4CK2A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
154
structure length
150
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 56
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ck2A00
3AVNA 1J53A 5E41A 3QO9A 1SL1A 1U49A 4LY7A 3SQ4A 4CEQA 4FJKA 2WOMA 2YV0X 4HHTA 3HK2A 4CJPA 1SKWA 1VSJA 3OS2A 4QCLA 3U6FA 1JLEA 1S6PA 4M3ZA 2IDOA 1NKCA 1J5OA 3ZSRA 4JRPA 4CJQA 4FJIA 2G8IA 1R0AA 1HYZA 3WNEA 2HHXA 2KZMA 4IFVA 4ID1A 4OKJA 3VQBA 1TK0A 3AO3A 4AHTA 4JS4A 4KHSA 4AH9A 3G0ZA 2KFZA 2O4IA 2B5JA 3AA3A 4CJVA 4YFUA 4NYNA 1NJWA 4CJSA 4FJGA 4FXDA 2HNZA 4FJJA 2D0CA 4KHNA 1EETA 1QSSA 1VSIA 4DSIA 3OYEA 3SV4A 4CHPA 3LPTA 3ZT1A 1C1CA 3QNNA 1C6VA 2YKMA 1HPZA 1S1UA 1ZYQA 3VQ8A 1U48A 1KVBA 2P51A 4M3RA 5HP1A 4IKFA 2YKNA 3AO5A 1LWCA 3AVLA 3F73A 1NKEA 4NCBA 3ISNC 1WAFA 3OYFA 5DK5A 4JRQA 2RN2A 3AA5X 1FXXA 1SV5A 4FM1A 3S3OA 3SV3A 4DTNA 5J2QA 3SPZA 5HLFA 5KGXA 3IG1A 1TAQA 3BGRA 2QXFA 3QERA 3SUOA 4DF8A 3QEPA 1O1WA 2G8WA 4HUEA 5KRTA 2R7YA 2ATQA 4QOZB 3P1GA 3K5LA 1S1TA 1X1PA 2D0AA 3NGZA 1KLMA 4DTRA 1L5UA 4EP5A 4IDKA 1BQMA 4CEDA 1QHTA 3CFPA 2G8FA 4RG8A 4I9LA 3OYJA 4N47A 4CJWA 3AO1A 3KJVA 4CEAA 1BI4A 4FLVA 1UWBA 4DQSA 4B8AB 4CEEA 1KVCA 5I3UA 5I42A 2AJQA 3VA0A 1RTHA 1QE1A 1EXQA 3HO1A 3SQ2A 3NF8A 2FBYA 2YNGA 4BACA 4CFAA 4DF4A 4RW7A 3LP2A 4FJHA 3AVGA 3DRPA 4DQRA 4DTSA 2Y1JA 2NUBA 1RTJA 4CERA 4Z4EA 4BDZA 1IKXA 3HP6A 2Z1JA 4W5NA 2E4LA 2PY5A 3DLHA 3TAEA 1WSGA 4AHVA 2ZD1A 2Z1IA 5HRNA 1XI1A 4Z4FA 1G15A 3V1OA 3WNGA 3O4NA 4CK2A 4BDPA 4DQQA 1RCHA 3CFRA 1XWLA 3DRSA 4N41A 4CEFA 5HROA 3TANA 3LP0A 3SPYA 1X9WA 1NK6A 4IBNA 2W42A 3OYHA 4OLAA 1VSKA 2OZMA 4LSNA 3V9XA 3OYDA 4HCCA 4PY5A 3B6PA 5C24A 4FZZA 3OS0A 2XRIA 4CEZA 3K5OA 1UA0A 3NH2A 1SKSA 1HQEA 3MEGA 3LAMA 4NCGA 3OYAA 1JLCA 3SUPA 3RRHA 1L3TA 4DTPA 1VSLA 1YT3A 3ZCMA 4CF9A 3V9SA 1WLJA 1VSMA 4H4OA 3M8SA 4ZTJA 4C8NA 4DFKA 5C42A 1TK8A 1Q8IA 1TVRA 1Z25A 1JL2A 4PQUA 4CGFA 2HHUA 1HMVA 1S1VA 3RWUA 3IAYA 4O0IA 1Q9XA 4CJKA 4Q5VA 2EHGA 3MXIA 1NK8A 1KRPA 1N5YA 4GW6A 4CHOA 5K14A 3JYTA 1BIZA 3V1RA 4CEOA 3OYCA 3U3GA 3MAQA 1RDAA 4KREA 1SUQA 3NGYA 1JLAA 2IGIA 2Q3SA 4C8KA 5HRRA 4OVLA 1QSLA 2FC0A 4DQPA 1N6QA 4OJRA 3LP1A 2A1SA 4Y1CA 1Z26A 3VA3A 3MEDA 4ZHRA 4FLWA 3RR8A 1WSJA 5KGWA 4CJLA 4CESA 1KCFA 2P5GA 4CF2A 1MU2A 5FDLA 1RBVA 3QIPA 4Z4HA 1U45A 1YVUA 1DTQA 4FK0A 1CXUA 1CZ9A 5SZTA 2HW3A 3KIOA 3QESA 1ASVA 1GOBA 3HM9A 1W0HA 4KFBA 5CZ1A 2F96A 3QIOA 4YNQA 2DFFA 3KLIA 3CFOA 5T7BA 3DLEA 4FK4A 3HPHA 4HUGA 4KO0A 1RT3A 3LWLA 4KHUA 3V9UA 3RTVA 1BISA 4KTWA 3OJUA 3OYMA 2BANA 3LZJA 3RMDA 3AVHA 1S1WA 4CJ5A 4NCAA 2VG6A 4CJEA 3B6OA 4E1MA 4DTOA 1VRTA 3VQEA 4G1QA 4PUOA 4CGIA 1KVAA 3TAMA 3AVFA 4AHUA 2E6LA 2GUIA 3S3MA 1QS4A 1TV6A 1T7PA 4ICLA 3V9ZA 3C6TA 4B8CA 1RT4A 4CF1A 2BGGA 3M8QA 3MXMA 4FJ8A 2HHTA 2ITGA 3FFIA 1DTTA 4M41A 3PX6A 2EX3A 1JLGA 3LPUA 1C0TA 1BGXT 1KTQA 1NJYA 1NK4A 5JS1A 1NK7A 3K5NA 1VSHA 3C94A 3V1QA 4GVMA 4DSJA 3PO4A 2QK9A 4RW8A 3AVBA 3CM6A 3DLGA 4CHQA 3F9KA 5KRSA 3KD1E 4ELTA 3LDSA 2X74A 3AA2A 3HL8A 4IG3A 3UIQA 4B9UA 3OYKA 2E6MA 4CEBA 3AVIA 4M3WA 5J2MA 1U04A 4E7KA 1RBUA 3LAKA 4CFDA 2A1RA 4KB0A 5FRNA 4AHSA 3DLBA 3NH0A 4FLTA 2JLEA 1WAJA 4MFBA 3O3HA 4LH4A 2QKKA 1TL1A 4I9QA 1XHZA 1BHLA 1WN7A 1VSFA 4B9LA 1K6YA 4DSEA 1VRUA 1D9DA 4BWJA 3T1AA 4FLZA 4DS4A 1C1BA 3VN5A 2ZE2A 4KV8A 4DLEA 1BIUA 1EX4A 1WNSA 1JLFA 4DSLA 4CGJA 1S9EA 2PZSA 1GOAA 3HPOA 3LALA 3KLEA 2OA8A 4O0JA 1YTAA 3KK3A 4Y1DA 1L3SA 2FBXA 2G8KA 4F3TA 3DOKA 1C0UA 1HQUA 2GBZA 1HNVA 1RDCA 5FRMA 4E7IA 2XY5A 3TAPA 3ZSZA 2HHWA 1D5AA 2B6AA 1TAUA 4O55A 4WE1A 3ITHA 3OYNA 2P1JA 1KLNA 5J2PA 4CF0A 3LANA 4RW4A 1WSFA 3CQ8A 3L2QA 4O44A 2HVHA 4FYDA 5CYQA 1S5JA 3ZSOA 3DMJA 4BE2A 1EP4A 3PV8A 3VQDA 1UA1A 1KFSA 4GMJB 1T03A 3I8DA 4DFPA 1ZBFA 4UQGA 4M3YA 4CJTA 1I3AA 3KLFA 3AA4A 3M8RA 1IG9A 4CJ4A 2OZSA 1NOYA 4FJXA 2RPIA 3L3UA 3KK1A 3NAEA 4DS5A 4KAZA 3T19A 3ZSWA 4DWIA 1FK9A 4I7FA 3RMAA 1KFDA 1DLOA 2KQ2A 3ZSVA 5J2NA 3NF7A 3ZT2A 4F4KA 4KHYA 1RBTA 2X6NA 1BCOA 4EZ9A 4ZTFA 4KI6A 3KK2A 4DU4A 1RT7A 2DTUA 3TWHA 4OLBA 4KTQA 4C8MA 3V9WA 4KHWA 1EKEA 2OPSA 4CIFA 1RT1A 2XO7A 1JLQA 1BQNA 1IKVA 1LW0A 3VQ6A 2FBVA 3MECA 1ITGA 1ZBHA 2I5JA 3SUQA 3AVCA 3D45A 1RNHA 3KKSA 3TAFA 3RMCA 2OYQA 3VQ9A 4FVMA 1S1XA 3NH1A 4KHQA 3NFAA 1BI4B 4CJFA 2HHVA 4B9MA 2BE2A 1C1AA 4CGGA 4KB1A 3HJFA 3OVNA 3U3YA 1RDBA 4EZ6A 3C95A 3OYIA 4FLUA 4FJ9A 4J2BA 2DFHA 4EP4A 1JXBA 5C25A 2D5RA 4B9NA 1WSHA 1CZBA 4NYFA 3L8BA 4L8RB 4CGHA 3CM5A 1L3VA 4DTMA 1ZBLA 4LD0A 1J54A 2FBTA 3ZT4A 4H8KA 3SJJA 3VQ5A 1JKHA 2G8HA 4BE1A 4Z4IA 3LWMA 3AVMA 1IKWA 1Y97A 2VWKA 3SUNA 2HNYA 3HT3A 4CK1A 1D9FA 3DI6A 4CJ3A 4I2PA 4TSXA 4E89A 4DMNA 3K2PA 4K8XA 4CFCA 3NHGA 3OJSA 1QSYA 4HCBA 3SYZA 2B4JA 4N76A 1C0MA 4Z0UA 3RR7A 4B3OA 3DYAA 3CG7A 3L2UA 1XHXA 3TI0A 4F3OA 3D0PA 1NKBA 1NJZA 2HMIA 1A5XA 3T3FA 2KW4A 4CHZA 1CXQA 2Y1IA 1RTIA 1XC9A 2G8UA 3PX4A 2QKBA 4DU1A 4N56A 1RDDA 1NK0A 4CHNA 1IKYA 2Z1HA 3ASMA 1RBRA 2VWJA 3L2RA 3PO5A 1RT6A 3HYFA 2HHSA 4C8OA 5FROA 3PX0A 4XIUA 4KTZA 3KLHA 5SWMA 4J2AA 3AVJA 3HPGA 3P83D 2VG7A 4FW1A 1W9HA 1JL1A 3MEEA 3VQAA 3ZSXA 4E7HA 1RBSA 3IS9A 3TR8A 3ZSQA 3QEXA 3ZSYA 1UAXA 4M3XA 2ETJA 4CJRA 2KFNA 4B9TA 3DM2A 4FLYA 4RW6A 3O3FA 3P5JA 1JLBA 1I39A 3KKRA 3NGIA 2OPPA 3H08A 5CZ2A 1CLQA 1ZBIA 2IC3A 1BL3A 4OGEA 1RTDA 3SZ2A 2BDPA 4J2EA 3LP3A 4IFYA 2OPQA 3RRGA 4OGCA 2KZZA 3QEVA 3QEWA 4CK3A 3KD5E 1SKRA 2X78A 3NCIA 2JGUA 1FKPA 2RKIA 3JSMA 5J1EA 5DMRA 4CIEA 3SCXA 1KSPA 1NK9A 2YNFA 3HSTB 3HP9A 1TL3A 4IG0A 1LV5A 4F8RA 4C8LA 4DSFA 1HYSA 1NOZA 1LAWA 3QLHA 4AHRA 3V6DA 1WSEA 4M45A 1GOCA 3WNHA 3AO4A 3S9HA 4PWDA 1FKOA 1A5VA 2D0BA 3AVKA 3G10A 3O4QA 4BWMA 4W5QA 3OYBA 1TKZA 1WSIA 1VSDA 3V4IA 1TK5A 4QAGA 4F2RA 4DU3A 3L2VA 4M3UA 1LW2A 3NDKA 1U47A 1NJXA 4K8ZA 4LH5A 1T8EA 2DY4A 3SQ0A 2HNDA 3EZ5A 4F2SA 1NK5A 4LSLA 4B9VA 3K59A 2PYLA 2KTQA 3MXJA 2ZQBA 1ZBUA 3I0RA 4FM2A 4E7JA 2DFEA 4RW9A 1LWFA 1TKTA 1U4BA 3S3NA 4FLXA 2PYJA 4E7LA 2YNIA 1QQCA 1RILA 4DSKA 2XY8A 3ALYA 4KKOA 3QETA 1T05A 1HRHA 2IS3A 3DLRA 3ZT3A 1QTMA 2XHBA 1D8YA 4FJMA 2GV9A 4OKKA 4DLGA 4M3TA 4Z4GA 5HRSA 4CGDA 3M8PA 4BDYA 4JS5A 1RT5A 4AILC 3WNFA 1ASWA 4OKEA 4OPJA 4W5TA 4DFMA 5HBMA 3HXMA 2VG5A 2XY6A 4KPYA 1IO2A 5JS2A 3LZIA 4FM0A 1LAVA 4DTXA 1JXEA 2X6SA 4AHCA 3L3VA 1REVA 3V81A 4B9SA 2HHQA 4FJNA 1TGOA 3HVTA 3O3GA 4HTUA 3EY1A 2OPRA 3AVAA 3SNNA 4FZXC 3DOLA 5KI6A 3E01A 3HVRA 3K58A 1VK0A 4DQIA 2WONA 3I0SA 1UOCA 2YNHA 4ID5A 1SL0A 1F21A 3EYZA 1VSEA 3NF9A 4E3SA 1L3UA 4W5RA 3DLKA 3VQ7A 5HRPA 3IRXA 5EU7A 2XY7A 3BDPA 1YTUA 1SL2A 3VQQA 5KTQA 4FJ7A 3TAQA 5D3GA 4DTJA 4Q0BA 2HVIA 1B92A 2YHBA 4N5SA 1BCMA 3ZT0A 2Z1GA 4J2DA 3THVA 2IOCA 2RF2A 3QNOA 3TABA 2LSNA 2O4GA 4R5PA 4H4MA 4JLHA 4CE9A 4CHYA 4CCHA 3KTQA 4FCYA 1HNIA 3CYMA 1B9FA 3NBPA 4CIGA 4E1NA 3K57A 3SQ1A 3PY8A 4FK2A 2F8SA 1X9SA 2P5OA 1S6QA 2F8TA 4OPKA 3OYLA 4CJUA 1HJRA 4O4GA 4FJLA 3TARA 4CECA 4E19A 3L2WA 1TKXA 3TAGA 4PA1A 4I2QA 3VQPA 3QEIA 1X9MA 3NE6A 4FW2A 4ELVA 2IAJA 3C6UA 5CY4A 4B08A 4BE0A 3SI6A 1A5WA 3OYGA 3OS1A 3QINA 4ELUA 4DFJA 4KRFA 3PUFA 1J9AA 4Z4CA 1IH7A 3RMBA 3K5MA 4O5BA 5CYMA 3VQCA 2YHAA 3A2FA 4W5OA 3OY9A 2G8VA 4E0DA 1S9GA 4DTUA 4KI4A 3DRRA 4HUFA 3AO2A 1LWEA 4DG1A 1B9DA 4FZYA 4M42A 3VQ4A 1RT2A 3NF6A 1HYVA 4CF8A 3KLGA 1ASUA 1TKDA 2HB5A 4HVJA 3ULDA 4MQ3A 3AV9A 4CFBA 1Q9YA 4FJ5A
chains in the Genus database with same CATH superfamily
5AQKA 1YJNN 3QO9A 1Z05A 2E2NA 3H45C 4DV4K 2Q0UA 4LY7A 3SQ4A 4H0PA 2YV0X 5M1QA 4HHTA 3K9JA 3HK2A 4IFEA 1SKWA 1YAGA 1LCUA 3NMUA 3ZETA 3ZSRA 3JS6A 3LDOA 1R0AA 1HYZA 3WNEA 2FSKA 3LDQA 4AH9A 3BF3A 3MDQA 3O9UA 5BN9A 2B5JA 4CJVA 4H5NA 4IO8A 4DR6K 2PAVA 2HNZA 1N36K 5AQOA 1EETA 1VSIA 1SS6A 4CHPA 4A62A 2HBJA 1C1CA 3BZKA 1ZYQA 3LDLA 2VGNA 4PKHA 5HP1A 3CC2N 2NRZA 3AVLA 1LWCA 4DR5K 3F73A 1NKEA 4YOTA 3OYFA 2UXCK 3WXMB 4CVNE 3AA5X 3HTVA 3T7ZA 3VEXA 4MO5A 3MCAB 3FZMA 1N32K 4DTNA 5J2QA 5HLFA 5KGXA 3SUOA 3MCPA 3QEPA 2BTFA 1O1WA 5BRDA 3CI5A 4QOZB 3P1GA 1S1TA 1KLMA 3C6AA 4IDHA 4IDKA 1NG9A 4DR7K 2UU9K 3VGKA 4CJWA 3KJVA 2QM1A 4CEAA 1UWBA 5AQHA 4JYAK 2AJQA 3DXKB 3VA0A 3SQ2A 3NF8A 4R79A 3O9TA 3LP2A 2F4VK 3ZEUB 4DQRA 1RTJA 4CERA 4Z4EA 4BDZA 3CERA 3HP6A 5GADP 3D2FA 1VAZA 3TAEA 1WSGA 1XI1A 1G15A 3V1OA 3ZYYX 5AQVA 4CK2A 4BDPA 3CFRA 1ZC6A 4CEFA 5HROA 3T69A 3LP0A 4WF9L 2WTUA 3SPYA 2DPNA 1X9WA 3VOVA 4IBNA 4U7BA 3OYHA 3CD6N 3PIOL 4LSNA 2YHWA 2BUPA 4PY5A 3ZX3A 3P31A 4CEZA 3K5OA 1UA0A 3NH2A 1SKSA 1JLCA 4DB3A 3SUPA 1RDWX 4DTPA 3ZCMA 3V9SA 4ZTJA 5C42A 4GV9A 3QFUA 1FW6A 5LMUK 5GINA 3RWUA 4JKGB 5AQUA 4CJKA 2YI1A 2FLOA 1BIZA 1TYQB 1JCFA 3OYCA 2WC9A 3U3GA 3MAQA 3NGYA 2A6AA 5HRRA 3CCVN 2O8BB 5ADXH 3UKUA 4Y1CA 3VA3A 1DT9A 3EO3A 3QBXA 3LL3A 3CCQN 4FWNA 5AQXA 4G9ZA 4NXMK 1K8KB 1YXQA 1U2VA 3QIOA 4WFAL 3C7NB 2GWKA 3CFOA 3I55N 4K41A 3DLEA 3RTVA 3HOTA 3CJ7A 1EWQA 4NCAA 2VG6A 1VRTA 3HI0A 3AVFA 3D2EA 3BEXA 1RT4A 1H1VA 3M8QA 4FJ8A 3PX6A 2EX3A 4AF1A 2HBMA 3H3NO 1NJYA 1NK4A 3K5NA 1VSHA 3C94A 2QK9A 2I7PA 4O8UA 4CHQA 2X74A 3AA2A 2YHYA 3HL8A 2P9SB 4B9UA 5FRNA 4BC4A 4V19S 3SAHA 3NH0A 3FZKA 5AZIB 1XHZA 4I9QA 3VF4A 1BHLA 3H46O 4ISFA 3C7NA 4BWJA 3M3ZA 1BIUA 2YJFA 1JLFA 3GE1A 4H0YB 2OA8A 1L3SA 4Y1DA 4F3TA 3DOKA 2HF3A 4E7IA 2XY5A 2HHWA 3BF1A 4CZHA 1QVGM 2AP1A 4X64K 2FF3B 4IJNA 4DV3K 2GUPA 1OH5A 1W7AA 4O44A 5CHIA 5CYQA 5F1XA 3DMJA 4BE2A 1UA1A 4DFPA 5GAEP 1FJGK 4CJ4A 2RPIA 3KK1A 4WFNL 3P4IA 4DWIA 1FK9A 4I7FA 1KFDA 3O9QA 1DLOA 2KQ2A 3NF7A 4H5TA 5C2DA 1HKCA 4DHYA 1RBTA 2X6NA 1GLEG 5AQRA 5F2RA 5H1SQ 4KI6A 1QVFM 3KK2A 3VEYA 5LJVA 3TWHA 1YIJN 4OLBA 3QDKA 1EKEA 3G6EN 1JLQA 4BRDA 3THXA 2OCEA 1VQMN 5FPEA 3RMCA 3AVCA 4LC9B 3D7EO 3G4SN 3CCEN 3OVNA 1RDBA 5BN8A 5C25A 1NBWA 3CJAA 4JKCA 4DTMA 4QS7A 2FBTA 3SJJA 1JKHA 3LWMA 3AVMA 1IKWA 3SUNA 1D9FA 3WEEB 2A5XA 1HPMA 3L4QA 1QSYA 3O6WA 2Q31A 1KAXA 1C0MA 3VGMA 4B3OA 3TI0A 3VGLA 4F3OA 3P38A 2AA4A 1NJZA 2HMIA 5JVHL 1RTIA 2RHKA 3KWGA 2QKBA 4DU1A 4CHNA 1IKYA 3FGUA 1RBRA 3L2RA 4H5WA 1RT6A 3HYFA 4XIUA 4CJ7A 3KLHA 3P83D 4CD1A 1JL1A 3VQAA 3ZSXA 1SAZA 4E7HA 3IS9A 1J6ZA 3ZSYA 3CJ9A 3WUHA 3CXCM 3DM2A 5AFUA 3CHWA 1I39A 2OPPA 4ISGA 1ZBIA 4YHHK 4OGEA 4FWLA 3LP3A 4IFYA 4YOWA 4DV5K 3KD5E 1ATRA 2ZM6K 1SKRA 4BREA 5A2QO 3SCXA 1TL3A 1DKGD 4IG0A 2GTDA 4M45A 5CE3A 1D4XA 1V4SA 2D0BA 5M1FA 1LV5A 1WSIA 4F2RA 3GBTA 4DV7K 4DU3A 1LW2A 5C2FA 1NJXA 2DY4A 4LH5A 4BR2A 4O8KA 1K8KA 5LJWA 4F2SA 3VMFB 1HX1A 4XH4A 4E7JA 4EIAA 2DFEA 1LWFA 4HWIA 4DSKA 4IEIA 3QETA 2D4WA 1ZXOA 2F7TA 3O8MA 4Z4GA 5KPRA 4JKGA 4BDYA 4H0OA 1ASWA 3C65A 4B1WB 3HXMA 1LAVA 4DTXA 2X6SA 4AHCA 5E26A 2HHQA 1W2BM 1QQMA 3AVAA 3JAMO 4FZXC 4BR7A 1GLCG 3K58A 1VK0A 3CJCA 3I0SA 3KK7A 1UOCA 2QWMA 3ZETB 5HRPA 4W5RA 4JI2K 3VQQA 5KTQA 1K9MO 4FJ7A 3TU5A 2HVIA 1B92A 3ZT0A 2Z1GA 3THVA 3G71N 2E2OA 3TABA 3QNOA 4DR2K 1OH7A 2LSNA 3WXIA 4PKIA 3KHYA 1NGFA 4CCHA 2VCPA 4Y0WA 4JI1K 1N8RO 1X9SA 2F8TA 3OYLA 2O8EA 4A5AA 1Q81O 5AQMA 3NE6A 1T44A 4CZGA 3SI6A 3L0QA 4BRGA 1XUPO 1T6DA 2NNWA 4DTUA 3ULEA 4M42A 1KC8O 4WQ5C 4CF8A 4RTFD 3OHRA 4HVJA 3ULDA 4MQ3A 4FJ5A 1J53A 3D2EB 3UB5A 4CEQA 1WOQA 3VTHA 4CJPA 1VSJA 1JLEA 4M3ZA 3TPQA 3J8AA 2IDOA 5B8HA 2P9UA 5HL7L 1GLLO 1J5OA 3SAFA 2V7YA 2HHXA 2KZMA 4ID1A 4OKJA 3SMPA 3CPWM 4AHTA 2ZGYA 3ID8A 1XC3A 1NJWA 2D0CA 4BRCA 5FPDA 1U6ZA 3OYEA 3HRGA 2E2QA 3ZT1A 3QNNA 1C6VA 1KVBA 5FPNA 4M3RA 2NRWA 2YKNA 3AO5A 4IZ9A 4NCBA 1BOTO 2D1KA 3S41A 4FM1A 3SPZA 4PL8A 3BGRA 4DF8A 2FSNA 2ITMA 2ATQA 4DR3K 3K5LA 2IVNA 3VEZA 1L5UA 1BQMA 3CFPA 4RG8A 4I9LA 5ELZA 4BGBA 3OYJA 4N47A 3TTFA 1BI4A 4FLVA 4CEEA 2E1ZA 2O8BA 3UE5A 5I3UA 5I42A 1QE1A 1TUYA 4BRMA 2FBYA 4BR0A 4CFAA 2QWNA 2CGLA 4BR4A 5AQQA 3AVGA 3DRPA 4DTSA 3MWTA 3ZX2A 2P9KB 4ILJA 4AHVA 3THYB 5HRNA 3BZCA 4X65K 3WNGA 4JKEA 4B1UB 1RCHA 1XWLA 2P9LB 3AGRA 4OLAA 4LFBK 3DXKA 1GLJO 4FPAA 3B6PA 5C24A 4FZZA 3OS0A 3MEGA 4IXCA 1QHAA 2VYPA 3HOSA 1L3TA 4CF9A 4IWVA 4H4OA 5BPMA 3M8SA 4FSVA 4C8NA 4DFKA 5M1OA 1Z25A 1TVRA 1S1VA 3KWIA 1VHXA 3THWA 1Q9XA 4CZMA 1KRPA 4Q5VA 3MXIA 2QW9A 1WB9A 3JYTA 1RDAA 1SUQA 3MN5A 4FOEA 3SJHA 3I33A 3K9KA 1QSLA 1N6QA 4DV1K 3RR8A 3MEDA 4ZHRA 1KCFA 2D0PA 2QWLA 4LF6K 3QIPA 2Q1NA 4DCHA 1YVUA 1BDGA 1CXUA 2IVOA 1ASVA 1GOBA 1W0HA 5CZ1A 4YNQA 2DFFA 1WBBA 2E2PA 5T7BA 4HUGA 1RT3A 3LWLA 4KHUA 3OJUA 2BANA 2J4RA 3B6OA 4DTOA 1I94K 4PUOA 1KVAA 3TAMA 4AHUA 2GUIA 3V9ZA 5EOYA 4JKAA 2E1YA 1IG8A 1NGGA 3C6TA 3AY9A 1OVQA 5LL6Z 3MXMA 4CZIA 2HHTA 4K25A 3FFIA 1DTTA 4M41A 3WQTA 4WQ4A 1C0TA 4GVMA 3PO4A 4BRKA 4RW8A 2NRXA 3CM6A 4B1ZA 2QWRA 4ELTA 3LDSA 5AFUH 5BREA 4EHTA 4NLCA 2RE2A 1U04A 4E7KA 2A1RA 3LAKA 2YHXA 4KB0A 2P9NB 5MLCQ 1WAJA 4MFBA 3O3HA 2NRRA 1TL1A 4C1NI 1K8AO 4NB4A 4EFHA 4DSEA 1D9DA 3D2FB 3T1AA 4DUZK 5AQSA 1C1BA 3FLCO 3U9ZA 3VN5A 2ZE2A 4KV8A 3VF2A 1J5EK 1EX4A 3EKUA 1ILYA 1S9EA 4BRIA 2VGMA 4JK8A 4JHDB 1MA9B 3HPOA 4O0JA 3KK3A 2G8KA 2FBXA 1HQUA 3C0BA 1HNVA 1RDCA 1VQPN 3TAPA 5C15A 4BVPA 1TAUA 4WE1A 3OYNA 2P1JA 5I9EB 5J2PA 4CF0A 3CQ8A 3MN6A 5ADXA 5BR8K 1EP4A 3DJCA 4UQGA 4M3YA 4KAZA 4DS5A 5BR9A 3N4PA 3EN9A 3ZSVA 1RDUA 3ZT2A 5DM6L 4F4KA 4IOAL 4KHYA 1S3XA 1BCOA 4O5FA 3O5BA 1RT7A 3V9WA 4CIFA 1RT1A 4OPAA 3VQ6A 1EO1A 3MECA 1VQNN 3D45A 5JLHA 1C0FA 3U4LA 3NH1A 3NFAA 3GOIA 4KB1A 1C1AA 3HJFA 3B8AX 4YOVA 3U3YA 4CZKA 1YITN 3OYIA 4FLUA 4FJ9A 3CQXA 5IWAK 1WSHA 1CZBA 3CPEA 4ISEA 1J54A 3VQ5A 3N4QA 4Z4IA 1NU0A 1Y97A 3UKRA 1IBKK 3HT3A 3DI6A 1X3MA 4CFCA 3NHGA 3SYZA 3L2UA 1XHXA 3CQYA 2NRVA 3D6RA 3QICA 3T3FA 1CXQA 1XC9A 2YCHA 3PX4A 1KXPA 1RDDA 4KH5A 2O8EB 3PO5A 3FZHA 4C8OA 4GNIA 3PX0A 4KTZA 4CI6A 2VQEK 5EXWA 4KH4A 3TR8A 3IMXA 2KFNA 4FLYA 4RW6A 2KHOA 3O3FA 3P5JA 1JLBA 2P9NA 5CZ2A 3H08A 2Q97A 2P9IA 1RTDA 3HSCA 4BRLA 2KZZA 4CK3A 3GL1A 3O80A 4RWTA 1VQ7N 3M1FA 1YF5L 1FKPA 4CBWA 3JSMA 1HKGA 1KSPA 3TTCA 1NK9A 3WT0A 3HP9A 4M63C 3H1QA 5JVGL 4YORA 1LAWA 2OTLN 1WSEA 4BQZA 3AO4A 1Y64A 1E4FT 1A5VA 3A5LC 4LF4K 3V4IA 4WFBL 4MDBA 2NZTA 1XMQK 1TK5A 4QAGA 3NDKA 3PSFA 1U47A 4K8ZA 1T3VA 1LOTB 3SQ0A 3NVMA 1NK5A 4LSLA 2P9IB 3IKMA 2PYLA 2KTQA 2WUSA 1ZBUA 2ZQBA 5AQZA 4RW9A 1KQSM 1TKTA 1GLBG 1TUUA 1QQCA 1RILA 1Q86O 2XY8A 3ALYA 1T05A 3ZT3A 2XHBA 1D8YA 1EQYA 5HRSA 5DM7L 2GWJA 4JS5A 1P8ZA 4OKEA 4KPYA 5HBMA 2VG5A 3MX2A 4CBXA 3ENBA 3O4WA 4FM0A 4FWSA 5IT9O 1SQKA 1JXEA 3U8XA 3V81A 4B9SA 2OPRA 4DV0K 4LF7K 1QQNA 2KLAA 5KI6A 3HVRA 1F21A 1VSEA 3UKRB 4E3SA 3BDPA 3IRXA 1SL2A 5D3GA 4JV5K 3VEVA 3WXJA 4Q0BA 4N5SA 5AQWA 4J2DA 3GG4A 5AJ3K 2RF2A 3CJBA 2P9KA 4A5BA 4CE9A 4FWRA 3MWPA 2IIRA 4FCYA 1HNIA 2F8SA 4CIGA 4OPKA 1HJRA 4JI0K 3L4IA 4O4GA 4FJLA 4CECA 1TKXA 3VQPA 1X9MA 4B08A 4BE0A 4FWPA 2ZJRL 3OYGA 3OS1A 1HR0K 4FVUA 4ELUA 4KRFA 1HNWK 1VQ5N 4W5OA 3A2FA 1IV0A 4HUFA 3ENHA 1B9DA 5EX5A 4YOXA 1YJWN 1HYVA 3KLGA 3ID6A 4JI8K 5E41A 1SL1A 3EE8A 4QS9A 1U49A 2QEXN 4BRQA 4FJKA 3L6QA 4FO0A 3OS2A 1GLAG 4CJQA 1BG3A 2V51B 3AO3A 4KHSA 2KFZA 2O4IA 2HOEA 5TKWA 3AA3A 4QS8A 4PHTX 1YJ9N 4FJJA 3F5TA 3SV4A 3LPTA 1V4TA 2ZJQL 1S1UA 2P51A 4IKFA 4MDAA 4BRPA 3HM8A 1ATNA 4AM7A 3ATVA 3J7AP 4JRQA 5DK5A 2RN2A 2HSTA 3SV3A 2H3GX 4YDUA 1TAQA 4XH5A 2QXFA 4BRAA 4KHPK 2G8WA 4HUEA 4NXNK 5KRTA 2R7YA 1XNRK 3MN9A 1X1PA 2D0AA 3NGZA 1NLVA 4DTRA 4EP5A 4CEDA 3T1HK 1QHTA 3O08A 1KAYA 4DQSA 4B8AB 1KVCA 1RTHA 1EXQA 3J80O 2YNGA 4BACA 2GX9A 4FJHA 2O8DA 3O1BA 3OTOK 5AZJA 4W5NA 2Z1JA 3VENA 2Z1IA 1YVNA 1VQON 2W42A 1OVYA 4MLEA 3T1YK 4B3SK 3V9XA 2XRIA 1BU6O 4FOIA 4BC3A 1R59O 1BUPA 4NCGA 2NLXA 3SBTA 4BG9A 1VSLA 1YT3A 4BRHA 2HBKA 4H5VA 1WLJA 1VSMA 4DKWA 1TK8A 1Q8IA 4GKJK 1JL2A 4EHUA 1HMVA 4LF9K 1GLFO 5AQGA 3PLAA 1N5YA 5AQYA 2O8FA 4ILHA 4B1XB 4CEOA 4KREA 1JLAA 2IGIA 2Q3SA 1QZ6A 5AR0A 4C8KA 4OVLA 2FC0A 4DQPA 3LP1A 1WSJA 5KGWA 4CJLA 1JCGA 4CESA 3CMEN 2P5GA 4CF2A 1MU2A 5FDLA 1RBVA 4Z4HA 1U45A 5SZTA 2HW3A 3QESA 4KFBA 1RGIA 2P9PB 4JD2A 2CGKA 3FE1A 3E9LA 4KO0A 5AQLA 3JXUA 2CH5A 3LZJA 3AVHA 1S1WA 3R3LA 4CJ5A 3RMDA 4CJEA 4E1MA 3VQEA 1HNXK 4I6MB 4G1QA 4CGIA 3CC4N 1HKBA 1NMDA 2E6LA 1QS4A 4FWKA 3S3MA 1TV6A 4B9QA 1T7PA 5AQPA 2Q0RA 3G25A 2BGGA 2ITGA 3E9PA 3LPUA 1BGXT 5JS1A 3BUZB 1NGHA 1NK7A 4WYBA 4DSJA 5BRHA 3AVBA 5KRSA 3KD1E 4IG3A 2HMPA 4JI5K 3UIQA 4M3WA 3OYKA 2E6MA 4CEBA 3A0IX 1HJOA 3DLBA 4FLTA 2JLEA 3TSQA 3ENOA 4LH4A 4NO7A 1VSFA 4B9LA 1K6YA 1NGDA 2YX6A 4BRFA 3J7YP 1NMNA 4DSLA 4CGJA 2PZSA 1GOAA 3CCUN 3LALA 1YTAA 4DQ8A 2GBZA 3E66A 5FRMA 1MWMA 3ITHA 3R9PA 3MN7A 3I56N 4RW4A 1WSFA 3L2QA 2HVHA 4FYDA 3TSPA 3ZSOA 3PV8A 1KFSA 3VQDA 4B1VA 4GMJB 4FL9A 3TTDA 2EWSA 3MX5A 3KLFA 3M8RA 2OZSA 4FJXA 3T19A 5GIPA 3RMAA 5J2NA 4GVEA 3FR0A 4ZTFA 3DXMA 2DTUA 4KTQA 4KHWA 2XO7A 2OPSA 4IEEA 3J81O 1LW0A 1IKVA 4M7XA 2FBVA 4OPHA 3ZX0A 1ITGA 1RNHA 1C0GA 2OYQA 3VQ9A 2YJEA 4B9MA 2BE2A 4CGGA 1BA1A 2QI2A 3C95A 4B9NA 4NYFA 1L3VA 4LD0A 2VWBA 2UUBK 4H8KA 5M1NA 4BE1A 4JNEA 4CZLA 4CK1A 4I2PA 4TSXA 4E89A 4DMNA 3K2PA 3SK3A 4GY2B 4GKKK 3VESA 2B4JA 3RR7A 3CG7A 3O1WA 3WXLA 4B3TK 1NKBA 1VQ4N 3LM2A 5AQIA 1A5XA 4KH6A 4CHZA 5BPNA 2Y1IA 1EWRA 4N56A 1NK0A 3ASMA 2D0OA 2HHSA 5FROA 4BR9A 4J2AA 5SWMA 3HPGA 4FW1A 3MEEA 4OO1J 4B1YB 1UAXA 2ETJA 1MWKA 4B9TA 3IDHA 1IBLK 4J8FA 2IVPA 3NGIA 1QQOA 1BL3A 3CCMN 4J2EA 1VQ6N 3FFKB 4OGCA 3QEVA 4AM6A 2X78A 3NCIA 2JGUA 4DV6K 5FPMA 1KAZA 1Z6RA 5DMRA 1NGJA 3EKSA 3HSTB 4LFAK 5LMNK 3VPZA 1NOZA 4AHRA 3V6DA 2PFUA 3S9HA 1U2VB 4PWDA 3O4QA 1FKOA 4W5QA 2QKKA 1QSSA 1TKZA 1RFQA 2UUCK 3AARA 2WBNA 4M3UA 4BC5A 1HUXA 1O13A 4B9VA 3K59A 4B3MK 3MXJA 3F9MA 1NWKA 5EY4A 4FLXA 2PYJA 2YNIA 1TYQA 4C23A 3DXMB 1HRHA 2QWPA 3QFPA 1QTMA 3E1YA 4OKKA 4DLGA 4AILC 3UKUB 3U9DA 4OPJA 4DFMA 5JS2A 1NGAA 2BH1A 3VETA 3FZFA 4FJNA 1TGOA 4HTUA 1NGBA 3EY1A 1BA0A 1NNEA 4U67L 4MLHA 3E01A 2WONA 1BWFO 2UXBK 1CZAN 4ID5A 4JKBA 4X66K 1L3UA 1YTUA 3WEEA 2XY7A 2P9SA 3TAQA 2QWOA 4DTJA 2NRTA 2YHBA 2A41A 5JLFA 4JK7A 4M7YA 2O4GA 4R5PA 4H4MA 5TKYA 2P9UB 3KTQA 4EAHD 4MO4A 3CYMA 3PY8A 1JJ2M 1IJJA 4XEIA 4BRNA 1VQLN 3IFRA 3ZLJA 3TARA 4H5RA 1Q18A 3L2WA 4I2QA 2QWQA 3QEIA 3EZWA 5JICA 4FW2A 2QA4N 2IAJA 3C6UA 3R1XA 5CY4A 1E4GT 3M6GA 1XQSC 2W40A 3PUFA 3H3OB 1IBMK 1XMOK 4CBUA 4Z4CA 3RMBA 5AZIA 3DAWA 3K5MA 3VQCA 3OY9A 2YHAA 2G8VA 2OANA 3DRRA 5HOOA 3VQ4A 3KZBA 3NF6A 3SMSA 1TKDA 1ASUA 2HB5A 1ZBHA 4DQQA 3AVNA 1DGKN 2ZGZA 4K43A 4LFCK 2UYTA 2WOMA 3OBYA 4YOYA 1P90A 4QCLA 3U6FA 1S6PA 3CCLN 1YHQN 1NKCA 2I7NA 4JRPA 3BY5A 4FJIA 2G8IA 2A42A 4BY9C 3VF6A 4IFVA 4YY3K 2PBDA 4PL7A 3VQBA 1TK0A 4JS4A 3G0ZA 4GV3A 4BQLA 4YFUA 4NYNA 4CJSA 2FF6A 4FJGA 4FXDA 4JKHA 4KHNA 2E20A 4DSIA 4JKFA 3OA9A 4A57A 3QB0A 1SZ2A 1U48A 1HPZA 2YKMA 3VQ8A 1MDUB 4BC2A 3CMAN 3ISNC 3TSUA 1WAFA 1FXXA 4H0XB 1SV5A 3S3OA 3RSEB 3IG1A 3M5RA 3SBGA 3QERA 3RSEA 4WQ4C 3K0SA 3CIPA 2F9TA 5JMVA 4IOXA 3OW2M 2G8FA 4JI4K 5M1PA 4JI6K 3AO1A 4A2AA 5CR4A 3HO1A 1E3MA 4DF4A 4RW7A 3NVKA 2O8FB 2Y1JA 2NUBA 1BO5O 4JAXA 3R6MA 3R8EA 3W3DA 1Q82O 1IKXA 2V7ZA 2E4LA 2PY5A 3DLHA 1OH6A 2ZD1A 3WXKA 2Q36A 4Z4FA 5M1KA 3O4NA 5AQTA 4F9OA 3AAPA 3DRSA 4N41A 3TANA 1NK6A 1VSKA 2OZMA 4IO9L 3OYDA 4HCCA 3ULEB 1HQEA 3LAMA 3OYAA 4LF8K 3RRHA 1YI2N 2A3ZA 2HHUA 4PQUA 4CGFA 3IAYA 5KQ8A 1XNQK 4O0IA 2EHGA 1NK8A 4GW6A 4H0TB 2A40A 5K14A 4CHOA 4AQYK 3V1RA 3EEQA 3VEWA 3CCJN 3I8BA 2QXLA 2ASPA 4BGAA 4OJRA 2A1SA 1Z26A 4FLWA 4DR4K 3EE9A 2ZWHA 2CGJA 2GEMA 4JHDA 2P9LA 3H6EA 1DTQA 3CC7N 4FK0A 4CZEA 1CZ9A 1N34K 3KIOA 3HM9A 4KBOA 2F96A 3KLIA 3ZEUA 4FK4A 3HPHA 4BG8A 5C0YA 5BPLA 3V9UA 1BISA 4KTWA 3OYMA 3A5OC 1X3NA 3P39A 4CW7B 5AQNA 4ICLA 2F9WA 4B8CA 4CF1A 4CZFA 2KKZA 4C1NK 1ZBSA 1JLGA 1KTQA 3MMVA 3V1QA 3DLGA 3F9KA 1KD1O 5E84A 3AVIA 5J2MA 4JN4A 1RBUA 4CFDA 5LY3A 4AHSA 5GAHP 3A5NC 3QMLA 1HLUA 2FSJA 4CZJA 1WN7A 1VRUA 2ASOA 4YOUA 4FLZA 4DS4A 4DLEA 1WNSA 5AZJB 2UUAK 4UY8O 2UXDK 1NM1A 3KLEA 1C0UA 2HF4A 3DWLA 3ZSZA 1Q7YO 1D5AA 2P9PA 2B6AA 3SLCA 4O55A 2ZJPL 1JCEA 1OKJA 2JWKA 1KLNA 2OTJN 3LANA 3F2KA 5EVZA 4WCEL 3KVGA 1S5JA 3W0LA 3PSIA 1T03A 3J7ZO 3I8DA 1ZBFA 2ASMA 4CJTA 1I3AA 4XH1A 3AA4A 1IG9A 1NOYA 3L3UA 3NAEA 4DR1K 3O9RA 3PIPL 4JI3K 3ZSWA 1VQ8N 2W6KA 4FWOA 4IJAA 4EZ9A 1S72N 3EL2A 4DU4A 5BRFA 4C8MA 4WQ5A 3DLLL 1NJIO 4ILGB 1BQNA 2O8CB 1VQ9N 2I5JA 2CH6A 4A2BA 3KKSA 3TAFA 3SUQA 5GAGP 4FVMA 1S1XA 4KHQA 1BI4B 3HZ6A 1G99A 4H03B 1ESVA 4CJFA 2HHVA 4YDUC 4FWQA 4EZ6A 2E88A 1N33K 2ZF5O 2DFHA 4EP4A 1JXBA 4J2BA 2D5RA 4L8RB 3L8BA 4CGHA 3CM5A 3BP8A 1ZBLA 1K73O 3CCRN 3ZT4A 2G8HA 5C10A 2VWKA 3CETA 2HNYA 3VERA 4CJ3A 1YUWA 4K8XA 3OJSA 4HCBA 4N76A 4Z0UA 3DYAA 3VTIA 1X9JA 2W6LA 1ATSA 4I6MA 2Q2RA 3D0PA 4GV6A 4A59A 2KW4A 3FZLA 3Q7CA 4BR5A 2G8UA 2Z1HA 2VWJA 2W41A 4JD2B 3GDQA 2E8AA 3CF5L 3AVJA 3IUCA 2VG7A 1W9HA 1RBSA 4JK9A 3ZSQA 3LM9A 3QEXA 4M3XA 4IOCL 4CJRA 3OBWA 4E1JA 5GIOA 2VQFK 3MK6A 3KKRA 1CLQA 3CJ1A 2IC3A 4NLBA 2BDPA 3SZ2A 3THYA 4RCHA 2OPQA 3RRGA 3QEWA 5C12A 1WBDA 3THWB 2RKIA 3A5MC 4K42A 1W97L 5J1EA 4L3QA 2WFBA 2HBLA 4CIEA 1M90O 2E5LK 2YNFA 4F8RA 4CD3A 4C8LA 4DSFA 1HYSA 3QLHA 4X62K 4JEPA 1GOCA 3WNHA 1DEJA 4OX9K 4BWMA 3AVKA 3G10A 2QTDA 3OYBA 1VSDA 3L2VA 1GLDG 3RVCA 3A8YA 3Q7BA 3WQUA 1T8EA 2HHHK 4K0KK 2HNDA 3EZ5A 1S22A 4A61A 3I0RA 4FM2A 1M1KO 1HNZK 4DUYK 3CCSN 3E9OA 1U4BA 3S3NA 4E7LA 4FPBA 1NGIA 1NGEA 1WUAA 5KPTA 5F0XA 4KKOA 3H1VX 1NGCA 2IS3A 3DLRA 4BVOA 4FJMA 2GV9A 4M3TA 4CGDA 3M8PA 5AQFA 1RT5A 3WNFA 2NRHA 4W5TA 2XY6A 2O8DB 1IO2A 3LZIA 3THXB 3QBWA 2O8CA 5AQJA 3L3VA 1REVA 5FLXO 3AAQA 5KQDA 4HTLA 3HVTA 3O3GA 3AGKA 3SNNA 5KPZA 3DOLA 2V52B 4DQIA 3SAGA 1SL0A 2YNHA 4JI7K 3EYZA 3NF9A 3DLKA 3VQ7A 5EU7A 3LDPA 1VQKN 3LDNA 3HBTA 1BCMA 2IOCA 4FWMA 2GELA 4H0VB 1OH8A 4JLHA 3O9SA 4CHYA 2JWLA 3NBPA 1B9FA 3SQ1A 3K57A 4E1NA 4FK2A 2P5OA 1S6QA 4B3RK 3ATUA 1QZ5A 4CJUA 4E19A 3VEOA 3TAGA 4PA1A 2FXUA 4ELVA 1A5WA 3QINA 4Z94A 4DFJA 1J9AA 1IH7A 4O5BA 5CYMA 4BROA 4E0DA 1S9GA 4KI4A 4FZYA 3AO2A 1LWEA 4DG1A 1T6CA 4LF5K 1RT2A 4JKDA 4PKGA 4DV2K 3C6HA 3AV9A 4CFBA 1Q9YA
chains in the Genus database with same CATH topology
3AVNA 1J53A 5E41A 3QO9A 1SL1A 1U49A 4LY7A 3SQ4A 4CEQA 4FJKA 2WOMA 2YV0X 4HHTA 3HK2A 4CJPA 1SKWA 1VSJA 3OS2A 4QCLA 3U6FA 1JLEA 1S6PA 4M3ZA 2IDOA 1NKCA 1J5OA 3ZSRA 4JRPA 4CJQA 4FJIA 2G8IA 1R0AA 1HYZA 3WNEA 2HHXA 2KZMA 4IFVA 4ID1A 4OKJA 3VQBA 1TK0A 3AO3A 4AHTA 4JS4A 4KHSA 4AH9A 3G0ZA 2KFZA 2O4IA 2B5JA 3AA3A 4CJVA 4YFUA 4NYNA 1NJWA 4CJSA 4FJGA 4FXDA 2HNZA 4FJJA 2D0CA 4KHNA 1EETA 1QSSA 1VSIA 4DSIA 3OYEA 3SV4A 4CHPA 3LPTA 3ZT1A 1C1CA 3QNNA 1C6VA 2YKMA 1HPZA 1S1UA 1ZYQA 3VQ8A 1U48A 1KVBA 2P51A 4M3RA 5HP1A 4IKFA 2YKNA 3AO5A 1LWCA 3AVLA 3F73A 1NKEA 4NCBA 3ISNC 1WAFA 3OYFA 5DK5A 4JRQA 2RN2A 3AA5X 1FXXA 1SV5A 4FM1A 3S3OA 3SV3A 4DTNA 5J2QA 3SPZA 5HLFA 5KGXA 3IG1A 1TAQA 3BGRA 2QXFA 3QERA 3SUOA 4DF8A 3QEPA 1O1WA 2G8WA 4HUEA 5KRTA 2R7YA 2ATQA 4QOZB 3P1GA 3K5LA 1S1TA 1X1PA 2D0AA 3NGZA 1KLMA 4DTRA 1L5UA 4EP5A 4IDKA 1BQMA 4CEDA 1QHTA 3CFPA 2G8FA 4RG8A 4I9LA 3OYJA 4N47A 4CJWA 3AO1A 3KJVA 4CEAA 1BI4A 4FLVA 1UWBA 4DQSA 4B8AB 4CEEA 1KVCA 5I3UA 5I42A 2AJQA 3VA0A 1RTHA 1QE1A 1EXQA 3HO1A 3SQ2A 3NF8A 2FBYA 2YNGA 4BACA 4CFAA 4DF4A 4RW7A 3LP2A 4FJHA 3AVGA 3DRPA 4DQRA 4DTSA 2Y1JA 2NUBA 1RTJA 4CERA 4Z4EA 4BDZA 1IKXA 3HP6A 2Z1JA 4W5NA 2E4LA 2PY5A 3DLHA 3TAEA 1WSGA 4AHVA 2ZD1A 2Z1IA 5HRNA 1XI1A 4Z4FA 1G15A 3V1OA 3WNGA 3O4NA 4CK2A 4BDPA 4DQQA 1RCHA 3CFRA 1XWLA 3DRSA 4N41A 4CEFA 5HROA 3TANA 3LP0A 3SPYA 1X9WA 1NK6A 4IBNA 2W42A 3OYHA 4OLAA 1VSKA 2OZMA 4LSNA 3V9XA 3OYDA 4HCCA 4PY5A 3B6PA 5C24A 4FZZA 3OS0A 2XRIA 4CEZA 3K5OA 1UA0A 3NH2A 1SKSA 1HQEA 3MEGA 3LAMA 4NCGA 3OYAA 1JLCA 3SUPA 3RRHA 1L3TA 4DTPA 1VSLA 1YT3A 3ZCMA 4CF9A 3V9SA 1WLJA 1VSMA 4H4OA 3M8SA 4ZTJA 4C8NA 4DFKA 5C42A 1TK8A 1Q8IA 1TVRA 1Z25A 1JL2A 4PQUA 4CGFA 2HHUA 1HMVA 1S1VA 3RWUA 3IAYA 4O0IA 1Q9XA 4CJKA 4Q5VA 2EHGA 3MXIA 1NK8A 1KRPA 1N5YA 4GW6A 4CHOA 5K14A 3JYTA 1BIZA 3V1RA 4CEOA 3OYCA 3U3GA 3MAQA 1RDAA 4KREA 1SUQA 3NGYA 1JLAA 2IGIA 2Q3SA 4C8KA 5HRRA 4OVLA 1QSLA 2FC0A 4DQPA 1N6QA 4OJRA 3LP1A 2A1SA 4Y1CA 1Z26A 3VA3A 3MEDA 4ZHRA 4FLWA 3RR8A 1WSJA 5KGWA 4CJLA 4CESA 1KCFA 2P5GA 4CF2A 1MU2A 5FDLA 1RBVA 3QIPA 4Z4HA 1U45A 1YVUA 1DTQA 4FK0A 1CXUA 1CZ9A 5SZTA 2HW3A 3KIOA 3QESA 1ASVA 1GOBA 3HM9A 1W0HA 4KFBA 5CZ1A 2F96A 3QIOA 4YNQA 2DFFA 3KLIA 3CFOA 5T7BA 3DLEA 4FK4A 3HPHA 4HUGA 4KO0A 1RT3A 3LWLA 4KHUA 3V9UA 3RTVA 1BISA 4KTWA 3OJUA 3OYMA 2BANA 3LZJA 3RMDA 3AVHA 1S1WA 4CJ5A 4NCAA 2VG6A 4CJEA 3B6OA 4E1MA 4DTOA 1VRTA 3VQEA 4G1QA 4PUOA 4CGIA 1KVAA 3TAMA 3AVFA 4AHUA 2E6LA 2GUIA 3S3MA 1QS4A 1TV6A 1T7PA 4ICLA 3V9ZA 3C6TA 4B8CA 1RT4A 4CF1A 2BGGA 3M8QA 3MXMA 4FJ8A 2HHTA 2ITGA 3FFIA 1DTTA 4M41A 3PX6A 2EX3A 1JLGA 3LPUA 1C0TA 1BGXT 1KTQA 1NJYA 1NK4A 5JS1A 1NK7A 3K5NA 1VSHA 3C94A 3V1QA 4GVMA 4DSJA 3PO4A 2QK9A 4RW8A 3AVBA 3CM6A 3DLGA 4CHQA 3F9KA 5KRSA 3KD1E 4ELTA 3LDSA 2X74A 3AA2A 3HL8A 4IG3A 3UIQA 4B9UA 3OYKA 2E6MA 4CEBA 3AVIA 4M3WA 5J2MA 1U04A 4E7KA 1RBUA 3LAKA 4CFDA 2A1RA 4KB0A 5FRNA 4AHSA 3DLBA 3NH0A 4FLTA 2JLEA 1WAJA 4MFBA 3O3HA 4LH4A 2QKKA 1TL1A 4I9QA 1XHZA 1BHLA 1WN7A 1VSFA 4B9LA 1K6YA 4DSEA 1VRUA 1D9DA 4BWJA 3T1AA 4FLZA 4DS4A 1C1BA 3VN5A 2ZE2A 4KV8A 4DLEA 1BIUA 1EX4A 1WNSA 1JLFA 4DSLA 4CGJA 1S9EA 2PZSA 1GOAA 3HPOA 3LALA 3KLEA 2OA8A 4O0JA 1YTAA 3KK3A 4Y1DA 1L3SA 2FBXA 2G8KA 4F3TA 3DOKA 1C0UA 1HQUA 2GBZA 1HNVA 1RDCA 5FRMA 4E7IA 2XY5A 3TAPA 3ZSZA 2HHWA 1D5AA 2B6AA 1TAUA 4O55A 4WE1A 3ITHA 3OYNA 2P1JA 1KLNA 5J2PA 4CF0A 3LANA 4RW4A 1WSFA 3CQ8A 3L2QA 4O44A 2HVHA 4FYDA 5CYQA 1S5JA 3ZSOA 3DMJA 4BE2A 1EP4A 3PV8A 3VQDA 1UA1A 1KFSA 4GMJB 1T03A 3I8DA 4DFPA 1ZBFA 4UQGA 4M3YA 4CJTA 1I3AA 3KLFA 3AA4A 3M8RA 1IG9A 4CJ4A 2OZSA 1NOYA 4FJXA 2RPIA 3L3UA 3KK1A 3NAEA 4DS5A 4KAZA 3T19A 3ZSWA 4DWIA 1FK9A 4I7FA 3RMAA 1KFDA 1DLOA 2KQ2A 3ZSVA 5J2NA 3NF7A 3ZT2A 4F4KA 4KHYA 1RBTA 2X6NA 1BCOA 4EZ9A 4ZTFA 4KI6A 3KK2A 4DU4A 1RT7A 2DTUA 3TWHA 4OLBA 4KTQA 4C8MA 3V9WA 4KHWA 1EKEA 2OPSA 4CIFA 1RT1A 2XO7A 1JLQA 1BQNA 1IKVA 1LW0A 3VQ6A 2FBVA 3MECA 1ITGA 1ZBHA 2I5JA 3SUQA 3AVCA 3D45A 1RNHA 3KKSA 3TAFA 3RMCA 2OYQA 3VQ9A 4FVMA 1S1XA 3NH1A 4KHQA 3NFAA 1BI4B 4CJFA 2HHVA 4B9MA 2BE2A 1C1AA 4CGGA 4KB1A 3HJFA 3OVNA 3U3YA 1RDBA 4EZ6A 3C95A 3OYIA 4FLUA 4FJ9A 4J2BA 2DFHA 4EP4A 1JXBA 5C25A 2D5RA 4B9NA 1WSHA 1CZBA 4NYFA 3L8BA 4L8RB 4CGHA 3CM5A 1L3VA 4DTMA 1ZBLA 4LD0A 1J54A 2FBTA 3ZT4A 4H8KA 3SJJA 3VQ5A 1JKHA 2G8HA 4BE1A 4Z4IA 3LWMA 3AVMA 1IKWA 1Y97A 2VWKA 3SUNA 2HNYA 3HT3A 4CK1A 1D9FA 3DI6A 4CJ3A 4I2PA 4TSXA 4E89A 4DMNA 3K2PA 4K8XA 4CFCA 3NHGA 3OJSA 1QSYA 4HCBA 3SYZA 2B4JA 4N76A 1C0MA 4Z0UA 3RR7A 4B3OA 3DYAA 3CG7A 3L2UA 1XHXA 3TI0A 4F3OA 3D0PA 1NKBA 1NJZA 2HMIA 1A5XA 3T3FA 2KW4A 4CHZA 1CXQA 2Y1IA 1RTIA 1XC9A 2G8UA 3PX4A 2QKBA 4DU1A 4N56A 1RDDA 1NK0A 4CHNA 1IKYA 2Z1HA 3ASMA 1RBRA 2VWJA 3L2RA 3PO5A 1RT6A 3HYFA 2HHSA 4C8OA 5FROA 3PX0A 4XIUA 4KTZA 3KLHA 5SWMA 4J2AA 3AVJA 3HPGA 3P83D 2VG7A 4FW1A 1W9HA 1JL1A 3MEEA 3VQAA 3ZSXA 4E7HA 1RBSA 3IS9A 3TR8A 3ZSQA 3QEXA 3ZSYA 1UAXA 4M3XA 2ETJA 4CJRA 2KFNA 4B9TA 3DM2A 4FLYA 4RW6A 3O3FA 3P5JA 1JLBA 1I39A 3KKRA 3NGIA 2OPPA 3H08A 5CZ2A 1CLQA 1ZBIA 2IC3A 1BL3A 4OGEA 1RTDA 3SZ2A 2BDPA 4J2EA 3LP3A 4IFYA 2OPQA 3RRGA 4OGCA 2KZZA 3QEVA 3QEWA 4CK3A 3KD5E 1SKRA 2X78A 3NCIA 2JGUA 1FKPA 2RKIA 3JSMA 5J1EA 5DMRA 4CIEA 3SCXA 1KSPA 1NK9A 2YNFA 3HSTB 3HP9A 1TL3A 4IG0A 1LV5A 4F8RA 4C8LA 4DSFA 1HYSA 1NOZA 1LAWA 3QLHA 4AHRA 3V6DA 1WSEA 4M45A 1GOCA 3WNHA 3AO4A 3S9HA 4PWDA 1FKOA 1A5VA 2D0BA 3AVKA 3G10A 3O4QA 4BWMA 4W5QA 3OYBA 1TKZA 1WSIA 1VSDA 3V4IA 1TK5A 4QAGA 4F2RA 4DU3A 3L2VA 4M3UA 1LW2A 3NDKA 1U47A 1NJXA 4K8ZA 4LH5A 1T8EA 2DY4A 3SQ0A 2HNDA 3EZ5A 4F2SA 1NK5A 4LSLA 4B9VA 3K59A 2PYLA 2KTQA 3MXJA 2ZQBA 1ZBUA 3I0RA 4FM2A 4E7JA 2DFEA 4RW9A 1LWFA 1TKTA 1U4BA 3S3NA 4FLXA 2PYJA 4E7LA 2YNIA 1QQCA 1RILA 4DSKA 2XY8A 3ALYA 4KKOA 3QETA 1T05A 1HRHA 2IS3A 3DLRA 3ZT3A 1QTMA 2XHBA 1D8YA 4FJMA 2GV9A 4OKKA 4DLGA 4M3TA 4Z4GA 5HRSA 4CGDA 3M8PA 4BDYA 4JS5A 1RT5A 4AILC 3WNFA 1ASWA 4OKEA 4OPJA 4W5TA 4DFMA 5HBMA 3HXMA 2VG5A 2XY6A 4KPYA 1IO2A 5JS2A 3LZIA 4FM0A 1LAVA 4DTXA 1JXEA 2X6SA 4AHCA 3L3VA 1REVA 3V81A 4B9SA 2HHQA 4FJNA 1TGOA 3HVTA 3O3GA 4HTUA 3EY1A 2OPRA 3AVAA 3SNNA 4FZXC 3DOLA 5KI6A 3E01A 3HVRA 3K58A 1VK0A 4DQIA 2WONA 3I0SA 1UOCA 2YNHA 4ID5A 1SL0A 1F21A 3EYZA 1VSEA 3NF9A 4E3SA 1L3UA 4W5RA 3DLKA 3VQ7A 5HRPA 3IRXA 5EU7A 2XY7A 3BDPA 1YTUA 1SL2A 3VQQA 5KTQA 4FJ7A 3TAQA 5D3GA 4DTJA 4Q0BA 2HVIA 1B92A 2YHBA 4N5SA 1BCMA 3ZT0A 2Z1GA 4J2DA 3THVA 2IOCA 2RF2A 3QNOA 3TABA 2LSNA 2O4GA 4R5PA 4H4MA 4JLHA 4CE9A 4CHYA 4CCHA 3KTQA 4FCYA 1HNIA 3CYMA 1B9FA 3NBPA 4CIGA 4E1NA 3K57A 3SQ1A 3PY8A 4FK2A 2F8SA 1X9SA 2P5OA 1S6QA 2F8TA 4OPKA 3OYLA 4CJUA 1HJRA 4O4GA 4FJLA 3TARA 4CECA 4E19A 3L2WA 1TKXA 3TAGA 4PA1A 4I2QA 3VQPA 3QEIA 1X9MA 3NE6A 4FW2A 4ELVA 2IAJA 3C6UA 5CY4A 4B08A 4BE0A 3SI6A 1A5WA 3OYGA 3OS1A 3QINA 4ELUA 4DFJA 4KRFA 3PUFA 1J9AA 4Z4CA 1IH7A 3RMBA 3K5MA 4O5BA 5CYMA 3VQCA 2YHAA 3A2FA 4W5OA 3OY9A 2G8VA 4E0DA 1S9GA 4DTUA 4KI4A 3DRRA 4HUFA 3AO2A 1LWEA 4DG1A 1B9DA 4FZYA 4M42A 3VQ4A 1RT2A 3NF6A 1HYVA 4CF8A 3KLGA 1ASUA 1TKDA 2HB5A 4HVJA 3ULDA 4MQ3A 3AV9A 4CFBA 1Q9YA 4FJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AVN A;  1J53 A;  5E41 A;  3QO9 A;  1SL1 A;  1U49 A;  4LY7 A;  3SQ4 A;  4CEQ A;  4FJK A;  2WOM A;  2YV0 X;  4HHT A;  3HK2 A;  4CJP A;  1SKW A;  1VSJ A;  3OS2 A;  4QCL A;  3U6F A;  1JLE A;  1S6P A;  4M3Z A;  2IDO A;  1NKC A;  1J5O A;  3ZSR A;  4JRP A;  4CJQ A;  4FJI A;  2G8I A;  1R0A A;  1HYZ A;  3WNE A;  2HHX A;  2KZM A;  4IFV A;  4ID1 A;  4OKJ A;  3VQB A;  1TK0 A;  3AO3 A;  4AHT A;  4JS4 A;  4KHS A;  4AH9 A;  3G0Z A;  2KFZ A;  2O4I A;  2B5J A;  3AA3 A;  4CJV A;  4YFU A;  4NYN A;  1NJW A;  4CJS A;  4FJG A;  4FXD A;  2HNZ A;  4FJJ A;  2D0C A;  4KHN A;  1EET A;  1QSS A;  1VSI A;  4DSI A;  3OYE A;  3SV4 A;  4CHP A;  3LPT A;  3ZT1 A;  1C1C A;  3QNN A;  1C6V A;  2YKM A;  1HPZ A;  1S1U A;  1ZYQ A;  3VQ8 A;  1U48 A;  1KVB A;  2P51 A;  4M3R A;  5HP1 A;  4IKF A;  2YKN A;  3AO5 A;  1LWC A;  3AVL A;  3F73 A;  1NKE A;  4NCB A;  3ISN C;  1WAF A;  3OYF A;  5DK5 A;  4JRQ A;  2RN2 A;  3AA5 X;  1FXX A;  1SV5 A;  4FM1 A;  3S3O A;  3SV3 A;  4DTN A;  5J2Q A;  3SPZ A;  5HLF A;  5KGX A;  3IG1 A;  1TAQ A;  3BGR A;  2QXF A;  3QER A;  3SUO A;  4DF8 A;  3QEP A;  1O1W A;  2G8W A;  4HUE A;  5KRT A;  2R7Y A;  2ATQ A;  4QOZ B;  3P1G A;  3K5L A;  1S1T A;  1X1P A;  2D0A A;  3NGZ A;  1KLM A;  4DTR A;  1L5U A;  4EP5 A;  4IDK A;  1BQM A;  4CED A;  1QHT A;  3CFP A;  2G8F A;  4RG8 A;  4I9L A;  3OYJ A;  4N47 A;  4CJW A;  3AO1 A;  3KJV A;  4CEA A;  1BI4 A;  4FLV A;  1UWB A;  4DQS A;  4B8A B;  4CEE A;  1KVC A;  5I3U A;  5I42 A;  2AJQ A;  3VA0 A;  1RTH A;  1QE1 A;  1EXQ A;  3HO1 A;  3SQ2 A;  3NF8 A;  2FBY A;  2YNG A;  4BAC A;  4CFA A;  4DF4 A;  4RW7 A;  3LP2 A;  4FJH A;  3AVG A;  3DRP A;  4DQR A;  4DTS A;  2Y1J A;  2NUB A;  1RTJ A;  4CER A;  4Z4E A;  4BDZ A;  1IKX A;  3HP6 A;  2Z1J A;  4W5N A;  2E4L A;  2PY5 A;  3DLH A;  3TAE A;  1WSG A;  4AHV A;  2ZD1 A;  2Z1I A;  5HRN A;  1XI1 A;  4Z4F A;  1G15 A;  3V1O A;  3WNG A;  3O4N A;  4CK2 A;  4BDP A;  4DQQ A;  1RCH A;  3CFR A;  1XWL A;  3DRS A;  4N41 A;  4CEF A;  5HRO A;  3TAN A;  3LP0 A;  3SPY A;  1X9W A;  1NK6 A;  4IBN A;  2W42 A;  3OYH A;  4OLA A;  1VSK A;  2OZM A;  4LSN A;  3V9X A;  3OYD A;  4HCC A;  4PY5 A;  3B6P A;  5C24 A;  4FZZ A;  3OS0 A;  2XRI A;  4CEZ A;  3K5O A;  1UA0 A;  3NH2 A;  1SKS A;  1HQE A;  3MEG A;  3LAM A;  4NCG A;  3OYA A;  1JLC A;  3SUP A;  3RRH A;  1L3T A;  4DTP A;  1VSL A;  1YT3 A;  3ZCM A;  4CF9 A;  3V9S A;  1WLJ A;  1VSM A;  4H4O A;  3M8S A;  4ZTJ A;  4C8N A;  4DFK A;  5C42 A;  1TK8 A;  1Q8I A;  1TVR A;  1Z25 A;  1JL2 A;  4PQU A;  4CGF A;  2HHU A;  1HMV A;  1S1V A;  3RWU A;  3IAY A;  4O0I A;  1Q9X A;  4CJK A;  4Q5V A;  2EHG A;  3MXI A;  1NK8 A;  1KRP A;  1N5Y A;  4GW6 A;  4CHO A;  5K14 A;  3JYT A;  1BIZ A;  3V1R A;  4CEO A;  3OYC A;  3U3G A;  3MAQ A;  1RDA A;  4KRE A;  1SUQ A;  3NGY A;  1JLA A;  2IGI A;  2Q3S A;  4C8K A;  5HRR A;  4OVL A;  1QSL A;  2FC0 A;  4DQP A;  1N6Q A;  4OJR A;  3LP1 A;  2A1S A;  4Y1C A;  1Z26 A;  3VA3 A;  3MED A;  4ZHR A;  4FLW A;  3RR8 A;  1WSJ A;  5KGW A;  4CJL A;  4CES A;  1KCF A;  2P5G A;  4CF2 A;  1MU2 A;  5FDL A;  1RBV A;  3QIP A;  4Z4H A;  1U45 A;  1YVU A;  1DTQ A;  4FK0 A;  1CXU A;  1CZ9 A;  5SZT A;  2HW3 A;  3KIO A;  3QES A;  1ASV A;  1GOB A;  3HM9 A;  1W0H A;  4KFB A;  5CZ1 A;  2F96 A;  3QIO A;  4YNQ A;  2DFF A;  3KLI A;  3CFO A;  5T7B A;  3DLE A;  4FK4 A;  3HPH A;  4HUG A;  4KO0 A;  1RT3 A;  3LWL A;  4KHU A;  3V9U A;  3RTV A;  1BIS A;  4KTW A;  3OJU A;  3OYM A;  2BAN A;  3LZJ A;  3RMD A;  3AVH A;  1S1W A;  4CJ5 A;  4NCA A;  2VG6 A;  4CJE A;  3B6O A;  4E1M A;  4DTO A;  1VRT A;  3VQE A;  4G1Q A;  4PUO A;  4CGI A;  1KVA A;  3TAM A;  3AVF A;  4AHU A;  2E6L A;  2GUI A;  3S3M A;  1QS4 A;  1TV6 A;  1T7P A;  4ICL A;  3V9Z A;  3C6T A;  4B8C A;  1RT4 A;  4CF1 A;  2BGG A;  3M8Q A;  3MXM A;  4FJ8 A;  2HHT A;  2ITG A;  3FFI A;  1DTT A;  4M41 A;  3PX6 A;  2EX3 A;  1JLG A;  3LPU A;  1C0T A;  1BGX T;  1KTQ A;  1NJY A;  1NK4 A;  5JS1 A;  1NK7 A;  3K5N A;  1VSH A;  3C94 A;  3V1Q A;  4GVM A;  4DSJ A;  3PO4 A;  2QK9 A;  4RW8 A;  3AVB A;  3CM6 A;  3DLG A;  4CHQ A;  3F9K A;  5KRS A;  3KD1 E;  4ELT A;  3LDS A;  2X74 A;  3AA2 A;  3HL8 A;  4IG3 A;  3UIQ A;  4B9U A;  3OYK A;  2E6M A;  4CEB A;  3AVI A;  4M3W A;  5J2M A;  1U04 A;  4E7K A;  1RBU A;  3LAK A;  4CFD A;  2A1R A;  4KB0 A;  5FRN A;  4AHS A;  3DLB A;  3NH0 A;  4FLT A;  2JLE A;  1WAJ A;  4MFB A;  3O3H A;  4LH4 A;  2QKK A;  1TL1 A;  4I9Q A;  1XHZ A;  1BHL A;  1WN7 A;  1VSF A;  4B9L A;  1K6Y A;  4DSE A;  1VRU A;  1D9D A;  4BWJ A;  3T1A A;  4FLZ A;  4DS4 A;  1C1B A;  3VN5 A;  2ZE2 A;  4KV8 A;  4DLE A;  1BIU A;  1EX4 A;  1WNS A;  1JLF A;  4DSL A;  4CGJ A;  1S9E A;  2PZS A;  1GOA A;  3HPO A;  3LAL A;  3KLE A;  2OA8 A;  4O0J A;  1YTA A;  3KK3 A;  4Y1D A;  1L3S A;  2FBX A;  2G8K A;  4F3T A;  3DOK A;  1C0U A;  1HQU A;  2GBZ A;  1HNV A;  1RDC A;  5FRM A;  4E7I A;  2XY5 A;  3TAP A;  3ZSZ A;  2HHW A;  1D5A A;  2B6A A;  1TAU A;  4O55 A;  4WE1 A;  3ITH A;  3OYN A;  2P1J A;  1KLN A;  5J2P A;  4CF0 A;  3LAN A;  4RW4 A;  1WSF A;  3CQ8 A;  3L2Q A;  4O44 A;  2HVH A;  4FYD A;  5CYQ A;  1S5J A;  3ZSO A;  3DMJ A;  4BE2 A;  1EP4 A;  3PV8 A;  3VQD A;  1UA1 A;  1KFS A;  4GMJ B;  1T03 A;  3I8D A;  4DFP A;  1ZBF A;  4UQG A;  4M3Y A;  4CJT A;  1I3A A;  3KLF A;  3AA4 A;  3M8R A;  1IG9 A;  4CJ4 A;  2OZS A;  1NOY A;  4FJX A;  2RPI A;  3L3U A;  3KK1 A;  3NAE A;  4DS5 A;  4KAZ A;  3T19 A;  3ZSW A;  4DWI A;  1FK9 A;  4I7F A;  3RMA A;  1KFD A;  1DLO A;  2KQ2 A;  3ZSV A;  5J2N A;  3NF7 A;  3ZT2 A;  4F4K A;  4KHY A;  1RBT A;  2X6N A;  1BCO A;  4EZ9 A;  4ZTF A;  4KI6 A;  3KK2 A;  4DU4 A;  1RT7 A;  2DTU A;  3TWH A;  4OLB A;  4KTQ A;  4C8M A;  3V9W A;  4KHW A;  1EKE A;  2OPS A;  4CIF A;  1RT1 A;  2XO7 A;  1JLQ A;  1BQN A;  1IKV A;  1LW0 A;  3VQ6 A;  2FBV A;  3MEC A;  1ITG A;  1ZBH A;  2I5J A;  3SUQ A;  3AVC A;  3D45 A;  1RNH A;  3KKS A;  3TAF A;  3RMC A;  2OYQ A;  3VQ9 A;  4FVM A;  1S1X A;  3NH1 A;  4KHQ A;  3NFA A;  1BI4 B;  4CJF A;  2HHV A;  4B9M A;  2BE2 A;  1C1A A;  4CGG A;  4KB1 A;  3HJF A;  3OVN A;  3U3Y A;  1RDB A;  4EZ6 A;  3C95 A;  3OYI A;  4FLU A;  4FJ9 A;  4J2B A;  2DFH A;  4EP4 A;  1JXB A;  5C25 A;  2D5R A;  4B9N A;  1WSH A;  1CZB A;  4NYF A;  3L8B A;  4L8R B;  4CGH A;  3CM5 A;  1L3V A;  4DTM A;  1ZBL A;  4LD0 A;  1J54 A;  2FBT A;  3ZT4 A;  4H8K A;  3SJJ A;  3VQ5 A;  1JKH A;  2G8H A;  4BE1 A;  4Z4I A;  3LWM A;  3AVM A;  1IKW A;  1Y97 A;  2VWK A;  3SUN A;  2HNY A;  3HT3 A;  4CK1 A;  1D9F A;  3DI6 A;  4CJ3 A;  4I2P A;  4TSX A;  4E89 A;  4DMN A;  3K2P A;  4K8X A;  4CFC A;  3NHG A;  3OJS A;  1QSY A;  4HCB A;  3SYZ A;  2B4J A;  4N76 A;  1C0M A;  4Z0U A;  3RR7 A;  4B3O A;  3DYA A;  3CG7 A;  3L2U A;  1XHX A;  3TI0 A;  4F3O A;  3D0P A;  1NKB A;  1NJZ A;  2HMI A;  1A5X A;  3T3F A;  2KW4 A;  4CHZ A;  1CXQ A;  2Y1I A;  1RTI A;  1XC9 A;  2G8U A;  3PX4 A;  2QKB A;  4DU1 A;  4N56 A;  1RDD A;  1NK0 A;  4CHN A;  1IKY A;  2Z1H A;  3ASM A;  1RBR A;  2VWJ A;  3L2R A;  3PO5 A;  1RT6 A;  3HYF A;  2HHS A;  4C8O A;  5FRO A;  3PX0 A;  4XIU A;  4KTZ A;  3KLH A;  5SWM A;  4J2A A;  3AVJ A;  3HPG A;  3P83 D;  2VG7 A;  4FW1 A;  1W9H A;  1JL1 A;  3MEE A;  3VQA A;  3ZSX A;  4E7H A;  1RBS A;  3IS9 A;  3TR8 A;  3ZSQ A;  3QEX A;  3ZSY A;  1UAX A;  4M3X A;  2ETJ A;  4CJR A;  2KFN A;  4B9T A;  3DM2 A;  4FLY A;  4RW6 A;  3O3F A;  3P5J A;  1JLB A;  1I39 A;  3KKR A;  3NGI A;  2OPP A;  3H08 A;  5CZ2 A;  1CLQ A;  1ZBI A;  2IC3 A;  1BL3 A;  4OGE A;  1RTD A;  3SZ2 A;  2BDP A;  4J2E A;  3LP3 A;  4IFY A;  2OPQ A;  3RRG A;  4OGC A;  2KZZ A;  3QEV A;  3QEW A;  4CK3 A;  3KD5 E;  1SKR A;  2X78 A;  3NCI A;  2JGU A;  1FKP A;  2RKI A;  3JSM A;  5J1E A;  5DMR A;  4CIE A;  3SCX A;  1KSP A;  1NK9 A;  2YNF A;  3HST B;  3HP9 A;  1TL3 A;  4IG0 A;  1LV5 A;  4F8R A;  4C8L A;  4DSF A;  1HYS A;  1NOZ A;  1LAW A;  3QLH A;  4AHR A;  3V6D A;  1WSE A;  4M45 A;  1GOC A;  3WNH A;  3AO4 A;  3S9H A;  4PWD A;  1FKO A;  1A5V A;  2D0B A;  3AVK A;  3G10 A;  3O4Q A;  4BWM A;  4W5Q A;  3OYB A;  1TKZ A;  1WSI A;  1VSD A;  3V4I A;  1TK5 A;  4QAG A;  4F2R A;  4DU3 A;  3L2V A;  4M3U A;  1LW2 A;  3NDK A;  1U47 A;  1NJX A;  4K8Z A;  4LH5 A;  1T8E A;  2DY4 A;  3SQ0 A;  2HND A;  3EZ5 A;  4F2S A;  1NK5 A;  4LSL A;  4B9V A;  3K59 A;  2PYL A;  2KTQ A;  3MXJ A;  2ZQB A;  1ZBU A;  3I0R A;  4FM2 A;  4E7J A;  2DFE A;  4RW9 A;  1LWF A;  1TKT A;  1U4B A;  3S3N A;  4FLX A;  2PYJ A;  4E7L A;  2YNI A;  1QQC A;  1RIL A;  4DSK A;  2XY8 A;  3ALY A;  4KKO A;  3QET A;  1T05 A;  1HRH A;  2IS3 A;  3DLR A;  3ZT3 A;  1QTM A;  2XHB A;  1D8Y A;  4FJM A;  2GV9 A;  4OKK A;  4DLG A;  4M3T A;  4Z4G A;  5HRS A;  4CGD A;  3M8P A;  4BDY A;  4JS5 A;  1RT5 A;  4AIL C;  3WNF A;  1ASW A;  4OKE A;  4OPJ A;  4W5T A;  4DFM A;  5HBM A;  3HXM A;  2VG5 A;  2XY6 A;  4KPY A;  1IO2 A;  5JS2 A;  3LZI A;  4FM0 A;  1LAV A;  4DTX A;  1JXE A;  2X6S A;  4AHC A;  3L3V A;  1REV A;  3V81 A;  4B9S A;  2HHQ A;  4FJN A;  1TGO A;  3HVT A;  3O3G A;  4HTU A;  3EY1 A;  2OPR A;  3AVA A;  3SNN A;  4FZX C;  3DOL A;  5KI6 A;  3E01 A;  3HVR A;  3K58 A;  1VK0 A;  4DQI A;  2WON A;  3I0S A;  1UOC A;  2YNH A;  4ID5 A;  1SL0 A;  1F21 A;  3EYZ A;  1VSE A;  3NF9 A;  4E3S A;  1L3U A;  4W5R A;  3DLK A;  3VQ7 A;  5HRP A;  3IRX A;  5EU7 A;  2XY7 A;  3BDP A;  1YTU A;  1SL2 A;  3VQQ A;  5KTQ A;  4FJ7 A;  3TAQ A;  5D3G A;  4DTJ A;  4Q0B A;  2HVI A;  1B92 A;  2YHB A;  4N5S A;  1BCM A;  3ZT0 A;  2Z1G A;  4J2D A;  3THV A;  2IOC A;  2RF2 A;  3QNO A;  3TAB A;  2LSN A;  2O4G A;  4R5P A;  4H4M A;  4JLH A;  4CE9 A;  4CHY A;  4CCH A;  3KTQ A;  4FCY A;  1HNI A;  3CYM A;  1B9F A;  3NBP A;  4CIG A;  4E1N A;  3K57 A;  3SQ1 A;  3PY8 A;  4FK2 A;  2F8S A;  1X9S A;  2P5O A;  1S6Q A;  2F8T A;  4OPK A;  3OYL A;  4CJU A;  1HJR A;  4O4G A;  4FJL A;  3TAR A;  4CEC A;  4E19 A;  3L2W A;  1TKX A;  3TAG A;  4PA1 A;  4I2Q A;  3VQP A;  3QEI A;  1X9M A;  3NE6 A;  4FW2 A;  4ELV A;  2IAJ A;  3C6U A;  5CY4 A;  4B08 A;  4BE0 A;  3SI6 A;  1A5W A;  3OYG A;  3OS1 A;  3QIN A;  4ELU A;  4DFJ A;  4KRF A;  3PUF A;  1J9A A;  4Z4C A;  1IH7 A;  3RMB A;  3K5M A;  4O5B A;  5CYM A;  3VQC A;  2YHA A;  3A2F A;  4W5O A;  3OY9 A;  2G8V A;  4E0D A;  1S9G A;  4DTU A;  4KI4 A;  3DRR A;  4HUF A;  3AO2 A;  1LWE A;  4DG1 A;  1B9D A;  4FZY A;  4M42 A;  3VQ4 A;  1RT2 A;  3NF6 A;  1HYV A;  4CF8 A;  3KLG A;  1ASU A;  1TKD A;  2HB5 A;  4HVJ A;  3ULD A;  4MQ3 A;  3AV9 A;  4CFB A;  1Q9Y A;  4FJ5 A; 
#chains in the Genus database with same CATH topology
 5AQK A;  1YJN N;  3QO9 A;  1Z05 A;  2E2N A;  3H45 C;  4DV4 K;  2Q0U A;  4LY7 A;  3SQ4 A;  4H0P A;  2YV0 X;  5M1Q A;  4HHT A;  3K9J A;  3HK2 A;  4IFE A;  1SKW A;  1YAG A;  1LCU A;  3NMU A;  3ZET A;  3ZSR A;  3JS6 A;  3LDO A;  1R0A A;  1HYZ A;  3WNE A;  2FSK A;  3LDQ A;  4AH9 A;  3BF3 A;  3MDQ A;  3O9U A;  5BN9 A;  2B5J A;  4CJV A;  4H5N A;  4IO8 A;  4DR6 K;  2PAV A;  2HNZ A;  1N36 K;  5AQO A;  1EET A;  1VSI A;  1SS6 A;  4CHP A;  4A62 A;  2HBJ A;  1C1C A;  3BZK A;  1ZYQ A;  3LDL A;  2VGN A;  4PKH A;  5HP1 A;  3CC2 N;  2NRZ A;  3AVL A;  1LWC A;  4DR5 K;  3F73 A;  1NKE A;  4YOT A;  3OYF A;  2UXC K;  3WXM B;  4CVN E;  3AA5 X;  3HTV A;  3T7Z A;  3VEX A;  4MO5 A;  3MCA B;  3FZM A;  1N32 K;  4DTN A;  5J2Q A;  5HLF A;  5KGX A;  3SUO A;  3MCP A;  3QEP A;  2BTF A;  1O1W A;  5BRD A;  3CI5 A;  4QOZ B;  3P1G A;  1S1T A;  1KLM A;  3C6A A;  4IDH A;  4IDK A;  1NG9 A;  4DR7 K;  2UU9 K;  3VGK A;  4CJW A;  3KJV A;  2QM1 A;  4CEA A;  1UWB A;  5AQH A;  4JYA K;  2AJQ A;  3DXK B;  3VA0 A;  3SQ2 A;  3NF8 A;  4R79 A;  3O9T A;  3LP2 A;  2F4V K;  3ZEU B;  4DQR A;  1RTJ A;  4CER A;  4Z4E A;  4BDZ A;  3CER A;  3HP6 A;  5GAD P;  3D2F A;  1VAZ A;  3TAE A;  1WSG A;  1XI1 A;  1G15 A;  3V1O A;  3ZYY X;  5AQV A;  4CK2 A;  4BDP A;  3CFR A;  1ZC6 A;  4CEF A;  5HRO A;  3T69 A;  3LP0 A;  4WF9 L;  2WTU A;  3SPY A;  2DPN A;  1X9W A;  3VOV A;  4IBN A;  4U7B A;  3OYH A;  3CD6 N;  3PIO L;  4LSN A;  2YHW A;  2BUP A;  4PY5 A;  3ZX3 A;  3P31 A;  4CEZ A;  3K5O A;  1UA0 A;  3NH2 A;  1SKS A;  1JLC A;  4DB3 A;  3SUP A;  1RDW X;  4DTP A;  3ZCM A;  3V9S A;  4ZTJ A;  5C42 A;  4GV9 A;  3QFU A;  1FW6 A;  5LMU K;  5GIN A;  3RWU A;  4JKG B;  5AQU A;  4CJK A;  2YI1 A;  2FLO A;  1BIZ A;  1TYQ B;  1JCF A;  3OYC A;  2WC9 A;  3U3G A;  3MAQ A;  3NGY A;  2A6A A;  5HRR A;  3CCV N;  2O8B B;  5ADX H;  3UKU A;  4Y1C A;  3VA3 A;  1DT9 A;  3EO3 A;  3QBX A;  3LL3 A;  3CCQ N;  4FWN A;  5AQX A;  4G9Z A;  4NXM K;  1K8K B;  1YXQ A;  1U2V A;  3QIO A;  4WFA L;  3C7N B;  2GWK A;  3CFO A;  3I55 N;  4K41 A;  3DLE A;  3RTV A;  3HOT A;  3CJ7 A;  1EWQ A;  4NCA A;  2VG6 A;  1VRT A;  3HI0 A;  3AVF A;  3D2E A;  3BEX A;  1RT4 A;  1H1V A;  3M8Q A;  4FJ8 A;  3PX6 A;  2EX3 A;  4AF1 A;  2HBM A;  3H3N O;  1NJY A;  1NK4 A;  3K5N A;  1VSH A;  3C94 A;  2QK9 A;  2I7P A;  4O8U A;  4CHQ A;  2X74 A;  3AA2 A;  2YHY A;  3HL8 A;  2P9S B;  4B9U A;  5FRN A;  4BC4 A;  4V19 S;  3SAH A;  3NH0 A;  3FZK A;  5AZI B;  1XHZ A;  4I9Q A;  3VF4 A;  1BHL A;  3H46 O;  4ISF A;  3C7N A;  4BWJ A;  3M3Z A;  1BIU A;  2YJF A;  1JLF A;  3GE1 A;  4H0Y B;  2OA8 A;  1L3S A;  4Y1D A;  4F3T A;  3DOK A;  2HF3 A;  4E7I A;  2XY5 A;  2HHW A;  3BF1 A;  4CZH A;  1QVG M;  2AP1 A;  4X64 K;  2FF3 B;  4IJN A;  4DV3 K;  2GUP A;  1OH5 A;  1W7A A;  4O44 A;  5CHI A;  5CYQ A;  5F1X A;  3DMJ A;  4BE2 A;  1UA1 A;  4DFP A;  5GAE P;  1FJG K;  4CJ4 A;  2RPI A;  3KK1 A;  4WFN L;  3P4I A;  4DWI A;  1FK9 A;  4I7F A;  1KFD A;  3O9Q A;  1DLO A;  2KQ2 A;  3NF7 A;  4H5T A;  5C2D A;  1HKC A;  4DHY A;  1RBT A;  2X6N A;  1GLE G;  5AQR A;  5F2R A;  5H1S Q;  4KI6 A;  1QVF M;  3KK2 A;  3VEY A;  5LJV A;  3TWH A;  1YIJ N;  4OLB A;  3QDK A;  1EKE A;  3G6E N;  1JLQ A;  4BRD A;  3THX A;  2OCE A;  1VQM N;  5FPE A;  3RMC A;  3AVC A;  4LC9 B;  3D7E O;  3G4S N;  3CCE N;  3OVN A;  1RDB A;  5BN8 A;  5C25 A;  1NBW A;  3CJA A;  4JKC A;  4DTM A;  4QS7 A;  2FBT A;  3SJJ A;  1JKH A;  3LWM A;  3AVM A;  1IKW A;  3SUN A;  1D9F A;  3WEE B;  2A5X A;  1HPM A;  3L4Q A;  1QSY A;  3O6W A;  2Q31 A;  1KAX A;  1C0M A;  3VGM A;  4B3O A;  3TI0 A;  3VGL A;  4F3O A;  3P38 A;  2AA4 A;  1NJZ A;  2HMI A;  5JVH L;  1RTI A;  2RHK A;  3KWG A;  2QKB A;  4DU1 A;  4CHN A;  1IKY A;  3FGU A;  1RBR A;  3L2R A;  4H5W A;  1RT6 A;  3HYF A;  4XIU A;  4CJ7 A;  3KLH A;  3P83 D;  4CD1 A;  1JL1 A;  3VQA A;  3ZSX A;  1SAZ A;  4E7H A;  3IS9 A;  1J6Z A;  3ZSY A;  3CJ9 A;  3WUH A;  3CXC M;  3DM2 A;  5AFU A;  3CHW A;  1I39 A;  2OPP A;  4ISG A;  1ZBI A;  4YHH K;  4OGE A;  4FWL A;  3LP3 A;  4IFY A;  4YOW A;  4DV5 K;  3KD5 E;  1ATR A;  2ZM6 K;  1SKR A;  4BRE A;  5A2Q O;  3SCX A;  1TL3 A;  1DKG D;  4IG0 A;  2GTD A;  4M45 A;  5CE3 A;  1D4X A;  1V4S A;  2D0B A;  5M1F A;  1LV5 A;  1WSI A;  4F2R A;  3GBT A;  4DV7 K;  4DU3 A;  1LW2 A;  5C2F A;  1NJX A;  2DY4 A;  4LH5 A;  4BR2 A;  4O8K A;  1K8K A;  5LJW A;  4F2S A;  3VMF B;  1HX1 A;  4XH4 A;  4E7J A;  4EIA A;  2DFE A;  1LWF A;  4HWI A;  4DSK A;  4IEI A;  3QET A;  2D4W A;  1ZXO A;  2F7T A;  3O8M A;  4Z4G A;  5KPR A;  4JKG A;  4BDY A;  4H0O A;  1ASW A;  3C65 A;  4B1W B;  3HXM A;  1LAV A;  4DTX A;  2X6S A;  4AHC A;  5E26 A;  2HHQ A;  1W2B M;  1QQM A;  3AVA A;  3JAM O;  4FZX C;  4BR7 A;  1GLC G;  3K58 A;  1VK0 A;  3CJC A;  3I0S A;  3KK7 A;  1UOC A;  2QWM A;  3ZET B;  5HRP A;  4W5R A;  4JI2 K;  3VQQ A;  5KTQ A;  1K9M O;  4FJ7 A;  3TU5 A;  2HVI A;  1B92 A;  3ZT0 A;  2Z1G A;  3THV A;  3G71 N;  2E2O A;  3TAB A;  3QNO A;  4DR2 K;  1OH7 A;  2LSN A;  3WXI A;  4PKI A;  3KHY A;  1NGF A;  4CCH A;  2VCP A;  4Y0W A;  4JI1 K;  1N8R O;  1X9S A;  2F8T A;  3OYL A;  2O8E A;  4A5A A;  1Q81 O;  5AQM A;  3NE6 A;  1T44 A;  4CZG A;  3SI6 A;  3L0Q A;  4BRG A;  1XUP O;  1T6D A;  2NNW A;  4DTU A;  3ULE A;  4M42 A;  1KC8 O;  4WQ5 C;  4CF8 A;  4RTF D;  3OHR A;  4HVJ A;  3ULD A;  4MQ3 A;  4FJ5 A;  1J53 A;  3D2E B;  3UB5 A;  4CEQ A;  1WOQ A;  3VTH A;  4CJP A;  1VSJ A;  1JLE A;  4M3Z A;  3TPQ A;  3J8A A;  2IDO A;  5B8H A;  2P9U A;  5HL7 L;  1GLL O;  1J5O A;  3SAF A;  2V7Y A;  2HHX A;  2KZM A;  4ID1 A;  4OKJ A;  3SMP A;  3CPW M;  4AHT A;  2ZGY A;  3ID8 A;  1XC3 A;  1NJW A;  2D0C A;  4BRC A;  5FPD A;  1U6Z A;  3OYE A;  3HRG A;  2E2Q A;  3ZT1 A;  3QNN A;  1C6V A;  1KVB A;  5FPN A;  4M3R A;  2NRW A;  2YKN A;  3AO5 A;  4IZ9 A;  4NCB A;  1BOT O;  2D1K A;  3S41 A;  4FM1 A;  3SPZ A;  4PL8 A;  3BGR A;  4DF8 A;  2FSN A;  2ITM A;  2ATQ A;  4DR3 K;  3K5L A;  2IVN A;  3VEZ A;  1L5U A;  1BQM A;  3CFP A;  4RG8 A;  4I9L A;  5ELZ A;  4BGB A;  3OYJ A;  4N47 A;  3TTF A;  1BI4 A;  4FLV A;  4CEE A;  2E1Z A;  2O8B A;  3UE5 A;  5I3U A;  5I42 A;  1QE1 A;  1TUY A;  4BRM A;  2FBY A;  4BR0 A;  4CFA A;  2QWN A;  2CGL A;  4BR4 A;  5AQQ A;  3AVG A;  3DRP A;  4DTS A;  3MWT A;  3ZX2 A;  2P9K B;  4ILJ A;  4AHV A;  3THY B;  5HRN A;  3BZC A;  4X65 K;  3WNG A;  4JKE A;  4B1U B;  1RCH A;  1XWL A;  2P9L B;  3AGR A;  4OLA A;  4LFB K;  3DXK A;  1GLJ O;  4FPA A;  3B6P A;  5C24 A;  4FZZ A;  3OS0 A;  3MEG A;  4IXC A;  1QHA A;  2VYP A;  3HOS A;  1L3T A;  4CF9 A;  4IWV A;  4H4O A;  5BPM A;  3M8S A;  4FSV A;  4C8N A;  4DFK A;  5M1O A;  1Z25 A;  1TVR A;  1S1V A;  3KWI A;  1VHX A;  3THW A;  1Q9X A;  4CZM A;  1KRP A;  4Q5V A;  3MXI A;  2QW9 A;  1WB9 A;  3JYT A;  1RDA A;  1SUQ A;  3MN5 A;  4FOE A;  3SJH A;  3I33 A;  3K9K A;  1QSL A;  1N6Q A;  4DV1 K;  3RR8 A;  3MED A;  4ZHR A;  1KCF A;  2D0P A;  2QWL A;  4LF6 K;  3QIP A;  2Q1N A;  4DCH A;  1YVU A;  1BDG A;  1CXU A;  2IVO A;  1ASV A;  1GOB A;  1W0H A;  5CZ1 A;  4YNQ A;  2DFF A;  1WBB A;  2E2P A;  5T7B A;  4HUG A;  1RT3 A;  3LWL A;  4KHU A;  3OJU A;  2BAN A;  2J4R A;  3B6O A;  4DTO A;  1I94 K;  4PUO A;  1KVA A;  3TAM A;  4AHU A;  2GUI A;  3V9Z A;  5EOY A;  4JKA A;  2E1Y A;  1IG8 A;  1NGG A;  3C6T A;  3AY9 A;  1OVQ A;  5LL6 Z;  3MXM A;  4CZI A;  2HHT A;  4K25 A;  3FFI A;  1DTT A;  4M41 A;  3WQT A;  4WQ4 A;  1C0T A;  4GVM A;  3PO4 A;  4BRK A;  4RW8 A;  2NRX A;  3CM6 A;  4B1Z A;  2QWR A;  4ELT A;  3LDS A;  5AFU H;  5BRE A;  4EHT A;  4NLC A;  2RE2 A;  1U04 A;  4E7K A;  2A1R A;  3LAK A;  2YHX A;  4KB0 A;  2P9N B;  5MLC Q;  1WAJ A;  4MFB A;  3O3H A;  2NRR A;  1TL1 A;  4C1N I;  1K8A O;  4NB4 A;  4EFH A;  4DSE A;  1D9D A;  3D2F B;  3T1A A;  4DUZ K;  5AQS A;  1C1B A;  3FLC O;  3U9Z A;  3VN5 A;  2ZE2 A;  4KV8 A;  3VF2 A;  1J5E K;  1EX4 A;  3EKU A;  1ILY A;  1S9E A;  4BRI A;  2VGM A;  4JK8 A;  4JHD B;  1MA9 B;  3HPO A;  4O0J A;  3KK3 A;  2G8K A;  2FBX A;  1HQU A;  3C0B A;  1HNV A;  1RDC A;  1VQP N;  3TAP A;  5C15 A;  4BVP A;  1TAU A;  4WE1 A;  3OYN A;  2P1J A;  5I9E B;  5J2P A;  4CF0 A;  3CQ8 A;  3MN6 A;  5ADX A;  5BR8 K;  1EP4 A;  3DJC A;  4UQG A;  4M3Y A;  4KAZ A;  4DS5 A;  5BR9 A;  3N4P A;  3EN9 A;  3ZSV A;  1RDU A;  3ZT2 A;  5DM6 L;  4F4K A;  4IOA L;  4KHY A;  1S3X A;  1BCO A;  4O5F A;  3O5B A;  1RT7 A;  3V9W A;  4CIF A;  1RT1 A;  4OPA A;  3VQ6 A;  1EO1 A;  3MEC A;  1VQN N;  3D45 A;  5JLH A;  1C0F A;  3U4L A;  3NH1 A;  3NFA A;  3GOI A;  4KB1 A;  1C1A A;  3HJF A;  3B8A X;  4YOV A;  3U3Y A;  4CZK A;  1YIT N;  3OYI A;  4FLU A;  4FJ9 A;  3CQX A;  5IWA K;  1WSH A;  1CZB A;  3CPE A;  4ISE A;  1J54 A;  3VQ5 A;  3N4Q A;  4Z4I A;  1NU0 A;  1Y97 A;  3UKR A;  1IBK K;  3HT3 A;  3DI6 A;  1X3M A;  4CFC A;  3NHG A;  3SYZ A;  3L2U A;  1XHX A;  3CQY A;  2NRV A;  3D6R A;  3QIC A;  3T3F A;  1CXQ A;  1XC9 A;  2YCH A;  3PX4 A;  1KXP A;  1RDD A;  4KH5 A;  2O8E B;  3PO5 A;  3FZH A;  4C8O A;  4GNI A;  3PX0 A;  4KTZ A;  4CI6 A;  2VQE K;  5EXW A;  4KH4 A;  3TR8 A;  3IMX A;  2KFN A;  4FLY A;  4RW6 A;  2KHO A;  3O3F A;  3P5J A;  1JLB A;  2P9N A;  5CZ2 A;  3H08 A;  2Q97 A;  2P9I A;  1RTD A;  3HSC A;  4BRL A;  2KZZ A;  4CK3 A;  3GL1 A;  3O80 A;  4RWT A;  1VQ7 N;  3M1F A;  1YF5 L;  1FKP A;  4CBW A;  3JSM A;  1HKG A;  1KSP A;  3TTC A;  1NK9 A;  3WT0 A;  3HP9 A;  4M63 C;  3H1Q A;  5JVG L;  4YOR A;  1LAW A;  2OTL N;  1WSE A;  4BQZ A;  3AO4 A;  1Y64 A;  1E4F T;  1A5V A;  3A5L C;  4LF4 K;  3V4I A;  4WFB L;  4MDB A;  2NZT A;  1XMQ K;  1TK5 A;  4QAG A;  3NDK A;  3PSF A;  1U47 A;  4K8Z A;  1T3V A;  1LOT B;  3SQ0 A;  3NVM A;  1NK5 A;  4LSL A;  2P9I B;  3IKM A;  2PYL A;  2KTQ A;  2WUS A;  1ZBU A;  2ZQB A;  5AQZ A;  4RW9 A;  1KQS M;  1TKT A;  1GLB G;  1TUU A;  1QQC A;  1RIL A;  1Q86 O;  2XY8 A;  3ALY A;  1T05 A;  3ZT3 A;  2XHB A;  1D8Y A;  1EQY A;  5HRS A;  5DM7 L;  2GWJ A;  4JS5 A;  1P8Z A;  4OKE A;  4KPY A;  5HBM A;  2VG5 A;  3MX2 A;  4CBX A;  3ENB A;  3O4W A;  4FM0 A;  4FWS A;  5IT9 O;  1SQK A;  1JXE A;  3U8X A;  3V81 A;  4B9S A;  2OPR A;  4DV0 K;  4LF7 K;  1QQN A;  2KLA A;  5KI6 A;  3HVR A;  1F21 A;  1VSE A;  3UKR B;  4E3S A;  3BDP A;  3IRX A;  1SL2 A;  5D3G A;  4JV5 K;  3VEV A;  3WXJ A;  4Q0B A;  4N5S A;  5AQW A;  4J2D A;  3GG4 A;  5AJ3 K;  2RF2 A;  3CJB A;  2P9K A;  4A5B A;  4CE9 A;  4FWR A;  3MWP A;  2IIR A;  4FCY A;  1HNI A;  2F8S A;  4CIG A;  4OPK A;  1HJR A;  4JI0 K;  3L4I A;  4O4G A;  4FJL A;  4CEC A;  1TKX A;  3VQP A;  1X9M A;  4B08 A;  4BE0 A;  4FWP A;  2ZJR L;  3OYG A;  3OS1 A;  1HR0 K;  4FVU A;  4ELU A;  4KRF A;  1HNW K;  1VQ5 N;  4W5O A;  3A2F A;  1IV0 A;  4HUF A;  3ENH A;  1B9D A;  5EX5 A;  4YOX A;  1YJW N;  1HYV A;  3KLG A;  3ID6 A;  4JI8 K;  5E41 A;  1SL1 A;  3EE8 A;  4QS9 A;  1U49 A;  2QEX N;  4BRQ A;  4FJK A;  3L6Q A;  4FO0 A;  3OS2 A;  1GLA G;  4CJQ A;  1BG3 A;  2V51 B;  3AO3 A;  4KHS A;  2KFZ A;  2O4I A;  2HOE A;  5TKW A;  3AA3 A;  4QS8 A;  4PHT X;  1YJ9 N;  4FJJ A;  3F5T A;  3SV4 A;  3LPT A;  1V4T A;  2ZJQ L;  1S1U A;  2P51 A;  4IKF A;  4MDA A;  4BRP A;  3HM8 A;  1ATN A;  4AM7 A;  3ATV A;  3J7A P;  4JRQ A;  5DK5 A;  2RN2 A;  2HST A;  3SV3 A;  2H3G X;  4YDU A;  1TAQ A;  4XH5 A;  2QXF A;  4BRA A;  4KHP K;  2G8W A;  4HUE A;  4NXN K;  5KRT A;  2R7Y A;  1XNR K;  3MN9 A;  1X1P A;  2D0A A;  3NGZ A;  1NLV A;  4DTR A;  4EP5 A;  4CED A;  3T1H K;  1QHT A;  3O08 A;  1KAY A;  4DQS A;  4B8A B;  1KVC A;  1RTH A;  1EXQ A;  3J80 O;  2YNG A;  4BAC A;  2GX9 A;  4FJH A;  2O8D A;  3O1B A;  3OTO K;  5AZJ A;  4W5N A;  2Z1J A;  3VEN A;  2Z1I A;  1YVN A;  1VQO N;  2W42 A;  1OVY A;  4MLE A;  3T1Y K;  4B3S K;  3V9X A;  2XRI A;  1BU6 O;  4FOI A;  4BC3 A;  1R59 O;  1BUP A;  4NCG A;  2NLX A;  3SBT A;  4BG9 A;  1VSL A;  1YT3 A;  4BRH A;  2HBK A;  4H5V A;  1WLJ A;  1VSM A;  4DKW A;  1TK8 A;  1Q8I A;  4GKJ K;  1JL2 A;  4EHU A;  1HMV A;  4LF9 K;  1GLF O;  5AQG A;  3PLA A;  1N5Y A;  5AQY A;  2O8F A;  4ILH A;  4B1X B;  4CEO A;  4KRE A;  1JLA A;  2IGI A;  2Q3S A;  1QZ6 A;  5AR0 A;  4C8K A;  4OVL A;  2FC0 A;  4DQP A;  3LP1 A;  1WSJ A;  5KGW A;  4CJL A;  1JCG A;  4CES A;  3CME N;  2P5G A;  4CF2 A;  1MU2 A;  5FDL A;  1RBV A;  4Z4H A;  1U45 A;  5SZT A;  2HW3 A;  3QES A;  4KFB A;  1RGI A;  2P9P B;  4JD2 A;  2CGK A;  3FE1 A;  3E9L A;  4KO0 A;  5AQL A;  3JXU A;  2CH5 A;  3LZJ A;  3AVH A;  1S1W A;  3R3L A;  4CJ5 A;  3RMD A;  4CJE A;  4E1M A;  3VQE A;  1HNX K;  4I6M B;  4G1Q A;  4CGI A;  3CC4 N;  1HKB A;  1NMD A;  2E6L A;  1QS4 A;  4FWK A;  3S3M A;  1TV6 A;  4B9Q A;  1T7P A;  5AQP A;  2Q0R A;  3G25 A;  2BGG A;  2ITG A;  3E9P A;  3LPU A;  1BGX T;  5JS1 A;  3BUZ B;  1NGH A;  1NK7 A;  4WYB A;  4DSJ A;  5BRH A;  3AVB A;  5KRS A;  3KD1 E;  4IG3 A;  2HMP A;  4JI5 K;  3UIQ A;  4M3W A;  3OYK A;  2E6M A;  4CEB A;  3A0I X;  1HJO A;  3DLB A;  4FLT A;  2JLE A;  3TSQ A;  3ENO A;  4LH4 A;  4NO7 A;  1VSF A;  4B9L A;  1K6Y A;  1NGD A;  2YX6 A;  4BRF A;  3J7Y P;  1NMN A;  4DSL A;  4CGJ A;  2PZS A;  1GOA A;  3CCU N;  3LAL A;  1YTA A;  4DQ8 A;  2GBZ A;  3E66 A;  5FRM A;  1MWM A;  3ITH A;  3R9P A;  3MN7 A;  3I56 N;  4RW4 A;  1WSF A;  3L2Q A;  2HVH A;  4FYD A;  3TSP A;  3ZSO A;  3PV8 A;  1KFS A;  3VQD A;  4B1V A;  4GMJ B;  4FL9 A;  3TTD A;  2EWS A;  3MX5 A;  3KLF A;  3M8R A;  2OZS A;  4FJX A;  3T19 A;  5GIP A;  3RMA A;  5J2N A;  4GVE A;  3FR0 A;  4ZTF A;  3DXM A;  2DTU A;  4KTQ A;  4KHW A;  2XO7 A;  2OPS A;  4IEE A;  3J81 O;  1LW0 A;  1IKV A;  4M7X A;  2FBV A;  4OPH A;  3ZX0 A;  1ITG A;  1RNH A;  1C0G A;  2OYQ A;  3VQ9 A;  2YJE A;  4B9M A;  2BE2 A;  4CGG A;  1BA1 A;  2QI2 A;  3C95 A;  4B9N A;  4NYF A;  1L3V A;  4LD0 A;  2VWB A;  2UUB K;  4H8K A;  5M1N A;  4BE1 A;  4JNE A;  4CZL A;  4CK1 A;  4I2P A;  4TSX A;  4E89 A;  4DMN A;  3K2P A;  3SK3 A;  4GY2 B;  4GKK K;  3VES A;  2B4J A;  3RR7 A;  3CG7 A;  3O1W A;  3WXL A;  4B3T K;  1NKB A;  1VQ4 N;  3LM2 A;  5AQI A;  1A5X A;  4KH6 A;  4CHZ A;  5BPN A;  2Y1I A;  1EWR A;  4N56 A;  1NK0 A;  3ASM A;  2D0O A;  2HHS A;  5FRO A;  4BR9 A;  4J2A A;  5SWM A;  3HPG A;  4FW1 A;  3MEE A;  4OO1 J;  4B1Y B;  1UAX A;  2ETJ A;  1MWK A;  4B9T A;  3IDH A;  1IBL K;  4J8F A;  2IVP A;  3NGI A;  1QQO A;  1BL3 A;  3CCM N;  4J2E A;  1VQ6 N;  3FFK B;  4OGC A;  3QEV A;  4AM6 A;  2X78 A;  3NCI A;  2JGU A;  4DV6 K;  5FPM A;  1KAZ A;  1Z6R A;  5DMR A;  1NGJ A;  3EKS A;  3HST B;  4LFA K;  5LMN K;  3VPZ A;  1NOZ A;  4AHR A;  3V6D A;  2PFU A;  3S9H A;  1U2V B;  4PWD A;  3O4Q A;  1FKO A;  4W5Q A;  2QKK A;  1QSS A;  1TKZ A;  1RFQ A;  2UUC K;  3AAR A;  2WBN A;  4M3U A;  4BC5 A;  1HUX A;  1O13 A;  4B9V A;  3K59 A;  4B3M K;  3MXJ A;  3F9M A;  1NWK A;  5EY4 A;  4FLX A;  2PYJ A;  2YNI A;  1TYQ A;  4C23 A;  3DXM B;  1HRH A;  2QWP A;  3QFP A;  1QTM A;  3E1Y A;  4OKK A;  4DLG A;  4AIL C;  3UKU B;  3U9D A;  4OPJ A;  4DFM A;  5JS2 A;  1NGA A;  2BH1 A;  3VET A;  3FZF A;  4FJN A;  1TGO A;  4HTU A;  1NGB A;  3EY1 A;  1BA0 A;  1NNE A;  4U67 L;  4MLH A;  3E01 A;  2WON A;  1BWF O;  2UXB K;  1CZA N;  4ID5 A;  4JKB A;  4X66 K;  1L3U A;  1YTU A;  3WEE A;  2XY7 A;  2P9S A;  3TAQ A;  2QWO A;  4DTJ A;  2NRT A;  2YHB A;  2A41 A;  5JLF A;  4JK7 A;  4M7Y A;  2O4G A;  4R5P A;  4H4M A;  5TKY A;  2P9U B;  3KTQ A;  4EAH D;  4MO4 A;  3CYM A;  3PY8 A;  1JJ2 M;  1IJJ A;  4XEI A;  4BRN A;  1VQL N;  3IFR A;  3ZLJ A;  3TAR A;  4H5R A;  1Q18 A;  3L2W A;  4I2Q A;  2QWQ A;  3QEI A;  3EZW A;  5JIC A;  4FW2 A;  2QA4 N;  2IAJ A;  3C6U A;  3R1X A;  5CY4 A;  1E4G T;  3M6G A;  1XQS C;  2W40 A;  3PUF A;  3H3O B;  1IBM K;  1XMO K;  4CBU A;  4Z4C A;  3RMB A;  5AZI A;  3DAW A;  3K5M A;  3VQC A;  3OY9 A;  2YHA A;  2G8V A;  2OAN A;  3DRR A;  5HOO A;  3VQ4 A;  3KZB A;  3NF6 A;  3SMS A;  1TKD A;  1ASU A;  2HB5 A;  1ZBH A;  4DQQ A;  3AVN A;  1DGK N;  2ZGZ A;  4K43 A;  4LFC K;  2UYT A;  2WOM A;  3OBY A;  4YOY A;  1P90 A;  4QCL A;  3U6F A;  1S6P A;  3CCL N;  1YHQ N;  1NKC A;  2I7N A;  4JRP A;  3BY5 A;  4FJI A;  2G8I A;  2A42 A;  4BY9 C;  3VF6 A;  4IFV A;  4YY3 K;  2PBD A;  4PL7 A;  3VQB A;  1TK0 A;  4JS4 A;  3G0Z A;  4GV3 A;  4BQL A;  4YFU A;  4NYN A;  4CJS A;  2FF6 A;  4FJG A;  4FXD A;  4JKH A;  4KHN A;  2E20 A;  4DSI A;  4JKF A;  3OA9 A;  4A57 A;  3QB0 A;  1SZ2 A;  1U48 A;  1HPZ A;  2YKM A;  3VQ8 A;  1MDU B;  4BC2 A;  3CMA N;  3ISN C;  3TSU A;  1WAF A;  1FXX A;  4H0X B;  1SV5 A;  3S3O A;  3RSE B;  3IG1 A;  3M5R A;  3SBG A;  3QER A;  3RSE A;  4WQ4 C;  3K0S A;  3CIP A;  2F9T A;  5JMV A;  4IOX A;  3OW2 M;  2G8F A;  4JI4 K;  5M1P A;  4JI6 K;  3AO1 A;  4A2A A;  5CR4 A;  3HO1 A;  1E3M A;  4DF4 A;  4RW7 A;  3NVK A;  2O8F B;  2Y1J A;  2NUB A;  1BO5 O;  4JAX A;  3R6M A;  3R8E A;  3W3D A;  1Q82 O;  1IKX A;  2V7Z A;  2E4L A;  2PY5 A;  3DLH A;  1OH6 A;  2ZD1 A;  3WXK A;  2Q36 A;  4Z4F A;  5M1K A;  3O4N A;  5AQT A;  4F9O A;  3AAP A;  3DRS A;  4N41 A;  3TAN A;  1NK6 A;  1VSK A;  2OZM A;  4IO9 L;  3OYD A;  4HCC A;  3ULE B;  1HQE A;  3LAM A;  3OYA A;  4LF8 K;  3RRH A;  1YI2 N;  2A3Z A;  2HHU A;  4PQU A;  4CGF A;  3IAY A;  5KQ8 A;  1XNQ K;  4O0I A;  2EHG A;  1NK8 A;  4GW6 A;  4H0T B;  2A40 A;  5K14 A;  4CHO A;  4AQY K;  3V1R A;  3EEQ A;  3VEW A;  3CCJ N;  3I8B A;  2QXL A;  2ASP A;  4BGA A;  4OJR A;  2A1S A;  1Z26 A;  4FLW A;  4DR4 K;  3EE9 A;  2ZWH A;  2CGJ A;  2GEM A;  4JHD A;  2P9L A;  3H6E A;  1DTQ A;  3CC7 N;  4FK0 A;  4CZE A;  1CZ9 A;  1N34 K;  3KIO A;  3HM9 A;  4KBO A;  2F96 A;  3KLI A;  3ZEU A;  4FK4 A;  3HPH A;  4BG8 A;  5C0Y A;  5BPL A;  3V9U A;  1BIS A;  4KTW A;  3OYM A;  3A5O C;  1X3N A;  3P39 A;  4CW7 B;  5AQN A;  4ICL A;  2F9W A;  4B8C A;  4CF1 A;  4CZF A;  2KKZ A;  4C1N K;  1ZBS A;  1JLG A;  1KTQ A;  3MMV A;  3V1Q A;  3DLG A;  3F9K A;  1KD1 O;  5E84 A;  3AVI A;  5J2M A;  4JN4 A;  1RBU A;  4CFD A;  5LY3 A;  4AHS A;  5GAH P;  3A5N C;  3QML A;  1HLU A;  2FSJ A;  4CZJ A;  1WN7 A;  1VRU A;  2ASO A;  4YOU A;  4FLZ A;  4DS4 A;  4DLE A;  1WNS A;  5AZJ B;  2UUA K;  4UY8 O;  2UXD K;  1NM1 A;  3KLE A;  1C0U A;  2HF4 A;  3DWL A;  3ZSZ A;  1Q7Y O;  1D5A A;  2P9P A;  2B6A A;  3SLC A;  4O55 A;  2ZJP L;  1JCE A;  1OKJ A;  2JWK A;  1KLN A;  2OTJ N;  3LAN A;  3F2K A;  5EVZ A;  4WCE L;  3KVG A;  1S5J A;  3W0L A;  3PSI A;  1T03 A;  3J7Z O;  3I8D A;  1ZBF A;  2ASM A;  4CJT A;  1I3A A;  4XH1 A;  3AA4 A;  1IG9 A;  1NOY A;  3L3U A;  3NAE A;  4DR1 K;  3O9R A;  3PIP L;  4JI3 K;  3ZSW A;  1VQ8 N;  2W6K A;  4FWO A;  4IJA A;  4EZ9 A;  1S72 N;  3EL2 A;  4DU4 A;  5BRF A;  4C8M A;  4WQ5 A;  3DLL L;  1NJI O;  4ILG B;  1BQN A;  2O8C B;  1VQ9 N;  2I5J A;  2CH6 A;  4A2B A;  3KKS A;  3TAF A;  3SUQ A;  5GAG P;  4FVM A;  1S1X A;  4KHQ A;  1BI4 B;  3HZ6 A;  1G99 A;  4H03 B;  1ESV A;  4CJF A;  2HHV A;  4YDU C;  4FWQ A;  4EZ6 A;  2E88 A;  1N33 K;  2ZF5 O;  2DFH A;  4EP4 A;  1JXB A;  4J2B A;  2D5R A;  4L8R B;  3L8B A;  4CGH A;  3CM5 A;  3BP8 A;  1ZBL A;  1K73 O;  3CCR N;  3ZT4 A;  2G8H A;  5C10 A;  2VWK A;  3CET A;  2HNY A;  3VER A;  4CJ3 A;  1YUW A;  4K8X A;  3OJS A;  4HCB A;  4N76 A;  4Z0U A;  3DYA A;  3VTI A;  1X9J A;  2W6L A;  1ATS A;  4I6M A;  2Q2R A;  3D0P A;  4GV6 A;  4A59 A;  2KW4 A;  3FZL A;  3Q7C A;  4BR5 A;  2G8U A;  2Z1H A;  2VWJ A;  2W41 A;  4JD2 B;  3GDQ A;  2E8A A;  3CF5 L;  3AVJ A;  3IUC A;  2VG7 A;  1W9H A;  1RBS A;  4JK9 A;  3ZSQ A;  3LM9 A;  3QEX A;  4M3X A;  4IOC L;  4CJR A;  3OBW A;  4E1J A;  5GIO A;  2VQF K;  3MK6 A;  3KKR A;  1CLQ A;  3CJ1 A;  2IC3 A;  4NLB A;  2BDP A;  3SZ2 A;  3THY A;  4RCH A;  2OPQ A;  3RRG A;  3QEW A;  5C12 A;  1WBD A;  3THW B;  2RKI A;  3A5M C;  4K42 A;  1W97 L;  5J1E A;  4L3Q A;  2WFB A;  2HBL A;  4CIE A;  1M90 O;  2E5L K;  2YNF A;  4F8R A;  4CD3 A;  4C8L A;  4DSF A;  1HYS A;  3QLH A;  4X62 K;  4JEP A;  1GOC A;  3WNH A;  1DEJ A;  4OX9 K;  4BWM A;  3AVK A;  3G10 A;  2QTD A;  3OYB A;  1VSD A;  3L2V A;  1GLD G;  3RVC A;  3A8Y A;  3Q7B A;  3WQU A;  1T8E A;  2HHH K;  4K0K K;  2HND A;  3EZ5 A;  1S22 A;  4A61 A;  3I0R A;  4FM2 A;  1M1K O;  1HNZ K;  4DUY K;  3CCS N;  3E9O A;  1U4B A;  3S3N A;  4E7L A;  4FPB A;  1NGI A;  1NGE A;  1WUA A;  5KPT A;  5F0X A;  4KKO A;  3H1V X;  1NGC A;  2IS3 A;  3DLR A;  4BVO A;  4FJM A;  2GV9 A;  4M3T A;  4CGD A;  3M8P A;  5AQF A;  1RT5 A;  3WNF A;  2NRH A;  4W5T A;  2XY6 A;  2O8D B;  1IO2 A;  3LZI A;  3THX B;  3QBW A;  2O8C A;  5AQJ A;  3L3V A;  1REV A;  5FLX O;  3AAQ A;  5KQD A;  4HTL A;  3HVT A;  3O3G A;  3AGK A;  3SNN A;  5KPZ A;  3DOL A;  2V52 B;  4DQI A;  3SAG A;  1SL0 A;  2YNH A;  4JI7 K;  3EYZ A;  3NF9 A;  3DLK A;  3VQ7 A;  5EU7 A;  3LDP A;  1VQK N;  3LDN A;  3HBT A;  1BCM A;  2IOC A;  4FWM A;  2GEL A;  4H0V B;  1OH8 A;  4JLH A;  3O9S A;  4CHY A;  2JWL A;  3NBP A;  1B9F A;  3SQ1 A;  3K57 A;  4E1N A;  4FK2 A;  2P5O A;  1S6Q A;  4B3R K;  3ATU A;  1QZ5 A;  4CJU A;  4E19 A;  3VEO A;  3TAG A;  4PA1 A;  2FXU A;  4ELV A;  1A5W A;  3QIN A;  4Z94 A;  4DFJ A;  1J9A A;  1IH7 A;  4O5B A;  5CYM A;  4BRO A;  4E0D A;  1S9G A;  4KI4 A;  4FZY A;  3AO2 A;  1LWE A;  4DG1 A;  1T6C A;  4LF5 K;  1RT2 A;  4JKD A;  4PKG A;  4DV2 K;  3C6H A;  3AV9 A;  4CFB A;  1Q9Y A; 
#chains in the Genus database with same CATH homology
 3AVN A;  1J53 A;  5E41 A;  3QO9 A;  1SL1 A;  1U49 A;  4LY7 A;  3SQ4 A;  4CEQ A;  4FJK A;  2WOM A;  2YV0 X;  4HHT A;  3HK2 A;  4CJP A;  1SKW A;  1VSJ A;  3OS2 A;  4QCL A;  3U6F A;  1JLE A;  1S6P A;  4M3Z A;  2IDO A;  1NKC A;  1J5O A;  3ZSR A;  4JRP A;  4CJQ A;  4FJI A;  2G8I A;  1R0A A;  1HYZ A;  3WNE A;  2HHX A;  2KZM A;  4IFV A;  4ID1 A;  4OKJ A;  3VQB A;  1TK0 A;  3AO3 A;  4AHT A;  4JS4 A;  4KHS A;  4AH9 A;  3G0Z A;  2KFZ A;  2O4I A;  2B5J A;  3AA3 A;  4CJV A;  4YFU A;  4NYN A;  1NJW A;  4CJS A;  4FJG A;  4FXD A;  2HNZ A;  4FJJ A;  2D0C A;  4KHN A;  1EET A;  1QSS A;  1VSI A;  4DSI A;  3OYE A;  3SV4 A;  4CHP A;  3LPT A;  3ZT1 A;  1C1C A;  3QNN A;  1C6V A;  2YKM A;  1HPZ A;  1S1U A;  1ZYQ A;  3VQ8 A;  1U48 A;  1KVB A;  2P51 A;  4M3R A;  5HP1 A;  4IKF A;  2YKN A;  3AO5 A;  1LWC A;  3AVL A;  3F73 A;  1NKE A;  4NCB A;  3ISN C;  1WAF A;  3OYF A;  5DK5 A;  4JRQ A;  2RN2 A;  3AA5 X;  1FXX A;  1SV5 A;  4FM1 A;  3S3O A;  3SV3 A;  4DTN A;  5J2Q A;  3SPZ A;  5HLF A;  5KGX A;  3IG1 A;  1TAQ A;  3BGR A;  2QXF A;  3QER A;  3SUO A;  4DF8 A;  3QEP A;  1O1W A;  2G8W A;  4HUE A;  5KRT A;  2R7Y A;  2ATQ A;  4QOZ B;  3P1G A;  3K5L A;  1S1T A;  1X1P A;  2D0A A;  3NGZ A;  1KLM A;  4DTR A;  1L5U A;  4EP5 A;  4IDK A;  1BQM A;  4CED A;  1QHT A;  3CFP A;  2G8F A;  4RG8 A;  4I9L A;  3OYJ A;  4N47 A;  4CJW A;  3AO1 A;  3KJV A;  4CEA A;  1BI4 A;  4FLV A;  1UWB A;  4DQS A;  4B8A B;  4CEE A;  1KVC A;  5I3U A;  5I42 A;  2AJQ A;  3VA0 A;  1RTH A;  1QE1 A;  1EXQ A;  3HO1 A;  3SQ2 A;  3NF8 A;  2FBY A;  2YNG A;  4BAC A;  4CFA A;  4DF4 A;  4RW7 A;  3LP2 A;  4FJH A;  3AVG A;  3DRP A;  4DQR A;  4DTS A;  2Y1J A;  2NUB A;  1RTJ A;  4CER A;  4Z4E A;  4BDZ A;  1IKX A;  3HP6 A;  2Z1J A;  4W5N A;  2E4L A;  2PY5 A;  3DLH A;  3TAE A;  1WSG A;  4AHV A;  2ZD1 A;  2Z1I A;  5HRN A;  1XI1 A;  4Z4F A;  1G15 A;  3V1O A;  3WNG A;  3O4N A;  4CK2 A;  4BDP A;  4DQQ A;  1RCH A;  3CFR A;  1XWL A;  3DRS A;  4N41 A;  4CEF A;  5HRO A;  3TAN A;  3LP0 A;  3SPY A;  1X9W A;  1NK6 A;  4IBN A;  2W42 A;  3OYH A;  4OLA A;  1VSK A;  2OZM A;  4LSN A;  3V9X A;  3OYD A;  4HCC A;  4PY5 A;  3B6P A;  5C24 A;  4FZZ A;  3OS0 A;  2XRI A;  4CEZ A;  3K5O A;  1UA0 A;  3NH2 A;  1SKS A;  1HQE A;  3MEG A;  3LAM A;  4NCG A;  3OYA A;  1JLC A;  3SUP A;  3RRH A;  1L3T A;  4DTP A;  1VSL A;  1YT3 A;  3ZCM A;  4CF9 A;  3V9S A;  1WLJ A;  1VSM A;  4H4O A;  3M8S A;  4ZTJ A;  4C8N A;  4DFK A;  5C42 A;  1TK8 A;  1Q8I A;  1TVR A;  1Z25 A;  1JL2 A;  4PQU A;  4CGF A;  2HHU A;  1HMV A;  1S1V A;  3RWU A;  3IAY A;  4O0I A;  1Q9X A;  4CJK A;  4Q5V A;  2EHG A;  3MXI A;  1NK8 A;  1KRP A;  1N5Y A;  4GW6 A;  4CHO A;  5K14 A;  3JYT A;  1BIZ A;  3V1R A;  4CEO A;  3OYC A;  3U3G A;  3MAQ A;  1RDA A;  4KRE A;  1SUQ A;  3NGY A;  1JLA A;  2IGI A;  2Q3S A;  4C8K A;  5HRR A;  4OVL A;  1QSL A;  2FC0 A;  4DQP A;  1N6Q A;  4OJR A;  3LP1 A;  2A1S A;  4Y1C A;  1Z26 A;  3VA3 A;  3MED A;  4ZHR A;  4FLW A;  3RR8 A;  1WSJ A;  5KGW A;  4CJL A;  4CES A;  1KCF A;  2P5G A;  4CF2 A;  1MU2 A;  5FDL A;  1RBV A;  3QIP A;  4Z4H A;  1U45 A;  1YVU A;  1DTQ A;  4FK0 A;  1CXU A;  1CZ9 A;  5SZT A;  2HW3 A;  3KIO A;  3QES A;  1ASV A;  1GOB A;  3HM9 A;  1W0H A;  4KFB A;  5CZ1 A;  2F96 A;  3QIO A;  4YNQ A;  2DFF A;  3KLI A;  3CFO A;  5T7B A;  3DLE A;  4FK4 A;  3HPH A;  4HUG A;  4KO0 A;  1RT3 A;  3LWL A;  4KHU A;  3V9U A;  3RTV A;  1BIS A;  4KTW A;  3OJU A;  3OYM A;  2BAN A;  3LZJ A;  3RMD A;  3AVH A;  1S1W A;  4CJ5 A;  4NCA A;  2VG6 A;  4CJE A;  3B6O A;  4E1M A;  4DTO A;  1VRT A;  3VQE A;  4G1Q A;  4PUO A;  4CGI A;  1KVA A;  3TAM A;  3AVF A;  4AHU A;  2E6L A;  2GUI A;  3S3M A;  1QS4 A;  1TV6 A;  1T7P A;  4ICL A;  3V9Z A;  3C6T A;  4B8C A;  1RT4 A;  4CF1 A;  2BGG A;  3M8Q A;  3MXM A;  4FJ8 A;  2HHT A;  2ITG A;  3FFI A;  1DTT A;  4M41 A;  3PX6 A;  2EX3 A;  1JLG A;  3LPU A;  1C0T A;  1BGX T;  1KTQ A;  1NJY A;  1NK4 A;  5JS1 A;  1NK7 A;  3K5N A;  1VSH A;  3C94 A;  3V1Q A;  4GVM A;  4DSJ A;  3PO4 A;  2QK9 A;  4RW8 A;  3AVB A;  3CM6 A;  3DLG A;  4CHQ A;  3F9K A;  5KRS A;  3KD1 E;  4ELT A;  3LDS A;  2X74 A;  3AA2 A;  3HL8 A;  4IG3 A;  3UIQ A;  4B9U A;  3OYK A;  2E6M A;  4CEB A;  3AVI A;  4M3W A;  5J2M A;  1U04 A;  4E7K A;  1RBU A;  3LAK A;  4CFD A;  2A1R A;  4KB0 A;  5FRN A;  4AHS A;  3DLB A;  3NH0 A;  4FLT A;  2JLE A;  1WAJ A;  4MFB A;  3O3H A;  4LH4 A;  2QKK A;  1TL1 A;  4I9Q A;  1XHZ A;  1BHL A;  1WN7 A;  1VSF A;  4B9L A;  1K6Y A;  4DSE A;  1VRU A;  1D9D A;  4BWJ A;  3T1A A;  4FLZ A;  4DS4 A;  1C1B A;  3VN5 A;  2ZE2 A;  4KV8 A;  4DLE A;  1BIU A;  1EX4 A;  1WNS A;  1JLF A;  4DSL A;  4CGJ A;  1S9E A;  2PZS A;  1GOA A;  3HPO A;  3LAL A;  3KLE A;  2OA8 A;  4O0J A;  1YTA A;  3KK3 A;  4Y1D A;  1L3S A;  2FBX A;  2G8K A;  4F3T A;  3DOK A;  1C0U A;  1HQU A;  2GBZ A;  1HNV A;  1RDC A;  5FRM A;  4E7I A;  2XY5 A;  3TAP A;  3ZSZ A;  2HHW A;  1D5A A;  2B6A A;  1TAU A;  4O55 A;  4WE1 A;  3ITH A;  3OYN A;  2P1J A;  1KLN A;  5J2P A;  4CF0 A;  3LAN A;  4RW4 A;  1WSF A;  3CQ8 A;  3L2Q A;  4O44 A;  2HVH A;  4FYD A;  5CYQ A;  1S5J A;  3ZSO A;  3DMJ A;  4BE2 A;  1EP4 A;  3PV8 A;  3VQD A;  1UA1 A;  1KFS A;  4GMJ B;  1T03 A;  3I8D A;  4DFP A;  1ZBF A;  4UQG A;  4M3Y A;  4CJT A;  1I3A A;  3KLF A;  3AA4 A;  3M8R A;  1IG9 A;  4CJ4 A;  2OZS A;  1NOY A;  4FJX A;  2RPI A;  3L3U A;  3KK1 A;  3NAE A;  4DS5 A;  4KAZ A;  3T19 A;  3ZSW A;  4DWI A;  1FK9 A;  4I7F A;  3RMA A;  1KFD A;  1DLO A;  2KQ2 A;  3ZSV A;  5J2N A;  3NF7 A;  3ZT2 A;  4F4K A;  4KHY A;  1RBT A;  2X6N A;  1BCO A;  4EZ9 A;  4ZTF A;  4KI6 A;  3KK2 A;  4DU4 A;  1RT7 A;  2DTU A;  3TWH A;  4OLB A;  4KTQ A;  4C8M A;  3V9W A;  4KHW A;  1EKE A;  2OPS A;  4CIF A;  1RT1 A;  2XO7 A;  1JLQ A;  1BQN A;  1IKV A;  1LW0 A;  3VQ6 A;  2FBV A;  3MEC A;  1ITG A;  1ZBH A;  2I5J A;  3SUQ A;  3AVC A;  3D45 A;  1RNH A;  3KKS A;  3TAF A;  3RMC A;  2OYQ A;  3VQ9 A;  4FVM A;  1S1X A;  3NH1 A;  4KHQ A;  3NFA A;  1BI4 B;  4CJF A;  2HHV A;  4B9M A;  2BE2 A;  1C1A A;  4CGG A;  4KB1 A;  3HJF A;  3OVN A;  3U3Y A;  1RDB A;  4EZ6 A;  3C95 A;  3OYI A;  4FLU A;  4FJ9 A;  4J2B A;  2DFH A;  4EP4 A;  1JXB A;  5C25 A;  2D5R A;  4B9N A;  1WSH A;  1CZB A;  4NYF A;  3L8B A;  4L8R B;  4CGH A;  3CM5 A;  1L3V A;  4DTM A;  1ZBL A;  4LD0 A;  1J54 A;  2FBT A;  3ZT4 A;  4H8K A;  3SJJ A;  3VQ5 A;  1JKH A;  2G8H A;  4BE1 A;  4Z4I A;  3LWM A;  3AVM A;  1IKW A;  1Y97 A;  2VWK A;  3SUN A;  2HNY A;  3HT3 A;  4CK1 A;  1D9F A;  3DI6 A;  4CJ3 A;  4I2P A;  4TSX A;  4E89 A;  4DMN A;  3K2P A;  4K8X A;  4CFC A;  3NHG A;  3OJS A;  1QSY A;  4HCB A;  3SYZ A;  2B4J A;  4N76 A;  1C0M A;  4Z0U A;  3RR7 A;  4B3O A;  3DYA A;  3CG7 A;  3L2U A;  1XHX A;  3TI0 A;  4F3O A;  3D0P A;  1NKB A;  1NJZ A;  2HMI A;  1A5X A;  3T3F A;  2KW4 A;  4CHZ A;  1CXQ A;  2Y1I A;  1RTI A;  1XC9 A;  2G8U A;  3PX4 A;  2QKB A;  4DU1 A;  4N56 A;  1RDD A;  1NK0 A;  4CHN A;  1IKY A;  2Z1H A;  3ASM A;  1RBR A;  2VWJ A;  3L2R A;  3PO5 A;  1RT6 A;  3HYF A;  2HHS A;  4C8O A;  5FRO A;  3PX0 A;  4XIU A;  4KTZ A;  3KLH A;  5SWM A;  4J2A A;  3AVJ A;  3HPG A;  3P83 D;  2VG7 A;  4FW1 A;  1W9H A;  1JL1 A;  3MEE A;  3VQA A;  3ZSX A;  4E7H A;  1RBS A;  3IS9 A;  3TR8 A;  3ZSQ A;  3QEX A;  3ZSY A;  1UAX A;  4M3X A;  2ETJ A;  4CJR A;  2KFN A;  4B9T A;  3DM2 A;  4FLY A;  4RW6 A;  3O3F A;  3P5J A;  1JLB A;  1I39 A;  3KKR A;  3NGI A;  2OPP A;  3H08 A;  5CZ2 A;  1CLQ A;  1ZBI A;  2IC3 A;  1BL3 A;  4OGE A;  1RTD A;  3SZ2 A;  2BDP A;  4J2E A;  3LP3 A;  4IFY A;  2OPQ A;  3RRG A;  4OGC A;  2KZZ A;  3QEV A;  3QEW A;  4CK3 A;  3KD5 E;  1SKR A;  2X78 A;  3NCI A;  2JGU A;  1FKP A;  2RKI A;  3JSM A;  5J1E A;  5DMR A;  4CIE A;  3SCX A;  1KSP A;  1NK9 A;  2YNF A;  3HST B;  3HP9 A;  1TL3 A;  4IG0 A;  1LV5 A;  4F8R A;  4C8L A;  4DSF A;  1HYS A;  1NOZ A;  1LAW A;  3QLH A;  4AHR A;  3V6D A;  1WSE A;  4M45 A;  1GOC A;  3WNH A;  3AO4 A;  3S9H A;  4PWD A;  1FKO A;  1A5V A;  2D0B A;  3AVK A;  3G10 A;  3O4Q A;  4BWM A;  4W5Q A;  3OYB A;  1TKZ A;  1WSI A;  1VSD A;  3V4I A;  1TK5 A;  4QAG A;  4F2R A;  4DU3 A;  3L2V A;  4M3U A;  1LW2 A;  3NDK A;  1U47 A;  1NJX A;  4K8Z A;  4LH5 A;  1T8E A;  2DY4 A;  3SQ0 A;  2HND A;  3EZ5 A;  4F2S A;  1NK5 A;  4LSL A;  4B9V A;  3K59 A;  2PYL A;  2KTQ A;  3MXJ A;  2ZQB A;  1ZBU A;  3I0R A;  4FM2 A;  4E7J A;  2DFE A;  4RW9 A;  1LWF A;  1TKT A;  1U4B A;  3S3N A;  4FLX A;  2PYJ A;  4E7L A;  2YNI A;  1QQC A;  1RIL A;  4DSK A;  2XY8 A;  3ALY A;  4KKO A;  3QET A;  1T05 A;  1HRH A;  2IS3 A;  3DLR A;  3ZT3 A;  1QTM A;  2XHB A;  1D8Y A;  4FJM A;  2GV9 A;  4OKK A;  4DLG A;  4M3T A;  4Z4G A;  5HRS A;  4CGD A;  3M8P A;  4BDY A;  4JS5 A;  1RT5 A;  4AIL C;  3WNF A;  1ASW A;  4OKE A;  4OPJ A;  4W5T A;  4DFM A;  5HBM A;  3HXM A;  2VG5 A;  2XY6 A;  4KPY A;  1IO2 A;  5JS2 A;  3LZI A;  4FM0 A;  1LAV A;  4DTX A;  1JXE A;  2X6S A;  4AHC A;  3L3V A;  1REV A;  3V81 A;  4B9S A;  2HHQ A;  4FJN A;  1TGO A;  3HVT A;  3O3G A;  4HTU A;  3EY1 A;  2OPR A;  3AVA A;  3SNN A;  4FZX C;  3DOL A;  5KI6 A;  3E01 A;  3HVR A;  3K58 A;  1VK0 A;  4DQI A;  2WON A;  3I0S A;  1UOC A;  2YNH A;  4ID5 A;  1SL0 A;  1F21 A;  3EYZ A;  1VSE A;  3NF9 A;  4E3S A;  1L3U A;  4W5R A;  3DLK A;  3VQ7 A;  5HRP A;  3IRX A;  5EU7 A;  2XY7 A;  3BDP A;  1YTU A;  1SL2 A;  3VQQ A;  5KTQ A;  4FJ7 A;  3TAQ A;  5D3G A;  4DTJ A;  4Q0B A;  2HVI A;  1B92 A;  2YHB A;  4N5S A;  1BCM A;  3ZT0 A;  2Z1G A;  4J2D A;  3THV A;  2IOC A;  2RF2 A;  3QNO A;  3TAB A;  2LSN A;  2O4G A;  4R5P A;  4H4M A;  4JLH A;  4CE9 A;  4CHY A;  4CCH A;  3KTQ A;  4FCY A;  1HNI A;  3CYM A;  1B9F A;  3NBP A;  4CIG A;  4E1N A;  3K57 A;  3SQ1 A;  3PY8 A;  4FK2 A;  2F8S A;  1X9S A;  2P5O A;  1S6Q A;  2F8T A;  4OPK A;  3OYL A;  4CJU A;  1HJR A;  4O4G A;  4FJL A;  3TAR A;  4CEC A;  4E19 A;  3L2W A;  1TKX A;  3TAG A;  4PA1 A;  4I2Q A;  3VQP A;  3QEI A;  1X9M A;  3NE6 A;  4FW2 A;  4ELV A;  2IAJ A;  3C6U A;  5CY4 A;  4B08 A;  4BE0 A;  3SI6 A;  1A5W A;  3OYG A;  3OS1 A;  3QIN A;  4ELU A;  4DFJ A;  4KRF A;  3PUF A;  1J9A A;  4Z4C A;  1IH7 A;  3RMB A;  3K5M A;  4O5B A;  5CYM A;  3VQC A;  2YHA A;  3A2F A;  4W5O A;  3OY9 A;  2G8V A;  4E0D A;  1S9G A;  4DTU A;  4KI4 A;  3DRR A;  4HUF A;  3AO2 A;  1LWE A;  4DG1 A;  1B9D A;  4FZY A;  4M42 A;  3VQ4 A;  1RT2 A;  3NF6 A;  1HYV A;  4CF8 A;  3KLG A;  1ASU A;  1TKD A;  2HB5 A;  4HVJ A;  3ULD A;  4MQ3 A;  3AV9 A;  4CFB A;  1Q9Y A;  4FJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...