5IWAK

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
115
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
molecule keywords 30S ribosomal protein S2
total genus 25
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2016-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 5iwaK00
4DR1K 1HNWK 3J7AP 4B3SK 4GKJK 2VQFK 4AQYK 4JI6K 4DV3K 3JAMO 4DUYK 1HNZK 5BR8K 3J7YP 1FJGK 5LMUK 4B3TK 4JI2K 4X66K 4NXMK 4X64K 1J5EK 4LF5K 4NXNK 4LF8K 4JI1K 5FLXO 1HR0K 1HNXK 1XMOK 1IBKK 1N32K 2UXDK 2F4VK 5IT9O 4DV6K 2UXBK 4CVNE 1I94K 4JI5K 4DV1K 4OX9K 4DV7K 4DV4K 4LF4K 4YY3K 4LF6K 4DR4K 4CW7B 4B3RK 4LF9K 2UXCK 4DR5K 5IWAK 4JI3K 4B3MK 1XMQK 3J80O 1N34K 2UUBK 2HHHK 4JI8K 3J81O 4V19S 4KHPK 4GKKK 2E5LK 5LL6Z 4LFBK 4LF7K 2UUCK 1IBLK 4JI0K 4DUZK 5A2QO 4K0KK 4JI4K 4X62K 2VQEK 2UUAK 3OTOK 3T1YK 4DV5K 1IBMK 4JYAK 4LFAK 5AJ3K 3T1HK 1XNQK 4DR2K 4DV2K 4X65K 4YHHK 2UU9K 1XNRK 4JI7K 2ZM6K 5LMNK 1N36K 4DR7K 4DV0K 4DR3K 4LFCK 4DR6K 4JV5K 1N33K
chains in the Genus database with same CATH superfamily
5JLHA 3PUFA 3SPYA 4CIGA 2HVHA 3MCPA 1BQNA 4J2BA 2O8EB 3AVGA 4HUEA 3R3LA 4CGGA 3IG1A 3JAMO 1WBDA 2PBDA 2P9NA 3OYDA 4FPAA 3ZT0A 2RN2A 4JKBA 3K59A 3THXA 1J5EK 4NXNK 3HSTB 2YKMA 3BGRA 5C0YA 4DWIA 1OH5A 4E7IA 2B4JA 4NLBA 5LJWA 1WUAA 3TSQA 1SKWA 3DLKA 5AQOA 4AH9A 3V9UA 1D5AA 1I94K 2KZMA 2OTJN 1DTTA 2F7TA 1K73O 4HTLA 3OYMA 4OX9K 3HVRA 5AQSA 1NGGA 4IDHA 2QKBA 3DYAA 1KAYA 3ZSYA 4BE1A 4M3XA 3SJJA 3CCEN 3O1BA 3CFPA 1IV0A 3NF9A 2QWQA 3BF1A 4B3RK 4PL8A 4E7HA 2P9LB 4AHUA 3DXKA 4MO4A 2RF2A 4IXCA 1ZBIA 5AQFA 4AHVA 4E1NA 4DMNA 4Z4IA 4KHYA 3ZX2A 3QICA 3F5TA 3ZT3A 4BDZA 2E5LK 3S9HA 3SQ0A 1VQPN 4CZEA 4BRQA 4DTXA 1E4FT 1YIJN 4NYFA 3LP2A 4FK2A 1SL1A 2VG5A 2G8KA 3V9XA 2FC0A 4ELUA 1NMDA 3E1YA 3LDPA 1MA9B 3M5RA 3H3NO 3TSUA 5J2QA 3VGMA 1JKHA 1VQ8N 2P9KB 3VEZA 4ZTJA 4JI7K 4YDUA 4IKFA 4JEPA 1CXUA 3U6FA 3ZSQA 1VSIA 2IIRA 2ZGZA 3HYFA 3M3ZA 4EFHA 1C6VA 2B5JA 3QO9A 1U2VA 3LP0A 1UA0A 2OZMA 3CJBA 3FFKB 3SAFA 4I9QA 5JVGL 2H3GX 1QQOA 2HSTA 4B08A 1WNSA 1G15A 5JS2A 3L2QA 5I3UA 2P9PB 3NMUA 4J2AA 3LZJA 4IZ9A 3AO4A 3VTHA 4AF1A 3B6PA 4CJLA 4FL9A 5JS1A 2X6NA 3ZSWA 2A42A 1QQMA 3PIOL 3SPZA 3MXIA 1NU0A 4BWJA 4W5QA 3CCQN 2D0BA 3QIPA 4WQ5A 4ILGB 3QBWA 1WN7A 1XMOK 3AVKA 4F3OA 3HI0A 1QZ6A 5IT9O 3LM2A 4JK9A 4DQPA 4H0PA 4H8KA 3P1GA 4I2PA 2ZE2A 4E7KA 1IG8A 3Q7CA 1K8KB 5KQ8A 2NRRA 4B9TA 4JHDA 1P8ZA 2YNIA 3CPWM 4O0JA 4CCHA 1S22A 3VOVA 5M1OA 1HRHA 1RBRA 5KRSA 3VQ6A 2IVOA 5CYMA 3VEVA 4KHUA 2QK9A 3WQUA 4EZ6A 4JI3K 2W40A 3D2FA 4CJUA 4B1ZA 1Z6RA 5HRSA 4MQ3A 3IAYA 1MU2A 4O4GA 3ZSXA 4FWSA 4O55A 3ZX0A 2NRTA 1O1WA 3G25A 4CBWA 1QTMA 3VQCA 1VQ6N 4LFBK 3O3HA 5HP1A 5BN8A 4OPJA 3ZLJA 2G8WA 4K0KK 1OH6A 4B1XB 1B92A 2Q0RA 3EZWA 3GBTA 3QDKA 3I0SA 4EP4A 1KTQA 1RT6A 4DF4A 5AQMA 1W97L 4B1WB 3E9PA 4DV2K 5E84A 4Z4HA 5DM6L 4BE2A 4JRPA 1X3NA 2EWSA 1OVYA 4CI6A 3LPTA 4BR4A 2EHGA 4RW6A 4FWPA 4CESA 5GAHP 3PX0A 2YHAA 1VRUA 5JLFA 4GMJB 5I42A 1TKZA 2NUBA 3HT3A 4YOWA 4FJXA 5E41A 2GX9A 3OW2M 1J53A 3A5LC 4EZ9A 3U3YA 3EO3A 3ZSVA 2BUPA 3OVNA 1SQKA 3C6TA 2XRIA 2YCHA 3IUCA 4A2BA 1A5VA 3WEEA 1HNVA 2XY5A 1RT1A 1X3MA 3RMBA 3TWHA 1VSLA 1G99A 1NLVA 3OHRA 3NF8A 1E3MA 5EOYA 3AGRA 1RDUA 4BVOA 2G8IA 2IDOA 3CCUN 2GWJA 2F4VK 1QQNA 3WXLA 1RT2A 2NRWA 3MN6A 4Q5VA 4YOXA 4GV3A 4FK4A 3L6QA 5ADXA 4FSVA 4CK1A 1TAQA 3R9PA 5F1XA 1DGKN 5M1KA 1L3VA 1L3SA 3KLIA 4FJGA 2VWKA 3LAKA 3I33A 4K8ZA 4FW1A 4DS5A 3TTCA 1QE1A 3DAWA 3WEEB 4CHZA 5AFUH 3DMJA 3VA3A 1Q86O 4NCAA 2FSNA 4NB4A 2QM1A 2BE2A 4CE9A 1NNEA 4LD0A 3LDQA 4CIEA 1QHAA 1GLCG 1GOBA 1VSEA 4JKAA 3VF2A 4JKDA 3OYCA 3EE8A 5M1QA 1YUWA 3IRXA 4C23A 3ZEUB 3K9JA 3PX6A 2UUAK 3V4IA 2WBNA 1HKGA 2G8VA 2ZJPL 4BG8A 1Q9XA 2HW3A 4DFMA 1X9MA 4KV8A 4RW4A 1XNQK 4F8RA 4CEAA 1KFDA 4B1UB 1XNRK 4RCHA 4QS8A 2P5GA 5FROA 1YJWN 5AQKA 2DFHA 2E8AA 4DTOA 4AHSA 2E2NA 4BDYA 1XI1A 4H5NA 2BGGA 4MDAA 1CZBA 1ZXOA 5EY4A 3V9ZA 1KAXA 1MWMA 3SUNA 4FJJA 2GUPA 3CG7A 1YHQN 4FJLA 5T7BA 4ZHRA 3SNNA 4M3YA 3RWUA 3AA5X 4JLHA 1EKEA 5TKYA 3NH0A 2HHXA 5F2RA 3C7NB 2NRZA 1HQUA 2P9SA 1TV6A 1Q81O 1IG9A 2HOEA 2YKNA 4XH1A 2JGUA 1QHTA 4ISEA 4KPYA 3QEXA 4W5OA 1SUQA 4C8LA 4AM7A 1D9DA 1QSYA 1NKCA 4F2RA 3Q7BA 4BRIA 2I7NA 4CJ5A 4CZGA 2I5JA 1R0AA 3D2FB 1TKTA 3K0SA 3ENOA 1JL1A 3TR8A 4YY3K 3PO4A 4ID1A 3V1RA 3NGYA 1GLBG 4MO5A 4DSJA 1UWBA 3U9ZA 2P9IB 2WOMA 3NAEA 1TVRA 3DI6A 3B8AX 2ASOA 1QS4A 3SV4A 5KGXA 4PWDA 5M1PA 3F9KA 4NYNA 1K8AO 5HL7L 1OH8A 4CK2A 1GLDG 4LF7K 4JI0K 4BG9A 1IBLK 1KXPA 2NRXA 3AVLA 2E88A 4YDUC 4X62K 1NGCA 1NOZA 4LSNA 1D9FA 3MN9A 2HMPA 5C25A 1ASWA 3VEWA 2WFBA 4M41A 3AY9A 4RWTA 3THWB 4BRKA 1KLMA 4FLYA 4FJMA 4IDKA 3MAQA 3M8PA 3O1WA 4J2DA 5LMNK 1NGIA 3O5BA 1NMNA 4FO0A 4M3UA 5J2NA 1FXXA 4CJ4A 1TKXA 3DXKB 3FFIA 4WF9L 3HP9A 1XUPO 4CBUA 3U8XA 4DQSA 3S3MA 4FZXC 4BQLA 4B3SK 1BCMA 4CJVA 3U4LA 3RR8A 3AA2A 3HTVA 4GNIA 3ZSRA 1Q7YO 4BGBA 1T03A 1YTUA 2PFUA 3LDSA 1VSKA 1DLOA 1V4TA 2X78A 1RDCA 4IOXA 4DB3A 4HVJA 3A0IX 3AVFA 3AVIA 4FJ5A 1IBKK 1W9HA 4CIFA 4DFKA 4HCCA 5MLCQ 4WYBA 3TAMA 2FXUA 5J2MA 1TUUA 3SBGA 4QS9A 2YHYA 3S41A 4DTUA 4JD2B 3RVCA 2X74A 5AZIB 1S3XA 1NK8A 2E2OA 1LAWA 3CCJN 4A61A 5M1FA 4DR4K 4CJFA 3VESA 4H0OA 4I6MA 4LF9K 4FLWA 2UXCK 3P4IA 4DQRA 3KD5E 5C24A 3ZSOA 3ZEUA 1RTDA 4KO0A 3G4SN 1TGOA 4H5TA 4KTZA 5FPNA 4N56A 1Y64A 4FZZA 2HHTA 3QEVA 3D7EO 2DFEA 1BI4B 4K42A 1C0MA 4PHTX 4M3TA 4ILHA 4JYAK 1LAVA 2RE2A 4EHUA 3DM2A 4YFUA 4H4MA 4FVUA 1YVUA 3VPZA 3C0BA 1LWEA 2Q3SA 3NVMA 3FE1A 2HHWA 4DFPA 5KQDA 1VQKN 5DM7L 3OYFA 3T19A 1HJRA 2QEXN 5AQNA 3O8MA 1EWRA 4B9MA 1KD1O 4H0TB 1YJ9N 4CF2A 1HYZA 3K5LA 3O3FA 2FBTA 5AQPA 1LW2A 3TSPA 3RSEA 1ASVA 4E3SA 4PL7A 1SL2A 2ZD1A 5FPMA 4FJIA 4JI6K 3AV9A 2EX3A 3VTIA 3ENBA 2P1JA 1NKBA 2VG6A 4B3TK 4FJNA 1U47A 1L3TA 3QEIA 1ATRA 1ZYQA 4W5RA 3FZLA 4BC3A 3EKUA 4E1MA 4YOVA 3AO1A 4FJHA 2ZJRL 3CC2N 3DOKA 5AQJA 3DRRA 4B9NA 5BPNA 2UXBK 3L2UA 4KI6A 3LWLA 4CEZA 3VGLA 3KIOA 3TU5A 4CHYA 5AQXA 4DV7K 2VWBA 2A6AA 3CM6A 4DV4K 2QWLA 3OYLA 3OYJA 4BREA 1EETA 3DWLA 2G8UA 2F9TA 2PYLA 1D4XA 2OYQA 1IO2A 1GOAA 2OANA 2ITGA 5BRFA 3TABA 1RBSA 4DTRA 3LL3A 1V4SA 1IH7A 1RT4A 4M63C 4CJEA 3CFRA 3RRGA 4IJAA 3OYEA 2HBJA 1C0GA 5AQVA 3G6EN 3O4WA 4BRHA 1D8YA 3IFRA 2O8FA 3DXMA 2QWRA 1ZBLA 2VQEK 5GAGP 1RT7A 1TK0A 3KKRA 4A2AA 3SAGA 3TARA 2YJFA 1VQ4N 1NM1A 3CCMN 1WB9A 1S9EA 2HHVA 5KPZA 2RHKA 2G8HA 4LH4A 1JLCA 1TUYA 4XH4A 4B8AB 1YAGA 2FF3B 3M6GA 3OYAA 4DV0K 4CF1A 2OZSA 3AA3A 2AJQA 3T69A 5AQLA 1B9DA 2ZQBA 3VGKA 2YI1A 1ZC6A 2GELA 4AHCA 4CFAA 4FK0A 4CZJA 4AQYK 3MXMA 3OJSA 1NWKA 1QQCA 3VEOA 3ZT1A 4FJKA 1KQSM 5J1EA 1HNZK 4CZKA 5GINA 1FJGK 4DSIA 4M3WA 1VQ5N 4CJ3A 4FJ7A 4B1YB 4C1NK 3CHWA 2V52B 4ZTFA 1RCHA 3QBXA 3CCRN 1WOQA 2E1ZA 1N32K 4FXDA 2QW9A 3L8BA 4DQIA 3H45C 3MEGA 2O4GA 2QXLA 4J2EA 3AVMA 3FGUA 5KRTA 2QKKA 2YHWA 3OYBA 4UY8O 2HBKA 1NGEA 3LALA 3HPHA 5LJVA 4KREA 4NLCA 1VQNN 4DR5K 4CHPA 1VSHA 4FWQA 4H0XB 3MECA 3BDPA 2PY5A 2XY7A 3G10A 4LH5A 3K2PA 3VMFB 4LY7A 4B1VA 1KVAA 4XEIA 4OGEA 4O8UA 4CD1A 1EQYA 4YOYA 5C15A 4BVPA 1K8KA 3K57A 2XHBA 1RDBA 3CETA 4Z4EA 1S1WA 2GWKA 3THVA 3L0QA 3KD1E 4WCEL 1N5YA 3KLFA 4BR5A 1S1TA 1LV5A 1NGBA 1C1BA 3U9DA 3DLEA 4OJRA 1X9SA 3SBTA 3CCSN 4HUGA 4DR7K 3CERA 2YHBA 3VQBA 3VQDA 1U04A 3AVNA 1GLEG 4DTPA 1KFSA 4DR1K 1JCGA 3TAGA 1Q18A 2O4IA 5JICA 2HBMA 3CJAA 1TK5A 5FRNA 1J6ZA 4IEIA 2X6SA 5HRNA 4JS5A 1L5UA 2KW4A 3D6RA 3S3OA 5GIPA 1BIUA 4FWMA 1ESVA 1YJNN 3VN5A 1R59O 1HPMA 3CMAN 4DHYA 1T8EA 4RW7A 5F0XA 3O4NA 3O80A 1TK8A 1CZ9A 3ZETB 5FRMA 3QNOA 2ASPA 2P9IA 3WXMB 4DFJA 3ZT4A 3LAMA 3CYMA 4DU3A 4E19A 3V1OA 3ZSZA 1EXQA 2QI2A 4B8CA 4KB1A 3K5NA 3E9OA 3HOTA 4F4KA 3MX5A 4FWNA 4KTWA 4I2QA 1VK0A 1RTJA 4WFAL 2NRVA 2YX6A 3PO5A 2F8TA 4F9OA 4LSLA 3R8EA 2OTLN 4KHPK 4PY5A 4WFBL 3A5NC 1VSJA 1VQ9N 4DSLA 2OCEA 1JLBA 3NBPA 4OVLA 1NOYA 3DLRA 3E9LA 1WAJA 4FJ9A 5KTQA 2HF3A 5ADXH 3CCVN 3JYTA 3WNHA 3C65A 3SK3A 4QAGA 5EXWA 2BTFA 4RTFD 3BP8A 4CZIA 4E1JA 1U45A 4HCBA 2RPIA 1VHXA 4OO1J 4CECA 1Z05A 1YITN 2E20A 3G71N 4CFDA 3QIOA 4JKCA 2Q97A 4BQZA 3CFOA 5AFUA 2E2QA 4KI4A 3E66A 2KLAA 5KPTA 3MN7A 2WC9A 4CD3A 5KI6A 3H3OB 4DR3K 4N47A 4CJRA 4BRAA 4QS7A 2JWKA 2NZTA 4I6MB 3QINA 4BRGA 2VWJA 4EP5A 1NK0A 4MLEA 4DTNA 4U7BA 3OS0A 4C8OA 4ELVA 4L8RB 1KVBA 3AVBA 3RMDA 3DLBA 4IG3A 4B9QA 4DU4A 1Z26A 5AQRA 3RR7A 4L3QA 4FCYA 3I0RA 3R6MA 1ZBFA 3HO1A 4Q0BA 4EHTA 3OBWA 1BI4A 4LF5K 2V7YA 3OYGA 3PIPL 3D2EA 3QERA 3KLHA 1TKDA 2O8CB 4CF0A 4KAZA 3BEXA 4DV6K 1VRTA 4OKKA 3VEYA 4A5AA 1SKRA 2A5XA 4BRCA 3C6UA 1HX1A 1BDGA 1T6DA 1C0UA 1HKBA 3AVCA 4BR9A 1NK6A 3ID6A 3DLLL 4M42A 2P9LA 2KFZA 4FOEA 1BQMA 1TAUA 4GVMA 2P9NB 4H4OA 5TKWA 3UKUB 4KKOA 4CF8A 2PYJA 5B8HA 3JSMA 3VQ7A 1Q82O 3NF7A 1BCOA 2PZSA 4F3TA 3S3NA 1HJOA 3I56N 3EY1A 2FSKA 4BE0A 2HHHK 2ZF5O 3P39A 1U4BA 1NK5A 3V9SA 1NK4A 5GAEP 4FVMA 4DSEA 1T7PA 4O8KA 4CHOA 1TL1A 1U2VB 1NJXA 4KRFA 3H1VX 1NGHA 3TAPA 2FBYA 3CM5A 3UIQA 1Q8IA 3K5MA 1IJJA 1FW6A 3P5JA 3OTOK 4FOIA 4KH4A 3LPUA 3VQ9A 3HPGA 1WBBA 3SMSA 2FF6A 4E0DA 5BPLA 1ASUA 2QA4N 3ULEB 4CGJA 2ETJA 2VYPA 1VAZA 3RRHA 4WQ4A 2HNZA 3CQYA 4BR0A 2NLXA 1NJYA 1N33K 1BU6O 4BRNA 2D0CA 1YT3A 5HROA 3QFPA 3ZT2A 3IMXA 1T6CA 4OKEA 1J5OA 3J7YP 2Y1IA 3U3GA 5DMRA 2ZWHA 4X66K 4JNEA 1NGJA 4PKGA 1N8RO 3BZKA 4MDBA 1YVNA 3NGZA 3K9KA 2XO7A 4TSXA 3WUHA 4CJSA 2D0PA 4Y1DA 1YTAA 2UXDK 2IVNA 4F2SA 4WQ4C 4H5RA 2FBVA 4CEFA 1I39A 1MDUB 1BIZA 2V51B 4CHNA 5BN9A 3RMAA 2ZGYA 1HPZA 3EL2A 1GLAG 2QWPA 2Z1IA 5KGWA 5HBMA 3GL1A 4FWRA 2W6LA 2D1KA 4JHDB 1SKSA 1M1KO 3VF4A 3VQ8A 3LP3A 3BZCA 1TL3A 2HHQA 4JKGB 2FSJA 4M45A 4OPHA 2YJEA 1N34K 1RBUA 5FPEA 4FM0A 4PUOA 1BUPA 4AHTA 5CYQA 1F21A 4BWMA 1A5WA 3QESA 2ATQA 4FWKA 3ATVA 3L2RA 4JI4K 1X9JA 3AVHA 3AVJA 4DSFA 2CH6A 1SL0A 4H03B 4X65K 3A2FA 3NH2A 2UU9K 3THWA 4Z4GA 3VENA 4CFCA 1JLGA 4GY2B 4CZFA 4CGDA 4GW6A 3MCAB 1N36K 4CJQA 1KCFA 3PV8A 5BPMA 2Q0UA 3V81A 4A57A 4N41A 4FLZA 4O5FA 2O8EA 1HMVA 4K43A 3OJUA 1ITGA 2A3ZA 3CI5A 4WFNL 1VQ7N 1JXBA 2E4LA 5E26A 4C8MA 3SLCA 5I9EB 4FYDA 4K41A 3P83D 4JKHA 1OVQA 3HRGA 3L3UA 4JN4A 4YOUA 2ASMA 5AZJA 4FLTA 3ITHA 4FLUA 1B9FA 2O8DB 3LANA 3N4QA 4BR7A 3OYHA 1S6PA 4FPBA 2YNGA 1E4GT 4B9VA 2W42A 4JRQA 2VG7A 4JI5K 1BG3A 4Z4FA 4ISFA 4DV1K 1KLNA 3JS6A 5JMVA 4E7LA 3O3GA 1YXQA 3ASMA 3HXMA 3THXB 1OKJA 4OKJA 1Q9YA 5BREA 1HLUA 1WAFA 4QOZB 4LF6K 2IOCA 2VCPA 1SAZA 5CR4A 3TPQA 3WXJA 3I55N 3TAEA 3HK2A 4HWIA 5IWAK 4AILC 4B3MK 1NGAA 1YF5L 3CJ1A 3MDQA 3SMPA 1BA1A 3F2KA 1RTHA 1BISA 3ZX3A 1P90A 4CJPA 5LL6Z 3SQ2A 2OPSA 1J54A 3KWGA 1W2BM 1X9WA 3ATUA 1SZ2A 3VQ4A 4NCGA 5AQUA 4HUFA 3VERA 2W6KA 4DUZK 4DLGA 2P51A 1NK7A 1RBTA 3LZIA 4IBNA 4CJWA 1CZAN 4CBXA 3OYNA 2CH5A 4IFYA 4W5TA 4DR2K 3SYZA 1WSJA 4DTSA 1WSIA 1JXEA 3O9UA 2CGKA 2JLEA 4UQGA 4Y0WA 3H1QA 4RW8A 4M7XA 5EU7A 2BANA 4DR6K 3QLHA 1WSGA 1XC3A 1OH7A 3UB5A 3AA4A 3EEQA 1REVA 1SS6A 1W7AA 1HYSA 1UOCA 3MMVA 3H08A 4A59A 3J7AP 4IWVA 3BUZB 4CEQA 4GKJK 5AZJB 4KHSA 4A5BA 3CC4N 1LWFA 1RDWX 3ZETA 1KRPA 3OY9A 3THYA 2B6AA 3KJVA 4HTUA 3NGIA 2Z1JA 4GVEA 3PSFA 1VQLN 4DTJA 4NCBA 1WSEA 3D0PA 2DPNA 4DCHA 3I8DA 3MWPA 3SQ1A 3C7NA 1WLJA 3P31A 2WONA 4CVNE 2P9PA 3CJCA 4OGCA 3O9TA 3WNGA 2A1RA 3DRPA 3UKRB 4IO8A 1O13A 1KSPA 1T44A 4RW9A 3TAFA 1NK9A 3QFUA 4BRFA 2YNFA 4PQUA 3C95A 4IEEA 4O5BA 4G9ZA 2OPPA 3GOIA 4CJKA 4H0YB 4I9LA 3EE9A 3FZHA 1VSFA 3KZBA 3PSIA 3OYIA 2D5RA 3GG4A 4M7YA 5SWMA 3J80O 1S1UA 3HM9A 5AQTA 1DKGD 4V19S 3CXCM 1ZBUA 5JVHL 1BA0A 1T05A 4YOTA 1VQON 1NGDA 3D45A 3PLAA 3MXJA 3L4IA 5AQGA 4GV9A 2HHSA 3H46O 1EWQA 3O9RA 2O8BA 1NGFA 2YV0X 3AO3A 4R79A 2GUIA 1U48A 2BDPA 4BROA 3NF6A 3CC7N 4FLXA 3NHGA 3HPOA 5H1SQ 4DV5K 2QXFA 1LCUA 4KHWA 2WTUA 1NJZA 2QWNA 3O08A 2Q31A 1VSDA 4CJ7A 3BF3A 3NCIA 1JJ2M 3RTVA 4C8NA 2ZM6K 1JLEA 2VGNA 2JWLA 3IKMA 1GLLO 1RT5A 4O0IA 3GDQA 4ELTA 3J8AA 5LY3A 4BDPA 3MWTA 3C94A 2IAJA 3MEDA 4CZMA 3KK2A 3T7ZA 5SZTA 2RKIA 1J9AA 3KHYA 3CQXA 4DTMA 1NJIO 3BY5A 3WT0A 5AZIA 3PX4A 4DV3K 3NDKA 3K5OA 1UA1A 1EP4A 4A62A 3L3VA 3MEEA 4CEEA 1FKOA 1U6ZA 2DFFA 1XC9A 1QZ5A 2O8DA 1IKYA 2D0OA 1YI2N 4JK7A 4X64K 2KZZA 4LF8K 4FWOA 4DKWA 4CK3A 3C6HA 1VQMN 3CQ8A 5FLXO 4CEDA 3V6DA 3T1AA 1N6QA 2QWMA 4CZLA 3UKUA 1H1VA 1GOCA 1UAXA 5EX5A 2E2PA 3TANA 4CF9A 3QB0A 5AR0A 3ULEA 5HLFA 3VQAA 4KHQA 5AQHA 4JKEA 4FWLA 3KWIA 3TI0A 1BO5O 4G1QA 5J2PA 4LF4K 4N76A 4W5NA 2V7ZA 3VQEA 4KB0A 2DTUA 4IFEA 2P5OA 3KVGA 3AARA 3ALYA 2HVIA 1FK9A 3VQ5A 2KHOA 3SUOA 2GV9A 5HRRA 1NG9A 4IJNA 2AA4A 4I7FA 2R7YA 4PKIA 1XWLA 4Y1CA 4WQ5C 3W3DA 3VEXA 4CHQA 4GKKK 4BGAA 5BR9A 4BRLA 1BHLA 1HKCA 2CGLA 2E1YA 3SQ4A 2BH1A 4DG1A 1RDAA 3RSEB 2DY4A 2XY8A 1C1AA 4J8FA 4HHTA 3QMLA 3EN9A 3T1YK 4IFVA 1IBMK 4CGFA 1M90O 5AJ3K 1CXQA 3WXIA 4EIAA 1RTIA 4DQQA 4YHHK 4MLHA 4IO9L 3LDNA 4H5WA 4CGHA 1HNIA 3NE6A 5K14A 3HVTA 4H0VB 1JLQA 3ULDA 1QVFM 1ZBSA 2P9UA 3WQTA 5C2FA 3AAQA 4U67L 2NRHA 1HNWK 1Y97A 3LM9A 3OA9A 2ZJQL 5AQZA 1RFQA 1C0TA 4R5PA 3B6OA 4DF8A 4CERA 4C1NI 3MK6A 1JCEA 5BR8K 3FZMA 5LMUK 4CEOA 3VA0A 2F96A 3V1QA 5CZ1A 3KLGA 3F9MA 2P9SB 1HNXK 1HR0K 2CGJA 4GV6A 2Q2RA 2Q1NA 3OYKA 4DQ8A 4AM6A 2NNWA 2IGIA 3M8RA 3EYZA 3THYB 4XIUA 3KTQA 2FLOA 4RG8A 1JCFA 4BRDA 4IG0A 2KTQA 2O8CA 1KC8O 1S5JA 3FZKA 4IOAL 3AO5A 3HOSA 1DEJA 1EX4A 4BRMA 4M3ZA 3HJFA 4PKHA 3RMCA 1W0HA 4O44A 2D0AA 4Z4CA 3KK7A 3E01A 1RNHA 4KH6A 3L4QA 3QEWA 4BC4A 4IOCL 3IDHA 1BWFO 3LDLA 3HM8A 3KLEA 1ZBHA 3CJ9A 3ID8A 4OPKA 4OPAA 2UUBK 2FBXA 4BC2A 1RBVA 3T3FA 4YNQA 4AHRA 5HOOA 2A41A 3FZFA 4FLVA 1C0FA 4JS4A 4JAXA 3P38A 1K9MO 1U49A 4K25A 5EVZA 1HYVA 3HL8A 4ISGA 1GLJO 1JLAA 3AVAA 2I7PA 3L2VA 2G8FA 1RGIA 4K8XA 3NH1A 5C2DA 4LC9B 1S9GA 1X1PA 1Z25A 4BACA 3CD6N 3SCXA 1HUXA 4N5SA 1QVGM 3M8SA 2QTDA 5C10A 4JV5K 3I8BA 2HB5A 2HF4A 4FJ8A 3O9QA 4C8KA 2VQFK 1EO1A 1JLFA 3LWMA 1QSSA 4BRPA 4EAHD 4BC5A 2J4RA 2A40A 4ID5A 1LOTB 5GADP 3FR0A 1RILA 2HBLA 5CY4A 3AO2A 3DOLA 4OLBA 1ILYA 1JL2A 3FLCO 2IVPA 3OBYA 2KQ2A 3ZYYX 2OA8A 3GE1A 3KKSA 1K6YA 2IS3A 3KK1A 1VSMA 5CZ2A 2Z1GA 3UE5A 2GBZA 4FM2A 3ISNC 3N4PA 5DK5A 1A5XA 3IS9A 3HZ6A 2F8SA 4M3RA 2XY6A 1BOTO 3AAPA 4JKFA 3DLHA 1S1XA 4KH5A 3HP6A 3JXUA 5CE3A 3AGKA 3HSCA 3WXKA 3SZ2A 4DU1A 2GTDA 4CW7B 3CPEA 3LDOA 2YHXA 4DS4A 5KPRA 2E6MA 2HNDA 4B9LA 3PY8A 4Z0UA 1ATNA 4ICLA 4JKGA 4CGIA 1DTQA 3TAQA 3MX2A 2Y1JA 3EKSA 4B9SA 5D3GA 4KTQA 1KAZA 2HHUA 3H6EA 5A2QO 3SAHA 3SUPA 2ITMA 1QSLA 4CJTA 4LFAK 1S72N 3T1HK 2P9UB 1TYQA 3KK3A 4KHNA 3VQPA 1MWKA 3DRSA 2OPQA 5AQQA 3O6WA 4B9UA 4DLEA 4B3OA 2HNYA 4FZYA 3EZ5A 3DXMB 3CIPA 2KFNA 1XHZA 1C1CA 1IKWA 4DSKA 4LFCK 4H5VA 3A5MC 4FM1A 3DLGA 1XQSC 3O9SA 2OPRA 3OS1A 5GIOA 2F9WA 3VF6A 4OLAA 3TTFA 3D2EB 5C12A 2IC3A 2VGMA 1T3VA 1CLQA 1WSHA 4MFBA 4PA1A 1RDDA 4DUYK 1IKXA 4FW2A 1NKEA 1BGXT 1WSFA 2KKZA 3LP1A 4BY9C 2O8BB 4JI2K 4NXMK 3VETA 1L3UA 4ILJA 3UKRA 4JI1K 1I3AA 1SV5A 2YNHA 2AP1A 3M1FA 3W0LA 5HRPA 3OS2A 3NVKA 3CCLN 2D4WA 3DJCA 3G0ZA 1DT9A 4KBOA 4QCLA 2WUSA 4BR2A 1LWCA 3TTDA 3WNEA 5CHIA 4E89A 5AQIA 4JD2A 4WE1A 5AQYA 3CJ7A 1FKPA 3V9WA 5FPDA 2Q36A 3SJHA 3SUQA 3QETA 5AQWA 4CZHA 2UYTA 1XHXA 4KFBA 3SI6A 3F73A 1GLFO 5C42A 3O4QA 4JK8A 5FDLA 1S6QA 3CMEN 1XMQK 3ENHA 1RT3A 1ATSA 3A5OC 4JI8K 3J81O 3VQQA 2A1SA 1HQEA 1NBWA 2QWOA 1TYQB 2W41A 3SV3A 2PAVA 1IKVA 2UUCK 2Z1HA 2P9KA 4CEBA 4CFBA 3WNFA 3M8QA 1S1VA 3MN5A 4NO7A 3L2WA 3C6AA 3R1XA 2HMIA 1KVCA 5BRHA 2GEMA 3QEPA 4YORA 4XH5A 3A8YA 5BRDA 5ELZA 3CF5L 1LW0A 3K58A 4E7JA 2E6LA 2LSNA 3ZCMA 2O8FB 3QNNA 3NFAA 1NJWA 5M1NA 3HBTA 3J7ZO 4Z94A 1BL3A
chains in the Genus database with same CATH topology
4DR1K 1HNWK 3J7AP 4B3SK 4GKJK 2VQFK 4AQYK 4JI6K 4DV3K 3JAMO 4DUYK 1HNZK 5BR8K 3J7YP 1FJGK 5LMUK 4B3TK 4JI2K 4X66K 4NXMK 4X64K 1J5EK 4LF5K 4NXNK 4LF8K 4JI1K 5FLXO 1HR0K 1HNXK 1XMOK 1IBKK 1N32K 2UXDK 2F4VK 5IT9O 4DV6K 2UXBK 4CVNE 1I94K 4JI5K 4DV1K 4OX9K 4DV7K 4DV4K 4LF4K 4YY3K 4LF6K 4DR4K 4CW7B 4B3RK 4LF9K 2UXCK 4DR5K 5IWAK 4JI3K 4B3MK 1XMQK 3J80O 1N34K 2UUBK 2HHHK 4JI8K 3J81O 4V19S 4KHPK 4GKKK 2E5LK 5LL6Z 4LFBK 4LF7K 2UUCK 1IBLK 4JI0K 4DUZK 5A2QO 4K0KK 4JI4K 4X62K 2VQEK 2UUAK 3OTOK 3T1YK 4DV5K 1IBMK 4JYAK 4LFAK 5AJ3K 3T1HK 1XNQK 4DR2K 4DV2K 4X65K 4YHHK 2UU9K 1XNRK 4JI7K 2ZM6K 5LMNK 1N36K 4DR7K 4DV0K 4DR3K 4LFCK 4DR6K 4JV5K 1N33K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR1 K;  1HNW K;  3J7A P;  4B3S K;  4GKJ K;  2VQF K;  4AQY K;  4JI6 K;  4DV3 K;  3JAM O;  4DUY K;  1HNZ K;  5BR8 K;  3J7Y P;  1FJG K;  5LMU K;  4B3T K;  4JI2 K;  4X66 K;  4NXM K;  4X64 K;  1J5E K;  4LF5 K;  4NXN K;  4LF8 K;  4JI1 K;  5FLX O;  1HR0 K;  1HNX K;  1XMO K;  1IBK K;  1N32 K;  2UXD K;  2F4V K;  5IT9 O;  4DV6 K;  2UXB K;  4CVN E;  1I94 K;  4JI5 K;  4DV1 K;  4OX9 K;  4DV7 K;  4DV4 K;  4LF4 K;  4YY3 K;  4LF6 K;  4DR4 K;  4CW7 B;  4B3R K;  4LF9 K;  2UXC K;  4DR5 K;  5IWA K;  4JI3 K;  4B3M K;  1XMQ K;  3J80 O;  1N34 K;  2UUB K;  2HHH K;  4JI8 K;  3J81 O;  4V19 S;  4KHP K;  4GKK K;  2E5L K;  5LL6 Z;  4LFB K;  4LF7 K;  2UUC K;  1IBL K;  4JI0 K;  4DUZ K;  5A2Q O;  4K0K K;  4JI4 K;  4X62 K;  2VQE K;  2UUA K;  3OTO K;  3T1Y K;  4DV5 K;  1IBM K;  4JYA K;  4LFA K;  5AJ3 K;  3T1H K;  1XNQ K;  4DR2 K;  4DV2 K;  4X65 K;  4YHH K;  2UU9 K;  1XNR K;  4JI7 K;  2ZM6 K;  5LMN K;  1N36 K;  4DR7 K;  4DV0 K;  4DR3 K;  4LFC K;  4DR6 K;  4JV5 K;  1N33 K; 
#chains in the Genus database with same CATH topology
 5JLH A;  3PUF A;  3SPY A;  4CIG A;  2HVH A;  3MCP A;  1BQN A;  4J2B A;  2O8E B;  3AVG A;  4HUE A;  3R3L A;  4CGG A;  3IG1 A;  3JAM O;  1WBD A;  2PBD A;  2P9N A;  3OYD A;  4FPA A;  3ZT0 A;  2RN2 A;  4JKB A;  3K59 A;  3THX A;  1J5E K;  4NXN K;  3HST B;  2YKM A;  3BGR A;  5C0Y A;  4DWI A;  1OH5 A;  4E7I A;  2B4J A;  4NLB A;  5LJW A;  1WUA A;  3TSQ A;  1SKW A;  3DLK A;  5AQO A;  4AH9 A;  3V9U A;  1D5A A;  1I94 K;  2KZM A;  2OTJ N;  1DTT A;  2F7T A;  1K73 O;  4HTL A;  3OYM A;  4OX9 K;  3HVR A;  5AQS A;  1NGG A;  4IDH A;  2QKB A;  3DYA A;  1KAY A;  3ZSY A;  4BE1 A;  4M3X A;  3SJJ A;  3CCE N;  3O1B A;  3CFP A;  1IV0 A;  3NF9 A;  2QWQ A;  3BF1 A;  4B3R K;  4PL8 A;  4E7H A;  2P9L B;  4AHU A;  3DXK A;  4MO4 A;  2RF2 A;  4IXC A;  1ZBI A;  5AQF A;  4AHV A;  4E1N A;  4DMN A;  4Z4I A;  4KHY A;  3ZX2 A;  3QIC A;  3F5T A;  3ZT3 A;  4BDZ A;  2E5L K;  3S9H A;  3SQ0 A;  1VQP N;  4CZE A;  4BRQ A;  4DTX A;  1E4F T;  1YIJ N;  4NYF A;  3LP2 A;  4FK2 A;  1SL1 A;  2VG5 A;  2G8K A;  3V9X A;  2FC0 A;  4ELU A;  1NMD A;  3E1Y A;  3LDP A;  1MA9 B;  3M5R A;  3H3N O;  3TSU A;  5J2Q A;  3VGM A;  1JKH A;  1VQ8 N;  2P9K B;  3VEZ A;  4ZTJ A;  4JI7 K;  4YDU A;  4IKF A;  4JEP A;  1CXU A;  3U6F A;  3ZSQ A;  1VSI A;  2IIR A;  2ZGZ A;  3HYF A;  3M3Z A;  4EFH A;  1C6V A;  2B5J A;  3QO9 A;  1U2V A;  3LP0 A;  1UA0 A;  2OZM A;  3CJB A;  3FFK B;  3SAF A;  4I9Q A;  5JVG L;  2H3G X;  1QQO A;  2HST A;  4B08 A;  1WNS A;  1G15 A;  5JS2 A;  3L2Q A;  5I3U A;  2P9P B;  3NMU A;  4J2A A;  3LZJ A;  4IZ9 A;  3AO4 A;  3VTH A;  4AF1 A;  3B6P A;  4CJL A;  4FL9 A;  5JS1 A;  2X6N A;  3ZSW A;  2A42 A;  1QQM A;  3PIO L;  3SPZ A;  3MXI A;  1NU0 A;  4BWJ A;  4W5Q A;  3CCQ N;  2D0B A;  3QIP A;  4WQ5 A;  4ILG B;  3QBW A;  1WN7 A;  1XMO K;  3AVK A;  4F3O A;  3HI0 A;  1QZ6 A;  5IT9 O;  3LM2 A;  4JK9 A;  4DQP A;  4H0P A;  4H8K A;  3P1G A;  4I2P A;  2ZE2 A;  4E7K A;  1IG8 A;  3Q7C A;  1K8K B;  5KQ8 A;  2NRR A;  4B9T A;  4JHD A;  1P8Z A;  2YNI A;  3CPW M;  4O0J A;  4CCH A;  1S22 A;  3VOV A;  5M1O A;  1HRH A;  1RBR A;  5KRS A;  3VQ6 A;  2IVO A;  5CYM A;  3VEV A;  4KHU A;  2QK9 A;  3WQU A;  4EZ6 A;  4JI3 K;  2W40 A;  3D2F A;  4CJU A;  4B1Z A;  1Z6R A;  5HRS A;  4MQ3 A;  3IAY A;  1MU2 A;  4O4G A;  3ZSX A;  4FWS A;  4O55 A;  3ZX0 A;  2NRT A;  1O1W A;  3G25 A;  4CBW A;  1QTM A;  3VQC A;  1VQ6 N;  4LFB K;  3O3H A;  5HP1 A;  5BN8 A;  4OPJ A;  3ZLJ A;  2G8W A;  4K0K K;  1OH6 A;  4B1X B;  1B92 A;  2Q0R A;  3EZW A;  3GBT A;  3QDK A;  3I0S A;  4EP4 A;  1KTQ A;  1RT6 A;  4DF4 A;  5AQM A;  1W97 L;  4B1W B;  3E9P A;  4DV2 K;  5E84 A;  4Z4H A;  5DM6 L;  4BE2 A;  4JRP A;  1X3N A;  2EWS A;  1OVY A;  4CI6 A;  3LPT A;  4BR4 A;  2EHG A;  4RW6 A;  4FWP A;  4CES A;  5GAH P;  3PX0 A;  2YHA A;  1VRU A;  5JLF A;  4GMJ B;  5I42 A;  1TKZ A;  2NUB A;  3HT3 A;  4YOW A;  4FJX A;  5E41 A;  2GX9 A;  3OW2 M;  1J53 A;  3A5L C;  4EZ9 A;  3U3Y A;  3EO3 A;  3ZSV A;  2BUP A;  3OVN A;  1SQK A;  3C6T A;  2XRI A;  2YCH A;  3IUC A;  4A2B A;  1A5V A;  3WEE A;  1HNV A;  2XY5 A;  1RT1 A;  1X3M A;  3RMB A;  3TWH A;  1VSL A;  1G99 A;  1NLV A;  3OHR A;  3NF8 A;  1E3M A;  5EOY A;  3AGR A;  1RDU A;  4BVO A;  2G8I A;  2IDO A;  3CCU N;  2GWJ A;  2F4V K;  1QQN A;  3WXL A;  1RT2 A;  2NRW A;  3MN6 A;  4Q5V A;  4YOX A;  4GV3 A;  4FK4 A;  3L6Q A;  5ADX A;  4FSV A;  4CK1 A;  1TAQ A;  3R9P A;  5F1X A;  1DGK N;  5M1K A;  1L3V A;  1L3S A;  3KLI A;  4FJG A;  2VWK A;  3LAK A;  3I33 A;  4K8Z A;  4FW1 A;  4DS5 A;  3TTC A;  1QE1 A;  3DAW A;  3WEE B;  4CHZ A;  5AFU H;  3DMJ A;  3VA3 A;  1Q86 O;  4NCA A;  2FSN A;  4NB4 A;  2QM1 A;  2BE2 A;  4CE9 A;  1NNE A;  4LD0 A;  3LDQ A;  4CIE A;  1QHA A;  1GLC G;  1GOB A;  1VSE A;  4JKA A;  3VF2 A;  4JKD A;  3OYC A;  3EE8 A;  5M1Q A;  1YUW A;  3IRX A;  4C23 A;  3ZEU B;  3K9J A;  3PX6 A;  2UUA K;  3V4I A;  2WBN A;  1HKG A;  2G8V A;  2ZJP L;  4BG8 A;  1Q9X A;  2HW3 A;  4DFM A;  1X9M A;  4KV8 A;  4RW4 A;  1XNQ K;  4F8R A;  4CEA A;  1KFD A;  4B1U B;  1XNR K;  4RCH A;  4QS8 A;  2P5G A;  5FRO A;  1YJW N;  5AQK A;  2DFH A;  2E8A A;  4DTO A;  4AHS A;  2E2N A;  4BDY A;  1XI1 A;  4H5N A;  2BGG A;  4MDA A;  1CZB A;  1ZXO A;  5EY4 A;  3V9Z A;  1KAX A;  1MWM A;  3SUN A;  4FJJ A;  2GUP A;  3CG7 A;  1YHQ N;  4FJL A;  5T7B A;  4ZHR A;  3SNN A;  4M3Y A;  3RWU A;  3AA5 X;  4JLH A;  1EKE A;  5TKY A;  3NH0 A;  2HHX A;  5F2R A;  3C7N B;  2NRZ A;  1HQU A;  2P9S A;  1TV6 A;  1Q81 O;  1IG9 A;  2HOE A;  2YKN A;  4XH1 A;  2JGU A;  1QHT A;  4ISE A;  4KPY A;  3QEX A;  4W5O A;  1SUQ A;  4C8L A;  4AM7 A;  1D9D A;  1QSY A;  1NKC A;  4F2R A;  3Q7B A;  4BRI A;  2I7N A;  4CJ5 A;  4CZG A;  2I5J A;  1R0A A;  3D2F B;  1TKT A;  3K0S A;  3ENO A;  1JL1 A;  3TR8 A;  4YY3 K;  3PO4 A;  4ID1 A;  3V1R A;  3NGY A;  1GLB G;  4MO5 A;  4DSJ A;  1UWB A;  3U9Z A;  2P9I B;  2WOM A;  3NAE A;  1TVR A;  3DI6 A;  3B8A X;  2ASO A;  1QS4 A;  3SV4 A;  5KGX A;  4PWD A;  5M1P A;  3F9K A;  4NYN A;  1K8A O;  5HL7 L;  1OH8 A;  4CK2 A;  1GLD G;  4LF7 K;  4JI0 K;  4BG9 A;  1IBL K;  1KXP A;  2NRX A;  3AVL A;  2E88 A;  4YDU C;  4X62 K;  1NGC A;  1NOZ A;  4LSN A;  1D9F A;  3MN9 A;  2HMP A;  5C25 A;  1ASW A;  3VEW A;  2WFB A;  4M41 A;  3AY9 A;  4RWT A;  3THW B;  4BRK A;  1KLM A;  4FLY A;  4FJM A;  4IDK A;  3MAQ A;  3M8P A;  3O1W A;  4J2D A;  5LMN K;  1NGI A;  3O5B A;  1NMN A;  4FO0 A;  4M3U A;  5J2N A;  1FXX A;  4CJ4 A;  1TKX A;  3DXK B;  3FFI A;  4WF9 L;  3HP9 A;  1XUP O;  4CBU A;  3U8X A;  4DQS A;  3S3M A;  4FZX C;  4BQL A;  4B3S K;  1BCM A;  4CJV A;  3U4L A;  3RR8 A;  3AA2 A;  3HTV A;  4GNI A;  3ZSR A;  1Q7Y O;  4BGB A;  1T03 A;  1YTU A;  2PFU A;  3LDS A;  1VSK A;  1DLO A;  1V4T A;  2X78 A;  1RDC A;  4IOX A;  4DB3 A;  4HVJ A;  3A0I X;  3AVF A;  3AVI A;  4FJ5 A;  1IBK K;  1W9H A;  4CIF A;  4DFK A;  4HCC A;  5MLC Q;  4WYB A;  3TAM A;  2FXU A;  5J2M A;  1TUU A;  3SBG A;  4QS9 A;  2YHY A;  3S41 A;  4DTU A;  4JD2 B;  3RVC A;  2X74 A;  5AZI B;  1S3X A;  1NK8 A;  2E2O A;  1LAW A;  3CCJ N;  4A61 A;  5M1F A;  4DR4 K;  4CJF A;  3VES A;  4H0O A;  4I6M A;  4LF9 K;  4FLW A;  2UXC K;  3P4I A;  4DQR A;  3KD5 E;  5C24 A;  3ZSO A;  3ZEU A;  1RTD A;  4KO0 A;  3G4S N;  1TGO A;  4H5T A;  4KTZ A;  5FPN A;  4N56 A;  1Y64 A;  4FZZ A;  2HHT A;  3QEV A;  3D7E O;  2DFE A;  1BI4 B;  4K42 A;  1C0M A;  4PHT X;  4M3T A;  4ILH A;  4JYA K;  1LAV A;  2RE2 A;  4EHU A;  3DM2 A;  4YFU A;  4H4M A;  4FVU A;  1YVU A;  3VPZ A;  3C0B A;  1LWE A;  2Q3S A;  3NVM A;  3FE1 A;  2HHW A;  4DFP A;  5KQD A;  1VQK N;  5DM7 L;  3OYF A;  3T19 A;  1HJR A;  2QEX N;  5AQN A;  3O8M A;  1EWR A;  4B9M A;  1KD1 O;  4H0T B;  1YJ9 N;  4CF2 A;  1HYZ A;  3K5L A;  3O3F A;  2FBT A;  5AQP A;  1LW2 A;  3TSP A;  3RSE A;  1ASV A;  4E3S A;  4PL7 A;  1SL2 A;  2ZD1 A;  5FPM A;  4FJI A;  4JI6 K;  3AV9 A;  2EX3 A;  3VTI A;  3ENB A;  2P1J A;  1NKB A;  2VG6 A;  4B3T K;  4FJN A;  1U47 A;  1L3T A;  3QEI A;  1ATR A;  1ZYQ A;  4W5R A;  3FZL A;  4BC3 A;  3EKU A;  4E1M A;  4YOV A;  3AO1 A;  4FJH A;  2ZJR L;  3CC2 N;  3DOK A;  5AQJ A;  3DRR A;  4B9N A;  5BPN A;  2UXB K;  3L2U A;  4KI6 A;  3LWL A;  4CEZ A;  3VGL A;  3KIO A;  3TU5 A;  4CHY A;  5AQX A;  4DV7 K;  2VWB A;  2A6A A;  3CM6 A;  4DV4 K;  2QWL A;  3OYL A;  3OYJ A;  4BRE A;  1EET A;  3DWL A;  2G8U A;  2F9T A;  2PYL A;  1D4X A;  2OYQ A;  1IO2 A;  1GOA A;  2OAN A;  2ITG A;  5BRF A;  3TAB A;  1RBS A;  4DTR A;  3LL3 A;  1V4S A;  1IH7 A;  1RT4 A;  4M63 C;  4CJE A;  3CFR A;  3RRG A;  4IJA A;  3OYE A;  2HBJ A;  1C0G A;  5AQV A;  3G6E N;  3O4W A;  4BRH A;  1D8Y A;  3IFR A;  2O8F A;  3DXM A;  2QWR A;  1ZBL A;  2VQE K;  5GAG P;  1RT7 A;  1TK0 A;  3KKR A;  4A2A A;  3SAG A;  3TAR A;  2YJF A;  1VQ4 N;  1NM1 A;  3CCM N;  1WB9 A;  1S9E A;  2HHV A;  5KPZ A;  2RHK A;  2G8H A;  4LH4 A;  1JLC A;  1TUY A;  4XH4 A;  4B8A B;  1YAG A;  2FF3 B;  3M6G A;  3OYA A;  4DV0 K;  4CF1 A;  2OZS A;  3AA3 A;  2AJQ A;  3T69 A;  5AQL A;  1B9D A;  2ZQB A;  3VGK A;  2YI1 A;  1ZC6 A;  2GEL A;  4AHC A;  4CFA A;  4FK0 A;  4CZJ A;  4AQY K;  3MXM A;  3OJS A;  1NWK A;  1QQC A;  3VEO A;  3ZT1 A;  4FJK A;  1KQS M;  5J1E A;  1HNZ K;  4CZK A;  5GIN A;  1FJG K;  4DSI A;  4M3W A;  1VQ5 N;  4CJ3 A;  4FJ7 A;  4B1Y B;  4C1N K;  3CHW A;  2V52 B;  4ZTF A;  1RCH A;  3QBX A;  3CCR N;  1WOQ A;  2E1Z A;  1N32 K;  4FXD A;  2QW9 A;  3L8B A;  4DQI A;  3H45 C;  3MEG A;  2O4G A;  2QXL A;  4J2E A;  3AVM A;  3FGU A;  5KRT A;  2QKK A;  2YHW A;  3OYB A;  4UY8 O;  2HBK A;  1NGE A;  3LAL A;  3HPH A;  5LJV A;  4KRE A;  4NLC A;  1VQN N;  4DR5 K;  4CHP A;  1VSH A;  4FWQ A;  4H0X B;  3MEC A;  3BDP A;  2PY5 A;  2XY7 A;  3G10 A;  4LH5 A;  3K2P A;  3VMF B;  4LY7 A;  4B1V A;  1KVA A;  4XEI A;  4OGE A;  4O8U A;  4CD1 A;  1EQY A;  4YOY A;  5C15 A;  4BVP A;  1K8K A;  3K57 A;  2XHB A;  1RDB A;  3CET A;  4Z4E A;  1S1W A;  2GWK A;  3THV A;  3L0Q A;  3KD1 E;  4WCE L;  1N5Y A;  3KLF A;  4BR5 A;  1S1T A;  1LV5 A;  1NGB A;  1C1B A;  3U9D A;  3DLE A;  4OJR A;  1X9S A;  3SBT A;  3CCS N;  4HUG A;  4DR7 K;  3CER A;  2YHB A;  3VQB A;  3VQD A;  1U04 A;  3AVN A;  1GLE G;  4DTP A;  1KFS A;  4DR1 K;  1JCG A;  3TAG A;  1Q18 A;  2O4I A;  5JIC A;  2HBM A;  3CJA A;  1TK5 A;  5FRN A;  1J6Z A;  4IEI A;  2X6S A;  5HRN A;  4JS5 A;  1L5U A;  2KW4 A;  3D6R A;  3S3O A;  5GIP A;  1BIU A;  4FWM A;  1ESV A;  1YJN N;  3VN5 A;  1R59 O;  1HPM A;  3CMA N;  4DHY A;  1T8E A;  4RW7 A;  5F0X A;  3O4N A;  3O80 A;  1TK8 A;  1CZ9 A;  3ZET B;  5FRM A;  3QNO A;  2ASP A;  2P9I A;  3WXM B;  4DFJ A;  3ZT4 A;  3LAM A;  3CYM A;  4DU3 A;  4E19 A;  3V1O A;  3ZSZ A;  1EXQ A;  2QI2 A;  4B8C A;  4KB1 A;  3K5N A;  3E9O A;  3HOT A;  4F4K A;  3MX5 A;  4FWN A;  4KTW A;  4I2Q A;  1VK0 A;  1RTJ A;  4WFA L;  2NRV A;  2YX6 A;  3PO5 A;  2F8T A;  4F9O A;  4LSL A;  3R8E A;  2OTL N;  4KHP K;  4PY5 A;  4WFB L;  3A5N C;  1VSJ A;  1VQ9 N;  4DSL A;  2OCE A;  1JLB A;  3NBP A;  4OVL A;  1NOY A;  3DLR A;  3E9L A;  1WAJ A;  4FJ9 A;  5KTQ A;  2HF3 A;  5ADX H;  3CCV N;  3JYT A;  3WNH A;  3C65 A;  3SK3 A;  4QAG A;  5EXW A;  2BTF A;  4RTF D;  3BP8 A;  4CZI A;  4E1J A;  1U45 A;  4HCB A;  2RPI A;  1VHX A;  4OO1 J;  4CEC A;  1Z05 A;  1YIT N;  2E20 A;  3G71 N;  4CFD A;  3QIO A;  4JKC A;  2Q97 A;  4BQZ A;  3CFO A;  5AFU A;  2E2Q A;  4KI4 A;  3E66 A;  2KLA A;  5KPT A;  3MN7 A;  2WC9 A;  4CD3 A;  5KI6 A;  3H3O B;  4DR3 K;  4N47 A;  4CJR A;  4BRA A;  4QS7 A;  2JWK A;  2NZT A;  4I6M B;  3QIN A;  4BRG A;  2VWJ A;  4EP5 A;  1NK0 A;  4MLE A;  4DTN A;  4U7B A;  3OS0 A;  4C8O A;  4ELV A;  4L8R B;  1KVB A;  3AVB A;  3RMD A;  3DLB A;  4IG3 A;  4B9Q A;  4DU4 A;  1Z26 A;  5AQR A;  3RR7 A;  4L3Q A;  4FCY A;  3I0R A;  3R6M A;  1ZBF A;  3HO1 A;  4Q0B A;  4EHT A;  3OBW A;  1BI4 A;  4LF5 K;  2V7Y A;  3OYG A;  3PIP L;  3D2E A;  3QER A;  3KLH A;  1TKD A;  2O8C B;  4CF0 A;  4KAZ A;  3BEX A;  4DV6 K;  1VRT A;  4OKK A;  3VEY A;  4A5A A;  1SKR A;  2A5X A;  4BRC A;  3C6U A;  1HX1 A;  1BDG A;  1T6D A;  1C0U A;  1HKB A;  3AVC A;  4BR9 A;  1NK6 A;  3ID6 A;  3DLL L;  4M42 A;  2P9L A;  2KFZ A;  4FOE A;  1BQM A;  1TAU A;  4GVM A;  2P9N B;  4H4O A;  5TKW A;  3UKU B;  4KKO A;  4CF8 A;  2PYJ A;  5B8H A;  3JSM A;  3VQ7 A;  1Q82 O;  3NF7 A;  1BCO A;  2PZS A;  4F3T A;  3S3N A;  1HJO A;  3I56 N;  3EY1 A;  2FSK A;  4BE0 A;  2HHH K;  2ZF5 O;  3P39 A;  1U4B A;  1NK5 A;  3V9S A;  1NK4 A;  5GAE P;  4FVM A;  4DSE A;  1T7P A;  4O8K A;  4CHO A;  1TL1 A;  1U2V B;  1NJX A;  4KRF A;  3H1V X;  1NGH A;  3TAP A;  2FBY A;  3CM5 A;  3UIQ A;  1Q8I A;  3K5M A;  1IJJ A;  1FW6 A;  3P5J A;  3OTO K;  4FOI A;  4KH4 A;  3LPU A;  3VQ9 A;  3HPG A;  1WBB A;  3SMS A;  2FF6 A;  4E0D A;  5BPL A;  1ASU A;  2QA4 N;  3ULE B;  4CGJ A;  2ETJ A;  2VYP A;  1VAZ A;  3RRH A;  4WQ4 A;  2HNZ A;  3CQY A;  4BR0 A;  2NLX A;  1NJY A;  1N33 K;  1BU6 O;  4BRN A;  2D0C A;  1YT3 A;  5HRO A;  3QFP A;  3ZT2 A;  3IMX A;  1T6C A;  4OKE A;  1J5O A;  3J7Y P;  2Y1I A;  3U3G A;  5DMR A;  2ZWH A;  4X66 K;  4JNE A;  1NGJ A;  4PKG A;  1N8R O;  3BZK A;  4MDB A;  1YVN A;  3NGZ A;  3K9K A;  2XO7 A;  4TSX A;  3WUH A;  4CJS A;  2D0P A;  4Y1D A;  1YTA A;  2UXD K;  2IVN A;  4F2S A;  4WQ4 C;  4H5R A;  2FBV A;  4CEF A;  1I39 A;  1MDU B;  1BIZ A;  2V51 B;  4CHN A;  5BN9 A;  3RMA A;  2ZGY A;  1HPZ A;  3EL2 A;  1GLA G;  2QWP A;  2Z1I A;  5KGW A;  5HBM A;  3GL1 A;  4FWR A;  2W6L A;  2D1K A;  4JHD B;  1SKS A;  1M1K O;  3VF4 A;  3VQ8 A;  3LP3 A;  3BZC A;  1TL3 A;  2HHQ A;  4JKG B;  2FSJ A;  4M45 A;  4OPH A;  2YJE A;  1N34 K;  1RBU A;  5FPE A;  4FM0 A;  4PUO A;  1BUP A;  4AHT A;  5CYQ A;  1F21 A;  4BWM A;  1A5W A;  3QES A;  2ATQ A;  4FWK A;  3ATV A;  3L2R A;  4JI4 K;  1X9J A;  3AVH A;  3AVJ A;  4DSF A;  2CH6 A;  1SL0 A;  4H03 B;  4X65 K;  3A2F A;  3NH2 A;  2UU9 K;  3THW A;  4Z4G A;  3VEN A;  4CFC A;  1JLG A;  4GY2 B;  4CZF A;  4CGD A;  4GW6 A;  3MCA B;  1N36 K;  4CJQ A;  1KCF A;  3PV8 A;  5BPM A;  2Q0U A;  3V81 A;  4A57 A;  4N41 A;  4FLZ A;  4O5F A;  2O8E A;  1HMV A;  4K43 A;  3OJU A;  1ITG A;  2A3Z A;  3CI5 A;  4WFN L;  1VQ7 N;  1JXB A;  2E4L A;  5E26 A;  4C8M A;  3SLC A;  5I9E B;  4FYD A;  4K41 A;  3P83 D;  4JKH A;  1OVQ A;  3HRG A;  3L3U A;  4JN4 A;  4YOU A;  2ASM A;  5AZJ A;  4FLT A;  3ITH A;  4FLU A;  1B9F A;  2O8D B;  3LAN A;  3N4Q A;  4BR7 A;  3OYH A;  1S6P A;  4FPB A;  2YNG A;  1E4G T;  4B9V A;  2W42 A;  4JRQ A;  2VG7 A;  4JI5 K;  1BG3 A;  4Z4F A;  4ISF A;  4DV1 K;  1KLN A;  3JS6 A;  5JMV A;  4E7L A;  3O3G A;  1YXQ A;  3ASM A;  3HXM A;  3THX B;  1OKJ A;  4OKJ A;  1Q9Y A;  5BRE A;  1HLU A;  1WAF A;  4QOZ B;  4LF6 K;  2IOC A;  2VCP A;  1SAZ A;  5CR4 A;  3TPQ A;  3WXJ A;  3I55 N;  3TAE A;  3HK2 A;  4HWI A;  5IWA K;  4AIL C;  4B3M K;  1NGA A;  1YF5 L;  3CJ1 A;  3MDQ A;  3SMP A;  1BA1 A;  3F2K A;  1RTH A;  1BIS A;  3ZX3 A;  1P90 A;  4CJP A;  5LL6 Z;  3SQ2 A;  2OPS A;  1J54 A;  3KWG A;  1W2B M;  1X9W A;  3ATU A;  1SZ2 A;  3VQ4 A;  4NCG A;  5AQU A;  4HUF A;  3VER A;  2W6K A;  4DUZ K;  4DLG A;  2P51 A;  1NK7 A;  1RBT A;  3LZI A;  4IBN A;  4CJW A;  1CZA N;  4CBX A;  3OYN A;  2CH5 A;  4IFY A;  4W5T A;  4DR2 K;  3SYZ A;  1WSJ A;  4DTS A;  1WSI A;  1JXE A;  3O9U A;  2CGK A;  2JLE A;  4UQG A;  4Y0W A;  3H1Q A;  4RW8 A;  4M7X A;  5EU7 A;  2BAN A;  4DR6 K;  3QLH A;  1WSG A;  1XC3 A;  1OH7 A;  3UB5 A;  3AA4 A;  3EEQ A;  1REV A;  1SS6 A;  1W7A A;  1HYS A;  1UOC A;  3MMV A;  3H08 A;  4A59 A;  3J7A P;  4IWV A;  3BUZ B;  4CEQ A;  4GKJ K;  5AZJ B;  4KHS A;  4A5B A;  3CC4 N;  1LWF A;  1RDW X;  3ZET A;  1KRP A;  3OY9 A;  3THY A;  2B6A A;  3KJV A;  4HTU A;  3NGI A;  2Z1J A;  4GVE A;  3PSF A;  1VQL N;  4DTJ A;  4NCB A;  1WSE A;  3D0P A;  2DPN A;  4DCH A;  3I8D A;  3MWP A;  3SQ1 A;  3C7N A;  1WLJ A;  3P31 A;  2WON A;  4CVN E;  2P9P A;  3CJC A;  4OGC A;  3O9T A;  3WNG A;  2A1R A;  3DRP A;  3UKR B;  4IO8 A;  1O13 A;  1KSP A;  1T44 A;  4RW9 A;  3TAF A;  1NK9 A;  3QFU A;  4BRF A;  2YNF A;  4PQU A;  3C95 A;  4IEE A;  4O5B A;  4G9Z A;  2OPP A;  3GOI A;  4CJK A;  4H0Y B;  4I9L A;  3EE9 A;  3FZH A;  1VSF A;  3KZB A;  3PSI A;  3OYI A;  2D5R A;  3GG4 A;  4M7Y A;  5SWM A;  3J80 O;  1S1U A;  3HM9 A;  5AQT A;  1DKG D;  4V19 S;  3CXC M;  1ZBU A;  5JVH L;  1BA0 A;  1T05 A;  4YOT A;  1VQO N;  1NGD A;  3D45 A;  3PLA A;  3MXJ A;  3L4I A;  5AQG A;  4GV9 A;  2HHS A;  3H46 O;  1EWQ A;  3O9R A;  2O8B A;  1NGF A;  2YV0 X;  3AO3 A;  4R79 A;  2GUI A;  1U48 A;  2BDP A;  4BRO A;  3NF6 A;  3CC7 N;  4FLX A;  3NHG A;  3HPO A;  5H1S Q;  4DV5 K;  2QXF A;  1LCU A;  4KHW A;  2WTU A;  1NJZ A;  2QWN A;  3O08 A;  2Q31 A;  1VSD A;  4CJ7 A;  3BF3 A;  3NCI A;  1JJ2 M;  3RTV A;  4C8N A;  2ZM6 K;  1JLE A;  2VGN A;  2JWL A;  3IKM A;  1GLL O;  1RT5 A;  4O0I A;  3GDQ A;  4ELT A;  3J8A A;  5LY3 A;  4BDP A;  3MWT A;  3C94 A;  2IAJ A;  3MED A;  4CZM A;  3KK2 A;  3T7Z A;  5SZT A;  2RKI A;  1J9A A;  3KHY A;  3CQX A;  4DTM A;  1NJI O;  3BY5 A;  3WT0 A;  5AZI A;  3PX4 A;  4DV3 K;  3NDK A;  3K5O A;  1UA1 A;  1EP4 A;  4A62 A;  3L3V A;  3MEE A;  4CEE A;  1FKO A;  1U6Z A;  2DFF A;  1XC9 A;  1QZ5 A;  2O8D A;  1IKY A;  2D0O A;  1YI2 N;  4JK7 A;  4X64 K;  2KZZ A;  4LF8 K;  4FWO A;  4DKW A;  4CK3 A;  3C6H A;  1VQM N;  3CQ8 A;  5FLX O;  4CED A;  3V6D A;  3T1A A;  1N6Q A;  2QWM A;  4CZL A;  3UKU A;  1H1V A;  1GOC A;  1UAX A;  5EX5 A;  2E2P A;  3TAN A;  4CF9 A;  3QB0 A;  5AR0 A;  3ULE A;  5HLF A;  3VQA A;  4KHQ A;  5AQH A;  4JKE A;  4FWL A;  3KWI A;  3TI0 A;  1BO5 O;  4G1Q A;  5J2P A;  4LF4 K;  4N76 A;  4W5N A;  2V7Z A;  3VQE A;  4KB0 A;  2DTU A;  4IFE A;  2P5O A;  3KVG A;  3AAR A;  3ALY A;  2HVI A;  1FK9 A;  3VQ5 A;  2KHO A;  3SUO A;  2GV9 A;  5HRR A;  1NG9 A;  4IJN A;  2AA4 A;  4I7F A;  2R7Y A;  4PKI A;  1XWL A;  4Y1C A;  4WQ5 C;  3W3D A;  3VEX A;  4CHQ A;  4GKK K;  4BGA A;  5BR9 A;  4BRL A;  1BHL A;  1HKC A;  2CGL A;  2E1Y A;  3SQ4 A;  2BH1 A;  4DG1 A;  1RDA A;  3RSE B;  2DY4 A;  2XY8 A;  1C1A A;  4J8F A;  4HHT A;  3QML A;  3EN9 A;  3T1Y K;  4IFV A;  1IBM K;  4CGF A;  1M90 O;  5AJ3 K;  1CXQ A;  3WXI A;  4EIA A;  1RTI A;  4DQQ A;  4YHH K;  4MLH A;  4IO9 L;  3LDN A;  4H5W A;  4CGH A;  1HNI A;  3NE6 A;  5K14 A;  3HVT A;  4H0V B;  1JLQ A;  3ULD A;  1QVF M;  1ZBS A;  2P9U A;  3WQT A;  5C2F A;  3AAQ A;  4U67 L;  2NRH A;  1HNW K;  1Y97 A;  3LM9 A;  3OA9 A;  2ZJQ L;  5AQZ A;  1RFQ A;  1C0T A;  4R5P A;  3B6O A;  4DF8 A;  4CER A;  4C1N I;  3MK6 A;  1JCE A;  5BR8 K;  3FZM A;  5LMU K;  4CEO A;  3VA0 A;  2F96 A;  3V1Q A;  5CZ1 A;  3KLG A;  3F9M A;  2P9S B;  1HNX K;  1HR0 K;  2CGJ A;  4GV6 A;  2Q2R A;  2Q1N A;  3OYK A;  4DQ8 A;  4AM6 A;  2NNW A;  2IGI A;  3M8R A;  3EYZ A;  3THY B;  4XIU A;  3KTQ A;  2FLO A;  4RG8 A;  1JCF A;  4BRD A;  4IG0 A;  2KTQ A;  2O8C A;  1KC8 O;  1S5J A;  3FZK A;  4IOA L;  3AO5 A;  3HOS A;  1DEJ A;  1EX4 A;  4BRM A;  4M3Z A;  3HJF A;  4PKH A;  3RMC A;  1W0H A;  4O44 A;  2D0A A;  4Z4C A;  3KK7 A;  3E01 A;  1RNH A;  4KH6 A;  3L4Q A;  3QEW A;  4BC4 A;  4IOC L;  3IDH A;  1BWF O;  3LDL A;  3HM8 A;  3KLE A;  1ZBH A;  3CJ9 A;  3ID8 A;  4OPK A;  4OPA A;  2UUB K;  2FBX A;  4BC2 A;  1RBV A;  3T3F A;  4YNQ A;  4AHR A;  5HOO A;  2A41 A;  3FZF A;  4FLV A;  1C0F A;  4JS4 A;  4JAX A;  3P38 A;  1K9M O;  1U49 A;  4K25 A;  5EVZ A;  1HYV A;  3HL8 A;  4ISG A;  1GLJ O;  1JLA A;  3AVA A;  2I7P A;  3L2V A;  2G8F A;  1RGI A;  4K8X A;  3NH1 A;  5C2D A;  4LC9 B;  1S9G A;  1X1P A;  1Z25 A;  4BAC A;  3CD6 N;  3SCX A;  1HUX A;  4N5S A;  1QVG M;  3M8S A;  2QTD A;  5C10 A;  4JV5 K;  3I8B A;  2HB5 A;  2HF4 A;  4FJ8 A;  3O9Q A;  4C8K A;  2VQF K;  1EO1 A;  1JLF A;  3LWM A;  1QSS A;  4BRP A;  4EAH D;  4BC5 A;  2J4R A;  2A40 A;  4ID5 A;  1LOT B;  5GAD P;  3FR0 A;  1RIL A;  2HBL A;  5CY4 A;  3AO2 A;  3DOL A;  4OLB A;  1ILY A;  1JL2 A;  3FLC O;  2IVP A;  3OBY A;  2KQ2 A;  3ZYY X;  2OA8 A;  3GE1 A;  3KKS A;  1K6Y A;  2IS3 A;  3KK1 A;  1VSM A;  5CZ2 A;  2Z1G A;  3UE5 A;  2GBZ A;  4FM2 A;  3ISN C;  3N4P A;  5DK5 A;  1A5X A;  3IS9 A;  3HZ6 A;  2F8S A;  4M3R A;  2XY6 A;  1BOT O;  3AAP A;  4JKF A;  3DLH A;  1S1X A;  4KH5 A;  3HP6 A;  3JXU A;  5CE3 A;  3AGK A;  3HSC A;  3WXK A;  3SZ2 A;  4DU1 A;  2GTD A;  4CW7 B;  3CPE A;  3LDO A;  2YHX A;  4DS4 A;  5KPR A;  2E6M A;  2HND A;  4B9L A;  3PY8 A;  4Z0U A;  1ATN A;  4ICL A;  4JKG A;  4CGI A;  1DTQ A;  3TAQ A;  3MX2 A;  2Y1J A;  3EKS A;  4B9S A;  5D3G A;  4KTQ A;  1KAZ A;  2HHU A;  3H6E A;  5A2Q O;  3SAH A;  3SUP A;  2ITM A;  1QSL A;  4CJT A;  4LFA K;  1S72 N;  3T1H K;  2P9U B;  1TYQ A;  3KK3 A;  4KHN A;  3VQP A;  1MWK A;  3DRS A;  2OPQ A;  5AQQ A;  3O6W A;  4B9U A;  4DLE A;  4B3O A;  2HNY A;  4FZY A;  3EZ5 A;  3DXM B;  3CIP A;  2KFN A;  1XHZ A;  1C1C A;  1IKW A;  4DSK A;  4LFC K;  4H5V A;  3A5M C;  4FM1 A;  3DLG A;  1XQS C;  3O9S A;  2OPR A;  3OS1 A;  5GIO A;  2F9W A;  3VF6 A;  4OLA A;  3TTF A;  3D2E B;  5C12 A;  2IC3 A;  2VGM A;  1T3V A;  1CLQ A;  1WSH A;  4MFB A;  4PA1 A;  1RDD A;  4DUY K;  1IKX A;  4FW2 A;  1NKE A;  1BGX T;  1WSF A;  2KKZ A;  3LP1 A;  4BY9 C;  2O8B B;  4JI2 K;  4NXM K;  3VET A;  1L3U A;  4ILJ A;  3UKR A;  4JI1 K;  1I3A A;  1SV5 A;  2YNH A;  2AP1 A;  3M1F A;  3W0L A;  5HRP A;  3OS2 A;  3NVK A;  3CCL N;  2D4W A;  3DJC A;  3G0Z A;  1DT9 A;  4KBO A;  4QCL A;  2WUS A;  4BR2 A;  1LWC A;  3TTD A;  3WNE A;  5CHI A;  4E89 A;  5AQI A;  4JD2 A;  4WE1 A;  5AQY A;  3CJ7 A;  1FKP A;  3V9W A;  5FPD A;  2Q36 A;  3SJH A;  3SUQ A;  3QET A;  5AQW A;  4CZH A;  2UYT A;  1XHX A;  4KFB A;  3SI6 A;  3F73 A;  1GLF O;  5C42 A;  3O4Q A;  4JK8 A;  5FDL A;  1S6Q A;  3CME N;  1XMQ K;  3ENH A;  1RT3 A;  1ATS A;  3A5O C;  4JI8 K;  3J81 O;  3VQQ A;  2A1S A;  1HQE A;  1NBW A;  2QWO A;  1TYQ B;  2W41 A;  3SV3 A;  2PAV A;  1IKV A;  2UUC K;  2Z1H A;  2P9K A;  4CEB A;  4CFB A;  3WNF A;  3M8Q A;  1S1V A;  3MN5 A;  4NO7 A;  3L2W A;  3C6A A;  3R1X A;  2HMI A;  1KVC A;  5BRH A;  2GEM A;  3QEP A;  4YOR A;  4XH5 A;  3A8Y A;  5BRD A;  5ELZ A;  3CF5 L;  1LW0 A;  3K58 A;  4E7J A;  2E6L A;  2LSN A;  3ZCM A;  2O8F B;  3QNN A;  3NFA A;  1NJW A;  5M1N A;  3HBT A;  3J7Z O;  4Z94 A;  1BL3 A; 
#chains in the Genus database with same CATH homology
 4DR1 K;  1HNW K;  3J7A P;  4B3S K;  4GKJ K;  2VQF K;  4AQY K;  4JI6 K;  4DV3 K;  3JAM O;  4DUY K;  1HNZ K;  5BR8 K;  3J7Y P;  1FJG K;  5LMU K;  4B3T K;  4JI2 K;  4X66 K;  4NXM K;  4X64 K;  1J5E K;  4LF5 K;  4NXN K;  4LF8 K;  4JI1 K;  5FLX O;  1HR0 K;  1HNX K;  1XMO K;  1IBK K;  1N32 K;  2UXD K;  2F4V K;  5IT9 O;  4DV6 K;  2UXB K;  4CVN E;  1I94 K;  4JI5 K;  4DV1 K;  4OX9 K;  4DV7 K;  4DV4 K;  4LF4 K;  4YY3 K;  4LF6 K;  4DR4 K;  4CW7 B;  4B3R K;  4LF9 K;  2UXC K;  4DR5 K;  5IWA K;  4JI3 K;  4B3M K;  1XMQ K;  3J80 O;  1N34 K;  2UUB K;  2HHH K;  4JI8 K;  3J81 O;  4V19 S;  4KHP K;  4GKK K;  2E5L K;  5LL6 Z;  4LFB K;  4LF7 K;  2UUC K;  1IBL K;  4JI0 K;  4DUZ K;  5A2Q O;  4K0K K;  4JI4 K;  4X62 K;  2VQE K;  2UUA K;  3OTO K;  3T1Y K;  4DV5 K;  1IBM K;  4JYA K;  4LFA K;  5AJ3 K;  3T1H K;  1XNQ K;  4DR2 K;  4DV2 K;  4X65 K;  4YHH K;  2UU9 K;  1XNR K;  4JI7 K;  2ZM6 K;  5LMN K;  1N36 K;  4DR7 K;  4DV0 K;  4DR3 K;  4LFC K;  4DR6 K;  4JV5 K;  1N33 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...