3MXJA

Crystal structure of the mtrex1 apoprotein
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
229
structure length
210
Chain Sequence
LPHGHMQTLIFLDLEATGLPSSRPEVTELCLLAVHRRALEPPVPRPPRVVDKLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAALKALEQKSYSLGSIYTRLYWQAPTDSHTAEGDVLTLLSICQWKPQALLQWVDEHARPFSTVKPMYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Crystal Structures of TREX1 3' Exonuclease Autoimmune Disease Mutants
rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Three prime repair exonuclease 1
total genus 71
structure length 210
sequence length 229
chains with identical sequence B
ec nomenclature ec 3.1.11.2: Exodeoxyribonuclease III.
pdb deposition date 2010-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3mxjA01
3QIPA 1N6QA 5D3GA 1QHTA 4I9LA 4C8NA 3QEPA 3RMCA 4CJ5A 4ELUA 4FZZA 3IAYA 1TL1A 1TKXA 4CGHA 1S9EA 3ISNC 2R7YA 1KFDA 2A1RA 1SKWA 1HJRA 4E3SA 3V9XA 3QEWA 1T05A 4M3YA 4N47A 1WAJA 4CJLA 1HPZA 2ITGA 3LAMA 3CQ8A 4FJGA 1RTJA 3DLKA 3RRGA 1JXEA 4CGIA 4DLGA 4E7HA 3S3OA 2LSNA 4KHNA 4QOZB 3OYDA 3NAEA 3VQ8A 4RW4A 3SUQA 3QO9A 4Z0UA 3K5LA 1NOYA 4DTSA 3IG1A 1Z25A 1ZBUA 2Z1JA 4AHSA 2Q3SA 4AHVA 3K57A 1IKXA 1UA0A 1QQCA 3DLHA 2HHUA 4KB1A 4FJNA 3P83D 4FLXA 4CERA 3DLGA 4KI4A 1GOCA 3ZT1A 4FLZA 2G8FA 4CF0A 4HCCA 4PWDA 2D0AA 3S3NA 4CGJA 4Z4FA 3AO4A 4F2SA 4C8OA 3K58A 4O55A 4CHOA 1IH7A 1C6VA 3RTVA 4RW9A 4C8MA 4CFDA 4B9MA 1ZBHA 3ZSVA 3OJSA 4Z4IA 1TK5A 4DSEA 2OYQA 3LANA 1VRUA 4ELVA 3LZIA 4W5OA 1JLBA 1BQNA 3I0SA 4B3OA 3QINA 3TANA 4CK1A 4LSLA 3V1RA 1U49A 3AVNA 3JSMA 3KKSA 1UOCA 5DK5A 3HYFA 3K5NA 2OPQA 4DTOA 1X9WA 1QSSA 1KSPA 4FK2A 3SPYA 3RRHA 4DF8A 2ZQBA 3PX4A 1RDBA 5KGWA 4DFMA 2PY5A 4FJ8A 2YHBA 1WSIA 1BHLA 1NK5A 2RPIA 3SV3A 3NH1A 1CZBA 1RTDA 3OYLA 1VSKA 3ZSOA 4KHUA 1O1WA 2YNIA 4GW6A 2O4GA 3VA3A 3SQ2A 2B5JA 3OYNA 1IKVA 4LH5A 1L3SA 3G10A 4AHTA 3UIQA 2HNYA 3I8DA 2KFZA 3KK1A 3L2QA 4CFBA 2RKIA 3K59A 3OYAA 4FJLA 1HMVA 1CXUA 3ZSXA 1C1BA 5J2MA 4KKOA 2Z1GA 3KTQA 4NCGA 2VWJA 3TAPA 1A5VA 3M8QA 4PA1A 5SZTA 4W5TA 1EKEA 4PY5A 4I7FA 4NCAA 1NJXA 1BCOA 4CIEA 3V9WA 3VN5A 1RILA 3NGIA 1TKDA 3DYAA 1RDCA 2JLEA 4RW7A 3V1QA 4DSLA 4IKFA 2OA8A 3NF6A 1LWEA 4CEOA 5KRSA 1VSIA 3KK2A 3NHGA 4HUGA 3SUOA 4F2RA 3KLFA 3OYJA 4KTZA 3ZT3A 3SPZA 3F73A 4DQQA 3AVHA 4CJRA 3JYTA 2PZSA 4MQ3A 3AO3A 2DFHA 3ITHA 1RDDA 3BGRA 1YTUA 5I42A 1VRTA 4LH4A 3HPOA 4E1NA 2G8VA 3EZ5A 1WSGA 4CK3A 2HVHA 4H4OA 2FBXA 4Z4EA 4W5QA 3QEXA 4ID5A 1JL1A 3NBPA 2KFNA 1DTQA 1JLCA 1UA1A 3AA4A 4M3TA 2HW3A 1IG9A 3VA0A 3RMAA 1C0TA 4DS5A 2B6AA 4NYNA 4DFPA 1KLNA 1U48A 5KI6A 3LAKA 1D9DA 1C1AA 3AA3A 2EHGA 1B9DA 3SYZA 4KHQA 3U6FA 3HK2A 3DLRA 4IFVA 4QCLA 2HHSA 1QS4A 1CLQA 3V4IA 1JXBA 2P1JA 1J9AA 3G0ZA 4E7KA 1JKHA 1JLEA 2IAJA 4CJPA 1DTTA 1RT1A 3KKRA 3RMBA 3OYHA 2HHWA 4AHCA 1WSEA 4CHPA 4ZHRA 1NKBA 3MXMA 1CXQA 2YNFA 2RN2A 1XHXA 3NGZA 4LY7A 3MEDA 4CJVA 4Z4GA 2QKBA 4KO0A 3D45A 4KREA 3KLGA 4CJUA 4DSFA 4B8AB 4ZTJA 3MAQA 3SV4A 4FLTA 3VQEA 2AJQA 1NJWA 4CEFA 3HP6A 3AA5X 3T3FA 5J2NA 1BGXT 4DSJA 4OKJA 3VQPA 3HP9A 4CIGA 2HHVA 3PO5A 3DI6A 5HROA 1IKWA 4DSKA 3HT3A 3HVRA 3O4NA 4BDYA 1KFSA 2D5RA 2G8HA 2GUIA 2PYLA 2HNZA 4M3RA 3HJFA 3NH0A 2BANA 3DOKA 1D8YA 2ZE2A 4CJWA 2VG5A 4BE2A 3V1OA 4HUFA 1EXQA 1IO2A 1Z26A 4LD0A 4DTJA 3S3MA 5HRRA 4N5SA 1L5UA 2D0CA 1S6QA 2YHAA 4Q5VA 4DQRA 2XY5A 5KRTA 1U4BA 1ASVA 3AVJA 3CM6A 3VQAA 1U47A 2GV9A 1RTIA 4CEEA 1D9FA 1DLOA 3SUNA 1LWCA 3NF8A 1Q9XA 1VSJA 3SCXA 4CHYA 3OYFA 4CHQA 3MEEA 5HLFA 4FYDA 1HYZA 3DLBA 4TSXA 1C1CA 3MEGA 3ULDA 4FZYA 4C8LA 4FLUA 2WONA 3K2PA 1JLGA 1RCHA 4FLWA 3PY8A 1HYVA 4CIFA 3VQCA 4DFJA 1QSLA 5HP1A 3ZT0A 4ICLA 3LZJA 4E7IA 3B6PA 2FBYA 3M8SA 3CFOA 4BE1A 3KD5E 1BIZA 4O0IA 4W5NA 1FK9A 3OS0A 1BQMA 1WNSA 5DMRA 4CFAA 5J2QA 3A2FA 3AVLA 3OYMA 1RBUA 1TK0A 1XHZA 4IFYA 4DQSA 1B9FA 2XO7A 2YNGA 2YKMA 3KLEA 3AVKA 3P1GA 3TABA 3WNEA 4AHUA 4DQIA 3TAGA 4DS4A 4FJ5A 3M8PA 3VQ6A 3VQDA 1Y97A 5HRSA 2EX3A 4Q0BA 2Y1IA 4CF2A 3DM2A 4DSIA 4FJXA 1ASUA 3L8BA 5E41A 3OY9A 1A5XA 1R0AA 1QSYA 4E7JA 4KB0A 1NOZA 2OZMA 2X78A 3C94A 3S9HA 3ZSQA 4PUOA 4CEDA 3TAEA 2A1SA 4JS5A 1Q9YA 4BWJA 4RG8A 3OS1A 3QNNA 5I3UA 1RT4A 1HQUA 4KV8A 4N76A 4YFUA 3AVBA 1J54A 1BIUA 3KLIA 1X9MA 1RT6A 4FCYA 2XHBA 3O3GA 5FRMA 3OYCA 2XRIA 1ZBLA 2ATQA 4CEAA 4W5RA 1HNVA 2IOCA 3AVMA 3SQ0A 3T1AA 5J1EA 1Q8IA 4R5PA 3RR8A 1A5WA 4L8RB 2XY8A 3E01A 1VSDA 3LP2A 2HHTA 2E6MA 3B6OA 3F9KA 1X1PA 1BI4A 3SJJA 1F21A 3C6TA 3L2RA 2QK9A 3OS2A 1L3VA 4KI6A 4FXDA 2KQ2A 3HO1A 3TAQA 3DOLA 1W0HA 4CGFA 3QEVA 2DY4A 2JGUA 4HCBA 1NK0A 4CJ4A 4HTUA 1FKOA 4AILC 1LW2A 1I3AA 5CY4A 5HRPA 5T7BA 1GOAA 1JLFA 1LWFA 4IG3A 4FM0A 3THVA 4E0DA 4M3UA 2BGGA 4BE0A 1UWBA 3CYMA 3HL8A 3RWUA 4FJ7A 4WE1A 3VQQA 2HHXA 3KD1E 4DTRA 4FJKA 1C0MA 1S1TA 1VSMA 3DRPA 3LP3A 4CEBA 3QESA 3OVNA 3AO5A 1NJZA 3LWMA 4CJ3A 3PO4A 1KVBA 3OJUA 1VSFA 4JLHA 4JS4A 4CGGA 1ITGA 1EP4A 1WSFA 1IKYA 4M3XA 2ETJA 3AVFA 3KK3A 3TI0A 2KW4A 3TR8A 2HNDA 2WOMA 3MXIA 4AH9A 4HHTA 3VQ7A 4Z4HA 4BDPA 1WAFA 1QE1A 3U3GA 4RW6A 4FJHA 4GMJB 4M3WA 1TGOA 4E1MA 3TWHA 3SI6A 1RT5A 1KRPA 1SL2A 4CJEA 4B9VA 3HSTB 4GVMA 2I5JA 2E6LA 3IRXA 3NFAA 3KIOA 4CGDA 4E19A 1SL1A 4I2QA 4BACA 4BDZA 4J2DA 4NYFA 4CF1A 3HPGA 1VSEA 4CF9A 4XIUA 3LDSA 1WSHA 3DRSA 1T7PA 3QEIA 3KJVA 4DU1A 2P5OA 3EY1A 1HYSA 3P5JA 2RF2A 2KZMA 1LV5A 1BCMA 4E89A 4CCHA 1KLMA 4MFBA 4AHRA 3O3HA 1TVRA 4OLAA 4CE9A 2Z1IA 1NK8A 1WN7A 3ZT4A 4O4GA 4B9TA 2HVIA 5KGXA 3QNOA 3OYKA 3AVIA 1XC9A 3MECA 3V9UA 3RR7A 2KZZA 1C0UA 3CM5A 3QIOA 4EP5A 5EU7A 5CYQA 1YTAA 4KAZA 5JS1A 3ALYA 3L3UA 2XY6A 4CK2A 5CZ2A 1EETA 1SUQA 2PYJA 1TV6A 4CJFA 4IBNA 2F8SA 5JS2A 1VSHA 1S1XA 1SKSA 2YKNA 4DU3A 1S6PA 3VQ5A 1T03A 5FRNA 1TK8A 4CHZA 4FM1A 1I39A 3O4QA 4I2PA 4OPJA 2IC3A 4DLEA 1NKCA 1ZBIA 1RDAA 1N5YA 2HMIA 4I9QA 1G15A 1L3TA 1ZBFA 4IDKA 4DTMA 3BDPA 4IG0A 3HXMA 3V9SA 4FJJA 4FK0A 3AO1A 1LW0A 4K8XA 3KLHA 3SZ2A 5FDLA 3K5MA 2DFFA 3L3VA 3V81A 3ZSWA 3DRRA 2IGIA 1LAVA 4O0JA 5CZ1A 4UQGA 4B9UA 4E7LA 3HVTA 3SUPA 1NK4A 1SKRA 3OYBA 1D5AA 2W42A 4M3ZA 2P5GA 3DMJA 1RTHA 4B9SA 4DU4A 3V9ZA 1NK6A 4B08A 4N56A 2QXFA 1REVA 4RW8A 1RT2A 2FBTA 4CFCA 3CFRA 4DF4A 1MU2A 5HRNA 4KTQA 3WNGA 4CJSA 3M8RA 3L2WA 3TARA 1L3UA 2FC0A 3ZT2A 2G8KA 1KTQA 4CEQA 4CEZA 1YVUA 2VWKA 4B9LA 3T19A 4FVMA 3CG7A 3EYZA 3VQ9A 3NF9A 3O3FA 3MXJA 1TAUA 3AA2A 4M42A 4M45A 3LWLA 1FXXA 2OPRA 4CHNA 1SL0A 4DMNA 1NK7A 3QERA 4F8RA 2GBZA 1TKTA 3AVGA 4JRPA 1T8EA 3H08A 3AVCA 3OYIA 4KPYA 1XWLA 1B92A 3LPUA 3NCIA 4HVJA 4OVLA 4OJRA 4CJQA 4FW1A 1UAXA 3AVAA 4H4MA 4O5BA 4OKEA 1U45A 2VG7A 3C95A 2BDPA 2QKKA 4N41A 1VSLA 4HUEA 1RBSA 2XY7A 5K14A 4OGEA 3LP0A 1HRHA 3HM9A 1S1VA 4F4KA 1K6YA 3I0RA 1NJYA 4FJMA 1QTMA 2E4LA 3U3YA 4H8KA 4OLBA 1ZYQA 2OPPA 3PV8A 4DFKA 1BI4B 3WNFA 4DQPA 4KFBA 2IDOA 2X6NA 2G8IA 2O4IA 3PUFA 4EZ9A 3NGYA 1XI1A 3HPHA 1LAWA 2OPSA 5HBMA 4BWMA 4Z4CA 3SQ4A 4J2EA 2F96A 1RT7A 3WNHA 1NKEA 3ZSZA 1S1UA 2FBVA 3LPTA 5C24A 1HQEA 4O44A 1S9GA 2B4JA 2HB5A 4DG1A 3SNNA 4OPKA 1J5OA 4G1QA 4B8CA 3SQ1A 4FJ9A 2G8UA 1RNHA 5SWMA 3TAFA 4KHWA 4FW2A 3OYEA 2P51A 4CJKA 2X6SA 1BISA 3PX6A 3NF7A 1KVAA 4NCBA 2G8WA 4DTNA 5J2PA 3ZSYA 4FLVA 1NK9A 1CZ9A 1U04A 4ID1A 4CECA 3LP1A 3ZCMA 4CF8A 4DWIA 1S5JA 2HHQA 4FK4A 4F3OA 1JLAA 4CESA 1BL3A 2X74A 4EP4A 1VK0A 3K5OA 5KTQA 2D0BA 2VG6A 3QLHA 3OYGA 3QETA 4JRQA 4B9NA 1GOBA 1WSJA 4QAGA 5C25A 4CJTA 5FROA 3C6UA 4DTUA 4Y1CA 2KTQA 2YV0X 3L2UA 4LSNA 1S1WA 3VQBA 1RBVA 4DTXA 3ASMA 1W9HA 2Y1JA 4DTPA 4FLYA 1EX4A 4J2AA 4K8ZA 4FM2A 4KHYA 1JLQA 3AO2A 1SV5A 1KCFA 4M41A 2IS3A 3D0PA 1X9SA 4J2BA 2BE2A 4OKKA 3IS9A 4FZXC 3FFIA 4Y1DA 4OGCA 2OZSA 2F8TA 3NH2A 2DTUA 1J53A 5CYMA 3CFPA 3L2VA 5C42A 1RT3A 4ELTA 3V6DA 4EZ6A 1RBTA 3DLEA 4YNQA 4F3TA 1KVCA 4KRFA 1YT3A 3AV9A 4PQUA 1WLJA 1HNIA 4KHSA 3LALA 3NDKA 3NE6A 4KTWA 3RMDA 2ZD1A 4C8KA 1TAQA 1TKZA 1TL3A 2YNHA 3TAMA 4ZTFA 2Z1HA 1ASWA 2DFEA 3VQ4A 2NUBA 3ZSRA 1RBRA 1FKPA 4FJIA 3PX0A 1JL2A
chains in the Genus database with same CATH superfamily
5H1SQ 2W6KA 4C8NA 3VGLA 1YJWN 4ELUA 1S9EA 1HPZA 3E1YA 1JXEA 4E7HA 2GELA 2LSNA 4KHNA 1FJGK 4NXMK 3SK3A 4RW4A 3QO9A 1R59O 4Z0UA 3K5LA 4DTSA 3K57A 4AHVA 3O5BA 3BF1A 4FLXA 5AQFA 4HCCA 4A5BA 5B8HA 3K58A 4A2BA 4CHOA 3FZMA 3RTVA 3OA9A 4B9MA 4CFDA 4DR7K 4Z4IA 4DSEA 3B8AX 4AF1A 3I0SA 3QINA 3TANA 4LSLA 4JHDB 4L3QA 4DR3K 3JSMA 2OPQA 4DF8A 3ZX0A 5KGWA 4DFMA 4JYAK 1DT9A 1I94K 3QFUA 2RPIA 1NK5A 3SBTA 3E9LA 1VSKA 2P9UA 1O1WA 4GW6A 3VA3A 3GDQA 3OYNA 4JD2B 3G10A 4FL9A 2P9LA 4WFNL 2HNYA 3KK1A 4X62K 3K59A 4JKCA 1T6CA 4FJLA 3ZSXA 5J2MA 4B3RK 2Z1GA 2VWJA 3M8QA 4PA1A 4CW7B 1NJIO 3SMPA 3VF4A 3DYAA 2JLEA 4BR4A 5TKYA 3NF6A 1VSIA 4H0VB 4F2RA 5E26A 3EL2A 4KH6A 4CJRA 3ENHA 3A5MC 3AO3A 3R1XA 2QW9A 4K42A 2P9UB 4E1NA 3HPOA 2NRWA 2FBXA 1W7AA 1JL1A 1NGJA 2NRRA 2KFNA 1TYQB 1ZXOA 2B6AA 2F9WA 2NNWA 3FFKB 4DFPA 5KI6A 1C1AA 5JVHL 2VGMA 1J9AA 3G0ZA 4WFAL 2IAJA 4H0PA 1DTTA 1RT1A 3KKRA 3ZETB 3OYHA 4AHCA 1NKBA 2YNFA 4B9QA 1XHXA 3J7YP 3R3LA 4CJ7A 3O9QA 2AJQA 3AA5X 4DR4K 4JAXA 1XNQK 3QB0A 3VQPA 3HP9A 3VESA 4BDYA 4BRPA 1KFSA 2HNZA 3ULEB 4M3RA 3SAGA 4GKJK 5AQSA 1Z26A 3S3MA 5HRRA 2D0CA 4DV2K 4PUOA 3TSPA 5KRTA 3CM6A 2CGLA 4CEEA 4JKGB 3SUNA 1LWCA 3NF8A 1VSJA 2O8DB 4H0TB 3SCXA 3J7ZO 3VTIA 3MEEA 1HYZA 3FLCO 2QWMA 2ASMA 4BRMA 4FLUA 2GTDA 3CCVN 1C0GA 4ICLA 3LZJA 1QQOA 1FK9A 1DGKN 3OS0A 1WNSA 4M7XA 4AQYK 3AVLA 3OYMA 4H5TA 3J81O 3C6AA 1XHZA 3FGUA 4IO8A 3WNEA 3A5OC 4K43A 2YHXA 3CCSN 3L6QA 2HSTA 1KAXA 3FZHA 4KB0A 2X78A 3H6EA 3S9HA 1RDUA 4CEDA 3TAEA 2UXCK 5AQYA 1Q9YA 4H5WA 3OS1A 1J54A 1BIUA 1X9MA 1EQYA 3L4IA 5BPNA 5FRMA 3NMUA 1ZBLA 4W5RA 3O9SA 1KQSM 5AQHA 1OKJA 5J1EA 1OH6A 3RR8A 4L8RB 3F9KA 4JKEA 5AFUA 3SJJA 1F21A 3C6TA 2QK9A 3OS2A 4KI6A 2KQ2A 3TAQA 4HCBA 4YDUA 1I3AA 1YIJN 1JLFA 5GINA 4M3UA 1HNWK 1WBDA 3RWUA 3LDNA 3MWPA 4KHPK 3D2FB 4FJKA 3DRPA 1QHAA 4CEBA 1KD1O 3PO4A 1KVBA 5BPLA 4CGGA 1ITGA 1WSFA 5LY3A 1GLEG 4M3XA 4CD1A 1HR0K 3KK3A 1RDWX 2WOMA 4AH9A 1XMQK 4B1UB 3SI6A 2FLOA 2I5JA 4CGDA 3IRXA 4E19A 1SL1A 4BDZA 1VQ6N 4C23A 3T7ZA 3LDSA 1WSHA 4BRNA 3DRSA 2QWNA 1LV5A 4E89A 4MFBA 1TVRA 2KHOA 4CE9A 3RSEB 3ZEUA 4O4GA 1NGHA 3AVIA 3RR7A 1DEJA 4ISFA 5AZIB 5JS1A 4PKGA 2W41A 4WF9L 1EETA 1SUQA 1TV6A 3OTOK 5JS2A 1VSHA 1S1XA 3LL3A 1SKSA 2QEXN 5BR8K 4JKHA 1TK8A 1SZ2A 3P4IA 5AQOA 4BG8A 3W3DA 1NGBA 4IDKA 3V9SA 1LW0A 3SZ2A 2DFFA 5GAEP 3F9MA 4E7LA 3TPQA 2P5GA 4DU4A 4N56A 5BREA 3R6MA 4ISGA 3CCRN 2Q2RA 4KTQA 4GY2B 4X64K 4IOXA 4CEZA 2VWKA 4FVMA 1BWFO 1ZC6A 3VQ9A 3NF9A 3MXJA 5LJVA 4QS7A 1QQMA 2VQEK 4CHNA 5JVGL 4DMNA 1TKTA 3AVGA 2P9IA 1B92A 3LPUA 4FWPA 4H4MA 3C95A 2V52B 4MLEA 1VSLA 4HUEA 4LF5K 3M1FA 2IVOA 2E4LA 3U3YA 1ZYQA 3HSCA 3R8EA 4EZ9A 1XI1A 1GLFO 4BG9A 5HBMA 4O8KA 4B1WB 1S9GA 4FJ9A 4G1QA 1NM1A 2G8UA 3SAFA 4FW2A 4CJKA 3MN5A 1KVAA 4B1VA 1NK9A 1CZ9A 3LP1A 3A5NC 1XQSC 2HHQA 1S5JA 5M1NA 4CESA 1BL3A 3IMXA 4JRQA 5F1XA 3DLLL 4DTUA 5C15A 4YHHK 3L4QA 4JEPA 3VQBA 1YXQA 3ASMA 4DTXA 4C1NK 3KWGA 5KPRA 4DTPA 1EX4A 1NWKA 3QMLA 5BRDA 4M41A 3UKRB 1Q7YO 2QA4N 3IS9A 4Y1DA 5HL7L 4BQLA 2OZSA 3D2EA 2DTUA 1S22A 4JHDA 5CHIA 5C42A 1RT3A 1YAGA 4PKHA 3DLEA 4KRFA 3P39A 4JI8K 4FWRA 1TAQA 4ZTFA 1ASWA 2NUBA 3LM2A 3ZSRA 3G71N 1FKPA 1XMOK 3THYB 1N6QA 5D3GA 4DHYA 3SAHA 3BEXA 4I9LA 2I7PA 3C7NA 2R7YA 1VQON 1KFDA 3HBTA 4H03B 4E3SA 3QEWA 4N47A 1JCGA 3CD6N 2DPNA 3HTVA 1V4TA 3OYDA 3VQ8A 1BA1A 1X9JA 1ZBUA 4AHSA 3P83D 2ZWHA 3DLGA 1GOCA 4FLZA 3S3NA 4Z4FA 3O80A 1C6VA 1ZBHA 3FZKA 4MO5A 3LANA 1J6ZA 4W5OA 1JLBA 1BQNA 4B3OA 5GIOA 5BN9A 3AVNA 3THWA 4CZFA 4QCLA 4DTOA 3HYFA 4IWVA 4CBWA 1QSSA 4LFAK 2DY4A 3SPYA 3ZETA 2ZQBA 3PX4A 2PY5A 2QWPA 1WSIA 3M5RA 3WQTA 1OH7A 3NH1A 3AY9A 1RTDA 3OYLA 3C0BA 4KHUA 2YNIA 2J4RA 2O4GA 4BRLA 3KZBA 4A61A 5BPMA 3UIQA 2KFZA 3OYAA 1Q81O 4BR0A 3DXMB 1C1BA 4KKOA 4Y0WA 1A5VA 5AQUA 1EKEA 4CZLA 1RILA 3O9RA 3SJHA 1RDCA 4RW7A 5A2QO 1LWEA 5KRSA 4HUGA 2E2NA 3KLFA 3IKMA 2ZGZA 3DAWA 3F73A 4MQ3A 1WBBA 3THYA 1KAZA 1IV0A 4LH4A 1E4GT 4CK3A 3FR0A 4W5QA 3QEXA 4LF8K 3NBPA 4FWSA 1DTQA 4B1YB 1UA1A 1K9MO 2Q1NA 4NYNA 1KLNA 3TTCA 4KHQA 2HHSA 1KC8O 4IFVA 1QS4A 3V4IA 4E7KA 2OTLN 4ZHRA 1CXQA 2Q0UA 5M1QA 3NGZA 3MEDA 4Z4GA 4KO0A 3VETA 4KREA 1N32K 3WXLA 3SV4A 1DKGD 3BF3A 4CEFA 3HP6A 3T3FA 3FE1A 4DV1K 4DV7K 4DSJA 1EWQA 4OKJA 4CIGA 3EKUA 5HROA 4DSKA 3MX5A 4K0KK 2VCPA 2OTJN 2BTFA 2GUIA 2GX9A 4BGBA 2G8HA 4PHTX 2BANA 3DOKA 2NRXA 1D8YA 4FSVA 4CJWA 3PLAA 4HUFA 1L5UA 1EXQA 1IO2A 3QFPA 1S6QA 2YHAA 2XY5A 1VQMN 1ASVA 3VEYA 3WQUA 1RTIA 3SMSA 3MDQA 4LFBK 4CHYA 5HLFA 4FYDA 1C1CA 3MEGA 3ULDA 4FLWA 3PY8A 4DFJA 4JI4K 5HP1A 2E8AA 3O8MA 4DB3A 2A3ZA 2FBYA 5M1KA 2V51B 2O8FA 5BR9A 4W5NA 4BREA 5J2QA 2O8CA 2HBMA 2XO7A 2YNGA 3KLEA 3P1GA 3TABA 4JN4A 4NO7A 1VQ7N 2YI1A 4FJ5A 2V7YA 3ID8A 3SLCA 2EX3A 4C1NI 5HRSA 4CI6A 3DM2A 4DSIA 1ASUA 3OY9A 2YHWA 4NB4A 1A5XA 1R0AA 1QSYA 2WTUA 3PIPL 1T44A 3VEWA 3K9KA 5I3UA 4UY8O 1HQUA 1U2VB 2QWRA 3KLIA 3GG4A 4FCYA 1V4SA 1NGIA 2XHBA 2ATQA 3U8XA 2A5XA 1NG9A 4B3MK 1A5WA 1NGCA 2E6MA 1BI4A 3H1QA 4FXDA 3HO1A 5AQGA 1W0HA 4CGFA 3QEVA 1NK0A 4CJ4A 1LW2A 5CY4A 3KHYA 4JI3K 4FM0A 2BGGA 3CYMA 3HL8A 4YOVA 4FJ7A 2HHXA 4DTRA 1S1TA 1VSMA 3O1WA 4BGAA 1NJZA 2W40A 4DR6K 1VSFA 4JLHA 4JS4A 4A59A 1EP4A 2Q97A 3AVFA 3CETA 3TR8A 4EHTA 3N4PA 1QVFM 3CQYA 1WAFA 2UXBK 3U3GA 4GMJB 4M3WA 3VF2A 3LDQA 2KKZA 3I56N 2D0OA 3HSTB 4JD2A 3CXCM 3KIOA 4I2QA 4BACA 4CBUA 4CF1A 4XIUA 1M90O 3EN9A 2Q0RA 1T7PA 1HYSA 1K8KA 4CCHA 2Z1IA 1WN7A 3ZT4A 3THWB 3UE5A 2O8CB 3TU5A 3MECA 3V9UA 4OO1J 5CYQA 3K0SA 4LF7K 2KLAA 3THXA 5E84A 1E3MA 3CC7N 3HZ6A 4IBNA 5AQJA 3CCQN 3WXMB 4FOEA 4FWQA 4DU3A 3VQ5A 1VQ4N 4CHZA 1I39A 2IC3A 1NKCA 4JKAA 4LFCK 1ZBIA 4JK9A 2HMIA 1ZBFA 4ILGB 4DTMA 3BDPA 4IG0A 4FK0A 3S41A 2YJEA 2ZJQL 3AO1A 3L3VA 3ZSWA 3DRRA 4E1JA 4B9UA 3HVTA 3SUPA 1SKRA 3M3ZA 1KAYA 4MDBA 2ZJPL 3DMJA 1RTHA 4BRFA 3G4SN 5IWAK 4CZJA 1MA9B 1REVA 3AGRA 4JNEA 5AFUH 4JK8A 4BRGA 1QZ5A 1FW6A 3TARA 4CEQA 1NU0A 4B9LA 2CH6A 5BRHA 3AA2A 4M45A 3WXKA 4BRIA 3QERA 4HWIA 3OYIA 3N4QA 5AQKA 4OVLA 3AAQA 3EKSA 4FW1A 3AVAA 4DR1K 4BRHA 4OKEA 1U45A 3ZLJA 1RGIA 2XY7A 5K14A 1M1KO 3HM9A 4F4KA 5BN8A 4B1XB 4LF6K 2YCHA 3PV8A 5AQXA 3AAPA 4KFBA 2IDOA 3A8YA 2O4IA 5KQ8A 1HNXK 2E5LK 5LJWA 3ZSZA 3LPTA 4O44A 3SNNA 1J5OA 4OPKA 2HHHK 3LDLA 3TAFA 2QI2A 3P31A 3OYEA 2X6SA 4K41A 4YDUC 4BY9C 3ZSYA 2AP1A 4ID1A 4CECA 2OANA 3TSQA 3ZCMA 4CF8A 4BR5A 1VK0A 2VG6A 3QLHA 3QETA 1YJNN 1GLLO 5JMVA 3C6UA 4Y1CA 3VGKA 5DM6L 5EOYA 1S1WA 3ZX2A 4FM2A 4B3SK 2NRZA 3AO2A 4DUYK 1X9SA 1JCFA 2FF6A 3FFIA 3IDHA 3L0QA 1Y64A 1J53A 4PKIA 1VQ5N 5FPDA 1MWKA 2NRVA 5JLHA 3V6DA 3P38A 1KVCA 4QS9A 4F3TA 1YT3A 4PQUA 4IJNA 5AZIA 1HNIA 4KHSA 3NE6A 5CR4A 3OW2M 1TKZA 1TL3A 4BROA 2Z1HA 3O4WA 1YJ9N 2P9PA 4FJIA 3H46O 3QIPA 1QHTA 3CC4N 3GE1A 3VEOA 3QEPA 3CJCA 2YHYA 5TKWA 3CCMN 4J8FA 1BOTO 1TL1A 1TKXA 4F8RA 3ISNC 2A1RA 4M3YA 3D6RA 1HJRA 3V9XA 3QBXA 1BO5O 4FJGA 4DQ8A 4JKFA 3DLKA 4FPBA 4IEEA 4WQ5C 4CGIA 3W0LA 3CCEN 4WYBA 2F7TA 4Z94A 1NOYA 2A42A 3IG1A 1Z25A 2Z1JA 3EZWA 3C65A 1OVQA 1QQCA 3DLHA 4KB1A 4FJNA 2BUPA 2A6AA 2G8FA 2D0AA 4WQ5A 1ILYA 5FLXO 4BVOA 3AO4A 1JJ2M 4O55A 3IUCA 1IH7A 4RW9A 4C8MA 2E2PA 3ID6A 3ZSVA 3KK7A 1GLDG 4JI6K 1VRUA 1Z05A 3LZIA 3GOIA 1GLCG 2FSKA 3V1RA 1U49A 4MO4A 3KKSA 1UOCA 5DK5A 3K5NA 4FK2A 1KSPA 3RRHA 1ATRA 3OBWA 4PL7A 2JWKA 2YHBA 1BHLA 5EY4A 2QM1A 3UKUB 2H3GX 3ZSOA 3SQ2A 3DXMA 2B5JA 4LH5A 4LC9B 4IOAL 3L2QA 4CFBA 1HMVA 1CXUA 2YX6A 2UUAK 2HF3A 4NCGA 3TAPA 1WOQA 4BC4A 4LF9K 2ZGYA 1VQ8N 4PY5A 4I7FA 4ISEA 4NCAA 4BQZA 1NJXA 4CIEA 3V9WA 4BRDA 3T1HK 2CGJA 3V1QA 4IKFA 1ESVA 5EXWA 3NHGA 4CZIA 4KTZA 4YORA 3ZYYX 1NMDA 4DQQA 3AVHA 2P9LB 3JYTA 2PZSA 1RDDA 3BGRA 1YTUA 1VRTA 1IG8A 3UKUA 2G8VA 3EZ5A 1WSGA 2HVHA 4OX9K 5M1OA 2HBJA 3AA4A 4M3TA 1JCEA 2HW3A 3BP8A 3RMAA 2A41A 1C0TA 3TTDA 4DS5A 3U9ZA 3O1BA 3LAKA 2WUSA 2EHGA 3SYZA 3HK2A 4QS8A 3O08A 2V7ZA 4WCEL 4FWOA 1JXBA 3ULEA 2P1JA 1YVNA 1JKHA 1JLEA 4CJPA 4ILJA 1NBWA 1WSEA 3BUZB 3MXMA 3CJBA 2RN2A 1VQKN 4LY7A 1SQKA 1E4FT 3D45A 3KLGA 4B8AB 4ZTJA 4FLTA 3VQEA 1X3MA 5EVZA 3HI0A 3MN9A 3E9OA 4MDAA 1Q86O 3PO5A 4IFEA 3DI6A 1IKWA 3HOTA 1EO1A 3HVRA 3O4NA 2D5RA 4BC5A 3HJFA 3VOVA 3NH0A 2ZE2A 4BE2A 3ATUA 4LD0A 2P9KA 4DTJA 2JWLA 1Z6RA 1U47A 3AVJA 2WBNA 2GV9A 1DLOA 2ZF5O 1Q9XA 5AQNA 1HJOA 4TSXA 4C8LA 4I6MA 3H3OB 1JLGA 1HYVA 4CIFA 5GADP 4E7IA 3B6PA 3Q7CA 3CFOA 4BE1A 4O0IA 2ASOA 4O5FA 5DMRA 4CFAA 3OBYA 3WXJA 1RBUA 1TK0A 4CZGA 4DQSA 1B9FA 5HOOA 2GWKA 4XEIA 4AHUA 3T69A 3IFRA 1S3XA 3TAGA 4DS4A 3LDOA 3VQ6A 5AZJB 1NGDA 4CF2A 2HBKA 4FJXA 5E41A 3GBTA 4V19S 5F2RA 2E2QA 1NOZA 3C94A 5EX5A 2CH5A 4JI0K 1K8KB 2EWSA 4X65K 2A1SA 4BWJA 2P9SB 4RG8A 3QNNA 5GAHP 1RT4A 4KV8A 4GVEA 4YFUA 1RT6A 3Q7BA 4NLCA 3MN6A 3OYCA 4CEAA 2QWLA 4JKDA 3AVMA 3THXB 3SQ0A 3T1AA 1Q8IA 4R5PA 3WEEA 3F2KA 2XY8A 1VSDA 2HHTA 4YOUA 1X1PA 4DV3K 1L3VA 1IJJA 2GWJA 3DXKA 3QICA 4GKKK 3QBWA 1FKOA 3VEZA 2UXDK 1GOAA 4IG3A 4BE0A 4WE1A 3VQQA 4JV5K 3I33A 1C0MA 2P9NA 4FO0A 3QESA 3OVNA 3AO5A 3LWMA 4CJ3A 4FWMA 4XH5A 3CC2N 1BUPA 1QVGM 1IKYA 1IBKK 3TI0A 5CE3A 2KW4A 2E1YA 2FSNA 3MXIA 3VQ7A 2QXLA 3KWIA 2P9KB 4BDPA 2O8BB 3AARA 2IIRA 4FJHA 1MDUB 3O9TA 4DV5K 1RT5A 1KRPA 4CJEA 3JS6A 2E6LA 4OPAA 3NFAA 1Q82O 5AJ3K 1LOTB 3A5LC 4J2DA 4NYFA 3HPGA 1VSEA 3D2FA 1C0FA 3QEIA 3KJVA 3WXIA 4DU1A 5ADXA 3P5JA 4JI7K 2KZMA 4OLAA 1BCMA 4B9TA 5KGXA 1NLVA 3OYKA 1XC9A 1NMNA 1SS6A 3E66A 5C2FA 3CM5A 4KAZA 3ALYA 2CGKA 3L3UA 2ITMA 1P8ZA 2XY6A 1TYQA 2PYJA 5IT9O 4CJFA 2F8SA 4CVNE 1TUYA 4BR7A 4IO9L 3CQXA 3MX2A 1T03A 5FRNA 4OPJA 3RVCA 1RDAA 2RHKA 5LL6Z 4YOWA 1G15A 1L3TA 3HXMA 4FJJA 5AQVA 3V81A 2IGIA 1LAVA 5CZ1A 4UQGA 1D5AA 2W42A 4M3ZA 4XH4A 2PFUA 1NK6A 4B08A 1RT2A 4CFCA 2FBTA 1MU2A 3K9JA 1OH8A 5HRNA 4WQ4C 3WNGA 1XUPO 3M8RA 3L2WA 2GUPA 1L3UA 2FC0A 3ZT2A 3CJ7A 3EEQA 1KTQA 1HKCA 3T19A 3O3FA 3O6WA 4U67L 3LWLA 1FXXA 3JAMO 2IVPA 2O8DA 1ATNA 4JRPA 3AVCA 3CPWM 1XWLA 3NCIA 4HVJA 3VF6A 4CJQA 3HM8A 4OJRA 3AGKA 1UAXA 4DR2K 1U2VA 4N41A 2QKKA 2BDPA 2QWQA 4OGEA 3G6EN 4BRCA 1K6YA 3I0RA 1NJYA 5JLFA 4FJMA 1QTMA 4OLBA 2OPPA 1S72N 4DFKA 1BI4B 3WNFA 4DQPA 4B1ZA 2I7NA 2G8IA 4DCHA 1W97L 1N8RO 1LAWA 2OPSA 4YOXA 3ATVA 1RT7A 3WNHA 1NKEA 2FBVA 5C24A 1W2BM 2HB5A 4RTFD 3E9PA 4B8CA 3SQ1A 5SWMA 4KHWA 3I55N 1SAZA 3NF7A 3PIOL 4DTNA 5J2PA 3U4LA 2G8WA 4CZKA 1J5EK 3MMVA 4EP4A 4FOIA 5KTQA 5AQPA 2D0BA 4AM7A 4YOYA 4B9NA 1WSJA 2HOEA 4QAGA 4CJTA 4CZEA 2KTQA 3L2UA 5DM7L 1W9HA 3MK6A 4RWTA 1OH5A 3HOSA 1VQNN 4F9OA 4J2AA 1JLQA 1KCFA 2IS3A 3D0PA 4J2BA 3VGMA 2Q31A 5C0YA 2F8TA 5CYMA 4WFBL 4ELTA 3VEVA 1N36K 4EZ6A 4H0YB 1G99A 1IBMK 4IJAA 5KPZA 1NGGA 3LALA 3RMDA 3CJ9A 2ZD1A 3TAMA 2YNHA 3ENBA 2DFEA 1RBRA 1JL2A 2HMPA 2O8EB 3RMCA 4CJ5A 4FZZA 3IAYA 4CGHA 1SKWA 4IZ9A 5KQDA 3ZX3A 1T05A 2QWOA 1WAJA 4CJLA 2ITGA 3LAMA 4NLBA 1RTJA 3RRGA 4DLGA 3S3OA 4H5NA 5AQTA 5AQQA 4QOZB 5FPNA 3NAEA 3SUQA 2Q3SA 4FWKA 3I8BA 1IKXA 1UA0A 2HHUA 5LMNK 4GNIA 4CERA 1LCUA 4H5VA 3ZT1A 4KI4A 4H5RA 4CF0A 3VPZA 4PWDA 3M6GA 4CGJA 4BC3A 4FWLA 4F2SA 4C8OA 3OJSA 2OCEA 3EE8A 3DXKB 1TK5A 2OYQA 2W6LA 4ELVA 4RCHA 2A40A 1BG3A 4CK1A 2ZJRL 3VERA 4DV0K 4X66K 1X9WA 4BC2A 1RDBA 4FJ8A 3SV3A 1Q18A 1CZBA 4DV4K 1IKVA 4JKBA 1L3SA 4AHTA 3ENOA 1NGFA 3I8DA 3CMEN 1HUXA 5F0XA 2RKIA 2UYTA 3CCUN 4EIAA 4DV6K 1BDGA 3CMAN 3BZKA 5BRFA 3KTQA 1EWRA 3CERA 1VQLN 5SZTA 4W5TA 1YITN 1HLUA 3D7EO 1NGEA 1BCOA 3VN5A 3NGIA 1TKDA 4DSLA 1N33K 2OA8A 3KK2A 4CEOA 3SUOA 5FPMA 3OYJA 2YJFA 3ZT3A 3SPZA 5GAGP 2DFHA 3ITHA 1BU6O 2E2OA 3A0IX 5I42A 3VEXA 5GIPA 4R79A 3KVGA 4H4OA 4Z4EA 1K8AO 4ID5A 4JI1K 2ZM6K 1JLCA 4YOTA 1IG9A 3VA0A 1T3VA 2D4WA 1YF5L 3CJAA 1U48A 1D9DA 3AA3A 1B9DA 4NXNK 5C2DA 3U6FA 3DLRA 1CLQA 4DKWA 1N34K 4LF4K 2E88A 1XNRK 2HHWA 3RMBA 3CI5A 3VMFB 1HKGA 4CHPA 2O8BA 5AQZA 4CJVA 1GLBG 2QKBA 4CJUA 4DSFA 3MAQA 2ASPA 1NJWA 2NZTA 4IEIA 5J2NA 1BGXT 2UUCK 4BR9A 4GV6A 2HHVA 5AQIA 4YY3K 4U7BA 2PBDA 3HT3A 4DR5K 2O8FB 3LM9A 2PYLA 3UKRA 4KH5A 2WC9A 3DWLA 2VG5A 3V1OA 2QTDA 4N5SA 4Q5VA 4DQRA 1U4BA 1VQ9N 3VQAA 3ZEUB 1D9FA 1HNZK 3OYFA 4A62A 4CHQA 1TUUA 3DLBA 4FZYA 2WONA 3K2PA 2P9NB 1RCHA 5ADXH 4G9ZA 3VQCA 1QSLA 3MCPA 3ZT0A 3BY5A 1QZ6A 4O8UA 3M8SA 4EHUA 3KD5E 1BIZA 3TTFA 4PL8A 1BQMA 3A2FA 4IFYA 4OPHA 2YKMA 5AQRA 3AVKA 3TSUA 3PSIA 4DQIA 4MLHA 1OVYA 5C12A 3M8PA 4DUZK 3VQDA 1Y97A 2P9PB 2E20A 4Q0BA 4CD3A 2Y1IA 3L8BA 1U6ZA 4A5AA 3FZFA 4E7JA 3GL1A 4M63C 2OZMA 3ZSQA 4K25A 4JS5A 3PSFA 5LMUK 2F9TA 3UB5A 5I9EB 4N76A 2D0PA 3AVBA 1WUAA 4GV9A 3O3GA 2XRIA 4JK7A 4BRKA 1HNVA 2IOCA 3H45C 3J80O 3R9PA 3E01A 3LP2A 2NLXA 3B6OA 2HF4A 3EO3A 3L2RA 3EE9A 3DOLA 2JGUA 2IVNA 3DJCA 4HTUA 4AILC 2NRTA 5HRPA 5T7BA 4E0DA 1LWFA 3THVA 1KXPA 1UWBA 5AQLA 2HBLA 3JXUA 3CF5L 3KD1E 3VENA 3LP3A 1GLJO 3OHRA 3MWTA 3OJUA 4BRAA 2VGNA 2ETJA 2Q36A 4EFHA 4BVPA 1YHQN 2HNDA 4BRQA 4HHTA 1BA0A 4Z4HA 4CBXA 2D1KA 1QE1A 4RW6A 1TGOA 4E1MA 4EAHD 3TWHA 1SL2A 4B9VA 4GVMA 5AQWA 4CF9A 4ILHA 2VWBA 4M7YA 3EY1A 4IOCL 1T6DA 3FZLA 3H3NO 2P5OA 2RF2A 1YUWA 1KLMA 4AHRA 3O3HA 5M1PA 2UUBK 4KH4A 3T1YK 1NK8A 2HVIA 3SBGA 3QNOA 2AA4A 4JI2K 1C0UA 3QIOA 4EP5A 5EU7A 1YTAA 3NVKA 4CK2A 5CZ2A 2FF3B 3G25A 4FPAA 4WQ4A 4JKGA 4B3TK 1QQNA 5FPEA 1NNEA 2YKNA 1S6PA 3CHWA 4FM1A 3O4QA 4I2PA 3WEEB 1ATSA 4DLEA 1D4XA 4FVUA 1N5YA 1K73O 4I9QA 1WB9A 3O9UA 4IXCA 4K8XA 3KLHA 4I6MB 5FDLA 3K5MA 3CCJN 1YI2N 4O0JA 3LDPA 3J8AA 5AZJA 3VTHA 2F4VK 1NK4A 5C10A 3OYBA 3NVMA 4B9SA 1ZBSA 1IBLK 2BH1A 3V9ZA 2RE2A 4CZMA 2QXFA 4DF4A 4RW8A 3CFRA 3C7NB 3CIPA 1HKBA 2P9SA 5MLCQ 4CJSA 3CJ1A 5AQMA 4H0XB 1VHXA 2G8KA 1CZAN 4A2AA 1YVUA 1RFQA 3CG7A 4HTLA 2FSJA 3EYZA 5M1FA 1HPMA 3D2EB 3J7AP 1TAUA 4M42A 2OPRA 1SL0A 1NK7A 2GBZA 1T8EA 3H08A 4KPYA 1HX1A 3WUHA 4A57A 4KBOA 1NGAA 1H1VA 2GEMA 4O5BA 2VG7A 1RBSA 3LP0A 1HRHA 2P9IB 1S1VA 1MWMA 3HRGA 3H1VX 4H8KA 2X6NA 3PUFA 3CPEA 1P90A 3NGYA 2VQFK 3HPHA 4BWMA 4J2EA 3SQ4A 4Z4CA 2O8EA 2F96A 2KZZA 1S1UA 3CQ8A 1HQEA 4DG1A 2B4JA 5KPTA 4XH1A 1GLAG 1RNHA 1VQPN 2WFBA 2P51A 4H0OA 3PX6A 1BISA 4NCBA 4FLVA 1U04A 2E1ZA 4JI5K 4DWIA 4FK4A 4F3OA 1JLAA 2X74A 3MCAB 3K5OA 4AM6A 4CZHA 3OYGA 1GOBA 5C25A 5JICA 5FROA 1X3NA 2YV0X 4LSNA 4GV3A 1RBVA 1VAZA 2Y1JA 3F5TA 2PAVA 4FLYA 4K8ZA 4KHYA 3RSEA 1SV5A 1XC3A 2FXUA 2BE2A 4OKKA 5AR0A 4FZXC 5ELZA 4OGCA 2VYPA 1O13A 3NH2A 4FWNA 3WT0A 3CFPA 2UU9K 3L2VA 3MN7A 1RBTA 3C6HA 4YNQA 3QDKA 3AV9A 1WLJA 3NDKA 4C8KA 3CCLN 4IDHA 3U9DA 4BR2A 3VQ4A 3BZCA 4KTWA 2NRHA 3PX0A
chains in the Genus database with same CATH topology
3QIPA 1N6QA 5D3GA 1QHTA 4I9LA 4C8NA 3QEPA 3RMCA 4CJ5A 4ELUA 4FZZA 3IAYA 1TL1A 1TKXA 4CGHA 1S9EA 3ISNC 2R7YA 1KFDA 2A1RA 1SKWA 1HJRA 4E3SA 3V9XA 3QEWA 1T05A 4M3YA 4N47A 1WAJA 4CJLA 1HPZA 2ITGA 3LAMA 3CQ8A 4FJGA 1RTJA 3DLKA 3RRGA 1JXEA 4CGIA 4DLGA 4E7HA 3S3OA 2LSNA 4KHNA 4QOZB 3OYDA 3NAEA 3VQ8A 4RW4A 3SUQA 3QO9A 4Z0UA 3K5LA 1NOYA 4DTSA 3IG1A 1Z25A 1ZBUA 2Z1JA 4AHSA 2Q3SA 4AHVA 3K57A 1IKXA 1UA0A 1QQCA 3DLHA 2HHUA 4KB1A 4FJNA 3P83D 4FLXA 4CERA 3DLGA 4KI4A 1GOCA 3ZT1A 4FLZA 2G8FA 4CF0A 4HCCA 4PWDA 2D0AA 3S3NA 4CGJA 4Z4FA 3AO4A 4F2SA 4C8OA 3K58A 4O55A 4CHOA 1IH7A 1C6VA 3RTVA 4RW9A 4C8MA 4CFDA 4B9MA 1ZBHA 3ZSVA 3OJSA 4Z4IA 1TK5A 4DSEA 2OYQA 3LANA 1VRUA 4ELVA 3LZIA 4W5OA 1JLBA 1BQNA 3I0SA 4B3OA 3QINA 3TANA 4CK1A 4LSLA 3V1RA 1U49A 3AVNA 3JSMA 3KKSA 1UOCA 5DK5A 3HYFA 3K5NA 2OPQA 4DTOA 1X9WA 1QSSA 1KSPA 4FK2A 3SPYA 3RRHA 4DF8A 2ZQBA 3PX4A 1RDBA 5KGWA 4DFMA 2PY5A 4FJ8A 2YHBA 1WSIA 1BHLA 1NK5A 2RPIA 3SV3A 3NH1A 1CZBA 1RTDA 3OYLA 1VSKA 3ZSOA 4KHUA 1O1WA 2YNIA 4GW6A 2O4GA 3VA3A 3SQ2A 2B5JA 3OYNA 1IKVA 4LH5A 1L3SA 3G10A 4AHTA 3UIQA 2HNYA 3I8DA 2KFZA 3KK1A 3L2QA 4CFBA 2RKIA 3K59A 3OYAA 4FJLA 1HMVA 1CXUA 3ZSXA 1C1BA 5J2MA 4KKOA 2Z1GA 3KTQA 4NCGA 2VWJA 3TAPA 1A5VA 3M8QA 4PA1A 5SZTA 4W5TA 1EKEA 4PY5A 4I7FA 4NCAA 1NJXA 1BCOA 4CIEA 3V9WA 3VN5A 1RILA 3NGIA 1TKDA 3DYAA 1RDCA 2JLEA 4RW7A 3V1QA 4DSLA 4IKFA 2OA8A 3NF6A 1LWEA 4CEOA 5KRSA 1VSIA 3KK2A 3NHGA 4HUGA 3SUOA 4F2RA 3KLFA 3OYJA 4KTZA 3ZT3A 3SPZA 3F73A 4DQQA 3AVHA 4CJRA 3JYTA 2PZSA 4MQ3A 3AO3A 2DFHA 3ITHA 1RDDA 3BGRA 1YTUA 5I42A 1VRTA 4LH4A 3HPOA 4E1NA 2G8VA 3EZ5A 1WSGA 4CK3A 2HVHA 4H4OA 2FBXA 4Z4EA 4W5QA 3QEXA 4ID5A 1JL1A 3NBPA 2KFNA 1DTQA 1JLCA 1UA1A 3AA4A 4M3TA 2HW3A 1IG9A 3VA0A 3RMAA 1C0TA 4DS5A 2B6AA 4NYNA 4DFPA 1KLNA 1U48A 5KI6A 3LAKA 1D9DA 1C1AA 3AA3A 2EHGA 1B9DA 3SYZA 4KHQA 3U6FA 3HK2A 3DLRA 4IFVA 4QCLA 2HHSA 1QS4A 1CLQA 3V4IA 1JXBA 2P1JA 1J9AA 3G0ZA 4E7KA 1JKHA 1JLEA 2IAJA 4CJPA 1DTTA 1RT1A 3KKRA 3RMBA 3OYHA 2HHWA 4AHCA 1WSEA 4CHPA 4ZHRA 1NKBA 3MXMA 1CXQA 2YNFA 2RN2A 1XHXA 3NGZA 4LY7A 3MEDA 4CJVA 4Z4GA 2QKBA 4KO0A 3D45A 4KREA 3KLGA 4CJUA 4DSFA 4B8AB 4ZTJA 3MAQA 3SV4A 4FLTA 3VQEA 2AJQA 1NJWA 4CEFA 3HP6A 3AA5X 3T3FA 5J2NA 1BGXT 4DSJA 4OKJA 3VQPA 3HP9A 4CIGA 2HHVA 3PO5A 3DI6A 5HROA 1IKWA 4DSKA 3HT3A 3HVRA 3O4NA 4BDYA 1KFSA 2D5RA 2G8HA 2GUIA 2PYLA 2HNZA 4M3RA 3HJFA 3NH0A 2BANA 3DOKA 1D8YA 2ZE2A 4CJWA 2VG5A 4BE2A 3V1OA 4HUFA 1EXQA 1IO2A 1Z26A 4LD0A 4DTJA 3S3MA 5HRRA 4N5SA 1L5UA 2D0CA 1S6QA 2YHAA 4Q5VA 4DQRA 2XY5A 5KRTA 1U4BA 1ASVA 3AVJA 3CM6A 3VQAA 1U47A 2GV9A 1RTIA 4CEEA 1D9FA 1DLOA 3SUNA 1LWCA 3NF8A 1Q9XA 1VSJA 3SCXA 4CHYA 3OYFA 4CHQA 3MEEA 5HLFA 4FYDA 1HYZA 3DLBA 4TSXA 1C1CA 3MEGA 3ULDA 4FZYA 4C8LA 4FLUA 2WONA 3K2PA 1JLGA 1RCHA 4FLWA 3PY8A 1HYVA 4CIFA 3VQCA 4DFJA 1QSLA 5HP1A 3ZT0A 4ICLA 3LZJA 4E7IA 3B6PA 2FBYA 3M8SA 3CFOA 4BE1A 3KD5E 1BIZA 4O0IA 4W5NA 1FK9A 3OS0A 1BQMA 1WNSA 5DMRA 4CFAA 5J2QA 3A2FA 3AVLA 3OYMA 1RBUA 1TK0A 1XHZA 4IFYA 4DQSA 1B9FA 2XO7A 2YNGA 2YKMA 3KLEA 3AVKA 3P1GA 3TABA 3WNEA 4AHUA 4DQIA 3TAGA 4DS4A 4FJ5A 3M8PA 3VQ6A 3VQDA 1Y97A 5HRSA 2EX3A 4Q0BA 2Y1IA 4CF2A 3DM2A 4DSIA 4FJXA 1ASUA 3L8BA 5E41A 3OY9A 1A5XA 1R0AA 1QSYA 4E7JA 4KB0A 1NOZA 2OZMA 2X78A 3C94A 3S9HA 3ZSQA 4PUOA 4CEDA 3TAEA 2A1SA 4JS5A 1Q9YA 4BWJA 4RG8A 3OS1A 3QNNA 5I3UA 1RT4A 1HQUA 4KV8A 4N76A 4YFUA 3AVBA 1J54A 1BIUA 3KLIA 1X9MA 1RT6A 4FCYA 2XHBA 3O3GA 5FRMA 3OYCA 2XRIA 1ZBLA 2ATQA 4CEAA 4W5RA 1HNVA 2IOCA 3AVMA 3SQ0A 3T1AA 5J1EA 1Q8IA 4R5PA 3RR8A 1A5WA 4L8RB 2XY8A 3E01A 1VSDA 3LP2A 2HHTA 2E6MA 3B6OA 3F9KA 1X1PA 1BI4A 3SJJA 1F21A 3C6TA 3L2RA 2QK9A 3OS2A 1L3VA 4KI6A 4FXDA 2KQ2A 3HO1A 3TAQA 3DOLA 1W0HA 4CGFA 3QEVA 2DY4A 2JGUA 4HCBA 1NK0A 4CJ4A 4HTUA 1FKOA 4AILC 1LW2A 1I3AA 5CY4A 5HRPA 5T7BA 1GOAA 1JLFA 1LWFA 4IG3A 4FM0A 3THVA 4E0DA 4M3UA 2BGGA 4BE0A 1UWBA 3CYMA 3HL8A 3RWUA 4FJ7A 4WE1A 3VQQA 2HHXA 3KD1E 4DTRA 4FJKA 1C0MA 1S1TA 1VSMA 3DRPA 3LP3A 4CEBA 3QESA 3OVNA 3AO5A 1NJZA 3LWMA 4CJ3A 3PO4A 1KVBA 3OJUA 1VSFA 4JLHA 4JS4A 4CGGA 1ITGA 1EP4A 1WSFA 1IKYA 4M3XA 2ETJA 3AVFA 3KK3A 3TI0A 2KW4A 3TR8A 2HNDA 2WOMA 3MXIA 4AH9A 4HHTA 3VQ7A 4Z4HA 4BDPA 1WAFA 1QE1A 3U3GA 4RW6A 4FJHA 4GMJB 4M3WA 1TGOA 4E1MA 3TWHA 3SI6A 1RT5A 1KRPA 1SL2A 4CJEA 4B9VA 3HSTB 4GVMA 2I5JA 2E6LA 3IRXA 3NFAA 3KIOA 4CGDA 4E19A 1SL1A 4I2QA 4BACA 4BDZA 4J2DA 4NYFA 4CF1A 3HPGA 1VSEA 4CF9A 4XIUA 3LDSA 1WSHA 3DRSA 1T7PA 3QEIA 3KJVA 4DU1A 2P5OA 3EY1A 1HYSA 3P5JA 2RF2A 2KZMA 1LV5A 1BCMA 4E89A 4CCHA 1KLMA 4MFBA 4AHRA 3O3HA 1TVRA 4OLAA 4CE9A 2Z1IA 1NK8A 1WN7A 3ZT4A 4O4GA 4B9TA 2HVIA 5KGXA 3QNOA 3OYKA 3AVIA 1XC9A 3MECA 3V9UA 3RR7A 2KZZA 1C0UA 3CM5A 3QIOA 4EP5A 5EU7A 5CYQA 1YTAA 4KAZA 5JS1A 3ALYA 3L3UA 2XY6A 4CK2A 5CZ2A 1EETA 1SUQA 2PYJA 1TV6A 4CJFA 4IBNA 2F8SA 5JS2A 1VSHA 1S1XA 1SKSA 2YKNA 4DU3A 1S6PA 3VQ5A 1T03A 5FRNA 1TK8A 4CHZA 4FM1A 1I39A 3O4QA 4I2PA 4OPJA 2IC3A 4DLEA 1NKCA 1ZBIA 1RDAA 1N5YA 2HMIA 4I9QA 1G15A 1L3TA 1ZBFA 4IDKA 4DTMA 3BDPA 4IG0A 3HXMA 3V9SA 4FJJA 4FK0A 3AO1A 1LW0A 4K8XA 3KLHA 3SZ2A 5FDLA 3K5MA 2DFFA 3L3VA 3V81A 3ZSWA 3DRRA 2IGIA 1LAVA 4O0JA 5CZ1A 4UQGA 4B9UA 4E7LA 3HVTA 3SUPA 1NK4A 1SKRA 3OYBA 1D5AA 2W42A 4M3ZA 2P5GA 3DMJA 1RTHA 4B9SA 4DU4A 3V9ZA 1NK6A 4B08A 4N56A 2QXFA 1REVA 4RW8A 1RT2A 2FBTA 4CFCA 3CFRA 4DF4A 1MU2A 5HRNA 4KTQA 3WNGA 4CJSA 3M8RA 3L2WA 3TARA 1L3UA 2FC0A 3ZT2A 2G8KA 1KTQA 4CEQA 4CEZA 1YVUA 2VWKA 4B9LA 3T19A 4FVMA 3CG7A 3EYZA 3VQ9A 3NF9A 3O3FA 3MXJA 1TAUA 3AA2A 4M42A 4M45A 3LWLA 1FXXA 2OPRA 4CHNA 1SL0A 4DMNA 1NK7A 3QERA 4F8RA 2GBZA 1TKTA 3AVGA 4JRPA 1T8EA 3H08A 3AVCA 3OYIA 4KPYA 1XWLA 1B92A 3LPUA 3NCIA 4HVJA 4OVLA 4OJRA 4CJQA 4FW1A 1UAXA 3AVAA 4H4MA 4O5BA 4OKEA 1U45A 2VG7A 3C95A 2BDPA 2QKKA 4N41A 1VSLA 4HUEA 1RBSA 2XY7A 5K14A 4OGEA 3LP0A 1HRHA 3HM9A 1S1VA 4F4KA 1K6YA 3I0RA 1NJYA 4FJMA 1QTMA 2E4LA 3U3YA 4H8KA 4OLBA 1ZYQA 2OPPA 3PV8A 4DFKA 1BI4B 3WNFA 4DQPA 4KFBA 2IDOA 2X6NA 2G8IA 2O4IA 3PUFA 4EZ9A 3NGYA 1XI1A 3HPHA 1LAWA 2OPSA 5HBMA 4BWMA 4Z4CA 3SQ4A 4J2EA 2F96A 1RT7A 3WNHA 1NKEA 3ZSZA 1S1UA 2FBVA 3LPTA 5C24A 1HQEA 4O44A 1S9GA 2B4JA 2HB5A 4DG1A 3SNNA 4OPKA 1J5OA 4G1QA 4B8CA 3SQ1A 4FJ9A 2G8UA 1RNHA 5SWMA 3TAFA 4KHWA 4FW2A 3OYEA 2P51A 4CJKA 2X6SA 1BISA 3PX6A 3NF7A 1KVAA 4NCBA 2G8WA 4DTNA 5J2PA 3ZSYA 4FLVA 1NK9A 1CZ9A 1U04A 4ID1A 4CECA 3LP1A 3ZCMA 4CF8A 4DWIA 1S5JA 2HHQA 4FK4A 4F3OA 1JLAA 4CESA 1BL3A 2X74A 4EP4A 1VK0A 3K5OA 5KTQA 2D0BA 2VG6A 3QLHA 3OYGA 3QETA 4JRQA 4B9NA 1GOBA 1WSJA 4QAGA 5C25A 4CJTA 5FROA 3C6UA 4DTUA 4Y1CA 2KTQA 2YV0X 3L2UA 4LSNA 1S1WA 3VQBA 1RBVA 4DTXA 3ASMA 1W9HA 2Y1JA 4DTPA 4FLYA 1EX4A 4J2AA 4K8ZA 4FM2A 4KHYA 1JLQA 3AO2A 1SV5A 1KCFA 4M41A 2IS3A 3D0PA 1X9SA 4J2BA 2BE2A 4OKKA 3IS9A 4FZXC 3FFIA 4Y1DA 4OGCA 2OZSA 2F8TA 3NH2A 2DTUA 1J53A 5CYMA 3CFPA 3L2VA 5C42A 1RT3A 4ELTA 3V6DA 4EZ6A 1RBTA 3DLEA 4YNQA 4F3TA 1KVCA 4KRFA 1YT3A 3AV9A 4PQUA 1WLJA 1HNIA 4KHSA 3LALA 3NDKA 3NE6A 4KTWA 3RMDA 2ZD1A 4C8KA 1TAQA 1TKZA 1TL3A 2YNHA 3TAMA 4ZTFA 2Z1HA 1ASWA 2DFEA 3VQ4A 2NUBA 3ZSRA 1RBRA 1FKPA 4FJIA 3PX0A 1JL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QIP A;  1N6Q A;  5D3G A;  1QHT A;  4I9L A;  4C8N A;  3QEP A;  3RMC A;  4CJ5 A;  4ELU A;  4FZZ A;  3IAY A;  1TL1 A;  1TKX A;  4CGH A;  1S9E A;  3ISN C;  2R7Y A;  1KFD A;  2A1R A;  1SKW A;  1HJR A;  4E3S A;  3V9X A;  3QEW A;  1T05 A;  4M3Y A;  4N47 A;  1WAJ A;  4CJL A;  1HPZ A;  2ITG A;  3LAM A;  3CQ8 A;  4FJG A;  1RTJ A;  3DLK A;  3RRG A;  1JXE A;  4CGI A;  4DLG A;  4E7H A;  3S3O A;  2LSN A;  4KHN A;  4QOZ B;  3OYD A;  3NAE A;  3VQ8 A;  4RW4 A;  3SUQ A;  3QO9 A;  4Z0U A;  3K5L A;  1NOY A;  4DTS A;  3IG1 A;  1Z25 A;  1ZBU A;  2Z1J A;  4AHS A;  2Q3S A;  4AHV A;  3K57 A;  1IKX A;  1UA0 A;  1QQC A;  3DLH A;  2HHU A;  4KB1 A;  4FJN A;  3P83 D;  4FLX A;  4CER A;  3DLG A;  4KI4 A;  1GOC A;  3ZT1 A;  4FLZ A;  2G8F A;  4CF0 A;  4HCC A;  4PWD A;  2D0A A;  3S3N A;  4CGJ A;  4Z4F A;  3AO4 A;  4F2S A;  4C8O A;  3K58 A;  4O55 A;  4CHO A;  1IH7 A;  1C6V A;  3RTV A;  4RW9 A;  4C8M A;  4CFD A;  4B9M A;  1ZBH A;  3ZSV A;  3OJS A;  4Z4I A;  1TK5 A;  4DSE A;  2OYQ A;  3LAN A;  1VRU A;  4ELV A;  3LZI A;  4W5O A;  1JLB A;  1BQN A;  3I0S A;  4B3O A;  3QIN A;  3TAN A;  4CK1 A;  4LSL A;  3V1R A;  1U49 A;  3AVN A;  3JSM A;  3KKS A;  1UOC A;  5DK5 A;  3HYF A;  3K5N A;  2OPQ A;  4DTO A;  1X9W A;  1QSS A;  1KSP A;  4FK2 A;  3SPY A;  3RRH A;  4DF8 A;  2ZQB A;  3PX4 A;  1RDB A;  5KGW A;  4DFM A;  2PY5 A;  4FJ8 A;  2YHB A;  1WSI A;  1BHL A;  1NK5 A;  2RPI A;  3SV3 A;  3NH1 A;  1CZB A;  1RTD A;  3OYL A;  1VSK A;  3ZSO A;  4KHU A;  1O1W A;  2YNI A;  4GW6 A;  2O4G A;  3VA3 A;  3SQ2 A;  2B5J A;  3OYN A;  1IKV A;  4LH5 A;  1L3S A;  3G10 A;  4AHT A;  3UIQ A;  2HNY A;  3I8D A;  2KFZ A;  3KK1 A;  3L2Q A;  4CFB A;  2RKI A;  3K59 A;  3OYA A;  4FJL A;  1HMV A;  1CXU A;  3ZSX A;  1C1B A;  5J2M A;  4KKO A;  2Z1G A;  3KTQ A;  4NCG A;  2VWJ A;  3TAP A;  1A5V A;  3M8Q A;  4PA1 A;  5SZT A;  4W5T A;  1EKE A;  4PY5 A;  4I7F A;  4NCA A;  1NJX A;  1BCO A;  4CIE A;  3V9W A;  3VN5 A;  1RIL A;  3NGI A;  1TKD A;  3DYA A;  1RDC A;  2JLE A;  4RW7 A;  3V1Q A;  4DSL A;  4IKF A;  2OA8 A;  3NF6 A;  1LWE A;  4CEO A;  5KRS A;  1VSI A;  3KK2 A;  3NHG A;  4HUG A;  3SUO A;  4F2R A;  3KLF A;  3OYJ A;  4KTZ A;  3ZT3 A;  3SPZ A;  3F73 A;  4DQQ A;  3AVH A;  4CJR A;  3JYT A;  2PZS A;  4MQ3 A;  3AO3 A;  2DFH A;  3ITH A;  1RDD A;  3BGR A;  1YTU A;  5I42 A;  1VRT A;  4LH4 A;  3HPO A;  4E1N A;  2G8V A;  3EZ5 A;  1WSG A;  4CK3 A;  2HVH A;  4H4O A;  2FBX A;  4Z4E A;  4W5Q A;  3QEX A;  4ID5 A;  1JL1 A;  3NBP A;  2KFN A;  1DTQ A;  1JLC A;  1UA1 A;  3AA4 A;  4M3T A;  2HW3 A;  1IG9 A;  3VA0 A;  3RMA A;  1C0T A;  4DS5 A;  2B6A A;  4NYN A;  4DFP A;  1KLN A;  1U48 A;  5KI6 A;  3LAK A;  1D9D A;  1C1A A;  3AA3 A;  2EHG A;  1B9D A;  3SYZ A;  4KHQ A;  3U6F A;  3HK2 A;  3DLR A;  4IFV A;  4QCL A;  2HHS A;  1QS4 A;  1CLQ A;  3V4I A;  1JXB A;  2P1J A;  1J9A A;  3G0Z A;  4E7K A;  1JKH A;  1JLE A;  2IAJ A;  4CJP A;  1DTT A;  1RT1 A;  3KKR A;  3RMB A;  3OYH A;  2HHW A;  4AHC A;  1WSE A;  4CHP A;  4ZHR A;  1NKB A;  3MXM A;  1CXQ A;  2YNF A;  2RN2 A;  1XHX A;  3NGZ A;  4LY7 A;  3MED A;  4CJV A;  4Z4G A;  2QKB A;  4KO0 A;  3D45 A;  4KRE A;  3KLG A;  4CJU A;  4DSF A;  4B8A B;  4ZTJ A;  3MAQ A;  3SV4 A;  4FLT A;  3VQE A;  2AJQ A;  1NJW A;  4CEF A;  3HP6 A;  3AA5 X;  3T3F A;  5J2N A;  1BGX T;  4DSJ A;  4OKJ A;  3VQP A;  3HP9 A;  4CIG A;  2HHV A;  3PO5 A;  3DI6 A;  5HRO A;  1IKW A;  4DSK A;  3HT3 A;  3HVR A;  3O4N A;  4BDY A;  1KFS A;  2D5R A;  2G8H A;  2GUI A;  2PYL A;  2HNZ A;  4M3R A;  3HJF A;  3NH0 A;  2BAN A;  3DOK A;  1D8Y A;  2ZE2 A;  4CJW A;  2VG5 A;  4BE2 A;  3V1O A;  4HUF A;  1EXQ A;  1IO2 A;  1Z26 A;  4LD0 A;  4DTJ A;  3S3M A;  5HRR A;  4N5S A;  1L5U A;  2D0C A;  1S6Q A;  2YHA A;  4Q5V A;  4DQR A;  2XY5 A;  5KRT A;  1U4B A;  1ASV A;  3AVJ A;  3CM6 A;  3VQA A;  1U47 A;  2GV9 A;  1RTI A;  4CEE A;  1D9F A;  1DLO A;  3SUN A;  1LWC A;  3NF8 A;  1Q9X A;  1VSJ A;  3SCX A;  4CHY A;  3OYF A;  4CHQ A;  3MEE A;  5HLF A;  4FYD A;  1HYZ A;  3DLB A;  4TSX A;  1C1C A;  3MEG A;  3ULD A;  4FZY A;  4C8L A;  4FLU A;  2WON A;  3K2P A;  1JLG A;  1RCH A;  4FLW A;  3PY8 A;  1HYV A;  4CIF A;  3VQC A;  4DFJ A;  1QSL A;  5HP1 A;  3ZT0 A;  4ICL A;  3LZJ A;  4E7I A;  3B6P A;  2FBY A;  3M8S A;  3CFO A;  4BE1 A;  3KD5 E;  1BIZ A;  4O0I A;  4W5N A;  1FK9 A;  3OS0 A;  1BQM A;  1WNS A;  5DMR A;  4CFA A;  5J2Q A;  3A2F A;  3AVL A;  3OYM A;  1RBU A;  1TK0 A;  1XHZ A;  4IFY A;  4DQS A;  1B9F A;  2XO7 A;  2YNG A;  2YKM A;  3KLE A;  3AVK A;  3P1G A;  3TAB A;  3WNE A;  4AHU A;  4DQI A;  3TAG A;  4DS4 A;  4FJ5 A;  3M8P A;  3VQ6 A;  3VQD A;  1Y97 A;  5HRS A;  2EX3 A;  4Q0B A;  2Y1I A;  4CF2 A;  3DM2 A;  4DSI A;  4FJX A;  1ASU A;  3L8B A;  5E41 A;  3OY9 A;  1A5X A;  1R0A A;  1QSY A;  4E7J A;  4KB0 A;  1NOZ A;  2OZM A;  2X78 A;  3C94 A;  3S9H A;  3ZSQ A;  4PUO A;  4CED A;  3TAE A;  2A1S A;  4JS5 A;  1Q9Y A;  4BWJ A;  4RG8 A;  3OS1 A;  3QNN A;  5I3U A;  1RT4 A;  1HQU A;  4KV8 A;  4N76 A;  4YFU A;  3AVB A;  1J54 A;  1BIU A;  3KLI A;  1X9M A;  1RT6 A;  4FCY A;  2XHB A;  3O3G A;  5FRM A;  3OYC A;  2XRI A;  1ZBL A;  2ATQ A;  4CEA A;  4W5R A;  1HNV A;  2IOC A;  3AVM A;  3SQ0 A;  3T1A A;  5J1E A;  1Q8I A;  4R5P A;  3RR8 A;  1A5W A;  4L8R B;  2XY8 A;  3E01 A;  1VSD A;  3LP2 A;  2HHT A;  2E6M A;  3B6O A;  3F9K A;  1X1P A;  1BI4 A;  3SJJ A;  1F21 A;  3C6T A;  3L2R A;  2QK9 A;  3OS2 A;  1L3V A;  4KI6 A;  4FXD A;  2KQ2 A;  3HO1 A;  3TAQ A;  3DOL A;  1W0H A;  4CGF A;  3QEV A;  2DY4 A;  2JGU A;  4HCB A;  1NK0 A;  4CJ4 A;  4HTU A;  1FKO A;  4AIL C;  1LW2 A;  1I3A A;  5CY4 A;  5HRP A;  5T7B A;  1GOA A;  1JLF A;  1LWF A;  4IG3 A;  4FM0 A;  3THV A;  4E0D A;  4M3U A;  2BGG A;  4BE0 A;  1UWB A;  3CYM A;  3HL8 A;  3RWU A;  4FJ7 A;  4WE1 A;  3VQQ A;  2HHX A;  3KD1 E;  4DTR A;  4FJK A;  1C0M A;  1S1T A;  1VSM A;  3DRP A;  3LP3 A;  4CEB A;  3QES A;  3OVN A;  3AO5 A;  1NJZ A;  3LWM A;  4CJ3 A;  3PO4 A;  1KVB A;  3OJU A;  1VSF A;  4JLH A;  4JS4 A;  4CGG A;  1ITG A;  1EP4 A;  1WSF A;  1IKY A;  4M3X A;  2ETJ A;  3AVF A;  3KK3 A;  3TI0 A;  2KW4 A;  3TR8 A;  2HND A;  2WOM A;  3MXI A;  4AH9 A;  4HHT A;  3VQ7 A;  4Z4H A;  4BDP A;  1WAF A;  1QE1 A;  3U3G A;  4RW6 A;  4FJH A;  4GMJ B;  4M3W A;  1TGO A;  4E1M A;  3TWH A;  3SI6 A;  1RT5 A;  1KRP A;  1SL2 A;  4CJE A;  4B9V A;  3HST B;  4GVM A;  2I5J A;  2E6L A;  3IRX A;  3NFA A;  3KIO A;  4CGD A;  4E19 A;  1SL1 A;  4I2Q A;  4BAC A;  4BDZ A;  4J2D A;  4NYF A;  4CF1 A;  3HPG A;  1VSE A;  4CF9 A;  4XIU A;  3LDS A;  1WSH A;  3DRS A;  1T7P A;  3QEI A;  3KJV A;  4DU1 A;  2P5O A;  3EY1 A;  1HYS A;  3P5J A;  2RF2 A;  2KZM A;  1LV5 A;  1BCM A;  4E89 A;  4CCH A;  1KLM A;  4MFB A;  4AHR A;  3O3H A;  1TVR A;  4OLA A;  4CE9 A;  2Z1I A;  1NK8 A;  1WN7 A;  3ZT4 A;  4O4G A;  4B9T A;  2HVI A;  5KGX A;  3QNO A;  3OYK A;  3AVI A;  1XC9 A;  3MEC A;  3V9U A;  3RR7 A;  2KZZ A;  1C0U A;  3CM5 A;  3QIO A;  4EP5 A;  5EU7 A;  5CYQ A;  1YTA A;  4KAZ A;  5JS1 A;  3ALY A;  3L3U A;  2XY6 A;  4CK2 A;  5CZ2 A;  1EET A;  1SUQ A;  2PYJ A;  1TV6 A;  4CJF A;  4IBN A;  2F8S A;  5JS2 A;  1VSH A;  1S1X A;  1SKS A;  2YKN A;  4DU3 A;  1S6P A;  3VQ5 A;  1T03 A;  5FRN A;  1TK8 A;  4CHZ A;  4FM1 A;  1I39 A;  3O4Q A;  4I2P A;  4OPJ A;  2IC3 A;  4DLE A;  1NKC A;  1ZBI A;  1RDA A;  1N5Y A;  2HMI A;  4I9Q A;  1G15 A;  1L3T A;  1ZBF A;  4IDK A;  4DTM A;  3BDP A;  4IG0 A;  3HXM A;  3V9S A;  4FJJ A;  4FK0 A;  3AO1 A;  1LW0 A;  4K8X A;  3KLH A;  3SZ2 A;  5FDL A;  3K5M A;  2DFF A;  3L3V A;  3V81 A;  3ZSW A;  3DRR A;  2IGI A;  1LAV A;  4O0J A;  5CZ1 A;  4UQG A;  4B9U A;  4E7L A;  3HVT A;  3SUP A;  1NK4 A;  1SKR A;  3OYB A;  1D5A A;  2W42 A;  4M3Z A;  2P5G A;  3DMJ A;  1RTH A;  4B9S A;  4DU4 A;  3V9Z A;  1NK6 A;  4B08 A;  4N56 A;  2QXF A;  1REV A;  4RW8 A;  1RT2 A;  2FBT A;  4CFC A;  3CFR A;  4DF4 A;  1MU2 A;  5HRN A;  4KTQ A;  3WNG A;  4CJS A;  3M8R A;  3L2W A;  3TAR A;  1L3U A;  2FC0 A;  3ZT2 A;  2G8K A;  1KTQ A;  4CEQ A;  4CEZ A;  1YVU A;  2VWK A;  4B9L A;  3T19 A;  4FVM A;  3CG7 A;  3EYZ A;  3VQ9 A;  3NF9 A;  3O3F A;  3MXJ A;  1TAU A;  3AA2 A;  4M42 A;  4M45 A;  3LWL A;  1FXX A;  2OPR A;  4CHN A;  1SL0 A;  4DMN A;  1NK7 A;  3QER A;  4F8R A;  2GBZ A;  1TKT A;  3AVG A;  4JRP A;  1T8E A;  3H08 A;  3AVC A;  3OYI A;  4KPY A;  1XWL A;  1B92 A;  3LPU A;  3NCI A;  4HVJ A;  4OVL A;  4OJR A;  4CJQ A;  4FW1 A;  1UAX A;  3AVA A;  4H4M A;  4O5B A;  4OKE A;  1U45 A;  2VG7 A;  3C95 A;  2BDP A;  2QKK A;  4N41 A;  1VSL A;  4HUE A;  1RBS A;  2XY7 A;  5K14 A;  4OGE A;  3LP0 A;  1HRH A;  3HM9 A;  1S1V A;  4F4K A;  1K6Y A;  3I0R A;  1NJY A;  4FJM A;  1QTM A;  2E4L A;  3U3Y A;  4H8K A;  4OLB A;  1ZYQ A;  2OPP A;  3PV8 A;  4DFK A;  1BI4 B;  3WNF A;  4DQP A;  4KFB A;  2IDO A;  2X6N A;  2G8I A;  2O4I A;  3PUF A;  4EZ9 A;  3NGY A;  1XI1 A;  3HPH A;  1LAW A;  2OPS A;  5HBM A;  4BWM A;  4Z4C A;  3SQ4 A;  4J2E A;  2F96 A;  1RT7 A;  3WNH A;  1NKE A;  3ZSZ A;  1S1U A;  2FBV A;  3LPT A;  5C24 A;  1HQE A;  4O44 A;  1S9G A;  2B4J A;  2HB5 A;  4DG1 A;  3SNN A;  4OPK A;  1J5O A;  4G1Q A;  4B8C A;  3SQ1 A;  4FJ9 A;  2G8U A;  1RNH A;  5SWM A;  3TAF A;  4KHW A;  4FW2 A;  3OYE A;  2P51 A;  4CJK A;  2X6S A;  1BIS A;  3PX6 A;  3NF7 A;  1KVA A;  4NCB A;  2G8W A;  4DTN A;  5J2P A;  3ZSY A;  4FLV A;  1NK9 A;  1CZ9 A;  1U04 A;  4ID1 A;  4CEC A;  3LP1 A;  3ZCM A;  4CF8 A;  4DWI A;  1S5J A;  2HHQ A;  4FK4 A;  4F3O A;  1JLA A;  4CES A;  1BL3 A;  2X74 A;  4EP4 A;  1VK0 A;  3K5O A;  5KTQ A;  2D0B A;  2VG6 A;  3QLH A;  3OYG A;  3QET A;  4JRQ A;  4B9N A;  1GOB A;  1WSJ A;  4QAG A;  5C25 A;  4CJT A;  5FRO A;  3C6U A;  4DTU A;  4Y1C A;  2KTQ A;  2YV0 X;  3L2U A;  4LSN A;  1S1W A;  3VQB A;  1RBV A;  4DTX A;  3ASM A;  1W9H A;  2Y1J A;  4DTP A;  4FLY A;  1EX4 A;  4J2A A;  4K8Z A;  4FM2 A;  4KHY A;  1JLQ A;  3AO2 A;  1SV5 A;  1KCF A;  4M41 A;  2IS3 A;  3D0P A;  1X9S A;  4J2B A;  2BE2 A;  4OKK A;  3IS9 A;  4FZX C;  3FFI A;  4Y1D A;  4OGC A;  2OZS A;  2F8T A;  3NH2 A;  2DTU A;  1J53 A;  5CYM A;  3CFP A;  3L2V A;  5C42 A;  1RT3 A;  4ELT A;  3V6D A;  4EZ6 A;  1RBT A;  3DLE A;  4YNQ A;  4F3T A;  1KVC A;  4KRF A;  1YT3 A;  3AV9 A;  4PQU A;  1WLJ A;  1HNI A;  4KHS A;  3LAL A;  3NDK A;  3NE6 A;  4KTW A;  3RMD A;  2ZD1 A;  4C8K A;  1TAQ A;  1TKZ A;  1TL3 A;  2YNH A;  3TAM A;  4ZTF A;  2Z1H A;  1ASW A;  2DFE A;  3VQ4 A;  2NUB A;  3ZSR A;  1RBR A;  1FKP A;  4FJI A;  3PX0 A;  1JL2 A; 
#chains in the Genus database with same CATH topology
 5H1S Q;  2W6K A;  4C8N A;  3VGL A;  1YJW N;  4ELU A;  1S9E A;  1HPZ A;  3E1Y A;  1JXE A;  4E7H A;  2GEL A;  2LSN A;  4KHN A;  1FJG K;  4NXM K;  3SK3 A;  4RW4 A;  3QO9 A;  1R59 O;  4Z0U A;  3K5L A;  4DTS A;  3K57 A;  4AHV A;  3O5B A;  3BF1 A;  4FLX A;  5AQF A;  4HCC A;  4A5B A;  5B8H A;  3K58 A;  4A2B A;  4CHO A;  3FZM A;  3RTV A;  3OA9 A;  4B9M A;  4CFD A;  4DR7 K;  4Z4I A;  4DSE A;  3B8A X;  4AF1 A;  3I0S A;  3QIN A;  3TAN A;  4LSL A;  4JHD B;  4L3Q A;  4DR3 K;  3JSM A;  2OPQ A;  4DF8 A;  3ZX0 A;  5KGW A;  4DFM A;  4JYA K;  1DT9 A;  1I94 K;  3QFU A;  2RPI A;  1NK5 A;  3SBT A;  3E9L A;  1VSK A;  2P9U A;  1O1W A;  4GW6 A;  3VA3 A;  3GDQ A;  3OYN A;  4JD2 B;  3G10 A;  4FL9 A;  2P9L A;  4WFN L;  2HNY A;  3KK1 A;  4X62 K;  3K59 A;  4JKC A;  1T6C A;  4FJL A;  3ZSX A;  5J2M A;  4B3R K;  2Z1G A;  2VWJ A;  3M8Q A;  4PA1 A;  4CW7 B;  1NJI O;  3SMP A;  3VF4 A;  3DYA A;  2JLE A;  4BR4 A;  5TKY A;  3NF6 A;  1VSI A;  4H0V B;  4F2R A;  5E26 A;  3EL2 A;  4KH6 A;  4CJR A;  3ENH A;  3A5M C;  3AO3 A;  3R1X A;  2QW9 A;  4K42 A;  2P9U B;  4E1N A;  3HPO A;  2NRW A;  2FBX A;  1W7A A;  1JL1 A;  1NGJ A;  2NRR A;  2KFN A;  1TYQ B;  1ZXO A;  2B6A A;  2F9W A;  2NNW A;  3FFK B;  4DFP A;  5KI6 A;  1C1A A;  5JVH L;  2VGM A;  1J9A A;  3G0Z A;  4WFA L;  2IAJ A;  4H0P A;  1DTT A;  1RT1 A;  3KKR A;  3ZET B;  3OYH A;  4AHC A;  1NKB A;  2YNF A;  4B9Q A;  1XHX A;  3J7Y P;  3R3L A;  4CJ7 A;  3O9Q A;  2AJQ A;  3AA5 X;  4DR4 K;  4JAX A;  1XNQ K;  3QB0 A;  3VQP A;  3HP9 A;  3VES A;  4BDY A;  4BRP A;  1KFS A;  2HNZ A;  3ULE B;  4M3R A;  3SAG A;  4GKJ K;  5AQS A;  1Z26 A;  3S3M A;  5HRR A;  2D0C A;  4DV2 K;  4PUO A;  3TSP A;  5KRT A;  3CM6 A;  2CGL A;  4CEE A;  4JKG B;  3SUN A;  1LWC A;  3NF8 A;  1VSJ A;  2O8D B;  4H0T B;  3SCX A;  3J7Z O;  3VTI A;  3MEE A;  1HYZ A;  3FLC O;  2QWM A;  2ASM A;  4BRM A;  4FLU A;  2GTD A;  3CCV N;  1C0G A;  4ICL A;  3LZJ A;  1QQO A;  1FK9 A;  1DGK N;  3OS0 A;  1WNS A;  4M7X A;  4AQY K;  3AVL A;  3OYM A;  4H5T A;  3J81 O;  3C6A A;  1XHZ A;  3FGU A;  4IO8 A;  3WNE A;  3A5O C;  4K43 A;  2YHX A;  3CCS N;  3L6Q A;  2HST A;  1KAX A;  3FZH A;  4KB0 A;  2X78 A;  3H6E A;  3S9H A;  1RDU A;  4CED A;  3TAE A;  2UXC K;  5AQY A;  1Q9Y A;  4H5W A;  3OS1 A;  1J54 A;  1BIU A;  1X9M A;  1EQY A;  3L4I A;  5BPN A;  5FRM A;  3NMU A;  1ZBL A;  4W5R A;  3O9S A;  1KQS M;  5AQH A;  1OKJ A;  5J1E A;  1OH6 A;  3RR8 A;  4L8R B;  3F9K A;  4JKE A;  5AFU A;  3SJJ A;  1F21 A;  3C6T A;  2QK9 A;  3OS2 A;  4KI6 A;  2KQ2 A;  3TAQ A;  4HCB A;  4YDU A;  1I3A A;  1YIJ N;  1JLF A;  5GIN A;  4M3U A;  1HNW K;  1WBD A;  3RWU A;  3LDN A;  3MWP A;  4KHP K;  3D2F B;  4FJK A;  3DRP A;  1QHA A;  4CEB A;  1KD1 O;  3PO4 A;  1KVB A;  5BPL A;  4CGG A;  1ITG A;  1WSF A;  5LY3 A;  1GLE G;  4M3X A;  4CD1 A;  1HR0 K;  3KK3 A;  1RDW X;  2WOM A;  4AH9 A;  1XMQ K;  4B1U B;  3SI6 A;  2FLO A;  2I5J A;  4CGD A;  3IRX A;  4E19 A;  1SL1 A;  4BDZ A;  1VQ6 N;  4C23 A;  3T7Z A;  3LDS A;  1WSH A;  4BRN A;  3DRS A;  2QWN A;  1LV5 A;  4E89 A;  4MFB A;  1TVR A;  2KHO A;  4CE9 A;  3RSE B;  3ZEU A;  4O4G A;  1NGH A;  3AVI A;  3RR7 A;  1DEJ A;  4ISF A;  5AZI B;  5JS1 A;  4PKG A;  2W41 A;  4WF9 L;  1EET A;  1SUQ A;  1TV6 A;  3OTO K;  5JS2 A;  1VSH A;  1S1X A;  3LL3 A;  1SKS A;  2QEX N;  5BR8 K;  4JKH A;  1TK8 A;  1SZ2 A;  3P4I A;  5AQO A;  4BG8 A;  3W3D A;  1NGB A;  4IDK A;  3V9S A;  1LW0 A;  3SZ2 A;  2DFF A;  5GAE P;  3F9M A;  4E7L A;  3TPQ A;  2P5G A;  4DU4 A;  4N56 A;  5BRE A;  3R6M A;  4ISG A;  3CCR N;  2Q2R A;  4KTQ A;  4GY2 B;  4X64 K;  4IOX A;  4CEZ A;  2VWK A;  4FVM A;  1BWF O;  1ZC6 A;  3VQ9 A;  3NF9 A;  3MXJ A;  5LJV A;  4QS7 A;  1QQM A;  2VQE K;  4CHN A;  5JVG L;  4DMN A;  1TKT A;  3AVG A;  2P9I A;  1B92 A;  3LPU A;  4FWP A;  4H4M A;  3C95 A;  2V52 B;  4MLE A;  1VSL A;  4HUE A;  4LF5 K;  3M1F A;  2IVO A;  2E4L A;  3U3Y A;  1ZYQ A;  3HSC A;  3R8E A;  4EZ9 A;  1XI1 A;  1GLF O;  4BG9 A;  5HBM A;  4O8K A;  4B1W B;  1S9G A;  4FJ9 A;  4G1Q A;  1NM1 A;  2G8U A;  3SAF A;  4FW2 A;  4CJK A;  3MN5 A;  1KVA A;  4B1V A;  1NK9 A;  1CZ9 A;  3LP1 A;  3A5N C;  1XQS C;  2HHQ A;  1S5J A;  5M1N A;  4CES A;  1BL3 A;  3IMX A;  4JRQ A;  5F1X A;  3DLL L;  4DTU A;  5C15 A;  4YHH K;  3L4Q A;  4JEP A;  3VQB A;  1YXQ A;  3ASM A;  4DTX A;  4C1N K;  3KWG A;  5KPR A;  4DTP A;  1EX4 A;  1NWK A;  3QML A;  5BRD A;  4M41 A;  3UKR B;  1Q7Y O;  2QA4 N;  3IS9 A;  4Y1D A;  5HL7 L;  4BQL A;  2OZS A;  3D2E A;  2DTU A;  1S22 A;  4JHD A;  5CHI A;  5C42 A;  1RT3 A;  1YAG A;  4PKH A;  3DLE A;  4KRF A;  3P39 A;  4JI8 K;  4FWR A;  1TAQ A;  4ZTF A;  1ASW A;  2NUB A;  3LM2 A;  3ZSR A;  3G71 N;  1FKP A;  1XMO K;  3THY B;  1N6Q A;  5D3G A;  4DHY A;  3SAH A;  3BEX A;  4I9L A;  2I7P A;  3C7N A;  2R7Y A;  1VQO N;  1KFD A;  3HBT A;  4H03 B;  4E3S A;  3QEW A;  4N47 A;  1JCG A;  3CD6 N;  2DPN A;  3HTV A;  1V4T A;  3OYD A;  3VQ8 A;  1BA1 A;  1X9J A;  1ZBU A;  4AHS A;  3P83 D;  2ZWH A;  3DLG A;  1GOC A;  4FLZ A;  3S3N A;  4Z4F A;  3O80 A;  1C6V A;  1ZBH A;  3FZK A;  4MO5 A;  3LAN A;  1J6Z A;  4W5O A;  1JLB A;  1BQN A;  4B3O A;  5GIO A;  5BN9 A;  3AVN A;  3THW A;  4CZF A;  4QCL A;  4DTO A;  3HYF A;  4IWV A;  4CBW A;  1QSS A;  4LFA K;  2DY4 A;  3SPY A;  3ZET A;  2ZQB A;  3PX4 A;  2PY5 A;  2QWP A;  1WSI A;  3M5R A;  3WQT A;  1OH7 A;  3NH1 A;  3AY9 A;  1RTD A;  3OYL A;  3C0B A;  4KHU A;  2YNI A;  2J4R A;  2O4G A;  4BRL A;  3KZB A;  4A61 A;  5BPM A;  3UIQ A;  2KFZ A;  3OYA A;  1Q81 O;  4BR0 A;  3DXM B;  1C1B A;  4KKO A;  4Y0W A;  1A5V A;  5AQU A;  1EKE A;  4CZL A;  1RIL A;  3O9R A;  3SJH A;  1RDC A;  4RW7 A;  5A2Q O;  1LWE A;  5KRS A;  4HUG A;  2E2N A;  3KLF A;  3IKM A;  2ZGZ A;  3DAW A;  3F73 A;  4MQ3 A;  1WBB A;  3THY A;  1KAZ A;  1IV0 A;  4LH4 A;  1E4G T;  4CK3 A;  3FR0 A;  4W5Q A;  3QEX A;  4LF8 K;  3NBP A;  4FWS A;  1DTQ A;  4B1Y B;  1UA1 A;  1K9M O;  2Q1N A;  4NYN A;  1KLN A;  3TTC A;  4KHQ A;  2HHS A;  1KC8 O;  4IFV A;  1QS4 A;  3V4I A;  4E7K A;  2OTL N;  4ZHR A;  1CXQ A;  2Q0U A;  5M1Q A;  3NGZ A;  3MED A;  4Z4G A;  4KO0 A;  3VET A;  4KRE A;  1N32 K;  3WXL A;  3SV4 A;  1DKG D;  3BF3 A;  4CEF A;  3HP6 A;  3T3F A;  3FE1 A;  4DV1 K;  4DV7 K;  4DSJ A;  1EWQ A;  4OKJ A;  4CIG A;  3EKU A;  5HRO A;  4DSK A;  3MX5 A;  4K0K K;  2VCP A;  2OTJ N;  2BTF A;  2GUI A;  2GX9 A;  4BGB A;  2G8H A;  4PHT X;  2BAN A;  3DOK A;  2NRX A;  1D8Y A;  4FSV A;  4CJW A;  3PLA A;  4HUF A;  1L5U A;  1EXQ A;  1IO2 A;  3QFP A;  1S6Q A;  2YHA A;  2XY5 A;  1VQM N;  1ASV A;  3VEY A;  3WQU A;  1RTI A;  3SMS A;  3MDQ A;  4LFB K;  4CHY A;  5HLF A;  4FYD A;  1C1C A;  3MEG A;  3ULD A;  4FLW A;  3PY8 A;  4DFJ A;  4JI4 K;  5HP1 A;  2E8A A;  3O8M A;  4DB3 A;  2A3Z A;  2FBY A;  5M1K A;  2V51 B;  2O8F A;  5BR9 A;  4W5N A;  4BRE A;  5J2Q A;  2O8C A;  2HBM A;  2XO7 A;  2YNG A;  3KLE A;  3P1G A;  3TAB A;  4JN4 A;  4NO7 A;  1VQ7 N;  2YI1 A;  4FJ5 A;  2V7Y A;  3ID8 A;  3SLC A;  2EX3 A;  4C1N I;  5HRS A;  4CI6 A;  3DM2 A;  4DSI A;  1ASU A;  3OY9 A;  2YHW A;  4NB4 A;  1A5X A;  1R0A A;  1QSY A;  2WTU A;  3PIP L;  1T44 A;  3VEW A;  3K9K A;  5I3U A;  4UY8 O;  1HQU A;  1U2V B;  2QWR A;  3KLI A;  3GG4 A;  4FCY A;  1V4S A;  1NGI A;  2XHB A;  2ATQ A;  3U8X A;  2A5X A;  1NG9 A;  4B3M K;  1A5W A;  1NGC A;  2E6M A;  1BI4 A;  3H1Q A;  4FXD A;  3HO1 A;  5AQG A;  1W0H A;  4CGF A;  3QEV A;  1NK0 A;  4CJ4 A;  1LW2 A;  5CY4 A;  3KHY A;  4JI3 K;  4FM0 A;  2BGG A;  3CYM A;  3HL8 A;  4YOV A;  4FJ7 A;  2HHX A;  4DTR A;  1S1T A;  1VSM A;  3O1W A;  4BGA A;  1NJZ A;  2W40 A;  4DR6 K;  1VSF A;  4JLH A;  4JS4 A;  4A59 A;  1EP4 A;  2Q97 A;  3AVF A;  3CET A;  3TR8 A;  4EHT A;  3N4P A;  1QVF M;  3CQY A;  1WAF A;  2UXB K;  3U3G A;  4GMJ B;  4M3W A;  3VF2 A;  3LDQ A;  2KKZ A;  3I56 N;  2D0O A;  3HST B;  4JD2 A;  3CXC M;  3KIO A;  4I2Q A;  4BAC A;  4CBU A;  4CF1 A;  4XIU A;  1M90 O;  3EN9 A;  2Q0R A;  1T7P A;  1HYS A;  1K8K A;  4CCH A;  2Z1I A;  1WN7 A;  3ZT4 A;  3THW B;  3UE5 A;  2O8C B;  3TU5 A;  3MEC A;  3V9U A;  4OO1 J;  5CYQ A;  3K0S A;  4LF7 K;  2KLA A;  3THX A;  5E84 A;  1E3M A;  3CC7 N;  3HZ6 A;  4IBN A;  5AQJ A;  3CCQ N;  3WXM B;  4FOE A;  4FWQ A;  4DU3 A;  3VQ5 A;  1VQ4 N;  4CHZ A;  1I39 A;  2IC3 A;  1NKC A;  4JKA A;  4LFC K;  1ZBI A;  4JK9 A;  2HMI A;  1ZBF A;  4ILG B;  4DTM A;  3BDP A;  4IG0 A;  4FK0 A;  3S41 A;  2YJE A;  2ZJQ L;  3AO1 A;  3L3V A;  3ZSW A;  3DRR A;  4E1J A;  4B9U A;  3HVT A;  3SUP A;  1SKR A;  3M3Z A;  1KAY A;  4MDB A;  2ZJP L;  3DMJ A;  1RTH A;  4BRF A;  3G4S N;  5IWA K;  4CZJ A;  1MA9 B;  1REV A;  3AGR A;  4JNE A;  5AFU H;  4JK8 A;  4BRG A;  1QZ5 A;  1FW6 A;  3TAR A;  4CEQ A;  1NU0 A;  4B9L A;  2CH6 A;  5BRH A;  3AA2 A;  4M45 A;  3WXK A;  4BRI A;  3QER A;  4HWI A;  3OYI A;  3N4Q A;  5AQK A;  4OVL A;  3AAQ A;  3EKS A;  4FW1 A;  3AVA A;  4DR1 K;  4BRH A;  4OKE A;  1U45 A;  3ZLJ A;  1RGI A;  2XY7 A;  5K14 A;  1M1K O;  3HM9 A;  4F4K A;  5BN8 A;  4B1X B;  4LF6 K;  2YCH A;  3PV8 A;  5AQX A;  3AAP A;  4KFB A;  2IDO A;  3A8Y A;  2O4I A;  5KQ8 A;  1HNX K;  2E5L K;  5LJW A;  3ZSZ A;  3LPT A;  4O44 A;  3SNN A;  1J5O A;  4OPK A;  2HHH K;  3LDL A;  3TAF A;  2QI2 A;  3P31 A;  3OYE A;  2X6S A;  4K41 A;  4YDU C;  4BY9 C;  3ZSY A;  2AP1 A;  4ID1 A;  4CEC A;  2OAN A;  3TSQ A;  3ZCM A;  4CF8 A;  4BR5 A;  1VK0 A;  2VG6 A;  3QLH A;  3QET A;  1YJN N;  1GLL O;  5JMV A;  3C6U A;  4Y1C A;  3VGK A;  5DM6 L;  5EOY A;  1S1W A;  3ZX2 A;  4FM2 A;  4B3S K;  2NRZ A;  3AO2 A;  4DUY K;  1X9S A;  1JCF A;  2FF6 A;  3FFI A;  3IDH A;  3L0Q A;  1Y64 A;  1J53 A;  4PKI A;  1VQ5 N;  5FPD A;  1MWK A;  2NRV A;  5JLH A;  3V6D A;  3P38 A;  1KVC A;  4QS9 A;  4F3T A;  1YT3 A;  4PQU A;  4IJN A;  5AZI A;  1HNI A;  4KHS A;  3NE6 A;  5CR4 A;  3OW2 M;  1TKZ A;  1TL3 A;  4BRO A;  2Z1H A;  3O4W A;  1YJ9 N;  2P9P A;  4FJI A;  3H46 O;  3QIP A;  1QHT A;  3CC4 N;  3GE1 A;  3VEO A;  3QEP A;  3CJC A;  2YHY A;  5TKW A;  3CCM N;  4J8F A;  1BOT O;  1TL1 A;  1TKX A;  4F8R A;  3ISN C;  2A1R A;  4M3Y A;  3D6R A;  1HJR A;  3V9X A;  3QBX A;  1BO5 O;  4FJG A;  4DQ8 A;  4JKF A;  3DLK A;  4FPB A;  4IEE A;  4WQ5 C;  4CGI A;  3W0L A;  3CCE N;  4WYB A;  2F7T A;  4Z94 A;  1NOY A;  2A42 A;  3IG1 A;  1Z25 A;  2Z1J A;  3EZW A;  3C65 A;  1OVQ A;  1QQC A;  3DLH A;  4KB1 A;  4FJN A;  2BUP A;  2A6A A;  2G8F A;  2D0A A;  4WQ5 A;  1ILY A;  5FLX O;  4BVO A;  3AO4 A;  1JJ2 M;  4O55 A;  3IUC A;  1IH7 A;  4RW9 A;  4C8M A;  2E2P A;  3ID6 A;  3ZSV A;  3KK7 A;  1GLD G;  4JI6 K;  1VRU A;  1Z05 A;  3LZI A;  3GOI A;  1GLC G;  2FSK A;  3V1R A;  1U49 A;  4MO4 A;  3KKS A;  1UOC A;  5DK5 A;  3K5N A;  4FK2 A;  1KSP A;  3RRH A;  1ATR A;  3OBW A;  4PL7 A;  2JWK A;  2YHB A;  1BHL A;  5EY4 A;  2QM1 A;  3UKU B;  2H3G X;  3ZSO A;  3SQ2 A;  3DXM A;  2B5J A;  4LH5 A;  4LC9 B;  4IOA L;  3L2Q A;  4CFB A;  1HMV A;  1CXU A;  2YX6 A;  2UUA K;  2HF3 A;  4NCG A;  3TAP A;  1WOQ A;  4BC4 A;  4LF9 K;  2ZGY A;  1VQ8 N;  4PY5 A;  4I7F A;  4ISE A;  4NCA A;  4BQZ A;  1NJX A;  4CIE A;  3V9W A;  4BRD A;  3T1H K;  2CGJ A;  3V1Q A;  4IKF A;  1ESV A;  5EXW A;  3NHG A;  4CZI A;  4KTZ A;  4YOR A;  3ZYY X;  1NMD A;  4DQQ A;  3AVH A;  2P9L B;  3JYT A;  2PZS A;  1RDD A;  3BGR A;  1YTU A;  1VRT A;  1IG8 A;  3UKU A;  2G8V A;  3EZ5 A;  1WSG A;  2HVH A;  4OX9 K;  5M1O A;  2HBJ A;  3AA4 A;  4M3T A;  1JCE A;  2HW3 A;  3BP8 A;  3RMA A;  2A41 A;  1C0T A;  3TTD A;  4DS5 A;  3U9Z A;  3O1B A;  3LAK A;  2WUS A;  2EHG A;  3SYZ A;  3HK2 A;  4QS8 A;  3O08 A;  2V7Z A;  4WCE L;  4FWO A;  1JXB A;  3ULE A;  2P1J A;  1YVN A;  1JKH A;  1JLE A;  4CJP A;  4ILJ A;  1NBW A;  1WSE A;  3BUZ B;  3MXM A;  3CJB A;  2RN2 A;  1VQK N;  4LY7 A;  1SQK A;  1E4F T;  3D45 A;  3KLG A;  4B8A B;  4ZTJ A;  4FLT A;  3VQE A;  1X3M A;  5EVZ A;  3HI0 A;  3MN9 A;  3E9O A;  4MDA A;  1Q86 O;  3PO5 A;  4IFE A;  3DI6 A;  1IKW A;  3HOT A;  1EO1 A;  3HVR A;  3O4N A;  2D5R A;  4BC5 A;  3HJF A;  3VOV A;  3NH0 A;  2ZE2 A;  4BE2 A;  3ATU A;  4LD0 A;  2P9K A;  4DTJ A;  2JWL A;  1Z6R A;  1U47 A;  3AVJ A;  2WBN A;  2GV9 A;  1DLO A;  2ZF5 O;  1Q9X A;  5AQN A;  1HJO A;  4TSX A;  4C8L A;  4I6M A;  3H3O B;  1JLG A;  1HYV A;  4CIF A;  5GAD P;  4E7I A;  3B6P A;  3Q7C A;  3CFO A;  4BE1 A;  4O0I A;  2ASO A;  4O5F A;  5DMR A;  4CFA A;  3OBY A;  3WXJ A;  1RBU A;  1TK0 A;  4CZG A;  4DQS A;  1B9F A;  5HOO A;  2GWK A;  4XEI A;  4AHU A;  3T69 A;  3IFR A;  1S3X A;  3TAG A;  4DS4 A;  3LDO A;  3VQ6 A;  5AZJ B;  1NGD A;  4CF2 A;  2HBK A;  4FJX A;  5E41 A;  3GBT A;  4V19 S;  5F2R A;  2E2Q A;  1NOZ A;  3C94 A;  5EX5 A;  2CH5 A;  4JI0 K;  1K8K B;  2EWS A;  4X65 K;  2A1S A;  4BWJ A;  2P9S B;  4RG8 A;  3QNN A;  5GAH P;  1RT4 A;  4KV8 A;  4GVE A;  4YFU A;  1RT6 A;  3Q7B A;  4NLC A;  3MN6 A;  3OYC A;  4CEA A;  2QWL A;  4JKD A;  3AVM A;  3THX B;  3SQ0 A;  3T1A A;  1Q8I A;  4R5P A;  3WEE A;  3F2K A;  2XY8 A;  1VSD A;  2HHT A;  4YOU A;  1X1P A;  4DV3 K;  1L3V A;  1IJJ A;  2GWJ A;  3DXK A;  3QIC A;  4GKK K;  3QBW A;  1FKO A;  3VEZ A;  2UXD K;  1GOA A;  4IG3 A;  4BE0 A;  4WE1 A;  3VQQ A;  4JV5 K;  3I33 A;  1C0M A;  2P9N A;  4FO0 A;  3QES A;  3OVN A;  3AO5 A;  3LWM A;  4CJ3 A;  4FWM A;  4XH5 A;  3CC2 N;  1BUP A;  1QVG M;  1IKY A;  1IBK K;  3TI0 A;  5CE3 A;  2KW4 A;  2E1Y A;  2FSN A;  3MXI A;  3VQ7 A;  2QXL A;  3KWI A;  2P9K B;  4BDP A;  2O8B B;  3AAR A;  2IIR A;  4FJH A;  1MDU B;  3O9T A;  4DV5 K;  1RT5 A;  1KRP A;  4CJE A;  3JS6 A;  2E6L A;  4OPA A;  3NFA A;  1Q82 O;  5AJ3 K;  1LOT B;  3A5L C;  4J2D A;  4NYF A;  3HPG A;  1VSE A;  3D2F A;  1C0F A;  3QEI A;  3KJV A;  3WXI A;  4DU1 A;  5ADX A;  3P5J A;  4JI7 K;  2KZM A;  4OLA A;  1BCM A;  4B9T A;  5KGX A;  1NLV A;  3OYK A;  1XC9 A;  1NMN A;  1SS6 A;  3E66 A;  5C2F A;  3CM5 A;  4KAZ A;  3ALY A;  2CGK A;  3L3U A;  2ITM A;  1P8Z A;  2XY6 A;  1TYQ A;  2PYJ A;  5IT9 O;  4CJF A;  2F8S A;  4CVN E;  1TUY A;  4BR7 A;  4IO9 L;  3CQX A;  3MX2 A;  1T03 A;  5FRN A;  4OPJ A;  3RVC A;  1RDA A;  2RHK A;  5LL6 Z;  4YOW A;  1G15 A;  1L3T A;  3HXM A;  4FJJ A;  5AQV A;  3V81 A;  2IGI A;  1LAV A;  5CZ1 A;  4UQG A;  1D5A A;  2W42 A;  4M3Z A;  4XH4 A;  2PFU A;  1NK6 A;  4B08 A;  1RT2 A;  4CFC A;  2FBT A;  1MU2 A;  3K9J A;  1OH8 A;  5HRN A;  4WQ4 C;  3WNG A;  1XUP O;  3M8R A;  3L2W A;  2GUP A;  1L3U A;  2FC0 A;  3ZT2 A;  3CJ7 A;  3EEQ A;  1KTQ A;  1HKC A;  3T19 A;  3O3F A;  3O6W A;  4U67 L;  3LWL A;  1FXX A;  3JAM O;  2IVP A;  2O8D A;  1ATN A;  4JRP A;  3AVC A;  3CPW M;  1XWL A;  3NCI A;  4HVJ A;  3VF6 A;  4CJQ A;  3HM8 A;  4OJR A;  3AGK A;  1UAX A;  4DR2 K;  1U2V A;  4N41 A;  2QKK A;  2BDP A;  2QWQ A;  4OGE A;  3G6E N;  4BRC A;  1K6Y A;  3I0R A;  1NJY A;  5JLF A;  4FJM A;  1QTM A;  4OLB A;  2OPP A;  1S72 N;  4DFK A;  1BI4 B;  3WNF A;  4DQP A;  4B1Z A;  2I7N A;  2G8I A;  4DCH A;  1W97 L;  1N8R O;  1LAW A;  2OPS A;  4YOX A;  3ATV A;  1RT7 A;  3WNH A;  1NKE A;  2FBV A;  5C24 A;  1W2B M;  2HB5 A;  4RTF D;  3E9P A;  4B8C A;  3SQ1 A;  5SWM A;  4KHW A;  3I55 N;  1SAZ A;  3NF7 A;  3PIO L;  4DTN A;  5J2P A;  3U4L A;  2G8W A;  4CZK A;  1J5E K;  3MMV A;  4EP4 A;  4FOI A;  5KTQ A;  5AQP A;  2D0B A;  4AM7 A;  4YOY A;  4B9N A;  1WSJ A;  2HOE A;  4QAG A;  4CJT A;  4CZE A;  2KTQ A;  3L2U A;  5DM7 L;  1W9H A;  3MK6 A;  4RWT A;  1OH5 A;  3HOS A;  1VQN N;  4F9O A;  4J2A A;  1JLQ A;  1KCF A;  2IS3 A;  3D0P A;  4J2B A;  3VGM A;  2Q31 A;  5C0Y A;  2F8T A;  5CYM A;  4WFB L;  4ELT A;  3VEV A;  1N36 K;  4EZ6 A;  4H0Y B;  1G99 A;  1IBM K;  4IJA A;  5KPZ A;  1NGG A;  3LAL A;  3RMD A;  3CJ9 A;  2ZD1 A;  3TAM A;  2YNH A;  3ENB A;  2DFE A;  1RBR A;  1JL2 A;  2HMP A;  2O8E B;  3RMC A;  4CJ5 A;  4FZZ A;  3IAY A;  4CGH A;  1SKW A;  4IZ9 A;  5KQD A;  3ZX3 A;  1T05 A;  2QWO A;  1WAJ A;  4CJL A;  2ITG A;  3LAM A;  4NLB A;  1RTJ A;  3RRG A;  4DLG A;  3S3O A;  4H5N A;  5AQT A;  5AQQ A;  4QOZ B;  5FPN A;  3NAE A;  3SUQ A;  2Q3S A;  4FWK A;  3I8B A;  1IKX A;  1UA0 A;  2HHU A;  5LMN K;  4GNI A;  4CER A;  1LCU A;  4H5V A;  3ZT1 A;  4KI4 A;  4H5R A;  4CF0 A;  3VPZ A;  4PWD A;  3M6G A;  4CGJ A;  4BC3 A;  4FWL A;  4F2S A;  4C8O A;  3OJS A;  2OCE A;  3EE8 A;  3DXK B;  1TK5 A;  2OYQ A;  2W6L A;  4ELV A;  4RCH A;  2A40 A;  1BG3 A;  4CK1 A;  2ZJR L;  3VER A;  4DV0 K;  4X66 K;  1X9W A;  4BC2 A;  1RDB A;  4FJ8 A;  3SV3 A;  1Q18 A;  1CZB A;  4DV4 K;  1IKV A;  4JKB A;  1L3S A;  4AHT A;  3ENO A;  1NGF A;  3I8D A;  3CME N;  1HUX A;  5F0X A;  2RKI A;  2UYT A;  3CCU N;  4EIA A;  4DV6 K;  1BDG A;  3CMA N;  3BZK A;  5BRF A;  3KTQ A;  1EWR A;  3CER A;  1VQL N;  5SZT A;  4W5T A;  1YIT N;  1HLU A;  3D7E O;  1NGE A;  1BCO A;  3VN5 A;  3NGI A;  1TKD A;  4DSL A;  1N33 K;  2OA8 A;  3KK2 A;  4CEO A;  3SUO A;  5FPM A;  3OYJ A;  2YJF A;  3ZT3 A;  3SPZ A;  5GAG P;  2DFH A;  3ITH A;  1BU6 O;  2E2O A;  3A0I X;  5I42 A;  3VEX A;  5GIP A;  4R79 A;  3KVG A;  4H4O A;  4Z4E A;  1K8A O;  4ID5 A;  4JI1 K;  2ZM6 K;  1JLC A;  4YOT A;  1IG9 A;  3VA0 A;  1T3V A;  2D4W A;  1YF5 L;  3CJA A;  1U48 A;  1D9D A;  3AA3 A;  1B9D A;  4NXN K;  5C2D A;  3U6F A;  3DLR A;  1CLQ A;  4DKW A;  1N34 K;  4LF4 K;  2E88 A;  1XNR K;  2HHW A;  3RMB A;  3CI5 A;  3VMF B;  1HKG A;  4CHP A;  2O8B A;  5AQZ A;  4CJV A;  1GLB G;  2QKB A;  4CJU A;  4DSF A;  3MAQ A;  2ASP A;  1NJW A;  2NZT A;  4IEI A;  5J2N A;  1BGX T;  2UUC K;  4BR9 A;  4GV6 A;  2HHV A;  5AQI A;  4YY3 K;  4U7B A;  2PBD A;  3HT3 A;  4DR5 K;  2O8F B;  3LM9 A;  2PYL A;  3UKR A;  4KH5 A;  2WC9 A;  3DWL A;  2VG5 A;  3V1O A;  2QTD A;  4N5S A;  4Q5V A;  4DQR A;  1U4B A;  1VQ9 N;  3VQA A;  3ZEU B;  1D9F A;  1HNZ K;  3OYF A;  4A62 A;  4CHQ A;  1TUU A;  3DLB A;  4FZY A;  2WON A;  3K2P A;  2P9N B;  1RCH A;  5ADX H;  4G9Z A;  3VQC A;  1QSL A;  3MCP A;  3ZT0 A;  3BY5 A;  1QZ6 A;  4O8U A;  3M8S A;  4EHU A;  3KD5 E;  1BIZ A;  3TTF A;  4PL8 A;  1BQM A;  3A2F A;  4IFY A;  4OPH A;  2YKM A;  5AQR A;  3AVK A;  3TSU A;  3PSI A;  4DQI A;  4MLH A;  1OVY A;  5C12 A;  3M8P A;  4DUZ K;  3VQD A;  1Y97 A;  2P9P B;  2E20 A;  4Q0B A;  4CD3 A;  2Y1I A;  3L8B A;  1U6Z A;  4A5A A;  3FZF A;  4E7J A;  3GL1 A;  4M63 C;  2OZM A;  3ZSQ A;  4K25 A;  4JS5 A;  3PSF A;  5LMU K;  2F9T A;  3UB5 A;  5I9E B;  4N76 A;  2D0P A;  3AVB A;  1WUA A;  4GV9 A;  3O3G A;  2XRI A;  4JK7 A;  4BRK A;  1HNV A;  2IOC A;  3H45 C;  3J80 O;  3R9P A;  3E01 A;  3LP2 A;  2NLX A;  3B6O A;  2HF4 A;  3EO3 A;  3L2R A;  3EE9 A;  3DOL A;  2JGU A;  2IVN A;  3DJC A;  4HTU A;  4AIL C;  2NRT A;  5HRP A;  5T7B A;  4E0D A;  1LWF A;  3THV A;  1KXP A;  1UWB A;  5AQL A;  2HBL A;  3JXU A;  3CF5 L;  3KD1 E;  3VEN A;  3LP3 A;  1GLJ O;  3OHR A;  3MWT A;  3OJU A;  4BRA A;  2VGN A;  2ETJ A;  2Q36 A;  4EFH A;  4BVP A;  1YHQ N;  2HND A;  4BRQ A;  4HHT A;  1BA0 A;  4Z4H A;  4CBX A;  2D1K A;  1QE1 A;  4RW6 A;  1TGO A;  4E1M A;  4EAH D;  3TWH A;  1SL2 A;  4B9V A;  4GVM A;  5AQW A;  4CF9 A;  4ILH A;  2VWB A;  4M7Y A;  3EY1 A;  4IOC L;  1T6D A;  3FZL A;  3H3N O;  2P5O A;  2RF2 A;  1YUW A;  1KLM A;  4AHR A;  3O3H A;  5M1P A;  2UUB K;  4KH4 A;  3T1Y K;  1NK8 A;  2HVI A;  3SBG A;  3QNO A;  2AA4 A;  4JI2 K;  1C0U A;  3QIO A;  4EP5 A;  5EU7 A;  1YTA A;  3NVK A;  4CK2 A;  5CZ2 A;  2FF3 B;  3G25 A;  4FPA A;  4WQ4 A;  4JKG A;  4B3T K;  1QQN A;  5FPE A;  1NNE A;  2YKN A;  1S6P A;  3CHW A;  4FM1 A;  3O4Q A;  4I2P A;  3WEE B;  1ATS A;  4DLE A;  1D4X A;  4FVU A;  1N5Y A;  1K73 O;  4I9Q A;  1WB9 A;  3O9U A;  4IXC A;  4K8X A;  3KLH A;  4I6M B;  5FDL A;  3K5M A;  3CCJ N;  1YI2 N;  4O0J A;  3LDP A;  3J8A A;  5AZJ A;  3VTH A;  2F4V K;  1NK4 A;  5C10 A;  3OYB A;  3NVM A;  4B9S A;  1ZBS A;  1IBL K;  2BH1 A;  3V9Z A;  2RE2 A;  4CZM A;  2QXF A;  4DF4 A;  4RW8 A;  3CFR A;  3C7N B;  3CIP A;  1HKB A;  2P9S A;  5MLC Q;  4CJS A;  3CJ1 A;  5AQM A;  4H0X B;  1VHX A;  2G8K A;  1CZA N;  4A2A A;  1YVU A;  1RFQ A;  3CG7 A;  4HTL A;  2FSJ A;  3EYZ A;  5M1F A;  1HPM A;  3D2E B;  3J7A P;  1TAU A;  4M42 A;  2OPR A;  1SL0 A;  1NK7 A;  2GBZ A;  1T8E A;  3H08 A;  4KPY A;  1HX1 A;  3WUH A;  4A57 A;  4KBO A;  1NGA A;  1H1V A;  2GEM A;  4O5B A;  2VG7 A;  1RBS A;  3LP0 A;  1HRH A;  2P9I B;  1S1V A;  1MWM A;  3HRG A;  3H1V X;  4H8K A;  2X6N A;  3PUF A;  3CPE A;  1P90 A;  3NGY A;  2VQF K;  3HPH A;  4BWM A;  4J2E A;  3SQ4 A;  4Z4C A;  2O8E A;  2F96 A;  2KZZ A;  1S1U A;  3CQ8 A;  1HQE A;  4DG1 A;  2B4J A;  5KPT A;  4XH1 A;  1GLA G;  1RNH A;  1VQP N;  2WFB A;  2P51 A;  4H0O A;  3PX6 A;  1BIS A;  4NCB A;  4FLV A;  1U04 A;  2E1Z A;  4JI5 K;  4DWI A;  4FK4 A;  4F3O A;  1JLA A;  2X74 A;  3MCA B;  3K5O A;  4AM6 A;  4CZH A;  3OYG A;  1GOB A;  5C25 A;  5JIC A;  5FRO A;  1X3N A;  2YV0 X;  4LSN A;  4GV3 A;  1RBV A;  1VAZ A;  2Y1J A;  3F5T A;  2PAV A;  4FLY A;  4K8Z A;  4KHY A;  3RSE A;  1SV5 A;  1XC3 A;  2FXU A;  2BE2 A;  4OKK A;  5AR0 A;  4FZX C;  5ELZ A;  4OGC A;  2VYP A;  1O13 A;  3NH2 A;  4FWN A;  3WT0 A;  3CFP A;  2UU9 K;  3L2V A;  3MN7 A;  1RBT A;  3C6H A;  4YNQ A;  3QDK A;  3AV9 A;  1WLJ A;  3NDK A;  4C8K A;  3CCL N;  4IDH A;  3U9D A;  4BR2 A;  3VQ4 A;  3BZC A;  4KTW A;  2NRH A;  3PX0 A; 
#chains in the Genus database with same CATH homology
 3QIP A;  1N6Q A;  5D3G A;  1QHT A;  4I9L A;  4C8N A;  3QEP A;  3RMC A;  4CJ5 A;  4ELU A;  4FZZ A;  3IAY A;  1TL1 A;  1TKX A;  4CGH A;  1S9E A;  3ISN C;  2R7Y A;  1KFD A;  2A1R A;  1SKW A;  1HJR A;  4E3S A;  3V9X A;  3QEW A;  1T05 A;  4M3Y A;  4N47 A;  1WAJ A;  4CJL A;  1HPZ A;  2ITG A;  3LAM A;  3CQ8 A;  4FJG A;  1RTJ A;  3DLK A;  3RRG A;  1JXE A;  4CGI A;  4DLG A;  4E7H A;  3S3O A;  2LSN A;  4KHN A;  4QOZ B;  3OYD A;  3NAE A;  3VQ8 A;  4RW4 A;  3SUQ A;  3QO9 A;  4Z0U A;  3K5L A;  1NOY A;  4DTS A;  3IG1 A;  1Z25 A;  1ZBU A;  2Z1J A;  4AHS A;  2Q3S A;  4AHV A;  3K57 A;  1IKX A;  1UA0 A;  1QQC A;  3DLH A;  2HHU A;  4KB1 A;  4FJN A;  3P83 D;  4FLX A;  4CER A;  3DLG A;  4KI4 A;  1GOC A;  3ZT1 A;  4FLZ A;  2G8F A;  4CF0 A;  4HCC A;  4PWD A;  2D0A A;  3S3N A;  4CGJ A;  4Z4F A;  3AO4 A;  4F2S A;  4C8O A;  3K58 A;  4O55 A;  4CHO A;  1IH7 A;  1C6V A;  3RTV A;  4RW9 A;  4C8M A;  4CFD A;  4B9M A;  1ZBH A;  3ZSV A;  3OJS A;  4Z4I A;  1TK5 A;  4DSE A;  2OYQ A;  3LAN A;  1VRU A;  4ELV A;  3LZI A;  4W5O A;  1JLB A;  1BQN A;  3I0S A;  4B3O A;  3QIN A;  3TAN A;  4CK1 A;  4LSL A;  3V1R A;  1U49 A;  3AVN A;  3JSM A;  3KKS A;  1UOC A;  5DK5 A;  3HYF A;  3K5N A;  2OPQ A;  4DTO A;  1X9W A;  1QSS A;  1KSP A;  4FK2 A;  3SPY A;  3RRH A;  4DF8 A;  2ZQB A;  3PX4 A;  1RDB A;  5KGW A;  4DFM A;  2PY5 A;  4FJ8 A;  2YHB A;  1WSI A;  1BHL A;  1NK5 A;  2RPI A;  3SV3 A;  3NH1 A;  1CZB A;  1RTD A;  3OYL A;  1VSK A;  3ZSO A;  4KHU A;  1O1W A;  2YNI A;  4GW6 A;  2O4G A;  3VA3 A;  3SQ2 A;  2B5J A;  3OYN A;  1IKV A;  4LH5 A;  1L3S A;  3G10 A;  4AHT A;  3UIQ A;  2HNY A;  3I8D A;  2KFZ A;  3KK1 A;  3L2Q A;  4CFB A;  2RKI A;  3K59 A;  3OYA A;  4FJL A;  1HMV A;  1CXU A;  3ZSX A;  1C1B A;  5J2M A;  4KKO A;  2Z1G A;  3KTQ A;  4NCG A;  2VWJ A;  3TAP A;  1A5V A;  3M8Q A;  4PA1 A;  5SZT A;  4W5T A;  1EKE A;  4PY5 A;  4I7F A;  4NCA A;  1NJX A;  1BCO A;  4CIE A;  3V9W A;  3VN5 A;  1RIL A;  3NGI A;  1TKD A;  3DYA A;  1RDC A;  2JLE A;  4RW7 A;  3V1Q A;  4DSL A;  4IKF A;  2OA8 A;  3NF6 A;  1LWE A;  4CEO A;  5KRS A;  1VSI A;  3KK2 A;  3NHG A;  4HUG A;  3SUO A;  4F2R A;  3KLF A;  3OYJ A;  4KTZ A;  3ZT3 A;  3SPZ A;  3F73 A;  4DQQ A;  3AVH A;  4CJR A;  3JYT A;  2PZS A;  4MQ3 A;  3AO3 A;  2DFH A;  3ITH A;  1RDD A;  3BGR A;  1YTU A;  5I42 A;  1VRT A;  4LH4 A;  3HPO A;  4E1N A;  2G8V A;  3EZ5 A;  1WSG A;  4CK3 A;  2HVH A;  4H4O A;  2FBX A;  4Z4E A;  4W5Q A;  3QEX A;  4ID5 A;  1JL1 A;  3NBP A;  2KFN A;  1DTQ A;  1JLC A;  1UA1 A;  3AA4 A;  4M3T A;  2HW3 A;  1IG9 A;  3VA0 A;  3RMA A;  1C0T A;  4DS5 A;  2B6A A;  4NYN A;  4DFP A;  1KLN A;  1U48 A;  5KI6 A;  3LAK A;  1D9D A;  1C1A A;  3AA3 A;  2EHG A;  1B9D A;  3SYZ A;  4KHQ A;  3U6F A;  3HK2 A;  3DLR A;  4IFV A;  4QCL A;  2HHS A;  1QS4 A;  1CLQ A;  3V4I A;  1JXB A;  2P1J A;  1J9A A;  3G0Z A;  4E7K A;  1JKH A;  1JLE A;  2IAJ A;  4CJP A;  1DTT A;  1RT1 A;  3KKR A;  3RMB A;  3OYH A;  2HHW A;  4AHC A;  1WSE A;  4CHP A;  4ZHR A;  1NKB A;  3MXM A;  1CXQ A;  2YNF A;  2RN2 A;  1XHX A;  3NGZ A;  4LY7 A;  3MED A;  4CJV A;  4Z4G A;  2QKB A;  4KO0 A;  3D45 A;  4KRE A;  3KLG A;  4CJU A;  4DSF A;  4B8A B;  4ZTJ A;  3MAQ A;  3SV4 A;  4FLT A;  3VQE A;  2AJQ A;  1NJW A;  4CEF A;  3HP6 A;  3AA5 X;  3T3F A;  5J2N A;  1BGX T;  4DSJ A;  4OKJ A;  3VQP A;  3HP9 A;  4CIG A;  2HHV A;  3PO5 A;  3DI6 A;  5HRO A;  1IKW A;  4DSK A;  3HT3 A;  3HVR A;  3O4N A;  4BDY A;  1KFS A;  2D5R A;  2G8H A;  2GUI A;  2PYL A;  2HNZ A;  4M3R A;  3HJF A;  3NH0 A;  2BAN A;  3DOK A;  1D8Y A;  2ZE2 A;  4CJW A;  2VG5 A;  4BE2 A;  3V1O A;  4HUF A;  1EXQ A;  1IO2 A;  1Z26 A;  4LD0 A;  4DTJ A;  3S3M A;  5HRR A;  4N5S A;  1L5U A;  2D0C A;  1S6Q A;  2YHA A;  4Q5V A;  4DQR A;  2XY5 A;  5KRT A;  1U4B A;  1ASV A;  3AVJ A;  3CM6 A;  3VQA A;  1U47 A;  2GV9 A;  1RTI A;  4CEE A;  1D9F A;  1DLO A;  3SUN A;  1LWC A;  3NF8 A;  1Q9X A;  1VSJ A;  3SCX A;  4CHY A;  3OYF A;  4CHQ A;  3MEE A;  5HLF A;  4FYD A;  1HYZ A;  3DLB A;  4TSX A;  1C1C A;  3MEG A;  3ULD A;  4FZY A;  4C8L A;  4FLU A;  2WON A;  3K2P A;  1JLG A;  1RCH A;  4FLW A;  3PY8 A;  1HYV A;  4CIF A;  3VQC A;  4DFJ A;  1QSL A;  5HP1 A;  3ZT0 A;  4ICL A;  3LZJ A;  4E7I A;  3B6P A;  2FBY A;  3M8S A;  3CFO A;  4BE1 A;  3KD5 E;  1BIZ A;  4O0I A;  4W5N A;  1FK9 A;  3OS0 A;  1BQM A;  1WNS A;  5DMR A;  4CFA A;  5J2Q A;  3A2F A;  3AVL A;  3OYM A;  1RBU A;  1TK0 A;  1XHZ A;  4IFY A;  4DQS A;  1B9F A;  2XO7 A;  2YNG A;  2YKM A;  3KLE A;  3AVK A;  3P1G A;  3TAB A;  3WNE A;  4AHU A;  4DQI A;  3TAG A;  4DS4 A;  4FJ5 A;  3M8P A;  3VQ6 A;  3VQD A;  1Y97 A;  5HRS A;  2EX3 A;  4Q0B A;  2Y1I A;  4CF2 A;  3DM2 A;  4DSI A;  4FJX A;  1ASU A;  3L8B A;  5E41 A;  3OY9 A;  1A5X A;  1R0A A;  1QSY A;  4E7J A;  4KB0 A;  1NOZ A;  2OZM A;  2X78 A;  3C94 A;  3S9H A;  3ZSQ A;  4PUO A;  4CED A;  3TAE A;  2A1S A;  4JS5 A;  1Q9Y A;  4BWJ A;  4RG8 A;  3OS1 A;  3QNN A;  5I3U A;  1RT4 A;  1HQU A;  4KV8 A;  4N76 A;  4YFU A;  3AVB A;  1J54 A;  1BIU A;  3KLI A;  1X9M A;  1RT6 A;  4FCY A;  2XHB A;  3O3G A;  5FRM A;  3OYC A;  2XRI A;  1ZBL A;  2ATQ A;  4CEA A;  4W5R A;  1HNV A;  2IOC A;  3AVM A;  3SQ0 A;  3T1A A;  5J1E A;  1Q8I A;  4R5P A;  3RR8 A;  1A5W A;  4L8R B;  2XY8 A;  3E01 A;  1VSD A;  3LP2 A;  2HHT A;  2E6M A;  3B6O A;  3F9K A;  1X1P A;  1BI4 A;  3SJJ A;  1F21 A;  3C6T A;  3L2R A;  2QK9 A;  3OS2 A;  1L3V A;  4KI6 A;  4FXD A;  2KQ2 A;  3HO1 A;  3TAQ A;  3DOL A;  1W0H A;  4CGF A;  3QEV A;  2DY4 A;  2JGU A;  4HCB A;  1NK0 A;  4CJ4 A;  4HTU A;  1FKO A;  4AIL C;  1LW2 A;  1I3A A;  5CY4 A;  5HRP A;  5T7B A;  1GOA A;  1JLF A;  1LWF A;  4IG3 A;  4FM0 A;  3THV A;  4E0D A;  4M3U A;  2BGG A;  4BE0 A;  1UWB A;  3CYM A;  3HL8 A;  3RWU A;  4FJ7 A;  4WE1 A;  3VQQ A;  2HHX A;  3KD1 E;  4DTR A;  4FJK A;  1C0M A;  1S1T A;  1VSM A;  3DRP A;  3LP3 A;  4CEB A;  3QES A;  3OVN A;  3AO5 A;  1NJZ A;  3LWM A;  4CJ3 A;  3PO4 A;  1KVB A;  3OJU A;  1VSF A;  4JLH A;  4JS4 A;  4CGG A;  1ITG A;  1EP4 A;  1WSF A;  1IKY A;  4M3X A;  2ETJ A;  3AVF A;  3KK3 A;  3TI0 A;  2KW4 A;  3TR8 A;  2HND A;  2WOM A;  3MXI A;  4AH9 A;  4HHT A;  3VQ7 A;  4Z4H A;  4BDP A;  1WAF A;  1QE1 A;  3U3G A;  4RW6 A;  4FJH A;  4GMJ B;  4M3W A;  1TGO A;  4E1M A;  3TWH A;  3SI6 A;  1RT5 A;  1KRP A;  1SL2 A;  4CJE A;  4B9V A;  3HST B;  4GVM A;  2I5J A;  2E6L A;  3IRX A;  3NFA A;  3KIO A;  4CGD A;  4E19 A;  1SL1 A;  4I2Q A;  4BAC A;  4BDZ A;  4J2D A;  4NYF A;  4CF1 A;  3HPG A;  1VSE A;  4CF9 A;  4XIU A;  3LDS A;  1WSH A;  3DRS A;  1T7P A;  3QEI A;  3KJV A;  4DU1 A;  2P5O A;  3EY1 A;  1HYS A;  3P5J A;  2RF2 A;  2KZM A;  1LV5 A;  1BCM A;  4E89 A;  4CCH A;  1KLM A;  4MFB A;  4AHR A;  3O3H A;  1TVR A;  4OLA A;  4CE9 A;  2Z1I A;  1NK8 A;  1WN7 A;  3ZT4 A;  4O4G A;  4B9T A;  2HVI A;  5KGX A;  3QNO A;  3OYK A;  3AVI A;  1XC9 A;  3MEC A;  3V9U A;  3RR7 A;  2KZZ A;  1C0U A;  3CM5 A;  3QIO A;  4EP5 A;  5EU7 A;  5CYQ A;  1YTA A;  4KAZ A;  5JS1 A;  3ALY A;  3L3U A;  2XY6 A;  4CK2 A;  5CZ2 A;  1EET A;  1SUQ A;  2PYJ A;  1TV6 A;  4CJF A;  4IBN A;  2F8S A;  5JS2 A;  1VSH A;  1S1X A;  1SKS A;  2YKN A;  4DU3 A;  1S6P A;  3VQ5 A;  1T03 A;  5FRN A;  1TK8 A;  4CHZ A;  4FM1 A;  1I39 A;  3O4Q A;  4I2P A;  4OPJ A;  2IC3 A;  4DLE A;  1NKC A;  1ZBI A;  1RDA A;  1N5Y A;  2HMI A;  4I9Q A;  1G15 A;  1L3T A;  1ZBF A;  4IDK A;  4DTM A;  3BDP A;  4IG0 A;  3HXM A;  3V9S A;  4FJJ A;  4FK0 A;  3AO1 A;  1LW0 A;  4K8X A;  3KLH A;  3SZ2 A;  5FDL A;  3K5M A;  2DFF A;  3L3V A;  3V81 A;  3ZSW A;  3DRR A;  2IGI A;  1LAV A;  4O0J A;  5CZ1 A;  4UQG A;  4B9U A;  4E7L A;  3HVT A;  3SUP A;  1NK4 A;  1SKR A;  3OYB A;  1D5A A;  2W42 A;  4M3Z A;  2P5G A;  3DMJ A;  1RTH A;  4B9S A;  4DU4 A;  3V9Z A;  1NK6 A;  4B08 A;  4N56 A;  2QXF A;  1REV A;  4RW8 A;  1RT2 A;  2FBT A;  4CFC A;  3CFR A;  4DF4 A;  1MU2 A;  5HRN A;  4KTQ A;  3WNG A;  4CJS A;  3M8R A;  3L2W A;  3TAR A;  1L3U A;  2FC0 A;  3ZT2 A;  2G8K A;  1KTQ A;  4CEQ A;  4CEZ A;  1YVU A;  2VWK A;  4B9L A;  3T19 A;  4FVM A;  3CG7 A;  3EYZ A;  3VQ9 A;  3NF9 A;  3O3F A;  3MXJ A;  1TAU A;  3AA2 A;  4M42 A;  4M45 A;  3LWL A;  1FXX A;  2OPR A;  4CHN A;  1SL0 A;  4DMN A;  1NK7 A;  3QER A;  4F8R A;  2GBZ A;  1TKT A;  3AVG A;  4JRP A;  1T8E A;  3H08 A;  3AVC A;  3OYI A;  4KPY A;  1XWL A;  1B92 A;  3LPU A;  3NCI A;  4HVJ A;  4OVL A;  4OJR A;  4CJQ A;  4FW1 A;  1UAX A;  3AVA A;  4H4M A;  4O5B A;  4OKE A;  1U45 A;  2VG7 A;  3C95 A;  2BDP A;  2QKK A;  4N41 A;  1VSL A;  4HUE A;  1RBS A;  2XY7 A;  5K14 A;  4OGE A;  3LP0 A;  1HRH A;  3HM9 A;  1S1V A;  4F4K A;  1K6Y A;  3I0R A;  1NJY A;  4FJM A;  1QTM A;  2E4L A;  3U3Y A;  4H8K A;  4OLB A;  1ZYQ A;  2OPP A;  3PV8 A;  4DFK A;  1BI4 B;  3WNF A;  4DQP A;  4KFB A;  2IDO A;  2X6N A;  2G8I A;  2O4I A;  3PUF A;  4EZ9 A;  3NGY A;  1XI1 A;  3HPH A;  1LAW A;  2OPS A;  5HBM A;  4BWM A;  4Z4C A;  3SQ4 A;  4J2E A;  2F96 A;  1RT7 A;  3WNH A;  1NKE A;  3ZSZ A;  1S1U A;  2FBV A;  3LPT A;  5C24 A;  1HQE A;  4O44 A;  1S9G A;  2B4J A;  2HB5 A;  4DG1 A;  3SNN A;  4OPK A;  1J5O A;  4G1Q A;  4B8C A;  3SQ1 A;  4FJ9 A;  2G8U A;  1RNH A;  5SWM A;  3TAF A;  4KHW A;  4FW2 A;  3OYE A;  2P51 A;  4CJK A;  2X6S A;  1BIS A;  3PX6 A;  3NF7 A;  1KVA A;  4NCB A;  2G8W A;  4DTN A;  5J2P A;  3ZSY A;  4FLV A;  1NK9 A;  1CZ9 A;  1U04 A;  4ID1 A;  4CEC A;  3LP1 A;  3ZCM A;  4CF8 A;  4DWI A;  1S5J A;  2HHQ A;  4FK4 A;  4F3O A;  1JLA A;  4CES A;  1BL3 A;  2X74 A;  4EP4 A;  1VK0 A;  3K5O A;  5KTQ A;  2D0B A;  2VG6 A;  3QLH A;  3OYG A;  3QET A;  4JRQ A;  4B9N A;  1GOB A;  1WSJ A;  4QAG A;  5C25 A;  4CJT A;  5FRO A;  3C6U A;  4DTU A;  4Y1C A;  2KTQ A;  2YV0 X;  3L2U A;  4LSN A;  1S1W A;  3VQB A;  1RBV A;  4DTX A;  3ASM A;  1W9H A;  2Y1J A;  4DTP A;  4FLY A;  1EX4 A;  4J2A A;  4K8Z A;  4FM2 A;  4KHY A;  1JLQ A;  3AO2 A;  1SV5 A;  1KCF A;  4M41 A;  2IS3 A;  3D0P A;  1X9S A;  4J2B A;  2BE2 A;  4OKK A;  3IS9 A;  4FZX C;  3FFI A;  4Y1D A;  4OGC A;  2OZS A;  2F8T A;  3NH2 A;  2DTU A;  1J53 A;  5CYM A;  3CFP A;  3L2V A;  5C42 A;  1RT3 A;  4ELT A;  3V6D A;  4EZ6 A;  1RBT A;  3DLE A;  4YNQ A;  4F3T A;  1KVC A;  4KRF A;  1YT3 A;  3AV9 A;  4PQU A;  1WLJ A;  1HNI A;  4KHS A;  3LAL A;  3NDK A;  3NE6 A;  4KTW A;  3RMD A;  2ZD1 A;  4C8K A;  1TAQ A;  1TKZ A;  1TL3 A;  2YNH A;  3TAM A;  4ZTF A;  2Z1H A;  1ASW A;  2DFE A;  3VQ4 A;  2NUB A;  3ZSR A;  1RBR A;  1FKP A;  4FJI A;  3PX0 A;  1JL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...