3MXJA

Crystal structure of the mtrex1 apoprotein
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
229
structure length
210
Chain Sequence
LPHGHMQTLIFLDLEATGLPSSRPEVTELCLLAVHRRALEPPVPRPPRVVDKLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAALKALEQKSYSLGSIYTRLYWQAPTDSHTAEGDVLTLLSICQWKPQALLQWVDEHARPFSTVKPMYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Three prime repair exonuclease 1
publication title X-ray Crystal Structures of TREX1 3' Exonuclease Autoimmune Disease Mutants
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 71
structure length 210
sequence length 229
chains with identical sequence B
ec nomenclature ec 3.1.11.2: Exodeoxyribonuclease III.
pdb deposition date 2010-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3mxjA01
1RDDA 4ELUA 3ZT3A 3ZT2A 3SQ4A 2HB5A 3P5JA 3AA3A 5CYQA 3QEWA 1UA1A 1EXQA 4K8ZA 3DRRA 5FRMA 5CYMA 2G8FA 3CQ8A 1KFSA 1D5AA 3JSMA 2F8SA 3SYZA 1VRTA 3K5NA 2A1SA 3QEVA 4FM1A 1FKPA 4WE1A 5FROA 3ZSWA 3DOLA 4NCGA 3LAKA 3TWHA 1QTMA 4F2RA 2BANA 2D0AA 2FC0A 3DLRA 1TK5A 4DQPA 1BCOA 3QINA 1NKEA 1NOYA 3OYIA 4FZXC 3AVGA 1WAFA 4KI6A 4B9SA 2OPPA 3T19A 3ZT1A 3NF7A 3K59A 4CK2A 1LAWA 3L2VA 1S1WA 4CHYA 4LD0A 3ZSZA 2EHGA 1JLAA 3QIPA 4B9NA 1JLCA 2HHXA 1L3TA 4FLYA 3HP9A 1SV5A 4FJ9A 1BI4B 3KIOA 4KTZA 1YT3A 2KFZA 4CFAA 3I8DA 3KD5E 3C95A 2GBZA 1REVA 2ZE2A 4N47A 3JYTA 4C8KA 4DS5A 4W5NA 4LH4A 4Z4HA 4C8MA 3SUOA 4F3TA 5KI6A 1IH7A 1N5YA 1WNSA 2HHWA 1NK0A 5C42A 2Y1JA 3O4QA 4GW6A 2P5OA 4Z4EA 3VA0A 2YNIA 4FW2A 3NH0A 4JRQA 3V6DA 1RNHA 5CZ1A 2FBXA 3A2FA 4FZZA 2E6MA 4FM0A 5SZTA 2KZMA 2O4GA 4JS5A 4DLGA 3IS9A 1WSFA 3OYMA 5J2PA 3QEIA 3NFAA 3NF8A 3ZSYA 4DQSA 3HK2A 4PUOA 1HPZA 1NK6A 4PWDA 5JS2A 4CGDA 4Z4CA 2VWJA 3AVJA 4KHUA 4CEAA 1X9MA 1I39A 1A5WA 3RR8A 2IS3A 4FK4A 1QSYA 4B3OA 3L2UA 4KFBA 2RF2A 1MU2A 2DFEA 5J1EA 3L3UA 3U3YA 4Z4GA 4DQRA 4CJQA 5C24A 4CFBA 2W42A 2YNFA 4O0JA 4CECA 1RT5A 4YFUA 3ULDA 1S6QA 4Z0UA 2KZZA 3S3OA 4HUGA 3G0ZA 2YNHA 2QK9A 2FBYA 2DFHA 3FFIA 3ISNC 3MAQA 1SL2A 1RBRA 5DK5A 1WSEA 2HHTA 3F9KA 3NHGA 4BDZA 3OYJA 4B9TA 4OLAA 3K2PA 3V1OA 2XY7A 3OS0A 3OYAA 1NJXA 2D5RA 1ZBFA 3MEDA 4AHCA 3EY1A 3C6TA 1S1TA 3D0PA 3T1AA 5K14A 3WNFA 4BDYA 4OLBA 2GV9A 1ZBIA 2QKBA 3CFPA 3E01A 1TAUA 4KHSA 4CJ4A 3DOKA 3TABA 3DMJA 1J54A 1LAVA 2HNYA 3OJUA 1L3UA 5HBMA 2O4IA 3SZ2A 4IDKA 2KW4A 3U6FA 3SQ1A 2Z1JA 1NK7A 4FJJA 3AA2A 3AO1A 3PO5A 3RMBA 2Z1IA 4FJHA 4I9QA 3AVAA 3ZCMA 3VQBA 4CF1A 3IAYA 4CEZA 3KLHA 3NCIA 3MXIA 1RBUA 3LANA 4CF2A 4FYDA 4CGHA 2HHQA 1VRUA 4JLHA 3ITHA 5DMRA 3NBPA 3VQ5A 4UQGA 4M3UA 4FJXA 1FK9A 2OPQA 4OGEA 1BHLA 1DTTA 1W0HA 3DYAA 1DLOA 1KFDA 3L3VA 4EP4A 1TAQA 1LW0A 3M8SA 4BE1A 3S3MA 1WSIA 4RW9A 3L2WA 1S9GA 3LDSA 1Q9YA 1NJWA 2DY4A 1RT6A 2XHBA 2HHUA 1RT2A 2Z1GA 3V4IA 4DWIA 4BWJA 5I42A 3KLGA 4M3TA 3CM6A 4IG0A 1B92A 3C6UA 3ZT4A 3K5OA 1RCHA 2BE2A 3RMCA 2HHSA 1TKZA 1HRHA 2LSNA 3AVLA 3BGRA 3CG7A 1Y97A 3TR8A 3ZT0A 4RW4A 1VSEA 3VQ6A 4PA1A 4LY7A 1L3VA 3NGYA 1BISA 3NDKA 3LP2A 3CYMA 1LWEA 2G8KA 4CJRA 3SPYA 3MXMA 1UA0A 1SL1A 2I5JA 3MEEA 3VQQA 4DSLA 4DSEA 2G8VA 4G1QA 1WLJA 2JLEA 2X6SA 4CIEA 4HUEA 1U49A 3TANA 4CF9A 4CGIA 3DRPA 3QNOA 1D9FA 3TARA 1U45A 1BQMA 4E1MA 4HUFA 1T7PA 4CESA 4CJUA 5KRTA 2EX3A 1LV5A 1JLBA 4CEFA 1BCMA 2JGUA 1XHXA 3ZSVA 1NK9A 4FK2A 1KLNA 2YHAA 3I0SA 4EP5A 4FJIA 2E6LA 4OKEA 1SKWA 1IG9A 3ZSQA 4ZHRA 4CHQA 1DTQA 3QNNA 2YHBA 3PUFA 4ZTJA 4C8LA 1NJYA 3MECA 1RBVA 4CJ3A 1O1WA 1ASWA 4J2EA 4ICLA 3ALYA 4FCYA 2DTUA 2OPRA 4E3SA 1F21A 2HNDA 3QEXA 1TK0A 1RT3A 4FJLA 3QIOA 1RDAA 3VQEA 1N6QA 1JXEA 2PZSA 3AVIA 1C6VA 4I2PA 1FKOA 3VN5A 4CJVA 4K8XA 2Q3SA 3OY9A 4DF8A 1CXQA 3P1GA 1WN7A 3LALA 4FJNA 3KLEA 3TAGA 4J2AA 2IDOA 1RTJA 2XY8A 5KTQA 1HMVA 1RTIA 4DS4A 1U48A 4CK3A 1VK0A 4B08A 5HRSA 2HNZA 4RG8A 1EP4A 4E7IA 3V9ZA 4CEDA 4CHOA 2VG7A 4KB0A 1D9DA 1J53A 1HYVA 5HLFA 4OPKA 3IRXA 4M45A 4DSKA 4M42A 1BI4A 3LWLA 3VQ4A 3HL8A 4FXDA 4OPJA 3SNNA 1HNVA 3WNEA 1TKDA 4KAZA 5SWMA 1VSLA 4E7LA 5JS1A 5HRPA 2G8UA 4J2DA 3H08A 2OYQA 3VQDA 1CXUA 1Z25A 3SPZA 4FLZA 3QESA 4IFVA 4CHPA 2YKMA 4KHYA 4N56A 2IC3A 3LP1A 2F8TA 3DRSA 5KGXA 5J2QA 4M41A 4AHSA 1VSIA 4CGGA 4AHUA 3SCXA 1RT1A 4DTJA 3BDPA 2P1JA 4FLVA 4C8NA 3AA4A 1S9EA 2IAJA 4CEOA 4CIGA 1ITGA 2RPIA 3HT3A 1IKWA 4M3XA 4E7JA 4N5SA 4FM2A 4DU3A 2KTQA 4DTXA 1S1XA 1TKTA 1WSHA 3CM5A 4I9LA 3QETA 3M8QA 4GVMA 4KKOA 2PYLA 3O3HA 4O5BA 2FBTA 2ATQA 4DTUA 2B5JA 4CHZA 1T8EA 3SV4A 4CJTA 3NH1A 3EYZA 3D45A 4B8CA 4M3WA 4ZTFA 4ELTA 3SJJA 4B9LA 4DFJA 3RWUA 2KFNA 4ID1A 4KPYA 3VQ7A 4DLEA 4PQUA 4KV8A 2ZD1A 3IG1A 1HYZA 4DSIA 4OKKA 4AHTA 1C1CA 3OYGA 5CY4A 1XWLA 3KK1A 3L8BA 1JL2A 5FDLA 3CFRA 1X1PA 4E1NA 1IKXA 4MFBA 3LP3A 3NAEA 3C94A 2HMIA 2HW3A 3TAPA 3KD1E 3K57A 4BE2A 3V9WA 4W5OA 4DTOA 4KHNA 1ZYQA 1CLQA 1QE1A 4DTSA 1CZ9A 3LZIA 1YTAA 4L8RB 1ZBHA 1JLFA 3ASMA 3HP6A 3AVNA 4W5RA 3OVNA 4AHRA 1GOCA 1IO2A 4W5QA 1RT4A 1U4BA 3VQAA 3QEPA 3NGIA 4KHWA 4CJWA 1BIUA 4CGJA 3RR7A 4LSNA 3O4NA 3ZSOA 1YTUA 3PX6A 1FXXA 1T05A 3HO1A 4QOZB 1X9SA 3NGZA 2BDPA 1VSFA 1NK5A 4O4GA 4DSJA 1S6PA 3SUQA 1ZBLA 1BQNA 3NE6A 2ITGA 1A5XA 4KTWA 3V1RA 4FJMA 1TKXA 4DQIA 3DI6A 2Z1HA 3KKRA 4E19A 3OYNA 2HVIA 2WONA 4MQ3A 2RKIA 1SKSA 4CEBA 4FLWA 1D8YA 5D3GA 4TSXA 3ZSRA 2E4LA 2B4JA 2QXFA 1J9AA 3AV9A 3QERA 4F3OA 4KREA 3DLBA 3SV3A 4DFPA 1BIZA 1ASUA 4DMNA 2YKNA 3MEGA 5C25A 4JRPA 3O3GA 4CERA 1SL0A 2D0BA 3OYHA 3PX0A 4N76A 4CCHA 2FBVA 4O44A 4DU4A 2PYJA 3HYFA 4FK0A 3LP0A 3V1QA 2XO7A 3V9XA 3OYEA 1HYSA 3OYBA 3LWMA 4GMJB 4DSFA 1UAXA 3WNHA 1KLMA 4Q5VA 3KLIA 2XRIA 3OYDA 4FLUA 2Y1IA 3AVBA 4LH5A 5HRRA 1A5VA 4CE9A 1KRPA 2X78A 4Z4FA 1C0UA 2G8IA 1S1UA 3LZJA 4HCBA 1X9WA 2OZSA 4J2BA 1EX4A 4CF0A 3THVA 1J5OA 1RILA 3O3FA 3P83D 4IG3A 1TVRA 4CHNA 1WAJA 3OYLA 2PY5A 4KTQA 4H4MA 4HTUA 2HHVA 1NOZA 1CZBA 1RDBA 2B6AA 2ETJA 3AVFA 3TAMA 3WNGA 4XIUA 1TV6A 1Q8IA 1U47A 4ID5A 1HNIA 4E7HA 3M8RA 3VQ9A 1C0TA 4AH9A 3DLKA 2F96A 1XI1A 4B9UA 1TL1A 3KKSA 1HQEA 4I7FA 1EETA 4F2SA 3AO2A 4FJ8A 1GOAA 1W9HA 1ZBUA 3L2QA 1S5JA 3HVRA 3KTQA 4QCLA 2VG5A 2IGIA 4OKJA 3SI6A 3KK3A 2XY6A 3K58A 3TI0A 1L5UA 3DLGA 4HCCA 1YVUA 1QSLA 1XHZA 1UWBA 4IKFA 4NYFA 3RMAA 4JS4A 1NJZA 1RBTA 3LPTA 3ZSXA 3TAFA 4Y1CA 3MXJA 3PO4A 1WSJA 3OS1A 2X74A 1QSSA 2P51A 2D0CA 3NF6A 2HVHA 1KVBA 3LAMA 4E0DA 3HPOA 2A1RA 4FLXA 4E7KA 1SKRA 4ELVA 4CF8A 5KGWA 4DF4A 4PY5A 5E41A 3AVKA 3QLHA 4IBNA 1JL1A 4KB1A 2BGGA 4HHTA 1KSPA 3TAEA 2QKKA 4M3YA 1R0AA 1Q9XA 1HJRA 3UIQA 5T7BA 3SUNA 4AILC 4RW8A 4FJKA 4Y1DA 4E89A 1EKEA 4CJKA 4NCAA 4DTMA 2NUBA 3DLEA 4O55A 3OS2A 1RTDA 3KK2A 3G10A 1KTQA 2P5GA 5HP1A 1G15A 2YV0X 3I0RA 4CJSA 2GUIA 1JXBA 4BWMA 3HPHA 3V9UA 1RT7A 3AVHA 1JLEA 4CJPA 4EZ6A 4M3RA 1QHTA 3OYFA 4FJ5A 2XY5A 4BE0A 3T3FA 3S9HA 3SUPA 4CJLA 1WSGA 1RBSA 1JKHA 1LWCA 3CFOA 1VSDA 3B6OA 3TAQA 1RTHA 4HVJA 4YNQA 4DFMA 1B9FA 4FJGA 1KVCA 3HPGA 4N41A 1GOBA 3DLHA 2G8WA 4OGCA 3RRHA 4O0IA 1NK4A 1L3SA 4Q0BA 3K5LA 2X6NA 3EZ5A 1LWFA 4EZ9A 3OYKA 3F73A 1XC9A 4F4KA 2KQ2A 3RTVA 4FW1A 3AA5X 3NF9A 1TGOA 1IKYA 1S1VA 3U3GA 3OJSA 4BACA 2WOMA 4KI4A 4IFYA 4CEQA 1BGXT 1KVAA 3AVCA 3VQ8A 1JLQA 2VWKA 3LPUA 5J2NA 2G8HA 3V9SA 1I3AA 2YNGA 3AO4A 4H8KA 4B8AB 5HRNA 4DTPA 1KCFA 1C0MA 1VSKA 3HJFA 1HQUA 3HM9A 4FZYA 4KRFA 4BDPA 4CEEA 4KHQA 3L2RA 2OZMA 3KLFA 3HVTA 1UOCA 5KRSA 3SQ0A 3KJVA 4RW7A 1NKBA 4CFCA 1QS4A 1QQCA 1RDCA 1LW2A 1VSHA 3V81A 3AO3A 3OYCA 4DQQA 2DFFA 2ZQBA 4B9MA 4CK1A 4B9VA 4CJEA 4I2QA 1IKVA 1SUQA 4DFKA 4CJFA 3RRGA 4C8OA 5EU7A 4CJ5A 3VA3A 2IOCA 3NH2A 2R7YA 4FLTA 4NCBA 1BL3A 1NKCA 1C1AA 1TL3A 2VG6A 1TK8A 2AJQA 3QO9A 3PY8A 4DU1A 4RW6A 3AVMA 4OVLA 3K5MA 1Z26A 4DTNA 3VQCA 5FRNA 1NK8A 5J2MA 1U04A 4LSLA 4NYNA 3HSTB 4R5PA 1T03A 4QAGA 5I3UA 3M8PA 5CZ2A 2RN2A 5HROA 1VSJA 4DG1A 3HXMA 3S3NA 4F8RA 4AHVA 3SQ2A 4H4OA 4KO0A 3PX4A 4CIFA 1ASVA 1JLGA 2OA8A 4DTRA 3DM2A 4OJRA 1VSMA 1C1BA 1B9DA 2OPSA 4CFDA 3PV8A 4M3ZA 3AO5A 4CGFA 4FVMA 3B6PA 1K6YA 3VQPA 3RMDA 4FJ7A 4W5TA 4Z4IA
chains in the Genus database with same CATH superfamily
1RDDA 4PY5A 3SQ4A 5EVZA 3P5JA 4WQ4C 2QA4N 3QEWA 1EXQA 2F9WA 5CYMA 3CQ8A 3JSMA 3CJAA 1HKCA 4FOEA 3CMAN 3K5NA 1BDGA 2A1SA 3A0IX 4WQ5C 1OKJA 4FM1A 3TU5A 4NCGA 3PLAA 1QTMA 3DLRA 1BCOA 3QINA 2FXUA 4L3QA 2WUSA 3VEXA 3ZT1A 1LAWA 3F5TA 3KWGA 3S41A 3D2FB 4LD0A 4OO1J 1JLAA 1LOTB 4PKHA 1L3TA 4FWMA 4B3RK 1YJ9N 3JYTA 3CJ1A 5C12A 4Z4HA 1W97L 4PKIA 4WF9L 3K0SA 1IH7A 5C42A 4CBUA 2Y1JA 4FW2A 2FBXA 1EWRA 3A2FA 4DLGA 3QEIA 1WSFA 3OYMA 3NFAA 3NF8A 3HK2A 4PWDA 4CGDA 4Z4CA 4BC3A 1X9MA 1I39A 3ULEA 2RF2A 4Z4GA 5F2RA 2W42A 2D0PA 1RT5A 4YFUA 4LF4K 3ULDA 1S6QA 3O1BA 3ZX0A 5BREA 3S3OA 4HUGA 2NRRA 3A8YA 1V4SA 2YNHA 2QK9A 2DFHA 1DGKN 4GVEA 3F9KA 4BDZA 1U6ZA 4OLAA 1JCGA 4B1VA 4GV9A 3V1OA 2XY7A 3EE9A 3OS0A 1NJXA 1IJJA 2D5RA 4K41A 3MEDA 4JK9A 5FPDA 3EY1A 2IVPA 4BQLA 5K14A 1BUPA 2GV9A 1ZBIA 3VESA 4KHSA 4CJ4A 4M7XA 1L3UA 3OJUA 5HBMA 2Z1JA 1NK7A 3AO1A 2VYPA 5AZJB 3VQBA 5M1OA 3KLHA 3CCEN 1RBUA 3VQ5A 5DMRA 4UQGA 1FK9A 1O13A 4YY3K 3BZCA 2AP1A 4BE1A 2GTDA 3LDSA 1VQ7N 1RT6A 3CC7N 2HHUA 1GLDG 4NO7A 4X65K 4BWJA 3BY5A 3TTDA 1SS6A 3KLGA 1B92A 4JKGA 3K5OA 4RTFD 5C15A 1TKZA 3AVLA 3BGRA 4CZJA 2HHSA 2A41A 4CZFA 4PA1A 3CYMA 1LWEA 3SPYA 4GNIA 2QTDA 2D4WA 4DR7K 4BRIA 2VGMA 3TANA 4CGIA 4U67L 1SZ2A 4CESA 2EWSA 5KRTA 2Q1NA 2JGUA 4YHHK 3P31A 4OKEA 1SKWA 5HL7L 1DTQA 1ASWA 4ICLA 4MDAA 3QEXA 3R6MA 4I2PA 1S22A 3VN5A 4CJVA 4EHUA 1NGGA 4DF8A 1CXQA 1WN7A 4JAXA 5AJ3K 4J2AA 1RTJA 5KTQA 2V52B 4CK3A 4GV6A 4CEDA 4KB0A 1MDUB 1D9DA 4BRCA 4M45A 1BI4A 2P9IA 3HL8A 4BC2A 3OBYA 2P9SB 5FPEA 5JS1A 3FFKB 4J2DA 3H08A 1H1VA 4MO4A 3VQDA 1DT9A 4CHPA 5I9EB 3DRSA 5KGXA 3ZX3A 4B3TK 3SCXA 4JI2K 1RT1A 4DTJA 3LDOA 2P9KB 1S9EA 3CQYA 3CM5A 4I9LA 4KKOA 3O3HA 4DTUA 2B5JA 3EYZA 4ZTFA 3LDLA 3TPQA 4DLEA 4PQUA 4KV8A 1HYZA 4OKKA 3KK1A 3CFRA 5CY4A 1XWLA 3L8BA 5FDLA 1X1PA 4E1NA 4B1UB 4BE2A 3PIPL 5AZIB 1KAYA 3LZIA 4I6MA 3NVKA 3AVNA 1IO2A 4ILGB 4KHWA 1BIUA 3NMUA 3HO1A 3O4NA 5KQDA 3PX6A 1X9SA 2BDPA 2HSTA 4CBWA 3CF5L 4B3SK 1E3MA 1A5XA 3V1RA 3HOSA 4FWKA 4DQIA 1YHQN 4E19A 3OYNA 1WBBA 4FWRA 2HVIA 2WONA 1D8YA 4FLWA 2FSKA 2O8EB 5GINA 1BOTO 2QXFA 2Q2RA 4BR5A 1J9AA 3QERA 4AQYK 3FZFA 2D0BA 3OYHA 3PX0A 3EZWA 3QFPA 4O44A 3DLLL 4FK0A 3OYEA 4O5FA 3LWMA 1KD1O 1KLMA 2XRIA 5HRRA 1A5VA 4BRMA 2X78A 3LZJA 1EX4A 2NLXA 3THVA 2FF6A 3P83D 4IG3A 1WAJA 4HTUA 2HHVA 1VQKN 1NOZA 1CZBA 2ETJA 1U47A 4MO5A 4E7HA 3M8RA 4GV3A 1XI1A 3I8BA 3OA9A 4B9UA 2V7ZA 4I7FA 3H1QA 3L2QA 1QQMA 4JHDA 3THYB 4OKJA 3SI6A 3TTCA 2XY6A 3DLGA 1QSLA 1XHZA 2UUAK 1JCEA 5AQMA 5BN9A 2D1KA 1HLUA 4DR2K 1EQYA 1KVBA 3TTFA 1C0FA 4ELVA 3B8AX 2WBNA 3QLHA 4IEEA 3A5LC 2BGGA 4HHTA 2NNWA 2VWBA 3TAEA 2QKKA 4M3YA 3SK3A 5T7BA 5GADP 4Y1DA 4E89A 4BR7A 2NUBA 3DXKA 3CPEA 4BWMA 3V9UA 4JKEA 1QHTA 3T3FA 2UXDK 3SUPA 3N4QA 1LWCA 1GLBG 5GAGP 4HVJA 4YNQA 4DFMA 3CD6N 2GWKA 1NK4A 1L3SA 4Q0BA 3FGUA 3J80O 4FOIA 1NGJA 3HI0A 2BUPA 3EEQA 5BPLA 3AA5X 1IKYA 2UXBK 1BGXT 3FE1A 3E9LA 1JLQA 4NXNK 1I3AA 3EKSA 1VSKA 2GEMA 1HQUA 3VEWA 1NKBA 1NWKA 1RDCA 1LW2A 1VSHA 3V81A 3LDPA 1Z6RA 2E1YA 3OYCA 4DQQA 4B9MA 3D2EB 4JKHA 1IKVA 3I33A 1BL3A 1QZ5A 2VG6A 4XH5A 3M6GA 5AR0A 5FRNA 1NK8A 1KAXA 2NRZA 5B8HA 2F7TA 4NYNA 2RN2A 4DG1A 4F8RA 1ATRA 3SQ2A 2P9UA 4E1JA 3RVCA 1B9DA 4C1NI 4JV5K 3B6PA 1K6YA 3VQPA 3CJBA 4W5TA 4K25A 5E26A 2HB5A 4H0TB 4QS7A 3WEEB 4K8ZA 3DRRA 2G8FA 2W6LA 3VTHA 1VQNN 3FZKA 4BR9A 5FPNA 4BRQA 1J5EK 4KHPK 3WXIA 1FKPA 2NRXA 5FROA 3VMFB 3BZKA 3DOLA 3LAKA 1HR0K 4BRDA 5LMNK 4WYBA 2P9PB 4IJAA 3O80A 3WT0A 3SAGA 2O8FB 3ZYYX 4CK2A 5LJWA 4CHYA 3BEXA 2EHGA 3C7NB 4B9NA 1JLCA 2W40A 3ID6A 1SV5A 3KIOA 3ZEUB 5A2QO 4CFAA 3C95A 1REVA 2ZE2A 4W5NA 3CCJN 3VF6A 4LH4A 4F3TA 1WNSA 4O8KA 1NK0A 2HHWA 3O4QA 4GW6A 2YNIA 3V6DA 3VEYA 4FM0A 2O4GA 1S3XA 5LMUK 4JKCA 2IVNA 3Q7CA 4DQSA 3G25A 1NK6A 1IBKK 5JS2A 1X3NA 4KHUA 3AVJA 1VQLN 4BG8A 4CEAA 3RR8A 4KFBA 5J1EA 4CJQA 3VERA 4BRGA 1OH5A 3ATUA 3DXMB 4CFBA 4CECA 4B1YB 3MMVA 4DQ8A 3UKRB 2FBYA 4WCEL 3THXB 5DK5A 2H3GX 3NHGA 4B9TA 2VCPA 1WBDA 4GKKK 1GLJO 1S1TA 3D0PA 3H1VX 1I94K 3WNFA 4BR2A 3C6AA 2QWNA 2QKBA 3E01A 3MX5A 2QWRA 3O5BA 3CETA 4FJJA 1VAZA 3ENOA 5E84A 3RMBA 3NCIA 3LANA 4CF2A 1Q81O 4FJXA 2OPQA 4OGEA 5JLFA 3U8XA 2GX9A 1DTTA 1W0HA 1KFDA 3AGKA 3L3VA 3MN9A 3M8SA 1LW0A 1ATNA 3S3MA 1WSIA 3VGMA 5ADXA 3L2WA 1YJWN 2DY4A 1RT2A 2ZWHA 3JAMO 4H5RA 3CCUN 3H6EA 4EAHD 4YDUA 3HBTA 5I42A 4M3TA 3CM6A 1HPMA 2E2NA 3CERA 3RMCA 3ZT0A 3CG7A 3TR8A 1Y97A 3D6RA 4RW4A 2NZTA 4LY7A 3NGYA 3ENBA 1L3VA 2G8KA 3M1FA 3MXMA 1UA0A 3EN9A 3MEEA 4DSLA 4FPBA 4DSEA 1WLJA 2JLEA 4CIEA 3LL3A 5AQNA 4CF9A 3DRPA 5AQIA 3TARA 5BPNA 1VQ8N 5KQ8A 2EX3A 1LV5A 1BCMA 1XHXA 3FZMA 3L4QA 4LF6K 1E4GT 4EP5A 4CD1A 2E6LA 2E5LK 4B1XB 3BF3A 5DM6L 4C8LA 4CZLA 1RBVA 4CJ3A 4J2EA 2DTUA 4FCYA 2O8CA 2OPRA 3R3LA 4UY8O 4FJLA 3QIOA 3VQEA 3RSEB 4A5BA 3P1GA 4H0XB 5JVHL 4A59A 3LALA 4JI3K 4FJNA 3TAGA 2IDOA 1K8AO 2P9NA 1VK0A 5HRSA 4IEIA 1J53A 3FR0A 4YOVA 4OPKA 1NLVA 3IMXA 3LWLA 5AQHA 4FXDA 4OPJA 4KAZA 5SWMA 3UKUA 5HRPA 1KQSM 2G8UA 3O1WA 5AQXA 2OYQA 1XUPO 3QESA 2KLAA 3SPZA 4IFVA 4KHYA 1XMOK 2P9LA 5J2QA 1VSIA 4CGGA 3O8MA 2ZM6K 2P1JA 4C8NA 3AA4A 3R1XA 1ITGA 2RPIA 3HT3A 4DKWA 4E7JA 4HTLA 1WSHA 2PYLA 4GVMA 4O5BA 2ATQA 3IKMA 4O8UA 3NH1A 4R79A 4M3WA 4ELTA 4WFAL 4B9LA 4DFJA 3RWUA 1Y64A 4A5AA 5CE3A 2ZD1A 2E2OA 4LFAK 3VTIA 4DSIA 2P9KA 4AHTA 2QWOA 1HKBA 1JL2A 3UE5A 4V19S 1IV0A 4K42A 3LP3A 2HW3A 2GELA 3K57A 5C2DA 3V9WA 4DTSA 1CZ9A 2J4RA 4L8RB 1ZBHA 3HP6A 4QS8A 4W5RA 4AHRA 3O9RA 1GOCA 4EHTA 4A62A 1Q82O 4BRHA 3NGIA 1YTUA 4LSNA 4DR3K 1NK5A 5AZIA 1BQNA 3K9KA 3NE6A 4KTWA 5AQJA 1TKXA 4YOXA 2Z1HA 2BH1A 4MQ3A 1MWMA 3C6HA 1HUXA 4B1ZA 5MLCQ 4TSXA 5D3GA 3ZSRA 4H0OA 2B4JA 1XMQK 2CGJA 3DLBA 3SV3A 4RWTA 3J7ZO 4B1WB 1GLFO 3ZETA 1QVFM 4CERA 1SL0A 5CHIA 1T6CA 2CH5A 4DU4A 2PYJA 1HYSA 1YF5L 4IOXA 4JD2A 4GMJB 5JICA 1UAXA 4DSFA 2HOEA 3OYDA 5CR4A 4FLUA 3AVBA 4LH5A 4CE9A 4B3MK 4FVUA 3WQTA 1S1UA 2G8IA 4PL7A 4IZ9A 4J2BA 3O3FA 3OYLA 2W41A 4DV3K 4H4MA 1VQ9N 3VGKA 1C0GA 1YAGA 2ASOA 1HNIA 3VQ9A 4AH9A 3KKSA 1HQEA 4H5WA 4DR1K 4FJ8A 1GOAA 3WQUA 2VG5A 2IGIA 4CZHA 2DPNA 4HCCA 1UWBA 3W0LA 4IKFA 3RMAA 4JS4A 1K73O 1NJZA 3ZSXA 1KAZA 1WSJA 3OS1A 4KH5A 1OVQA 3U9ZA 5EXWA 3HPOA 2A1RA 4MLEA 4E7KA 4CF8A 5KGWA 4DF4A 5E41A 1ESVA 3AVKA 1JL1A 3L0QA 4M7YA 1HJRA 3P4IA 2NRHA 4CJKA 4NCAA 4DTMA 5BRHA 5AQOA 2PAVA 4O55A 3ZX2A 2QXLA 3ULEB 3G10A 3HM8A 5HP1A 2GUIA 1JXBA 1N8RO 4HCBA 1RT7A 3AVHA 4CJPA 4ISFA 4EZ6A 3OYFA 1TYQA 4BE0A 4NXMK 1RBSA 1JKHA 4KH4A 3U9DA 1B9FA 4DV5K 4DHYA 4OGCA 4O0IA 2QWMA 3D7EO 3QB0A 4H5NA 3K5LA 2X6NA 3EZ5A 4EZ9A 4NLCA 1U2VB 3HRGA 3I55N 3F73A 2KQ2A 4DV1K 1TGOA 1S1VA 4WFBL 4CEQA 5AFUH 1KVAA 3AVCA 3LM9A 4CBXA 3VQ8A 2VWKA 5IT9O 2YNGA 3AO4A 3MDQA 3H46O 3EE8A 3HJFA 1C0MA 2I7PA 4XH4A 5BRDA 3CCRN 1D4XA 4KRFA 4CEEA 1T44A 4KHQA 2OZMA 3KLFA 1UOCA 1X3MA 3AAPA 4CFCA 2FSNA 3MWTA 4CK1A 3VEVA 4CJEA 4BRPA 3RRGA 3AY9A 1NGHA 3SLCA 4C8OA 5LL6Z 4CJ5A 1GLAG 3R9PA 4NCBA 5FLXO 1P8ZA 1TL3A 3CCVN 3CIPA 3QO9A 3THWB 1HJOA 4JKGB 4DU1A 5KPZA 3QBXA 1Z26A 3UB5A 4OX9K 5J2MA 5KPRA 4ILHA 1T03A 1HX1A 2V51B 4QAGA 3TSUA 1VSJA 4KO0A 2VQFK 1ASVA 3DM2A 2A6AA 1MA9B 2OPSA 4CFDA 3PV8A 1VQPN 4X62K 4ISGA 4FVMA 2WC9A 3RMDA 4FJ7A 1GLEG 3VF2A 3ZT3A 3ZT2A 1UA1A 4JK8A 4LF8K 3A5OC 1HKGA 2QEXN 5FRMA 2O8BA 2GUPA 1NMDA 2I7NA 1BG3A 1OH6A 1VRTA 2FSJA 3CC2N 2ZGZA 2WFBA 1ZC6A 3T69A 1RDUA 3HSCA 3TWHA 2UYTA 2D0AA 1TK5A 1NOYA 3K59A 2Q31A 5AQUA 2O8DA 3QIPA 4FLYA 3HP9A 4FJ9A 1BI4B 3CCQN 2P9IB 3I8DA 3KD5E 2GBZA 4C8KA 3DAWA 5EY4A 1OH8A 4C8MA 3SUOA 4A2BA 5KI6A 1N5YA 3TSPA 3QDKA 4Z4EA 2FF3B 5AQPA 4JRQA 1QQNA 5CZ1A 4FZZA 2E6MA 5SZTA 4JS5A 3IS9A 3VENA 5J2PA 4PUOA 2VWJA 4FWQA 1Q86O 1A5WA 4FK4A 2IS3A 2ITMA 1QSYA 4B3OA 3L2UA 1MU2A 3L3UA 4H5VA 4DQRA 5C24A 2YNFA 3R8EA 4DCHA 5AQWA 4Z0UA 2E2QA 3G0ZA 3HZ6A 3TSQA 1VQ4N 2HHXA 3FFIA 4JKDA 3MAQA 1SL2A 1N33K 2HHTA 4I6MB 3OYJA 1SQKA 4DV0K 3C6TA 2OCEA 3T1AA 4BROA 3ID8A 3SMSA 4F9OA 3CFPA 1TAUA 1NG9A 3DOKA 1NGEA 4YOTA 1J54A 1YI2N 1YIJN 4IDKA 2KW4A 1HNZK 3U6FA 3SQ1A 2YHWA 3PO5A 4DR4K 4FJHA 4DB3A 4CZMA 1DEJA 4BGBA 4CF1A 3J7YP 3MXIA 2UUBK 4FYDA 5C2FA 1VRUA 3ENHA 1NM1A 3NBPA 2UU9K 4M3UA 3J7AP 3QMLA 4EP4A 1DKGD 2YCHA 4RW9A 4JI4K 1S9GA 2JWKA 1NJWA 4CW7B 1X9JA 4LFCK 3V4IA 4DWIA 1NGCA 5AQKA 5M1NA 4CZKA 1TUYA 4LF7K 2LSNA 1HRHA 3ATVA 1GLCG 3MX2A 1VSEA 4DV6K 3KK7A 3NDKA 3LP2A 4CZEA 1YVNA 4IDHA 2I5JA 5AFUA 3VQQA 4NLBA 2G8VA 2UXCK 1NGAA 4HUEA 2ZF5O 4KH6A 3HOTA 1K8KA 1U45A 4HUFA 1XQSC 4JHDB 4E1MA 3M5RA 3VOVA 5BPMA 3J81O 2D0OA 1NK9A 2YHAA 3KHYA 4CI6A 1IG9A 4BREA 2YHBA 3PUFA 3CJ9A 4ZTJA 1NJYA 2NRVA 3K9JA 1F21A 2YHXA 2HNDA 1XNRK 1RT3A 3E1YA 4H03B 3AVIA 4K8XA 2Q3SA 3MK6A 1BA0A 1CZAN 1W7AA 4WQ4A 1RTIA 4BY9C 5C10A 4ILJA 1U48A 3OW2M 4B08A 2HNZA 3D2FA 5GAEP 4CHOA 3DXKB 4ISEA 5HLFA 4BRNA 3IRXA 1NGIA 4WQ5A 4FWOA 3VQ4A 1TKDA 3WNEA 5JMVA 4X64K 1XC3A 5LJVA 2YKMA 4N56A 2IC3A 5BRFA 4B9QA 4M41A 4AHUA 3WXKA 4CEOA 3MCAB 4JKBA 4N5SA 4FM2A 4DU3A 1S1XA 4DTXA 4MDBA 2PZSA 2FBTA 1T8EA 4CHZA 3P39A 3D45A 3O08A 3SJJA 2KFNA 3VQ7A 2E88A 3AAQA 1NBWA 4HWIA 1NJIO 4MFBA 2HMIA 5M1FA 3C94A 3NAEA 2AA4A 1BA1A 4W5OA 4DTOA 4KHNA 1YTAA 1JLFA 3NVMA 3OVNA 4LF5K 3QEPA 2W6KA 1WUAA 4BVPA 4CGJA 2ZJPL 3ZSOA 3RR7A 3OTOK 3C65A 1FXXA 3FLCO 4IXCA 2QWPA 1K9MO 1VSFA 4O4GA 1S6PA 4OPHA 4BC5A 3SAHA 5AZJA 4K0KK 2VQEK 1FW6A 1WB9A 3AARA 4BGAA 1SKSA 4CEBA 4BG9A 3GOIA 5IWAK 2P9UB 2E4LA 2YHYA 3AV9A 1XNQK 4F3OA 4XEIA 3MWPA 2YKNA 3MEGA 5AQVA 3O3GA 2F4VK 3GG4A 2FBVA 3LP0A 2XO7A 2OTJN 4Q5VA 4A57A 1KRPA 1C0UA 1BU6O 1X9WA 1JJ2M 1RILA 4CHNA 2CGLA 2GWJA 4BRKA 2B6AA 3TAMA 1NU0A 3HTVA 3LDQA 3WNGA 1OH7A 1Q8IA 3EO3A 4X66K 1C0TA 4BRAA 2A3ZA 2F96A 3DLKA 1EETA 4F2SA 3HVRA 1S5JA 2V7YA 3KTQA 1M90O 4QCLA 2ZJQL 3KK3A 3K58A 1L5UA 1N34K 3WXLA 4NYFA 1RBTA 3LPTA 3TAFA 4Y1CA 2OTLN 3MXJA 3PO4A 1QSSA 2P51A 5GIPA 3NF6A 3LAMA 4E0DA 4FLXA 5DM7L 1SKRA 3CC4N 5GAHP 4IBNA 3WXMB 4KB1A 1KSPA 4BRLA 3UIQA 3BP8A 4RW8A 3E9OA 1EKEA 4BC4A 1MWKA 1RTDA 2KKZA 3KK2A 1KTQA 3T1YK 4A2AA 1G15A 3JS6A 4EIAA 1JLEA 2XY5A 2P9SA 3S9HA 1WSGA 4H0YB 4JI1K 3CFOA 3TAQA 4FJGA 1CLQA 1RTHA 1ILYA 4K43A 3SBTA 4N41A 2QWQA 1GOBA 3IDHA 2G8WA 4FWLA 1LWFA 4KBOA 2Q0RA 1XC9A 4F4KA 3VEZA 3RTVA 4FW1A 1VQ6N 2HBLA 4YORA 4BRFA 4IO9L 3U3GA 2WOMA 4KI4A 4IFYA 1WOQA 3CJCA 1ZBSA 1NNEA 3JXUA 3LPUA 4AM6A 3TI0A 4H8KA 1KCFA 1U2VA 3F9MA 4JEPA 4YDUC 2ZGYA 5TKYA 3L2RA 3HVTA 5KRSA 3SQ0A 3T1HK 1QS4A 1QQCA 4AM7A 4NB4A 3AO3A 2DFFA 4PL8A 4JKAA 4CJFA 4DUYK 5EU7A 4FWNA 3NH2A 2R7YA 4XH1A 1NKCA 1C1AA 2AJQA 1IG8A 1SAZA 3PY8A 1M1KO 4RW6A 4OPAA 5H1SQ 3H3OB 3VQCA 4IO8A 3EKUA 3E9PA 5JLHA 4R5PA 5I3UA 3M8PA 5CZ2A 5HROA 3S3NA 1BWFO 5M1QA 2O8EA 4CIFA 1C1BA 3THWA 3KZBA 4U7BA 4M3ZA 3AO5A 4GY2B 3O9UA 3DJCA 3G6EN 2YX6A 4M63C 3L6QA 1NMNA 1T6DA 4ELUA 5EX5A 5CYQA 3AA3A 1ATSA 1HNWK 2YJEA 1KFSA 1D5AA 2F8SA 4WFNL 3CCMN 3SYZA 2OANA 2O8CB 1P90A 3QEVA 3H45C 4FO0A 4WE1A 3W3DA 3E66A 3ZSWA 4CZGA 5EOYA 4F2RA 2BANA 3CJ7A 2FC0A 4DQPA 1NKEA 5AQGA 4JI0K 3OYIA 2P9NB 3AVGA 1WAFA 4FZXC 4B9SA 4KI6A 2OPPA 3T19A 3NF7A 5BR9A 3L2VA 1S1WA 3A5MC 5AQRA 3ZSZA 4IOAL 1R59O 4KTZA 1YT3A 2KFZA 4QS9A 3THYA 4LFBK 5AQTA 4N47A 3UKUB 4DS5A 2E1ZA 2YJFA 3CCLN 3O4WA 4H0PA 2P9LB 5AQZA 2HHHK 1IBMK 3U4LA 2P5OA 3VA0A 1NGDA 3NH0A 1FJGK 1RGIA 1RNHA 2KZMA 3ZSYA 3CI5A 1HPZA 3C0BA 3P38A 2PFUA 3O9SA 1OVYA 3U3YA 2DFEA 1QVGM 4FPAA 4O0JA 3SMPA 2KZZA 4CVNE 1E4FT 3ISNC 1RBRA 1WSEA 3LM2A 3ZLJA 4BQZA 3K2PA 3OYAA 2HBKA 1ZBFA 4AHCA 3O9TA 3OHRA 3QICA 5JVGL 5GIOA 1GLLO 4BDYA 4OLBA 5LY3A 1S72N 2JWLA 4A61A 3TABA 1VQMN 3DMJA 1LAVA 2HNYA 2IVOA 2O4IA 4AF1A 3SZ2A 4GKJK 4JKFA 2HMPA 3AA2A 3L4IA 2Z1IA 4I9QA 1G99A 3AVAA 3ZCMA 3IAYA 4CEZA 1Q18A 2HHQA 4CGHA 4JLHA 3ITHA 1EO1A 2NRWA 1BHLA 3DYAA 1DLOA 1TAQA 3Q7BA 2Q97A 5FPMA 3ZETB 4RCHA 4BVOA 3D2EA 1Q9YA 3A5NC 2XHBA 2QI2A 3QFUA 4FWSA 2Z1GA 4JD2B 4IG0A 3C6UA 3ZT4A 1RCHA 2BE2A 3GL1A 5BN8A 3MN6A 1BO5O 3VQ6A 1QQOA 4YOWA 4IWVA 1BISA 4CJRA 1SL1A 1VQON 3G71N 4MLHA 4DUZK 4G1QA 3WUHA 2X6SA 4CZIA 3KVGA 1U49A 1D9FA 3QNOA 3KWIA 1BQMA 1T7PA 5KPTA 4CJUA 5HOOA 2RE2A 1JLBA 4CEFA 3ZSVA 4FK2A 1KLNA 3I0SA 4FJIA 2QWLA 1Z05A 3WEEA 3ZSQA 4ZHRA 4CHQA 3QNNA 1IBLK 3MECA 4JN4A 4JI5K 1O1WA 3ALYA 2E2PA 4E3SA 1YJNN 1TK0A 1RDAA 1N6QA 1JXEA 1ZXOA 1C6VA 1FKOA 3OY9A 2P9PA 3KLEA 2XY8A 1HMVA 1JCFA 2O8FA 4DS4A 3FZLA 4IOCL 4DR5K 4RG8A 1EP4A 2F9TA 3V9ZA 4E7IA 1VQ5N 2VG7A 3C7NA 1HYVA 4DSKA 3J8AA 4M42A 3ZEUA 5AQQA 3SNNA 1HNVA 1YUWA 1VSLA 4E7LA 1TYQB 4PHTX 5TKWA 1CXUA 1Z25A 5AQFA 4FLZA 3LP1A 2F8TA 4AHSA 5C0YA 3BDPA 4FLVA 2IAJA 4C1NK 4CIGA 1IKWA 4M3XA 4JI7K 2KTQA 3QETA 1TKTA 3M8QA 5ADXH 4CD3A 1LCUA 3SV4A 3O9QA 4CJTA 4B8CA 3N4PA 4ID1A 4KPYA 4EFHA 3IG1A 3DXMA 1C1CA 3OYGA 3CMEN 1IKXA 5AQLA 4H5TA 3BUZB 3TAPA 3VETA 3KD1E 2ASMA 1ZYQA 4PKGA 3UKRA 3THXA 1QE1A 3F2KA 1V4TA 4YOYA 3G4SN 1YITN 3ASMA 3WXJA 3SJHA 4W5QA 3CXCM 1RT4A 1U4BA 3VQAA 4YOUA 1T3VA 2A40A 4DV4K 4CJWA 2BTFA 4QOZB 3CQXA 3GBTA 1T05A 4FSVA 4DSJA 3O6WA 3NGZA 1Q7YO 4Z94A 4Y0WA 3SUQA 1ZBLA 3PSFA 4DR6K 4G9ZA 2ASPA 4DV7K 2ITGA 2FLOA 3VF4A 4CJ7A 4FJMA 2Q0UA 3DI6A 1HNXK 3KKRA 3GE1A 2RKIA 4H0VB 3SAFA 1NGBA 4KREA 1RDWX 3PSIA 4DFPA 1BIZA 1ASUA 4DMNA 1KXPA 4JRPA 3MCPA 5C25A 4FWPA 4N76A 4CCHA 1RFQA 3MN7A 3HYFA 3V9XA 2HF3A 3V1QA 2O8BB 5ELZA 3OYBA 3EL2A 5AQYA 3WNHA 3KLIA 3M3ZA 2Y1IA 1KC8O 4JI8K 2PBDA 4Z4FA 2E8AA 4J8FA 2OZSA 4CF0A 1J5OA 4KTQA 2PY5A 1TVRA 3IUCA 2A42A 1RDBA 3AVFA 3VEOA 4XIUA 1TV6A 5BR8K 4ID5A 4BR4A 4DV2K 1EWQA 1TL1A 1W2BM 5F1XA 3AO2A 2O8DB 1W9HA 1ZBUA 2UUCK 1YVUA 3CPWM 2NRTA 2X74A 1VHXA 2D0CA 2HVHA 4JNEA 2YI1A 2IIRA 4LF9K 3RSEA 4IJNA 3VPZA 2RHKA 2QM1A 4FL9A 3I56N 1R0AA 1Q9XA 3PIOL 3SUNA 4AILC 4FJKA 3FZHA 3AGRA 5AQSA 5F0XA 3DLEA 3LDNA 3OS2A 2P5GA 2ZJRL 3SBGA 3I0RA 2YV0X 4CJSA 4JK7A 3HPHA 2CGKA 4M3RA 4FJ5A 2A5XA 4CJLA 3H3NO 1VSDA 3B6OA 1KVCA 3HPGA 4JYAK 5M1KA 3DLHA 3RRHA 2KHOA 3OYKA 3MN5A 3IFRA 3NF9A 3OJSA 2QW9A 4BACA 4C23A 1YXQA 2WTUA 5M1PA 3CHWA 2E20A 2HF4A 5J2NA 3V9SA 2G8HA 4B8AB 4DTPA 5HRNA 3CCSN 3HM9A 4FZYA 4BDPA 1N36K 2VGNA 3KJVA 4RW7A 3BF1A 4BR0A 1N32K 2HBMA 2ZQBA 4B9VA 4I2QA 4DFKA 1SUQA 3VGLA 3VA3A 2IOCA 3GDQA 4FLTA 1TUUA 1TK8A 3DWLA 2Q36A 4LC9B 3AVMA 1J6ZA 4OVLA 2HBJA 3K5MA 4DTNA 3QBWA 1U04A 1QHAA 4JI6K 4LSLA 3HSTB 2CH6A 3HXMA 4AHVA 4IFEA 4H4OA 3PX4A 1JLGA 2OA8A 4DTRA 4OJRA 1VSMA 1K8KB 3OBWA 4CGFA 3T7ZA 4Z4IA 1QZ6A 1NGFA
chains in the Genus database with same CATH topology
1RDDA 4ELUA 3ZT3A 3ZT2A 3SQ4A 2HB5A 3P5JA 3AA3A 5CYQA 3QEWA 1UA1A 1EXQA 4K8ZA 3DRRA 5FRMA 5CYMA 2G8FA 3CQ8A 1KFSA 1D5AA 3JSMA 2F8SA 3SYZA 1VRTA 3K5NA 2A1SA 3QEVA 4FM1A 1FKPA 4WE1A 5FROA 3ZSWA 3DOLA 4NCGA 3LAKA 3TWHA 1QTMA 4F2RA 2BANA 2D0AA 2FC0A 3DLRA 1TK5A 4DQPA 1BCOA 3QINA 1NKEA 1NOYA 3OYIA 4FZXC 3AVGA 1WAFA 4KI6A 4B9SA 2OPPA 3T19A 3ZT1A 3NF7A 3K59A 4CK2A 1LAWA 3L2VA 1S1WA 4CHYA 4LD0A 3ZSZA 2EHGA 1JLAA 3QIPA 4B9NA 1JLCA 2HHXA 1L3TA 4FLYA 3HP9A 1SV5A 4FJ9A 1BI4B 3KIOA 4KTZA 1YT3A 2KFZA 4CFAA 3I8DA 3KD5E 3C95A 2GBZA 1REVA 2ZE2A 4N47A 3JYTA 4C8KA 4DS5A 4W5NA 4LH4A 4Z4HA 4C8MA 3SUOA 4F3TA 5KI6A 1IH7A 1N5YA 1WNSA 2HHWA 1NK0A 5C42A 2Y1JA 3O4QA 4GW6A 2P5OA 4Z4EA 3VA0A 2YNIA 4FW2A 3NH0A 4JRQA 3V6DA 1RNHA 5CZ1A 2FBXA 3A2FA 4FZZA 2E6MA 4FM0A 5SZTA 2KZMA 2O4GA 4JS5A 4DLGA 3IS9A 1WSFA 3OYMA 5J2PA 3QEIA 3NFAA 3NF8A 3ZSYA 4DQSA 3HK2A 4PUOA 1HPZA 1NK6A 4PWDA 5JS2A 4CGDA 4Z4CA 2VWJA 3AVJA 4KHUA 4CEAA 1X9MA 1I39A 1A5WA 3RR8A 2IS3A 4FK4A 1QSYA 4B3OA 3L2UA 4KFBA 2RF2A 1MU2A 2DFEA 5J1EA 3L3UA 3U3YA 4Z4GA 4DQRA 4CJQA 5C24A 4CFBA 2W42A 2YNFA 4O0JA 4CECA 1RT5A 4YFUA 3ULDA 1S6QA 4Z0UA 2KZZA 3S3OA 4HUGA 3G0ZA 2YNHA 2QK9A 2FBYA 2DFHA 3FFIA 3ISNC 3MAQA 1SL2A 1RBRA 5DK5A 1WSEA 2HHTA 3F9KA 3NHGA 4BDZA 3OYJA 4B9TA 4OLAA 3K2PA 3V1OA 2XY7A 3OS0A 3OYAA 1NJXA 2D5RA 1ZBFA 3MEDA 4AHCA 3EY1A 3C6TA 1S1TA 3D0PA 3T1AA 5K14A 3WNFA 4BDYA 4OLBA 2GV9A 1ZBIA 2QKBA 3CFPA 3E01A 1TAUA 4KHSA 4CJ4A 3DOKA 3TABA 3DMJA 1J54A 1LAVA 2HNYA 3OJUA 1L3UA 5HBMA 2O4IA 3SZ2A 4IDKA 2KW4A 3U6FA 3SQ1A 2Z1JA 1NK7A 4FJJA 3AA2A 3AO1A 3PO5A 3RMBA 2Z1IA 4FJHA 4I9QA 3AVAA 3ZCMA 3VQBA 4CF1A 3IAYA 4CEZA 3KLHA 3NCIA 3MXIA 1RBUA 3LANA 4CF2A 4FYDA 4CGHA 2HHQA 1VRUA 4JLHA 3ITHA 5DMRA 3NBPA 3VQ5A 4UQGA 4M3UA 4FJXA 1FK9A 2OPQA 4OGEA 1BHLA 1DTTA 1W0HA 3DYAA 1DLOA 1KFDA 3L3VA 4EP4A 1TAQA 1LW0A 3M8SA 4BE1A 3S3MA 1WSIA 4RW9A 3L2WA 1S9GA 3LDSA 1Q9YA 1NJWA 2DY4A 1RT6A 2XHBA 2HHUA 1RT2A 2Z1GA 3V4IA 4DWIA 4BWJA 5I42A 3KLGA 4M3TA 3CM6A 4IG0A 1B92A 3C6UA 3ZT4A 3K5OA 1RCHA 2BE2A 3RMCA 2HHSA 1TKZA 1HRHA 2LSNA 3AVLA 3BGRA 3CG7A 1Y97A 3TR8A 3ZT0A 4RW4A 1VSEA 3VQ6A 4PA1A 4LY7A 1L3VA 3NGYA 1BISA 3NDKA 3LP2A 3CYMA 1LWEA 2G8KA 4CJRA 3SPYA 3MXMA 1UA0A 1SL1A 2I5JA 3MEEA 3VQQA 4DSLA 4DSEA 2G8VA 4G1QA 1WLJA 2JLEA 2X6SA 4CIEA 4HUEA 1U49A 3TANA 4CF9A 4CGIA 3DRPA 3QNOA 1D9FA 3TARA 1U45A 1BQMA 4E1MA 4HUFA 1T7PA 4CESA 4CJUA 5KRTA 2EX3A 1LV5A 1JLBA 4CEFA 1BCMA 2JGUA 1XHXA 3ZSVA 1NK9A 4FK2A 1KLNA 2YHAA 3I0SA 4EP5A 4FJIA 2E6LA 4OKEA 1SKWA 1IG9A 3ZSQA 4ZHRA 4CHQA 1DTQA 3QNNA 2YHBA 3PUFA 4ZTJA 4C8LA 1NJYA 3MECA 1RBVA 4CJ3A 1O1WA 1ASWA 4J2EA 4ICLA 3ALYA 4FCYA 2DTUA 2OPRA 4E3SA 1F21A 2HNDA 3QEXA 1TK0A 1RT3A 4FJLA 3QIOA 1RDAA 3VQEA 1N6QA 1JXEA 2PZSA 3AVIA 1C6VA 4I2PA 1FKOA 3VN5A 4CJVA 4K8XA 2Q3SA 3OY9A 4DF8A 1CXQA 3P1GA 1WN7A 3LALA 4FJNA 3KLEA 3TAGA 4J2AA 2IDOA 1RTJA 2XY8A 5KTQA 1HMVA 1RTIA 4DS4A 1U48A 4CK3A 1VK0A 4B08A 5HRSA 2HNZA 4RG8A 1EP4A 4E7IA 3V9ZA 4CEDA 4CHOA 2VG7A 4KB0A 1D9DA 1J53A 1HYVA 5HLFA 4OPKA 3IRXA 4M45A 4DSKA 4M42A 1BI4A 3LWLA 3VQ4A 3HL8A 4FXDA 4OPJA 3SNNA 1HNVA 3WNEA 1TKDA 4KAZA 5SWMA 1VSLA 4E7LA 5JS1A 5HRPA 2G8UA 4J2DA 3H08A 2OYQA 3VQDA 1CXUA 1Z25A 3SPZA 4FLZA 3QESA 4IFVA 4CHPA 2YKMA 4KHYA 4N56A 2IC3A 3LP1A 2F8TA 3DRSA 5KGXA 5J2QA 4M41A 4AHSA 1VSIA 4CGGA 4AHUA 3SCXA 1RT1A 4DTJA 3BDPA 2P1JA 4FLVA 4C8NA 3AA4A 1S9EA 2IAJA 4CEOA 4CIGA 1ITGA 2RPIA 3HT3A 1IKWA 4M3XA 4E7JA 4N5SA 4FM2A 4DU3A 2KTQA 4DTXA 1S1XA 1TKTA 1WSHA 3CM5A 4I9LA 3QETA 3M8QA 4GVMA 4KKOA 2PYLA 3O3HA 4O5BA 2FBTA 2ATQA 4DTUA 2B5JA 4CHZA 1T8EA 3SV4A 4CJTA 3NH1A 3EYZA 3D45A 4B8CA 4M3WA 4ZTFA 4ELTA 3SJJA 4B9LA 4DFJA 3RWUA 2KFNA 4ID1A 4KPYA 3VQ7A 4DLEA 4PQUA 4KV8A 2ZD1A 3IG1A 1HYZA 4DSIA 4OKKA 4AHTA 1C1CA 3OYGA 5CY4A 1XWLA 3KK1A 3L8BA 1JL2A 5FDLA 3CFRA 1X1PA 4E1NA 1IKXA 4MFBA 3LP3A 3NAEA 3C94A 2HMIA 2HW3A 3TAPA 3KD1E 3K57A 4BE2A 3V9WA 4W5OA 4DTOA 4KHNA 1ZYQA 1CLQA 1QE1A 4DTSA 1CZ9A 3LZIA 1YTAA 4L8RB 1ZBHA 1JLFA 3ASMA 3HP6A 3AVNA 4W5RA 3OVNA 4AHRA 1GOCA 1IO2A 4W5QA 1RT4A 1U4BA 3VQAA 3QEPA 3NGIA 4KHWA 4CJWA 1BIUA 4CGJA 3RR7A 4LSNA 3O4NA 3ZSOA 1YTUA 3PX6A 1FXXA 1T05A 3HO1A 4QOZB 1X9SA 3NGZA 2BDPA 1VSFA 1NK5A 4O4GA 4DSJA 1S6PA 3SUQA 1ZBLA 1BQNA 3NE6A 2ITGA 1A5XA 4KTWA 3V1RA 4FJMA 1TKXA 4DQIA 3DI6A 2Z1HA 3KKRA 4E19A 3OYNA 2HVIA 2WONA 4MQ3A 2RKIA 1SKSA 4CEBA 4FLWA 1D8YA 5D3GA 4TSXA 3ZSRA 2E4LA 2B4JA 2QXFA 1J9AA 3AV9A 3QERA 4F3OA 4KREA 3DLBA 3SV3A 4DFPA 1BIZA 1ASUA 4DMNA 2YKNA 3MEGA 5C25A 4JRPA 3O3GA 4CERA 1SL0A 2D0BA 3OYHA 3PX0A 4N76A 4CCHA 2FBVA 4O44A 4DU4A 2PYJA 3HYFA 4FK0A 3LP0A 3V1QA 2XO7A 3V9XA 3OYEA 1HYSA 3OYBA 3LWMA 4GMJB 4DSFA 1UAXA 3WNHA 1KLMA 4Q5VA 3KLIA 2XRIA 3OYDA 4FLUA 2Y1IA 3AVBA 4LH5A 5HRRA 1A5VA 4CE9A 1KRPA 2X78A 4Z4FA 1C0UA 2G8IA 1S1UA 3LZJA 4HCBA 1X9WA 2OZSA 4J2BA 1EX4A 4CF0A 3THVA 1J5OA 1RILA 3O3FA 3P83D 4IG3A 1TVRA 4CHNA 1WAJA 3OYLA 2PY5A 4KTQA 4H4MA 4HTUA 2HHVA 1NOZA 1CZBA 1RDBA 2B6AA 2ETJA 3AVFA 3TAMA 3WNGA 4XIUA 1TV6A 1Q8IA 1U47A 4ID5A 1HNIA 4E7HA 3M8RA 3VQ9A 1C0TA 4AH9A 3DLKA 2F96A 1XI1A 4B9UA 1TL1A 3KKSA 1HQEA 4I7FA 1EETA 4F2SA 3AO2A 4FJ8A 1GOAA 1W9HA 1ZBUA 3L2QA 1S5JA 3HVRA 3KTQA 4QCLA 2VG5A 2IGIA 4OKJA 3SI6A 3KK3A 2XY6A 3K58A 3TI0A 1L5UA 3DLGA 4HCCA 1YVUA 1QSLA 1XHZA 1UWBA 4IKFA 4NYFA 3RMAA 4JS4A 1NJZA 1RBTA 3LPTA 3ZSXA 3TAFA 4Y1CA 3MXJA 3PO4A 1WSJA 3OS1A 2X74A 1QSSA 2P51A 2D0CA 3NF6A 2HVHA 1KVBA 3LAMA 4E0DA 3HPOA 2A1RA 4FLXA 4E7KA 1SKRA 4ELVA 4CF8A 5KGWA 4DF4A 4PY5A 5E41A 3AVKA 3QLHA 4IBNA 1JL1A 4KB1A 2BGGA 4HHTA 1KSPA 3TAEA 2QKKA 4M3YA 1R0AA 1Q9XA 1HJRA 3UIQA 5T7BA 3SUNA 4AILC 4RW8A 4FJKA 4Y1DA 4E89A 1EKEA 4CJKA 4NCAA 4DTMA 2NUBA 3DLEA 4O55A 3OS2A 1RTDA 3KK2A 3G10A 1KTQA 2P5GA 5HP1A 1G15A 2YV0X 3I0RA 4CJSA 2GUIA 1JXBA 4BWMA 3HPHA 3V9UA 1RT7A 3AVHA 1JLEA 4CJPA 4EZ6A 4M3RA 1QHTA 3OYFA 4FJ5A 2XY5A 4BE0A 3T3FA 3S9HA 3SUPA 4CJLA 1WSGA 1RBSA 1JKHA 1LWCA 3CFOA 1VSDA 3B6OA 3TAQA 1RTHA 4HVJA 4YNQA 4DFMA 1B9FA 4FJGA 1KVCA 3HPGA 4N41A 1GOBA 3DLHA 2G8WA 4OGCA 3RRHA 4O0IA 1NK4A 1L3SA 4Q0BA 3K5LA 2X6NA 3EZ5A 1LWFA 4EZ9A 3OYKA 3F73A 1XC9A 4F4KA 2KQ2A 3RTVA 4FW1A 3AA5X 3NF9A 1TGOA 1IKYA 1S1VA 3U3GA 3OJSA 4BACA 2WOMA 4KI4A 4IFYA 4CEQA 1BGXT 1KVAA 3AVCA 3VQ8A 1JLQA 2VWKA 3LPUA 5J2NA 2G8HA 3V9SA 1I3AA 2YNGA 3AO4A 4H8KA 4B8AB 5HRNA 4DTPA 1KCFA 1C0MA 1VSKA 3HJFA 1HQUA 3HM9A 4FZYA 4KRFA 4BDPA 4CEEA 4KHQA 3L2RA 2OZMA 3KLFA 3HVTA 1UOCA 5KRSA 3SQ0A 3KJVA 4RW7A 1NKBA 4CFCA 1QS4A 1QQCA 1RDCA 1LW2A 1VSHA 3V81A 3AO3A 3OYCA 4DQQA 2DFFA 2ZQBA 4B9MA 4CK1A 4B9VA 4CJEA 4I2QA 1IKVA 1SUQA 4DFKA 4CJFA 3RRGA 4C8OA 5EU7A 4CJ5A 3VA3A 2IOCA 3NH2A 2R7YA 4FLTA 4NCBA 1BL3A 1NKCA 1C1AA 1TL3A 2VG6A 1TK8A 2AJQA 3QO9A 3PY8A 4DU1A 4RW6A 3AVMA 4OVLA 3K5MA 1Z26A 4DTNA 3VQCA 5FRNA 1NK8A 5J2MA 1U04A 4LSLA 4NYNA 3HSTB 4R5PA 1T03A 4QAGA 5I3UA 3M8PA 5CZ2A 2RN2A 5HROA 1VSJA 4DG1A 3HXMA 3S3NA 4F8RA 4AHVA 3SQ2A 4H4OA 4KO0A 3PX4A 4CIFA 1ASVA 1JLGA 2OA8A 4DTRA 3DM2A 4OJRA 1VSMA 1C1BA 1B9DA 2OPSA 4CFDA 3PV8A 4M3ZA 3AO5A 4CGFA 4FVMA 3B6PA 1K6YA 3VQPA 3RMDA 4FJ7A 4W5TA 4Z4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RDD A;  4ELU A;  3ZT3 A;  3ZT2 A;  3SQ4 A;  2HB5 A;  3P5J A;  3AA3 A;  5CYQ A;  3QEW A;  1UA1 A;  1EXQ A;  4K8Z A;  3DRR A;  5FRM A;  5CYM A;  2G8F A;  3CQ8 A;  1KFS A;  1D5A A;  3JSM A;  2F8S A;  3SYZ A;  1VRT A;  3K5N A;  2A1S A;  3QEV A;  4FM1 A;  1FKP A;  4WE1 A;  5FRO A;  3ZSW A;  3DOL A;  4NCG A;  3LAK A;  3TWH A;  1QTM A;  4F2R A;  2BAN A;  2D0A A;  2FC0 A;  3DLR A;  1TK5 A;  4DQP A;  1BCO A;  3QIN A;  1NKE A;  1NOY A;  3OYI A;  4FZX C;  3AVG A;  1WAF A;  4KI6 A;  4B9S A;  2OPP A;  3T19 A;  3ZT1 A;  3NF7 A;  3K59 A;  4CK2 A;  1LAW A;  3L2V A;  1S1W A;  4CHY A;  4LD0 A;  3ZSZ A;  2EHG A;  1JLA A;  3QIP A;  4B9N A;  1JLC A;  2HHX A;  1L3T A;  4FLY A;  3HP9 A;  1SV5 A;  4FJ9 A;  1BI4 B;  3KIO A;  4KTZ A;  1YT3 A;  2KFZ A;  4CFA A;  3I8D A;  3KD5 E;  3C95 A;  2GBZ A;  1REV A;  2ZE2 A;  4N47 A;  3JYT A;  4C8K A;  4DS5 A;  4W5N A;  4LH4 A;  4Z4H A;  4C8M A;  3SUO A;  4F3T A;  5KI6 A;  1IH7 A;  1N5Y A;  1WNS A;  2HHW A;  1NK0 A;  5C42 A;  2Y1J A;  3O4Q A;  4GW6 A;  2P5O A;  4Z4E A;  3VA0 A;  2YNI A;  4FW2 A;  3NH0 A;  4JRQ A;  3V6D A;  1RNH A;  5CZ1 A;  2FBX A;  3A2F A;  4FZZ A;  2E6M A;  4FM0 A;  5SZT A;  2KZM A;  2O4G A;  4JS5 A;  4DLG A;  3IS9 A;  1WSF A;  3OYM A;  5J2P A;  3QEI A;  3NFA A;  3NF8 A;  3ZSY A;  4DQS A;  3HK2 A;  4PUO A;  1HPZ A;  1NK6 A;  4PWD A;  5JS2 A;  4CGD A;  4Z4C A;  2VWJ A;  3AVJ A;  4KHU A;  4CEA A;  1X9M A;  1I39 A;  1A5W A;  3RR8 A;  2IS3 A;  4FK4 A;  1QSY A;  4B3O A;  3L2U A;  4KFB A;  2RF2 A;  1MU2 A;  2DFE A;  5J1E A;  3L3U A;  3U3Y A;  4Z4G A;  4DQR A;  4CJQ A;  5C24 A;  4CFB A;  2W42 A;  2YNF A;  4O0J A;  4CEC A;  1RT5 A;  4YFU A;  3ULD A;  1S6Q A;  4Z0U A;  2KZZ A;  3S3O A;  4HUG A;  3G0Z A;  2YNH A;  2QK9 A;  2FBY A;  2DFH A;  3FFI A;  3ISN C;  3MAQ A;  1SL2 A;  1RBR A;  5DK5 A;  1WSE A;  2HHT A;  3F9K A;  3NHG A;  4BDZ A;  3OYJ A;  4B9T A;  4OLA A;  3K2P A;  3V1O A;  2XY7 A;  3OS0 A;  3OYA A;  1NJX A;  2D5R A;  1ZBF A;  3MED A;  4AHC A;  3EY1 A;  3C6T A;  1S1T A;  3D0P A;  3T1A A;  5K14 A;  3WNF A;  4BDY A;  4OLB A;  2GV9 A;  1ZBI A;  2QKB A;  3CFP A;  3E01 A;  1TAU A;  4KHS A;  4CJ4 A;  3DOK A;  3TAB A;  3DMJ A;  1J54 A;  1LAV A;  2HNY A;  3OJU A;  1L3U A;  5HBM A;  2O4I A;  3SZ2 A;  4IDK A;  2KW4 A;  3U6F A;  3SQ1 A;  2Z1J A;  1NK7 A;  4FJJ A;  3AA2 A;  3AO1 A;  3PO5 A;  3RMB A;  2Z1I A;  4FJH A;  4I9Q A;  3AVA A;  3ZCM A;  3VQB A;  4CF1 A;  3IAY A;  4CEZ A;  3KLH A;  3NCI A;  3MXI A;  1RBU A;  3LAN A;  4CF2 A;  4FYD A;  4CGH A;  2HHQ A;  1VRU A;  4JLH A;  3ITH A;  5DMR A;  3NBP A;  3VQ5 A;  4UQG A;  4M3U A;  4FJX A;  1FK9 A;  2OPQ A;  4OGE A;  1BHL A;  1DTT A;  1W0H A;  3DYA A;  1DLO A;  1KFD A;  3L3V A;  4EP4 A;  1TAQ A;  1LW0 A;  3M8S A;  4BE1 A;  3S3M A;  1WSI A;  4RW9 A;  3L2W A;  1S9G A;  3LDS A;  1Q9Y A;  1NJW A;  2DY4 A;  1RT6 A;  2XHB A;  2HHU A;  1RT2 A;  2Z1G A;  3V4I A;  4DWI A;  4BWJ A;  5I42 A;  3KLG A;  4M3T A;  3CM6 A;  4IG0 A;  1B92 A;  3C6U A;  3ZT4 A;  3K5O A;  1RCH A;  2BE2 A;  3RMC A;  2HHS A;  1TKZ A;  1HRH A;  2LSN A;  3AVL A;  3BGR A;  3CG7 A;  1Y97 A;  3TR8 A;  3ZT0 A;  4RW4 A;  1VSE A;  3VQ6 A;  4PA1 A;  4LY7 A;  1L3V A;  3NGY A;  1BIS A;  3NDK A;  3LP2 A;  3CYM A;  1LWE A;  2G8K A;  4CJR A;  3SPY A;  3MXM A;  1UA0 A;  1SL1 A;  2I5J A;  3MEE A;  3VQQ A;  4DSL A;  4DSE A;  2G8V A;  4G1Q A;  1WLJ A;  2JLE A;  2X6S A;  4CIE A;  4HUE A;  1U49 A;  3TAN A;  4CF9 A;  4CGI A;  3DRP A;  3QNO A;  1D9F A;  3TAR A;  1U45 A;  1BQM A;  4E1M A;  4HUF A;  1T7P A;  4CES A;  4CJU A;  5KRT A;  2EX3 A;  1LV5 A;  1JLB A;  4CEF A;  1BCM A;  2JGU A;  1XHX A;  3ZSV A;  1NK9 A;  4FK2 A;  1KLN A;  2YHA A;  3I0S A;  4EP5 A;  4FJI A;  2E6L A;  4OKE A;  1SKW A;  1IG9 A;  3ZSQ A;  4ZHR A;  4CHQ A;  1DTQ A;  3QNN A;  2YHB A;  3PUF A;  4ZTJ A;  4C8L A;  1NJY A;  3MEC A;  1RBV A;  4CJ3 A;  1O1W A;  1ASW A;  4J2E A;  4ICL A;  3ALY A;  4FCY A;  2DTU A;  2OPR A;  4E3S A;  1F21 A;  2HND A;  3QEX A;  1TK0 A;  1RT3 A;  4FJL A;  3QIO A;  1RDA A;  3VQE A;  1N6Q A;  1JXE A;  2PZS A;  3AVI A;  1C6V A;  4I2P A;  1FKO A;  3VN5 A;  4CJV A;  4K8X A;  2Q3S A;  3OY9 A;  4DF8 A;  1CXQ A;  3P1G A;  1WN7 A;  3LAL A;  4FJN A;  3KLE A;  3TAG A;  4J2A A;  2IDO A;  1RTJ A;  2XY8 A;  5KTQ A;  1HMV A;  1RTI A;  4DS4 A;  1U48 A;  4CK3 A;  1VK0 A;  4B08 A;  5HRS A;  2HNZ A;  4RG8 A;  1EP4 A;  4E7I A;  3V9Z A;  4CED A;  4CHO A;  2VG7 A;  4KB0 A;  1D9D A;  1J53 A;  1HYV A;  5HLF A;  4OPK A;  3IRX A;  4M45 A;  4DSK A;  4M42 A;  1BI4 A;  3LWL A;  3VQ4 A;  3HL8 A;  4FXD A;  4OPJ A;  3SNN A;  1HNV A;  3WNE A;  1TKD A;  4KAZ A;  5SWM A;  1VSL A;  4E7L A;  5JS1 A;  5HRP A;  2G8U A;  4J2D A;  3H08 A;  2OYQ A;  3VQD A;  1CXU A;  1Z25 A;  3SPZ A;  4FLZ A;  3QES A;  4IFV A;  4CHP A;  2YKM A;  4KHY A;  4N56 A;  2IC3 A;  3LP1 A;  2F8T A;  3DRS A;  5KGX A;  5J2Q A;  4M41 A;  4AHS A;  1VSI A;  4CGG A;  4AHU A;  3SCX A;  1RT1 A;  4DTJ A;  3BDP A;  2P1J A;  4FLV A;  4C8N A;  3AA4 A;  1S9E A;  2IAJ A;  4CEO A;  4CIG A;  1ITG A;  2RPI A;  3HT3 A;  1IKW A;  4M3X A;  4E7J A;  4N5S A;  4FM2 A;  4DU3 A;  2KTQ A;  4DTX A;  1S1X A;  1TKT A;  1WSH A;  3CM5 A;  4I9L A;  3QET A;  3M8Q A;  4GVM A;  4KKO A;  2PYL A;  3O3H A;  4O5B A;  2FBT A;  2ATQ A;  4DTU A;  2B5J A;  4CHZ A;  1T8E A;  3SV4 A;  4CJT A;  3NH1 A;  3EYZ A;  3D45 A;  4B8C A;  4M3W A;  4ZTF A;  4ELT A;  3SJJ A;  4B9L A;  4DFJ A;  3RWU A;  2KFN A;  4ID1 A;  4KPY A;  3VQ7 A;  4DLE A;  4PQU A;  4KV8 A;  2ZD1 A;  3IG1 A;  1HYZ A;  4DSI A;  4OKK A;  4AHT A;  1C1C A;  3OYG A;  5CY4 A;  1XWL A;  3KK1 A;  3L8B A;  1JL2 A;  5FDL A;  3CFR A;  1X1P A;  4E1N A;  1IKX A;  4MFB A;  3LP3 A;  3NAE A;  3C94 A;  2HMI A;  2HW3 A;  3TAP A;  3KD1 E;  3K57 A;  4BE2 A;  3V9W A;  4W5O A;  4DTO A;  4KHN A;  1ZYQ A;  1CLQ A;  1QE1 A;  4DTS A;  1CZ9 A;  3LZI A;  1YTA A;  4L8R B;  1ZBH A;  1JLF A;  3ASM A;  3HP6 A;  3AVN A;  4W5R A;  3OVN A;  4AHR A;  1GOC A;  1IO2 A;  4W5Q A;  1RT4 A;  1U4B A;  3VQA A;  3QEP A;  3NGI A;  4KHW A;  4CJW A;  1BIU A;  4CGJ A;  3RR7 A;  4LSN A;  3O4N A;  3ZSO A;  1YTU A;  3PX6 A;  1FXX A;  1T05 A;  3HO1 A;  4QOZ B;  1X9S A;  3NGZ A;  2BDP A;  1VSF A;  1NK5 A;  4O4G A;  4DSJ A;  1S6P A;  3SUQ A;  1ZBL A;  1BQN A;  3NE6 A;  2ITG A;  1A5X A;  4KTW A;  3V1R A;  4FJM A;  1TKX A;  4DQI A;  3DI6 A;  2Z1H A;  3KKR A;  4E19 A;  3OYN A;  2HVI A;  2WON A;  4MQ3 A;  2RKI A;  1SKS A;  4CEB A;  4FLW A;  1D8Y A;  5D3G A;  4TSX A;  3ZSR A;  2E4L A;  2B4J A;  2QXF A;  1J9A A;  3AV9 A;  3QER A;  4F3O A;  4KRE A;  3DLB A;  3SV3 A;  4DFP A;  1BIZ A;  1ASU A;  4DMN A;  2YKN A;  3MEG A;  5C25 A;  4JRP A;  3O3G A;  4CER A;  1SL0 A;  2D0B A;  3OYH A;  3PX0 A;  4N76 A;  4CCH A;  2FBV A;  4O44 A;  4DU4 A;  2PYJ A;  3HYF A;  4FK0 A;  3LP0 A;  3V1Q A;  2XO7 A;  3V9X A;  3OYE A;  1HYS A;  3OYB A;  3LWM A;  4GMJ B;  4DSF A;  1UAX A;  3WNH A;  1KLM A;  4Q5V A;  3KLI A;  2XRI A;  3OYD A;  4FLU A;  2Y1I A;  3AVB A;  4LH5 A;  5HRR A;  1A5V A;  4CE9 A;  1KRP A;  2X78 A;  4Z4F A;  1C0U A;  2G8I A;  1S1U A;  3LZJ A;  4HCB A;  1X9W A;  2OZS A;  4J2B A;  1EX4 A;  4CF0 A;  3THV A;  1J5O A;  1RIL A;  3O3F A;  3P83 D;  4IG3 A;  1TVR A;  4CHN A;  1WAJ A;  3OYL A;  2PY5 A;  4KTQ A;  4H4M A;  4HTU A;  2HHV A;  1NOZ A;  1CZB A;  1RDB A;  2B6A A;  2ETJ A;  3AVF A;  3TAM A;  3WNG A;  4XIU A;  1TV6 A;  1Q8I A;  1U47 A;  4ID5 A;  1HNI A;  4E7H A;  3M8R A;  3VQ9 A;  1C0T A;  4AH9 A;  3DLK A;  2F96 A;  1XI1 A;  4B9U A;  1TL1 A;  3KKS A;  1HQE A;  4I7F A;  1EET A;  4F2S A;  3AO2 A;  4FJ8 A;  1GOA A;  1W9H A;  1ZBU A;  3L2Q A;  1S5J A;  3HVR A;  3KTQ A;  4QCL A;  2VG5 A;  2IGI A;  4OKJ A;  3SI6 A;  3KK3 A;  2XY6 A;  3K58 A;  3TI0 A;  1L5U A;  3DLG A;  4HCC A;  1YVU A;  1QSL A;  1XHZ A;  1UWB A;  4IKF A;  4NYF A;  3RMA A;  4JS4 A;  1NJZ A;  1RBT A;  3LPT A;  3ZSX A;  3TAF A;  4Y1C A;  3MXJ A;  3PO4 A;  1WSJ A;  3OS1 A;  2X74 A;  1QSS A;  2P51 A;  2D0C A;  3NF6 A;  2HVH A;  1KVB A;  3LAM A;  4E0D A;  3HPO A;  2A1R A;  4FLX A;  4E7K A;  1SKR A;  4ELV A;  4CF8 A;  5KGW A;  4DF4 A;  4PY5 A;  5E41 A;  3AVK A;  3QLH A;  4IBN A;  1JL1 A;  4KB1 A;  2BGG A;  4HHT A;  1KSP A;  3TAE A;  2QKK A;  4M3Y A;  1R0A A;  1Q9X A;  1HJR A;  3UIQ A;  5T7B A;  3SUN A;  4AIL C;  4RW8 A;  4FJK A;  4Y1D A;  4E89 A;  1EKE A;  4CJK A;  4NCA A;  4DTM A;  2NUB A;  3DLE A;  4O55 A;  3OS2 A;  1RTD A;  3KK2 A;  3G10 A;  1KTQ A;  2P5G A;  5HP1 A;  1G15 A;  2YV0 X;  3I0R A;  4CJS A;  2GUI A;  1JXB A;  4BWM A;  3HPH A;  3V9U A;  1RT7 A;  3AVH A;  1JLE A;  4CJP A;  4EZ6 A;  4M3R A;  1QHT A;  3OYF A;  4FJ5 A;  2XY5 A;  4BE0 A;  3T3F A;  3S9H A;  3SUP A;  4CJL A;  1WSG A;  1RBS A;  1JKH A;  1LWC A;  3CFO A;  1VSD A;  3B6O A;  3TAQ A;  1RTH A;  4HVJ A;  4YNQ A;  4DFM A;  1B9F A;  4FJG A;  1KVC A;  3HPG A;  4N41 A;  1GOB A;  3DLH A;  2G8W A;  4OGC A;  3RRH A;  4O0I A;  1NK4 A;  1L3S A;  4Q0B A;  3K5L A;  2X6N A;  3EZ5 A;  1LWF A;  4EZ9 A;  3OYK A;  3F73 A;  1XC9 A;  4F4K A;  2KQ2 A;  3RTV A;  4FW1 A;  3AA5 X;  3NF9 A;  1TGO A;  1IKY A;  1S1V A;  3U3G A;  3OJS A;  4BAC A;  2WOM A;  4KI4 A;  4IFY A;  4CEQ A;  1BGX T;  1KVA A;  3AVC A;  3VQ8 A;  1JLQ A;  2VWK A;  3LPU A;  5J2N A;  2G8H A;  3V9S A;  1I3A A;  2YNG A;  3AO4 A;  4H8K A;  4B8A B;  5HRN A;  4DTP A;  1KCF A;  1C0M A;  1VSK A;  3HJF A;  1HQU A;  3HM9 A;  4FZY A;  4KRF A;  4BDP A;  4CEE A;  4KHQ A;  3L2R A;  2OZM A;  3KLF A;  3HVT A;  1UOC A;  5KRS A;  3SQ0 A;  3KJV A;  4RW7 A;  1NKB A;  4CFC A;  1QS4 A;  1QQC A;  1RDC A;  1LW2 A;  1VSH A;  3V81 A;  3AO3 A;  3OYC A;  4DQQ A;  2DFF A;  2ZQB A;  4B9M A;  4CK1 A;  4B9V A;  4CJE A;  4I2Q A;  1IKV A;  1SUQ A;  4DFK A;  4CJF A;  3RRG A;  4C8O A;  5EU7 A;  4CJ5 A;  3VA3 A;  2IOC A;  3NH2 A;  2R7Y A;  4FLT A;  4NCB A;  1BL3 A;  1NKC A;  1C1A A;  1TL3 A;  2VG6 A;  1TK8 A;  2AJQ A;  3QO9 A;  3PY8 A;  4DU1 A;  4RW6 A;  3AVM A;  4OVL A;  3K5M A;  1Z26 A;  4DTN A;  3VQC A;  5FRN A;  1NK8 A;  5J2M A;  1U04 A;  4LSL A;  4NYN A;  3HST B;  4R5P A;  1T03 A;  4QAG A;  5I3U A;  3M8P A;  5CZ2 A;  2RN2 A;  5HRO A;  1VSJ A;  4DG1 A;  3HXM A;  3S3N A;  4F8R A;  4AHV A;  3SQ2 A;  4H4O A;  4KO0 A;  3PX4 A;  4CIF A;  1ASV A;  1JLG A;  2OA8 A;  4DTR A;  3DM2 A;  4OJR A;  1VSM A;  1C1B A;  1B9D A;  2OPS A;  4CFD A;  3PV8 A;  4M3Z A;  3AO5 A;  4CGF A;  4FVM A;  3B6P A;  1K6Y A;  3VQP A;  3RMD A;  4FJ7 A;  4W5T A;  4Z4I A; 
#chains in the Genus database with same CATH topology
 1RDD A;  4PY5 A;  3SQ4 A;  5EVZ A;  3P5J A;  4WQ4 C;  2QA4 N;  3QEW A;  1EXQ A;  2F9W A;  5CYM A;  3CQ8 A;  3JSM A;  3CJA A;  1HKC A;  4FOE A;  3CMA N;  3K5N A;  1BDG A;  2A1S A;  3A0I X;  4WQ5 C;  1OKJ A;  4FM1 A;  3TU5 A;  4NCG A;  3PLA A;  1QTM A;  3DLR A;  1BCO A;  3QIN A;  2FXU A;  4L3Q A;  2WUS A;  3VEX A;  3ZT1 A;  1LAW A;  3F5T A;  3KWG A;  3S41 A;  3D2F B;  4LD0 A;  4OO1 J;  1JLA A;  1LOT B;  4PKH A;  1L3T A;  4FWM A;  4B3R K;  1YJ9 N;  3JYT A;  3CJ1 A;  5C12 A;  4Z4H A;  1W97 L;  4PKI A;  4WF9 L;  3K0S A;  1IH7 A;  5C42 A;  4CBU A;  2Y1J A;  4FW2 A;  2FBX A;  1EWR A;  3A2F A;  4DLG A;  3QEI A;  1WSF A;  3OYM A;  3NFA A;  3NF8 A;  3HK2 A;  4PWD A;  4CGD A;  4Z4C A;  4BC3 A;  1X9M A;  1I39 A;  3ULE A;  2RF2 A;  4Z4G A;  5F2R A;  2W42 A;  2D0P A;  1RT5 A;  4YFU A;  4LF4 K;  3ULD A;  1S6Q A;  3O1B A;  3ZX0 A;  5BRE A;  3S3O A;  4HUG A;  2NRR A;  3A8Y A;  1V4S A;  2YNH A;  2QK9 A;  2DFH A;  1DGK N;  4GVE A;  3F9K A;  4BDZ A;  1U6Z A;  4OLA A;  1JCG A;  4B1V A;  4GV9 A;  3V1O A;  2XY7 A;  3EE9 A;  3OS0 A;  1NJX A;  1IJJ A;  2D5R A;  4K41 A;  3MED A;  4JK9 A;  5FPD A;  3EY1 A;  2IVP A;  4BQL A;  5K14 A;  1BUP A;  2GV9 A;  1ZBI A;  3VES A;  4KHS A;  4CJ4 A;  4M7X A;  1L3U A;  3OJU A;  5HBM A;  2Z1J A;  1NK7 A;  3AO1 A;  2VYP A;  5AZJ B;  3VQB A;  5M1O A;  3KLH A;  3CCE N;  1RBU A;  3VQ5 A;  5DMR A;  4UQG A;  1FK9 A;  1O13 A;  4YY3 K;  3BZC A;  2AP1 A;  4BE1 A;  2GTD A;  3LDS A;  1VQ7 N;  1RT6 A;  3CC7 N;  2HHU A;  1GLD G;  4NO7 A;  4X65 K;  4BWJ A;  3BY5 A;  3TTD A;  1SS6 A;  3KLG A;  1B92 A;  4JKG A;  3K5O A;  4RTF D;  5C15 A;  1TKZ A;  3AVL A;  3BGR A;  4CZJ A;  2HHS A;  2A41 A;  4CZF A;  4PA1 A;  3CYM A;  1LWE A;  3SPY A;  4GNI A;  2QTD A;  2D4W A;  4DR7 K;  4BRI A;  2VGM A;  3TAN A;  4CGI A;  4U67 L;  1SZ2 A;  4CES A;  2EWS A;  5KRT A;  2Q1N A;  2JGU A;  4YHH K;  3P31 A;  4OKE A;  1SKW A;  5HL7 L;  1DTQ A;  1ASW A;  4ICL A;  4MDA A;  3QEX A;  3R6M A;  4I2P A;  1S22 A;  3VN5 A;  4CJV A;  4EHU A;  1NGG A;  4DF8 A;  1CXQ A;  1WN7 A;  4JAX A;  5AJ3 K;  4J2A A;  1RTJ A;  5KTQ A;  2V52 B;  4CK3 A;  4GV6 A;  4CED A;  4KB0 A;  1MDU B;  1D9D A;  4BRC A;  4M45 A;  1BI4 A;  2P9I A;  3HL8 A;  4BC2 A;  3OBY A;  2P9S B;  5FPE A;  5JS1 A;  3FFK B;  4J2D A;  3H08 A;  1H1V A;  4MO4 A;  3VQD A;  1DT9 A;  4CHP A;  5I9E B;  3DRS A;  5KGX A;  3ZX3 A;  4B3T K;  3SCX A;  4JI2 K;  1RT1 A;  4DTJ A;  3LDO A;  2P9K B;  1S9E A;  3CQY A;  3CM5 A;  4I9L A;  4KKO A;  3O3H A;  4DTU A;  2B5J A;  3EYZ A;  4ZTF A;  3LDL A;  3TPQ A;  4DLE A;  4PQU A;  4KV8 A;  1HYZ A;  4OKK A;  3KK1 A;  3CFR A;  5CY4 A;  1XWL A;  3L8B A;  5FDL A;  1X1P A;  4E1N A;  4B1U B;  4BE2 A;  3PIP L;  5AZI B;  1KAY A;  3LZI A;  4I6M A;  3NVK A;  3AVN A;  1IO2 A;  4ILG B;  4KHW A;  1BIU A;  3NMU A;  3HO1 A;  3O4N A;  5KQD A;  3PX6 A;  1X9S A;  2BDP A;  2HST A;  4CBW A;  3CF5 L;  4B3S K;  1E3M A;  1A5X A;  3V1R A;  3HOS A;  4FWK A;  4DQI A;  1YHQ N;  4E19 A;  3OYN A;  1WBB A;  4FWR A;  2HVI A;  2WON A;  1D8Y A;  4FLW A;  2FSK A;  2O8E B;  5GIN A;  1BOT O;  2QXF A;  2Q2R A;  4BR5 A;  1J9A A;  3QER A;  4AQY K;  3FZF A;  2D0B A;  3OYH A;  3PX0 A;  3EZW A;  3QFP A;  4O44 A;  3DLL L;  4FK0 A;  3OYE A;  4O5F A;  3LWM A;  1KD1 O;  1KLM A;  2XRI A;  5HRR A;  1A5V A;  4BRM A;  2X78 A;  3LZJ A;  1EX4 A;  2NLX A;  3THV A;  2FF6 A;  3P83 D;  4IG3 A;  1WAJ A;  4HTU A;  2HHV A;  1VQK N;  1NOZ A;  1CZB A;  2ETJ A;  1U47 A;  4MO5 A;  4E7H A;  3M8R A;  4GV3 A;  1XI1 A;  3I8B A;  3OA9 A;  4B9U A;  2V7Z A;  4I7F A;  3H1Q A;  3L2Q A;  1QQM A;  4JHD A;  3THY B;  4OKJ A;  3SI6 A;  3TTC A;  2XY6 A;  3DLG A;  1QSL A;  1XHZ A;  2UUA K;  1JCE A;  5AQM A;  5BN9 A;  2D1K A;  1HLU A;  4DR2 K;  1EQY A;  1KVB A;  3TTF A;  1C0F A;  4ELV A;  3B8A X;  2WBN A;  3QLH A;  4IEE A;  3A5L C;  2BGG A;  4HHT A;  2NNW A;  2VWB A;  3TAE A;  2QKK A;  4M3Y A;  3SK3 A;  5T7B A;  5GAD P;  4Y1D A;  4E89 A;  4BR7 A;  2NUB A;  3DXK A;  3CPE A;  4BWM A;  3V9U A;  4JKE A;  1QHT A;  3T3F A;  2UXD K;  3SUP A;  3N4Q A;  1LWC A;  1GLB G;  5GAG P;  4HVJ A;  4YNQ A;  4DFM A;  3CD6 N;  2GWK A;  1NK4 A;  1L3S A;  4Q0B A;  3FGU A;  3J80 O;  4FOI A;  1NGJ A;  3HI0 A;  2BUP A;  3EEQ A;  5BPL A;  3AA5 X;  1IKY A;  2UXB K;  1BGX T;  3FE1 A;  3E9L A;  1JLQ A;  4NXN K;  1I3A A;  3EKS A;  1VSK A;  2GEM A;  1HQU A;  3VEW A;  1NKB A;  1NWK A;  1RDC A;  1LW2 A;  1VSH A;  3V81 A;  3LDP A;  1Z6R A;  2E1Y A;  3OYC A;  4DQQ A;  4B9M A;  3D2E B;  4JKH A;  1IKV A;  3I33 A;  1BL3 A;  1QZ5 A;  2VG6 A;  4XH5 A;  3M6G A;  5AR0 A;  5FRN A;  1NK8 A;  1KAX A;  2NRZ A;  5B8H A;  2F7T A;  4NYN A;  2RN2 A;  4DG1 A;  4F8R A;  1ATR A;  3SQ2 A;  2P9U A;  4E1J A;  3RVC A;  1B9D A;  4C1N I;  4JV5 K;  3B6P A;  1K6Y A;  3VQP A;  3CJB A;  4W5T A;  4K25 A;  5E26 A;  2HB5 A;  4H0T B;  4QS7 A;  3WEE B;  4K8Z A;  3DRR A;  2G8F A;  2W6L A;  3VTH A;  1VQN N;  3FZK A;  4BR9 A;  5FPN A;  4BRQ A;  1J5E K;  4KHP K;  3WXI A;  1FKP A;  2NRX A;  5FRO A;  3VMF B;  3BZK A;  3DOL A;  3LAK A;  1HR0 K;  4BRD A;  5LMN K;  4WYB A;  2P9P B;  4IJA A;  3O80 A;  3WT0 A;  3SAG A;  2O8F B;  3ZYY X;  4CK2 A;  5LJW A;  4CHY A;  3BEX A;  2EHG A;  3C7N B;  4B9N A;  1JLC A;  2W40 A;  3ID6 A;  1SV5 A;  3KIO A;  3ZEU B;  5A2Q O;  4CFA A;  3C95 A;  1REV A;  2ZE2 A;  4W5N A;  3CCJ N;  3VF6 A;  4LH4 A;  4F3T A;  1WNS A;  4O8K A;  1NK0 A;  2HHW A;  3O4Q A;  4GW6 A;  2YNI A;  3V6D A;  3VEY A;  4FM0 A;  2O4G A;  1S3X A;  5LMU K;  4JKC A;  2IVN A;  3Q7C A;  4DQS A;  3G25 A;  1NK6 A;  1IBK K;  5JS2 A;  1X3N A;  4KHU A;  3AVJ A;  1VQL N;  4BG8 A;  4CEA A;  3RR8 A;  4KFB A;  5J1E A;  4CJQ A;  3VER A;  4BRG A;  1OH5 A;  3ATU A;  3DXM B;  4CFB A;  4CEC A;  4B1Y B;  3MMV A;  4DQ8 A;  3UKR B;  2FBY A;  4WCE L;  3THX B;  5DK5 A;  2H3G X;  3NHG A;  4B9T A;  2VCP A;  1WBD A;  4GKK K;  1GLJ O;  1S1T A;  3D0P A;  3H1V X;  1I94 K;  3WNF A;  4BR2 A;  3C6A A;  2QWN A;  2QKB A;  3E01 A;  3MX5 A;  2QWR A;  3O5B A;  3CET A;  4FJJ A;  1VAZ A;  3ENO A;  5E84 A;  3RMB A;  3NCI A;  3LAN A;  4CF2 A;  1Q81 O;  4FJX A;  2OPQ A;  4OGE A;  5JLF A;  3U8X A;  2GX9 A;  1DTT A;  1W0H A;  1KFD A;  3AGK A;  3L3V A;  3MN9 A;  3M8S A;  1LW0 A;  1ATN A;  3S3M A;  1WSI A;  3VGM A;  5ADX A;  3L2W A;  1YJW N;  2DY4 A;  1RT2 A;  2ZWH A;  3JAM O;  4H5R A;  3CCU N;  3H6E A;  4EAH D;  4YDU A;  3HBT A;  5I42 A;  4M3T A;  3CM6 A;  1HPM A;  2E2N A;  3CER A;  3RMC A;  3ZT0 A;  3CG7 A;  3TR8 A;  1Y97 A;  3D6R A;  4RW4 A;  2NZT A;  4LY7 A;  3NGY A;  3ENB A;  1L3V A;  2G8K A;  3M1F A;  3MXM A;  1UA0 A;  3EN9 A;  3MEE A;  4DSL A;  4FPB A;  4DSE A;  1WLJ A;  2JLE A;  4CIE A;  3LL3 A;  5AQN A;  4CF9 A;  3DRP A;  5AQI A;  3TAR A;  5BPN A;  1VQ8 N;  5KQ8 A;  2EX3 A;  1LV5 A;  1BCM A;  1XHX A;  3FZM A;  3L4Q A;  4LF6 K;  1E4G T;  4EP5 A;  4CD1 A;  2E6L A;  2E5L K;  4B1X B;  3BF3 A;  5DM6 L;  4C8L A;  4CZL A;  1RBV A;  4CJ3 A;  4J2E A;  2DTU A;  4FCY A;  2O8C A;  2OPR A;  3R3L A;  4UY8 O;  4FJL A;  3QIO A;  3VQE A;  3RSE B;  4A5B A;  3P1G A;  4H0X B;  5JVH L;  4A59 A;  3LAL A;  4JI3 K;  4FJN A;  3TAG A;  2IDO A;  1K8A O;  2P9N A;  1VK0 A;  5HRS A;  4IEI A;  1J53 A;  3FR0 A;  4YOV A;  4OPK A;  1NLV A;  3IMX A;  3LWL A;  5AQH A;  4FXD A;  4OPJ A;  4KAZ A;  5SWM A;  3UKU A;  5HRP A;  1KQS M;  2G8U A;  3O1W A;  5AQX A;  2OYQ A;  1XUP O;  3QES A;  2KLA A;  3SPZ A;  4IFV A;  4KHY A;  1XMO K;  2P9L A;  5J2Q A;  1VSI A;  4CGG A;  3O8M A;  2ZM6 K;  2P1J A;  4C8N A;  3AA4 A;  3R1X A;  1ITG A;  2RPI A;  3HT3 A;  4DKW A;  4E7J A;  4HTL A;  1WSH A;  2PYL A;  4GVM A;  4O5B A;  2ATQ A;  3IKM A;  4O8U A;  3NH1 A;  4R79 A;  4M3W A;  4ELT A;  4WFA L;  4B9L A;  4DFJ A;  3RWU A;  1Y64 A;  4A5A A;  5CE3 A;  2ZD1 A;  2E2O A;  4LFA K;  3VTI A;  4DSI A;  2P9K A;  4AHT A;  2QWO A;  1HKB A;  1JL2 A;  3UE5 A;  4V19 S;  1IV0 A;  4K42 A;  3LP3 A;  2HW3 A;  2GEL A;  3K57 A;  5C2D A;  3V9W A;  4DTS A;  1CZ9 A;  2J4R A;  4L8R B;  1ZBH A;  3HP6 A;  4QS8 A;  4W5R A;  4AHR A;  3O9R A;  1GOC A;  4EHT A;  4A62 A;  1Q82 O;  4BRH A;  3NGI A;  1YTU A;  4LSN A;  4DR3 K;  1NK5 A;  5AZI A;  1BQN A;  3K9K A;  3NE6 A;  4KTW A;  5AQJ A;  1TKX A;  4YOX A;  2Z1H A;  2BH1 A;  4MQ3 A;  1MWM A;  3C6H A;  1HUX A;  4B1Z A;  5MLC Q;  4TSX A;  5D3G A;  3ZSR A;  4H0O A;  2B4J A;  1XMQ K;  2CGJ A;  3DLB A;  3SV3 A;  4RWT A;  3J7Z O;  4B1W B;  1GLF O;  3ZET A;  1QVF M;  4CER A;  1SL0 A;  5CHI A;  1T6C A;  2CH5 A;  4DU4 A;  2PYJ A;  1HYS A;  1YF5 L;  4IOX A;  4JD2 A;  4GMJ B;  5JIC A;  1UAX A;  4DSF A;  2HOE A;  3OYD A;  5CR4 A;  4FLU A;  3AVB A;  4LH5 A;  4CE9 A;  4B3M K;  4FVU A;  3WQT A;  1S1U A;  2G8I A;  4PL7 A;  4IZ9 A;  4J2B A;  3O3F A;  3OYL A;  2W41 A;  4DV3 K;  4H4M A;  1VQ9 N;  3VGK A;  1C0G A;  1YAG A;  2ASO A;  1HNI A;  3VQ9 A;  4AH9 A;  3KKS A;  1HQE A;  4H5W A;  4DR1 K;  4FJ8 A;  1GOA A;  3WQU A;  2VG5 A;  2IGI A;  4CZH A;  2DPN A;  4HCC A;  1UWB A;  3W0L A;  4IKF A;  3RMA A;  4JS4 A;  1K73 O;  1NJZ A;  3ZSX A;  1KAZ A;  1WSJ A;  3OS1 A;  4KH5 A;  1OVQ A;  3U9Z A;  5EXW A;  3HPO A;  2A1R A;  4MLE A;  4E7K A;  4CF8 A;  5KGW A;  4DF4 A;  5E41 A;  1ESV A;  3AVK A;  1JL1 A;  3L0Q A;  4M7Y A;  1HJR A;  3P4I A;  2NRH A;  4CJK A;  4NCA A;  4DTM A;  5BRH A;  5AQO A;  2PAV A;  4O55 A;  3ZX2 A;  2QXL A;  3ULE B;  3G10 A;  3HM8 A;  5HP1 A;  2GUI A;  1JXB A;  1N8R O;  4HCB A;  1RT7 A;  3AVH A;  4CJP A;  4ISF A;  4EZ6 A;  3OYF A;  1TYQ A;  4BE0 A;  4NXM K;  1RBS A;  1JKH A;  4KH4 A;  3U9D A;  1B9F A;  4DV5 K;  4DHY A;  4OGC A;  4O0I A;  2QWM A;  3D7E O;  3QB0 A;  4H5N A;  3K5L A;  2X6N A;  3EZ5 A;  4EZ9 A;  4NLC A;  1U2V B;  3HRG A;  3I55 N;  3F73 A;  2KQ2 A;  4DV1 K;  1TGO A;  1S1V A;  4WFB L;  4CEQ A;  5AFU H;  1KVA A;  3AVC A;  3LM9 A;  4CBX A;  3VQ8 A;  2VWK A;  5IT9 O;  2YNG A;  3AO4 A;  3MDQ A;  3H46 O;  3EE8 A;  3HJF A;  1C0M A;  2I7P A;  4XH4 A;  5BRD A;  3CCR N;  1D4X A;  4KRF A;  4CEE A;  1T44 A;  4KHQ A;  2OZM A;  3KLF A;  1UOC A;  1X3M A;  3AAP A;  4CFC A;  2FSN A;  3MWT A;  4CK1 A;  3VEV A;  4CJE A;  4BRP A;  3RRG A;  3AY9 A;  1NGH A;  3SLC A;  4C8O A;  5LL6 Z;  4CJ5 A;  1GLA G;  3R9P A;  4NCB A;  5FLX O;  1P8Z A;  1TL3 A;  3CCV N;  3CIP A;  3QO9 A;  3THW B;  1HJO A;  4JKG B;  4DU1 A;  5KPZ A;  3QBX A;  1Z26 A;  3UB5 A;  4OX9 K;  5J2M A;  5KPR A;  4ILH A;  1T03 A;  1HX1 A;  2V51 B;  4QAG A;  3TSU A;  1VSJ A;  4KO0 A;  2VQF K;  1ASV A;  3DM2 A;  2A6A A;  1MA9 B;  2OPS A;  4CFD A;  3PV8 A;  1VQP N;  4X62 K;  4ISG A;  4FVM A;  2WC9 A;  3RMD A;  4FJ7 A;  1GLE G;  3VF2 A;  3ZT3 A;  3ZT2 A;  1UA1 A;  4JK8 A;  4LF8 K;  3A5O C;  1HKG A;  2QEX N;  5FRM A;  2O8B A;  2GUP A;  1NMD A;  2I7N A;  1BG3 A;  1OH6 A;  1VRT A;  2FSJ A;  3CC2 N;  2ZGZ A;  2WFB A;  1ZC6 A;  3T69 A;  1RDU A;  3HSC A;  3TWH A;  2UYT A;  2D0A A;  1TK5 A;  1NOY A;  3K59 A;  2Q31 A;  5AQU A;  2O8D A;  3QIP A;  4FLY A;  3HP9 A;  4FJ9 A;  1BI4 B;  3CCQ N;  2P9I B;  3I8D A;  3KD5 E;  2GBZ A;  4C8K A;  3DAW A;  5EY4 A;  1OH8 A;  4C8M A;  3SUO A;  4A2B A;  5KI6 A;  1N5Y A;  3TSP A;  3QDK A;  4Z4E A;  2FF3 B;  5AQP A;  4JRQ A;  1QQN A;  5CZ1 A;  4FZZ A;  2E6M A;  5SZT A;  4JS5 A;  3IS9 A;  3VEN A;  5J2P A;  4PUO A;  2VWJ A;  4FWQ A;  1Q86 O;  1A5W A;  4FK4 A;  2IS3 A;  2ITM A;  1QSY A;  4B3O A;  3L2U A;  1MU2 A;  3L3U A;  4H5V A;  4DQR A;  5C24 A;  2YNF A;  3R8E A;  4DCH A;  5AQW A;  4Z0U A;  2E2Q A;  3G0Z A;  3HZ6 A;  3TSQ A;  1VQ4 N;  2HHX A;  3FFI A;  4JKD A;  3MAQ A;  1SL2 A;  1N33 K;  2HHT A;  4I6M B;  3OYJ A;  1SQK A;  4DV0 K;  3C6T A;  2OCE A;  3T1A A;  4BRO A;  3ID8 A;  3SMS A;  4F9O A;  3CFP A;  1TAU A;  1NG9 A;  3DOK A;  1NGE A;  4YOT A;  1J54 A;  1YI2 N;  1YIJ N;  4IDK A;  2KW4 A;  1HNZ K;  3U6F A;  3SQ1 A;  2YHW A;  3PO5 A;  4DR4 K;  4FJH A;  4DB3 A;  4CZM A;  1DEJ A;  4BGB A;  4CF1 A;  3J7Y P;  3MXI A;  2UUB K;  4FYD A;  5C2F A;  1VRU A;  3ENH A;  1NM1 A;  3NBP A;  2UU9 K;  4M3U A;  3J7A P;  3QML A;  4EP4 A;  1DKG D;  2YCH A;  4RW9 A;  4JI4 K;  1S9G A;  2JWK A;  1NJW A;  4CW7 B;  1X9J A;  4LFC K;  3V4I A;  4DWI A;  1NGC A;  5AQK A;  5M1N A;  4CZK A;  1TUY A;  4LF7 K;  2LSN A;  1HRH A;  3ATV A;  1GLC G;  3MX2 A;  1VSE A;  4DV6 K;  3KK7 A;  3NDK A;  3LP2 A;  4CZE A;  1YVN A;  4IDH A;  2I5J A;  5AFU A;  3VQQ A;  4NLB A;  2G8V A;  2UXC K;  1NGA A;  4HUE A;  2ZF5 O;  4KH6 A;  3HOT A;  1K8K A;  1U45 A;  4HUF A;  1XQS C;  4JHD B;  4E1M A;  3M5R A;  3VOV A;  5BPM A;  3J81 O;  2D0O A;  1NK9 A;  2YHA A;  3KHY A;  4CI6 A;  1IG9 A;  4BRE A;  2YHB A;  3PUF A;  3CJ9 A;  4ZTJ A;  1NJY A;  2NRV A;  3K9J A;  1F21 A;  2YHX A;  2HND A;  1XNR K;  1RT3 A;  3E1Y A;  4H03 B;  3AVI A;  4K8X A;  2Q3S A;  3MK6 A;  1BA0 A;  1CZA N;  1W7A A;  4WQ4 A;  1RTI A;  4BY9 C;  5C10 A;  4ILJ A;  1U48 A;  3OW2 M;  4B08 A;  2HNZ A;  3D2F A;  5GAE P;  4CHO A;  3DXK B;  4ISE A;  5HLF A;  4BRN A;  3IRX A;  1NGI A;  4WQ5 A;  4FWO A;  3VQ4 A;  1TKD A;  3WNE A;  5JMV A;  4X64 K;  1XC3 A;  5LJV A;  2YKM A;  4N56 A;  2IC3 A;  5BRF A;  4B9Q A;  4M41 A;  4AHU A;  3WXK A;  4CEO A;  3MCA B;  4JKB A;  4N5S A;  4FM2 A;  4DU3 A;  1S1X A;  4DTX A;  4MDB A;  2PZS A;  2FBT A;  1T8E A;  4CHZ A;  3P39 A;  3D45 A;  3O08 A;  3SJJ A;  2KFN A;  3VQ7 A;  2E88 A;  3AAQ A;  1NBW A;  4HWI A;  1NJI O;  4MFB A;  2HMI A;  5M1F A;  3C94 A;  3NAE A;  2AA4 A;  1BA1 A;  4W5O A;  4DTO A;  4KHN A;  1YTA A;  1JLF A;  3NVM A;  3OVN A;  4LF5 K;  3QEP A;  2W6K A;  1WUA A;  4BVP A;  4CGJ A;  2ZJP L;  3ZSO A;  3RR7 A;  3OTO K;  3C65 A;  1FXX A;  3FLC O;  4IXC A;  2QWP A;  1K9M O;  1VSF A;  4O4G A;  1S6P A;  4OPH A;  4BC5 A;  3SAH A;  5AZJ A;  4K0K K;  2VQE K;  1FW6 A;  1WB9 A;  3AAR A;  4BGA A;  1SKS A;  4CEB A;  4BG9 A;  3GOI A;  5IWA K;  2P9U B;  2E4L A;  2YHY A;  3AV9 A;  1XNQ K;  4F3O A;  4XEI A;  3MWP A;  2YKN A;  3MEG A;  5AQV A;  3O3G A;  2F4V K;  3GG4 A;  2FBV A;  3LP0 A;  2XO7 A;  2OTJ N;  4Q5V A;  4A57 A;  1KRP A;  1C0U A;  1BU6 O;  1X9W A;  1JJ2 M;  1RIL A;  4CHN A;  2CGL A;  2GWJ A;  4BRK A;  2B6A A;  3TAM A;  1NU0 A;  3HTV A;  3LDQ A;  3WNG A;  1OH7 A;  1Q8I A;  3EO3 A;  4X66 K;  1C0T A;  4BRA A;  2A3Z A;  2F96 A;  3DLK A;  1EET A;  4F2S A;  3HVR A;  1S5J A;  2V7Y A;  3KTQ A;  1M90 O;  4QCL A;  2ZJQ L;  3KK3 A;  3K58 A;  1L5U A;  1N34 K;  3WXL A;  4NYF A;  1RBT A;  3LPT A;  3TAF A;  4Y1C A;  2OTL N;  3MXJ A;  3PO4 A;  1QSS A;  2P51 A;  5GIP A;  3NF6 A;  3LAM A;  4E0D A;  4FLX A;  5DM7 L;  1SKR A;  3CC4 N;  5GAH P;  4IBN A;  3WXM B;  4KB1 A;  1KSP A;  4BRL A;  3UIQ A;  3BP8 A;  4RW8 A;  3E9O A;  1EKE A;  4BC4 A;  1MWK A;  1RTD A;  2KKZ A;  3KK2 A;  1KTQ A;  3T1Y K;  4A2A A;  1G15 A;  3JS6 A;  4EIA A;  1JLE A;  2XY5 A;  2P9S A;  3S9H A;  1WSG A;  4H0Y B;  4JI1 K;  3CFO A;  3TAQ A;  4FJG A;  1CLQ A;  1RTH A;  1ILY A;  4K43 A;  3SBT A;  4N41 A;  2QWQ A;  1GOB A;  3IDH A;  2G8W A;  4FWL A;  1LWF A;  4KBO A;  2Q0R A;  1XC9 A;  4F4K A;  3VEZ A;  3RTV A;  4FW1 A;  1VQ6 N;  2HBL A;  4YOR A;  4BRF A;  4IO9 L;  3U3G A;  2WOM A;  4KI4 A;  4IFY A;  1WOQ A;  3CJC A;  1ZBS A;  1NNE A;  3JXU A;  3LPU A;  4AM6 A;  3TI0 A;  4H8K A;  1KCF A;  1U2V A;  3F9M A;  4JEP A;  4YDU C;  2ZGY A;  5TKY A;  3L2R A;  3HVT A;  5KRS A;  3SQ0 A;  3T1H K;  1QS4 A;  1QQC A;  4AM7 A;  4NB4 A;  3AO3 A;  2DFF A;  4PL8 A;  4JKA A;  4CJF A;  4DUY K;  5EU7 A;  4FWN A;  3NH2 A;  2R7Y A;  4XH1 A;  1NKC A;  1C1A A;  2AJQ A;  1IG8 A;  1SAZ A;  3PY8 A;  1M1K O;  4RW6 A;  4OPA A;  5H1S Q;  3H3O B;  3VQC A;  4IO8 A;  3EKU A;  3E9P A;  5JLH A;  4R5P A;  5I3U A;  3M8P A;  5CZ2 A;  5HRO A;  3S3N A;  1BWF O;  5M1Q A;  2O8E A;  4CIF A;  1C1B A;  3THW A;  3KZB A;  4U7B A;  4M3Z A;  3AO5 A;  4GY2 B;  3O9U A;  3DJC A;  3G6E N;  2YX6 A;  4M63 C;  3L6Q A;  1NMN A;  1T6D A;  4ELU A;  5EX5 A;  5CYQ A;  3AA3 A;  1ATS A;  1HNW K;  2YJE A;  1KFS A;  1D5A A;  2F8S A;  4WFN L;  3CCM N;  3SYZ A;  2OAN A;  2O8C B;  1P90 A;  3QEV A;  3H45 C;  4FO0 A;  4WE1 A;  3W3D A;  3E66 A;  3ZSW A;  4CZG A;  5EOY A;  4F2R A;  2BAN A;  3CJ7 A;  2FC0 A;  4DQP A;  1NKE A;  5AQG A;  4JI0 K;  3OYI A;  2P9N B;  3AVG A;  1WAF A;  4FZX C;  4B9S A;  4KI6 A;  2OPP A;  3T19 A;  3NF7 A;  5BR9 A;  3L2V A;  1S1W A;  3A5M C;  5AQR A;  3ZSZ A;  4IOA L;  1R59 O;  4KTZ A;  1YT3 A;  2KFZ A;  4QS9 A;  3THY A;  4LFB K;  5AQT A;  4N47 A;  3UKU B;  4DS5 A;  2E1Z A;  2YJF A;  3CCL N;  3O4W A;  4H0P A;  2P9L B;  5AQZ A;  2HHH K;  1IBM K;  3U4L A;  2P5O A;  3VA0 A;  1NGD A;  3NH0 A;  1FJG K;  1RGI A;  1RNH A;  2KZM A;  3ZSY A;  3CI5 A;  1HPZ A;  3C0B A;  3P38 A;  2PFU A;  3O9S A;  1OVY A;  3U3Y A;  2DFE A;  1QVG M;  4FPA A;  4O0J A;  3SMP A;  2KZZ A;  4CVN E;  1E4F T;  3ISN C;  1RBR A;  1WSE A;  3LM2 A;  3ZLJ A;  4BQZ A;  3K2P A;  3OYA A;  2HBK A;  1ZBF A;  4AHC A;  3O9T A;  3OHR A;  3QIC A;  5JVG L;  5GIO A;  1GLL O;  4BDY A;  4OLB A;  5LY3 A;  1S72 N;  2JWL A;  4A61 A;  3TAB A;  1VQM N;  3DMJ A;  1LAV A;  2HNY A;  2IVO A;  2O4I A;  4AF1 A;  3SZ2 A;  4GKJ K;  4JKF A;  2HMP A;  3AA2 A;  3L4I A;  2Z1I A;  4I9Q A;  1G99 A;  3AVA A;  3ZCM A;  3IAY A;  4CEZ A;  1Q18 A;  2HHQ A;  4CGH A;  4JLH A;  3ITH A;  1EO1 A;  2NRW A;  1BHL A;  3DYA A;  1DLO A;  1TAQ A;  3Q7B A;  2Q97 A;  5FPM A;  3ZET B;  4RCH A;  4BVO A;  3D2E A;  1Q9Y A;  3A5N C;  2XHB A;  2QI2 A;  3QFU A;  4FWS A;  2Z1G A;  4JD2 B;  4IG0 A;  3C6U A;  3ZT4 A;  1RCH A;  2BE2 A;  3GL1 A;  5BN8 A;  3MN6 A;  1BO5 O;  3VQ6 A;  1QQO A;  4YOW A;  4IWV A;  1BIS A;  4CJR A;  1SL1 A;  1VQO N;  3G71 N;  4MLH A;  4DUZ K;  4G1Q A;  3WUH A;  2X6S A;  4CZI A;  3KVG A;  1U49 A;  1D9F A;  3QNO A;  3KWI A;  1BQM A;  1T7P A;  5KPT A;  4CJU A;  5HOO A;  2RE2 A;  1JLB A;  4CEF A;  3ZSV A;  4FK2 A;  1KLN A;  3I0S A;  4FJI A;  2QWL A;  1Z05 A;  3WEE A;  3ZSQ A;  4ZHR A;  4CHQ A;  3QNN A;  1IBL K;  3MEC A;  4JN4 A;  4JI5 K;  1O1W A;  3ALY A;  2E2P A;  4E3S A;  1YJN N;  1TK0 A;  1RDA A;  1N6Q A;  1JXE A;  1ZXO A;  1C6V A;  1FKO A;  3OY9 A;  2P9P A;  3KLE A;  2XY8 A;  1HMV A;  1JCF A;  2O8F A;  4DS4 A;  3FZL A;  4IOC L;  4DR5 K;  4RG8 A;  1EP4 A;  2F9T A;  3V9Z A;  4E7I A;  1VQ5 N;  2VG7 A;  3C7N A;  1HYV A;  4DSK A;  3J8A A;  4M42 A;  3ZEU A;  5AQQ A;  3SNN A;  1HNV A;  1YUW A;  1VSL A;  4E7L A;  1TYQ B;  4PHT X;  5TKW A;  1CXU A;  1Z25 A;  5AQF A;  4FLZ A;  3LP1 A;  2F8T A;  4AHS A;  5C0Y A;  3BDP A;  4FLV A;  2IAJ A;  4C1N K;  4CIG A;  1IKW A;  4M3X A;  4JI7 K;  2KTQ A;  3QET A;  1TKT A;  3M8Q A;  5ADX H;  4CD3 A;  1LCU A;  3SV4 A;  3O9Q A;  4CJT A;  4B8C A;  3N4P A;  4ID1 A;  4KPY A;  4EFH A;  3IG1 A;  3DXM A;  1C1C A;  3OYG A;  3CME N;  1IKX A;  5AQL A;  4H5T A;  3BUZ B;  3TAP A;  3VET A;  3KD1 E;  2ASM A;  1ZYQ A;  4PKG A;  3UKR A;  3THX A;  1QE1 A;  3F2K A;  1V4T A;  4YOY A;  3G4S N;  1YIT N;  3ASM A;  3WXJ A;  3SJH A;  4W5Q A;  3CXC M;  1RT4 A;  1U4B A;  3VQA A;  4YOU A;  1T3V A;  2A40 A;  4DV4 K;  4CJW A;  2BTF A;  4QOZ B;  3CQX A;  3GBT A;  1T05 A;  4FSV A;  4DSJ A;  3O6W A;  3NGZ A;  1Q7Y O;  4Z94 A;  4Y0W A;  3SUQ A;  1ZBL A;  3PSF A;  4DR6 K;  4G9Z A;  2ASP A;  4DV7 K;  2ITG A;  2FLO A;  3VF4 A;  4CJ7 A;  4FJM A;  2Q0U A;  3DI6 A;  1HNX K;  3KKR A;  3GE1 A;  2RKI A;  4H0V B;  3SAF A;  1NGB A;  4KRE A;  1RDW X;  3PSI A;  4DFP A;  1BIZ A;  1ASU A;  4DMN A;  1KXP A;  4JRP A;  3MCP A;  5C25 A;  4FWP A;  4N76 A;  4CCH A;  1RFQ A;  3MN7 A;  3HYF A;  3V9X A;  2HF3 A;  3V1Q A;  2O8B B;  5ELZ A;  3OYB A;  3EL2 A;  5AQY A;  3WNH A;  3KLI A;  3M3Z A;  2Y1I A;  1KC8 O;  4JI8 K;  2PBD A;  4Z4F A;  2E8A A;  4J8F A;  2OZS A;  4CF0 A;  1J5O A;  4KTQ A;  2PY5 A;  1TVR A;  3IUC A;  2A42 A;  1RDB A;  3AVF A;  3VEO A;  4XIU A;  1TV6 A;  5BR8 K;  4ID5 A;  4BR4 A;  4DV2 K;  1EWQ A;  1TL1 A;  1W2B M;  5F1X A;  3AO2 A;  2O8D B;  1W9H A;  1ZBU A;  2UUC K;  1YVU A;  3CPW M;  2NRT A;  2X74 A;  1VHX A;  2D0C A;  2HVH A;  4JNE A;  2YI1 A;  2IIR A;  4LF9 K;  3RSE A;  4IJN A;  3VPZ A;  2RHK A;  2QM1 A;  4FL9 A;  3I56 N;  1R0A A;  1Q9X A;  3PIO L;  3SUN A;  4AIL C;  4FJK A;  3FZH A;  3AGR A;  5AQS A;  5F0X A;  3DLE A;  3LDN A;  3OS2 A;  2P5G A;  2ZJR L;  3SBG A;  3I0R A;  2YV0 X;  4CJS A;  4JK7 A;  3HPH A;  2CGK A;  4M3R A;  4FJ5 A;  2A5X A;  4CJL A;  3H3N O;  1VSD A;  3B6O A;  1KVC A;  3HPG A;  4JYA K;  5M1K A;  3DLH A;  3RRH A;  2KHO A;  3OYK A;  3MN5 A;  3IFR A;  3NF9 A;  3OJS A;  2QW9 A;  4BAC A;  4C23 A;  1YXQ A;  2WTU A;  5M1P A;  3CHW A;  2E20 A;  2HF4 A;  5J2N A;  3V9S A;  2G8H A;  4B8A B;  4DTP A;  5HRN A;  3CCS N;  3HM9 A;  4FZY A;  4BDP A;  1N36 K;  2VGN A;  3KJV A;  4RW7 A;  3BF1 A;  4BR0 A;  1N32 K;  2HBM A;  2ZQB A;  4B9V A;  4I2Q A;  4DFK A;  1SUQ A;  3VGL A;  3VA3 A;  2IOC A;  3GDQ A;  4FLT A;  1TUU A;  1TK8 A;  3DWL A;  2Q36 A;  4LC9 B;  3AVM A;  1J6Z A;  4OVL A;  2HBJ A;  3K5M A;  4DTN A;  3QBW A;  1U04 A;  1QHA A;  4JI6 K;  4LSL A;  3HST B;  2CH6 A;  3HXM A;  4AHV A;  4IFE A;  4H4O A;  3PX4 A;  1JLG A;  2OA8 A;  4DTR A;  4OJR A;  1VSM A;  1K8K B;  3OBW A;  4CGF A;  3T7Z A;  4Z4I A;  1QZ6 A;  1NGF A; 
#chains in the Genus database with same CATH homology
 1RDD A;  4ELU A;  3ZT3 A;  3ZT2 A;  3SQ4 A;  2HB5 A;  3P5J A;  3AA3 A;  5CYQ A;  3QEW A;  1UA1 A;  1EXQ A;  4K8Z A;  3DRR A;  5FRM A;  5CYM A;  2G8F A;  3CQ8 A;  1KFS A;  1D5A A;  3JSM A;  2F8S A;  3SYZ A;  1VRT A;  3K5N A;  2A1S A;  3QEV A;  4FM1 A;  1FKP A;  4WE1 A;  5FRO A;  3ZSW A;  3DOL A;  4NCG A;  3LAK A;  3TWH A;  1QTM A;  4F2R A;  2BAN A;  2D0A A;  2FC0 A;  3DLR A;  1TK5 A;  4DQP A;  1BCO A;  3QIN A;  1NKE A;  1NOY A;  3OYI A;  4FZX C;  3AVG A;  1WAF A;  4KI6 A;  4B9S A;  2OPP A;  3T19 A;  3ZT1 A;  3NF7 A;  3K59 A;  4CK2 A;  1LAW A;  3L2V A;  1S1W A;  4CHY A;  4LD0 A;  3ZSZ A;  2EHG A;  1JLA A;  3QIP A;  4B9N A;  1JLC A;  2HHX A;  1L3T A;  4FLY A;  3HP9 A;  1SV5 A;  4FJ9 A;  1BI4 B;  3KIO A;  4KTZ A;  1YT3 A;  2KFZ A;  4CFA A;  3I8D A;  3KD5 E;  3C95 A;  2GBZ A;  1REV A;  2ZE2 A;  4N47 A;  3JYT A;  4C8K A;  4DS5 A;  4W5N A;  4LH4 A;  4Z4H A;  4C8M A;  3SUO A;  4F3T A;  5KI6 A;  1IH7 A;  1N5Y A;  1WNS A;  2HHW A;  1NK0 A;  5C42 A;  2Y1J A;  3O4Q A;  4GW6 A;  2P5O A;  4Z4E A;  3VA0 A;  2YNI A;  4FW2 A;  3NH0 A;  4JRQ A;  3V6D A;  1RNH A;  5CZ1 A;  2FBX A;  3A2F A;  4FZZ A;  2E6M A;  4FM0 A;  5SZT A;  2KZM A;  2O4G A;  4JS5 A;  4DLG A;  3IS9 A;  1WSF A;  3OYM A;  5J2P A;  3QEI A;  3NFA A;  3NF8 A;  3ZSY A;  4DQS A;  3HK2 A;  4PUO A;  1HPZ A;  1NK6 A;  4PWD A;  5JS2 A;  4CGD A;  4Z4C A;  2VWJ A;  3AVJ A;  4KHU A;  4CEA A;  1X9M A;  1I39 A;  1A5W A;  3RR8 A;  2IS3 A;  4FK4 A;  1QSY A;  4B3O A;  3L2U A;  4KFB A;  2RF2 A;  1MU2 A;  2DFE A;  5J1E A;  3L3U A;  3U3Y A;  4Z4G A;  4DQR A;  4CJQ A;  5C24 A;  4CFB A;  2W42 A;  2YNF A;  4O0J A;  4CEC A;  1RT5 A;  4YFU A;  3ULD A;  1S6Q A;  4Z0U A;  2KZZ A;  3S3O A;  4HUG A;  3G0Z A;  2YNH A;  2QK9 A;  2FBY A;  2DFH A;  3FFI A;  3ISN C;  3MAQ A;  1SL2 A;  1RBR A;  5DK5 A;  1WSE A;  2HHT A;  3F9K A;  3NHG A;  4BDZ A;  3OYJ A;  4B9T A;  4OLA A;  3K2P A;  3V1O A;  2XY7 A;  3OS0 A;  3OYA A;  1NJX A;  2D5R A;  1ZBF A;  3MED A;  4AHC A;  3EY1 A;  3C6T A;  1S1T A;  3D0P A;  3T1A A;  5K14 A;  3WNF A;  4BDY A;  4OLB A;  2GV9 A;  1ZBI A;  2QKB A;  3CFP A;  3E01 A;  1TAU A;  4KHS A;  4CJ4 A;  3DOK A;  3TAB A;  3DMJ A;  1J54 A;  1LAV A;  2HNY A;  3OJU A;  1L3U A;  5HBM A;  2O4I A;  3SZ2 A;  4IDK A;  2KW4 A;  3U6F A;  3SQ1 A;  2Z1J A;  1NK7 A;  4FJJ A;  3AA2 A;  3AO1 A;  3PO5 A;  3RMB A;  2Z1I A;  4FJH A;  4I9Q A;  3AVA A;  3ZCM A;  3VQB A;  4CF1 A;  3IAY A;  4CEZ A;  3KLH A;  3NCI A;  3MXI A;  1RBU A;  3LAN A;  4CF2 A;  4FYD A;  4CGH A;  2HHQ A;  1VRU A;  4JLH A;  3ITH A;  5DMR A;  3NBP A;  3VQ5 A;  4UQG A;  4M3U A;  4FJX A;  1FK9 A;  2OPQ A;  4OGE A;  1BHL A;  1DTT A;  1W0H A;  3DYA A;  1DLO A;  1KFD A;  3L3V A;  4EP4 A;  1TAQ A;  1LW0 A;  3M8S A;  4BE1 A;  3S3M A;  1WSI A;  4RW9 A;  3L2W A;  1S9G A;  3LDS A;  1Q9Y A;  1NJW A;  2DY4 A;  1RT6 A;  2XHB A;  2HHU A;  1RT2 A;  2Z1G A;  3V4I A;  4DWI A;  4BWJ A;  5I42 A;  3KLG A;  4M3T A;  3CM6 A;  4IG0 A;  1B92 A;  3C6U A;  3ZT4 A;  3K5O A;  1RCH A;  2BE2 A;  3RMC A;  2HHS A;  1TKZ A;  1HRH A;  2LSN A;  3AVL A;  3BGR A;  3CG7 A;  1Y97 A;  3TR8 A;  3ZT0 A;  4RW4 A;  1VSE A;  3VQ6 A;  4PA1 A;  4LY7 A;  1L3V A;  3NGY A;  1BIS A;  3NDK A;  3LP2 A;  3CYM A;  1LWE A;  2G8K A;  4CJR A;  3SPY A;  3MXM A;  1UA0 A;  1SL1 A;  2I5J A;  3MEE A;  3VQQ A;  4DSL A;  4DSE A;  2G8V A;  4G1Q A;  1WLJ A;  2JLE A;  2X6S A;  4CIE A;  4HUE A;  1U49 A;  3TAN A;  4CF9 A;  4CGI A;  3DRP A;  3QNO A;  1D9F A;  3TAR A;  1U45 A;  1BQM A;  4E1M A;  4HUF A;  1T7P A;  4CES A;  4CJU A;  5KRT A;  2EX3 A;  1LV5 A;  1JLB A;  4CEF A;  1BCM A;  2JGU A;  1XHX A;  3ZSV A;  1NK9 A;  4FK2 A;  1KLN A;  2YHA A;  3I0S A;  4EP5 A;  4FJI A;  2E6L A;  4OKE A;  1SKW A;  1IG9 A;  3ZSQ A;  4ZHR A;  4CHQ A;  1DTQ A;  3QNN A;  2YHB A;  3PUF A;  4ZTJ A;  4C8L A;  1NJY A;  3MEC A;  1RBV A;  4CJ3 A;  1O1W A;  1ASW A;  4J2E A;  4ICL A;  3ALY A;  4FCY A;  2DTU A;  2OPR A;  4E3S A;  1F21 A;  2HND A;  3QEX A;  1TK0 A;  1RT3 A;  4FJL A;  3QIO A;  1RDA A;  3VQE A;  1N6Q A;  1JXE A;  2PZS A;  3AVI A;  1C6V A;  4I2P A;  1FKO A;  3VN5 A;  4CJV A;  4K8X A;  2Q3S A;  3OY9 A;  4DF8 A;  1CXQ A;  3P1G A;  1WN7 A;  3LAL A;  4FJN A;  3KLE A;  3TAG A;  4J2A A;  2IDO A;  1RTJ A;  2XY8 A;  5KTQ A;  1HMV A;  1RTI A;  4DS4 A;  1U48 A;  4CK3 A;  1VK0 A;  4B08 A;  5HRS A;  2HNZ A;  4RG8 A;  1EP4 A;  4E7I A;  3V9Z A;  4CED A;  4CHO A;  2VG7 A;  4KB0 A;  1D9D A;  1J53 A;  1HYV A;  5HLF A;  4OPK A;  3IRX A;  4M45 A;  4DSK A;  4M42 A;  1BI4 A;  3LWL A;  3VQ4 A;  3HL8 A;  4FXD A;  4OPJ A;  3SNN A;  1HNV A;  3WNE A;  1TKD A;  4KAZ A;  5SWM A;  1VSL A;  4E7L A;  5JS1 A;  5HRP A;  2G8U A;  4J2D A;  3H08 A;  2OYQ A;  3VQD A;  1CXU A;  1Z25 A;  3SPZ A;  4FLZ A;  3QES A;  4IFV A;  4CHP A;  2YKM A;  4KHY A;  4N56 A;  2IC3 A;  3LP1 A;  2F8T A;  3DRS A;  5KGX A;  5J2Q A;  4M41 A;  4AHS A;  1VSI A;  4CGG A;  4AHU A;  3SCX A;  1RT1 A;  4DTJ A;  3BDP A;  2P1J A;  4FLV A;  4C8N A;  3AA4 A;  1S9E A;  2IAJ A;  4CEO A;  4CIG A;  1ITG A;  2RPI A;  3HT3 A;  1IKW A;  4M3X A;  4E7J A;  4N5S A;  4FM2 A;  4DU3 A;  2KTQ A;  4DTX A;  1S1X A;  1TKT A;  1WSH A;  3CM5 A;  4I9L A;  3QET A;  3M8Q A;  4GVM A;  4KKO A;  2PYL A;  3O3H A;  4O5B A;  2FBT A;  2ATQ A;  4DTU A;  2B5J A;  4CHZ A;  1T8E A;  3SV4 A;  4CJT A;  3NH1 A;  3EYZ A;  3D45 A;  4B8C A;  4M3W A;  4ZTF A;  4ELT A;  3SJJ A;  4B9L A;  4DFJ A;  3RWU A;  2KFN A;  4ID1 A;  4KPY A;  3VQ7 A;  4DLE A;  4PQU A;  4KV8 A;  2ZD1 A;  3IG1 A;  1HYZ A;  4DSI A;  4OKK A;  4AHT A;  1C1C A;  3OYG A;  5CY4 A;  1XWL A;  3KK1 A;  3L8B A;  1JL2 A;  5FDL A;  3CFR A;  1X1P A;  4E1N A;  1IKX A;  4MFB A;  3LP3 A;  3NAE A;  3C94 A;  2HMI A;  2HW3 A;  3TAP A;  3KD1 E;  3K57 A;  4BE2 A;  3V9W A;  4W5O A;  4DTO A;  4KHN A;  1ZYQ A;  1CLQ A;  1QE1 A;  4DTS A;  1CZ9 A;  3LZI A;  1YTA A;  4L8R B;  1ZBH A;  1JLF A;  3ASM A;  3HP6 A;  3AVN A;  4W5R A;  3OVN A;  4AHR A;  1GOC A;  1IO2 A;  4W5Q A;  1RT4 A;  1U4B A;  3VQA A;  3QEP A;  3NGI A;  4KHW A;  4CJW A;  1BIU A;  4CGJ A;  3RR7 A;  4LSN A;  3O4N A;  3ZSO A;  1YTU A;  3PX6 A;  1FXX A;  1T05 A;  3HO1 A;  4QOZ B;  1X9S A;  3NGZ A;  2BDP A;  1VSF A;  1NK5 A;  4O4G A;  4DSJ A;  1S6P A;  3SUQ A;  1ZBL A;  1BQN A;  3NE6 A;  2ITG A;  1A5X A;  4KTW A;  3V1R A;  4FJM A;  1TKX A;  4DQI A;  3DI6 A;  2Z1H A;  3KKR A;  4E19 A;  3OYN A;  2HVI A;  2WON A;  4MQ3 A;  2RKI A;  1SKS A;  4CEB A;  4FLW A;  1D8Y A;  5D3G A;  4TSX A;  3ZSR A;  2E4L A;  2B4J A;  2QXF A;  1J9A A;  3AV9 A;  3QER A;  4F3O A;  4KRE A;  3DLB A;  3SV3 A;  4DFP A;  1BIZ A;  1ASU A;  4DMN A;  2YKN A;  3MEG A;  5C25 A;  4JRP A;  3O3G A;  4CER A;  1SL0 A;  2D0B A;  3OYH A;  3PX0 A;  4N76 A;  4CCH A;  2FBV A;  4O44 A;  4DU4 A;  2PYJ A;  3HYF A;  4FK0 A;  3LP0 A;  3V1Q A;  2XO7 A;  3V9X A;  3OYE A;  1HYS A;  3OYB A;  3LWM A;  4GMJ B;  4DSF A;  1UAX A;  3WNH A;  1KLM A;  4Q5V A;  3KLI A;  2XRI A;  3OYD A;  4FLU A;  2Y1I A;  3AVB A;  4LH5 A;  5HRR A;  1A5V A;  4CE9 A;  1KRP A;  2X78 A;  4Z4F A;  1C0U A;  2G8I A;  1S1U A;  3LZJ A;  4HCB A;  1X9W A;  2OZS A;  4J2B A;  1EX4 A;  4CF0 A;  3THV A;  1J5O A;  1RIL A;  3O3F A;  3P83 D;  4IG3 A;  1TVR A;  4CHN A;  1WAJ A;  3OYL A;  2PY5 A;  4KTQ A;  4H4M A;  4HTU A;  2HHV A;  1NOZ A;  1CZB A;  1RDB A;  2B6A A;  2ETJ A;  3AVF A;  3TAM A;  3WNG A;  4XIU A;  1TV6 A;  1Q8I A;  1U47 A;  4ID5 A;  1HNI A;  4E7H A;  3M8R A;  3VQ9 A;  1C0T A;  4AH9 A;  3DLK A;  2F96 A;  1XI1 A;  4B9U A;  1TL1 A;  3KKS A;  1HQE A;  4I7F A;  1EET A;  4F2S A;  3AO2 A;  4FJ8 A;  1GOA A;  1W9H A;  1ZBU A;  3L2Q A;  1S5J A;  3HVR A;  3KTQ A;  4QCL A;  2VG5 A;  2IGI A;  4OKJ A;  3SI6 A;  3KK3 A;  2XY6 A;  3K58 A;  3TI0 A;  1L5U A;  3DLG A;  4HCC A;  1YVU A;  1QSL A;  1XHZ A;  1UWB A;  4IKF A;  4NYF A;  3RMA A;  4JS4 A;  1NJZ A;  1RBT A;  3LPT A;  3ZSX A;  3TAF A;  4Y1C A;  3MXJ A;  3PO4 A;  1WSJ A;  3OS1 A;  2X74 A;  1QSS A;  2P51 A;  2D0C A;  3NF6 A;  2HVH A;  1KVB A;  3LAM A;  4E0D A;  3HPO A;  2A1R A;  4FLX A;  4E7K A;  1SKR A;  4ELV A;  4CF8 A;  5KGW A;  4DF4 A;  4PY5 A;  5E41 A;  3AVK A;  3QLH A;  4IBN A;  1JL1 A;  4KB1 A;  2BGG A;  4HHT A;  1KSP A;  3TAE A;  2QKK A;  4M3Y A;  1R0A A;  1Q9X A;  1HJR A;  3UIQ A;  5T7B A;  3SUN A;  4AIL C;  4RW8 A;  4FJK A;  4Y1D A;  4E89 A;  1EKE A;  4CJK A;  4NCA A;  4DTM A;  2NUB A;  3DLE A;  4O55 A;  3OS2 A;  1RTD A;  3KK2 A;  3G10 A;  1KTQ A;  2P5G A;  5HP1 A;  1G15 A;  2YV0 X;  3I0R A;  4CJS A;  2GUI A;  1JXB A;  4BWM A;  3HPH A;  3V9U A;  1RT7 A;  3AVH A;  1JLE A;  4CJP A;  4EZ6 A;  4M3R A;  1QHT A;  3OYF A;  4FJ5 A;  2XY5 A;  4BE0 A;  3T3F A;  3S9H A;  3SUP A;  4CJL A;  1WSG A;  1RBS A;  1JKH A;  1LWC A;  3CFO A;  1VSD A;  3B6O A;  3TAQ A;  1RTH A;  4HVJ A;  4YNQ A;  4DFM A;  1B9F A;  4FJG A;  1KVC A;  3HPG A;  4N41 A;  1GOB A;  3DLH A;  2G8W A;  4OGC A;  3RRH A;  4O0I A;  1NK4 A;  1L3S A;  4Q0B A;  3K5L A;  2X6N A;  3EZ5 A;  1LWF A;  4EZ9 A;  3OYK A;  3F73 A;  1XC9 A;  4F4K A;  2KQ2 A;  3RTV A;  4FW1 A;  3AA5 X;  3NF9 A;  1TGO A;  1IKY A;  1S1V A;  3U3G A;  3OJS A;  4BAC A;  2WOM A;  4KI4 A;  4IFY A;  4CEQ A;  1BGX T;  1KVA A;  3AVC A;  3VQ8 A;  1JLQ A;  2VWK A;  3LPU A;  5J2N A;  2G8H A;  3V9S A;  1I3A A;  2YNG A;  3AO4 A;  4H8K A;  4B8A B;  5HRN A;  4DTP A;  1KCF A;  1C0M A;  1VSK A;  3HJF A;  1HQU A;  3HM9 A;  4FZY A;  4KRF A;  4BDP A;  4CEE A;  4KHQ A;  3L2R A;  2OZM A;  3KLF A;  3HVT A;  1UOC A;  5KRS A;  3SQ0 A;  3KJV A;  4RW7 A;  1NKB A;  4CFC A;  1QS4 A;  1QQC A;  1RDC A;  1LW2 A;  1VSH A;  3V81 A;  3AO3 A;  3OYC A;  4DQQ A;  2DFF A;  2ZQB A;  4B9M A;  4CK1 A;  4B9V A;  4CJE A;  4I2Q A;  1IKV A;  1SUQ A;  4DFK A;  4CJF A;  3RRG A;  4C8O A;  5EU7 A;  4CJ5 A;  3VA3 A;  2IOC A;  3NH2 A;  2R7Y A;  4FLT A;  4NCB A;  1BL3 A;  1NKC A;  1C1A A;  1TL3 A;  2VG6 A;  1TK8 A;  2AJQ A;  3QO9 A;  3PY8 A;  4DU1 A;  4RW6 A;  3AVM A;  4OVL A;  3K5M A;  1Z26 A;  4DTN A;  3VQC A;  5FRN A;  1NK8 A;  5J2M A;  1U04 A;  4LSL A;  4NYN A;  3HST B;  4R5P A;  1T03 A;  4QAG A;  5I3U A;  3M8P A;  5CZ2 A;  2RN2 A;  5HRO A;  1VSJ A;  4DG1 A;  3HXM A;  3S3N A;  4F8R A;  4AHV A;  3SQ2 A;  4H4O A;  4KO0 A;  3PX4 A;  4CIF A;  1ASV A;  1JLG A;  2OA8 A;  4DTR A;  3DM2 A;  4OJR A;  1VSM A;  1C1B A;  1B9D A;  2OPS A;  4CFD A;  3PV8 A;  4M3Z A;  3AO5 A;  4CGF A;  4FVM A;  3B6P A;  1K6Y A;  3VQP A;  3RMD A;  4FJ7 A;  4W5T A;  4Z4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...