5IWAK

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
115
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
molecule keywords 30S ribosomal protein S2
total genus 25
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2016-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 5iwaK00
1XNRK 4KHPK 2UU9K 4LFAK 3J7YP 5A2QO 2HHHK 4LF5K 3JAMO 4DV1K 4GKKK 4JI0K 4JI8K 1XMOK 4DR4K 4JI3K 4DR5K 4DV4K 2E5LK 2UUAK 4CW7B 4NXNK 2UUCK 4K0KK 4YY3K 2UUBK 4LF6K 4DR6K 4LF8K 4AQYK 4JI6K 5BR8K 4B3RK 1J5EK 4LF9K 2UXBK 4B3MK 1HNXK 1IBLK 1XMQK 4JYAK 2ZM6K 5LMNK 4X64K 4DV0K 4DR1K 4DV2K 2F4VK 4CVNE 5IT9O 3J7AP 4DV5K 1N32K 4NXMK 4DV6K 4LF7K 4B3TK 5AJ3K 5FLXO 4X66K 1IBMK 3OTOK 1IBKK 3J81O 4X65K 1N36K 4JI4K 1XNQK 4OX9K 1FJGK 4X62K 4GKJK 4DUZK 5LL6Z 4DR3K 1I94K 4LFBK 4DV7K 1HNWK 4B3SK 4JI2K 3J80O 3T1HK 1N34K 4JI7K 4YHHK 4DUYK 4LF4K 4JV5K 1HR0K 4DV3K 2UXCK 2VQFK 5LMUK 5IWAK 2VQEK 4DR2K 4JI5K 2UXDK 4V19S 4LFCK 4DR7K 1HNZK 3T1YK 4JI1K 1N33K
chains in the Genus database with same CATH superfamily
1QSYA 4LFAK 3THYB 4WQ4C 5BR9A 3FZMA 3BF1A 3OYDA 5M1OA 1Z05A 4BROA 1NJYA 3DRSA 1UA1A 4NLBA 1T6DA 2WBNA 2BGGA 1RBVA 4CK2A 4O0IA 3HPGA 2O4GA 3SPZA 1OH6A 3G71N 3DOKA 3JYTA 5JS2A 2E2QA 3IG1A 2CH5A 3S3MA 4BRMA 3V6DA 1TUYA 1OVQA 2HHQA 2FXUA 3EL2A 3OYAA 1HNVA 1GLEG 1GOBA 4C23A 5BPNA 4CVNE 3OYBA 3EE9A 3TABA 4LH4A 5HRRA 2W42A 1Q8IA 4B3TK 3NFAA 2IIRA 4FW1A 4IXCA 4Z4GA 2QWQA 1TAUA 1JXBA 3ULEB 3E9OA 4K43A 5AQNA 3NF9A 4OLBA 4QS7A 4DCHA 1E4GT 5AQXA 1N36K 4E89A 4DS4A 5FPDA 1EKEA 2D0OA 5BRDA 2Z1IA 4ISEA 4FLWA 4X62K 2YNHA 4IKFA 1VQ4N 2D0PA 3L0QA 3FZLA 4E3SA 1NBWA 4CF2A 4M63C 4FLUA 1UOCA 3L4QA 1G15A 1BIUA 3TAGA 3OS2A 4U7BA 3MN7A 1J9AA 2KFNA 3SQ0A 1U2VB 4I9LA 2P9PA 4H4MA 3KLFA 1NKBA 3OYFA 5FPEA 3CM6A 2OA8A 2VQEK 2EX3A 1BL3A 4B9SA 4YOUA 5DM6L 4HUFA 4BGBA 1EWRA 1GLAG 2YKNA 2AP1A 3EKSA 3O6WA 4KV8A 1HNZK 1TVRA 1NOYA 2QTDA 3NH0A 4DFPA 3SPYA 3OYNA 1KXPA 2YV0X 5A2QO 2HBLA 3ZSOA 1KAZA 4XIUA 2P1JA 1SZ2A 4CFAA 3QFPA 3C0BA 3SUNA 2P5GA 3MEDA 4E0DA 4JI3K 1RTDA 3TAMA 5HRNA 4KHWA 4IDHA 4DTNA 1YI2N 1LOTB 3O9UA 5BR8K 3DRRA 3VEYA 3G25A 5AQRA 2IVOA 4FPAA 1VAZA 1GLDG 2Q36A 3ZSVA 2Q0RA 4B08A 5J2MA 4MFBA 1KC8O 3KHYA 3CC4N 4FOIA 4CGGA 4XH4A 4Q0BA 3K9KA 1RDDA 5AJ3K 4DSLA 2RKIA 3VGKA 3D6RA 3CMEN 4E7HA 4RG8A 4JK7A 3LDPA 3WXLA 3DM2A 1KD1O 4YORA 5AQYA 4ID1A 2ZD1A 4BVOA 4BC2A 1TAQA 1DGKN 3AY9A 1YUWA 1L3UA 1SUQA 1NJXA 3VEWA 3MX2A 1MA9B 4CJ7A 4ISFA 2Q1NA 3EZWA 1RILA 2YNIA 5DMRA 4CHOA 4OGCA 3CQ8A 3O3GA 1X1PA 4HHTA 2NUBA 1BA0A 4U67L 2AA4A 1LW0A 1ZBUA 4CBXA 4ILGB 1EP4A 2BH1A 3K59A 5LMUK 1NK7A 3AA3A 5J2NA 3U3GA 2FBXA 3AVLA 3HSTB 3OS0A 3OYHA 3O4NA 3WT0A 4OPKA 2NZTA 4CI6A 3SAGA 3HJFA 4NYNA 1UAXA 2O4IA 4NCBA 3H08A 5HRPA 3LZJA 3CJAA 2E1YA 2OPQA 4B9TA 3CCVN 3EN9A 4B1YB 4CFDA 4R79A 1UA0A 4DWIA 1U48A 4N5SA 3GL1A 2FF6A 4YFUA 4DB3A 2EWSA 5DM7L 1F21A 4RW8A 4B9UA 1RDWX 4LF8K 3BF3A 3IS9A 2P5OA 4CJSA 2ZJPL 1KLMA 3TR8A 1D9FA 3MWPA 5CYQA 4OVLA 3KLHA 4YOYA 4JK8A 4DU3A 4BR2A 2E6LA 3OY9A 3OYIA 2FLOA 4BE1A 4BRFA 5FPMA 4NXMK 5HOOA 5FRNA 3ZT4A 1NK6A 3JS6A 1HYVA 3HT3A 3HI0A 4MLHA 2E88A 5FLXO 2HHVA 3ID6A 4W5RA 1ZBLA 3EY1A 1RBTA 2F8SA 3CFOA 4Y0WA 3VTIA 1P90A 3O1WA 4X65K 2A1SA 5AQPA 4JKHA 2ASPA 2YHAA 5ADXA 3AAQA 4F9OA 1Y64A 3RSEB 3VEOA 1VSMA 4CZLA 3F9MA 2X6SA 1XC3A 4QS9A 4JI2K 3W0LA 2HHUA 3LWLA 3RMCA 3H46O 4O8KA 3AV9A 3OYEA 2O8CA 2VQFK 3L2VA 3UB5A 5C2FA 3VGMA 1U47A 4CHYA 2PYJA 1RT6A 5F2RA 2UXDK 1JLEA 3M3ZA 4EHTA 4WFAL 4BE2A 1ASWA 1QE1A 2QWNA 3ZSXA 2KZZA 2BDPA 1VQON 2H3GX 3O5BA 5KQ8A 2F7TA 3U4LA 3ZEUA 5AZJA 3EEQA 4EZ9A 4BQZA 4O5BA 4BDPA 1B9FA 3MDQA 3HXMA 2Z1GA 3GOIA 2NLXA 1Q9XA 1NK4A 4M45A 3NE6A 4DR4K 1ATNA 4CGDA 1FK9A 2F96A 3CCQN 4CIGA 3K5NA 3VF4A 4FWKA 3OJUA 2D1KA 4CJPA 1XUPO 1TK0A 3DXKA 3DXMA 4NLCA 3V1QA 4K42A 1X9WA 3RRGA 1SQKA 1EX4A 1RFQA 2D5RA 4ICLA 2QWMA 1JLQA 2BUPA 1DKGD 1HKBA 4FOEA 1WSHA 4H5TA 1GLLO 4FZXC 2ZWHA 3ZSQA 5HRSA 4JRPA 1TV6A 4DV5K 1YIJN 3K57A 3U3YA 3OBYA 2BANA 1JLCA 1YTAA 4C8LA 1ZBFA 3LP0A 3NGZA 2BTFA 4CGFA 2B4JA 1Q18A 3MXMA 1RTHA 4FWNA 1Z26A 3THYA 3VQ4A 2FSJA 5E26A 3ZEUB 4CGJA 1W2BM 2F9TA 3DLEA 3NGIA 2Q0UA 2VG5A 4O8UA 1RDCA 4J2DA 1S6QA 3PIOL 3J80O 1BWFO 4M3ZA 4DUYK 4HUGA 3KK3A 3FZFA 3TWHA 4IBNA 3H1QA 1NGEA 3LP2A 3TI0A 4LSNA 2RHKA 5GINA 5TKWA 4EIAA 1KTQA 3LPUA 4L8RB 3O3FA 3HPOA 3ZSZA 2JWKA 4BWMA 4DR7K 1WSGA 4IOAL 5BN9A 2YCHA 4JHDB 4E1JA 3KLGA 3VESA 3O3HA 2E20A 2UU9K 2CH6A 4OO1J 4OKKA 1QS4A 4GNIA 1BA1A 5KGXA 2VWJA 4BY9C 1XMOK 3QEWA 4CHZA 1BGXT 3AA4A 2QWOA 3LAMA 1HUXA 2YJEA 2ZGYA 3CI5A 2GUIA 1SAZA 4IOCL 2FF3B 4J2EA 1JCFA 1IKVA 3L2QA 5JLHA 4PKIA 3KTQA 3NF6A 4DSIA 4KI4A 1SL2A 3TSQA 4DQQA 4B3MK 4A2BA 3CJ7A 4WQ5A 1YJNN 1JLBA 4B9QA 5GAGP 3UKUB 4M7YA 2GWJA 4CJKA 5AQWA 1C1BA 3SV4A 3BP8A 3NBPA 3VQCA 1HQEA 3BZCA 1T7PA 4B1UB 3CXCM 3PV8A 3RR7A 3ATUA 2DFFA 3E1YA 3KKSA 3IKMA 1B92A 3G10A 4AHSA 4DS5A 2EHGA 1NGCA 3LM9A 3OA9A 1VQNN 1S3XA 4KB1A 3JSMA 1NM1A 2P9UA 1JCGA 3W3DA 3SLCA 1OH7A 3CQYA 4LSLA 4O0JA 1NGFA 2QXFA 4FJ5A 1TK5A 5AZIB 4BACA 4PL8A 3TANA 5TKYA 5M1QA 1N5YA 3U6FA 1L3TA 4IO8A 4BQLA 3PX0A 1KSPA 4FWSA 1WSIA 5E41A 1QSLA 1TK8A 4CK3A 1X9MA 4N47A 3HL8A 3SBGA 3SZ2A 2OZMA 2Y1IA 3SMPA 1YTUA 3QBXA 4CJRA 3P1GA 4DR2K 1QZ5A 1IG9A 2P9SB 3ASMA 4Z94A 4WF9L 4HVJA 1TGOA 1FKOA 2QXLA 2O8EB 4GY2B 1WNSA 4IZ9A 3TAPA 4M7XA 3QERA 4FJXA 3BDPA 2IVNA 1KRPA 3R3LA 2HMIA 4CZIA 1NK8A 1HX1A 1VSKA 1RDUA 4M41A 2A41A 4ID5A 3LAKA 3SCXA 3M6GA 2P9NB 5AQMA 3KKRA 3KZBA 2P9LA 4C8KA 4FJ9A 2O8EA 5GAHP 2WC9A 3CFPA 4CESA 1WSEA 1IBLK 5M1NA 1LW2A 3QB0A 4KHQA 4B8AB 1HKCA 4B9VA 3DLBA 5IT9O 1S1UA 4RW9A 4IFVA 4E1MA 2NNWA 3CETA 2IGIA 4JKEA 3BY5A 2OANA 4LF7K 4DFKA 4QOZB 3JXUA 2O8BA 3LDNA 4JKBA 3RWUA 4OKEA 3VQAA 2D0AA 4GVEA 4ZHRA 2YHXA 4KTZA 3V9UA 1IBKK 3CQXA 3H1VX 5JVGL 2XO7A 2RN2A 3FFIA 3D2FA 4Z4IA 4CZHA 2V52B 4BRPA 4GW6A 3AO4A 2V7ZA 4H5RA 3QBWA 2GWKA 5KPTA 1FJGK 4FCYA 4C8MA 1IV0A 3VQBA 3E9PA 1HLUA 1LAVA 1S1VA 4N56A 4N41A 4F2SA 1MU2A 1U45A 5AZJB 1IG8A 3NVKA 3ZX0A 3G4SN 4W5OA 3AVHA 5I9EB 2HF3A 1ZC6A 4CEBA 4DSEA 1TKDA 4FJIA 3DRPA 3HM9A 4M3RA 3TTCA 1NJZA 1K8AO 4DF8A 3LM2A 4DSKA 2I7PA 1TUUA 5BREA 3H6EA 2IOCA 4BRDA 3DLKA 4DTRA 1EO1A 4DTJA 1WLJA 2VG6A 3T1YK 1C0TA 4GV9A 1EETA 2VGNA 1RBSA 2F8TA 5M1KA 3SAFA 1RBUA 4H8KA 4KHPK 3ZSRA 1XC9A 1BCOA 1W97L 3HK2A 5C15A 1VQLN 4FJHA 1NKCA 3U9ZA 3IRXA 3AVJA 2B5JA 3RMBA 3FGUA 3TU5A 4K8XA 2X78A 5KRSA 3PX6A 3LP1A 3HM8A 1J54A 1SKSA 4LF6K 1CXUA 2VWKA 4HWIA 4LF9K 4CJEA 4LY7A 4CZGA 5HP1A 3ZSWA 4KHSA 2O8BB 1XMQK 1RT4A 3SUOA 2W6KA 2NRVA 4X64K 3IMXA 1WN7A 3NF7A 1KFDA 1RT5A 1QVGM 5AQVA 4KO0A 2VG7A 4BRNA 5BN8A 3EZ5A 3V9SA 3O9QA 1YJ9N 1N6QA 4JD2A 1VQMN 1X9JA 4PKGA 2KFZA 3A0IX 1T05A 2P9LB 4B8CA 2P9UB 4FVMA 3WNEA 1NK5A 3HP6A 1NK9A 4BR4A 3AVFA 3K0SA 5K14A 2RPIA 3T69A 5AQKA 2HHTA 4EP4A 3CCMN 1O13A 5LL6Z 3OJSA 5LY3A 5JICA 3AVMA 4A59A 2A42A 2ASMA 2OPRA 4GMJB 1Q82O 4FJKA 1NMDA 1BIZA 3T1HK 1ILYA 1V4SA 4FJGA 4F3TA 3G6EN 4DU4A 1NGIA 4IJAA 4LF4K 2O8CB 1QQMA 2HBKA 4FWQA 1NJWA 1NG9A 3UE5A 3QESA 4JS5A 4MLEA 5D3GA 3QEIA 2YI1A 4BC4A 2PFUA 4RW6A 2WTUA 4CEQA 1KAYA 2G8WA 1ZBIA 3DWLA 5AQOA 1HRHA 1XQSC 1TL1A 4XH5A 2IAJA 3CJ9A 3JAMO 3OW2M 4KHNA 1Q9YA 3L8BA 4PQUA 1H1VA 3FR0A 4KTWA 5CR4A 3CCSN 2XY7A 4DV4K 2UUAK 4Z4EA 3V9ZA 3M8PA 3DLHA 4NB4A 2IDOA 1A5WA 4NYFA 4Y1DA 4ZTFA 4G1QA 1M1KO 4BRHA 4BC5A 1KVBA 4CF1A 2ITMA 2KHOA 3M5RA 3C6HA 1KVCA 3THVA 4G9ZA 2XY5A 4CJ4A 4H0YB 4YOVA 1C1CA 3H45C 5M1FA 3H3NO 4CF8A 4FJLA 2ZGZA 5FDLA 3OYJA 2DY4A 3ULDA 3SUPA 4F4KA 2ZE2A 4K41A 3KJVA 2YJFA 4BGAA 4FK4A 3KIOA 2NRHA 1TKTA 4K25A 1IBMK 3I8DA 4IG3A 2DFEA 5C12A 4OPAA 1T8EA 4I9QA 3OTOK 1IKWA 2YNFA 2HVHA 1J53A 3P31A 2G8HA 2NRXA 3I0SA 4K8ZA 1VSDA 2E1ZA 3KK1A 1ATSA 4IEEA 5F0XA 3LDLA 5C10A 5ELZA 3VPZA 4DUZK 1EXQA 3E01A 2PYLA 2P9SA 1NLVA 2W40A 3C94A 4B3SK 4M3UA 2B6AA 4RCHA 5DK5A 3AARA 3CD6N 2HMPA 4JKDA 3M8SA 1N34K 4JHDA 1RT1A 5CE3A 2PAVA 3UKRB 1K9MO 1OVYA 1U04A 1TKXA 4IO9L 3ZT3A 2ITGA 5GAEP 4F8RA 2QW9A 3QNNA 1RCHA 1BQNA 2NRZA 2W41A 3DXKB 3MEGA 2YX6A 3N4QA 3L2UA 3KK2A 3TARA 4A5AA 3OS1A 3RMAA 4OPHA 3NHGA 4DQIA 1K8KB 1NGHA 5J1EA 4B9MA 1OH8A 4H4OA 2OZSA 3PUFA 3J7YP 3O9TA 4RWTA 4JS4A 1WB9A 1KQSM 1TKZA 5AQUA 4JI8K 4FLYA 1HPZA 3WNFA 4WQ5C 4CW7B 1BOTO 1W7AA 3WQUA 1WOQA 4CJQA 3V1OA 4EFHA 2FSNA 4AILC 3MXIA 3TSUA 1K8KA 3SV3A 1J5EK 5FRMA 3E9LA 4IWVA 3FE1A 5BRFA 4H0VB 2LSNA 1QQOA 2RE2A 1NGGA 5EOYA 3B6OA 1LV5A 3U8XA 4PL7A 2P9KA 1N32K 3S3NA 1T03A 5AQJA 1EWQA 2YNGA 4FJMA 1GLCG 1YJWN 4OLAA 4X66K 3AO1A 1SKRA 2FBYA 3D0PA 2QEXN 1WSFA 3VENA 4KBOA 5C24A 1S1TA 3QEXA 3D2FB 1VSJA 4F3OA 1X3NA 2HHXA 1RT3A 1HJRA 4GKJK 4DQ8A 5AQZA 1R59O 2HBJA 3TPQA 3CC7N 4EHUA 1W0HA 4FWPA 3P38A 4B1ZA 2OYQA 4XH1A 4QAGA 4E19A 3OBWA 1VQKN 4A61A 4HTLA 4DTPA 4JLHA 2HOEA 2HNDA 2P9PB 3MCAB 2XY8A 3WXKA 5KPRA 3B8AX 3O4QA 3VA0A 3ZX2A 1ASUA 5I3UA 4IJNA 3T19A 1U6ZA 3ZSYA 1RGIA 3NGYA 1V4TA 3FLCO 4CZKA 1JLAA 2A5XA 5CHIA 1S72N 4PHTX 1BU6O 2KW4A 4BRAA 4DHYA 1S22A 3R8EA 3S3OA 1ESVA 4ELTA 4MDBA 4NCGA 2Z1HA 1C0UA 2PY5A 2VWBA 3G0ZA 3ENBA 1T6CA 3KWGA 2QA4N 2JWLA 4JI6K 4DSJA 4DQSA 5BRHA 4A57A 4FLZA 3BGRA 4BWJA 5E84A 1IKYA 4BDZA 4OPJA 2W6LA 5EU7A 4CJ3A 5AQHA 3HVTA 3DI6A 3MN6A 3OHRA 5JLFA 3E66A 1HYSA 4DTUA 2F4VK 1NJIO 1J6ZA 2BE2A 4E7IA 1UWBA 1LWEA 2FSKA 1ZBHA 3VA3A 2Q2RA 3UIQA 5CZ1A 5GADP 1VSFA 2ZF5O 4OJRA 3L2WA 2CGLA 4M3WA 4Z0UA 4LC9B 5HLFA 3I8BA 2A40A 4YNQA 3ALYA 5T7BA 3CPEA 2VCPA 2ASOA 4DQRA 3HOSA 5SWMA 3MAQA 4YOTA 3WXIA 1RT2A 3GE1A 5FROA 3VQPA 1Y97A 3NAEA 4CBUA 1KFSA 3HO1A 1T3VA 2Q3SA 4H03B 2P9IB 3T1AA 3QNOA 3WUHA 4IDKA 4I6MB 1G99A 1QZ6A 1NNEA 2HBMA 5KPZA 4BDYA 1K6YA 4JV5K 1ATRA 3WEEA 5HBMA 2XRIA 3ATVA 3Q7CA 2QWLA 3AVBA 3ID8A 3SI6A 3EE8A 3ZYYX 4AHTA 4GV3A 4DSFA 4OKJA 4JI5K 1KLNA 3HYFA 4UY8O 1D8YA 4CCHA 2P9IA 4HTUA 3AVIA 4H0XB 3RSEA 3VTHA 3NH1A 4JI1K 2FBTA 3AO2A 4FJNA 1VQPN 4NO7A 3O1BA 1BG3A 4O44A 4HUEA 4QS8A 3QEVA 3MECA 2XHBA 3SK3A 4KI6A 1BCMA 2RF2A 2UYTA 4GKKK 3TAFA 1U4BA 4DTXA 4DR5K 3MCPA 3CJBA 2D4WA 2QI2A 4FM2A 4CJUA 2DPNA 3AVNA 2HNZA 3C7NA 1CXQA 2YHBA 4M3TA 4B3RK 1SKWA 2VYPA 1C0MA 3A5MC 3TAQA 4KRFA 3QEPA 1OH5A 2ZM6K 4DV0K 4CFBA 3V4IA 3D2EA 2GX9A 2QKBA 4CFCA 4CD1A 3O4WA 2A6AA 4I2QA 5AQLA 4I2PA 2G8KA 1ASVA 5AQGA 3QDKA 1DTTA 2O8DA 3LANA 3ZLJA 3WXMB 1S1WA 3CERA 4KH4A 1J5OA 1GLJO 1JL2A 3QFUA 4CF0A 4OX9K 3KD1E 4H0OA 3HVRA 5JVHL 4AHRA 1MWMA 4Z4CA 3CMAN 5MLCQ 3THXA 3HTVA 4B9LA 4KH6A 4AM6A 4B3OA 1RTIA 3AAPA 3VF6A 3QINA 3H3OB 3VEVA 1GLBG 2E2PA 3NDKA 4E1NA 3M1FA 3ZT2A 1VQ6N 4KHUA 4FLVA 1XI1A 3L6QA 1L3VA 4IFEA 5EVZA 4B9NA 3C65A 1FXXA 3R1XA 3O08A 1QHTA 4YOWA 4Y1CA 5AQTA 4HCBA 3C7NB 3SBTA 1SL1A 4DF4A 3VMFB 4N76A 3CFRA 2P51A 4DLGA 3LDOA 3IDHA 3LZIA 3O8MA 3VEXA 2J4RA 4AHVA 2HNYA 5AR0A 2HSTA 4FL9A 3C6AA 1VSEA 3ISNC 4FJJA 3B6PA 2HHHK 1B9DA 1NK0A 4QCLA 4O55A 4CEDA 1RDBA 1IH7A 3NVMA 1CZ9A 4M42A 1ZBSA 1CZBA 2E5LK 1QQCA 1TYQB 4CHQA 3LALA 4KH5A 2ATQA 3SQ4A 4AQYK 3TAEA 3V1RA 3SNNA 2QWRA 3ULEA 2UXBK 1NGBA 3CYMA 3TTFA 3O9RA 2KKZA 5LMNK 1HJOA 1WAFA 3A5LC 3LL3A 3MWTA 2HHWA 3GDQA 5H1SQ 1NGJA 1A5VA 3RRHA 3CF5L 3P39A 3VQEA 1XWLA 1HKGA 4JK9A 5KI6A 3AO3A 4BR9A 2CGJA 4WFNL 3Q7BA 4CERA 1E3MA 2OCEA 2QK9A 4CJFA 3EYZA 1JKHA 4DTMA 5C25A 3CC2N 4DMNA 3HOTA 1SL0A 3ZETB 1JL1A 1QTMA 4DR3K 1Z25A 1D5AA 1VK0A 5LJVA 4LFBK 2PBDA 2E2OA 2NRTA 3F5TA 2OTLN 4GV6A 4CGIA 1NGAA 1NKEA 3MN5A 4IOXA 4CJLA 3FZHA 3PSFA 1A5XA 4ELUA 1XHZA 3T7ZA 3CPWM 1Q81O 4FVUA 1U2VA 1IO2A 3EKUA 2QKKA 3UKRA 4WE1A 1CZAN 1R0AA 1YF5L 3K9JA 4BRIA 3K5MA 4CEOA 4FWMA 3VERA 3HSCA 3VQQA 1YVUA 3DMJA 4WQ4A 1U49A 3SAHA 4Z4FA 4RTFD 3KVGA 4IFYA 4KB0A 4KKOA 4W5QA 1SV5A 3EO3A 3THWB 3D7EO 4H5WA 1IKXA 4H0PA 5BPLA 3BUZB 3AVCA 4CZJA 4F2RA 1NGDA 4FJ8A 3RTVA 4KTQA 1DEJA 4IG0A 2IVPA 3AGRA 3DAWA 1JLGA 4JNEA 4CECA 4CE9A 4CGHA 2KTQA 2G8IA 5EY4A 1VHXA 1HPMA 2XY6A 4YY3K 3A5NC 4JRQA 4FWLA 2ZJQL 3DOLA 1VRTA 4C8NA 1SS6A 4ZTJA 5C42A 3M8QA 4BR7A 3QLHA 4EZ6A 3ITHA 3LDSA 3S9HA 4B1XB 1KCFA 1E4FT 1P8ZA 1YAGA 4DFJA 5I42A 2WUSA 1W9HA 3M8RA 1FW6A 3VEZA 3DLLL 4DR1K 1RBRA 3S41A 4JKGA 4Q5VA 4DV2K 3TTDA 2E8AA 4O4GA 4FYDA 3SQ2A 3KD5E 4JKGB 1HQUA 4DV6K 4MDAA 4MQ3A 3NF8A 3BEXA 3ZT0A 2YHWA 3AO5A 3CCRN 5AFUA 1YHQN 2PZSA 3PSIA 2P9NA 1VQ8N 1VSLA 4WFBL 3PIPL 3IAYA 3AGKA 5CY4A 4DTSA 4FM0A 3THXB 4CJTA 3PY8A 3VQ6A 3WNGA 4A2AA 4BRLA 1DLOA 2OTJN 4FM1A 2E4LA 2X74A 3VGLA 2NRWA 1I94K 4DV7K 1S1XA 4H5VA 3V9WA 3ZX3A 1HNWK 4W5TA 1T44A 2HW3A 4C8OA 2D0BA 3VQ9A 3AA5X 2GUPA 2WONA 4MO4A 5SZTA 1ZYQA 2NRRA 1YT3A 5AQIA 1HR0K 4AHUA 3U9DA 4DV3K 4FZYA 4CJ5A 3O9SA 3ENOA 1JLFA 1VQ9N 4J2BA 3WXJA 3AVAA 1NU0A 3CG7A 4V19S 1D9DA 4KFBA 5C0YA 4O5FA 1RTJA 4PY5A 5AQFA 4YOXA 1NMNA 2GEMA 4KPYA 1Q86O 4CIEA 5AZIA 2GELA 2YHYA 5AFUH 4BG9A 3I0RA 3K2PA 1HYZA 4BRQA 4JI0K 3ZETA 4CEAA 4JEPA 3J7ZO 2UUCK 4K0KK 4ISGA 1RNHA 4JD2B 2I7NA 3DJCA 3HBTA 5AQSA 3PO4A 2UUBK 3CCJN 1C0FA 4KREA 3LP3A 1BHLA 2IS3A 2Y1JA 2GBZA 4KAZA 4ILHA 2I5JA 4MO5A 5F1XA 3QO9A 3FFKB 2O8FB 4J8FA 4JKAA 1X3MA 3UKUA 3J7AP 4YDUA 4L3QA 4FLTA 1QHAA 4LH5A 2JGUA 3HRGA 4B1WB 1VQ7N 3WEEB 3C6TA 3SJJA 4EP5A 2X6NA 1NOZA 4XEIA 2JLEA 5HROA 1M90O 3P5JA 4ILJA 4JKCA 1TL3A 2OPPA 4CHPA 3L3UA 3A8YA 4CBWA 2D0CA 4BREA 3DLGA 1L5UA 3AVKA 1I3AA 1RDAA 5KGWA 4FPBA 3IUCA 4JI4K 4LD0A 5GIOA 4FLXA 3THWA 4FJ7A 4FXDA 1BISA 2VGMA 3SJHA 4PWDA 1ITGA 1KAXA 4FK2A 1S9GA 3MX5A 4ELVA 4JN4A 2Q97A 4BVPA 4C1NK 4FZZA 1EQYA 3OYMA 1Q7YO 4E7LA 4CEEA 3KLEA 3A2FA 3L2RA 4JI7K 2DTUA 4FK0A 1S5JA 1HMVA 3HZ6A 4DKWA 1C6VA 4Z4HA 4R5PA 3NCIA 1S6PA 2QWPA 2UXCK 2Q31A 1LWFA 1LCUA 5IWAK 1S9EA 1ZXOA 1L3SA 3VN5A 2Z1JA 4GVMA 1Z6RA 1WBBA 4BG8A 3GG4A 3MK6A 5KQDA 1N8RO 3LPTA 2ETJA 3GBTA 3PLAA 1WSJA 3KLIA 2GTDA 1O1WA 3O80A 1K73O 4E7JA 1XNRK 3HPHA 1C0GA 3QMLA 1FKPA 3VQDA 4DV1K 4CZEA 3DLRA 1WUAA 5HL7L 1QSSA 1IJJA 3RVCA 1BI4B 1YVNA 1VRUA 3VQ8A 4YDUC 4TSXA 4NXNK 1OKJA 5GIPA 3VETA 3CCLN 1MDUB 4CZFA 2KQ2A 1I39A 5CZ2A 3R6MA 4FWOA 4BR5A 4CZMA 3RR8A 4DR6K 1WAJA 4DTOA 1JXEA 3CM5A 3P83D 1XHXA 3C95A 4H5NA 4AH9A 5J2PA 1X9SA 5EXWA 4CIFA 3OYLA 2YKMA 1VSHA 2ZQBA 3HP9A 3AA2A 4A5BA 3AVGA 3CHWA 3PO5A 4BRKA 4BRCA 4DU1A 3CIPA 4IEIA 5FPNA 3J8AA 3RMDA 2E6MA 4JAXA 2GV9A 3C6UA 3QIPA 4AM7A 4CD3A 3IFRA 2A3ZA 3MEEA 3DXMB 2WOMA 3J81O 3I33A 4JKFA 2F9WA 5ADXH 4C1NI 4EAHD 2IC3A 4W5NA 4H0TB 1YXQA 4BR0A 2KZMA 5EX5A 4DG1A 4CJWA 4BC3A 4PKHA 4UQGA 1VQ5N 4AHCA 3BZKA 3MXJA 4PA1A 4CJVA 3MMVA 4BRGA 4M3YA 1BDGA 3PX4A 5CYMA 2HVIA 5LJWA 3WNHA 3KWIA 3ZCMA 1GLFO 1GOCA 3F2KA 3OVNA 4J2AA 2A1RA 2FC0A 1KVAA 4PUOA 2CGKA 1RT7A 4E7KA 2V51B 3D45A 2G8FA 4RW7A 1LWCA 1YITN 2DFHA 3K5LA 3NMUA 1N33K 4CEFA 3VOVA 2V7YA 4OGEA 3ZT1A 3CCUN 1BQMA 4LF5K 3F73A 5M1PA 2AJQA 1TYQA 3T3FA 1BI4A 3TSPA 3WQTA 3V9XA 2R7YA 4FO0A 5KTQA 4BE0A 4DQPA 5KRTA 3CCEN 4NCAA 4CF9A 3V81A 1D4XA 3SMSA 3K58A 3KK7A 3LDQA 5BPMA 2O8FA 3L4IA 1HNIA 1HNXK 4JYAK 5JMVA 3QETA 1GOAA 2WFBA 3QICA 2G8UA 3R9PA 1WBDA 2KLAA 1BUPA 2E2NA 5AQQA 3SYZA 3CJ1A 3N4PA 4CEZA 2ZJRL 2OPSA 2G8VA 1MWKA 3VQ5A 3FZKA 3OYKA 3K5OA 3F9KA 1BO5O 3QIOA 1XNQK 3MN9A 1JCEA 1QQNA 2HB5A 3SQ1A 1LAWA 4FW2A 4WYBA 1NWKA 4M3XA 5JS1A 4KHYA 1DTQA 4HCCA 4RW4A 2QM1A 4B1VA 4CK1A 4A62A 3VF2A 3CJCA 4WCEL 1C1AA 2P9KB 5J2QA 4I7FA 3DYAA 4YHHK 4FWRA 5C2DA 2O8DB 1JJ2M 4AF1A 3OYCA 1VSIA 3LWMA 3P4IA 3SUQA 2HF4A 3L3VA 5B8HA 4DFMA 3ENHA 1CLQA 1QVFM 4DLEA 3OYGA 2FBVA 4I6MA 3D2EB 4FSVA 3A5OC 3VQ7A 4LFCK 1REVA 3I56N 3I55N 4CHNA 3NH2A 2HHSA 1DT9A
chains in the Genus database with same CATH topology
1XNRK 4KHPK 2UU9K 4LFAK 3J7YP 5A2QO 2HHHK 4LF5K 3JAMO 4DV1K 4GKKK 4JI0K 4JI8K 1XMOK 4DR4K 4JI3K 4DR5K 4DV4K 2E5LK 2UUAK 4CW7B 4NXNK 2UUCK 4K0KK 4YY3K 2UUBK 4LF6K 4DR6K 4LF8K 4AQYK 4JI6K 5BR8K 4B3RK 1J5EK 4LF9K 2UXBK 4B3MK 1HNXK 1IBLK 1XMQK 4JYAK 2ZM6K 5LMNK 4X64K 4DV0K 4DR1K 4DV2K 2F4VK 4CVNE 5IT9O 3J7AP 4DV5K 1N32K 4NXMK 4DV6K 4LF7K 4B3TK 5AJ3K 5FLXO 4X66K 1IBMK 3OTOK 1IBKK 3J81O 4X65K 1N36K 4JI4K 1XNQK 4OX9K 1FJGK 4X62K 4GKJK 4DUZK 5LL6Z 4DR3K 1I94K 4LFBK 4DV7K 1HNWK 4B3SK 4JI2K 3J80O 3T1HK 1N34K 4JI7K 4YHHK 4DUYK 4LF4K 4JV5K 1HR0K 4DV3K 2UXCK 2VQFK 5LMUK 5IWAK 2VQEK 4DR2K 4JI5K 2UXDK 4V19S 4LFCK 4DR7K 1HNZK 3T1YK 4JI1K 1N33K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR K;  4KHP K;  2UU9 K;  4LFA K;  3J7Y P;  5A2Q O;  2HHH K;  4LF5 K;  3JAM O;  4DV1 K;  4GKK K;  4JI0 K;  4JI8 K;  1XMO K;  4DR4 K;  4JI3 K;  4DR5 K;  4DV4 K;  2E5L K;  2UUA K;  4CW7 B;  4NXN K;  2UUC K;  4K0K K;  4YY3 K;  2UUB K;  4LF6 K;  4DR6 K;  4LF8 K;  4AQY K;  4JI6 K;  5BR8 K;  4B3R K;  1J5E K;  4LF9 K;  2UXB K;  4B3M K;  1HNX K;  1IBL K;  1XMQ K;  4JYA K;  2ZM6 K;  5LMN K;  4X64 K;  4DV0 K;  4DR1 K;  4DV2 K;  2F4V K;  4CVN E;  5IT9 O;  3J7A P;  4DV5 K;  1N32 K;  4NXM K;  4DV6 K;  4LF7 K;  4B3T K;  5AJ3 K;  5FLX O;  4X66 K;  1IBM K;  3OTO K;  1IBK K;  3J81 O;  4X65 K;  1N36 K;  4JI4 K;  1XNQ K;  4OX9 K;  1FJG K;  4X62 K;  4GKJ K;  4DUZ K;  5LL6 Z;  4DR3 K;  1I94 K;  4LFB K;  4DV7 K;  1HNW K;  4B3S K;  4JI2 K;  3J80 O;  3T1H K;  1N34 K;  4JI7 K;  4YHH K;  4DUY K;  4LF4 K;  4JV5 K;  1HR0 K;  4DV3 K;  2UXC K;  2VQF K;  5LMU K;  5IWA K;  2VQE K;  4DR2 K;  4JI5 K;  2UXD K;  4V19 S;  4LFC K;  4DR7 K;  1HNZ K;  3T1Y K;  4JI1 K;  1N33 K; 
#chains in the Genus database with same CATH topology
 1QSY A;  4LFA K;  3THY B;  4WQ4 C;  5BR9 A;  3FZM A;  3BF1 A;  3OYD A;  5M1O A;  1Z05 A;  4BRO A;  1NJY A;  3DRS A;  1UA1 A;  4NLB A;  1T6D A;  2WBN A;  2BGG A;  1RBV A;  4CK2 A;  4O0I A;  3HPG A;  2O4G A;  3SPZ A;  1OH6 A;  3G71 N;  3DOK A;  3JYT A;  5JS2 A;  2E2Q A;  3IG1 A;  2CH5 A;  3S3M A;  4BRM A;  3V6D A;  1TUY A;  1OVQ A;  2HHQ A;  2FXU A;  3EL2 A;  3OYA A;  1HNV A;  1GLE G;  1GOB A;  4C23 A;  5BPN A;  4CVN E;  3OYB A;  3EE9 A;  3TAB A;  4LH4 A;  5HRR A;  2W42 A;  1Q8I A;  4B3T K;  3NFA A;  2IIR A;  4FW1 A;  4IXC A;  4Z4G A;  2QWQ A;  1TAU A;  1JXB A;  3ULE B;  3E9O A;  4K43 A;  5AQN A;  3NF9 A;  4OLB A;  4QS7 A;  4DCH A;  1E4G T;  5AQX A;  1N36 K;  4E89 A;  4DS4 A;  5FPD A;  1EKE A;  2D0O A;  5BRD A;  2Z1I A;  4ISE A;  4FLW A;  4X62 K;  2YNH A;  4IKF A;  1VQ4 N;  2D0P A;  3L0Q A;  3FZL A;  4E3S A;  1NBW A;  4CF2 A;  4M63 C;  4FLU A;  1UOC A;  3L4Q A;  1G15 A;  1BIU A;  3TAG A;  3OS2 A;  4U7B A;  3MN7 A;  1J9A A;  2KFN A;  3SQ0 A;  1U2V B;  4I9L A;  2P9P A;  4H4M A;  3KLF A;  1NKB A;  3OYF A;  5FPE A;  3CM6 A;  2OA8 A;  2VQE K;  2EX3 A;  1BL3 A;  4B9S A;  4YOU A;  5DM6 L;  4HUF A;  4BGB A;  1EWR A;  1GLA G;  2YKN A;  2AP1 A;  3EKS A;  3O6W A;  4KV8 A;  1HNZ K;  1TVR A;  1NOY A;  2QTD A;  3NH0 A;  4DFP A;  3SPY A;  3OYN A;  1KXP A;  2YV0 X;  5A2Q O;  2HBL A;  3ZSO A;  1KAZ A;  4XIU A;  2P1J A;  1SZ2 A;  4CFA A;  3QFP A;  3C0B A;  3SUN A;  2P5G A;  3MED A;  4E0D A;  4JI3 K;  1RTD A;  3TAM A;  5HRN A;  4KHW A;  4IDH A;  4DTN A;  1YI2 N;  1LOT B;  3O9U A;  5BR8 K;  3DRR A;  3VEY A;  3G25 A;  5AQR A;  2IVO A;  4FPA A;  1VAZ A;  1GLD G;  2Q36 A;  3ZSV A;  2Q0R A;  4B08 A;  5J2M A;  4MFB A;  1KC8 O;  3KHY A;  3CC4 N;  4FOI A;  4CGG A;  4XH4 A;  4Q0B A;  3K9K A;  1RDD A;  5AJ3 K;  4DSL A;  2RKI A;  3VGK A;  3D6R A;  3CME N;  4E7H A;  4RG8 A;  4JK7 A;  3LDP A;  3WXL A;  3DM2 A;  1KD1 O;  4YOR A;  5AQY A;  4ID1 A;  2ZD1 A;  4BVO A;  4BC2 A;  1TAQ A;  1DGK N;  3AY9 A;  1YUW A;  1L3U A;  1SUQ A;  1NJX A;  3VEW A;  3MX2 A;  1MA9 B;  4CJ7 A;  4ISF A;  2Q1N A;  3EZW A;  1RIL A;  2YNI A;  5DMR A;  4CHO A;  4OGC A;  3CQ8 A;  3O3G A;  1X1P A;  4HHT A;  2NUB A;  1BA0 A;  4U67 L;  2AA4 A;  1LW0 A;  1ZBU A;  4CBX A;  4ILG B;  1EP4 A;  2BH1 A;  3K59 A;  5LMU K;  1NK7 A;  3AA3 A;  5J2N A;  3U3G A;  2FBX A;  3AVL A;  3HST B;  3OS0 A;  3OYH A;  3O4N A;  3WT0 A;  4OPK A;  2NZT A;  4CI6 A;  3SAG A;  3HJF A;  4NYN A;  1UAX A;  2O4I A;  4NCB A;  3H08 A;  5HRP A;  3LZJ A;  3CJA A;  2E1Y A;  2OPQ A;  4B9T A;  3CCV N;  3EN9 A;  4B1Y B;  4CFD A;  4R79 A;  1UA0 A;  4DWI A;  1U48 A;  4N5S A;  3GL1 A;  2FF6 A;  4YFU A;  4DB3 A;  2EWS A;  5DM7 L;  1F21 A;  4RW8 A;  4B9U A;  1RDW X;  4LF8 K;  3BF3 A;  3IS9 A;  2P5O A;  4CJS A;  2ZJP L;  1KLM A;  3TR8 A;  1D9F A;  3MWP A;  5CYQ A;  4OVL A;  3KLH A;  4YOY A;  4JK8 A;  4DU3 A;  4BR2 A;  2E6L A;  3OY9 A;  3OYI A;  2FLO A;  4BE1 A;  4BRF A;  5FPM A;  4NXM K;  5HOO A;  5FRN A;  3ZT4 A;  1NK6 A;  3JS6 A;  1HYV A;  3HT3 A;  3HI0 A;  4MLH A;  2E88 A;  5FLX O;  2HHV A;  3ID6 A;  4W5R A;  1ZBL A;  3EY1 A;  1RBT A;  2F8S A;  3CFO A;  4Y0W A;  3VTI A;  1P90 A;  3O1W A;  4X65 K;  2A1S A;  5AQP A;  4JKH A;  2ASP A;  2YHA A;  5ADX A;  3AAQ A;  4F9O A;  1Y64 A;  3RSE B;  3VEO A;  1VSM A;  4CZL A;  3F9M A;  2X6S A;  1XC3 A;  4QS9 A;  4JI2 K;  3W0L A;  2HHU A;  3LWL A;  3RMC A;  3H46 O;  4O8K A;  3AV9 A;  3OYE A;  2O8C A;  2VQF K;  3L2V A;  3UB5 A;  5C2F A;  3VGM A;  1U47 A;  4CHY A;  2PYJ A;  1RT6 A;  5F2R A;  2UXD K;  1JLE A;  3M3Z A;  4EHT A;  4WFA L;  4BE2 A;  1ASW A;  1QE1 A;  2QWN A;  3ZSX A;  2KZZ A;  2BDP A;  1VQO N;  2H3G X;  3O5B A;  5KQ8 A;  2F7T A;  3U4L A;  3ZEU A;  5AZJ A;  3EEQ A;  4EZ9 A;  4BQZ A;  4O5B A;  4BDP A;  1B9F A;  3MDQ A;  3HXM A;  2Z1G A;  3GOI A;  2NLX A;  1Q9X A;  1NK4 A;  4M45 A;  3NE6 A;  4DR4 K;  1ATN A;  4CGD A;  1FK9 A;  2F96 A;  3CCQ N;  4CIG A;  3K5N A;  3VF4 A;  4FWK A;  3OJU A;  2D1K A;  4CJP A;  1XUP O;  1TK0 A;  3DXK A;  3DXM A;  4NLC A;  3V1Q A;  4K42 A;  1X9W A;  3RRG A;  1SQK A;  1EX4 A;  1RFQ A;  2D5R A;  4ICL A;  2QWM A;  1JLQ A;  2BUP A;  1DKG D;  1HKB A;  4FOE A;  1WSH A;  4H5T A;  1GLL O;  4FZX C;  2ZWH A;  3ZSQ A;  5HRS A;  4JRP A;  1TV6 A;  4DV5 K;  1YIJ N;  3K57 A;  3U3Y A;  3OBY A;  2BAN A;  1JLC A;  1YTA A;  4C8L A;  1ZBF A;  3LP0 A;  3NGZ A;  2BTF A;  4CGF A;  2B4J A;  1Q18 A;  3MXM A;  1RTH A;  4FWN A;  1Z26 A;  3THY A;  3VQ4 A;  2FSJ A;  5E26 A;  3ZEU B;  4CGJ A;  1W2B M;  2F9T A;  3DLE A;  3NGI A;  2Q0U A;  2VG5 A;  4O8U A;  1RDC A;  4J2D A;  1S6Q A;  3PIO L;  3J80 O;  1BWF O;  4M3Z A;  4DUY K;  4HUG A;  3KK3 A;  3FZF A;  3TWH A;  4IBN A;  3H1Q A;  1NGE A;  3LP2 A;  3TI0 A;  4LSN A;  2RHK A;  5GIN A;  5TKW A;  4EIA A;  1KTQ A;  3LPU A;  4L8R B;  3O3F A;  3HPO A;  3ZSZ A;  2JWK A;  4BWM A;  4DR7 K;  1WSG A;  4IOA L;  5BN9 A;  2YCH A;  4JHD B;  4E1J A;  3KLG A;  3VES A;  3O3H A;  2E20 A;  2UU9 K;  2CH6 A;  4OO1 J;  4OKK A;  1QS4 A;  4GNI A;  1BA1 A;  5KGX A;  2VWJ A;  4BY9 C;  1XMO K;  3QEW A;  4CHZ A;  1BGX T;  3AA4 A;  2QWO A;  3LAM A;  1HUX A;  2YJE A;  2ZGY A;  3CI5 A;  2GUI A;  1SAZ A;  4IOC L;  2FF3 B;  4J2E A;  1JCF A;  1IKV A;  3L2Q A;  5JLH A;  4PKI A;  3KTQ A;  3NF6 A;  4DSI A;  4KI4 A;  1SL2 A;  3TSQ A;  4DQQ A;  4B3M K;  4A2B A;  3CJ7 A;  4WQ5 A;  1YJN N;  1JLB A;  4B9Q A;  5GAG P;  3UKU B;  4M7Y A;  2GWJ A;  4CJK A;  5AQW A;  1C1B A;  3SV4 A;  3BP8 A;  3NBP A;  3VQC A;  1HQE A;  3BZC A;  1T7P A;  4B1U B;  3CXC M;  3PV8 A;  3RR7 A;  3ATU A;  2DFF A;  3E1Y A;  3KKS A;  3IKM A;  1B92 A;  3G10 A;  4AHS A;  4DS5 A;  2EHG A;  1NGC A;  3LM9 A;  3OA9 A;  1VQN N;  1S3X A;  4KB1 A;  3JSM A;  1NM1 A;  2P9U A;  1JCG A;  3W3D A;  3SLC A;  1OH7 A;  3CQY A;  4LSL A;  4O0J A;  1NGF A;  2QXF A;  4FJ5 A;  1TK5 A;  5AZI B;  4BAC A;  4PL8 A;  3TAN A;  5TKY A;  5M1Q A;  1N5Y A;  3U6F A;  1L3T A;  4IO8 A;  4BQL A;  3PX0 A;  1KSP A;  4FWS A;  1WSI A;  5E41 A;  1QSL A;  1TK8 A;  4CK3 A;  1X9M A;  4N47 A;  3HL8 A;  3SBG A;  3SZ2 A;  2OZM A;  2Y1I A;  3SMP A;  1YTU A;  3QBX A;  4CJR A;  3P1G A;  4DR2 K;  1QZ5 A;  1IG9 A;  2P9S B;  3ASM A;  4Z94 A;  4WF9 L;  4HVJ A;  1TGO A;  1FKO A;  2QXL A;  2O8E B;  4GY2 B;  1WNS A;  4IZ9 A;  3TAP A;  4M7X A;  3QER A;  4FJX A;  3BDP A;  2IVN A;  1KRP A;  3R3L A;  2HMI A;  4CZI A;  1NK8 A;  1HX1 A;  1VSK A;  1RDU A;  4M41 A;  2A41 A;  4ID5 A;  3LAK A;  3SCX A;  3M6G A;  2P9N B;  5AQM A;  3KKR A;  3KZB A;  2P9L A;  4C8K A;  4FJ9 A;  2O8E A;  5GAH P;  2WC9 A;  3CFP A;  4CES A;  1WSE A;  1IBL K;  5M1N A;  1LW2 A;  3QB0 A;  4KHQ A;  4B8A B;  1HKC A;  4B9V A;  3DLB A;  5IT9 O;  1S1U A;  4RW9 A;  4IFV A;  4E1M A;  2NNW A;  3CET A;  2IGI A;  4JKE A;  3BY5 A;  2OAN A;  4LF7 K;  4DFK A;  4QOZ B;  3JXU A;  2O8B A;  3LDN A;  4JKB A;  3RWU A;  4OKE A;  3VQA A;  2D0A A;  4GVE A;  4ZHR A;  2YHX A;  4KTZ A;  3V9U A;  1IBK K;  3CQX A;  3H1V X;  5JVG L;  2XO7 A;  2RN2 A;  3FFI A;  3D2F A;  4Z4I A;  4CZH A;  2V52 B;  4BRP A;  4GW6 A;  3AO4 A;  2V7Z A;  4H5R A;  3QBW A;  2GWK A;  5KPT A;  1FJG K;  4FCY A;  4C8M A;  1IV0 A;  3VQB A;  3E9P A;  1HLU A;  1LAV A;  1S1V A;  4N56 A;  4N41 A;  4F2S A;  1MU2 A;  1U45 A;  5AZJ B;  1IG8 A;  3NVK A;  3ZX0 A;  3G4S N;  4W5O A;  3AVH A;  5I9E B;  2HF3 A;  1ZC6 A;  4CEB A;  4DSE A;  1TKD A;  4FJI A;  3DRP A;  3HM9 A;  4M3R A;  3TTC A;  1NJZ A;  1K8A O;  4DF8 A;  3LM2 A;  4DSK A;  2I7P A;  1TUU A;  5BRE A;  3H6E A;  2IOC A;  4BRD A;  3DLK A;  4DTR A;  1EO1 A;  4DTJ A;  1WLJ A;  2VG6 A;  3T1Y K;  1C0T A;  4GV9 A;  1EET A;  2VGN A;  1RBS A;  2F8T A;  5M1K A;  3SAF A;  1RBU A;  4H8K A;  4KHP K;  3ZSR A;  1XC9 A;  1BCO A;  1W97 L;  3HK2 A;  5C15 A;  1VQL N;  4FJH A;  1NKC A;  3U9Z A;  3IRX A;  3AVJ A;  2B5J A;  3RMB A;  3FGU A;  3TU5 A;  4K8X A;  2X78 A;  5KRS A;  3PX6 A;  3LP1 A;  3HM8 A;  1J54 A;  1SKS A;  4LF6 K;  1CXU A;  2VWK A;  4HWI A;  4LF9 K;  4CJE A;  4LY7 A;  4CZG A;  5HP1 A;  3ZSW A;  4KHS A;  2O8B B;  1XMQ K;  1RT4 A;  3SUO A;  2W6K A;  2NRV A;  4X64 K;  3IMX A;  1WN7 A;  3NF7 A;  1KFD A;  1RT5 A;  1QVG M;  5AQV A;  4KO0 A;  2VG7 A;  4BRN A;  5BN8 A;  3EZ5 A;  3V9S A;  3O9Q A;  1YJ9 N;  1N6Q A;  4JD2 A;  1VQM N;  1X9J A;  4PKG A;  2KFZ A;  3A0I X;  1T05 A;  2P9L B;  4B8C A;  2P9U B;  4FVM A;  3WNE A;  1NK5 A;  3HP6 A;  1NK9 A;  4BR4 A;  3AVF A;  3K0S A;  5K14 A;  2RPI A;  3T69 A;  5AQK A;  2HHT A;  4EP4 A;  3CCM N;  1O13 A;  5LL6 Z;  3OJS A;  5LY3 A;  5JIC A;  3AVM A;  4A59 A;  2A42 A;  2ASM A;  2OPR A;  4GMJ B;  1Q82 O;  4FJK A;  1NMD A;  1BIZ A;  3T1H K;  1ILY A;  1V4S A;  4FJG A;  4F3T A;  3G6E N;  4DU4 A;  1NGI A;  4IJA A;  4LF4 K;  2O8C B;  1QQM A;  2HBK A;  4FWQ A;  1NJW A;  1NG9 A;  3UE5 A;  3QES A;  4JS5 A;  4MLE A;  5D3G A;  3QEI A;  2YI1 A;  4BC4 A;  2PFU A;  4RW6 A;  2WTU A;  4CEQ A;  1KAY A;  2G8W A;  1ZBI A;  3DWL A;  5AQO A;  1HRH A;  1XQS C;  1TL1 A;  4XH5 A;  2IAJ A;  3CJ9 A;  3JAM O;  3OW2 M;  4KHN A;  1Q9Y A;  3L8B A;  4PQU A;  1H1V A;  3FR0 A;  4KTW A;  5CR4 A;  3CCS N;  2XY7 A;  4DV4 K;  2UUA K;  4Z4E A;  3V9Z A;  3M8P A;  3DLH A;  4NB4 A;  2IDO A;  1A5W A;  4NYF A;  4Y1D A;  4ZTF A;  4G1Q A;  1M1K O;  4BRH A;  4BC5 A;  1KVB A;  4CF1 A;  2ITM A;  2KHO A;  3M5R A;  3C6H A;  1KVC A;  3THV A;  4G9Z A;  2XY5 A;  4CJ4 A;  4H0Y B;  4YOV A;  1C1C A;  3H45 C;  5M1F A;  3H3N O;  4CF8 A;  4FJL A;  2ZGZ A;  5FDL A;  3OYJ A;  2DY4 A;  3ULD A;  3SUP A;  4F4K A;  2ZE2 A;  4K41 A;  3KJV A;  2YJF A;  4BGA A;  4FK4 A;  3KIO A;  2NRH A;  1TKT A;  4K25 A;  1IBM K;  3I8D A;  4IG3 A;  2DFE A;  5C12 A;  4OPA A;  1T8E A;  4I9Q A;  3OTO K;  1IKW A;  2YNF A;  2HVH A;  1J53 A;  3P31 A;  2G8H A;  2NRX A;  3I0S A;  4K8Z A;  1VSD A;  2E1Z A;  3KK1 A;  1ATS A;  4IEE A;  5F0X A;  3LDL A;  5C10 A;  5ELZ A;  3VPZ A;  4DUZ K;  1EXQ A;  3E01 A;  2PYL A;  2P9S A;  1NLV A;  2W40 A;  3C94 A;  4B3S K;  4M3U A;  2B6A A;  4RCH A;  5DK5 A;  3AAR A;  3CD6 N;  2HMP A;  4JKD A;  3M8S A;  1N34 K;  4JHD A;  1RT1 A;  5CE3 A;  2PAV A;  3UKR B;  1K9M O;  1OVY A;  1U04 A;  1TKX A;  4IO9 L;  3ZT3 A;  2ITG A;  5GAE P;  4F8R A;  2QW9 A;  3QNN A;  1RCH A;  1BQN A;  2NRZ A;  2W41 A;  3DXK B;  3MEG A;  2YX6 A;  3N4Q A;  3L2U A;  3KK2 A;  3TAR A;  4A5A A;  3OS1 A;  3RMA A;  4OPH A;  3NHG A;  4DQI A;  1K8K B;  1NGH A;  5J1E A;  4B9M A;  1OH8 A;  4H4O A;  2OZS A;  3PUF A;  3J7Y P;  3O9T A;  4RWT A;  4JS4 A;  1WB9 A;  1KQS M;  1TKZ A;  5AQU A;  4JI8 K;  4FLY A;  1HPZ A;  3WNF A;  4WQ5 C;  4CW7 B;  1BOT O;  1W7A A;  3WQU A;  1WOQ A;  4CJQ A;  3V1O A;  4EFH A;  2FSN A;  4AIL C;  3MXI A;  3TSU A;  1K8K A;  3SV3 A;  1J5E K;  5FRM A;  3E9L A;  4IWV A;  3FE1 A;  5BRF A;  4H0V B;  2LSN A;  1QQO A;  2RE2 A;  1NGG A;  5EOY A;  3B6O A;  1LV5 A;  3U8X A;  4PL7 A;  2P9K A;  1N32 K;  3S3N A;  1T03 A;  5AQJ A;  1EWQ A;  2YNG A;  4FJM A;  1GLC G;  1YJW N;  4OLA A;  4X66 K;  3AO1 A;  1SKR A;  2FBY A;  3D0P A;  2QEX N;  1WSF A;  3VEN A;  4KBO A;  5C24 A;  1S1T A;  3QEX A;  3D2F B;  1VSJ A;  4F3O A;  1X3N A;  2HHX A;  1RT3 A;  1HJR A;  4GKJ K;  4DQ8 A;  5AQZ A;  1R59 O;  2HBJ A;  3TPQ A;  3CC7 N;  4EHU A;  1W0H A;  4FWP A;  3P38 A;  4B1Z A;  2OYQ A;  4XH1 A;  4QAG A;  4E19 A;  3OBW A;  1VQK N;  4A61 A;  4HTL A;  4DTP A;  4JLH A;  2HOE A;  2HND A;  2P9P B;  3MCA B;  2XY8 A;  3WXK A;  5KPR A;  3B8A X;  3O4Q A;  3VA0 A;  3ZX2 A;  1ASU A;  5I3U A;  4IJN A;  3T19 A;  1U6Z A;  3ZSY A;  1RGI A;  3NGY A;  1V4T A;  3FLC O;  4CZK A;  1JLA A;  2A5X A;  5CHI A;  1S72 N;  4PHT X;  1BU6 O;  2KW4 A;  4BRA A;  4DHY A;  1S22 A;  3R8E A;  3S3O A;  1ESV A;  4ELT A;  4MDB A;  4NCG A;  2Z1H A;  1C0U A;  2PY5 A;  2VWB A;  3G0Z A;  3ENB A;  1T6C A;  3KWG A;  2QA4 N;  2JWL A;  4JI6 K;  4DSJ A;  4DQS A;  5BRH A;  4A57 A;  4FLZ A;  3BGR A;  4BWJ A;  5E84 A;  1IKY A;  4BDZ A;  4OPJ A;  2W6L A;  5EU7 A;  4CJ3 A;  5AQH A;  3HVT A;  3DI6 A;  3MN6 A;  3OHR A;  5JLF A;  3E66 A;  1HYS A;  4DTU A;  2F4V K;  1NJI O;  1J6Z A;  2BE2 A;  4E7I A;  1UWB A;  1LWE A;  2FSK A;  1ZBH A;  3VA3 A;  2Q2R A;  3UIQ A;  5CZ1 A;  5GAD P;  1VSF A;  2ZF5 O;  4OJR A;  3L2W A;  2CGL A;  4M3W A;  4Z0U A;  4LC9 B;  5HLF A;  3I8B A;  2A40 A;  4YNQ A;  3ALY A;  5T7B A;  3CPE A;  2VCP A;  2ASO A;  4DQR A;  3HOS A;  5SWM A;  3MAQ A;  4YOT A;  3WXI A;  1RT2 A;  3GE1 A;  5FRO A;  3VQP A;  1Y97 A;  3NAE A;  4CBU A;  1KFS A;  3HO1 A;  1T3V A;  2Q3S A;  4H03 B;  2P9I B;  3T1A A;  3QNO A;  3WUH A;  4IDK A;  4I6M B;  1G99 A;  1QZ6 A;  1NNE A;  2HBM A;  5KPZ A;  4BDY A;  1K6Y A;  4JV5 K;  1ATR A;  3WEE A;  5HBM A;  2XRI A;  3ATV A;  3Q7C A;  2QWL A;  3AVB A;  3ID8 A;  3SI6 A;  3EE8 A;  3ZYY X;  4AHT A;  4GV3 A;  4DSF A;  4OKJ A;  4JI5 K;  1KLN A;  3HYF A;  4UY8 O;  1D8Y A;  4CCH A;  2P9I A;  4HTU A;  3AVI A;  4H0X B;  3RSE A;  3VTH A;  3NH1 A;  4JI1 K;  2FBT A;  3AO2 A;  4FJN A;  1VQP N;  4NO7 A;  3O1B A;  1BG3 A;  4O44 A;  4HUE A;  4QS8 A;  3QEV A;  3MEC A;  2XHB A;  3SK3 A;  4KI6 A;  1BCM A;  2RF2 A;  2UYT A;  4GKK K;  3TAF A;  1U4B A;  4DTX A;  4DR5 K;  3MCP A;  3CJB A;  2D4W A;  2QI2 A;  4FM2 A;  4CJU A;  2DPN A;  3AVN A;  2HNZ A;  3C7N A;  1CXQ A;  2YHB A;  4M3T A;  4B3R K;  1SKW A;  2VYP A;  1C0M A;  3A5M C;  3TAQ A;  4KRF A;  3QEP A;  1OH5 A;  2ZM6 K;  4DV0 K;  4CFB A;  3V4I A;  3D2E A;  2GX9 A;  2QKB A;  4CFC A;  4CD1 A;  3O4W A;  2A6A A;  4I2Q A;  5AQL A;  4I2P A;  2G8K A;  1ASV A;  5AQG A;  3QDK A;  1DTT A;  2O8D A;  3LAN A;  3ZLJ A;  3WXM B;  1S1W A;  3CER A;  4KH4 A;  1J5O A;  1GLJ O;  1JL2 A;  3QFU A;  4CF0 A;  4OX9 K;  3KD1 E;  4H0O A;  3HVR A;  5JVH L;  4AHR A;  1MWM A;  4Z4C A;  3CMA N;  5MLC Q;  3THX A;  3HTV A;  4B9L A;  4KH6 A;  4AM6 A;  4B3O A;  1RTI A;  3AAP A;  3VF6 A;  3QIN A;  3H3O B;  3VEV A;  1GLB G;  2E2P A;  3NDK A;  4E1N A;  3M1F A;  3ZT2 A;  1VQ6 N;  4KHU A;  4FLV A;  1XI1 A;  3L6Q A;  1L3V A;  4IFE A;  5EVZ A;  4B9N A;  3C65 A;  1FXX A;  3R1X A;  3O08 A;  1QHT A;  4YOW A;  4Y1C A;  5AQT A;  4HCB A;  3C7N B;  3SBT A;  1SL1 A;  4DF4 A;  3VMF B;  4N76 A;  3CFR A;  2P51 A;  4DLG A;  3LDO A;  3IDH A;  3LZI A;  3O8M A;  3VEX A;  2J4R A;  4AHV A;  2HNY A;  5AR0 A;  2HST A;  4FL9 A;  3C6A A;  1VSE A;  3ISN C;  4FJJ A;  3B6P A;  2HHH K;  1B9D A;  1NK0 A;  4QCL A;  4O55 A;  4CED A;  1RDB A;  1IH7 A;  3NVM A;  1CZ9 A;  4M42 A;  1ZBS A;  1CZB A;  2E5L K;  1QQC A;  1TYQ B;  4CHQ A;  3LAL A;  4KH5 A;  2ATQ A;  3SQ4 A;  4AQY K;  3TAE A;  3V1R A;  3SNN A;  2QWR A;  3ULE A;  2UXB K;  1NGB A;  3CYM A;  3TTF A;  3O9R A;  2KKZ A;  5LMN K;  1HJO A;  1WAF A;  3A5L C;  3LL3 A;  3MWT A;  2HHW A;  3GDQ A;  5H1S Q;  1NGJ A;  1A5V A;  3RRH A;  3CF5 L;  3P39 A;  3VQE A;  1XWL A;  1HKG A;  4JK9 A;  5KI6 A;  3AO3 A;  4BR9 A;  2CGJ A;  4WFN L;  3Q7B A;  4CER A;  1E3M A;  2OCE A;  2QK9 A;  4CJF A;  3EYZ A;  1JKH A;  4DTM A;  5C25 A;  3CC2 N;  4DMN A;  3HOT A;  1SL0 A;  3ZET B;  1JL1 A;  1QTM A;  4DR3 K;  1Z25 A;  1D5A A;  1VK0 A;  5LJV A;  4LFB K;  2PBD A;  2E2O A;  2NRT A;  3F5T A;  2OTL N;  4GV6 A;  4CGI A;  1NGA A;  1NKE A;  3MN5 A;  4IOX A;  4CJL A;  3FZH A;  3PSF A;  1A5X A;  4ELU A;  1XHZ A;  3T7Z A;  3CPW M;  1Q81 O;  4FVU A;  1U2V A;  1IO2 A;  3EKU A;  2QKK A;  3UKR A;  4WE1 A;  1CZA N;  1R0A A;  1YF5 L;  3K9J A;  4BRI A;  3K5M A;  4CEO A;  4FWM A;  3VER A;  3HSC A;  3VQQ A;  1YVU A;  3DMJ A;  4WQ4 A;  1U49 A;  3SAH A;  4Z4F A;  4RTF D;  3KVG A;  4IFY A;  4KB0 A;  4KKO A;  4W5Q A;  1SV5 A;  3EO3 A;  3THW B;  3D7E O;  4H5W A;  1IKX A;  4H0P A;  5BPL A;  3BUZ B;  3AVC A;  4CZJ A;  4F2R A;  1NGD A;  4FJ8 A;  3RTV A;  4KTQ A;  1DEJ A;  4IG0 A;  2IVP A;  3AGR A;  3DAW A;  1JLG A;  4JNE A;  4CEC A;  4CE9 A;  4CGH A;  2KTQ A;  2G8I A;  5EY4 A;  1VHX A;  1HPM A;  2XY6 A;  4YY3 K;  3A5N C;  4JRQ A;  4FWL A;  2ZJQ L;  3DOL A;  1VRT A;  4C8N A;  1SS6 A;  4ZTJ A;  5C42 A;  3M8Q A;  4BR7 A;  3QLH A;  4EZ6 A;  3ITH A;  3LDS A;  3S9H A;  4B1X B;  1KCF A;  1E4F T;  1P8Z A;  1YAG A;  4DFJ A;  5I42 A;  2WUS A;  1W9H A;  3M8R A;  1FW6 A;  3VEZ A;  3DLL L;  4DR1 K;  1RBR A;  3S41 A;  4JKG A;  4Q5V A;  4DV2 K;  3TTD A;  2E8A A;  4O4G A;  4FYD A;  3SQ2 A;  3KD5 E;  4JKG B;  1HQU A;  4DV6 K;  4MDA A;  4MQ3 A;  3NF8 A;  3BEX A;  3ZT0 A;  2YHW A;  3AO5 A;  3CCR N;  5AFU A;  1YHQ N;  2PZS A;  3PSI A;  2P9N A;  1VQ8 N;  1VSL A;  4WFB L;  3PIP L;  3IAY A;  3AGK A;  5CY4 A;  4DTS A;  4FM0 A;  3THX B;  4CJT A;  3PY8 A;  3VQ6 A;  3WNG A;  4A2A A;  4BRL A;  1DLO A;  2OTJ N;  4FM1 A;  2E4L A;  2X74 A;  3VGL A;  2NRW A;  1I94 K;  4DV7 K;  1S1X A;  4H5V A;  3V9W A;  3ZX3 A;  1HNW K;  4W5T A;  1T44 A;  2HW3 A;  4C8O A;  2D0B A;  3VQ9 A;  3AA5 X;  2GUP A;  2WON A;  4MO4 A;  5SZT A;  1ZYQ A;  2NRR A;  1YT3 A;  5AQI A;  1HR0 K;  4AHU A;  3U9D A;  4DV3 K;  4FZY A;  4CJ5 A;  3O9S A;  3ENO A;  1JLF A;  1VQ9 N;  4J2B A;  3WXJ A;  3AVA A;  1NU0 A;  3CG7 A;  4V19 S;  1D9D A;  4KFB A;  5C0Y A;  4O5F A;  1RTJ A;  4PY5 A;  5AQF A;  4YOX A;  1NMN A;  2GEM A;  4KPY A;  1Q86 O;  4CIE A;  5AZI A;  2GEL A;  2YHY A;  5AFU H;  4BG9 A;  3I0R A;  3K2P A;  1HYZ A;  4BRQ A;  4JI0 K;  3ZET A;  4CEA A;  4JEP A;  3J7Z O;  2UUC K;  4K0K K;  4ISG A;  1RNH A;  4JD2 B;  2I7N A;  3DJC A;  3HBT A;  5AQS A;  3PO4 A;  2UUB K;  3CCJ N;  1C0F A;  4KRE A;  3LP3 A;  1BHL A;  2IS3 A;  2Y1J A;  2GBZ A;  4KAZ A;  4ILH A;  2I5J A;  4MO5 A;  5F1X A;  3QO9 A;  3FFK B;  2O8F B;  4J8F A;  4JKA A;  1X3M A;  3UKU A;  3J7A P;  4YDU A;  4L3Q A;  4FLT A;  1QHA A;  4LH5 A;  2JGU A;  3HRG A;  4B1W B;  1VQ7 N;  3WEE B;  3C6T A;  3SJJ A;  4EP5 A;  2X6N A;  1NOZ A;  4XEI A;  2JLE A;  5HRO A;  1M90 O;  3P5J A;  4ILJ A;  4JKC A;  1TL3 A;  2OPP A;  4CHP A;  3L3U A;  3A8Y A;  4CBW A;  2D0C A;  4BRE A;  3DLG A;  1L5U A;  3AVK A;  1I3A A;  1RDA A;  5KGW A;  4FPB A;  3IUC A;  4JI4 K;  4LD0 A;  5GIO A;  4FLX A;  3THW A;  4FJ7 A;  4FXD A;  1BIS A;  2VGM A;  3SJH A;  4PWD A;  1ITG A;  1KAX A;  4FK2 A;  1S9G A;  3MX5 A;  4ELV A;  4JN4 A;  2Q97 A;  4BVP A;  4C1N K;  4FZZ A;  1EQY A;  3OYM A;  1Q7Y O;  4E7L A;  4CEE A;  3KLE A;  3A2F A;  3L2R A;  4JI7 K;  2DTU A;  4FK0 A;  1S5J A;  1HMV A;  3HZ6 A;  4DKW A;  1C6V A;  4Z4H A;  4R5P A;  3NCI A;  1S6P A;  2QWP A;  2UXC K;  2Q31 A;  1LWF A;  1LCU A;  5IWA K;  1S9E A;  1ZXO A;  1L3S A;  3VN5 A;  2Z1J A;  4GVM A;  1Z6R A;  1WBB A;  4BG8 A;  3GG4 A;  3MK6 A;  5KQD A;  1N8R O;  3LPT A;  2ETJ A;  3GBT A;  3PLA A;  1WSJ A;  3KLI A;  2GTD A;  1O1W A;  3O80 A;  1K73 O;  4E7J A;  1XNR K;  3HPH A;  1C0G A;  3QML A;  1FKP A;  3VQD A;  4DV1 K;  4CZE A;  3DLR A;  1WUA A;  5HL7 L;  1QSS A;  1IJJ A;  3RVC A;  1BI4 B;  1YVN A;  1VRU A;  3VQ8 A;  4YDU C;  4TSX A;  4NXN K;  1OKJ A;  5GIP A;  3VET A;  3CCL N;  1MDU B;  4CZF A;  2KQ2 A;  1I39 A;  5CZ2 A;  3R6M A;  4FWO A;  4BR5 A;  4CZM A;  3RR8 A;  4DR6 K;  1WAJ A;  4DTO A;  1JXE A;  3CM5 A;  3P83 D;  1XHX A;  3C95 A;  4H5N A;  4AH9 A;  5J2P A;  1X9S A;  5EXW A;  4CIF A;  3OYL A;  2YKM A;  1VSH A;  2ZQB A;  3HP9 A;  3AA2 A;  4A5B A;  3AVG A;  3CHW A;  3PO5 A;  4BRK A;  4BRC A;  4DU1 A;  3CIP A;  4IEI A;  5FPN A;  3J8A A;  3RMD A;  2E6M A;  4JAX A;  2GV9 A;  3C6U A;  3QIP A;  4AM7 A;  4CD3 A;  3IFR A;  2A3Z A;  3MEE A;  3DXM B;  2WOM A;  3J81 O;  3I33 A;  4JKF A;  2F9W A;  5ADX H;  4C1N I;  4EAH D;  2IC3 A;  4W5N A;  4H0T B;  1YXQ A;  4BR0 A;  2KZM A;  5EX5 A;  4DG1 A;  4CJW A;  4BC3 A;  4PKH A;  4UQG A;  1VQ5 N;  4AHC A;  3BZK A;  3MXJ A;  4PA1 A;  4CJV A;  3MMV A;  4BRG A;  4M3Y A;  1BDG A;  3PX4 A;  5CYM A;  2HVI A;  5LJW A;  3WNH A;  3KWI A;  3ZCM A;  1GLF O;  1GOC A;  3F2K A;  3OVN A;  4J2A A;  2A1R A;  2FC0 A;  1KVA A;  4PUO A;  2CGK A;  1RT7 A;  4E7K A;  2V51 B;  3D45 A;  2G8F A;  4RW7 A;  1LWC A;  1YIT N;  2DFH A;  3K5L A;  3NMU A;  1N33 K;  4CEF A;  3VOV A;  2V7Y A;  4OGE A;  3ZT1 A;  3CCU N;  1BQM A;  4LF5 K;  3F73 A;  5M1P A;  2AJQ A;  1TYQ A;  3T3F A;  1BI4 A;  3TSP A;  3WQT A;  3V9X A;  2R7Y A;  4FO0 A;  5KTQ A;  4BE0 A;  4DQP A;  5KRT A;  3CCE N;  4NCA A;  4CF9 A;  3V81 A;  1D4X A;  3SMS A;  3K58 A;  3KK7 A;  3LDQ A;  5BPM A;  2O8F A;  3L4I A;  1HNI A;  1HNX K;  4JYA K;  5JMV A;  3QET A;  1GOA A;  2WFB A;  3QIC A;  2G8U A;  3R9P A;  1WBD A;  2KLA A;  1BUP A;  2E2N A;  5AQQ A;  3SYZ A;  3CJ1 A;  3N4P A;  4CEZ A;  2ZJR L;  2OPS A;  2G8V A;  1MWK A;  3VQ5 A;  3FZK A;  3OYK A;  3K5O A;  3F9K A;  1BO5 O;  3QIO A;  1XNQ K;  3MN9 A;  1JCE A;  1QQN A;  2HB5 A;  3SQ1 A;  1LAW A;  4FW2 A;  4WYB A;  1NWK A;  4M3X A;  5JS1 A;  4KHY A;  1DTQ A;  4HCC A;  4RW4 A;  2QM1 A;  4B1V A;  4CK1 A;  4A62 A;  3VF2 A;  3CJC A;  4WCE L;  1C1A A;  2P9K B;  5J2Q A;  4I7F A;  3DYA A;  4YHH K;  4FWR A;  5C2D A;  2O8D B;  1JJ2 M;  4AF1 A;  3OYC A;  1VSI A;  3LWM A;  3P4I A;  3SUQ A;  2HF4 A;  3L3V A;  5B8H A;  4DFM A;  3ENH A;  1CLQ A;  1QVF M;  4DLE A;  3OYG A;  2FBV A;  4I6M A;  3D2E B;  4FSV A;  3A5O C;  3VQ7 A;  4LFC K;  1REV A;  3I56 N;  3I55 N;  4CHN A;  3NH2 A;  2HHS A;  1DT9 A; 
#chains in the Genus database with same CATH homology
 1XNR K;  4KHP K;  2UU9 K;  4LFA K;  3J7Y P;  5A2Q O;  2HHH K;  4LF5 K;  3JAM O;  4DV1 K;  4GKK K;  4JI0 K;  4JI8 K;  1XMO K;  4DR4 K;  4JI3 K;  4DR5 K;  4DV4 K;  2E5L K;  2UUA K;  4CW7 B;  4NXN K;  2UUC K;  4K0K K;  4YY3 K;  2UUB K;  4LF6 K;  4DR6 K;  4LF8 K;  4AQY K;  4JI6 K;  5BR8 K;  4B3R K;  1J5E K;  4LF9 K;  2UXB K;  4B3M K;  1HNX K;  1IBL K;  1XMQ K;  4JYA K;  2ZM6 K;  5LMN K;  4X64 K;  4DV0 K;  4DR1 K;  4DV2 K;  2F4V K;  4CVN E;  5IT9 O;  3J7A P;  4DV5 K;  1N32 K;  4NXM K;  4DV6 K;  4LF7 K;  4B3T K;  5AJ3 K;  5FLX O;  4X66 K;  1IBM K;  3OTO K;  1IBK K;  3J81 O;  4X65 K;  1N36 K;  4JI4 K;  1XNQ K;  4OX9 K;  1FJG K;  4X62 K;  4GKJ K;  4DUZ K;  5LL6 Z;  4DR3 K;  1I94 K;  4LFB K;  4DV7 K;  1HNW K;  4B3S K;  4JI2 K;  3J80 O;  3T1H K;  1N34 K;  4JI7 K;  4YHH K;  4DUY K;  4LF4 K;  4JV5 K;  1HR0 K;  4DV3 K;  2UXC K;  2VQF K;  5LMU K;  5IWA K;  2VQE K;  4DR2 K;  4JI5 K;  2UXD K;  4V19 S;  4LFC K;  4DR7 K;  1HNZ K;  3T1Y K;  4JI1 K;  1N33 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...