3MXJA

Crystal structure of the mtrex1 apoprotein
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
229
structure length
210
Chain Sequence
LPHGHMQTLIFLDLEATGLPSSRPEVTELCLLAVHRRALEPPVPRPPRVVDKLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAALKALEQKSYSLGSIYTRLYWQAPTDSHTAEGDVLTLLSICQWKPQALLQWVDEHARPFSTVKPMYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Crystal Structures of TREX1 3' Exonuclease Autoimmune Disease Mutants
rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Three prime repair exonuclease 1
total genus 71
structure length 210
sequence length 229
chains with identical sequence B
ec nomenclature ec 3.1.11.2: Exodeoxyribonuclease III.
pdb deposition date 2010-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3mxjA01
4E89A 5J2PA 3QESA 1KLNA 3WNFA 1NK0A 3SJJA 1WSEA 2KZZA 3D0PA 4C8MA 4DTXA 1ITGA 2YHBA 4OPKA 1BHLA 4CJPA 1WNSA 1S5JA 2A1RA 2HNDA 4W5OA 3HVTA 3PV8A 2PYJA 2XY8A 3DLKA 3NHGA 4OGCA 4F3OA 3DYAA 5FRNA 3VQDA 3HYFA 2HHXA 4FLUA 2HHTA 4LY7A 4B3OA 4DLEA 2JGUA 3O3HA 1K6YA 4E7HA 5JS1A 3P5JA 3MXMA 3S3OA 3L8BA 3SI6A 4RG8A 3V1OA 4CEOA 1XI1A 1L3VA 1MU2A 3RWUA 4C8LA 1VSEA 3K2PA 4B9NA 1FKPA 3LZIA 3O4QA 4FZXC 1ZYQA 4IFVA 1BISA 1RT5A 2DFHA 4OVLA 1J54A 4FJ8A 3TAPA 2D0BA 4FM0A 3SUPA 1RT4A 4IG0A 4M42A 3CG7A 4W5TA 4FLZA 2KW4A 4CJSA 1RBSA 2ZQBA 4N56A 2RN2A 3KK1A 3T3FA 3C6UA 3V9WA 4FJLA 1J5OA 1HYSA 3NGYA 5HROA 2FBTA 4B8CA 4O55A 4BWMA 1SUQA 3O3FA 4EP5A 3SQ0A 3VQ9A 3SNNA 4HUGA 2IGIA 3K5OA 4CJLA 2G8KA 2Y1JA 4ICLA 3M8RA 1X9SA 4CGJA 3OJSA 1JL1A 1IKWA 3K57A 5DK5A 1SL2A 2D5RA 4FZYA 4OKJA 4OKKA 4DFPA 2QK9A 4KHUA 4CGDA 3RRHA 4G1QA 1JLCA 1CZBA 1F21A 2VWKA 4FLWA 1SKSA 4M3WA 4OLBA 4MFBA 3KLFA 4ZTFA 4FJKA 3I0RA 3NF8A 3P1GA 2XY5A 3A2FA 3RRGA 1HMVA 2JLEA 2XY6A 2DY4A 3B6OA 3ZT3A 2PY5A 1W0HA 5CY4A 3AVAA 3EY1A 2E6MA 1A5WA 3QEWA 4DF8A 2YKNA 1U04A 3DRPA 3VQCA 3JYTA 3IAYA 3HXMA 3TAMA 3HVRA 3HM9A 1D9DA 2G8IA 3VQ5A 2Y1IA 3V4IA 3NF7A 3ULDA 1KVCA 4E0DA 3TI0A 1QTMA 2G8FA 5J2MA 1J53A 3F9KA 1C0TA 2X6NA 4CJ4A 3CQ8A 3QNNA 1N5YA 1ASVA 4DTSA 4M45A 1VSDA 2VG5A 4KFBA 1G15A 4BE2A 4N47A 1VRTA 1T05A 4KHYA 3ZSQA 2QKBA 1VRUA 1IH7A 2IAJA 4FLXA 2FC0A 1SL1A 1RNHA 4MQ3A 4RW8A 3SQ4A 4KHNA 2HHUA 3KTQA 3TR8A 2HNZA 1EX4A 3S3NA 4PUOA 4BWJA 4CJUA 5KTQA 1GOBA 1HYZA 1NKCA 3ZSWA 3SQ2A 4OKEA 3NFAA 2VG6A 4CF2A 3DLHA 4GW6A 2YNFA 5HBMA 3SQ1A 4BACA 1VSJA 3G10A 5HRPA 3ZT4A 3K5LA 3WNHA 4DS4A 1TK5A 4CGGA 4FJ9A 2HHQA 4JS4A 2HNYA 1UA1A 1FKOA 4CFDA 1SKRA 3TAQA 3VN5A 2FBXA 2YNIA 3AA3A 1QHTA 5K14A 3NH1A 4FJ7A 1NJYA 2RKIA 1KRPA 4FJJA 3KK3A 1I39A 4W5NA 4M3YA 3DLBA 1YVUA 1BI4A 4I2PA 4DFMA 3TAEA 3SZ2A 3S3MA 4M3ZA 4CJRA 1A5VA 4DSIA 4CHZA 4Z4FA 4HVJA 4Z4CA 4FLVA 3DMJA 4DU3A 4FYDA 2X74A 3KKRA 4PQUA 1TL3A 4E1NA 4DQPA 3ZSVA 5SWMA 1VSFA 3LANA 3L2VA 5C42A 2P1JA 3VQ6A 4YFUA 1RDAA 1UA0A 2KZMA 2HHVA 5J2NA 4AHCA 3EYZA 1VSMA 4CECA 2AJQA 3I0SA 3QO9A 2E4LA 2B5JA 3OYGA 1WSFA 4KI4A 3PUFA 1FXXA 4B9SA 4AHRA 4B9UA 4HUFA 4HCCA 4BDYA 4QCLA 4Z0UA 2EHGA 3PO5A 1Z25A 3L2RA 1REVA 2FBYA 1QSSA 4BDPA 2HMIA 4I7FA 3VA0A 3V9SA 2P5GA 1NJXA 2NUBA 1R0AA 3RMDA 4DU4A 3OYAA 2VG7A 1O1WA 1VK0A 4XIUA 4PY5A 1JKHA 1TK8A 4KRFA 5CZ2A 2D0AA 2IDOA 2P5OA 3ZSXA 1TAUA 1SL0A 3OY9A 2YV0X 4DTUA 2KFZA 1WSJA 4HTUA 4O44A 3SV3A 4CERA 3K5MA 3SUNA 1S1TA 4FZZA 5FRMA 1EP4A 4E7LA 3DRSA 1WSHA 3CM5A 3C94A 4CESA 3M8QA 4E7IA 4HCBA 4Z4EA 3MEDA 3VQ4A 4EP4A 1ASUA 4JLHA 3NGZA 1ZBIA 4CJ3A 1LWCA 3SV4A 4OLAA 4CHOA 3ZSOA 5J2QA 4NCBA 4J2AA 2Q3SA 1LWFA 3VQPA 2A1SA 4DQIA 3LZJA 2EX3A 4I9QA 1WN7A 4FM1A 3M8SA 3V9UA 1NJWA 4NYNA 2ZE2A 4CJWA 3RMBA 1RDDA 4KTZA 4K8ZA 4M3TA 4DTNA 1C0UA 4KKOA 3I8DA 3ISNC 1HRHA 3E01A 4ID1A 4FW2A 3NGIA 4J2DA 4CIFA 4CJ5A 5EU7A 4DMNA 3T1AA 4FJMA 2OZSA 1LV5A 5KGWA 4DLGA 1U48A 4O0IA 3UIQA 4NCAA 3V9ZA 3HPGA 3OYFA 3L2UA 4DTMA 2HW3A 1X9MA 1NKBA 4FLTA 1S9EA 4PWDA 4KREA 1BCOA 4I2QA 3HSTB 4DSEA 5HLFA 1UOCA 4DTRA 4DSFA 3WNGA 2HVHA 1RBTA 2WOMA 3L3VA 4DSKA 1DLOA 3RMAA 1NK8A 3OYCA 1RT6A 3QETA 3FFIA 3AV9A 2Z1IA 4JRPA 2GBZA 3O4NA 3MAQA 1RT2A 3DLGA 1IG9A 2Z1JA 4CFAA 1C1CA 4Z4HA 3NAEA 3LWLA 5D3GA 4DQRA 3ZT0A 3ZSZA 4B9LA 4E19A 3VQ7A 4KHSA 3OVNA 3NH0A 1NKEA 3VQAA 4CJEA 4CCHA 4KHQA 4LSLA 4F3TA 2F8SA 4Q5VA 1RTIA 5T7BA 5CYMA 3VQEA 1XHXA 1QQCA 1HYVA 1RCHA 3L3UA 4Y1DA 4B8AB 2B6AA 3CM6A 4FM2A 4AHUA 2O4GA 1Q8IA 1S6QA 3KLIA 1T03A 1KFSA 4M3XA 2HHWA 1YTUA 2KFNA 4IG3A 3IRXA 4DFKA 4F2SA 4AHTA 2G8WA 3S9HA 1DTTA 4CJFA 3V9XA 3QNOA 1TGOA 4CHPA 2QXFA 3LALA 4NYFA 4ZHRA 5HRNA 3QEXA 4N41A 3KLEA 1RBVA 3AVCA 1U47A 3OS2A 3AVIA 3CFOA 5KRTA 1FK9A 3PX6A 1HNVA 1SKWA 3M8PA 1JLAA 3KLGA 4ELVA 2OPRA 1HQEA 1U45A 1S9GA 3L2WA 2KQ2A 4DSJA 1S1UA 1RTDA 4E7JA 5CYQA 4Z4IA 1TKZA 4FVMA 2YNHA 3V1QA 3T19A 3HK2A 4FLYA 4DTPA 4CFCA 4KTQA 1BI4B 3K58A 2Z1HA 3LP1A 4E7KA 5JS2A 3AO2A 3TANA 3V6DA 1CZ9A 2VWJA 4DU1A 2R7YA 4E3SA 3DLRA 1HJRA 2GV9A 4J2BA 1KTQA 1IKVA 5CZ1A 1NK4A 1TVRA 1YT3A 4N5SA 4FCYA 4CEAA 1QE1A 2P51A 1BQNA 4LH5A 1ZBFA 4M3UA 1UWBA 3OYNA 1NK6A 3U3GA 4IBNA 5FROA 1D8YA 4IDKA 3AO4A 4LD0A 1A5XA 3SYZA 3AVFA 4AHVA 4DQQA 4KI6A 4KHWA 4CGHA 1NOZA 3TWHA 3QERA 3OYLA 2BANA 2DFEA 4FXDA 3NH2A 1S1VA 4CEBA 4HHTA 4CK1A 3SPZA 3HP9A 2D0CA 3OS0A 4WE1A 3TARA 1D9FA 4DSLA 1BIUA 4CFBA 3C95A 3TABA 4L8RB 3OYDA 2BE2A 3HL8A 1XWLA 1VSKA 3F73A 4CEZA 2OPPA 3OYIA 3ZSYA 1L3SA 5HRSA 3KKSA 3OYMA 5KGXA 1LWEA 3OYJA 1U49A 4ELUA 1TL1A 2XRIA 1JLFA 1RTJA 5FDLA 2GUIA 4KB0A 4F8RA 1TV6A 3AVGA 1Q9XA 1GOCA 1LW2A 3G0ZA 1QSLA 4KPYA 3SPYA 4CHNA 4FJNA 3RMCA 2F96A 3QEPA 4F4KA 3DM2A 1BIZA 1KVBA 4W5RA 1LW0A 3K59A 1EXQA 1S1XA 1CXUA 1LAVA 1C6VA 3VQQA 3SCXA 4EZ6A 1X1PA 4DS5A 3C6TA 4DFJA 3NF6A 3U3YA 1NK9A 4R5PA 3LPUA 5C25A 4RW9A 1ASWA 2HB5A 2OPSA 1S1WA 3DI6A 3AO1A 3KIOA 3NBPA 4FK2A 1Y97A 4CEDA 1BL3A 5KI6A 4Y1CA 4GMJB 3LDSA 1RDCA 1VSLA 4LSNA 3OYEA 1IKXA 3QLHA 4OJRA 4C8NA 1I3AA 1JL2A 3JSMA 1N6QA 3AVJA 2G8VA 3RR7A 4C8KA 2F8TA 4CJKA 1SV5A 4O5BA 1KCFA 3CFRA 3AA4A 2B4JA 4DTOA 2HHSA 1YTAA 4CF8A 3K5NA 3NDKA 4IKFA 3LP3A 3P83D 4CE9A 4BE0A 2BDPA 4QAGA 1EKEA 4RW7A 4N76A 5HRRA 1S6PA 4B9TA 4CEQA 3MXJA 4K8XA 3KLHA 4DF4A 1C0MA 4H4OA 4FJXA 1W9HA 4KB1A 1RBRA 1X9WA 3MXIA 1EETA 3DOLA 4O4GA 3AVNA 4H8KA 3EZ5A 1B9FA 1L5UA 3HPOA 1TAQA 4AILC 1JLBA 1CLQA 1HQUA 4J2EA 4RW6A 5C24A 1XHZA 4M3RA 2KTQA 3KD5E 1GOAA 3LP2A 3KD1E 3QINA 1RILA 3AA5X 4IFYA 1RBUA 5KRSA 3ITHA 1B92A 1DTQA 3ALYA 4CF0A 2E6LA 4CJQA 3CFPA 3THVA 2PYLA 1NOYA 1QS4A 4DWIA 1RDBA 5I42A 2OYQA 4F2RA 2G8UA 4E1MA 1NK5A 3NF9A 4CEEA 2YKMA 4YNQA 2WONA 5I3UA 2FBVA 1WAJA 1VSIA 3HPHA 3LPTA 4KTWA 5HP1A 1KSPA 3BDPA 3QIPA 1KLMA 1RT7A 2DFFA 5DMRA 4OGEA 1T8EA 4AHSA 1L3TA 4FK0A 2ETJA 4CIEA 3B6PA 1ZBLA 4CEFA 4ZTJA 2HVIA 1BQMA 3HP6A 4KAZA 1KVAA 4GVMA 3ZT1A 1J9AA 1TKXA 3WNEA 1HNIA 3CYMA 1CXQA 4B9VA 1NK7A 1T7PA 1JXEA 4CHQA 3DLEA 2RF2A 5J1EA 4EZ9A 4CK2A 2OA8A 3KK2A 2X6SA 3AVHA 3V81A 1L3UA 3MEEA 5E41A 2Z1GA 3ZT2A 1Q9YA 4QOZB 1BCMA 3HO1A 1WSGA 1HPZA 4ID5A 1RTHA 4JS5A 4HUEA 2IOCA 2XY7A 4RW4A 4CJVA 1TK0A 4FJIA 4FJGA 1WSIA 3VQBA 4I9LA 1XC9A 1ZBHA 3U6FA 3ZSRA 3AVLA 5SZTA 4CHYA 3V1RA 3IG1A 2ATQA 3IS9A 2W42A 1JLEA 4C8OA 1TKDA 3ZCMA 3H08A 4KV8A 1D5AA 3RR8A 1VSHA 1JLGA 3AA2A 4W5QA 3NE6A 3RTVA 3AVKA 4KO0A 3NCIA 2I5JA 4PA1A 4M41A 4CF1A 4OPJA 4TSXA 4AH9A 3QIOA 1U4BA 4NCGA 4DTJA 3O3GA 3SUOA 1JXBA 1RT1A 4CIGA 2BGGA 4CF9A 3PX4A 3MEGA 4FJ5A 2OPQA 4BDZA 4UQGA 4JRQA 2LSNA 3TAGA 2OZMA 1C1BA 3PO4A 3LAKA 3VQ8A 1TKTA 3PY8A 3DRRA 4CGFA 1JLQA 3OJUA 4BE1A 4Q0BA 3AO5A 3SUQA 3PX0A 3BGRA 4DQSA 2RPIA 3AVBA 3HT3A 1UAXA 2YNGA 4FW1A 2YHAA 3D45A 3OS1A 1Z26A 2XO7A 2DTUA 3ASMA 4CK3A 3DOKA 3LP0A 1WAFA 3QEVA 2PZSA 1WLJA 3AVMA 3MECA 4B08A 4DG1A 1QSYA 2ZD1A 1IKYA 1LAWA 2XHBA 1KFDA 4H4MA 2O4IA 2IC3A 1IO2A 1NJZA 1C1AA 1BGXT 2QKKA 3KJVA 3OYHA 4FJHA 3LWMA 3LAMA 1ZBUA 4CJTA 3HJFA 4LH4A 3VA3A 3L2QA 2ITGA 3QEIA 4ELTA 1B9DA 4O0JA 2G8HA 3OYBA 2X78A 3TAFA 4CGIA 1RT3A 2IS3A 3AO3A 4B9MA 4Z4GA 3OYKA 4FK4A
chains in the Genus database with same CATH superfamily
1NK0A 4R79A 4C8MA 4DTXA 4BRDA 1CZAN 2O8EB 1BHLA 4CJPA 5EY4A 1WNSA 2HNDA 3UKUA 1N32K 2PYJA 4F3OA 4OGCA 5JLFA 2HHXA 4B3TK 4B3OA 1K6YA 4MDBA 5AQJA 3LZIA 2CH6A 1ZYQA 1HX1A 4CJ7A 2DFHA 3FFKB 4FM0A 1RT4A 4M42A 1RBSA 4FJLA 3T3FA 2V51B 3NGYA 4B8CA 3OA9A 1JCFA 4BWMA 1S72N 4B3RK 3SNNA 2G8KA 1NGGA 1X9SA 4CGJA 1JL1A 5AZJA 3O08A 1SKSA 4H5RA 1CZBA 3KLFA 3NF8A 3P1GA 3RRGA 1GLAG 2JLEA 2DY4A 1NGAA 3ZT3A 4DR6K 4KHPK 3AVAA 3QEWA 2NRTA 4PKIA 2YKNA 5JLHA 1U04A 3DRPA 3VQCA 3JYTA 3LM9A 3JS6A 1VQON 4LFBK 2P9UA 3HXMA 3HM9A 2HBMA 3TI0A 1YI2N 1QTMA 1J53A 3F9KA 4CJ4A 3QNNA 4DTSA 2KKZA 4M45A 2QTDA 2VG5A 3QFPA 4BE2A 4NO7A 2UYTA 1VRTA 3ZSQA 1IH7A 4MQ3A 3ZX2A 3SQ4A 2HHUA 4A57A 4DV0K 2O8BA 4BWJA 2CGLA 5KTQA 1HYZA 3SQ2A 2QWRA 4GW6A 3SQ1A 3PSIA 4BQZA 4WFBL 1UA1A 2AP1A 1FKOA 3CXCM 5K14A 1XC3A 2RKIA 4FJJA 3KK3A 3MCAB 2ITMA 4ILHA 2V52B 5GAEP 1YVUA 3AARA 4DFMA 3SZ2A 2Q0UA 4DSIA 1XMOK 4FYDA 5FLXO 4PQUA 4E1NA 4DQPA 2P9KB 3MN7A 5KPZA 2HHVA 4KI4A 1FXXA 4B9SA 4QCLA 2GUPA 3ULEA 1REVA 3DAWA 2FBYA 5LJVA 5EVZA 1N36K 5AZJB 2P5GA 1R0AA 3RMDA 4BRQA 4IZ9A 2VG7A 1O1WA 4XIUA 4BR7A 1TK8A 4KH5A 2IDOA 1ATSA 3TTCA 3ZSXA 2QEXN 1TAUA 1RDWX 2W41A 1NNEA 2YV0X 3N4QA 4O44A 3SUNA 1S1TA 3C7NB 3M8QA 4HCBA 5C2FA 5BR8K 4H03B 4EP4A 4JLHA 3SBGA 3QICA 3SV4A 1U2VA 2Q3SA 1LWFA 3VQPA 2YJEA 2EX3A 3LZJA 3V9UA 5KQ8A 4M3TA 2ZF5O 3I8DA 3E01A 4CZMA 4J2DA 4HWIA 1KQSM 1VAZA 5EU7A 2OZSA 4DLGA 2OTLN 4O0IA 4NCAA 2P9LA 3OYFA 3L2UA 4FOIA 2HW3A 1S9EA 1M1KO 1BCOA 4DSEA 1UOCA 3HI0A 3TPQA 3WNGA 4DSKA 2WOMA 3WQUA 3DLGA 1C1CA 3OTOK 3NAEA 4DQRA 3N4PA 3CC7N 1N8RO 4FWSA 4LSLA 4JI3K 3FZHA 4WQ5A 1XHXA 1RCHA 1D8YA 3O6WA 4DFKA 2G8WA 2UXDK 2E8AA 3D2EA 2NNWA 3KLEA 3PX6A 1HNVA 2QWLA 3O9TA 5CYQA 4LF6K 2IVNA 1TKZA 2Q31A 4JI5K 3V1QA 3IKMA 3D7EO 4BC5A 2WUSA 1IBKK 3V6DA 3OW2M 4J2BA 5CZ1A 5AQGA 4BGBA 1YT3A 4N5SA 4GV9A 1EWQA 2ZM6K 2I7PA 2O8CB 4O5FA 4DV2K 4M3UA 1NK6A 4YOUA 3AO4A 4KH4A 3ENHA 4YOYA 1NOZA 4RTFD 3TWHA 3QERA 4V19S 2NZTA 4XH1A 1S1VA 3C65A 4CEBA 4CK1A 2D0CA 3OS0A 3C95A 2P9IB 4B3SK 4IJAA 2BE2A 5FPNA 4CZEA 2CH5A 3F73A 1VQMN 4GVEA 3ZSYA 3CCLN 1L3SA 3O9UA 1U49A 5FDLA 3I33A 5B8HA 1TV6A 3G0ZA 3VMFB 3MK6A 4JKAA 3ZEUA 4BRAA 3QEPA 5LMNK 1KVBA 4YOWA 4GKJK 3VQQA 1X1PA 4CBXA 2NRWA 3LPUA 3DI6A 3SAHA 1K9MO 2HHSA 3QLHA 4OJRA 4C8NA 1JL2A 1IV0A 4CZFA 4CJKA 2RE2A 3AA4A 4DTOA 4IEEA 3NDKA 2QWMA 3K5NA 3LP3A 4UY8O 1EKEA 4BQLA 1S6PA 4LFAK 4K0KK 2O8DB 4FJXA 1W9HA 2O8CA 1RBRA 3MMVA 1EETA 4O4GA 3T69A 3EZ5A 1L5UA 4FWOA 5AQMA 4MDAA 3DWLA 4RW6A 2UUBK 4M3RA 1GOAA 3Q7CA 4KAZA 4DWIA 5AQPA 1NOYA 5MLCQ 2G8UA 4IJNA 3ZETB 4E1MA 3CQYA 1FJGK 4YNQA 1MWMA 2FBVA 4WQ4A 5HP1A 4L3QA 1KLMA 1GLLO 3WXLA 4M7YA 4BREA 2ETJA 1Q7YO 3B6PA 1ZBLA 2IVPA 3HP6A 3H46O 1J9AA 2WBNA 3R8EA 3E9OA 1X3MA 4H0OA 1KD1O 5AZIB 3DLEA 2E1ZA 2RF2A 1LCUA 1L3UA 1NM1A 2NRZA 3O9SA 3V81A 5E41A 3MN9A 1WBDA 1Q9YA 1YJNN 1HPZA 4ID5A 4JD2B 2IOCA 3E9PA 3RSEA 5BPNA 3VQBA 4I9LA 3ZSRA 3B8AX 5SZTA 3IG1A 2QWNA 4QS9A 2W42A 1HR0K 1MA9B 4IOXA 2O8EA 1VSHA 1JLGA 1TK5A 4KO0A 4OPJA 4AH9A 3QIOA 1U4BA 4NCGA 3O3GA 3U9DA 4DUZK 2OPQA 2OZMA 1C1BA 2D1KA 1BOTO 1JCEA 3J80O 5BRFA 3OS1A 3VESA 4LF8K 2PZSA 3MECA 3CCJN 1Q82O 5AFUH 2ZD1A 4FPAA 2UXBK 2IC3A 1C1AA 4GY2B 2QKKA 4FJHA 4G9ZA 1ZBUA 3HZ6A 3VA3A 3WXKA 3O9RA 4CGIA 1RT3A 4K43A 4B9MA 3OYKA 1KLNA 5J2PA 1GLEG 3SJJA 3H45C 2OANA 1W2BM 1ITGA 1P8ZA 1S5JA 1S3XA 2FSNA 4FPBA 5AQWA 1OH8A 2ZGYA 3DLKA 3NHGA 3FE1A 1GLDG 4XEIA 2JGUA 4AM6A 3L8BA 4RG8A 3V1OA 3P38A 3RWUA 5ADXA 5AQZA 3O1WA 3GBTA 3GE1A 4C1NI 4FVUA 4IG0A 1VQ6N 4FLZA 3L4QA 5BREA 1I94K 3V9WA 1S22A 1J5OA 1HLUA 3VQ9A 4JI4K 3K5OA 4ICLA 3M8RA 2D0OA 3OJSA 1IKWA 1ZC6A 5DK5A 4FZYA 4OKJA 3E1YA 4OKKA 4DFPA 4KHUA 4CGDA 4G1QA 3CCSN 2VWKA 4FLWA 4ZTFA 3I0RA 2XY5A 3A2FA 3CIPA 2XY6A 2ASPA 1A5WA 4DF8A 1Q86O 3IAYA 4GV3A 1D9DA 3TAMA 2G8IA 3G25A 2Y1IA 3MX5A 3NF7A 1KVCA 4A62A 4E0DA 3ID8A 3SLCA 4B9QA 1VHXA 5KPTA 1JCGA 4CW7B 4JK7A 1T05A 4KHYA 2QKBA 1VRUA 1SL1A 2FC0A 4O8KA 3R9PA 4BRFA 3KTQA 2HNZA 3S3NA 2E1YA 4ISGA 1GOBA 3NMUA 3O4WA 2E20A 3NFAA 4CF2A 1JJ2M 1ILYA 3CPWM 1VSJA 3DLLL 5HRPA 3ZT4A 3K5LA 2UU9K 2P9SB 4CGGA 1U6ZA 3C6AA 1EWRA 5C10A 4JHDB 2HNYA 4CFDA 3CJAA 3TAQA 3VN5A 1QHTA 3NH1A 4FJ7A 1KRPA 2YHYA 4M3YA 5HOOA 3TAEA 3S3MA 4M3ZA 2VGNA 1A5VA 4JI7K 1DKGD 1GLFO 4DU3A 2HF4A 4AM7A 1VSFA 1J5EK 2P9SA 1RDAA 3DXMB 2KZMA 3EYZA 4J8FA 3QO9A 4YDUA 2E2PA 1BO5O 4JKDA 4AHRA 4B9UA 4HUFA 4BDYA 4Z0UA 2EHGA 1Z25A 3A0IX 3L2RA 5GAGP 5C15A 3MN5A 4X64K 2RHKA 3L4IA 3VA0A 2P9PA 1NJXA 3OYAA 3ATVA 4C1NK 3KWIA 1JKHA 2A3ZA 2E2NA 5AQHA 1SL0A 2KFZA 4XH5A 4JKFA 5IWAK 1EQYA 3DRSA 3C94A 4CESA 1NGFA 5BRDA 3KZBA 1YITN 2UXCK 1ZBIA 4CJ3A 3CJ1A 1LWCA 4CHOA 3HSCA 3ZSOA 3K0SA 5J2QA 4J2AA 2A1SA 1NMNA 3D6RA 4DQIA 1WN7A 4CZLA 4FM1A 1RDDA 4KTZA 4DTNA 3I8BA 1KXPA 4KKOA 3ISNC 4ID1A 3NGIA 3D2FA 3E9LA 4CIFA 3T1AA 4FJMA 4FZZA 5KGWA 1U48A 3UIQA 2YCHA 1VQ9N 3HPGA 2P9NA 2D0PA 1X9MA 3J7YP 4I2QA 3A5MC 3L0QA 3THWB 5HLFA 4DTRA 2HVHA 2HBLA 3L3VA 1DLOA 3OYCA 1RT6A 3VTIA 3QETA 2Z1IA 4JRPA 1RT2A 4YY3K 2P9UB 3ZSZA 4E19A 3VQ7A 3VQAA 4IDHA 4F3TA 3RVCA 1RTIA 5CYMA 4B8AB 3L3UA 1HYVA 3JAMO 4Y1DA 4FM2A 2B6AA 4OPAA 3W3DA 4AHUA 2O4GA 2ZWHA 1YTUA 1W97L 3BF3A 4ZHRA 5HRNA 1GLBG 1U47A 1T6CA 4FWKA 5KRTA 3O9QA 3NVMA 4BR2A 3IDHA 1HQEA 4A2BA 1U45A 5AQKA 2YNHA 3T19A 2FF6A 3C0BA 4CFCA 2PBDA 4KTQA 1BI4B 4PHTX 2Z1HA 3LP1A 4E3SA 2F7TA 2Q2RA 4Z94A 1IKVA 1NG9A 3S41A 3FZMA 2P51A 1C0FA 1X9JA 1ZBFA 4H5TA 1H1VA 1UWBA 4IDKA 1A5XA 3SYZA 3AVFA 3CERA 3TTDA 3M3ZA 3C7NA 4FXDA 3SPZA 4DSLA 4CFBA 5ADXH 3ZLJA 5AQLA 3OYDA 3BZCA 3HL8A 3THXA 1VSKA 2OPPA 1HPMA 4ISFA 3KKSA 3OYJA 1K73O 4DV6K 5AQYA 5CE3A 4KB0A 4FJNA 1GOCA 3SPYA 2UUCK 4DV3K 1NGHA 1BIZA 4FOEA 1EXQA 2O8FB 2O8BB 4CZHA 3U3YA 4R5PA 4RW9A 2HB5A 4LC9B 5M1FA 1S1WA 5M1PA 3AO1A 5KI6A 3FZFA 3LDSA 4F2SA 4LSNA 3OYEA 2G8VA 3JSMA 2F8TA 3CFRA 2QWQA 4CF8A 3VF4A 4IKFA 2BDPA 4IXCA 2IIRA 4RW7A 4N76A 4K8XA 4B9TA 4CEQA 3MXJA 4PL8A 4BRMA 3CCQN 4KBOA 3DXKB 4RWTA 3AVNA 1TAQA 3OBYA 2KTQA 2YHWA 4DR1K 4X65K 3LP2A 3AGKA 4IFYA 3CETA 3ITHA 3ALYA 3VGKA 3CFPA 2E6LA 4BVPA 4F2RA 2OYQA 3NF9A 3L6QA 2GEMA 1VSIA 3F2KA 3LPTA 3QDKA 4FWQA 3EZWA 3QIPA 1RT7A 1T8EA 4AHSA 4CEFA 2P9IA 4I6MB 3UKRA 2VGMA 3G71N 1KVAA 4GVMA 3WNEA 1HNIA 3CQXA 1Z05A 4JHDA 3HOSA 1NK7A 4B9VA 3IFRA 4EZ9A 1N34K 2PAVA 4BGAA 2Z1GA 5M1NA 1SS6A 3ID6A 3CCVN 5IT9O 2YX6A 4A5BA 4JS5A 2XY7A 4CJVA 1TK0A 3BF1A 1WSIA 3U6FA 4K42A 3QBXA 3V1RA 3THYA 3IS9A 4C8OA 3MN6A 3O8MA 4KV8A 3RR8A 2VWBA 3AVKA 3NCIA 4M41A 2HHHK 2D4WA 4BRLA 3SUOA 4CZGA 4CIGA 3LDLA 2F4VK 3IMXA 4JRQA 3TAGA 4B1XB 1JLQA 3OJUA 4BE1A 4Q0BA 3T1HK 2W6KA 4WYBA 5ELZA 1X3NA 3AVBA 1UAXA 2YNGA 4FW1A 2XO7A 4MLEA 3MWTA 3A8YA 3DOKA 4BC4A 5E26A 4BROA 3AVMA 1E4GT 1VQNN 1ATNA 2O4IA 1NJZA 1IO2A 4BC2A 3KJVA 4YORA 4JI1K 3LWMA 3HJFA 3QEIA 4OO1J 2G8HA 3TAFA 3VGMA 2HOEA 4E89A 3QESA 2GTDA 1BG3A 3WNFA 3O80A 2KZZA 3D0PA 2Q1NA 2YHBA 5KQDA 4W5OA 3HVTA 3PV8A 2XY8A 2W40A 3VGLA 5FRNA 4H0VB 4LY7A 4CZJA 3O3HA 4E7HA 5JS1A 3P5JA 1BDGA 1KAYA 3MXMA 3SI6A 1XI1A 1MU2A 4C8LA 1VSEA 1YIJN 4B9NA 4Y0WA 4ILJA 3O4QA 4FZXC 3ZX3A 4IFVA 1BISA 1NGEA 5FPDA 4OVLA 4FJ8A 2D0BA 3VERA 3K9JA 4CD1A 1NGDA 2KW4A 4N56A 2ZQBA 4FWRA 1Q18A 2FSJA 1HYSA 2FBTA 4O55A 2NRVA 1YUWA 1BA1A 2IGIA 4HUGA 1BUPA 1XUPO 4JYAK 4CJLA 2Y1JA 1T6DA 3WEEB 1C0GA 2FXUA 3VENA 4B1VA 2Q0RA 3K57A 3RRHA 1JLCA 4OLBA 4MFBA 4FJKA 3MCPA 1HMVA 1ZBSA 2PY5A 1U2VB 1W0HA 5CY4A 4X66K 3EY1A 2CGJA 1E4FT 1SZ2A 3LDNA 5GAHP 1ZXOA 3VOVA 3WXIA 3H1VX 3ULDA 2G8FA 5J2MA 3CQ8A 5BR9A 1N5YA 1ASVA 1VSDA 5BN9A 3CCUN 3FZKA 3H1QA 1FW6A 4FLXA 3U4LA 4KH6A 5M1OA 4KHNA 4RW8A 4CZIA 1QVGM 1XNRK 5AFUA 1NWKA 3H6EA 3TR8A 5DM6L 4PUOA 4CJUA 4BR0A 1NKCA 3ZSWA 1O13A 2VG6A 5LL6Z 4H0YB 4MO5A 4DKWA 2YNFA 5HBMA 5EOYA 5GIPA 3G10A 3WNHA 4DS4A 5AZIA 1SKRA 2IVOA 2YNIA 3AA3A 1NJYA 2J4RA 1I39A 3BY5A 5AJ3K 1WB9A 5F0XA 3DLBA 1BI4A 1T44A 4JKHA 3F5TA 4CHZA 3VEOA 3VETA 4Z4FA 3FLCO 4Z4CA 1QHAA 4FLVA 1KAZA 3KKRA 1TL3A 4B3MK 3ZSVA 3LANA 4IWVA 4QS8A 3AAPA 2HMPA 4HTLA 1GLCG 2YJFA 5C42A 2WTUA 3VQ6A 4BRPA 4FL9A 4BRIA 3VF6A 5J2NA 5AQOA 2BTFA 4AHCA 4BY9C 2AJQA 3I0SA 2B5JA 1WSFA 4DR2K 5C0YA 1BU6O 4FSVA 3PO5A 4GV6A 5TKYA 5EXWA 4B1YB 4H5VA 4JKCA 4PY5A 4YOXA 4KRFA 3GOIA 1YAGA 3ENBA 2P5OA 1TUYA 3MDQA 1YXQA 3OY9A 4DTUA 1WSJA 4HTUA 4IOAL 2A42A 3SV3A 3K5MA 4BRGA 5FRMA 3QBWA 1WSHA 3CM5A 4E7IA 4Z4EA 3MEDA 3VQ4A 1HNWK 1ASUA 3NGZA 4OLAA 3AY9A 3TSPA 3U8XA 2E88A 3EO3A 2ZE2A 1C0UA 5GIOA 1HRHA 4FW2A 3UE5A 1Z6RA 3CJBA 4CJ5A 4DMNA 3UB5A 4DV7K 4JKGB 3I55N 3EKSA 5I9EB 5AQSA 1NKBA 4KREA 4DQ8A 2YHXA 4BRHA 3ZYYX 4DSFA 2HBJA 1RBTA 3CCRN 3FFIA 3AV9A 3SAFA 3ENOA 3WXJA 1IG9A 2Z1JA 4CFAA 4Z4HA 2QXLA 3LWLA 3ZT0A 4JEPA 4B9LA 2GWKA 1MWKA 3BP8A 4KHSA 4KHQA 4DB3A 2F8SA 5LJWA 4Q5VA 3H3OB 5T7BA 2HSTA 1QQCA 4BG8A 2HHTA 2P9PB 1KFSA 4M3XA 2KFNA 3I56N 3KWGA 3IRXA 4IG3A 1DTTA 3V9XA 1K8KA 2QXFA 3LALA 4DCHA 3QEXA 1VQKN 3AVCA 1ESVA 3E66A 1JLAA 1KAXA 3M8PA 3KLGA 4JI8K 2OPRA 1S9GA 3BUZB 3L2WA 1S1UA 5AR0A 1RTDA 4FWMA 4Z4IA 4FVMA 4JKBA 5KPRA 3HK2A 1IJJA 4DTPA 2BH1A 4U7BA 4GKKK 3AO2A 4EIAA 4DU1A 3DLRA 1KTQA 3DXKA 4CEAA 1QE1A 4LH5A 3ZX0A 3OYNA 4IBNA 5FROA 4WFAL 4LD0A 4AHVA 4DQQA 3VEZA 3OYLA 2BANA 2DFEA 3EE8A 3NH2A 4HHTA 5BPMA 1D9FA 1HKCA 4L8RB 4DR3K 1XWLA 4FWPA 4CEZA 3ZETA 4FWNA 2ASOA 5KGXA 1XNQK 1TL1A 2XRIA 1JLFA 1RTJA 4JK8A 3AVGA 2F9WA 4A2AA 1LW2A 1Q9XA 4KPYA 3WXMB 3RMCA 2F96A 4F4KA 4K25A 3PIPL 5AQXA 4W5RA 2WC9A 5A2QO 3U9ZA 5C2DA 3GL1A 2FF3B 4EZ6A 3QMLA 4RCHA 3NF6A 5C12A 5C25A 1HNZK 1ASWA 4BRNA 4FK2A 5E84A 4CEDA 4GMJB 4X62K 4EFHA 1I3AA 4C8KA 1N6QA 3RR7A 1SV5A 4O5BA 4WCEL 3THXB 3P83D 4BE0A 4QAGA 5HRRA 3J8AA 4FWLA 3TSUA 3KLHA 2A41A 1KC8O 4DF4A 1C0MA 1T3VA 4H0XB 2ASMA 1X9WA 5CR4A 3DOLA 2QWPA 2W6LA 1Q81O 3HPOA 4AILC 1JLBA 3WT0A 1HQUA 5C24A 1XHZA 1OH5A 3KD1E 1RILA 4NLBA 2PFUA 1RBUA 2NRHA 5KRSA 4CJQA 1DTQA 2PYLA 2GELA 2A40A 5I42A 1NK5A 4CEEA 5I3UA 4GNIA 2DFFA 4OGEA 1L3TA 4FK0A 3CHWA 4CIEA 3CJ9A 1BQMA 3ZT1A 3P4IA 3CYMA 1VQPN 1CXQA 3WUHA 3PIOL 2H3GX 1JXEA 4H0TB 4CHQA 2VYPA 2OA8A 4FO0A 3KK2A 2X6SA 1V4SA 3ZT2A 5BPLA 3Q7BA 4QOZB 3HO1A 3SAGA 1WUAA 1WSGA 4JK9A 2V7ZA 4FJGA 1ZBHA 1XC9A 2BUPA 3AVLA 4CHYA 3JXUA 2F9TA 2ATQA 4WQ5C 1VQ4N 3AAQA 2OCEA 1TKDA 3ZCMA 3H08A 4BRKA 1V4TA 3CPEA 1SAZA 3AA2A 4W5QA 5AQIA 2I5JA 4PA1A 4CF1A 3CJCA 1NGIA 4TSXA 1XMQK 1IBMK 1JXBA 4DV5K 4CF9A 2E5LK 5LMUK 3MEGA 4XH4A 4FJ5A 4DUYK 4EHUA 4BDZA 2LSNA 5LY3A 3PO4A 4IOCL 4CGFA 4CI6A 2FSKA 3GDQA 3AO5A 3SUQA 5F2RA 4U67L 3BGRA 4DQSA 1W7AA 2RPIA 3HT3A 2DTUA 2YHAA 3D45A 1Z26A 1OH6A 3ASMA 3HBTA 2QWOA 4WFNL 4DR7K 4A59A 4LFCK 1D4XA 4B08A 4DG1A 1QSYA 1LAWA 1QQMA 1KFDA 3A5NC 4H4MA 4IO8A 3OHRA 3D2FB 4JI2K 1BGXT 3OYHA 1WOQA 5CHIA 5JMVA 4CJTA 2ITGA 4NLCA 3P31A 1B9DA 4O0JA 3CCMN 1EO1A 2IS3A 3PLAA 4FK4A 1WSEA 4OPKA 3IUCA 3G6EN 3R3LA 2P9LB 1YVNA 2A1RA 3P39A 4EAHD 3EE9A 4AQYK 3DYAA 3VQDA 3HYFA 4FLUA 4DLEA 3S3OA 4CEOA 1L3VA 4YOTA 3K2PA 1FKPA 3VEYA 3CCEN 1RT5A 3VEXA 4OX9K 1J54A 3TAPA 3SUPA 3DJCA 3CG7A 4W5TA 1GLJO 4BR9A 4CJSA 3KK1A 2RN2A 4PL7A 3EN9A 3C6UA 5HROA 3SQ0A 3O3FA 1SUQA 5AQTA 4EP5A 3HM8A 2KLAA 1HKBA 1SL2A 2D5RA 2QK9A 3PSFA 4M3WA 4BC3A 1F21A 1VQ7N 3CI5A 1TYQA 3TSQA 2EWSA 3VEVA 3B6OA 3ULEB 4CBUA 2I7NA 2E6MA 3BZKA 5AQQA 5H1SQ 2JWLA 3HVRA 4CZKA 3VQ5A 3LL3A 1YJ9N 3V4IA 1C0TA 2Q36A 2X6NA 2ZJPL 4I6MA 4JNEA 3UKRB 1NGCA 1RFQA 2Q97A 1TUUA 4KFBA 1G15A 1YJWN 4NXMK 4N47A 4JI6K 1P90A 2IAJA 1RNHA 3M1FA 4WQ4C 1EX4A 4JV5K 1DT9A 4JD2A 1NJIO 2GWJA 1OH7A 4OKEA 3DLHA 2A6AA 4BACA 4FJ9A 2HHQA 4JS4A 4ISEA 4PKHA 4ILGB 2FBXA 1MDUB 3CC4N 2O8DA 3SK3A 4W5NA 4I2PA 4CJRA 4BR4A 3QFUA 1QVFM 3EKUA 4HVJA 3DMJA 2X74A 1NU0A 3KHYA 5FPMA 4CD3A 5SWMA 4WF9L 3L2VA 1WBBA 4IEIA 3MX2A 1QQOA 2P1JA 2VCPA 4YFUA 1UA0A 1YF5L 3EL2A 1VSMA 4DR5K 4CECA 1NMDA 5M1KA 3O1BA 2E4LA 3OYGA 3PUFA 3A5OC 3SJHA 4HCCA 2FLOA 1QSSA 3SMSA 4BDPA 3J81O 2HMIA 4I7FA 3V9SA 2NUBA 4DU4A 1VK0A 4O8UA 2UUAK 5CZ2A 2D0AA 2QM1A 4CERA 1EP4A 5AQRA 4E7LA 2DPNA 2HVIA 1SQKA 5EX5A 2NLXA 5JVHL 4NCBA 1HJOA 4DV4K 4LF9K 1R59O 4I9QA 4B1ZA 1NJWA 2ZGZA 3M8SA 1DEJA 4NYNA 4CJWA 3RMBA 4K8ZA 2A5XA 3QB0A 3AGRA 3WEEA 3GG4A 3T7ZA 1LV5A 2OTJN 3V9ZA 1VQLN 4DTMA 2VQFK 1OVYA 4PWDA 4FLTA 3OBWA 1NBWA 3HSTB 2QI2A 3DXMA 2E2OA 3RMAA 2ZJQL 1NK8A 4IFEA 2NRXA 2GBZA 3O4NA 3MAQA 4LF7K 5AQVA 5D3GA 3LDPA 3OVNA 3NH0A 1NKEA 4CJEA 4CCHA 3H3NO 4JKGA 5AQFA 1ATRA 1VQ8N 1BA0A 3T1YK 1Y64A 3VQEA 1J6ZA 3CM6A 2HHWA 1Q8IA 1OVQA 1S6QA 3KLIA 1T03A 3CD6N 4AHTA 3J7ZO 3CC2N 5TKWA 3S9HA 4CJFA 3LDQA 3QNOA 2ZJRL 1TGOA 4CHPA 4NYFA 4N41A 1RBVA 3K9KA 3VPZA 3OS2A 3AVIA 3CFOA 4A61A 1FK9A 1NLVA 4EHTA 1SKWA 4ELVA 4JAXA 3R6MA 2P9KA 2KQ2A 4DSJA 3BEXA 4E7JA 4JI0K 2GX9A 4FLYA 2VQEK 5DM7L 3K58A 4E7KA 5JS2A 3TANA 1CZ9A 2VWJA 4BG9A 2R7YA 4LF5K 1HJRA 2GV9A 1NK4A 4B1WB 1TVRA 2O8FA 3EEQA 4NB4A 4FCYA 1BQNA 1RGIA 5JVGL 1LOTB 3U3GA 5JICA 4H5WA 4KI6A 4KHWA 4CGHA 3LDOA 1M90O 1VQ5N 3HP9A 5HL7L 3SMPA 1QZ5A 4WE1A 3TARA 1BIUA 3TABA 1HKGA 1RDUA 4YOVA 2QA4N 2E2QA 3OYIA 1IBLK 5HRSA 3OYMA 1LWEA 4CBWA 4ELUA 4M7XA 2GUIA 3A5LC 4F8RA 1QSLA 4DV1K 4CHNA 1NGJA 4JKEA 5AQNA 3DM2A 4B1UB 1LW0A 4AF1A 3K59A 1S1XA 1CXUA 1LAVA 1C6VA 5FPEA 1QQNA 3SCXA 4DS5A 4YDUC 3HOTA 3C6TA 4DFJA 4JN4A 1NK9A 1YHQN 2OPSA 3NBPA 3KIOA 4NXNK 1Y97A 1BL3A 4OPHA 4Y1CA 1RDCA 1G99A 1VSLA 1IKXA 2KHOA 3HRGA 3AVJA 3TU5A 1KCFA 4QS7A 2B4JA 1YTAA 3THYB 4LF4K 4CE9A 2V7YA 3CJ7A 1E3MA 4DR4K 3RSEB 4H4OA 4KB1A 3MXIA 1HNXK 5GADP 4H8KA 1B9FA 3ZEUB 1K8KB 3HTVA 1CLQA 4J2EA 3KD5E 3W0LA 3QINA 3AA5X 1B92A 4CF0A 3O5BA 2NRRA 3THVA 1QS4A 1RDBA 2HF3A 2YKMA 4CVNE 2WONA 3KVGA 4F9OA 4KTWA 1WAJA 3HPHA 3UKUB 1KSPA 3BDPA 4M63C 4BR5A 3FZLA 5DMRA 3G4SN 2YI1A 4ZTJA 5GINA 4A5AA 5BRHA 1TKXA 1N33K 3D2EB 5F1XA 1T7PA 3ATUA 3VEWA 5J1EA 4CK2A 3AVHA 3THWA 4H0PA 3KK7A 3MEEA 4YHHK 1BCMA 1DGKN 3LM2A 3J7AP 2HBKA 2AA4A 4BVOA 1RTHA 4HUEA 3CMEN 1IG8A 4MLHA 3CF5L 3R1XA 3M6GA 4RW4A 3F9MA 4FJIA 4IO9L 5AQUA 4C23A 1JLEA 4H5NA 4MO4A 4PKGA 1D5AA 3NE6A 3RTVA 4DTJA 1RT1A 3MWPA 3SBTA 2BGGA 3PX4A 3VF2A 3M5RA 5BN8A 4UQGA 3FGUA 2P9NB 3LAKA 3VQ8A 1TKTA 3PY8A 3DRRA 1OKJA 3WQTA 1TYQB 5M1QA 3PX0A 2JWKA 4BRCA 1XQSC 4CK3A 3LP0A 1WAFA 1QZ6A 3QEVA 1WLJA 1NGBA 2CGKA 3CMAN 1IKYA 2QW9A 2XHBA 2WFBA 3TTFA 3FR0A 3NVKA 3LAMA 3C6HA 4LH4A 4ELTA 3L2QA 4DHYA 4K41A 1HUXA 3OYBA 2X78A 1K8AO 3AO3A 4E1JA 1BWFO 4Z4GA 3VTHA
chains in the Genus database with same CATH topology
4E89A 5J2PA 3QESA 1KLNA 3WNFA 1NK0A 3SJJA 1WSEA 2KZZA 3D0PA 4C8MA 4DTXA 1ITGA 2YHBA 4OPKA 1BHLA 4CJPA 1WNSA 1S5JA 2A1RA 2HNDA 4W5OA 3HVTA 3PV8A 2PYJA 2XY8A 3DLKA 3NHGA 4OGCA 4F3OA 3DYAA 5FRNA 3VQDA 3HYFA 2HHXA 4FLUA 2HHTA 4LY7A 4B3OA 4DLEA 2JGUA 3O3HA 1K6YA 4E7HA 5JS1A 3P5JA 3MXMA 3S3OA 3L8BA 3SI6A 4RG8A 3V1OA 4CEOA 1XI1A 1L3VA 1MU2A 3RWUA 4C8LA 1VSEA 3K2PA 4B9NA 1FKPA 3LZIA 3O4QA 4FZXC 1ZYQA 4IFVA 1BISA 1RT5A 2DFHA 4OVLA 1J54A 4FJ8A 3TAPA 2D0BA 4FM0A 3SUPA 1RT4A 4IG0A 4M42A 3CG7A 4W5TA 4FLZA 2KW4A 4CJSA 1RBSA 2ZQBA 4N56A 2RN2A 3KK1A 3T3FA 3C6UA 3V9WA 4FJLA 1J5OA 1HYSA 3NGYA 5HROA 2FBTA 4B8CA 4O55A 4BWMA 1SUQA 3O3FA 4EP5A 3SQ0A 3VQ9A 3SNNA 4HUGA 2IGIA 3K5OA 4CJLA 2G8KA 2Y1JA 4ICLA 3M8RA 1X9SA 4CGJA 3OJSA 1JL1A 1IKWA 3K57A 5DK5A 1SL2A 2D5RA 4FZYA 4OKJA 4OKKA 4DFPA 2QK9A 4KHUA 4CGDA 3RRHA 4G1QA 1JLCA 1CZBA 1F21A 2VWKA 4FLWA 1SKSA 4M3WA 4OLBA 4MFBA 3KLFA 4ZTFA 4FJKA 3I0RA 3NF8A 3P1GA 2XY5A 3A2FA 3RRGA 1HMVA 2JLEA 2XY6A 2DY4A 3B6OA 3ZT3A 2PY5A 1W0HA 5CY4A 3AVAA 3EY1A 2E6MA 1A5WA 3QEWA 4DF8A 2YKNA 1U04A 3DRPA 3VQCA 3JYTA 3IAYA 3HXMA 3TAMA 3HVRA 3HM9A 1D9DA 2G8IA 3VQ5A 2Y1IA 3V4IA 3NF7A 3ULDA 1KVCA 4E0DA 3TI0A 1QTMA 2G8FA 5J2MA 1J53A 3F9KA 1C0TA 2X6NA 4CJ4A 3CQ8A 3QNNA 1N5YA 1ASVA 4DTSA 4M45A 1VSDA 2VG5A 4KFBA 1G15A 4BE2A 4N47A 1VRTA 1T05A 4KHYA 3ZSQA 2QKBA 1VRUA 1IH7A 2IAJA 4FLXA 2FC0A 1SL1A 1RNHA 4MQ3A 4RW8A 3SQ4A 4KHNA 2HHUA 3KTQA 3TR8A 2HNZA 1EX4A 3S3NA 4PUOA 4BWJA 4CJUA 5KTQA 1GOBA 1HYZA 1NKCA 3ZSWA 3SQ2A 4OKEA 3NFAA 2VG6A 4CF2A 3DLHA 4GW6A 2YNFA 5HBMA 3SQ1A 4BACA 1VSJA 3G10A 5HRPA 3ZT4A 3K5LA 3WNHA 4DS4A 1TK5A 4CGGA 4FJ9A 2HHQA 4JS4A 2HNYA 1UA1A 1FKOA 4CFDA 1SKRA 3TAQA 3VN5A 2FBXA 2YNIA 3AA3A 1QHTA 5K14A 3NH1A 4FJ7A 1NJYA 2RKIA 1KRPA 4FJJA 3KK3A 1I39A 4W5NA 4M3YA 3DLBA 1YVUA 1BI4A 4I2PA 4DFMA 3TAEA 3SZ2A 3S3MA 4M3ZA 4CJRA 1A5VA 4DSIA 4CHZA 4Z4FA 4HVJA 4Z4CA 4FLVA 3DMJA 4DU3A 4FYDA 2X74A 3KKRA 4PQUA 1TL3A 4E1NA 4DQPA 3ZSVA 5SWMA 1VSFA 3LANA 3L2VA 5C42A 2P1JA 3VQ6A 4YFUA 1RDAA 1UA0A 2KZMA 2HHVA 5J2NA 4AHCA 3EYZA 1VSMA 4CECA 2AJQA 3I0SA 3QO9A 2E4LA 2B5JA 3OYGA 1WSFA 4KI4A 3PUFA 1FXXA 4B9SA 4AHRA 4B9UA 4HUFA 4HCCA 4BDYA 4QCLA 4Z0UA 2EHGA 3PO5A 1Z25A 3L2RA 1REVA 2FBYA 1QSSA 4BDPA 2HMIA 4I7FA 3VA0A 3V9SA 2P5GA 1NJXA 2NUBA 1R0AA 3RMDA 4DU4A 3OYAA 2VG7A 1O1WA 1VK0A 4XIUA 4PY5A 1JKHA 1TK8A 4KRFA 5CZ2A 2D0AA 2IDOA 2P5OA 3ZSXA 1TAUA 1SL0A 3OY9A 2YV0X 4DTUA 2KFZA 1WSJA 4HTUA 4O44A 3SV3A 4CERA 3K5MA 3SUNA 1S1TA 4FZZA 5FRMA 1EP4A 4E7LA 3DRSA 1WSHA 3CM5A 3C94A 4CESA 3M8QA 4E7IA 4HCBA 4Z4EA 3MEDA 3VQ4A 4EP4A 1ASUA 4JLHA 3NGZA 1ZBIA 4CJ3A 1LWCA 3SV4A 4OLAA 4CHOA 3ZSOA 5J2QA 4NCBA 4J2AA 2Q3SA 1LWFA 3VQPA 2A1SA 4DQIA 3LZJA 2EX3A 4I9QA 1WN7A 4FM1A 3M8SA 3V9UA 1NJWA 4NYNA 2ZE2A 4CJWA 3RMBA 1RDDA 4KTZA 4K8ZA 4M3TA 4DTNA 1C0UA 4KKOA 3I8DA 3ISNC 1HRHA 3E01A 4ID1A 4FW2A 3NGIA 4J2DA 4CIFA 4CJ5A 5EU7A 4DMNA 3T1AA 4FJMA 2OZSA 1LV5A 5KGWA 4DLGA 1U48A 4O0IA 3UIQA 4NCAA 3V9ZA 3HPGA 3OYFA 3L2UA 4DTMA 2HW3A 1X9MA 1NKBA 4FLTA 1S9EA 4PWDA 4KREA 1BCOA 4I2QA 3HSTB 4DSEA 5HLFA 1UOCA 4DTRA 4DSFA 3WNGA 2HVHA 1RBTA 2WOMA 3L3VA 4DSKA 1DLOA 3RMAA 1NK8A 3OYCA 1RT6A 3QETA 3FFIA 3AV9A 2Z1IA 4JRPA 2GBZA 3O4NA 3MAQA 1RT2A 3DLGA 1IG9A 2Z1JA 4CFAA 1C1CA 4Z4HA 3NAEA 3LWLA 5D3GA 4DQRA 3ZT0A 3ZSZA 4B9LA 4E19A 3VQ7A 4KHSA 3OVNA 3NH0A 1NKEA 3VQAA 4CJEA 4CCHA 4KHQA 4LSLA 4F3TA 2F8SA 4Q5VA 1RTIA 5T7BA 5CYMA 3VQEA 1XHXA 1QQCA 1HYVA 1RCHA 3L3UA 4Y1DA 4B8AB 2B6AA 3CM6A 4FM2A 4AHUA 2O4GA 1Q8IA 1S6QA 3KLIA 1T03A 1KFSA 4M3XA 2HHWA 1YTUA 2KFNA 4IG3A 3IRXA 4DFKA 4F2SA 4AHTA 2G8WA 3S9HA 1DTTA 4CJFA 3V9XA 3QNOA 1TGOA 4CHPA 2QXFA 3LALA 4NYFA 4ZHRA 5HRNA 3QEXA 4N41A 3KLEA 1RBVA 3AVCA 1U47A 3OS2A 3AVIA 3CFOA 5KRTA 1FK9A 3PX6A 1HNVA 1SKWA 3M8PA 1JLAA 3KLGA 4ELVA 2OPRA 1HQEA 1U45A 1S9GA 3L2WA 2KQ2A 4DSJA 1S1UA 1RTDA 4E7JA 5CYQA 4Z4IA 1TKZA 4FVMA 2YNHA 3V1QA 3T19A 3HK2A 4FLYA 4DTPA 4CFCA 4KTQA 1BI4B 3K58A 2Z1HA 3LP1A 4E7KA 5JS2A 3AO2A 3TANA 3V6DA 1CZ9A 2VWJA 4DU1A 2R7YA 4E3SA 3DLRA 1HJRA 2GV9A 4J2BA 1KTQA 1IKVA 5CZ1A 1NK4A 1TVRA 1YT3A 4N5SA 4FCYA 4CEAA 1QE1A 2P51A 1BQNA 4LH5A 1ZBFA 4M3UA 1UWBA 3OYNA 1NK6A 3U3GA 4IBNA 5FROA 1D8YA 4IDKA 3AO4A 4LD0A 1A5XA 3SYZA 3AVFA 4AHVA 4DQQA 4KI6A 4KHWA 4CGHA 1NOZA 3TWHA 3QERA 3OYLA 2BANA 2DFEA 4FXDA 3NH2A 1S1VA 4CEBA 4HHTA 4CK1A 3SPZA 3HP9A 2D0CA 3OS0A 4WE1A 3TARA 1D9FA 4DSLA 1BIUA 4CFBA 3C95A 3TABA 4L8RB 3OYDA 2BE2A 3HL8A 1XWLA 1VSKA 3F73A 4CEZA 2OPPA 3OYIA 3ZSYA 1L3SA 5HRSA 3KKSA 3OYMA 5KGXA 1LWEA 3OYJA 1U49A 4ELUA 1TL1A 2XRIA 1JLFA 1RTJA 5FDLA 2GUIA 4KB0A 4F8RA 1TV6A 3AVGA 1Q9XA 1GOCA 1LW2A 3G0ZA 1QSLA 4KPYA 3SPYA 4CHNA 4FJNA 3RMCA 2F96A 3QEPA 4F4KA 3DM2A 1BIZA 1KVBA 4W5RA 1LW0A 3K59A 1EXQA 1S1XA 1CXUA 1LAVA 1C6VA 3VQQA 3SCXA 4EZ6A 1X1PA 4DS5A 3C6TA 4DFJA 3NF6A 3U3YA 1NK9A 4R5PA 3LPUA 5C25A 4RW9A 1ASWA 2HB5A 2OPSA 1S1WA 3DI6A 3AO1A 3KIOA 3NBPA 4FK2A 1Y97A 4CEDA 1BL3A 5KI6A 4Y1CA 4GMJB 3LDSA 1RDCA 1VSLA 4LSNA 3OYEA 1IKXA 3QLHA 4OJRA 4C8NA 1I3AA 1JL2A 3JSMA 1N6QA 3AVJA 2G8VA 3RR7A 4C8KA 2F8TA 4CJKA 1SV5A 4O5BA 1KCFA 3CFRA 3AA4A 2B4JA 4DTOA 2HHSA 1YTAA 4CF8A 3K5NA 3NDKA 4IKFA 3LP3A 3P83D 4CE9A 4BE0A 2BDPA 4QAGA 1EKEA 4RW7A 4N76A 5HRRA 1S6PA 4B9TA 4CEQA 3MXJA 4K8XA 3KLHA 4DF4A 1C0MA 4H4OA 4FJXA 1W9HA 4KB1A 1RBRA 1X9WA 3MXIA 1EETA 3DOLA 4O4GA 3AVNA 4H8KA 3EZ5A 1B9FA 1L5UA 3HPOA 1TAQA 4AILC 1JLBA 1CLQA 1HQUA 4J2EA 4RW6A 5C24A 1XHZA 4M3RA 2KTQA 3KD5E 1GOAA 3LP2A 3KD1E 3QINA 1RILA 3AA5X 4IFYA 1RBUA 5KRSA 3ITHA 1B92A 1DTQA 3ALYA 4CF0A 2E6LA 4CJQA 3CFPA 3THVA 2PYLA 1NOYA 1QS4A 4DWIA 1RDBA 5I42A 2OYQA 4F2RA 2G8UA 4E1MA 1NK5A 3NF9A 4CEEA 2YKMA 4YNQA 2WONA 5I3UA 2FBVA 1WAJA 1VSIA 3HPHA 3LPTA 4KTWA 5HP1A 1KSPA 3BDPA 3QIPA 1KLMA 1RT7A 2DFFA 5DMRA 4OGEA 1T8EA 4AHSA 1L3TA 4FK0A 2ETJA 4CIEA 3B6PA 1ZBLA 4CEFA 4ZTJA 2HVIA 1BQMA 3HP6A 4KAZA 1KVAA 4GVMA 3ZT1A 1J9AA 1TKXA 3WNEA 1HNIA 3CYMA 1CXQA 4B9VA 1NK7A 1T7PA 1JXEA 4CHQA 3DLEA 2RF2A 5J1EA 4EZ9A 4CK2A 2OA8A 3KK2A 2X6SA 3AVHA 3V81A 1L3UA 3MEEA 5E41A 2Z1GA 3ZT2A 1Q9YA 4QOZB 1BCMA 3HO1A 1WSGA 1HPZA 4ID5A 1RTHA 4JS5A 4HUEA 2IOCA 2XY7A 4RW4A 4CJVA 1TK0A 4FJIA 4FJGA 1WSIA 3VQBA 4I9LA 1XC9A 1ZBHA 3U6FA 3ZSRA 3AVLA 5SZTA 4CHYA 3V1RA 3IG1A 2ATQA 3IS9A 2W42A 1JLEA 4C8OA 1TKDA 3ZCMA 3H08A 4KV8A 1D5AA 3RR8A 1VSHA 1JLGA 3AA2A 4W5QA 3NE6A 3RTVA 3AVKA 4KO0A 3NCIA 2I5JA 4PA1A 4M41A 4CF1A 4OPJA 4TSXA 4AH9A 3QIOA 1U4BA 4NCGA 4DTJA 3O3GA 3SUOA 1JXBA 1RT1A 4CIGA 2BGGA 4CF9A 3PX4A 3MEGA 4FJ5A 2OPQA 4BDZA 4UQGA 4JRQA 2LSNA 3TAGA 2OZMA 1C1BA 3PO4A 3LAKA 3VQ8A 1TKTA 3PY8A 3DRRA 4CGFA 1JLQA 3OJUA 4BE1A 4Q0BA 3AO5A 3SUQA 3PX0A 3BGRA 4DQSA 2RPIA 3AVBA 3HT3A 1UAXA 2YNGA 4FW1A 2YHAA 3D45A 3OS1A 1Z26A 2XO7A 2DTUA 3ASMA 4CK3A 3DOKA 3LP0A 1WAFA 3QEVA 2PZSA 1WLJA 3AVMA 3MECA 4B08A 4DG1A 1QSYA 2ZD1A 1IKYA 1LAWA 2XHBA 1KFDA 4H4MA 2O4IA 2IC3A 1IO2A 1NJZA 1C1AA 1BGXT 2QKKA 3KJVA 3OYHA 4FJHA 3LWMA 3LAMA 1ZBUA 4CJTA 3HJFA 4LH4A 3VA3A 3L2QA 2ITGA 3QEIA 4ELTA 1B9DA 4O0JA 2G8HA 3OYBA 2X78A 3TAFA 4CGIA 1RT3A 2IS3A 3AO3A 4B9MA 4Z4GA 3OYKA 4FK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E89 A;  5J2P A;  3QES A;  1KLN A;  3WNF A;  1NK0 A;  3SJJ A;  1WSE A;  2KZZ A;  3D0P A;  4C8M A;  4DTX A;  1ITG A;  2YHB A;  4OPK A;  1BHL A;  4CJP A;  1WNS A;  1S5J A;  2A1R A;  2HND A;  4W5O A;  3HVT A;  3PV8 A;  2PYJ A;  2XY8 A;  3DLK A;  3NHG A;  4OGC A;  4F3O A;  3DYA A;  5FRN A;  3VQD A;  3HYF A;  2HHX A;  4FLU A;  2HHT A;  4LY7 A;  4B3O A;  4DLE A;  2JGU A;  3O3H A;  1K6Y A;  4E7H A;  5JS1 A;  3P5J A;  3MXM A;  3S3O A;  3L8B A;  3SI6 A;  4RG8 A;  3V1O A;  4CEO A;  1XI1 A;  1L3V A;  1MU2 A;  3RWU A;  4C8L A;  1VSE A;  3K2P A;  4B9N A;  1FKP A;  3LZI A;  3O4Q A;  4FZX C;  1ZYQ A;  4IFV A;  1BIS A;  1RT5 A;  2DFH A;  4OVL A;  1J54 A;  4FJ8 A;  3TAP A;  2D0B A;  4FM0 A;  3SUP A;  1RT4 A;  4IG0 A;  4M42 A;  3CG7 A;  4W5T A;  4FLZ A;  2KW4 A;  4CJS A;  1RBS A;  2ZQB A;  4N56 A;  2RN2 A;  3KK1 A;  3T3F A;  3C6U A;  3V9W A;  4FJL A;  1J5O A;  1HYS A;  3NGY A;  5HRO A;  2FBT A;  4B8C A;  4O55 A;  4BWM A;  1SUQ A;  3O3F A;  4EP5 A;  3SQ0 A;  3VQ9 A;  3SNN A;  4HUG A;  2IGI A;  3K5O A;  4CJL A;  2G8K A;  2Y1J A;  4ICL A;  3M8R A;  1X9S A;  4CGJ A;  3OJS A;  1JL1 A;  1IKW A;  3K57 A;  5DK5 A;  1SL2 A;  2D5R A;  4FZY A;  4OKJ A;  4OKK A;  4DFP A;  2QK9 A;  4KHU A;  4CGD A;  3RRH A;  4G1Q A;  1JLC A;  1CZB A;  1F21 A;  2VWK A;  4FLW A;  1SKS A;  4M3W A;  4OLB A;  4MFB A;  3KLF A;  4ZTF A;  4FJK A;  3I0R A;  3NF8 A;  3P1G A;  2XY5 A;  3A2F A;  3RRG A;  1HMV A;  2JLE A;  2XY6 A;  2DY4 A;  3B6O A;  3ZT3 A;  2PY5 A;  1W0H A;  5CY4 A;  3AVA A;  3EY1 A;  2E6M A;  1A5W A;  3QEW A;  4DF8 A;  2YKN A;  1U04 A;  3DRP A;  3VQC A;  3JYT A;  3IAY A;  3HXM A;  3TAM A;  3HVR A;  3HM9 A;  1D9D A;  2G8I A;  3VQ5 A;  2Y1I A;  3V4I A;  3NF7 A;  3ULD A;  1KVC A;  4E0D A;  3TI0 A;  1QTM A;  2G8F A;  5J2M A;  1J53 A;  3F9K A;  1C0T A;  2X6N A;  4CJ4 A;  3CQ8 A;  3QNN A;  1N5Y A;  1ASV A;  4DTS A;  4M45 A;  1VSD A;  2VG5 A;  4KFB A;  1G15 A;  4BE2 A;  4N47 A;  1VRT A;  1T05 A;  4KHY A;  3ZSQ A;  2QKB A;  1VRU A;  1IH7 A;  2IAJ A;  4FLX A;  2FC0 A;  1SL1 A;  1RNH A;  4MQ3 A;  4RW8 A;  3SQ4 A;  4KHN A;  2HHU A;  3KTQ A;  3TR8 A;  2HNZ A;  1EX4 A;  3S3N A;  4PUO A;  4BWJ A;  4CJU A;  5KTQ A;  1GOB A;  1HYZ A;  1NKC A;  3ZSW A;  3SQ2 A;  4OKE A;  3NFA A;  2VG6 A;  4CF2 A;  3DLH A;  4GW6 A;  2YNF A;  5HBM A;  3SQ1 A;  4BAC A;  1VSJ A;  3G10 A;  5HRP A;  3ZT4 A;  3K5L A;  3WNH A;  4DS4 A;  1TK5 A;  4CGG A;  4FJ9 A;  2HHQ A;  4JS4 A;  2HNY A;  1UA1 A;  1FKO A;  4CFD A;  1SKR A;  3TAQ A;  3VN5 A;  2FBX A;  2YNI A;  3AA3 A;  1QHT A;  5K14 A;  3NH1 A;  4FJ7 A;  1NJY A;  2RKI A;  1KRP A;  4FJJ A;  3KK3 A;  1I39 A;  4W5N A;  4M3Y A;  3DLB A;  1YVU A;  1BI4 A;  4I2P A;  4DFM A;  3TAE A;  3SZ2 A;  3S3M A;  4M3Z A;  4CJR A;  1A5V A;  4DSI A;  4CHZ A;  4Z4F A;  4HVJ A;  4Z4C A;  4FLV A;  3DMJ A;  4DU3 A;  4FYD A;  2X74 A;  3KKR A;  4PQU A;  1TL3 A;  4E1N A;  4DQP A;  3ZSV A;  5SWM A;  1VSF A;  3LAN A;  3L2V A;  5C42 A;  2P1J A;  3VQ6 A;  4YFU A;  1RDA A;  1UA0 A;  2KZM A;  2HHV A;  5J2N A;  4AHC A;  3EYZ A;  1VSM A;  4CEC A;  2AJQ A;  3I0S A;  3QO9 A;  2E4L A;  2B5J A;  3OYG A;  1WSF A;  4KI4 A;  3PUF A;  1FXX A;  4B9S A;  4AHR A;  4B9U A;  4HUF A;  4HCC A;  4BDY A;  4QCL A;  4Z0U A;  2EHG A;  3PO5 A;  1Z25 A;  3L2R A;  1REV A;  2FBY A;  1QSS A;  4BDP A;  2HMI A;  4I7F A;  3VA0 A;  3V9S A;  2P5G A;  1NJX A;  2NUB A;  1R0A A;  3RMD A;  4DU4 A;  3OYA A;  2VG7 A;  1O1W A;  1VK0 A;  4XIU A;  4PY5 A;  1JKH A;  1TK8 A;  4KRF A;  5CZ2 A;  2D0A A;  2IDO A;  2P5O A;  3ZSX A;  1TAU A;  1SL0 A;  3OY9 A;  2YV0 X;  4DTU A;  2KFZ A;  1WSJ A;  4HTU A;  4O44 A;  3SV3 A;  4CER A;  3K5M A;  3SUN A;  1S1T A;  4FZZ A;  5FRM A;  1EP4 A;  4E7L A;  3DRS A;  1WSH A;  3CM5 A;  3C94 A;  4CES A;  3M8Q A;  4E7I A;  4HCB A;  4Z4E A;  3MED A;  3VQ4 A;  4EP4 A;  1ASU A;  4JLH A;  3NGZ A;  1ZBI A;  4CJ3 A;  1LWC A;  3SV4 A;  4OLA A;  4CHO A;  3ZSO A;  5J2Q A;  4NCB A;  4J2A A;  2Q3S A;  1LWF A;  3VQP A;  2A1S A;  4DQI A;  3LZJ A;  2EX3 A;  4I9Q A;  1WN7 A;  4FM1 A;  3M8S A;  3V9U A;  1NJW A;  4NYN A;  2ZE2 A;  4CJW A;  3RMB A;  1RDD A;  4KTZ A;  4K8Z A;  4M3T A;  4DTN A;  1C0U A;  4KKO A;  3I8D A;  3ISN C;  1HRH A;  3E01 A;  4ID1 A;  4FW2 A;  3NGI A;  4J2D A;  4CIF A;  4CJ5 A;  5EU7 A;  4DMN A;  3T1A A;  4FJM A;  2OZS A;  1LV5 A;  5KGW A;  4DLG A;  1U48 A;  4O0I A;  3UIQ A;  4NCA A;  3V9Z A;  3HPG A;  3OYF A;  3L2U A;  4DTM A;  2HW3 A;  1X9M A;  1NKB A;  4FLT A;  1S9E A;  4PWD A;  4KRE A;  1BCO A;  4I2Q A;  3HST B;  4DSE A;  5HLF A;  1UOC A;  4DTR A;  4DSF A;  3WNG A;  2HVH A;  1RBT A;  2WOM A;  3L3V A;  4DSK A;  1DLO A;  3RMA A;  1NK8 A;  3OYC A;  1RT6 A;  3QET A;  3FFI A;  3AV9 A;  2Z1I A;  4JRP A;  2GBZ A;  3O4N A;  3MAQ A;  1RT2 A;  3DLG A;  1IG9 A;  2Z1J A;  4CFA A;  1C1C A;  4Z4H A;  3NAE A;  3LWL A;  5D3G A;  4DQR A;  3ZT0 A;  3ZSZ A;  4B9L A;  4E19 A;  3VQ7 A;  4KHS A;  3OVN A;  3NH0 A;  1NKE A;  3VQA A;  4CJE A;  4CCH A;  4KHQ A;  4LSL A;  4F3T A;  2F8S A;  4Q5V A;  1RTI A;  5T7B A;  5CYM A;  3VQE A;  1XHX A;  1QQC A;  1HYV A;  1RCH A;  3L3U A;  4Y1D A;  4B8A B;  2B6A A;  3CM6 A;  4FM2 A;  4AHU A;  2O4G A;  1Q8I A;  1S6Q A;  3KLI A;  1T03 A;  1KFS A;  4M3X A;  2HHW A;  1YTU A;  2KFN A;  4IG3 A;  3IRX A;  4DFK A;  4F2S A;  4AHT A;  2G8W A;  3S9H A;  1DTT A;  4CJF A;  3V9X A;  3QNO A;  1TGO A;  4CHP A;  2QXF A;  3LAL A;  4NYF A;  4ZHR A;  5HRN A;  3QEX A;  4N41 A;  3KLE A;  1RBV A;  3AVC A;  1U47 A;  3OS2 A;  3AVI A;  3CFO A;  5KRT A;  1FK9 A;  3PX6 A;  1HNV A;  1SKW A;  3M8P A;  1JLA A;  3KLG A;  4ELV A;  2OPR A;  1HQE A;  1U45 A;  1S9G A;  3L2W A;  2KQ2 A;  4DSJ A;  1S1U A;  1RTD A;  4E7J A;  5CYQ A;  4Z4I A;  1TKZ A;  4FVM A;  2YNH A;  3V1Q A;  3T19 A;  3HK2 A;  4FLY A;  4DTP A;  4CFC A;  4KTQ A;  1BI4 B;  3K58 A;  2Z1H A;  3LP1 A;  4E7K A;  5JS2 A;  3AO2 A;  3TAN A;  3V6D A;  1CZ9 A;  2VWJ A;  4DU1 A;  2R7Y A;  4E3S A;  3DLR A;  1HJR A;  2GV9 A;  4J2B A;  1KTQ A;  1IKV A;  5CZ1 A;  1NK4 A;  1TVR A;  1YT3 A;  4N5S A;  4FCY A;  4CEA A;  1QE1 A;  2P51 A;  1BQN A;  4LH5 A;  1ZBF A;  4M3U A;  1UWB A;  3OYN A;  1NK6 A;  3U3G A;  4IBN A;  5FRO A;  1D8Y A;  4IDK A;  3AO4 A;  4LD0 A;  1A5X A;  3SYZ A;  3AVF A;  4AHV A;  4DQQ A;  4KI6 A;  4KHW A;  4CGH A;  1NOZ A;  3TWH A;  3QER A;  3OYL A;  2BAN A;  2DFE A;  4FXD A;  3NH2 A;  1S1V A;  4CEB A;  4HHT A;  4CK1 A;  3SPZ A;  3HP9 A;  2D0C A;  3OS0 A;  4WE1 A;  3TAR A;  1D9F A;  4DSL A;  1BIU A;  4CFB A;  3C95 A;  3TAB A;  4L8R B;  3OYD A;  2BE2 A;  3HL8 A;  1XWL A;  1VSK A;  3F73 A;  4CEZ A;  2OPP A;  3OYI A;  3ZSY A;  1L3S A;  5HRS A;  3KKS A;  3OYM A;  5KGX A;  1LWE A;  3OYJ A;  1U49 A;  4ELU A;  1TL1 A;  2XRI A;  1JLF A;  1RTJ A;  5FDL A;  2GUI A;  4KB0 A;  4F8R A;  1TV6 A;  3AVG A;  1Q9X A;  1GOC A;  1LW2 A;  3G0Z A;  1QSL A;  4KPY A;  3SPY A;  4CHN A;  4FJN A;  3RMC A;  2F96 A;  3QEP A;  4F4K A;  3DM2 A;  1BIZ A;  1KVB A;  4W5R A;  1LW0 A;  3K59 A;  1EXQ A;  1S1X A;  1CXU A;  1LAV A;  1C6V A;  3VQQ A;  3SCX A;  4EZ6 A;  1X1P A;  4DS5 A;  3C6T A;  4DFJ A;  3NF6 A;  3U3Y A;  1NK9 A;  4R5P A;  3LPU A;  5C25 A;  4RW9 A;  1ASW A;  2HB5 A;  2OPS A;  1S1W A;  3DI6 A;  3AO1 A;  3KIO A;  3NBP A;  4FK2 A;  1Y97 A;  4CED A;  1BL3 A;  5KI6 A;  4Y1C A;  4GMJ B;  3LDS A;  1RDC A;  1VSL A;  4LSN A;  3OYE A;  1IKX A;  3QLH A;  4OJR A;  4C8N A;  1I3A A;  1JL2 A;  3JSM A;  1N6Q A;  3AVJ A;  2G8V A;  3RR7 A;  4C8K A;  2F8T A;  4CJK A;  1SV5 A;  4O5B A;  1KCF A;  3CFR A;  3AA4 A;  2B4J A;  4DTO A;  2HHS A;  1YTA A;  4CF8 A;  3K5N A;  3NDK A;  4IKF A;  3LP3 A;  3P83 D;  4CE9 A;  4BE0 A;  2BDP A;  4QAG A;  1EKE A;  4RW7 A;  4N76 A;  5HRR A;  1S6P A;  4B9T A;  4CEQ A;  3MXJ A;  4K8X A;  3KLH A;  4DF4 A;  1C0M A;  4H4O A;  4FJX A;  1W9H A;  4KB1 A;  1RBR A;  1X9W A;  3MXI A;  1EET A;  3DOL A;  4O4G A;  3AVN A;  4H8K A;  3EZ5 A;  1B9F A;  1L5U A;  3HPO A;  1TAQ A;  4AIL C;  1JLB A;  1CLQ A;  1HQU A;  4J2E A;  4RW6 A;  5C24 A;  1XHZ A;  4M3R A;  2KTQ A;  3KD5 E;  1GOA A;  3LP2 A;  3KD1 E;  3QIN A;  1RIL A;  3AA5 X;  4IFY A;  1RBU A;  5KRS A;  3ITH A;  1B92 A;  1DTQ A;  3ALY A;  4CF0 A;  2E6L A;  4CJQ A;  3CFP A;  3THV A;  2PYL A;  1NOY A;  1QS4 A;  4DWI A;  1RDB A;  5I42 A;  2OYQ A;  4F2R A;  2G8U A;  4E1M A;  1NK5 A;  3NF9 A;  4CEE A;  2YKM A;  4YNQ A;  2WON A;  5I3U A;  2FBV A;  1WAJ A;  1VSI A;  3HPH A;  3LPT A;  4KTW A;  5HP1 A;  1KSP A;  3BDP A;  3QIP A;  1KLM A;  1RT7 A;  2DFF A;  5DMR A;  4OGE A;  1T8E A;  4AHS A;  1L3T A;  4FK0 A;  2ETJ A;  4CIE A;  3B6P A;  1ZBL A;  4CEF A;  4ZTJ A;  2HVI A;  1BQM A;  3HP6 A;  4KAZ A;  1KVA A;  4GVM A;  3ZT1 A;  1J9A A;  1TKX A;  3WNE A;  1HNI A;  3CYM A;  1CXQ A;  4B9V A;  1NK7 A;  1T7P A;  1JXE A;  4CHQ A;  3DLE A;  2RF2 A;  5J1E A;  4EZ9 A;  4CK2 A;  2OA8 A;  3KK2 A;  2X6S A;  3AVH A;  3V81 A;  1L3U A;  3MEE A;  5E41 A;  2Z1G A;  3ZT2 A;  1Q9Y A;  4QOZ B;  1BCM A;  3HO1 A;  1WSG A;  1HPZ A;  4ID5 A;  1RTH A;  4JS5 A;  4HUE A;  2IOC A;  2XY7 A;  4RW4 A;  4CJV A;  1TK0 A;  4FJI A;  4FJG A;  1WSI A;  3VQB A;  4I9L A;  1XC9 A;  1ZBH A;  3U6F A;  3ZSR A;  3AVL A;  5SZT A;  4CHY A;  3V1R A;  3IG1 A;  2ATQ A;  3IS9 A;  2W42 A;  1JLE A;  4C8O A;  1TKD A;  3ZCM A;  3H08 A;  4KV8 A;  1D5A A;  3RR8 A;  1VSH A;  1JLG A;  3AA2 A;  4W5Q A;  3NE6 A;  3RTV A;  3AVK A;  4KO0 A;  3NCI A;  2I5J A;  4PA1 A;  4M41 A;  4CF1 A;  4OPJ A;  4TSX A;  4AH9 A;  3QIO A;  1U4B A;  4NCG A;  4DTJ A;  3O3G A;  3SUO A;  1JXB A;  1RT1 A;  4CIG A;  2BGG A;  4CF9 A;  3PX4 A;  3MEG A;  4FJ5 A;  2OPQ A;  4BDZ A;  4UQG A;  4JRQ A;  2LSN A;  3TAG A;  2OZM A;  1C1B A;  3PO4 A;  3LAK A;  3VQ8 A;  1TKT A;  3PY8 A;  3DRR A;  4CGF A;  1JLQ A;  3OJU A;  4BE1 A;  4Q0B A;  3AO5 A;  3SUQ A;  3PX0 A;  3BGR A;  4DQS A;  2RPI A;  3AVB A;  3HT3 A;  1UAX A;  2YNG A;  4FW1 A;  2YHA A;  3D45 A;  3OS1 A;  1Z26 A;  2XO7 A;  2DTU A;  3ASM A;  4CK3 A;  3DOK A;  3LP0 A;  1WAF A;  3QEV A;  2PZS A;  1WLJ A;  3AVM A;  3MEC A;  4B08 A;  4DG1 A;  1QSY A;  2ZD1 A;  1IKY A;  1LAW A;  2XHB A;  1KFD A;  4H4M A;  2O4I A;  2IC3 A;  1IO2 A;  1NJZ A;  1C1A A;  1BGX T;  2QKK A;  3KJV A;  3OYH A;  4FJH A;  3LWM A;  3LAM A;  1ZBU A;  4CJT A;  3HJF A;  4LH4 A;  3VA3 A;  3L2Q A;  2ITG A;  3QEI A;  4ELT A;  1B9D A;  4O0J A;  2G8H A;  3OYB A;  2X78 A;  3TAF A;  4CGI A;  1RT3 A;  2IS3 A;  3AO3 A;  4B9M A;  4Z4G A;  3OYK A;  4FK4 A; 
#chains in the Genus database with same CATH topology
 1NK0 A;  4R79 A;  4C8M A;  4DTX A;  4BRD A;  1CZA N;  2O8E B;  1BHL A;  4CJP A;  5EY4 A;  1WNS A;  2HND A;  3UKU A;  1N32 K;  2PYJ A;  4F3O A;  4OGC A;  5JLF A;  2HHX A;  4B3T K;  4B3O A;  1K6Y A;  4MDB A;  5AQJ A;  3LZI A;  2CH6 A;  1ZYQ A;  1HX1 A;  4CJ7 A;  2DFH A;  3FFK B;  4FM0 A;  1RT4 A;  4M42 A;  1RBS A;  4FJL A;  3T3F A;  2V51 B;  3NGY A;  4B8C A;  3OA9 A;  1JCF A;  4BWM A;  1S72 N;  4B3R K;  3SNN A;  2G8K A;  1NGG A;  1X9S A;  4CGJ A;  1JL1 A;  5AZJ A;  3O08 A;  1SKS A;  4H5R A;  1CZB A;  3KLF A;  3NF8 A;  3P1G A;  3RRG A;  1GLA G;  2JLE A;  2DY4 A;  1NGA A;  3ZT3 A;  4DR6 K;  4KHP K;  3AVA A;  3QEW A;  2NRT A;  4PKI A;  2YKN A;  5JLH A;  1U04 A;  3DRP A;  3VQC A;  3JYT A;  3LM9 A;  3JS6 A;  1VQO N;  4LFB K;  2P9U A;  3HXM A;  3HM9 A;  2HBM A;  3TI0 A;  1YI2 N;  1QTM A;  1J53 A;  3F9K A;  4CJ4 A;  3QNN A;  4DTS A;  2KKZ A;  4M45 A;  2QTD A;  2VG5 A;  3QFP A;  4BE2 A;  4NO7 A;  2UYT A;  1VRT A;  3ZSQ A;  1IH7 A;  4MQ3 A;  3ZX2 A;  3SQ4 A;  2HHU A;  4A57 A;  4DV0 K;  2O8B A;  4BWJ A;  2CGL A;  5KTQ A;  1HYZ A;  3SQ2 A;  2QWR A;  4GW6 A;  3SQ1 A;  3PSI A;  4BQZ A;  4WFB L;  1UA1 A;  2AP1 A;  1FKO A;  3CXC M;  5K14 A;  1XC3 A;  2RKI A;  4FJJ A;  3KK3 A;  3MCA B;  2ITM A;  4ILH A;  2V52 B;  5GAE P;  1YVU A;  3AAR A;  4DFM A;  3SZ2 A;  2Q0U A;  4DSI A;  1XMO K;  4FYD A;  5FLX O;  4PQU A;  4E1N A;  4DQP A;  2P9K B;  3MN7 A;  5KPZ A;  2HHV A;  4KI4 A;  1FXX A;  4B9S A;  4QCL A;  2GUP A;  3ULE A;  1REV A;  3DAW A;  2FBY A;  5LJV A;  5EVZ A;  1N36 K;  5AZJ B;  2P5G A;  1R0A A;  3RMD A;  4BRQ A;  4IZ9 A;  2VG7 A;  1O1W A;  4XIU A;  4BR7 A;  1TK8 A;  4KH5 A;  2IDO A;  1ATS A;  3TTC A;  3ZSX A;  2QEX N;  1TAU A;  1RDW X;  2W41 A;  1NNE A;  2YV0 X;  3N4Q A;  4O44 A;  3SUN A;  1S1T A;  3C7N B;  3M8Q A;  4HCB A;  5C2F A;  5BR8 K;  4H03 B;  4EP4 A;  4JLH A;  3SBG A;  3QIC A;  3SV4 A;  1U2V A;  2Q3S A;  1LWF A;  3VQP A;  2YJE A;  2EX3 A;  3LZJ A;  3V9U A;  5KQ8 A;  4M3T A;  2ZF5 O;  3I8D A;  3E01 A;  4CZM A;  4J2D A;  4HWI A;  1KQS M;  1VAZ A;  5EU7 A;  2OZS A;  4DLG A;  2OTL N;  4O0I A;  4NCA A;  2P9L A;  3OYF A;  3L2U A;  4FOI A;  2HW3 A;  1S9E A;  1M1K O;  1BCO A;  4DSE A;  1UOC A;  3HI0 A;  3TPQ A;  3WNG A;  4DSK A;  2WOM A;  3WQU A;  3DLG A;  1C1C A;  3OTO K;  3NAE A;  4DQR A;  3N4P A;  3CC7 N;  1N8R O;  4FWS A;  4LSL A;  4JI3 K;  3FZH A;  4WQ5 A;  1XHX A;  1RCH A;  1D8Y A;  3O6W A;  4DFK A;  2G8W A;  2UXD K;  2E8A A;  3D2E A;  2NNW A;  3KLE A;  3PX6 A;  1HNV A;  2QWL A;  3O9T A;  5CYQ A;  4LF6 K;  2IVN A;  1TKZ A;  2Q31 A;  4JI5 K;  3V1Q A;  3IKM A;  3D7E O;  4BC5 A;  2WUS A;  1IBK K;  3V6D A;  3OW2 M;  4J2B A;  5CZ1 A;  5AQG A;  4BGB A;  1YT3 A;  4N5S A;  4GV9 A;  1EWQ A;  2ZM6 K;  2I7P A;  2O8C B;  4O5F A;  4DV2 K;  4M3U A;  1NK6 A;  4YOU A;  3AO4 A;  4KH4 A;  3ENH A;  4YOY A;  1NOZ A;  4RTF D;  3TWH A;  3QER A;  4V19 S;  2NZT A;  4XH1 A;  1S1V A;  3C65 A;  4CEB A;  4CK1 A;  2D0C A;  3OS0 A;  3C95 A;  2P9I B;  4B3S K;  4IJA A;  2BE2 A;  5FPN A;  4CZE A;  2CH5 A;  3F73 A;  1VQM N;  4GVE A;  3ZSY A;  3CCL N;  1L3S A;  3O9U A;  1U49 A;  5FDL A;  3I33 A;  5B8H A;  1TV6 A;  3G0Z A;  3VMF B;  3MK6 A;  4JKA A;  3ZEU A;  4BRA A;  3QEP A;  5LMN K;  1KVB A;  4YOW A;  4GKJ K;  3VQQ A;  1X1P A;  4CBX A;  2NRW A;  3LPU A;  3DI6 A;  3SAH A;  1K9M O;  2HHS A;  3QLH A;  4OJR A;  4C8N A;  1JL2 A;  1IV0 A;  4CZF A;  4CJK A;  2RE2 A;  3AA4 A;  4DTO A;  4IEE A;  3NDK A;  2QWM A;  3K5N A;  3LP3 A;  4UY8 O;  1EKE A;  4BQL A;  1S6P A;  4LFA K;  4K0K K;  2O8D B;  4FJX A;  1W9H A;  2O8C A;  1RBR A;  3MMV A;  1EET A;  4O4G A;  3T69 A;  3EZ5 A;  1L5U A;  4FWO A;  5AQM A;  4MDA A;  3DWL A;  4RW6 A;  2UUB K;  4M3R A;  1GOA A;  3Q7C A;  4KAZ A;  4DWI A;  5AQP A;  1NOY A;  5MLC Q;  2G8U A;  4IJN A;  3ZET B;  4E1M A;  3CQY A;  1FJG K;  4YNQ A;  1MWM A;  2FBV A;  4WQ4 A;  5HP1 A;  4L3Q A;  1KLM A;  1GLL O;  3WXL A;  4M7Y A;  4BRE A;  2ETJ A;  1Q7Y O;  3B6P A;  1ZBL A;  2IVP A;  3HP6 A;  3H46 O;  1J9A A;  2WBN A;  3R8E A;  3E9O A;  1X3M A;  4H0O A;  1KD1 O;  5AZI B;  3DLE A;  2E1Z A;  2RF2 A;  1LCU A;  1L3U A;  1NM1 A;  2NRZ A;  3O9S A;  3V81 A;  5E41 A;  3MN9 A;  1WBD A;  1Q9Y A;  1YJN N;  1HPZ A;  4ID5 A;  4JD2 B;  2IOC A;  3E9P A;  3RSE A;  5BPN A;  3VQB A;  4I9L A;  3ZSR A;  3B8A X;  5SZT A;  3IG1 A;  2QWN A;  4QS9 A;  2W42 A;  1HR0 K;  1MA9 B;  4IOX A;  2O8E A;  1VSH A;  1JLG A;  1TK5 A;  4KO0 A;  4OPJ A;  4AH9 A;  3QIO A;  1U4B A;  4NCG A;  3O3G A;  3U9D A;  4DUZ K;  2OPQ A;  2OZM A;  1C1B A;  2D1K A;  1BOT O;  1JCE A;  3J80 O;  5BRF A;  3OS1 A;  3VES A;  4LF8 K;  2PZS A;  3MEC A;  3CCJ N;  1Q82 O;  5AFU H;  2ZD1 A;  4FPA A;  2UXB K;  2IC3 A;  1C1A A;  4GY2 B;  2QKK A;  4FJH A;  4G9Z A;  1ZBU A;  3HZ6 A;  3VA3 A;  3WXK A;  3O9R A;  4CGI A;  1RT3 A;  4K43 A;  4B9M A;  3OYK A;  1KLN A;  5J2P A;  1GLE G;  3SJJ A;  3H45 C;  2OAN A;  1W2B M;  1ITG A;  1P8Z A;  1S5J A;  1S3X A;  2FSN A;  4FPB A;  5AQW A;  1OH8 A;  2ZGY A;  3DLK A;  3NHG A;  3FE1 A;  1GLD G;  4XEI A;  2JGU A;  4AM6 A;  3L8B A;  4RG8 A;  3V1O A;  3P38 A;  3RWU A;  5ADX A;  5AQZ A;  3O1W A;  3GBT A;  3GE1 A;  4C1N I;  4FVU A;  4IG0 A;  1VQ6 N;  4FLZ A;  3L4Q A;  5BRE A;  1I94 K;  3V9W A;  1S22 A;  1J5O A;  1HLU A;  3VQ9 A;  4JI4 K;  3K5O A;  4ICL A;  3M8R A;  2D0O A;  3OJS A;  1IKW A;  1ZC6 A;  5DK5 A;  4FZY A;  4OKJ A;  3E1Y A;  4OKK A;  4DFP A;  4KHU A;  4CGD A;  4G1Q A;  3CCS N;  2VWK A;  4FLW A;  4ZTF A;  3I0R A;  2XY5 A;  3A2F A;  3CIP A;  2XY6 A;  2ASP A;  1A5W A;  4DF8 A;  1Q86 O;  3IAY A;  4GV3 A;  1D9D A;  3TAM A;  2G8I A;  3G25 A;  2Y1I A;  3MX5 A;  3NF7 A;  1KVC A;  4A62 A;  4E0D A;  3ID8 A;  3SLC A;  4B9Q A;  1VHX A;  5KPT A;  1JCG A;  4CW7 B;  4JK7 A;  1T05 A;  4KHY A;  2QKB A;  1VRU A;  1SL1 A;  2FC0 A;  4O8K A;  3R9P A;  4BRF A;  3KTQ A;  2HNZ A;  3S3N A;  2E1Y A;  4ISG A;  1GOB A;  3NMU A;  3O4W A;  2E20 A;  3NFA A;  4CF2 A;  1JJ2 M;  1ILY A;  3CPW M;  1VSJ A;  3DLL L;  5HRP A;  3ZT4 A;  3K5L A;  2UU9 K;  2P9S B;  4CGG A;  1U6Z A;  3C6A A;  1EWR A;  5C10 A;  4JHD B;  2HNY A;  4CFD A;  3CJA A;  3TAQ A;  3VN5 A;  1QHT A;  3NH1 A;  4FJ7 A;  1KRP A;  2YHY A;  4M3Y A;  5HOO A;  3TAE A;  3S3M A;  4M3Z A;  2VGN A;  1A5V A;  4JI7 K;  1DKG D;  1GLF O;  4DU3 A;  2HF4 A;  4AM7 A;  1VSF A;  1J5E K;  2P9S A;  1RDA A;  3DXM B;  2KZM A;  3EYZ A;  4J8F A;  3QO9 A;  4YDU A;  2E2P A;  1BO5 O;  4JKD A;  4AHR A;  4B9U A;  4HUF A;  4BDY A;  4Z0U A;  2EHG A;  1Z25 A;  3A0I X;  3L2R A;  5GAG P;  5C15 A;  3MN5 A;  4X64 K;  2RHK A;  3L4I A;  3VA0 A;  2P9P A;  1NJX A;  3OYA A;  3ATV A;  4C1N K;  3KWI A;  1JKH A;  2A3Z A;  2E2N A;  5AQH A;  1SL0 A;  2KFZ A;  4XH5 A;  4JKF A;  5IWA K;  1EQY A;  3DRS A;  3C94 A;  4CES A;  1NGF A;  5BRD A;  3KZB A;  1YIT N;  2UXC K;  1ZBI A;  4CJ3 A;  3CJ1 A;  1LWC A;  4CHO A;  3HSC A;  3ZSO A;  3K0S A;  5J2Q A;  4J2A A;  2A1S A;  1NMN A;  3D6R A;  4DQI A;  1WN7 A;  4CZL A;  4FM1 A;  1RDD A;  4KTZ A;  4DTN A;  3I8B A;  1KXP A;  4KKO A;  3ISN C;  4ID1 A;  3NGI A;  3D2F A;  3E9L A;  4CIF A;  3T1A A;  4FJM A;  4FZZ A;  5KGW A;  1U48 A;  3UIQ A;  2YCH A;  1VQ9 N;  3HPG A;  2P9N A;  2D0P A;  1X9M A;  3J7Y P;  4I2Q A;  3A5M C;  3L0Q A;  3THW B;  5HLF A;  4DTR A;  2HVH A;  2HBL A;  3L3V A;  1DLO A;  3OYC A;  1RT6 A;  3VTI A;  3QET A;  2Z1I A;  4JRP A;  1RT2 A;  4YY3 K;  2P9U B;  3ZSZ A;  4E19 A;  3VQ7 A;  3VQA A;  4IDH A;  4F3T A;  3RVC A;  1RTI A;  5CYM A;  4B8A B;  3L3U A;  1HYV A;  3JAM O;  4Y1D A;  4FM2 A;  2B6A A;  4OPA A;  3W3D A;  4AHU A;  2O4G A;  2ZWH A;  1YTU A;  1W97 L;  3BF3 A;  4ZHR A;  5HRN A;  1GLB G;  1U47 A;  1T6C A;  4FWK A;  5KRT A;  3O9Q A;  3NVM A;  4BR2 A;  3IDH A;  1HQE A;  4A2B A;  1U45 A;  5AQK A;  2YNH A;  3T19 A;  2FF6 A;  3C0B A;  4CFC A;  2PBD A;  4KTQ A;  1BI4 B;  4PHT X;  2Z1H A;  3LP1 A;  4E3S A;  2F7T A;  2Q2R A;  4Z94 A;  1IKV A;  1NG9 A;  3S41 A;  3FZM A;  2P51 A;  1C0F A;  1X9J A;  1ZBF A;  4H5T A;  1H1V A;  1UWB A;  4IDK A;  1A5X A;  3SYZ A;  3AVF A;  3CER A;  3TTD A;  3M3Z A;  3C7N A;  4FXD A;  3SPZ A;  4DSL A;  4CFB A;  5ADX H;  3ZLJ A;  5AQL A;  3OYD A;  3BZC A;  3HL8 A;  3THX A;  1VSK A;  2OPP A;  1HPM A;  4ISF A;  3KKS A;  3OYJ A;  1K73 O;  4DV6 K;  5AQY A;  5CE3 A;  4KB0 A;  4FJN A;  1GOC A;  3SPY A;  2UUC K;  4DV3 K;  1NGH A;  1BIZ A;  4FOE A;  1EXQ A;  2O8F B;  2O8B B;  4CZH A;  3U3Y A;  4R5P A;  4RW9 A;  2HB5 A;  4LC9 B;  5M1F A;  1S1W A;  5M1P A;  3AO1 A;  5KI6 A;  3FZF A;  3LDS A;  4F2S A;  4LSN A;  3OYE A;  2G8V A;  3JSM A;  2F8T A;  3CFR A;  2QWQ A;  4CF8 A;  3VF4 A;  4IKF A;  2BDP A;  4IXC A;  2IIR A;  4RW7 A;  4N76 A;  4K8X A;  4B9T A;  4CEQ A;  3MXJ A;  4PL8 A;  4BRM A;  3CCQ N;  4KBO A;  3DXK B;  4RWT A;  3AVN A;  1TAQ A;  3OBY A;  2KTQ A;  2YHW A;  4DR1 K;  4X65 K;  3LP2 A;  3AGK A;  4IFY A;  3CET A;  3ITH A;  3ALY A;  3VGK A;  3CFP A;  2E6L A;  4BVP A;  4F2R A;  2OYQ A;  3NF9 A;  3L6Q A;  2GEM A;  1VSI A;  3F2K A;  3LPT A;  3QDK A;  4FWQ A;  3EZW A;  3QIP A;  1RT7 A;  1T8E A;  4AHS A;  4CEF A;  2P9I A;  4I6M B;  3UKR A;  2VGM A;  3G71 N;  1KVA A;  4GVM A;  3WNE A;  1HNI A;  3CQX A;  1Z05 A;  4JHD A;  3HOS A;  1NK7 A;  4B9V A;  3IFR A;  4EZ9 A;  1N34 K;  2PAV A;  4BGA A;  2Z1G A;  5M1N A;  1SS6 A;  3ID6 A;  3CCV N;  5IT9 O;  2YX6 A;  4A5B A;  4JS5 A;  2XY7 A;  4CJV A;  1TK0 A;  3BF1 A;  1WSI A;  3U6F A;  4K42 A;  3QBX A;  3V1R A;  3THY A;  3IS9 A;  4C8O A;  3MN6 A;  3O8M A;  4KV8 A;  3RR8 A;  2VWB A;  3AVK A;  3NCI A;  4M41 A;  2HHH K;  2D4W A;  4BRL A;  3SUO A;  4CZG A;  4CIG A;  3LDL A;  2F4V K;  3IMX A;  4JRQ A;  3TAG A;  4B1X B;  1JLQ A;  3OJU A;  4BE1 A;  4Q0B A;  3T1H K;  2W6K A;  4WYB A;  5ELZ A;  1X3N A;  3AVB A;  1UAX A;  2YNG A;  4FW1 A;  2XO7 A;  4MLE A;  3MWT A;  3A8Y A;  3DOK A;  4BC4 A;  5E26 A;  4BRO A;  3AVM A;  1E4G T;  1VQN N;  1ATN A;  2O4I A;  1NJZ A;  1IO2 A;  4BC2 A;  3KJV A;  4YOR A;  4JI1 K;  3LWM A;  3HJF A;  3QEI A;  4OO1 J;  2G8H A;  3TAF A;  3VGM A;  2HOE A;  4E89 A;  3QES A;  2GTD A;  1BG3 A;  3WNF A;  3O80 A;  2KZZ A;  3D0P A;  2Q1N A;  2YHB A;  5KQD A;  4W5O A;  3HVT A;  3PV8 A;  2XY8 A;  2W40 A;  3VGL A;  5FRN A;  4H0V B;  4LY7 A;  4CZJ A;  3O3H A;  4E7H A;  5JS1 A;  3P5J A;  1BDG A;  1KAY A;  3MXM A;  3SI6 A;  1XI1 A;  1MU2 A;  4C8L A;  1VSE A;  1YIJ N;  4B9N A;  4Y0W A;  4ILJ A;  3O4Q A;  4FZX C;  3ZX3 A;  4IFV A;  1BIS A;  1NGE A;  5FPD A;  4OVL A;  4FJ8 A;  2D0B A;  3VER A;  3K9J A;  4CD1 A;  1NGD A;  2KW4 A;  4N56 A;  2ZQB A;  4FWR A;  1Q18 A;  2FSJ A;  1HYS A;  2FBT A;  4O55 A;  2NRV A;  1YUW A;  1BA1 A;  2IGI A;  4HUG A;  1BUP A;  1XUP O;  4JYA K;  4CJL A;  2Y1J A;  1T6D A;  3WEE B;  1C0G A;  2FXU A;  3VEN A;  4B1V A;  2Q0R A;  3K57 A;  3RRH A;  1JLC A;  4OLB A;  4MFB A;  4FJK A;  3MCP A;  1HMV A;  1ZBS A;  2PY5 A;  1U2V B;  1W0H A;  5CY4 A;  4X66 K;  3EY1 A;  2CGJ A;  1E4F T;  1SZ2 A;  3LDN A;  5GAH P;  1ZXO A;  3VOV A;  3WXI A;  3H1V X;  3ULD A;  2G8F A;  5J2M A;  3CQ8 A;  5BR9 A;  1N5Y A;  1ASV A;  1VSD A;  5BN9 A;  3CCU N;  3FZK A;  3H1Q A;  1FW6 A;  4FLX A;  3U4L A;  4KH6 A;  5M1O A;  4KHN A;  4RW8 A;  4CZI A;  1QVG M;  1XNR K;  5AFU A;  1NWK A;  3H6E A;  3TR8 A;  5DM6 L;  4PUO A;  4CJU A;  4BR0 A;  1NKC A;  3ZSW A;  1O13 A;  2VG6 A;  5LL6 Z;  4H0Y B;  4MO5 A;  4DKW A;  2YNF A;  5HBM A;  5EOY A;  5GIP A;  3G10 A;  3WNH A;  4DS4 A;  5AZI A;  1SKR A;  2IVO A;  2YNI A;  3AA3 A;  1NJY A;  2J4R A;  1I39 A;  3BY5 A;  5AJ3 K;  1WB9 A;  5F0X A;  3DLB A;  1BI4 A;  1T44 A;  4JKH A;  3F5T A;  4CHZ A;  3VEO A;  3VET A;  4Z4F A;  3FLC O;  4Z4C A;  1QHA A;  4FLV A;  1KAZ A;  3KKR A;  1TL3 A;  4B3M K;  3ZSV A;  3LAN A;  4IWV A;  4QS8 A;  3AAP A;  2HMP A;  4HTL A;  1GLC G;  2YJF A;  5C42 A;  2WTU A;  3VQ6 A;  4BRP A;  4FL9 A;  4BRI A;  3VF6 A;  5J2N A;  5AQO A;  2BTF A;  4AHC A;  4BY9 C;  2AJQ A;  3I0S A;  2B5J A;  1WSF A;  4DR2 K;  5C0Y A;  1BU6 O;  4FSV A;  3PO5 A;  4GV6 A;  5TKY A;  5EXW A;  4B1Y B;  4H5V A;  4JKC A;  4PY5 A;  4YOX A;  4KRF A;  3GOI A;  1YAG A;  3ENB A;  2P5O A;  1TUY A;  3MDQ A;  1YXQ A;  3OY9 A;  4DTU A;  1WSJ A;  4HTU A;  4IOA L;  2A42 A;  3SV3 A;  3K5M A;  4BRG A;  5FRM A;  3QBW A;  1WSH A;  3CM5 A;  4E7I A;  4Z4E A;  3MED A;  3VQ4 A;  1HNW K;  1ASU A;  3NGZ A;  4OLA A;  3AY9 A;  3TSP A;  3U8X A;  2E88 A;  3EO3 A;  2ZE2 A;  1C0U A;  5GIO A;  1HRH A;  4FW2 A;  3UE5 A;  1Z6R A;  3CJB A;  4CJ5 A;  4DMN A;  3UB5 A;  4DV7 K;  4JKG B;  3I55 N;  3EKS A;  5I9E B;  5AQS A;  1NKB A;  4KRE A;  4DQ8 A;  2YHX A;  4BRH A;  3ZYY X;  4DSF A;  2HBJ A;  1RBT A;  3CCR N;  3FFI A;  3AV9 A;  3SAF A;  3ENO A;  3WXJ A;  1IG9 A;  2Z1J A;  4CFA A;  4Z4H A;  2QXL A;  3LWL A;  3ZT0 A;  4JEP A;  4B9L A;  2GWK A;  1MWK A;  3BP8 A;  4KHS A;  4KHQ A;  4DB3 A;  2F8S A;  5LJW A;  4Q5V A;  3H3O B;  5T7B A;  2HST A;  1QQC A;  4BG8 A;  2HHT A;  2P9P B;  1KFS A;  4M3X A;  2KFN A;  3I56 N;  3KWG A;  3IRX A;  4IG3 A;  1DTT A;  3V9X A;  1K8K A;  2QXF A;  3LAL A;  4DCH A;  3QEX A;  1VQK N;  3AVC A;  1ESV A;  3E66 A;  1JLA A;  1KAX A;  3M8P A;  3KLG A;  4JI8 K;  2OPR A;  1S9G A;  3BUZ B;  3L2W A;  1S1U A;  5AR0 A;  1RTD A;  4FWM A;  4Z4I A;  4FVM A;  4JKB A;  5KPR A;  3HK2 A;  1IJJ A;  4DTP A;  2BH1 A;  4U7B A;  4GKK K;  3AO2 A;  4EIA A;  4DU1 A;  3DLR A;  1KTQ A;  3DXK A;  4CEA A;  1QE1 A;  4LH5 A;  3ZX0 A;  3OYN A;  4IBN A;  5FRO A;  4WFA L;  4LD0 A;  4AHV A;  4DQQ A;  3VEZ A;  3OYL A;  2BAN A;  2DFE A;  3EE8 A;  3NH2 A;  4HHT A;  5BPM A;  1D9F A;  1HKC A;  4L8R B;  4DR3 K;  1XWL A;  4FWP A;  4CEZ A;  3ZET A;  4FWN A;  2ASO A;  5KGX A;  1XNQ K;  1TL1 A;  2XRI A;  1JLF A;  1RTJ A;  4JK8 A;  3AVG A;  2F9W A;  4A2A A;  1LW2 A;  1Q9X A;  4KPY A;  3WXM B;  3RMC A;  2F96 A;  4F4K A;  4K25 A;  3PIP L;  5AQX A;  4W5R A;  2WC9 A;  5A2Q O;  3U9Z A;  5C2D A;  3GL1 A;  2FF3 B;  4EZ6 A;  3QML A;  4RCH A;  3NF6 A;  5C12 A;  5C25 A;  1HNZ K;  1ASW A;  4BRN A;  4FK2 A;  5E84 A;  4CED A;  4GMJ B;  4X62 K;  4EFH A;  1I3A A;  4C8K A;  1N6Q A;  3RR7 A;  1SV5 A;  4O5B A;  4WCE L;  3THX B;  3P83 D;  4BE0 A;  4QAG A;  5HRR A;  3J8A A;  4FWL A;  3TSU A;  3KLH A;  2A41 A;  1KC8 O;  4DF4 A;  1C0M A;  1T3V A;  4H0X B;  2ASM A;  1X9W A;  5CR4 A;  3DOL A;  2QWP A;  2W6L A;  1Q81 O;  3HPO A;  4AIL C;  1JLB A;  3WT0 A;  1HQU A;  5C24 A;  1XHZ A;  1OH5 A;  3KD1 E;  1RIL A;  4NLB A;  2PFU A;  1RBU A;  2NRH A;  5KRS A;  4CJQ A;  1DTQ A;  2PYL A;  2GEL A;  2A40 A;  5I42 A;  1NK5 A;  4CEE A;  5I3U A;  4GNI A;  2DFF A;  4OGE A;  1L3T A;  4FK0 A;  3CHW A;  4CIE A;  3CJ9 A;  1BQM A;  3ZT1 A;  3P4I A;  3CYM A;  1VQP N;  1CXQ A;  3WUH A;  3PIO L;  2H3G X;  1JXE A;  4H0T B;  4CHQ A;  2VYP A;  2OA8 A;  4FO0 A;  3KK2 A;  2X6S A;  1V4S A;  3ZT2 A;  5BPL A;  3Q7B A;  4QOZ B;  3HO1 A;  3SAG A;  1WUA A;  1WSG A;  4JK9 A;  2V7Z A;  4FJG A;  1ZBH A;  1XC9 A;  2BUP A;  3AVL A;  4CHY A;  3JXU A;  2F9T A;  2ATQ A;  4WQ5 C;  1VQ4 N;  3AAQ A;  2OCE A;  1TKD A;  3ZCM A;  3H08 A;  4BRK A;  1V4T A;  3CPE A;  1SAZ A;  3AA2 A;  4W5Q A;  5AQI A;  2I5J A;  4PA1 A;  4CF1 A;  3CJC A;  1NGI A;  4TSX A;  1XMQ K;  1IBM K;  1JXB A;  4DV5 K;  4CF9 A;  2E5L K;  5LMU K;  3MEG A;  4XH4 A;  4FJ5 A;  4DUY K;  4EHU A;  4BDZ A;  2LSN A;  5LY3 A;  3PO4 A;  4IOC L;  4CGF A;  4CI6 A;  2FSK A;  3GDQ A;  3AO5 A;  3SUQ A;  5F2R A;  4U67 L;  3BGR A;  4DQS A;  1W7A A;  2RPI A;  3HT3 A;  2DTU A;  2YHA A;  3D45 A;  1Z26 A;  1OH6 A;  3ASM A;  3HBT A;  2QWO A;  4WFN L;  4DR7 K;  4A59 A;  4LFC K;  1D4X A;  4B08 A;  4DG1 A;  1QSY A;  1LAW A;  1QQM A;  1KFD A;  3A5N C;  4H4M A;  4IO8 A;  3OHR A;  3D2F B;  4JI2 K;  1BGX T;  3OYH A;  1WOQ A;  5CHI A;  5JMV A;  4CJT A;  2ITG A;  4NLC A;  3P31 A;  1B9D A;  4O0J A;  3CCM N;  1EO1 A;  2IS3 A;  3PLA A;  4FK4 A;  1WSE A;  4OPK A;  3IUC A;  3G6E N;  3R3L A;  2P9L B;  1YVN A;  2A1R A;  3P39 A;  4EAH D;  3EE9 A;  4AQY K;  3DYA A;  3VQD A;  3HYF A;  4FLU A;  4DLE A;  3S3O A;  4CEO A;  1L3V A;  4YOT A;  3K2P A;  1FKP A;  3VEY A;  3CCE N;  1RT5 A;  3VEX A;  4OX9 K;  1J54 A;  3TAP A;  3SUP A;  3DJC A;  3CG7 A;  4W5T A;  1GLJ O;  4BR9 A;  4CJS A;  3KK1 A;  2RN2 A;  4PL7 A;  3EN9 A;  3C6U A;  5HRO A;  3SQ0 A;  3O3F A;  1SUQ A;  5AQT A;  4EP5 A;  3HM8 A;  2KLA A;  1HKB A;  1SL2 A;  2D5R A;  2QK9 A;  3PSF A;  4M3W A;  4BC3 A;  1F21 A;  1VQ7 N;  3CI5 A;  1TYQ A;  3TSQ A;  2EWS A;  3VEV A;  3B6O A;  3ULE B;  4CBU A;  2I7N A;  2E6M A;  3BZK A;  5AQQ A;  5H1S Q;  2JWL A;  3HVR A;  4CZK A;  3VQ5 A;  3LL3 A;  1YJ9 N;  3V4I A;  1C0T A;  2Q36 A;  2X6N A;  2ZJP L;  4I6M A;  4JNE A;  3UKR B;  1NGC A;  1RFQ A;  2Q97 A;  1TUU A;  4KFB A;  1G15 A;  1YJW N;  4NXM K;  4N47 A;  4JI6 K;  1P90 A;  2IAJ A;  1RNH A;  3M1F A;  4WQ4 C;  1EX4 A;  4JV5 K;  1DT9 A;  4JD2 A;  1NJI O;  2GWJ A;  1OH7 A;  4OKE A;  3DLH A;  2A6A A;  4BAC A;  4FJ9 A;  2HHQ A;  4JS4 A;  4ISE A;  4PKH A;  4ILG B;  2FBX A;  1MDU B;  3CC4 N;  2O8D A;  3SK3 A;  4W5N A;  4I2P A;  4CJR A;  4BR4 A;  3QFU A;  1QVF M;  3EKU A;  4HVJ A;  3DMJ A;  2X74 A;  1NU0 A;  3KHY A;  5FPM A;  4CD3 A;  5SWM A;  4WF9 L;  3L2V A;  1WBB A;  4IEI A;  3MX2 A;  1QQO A;  2P1J A;  2VCP A;  4YFU A;  1UA0 A;  1YF5 L;  3EL2 A;  1VSM A;  4DR5 K;  4CEC A;  1NMD A;  5M1K A;  3O1B A;  2E4L A;  3OYG A;  3PUF A;  3A5O C;  3SJH A;  4HCC A;  2FLO A;  1QSS A;  3SMS A;  4BDP A;  3J81 O;  2HMI A;  4I7F A;  3V9S A;  2NUB A;  4DU4 A;  1VK0 A;  4O8U A;  2UUA K;  5CZ2 A;  2D0A A;  2QM1 A;  4CER A;  1EP4 A;  5AQR A;  4E7L A;  2DPN A;  2HVI A;  1SQK A;  5EX5 A;  2NLX A;  5JVH L;  4NCB A;  1HJO A;  4DV4 K;  4LF9 K;  1R59 O;  4I9Q A;  4B1Z A;  1NJW A;  2ZGZ A;  3M8S A;  1DEJ A;  4NYN A;  4CJW A;  3RMB A;  4K8Z A;  2A5X A;  3QB0 A;  3AGR A;  3WEE A;  3GG4 A;  3T7Z A;  1LV5 A;  2OTJ N;  3V9Z A;  1VQL N;  4DTM A;  2VQF K;  1OVY A;  4PWD A;  4FLT A;  3OBW A;  1NBW A;  3HST B;  2QI2 A;  3DXM A;  2E2O A;  3RMA A;  2ZJQ L;  1NK8 A;  4IFE A;  2NRX A;  2GBZ A;  3O4N A;  3MAQ A;  4LF7 K;  5AQV A;  5D3G A;  3LDP A;  3OVN A;  3NH0 A;  1NKE A;  4CJE A;  4CCH A;  3H3N O;  4JKG A;  5AQF A;  1ATR A;  1VQ8 N;  1BA0 A;  3T1Y K;  1Y64 A;  3VQE A;  1J6Z A;  3CM6 A;  2HHW A;  1Q8I A;  1OVQ A;  1S6Q A;  3KLI A;  1T03 A;  3CD6 N;  4AHT A;  3J7Z O;  3CC2 N;  5TKW A;  3S9H A;  4CJF A;  3LDQ A;  3QNO A;  2ZJR L;  1TGO A;  4CHP A;  4NYF A;  4N41 A;  1RBV A;  3K9K A;  3VPZ A;  3OS2 A;  3AVI A;  3CFO A;  4A61 A;  1FK9 A;  1NLV A;  4EHT A;  1SKW A;  4ELV A;  4JAX A;  3R6M A;  2P9K A;  2KQ2 A;  4DSJ A;  3BEX A;  4E7J A;  4JI0 K;  2GX9 A;  4FLY A;  2VQE K;  5DM7 L;  3K58 A;  4E7K A;  5JS2 A;  3TAN A;  1CZ9 A;  2VWJ A;  4BG9 A;  2R7Y A;  4LF5 K;  1HJR A;  2GV9 A;  1NK4 A;  4B1W B;  1TVR A;  2O8F A;  3EEQ A;  4NB4 A;  4FCY A;  1BQN A;  1RGI A;  5JVG L;  1LOT B;  3U3G A;  5JIC A;  4H5W A;  4KI6 A;  4KHW A;  4CGH A;  3LDO A;  1M90 O;  1VQ5 N;  3HP9 A;  5HL7 L;  3SMP A;  1QZ5 A;  4WE1 A;  3TAR A;  1BIU A;  3TAB A;  1HKG A;  1RDU A;  4YOV A;  2QA4 N;  2E2Q A;  3OYI A;  1IBL K;  5HRS A;  3OYM A;  1LWE A;  4CBW A;  4ELU A;  4M7X A;  2GUI A;  3A5L C;  4F8R A;  1QSL A;  4DV1 K;  4CHN A;  1NGJ A;  4JKE A;  5AQN A;  3DM2 A;  4B1U B;  1LW0 A;  4AF1 A;  3K59 A;  1S1X A;  1CXU A;  1LAV A;  1C6V A;  5FPE A;  1QQN A;  3SCX A;  4DS5 A;  4YDU C;  3HOT A;  3C6T A;  4DFJ A;  4JN4 A;  1NK9 A;  1YHQ N;  2OPS A;  3NBP A;  3KIO A;  4NXN K;  1Y97 A;  1BL3 A;  4OPH A;  4Y1C A;  1RDC A;  1G99 A;  1VSL A;  1IKX A;  2KHO A;  3HRG A;  3AVJ A;  3TU5 A;  1KCF A;  4QS7 A;  2B4J A;  1YTA A;  3THY B;  4LF4 K;  4CE9 A;  2V7Y A;  3CJ7 A;  1E3M A;  4DR4 K;  3RSE B;  4H4O A;  4KB1 A;  3MXI A;  1HNX K;  5GAD P;  4H8K A;  1B9F A;  3ZEU B;  1K8K B;  3HTV A;  1CLQ A;  4J2E A;  3KD5 E;  3W0L A;  3QIN A;  3AA5 X;  1B92 A;  4CF0 A;  3O5B A;  2NRR A;  3THV A;  1QS4 A;  1RDB A;  2HF3 A;  2YKM A;  4CVN E;  2WON A;  3KVG A;  4F9O A;  4KTW A;  1WAJ A;  3HPH A;  3UKU B;  1KSP A;  3BDP A;  4M63 C;  4BR5 A;  3FZL A;  5DMR A;  3G4S N;  2YI1 A;  4ZTJ A;  5GIN A;  4A5A A;  5BRH A;  1TKX A;  1N33 K;  3D2E B;  5F1X A;  1T7P A;  3ATU A;  3VEW A;  5J1E A;  4CK2 A;  3AVH A;  3THW A;  4H0P A;  3KK7 A;  3MEE A;  4YHH K;  1BCM A;  1DGK N;  3LM2 A;  3J7A P;  2HBK A;  2AA4 A;  4BVO A;  1RTH A;  4HUE A;  3CME N;  1IG8 A;  4MLH A;  3CF5 L;  3R1X A;  3M6G A;  4RW4 A;  3F9M A;  4FJI A;  4IO9 L;  5AQU A;  4C23 A;  1JLE A;  4H5N A;  4MO4 A;  4PKG A;  1D5A A;  3NE6 A;  3RTV A;  4DTJ A;  1RT1 A;  3MWP A;  3SBT A;  2BGG A;  3PX4 A;  3VF2 A;  3M5R A;  5BN8 A;  4UQG A;  3FGU A;  2P9N B;  3LAK A;  3VQ8 A;  1TKT A;  3PY8 A;  3DRR A;  1OKJ A;  3WQT A;  1TYQ B;  5M1Q A;  3PX0 A;  2JWK A;  4BRC A;  1XQS C;  4CK3 A;  3LP0 A;  1WAF A;  1QZ6 A;  3QEV A;  1WLJ A;  1NGB A;  2CGK A;  3CMA N;  1IKY A;  2QW9 A;  2XHB A;  2WFB A;  3TTF A;  3FR0 A;  3NVK A;  3LAM A;  3C6H A;  4LH4 A;  4ELT A;  3L2Q A;  4DHY A;  4K41 A;  1HUX A;  3OYB A;  2X78 A;  1K8A O;  3AO3 A;  4E1J A;  1BWF O;  4Z4G A;  3VTH A; 
#chains in the Genus database with same CATH homology
 4E89 A;  5J2P A;  3QES A;  1KLN A;  3WNF A;  1NK0 A;  3SJJ A;  1WSE A;  2KZZ A;  3D0P A;  4C8M A;  4DTX A;  1ITG A;  2YHB A;  4OPK A;  1BHL A;  4CJP A;  1WNS A;  1S5J A;  2A1R A;  2HND A;  4W5O A;  3HVT A;  3PV8 A;  2PYJ A;  2XY8 A;  3DLK A;  3NHG A;  4OGC A;  4F3O A;  3DYA A;  5FRN A;  3VQD A;  3HYF A;  2HHX A;  4FLU A;  2HHT A;  4LY7 A;  4B3O A;  4DLE A;  2JGU A;  3O3H A;  1K6Y A;  4E7H A;  5JS1 A;  3P5J A;  3MXM A;  3S3O A;  3L8B A;  3SI6 A;  4RG8 A;  3V1O A;  4CEO A;  1XI1 A;  1L3V A;  1MU2 A;  3RWU A;  4C8L A;  1VSE A;  3K2P A;  4B9N A;  1FKP A;  3LZI A;  3O4Q A;  4FZX C;  1ZYQ A;  4IFV A;  1BIS A;  1RT5 A;  2DFH A;  4OVL A;  1J54 A;  4FJ8 A;  3TAP A;  2D0B A;  4FM0 A;  3SUP A;  1RT4 A;  4IG0 A;  4M42 A;  3CG7 A;  4W5T A;  4FLZ A;  2KW4 A;  4CJS A;  1RBS A;  2ZQB A;  4N56 A;  2RN2 A;  3KK1 A;  3T3F A;  3C6U A;  3V9W A;  4FJL A;  1J5O A;  1HYS A;  3NGY A;  5HRO A;  2FBT A;  4B8C A;  4O55 A;  4BWM A;  1SUQ A;  3O3F A;  4EP5 A;  3SQ0 A;  3VQ9 A;  3SNN A;  4HUG A;  2IGI A;  3K5O A;  4CJL A;  2G8K A;  2Y1J A;  4ICL A;  3M8R A;  1X9S A;  4CGJ A;  3OJS A;  1JL1 A;  1IKW A;  3K57 A;  5DK5 A;  1SL2 A;  2D5R A;  4FZY A;  4OKJ A;  4OKK A;  4DFP A;  2QK9 A;  4KHU A;  4CGD A;  3RRH A;  4G1Q A;  1JLC A;  1CZB A;  1F21 A;  2VWK A;  4FLW A;  1SKS A;  4M3W A;  4OLB A;  4MFB A;  3KLF A;  4ZTF A;  4FJK A;  3I0R A;  3NF8 A;  3P1G A;  2XY5 A;  3A2F A;  3RRG A;  1HMV A;  2JLE A;  2XY6 A;  2DY4 A;  3B6O A;  3ZT3 A;  2PY5 A;  1W0H A;  5CY4 A;  3AVA A;  3EY1 A;  2E6M A;  1A5W A;  3QEW A;  4DF8 A;  2YKN A;  1U04 A;  3DRP A;  3VQC A;  3JYT A;  3IAY A;  3HXM A;  3TAM A;  3HVR A;  3HM9 A;  1D9D A;  2G8I A;  3VQ5 A;  2Y1I A;  3V4I A;  3NF7 A;  3ULD A;  1KVC A;  4E0D A;  3TI0 A;  1QTM A;  2G8F A;  5J2M A;  1J53 A;  3F9K A;  1C0T A;  2X6N A;  4CJ4 A;  3CQ8 A;  3QNN A;  1N5Y A;  1ASV A;  4DTS A;  4M45 A;  1VSD A;  2VG5 A;  4KFB A;  1G15 A;  4BE2 A;  4N47 A;  1VRT A;  1T05 A;  4KHY A;  3ZSQ A;  2QKB A;  1VRU A;  1IH7 A;  2IAJ A;  4FLX A;  2FC0 A;  1SL1 A;  1RNH A;  4MQ3 A;  4RW8 A;  3SQ4 A;  4KHN A;  2HHU A;  3KTQ A;  3TR8 A;  2HNZ A;  1EX4 A;  3S3N A;  4PUO A;  4BWJ A;  4CJU A;  5KTQ A;  1GOB A;  1HYZ A;  1NKC A;  3ZSW A;  3SQ2 A;  4OKE A;  3NFA A;  2VG6 A;  4CF2 A;  3DLH A;  4GW6 A;  2YNF A;  5HBM A;  3SQ1 A;  4BAC A;  1VSJ A;  3G10 A;  5HRP A;  3ZT4 A;  3K5L A;  3WNH A;  4DS4 A;  1TK5 A;  4CGG A;  4FJ9 A;  2HHQ A;  4JS4 A;  2HNY A;  1UA1 A;  1FKO A;  4CFD A;  1SKR A;  3TAQ A;  3VN5 A;  2FBX A;  2YNI A;  3AA3 A;  1QHT A;  5K14 A;  3NH1 A;  4FJ7 A;  1NJY A;  2RKI A;  1KRP A;  4FJJ A;  3KK3 A;  1I39 A;  4W5N A;  4M3Y A;  3DLB A;  1YVU A;  1BI4 A;  4I2P A;  4DFM A;  3TAE A;  3SZ2 A;  3S3M A;  4M3Z A;  4CJR A;  1A5V A;  4DSI A;  4CHZ A;  4Z4F A;  4HVJ A;  4Z4C A;  4FLV A;  3DMJ A;  4DU3 A;  4FYD A;  2X74 A;  3KKR A;  4PQU A;  1TL3 A;  4E1N A;  4DQP A;  3ZSV A;  5SWM A;  1VSF A;  3LAN A;  3L2V A;  5C42 A;  2P1J A;  3VQ6 A;  4YFU A;  1RDA A;  1UA0 A;  2KZM A;  2HHV A;  5J2N A;  4AHC A;  3EYZ A;  1VSM A;  4CEC A;  2AJQ A;  3I0S A;  3QO9 A;  2E4L A;  2B5J A;  3OYG A;  1WSF A;  4KI4 A;  3PUF A;  1FXX A;  4B9S A;  4AHR A;  4B9U A;  4HUF A;  4HCC A;  4BDY A;  4QCL A;  4Z0U A;  2EHG A;  3PO5 A;  1Z25 A;  3L2R A;  1REV A;  2FBY A;  1QSS A;  4BDP A;  2HMI A;  4I7F A;  3VA0 A;  3V9S A;  2P5G A;  1NJX A;  2NUB A;  1R0A A;  3RMD A;  4DU4 A;  3OYA A;  2VG7 A;  1O1W A;  1VK0 A;  4XIU A;  4PY5 A;  1JKH A;  1TK8 A;  4KRF A;  5CZ2 A;  2D0A A;  2IDO A;  2P5O A;  3ZSX A;  1TAU A;  1SL0 A;  3OY9 A;  2YV0 X;  4DTU A;  2KFZ A;  1WSJ A;  4HTU A;  4O44 A;  3SV3 A;  4CER A;  3K5M A;  3SUN A;  1S1T A;  4FZZ A;  5FRM A;  1EP4 A;  4E7L A;  3DRS A;  1WSH A;  3CM5 A;  3C94 A;  4CES A;  3M8Q A;  4E7I A;  4HCB A;  4Z4E A;  3MED A;  3VQ4 A;  4EP4 A;  1ASU A;  4JLH A;  3NGZ A;  1ZBI A;  4CJ3 A;  1LWC A;  3SV4 A;  4OLA A;  4CHO A;  3ZSO A;  5J2Q A;  4NCB A;  4J2A A;  2Q3S A;  1LWF A;  3VQP A;  2A1S A;  4DQI A;  3LZJ A;  2EX3 A;  4I9Q A;  1WN7 A;  4FM1 A;  3M8S A;  3V9U A;  1NJW A;  4NYN A;  2ZE2 A;  4CJW A;  3RMB A;  1RDD A;  4KTZ A;  4K8Z A;  4M3T A;  4DTN A;  1C0U A;  4KKO A;  3I8D A;  3ISN C;  1HRH A;  3E01 A;  4ID1 A;  4FW2 A;  3NGI A;  4J2D A;  4CIF A;  4CJ5 A;  5EU7 A;  4DMN A;  3T1A A;  4FJM A;  2OZS A;  1LV5 A;  5KGW A;  4DLG A;  1U48 A;  4O0I A;  3UIQ A;  4NCA A;  3V9Z A;  3HPG A;  3OYF A;  3L2U A;  4DTM A;  2HW3 A;  1X9M A;  1NKB A;  4FLT A;  1S9E A;  4PWD A;  4KRE A;  1BCO A;  4I2Q A;  3HST B;  4DSE A;  5HLF A;  1UOC A;  4DTR A;  4DSF A;  3WNG A;  2HVH A;  1RBT A;  2WOM A;  3L3V A;  4DSK A;  1DLO A;  3RMA A;  1NK8 A;  3OYC A;  1RT6 A;  3QET A;  3FFI A;  3AV9 A;  2Z1I A;  4JRP A;  2GBZ A;  3O4N A;  3MAQ A;  1RT2 A;  3DLG A;  1IG9 A;  2Z1J A;  4CFA A;  1C1C A;  4Z4H A;  3NAE A;  3LWL A;  5D3G A;  4DQR A;  3ZT0 A;  3ZSZ A;  4B9L A;  4E19 A;  3VQ7 A;  4KHS A;  3OVN A;  3NH0 A;  1NKE A;  3VQA A;  4CJE A;  4CCH A;  4KHQ A;  4LSL A;  4F3T A;  2F8S A;  4Q5V A;  1RTI A;  5T7B A;  5CYM A;  3VQE A;  1XHX A;  1QQC A;  1HYV A;  1RCH A;  3L3U A;  4Y1D A;  4B8A B;  2B6A A;  3CM6 A;  4FM2 A;  4AHU A;  2O4G A;  1Q8I A;  1S6Q A;  3KLI A;  1T03 A;  1KFS A;  4M3X A;  2HHW A;  1YTU A;  2KFN A;  4IG3 A;  3IRX A;  4DFK A;  4F2S A;  4AHT A;  2G8W A;  3S9H A;  1DTT A;  4CJF A;  3V9X A;  3QNO A;  1TGO A;  4CHP A;  2QXF A;  3LAL A;  4NYF A;  4ZHR A;  5HRN A;  3QEX A;  4N41 A;  3KLE A;  1RBV A;  3AVC A;  1U47 A;  3OS2 A;  3AVI A;  3CFO A;  5KRT A;  1FK9 A;  3PX6 A;  1HNV A;  1SKW A;  3M8P A;  1JLA A;  3KLG A;  4ELV A;  2OPR A;  1HQE A;  1U45 A;  1S9G A;  3L2W A;  2KQ2 A;  4DSJ A;  1S1U A;  1RTD A;  4E7J A;  5CYQ A;  4Z4I A;  1TKZ A;  4FVM A;  2YNH A;  3V1Q A;  3T19 A;  3HK2 A;  4FLY A;  4DTP A;  4CFC A;  4KTQ A;  1BI4 B;  3K58 A;  2Z1H A;  3LP1 A;  4E7K A;  5JS2 A;  3AO2 A;  3TAN A;  3V6D A;  1CZ9 A;  2VWJ A;  4DU1 A;  2R7Y A;  4E3S A;  3DLR A;  1HJR A;  2GV9 A;  4J2B A;  1KTQ A;  1IKV A;  5CZ1 A;  1NK4 A;  1TVR A;  1YT3 A;  4N5S A;  4FCY A;  4CEA A;  1QE1 A;  2P51 A;  1BQN A;  4LH5 A;  1ZBF A;  4M3U A;  1UWB A;  3OYN A;  1NK6 A;  3U3G A;  4IBN A;  5FRO A;  1D8Y A;  4IDK A;  3AO4 A;  4LD0 A;  1A5X A;  3SYZ A;  3AVF A;  4AHV A;  4DQQ A;  4KI6 A;  4KHW A;  4CGH A;  1NOZ A;  3TWH A;  3QER A;  3OYL A;  2BAN A;  2DFE A;  4FXD A;  3NH2 A;  1S1V A;  4CEB A;  4HHT A;  4CK1 A;  3SPZ A;  3HP9 A;  2D0C A;  3OS0 A;  4WE1 A;  3TAR A;  1D9F A;  4DSL A;  1BIU A;  4CFB A;  3C95 A;  3TAB A;  4L8R B;  3OYD A;  2BE2 A;  3HL8 A;  1XWL A;  1VSK A;  3F73 A;  4CEZ A;  2OPP A;  3OYI A;  3ZSY A;  1L3S A;  5HRS A;  3KKS A;  3OYM A;  5KGX A;  1LWE A;  3OYJ A;  1U49 A;  4ELU A;  1TL1 A;  2XRI A;  1JLF A;  1RTJ A;  5FDL A;  2GUI A;  4KB0 A;  4F8R A;  1TV6 A;  3AVG A;  1Q9X A;  1GOC A;  1LW2 A;  3G0Z A;  1QSL A;  4KPY A;  3SPY A;  4CHN A;  4FJN A;  3RMC A;  2F96 A;  3QEP A;  4F4K A;  3DM2 A;  1BIZ A;  1KVB A;  4W5R A;  1LW0 A;  3K59 A;  1EXQ A;  1S1X A;  1CXU A;  1LAV A;  1C6V A;  3VQQ A;  3SCX A;  4EZ6 A;  1X1P A;  4DS5 A;  3C6T A;  4DFJ A;  3NF6 A;  3U3Y A;  1NK9 A;  4R5P A;  3LPU A;  5C25 A;  4RW9 A;  1ASW A;  2HB5 A;  2OPS A;  1S1W A;  3DI6 A;  3AO1 A;  3KIO A;  3NBP A;  4FK2 A;  1Y97 A;  4CED A;  1BL3 A;  5KI6 A;  4Y1C A;  4GMJ B;  3LDS A;  1RDC A;  1VSL A;  4LSN A;  3OYE A;  1IKX A;  3QLH A;  4OJR A;  4C8N A;  1I3A A;  1JL2 A;  3JSM A;  1N6Q A;  3AVJ A;  2G8V A;  3RR7 A;  4C8K A;  2F8T A;  4CJK A;  1SV5 A;  4O5B A;  1KCF A;  3CFR A;  3AA4 A;  2B4J A;  4DTO A;  2HHS A;  1YTA A;  4CF8 A;  3K5N A;  3NDK A;  4IKF A;  3LP3 A;  3P83 D;  4CE9 A;  4BE0 A;  2BDP A;  4QAG A;  1EKE A;  4RW7 A;  4N76 A;  5HRR A;  1S6P A;  4B9T A;  4CEQ A;  3MXJ A;  4K8X A;  3KLH A;  4DF4 A;  1C0M A;  4H4O A;  4FJX A;  1W9H A;  4KB1 A;  1RBR A;  1X9W A;  3MXI A;  1EET A;  3DOL A;  4O4G A;  3AVN A;  4H8K A;  3EZ5 A;  1B9F A;  1L5U A;  3HPO A;  1TAQ A;  4AIL C;  1JLB A;  1CLQ A;  1HQU A;  4J2E A;  4RW6 A;  5C24 A;  1XHZ A;  4M3R A;  2KTQ A;  3KD5 E;  1GOA A;  3LP2 A;  3KD1 E;  3QIN A;  1RIL A;  3AA5 X;  4IFY A;  1RBU A;  5KRS A;  3ITH A;  1B92 A;  1DTQ A;  3ALY A;  4CF0 A;  2E6L A;  4CJQ A;  3CFP A;  3THV A;  2PYL A;  1NOY A;  1QS4 A;  4DWI A;  1RDB A;  5I42 A;  2OYQ A;  4F2R A;  2G8U A;  4E1M A;  1NK5 A;  3NF9 A;  4CEE A;  2YKM A;  4YNQ A;  2WON A;  5I3U A;  2FBV A;  1WAJ A;  1VSI A;  3HPH A;  3LPT A;  4KTW A;  5HP1 A;  1KSP A;  3BDP A;  3QIP A;  1KLM A;  1RT7 A;  2DFF A;  5DMR A;  4OGE A;  1T8E A;  4AHS A;  1L3T A;  4FK0 A;  2ETJ A;  4CIE A;  3B6P A;  1ZBL A;  4CEF A;  4ZTJ A;  2HVI A;  1BQM A;  3HP6 A;  4KAZ A;  1KVA A;  4GVM A;  3ZT1 A;  1J9A A;  1TKX A;  3WNE A;  1HNI A;  3CYM A;  1CXQ A;  4B9V A;  1NK7 A;  1T7P A;  1JXE A;  4CHQ A;  3DLE A;  2RF2 A;  5J1E A;  4EZ9 A;  4CK2 A;  2OA8 A;  3KK2 A;  2X6S A;  3AVH A;  3V81 A;  1L3U A;  3MEE A;  5E41 A;  2Z1G A;  3ZT2 A;  1Q9Y A;  4QOZ B;  1BCM A;  3HO1 A;  1WSG A;  1HPZ A;  4ID5 A;  1RTH A;  4JS5 A;  4HUE A;  2IOC A;  2XY7 A;  4RW4 A;  4CJV A;  1TK0 A;  4FJI A;  4FJG A;  1WSI A;  3VQB A;  4I9L A;  1XC9 A;  1ZBH A;  3U6F A;  3ZSR A;  3AVL A;  5SZT A;  4CHY A;  3V1R A;  3IG1 A;  2ATQ A;  3IS9 A;  2W42 A;  1JLE A;  4C8O A;  1TKD A;  3ZCM A;  3H08 A;  4KV8 A;  1D5A A;  3RR8 A;  1VSH A;  1JLG A;  3AA2 A;  4W5Q A;  3NE6 A;  3RTV A;  3AVK A;  4KO0 A;  3NCI A;  2I5J A;  4PA1 A;  4M41 A;  4CF1 A;  4OPJ A;  4TSX A;  4AH9 A;  3QIO A;  1U4B A;  4NCG A;  4DTJ A;  3O3G A;  3SUO A;  1JXB A;  1RT1 A;  4CIG A;  2BGG A;  4CF9 A;  3PX4 A;  3MEG A;  4FJ5 A;  2OPQ A;  4BDZ A;  4UQG A;  4JRQ A;  2LSN A;  3TAG A;  2OZM A;  1C1B A;  3PO4 A;  3LAK A;  3VQ8 A;  1TKT A;  3PY8 A;  3DRR A;  4CGF A;  1JLQ A;  3OJU A;  4BE1 A;  4Q0B A;  3AO5 A;  3SUQ A;  3PX0 A;  3BGR A;  4DQS A;  2RPI A;  3AVB A;  3HT3 A;  1UAX A;  2YNG A;  4FW1 A;  2YHA A;  3D45 A;  3OS1 A;  1Z26 A;  2XO7 A;  2DTU A;  3ASM A;  4CK3 A;  3DOK A;  3LP0 A;  1WAF A;  3QEV A;  2PZS A;  1WLJ A;  3AVM A;  3MEC A;  4B08 A;  4DG1 A;  1QSY A;  2ZD1 A;  1IKY A;  1LAW A;  2XHB A;  1KFD A;  4H4M A;  2O4I A;  2IC3 A;  1IO2 A;  1NJZ A;  1C1A A;  1BGX T;  2QKK A;  3KJV A;  3OYH A;  4FJH A;  3LWM A;  3LAM A;  1ZBU A;  4CJT A;  3HJF A;  4LH4 A;  3VA3 A;  3L2Q A;  2ITG A;  3QEI A;  4ELT A;  1B9D A;  4O0J A;  2G8H A;  3OYB A;  2X78 A;  3TAF A;  4CGI A;  1RT3 A;  2IS3 A;  3AO3 A;  4B9M A;  4Z4G A;  3OYK A;  4FK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...