5IWAK

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
115
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
total genus 25
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2016-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 5iwaK00
5LMUK 4NXMK 5FLXO 4DV4K 4DUYK 4CW7B 5AJ3K 4DV0K 4JYAK 4OX9K 3T1HK 4DV3K 4JI7K 4K0KK 4LFBK 2HHHK 4DR2K 4DR7K 4B3MK 4YY3K 4B3TK 4DV1K 4DUZK 2UUBK 3OTOK 4B3SK 4LFAK 4NXNK 4JV5K 4JI1K 4LF4K 1I94K 1HNWK 2UXBK 4LF6K 4LF5K 4X65K 2UXCK 1IBMK 1N34K 4LFCK 5LMNK 1XMOK 4LF8K 4JI5K 4X64K 2VQEK 4CVNE 4B3RK 1FJGK 4JI6K 4DV2K 4X62K 4JI3K 4DR3K 4DR5K 3J81O 3J7YP 3T1YK 4YHHK 4KHPK 5IT9O 1HR0K 2ZM6K 4DR6K 2VQFK 5LL6Z 4DR1K 4LF9K 3J80O 2UXDK 4DV5K 4JI0K 4JI2K 1IBKK 2UU9K 1N32K 4LF7K 1N33K 1IBLK 2UUCK 4V19S 1XNRK 2UUAK 1XNQK 3JAMO 4JI4K 5IWAK 5A2QO 3J7AP 5BR8K 4AQYK 1XMQK 2F4VK 4JI8K 1N36K 4DV7K 2E5LK 1HNZK 4DR4K 4X66K 4DV6K 4GKJK 1J5EK 4GKKK 1HNXK
chains in the Genus database with same CATH superfamily
1GLDG 3O5BA 5M1OA 1U45A 4PL8A 4FJXA 2VGMA 4OPAA 1N6QA 4KI6A 3RMDA 3OA9A 4B08A 3OYMA 1BCMA 4K43A 5FPNA 3AO3A 5BR9A 1U2VA 1KD1O 2IVNA 3AO5A 3OYEA 1JLQA 3OYJA 2HMPA 2YHYA 4DFMA 1NK9A 4F3OA 4KHQA 2YJFA 3QFUA 3O4WA 4CZIA 4DR7K 4IG3A 4CZGA 4YY3K 1QSLA 4ID1A 3SNNA 3ASMA 5BPMA 1ZBSA 2KLAA 4FLVA 2P9UA 4LH4A 1NKEA 3KK2A 3TTCA 3D0PA 1RBTA 4O44A 3CCEN 2EX3A 1GOBA 1MU2A 4JN4A 4IEEA 2ATQA 4H8KA 1S72N 4JS5A 1VQ9N 1S1XA 3O08A 3A5LC 2JLEA 3LDPA 1RFQA 4PKHA 1RBVA 1TUUA 5DK5A 3G71N 3UKRA 2BUPA 4X62K 2KZMA 4IKFA 2GUPA 3J7YP 2Q97A 1S3XA 3IUCA 3U9DA 3AVHA 2VQFK 3K5OA 1G99A 5CYMA 4RG8A 4WQ4C 2QEXN 4QAGA 4A62A 1MDUB 1NLVA 4AHVA 4LF7K 4Z94A 1E4FT 4MDBA 4L3QA 4BRKA 1X3NA 1OH5A 3THWA 3VQEA 1UWBA 3DRRA 5J1EA 1VSHA 2ZWHA 5TKYA 1WAFA 5GAEP 3ULDA 1T8EA 1MWMA 3P4IA 3O9SA 5C10A 3LDOA 1J6ZA 3J7ZO 4IWVA 4WFAL 1KAZA 3CYMA 5I42A 2D0OA 4BR0A 3TWHA 2O8DA 3AARA 3ZX3A 2E6LA 2A41A 5JVGL 2NRXA 3AVFA 2AJQA 3AA2A 4AH9A 3A5NC 1KCFA 2Z1HA 1WSJA 2FSKA 1NOYA 2ASPA 4DUYK 2RPIA 4E7IA 1CLQA 4ZTJA 2XRIA 4JKHA 5DM7L 3IRXA 3SMSA 4FSVA 4FVMA 3MXMA 2Q36A 4FWNA 5CY4A 3MWPA 4B3MK 3MX5A 1YTAA 3OBYA 3R1XA 3EL2A 2UUBK 4U67L 2EHGA 4K42A 4YOUA 3K9KA 3CCVN 4G1QA 4FJLA 4I6MB 4DFPA 3I56N 1EP4A 2XY5A 1BQMA 1ATRA 1QZ5A 2I7PA 2HHWA 1QQCA 4IOXA 4IG0A 4LF5K 4E0DA 5FDLA 5KPRA 3OW2M 4PQUA 4JAXA 5AQTA 3VGKA 3VQ6A 5GIPA 1ZBHA 1B92A 3GBTA 4RW4A 4KFBA 1RBSA 5DMRA 4M41A 4OO1J 4M7YA 1VHXA 4DTPA 3UKUA 4BC2A 4HWIA 4CEFA 3QICA 1EQYA 2A3ZA 2E1YA 4BRIA 1S9GA 1ZXOA 2GWKA 3EKUA 2G8HA 3DXMB 1X9WA 5AQLA 3LDQA 2O4GA 4BRPA 3TSPA 4ELVA 1YJNN 3EZWA 3J8AA 4CHQA 4FW1A 3F9KA 3SMPA 3F9MA 3SQ0A 2PAVA 3HK2A 1JXEA 2QTDA 1R0AA 3IG1A 2QK9A 3OJUA 3VEVA 4FJ5A 4DSFA 3O8MA 1WSHA 1NM1A 4IOCL 4CJ7A 3TAPA 1RT7A 2UUAK 4J2DA 2WUSA 3NF7A 1DGKN 3FE1A 2DY4A 1LAVA 4DF8A 4NYNA 4FLWA 4JKBA 1XMQK 1C1AA 5KGXA 2FBVA 2YHAA 1JCEA 1KVBA 4J2BA 3EEQA 4DV7K 1K73O 4XH1A 1BA1A 4CHNA 3OYHA 2HW3A 2P5GA 4IO9L 5T7BA 4DQIA 2ASOA 4RTFD 2FBYA 4IFVA 3D2FA 3I0RA 4KRFA 3A5OC 3SBGA 1SKSA 1T7PA 3JS6A 5AJ3K 1RT2A 2P9LB 4K8ZA 1U04A 3L0QA 3MEDA 4OVLA 3CCMN 3VENA 4RCHA 4JK9A 3ZYYX 4DTMA 3VOVA 4BQZA 4C1NI 3L8BA 4BDYA 2X74A 1X9MA 1W7AA 4WQ5C 2CH5A 4CCHA 2FBTA 1VQ6N 3CD6N 4JKAA 3DMJA 1RDDA 2RKIA 1L3SA 3SQ2A 1VK0A 1JCFA 3K57A 2G8FA 2P9NB 4CGDA 2YCHA 4CHYA 1HKBA 4DTRA 3VEYA 1SAZA 5J2PA 1KAYA 3ATUA 5AQYA 4C1NK 3C6HA 3ZEUA 2A1SA 3AA5X 1EETA 1KSPA 4YDUA 2GX9A 1BU6O 5J2QA 3QERA 4FJHA 4B3RK 1HJRA 1BI4B 4DV2K 2O8EB 1VSEA 2CGKA 1A5WA 3IFRA 1D4XA 3AO1A 3VERA 1SKRA 1YVUA 2KKZA 4DR6K 2IGIA 4LF9K 1VQ5N 2HHVA 3P38A 1LAWA 3ULEB 5I3UA 4DV5K 3SJJA 2DFHA 4AHTA 1BG3A 4OJRA 3AVMA 2YX6A 1OH6A 2E4LA 3PO5A 4IOAL 1RDUA 2HNYA 3EYZA 1VRUA 3GG4A 4BE2A 3FZFA 5AQZA 1JLAA 1G15A 3WXKA 4DU4A 4KBOA 5BRFA 3HJFA 4AHUA 5AQFA 1GOAA 3WUHA 4JI8K 3PUFA 4BQLA 1TAQA 3L2WA 2E5LK 3L2VA 1NKCA 2RE2A 3M6GA 4JLHA 1HYVA 3VQ4A 4CFAA 3F2KA 2ITGA 4CEQA 4JRQA 3OYNA 4XH4A 1S1VA 2ZJQL 3SUQA 4KHUA 1HMVA 1NK8A 1J9AA 3NH1A 4DV3K 1RILA 3QLHA 4K0KK 4LFBK 4H0YB 4HUEA 1BQNA 1SKWA 3HOSA 3QEIA 4IJAA 3OS0A 4ELUA 3LZJA 4JKGB 3O80A 4CD1A 2GUIA 3HT3A 2YNGA 4DSLA 2CH6A 2Q1NA 1H1VA 3AGRA 4IXCA 4N41A 3KZBA 5C15A 2HB5A 3DLGA 3THVA 5AQWA 1BL3A 4JD2B 4CF9A 3AY9A 2UXBK 4I9QA 5LJVA 1QSSA 2P9SB 4IJNA 3EZ5A 3QO9A 3M5RA 4F2SA 4CGGA 4UY8O 2DPNA 3CI5A 1Q8IA 3VN5A 3E01A 5M1FA 3CJAA 2P9IB 2A40A 3M8QA 4CZKA 4CD3A 5AQSA 3V81A 5AQPA 4KAZA 4FWOA 5AZIB 4AHRA 4JI3K 1TUYA 1RT4A 3KK3A 2PBDA 5BPLA 3VPZA 3TAQA 3NCIA 1VQLN 3K0SA 1KFDA 4KH5A 4B9LA 3AA3A 4QS7A 3CXCM 3MEGA 1TKDA 1NGHA 4JI2K 1T44A 3HM9A 1CZ9A 3O4NA 3L2QA 4CJSA 2HNDA 3TAGA 2G8VA 5AQGA 3HSCA 5JS2A 3P83D 4CE9A 4Z4HA 2OA8A 3AO4A 4YDUC 3DRPA 4PKGA 3QNOA 4AQYK 3WNEA 4DSKA 5AQMA 2F4VK 3T7ZA 2AP1A 2FC0A 4M3UA 3RMBA 4IBNA 4CZHA 5FPMA 2ASMA 1S6QA 4KH6A 4BRCA 4CJRA 4Q5VA 1YI2N 1HX1A 4CFCA 3JYTA 2ZE2A 4CJKA 4DQ8A 3K59A 1YITN 3V9XA 1WB9A 4JYAK 3CC2N 1NK5A 1WSEA 1QVFM 5AQJA 4DTOA 3MAQA 3OBWA 4AHSA 4CIFA 5HROA 4PKIA 3KLGA 3OTOK 3QEVA 3CJ7A 2O8CB 4NXNK 1RTIA 2GBZA 3O9QA 2PZSA 1TAUA 4JV5K 3VESA 2G8KA 5AFUA 2OPRA 4CJWA 1KC8O 1L3TA 3ZSXA 2X6SA 5F2RA 3TARA 3DLLL 1UA1A 2YI1A 4E7HA 4BRHA 2OPQA 4A2BA 3HVRA 3CJ9A 3VQBA 1TL1A 3QFPA 3E9PA 1SZ2A 1N5YA 3L2RA 4BRGA 2V51B 3C7NA 2VQEK 3VTHA 4MFBA 2P9PA 4FK2A 4WQ4A 2OZMA 2NRVA 4BRDA 5SZTA 1LWCA 3NBPA 3PY8A 1RTHA 2E1ZA 1NK4A 4JKCA 1NJZA 1JL1A 4BGAA 2WC9A 1HKGA 1HNVA 2QWMA 4H0XB 5AZJB 3SAHA 1IBKK 4KV8A 1U47A 3KHYA 2A6AA 2UYTA 4CF8A 1X9SA 2D5RA 4EAHD 2P9KB 1Q86O 4CGJA 4E7JA 2HNZA 3BEXA 3OHRA 3QNNA 5CYQA 1NGAA 4CFDA 1Q7YO 3H1VX 5F0XA 5J2MA 1RT5A 4BREA 2ZQBA 3C95A 3RRHA 3QDKA 2NNWA 3NF9A 1NGJA 4FWSA 3VQ8A 1BUPA 3HO1A 2W40A 5BRDA 2G8WA 4DV6K 1D8YA 1U2VB 3VF2A 5LY3A 3HP9A 5AQKA 4JHDA 1IKYA 5B8HA 1ZYQA 2O8BB 1KAXA 1EKEA 4FJMA 4B1ZA 2BH1A 3ZETB 3OS1A 1REVA 3ZSOA 4H5WA 4FLZA 4CZLA 1GLJO 4KPYA 4B3TK 3HXMA 4R79A 2RF2A 2O4IA 1LWEA 3I33A 4DSJA 4DKWA 4OPKA 4DSEA 1Q18A 4EIAA 3QIOA 3MN7A 3U8XA 3A2FA 3V9UA 2KFZA 3TAFA 4FK0A 1WBBA 3VQ9A 3KJVA 4FJ9A 2GEMA 3VEZA 4O4GA 2WONA 4QCLA 4Z4FA 4CF0A 3LP0A 2ZD1A 4O5FA 1NK6A 4KREA 4OGEA 3CCRN 3B6PA 4DLEA 1UOCA 3A8YA 1YJWN 3H08A 3C65A 1T6DA 4NCBA 4EZ6A 1DKGD 3ZT1A 1K8KA 5EU7A 3LDLA 1S1WA 4CEEA 1S9EA 4DTSA 1J54A 4BC3A 4MDAA 3THWB 2XY7A 3WEEA 3TAEA 3OYCA 4FM2A 4JI0K 3HSTB 1TKXA 1FKOA 3THXA 3D45A 5AQQA 1NK0A 4RW9A 3AVLA 1Q81O 3CQ8A 3L4QA 2O8DB 3BGRA 3ZSWA 4H03B 1YHQN 2VG6A 4CJVA 5EX5A 4CHZA 2HF3A 4GV3A 2Q0UA 3UIQA 4JS4A 3PO4A 2HSTA 3EO3A 1IV0A 4CJTA 4BWJA 2X78A 4GV6A 2B4JA 4YFUA 1VQON 1JCGA 3F5TA 4CJLA 3W0LA 1I39A 2D0AA 3NAEA 3LP2A 3MN6A 4GVMA 4F2RA 4GKKK 4KTWA 5CZ2A 5LMUK 3VEXA 3HM8A 1IJJA 1U4BA 4B1UB 4BDPA 3ZT4A 2YHWA 4H4OA 3L2UA 4YORA 3NF6A 2VG5A 4WQ5A 4O0IA 2VGNA 2E8AA 3IS9A 4DR2K 2B6AA 5C2FA 3PLAA 1MWKA 1Q9XA 1C1CA 4CHPA 3O6WA 3TABA 4FWKA 2CGLA 5GINA 1KRPA 1VQ4N 3HZ6A 2OTLN 4M45A 4M3YA 4CFBA 2GELA 3G10A 1NK7A 3BZCA 3ZT3A 3OYGA 4ICLA 4X65K 3EN9A 5KRTA 1IBMK 3RSEA 2HVIA 3UKUB 3HPOA 5C2DA 1FW6A 3AVCA 2V52B 1X9JA 2IVOA 3RR7A 1OKJA 2QXFA 3CMEN 2J4RA 1EXQA 3QEWA 4FW2A 2XY8A 3O3HA 2F9TA 2A42A 3UE5A 3AVBA 4YOXA 4H0PA 3SYZA 3HYFA 2HOEA 4B1XB 5IT9O 4ID5A 2QXLA 2Q31A 4YOYA 3SI6A 4UQGA 1T6CA 2E2NA 4HTUA 3FZMA 4B9MA 3SCXA 4L8RB 4DQRA 3OY9A 4FYDA 3MEEA 1KLMA 3WQTA 4CGIA 3LDSA 5EOYA 3HI0A 2W6KA 3K9JA 1XNRK 4QS9A 1HUXA 5EY4A 3ENHA 1HYSA 4FK4A 2OTJN 1IG8A 4JI4K 4CGHA 1RTJA 5D3GA 3BDPA 1GLBG 3WT0A 2A5XA 2Q0RA 3VF4A 1BOTO 4H5TA 4EP4A 5C24A 3QEXA 3LP3A 2WTUA 3LM9A 3E9LA 1HNXK 3QINA 4ILHA 3T69A 4I2QA 2XHBA 1BDGA 4DV4K 4BRFA 4EHTA 1CXQA 3PIPL 3FZLA 4A59A 3LM2A 4FCYA 2HHHK 3SV3A 5CHIA 2F9WA 1L3UA 4ILJA 5H1SQ 1WSGA 2FBXA 3AVGA 4KHWA 2OANA 3BF3A 4CGFA 2VCPA 3OYBA 1MA9B 4GY2B 4KB0A 4Z4IA 4JI1K 3ZSVA 1GOCA 4BG8A 2BDPA 2RN2A 3DXKA 4BRAA 3IDHA 5E84A 2NRRA 4NLCA 3RRGA 1BWFO 2OZSA 1N34K 3FZKA 3DRSA 4BWMA 5EXWA 3WNHA 5I9EB 3CPWM 3H3OB 4O5BA 4JNEA 1LOTB 3D7EO 1GLCG 4C8LA 5AQUA 1NJYA 3J81O 3BP8A 1NGIA 5BN9A 2F8TA 1HR0K 4CF1A 1XQSC 2Z1JA 4U7BA 2ZGYA 1RBRA 1VSFA 1SS6A 3CQXA 4E1NA 3LDNA 1SL1A 1WUAA 4C23A 3NHGA 3SQ1A 4B8AB 4FZYA 4B9SA 2HVHA 3P5JA 2GWJA 4E1MA 2E88A 3K5NA 3JXUA 4NCGA 3SAFA 1CXUA 1HJOA 5AFUH 3NMUA 3TANA 3LPTA 4PA1A 5BRHA 1NGGA 1LW0A 5IWAK 4FJGA 2XO7A 4FM0A 3U6FA 2OYQA 4GW6A 4DB3A 1KLNA 1BGXT 1WAJA 2OPPA 1YF5L 1VQNN 3NH2A 2FLOA 4NXMK 5FPDA 4N56A 4FJKA 1NOZA 3M8PA 5JLFA 4O55A 4CJFA 1NBWA 2YV0X 4AILC 1JLEA 4R5PA 3CJBA 3VQQA 5KQDA 1BISA 1TGOA 1XWLA 3HOTA 1U49A 4BY9C 3DLBA 3QETA 4XEIA 4A2AA 1K8AO 4BRNA 3L4IA 5CE3A 3K5LA 1NGFA 2P9NA 2ZF5O 3L3VA 3I55N 3DI6A 4A5AA 4Z0UA 3KWGA 1XI1A 1NWKA 3CG7A 1T3VA 3LWLA 3LZIA 4JKFA 4NB4A 2DFFA 1QQMA 2I5JA 4I9LA 4FLTA 2QWNA 5KI6A 1BI4A 3NE6A 3O3GA 1TL3A 1Z6RA 4LFCK 1SL0A 3LL3A 2IIRA 4IZ9A 1VQPN 3ULEA 1Z25A 3D6RA 1TK5A 1Y97A 1EO1A 4FVUA 4WFNL 4FJIA 2YKMA 1NMNA 4O8UA 4XH5A 4CZMA 1CZAN 1U6ZA 2V7YA 2CGJA 4CIGA 1B9DA 1M90O 4IDHA 1KFSA 2IS3A 4K8XA 3ZT0A 4EZ9A 3DAWA 2D0BA 3H45C 1W0HA 2RHKA 1ASUA 4W5NA 3DLKA 3O9RA 2OCEA 1C6VA 5JMVA 4RWTA 1NKBA 5AQXA 2QKKA 3AAQA 3AVJA 3VQAA 3S3NA 3T19A 1X1PA 3EY1A 3MN5A 1N36K 1V4TA 3QESA 3VETA 3QMLA 3VEOA 4ILGB 4X66K 3PIOL 4W5OA 1ILYA 5ADXA 4ISFA 5FLXO 4DTUA 4KHSA 1KVAA 2YHBA 1NG9A 3ID8A 3CM6A 3PX6A 4F8RA 4JKGA 3P39A 1IKXA 2YJEA 3K58A 1W9HA 3SUPA 1Z26A 3RMAA 4DV0K 4CK2A 3QBWA 4K25A 2O8FB 5HRSA 2D0PA 4CBWA 5C12A 3PX4A 3KIOA 4DUZK 2B5JA 4N47A 4JD2A 1YAGA 3OVNA 4E7LA 4A61A 3DOKA 3M8SA 2P9SA 3WXMB 1TYQA 1DTTA 1Z05A 2IAJA 3ENOA 3CCQN 3SQ4A 2A1RA 3KLIA 1IH7A 2P9IA 5GADP 4WF9L 1HQUA 1QZ6A 3NF8A 4CEOA 4J8FA 5AZIA 1JLGA 4DTJA 4NYFA 4C8KA 3S3MA 5DM6L 4CESA 2PYLA 5BN8A 4CF2A 1VSDA 4LD0A 3PSIA 1UAXA 4JI5K 1RDCA 3MMVA 1FXXA 2YNIA 1TKZA 1C0MA 3THYB 1QTMA 3Q7BA 3V1OA 3PV8A 1VQKN 3S3OA 1J5OA 4N76A 4AF1A 1C0GA 3PSFA 3MCPA 3P31A 3TSUA 4DS5A 3KLFA 3ITHA 3NGYA 3MK6A 4FWRA 1QE1A 3CJ1A 4KTZA 4BRMA 5HRPA 4M3WA 4H5RA 1ASVA 5CZ1A 1XUPO 3BZKA 3RVCA 4YOVA 4CEDA 1WSIA 4HTLA 1C0TA 1VQ8N 1RT6A 3QIPA 3QBXA 5E26A 3MXJA 4AM6A 1RDWX 1W97L 4KTQA 1TK8A 1P90A 1XC3A 3V4IA 3ISNC 3RWUA 4M3TA 3SBTA 2VWJA 3IAYA 4WYBA 2Y1IA 1Y64A 3M8RA 5HOOA 5EVZA 3HVTA 3AVIA 4B9QA 1WN7A 4Y0WA 4GKJK 1J5EK 4FJ7A 1NGDA 5KTQA 1IKWA 3HPGA 4ISEA 4A5BA 5M1PA 5KPTA 4I7FA 4FWLA 1S5JA 4MLEA 4I2PA 4K41A 2HMIA 1WLJA 1T03A 2O8CA 5CR4A 3A5MC 4JI7K 1NGEA 5MLCQ 3ZX0A 3V9WA 3NVMA 1QVGM 1EX4A 3N4PA 1HRHA 4OKEA 4H0TB 2KZZA 4LFAK 4CEAA 1HNIA 4YNQA 3CMAN 1VSJA 5M1QA 4CK3A 1RDAA 3HL8A 1NU0A 1WSFA 4CIEA 4LF4K 1VAZA 1VSMA 1N8RO 2HHQA 3TTFA 2HHTA 2P9UB 3KD5E 3FR0A 3T1AA 4IEIA 2XY6A 3A0IX 3AVKA 2NZTA 1K8KB 3WNFA 4BR9A 1YT3A 5LMNK 4AM7A 1XMOK 2IDOA 1IKVA 1WBDA 1OVQA 4B8CA 5BREA 2WFBA 1D5AA 1RT3A 1IG9A 2BANA 4DR3K 5AZJA 1X3MA 3FGUA 4DR5K 4DS4A 4BE0A 3H6EA 4JKDA 3WXIA 4BVPA 3KD1E 4NO7A 1K6YA 1IO2A 5AQVA 1S1TA 3UKRB 2JWKA 2FF6A 1S22A 3QEPA 4CJUA 1QSYA 3U3GA 1HYZA 4DCHA 1N32K 3O1BA 4PL7A 1UA0A 1SL2A 3U4LA 2JGUA 1KXPA 1GLEG 3GL1A 4CZFA 4DWIA 3MWTA 3I0SA 4LC9B 2W6LA 4DLGA 4CI6A 3C6UA 4Y1CA 1O13A 3OYLA 4DMNA 5A2QO 3EE8A 3RMCA 3V6DA 1TVRA 4HCCA 2O8BA 1RCHA 4KHNA 3KTQA 1FKPA 5LJWA 4FM1A 4CECA 4RW7A 3ZETA 3WXJA 4OKJA 3R8EA 4OLBA 3D2EA 2NRZA 1NJWA 2HF4A 3MX2A 3CM5A 1JL2A 3OYAA 4O8KA 1Q82O 2NLXA 3W3DA 4KI4A 4RW8A 1JLFA 3L3UA 1S1UA 3E1YA 4DV1K 2PYJA 3O9TA 4LY7A 3RSEB 3LAKA 1B9FA 4CJQA 3L6QA 3VQDA 4CBUA 2EWSA 1A5XA 3DLRA 3SJHA 2V7ZA 2NRWA 4B9VA 1T05A 2WOMA 3CQYA 1TV6A 1LV5A 4LF6K 4Z4CA 1EWRA 4F4KA 3NDKA 3I8BA 1A5VA 2QM1A 1DEJA 3Q7CA 2P1JA 4GV9A 5FRNA 3PX0A 3TPQA 3H46O 3G0ZA 2P51A 3HPHA 4EFHA 3OYKA 2F8SA 4RW6A 3V9SA 3UB5A 3TI0A 2KHOA 4KH4A 4BC5A 3OYIA 1HPMA 1HPZA 2UXDK 1RBUA 1W2BM 2JWLA 4DFJA 1JKHA 2UU9K 3BF1A 4FZXC 1M1KO 1ATNA 4PY5A 3CFRA 5SWMA 2Z1GA 1SQKA 4WCEL 2ZGZA 1RDBA 3EKSA 3NGZA 1ITGA 3KK1A 4FLXA 3K2PA 3SPYA 1NNEA 4H5NA 5GAHP 2E2QA 3V1QA 2KTQA 5F1XA 1R59O 4QOZB 3O4QA 3C94A 3O1WA 4PWDA 1D9DA 4FLUA 4CZJA 1RTDA 2P5OA 4C8MA 3MECA 3S41A 1BHLA 3AVNA 4FWQA 4BR7A 1YVNA 5GAGP 2QKBA 3H3NO 1TKTA 4J2AA 3WQUA 4M3ZA 5KQ8A 2FXUA 3T1HK 4Y1DA 3F73A 4DU1A 1DTQA 3R9PA 1QHAA 4FJ8A 1BA0A 4BDZA 3D2FB 3DXKB 4YOTA 2ZJPL 1VQ7N 4BROA 4H5VA 1V4SA 2OPSA 4OKKA 1DLOA 3SUNA 1F21A 2FSNA 5C0YA 3NFAA 3OYFA 3BY5A 4MO4A 3P1GA 2KFNA 1NGBA 4N5SA 3VQCA 4JRPA 2UXCK 4C8NA 3VA0A 4W5RA 1LW2A 1ZC6A 1LWFA 1NMDA 1GLLO 3SUOA 1RGIA 3H1QA 4I6MA 5JS1A 4GVEA 3S9HA 3CF5L 1GLAG 2YKNA 3ZLJA 3O3FA 4ZTFA 4CZEA 3CCUN 3AAPA 5ADXH 2AA4A 4M3RA 5GIOA 3SZ2A 3C0BA 3LP1A 3T1YK 1LCUA 4YHHK 3ZEUB 4HCBA 4DR1K 4CERA 3CERA 1L3VA 1YIJN 3LAMA 2KQ2A 2QWRA 1VSIA 3E9OA 3R3LA 4WFBL 4FOEA 2E2PA 4KKOA 3E66A 3NH0A 2ZJRL 2NUBA 1N33K 3RR8A 4NLBA 4IDKA 3DXMA 3DOLA 4E1JA 3G4SN 4HHTA 4E7KA 3MCAB 1O1WA 1JLCA 1IBLK 3QB0A 4V19S 5JVHL 3KK7A 2E2OA 3FZHA 4CJ3A 4FWPA 4H0OA 4GMJB 3SV4A 3C6AA 4E89A 4LSLA 4Q0BA 1SUQA 3TSQA 2QW9A 5HL7L 3C6TA 5HRNA 3KWIA 2D4WA 4DSIA 1GLFO 5AQRA 5E41A 4YOWA 3VQ5A 4DHYA 4CJPA 2HHUA 3CCSN 4CW7B 2IC3A 5BPNA 1ZBUA 3ALYA 4HUFA 3GE1A 4IO8A 3CHWA 3SLCA 3LPUA 1KVCA 4G9ZA 2BE2A 1JJ2M 3LALA 1BO5O 2HBJA 3DLHA 2LSNA 1HLUA 5M1NA 1NJXA 1KQSM 2E20A 3OYDA 3DM2A 2R7YA 4FZZA 4F3TA 5HBMA 1VSKA 3TR8A 2P9LA 3NGIA 5FROA 4BG9A 3IKMA 2W42A 2GV9A 3CCLN 4EP5A 2IOCA 4PUOA 1I94K 1HNWK 3T3FA 1P8ZA 4KB1A 1JLBA 2HBLA 3BUZB 4DF4A 2GTDA 4DQPA 4CEZA 4HVJA 1Q9YA 4CK1A 4LF8K 2ETJA 5FRMA 1OH7A 2I7NA 4X64K 4FO0A 3ZSZA 3CFPA 2HHSA 2Q2RA 3ID6A 4PHTX 4KHPK 4FJJA 2Q3SA 1BIUA 4CHOA 4JKEA 4BR2A 3MDQA 4OPJA 4CBXA 3VTIA 3VEWA 2O8EA 1DT9A 1RT1A 2NRHA 2QWQA 2YNFA 5C42A 4IFYA 2QWOA 4F9OA 4DQSA 2BGGA 4OLAA 3G25A 3VGLA 2QWLA 2UUCK 3SAGA 1FK9A 1E3MA 3GDQA 1C1BA 2Z1IA 3N4QA 3ZSRA 1YJ9N 1OH8A 4Z4GA 3ZX2A 4JEPA 4Z4EA 3ZT2A 5JLHA 5BR8K 3AA4A 1XHZA 3SPZA 3CFOA 3AGKA 3ZSYA 3KVGA 3CC7N 1QHTA 4DR4K 4LH5A 4MLHA 3TU5A 2KW4A 4C8OA 4B9NA 1KTQA 4J2EA 4DQQA 4FXDA 4BVOA 3EE9A 3NVKA 4EHUA 4B9UA 2YNHA 2WBNA 3FLCO 1OVYA 3VMFB 5HLFA 4BC4A 4OX9K 1NJIO 1TYQB 1ZBFA 1VQMN 1YXQA 3G6EN 3FFIA 4QS8A 4WE1A 1QS4A 1VSLA 2PFUA 3ZCMA 4FPAA 4B3SK 4DTNA 3KKSA 5J2NA 3LWMA 5KRSA 1L5UA 3IMXA 4B1VA 2F96A 3WXLA 2D1KA 3R6MA 2DTUA 3U9ZA 2NRTA 4B9TA 5KGWA 4BR5A 1RNHA 4M42A 2ITMA 3B6OA 2D0CA 1YUWA 4BRLA 4KHYA 4CVNE 4FWMA 1HQEA 4JI6K 1YTUA 4FL9A 3MN9A 2Y1JA 3O9UA 3FFKB 5LL6Z 3VQ7A 1VRTA 1E4GT 4NCAA 3C7NB 2P9PB 4BGBA 5M1KA 3V9ZA 3VA3A 4GNIA 1K9MO 4FJNA 5HRRA 3VF6A 3AVAA 2QA4N 1ASWA 3OS2A 3K5MA 4CEBA 2FF3B 4W5QA 5K14A 3ZSQA 2YHXA 4XIUA 2G8UA 3JAMO 4MO5A 4FPBA 3J7AP 1HKCA 3AV9A 4O0JA 4OPHA 2X6NA 2VWBA 3TAMA 4AHCA 1HNZK 1SV5A 4IFEA 3KLHA 1CZBA 3U3YA 1QQOA 1WOQA 1XHXA 5KPZA 2VWKA 3CIPA 3I8DA 2O8FA 1ZBIA 5AQIA 3HBTA 5HP1A 3MXIA 2QI2A 1U48A 4BRQA 1C0FA 2IVPA 3KKRA 4FLYA 2PY5A 3DYAA 4JHDB 4TSXA 3JSMA 3AO2A 1NGCA 2HHXA 4OGCA 3TTDA 4BE1A 1C0UA 4B1YB 3M1FA 4JK7A 4H4MA 3ENBA 4DU3A 4BACA 1JXBA 4CJ4A 3CJCA 4ZHRA 4ISGA 1TK0A 1J53A 4JK8A 4DTXA 3OJSA 3CCJN 1S6PA 3V1RA 4H0VB 4M7XA 4CJEA 4FOIA 2H3GX 2FSJA 2VG7A 3THYA 3CETA 2BTFA 2E6MA 4B1WB 4E3SA 3RTVA 1ATSA 3VGMA 1BCOA 2G8IA 3HTVA 2QWPA 3M3ZA 1FJGK 3DJCA 2VYPA 3CC4N 3DLEA 3B8AX 3HP6A 3LANA 1BIZA 4W5TA 4DFKA 2HBMA 2ZM6K 4ELTA 4KO0A 3CPEA 1I3AA 5JICA 3KLEA 3J80O 2DFEA 4CJ5A 4DG1A 1XC9A 4B3OA 1ESVA 2F7TA 5TKWA 3VQPA 5C25A 5ELZA 4LSNA 5AQOA 5AQNA 4M63C 3WEEB 4HUGA 3ATVA 5FPEA 1QQNA 2HBKA 2W41A 3THXB 1D9FA 1XNQK 3GOIA 1EWQA 5AQHA 4BR4A 1ZBLA 3WNGA 3DWLA 5AR0A 3D2EB 4MQ3A 2P9KA 4A57A 4E19A 3SK3A 4M3XA 1WNSA 3HRGA
chains in the Genus database with same CATH topology
5LMUK 4NXMK 5FLXO 4DV4K 4DUYK 4CW7B 5AJ3K 4DV0K 4JYAK 4OX9K 3T1HK 4DV3K 4JI7K 4K0KK 4LFBK 2HHHK 4DR2K 4DR7K 4B3MK 4YY3K 4B3TK 4DV1K 4DUZK 2UUBK 3OTOK 4B3SK 4LFAK 4NXNK 4JV5K 4JI1K 4LF4K 1I94K 1HNWK 2UXBK 4LF6K 4LF5K 4X65K 2UXCK 1IBMK 1N34K 4LFCK 5LMNK 1XMOK 4LF8K 4JI5K 4X64K 2VQEK 4CVNE 4B3RK 1FJGK 4JI6K 4DV2K 4X62K 4JI3K 4DR3K 4DR5K 3J81O 3J7YP 3T1YK 4YHHK 4KHPK 5IT9O 1HR0K 2ZM6K 4DR6K 2VQFK 5LL6Z 4DR1K 4LF9K 3J80O 2UXDK 4DV5K 4JI0K 4JI2K 1IBKK 2UU9K 1N32K 4LF7K 1N33K 1IBLK 2UUCK 4V19S 1XNRK 2UUAK 1XNQK 3JAMO 4JI4K 5IWAK 5A2QO 3J7AP 5BR8K 4AQYK 1XMQK 2F4VK 4JI8K 1N36K 4DV7K 2E5LK 1HNZK 4DR4K 4X66K 4DV6K 4GKJK 1J5EK 4GKKK 1HNXK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU K;  4NXM K;  5FLX O;  4DV4 K;  4DUY K;  4CW7 B;  5AJ3 K;  4DV0 K;  4JYA K;  4OX9 K;  3T1H K;  4DV3 K;  4JI7 K;  4K0K K;  4LFB K;  2HHH K;  4DR2 K;  4DR7 K;  4B3M K;  4YY3 K;  4B3T K;  4DV1 K;  4DUZ K;  2UUB K;  3OTO K;  4B3S K;  4LFA K;  4NXN K;  4JV5 K;  4JI1 K;  4LF4 K;  1I94 K;  1HNW K;  2UXB K;  4LF6 K;  4LF5 K;  4X65 K;  2UXC K;  1IBM K;  1N34 K;  4LFC K;  5LMN K;  1XMO K;  4LF8 K;  4JI5 K;  4X64 K;  2VQE K;  4CVN E;  4B3R K;  1FJG K;  4JI6 K;  4DV2 K;  4X62 K;  4JI3 K;  4DR3 K;  4DR5 K;  3J81 O;  3J7Y P;  3T1Y K;  4YHH K;  4KHP K;  5IT9 O;  1HR0 K;  2ZM6 K;  4DR6 K;  2VQF K;  5LL6 Z;  4DR1 K;  4LF9 K;  3J80 O;  2UXD K;  4DV5 K;  4JI0 K;  4JI2 K;  1IBK K;  2UU9 K;  1N32 K;  4LF7 K;  1N33 K;  1IBL K;  2UUC K;  4V19 S;  1XNR K;  2UUA K;  1XNQ K;  3JAM O;  4JI4 K;  5IWA K;  5A2Q O;  3J7A P;  5BR8 K;  4AQY K;  1XMQ K;  2F4V K;  4JI8 K;  1N36 K;  4DV7 K;  2E5L K;  1HNZ K;  4DR4 K;  4X66 K;  4DV6 K;  4GKJ K;  1J5E K;  4GKK K;  1HNX K; 
#chains in the Genus database with same CATH topology
 1GLD G;  3O5B A;  5M1O A;  1U45 A;  4PL8 A;  4FJX A;  2VGM A;  4OPA A;  1N6Q A;  4KI6 A;  3RMD A;  3OA9 A;  4B08 A;  3OYM A;  1BCM A;  4K43 A;  5FPN A;  3AO3 A;  5BR9 A;  1U2V A;  1KD1 O;  2IVN A;  3AO5 A;  3OYE A;  1JLQ A;  3OYJ A;  2HMP A;  2YHY A;  4DFM A;  1NK9 A;  4F3O A;  4KHQ A;  2YJF A;  3QFU A;  3O4W A;  4CZI A;  4DR7 K;  4IG3 A;  4CZG A;  4YY3 K;  1QSL A;  4ID1 A;  3SNN A;  3ASM A;  5BPM A;  1ZBS A;  2KLA A;  4FLV A;  2P9U A;  4LH4 A;  1NKE A;  3KK2 A;  3TTC A;  3D0P A;  1RBT A;  4O44 A;  3CCE N;  2EX3 A;  1GOB A;  1MU2 A;  4JN4 A;  4IEE A;  2ATQ A;  4H8K A;  1S72 N;  4JS5 A;  1VQ9 N;  1S1X A;  3O08 A;  3A5L C;  2JLE A;  3LDP A;  1RFQ A;  4PKH A;  1RBV A;  1TUU A;  5DK5 A;  3G71 N;  3UKR A;  2BUP A;  4X62 K;  2KZM A;  4IKF A;  2GUP A;  3J7Y P;  2Q97 A;  1S3X A;  3IUC A;  3U9D A;  3AVH A;  2VQF K;  3K5O A;  1G99 A;  5CYM A;  4RG8 A;  4WQ4 C;  2QEX N;  4QAG A;  4A62 A;  1MDU B;  1NLV A;  4AHV A;  4LF7 K;  4Z94 A;  1E4F T;  4MDB A;  4L3Q A;  4BRK A;  1X3N A;  1OH5 A;  3THW A;  3VQE A;  1UWB A;  3DRR A;  5J1E A;  1VSH A;  2ZWH A;  5TKY A;  1WAF A;  5GAE P;  3ULD A;  1T8E A;  1MWM A;  3P4I A;  3O9S A;  5C10 A;  3LDO A;  1J6Z A;  3J7Z O;  4IWV A;  4WFA L;  1KAZ A;  3CYM A;  5I42 A;  2D0O A;  4BR0 A;  3TWH A;  2O8D A;  3AAR A;  3ZX3 A;  2E6L A;  2A41 A;  5JVG L;  2NRX A;  3AVF A;  2AJQ A;  3AA2 A;  4AH9 A;  3A5N C;  1KCF A;  2Z1H A;  1WSJ A;  2FSK A;  1NOY A;  2ASP A;  4DUY K;  2RPI A;  4E7I A;  1CLQ A;  4ZTJ A;  2XRI A;  4JKH A;  5DM7 L;  3IRX A;  3SMS A;  4FSV A;  4FVM A;  3MXM A;  2Q36 A;  4FWN A;  5CY4 A;  3MWP A;  4B3M K;  3MX5 A;  1YTA A;  3OBY A;  3R1X A;  3EL2 A;  2UUB K;  4U67 L;  2EHG A;  4K42 A;  4YOU A;  3K9K A;  3CCV N;  4G1Q A;  4FJL A;  4I6M B;  4DFP A;  3I56 N;  1EP4 A;  2XY5 A;  1BQM A;  1ATR A;  1QZ5 A;  2I7P A;  2HHW A;  1QQC A;  4IOX A;  4IG0 A;  4LF5 K;  4E0D A;  5FDL A;  5KPR A;  3OW2 M;  4PQU A;  4JAX A;  5AQT A;  3VGK A;  3VQ6 A;  5GIP A;  1ZBH A;  1B92 A;  3GBT A;  4RW4 A;  4KFB A;  1RBS A;  5DMR A;  4M41 A;  4OO1 J;  4M7Y A;  1VHX A;  4DTP A;  3UKU A;  4BC2 A;  4HWI A;  4CEF A;  3QIC A;  1EQY A;  2A3Z A;  2E1Y A;  4BRI A;  1S9G A;  1ZXO A;  2GWK A;  3EKU A;  2G8H A;  3DXM B;  1X9W A;  5AQL A;  3LDQ A;  2O4G A;  4BRP A;  3TSP A;  4ELV A;  1YJN N;  3EZW A;  3J8A A;  4CHQ A;  4FW1 A;  3F9K A;  3SMP A;  3F9M A;  3SQ0 A;  2PAV A;  3HK2 A;  1JXE A;  2QTD A;  1R0A A;  3IG1 A;  2QK9 A;  3OJU A;  3VEV A;  4FJ5 A;  4DSF A;  3O8M A;  1WSH A;  1NM1 A;  4IOC L;  4CJ7 A;  3TAP A;  1RT7 A;  2UUA K;  4J2D A;  2WUS A;  3NF7 A;  1DGK N;  3FE1 A;  2DY4 A;  1LAV A;  4DF8 A;  4NYN A;  4FLW A;  4JKB A;  1XMQ K;  1C1A A;  5KGX A;  2FBV A;  2YHA A;  1JCE A;  1KVB A;  4J2B A;  3EEQ A;  4DV7 K;  1K73 O;  4XH1 A;  1BA1 A;  4CHN A;  3OYH A;  2HW3 A;  2P5G A;  4IO9 L;  5T7B A;  4DQI A;  2ASO A;  4RTF D;  2FBY A;  4IFV A;  3D2F A;  3I0R A;  4KRF A;  3A5O C;  3SBG A;  1SKS A;  1T7P A;  3JS6 A;  5AJ3 K;  1RT2 A;  2P9L B;  4K8Z A;  1U04 A;  3L0Q A;  3MED A;  4OVL A;  3CCM N;  3VEN A;  4RCH A;  4JK9 A;  3ZYY X;  4DTM A;  3VOV A;  4BQZ A;  4C1N I;  3L8B A;  4BDY A;  2X74 A;  1X9M A;  1W7A A;  4WQ5 C;  2CH5 A;  4CCH A;  2FBT A;  1VQ6 N;  3CD6 N;  4JKA A;  3DMJ A;  1RDD A;  2RKI A;  1L3S A;  3SQ2 A;  1VK0 A;  1JCF A;  3K57 A;  2G8F A;  2P9N B;  4CGD A;  2YCH A;  4CHY A;  1HKB A;  4DTR A;  3VEY A;  1SAZ A;  5J2P A;  1KAY A;  3ATU A;  5AQY A;  4C1N K;  3C6H A;  3ZEU A;  2A1S A;  3AA5 X;  1EET A;  1KSP A;  4YDU A;  2GX9 A;  1BU6 O;  5J2Q A;  3QER A;  4FJH A;  4B3R K;  1HJR A;  1BI4 B;  4DV2 K;  2O8E B;  1VSE A;  2CGK A;  1A5W A;  3IFR A;  1D4X A;  3AO1 A;  3VER A;  1SKR A;  1YVU A;  2KKZ A;  4DR6 K;  2IGI A;  4LF9 K;  1VQ5 N;  2HHV A;  3P38 A;  1LAW A;  3ULE B;  5I3U A;  4DV5 K;  3SJJ A;  2DFH A;  4AHT A;  1BG3 A;  4OJR A;  3AVM A;  2YX6 A;  1OH6 A;  2E4L A;  3PO5 A;  4IOA L;  1RDU A;  2HNY A;  3EYZ A;  1VRU A;  3GG4 A;  4BE2 A;  3FZF A;  5AQZ A;  1JLA A;  1G15 A;  3WXK A;  4DU4 A;  4KBO A;  5BRF A;  3HJF A;  4AHU A;  5AQF A;  1GOA A;  3WUH A;  4JI8 K;  3PUF A;  4BQL A;  1TAQ A;  3L2W A;  2E5L K;  3L2V A;  1NKC A;  2RE2 A;  3M6G A;  4JLH A;  1HYV A;  3VQ4 A;  4CFA A;  3F2K A;  2ITG A;  4CEQ A;  4JRQ A;  3OYN A;  4XH4 A;  1S1V A;  2ZJQ L;  3SUQ A;  4KHU A;  1HMV A;  1NK8 A;  1J9A A;  3NH1 A;  4DV3 K;  1RIL A;  3QLH A;  4K0K K;  4LFB K;  4H0Y B;  4HUE A;  1BQN A;  1SKW A;  3HOS A;  3QEI A;  4IJA A;  3OS0 A;  4ELU A;  3LZJ A;  4JKG B;  3O80 A;  4CD1 A;  2GUI A;  3HT3 A;  2YNG A;  4DSL A;  2CH6 A;  2Q1N A;  1H1V A;  3AGR A;  4IXC A;  4N41 A;  3KZB A;  5C15 A;  2HB5 A;  3DLG A;  3THV A;  5AQW A;  1BL3 A;  4JD2 B;  4CF9 A;  3AY9 A;  2UXB K;  4I9Q A;  5LJV A;  1QSS A;  2P9S B;  4IJN A;  3EZ5 A;  3QO9 A;  3M5R A;  4F2S A;  4CGG A;  4UY8 O;  2DPN A;  3CI5 A;  1Q8I A;  3VN5 A;  3E01 A;  5M1F A;  3CJA A;  2P9I B;  2A40 A;  3M8Q A;  4CZK A;  4CD3 A;  5AQS A;  3V81 A;  5AQP A;  4KAZ A;  4FWO A;  5AZI B;  4AHR A;  4JI3 K;  1TUY A;  1RT4 A;  3KK3 A;  2PBD A;  5BPL A;  3VPZ A;  3TAQ A;  3NCI A;  1VQL N;  3K0S A;  1KFD A;  4KH5 A;  4B9L A;  3AA3 A;  4QS7 A;  3CXC M;  3MEG A;  1TKD A;  1NGH A;  4JI2 K;  1T44 A;  3HM9 A;  1CZ9 A;  3O4N A;  3L2Q A;  4CJS A;  2HND A;  3TAG A;  2G8V A;  5AQG A;  3HSC A;  5JS2 A;  3P83 D;  4CE9 A;  4Z4H A;  2OA8 A;  3AO4 A;  4YDU C;  3DRP A;  4PKG A;  3QNO A;  4AQY K;  3WNE A;  4DSK A;  5AQM A;  2F4V K;  3T7Z A;  2AP1 A;  2FC0 A;  4M3U A;  3RMB A;  4IBN A;  4CZH A;  5FPM A;  2ASM A;  1S6Q A;  4KH6 A;  4BRC A;  4CJR A;  4Q5V A;  1YI2 N;  1HX1 A;  4CFC A;  3JYT A;  2ZE2 A;  4CJK A;  4DQ8 A;  3K59 A;  1YIT N;  3V9X A;  1WB9 A;  4JYA K;  3CC2 N;  1NK5 A;  1WSE A;  1QVF M;  5AQJ A;  4DTO A;  3MAQ A;  3OBW A;  4AHS A;  4CIF A;  5HRO A;  4PKI A;  3KLG A;  3OTO K;  3QEV A;  3CJ7 A;  2O8C B;  4NXN K;  1RTI A;  2GBZ A;  3O9Q A;  2PZS A;  1TAU A;  4JV5 K;  3VES A;  2G8K A;  5AFU A;  2OPR A;  4CJW A;  1KC8 O;  1L3T A;  3ZSX A;  2X6S A;  5F2R A;  3TAR A;  3DLL L;  1UA1 A;  2YI1 A;  4E7H A;  4BRH A;  2OPQ A;  4A2B A;  3HVR A;  3CJ9 A;  3VQB A;  1TL1 A;  3QFP A;  3E9P A;  1SZ2 A;  1N5Y A;  3L2R A;  4BRG A;  2V51 B;  3C7N A;  2VQE K;  3VTH A;  4MFB A;  2P9P A;  4FK2 A;  4WQ4 A;  2OZM A;  2NRV A;  4BRD A;  5SZT A;  1LWC A;  3NBP A;  3PY8 A;  1RTH A;  2E1Z A;  1NK4 A;  4JKC A;  1NJZ A;  1JL1 A;  4BGA A;  2WC9 A;  1HKG A;  1HNV A;  2QWM A;  4H0X B;  5AZJ B;  3SAH A;  1IBK K;  4KV8 A;  1U47 A;  3KHY A;  2A6A A;  2UYT A;  4CF8 A;  1X9S A;  2D5R A;  4EAH D;  2P9K B;  1Q86 O;  4CGJ A;  4E7J A;  2HNZ A;  3BEX A;  3OHR A;  3QNN A;  5CYQ A;  1NGA A;  4CFD A;  1Q7Y O;  3H1V X;  5F0X A;  5J2M A;  1RT5 A;  4BRE A;  2ZQB A;  3C95 A;  3RRH A;  3QDK A;  2NNW A;  3NF9 A;  1NGJ A;  4FWS A;  3VQ8 A;  1BUP A;  3HO1 A;  2W40 A;  5BRD A;  2G8W A;  4DV6 K;  1D8Y A;  1U2V B;  3VF2 A;  5LY3 A;  3HP9 A;  5AQK A;  4JHD A;  1IKY A;  5B8H A;  1ZYQ A;  2O8B B;  1KAX A;  1EKE A;  4FJM A;  4B1Z A;  2BH1 A;  3ZET B;  3OS1 A;  1REV A;  3ZSO A;  4H5W A;  4FLZ A;  4CZL A;  1GLJ O;  4KPY A;  4B3T K;  3HXM A;  4R79 A;  2RF2 A;  2O4I A;  1LWE A;  3I33 A;  4DSJ A;  4DKW A;  4OPK A;  4DSE A;  1Q18 A;  4EIA A;  3QIO A;  3MN7 A;  3U8X A;  3A2F A;  3V9U A;  2KFZ A;  3TAF A;  4FK0 A;  1WBB A;  3VQ9 A;  3KJV A;  4FJ9 A;  2GEM A;  3VEZ A;  4O4G A;  2WON A;  4QCL A;  4Z4F A;  4CF0 A;  3LP0 A;  2ZD1 A;  4O5F A;  1NK6 A;  4KRE A;  4OGE A;  3CCR N;  3B6P A;  4DLE A;  1UOC A;  3A8Y A;  1YJW N;  3H08 A;  3C65 A;  1T6D A;  4NCB A;  4EZ6 A;  1DKG D;  3ZT1 A;  1K8K A;  5EU7 A;  3LDL A;  1S1W A;  4CEE A;  1S9E A;  4DTS A;  1J54 A;  4BC3 A;  4MDA A;  3THW B;  2XY7 A;  3WEE A;  3TAE A;  3OYC A;  4FM2 A;  4JI0 K;  3HST B;  1TKX A;  1FKO A;  3THX A;  3D45 A;  5AQQ A;  1NK0 A;  4RW9 A;  3AVL A;  1Q81 O;  3CQ8 A;  3L4Q A;  2O8D B;  3BGR A;  3ZSW A;  4H03 B;  1YHQ N;  2VG6 A;  4CJV A;  5EX5 A;  4CHZ A;  2HF3 A;  4GV3 A;  2Q0U A;  3UIQ A;  4JS4 A;  3PO4 A;  2HST A;  3EO3 A;  1IV0 A;  4CJT A;  4BWJ A;  2X78 A;  4GV6 A;  2B4J A;  4YFU A;  1VQO N;  1JCG A;  3F5T A;  4CJL A;  3W0L A;  1I39 A;  2D0A A;  3NAE A;  3LP2 A;  3MN6 A;  4GVM A;  4F2R A;  4GKK K;  4KTW A;  5CZ2 A;  5LMU K;  3VEX A;  3HM8 A;  1IJJ A;  1U4B A;  4B1U B;  4BDP A;  3ZT4 A;  2YHW A;  4H4O A;  3L2U A;  4YOR A;  3NF6 A;  2VG5 A;  4WQ5 A;  4O0I A;  2VGN A;  2E8A A;  3IS9 A;  4DR2 K;  2B6A A;  5C2F A;  3PLA A;  1MWK A;  1Q9X A;  1C1C A;  4CHP A;  3O6W A;  3TAB A;  4FWK A;  2CGL A;  5GIN A;  1KRP A;  1VQ4 N;  3HZ6 A;  2OTL N;  4M45 A;  4M3Y A;  4CFB A;  2GEL A;  3G10 A;  1NK7 A;  3BZC A;  3ZT3 A;  3OYG A;  4ICL A;  4X65 K;  3EN9 A;  5KRT A;  1IBM K;  3RSE A;  2HVI A;  3UKU B;  3HPO A;  5C2D A;  1FW6 A;  3AVC A;  2V52 B;  1X9J A;  2IVO A;  3RR7 A;  1OKJ A;  2QXF A;  3CME N;  2J4R A;  1EXQ A;  3QEW A;  4FW2 A;  2XY8 A;  3O3H A;  2F9T A;  2A42 A;  3UE5 A;  3AVB A;  4YOX A;  4H0P A;  3SYZ A;  3HYF A;  2HOE A;  4B1X B;  5IT9 O;  4ID5 A;  2QXL A;  2Q31 A;  4YOY A;  3SI6 A;  4UQG A;  1T6C A;  2E2N A;  4HTU A;  3FZM A;  4B9M A;  3SCX A;  4L8R B;  4DQR A;  3OY9 A;  4FYD A;  3MEE A;  1KLM A;  3WQT A;  4CGI A;  3LDS A;  5EOY A;  3HI0 A;  2W6K A;  3K9J A;  1XNR K;  4QS9 A;  1HUX A;  5EY4 A;  3ENH A;  1HYS A;  4FK4 A;  2OTJ N;  1IG8 A;  4JI4 K;  4CGH A;  1RTJ A;  5D3G A;  3BDP A;  1GLB G;  3WT0 A;  2A5X A;  2Q0R A;  3VF4 A;  1BOT O;  4H5T A;  4EP4 A;  5C24 A;  3QEX A;  3LP3 A;  2WTU A;  3LM9 A;  3E9L A;  1HNX K;  3QIN A;  4ILH A;  3T69 A;  4I2Q A;  2XHB A;  1BDG A;  4DV4 K;  4BRF A;  4EHT A;  1CXQ A;  3PIP L;  3FZL A;  4A59 A;  3LM2 A;  4FCY A;  2HHH K;  3SV3 A;  5CHI A;  2F9W A;  1L3U A;  4ILJ A;  5H1S Q;  1WSG A;  2FBX A;  3AVG A;  4KHW A;  2OAN A;  3BF3 A;  4CGF A;  2VCP A;  3OYB A;  1MA9 B;  4GY2 B;  4KB0 A;  4Z4I A;  4JI1 K;  3ZSV A;  1GOC A;  4BG8 A;  2BDP A;  2RN2 A;  3DXK A;  4BRA A;  3IDH A;  5E84 A;  2NRR A;  4NLC A;  3RRG A;  1BWF O;  2OZS A;  1N34 K;  3FZK A;  3DRS A;  4BWM A;  5EXW A;  3WNH A;  5I9E B;  3CPW M;  3H3O B;  4O5B A;  4JNE A;  1LOT B;  3D7E O;  1GLC G;  4C8L A;  5AQU A;  1NJY A;  3J81 O;  3BP8 A;  1NGI A;  5BN9 A;  2F8T A;  1HR0 K;  4CF1 A;  1XQS C;  2Z1J A;  4U7B A;  2ZGY A;  1RBR A;  1VSF A;  1SS6 A;  3CQX A;  4E1N A;  3LDN A;  1SL1 A;  1WUA A;  4C23 A;  3NHG A;  3SQ1 A;  4B8A B;  4FZY A;  4B9S A;  2HVH A;  3P5J A;  2GWJ A;  4E1M A;  2E88 A;  3K5N A;  3JXU A;  4NCG A;  3SAF A;  1CXU A;  1HJO A;  5AFU H;  3NMU A;  3TAN A;  3LPT A;  4PA1 A;  5BRH A;  1NGG A;  1LW0 A;  5IWA K;  4FJG A;  2XO7 A;  4FM0 A;  3U6F A;  2OYQ A;  4GW6 A;  4DB3 A;  1KLN A;  1BGX T;  1WAJ A;  2OPP A;  1YF5 L;  1VQN N;  3NH2 A;  2FLO A;  4NXM K;  5FPD A;  4N56 A;  4FJK A;  1NOZ A;  3M8P A;  5JLF A;  4O55 A;  4CJF A;  1NBW A;  2YV0 X;  4AIL C;  1JLE A;  4R5P A;  3CJB A;  3VQQ A;  5KQD A;  1BIS A;  1TGO A;  1XWL A;  3HOT A;  1U49 A;  4BY9 C;  3DLB A;  3QET A;  4XEI A;  4A2A A;  1K8A O;  4BRN A;  3L4I A;  5CE3 A;  3K5L A;  1NGF A;  2P9N A;  2ZF5 O;  3L3V A;  3I55 N;  3DI6 A;  4A5A A;  4Z0U A;  3KWG A;  1XI1 A;  1NWK A;  3CG7 A;  1T3V A;  3LWL A;  3LZI A;  4JKF A;  4NB4 A;  2DFF A;  1QQM A;  2I5J A;  4I9L A;  4FLT A;  2QWN A;  5KI6 A;  1BI4 A;  3NE6 A;  3O3G A;  1TL3 A;  1Z6R A;  4LFC K;  1SL0 A;  3LL3 A;  2IIR A;  4IZ9 A;  1VQP N;  3ULE A;  1Z25 A;  3D6R A;  1TK5 A;  1Y97 A;  1EO1 A;  4FVU A;  4WFN L;  4FJI A;  2YKM A;  1NMN A;  4O8U A;  4XH5 A;  4CZM A;  1CZA N;  1U6Z A;  2V7Y A;  2CGJ A;  4CIG A;  1B9D A;  1M90 O;  4IDH A;  1KFS A;  2IS3 A;  4K8X A;  3ZT0 A;  4EZ9 A;  3DAW A;  2D0B A;  3H45 C;  1W0H A;  2RHK A;  1ASU A;  4W5N A;  3DLK A;  3O9R A;  2OCE A;  1C6V A;  5JMV A;  4RWT A;  1NKB A;  5AQX A;  2QKK A;  3AAQ A;  3AVJ A;  3VQA A;  3S3N A;  3T19 A;  1X1P A;  3EY1 A;  3MN5 A;  1N36 K;  1V4T A;  3QES A;  3VET A;  3QML A;  3VEO A;  4ILG B;  4X66 K;  3PIO L;  4W5O A;  1ILY A;  5ADX A;  4ISF A;  5FLX O;  4DTU A;  4KHS A;  1KVA A;  2YHB A;  1NG9 A;  3ID8 A;  3CM6 A;  3PX6 A;  4F8R A;  4JKG A;  3P39 A;  1IKX A;  2YJE A;  3K58 A;  1W9H A;  3SUP A;  1Z26 A;  3RMA A;  4DV0 K;  4CK2 A;  3QBW A;  4K25 A;  2O8F B;  5HRS A;  2D0P A;  4CBW A;  5C12 A;  3PX4 A;  3KIO A;  4DUZ K;  2B5J A;  4N47 A;  4JD2 A;  1YAG A;  3OVN A;  4E7L A;  4A61 A;  3DOK A;  3M8S A;  2P9S A;  3WXM B;  1TYQ A;  1DTT A;  1Z05 A;  2IAJ A;  3ENO A;  3CCQ N;  3SQ4 A;  2A1R A;  3KLI A;  1IH7 A;  2P9I A;  5GAD P;  4WF9 L;  1HQU A;  1QZ6 A;  3NF8 A;  4CEO A;  4J8F A;  5AZI A;  1JLG A;  4DTJ A;  4NYF A;  4C8K A;  3S3M A;  5DM6 L;  4CES A;  2PYL A;  5BN8 A;  4CF2 A;  1VSD A;  4LD0 A;  3PSI A;  1UAX A;  4JI5 K;  1RDC A;  3MMV A;  1FXX A;  2YNI A;  1TKZ A;  1C0M A;  3THY B;  1QTM A;  3Q7B A;  3V1O A;  3PV8 A;  1VQK N;  3S3O A;  1J5O A;  4N76 A;  4AF1 A;  1C0G A;  3PSF A;  3MCP A;  3P31 A;  3TSU A;  4DS5 A;  3KLF A;  3ITH A;  3NGY A;  3MK6 A;  4FWR A;  1QE1 A;  3CJ1 A;  4KTZ A;  4BRM A;  5HRP A;  4M3W A;  4H5R A;  1ASV A;  5CZ1 A;  1XUP O;  3BZK A;  3RVC A;  4YOV A;  4CED A;  1WSI A;  4HTL A;  1C0T A;  1VQ8 N;  1RT6 A;  3QIP A;  3QBX A;  5E26 A;  3MXJ A;  4AM6 A;  1RDW X;  1W97 L;  4KTQ A;  1TK8 A;  1P90 A;  1XC3 A;  3V4I A;  3ISN C;  3RWU A;  4M3T A;  3SBT A;  2VWJ A;  3IAY A;  4WYB A;  2Y1I A;  1Y64 A;  3M8R A;  5HOO A;  5EVZ A;  3HVT A;  3AVI A;  4B9Q A;  1WN7 A;  4Y0W A;  4GKJ K;  1J5E K;  4FJ7 A;  1NGD A;  5KTQ A;  1IKW A;  3HPG A;  4ISE A;  4A5B A;  5M1P A;  5KPT A;  4I7F A;  4FWL A;  1S5J A;  4MLE A;  4I2P A;  4K41 A;  2HMI A;  1WLJ A;  1T03 A;  2O8C A;  5CR4 A;  3A5M C;  4JI7 K;  1NGE A;  5MLC Q;  3ZX0 A;  3V9W A;  3NVM A;  1QVG M;  1EX4 A;  3N4P A;  1HRH A;  4OKE A;  4H0T B;  2KZZ A;  4LFA K;  4CEA A;  1HNI A;  4YNQ A;  3CMA N;  1VSJ A;  5M1Q A;  4CK3 A;  1RDA A;  3HL8 A;  1NU0 A;  1WSF A;  4CIE A;  4LF4 K;  1VAZ A;  1VSM A;  1N8R O;  2HHQ A;  3TTF A;  2HHT A;  2P9U B;  3KD5 E;  3FR0 A;  3T1A A;  4IEI A;  2XY6 A;  3A0I X;  3AVK A;  2NZT A;  1K8K B;  3WNF A;  4BR9 A;  1YT3 A;  5LMN K;  4AM7 A;  1XMO K;  2IDO A;  1IKV A;  1WBD A;  1OVQ A;  4B8C A;  5BRE A;  2WFB A;  1D5A A;  1RT3 A;  1IG9 A;  2BAN A;  4DR3 K;  5AZJ A;  1X3M A;  3FGU A;  4DR5 K;  4DS4 A;  4BE0 A;  3H6E A;  4JKD A;  3WXI A;  4BVP A;  3KD1 E;  4NO7 A;  1K6Y A;  1IO2 A;  5AQV A;  1S1T A;  3UKR B;  2JWK A;  2FF6 A;  1S22 A;  3QEP A;  4CJU A;  1QSY A;  3U3G A;  1HYZ A;  4DCH A;  1N32 K;  3O1B A;  4PL7 A;  1UA0 A;  1SL2 A;  3U4L A;  2JGU A;  1KXP A;  1GLE G;  3GL1 A;  4CZF A;  4DWI A;  3MWT A;  3I0S A;  4LC9 B;  2W6L A;  4DLG A;  4CI6 A;  3C6U A;  4Y1C A;  1O13 A;  3OYL A;  4DMN A;  5A2Q O;  3EE8 A;  3RMC A;  3V6D A;  1TVR A;  4HCC A;  2O8B A;  1RCH A;  4KHN A;  3KTQ A;  1FKP A;  5LJW A;  4FM1 A;  4CEC A;  4RW7 A;  3ZET A;  3WXJ A;  4OKJ A;  3R8E A;  4OLB A;  3D2E A;  2NRZ A;  1NJW A;  2HF4 A;  3MX2 A;  3CM5 A;  1JL2 A;  3OYA A;  4O8K A;  1Q82 O;  2NLX A;  3W3D A;  4KI4 A;  4RW8 A;  1JLF A;  3L3U A;  1S1U A;  3E1Y A;  4DV1 K;  2PYJ A;  3O9T A;  4LY7 A;  3RSE B;  3LAK A;  1B9F A;  4CJQ A;  3L6Q A;  3VQD A;  4CBU A;  2EWS A;  1A5X A;  3DLR A;  3SJH A;  2V7Z A;  2NRW A;  4B9V A;  1T05 A;  2WOM A;  3CQY A;  1TV6 A;  1LV5 A;  4LF6 K;  4Z4C A;  1EWR A;  4F4K A;  3NDK A;  3I8B A;  1A5V A;  2QM1 A;  1DEJ A;  3Q7C A;  2P1J A;  4GV9 A;  5FRN A;  3PX0 A;  3TPQ A;  3H46 O;  3G0Z A;  2P51 A;  3HPH A;  4EFH A;  3OYK A;  2F8S A;  4RW6 A;  3V9S A;  3UB5 A;  3TI0 A;  2KHO A;  4KH4 A;  4BC5 A;  3OYI A;  1HPM A;  1HPZ A;  2UXD K;  1RBU A;  1W2B M;  2JWL A;  4DFJ A;  1JKH A;  2UU9 K;  3BF1 A;  4FZX C;  1M1K O;  1ATN A;  4PY5 A;  3CFR A;  5SWM A;  2Z1G A;  1SQK A;  4WCE L;  2ZGZ A;  1RDB A;  3EKS A;  3NGZ A;  1ITG A;  3KK1 A;  4FLX A;  3K2P A;  3SPY A;  1NNE A;  4H5N A;  5GAH P;  2E2Q A;  3V1Q A;  2KTQ A;  5F1X A;  1R59 O;  4QOZ B;  3O4Q A;  3C94 A;  3O1W A;  4PWD A;  1D9D A;  4FLU A;  4CZJ A;  1RTD A;  2P5O A;  4C8M A;  3MEC A;  3S41 A;  1BHL A;  3AVN A;  4FWQ A;  4BR7 A;  1YVN A;  5GAG P;  2QKB A;  3H3N O;  1TKT A;  4J2A A;  3WQU A;  4M3Z A;  5KQ8 A;  2FXU A;  3T1H K;  4Y1D A;  3F73 A;  4DU1 A;  1DTQ A;  3R9P A;  1QHA A;  4FJ8 A;  1BA0 A;  4BDZ A;  3D2F B;  3DXK B;  4YOT A;  2ZJP L;  1VQ7 N;  4BRO A;  4H5V A;  1V4S A;  2OPS A;  4OKK A;  1DLO A;  3SUN A;  1F21 A;  2FSN A;  5C0Y A;  3NFA A;  3OYF A;  3BY5 A;  4MO4 A;  3P1G A;  2KFN A;  1NGB A;  4N5S A;  3VQC A;  4JRP A;  2UXC K;  4C8N A;  3VA0 A;  4W5R A;  1LW2 A;  1ZC6 A;  1LWF A;  1NMD A;  1GLL O;  3SUO A;  1RGI A;  3H1Q A;  4I6M A;  5JS1 A;  4GVE A;  3S9H A;  3CF5 L;  1GLA G;  2YKN A;  3ZLJ A;  3O3F A;  4ZTF A;  4CZE A;  3CCU N;  3AAP A;  5ADX H;  2AA4 A;  4M3R A;  5GIO A;  3SZ2 A;  3C0B A;  3LP1 A;  3T1Y K;  1LCU A;  4YHH K;  3ZEU B;  4HCB A;  4DR1 K;  4CER A;  3CER A;  1L3V A;  1YIJ N;  3LAM A;  2KQ2 A;  2QWR A;  1VSI A;  3E9O A;  3R3L A;  4WFB L;  4FOE A;  2E2P A;  4KKO A;  3E66 A;  3NH0 A;  2ZJR L;  2NUB A;  1N33 K;  3RR8 A;  4NLB A;  4IDK A;  3DXM A;  3DOL A;  4E1J A;  3G4S N;  4HHT A;  4E7K A;  3MCA B;  1O1W A;  1JLC A;  1IBL K;  3QB0 A;  4V19 S;  5JVH L;  3KK7 A;  2E2O A;  3FZH A;  4CJ3 A;  4FWP A;  4H0O A;  4GMJ B;  3SV4 A;  3C6A A;  4E89 A;  4LSL A;  4Q0B A;  1SUQ A;  3TSQ A;  2QW9 A;  5HL7 L;  3C6T A;  5HRN A;  3KWI A;  2D4W A;  4DSI A;  1GLF O;  5AQR A;  5E41 A;  4YOW A;  3VQ5 A;  4DHY A;  4CJP A;  2HHU A;  3CCS N;  4CW7 B;  2IC3 A;  5BPN A;  1ZBU A;  3ALY A;  4HUF A;  3GE1 A;  4IO8 A;  3CHW A;  3SLC A;  3LPU A;  1KVC A;  4G9Z A;  2BE2 A;  1JJ2 M;  3LAL A;  1BO5 O;  2HBJ A;  3DLH A;  2LSN A;  1HLU A;  5M1N A;  1NJX A;  1KQS M;  2E20 A;  3OYD A;  3DM2 A;  2R7Y A;  4FZZ A;  4F3T A;  5HBM A;  1VSK A;  3TR8 A;  2P9L A;  3NGI A;  5FRO A;  4BG9 A;  3IKM A;  2W42 A;  2GV9 A;  3CCL N;  4EP5 A;  2IOC A;  4PUO A;  1I94 K;  1HNW K;  3T3F A;  1P8Z A;  4KB1 A;  1JLB A;  2HBL A;  3BUZ B;  4DF4 A;  2GTD A;  4DQP A;  4CEZ A;  4HVJ A;  1Q9Y A;  4CK1 A;  4LF8 K;  2ETJ A;  5FRM A;  1OH7 A;  2I7N A;  4X64 K;  4FO0 A;  3ZSZ A;  3CFP A;  2HHS A;  2Q2R A;  3ID6 A;  4PHT X;  4KHP K;  4FJJ A;  2Q3S A;  1BIU A;  4CHO A;  4JKE A;  4BR2 A;  3MDQ A;  4OPJ A;  4CBX A;  3VTI A;  3VEW A;  2O8E A;  1DT9 A;  1RT1 A;  2NRH A;  2QWQ A;  2YNF A;  5C42 A;  4IFY A;  2QWO A;  4F9O A;  4DQS A;  2BGG A;  4OLA A;  3G25 A;  3VGL A;  2QWL A;  2UUC K;  3SAG A;  1FK9 A;  1E3M A;  3GDQ A;  1C1B A;  2Z1I A;  3N4Q A;  3ZSR A;  1YJ9 N;  1OH8 A;  4Z4G A;  3ZX2 A;  4JEP A;  4Z4E A;  3ZT2 A;  5JLH A;  5BR8 K;  3AA4 A;  1XHZ A;  3SPZ A;  3CFO A;  3AGK A;  3ZSY A;  3KVG A;  3CC7 N;  1QHT A;  4DR4 K;  4LH5 A;  4MLH A;  3TU5 A;  2KW4 A;  4C8O A;  4B9N A;  1KTQ A;  4J2E A;  4DQQ A;  4FXD A;  4BVO A;  3EE9 A;  3NVK A;  4EHU A;  4B9U A;  2YNH A;  2WBN A;  3FLC O;  1OVY A;  3VMF B;  5HLF A;  4BC4 A;  4OX9 K;  1NJI O;  1TYQ B;  1ZBF A;  1VQM N;  1YXQ A;  3G6E N;  3FFI A;  4QS8 A;  4WE1 A;  1QS4 A;  1VSL A;  2PFU A;  3ZCM A;  4FPA A;  4B3S K;  4DTN A;  3KKS A;  5J2N A;  3LWM A;  5KRS A;  1L5U A;  3IMX A;  4B1V A;  2F96 A;  3WXL A;  2D1K A;  3R6M A;  2DTU A;  3U9Z A;  2NRT A;  4B9T A;  5KGW A;  4BR5 A;  1RNH A;  4M42 A;  2ITM A;  3B6O A;  2D0C A;  1YUW A;  4BRL A;  4KHY A;  4CVN E;  4FWM A;  1HQE A;  4JI6 K;  1YTU A;  4FL9 A;  3MN9 A;  2Y1J A;  3O9U A;  3FFK B;  5LL6 Z;  3VQ7 A;  1VRT A;  1E4G T;  4NCA A;  3C7N B;  2P9P B;  4BGB A;  5M1K A;  3V9Z A;  3VA3 A;  4GNI A;  1K9M O;  4FJN A;  5HRR A;  3VF6 A;  3AVA A;  2QA4 N;  1ASW A;  3OS2 A;  3K5M A;  4CEB A;  2FF3 B;  4W5Q A;  5K14 A;  3ZSQ A;  2YHX A;  4XIU A;  2G8U A;  3JAM O;  4MO5 A;  4FPB A;  3J7A P;  1HKC A;  3AV9 A;  4O0J A;  4OPH A;  2X6N A;  2VWB A;  3TAM A;  4AHC A;  1HNZ K;  1SV5 A;  4IFE A;  3KLH A;  1CZB A;  3U3Y A;  1QQO A;  1WOQ A;  1XHX A;  5KPZ A;  2VWK A;  3CIP A;  3I8D A;  2O8F A;  1ZBI A;  5AQI A;  3HBT A;  5HP1 A;  3MXI A;  2QI2 A;  1U48 A;  4BRQ A;  1C0F A;  2IVP A;  3KKR A;  4FLY A;  2PY5 A;  3DYA A;  4JHD B;  4TSX A;  3JSM A;  3AO2 A;  1NGC A;  2HHX A;  4OGC A;  3TTD A;  4BE1 A;  1C0U A;  4B1Y B;  3M1F A;  4JK7 A;  4H4M A;  3ENB A;  4DU3 A;  4BAC A;  1JXB A;  4CJ4 A;  3CJC A;  4ZHR A;  4ISG A;  1TK0 A;  1J53 A;  4JK8 A;  4DTX A;  3OJS A;  3CCJ N;  1S6P A;  3V1R A;  4H0V B;  4M7X A;  4CJE A;  4FOI A;  2H3G X;  2FSJ A;  2VG7 A;  3THY A;  3CET A;  2BTF A;  2E6M A;  4B1W B;  4E3S A;  3RTV A;  1ATS A;  3VGM A;  1BCO A;  2G8I A;  3HTV A;  2QWP A;  3M3Z A;  1FJG K;  3DJC A;  2VYP A;  3CC4 N;  3DLE A;  3B8A X;  3HP6 A;  3LAN A;  1BIZ A;  4W5T A;  4DFK A;  2HBM A;  2ZM6 K;  4ELT A;  4KO0 A;  3CPE A;  1I3A A;  5JIC A;  3KLE A;  3J80 O;  2DFE A;  4CJ5 A;  4DG1 A;  1XC9 A;  4B3O A;  1ESV A;  2F7T A;  5TKW A;  3VQP A;  5C25 A;  5ELZ A;  4LSN A;  5AQO A;  5AQN A;  4M63 C;  3WEE B;  4HUG A;  3ATV A;  5FPE A;  1QQN A;  2HBK A;  2W41 A;  3THX B;  1D9F A;  1XNQ K;  3GOI A;  1EWQ A;  5AQH A;  4BR4 A;  1ZBL A;  3WNG A;  3DWL A;  5AR0 A;  3D2E B;  4MQ3 A;  2P9K A;  4A57 A;  4E19 A;  3SK3 A;  4M3X A;  1WNS A;  3HRG A; 
#chains in the Genus database with same CATH homology
 5LMU K;  4NXM K;  5FLX O;  4DV4 K;  4DUY K;  4CW7 B;  5AJ3 K;  4DV0 K;  4JYA K;  4OX9 K;  3T1H K;  4DV3 K;  4JI7 K;  4K0K K;  4LFB K;  2HHH K;  4DR2 K;  4DR7 K;  4B3M K;  4YY3 K;  4B3T K;  4DV1 K;  4DUZ K;  2UUB K;  3OTO K;  4B3S K;  4LFA K;  4NXN K;  4JV5 K;  4JI1 K;  4LF4 K;  1I94 K;  1HNW K;  2UXB K;  4LF6 K;  4LF5 K;  4X65 K;  2UXC K;  1IBM K;  1N34 K;  4LFC K;  5LMN K;  1XMO K;  4LF8 K;  4JI5 K;  4X64 K;  2VQE K;  4CVN E;  4B3R K;  1FJG K;  4JI6 K;  4DV2 K;  4X62 K;  4JI3 K;  4DR3 K;  4DR5 K;  3J81 O;  3J7Y P;  3T1Y K;  4YHH K;  4KHP K;  5IT9 O;  1HR0 K;  2ZM6 K;  4DR6 K;  2VQF K;  5LL6 Z;  4DR1 K;  4LF9 K;  3J80 O;  2UXD K;  4DV5 K;  4JI0 K;  4JI2 K;  1IBK K;  2UU9 K;  1N32 K;  4LF7 K;  1N33 K;  1IBL K;  2UUC K;  4V19 S;  1XNR K;  2UUA K;  1XNQ K;  3JAM O;  4JI4 K;  5IWA K;  5A2Q O;  3J7A P;  5BR8 K;  4AQY K;  1XMQ K;  2F4V K;  4JI8 K;  1N36 K;  4DV7 K;  2E5L K;  1HNZ K;  4DR4 K;  4X66 K;  4DV6 K;  4GKJ K;  1J5E K;  4GKK K;  1HNX K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...