4CK2A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
154
structure length
150
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 56
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ck2A00
1TAUA 1TKZA 2EHGA 1ASVA 4DU4A 3RMDA 3NF7A 4CECA 4OKJA 4DG1A 1DTQA 3TAPA 4KB0A 3DOLA 3OYIA 3SNNA 4FW1A 3SUQA 3PO5A 2OYQA 3SUPA 3LP1A 1NJYA 3OYAA 2HHWA 3DRPA 3M8SA 3TARA 3VQAA 4Q5VA 2YHBA 1WSIA 4RW8A 3VQBA 1C1CA 2OPRA 4NYNA 4O55A 3K5NA 1HPZA 4I9LA 3K58A 3K5LA 3F73A 1K6YA 5J2MA 1NKEA 1L3TA 1L3VA 4C8KA 3ZSQA 3QEVA 4M42A 1VRTA 3B6PA 1GOBA 1A5WA 5HBMA 4Z4HA 4CFBA 3WNFA 4DFMA 4E1NA 3OYNA 2WONA 4CGHA 3AO1A 3OJSA 4FLZA 1X1PA 3KLIA 3EZ5A 3TABA 2PY5A 1KLNA 4K8XA 2VG6A 5SZTA 1C1AA 2B6AA 5HRSA 1U47A 4CEQA 3ALYA 3KKSA 3AVFA 4DSKA 1BI4A 2QXFA 2E4LA 2Y1JA 4QAGA 3AA2A 1Z26A 3UIQA 4CJRA 4BE0A 4B9MA 2JGUA 1I39A 3AVKA 3VA0A 3DRRA 4PQUA 4M3YA 1TK0A 4CJTA 1IG9A 3OYHA 4OKKA 2GUIA 4B9UA 2XO7A 4M45A 2YNGA 4KAZA 3L2WA 3CG7A 1QSLA 2I5JA 1TKDA 4CCHA 2RF2A 1RDBA 4HCBA 3RWUA 3DYAA 3OVNA 2XY6A 1UA1A 3HYFA 1D9FA 5E41A 3LWLA 4KI4A 3QNOA 2D5RA 4DTJA 3D0PA 2OZMA 3F9KA 4J2AA 3ZSOA 3OYLA 3WNGA 3QEXA 3SPZA 1LW0A 4FJ9A 1KVBA 3L2VA 1T05A 4DLEA 2HNDA 1SV5A 2GV9A 2AJQA 3S3NA 3ZSXA 1UWBA 3HT3A 1RBSA 4AHUA 4FJKA 4FVMA 3QEIA 2P1JA 1S1WA 1Y97A 2KZZA 1WN7A 3V1QA 1SKRA 1YVUA 3HPHA 4AHRA 4J2EA 3AA4A 4AHCA 4N41A 1FKPA 1IH7A 3RMCA 2XHBA 3KD1E 4DTNA 3NCIA 4OPKA 1KRPA 2IGIA 4FJMA 4DTXA 3LP2A 4LSLA 3AVMA 3O3HA 3KK2A 3OYJA 3OJUA 4FK0A 4FJGA 4CGFA 4KPYA 3HJFA 4R5PA 4GMJB 3T1AA 4DF4A 1XI1A 3TAQA 1NOYA 1ZBHA 4M41A 4IKFA 1Q8IA 5J2QA 3VQPA 3P83D 2IAJA 3QERA 4E7HA 1N6QA 1BIUA 5FDLA 4QCLA 5CZ1A 3RR7A 3OYBA 4FM0A 2YNIA 4FLVA 1JL2A 1MU2A 2E6MA 1BQMA 2DFFA 3IG1A 3IS9A 5CYMA 4CJEA 3HPOA 3HVRA 1RNHA 4CJ3A 1JLCA 4OKEA 2ITGA 3AO5A 4K8ZA 2VG5A 3AA3A 1TKXA 3SQ2A 1X9SA 3VQCA 4OLAA 2QKKA 4HUEA 4Z4FA 4BE2A 1HRHA 1J53A 1WAFA 4E1MA 2B5JA 1VSMA 2Z1GA 4CJ5A 3HXMA 4Z4EA 3TI0A 3DLHA 4Y1DA 4NCBA 4FW2A 4C8NA 1ZBLA 4BDZA 3LAMA 1QHTA 2VG7A 3OYDA 4NCGA 2GBZA 1CXUA 2BANA 5C25A 5SWMA 3LDSA 1R0AA 4FXDA 2YKNA 3KIOA 3THVA 1SKWA 3AO2A 3KKRA 1SKSA 3V9SA 2QKBA 4KB1A 4J2BA 3ZSRA 3OY9A 3K57A 1B9DA 3VQ9A 3QESA 2G8HA 3LZIA 2FBTA 1NJZA 1LWFA 1EKEA 1O1WA 3TAGA 3O3FA 4DQPA 4WE1A 2RN2A 3CM5A 1B92A 3NHGA 2G8VA 4HCCA 1U04A 2D0BA 3OYGA 3M8PA 3WNEA 2DFHA 2BDPA 4CF9A 4N47A 3RRGA 2G8UA 5KRTA 1LW2A 4KV8A 1JXBA 3MEEA 4CEOA 5DK5A 4PUOA 3O3GA 4B9NA 3KLFA 3LPTA 3V1OA 1WNSA 2IDOA 4CGJA 4BDYA 1TK8A 3ISNC 4EZ9A 3E01A 1RT7A 3HPGA 1QS4A 4CF0A 5D3GA 4J2DA 3NF9A 3K2PA 4JLHA 3G0ZA 3MXJA 3RMBA 4MFBA 1X9WA 3ZT3A 4F3TA 4BACA 3BDPA 5CY4A 5CZ2A 4F3OA 3SI6A 1TL1A 3VQ7A 3AVGA 1FKOA 3SUOA 2VWJA 2OPQA 4GW6A 1VSHA 4B9LA 4KO0A 3SQ4A 1KVAA 2VWKA 4CEZA 1QE1A 3AVJA 3CYMA 4BE1A 3RMAA 4FZZA 4OJRA 5CYQA 1NK8A 1RT2A 1YTAA 3LWMA 3O4QA 3V9UA 4W5QA 3AO4A 4H4OA 4RW6A 4W5TA 1UAXA 3ZSVA 1C1BA 3QEPA 1VSEA 4I2QA 4B08A 1NKBA 1HJRA 1RBRA 3DRSA 1RTIA 3HL8A 3DLEA 4GVMA 4M3RA 1S1VA 2OA8A 4F2SA 1U45A 1LAVA 1VRUA 4QOZB 2HB5A 1J54A 4MQ3A 3VQ5A 3DMJA 4KTZA 4CIGA 1L3SA 4FM1A 3V81A 3SQ1A 1S1UA 4CF8A 1HQUA 4FZXC 4O0JA 1GOAA 2F96A 1C6VA 1KTQA 3ZT4A 3TANA 4CIFA 1TK5A 1C0MA 4B9SA 4CERA 4CHNA 3QEWA 3DM2A 4JRPA 3C94A 4Z4GA 5T7BA 2NUBA 4N76A 4ZTFA 3HK2A 1S1XA 1NK5A 3SPYA 1JLGA 4DU1A 4JRQA 4E89A 3DLGA 2FBXA 4E19A 4ELVA 1HMVA 1RILA 3L3VA 3ZSZA 3C6UA 5HRNA 1CLQA 1KSPA 3ZSWA 4OVLA 1BHLA 1LWEA 2XY5A 4CJWA 1SL0A 1QTMA 3AVHA 4OLBA 4EP4A 4ZHRA 4N56A 3EYZA 3TWHA 1JLQA 3SCXA 5HLFA 4HUGA 1TL3A 5C42A 3NE6A 3MAQA 4DTMA 2D0CA 3NH0A 1RTJA 2ETJA 4CEBA 2G8FA 1S6PA 4DTOA 4W5OA 2FBVA 1XHZA 4OPJA 3MEGA 4M3TA 3NH1A 1BISA 1RTDA 1WSJA 1NK4A 3V9WA 4CF1A 3KJVA 2P5OA 4EZ6A 4FJIA 3NBPA 4KFBA 1JLBA 4DSFA 1CZ9A 4DS5A 4H8KA 4DFKA 4DTUA 3WNHA 1CXQA 4CJSA 3AVNA 3AVBA 5KRSA 3I8DA 4M3WA 1HQEA 2Q3SA 2HMIA 1WSFA 1A5VA 1U48A 3HO1A 2KTQA 4FK4A 3CQ8A 4B8AB 1JKHA 1RBUA 4F8RA 4LH5A 4O4GA 1J9AA 3U3YA 3TAEA 4B9VA 1B9FA 1XWLA 3NGZA 5J2PA 4FK2A 1QSSA 2X6NA 1JXEA 1IO2A 4NCAA 3DOKA 2HNZA 1XHXA 2OPPA 4FLYA 1U49A 4Z4IA 4Q0BA 4DFPA 4CJPA 4CGGA 3CFRA 5KGXA 4KREA 3TAFA 3QIPA 4IDKA 1ZBIA 2HHXA 4RW7A 4JS5A 3O4NA 5KTQA 1S6QA 3ASMA 4O0IA 4DQQA 3MXIA 4KHQA 4AHVA 3SJJA 5FROA 3V9XA 1I3AA 3HP9A 1LWCA 4B8CA 4DSJA 3EY1A 1HNVA 1KCFA 4IG3A 4KHUA 2IOCA 3NDKA 1S9EA 2HNYA 3MXMA 3C95A 2ZE2A 1TAQA 4B3OA 1G15A 3M8RA 3U6FA 1REVA 3C6TA 1LV5A 2FBYA 4CEDA 4HVJA 4HHTA 4CK2A 1QSYA 2Z1IA 3M8QA 3VQ8A 2PYJA 1F21A 1JL1A 3MEDA 3OS1A 2G8WA 2HHVA 4CK1A 3NF8A 2P5GA 4CEFA 1ITGA 5HRPA 1WSHA 1WSGA 3S3MA 4FZYA 1Q9YA 4RW9A 1KLMA 5J1EA 1C0UA 4CIEA 4UQGA 1T8EA 1S9GA 2YNFA 3LAKA 4E7IA 4M3XA 4CEAA 3I0RA 1YT3A 3SUNA 1KFDA 4O5BA 1ASWA 1BCOA 4DTSA 1WAJA 3T3FA 1HYVA 1RDAA 3PV8A 1L3UA 4DU3A 1X9MA 4CHOA 4KHSA 2KFZA 1Z25A 2P51A 4ID1A 3QLHA 3OS2A 3L2QA 1BL3A 1VSIA 4CJKA 1HNIA 2BE2A 2F8TA 1WLJA 3KLGA 4FJ5A 2A1SA 3VA3A 5J2NA 3I0SA 3HM9A 3AA5X 2KQ2A 2RKIA 3S3OA 2D0AA 3VN5A 1NJWA 3RR8A 2X74A 3OYFA 3OYMA 1U4BA 1HYZA 4ID5A 4ELTA 3AV9A 4CHQA 2A1RA 1UA0A 3NH2A 5HP1A 1IKXA 4DQRA 1KVCA 1EX4A 1TVRA 4DQSA 4B9TA 4AHSA 2BGGA 4CJVA 3K5OA 1JLAA 1D8YA 1UOCA 2ATQA 3T19A 2Z1HA 2QK9A 4ICLA 2Z1JA 1QQCA 3SV4A 1VK0A 4ZTJA 1L5UA 2HVHA 1BI4B 4CJQA 4XIUA 1C0TA 2DFEA 1BQNA 3LP3A 4FCYA 1NOZA 4BDPA 4PA1A 3ZT0A 2HHUA 4KRFA 1D9DA 4KHWA 3NGIA 4N5SA 5KI6A 2R7YA 3A2FA 3ITHA 1SL1A 1YTUA 3DLKA 2KFNA 3HP6A 4PY5A 1N5YA 4FLUA 3V9ZA 2B4JA 3DLRA 4KTWA 4E0DA 3TAMA 4C8MA 1W0HA 3SYZA 3U3GA 3L3UA 1T03A 3KK3A 3KLHA 4CJUA 3RRHA 3LPUA 4LSNA 2ZD1A 4E3SA 2W42A 3H08A 4I7FA 3VQ4A 3ZCMA 4AH9A 2XRIA 4CFAA 2IC3A 3AVCA 1IKVA 3PX0A 1BGXT 1WSEA 3NGYA 4OGEA 2IS3A 4L8RB 2HW3A 1IKYA 2KZMA 1TV6A 4CE9A 2RPIA 3OYKA 3KLEA 3NAEA 3RTVA 4NYFA 4E7LA 2E6LA 3KK1A 5DMRA 3VQEA 1W9HA 3ULDA 4FJXA 4DSLA 3QINA 1FK9A 4AILC 1VSJA 4FJLA 3S9HA 3SZ2A 3PO4A 4RW4A 3V6DA 3IAYA 4M3ZA 1TGOA 3PX4A 3AVLA 3V1RA 4FM2A 4I9QA 2OPSA 1EXQA 4DF8A 1S5JA 2X78A 5JS2A 4O44A 4JS4A 3ZSYA 3LZJA 2PZSA 3B6OA 3L2RA 4LD0A 4DTRA 4IFVA 4CHYA 3KTQA 3JYTA 5KGWA 1EP4A 4CFDA 4DTPA 3JSMA 1GOCA 4C8LA 4KI6A 4KKOA 4FLTA 2HVIA 4F2RA 3HVTA 5C24A 1VSDA 3SQ0A 1RT4A 4DLGA 1FXXA 2JLEA 5FRNA 1DLOA 4HUFA 3AVIA 4BWJA 3V4IA 4CF2A 3CFPA 1RDCA 4IG0A 4LH4A 4CGIA 4YNQA 1Q9XA 1SL2A 1DTTA 3PUFA 5HROA 3ZT2A 5I3UA 4FJ7A 1VSFA 3KD5E 3MECA 3VQQA 1RCHA 4IBNA 3P5JA 4ELUA 1HYSA 1RBTA 2G8IA 3K5MA 3P1GA 3ZT1A 2PYLA 2DY4A 1A5XA 2YV0X 3DI6A 3NFAA 4CJ4A 1NKCA 3PY8A 5JS1A 4CEEA 3D45A 3L2UA 4E7KA 1SUQA 3G10A 3LANA 3OYCA 1KFSA 1NK7A 1S1TA 1IKWA 4RG8A 3K59A 4Y1CA 4HTUA 2FC0A 3SV3A 1RDDA 2YKMA 4KTQA 4H4MA 4TSXA 2WOMA 1NJXA 4DS4A 3DLBA 4KHYA 1RBVA 1ASUA 1RT1A 4FJNA 5I42A 1ZBFA 3OS0A 2EX3A 1TKTA 1VSLA 4CESA 4DSIA 1RT5A 4CJLA 1ZYQA 4FJHA 4CJFA 3TR8A 3NF6A 4CK3A 1D5AA 1RT3A 4DSEA 4DMNA 3HSTB 5HRRA 4FJ8A 4CGDA 2X6SA 3AO3A 3LP0A 4OGCA 4CFCA 1NK6A 2HHQA 4CHZA 4W5NA 1RT6A 4Z4CA 2Y1IA 2DTUA 2O4GA 4LY7A 2OZSA 3QETA 2YNHA 3CFOA 1BIZA 4CHPA 2HHSA 3QO9A 1CZBA 5K14A 4M3UA 2G8KA 4F4KA 4FLXA 2O4IA 5FRMA 2ZQBA 3L8BA 4E7JA 2XY8A 1J5OA 4YFUA 3QNNA 3CM6A 4W5RA 2XY7A 4I2PA 3FFIA 1JLFA 2KW4A 4Z0UA 1T7PA 1NK0A 2F8SA 3VQDA 2HHTA 1RTHA 5EU7A 4AHTA 3PX6A 4C8OA 2YHAA 1LAWA 3LALA 4KHNA 1JLEA 3OYEA 4G1QA 4DFJA 3QIOA 1EETA 3AVAA 4BWMA 1ZBUA 4FYDA 1BCMA 3BGRA 3IRXA 4FLWA 4DQIA 4FJJA 4PWDA 1VSKA 1NK9A 4EP5A 3VQ6A 4DWIA 2LSNA 4IFYA 1XC9A
chains in the Genus database with same CATH superfamily
1TKZA 3SBTA 2WTUA 1DTQA 3TAPA 3VESA 3OYIA 3CCMN 1N32K 1GLLO 2OYQA 3SUPA 1NJYA 3OYAA 2DPNA 2HHWA 5LJVA 3DRPA 5GADP 4JHDB 2YHBA 4U7BA 4BR4A 5E84A 1KAXA 5AFUA 5C2DA 1HPZA 1L3TA 3F73A 2HW3A 5BRDA 1VRTA 3MN5A 4XH4A 1IBMK 2WONA 3AO1A 3OJSA 3EO3A 2PY5A 2B6AA 1U47A 5AQYA 3ALYA 1BI4A 4FVUA 4BE0A 4B9MA 3CXCM 1I39A 4EHTA 4M3YA 4CJTA 5BPNA 4NLBA 4H0PA 3DJCA 1UA1A 3OVNA 3LWLA 3WXMB 4KI4A 3QNOA 2D5RA 1YHQN 4J2AA 2KKZA 3WNGA 1LW0A 1KVBA 2Q1NA 1SV5A 2GV9A 1UWBA 3THXB 3RSEA 2P1JA 1WN7A 3V1QA 1QQMA 4AHRA 4X65K 4N41A 1NGEA 1IH7A 2HF3A 2QWQA 2IGIA 4DTXA 3LP2A 3AVMA 3O3HA 3KK2A 3OJUA 4CGFA 5BRFA 3HJFA 4JKFA 1NOYA 3TAQA 4M41A 4EHUA 3DXKB 4YDUC 4IKFA 3QERA 4E7HA 3VERA 1HLUA 4FM0A 2J4RA 5AQOA 1JL2A 3IG1A 3U9DA 1RNHA 2E88A 4IJAA 4HTLA 3AO5A 3IUCA 5AQGA 3HBTA 1X9SA 2QKKA 4IO8A 4Z4FA 2E20A 4E1MA 2B5JA 2P9PA 3H3NO 3HXMA 3CI5A 4Z4EA 2ASMA 1N34K 1HKCA 2YI1A 4LFCK 2I7PA 2GBZA 3LDSA 5SWMA 2IVNA 5HL7L 1R0AA 4H03B 5KPTA 3A5OC 3AO2A 3L0QA 5TKYA 3AGKA 4J2BA 1B9DA 2FBTA 1O1WA 3CM5A 4HCCA 3WNEA 3CCLN 3R1XA 3RRGA 5KRTA 4IOAL 3MEEA 2P9IA 1OKJA 3KLFA 3LPTA 3O1BA 1WNSA 4BDYA 3QBXA 1RT7A 2GWKA 4J2DA 3K2PA 3FZLA 4YY3K 4JLHA 3H1VX 3ZT3A 2CH6A 1TUUA 3MX5A 5AJ3K 1TL1A 4WCEL 1FKOA 2VWJA 1RGIA 4KO0A 2VWKA 1QE1A 4BE1A 3N4QA 1KAYA 1UAXA 3QEPA 3FGUA 4I2QA 4B08A 1NKBA 1HJRA 4GVMA 1RTIA 2A42A 4F2SA 1LAVA 1VRUA 1XUPO 2HB5A 1J54A 4FZXC 4O0JA 4GV9A 3ZT4A 3CC7N 1TK5A 4CIFA 3THYA 2QWMA 1VQ8N 1KQSM 1X3NA 4E89A 4H5VA 1ZC6A 1KXPA 3ZSZA 3C6UA 1CLQA 1KSPA 3ZSWA 1BHLA 1VQKN 4EP4A 4ZHRA 4N56A 3TWHA 3CC2N 2ZJPL 4HUGA 1TL3A 4G9ZA 3MAQA 4DTMA 5AQSA 3NH0A 2ETJA 4CEBA 5AQFA 4W5OA 4OPJA 1BISA 1NMDA 3FZFA 3NBPA 2Q0RA 4DS5A 3PLAA 4DTUA 3ZETA 1CXQA 3ENOA 3I8DA 4YOVA 3THXA 1HQEA 3BEXA 1I94K 3HO1A 1IV0A 2UYTA 5EX5A 4LH5A 1XC3A 4O4GA 3TAEA 1B9FA 2Q0UA 3P31A 3RSEB 4BRIA 2HF4A 4YOYA 4KH6A 4LF8K 4CJPA 3CFRA 5KGXA 4KREA 3TAFA 4H0OA 1Z05A 1GLCG 3O4NA 1S6QA 5KTQA 4KHQA 1KCFA 3CIPA 3EN9A 3DXKA 3VEVA 3WQUA 2FBYA 3CERA 4CK2A 3VQ8A 2Z1IA 3MWTA 2PYJA 3NF8A 1NU0A 4A5BA 4DR4K 3S3MA 1WSGA 1V4TA 1T8EA 4CZHA 4GV6A 2WBNA 2QI2A 3WQTA 3SUNA 1KFDA 2UXCK 3HZ6A 3T3FA 1WAJA 4C1NI 3O1WA 1L3UA 1X9MA 3A5MC 4FL9A 2O8DA 3O6WA 3OS2A 3SJHA 4O5FA 1OH7A 1GLAG 3FZKA 2BE2A 2F8TA 3KLGA 4FJ5A 2A1SA 2W41A 4BG9A 3G4SN 3HM9A 1NJWA 3ZEUA 3AV9A 3J81O 1NGJA 4JI0K 4KH4A 5HP1A 5JLHA 4BRMA 4BC3A 4DQSA 2OANA 1UOCA 4JKDA 3HRGA 3SV4A 1BI4B 2DFEA 5A2QO 2HHUA 1Q86O 3HSCA 1D9DA 3BF3A 4DR1K 1YAGA 3B8AX 4CZEA 2JWLA 4C8MA 3SYZA 3U3GA 3L3UA 3RRHA 3LPUA 3H08A 4I7FA 4JKHA 2XRIA 4CBWA 3KLEA 4CE9A 4NYFA 2VCPA 4H5NA 3ULDA 1NGDA 4FJLA 3IAYA 4M3ZA 4JAXA 1TGOA 3V1RA 4FM2A 4IZ9A 1EXQA 4DF8A 1S5JA 4DR7K 2X78A 4JS4A 3R9PA 3TTFA 5C12A 4DTRA 4IFVA 2FXUA 1EP4A 1IBLK 4CFDA 3JSMA 4A2BA 3UKRA 4FLTA 4F2RA 5C24A 2O8FB 4PHTX 1Y64A 1DLOA 4HUFA 3AVIA 1KC8O 3V4IA 4CF2A 3CFPA 5LMUK 4LH4A 4CGIA 4JKGA 5HROA 3KD5E 3J7ZO 3MCPA 3K5MA 3ZT1A 2PYLA 1A5XA 2QW9A 2YV0X 1NKCA 5JS1A 1XNQK 4E7KA 2PAVA 3LANA 2AA4A 1KFSA 4CD3A 4RG8A 4Y1CA 4HTUA 4H4MA 1NJXA 4UY8O 4KHYA 1ASUA 1ZBFA 3SMSA 1RT5A 1ZYQA 4DSEA 2GELA 3HSTB 5HRRA 3LP0A 1MDUB 1NK6A 5EY4A 1NLVA 3LDLA 4FPBA 1RT6A 4CHZA 2O4GA 4KH5A 2H3GX 4M3UA 5K14A 2G8KA 5FRMA 2XY8A 1J5OA 3G6EN 2GX9A 3VQDA 5EU7A 4NB4A 1LOTB 4AHTA 3CPEA 4MDBA 4C8OA 3L4IA 3D2EA 4BR2A 3HM8A 4G1QA 4H5TA 4ISEA 3AVAA 5AQTA 4FJJA 4FLWA 3KVGA 5H1SQ 4OO1J 1VSKA 1NK9A 2OTJN 4DV6K 1TAUA 1ASVA 3J80O 1JCFA 3NF7A 4DUYK 1HR0K 4DV1K 3SNNA 1S22A 3SUQA 1IJJA 2IVOA 2NRZA 3LP1A 3MK6A 4FWMA 3CCSN 3VQAA 3P4IA 4PKHA 4Q5VA 3PSIA 4A61A 1VQ5N 2NRRA 1YJ9N 2OPRA 5AZIA 3K5LA 3C0BA 3TPQA 1O13A 5HBMA 2YHYA 4DFMA 4E1NA 2FLOA 4FLZA 4JK8A 1X1PA 3KLIA 3EZ5A 3TABA 1KLNA 3TSQA 4BRLA 3AVFA 4DSKA 2E4LA 2Y1JA 3M3ZA 1Z26A 5BN9A 3VEXA 4PQUA 4FOIA 1IG9A 2YNGA 4KAZA 3L2WA 2BUPA 4HCBA 3RWUA 2A40A 2FSJA 3DYAA 2XY6A 5E41A 4DTJA 3GL1A 3F9KA 3OYLA 3QEXA 3ATVA 4AF1A 4DLEA 2HNDA 1T44A 4F9OA 3HT3A 2NZTA 4FJKA 4LF7K 1S1WA 5AQLA 4NXNK 4EIAA 1NGBA 3KD1E 4DTNA 1IG8A 4OPKA 1P90A 4LSLA 1C0FA 3LDQA 4GMJB 3GE1A 3P83D 5DM7L 1N6QA 3QMLA 4QCLA 5CZ1A 3RR7A 3C7NA 1BA0A 2WC9A 2YNIA 2GWJA 3IS9A 4CJ3A 4DB3A 5CHIA 4OKEA 4K8ZA 5AQUA 1ZBSA 3SQ2A 1GLFO 4HUEA 2W6KA 4H0TB 1HRHA 1J53A 2O8CB 1VSMA 3TI0A 3DLHA 2FF3B 4C8NA 3CMAN 4B3RK 1CXUA 5C25A 3J8AA 3DLLL 2YKNA 3KIOA 4XH1A 3THVA 1SKWA 4B1VA 3KKRA 1HNZK 2P9LB 3VENA 3K57A 3OY9A 3QESA 3VQ9A 4KB1A 3LZIA 3CCQN 1LWFA 3O3FA 2G8VA 2F9TA 3D2FB 3MX2A 4CF9A 2HBKA 4H5WA 2IIRA 4LF6K 1JXBA 4CEOA 2GEMA 4CZGA 3O3GA 4BR5A 2IDOA 4CGJA 3KZBA 5AZIB 5D3GA 1GLJO 3RMBA 5ADXH 4F3TA 3VGLA 5CY4A 5CZ2A 4F3OA 1C0GA 3A5LC 3SUOA 3R3LA 5AQWA 2GTDA 4H0VB 3EL2A 3RMAA 4CEZA 3CYMA 5C0YA 4FZZA 1NK8A 1RT2A 1YTAA 3O4QA 2UXDK 3VF4A 3W0LA 1DKGD 3CJBA 4H4OA 4RW6A 4W5TA 1C1BA 2YHWA 4B9UA 3VPZA 1RBRA 3HL8A 4M3RA 2OA8A 1U45A 1YIJN 4DR6K 4BQZA 4M7XA 1DT9A 3SLCA 3DMJA 3FR0A 1L3SA 3SQ1A 1S1UA 4CF8A 2F96A 3MMVA 3ZYYX 5BREA 3C94A 5F0XA 4ZTFA 3HK2A 4JNEA 4EAHD 2OCEA 4DU1A 3SAHA 3L4QA 1NMNA 3OTOK 5HRNA 4OVLA 3MN9A 2XY5A 4CJWA 2VGMA 3N4PA 3Q7BA 5I9EB 1IBKK 5C42A 4DUZK 3MDQA 3BY5A 3BUZB 4DTOA 2PBDA 4CZKA 3MEGA 3ATUA 3NH1A 4M3TA 1WSJA 3V9WA 1NGCA 3KJVA 2P5OA 4FJIA 1W7AA 1W97L 2NLXA 1JLBA 4CBUA 1BDGA 3AVNA 3IDHA 1ATSA 2HMIA 1MWKA 3ID8A 2KTQA 5FPNA 3PSFA 4B8AB 1VQNN 1GLDG 4F8RA 3TTCA 2CH5A 2E2PA 3U3YA 1NGHA 1XWLA 1EWQA 5FPEA 1QVGM 2HNZA 4FLYA 3LDOA 5FPDA 4CGGA 4O8KA 1NWKA 2ZM6K 1ZBIA 3I8BA 2HHXA 4JS5A 4IEEA 4CZMA 4IO9L 3UKUB 4FSVA 1LWCA 2YCHA 4B8CA 3EY1A 4KHUA 4IG3A 1YVNA 2ZE2A 4CJ7A 3O8MA 5HOOA 1REVA 2HBJA 1LV5A 4CEDA 4HHTA 1J5EK 1XNRK 1TYQB 2I7NA 5B8HA 2P5GA 5GIPA 1BG3A 4OPAA 2UUCK 5HRPA 1WSHA 1Q9YA 1C0UA 2YNFA 4E7IA 4CEAA 4QS8A 4O5BA 3PIPL 1BCOA 4DTSA 1HYVA 4CHOA 3KWIA 3QICA 4ID1A 3WUHA 4CJKA 1HNIA 4IDHA 3I56N 4DQ8A 4MLHA 4OX9K 2KQ2A 2RKIA 3S3OA 2X74A 3OBYA 1HYZA 4ELTA 4LFBK 3K9JA 3NH2A 1IKXA 2QXLA 4KBOA 1TVRA 2BGGA 4AHSA 4CJVA 1JLAA 1T3VA 2Z1HA 2Z1JA 1L5UA 4BDPA 1NOZA 4LC9B 4PA1A 3ZT0A 4BR0A 4KRFA 1SQKA 3NMUA 4IXCA 1EQYA 1YTUA 2P9UA 4B1UB 2ITMA 4BRFA 3HP6A 4PY5A 1WBBA 1N5YA 3V9ZA 3DLRA 4KTWA 3ZX3A 1CZAN 3R8EA 3KLHA 4LSNA 4E1JA 1K8AO 4AH9A 2IC3A 3GG4A 1BGXT 4OGEA 3AAPA 4L8RB 3VTHA 1IKYA 2KZMA 1TV6A 2RPIA 3NAEA 4DV0K 3RTVA 4E7LA 4FJXA 3SZ2A 1W2BM 1ATRA 4O44A 3ZSYA 4CBXA 5JVGL 2PZSA 4LD0A 3Q7CA 1Z6RA 5EXWA 4AQYK 1VQON 3JYTA 5BRHA 3OA9A 3I33A 1GOCA 5GAGP 4DCHA 4KI6A 4KKOA 4JHDA 3HVTA 3WT0A 1VSDA 2EWSA 1RT4A 3SQ0A 4DLGA 1FXXA 3H1QA 3SMPA 1ATNA 2VQFK 3CC4N 4BVOA 4IG0A 4YNQA 1Q9XA 3PUFA 2ZGZA 1VSFA 5FLXO 4IBNA 4IOXA 2G8IA 3P1GA 3CJ1A 3L2UA 3G10A 5JVHL 3OYCA 1S1TA 2WFBA 4MO5A 1HUXA 5BR9A 3K59A 4H5RA 4K0KK 3E9PA 1RDDA 4TSXA 5IT9O 4WQ4A 3DLBA 5ADXA 1BU6O 2ZGYA 1RT1A 5CE3A 1VSLA 4CESA 4CJLA 4FJHA 2ZJRL 3VEZA 4PL8A 2UUAK 4CGDA 4FJ8A 3QDKA 4W5NA 4Z4CA 3ID6A 2OZSA 4DHYA 2QWRA 4NLCA 3QO9A 1CZBA 3VEWA 1NBWA 4F4KA 2ZQBA 3L8BA 3CHWA 2VQEK 3THYB 5M1PA 3QNNA 3FFIA 1JLFA 2KW4A 1NK0A 4RWTA 3F5TA 4NO7A 1LAWA 1JLEA 5BN8A 3OYEA 1EETA 2Q31A 3IRXA 3LM9A 4PWDA 2AP1A 2P9SA 3VQ6A 3LDPA 2HVHA 1XC9A 1U2VA 2EHGA 4DU4A 4CECA 4OKJA 3ZLJA 3GOIA 4KB0A 3DOLA 1HX1A 2O8BA 4FW1A 1H1VA 4FWKA 4YHHK 2W40A 4JK7A 1MWMA 3M8SA 2YJEA 3TARA 4DV7K 3O08A 4C23A 1C1CA 3K5NA 4O55A 1K6YA 1L3VA 4C8KA 3VGKA 4M42A 5AFUH 3QEVA 5MLCQ 1GOBA 1A5WA 4ILJA 1SAZA 3F9MA 2VG6A 5SZTA 5AQRA 3IKMA 4CEQA 3KKSA 1QQOA 1U6ZA 3AA2A 3UIQA 3VA0A 3AVKA 2VWBA 1TK0A 2P9LA 3OYHA 4OKKA 2V7ZA 1YXQA 5GINA 3J7AP 3AAQA 1QSLA 4CCHA 1RDBA 4BC2A 4ILHA 2WUSA 1D9FA 3HYFA 3AGRA 2OZMA 3D0PA 3ZSOA 2O8BB 4FJ9A 3L2VA 2AJQA 3ZSXA 1RBSA 3DXMB 4FVMA 2KZZA 1Y97A 2GUPA 2FSNA 3VETA 1SKRA 1YVUA 4J2EA 4B1WB 1QHAA 3EKSA 3RMCA 4LFAK 3IMXA 4MLEA 1KRPA 4FJMA 3OYJA 4R5PA 4DF4A 3T1AA 1Q8IA 5J2QA 3O9TA 2IAJA 1RDWX 5AQHA 5BR8K 3UKUA 1EWRA 1MU2A 3HVRA 4CJEA 1JLCA 2F9WA 2VG5A 3O80A 3AA3A 1TKXA 2QWOA 5C15A 3VQCA 4OLAA 1WAFA 1S3XA 2E2OA 2NNWA 4CJ5A 2KHOA 3ZX2A 4FW2A 5BPLA 2ZF5O 3O9QA 4BDZA 1ZBLA 1QVFM 1QHTA 2VG7A 3JXUA 3OYDA 2BANA 1DGKN 1OVYA 3O9UA 1SKSA 4H0YB 3ZSRA 2QWLA 1ESVA 1EKEA 3TAGA 3MN6A 4DQPA 4WE1A 2RN2A 1B92A 1Q7YO 1U04A 3LDNA 5M1QA 2DFHA 2BDPA 2ASPA 4U67L 4JI4K 3HI0A 2D0OA 2G8UA 2E2NA 1VQLN 4LF5K 2BTFA 4PUOA 2QEXN 2Q97A 4B9NA 3V1OA 1WBDA 4EZ9A 4CW7B 3E01A 3HPGA 4CF0A 5TKWA 1VQ7N 4BC5A 3NF9A 2O8EA 4A5AA 3MXJA 4MFBA 3FZMA 4JKCA 4L3QA 3CJCA 4BACA 5F2RA 4FPAA 3BDPA 3GDQA 4JEPA 2P9KB 4B9LA 3SAFA 1QZ5A 3AVJA 3UE5A 4OJRA 4BROA 4DV3K 4W5QA 3AO4A 5CR4A 1VSEA 3DRSA 1VQ4N 1S1VA 1T6CA 2HBMA 3C65A 3MWPA 2JWKA 3VQ5A 4V19S 4CIGA 2YX6A 4FM1A 3V81A 4JKEA 2E1YA 1HQUA 1N33K 1GOAA 4B9SA 1KTQA 1HPMA 2HBLA 4CHNA 4B1ZA 4JRPA 4Z4GA 1S1XA 3SPYA 1JLGA 3H3OB 2A6AA 4HWIA 2FBXA 1RILA 2A3ZA 1LWEA 3VMFB 4BG8A 1QTMA 3EYZA 1RDUA 3SCXA 5HLFA 3QFPA 5C10A 1RTJA 3WEEB 1S6PA 3WXIA 2FBVA 1XHZA 3UB5A 5GAEP 4X66K 1RTDA 3D6RA 4DSFA 1CZ9A 4H8KA 1K8KB 4DFKA 1M90O 3K9KA 5AQIA 4CJSA 5KRSA 1BWFO 2O8CA 1WSFA 4WQ5C 1A5VA 2W6LA 3ZX0A 3S41A 3CQ8A 1JKHA 3T1HK 4A2AA 1J9AA 3ULEA 5AQNA 5KQ8A 4B9VA 4FK2A 1N36K 5AQJA 2X6NA 3HOTA 4AM6A 4JI8K 3DOKA 1XHXA 2OPPA 4Q0BA 4DFPA 1DEJA 4BVPA 3QIPA 3CCVN 4DV4K 2RHKA 4AHVA 4Z94A 5M1KA 3SJJA 1HKGA 3V9XA 1I3AA 3HP9A 3NVMA 1HNVA 2HNYA 1BO5O 3MXMA 4H0XB 3E1YA 4WQ4C 3M8RA 3U6FA 3C6TA 1QSYA 3M8QA 2HHVA 1JL1A 2HOEA 1G99A 2P9PB 1SS6A 4FO0A 4FZYA 3I55N 4RW9A 5J1EA 4UQGA 4CIEA 2V52B 3A8YA 1YT3A 2QWPA 3K0SA 3C6HA 4DU3A 1Z25A 2P51A 1BL3A 1VSIA 3VGMA 3G25A 2ZWHA 1R59O 4BGAA 3VA3A 3WXJA 2ASOA 3I0SA 4A59A 2RE2A 5M1OA 4CZFA 1U4BA 3OYMA 2A1RA 1UA0A 1KVCA 4LF9K 4YORA 3K5OA 3U4LA 1D8YA 2ATQA 2NRHA 3T19A 2HSTA 2QK9A 4ICLA 1VK0A 1EO1A 4XIUA 4FCYA 3AARA 3LP3A 1M1KO 1T6DA 1HNXK 2HHHK 4KHWA 2NRTA 5KI6A 2R7YA 3ITHA 1SL1A 4CD1A 3SK3A 2CGKA 2B4JA 4B1XB 4K25A 5AQVA 4E0DA 3TAMA 3KK3A 4JI5K 4E3SA 2W42A 2QWNA 3VQ4A 4CFAA 3AVCA 3PX0A 3VTIA 1WSEA 5AQKA 5GAHP 4DKWA 2E6LA 3SBGA 3KK1A 5DMRA 3VQEA 1W9HA 4B3MK 4AILC 1VSJA 3M5RA 3S9HA 1VQPN 2BH1A 1WB9A 3PO4A 3AVLA 4I9QA 5JS2A 4FWPA 5KQDA 2OTLN 3B6OA 4CHYA 3G71N 4DTPA 5AQXA 1J6ZA 3CETA 4GVEA 4PL7A 1KAZA 4C1NK 4CZLA 5FRNA 4WQ5A 3QFUA 1E4FT 4NXMK 4BWJA 1RFQA 4K41A 3ENHA 3FFKB 4RCHA 1SL2A 5I3UA 1RCHA 4ELUA 5GIOA 4X62K 4JD2B 3DI6A 4CJ4A 1YJNN 3PY8A 4CEEA 3D45A 3EE8A 1SUQA 5AQZA 3NVKA 3SV3A 3T69A 3CJ7A 4KTQA 4DS4A 1RBVA 1SZ2A 2EX3A 4JI2K 4X64K 1KD1O 2VGNA 1D5AA 1RT3A 5BPMA 4JN4A 1OH8A 2X6SA 5JMVA 4CFCA 5C2FA 2HHQA 3W3DA 2DTUA 4IFEA 3VEYA 1NGGA 3CFOA 1BIZA 3ENBA 4CHPA 3CPWM 3CF5L 4FLXA 5AR0A 4E7JA 2Q36A 4YFUA 3CM6A 4W5RA 2XY7A 4Z0UA 1T7PA 3D7EO 3BZCA 4BGBA 2HHTA 1K8KA 1RTHA 5KPZA 3PX6A 2YHAA 4YOWA 3LALA 1P8ZA 4DFJA 3QIOA 1ZBUA 1BCMA 3BGRA 3HOSA 1NGIA 3LM2A 4EP5A 3EZWA 4IFYA 3DXMA 3RMDA 4WFNL 4WFBL 3H45C 4DG1A 3C6AA 3O5BA 5DM6L 1BUPA 3PO5A 1VHXA 4JKAA 4JKGB 2QM1A 4YOXA 1WSIA 4RW8A 3VQBA 4NYNA 4XH5A 4I9LA 3K58A 5J2MA 1NKEA 4DR2K 4KHPK 3ZSQA 1U2VB 2D4WA 5EOYA 3B6PA 1ILYA 4Z4HA 4CFBA 3WNFA 3OYNA 3RVCA 3FE1A 4CGHA 4K8XA 2V51B 1C1AA 5HRSA 4EFHA 2QXFA 4WF9L 4QAGA 3CCRN 4CJRA 1NGAA 2JGUA 3DRRA 2GUIA 2XO7A 4M45A 4BRHA 3CG7A 2I5JA 3KWGA 1TKDA 1JCEA 2RF2A 3DAWA 4BRKA 3A0IX 3MCAB 2FSKA 3SPZA 2F4VK 1T05A 3S3NA 3AY9A 4AHUA 5EVZA 4YOTA 2E8AA 3QEIA 3ZETB 5LL6Z 2UUBK 3HPHA 1N8RO 4OPHA 3AA4A 4AHCA 1FKPA 2XHBA 3IFRA 1X3MA 3NCIA 3CQXA 4JK9A 2P9NB 2P9IB 1JCGA 4FK0A 4FJGA 4KPYA 5KPRA 1XI1A 4JI6K 1ZBHA 1MA9B 5AZJB 3VQPA 4BQLA 4XEIA 2ZJQL 1BIUA 4GV3A 2UXBK 5FDLA 3OYBA 4FLVA 5AQQA 2E6MA 5CYMA 1BQMA 2DFFA 5E26A 3HPOA 1NG9A 1YUWA 2ITGA 3F2KA 2O8EB 1D4XA 2P9KA 5LY3A 2NRVA 3M6GA 2O8DB 4BE2A 1NNEA 4RTFD 3HTVA 2Z1GA 4NCBA 4Y1DA 4DV2K 1XQSC 1X9JA 3LAMA 3T7ZA 4NCGA 4FXDA 3V9SA 3MN7A 3J7YP 2QKBA 3CJ9A 5FPMA 3CMEN 2G8HA 3U8XA 2PFUA 1NJZA 4B1YB 3NHGA 1K9MO 3L6QA 4BRDA 2D0BA 4B9QA 3OYGA 1QQNA 2FF6A 3M8PA 1JJ2M 4N47A 4ISFA 1FJGK 3D2EB 1LW2A 4KV8A 5DK5A 2D0PA 4CI6A 1TK8A 3ISNC 1QS4A 3VF6A 3G0ZA 1X9WA 3E9LA 3M1FA 3VOVA 1Q82O 3SI6A 3VQ7A 3KHYA 3AVGA 2OPQA 4GW6A 1VSHA 3SQ4A 4Z4IA 1KVAA 5CYQA 3WEEA 3P39A 3VF2A 3LWMA 2O8FA 3JS6A 1QZ6A 3V9UA 1YJWN 5IWAK 2YHXA 3ZSVA 4QS9A 3DLEA 5AZJA 1Q81O 3EE9A 3P38A 4QOZB 4MQ3A 3O4WA 3QBWA 3O9RA 4KTZA 3TSPA 4WYBA 3TANA 1C6VA 3OHRA 1C0MA 4CZIA 4CERA 1OVQA 3QEWA 3DM2A 4O8UA 1E4GT 5T7BA 2NUBA 4MDAA 4N76A 1NK5A 4IWVA 1BA1A 3CJAA 4JRQA 3DLGA 4E19A 4ELVA 1HMVA 3L3VA 1WUAA 3O9SA 3EKUA 1SL0A 4OLBA 3AVHA 1JLQA 2Q2RA 5AQMA 2E2QA 3NE6A 2D0CA 2NRWA 3E66A 2G8FA 3H6EA 3D2FA 1NK4A 4CF1A 1VAZA 3ZEUB 5LMNK 4EZ6A 4KFBA 2A41A 5M1FA 1YI2N 1XMQK 3WNHA 4M3WA 3AVBA 4B3SK 2HMPA 2Q3SA 3PIOL 1FW6A 1U48A 4FK4A 4GY2B 1RBUA 3U9ZA 5AQPA 3NGZA 5J2PA 4FWNA 3ULEB 1QSSA 1JXEA 1IO2A 4NCAA 4A62A 4QS7A 1U49A 2IVPA 4GKJK 4JYAK 4IDKA 4RW7A 4DQQA 3MXIA 4O0IA 3ASMA 5FROA 3FZHA 4DSJA 4GNIA 2IOCA 2D1KA 4JV5K 4CZJA 3NDKA 1S9EA 3C95A 4BRQA 1TAQA 4B3OA 1G15A 3KK7A 1VQ6N 4FWQA 4FWRA 4DR5K 4B3TK 3CCUN 4HVJA 3THWA 4FWOA 4PKIA 1F21A 3MEDA 2G8WA 3OS1A 4CK1A 1E3MA 4CEFA 3T1YK 1ITGA 4Y0WA 1KLMA 1LCUA 4IOCL 3EEQA 1S9GA 4M3XA 3LAKA 3I0RA 3DWLA 1YITN 1ASWA 4IJNA 4DV5K 3PV8A 1RDAA 3SAGA 4KHSA 2KFZA 2KLAA 3QLHA 5ELZA 4M7YA 3L2QA 1WLJA 5J2NA 4BRPA 3AA5X 2QA4N 2D0AA 3VN5A 3CQYA 4AM7A 3FLCO 4BRGA 3OYFA 3RR8A 4BY9C 4ID5A 4CHQA 4BC4A 1HJOA 3LL3A 4LF4K 4DQRA 4B9TA 1EX4A 4ISGA 3R6MA 4JI7K 4BRCA 1QQCA 4ZTJA 1VQMN 4JI3K 4CJQA 1C0TA 2P9SB 1BQNA 3THWB 4FWSA 3CD6N 1VQ9N 3NGIA 4N5SA 3BZKA 3A2FA 3DLKA 2KFNA 4WFAL 4FOEA 4J8FA 1NJIO 4FLUA 3GBTA 2UU9K 1WOQA 4K42A 1W0HA 1T03A 4YOUA 1Q18A 4CJUA 2ZD1A 1GLBG 2A5XA 3ZCMA 1XMOK 1IKVA 3NGYA 2IS3A 2CGJA 3A5NC 3OYKA 4BRNA 3TSUA 4M63C 4DSLA 3QINA 1FK9A 2QTDA 3JAMO 1YF5L 4RW4A 3V6DA 3PX4A 4BR9A 2P9NA 2OPSA 3QB0A 3LZJA 3L2RA 3KTQA 5KGWA 3TU5A 1ZXOA 4C8LA 1NM1A 5LJWA 2VYPA 2HVIA 4JI1K 2F7TA 1S72N 2JLEA 3BF1A 1RDCA 2V7YA 4MO4A 2YJFA 3WXKA 1DTTA 2E1ZA 3ZT2A 3E9OA 4FJ7A 3MECA 3UKRB 3VQQA 1V4SA 5JLFA 1K73O 3P5JA 1HYSA 5F1XA 3CCJN 1RBTA 2P9UB 1NGFA 2DY4A 4IEIA 3NFAA 4BR7A 2E5LK 4BRAA 1NK7A 3TTDA 2NRXA 4I6MA 1IKWA 4GKKK 3OBWA 3WXLA 2FC0A 3BP8A 4YDUA 1GLEG 2YKMA 3CCEN 2WOMA 4FJNA 4DR3K 5I42A 3OS0A 2CGLA 5M1NA 1TKTA 4DSIA 4CJFA 3TR8A 3NF6A 3VEOA 4CK3A 4BREA 1HKBA 4DMNA 1HNWK 3AO3A 4OGCA 4A57A 2Y1IA 4LY7A 5JICA 3QETA 2YNHA 3C7NB 4FWLA 3H46O 2HHSA 2O4IA 4I2PA 4CVNE 2F8SA 4ILGB 4R79A 1TYQA 4KHNA 3OW2M 1OH5A 1TUYA 4K43A 4BWMA 4FYDA 4JD2A 1BOTO 4DQIA 4PKGA 4JKBA 4DWIA 4I6MB 2LSNA 1OH6A
chains in the Genus database with same CATH topology
1TAUA 1TKZA 2EHGA 1ASVA 4DU4A 3RMDA 3NF7A 4CECA 4OKJA 4DG1A 1DTQA 3TAPA 4KB0A 3DOLA 3OYIA 3SNNA 4FW1A 3SUQA 3PO5A 2OYQA 3SUPA 3LP1A 1NJYA 3OYAA 2HHWA 3DRPA 3M8SA 3TARA 3VQAA 4Q5VA 2YHBA 1WSIA 4RW8A 3VQBA 1C1CA 2OPRA 4NYNA 4O55A 3K5NA 1HPZA 4I9LA 3K58A 3K5LA 3F73A 1K6YA 5J2MA 1NKEA 1L3TA 1L3VA 4C8KA 3ZSQA 3QEVA 4M42A 1VRTA 3B6PA 1GOBA 1A5WA 5HBMA 4Z4HA 4CFBA 3WNFA 4DFMA 4E1NA 3OYNA 2WONA 4CGHA 3AO1A 3OJSA 4FLZA 1X1PA 3KLIA 3EZ5A 3TABA 2PY5A 1KLNA 4K8XA 2VG6A 5SZTA 1C1AA 2B6AA 5HRSA 1U47A 4CEQA 3ALYA 3KKSA 3AVFA 4DSKA 1BI4A 2QXFA 2E4LA 2Y1JA 4QAGA 3AA2A 1Z26A 3UIQA 4CJRA 4BE0A 4B9MA 2JGUA 1I39A 3AVKA 3VA0A 3DRRA 4PQUA 4M3YA 1TK0A 4CJTA 1IG9A 3OYHA 4OKKA 2GUIA 4B9UA 2XO7A 4M45A 2YNGA 4KAZA 3L2WA 3CG7A 1QSLA 2I5JA 1TKDA 4CCHA 2RF2A 1RDBA 4HCBA 3RWUA 3DYAA 3OVNA 2XY6A 1UA1A 3HYFA 1D9FA 5E41A 3LWLA 4KI4A 3QNOA 2D5RA 4DTJA 3D0PA 2OZMA 3F9KA 4J2AA 3ZSOA 3OYLA 3WNGA 3QEXA 3SPZA 1LW0A 4FJ9A 1KVBA 3L2VA 1T05A 4DLEA 2HNDA 1SV5A 2GV9A 2AJQA 3S3NA 3ZSXA 1UWBA 3HT3A 1RBSA 4AHUA 4FJKA 4FVMA 3QEIA 2P1JA 1S1WA 1Y97A 2KZZA 1WN7A 3V1QA 1SKRA 1YVUA 3HPHA 4AHRA 4J2EA 3AA4A 4AHCA 4N41A 1FKPA 1IH7A 3RMCA 2XHBA 3KD1E 4DTNA 3NCIA 4OPKA 1KRPA 2IGIA 4FJMA 4DTXA 3LP2A 4LSLA 3AVMA 3O3HA 3KK2A 3OYJA 3OJUA 4FK0A 4FJGA 4CGFA 4KPYA 3HJFA 4R5PA 4GMJB 3T1AA 4DF4A 1XI1A 3TAQA 1NOYA 1ZBHA 4M41A 4IKFA 1Q8IA 5J2QA 3VQPA 3P83D 2IAJA 3QERA 4E7HA 1N6QA 1BIUA 5FDLA 4QCLA 5CZ1A 3RR7A 3OYBA 4FM0A 2YNIA 4FLVA 1JL2A 1MU2A 2E6MA 1BQMA 2DFFA 3IG1A 3IS9A 5CYMA 4CJEA 3HPOA 3HVRA 1RNHA 4CJ3A 1JLCA 4OKEA 2ITGA 3AO5A 4K8ZA 2VG5A 3AA3A 1TKXA 3SQ2A 1X9SA 3VQCA 4OLAA 2QKKA 4HUEA 4Z4FA 4BE2A 1HRHA 1J53A 1WAFA 4E1MA 2B5JA 1VSMA 2Z1GA 4CJ5A 3HXMA 4Z4EA 3TI0A 3DLHA 4Y1DA 4NCBA 4FW2A 4C8NA 1ZBLA 4BDZA 3LAMA 1QHTA 2VG7A 3OYDA 4NCGA 2GBZA 1CXUA 2BANA 5C25A 5SWMA 3LDSA 1R0AA 4FXDA 2YKNA 3KIOA 3THVA 1SKWA 3AO2A 3KKRA 1SKSA 3V9SA 2QKBA 4KB1A 4J2BA 3ZSRA 3OY9A 3K57A 1B9DA 3VQ9A 3QESA 2G8HA 3LZIA 2FBTA 1NJZA 1LWFA 1EKEA 1O1WA 3TAGA 3O3FA 4DQPA 4WE1A 2RN2A 3CM5A 1B92A 3NHGA 2G8VA 4HCCA 1U04A 2D0BA 3OYGA 3M8PA 3WNEA 2DFHA 2BDPA 4CF9A 4N47A 3RRGA 2G8UA 5KRTA 1LW2A 4KV8A 1JXBA 3MEEA 4CEOA 5DK5A 4PUOA 3O3GA 4B9NA 3KLFA 3LPTA 3V1OA 1WNSA 2IDOA 4CGJA 4BDYA 1TK8A 3ISNC 4EZ9A 3E01A 1RT7A 3HPGA 1QS4A 4CF0A 5D3GA 4J2DA 3NF9A 3K2PA 4JLHA 3G0ZA 3MXJA 3RMBA 4MFBA 1X9WA 3ZT3A 4F3TA 4BACA 3BDPA 5CY4A 5CZ2A 4F3OA 3SI6A 1TL1A 3VQ7A 3AVGA 1FKOA 3SUOA 2VWJA 2OPQA 4GW6A 1VSHA 4B9LA 4KO0A 3SQ4A 1KVAA 2VWKA 4CEZA 1QE1A 3AVJA 3CYMA 4BE1A 3RMAA 4FZZA 4OJRA 5CYQA 1NK8A 1RT2A 1YTAA 3LWMA 3O4QA 3V9UA 4W5QA 3AO4A 4H4OA 4RW6A 4W5TA 1UAXA 3ZSVA 1C1BA 3QEPA 1VSEA 4I2QA 4B08A 1NKBA 1HJRA 1RBRA 3DRSA 1RTIA 3HL8A 3DLEA 4GVMA 4M3RA 1S1VA 2OA8A 4F2SA 1U45A 1LAVA 1VRUA 4QOZB 2HB5A 1J54A 4MQ3A 3VQ5A 3DMJA 4KTZA 4CIGA 1L3SA 4FM1A 3V81A 3SQ1A 1S1UA 4CF8A 1HQUA 4FZXC 4O0JA 1GOAA 2F96A 1C6VA 1KTQA 3ZT4A 3TANA 4CIFA 1TK5A 1C0MA 4B9SA 4CERA 4CHNA 3QEWA 3DM2A 4JRPA 3C94A 4Z4GA 5T7BA 2NUBA 4N76A 4ZTFA 3HK2A 1S1XA 1NK5A 3SPYA 1JLGA 4DU1A 4JRQA 4E89A 3DLGA 2FBXA 4E19A 4ELVA 1HMVA 1RILA 3L3VA 3ZSZA 3C6UA 5HRNA 1CLQA 1KSPA 3ZSWA 4OVLA 1BHLA 1LWEA 2XY5A 4CJWA 1SL0A 1QTMA 3AVHA 4OLBA 4EP4A 4ZHRA 4N56A 3EYZA 3TWHA 1JLQA 3SCXA 5HLFA 4HUGA 1TL3A 5C42A 3NE6A 3MAQA 4DTMA 2D0CA 3NH0A 1RTJA 2ETJA 4CEBA 2G8FA 1S6PA 4DTOA 4W5OA 2FBVA 1XHZA 4OPJA 3MEGA 4M3TA 3NH1A 1BISA 1RTDA 1WSJA 1NK4A 3V9WA 4CF1A 3KJVA 2P5OA 4EZ6A 4FJIA 3NBPA 4KFBA 1JLBA 4DSFA 1CZ9A 4DS5A 4H8KA 4DFKA 4DTUA 3WNHA 1CXQA 4CJSA 3AVNA 3AVBA 5KRSA 3I8DA 4M3WA 1HQEA 2Q3SA 2HMIA 1WSFA 1A5VA 1U48A 3HO1A 2KTQA 4FK4A 3CQ8A 4B8AB 1JKHA 1RBUA 4F8RA 4LH5A 4O4GA 1J9AA 3U3YA 3TAEA 4B9VA 1B9FA 1XWLA 3NGZA 5J2PA 4FK2A 1QSSA 2X6NA 1JXEA 1IO2A 4NCAA 3DOKA 2HNZA 1XHXA 2OPPA 4FLYA 1U49A 4Z4IA 4Q0BA 4DFPA 4CJPA 4CGGA 3CFRA 5KGXA 4KREA 3TAFA 3QIPA 4IDKA 1ZBIA 2HHXA 4RW7A 4JS5A 3O4NA 5KTQA 1S6QA 3ASMA 4O0IA 4DQQA 3MXIA 4KHQA 4AHVA 3SJJA 5FROA 3V9XA 1I3AA 3HP9A 1LWCA 4B8CA 4DSJA 3EY1A 1HNVA 1KCFA 4IG3A 4KHUA 2IOCA 3NDKA 1S9EA 2HNYA 3MXMA 3C95A 2ZE2A 1TAQA 4B3OA 1G15A 3M8RA 3U6FA 1REVA 3C6TA 1LV5A 2FBYA 4CEDA 4HVJA 4HHTA 4CK2A 1QSYA 2Z1IA 3M8QA 3VQ8A 2PYJA 1F21A 1JL1A 3MEDA 3OS1A 2G8WA 2HHVA 4CK1A 3NF8A 2P5GA 4CEFA 1ITGA 5HRPA 1WSHA 1WSGA 3S3MA 4FZYA 1Q9YA 4RW9A 1KLMA 5J1EA 1C0UA 4CIEA 4UQGA 1T8EA 1S9GA 2YNFA 3LAKA 4E7IA 4M3XA 4CEAA 3I0RA 1YT3A 3SUNA 1KFDA 4O5BA 1ASWA 1BCOA 4DTSA 1WAJA 3T3FA 1HYVA 1RDAA 3PV8A 1L3UA 4DU3A 1X9MA 4CHOA 4KHSA 2KFZA 1Z25A 2P51A 4ID1A 3QLHA 3OS2A 3L2QA 1BL3A 1VSIA 4CJKA 1HNIA 2BE2A 2F8TA 1WLJA 3KLGA 4FJ5A 2A1SA 3VA3A 5J2NA 3I0SA 3HM9A 3AA5X 2KQ2A 2RKIA 3S3OA 2D0AA 3VN5A 1NJWA 3RR8A 2X74A 3OYFA 3OYMA 1U4BA 1HYZA 4ID5A 4ELTA 3AV9A 4CHQA 2A1RA 1UA0A 3NH2A 5HP1A 1IKXA 4DQRA 1KVCA 1EX4A 1TVRA 4DQSA 4B9TA 4AHSA 2BGGA 4CJVA 3K5OA 1JLAA 1D8YA 1UOCA 2ATQA 3T19A 2Z1HA 2QK9A 4ICLA 2Z1JA 1QQCA 3SV4A 1VK0A 4ZTJA 1L5UA 2HVHA 1BI4B 4CJQA 4XIUA 1C0TA 2DFEA 1BQNA 3LP3A 4FCYA 1NOZA 4BDPA 4PA1A 3ZT0A 2HHUA 4KRFA 1D9DA 4KHWA 3NGIA 4N5SA 5KI6A 2R7YA 3A2FA 3ITHA 1SL1A 1YTUA 3DLKA 2KFNA 3HP6A 4PY5A 1N5YA 4FLUA 3V9ZA 2B4JA 3DLRA 4KTWA 4E0DA 3TAMA 4C8MA 1W0HA 3SYZA 3U3GA 3L3UA 1T03A 3KK3A 3KLHA 4CJUA 3RRHA 3LPUA 4LSNA 2ZD1A 4E3SA 2W42A 3H08A 4I7FA 3VQ4A 3ZCMA 4AH9A 2XRIA 4CFAA 2IC3A 3AVCA 1IKVA 3PX0A 1BGXT 1WSEA 3NGYA 4OGEA 2IS3A 4L8RB 2HW3A 1IKYA 2KZMA 1TV6A 4CE9A 2RPIA 3OYKA 3KLEA 3NAEA 3RTVA 4NYFA 4E7LA 2E6LA 3KK1A 5DMRA 3VQEA 1W9HA 3ULDA 4FJXA 4DSLA 3QINA 1FK9A 4AILC 1VSJA 4FJLA 3S9HA 3SZ2A 3PO4A 4RW4A 3V6DA 3IAYA 4M3ZA 1TGOA 3PX4A 3AVLA 3V1RA 4FM2A 4I9QA 2OPSA 1EXQA 4DF8A 1S5JA 2X78A 5JS2A 4O44A 4JS4A 3ZSYA 3LZJA 2PZSA 3B6OA 3L2RA 4LD0A 4DTRA 4IFVA 4CHYA 3KTQA 3JYTA 5KGWA 1EP4A 4CFDA 4DTPA 3JSMA 1GOCA 4C8LA 4KI6A 4KKOA 4FLTA 2HVIA 4F2RA 3HVTA 5C24A 1VSDA 3SQ0A 1RT4A 4DLGA 1FXXA 2JLEA 5FRNA 1DLOA 4HUFA 3AVIA 4BWJA 3V4IA 4CF2A 3CFPA 1RDCA 4IG0A 4LH4A 4CGIA 4YNQA 1Q9XA 1SL2A 1DTTA 3PUFA 5HROA 3ZT2A 5I3UA 4FJ7A 1VSFA 3KD5E 3MECA 3VQQA 1RCHA 4IBNA 3P5JA 4ELUA 1HYSA 1RBTA 2G8IA 3K5MA 3P1GA 3ZT1A 2PYLA 2DY4A 1A5XA 2YV0X 3DI6A 3NFAA 4CJ4A 1NKCA 3PY8A 5JS1A 4CEEA 3D45A 3L2UA 4E7KA 1SUQA 3G10A 3LANA 3OYCA 1KFSA 1NK7A 1S1TA 1IKWA 4RG8A 3K59A 4Y1CA 4HTUA 2FC0A 3SV3A 1RDDA 2YKMA 4KTQA 4H4MA 4TSXA 2WOMA 1NJXA 4DS4A 3DLBA 4KHYA 1RBVA 1ASUA 1RT1A 4FJNA 5I42A 1ZBFA 3OS0A 2EX3A 1TKTA 1VSLA 4CESA 4DSIA 1RT5A 4CJLA 1ZYQA 4FJHA 4CJFA 3TR8A 3NF6A 4CK3A 1D5AA 1RT3A 4DSEA 4DMNA 3HSTB 5HRRA 4FJ8A 4CGDA 2X6SA 3AO3A 3LP0A 4OGCA 4CFCA 1NK6A 2HHQA 4CHZA 4W5NA 1RT6A 4Z4CA 2Y1IA 2DTUA 2O4GA 4LY7A 2OZSA 3QETA 2YNHA 3CFOA 1BIZA 4CHPA 2HHSA 3QO9A 1CZBA 5K14A 4M3UA 2G8KA 4F4KA 4FLXA 2O4IA 5FRMA 2ZQBA 3L8BA 4E7JA 2XY8A 1J5OA 4YFUA 3QNNA 3CM6A 4W5RA 2XY7A 4I2PA 3FFIA 1JLFA 2KW4A 4Z0UA 1T7PA 1NK0A 2F8SA 3VQDA 2HHTA 1RTHA 5EU7A 4AHTA 3PX6A 4C8OA 2YHAA 1LAWA 3LALA 4KHNA 1JLEA 3OYEA 4G1QA 4DFJA 3QIOA 1EETA 3AVAA 4BWMA 1ZBUA 4FYDA 1BCMA 3BGRA 3IRXA 4FLWA 4DQIA 4FJJA 4PWDA 1VSKA 1NK9A 4EP5A 3VQ6A 4DWIA 2LSNA 4IFYA 1XC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TAU A;  1TKZ A;  2EHG A;  1ASV A;  4DU4 A;  3RMD A;  3NF7 A;  4CEC A;  4OKJ A;  4DG1 A;  1DTQ A;  3TAP A;  4KB0 A;  3DOL A;  3OYI A;  3SNN A;  4FW1 A;  3SUQ A;  3PO5 A;  2OYQ A;  3SUP A;  3LP1 A;  1NJY A;  3OYA A;  2HHW A;  3DRP A;  3M8S A;  3TAR A;  3VQA A;  4Q5V A;  2YHB A;  1WSI A;  4RW8 A;  3VQB A;  1C1C A;  2OPR A;  4NYN A;  4O55 A;  3K5N A;  1HPZ A;  4I9L A;  3K58 A;  3K5L A;  3F73 A;  1K6Y A;  5J2M A;  1NKE A;  1L3T A;  1L3V A;  4C8K A;  3ZSQ A;  3QEV A;  4M42 A;  1VRT A;  3B6P A;  1GOB A;  1A5W A;  5HBM A;  4Z4H A;  4CFB A;  3WNF A;  4DFM A;  4E1N A;  3OYN A;  2WON A;  4CGH A;  3AO1 A;  3OJS A;  4FLZ A;  1X1P A;  3KLI A;  3EZ5 A;  3TAB A;  2PY5 A;  1KLN A;  4K8X A;  2VG6 A;  5SZT A;  1C1A A;  2B6A A;  5HRS A;  1U47 A;  4CEQ A;  3ALY A;  3KKS A;  3AVF A;  4DSK A;  1BI4 A;  2QXF A;  2E4L A;  2Y1J A;  4QAG A;  3AA2 A;  1Z26 A;  3UIQ A;  4CJR A;  4BE0 A;  4B9M A;  2JGU A;  1I39 A;  3AVK A;  3VA0 A;  3DRR A;  4PQU A;  4M3Y A;  1TK0 A;  4CJT A;  1IG9 A;  3OYH A;  4OKK A;  2GUI A;  4B9U A;  2XO7 A;  4M45 A;  2YNG A;  4KAZ A;  3L2W A;  3CG7 A;  1QSL A;  2I5J A;  1TKD A;  4CCH A;  2RF2 A;  1RDB A;  4HCB A;  3RWU A;  3DYA A;  3OVN A;  2XY6 A;  1UA1 A;  3HYF A;  1D9F A;  5E41 A;  3LWL A;  4KI4 A;  3QNO A;  2D5R A;  4DTJ A;  3D0P A;  2OZM A;  3F9K A;  4J2A A;  3ZSO A;  3OYL A;  3WNG A;  3QEX A;  3SPZ A;  1LW0 A;  4FJ9 A;  1KVB A;  3L2V A;  1T05 A;  4DLE A;  2HND A;  1SV5 A;  2GV9 A;  2AJQ A;  3S3N A;  3ZSX A;  1UWB A;  3HT3 A;  1RBS A;  4AHU A;  4FJK A;  4FVM A;  3QEI A;  2P1J A;  1S1W A;  1Y97 A;  2KZZ A;  1WN7 A;  3V1Q A;  1SKR A;  1YVU A;  3HPH A;  4AHR A;  4J2E A;  3AA4 A;  4AHC A;  4N41 A;  1FKP A;  1IH7 A;  3RMC A;  2XHB A;  3KD1 E;  4DTN A;  3NCI A;  4OPK A;  1KRP A;  2IGI A;  4FJM A;  4DTX A;  3LP2 A;  4LSL A;  3AVM A;  3O3H A;  3KK2 A;  3OYJ A;  3OJU A;  4FK0 A;  4FJG A;  4CGF A;  4KPY A;  3HJF A;  4R5P A;  4GMJ B;  3T1A A;  4DF4 A;  1XI1 A;  3TAQ A;  1NOY A;  1ZBH A;  4M41 A;  4IKF A;  1Q8I A;  5J2Q A;  3VQP A;  3P83 D;  2IAJ A;  3QER A;  4E7H A;  1N6Q A;  1BIU A;  5FDL A;  4QCL A;  5CZ1 A;  3RR7 A;  3OYB A;  4FM0 A;  2YNI A;  4FLV A;  1JL2 A;  1MU2 A;  2E6M A;  1BQM A;  2DFF A;  3IG1 A;  3IS9 A;  5CYM A;  4CJE A;  3HPO A;  3HVR A;  1RNH A;  4CJ3 A;  1JLC A;  4OKE A;  2ITG A;  3AO5 A;  4K8Z A;  2VG5 A;  3AA3 A;  1TKX A;  3SQ2 A;  1X9S A;  3VQC A;  4OLA A;  2QKK A;  4HUE A;  4Z4F A;  4BE2 A;  1HRH A;  1J53 A;  1WAF A;  4E1M A;  2B5J A;  1VSM A;  2Z1G A;  4CJ5 A;  3HXM A;  4Z4E A;  3TI0 A;  3DLH A;  4Y1D A;  4NCB A;  4FW2 A;  4C8N A;  1ZBL A;  4BDZ A;  3LAM A;  1QHT A;  2VG7 A;  3OYD A;  4NCG A;  2GBZ A;  1CXU A;  2BAN A;  5C25 A;  5SWM A;  3LDS A;  1R0A A;  4FXD A;  2YKN A;  3KIO A;  3THV A;  1SKW A;  3AO2 A;  3KKR A;  1SKS A;  3V9S A;  2QKB A;  4KB1 A;  4J2B A;  3ZSR A;  3OY9 A;  3K57 A;  1B9D A;  3VQ9 A;  3QES A;  2G8H A;  3LZI A;  2FBT A;  1NJZ A;  1LWF A;  1EKE A;  1O1W A;  3TAG A;  3O3F A;  4DQP A;  4WE1 A;  2RN2 A;  3CM5 A;  1B92 A;  3NHG A;  2G8V A;  4HCC A;  1U04 A;  2D0B A;  3OYG A;  3M8P A;  3WNE A;  2DFH A;  2BDP A;  4CF9 A;  4N47 A;  3RRG A;  2G8U A;  5KRT A;  1LW2 A;  4KV8 A;  1JXB A;  3MEE A;  4CEO A;  5DK5 A;  4PUO A;  3O3G A;  4B9N A;  3KLF A;  3LPT A;  3V1O A;  1WNS A;  2IDO A;  4CGJ A;  4BDY A;  1TK8 A;  3ISN C;  4EZ9 A;  3E01 A;  1RT7 A;  3HPG A;  1QS4 A;  4CF0 A;  5D3G A;  4J2D A;  3NF9 A;  3K2P A;  4JLH A;  3G0Z A;  3MXJ A;  3RMB A;  4MFB A;  1X9W A;  3ZT3 A;  4F3T A;  4BAC A;  3BDP A;  5CY4 A;  5CZ2 A;  4F3O A;  3SI6 A;  1TL1 A;  3VQ7 A;  3AVG A;  1FKO A;  3SUO A;  2VWJ A;  2OPQ A;  4GW6 A;  1VSH A;  4B9L A;  4KO0 A;  3SQ4 A;  1KVA A;  2VWK A;  4CEZ A;  1QE1 A;  3AVJ A;  3CYM A;  4BE1 A;  3RMA A;  4FZZ A;  4OJR A;  5CYQ A;  1NK8 A;  1RT2 A;  1YTA A;  3LWM A;  3O4Q A;  3V9U A;  4W5Q A;  3AO4 A;  4H4O A;  4RW6 A;  4W5T A;  1UAX A;  3ZSV A;  1C1B A;  3QEP A;  1VSE A;  4I2Q A;  4B08 A;  1NKB A;  1HJR A;  1RBR A;  3DRS A;  1RTI A;  3HL8 A;  3DLE A;  4GVM A;  4M3R A;  1S1V A;  2OA8 A;  4F2S A;  1U45 A;  1LAV A;  1VRU A;  4QOZ B;  2HB5 A;  1J54 A;  4MQ3 A;  3VQ5 A;  3DMJ A;  4KTZ A;  4CIG A;  1L3S A;  4FM1 A;  3V81 A;  3SQ1 A;  1S1U A;  4CF8 A;  1HQU A;  4FZX C;  4O0J A;  1GOA A;  2F96 A;  1C6V A;  1KTQ A;  3ZT4 A;  3TAN A;  4CIF A;  1TK5 A;  1C0M A;  4B9S A;  4CER A;  4CHN A;  3QEW A;  3DM2 A;  4JRP A;  3C94 A;  4Z4G A;  5T7B A;  2NUB A;  4N76 A;  4ZTF A;  3HK2 A;  1S1X A;  1NK5 A;  3SPY A;  1JLG A;  4DU1 A;  4JRQ A;  4E89 A;  3DLG A;  2FBX A;  4E19 A;  4ELV A;  1HMV A;  1RIL A;  3L3V A;  3ZSZ A;  3C6U A;  5HRN A;  1CLQ A;  1KSP A;  3ZSW A;  4OVL A;  1BHL A;  1LWE A;  2XY5 A;  4CJW A;  1SL0 A;  1QTM A;  3AVH A;  4OLB A;  4EP4 A;  4ZHR A;  4N56 A;  3EYZ A;  3TWH A;  1JLQ A;  3SCX A;  5HLF A;  4HUG A;  1TL3 A;  5C42 A;  3NE6 A;  3MAQ A;  4DTM A;  2D0C A;  3NH0 A;  1RTJ A;  2ETJ A;  4CEB A;  2G8F A;  1S6P A;  4DTO A;  4W5O A;  2FBV A;  1XHZ A;  4OPJ A;  3MEG A;  4M3T A;  3NH1 A;  1BIS A;  1RTD A;  1WSJ A;  1NK4 A;  3V9W A;  4CF1 A;  3KJV A;  2P5O A;  4EZ6 A;  4FJI A;  3NBP A;  4KFB A;  1JLB A;  4DSF A;  1CZ9 A;  4DS5 A;  4H8K A;  4DFK A;  4DTU A;  3WNH A;  1CXQ A;  4CJS A;  3AVN A;  3AVB A;  5KRS A;  3I8D A;  4M3W A;  1HQE A;  2Q3S A;  2HMI A;  1WSF A;  1A5V A;  1U48 A;  3HO1 A;  2KTQ A;  4FK4 A;  3CQ8 A;  4B8A B;  1JKH A;  1RBU A;  4F8R A;  4LH5 A;  4O4G A;  1J9A A;  3U3Y A;  3TAE A;  4B9V A;  1B9F A;  1XWL A;  3NGZ A;  5J2P A;  4FK2 A;  1QSS A;  2X6N A;  1JXE A;  1IO2 A;  4NCA A;  3DOK A;  2HNZ A;  1XHX A;  2OPP A;  4FLY A;  1U49 A;  4Z4I A;  4Q0B A;  4DFP A;  4CJP A;  4CGG A;  3CFR A;  5KGX A;  4KRE A;  3TAF A;  3QIP A;  4IDK A;  1ZBI A;  2HHX A;  4RW7 A;  4JS5 A;  3O4N A;  5KTQ A;  1S6Q A;  3ASM A;  4O0I A;  4DQQ A;  3MXI A;  4KHQ A;  4AHV A;  3SJJ A;  5FRO A;  3V9X A;  1I3A A;  3HP9 A;  1LWC A;  4B8C A;  4DSJ A;  3EY1 A;  1HNV A;  1KCF A;  4IG3 A;  4KHU A;  2IOC A;  3NDK A;  1S9E A;  2HNY A;  3MXM A;  3C95 A;  2ZE2 A;  1TAQ A;  4B3O A;  1G15 A;  3M8R A;  3U6F A;  1REV A;  3C6T A;  1LV5 A;  2FBY A;  4CED A;  4HVJ A;  4HHT A;  4CK2 A;  1QSY A;  2Z1I A;  3M8Q A;  3VQ8 A;  2PYJ A;  1F21 A;  1JL1 A;  3MED A;  3OS1 A;  2G8W A;  2HHV A;  4CK1 A;  3NF8 A;  2P5G A;  4CEF A;  1ITG A;  5HRP A;  1WSH A;  1WSG A;  3S3M A;  4FZY A;  1Q9Y A;  4RW9 A;  1KLM A;  5J1E A;  1C0U A;  4CIE A;  4UQG A;  1T8E A;  1S9G A;  2YNF A;  3LAK A;  4E7I A;  4M3X A;  4CEA A;  3I0R A;  1YT3 A;  3SUN A;  1KFD A;  4O5B A;  1ASW A;  1BCO A;  4DTS A;  1WAJ A;  3T3F A;  1HYV A;  1RDA A;  3PV8 A;  1L3U A;  4DU3 A;  1X9M A;  4CHO A;  4KHS A;  2KFZ A;  1Z25 A;  2P51 A;  4ID1 A;  3QLH A;  3OS2 A;  3L2Q A;  1BL3 A;  1VSI A;  4CJK A;  1HNI A;  2BE2 A;  2F8T A;  1WLJ A;  3KLG A;  4FJ5 A;  2A1S A;  3VA3 A;  5J2N A;  3I0S A;  3HM9 A;  3AA5 X;  2KQ2 A;  2RKI A;  3S3O A;  2D0A A;  3VN5 A;  1NJW A;  3RR8 A;  2X74 A;  3OYF A;  3OYM A;  1U4B A;  1HYZ A;  4ID5 A;  4ELT A;  3AV9 A;  4CHQ A;  2A1R A;  1UA0 A;  3NH2 A;  5HP1 A;  1IKX A;  4DQR A;  1KVC A;  1EX4 A;  1TVR A;  4DQS A;  4B9T A;  4AHS A;  2BGG A;  4CJV A;  3K5O A;  1JLA A;  1D8Y A;  1UOC A;  2ATQ A;  3T19 A;  2Z1H A;  2QK9 A;  4ICL A;  2Z1J A;  1QQC A;  3SV4 A;  1VK0 A;  4ZTJ A;  1L5U A;  2HVH A;  1BI4 B;  4CJQ A;  4XIU A;  1C0T A;  2DFE A;  1BQN A;  3LP3 A;  4FCY A;  1NOZ A;  4BDP A;  4PA1 A;  3ZT0 A;  2HHU A;  4KRF A;  1D9D A;  4KHW A;  3NGI A;  4N5S A;  5KI6 A;  2R7Y A;  3A2F A;  3ITH A;  1SL1 A;  1YTU A;  3DLK A;  2KFN A;  3HP6 A;  4PY5 A;  1N5Y A;  4FLU A;  3V9Z A;  2B4J A;  3DLR A;  4KTW A;  4E0D A;  3TAM A;  4C8M A;  1W0H A;  3SYZ A;  3U3G A;  3L3U A;  1T03 A;  3KK3 A;  3KLH A;  4CJU A;  3RRH A;  3LPU A;  4LSN A;  2ZD1 A;  4E3S A;  2W42 A;  3H08 A;  4I7F A;  3VQ4 A;  3ZCM A;  4AH9 A;  2XRI A;  4CFA A;  2IC3 A;  3AVC A;  1IKV A;  3PX0 A;  1BGX T;  1WSE A;  3NGY A;  4OGE A;  2IS3 A;  4L8R B;  2HW3 A;  1IKY A;  2KZM A;  1TV6 A;  4CE9 A;  2RPI A;  3OYK A;  3KLE A;  3NAE A;  3RTV A;  4NYF A;  4E7L A;  2E6L A;  3KK1 A;  5DMR A;  3VQE A;  1W9H A;  3ULD A;  4FJX A;  4DSL A;  3QIN A;  1FK9 A;  4AIL C;  1VSJ A;  4FJL A;  3S9H A;  3SZ2 A;  3PO4 A;  4RW4 A;  3V6D A;  3IAY A;  4M3Z A;  1TGO A;  3PX4 A;  3AVL A;  3V1R A;  4FM2 A;  4I9Q A;  2OPS A;  1EXQ A;  4DF8 A;  1S5J A;  2X78 A;  5JS2 A;  4O44 A;  4JS4 A;  3ZSY A;  3LZJ A;  2PZS A;  3B6O A;  3L2R A;  4LD0 A;  4DTR A;  4IFV A;  4CHY A;  3KTQ A;  3JYT A;  5KGW A;  1EP4 A;  4CFD A;  4DTP A;  3JSM A;  1GOC A;  4C8L A;  4KI6 A;  4KKO A;  4FLT A;  2HVI A;  4F2R A;  3HVT A;  5C24 A;  1VSD A;  3SQ0 A;  1RT4 A;  4DLG A;  1FXX A;  2JLE A;  5FRN A;  1DLO A;  4HUF A;  3AVI A;  4BWJ A;  3V4I A;  4CF2 A;  3CFP A;  1RDC A;  4IG0 A;  4LH4 A;  4CGI A;  4YNQ A;  1Q9X A;  1SL2 A;  1DTT A;  3PUF A;  5HRO A;  3ZT2 A;  5I3U A;  4FJ7 A;  1VSF A;  3KD5 E;  3MEC A;  3VQQ A;  1RCH A;  4IBN A;  3P5J A;  4ELU A;  1HYS A;  1RBT A;  2G8I A;  3K5M A;  3P1G A;  3ZT1 A;  2PYL A;  2DY4 A;  1A5X A;  2YV0 X;  3DI6 A;  3NFA A;  4CJ4 A;  1NKC A;  3PY8 A;  5JS1 A;  4CEE A;  3D45 A;  3L2U A;  4E7K A;  1SUQ A;  3G10 A;  3LAN A;  3OYC A;  1KFS A;  1NK7 A;  1S1T A;  1IKW A;  4RG8 A;  3K59 A;  4Y1C A;  4HTU A;  2FC0 A;  3SV3 A;  1RDD A;  2YKM A;  4KTQ A;  4H4M A;  4TSX A;  2WOM A;  1NJX A;  4DS4 A;  3DLB A;  4KHY A;  1RBV A;  1ASU A;  1RT1 A;  4FJN A;  5I42 A;  1ZBF A;  3OS0 A;  2EX3 A;  1TKT A;  1VSL A;  4CES A;  4DSI A;  1RT5 A;  4CJL A;  1ZYQ A;  4FJH A;  4CJF A;  3TR8 A;  3NF6 A;  4CK3 A;  1D5A A;  1RT3 A;  4DSE A;  4DMN A;  3HST B;  5HRR A;  4FJ8 A;  4CGD A;  2X6S A;  3AO3 A;  3LP0 A;  4OGC A;  4CFC A;  1NK6 A;  2HHQ A;  4CHZ A;  4W5N A;  1RT6 A;  4Z4C A;  2Y1I A;  2DTU A;  2O4G A;  4LY7 A;  2OZS A;  3QET A;  2YNH A;  3CFO A;  1BIZ A;  4CHP A;  2HHS A;  3QO9 A;  1CZB A;  5K14 A;  4M3U A;  2G8K A;  4F4K A;  4FLX A;  2O4I A;  5FRM A;  2ZQB A;  3L8B A;  4E7J A;  2XY8 A;  1J5O A;  4YFU A;  3QNN A;  3CM6 A;  4W5R A;  2XY7 A;  4I2P A;  3FFI A;  1JLF A;  2KW4 A;  4Z0U A;  1T7P A;  1NK0 A;  2F8S A;  3VQD A;  2HHT A;  1RTH A;  5EU7 A;  4AHT A;  3PX6 A;  4C8O A;  2YHA A;  1LAW A;  3LAL A;  4KHN A;  1JLE A;  3OYE A;  4G1Q A;  4DFJ A;  3QIO A;  1EET A;  3AVA A;  4BWM A;  1ZBU A;  4FYD A;  1BCM A;  3BGR A;  3IRX A;  4FLW A;  4DQI A;  4FJJ A;  4PWD A;  1VSK A;  1NK9 A;  4EP5 A;  3VQ6 A;  4DWI A;  2LSN A;  4IFY A;  1XC9 A; 
#chains in the Genus database with same CATH topology
 1TKZ A;  3SBT A;  2WTU A;  1DTQ A;  3TAP A;  3VES A;  3OYI A;  3CCM N;  1N32 K;  1GLL O;  2OYQ A;  3SUP A;  1NJY A;  3OYA A;  2DPN A;  2HHW A;  5LJV A;  3DRP A;  5GAD P;  4JHD B;  2YHB A;  4U7B A;  4BR4 A;  5E84 A;  1KAX A;  5AFU A;  5C2D A;  1HPZ A;  1L3T A;  3F73 A;  2HW3 A;  5BRD A;  1VRT A;  3MN5 A;  4XH4 A;  1IBM K;  2WON A;  3AO1 A;  3OJS A;  3EO3 A;  2PY5 A;  2B6A A;  1U47 A;  5AQY A;  3ALY A;  1BI4 A;  4FVU A;  4BE0 A;  4B9M A;  3CXC M;  1I39 A;  4EHT A;  4M3Y A;  4CJT A;  5BPN A;  4NLB A;  4H0P A;  3DJC A;  1UA1 A;  3OVN A;  3LWL A;  3WXM B;  4KI4 A;  3QNO A;  2D5R A;  1YHQ N;  4J2A A;  2KKZ A;  3WNG A;  1LW0 A;  1KVB A;  2Q1N A;  1SV5 A;  2GV9 A;  1UWB A;  3THX B;  3RSE A;  2P1J A;  1WN7 A;  3V1Q A;  1QQM A;  4AHR A;  4X65 K;  4N41 A;  1NGE A;  1IH7 A;  2HF3 A;  2QWQ A;  2IGI A;  4DTX A;  3LP2 A;  3AVM A;  3O3H A;  3KK2 A;  3OJU A;  4CGF A;  5BRF A;  3HJF A;  4JKF A;  1NOY A;  3TAQ A;  4M41 A;  4EHU A;  3DXK B;  4YDU C;  4IKF A;  3QER A;  4E7H A;  3VER A;  1HLU A;  4FM0 A;  2J4R A;  5AQO A;  1JL2 A;  3IG1 A;  3U9D A;  1RNH A;  2E88 A;  4IJA A;  4HTL A;  3AO5 A;  3IUC A;  5AQG A;  3HBT A;  1X9S A;  2QKK A;  4IO8 A;  4Z4F A;  2E20 A;  4E1M A;  2B5J A;  2P9P A;  3H3N O;  3HXM A;  3CI5 A;  4Z4E A;  2ASM A;  1N34 K;  1HKC A;  2YI1 A;  4LFC K;  2I7P A;  2GBZ A;  3LDS A;  5SWM A;  2IVN A;  5HL7 L;  1R0A A;  4H03 B;  5KPT A;  3A5O C;  3AO2 A;  3L0Q A;  5TKY A;  3AGK A;  4J2B A;  1B9D A;  2FBT A;  1O1W A;  3CM5 A;  4HCC A;  3WNE A;  3CCL N;  3R1X A;  3RRG A;  5KRT A;  4IOA L;  3MEE A;  2P9I A;  1OKJ A;  3KLF A;  3LPT A;  3O1B A;  1WNS A;  4BDY A;  3QBX A;  1RT7 A;  2GWK A;  4J2D A;  3K2P A;  3FZL A;  4YY3 K;  4JLH A;  3H1V X;  3ZT3 A;  2CH6 A;  1TUU A;  3MX5 A;  5AJ3 K;  1TL1 A;  4WCE L;  1FKO A;  2VWJ A;  1RGI A;  4KO0 A;  2VWK A;  1QE1 A;  4BE1 A;  3N4Q A;  1KAY A;  1UAX A;  3QEP A;  3FGU A;  4I2Q A;  4B08 A;  1NKB A;  1HJR A;  4GVM A;  1RTI A;  2A42 A;  4F2S A;  1LAV A;  1VRU A;  1XUP O;  2HB5 A;  1J54 A;  4FZX C;  4O0J A;  4GV9 A;  3ZT4 A;  3CC7 N;  1TK5 A;  4CIF A;  3THY A;  2QWM A;  1VQ8 N;  1KQS M;  1X3N A;  4E89 A;  4H5V A;  1ZC6 A;  1KXP A;  3ZSZ A;  3C6U A;  1CLQ A;  1KSP A;  3ZSW A;  1BHL A;  1VQK N;  4EP4 A;  4ZHR A;  4N56 A;  3TWH A;  3CC2 N;  2ZJP L;  4HUG A;  1TL3 A;  4G9Z A;  3MAQ A;  4DTM A;  5AQS A;  3NH0 A;  2ETJ A;  4CEB A;  5AQF A;  4W5O A;  4OPJ A;  1BIS A;  1NMD A;  3FZF A;  3NBP A;  2Q0R A;  4DS5 A;  3PLA A;  4DTU A;  3ZET A;  1CXQ A;  3ENO A;  3I8D A;  4YOV A;  3THX A;  1HQE A;  3BEX A;  1I94 K;  3HO1 A;  1IV0 A;  2UYT A;  5EX5 A;  4LH5 A;  1XC3 A;  4O4G A;  3TAE A;  1B9F A;  2Q0U A;  3P31 A;  3RSE B;  4BRI A;  2HF4 A;  4YOY A;  4KH6 A;  4LF8 K;  4CJP A;  3CFR A;  5KGX A;  4KRE A;  3TAF A;  4H0O A;  1Z05 A;  1GLC G;  3O4N A;  1S6Q A;  5KTQ A;  4KHQ A;  1KCF A;  3CIP A;  3EN9 A;  3DXK A;  3VEV A;  3WQU A;  2FBY A;  3CER A;  4CK2 A;  3VQ8 A;  2Z1I A;  3MWT A;  2PYJ A;  3NF8 A;  1NU0 A;  4A5B A;  4DR4 K;  3S3M A;  1WSG A;  1V4T A;  1T8E A;  4CZH A;  4GV6 A;  2WBN A;  2QI2 A;  3WQT A;  3SUN A;  1KFD A;  2UXC K;  3HZ6 A;  3T3F A;  1WAJ A;  4C1N I;  3O1W A;  1L3U A;  1X9M A;  3A5M C;  4FL9 A;  2O8D A;  3O6W A;  3OS2 A;  3SJH A;  4O5F A;  1OH7 A;  1GLA G;  3FZK A;  2BE2 A;  2F8T A;  3KLG A;  4FJ5 A;  2A1S A;  2W41 A;  4BG9 A;  3G4S N;  3HM9 A;  1NJW A;  3ZEU A;  3AV9 A;  3J81 O;  1NGJ A;  4JI0 K;  4KH4 A;  5HP1 A;  5JLH A;  4BRM A;  4BC3 A;  4DQS A;  2OAN A;  1UOC A;  4JKD A;  3HRG A;  3SV4 A;  1BI4 B;  2DFE A;  5A2Q O;  2HHU A;  1Q86 O;  3HSC A;  1D9D A;  3BF3 A;  4DR1 K;  1YAG A;  3B8A X;  4CZE A;  2JWL A;  4C8M A;  3SYZ A;  3U3G A;  3L3U A;  3RRH A;  3LPU A;  3H08 A;  4I7F A;  4JKH A;  2XRI A;  4CBW A;  3KLE A;  4CE9 A;  4NYF A;  2VCP A;  4H5N A;  3ULD A;  1NGD A;  4FJL A;  3IAY A;  4M3Z A;  4JAX A;  1TGO A;  3V1R A;  4FM2 A;  4IZ9 A;  1EXQ A;  4DF8 A;  1S5J A;  4DR7 K;  2X78 A;  4JS4 A;  3R9P A;  3TTF A;  5C12 A;  4DTR A;  4IFV A;  2FXU A;  1EP4 A;  1IBL K;  4CFD A;  3JSM A;  4A2B A;  3UKR A;  4FLT A;  4F2R A;  5C24 A;  2O8F B;  4PHT X;  1Y64 A;  1DLO A;  4HUF A;  3AVI A;  1KC8 O;  3V4I A;  4CF2 A;  3CFP A;  5LMU K;  4LH4 A;  4CGI A;  4JKG A;  5HRO A;  3KD5 E;  3J7Z O;  3MCP A;  3K5M A;  3ZT1 A;  2PYL A;  1A5X A;  2QW9 A;  2YV0 X;  1NKC A;  5JS1 A;  1XNQ K;  4E7K A;  2PAV A;  3LAN A;  2AA4 A;  1KFS A;  4CD3 A;  4RG8 A;  4Y1C A;  4HTU A;  4H4M A;  1NJX A;  4UY8 O;  4KHY A;  1ASU A;  1ZBF A;  3SMS A;  1RT5 A;  1ZYQ A;  4DSE A;  2GEL A;  3HST B;  5HRR A;  3LP0 A;  1MDU B;  1NK6 A;  5EY4 A;  1NLV A;  3LDL A;  4FPB A;  1RT6 A;  4CHZ A;  2O4G A;  4KH5 A;  2H3G X;  4M3U A;  5K14 A;  2G8K A;  5FRM A;  2XY8 A;  1J5O A;  3G6E N;  2GX9 A;  3VQD A;  5EU7 A;  4NB4 A;  1LOT B;  4AHT A;  3CPE A;  4MDB A;  4C8O A;  3L4I A;  3D2E A;  4BR2 A;  3HM8 A;  4G1Q A;  4H5T A;  4ISE A;  3AVA A;  5AQT A;  4FJJ A;  4FLW A;  3KVG A;  5H1S Q;  4OO1 J;  1VSK A;  1NK9 A;  2OTJ N;  4DV6 K;  1TAU A;  1ASV A;  3J80 O;  1JCF A;  3NF7 A;  4DUY K;  1HR0 K;  4DV1 K;  3SNN A;  1S22 A;  3SUQ A;  1IJJ A;  2IVO A;  2NRZ A;  3LP1 A;  3MK6 A;  4FWM A;  3CCS N;  3VQA A;  3P4I A;  4PKH A;  4Q5V A;  3PSI A;  4A61 A;  1VQ5 N;  2NRR A;  1YJ9 N;  2OPR A;  5AZI A;  3K5L A;  3C0B A;  3TPQ A;  1O13 A;  5HBM A;  2YHY A;  4DFM A;  4E1N A;  2FLO A;  4FLZ A;  4JK8 A;  1X1P A;  3KLI A;  3EZ5 A;  3TAB A;  1KLN A;  3TSQ A;  4BRL A;  3AVF A;  4DSK A;  2E4L A;  2Y1J A;  3M3Z A;  1Z26 A;  5BN9 A;  3VEX A;  4PQU A;  4FOI A;  1IG9 A;  2YNG A;  4KAZ A;  3L2W A;  2BUP A;  4HCB A;  3RWU A;  2A40 A;  2FSJ A;  3DYA A;  2XY6 A;  5E41 A;  4DTJ A;  3GL1 A;  3F9K A;  3OYL A;  3QEX A;  3ATV A;  4AF1 A;  4DLE A;  2HND A;  1T44 A;  4F9O A;  3HT3 A;  2NZT A;  4FJK A;  4LF7 K;  1S1W A;  5AQL A;  4NXN K;  4EIA A;  1NGB A;  3KD1 E;  4DTN A;  1IG8 A;  4OPK A;  1P90 A;  4LSL A;  1C0F A;  3LDQ A;  4GMJ B;  3GE1 A;  3P83 D;  5DM7 L;  1N6Q A;  3QML A;  4QCL A;  5CZ1 A;  3RR7 A;  3C7N A;  1BA0 A;  2WC9 A;  2YNI A;  2GWJ A;  3IS9 A;  4CJ3 A;  4DB3 A;  5CHI A;  4OKE A;  4K8Z A;  5AQU A;  1ZBS A;  3SQ2 A;  1GLF O;  4HUE A;  2W6K A;  4H0T B;  1HRH A;  1J53 A;  2O8C B;  1VSM A;  3TI0 A;  3DLH A;  2FF3 B;  4C8N A;  3CMA N;  4B3R K;  1CXU A;  5C25 A;  3J8A A;  3DLL L;  2YKN A;  3KIO A;  4XH1 A;  3THV A;  1SKW A;  4B1V A;  3KKR A;  1HNZ K;  2P9L B;  3VEN A;  3K57 A;  3OY9 A;  3QES A;  3VQ9 A;  4KB1 A;  3LZI A;  3CCQ N;  1LWF A;  3O3F A;  2G8V A;  2F9T A;  3D2F B;  3MX2 A;  4CF9 A;  2HBK A;  4H5W A;  2IIR A;  4LF6 K;  1JXB A;  4CEO A;  2GEM A;  4CZG A;  3O3G A;  4BR5 A;  2IDO A;  4CGJ A;  3KZB A;  5AZI B;  5D3G A;  1GLJ O;  3RMB A;  5ADX H;  4F3T A;  3VGL A;  5CY4 A;  5CZ2 A;  4F3O A;  1C0G A;  3A5L C;  3SUO A;  3R3L A;  5AQW A;  2GTD A;  4H0V B;  3EL2 A;  3RMA A;  4CEZ A;  3CYM A;  5C0Y A;  4FZZ A;  1NK8 A;  1RT2 A;  1YTA A;  3O4Q A;  2UXD K;  3VF4 A;  3W0L A;  1DKG D;  3CJB A;  4H4O A;  4RW6 A;  4W5T A;  1C1B A;  2YHW A;  4B9U A;  3VPZ A;  1RBR A;  3HL8 A;  4M3R A;  2OA8 A;  1U45 A;  1YIJ N;  4DR6 K;  4BQZ A;  4M7X A;  1DT9 A;  3SLC A;  3DMJ A;  3FR0 A;  1L3S A;  3SQ1 A;  1S1U A;  4CF8 A;  2F96 A;  3MMV A;  3ZYY X;  5BRE A;  3C94 A;  5F0X A;  4ZTF A;  3HK2 A;  4JNE A;  4EAH D;  2OCE A;  4DU1 A;  3SAH A;  3L4Q A;  1NMN A;  3OTO K;  5HRN A;  4OVL A;  3MN9 A;  2XY5 A;  4CJW A;  2VGM A;  3N4P A;  3Q7B A;  5I9E B;  1IBK K;  5C42 A;  4DUZ K;  3MDQ A;  3BY5 A;  3BUZ B;  4DTO A;  2PBD A;  4CZK A;  3MEG A;  3ATU A;  3NH1 A;  4M3T A;  1WSJ A;  3V9W A;  1NGC A;  3KJV A;  2P5O A;  4FJI A;  1W7A A;  1W97 L;  2NLX A;  1JLB A;  4CBU A;  1BDG A;  3AVN A;  3IDH A;  1ATS A;  2HMI A;  1MWK A;  3ID8 A;  2KTQ A;  5FPN A;  3PSF A;  4B8A B;  1VQN N;  1GLD G;  4F8R A;  3TTC A;  2CH5 A;  2E2P A;  3U3Y A;  1NGH A;  1XWL A;  1EWQ A;  5FPE A;  1QVG M;  2HNZ A;  4FLY A;  3LDO A;  5FPD A;  4CGG A;  4O8K A;  1NWK A;  2ZM6 K;  1ZBI A;  3I8B A;  2HHX A;  4JS5 A;  4IEE A;  4CZM A;  4IO9 L;  3UKU B;  4FSV A;  1LWC A;  2YCH A;  4B8C A;  3EY1 A;  4KHU A;  4IG3 A;  1YVN A;  2ZE2 A;  4CJ7 A;  3O8M A;  5HOO A;  1REV A;  2HBJ A;  1LV5 A;  4CED A;  4HHT A;  1J5E K;  1XNR K;  1TYQ B;  2I7N A;  5B8H A;  2P5G A;  5GIP A;  1BG3 A;  4OPA A;  2UUC K;  5HRP A;  1WSH A;  1Q9Y A;  1C0U A;  2YNF A;  4E7I A;  4CEA A;  4QS8 A;  4O5B A;  3PIP L;  1BCO A;  4DTS A;  1HYV A;  4CHO A;  3KWI A;  3QIC A;  4ID1 A;  3WUH A;  4CJK A;  1HNI A;  4IDH A;  3I56 N;  4DQ8 A;  4MLH A;  4OX9 K;  2KQ2 A;  2RKI A;  3S3O A;  2X74 A;  3OBY A;  1HYZ A;  4ELT A;  4LFB K;  3K9J A;  3NH2 A;  1IKX A;  2QXL A;  4KBO A;  1TVR A;  2BGG A;  4AHS A;  4CJV A;  1JLA A;  1T3V A;  2Z1H A;  2Z1J A;  1L5U A;  4BDP A;  1NOZ A;  4LC9 B;  4PA1 A;  3ZT0 A;  4BR0 A;  4KRF A;  1SQK A;  3NMU A;  4IXC A;  1EQY A;  1YTU A;  2P9U A;  4B1U B;  2ITM A;  4BRF A;  3HP6 A;  4PY5 A;  1WBB A;  1N5Y A;  3V9Z A;  3DLR A;  4KTW A;  3ZX3 A;  1CZA N;  3R8E A;  3KLH A;  4LSN A;  4E1J A;  1K8A O;  4AH9 A;  2IC3 A;  3GG4 A;  1BGX T;  4OGE A;  3AAP A;  4L8R B;  3VTH A;  1IKY A;  2KZM A;  1TV6 A;  2RPI A;  3NAE A;  4DV0 K;  3RTV A;  4E7L A;  4FJX A;  3SZ2 A;  1W2B M;  1ATR A;  4O44 A;  3ZSY A;  4CBX A;  5JVG L;  2PZS A;  4LD0 A;  3Q7C A;  1Z6R A;  5EXW A;  4AQY K;  1VQO N;  3JYT A;  5BRH A;  3OA9 A;  3I33 A;  1GOC A;  5GAG P;  4DCH A;  4KI6 A;  4KKO A;  4JHD A;  3HVT A;  3WT0 A;  1VSD A;  2EWS A;  1RT4 A;  3SQ0 A;  4DLG A;  1FXX A;  3H1Q A;  3SMP A;  1ATN A;  2VQF K;  3CC4 N;  4BVO A;  4IG0 A;  4YNQ A;  1Q9X A;  3PUF A;  2ZGZ A;  1VSF A;  5FLX O;  4IBN A;  4IOX A;  2G8I A;  3P1G A;  3CJ1 A;  3L2U A;  3G10 A;  5JVH L;  3OYC A;  1S1T A;  2WFB A;  4MO5 A;  1HUX A;  5BR9 A;  3K59 A;  4H5R A;  4K0K K;  3E9P A;  1RDD A;  4TSX A;  5IT9 O;  4WQ4 A;  3DLB A;  5ADX A;  1BU6 O;  2ZGY A;  1RT1 A;  5CE3 A;  1VSL A;  4CES A;  4CJL A;  4FJH A;  2ZJR L;  3VEZ A;  4PL8 A;  2UUA K;  4CGD A;  4FJ8 A;  3QDK A;  4W5N A;  4Z4C A;  3ID6 A;  2OZS A;  4DHY A;  2QWR A;  4NLC A;  3QO9 A;  1CZB A;  3VEW A;  1NBW A;  4F4K A;  2ZQB A;  3L8B A;  3CHW A;  2VQE K;  3THY B;  5M1P A;  3QNN A;  3FFI A;  1JLF A;  2KW4 A;  1NK0 A;  4RWT A;  3F5T A;  4NO7 A;  1LAW A;  1JLE A;  5BN8 A;  3OYE A;  1EET A;  2Q31 A;  3IRX A;  3LM9 A;  4PWD A;  2AP1 A;  2P9S A;  3VQ6 A;  3LDP A;  2HVH A;  1XC9 A;  1U2V A;  2EHG A;  4DU4 A;  4CEC A;  4OKJ A;  3ZLJ A;  3GOI A;  4KB0 A;  3DOL A;  1HX1 A;  2O8B A;  4FW1 A;  1H1V A;  4FWK A;  4YHH K;  2W40 A;  4JK7 A;  1MWM A;  3M8S A;  2YJE A;  3TAR A;  4DV7 K;  3O08 A;  4C23 A;  1C1C A;  3K5N A;  4O55 A;  1K6Y A;  1L3V A;  4C8K A;  3VGK A;  4M42 A;  5AFU H;  3QEV A;  5MLC Q;  1GOB A;  1A5W A;  4ILJ A;  1SAZ A;  3F9M A;  2VG6 A;  5SZT A;  5AQR A;  3IKM A;  4CEQ A;  3KKS A;  1QQO A;  1U6Z A;  3AA2 A;  3UIQ A;  3VA0 A;  3AVK A;  2VWB A;  1TK0 A;  2P9L A;  3OYH A;  4OKK A;  2V7Z A;  1YXQ A;  5GIN A;  3J7A P;  3AAQ A;  1QSL A;  4CCH A;  1RDB A;  4BC2 A;  4ILH A;  2WUS A;  1D9F A;  3HYF A;  3AGR A;  2OZM A;  3D0P A;  3ZSO A;  2O8B B;  4FJ9 A;  3L2V A;  2AJQ A;  3ZSX A;  1RBS A;  3DXM B;  4FVM A;  2KZZ A;  1Y97 A;  2GUP A;  2FSN A;  3VET A;  1SKR A;  1YVU A;  4J2E A;  4B1W B;  1QHA A;  3EKS A;  3RMC A;  4LFA K;  3IMX A;  4MLE A;  1KRP A;  4FJM A;  3OYJ A;  4R5P A;  4DF4 A;  3T1A A;  1Q8I A;  5J2Q A;  3O9T A;  2IAJ A;  1RDW X;  5AQH A;  5BR8 K;  3UKU A;  1EWR A;  1MU2 A;  3HVR A;  4CJE A;  1JLC A;  2F9W A;  2VG5 A;  3O80 A;  3AA3 A;  1TKX A;  2QWO A;  5C15 A;  3VQC A;  4OLA A;  1WAF A;  1S3X A;  2E2O A;  2NNW A;  4CJ5 A;  2KHO A;  3ZX2 A;  4FW2 A;  5BPL A;  2ZF5 O;  3O9Q A;  4BDZ A;  1ZBL A;  1QVF M;  1QHT A;  2VG7 A;  3JXU A;  3OYD A;  2BAN A;  1DGK N;  1OVY A;  3O9U A;  1SKS A;  4H0Y B;  3ZSR A;  2QWL A;  1ESV A;  1EKE A;  3TAG A;  3MN6 A;  4DQP A;  4WE1 A;  2RN2 A;  1B92 A;  1Q7Y O;  1U04 A;  3LDN A;  5M1Q A;  2DFH A;  2BDP A;  2ASP A;  4U67 L;  4JI4 K;  3HI0 A;  2D0O A;  2G8U A;  2E2N A;  1VQL N;  4LF5 K;  2BTF A;  4PUO A;  2QEX N;  2Q97 A;  4B9N A;  3V1O A;  1WBD A;  4EZ9 A;  4CW7 B;  3E01 A;  3HPG A;  4CF0 A;  5TKW A;  1VQ7 N;  4BC5 A;  3NF9 A;  2O8E A;  4A5A A;  3MXJ A;  4MFB A;  3FZM A;  4JKC A;  4L3Q A;  3CJC A;  4BAC A;  5F2R A;  4FPA A;  3BDP A;  3GDQ A;  4JEP A;  2P9K B;  4B9L A;  3SAF A;  1QZ5 A;  3AVJ A;  3UE5 A;  4OJR A;  4BRO A;  4DV3 K;  4W5Q A;  3AO4 A;  5CR4 A;  1VSE A;  3DRS A;  1VQ4 N;  1S1V A;  1T6C A;  2HBM A;  3C65 A;  3MWP A;  2JWK A;  3VQ5 A;  4V19 S;  4CIG A;  2YX6 A;  4FM1 A;  3V81 A;  4JKE A;  2E1Y A;  1HQU A;  1N33 K;  1GOA A;  4B9S A;  1KTQ A;  1HPM A;  2HBL A;  4CHN A;  4B1Z A;  4JRP A;  4Z4G A;  1S1X A;  3SPY A;  1JLG A;  3H3O B;  2A6A A;  4HWI A;  2FBX A;  1RIL A;  2A3Z A;  1LWE A;  3VMF B;  4BG8 A;  1QTM A;  3EYZ A;  1RDU A;  3SCX A;  5HLF A;  3QFP A;  5C10 A;  1RTJ A;  3WEE B;  1S6P A;  3WXI A;  2FBV A;  1XHZ A;  3UB5 A;  5GAE P;  4X66 K;  1RTD A;  3D6R A;  4DSF A;  1CZ9 A;  4H8K A;  1K8K B;  4DFK A;  1M90 O;  3K9K A;  5AQI A;  4CJS A;  5KRS A;  1BWF O;  2O8C A;  1WSF A;  4WQ5 C;  1A5V A;  2W6L A;  3ZX0 A;  3S41 A;  3CQ8 A;  1JKH A;  3T1H K;  4A2A A;  1J9A A;  3ULE A;  5AQN A;  5KQ8 A;  4B9V A;  4FK2 A;  1N36 K;  5AQJ A;  2X6N A;  3HOT A;  4AM6 A;  4JI8 K;  3DOK A;  1XHX A;  2OPP A;  4Q0B A;  4DFP A;  1DEJ A;  4BVP A;  3QIP A;  3CCV N;  4DV4 K;  2RHK A;  4AHV A;  4Z94 A;  5M1K A;  3SJJ A;  1HKG A;  3V9X A;  1I3A A;  3HP9 A;  3NVM A;  1HNV A;  2HNY A;  1BO5 O;  3MXM A;  4H0X B;  3E1Y A;  4WQ4 C;  3M8R A;  3U6F A;  3C6T A;  1QSY A;  3M8Q A;  2HHV A;  1JL1 A;  2HOE A;  1G99 A;  2P9P B;  1SS6 A;  4FO0 A;  4FZY A;  3I55 N;  4RW9 A;  5J1E A;  4UQG A;  4CIE A;  2V52 B;  3A8Y A;  1YT3 A;  2QWP A;  3K0S A;  3C6H A;  4DU3 A;  1Z25 A;  2P51 A;  1BL3 A;  1VSI A;  3VGM A;  3G25 A;  2ZWH A;  1R59 O;  4BGA A;  3VA3 A;  3WXJ A;  2ASO A;  3I0S A;  4A59 A;  2RE2 A;  5M1O A;  4CZF A;  1U4B A;  3OYM A;  2A1R A;  1UA0 A;  1KVC A;  4LF9 K;  4YOR A;  3K5O A;  3U4L A;  1D8Y A;  2ATQ A;  2NRH A;  3T19 A;  2HST A;  2QK9 A;  4ICL A;  1VK0 A;  1EO1 A;  4XIU A;  4FCY A;  3AAR A;  3LP3 A;  1M1K O;  1T6D A;  1HNX K;  2HHH K;  4KHW A;  2NRT A;  5KI6 A;  2R7Y A;  3ITH A;  1SL1 A;  4CD1 A;  3SK3 A;  2CGK A;  2B4J A;  4B1X B;  4K25 A;  5AQV A;  4E0D A;  3TAM A;  3KK3 A;  4JI5 K;  4E3S A;  2W42 A;  2QWN A;  3VQ4 A;  4CFA A;  3AVC A;  3PX0 A;  3VTI A;  1WSE A;  5AQK A;  5GAH P;  4DKW A;  2E6L A;  3SBG A;  3KK1 A;  5DMR A;  3VQE A;  1W9H A;  4B3M K;  4AIL C;  1VSJ A;  3M5R A;  3S9H A;  1VQP N;  2BH1 A;  1WB9 A;  3PO4 A;  3AVL A;  4I9Q A;  5JS2 A;  4FWP A;  5KQD A;  2OTL N;  3B6O A;  4CHY A;  3G71 N;  4DTP A;  5AQX A;  1J6Z A;  3CET A;  4GVE A;  4PL7 A;  1KAZ A;  4C1N K;  4CZL A;  5FRN A;  4WQ5 A;  3QFU A;  1E4F T;  4NXM K;  4BWJ A;  1RFQ A;  4K41 A;  3ENH A;  3FFK B;  4RCH A;  1SL2 A;  5I3U A;  1RCH A;  4ELU A;  5GIO A;  4X62 K;  4JD2 B;  3DI6 A;  4CJ4 A;  1YJN N;  3PY8 A;  4CEE A;  3D45 A;  3EE8 A;  1SUQ A;  5AQZ A;  3NVK A;  3SV3 A;  3T69 A;  3CJ7 A;  4KTQ A;  4DS4 A;  1RBV A;  1SZ2 A;  2EX3 A;  4JI2 K;  4X64 K;  1KD1 O;  2VGN A;  1D5A A;  1RT3 A;  5BPM A;  4JN4 A;  1OH8 A;  2X6S A;  5JMV A;  4CFC A;  5C2F A;  2HHQ A;  3W3D A;  2DTU A;  4IFE A;  3VEY A;  1NGG A;  3CFO A;  1BIZ A;  3ENB A;  4CHP A;  3CPW M;  3CF5 L;  4FLX A;  5AR0 A;  4E7J A;  2Q36 A;  4YFU A;  3CM6 A;  4W5R A;  2XY7 A;  4Z0U A;  1T7P A;  3D7E O;  3BZC A;  4BGB A;  2HHT A;  1K8K A;  1RTH A;  5KPZ A;  3PX6 A;  2YHA A;  4YOW A;  3LAL A;  1P8Z A;  4DFJ A;  3QIO A;  1ZBU A;  1BCM A;  3BGR A;  3HOS A;  1NGI A;  3LM2 A;  4EP5 A;  3EZW A;  4IFY A;  3DXM A;  3RMD A;  4WFN L;  4WFB L;  3H45 C;  4DG1 A;  3C6A A;  3O5B A;  5DM6 L;  1BUP A;  3PO5 A;  1VHX A;  4JKA A;  4JKG B;  2QM1 A;  4YOX A;  1WSI A;  4RW8 A;  3VQB A;  4NYN A;  4XH5 A;  4I9L A;  3K58 A;  5J2M A;  1NKE A;  4DR2 K;  4KHP K;  3ZSQ A;  1U2V B;  2D4W A;  5EOY A;  3B6P A;  1ILY A;  4Z4H A;  4CFB A;  3WNF A;  3OYN A;  3RVC A;  3FE1 A;  4CGH A;  4K8X A;  2V51 B;  1C1A A;  5HRS A;  4EFH A;  2QXF A;  4WF9 L;  4QAG A;  3CCR N;  4CJR A;  1NGA A;  2JGU A;  3DRR A;  2GUI A;  2XO7 A;  4M45 A;  4BRH A;  3CG7 A;  2I5J A;  3KWG A;  1TKD A;  1JCE A;  2RF2 A;  3DAW A;  4BRK A;  3A0I X;  3MCA B;  2FSK A;  3SPZ A;  2F4V K;  1T05 A;  3S3N A;  3AY9 A;  4AHU A;  5EVZ A;  4YOT A;  2E8A A;  3QEI A;  3ZET B;  5LL6 Z;  2UUB K;  3HPH A;  1N8R O;  4OPH A;  3AA4 A;  4AHC A;  1FKP A;  2XHB A;  3IFR A;  1X3M A;  3NCI A;  3CQX A;  4JK9 A;  2P9N B;  2P9I B;  1JCG A;  4FK0 A;  4FJG A;  4KPY A;  5KPR A;  1XI1 A;  4JI6 K;  1ZBH A;  1MA9 B;  5AZJ B;  3VQP A;  4BQL A;  4XEI A;  2ZJQ L;  1BIU A;  4GV3 A;  2UXB K;  5FDL A;  3OYB A;  4FLV A;  5AQQ A;  2E6M A;  5CYM A;  1BQM A;  2DFF A;  5E26 A;  3HPO A;  1NG9 A;  1YUW A;  2ITG A;  3F2K A;  2O8E B;  1D4X A;  2P9K A;  5LY3 A;  2NRV A;  3M6G A;  2O8D B;  4BE2 A;  1NNE A;  4RTF D;  3HTV A;  2Z1G A;  4NCB A;  4Y1D A;  4DV2 K;  1XQS C;  1X9J A;  3LAM A;  3T7Z A;  4NCG A;  4FXD A;  3V9S A;  3MN7 A;  3J7Y P;  2QKB A;  3CJ9 A;  5FPM A;  3CME N;  2G8H A;  3U8X A;  2PFU A;  1NJZ A;  4B1Y B;  3NHG A;  1K9M O;  3L6Q A;  4BRD A;  2D0B A;  4B9Q A;  3OYG A;  1QQN A;  2FF6 A;  3M8P A;  1JJ2 M;  4N47 A;  4ISF A;  1FJG K;  3D2E B;  1LW2 A;  4KV8 A;  5DK5 A;  2D0P A;  4CI6 A;  1TK8 A;  3ISN C;  1QS4 A;  3VF6 A;  3G0Z A;  1X9W A;  3E9L A;  3M1F A;  3VOV A;  1Q82 O;  3SI6 A;  3VQ7 A;  3KHY A;  3AVG A;  2OPQ A;  4GW6 A;  1VSH A;  3SQ4 A;  4Z4I A;  1KVA A;  5CYQ A;  3WEE A;  3P39 A;  3VF2 A;  3LWM A;  2O8F A;  3JS6 A;  1QZ6 A;  3V9U A;  1YJW N;  5IWA K;  2YHX A;  3ZSV A;  4QS9 A;  3DLE A;  5AZJ A;  1Q81 O;  3EE9 A;  3P38 A;  4QOZ B;  4MQ3 A;  3O4W A;  3QBW A;  3O9R A;  4KTZ A;  3TSP A;  4WYB A;  3TAN A;  1C6V A;  3OHR A;  1C0M A;  4CZI A;  4CER A;  1OVQ A;  3QEW A;  3DM2 A;  4O8U A;  1E4G T;  5T7B A;  2NUB A;  4MDA A;  4N76 A;  1NK5 A;  4IWV A;  1BA1 A;  3CJA A;  4JRQ A;  3DLG A;  4E19 A;  4ELV A;  1HMV A;  3L3V A;  1WUA A;  3O9S A;  3EKU A;  1SL0 A;  4OLB A;  3AVH A;  1JLQ A;  2Q2R A;  5AQM A;  2E2Q A;  3NE6 A;  2D0C A;  2NRW A;  3E66 A;  2G8F A;  3H6E A;  3D2F A;  1NK4 A;  4CF1 A;  1VAZ A;  3ZEU B;  5LMN K;  4EZ6 A;  4KFB A;  2A41 A;  5M1F A;  1YI2 N;  1XMQ K;  3WNH A;  4M3W A;  3AVB A;  4B3S K;  2HMP A;  2Q3S A;  3PIO L;  1FW6 A;  1U48 A;  4FK4 A;  4GY2 B;  1RBU A;  3U9Z A;  5AQP A;  3NGZ A;  5J2P A;  4FWN A;  3ULE B;  1QSS A;  1JXE A;  1IO2 A;  4NCA A;  4A62 A;  4QS7 A;  1U49 A;  2IVP A;  4GKJ K;  4JYA K;  4IDK A;  4RW7 A;  4DQQ A;  3MXI A;  4O0I A;  3ASM A;  5FRO A;  3FZH A;  4DSJ A;  4GNI A;  2IOC A;  2D1K A;  4JV5 K;  4CZJ A;  3NDK A;  1S9E A;  3C95 A;  4BRQ A;  1TAQ A;  4B3O A;  1G15 A;  3KK7 A;  1VQ6 N;  4FWQ A;  4FWR A;  4DR5 K;  4B3T K;  3CCU N;  4HVJ A;  3THW A;  4FWO A;  4PKI A;  1F21 A;  3MED A;  2G8W A;  3OS1 A;  4CK1 A;  1E3M A;  4CEF A;  3T1Y K;  1ITG A;  4Y0W A;  1KLM A;  1LCU A;  4IOC L;  3EEQ A;  1S9G A;  4M3X A;  3LAK A;  3I0R A;  3DWL A;  1YIT N;  1ASW A;  4IJN A;  4DV5 K;  3PV8 A;  1RDA A;  3SAG A;  4KHS A;  2KFZ A;  2KLA A;  3QLH A;  5ELZ A;  4M7Y A;  3L2Q A;  1WLJ A;  5J2N A;  4BRP A;  3AA5 X;  2QA4 N;  2D0A A;  3VN5 A;  3CQY A;  4AM7 A;  3FLC O;  4BRG A;  3OYF A;  3RR8 A;  4BY9 C;  4ID5 A;  4CHQ A;  4BC4 A;  1HJO A;  3LL3 A;  4LF4 K;  4DQR A;  4B9T A;  1EX4 A;  4ISG A;  3R6M A;  4JI7 K;  4BRC A;  1QQC A;  4ZTJ A;  1VQM N;  4JI3 K;  4CJQ A;  1C0T A;  2P9S B;  1BQN A;  3THW B;  4FWS A;  3CD6 N;  1VQ9 N;  3NGI A;  4N5S A;  3BZK A;  3A2F A;  3DLK A;  2KFN A;  4WFA L;  4FOE A;  4J8F A;  1NJI O;  4FLU A;  3GBT A;  2UU9 K;  1WOQ A;  4K42 A;  1W0H A;  1T03 A;  4YOU A;  1Q18 A;  4CJU A;  2ZD1 A;  1GLB G;  2A5X A;  3ZCM A;  1XMO K;  1IKV A;  3NGY A;  2IS3 A;  2CGJ A;  3A5N C;  3OYK A;  4BRN A;  3TSU A;  4M63 C;  4DSL A;  3QIN A;  1FK9 A;  2QTD A;  3JAM O;  1YF5 L;  4RW4 A;  3V6D A;  3PX4 A;  4BR9 A;  2P9N A;  2OPS A;  3QB0 A;  3LZJ A;  3L2R A;  3KTQ A;  5KGW A;  3TU5 A;  1ZXO A;  4C8L A;  1NM1 A;  5LJW A;  2VYP A;  2HVI A;  4JI1 K;  2F7T A;  1S72 N;  2JLE A;  3BF1 A;  1RDC A;  2V7Y A;  4MO4 A;  2YJF A;  3WXK A;  1DTT A;  2E1Z A;  3ZT2 A;  3E9O A;  4FJ7 A;  3MEC A;  3UKR B;  3VQQ A;  1V4S A;  5JLF A;  1K73 O;  3P5J A;  1HYS A;  5F1X A;  3CCJ N;  1RBT A;  2P9U B;  1NGF A;  2DY4 A;  4IEI A;  3NFA A;  4BR7 A;  2E5L K;  4BRA A;  1NK7 A;  3TTD A;  2NRX A;  4I6M A;  1IKW A;  4GKK K;  3OBW A;  3WXL A;  2FC0 A;  3BP8 A;  4YDU A;  1GLE G;  2YKM A;  3CCE N;  2WOM A;  4FJN A;  4DR3 K;  5I42 A;  3OS0 A;  2CGL A;  5M1N A;  1TKT A;  4DSI A;  4CJF A;  3TR8 A;  3NF6 A;  3VEO A;  4CK3 A;  4BRE A;  1HKB A;  4DMN A;  1HNW K;  3AO3 A;  4OGC A;  4A57 A;  2Y1I A;  4LY7 A;  5JIC A;  3QET A;  2YNH A;  3C7N B;  4FWL A;  3H46 O;  2HHS A;  2O4I A;  4I2P A;  4CVN E;  2F8S A;  4ILG B;  4R79 A;  1TYQ A;  4KHN A;  3OW2 M;  1OH5 A;  1TUY A;  4K43 A;  4BWM A;  4FYD A;  4JD2 A;  1BOT O;  4DQI A;  4PKG A;  4JKB A;  4DWI A;  4I6M B;  2LSN A;  1OH6 A; 
#chains in the Genus database with same CATH homology
 1TAU A;  1TKZ A;  2EHG A;  1ASV A;  4DU4 A;  3RMD A;  3NF7 A;  4CEC A;  4OKJ A;  4DG1 A;  1DTQ A;  3TAP A;  4KB0 A;  3DOL A;  3OYI A;  3SNN A;  4FW1 A;  3SUQ A;  3PO5 A;  2OYQ A;  3SUP A;  3LP1 A;  1NJY A;  3OYA A;  2HHW A;  3DRP A;  3M8S A;  3TAR A;  3VQA A;  4Q5V A;  2YHB A;  1WSI A;  4RW8 A;  3VQB A;  1C1C A;  2OPR A;  4NYN A;  4O55 A;  3K5N A;  1HPZ A;  4I9L A;  3K58 A;  3K5L A;  3F73 A;  1K6Y A;  5J2M A;  1NKE A;  1L3T A;  1L3V A;  4C8K A;  3ZSQ A;  3QEV A;  4M42 A;  1VRT A;  3B6P A;  1GOB A;  1A5W A;  5HBM A;  4Z4H A;  4CFB A;  3WNF A;  4DFM A;  4E1N A;  3OYN A;  2WON A;  4CGH A;  3AO1 A;  3OJS A;  4FLZ A;  1X1P A;  3KLI A;  3EZ5 A;  3TAB A;  2PY5 A;  1KLN A;  4K8X A;  2VG6 A;  5SZT A;  1C1A A;  2B6A A;  5HRS A;  1U47 A;  4CEQ A;  3ALY A;  3KKS A;  3AVF A;  4DSK A;  1BI4 A;  2QXF A;  2E4L A;  2Y1J A;  4QAG A;  3AA2 A;  1Z26 A;  3UIQ A;  4CJR A;  4BE0 A;  4B9M A;  2JGU A;  1I39 A;  3AVK A;  3VA0 A;  3DRR A;  4PQU A;  4M3Y A;  1TK0 A;  4CJT A;  1IG9 A;  3OYH A;  4OKK A;  2GUI A;  4B9U A;  2XO7 A;  4M45 A;  2YNG A;  4KAZ A;  3L2W A;  3CG7 A;  1QSL A;  2I5J A;  1TKD A;  4CCH A;  2RF2 A;  1RDB A;  4HCB A;  3RWU A;  3DYA A;  3OVN A;  2XY6 A;  1UA1 A;  3HYF A;  1D9F A;  5E41 A;  3LWL A;  4KI4 A;  3QNO A;  2D5R A;  4DTJ A;  3D0P A;  2OZM A;  3F9K A;  4J2A A;  3ZSO A;  3OYL A;  3WNG A;  3QEX A;  3SPZ A;  1LW0 A;  4FJ9 A;  1KVB A;  3L2V A;  1T05 A;  4DLE A;  2HND A;  1SV5 A;  2GV9 A;  2AJQ A;  3S3N A;  3ZSX A;  1UWB A;  3HT3 A;  1RBS A;  4AHU A;  4FJK A;  4FVM A;  3QEI A;  2P1J A;  1S1W A;  1Y97 A;  2KZZ A;  1WN7 A;  3V1Q A;  1SKR A;  1YVU A;  3HPH A;  4AHR A;  4J2E A;  3AA4 A;  4AHC A;  4N41 A;  1FKP A;  1IH7 A;  3RMC A;  2XHB A;  3KD1 E;  4DTN A;  3NCI A;  4OPK A;  1KRP A;  2IGI A;  4FJM A;  4DTX A;  3LP2 A;  4LSL A;  3AVM A;  3O3H A;  3KK2 A;  3OYJ A;  3OJU A;  4FK0 A;  4FJG A;  4CGF A;  4KPY A;  3HJF A;  4R5P A;  4GMJ B;  3T1A A;  4DF4 A;  1XI1 A;  3TAQ A;  1NOY A;  1ZBH A;  4M41 A;  4IKF A;  1Q8I A;  5J2Q A;  3VQP A;  3P83 D;  2IAJ A;  3QER A;  4E7H A;  1N6Q A;  1BIU A;  5FDL A;  4QCL A;  5CZ1 A;  3RR7 A;  3OYB A;  4FM0 A;  2YNI A;  4FLV A;  1JL2 A;  1MU2 A;  2E6M A;  1BQM A;  2DFF A;  3IG1 A;  3IS9 A;  5CYM A;  4CJE A;  3HPO A;  3HVR A;  1RNH A;  4CJ3 A;  1JLC A;  4OKE A;  2ITG A;  3AO5 A;  4K8Z A;  2VG5 A;  3AA3 A;  1TKX A;  3SQ2 A;  1X9S A;  3VQC A;  4OLA A;  2QKK A;  4HUE A;  4Z4F A;  4BE2 A;  1HRH A;  1J53 A;  1WAF A;  4E1M A;  2B5J A;  1VSM A;  2Z1G A;  4CJ5 A;  3HXM A;  4Z4E A;  3TI0 A;  3DLH A;  4Y1D A;  4NCB A;  4FW2 A;  4C8N A;  1ZBL A;  4BDZ A;  3LAM A;  1QHT A;  2VG7 A;  3OYD A;  4NCG A;  2GBZ A;  1CXU A;  2BAN A;  5C25 A;  5SWM A;  3LDS A;  1R0A A;  4FXD A;  2YKN A;  3KIO A;  3THV A;  1SKW A;  3AO2 A;  3KKR A;  1SKS A;  3V9S A;  2QKB A;  4KB1 A;  4J2B A;  3ZSR A;  3OY9 A;  3K57 A;  1B9D A;  3VQ9 A;  3QES A;  2G8H A;  3LZI A;  2FBT A;  1NJZ A;  1LWF A;  1EKE A;  1O1W A;  3TAG A;  3O3F A;  4DQP A;  4WE1 A;  2RN2 A;  3CM5 A;  1B92 A;  3NHG A;  2G8V A;  4HCC A;  1U04 A;  2D0B A;  3OYG A;  3M8P A;  3WNE A;  2DFH A;  2BDP A;  4CF9 A;  4N47 A;  3RRG A;  2G8U A;  5KRT A;  1LW2 A;  4KV8 A;  1JXB A;  3MEE A;  4CEO A;  5DK5 A;  4PUO A;  3O3G A;  4B9N A;  3KLF A;  3LPT A;  3V1O A;  1WNS A;  2IDO A;  4CGJ A;  4BDY A;  1TK8 A;  3ISN C;  4EZ9 A;  3E01 A;  1RT7 A;  3HPG A;  1QS4 A;  4CF0 A;  5D3G A;  4J2D A;  3NF9 A;  3K2P A;  4JLH A;  3G0Z A;  3MXJ A;  3RMB A;  4MFB A;  1X9W A;  3ZT3 A;  4F3T A;  4BAC A;  3BDP A;  5CY4 A;  5CZ2 A;  4F3O A;  3SI6 A;  1TL1 A;  3VQ7 A;  3AVG A;  1FKO A;  3SUO A;  2VWJ A;  2OPQ A;  4GW6 A;  1VSH A;  4B9L A;  4KO0 A;  3SQ4 A;  1KVA A;  2VWK A;  4CEZ A;  1QE1 A;  3AVJ A;  3CYM A;  4BE1 A;  3RMA A;  4FZZ A;  4OJR A;  5CYQ A;  1NK8 A;  1RT2 A;  1YTA A;  3LWM A;  3O4Q A;  3V9U A;  4W5Q A;  3AO4 A;  4H4O A;  4RW6 A;  4W5T A;  1UAX A;  3ZSV A;  1C1B A;  3QEP A;  1VSE A;  4I2Q A;  4B08 A;  1NKB A;  1HJR A;  1RBR A;  3DRS A;  1RTI A;  3HL8 A;  3DLE A;  4GVM A;  4M3R A;  1S1V A;  2OA8 A;  4F2S A;  1U45 A;  1LAV A;  1VRU A;  4QOZ B;  2HB5 A;  1J54 A;  4MQ3 A;  3VQ5 A;  3DMJ A;  4KTZ A;  4CIG A;  1L3S A;  4FM1 A;  3V81 A;  3SQ1 A;  1S1U A;  4CF8 A;  1HQU A;  4FZX C;  4O0J A;  1GOA A;  2F96 A;  1C6V A;  1KTQ A;  3ZT4 A;  3TAN A;  4CIF A;  1TK5 A;  1C0M A;  4B9S A;  4CER A;  4CHN A;  3QEW A;  3DM2 A;  4JRP A;  3C94 A;  4Z4G A;  5T7B A;  2NUB A;  4N76 A;  4ZTF A;  3HK2 A;  1S1X A;  1NK5 A;  3SPY A;  1JLG A;  4DU1 A;  4JRQ A;  4E89 A;  3DLG A;  2FBX A;  4E19 A;  4ELV A;  1HMV A;  1RIL A;  3L3V A;  3ZSZ A;  3C6U A;  5HRN A;  1CLQ A;  1KSP A;  3ZSW A;  4OVL A;  1BHL A;  1LWE A;  2XY5 A;  4CJW A;  1SL0 A;  1QTM A;  3AVH A;  4OLB A;  4EP4 A;  4ZHR A;  4N56 A;  3EYZ A;  3TWH A;  1JLQ A;  3SCX A;  5HLF A;  4HUG A;  1TL3 A;  5C42 A;  3NE6 A;  3MAQ A;  4DTM A;  2D0C A;  3NH0 A;  1RTJ A;  2ETJ A;  4CEB A;  2G8F A;  1S6P A;  4DTO A;  4W5O A;  2FBV A;  1XHZ A;  4OPJ A;  3MEG A;  4M3T A;  3NH1 A;  1BIS A;  1RTD A;  1WSJ A;  1NK4 A;  3V9W A;  4CF1 A;  3KJV A;  2P5O A;  4EZ6 A;  4FJI A;  3NBP A;  4KFB A;  1JLB A;  4DSF A;  1CZ9 A;  4DS5 A;  4H8K A;  4DFK A;  4DTU A;  3WNH A;  1CXQ A;  4CJS A;  3AVN A;  3AVB A;  5KRS A;  3I8D A;  4M3W A;  1HQE A;  2Q3S A;  2HMI A;  1WSF A;  1A5V A;  1U48 A;  3HO1 A;  2KTQ A;  4FK4 A;  3CQ8 A;  4B8A B;  1JKH A;  1RBU A;  4F8R A;  4LH5 A;  4O4G A;  1J9A A;  3U3Y A;  3TAE A;  4B9V A;  1B9F A;  1XWL A;  3NGZ A;  5J2P A;  4FK2 A;  1QSS A;  2X6N A;  1JXE A;  1IO2 A;  4NCA A;  3DOK A;  2HNZ A;  1XHX A;  2OPP A;  4FLY A;  1U49 A;  4Z4I A;  4Q0B A;  4DFP A;  4CJP A;  4CGG A;  3CFR A;  5KGX A;  4KRE A;  3TAF A;  3QIP A;  4IDK A;  1ZBI A;  2HHX A;  4RW7 A;  4JS5 A;  3O4N A;  5KTQ A;  1S6Q A;  3ASM A;  4O0I A;  4DQQ A;  3MXI A;  4KHQ A;  4AHV A;  3SJJ A;  5FRO A;  3V9X A;  1I3A A;  3HP9 A;  1LWC A;  4B8C A;  4DSJ A;  3EY1 A;  1HNV A;  1KCF A;  4IG3 A;  4KHU A;  2IOC A;  3NDK A;  1S9E A;  2HNY A;  3MXM A;  3C95 A;  2ZE2 A;  1TAQ A;  4B3O A;  1G15 A;  3M8R A;  3U6F A;  1REV A;  3C6T A;  1LV5 A;  2FBY A;  4CED A;  4HVJ A;  4HHT A;  4CK2 A;  1QSY A;  2Z1I A;  3M8Q A;  3VQ8 A;  2PYJ A;  1F21 A;  1JL1 A;  3MED A;  3OS1 A;  2G8W A;  2HHV A;  4CK1 A;  3NF8 A;  2P5G A;  4CEF A;  1ITG A;  5HRP A;  1WSH A;  1WSG A;  3S3M A;  4FZY A;  1Q9Y A;  4RW9 A;  1KLM A;  5J1E A;  1C0U A;  4CIE A;  4UQG A;  1T8E A;  1S9G A;  2YNF A;  3LAK A;  4E7I A;  4M3X A;  4CEA A;  3I0R A;  1YT3 A;  3SUN A;  1KFD A;  4O5B A;  1ASW A;  1BCO A;  4DTS A;  1WAJ A;  3T3F A;  1HYV A;  1RDA A;  3PV8 A;  1L3U A;  4DU3 A;  1X9M A;  4CHO A;  4KHS A;  2KFZ A;  1Z25 A;  2P51 A;  4ID1 A;  3QLH A;  3OS2 A;  3L2Q A;  1BL3 A;  1VSI A;  4CJK A;  1HNI A;  2BE2 A;  2F8T A;  1WLJ A;  3KLG A;  4FJ5 A;  2A1S A;  3VA3 A;  5J2N A;  3I0S A;  3HM9 A;  3AA5 X;  2KQ2 A;  2RKI A;  3S3O A;  2D0A A;  3VN5 A;  1NJW A;  3RR8 A;  2X74 A;  3OYF A;  3OYM A;  1U4B A;  1HYZ A;  4ID5 A;  4ELT A;  3AV9 A;  4CHQ A;  2A1R A;  1UA0 A;  3NH2 A;  5HP1 A;  1IKX A;  4DQR A;  1KVC A;  1EX4 A;  1TVR A;  4DQS A;  4B9T A;  4AHS A;  2BGG A;  4CJV A;  3K5O A;  1JLA A;  1D8Y A;  1UOC A;  2ATQ A;  3T19 A;  2Z1H A;  2QK9 A;  4ICL A;  2Z1J A;  1QQC A;  3SV4 A;  1VK0 A;  4ZTJ A;  1L5U A;  2HVH A;  1BI4 B;  4CJQ A;  4XIU A;  1C0T A;  2DFE A;  1BQN A;  3LP3 A;  4FCY A;  1NOZ A;  4BDP A;  4PA1 A;  3ZT0 A;  2HHU A;  4KRF A;  1D9D A;  4KHW A;  3NGI A;  4N5S A;  5KI6 A;  2R7Y A;  3A2F A;  3ITH A;  1SL1 A;  1YTU A;  3DLK A;  2KFN A;  3HP6 A;  4PY5 A;  1N5Y A;  4FLU A;  3V9Z A;  2B4J A;  3DLR A;  4KTW A;  4E0D A;  3TAM A;  4C8M A;  1W0H A;  3SYZ A;  3U3G A;  3L3U A;  1T03 A;  3KK3 A;  3KLH A;  4CJU A;  3RRH A;  3LPU A;  4LSN A;  2ZD1 A;  4E3S A;  2W42 A;  3H08 A;  4I7F A;  3VQ4 A;  3ZCM A;  4AH9 A;  2XRI A;  4CFA A;  2IC3 A;  3AVC A;  1IKV A;  3PX0 A;  1BGX T;  1WSE A;  3NGY A;  4OGE A;  2IS3 A;  4L8R B;  2HW3 A;  1IKY A;  2KZM A;  1TV6 A;  4CE9 A;  2RPI A;  3OYK A;  3KLE A;  3NAE A;  3RTV A;  4NYF A;  4E7L A;  2E6L A;  3KK1 A;  5DMR A;  3VQE A;  1W9H A;  3ULD A;  4FJX A;  4DSL A;  3QIN A;  1FK9 A;  4AIL C;  1VSJ A;  4FJL A;  3S9H A;  3SZ2 A;  3PO4 A;  4RW4 A;  3V6D A;  3IAY A;  4M3Z A;  1TGO A;  3PX4 A;  3AVL A;  3V1R A;  4FM2 A;  4I9Q A;  2OPS A;  1EXQ A;  4DF8 A;  1S5J A;  2X78 A;  5JS2 A;  4O44 A;  4JS4 A;  3ZSY A;  3LZJ A;  2PZS A;  3B6O A;  3L2R A;  4LD0 A;  4DTR A;  4IFV A;  4CHY A;  3KTQ A;  3JYT A;  5KGW A;  1EP4 A;  4CFD A;  4DTP A;  3JSM A;  1GOC A;  4C8L A;  4KI6 A;  4KKO A;  4FLT A;  2HVI A;  4F2R A;  3HVT A;  5C24 A;  1VSD A;  3SQ0 A;  1RT4 A;  4DLG A;  1FXX A;  2JLE A;  5FRN A;  1DLO A;  4HUF A;  3AVI A;  4BWJ A;  3V4I A;  4CF2 A;  3CFP A;  1RDC A;  4IG0 A;  4LH4 A;  4CGI A;  4YNQ A;  1Q9X A;  1SL2 A;  1DTT A;  3PUF A;  5HRO A;  3ZT2 A;  5I3U A;  4FJ7 A;  1VSF A;  3KD5 E;  3MEC A;  3VQQ A;  1RCH A;  4IBN A;  3P5J A;  4ELU A;  1HYS A;  1RBT A;  2G8I A;  3K5M A;  3P1G A;  3ZT1 A;  2PYL A;  2DY4 A;  1A5X A;  2YV0 X;  3DI6 A;  3NFA A;  4CJ4 A;  1NKC A;  3PY8 A;  5JS1 A;  4CEE A;  3D45 A;  3L2U A;  4E7K A;  1SUQ A;  3G10 A;  3LAN A;  3OYC A;  1KFS A;  1NK7 A;  1S1T A;  1IKW A;  4RG8 A;  3K59 A;  4Y1C A;  4HTU A;  2FC0 A;  3SV3 A;  1RDD A;  2YKM A;  4KTQ A;  4H4M A;  4TSX A;  2WOM A;  1NJX A;  4DS4 A;  3DLB A;  4KHY A;  1RBV A;  1ASU A;  1RT1 A;  4FJN A;  5I42 A;  1ZBF A;  3OS0 A;  2EX3 A;  1TKT A;  1VSL A;  4CES A;  4DSI A;  1RT5 A;  4CJL A;  1ZYQ A;  4FJH A;  4CJF A;  3TR8 A;  3NF6 A;  4CK3 A;  1D5A A;  1RT3 A;  4DSE A;  4DMN A;  3HST B;  5HRR A;  4FJ8 A;  4CGD A;  2X6S A;  3AO3 A;  3LP0 A;  4OGC A;  4CFC A;  1NK6 A;  2HHQ A;  4CHZ A;  4W5N A;  1RT6 A;  4Z4C A;  2Y1I A;  2DTU A;  2O4G A;  4LY7 A;  2OZS A;  3QET A;  2YNH A;  3CFO A;  1BIZ A;  4CHP A;  2HHS A;  3QO9 A;  1CZB A;  5K14 A;  4M3U A;  2G8K A;  4F4K A;  4FLX A;  2O4I A;  5FRM A;  2ZQB A;  3L8B A;  4E7J A;  2XY8 A;  1J5O A;  4YFU A;  3QNN A;  3CM6 A;  4W5R A;  2XY7 A;  4I2P A;  3FFI A;  1JLF A;  2KW4 A;  4Z0U A;  1T7P A;  1NK0 A;  2F8S A;  3VQD A;  2HHT A;  1RTH A;  5EU7 A;  4AHT A;  3PX6 A;  4C8O A;  2YHA A;  1LAW A;  3LAL A;  4KHN A;  1JLE A;  3OYE A;  4G1Q A;  4DFJ A;  3QIO A;  1EET A;  3AVA A;  4BWM A;  1ZBU A;  4FYD A;  1BCM A;  3BGR A;  3IRX A;  4FLW A;  4DQI A;  4FJJ A;  4PWD A;  1VSK A;  1NK9 A;  4EP5 A;  3VQ6 A;  4DWI A;  2LSN A;  4IFY A;  1XC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...