5IWAK

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
115
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
total genus 25
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2016-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 5iwaK00
4JI7K 5IT9O 4DV3K 1XMQK 4DV1K 1IBMK 4JI3K 2VQFK 4NXMK 4DR6K 4B3SK 2UUCK 4CW7B 2UUAK 5LMUK 5A2QO 4DV5K 2E5LK 4KHPK 1HNZK 4DUYK 4LF7K 4JV5K 4V19S 4JI5K 3T1YK 1IBKK 4JI2K 4LFCK 5LMNK 4LFAK 1FJGK 1N32K 4DUZK 4B3TK 4AQYK 3JAMO 1I94K 4NXNK 5BR8K 2ZM6K 4B3RK 4GKJK 4DV2K 3T1HK 4DV6K 4X65K 4X62K 4DV7K 5IWAK 4LF6K 4LF5K 4DR5K 2UXBK 1N36K 1XNQK 4JI1K 4K0KK 3J7YP 5LL6Z 4JI0K 2HHHK 1HR0K 4LF9K 4DR3K 4OX9K 2UUBK 1HNWK 4X66K 4LF8K 4DR2K 1XMOK 4B3MK 4YY3K 3J81O 1HNXK 2VQEK 4DV0K 4DR1K 4DR7K 1XNRK 2UXDK 3J80O 5FLXO 1IBLK 4DR4K 3OTOK 1N34K 2F4VK 3J7AP 1N33K 4X64K 4LF4K 2UU9K 4GKKK 2UXCK 4DV4K 1J5EK 5AJ3K 4YHHK 4LFBK 4JI6K 4CVNE 4JI8K 4JI4K 4JYAK
chains in the Genus database with same CATH superfamily
3T19A 3F2KA 2Q3SA 3VQDA 1LWFA 3HXMA 4JI3K 5K14A 4LSLA 5JLFA 3NGIA 1FXXA 3MXMA 1VQ4N 3KK7A 5EY4A 1NNEA 4EP5A 3MECA 2ASOA 2D0BA 5GIPA 4IFEA 4JKGB 4CEFA 2P9PA 5BRHA 3CCMN 4CJTA 5AZJB 3ZX0A 4JN4A 4V19S 2OPQA 2D0PA 4FWOA 3E01A 4MO5A 3VEWA 1XHZA 4AHVA 3F73A 4CK3A 4HTLA 1MA9B 5M1KA 1FJGK 2PAVA 3UKRB 3S3OA 1XI1A 1X9SA 1OH8A 4QS8A 4DQIA 3KLFA 3R6MA 4I6MA 3QEXA 4OO1J 2P9LB 3LZIA 1NKEA 5F0XA 1YXQA 3K0SA 3LWLA 3LP0A 3HP6A 1D9FA 1X3NA 1N36K 4O5BA 3TWHA 3WXIA 4HUGA 1NOYA 4CZEA 3FLCO 2RHKA 4F4KA 4Z4CA 1HUXA 3KLGA 1UA1A 5FRNA 4BQZA 4CECA 1KLMA 2YCHA 4BVOA 5AQKA 2A5XA 4B3MK 1KD1O 2VQEK 1QHAA 4PL8A 2A3ZA 3ZETB 4BDYA 1RT6A 3HO1A 4JD2A 4IJAA 1OKJA 3K57A 3VENA 1T6CA 3W3DA 2CH5A 5M1FA 4KPYA 2YJEA 4O8KA 4DF8A 2X78A 4DFMA 3OTOK 1TGOA 1X1PA 2E20A 3TSUA 1C1BA 4FWKA 3DRPA 1Y64A 4E19A 3DAWA 3RSEB 4DQPA 1A5WA 2BANA 1S1WA 1KAYA 3O6WA 4IFYA 1K8AO 3IUCA 3G25A 5AQLA 3SMSA 5KPZA 4B8CA 2QW9A 1Q86O 3AVHA 4LH5A 1XMQK 4FYDA 2X6NA 3GOIA 4JK9A 3BEXA 1TAUA 2HW3A 1TKDA 4FPBA 3LDPA 3OS1A 5AR0A 3SLCA 1HQEA 4CZLA 1BA0A 1JXEA 3HJFA 2YHBA 2OZSA 1CZAN 1RT3A 4CHQA 1VSKA 4FZYA 1J6ZA 4HUFA 4CIGA 1VQNN 3AO4A 3MWPA 2FBXA 4LH4A 3SK3A 1Q82O 4CK1A 1EP4A 4IDKA 3P4IA 3VGMA 3ALYA 3SPZA 2IIRA 1JCEA 1B92A 3UKUB 5GIOA 1EX4A 3FE1A 4PWDA 4F2RA 3IG1A 3TU5A 2E2OA 3H3OB 2ZJQL 4CF0A 1N5YA 4GY2B 4LD0A 4DV7K 4W5RA 3BZCA 3MX2A 5FDLA 2YNIA 4C1NK 5JVGL 4LF6K 4O0IA 3IMXA 3VESA 3VEOA 1WNSA 3K9JA 1GLAG 4PKGA 3VEVA 4B9NA 5AQUA 1RT5A 4AM7A 3C6UA 4CBXA 1KSPA 3ULEA 5M1PA 2E88A 3HM8A 5I9EB 4DTUA 3OS0A 3QEWA 2P5OA 3J81O 1XHXA 1DTQA 4Y1CA 3O1WA 1GLLO 2Q31A 4FJLA 4WQ4C 3HPGA 3TI0A 3O4QA 1XNRK 2YHYA 1K73O 3QEPA 2Y1JA 3WEEA 3N4PA 4PY5A 2YHWA 1UAXA 4JK7A 4MDBA 3MEDA 3I0SA 3M1FA 2HHUA 2DY4A 2I5JA 4A57A 2YHAA 4BRQA 4OKJA 3R1XA 1NGCA 4O44A 1CZ9A 1ATRA 4NB4A 1U2VA 3MWTA 2KKZA 5CY4A 1WB9A 2VG6A 2KFNA 3LP2A 2QWOA 4K42A 4CJVA 2IOCA 3F9KA 4WFBL 3CD6N 1HJOA 3HRGA 4AHUA 1WUAA 2JLEA 4I2QA 4CFCA 4UQGA 1TAQA 3SBGA 3M8PA 2IS3A 5CHIA 4LF7K 4B9TA 1DTTA 4M3WA 5CYQA 5HP1A 1SQKA 2HHXA 1NWKA 3QLHA 4M42A 3ZLJA 5LMNK 4WF9L 3JXUA 4DQQA 4FLZA 1OVYA 1LW2A 4B1WB 3V9UA 3BGRA 4DUZK 2W6LA 3RMBA 5ADXA 1I94K 2EWSA 3A8YA 3SV4A 1D8YA 1JLFA 2RF2A 3H1VX 2NUBA 3CHWA 2P9UB 3CCLN 2NRHA 3CM5A 1MDUB 1BIZA 4FJ9A 3D2EB 4R79A 4FM1A 4NYNA 3BDPA 1TL3A 4U7BA 2FBTA 2PYJA 4EAHD 3U9ZA 2IVPA 5BR9A 4B08A 4IO8A 2QKKA 3GG4A 3ZX2A 3J7YP 4FVUA 1VSJA 2HNYA 5AQPA 4IDHA 1GLCG 4JI0K 3DYAA 4OJRA 3IDHA 1HKGA 4E1NA 2UUBK 1HNWK 1JCGA 2AP1A 4C8LA 1S22A 1XMOK 4DR7K 4FJXA 4RW4A 2ZGYA 5AQZA 3L6QA 1QE1A 4H0YB 3VEZA 3WNGA 1JLGA 3K5OA 2HVHA 4WQ5A 3LZJA 1B9FA 3H45C 2ZQBA 3QERA 4H0PA 4JS4A 4BRFA 4CEZA 2A41A 3HVTA 3TTDA 5IT9O 5GAEP 4DTNA 1U48A 4FJGA 1RFQA 4GV6A 4NCGA 1XWLA 4M3XA 4KHNA 1JXBA 4K25A 3QINA 1VRTA 1NK7A 1HNZK 4ELVA 1VQ8N 4H0OA 3DLLL 2QTDA 4EZ6A 1RDDA 5SZTA 5CE3A 1G15A 3T3FA 4OLBA 1BGXT 3A5LC 4M63C 4MO4A 1RILA 4H5TA 4CCHA 1ITGA 1TK8A 3SPYA 5BREA 4DQSA 1IKXA 1SAZA 4CZKA 4H8KA 2YKMA 2X74A 3WNHA 4B3TK 1WSHA 4BROA 4WCEL 3AY9A 5GINA 3C6AA 4A62A 2P1JA 4CJKA 3HSTB 3VQ4A 1NBWA 1ATSA 3NAEA 3BZKA 1U49A 3DLRA 1RTIA 1KFDA 3D2FB 4LY7A 4E89A 3A5MC 4N76A 4I9LA 1G99A 4FVMA 3G4SN 4DSEA 4YOUA 5M1OA 3THXA 1RBUA 4M3RA 4MLEA 4BRGA 3SNNA 3TTCA 4KO0A 1Z25A 2KQ2A 1BO5O 2ETJA 1C0MA 4KHYA 5AZIB 3AA5X 3U3GA 4AF1A 4CJWA 5AQQA 4ISGA 3ZSVA 1Q7YO 1RT1A 3MEGA 3S41A 3THYB 3MK6A 4FLUA 2UXDK 2VWKA 3ZEUB 1ILYA 1VSLA 3HZ6A 3PY8A 1U6ZA 4JK8A 4W5OA 4CHNA 2O8FA 2ZJPL 5KPTA 1VSDA 1XQSC 1O1WA 3LWMA 3R9PA 4XH1A 3CJ1A 2NNWA 1TKTA 1T7PA 1TYQB 1LWCA 4RW7A 3C7NB 2VGNA 1BDGA 2XY8A 4NCAA 4JHDB 5FROA 1U4BA 5GADP 1NM1A 3ATVA 1DGKN 3LL3A 4CHYA 5JMVA 3SI6A 5HRPA 5LMUK 3ISNC 3KLHA 1NK9A 4KHPK 4JAXA 2CH6A 3EO3A 2OTLN 1RBSA 4R5PA 1EO1A 1NMNA 4BDZA 4FJ5A 3ZT0A 5J2NA 3PX0A 2P9KB 5B8HA 5E26A 3THVA 3OBYA 1REVA 2B6AA 3BY5A 1L5UA 4LFCK 1TL1A 3HL8A 1E4GT 2ASPA 1N32K 2D0CA 1EWRA 1GLBG 1CLQA 4BC5A 2XY7A 2WBNA 2F9WA 3KWIA 3PLAA 4FCYA 4FLYA 1IO2A 2QXLA 2QWLA 1KAXA 4JRQA 4B3RK 3KK1A 5AQVA 3CQXA 2YNHA 2D5RA 3MCPA 2VGMA 2BH1A 2P9PB 1WSFA 5SWMA 5EXWA 4EHUA 2V7YA 3CCRN 1RBTA 3VOVA 5C42A 2EX3A 3LDNA 5C2DA 2QWNA 1RGIA 4BACA 1RT4A 4RW6A 2E2NA 3ITHA 4L3QA 3QICA 1QSYA 4CGIA 2E2PA 3O3FA 4C23A 3C6TA 4M3ZA 1SL1A 4AHCA 4CE9A 1V4TA 2QK9A 3VF4A 4CF8A 5BRDA 4I6MB 4YFUA 1T8EA 3I55N 1U04A 4KHSA 3W0LA 2I7PA 2OPSA 4DU3A 1ZBLA 2KLAA 4FZZA 3JYTA 3J7AP 4KH6A 3L2VA 4DWIA 3CXCM 2YNGA 4BWMA 3FZHA 1JLEA 4DQRA 1OH7A 3V9XA 3VQEA 1OH6A 5E41A 3HPHA 3LAKA 1BCOA 2FF3B 3A2FA 4JKHA 4E7JA 3ZX3A 2VQFK 4HHTA 2XHBA 5KPRA 2FBYA 3GL1A 2XO7A 3AAQA 4ZTFA 1ZBHA 4DFKA 1WBDA 1ASVA 2E5LK 4NYFA 3J8AA 4CF1A 3OVNA 4KB1A 4CF2A 4H5NA 2O8CA 1EWQA 1YT3A 4BGAA 1S3XA 4Z4EA 1Z6RA 4BC3A 1YJWN 1SL0A 1S6PA 4FK2A 3O9UA 1WSIA 1YF5L 3KD5E 4B9LA 4LFAK 3NF8A 5C10A 3QBXA 4AQYK 3E1YA 4YOXA 1QZ5A 3D0PA 5HRSA 3NMUA 1KAZA 4EFHA 1KLNA 5KGXA 3OW2M 2P51A 2OANA 5KQ8A 1Q9XA 5JS1A 4FM0A 1SKWA 4GV3A 2GUIA 4FSVA 4DV2K 2KFZA 3I8BA 3LPUA 4WQ4A 5AQFA 4DF4A 2RPIA 2V7ZA 4LF5K 1VQ6N 1YTAA 3ZSQA 1W9HA 4Z4FA 4OKEA 4A5BA 4KAZA 3V6DA 3VQ8A 1J9AA 2ZE2A 4KHWA 4DU1A 1SV5A 4B9QA 3SUPA 4CZMA 1ZC6A 3AGRA 3EZ5A 3MAQA 3OYNA 4I2PA 2HMIA 3L2QA 1HPMA 3AVKA 3M8SA 3ZSOA 5FPMA 4KHQA 4LF8K 4Z94A 3KK2A 4TSXA 3NBPA 1SKRA 4PA1A 2G8UA 2F8SA 4FWNA 3SUNA 3OYDA 4DSKA 3H1QA 3BF1A 1HX1A 3NVKA 1NGEA 4CHZA 5C12A 3CCUN 5HROA 5EOYA 5AQNA 4DTJA 4KTZA 4YHHK 2IAJA 1NK6A 1UWBA 2FSKA 4BRAA 3ULEB 5J1EA 1IH7A 5ELZA 3WQTA 1ZBFA 3HTVA 4N56A 3E9LA 4EHTA 4DTPA 5F1XA 2QA4N 4PKIA 4YOVA 4M3UA 3PUFA 4NO7A 4M7YA 2NRZA 1FKOA 4PQUA 3WEEB 4QS7A 1C0TA 4CEOA 4FJIA 3OYKA 4E3SA 4OPKA 3FZLA 4HUEA 4CJ5A 3VGLA 1L3VA 4CJFA 3I8DA 4CIFA 3C0BA 1QQOA 3TAQA 3CCSN 1N6QA 3DWLA 3P38A 1F21A 2FXUA 3V9ZA 4F8RA 1L3SA 3ENHA 3M8QA 3L8BA 4DTMA 1NJIO 4E7IA 4I9QA 1RT2A 1XC3A 4UY8O 3HSCA 2OZMA 4FXDA 4BG9A 1QQCA 2D0OA 2FSJA 4KTWA 4B3OA 3R8EA 4MDAA 3O3HA 1YTUA 1Q81O 4CEDA 3BUZB 4K0KK 5J2QA 4E7HA 4LF9K 3E9OA 3OYEA 1VAZA 3EYZA 4XIUA 3KTQA 3HOTA 3CJ7A 4IEIA 3VQPA 4RCHA 1BG3A 3NFAA 2OA8A 4YDUA 2YX6A 1EXQA 4DFPA 3SUOA 3WUHA 2Q1NA 4DTXA 4CD1A 1VSEA 3DLEA 2WUSA 4IOXA 3SJJA 4GVMA 3PSFA 2BTFA 1M90O 2F8TA 3K2PA 3CYMA 1C0UA 4CHOA 4QS9A 3O4NA 4FWLA 3L0QA 1QHTA 1NGAA 2IC3A 4Y1DA 3VN5A 4BR9A 2HB5A 4BC4A 3AVCA 2QEXN 2WTUA 3DOLA 2IVNA 2FF6A 4GV9A 3PO5A 4DV3K 4HTUA 1IBMK 2GV9A 1NKBA 1YAGA 4A59A 3CQYA 4NXMK 3KD1E 3LDQA 4FLWA 4Z4IA 4LC9B 4CW7B 4BE0A 3JS6A 2ZGZA 2B4JA 4A2AA 4CGHA 2HHSA 4JLHA 3VQBA 3OJSA 3UIQA 1QSLA 1TVRA 4DS5A 3L2WA 3QNNA 1TUUA 1GOCA 4IOAL 4F3OA 3VGKA 2GWKA 2QM1A 1WSJA 1C0GA 1K8KA 4BR4A 1H1VA 2ATQA 3ULDA 3M5RA 2J4RA 5CZ2A 1RNHA 1NGHA 3SJHA 4DSFA 1K6YA 3CJCA 3HI0A 1S9GA 3NF7A 3WQUA 4Z0UA 3WXMB 5C2FA 4X62K 3AVAA 3QBWA 3FZKA 3K58A 4F9OA 3PO4A 1VRUA 1YVNA 3MN9A 3T7ZA 3KVGA 4CJ7A 3TANA 3D6RA 5C0YA 3NH1A 2Z1GA 5J2PA 1RTDA 2FBVA 2YNFA 1NK0A 2EHGA 2HHHK 4OX9K 1C1AA 2F9TA 2O4GA 4ILGB 4H0XB 4ILJA 1Q18A 4DR2K 2WFBA 2E4LA 2P9IA 1JLAA 4K43A 3P1GA 3OYMA 3CETA 2QXFA 2HBKA 3PIPL 3V9SA 2HVIA 2I7NA 1KVCA 2Z1IA 3CG7A 4X64K 4LF4K 4N5SA 3THXB 2HNZA 3QEVA 3K5LA 1TV6A 5F2RA 4KKOA 1EQYA 3C95A 4ID5A 4IG3A 4BWJA 3OYLA 1YHQN 3NVMA 1Z26A 3G6EN 3TAMA 3V4IA 4KREA 2Q97A 3AO5A 3AVNA 4FWPA 1NK5A 4FWSA 4BRCA 4A61A 3G0ZA 2OPPA 3T1AA 3G71N 3BP8A 3OBWA 3RMCA 2O8FB 4Z4GA 4C8KA 1E3MA 4JV5K 3RR7A 1C0FA 4CGGA 2O8EB 3TTFA 2Q2RA 1HYZA 3E9PA 4BY9C 4E0DA 4YDUC 3B6PA 4AHSA 3LP3A 3IRXA 3FZFA 2UYTA 4C8NA 4PHTX 3UE5A 1WSGA 4IKFA 5BPMA 4YORA 3OYAA 3AVBA 4BVPA 3AVMA 3FFIA 2VCPA 4NXNK 2KW4A 4CJ4A 2FLOA 3A5NC 3KJVA 3TAGA 5FPNA 4MFBA 2ZF5O 3VPZA 3SAGA 1W0HA 5KRSA 3A5OC 1ZYQA 2UXBK 3Q7CA 3WNFA 3LANA 1QSSA 4J2AA 2QWPA 4CGJA 3SZ2A 1BA1A 2ASMA 2OYQA 2Q0UA 3VEYA 4YOYA 1RBVA 3VQCA 2BE2A 1W7AA 1C1CA 3CCVN 1ATNA 4ISEA 2HF4A 3VMFB 1RDBA 1WAJA 5D3GA 4CJRA 4OGCA 5AQYA 3NDKA 3IKMA 1NGBA 3O9RA 4DR1K 1SL2A 4YNQA 4DCHA 3CMAN 1BUPA 4FOEA 1GLFO 3HK2A 3DXKA 5EVZA 3H08A 1HKBA 1YUWA 3K59A 4F3TA 4DTSA 4B1UB 4ILHA 1TK5A 2UU9K 3VQ7A 2QI2A 5AQJA 3EKUA 3ZT3A 1ASWA 2A42A 3MCAB 1T44A 1BQMA 2NRRA 3F9MA 5CR4A 4M3YA 4KH4A 1I3AA 3V1OA 1Q8IA 3MDQA 1MWKA 2Q36A 4DR6K 5LJWA 1OVQA 1WAFA 1S9EA 2UUAK 3RMDA 3CFOA 3DLKA 2HNDA 2G8KA 4DQ8A 1MWMA 2FSNA 4CJLA 4N41A 4CBUA 4ELTA 5AFUH 3L2UA 4JI5K 1T3VA 1DLOA 3CPWM 3T1YK 5FPDA 4BR7A 3EZWA 3O08A 4BR0A 3EL2A 2HBLA 3UB5A 5LY3A 1QZ6A 2BUPA 5C15A 5BRFA 4IFVA 1SUQA 4W5TA 4BGBA 1KVBA 1NGGA 5ADXH 1D5AA 4K41A 3TSPA 4EZ9A 3MN7A 1RDAA 3KK3A 1YJ9N 2BGGA 5E84A 3FR0A 2P9SA 4B8AB 3ZYYX 2E1ZA 4X65K 4FJ7A 1JLBA 3R3LA 2O8CB 1K9MO 2D1KA 5AQRA 1KQSM 3QIPA 3CMEN 2JWLA 2DFHA 1KXPA 3CC7N 3CQ8A 2YV0X 3VA0A 1NGIA 1EETA 2P9NA 5EX5A 5DM6L 4RWTA 4FJ8A 3U6FA 5HRNA 3HOSA 3QEIA 5KGWA 2WOMA 3FGUA 4GVEA 3ZSZA 3OYFA 4KB0A 3K9KA 2KTQA 2GX9A 2W6KA 2QWRA 4RG8A 3RVCA 3S3MA 2Q0RA 3L2RA 4FJKA 3OYIA 1IG8A 2O8BA 4CFAA 3KIOA 3ZCMA 5H1SQ 1NK8A 3EN9A 1VQMN 4BDPA 1NJZA 1ZXOA 4CF9A 4QAGA 3TARA 4E1MA 1JLQA 4B9UA 2HHWA 1VSIA 4FM2A 2W41A 4AM6A 4KHUA 3NCIA 3U9DA 4C8OA 2ITGA 1NGFA 4WFNL 5A2QO 3HBTA 4DV5K 3H46O 3LDOA 3EY1A 1KFSA 4CZFA 4O55A 3H6EA 4FW2A 3AARA 1VQ5N 3DOKA 3IAYA 1GOAA 1RT7A 4JI2K 4H5VA 1IBKK 3RMAA 4AHRA 1VSFA 3QDKA 4JD2B 3O8MA 4H0TB 1FKPA 4JKAA 4B9SA 2ITMA 3C7NA 3MXJA 3CC4N 3AVLA 3VQ6A 3DRSA 3F5TA 3T1HK 5GAGP 4Q0BA 2GWJA 5I42A 1UOCA 1ZBSA 4BE1A 1D9DA 3THWA 2E6MA 1WN7A 4E7LA 4BRIA 4ID1A 3NF6A 4Z4HA 5KQDA 4DLEA 3ENOA 2BDPA 1B9DA 4XH4A 3L4IA 2X6SA 5FPEA 1T03A 3L3UA 2VYPA 4WE1A 1VSHA 4RW9A 4CHPA 5BPNA 3EE9A 3SUQA 3SV3A 3OHRA 1QTMA 5JICA 2ZD1A 3DXMA 3CI5A 4FLXA 4B9VA 2HOEA 1NG9A 4DV0K 4FLVA 4FPAA 3DM2A 4MLHA 2B5JA 4JEPA 3SYZA 1C6VA 2HBMA 1NJXA 4FL9A 2FC0A 3OYGA 3SMPA 1NLVA 3ZSRA 4GNIA 1IG9A 4JI8K 4B9MA 1OH5A 3OY9A 5HL7L 1J5OA 4H5RA 4BE2A 2F96A 4H4MA 4JI7K 4CIEA 4DV1K 3ZSYA 4ISFA 2CGLA 1M1KO 4B3SK 3L4QA 4O0JA 3O9QA 3B8AX 3I33A 3HM9A 4GMJB 4OPAA 4MQ3A 5KI6A 4JS5A 3L3VA 1GLDG 4CJSA 1W2BM 3GE1A 2F7TA 3OYJA 3CC2N 3ASMA 1BISA 4HCCA 2V51B 1BI4A 1S1XA 3EKSA 1R59O 1DEJA 3VQAA 4KI6A 3ATUA 4NLBA 4OGEA 3C6HA 1HNIA 3IS9A 3QESA 3SQ1A 4A2BA 3EEQA 4CFDA 4CZJA 3B6OA 5BR8K 4O4GA 1VQON 3AVJA 3LAMA 3J7ZO 1BQNA 5BN8A 1JKHA 4HCBA 3O9TA 4J8FA 1IKVA 1VHXA 4AILC 4I7FA 4DV6K 3Q7BA 3WT0A 3TABA 4DTOA 2VWJA 1NGJA 2O8DA 3MEEA 4ICLA 1L3TA 3SQ0A 3DLGA 4NLCA 3DI6A 1J53A 3OYCA 3LDSA 2QWQA 4AHTA 1VSMA 3PX6A 1U2VB 2XY6A 4KI4A 1K8KB 3RRGA 4C8MA 4W5QA 1S1TA 1YITN 3VTHA 4FJMA 3H3NO 3U3YA 2P5GA 1WSEA 4YY3K 2VWBA 2LSNA 3P5JA 3DJCA 2GEMA 4O8UA 3ZSXA 1CZBA 1Q9YA 4JKCA 5AQSA 4QCLA 3J80O 3RRHA 1D4XA 2JWKA 4CEQA 2F4VK 2PBDA 4JKGA 3QNOA 4PUOA 5AZJA 3LDLA 2VG7A 2UXCK 4FOIA 4CJEA 4JKFA 3EE8A 4JI6K 3TPQA 4HWIA 3DMJA 3VERA 3AA4A 4H5WA 3O4WA 4AH9A 3SAFA 4BRPA 4H03B 3QB0A 1LWEA 1YJNN 3UKRA 1RDUA 4CEEA 3CFPA 2P9IB 3CM6A 3MMVA 3LM9A 1VQ7N 1TKXA 2HHVA 3M6GA 2P9LA 1BWFO 5C25A 1Z05A 4CZHA 4CBWA 4JKEA 3P39A 4BRHA 4FK0A 4HVJA 3AO2A 2HMPA 1L3UA 4C1NI 1QVGM 3U4LA 2Y1IA 1LOTB 4J2BA 5AQXA 5AQGA 1O13A 2YHXA 2AA4A 2YJFA 1QQNA 2KZZA 2OTJN 2Z1JA 5JS2A 1TKZA 3KKRA 3QO9A 2ZJRL 5BPLA 3SAHA 1YIJN 4NCBA 4FK4A 3ZETA 1JL1A 5BN9A 3KLIA 3VF6A 4WFAL 1HMVA 2ZM6K 2E2QA 4QOZB 2HSTA 1JLCA 4IO9L 1EKEA 2E6LA 2D4WA 1BHLA 4OVLA 5IWAK 2NRWA 2ZWHA 4DR5K 4CJUA 3QETA 1W97L 3RSEA 3K5MA 4CZIA 4DTRA 2GTDA 3DLHA 4DSLA 3O5BA 4KFBA 4DU4A 5LL6Z 1TK0A 1HR0K 3KZBA 3CFRA 3JSMA 4IEEA 5TKYA 5KRTA 5DK5A 3VTIA 3OJUA 4FWMA 3AVFA 5I3UA 3TAEA 3M3ZA 3QMLA 1NJWA 1GOBA 1IBLK 5CZ1A 4BR2A 4M45A 1VQLN 1QVFM 3QIOA 4ZHRA 1ASUA 1LAWA 3CIPA 4IBNA 3AGKA 4KBOA 4B1VA 1IKWA 4XH5A 5DMRA 5M1QA 4CVNE 3GBTA 3MN6A 1HKCA 5AFUA 2QKBA 3AA2A 3TAPA 3HP9A 5HBMA 4B1YB 2CGKA 1ZBIA 3NH0A 3CCJN 2A6AA 3U8XA 3RTVA 4IWVA 3FFKB 1NMDA 2UUCK 3UKUA 1LW0A 5KTQA 2GBZA 2JGUA 1HYSA 3V1RA 1BL3A 1UA0A 2NLXA 3DXKB 1JL2A 2G8FA 3CJBA 4H4OA 4FO0A 4FWRA 3WNEA 4BRLA 3TSQA 3SCXA 3OS2A 4FJNA 3VQ5A 4BR5A 3MN5A 3QFUA 4CJ3A 1S1UA 1LAVA 1KC8O 3VETA 1HNVA 3HT3A 2W40A 1FK9A 3SBTA 3VEXA 4J2EA 3WXJA 4FJHA 1YVUA 3ID8A 4ZTJA 2G8IA 3TAFA 2R7YA 2O4IA 3D7EO 2RN2A 1LCUA 3LPTA 4EP4A 1QQMA 2HHTA 4GKJK 5MLCQ 3PSIA 3CERA 4PL7A 1VQKN 1X9MA 2A40A 4DLGA 2NZTA 3IFRA 3WXKA 4PKHA 4CEAA 3VQQA 4IOCL 3GDQA 1HLUA 4JI1K 1VQPN 3KLEA 4IJNA 3AAPA 4JKBA 2VG5A 1NGDA 1U47A 4CGDA 1GLJO 4CZGA 3AVGA 3KWGA 1HNXK 1P90A 2P9SB 4H0VB 1DT9A 4CGFA 2W42A 3RWUA 3O1BA 2IDOA 2CGJA 4DR4K 3BF3A 5DM7L 1IV0A 2PFUA 3V81A 3TR8A 3O3GA 1A5VA 4FW1A 2WC9A 1XC9A 4DV4K 3HPOA 4LFBK 4DS4A 1JCFA 1P8ZA 3CPEA 2RKIA 4FJJA 4CI6A 1BIUA 1J54A 3VA3A 1XUPO 4ELUA 2P9NB 4DG1A 3OYBA 3I0RA 2YI1A 1JJ2M 3A0IX 3KKSA 5FRMA 3NF9A 2GUPA 4OPJA 2XRIA 1BOTO 4XEIA 4W5NA 4WYBA 3DLBA 1RTJA 2P9UA 3ZSWA 2HBJA 3CCEN 4M41A 5AQWA 3D2EA 1SS6A 3K5NA 3DRRA 4DUYK 4K8ZA 5J2MA 2O8BB 1HQUA 3PX4A 1RDCA 3D45A 1HYVA 3VF2A 3SQ2A 4G1QA 4BRDA 4DSJA 4KV8A 1NU0A 4DB3A 2A1RA 1ZBUA 4BRNA 3AO3A 2DFEA 3JAMO 4Q5VA 2GELA 5AQTA 1NOZA 4BREA 4CEBA 5AQHA 2XY5A 1X9JA 4RW8A 3ZT4A 2QWMA 4DSIA 4JKDA 3AV9A 4CERA 3C94A 1Y97A 4CJQA 1SKSA 3P83D 3SQ4A 3NE6A 1V4SA 4CD3A 2H3GX 1E4FT 4CFBA 3OA9A 5CYMA 3E66A 2PYLA 2NRTA 2DFFA 1XNQK 3T69A 4FWQA 4CJPA 1CXUA 5AQOA 3RR8A 3HVRA 3PV8A 3AO1A 2IVOA 4BC2A 3ENBA 4DR3K 5AQIA 3M8RA 2AJQA 2O8EA 4IG0A 4OKKA 5LJVA 2IGIA 3O80A 1I39A 1QS4A 5JLHA 2G8WA 1MU2A 3NH2A 4FZXC 3CJAA 2HF3A 1NK4A 2DTUA 1X3MA 1IJJA 3AVIA 1IKYA 2OCEA 3AA3A 4F2SA 3THWB 1N8RO 3WXLA 1N34K 3NHGA 4FLTA 1N33K 1S1VA 1RDWX 1GLEG 4K8XA 3CJ9A 3NGZA 4E7KA 1WLJA 5EU7A 2OPRA 2V52B 1CXQA 3PIOL 1HRHA 1T6DA 3QFPA 4JYAK 4LSNA 3O9SA 4G9ZA 4BQLA 5JVHL 3P31A 4KRFA 2G8VA 5TKWA 1FW6A 3CF5L 1X9WA 3DXMB 5HRRA 1BU6O 4JRPA 4BRMA 5AQMA 1RTHA 4GW6A 4KH5A 3ID6A 4IXCA 2HHQA 1SZ2A 3G10A 2E8AA 4WQ5C 3FZMA 1VQ9N 3D2FA 3V9WA 2D0AA 1WOQA 4M7XA 3MXIA 2PY5A 2NRVA 5M1NA 4RTFD 3S3NA 4JNEA 1S5JA 4YOTA 1LV5A 2E1YA 3ZT2A 5T7BA 4OLAA 3CCQN 5GAHP 4BG8A 4L8RB 3LP1A 3V1QA 4N47A 4IZ9A 5AZIA 2PZSA 1HJRA 1VK0A 3MX5A 5HLFA 3HYFA 1KVAA 1WBBA 3KHYA 2Z1HA 1T05A 1TUYA 2KZMA 1KTQA 3THYA 4CK2A 3LM2A 3ZEUA 1R0AA 3VQ9A 3OYHA 1DKGD 2DPNA 1RCHA 3ZT1A 5C24A 3N4QA 5HOOA 3I56N 3S9HA 1BI4B 1NJYA 2G8HA 1KRPA 4B1ZA 1S72N 2KHOA 4Y0WA 4J2DA 1TYQA 3NGYA 4X66K 4CESA 2NRXA 4JHDA 1ESVA 4DHYA 1NKCA 4BRKA 1KCFA 4DFJA 1BCMA 1YI2N 4E1JA 2A1SA 2WONA 1RBRA 5FLXO 4U67L 4YOWA 4DKWA 4OPHA 4KTQA 2O8DB 4DMNA 4O5FA 4EIAA 1S6QA 4B1XB 3LALA 1A5XA 2RE2A 4GKKK 2P9KA 1U45A 1J5EK 4A5AA 1HPZA 5AJ3K 4M3TA 4JI4K 3C65A 2YKNA
chains in the Genus database with same CATH topology
4JI7K 5IT9O 4DV3K 1XMQK 4DV1K 1IBMK 4JI3K 2VQFK 4NXMK 4DR6K 4B3SK 2UUCK 4CW7B 2UUAK 5LMUK 5A2QO 4DV5K 2E5LK 4KHPK 1HNZK 4DUYK 4LF7K 4JV5K 4V19S 4JI5K 3T1YK 1IBKK 4JI2K 4LFCK 5LMNK 4LFAK 1FJGK 1N32K 4DUZK 4B3TK 4AQYK 3JAMO 1I94K 4NXNK 5BR8K 2ZM6K 4B3RK 4GKJK 4DV2K 3T1HK 4DV6K 4X65K 4X62K 4DV7K 5IWAK 4LF6K 4LF5K 4DR5K 2UXBK 1N36K 1XNQK 4JI1K 4K0KK 3J7YP 5LL6Z 4JI0K 2HHHK 1HR0K 4LF9K 4DR3K 4OX9K 2UUBK 1HNWK 4X66K 4LF8K 4DR2K 1XMOK 4B3MK 4YY3K 3J81O 1HNXK 2VQEK 4DV0K 4DR1K 4DR7K 1XNRK 2UXDK 3J80O 5FLXO 1IBLK 4DR4K 3OTOK 1N34K 2F4VK 3J7AP 1N33K 4X64K 4LF4K 2UU9K 4GKKK 2UXCK 4DV4K 1J5EK 5AJ3K 4YHHK 4LFBK 4JI6K 4CVNE 4JI8K 4JI4K 4JYAK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI7 K;  5IT9 O;  4DV3 K;  1XMQ K;  4DV1 K;  1IBM K;  4JI3 K;  2VQF K;  4NXM K;  4DR6 K;  4B3S K;  2UUC K;  4CW7 B;  2UUA K;  5LMU K;  5A2Q O;  4DV5 K;  2E5L K;  4KHP K;  1HNZ K;  4DUY K;  4LF7 K;  4JV5 K;  4V19 S;  4JI5 K;  3T1Y K;  1IBK K;  4JI2 K;  4LFC K;  5LMN K;  4LFA K;  1FJG K;  1N32 K;  4DUZ K;  4B3T K;  4AQY K;  3JAM O;  1I94 K;  4NXN K;  5BR8 K;  2ZM6 K;  4B3R K;  4GKJ K;  4DV2 K;  3T1H K;  4DV6 K;  4X65 K;  4X62 K;  4DV7 K;  5IWA K;  4LF6 K;  4LF5 K;  4DR5 K;  2UXB K;  1N36 K;  1XNQ K;  4JI1 K;  4K0K K;  3J7Y P;  5LL6 Z;  4JI0 K;  2HHH K;  1HR0 K;  4LF9 K;  4DR3 K;  4OX9 K;  2UUB K;  1HNW K;  4X66 K;  4LF8 K;  4DR2 K;  1XMO K;  4B3M K;  4YY3 K;  3J81 O;  1HNX K;  2VQE K;  4DV0 K;  4DR1 K;  4DR7 K;  1XNR K;  2UXD K;  3J80 O;  5FLX O;  1IBL K;  4DR4 K;  3OTO K;  1N34 K;  2F4V K;  3J7A P;  1N33 K;  4X64 K;  4LF4 K;  2UU9 K;  4GKK K;  2UXC K;  4DV4 K;  1J5E K;  5AJ3 K;  4YHH K;  4LFB K;  4JI6 K;  4CVN E;  4JI8 K;  4JI4 K;  4JYA K; 
#chains in the Genus database with same CATH topology
 3T19 A;  3F2K A;  2Q3S A;  3VQD A;  1LWF A;  3HXM A;  4JI3 K;  5K14 A;  4LSL A;  5JLF A;  3NGI A;  1FXX A;  3MXM A;  1VQ4 N;  3KK7 A;  5EY4 A;  1NNE A;  4EP5 A;  3MEC A;  2ASO A;  2D0B A;  5GIP A;  4IFE A;  4JKG B;  4CEF A;  2P9P A;  5BRH A;  3CCM N;  4CJT A;  5AZJ B;  3ZX0 A;  4JN4 A;  4V19 S;  2OPQ A;  2D0P A;  4FWO A;  3E01 A;  4MO5 A;  3VEW A;  1XHZ A;  4AHV A;  3F73 A;  4CK3 A;  4HTL A;  1MA9 B;  5M1K A;  1FJG K;  2PAV A;  3UKR B;  3S3O A;  1XI1 A;  1X9S A;  1OH8 A;  4QS8 A;  4DQI A;  3KLF A;  3R6M A;  4I6M A;  3QEX A;  4OO1 J;  2P9L B;  3LZI A;  1NKE A;  5F0X A;  1YXQ A;  3K0S A;  3LWL A;  3LP0 A;  3HP6 A;  1D9F A;  1X3N A;  1N36 K;  4O5B A;  3TWH A;  3WXI A;  4HUG A;  1NOY A;  4CZE A;  3FLC O;  2RHK A;  4F4K A;  4Z4C A;  1HUX A;  3KLG A;  1UA1 A;  5FRN A;  4BQZ A;  4CEC A;  1KLM A;  2YCH A;  4BVO A;  5AQK A;  2A5X A;  4B3M K;  1KD1 O;  2VQE K;  1QHA A;  4PL8 A;  2A3Z A;  3ZET B;  4BDY A;  1RT6 A;  3HO1 A;  4JD2 A;  4IJA A;  1OKJ A;  3K57 A;  3VEN A;  1T6C A;  3W3D A;  2CH5 A;  5M1F A;  4KPY A;  2YJE A;  4O8K A;  4DF8 A;  2X78 A;  4DFM A;  3OTO K;  1TGO A;  1X1P A;  2E20 A;  3TSU A;  1C1B A;  4FWK A;  3DRP A;  1Y64 A;  4E19 A;  3DAW A;  3RSE B;  4DQP A;  1A5W A;  2BAN A;  1S1W A;  1KAY A;  3O6W A;  4IFY A;  1K8A O;  3IUC A;  3G25 A;  5AQL A;  3SMS A;  5KPZ A;  4B8C A;  2QW9 A;  1Q86 O;  3AVH A;  4LH5 A;  1XMQ K;  4FYD A;  2X6N A;  3GOI A;  4JK9 A;  3BEX A;  1TAU A;  2HW3 A;  1TKD A;  4FPB A;  3LDP A;  3OS1 A;  5AR0 A;  3SLC A;  1HQE A;  4CZL A;  1BA0 A;  1JXE A;  3HJF A;  2YHB A;  2OZS A;  1CZA N;  1RT3 A;  4CHQ A;  1VSK A;  4FZY A;  1J6Z A;  4HUF A;  4CIG A;  1VQN N;  3AO4 A;  3MWP A;  2FBX A;  4LH4 A;  3SK3 A;  1Q82 O;  4CK1 A;  1EP4 A;  4IDK A;  3P4I A;  3VGM A;  3ALY A;  3SPZ A;  2IIR A;  1JCE A;  1B92 A;  3UKU B;  5GIO A;  1EX4 A;  3FE1 A;  4PWD A;  4F2R A;  3IG1 A;  3TU5 A;  2E2O A;  3H3O B;  2ZJQ L;  4CF0 A;  1N5Y A;  4GY2 B;  4LD0 A;  4DV7 K;  4W5R A;  3BZC A;  3MX2 A;  5FDL A;  2YNI A;  4C1N K;  5JVG L;  4LF6 K;  4O0I A;  3IMX A;  3VES A;  3VEO A;  1WNS A;  3K9J A;  1GLA G;  4PKG A;  3VEV A;  4B9N A;  5AQU A;  1RT5 A;  4AM7 A;  3C6U A;  4CBX A;  1KSP A;  3ULE A;  5M1P A;  2E88 A;  3HM8 A;  5I9E B;  4DTU A;  3OS0 A;  3QEW A;  2P5O A;  3J81 O;  1XHX A;  1DTQ A;  4Y1C A;  3O1W A;  1GLL O;  2Q31 A;  4FJL A;  4WQ4 C;  3HPG A;  3TI0 A;  3O4Q A;  1XNR K;  2YHY A;  1K73 O;  3QEP A;  2Y1J A;  3WEE A;  3N4P A;  4PY5 A;  2YHW A;  1UAX A;  4JK7 A;  4MDB A;  3MED A;  3I0S A;  3M1F A;  2HHU A;  2DY4 A;  2I5J A;  4A57 A;  2YHA A;  4BRQ A;  4OKJ A;  3R1X A;  1NGC A;  4O44 A;  1CZ9 A;  1ATR A;  4NB4 A;  1U2V A;  3MWT A;  2KKZ A;  5CY4 A;  1WB9 A;  2VG6 A;  2KFN A;  3LP2 A;  2QWO A;  4K42 A;  4CJV A;  2IOC A;  3F9K A;  4WFB L;  3CD6 N;  1HJO A;  3HRG A;  4AHU A;  1WUA A;  2JLE A;  4I2Q A;  4CFC A;  4UQG A;  1TAQ A;  3SBG A;  3M8P A;  2IS3 A;  5CHI A;  4LF7 K;  4B9T A;  1DTT A;  4M3W A;  5CYQ A;  5HP1 A;  1SQK A;  2HHX A;  1NWK A;  3QLH A;  4M42 A;  3ZLJ A;  5LMN K;  4WF9 L;  3JXU A;  4DQQ A;  4FLZ A;  1OVY A;  1LW2 A;  4B1W B;  3V9U A;  3BGR A;  4DUZ K;  2W6L A;  3RMB A;  5ADX A;  1I94 K;  2EWS A;  3A8Y A;  3SV4 A;  1D8Y A;  1JLF A;  2RF2 A;  3H1V X;  2NUB A;  3CHW A;  2P9U B;  3CCL N;  2NRH A;  3CM5 A;  1MDU B;  1BIZ A;  4FJ9 A;  3D2E B;  4R79 A;  4FM1 A;  4NYN A;  3BDP A;  1TL3 A;  4U7B A;  2FBT A;  2PYJ A;  4EAH D;  3U9Z A;  2IVP A;  5BR9 A;  4B08 A;  4IO8 A;  2QKK A;  3GG4 A;  3ZX2 A;  3J7Y P;  4FVU A;  1VSJ A;  2HNY A;  5AQP A;  4IDH A;  1GLC G;  4JI0 K;  3DYA A;  4OJR A;  3IDH A;  1HKG A;  4E1N A;  2UUB K;  1HNW K;  1JCG A;  2AP1 A;  4C8L A;  1S22 A;  1XMO K;  4DR7 K;  4FJX A;  4RW4 A;  2ZGY A;  5AQZ A;  3L6Q A;  1QE1 A;  4H0Y B;  3VEZ A;  3WNG A;  1JLG A;  3K5O A;  2HVH A;  4WQ5 A;  3LZJ A;  1B9F A;  3H45 C;  2ZQB A;  3QER A;  4H0P A;  4JS4 A;  4BRF A;  4CEZ A;  2A41 A;  3HVT A;  3TTD A;  5IT9 O;  5GAE P;  4DTN A;  1U48 A;  4FJG A;  1RFQ A;  4GV6 A;  4NCG A;  1XWL A;  4M3X A;  4KHN A;  1JXB A;  4K25 A;  3QIN A;  1VRT A;  1NK7 A;  1HNZ K;  4ELV A;  1VQ8 N;  4H0O A;  3DLL L;  2QTD A;  4EZ6 A;  1RDD A;  5SZT A;  5CE3 A;  1G15 A;  3T3F A;  4OLB A;  1BGX T;  3A5L C;  4M63 C;  4MO4 A;  1RIL A;  4H5T A;  4CCH A;  1ITG A;  1TK8 A;  3SPY A;  5BRE A;  4DQS A;  1IKX A;  1SAZ A;  4CZK A;  4H8K A;  2YKM A;  2X74 A;  3WNH A;  4B3T K;  1WSH A;  4BRO A;  4WCE L;  3AY9 A;  5GIN A;  3C6A A;  4A62 A;  2P1J A;  4CJK A;  3HST B;  3VQ4 A;  1NBW A;  1ATS A;  3NAE A;  3BZK A;  1U49 A;  3DLR A;  1RTI A;  1KFD A;  3D2F B;  4LY7 A;  4E89 A;  3A5M C;  4N76 A;  4I9L A;  1G99 A;  4FVM A;  3G4S N;  4DSE A;  4YOU A;  5M1O A;  3THX A;  1RBU A;  4M3R A;  4MLE A;  4BRG A;  3SNN A;  3TTC A;  4KO0 A;  1Z25 A;  2KQ2 A;  1BO5 O;  2ETJ A;  1C0M A;  4KHY A;  5AZI B;  3AA5 X;  3U3G A;  4AF1 A;  4CJW A;  5AQQ A;  4ISG A;  3ZSV A;  1Q7Y O;  1RT1 A;  3MEG A;  3S41 A;  3THY B;  3MK6 A;  4FLU A;  2UXD K;  2VWK A;  3ZEU B;  1ILY A;  1VSL A;  3HZ6 A;  3PY8 A;  1U6Z A;  4JK8 A;  4W5O A;  4CHN A;  2O8F A;  2ZJP L;  5KPT A;  1VSD A;  1XQS C;  1O1W A;  3LWM A;  3R9P A;  4XH1 A;  3CJ1 A;  2NNW A;  1TKT A;  1T7P A;  1TYQ B;  1LWC A;  4RW7 A;  3C7N B;  2VGN A;  1BDG A;  2XY8 A;  4NCA A;  4JHD B;  5FRO A;  1U4B A;  5GAD P;  1NM1 A;  3ATV A;  1DGK N;  3LL3 A;  4CHY A;  5JMV A;  3SI6 A;  5HRP A;  5LMU K;  3ISN C;  3KLH A;  1NK9 A;  4KHP K;  4JAX A;  2CH6 A;  3EO3 A;  2OTL N;  1RBS A;  4R5P A;  1EO1 A;  1NMN A;  4BDZ A;  4FJ5 A;  3ZT0 A;  5J2N A;  3PX0 A;  2P9K B;  5B8H A;  5E26 A;  3THV A;  3OBY A;  1REV A;  2B6A A;  3BY5 A;  1L5U A;  4LFC K;  1TL1 A;  3HL8 A;  1E4G T;  2ASP A;  1N32 K;  2D0C A;  1EWR A;  1GLB G;  1CLQ A;  4BC5 A;  2XY7 A;  2WBN A;  2F9W A;  3KWI A;  3PLA A;  4FCY A;  4FLY A;  1IO2 A;  2QXL A;  2QWL A;  1KAX A;  4JRQ A;  4B3R K;  3KK1 A;  5AQV A;  3CQX A;  2YNH A;  2D5R A;  3MCP A;  2VGM A;  2BH1 A;  2P9P B;  1WSF A;  5SWM A;  5EXW A;  4EHU A;  2V7Y A;  3CCR N;  1RBT A;  3VOV A;  5C42 A;  2EX3 A;  3LDN A;  5C2D A;  2QWN A;  1RGI A;  4BAC A;  1RT4 A;  4RW6 A;  2E2N A;  3ITH A;  4L3Q A;  3QIC A;  1QSY A;  4CGI A;  2E2P A;  3O3F A;  4C23 A;  3C6T A;  4M3Z A;  1SL1 A;  4AHC A;  4CE9 A;  1V4T A;  2QK9 A;  3VF4 A;  4CF8 A;  5BRD A;  4I6M B;  4YFU A;  1T8E A;  3I55 N;  1U04 A;  4KHS A;  3W0L A;  2I7P A;  2OPS A;  4DU3 A;  1ZBL A;  2KLA A;  4FZZ A;  3JYT A;  3J7A P;  4KH6 A;  3L2V A;  4DWI A;  3CXC M;  2YNG A;  4BWM A;  3FZH A;  1JLE A;  4DQR A;  1OH7 A;  3V9X A;  3VQE A;  1OH6 A;  5E41 A;  3HPH A;  3LAK A;  1BCO A;  2FF3 B;  3A2F A;  4JKH A;  4E7J A;  3ZX3 A;  2VQF K;  4HHT A;  2XHB A;  5KPR A;  2FBY A;  3GL1 A;  2XO7 A;  3AAQ A;  4ZTF A;  1ZBH A;  4DFK A;  1WBD A;  1ASV A;  2E5L K;  4NYF A;  3J8A A;  4CF1 A;  3OVN A;  4KB1 A;  4CF2 A;  4H5N A;  2O8C A;  1EWQ A;  1YT3 A;  4BGA A;  1S3X A;  4Z4E A;  1Z6R A;  4BC3 A;  1YJW N;  1SL0 A;  1S6P A;  4FK2 A;  3O9U A;  1WSI A;  1YF5 L;  3KD5 E;  4B9L A;  4LFA K;  3NF8 A;  5C10 A;  3QBX A;  4AQY K;  3E1Y A;  4YOX A;  1QZ5 A;  3D0P A;  5HRS A;  3NMU A;  1KAZ A;  4EFH A;  1KLN A;  5KGX A;  3OW2 M;  2P51 A;  2OAN A;  5KQ8 A;  1Q9X A;  5JS1 A;  4FM0 A;  1SKW A;  4GV3 A;  2GUI A;  4FSV A;  4DV2 K;  2KFZ A;  3I8B A;  3LPU A;  4WQ4 A;  5AQF A;  4DF4 A;  2RPI A;  2V7Z A;  4LF5 K;  1VQ6 N;  1YTA A;  3ZSQ A;  1W9H A;  4Z4F A;  4OKE A;  4A5B A;  4KAZ A;  3V6D A;  3VQ8 A;  1J9A A;  2ZE2 A;  4KHW A;  4DU1 A;  1SV5 A;  4B9Q A;  3SUP A;  4CZM A;  1ZC6 A;  3AGR A;  3EZ5 A;  3MAQ A;  3OYN A;  4I2P A;  2HMI A;  3L2Q A;  1HPM A;  3AVK A;  3M8S A;  3ZSO A;  5FPM A;  4KHQ A;  4LF8 K;  4Z94 A;  3KK2 A;  4TSX A;  3NBP A;  1SKR A;  4PA1 A;  2G8U A;  2F8S A;  4FWN A;  3SUN A;  3OYD A;  4DSK A;  3H1Q A;  3BF1 A;  1HX1 A;  3NVK A;  1NGE A;  4CHZ A;  5C12 A;  3CCU N;  5HRO A;  5EOY A;  5AQN A;  4DTJ A;  4KTZ A;  4YHH K;  2IAJ A;  1NK6 A;  1UWB A;  2FSK A;  4BRA A;  3ULE B;  5J1E A;  1IH7 A;  5ELZ A;  3WQT A;  1ZBF A;  3HTV A;  4N56 A;  3E9L A;  4EHT A;  4DTP A;  5F1X A;  2QA4 N;  4PKI A;  4YOV A;  4M3U A;  3PUF A;  4NO7 A;  4M7Y A;  2NRZ A;  1FKO A;  4PQU A;  3WEE B;  4QS7 A;  1C0T A;  4CEO A;  4FJI A;  3OYK A;  4E3S A;  4OPK A;  3FZL A;  4HUE A;  4CJ5 A;  3VGL A;  1L3V A;  4CJF A;  3I8D A;  4CIF A;  3C0B A;  1QQO A;  3TAQ A;  3CCS N;  1N6Q A;  3DWL A;  3P38 A;  1F21 A;  2FXU A;  3V9Z A;  4F8R A;  1L3S A;  3ENH A;  3M8Q A;  3L8B A;  4DTM A;  1NJI O;  4E7I A;  4I9Q A;  1RT2 A;  1XC3 A;  4UY8 O;  3HSC A;  2OZM A;  4FXD A;  4BG9 A;  1QQC A;  2D0O A;  2FSJ A;  4KTW A;  4B3O A;  3R8E A;  4MDA A;  3O3H A;  1YTU A;  1Q81 O;  4CED A;  3BUZ B;  4K0K K;  5J2Q A;  4E7H A;  4LF9 K;  3E9O A;  3OYE A;  1VAZ A;  3EYZ A;  4XIU A;  3KTQ A;  3HOT A;  3CJ7 A;  4IEI A;  3VQP A;  4RCH A;  1BG3 A;  3NFA A;  2OA8 A;  4YDU A;  2YX6 A;  1EXQ A;  4DFP A;  3SUO A;  3WUH A;  2Q1N A;  4DTX A;  4CD1 A;  1VSE A;  3DLE A;  2WUS A;  4IOX A;  3SJJ A;  4GVM A;  3PSF A;  2BTF A;  1M90 O;  2F8T A;  3K2P A;  3CYM A;  1C0U A;  4CHO A;  4QS9 A;  3O4N A;  4FWL A;  3L0Q A;  1QHT A;  1NGA A;  2IC3 A;  4Y1D A;  3VN5 A;  4BR9 A;  2HB5 A;  4BC4 A;  3AVC A;  2QEX N;  2WTU A;  3DOL A;  2IVN A;  2FF6 A;  4GV9 A;  3PO5 A;  4DV3 K;  4HTU A;  1IBM K;  2GV9 A;  1NKB A;  1YAG A;  4A59 A;  3CQY A;  4NXM K;  3KD1 E;  3LDQ A;  4FLW A;  4Z4I A;  4LC9 B;  4CW7 B;  4BE0 A;  3JS6 A;  2ZGZ A;  2B4J A;  4A2A A;  4CGH A;  2HHS A;  4JLH A;  3VQB A;  3OJS A;  3UIQ A;  1QSL A;  1TVR A;  4DS5 A;  3L2W A;  3QNN A;  1TUU A;  1GOC A;  4IOA L;  4F3O A;  3VGK A;  2GWK A;  2QM1 A;  1WSJ A;  1C0G A;  1K8K A;  4BR4 A;  1H1V A;  2ATQ A;  3ULD A;  3M5R A;  2J4R A;  5CZ2 A;  1RNH A;  1NGH A;  3SJH A;  4DSF A;  1K6Y A;  3CJC A;  3HI0 A;  1S9G A;  3NF7 A;  3WQU A;  4Z0U A;  3WXM B;  5C2F A;  4X62 K;  3AVA A;  3QBW A;  3FZK A;  3K58 A;  4F9O A;  3PO4 A;  1VRU A;  1YVN A;  3MN9 A;  3T7Z A;  3KVG A;  4CJ7 A;  3TAN A;  3D6R A;  5C0Y A;  3NH1 A;  2Z1G A;  5J2P A;  1RTD A;  2FBV A;  2YNF A;  1NK0 A;  2EHG A;  2HHH K;  4OX9 K;  1C1A A;  2F9T A;  2O4G A;  4ILG B;  4H0X B;  4ILJ A;  1Q18 A;  4DR2 K;  2WFB A;  2E4L A;  2P9I A;  1JLA A;  4K43 A;  3P1G A;  3OYM A;  3CET A;  2QXF A;  2HBK A;  3PIP L;  3V9S A;  2HVI A;  2I7N A;  1KVC A;  2Z1I A;  3CG7 A;  4X64 K;  4LF4 K;  4N5S A;  3THX B;  2HNZ A;  3QEV A;  3K5L A;  1TV6 A;  5F2R A;  4KKO A;  1EQY A;  3C95 A;  4ID5 A;  4IG3 A;  4BWJ A;  3OYL A;  1YHQ N;  3NVM A;  1Z26 A;  3G6E N;  3TAM A;  3V4I A;  4KRE A;  2Q97 A;  3AO5 A;  3AVN A;  4FWP A;  1NK5 A;  4FWS A;  4BRC A;  4A61 A;  3G0Z A;  2OPP A;  3T1A A;  3G71 N;  3BP8 A;  3OBW A;  3RMC A;  2O8F B;  4Z4G A;  4C8K A;  1E3M A;  4JV5 K;  3RR7 A;  1C0F A;  4CGG A;  2O8E B;  3TTF A;  2Q2R A;  1HYZ A;  3E9P A;  4BY9 C;  4E0D A;  4YDU C;  3B6P A;  4AHS A;  3LP3 A;  3IRX A;  3FZF A;  2UYT A;  4C8N A;  4PHT X;  3UE5 A;  1WSG A;  4IKF A;  5BPM A;  4YOR A;  3OYA A;  3AVB A;  4BVP A;  3AVM A;  3FFI A;  2VCP A;  4NXN K;  2KW4 A;  4CJ4 A;  2FLO A;  3A5N C;  3KJV A;  3TAG A;  5FPN A;  4MFB A;  2ZF5 O;  3VPZ A;  3SAG A;  1W0H A;  5KRS A;  3A5O C;  1ZYQ A;  2UXB K;  3Q7C A;  3WNF A;  3LAN A;  1QSS A;  4J2A A;  2QWP A;  4CGJ A;  3SZ2 A;  1BA1 A;  2ASM A;  2OYQ A;  2Q0U A;  3VEY A;  4YOY A;  1RBV A;  3VQC A;  2BE2 A;  1W7A A;  1C1C A;  3CCV N;  1ATN A;  4ISE A;  2HF4 A;  3VMF B;  1RDB A;  1WAJ A;  5D3G A;  4CJR A;  4OGC A;  5AQY A;  3NDK A;  3IKM A;  1NGB A;  3O9R A;  4DR1 K;  1SL2 A;  4YNQ A;  4DCH A;  3CMA N;  1BUP A;  4FOE A;  1GLF O;  3HK2 A;  3DXK A;  5EVZ A;  3H08 A;  1HKB A;  1YUW A;  3K59 A;  4F3T A;  4DTS A;  4B1U B;  4ILH A;  1TK5 A;  2UU9 K;  3VQ7 A;  2QI2 A;  5AQJ A;  3EKU A;  3ZT3 A;  1ASW A;  2A42 A;  3MCA B;  1T44 A;  1BQM A;  2NRR A;  3F9M A;  5CR4 A;  4M3Y A;  4KH4 A;  1I3A A;  3V1O A;  1Q8I A;  3MDQ A;  1MWK A;  2Q36 A;  4DR6 K;  5LJW A;  1OVQ A;  1WAF A;  1S9E A;  2UUA K;  3RMD A;  3CFO A;  3DLK A;  2HND A;  2G8K A;  4DQ8 A;  1MWM A;  2FSN A;  4CJL A;  4N41 A;  4CBU A;  4ELT A;  5AFU H;  3L2U A;  4JI5 K;  1T3V A;  1DLO A;  3CPW M;  3T1Y K;  5FPD A;  4BR7 A;  3EZW A;  3O08 A;  4BR0 A;  3EL2 A;  2HBL A;  3UB5 A;  5LY3 A;  1QZ6 A;  2BUP A;  5C15 A;  5BRF A;  4IFV A;  1SUQ A;  4W5T A;  4BGB A;  1KVB A;  1NGG A;  5ADX H;  1D5A A;  4K41 A;  3TSP A;  4EZ9 A;  3MN7 A;  1RDA A;  3KK3 A;  1YJ9 N;  2BGG A;  5E84 A;  3FR0 A;  2P9S A;  4B8A B;  3ZYY X;  2E1Z A;  4X65 K;  4FJ7 A;  1JLB A;  3R3L A;  2O8C B;  1K9M O;  2D1K A;  5AQR A;  1KQS M;  3QIP A;  3CME N;  2JWL A;  2DFH A;  1KXP A;  3CC7 N;  3CQ8 A;  2YV0 X;  3VA0 A;  1NGI A;  1EET A;  2P9N A;  5EX5 A;  5DM6 L;  4RWT A;  4FJ8 A;  3U6F A;  5HRN A;  3HOS A;  3QEI A;  5KGW A;  2WOM A;  3FGU A;  4GVE A;  3ZSZ A;  3OYF A;  4KB0 A;  3K9K A;  2KTQ A;  2GX9 A;  2W6K A;  2QWR A;  4RG8 A;  3RVC A;  3S3M A;  2Q0R A;  3L2R A;  4FJK A;  3OYI A;  1IG8 A;  2O8B A;  4CFA A;  3KIO A;  3ZCM A;  5H1S Q;  1NK8 A;  3EN9 A;  1VQM N;  4BDP A;  1NJZ A;  1ZXO A;  4CF9 A;  4QAG A;  3TAR A;  4E1M A;  1JLQ A;  4B9U A;  2HHW A;  1VSI A;  4FM2 A;  2W41 A;  4AM6 A;  4KHU A;  3NCI A;  3U9D A;  4C8O A;  2ITG A;  1NGF A;  4WFN L;  5A2Q O;  3HBT A;  4DV5 K;  3H46 O;  3LDO A;  3EY1 A;  1KFS A;  4CZF A;  4O55 A;  3H6E A;  4FW2 A;  3AAR A;  1VQ5 N;  3DOK A;  3IAY A;  1GOA A;  1RT7 A;  4JI2 K;  4H5V A;  1IBK K;  3RMA A;  4AHR A;  1VSF A;  3QDK A;  4JD2 B;  3O8M A;  4H0T B;  1FKP A;  4JKA A;  4B9S A;  2ITM A;  3C7N A;  3MXJ A;  3CC4 N;  3AVL A;  3VQ6 A;  3DRS A;  3F5T A;  3T1H K;  5GAG P;  4Q0B A;  2GWJ A;  5I42 A;  1UOC A;  1ZBS A;  4BE1 A;  1D9D A;  3THW A;  2E6M A;  1WN7 A;  4E7L A;  4BRI A;  4ID1 A;  3NF6 A;  4Z4H A;  5KQD A;  4DLE A;  3ENO A;  2BDP A;  1B9D A;  4XH4 A;  3L4I A;  2X6S A;  5FPE A;  1T03 A;  3L3U A;  2VYP A;  4WE1 A;  1VSH A;  4RW9 A;  4CHP A;  5BPN A;  3EE9 A;  3SUQ A;  3SV3 A;  3OHR A;  1QTM A;  5JIC A;  2ZD1 A;  3DXM A;  3CI5 A;  4FLX A;  4B9V A;  2HOE A;  1NG9 A;  4DV0 K;  4FLV A;  4FPA A;  3DM2 A;  4MLH A;  2B5J A;  4JEP A;  3SYZ A;  1C6V A;  2HBM A;  1NJX A;  4FL9 A;  2FC0 A;  3OYG A;  3SMP A;  1NLV A;  3ZSR A;  4GNI A;  1IG9 A;  4JI8 K;  4B9M A;  1OH5 A;  3OY9 A;  5HL7 L;  1J5O A;  4H5R A;  4BE2 A;  2F96 A;  4H4M A;  4JI7 K;  4CIE A;  4DV1 K;  3ZSY A;  4ISF A;  2CGL A;  1M1K O;  4B3S K;  3L4Q A;  4O0J A;  3O9Q A;  3B8A X;  3I33 A;  3HM9 A;  4GMJ B;  4OPA A;  4MQ3 A;  5KI6 A;  4JS5 A;  3L3V A;  1GLD G;  4CJS A;  1W2B M;  3GE1 A;  2F7T A;  3OYJ A;  3CC2 N;  3ASM A;  1BIS A;  4HCC A;  2V51 B;  1BI4 A;  1S1X A;  3EKS A;  1R59 O;  1DEJ A;  3VQA A;  4KI6 A;  3ATU A;  4NLB A;  4OGE A;  3C6H A;  1HNI A;  3IS9 A;  3QES A;  3SQ1 A;  4A2B A;  3EEQ A;  4CFD A;  4CZJ A;  3B6O A;  5BR8 K;  4O4G A;  1VQO N;  3AVJ A;  3LAM A;  3J7Z O;  1BQN A;  5BN8 A;  1JKH A;  4HCB A;  3O9T A;  4J8F A;  1IKV A;  1VHX A;  4AIL C;  4I7F A;  4DV6 K;  3Q7B A;  3WT0 A;  3TAB A;  4DTO A;  2VWJ A;  1NGJ A;  2O8D A;  3MEE A;  4ICL A;  1L3T A;  3SQ0 A;  3DLG A;  4NLC A;  3DI6 A;  1J53 A;  3OYC A;  3LDS A;  2QWQ A;  4AHT A;  1VSM A;  3PX6 A;  1U2V B;  2XY6 A;  4KI4 A;  1K8K B;  3RRG A;  4C8M A;  4W5Q A;  1S1T A;  1YIT N;  3VTH A;  4FJM A;  3H3N O;  3U3Y A;  2P5G A;  1WSE A;  4YY3 K;  2VWB A;  2LSN A;  3P5J A;  3DJC A;  2GEM A;  4O8U A;  3ZSX A;  1CZB A;  1Q9Y A;  4JKC A;  5AQS A;  4QCL A;  3J80 O;  3RRH A;  1D4X A;  2JWK A;  4CEQ A;  2F4V K;  2PBD A;  4JKG A;  3QNO A;  4PUO A;  5AZJ A;  3LDL A;  2VG7 A;  2UXC K;  4FOI A;  4CJE A;  4JKF A;  3EE8 A;  4JI6 K;  3TPQ A;  4HWI A;  3DMJ A;  3VER A;  3AA4 A;  4H5W A;  3O4W A;  4AH9 A;  3SAF A;  4BRP A;  4H03 B;  3QB0 A;  1LWE A;  1YJN N;  3UKR A;  1RDU A;  4CEE A;  3CFP A;  2P9I B;  3CM6 A;  3MMV A;  3LM9 A;  1VQ7 N;  1TKX A;  2HHV A;  3M6G A;  2P9L A;  1BWF O;  5C25 A;  1Z05 A;  4CZH A;  4CBW A;  4JKE A;  3P39 A;  4BRH A;  4FK0 A;  4HVJ A;  3AO2 A;  2HMP A;  1L3U A;  4C1N I;  1QVG M;  3U4L A;  2Y1I A;  1LOT B;  4J2B A;  5AQX A;  5AQG A;  1O13 A;  2YHX A;  2AA4 A;  2YJF A;  1QQN A;  2KZZ A;  2OTJ N;  2Z1J A;  5JS2 A;  1TKZ A;  3KKR A;  3QO9 A;  2ZJR L;  5BPL A;  3SAH A;  1YIJ N;  4NCB A;  4FK4 A;  3ZET A;  1JL1 A;  5BN9 A;  3KLI A;  3VF6 A;  4WFA L;  1HMV A;  2ZM6 K;  2E2Q A;  4QOZ B;  2HST A;  1JLC A;  4IO9 L;  1EKE A;  2E6L A;  2D4W A;  1BHL A;  4OVL A;  5IWA K;  2NRW A;  2ZWH A;  4DR5 K;  4CJU A;  3QET A;  1W97 L;  3RSE A;  3K5M A;  4CZI A;  4DTR A;  2GTD A;  3DLH A;  4DSL A;  3O5B A;  4KFB A;  4DU4 A;  5LL6 Z;  1TK0 A;  1HR0 K;  3KZB A;  3CFR A;  3JSM A;  4IEE A;  5TKY A;  5KRT A;  5DK5 A;  3VTI A;  3OJU A;  4FWM A;  3AVF A;  5I3U A;  3TAE A;  3M3Z A;  3QML A;  1NJW A;  1GOB A;  1IBL K;  5CZ1 A;  4BR2 A;  4M45 A;  1VQL N;  1QVF M;  3QIO A;  4ZHR A;  1ASU A;  1LAW A;  3CIP A;  4IBN A;  3AGK A;  4KBO A;  4B1V A;  1IKW A;  4XH5 A;  5DMR A;  5M1Q A;  4CVN E;  3GBT A;  3MN6 A;  1HKC A;  5AFU A;  2QKB A;  3AA2 A;  3TAP A;  3HP9 A;  5HBM A;  4B1Y B;  2CGK A;  1ZBI A;  3NH0 A;  3CCJ N;  2A6A A;  3U8X A;  3RTV A;  4IWV A;  3FFK B;  1NMD A;  2UUC K;  3UKU A;  1LW0 A;  5KTQ A;  2GBZ A;  2JGU A;  1HYS A;  3V1R A;  1BL3 A;  1UA0 A;  2NLX A;  3DXK B;  1JL2 A;  2G8F A;  3CJB A;  4H4O A;  4FO0 A;  4FWR A;  3WNE A;  4BRL A;  3TSQ A;  3SCX A;  3OS2 A;  4FJN A;  3VQ5 A;  4BR5 A;  3MN5 A;  3QFU A;  4CJ3 A;  1S1U A;  1LAV A;  1KC8 O;  3VET A;  1HNV A;  3HT3 A;  2W40 A;  1FK9 A;  3SBT A;  3VEX A;  4J2E A;  3WXJ A;  4FJH A;  1YVU A;  3ID8 A;  4ZTJ A;  2G8I A;  3TAF A;  2R7Y A;  2O4I A;  3D7E O;  2RN2 A;  1LCU A;  3LPT A;  4EP4 A;  1QQM A;  2HHT A;  4GKJ K;  5MLC Q;  3PSI A;  3CER A;  4PL7 A;  1VQK N;  1X9M A;  2A40 A;  4DLG A;  2NZT A;  3IFR A;  3WXK A;  4PKH A;  4CEA A;  3VQQ A;  4IOC L;  3GDQ A;  1HLU A;  4JI1 K;  1VQP N;  3KLE A;  4IJN A;  3AAP A;  4JKB A;  2VG5 A;  1NGD A;  1U47 A;  4CGD A;  1GLJ O;  4CZG A;  3AVG A;  3KWG A;  1HNX K;  1P90 A;  2P9S B;  4H0V B;  1DT9 A;  4CGF A;  2W42 A;  3RWU A;  3O1B A;  2IDO A;  2CGJ A;  4DR4 K;  3BF3 A;  5DM7 L;  1IV0 A;  2PFU A;  3V81 A;  3TR8 A;  3O3G A;  1A5V A;  4FW1 A;  2WC9 A;  1XC9 A;  4DV4 K;  3HPO A;  4LFB K;  4DS4 A;  1JCF A;  1P8Z A;  3CPE A;  2RKI A;  4FJJ A;  4CI6 A;  1BIU A;  1J54 A;  3VA3 A;  1XUP O;  4ELU A;  2P9N B;  4DG1 A;  3OYB A;  3I0R A;  2YI1 A;  1JJ2 M;  3A0I X;  3KKS A;  5FRM A;  3NF9 A;  2GUP A;  4OPJ A;  2XRI A;  1BOT O;  4XEI A;  4W5N A;  4WYB A;  3DLB A;  1RTJ A;  2P9U A;  3ZSW A;  2HBJ A;  3CCE N;  4M41 A;  5AQW A;  3D2E A;  1SS6 A;  3K5N A;  3DRR A;  4DUY K;  4K8Z A;  5J2M A;  2O8B B;  1HQU A;  3PX4 A;  1RDC A;  3D45 A;  1HYV A;  3VF2 A;  3SQ2 A;  4G1Q A;  4BRD A;  4DSJ A;  4KV8 A;  1NU0 A;  4DB3 A;  2A1R A;  1ZBU A;  4BRN A;  3AO3 A;  2DFE A;  3JAM O;  4Q5V A;  2GEL A;  5AQT A;  1NOZ A;  4BRE A;  4CEB A;  5AQH A;  2XY5 A;  1X9J A;  4RW8 A;  3ZT4 A;  2QWM A;  4DSI A;  4JKD A;  3AV9 A;  4CER A;  3C94 A;  1Y97 A;  4CJQ A;  1SKS A;  3P83 D;  3SQ4 A;  3NE6 A;  1V4S A;  4CD3 A;  2H3G X;  1E4F T;  4CFB A;  3OA9 A;  5CYM A;  3E66 A;  2PYL A;  2NRT A;  2DFF A;  1XNQ K;  3T69 A;  4FWQ A;  4CJP A;  1CXU A;  5AQO A;  3RR8 A;  3HVR A;  3PV8 A;  3AO1 A;  2IVO A;  4BC2 A;  3ENB A;  4DR3 K;  5AQI A;  3M8R A;  2AJQ A;  2O8E A;  4IG0 A;  4OKK A;  5LJV A;  2IGI A;  3O80 A;  1I39 A;  1QS4 A;  5JLH A;  2G8W A;  1MU2 A;  3NH2 A;  4FZX C;  3CJA A;  2HF3 A;  1NK4 A;  2DTU A;  1X3M A;  1IJJ A;  3AVI A;  1IKY A;  2OCE A;  3AA3 A;  4F2S A;  3THW B;  1N8R O;  3WXL A;  1N34 K;  3NHG A;  4FLT A;  1N33 K;  1S1V A;  1RDW X;  1GLE G;  4K8X A;  3CJ9 A;  3NGZ A;  4E7K A;  1WLJ A;  5EU7 A;  2OPR A;  2V52 B;  1CXQ A;  3PIO L;  1HRH A;  1T6D A;  3QFP A;  4JYA K;  4LSN A;  3O9S A;  4G9Z A;  4BQL A;  5JVH L;  3P31 A;  4KRF A;  2G8V A;  5TKW A;  1FW6 A;  3CF5 L;  1X9W A;  3DXM B;  5HRR A;  1BU6 O;  4JRP A;  4BRM A;  5AQM A;  1RTH A;  4GW6 A;  4KH5 A;  3ID6 A;  4IXC A;  2HHQ A;  1SZ2 A;  3G10 A;  2E8A A;  4WQ5 C;  3FZM A;  1VQ9 N;  3D2F A;  3V9W A;  2D0A A;  1WOQ A;  4M7X A;  3MXI A;  2PY5 A;  2NRV A;  5M1N A;  4RTF D;  3S3N A;  4JNE A;  1S5J A;  4YOT A;  1LV5 A;  2E1Y A;  3ZT2 A;  5T7B A;  4OLA A;  3CCQ N;  5GAH P;  4BG8 A;  4L8R B;  3LP1 A;  3V1Q A;  4N47 A;  4IZ9 A;  5AZI A;  2PZS A;  1HJR A;  1VK0 A;  3MX5 A;  5HLF A;  3HYF A;  1KVA A;  1WBB A;  3KHY A;  2Z1H A;  1T05 A;  1TUY A;  2KZM A;  1KTQ A;  3THY A;  4CK2 A;  3LM2 A;  3ZEU A;  1R0A A;  3VQ9 A;  3OYH A;  1DKG D;  2DPN A;  1RCH A;  3ZT1 A;  5C24 A;  3N4Q A;  5HOO A;  3I56 N;  3S9H A;  1BI4 B;  1NJY A;  2G8H A;  1KRP A;  4B1Z A;  1S72 N;  2KHO A;  4Y0W A;  4J2D A;  1TYQ A;  3NGY A;  4X66 K;  4CES A;  2NRX A;  4JHD A;  1ESV A;  4DHY A;  1NKC A;  4BRK A;  1KCF A;  4DFJ A;  1BCM A;  1YI2 N;  4E1J A;  2A1S A;  2WON A;  1RBR A;  5FLX O;  4U67 L;  4YOW A;  4DKW A;  4OPH A;  4KTQ A;  2O8D B;  4DMN A;  4O5F A;  4EIA A;  1S6Q A;  4B1X B;  3LAL A;  1A5X A;  2RE2 A;  4GKK K;  2P9K A;  1U45 A;  1J5E K;  4A5A A;  1HPZ A;  5AJ3 K;  4M3T A;  4JI4 K;  3C65 A;  2YKN A; 
#chains in the Genus database with same CATH homology
 4JI7 K;  5IT9 O;  4DV3 K;  1XMQ K;  4DV1 K;  1IBM K;  4JI3 K;  2VQF K;  4NXM K;  4DR6 K;  4B3S K;  2UUC K;  4CW7 B;  2UUA K;  5LMU K;  5A2Q O;  4DV5 K;  2E5L K;  4KHP K;  1HNZ K;  4DUY K;  4LF7 K;  4JV5 K;  4V19 S;  4JI5 K;  3T1Y K;  1IBK K;  4JI2 K;  4LFC K;  5LMN K;  4LFA K;  1FJG K;  1N32 K;  4DUZ K;  4B3T K;  4AQY K;  3JAM O;  1I94 K;  4NXN K;  5BR8 K;  2ZM6 K;  4B3R K;  4GKJ K;  4DV2 K;  3T1H K;  4DV6 K;  4X65 K;  4X62 K;  4DV7 K;  5IWA K;  4LF6 K;  4LF5 K;  4DR5 K;  2UXB K;  1N36 K;  1XNQ K;  4JI1 K;  4K0K K;  3J7Y P;  5LL6 Z;  4JI0 K;  2HHH K;  1HR0 K;  4LF9 K;  4DR3 K;  4OX9 K;  2UUB K;  1HNW K;  4X66 K;  4LF8 K;  4DR2 K;  1XMO K;  4B3M K;  4YY3 K;  3J81 O;  1HNX K;  2VQE K;  4DV0 K;  4DR1 K;  4DR7 K;  1XNR K;  2UXD K;  3J80 O;  5FLX O;  1IBL K;  4DR4 K;  3OTO K;  1N34 K;  2F4V K;  3J7A P;  1N33 K;  4X64 K;  4LF4 K;  2UU9 K;  4GKK K;  2UXC K;  4DV4 K;  1J5E K;  5AJ3 K;  4YHH K;  4LFB K;  4JI6 K;  4CVN E;  4JI8 K;  4JI4 K;  4JYA K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...