HYV A;  1S1X A;  4CEO A;  1TV6 A;  3CFP A;  5HLF A;  1RIL A;  4F2R A;  1TGO A;  1SKS A;  2X6N A;  4FJ9 A;  4BE2 A;  2Y1I A;  3LP2 A;  3OYD A;  3SZ2 A;  3THV A;  2E6L A;  1WSF A;  3QNN A;  5C24 A;  4IDK A;  5HP1 A;  4B08 A;  4Z0U A;  4KRF A;  3IRX A;  4DSE A;  3VQ9 A;  4CHN A;  5HRS A;  4E7L A;  3LWL A;  4FJ5 A;  2PYL A;  4B3O A;  2LSN A;  1NK9 A;  3LP3 A;  4MQ3 A;  2DY4 A;  3RMB A;  4B8A B;  3LZJ A;  4DG1 A;  3NAE A;  1N6Q A;  3TAE A;  3RMC A;  4FZY A;  3HVR A;  4FLX A;  1YTA A;  1RDC A;  2Z1G A;  3AVA A;  2A1R A;  2G8H A;  2HHX A;  4B9S A;  1RBR A;  3AVL A;  4Z4C A;  1RBS A;  2D5R A;  3SQ2 A;  2D0A A;  4RW6 A;  3JYT A;  1FK9 A;  3PV8 A;  5KI6 A;  2P51 A;  3OYA A;  1XHX A;  3K57 A;  1GOC A;  1HRH A;  3TAM A;  3LPU A;  1C0U A;  3V9W A;  3V9X A;  1S6P A;  3DRP A;  5SZT A;  3SPZ A;  1WN7 A;  5CY4 A;  3VQA A;  2OA8 A;  4PY5 A;  4RW4 A;  1RDD A;  3OYJ A;  5JS2 A;  1VRT A;  2VWJ A;  1TK0 A;  1HQE A;  3SQ4 A;  3V81 A;  4KPY A;  3ULD A;  2BE2 A;  4NYF A;  4CFB A;  4FLZ A;  1NOZ A;  3AO3 A;  4DSK A;  4HCB A;  4KHY A;  4OLA A;  4CJ4 A;  4KHS A;  4CEA A;  3KIO A;  4Z4G A;  1BHL A;  4BE0 A;  4C8L A;  2IOC A;  4CK3 A;  1BGX T;  1XHZ A;  4F3T A;  3SUQ A;  3AVG A;  4KTZ A;  1ASU A;  4R5P A;  2NUB A;  4RW9 A;  4O0I A;  3I0S A;  4B9T A;  1YT3 A;  3M8Q A;  2RF2 A;  1S1U A;  4M3R A;  3VQB A;  3SV4 A;  1KFD A;  1VRU A;  4I2Q A;  4ICL A;  4CED A;  1I39 A;  3L2Q A;  1NK5 A;  1W0H A;  4KHN A;  2HHV A;  4ELT A;  3DLK A;  1RTI A;  1RBV A;  1ZBU A;  4B9M A;  4KB1 A;  5SWM A;  4EZ6 A;  2YNI A;  1IH7 A;  2D0B A;  5T7B A;  1A5V A;  1JKH A;  1F21 A;  1EET A;  1CZ9 A;  2ITG A;  1WSH A;  3KD1 E;  4Z4E A;  3C6U A;  1RTH A;  2RKI A;  1IKV A;  4CES A;  4FLU A;  3SCX A;  3MAQ A;  1NKE A;  3TAQ A;  3RMD A;  1NK7 A;  1A5X A;  3L2R A;  4F8R A;  4JLH A;  2HVI A;  1JLC A;  4BDP A;  2IS3 A;  4PA1 A;  3E01 A;  1SL2 A;  2VG5 A;  4E7K A;  3OY9 A;  3KLF A;  3UIQ A;  4LSN A;  4FCY A;  4DU4 A;  4QOZ B;  1RTD A;  1LAW A;  5J1E A;  5HRO A;  3G0Z A;  3QIP A;  1U45 A;  1WLJ A;  2OPP A;  3NGZ A;  3KLG A;  3P1G A;  3L2W A;  4CGF A;  4O44 A;  2A1S A;  1ZBL A;  1VSI A;  4C8O A;  4CHZ A;  5HBM A;  1EP4 A;  1BQM A;  4CJQ A;  3RR7 A;  2D0C A;  2VG7 A;  4IG0 A;  1J9A A;  3FFI A;  2B5J A;  3OYC A;  1SL1 A;  3QNO A;  1D9D A;  2G8K A;  4F4K A;  3SQ1 A;  2F96 A;  2OYQ A;  2DFE A;  3KLH A;  1RT6 A;  2X74 A;  1QHT A;  4BAC A;  4BDY A;  4PUO A;  4IFV A;  4M3W A;  3DYA A;  4AHS A;  4KI4 A;  1O1W A;  1TAQ A;  3SJJ A;  2PY5 A;  1KVC A;  3AVC A;  3SQ0 A;  2YNF A;  4H4M A;  4NCG A;  1RT7 A;  4KFB A;  4CJV A;  1J53 A;  1KVB A;  4E1N A;  1NK6 A;  3DLH A;  1KLM A;  3ASM A;  5EU7 A;  2DFH A;  3LP1 A;  4CHO A;  4W5T A;  3LAK A;  3O3G A;  3AVF A;  4CGJ A;  4DU3 A;  2I5J A;  3HP9 A;  3MED A;  4CJR A;  4DS5 A;  3C95 A;  3QEP A;  4FJM A;  3NH1 A;  2BAN A;  3L2V A;  1GOB A;  3V4I A;  3KK3 A;  4KV8 A;  4LSL A;  4KHW A;  2YHA A;  4ZHR A;  1G15 A;  4Y1D A;  4BDZ A;  1QQC A;  4DF8 A;  4NCA A;  1VSE A;  2HNZ A;  1HJR A;  4K8X A;  3L8B A;  2O4I A;  4CGH A;  1S1T A;  1T03 A;  4DQS A;  2KFN A;  1NK8 A;  3DOL A;  1S1W A;  5FRN A;  1JLG A;  4CF8 A;  2G8V A;  3AO4 A;  5CZ1 A;  4DS4 A;  4CEZ A;  4EP5 A;  3QO9 A;  3NDK A;  3OYM A;  3NCI A;  3ZT2 A;  1HYZ A;  3M8S A;  3MXJ A;  3MEC A;  2XRI A;  1JXE A;  1RT1 A;  1TVR A;  4RW7 A;  2GBZ A;  1T05 A;  1BL3 A;  3T3F A;  4CJP A;  3U3Y A;  2KZZ A;  3DLR A;  2VG6 A;  2Q3S A;  4JS4 A;  1NKB A;  3OYN A;  3HK2 A;  1TL3 A;  1WSE A;  2ZE2 A;  3V1Q A;  4CF1 A;  1ZYQ A;  4OGC A;  5D3G A;  4Z4I A;  1TKZ A;  2HHT A;  3KJV A;  3NF8 A;  4H4O A;  4FK2 A;  4CHQ A;  1Q9Y A;  4DQQ A;  2OZM A;  2XY5 A;  4EZ9 A;  4O5B A;  4KO0 A;  3O3F A;  4KHU A;  4O55 A;  1VSK A;  3DOK A;  4EP4 A;  3EYZ A;  1RBU A;  2HND A;  3SPY A;  3HJF A;  2QK9 A;  4W5N A;  1QSY A;  4IKF A;  1Y97 A;  4Q0B A;  4OKJ A;  3VA3 A;  3IS9 A;  3VQP A;  2FBX A;  3QEX A;  2IGI A;  1QSS A;  1BI4 A;  4CJW A;  4FM2 A;  2G8U A;  3CQ8 A;  3C94 A;  2PZS A;  1C6V A;  2ETJ A;  1C0M A;  3HPH A;  4BWJ A;  3QEI A;  1X9M A;  2QKB A;  4FYD A;  4RG8 A;  3TAG A;  3TAB A;  1NK0 A;  4LD0 A;  4FM1 A;  3B6O A;  3H08 A;  2XY6 A;  1KSP A;  1UAX A;  3O3H A;  3KTQ A;  1REV A;  3ZT3 A;  5HRP A;  4DTU A;  3AO1 A;  4J2A A;  2KW4 A;  3ZCM A;  2HHS A;  4CJ5 A;  4CJS A;  3KLE A;  3RWU A;  1TKX A;  1DLO A;  4BWM A;  3HVT A;  2KTQ A;  1BCO A;  4FJ7 A;  5FRM A;  4PQU A;  4M42 A;  2GV9 A;  1HNV A;  3S3M A;  1EX4 A;  1JLE A;  1HMV A;  4CF0 A;  5HRN A;  3OYH A;  3ITH A;  3LWM A;  3NE6 A;  3HP6 A;  1NJY A;  1T8E A;  3HXM A;  1N5Y A;  4IFY A;  1FXX A;  3HPG A;  3ZSR A;  1WSJ A;  3K5N A;  1SV5 A;  3AV9 A;  4KKO A;  4I9L A;  4OGE A;  4O4G A;  3OVN A;  3SUO A;  5I3U A;  1UA0 A;  1XC9 A;  1JLA A;  2HMI A;  3AVN A;  4Z4F A;  3OYK A;  4B9N A;  1HQU A;  3K58 A;  4E3S A;  2DTU A;  2XY8 A;  2F8T A;  3OS1 A;  3LAL A;  4XIU A;  1LW0 A;  3SUP A;  3CM6 A;  4HUG A;  1XI1 A;  1TK8 A;  4OKE A;  4W5Q A;  3WNF A;  3MEG A;  3ZSW A;  4DTP A;  3OJU A;  2G8F A;  3TR8 A;  2B4J A;  3VQD A;  1VSD A;  3HL8 A;  4E7H A;  4ZTJ A;  4C8N A;  3L2U A;  3QER A;  5KTQ A;  4CGI A;  2JLE A;  1WSG A;  3M8P A;  4FZX C;  4FJK A;  1KFS A;  3L3V A;  5CYQ A;  1U48 A;  3ZSO A;  2PYJ A;  1S5J A;  2ATQ A;  3ALY A;  3S9H A;  4W5O A;  1U49 A;  1B92 A;  4OPK A;  1JL2 A;  1Q8I A;  3A2F A;  2YNH A;  4KTW A;  3TI0 A;  4YNQ A;  2XO7 A;  4FVM A;  4DSJ A;  1HNI A;  2KQ2 A;  3O4N A;  4DTO A;  4E7I A;  4OVL A;  2FBV A;  3V9Z A;  3VA0 A;  4HUE A;  1NJW A;  3VQ8 A;  3DRR A;  1LAV A;  4FK4 A;  2X78 A;  1HYS A;  4MFB A;  3LZI A;  1CLQ A;  3MXM A;  2FBY A;  4FLV A;  1X9S A;  2OZS A;  1S1V A;  1Z25 A;  4IG3 A;  4BE1 A;  4J2B A;  3MXI A;  4FJN A;  1IKY A;  4CEB A;  1I3A A;  4DQI A;  4DSF A;  2HHW A;  4K8Z A;  3AVM A;  3ZSQ A;  1ITG A;  3AA3 A;  3WNE A;  2Z1J A;  4GVM A;  1BIS A;  4LH4 A;  1RNH A;  4FJI A;  1TKD A;  5JS1 A;  4I2P A;  2EX3 A;  2VWK A;  4YFU A;  4DQP A;  4CCH A;  4LY7 A;  1VSJ A;  3K59 A;  4CEF A;  4FJH A;  1L3T A;  3K5O A;  4RW8 A;  1HPZ A;  1LV5 A;  3SUN A;  4AHV A;  4PWD A;  3DLB A;  2GUI A;  3PUF A;  4FJL A;  3K5M A;  3QLH A;  1RDB A;  2O4G A;  3ZSY A;  1QTM A;  2DFF A;  4DQR A;  2OPS A;  4AHT A;  3S3O A;  4FJG A;  4OLB A;  1BQN A;  5FRO A;  1EXQ A;  3OYG A;  1WAF A;  2FBT A;  4CIF A;  3AA4 A;  4CJT A;  1IKX A;  1JL1 A;  4DTX A;  3SI6 A;  1GOA A;  1NKC A;  1IG9 A;  3LP0 A;  1SL0 A;  1VSH A;  4J2D A;  3V9S A;  1KVA A;  1WAJ A;  5I42 A;  4C8K A;  4F2S A;  3NH0 A;  3KLI A;  1ZBF A;  3QEW A;  4E89 A;  2QXF A;  1U47 A;  4OPJ A;  3KKR A;  3KK2 A;  4KI6 A;  1JLQ A;  4CFA A;  4CJU A;  3D0P A;  3VQ5 A;  4CEE A;  1UA1 A;  2OPQ A;  4NYN A;  3BGR A;  4E0D A;  3QES A;  1TK5 A;  1C1C A;  4FK0 A;  4I9Q A;  3PX4 A;  1IO2 A;  4AHR A;  2YKN A;  1B9D A;  3HYF A;  4CJL A;  1YVU A;  4G1Q A;  3VQQ A;  5DK5 A;  3TWH A;  3CG7 A;  3OYF A;  1VK0 A;  3TAN A;  1J54 A;  2OPR A;  4Q5V A;  3V1R A;  3K5L A;  5CZ2 A;  4WE1 A;  1QE1 A;  4N5S A;  1BCM A;  4I7F A;  2XY7 A;  3VQ6 A;  3VQC A;  3ZSV A; 
#chains in the Genus database with same CATH topology
 4K42 A;  5BPN A;  2NRR A;  2F7T A;  3NBP A;  4BRQ A;  4WFA L;  2KZM A;  2RN2 A;  4UQG A;  1TUY A;  4O8U A;  3TAF A;  5C42 A;  3H1Q A;  4QS7 A;  4GMJ B;  1T6D A;  2Z1H A;  3ZT0 A;  3PO5 A;  3ZSZ A;  3AAR A;  3EE9 A;  1NGA A;  5LL6 Z;  3G10 A;  4Y1C A;  1WNS A;  3E9O A;  1TYQ A;  4CGG A;  4E7J A;  1UOC A;  4PKI A;  4AIL C;  1N34 K;  4BRK A;  2OZS A;  3P5J A;  2FSJ A;  4H03 B;  2YJE A;  1UWB A;  2F8S A;  3OJS A;  1XWL A;  3AY9 A;  4M3Z A;  4LF9 K;  2A40 A;  3NHG A;  4CW7 B;  3DMJ A;  3CQY A;  3G25 A;  3KD5 E;  5C2F A;  4PL7 A;  2PFU A;  3QIN A;  4DKW A;  4BC3 A;  4ILJ A;  2WON A;  4IO9 L;  4DSL A;  1WSI A;  2ZGZ A;  4H8K A;  5DMR A;  3JAM O;  1U2V B;  2D0P A;  2F9T A;  3CPW M;  3W3D A;  4DTJ A;  3OYB A;  1NJZ A;  1JCG A;  1Q81 O;  2NRV A;  3CJ1 A;  4H0O A;  1S72 N;  4K0K K;  4FM0 A;  4N56 A;  3CFR A;  3S3N A;  3BDP A;  2VCP A;  1QZ6 A;  3NFA A;  2KFZ A;  3GL1 A;  3RR8 A;  3KWG A;  4IO8 A;  1EWR A;  5K14 A;  2WOM A;  4BRE A;  4DU1 A;  1L5U A;  3JSM A;  3PSI A;  4HWI A;  5AQG A;  2WC9 A;  4O0J A;  3AA5 X;  2HF3 A;  1BI4 B;  3EKU A;  3ULE B;  2HHQ A;  4DFJ A;  3PX6 A;  3AVJ A;  4CHP A;  2B6A A;  4CZI A;  1NMN A;  2XHB A;  1A5W A;  5KGX A;  4CHY A;  3VEW A;  3OYI A;  3MCA B;  1H1V A;  5CYM A;  4TSX A;  3RRG A;  3EY1 A;  4HCC A;  4BRF A;  3CCU N;  1RT3 A;  4BGA A;  3F9K A;  3VTI A;  5KQD A;  4DTM A;  1RDW X;  4HHT A;  3TAR A;  2JWK A;  4M3T A;  3CCQ N;  1NGE A;  2NNW A;  3RMA A;  3LDQ A;  1J5O A;  3OS2 A;  1RDA A;  3I8D A;  4HVJ A;  4L3Q A;  1IBM K;  1BIZ A;  3K2P A;  1K8A O;  1U2V A;  4YOV A;  4JKG B;  3CET A;  3LDP A;  5AFU A;  3CC4 N;  4JRP A;  4DLE A;  3MWP A;  3C65 A;  4RCH A;  3M8R A;  3D7E O;  4HUF A;  5HLF A;  3QIO A;  1CXQ A;  4B08 A;  2W41 A;  4KRF A;  4DSE A;  4E7L A;  3VOV A;  2LSN A;  4JKD A;  1HKB A;  4AM7 A;  4B9S A;  1RBR A;  3AVL A;  3CJB A;  3ULE A;  4DV3 K;  1RBS A;  2D5R A;  4IWV A;  4RW6 A;  3JYT A;  4DR1 K;  1FK9 A;  3PV8 A;  5IT9 O;  3G6E N;  3E9P A;  4PY5 A;  5CY4 A;  4JEP A;  1VQ9 N;  2UYT A;  4LF8 K;  3BY5 A;  3OYJ A;  1VQ5 N;  3SQ4 A;  1OVY A;  4KHY A;  4Q0B A;  4FLZ A;  4DSK A;  4X65 K;  4KHS A;  4CEA A;  4Z4G A;  1NM1 A;  3GDQ A;  4Z94 A;  1ASU A;  2VWB A;  3I0S A;  1XNR K;  3EO3 A;  5MLC Q;  4DR5 K;  3J8A A;  5AQF A;  1VRU A;  4I2Q A;  4JI0 K;  2HHV A;  3DLK A;  1RBV A;  3KWI A;  1HPM A;  1HUX A;  1ZBU A;  4B9M A;  5BPM A;  3T69 A;  1IH7 A;  3JXU A;  4JKG A;  4KHP K;  1EET A;  2CGJ A;  1RTH A;  2RKI A;  3C6U A;  1NGC A;  3MAQ A;  5HOO A;  4B1Z A;  4JLH A;  3WQU A;  1JLC A;  1VHX A;  3OY9 A;  3KLF A;  4IZ9 A;  1RTD A;  5J1E A;  2CGL A;  3QIP A;  1U45 A;  3H6E A;  3VGK A;  4BR2 A;  4O44 A;  2A1S A;  4YOW A;  4C8O A;  1J9A A;  3RVC A;  4F4K A;  3WQT A;  1RT6 A;  4PUO A;  5C10 A;  2CGK A;  4KI4 A;  1O1W A;  4IXC A;  5FPM A;  1KVC A;  4H5N A;  3AVC A;  4G9Z A;  4H4M A;  1YIJ N;  3VET A;  3ENH A;  4E1N A;  1KLM A;  5EU7 A;  1HKC A;  3LP1 A;  4W5T A;  3LAK A;  3KVG A;  3MED A;  4M7X A;  3UKR A;  3C95 A;  3T7Z A;  1GOB A;  3CIP A;  4KV8 A;  4KHW A;  4DQ8 A;  4EHT A;  1QQC A;  3RSE B;  4NCA A;  2Q0U A;  3QBW A;  4K8X A;  1CZA N;  2KFN A;  4DQS A;  3DOL A;  3JS6 A;  5BN8 A;  5KPR A;  3OYM A;  3ZT2 A;  3C0B A;  3MXJ A;  3MEC A;  2XRI A;  1RT1 A;  3U3Y A;  3T3F A;  5BPL A;  2VG6 A;  3V1Q A;  3F5T A;  4CF1 A;  4CZM A;  5D3G A;  2HHT A;  4FK2 A;  3CJA A;  3ATU A;  3LM2 A;  2F4V K;  3R6M A;  1QSY A;  4DR4 K;  1VQ7 N;  3VQP A;  2FSK A;  4FM2 A;  3L0Q A;  3CQ8 A;  2ETJ A;  4DR6 K;  5M1O A;  4FM1 A;  3N4Q A;  4FOE A;  2XY6 A;  3KTQ A;  4CBU A;  1REV A;  1GLJ O;  1Z6R A;  3AO1 A;  3BZC A;  4J2A A;  4H0V B;  3CD6 N;  4CJ5 A;  5AQL A;  3KLE A;  1SZ2 A;  1DLO A;  5AQY A;  4BWM A;  1WBB A;  3VF6 A;  1JLE A;  3QBX A;  3EN9 A;  4IFY A;  3ZSR A;  3K5N A;  1M1K O;  5M1Q A;  5I3U A;  1XC9 A;  3K58 A;  2DTU A;  3DXM B;  1FW6 A;  3H45 C;  5AQX A;  3WNF A;  3MEG A;  3MCP A;  3OJU A;  3TR8 A;  3VQD A;  4E7H A;  1K9M O;  3L2U A;  3ZX3 A;  5AFU H;  1BU6 O;  3L3V A;  3CCE N;  1U48 A;  2PYJ A;  4OPK A;  1JL2 A;  2YNH A;  4M7Y A;  3TI0 A;  2KQ2 A;  4E7I A;  2FBV A;  2ZGY A;  3VA0 A;  2YX6 A;  4HUE A;  1J6Z A;  3DRR A;  1HYS A;  1CLQ A;  4YOR A;  4BE1 A;  3BZK A;  3MXI A;  2DPN A;  2HHW A;  3AVM A;  1ITG A;  3AA3 A;  3WNE A;  4GV9 A;  4DQP A;  2VWK A;  4H5T A;  4GV6 A;  4DB3 A;  1VQ6 N;  3ZEU A;  4WCE L;  1LV5 A;  1XNQ K;  3DLB A;  3K5M A;  3FZK A;  3QLH A;  3S3O A;  2P9I B;  5I9E B;  4DV0 K;  3AAQ A;  3SLC A;  1BA0 A;  1EXQ A;  1NGH A;  3VEV A;  2NRZ A;  3AA4 A;  3SI6 A;  4J2D A;  1SL0 A;  3DXM A;  1RGI A;  4E89 A;  2ZJR L;  3LDL A;  3CJ9 A;  4KI6 A;  4CJU A;  1UA1 A;  2OPQ A;  2UXB K;  4BRD A;  1VQP N;  4CBW A;  3CME N;  4AHR A;  2YKN A;  3VEZ A;  4CJL A;  1N8R O;  3ID6 A;  3TWH A;  1QQO A;  1VK0 A;  3TAN A;  4Q5V A;  3K5L A;  2QWM A;  4N5S A;  4I7F A;  2OA8 A;  3VQC A;  4XIU A;  3R9P A;  2NZT A;  1KRP A;  2QWR A;  1C1B A;  4LC9 B;  1L3S A;  1R59 O;  3NVK A;  4FXD A;  2Z1I A;  1YJ9 N;  3CC2 N;  5E26 A;  1KLN A;  4B9U A;  2O8F B;  2HHU A;  4J8F A;  3OBW A;  4C8M A;  3AO2 A;  4CIG A;  1S9G A;  3FZF A;  4DFP A;  4CFD A;  4XH5 A;  5C25 A;  3WNH A;  4N41 A;  1YAG A;  4JD2 A;  1P90 A;  4B9L A;  4BY9 C;  1E4G T;  1HNX K;  2P9N A;  1YJW N;  3I0R A;  2HF4 A;  3KKS A;  3AVB A;  1DT9 A;  5F2R A;  3ZT4 A;  3NGI A;  1D9F A;  4ID5 A;  4QAG A;  4JS5 A;  3THW A;  2P9I A;  5CR4 A;  2YHY A;  4B1X B;  4MDB A;  1WBD A;  4BVP A;  3AGR A;  1ASV A;  3HI0 A;  4FSV A;  4IJN A;  1NGI A;  4CGD A;  1J5E K;  3WXL A;  4X66 K;  3U4L A;  4JI5 K;  1Q82 O;  2WTU A;  2P9S B;  4WFN L;  4M41 A;  3BP8 A;  3HO1 A;  4DCH A;  3P38 A;  2P9L A;  1NGB A;  1ATR A;  2P9U B;  3WNG A;  5AQT A;  5C2D A;  1MU2 A;  2V52 B;  3HM9 A;  4IOX A;  4LFB K;  4CJE A;  3IFR A;  4WQ5 C;  4CJ3 A;  3LM9 A;  3H3N O;  1EQY A;  1U04 A;  2KHO A;  4QCL A;  1B9F A;  4CZE A;  3OS0 A;  4JKF A;  3U9D A;  1DTQ A;  2QEX N;  5KRT A;  3PX0 A;  4X62 K;  1QS4 A;  2O8F A;  3HOT A;  1GLE G;  4WYB A;  5KGW A;  3O5B A;  2RPI A;  3MN7 A;  4CJK A;  4DTR A;  1K6Y A;  5ADX H;  4H5R A;  4CE9 A;  2Q1N A;  3VQE A;  3SAG A;  3ISN C;  2BUP A;  2FC0 A;  5EXW A;  1T7P A;  1L3U A;  2AJQ A;  1WUA A;  3EKS A;  4BR0 A;  3AVI A;  5BRD A;  3J7A P;  1KCF A;  1YIT N;  5M1K A;  1BIU A;  2ZD1 A;  4EIA A;  5J2N A;  1SQK A;  2JGU A;  4EAH D;  3P83 D;  2IDO A;  4N47 A;  3HPO A;  1Q9X A;  4B1U B;  1VQK N;  4IEI A;  4BG8 A;  4AM6 A;  4HTU A;  4I6M B;  4KAZ A;  4GNI A;  2HBL A;  3KZB A;  3ZET B;  4A61 A;  4DHY A;  3CC7 N;  3CYM A;  3EZW A;  4CF9 A;  1WB9 A;  3I33 A;  3U6F A;  2GTD A;  4FLY A;  2YNG A;  3OYE A;  4E19 A;  1NG9 A;  3O9Q A;  5LMN K;  1NGG A;  2AP1 A;  2ZF5 O;  1GLD G;  1U4B A;  3ZT1 A;  3MEE A;  2HW3 A;  4J2E A;  4AF1 A;  4N76 A;  4IBN A;  2P9U A;  3SMP A;  5GAE P;  3CFO A;  1I94 K;  5KQ8 A;  1D8Y A;  4M63 C;  4CEQ A;  3BF3 A;  3OTO K;  1HYV A;  3F73 A;  3CFP A;  1TV6 A;  3W0L A;  1SKS A;  2BH1 A;  3LP2 A;  3WT0 A;  2ZWH A;  3THV A;  5C24 A;  1BG3 A;  5DM7 L;  5HRS A;  1P8Z A;  2E1Z A;  4MQ3 A;  4B8A B;  4LF7 K;  3L6Q A;  3NAE A;  4B1Y B;  4FZY A;  3J7Z O;  3HVR A;  4FLX A;  1RDC A;  4V19 S;  2HHX A;  4FWP A;  4Z4C A;  3SQ2 A;  5AQH A;  2P51 A;  1XHX A;  1HRH A;  3TAM A;  1C0U A;  1DEJ A;  5AQN A;  5TKW A;  3VQA A;  2E8A A;  4YOT A;  1RDD A;  4UY8 O;  3CJC A;  3KK7 A;  3ID8 A;  2NRX A;  3ULD A;  2BE2 A;  4CFB A;  4HCB A;  3AO3 A;  3VMF B;  5AQK A;  4CJ4 A;  4YHH K;  4CVN E;  3HSC A;  4C8L A;  2IOC A;  3BEX A;  4DUY K;  2PBD A;  4CD3 A;  4GY2 B;  1HNZ K;  3ZET A;  4DV6 K;  3EL2 A;  4FWQ A;  3H1V X;  4M3R A;  3VQB A;  3SV4 A;  4ICL A;  1I39 A;  3L4I A;  2I7N A;  4ELT A;  4KB1 A;  5SWM A;  5KPZ A;  3CCL N;  1JKH A;  1F21 A;  3C7N B;  5AQJ A;  3KD1 E;  1WSH A;  2BGG A;  4CES A;  4A57 A;  1IKV A;  3TAQ A;  4YDU A;  1NK7 A;  1A5X A;  3A5L C;  4PA1 A;  1SL2 A;  2VG5 A;  1LOT B;  4JV5 K;  1XQS C;  5HRO A;  5AQU A;  3G0Z A;  3QDK A;  3ENB A;  2OPP A;  3NGZ A;  4ILH A;  4CGF A;  2E2N A;  1EP4 A;  5EX5 A;  4CJQ A;  1ATN A;  4JAX A;  4IG0 A;  3OYC A;  3QNO A;  1KD1 O;  3DWL A;  2OYQ A;  2DFE A;  3KLH A;  4BDY A;  2Q2R A;  4IFV A;  4ISE A;  3DYA A;  3O8M A;  3VEY A;  4AHS A;  3SJJ A;  3TSQ A;  3NMU A;  3I55 N;  3VGM A;  2W40 A;  4KFB A;  1KVB A;  3QML A;  1NK6 A;  4CHO A;  4ISF A;  3O3G A;  4WQ4 A;  4NLC A;  1IBL K;  2FF6 A;  2P9P B;  4BR4 A;  4IOA L;  2BAN A;  1JJ2 M;  1RDU A;  2QI2 A;  4ZHR A;  1G15 A;  5GIP A;  4DF8 A;  3PIO L;  2HNZ A;  1HJR A;  2O4I A;  4CGH A;  4IDH A;  5AZI B;  4IOC L;  1S1T A;  1LCU A;  4Y0W A;  5FRN A;  1IBK K;  4DS4 A;  3FE1 A;  4EP5 A;  3NCI A;  2O8E B;  1HYZ A;  3M8S A;  4JKE A;  1JXE A;  4BC2 A;  4OX9 K;  2GBZ A;  4DR3 K;  4CJP A;  1XC3 A;  1K8K B;  1TL3 A;  1WSE A;  5AZJ B;  3HOS A;  3NF8 A;  4H4O A;  4BRM A;  3TU5 A;  5KPT A;  3TPQ A;  2HHH K;  2V7Z A;  4KHU A;  1VSK A;  3DOK A;  1RBU A;  1YF5 L;  2QK9 A;  4IKF A;  4CZG A;  3VA3 A;  2A42 A;  1BI4 A;  4CJW A;  3C94 A;  4BWJ A;  4CZH A;  4FYD A;  4JI6 K;  3TAB A;  3TAG A;  4LD0 A;  3B6O A;  1UAX A;  3O3H A;  3ZCM A;  4CJS A;  3RWU A;  1TKX A;  4C1N K;  1BWF O;  4PQU A;  4H5W A;  3FZL A;  5HRN A;  3LWM A;  3ITH A;  1OVQ A;  3NE6 A;  1YHQ N;  3TTC A;  1N5Y A;  4BVO A;  3HPG A;  1SV5 A;  2P9P A;  1JCF A;  3P4I A;  3SUO A;  2HMI A;  3OYK A;  1HQU A;  4DUZ K;  2XY8 A;  2F8T A;  2HBJ A;  3SUP A;  3CF5 L;  3CM6 A;  3WXM B;  1HLU A;  1KAZ A;  4HUG A;  3O9R A;  1TK8 A;  4OKE A;  3PIP L;  4OO1 J;  4MLH A;  4DTP A;  5BRE A;  2G8F A;  2B4J A;  2O8E A;  3HL8 A;  3FLC O;  4KH6 A;  2QWQ A;  3QER A;  5KTQ A;  2JLE A;  3M6G A;  1K8K A;  1OKJ A;  5AZJ A;  5CYQ A;  3ZSO A;  3WXI A;  1Q8I A;  1V4T A;  4KTW A;  2XO7 A;  3C6H A;  1OH5 A;  2YHX A;  3MWT A;  4R79 A;  3V9Z A;  2QA4 N;  3VQ8 A;  4MFB A;  3LZI A;  3MXM A;  3LDO A;  1HKG A;  2FBY A;  4FLV A;  4LFC K;  3K0S A;  2WUS A;  2GEM A;  3H46 O;  4JYA K;  4K8Z A;  2YHW A;  4WQ5 A;  3ZSQ A;  4CZJ A;  1HNW K;  1RNH A;  3ZX2 A;  5JS1 A;  1TKD A;  4YFU A;  4CCH A;  2A6A A;  3VER A;  3K59 A;  1D4X A;  3K5O A;  4FL9 A;  1HPZ A;  4GKK K;  4A59 A;  1HX1 A;  3O9T A;  3A8Y A;  4FO0 A;  4BQL A;  4FJL A;  3U9Z A;  1KAX A;  4XEI A;  3ZSY A;  2BTF A;  1DGK N;  3Q7C A;  3CHW A;  1Z05 A;  1OH8 A;  4OLB A;  5FRO A;  4JK9 A;  3CMA N;  4CIF A;  1E4F T;  3QFP A;  2FSN A;  4C8K A;  4F2S A;  4ISG A;  3PSF A;  3WEE B;  3KKR A;  4CFA A;  1SS6 A;  3D0P A;  1YJN N;  4NYN A;  4E0D A;  3QES A;  2E5L K;  3WXK A;  3VQQ A;  2NLX A;  3VEX A;  2VQE K;  3SAH A;  5LMU K;  2NRH A;  4WE1 A;  1QE1 A;  3VQ6 A;  4CEC A;  3ZSV A;  3HJF A;  1NLV A;  4NLB A;  2G8I A;  4DMN A;  1X9W A;  1KXP A;  3QIC A;  5ADX A;  2YKM A;  2IAJ A;  4CER A;  1OH6 A;  4JI2 K;  5BR8 K;  1C1A A;  2Y1J A;  2HMP A;  2YCH A;  5EOY A;  4KHQ A;  4OKK A;  3SBT A;  4FWM A;  1NJX A;  4FPA A;  1RCH A;  2X6S A;  3AA2 A;  3C6A A;  4M3X A;  4BRN A;  4CK1 A;  4GW6 A;  2EHG A;  4DV4 K;  4KB0 A;  4JI1 K;  1RT2 A;  3RSE A;  4NO7 A;  3LPT A;  1OH7 A;  2QXL A;  1NMD A;  3M5R A;  2E1Y A;  3O08 A;  2HVH A;  4FZZ A;  5FDL A;  3QET A;  3VQ4 A;  1ZC6 A;  2FF3 B;  3OYL A;  3NF9 A;  1W9H A;  4ILG B;  3AVH A;  3RRH A;  3AVK A;  3R1X A;  3DLE A;  5AQZ A;  1LWF A;  3CCV N;  2FXU A;  4GV3 A;  3ZSX A;  1R0A A;  1SKR A;  2BDP A;  2IIR A;  4FW1 A;  4M3Y A;  2QWP A;  1LWC A;  4M3U A;  4ELV A;  1HJO A;  4BR5 A;  5A2Q O;  4DR7 K;  3FZH A;  1Z26 A;  1SAZ A;  5CHI A;  4ELU A;  2R7Y A;  2QW9 A;  2VQF K;  4CFC A;  5HRR A;  1NNE A;  2OTL N;  1JXB A;  1W97 L;  1DKG D;  4JRQ A;  4FW2 A;  3F9M A;  1NGF A;  1VSM A;  2E4L A;  4AHU A;  4FWS A;  2E2P A;  4JKA A;  4FJ8 A;  4KRE A;  1TL1 A;  1CXU A;  1ASW A;  4BG9 A;  4BR7 A;  4BRL A;  5E41 A;  4IEE A;  3T19 A;  5J2M A;  3QFU A;  3T1Y K;  3U3G A;  3IG1 A;  1BO5 O;  2OAN A;  4W5R A;  1TAU A;  3V6D A;  5GIO A;  1N32 K;  3DRS A;  5E84 A;  2O8B B;  1SKW A;  1N33 K;  1NGD A;  1S6Q A;  4CJF A;  3VEO A;  3DXK B;  1QVF M;  4FOI A;  5J2P A;  4A62 A;  2HB5 A;  3V1O A;  4DR2 K;  2HNY A;  1FKO A;  1LW2 A;  2PAV A;  4BRH A;  2P5G A;  4L8R B;  3ZYY X;  4DTN A;  3NF6 A;  3DI6 A;  3CQX A;  4CEO A;  4F2R A;  4FJ9 A;  1MWK A;  1TGO A;  3AAP A;  3GBT A;  3O9S A;  4BE2 A;  2Y1I A;  2ZJQ L;  3OYD A;  5F0X A;  5HP1 A;  4IDK A;  3IMX A;  3IRX A;  4FJ5 A;  2PYL A;  1NK9 A;  3LZJ A;  1T3V A;  4IFE A;  3RMC A;  5BRF A;  2A1R A;  2G8H A;  4MO4 A;  1X9J A;  3THY B;  2D0A A;  4NXN K;  5IWA K;  1C0F A;  5KI6 A;  4RWT A;  3LPU A;  3SPZ A;  1S6P A;  3DRP A;  4YOX A;  5JS2 A;  5AQI A;  2VWJ A;  1TK0 A;  4KPY A;  5BN9 A;  4OLA A;  2RHK A;  4K41 A;  4CD1 A;  4CK3 A;  1HR0 K;  1BGX T;  1XHZ A;  4RTF D;  1XMQ K;  2NUB A;  3CPE A;  4JNE A;  4RW9 A;  4O0I A;  4B9T A;  1YT3 A;  1NJI O;  1S1U A;  3D2F B;  2O8B A;  1KFD A;  2GWK A;  3O1B A;  1W0H A;  1NK5 A;  3DXK A;  1RTI A;  3D2E B;  4EZ6 A;  2D0B A;  1YVN A;  1A5V A;  4A5B A;  5GAG P;  2ITG A;  4Z4E A;  3SCX A;  5LJV A;  3J80 O;  1NKE A;  4FLU A;  4YOY A;  2QWL A;  3L2R A;  2HVI A;  2A5X A;  3D6R A;  2IS3 A;  3E01 A;  5AQO A;  1NBW A;  4MO5 A;  3UIQ A;  4DU4 A;  4QOZ B;  1LAW A;  1GLL O;  4JHD B;  3KLG A;  5AQW A;  3L2W A;  1VSI A;  2D1K A;  4CHZ A;  2V7Y A;  5AQP A;  3RR7 A;  2VG7 A;  3HTV A;  3FFI A;  2B5J A;  1O13 A;  2I7P A;  1QHT A;  1Q18 A;  4DV2 K;  4M3W A;  5JVH L;  3THY A;  1YUW A;  1NGJ A;  3GE1 A;  2E88 A;  3VGL A;  4AQY K;  4PKG A;  3SQ0 A;  2YNF A;  1RT7 A;  4F9O A;  1J53 A;  3ZX0 A;  3WXJ A;  3CER A;  3VF4 A;  4EHU A;  1TYQ B;  1VQ4 N;  3AVF A;  2YJF A;  4MLE A;  1MA9 B;  4B3T K;  3HP9 A;  3EEQ A;  4CJR A;  3QEP A;  1ESV A;  3NH1 A;  3V4I A;  4E1J A;  2YHA A;  3THX B;  3K9J A;  2A3Z A;  4Y1D A;  4A5A A;  5AQM A;  1VSE A;  4U67 L;  2VGM A;  2UU9 K;  2P9S A;  3L8B A;  3UB5 A;  2HBK A;  3VEN A;  5H1S Q;  3D2F A;  1S1W A;  4CF8 A;  5LY3 A;  3MN6 A;  3NDK A;  5AQS A;  3QO9 A;  3O6W A;  4U7B A;  3D2E A;  1TVR A;  4RW7 A;  4B3R K;  1NKB A;  2Q3S A;  3FZM A;  1TKZ A;  4PL8 A;  4B3M K;  4YOU A;  4CHQ A;  4JI4 K;  4DQQ A;  2OZM A;  4EZ9 A;  4JK8 A;  4KO0 A;  4EP4 A;  2HND A;  4KH4 A;  4W5N A;  1Y97 A;  4OKJ A;  1BOT O;  3SK3 A;  2IGI A;  2QKB A;  2Q36 A;  1C0M A;  3QEI A;  5FPE A;  3CCS N;  4BGB A;  5FPN A;  1KSP A;  3H08 A;  4JKC A;  4GVE A;  2O8C B;  5HRP A;  4DTU A;  4NXM K;  2KW4 A;  2QM1 A;  2UXD K;  1BCO A;  5FRM A;  3G71 N;  2GV9 A;  1HNV A;  3OYH A;  3HP6 A;  1NJY A;  3VPZ A;  1W7A A;  1IG8 A;  1GLB G;  1X3M A;  3AV9 A;  4I9L A;  3J81 O;  4I6M A;  4OPH A;  4B9N A;  2Q97 A;  4E3S A;  3THX A;  1N36 K;  1U6Z A;  3OS1 A;  3MN5 A;  3CCR N;  4DV5 K;  1VQL N;  1IJJ A;  4W5Q A;  2UUB K;  3ZSW A;  2GEL A;  5GAD P;  1VSD A;  1NU0 A;  4ZTJ A;  4C8N A;  5FLX O;  1K73 O;  3OA9 A;  3M8P A;  4FZX C;  1KFS A;  4YY3 K;  2QWN A;  1KQS M;  3A2F A;  1VAZ A;  1HNI A;  3O4N A;  4DTO A;  1BUP A;  4OVL A;  1NJW A;  5C15 A;  4FK4 A;  4JKH A;  4IG3 A;  4FJN A;  1BDG A;  1IKY A;  4CEB A;  1JCE A;  3OHR A;  3BF1 A;  4GVM A;  4LH4 A;  1VQM N;  3TSP A;  4FJI A;  2O8C A;  4I2P A;  4H0X B;  4LY7 A;  1VSJ A;  4FJH A;  4CEF A;  2KLA A;  4RW8 A;  3DJC A;  4AHV A;  4PWD A;  2GUI A;  3PUF A;  2GX9 A;  1QTM A;  4DQR A;  4PHT X;  2OPS A;  4AHT A;  4FJG A;  2ASO A;  4H5V A;  4BRC A;  3O1W A;  1BQN A;  3OYG A;  3WUH A;  2FBT A;  1NKC A;  4CJT A;  1IG9 A;  1IKX A;  1JL1 A;  1GOA A;  1VSH A;  4FWK A;  3V9S A;  1KVA A;  1WAJ A;  5I42 A;  4JK7 A;  3OBY A;  3KLI A;  4PKH A;  2QXF A;  1U47 A;  4OPJ A;  1GLC G;  3KK2 A;  4BRA A;  4BC4 A;  1JLQ A;  3VQ5 A;  2QWO A;  4CEE A;  3HM8 A;  3J7Y P;  2VYP A;  3S41 A;  4CBX A;  3BGR A;  1TK5 A;  4FWL A;  1C1C A;  3C7N A;  1KC8 O;  3H3O B;  5HL7 L;  3PX4 A;  1IO2 A;  1B9D A;  3HYF A;  4G1Q A;  5LJW A;  5DK5 A;  3CG7 A;  1Q86 O;  4IJA A;  1J54 A;  3V1R A;  2XY7 A;  1NOY A;  2IVN A;  1ZXO A;  4XH1 A;  3VTH A;  5M1N A;  3LAN A;  4AHC A;  1RT4 A;  1X1P A;  1C0T A;  4LF5 K;  3V9U A;  3ZLJ A;  1IKW A;  3PY8 A;  4LH5 A;  4WFB L;  3UE5 A;  5KRS A;  1X3N A;  4BRO A;  4B9V A;  1YTU A;  3AGK A;  4DSI A;  2A41 A;  1Q7Y O;  5J2Q A;  3CM5 A;  4H0Y B;  2W42 A;  1JLF A;  1EKE A;  2ITM A;  2G8W A;  3EZ5 A;  1ATS A;  2IC3 A;  4E1M A;  2UUC K;  2QKK A;  4B8C A;  2KKZ A;  3DLG A;  5AZI A;  2ZQB A;  3UKR B;  2CH5 A;  3F2K A;  1JLB A;  4KBO A;  2NRT A;  1GLF O;  3Q7B A;  3RTV A;  4ZTF A;  5B8H A;  2P1J A;  4DF4 A;  3E66 A;  2E6M A;  2IVP A;  3HT3 A;  1SUQ A;  4JI8 K;  3I8B A;  3LDS A;  3B6P A;  3L3U A;  2YHB A;  3TTD A;  3DM2 A;  3L4Q A;  1ZBH A;  4DLG A;  1D5A A;  1L3V A;  4FJX A;  4H0P A;  3R3L A;  2J4R A;  1M90 O;  3T1A A;  3VN5 A;  4CJ7 A;  4BRP A;  3HST B;  1S3X A;  1VSL A;  2IVO A;  3R8E A;  3MX2 A;  4AH9 A;  3D45 A;  1EWQ A;  3E9L A;  3KK1 A;  3TSU A;  1RBT A;  4X64 K;  4FLW A;  4JI3 K;  1KTQ A;  3NGY A;  1W2B M;  4ID1 A;  1ZBI A;  3PO4 A;  1ZBS A;  1WOQ A;  3GG4 A;  3O4Q A;  3SYZ A;  1RT5 A;  4OJR A;  5BR9 A;  3LAM A;  4DFK A;  1RFQ A;  4Z4H A;  4FJJ A;  4B1W B;  1DTT A;  2P5O A;  5EY4 A;  4DTS A;  4F3O A;  3CCM N;  3QEV A;  3SV3 A;  3C6T A;  1NK4 A;  3NF7 A;  3K9K A;  1TKT A;  3VQ7 A;  4CIE A;  4CZL A;  4KTQ A;  2YV0 X;  3HBT A;  1S22 A;  3CJ7 A;  2E20 A;  3IAY A;  4K25 A;  1CZB A;  1NWK A;  4BR9 A;  3SNN A;  4DWI A;  3N4P A;  3P31 A;  4FLT A;  1FKP A;  4CK2 A;  1VQN N;  4M45 A;  4JKB A;  3HRG A;  1LWE A;  4NCB A;  5CE3 A;  1VSF A;  1S9E A;  2W6L A;  4FWO A;  4DFM A;  5C0Y A;  3NH2 A;  3AO5 A;  3TAP A;  4BQZ A;  1KAY A;  4CF2 A;  1QSL A;  5AR0 A;  4LFA K;  1RTJ A;  3UKU B;  1S1X A;  1RIL A;  4CZF A;  2X6N A;  4OPA A;  4QS8 A;  1Y64 A;  5AJ3 K;  2WFB A;  2D4W A;  3SZ2 A;  2E6L A;  1WSF A;  3QNN A;  4Z0U A;  3VQ9 A;  4CHN A;  4O5F A;  3LWL A;  4B3O A;  4O8K A;  3LP3 A;  2DY4 A;  3RMB A;  4DG1 A;  1N6Q A;  3TAE A;  2O8D B;  2E2O A;  1YTA A;  3AVA A;  2Z1G A;  5AQR A;  4DV1 K;  2UUA K;  2GUP A;  3OYA A;  3K57 A;  4LF6 K;  1GOC A;  3M3Z A;  5C12 A;  3V9W A;  3V9X A;  1ILY A;  5SZT A;  1WN7 A;  3P39 A;  3MMV A;  1QQN A;  1V4S A;  4RW4 A;  3MDQ A;  1VRT A;  4A2A A;  1HQE A;  3ZEU B;  3QB0 A;  2WBN A;  1XUP O;  3V81 A;  4FVU A;  4NYF A;  3O80 A;  1NOZ A;  3KIO A;  1BHL A;  4BE0 A;  4B3S K;  3WEE A;  3KHY A;  4F3T A;  3CI5 A;  1E3M A;  3SUQ A;  4XH4 A;  3AVG A;  4KTZ A;  4R5P A;  1YXQ A;  4B1V A;  4BC5 A;  3E1Y A;  3M8Q A;  2RF2 A;  5EVZ A;  4CED A;  3SBG A;  4YDU C;  3L2Q A;  3ATV A;  4KHN A;  3FGU A;  2YNI A;  5T7B A;  1CZ9 A;  3A5M C;  3RMD A;  5F1X A;  4F8R A;  4BDP A;  3UKU A;  4E7K A;  4LSN A;  4FCY A;  1QQM A;  2F9W A;  3IKM A;  3O9U A;  1WLJ A;  3P1G A;  3G4S N;  1ZBL A;  1MDU B;  5HBM A;  1GLA G;  3TTF A;  1BQM A;  4NB4 A;  2D0C A;  1SL1 A;  3OW2 M;  1D9D A;  2G8K A;  3SQ1 A;  2F96 A;  3A5N C;  2O8D A;  3VES A;  4EFH A;  4WQ4 C;  2X74 A;  4BAC A;  1FJG K;  4JN4 A;  4BRG A;  3LL3 A;  1TAQ A;  2ZM6 K;  2PY5 A;  2P9K B;  1C0G A;  5DM6 L;  1QHA A;  4NCG A;  4CJV A;  3DLH A;  3ASM A;  2HST A;  2DFH A;  5JLH A;  4JD2 B;  2EWS A;  4CGJ A;  4DU3 A;  2I5J A;  4DS5 A;  4FJM A;  2P9N B;  3PLA A;  3L2V A;  3KK3 A;  4DV7 K;  4LSL A;  3THW B;  4BDZ A;  5BRH A;  2YI1 A;  1BA1 A;  1EO1 A;  1QVG M;  1T03 A;  1NK8 A;  1TUU A;  1JLG A;  3CXC M;  2G8V A;  3AO4 A;  5CZ1 A;  4CEZ A;  1YI2 N;  1VQO N;  1T05 A;  1BL3 A;  2KZZ A;  3DLR A;  4JS4 A;  3OYN A;  3HK2 A;  1ZYQ A;  2ZE2 A;  3FR0 A;  4Z4I A;  4OGC A;  3A0I X;  2P9L B;  3KJV A;  2UXC K;  1Q9Y A;  2XY5 A;  1IV0 A;  4CI6 A;  3CCJ N;  4O5B A;  5JLF A;  2Q31 A;  3O3F A;  4O55 A;  2HOE A;  3EYZ A;  3SPY A;  5ELZ A;  3IS9 A;  5GAH P;  2FBX A;  3QEX A;  5M1P A;  3DLL L;  1QSS A;  3ENO A;  2G8U A;  2PZS A;  1C6V A;  2NRW A;  3HPH A;  1T6C A;  1MWM A;  1X9M A;  2QTD A;  4RG8 A;  1NK0 A;  2Q0R A;  2CH6 A;  3ZT3 A;  3MK6 A;  4FWN A;  2HHS A;  4K43 A;  3FFK B;  4QS9 A;  2P9K A;  3HVT A;  2KTQ A;  4FJ7 A;  4M42 A;  3O4W A;  3S3M A;  1EX4 A;  1HMV A;  4CF0 A;  4C23 A;  1T8E A;  3HXM A;  2H3G X;  2ASM A;  1FXX A;  1WSJ A;  2GWJ A;  4OGE A;  4KKO A;  3T1H K;  1UA0 A;  4O4G A;  3OVN A;  4Z4F A;  4MDA A;  3M1F A;  1JLA A;  3AVN A;  2ASP A;  4FWR A;  3LAL A;  1LW0 A;  4B9Q A;  3B8A X;  3SJH A;  1XI1 A;  5GIN A;  4JI7 K;  3IUC A;  2RE2 A;  2VGN A;  5AQQ A;  4CZK A;  4GKJ K;  2OTJ N;  2AA4 A;  4CGI A;  1WSG A;  2OCE A;  4FJK A;  3MN9 A;  2D0O A;  1QZ5 A;  1S5J A;  2ATQ A;  3ALY A;  4H0T B;  4W5O A;  1B92 A;  3S9H A;  1U49 A;  2JWL A;  4YNQ A;  4FVM A;  4DSJ A;  5TKY A;  4A2B A;  1LAV A;  4WF9 L;  3HZ6 A;  2X78 A;  4FPB A;  1X9S A;  1S1V A;  1Z25 A;  3IDH A;  4J2B A;  5JMV A;  1I3A A;  4DQI A;  4DSF A;  2Z1J A;  1BIS A;  2ZJP L;  3GOI A;  3LDN A;  2E2Q A;  4C1N I;  2EX3 A;  1L3T A;  3MX5 A;  3SUN A;  3A5O C;  4KH5 A;  1T44 A;  1RDB A;  2O4G A;  2DFF A;  3NVM A;  1G99 A;  3EE8 A;  1VQ8 N;  4HTL A;  1XMO K;  1WAF A;  2FLO A;  4DTX A;  3LP0 A;  2W6K A;  3SAF A;  3NH0 A;  1ZBF A;  3QEW A;  3U8X A;  3VF2 A;  4LF4 K;  3BUZ B;  2V51 B;  5JIC A;  3SMS A;  2HBM A;  5M1F A;  4FK0 A;  5JVG L;  4I9Q A;  1YVU A;  5AQV A;  4BRI A;  3OYF A;  5FPD A;  2OPR A;  3DAW A;  5CZ2 A;  3I56 N;  4JHD A;  1BCM A; 
#chains in the Genus database with same CATH homology
 1NOY A;  1KRP A;  1C1B A;  3NBP A;  1L3S A;  3LAN A;  4AHC A;  4DMN A;  1X9W A;  2G8I A;  1RT4 A;  4FXD A;  1X1P A;  1C0T A;  2KZM A;  2Z1I A;  2YKM A;  2RN2 A;  2IAJ A;  4UQG A;  4CER A;  1KLN A;  4B9U A;  3V9U A;  1IKW A;  3TAF A;  3PY8 A;  5C42 A;  2HHU A;  4GMJ B;  4LH5 A;  1C1A A;  2Z1H A;  4C8M A;  3ZT0 A;  3PO5 A;  3ZSZ A;  2Y1J A;  5KRS A;  3AO2 A;  4CIG A;  4B9V A;  1S9G A;  4DFP A;  4CFD A;  1YTU A;  4KHQ A;  4OKK A;  3G10 A;  4Y1C A;  4DSI A;  1WNS A;  5J2Q A;  5C25 A;  3WNH A;  1NJX A;  4N41 A;  2BGG A;  3CM5 A;  1RCH A;  4CGG A;  4B9L A;  4E7J A;  1UOC A;  2X6S A;  2W42 A;  1JLF A;  1EKE A;  3AA2 A;  3I0R A;  4M3X A;  3KKS A;  3AVB A;  3ZT4 A;  4CK1 A;  4AIL C;  3NGI A;  4GW6 A;  1D9F A;  4ID5 A;  2EHG A;  3P5J A;  4QAG A;  4JS5 A;  2G8W A;  3EZ5 A;  1UWB A;  4KB0 A;  2F8S A;  3OJS A;  1RT2 A;  1XWL A;  2IC3 A;  4E1M A;  2QKK A;  4B8C A;  3LPT A;  4M3Z A;  3DLG A;  1ASV A;  2ZQB A;  3NHG A;  3DMJ A;  2HVH A;  3KD5 E;  1JLB A;  4FZZ A;  5FDL A;  4CGD A;  3QET A;  3RTV A;  3VQ4 A;  4ZTF A;  3QIN A;  3OYL A;  3NF9 A;  1W9H A;  2P1J A;  2WON A;  4DF4 A;  4DSL A;  1WSI A;  2E6M A;  4M41 A;  3AVH A;  3RRH A;  3AVK A;  4H8K A;  3HO1 A;  3DLE A;  5DMR A;  1SUQ A;  1LWF A;  3HT3 A;  3LDS A;  3B6P A;  3WNG A;  3L3U A;  2YHB A;  3OYB A;  3DM2 A;  4DTJ A;  1MU2 A;  3HM9 A;  1NJZ A;  1ZBH A;  3ZSX A;  4DLG A;  4CJE A;  1R0A A;  1D5A A;  4CJ3 A;  4FM0 A;  4N56 A;  3CFR A;  1L3V A;  4FJX A;  3S3N A;  1SKR A;  3BDP A;  2BDP A;  4FW1 A;  1U04 A;  4QCL A;  4M3Y A;  3NFA A;  3T1A A;  3VN5 A;  2KFZ A;  3HST B;  1LWC A;  3RR8 A;  4M3U A;  1B9F A;  3OS0 A;  1VSL A;  5K14 A;  4ELV A;  2WOM A;  4AH9 A;  3D45 A;  1DTQ A;  3KK1 A;  1RBT A;  1Z26 A;  5KRT A;  4FLW A;  3PX0 A;  4DU1 A;  1KTQ A;  4ELU A;  2R7Y A;  1L5U A;  3JSM A;  3NGY A;  1QS4 A;  4ID1 A;  5HRR A;  4CFC A;  1ZBI A;  5KGW A;  1JXB A;  2RPI A;  3PO4 A;  4O0J A;  4CJK A;  3AA5 X;  4DTR A;  1K6Y A;  1BI4 B;  4JRQ A;  3O4Q A;  3SYZ A;  4FW2 A;  4CE9 A;  1RT5 A;  4OJR A;  3VQE A;  3LAM A;  4DFJ A;  2HHQ A;  3PX6 A;  3AVJ A;  4CHP A;  2B6A A;  3ISN C;  2XHB A;  4DFK A;  1A5W A;  1VSM A;  5KGX A;  4Z4H A;  2E4L A;  4CHY A;  3OYI A;  4AHU A;  4FJJ A;  4FJ8 A;  2FC0 A;  5CYM A;  1DTT A;  4TSX A;  3RRG A;  4KRE A;  3EY1 A;  2P5O A;  4DTS A;  4HCC A;  1TL1 A;  4F3O A;  1T7P A;  1CXU A;  1L3U A;  1ASW A;  2AJQ A;  3QEV A;  3SV3 A;  1RT3 A;  5E41 A;  3AVI A;  3C6T A;  3T19 A;  3NF7 A;  1NK4 A;  1KCF A;  3F9K A;  5J2M A;  1TKT A;  3VQ7 A;  4DTM A;  4CIE A;  2ZD1 A;  1BIU A;  3U3G A;  4KTQ A;  5J2N A;  4HHT A;  3TAR A;  2JGU A;  3IG1 A;  4M3T A;  2YV0 X;  2IDO A;  3P83 D;  4N47 A;  3HPO A;  1Q9X A;  3RMA A;  4W5R A;  1J5O A;  3IAY A;  3OS2 A;  1CZB A;  1RDA A;  3I8D A;  1TAU A;  4HTU A;  3V6D A;  4KAZ A;  4HVJ A;  3SNN A;  4DWI A;  3CYM A;  4CF9 A;  3DRS A;  3U6F A;  4FLY A;  2YNG A;  3OYE A;  1BIZ A;  1SKW A;  4E19 A;  4FLT A;  1S6Q A;  4CJF A;  3K2P A;  1FKP A;  4CK2 A;  5J2P A;  1U4B A;  3ZT1 A;  4M45 A;  1LWE A;  4NCB A;  3MEE A;  4CEC A;  2HB5 A;  4J2E A;  3V1O A;  4N76 A;  2HW3 A;  4IBN A;  1VSF A;  1S9E A;  4DFM A;  2HNY A;  1FKO A;  1LW2 A;  3CFO A;  4L8R B;  2P5G A;  3NH2 A;  4JRP A;  3AO5 A;  4DLE A;  3TAP A;  1D8Y A;  3M8R A;  4CF2 A;  4DTN A;  1QSL A;  3NF6 A;  3DI6 A;  4HUF A;  4CEQ A;  1RTJ A;  3QIO A;  3F73 A;  1CXQ A;  1HYV A;  1S1X A;  4CEO A;  1TV6 A;  3CFP A;  5HLF A;  1RIL A;  4F2R A;  1TGO A;  1SKS A;  2X6N A;  4FJ9 A;  4BE2 A;  2Y1I A;  3LP2 A;  3OYD A;  3SZ2 A;  3THV A;  2E6L A;  1WSF A;  3QNN A;  5C24 A;  4IDK A;  5HP1 A;  4B08 A;  4Z0U A;  4KRF A;  3IRX A;  4DSE A;  3VQ9 A;  4CHN A;  5HRS A;  4E7L A;  3LWL A;  4FJ5 A;  2PYL A;  4B3O A;  2LSN A;  1NK9 A;  3LP3 A;  4MQ3 A;  2DY4 A;  3RMB A;  4B8A B;  3LZJ A;  4DG1 A;  3NAE A;  1N6Q A;  3TAE A;  3RMC A;  4FZY A;  3HVR A;  4FLX A;  1YTA A;  1RDC A;  2Z1G A;  3AVA A;  2A1R A;  2G8H A;  2HHX A;  4B9S A;  1RBR A;  3AVL A;  4Z4C A;  1RBS A;  2D5R A;  3SQ2 A;  2D0A A;  4RW6 A;  3JYT A;  1FK9 A;  3PV8 A;  5KI6 A;  2P51 A;  3OYA A;  1XHX A;  3K57 A;  1GOC A;  1HRH A;  3TAM A;  3LPU A;  1C0U A;  3V9W A;  3V9X A;  1S6P A;  3DRP A;  5SZT A;  3SPZ A;  1WN7 A;  5CY4 A;  3VQA A;  2OA8 A;  4PY5 A;  4RW4 A;  1RDD A;  3OYJ A;  5JS2 A;  1VRT A;  2VWJ A;  1TK0 A;  1HQE A;  3SQ4 A;  3V81 A;  4KPY A;  3ULD A;  2BE2 A;  4NYF A;  4CFB A;  4FLZ A;  1NOZ A;  3AO3 A;  4DSK A;  4HCB A;  4KHY A;  4OLA A;  4CJ4 A;  4KHS A;  4CEA A;  3KIO A;  4Z4G A;  1BHL A;  4BE0 A;  4C8L A;  2IOC A;  4CK3 A;  1BGX T;  1XHZ A;  4F3T A;  3SUQ A;  3AVG A;  4KTZ A;  1ASU A;  4R5P A;  2NUB A;  4RW9 A;  4O0I A;  3I0S A;  4B9T A;  1YT3 A;  3M8Q A;  2RF2 A;  1S1U A;  4M3R A;  3VQB A;  3SV4 A;  1KFD A;  1VRU A;  4I2Q A;  4ICL A;  4CED A;  1I39 A;  3L2Q A;  1NK5 A;  1W0H A;  4KHN A;  2HHV A;  4ELT A;  3DLK A;  1RTI A;  1RBV A;  1ZBU A;  4B9M A;  4KB1 A;  5SWM A;  4EZ6 A;  2YNI A;  1IH7 A;  2D0B A;  5T7B A;  1A5V A;  1JKH A;  1F21 A;  1EET A;  1CZ9 A;  2ITG A;  1WSH A;  3KD1 E;  4Z4E A;  3C6U A;  1RTH A;  2RKI A;  1IKV A;  4CES A;  4FLU A;  3SCX A;  3MAQ A;  1NKE A;  3TAQ A;  3RMD A;  1NK7 A;  1A5X A;  3L2R A;  4F8R A;  4JLH A;  2HVI A;  1JLC A;  4BDP A;  2IS3 A;  4PA1 A;  3E01 A;  1SL2 A;  2VG5 A;  4E7K A;  3OY9 A;  3KLF A;  3UIQ A;  4LSN A;  4FCY A;  4DU4 A;  4QOZ B;  1RTD A;  1LAW A;  5J1E A;  5HRO A;  3G0Z A;  3QIP A;  1U45 A;  1WLJ A;  2OPP A;  3NGZ A;  3KLG A;  3P1G A;  3L2W A;  4CGF A;  4O44 A;  2A1S A;  1ZBL A;  1VSI A;  4C8O A;  4CHZ A;  5HBM A;  1EP4 A;  1BQM A;  4CJQ A;  3RR7 A;  2D0C A;  2VG7 A;  4IG0 A;  1J9A A;  3FFI A;  2B5J A;  3OYC A;  1SL1 A;  3QNO A;  1D9D A;  2G8K A;  4F4K A;  3SQ1 A;  2F96 A;  2OYQ A;  2DFE A;  3KLH A;  1RT6 A;  2X74 A;  1QHT A;  4BAC A;  4BDY A;  4PUO A;  4IFV A;  4M3W A;  3DYA A;  4AHS A;  4KI4 A;  1O1W A;  1TAQ A;  3SJJ A;  2PY5 A;  1KVC A;  3AVC A;  3SQ0 A;  2YNF A;  4H4M A;  4NCG A;  1RT7 A;  4KFB A;  4CJV A;  1J53 A;  1KVB A;  4E1N A;  1NK6 A;  3DLH A;  1KLM A;  3ASM A;  5EU7 A;  2DFH A;  3LP1 A;  4CHO A;  4W5T A;  3LAK A;  3O3G A;  3AVF A;  4CGJ A;  4DU3 A;  2I5J A;  3HP9 A;  3MED A;  4CJR A;  4DS5 A;  3C95 A;  3QEP A;  4FJM A;  3NH1 A;  2BAN A;  3L2V A;  1GOB A;  3V4I A;  3KK3 A;  4KV8 A;  4LSL A;  4KHW A;  2YHA A;  4ZHR A;  1G15 A;  4Y1D A;  4BDZ A;  1QQC A;  4DF8 A;  4NCA A;  1VSE A;  2HNZ A;  1HJR A;  4K8X A;  3L8B A;  2O4I A;  4CGH A;  1S1T A;  1T03 A;  4DQS A;  2KFN A;  1NK8 A;  3DOL A;  1S1W A;  5FRN A;  1JLG A;  4CF8 A;  2G8V A;  3AO4 A;  5CZ1 A;  4DS4 A;  4CEZ A;  4EP5 A;  3QO9 A;  3NDK A;  3OYM A;  3NCI A;  3ZT2 A;  1HYZ A;  3M8S A;  3MXJ A;  3MEC A;  2XRI A;  1JXE A;  1RT1 A;  1TVR A;  4RW7 A;  2GBZ A;  1T05 A;  1BL3 A;  3T3F A;  4CJP A;  3U3Y A;  2KZZ A;  3DLR A;  2VG6 A;  2Q3S A;  4JS4 A;  1NKB A;  3OYN A;  3HK2 A;  1TL3 A;  1WSE A;  2ZE2 A;  3V1Q A;  4CF1 A;  1ZYQ A;  4OGC A;  5D3G A;  4Z4I A;  1TKZ A;  2HHT A;  3KJV A;  3NF8 A;  4H4O A;  4FK2 A;  4CHQ A;  1Q9Y A;  4DQQ A;  2OZM A;  2XY5 A;  4EZ9 A;  4O5B A;  4KO0 A;  3O3F A;  4KHU A;  4O55 A;  1VSK A;  3DOK A;  4EP4 A;  3EYZ A;  1RBU A;  2HND A;  3SPY A;  3HJF A;  2QK9 A;  4W5N A;  1QSY A;  4IKF A;  1Y97 A;  4Q0B A;  4OKJ A;  3VA3 A;  3IS9 A;  3VQP A;  2FBX A;  3QEX A;  2IGI A;  1QSS A;  1BI4 A;  4CJW A;  4FM2 A;  2G8U A;  3CQ8 A;  3C94 A;  2PZS A;  1C6V A;  2ETJ A;  1C0M A;  3HPH A;  4BWJ A;  3QEI A;  1X9M A;  2QKB A;  4FYD A;  4RG8 A;  3TAG A;  3TAB A;  1NK0 A;  4LD0 A;  4FM1 A;  3B6O A;  3H08 A;  2XY6 A;  1KSP A;  1UAX A;  3O3H A;  3KTQ A;  1REV A;  3ZT3 A;  5HRP A;  4DTU A;  3AO1 A;  4J2A A;  2KW4 A;  3ZCM A;  2HHS A;  4CJ5 A;  4CJS A;  3KLE A;  3RWU A;  1TKX A;  1DLO A;  4BWM A;  3HVT A;  2KTQ A;  1BCO A;  4FJ7 A;  5FRM A;  4PQU A;  4M42 A;  2GV9 A;  1HNV A;  3S3M A;  1EX4 A;  1JLE A;  1HMV A;  4CF0 A;  5HRN A;  3OYH A;  3ITH A;  3LWM A;  3NE6 A;  3HP6 A;  1NJY A;  1T8E A;  3HXM A;  1N5Y A;  4IFY A;  1FXX A;  3HPG A;  3ZSR A;  1WSJ A;  3K5N A;  1SV5 A;  3AV9 A;  4KKO A;  4I9L A;  4OGE A;  4O4G A;  3OVN A;  3SUO A;  5I3U A;  1UA0 A;  1XC9 A;  1JLA A;  2HMI A;  3AVN A;  4Z4F A;  3OYK A;  4B9N A;  1HQU A;  3K58 A;  4E3S A;  2DTU A;  2XY8 A;  2F8T A;  3OS1 A;  3LAL A;  4XIU A;  1LW0 A;  3SUP A;  3CM6 A;  4HUG A;  1XI1 A;  1TK8 A;  4OKE A;  4W5Q A;  3WNF A;  3MEG A;  3ZSW A;  4DTP A;  3OJU A;  2G8F A;  3TR8 A;  2B4J A;  3VQD A;  1VSD A;  3HL8 A;  4E7H A;  4ZTJ A;  4C8N A;  3L2U A;  3QER A;  5KTQ A;  4CGI A;  2JLE A;  1WSG A;  3M8P A;  4FZX C;  4FJK A;  1KFS A;  3L3V A;  5CYQ A;  1U48 A;  3ZSO A;  2PYJ A;  1S5J A;  2ATQ A;  3ALY A;  3S9H A;  4W5O A;  1U49 A;  1B92 A;  4OPK A;  1JL2 A;  1Q8I A;  3A2F A;  2YNH A;  4KTW A;  3TI0 A;  4YNQ A;  2XO7 A;  4FVM A;  4DSJ A;  1HNI A;  2KQ2 A;  3O4N A;  4DTO A;  4E7I A;  4OVL A;  2FBV A;  3V9Z A;  3VA0 A;  4HUE A;  1NJW A;  3VQ8 A;  3DRR A;  1LAV A;  4FK4 A;  2X78 A;  1HYS A;  4MFB A;  3LZI A;  1CLQ A;  3MXM A;  2FBY A;  4FLV A;  1X9S A;  2OZS A;  1S1V A;  1Z25 A;  4IG3 A;  4BE1 A;  4J2B A;  3MXI A;  4FJN A;  1IKY A;  4CEB A;  1I3A A;  4DQI A;  4DSF A;  2HHW A;  4K8Z A;  3AVM A;  3ZSQ A;  1ITG A;  3AA3 A;  3WNE A;  2Z1J A;  4GVM A;  1BIS A;  4LH4 A;  1RNH A;  4FJI A;  1TKD A;  5JS1 A;  4I2P A;  2EX3 A;  2VWK A;  4YFU A;  4DQP A;  4CCH A;  4LY7 A;  1VSJ A;  3K59 A;  4CEF A;  4FJH A;  1L3T A;  3K5O A;  4RW8 A;  1HPZ A;  1LV5 A;  3SUN A;  4AHV A;  4PWD A;  3DLB A;  2GUI A;  3PUF A;  4FJL A;  3K5M A;  3QLH A;  1RDB A;  2O4G A;  3ZSY A;  1QTM A;  2DFF A;  4DQR A;  2OPS A;  4AHT A;  3S3O A;  4FJG A;  4OLB A;  1BQN A;  5FRO A;  1EXQ A;  3OYG A;  1WAF A;  2FBT A;  4CIF A;  3AA4 A;  4CJT A;  1IKX A;  1JL1 A;  4DTX A;  3SI6 A;  1GOA A;  1NKC A;  1IG9 A;  3LP0 A;  1SL0 A;  1VSH A;  4J2D A;  3V9S A;  1KVA A;  1WAJ A;  5I42 A;  4C8K A;  4F2S A;  3NH0 A;  3KLI A;  1ZBF A;  3QEW A;  4E89 A;  2QXF A;  1U47 A;  4OPJ A;  3KKR A;  3KK2 A;  4KI6 A;  1JLQ A;  4CFA A;  4CJU A;  3D0P A;  3VQ5 A;  4CEE A;  1UA1 A;  2OPQ A;  4NYN A;  3BGR A;  4E0D A;  3QES A;  1TK5 A;  1C1C A;  4FK0 A;  4I9Q A;  3PX4 A;  1IO2 A;  4AHR A;  2YKN A;  1B9D A;  3HYF A;  4CJL A;  1YVU A;  4G1Q A;  3VQQ A;  5DK5 A;  3TWH A;  3CG7 A;  3OYF A;  1VK0 A;  3TAN A;  1J54 A;  2OPR A;  4Q5V A;  3V1R A;  3K5L A;  5CZ2 A;  4WE1 A;  1QE1 A;  4N5S A;  1BCM A;  4I7F A;  2XY7 A;  3VQ6 A;  3VQC A;  3ZSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...