4CK2A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
154
structure length
150
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 56
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ck2A00
1YTUA 4J2DA 3RMBA 3QEWA 4CJEA 4CGJA 3OYKA 4DU1A 3KTQA 2HVIA 1VSEA 4KTZA 3M8RA 3NGIA 3NE6A 1TGOA 4CJPA 1J9AA 1A5VA 1WLJA 2YKMA 1C0MA 4AHUA 4OKEA 3SV3A 4IBNA 4OKKA 3QETA 3AO3A 2OPQA 2IAJA 5CZ1A 1T03A 1JLFA 1NJYA 3V9XA 1JXEA 3L3UA 2YKNA 5CYQA 4DTOA 1VK0A 2G8UA 1K6YA 1CXUA 1XHXA 3OYMA 4HVJA 4M3YA 3KLIA 2OZSA 4PA1A 4B08A 1VRTA 4W5NA 1NKEA 1TAUA 4B9TA 3JSMA 2DFFA 4CJTA 4DMNA 3RMAA 1U47A 1S1TA 4DTXA 4PWDA 3HVTA 1I39A 3PUFA 4BDYA 2KQ2A 3NBPA 3WNFA 3H08A 4CK3A 2XHBA 2G8WA 2EHGA 3VQBA 3V9WA 4DFMA 1R0AA 2KZMA 2DFHA 4PY5A 4RW4A 3CFPA 4YNQA 3KLGA 3MXJA 2X6NA 4N56A 4QOZB 2YNFA 1YT3A 3WNHA 4B9NA 3LP1A 1LW0A 3S3NA 4CF9A 3VA3A 4DTMA 5FRNA 4RW9A 2LSNA 4ELUA 4DTPA 2HB5A 1BGXT 5HBMA 2PZSA 2B4JA 3AVAA 4FJIA 2BANA 2A1SA 4LH4A 4XIUA 1T8EA 4KHYA 4ICLA 4CK1A 1Q9XA 1C1CA 5HRRA 4DF8A 3S3OA 4M42A 1VSIA 2OPSA 2FBVA 1KCFA 3QESA 5KGXA 4B9MA 4FJJA 1IG9A 1UA1A 4BDPA 4FJ5A 5D3GA 4CJQA 4FYDA 1WSFA 4CJKA 3ZT4A 3EZ5A 3DLHA 2IGIA 3VQ7A 3HK2A 4JLHA 4DWIA 1A5WA 3RWUA 3K2PA 4LSLA 3NH2A 2P1JA 1ITGA 4FJ9A 3HL8A 3SQ2A 3AA5X 2EX3A 3CQ8A 3KK1A 2XY6A 4M3UA 3AO4A 2VG7A 4IG0A 5I3UA 1RTJA 4FCYA 2Z1JA 3V9UA 1HNVA 5KRSA 1TL1A 3AO1A 4I9LA 3AVKA 1JLGA 4OKJA 4CJVA 3ZT1A 2P5GA 1NJWA 4BE1A 1WSIA 3MEGA 3NFAA 4BWMA 3O3FA 3KD1E 1B9DA 3AVNA 1S1WA 3DOLA 3P83D 4RW7A 3TI0A 1T05A 1SKWA 1YVUA 1KSPA 2P51A 4BDZA 4KPYA 1XHZA 2KZZA 4CFAA 1RNHA 4R5PA 1WNSA 3VA0A 4QCLA 3ZSWA 1IH7A 4HUGA 4CIEA 2ATQA 4CJWA 4DQPA 1RDAA 3U3GA 1VSHA 4EZ9A 3LALA 1Q9YA 5CYMA 3V9ZA 3DOKA 3I0SA 3MEEA 4E89A 3VQCA 4O4GA 4OPKA 1G15A 3L2WA 2HMIA 4CCHA 2D5RA 2Z1IA 1UAXA 3AVFA 4KTWA 1JLEA 3HVRA 3PV8A 4DLGA 3TR8A 5HRNA 4DTSA 1ZBFA 1WAFA 3CM6A 2XY5A 3PX0A 1ZBHA 1RBUA 3LWMA 3OYDA 5KI6A 2BE2A 5I42A 4FJLA 1IKWA 2X74A 2QXFA 4H4OA 1BIUA 1JLBA 3CYMA 4AHRA 1S1VA 1L3TA 2IDOA 2RN2A 2B5JA 4DTRA 3KK2A 4K8XA 4KHUA 1KLNA 2GV9A 3OYFA 1RT2A 1NK6A 5FDLA 3RRGA 1X9SA 3AVJA 4MQ3A 3ZCMA 1Q8IA 1WAJA 4CIGA 3S3MA 1J53A 1QSSA 3B6OA 1GOCA 5C42A 4F3OA 1YTAA 2ZQBA 1U48A 5SWMA 3G10A 2OYQA 1C0TA 2D0BA 4M41A 3HP6A 4IFVA 2W42A 3HO1A 3AVIA 3OYCA 4CFDA 2E4LA 1N5YA 1SL1A 4KAZA 3KK3A 4CESA 3B6PA 4CHNA 3OYJA 3NGZA 1J5OA 1QS4A 1UWBA 1REVA 4E7JA 3SI6A 1TK0A 4N5SA 1KVAA 3O3HA 4HUEA 4KHNA 4E1MA 3G0ZA 3HM9A 1TL3A 4NYFA 3LPTA 3NF9A 1IKVA 1NJXA 1C6VA 3VQEA 4FZXC 2RPIA 4AHVA 1F21A 4DSJA 1IKXA 1RBSA 3AVBA 3AVGA 4OVLA 1ASWA 4ZHRA 2XO7A 1NOZA 1QSYA 3MAQA 1L5UA 4Y1CA 2XY8A 4DG1A 3OYAA 3FFIA 4ELTA 2YNHA 3OYNA 3TAMA 3F73A 3TANA 1NK4A 4E7IA 3TAPA 2PYLA 1HRHA 3L2RA 3NF8A 4LD0A 4FJKA 1Y97A 4FVMA 4FLUA 4DFJA 4HCCA 4OGCA 1RT5A 2GUIA 4DTUA 4DSIA 1NKCA 1TAQA 3RMDA 1NK0A 4PQUA 4CEFA 3AV9A 3QIOA 5HRPA 4CEBA 3TWHA 3T19A 4OLAA 2PY5A 4Y1DA 4K8ZA 1BQNA 1BISA 4KFBA 1FK9A 4JS4A 3HP9A 3DI6A 4HTUA 4KHQA 4CEEA 4Z4CA 1RILA 4Z4IA 3O4NA 2Y1JA 1HYSA 3D45A 3LP0A 3JYTA 4CE9A 1BCOA 1EP4A 1D5AA 2E6MA 1DTTA 1C0UA 4DQQA 2DFEA 3KD5E 2F96A 1S5JA 1W9HA 2WOMA 4KV8A 4CEZA 2O4IA 4FLWA 1BI4A 1CXQA 1LAWA 1NJZA 3VQ9A 3LPUA 4AHCA 4FJGA 3M8QA 3V1OA 2D0CA 1IKYA 4Q5VA 4W5OA 4DQIA 3EY1A 3ZSQA 2YNGA 3QIPA 3ZSVA 1RT7A 2ZE2A 1LWEA 4HUFA 4KB0A 5FRMA 2X78A 1CLQA 4E19A 2RKIA 2PYJA 4CJLA 4JRPA 1NK9A 2KFNA 1GOAA 4E1NA 1VRUA 3HXMA 3QLHA 4CJSA 1BI4B 4RW6A 4E7KA 1CZ9A 1FXXA 3M8PA 1KFSA 4FK0A 3KLEA 1U45A 4NCGA 1SUQA 2YNIA 1FKOA 3ZSRA 1WSEA 3ASMA 1KRPA 2ITGA 4CHQA 4FLXA 1QTMA 4FXDA 3LWLA 1ASUA 3BGRA 1D9DA 4O55A 4B9VA 4CJUA 4TSXA 5JS2A 3QNNA 5HP1A 2KFZA 4MFBA 1VSKA 3P5JA 1C1BA 3VQAA 3NCIA 3HPHA 3SZ2A 4LH5A 3KKSA 4DSEA 4CGGA 1BHLA 2ZD1A 3DMJA 4CGHA 4DTJA 3SUQA 2F8SA 3AO2A 4WE1A 1ZBUA 3CFRA 3U3YA 3AVHA 4H8KA 1JLAA 3RRHA 1VSLA 1TKDA 1ZBIA 4B9SA 3K5OA 1XI1A 5SZTA 1KLMA 3RR8A 3TABA 1RBRA 4CERA 4NCBA 2BDPA 3RTVA 3RMCA 3OVNA 3I0RA 4RG8A 2B6AA 2VG5A 2Z1HA 4FLTA 1RT6A 2I5JA 4Z4HA 1TK5A 3OS0A 1KTQA 2BGGA 1WSJA 3O3GA 1NK7A 5KRTA 2Y1IA 4KHWA 5CZ2A 5K14A 4CJ3A 3OYIA 4JRQA 1L3VA 3LZJA 3DYAA 3NF6A 3ZSOA 1SL0A 3VQPA 2OA8A 4J2EA 4PUOA 4CEDA 1UOCA 3CFOA 3LP2A 4H4MA 4QAGA 4DF4A 1RBVA 1KVBA 4B3OA 4O44A 1S1UA 3KLHA 4AHTA 4J2AA 4I9QA 2YHBA 3V6DA 3C6UA 3NHGA 1JL1A 5EU7A 3HT3A 4M3ZA 1EX4A 4CHOA 2DY4A 1C1AA 1A5XA 4GW6A 4CK2A 3QEVA 4B9UA 4FJNA 4DSFA 3C94A 4CEQA 3MXIA 4F8RA 3DLGA 4CEAA 4UQGA 1BQMA 3OYGA 2KTQA 3K57A 2WONA 1TKTA 3F9KA 1DLOA 1RT3A 2DTUA 1XWLA 1U04A 4FLVA 3CM5A 4OJRA 5KGWA 4CGFA 4KI4A 4Q0BA 4KO0A 3MECA 1D9FA 3PO4A 5JS1A 3DLEA 4C8KA 4DS4A 4KRFA 4F2SA 4CF2A 1S6QA 3OYBA 2VG6A 2G8VA 3BDPA 3SUPA 2D0AA 3DLKA 4CF1A 4CFBA 4BE2A 1X9WA 3ULDA 3HPOA 1WSGA 1NKBA 2R7YA 3IG1A 1NK5A 3ZT3A 4DSKA 3NDKA 3NH1A 4B9LA 1HNIA 3AVLA 4FK2A 3M8SA 4AH9A 4DFKA 4EZ6A 4CF0A 4FM2A 4CIFA 4C8NA 2JLEA 4CJRA 4E3SA 2XY7A 1RDCA 4IDKA 3CG7A 4LY7A 3ZSYA 3TAEA 2HNYA 3SPZA 2AJQA 1L3SA 4DSLA 4OPJA 3OJSA 4B8CA 1BL3A 1RCHA 1S1XA 3C95A 3KKRA 3NH0A 4HHTA 4DTNA 4E7HA 4ZTJA 4I7FA 4KHSA 1WSHA 4IKFA 3VN5A 4GVMA 3AVMA 1RTDA 3ZT0A 2RF2A 3V81A 2FBTA 3AO5A 3SQ4A 3L2VA 2G8HA 4FLZA 4E7LA 4CGIA 4AILC 1BIZA 1U4BA 4OGEA 2IC3A 4FJ8A 4FM0A 3E01A 1S9GA 3LAKA 1TV6A 4CHZA 1EXQA 1SL2A 1LWFA 4CJ5A 4BWJA 3HJFA 3IRXA 4NCAA 3TARA 5C25A 4FLYA 4BACA 4FJ7A 3QEIA 3OJUA 4DU4A 1D8YA 3VQ4A 2NUBA 1LWCA 5FROA 4FJHA 3S9HA 3ZSZA 1HPZA 4YFUA 2VWJA 4N41A 3HSTB 3NGYA 3DRPA 1HQUA 3AA4A 1KVCA 4I2PA 1JL2A 4CF8A 1LW2A 3OY9A 2OZMA 1RT4A 3OYLA 4LSNA 3EYZA 3KLFA 4O5BA 1TK8A 5T7BA 4W5QA 2KW4A 4IG3A 3PX6A 4Z4GA 4C8OA 4CHYA 1Z25A 1B92A 3C6TA 1IO2A 1L3UA 4Z4FA 3RR7A 4EP4A 1JKHA 4CGDA 5E41A 4FZYA 1VSDA 4DQSA 1TVRA 1QQCA 3V4IA 2G8IA 5DMRA 2IOCA 3LANA 2HNDA 2Q3SA 2HHTA 1WN7A 3PX4A 1RT1A 3AA3A 3WNGA 3V9SA 3PO5A 3MXMA 3O4QA 1U49A 2GBZA 2G8KA 4ELVA 1RBTA 2HHVA 4Z0UA 1B9FA 5HRSA 4M3XA 3I8DA 3UIQA 5C24A 1HJRA 5KTQA 3QNOA 2QKBA 4W5TA 3DRRA 3QO9A 3AVCA 3LP3A 1S6PA 3QINA 3LZIA 2OPRA 3VQ5A 1ZYQA 4CHPA 3ZT2A 2O4GA 4ID5A 3VQ8A 1W0HA 4CFCA 1N6QA 2JGUA 4C8LA 1JLCA 3OS2A 4Z4EA 1QHTA 3QERA 1X9MA 1VSFA 4W5RA 4J2BA 3SPYA 4O0IA 3T1AA 4ZTFA 4EP5A 3K5NA 4E0DA 4DLEA 4DS5A 3NF7A 1NOYA 4BE0A 2E6LA 3OYEA 4FZZA 1S9EA 3QEPA 4KREA 3DLRA 3U6FA 4JS5A 1RDBA 1EETA 3SNNA 3SQ1A 3HYFA 4M3TA 3PY8A 4M3WA 2XRIA 4KKOA 2FBXA 1HMVA 1TKZA 3OS1A 4FJXA 3HPGA 4C8MA 3LDSA 3A2FA 3WNEA 1LAVA 4FW1A 2HHQA 2YHAA 4KB1A 2HW3A 2OPPA 4CEOA 1RDDA 3SCXA 2QKKA 3SV4A 3OYHA 3SQ0A 3THVA 2VWKA 3AA2A 3IS9A 3K5LA 3SYZA 5J2NA 1ZBLA 2G8FA 3ITHA 1VSJA 2HHSA 4OLBA 2HNZA 5CY4A 1T7PA 5J2PA 4CECA 4DU3A 3DLBA 4FJMA 1HQEA 2Z1GA 4HCBA 3TAQA 2F8TA 2HHWA 3ALYA 3L2QA 3L3VA 4N47A 1LV5A 3KJVA 1O1WA 1EKEA 3L2UA 5J1EA 1HYZA 1NK8A 4M3RA 3K59A 2HVHA 1TKXA 1QSLA 1Z26A 3DRSA 4IFYA 3QEXA 4I2QA 4KI6A 4M45A 4CJ4A 3K58A 1SKRA 3DM2A 3TAFA 1X1PA 4ID1A 5DK5A 1MU2A 3K5MA 4GMJB 4L8RB 1JLQA 1UA0A 3TAGA 1J54A 3VQQA 3L8BA 4NYNA 5HROA 4KTQA 2P5OA 3LAMA 4G1QA 3SUNA 1XC9A 4FK4A 4DQRA 4F3TA 4CJFA 2HHUA 1I3AA 1BCMA 3NAEA 4F2RA 1RTHA 3ISNC 4FW2A 3SJJA 3T3FA 1SKSA 1JXBA 3MEDA 2IS3A 4O0JA 1DTQA 4F4KA 1HYVA 1ASVA 3SUOA 1KFDA 3VQ6A 3D0PA 2X6SA 2QK9A 1FKPA 1VSMA 3IAYA 4AHSA 5J2MA 1CZBA 4DFPA 4RW8A 2FBYA 3VQDA 2FC0A 1GOBA 3P1GA 3ZSXA 2HHXA 5HLFA 4B8AB 3V1QA 2A1RA 5J2QA 1QE1A 1SV5A 3V1RA 4FM1A 4N76A 3KIOA 2YV0X 1RTIA 2ETJA
chains in the Genus database with same CATH superfamily
3UKUA 4CJEA 2P9UA 4CGJA 3OYKA 4DU1A 1GLBG 4WQ4C 1WLJA 4C1NK 3BF3A 3QMLA 1VQ4N 4OKKA 4B3SK 1VQON 3TTFA 4JKBA 1JLFA 1JXEA 3UKUB 4LF9K 2P9UB 4W5NA 2UYTA 4FWRA 4ILGB 2DFFA 5TKYA 3VEWA 4H0VB 1U47A 3HVTA 2KQ2A 2WTUA 3WNFA 1MDUB 4DFMA 2DFHA 3CFPA 2X6NA 1LW0A 1EQYA 2A41A 4FJIA 2HB5A 1BGXT 2B4JA 2BANA 2A1SA 1C1CA 5HRRA 1E3MA 1VSIA 4CZJA 5KGXA 4FJ5A 4YOWA 4FYDA 4BY9C 3ZT4A 3EZ5A 3DLHA 3VQ7A 1DKGD 1C0GA 1OVYA 4CD3A 3HL8A 1ATSA 3OBWA 4M3UA 4IG0A 1RTJA 4WFNL 4A62A 4I9LA 4V19S 3AVKA 3GBTA 1XUPO 2P5GA 1NJWA 4BE1A 4BWMA 1KXPA 3AVNA 1T05A 3P83D 3TI0A 1SKWA 4KPYA 1KSPA 5FLXO 1NGAA 4CFAA 1RNHA 1WNSA 2V7ZA 4QCLA 2ITMA 4JI4K 2ATQA 4RTFD 3G6EN 3MEEA 4O4GA 1G15A 1UAXA 1JLEA 2RHKA 3ZX2A 3BP8A 5HRNA 4DTSA 2OANA 3ZLJA 2KHOA 3MWTA 1RBUA 1VQ6N 4IZ9A 1W2BM 5I42A 3CERA 4AHRA 1M90O 4IOCL 1L3TA 3EE8A 2RN2A 3CXCM 1Q82O 1S72N 4BC2A 1ZC6A 5AQFA 3OYFA 1CZAN 1RT2A 3RRGA 2Q97A 4MQ3A 1NG9A 5C42A 4F3OA 1YTAA 1VAZA 4KBOA 1HKGA 4JI8K 3G10A 4BRPA 2W42A 2OYQA 3HO1A 5AQXA 3A8YA 2UUBK 2E4LA 1S3XA 3B6PA 1V4SA 3AAPA 3R9PA 1UWBA 3QFUA 3SI6A 3O5BA 1KVAA 3FZMA 3O3HA 1BOTO 5BPNA 5AQPA 4NYFA 3SBGA 2E1YA 2QWOA 3IFRA 1F21A 3AVGA 4OVLA 2GWJA 1L5UA 4DG1A 3FFIA 3HI0A 4ELTA 3W3DA 3TAMA 3F73A 1NK4A 4OGCA 1RT5A 4DTUA 1MWMA 3CQYA 2VQFK 1TAQA 3OBYA 4BRMA 1N36K 3O9UA 3TWHA 1BISA 2E2PA 4KFBA 1FK9A 5FPNA 4HTUA 4Z4CA 3O8MA 4CVNE 4Z4IA 3D45A 4DR3K 2H3GX 2GTDA 2GELA 1DTTA 5AQIA 1C0UA 4DQQA 1ATRA 2F96A 4CEZA 3E66A 4GY2B 3D2FA 3H45C 1LAWA 3O1BA 3CCVN 3M6GA 1X9JA 4YOVA 3V1OA 1WOQA 4M3YA 4LFBK 5FRMA 4E19A 4HWIA 4X65K 2PYJA 1NK9A 1VRUA 3ID6A 4MDBA 3AAQA 3D2FB 3HXMA 4CJSA 3M8PA 3LDQA 4FK0A 4NCGA 1QTMA 3LWLA 1D9DA 1NGJA 1C0FA 4TSXA 3QNNA 3P31A 4MFBA 5GIPA 3CC7N 3P5JA 3VQAA 3HPHA 3KKSA 2UXCK 4EIAA 1Q7YO 1JLAA 2F7TA 1VSLA 2Q36A 4CERA 3I0RA 4O8KA 4NXNK 4DR4K 2Z1HA 1RT6A 3A5MC 4A5AA 1WSJA 4IEEA 1NK7A 5KRTA 3OYIA 1L3VA 3DYAA 3P4IA 1P90A 1SL0A 4PUOA 4CEDA 4H4MA 4DF4A 1RBVA 1S1UA 3KLHA 4AHTA 4I9QA 3A5OC 3NHGA 3VOVA 4CHOA 1A5XA 4B9UA 2P9LA 4F8RA 1VQMN 4UQGA 3RVCA 3F9KA 1RT3A 3IUCA 4JN4A 4OJRA 4Q0BA 4CGFA 4LF8K 1QQNA 3DLEA 1OH6A 4KRFA 4CZLA 3OYBA 4CF1A 4BE2A 1X9WA 1WSGA 2P9LB 3ZT3A 2GUPA 3C65A 4JI2K 4DV1K 3NH1A 3AVLA 2D0PA 2FSNA 4AH9A 4EZ6A 1HNWK 2AJQA 4LY7A 3ZSYA 4CZGA 4OPJA 3KWGA 4YOXA 4B8CA 3UIQA 4JD2A 4ZTJA 4JI6K 3C6HA 4E7HA 3FZHA 4IKFA 3ATVA 4WQ5A 4GVMA 2RF2A 1FW6A 4H0TB 4JK9A 3L2VA 3MX5A 3CJ9A 5EY4A 2W6KA 3VESA 4CZIA 1QZ5A 3CJ1A 3EL2A 4JD2B 1HPMA 3OJUA 4PL7A 4BR2A 4DU4A 1NBWA 3VQ4A 4FJHA 5AQMA 4YFUA 3DRPA 2ZM6K 3AA4A 1LW2A 3RSEA 3ZX0A 4LSNA 3KLFA 4IG3A 2IVOA 1TUYA 3EKSA 3PSFA 1Z25A 4BRNA 3TPQA 1L3UA 4CGDA 3T7ZA 4FZYA 2VCPA 1TVRA 1JCGA 5HOOA 4K25A 2HNDA 3ZEUA 2Q3SA 4NLCA 3CJBA 3T1YK 3RSEB 2G8KA 5HRSA 3QNOA 1JJ2M 4W5TA 4FPAA 3AVCA 3LP3A 1S6PA 3LZIA 2VQEK 3ZEUB 2ZF5O 3VQ8A 4BGAA 2A5XA 4CZKA 3H1QA 4J2BA 3SPYA 4JKAA 1LCUA 4EP5A 2ASOA 4E0DA 4DLEA 4DS5A 1SS6A 4C23A 3QEPA 3DLRA 4JS5A 1RDBA 4M3TA 4BRHA 3HYFA 4EAHD 3LDNA 4WQ5C 2FBXA 1TKZA 3WNEA 1ZBSA 4CEOA 4XH5A 3M5RA 1VQ8N 1U6ZA 3SCXA 3SV4A 2P9SA 1ZBLA 2G8FA 5J2NA 3AGRA 3VEYA 3MN5A 1T6CA 3DLBA 3WXIA 3TAQA 5AR0A 1NK8A 4M3RA 4IFYA 5BRDA 1KAXA 2HF3A 1SKRA 4RCHA 2P9SB 4ID1A 3K5MA 4GMJB 2HHHK 1GLFO 3VQQA 5C2DA 3L8BA 3OW2M 2P5OA 5CR4A 3SUNA 1XC9A 2O8EA 4CJFA 2NRXA 4BREA 3T3FA 4ISGA 4K0KK 3I8BA 3O6WA 3MEDA 1HYVA 4DCHA 4UY8O 4I6MA 1VSMA 2P9PA 4AHSA 1Q86O 4RW8A 4BR4A 1U2VA 4X62K 2HHXA 4PL8A 5J2QA 1SV5A 3V1RA 1RTIA 2O8EB 4IEIA 3RMBA 2HVIA 3NGIA 4JEPA 4C1NI 1TGOA 4CJPA 3NE6A 1WB9A 1A5VA 2YKMA 4I6MB 1C0MA 2P9PB 4O8UA 1U2VB 5ADXA 4LF6K 2OPQA 5CZ1A 1NJYA 2E2NA 3WQTA 3L3UA 1HNXK 2YKNA 5CYQA 1VK0A 2E8AA 1K6YA 2YJEA 3BZKA 1XHXA 5AZJA 3CHWA 4HVJA 4B08A 4H0XB 3ZETA 1KQSM 3JSMA 4CJTA 4DMNA 3RMAA 1S1TA 1VQ7N 5E26A 5A2QO 3NBPA 3H08A 3VMFB 1RGIA 2EHGA 1R0AA 2IVPA 2VWBA 4QOZB 3MXJA 2YNFA 1GLLO 5AZJB 5FRNA 5DM7L 3ZETB 2LSNA 2PZSA 3HRGA 3A0IX 1SQKA 2FSKA 4CK1A 3U8XA 2OPSA 3L4QA 2CH6A 4B9MA 4FJJA 4BDPA 3KK7A 5D3GA 5GAGP 1WSFA 3EE9A 3S41A 4CJKA 3BY5A 1K9MO 4FWNA 4DWIA 1A5WA 3RWUA 3K2PA 2P1JA 5KQ8A 4CBXA 2YHWA 4B1YB 1N34K 1EWRA 3KK1A 2XY6A 4LC9B 4B1WB 1VQNN 1HNVA 4BC4A 1TL1A 3L0QA 3AO1A 5KRSA 2NRVA 3ZT1A 4JYAK 1WSIA 3MEGA 3R8EA 1DEJA 1B9DA 5AQYA 3SJHA 4R5PA 1IH7A 4DB3A 4CIEA 4CJWA 4HUGA 4DQPA 3U3GA 3LALA 1Q9YA 3UKRA 4OPKA 4CCHA 3VQCA 1NJIO 2HMIA 3AVFA 4KTWA 3HVRA 2XY5A 3PX0A 3LL3A 3M3ZA 1N33K 4JKDA 3LWMA 4FOIA 3OYDA 5H1SQ 2X74A 2QXFA 4H4OA 1JLBA 4BRLA 3UKRB 2ZJQL 4K8XA 4KHUA 3SLCA 1FJGK 3AVJA 4CIGA 4FO0A 3BZCA 4OPAA 1GOCA 1U48A 3GOIA 5SWMA 3LM2A 1C0TA 2QWMA 2E1ZA 2FF6A 3AVIA 3FFKB 3AGKA 1N5YA 1SL1A 3VEZA 3KK3A 3HOTA 1REVA 4E7JA 1TK0A 3DXMA 4YOUA 3HM9A 1TL3A 4JI3K 4M63C 1IKVA 2FXUA 1NJXA 3VQEA 2E2OA 4FZXC 4H5TA 2RPIA 4AHVA 1IKXA 3BEXA 1ASWA 1NOZA 3QBXA 3DXMB 3FGUA 3MN9A 3H3OB 4H0YB 3TANA 2PYLA 4NXMK 1T44A 1Y97A 4FVMA 4HCCA 4DSIA 1NKCA 4WF9L 5BPMA 3QIOA 4CZEA 4CEBA 2PY5A 1BQNA 2OCEA 3O80A 4JS4A 3HP9A 3DI6A 4KHQA 1BDGA 4H0PA 4CEEA 2Y1JA 3F9MA 3JYTA 3EEQA 4CE9A 1P8ZA 1M1KO 4PKHA 2E6MA 3JAMO 3QBWA 4BRDA 2CGKA 2I7PA 3F2KA 3CQXA 4RWTA 1S5JA 1W9HA 2WOMA 4KV8A 4G9ZA 4FLWA 4FVUA 3CCRN 2IVNA 1NJZA 1NMDA 3LPUA 3T1HK 2HBKA 4KB0A 4HUFA 2E88A 2X78A 3G71N 4CJLA 4JRPA 3A5LC 4E1NA 3CD6N 2J4RA 4K43A 4GKJK 4JAXA 2QW9A 4E7KA 1CZ9A 1NGCA 3KLEA 4DV3K 4MDAA 3E9LA 1FKOA 1WSEA 5BN8A 1NGIA 4FLXA 4AM6A 3D7EO 4B9VA 2IIRA 5JICA 2A6AA 3K9JA 3VEXA 3SAHA 1VSKA 3N4PA 2FSJA 4H5RA 3KZBA 2ZD1A 4BVPA 4CGHA 4DTJA 4WFAL 4WE1A 4JHDA 3CFRA 4KH5A 1XI1A 5SZTA 4NCBA 3TABA 1RBRA 3KWIA 3WXJA 3RTVA 2ZJRL 3K9KA 2B6AA 4FLTA 2I5JA 1TK5A 3OS0A 4J8FA 4CBUA 2Y1IA 3DLLL 4JKFA 5CZ2A 5K14A 4CJ3A 2BUPA 1GLAG 4JHDB 4BVOA 2V51B 4J2EA 2ZGYA 3CJAA 1KVBA 2UUAK 4O44A 2FF3B 3UE5A 4B3MK 2DY4A 1JCFA 1NGEA 4CK2A 3J7ZO 5M1PA 3C94A 3MXIA 3OYGA 4DHYA 3J81O 3R6MA 1DLOA 2DTUA 1XWLA 3FZKA 5KGWA 2F9TA 3MECA 4KO0A 5AQSA 3MMVA 3WQUA 2FLOA 2Q2RA 3DLKA 4CFBA 3ULDA 2HSTA 3NDKA 3J8AA 1HNIA 3CPWM 4FK2A 3M8SA 4DFKA 4FM2A 3VGLA 1YF5L 4E3SA 2PAVA 4IDKA 3WEEA 3CG7A 1RCHA 3KKRA 3KVGA 3MCPA 2ASMA 3VN5A 3V81A 3O9RA 2CH5A 4AILC 4FM0A 1S9GA 2KLAA 4A2AA 2QM1A 3IRXA 3WEEB 1XQSC 3EZWA 4DKWA 2HMPA 2V52B 4BRIA 1YXQA 3S9HA 4YORA 1JL2A 3OY9A 1HJOA 1QZ6A 4O5BA 1TK8A 5T7BA 1Q81O 2KW4A 1B92A 3C6TA 2QXLA 1IO2A 4Z4FA 4EP4A 1VSDA 2VGMA 1H1VA 3V4IA 2G8IA 2O8DA 5AQZA 3FLCO 1WN7A 3AA3A 3PO5A 3O4QA 4BG9A 3EO3A 1RBTA 4JKEA 4Z0UA 4ILHA 3I8DA 5C24A 3CJCA 1I94K 4U67L 2HBMA 2O8DB 5LJVA 3CI5A 4CHPA 2O4GA 1VQ5N 4LFAK 3OS2A 1VSFA 3BUZB 4ZTFA 4A2BA 3K5NA 4H03B 1QHAA 3PIOL 1RFQA 4BE0A 1S9EA 3DAWA 1EETA 3SNNA 2V7YA 4M3WA 1SZ2A 2WBNA 4KKOA 4FJXA 2HHQA 5F0XA 3HTVA 1HX1A 2WUSA 2UU9K 3SQ0A 1T7PA 2VWKA 3AA2A 3SYZA 4MLHA 3CF5L 1N8RO 3C0BA 3ITHA 4B9QA 4OLBA 1KAZA 5CY4A 4FJMA 1HQEA 2Z1GA 2F8TA 2HHWA 3ALYA 3L2QA 1EKEA 4B1ZA 1HYZA 5BPLA 4BC3A 1TKXA 1QSLA 1Z26A 4F9OA 4I2QA 4M45A 3DM2A 2OTJN 3TAFA 1Z05A 4DV6K 1GLCG 4KTQA 4NYNA 4G1QA 4FWSA 4F3TA 3E9PA 1BCMA 4F2RA 3GG4A 3SJJA 1SKSA 1JXBA 2IS3A 4H5VA 3D0PA 3CCLN 1NGGA 2QK9A 3MN7A 1FKPA 2O8BA 1CZBA 1IV0A 1YUWA 2FBYA 4FWQA 2VYPA 3P1GA 4FWMA 4B8AB 2PBDA 4FM1A 3LP0A 2ETJA 1J5EK 4J2DA 3VGMA 4KTZA 1KAYA 4DV5K 4CI6A 4AHUA 4OKEA 3VEOA 2O8BB 4IBNA 2W41A 4FWLA 4PKGA 5AQVA 4JV5K 4JI0K 1BWFO 1T03A 1W97L 2UXBK 4DTOA 2A40A 2E5LK 3OYMA 3KLIA 5JMVA 2UXDK 1NKEA 4B9TA 4WCEL 3HM8A 3ATUA 3PLAA 2G8WA 1NGDA 3OA9A 1NMNA 3VQBA 3V9WA 4PY5A 4YNQA 4B1VA 1YI2N 1YT3A 3WNHA 4B9NA 3LP1A 3G25A 3S3NA 4CF9A 4DTMA 4RW9A 3QB0A 5M1FA 4ELUA 1YJNN 4DTPA 5HBMA 4XIUA 4LH4A 1T8EA 3CC2N 3ENOA 4ICLA 1Q9XA 4DF8A 4M42A 1KCFA 2JWKA 3QESA 1IG9A 3C6AA 2IGIA 3HK2A 4JLHA 5I9EB 3CCJN 3NH2A 3MK6A 1ITGA 4FJ9A 2EX3A 4FWOA 3CQ8A 2YI1A 4BR7A 4E1JA 3AO4A 3L6QA 5I3UA 4FCYA 4M7XA 2Z1JA 3VTHA 2NRZA 2CGLA 1JLGA 4OKJA 3Q7CA 5F1XA 3DOLA 1S1WA 5AFUH 1VQ9N 3ZSWA 4BRGA 4EZ9A 3V9ZA 3DOKA 4E89A 3THWA 2D5RA 2Z1IA 3PV8A 2HF4A 4X64K 1ZBFA 1WAFA 3CM6A 4CZHA 4FPBA 3VERA 3C7NA 3CETA 5KI6A 2BE2A 4FJLA 1IBLK 1BIUA 2EWSA 3THWB 4NO7A 2YX6A 2GV9A 1XC3A 5FDLA 5EOYA 4DV4K 1X9SA 1WUAA 3VF6A 1Q8IA 1WAJA 3ZCMA 3C7NB 3CCQN 4OO1J 1QSSA 3CCMN 2ZQBA 4K42A 4M41A 3HP6A 4IFVA 4YY3K 3TSUA 1LOTB 4GV3A 1V4TA 4KAZA 4PHTX 4CESA 3E9OA 4CHNA 3OYJA 1QS4A 4CBWA 1YVNA 4BR9A 4HUEA 4KHNA 3H1VX 1YAGA 3G0ZA 4E1MA 1IBKK 3NF9A 4AF1A 5LY3A 3H6EA 4DSJA 1RBSA 3IDHA 2Q0UA 3AVBA 3I33A 1OH8A 3CJ7A 4ZHRA 2XO7A 3O08A 4Y0WA 2XY8A 3OYAA 4LF4K 3OYNA 3NVKA 4QS7A 4FJKA 4E7IA 1NGHA 2WFBA 3TAPA 2D4WA 1IBMK 1HUXA 1NK0A 4PQUA 3AV9A 5HRPA 3J7YP 3CCUN 4Z94A 4K8ZA 4BR5A 1BCOA 1EP4A 3O1WA 3WXKA 2GX9A 1WBDA 3KD5E 1XNRK 3Q7BA 2O4IA 3LDPA 3VQ9A 2P9IB 4AHCA 1T3VA 3M8QA 1RDWX 3UB5A 1NGBA 4DQIA 3ZSQA 3QIPA 5AQLA 1RT7A 2ZE2A 1LWEA 1CLQA 1GLEG 2O8CA 3QICA 2KFNA 4IJNA 1GOAA 2QWRA 4EHUA 2ZJPL 5M1OA 3U4LA 3QLHA 3HOSA 5JVHL 4RW6A 2HBJA 1KFSA 1SUQA 2YNIA 1BO5O 3ASMA 4GV9A 4FXDA 1ASUA 3E1YA 4WYBA 1TUUA 4CZFA 2O8CB 3BF1A 5AJ3K 1C1BA 2AA4A 3VPZA 3NCIA 3SZ2A 4LH5A 4DSEA 4BRFA 1BHLA 3AO2A 1ZBUA 3NMUA 1TKDA 4FSVA 4H8KA 3RRHA 1NLVA 4A57A 3R3LA 5M1QA 3RMCA 2NRRA 5B8HA 3OVNA 3J80O 3THYA 1DGKN 1JCEA 2VG5A 2QA4N 3M1FA 4JNEA 1KTQA 2BGGA 3HSCA 3TTCA 1GLJO 4JRQA 3LZJA 4DQ8A 4YDUA 3VQPA 2E20A 5JLHA 1UOCA 3CFOA 3LP2A 3VGKA 4B3OA 3CC4N 2YHBA 1JL1A 5EU7A 3HT3A 1EX4A 3THYB 4GW6A 4PKIA 1X3NA 4FJNA 5AQKA 2ZGZA 1BQMA 1O13A 3AY9A 4FLVA 4ILJA 1NM1A 1D9FA 2QEXN 3K0SA 2Q1NA 4CF2A 1S6QA 2DPNA 2VG6A 4XH4A 4CD1A 2G8VA 3BDPA 3A5NC 2D0AA 3CMEN 2R7YA 3IG1A 5IWAK 1NK5A 4BROA 4B9LA 4IO9L 4CIFA 4C8NA 4CJRA 2XY7A 1RDCA 4H0OA 1L3SA 1BL3A 4HHTA 3C95A 3NH0A 1HLUA 3O9QA 5EXWA 1WSHA 3MCAB 3AVMA 2QWPA 2FBTA 4FLZA 4CGIA 1NNEA 4JKGA 4OGEA 4CHZA 5AQOA 3DWLA 1TV6A 1EXQA 1SL2A 4CJ5A 3SAFA 4BWJA 3J7AP 3HJFA 1Y64A 5C25A 4FJ7A 3P39A 2BH1A 4BACA 4YOYA 4A59A 1ESVA 1D8YA 2P9NA 1HPZA 3QFPA 2VWJA 4N41A 2YCHA 1HQUA 3U9ZA 4IDHA 4JKGB 1RT4A 3OYLA 2OZMA 4YDUC 3PX6A 4LFCK 4IFEA 3LANA 2P9NB 2HHTA 3V9SA 3H46O 2HOEA 5BRHA 3MXMA 1U49A 1BG3A 2GBZA 1KD1O 4ELVA 2HHVA 3JXUA 4YOTA 1B9FA 4M3XA 5E84A 5F2RA 5KTQA 1HJRA 2QKBA 1XMQK 2GWKA 4IOXA 4WFBL 1OKJA 3EN9A 3OHRA 3QINA 3CCSN 3IMXA 3VQ5A 2NRTA 3ZT2A 4ID5A 4AM7A 1W0HA 1VQKN 1N6QA 4CJ7A 4Z4EA 4BG8A 1X9MA 5TKWA 1YJ9N 3PSIA 3B8AX 5C15A 4O0IA 1K8AO 1NOYA 3OYEA 3GE1A 4FZZA 1K8KA 4B3RK 4NLBA 1T6DA 3U6FA 1YHQN 2XRIA 1NGFA 1HMVA 5JLFA 4C8MA 3LDSA 3A2FA 1LAVA 4FW1A 4FWPA 2YHAA 3OYHA 3THVA 3K5LA 4KH6A 1VSJA 2QWNA 2HHSA 1K8KB 2HNZA 5J2PA 4CECA 3EKUA 3L3VA 5GADP 1O1WA 2NRHA 3L2UA 5J1EA 3K59A 2HVHA 3QEXA 4KI6A 1G99A 5AQGA 1X1PA 1Z6RA 4JKHA 5BREA 5C12A 4DQRA 2HHUA 1I3AA 3ULEA 3NAEA 1NWKA 4IWVA 1RTHA 3ISNC 4FW2A 4MLEA 3LDLA 3LM9A 3SUOA 1KFDA 4JK7A 4DR6K 3VQ6A 2X6SA 3D6RA 3IAYA 5BR9A 3VQDA 1GOBA 2A1RA 1QE1A 4N76A 1ZXOA 1K73O 2YV0X 5AQUA 3ULEB 1YTUA 4XH1A 5AQHA 3QEWA 5CHIA 3KTQA 4LF5K 1VSEA 3M8RA 4DR7K 2RE2A 4QS8A 1J9AA 1QVGM 3SV3A 3N4QA 2W40A 3QETA 1QQOA 4OX9K 3AO3A 4DR2K 1IG8A 2IAJA 4BC5A 3MDQA 3V9XA 1J6ZA 2G8UA 1CXUA 3CIPA 3FZFA 2OZSA 4PA1A 1VRTA 4M7YA 3VTIA 1TAUA 3W0LA 4DTXA 4PWDA 2JWLA 1I39A 3PUFA 3TSPA 4BDYA 4CK3A 2NRWA 2XHBA 5FPDA 1DT9A 2Q31A 2KZMA 3THXA 4RW4A 3KLGA 4N56A 3MWPA 3R1XA 2VGNA 3VA3A 5AQRA 4BR0A 3AVAA 2CGJA 3IKMA 4KHYA 1YIJN 5MLCQ 3S3OA 2FBVA 1MWKA 1UA1A 4CJQA 4GVEA 3THXB 3KHYA 4CW7B 4AQYK 3GDQA 3WXLA 4LSLA 5C10A 3SQ2A 3AA5X 5AQTA 1W7AA 5C2FA 2NNWA 2VG7A 3V9UA 4CJVA 3MN6A 3KD1E 3NFAA 3O3FA 4RW7A 1YVUA 2P51A 4BDZA 1XHZA 2KZZA 1N32K 3VA0A 3SMPA 4O5FA 1RDAA 1VSHA 5LMNK 5CYMA 3I0SA 4BRAA 3L2WA 4X66K 2GEMA 4DLGA 3GL1A 5ADXH 3TR8A 2ASPA 3G4SN 2Q0RA 1ZBHA 3WUHA 4IJAA 4DUYK 3WT0A 2NZTA 3H3NO 5AQJA 1IKWA 2O8FA 3VEVA 5M1NA 3CYMA 3DXKA 1S1VA 2IDOA 2B5JA 4DTRA 3KK2A 4IOAL 1KLNA 1NU0A 4A61A 4R79A 1NK6A 4BQLA 4DV2K 3S3MA 3O9TA 3U9DA 1J53A 2QWLA 3B6OA 3HBTA 1XNQK 4BRQA 3HZ6A 4XEIA 2O8FB 2D0BA 2OTLN 4EFHA 1BU6O 1HKCA 2D1KA 3DXKB 3OYCA 4CFDA 4A5BA 3NGZA 1J5OA 4KH4A 1KC8O 4JK8A 1ILYA 3CCEN 4N5SA 3LPTA 4OPHA 1C6VA 2F9WA 1OVQA 3ENBA 1QSYA 1ATNA 3MAQA 4Y1CA 2YJFA 5LL6Z 1OH5A 2YNHA 5GIOA 3F5TA 1RDUA 2UUCK 1HRHA 1SAZA 3FE1A 3NF8A 4LD0A 3L2RA 1YITN 4DFJA 4FLUA 2GUIA 4JI7K 1BUPA 3RMDA 4CEFA 3PIPL 1OH7A 3T19A 4OLAA 4Y1DA 1TYQA 1RILA 3O4NA 1HYSA 4MO5A 1QVFM 1D5AA 5EVZA 3L4IA 2DFEA 4GKKK 5BN9A 5AQQA 1QQMA 5HL7L 1BI4A 5IT9O 1CXQA 4IXCA 5AQNA 5KQDA 5LJWA 4FJGA 2D0CA 5FPMA 1IKYA 1TYQB 4Q5VA 4W5OA 3EY1A 1BA1A 2YNGA 3ZSVA 2P9KA 2RKIA 3T69A 3FZLA 1X3MA 2A42A 5KPZA 5EX5A 1BI4B 1FXXA 1VHXA 5BRFA 3VF2A 1U45A 3ZSRA 4B3TK 3WXMB 4JI1K 1KRPA 2ITGA 4CHQA 3BGRA 4O55A 2P9KB 4CJUA 5JS2A 5HP1A 3TTDA 2KFZA 3ZX3A 4DV7K 4CGGA 1R59O 3SUQA 3DMJA 2F8SA 3U3YA 3AVHA 4BGBA 1ZBIA 4B9SA 3K5OA 5ELZA 3RR8A 1KLMA 4DV0K 4EHTA 2BDPA 3CPEA 4RG8A 1E4FT 4Z4HA 5GINA 3O3GA 1S22A 4ISFA 4KHWA 3NF6A 3ZSOA 2OA8A 5AZIA 4QAGA 4J2AA 3V6DA 3C6UA 4M3ZA 2W6LA 1C1AA 3QEVA 4JKCA 4DSFA 4CEQA 3P38A 3DLGA 4CEAA 3K57A 3DJCA 4BRCA 2WONA 1TKTA 1EWQA 3VETA 5GAHP 1U04A 4KI4A 3CM5A 2KTQA 5JS1A 3PO4A 2E2QA 5AZIB 4K41A 4C8KA 2A3ZA 4QS9A 3OTOK 4DS4A 4F2SA 4CZMA 4B1XB 3LDOA 3SUPA 4IO8A 3JS6A 3AARA 3HPOA 3ZYYX 1NKBA 4DSKA 4HTLA 4NB4A 5CE3A 2QI2A 4ISEA 4CF0A 5AQWA 2JLEA 5C0YA 5M1KA 3MX2A 2NLXA 3TAEA 3SPZA 2HNYA 4DSLA 3OJSA 1S1XA 4B1UB 5DM6L 4DTNA 3SK3A 3O9SA 4FL9A 4I7FA 4YHHK 4KHSA 1RTDA 3CMAN 3ZT0A 3AO5A 3SQ4A 2G8HA 4E7LA 1U4BA 1BIZA 2IC3A 4FJ8A 3E01A 3LAKA 1HR0K 1LWFA 1HKBA 2P9IA 4NCAA 3ENHA 4MO4A 3TARA 4BRKA 4FLYA 3QEIA 3VF4A 4H5NA 2NUBA 1LWCA 5FROA 3ZSZA 3HSTB 3NGYA 3QDKA 2KKZA 1KVCA 4I2PA 4CF8A 3O4WA 3I55N 1EO1A 3EYZA 3TSQA 4W5QA 3ID8A 4Z4GA 5KPTA 4C8OA 4CHYA 2F4VK 3SAGA 3RR7A 1JKHA 5E41A 1XMOK 4DQSA 1QQCA 5DMRA 5BR8K 2IOCA 1Q18A 3PX4A 4LF7K 1RT1A 3WNGA 4U7BA 1BA0A 1E4GT 1WBBA 3D2EA 4DR5K 3DRRA 3QO9A 1GLDG 4GV6A 2YHYA 2OPRA 1ZYQA 4CFCA 2AP1A 2JGUA 4C8LA 1JLCA 4WQ4A 1QHTA 3QERA 4W5RA 3SMSA 3T1AA 3VENA 3NF7A 3D2EB 2E6LA 4KREA 2D0OA 3SQ1A 3PY8A 3TU5A 3OS1A 1VQPN 3HPGA 2PFUA 1MA9B 4BQZA 4KB1A 2HW3A 2OPPA 5KPRA 1HNZK 1RDDA 1IJJA 2QKKA 3FR0A 3IS9A 2QWQA 1D4XA 2BTFA 4DU3A 4HCBA 4N47A 1LV5A 3KJVA 5GAEP 4FWKA 3SBTA 4JI5K 3DRSA 4CJ4A 3K58A 4GNIA 5DK5A 1MU2A 4L8RB 1JLQA 4DUZK 1UA0A 3TAGA 1J54A 5HROA 3LAMA 1YJWN 4FK4A 4FOEA 5FPEA 2ZWHA 2WC9A 4KHPK 5JVGL 4O0JA 4L3QA 1DTQA 4F4KA 2YHXA 1ASVA 2QTDA 3I56N 2HBLA 5LMUK 2I7NA 5J2MA 4DFPA 2FC0A 3ZSXA 3NVMA 5HLFA 3V1QA 4H5WA 1VQLN 3KIOA 4DR1K 5AFUA
chains in the Genus database with same CATH topology
1YTUA 4J2DA 3RMBA 3QEWA 4CJEA 4CGJA 3OYKA 4DU1A 3KTQA 2HVIA 1VSEA 4KTZA 3M8RA 3NGIA 3NE6A 1TGOA 4CJPA 1J9AA 1A5VA 1WLJA 2YKMA 1C0MA 4AHUA 4OKEA 3SV3A 4IBNA 4OKKA 3QETA 3AO3A 2OPQA 2IAJA 5CZ1A 1T03A 1JLFA 1NJYA 3V9XA 1JXEA 3L3UA 2YKNA 5CYQA 4DTOA 1VK0A 2G8UA 1K6YA 1CXUA 1XHXA 3OYMA 4HVJA 4M3YA 3KLIA 2OZSA 4PA1A 4B08A 1VRTA 4W5NA 1NKEA 1TAUA 4B9TA 3JSMA 2DFFA 4CJTA 4DMNA 3RMAA 1U47A 1S1TA 4DTXA 4PWDA 3HVTA 1I39A 3PUFA 4BDYA 2KQ2A 3NBPA 3WNFA 3H08A 4CK3A 2XHBA 2G8WA 2EHGA 3VQBA 3V9WA 4DFMA 1R0AA 2KZMA 2DFHA 4PY5A 4RW4A 3CFPA 4YNQA 3KLGA 3MXJA 2X6NA 4N56A 4QOZB 2YNFA 1YT3A 3WNHA 4B9NA 3LP1A 1LW0A 3S3NA 4CF9A 3VA3A 4DTMA 5FRNA 4RW9A 2LSNA 4ELUA 4DTPA 2HB5A 1BGXT 5HBMA 2PZSA 2B4JA 3AVAA 4FJIA 2BANA 2A1SA 4LH4A 4XIUA 1T8EA 4KHYA 4ICLA 4CK1A 1Q9XA 1C1CA 5HRRA 4DF8A 3S3OA 4M42A 1VSIA 2OPSA 2FBVA 1KCFA 3QESA 5KGXA 4B9MA 4FJJA 1IG9A 1UA1A 4BDPA 4FJ5A 5D3GA 4CJQA 4FYDA 1WSFA 4CJKA 3ZT4A 3EZ5A 3DLHA 2IGIA 3VQ7A 3HK2A 4JLHA 4DWIA 1A5WA 3RWUA 3K2PA 4LSLA 3NH2A 2P1JA 1ITGA 4FJ9A 3HL8A 3SQ2A 3AA5X 2EX3A 3CQ8A 3KK1A 2XY6A 4M3UA 3AO4A 2VG7A 4IG0A 5I3UA 1RTJA 4FCYA 2Z1JA 3V9UA 1HNVA 5KRSA 1TL1A 3AO1A 4I9LA 3AVKA 1JLGA 4OKJA 4CJVA 3ZT1A 2P5GA 1NJWA 4BE1A 1WSIA 3MEGA 3NFAA 4BWMA 3O3FA 3KD1E 1B9DA 3AVNA 1S1WA 3DOLA 3P83D 4RW7A 3TI0A 1T05A 1SKWA 1YVUA 1KSPA 2P51A 4BDZA 4KPYA 1XHZA 2KZZA 4CFAA 1RNHA 4R5PA 1WNSA 3VA0A 4QCLA 3ZSWA 1IH7A 4HUGA 4CIEA 2ATQA 4CJWA 4DQPA 1RDAA 3U3GA 1VSHA 4EZ9A 3LALA 1Q9YA 5CYMA 3V9ZA 3DOKA 3I0SA 3MEEA 4E89A 3VQCA 4O4GA 4OPKA 1G15A 3L2WA 2HMIA 4CCHA 2D5RA 2Z1IA 1UAXA 3AVFA 4KTWA 1JLEA 3HVRA 3PV8A 4DLGA 3TR8A 5HRNA 4DTSA 1ZBFA 1WAFA 3CM6A 2XY5A 3PX0A 1ZBHA 1RBUA 3LWMA 3OYDA 5KI6A 2BE2A 5I42A 4FJLA 1IKWA 2X74A 2QXFA 4H4OA 1BIUA 1JLBA 3CYMA 4AHRA 1S1VA 1L3TA 2IDOA 2RN2A 2B5JA 4DTRA 3KK2A 4K8XA 4KHUA 1KLNA 2GV9A 3OYFA 1RT2A 1NK6A 5FDLA 3RRGA 1X9SA 3AVJA 4MQ3A 3ZCMA 1Q8IA 1WAJA 4CIGA 3S3MA 1J53A 1QSSA 3B6OA 1GOCA 5C42A 4F3OA 1YTAA 2ZQBA 1U48A 5SWMA 3G10A 2OYQA 1C0TA 2D0BA 4M41A 3HP6A 4IFVA 2W42A 3HO1A 3AVIA 3OYCA 4CFDA 2E4LA 1N5YA 1SL1A 4KAZA 3KK3A 4CESA 3B6PA 4CHNA 3OYJA 3NGZA 1J5OA 1QS4A 1UWBA 1REVA 4E7JA 3SI6A 1TK0A 4N5SA 1KVAA 3O3HA 4HUEA 4KHNA 4E1MA 3G0ZA 3HM9A 1TL3A 4NYFA 3LPTA 3NF9A 1IKVA 1NJXA 1C6VA 3VQEA 4FZXC 2RPIA 4AHVA 1F21A 4DSJA 1IKXA 1RBSA 3AVBA 3AVGA 4OVLA 1ASWA 4ZHRA 2XO7A 1NOZA 1QSYA 3MAQA 1L5UA 4Y1CA 2XY8A 4DG1A 3OYAA 3FFIA 4ELTA 2YNHA 3OYNA 3TAMA 3F73A 3TANA 1NK4A 4E7IA 3TAPA 2PYLA 1HRHA 3L2RA 3NF8A 4LD0A 4FJKA 1Y97A 4FVMA 4FLUA 4DFJA 4HCCA 4OGCA 1RT5A 2GUIA 4DTUA 4DSIA 1NKCA 1TAQA 3RMDA 1NK0A 4PQUA 4CEFA 3AV9A 3QIOA 5HRPA 4CEBA 3TWHA 3T19A 4OLAA 2PY5A 4Y1DA 4K8ZA 1BQNA 1BISA 4KFBA 1FK9A 4JS4A 3HP9A 3DI6A 4HTUA 4KHQA 4CEEA 4Z4CA 1RILA 4Z4IA 3O4NA 2Y1JA 1HYSA 3D45A 3LP0A 3JYTA 4CE9A 1BCOA 1EP4A 1D5AA 2E6MA 1DTTA 1C0UA 4DQQA 2DFEA 3KD5E 2F96A 1S5JA 1W9HA 2WOMA 4KV8A 4CEZA 2O4IA 4FLWA 1BI4A 1CXQA 1LAWA 1NJZA 3VQ9A 3LPUA 4AHCA 4FJGA 3M8QA 3V1OA 2D0CA 1IKYA 4Q5VA 4W5OA 4DQIA 3EY1A 3ZSQA 2YNGA 3QIPA 3ZSVA 1RT7A 2ZE2A 1LWEA 4HUFA 4KB0A 5FRMA 2X78A 1CLQA 4E19A 2RKIA 2PYJA 4CJLA 4JRPA 1NK9A 2KFNA 1GOAA 4E1NA 1VRUA 3HXMA 3QLHA 4CJSA 1BI4B 4RW6A 4E7KA 1CZ9A 1FXXA 3M8PA 1KFSA 4FK0A 3KLEA 1U45A 4NCGA 1SUQA 2YNIA 1FKOA 3ZSRA 1WSEA 3ASMA 1KRPA 2ITGA 4CHQA 4FLXA 1QTMA 4FXDA 3LWLA 1ASUA 3BGRA 1D9DA 4O55A 4B9VA 4CJUA 4TSXA 5JS2A 3QNNA 5HP1A 2KFZA 4MFBA 1VSKA 3P5JA 1C1BA 3VQAA 3NCIA 3HPHA 3SZ2A 4LH5A 3KKSA 4DSEA 4CGGA 1BHLA 2ZD1A 3DMJA 4CGHA 4DTJA 3SUQA 2F8SA 3AO2A 4WE1A 1ZBUA 3CFRA 3U3YA 3AVHA 4H8KA 1JLAA 3RRHA 1VSLA 1TKDA 1ZBIA 4B9SA 3K5OA 1XI1A 5SZTA 1KLMA 3RR8A 3TABA 1RBRA 4CERA 4NCBA 2BDPA 3RTVA 3RMCA 3OVNA 3I0RA 4RG8A 2B6AA 2VG5A 2Z1HA 4FLTA 1RT6A 2I5JA 4Z4HA 1TK5A 3OS0A 1KTQA 2BGGA 1WSJA 3O3GA 1NK7A 5KRTA 2Y1IA 4KHWA 5CZ2A 5K14A 4CJ3A 3OYIA 4JRQA 1L3VA 3LZJA 3DYAA 3NF6A 3ZSOA 1SL0A 3VQPA 2OA8A 4J2EA 4PUOA 4CEDA 1UOCA 3CFOA 3LP2A 4H4MA 4QAGA 4DF4A 1RBVA 1KVBA 4B3OA 4O44A 1S1UA 3KLHA 4AHTA 4J2AA 4I9QA 2YHBA 3V6DA 3C6UA 3NHGA 1JL1A 5EU7A 3HT3A 4M3ZA 1EX4A 4CHOA 2DY4A 1C1AA 1A5XA 4GW6A 4CK2A 3QEVA 4B9UA 4FJNA 4DSFA 3C94A 4CEQA 3MXIA 4F8RA 3DLGA 4CEAA 4UQGA 1BQMA 3OYGA 2KTQA 3K57A 2WONA 1TKTA 3F9KA 1DLOA 1RT3A 2DTUA 1XWLA 1U04A 4FLVA 3CM5A 4OJRA 5KGWA 4CGFA 4KI4A 4Q0BA 4KO0A 3MECA 1D9FA 3PO4A 5JS1A 3DLEA 4C8KA 4DS4A 4KRFA 4F2SA 4CF2A 1S6QA 3OYBA 2VG6A 2G8VA 3BDPA 3SUPA 2D0AA 3DLKA 4CF1A 4CFBA 4BE2A 1X9WA 3ULDA 3HPOA 1WSGA 1NKBA 2R7YA 3IG1A 1NK5A 3ZT3A 4DSKA 3NDKA 3NH1A 4B9LA 1HNIA 3AVLA 4FK2A 3M8SA 4AH9A 4DFKA 4EZ6A 4CF0A 4FM2A 4CIFA 4C8NA 2JLEA 4CJRA 4E3SA 2XY7A 1RDCA 4IDKA 3CG7A 4LY7A 3ZSYA 3TAEA 2HNYA 3SPZA 2AJQA 1L3SA 4DSLA 4OPJA 3OJSA 4B8CA 1BL3A 1RCHA 1S1XA 3C95A 3KKRA 3NH0A 4HHTA 4DTNA 4E7HA 4ZTJA 4I7FA 4KHSA 1WSHA 4IKFA 3VN5A 4GVMA 3AVMA 1RTDA 3ZT0A 2RF2A 3V81A 2FBTA 3AO5A 3SQ4A 3L2VA 2G8HA 4FLZA 4E7LA 4CGIA 4AILC 1BIZA 1U4BA 4OGEA 2IC3A 4FJ8A 4FM0A 3E01A 1S9GA 3LAKA 1TV6A 4CHZA 1EXQA 1SL2A 1LWFA 4CJ5A 4BWJA 3HJFA 3IRXA 4NCAA 3TARA 5C25A 4FLYA 4BACA 4FJ7A 3QEIA 3OJUA 4DU4A 1D8YA 3VQ4A 2NUBA 1LWCA 5FROA 4FJHA 3S9HA 3ZSZA 1HPZA 4YFUA 2VWJA 4N41A 3HSTB 3NGYA 3DRPA 1HQUA 3AA4A 1KVCA 4I2PA 1JL2A 4CF8A 1LW2A 3OY9A 2OZMA 1RT4A 3OYLA 4LSNA 3EYZA 3KLFA 4O5BA 1TK8A 5T7BA 4W5QA 2KW4A 4IG3A 3PX6A 4Z4GA 4C8OA 4CHYA 1Z25A 1B92A 3C6TA 1IO2A 1L3UA 4Z4FA 3RR7A 4EP4A 1JKHA 4CGDA 5E41A 4FZYA 1VSDA 4DQSA 1TVRA 1QQCA 3V4IA 2G8IA 5DMRA 2IOCA 3LANA 2HNDA 2Q3SA 2HHTA 1WN7A 3PX4A 1RT1A 3AA3A 3WNGA 3V9SA 3PO5A 3MXMA 3O4QA 1U49A 2GBZA 2G8KA 4ELVA 1RBTA 2HHVA 4Z0UA 1B9FA 5HRSA 4M3XA 3I8DA 3UIQA 5C24A 1HJRA 5KTQA 3QNOA 2QKBA 4W5TA 3DRRA 3QO9A 3AVCA 3LP3A 1S6PA 3QINA 3LZIA 2OPRA 3VQ5A 1ZYQA 4CHPA 3ZT2A 2O4GA 4ID5A 3VQ8A 1W0HA 4CFCA 1N6QA 2JGUA 4C8LA 1JLCA 3OS2A 4Z4EA 1QHTA 3QERA 1X9MA 1VSFA 4W5RA 4J2BA 3SPYA 4O0IA 3T1AA 4ZTFA 4EP5A 3K5NA 4E0DA 4DLEA 4DS5A 3NF7A 1NOYA 4BE0A 2E6LA 3OYEA 4FZZA 1S9EA 3QEPA 4KREA 3DLRA 3U6FA 4JS5A 1RDBA 1EETA 3SNNA 3SQ1A 3HYFA 4M3TA 3PY8A 4M3WA 2XRIA 4KKOA 2FBXA 1HMVA 1TKZA 3OS1A 4FJXA 3HPGA 4C8MA 3LDSA 3A2FA 3WNEA 1LAVA 4FW1A 2HHQA 2YHAA 4KB1A 2HW3A 2OPPA 4CEOA 1RDDA 3SCXA 2QKKA 3SV4A 3OYHA 3SQ0A 3THVA 2VWKA 3AA2A 3IS9A 3K5LA 3SYZA 5J2NA 1ZBLA 2G8FA 3ITHA 1VSJA 2HHSA 4OLBA 2HNZA 5CY4A 1T7PA 5J2PA 4CECA 4DU3A 3DLBA 4FJMA 1HQEA 2Z1GA 4HCBA 3TAQA 2F8TA 2HHWA 3ALYA 3L2QA 3L3VA 4N47A 1LV5A 3KJVA 1O1WA 1EKEA 3L2UA 5J1EA 1HYZA 1NK8A 4M3RA 3K59A 2HVHA 1TKXA 1QSLA 1Z26A 3DRSA 4IFYA 3QEXA 4I2QA 4KI6A 4M45A 4CJ4A 3K58A 1SKRA 3DM2A 3TAFA 1X1PA 4ID1A 5DK5A 1MU2A 3K5MA 4GMJB 4L8RB 1JLQA 1UA0A 3TAGA 1J54A 3VQQA 3L8BA 4NYNA 5HROA 4KTQA 2P5OA 3LAMA 4G1QA 3SUNA 1XC9A 4FK4A 4DQRA 4F3TA 4CJFA 2HHUA 1I3AA 1BCMA 3NAEA 4F2RA 1RTHA 3ISNC 4FW2A 3SJJA 3T3FA 1SKSA 1JXBA 3MEDA 2IS3A 4O0JA 1DTQA 4F4KA 1HYVA 1ASVA 3SUOA 1KFDA 3VQ6A 3D0PA 2X6SA 2QK9A 1FKPA 1VSMA 3IAYA 4AHSA 5J2MA 1CZBA 4DFPA 4RW8A 2FBYA 3VQDA 2FC0A 1GOBA 3P1GA 3ZSXA 2HHXA 5HLFA 4B8AB 3V1QA 2A1RA 5J2QA 1QE1A 1SV5A 3V1RA 4FM1A 4N76A 3KIOA 2YV0X 1RTIA 2ETJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YTU A;  4J2D A;  3RMB A;  3QEW A;  4CJE A;  4CGJ A;  3OYK A;  4DU1 A;  3KTQ A;  2HVI A;  1VSE A;  4KTZ A;  3M8R A;  3NGI A;  3NE6 A;  1TGO A;  4CJP A;  1J9A A;  1A5V A;  1WLJ A;  2YKM A;  1C0M A;  4AHU A;  4OKE A;  3SV3 A;  4IBN A;  4OKK A;  3QET A;  3AO3 A;  2OPQ A;  2IAJ A;  5CZ1 A;  1T03 A;  1JLF A;  1NJY A;  3V9X A;  1JXE A;  3L3U A;  2YKN A;  5CYQ A;  4DTO A;  1VK0 A;  2G8U A;  1K6Y A;  1CXU A;  1XHX A;  3OYM A;  4HVJ A;  4M3Y A;  3KLI A;  2OZS A;  4PA1 A;  4B08 A;  1VRT A;  4W5N A;  1NKE A;  1TAU A;  4B9T A;  3JSM A;  2DFF A;  4CJT A;  4DMN A;  3RMA A;  1U47 A;  1S1T A;  4DTX A;  4PWD A;  3HVT A;  1I39 A;  3PUF A;  4BDY A;  2KQ2 A;  3NBP A;  3WNF A;  3H08 A;  4CK3 A;  2XHB A;  2G8W A;  2EHG A;  3VQB A;  3V9W A;  4DFM A;  1R0A A;  2KZM A;  2DFH A;  4PY5 A;  4RW4 A;  3CFP A;  4YNQ A;  3KLG A;  3MXJ A;  2X6N A;  4N56 A;  4QOZ B;  2YNF A;  1YT3 A;  3WNH A;  4B9N A;  3LP1 A;  1LW0 A;  3S3N A;  4CF9 A;  3VA3 A;  4DTM A;  5FRN A;  4RW9 A;  2LSN A;  4ELU A;  4DTP A;  2HB5 A;  1BGX T;  5HBM A;  2PZS A;  2B4J A;  3AVA A;  4FJI A;  2BAN A;  2A1S A;  4LH4 A;  4XIU A;  1T8E A;  4KHY A;  4ICL A;  4CK1 A;  1Q9X A;  1C1C A;  5HRR A;  4DF8 A;  3S3O A;  4M42 A;  1VSI A;  2OPS A;  2FBV A;  1KCF A;  3QES A;  5KGX A;  4B9M A;  4FJJ A;  1IG9 A;  1UA1 A;  4BDP A;  4FJ5 A;  5D3G A;  4CJQ A;  4FYD A;  1WSF A;  4CJK A;  3ZT4 A;  3EZ5 A;  3DLH A;  2IGI A;  3VQ7 A;  3HK2 A;  4JLH A;  4DWI A;  1A5W A;  3RWU A;  3K2P A;  4LSL A;  3NH2 A;  2P1J A;  1ITG A;  4FJ9 A;  3HL8 A;  3SQ2 A;  3AA5 X;  2EX3 A;  3CQ8 A;  3KK1 A;  2XY6 A;  4M3U A;  3AO4 A;  2VG7 A;  4IG0 A;  5I3U A;  1RTJ A;  4FCY A;  2Z1J A;  3V9U A;  1HNV A;  5KRS A;  1TL1 A;  3AO1 A;  4I9L A;  3AVK A;  1JLG A;  4OKJ A;  4CJV A;  3ZT1 A;  2P5G A;  1NJW A;  4BE1 A;  1WSI A;  3MEG A;  3NFA A;  4BWM A;  3O3F A;  3KD1 E;  1B9D A;  3AVN A;  1S1W A;  3DOL A;  3P83 D;  4RW7 A;  3TI0 A;  1T05 A;  1SKW A;  1YVU A;  1KSP A;  2P51 A;  4BDZ A;  4KPY A;  1XHZ A;  2KZZ A;  4CFA A;  1RNH A;  4R5P A;  1WNS A;  3VA0 A;  4QCL A;  3ZSW A;  1IH7 A;  4HUG A;  4CIE A;  2ATQ A;  4CJW A;  4DQP A;  1RDA A;  3U3G A;  1VSH A;  4EZ9 A;  3LAL A;  1Q9Y A;  5CYM A;  3V9Z A;  3DOK A;  3I0S A;  3MEE A;  4E89 A;  3VQC A;  4O4G A;  4OPK A;  1G15 A;  3L2W A;  2HMI A;  4CCH A;  2D5R A;  2Z1I A;  1UAX A;  3AVF A;  4KTW A;  1JLE A;  3HVR A;  3PV8 A;  4DLG A;  3TR8 A;  5HRN A;  4DTS A;  1ZBF A;  1WAF A;  3CM6 A;  2XY5 A;  3PX0 A;  1ZBH A;  1RBU A;  3LWM A;  3OYD A;  5KI6 A;  2BE2 A;  5I42 A;  4FJL A;  1IKW A;  2X74 A;  2QXF A;  4H4O A;  1BIU A;  1JLB A;  3CYM A;  4AHR A;  1S1V A;  1L3T A;  2IDO A;  2RN2 A;  2B5J A;  4DTR A;  3KK2 A;  4K8X A;  4KHU A;  1KLN A;  2GV9 A;  3OYF A;  1RT2 A;  1NK6 A;  5FDL A;  3RRG A;  1X9S A;  3AVJ A;  4MQ3 A;  3ZCM A;  1Q8I A;  1WAJ A;  4CIG A;  3S3M A;  1J53 A;  1QSS A;  3B6O A;  1GOC A;  5C42 A;  4F3O A;  1YTA A;  2ZQB A;  1U48 A;  5SWM A;  3G10 A;  2OYQ A;  1C0T A;  2D0B A;  4M41 A;  3HP6 A;  4IFV A;  2W42 A;  3HO1 A;  3AVI A;  3OYC A;  4CFD A;  2E4L A;  1N5Y A;  1SL1 A;  4KAZ A;  3KK3 A;  4CES A;  3B6P A;  4CHN A;  3OYJ A;  3NGZ A;  1J5O A;  1QS4 A;  1UWB A;  1REV A;  4E7J A;  3SI6 A;  1TK0 A;  4N5S A;  1KVA A;  3O3H A;  4HUE A;  4KHN A;  4E1M A;  3G0Z A;  3HM9 A;  1TL3 A;  4NYF A;  3LPT A;  3NF9 A;  1IKV A;  1NJX A;  1C6V A;  3VQE A;  4FZX C;  2RPI A;  4AHV A;  1F21 A;  4DSJ A;  1IKX A;  1RBS A;  3AVB A;  3AVG A;  4OVL A;  1ASW A;  4ZHR A;  2XO7 A;  1NOZ A;  1QSY A;  3MAQ A;  1L5U A;  4Y1C A;  2XY8 A;  4DG1 A;  3OYA A;  3FFI A;  4ELT A;  2YNH A;  3OYN A;  3TAM A;  3F73 A;  3TAN A;  1NK4 A;  4E7I A;  3TAP A;  2PYL A;  1HRH A;  3L2R A;  3NF8 A;  4LD0 A;  4FJK A;  1Y97 A;  4FVM A;  4FLU A;  4DFJ A;  4HCC A;  4OGC A;  1RT5 A;  2GUI A;  4DTU A;  4DSI A;  1NKC A;  1TAQ A;  3RMD A;  1NK0 A;  4PQU A;  4CEF A;  3AV9 A;  3QIO A;  5HRP A;  4CEB A;  3TWH A;  3T19 A;  4OLA A;  2PY5 A;  4Y1D A;  4K8Z A;  1BQN A;  1BIS A;  4KFB A;  1FK9 A;  4JS4 A;  3HP9 A;  3DI6 A;  4HTU A;  4KHQ A;  4CEE A;  4Z4C A;  1RIL A;  4Z4I A;  3O4N A;  2Y1J A;  1HYS A;  3D45 A;  3LP0 A;  3JYT A;  4CE9 A;  1BCO A;  1EP4 A;  1D5A A;  2E6M A;  1DTT A;  1C0U A;  4DQQ A;  2DFE A;  3KD5 E;  2F96 A;  1S5J A;  1W9H A;  2WOM A;  4KV8 A;  4CEZ A;  2O4I A;  4FLW A;  1BI4 A;  1CXQ A;  1LAW A;  1NJZ A;  3VQ9 A;  3LPU A;  4AHC A;  4FJG A;  3M8Q A;  3V1O A;  2D0C A;  1IKY A;  4Q5V A;  4W5O A;  4DQI A;  3EY1 A;  3ZSQ A;  2YNG A;  3QIP A;  3ZSV A;  1RT7 A;  2ZE2 A;  1LWE A;  4HUF A;  4KB0 A;  5FRM A;  2X78 A;  1CLQ A;  4E19 A;  2RKI A;  2PYJ A;  4CJL A;  4JRP A;  1NK9 A;  2KFN A;  1GOA A;  4E1N A;  1VRU A;  3HXM A;  3QLH A;  4CJS A;  1BI4 B;  4RW6 A;  4E7K A;  1CZ9 A;  1FXX A;  3M8P A;  1KFS A;  4FK0 A;  3KLE A;  1U45 A;  4NCG A;  1SUQ A;  2YNI A;  1FKO A;  3ZSR A;  1WSE A;  3ASM A;  1KRP A;  2ITG A;  4CHQ A;  4FLX A;  1QTM A;  4FXD A;  3LWL A;  1ASU A;  3BGR A;  1D9D A;  4O55 A;  4B9V A;  4CJU A;  4TSX A;  5JS2 A;  3QNN A;  5HP1 A;  2KFZ A;  4MFB A;  1VSK A;  3P5J A;  1C1B A;  3VQA A;  3NCI A;  3HPH A;  3SZ2 A;  4LH5 A;  3KKS A;  4DSE A;  4CGG A;  1BHL A;  2ZD1 A;  3DMJ A;  4CGH A;  4DTJ A;  3SUQ A;  2F8S A;  3AO2 A;  4WE1 A;  1ZBU A;  3CFR A;  3U3Y A;  3AVH A;  4H8K A;  1JLA A;  3RRH A;  1VSL A;  1TKD A;  1ZBI A;  4B9S A;  3K5O A;  1XI1 A;  5SZT A;  1KLM A;  3RR8 A;  3TAB A;  1RBR A;  4CER A;  4NCB A;  2BDP A;  3RTV A;  3RMC A;  3OVN A;  3I0R A;  4RG8 A;  2B6A A;  2VG5 A;  2Z1H A;  4FLT A;  1RT6 A;  2I5J A;  4Z4H A;  1TK5 A;  3OS0 A;  1KTQ A;  2BGG A;  1WSJ A;  3O3G A;  1NK7 A;  5KRT A;  2Y1I A;  4KHW A;  5CZ2 A;  5K14 A;  4CJ3 A;  3OYI A;  4JRQ A;  1L3V A;  3LZJ A;  3DYA A;  3NF6 A;  3ZSO A;  1SL0 A;  3VQP A;  2OA8 A;  4J2E A;  4PUO A;  4CED A;  1UOC A;  3CFO A;  3LP2 A;  4H4M A;  4QAG A;  4DF4 A;  1RBV A;  1KVB A;  4B3O A;  4O44 A;  1S1U A;  3KLH A;  4AHT A;  4J2A A;  4I9Q A;  2YHB A;  3V6D A;  3C6U A;  3NHG A;  1JL1 A;  5EU7 A;  3HT3 A;  4M3Z A;  1EX4 A;  4CHO A;  2DY4 A;  1C1A A;  1A5X A;  4GW6 A;  4CK2 A;  3QEV A;  4B9U A;  4FJN A;  4DSF A;  3C94 A;  4CEQ A;  3MXI A;  4F8R A;  3DLG A;  4CEA A;  4UQG A;  1BQM A;  3OYG A;  2KTQ A;  3K57 A;  2WON A;  1TKT A;  3F9K A;  1DLO A;  1RT3 A;  2DTU A;  1XWL A;  1U04 A;  4FLV A;  3CM5 A;  4OJR A;  5KGW A;  4CGF A;  4KI4 A;  4Q0B A;  4KO0 A;  3MEC A;  1D9F A;  3PO4 A;  5JS1 A;  3DLE A;  4C8K A;  4DS4 A;  4KRF A;  4F2S A;  4CF2 A;  1S6Q A;  3OYB A;  2VG6 A;  2G8V A;  3BDP A;  3SUP A;  2D0A A;  3DLK A;  4CF1 A;  4CFB A;  4BE2 A;  1X9W A;  3ULD A;  3HPO A;  1WSG A;  1NKB A;  2R7Y A;  3IG1 A;  1NK5 A;  3ZT3 A;  4DSK A;  3NDK A;  3NH1 A;  4B9L A;  1HNI A;  3AVL A;  4FK2 A;  3M8S A;  4AH9 A;  4DFK A;  4EZ6 A;  4CF0 A;  4FM2 A;  4CIF A;  4C8N A;  2JLE A;  4CJR A;  4E3S A;  2XY7 A;  1RDC A;  4IDK A;  3CG7 A;  4LY7 A;  3ZSY A;  3TAE A;  2HNY A;  3SPZ A;  2AJQ A;  1L3S A;  4DSL A;  4OPJ A;  3OJS A;  4B8C A;  1BL3 A;  1RCH A;  1S1X A;  3C95 A;  3KKR A;  3NH0 A;  4HHT A;  4DTN A;  4E7H A;  4ZTJ A;  4I7F A;  4KHS A;  1WSH A;  4IKF A;  3VN5 A;  4GVM A;  3AVM A;  1RTD A;  3ZT0 A;  2RF2 A;  3V81 A;  2FBT A;  3AO5 A;  3SQ4 A;  3L2V A;  2G8H A;  4FLZ A;  4E7L A;  4CGI A;  4AIL C;  1BIZ A;  1U4B A;  4OGE A;  2IC3 A;  4FJ8 A;  4FM0 A;  3E01 A;  1S9G A;  3LAK A;  1TV6 A;  4CHZ A;  1EXQ A;  1SL2 A;  1LWF A;  4CJ5 A;  4BWJ A;  3HJF A;  3IRX A;  4NCA A;  3TAR A;  5C25 A;  4FLY A;  4BAC A;  4FJ7 A;  3QEI A;  3OJU A;  4DU4 A;  1D8Y A;  3VQ4 A;  2NUB A;  1LWC A;  5FRO A;  4FJH A;  3S9H A;  3ZSZ A;  1HPZ A;  4YFU A;  2VWJ A;  4N41 A;  3HST B;  3NGY A;  3DRP A;  1HQU A;  3AA4 A;  1KVC A;  4I2P A;  1JL2 A;  4CF8 A;  1LW2 A;  3OY9 A;  2OZM A;  1RT4 A;  3OYL A;  4LSN A;  3EYZ A;  3KLF A;  4O5B A;  1TK8 A;  5T7B A;  4W5Q A;  2KW4 A;  4IG3 A;  3PX6 A;  4Z4G A;  4C8O A;  4CHY A;  1Z25 A;  1B92 A;  3C6T A;  1IO2 A;  1L3U A;  4Z4F A;  3RR7 A;  4EP4 A;  1JKH A;  4CGD A;  5E41 A;  4FZY A;  1VSD A;  4DQS A;  1TVR A;  1QQC A;  3V4I A;  2G8I A;  5DMR A;  2IOC A;  3LAN A;  2HND A;  2Q3S A;  2HHT A;  1WN7 A;  3PX4 A;  1RT1 A;  3AA3 A;  3WNG A;  3V9S A;  3PO5 A;  3MXM A;  3O4Q A;  1U49 A;  2GBZ A;  2G8K A;  4ELV A;  1RBT A;  2HHV A;  4Z0U A;  1B9F A;  5HRS A;  4M3X A;  3I8D A;  3UIQ A;  5C24 A;  1HJR A;  5KTQ A;  3QNO A;  2QKB A;  4W5T A;  3DRR A;  3QO9 A;  3AVC A;  3LP3 A;  1S6P A;  3QIN A;  3LZI A;  2OPR A;  3VQ5 A;  1ZYQ A;  4CHP A;  3ZT2 A;  2O4G A;  4ID5 A;  3VQ8 A;  1W0H A;  4CFC A;  1N6Q A;  2JGU A;  4C8L A;  1JLC A;  3OS2 A;  4Z4E A;  1QHT A;  3QER A;  1X9M A;  1VSF A;  4W5R A;  4J2B A;  3SPY A;  4O0I A;  3T1A A;  4ZTF A;  4EP5 A;  3K5N A;  4E0D A;  4DLE A;  4DS5 A;  3NF7 A;  1NOY A;  4BE0 A;  2E6L A;  3OYE A;  4FZZ A;  1S9E A;  3QEP A;  4KRE A;  3DLR A;  3U6F A;  4JS5 A;  1RDB A;  1EET A;  3SNN A;  3SQ1 A;  3HYF A;  4M3T A;  3PY8 A;  4M3W A;  2XRI A;  4KKO A;  2FBX A;  1HMV A;  1TKZ A;  3OS1 A;  4FJX A;  3HPG A;  4C8M A;  3LDS A;  3A2F A;  3WNE A;  1LAV A;  4FW1 A;  2HHQ A;  2YHA A;  4KB1 A;  2HW3 A;  2OPP A;  4CEO A;  1RDD A;  3SCX A;  2QKK A;  3SV4 A;  3OYH A;  3SQ0 A;  3THV A;  2VWK A;  3AA2 A;  3IS9 A;  3K5L A;  3SYZ A;  5J2N A;  1ZBL A;  2G8F A;  3ITH A;  1VSJ A;  2HHS A;  4OLB A;  2HNZ A;  5CY4 A;  1T7P A;  5J2P A;  4CEC A;  4DU3 A;  3DLB A;  4FJM A;  1HQE A;  2Z1G A;  4HCB A;  3TAQ A;  2F8T A;  2HHW A;  3ALY A;  3L2Q A;  3L3V A;  4N47 A;  1LV5 A;  3KJV A;  1O1W A;  1EKE A;  3L2U A;  5J1E A;  1HYZ A;  1NK8 A;  4M3R A;  3K59 A;  2HVH A;  1TKX A;  1QSL A;  1Z26 A;  3DRS A;  4IFY A;  3QEX A;  4I2Q A;  4KI6 A;  4M45 A;  4CJ4 A;  3K58 A;  1SKR A;  3DM2 A;  3TAF A;  1X1P A;  4ID1 A;  5DK5 A;  1MU2 A;  3K5M A;  4GMJ B;  4L8R B;  1JLQ A;  1UA0 A;  3TAG A;  1J54 A;  3VQQ A;  3L8B A;  4NYN A;  5HRO A;  4KTQ A;  2P5O A;  3LAM A;  4G1Q A;  3SUN A;  1XC9 A;  4FK4 A;  4DQR A;  4F3T A;  4CJF A;  2HHU A;  1I3A A;  1BCM A;  3NAE A;  4F2R A;  1RTH A;  3ISN C;  4FW2 A;  3SJJ A;  3T3F A;  1SKS A;  1JXB A;  3MED A;  2IS3 A;  4O0J A;  1DTQ A;  4F4K A;  1HYV A;  1ASV A;  3SUO A;  1KFD A;  3VQ6 A;  3D0P A;  2X6S A;  2QK9 A;  1FKP A;  1VSM A;  3IAY A;  4AHS A;  5J2M A;  1CZB A;  4DFP A;  4RW8 A;  2FBY A;  3VQD A;  2FC0 A;  1GOB A;  3P1G A;  3ZSX A;  2HHX A;  5HLF A;  4B8A B;  3V1Q A;  2A1R A;  5J2Q A;  1QE1 A;  1SV5 A;  3V1R A;  4FM1 A;  4N76 A;  3KIO A;  2YV0 X;  1RTI A;  2ETJ A; 
#chains in the Genus database with same CATH topology
 3UKU A;  4CJE A;  2P9U A;  4CGJ A;  3OYK A;  4DU1 A;  1GLB G;  4WQ4 C;  1WLJ A;  4C1N K;  3BF3 A;  3QML A;  1VQ4 N;  4OKK A;  4B3S K;  1VQO N;  3TTF A;  4JKB A;  1JLF A;  1JXE A;  3UKU B;  4LF9 K;  2P9U B;  4W5N A;  2UYT A;  4FWR A;  4ILG B;  2DFF A;  5TKY A;  3VEW A;  4H0V B;  1U47 A;  3HVT A;  2KQ2 A;  2WTU A;  3WNF A;  1MDU B;  4DFM A;  2DFH A;  3CFP A;  2X6N A;  1LW0 A;  1EQY A;  2A41 A;  4FJI A;  2HB5 A;  1BGX T;  2B4J A;  2BAN A;  2A1S A;  1C1C A;  5HRR A;  1E3M A;  1VSI A;  4CZJ A;  5KGX A;  4FJ5 A;  4YOW A;  4FYD A;  4BY9 C;  3ZT4 A;  3EZ5 A;  3DLH A;  3VQ7 A;  1DKG D;  1C0G A;  1OVY A;  4CD3 A;  3HL8 A;  1ATS A;  3OBW A;  4M3U A;  4IG0 A;  1RTJ A;  4WFN L;  4A62 A;  4I9L A;  4V19 S;  3AVK A;  3GBT A;  1XUP O;  2P5G A;  1NJW A;  4BE1 A;  4BWM A;  1KXP A;  3AVN A;  1T05 A;  3P83 D;  3TI0 A;  1SKW A;  4KPY A;  1KSP A;  5FLX O;  1NGA A;  4CFA A;  1RNH A;  1WNS A;  2V7Z A;  4QCL A;  2ITM A;  4JI4 K;  2ATQ A;  4RTF D;  3G6E N;  3MEE A;  4O4G A;  1G15 A;  1UAX A;  1JLE A;  2RHK A;  3ZX2 A;  3BP8 A;  5HRN A;  4DTS A;  2OAN A;  3ZLJ A;  2KHO A;  3MWT A;  1RBU A;  1VQ6 N;  4IZ9 A;  1W2B M;  5I42 A;  3CER A;  4AHR A;  1M90 O;  4IOC L;  1L3T A;  3EE8 A;  2RN2 A;  3CXC M;  1Q82 O;  1S72 N;  4BC2 A;  1ZC6 A;  5AQF A;  3OYF A;  1CZA N;  1RT2 A;  3RRG A;  2Q97 A;  4MQ3 A;  1NG9 A;  5C42 A;  4F3O A;  1YTA A;  1VAZ A;  4KBO A;  1HKG A;  4JI8 K;  3G10 A;  4BRP A;  2W42 A;  2OYQ A;  3HO1 A;  5AQX A;  3A8Y A;  2UUB K;  2E4L A;  1S3X A;  3B6P A;  1V4S A;  3AAP A;  3R9P A;  1UWB A;  3QFU A;  3SI6 A;  3O5B A;  1KVA A;  3FZM A;  3O3H A;  1BOT O;  5BPN A;  5AQP A;  4NYF A;  3SBG A;  2E1Y A;  2QWO A;  3IFR A;  1F21 A;  3AVG A;  4OVL A;  2GWJ A;  1L5U A;  4DG1 A;  3FFI A;  3HI0 A;  4ELT A;  3W3D A;  3TAM A;  3F73 A;  1NK4 A;  4OGC A;  1RT5 A;  4DTU A;  1MWM A;  3CQY A;  2VQF K;  1TAQ A;  3OBY A;  4BRM A;  1N36 K;  3O9U A;  3TWH A;  1BIS A;  2E2P A;  4KFB A;  1FK9 A;  5FPN A;  4HTU A;  4Z4C A;  3O8M A;  4CVN E;  4Z4I A;  3D45 A;  4DR3 K;  2H3G X;  2GTD A;  2GEL A;  1DTT A;  5AQI A;  1C0U A;  4DQQ A;  1ATR A;  2F96 A;  4CEZ A;  3E66 A;  4GY2 B;  3D2F A;  3H45 C;  1LAW A;  3O1B A;  3CCV N;  3M6G A;  1X9J A;  4YOV A;  3V1O A;  1WOQ A;  4M3Y A;  4LFB K;  5FRM A;  4E19 A;  4HWI A;  4X65 K;  2PYJ A;  1NK9 A;  1VRU A;  3ID6 A;  4MDB A;  3AAQ A;  3D2F B;  3HXM A;  4CJS A;  3M8P A;  3LDQ A;  4FK0 A;  4NCG A;  1QTM A;  3LWL A;  1D9D A;  1NGJ A;  1C0F A;  4TSX A;  3QNN A;  3P31 A;  4MFB A;  5GIP A;  3CC7 N;  3P5J A;  3VQA A;  3HPH A;  3KKS A;  2UXC K;  4EIA A;  1Q7Y O;  1JLA A;  2F7T A;  1VSL A;  2Q36 A;  4CER A;  3I0R A;  4O8K A;  4NXN K;  4DR4 K;  2Z1H A;  1RT6 A;  3A5M C;  4A5A A;  1WSJ A;  4IEE A;  1NK7 A;  5KRT A;  3OYI A;  1L3V A;  3DYA A;  3P4I A;  1P90 A;  1SL0 A;  4PUO A;  4CED A;  4H4M A;  4DF4 A;  1RBV A;  1S1U A;  3KLH A;  4AHT A;  4I9Q A;  3A5O C;  3NHG A;  3VOV A;  4CHO A;  1A5X A;  4B9U A;  2P9L A;  4F8R A;  1VQM N;  4UQG A;  3RVC A;  3F9K A;  1RT3 A;  3IUC A;  4JN4 A;  4OJR A;  4Q0B A;  4CGF A;  4LF8 K;  1QQN A;  3DLE A;  1OH6 A;  4KRF A;  4CZL A;  3OYB A;  4CF1 A;  4BE2 A;  1X9W A;  1WSG A;  2P9L B;  3ZT3 A;  2GUP A;  3C65 A;  4JI2 K;  4DV1 K;  3NH1 A;  3AVL A;  2D0P A;  2FSN A;  4AH9 A;  4EZ6 A;  1HNW K;  2AJQ A;  4LY7 A;  3ZSY A;  4CZG A;  4OPJ A;  3KWG A;  4YOX A;  4B8C A;  3UIQ A;  4JD2 A;  4ZTJ A;  4JI6 K;  3C6H A;  4E7H A;  3FZH A;  4IKF A;  3ATV A;  4WQ5 A;  4GVM A;  2RF2 A;  1FW6 A;  4H0T B;  4JK9 A;  3L2V A;  3MX5 A;  3CJ9 A;  5EY4 A;  2W6K A;  3VES A;  4CZI A;  1QZ5 A;  3CJ1 A;  3EL2 A;  4JD2 B;  1HPM A;  3OJU A;  4PL7 A;  4BR2 A;  4DU4 A;  1NBW A;  3VQ4 A;  4FJH A;  5AQM A;  4YFU A;  3DRP A;  2ZM6 K;  3AA4 A;  1LW2 A;  3RSE A;  3ZX0 A;  4LSN A;  3KLF A;  4IG3 A;  2IVO A;  1TUY A;  3EKS A;  3PSF A;  1Z25 A;  4BRN A;  3TPQ A;  1L3U A;  4CGD A;  3T7Z A;  4FZY A;  2VCP A;  1TVR A;  1JCG A;  5HOO A;  4K25 A;  2HND A;  3ZEU A;  2Q3S A;  4NLC A;  3CJB A;  3T1Y K;  3RSE B;  2G8K A;  5HRS A;  3QNO A;  1JJ2 M;  4W5T A;  4FPA A;  3AVC A;  3LP3 A;  1S6P A;  3LZI A;  2VQE K;  3ZEU B;  2ZF5 O;  3VQ8 A;  4BGA A;  2A5X A;  4CZK A;  3H1Q A;  4J2B A;  3SPY A;  4JKA A;  1LCU A;  4EP5 A;  2ASO A;  4E0D A;  4DLE A;  4DS5 A;  1SS6 A;  4C23 A;  3QEP A;  3DLR A;  4JS5 A;  1RDB A;  4M3T A;  4BRH A;  3HYF A;  4EAH D;  3LDN A;  4WQ5 C;  2FBX A;  1TKZ A;  3WNE A;  1ZBS A;  4CEO A;  4XH5 A;  3M5R A;  1VQ8 N;  1U6Z A;  3SCX A;  3SV4 A;  2P9S A;  1ZBL A;  2G8F A;  5J2N A;  3AGR A;  3VEY A;  3MN5 A;  1T6C A;  3DLB A;  3WXI A;  3TAQ A;  5AR0 A;  1NK8 A;  4M3R A;  4IFY A;  5BRD A;  1KAX A;  2HF3 A;  1SKR A;  4RCH A;  2P9S B;  4ID1 A;  3K5M A;  4GMJ B;  2HHH K;  1GLF O;  3VQQ A;  5C2D A;  3L8B A;  3OW2 M;  2P5O A;  5CR4 A;  3SUN A;  1XC9 A;  2O8E A;  4CJF A;  2NRX A;  4BRE A;  3T3F A;  4ISG A;  4K0K K;  3I8B A;  3O6W A;  3MED A;  1HYV A;  4DCH A;  4UY8 O;  4I6M A;  1VSM A;  2P9P A;  4AHS A;  1Q86 O;  4RW8 A;  4BR4 A;  1U2V A;  4X62 K;  2HHX A;  4PL8 A;  5J2Q A;  1SV5 A;  3V1R A;  1RTI A;  2O8E B;  4IEI A;  3RMB A;  2HVI A;  3NGI A;  4JEP A;  4C1N I;  1TGO A;  4CJP A;  3NE6 A;  1WB9 A;  1A5V A;  2YKM A;  4I6M B;  1C0M A;  2P9P B;  4O8U A;  1U2V B;  5ADX A;  4LF6 K;  2OPQ A;  5CZ1 A;  1NJY A;  2E2N A;  3WQT A;  3L3U A;  1HNX K;  2YKN A;  5CYQ A;  1VK0 A;  2E8A A;  1K6Y A;  2YJE A;  3BZK A;  1XHX A;  5AZJ A;  3CHW A;  4HVJ A;  4B08 A;  4H0X B;  3ZET A;  1KQS M;  3JSM A;  4CJT A;  4DMN A;  3RMA A;  1S1T A;  1VQ7 N;  5E26 A;  5A2Q O;  3NBP A;  3H08 A;  3VMF B;  1RGI A;  2EHG A;  1R0A A;  2IVP A;  2VWB A;  4QOZ B;  3MXJ A;  2YNF A;  1GLL O;  5AZJ B;  5FRN A;  5DM7 L;  3ZET B;  2LSN A;  2PZS A;  3HRG A;  3A0I X;  1SQK A;  2FSK A;  4CK1 A;  3U8X A;  2OPS A;  3L4Q A;  2CH6 A;  4B9M A;  4FJJ A;  4BDP A;  3KK7 A;  5D3G A;  5GAG P;  1WSF A;  3EE9 A;  3S41 A;  4CJK A;  3BY5 A;  1K9M O;  4FWN A;  4DWI A;  1A5W A;  3RWU A;  3K2P A;  2P1J A;  5KQ8 A;  4CBX A;  2YHW A;  4B1Y B;  1N34 K;  1EWR A;  3KK1 A;  2XY6 A;  4LC9 B;  4B1W B;  1VQN N;  1HNV A;  4BC4 A;  1TL1 A;  3L0Q A;  3AO1 A;  5KRS A;  2NRV A;  3ZT1 A;  4JYA K;  1WSI A;  3MEG A;  3R8E A;  1DEJ A;  1B9D A;  5AQY A;  3SJH A;  4R5P A;  1IH7 A;  4DB3 A;  4CIE A;  4CJW A;  4HUG A;  4DQP A;  3U3G A;  3LAL A;  1Q9Y A;  3UKR A;  4OPK A;  4CCH A;  3VQC A;  1NJI O;  2HMI A;  3AVF A;  4KTW A;  3HVR A;  2XY5 A;  3PX0 A;  3LL3 A;  3M3Z A;  1N33 K;  4JKD A;  3LWM A;  4FOI A;  3OYD A;  5H1S Q;  2X74 A;  2QXF A;  4H4O A;  1JLB A;  4BRL A;  3UKR B;  2ZJQ L;  4K8X A;  4KHU A;  3SLC A;  1FJG K;  3AVJ A;  4CIG A;  4FO0 A;  3BZC A;  4OPA A;  1GOC A;  1U48 A;  3GOI A;  5SWM A;  3LM2 A;  1C0T A;  2QWM A;  2E1Z A;  2FF6 A;  3AVI A;  3FFK B;  3AGK A;  1N5Y A;  1SL1 A;  3VEZ A;  3KK3 A;  3HOT A;  1REV A;  4E7J A;  1TK0 A;  3DXM A;  4YOU A;  3HM9 A;  1TL3 A;  4JI3 K;  4M63 C;  1IKV A;  2FXU A;  1NJX A;  3VQE A;  2E2O A;  4FZX C;  4H5T A;  2RPI A;  4AHV A;  1IKX A;  3BEX A;  1ASW A;  1NOZ A;  3QBX A;  3DXM B;  3FGU A;  3MN9 A;  3H3O B;  4H0Y B;  3TAN A;  2PYL A;  4NXM K;  1T44 A;  1Y97 A;  4FVM A;  4HCC A;  4DSI A;  1NKC A;  4WF9 L;  5BPM A;  3QIO A;  4CZE A;  4CEB A;  2PY5 A;  1BQN A;  2OCE A;  3O80 A;  4JS4 A;  3HP9 A;  3DI6 A;  4KHQ A;  1BDG A;  4H0P A;  4CEE A;  2Y1J A;  3F9M A;  3JYT A;  3EEQ A;  4CE9 A;  1P8Z A;  1M1K O;  4PKH A;  2E6M A;  3JAM O;  3QBW A;  4BRD A;  2CGK A;  2I7P A;  3F2K A;  3CQX A;  4RWT A;  1S5J A;  1W9H A;  2WOM A;  4KV8 A;  4G9Z A;  4FLW A;  4FVU A;  3CCR N;  2IVN A;  1NJZ A;  1NMD A;  3LPU A;  3T1H K;  2HBK A;  4KB0 A;  4HUF A;  2E88 A;  2X78 A;  3G71 N;  4CJL A;  4JRP A;  3A5L C;  4E1N A;  3CD6 N;  2J4R A;  4K43 A;  4GKJ K;  4JAX A;  2QW9 A;  4E7K A;  1CZ9 A;  1NGC A;  3KLE A;  4DV3 K;  4MDA A;  3E9L A;  1FKO A;  1WSE A;  5BN8 A;  1NGI A;  4FLX A;  4AM6 A;  3D7E O;  4B9V A;  2IIR A;  5JIC A;  2A6A A;  3K9J A;  3VEX A;  3SAH A;  1VSK A;  3N4P A;  2FSJ A;  4H5R A;  3KZB A;  2ZD1 A;  4BVP A;  4CGH A;  4DTJ A;  4WFA L;  4WE1 A;  4JHD A;  3CFR A;  4KH5 A;  1XI1 A;  5SZT A;  4NCB A;  3TAB A;  1RBR A;  3KWI A;  3WXJ A;  3RTV A;  2ZJR L;  3K9K A;  2B6A A;  4FLT A;  2I5J A;  1TK5 A;  3OS0 A;  4J8F A;  4CBU A;  2Y1I A;  3DLL L;  4JKF A;  5CZ2 A;  5K14 A;  4CJ3 A;  2BUP A;  1GLA G;  4JHD B;  4BVO A;  2V51 B;  4J2E A;  2ZGY A;  3CJA A;  1KVB A;  2UUA K;  4O44 A;  2FF3 B;  3UE5 A;  4B3M K;  2DY4 A;  1JCF A;  1NGE A;  4CK2 A;  3J7Z O;  5M1P A;  3C94 A;  3MXI A;  3OYG A;  4DHY A;  3J81 O;  3R6M A;  1DLO A;  2DTU A;  1XWL A;  3FZK A;  5KGW A;  2F9T A;  3MEC A;  4KO0 A;  5AQS A;  3MMV A;  3WQU A;  2FLO A;  2Q2R A;  3DLK A;  4CFB A;  3ULD A;  2HST A;  3NDK A;  3J8A A;  1HNI A;  3CPW M;  4FK2 A;  3M8S A;  4DFK A;  4FM2 A;  3VGL A;  1YF5 L;  4E3S A;  2PAV A;  4IDK A;  3WEE A;  3CG7 A;  1RCH A;  3KKR A;  3KVG A;  3MCP A;  2ASM A;  3VN5 A;  3V81 A;  3O9R A;  2CH5 A;  4AIL C;  4FM0 A;  1S9G A;  2KLA A;  4A2A A;  2QM1 A;  3IRX A;  3WEE B;  1XQS C;  3EZW A;  4DKW A;  2HMP A;  2V52 B;  4BRI A;  1YXQ A;  3S9H A;  4YOR A;  1JL2 A;  3OY9 A;  1HJO A;  1QZ6 A;  4O5B A;  1TK8 A;  5T7B A;  1Q81 O;  2KW4 A;  1B92 A;  3C6T A;  2QXL A;  1IO2 A;  4Z4F A;  4EP4 A;  1VSD A;  2VGM A;  1H1V A;  3V4I A;  2G8I A;  2O8D A;  5AQZ A;  3FLC O;  1WN7 A;  3AA3 A;  3PO5 A;  3O4Q A;  4BG9 A;  3EO3 A;  1RBT A;  4JKE A;  4Z0U A;  4ILH A;  3I8D A;  5C24 A;  3CJC A;  1I94 K;  4U67 L;  2HBM A;  2O8D B;  5LJV A;  3CI5 A;  4CHP A;  2O4G A;  1VQ5 N;  4LFA K;  3OS2 A;  1VSF A;  3BUZ B;  4ZTF A;  4A2B A;  3K5N A;  4H03 B;  1QHA A;  3PIO L;  1RFQ A;  4BE0 A;  1S9E A;  3DAW A;  1EET A;  3SNN A;  2V7Y A;  4M3W A;  1SZ2 A;  2WBN A;  4KKO A;  4FJX A;  2HHQ A;  5F0X A;  3HTV A;  1HX1 A;  2WUS A;  2UU9 K;  3SQ0 A;  1T7P A;  2VWK A;  3AA2 A;  3SYZ A;  4MLH A;  3CF5 L;  1N8R O;  3C0B A;  3ITH A;  4B9Q A;  4OLB A;  1KAZ A;  5CY4 A;  4FJM A;  1HQE A;  2Z1G A;  2F8T A;  2HHW A;  3ALY A;  3L2Q A;  1EKE A;  4B1Z A;  1HYZ A;  5BPL A;  4BC3 A;  1TKX A;  1QSL A;  1Z26 A;  4F9O A;  4I2Q A;  4M45 A;  3DM2 A;  2OTJ N;  3TAF A;  1Z05 A;  4DV6 K;  1GLC G;  4KTQ A;  4NYN A;  4G1Q A;  4FWS A;  4F3T A;  3E9P A;  1BCM A;  4F2R A;  3GG4 A;  3SJJ A;  1SKS A;  1JXB A;  2IS3 A;  4H5V A;  3D0P A;  3CCL N;  1NGG A;  2QK9 A;  3MN7 A;  1FKP A;  2O8B A;  1CZB A;  1IV0 A;  1YUW A;  2FBY A;  4FWQ A;  2VYP A;  3P1G A;  4FWM A;  4B8A B;  2PBD A;  4FM1 A;  3LP0 A;  2ETJ A;  1J5E K;  4J2D A;  3VGM A;  4KTZ A;  1KAY A;  4DV5 K;  4CI6 A;  4AHU A;  4OKE A;  3VEO A;  2O8B B;  4IBN A;  2W41 A;  4FWL A;  4PKG A;  5AQV A;  4JV5 K;  4JI0 K;  1BWF O;  1T03 A;  1W97 L;  2UXB K;  4DTO A;  2A40 A;  2E5L K;  3OYM A;  3KLI A;  5JMV A;  2UXD K;  1NKE A;  4B9T A;  4WCE L;  3HM8 A;  3ATU A;  3PLA A;  2G8W A;  1NGD A;  3OA9 A;  1NMN A;  3VQB A;  3V9W A;  4PY5 A;  4YNQ A;  4B1V A;  1YI2 N;  1YT3 A;  3WNH A;  4B9N A;  3LP1 A;  3G25 A;  3S3N A;  4CF9 A;  4DTM A;  4RW9 A;  3QB0 A;  5M1F A;  4ELU A;  1YJN N;  4DTP A;  5HBM A;  4XIU A;  4LH4 A;  1T8E A;  3CC2 N;  3ENO A;  4ICL A;  1Q9X A;  4DF8 A;  4M42 A;  1KCF A;  2JWK A;  3QES A;  1IG9 A;  3C6A A;  2IGI A;  3HK2 A;  4JLH A;  5I9E B;  3CCJ N;  3NH2 A;  3MK6 A;  1ITG A;  4FJ9 A;  2EX3 A;  4FWO A;  3CQ8 A;  2YI1 A;  4BR7 A;  4E1J A;  3AO4 A;  3L6Q A;  5I3U A;  4FCY A;  4M7X A;  2Z1J A;  3VTH A;  2NRZ A;  2CGL A;  1JLG A;  4OKJ A;  3Q7C A;  5F1X A;  3DOL A;  1S1W A;  5AFU H;  1VQ9 N;  3ZSW A;  4BRG A;  4EZ9 A;  3V9Z A;  3DOK A;  4E89 A;  3THW A;  2D5R A;  2Z1I A;  3PV8 A;  2HF4 A;  4X64 K;  1ZBF A;  1WAF A;  3CM6 A;  4CZH A;  4FPB A;  3VER A;  3C7N A;  3CET A;  5KI6 A;  2BE2 A;  4FJL A;  1IBL K;  1BIU A;  2EWS A;  3THW B;  4NO7 A;  2YX6 A;  2GV9 A;  1XC3 A;  5FDL A;  5EOY A;  4DV4 K;  1X9S A;  1WUA A;  3VF6 A;  1Q8I A;  1WAJ A;  3ZCM A;  3C7N B;  3CCQ N;  4OO1 J;  1QSS A;  3CCM N;  2ZQB A;  4K42 A;  4M41 A;  3HP6 A;  4IFV A;  4YY3 K;  3TSU A;  1LOT B;  4GV3 A;  1V4T A;  4KAZ A;  4PHT X;  4CES A;  3E9O A;  4CHN A;  3OYJ A;  1QS4 A;  4CBW A;  1YVN A;  4BR9 A;  4HUE A;  4KHN A;  3H1V X;  1YAG A;  3G0Z A;  4E1M A;  1IBK K;  3NF9 A;  4AF1 A;  5LY3 A;  3H6E A;  4DSJ A;  1RBS A;  3IDH A;  2Q0U A;  3AVB A;  3I33 A;  1OH8 A;  3CJ7 A;  4ZHR A;  2XO7 A;  3O08 A;  4Y0W A;  2XY8 A;  3OYA A;  4LF4 K;  3OYN A;  3NVK A;  4QS7 A;  4FJK A;  4E7I A;  1NGH A;  2WFB A;  3TAP A;  2D4W A;  1IBM K;  1HUX A;  1NK0 A;  4PQU A;  3AV9 A;  5HRP A;  3J7Y P;  3CCU N;  4Z94 A;  4K8Z A;  4BR5 A;  1BCO A;  1EP4 A;  3O1W A;  3WXK A;  2GX9 A;  1WBD A;  3KD5 E;  1XNR K;  3Q7B A;  2O4I A;  3LDP A;  3VQ9 A;  2P9I B;  4AHC A;  1T3V A;  3M8Q A;  1RDW X;  3UB5 A;  1NGB A;  4DQI A;  3ZSQ A;  3QIP A;  5AQL A;  1RT7 A;  2ZE2 A;  1LWE A;  1CLQ A;  1GLE G;  2O8C A;  3QIC A;  2KFN A;  4IJN A;  1GOA A;  2QWR A;  4EHU A;  2ZJP L;  5M1O A;  3U4L A;  3QLH A;  3HOS A;  5JVH L;  4RW6 A;  2HBJ A;  1KFS A;  1SUQ A;  2YNI A;  1BO5 O;  3ASM A;  4GV9 A;  4FXD A;  1ASU A;  3E1Y A;  4WYB A;  1TUU A;  4CZF A;  2O8C B;  3BF1 A;  5AJ3 K;  1C1B A;  2AA4 A;  3VPZ A;  3NCI A;  3SZ2 A;  4LH5 A;  4DSE A;  4BRF A;  1BHL A;  3AO2 A;  1ZBU A;  3NMU A;  1TKD A;  4FSV A;  4H8K A;  3RRH A;  1NLV A;  4A57 A;  3R3L A;  5M1Q A;  3RMC A;  2NRR A;  5B8H A;  3OVN A;  3J80 O;  3THY A;  1DGK N;  1JCE A;  2VG5 A;  2QA4 N;  3M1F A;  4JNE A;  1KTQ A;  2BGG A;  3HSC A;  3TTC A;  1GLJ O;  4JRQ A;  3LZJ A;  4DQ8 A;  4YDU A;  3VQP A;  2E20 A;  5JLH A;  1UOC A;  3CFO A;  3LP2 A;  3VGK A;  4B3O A;  3CC4 N;  2YHB A;  1JL1 A;  5EU7 A;  3HT3 A;  1EX4 A;  3THY B;  4GW6 A;  4PKI A;  1X3N A;  4FJN A;  5AQK A;  2ZGZ A;  1BQM A;  1O13 A;  3AY9 A;  4FLV A;  4ILJ A;  1NM1 A;  1D9F A;  2QEX N;  3K0S A;  2Q1N A;  4CF2 A;  1S6Q A;  2DPN A;  2VG6 A;  4XH4 A;  4CD1 A;  2G8V A;  3BDP A;  3A5N C;  2D0A A;  3CME N;  2R7Y A;  3IG1 A;  5IWA K;  1NK5 A;  4BRO A;  4B9L A;  4IO9 L;  4CIF A;  4C8N A;  4CJR A;  2XY7 A;  1RDC A;  4H0O A;  1L3S A;  1BL3 A;  4HHT A;  3C95 A;  3NH0 A;  1HLU A;  3O9Q A;  5EXW A;  1WSH A;  3MCA B;  3AVM A;  2QWP A;  2FBT A;  4FLZ A;  4CGI A;  1NNE A;  4JKG A;  4OGE A;  4CHZ A;  5AQO A;  3DWL A;  1TV6 A;  1EXQ A;  1SL2 A;  4CJ5 A;  3SAF A;  4BWJ A;  3J7A P;  3HJF A;  1Y64 A;  5C25 A;  4FJ7 A;  3P39 A;  2BH1 A;  4BAC A;  4YOY A;  4A59 A;  1ESV A;  1D8Y A;  2P9N A;  1HPZ A;  3QFP A;  2VWJ A;  4N41 A;  2YCH A;  1HQU A;  3U9Z A;  4IDH A;  4JKG B;  1RT4 A;  3OYL A;  2OZM A;  4YDU C;  3PX6 A;  4LFC K;  4IFE A;  3LAN A;  2P9N B;  2HHT A;  3V9S A;  3H46 O;  2HOE A;  5BRH A;  3MXM A;  1U49 A;  1BG3 A;  2GBZ A;  1KD1 O;  4ELV A;  2HHV A;  3JXU A;  4YOT A;  1B9F A;  4M3X A;  5E84 A;  5F2R A;  5KTQ A;  1HJR A;  2QKB A;  1XMQ K;  2GWK A;  4IOX A;  4WFB L;  1OKJ A;  3EN9 A;  3OHR A;  3QIN A;  3CCS N;  3IMX A;  3VQ5 A;  2NRT A;  3ZT2 A;  4ID5 A;  4AM7 A;  1W0H A;  1VQK N;  1N6Q A;  4CJ7 A;  4Z4E A;  4BG8 A;  1X9M A;  5TKW A;  1YJ9 N;  3PSI A;  3B8A X;  5C15 A;  4O0I A;  1K8A O;  1NOY A;  3OYE A;  3GE1 A;  4FZZ A;  1K8K A;  4B3R K;  4NLB A;  1T6D A;  3U6F A;  1YHQ N;  2XRI A;  1NGF A;  1HMV A;  5JLF A;  4C8M A;  3LDS A;  3A2F A;  1LAV A;  4FW1 A;  4FWP A;  2YHA A;  3OYH A;  3THV A;  3K5L A;  4KH6 A;  1VSJ A;  2QWN A;  2HHS A;  1K8K B;  2HNZ A;  5J2P A;  4CEC A;  3EKU A;  3L3V A;  5GAD P;  1O1W A;  2NRH A;  3L2U A;  5J1E A;  3K59 A;  2HVH A;  3QEX A;  4KI6 A;  1G99 A;  5AQG A;  1X1P A;  1Z6R A;  4JKH A;  5BRE A;  5C12 A;  4DQR A;  2HHU A;  1I3A A;  3ULE A;  3NAE A;  1NWK A;  4IWV A;  1RTH A;  3ISN C;  4FW2 A;  4MLE A;  3LDL A;  3LM9 A;  3SUO A;  1KFD A;  4JK7 A;  4DR6 K;  3VQ6 A;  2X6S A;  3D6R A;  3IAY A;  5BR9 A;  3VQD A;  1GOB A;  2A1R A;  1QE1 A;  4N76 A;  1ZXO A;  1K73 O;  2YV0 X;  5AQU A;  3ULE B;  1YTU A;  4XH1 A;  5AQH A;  3QEW A;  5CHI A;  3KTQ A;  4LF5 K;  1VSE A;  3M8R A;  4DR7 K;  2RE2 A;  4QS8 A;  1J9A A;  1QVG M;  3SV3 A;  3N4Q A;  2W40 A;  3QET A;  1QQO A;  4OX9 K;  3AO3 A;  4DR2 K;  1IG8 A;  2IAJ A;  4BC5 A;  3MDQ A;  3V9X A;  1J6Z A;  2G8U A;  1CXU A;  3CIP A;  3FZF A;  2OZS A;  4PA1 A;  1VRT A;  4M7Y A;  3VTI A;  1TAU A;  3W0L A;  4DTX A;  4PWD A;  2JWL A;  1I39 A;  3PUF A;  3TSP A;  4BDY A;  4CK3 A;  2NRW A;  2XHB A;  5FPD A;  1DT9 A;  2Q31 A;  2KZM A;  3THX A;  4RW4 A;  3KLG A;  4N56 A;  3MWP A;  3R1X A;  2VGN A;  3VA3 A;  5AQR A;  4BR0 A;  3AVA A;  2CGJ A;  3IKM A;  4KHY A;  1YIJ N;  5MLC Q;  3S3O A;  2FBV A;  1MWK A;  1UA1 A;  4CJQ A;  4GVE A;  3THX B;  3KHY A;  4CW7 B;  4AQY K;  3GDQ A;  3WXL A;  4LSL A;  5C10 A;  3SQ2 A;  3AA5 X;  5AQT A;  1W7A A;  5C2F A;  2NNW A;  2VG7 A;  3V9U A;  4CJV A;  3MN6 A;  3KD1 E;  3NFA A;  3O3F A;  4RW7 A;  1YVU A;  2P51 A;  4BDZ A;  1XHZ A;  2KZZ A;  1N32 K;  3VA0 A;  3SMP A;  4O5F A;  1RDA A;  1VSH A;  5LMN K;  5CYM A;  3I0S A;  4BRA A;  3L2W A;  4X66 K;  2GEM A;  4DLG A;  3GL1 A;  5ADX H;  3TR8 A;  2ASP A;  3G4S N;  2Q0R A;  1ZBH A;  3WUH A;  4IJA A;  4DUY K;  3WT0 A;  2NZT A;  3H3N O;  5AQJ A;  1IKW A;  2O8F A;  3VEV A;  5M1N A;  3CYM A;  3DXK A;  1S1V A;  2IDO A;  2B5J A;  4DTR A;  3KK2 A;  4IOA L;  1KLN A;  1NU0 A;  4A61 A;  4R79 A;  1NK6 A;  4BQL A;  4DV2 K;  3S3M A;  3O9T A;  3U9D A;  1J53 A;  2QWL A;  3B6O A;  3HBT A;  1XNQ K;  4BRQ A;  3HZ6 A;  4XEI A;  2O8F B;  2D0B A;  2OTL N;  4EFH A;  1BU6 O;  1HKC A;  2D1K A;  3DXK B;  3OYC A;  4CFD A;  4A5B A;  3NGZ A;  1J5O A;  4KH4 A;  1KC8 O;  4JK8 A;  1ILY A;  3CCE N;  4N5S A;  3LPT A;  4OPH A;  1C6V A;  2F9W A;  1OVQ A;  3ENB A;  1QSY A;  1ATN A;  3MAQ A;  4Y1C A;  2YJF A;  5LL6 Z;  1OH5 A;  2YNH A;  5GIO A;  3F5T A;  1RDU A;  2UUC K;  1HRH A;  1SAZ A;  3FE1 A;  3NF8 A;  4LD0 A;  3L2R A;  1YIT N;  4DFJ A;  4FLU A;  2GUI A;  4JI7 K;  1BUP A;  3RMD A;  4CEF A;  3PIP L;  1OH7 A;  3T19 A;  4OLA A;  4Y1D A;  1TYQ A;  1RIL A;  3O4N A;  1HYS A;  4MO5 A;  1QVF M;  1D5A A;  5EVZ A;  3L4I A;  2DFE A;  4GKK K;  5BN9 A;  5AQQ A;  1QQM A;  5HL7 L;  1BI4 A;  5IT9 O;  1CXQ A;  4IXC A;  5AQN A;  5KQD A;  5LJW A;  4FJG A;  2D0C A;  5FPM A;  1IKY A;  1TYQ B;  4Q5V A;  4W5O A;  3EY1 A;  1BA1 A;  2YNG A;  3ZSV A;  2P9K A;  2RKI A;  3T69 A;  3FZL A;  1X3M A;  2A42 A;  5KPZ A;  5EX5 A;  1BI4 B;  1FXX A;  1VHX A;  5BRF A;  3VF2 A;  1U45 A;  3ZSR A;  4B3T K;  3WXM B;  4JI1 K;  1KRP A;  2ITG A;  4CHQ A;  3BGR A;  4O55 A;  2P9K B;  4CJU A;  5JS2 A;  5HP1 A;  3TTD A;  2KFZ A;  3ZX3 A;  4DV7 K;  4CGG A;  1R59 O;  3SUQ A;  3DMJ A;  2F8S A;  3U3Y A;  3AVH A;  4BGB A;  1ZBI A;  4B9S A;  3K5O A;  5ELZ A;  3RR8 A;  1KLM A;  4DV0 K;  4EHT A;  2BDP A;  3CPE A;  4RG8 A;  1E4F T;  4Z4H A;  5GIN A;  3O3G A;  1S22 A;  4ISF A;  4KHW A;  3NF6 A;  3ZSO A;  2OA8 A;  5AZI A;  4QAG A;  4J2A A;  3V6D A;  3C6U A;  4M3Z A;  2W6L A;  1C1A A;  3QEV A;  4JKC A;  4DSF A;  4CEQ A;  3P38 A;  3DLG A;  4CEA A;  3K57 A;  3DJC A;  4BRC A;  2WON A;  1TKT A;  1EWQ A;  3VET A;  5GAH P;  1U04 A;  4KI4 A;  3CM5 A;  2KTQ A;  5JS1 A;  3PO4 A;  2E2Q A;  5AZI B;  4K41 A;  4C8K A;  2A3Z A;  4QS9 A;  3OTO K;  4DS4 A;  4F2S A;  4CZM A;  4B1X B;  3LDO A;  3SUP A;  4IO8 A;  3JS6 A;  3AAR A;  3HPO A;  3ZYY X;  1NKB A;  4DSK A;  4HTL A;  4NB4 A;  5CE3 A;  2QI2 A;  4ISE A;  4CF0 A;  5AQW A;  2JLE A;  5C0Y A;  5M1K A;  3MX2 A;  2NLX A;  3TAE A;  3SPZ A;  2HNY A;  4DSL A;  3OJS A;  1S1X A;  4B1U B;  5DM6 L;  4DTN A;  3SK3 A;  3O9S A;  4FL9 A;  4I7F A;  4YHH K;  4KHS A;  1RTD A;  3CMA N;  3ZT0 A;  3AO5 A;  3SQ4 A;  2G8H A;  4E7L A;  1U4B A;  1BIZ A;  2IC3 A;  4FJ8 A;  3E01 A;  3LAK A;  1HR0 K;  1LWF A;  1HKB A;  2P9I A;  4NCA A;  3ENH A;  4MO4 A;  3TAR A;  4BRK A;  4FLY A;  3QEI A;  3VF4 A;  4H5N A;  2NUB A;  1LWC A;  5FRO A;  3ZSZ A;  3HST B;  3NGY A;  3QDK A;  2KKZ A;  1KVC A;  4I2P A;  4CF8 A;  3O4W A;  3I55 N;  1EO1 A;  3EYZ A;  3TSQ A;  4W5Q A;  3ID8 A;  4Z4G A;  5KPT A;  4C8O A;  4CHY A;  2F4V K;  3SAG A;  3RR7 A;  1JKH A;  5E41 A;  1XMO K;  4DQS A;  1QQC A;  5DMR A;  5BR8 K;  2IOC A;  1Q18 A;  3PX4 A;  4LF7 K;  1RT1 A;  3WNG A;  4U7B A;  1BA0 A;  1E4G T;  1WBB A;  3D2E A;  4DR5 K;  3DRR A;  3QO9 A;  1GLD G;  4GV6 A;  2YHY A;  2OPR A;  1ZYQ A;  4CFC A;  2AP1 A;  2JGU A;  4C8L A;  1JLC A;  4WQ4 A;  1QHT A;  3QER A;  4W5R A;  3SMS A;  3T1A A;  3VEN A;  3NF7 A;  3D2E B;  2E6L A;  4KRE A;  2D0O A;  3SQ1 A;  3PY8 A;  3TU5 A;  3OS1 A;  1VQP N;  3HPG A;  2PFU A;  1MA9 B;  4BQZ A;  4KB1 A;  2HW3 A;  2OPP A;  5KPR A;  1HNZ K;  1RDD A;  1IJJ A;  2QKK A;  3FR0 A;  3IS9 A;  2QWQ A;  1D4X A;  2BTF A;  4DU3 A;  4HCB A;  4N47 A;  1LV5 A;  3KJV A;  5GAE P;  4FWK A;  3SBT A;  4JI5 K;  3DRS A;  4CJ4 A;  3K58 A;  4GNI A;  5DK5 A;  1MU2 A;  4L8R B;  1JLQ A;  4DUZ K;  1UA0 A;  3TAG A;  1J54 A;  5HRO A;  3LAM A;  1YJW N;  4FK4 A;  4FOE A;  5FPE A;  2ZWH A;  2WC9 A;  4KHP K;  5JVG L;  4O0J A;  4L3Q A;  1DTQ A;  4F4K A;  2YHX A;  1ASV A;  2QTD A;  3I56 N;  2HBL A;  5LMU K;  2I7N A;  5J2M A;  4DFP A;  2FC0 A;  3ZSX A;  3NVM A;  5HLF A;  3V1Q A;  4H5W A;  1VQL N;  3KIO A;  4DR1 K;  5AFU A; 
#chains in the Genus database with same CATH homology
 1YTU A;  4J2D A;  3RMB A;  3QEW A;  4CJE A;  4CGJ A;  3OYK A;  4DU1 A;  3KTQ A;  2HVI A;  1VSE A;  4KTZ A;  3M8R A;  3NGI A;  3NE6 A;  1TGO A;  4CJP A;  1J9A A;  1A5V A;  1WLJ A;  2YKM A;  1C0M A;  4AHU A;  4OKE A;  3SV3 A;  4IBN A;  4OKK A;  3QET A;  3AO3 A;  2OPQ A;  2IAJ A;  5CZ1 A;  1T03 A;  1JLF A;  1NJY A;  3V9X A;  1JXE A;  3L3U A;  2YKN A;  5CYQ A;  4DTO A;  1VK0 A;  2G8U A;  1K6Y A;  1CXU A;  1XHX A;  3OYM A;  4HVJ A;  4M3Y A;  3KLI A;  2OZS A;  4PA1 A;  4B08 A;  1VRT A;  4W5N A;  1NKE A;  1TAU A;  4B9T A;  3JSM A;  2DFF A;  4CJT A;  4DMN A;  3RMA A;  1U47 A;  1S1T A;  4DTX A;  4PWD A;  3HVT A;  1I39 A;  3PUF A;  4BDY A;  2KQ2 A;  3NBP A;  3WNF A;  3H08 A;  4CK3 A;  2XHB A;  2G8W A;  2EHG A;  3VQB A;  3V9W A;  4DFM A;  1R0A A;  2KZM A;  2DFH A;  4PY5 A;  4RW4 A;  3CFP A;  4YNQ A;  3KLG A;  3MXJ A;  2X6N A;  4N56 A;  4QOZ B;  2YNF A;  1YT3 A;  3WNH A;  4B9N A;  3LP1 A;  1LW0 A;  3S3N A;  4CF9 A;  3VA3 A;  4DTM A;  5FRN A;  4RW9 A;  2LSN A;  4ELU A;  4DTP A;  2HB5 A;  1BGX T;  5HBM A;  2PZS A;  2B4J A;  3AVA A;  4FJI A;  2BAN A;  2A1S A;  4LH4 A;  4XIU A;  1T8E A;  4KHY A;  4ICL A;  4CK1 A;  1Q9X A;  1C1C A;  5HRR A;  4DF8 A;  3S3O A;  4M42 A;  1VSI A;  2OPS A;  2FBV A;  1KCF A;  3QES A;  5KGX A;  4B9M A;  4FJJ A;  1IG9 A;  1UA1 A;  4BDP A;  4FJ5 A;  5D3G A;  4CJQ A;  4FYD A;  1WSF A;  4CJK A;  3ZT4 A;  3EZ5 A;  3DLH A;  2IGI A;  3VQ7 A;  3HK2 A;  4JLH A;  4DWI A;  1A5W A;  3RWU A;  3K2P A;  4LSL A;  3NH2 A;  2P1J A;  1ITG A;  4FJ9 A;  3HL8 A;  3SQ2 A;  3AA5 X;  2EX3 A;  3CQ8 A;  3KK1 A;  2XY6 A;  4M3U A;  3AO4 A;  2VG7 A;  4IG0 A;  5I3U A;  1RTJ A;  4FCY A;  2Z1J A;  3V9U A;  1HNV A;  5KRS A;  1TL1 A;  3AO1 A;  4I9L A;  3AVK A;  1JLG A;  4OKJ A;  4CJV A;  3ZT1 A;  2P5G A;  1NJW A;  4BE1 A;  1WSI A;  3MEG A;  3NFA A;  4BWM A;  3O3F A;  3KD1 E;  1B9D A;  3AVN A;  1S1W A;  3DOL A;  3P83 D;  4RW7 A;  3TI0 A;  1T05 A;  1SKW A;  1YVU A;  1KSP A;  2P51 A;  4BDZ A;  4KPY A;  1XHZ A;  2KZZ A;  4CFA A;  1RNH A;  4R5P A;  1WNS A;  3VA0 A;  4QCL A;  3ZSW A;  1IH7 A;  4HUG A;  4CIE A;  2ATQ A;  4CJW A;  4DQP A;  1RDA A;  3U3G A;  1VSH A;  4EZ9 A;  3LAL A;  1Q9Y A;  5CYM A;  3V9Z A;  3DOK A;  3I0S A;  3MEE A;  4E89 A;  3VQC A;  4O4G A;  4OPK A;  1G15 A;  3L2W A;  2HMI A;  4CCH A;  2D5R A;  2Z1I A;  1UAX A;  3AVF A;  4KTW A;  1JLE A;  3HVR A;  3PV8 A;  4DLG A;  3TR8 A;  5HRN A;  4DTS A;  1ZBF A;  1WAF A;  3CM6 A;  2XY5 A;  3PX0 A;  1ZBH A;  1RBU A;  3LWM A;  3OYD A;  5KI6 A;  2BE2 A;  5I42 A;  4FJL A;  1IKW A;  2X74 A;  2QXF A;  4H4O A;  1BIU A;  1JLB A;  3CYM A;  4AHR A;  1S1V A;  1L3T A;  2IDO A;  2RN2 A;  2B5J A;  4DTR A;  3KK2 A;  4K8X A;  4KHU A;  1KLN A;  2GV9 A;  3OYF A;  1RT2 A;  1NK6 A;  5FDL A;  3RRG A;  1X9S A;  3AVJ A;  4MQ3 A;  3ZCM A;  1Q8I A;  1WAJ A;  4CIG A;  3S3M A;  1J53 A;  1QSS A;  3B6O A;  1GOC A;  5C42 A;  4F3O A;  1YTA A;  2ZQB A;  1U48 A;  5SWM A;  3G10 A;  2OYQ A;  1C0T A;  2D0B A;  4M41 A;  3HP6 A;  4IFV A;  2W42 A;  3HO1 A;  3AVI A;  3OYC A;  4CFD A;  2E4L A;  1N5Y A;  1SL1 A;  4KAZ A;  3KK3 A;  4CES A;  3B6P A;  4CHN A;  3OYJ A;  3NGZ A;  1J5O A;  1QS4 A;  1UWB A;  1REV A;  4E7J A;  3SI6 A;  1TK0 A;  4N5S A;  1KVA A;  3O3H A;  4HUE A;  4KHN A;  4E1M A;  3G0Z A;  3HM9 A;  1TL3 A;  4NYF A;  3LPT A;  3NF9 A;  1IKV A;  1NJX A;  1C6V A;  3VQE A;  4FZX C;  2RPI A;  4AHV A;  1F21 A;  4DSJ A;  1IKX A;  1RBS A;  3AVB A;  3AVG A;  4OVL A;  1ASW A;  4ZHR A;  2XO7 A;  1NOZ A;  1QSY A;  3MAQ A;  1L5U A;  4Y1C A;  2XY8 A;  4DG1 A;  3OYA A;  3FFI A;  4ELT A;  2YNH A;  3OYN A;  3TAM A;  3F73 A;  3TAN A;  1NK4 A;  4E7I A;  3TAP A;  2PYL A;  1HRH A;  3L2R A;  3NF8 A;  4LD0 A;  4FJK A;  1Y97 A;  4FVM A;  4FLU A;  4DFJ A;  4HCC A;  4OGC A;  1RT5 A;  2GUI A;  4DTU A;  4DSI A;  1NKC A;  1TAQ A;  3RMD A;  1NK0 A;  4PQU A;  4CEF A;  3AV9 A;  3QIO A;  5HRP A;  4CEB A;  3TWH A;  3T19 A;  4OLA A;  2PY5 A;  4Y1D A;  4K8Z A;  1BQN A;  1BIS A;  4KFB A;  1FK9 A;  4JS4 A;  3HP9 A;  3DI6 A;  4HTU A;  4KHQ A;  4CEE A;  4Z4C A;  1RIL A;  4Z4I A;  3O4N A;  2Y1J A;  1HYS A;  3D45 A;  3LP0 A;  3JYT A;  4CE9 A;  1BCO A;  1EP4 A;  1D5A A;  2E6M A;  1DTT A;  1C0U A;  4DQQ A;  2DFE A;  3KD5 E;  2F96 A;  1S5J A;  1W9H A;  2WOM A;  4KV8 A;  4CEZ A;  2O4I A;  4FLW A;  1BI4 A;  1CXQ A;  1LAW A;  1NJZ A;  3VQ9 A;  3LPU A;  4AHC A;  4FJG A;  3M8Q A;  3V1O A;  2D0C A;  1IKY A;  4Q5V A;  4W5O A;  4DQI A;  3EY1 A;  3ZSQ A;  2YNG A;  3QIP A;  3ZSV A;  1RT7 A;  2ZE2 A;  1LWE A;  4HUF A;  4KB0 A;  5FRM A;  2X78 A;  1CLQ A;  4E19 A;  2RKI A;  2PYJ A;  4CJL A;  4JRP A;  1NK9 A;  2KFN A;  1GOA A;  4E1N A;  1VRU A;  3HXM A;  3QLH A;  4CJS A;  1BI4 B;  4RW6 A;  4E7K A;  1CZ9 A;  1FXX A;  3M8P A;  1KFS A;  4FK0 A;  3KLE A;  1U45 A;  4NCG A;  1SUQ A;  2YNI A;  1FKO A;  3ZSR A;  1WSE A;  3ASM A;  1KRP A;  2ITG A;  4CHQ A;  4FLX A;  1QTM A;  4FXD A;  3LWL A;  1ASU A;  3BGR A;  1D9D A;  4O55 A;  4B9V A;  4CJU A;  4TSX A;  5JS2 A;  3QNN A;  5HP1 A;  2KFZ A;  4MFB A;  1VSK A;  3P5J A;  1C1B A;  3VQA A;  3NCI A;  3HPH A;  3SZ2 A;  4LH5 A;  3KKS A;  4DSE A;  4CGG A;  1BHL A;  2ZD1 A;  3DMJ A;  4CGH A;  4DTJ A;  3SUQ A;  2F8S A;  3AO2 A;  4WE1 A;  1ZBU A;  3CFR A;  3U3Y A;  3AVH A;  4H8K A;  1JLA A;  3RRH A;  1VSL A;  1TKD A;  1ZBI A;  4B9S A;  3K5O A;  1XI1 A;  5SZT A;  1KLM A;  3RR8 A;  3TAB A;  1RBR A;  4CER A;  4NCB A;  2BDP A;  3RTV A;  3RMC A;  3OVN A;  3I0R A;  4RG8 A;  2B6A A;  2VG5 A;  2Z1H A;  4FLT A;  1RT6 A;  2I5J A;  4Z4H A;  1TK5 A;  3OS0 A;  1KTQ A;  2BGG A;  1WSJ A;  3O3G A;  1NK7 A;  5KRT A;  2Y1I A;  4KHW A;  5CZ2 A;  5K14 A;  4CJ3 A;  3OYI A;  4JRQ A;  1L3V A;  3LZJ A;  3DYA A;  3NF6 A;  3ZSO A;  1SL0 A;  3VQP A;  2OA8 A;  4J2E A;  4PUO A;  4CED A;  1UOC A;  3CFO A;  3LP2 A;  4H4M A;  4QAG A;  4DF4 A;  1RBV A;  1KVB A;  4B3O A;  4O44 A;  1S1U A;  3KLH A;  4AHT A;  4J2A A;  4I9Q A;  2YHB A;  3V6D A;  3C6U A;  3NHG A;  1JL1 A;  5EU7 A;  3HT3 A;  4M3Z A;  1EX4 A;  4CHO A;  2DY4 A;  1C1A A;  1A5X A;  4GW6 A;  4CK2 A;  3QEV A;  4B9U A;  4FJN A;  4DSF A;  3C94 A;  4CEQ A;  3MXI A;  4F8R A;  3DLG A;  4CEA A;  4UQG A;  1BQM A;  3OYG A;  2KTQ A;  3K57 A;  2WON A;  1TKT A;  3F9K A;  1DLO A;  1RT3 A;  2DTU A;  1XWL A;  1U04 A;  4FLV A;  3CM5 A;  4OJR A;  5KGW A;  4CGF A;  4KI4 A;  4Q0B A;  4KO0 A;  3MEC A;  1D9F A;  3PO4 A;  5JS1 A;  3DLE A;  4C8K A;  4DS4 A;  4KRF A;  4F2S A;  4CF2 A;  1S6Q A;  3OYB A;  2VG6 A;  2G8V A;  3BDP A;  3SUP A;  2D0A A;  3DLK A;  4CF1 A;  4CFB A;  4BE2 A;  1X9W A;  3ULD A;  3HPO A;  1WSG A;  1NKB A;  2R7Y A;  3IG1 A;  1NK5 A;  3ZT3 A;  4DSK A;  3NDK A;  3NH1 A;  4B9L A;  1HNI A;  3AVL A;  4FK2 A;  3M8S A;  4AH9 A;  4DFK A;  4EZ6 A;  4CF0 A;  4FM2 A;  4CIF A;  4C8N A;  2JLE A;  4CJR A;  4E3S A;  2XY7 A;  1RDC A;  4IDK A;  3CG7 A;  4LY7 A;  3ZSY A;  3TAE A;  2HNY A;  3SPZ A;  2AJQ A;  1L3S A;  4DSL A;  4OPJ A;  3OJS A;  4B8C A;  1BL3 A;  1RCH A;  1S1X A;  3C95 A;  3KKR A;  3NH0 A;  4HHT A;  4DTN A;  4E7H A;  4ZTJ A;  4I7F A;  4KHS A;  1WSH A;  4IKF A;  3VN5 A;  4GVM A;  3AVM A;  1RTD A;  3ZT0 A;  2RF2 A;  3V81 A;  2FBT A;  3AO5 A;  3SQ4 A;  3L2V A;  2G8H A;  4FLZ A;  4E7L A;  4CGI A;  4AIL C;  1BIZ A;  1U4B A;  4OGE A;  2IC3 A;  4FJ8 A;  4FM0 A;  3E01 A;  1S9G A;  3LAK A;  1TV6 A;  4CHZ A;  1EXQ A;  1SL2 A;  1LWF A;  4CJ5 A;  4BWJ A;  3HJF A;  3IRX A;  4NCA A;  3TAR A;  5C25 A;  4FLY A;  4BAC A;  4FJ7 A;  3QEI A;  3OJU A;  4DU4 A;  1D8Y A;  3VQ4 A;  2NUB A;  1LWC A;  5FRO A;  4FJH A;  3S9H A;  3ZSZ A;  1HPZ A;  4YFU A;  2VWJ A;  4N41 A;  3HST B;  3NGY A;  3DRP A;  1HQU A;  3AA4 A;  1KVC A;  4I2P A;  1JL2 A;  4CF8 A;  1LW2 A;  3OY9 A;  2OZM A;  1RT4 A;  3OYL A;  4LSN A;  3EYZ A;  3KLF A;  4O5B A;  1TK8 A;  5T7B A;  4W5Q A;  2KW4 A;  4IG3 A;  3PX6 A;  4Z4G A;  4C8O A;  4CHY A;  1Z25 A;  1B92 A;  3C6T A;  1IO2 A;  1L3U A;  4Z4F A;  3RR7 A;  4EP4 A;  1JKH A;  4CGD A;  5E41 A;  4FZY A;  1VSD A;  4DQS A;  1TVR A;  1QQC A;  3V4I A;  2G8I A;  5DMR A;  2IOC A;  3LAN A;  2HND A;  2Q3S A;  2HHT A;  1WN7 A;  3PX4 A;  1RT1 A;  3AA3 A;  3WNG A;  3V9S A;  3PO5 A;  3MXM A;  3O4Q A;  1U49 A;  2GBZ A;  2G8K A;  4ELV A;  1RBT A;  2HHV A;  4Z0U A;  1B9F A;  5HRS A;  4M3X A;  3I8D A;  3UIQ A;  5C24 A;  1HJR A;  5KTQ A;  3QNO A;  2QKB A;  4W5T A;  3DRR A;  3QO9 A;  3AVC A;  3LP3 A;  1S6P A;  3QIN A;  3LZI A;  2OPR A;  3VQ5 A;  1ZYQ A;  4CHP A;  3ZT2 A;  2O4G A;  4ID5 A;  3VQ8 A;  1W0H A;  4CFC A;  1N6Q A;  2JGU A;  4C8L A;  1JLC A;  3OS2 A;  4Z4E A;  1QHT A;  3QER A;  1X9M A;  1VSF A;  4W5R A;  4J2B A;  3SPY A;  4O0I A;  3T1A A;  4ZTF A;  4EP5 A;  3K5N A;  4E0D A;  4DLE A;  4DS5 A;  3NF7 A;  1NOY A;  4BE0 A;  2E6L A;  3OYE A;  4FZZ A;  1S9E A;  3QEP A;  4KRE A;  3DLR A;  3U6F A;  4JS5 A;  1RDB A;  1EET A;  3SNN A;  3SQ1 A;  3HYF A;  4M3T A;  3PY8 A;  4M3W A;  2XRI A;  4KKO A;  2FBX A;  1HMV A;  1TKZ A;  3OS1 A;  4FJX A;  3HPG A;  4C8M A;  3LDS A;  3A2F A;  3WNE A;  1LAV A;  4FW1 A;  2HHQ A;  2YHA A;  4KB1 A;  2HW3 A;  2OPP A;  4CEO A;  1RDD A;  3SCX A;  2QKK A;  3SV4 A;  3OYH A;  3SQ0 A;  3THV A;  2VWK A;  3AA2 A;  3IS9 A;  3K5L A;  3SYZ A;  5J2N A;  1ZBL A;  2G8F A;  3ITH A;  1VSJ A;  2HHS A;  4OLB A;  2HNZ A;  5CY4 A;  1T7P A;  5J2P A;  4CEC A;  4DU3 A;  3DLB A;  4FJM A;  1HQE A;  2Z1G A;  4HCB A;  3TAQ A;  2F8T A;  2HHW A;  3ALY A;  3L2Q A;  3L3V A;  4N47 A;  1LV5 A;  3KJV A;  1O1W A;  1EKE A;  3L2U A;  5J1E A;  1HYZ A;  1NK8 A;  4M3R A;  3K59 A;  2HVH A;  1TKX A;  1QSL A;  1Z26 A;  3DRS A;  4IFY A;  3QEX A;  4I2Q A;  4KI6 A;  4M45 A;  4CJ4 A;  3K58 A;  1SKR A;  3DM2 A;  3TAF A;  1X1P A;  4ID1 A;  5DK5 A;  1MU2 A;  3K5M A;  4GMJ B;  4L8R B;  1JLQ A;  1UA0 A;  3TAG A;  1J54 A;  3VQQ A;  3L8B A;  4NYN A;  5HRO A;  4KTQ A;  2P5O A;  3LAM A;  4G1Q A;  3SUN A;  1XC9 A;  4FK4 A;  4DQR A;  4F3T A;  4CJF A;  2HHU A;  1I3A A;  1BCM A;  3NAE A;  4F2R A;  1RTH A;  3ISN C;  4FW2 A;  3SJJ A;  3T3F A;  1SKS A;  1JXB A;  3MED A;  2IS3 A;  4O0J A;  1DTQ A;  4F4K A;  1HYV A;  1ASV A;  3SUO A;  1KFD A;  3VQ6 A;  3D0P A;  2X6S A;  2QK9 A;  1FKP A;  1VSM A;  3IAY A;  4AHS A;  5J2M A;  1CZB A;  4DFP A;  4RW8 A;  2FBY A;  3VQD A;  2FC0 A;  1GOB A;  3P1G A;  3ZSX A;  2HHX A;  5HLF A;  4B8A B;  3V1Q A;  2A1R A;  5J2Q A;  1QE1 A;  1SV5 A;  3V1R A;  4FM1 A;  4N76 A;  3KIO A;  2YV0 X;  1RTI A;  2ETJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...