4CK2A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
154
structure length
150
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 56
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ck2A00
4CFBA 4Z0UA 3DLKA 3MEGA 4CHYA 2HHTA 1S9EA 1VK0A 3HYFA 4FZZA 4DTUA 3VN5A 2OYQA 4N56A 4I7FA 4KHWA 1YTUA 1U49A 3HM9A 4KHQA 3TWHA 5CZ1A 2AJQA 3VA0A 4FZYA 4ELVA 2LSNA 1C0MA 4CGFA 4F2RA 1TK8A 4MFBA 3TAGA 3S3OA 2VWJA 1QSSA 1KTQA 3AVBA 1KRPA 4DLEA 4E1NA 4J2BA 2IC3A 3HK2A 3AA2A 4ELTA 2BGGA 3QIPA 4CECA 4M3ZA 3WNFA 3U3YA 4J2AA 4OGCA 3K59A 4CIEA 3K5NA 3MAQA 2D0CA 3L2UA 4NCAA 3U6FA 2G8HA 3MEDA 1EETA 3LANA 4E7LA 4CEBA 1Z26A 3S3NA 1S5JA 1TL3A 1U45A 1ZBHA 3E01A 5HBMA 4OPJA 1R0AA 2D0AA 3C6UA 5J1EA 3SI6A 3M8QA 3QEXA 4CF1A 4B08A 1CXUA 1Q9XA 2DFHA 1JLAA 4OPKA 3OY9A 4CGGA 1U4BA 3K5MA 2Y1JA 1NJZA 3CFOA 4RW6A 3DLRA 3OYMA 3RMAA 4GW6A 4TSXA 4CJ3A 4HUFA 3SUOA 3V1OA 3TAEA 1BIZA 3NF7A 1RILA 2JGUA 1D9DA 2A1SA 3AO1A 4FJ8A 1IKVA 1WNSA 4CIGA 4OLBA 3QIOA 1RNHA 3NH1A 4CGDA 4ZHRA 3AO4A 2BE2A 4AHRA 2GUIA 2RF2A 4GMJB 1LW0A 5DMRA 3VQ7A 4FLVA 4DU3A 3SUPA 4N76A 1IKXA 1RDAA 4J2EA 4AHUA 4CJEA 4IFYA 4XIUA 1RT6A 3ASMA 3S3MA 3NE6A 4QOZB 4BDYA 5C42A 5JS2A 2FBTA 1JLFA 2P51A 3IS9A 3V1RA 3OS2A 4DS5A 3LZIA 2OZMA 3KLHA 1HNIA 1VSJA 2ETJA 2YNIA 4HHTA 4DS4A 1IKYA 2RKIA 1VRUA 5J2MA 3SPYA 4E0DA 2X74A 2VWKA 4Q5VA 1BQNA 2VG7A 3DMJA 1J54A 3KKSA 4M41A 3MXMA 1NOYA 1BI4A 4CK2A 3LWMA 3PO5A 4KHSA 1CLQA 5CZ2A 4W5NA 4J2DA 1NK4A 1QS4A 3QO9A 2VG5A 3SNNA 1RT4A 1TV6A 3VQPA 4CIFA 5HP1A 2KFZA 3VQ5A 1HYZA 4RW4A 2XY5A 2HMIA 1TAQA 1HPZA 2XRIA 3LPUA 4H4MA 1T7PA 1VSFA 3KLEA 1L3UA 1S9GA 1CXQA 3L3UA 4KREA 1W9HA 1S1WA 1RTDA 4ID5A 1ZBIA 2G8IA 1HJRA 4C8LA 5KGWA 4CHQA 1REVA 1D5AA 1RT3A 4FLXA 3ZSXA 1Q9YA 2G8KA 1RT1A 3PX0A 1HNVA 3OYDA 4O55A 3U3GA 2Z1HA 1BGXT 1XHXA 3SJJA 1IG9A 3DI6A 1HRHA 4NYNA 4CGJA 1D9FA 1QTMA 3DLHA 3LAMA 3TR8A 2YKMA 1RDDA 4GVMA 3DRPA 3OYIA 3V9ZA 1QSYA 2OA8A 4DWIA 4HVJA 3LPTA 4KB0A 3V9UA 1TVRA 3OYCA 3V9SA 3SZ2A 3BDPA 2I5JA 2ZD1A 1VSHA 4C8MA 5J2PA 4M45A 1QSLA 3NHGA 2FBYA 1DLOA 4WE1A 1K6YA 1EXQA 3KK2A 2PYJA 2XY8A 3RR7A 5CYMA 3ZSZA 1ZBLA 2FBVA 1U04A 1KVCA 2IDOA 1LWEA 4B9UA 3PX4A 2G8UA 3AVGA 1YTAA 3T1AA 2W42A 2PY5A 1T05A 3IRXA 1C0TA 1JLCA 1RT7A 4AH9A 4CE9A 2HVIA 2D5RA 3ZSQA 1JL2A 2EX3A 4FK4A 2HHSA 4E7IA 1KLNA 5J2NA 3MXJA 4NCGA 1NK5A 4FM1A 4FJGA 4NCBA 4OLAA 3AVNA 5C25A 4FLWA 4FLTA 3TAPA 4YNQA 1Z25A 3BGRA 1O1WA 3KKRA 4LSNA 4O5BA 3HT3A 3K5LA 1D8YA 2HNZA 4KB1A 2A1RA 1SV5A 2YNHA 4B9LA 1C1CA 4AHTA 4IKFA 3OYJA 3I0SA 1RBSA 1X9WA 4G1QA 4CEAA 4CEDA 2HHUA 1RBUA 2KW4A 4BE2A 4HCBA 1I39A 3L2QA 3AVJA 4EZ6A 1JLGA 2GBZA 3AVIA 4DSLA 4C8OA 4DFJA 4DSJA 4KHNA 1Q8IA 3OS0A 5I42A 3ITHA 2P5GA 3EY1A 4CCHA 1UA0A 4DQIA 3I8DA 4FZXC 2YKNA 4CJUA 2Z1IA 4IFVA 3WNEA 1JXBA 4Q0BA 4FW2A 3ZT3A 1L3SA 2HW3A 4DSIA 4CEFA 3ZT0A 2WONA 4JLHA 1WN7A 5FRNA 3RMCA 1SKSA 1I3AA 1WSEA 1WSFA 1KVAA 4FM2A 4DLGA 4B3OA 1TAUA 1ZBUA 4IG0A 1DTQA 4Z4IA 2B5JA 3K58A 1IO2A 2DTUA 4B8CA 4W5QA 4F8RA 2HNYA 3V4IA 2X6NA 3NGYA 4CFDA 1L5UA 3SQ2A 2E4LA 2QXFA 1HYVA 5J2QA 3AVFA 4CJSA 4Z4CA 1C1AA 1IKWA 4H8KA 4CHOA 3NCIA 1LAWA 4B9VA 4OKKA 1QQCA 4CF2A 3OJSA 4DU4A 3KLIA 1FKPA 2WOMA 4HUEA 1LWFA 4LH5A 3M8RA 3NF8A 4DSKA 4L8RB 3OYEA 1W0HA 3O4NA 3AO3A 2O4GA 2ZE2A 3DLGA 3O3GA 1FXXA 3RTVA 1X1PA 4FJ9A 4E89A 1QHTA 3OYLA 3VA3A 4LH4A 5HLFA 1G15A 3THVA 1TKTA 3ZT4A 4HUGA 4FJ5A 4KTQA 1XWLA 1A5WA 4E19A 3DM2A 3OYHA 3AVAA 3FFIA 2F8SA 1YT3A 3SQ0A 4F2SA 4CF8A 4CJWA 3MXIA 3C95A 1JKHA 1NK0A 3VQEA 3ZSOA 4CHPA 4RW7A 5HRNA 5T7BA 4DTRA 1S1TA 4DFPA 3SQ1A 2ATQA 3AA3A 3ZSRA 3QEIA 3G0ZA 4MQ3A 1T8EA 4K8ZA 4PY5A 3L8BA 3ZT2A 2E6LA 4N41A 4DQRA 4FJ7A 1EX4A 3ZSYA 4B9NA 5KRSA 3LAKA 2PYLA 1BIUA 1NKCA 1C6VA 4O0JA 3QNOA 3OJUA 4F3TA 1RBRA 1J9AA 3B6OA 3VQBA 5HRSA 1GOAA 4FJNA 1NKEA 1A5XA 1S6PA 1GOCA 4CEZA 3TAMA 4LD0A 1LAVA 2Q3SA 5KI6A 4CJKA 1ASWA 3I0RA 4FJJA 4FCYA 4CJRA 3SUQA 4M3RA 3HJFA 4I9QA 3LDSA 4FYDA 3ZT1A 2G8FA 3AO2A 2YHBA 3L2RA 4DSFA 1XHZA 1ZYQA 4DFKA 3VQ8A 4M3YA 1JLQA 2HNDA 4CFCA 3JYTA 2QK9A 4B9TA 2P5OA 3MECA 2E6MA 4KV8A 3O3HA 2IOCA 5DK5A 3HXMA 3CFRA 1N6QA 2OZSA 3B6PA 2BDPA 4FJXA 3CM6A 4I2PA 1Y97A 5E41A 4DTPA 4H4OA 1GOBA 3PUFA 4DFMA 1ASVA 4CERA 2HVHA 2G8WA 2KZMA 5KRTA 1TK5A 3AVCA 1TK0A 2PZSA 3RMBA 4Z4EA 3QINA 2KFNA 3ZCMA 4CK1A 1VSIA 1RTJA 2Z1GA 3P5JA 4OVLA 4CESA 3RWUA 4IBNA 4IG3A 4QAGA 3LWLA 1JXEA 5HRRA 3RMDA 4YFUA 2YHAA 3RRGA 5CY4A 4CJVA 4FM0A 4RG8A 1L3TA 4CJFA 3OS1A 4CFAA 1HMVA 3KIOA 4LY7A 4PWDA 1RTIA 4UQGA 2QKBA 3HPOA 1J5OA 1B92A 2FC0A 4CGIA 3D0PA 3NF6A 3OYNA 1S1VA 4CJQA 3A2FA 4KI4A 1HYSA 3VQ6A 3L3VA 4HTUA 1DTTA 3TAQA 4JRPA 4QCLA 1NJXA 3V9XA 2IS3A 1NKBA 4KFBA 4FK2A 4JRQA 4JS5A 4M3TA 4W5TA 4FJLA 1C0UA 1NJWA 4W5RA 1X9MA 4F3OA 2HHVA 1VRTA 4OKJA 5EU7A 5FRMA 4BWMA 1SKWA 2YV0X 3EYZA 2HHWA 3HP9A 3AO5A 4Z4HA 3PY8A 4HCCA 5SZTA 4E7KA 1LV5A 4FK0A 1RBTA 4CEOA 5FDLA 1B9DA 3P83D 3CYMA 4IDKA 4BWJA 2F96A 1SL2A 4FLYA 1C1BA 1N5YA 3CM5A 1BL3A 3G10A 3HPGA 4OKEA 1WAFA 2HB5A 1RTHA 4RW8A 4FLUA 4DMNA 3KK1A 4CJTA 2R7YA 3T3FA 3EZ5A 4FJIA 4KAZA 3L2VA 1WSIA 4BACA 3TI0A 4ID1A 1BCOA 3RR8A 4FVMA 2FBXA 4KHYA 3AA4A 4O44A 4Y1CA 3F9KA 4O0IA 4Z4GA 2ITGA 1BI4B 3PX6A 3AV9A 3TAFA 4KTWA 4CJPA 3CG7A 4AHVA 1KSPA 3ALYA 1B9FA 1RCHA 1VSLA 2D0BA 3JSMA 4ZTFA 1KFSA 3AVHA 4CGHA 4DTOA 2XO7A 2P1JA 5HRPA 3V1QA 4B8AB 1T03A 4E7JA 1ITGA 1RT2A 1UWBA 3LP0A 3QERA 3HPHA 3LP3A 4DQPA 3KJVA 5D3GA 4LSLA 4F4KA 5KTQA 3HP6A 3P1GA 1X9SA 4CEQA 3AVKA 3NDKA 2OPPA 3DLBA 4PUOA 2ZQBA 1YVUA 1TKDA 1NK9A 3D45A 2XY7A 3KLGA 3KTQA 3WNHA 3AVMA 3OYFA 1LW2A 1F21A 4ICLA 1UAXA 4CJ5A 1JLBA 3V6DA 1RDCA 1VSMA 1RT5A 4DSEA 2IGIA 4CHNA 3SYZA 1WSHA 3MEEA 3K5OA 4Y1DA 3V81A 4M42A 1TL1A 1ZBFA 5I3UA 4E1MA 3SPZA 1KCFA 4OJRA 3K2PA 3QLHA 4E3SA 3T19A 1KVBA 4FJMA 3CQ8A 3KK3A 2EHGA 4DU1A 1NK8A 1A5VA 1RBVA 2VG6A 3SQ4A 1U48A 1BHLA 4KRFA 3NH0A 4KPYA 2OPRA 4FW1A 3AVLA 1BISA 4JS4A 1KLMA 2B4JA 3VQQA 3WNGA 1MU2A 4DTMA 2OPQA 3S9HA 3DRSA 1SKRA 3M8PA 3UIQA 3CFPA 3VQCA 1S1XA 1WLJA 4I2QA 4DF4A 3HVTA 2DFFA 1KFDA 4KTZA 1LWCA 5FROA 4BE1A 3VQ4A 1XC9A 4PA1A 1VSEA 3LP2A 1FKOA 2BANA 4NYFA 4C8NA 3QEVA 3V9WA 4B9SA 3F73A 3O3FA 2GV9A 1WSJA 2NUBA 2RN2A 3L2WA 1RDBA 1BQMA 4AILC 3H08A 1CZBA 1XI1A 1L3VA 2RPIA 3QNNA 2G8VA 3PO4A 4Z4FA 3SUNA 3DOLA 4FJHA 2Z1JA 4FLZA 3OYGA 1JLEA 4KI6A 2HHXA 4M3UA 4AHSA 4O4GA 1JL1A 3KD5E 3PV8A 1TKXA 3AA5X 4PQUA 3DLEA 2KZZA 2OPSA 4CHZA 3NH2A 3KLFA 3IAYA 1FK9A 3QEPA 2XY6A 4BDPA 3VQDA 4DF8A 2YNGA 2DY4A 4EP4A 4CK3A 3OYKA 1SL0A 1NJYA 3HO1A 2B6AA 4OGEA 4DQQA 3K57A 3LP1A 4E7HA 4EZ9A 4RW9A 4DTSA 1J53A 1SUQA 3ZSWA 1BCMA 1S6QA 2DFEA 2YNFA 1EKEA 5CYQA 3VQ9A 3SCXA 4FJKA 4DQSA 3KD1E 4BDZA 3QESA 1ASUA 1EP4A 3HL8A 3ZSVA 4N5SA 3HSTB 3TANA 3C6TA 4CF0A 3DYAA 4DTXA 1CZ9A 1U47A 3SV4A 4R5PA 4K8XA 3NAEA 4W5OA 3NBPA 5HROA 4CJ4A 3NGIA 3DRRA 1TKZA 3SV3A 2IAJA 5K14A 4ELUA 4DG1A 1WSGA 1UA1A 2X78A 3IG1A 1WAJA 1TGOA 3ULDA 4CJLA 5SWMA 1QE1A 1SL1A 1VSKA 3M8SA 2X6SA 3LALA 3RRHA 4M3WA 2QKKA 3TABA 4ZTJA 2O4IA 4FXDA 3NGZA 4DTNA 2HHQA 4KKOA 2Y1IA 1NK6A 4CEEA 2F8TA 4DTJA 1NK7A 1S1UA 1IH7A 3O4QA 3OVNA 3QETA 2KTQA 1HQEA 1HQUA 4I9LA 4M3XA 4B9MA 3ISNC 1VSDA 3LZJA 3DOKA 4N47A 3C94A 4EP5A 2KQ2A 4BE0A 5C24A 3VQAA 5JS1A 3TARA 1NOZA 3NFAA 3OYBA 1UOCA 3QEWA 3NF9A 3OYAA 3HVRA 4KHUA 4KO0A 4CF9A 2JLEA 5KGXA 4AHCA 4C8KA 2XHBA
chains in the Genus database with same CATH superfamily
4U67L 4Z0UA 4FZZA 3QFPA 4DTUA 3VN5A 2OYQA 1NBWA 4N56A 4KHWA 3MN6A 1U49A 2VGMA 4KHQA 1TUYA 4JEPA 4FZYA 2UUAK 3OBYA 4F2RA 4MFBA 3S3OA 2E2OA 2QM1A 3GG4A 4E1NA 3HZ6A 4BR4A 3PSIA 3ULEA 3U3YA 4J2AA 4OGCA 3K59A 4CIEA 3L2UA 4CZLA 2FSJA 3CJ7A 3U6FA 3MEDA 3E9OA 5EVZA 1S5JA 5JVHL 1VQKN 3EO3A 5HBMA 1R0AA 1NGFA 5BR9A 1ATNA 4C23A 4CF1A 3T1HK 3K5MA 1U4BA 4M7YA 2UYTA 2QWMA 4GW6A 2HHHK 4HUFA 4K25A 4DKWA 3V1OA 1BIZA 2P9LB 3E1YA 4FJ8A 2A1SA 3WEEB 1WNSA 4CBXA 4ZHRA 3R1XA 3D6RA 2BE2A 2RF2A 3BZKA 2Q97A 3LM2A 1RDAA 4IFYA 3ASMA 4QOZB 3KWGA 4MO5A 4MLHA 1JLFA 2P51A 5AQZA 4DS5A 3KLHA 4QS9A 3W3DA 5J2MA 1NGJA 5GADP 2X74A 2VG7A 3KKSA 4M41A 3PO5A 4CK2A 2PFUA 3SK3A 2P9KA 4JI6K 1TV6A 3VMFB 1TAQA 1T7PA 1VSFA 3KLEA 4KREA 1RTDA 4Y0WA 4J8FA 3SJHA 1KXPA 4CHQA 1REVA 4FLXA 4X65K 5KQ8A 1RT1A 1HNVA 2NRHA 4BRKA 3P31A 3A5MC 2A40A 3DI6A 4CGJA 1D9FA 3LAMA 4GVMA 4BC3A 3DRPA 4HVJA 4KB0A 1TVRA 4DCHA 1VSHA 5M1PA 4C8MA 2FBYA 3S41A 3KK2A 3FZFA 1KVCA 2IDOA 3O80A 3QBXA 2QW9A 4XH5A 1YTAA 3IRXA 1C0TA 3GL1A 5LMUK 5GIPA 4BRDA 1KLNA 2O8EA 4FM1A 2WBNA 2NRWA 4FLWA 4KH6A 4NLBA 3HT3A 4KB1A 2YNHA 2Q0RA 2GX9A 4CEDA 2HHUA 4DHYA 4YHHK 3RSEB 4B1XB 1NG9A 3L2QA 1NGHA 3VF6A 1Q8IA 3D2EB 3ITHA 3EY1A 4RCHA 1GLCG 2YKNA 4MDBA 3CCVN 1VQNN 4Z94A 4WFNL 5F2RA 5FRNA 2V7ZA 4B3OA 1ZBUA 3ZX2A 2IVNA 2AP1A 2DTUA 4I6MB 4JYAK 2NNWA 3VEXA 3SQ2A 2E4LA 2QXFA 1HYVA 2CH6A 3WXIA 4CJSA 4Z4CA 1C1AA 4XH1A 1IKWA 1HKGA 4H5VA 1LAWA 4DU4A 1TUUA 3QFUA 4L8RB 4JHDB 1YI2N 4O5FA 3OYEA 3AO3A 2O4GA 3CQXA 1EO1A 3CMAN 3B8AX 4KTQA 3MN5A 2Q36A 3FFKB 4HUGA 1FJGK 3EE9A 3UKRA 3FFIA 1YT3A 4CF8A 1J5EK 3ZLJA 3VQEA 4CHPA 5HRNA 4RW7A 4DTRA 1S1TA 2ATQA 3AA3A 2ZM6K 4MQ3A 1MA9B 2UXBK 3Q7BA 4N41A 3VERA 2JWKA 4B9NA 2PYLA 1BIUA 4PKHA 3UB5A 3QNOA 3OJUA 4H5WA 1RBRA 5M1KA 3Q7CA 1IJJA 3FGUA 5C10A 2Q0UA 4IOCL 1LAVA 2Q3SA 5KI6A 3K0SA 4IXCA 1Q81O 3EEQA 3I0RA 2QEXN 4A5BA 4DV1K 4M3RA 5DM6L 1ZYQA 4DFKA 4BRAA 4CFCA 2HNDA 3JYTA 1N36K 1ATRA 4YOVA 2QK9A 4UY8O 5AJ3K 5TKYA 3DLLL 4LF9K 4FJXA 1Y97A 2E1YA 4DTPA 2HF3A 3R9PA 3PUFA 3LM9A 1JCFA 4CERA 3T69A 3AVCA 1TK0A 1DEJA 1GLFO 2RE2A 1VSIA 3P5JA 4OVLA 3ULEB 3EZWA 2ASPA 3RMDA 2UXDK 3SAGA 4CJVA 4BVPA 4CFAA 1NGBA 4UQGA 1B92A 3D0PA 3NF6A 1N33K 4CJQA 3L3VA 3TAQA 2NRZA 5CE3A 3PIPL 1NKBA 4JRQA 1EWRA 1XMQK 1C0UA 5FRMA 5EU7A 1SKWA 1W97L 1GLBG 3M5RA 1SZ2A 3F9MA 4Z4HA 1FW6A 3PY8A 4CZHA 1RBTA 5FDLA 1B9DA 4BWJA 4IDKA 1RFQA 2F96A 4H0VB 3G10A 3VF4A 1NMNA 5AQVA 2R7YA 3EZ5A 4FL9A 4KHYA 4NXMK 4Z4GA 4BY9C 5AQSA 5C12A 3CG7A 4M3XA 2P9KB 1RCHA 4ZTFA 2D0BA 2XO7A 2H3GX 2P1JA 4WFBL 5D3GA 4FSVA 3LP0A 2QWPA 4LSLA 1NWKA 3CC2N 2OPPA 3TSUA 4IOAL 5C2DA 1YXQA 4FOEA 3WNHA 1LW2A 1K73O 1VSMA 4DSEA 4FWNA 3SYZA 2Q1NA 1HNXK 1TL1A 4BQZA 4KH5A 1KCFA 1XUPO 1VQLN 3T19A 1KVBA 3CQ8A 3BP8A 5KPTA 1NK8A 1U48A 4YDUA 2OPRA 1U2VB 2F9TA 4JS4A 1V4SA 3VQQA 4H03B 3VENA 3CCJN 3M8PA 2GEMA 2OTJN 1WLJA 4I2QA 1YJWN 1RDWX 1VQPN 4R79A 3VQ4A 4CVNE 4JKGA 1BDGA 1FKOA 4B9SA 3O3FA 2RN2A 4DFJA 1XMOK 1HR0K 2G8VA 4G9ZA 1LCUA 2O8EB 3ZETB 2NRTA 4BGBA 4FVUA 3CCSN 3PV8A 3AA5X 3MCPA 2OPSA 4CZJA 4B1UB 2BTFA 1ZBSA 3F5TA 2WTUA 2XY6A 4JI3K 4BDPA 4DF8A 4EP4A 4CK3A 3DXMB 3HOSA 5AQKA 1S72N 3HO1A 3O9TA 2YCHA 3LP1A 4RW9A 4DTSA 4JRPA 1S6QA 5CYQA 3SMSA 4BC5A 3KD1E 3QESA 2E2NA 4PKIA 1EP4A 4N5SA 3HSTB 3C6TA 4DTXA 4R5PA 1TKZA 4DG1A 1WSGA 5AQXA 5I9EB 1KD1O 4CJLA 2YJFA 3CQYA 3C6HA 1VSKA 2HBLA 3LALA 5FPDA 4ZTJA 4KKOA 2Y1IA 1NK6A 2F8TA 3OVNA 1BUPA 1QVGM 1HQEA 1HQUA 1TYQA 3DOKA 4N47A 4CBWA 2KQ2A 5C24A 4IJAA 3VQAA 4C1NK 1NOZA 3NFAA 3QEWA 3THXA 3NF9A 3OYAA 3HVRA 4KHUA 5AQOA 1HNWK 4V19S 4C8KA 5LJWA 4CFBA 4BRNA 3DLKA 3MEGA 5FPNA 4BRHA 4JKHA 3UKRB 5BRHA 4DB3A 4QS7A 3GDQA 1YTUA 2NRRA 1NGEA 3VEYA 3HOTA 3TWHA 3L6QA 3NVMA 3E9PA 2LSNA 4MLEA 4ELVA 5IT9O 4K43A 3TAGA 1QSSA 1KTQA 3AVBA 1KRPA 4J2BA 3JXUA 4ELTA 2V52B 4YOXA 3S3NA 1U45A 4LFCK 3E01A 2IVOA 3O8MA 4H0YB 2DFHA 1JLAA 3OY9A 3OBWA 3OYMA 3U9DA 3RMAA 1R59O 1YVNA 1WBBA 2I7NA 3NF7A 1D9DA 3DWLA 3A8YA 1RNHA 3IKMA 3J8AA 4EFHA 4DU3A 4J2EA 2V51B 4A2AA 4CJEA 1RT6A 3S3MA 4BDYA 4LF6K 3V1RA 1ILYA 2OZMA 2ETJA 1IKYA 5GAHP 3L4IA 5AQQA 4Q5VA 2VWKA 1Y64A 3MXMA 5C15A 1NOYA 1BI4A 4KHSA 1CLQA 4FWPA 3O6WA 2P9PA 5CZ2A 2ZJRL 4W5NA 4H0OA 4XEIA 5F1XA 5JMVA 4A57A 2HMIA 2XRIA 2UXCK 3WUHA 1L3UA 3U8XA 1W9HA 3CCMN 1SAZA 2G8IA 1WB9A 4DUZK 4JI1K 4NO7A 1D5AA 1SS6A 3DJCA 3A5LC 5F0XA 3U3GA 2WUSA 1BGXT 3GBTA 1XHXA 1SQKA 3A5OC 1QTMA 3TTFA 1RDDA 1CZAN 3OYIA 3LPTA 1NJIO 3OYCA 3V9SA 3SZ2A 3BDPA 2ZD1A 1BA1A 3ZEUA 1QSLA 3NHGA 1DLOA 4WE1A 1EXQA 5AFUH 3J7YP 1J6ZA 2XY8A 3ZSZA 2FBVA 1KQSM 2VGNA 5M1NA 1LWEA 4FO0A 2WFBA 5CR4A 3T1AA 4OPAA 2PY5A 2BH1A 4BC2A 3OA9A 2EX3A 2P9SA 2HHSA 1NK5A 4FJGA 4OLAA 1WUAA 3MCAB 4LSNA 4JI7K 1D8YA 4JKBA 4A5AA 2HNZA 1OKJA 2E5LK 4B9LA 3I0SA 4LF7K 1E4GT 5MLCQ 4HCBA 3AVJA 2GBZA 4DSLA 3I33A 4DSJA 5I42A 2YX6A 1HUXA 4DQIA 2Z1IA 4IFVA 4JKGB 1JXBA 4Q0BA 1L3SA 4CEFA 3ZT0A 2E8AA 5BRFA 3CCLN 1VQ6N 4FM2A 1KVAA 1TAUA 4IG0A 5JICA 3N4QA 3I56N 3K58A 4W5QA 5AQPA 4F8RA 2HNYA 3V4IA 2O8DA 2IVPA 5J2QA 5LJVA 3VTIA 3NCIA 4B9VA 1QQCA 3CHWA 3KLIA 1VQ9N 4DSKA 3P39A 4DR3K 4BR7A 1FXXA 1X1PA 4FJ9A 2E1ZA 4E89A 4OX9K 3ZT4A 3D7EO 2F8SA 4F2SA 3SMPA 3ATVA 3MXIA 3C95A 1NK0A 2I7PA 3ZSOA 3ZSRA 3G0ZA 4H0TB 4FPAA 4FWMA 3ZT2A 3L8BA 4ILJA 4FJ7A 3ZSYA 1T3VA 3LAKA 5LY3A 5ADXA 1J9AA 3VQBA 5HRSA 1S6PA 4CJKA 4B3RK 3THXB 4MDAA 4FCYA 4CJRA 3SUQA 3HJFA 4DV3K 4I9QA 4DR2K 3ZT1A 4IO9L 4DSFA 1XHZA 4X64K 4GNIA 4M3YA 3VQ8A 5BPMA 1NGCA 4B9TA 3U4LA 4IZ9A 2IOCA 3CFRA 1N6QA 2OZSA 3P38A 3B6PA 4JAXA 4JKEA 2FSNA 5E41A 3O5BA 1GOBA 3J81O 1ASVA 5GIOA 2G8WA 2HBMA 2PZSA 5AQNA 3J80O 3QINA 4XH4A 1NU0A 4QAGA 4YOYA 3LWLA 3SBTA 4YFUA 1C0FA 4X66K 3EKUA 2QI2A 1L3TA 4CJFA 3OS1A 3M6GA 1HMVA 4NXNK 2ZGYA 2ASMA 3KVGA 3A2FA 3G4SN 5M1FA 4DV7K 1DTTA 4H5TA 2A42A 2IS3A 4FK2A 4BG9A 4GVEA 5LMNK 4JS5A 4M3TA 4FJLA 1NJWA 3PLAA 4F3OA 1VRTA 4OKJA 4BWMA 3EYZA 2HHWA 3M3ZA 4HCCA 4PKGA 2UUBK 4E7KA 4FK0A 1OH5A 4CD1A 1N5YA 3HPGA 3D2FA 1P90A 1RTHA 4FLUA 4FJIA 4DMNA 3KK1A 3WQTA 2QXLA 4CJTA 5CHIA 3T3FA 4ID1A 1BCOA 3RR8A 1BI4B 2GELA 4BRQA 3TAFA 4KTWA 3ZYYX 4BQLA 2UUCK 1KSPA 3ALYA 1B9FA 1KFSA 1BU6O 3AVHA 4B3MK 1ITGA 3QERA 3HPHA 4JKCA 3KJVA 4IFEA 3P1GA 1X9SA 1NLVA 4AF1A 4A62A 5FPMA 3JAMO 4PUOA 1YVUA 2ZQBA 1NK9A 3D45A 4AQYK 1F21A 1KAYA 1UAXA 4CJ5A 1RDCA 3VOVA 3V81A 3CD6N 1G99A 3CF5L 3WXMB 3SPZA 4OJRA 4FWOA 1QZ6A 2UU9K 3KK3A 2EHGA 4DU1A 3FZLA 3SQ4A 1BHLA 2ZF5O 4KRFA 3ZEUB 4FW1A 1JCGA 4B1YB 5GAGP 4DTMA 2B4JA 3S9HA 1SKRA 2OPQA 3EE8A 4WYBA 4DF4A 1S1XA 2GTDA 3C0BA 3CI5A 4HTLA 3ID8A 5FROA 4FWKA 2QWOA 4NYFA 4C8NA 2BANA 3QEVA 3V9WA 3F73A 2NUBA 1WSJA 2PYJA 2P9SB 4AILC 3DXKA 2P9IA 3DOLA 4FJHA 4FLZA 3OYGA 2HHXA 3KD5E 3DLEA 3UE5A 5EOYA 4JK9A 2DY4A 1NGAA 1SL0A 2B6AA 3RVCA 3K57A 4E7HA 5KPRA 2YNFA 4BR0A 3FZMA 5AQLA 4AM7A 5BR8K 1U47A 4K8XA 5A2QO 3NAEA 5HROA 4CJ4A 3OW2M 2IAJA 5K14A 4FWSA 3VGKA 1H1VA 2CGLA 2X78A 3ULDA 1TGOA 4BROA 5SWMA 1QE1A 4WCEL 4DV5K 2O4IA 3AAPA 2O8DB 4FXDA 1VQMN 3P4IA 1YIJN 1T44A 3TPQA 2D0PA 3A5NC 1NK7A 1IH7A 4JI4K 3BUZB 1HJOA 4I9LA 3LZJA 3C94A 3NVKA 3O08A 4BE0A 5JS1A 3AAQA 2FSKA 1UOCA 3R8EA 2XHBA 5DM7L 2W41A 5AZIA 1VK0A 2HHTA 2QWQA 3KK7A 3TU5A 1ESVA 2D0OA 3THWA 5AQIA 5CZ1A 2DPNA 3CJ9A 5EX5A 3VA0A 1TK8A 4A59A 4DLEA 5B8HA 3HM8A 4ISFA 4CECA 3WNFA 4JKFA 1JCEA 1O13A 3FR0A 3O9SA 4FWRA 1EETA 4E7LA 3CXCM 4CEBA 1Z26A 1TL3A 4E1JA 1OH6A 4OPJA 3C6UA 5J1EA 4B08A 1CXUA 1Q9XA 5HOOA 3PIOL 2Y1JA 3H3OB 1NJZA 3CFOA 4DV6K 1HKBA 3OTOK 2IIRA 3SUOA 4BR5A 2JGUA 3AO1A 5AQUA 4CIGA 4OLBA 3QIOA 4CGDA 4M7XA 2GUIA 4GMJB 5DMRA 3VQ7A 4FLVA 1VAZA 4IO8A 4AHUA 4XIUA 5EY4A 4BRLA 3NE6A 1QQOA 2FBTA 2PBDA 3U9ZA 1K8KA 3OS2A 3H46O 1HNIA 3SPYA 1N8RO 3DMJA 1J54A 4JK7A 5C2FA 3LWMA 5AQJA 4JKAA 2VG5A 3CCRN 4CIFA 2KFZA 2HOEA 5M1OA 4RW4A 1Q82O 5GINA 2HBKA 4LF8K 4KBOA 1HPZA 3LPUA 1S9GA 3L3UA 1S1WA 1NGDA 2CGJA 3CIPA 4ID5A 1ZBIA 1HJRA 4C8LA 5KGWA 3CPEA 5BPLA 1Q9YA 3ZSXA 3PX0A 3D2FB 3UKUA 4FOIA 2Z1HA 1IG9A 1IBMK 4NYNA 4DWIA 1QSYA 1GLJO 2OA8A 3V9ZA 3V9UA 5AZJA 3EN9A 1Z6RA 1VHXA 5CYMA 4JN4A 1ZBLA 1U04A 1GLDG 3IUCA 4B9UA 3PX4A 2P9NA 2W42A 1T05A 1JLCA 1RT7A 4AH9A 3K9KA 4CE9A 2D5RA 4FK4A 4H5NA 4E7IA 3MXJA 4NCGA 4GV9A 1YUWA 2NRVA 2FF3B 2QWRA 3AVNA 4FLTA 3TAPA 4YNQA 3KKRA 1O1WA 4O5BA 3CJCA 1C1CA 4AHTA 1RBSA 4CEAA 2W6LA 1N34K 2KW4A 4BE2A 1IG8A 4PL8A 1I39A 4EZ6A 3AVIA 1DT9A 3OS0A 2P5GA 1ZC6A 1Q7YO 4CCHA 3I8DA 4FZXC 4MO4A 4CJUA 3WNEA 3G6EN 3W0LA 4FW2A 3QB0A 2HW3A 4DSIA 2WONA 5IWAK 3ZX0A 3K9JA 2ZWHA 4A61A 3BY5A 1WSFA 1WSEA 4GV6A 1Z05A 1DTQA 2B5JA 1IO2A 4GKKK 4B8CA 3MK6A 3NGYA 4C1NI 3CC4N 1GLEG 3LDLA 4OKKA 2ZJPL 4CF2A 1FKPA 4WQ4C 4HUEA 1LWFA 3CJAA 3M8RA 3O4NA 3O3GA 1IBLK 3RTVA 5JLFA 1QHTA 3OYLA 3THVA 1TKTA 4FJ5A 1XWLA 5JVGL 3OYHA 3AVAA 4JI5K 4CD3A 3SQ0A 4EHUA 3SAHA 5T7BA 3SQ1A 2QKBA 3QEIA 1T8EA 3AARA 3RSEA 4DQRA 1EX4A 5AQYA 5KRSA 2O8CA 2CGKA 3QBWA 3R6MA 1C6VA 4BVOA 1RDUA 3B6OA 2QTDA 3O9QA 1GOAA 3WXKA 4FJNA 1NKEA 2J4RA 1GOCA 4CEZA 4HWIA 1ASWA 1WBDA 1P8ZA 2AA4A 4FJJA 3OHRA 3EKSA 3LDSA 4FYDA 4BRCA 2YHBA 3L2RA 5AZIB 1OH7A 1OH8A 4CJ7A 2P5OA 3THWB 2NLXA 3SLCA 4KV8A 2F7TA 5DK5A 1U6ZA 2BDPA 3CM6A 2HMPA 3LL3A 2HVHA 3H1QA 4PL7A 5KRTA 1TK5A 2E2QA 1VQ8N 4Z4EA 3QDKA 4DUYK 3ZCMA 4CK1A 4CESA 4IBNA 4IG3A 1JXEA 4O8UA 4NLCA 3RRGA 1S22A 5CY4A 4FM0A 3CETA 4PWDA 1RTIA 4CGIA 5BPNA 3OYNA 2P9UA 3VQ6A 1YJNN 1LOTB 3TTDA 4YOUA 2GWKA 4WQ5C 3BF3A 4W5TA 4W5RA 2YV0X 4DQ8A 3BF1A 5SZTA 1HPMA 2D4WA 4U7BA 2Q31A 1LV5A 1K9MO 4CEOA 3P83D 3MX2A 3LDQA 3H6EA 1K8KB 1WAFA 3KHYA 3L2VA 4BACA 2Q2RA 4FVMA 2FBXA 3ATUA 3AA4A 4Y1CA 3F9KA 4O0IA 2ITGA 4CJPA 3FZHA 4AHVA 1V4TA 1KAZA 4BREA 1VQ4N 4CGHA 4LF5K 5TKWA 5E84A 4ISEA 3G25A 2E20A 4E7JA 1RT2A 3CCQN 3A0IX 3LP3A 1KAXA 5KTQA 1X9JA 3NDKA 5H1SQ 1TKDA 2XY7A 1EWQA 3KTQA 3AVMA 2ITMA 4ICLA 1JLBA 1Q18A 1RT5A 2IGIA 1WSHA 3UKUB 3CCUN 3HBTA 4M42A 2HSTA 1ZBFA 2QWNA 3F2KA 4E1MA 1QQNA 3K2PA 4E3SA 1W2BM 4AM6A 1A5VA 5AZJB 4YORA 2VYPA 3NH0A 1BISA 3DRSA 3VGLA 3CFPA 3VQCA 1VQ7N 4A2BA 5AQMA 3HVTA 1KFDA 4KTZA 4WQ4A 1LWCA 1TYQB 4BE1A 2P9NB 1XC9A 1VSEA 3LP2A 3T7ZA 3VETA 2ZJQL 1XI1A 1RDBA 1BQMA 3GE1A 3H08A 3PO4A 3QNNA 2Z1JA 2KLAA 4M3UA 5M1QA 1JL1A 3TSQA 3L0QA 4CHZA 3NH2A 3KLFA 1FK9A 3QEPA 4B1WB 2YNGA 3WT0A 3OYKA 4OGEA 4DQQA 4EZ9A 2OCEA 1J53A 1SUQA 3R3LA 3ZSWA 2DFEA 3SCXA 4KAZA 4JNEA 4FJKA 1IV0A 2EWSA 3ZSVA 3TANA 4B3TK 3VEWA 3DYAA 2VWBA 4IWVA 3NGIA 3VTHA 1N32K 4O8KA 3VEZA 1UA1A 3IG1A 3MN7A 2F9WA 4DV0K 1VQON 4IEIA 5AR0A 2X6SA 3RRHA 4M3WA 3LDNA 1U2VA 3TABA 2YJEA 3NGZA 4DTNA 4KH4A 4DTJA 2KTQA 3O4QA 3QETA 4JI8K 3TTCA 3ISNC 1VSDA 1NM1A 4EP5A 3CERA 4JD2A 3OYBA 5FLXO 1VQ5N 3ZETA 4CHYA 1S9EA 1D4XA 3HYFA 3HI0A 1T6CA 4I7FA 1RGIA 2W40A 4IDHA 2HBJA 1ATSA 3HM9A 1XNRK 2AJQA 4DR6K 2O8FA 2P9PB 1C0MA 3DXMA 4BG8A 4CGFA 4WQ5A 4GY2B 2VWJA 2GUPA 2O8CB 2IC3A 3HK2A 3AA2A 2BGGA 3QIPA 4M3ZA 3K5NA 3MX5A 3MAQA 4JV5K 2D0CA 4NCAA 4KHPK 2G8HA 3LANA 5BREA 1ZBHA 2VQFK 2D0AA 3VGMA 3SI6A 3M8QA 3QEXA 5BN8A 1MWKA 4K42A 4OPKA 2F4VK 4CGGA 1OVYA 4K41A 4RW6A 3DLRA 3BEXA 4YDUC 4CJ3A 4TSXA 3TAEA 4ISGA 1RILA 1IKVA 2FXUA 4EIAA 3NH1A 4K0KK 3I8BA 3AO4A 5AQTA 1NGIA 4AHRA 3IDHA 1LW0A 3SUPA 4N76A 1NGGA 1IKXA 2RHKA 4B3SK 4YOWA 3C6AA 4WF9L 2O8BA 2GWJA 5C42A 5JS2A 3IS9A 1WOQA 4CZGA 3LZIA 4OO1J 3THYA 1HLUA 1VSJA 2YNIA 4HHTA 4DS4A 2RKIA 1VRUA 4E0DA 4YY3K 2P9UB 3C7NA 3IFRA 1BQNA 3SAFA 4J2DA 1NK4A 1QS4A 3QO9A 1RT4A 1S3XA 3VQPA 5HP1A 3VQ5A 2NZTA 5E26A 1HYZA 2XY5A 4H0XB 4H4MA 3AY9A 1CXQA 2YHXA 5LL6Z 1YF5L 1RT3A 2G8KA 3NMUA 3PSFA 1E3MA 4FWQA 3LDPA 3OYDA 4O55A 3SJJA 3WXLA 1HRHA 4BC4A 2V7YA 1YITN 3DLHA 4CBUA 5BRDA 4ILHA 3N4PA 3TR8A 2YKMA 4BR9A 2HF4A 3VESA 4EHTA 2I5JA 4IEEA 4M45A 5J2PA 4WFAL 1K6YA 1X3NA 3RR7A 3CMEN 3O9RA 3O1WA 2G8UA 3AVGA 5ELZA 4NB4A 3QICA 2OANA 2HVIA 3VEVA 3FLCO 1JL2A 3ZSQA 5J2NA 2A5XA 4OPHA 4NCBA 5AQRA 5C25A 1ZXOA 1Z25A 3BGRA 5AFUA 2KKZA 3K5LA 4DV2K 4IJNA 5AQGA 1SV5A 4LC9B 2A1RA 3ENOA 4IKFA 2FLOA 3OYJA 5KQDA 1X9WA 4G1QA 3MMVA 4GV3A 1RBUA 5EXWA 5C0YA 4KHNA 1JLGA 4C8OA 4BRFA 3HRGA 3WQUA 2A6AA 1UA0A 1YJ9N 4CZIA 4BGAA 3ZT3A 4JLHA 1WN7A 5KPZA 1HX1A 3RMCA 1SKSA 1I3AA 1M1KO 4DLGA 1E4FT 4EAHD 4Z4IA 1C0GA 1XQSC 2X6NA 4CFDA 2QA4N 1L5UA 2YHWA 3AVFA 1HNZK 1JJ2M 4CHOA 4H8KA 3LDOA 3OJSA 2A41A 4FPBA 2WOMA 3H45C 4LH5A 3NF8A 4BR2A 4B1ZA 1W0HA 1NNEA 2ZE2A 3DLGA 5GAEP 3VA3A 4LH4A 5HLFA 5ADXH 1G15A 1A5WA 4E19A 3T1YK 3DM2A 4IOXA 2VQEK 3J7AP 4CJWA 1EQYA 1JKHA 3H3NO 3VEOA 3BZCA 4DFPA 4PY5A 2WC9A 2E6LA 1NKCA 3ID6A 4O0JA 4F3TA 4QS8A 4CZFA 1BG3A 1A5XA 4DR5K 1QVFM 1X3MA 3TAMA 4JD2B 4LD0A 3QMLA 3I55N 3O4WA 4CI6A 5HL7L 2G8FA 3AO2A 3MDQA 1JLQA 3E66A 1GLLO 3MECA 2E6MA 3ENHA 3O3HA 3HXMA 2W6KA 4LFBK 2O8FB 2OTLN 2P9LA 4DR7K 4I2PA 4H4OA 3WEEA 2E2PA 4DFMA 2KZMA 3SBGA 1MDUB 1KC8O 3RMBA 3O9UA 1XNQK 4ILGB 2KFNA 3HSCA 1RTJA 2Z1GA 3RWUA 5BN9A 5HRRA 2FF6A 2YHAA 4RG8A 4CZEA 4LY7A 3KIOA 3HPOA 1J5OA 2FC0A 4B1VA 1QZ5A 4PHTX 1S1VA 4KI4A 1HYSA 1GLAG 4L3QA 4BRPA 4HTUA 1YHQN 4QCLA 1NJXA 3V9XA 3CJ1A 4CW7B 4KFBA 4JKDA 3AGRA 4YOTA 1X9MA 2HHVA 3MN9A 1T6DA 2E88A 4CZKA 3HP9A 3AO5A 1QHAA 4X62K 2PAVA 3CYMA 1SL2A 4FLYA 2O8BB 1C1BA 3C65A 4LFAK 1Q86O 3CM5A 1BL3A 4BRGA 4OKEA 2HB5A 4RW8A 3ENBA 3THYB 1BA0A 1WSIA 3TI0A 4JI0K 3C7NB 3DXKB 4FWLA 2P9IB 4O44A 1IBKK 3PX6A 3CPWM 1W7AA 3AV9A 1M90O 4BRMA 2YHYA 3JSMA 1VSLA 4JI2K 4DTOA 5HRPA 3V1QA 4B8AB 2D1KA 1T03A 1UWBA 4DQPA 3H1VX 4DR1K 1YAGA 4F4KA 3HP6A 1BO5O 4CEQA 3AVKA 3DLBA 2KHOA 4F9OA 3KLGA 3OYFA 2QWLA 3V6DA 3CC7N 4CHNA 2NRXA 3FE1A 2CH5A 3MEEA 1HKCA 3K5OA 4Y1DA 3VF2A 1K8AO 5I3UA 2BUPA 3QLHA 1BWFO 4FJMA 1RBVA 2VG6A 3CCEN 5JLHA 4CZMA 4DV4K 4KPYA 3HTVA 3AVLA 3E9LA 3SNNA 1KLMA 3WNGA 1MU2A 3UIQA 3D2EA 3AGKA 2DFFA 3L4QA 4PA1A 3CJBA 1OVQA 3M1FA 3GOIA 2GV9A 3L2WA 4LF4K 1CZBA 1L3VA 4Z4FA 2RPIA 3SUNA 4RWTA 3JS6A 3IMXA 1JLEA 4KI6A 3FZKA 4AHSA 4O4GA 2YI1A 4RTFD 1TKXA 5AQFA 4PQUA 2A3ZA 2KZZA 3MWTA 4I6MA 1QQMA 3IAYA 1I94K 3VQDA 1NJYA 1BCMA 4JHDA 1EKEA 3VQ9A 1NMDA 4DQSA 2ZGZA 4BDZA 1ASUA 3HL8A 4CF0A 1CZ9A 3SV4A 4W5OA 3NBPA 4H0PA 3DRRA 2JWLA 3KZBA 3SV3A 4BRIA 3G71N 4ELUA 3WXJA 4DR4K 4M63C 1WAJA 5AQWA 4B9QA 1MWMA 4JK8A 3VPZA 1SL1A 3M8SA 2QKKA 4GKJK 2VCPA 2HHQA 4CEEA 1DKGD 1S1UA 3EL2A 1BOTO 4B9MA 1XC3A 3KWIA 5FPEA 1DGKN 4H5RA 3TSPA 3J7ZO 3MWPA 3ZX3A 3TARA 3O1BA 3DAWA 4KO0A 4CF9A 2JLEA 2ASOA 4AHCA 5KGXA 4K8ZA 5AQHA
chains in the Genus database with same CATH topology
4CFBA 4Z0UA 3DLKA 3MEGA 4CHYA 2HHTA 1S9EA 1VK0A 3HYFA 4FZZA 4DTUA 3VN5A 2OYQA 4N56A 4I7FA 4KHWA 1YTUA 1U49A 3HM9A 4KHQA 3TWHA 5CZ1A 2AJQA 3VA0A 4FZYA 4ELVA 2LSNA 1C0MA 4CGFA 4F2RA 1TK8A 4MFBA 3TAGA 3S3OA 2VWJA 1QSSA 1KTQA 3AVBA 1KRPA 4DLEA 4E1NA 4J2BA 2IC3A 3HK2A 3AA2A 4ELTA 2BGGA 3QIPA 4CECA 4M3ZA 3WNFA 3U3YA 4J2AA 4OGCA 3K59A 4CIEA 3K5NA 3MAQA 2D0CA 3L2UA 4NCAA 3U6FA 2G8HA 3MEDA 1EETA 3LANA 4E7LA 4CEBA 1Z26A 3S3NA 1S5JA 1TL3A 1U45A 1ZBHA 3E01A 5HBMA 4OPJA 1R0AA 2D0AA 3C6UA 5J1EA 3SI6A 3M8QA 3QEXA 4CF1A 4B08A 1CXUA 1Q9XA 2DFHA 1JLAA 4OPKA 3OY9A 4CGGA 1U4BA 3K5MA 2Y1JA 1NJZA 3CFOA 4RW6A 3DLRA 3OYMA 3RMAA 4GW6A 4TSXA 4CJ3A 4HUFA 3SUOA 3V1OA 3TAEA 1BIZA 3NF7A 1RILA 2JGUA 1D9DA 2A1SA 3AO1A 4FJ8A 1IKVA 1WNSA 4CIGA 4OLBA 3QIOA 1RNHA 3NH1A 4CGDA 4ZHRA 3AO4A 2BE2A 4AHRA 2GUIA 2RF2A 4GMJB 1LW0A 5DMRA 3VQ7A 4FLVA 4DU3A 3SUPA 4N76A 1IKXA 1RDAA 4J2EA 4AHUA 4CJEA 4IFYA 4XIUA 1RT6A 3ASMA 3S3MA 3NE6A 4QOZB 4BDYA 5C42A 5JS2A 2FBTA 1JLFA 2P51A 3IS9A 3V1RA 3OS2A 4DS5A 3LZIA 2OZMA 3KLHA 1HNIA 1VSJA 2ETJA 2YNIA 4HHTA 4DS4A 1IKYA 2RKIA 1VRUA 5J2MA 3SPYA 4E0DA 2X74A 2VWKA 4Q5VA 1BQNA 2VG7A 3DMJA 1J54A 3KKSA 4M41A 3MXMA 1NOYA 1BI4A 4CK2A 3LWMA 3PO5A 4KHSA 1CLQA 5CZ2A 4W5NA 4J2DA 1NK4A 1QS4A 3QO9A 2VG5A 3SNNA 1RT4A 1TV6A 3VQPA 4CIFA 5HP1A 2KFZA 3VQ5A 1HYZA 4RW4A 2XY5A 2HMIA 1TAQA 1HPZA 2XRIA 3LPUA 4H4MA 1T7PA 1VSFA 3KLEA 1L3UA 1S9GA 1CXQA 3L3UA 4KREA 1W9HA 1S1WA 1RTDA 4ID5A 1ZBIA 2G8IA 1HJRA 4C8LA 5KGWA 4CHQA 1REVA 1D5AA 1RT3A 4FLXA 3ZSXA 1Q9YA 2G8KA 1RT1A 3PX0A 1HNVA 3OYDA 4O55A 3U3GA 2Z1HA 1BGXT 1XHXA 3SJJA 1IG9A 3DI6A 1HRHA 4NYNA 4CGJA 1D9FA 1QTMA 3DLHA 3LAMA 3TR8A 2YKMA 1RDDA 4GVMA 3DRPA 3OYIA 3V9ZA 1QSYA 2OA8A 4DWIA 4HVJA 3LPTA 4KB0A 3V9UA 1TVRA 3OYCA 3V9SA 3SZ2A 3BDPA 2I5JA 2ZD1A 1VSHA 4C8MA 5J2PA 4M45A 1QSLA 3NHGA 2FBYA 1DLOA 4WE1A 1K6YA 1EXQA 3KK2A 2PYJA 2XY8A 3RR7A 5CYMA 3ZSZA 1ZBLA 2FBVA 1U04A 1KVCA 2IDOA 1LWEA 4B9UA 3PX4A 2G8UA 3AVGA 1YTAA 3T1AA 2W42A 2PY5A 1T05A 3IRXA 1C0TA 1JLCA 1RT7A 4AH9A 4CE9A 2HVIA 2D5RA 3ZSQA 1JL2A 2EX3A 4FK4A 2HHSA 4E7IA 1KLNA 5J2NA 3MXJA 4NCGA 1NK5A 4FM1A 4FJGA 4NCBA 4OLAA 3AVNA 5C25A 4FLWA 4FLTA 3TAPA 4YNQA 1Z25A 3BGRA 1O1WA 3KKRA 4LSNA 4O5BA 3HT3A 3K5LA 1D8YA 2HNZA 4KB1A 2A1RA 1SV5A 2YNHA 4B9LA 1C1CA 4AHTA 4IKFA 3OYJA 3I0SA 1RBSA 1X9WA 4G1QA 4CEAA 4CEDA 2HHUA 1RBUA 2KW4A 4BE2A 4HCBA 1I39A 3L2QA 3AVJA 4EZ6A 1JLGA 2GBZA 3AVIA 4DSLA 4C8OA 4DFJA 4DSJA 4KHNA 1Q8IA 3OS0A 5I42A 3ITHA 2P5GA 3EY1A 4CCHA 1UA0A 4DQIA 3I8DA 4FZXC 2YKNA 4CJUA 2Z1IA 4IFVA 3WNEA 1JXBA 4Q0BA 4FW2A 3ZT3A 1L3SA 2HW3A 4DSIA 4CEFA 3ZT0A 2WONA 4JLHA 1WN7A 5FRNA 3RMCA 1SKSA 1I3AA 1WSEA 1WSFA 1KVAA 4FM2A 4DLGA 4B3OA 1TAUA 1ZBUA 4IG0A 1DTQA 4Z4IA 2B5JA 3K58A 1IO2A 2DTUA 4B8CA 4W5QA 4F8RA 2HNYA 3V4IA 2X6NA 3NGYA 4CFDA 1L5UA 3SQ2A 2E4LA 2QXFA 1HYVA 5J2QA 3AVFA 4CJSA 4Z4CA 1C1AA 1IKWA 4H8KA 4CHOA 3NCIA 1LAWA 4B9VA 4OKKA 1QQCA 4CF2A 3OJSA 4DU4A 3KLIA 1FKPA 2WOMA 4HUEA 1LWFA 4LH5A 3M8RA 3NF8A 4DSKA 4L8RB 3OYEA 1W0HA 3O4NA 3AO3A 2O4GA 2ZE2A 3DLGA 3O3GA 1FXXA 3RTVA 1X1PA 4FJ9A 4E89A 1QHTA 3OYLA 3VA3A 4LH4A 5HLFA 1G15A 3THVA 1TKTA 3ZT4A 4HUGA 4FJ5A 4KTQA 1XWLA 1A5WA 4E19A 3DM2A 3OYHA 3AVAA 3FFIA 2F8SA 1YT3A 3SQ0A 4F2SA 4CF8A 4CJWA 3MXIA 3C95A 1JKHA 1NK0A 3VQEA 3ZSOA 4CHPA 4RW7A 5HRNA 5T7BA 4DTRA 1S1TA 4DFPA 3SQ1A 2ATQA 3AA3A 3ZSRA 3QEIA 3G0ZA 4MQ3A 1T8EA 4K8ZA 4PY5A 3L8BA 3ZT2A 2E6LA 4N41A 4DQRA 4FJ7A 1EX4A 3ZSYA 4B9NA 5KRSA 3LAKA 2PYLA 1BIUA 1NKCA 1C6VA 4O0JA 3QNOA 3OJUA 4F3TA 1RBRA 1J9AA 3B6OA 3VQBA 5HRSA 1GOAA 4FJNA 1NKEA 1A5XA 1S6PA 1GOCA 4CEZA 3TAMA 4LD0A 1LAVA 2Q3SA 5KI6A 4CJKA 1ASWA 3I0RA 4FJJA 4FCYA 4CJRA 3SUQA 4M3RA 3HJFA 4I9QA 3LDSA 4FYDA 3ZT1A 2G8FA 3AO2A 2YHBA 3L2RA 4DSFA 1XHZA 1ZYQA 4DFKA 3VQ8A 4M3YA 1JLQA 2HNDA 4CFCA 3JYTA 2QK9A 4B9TA 2P5OA 3MECA 2E6MA 4KV8A 3O3HA 2IOCA 5DK5A 3HXMA 3CFRA 1N6QA 2OZSA 3B6PA 2BDPA 4FJXA 3CM6A 4I2PA 1Y97A 5E41A 4DTPA 4H4OA 1GOBA 3PUFA 4DFMA 1ASVA 4CERA 2HVHA 2G8WA 2KZMA 5KRTA 1TK5A 3AVCA 1TK0A 2PZSA 3RMBA 4Z4EA 3QINA 2KFNA 3ZCMA 4CK1A 1VSIA 1RTJA 2Z1GA 3P5JA 4OVLA 4CESA 3RWUA 4IBNA 4IG3A 4QAGA 3LWLA 1JXEA 5HRRA 3RMDA 4YFUA 2YHAA 3RRGA 5CY4A 4CJVA 4FM0A 4RG8A 1L3TA 4CJFA 3OS1A 4CFAA 1HMVA 3KIOA 4LY7A 4PWDA 1RTIA 4UQGA 2QKBA 3HPOA 1J5OA 1B92A 2FC0A 4CGIA 3D0PA 3NF6A 3OYNA 1S1VA 4CJQA 3A2FA 4KI4A 1HYSA 3VQ6A 3L3VA 4HTUA 1DTTA 3TAQA 4JRPA 4QCLA 1NJXA 3V9XA 2IS3A 1NKBA 4KFBA 4FK2A 4JRQA 4JS5A 4M3TA 4W5TA 4FJLA 1C0UA 1NJWA 4W5RA 1X9MA 4F3OA 2HHVA 1VRTA 4OKJA 5EU7A 5FRMA 4BWMA 1SKWA 2YV0X 3EYZA 2HHWA 3HP9A 3AO5A 4Z4HA 3PY8A 4HCCA 5SZTA 4E7KA 1LV5A 4FK0A 1RBTA 4CEOA 5FDLA 1B9DA 3P83D 3CYMA 4IDKA 4BWJA 2F96A 1SL2A 4FLYA 1C1BA 1N5YA 3CM5A 1BL3A 3G10A 3HPGA 4OKEA 1WAFA 2HB5A 1RTHA 4RW8A 4FLUA 4DMNA 3KK1A 4CJTA 2R7YA 3T3FA 3EZ5A 4FJIA 4KAZA 3L2VA 1WSIA 4BACA 3TI0A 4ID1A 1BCOA 3RR8A 4FVMA 2FBXA 4KHYA 3AA4A 4O44A 4Y1CA 3F9KA 4O0IA 4Z4GA 2ITGA 1BI4B 3PX6A 3AV9A 3TAFA 4KTWA 4CJPA 3CG7A 4AHVA 1KSPA 3ALYA 1B9FA 1RCHA 1VSLA 2D0BA 3JSMA 4ZTFA 1KFSA 3AVHA 4CGHA 4DTOA 2XO7A 2P1JA 5HRPA 3V1QA 4B8AB 1T03A 4E7JA 1ITGA 1RT2A 1UWBA 3LP0A 3QERA 3HPHA 3LP3A 4DQPA 3KJVA 5D3GA 4LSLA 4F4KA 5KTQA 3HP6A 3P1GA 1X9SA 4CEQA 3AVKA 3NDKA 2OPPA 3DLBA 4PUOA 2ZQBA 1YVUA 1TKDA 1NK9A 3D45A 2XY7A 3KLGA 3KTQA 3WNHA 3AVMA 3OYFA 1LW2A 1F21A 4ICLA 1UAXA 4CJ5A 1JLBA 3V6DA 1RDCA 1VSMA 1RT5A 4DSEA 2IGIA 4CHNA 3SYZA 1WSHA 3MEEA 3K5OA 4Y1DA 3V81A 4M42A 1TL1A 1ZBFA 5I3UA 4E1MA 3SPZA 1KCFA 4OJRA 3K2PA 3QLHA 4E3SA 3T19A 1KVBA 4FJMA 3CQ8A 3KK3A 2EHGA 4DU1A 1NK8A 1A5VA 1RBVA 2VG6A 3SQ4A 1U48A 1BHLA 4KRFA 3NH0A 4KPYA 2OPRA 4FW1A 3AVLA 1BISA 4JS4A 1KLMA 2B4JA 3VQQA 3WNGA 1MU2A 4DTMA 2OPQA 3S9HA 3DRSA 1SKRA 3M8PA 3UIQA 3CFPA 3VQCA 1S1XA 1WLJA 4I2QA 4DF4A 3HVTA 2DFFA 1KFDA 4KTZA 1LWCA 5FROA 4BE1A 3VQ4A 1XC9A 4PA1A 1VSEA 3LP2A 1FKOA 2BANA 4NYFA 4C8NA 3QEVA 3V9WA 4B9SA 3F73A 3O3FA 2GV9A 1WSJA 2NUBA 2RN2A 3L2WA 1RDBA 1BQMA 4AILC 3H08A 1CZBA 1XI1A 1L3VA 2RPIA 3QNNA 2G8VA 3PO4A 4Z4FA 3SUNA 3DOLA 4FJHA 2Z1JA 4FLZA 3OYGA 1JLEA 4KI6A 2HHXA 4M3UA 4AHSA 4O4GA 1JL1A 3KD5E 3PV8A 1TKXA 3AA5X 4PQUA 3DLEA 2KZZA 2OPSA 4CHZA 3NH2A 3KLFA 3IAYA 1FK9A 3QEPA 2XY6A 4BDPA 3VQDA 4DF8A 2YNGA 2DY4A 4EP4A 4CK3A 3OYKA 1SL0A 1NJYA 3HO1A 2B6AA 4OGEA 4DQQA 3K57A 3LP1A 4E7HA 4EZ9A 4RW9A 4DTSA 1J53A 1SUQA 3ZSWA 1BCMA 1S6QA 2DFEA 2YNFA 1EKEA 5CYQA 3VQ9A 3SCXA 4FJKA 4DQSA 3KD1E 4BDZA 3QESA 1ASUA 1EP4A 3HL8A 3ZSVA 4N5SA 3HSTB 3TANA 3C6TA 4CF0A 3DYAA 4DTXA 1CZ9A 1U47A 3SV4A 4R5PA 4K8XA 3NAEA 4W5OA 3NBPA 5HROA 4CJ4A 3NGIA 3DRRA 1TKZA 3SV3A 2IAJA 5K14A 4ELUA 4DG1A 1WSGA 1UA1A 2X78A 3IG1A 1WAJA 1TGOA 3ULDA 4CJLA 5SWMA 1QE1A 1SL1A 1VSKA 3M8SA 2X6SA 3LALA 3RRHA 4M3WA 2QKKA 3TABA 4ZTJA 2O4IA 4FXDA 3NGZA 4DTNA 2HHQA 4KKOA 2Y1IA 1NK6A 4CEEA 2F8TA 4DTJA 1NK7A 1S1UA 1IH7A 3O4QA 3OVNA 3QETA 2KTQA 1HQEA 1HQUA 4I9LA 4M3XA 4B9MA 3ISNC 1VSDA 3LZJA 3DOKA 4N47A 3C94A 4EP5A 2KQ2A 4BE0A 5C24A 3VQAA 5JS1A 3TARA 1NOZA 3NFAA 3OYBA 1UOCA 3QEWA 3NF9A 3OYAA 3HVRA 4KHUA 4KO0A 4CF9A 2JLEA 5KGXA 4AHCA 4C8KA 2XHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CFB A;  4Z0U A;  3DLK A;  3MEG A;  4CHY A;  2HHT A;  1S9E A;  1VK0 A;  3HYF A;  4FZZ A;  4DTU A;  3VN5 A;  2OYQ A;  4N56 A;  4I7F A;  4KHW A;  1YTU A;  1U49 A;  3HM9 A;  4KHQ A;  3TWH A;  5CZ1 A;  2AJQ A;  3VA0 A;  4FZY A;  4ELV A;  2LSN A;  1C0M A;  4CGF A;  4F2R A;  1TK8 A;  4MFB A;  3TAG A;  3S3O A;  2VWJ A;  1QSS A;  1KTQ A;  3AVB A;  1KRP A;  4DLE A;  4E1N A;  4J2B A;  2IC3 A;  3HK2 A;  3AA2 A;  4ELT A;  2BGG A;  3QIP A;  4CEC A;  4M3Z A;  3WNF A;  3U3Y A;  4J2A A;  4OGC A;  3K59 A;  4CIE A;  3K5N A;  3MAQ A;  2D0C A;  3L2U A;  4NCA A;  3U6F A;  2G8H A;  3MED A;  1EET A;  3LAN A;  4E7L A;  4CEB A;  1Z26 A;  3S3N A;  1S5J A;  1TL3 A;  1U45 A;  1ZBH A;  3E01 A;  5HBM A;  4OPJ A;  1R0A A;  2D0A A;  3C6U A;  5J1E A;  3SI6 A;  3M8Q A;  3QEX A;  4CF1 A;  4B08 A;  1CXU A;  1Q9X A;  2DFH A;  1JLA A;  4OPK A;  3OY9 A;  4CGG A;  1U4B A;  3K5M A;  2Y1J A;  1NJZ A;  3CFO A;  4RW6 A;  3DLR A;  3OYM A;  3RMA A;  4GW6 A;  4TSX A;  4CJ3 A;  4HUF A;  3SUO A;  3V1O A;  3TAE A;  1BIZ A;  3NF7 A;  1RIL A;  2JGU A;  1D9D A;  2A1S A;  3AO1 A;  4FJ8 A;  1IKV A;  1WNS A;  4CIG A;  4OLB A;  3QIO A;  1RNH A;  3NH1 A;  4CGD A;  4ZHR A;  3AO4 A;  2BE2 A;  4AHR A;  2GUI A;  2RF2 A;  4GMJ B;  1LW0 A;  5DMR A;  3VQ7 A;  4FLV A;  4DU3 A;  3SUP A;  4N76 A;  1IKX A;  1RDA A;  4J2E A;  4AHU A;  4CJE A;  4IFY A;  4XIU A;  1RT6 A;  3ASM A;  3S3M A;  3NE6 A;  4QOZ B;  4BDY A;  5C42 A;  5JS2 A;  2FBT A;  1JLF A;  2P51 A;  3IS9 A;  3V1R A;  3OS2 A;  4DS5 A;  3LZI A;  2OZM A;  3KLH A;  1HNI A;  1VSJ A;  2ETJ A;  2YNI A;  4HHT A;  4DS4 A;  1IKY A;  2RKI A;  1VRU A;  5J2M A;  3SPY A;  4E0D A;  2X74 A;  2VWK A;  4Q5V A;  1BQN A;  2VG7 A;  3DMJ A;  1J54 A;  3KKS A;  4M41 A;  3MXM A;  1NOY A;  1BI4 A;  4CK2 A;  3LWM A;  3PO5 A;  4KHS A;  1CLQ A;  5CZ2 A;  4W5N A;  4J2D A;  1NK4 A;  1QS4 A;  3QO9 A;  2VG5 A;  3SNN A;  1RT4 A;  1TV6 A;  3VQP A;  4CIF A;  5HP1 A;  2KFZ A;  3VQ5 A;  1HYZ A;  4RW4 A;  2XY5 A;  2HMI A;  1TAQ A;  1HPZ A;  2XRI A;  3LPU A;  4H4M A;  1T7P A;  1VSF A;  3KLE A;  1L3U A;  1S9G A;  1CXQ A;  3L3U A;  4KRE A;  1W9H A;  1S1W A;  1RTD A;  4ID5 A;  1ZBI A;  2G8I A;  1HJR A;  4C8L A;  5KGW A;  4CHQ A;  1REV A;  1D5A A;  1RT3 A;  4FLX A;  3ZSX A;  1Q9Y A;  2G8K A;  1RT1 A;  3PX0 A;  1HNV A;  3OYD A;  4O55 A;  3U3G A;  2Z1H A;  1BGX T;  1XHX A;  3SJJ A;  1IG9 A;  3DI6 A;  1HRH A;  4NYN A;  4CGJ A;  1D9F A;  1QTM A;  3DLH A;  3LAM A;  3TR8 A;  2YKM A;  1RDD A;  4GVM A;  3DRP A;  3OYI A;  3V9Z A;  1QSY A;  2OA8 A;  4DWI A;  4HVJ A;  3LPT A;  4KB0 A;  3V9U A;  1TVR A;  3OYC A;  3V9S A;  3SZ2 A;  3BDP A;  2I5J A;  2ZD1 A;  1VSH A;  4C8M A;  5J2P A;  4M45 A;  1QSL A;  3NHG A;  2FBY A;  1DLO A;  4WE1 A;  1K6Y A;  1EXQ A;  3KK2 A;  2PYJ A;  2XY8 A;  3RR7 A;  5CYM A;  3ZSZ A;  1ZBL A;  2FBV A;  1U04 A;  1KVC A;  2IDO A;  1LWE A;  4B9U A;  3PX4 A;  2G8U A;  3AVG A;  1YTA A;  3T1A A;  2W42 A;  2PY5 A;  1T05 A;  3IRX A;  1C0T A;  1JLC A;  1RT7 A;  4AH9 A;  4CE9 A;  2HVI A;  2D5R A;  3ZSQ A;  1JL2 A;  2EX3 A;  4FK4 A;  2HHS A;  4E7I A;  1KLN A;  5J2N A;  3MXJ A;  4NCG A;  1NK5 A;  4FM1 A;  4FJG A;  4NCB A;  4OLA A;  3AVN A;  5C25 A;  4FLW A;  4FLT A;  3TAP A;  4YNQ A;  1Z25 A;  3BGR A;  1O1W A;  3KKR A;  4LSN A;  4O5B A;  3HT3 A;  3K5L A;  1D8Y A;  2HNZ A;  4KB1 A;  2A1R A;  1SV5 A;  2YNH A;  4B9L A;  1C1C A;  4AHT A;  4IKF A;  3OYJ A;  3I0S A;  1RBS A;  1X9W A;  4G1Q A;  4CEA A;  4CED A;  2HHU A;  1RBU A;  2KW4 A;  4BE2 A;  4HCB A;  1I39 A;  3L2Q A;  3AVJ A;  4EZ6 A;  1JLG A;  2GBZ A;  3AVI A;  4DSL A;  4C8O A;  4DFJ A;  4DSJ A;  4KHN A;  1Q8I A;  3OS0 A;  5I42 A;  3ITH A;  2P5G A;  3EY1 A;  4CCH A;  1UA0 A;  4DQI A;  3I8D A;  4FZX C;  2YKN A;  4CJU A;  2Z1I A;  4IFV A;  3WNE A;  1JXB A;  4Q0B A;  4FW2 A;  3ZT3 A;  1L3S A;  2HW3 A;  4DSI A;  4CEF A;  3ZT0 A;  2WON A;  4JLH A;  1WN7 A;  5FRN A;  3RMC A;  1SKS A;  1I3A A;  1WSE A;  1WSF A;  1KVA A;  4FM2 A;  4DLG A;  4B3O A;  1TAU A;  1ZBU A;  4IG0 A;  1DTQ A;  4Z4I A;  2B5J A;  3K58 A;  1IO2 A;  2DTU A;  4B8C A;  4W5Q A;  4F8R A;  2HNY A;  3V4I A;  2X6N A;  3NGY A;  4CFD A;  1L5U A;  3SQ2 A;  2E4L A;  2QXF A;  1HYV A;  5J2Q A;  3AVF A;  4CJS A;  4Z4C A;  1C1A A;  1IKW A;  4H8K A;  4CHO A;  3NCI A;  1LAW A;  4B9V A;  4OKK A;  1QQC A;  4CF2 A;  3OJS A;  4DU4 A;  3KLI A;  1FKP A;  2WOM A;  4HUE A;  1LWF A;  4LH5 A;  3M8R A;  3NF8 A;  4DSK A;  4L8R B;  3OYE A;  1W0H A;  3O4N A;  3AO3 A;  2O4G A;  2ZE2 A;  3DLG A;  3O3G A;  1FXX A;  3RTV A;  1X1P A;  4FJ9 A;  4E89 A;  1QHT A;  3OYL A;  3VA3 A;  4LH4 A;  5HLF A;  1G15 A;  3THV A;  1TKT A;  3ZT4 A;  4HUG A;  4FJ5 A;  4KTQ A;  1XWL A;  1A5W A;  4E19 A;  3DM2 A;  3OYH A;  3AVA A;  3FFI A;  2F8S A;  1YT3 A;  3SQ0 A;  4F2S A;  4CF8 A;  4CJW A;  3MXI A;  3C95 A;  1JKH A;  1NK0 A;  3VQE A;  3ZSO A;  4CHP A;  4RW7 A;  5HRN A;  5T7B A;  4DTR A;  1S1T A;  4DFP A;  3SQ1 A;  2ATQ A;  3AA3 A;  3ZSR A;  3QEI A;  3G0Z A;  4MQ3 A;  1T8E A;  4K8Z A;  4PY5 A;  3L8B A;  3ZT2 A;  2E6L A;  4N41 A;  4DQR A;  4FJ7 A;  1EX4 A;  3ZSY A;  4B9N A;  5KRS A;  3LAK A;  2PYL A;  1BIU A;  1NKC A;  1C6V A;  4O0J A;  3QNO A;  3OJU A;  4F3T A;  1RBR A;  1J9A A;  3B6O A;  3VQB A;  5HRS A;  1GOA A;  4FJN A;  1NKE A;  1A5X A;  1S6P A;  1GOC A;  4CEZ A;  3TAM A;  4LD0 A;  1LAV A;  2Q3S A;  5KI6 A;  4CJK A;  1ASW A;  3I0R A;  4FJJ A;  4FCY A;  4CJR A;  3SUQ A;  4M3R A;  3HJF A;  4I9Q A;  3LDS A;  4FYD A;  3ZT1 A;  2G8F A;  3AO2 A;  2YHB A;  3L2R A;  4DSF A;  1XHZ A;  1ZYQ A;  4DFK A;  3VQ8 A;  4M3Y A;  1JLQ A;  2HND A;  4CFC A;  3JYT A;  2QK9 A;  4B9T A;  2P5O A;  3MEC A;  2E6M A;  4KV8 A;  3O3H A;  2IOC A;  5DK5 A;  3HXM A;  3CFR A;  1N6Q A;  2OZS A;  3B6P A;  2BDP A;  4FJX A;  3CM6 A;  4I2P A;  1Y97 A;  5E41 A;  4DTP A;  4H4O A;  1GOB A;  3PUF A;  4DFM A;  1ASV A;  4CER A;  2HVH A;  2G8W A;  2KZM A;  5KRT A;  1TK5 A;  3AVC A;  1TK0 A;  2PZS A;  3RMB A;  4Z4E A;  3QIN A;  2KFN A;  3ZCM A;  4CK1 A;  1VSI A;  1RTJ A;  2Z1G A;  3P5J A;  4OVL A;  4CES A;  3RWU A;  4IBN A;  4IG3 A;  4QAG A;  3LWL A;  1JXE A;  5HRR A;  3RMD A;  4YFU A;  2YHA A;  3RRG A;  5CY4 A;  4CJV A;  4FM0 A;  4RG8 A;  1L3T A;  4CJF A;  3OS1 A;  4CFA A;  1HMV A;  3KIO A;  4LY7 A;  4PWD A;  1RTI A;  4UQG A;  2QKB A;  3HPO A;  1J5O A;  1B92 A;  2FC0 A;  4CGI A;  3D0P A;  3NF6 A;  3OYN A;  1S1V A;  4CJQ A;  3A2F A;  4KI4 A;  1HYS A;  3VQ6 A;  3L3V A;  4HTU A;  1DTT A;  3TAQ A;  4JRP A;  4QCL A;  1NJX A;  3V9X A;  2IS3 A;  1NKB A;  4KFB A;  4FK2 A;  4JRQ A;  4JS5 A;  4M3T A;  4W5T A;  4FJL A;  1C0U A;  1NJW A;  4W5R A;  1X9M A;  4F3O A;  2HHV A;  1VRT A;  4OKJ A;  5EU7 A;  5FRM A;  4BWM A;  1SKW A;  2YV0 X;  3EYZ A;  2HHW A;  3HP9 A;  3AO5 A;  4Z4H A;  3PY8 A;  4HCC A;  5SZT A;  4E7K A;  1LV5 A;  4FK0 A;  1RBT A;  4CEO A;  5FDL A;  1B9D A;  3P83 D;  3CYM A;  4IDK A;  4BWJ A;  2F96 A;  1SL2 A;  4FLY A;  1C1B A;  1N5Y A;  3CM5 A;  1BL3 A;  3G10 A;  3HPG A;  4OKE A;  1WAF A;  2HB5 A;  1RTH A;  4RW8 A;  4FLU A;  4DMN A;  3KK1 A;  4CJT A;  2R7Y A;  3T3F A;  3EZ5 A;  4FJI A;  4KAZ A;  3L2V A;  1WSI A;  4BAC A;  3TI0 A;  4ID1 A;  1BCO A;  3RR8 A;  4FVM A;  2FBX A;  4KHY A;  3AA4 A;  4O44 A;  4Y1C A;  3F9K A;  4O0I A;  4Z4G A;  2ITG A;  1BI4 B;  3PX6 A;  3AV9 A;  3TAF A;  4KTW A;  4CJP A;  3CG7 A;  4AHV A;  1KSP A;  3ALY A;  1B9F A;  1RCH A;  1VSL A;  2D0B A;  3JSM A;  4ZTF A;  1KFS A;  3AVH A;  4CGH A;  4DTO A;  2XO7 A;  2P1J A;  5HRP A;  3V1Q A;  4B8A B;  1T03 A;  4E7J A;  1ITG A;  1RT2 A;  1UWB A;  3LP0 A;  3QER A;  3HPH A;  3LP3 A;  4DQP A;  3KJV A;  5D3G A;  4LSL A;  4F4K A;  5KTQ A;  3HP6 A;  3P1G A;  1X9S A;  4CEQ A;  3AVK A;  3NDK A;  2OPP A;  3DLB A;  4PUO A;  2ZQB A;  1YVU A;  1TKD A;  1NK9 A;  3D45 A;  2XY7 A;  3KLG A;  3KTQ A;  3WNH A;  3AVM A;  3OYF A;  1LW2 A;  1F21 A;  4ICL A;  1UAX A;  4CJ5 A;  1JLB A;  3V6D A;  1RDC A;  1VSM A;  1RT5 A;  4DSE A;  2IGI A;  4CHN A;  3SYZ A;  1WSH A;  3MEE A;  3K5O A;  4Y1D A;  3V81 A;  4M42 A;  1TL1 A;  1ZBF A;  5I3U A;  4E1M A;  3SPZ A;  1KCF A;  4OJR A;  3K2P A;  3QLH A;  4E3S A;  3T19 A;  1KVB A;  4FJM A;  3CQ8 A;  3KK3 A;  2EHG A;  4DU1 A;  1NK8 A;  1A5V A;  1RBV A;  2VG6 A;  3SQ4 A;  1U48 A;  1BHL A;  4KRF A;  3NH0 A;  4KPY A;  2OPR A;  4FW1 A;  3AVL A;  1BIS A;  4JS4 A;  1KLM A;  2B4J A;  3VQQ A;  3WNG A;  1MU2 A;  4DTM A;  2OPQ A;  3S9H A;  3DRS A;  1SKR A;  3M8P A;  3UIQ A;  3CFP A;  3VQC A;  1S1X A;  1WLJ A;  4I2Q A;  4DF4 A;  3HVT A;  2DFF A;  1KFD A;  4KTZ A;  1LWC A;  5FRO A;  4BE1 A;  3VQ4 A;  1XC9 A;  4PA1 A;  1VSE A;  3LP2 A;  1FKO A;  2BAN A;  4NYF A;  4C8N A;  3QEV A;  3V9W A;  4B9S A;  3F73 A;  3O3F A;  2GV9 A;  1WSJ A;  2NUB A;  2RN2 A;  3L2W A;  1RDB A;  1BQM A;  4AIL C;  3H08 A;  1CZB A;  1XI1 A;  1L3V A;  2RPI A;  3QNN A;  2G8V A;  3PO4 A;  4Z4F A;  3SUN A;  3DOL A;  4FJH A;  2Z1J A;  4FLZ A;  3OYG A;  1JLE A;  4KI6 A;  2HHX A;  4M3U A;  4AHS A;  4O4G A;  1JL1 A;  3KD5 E;  3PV8 A;  1TKX A;  3AA5 X;  4PQU A;  3DLE A;  2KZZ A;  2OPS A;  4CHZ A;  3NH2 A;  3KLF A;  3IAY A;  1FK9 A;  3QEP A;  2XY6 A;  4BDP A;  3VQD A;  4DF8 A;  2YNG A;  2DY4 A;  4EP4 A;  4CK3 A;  3OYK A;  1SL0 A;  1NJY A;  3HO1 A;  2B6A A;  4OGE A;  4DQQ A;  3K57 A;  3LP1 A;  4E7H A;  4EZ9 A;  4RW9 A;  4DTS A;  1J53 A;  1SUQ A;  3ZSW A;  1BCM A;  1S6Q A;  2DFE A;  2YNF A;  1EKE A;  5CYQ A;  3VQ9 A;  3SCX A;  4FJK A;  4DQS A;  3KD1 E;  4BDZ A;  3QES A;  1ASU A;  1EP4 A;  3HL8 A;  3ZSV A;  4N5S A;  3HST B;  3TAN A;  3C6T A;  4CF0 A;  3DYA A;  4DTX A;  1CZ9 A;  1U47 A;  3SV4 A;  4R5P A;  4K8X A;  3NAE A;  4W5O A;  3NBP A;  5HRO A;  4CJ4 A;  3NGI A;  3DRR A;  1TKZ A;  3SV3 A;  2IAJ A;  5K14 A;  4ELU A;  4DG1 A;  1WSG A;  1UA1 A;  2X78 A;  3IG1 A;  1WAJ A;  1TGO A;  3ULD A;  4CJL A;  5SWM A;  1QE1 A;  1SL1 A;  1VSK A;  3M8S A;  2X6S A;  3LAL A;  3RRH A;  4M3W A;  2QKK A;  3TAB A;  4ZTJ A;  2O4I A;  4FXD A;  3NGZ A;  4DTN A;  2HHQ A;  4KKO A;  2Y1I A;  1NK6 A;  4CEE A;  2F8T A;  4DTJ A;  1NK7 A;  1S1U A;  1IH7 A;  3O4Q A;  3OVN A;  3QET A;  2KTQ A;  1HQE A;  1HQU A;  4I9L A;  4M3X A;  4B9M A;  3ISN C;  1VSD A;  3LZJ A;  3DOK A;  4N47 A;  3C94 A;  4EP5 A;  2KQ2 A;  4BE0 A;  5C24 A;  3VQA A;  5JS1 A;  3TAR A;  1NOZ A;  3NFA A;  3OYB A;  1UOC A;  3QEW A;  3NF9 A;  3OYA A;  3HVR A;  4KHU A;  4KO0 A;  4CF9 A;  2JLE A;  5KGX A;  4AHC A;  4C8K A;  2XHB A; 
#chains in the Genus database with same CATH topology
 4U67 L;  4Z0U A;  4FZZ A;  3QFP A;  4DTU A;  3VN5 A;  2OYQ A;  1NBW A;  4N56 A;  4KHW A;  3MN6 A;  1U49 A;  2VGM A;  4KHQ A;  1TUY A;  4JEP A;  4FZY A;  2UUA K;  3OBY A;  4F2R A;  4MFB A;  3S3O A;  2E2O A;  2QM1 A;  3GG4 A;  4E1N A;  3HZ6 A;  4BR4 A;  3PSI A;  3ULE A;  3U3Y A;  4J2A A;  4OGC A;  3K59 A;  4CIE A;  3L2U A;  4CZL A;  2FSJ A;  3CJ7 A;  3U6F A;  3MED A;  3E9O A;  5EVZ A;  1S5J A;  5JVH L;  1VQK N;  3EO3 A;  5HBM A;  1R0A A;  1NGF A;  5BR9 A;  1ATN A;  4C23 A;  4CF1 A;  3T1H K;  3K5M A;  1U4B A;  4M7Y A;  2UYT A;  2QWM A;  4GW6 A;  2HHH K;  4HUF A;  4K25 A;  4DKW A;  3V1O A;  1BIZ A;  2P9L B;  3E1Y A;  4FJ8 A;  2A1S A;  3WEE B;  1WNS A;  4CBX A;  4ZHR A;  3R1X A;  3D6R A;  2BE2 A;  2RF2 A;  3BZK A;  2Q97 A;  3LM2 A;  1RDA A;  4IFY A;  3ASM A;  4QOZ B;  3KWG A;  4MO5 A;  4MLH A;  1JLF A;  2P51 A;  5AQZ A;  4DS5 A;  3KLH A;  4QS9 A;  3W3D A;  5J2M A;  1NGJ A;  5GAD P;  2X74 A;  2VG7 A;  3KKS A;  4M41 A;  3PO5 A;  4CK2 A;  2PFU A;  3SK3 A;  2P9K A;  4JI6 K;  1TV6 A;  3VMF B;  1TAQ A;  1T7P A;  1VSF A;  3KLE A;  4KRE A;  1RTD A;  4Y0W A;  4J8F A;  3SJH A;  1KXP A;  4CHQ A;  1REV A;  4FLX A;  4X65 K;  5KQ8 A;  1RT1 A;  1HNV A;  2NRH A;  4BRK A;  3P31 A;  3A5M C;  2A40 A;  3DI6 A;  4CGJ A;  1D9F A;  3LAM A;  4GVM A;  4BC3 A;  3DRP A;  4HVJ A;  4KB0 A;  1TVR A;  4DCH A;  1VSH A;  5M1P A;  4C8M A;  2FBY A;  3S41 A;  3KK2 A;  3FZF A;  1KVC A;  2IDO A;  3O80 A;  3QBX A;  2QW9 A;  4XH5 A;  1YTA A;  3IRX A;  1C0T A;  3GL1 A;  5LMU K;  5GIP A;  4BRD A;  1KLN A;  2O8E A;  4FM1 A;  2WBN A;  2NRW A;  4FLW A;  4KH6 A;  4NLB A;  3HT3 A;  4KB1 A;  2YNH A;  2Q0R A;  2GX9 A;  4CED A;  2HHU A;  4DHY A;  4YHH K;  3RSE B;  4B1X B;  1NG9 A;  3L2Q A;  1NGH A;  3VF6 A;  1Q8I A;  3D2E B;  3ITH A;  3EY1 A;  4RCH A;  1GLC G;  2YKN A;  4MDB A;  3CCV N;  1VQN N;  4Z94 A;  4WFN L;  5F2R A;  5FRN A;  2V7Z A;  4B3O A;  1ZBU A;  3ZX2 A;  2IVN A;  2AP1 A;  2DTU A;  4I6M B;  4JYA K;  2NNW A;  3VEX A;  3SQ2 A;  2E4L A;  2QXF A;  1HYV A;  2CH6 A;  3WXI A;  4CJS A;  4Z4C A;  1C1A A;  4XH1 A;  1IKW A;  1HKG A;  4H5V A;  1LAW A;  4DU4 A;  1TUU A;  3QFU A;  4L8R B;  4JHD B;  1YI2 N;  4O5F A;  3OYE A;  3AO3 A;  2O4G A;  3CQX A;  1EO1 A;  3CMA N;  3B8A X;  4KTQ A;  3MN5 A;  2Q36 A;  3FFK B;  4HUG A;  1FJG K;  3EE9 A;  3UKR A;  3FFI A;  1YT3 A;  4CF8 A;  1J5E K;  3ZLJ A;  3VQE A;  4CHP A;  5HRN A;  4RW7 A;  4DTR A;  1S1T A;  2ATQ A;  3AA3 A;  2ZM6 K;  4MQ3 A;  1MA9 B;  2UXB K;  3Q7B A;  4N41 A;  3VER A;  2JWK A;  4B9N A;  2PYL A;  1BIU A;  4PKH A;  3UB5 A;  3QNO A;  3OJU A;  4H5W A;  1RBR A;  5M1K A;  3Q7C A;  1IJJ A;  3FGU A;  5C10 A;  2Q0U A;  4IOC L;  1LAV A;  2Q3S A;  5KI6 A;  3K0S A;  4IXC A;  1Q81 O;  3EEQ A;  3I0R A;  2QEX N;  4A5B A;  4DV1 K;  4M3R A;  5DM6 L;  1ZYQ A;  4DFK A;  4BRA A;  4CFC A;  2HND A;  3JYT A;  1N36 K;  1ATR A;  4YOV A;  2QK9 A;  4UY8 O;  5AJ3 K;  5TKY A;  3DLL L;  4LF9 K;  4FJX A;  1Y97 A;  2E1Y A;  4DTP A;  2HF3 A;  3R9P A;  3PUF A;  3LM9 A;  1JCF A;  4CER A;  3T69 A;  3AVC A;  1TK0 A;  1DEJ A;  1GLF O;  2RE2 A;  1VSI A;  3P5J A;  4OVL A;  3ULE B;  3EZW A;  2ASP A;  3RMD A;  2UXD K;  3SAG A;  4CJV A;  4BVP A;  4CFA A;  1NGB A;  4UQG A;  1B92 A;  3D0P A;  3NF6 A;  1N33 K;  4CJQ A;  3L3V A;  3TAQ A;  2NRZ A;  5CE3 A;  3PIP L;  1NKB A;  4JRQ A;  1EWR A;  1XMQ K;  1C0U A;  5FRM A;  5EU7 A;  1SKW A;  1W97 L;  1GLB G;  3M5R A;  1SZ2 A;  3F9M A;  4Z4H A;  1FW6 A;  3PY8 A;  4CZH A;  1RBT A;  5FDL A;  1B9D A;  4BWJ A;  4IDK A;  1RFQ A;  2F96 A;  4H0V B;  3G10 A;  3VF4 A;  1NMN A;  5AQV A;  2R7Y A;  3EZ5 A;  4FL9 A;  4KHY A;  4NXM K;  4Z4G A;  4BY9 C;  5AQS A;  5C12 A;  3CG7 A;  4M3X A;  2P9K B;  1RCH A;  4ZTF A;  2D0B A;  2XO7 A;  2H3G X;  2P1J A;  4WFB L;  5D3G A;  4FSV A;  3LP0 A;  2QWP A;  4LSL A;  1NWK A;  3CC2 N;  2OPP A;  3TSU A;  4IOA L;  5C2D A;  1YXQ A;  4FOE A;  3WNH A;  1LW2 A;  1K73 O;  1VSM A;  4DSE A;  4FWN A;  3SYZ A;  2Q1N A;  1HNX K;  1TL1 A;  4BQZ A;  4KH5 A;  1KCF A;  1XUP O;  1VQL N;  3T19 A;  1KVB A;  3CQ8 A;  3BP8 A;  5KPT A;  1NK8 A;  1U48 A;  4YDU A;  2OPR A;  1U2V B;  2F9T A;  4JS4 A;  1V4S A;  3VQQ A;  4H03 B;  3VEN A;  3CCJ N;  3M8P A;  2GEM A;  2OTJ N;  1WLJ A;  4I2Q A;  1YJW N;  1RDW X;  1VQP N;  4R79 A;  3VQ4 A;  4CVN E;  4JKG A;  1BDG A;  1FKO A;  4B9S A;  3O3F A;  2RN2 A;  4DFJ A;  1XMO K;  1HR0 K;  2G8V A;  4G9Z A;  1LCU A;  2O8E B;  3ZET B;  2NRT A;  4BGB A;  4FVU A;  3CCS N;  3PV8 A;  3AA5 X;  3MCP A;  2OPS A;  4CZJ A;  4B1U B;  2BTF A;  1ZBS A;  3F5T A;  2WTU A;  2XY6 A;  4JI3 K;  4BDP A;  4DF8 A;  4EP4 A;  4CK3 A;  3DXM B;  3HOS A;  5AQK A;  1S72 N;  3HO1 A;  3O9T A;  2YCH A;  3LP1 A;  4RW9 A;  4DTS A;  4JRP A;  1S6Q A;  5CYQ A;  3SMS A;  4BC5 A;  3KD1 E;  3QES A;  2E2N A;  4PKI A;  1EP4 A;  4N5S A;  3HST B;  3C6T A;  4DTX A;  4R5P A;  1TKZ A;  4DG1 A;  1WSG A;  5AQX A;  5I9E B;  1KD1 O;  4CJL A;  2YJF A;  3CQY A;  3C6H A;  1VSK A;  2HBL A;  3LAL A;  5FPD A;  4ZTJ A;  4KKO A;  2Y1I A;  1NK6 A;  2F8T A;  3OVN A;  1BUP A;  1QVG M;  1HQE A;  1HQU A;  1TYQ A;  3DOK A;  4N47 A;  4CBW A;  2KQ2 A;  5C24 A;  4IJA A;  3VQA A;  4C1N K;  1NOZ A;  3NFA A;  3QEW A;  3THX A;  3NF9 A;  3OYA A;  3HVR A;  4KHU A;  5AQO A;  1HNW K;  4V19 S;  4C8K A;  5LJW A;  4CFB A;  4BRN A;  3DLK A;  3MEG A;  5FPN A;  4BRH A;  4JKH A;  3UKR B;  5BRH A;  4DB3 A;  4QS7 A;  3GDQ A;  1YTU A;  2NRR A;  1NGE A;  3VEY A;  3HOT A;  3TWH A;  3L6Q A;  3NVM A;  3E9P A;  2LSN A;  4MLE A;  4ELV A;  5IT9 O;  4K43 A;  3TAG A;  1QSS A;  1KTQ A;  3AVB A;  1KRP A;  4J2B A;  3JXU A;  4ELT A;  2V52 B;  4YOX A;  3S3N A;  1U45 A;  4LFC K;  3E01 A;  2IVO A;  3O8M A;  4H0Y B;  2DFH A;  1JLA A;  3OY9 A;  3OBW A;  3OYM A;  3U9D A;  3RMA A;  1R59 O;  1YVN A;  1WBB A;  2I7N A;  3NF7 A;  1D9D A;  3DWL A;  3A8Y A;  1RNH A;  3IKM A;  3J8A A;  4EFH A;  4DU3 A;  4J2E A;  2V51 B;  4A2A A;  4CJE A;  1RT6 A;  3S3M A;  4BDY A;  4LF6 K;  3V1R A;  1ILY A;  2OZM A;  2ETJ A;  1IKY A;  5GAH P;  3L4I A;  5AQQ A;  4Q5V A;  2VWK A;  1Y64 A;  3MXM A;  5C15 A;  1NOY A;  1BI4 A;  4KHS A;  1CLQ A;  4FWP A;  3O6W A;  2P9P A;  5CZ2 A;  2ZJR L;  4W5N A;  4H0O A;  4XEI A;  5F1X A;  5JMV A;  4A57 A;  2HMI A;  2XRI A;  2UXC K;  3WUH A;  1L3U A;  3U8X A;  1W9H A;  3CCM N;  1SAZ A;  2G8I A;  1WB9 A;  4DUZ K;  4JI1 K;  4NO7 A;  1D5A A;  1SS6 A;  3DJC A;  3A5L C;  5F0X A;  3U3G A;  2WUS A;  1BGX T;  3GBT A;  1XHX A;  1SQK A;  3A5O C;  1QTM A;  3TTF A;  1RDD A;  1CZA N;  3OYI A;  3LPT A;  1NJI O;  3OYC A;  3V9S A;  3SZ2 A;  3BDP A;  2ZD1 A;  1BA1 A;  3ZEU A;  1QSL A;  3NHG A;  1DLO A;  4WE1 A;  1EXQ A;  5AFU H;  3J7Y P;  1J6Z A;  2XY8 A;  3ZSZ A;  2FBV A;  1KQS M;  2VGN A;  5M1N A;  1LWE A;  4FO0 A;  2WFB A;  5CR4 A;  3T1A A;  4OPA A;  2PY5 A;  2BH1 A;  4BC2 A;  3OA9 A;  2EX3 A;  2P9S A;  2HHS A;  1NK5 A;  4FJG A;  4OLA A;  1WUA A;  3MCA B;  4LSN A;  4JI7 K;  1D8Y A;  4JKB A;  4A5A A;  2HNZ A;  1OKJ A;  2E5L K;  4B9L A;  3I0S A;  4LF7 K;  1E4G T;  5MLC Q;  4HCB A;  3AVJ A;  2GBZ A;  4DSL A;  3I33 A;  4DSJ A;  5I42 A;  2YX6 A;  1HUX A;  4DQI A;  2Z1I A;  4IFV A;  4JKG B;  1JXB A;  4Q0B A;  1L3S A;  4CEF A;  3ZT0 A;  2E8A A;  5BRF A;  3CCL N;  1VQ6 N;  4FM2 A;  1KVA A;  1TAU A;  4IG0 A;  5JIC A;  3N4Q A;  3I56 N;  3K58 A;  4W5Q A;  5AQP A;  4F8R A;  2HNY A;  3V4I A;  2O8D A;  2IVP A;  5J2Q A;  5LJV A;  3VTI A;  3NCI A;  4B9V A;  1QQC A;  3CHW A;  3KLI A;  1VQ9 N;  4DSK A;  3P39 A;  4DR3 K;  4BR7 A;  1FXX A;  1X1P A;  4FJ9 A;  2E1Z A;  4E89 A;  4OX9 K;  3ZT4 A;  3D7E O;  2F8S A;  4F2S A;  3SMP A;  3ATV A;  3MXI A;  3C95 A;  1NK0 A;  2I7P A;  3ZSO A;  3ZSR A;  3G0Z A;  4H0T B;  4FPA A;  4FWM A;  3ZT2 A;  3L8B A;  4ILJ A;  4FJ7 A;  3ZSY A;  1T3V A;  3LAK A;  5LY3 A;  5ADX A;  1J9A A;  3VQB A;  5HRS A;  1S6P A;  4CJK A;  4B3R K;  3THX B;  4MDA A;  4FCY A;  4CJR A;  3SUQ A;  3HJF A;  4DV3 K;  4I9Q A;  4DR2 K;  3ZT1 A;  4IO9 L;  4DSF A;  1XHZ A;  4X64 K;  4GNI A;  4M3Y A;  3VQ8 A;  5BPM A;  1NGC A;  4B9T A;  3U4L A;  4IZ9 A;  2IOC A;  3CFR A;  1N6Q A;  2OZS A;  3P38 A;  3B6P A;  4JAX A;  4JKE A;  2FSN A;  5E41 A;  3O5B A;  1GOB A;  3J81 O;  1ASV A;  5GIO A;  2G8W A;  2HBM A;  2PZS A;  5AQN A;  3J80 O;  3QIN A;  4XH4 A;  1NU0 A;  4QAG A;  4YOY A;  3LWL A;  3SBT A;  4YFU A;  1C0F A;  4X66 K;  3EKU A;  2QI2 A;  1L3T A;  4CJF A;  3OS1 A;  3M6G A;  1HMV A;  4NXN K;  2ZGY A;  2ASM A;  3KVG A;  3A2F A;  3G4S N;  5M1F A;  4DV7 K;  1DTT A;  4H5T A;  2A42 A;  2IS3 A;  4FK2 A;  4BG9 A;  4GVE A;  5LMN K;  4JS5 A;  4M3T A;  4FJL A;  1NJW A;  3PLA A;  4F3O A;  1VRT A;  4OKJ A;  4BWM A;  3EYZ A;  2HHW A;  3M3Z A;  4HCC A;  4PKG A;  2UUB K;  4E7K A;  4FK0 A;  1OH5 A;  4CD1 A;  1N5Y A;  3HPG A;  3D2F A;  1P90 A;  1RTH A;  4FLU A;  4FJI A;  4DMN A;  3KK1 A;  3WQT A;  2QXL A;  4CJT A;  5CHI A;  3T3F A;  4ID1 A;  1BCO A;  3RR8 A;  1BI4 B;  2GEL A;  4BRQ A;  3TAF A;  4KTW A;  3ZYY X;  4BQL A;  2UUC K;  1KSP A;  3ALY A;  1B9F A;  1KFS A;  1BU6 O;  3AVH A;  4B3M K;  1ITG A;  3QER A;  3HPH A;  4JKC A;  3KJV A;  4IFE A;  3P1G A;  1X9S A;  1NLV A;  4AF1 A;  4A62 A;  5FPM A;  3JAM O;  4PUO A;  1YVU A;  2ZQB A;  1NK9 A;  3D45 A;  4AQY K;  1F21 A;  1KAY A;  1UAX A;  4CJ5 A;  1RDC A;  3VOV A;  3V81 A;  3CD6 N;  1G99 A;  3CF5 L;  3WXM B;  3SPZ A;  4OJR A;  4FWO A;  1QZ6 A;  2UU9 K;  3KK3 A;  2EHG A;  4DU1 A;  3FZL A;  3SQ4 A;  1BHL A;  2ZF5 O;  4KRF A;  3ZEU B;  4FW1 A;  1JCG A;  4B1Y B;  5GAG P;  4DTM A;  2B4J A;  3S9H A;  1SKR A;  2OPQ A;  3EE8 A;  4WYB A;  4DF4 A;  1S1X A;  2GTD A;  3C0B A;  3CI5 A;  4HTL A;  3ID8 A;  5FRO A;  4FWK A;  2QWO A;  4NYF A;  4C8N A;  2BAN A;  3QEV A;  3V9W A;  3F73 A;  2NUB A;  1WSJ A;  2PYJ A;  2P9S B;  4AIL C;  3DXK A;  2P9I A;  3DOL A;  4FJH A;  4FLZ A;  3OYG A;  2HHX A;  3KD5 E;  3DLE A;  3UE5 A;  5EOY A;  4JK9 A;  2DY4 A;  1NGA A;  1SL0 A;  2B6A A;  3RVC A;  3K57 A;  4E7H A;  5KPR A;  2YNF A;  4BR0 A;  3FZM A;  5AQL A;  4AM7 A;  5BR8 K;  1U47 A;  4K8X A;  5A2Q O;  3NAE A;  5HRO A;  4CJ4 A;  3OW2 M;  2IAJ A;  5K14 A;  4FWS A;  3VGK A;  1H1V A;  2CGL A;  2X78 A;  3ULD A;  1TGO A;  4BRO A;  5SWM A;  1QE1 A;  4WCE L;  4DV5 K;  2O4I A;  3AAP A;  2O8D B;  4FXD A;  1VQM N;  3P4I A;  1YIJ N;  1T44 A;  3TPQ A;  2D0P A;  3A5N C;  1NK7 A;  1IH7 A;  4JI4 K;  3BUZ B;  1HJO A;  4I9L A;  3LZJ A;  3C94 A;  3NVK A;  3O08 A;  4BE0 A;  5JS1 A;  3AAQ A;  2FSK A;  1UOC A;  3R8E A;  2XHB A;  5DM7 L;  2W41 A;  5AZI A;  1VK0 A;  2HHT A;  2QWQ A;  3KK7 A;  3TU5 A;  1ESV A;  2D0O A;  3THW A;  5AQI A;  5CZ1 A;  2DPN A;  3CJ9 A;  5EX5 A;  3VA0 A;  1TK8 A;  4A59 A;  4DLE A;  5B8H A;  3HM8 A;  4ISF A;  4CEC A;  3WNF A;  4JKF A;  1JCE A;  1O13 A;  3FR0 A;  3O9S A;  4FWR A;  1EET A;  4E7L A;  3CXC M;  4CEB A;  1Z26 A;  1TL3 A;  4E1J A;  1OH6 A;  4OPJ A;  3C6U A;  5J1E A;  4B08 A;  1CXU A;  1Q9X A;  5HOO A;  3PIO L;  2Y1J A;  3H3O B;  1NJZ A;  3CFO A;  4DV6 K;  1HKB A;  3OTO K;  2IIR A;  3SUO A;  4BR5 A;  2JGU A;  3AO1 A;  5AQU A;  4CIG A;  4OLB A;  3QIO A;  4CGD A;  4M7X A;  2GUI A;  4GMJ B;  5DMR A;  3VQ7 A;  4FLV A;  1VAZ A;  4IO8 A;  4AHU A;  4XIU A;  5EY4 A;  4BRL A;  3NE6 A;  1QQO A;  2FBT A;  2PBD A;  3U9Z A;  1K8K A;  3OS2 A;  3H46 O;  1HNI A;  3SPY A;  1N8R O;  3DMJ A;  1J54 A;  4JK7 A;  5C2F A;  3LWM A;  5AQJ A;  4JKA A;  2VG5 A;  3CCR N;  4CIF A;  2KFZ A;  2HOE A;  5M1O A;  4RW4 A;  1Q82 O;  5GIN A;  2HBK A;  4LF8 K;  4KBO A;  1HPZ A;  3LPU A;  1S9G A;  3L3U A;  1S1W A;  1NGD A;  2CGJ A;  3CIP A;  4ID5 A;  1ZBI A;  1HJR A;  4C8L A;  5KGW A;  3CPE A;  5BPL A;  1Q9Y A;  3ZSX A;  3PX0 A;  3D2F B;  3UKU A;  4FOI A;  2Z1H A;  1IG9 A;  1IBM K;  4NYN A;  4DWI A;  1QSY A;  1GLJ O;  2OA8 A;  3V9Z A;  3V9U A;  5AZJ A;  3EN9 A;  1Z6R A;  1VHX A;  5CYM A;  4JN4 A;  1ZBL A;  1U04 A;  1GLD G;  3IUC A;  4B9U A;  3PX4 A;  2P9N A;  2W42 A;  1T05 A;  1JLC A;  1RT7 A;  4AH9 A;  3K9K A;  4CE9 A;  2D5R A;  4FK4 A;  4H5N A;  4E7I A;  3MXJ A;  4NCG A;  4GV9 A;  1YUW A;  2NRV A;  2FF3 B;  2QWR A;  3AVN A;  4FLT A;  3TAP A;  4YNQ A;  3KKR A;  1O1W A;  4O5B A;  3CJC A;  1C1C A;  4AHT A;  1RBS A;  4CEA A;  2W6L A;  1N34 K;  2KW4 A;  4BE2 A;  1IG8 A;  4PL8 A;  1I39 A;  4EZ6 A;  3AVI A;  1DT9 A;  3OS0 A;  2P5G A;  1ZC6 A;  1Q7Y O;  4CCH A;  3I8D A;  4FZX C;  4MO4 A;  4CJU A;  3WNE A;  3G6E N;  3W0L A;  4FW2 A;  3QB0 A;  2HW3 A;  4DSI A;  2WON A;  5IWA K;  3ZX0 A;  3K9J A;  2ZWH A;  4A61 A;  3BY5 A;  1WSF A;  1WSE A;  4GV6 A;  1Z05 A;  1DTQ A;  2B5J A;  1IO2 A;  4GKK K;  4B8C A;  3MK6 A;  3NGY A;  4C1N I;  3CC4 N;  1GLE G;  3LDL A;  4OKK A;  2ZJP L;  4CF2 A;  1FKP A;  4WQ4 C;  4HUE A;  1LWF A;  3CJA A;  3M8R A;  3O4N A;  3O3G A;  1IBL K;  3RTV A;  5JLF A;  1QHT A;  3OYL A;  3THV A;  1TKT A;  4FJ5 A;  1XWL A;  5JVG L;  3OYH A;  3AVA A;  4JI5 K;  4CD3 A;  3SQ0 A;  4EHU A;  3SAH A;  5T7B A;  3SQ1 A;  2QKB A;  3QEI A;  1T8E A;  3AAR A;  3RSE A;  4DQR A;  1EX4 A;  5AQY A;  5KRS A;  2O8C A;  2CGK A;  3QBW A;  3R6M A;  1C6V A;  4BVO A;  1RDU A;  3B6O A;  2QTD A;  3O9Q A;  1GOA A;  3WXK A;  4FJN A;  1NKE A;  2J4R A;  1GOC A;  4CEZ A;  4HWI A;  1ASW A;  1WBD A;  1P8Z A;  2AA4 A;  4FJJ A;  3OHR A;  3EKS A;  3LDS A;  4FYD A;  4BRC A;  2YHB A;  3L2R A;  5AZI B;  1OH7 A;  1OH8 A;  4CJ7 A;  2P5O A;  3THW B;  2NLX A;  3SLC A;  4KV8 A;  2F7T A;  5DK5 A;  1U6Z A;  2BDP A;  3CM6 A;  2HMP A;  3LL3 A;  2HVH A;  3H1Q A;  4PL7 A;  5KRT A;  1TK5 A;  2E2Q A;  1VQ8 N;  4Z4E A;  3QDK A;  4DUY K;  3ZCM A;  4CK1 A;  4CES A;  4IBN A;  4IG3 A;  1JXE A;  4O8U A;  4NLC A;  3RRG A;  1S22 A;  5CY4 A;  4FM0 A;  3CET A;  4PWD A;  1RTI A;  4CGI A;  5BPN A;  3OYN A;  2P9U A;  3VQ6 A;  1YJN N;  1LOT B;  3TTD A;  4YOU A;  2GWK A;  4WQ5 C;  3BF3 A;  4W5T A;  4W5R A;  2YV0 X;  4DQ8 A;  3BF1 A;  5SZT A;  1HPM A;  2D4W A;  4U7B A;  2Q31 A;  1LV5 A;  1K9M O;  4CEO A;  3P83 D;  3MX2 A;  3LDQ A;  3H6E A;  1K8K B;  1WAF A;  3KHY A;  3L2V A;  4BAC A;  2Q2R A;  4FVM A;  2FBX A;  3ATU A;  3AA4 A;  4Y1C A;  3F9K A;  4O0I A;  2ITG A;  4CJP A;  3FZH A;  4AHV A;  1V4T A;  1KAZ A;  4BRE A;  1VQ4 N;  4CGH A;  4LF5 K;  5TKW A;  5E84 A;  4ISE A;  3G25 A;  2E20 A;  4E7J A;  1RT2 A;  3CCQ N;  3A0I X;  3LP3 A;  1KAX A;  5KTQ A;  1X9J A;  3NDK A;  5H1S Q;  1TKD A;  2XY7 A;  1EWQ A;  3KTQ A;  3AVM A;  2ITM A;  4ICL A;  1JLB A;  1Q18 A;  1RT5 A;  2IGI A;  1WSH A;  3UKU B;  3CCU N;  3HBT A;  4M42 A;  2HST A;  1ZBF A;  2QWN A;  3F2K A;  4E1M A;  1QQN A;  3K2P A;  4E3S A;  1W2B M;  4AM6 A;  1A5V A;  5AZJ B;  4YOR A;  2VYP A;  3NH0 A;  1BIS A;  3DRS A;  3VGL A;  3CFP A;  3VQC A;  1VQ7 N;  4A2B A;  5AQM A;  3HVT A;  1KFD A;  4KTZ A;  4WQ4 A;  1LWC A;  1TYQ B;  4BE1 A;  2P9N B;  1XC9 A;  1VSE A;  3LP2 A;  3T7Z A;  3VET A;  2ZJQ L;  1XI1 A;  1RDB A;  1BQM A;  3GE1 A;  3H08 A;  3PO4 A;  3QNN A;  2Z1J A;  2KLA A;  4M3U A;  5M1Q A;  1JL1 A;  3TSQ A;  3L0Q A;  4CHZ A;  3NH2 A;  3KLF A;  1FK9 A;  3QEP A;  4B1W B;  2YNG A;  3WT0 A;  3OYK A;  4OGE A;  4DQQ A;  4EZ9 A;  2OCE A;  1J53 A;  1SUQ A;  3R3L A;  3ZSW A;  2DFE A;  3SCX A;  4KAZ A;  4JNE A;  4FJK A;  1IV0 A;  2EWS A;  3ZSV A;  3TAN A;  4B3T K;  3VEW A;  3DYA A;  2VWB A;  4IWV A;  3NGI A;  3VTH A;  1N32 K;  4O8K A;  3VEZ A;  1UA1 A;  3IG1 A;  3MN7 A;  2F9W A;  4DV0 K;  1VQO N;  4IEI A;  5AR0 A;  2X6S A;  3RRH A;  4M3W A;  3LDN A;  1U2V A;  3TAB A;  2YJE A;  3NGZ A;  4DTN A;  4KH4 A;  4DTJ A;  2KTQ A;  3O4Q A;  3QET A;  4JI8 K;  3TTC A;  3ISN C;  1VSD A;  1NM1 A;  4EP5 A;  3CER A;  4JD2 A;  3OYB A;  5FLX O;  1VQ5 N;  3ZET A;  4CHY A;  1S9E A;  1D4X A;  3HYF A;  3HI0 A;  1T6C A;  4I7F A;  1RGI A;  2W40 A;  4IDH A;  2HBJ A;  1ATS A;  3HM9 A;  1XNR K;  2AJQ A;  4DR6 K;  2O8F A;  2P9P B;  1C0M A;  3DXM A;  4BG8 A;  4CGF A;  4WQ5 A;  4GY2 B;  2VWJ A;  2GUP A;  2O8C B;  2IC3 A;  3HK2 A;  3AA2 A;  2BGG A;  3QIP A;  4M3Z A;  3K5N A;  3MX5 A;  3MAQ A;  4JV5 K;  2D0C A;  4NCA A;  4KHP K;  2G8H A;  3LAN A;  5BRE A;  1ZBH A;  2VQF K;  2D0A A;  3VGM A;  3SI6 A;  3M8Q A;  3QEX A;  5BN8 A;  1MWK A;  4K42 A;  4OPK A;  2F4V K;  4CGG A;  1OVY A;  4K41 A;  4RW6 A;  3DLR A;  3BEX A;  4YDU C;  4CJ3 A;  4TSX A;  3TAE A;  4ISG A;  1RIL A;  1IKV A;  2FXU A;  4EIA A;  3NH1 A;  4K0K K;  3I8B A;  3AO4 A;  5AQT A;  1NGI A;  4AHR A;  3IDH A;  1LW0 A;  3SUP A;  4N76 A;  1NGG A;  1IKX A;  2RHK A;  4B3S K;  4YOW A;  3C6A A;  4WF9 L;  2O8B A;  2GWJ A;  5C42 A;  5JS2 A;  3IS9 A;  1WOQ A;  4CZG A;  3LZI A;  4OO1 J;  3THY A;  1HLU A;  1VSJ A;  2YNI A;  4HHT A;  4DS4 A;  2RKI A;  1VRU A;  4E0D A;  4YY3 K;  2P9U B;  3C7N A;  3IFR A;  1BQN A;  3SAF A;  4J2D A;  1NK4 A;  1QS4 A;  3QO9 A;  1RT4 A;  1S3X A;  3VQP A;  5HP1 A;  3VQ5 A;  2NZT A;  5E26 A;  1HYZ A;  2XY5 A;  4H0X B;  4H4M A;  3AY9 A;  1CXQ A;  2YHX A;  5LL6 Z;  1YF5 L;  1RT3 A;  2G8K A;  3NMU A;  3PSF A;  1E3M A;  4FWQ A;  3LDP A;  3OYD A;  4O55 A;  3SJJ A;  3WXL A;  1HRH A;  4BC4 A;  2V7Y A;  1YIT N;  3DLH A;  4CBU A;  5BRD A;  4ILH A;  3N4P A;  3TR8 A;  2YKM A;  4BR9 A;  2HF4 A;  3VES A;  4EHT A;  2I5J A;  4IEE A;  4M45 A;  5J2P A;  4WFA L;  1K6Y A;  1X3N A;  3RR7 A;  3CME N;  3O9R A;  3O1W A;  2G8U A;  3AVG A;  5ELZ A;  4NB4 A;  3QIC A;  2OAN A;  2HVI A;  3VEV A;  3FLC O;  1JL2 A;  3ZSQ A;  5J2N A;  2A5X A;  4OPH A;  4NCB A;  5AQR A;  5C25 A;  1ZXO A;  1Z25 A;  3BGR A;  5AFU A;  2KKZ A;  3K5L A;  4DV2 K;  4IJN A;  5AQG A;  1SV5 A;  4LC9 B;  2A1R A;  3ENO A;  4IKF A;  2FLO A;  3OYJ A;  5KQD A;  1X9W A;  4G1Q A;  3MMV A;  4GV3 A;  1RBU A;  5EXW A;  5C0Y A;  4KHN A;  1JLG A;  4C8O A;  4BRF A;  3HRG A;  3WQU A;  2A6A A;  1UA0 A;  1YJ9 N;  4CZI A;  4BGA A;  3ZT3 A;  4JLH A;  1WN7 A;  5KPZ A;  1HX1 A;  3RMC A;  1SKS A;  1I3A A;  1M1K O;  4DLG A;  1E4F T;  4EAH D;  4Z4I A;  1C0G A;  1XQS C;  2X6N A;  4CFD A;  2QA4 N;  1L5U A;  2YHW A;  3AVF A;  1HNZ K;  1JJ2 M;  4CHO A;  4H8K A;  3LDO A;  3OJS A;  2A41 A;  4FPB A;  2WOM A;  3H45 C;  4LH5 A;  3NF8 A;  4BR2 A;  4B1Z A;  1W0H A;  1NNE A;  2ZE2 A;  3DLG A;  5GAE P;  3VA3 A;  4LH4 A;  5HLF A;  5ADX H;  1G15 A;  1A5W A;  4E19 A;  3T1Y K;  3DM2 A;  4IOX A;  2VQE K;  3J7A P;  4CJW A;  1EQY A;  1JKH A;  3H3N O;  3VEO A;  3BZC A;  4DFP A;  4PY5 A;  2WC9 A;  2E6L A;  1NKC A;  3ID6 A;  4O0J A;  4F3T A;  4QS8 A;  4CZF A;  1BG3 A;  1A5X A;  4DR5 K;  1QVF M;  1X3M A;  3TAM A;  4JD2 B;  4LD0 A;  3QML A;  3I55 N;  3O4W A;  4CI6 A;  5HL7 L;  2G8F A;  3AO2 A;  3MDQ A;  1JLQ A;  3E66 A;  1GLL O;  3MEC A;  2E6M A;  3ENH A;  3O3H A;  3HXM A;  2W6K A;  4LFB K;  2O8F B;  2OTL N;  2P9L A;  4DR7 K;  4I2P A;  4H4O A;  3WEE A;  2E2P A;  4DFM A;  2KZM A;  3SBG A;  1MDU B;  1KC8 O;  3RMB A;  3O9U A;  1XNQ K;  4ILG B;  2KFN A;  3HSC A;  1RTJ A;  2Z1G A;  3RWU A;  5BN9 A;  5HRR A;  2FF6 A;  2YHA A;  4RG8 A;  4CZE A;  4LY7 A;  3KIO A;  3HPO A;  1J5O A;  2FC0 A;  4B1V A;  1QZ5 A;  4PHT X;  1S1V A;  4KI4 A;  1HYS A;  1GLA G;  4L3Q A;  4BRP A;  4HTU A;  1YHQ N;  4QCL A;  1NJX A;  3V9X A;  3CJ1 A;  4CW7 B;  4KFB A;  4JKD A;  3AGR A;  4YOT A;  1X9M A;  2HHV A;  3MN9 A;  1T6D A;  2E88 A;  4CZK A;  3HP9 A;  3AO5 A;  1QHA A;  4X62 K;  2PAV A;  3CYM A;  1SL2 A;  4FLY A;  2O8B B;  1C1B A;  3C65 A;  4LFA K;  1Q86 O;  3CM5 A;  1BL3 A;  4BRG A;  4OKE A;  2HB5 A;  4RW8 A;  3ENB A;  3THY B;  1BA0 A;  1WSI A;  3TI0 A;  4JI0 K;  3C7N B;  3DXK B;  4FWL A;  2P9I B;  4O44 A;  1IBK K;  3PX6 A;  3CPW M;  1W7A A;  3AV9 A;  1M90 O;  4BRM A;  2YHY A;  3JSM A;  1VSL A;  4JI2 K;  4DTO A;  5HRP A;  3V1Q A;  4B8A B;  2D1K A;  1T03 A;  1UWB A;  4DQP A;  3H1V X;  4DR1 K;  1YAG A;  4F4K A;  3HP6 A;  1BO5 O;  4CEQ A;  3AVK A;  3DLB A;  2KHO A;  4F9O A;  3KLG A;  3OYF A;  2QWL A;  3V6D A;  3CC7 N;  4CHN A;  2NRX A;  3FE1 A;  2CH5 A;  3MEE A;  1HKC A;  3K5O A;  4Y1D A;  3VF2 A;  1K8A O;  5I3U A;  2BUP A;  3QLH A;  1BWF O;  4FJM A;  1RBV A;  2VG6 A;  3CCE N;  5JLH A;  4CZM A;  4DV4 K;  4KPY A;  3HTV A;  3AVL A;  3E9L A;  3SNN A;  1KLM A;  3WNG A;  1MU2 A;  3UIQ A;  3D2E A;  3AGK A;  2DFF A;  3L4Q A;  4PA1 A;  3CJB A;  1OVQ A;  3M1F A;  3GOI A;  2GV9 A;  3L2W A;  4LF4 K;  1CZB A;  1L3V A;  4Z4F A;  2RPI A;  3SUN A;  4RWT A;  3JS6 A;  3IMX A;  1JLE A;  4KI6 A;  3FZK A;  4AHS A;  4O4G A;  2YI1 A;  4RTF D;  1TKX A;  5AQF A;  4PQU A;  2A3Z A;  2KZZ A;  3MWT A;  4I6M A;  1QQM A;  3IAY A;  1I94 K;  3VQD A;  1NJY A;  1BCM A;  4JHD A;  1EKE A;  3VQ9 A;  1NMD A;  4DQS A;  2ZGZ A;  4BDZ A;  1ASU A;  3HL8 A;  4CF0 A;  1CZ9 A;  3SV4 A;  4W5O A;  3NBP A;  4H0P A;  3DRR A;  2JWL A;  3KZB A;  3SV3 A;  4BRI A;  3G71 N;  4ELU A;  3WXJ A;  4DR4 K;  4M63 C;  1WAJ A;  5AQW A;  4B9Q A;  1MWM A;  4JK8 A;  3VPZ A;  1SL1 A;  3M8S A;  2QKK A;  4GKJ K;  2VCP A;  2HHQ A;  4CEE A;  1DKG D;  1S1U A;  3EL2 A;  1BOT O;  4B9M A;  1XC3 A;  3KWI A;  5FPE A;  1DGK N;  4H5R A;  3TSP A;  3J7Z O;  3MWP A;  3ZX3 A;  3TAR A;  3O1B A;  3DAW A;  4KO0 A;  4CF9 A;  2JLE A;  2ASO A;  4AHC A;  5KGX A;  4K8Z A;  5AQH A; 
#chains in the Genus database with same CATH homology
 4CFB A;  4Z0U A;  3DLK A;  3MEG A;  4CHY A;  2HHT A;  1S9E A;  1VK0 A;  3HYF A;  4FZZ A;  4DTU A;  3VN5 A;  2OYQ A;  4N56 A;  4I7F A;  4KHW A;  1YTU A;  1U49 A;  3HM9 A;  4KHQ A;  3TWH A;  5CZ1 A;  2AJQ A;  3VA0 A;  4FZY A;  4ELV A;  2LSN A;  1C0M A;  4CGF A;  4F2R A;  1TK8 A;  4MFB A;  3TAG A;  3S3O A;  2VWJ A;  1QSS A;  1KTQ A;  3AVB A;  1KRP A;  4DLE A;  4E1N A;  4J2B A;  2IC3 A;  3HK2 A;  3AA2 A;  4ELT A;  2BGG A;  3QIP A;  4CEC A;  4M3Z A;  3WNF A;  3U3Y A;  4J2A A;  4OGC A;  3K59 A;  4CIE A;  3K5N A;  3MAQ A;  2D0C A;  3L2U A;  4NCA A;  3U6F A;  2G8H A;  3MED A;  1EET A;  3LAN A;  4E7L A;  4CEB A;  1Z26 A;  3S3N A;  1S5J A;  1TL3 A;  1U45 A;  1ZBH A;  3E01 A;  5HBM A;  4OPJ A;  1R0A A;  2D0A A;  3C6U A;  5J1E A;  3SI6 A;  3M8Q A;  3QEX A;  4CF1 A;  4B08 A;  1CXU A;  1Q9X A;  2DFH A;  1JLA A;  4OPK A;  3OY9 A;  4CGG A;  1U4B A;  3K5M A;  2Y1J A;  1NJZ A;  3CFO A;  4RW6 A;  3DLR A;  3OYM A;  3RMA A;  4GW6 A;  4TSX A;  4CJ3 A;  4HUF A;  3SUO A;  3V1O A;  3TAE A;  1BIZ A;  3NF7 A;  1RIL A;  2JGU A;  1D9D A;  2A1S A;  3AO1 A;  4FJ8 A;  1IKV A;  1WNS A;  4CIG A;  4OLB A;  3QIO A;  1RNH A;  3NH1 A;  4CGD A;  4ZHR A;  3AO4 A;  2BE2 A;  4AHR A;  2GUI A;  2RF2 A;  4GMJ B;  1LW0 A;  5DMR A;  3VQ7 A;  4FLV A;  4DU3 A;  3SUP A;  4N76 A;  1IKX A;  1RDA A;  4J2E A;  4AHU A;  4CJE A;  4IFY A;  4XIU A;  1RT6 A;  3ASM A;  3S3M A;  3NE6 A;  4QOZ B;  4BDY A;  5C42 A;  5JS2 A;  2FBT A;  1JLF A;  2P51 A;  3IS9 A;  3V1R A;  3OS2 A;  4DS5 A;  3LZI A;  2OZM A;  3KLH A;  1HNI A;  1VSJ A;  2ETJ A;  2YNI A;  4HHT A;  4DS4 A;  1IKY A;  2RKI A;  1VRU A;  5J2M A;  3SPY A;  4E0D A;  2X74 A;  2VWK A;  4Q5V A;  1BQN A;  2VG7 A;  3DMJ A;  1J54 A;  3KKS A;  4M41 A;  3MXM A;  1NOY A;  1BI4 A;  4CK2 A;  3LWM A;  3PO5 A;  4KHS A;  1CLQ A;  5CZ2 A;  4W5N A;  4J2D A;  1NK4 A;  1QS4 A;  3QO9 A;  2VG5 A;  3SNN A;  1RT4 A;  1TV6 A;  3VQP A;  4CIF A;  5HP1 A;  2KFZ A;  3VQ5 A;  1HYZ A;  4RW4 A;  2XY5 A;  2HMI A;  1TAQ A;  1HPZ A;  2XRI A;  3LPU A;  4H4M A;  1T7P A;  1VSF A;  3KLE A;  1L3U A;  1S9G A;  1CXQ A;  3L3U A;  4KRE A;  1W9H A;  1S1W A;  1RTD A;  4ID5 A;  1ZBI A;  2G8I A;  1HJR A;  4C8L A;  5KGW A;  4CHQ A;  1REV A;  1D5A A;  1RT3 A;  4FLX A;  3ZSX A;  1Q9Y A;  2G8K A;  1RT1 A;  3PX0 A;  1HNV A;  3OYD A;  4O55 A;  3U3G A;  2Z1H A;  1BGX T;  1XHX A;  3SJJ A;  1IG9 A;  3DI6 A;  1HRH A;  4NYN A;  4CGJ A;  1D9F A;  1QTM A;  3DLH A;  3LAM A;  3TR8 A;  2YKM A;  1RDD A;  4GVM A;  3DRP A;  3OYI A;  3V9Z A;  1QSY A;  2OA8 A;  4DWI A;  4HVJ A;  3LPT A;  4KB0 A;  3V9U A;  1TVR A;  3OYC A;  3V9S A;  3SZ2 A;  3BDP A;  2I5J A;  2ZD1 A;  1VSH A;  4C8M A;  5J2P A;  4M45 A;  1QSL A;  3NHG A;  2FBY A;  1DLO A;  4WE1 A;  1K6Y A;  1EXQ A;  3KK2 A;  2PYJ A;  2XY8 A;  3RR7 A;  5CYM A;  3ZSZ A;  1ZBL A;  2FBV A;  1U04 A;  1KVC A;  2IDO A;  1LWE A;  4B9U A;  3PX4 A;  2G8U A;  3AVG A;  1YTA A;  3T1A A;  2W42 A;  2PY5 A;  1T05 A;  3IRX A;  1C0T A;  1JLC A;  1RT7 A;  4AH9 A;  4CE9 A;  2HVI A;  2D5R A;  3ZSQ A;  1JL2 A;  2EX3 A;  4FK4 A;  2HHS A;  4E7I A;  1KLN A;  5J2N A;  3MXJ A;  4NCG A;  1NK5 A;  4FM1 A;  4FJG A;  4NCB A;  4OLA A;  3AVN A;  5C25 A;  4FLW A;  4FLT A;  3TAP A;  4YNQ A;  1Z25 A;  3BGR A;  1O1W A;  3KKR A;  4LSN A;  4O5B A;  3HT3 A;  3K5L A;  1D8Y A;  2HNZ A;  4KB1 A;  2A1R A;  1SV5 A;  2YNH A;  4B9L A;  1C1C A;  4AHT A;  4IKF A;  3OYJ A;  3I0S A;  1RBS A;  1X9W A;  4G1Q A;  4CEA A;  4CED A;  2HHU A;  1RBU A;  2KW4 A;  4BE2 A;  4HCB A;  1I39 A;  3L2Q A;  3AVJ A;  4EZ6 A;  1JLG A;  2GBZ A;  3AVI A;  4DSL A;  4C8O A;  4DFJ A;  4DSJ A;  4KHN A;  1Q8I A;  3OS0 A;  5I42 A;  3ITH A;  2P5G A;  3EY1 A;  4CCH A;  1UA0 A;  4DQI A;  3I8D A;  4FZX C;  2YKN A;  4CJU A;  2Z1I A;  4IFV A;  3WNE A;  1JXB A;  4Q0B A;  4FW2 A;  3ZT3 A;  1L3S A;  2HW3 A;  4DSI A;  4CEF A;  3ZT0 A;  2WON A;  4JLH A;  1WN7 A;  5FRN A;  3RMC A;  1SKS A;  1I3A A;  1WSE A;  1WSF A;  1KVA A;  4FM2 A;  4DLG A;  4B3O A;  1TAU A;  1ZBU A;  4IG0 A;  1DTQ A;  4Z4I A;  2B5J A;  3K58 A;  1IO2 A;  2DTU A;  4B8C A;  4W5Q A;  4F8R A;  2HNY A;  3V4I A;  2X6N A;  3NGY A;  4CFD A;  1L5U A;  3SQ2 A;  2E4L A;  2QXF A;  1HYV A;  5J2Q A;  3AVF A;  4CJS A;  4Z4C A;  1C1A A;  1IKW A;  4H8K A;  4CHO A;  3NCI A;  1LAW A;  4B9V A;  4OKK A;  1QQC A;  4CF2 A;  3OJS A;  4DU4 A;  3KLI A;  1FKP A;  2WOM A;  4HUE A;  1LWF A;  4LH5 A;  3M8R A;  3NF8 A;  4DSK A;  4L8R B;  3OYE A;  1W0H A;  3O4N A;  3AO3 A;  2O4G A;  2ZE2 A;  3DLG A;  3O3G A;  1FXX A;  3RTV A;  1X1P A;  4FJ9 A;  4E89 A;  1QHT A;  3OYL A;  3VA3 A;  4LH4 A;  5HLF A;  1G15 A;  3THV A;  1TKT A;  3ZT4 A;  4HUG A;  4FJ5 A;  4KTQ A;  1XWL A;  1A5W A;  4E19 A;  3DM2 A;  3OYH A;  3AVA A;  3FFI A;  2F8S A;  1YT3 A;  3SQ0 A;  4F2S A;  4CF8 A;  4CJW A;  3MXI A;  3C95 A;  1JKH A;  1NK0 A;  3VQE A;  3ZSO A;  4CHP A;  4RW7 A;  5HRN A;  5T7B A;  4DTR A;  1S1T A;  4DFP A;  3SQ1 A;  2ATQ A;  3AA3 A;  3ZSR A;  3QEI A;  3G0Z A;  4MQ3 A;  1T8E A;  4K8Z A;  4PY5 A;  3L8B A;  3ZT2 A;  2E6L A;  4N41 A;  4DQR A;  4FJ7 A;  1EX4 A;  3ZSY A;  4B9N A;  5KRS A;  3LAK A;  2PYL A;  1BIU A;  1NKC A;  1C6V A;  4O0J A;  3QNO A;  3OJU A;  4F3T A;  1RBR A;  1J9A A;  3B6O A;  3VQB A;  5HRS A;  1GOA A;  4FJN A;  1NKE A;  1A5X A;  1S6P A;  1GOC A;  4CEZ A;  3TAM A;  4LD0 A;  1LAV A;  2Q3S A;  5KI6 A;  4CJK A;  1ASW A;  3I0R A;  4FJJ A;  4FCY A;  4CJR A;  3SUQ A;  4M3R A;  3HJF A;  4I9Q A;  3LDS A;  4FYD A;  3ZT1 A;  2G8F A;  3AO2 A;  2YHB A;  3L2R A;  4DSF A;  1XHZ A;  1ZYQ A;  4DFK A;  3VQ8 A;  4M3Y A;  1JLQ A;  2HND A;  4CFC A;  3JYT A;  2QK9 A;  4B9T A;  2P5O A;  3MEC A;  2E6M A;  4KV8 A;  3O3H A;  2IOC A;  5DK5 A;  3HXM A;  3CFR A;  1N6Q A;  2OZS A;  3B6P A;  2BDP A;  4FJX A;  3CM6 A;  4I2P A;  1Y97 A;  5E41 A;  4DTP A;  4H4O A;  1GOB A;  3PUF A;  4DFM A;  1ASV A;  4CER A;  2HVH A;  2G8W A;  2KZM A;  5KRT A;  1TK5 A;  3AVC A;  1TK0 A;  2PZS A;  3RMB A;  4Z4E A;  3QIN A;  2KFN A;  3ZCM A;  4CK1 A;  1VSI A;  1RTJ A;  2Z1G A;  3P5J A;  4OVL A;  4CES A;  3RWU A;  4IBN A;  4IG3 A;  4QAG A;  3LWL A;  1JXE A;  5HRR A;  3RMD A;  4YFU A;  2YHA A;  3RRG A;  5CY4 A;  4CJV A;  4FM0 A;  4RG8 A;  1L3T A;  4CJF A;  3OS1 A;  4CFA A;  1HMV A;  3KIO A;  4LY7 A;  4PWD A;  1RTI A;  4UQG A;  2QKB A;  3HPO A;  1J5O A;  1B92 A;  2FC0 A;  4CGI A;  3D0P A;  3NF6 A;  3OYN A;  1S1V A;  4CJQ A;  3A2F A;  4KI4 A;  1HYS A;  3VQ6 A;  3L3V A;  4HTU A;  1DTT A;  3TAQ A;  4JRP A;  4QCL A;  1NJX A;  3V9X A;  2IS3 A;  1NKB A;  4KFB A;  4FK2 A;  4JRQ A;  4JS5 A;  4M3T A;  4W5T A;  4FJL A;  1C0U A;  1NJW A;  4W5R A;  1X9M A;  4F3O A;  2HHV A;  1VRT A;  4OKJ A;  5EU7 A;  5FRM A;  4BWM A;  1SKW A;  2YV0 X;  3EYZ A;  2HHW A;  3HP9 A;  3AO5 A;  4Z4H A;  3PY8 A;  4HCC A;  5SZT A;  4E7K A;  1LV5 A;  4FK0 A;  1RBT A;  4CEO A;  5FDL A;  1B9D A;  3P83 D;  3CYM A;  4IDK A;  4BWJ A;  2F96 A;  1SL2 A;  4FLY A;  1C1B A;  1N5Y A;  3CM5 A;  1BL3 A;  3G10 A;  3HPG A;  4OKE A;  1WAF A;  2HB5 A;  1RTH A;  4RW8 A;  4FLU A;  4DMN A;  3KK1 A;  4CJT A;  2R7Y A;  3T3F A;  3EZ5 A;  4FJI A;  4KAZ A;  3L2V A;  1WSI A;  4BAC A;  3TI0 A;  4ID1 A;  1BCO A;  3RR8 A;  4FVM A;  2FBX A;  4KHY A;  3AA4 A;  4O44 A;  4Y1C A;  3F9K A;  4O0I A;  4Z4G A;  2ITG A;  1BI4 B;  3PX6 A;  3AV9 A;  3TAF A;  4KTW A;  4CJP A;  3CG7 A;  4AHV A;  1KSP A;  3ALY A;  1B9F A;  1RCH A;  1VSL A;  2D0B A;  3JSM A;  4ZTF A;  1KFS A;  3AVH A;  4CGH A;  4DTO A;  2XO7 A;  2P1J A;  5HRP A;  3V1Q A;  4B8A B;  1T03 A;  4E7J A;  1ITG A;  1RT2 A;  1UWB A;  3LP0 A;  3QER A;  3HPH A;  3LP3 A;  4DQP A;  3KJV A;  5D3G A;  4LSL A;  4F4K A;  5KTQ A;  3HP6 A;  3P1G A;  1X9S A;  4CEQ A;  3AVK A;  3NDK A;  2OPP A;  3DLB A;  4PUO A;  2ZQB A;  1YVU A;  1TKD A;  1NK9 A;  3D45 A;  2XY7 A;  3KLG A;  3KTQ A;  3WNH A;  3AVM A;  3OYF A;  1LW2 A;  1F21 A;  4ICL A;  1UAX A;  4CJ5 A;  1JLB A;  3V6D A;  1RDC A;  1VSM A;  1RT5 A;  4DSE A;  2IGI A;  4CHN A;  3SYZ A;  1WSH A;  3MEE A;  3K5O A;  4Y1D A;  3V81 A;  4M42 A;  1TL1 A;  1ZBF A;  5I3U A;  4E1M A;  3SPZ A;  1KCF A;  4OJR A;  3K2P A;  3QLH A;  4E3S A;  3T19 A;  1KVB A;  4FJM A;  3CQ8 A;  3KK3 A;  2EHG A;  4DU1 A;  1NK8 A;  1A5V A;  1RBV A;  2VG6 A;  3SQ4 A;  1U48 A;  1BHL A;  4KRF A;  3NH0 A;  4KPY A;  2OPR A;  4FW1 A;  3AVL A;  1BIS A;  4JS4 A;  1KLM A;  2B4J A;  3VQQ A;  3WNG A;  1MU2 A;  4DTM A;  2OPQ A;  3S9H A;  3DRS A;  1SKR A;  3M8P A;  3UIQ A;  3CFP A;  3VQC A;  1S1X A;  1WLJ A;  4I2Q A;  4DF4 A;  3HVT A;  2DFF A;  1KFD A;  4KTZ A;  1LWC A;  5FRO A;  4BE1 A;  3VQ4 A;  1XC9 A;  4PA1 A;  1VSE A;  3LP2 A;  1FKO A;  2BAN A;  4NYF A;  4C8N A;  3QEV A;  3V9W A;  4B9S A;  3F73 A;  3O3F A;  2GV9 A;  1WSJ A;  2NUB A;  2RN2 A;  3L2W A;  1RDB A;  1BQM A;  4AIL C;  3H08 A;  1CZB A;  1XI1 A;  1L3V A;  2RPI A;  3QNN A;  2G8V A;  3PO4 A;  4Z4F A;  3SUN A;  3DOL A;  4FJH A;  2Z1J A;  4FLZ A;  3OYG A;  1JLE A;  4KI6 A;  2HHX A;  4M3U A;  4AHS A;  4O4G A;  1JL1 A;  3KD5 E;  3PV8 A;  1TKX A;  3AA5 X;  4PQU A;  3DLE A;  2KZZ A;  2OPS A;  4CHZ A;  3NH2 A;  3KLF A;  3IAY A;  1FK9 A;  3QEP A;  2XY6 A;  4BDP A;  3VQD A;  4DF8 A;  2YNG A;  2DY4 A;  4EP4 A;  4CK3 A;  3OYK A;  1SL0 A;  1NJY A;  3HO1 A;  2B6A A;  4OGE A;  4DQQ A;  3K57 A;  3LP1 A;  4E7H A;  4EZ9 A;  4RW9 A;  4DTS A;  1J53 A;  1SUQ A;  3ZSW A;  1BCM A;  1S6Q A;  2DFE A;  2YNF A;  1EKE A;  5CYQ A;  3VQ9 A;  3SCX A;  4FJK A;  4DQS A;  3KD1 E;  4BDZ A;  3QES A;  1ASU A;  1EP4 A;  3HL8 A;  3ZSV A;  4N5S A;  3HST B;  3TAN A;  3C6T A;  4CF0 A;  3DYA A;  4DTX A;  1CZ9 A;  1U47 A;  3SV4 A;  4R5P A;  4K8X A;  3NAE A;  4W5O A;  3NBP A;  5HRO A;  4CJ4 A;  3NGI A;  3DRR A;  1TKZ A;  3SV3 A;  2IAJ A;  5K14 A;  4ELU A;  4DG1 A;  1WSG A;  1UA1 A;  2X78 A;  3IG1 A;  1WAJ A;  1TGO A;  3ULD A;  4CJL A;  5SWM A;  1QE1 A;  1SL1 A;  1VSK A;  3M8S A;  2X6S A;  3LAL A;  3RRH A;  4M3W A;  2QKK A;  3TAB A;  4ZTJ A;  2O4I A;  4FXD A;  3NGZ A;  4DTN A;  2HHQ A;  4KKO A;  2Y1I A;  1NK6 A;  4CEE A;  2F8T A;  4DTJ A;  1NK7 A;  1S1U A;  1IH7 A;  3O4Q A;  3OVN A;  3QET A;  2KTQ A;  1HQE A;  1HQU A;  4I9L A;  4M3X A;  4B9M A;  3ISN C;  1VSD A;  3LZJ A;  3DOK A;  4N47 A;  3C94 A;  4EP5 A;  2KQ2 A;  4BE0 A;  5C24 A;  3VQA A;  5JS1 A;  3TAR A;  1NOZ A;  3NFA A;  3OYB A;  1UOC A;  3QEW A;  3NF9 A;  3OYA A;  3HVR A;  4KHU A;  4KO0 A;  4CF9 A;  2JLE A;  5KGX A;  4AHC A;  4C8K A;  2XHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...