5IWAK

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
115
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
total genus 25
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2016-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 5iwaK00
4X64K 4OX9K 1XNQK 4DR7K 4B3TK 4LF4K 4JI7K 1IBMK 4NXMK 3T1HK 4LFBK 3T1YK 4V19S 3J7AP 4JI8K 3J7YP 4JV5K 1N33K 2UXDK 4DV7K 1N36K 4YHHK 4JI2K 1J5EK 4DR6K 4DV2K 4DR1K 1FJGK 4LF7K 4JI0K 1N34K 5AJ3K 4DV4K 4JI3K 4LF9K 2VQEK 4DR2K 4JI6K 1HNXK 3JAMO 4X65K 4B3MK 4K0KK 4B3SK 4JI4K 5LMUK 3OTOK 5LMNK 2F4VK 2UUBK 4X66K 1IBKK 2UXCK 5IWAK 4CVNE 1HNZK 2VQFK 4DR3K 4LFAK 1HR0K 4DUYK 5A2QO 1XMQK 5LL6Z 4DV3K 5IT9O 2UUAK 4DUZK 4LFCK 4JI5K 4NXNK 4DV1K 1XMOK 1HNWK 4AQYK 4DR5K 4DR4K 2UUCK 5FLXO 1N32K 1XNRK 2HHHK 2E5LK 4B3RK 4DV6K 4DV5K 4KHPK 4X62K 2ZM6K 3J80O 4DV0K 4GKJK 4LF8K 4GKKK 4JYAK 4CW7B 4LF5K 1IBLK 5BR8K 1I94K 4LF6K 3J81O 2UU9K 4JI1K 4YY3K 2UXBK
chains in the Genus database with same CATH superfamily
2YHWA 1SL2A 3ZX2A 5CZ1A 1BU6O 2HB5A 1B9DA 4BRCA 1BUPA 4CZIA 3L2VA 3CETA 4EIAA 1X9MA 3P39A 1JXEA 1HQUA 4V19S 3HO1A 3BGRA 3R1XA 5BREA 3LL3A 2P5OA 2GEMA 2Q3SA 4FJKA 5EX5A 1KAXA 5J2QA 3P38A 3AVFA 1VSFA 3VF4A 4IZ9A 2QXFA 3BZKA 4B9VA 4H8KA 1WNSA 3LDOA 3VQDA 1EKEA 2OTJN 4CF8A 1RBTA 3AVCA 3C65A 2Q97A 3M6GA 2R7YA 2HF4A 3OYDA 1U45A 1HRHA 3CCQN 3JSMA 3AAQA 4BC5A 2A40A 1BQMA 4JKEA 1VAZA 1RTJA 1B9FA 1I39A 4E7JA 4CD3A 3VETA 3HM8A 1JLGA 5J1EA 4GW6A 1BWFO 4KFBA 4M45A 3CCVN 3V1RA 3OYEA 4CJFA 4DR3K 2QTDA 3O6WA 3WNGA 1HR0K 4LSNA 1J5OA 4CZMA 2FSKA 3VQEA 5DM6L 3TAQA 2F8SA 3SMPA 4EP4A 4O5FA 4DV1K 3OW2M 3AVIA 4DTJA 1HNVA 2ZF5O 4DR5K 4KBOA 4PWDA 1S1TA 1DTTA 1NGHA 2F9WA 3NE6A 3KVGA 4FO0A 3VQ9A 1IH7A 1Q18A 3C94A 3NDKA 1RFQA 2G8UA 4E7LA 5J2NA 1OH6A 2RHKA 4IG3A 2PAVA 1ZBUA 5JMVA 3MN9A 2OZSA 1CZBA 4DQ8A 3RMCA 4N41A 3QETA 2QWNA 1RDWX 4KHQA 2Q0UA 1RBUA 1R59O 4FZZA 3D6RA 3TAFA 3MEGA 3VEYA 4BE2A 4CJUA 4YY3K 5JLFA 3N4PA 3RSEB 1U6ZA 1NGIA 4YOXA 1VHXA 1XQSC 4DQIA 4OKKA 3NVKA 1QZ5A 3QBXA 2V7ZA 4Y1CA 5KPZA 1MA9B 3LZIA 1RDDA 1L3TA 3DI6A 1RNHA 1KAZA 5SZTA 1SL1A 1ZBFA 3AGKA 4CGHA 4CIGA 3I33A 1KXPA 2DFEA 4CJ5A 2Z1JA 4N56A 5J2MA 4DSKA 4BG8A 2GTDA 4FVMA 4QS9A 3D2EB 2V51B 1HMVA 4B9NA 2G8KA 1NGFA 5HROA 3FE1A 4ILJA 4CEFA 2OZMA 1Q86O 3FZHA 4CEQA 2QM1A 1XI1A 4JD2B 4IDHA 4PKGA 1NGJA 1JCFA 1XHXA 5LMUK 4Z4EA 2FBYA 2HVIA 4M7XA 4ID1A 4IFEA 2VWKA 1Z26A 3QERA 4WQ5C 4DSLA 1BA0A 5HOOA 1X9WA 3UE5A 1SKRA 1QSYA 2QWOA 3ZEUB 3QLHA 1Y97A 2ATQA 5BPLA 1OKJA 4JS4A 2YHAA 3WEEA 4A2AA 3TSUA 4ZTFA 4ZHRA 3MCAB 4I2QA 4IKFA 3RVCA 1HKBA 2UUAK 4BRDA 1C0GA 1SZ2A 3OVNA 2H3GX 5HL7L 1GLAG 2F7TA 3BEXA 4AQYK 5GIPA 4M42A 2KFZA 2HNZA 1NK9A 1JLQA 3IDHA 4W5RA 2IC3A 4FJGA 4PL7A 2IVOA 4FLVA 1RT3A 4A59A 4CI6A 4Z4HA 1VQPN 3TAPA 4F2SA 5AQHA 3OA9A 4KHPK 1J54A 3AO3A 4X62K 1NGDA 4F8RA 4M41A 4HUEA 5EU7A 1G99A 4H4MA 3ZT2A 4CF0A 3V9SA 3RMDA 4RW6A 3TSPA 2HBLA 4OPHA 4ISEA 5BRDA 1TL3A 4HUGA 2YKNA 4OO1J 2O4IA 1LAVA 4BY9C 1REVA 1W9HA 2QI2A 4FLTA 4NXMK 3L2UA 2Q0RA 4IO8A 4BWJA 1LCUA 1FW6A 4CZJA 2YKMA 3PX0A 3V9ZA 3R8EA 4IXCA 3TTCA 4H0VB 1LWEA 4H5NA 1N36K 2E8AA 4CK3A 1J5EK 3ZETA 4BRIA 4LF7K 4KTWA 5FRNA 1SAZA 4YDUC 1W2BM 3M8QA 1VQMN 3QB0A 4B9MA 1X3NA 4MLHA 4BRMA 3GE1A 3SI6A 2NLXA 4BREA 4DTSA 1TK0A 4OPAA 1NKEA 5BPMA 3TAGA 2X78A 4E7IA 1VQKN 4LH5A 4J2BA 3PUFA 3SBTA 2HHSA 1IBKK 4CIFA 1KFSA 3HM9A 3W3DA 3KLHA 1A5XA 1BDGA 4H03B 5AFUA 2WOMA 3MN6A 3T69A 1YAGA 1ASVA 3G4SN 1D9FA 4BGBA 4YOVA 1U49A 1YIJN 4LFCK 1QQMA 3LDQA 5AQFA 4CF9A 2ETJA 4ID5A 3QMLA 4BACA 1CZAN 2P9NA 3PO4A 2XRIA 4H5RA 3OYJA 3A5OC 3NF6A 4RW9A 3CCMN 3VN5A 1N32K 1JLAA 2CGJA 1T05A 4B3RK 4FWQA 2D4WA 4R5PA 3LZJA 4OJRA 2AJQA 3M8PA 3VEZA 3CCRN 4B08A 2KHOA 5I3UA 3KWIA 3L4IA 1NOZA 1S22A 3MEDA 4BR4A 5BR8K 1D5AA 4HUFA 4BE0A 3CCLN 3DM2A 3E01A 3C6TA 3FR0A 5F0XA 5AQNA 3PX6A 4X64K 4FJLA 4DR7K 3CMEN 3ULDA 4BVOA 3THWB 3CG7A 1BIZA 1R0AA 3L8BA 5HP1A 4GMJB 3ZT3A 5E26A 3OY9A 3M3ZA 3HP9A 3ISNC 5HRPA 3WQTA 3V6DA 1UA0A 2Y1JA 2G8IA 3LP0A 2ASPA 1LWCA 5K14A 3U3GA 3O3FA 1ILYA 1E4FT 3QEPA 3WUHA 1D8YA 4H5VA 1SUQA 4CJRA 4CJPA 3VGLA 4IOAL 2W40A 4CEEA 1GLEG 4K8ZA 2JGUA 1S3XA 1NGGA 2WBNA 5KPTA 1VSKA 2GX9A 1WBBA 4BRPA 1WSIA 1QSSA 1NGEA 5AQOA 3C0BA 4M3ZA 2VQFK 4DS5A 3SZ2A 1JL1A 1T6DA 1YJNN 4BQLA 5AQPA 4DS4A 3SLCA 5CYMA 2ZJQL 4DV3K 4Q5VA 3CQYA 3FFIA 3VESA 4NO7A 4BDZA 1D4XA 4Z94A 3BP8A 1CXUA 3F2KA 2PYLA 3P31A 1F21A 4CEAA 4RW7A 4YOWA 1RTDA 1WBDA 3PLAA 4ZTJA 4AH9A 1RT7A 1JL2A 5M1PA 4EP5A 3SAFA 4PQUA 4CZFA 3B6OA 4FJXA 2E6MA 2YJFA 1CLQA 4FPBA 3VQ6A 4WFBL 3CFPA 5KQ8A 3KLGA 5SWMA 3H46O 3D2EA 3UB5A 4CW7B 4UY8O 3PY8A 3O9UA 4NCAA 1HX1A 1TL1A 2P5GA 4CECA 4CGIA 4JI1K 4H0PA 1NK8A 4CJEA 2HNYA 4A57A 3CJ7A 3I56N 3HXMA 4AILC 2OTLN 3P83D 4C8OA 5AQGA 2EX3A 3ZSZA 2YJEA 5JS1A 1KTQA 2RPIA 2NRZA 5MLCQ 3AA4A 4PKIA 3ZT0A 1SKWA 5M1QA 1NMDA 3HVRA 4B1VA 3S9HA 2P9UB 5J2PA 3D2FB 1WAFA 4OLAA 4U67L 2P9PB 4FWRA 2J4RA 3OYBA 3CCSN 2VG7A 4CZHA 2HMPA 4FWPA 3C6UA 3T3FA 4B3MK 2O8CB 1OH8A 4WF9L 3K2PA 2ZQBA 1E3MA 4ELTA 1B92A 4GY2B 4O8UA 2QEXN 2F8TA 4AM7A 2E88A 4X66K 4M3XA 3SQ2A 1ATNA 5C10A 1QZ6A 3VEOA 2IVNA 3C6HA 5DK5A 3VTHA 3QINA 5CHIA 4JRPA 2Z1HA 4CZGA 3K5NA 4QS7A 4KREA 3WXLA 3OBWA 3BZCA 3U9DA 4JHDA 5EOYA 4B9LA 4FM2A 4CJ4A 3KZBA 1EX4A 3S3OA 1SKSA 4JS5A 2PZSA 1VQ5N 3BUZB 3CPEA 1QHTA 4YORA 1Z05A 2E1ZA 1KRPA 3O4WA 4NYNA 1NBWA 5EXWA 3VQCA 4F2RA 3HOTA 3KIOA 3OYHA 1C6VA 2RKIA 2IS3A 2OPSA 2D0OA 4Z4IA 3DJCA 2W42A 4JYAK 3M5RA 3ZT4A 4KI4A 3G25A 3ZSYA 4DFJA 3IKMA 5DM7L 1RBSA 4Q0BA 1XNQK 2HHVA 3ZSVA 3TPQA 5TKYA 2HHXA 4LF4K 5KPRA 4QAGA 1DGKN 3DAWA 1Z6RA 1UWBA 2XY7A 4KB0A 3TU5A 2A3ZA 4WQ5A 5JLHA 3NGZA 1N33K 1FK9A 1BG3A 4FW1A 4ELUA 2DPNA 4FZXC 3V9UA 2A1RA 1HQEA 3ITHA 3VQ5A 4JI0K 3CC7N 3O1BA 3HI0A 1L3UA 5AQXA 4CZKA 3GOIA 4OVLA 5HRRA 4EHTA 2HMIA 4DSIA 2Q36A 5AQRA 2HHUA 4W5NA 5BRFA 4IOXA 3JAMO 4CEBA 1NJYA 3DRRA 1GLBG 4H5TA 4KKOA 4BDPA 2KQ2A 5C24A 4MO4A 3BDPA 5GIOA 3IG1A 4W5TA 2P9NB 1HPZA 3SQ0A 2FF6A 2QW9A 4KHYA 2F96A 1NG9A 4EFHA 1BIUA 2XY6A 1RDUA 3HVTA 1WSJA 3L0QA 4HCBA 3QO9A 4FJ5A 4FJ8A 3PV8A 4IO9L 4Y0WA 5TKWA 4O4GA 1CZ9A 3THWA 1QQOA 2E4LA 4OGCA 1N5YA 3LWMA 2CGLA 3KK1A 1NJIO 1X1PA 2GWJA 1T8EA 5EY4A 4DR4K 1LOTB 4JK7A 4BR7A 4BC4A 3ALYA 1NK7A 1YJWN 4F4KA 3EZWA 3LAKA 3VGKA 1A5VA 4RW8A 1RCHA 4YDUA 4DTPA 1NJXA 3H45C 3B8AX 5C12A 3NGIA 3SPZA 1S6PA 4DF8A 3KWGA 2HBKA 5AZJA 3SAGA 1MDUB 2B5JA 4LC9B 4CJWA 1U04A 1N8RO 2WC9A 2I5JA 5C2DA 4BC3A 4JI7K 3SJHA 5GADP 4Y1DA 4LFBK 1IO2A 5EVZA 3ID8A 3ZSXA 4OPJA 3LP1A 3O9SA 4E3SA 1S72N 4FVUA 3O4QA 3AVGA 3CPWM 3VA0A 1ATSA 4Z4FA 5ADXH 1ZC6A 4YOUA 4JKHA 3EL2A 3CCUN 2W6LA 5HBMA 4DR1K 5AQIA 3MXJA 1YTUA 3MECA 2Q2RA 1XC3A 5AJ3K 4JI3K 4LF9K 2NRVA 2GBZA 2YNGA 3JXUA 4M7YA 4MO5A 4BG9A 4IOCL 1N6QA 1X9JA 1VQ9N 4KHNA 4BR0A 3M8RA 1JJ2M 3EO3A 4WFNL 1RDCA 2OYQA 5LJVA 3O08A 1WOQA 3OS0A 4WQ4C 5FROA 4N47A 4FK4A 3SNNA 4B1UB 1LAWA 4AM6A 3K5LA 1GLDG 3K9KA 2JLEA 2KW4A 3WT0A 2QKKA 1JKHA 3PSIA 4B8AB 3EY1A 1NJWA 4J2AA 5FPMA 1XMQK 4XH5A 2KFNA 2HHWA 4K42A 1FXXA 2XY5A 3N4QA 4I6MB 1XMOK 2PYJA 1IKVA 3LPTA 1J53A 4FCYA 1VQ4N 2UUCK 2BDPA 2PFUA 3O3HA 1RTHA 4DSFA 1BO5O 1JCGA 2YNFA 3TR8A 4E7HA 2P9UA 2Z1IA 3CJ1A 3D2FA 5FDLA 4B9QA 2CH5A 2G8VA 3OYFA 2XO7A 4BQZA 3J80O 2P9PA 4GVEA 1NK4A 3TANA 4GKKK 5C0YA 3FZLA 2OA8A 4IG0A 2P9IA 4DTRA 2O8CA 4KB1A 2W41A 2UXBK 2Z1GA 1Q8IA 3ZCMA 4FJ9A 1WSHA 3DLBA 1S5JA 4FWLA 4A62A 3HPOA 2YX6A 3QESA 1JLCA 1QHAA 4M3RA 3LDNA 5KI6A 4BR5A 1O13A 3VEWA 3A5LC 5I9EB 1RBVA 4JI8K 4JKGA 1BOTO 5C25A 1RGIA 2KZMA 3J8AA 3JYTA 2KKZA 2UXDK 1GLLO 4WFAL 1EP4A 4AHVA 4DR6K 3SAHA 4GV6A 3CERA 3VMFB 4DU4A 1T7PA 1QSLA 1RDAA 4JHDB 2PY5A 4L8RB 3CXCM 4FLUA 4DFPA 2BUPA 4QS8A 4I9LA 5JS2A 4JI4K 3GBTA 2GUPA 4E89A 4FWSA 2D5RA 3OTOK 3TAEA 3HYFA 4LY7A 3O3GA 2NRRA 4KH5A 1W0HA 2A5XA 4CVNE 3KKSA 4CHOA 3ENBA 1VSDA 1YF5L 4NLCA 1S1XA 3VQ7A 2HVHA 1BCOA 3EE9A 1VQ8N 2G8WA 4CBXA 1QQCA 4OKEA 2AP1A 2VG6A 3LPUA 5AZIA 4DSJA 2ZGYA 1WN7A 3CQ8A 1NWKA 3K0SA 3HRGA 3HOSA 2P1JA 3LM9A 3KD1E 4RG8A 3NF7A 2BTFA 4FJ7A 4IEIA 5D3GA 4B1XB 4B1WB 1XC9A 3SV4A 1UAXA 2OPQA 4LF5K 3VENA 5M1NA 3G0ZA 3KLEA 1HNWK 3HL8A 3DXKB 5AQKA 2A42A 4OX9K 2E6LA 4YOYA 3MAQA 3S3NA 1A5WA 1C0TA 1IBMK 1DEJA 3CFOA 1Q9XA 3BY5A 1JXBA 3KHYA 3DWLA 3TARA 3GL1A 5M1KA 3LANA 2CH6A 1WAJA 5E84A 5FPEA 4DV4K 4EZ9A 4J2DA 1K9MO 3MXIA 4E1NA 2HOEA 4DKWA 3O9RA 4CJKA 3VQQA 3SJJA 5CZ2A 4B9UA 2B6AA 1T03A 4BWMA 1QVFM 1ZBLA 4XEIA 3MN5A 4ILHA 1TAUA 2QWLA 1NNEA 2UUBK 4I9QA 1L5UA 1C1BA 3J7ZO 1C0FA 1U48A 2ITGA 3CCEN 4LFAK 4H0XB 4IFVA 4O0IA 1ASWA 4CGJA 4PUOA 2D0CA 3FFKB 3CFRA 4U7BA 1LW0A 2IIRA 3VTIA 1IG9A 3CD6N 4B1ZA 1VQ6N 1ITGA 4NXNK 3VGMA 1WLJA 1QTMA 5AZJB 1S6QA 3THXB 1QE1A 4CJTA 1C1AA 3H6EA 3P5JA 1KVCA 1KQSM 3JS6A 3WXJA 4BROA 4C8NA 3CYMA 1U2VB 2FBVA 2W6KA 4RTFD 4M3TA 1T44A 2ASMA 3PO5A 3QIPA 2HHHK 1KSPA 3F9KA 4DB3A 1SV5A 4E7KA 2YHBA 4DV5K 4FM0A 3SCXA 2I7PA 3QDKA 3O80A 4FOIA 4MLEA 4C8MA 1KVAA 4LF8K 4H0OA 2FF3B 4CJQA 3PIOL 4KAZA 4BR9A 1KFDA 3KK2A 1IBLK 3DLHA 4QOZB 2D0PA 4FW2A 4M63C 3L2QA 5DMRA 3QIOA 2VG5A 3HSTB 1SQKA 3P1GA 1BL3A 3V1OA 3MDQA 3QEWA 3FLCO 2QK9A 2IGIA 4MDAA 4CF2A 1L3SA 3FGUA 5BPNA 4CGFA 2HHQA 4G1QA 4CJLA 4CHYA 3VQAA 3VEXA 4H4OA 3L3VA 1YHQN 1ZBHA 1RT6A 4CCHA 4JK9A 3WNEA 3AO1A 4KHUA 4XH4A 1NJZA 2HF3A 4AF1A 2NNWA 1BCMA 3VQPA 4BRNA 4I6MA 2NRWA 2DY4A 3AO2A 3F73A 3MX2A 1HYSA 2A1SA 3UKUA 3CC2N 3NVMA 3NF8A 3VF2A 3B6PA 3VF6A 4CHNA 3VOVA 3MX5A 4KTQA 4Z4CA 1HLUA 1UA1A 3OS2A 4DFMA 5ADXA 4IDKA 4DTXA 1NK0A 1T3VA 4HCCA 5BN9A 3ATUA 4OGEA 4R79A 5IWAK 1YT3A 4K25A 4DG1A 1HNZK 2Q31A 2YHYA 3CJCA 1KLMA 1EWRA 2P9IB 5AQVA 4DUZK 3T1AA 4JI5K 1TV6A 1HJOA 4CGGA 3I8DA 3CJ9A 1BHLA 2HSTA 3DRPA 3DXMA 3RR8A 4M3WA 1Q82O 1ZXOA 1S1VA 3I0SA 3TABA 4DLGA 2BE2A 3FZFA 2BANA 3RWUA 3AVBA 4KRFA 1S1WA 4FZYA 1RT2A 4KI6A 4JKGB 4DV6K 2IVPA 4B3OA 3LDLA 2XY8A 4BRGA 5M1FA 3DLLL 5AQYA 1V4TA 3K9JA 4IBNA 2PBDA 5FPDA 2ZGZA 3HJFA 4PL8A 4B8CA 1I94K 3KJVA 1OVQA 3TWHA 3UIQA 5BR9A 3K57A 3QEVA 1K73O 5HRSA 4FL9A 1KLNA 3THVA 1ZBIA 3PIPL 2E2NA 4PKHA 4JKAA 1UOCA 4WQ4A 1S9GA 2O8BB 3T1HK 3AVAA 5GAEP 3D45A 2WTUA 3OJUA 1TK8A 4JKDA 4RWTA 1VQNN 1HNIA 3OJSA 4DV7K 4KO0A 2YV0X 1L3VA 2BGGA 1FJGK 3R3LA 4C1NI 1N34K 1ATRA 5GAHP 2VCPA 2VQEK 4JI6K 2A6AA 3DRSA 2YCHA 4PA1A 4W5OA 3DMJA 3AAPA 1VSLA 3C6AA 4F3OA 1TUUA 2FLOA 1K8AO 4KV8A 4CJ7A 5AZIB 2ZJRL 1WSEA 3I8BA 2WONA 1KVBA 1GLFO 1YI2N 4HHTA 2F4VK 2D0BA 5T7BA 1NGAA 2FBTA 4C8KA 5JVGL 1EWQA 3WXIA 4DTMA 1XHZA 2G8FA 4AHCA 4FLZA 4JKCA 1YJ9N 5KTQA 2X6SA 3DXKA 4DUYK 4FJHA 2VWJA 5LL6Z 4K41A 5IT9O 1TKTA 3VQ4A 3A2FA 4CE9A 2NZTA 1BGXT 4ICLA 2O8DB 5BRHA 2ITMA 2B4JA 4E19A 1ZBSA 2QWRA 1G15A 3RMAA 4JK8A 3AV9A 1VSEA 3DLEA 3O1WA 2JWKA 5AQJA 3H3OB 1NLVA 3K5OA 3V9WA 2XHBA 4Z0UA 3I0RA 4KHSA 4W5QA 1GLJO 4O0JA 1U47A 1EXQA 1NGCA 3LM2A 2ZM6K 1VRUA 4WE1A 4CEOA 4CK1A 2VYPA 2ZWHA 1OH5A 2RF2A 4EAHD 3M8SA 4C8LA 2HHTA 2FXUA 3SUPA 3LP3A 2OCEA 3QNOA 4CEDA 4FK2A 4H0YB 3H1QA 5AQUA 3OYGA 2X74A 1VSJA 4B3TK 3P4IA 4CHZA 2E1YA 3IAYA 3ZSOA 3QEIA 5CYQA 3W0LA 2DTUA 1TYQA 1KCFA 4ILGB 1M90O 4CHQA 3Q7BA 3E9OA 3SQ4A 4CGDA 3SUOA 3NCIA 4AHUA 4JI2K 3QNNA 1GLCG 2IAJA 2RE2A 3KK7A 4WYBA 3C95A 3THXA 1HUXA 3LDSA 3ATVA 2YNIA 4O5BA 3T7ZA 2YNHA 2Q1NA 2QWPA 4KPYA 4DU3A 3OYMA 3LP2A 1U2VA 4XH1A 3AVNA 3THYB 1O1WA 4C23A 2GELA 2FSNA 1NK6A 3SUNA 1RDBA 4CD1A 4DTOA 4WCEL 4A5BA 5CR4A 3UKRA 3TTFA 4CFDA 4CEZA 4CK2A 5AQWA 5HRNA 3HPHA 4PHTX 2FSJA 3WNFA 4FWOA 3EKSA 2P9SB 1EETA 4N76A 3IRXA 5KRSA 5C2FA 4J2EA 1Q7YO 3QFUA 3NHGA 2O8FA 4HVJA 3BF1A 3AA5X 3NH0A 2VGNA 4IWVA 1CXQA 1I3AA 1TAQA 3AY9A 4FM1A 1FKPA 2GV9A 2QA4N 4MDBA 1XNRK 4F3TA 2BH1A 3RRGA 1ESVA 1BI4A 4YNQA 4FYDA 2HBMA 3U3YA 3EKUA 1MWMA 1VK0A 3CMAN 3EYZA 3ID6A 4F9OA 1Y64A 1C1CA 3AARA 3IUCA 2UU9K 4JN4A 1WSFA 3UKUB 3PSFA 1SS6A 4BC2A 4H5WA 4O44A 4FJIA 4CF1A 3ZYYX 4H0TB 3EEQA 3CQXA 5KQDA 2WUSA 1P90A 4CFBA 3T1YK 3A5NC 1VSHA 3AA2A 4G9ZA 3LAMA 3J7YP 1K8KA 3HP6A 2DFHA 2VWBA 2YI1A 2KTQA 3DLRA 2P9KA 4TSXA 5AQTA 1WB9A 4DV2K 1RTIA 4FSVA 2FBXA 4BGAA 2FC0A 4LH4A 4DQSA 3KK3A 2VGMA 2E2PA 2LSNA 1HNXK 1WUAA 1MWKA 3R6MA 1C0MA 3L4QA 5LJWA 3DXMB 3AO5A 4HTLA 1OVYA 3V81A 1D9DA 3A0IX 1HJRA 3SMSA 3E1YA 3HSCA 5AQZA 3ULEB 1VQ7N 4JNEA 2JWLA 3OHRA 1DTQA 2O8EB 5GINA 3MXMA 3CC4N 2HW3A 2P51A 4I7FA 3SBGA 4NCBA 5AQMA 3K59A 3U4LA 2ZE2A 4A61A 1M1KO 5F1XA 5CE3A 4GV9A 2NRHA 3H1VX 1IJJA 3AVMA 2P9LB 4FPAA 3I55N 2O8BA 4CFAA 2E2OA 2ZJPL 3FZMA 4KHWA 2YHXA 3HK2A 4YFUA 1NU0A 3NGYA 4BRAA 4BRLA 3L6QA 1TKDA 1QQNA 4EZ6A 2F9TA 3NMUA 2KLAA 4GV3A 1P8ZA 3NAEA 4GNIA 3MK6A 3TTDA 1K6YA 3A5MC 4DV0K 5KGWA 3QEXA 4BVPA 4CJ3A 2HNDA 1J9AA 2NRTA 3AA3A 5I42A 3BF3A 4ELVA 3U6FA 2ZD1A 1KC8O 5AQQA 2D0AA 4IJAA 1XUPO 2NRXA 3M1FA 1YVUA 5GAGP 5C15A 1DT9A 2NUBA 4JAXA 3AVKA 3MCPA 3OYNA 1IKWA 3AGRA 1WSGA 4OPKA 3Q7CA 3T19A 3K5MA 4IFYA 2A41A 3HPGA 1HKCA 5AQSA 1IKYA 4JV5K 3AVJA 5B8HA 4AHSA 1RBRA 4OKJA 4DSEA 3HZ6A 4FLXA 1QS4A 1VSMA 4OLBA 4DLEA 2O8DA 4Z4GA 3DLGA 1EO1A 1YVNA 3ZX3A 2OPPA 3ZSRA 1H1VA 4BR2A 3SYZA 1TGOA 1C0UA 1NGBA 3C7NA 1S9EA 4L3QA 1MU2A 4CIEA 3G71N 4DQPA 4FJNA 4PY5A 1BISA 3CJAA 1NOYA 3S41A 1RT4A 4HTUA 3ZSQA 2HBJA 3WXMB 5E41A 1YUWA 5M1OA 5AQLA 3WNHA 3OYCA 3A8YA 3SPYA 4RW4A 4DF4A 1RILA 3IFRA 4JRQA 4LSLA 4FLYA 1FKOA 3VERA 2V52B 4NYFA 4DHYA 1KAYA 1V4SA 3FZKA 5HLFA 4CJSA 3MWPA 2ASOA 3O5BA 3HTVA 2G8HA 3H08A 4NLBA 4CERA 1W97L 1HYZA 4KH4A 3D0PA 1W7AA 4O8KA 1Q81O 3TAMA 3CM5A 1JCEA 1TYQB 3E66A 2IOCA 4B9TA 2RN2A 3NH2A 3KD5E 3R9PA 4DQRA 4FWMA 4DFKA 1HYVA 1RT1A 4K8XA 3GDQA 3TSQA 2QKBA 5KGXA 3RMBA 2X6NA 2E20A 4MFBA 4DWIA 4GKJK 1GOBA 4J8FA 5C42A 4JEPA 3O9TA 4BRKA 3THYA 1U4BA 3WQUA 3PX4A 3QBWA 4CBUA 2GUIA 5JICA 5FRMA 4IJNA 4BRQA 4JLHA 3ZT1A 4K43A 1TUYA 1NKBA 3ENOA 4MQ3A 5BN8A 1YITN 1Z25A 3E9LA 4FXDA 1IG8A 1LWFA 3J7AP 3SQ1A 2OANA 1ASUA 3O4NA 3UKRB 2P9SA 2WFBA 3IMXA 4BDYA 3L3UA 1J6ZA 4YHHK 3DOKA 1IKXA 3VQ8A 3L2WA 4CJVA 3HT3A 3KLFA 4BRHA 4FWKA 3NH1A 3WXKA 2DFFA 5KRTA 4DR2K 3K58A 3S3MA 3CM6A 4N5SA 4O55A 3V4IA 5CY4A 3RSEA 1HKGA 2O8FB 1IV0A 3LDPA 3NF9A 4B3SK 4FLWA 3O8MA 3V1QA 3G10A 1ZYQA 4UQGA 3NFAA 3CCJN 1VSIA 1SL0A 2UXCK 3ZX0A 1BI4B 1XWLA 5AR0A 3IS9A 4BRFA 3AVHA 1TK5A 3DYAA 4DCHA 1TKXA 4NCGA 4CHPA 4B9SA 1JLFA 3VQBA 1NK5A 1GOCA 4GVMA 2KZZA 3VEVA 4M3YA 3LALA 1S1UA 3MMVA 1TVRA 1DLOA 4QCLA 4JD2A 4HWIA 4JKBA 4AHTA 4KH6A 5FLXO 1BQNA 2E2QA 3OYLA 3CIPA 3OS1A 3AVLA 3TI0A 1KD1O 1T6CA 3F5TA 4FK0A 4ISGA 4FJJA 1K8KB 2I7NA 2V7YA 3HBTA 3ZEUA 3LWLA 2P9KB 3DOLA 1DKGD 3KLIA 1LV5A 2D1KA 1NMNA 1YXQA 4LF6K 5JVHL 4K0KK 3ULEA 3ZSWA 4CFCA 3WEEB 4LD0A 1VQON 3NBPA 3SV3A 4FOEA 2O8EA 1OH7A 4E1JA 4FWNA 1HPMA 3CHWA 2IDOA 3MWTA 3ZLJA 4CZLA 3GG4A 4RCHA 4A5AA 1X3MA 2QXLA 4CESA 4M3UA 1LW2A 3SUQA 4KTZA 5F2RA 3VA3A 4DQQA 1YTAA 2P9LA 2QWMA 3MEEA 3U9ZA 1BA1A 5H1SQ 3ASMA 4FJMA 3V9XA 3EE8A 3ENHA 4NB4A 3QFPA 2QWQA 5AFUH 5ELZA 1EQYA 2OPRA 5FPNA 4X65K 5LY3A 3RR7A 3O9QA 3SK3A 4C1NK 1VRTA 1VQLN 4XIUA 5LMNK 2EWSA 1GOAA 1JLBA 4E0DA 1X9SA 4IEEA 2AA4A 4A2BA 3CI5A 3CF5L 2EHGA 3L2RA 3OYIA 4DTUA 4YOTA 3EZ5A 3MN7A 3QICA 1RT5A 5A2QO 1E4GT 3DLKA 1TKZA 4CZEA 4EHUA 3F9MA 3ZETB 4E1MA 3H3NO 4JKFA 4BE1A 2Y1IA 3KKRA 4CBWA 3D7EO 3RTVA 3KTQA 3AO4A 4I2PA 3EN9A 4DMNA 4B1YB 3OYAA 4DU1A 1NM1A 2E5LK 2UYTA 3OBYA 4ISFA 1Q9YA 4AHRA 3E9PA 3OYKA 1NKCA 3G6EN 3VPZA 4DTNA 1QVGM 1JLEA 3J81O 2O4GA 2CGKA 2GWKA 3U8XA 3RRHA 3CJBA 3C7NB
chains in the Genus database with same CATH topology
4X64K 4OX9K 1XNQK 4DR7K 4B3TK 4LF4K 4JI7K 1IBMK 4NXMK 3T1HK 4LFBK 3T1YK 4V19S 3J7AP 4JI8K 3J7YP 4JV5K 1N33K 2UXDK 4DV7K 1N36K 4YHHK 4JI2K 1J5EK 4DR6K 4DV2K 4DR1K 1FJGK 4LF7K 4JI0K 1N34K 5AJ3K 4DV4K 4JI3K 4LF9K 2VQEK 4DR2K 4JI6K 1HNXK 3JAMO 4X65K 4B3MK 4K0KK 4B3SK 4JI4K 5LMUK 3OTOK 5LMNK 2F4VK 2UUBK 4X66K 1IBKK 2UXCK 5IWAK 4CVNE 1HNZK 2VQFK 4DR3K 4LFAK 1HR0K 4DUYK 5A2QO 1XMQK 5LL6Z 4DV3K 5IT9O 2UUAK 4DUZK 4LFCK 4JI5K 4NXNK 4DV1K 1XMOK 1HNWK 4AQYK 4DR5K 4DR4K 2UUCK 5FLXO 1N32K 1XNRK 2HHHK 2E5LK 4B3RK 4DV6K 4DV5K 4KHPK 4X62K 2ZM6K 3J80O 4DV0K 4GKJK 4LF8K 4GKKK 4JYAK 4CW7B 4LF5K 1IBLK 5BR8K 1I94K 4LF6K 3J81O 2UU9K 4JI1K 4YY3K 2UXBK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 K;  4OX9 K;  1XNQ K;  4DR7 K;  4B3T K;  4LF4 K;  4JI7 K;  1IBM K;  4NXM K;  3T1H K;  4LFB K;  3T1Y K;  4V19 S;  3J7A P;  4JI8 K;  3J7Y P;  4JV5 K;  1N33 K;  2UXD K;  4DV7 K;  1N36 K;  4YHH K;  4JI2 K;  1J5E K;  4DR6 K;  4DV2 K;  4DR1 K;  1FJG K;  4LF7 K;  4JI0 K;  1N34 K;  5AJ3 K;  4DV4 K;  4JI3 K;  4LF9 K;  2VQE K;  4DR2 K;  4JI6 K;  1HNX K;  3JAM O;  4X65 K;  4B3M K;  4K0K K;  4B3S K;  4JI4 K;  5LMU K;  3OTO K;  5LMN K;  2F4V K;  2UUB K;  4X66 K;  1IBK K;  2UXC K;  5IWA K;  4CVN E;  1HNZ K;  2VQF K;  4DR3 K;  4LFA K;  1HR0 K;  4DUY K;  5A2Q O;  1XMQ K;  5LL6 Z;  4DV3 K;  5IT9 O;  2UUA K;  4DUZ K;  4LFC K;  4JI5 K;  4NXN K;  4DV1 K;  1XMO K;  1HNW K;  4AQY K;  4DR5 K;  4DR4 K;  2UUC K;  5FLX O;  1N32 K;  1XNR K;  2HHH K;  2E5L K;  4B3R K;  4DV6 K;  4DV5 K;  4KHP K;  4X62 K;  2ZM6 K;  3J80 O;  4DV0 K;  4GKJ K;  4LF8 K;  4GKK K;  4JYA K;  4CW7 B;  4LF5 K;  1IBL K;  5BR8 K;  1I94 K;  4LF6 K;  3J81 O;  2UU9 K;  4JI1 K;  4YY3 K;  2UXB K; 
#chains in the Genus database with same CATH topology
 2YHW A;  1SL2 A;  3ZX2 A;  5CZ1 A;  1BU6 O;  2HB5 A;  1B9D A;  4BRC A;  1BUP A;  4CZI A;  3L2V A;  3CET A;  4EIA A;  1X9M A;  3P39 A;  1JXE A;  1HQU A;  4V19 S;  3HO1 A;  3BGR A;  3R1X A;  5BRE A;  3LL3 A;  2P5O A;  2GEM A;  2Q3S A;  4FJK A;  5EX5 A;  1KAX A;  5J2Q A;  3P38 A;  3AVF A;  1VSF A;  3VF4 A;  4IZ9 A;  2QXF A;  3BZK A;  4B9V A;  4H8K A;  1WNS A;  3LDO A;  3VQD A;  1EKE A;  2OTJ N;  4CF8 A;  1RBT A;  3AVC A;  3C65 A;  2Q97 A;  3M6G A;  2R7Y A;  2HF4 A;  3OYD A;  1U45 A;  1HRH A;  3CCQ N;  3JSM A;  3AAQ A;  4BC5 A;  2A40 A;  1BQM A;  4JKE A;  1VAZ A;  1RTJ A;  1B9F A;  1I39 A;  4E7J A;  4CD3 A;  3VET A;  3HM8 A;  1JLG A;  5J1E A;  4GW6 A;  1BWF O;  4KFB A;  4M45 A;  3CCV N;  3V1R A;  3OYE A;  4CJF A;  4DR3 K;  2QTD A;  3O6W A;  3WNG A;  1HR0 K;  4LSN A;  1J5O A;  4CZM A;  2FSK A;  3VQE A;  5DM6 L;  3TAQ A;  2F8S A;  3SMP A;  4EP4 A;  4O5F A;  4DV1 K;  3OW2 M;  3AVI A;  4DTJ A;  1HNV A;  2ZF5 O;  4DR5 K;  4KBO A;  4PWD A;  1S1T A;  1DTT A;  1NGH A;  2F9W A;  3NE6 A;  3KVG A;  4FO0 A;  3VQ9 A;  1IH7 A;  1Q18 A;  3C94 A;  3NDK A;  1RFQ A;  2G8U A;  4E7L A;  5J2N A;  1OH6 A;  2RHK A;  4IG3 A;  2PAV A;  1ZBU A;  5JMV A;  3MN9 A;  2OZS A;  1CZB A;  4DQ8 A;  3RMC A;  4N41 A;  3QET A;  2QWN A;  1RDW X;  4KHQ A;  2Q0U A;  1RBU A;  1R59 O;  4FZZ A;  3D6R A;  3TAF A;  3MEG A;  3VEY A;  4BE2 A;  4CJU A;  4YY3 K;  5JLF A;  3N4P A;  3RSE B;  1U6Z A;  1NGI A;  4YOX A;  1VHX A;  1XQS C;  4DQI A;  4OKK A;  3NVK A;  1QZ5 A;  3QBX A;  2V7Z A;  4Y1C A;  5KPZ A;  1MA9 B;  3LZI A;  1RDD A;  1L3T A;  3DI6 A;  1RNH A;  1KAZ A;  5SZT A;  1SL1 A;  1ZBF A;  3AGK A;  4CGH A;  4CIG A;  3I33 A;  1KXP A;  2DFE A;  4CJ5 A;  2Z1J A;  4N56 A;  5J2M A;  4DSK A;  4BG8 A;  2GTD A;  4FVM A;  4QS9 A;  3D2E B;  2V51 B;  1HMV A;  4B9N A;  2G8K A;  1NGF A;  5HRO A;  3FE1 A;  4ILJ A;  4CEF A;  2OZM A;  1Q86 O;  3FZH A;  4CEQ A;  2QM1 A;  1XI1 A;  4JD2 B;  4IDH A;  4PKG A;  1NGJ A;  1JCF A;  1XHX A;  5LMU K;  4Z4E A;  2FBY A;  2HVI A;  4M7X A;  4ID1 A;  4IFE A;  2VWK A;  1Z26 A;  3QER A;  4WQ5 C;  4DSL A;  1BA0 A;  5HOO A;  1X9W A;  3UE5 A;  1SKR A;  1QSY A;  2QWO A;  3ZEU B;  3QLH A;  1Y97 A;  2ATQ A;  5BPL A;  1OKJ A;  4JS4 A;  2YHA A;  3WEE A;  4A2A A;  3TSU A;  4ZTF A;  4ZHR A;  3MCA B;  4I2Q A;  4IKF A;  3RVC A;  1HKB A;  2UUA K;  4BRD A;  1C0G A;  1SZ2 A;  3OVN A;  2H3G X;  5HL7 L;  1GLA G;  2F7T A;  3BEX A;  4AQY K;  5GIP A;  4M42 A;  2KFZ A;  2HNZ A;  1NK9 A;  1JLQ A;  3IDH A;  4W5R A;  2IC3 A;  4FJG A;  4PL7 A;  2IVO A;  4FLV A;  1RT3 A;  4A59 A;  4CI6 A;  4Z4H A;  1VQP N;  3TAP A;  4F2S A;  5AQH A;  3OA9 A;  4KHP K;  1J54 A;  3AO3 A;  4X62 K;  1NGD A;  4F8R A;  4M41 A;  4HUE A;  5EU7 A;  1G99 A;  4H4M A;  3ZT2 A;  4CF0 A;  3V9S A;  3RMD A;  4RW6 A;  3TSP A;  2HBL A;  4OPH A;  4ISE A;  5BRD A;  1TL3 A;  4HUG A;  2YKN A;  4OO1 J;  2O4I A;  1LAV A;  4BY9 C;  1REV A;  1W9H A;  2QI2 A;  4FLT A;  4NXM K;  3L2U A;  2Q0R A;  4IO8 A;  4BWJ A;  1LCU A;  1FW6 A;  4CZJ A;  2YKM A;  3PX0 A;  3V9Z A;  3R8E A;  4IXC A;  3TTC A;  4H0V B;  1LWE A;  4H5N A;  1N36 K;  2E8A A;  4CK3 A;  1J5E K;  3ZET A;  4BRI A;  4LF7 K;  4KTW A;  5FRN A;  1SAZ A;  4YDU C;  1W2B M;  3M8Q A;  1VQM N;  3QB0 A;  4B9M A;  1X3N A;  4MLH A;  4BRM A;  3GE1 A;  3SI6 A;  2NLX A;  4BRE A;  4DTS A;  1TK0 A;  4OPA A;  1NKE A;  5BPM A;  3TAG A;  2X78 A;  4E7I A;  1VQK N;  4LH5 A;  4J2B A;  3PUF A;  3SBT A;  2HHS A;  1IBK K;  4CIF A;  1KFS A;  3HM9 A;  3W3D A;  3KLH A;  1A5X A;  1BDG A;  4H03 B;  5AFU A;  2WOM A;  3MN6 A;  3T69 A;  1YAG A;  1ASV A;  3G4S N;  1D9F A;  4BGB A;  4YOV A;  1U49 A;  1YIJ N;  4LFC K;  1QQM A;  3LDQ A;  5AQF A;  4CF9 A;  2ETJ A;  4ID5 A;  3QML A;  4BAC A;  1CZA N;  2P9N A;  3PO4 A;  2XRI A;  4H5R A;  3OYJ A;  3A5O C;  3NF6 A;  4RW9 A;  3CCM N;  3VN5 A;  1N32 K;  1JLA A;  2CGJ A;  1T05 A;  4B3R K;  4FWQ A;  2D4W A;  4R5P A;  3LZJ A;  4OJR A;  2AJQ A;  3M8P A;  3VEZ A;  3CCR N;  4B08 A;  2KHO A;  5I3U A;  3KWI A;  3L4I A;  1NOZ A;  1S22 A;  3MED A;  4BR4 A;  5BR8 K;  1D5A A;  4HUF A;  4BE0 A;  3CCL N;  3DM2 A;  3E01 A;  3C6T A;  3FR0 A;  5F0X A;  5AQN A;  3PX6 A;  4X64 K;  4FJL A;  4DR7 K;  3CME N;  3ULD A;  4BVO A;  3THW B;  3CG7 A;  1BIZ A;  1R0A A;  3L8B A;  5HP1 A;  4GMJ B;  3ZT3 A;  5E26 A;  3OY9 A;  3M3Z A;  3HP9 A;  3ISN C;  5HRP A;  3WQT A;  3V6D A;  1UA0 A;  2Y1J A;  2G8I A;  3LP0 A;  2ASP A;  1LWC A;  5K14 A;  3U3G A;  3O3F A;  1ILY A;  1E4F T;  3QEP A;  3WUH A;  1D8Y A;  4H5V A;  1SUQ A;  4CJR A;  4CJP A;  3VGL A;  4IOA L;  2W40 A;  4CEE A;  1GLE G;  4K8Z A;  2JGU A;  1S3X A;  1NGG A;  2WBN A;  5KPT A;  1VSK A;  2GX9 A;  1WBB A;  4BRP A;  1WSI A;  1QSS A;  1NGE A;  5AQO A;  3C0B A;  4M3Z A;  2VQF K;  4DS5 A;  3SZ2 A;  1JL1 A;  1T6D A;  1YJN N;  4BQL A;  5AQP A;  4DS4 A;  3SLC A;  5CYM A;  2ZJQ L;  4DV3 K;  4Q5V A;  3CQY A;  3FFI A;  3VES A;  4NO7 A;  4BDZ A;  1D4X A;  4Z94 A;  3BP8 A;  1CXU A;  3F2K A;  2PYL A;  3P31 A;  1F21 A;  4CEA A;  4RW7 A;  4YOW A;  1RTD A;  1WBD A;  3PLA A;  4ZTJ A;  4AH9 A;  1RT7 A;  1JL2 A;  5M1P A;  4EP5 A;  3SAF A;  4PQU A;  4CZF A;  3B6O A;  4FJX A;  2E6M A;  2YJF A;  1CLQ A;  4FPB A;  3VQ6 A;  4WFB L;  3CFP A;  5KQ8 A;  3KLG A;  5SWM A;  3H46 O;  3D2E A;  3UB5 A;  4CW7 B;  4UY8 O;  3PY8 A;  3O9U A;  4NCA A;  1HX1 A;  1TL1 A;  2P5G A;  4CEC A;  4CGI A;  4JI1 K;  4H0P A;  1NK8 A;  4CJE A;  2HNY A;  4A57 A;  3CJ7 A;  3I56 N;  3HXM A;  4AIL C;  2OTL N;  3P83 D;  4C8O A;  5AQG A;  2EX3 A;  3ZSZ A;  2YJE A;  5JS1 A;  1KTQ A;  2RPI A;  2NRZ A;  5MLC Q;  3AA4 A;  4PKI A;  3ZT0 A;  1SKW A;  5M1Q A;  1NMD A;  3HVR A;  4B1V A;  3S9H A;  2P9U B;  5J2P A;  3D2F B;  1WAF A;  4OLA A;  4U67 L;  2P9P B;  4FWR A;  2J4R A;  3OYB A;  3CCS N;  2VG7 A;  4CZH A;  2HMP A;  4FWP A;  3C6U A;  3T3F A;  4B3M K;  2O8C B;  1OH8 A;  4WF9 L;  3K2P A;  2ZQB A;  1E3M A;  4ELT A;  1B92 A;  4GY2 B;  4O8U A;  2QEX N;  2F8T A;  4AM7 A;  2E88 A;  4X66 K;  4M3X A;  3SQ2 A;  1ATN A;  5C10 A;  1QZ6 A;  3VEO A;  2IVN A;  3C6H A;  5DK5 A;  3VTH A;  3QIN A;  5CHI A;  4JRP A;  2Z1H A;  4CZG A;  3K5N A;  4QS7 A;  4KRE A;  3WXL A;  3OBW A;  3BZC A;  3U9D A;  4JHD A;  5EOY A;  4B9L A;  4FM2 A;  4CJ4 A;  3KZB A;  1EX4 A;  3S3O A;  1SKS A;  4JS5 A;  2PZS A;  1VQ5 N;  3BUZ B;  3CPE A;  1QHT A;  4YOR A;  1Z05 A;  2E1Z A;  1KRP A;  3O4W A;  4NYN A;  1NBW A;  5EXW A;  3VQC A;  4F2R A;  3HOT A;  3KIO A;  3OYH A;  1C6V A;  2RKI A;  2IS3 A;  2OPS A;  2D0O A;  4Z4I A;  3DJC A;  2W42 A;  4JYA K;  3M5R A;  3ZT4 A;  4KI4 A;  3G25 A;  3ZSY A;  4DFJ A;  3IKM A;  5DM7 L;  1RBS A;  4Q0B A;  1XNQ K;  2HHV A;  3ZSV A;  3TPQ A;  5TKY A;  2HHX A;  4LF4 K;  5KPR A;  4QAG A;  1DGK N;  3DAW A;  1Z6R A;  1UWB A;  2XY7 A;  4KB0 A;  3TU5 A;  2A3Z A;  4WQ5 A;  5JLH A;  3NGZ A;  1N33 K;  1FK9 A;  1BG3 A;  4FW1 A;  4ELU A;  2DPN A;  4FZX C;  3V9U A;  2A1R A;  1HQE A;  3ITH A;  3VQ5 A;  4JI0 K;  3CC7 N;  3O1B A;  3HI0 A;  1L3U A;  5AQX A;  4CZK A;  3GOI A;  4OVL A;  5HRR A;  4EHT A;  2HMI A;  4DSI A;  2Q36 A;  5AQR A;  2HHU A;  4W5N A;  5BRF A;  4IOX A;  3JAM O;  4CEB A;  1NJY A;  3DRR A;  1GLB G;  4H5T A;  4KKO A;  4BDP A;  2KQ2 A;  5C24 A;  4MO4 A;  3BDP A;  5GIO A;  3IG1 A;  4W5T A;  2P9N B;  1HPZ A;  3SQ0 A;  2FF6 A;  2QW9 A;  4KHY A;  2F96 A;  1NG9 A;  4EFH A;  1BIU A;  2XY6 A;  1RDU A;  3HVT A;  1WSJ A;  3L0Q A;  4HCB A;  3QO9 A;  4FJ5 A;  4FJ8 A;  3PV8 A;  4IO9 L;  4Y0W A;  5TKW A;  4O4G A;  1CZ9 A;  3THW A;  1QQO A;  2E4L A;  4OGC A;  1N5Y A;  3LWM A;  2CGL A;  3KK1 A;  1NJI O;  1X1P A;  2GWJ A;  1T8E A;  5EY4 A;  4DR4 K;  1LOT B;  4JK7 A;  4BR7 A;  4BC4 A;  3ALY A;  1NK7 A;  1YJW N;  4F4K A;  3EZW A;  3LAK A;  3VGK A;  1A5V A;  4RW8 A;  1RCH A;  4YDU A;  4DTP A;  1NJX A;  3H45 C;  3B8A X;  5C12 A;  3NGI A;  3SPZ A;  1S6P A;  4DF8 A;  3KWG A;  2HBK A;  5AZJ A;  3SAG A;  1MDU B;  2B5J A;  4LC9 B;  4CJW A;  1U04 A;  1N8R O;  2WC9 A;  2I5J A;  5C2D A;  4BC3 A;  4JI7 K;  3SJH A;  5GAD P;  4Y1D A;  4LFB K;  1IO2 A;  5EVZ A;  3ID8 A;  3ZSX A;  4OPJ A;  3LP1 A;  3O9S A;  4E3S A;  1S72 N;  4FVU A;  3O4Q A;  3AVG A;  3CPW M;  3VA0 A;  1ATS A;  4Z4F A;  5ADX H;  1ZC6 A;  4YOU A;  4JKH A;  3EL2 A;  3CCU N;  2W6L A;  5HBM A;  4DR1 K;  5AQI A;  3MXJ A;  1YTU A;  3MEC A;  2Q2R A;  1XC3 A;  5AJ3 K;  4JI3 K;  4LF9 K;  2NRV A;  2GBZ A;  2YNG A;  3JXU A;  4M7Y A;  4MO5 A;  4BG9 A;  4IOC L;  1N6Q A;  1X9J A;  1VQ9 N;  4KHN A;  4BR0 A;  3M8R A;  1JJ2 M;  3EO3 A;  4WFN L;  1RDC A;  2OYQ A;  5LJV A;  3O08 A;  1WOQ A;  3OS0 A;  4WQ4 C;  5FRO A;  4N47 A;  4FK4 A;  3SNN A;  4B1U B;  1LAW A;  4AM6 A;  3K5L A;  1GLD G;  3K9K A;  2JLE A;  2KW4 A;  3WT0 A;  2QKK A;  1JKH A;  3PSI A;  4B8A B;  3EY1 A;  1NJW A;  4J2A A;  5FPM A;  1XMQ K;  4XH5 A;  2KFN A;  2HHW A;  4K42 A;  1FXX A;  2XY5 A;  3N4Q A;  4I6M B;  1XMO K;  2PYJ A;  1IKV A;  3LPT A;  1J53 A;  4FCY A;  1VQ4 N;  2UUC K;  2BDP A;  2PFU A;  3O3H A;  1RTH A;  4DSF A;  1BO5 O;  1JCG A;  2YNF A;  3TR8 A;  4E7H A;  2P9U A;  2Z1I A;  3CJ1 A;  3D2F A;  5FDL A;  4B9Q A;  2CH5 A;  2G8V A;  3OYF A;  2XO7 A;  4BQZ A;  3J80 O;  2P9P A;  4GVE A;  1NK4 A;  3TAN A;  4GKK K;  5C0Y A;  3FZL A;  2OA8 A;  4IG0 A;  2P9I A;  4DTR A;  2O8C A;  4KB1 A;  2W41 A;  2UXB K;  2Z1G A;  1Q8I A;  3ZCM A;  4FJ9 A;  1WSH A;  3DLB A;  1S5J A;  4FWL A;  4A62 A;  3HPO A;  2YX6 A;  3QES A;  1JLC A;  1QHA A;  4M3R A;  3LDN A;  5KI6 A;  4BR5 A;  1O13 A;  3VEW A;  3A5L C;  5I9E B;  1RBV A;  4JI8 K;  4JKG A;  1BOT O;  5C25 A;  1RGI A;  2KZM A;  3J8A A;  3JYT A;  2KKZ A;  2UXD K;  1GLL O;  4WFA L;  1EP4 A;  4AHV A;  4DR6 K;  3SAH A;  4GV6 A;  3CER A;  3VMF B;  4DU4 A;  1T7P A;  1QSL A;  1RDA A;  4JHD B;  2PY5 A;  4L8R B;  3CXC M;  4FLU A;  4DFP A;  2BUP A;  4QS8 A;  4I9L A;  5JS2 A;  4JI4 K;  3GBT A;  2GUP A;  4E89 A;  4FWS A;  2D5R A;  3OTO K;  3TAE A;  3HYF A;  4LY7 A;  3O3G A;  2NRR A;  4KH5 A;  1W0H A;  2A5X A;  4CVN E;  3KKS A;  4CHO A;  3ENB A;  1VSD A;  1YF5 L;  4NLC A;  1S1X A;  3VQ7 A;  2HVH A;  1BCO A;  3EE9 A;  1VQ8 N;  2G8W A;  4CBX A;  1QQC A;  4OKE A;  2AP1 A;  2VG6 A;  3LPU A;  5AZI A;  4DSJ A;  2ZGY A;  1WN7 A;  3CQ8 A;  1NWK A;  3K0S A;  3HRG A;  3HOS A;  2P1J A;  3LM9 A;  3KD1 E;  4RG8 A;  3NF7 A;  2BTF A;  4FJ7 A;  4IEI A;  5D3G A;  4B1X B;  4B1W B;  1XC9 A;  3SV4 A;  1UAX A;  2OPQ A;  4LF5 K;  3VEN A;  5M1N A;  3G0Z A;  3KLE A;  1HNW K;  3HL8 A;  3DXK B;  5AQK A;  2A42 A;  4OX9 K;  2E6L A;  4YOY A;  3MAQ A;  3S3N A;  1A5W A;  1C0T A;  1IBM K;  1DEJ A;  3CFO A;  1Q9X A;  3BY5 A;  1JXB A;  3KHY A;  3DWL A;  3TAR A;  3GL1 A;  5M1K A;  3LAN A;  2CH6 A;  1WAJ A;  5E84 A;  5FPE A;  4DV4 K;  4EZ9 A;  4J2D A;  1K9M O;  3MXI A;  4E1N A;  2HOE A;  4DKW A;  3O9R A;  4CJK A;  3VQQ A;  3SJJ A;  5CZ2 A;  4B9U A;  2B6A A;  1T03 A;  4BWM A;  1QVF M;  1ZBL A;  4XEI A;  3MN5 A;  4ILH A;  1TAU A;  2QWL A;  1NNE A;  2UUB K;  4I9Q A;  1L5U A;  1C1B A;  3J7Z O;  1C0F A;  1U48 A;  2ITG A;  3CCE N;  4LFA K;  4H0X B;  4IFV A;  4O0I A;  1ASW A;  4CGJ A;  4PUO A;  2D0C A;  3FFK B;  3CFR A;  4U7B A;  1LW0 A;  2IIR A;  3VTI A;  1IG9 A;  3CD6 N;  4B1Z A;  1VQ6 N;  1ITG A;  4NXN K;  3VGM A;  1WLJ A;  1QTM A;  5AZJ B;  1S6Q A;  3THX B;  1QE1 A;  4CJT A;  1C1A A;  3H6E A;  3P5J A;  1KVC A;  1KQS M;  3JS6 A;  3WXJ A;  4BRO A;  4C8N A;  3CYM A;  1U2V B;  2FBV A;  2W6K A;  4RTF D;  4M3T A;  1T44 A;  2ASM A;  3PO5 A;  3QIP A;  2HHH K;  1KSP A;  3F9K A;  4DB3 A;  1SV5 A;  4E7K A;  2YHB A;  4DV5 K;  4FM0 A;  3SCX A;  2I7P A;  3QDK A;  3O80 A;  4FOI A;  4MLE A;  4C8M A;  1KVA A;  4LF8 K;  4H0O A;  2FF3 B;  4CJQ A;  3PIO L;  4KAZ A;  4BR9 A;  1KFD A;  3KK2 A;  1IBL K;  3DLH A;  4QOZ B;  2D0P A;  4FW2 A;  4M63 C;  3L2Q A;  5DMR A;  3QIO A;  2VG5 A;  3HST B;  1SQK A;  3P1G A;  1BL3 A;  3V1O A;  3MDQ A;  3QEW A;  3FLC O;  2QK9 A;  2IGI A;  4MDA A;  4CF2 A;  1L3S A;  3FGU A;  5BPN A;  4CGF A;  2HHQ A;  4G1Q A;  4CJL A;  4CHY A;  3VQA A;  3VEX A;  4H4O A;  3L3V A;  1YHQ N;  1ZBH A;  1RT6 A;  4CCH A;  4JK9 A;  3WNE A;  3AO1 A;  4KHU A;  4XH4 A;  1NJZ A;  2HF3 A;  4AF1 A;  2NNW A;  1BCM A;  3VQP A;  4BRN A;  4I6M A;  2NRW A;  2DY4 A;  3AO2 A;  3F73 A;  3MX2 A;  1HYS A;  2A1S A;  3UKU A;  3CC2 N;  3NVM A;  3NF8 A;  3VF2 A;  3B6P A;  3VF6 A;  4CHN A;  3VOV A;  3MX5 A;  4KTQ A;  4Z4C A;  1HLU A;  1UA1 A;  3OS2 A;  4DFM A;  5ADX A;  4IDK A;  4DTX A;  1NK0 A;  1T3V A;  4HCC A;  5BN9 A;  3ATU A;  4OGE A;  4R79 A;  5IWA K;  1YT3 A;  4K25 A;  4DG1 A;  1HNZ K;  2Q31 A;  2YHY A;  3CJC A;  1KLM A;  1EWR A;  2P9I B;  5AQV A;  4DUZ K;  3T1A A;  4JI5 K;  1TV6 A;  1HJO A;  4CGG A;  3I8D A;  3CJ9 A;  1BHL A;  2HST A;  3DRP A;  3DXM A;  3RR8 A;  4M3W A;  1Q82 O;  1ZXO A;  1S1V A;  3I0S A;  3TAB A;  4DLG A;  2BE2 A;  3FZF A;  2BAN A;  3RWU A;  3AVB A;  4KRF A;  1S1W A;  4FZY A;  1RT2 A;  4KI6 A;  4JKG B;  4DV6 K;  2IVP A;  4B3O A;  3LDL A;  2XY8 A;  4BRG A;  5M1F A;  3DLL L;  5AQY A;  1V4T A;  3K9J A;  4IBN A;  2PBD A;  5FPD A;  2ZGZ A;  3HJF A;  4PL8 A;  4B8C A;  1I94 K;  3KJV A;  1OVQ A;  3TWH A;  3UIQ A;  5BR9 A;  3K57 A;  3QEV A;  1K73 O;  5HRS A;  4FL9 A;  1KLN A;  3THV A;  1ZBI A;  3PIP L;  2E2N A;  4PKH A;  4JKA A;  1UOC A;  4WQ4 A;  1S9G A;  2O8B B;  3T1H K;  3AVA A;  5GAE P;  3D45 A;  2WTU A;  3OJU A;  1TK8 A;  4JKD A;  4RWT A;  1VQN N;  1HNI A;  3OJS A;  4DV7 K;  4KO0 A;  2YV0 X;  1L3V A;  2BGG A;  1FJG K;  3R3L A;  4C1N I;  1N34 K;  1ATR A;  5GAH P;  2VCP A;  2VQE K;  4JI6 K;  2A6A A;  3DRS A;  2YCH A;  4PA1 A;  4W5O A;  3DMJ A;  3AAP A;  1VSL A;  3C6A A;  4F3O A;  1TUU A;  2FLO A;  1K8A O;  4KV8 A;  4CJ7 A;  5AZI B;  2ZJR L;  1WSE A;  3I8B A;  2WON A;  1KVB A;  1GLF O;  1YI2 N;  4HHT A;  2F4V K;  2D0B A;  5T7B A;  1NGA A;  2FBT A;  4C8K A;  5JVG L;  1EWQ A;  3WXI A;  4DTM A;  1XHZ A;  2G8F A;  4AHC A;  4FLZ A;  4JKC A;  1YJ9 N;  5KTQ A;  2X6S A;  3DXK A;  4DUY K;  4FJH A;  2VWJ A;  5LL6 Z;  4K41 A;  5IT9 O;  1TKT A;  3VQ4 A;  3A2F A;  4CE9 A;  2NZT A;  1BGX T;  4ICL A;  2O8D B;  5BRH A;  2ITM A;  2B4J A;  4E19 A;  1ZBS A;  2QWR A;  1G15 A;  3RMA A;  4JK8 A;  3AV9 A;  1VSE A;  3DLE A;  3O1W A;  2JWK A;  5AQJ A;  3H3O B;  1NLV A;  3K5O A;  3V9W A;  2XHB A;  4Z0U A;  3I0R A;  4KHS A;  4W5Q A;  1GLJ O;  4O0J A;  1U47 A;  1EXQ A;  1NGC A;  3LM2 A;  2ZM6 K;  1VRU A;  4WE1 A;  4CEO A;  4CK1 A;  2VYP A;  2ZWH A;  1OH5 A;  2RF2 A;  4EAH D;  3M8S A;  4C8L A;  2HHT A;  2FXU A;  3SUP A;  3LP3 A;  2OCE A;  3QNO A;  4CED A;  4FK2 A;  4H0Y B;  3H1Q A;  5AQU A;  3OYG A;  2X74 A;  1VSJ A;  4B3T K;  3P4I A;  4CHZ A;  2E1Y A;  3IAY A;  3ZSO A;  3QEI A;  5CYQ A;  3W0L A;  2DTU A;  1TYQ A;  1KCF A;  4ILG B;  1M90 O;  4CHQ A;  3Q7B A;  3E9O A;  3SQ4 A;  4CGD A;  3SUO A;  3NCI A;  4AHU A;  4JI2 K;  3QNN A;  1GLC G;  2IAJ A;  2RE2 A;  3KK7 A;  4WYB A;  3C95 A;  3THX A;  1HUX A;  3LDS A;  3ATV A;  2YNI A;  4O5B A;  3T7Z A;  2YNH A;  2Q1N A;  2QWP A;  4KPY A;  4DU3 A;  3OYM A;  3LP2 A;  1U2V A;  4XH1 A;  3AVN A;  3THY B;  1O1W A;  4C23 A;  2GEL A;  2FSN A;  1NK6 A;  3SUN A;  1RDB A;  4CD1 A;  4DTO A;  4WCE L;  4A5B A;  5CR4 A;  3UKR A;  3TTF A;  4CFD A;  4CEZ A;  4CK2 A;  5AQW A;  5HRN A;  3HPH A;  4PHT X;  2FSJ A;  3WNF A;  4FWO A;  3EKS A;  2P9S B;  1EET A;  4N76 A;  3IRX A;  5KRS A;  5C2F A;  4J2E A;  1Q7Y O;  3QFU A;  3NHG A;  2O8F A;  4HVJ A;  3BF1 A;  3AA5 X;  3NH0 A;  2VGN A;  4IWV A;  1CXQ A;  1I3A A;  1TAQ A;  3AY9 A;  4FM1 A;  1FKP A;  2GV9 A;  2QA4 N;  4MDB A;  1XNR K;  4F3T A;  2BH1 A;  3RRG A;  1ESV A;  1BI4 A;  4YNQ A;  4FYD A;  2HBM A;  3U3Y A;  3EKU A;  1MWM A;  1VK0 A;  3CMA N;  3EYZ A;  3ID6 A;  4F9O A;  1Y64 A;  1C1C A;  3AAR A;  3IUC A;  2UU9 K;  4JN4 A;  1WSF A;  3UKU B;  3PSF A;  1SS6 A;  4BC2 A;  4H5W A;  4O44 A;  4FJI A;  4CF1 A;  3ZYY X;  4H0T B;  3EEQ A;  3CQX A;  5KQD A;  2WUS A;  1P90 A;  4CFB A;  3T1Y K;  3A5N C;  1VSH A;  3AA2 A;  4G9Z A;  3LAM A;  3J7Y P;  1K8K A;  3HP6 A;  2DFH A;  2VWB A;  2YI1 A;  2KTQ A;  3DLR A;  2P9K A;  4TSX A;  5AQT A;  1WB9 A;  4DV2 K;  1RTI A;  4FSV A;  2FBX A;  4BGA A;  2FC0 A;  4LH4 A;  4DQS A;  3KK3 A;  2VGM A;  2E2P A;  2LSN A;  1HNX K;  1WUA A;  1MWK A;  3R6M A;  1C0M A;  3L4Q A;  5LJW A;  3DXM B;  3AO5 A;  4HTL A;  1OVY A;  3V81 A;  1D9D A;  3A0I X;  1HJR A;  3SMS A;  3E1Y A;  3HSC A;  5AQZ A;  3ULE B;  1VQ7 N;  4JNE A;  2JWL A;  3OHR A;  1DTQ A;  2O8E B;  5GIN A;  3MXM A;  3CC4 N;  2HW3 A;  2P51 A;  4I7F A;  3SBG A;  4NCB A;  5AQM A;  3K59 A;  3U4L A;  2ZE2 A;  4A61 A;  1M1K O;  5F1X A;  5CE3 A;  4GV9 A;  2NRH A;  3H1V X;  1IJJ A;  3AVM A;  2P9L B;  4FPA A;  3I55 N;  2O8B A;  4CFA A;  2E2O A;  2ZJP L;  3FZM A;  4KHW A;  2YHX A;  3HK2 A;  4YFU A;  1NU0 A;  3NGY A;  4BRA A;  4BRL A;  3L6Q A;  1TKD A;  1QQN A;  4EZ6 A;  2F9T A;  3NMU A;  2KLA A;  4GV3 A;  1P8Z A;  3NAE A;  4GNI A;  3MK6 A;  3TTD A;  1K6Y A;  3A5M C;  4DV0 K;  5KGW A;  3QEX A;  4BVP A;  4CJ3 A;  2HND A;  1J9A A;  2NRT A;  3AA3 A;  5I42 A;  3BF3 A;  4ELV A;  3U6F A;  2ZD1 A;  1KC8 O;  5AQQ A;  2D0A A;  4IJA A;  1XUP O;  2NRX A;  3M1F A;  1YVU A;  5GAG P;  5C15 A;  1DT9 A;  2NUB A;  4JAX A;  3AVK A;  3MCP A;  3OYN A;  1IKW A;  3AGR A;  1WSG A;  4OPK A;  3Q7C A;  3T19 A;  3K5M A;  4IFY A;  2A41 A;  3HPG A;  1HKC A;  5AQS A;  1IKY A;  4JV5 K;  3AVJ A;  5B8H A;  4AHS A;  1RBR A;  4OKJ A;  4DSE A;  3HZ6 A;  4FLX A;  1QS4 A;  1VSM A;  4OLB A;  4DLE A;  2O8D A;  4Z4G A;  3DLG A;  1EO1 A;  1YVN A;  3ZX3 A;  2OPP A;  3ZSR A;  1H1V A;  4BR2 A;  3SYZ A;  1TGO A;  1C0U A;  1NGB A;  3C7N A;  1S9E A;  4L3Q A;  1MU2 A;  4CIE A;  3G71 N;  4DQP A;  4FJN A;  4PY5 A;  1BIS A;  3CJA A;  1NOY A;  3S41 A;  1RT4 A;  4HTU A;  3ZSQ A;  2HBJ A;  3WXM B;  5E41 A;  1YUW A;  5M1O A;  5AQL A;  3WNH A;  3OYC A;  3A8Y A;  3SPY A;  4RW4 A;  4DF4 A;  1RIL A;  3IFR A;  4JRQ A;  4LSL A;  4FLY A;  1FKO A;  3VER A;  2V52 B;  4NYF A;  4DHY A;  1KAY A;  1V4S A;  3FZK A;  5HLF A;  4CJS A;  3MWP A;  2ASO A;  3O5B A;  3HTV A;  2G8H A;  3H08 A;  4NLB A;  4CER A;  1W97 L;  1HYZ A;  4KH4 A;  3D0P A;  1W7A A;  4O8K A;  1Q81 O;  3TAM A;  3CM5 A;  1JCE A;  1TYQ B;  3E66 A;  2IOC A;  4B9T A;  2RN2 A;  3NH2 A;  3KD5 E;  3R9P A;  4DQR A;  4FWM A;  4DFK A;  1HYV A;  1RT1 A;  4K8X A;  3GDQ A;  3TSQ A;  2QKB A;  5KGX A;  3RMB A;  2X6N A;  2E20 A;  4MFB A;  4DWI A;  4GKJ K;  1GOB A;  4J8F A;  5C42 A;  4JEP A;  3O9T A;  4BRK A;  3THY A;  1U4B A;  3WQU A;  3PX4 A;  3QBW A;  4CBU A;  2GUI A;  5JIC A;  5FRM A;  4IJN A;  4BRQ A;  4JLH A;  3ZT1 A;  4K43 A;  1TUY A;  1NKB A;  3ENO A;  4MQ3 A;  5BN8 A;  1YIT N;  1Z25 A;  3E9L A;  4FXD A;  1IG8 A;  1LWF A;  3J7A P;  3SQ1 A;  2OAN A;  1ASU A;  3O4N A;  3UKR B;  2P9S A;  2WFB A;  3IMX A;  4BDY A;  3L3U A;  1J6Z A;  4YHH K;  3DOK A;  1IKX A;  3VQ8 A;  3L2W A;  4CJV A;  3HT3 A;  3KLF A;  4BRH A;  4FWK A;  3NH1 A;  3WXK A;  2DFF A;  5KRT A;  4DR2 K;  3K58 A;  3S3M A;  3CM6 A;  4N5S A;  4O55 A;  3V4I A;  5CY4 A;  3RSE A;  1HKG A;  2O8F B;  1IV0 A;  3LDP A;  3NF9 A;  4B3S K;  4FLW A;  3O8M A;  3V1Q A;  3G10 A;  1ZYQ A;  4UQG A;  3NFA A;  3CCJ N;  1VSI A;  1SL0 A;  2UXC K;  3ZX0 A;  1BI4 B;  1XWL A;  5AR0 A;  3IS9 A;  4BRF A;  3AVH A;  1TK5 A;  3DYA A;  4DCH A;  1TKX A;  4NCG A;  4CHP A;  4B9S A;  1JLF A;  3VQB A;  1NK5 A;  1GOC A;  4GVM A;  2KZZ A;  3VEV A;  4M3Y A;  3LAL A;  1S1U A;  3MMV A;  1TVR A;  1DLO A;  4QCL A;  4JD2 A;  4HWI A;  4JKB A;  4AHT A;  4KH6 A;  5FLX O;  1BQN A;  2E2Q A;  3OYL A;  3CIP A;  3OS1 A;  3AVL A;  3TI0 A;  1KD1 O;  1T6C A;  3F5T A;  4FK0 A;  4ISG A;  4FJJ A;  1K8K B;  2I7N A;  2V7Y A;  3HBT A;  3ZEU A;  3LWL A;  2P9K B;  3DOL A;  1DKG D;  3KLI A;  1LV5 A;  2D1K A;  1NMN A;  1YXQ A;  4LF6 K;  5JVH L;  4K0K K;  3ULE A;  3ZSW A;  4CFC A;  3WEE B;  4LD0 A;  1VQO N;  3NBP A;  3SV3 A;  4FOE A;  2O8E A;  1OH7 A;  4E1J A;  4FWN A;  1HPM A;  3CHW A;  2IDO A;  3MWT A;  3ZLJ A;  4CZL A;  3GG4 A;  4RCH A;  4A5A A;  1X3M A;  2QXL A;  4CES A;  4M3U A;  1LW2 A;  3SUQ A;  4KTZ A;  5F2R A;  3VA3 A;  4DQQ A;  1YTA A;  2P9L A;  2QWM A;  3MEE A;  3U9Z A;  1BA1 A;  5H1S Q;  3ASM A;  4FJM A;  3V9X A;  3EE8 A;  3ENH A;  4NB4 A;  3QFP A;  2QWQ A;  5AFU H;  5ELZ A;  1EQY A;  2OPR A;  5FPN A;  4X65 K;  5LY3 A;  3RR7 A;  3O9Q A;  3SK3 A;  4C1N K;  1VRT A;  1VQL N;  4XIU A;  5LMN K;  2EWS A;  1GOA A;  1JLB A;  4E0D A;  1X9S A;  4IEE A;  2AA4 A;  4A2B A;  3CI5 A;  3CF5 L;  2EHG A;  3L2R A;  3OYI A;  4DTU A;  4YOT A;  3EZ5 A;  3MN7 A;  3QIC A;  1RT5 A;  5A2Q O;  1E4G T;  3DLK A;  1TKZ A;  4CZE A;  4EHU A;  3F9M A;  3ZET B;  4E1M A;  3H3N O;  4JKF A;  4BE1 A;  2Y1I A;  3KKR A;  4CBW A;  3D7E O;  3RTV A;  3KTQ A;  3AO4 A;  4I2P A;  3EN9 A;  4DMN A;  4B1Y B;  3OYA A;  4DU1 A;  1NM1 A;  2E5L K;  2UYT A;  3OBY A;  4ISF A;  1Q9Y A;  4AHR A;  3E9P A;  3OYK A;  1NKC A;  3G6E N;  3VPZ A;  4DTN A;  1QVG M;  1JLE A;  3J81 O;  2O4G A;  2CGK A;  2GWK A;  3U8X A;  3RRH A;  3CJB A;  3C7N B; 
#chains in the Genus database with same CATH homology
 4X64 K;  4OX9 K;  1XNQ K;  4DR7 K;  4B3T K;  4LF4 K;  4JI7 K;  1IBM K;  4NXM K;  3T1H K;  4LFB K;  3T1Y K;  4V19 S;  3J7A P;  4JI8 K;  3J7Y P;  4JV5 K;  1N33 K;  2UXD K;  4DV7 K;  1N36 K;  4YHH K;  4JI2 K;  1J5E K;  4DR6 K;  4DV2 K;  4DR1 K;  1FJG K;  4LF7 K;  4JI0 K;  1N34 K;  5AJ3 K;  4DV4 K;  4JI3 K;  4LF9 K;  2VQE K;  4DR2 K;  4JI6 K;  1HNX K;  3JAM O;  4X65 K;  4B3M K;  4K0K K;  4B3S K;  4JI4 K;  5LMU K;  3OTO K;  5LMN K;  2F4V K;  2UUB K;  4X66 K;  1IBK K;  2UXC K;  5IWA K;  4CVN E;  1HNZ K;  2VQF K;  4DR3 K;  4LFA K;  1HR0 K;  4DUY K;  5A2Q O;  1XMQ K;  5LL6 Z;  4DV3 K;  5IT9 O;  2UUA K;  4DUZ K;  4LFC K;  4JI5 K;  4NXN K;  4DV1 K;  1XMO K;  1HNW K;  4AQY K;  4DR5 K;  4DR4 K;  2UUC K;  5FLX O;  1N32 K;  1XNR K;  2HHH K;  2E5L K;  4B3R K;  4DV6 K;  4DV5 K;  4KHP K;  4X62 K;  2ZM6 K;  3J80 O;  4DV0 K;  4GKJ K;  4LF8 K;  4GKK K;  4JYA K;  4CW7 B;  4LF5 K;  1IBL K;  5BR8 K;  1I94 K;  4LF6 K;  3J81 O;  2UU9 K;  4JI1 K;  4YY3 K;  2UXB K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...