4CK2A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
154
structure length
150
Chain Sequence
b'SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 56
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ck2A00
2VWJA 3QO9A 4DS5A 1BL3A 4NYNA 3S3OA 3AO5A 2OPSA 3K5LA 4HHTA 1KFSA 4FJMA 1TL1A 1S9GA 3IG1A 2HNYA 3ZSWA 3HO1A 5KRTA 3IS9A 3CFRA 3AVGA 1NK6A 1KFDA 4AHTA 4E7HA 1TKDA 3HVRA 4KREA 3ZSQA 3V9UA 1X9SA 4J2BA 4IFYA 4Z4FA 4TSXA 3L3UA 3D0PA 4G1QA 4DF4A 4Z4HA 4LY7A 1ASVA 4DQQA 1NK9A 2Z1GA 1B92A 1GOCA 5HBMA 3NAEA 1A5XA 3OS0A 3AVKA 3SV4A 4DFKA 1L3UA 4KI4A 3RR8A 3ZT3A 1F21A 4CHNA 1RDAA 3VA0A 3G10A 3LWMA 1J54A 1RT5A 1B9FA 3RRGA 1N6QA 3SPZA 1WNSA 3OYAA 1DTQA 1U47A 5KI6A 3MAQA 4E7IA 1BISA 4NCAA 2F96A 1UA1A 5JS1A 1SL0A 1I3AA 3AA3A 2FBTA 2VG5A 1J9AA 1ITGA 5J2MA 1LV5A 2HMIA 4B9LA 2P1JA 4FJKA 4B3OA 3TAPA 4FJ7A 3NGYA 1WSFA 3KK1A 3AO1A 1T05A 1RTDA 2YHBA 3WNGA 3ZSRA 2XO7A 1VK0A 4KHUA 1SKWA 1QQCA 5HRSA 2F8TA 3OJUA 4MFBA 4C8MA 4DQPA 3AA5X 3AA4A 1IO2A 2EHGA 5K14A 3VQ6A 3ZT4A 5HROA 2LSNA 4F2SA 4Z4IA 3PX4A 4DTJA 3ITHA 3V1QA 4CIFA 1ASWA 1RTIA 2XY7A 4FLXA 3SV3A 4B9SA 4B9MA 1NK0A 3QEVA 1GOBA 1NJZA 3HXMA 4FJXA 5C25A 3NH2A 3U6FA 4DMNA 1BI4A 1RBUA 3LAKA 4FJ8A 3L2UA 1DLOA 3T1AA 4NCBA 4WE1A 2D0AA 4LD0A 4KB0A 2NUBA 3OJSA 2DFEA 2B4JA 1U4BA 3HK2A 4CFCA 1CLQA 2G8HA 1KCFA 3U3YA 3I0SA 4FYDA 2XY8A 1HNVA 5SZTA 3V81A 3QIOA 4CEOA 4CF2A 1RTJA 3SPYA 4CECA 4OLAA 3OYMA 3V6DA 4W5QA 4M3ZA 4FM0A 1VSKA 3KIOA 1SL2A 2X78A 1HRHA 3RR7A 2Z1HA 4W5NA 1FKPA 2QXFA 1EXQA 4H4OA 3OYHA 2XY6A 4CJEA 3SI6A 3IRXA 3FFIA 1QE1A 4BACA 3AO4A 4KB1A 2YNIA 4GVMA 4IBNA 3KK2A 3QERA 1NJXA 4B9VA 1TAUA 3MECA 5I42A 4N5SA 4DQSA 1XWLA 1T7PA 4JRQA 1RT2A 3DRSA 4ELVA 4KV8A 4IKFA 1HYSA 3LDSA 4FZZA 1KTQA 2HHUA 2OPPA 4I9QA 3F9KA 1IKWA 4W5RA 3M8PA 5CYQA 1G15A 2FC0A 3AVJA 4AHVA 3LANA 4I9LA 4M42A 2D0CA 2OPQA 2O4IA 1TKXA 2IAJA 2RF2A 4CEAA 4CGJA 3HT3A 3OS1A 4ELUA 1CXQA 3QETA 2E6MA 3LZIA 4FJGA 4CEDA 4FJIA 5DK5A 1S5JA 1Y97A 3KTQA 1N5YA 1EKEA 3WNEA 3RRHA 1RCHA 1CZBA 3OYIA 1W0HA 3LWLA 1KRPA 3BGRA 1ZYQA 1JLGA 4LH5A 3VQ5A 2WONA 4DSFA 3LAMA 5FRNA 3VQPA 1VSHA 3DLGA 1RNHA 3QESA 3ULDA 1IH7A 3K5OA 3HM9A 3K5MA 2HHTA 3OS2A 4N47A 2KZZA 1RILA 3ASMA 2QKBA 3ISNC 1C0TA 1BQNA 2RN2A 3NE6A 4GMJB 4CF8A 1C1AA 4KTWA 5CZ1A 1QHTA 4CHQA 4DLEA 1D9FA 3WNHA 3HSTB 4DTPA 4F3TA 3AVHA 3SUPA 4BE2A 1BCMA 3LPTA 1ASUA 5CZ2A 3VQDA 3L3VA 3LP3A 3V9XA 1HMVA 3C94A 1WSHA 4DS4A 3SUQA 1RBVA 3HJFA 1RDBA 3LP0A 3VQ8A 3WNFA 2OYQA 3KLIA 4NCGA 1EX4A 2YNFA 1L3TA 4N76A 2Z1JA 3K59A 1T8EA 4DTSA 1X1PA 4OVLA 3TI0A 2B6AA 1HQUA 1VSEA 1TKZA 1RT1A 2IGIA 2JGUA 4CJPA 4Q5VA 5FDLA 2DFHA 1VSDA 3OYBA 2A1RA 4B9UA 2VG6A 1D8YA 4FJNA 3HYFA 4AHUA 4DSEA 3DYAA 4KO0A 1RBTA 2GV9A 1K6YA 3MEDA 3NFAA 4L8RB 2IOCA 3CG7A 3NBPA 4EP4A 4O0JA 1HNIA 2KZMA 4I2QA 1GOAA 4O4GA 3DM2A 4Y1CA 2B5JA 1HYVA 2ZE2A 3V9SA 1JLBA 1JLAA 5SWMA 1BIZA 1Z26A 4B08A 4W5TA 3EYZA 5T7BA 3T3FA 3CM6A 1HYZA 3VQEA 4CJRA 3SZ2A 1Q9YA 3HVTA 3ZSOA 4E0DA 2HHXA 4CHPA 1QS4A 3NGIA 4HTUA 1IG9A 1S1TA 3TANA 4PA1A 4BDPA 1EETA 4DTMA 1BI4B 2X6SA 3H08A 4ZTJA 5HLFA 1TK8A 4IG3A 4E7KA 2BGGA 2D0BA 2W42A 2FBXA 4IDKA 3ZT2A 1NK8A 4CJKA 1KVBA 1LWFA 3KD1E 1U04A 4QOZB 2KW4A 4JS5A 2OZSA 2IDOA 1HPZA 1UWBA 3ZSVA 1KVCA 3LP2A 4N56A 3K57A 1RBRA 5C24A 2XRIA 1VSMA 3K5NA 4JS4A 2G8KA 4M3WA 2ZQBA 3DLEA 4CJ5A 4RW9A 1BGXT 1DTTA 4E89A 4FK4A 1TL3A 1UOCA 4CEEA 4ZTFA 4M3XA 4M41A 4RW4A 4HVJA 2RPIA 4DFPA 1RT7A 2OZMA 1C1CA 4M3YA 4MQ3A 3MXMA 2ZD1A 4PQUA 4YFUA 3U3GA 2XHBA 2HVHA 1UAXA 1REVA 3VA3A 4CJWA 1NKEA 2IS3A 1BCOA 1WSGA 2A1SA 4AHCA 3VQCA 3B6OA 1B9DA 1X9MA 4CHYA 4CGHA 4RW8A 4M3RA 2HB5A 3P83D 3L2WA 1U48A 4IFVA 5JS2A 4CJLA 4FLTA 1J5OA 4DSJA 4CFAA 1TAQA 2YKNA 3NF8A 5KGWA 4N41A 3NCIA 3CFOA 5KRSA 1MU2A 3DLRA 4E7JA 4OPJA 1A5WA 1EP4A 1HJRA 4CFBA 2PYLA 1FK9A 2X6NA 4CJFA 3HPHA 1W9HA 4E3SA 1CZ9A 5E41A 2FBVA 3SNNA 3OYLA 1WAFA 1X9WA 1RT6A 3VQ9A 3EY1A 4BDYA 1IKXA 3RMDA 1VSIA 2Z1IA 3AVBA 2JLEA 4DG1A 4CF0A 4DU3A 4KI6A 2HHSA 3HPGA 4CK3A 4FW2A 3KLGA 4DTRA 3LPUA 5FRMA 1WSEA 3NHGA 4QCLA 4FVMA 4CIEA 1KVAA 4AHRA 4DQRA 4E7LA 1NKBA 4M3TA 2Q3SA 4F8RA 4CJQA 3NF7A 3O3FA 3RMCA 4C8OA 2HHQA 1ZBHA 3ZSYA 4CGFA 1NJYA 1S9EA 3B6PA 1S6QA 1LW2A 2GBZA 2IC3A 1WSJA 3ALYA 3DRRA 2P51A 4ID1A 3VN5A 4HUEA 1NK4A 4CEFA 3CQ8A 2QK9A 4FCYA 4YNQA 4LH4A 1VSLA 4ELTA 3NF6A 3HP9A 4KHWA 4H8KA 4CJVA 4FJHA 3VQ4A 3OYCA 1LW0A 4OKJA 5HRNA 1O1WA 3CYMA 3JSMA 1WAJA 1XHZA 3QINA 4RW6A 4EP5A 3SUNA 4DSKA 3S3NA 1SV5A 1ZBLA 4K8XA 2AJQA 4CHOA 3VQAA 4B9NA 3NF9A 2PZSA 3KD5E 5C42A 4CJSA 1KSPA 2VG7A 4KHSA 3SQ2A 4CFDA 4DSIA 2DFFA 4FLZA 4FLUA 3PO5A 1NJWA 1C0UA 2P5GA 4HCBA 4OLBA 4FJ9A 4HCCA 3O4NA 2KTQA 2KFZA 3P5JA 3QEIA 2KQ2A 1TK5A 4Z4CA 3V1RA 3V9ZA 1QTMA 4M3UA 3SUOA 3V1OA 1S6PA 3OYDA 1YT3A 3KLFA 4FM2A 1JKHA 3KLHA 5J2NA 3LZJA 5I3UA 2WOMA 5HRPA 3PO4A 3AVLA 4DQIA 4OJRA 4Z4EA 3L8BA 3QIPA 2HW3A 4RG8A 3MXIA 2G8IA 4O5BA 1S1UA 1TGOA 3I0RA 5J1EA 2Y1JA 3SQ0A 4FJ5A 2EX3A 1Q8IA 3AVAA 3HL8A 3TAMA 3LP1A 3OYEA 3I8DA 3OY9A 3KLEA 3SCXA 3AV9A 1YTUA 4FXDA 1UA0A 3SQ1A 4C8KA 4CE9A 5J2PA 3SYZA 2P5OA 3T19A 1ZBIA 3ZSXA 1KLMA 4E1MA 4Y1DA 2F8SA 1ZBFA 1L3SA 3L2RA 4CIGA 3RWUA 3AVFA 4CK2A 2DY4A 1XC9A 3QNOA 2YNGA 4OKEA 3QEWA 4DLGA 4KTZA 4O0IA 4FLWA 3OYJA 4CF9A 3OYNA 1IKVA 1XHXA 3AVMA 3C95A 2R7YA 3TARA 2G8UA 1LAVA 3O3HA 1IKYA 4CHZA 1VRUA 3TWHA 4OKKA 4KHNA 1LWCA 3L2VA 4KFBA 1JLFA 5HRRA 4FK0A 1YVUA 4ID5A 1J53A 4ZHRA 3PV8A 3THVA 1RTHA 2BDPA 1WN7A 3V4IA 4DSLA 2YV0X 4HUGA 5CYMA 2E4LA 4GW6A 2FBYA 3K58A 1RT3A 4B8CA 5FROA 3PX6A 2GUIA 3AO2A 4DU1A 1JL1A 3EZ5A 4KTQA 4CERA 1LWEA 1BHLA 1XI1A 1NK7A 3PUFA 3OVNA 2QKKA 1YTAA 4CESA 1SKRA 1Q9XA 1SUQA 4B8AB 4LSNA 3TAGA 2DTUA 4Z4GA 3KJVA 1L3VA 4CJ4A 4C8NA 4Z0UA 4J2EA 3OYGA 4CEBA 3S3MA 3M8QA 1JXBA 5HP1A 3PX0A 3AVNA 1D5AA 4DTNA 1D9DA 1R0AA 3KKSA 4OGCA 4BWMA 3TAQA 3DOLA 4FZXC 1TV6A 2RKIA 2YKMA 3TAFA 4CEQA 3OYFA 3DMJA 3S9HA 3O3GA 4DTUA 3DI6A 1RDDA 3ZT1A 1JL2A 4AHSA 3VQBA 4FZYA 2KFNA 4CJUA 3NH0A 4DFMA 2ITGA 4DTOA 2I5JA 3RMBA 3BDPA 2HHWA 1NKCA 4H4MA 4XIUA 4W5OA 5J2QA 2PY5A 4DTXA 2PYJA 2BE2A 2E6LA 4I7FA 4CGIA 3SJJA 1U45A 5KTQA 3P1GA 4E1NA 4AILC 4ICLA 4FK2A 1VSFA 2ETJA 1QSYA 2D5RA 4EZ6A 4CGDA 3D45A 4BE1A 4BDZA 5D3GA 3DLBA 4PWDA 4LSLA 4DF8A 4CCHA 4EZ9A 4M45A 3ZCMA 4CK1A 4UQGA 3O4QA 4PUOA 4FM1A 1JLQA 3M8RA 4I2PA 1SKSA 3UIQA 1I39A 4O44A 4OGEA 4FW1A 4KRFA 3MXJA 3DRPA 3MEGA 3VQQA 5KGXA 4PY5A 2HNZA 3HPOA 3CFPA 3QNNA 3QEXA 1TVRA 4K8ZA 3F73A 3A2FA 1Z25A 3LALA 3G0ZA 3TABA 4DWIA 1HQEA 3DOKA 4J2DA 4F4KA 1TK0A 3NGZA 2G8WA 1C0MA 4C8LA 1RBSA 4F2RA 1NOZA 1S1WA 1NK5A 3RTVA 1RT4A 4R5PA 3K2PA 3L2QA 4DU4A 1TKTA 4BWJA 1T03A 1U49A 4J2AA 4RW7A 1QSSA 1JLCA 4IG0A 2VWKA 1WLJA 4AH9A 4B9TA 3KKRA 1FKOA 1NOYA 4KAZA 3C6UA 3AA2A 5CY4A 3IAYA 4CJTA 1JLEA 1JXEA 3C6TA 3KK3A 4NYFA 4JRPA 1WSIA 1QSLA 3QLHA 1VSJA 3VQ7A 2XY5A 2HHVA 4HUFA 2BANA 3PY8A 4BE0A 4DFJA 3DLHA 2G8FA 1LAWA 3AO3A 3E01A 3MEEA 3ZSZA 4KHQA 2HVIA 4Q0BA 3ZT0A 1RDCA 4CGGA 4FJJA 2YHAA 4CJ3A 3HP6A 3OYKA 3NDKA 2ATQA 4F3OA 1BQMA 1BIUA 2HNDA 2YNHA 3DLKA 1S1XA 4FLVA 4O55A 2G8VA 4FJLA 3V9WA 3SQ4A 5DMRA 2OPRA 3JYTA 1CXUA 3TR8A 1FXXA 4E19A 4KKOA 5EU7A 1VRTA 1SL1A 1L5UA 3AVCA 4JLHA 4QAGA 3QEPA 4CF1A 2X74A 3RMAA 1C1BA 1ZBUA 1A5VA 1C6VA 3AVIA 3TAEA 4KHYA 2Y1IA 1S1VA 3NH1A 3M8SA 2O4GA 2OA8A 1KLNA 3CM5A 4FLYA 4KPYA 4CEZA 4OPKA
chains in the Genus database with same CATH superfamily
3PSFA 3QO9A 2CH6A 2E2QA 2OPSA 3FZLA 5F0XA 3K5LA 4HHTA 1KFSA 5AQZA 3EL2A 1S22A 2I7NA 2HMPA 3CMEN 4BR2A 3D0PA 3DXMA 3M1FA 4DF4A 1NK9A 5HBMA 1A5XA 3RR8A 2Q0UA 1WNSA 4IEIA 4DUZK 2E8AA 3SJHA 5KI6A 4NCAA 1UA1A 3CJCA 5JS1A 3AA3A 1X3NA 4MO4A 3GG4A 5J2MA 2HMIA 4FJKA 3VTIA 4B3OA 3CJAA 2OTLN 1HNZK 1WSFA 3F9MA 2YHBA 4KHUA 4JKBA 2GX9A 4H0VB 4C8MA 1M1KO 4X66K 4YORA 3AA5X 3AA4A 2JWKA 4H0YB 3I33A 5K14A 3ZETB 2LSNA 5HROA 4F2SA 1RTIA 1BG3A 3SV3A 3VF4A 4B9MA 3O9UA 5AQWA 4DHYA 1GOBA 1NJZA 1T44A 4JNEA 4BRQA 4WQ4C 3UE5A 1BI4A 3LAKA 2G8IA 2D0AA 3QDKA 1WBDA 1CLQA 3PIPL 4CBXA 2XY8A 3V81A 5BPMA 3L0QA 1RTJA 3OYMA 4FM0A 1SL2A 2QWQA 3RR7A 1HRHA 2JWLA 3CIPA 5GIOA 1FKPA 4H4OA 5AQTA 4CJEA 2Q97A 4V19S 4FVUA 4KB1A 3KK2A 4KH5A 2D0OA 2O8BB 3FZKA 3MECA 3TTCA 4N5SA 5GIPA 4JRQA 3DRSA 2WC9A 2D1KA 1HYSA 3LDSA 4JI5K 2FC0A 1VQKN 3LANA 3FGUA 3U4LA 4FWQA 1TKXA 5AQYA 2NRHA 4ELUA 1CXQA 3VEWA 3QETA 3LZIA 4FJIA 4CEDA 1S5JA 1CZBA 3OYIA 3OBYA 1ZYQA 1YJ9N 4HTLA 4DSFA 2WONA 1YF5L 3IKMA 3WEEB 5C2FA 3VQPA 1VSHA 3ULDA 1IH7A 3GE1A 2HHHK 1RILA 3M3ZA 1BQNA 2RN2A 3NE6A 4GMJB 3D6RA 3DLLL 4FWSA 5FLXO 3VMFB 4DQ8A 1QHTA 5AQHA 4J8FA 3IDHA 4CHQA 1D9FA 3GOIA 4BE2A 5CZ2A 4GKJK 5GINA 4CZIA 5DM6L 3LP3A 3V9XA 1S3XA 3NMUA 1HX1A 3QMLA 3LP0A 2HSTA 3MWTA 1T8EA 2HBLA 4OVLA 2P9UA 2B6AA 1VSEA 5AQLA 5HOOA 2IGIA 3I55N 4CJPA 4ILJA 2BTFA 3G4SN 4FLUA 2A1RA 3F2KA 2O8CB 3I8BA 3ID8A 2ASOA 4DSEA 4OO1J 3NBPA 4EP4A 4FO0A 4O8KA 4BQZA 2CGJA 4Y1CA 2ZE2A 5SWMA 5M1QA 4CJRA 1IG9A 2VGMA 1S1TA 3HBTA 3R1XA 3TANA 1EETA 4DR6K 4DTMA 1HKBA 2X6SA 3H08A 2ZGZA 5AZIA 1TK8A 1S72N 1XMQK 2D0BA 3MX5A 4IDKA 4LFCK 4CJKA 1KVBA 1QQOA 3KD1E 4QOZB 2OZSA 2IDOA 1N33K 2ASMA 4IDHA 2G8KA 2XRIA 4FK4A 4M3XA 4M41A 3J8AA 2RPIA 1H1VA 4M3YA 3T7ZA 2ZD1A 2UXBK 4X64K 3VA3A 4WFNL 3IUCA 1SAZA 2IS3A 1BCOA 4CJ7A 1BDGA 3DAWA 3VQCA 1B9DA 1OH8A 1XMOK 1GLDG 5M1KA 4CFAA 1TAQA 2YKNA 3NF8A 1OH6A 2F7TA 3NCIA 3CFOA 5KRSA 4KHPK 4OPJA 1HJRA 4WQ5C 2VQFK 4GV3A 2P9KB 1CZ9A 5E41A 2FLOA 1N36K 3VQ9A 3RMDA 1R59O 4EHUA 2Z1IA 2JLEA 4KI6A 4YY3K 4FW2A 3GL1A 3KLGA 1WSEA 4QCLA 3ID6A 1VQON 1KVAA 4DQRA 3NF7A 1ZBSA 2GBZA 2IC3A 4B1ZA 2P51A 4CEFA 4NLBA 2YHXA 4LH4A 4YNQA 3HP9A 1XNRK 4PKIA 3J81O 2E2OA 3G71N 3CYMA 5AZJB 1WAJA 4RW6A 4EP5A 2AJQA 3S3NA 3VQAA 3O9QA 5C42A 4CJSA 4FLZA 3PO5A 2KFZA 2P9PA 4FJ9A 3O4NA 3CXCM 2KQ2A 4M3UA 3SUOA 2KHOA 3VERA 4WFAL 2P9SA 1JKHA 4I6MB 4DQIA 4Z4EA 1BOTO 4OJRA 2J4RA 3D7EO 2NRRA 4O5BA 4M63C 5AQSA 4RWTA 2Y1JA 1IG8A 3AVAA 3D2EB 1YTUA 4FWOA 1ZXOA 1UA0A 5JLFA 4C8KA 3T19A 1KLMA 1X3MA 4E1MA 4YDUA 3O6WA 1L3SA 3A5LC 4CIGA 5C15A 4CK2A 2DY4A 1XC9A 3EE9A 2WTUA 1D4XA 3AVMA 3C95A 1IKYA 4CBWA 1VRUA 4R79A 2A42A 1NMDA 3QFUA 3PV8A 1RTHA 3THVA 1HNXK 4GW6A 2FBYA 3K58A 4B8CA 4KTQA 2YCHA 3AGKA 1LWEA 3VGKA 1NK7A 3OVNA 1JCFA 1SUQA 4K42A 4Z4GA 1L3VA 4CJ4A 4YOTA 4Z0UA 4J2EA 4CEBA 1JXBA 3PX0A 2HBKA 1R0AA 3UKRB 3KKSA 4OGCA 3R8EA 1VQ5N 3DOLA 4FZXC 1BWFO 1TV6A 3O08A 4IWVA 3TAFA 4KH6A 3PLAA 1P8ZA 1Q81O 4NLCA 4BROA 5BPLA 1RDDA 3PIOL 1FJGK 4AHSA 2RHKA 4DFMA 5LMUK 2HHWA 3BDPA 1NKCA 4H4MA 4XIUA 2PY5A 2PYJA 4I7FA 2P9IB 5KTQA 1E4GT 1HJOA 2NLXA 1VSFA 3ATUA 4IO8A 3ZETA 5C10A 4PWDA 4LSLA 4DF8A 4M45A 4FM1A 4KRFA 4I2PA 4FW1A 3QBWA 3CFPA 3QNNA 1LCUA 3F73A 3LALA 3G0ZA 1CZAN 2E2PA 1TK0A 3S41A 2G8WA 1C0MA 4BGBA 4CBUA 1S1WA 2UXDK 1VAZA 4J2AA 1T03A 1U49A 4RW7A 5A2QO 4M7YA 1QSSA 4B9TA 3KKRA 1FKOA 4WF9L 5KPRA 1JLEA 3KK3A 4BRKA 1WSIA 1QSLA 1C0FA 1VSJA 3THXB 4HUFA 1JJ2M 2BANA 2V51B 4AM6A 3DLHA 3M5RA 3MEEA 3P38A 2GELA 2O8BA 4BR7A 4RTFD 2YNHA 1BIUA 2HNDA 3VF2A 3E9OA 2G8VA 4O55A 4FJLA 5EX5A 1NLVA 3SQ4A 5DMRA 2OPRA 1CXUA 1FXXA 4E19A 5CHIA 1A5VA 1C6VA 1NGIA 3TAEA 1SZ2A 4DV5K 3HSCA 5LY3A 4ILGB 2OCEA 4DS5A 3E9PA 5AQIA 4JEPA 3WEEA 1S9GA 3VGMA 3ZSWA 3IMXA 5KRTA 3IS9A 4E7HA 5GAEP 4KBOA 3HVRA 3V9UA 4KREA 1YVNA 4MDAA 3CCEN 4NXMK 4O5FA 3LDLA 4Z4HA 4DKWA 1ASVA 4YOYA 4DQQA 2Z1GA 4KI4A 3VA0A 1RDAA 3J7ZO 1J54A 1B9FA 1BA1A 1N6QA 3J7AP 1SQKA 4FWMA 1EWRA 4DV3K 5FPEA 2FBTA 3A5NC 1J9AA 3R6MA 3TAPA 2ITMA 2O8CA 1RTDA 3BP8A 3WNGA 3ATVA 2PFUA 1QQCA 5HRSA 5LMNK 1J5EK 4A5AA 4FLYA 4DQPA 4BRDA 1RFQA 1ASWA 2XY7A 4B9SA 4IO9L 3MN5A 4JKHA 1NGDA 5AR0A 3NH2A 4JI4K 1DT9A 4DMNA 3O1WA 4WE1A 4KB0A 4LD0A 1BO5O 3HK2A 1U4BA 4BRAA 4CFCA 3CERA 1KCFA 2G8HA 4FYDA 2QI2A 2A40A 3QIOA 3E66A 4W5QA 4M3ZA 3KIOA 4CZMA 4W5NA 2Z1HA 4PL8A 5BRDA 1X9MA 2QXFA 3SI6A 3OYHA 3FFIA 3AO4A 4JKEA 3QERA 2UUBK 4OPHA 4B9VA 5AQOA 2P9PB 4DQSA 5GADP 1RT2A 1KTQA 4CZKA 2OPPA 3AGRA 3VETA 3F9KA 4W5RA 2P9SB 3M8PA 5CYQA 2UU9K 3AVJA 4AHVA 4I9LA 4M42A 5JVHL 2OPQA 5E26A 2O4IA 4CEAA 3HT3A 4A59A 3THWB 3KZBA 2CH5A 3CF5L 1KD1O 3VF6A 2E6MA 4FJGA 1W97L 5DK5A 1NGAA 5BRHA 1N5YA 3WNEA 3LWLA 1KRPA 4LH5A 5FRNA 2P9KA 4BC2A 3QESA 4B3SK 4BRMA 3ASMA 4IOCL 4BQLA 4XH1A 3WXJA 1C1AA 5CZ1A 3HOSA 2W6LA 2BUPA 3WNHA 5DM7L 3MN6A 3L4IA 3O9RA 1BCMA 3F5TA 1ATSA 2Q31A 3C94A 5ELZA 1RDBA 3CPEA 4Z94A 4FPBA 1Q82O 1L3TA 4N76A 3C0BA 4DTSA 1X1PA 4JI2K 5AZJA 2JGUA 1TKZA 1RT1A 4Q5VA 2HW3A 1WOQA 1VSDA 2VG6A 4FJNA 3HYFA 1C0GA 2VYPA 4JI6K 1YJNN 1ESVA 2QA4N 1NWKA 2YJEA 4I6MA 3EYZA 1TUYA 4JI8K 3CM6A 1HYZA 4E0DA 1OH7A 1OH5A 2W6KA 4WYBA 3D2EA 5JLHA 3W0LA 1XUPO 5HLFA 4ZTJA 5JVGL 4E7KA 4A57A 2BGGA 2HBMA 4H5RA 1KAZA 4CVNE 1NK8A 4DV6K 1FW6A 2KW4A 5B8HA 3LP2A 4WCEL 1RBRA 4CZJA 2D4WA 4CJ5A 3FE1A 1DTTA 4DV7K 4RW4A 3W3DA 1RT7A 4LF8K 4MQ3A 2ZJRL 3MWPA 3MXMA 5BN9A 5CE3A 2V52B 4YFUA 1E3MA 3CQYA 1NKEA 3B6OA 4CGHA 4OX9K 5LL6Z 3RSEA 4M3RA 3ENBA 2FSNA 3CCLN 4FLTA 4IZ9A 4DSJA 4N41A 2UYTA 3K0SA 3UKRA 4FPAA 3AARA 3DLRA 4E7JA 1VQLN 3H45C 5ADXH 3CCVN 4B1WB 4E3SA 1WAFA 3EKSA 4RCHA 1IKXA 3VEVA 4DR7K 3HPGA 4CK3A 4DTRA 3LDNA 3LPUA 5FRMA 2P9IA 4BC4A 4CJQA 3RMCA 2HHQA 1ZBHA 4CGFA 2W40A 1NJYA 3B6PA 3QFPA 4ID1A 3VN5A 1NK4A 3CQ8A 1VSLA 3U9ZA 4CJVA 2RE2A 4YHHK 1LW0A 5HRNA 4H03B 3JSMA 4K41A 3SUNA 1G99A 4EFHA 4CHOA 1KSPA 4A62A 3SQ2A 2O8EB 2IVOA 1NJWA 4IOXA 3OHRA 3QEIA 1QTMA 4K43A 3V1OA 3OYDA 1YT3A 5M1FA 3KLHA 4LF6K 5I3UA 4JK9A 3MCAB 3L8BA 2NRZA 4RG8A 3THXA 1YJWN 3FLCO 3TAMA 2YX6A 2ASPA 1BU6O 3CD6N 4CE9A 4XH4A 2GWKA 5JMVA 5J2PA 2P5OA 1ZBFA 3TSQA 3KHYA 5FPDA 3RWUA 4A61A 4BRPA 3QNOA 2YNGA 3EZWA 4CF9A 2VWBA 3OYNA 2QWPA 3Q7BA 3TARA 4BRGA 1LAVA 3O3HA 4YDUC 4BG9A 1VQNN 1LWCA 3L2VA 4FK0A 1YVUA 4ZHRA 4C23A 1WN7A 4FWRA 4PKHA 4HUGA 4LC9B 1RT3A 2NRWA 3EZ5A 1YXQA 4ISGA 1YTAA 4CESA 4K0KK 1BA0A 1HUXA 3S3MA 4LF4K 3O5BA 5HP1A 4PL7A 1D9DA 3DXKB 3TAQA 2AA4A 3CC2N 2RKIA 2YKMA 4IOAL 3DI6A 3ZT1A 5BR8K 3VEZA 3VQBA 5GAGP 5BPNA 4FZYA 4CJUA 2ITGA 4DTOA 2I5JA 3H3OB 4M7XA 1U6ZA 4DTXA 2BE2A 2E6LA 3SJJA 1U45A 3P1GA 4E1NA 3E9LA 2ETJA 1QSYA 2D5RA 2I7PA 4FOEA 4CGDA 4BDZA 5D3GA 4CCHA 4X62K 4H0TB 1N32K 1I94K 1JLQA 4E1JA 1HNWK 1I39A 4O44A 5KGXA 4PY5A 4FSVA 3JAMO 3VTHA 3A2FA 3TABA 4DWIA 1HQEA 3CMAN 4F4KA 4A2AA 3NGZA 3MX2A 2P9NB 4EHTA 4R5PA 3TTDA 4DU4A 1TKTA 4B1YB 1JLCA 4IEEA 1QVFM 1YITN 3WQUA 4JKGB 4CJTA 1K8KB 4JI3K 1Z05A 2G8FA 1LAWA 1QQNA 4FJJA 2ZGYA 1NG9A 1NNEA 2ATQA 2HBJA 4IJAA 4FLVA 1NU0A 3JYTA 4ISEA 3BF3A 1Y64A 3ZYYX 3THWA 4QAGA 3QEPA 4CF1A 4KHYA 2Y1IA 1S1VA 3M8SA 2O4GA 4CZFA 3HRGA 4IFEA 2VWJA 2QWRA 1BL3A 3S3OA 3AO5A 3IG1A 3HO1A 2WBNA 4H5WA 3CFRA 1X9SA 4TSXA 1GLBG 3NAEA 1B92A 2DPNA 3VENA 4DFKA 3A8YA 1F21A 2QWNA 3G10A 3LWMA 3KK7A 4G9ZA 1VQ9N 3RRGA 3ZX3A 3H46O 3MAQA 4E7IA 2F96A 3TSPA 1I3AA 4DR5K 3OA9A 3CETA 1NGHA 2QTDA 2VG5A 4LFAK 1GLAG 3BY5A 4JD2B 3Q7CA 4FJ7A 3LDPA 3FZMA 3RSEB 3CCMN 3ZSRA 2XO7A 1YUWA 1VK0A 2F8TA 3QICA 3SAGA 4MFBA 5F2RA 4NO7A 1NGJA 3VQ6A 3ZT4A 3CJ1A 3ITHA 3V1QA 4CIFA 2F9WA 4FLXA 3L6QA 1VQ6N 1WB9A 3A5MC 4C1NK 3QEVA 1XC3A 4QS8A 4H5TA 4JAXA 4FJXA 5C25A 4BGAA 3U6FA 4HWIA 1KAXA 4BR0A 3T1AA 4UY8O 3U3YA 1HNVA 5SZTA 4CEOA 4CECA 4YOVA 3V6DA 3H1QA 1VSKA 2X78A 1NGGA 4JI7K 5EY4A 2XY6A 1IBKK 2NRXA 3IRXA 1QE1A 2OTJN 1NJXA 2QXLA 1TAUA 3MDQA 5I42A 5AQUA 2PAVA 5AFUH 2ZM6K 4BG8A 4KV8A 4IKFA 4FZZA 2UUCK 5KPTA 1KQSM 4BC3A 4CD1A 2D0CA 4LF7K 1IJJA 2RF2A 4U67L 3OS1A 1KC8O 3SBGA 1KXPA 3KTQA 4JKDA 3BF1A 3RRHA 1JLGA 3VQ5A 3K9JA 3LAMA 3DLGA 3ZEUA 3K5OA 3K5MA 2HHTA 4MLHA 3OS2A 4N47A 4JI0K 2KZZA 1NGEA 1U2VB 5EOYA 1C0TA 1YAGA 3EEQA 4CF8A 3O4WA 3BZCA 3NVKA 3HSTB 4DTPA 3OTOK 2F9TA 4FWLA 3LPTA 4KH4A 3L3VA 1HMVA 2FF3B 4DS4A 1RBVA 3GBTA 3HJFA 3VQ8A 2OYQA 3KLIA 4DCHA 3A5OC 5FPNA 3FZHA 1QVGM 3MK6A 3K59A 5GAHP 1X9JA 3TI0A 3EN9A 1YIJN 1HQUA 4A5BA 4B9UA 4DR2K 1NGCA 5MLCQ 2O8EA 1RBTA 1K6YA 3NFAA 2IOCA 3CG7A 4XH5A 1HNIA 2KZMA 3SMSA 1IBLK 4I2QA 3PSIA 4O4GA 3DM2A 3ENHA 2B5JA 2W41A 1JLBA 5T7BA 1Q9YA 4JI1K 4A2BA 1QS4A 3EE8A 4BDPA 1VHXA 4B3RK 4IG3A 1NGFA 2FBXA 4AM7A 3ZT2A 4H0OA 1LWFA 4FL9A 1UWBA 4JK7A 3KWIA 5H1SQ 2Q0RA 1Q7YO 4N56A 4JS4A 1VSMA 5EXWA 2ZQBA 3DLEA 2F4VK 1BGXT 3LDQA 3WQTA 1OVQA 1UOCA 4ZTFA 5BRFA 4DFPA 1K8AO 1WUAA 3WXLA 3CC7N 2OZMA 1C1CA 2NNWA 2XHBA 3U8XA 1UAXA 1REVA 4CJWA 1WSGA 2D0PA 5TKYA 1TUUA 3QBXA 3L2WA 1U48A 4IFVA 5JS2A 1J5OA 5AQGA 3DXKA 5IWAK 1MU2A 2PYLA 5AQFA 2CGKA 1MDUB 2X6NA 4XEIA 2HF4A 3HPHA 1VQMN 3G6EN 2A5XA 3H3NO 3OYLA 2O8FB 1VQ7N 4H5NA 5C2DA 1X9WA 1VSIA 4DG1A 4CF0A 4DU3A 3FZFA 4DV1K 4FVMA 4BR4A 4CIEA 1NKBA 4AHRA 1V4TA 3CCRN 4F8RA 3AAQA 1S6QA 3ALYA 4BRNA 4FCYA 4LF5K 4B3MK 4H8KA 4FJHA 3VQ4A 3OYCA 4OKJA 1O1WA 4GV9A 1XHZA 4DSKA 4K8XA 5KPZA 3NF9A 2PZSA 3FR0A 3KD5E 2WFBA 4DSIA 2DFFA 4OLBA 1C0UA 2P9NA 1KAYA 4HCCA 1K73O 3P5JA 2QWOA 1TK5A 4Z4CA 3V9ZA 2A3ZA 4O8UA 1GLLO 3TU5A 3KLFA 4FM2A 4JKGA 3LZJA 2WOMA 3PO4A 1P90A 3AVLA 1K8KA 3I56N 3MXIA 4QS7A 3AY9A 3D2FB 1TGOA 5J1EA 4FJ5A 1Q8IA 3LP1A 3OYEA 3E1YA 3I8DA 3OY9A 3KLEA 3SCXA 4FXDA 1Q18A 1OKJA 2A6AA 5AQKA 3SQ1A 1ZBIA 4Y1DA 3T69A 3L2RA 2E2NA 2YHWA 3AVFA 4CZLA 4DLGA 4FLWA 4JYAK 3OYJA 5KQDA 1IKVA 1XHXA 2QM1A 4CI6A 2G8UA 3T1YK 3DJCA 4CHZA 1VQPN 4OKKA 4KHNA 1JLFA 4ID5A 1OVYA 3V4IA 4AF1A 5CYMA 5JICA 2GWJA 3PX6A 5FROA 2HOEA 1DEJA 1JL1A 4CERA 4GKKK 1BHLA 1NMNA 3PUFA 3CCUN 4B8AB 3EO3A 3TAGA 3KJVA 4DR3K 3J80O 4DR1K 3M8QA 3AVNA 4DTNA 3N4PA 3ENOA 4BWMA 3HI0A 3ZLJA 1HKGA 3O80A 1VQ4N 5AQNA 3KVGA 3OYFA 3DMJA 1ATRA 2Q2RA 3UKUA 4DTUA 1HPMA 1JL2A 4JD2A 1T3VA 2VQEK 5J2QA 3WXKA 5M1OA 1RDWX 4CGIA 4ICLA 4FK2A 3BUZB 3THYB 3OW2M 3DLBA 4EZ9A 3ZEUB 3ZCMA 4CK1A 4UQGA 3O4QA 3JS6A 4PUOA 3IFRA 3EKUA 3M8RA 3VESA 4OGEA 4U7BA 2GTDA 3DRPA 3VQQA 2HNZA 3HPOA 4K8ZA 1Z25A 4C1NI 4J2DA 2E5LK 1RBSA 4F2RA 4JKAA 1NK5A 3K2PA 4NB4A 3H6EA 2VWKA 1WLJA 4AH9A 1IBMK 4KAZA 3C6UA 5CY4A 1V4SA 2KKZA 3WT0A 3IAYA 1JXEA 3HM8A 2XY5A 3QB0A 4BE0A 1DGKN 3AO3A 3E01A 3ZSZA 3ZT0A 1JCGA 4DR4K 2YHAA 3H1VX 3JXUA 1SS6A 4CJ3A 3HP6A 1ATNA 3OYKA 3NDKA 4F3OA 1BQMA 2ZWHA 1S1XA 2V7YA 3CQXA 4ISFA 4ILHA 4CZEA 3TR8A 4IJNA 3TSUA 4H0PA 4JLHA 3RMAA 1ZBUA 3AVIA 3NH1A 1KLNA 2YI1A 4KPYA 4OPKA 4NYNA 4FJMA 1TL1A 2HNYA 5CR4A 1NK6A 3AVGA 1KFDA 1U2VA 4AHTA 1TKDA 3VEXA 3ZSQA 4JKFA 4J2BA 4IFYA 4B1VA 3HZ6A 4Z4FA 1EO1A 3L3UA 4G1QA 5AQJA 3J7YP 4FWPA 4LY7A 1GOCA 3SV4A 3OS0A 3AVKA 1L3UA 2ZJQL 3ZT3A 1XQSC 3C6AA 4CHNA 1RT5A 1TYQA 1YHQN 3SPZA 3NVMA 3OYAA 1DTQA 5AQRA 1U47A 2E1YA 1BISA 1SL0A 4MLEA 4JV5K 3TTFA 2P9LB 1ITGA 4B9LA 1LV5A 4Y0WA 2P1JA 4JHDB 4JKCA 5TKWA 3VOVA 3NGYA 3KK1A 1T05A 3AO1A 4BVOA 1GLCG 5BR9A 1SKWA 3OJUA 3RVCA 3MN7A 4BRCA 4GVEA 1IO2A 2EHGA 1YI2N 4WQ4A 5LJVA 4Z4IA 4CD3A 3PX4A 4DTJA 4OPAA 4DV0K 4CW7B 1NK0A 1NBWA 5FPMA 2YJFA 5AQPA 3LM9A 4GV6A 3HOTA 1T6CA 3HXMA 2QWLA 3FFKB 4BRHA 1RBUA 4B3TK 4FJ8A 3O9TA 3L2UA 1DLOA 5F1XA 4NCBA 2NUBA 4CZGA 2DFEA 2B4JA 3OJSA 5C0YA 3ZX0A 3I0SA 4CF2A 3SPYA 5AQMA 4OLAA 5ADXA 3P31A 3SLCA 3LDOA 5BREA 1EXQA 4BACA 2ZF5O 2YNIA 4GVMA 4IBNA 3VEYA 2O8DB 3AAPA 3OBWA 3O8MA 1XWLA 1T7PA 4ELVA 2A41A 2WUSA 2HHUA 2PBDA 4GNIA 4I9QA 3O1BA 1IKWA 1G15A 4GY2B 4K25A 4B1UB 2IAJA 4CGJA 1QHAA 3C65A 1Y97A 5KQ8A 3KWGA 1EKEA 1RCHA 1W0HA 3BGRA 1LOTB 1RNHA 1EWQA 3HM9A 2O8FA 1N34K 2QKBA 3ISNC 3M6GA 5LJWA 2NZTA 3DXMB 4KTWA 4DLEA 4YOWA 3ULEA 4FWKA 1EQYA 4F9OA 4F3TA 3AVHA 3SUPA 1ASUA 3VQDA 1WSHA 3SUQA 3WNFA 3DWLA 2FF6A 4NCGA 2QWMA 1EX4A 2YNFA 2VGNA 2Z1JA 4BR5A 4JK8A 3C7NA 3WUHA 1VQ8N 4EZ6A 1HLUA 3OYBA 5FDLA 2DFHA 3SK3A 1D8YA 4AHUA 3DYAA 4KO0A 1MWMA 2GV9A 3MEDA 3SAHA 4L8RB 1NM1A 4O0JA 1GLJO 3U9DA 1GOAA 3CC4N 1N8RO 1HYVA 3V9SA 3UKUB 1JLAA 2NRTA 1BIZA 1Z26A 4B08A 4W5TA 3T3FA 3VQEA 3SZ2A 3HVTA 3ZSOA 2HHXA 4CHPA 3NGIA 4HTUA 3D2FA 4PA1A 1BI4B 3LM2A 4PKGA 2FSJA 2W42A 3CCJN 2IIRA 4BY9C 1U04A 4JS5A 1HPZA 3ZSVA 1KVCA 3WXIA 3LL3A 3K57A 5C24A 3K5NA 4M3WA 1HKCA 4RW9A 2AP1A 3UB5A 1NGBA 4E89A 4YOXA 1TL3A 3L4QA 4CEEA 3VPZA 4HVJA 4DB3A 4BRIA 2HVHA 3U3GA 5BN8A 2A1SA 4AHCA 4CHYA 3P4IA 4RW8A 4WQ5A 2HB5A 3P83D 5EVZA 4CJLA 5KGWA 1GLFO 1A5WA 1EP4A 4FWNA 4CFBA 1FK9A 4CJFA 1W9HA 3SNNA 4MDBA 2FBVA 3N4QA 4NXNK 3CHWA 4CZHA 5AJ3K 4H5VA 1RT6A 3EY1A 4BDYA 3AVBA 2HHSA 3K9KA 3MCPA 1MA9B 2KLAA 4BVPA 2UXCK 3NHGA 2CGLA 4M3TA 4E7LA 2Q3SA 1Z6RA 3SMPA 1NJIO 3GDQA 3O3FA 4BC5A 3CPWM 4C8OA 3ZSYA 3THYA 1T6DA 3R3LA 1S9EA 1LW2A 1WSJA 3DRRA 4HUEA 2QK9A 4ELTA 3NF6A 4KHWA 3CCQN 2QEXN 3BZKA 3VGLA 2P9UB 3QINA 4AQYK 1ZBLA 1E4FT 1SV5A 4B9NA 4BRFA 2EWSA 2VG7A 3TPQA 4KHSA 4CFDA 2ZJPL 2GUPA 4HCBA 2P5GA 4H0XB 1TYQB 2KTQA 4BREA 3SBTA 3V1RA 5IT9O 1S6PA 2V7ZA 5J2NA 1JCEA 5HRPA 3C6HA 3QIPA 1XNQK 1QZ5A 4PHTX 4LFBK 4X65K 2E88A 1S1UA 3I0RA 3SQ0A 2EX3A 5HL7L 3HL8A 3MMVA 4BR9A 3MN9A 3AV9A 4FOIA 4EAHD 5AZIB 3SYZA 1GLEG 3ZSXA 2F8SA 2FSKA 1MWKA 1WBBA 4OKEA 3QEWA 4KTZA 4BRLA 4O0IA 2R7YA 3TWHA 4QS9A 4KFBA 2GEMA 5HRRA 1J53A 2BDPA 5C12A 4DSLA 2YV0X 3CJ9A 1W2BM 5AQQA 2E4LA 1RDUA 1ILYA 2GUIA 3AO2A 4DU1A 2QKKA 1XI1A 1QZ6A 1SKRA 1Q9XA 4B1XB 4LSNA 2DTUA 4C8NA 1ZC6A 2Q36A 3CJ7A 3OYGA 1IV0A 1W7AA 3G25A 1D5AA 4DUYK 2BH1A 4IXCA 2OANA 5M1PA 4L3QA 1K9MO 2QW9A 3B8AX 4CEQA 3S9HA 1BUPA 3O3GA 4DV4K 3CCSN 4B9QA 3VEOA 3R9PA 3CI5A 2VCPA 2UUAK 2P9LA 4JHDA 2KFNA 3NH0A 1O13A 3RMBA 1HR0K 4W5OA 2IVPA 3HTVA 3ZX2A 4AILC 3WXMB 2IVNA 3D45A 4BE1A 1Q86O 2YHYA 4JN4A 5I9EB 1SKSA 3UIQA 5AFUA 3MXJA 3MEGA 4PQUA 2NRVA 3QEXA 1TVRA 3DOKA 3CJBA 3ULEB 3A0IX 4C8LA 3O9SA 1NOZA 3RTVA 1RT4A 4MO5A 3L2QA 4BWJA 1QQMA 2E20A 4IG0A 1NOYA 3AA2A 3BEXA 3C6TA 5E84A 4NYFA 4JRPA 2E1ZA 3QLHA 3VQ7A 2HHVA 3C7NB 4DV2K 4WFBL 3PY8A 4DFJA 2HF3A 4KHQA 2HVIA 2O8DA 4Q0BA 1RDCA 4CGGA 4EIAA 4YOUA 1DKGD 3DLKA 3SAFA 3P39A 3V9WA 1L5UA 4KKOA 5EU7A 1VRTA 1SL1A 1M90O 3AVCA 2Q1NA 2X74A 1C1BA 1RGIA 5M1NA 4LF9K 5AQVA 2FXUA 2H3GX 2OA8A 3CM5A 3T1HK 5AQXA 1J6ZA 4CEZA
chains in the Genus database with same CATH topology
2VWJA 3QO9A 4DS5A 1BL3A 4NYNA 3S3OA 3AO5A 2OPSA 3K5LA 4HHTA 1KFSA 4FJMA 1TL1A 1S9GA 3IG1A 2HNYA 3ZSWA 3HO1A 5KRTA 3IS9A 3CFRA 3AVGA 1NK6A 1KFDA 4AHTA 4E7HA 1TKDA 3HVRA 4KREA 3ZSQA 3V9UA 1X9SA 4J2BA 4IFYA 4Z4FA 4TSXA 3L3UA 3D0PA 4G1QA 4DF4A 4Z4HA 4LY7A 1ASVA 4DQQA 1NK9A 2Z1GA 1B92A 1GOCA 5HBMA 3NAEA 1A5XA 3OS0A 3AVKA 3SV4A 4DFKA 1L3UA 4KI4A 3RR8A 3ZT3A 1F21A 4CHNA 1RDAA 3VA0A 3G10A 3LWMA 1J54A 1RT5A 1B9FA 3RRGA 1N6QA 3SPZA 1WNSA 3OYAA 1DTQA 1U47A 5KI6A 3MAQA 4E7IA 1BISA 4NCAA 2F96A 1UA1A 5JS1A 1SL0A 1I3AA 3AA3A 2FBTA 2VG5A 1J9AA 1ITGA 5J2MA 1LV5A 2HMIA 4B9LA 2P1JA 4FJKA 4B3OA 3TAPA 4FJ7A 3NGYA 1WSFA 3KK1A 3AO1A 1T05A 1RTDA 2YHBA 3WNGA 3ZSRA 2XO7A 1VK0A 4KHUA 1SKWA 1QQCA 5HRSA 2F8TA 3OJUA 4MFBA 4C8MA 4DQPA 3AA5X 3AA4A 1IO2A 2EHGA 5K14A 3VQ6A 3ZT4A 5HROA 2LSNA 4F2SA 4Z4IA 3PX4A 4DTJA 3ITHA 3V1QA 4CIFA 1ASWA 1RTIA 2XY7A 4FLXA 3SV3A 4B9SA 4B9MA 1NK0A 3QEVA 1GOBA 1NJZA 3HXMA 4FJXA 5C25A 3NH2A 3U6FA 4DMNA 1BI4A 1RBUA 3LAKA 4FJ8A 3L2UA 1DLOA 3T1AA 4NCBA 4WE1A 2D0AA 4LD0A 4KB0A 2NUBA 3OJSA 2DFEA 2B4JA 1U4BA 3HK2A 4CFCA 1CLQA 2G8HA 1KCFA 3U3YA 3I0SA 4FYDA 2XY8A 1HNVA 5SZTA 3V81A 3QIOA 4CEOA 4CF2A 1RTJA 3SPYA 4CECA 4OLAA 3OYMA 3V6DA 4W5QA 4M3ZA 4FM0A 1VSKA 3KIOA 1SL2A 2X78A 1HRHA 3RR7A 2Z1HA 4W5NA 1FKPA 2QXFA 1EXQA 4H4OA 3OYHA 2XY6A 4CJEA 3SI6A 3IRXA 3FFIA 1QE1A 4BACA 3AO4A 4KB1A 2YNIA 4GVMA 4IBNA 3KK2A 3QERA 1NJXA 4B9VA 1TAUA 3MECA 5I42A 4N5SA 4DQSA 1XWLA 1T7PA 4JRQA 1RT2A 3DRSA 4ELVA 4KV8A 4IKFA 1HYSA 3LDSA 4FZZA 1KTQA 2HHUA 2OPPA 4I9QA 3F9KA 1IKWA 4W5RA 3M8PA 5CYQA 1G15A 2FC0A 3AVJA 4AHVA 3LANA 4I9LA 4M42A 2D0CA 2OPQA 2O4IA 1TKXA 2IAJA 2RF2A 4CEAA 4CGJA 3HT3A 3OS1A 4ELUA 1CXQA 3QETA 2E6MA 3LZIA 4FJGA 4CEDA 4FJIA 5DK5A 1S5JA 1Y97A 3KTQA 1N5YA 1EKEA 3WNEA 3RRHA 1RCHA 1CZBA 3OYIA 1W0HA 3LWLA 1KRPA 3BGRA 1ZYQA 1JLGA 4LH5A 3VQ5A 2WONA 4DSFA 3LAMA 5FRNA 3VQPA 1VSHA 3DLGA 1RNHA 3QESA 3ULDA 1IH7A 3K5OA 3HM9A 3K5MA 2HHTA 3OS2A 4N47A 2KZZA 1RILA 3ASMA 2QKBA 3ISNC 1C0TA 1BQNA 2RN2A 3NE6A 4GMJB 4CF8A 1C1AA 4KTWA 5CZ1A 1QHTA 4CHQA 4DLEA 1D9FA 3WNHA 3HSTB 4DTPA 4F3TA 3AVHA 3SUPA 4BE2A 1BCMA 3LPTA 1ASUA 5CZ2A 3VQDA 3L3VA 3LP3A 3V9XA 1HMVA 3C94A 1WSHA 4DS4A 3SUQA 1RBVA 3HJFA 1RDBA 3LP0A 3VQ8A 3WNFA 2OYQA 3KLIA 4NCGA 1EX4A 2YNFA 1L3TA 4N76A 2Z1JA 3K59A 1T8EA 4DTSA 1X1PA 4OVLA 3TI0A 2B6AA 1HQUA 1VSEA 1TKZA 1RT1A 2IGIA 2JGUA 4CJPA 4Q5VA 5FDLA 2DFHA 1VSDA 3OYBA 2A1RA 4B9UA 2VG6A 1D8YA 4FJNA 3HYFA 4AHUA 4DSEA 3DYAA 4KO0A 1RBTA 2GV9A 1K6YA 3MEDA 3NFAA 4L8RB 2IOCA 3CG7A 3NBPA 4EP4A 4O0JA 1HNIA 2KZMA 4I2QA 1GOAA 4O4GA 3DM2A 4Y1CA 2B5JA 1HYVA 2ZE2A 3V9SA 1JLBA 1JLAA 5SWMA 1BIZA 1Z26A 4B08A 4W5TA 3EYZA 5T7BA 3T3FA 3CM6A 1HYZA 3VQEA 4CJRA 3SZ2A 1Q9YA 3HVTA 3ZSOA 4E0DA 2HHXA 4CHPA 1QS4A 3NGIA 4HTUA 1IG9A 1S1TA 3TANA 4PA1A 4BDPA 1EETA 4DTMA 1BI4B 2X6SA 3H08A 4ZTJA 5HLFA 1TK8A 4IG3A 4E7KA 2BGGA 2D0BA 2W42A 2FBXA 4IDKA 3ZT2A 1NK8A 4CJKA 1KVBA 1LWFA 3KD1E 1U04A 4QOZB 2KW4A 4JS5A 2OZSA 2IDOA 1HPZA 1UWBA 3ZSVA 1KVCA 3LP2A 4N56A 3K57A 1RBRA 5C24A 2XRIA 1VSMA 3K5NA 4JS4A 2G8KA 4M3WA 2ZQBA 3DLEA 4CJ5A 4RW9A 1BGXT 1DTTA 4E89A 4FK4A 1TL3A 1UOCA 4CEEA 4ZTFA 4M3XA 4M41A 4RW4A 4HVJA 2RPIA 4DFPA 1RT7A 2OZMA 1C1CA 4M3YA 4MQ3A 3MXMA 2ZD1A 4PQUA 4YFUA 3U3GA 2XHBA 2HVHA 1UAXA 1REVA 3VA3A 4CJWA 1NKEA 2IS3A 1BCOA 1WSGA 2A1SA 4AHCA 3VQCA 3B6OA 1B9DA 1X9MA 4CHYA 4CGHA 4RW8A 4M3RA 2HB5A 3P83D 3L2WA 1U48A 4IFVA 5JS2A 4CJLA 4FLTA 1J5OA 4DSJA 4CFAA 1TAQA 2YKNA 3NF8A 5KGWA 4N41A 3NCIA 3CFOA 5KRSA 1MU2A 3DLRA 4E7JA 4OPJA 1A5WA 1EP4A 1HJRA 4CFBA 2PYLA 1FK9A 2X6NA 4CJFA 3HPHA 1W9HA 4E3SA 1CZ9A 5E41A 2FBVA 3SNNA 3OYLA 1WAFA 1X9WA 1RT6A 3VQ9A 3EY1A 4BDYA 1IKXA 3RMDA 1VSIA 2Z1IA 3AVBA 2JLEA 4DG1A 4CF0A 4DU3A 4KI6A 2HHSA 3HPGA 4CK3A 4FW2A 3KLGA 4DTRA 3LPUA 5FRMA 1WSEA 3NHGA 4QCLA 4FVMA 4CIEA 1KVAA 4AHRA 4DQRA 4E7LA 1NKBA 4M3TA 2Q3SA 4F8RA 4CJQA 3NF7A 3O3FA 3RMCA 4C8OA 2HHQA 1ZBHA 3ZSYA 4CGFA 1NJYA 1S9EA 3B6PA 1S6QA 1LW2A 2GBZA 2IC3A 1WSJA 3ALYA 3DRRA 2P51A 4ID1A 3VN5A 4HUEA 1NK4A 4CEFA 3CQ8A 2QK9A 4FCYA 4YNQA 4LH4A 1VSLA 4ELTA 3NF6A 3HP9A 4KHWA 4H8KA 4CJVA 4FJHA 3VQ4A 3OYCA 1LW0A 4OKJA 5HRNA 1O1WA 3CYMA 3JSMA 1WAJA 1XHZA 3QINA 4RW6A 4EP5A 3SUNA 4DSKA 3S3NA 1SV5A 1ZBLA 4K8XA 2AJQA 4CHOA 3VQAA 4B9NA 3NF9A 2PZSA 3KD5E 5C42A 4CJSA 1KSPA 2VG7A 4KHSA 3SQ2A 4CFDA 4DSIA 2DFFA 4FLZA 4FLUA 3PO5A 1NJWA 1C0UA 2P5GA 4HCBA 4OLBA 4FJ9A 4HCCA 3O4NA 2KTQA 2KFZA 3P5JA 3QEIA 2KQ2A 1TK5A 4Z4CA 3V1RA 3V9ZA 1QTMA 4M3UA 3SUOA 3V1OA 1S6PA 3OYDA 1YT3A 3KLFA 4FM2A 1JKHA 3KLHA 5J2NA 3LZJA 5I3UA 2WOMA 5HRPA 3PO4A 3AVLA 4DQIA 4OJRA 4Z4EA 3L8BA 3QIPA 2HW3A 4RG8A 3MXIA 2G8IA 4O5BA 1S1UA 1TGOA 3I0RA 5J1EA 2Y1JA 3SQ0A 4FJ5A 2EX3A 1Q8IA 3AVAA 3HL8A 3TAMA 3LP1A 3OYEA 3I8DA 3OY9A 3KLEA 3SCXA 3AV9A 1YTUA 4FXDA 1UA0A 3SQ1A 4C8KA 4CE9A 5J2PA 3SYZA 2P5OA 3T19A 1ZBIA 3ZSXA 1KLMA 4E1MA 4Y1DA 2F8SA 1ZBFA 1L3SA 3L2RA 4CIGA 3RWUA 3AVFA 4CK2A 2DY4A 1XC9A 3QNOA 2YNGA 4OKEA 3QEWA 4DLGA 4KTZA 4O0IA 4FLWA 3OYJA 4CF9A 3OYNA 1IKVA 1XHXA 3AVMA 3C95A 2R7YA 3TARA 2G8UA 1LAVA 3O3HA 1IKYA 4CHZA 1VRUA 3TWHA 4OKKA 4KHNA 1LWCA 3L2VA 4KFBA 1JLFA 5HRRA 4FK0A 1YVUA 4ID5A 1J53A 4ZHRA 3PV8A 3THVA 1RTHA 2BDPA 1WN7A 3V4IA 4DSLA 2YV0X 4HUGA 5CYMA 2E4LA 4GW6A 2FBYA 3K58A 1RT3A 4B8CA 5FROA 3PX6A 2GUIA 3AO2A 4DU1A 1JL1A 3EZ5A 4KTQA 4CERA 1LWEA 1BHLA 1XI1A 1NK7A 3PUFA 3OVNA 2QKKA 1YTAA 4CESA 1SKRA 1Q9XA 1SUQA 4B8AB 4LSNA 3TAGA 2DTUA 4Z4GA 3KJVA 1L3VA 4CJ4A 4C8NA 4Z0UA 4J2EA 3OYGA 4CEBA 3S3MA 3M8QA 1JXBA 5HP1A 3PX0A 3AVNA 1D5AA 4DTNA 1D9DA 1R0AA 3KKSA 4OGCA 4BWMA 3TAQA 3DOLA 4FZXC 1TV6A 2RKIA 2YKMA 3TAFA 4CEQA 3OYFA 3DMJA 3S9HA 3O3GA 4DTUA 3DI6A 1RDDA 3ZT1A 1JL2A 4AHSA 3VQBA 4FZYA 2KFNA 4CJUA 3NH0A 4DFMA 2ITGA 4DTOA 2I5JA 3RMBA 3BDPA 2HHWA 1NKCA 4H4MA 4XIUA 4W5OA 5J2QA 2PY5A 4DTXA 2PYJA 2BE2A 2E6LA 4I7FA 4CGIA 3SJJA 1U45A 5KTQA 3P1GA 4E1NA 4AILC 4ICLA 4FK2A 1VSFA 2ETJA 1QSYA 2D5RA 4EZ6A 4CGDA 3D45A 4BE1A 4BDZA 5D3GA 3DLBA 4PWDA 4LSLA 4DF8A 4CCHA 4EZ9A 4M45A 3ZCMA 4CK1A 4UQGA 3O4QA 4PUOA 4FM1A 1JLQA 3M8RA 4I2PA 1SKSA 3UIQA 1I39A 4O44A 4OGEA 4FW1A 4KRFA 3MXJA 3DRPA 3MEGA 3VQQA 5KGXA 4PY5A 2HNZA 3HPOA 3CFPA 3QNNA 3QEXA 1TVRA 4K8ZA 3F73A 3A2FA 1Z25A 3LALA 3G0ZA 3TABA 4DWIA 1HQEA 3DOKA 4J2DA 4F4KA 1TK0A 3NGZA 2G8WA 1C0MA 4C8LA 1RBSA 4F2RA 1NOZA 1S1WA 1NK5A 3RTVA 1RT4A 4R5PA 3K2PA 3L2QA 4DU4A 1TKTA 4BWJA 1T03A 1U49A 4J2AA 4RW7A 1QSSA 1JLCA 4IG0A 2VWKA 1WLJA 4AH9A 4B9TA 3KKRA 1FKOA 1NOYA 4KAZA 3C6UA 3AA2A 5CY4A 3IAYA 4CJTA 1JLEA 1JXEA 3C6TA 3KK3A 4NYFA 4JRPA 1WSIA 1QSLA 3QLHA 1VSJA 3VQ7A 2XY5A 2HHVA 4HUFA 2BANA 3PY8A 4BE0A 4DFJA 3DLHA 2G8FA 1LAWA 3AO3A 3E01A 3MEEA 3ZSZA 4KHQA 2HVIA 4Q0BA 3ZT0A 1RDCA 4CGGA 4FJJA 2YHAA 4CJ3A 3HP6A 3OYKA 3NDKA 2ATQA 4F3OA 1BQMA 1BIUA 2HNDA 2YNHA 3DLKA 1S1XA 4FLVA 4O55A 2G8VA 4FJLA 3V9WA 3SQ4A 5DMRA 2OPRA 3JYTA 1CXUA 3TR8A 1FXXA 4E19A 4KKOA 5EU7A 1VRTA 1SL1A 1L5UA 3AVCA 4JLHA 4QAGA 3QEPA 4CF1A 2X74A 3RMAA 1C1BA 1ZBUA 1A5VA 1C6VA 3AVIA 3TAEA 4KHYA 2Y1IA 1S1VA 3NH1A 3M8SA 2O4GA 2OA8A 1KLNA 3CM5A 4FLYA 4KPYA 4CEZA 4OPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VWJ A;  3QO9 A;  4DS5 A;  1BL3 A;  4NYN A;  3S3O A;  3AO5 A;  2OPS A;  3K5L A;  4HHT A;  1KFS A;  4FJM A;  1TL1 A;  1S9G A;  3IG1 A;  2HNY A;  3ZSW A;  3HO1 A;  5KRT A;  3IS9 A;  3CFR A;  3AVG A;  1NK6 A;  1KFD A;  4AHT A;  4E7H A;  1TKD A;  3HVR A;  4KRE A;  3ZSQ A;  3V9U A;  1X9S A;  4J2B A;  4IFY A;  4Z4F A;  4TSX A;  3L3U A;  3D0P A;  4G1Q A;  4DF4 A;  4Z4H A;  4LY7 A;  1ASV A;  4DQQ A;  1NK9 A;  2Z1G A;  1B92 A;  1GOC A;  5HBM A;  3NAE A;  1A5X A;  3OS0 A;  3AVK A;  3SV4 A;  4DFK A;  1L3U A;  4KI4 A;  3RR8 A;  3ZT3 A;  1F21 A;  4CHN A;  1RDA A;  3VA0 A;  3G10 A;  3LWM A;  1J54 A;  1RT5 A;  1B9F A;  3RRG A;  1N6Q A;  3SPZ A;  1WNS A;  3OYA A;  1DTQ A;  1U47 A;  5KI6 A;  3MAQ A;  4E7I A;  1BIS A;  4NCA A;  2F96 A;  1UA1 A;  5JS1 A;  1SL0 A;  1I3A A;  3AA3 A;  2FBT A;  2VG5 A;  1J9A A;  1ITG A;  5J2M A;  1LV5 A;  2HMI A;  4B9L A;  2P1J A;  4FJK A;  4B3O A;  3TAP A;  4FJ7 A;  3NGY A;  1WSF A;  3KK1 A;  3AO1 A;  1T05 A;  1RTD A;  2YHB A;  3WNG A;  3ZSR A;  2XO7 A;  1VK0 A;  4KHU A;  1SKW A;  1QQC A;  5HRS A;  2F8T A;  3OJU A;  4MFB A;  4C8M A;  4DQP A;  3AA5 X;  3AA4 A;  1IO2 A;  2EHG A;  5K14 A;  3VQ6 A;  3ZT4 A;  5HRO A;  2LSN A;  4F2S A;  4Z4I A;  3PX4 A;  4DTJ A;  3ITH A;  3V1Q A;  4CIF A;  1ASW A;  1RTI A;  2XY7 A;  4FLX A;  3SV3 A;  4B9S A;  4B9M A;  1NK0 A;  3QEV A;  1GOB A;  1NJZ A;  3HXM A;  4FJX A;  5C25 A;  3NH2 A;  3U6F A;  4DMN A;  1BI4 A;  1RBU A;  3LAK A;  4FJ8 A;  3L2U A;  1DLO A;  3T1A A;  4NCB A;  4WE1 A;  2D0A A;  4LD0 A;  4KB0 A;  2NUB A;  3OJS A;  2DFE A;  2B4J A;  1U4B A;  3HK2 A;  4CFC A;  1CLQ A;  2G8H A;  1KCF A;  3U3Y A;  3I0S A;  4FYD A;  2XY8 A;  1HNV A;  5SZT A;  3V81 A;  3QIO A;  4CEO A;  4CF2 A;  1RTJ A;  3SPY A;  4CEC A;  4OLA A;  3OYM A;  3V6D A;  4W5Q A;  4M3Z A;  4FM0 A;  1VSK A;  3KIO A;  1SL2 A;  2X78 A;  1HRH A;  3RR7 A;  2Z1H A;  4W5N A;  1FKP A;  2QXF A;  1EXQ A;  4H4O A;  3OYH A;  2XY6 A;  4CJE A;  3SI6 A;  3IRX A;  3FFI A;  1QE1 A;  4BAC A;  3AO4 A;  4KB1 A;  2YNI A;  4GVM A;  4IBN A;  3KK2 A;  3QER A;  1NJX A;  4B9V A;  1TAU A;  3MEC A;  5I42 A;  4N5S A;  4DQS A;  1XWL A;  1T7P A;  4JRQ A;  1RT2 A;  3DRS A;  4ELV A;  4KV8 A;  4IKF A;  1HYS A;  3LDS A;  4FZZ A;  1KTQ A;  2HHU A;  2OPP A;  4I9Q A;  3F9K A;  1IKW A;  4W5R A;  3M8P A;  5CYQ A;  1G15 A;  2FC0 A;  3AVJ A;  4AHV A;  3LAN A;  4I9L A;  4M42 A;  2D0C A;  2OPQ A;  2O4I A;  1TKX A;  2IAJ A;  2RF2 A;  4CEA A;  4CGJ A;  3HT3 A;  3OS1 A;  4ELU A;  1CXQ A;  3QET A;  2E6M A;  3LZI A;  4FJG A;  4CED A;  4FJI A;  5DK5 A;  1S5J A;  1Y97 A;  3KTQ A;  1N5Y A;  1EKE A;  3WNE A;  3RRH A;  1RCH A;  1CZB A;  3OYI A;  1W0H A;  3LWL A;  1KRP A;  3BGR A;  1ZYQ A;  1JLG A;  4LH5 A;  3VQ5 A;  2WON A;  4DSF A;  3LAM A;  5FRN A;  3VQP A;  1VSH A;  3DLG A;  1RNH A;  3QES A;  3ULD A;  1IH7 A;  3K5O A;  3HM9 A;  3K5M A;  2HHT A;  3OS2 A;  4N47 A;  2KZZ A;  1RIL A;  3ASM A;  2QKB A;  3ISN C;  1C0T A;  1BQN A;  2RN2 A;  3NE6 A;  4GMJ B;  4CF8 A;  1C1A A;  4KTW A;  5CZ1 A;  1QHT A;  4CHQ A;  4DLE A;  1D9F A;  3WNH A;  3HST B;  4DTP A;  4F3T A;  3AVH A;  3SUP A;  4BE2 A;  1BCM A;  3LPT A;  1ASU A;  5CZ2 A;  3VQD A;  3L3V A;  3LP3 A;  3V9X A;  1HMV A;  3C94 A;  1WSH A;  4DS4 A;  3SUQ A;  1RBV A;  3HJF A;  1RDB A;  3LP0 A;  3VQ8 A;  3WNF A;  2OYQ A;  3KLI A;  4NCG A;  1EX4 A;  2YNF A;  1L3T A;  4N76 A;  2Z1J A;  3K59 A;  1T8E A;  4DTS A;  1X1P A;  4OVL A;  3TI0 A;  2B6A A;  1HQU A;  1VSE A;  1TKZ A;  1RT1 A;  2IGI A;  2JGU A;  4CJP A;  4Q5V A;  5FDL A;  2DFH A;  1VSD A;  3OYB A;  2A1R A;  4B9U A;  2VG6 A;  1D8Y A;  4FJN A;  3HYF A;  4AHU A;  4DSE A;  3DYA A;  4KO0 A;  1RBT A;  2GV9 A;  1K6Y A;  3MED A;  3NFA A;  4L8R B;  2IOC A;  3CG7 A;  3NBP A;  4EP4 A;  4O0J A;  1HNI A;  2KZM A;  4I2Q A;  1GOA A;  4O4G A;  3DM2 A;  4Y1C A;  2B5J A;  1HYV A;  2ZE2 A;  3V9S A;  1JLB A;  1JLA A;  5SWM A;  1BIZ A;  1Z26 A;  4B08 A;  4W5T A;  3EYZ A;  5T7B A;  3T3F A;  3CM6 A;  1HYZ A;  3VQE A;  4CJR A;  3SZ2 A;  1Q9Y A;  3HVT A;  3ZSO A;  4E0D A;  2HHX A;  4CHP A;  1QS4 A;  3NGI A;  4HTU A;  1IG9 A;  1S1T A;  3TAN A;  4PA1 A;  4BDP A;  1EET A;  4DTM A;  1BI4 B;  2X6S A;  3H08 A;  4ZTJ A;  5HLF A;  1TK8 A;  4IG3 A;  4E7K A;  2BGG A;  2D0B A;  2W42 A;  2FBX A;  4IDK A;  3ZT2 A;  1NK8 A;  4CJK A;  1KVB A;  1LWF A;  3KD1 E;  1U04 A;  4QOZ B;  2KW4 A;  4JS5 A;  2OZS A;  2IDO A;  1HPZ A;  1UWB A;  3ZSV A;  1KVC A;  3LP2 A;  4N56 A;  3K57 A;  1RBR A;  5C24 A;  2XRI A;  1VSM A;  3K5N A;  4JS4 A;  2G8K A;  4M3W A;  2ZQB A;  3DLE A;  4CJ5 A;  4RW9 A;  1BGX T;  1DTT A;  4E89 A;  4FK4 A;  1TL3 A;  1UOC A;  4CEE A;  4ZTF A;  4M3X A;  4M41 A;  4RW4 A;  4HVJ A;  2RPI A;  4DFP A;  1RT7 A;  2OZM A;  1C1C A;  4M3Y A;  4MQ3 A;  3MXM A;  2ZD1 A;  4PQU A;  4YFU A;  3U3G A;  2XHB A;  2HVH A;  1UAX A;  1REV A;  3VA3 A;  4CJW A;  1NKE A;  2IS3 A;  1BCO A;  1WSG A;  2A1S A;  4AHC A;  3VQC A;  3B6O A;  1B9D A;  1X9M A;  4CHY A;  4CGH A;  4RW8 A;  4M3R A;  2HB5 A;  3P83 D;  3L2W A;  1U48 A;  4IFV A;  5JS2 A;  4CJL A;  4FLT A;  1J5O A;  4DSJ A;  4CFA A;  1TAQ A;  2YKN A;  3NF8 A;  5KGW A;  4N41 A;  3NCI A;  3CFO A;  5KRS A;  1MU2 A;  3DLR A;  4E7J A;  4OPJ A;  1A5W A;  1EP4 A;  1HJR A;  4CFB A;  2PYL A;  1FK9 A;  2X6N A;  4CJF A;  3HPH A;  1W9H A;  4E3S A;  1CZ9 A;  5E41 A;  2FBV A;  3SNN A;  3OYL A;  1WAF A;  1X9W A;  1RT6 A;  3VQ9 A;  3EY1 A;  4BDY A;  1IKX A;  3RMD A;  1VSI A;  2Z1I A;  3AVB A;  2JLE A;  4DG1 A;  4CF0 A;  4DU3 A;  4KI6 A;  2HHS A;  3HPG A;  4CK3 A;  4FW2 A;  3KLG A;  4DTR A;  3LPU A;  5FRM A;  1WSE A;  3NHG A;  4QCL A;  4FVM A;  4CIE A;  1KVA A;  4AHR A;  4DQR A;  4E7L A;  1NKB A;  4M3T A;  2Q3S A;  4F8R A;  4CJQ A;  3NF7 A;  3O3F A;  3RMC A;  4C8O A;  2HHQ A;  1ZBH A;  3ZSY A;  4CGF A;  1NJY A;  1S9E A;  3B6P A;  1S6Q A;  1LW2 A;  2GBZ A;  2IC3 A;  1WSJ A;  3ALY A;  3DRR A;  2P51 A;  4ID1 A;  3VN5 A;  4HUE A;  1NK4 A;  4CEF A;  3CQ8 A;  2QK9 A;  4FCY A;  4YNQ A;  4LH4 A;  1VSL A;  4ELT A;  3NF6 A;  3HP9 A;  4KHW A;  4H8K A;  4CJV A;  4FJH A;  3VQ4 A;  3OYC A;  1LW0 A;  4OKJ A;  5HRN A;  1O1W A;  3CYM A;  3JSM A;  1WAJ A;  1XHZ A;  3QIN A;  4RW6 A;  4EP5 A;  3SUN A;  4DSK A;  3S3N A;  1SV5 A;  1ZBL A;  4K8X A;  2AJQ A;  4CHO A;  3VQA A;  4B9N A;  3NF9 A;  2PZS A;  3KD5 E;  5C42 A;  4CJS A;  1KSP A;  2VG7 A;  4KHS A;  3SQ2 A;  4CFD A;  4DSI A;  2DFF A;  4FLZ A;  4FLU A;  3PO5 A;  1NJW A;  1C0U A;  2P5G A;  4HCB A;  4OLB A;  4FJ9 A;  4HCC A;  3O4N A;  2KTQ A;  2KFZ A;  3P5J A;  3QEI A;  2KQ2 A;  1TK5 A;  4Z4C A;  3V1R A;  3V9Z A;  1QTM A;  4M3U A;  3SUO A;  3V1O A;  1S6P A;  3OYD A;  1YT3 A;  3KLF A;  4FM2 A;  1JKH A;  3KLH A;  5J2N A;  3LZJ A;  5I3U A;  2WOM A;  5HRP A;  3PO4 A;  3AVL A;  4DQI A;  4OJR A;  4Z4E A;  3L8B A;  3QIP A;  2HW3 A;  4RG8 A;  3MXI A;  2G8I A;  4O5B A;  1S1U A;  1TGO A;  3I0R A;  5J1E A;  2Y1J A;  3SQ0 A;  4FJ5 A;  2EX3 A;  1Q8I A;  3AVA A;  3HL8 A;  3TAM A;  3LP1 A;  3OYE A;  3I8D A;  3OY9 A;  3KLE A;  3SCX A;  3AV9 A;  1YTU A;  4FXD A;  1UA0 A;  3SQ1 A;  4C8K A;  4CE9 A;  5J2P A;  3SYZ A;  2P5O A;  3T19 A;  1ZBI A;  3ZSX A;  1KLM A;  4E1M A;  4Y1D A;  2F8S A;  1ZBF A;  1L3S A;  3L2R A;  4CIG A;  3RWU A;  3AVF A;  4CK2 A;  2DY4 A;  1XC9 A;  3QNO A;  2YNG A;  4OKE A;  3QEW A;  4DLG A;  4KTZ A;  4O0I A;  4FLW A;  3OYJ A;  4CF9 A;  3OYN A;  1IKV A;  1XHX A;  3AVM A;  3C95 A;  2R7Y A;  3TAR A;  2G8U A;  1LAV A;  3O3H A;  1IKY A;  4CHZ A;  1VRU A;  3TWH A;  4OKK A;  4KHN A;  1LWC A;  3L2V A;  4KFB A;  1JLF A;  5HRR A;  4FK0 A;  1YVU A;  4ID5 A;  1J53 A;  4ZHR A;  3PV8 A;  3THV A;  1RTH A;  2BDP A;  1WN7 A;  3V4I A;  4DSL A;  2YV0 X;  4HUG A;  5CYM A;  2E4L A;  4GW6 A;  2FBY A;  3K58 A;  1RT3 A;  4B8C A;  5FRO A;  3PX6 A;  2GUI A;  3AO2 A;  4DU1 A;  1JL1 A;  3EZ5 A;  4KTQ A;  4CER A;  1LWE A;  1BHL A;  1XI1 A;  1NK7 A;  3PUF A;  3OVN A;  2QKK A;  1YTA A;  4CES A;  1SKR A;  1Q9X A;  1SUQ A;  4B8A B;  4LSN A;  3TAG A;  2DTU A;  4Z4G A;  3KJV A;  1L3V A;  4CJ4 A;  4C8N A;  4Z0U A;  4J2E A;  3OYG A;  4CEB A;  3S3M A;  3M8Q A;  1JXB A;  5HP1 A;  3PX0 A;  3AVN A;  1D5A A;  4DTN A;  1D9D A;  1R0A A;  3KKS A;  4OGC A;  4BWM A;  3TAQ A;  3DOL A;  4FZX C;  1TV6 A;  2RKI A;  2YKM A;  3TAF A;  4CEQ A;  3OYF A;  3DMJ A;  3S9H A;  3O3G A;  4DTU A;  3DI6 A;  1RDD A;  3ZT1 A;  1JL2 A;  4AHS A;  3VQB A;  4FZY A;  2KFN A;  4CJU A;  3NH0 A;  4DFM A;  2ITG A;  4DTO A;  2I5J A;  3RMB A;  3BDP A;  2HHW A;  1NKC A;  4H4M A;  4XIU A;  4W5O A;  5J2Q A;  2PY5 A;  4DTX A;  2PYJ A;  2BE2 A;  2E6L A;  4I7F A;  4CGI A;  3SJJ A;  1U45 A;  5KTQ A;  3P1G A;  4E1N A;  4AIL C;  4ICL A;  4FK2 A;  1VSF A;  2ETJ A;  1QSY A;  2D5R A;  4EZ6 A;  4CGD A;  3D45 A;  4BE1 A;  4BDZ A;  5D3G A;  3DLB A;  4PWD A;  4LSL A;  4DF8 A;  4CCH A;  4EZ9 A;  4M45 A;  3ZCM A;  4CK1 A;  4UQG A;  3O4Q A;  4PUO A;  4FM1 A;  1JLQ A;  3M8R A;  4I2P A;  1SKS A;  3UIQ A;  1I39 A;  4O44 A;  4OGE A;  4FW1 A;  4KRF A;  3MXJ A;  3DRP A;  3MEG A;  3VQQ A;  5KGX A;  4PY5 A;  2HNZ A;  3HPO A;  3CFP A;  3QNN A;  3QEX A;  1TVR A;  4K8Z A;  3F73 A;  3A2F A;  1Z25 A;  3LAL A;  3G0Z A;  3TAB A;  4DWI A;  1HQE A;  3DOK A;  4J2D A;  4F4K A;  1TK0 A;  3NGZ A;  2G8W A;  1C0M A;  4C8L A;  1RBS A;  4F2R A;  1NOZ A;  1S1W A;  1NK5 A;  3RTV A;  1RT4 A;  4R5P A;  3K2P A;  3L2Q A;  4DU4 A;  1TKT A;  4BWJ A;  1T03 A;  1U49 A;  4J2A A;  4RW7 A;  1QSS A;  1JLC A;  4IG0 A;  2VWK A;  1WLJ A;  4AH9 A;  4B9T A;  3KKR A;  1FKO A;  1NOY A;  4KAZ A;  3C6U A;  3AA2 A;  5CY4 A;  3IAY A;  4CJT A;  1JLE A;  1JXE A;  3C6T A;  3KK3 A;  4NYF A;  4JRP A;  1WSI A;  1QSL A;  3QLH A;  1VSJ A;  3VQ7 A;  2XY5 A;  2HHV A;  4HUF A;  2BAN A;  3PY8 A;  4BE0 A;  4DFJ A;  3DLH A;  2G8F A;  1LAW A;  3AO3 A;  3E01 A;  3MEE A;  3ZSZ A;  4KHQ A;  2HVI A;  4Q0B A;  3ZT0 A;  1RDC A;  4CGG A;  4FJJ A;  2YHA A;  4CJ3 A;  3HP6 A;  3OYK A;  3NDK A;  2ATQ A;  4F3O A;  1BQM A;  1BIU A;  2HND A;  2YNH A;  3DLK A;  1S1X A;  4FLV A;  4O55 A;  2G8V A;  4FJL A;  3V9W A;  3SQ4 A;  5DMR A;  2OPR A;  3JYT A;  1CXU A;  3TR8 A;  1FXX A;  4E19 A;  4KKO A;  5EU7 A;  1VRT A;  1SL1 A;  1L5U A;  3AVC A;  4JLH A;  4QAG A;  3QEP A;  4CF1 A;  2X74 A;  3RMA A;  1C1B A;  1ZBU A;  1A5V A;  1C6V A;  3AVI A;  3TAE A;  4KHY A;  2Y1I A;  1S1V A;  3NH1 A;  3M8S A;  2O4G A;  2OA8 A;  1KLN A;  3CM5 A;  4FLY A;  4KPY A;  4CEZ A;  4OPK A; 
#chains in the Genus database with same CATH topology
 3PSF A;  3QO9 A;  2CH6 A;  2E2Q A;  2OPS A;  3FZL A;  5F0X A;  3K5L A;  4HHT A;  1KFS A;  5AQZ A;  3EL2 A;  1S22 A;  2I7N A;  2HMP A;  3CME N;  4BR2 A;  3D0P A;  3DXM A;  3M1F A;  4DF4 A;  1NK9 A;  5HBM A;  1A5X A;  3RR8 A;  2Q0U A;  1WNS A;  4IEI A;  4DUZ K;  2E8A A;  3SJH A;  5KI6 A;  4NCA A;  1UA1 A;  3CJC A;  5JS1 A;  3AA3 A;  1X3N A;  4MO4 A;  3GG4 A;  5J2M A;  2HMI A;  4FJK A;  3VTI A;  4B3O A;  3CJA A;  2OTL N;  1HNZ K;  1WSF A;  3F9M A;  2YHB A;  4KHU A;  4JKB A;  2GX9 A;  4H0V B;  4C8M A;  1M1K O;  4X66 K;  4YOR A;  3AA5 X;  3AA4 A;  2JWK A;  4H0Y B;  3I33 A;  5K14 A;  3ZET B;  2LSN A;  5HRO A;  4F2S A;  1RTI A;  1BG3 A;  3SV3 A;  3VF4 A;  4B9M A;  3O9U A;  5AQW A;  4DHY A;  1GOB A;  1NJZ A;  1T44 A;  4JNE A;  4BRQ A;  4WQ4 C;  3UE5 A;  1BI4 A;  3LAK A;  2G8I A;  2D0A A;  3QDK A;  1WBD A;  1CLQ A;  3PIP L;  4CBX A;  2XY8 A;  3V81 A;  5BPM A;  3L0Q A;  1RTJ A;  3OYM A;  4FM0 A;  1SL2 A;  2QWQ A;  3RR7 A;  1HRH A;  2JWL A;  3CIP A;  5GIO A;  1FKP A;  4H4O A;  5AQT A;  4CJE A;  2Q97 A;  4V19 S;  4FVU A;  4KB1 A;  3KK2 A;  4KH5 A;  2D0O A;  2O8B B;  3FZK A;  3MEC A;  3TTC A;  4N5S A;  5GIP A;  4JRQ A;  3DRS A;  2WC9 A;  2D1K A;  1HYS A;  3LDS A;  4JI5 K;  2FC0 A;  1VQK N;  3LAN A;  3FGU A;  3U4L A;  4FWQ A;  1TKX A;  5AQY A;  2NRH A;  4ELU A;  1CXQ A;  3VEW A;  3QET A;  3LZI A;  4FJI A;  4CED A;  1S5J A;  1CZB A;  3OYI A;  3OBY A;  1ZYQ A;  1YJ9 N;  4HTL A;  4DSF A;  2WON A;  1YF5 L;  3IKM A;  3WEE B;  5C2F A;  3VQP A;  1VSH A;  3ULD A;  1IH7 A;  3GE1 A;  2HHH K;  1RIL A;  3M3Z A;  1BQN A;  2RN2 A;  3NE6 A;  4GMJ B;  3D6R A;  3DLL L;  4FWS A;  5FLX O;  3VMF B;  4DQ8 A;  1QHT A;  5AQH A;  4J8F A;  3IDH A;  4CHQ A;  1D9F A;  3GOI A;  4BE2 A;  5CZ2 A;  4GKJ K;  5GIN A;  4CZI A;  5DM6 L;  3LP3 A;  3V9X A;  1S3X A;  3NMU A;  1HX1 A;  3QML A;  3LP0 A;  2HST A;  3MWT A;  1T8E A;  2HBL A;  4OVL A;  2P9U A;  2B6A A;  1VSE A;  5AQL A;  5HOO A;  2IGI A;  3I55 N;  4CJP A;  4ILJ A;  2BTF A;  3G4S N;  4FLU A;  2A1R A;  3F2K A;  2O8C B;  3I8B A;  3ID8 A;  2ASO A;  4DSE A;  4OO1 J;  3NBP A;  4EP4 A;  4FO0 A;  4O8K A;  4BQZ A;  2CGJ A;  4Y1C A;  2ZE2 A;  5SWM A;  5M1Q A;  4CJR A;  1IG9 A;  2VGM A;  1S1T A;  3HBT A;  3R1X A;  3TAN A;  1EET A;  4DR6 K;  4DTM A;  1HKB A;  2X6S A;  3H08 A;  2ZGZ A;  5AZI A;  1TK8 A;  1S72 N;  1XMQ K;  2D0B A;  3MX5 A;  4IDK A;  4LFC K;  4CJK A;  1KVB A;  1QQO A;  3KD1 E;  4QOZ B;  2OZS A;  2IDO A;  1N33 K;  2ASM A;  4IDH A;  2G8K A;  2XRI A;  4FK4 A;  4M3X A;  4M41 A;  3J8A A;  2RPI A;  1H1V A;  4M3Y A;  3T7Z A;  2ZD1 A;  2UXB K;  4X64 K;  3VA3 A;  4WFN L;  3IUC A;  1SAZ A;  2IS3 A;  1BCO A;  4CJ7 A;  1BDG A;  3DAW A;  3VQC A;  1B9D A;  1OH8 A;  1XMO K;  1GLD G;  5M1K A;  4CFA A;  1TAQ A;  2YKN A;  3NF8 A;  1OH6 A;  2F7T A;  3NCI A;  3CFO A;  5KRS A;  4KHP K;  4OPJ A;  1HJR A;  4WQ5 C;  2VQF K;  4GV3 A;  2P9K B;  1CZ9 A;  5E41 A;  2FLO A;  1N36 K;  3VQ9 A;  3RMD A;  1R59 O;  4EHU A;  2Z1I A;  2JLE A;  4KI6 A;  4YY3 K;  4FW2 A;  3GL1 A;  3KLG A;  1WSE A;  4QCL A;  3ID6 A;  1VQO N;  1KVA A;  4DQR A;  3NF7 A;  1ZBS A;  2GBZ A;  2IC3 A;  4B1Z A;  2P51 A;  4CEF A;  4NLB A;  2YHX A;  4LH4 A;  4YNQ A;  3HP9 A;  1XNR K;  4PKI A;  3J81 O;  2E2O A;  3G71 N;  3CYM A;  5AZJ B;  1WAJ A;  4RW6 A;  4EP5 A;  2AJQ A;  3S3N A;  3VQA A;  3O9Q A;  5C42 A;  4CJS A;  4FLZ A;  3PO5 A;  2KFZ A;  2P9P A;  4FJ9 A;  3O4N A;  3CXC M;  2KQ2 A;  4M3U A;  3SUO A;  2KHO A;  3VER A;  4WFA L;  2P9S A;  1JKH A;  4I6M B;  4DQI A;  4Z4E A;  1BOT O;  4OJR A;  2J4R A;  3D7E O;  2NRR A;  4O5B A;  4M63 C;  5AQS A;  4RWT A;  2Y1J A;  1IG8 A;  3AVA A;  3D2E B;  1YTU A;  4FWO A;  1ZXO A;  1UA0 A;  5JLF A;  4C8K A;  3T19 A;  1KLM A;  1X3M A;  4E1M A;  4YDU A;  3O6W A;  1L3S A;  3A5L C;  4CIG A;  5C15 A;  4CK2 A;  2DY4 A;  1XC9 A;  3EE9 A;  2WTU A;  1D4X A;  3AVM A;  3C95 A;  1IKY A;  4CBW A;  1VRU A;  4R79 A;  2A42 A;  1NMD A;  3QFU A;  3PV8 A;  1RTH A;  3THV A;  1HNX K;  4GW6 A;  2FBY A;  3K58 A;  4B8C A;  4KTQ A;  2YCH A;  3AGK A;  1LWE A;  3VGK A;  1NK7 A;  3OVN A;  1JCF A;  1SUQ A;  4K42 A;  4Z4G A;  1L3V A;  4CJ4 A;  4YOT A;  4Z0U A;  4J2E A;  4CEB A;  1JXB A;  3PX0 A;  2HBK A;  1R0A A;  3UKR B;  3KKS A;  4OGC A;  3R8E A;  1VQ5 N;  3DOL A;  4FZX C;  1BWF O;  1TV6 A;  3O08 A;  4IWV A;  3TAF A;  4KH6 A;  3PLA A;  1P8Z A;  1Q81 O;  4NLC A;  4BRO A;  5BPL A;  1RDD A;  3PIO L;  1FJG K;  4AHS A;  2RHK A;  4DFM A;  5LMU K;  2HHW A;  3BDP A;  1NKC A;  4H4M A;  4XIU A;  2PY5 A;  2PYJ A;  4I7F A;  2P9I B;  5KTQ A;  1E4G T;  1HJO A;  2NLX A;  1VSF A;  3ATU A;  4IO8 A;  3ZET A;  5C10 A;  4PWD A;  4LSL A;  4DF8 A;  4M45 A;  4FM1 A;  4KRF A;  4I2P A;  4FW1 A;  3QBW A;  3CFP A;  3QNN A;  1LCU A;  3F73 A;  3LAL A;  3G0Z A;  1CZA N;  2E2P A;  1TK0 A;  3S41 A;  2G8W A;  1C0M A;  4BGB A;  4CBU A;  1S1W A;  2UXD K;  1VAZ A;  4J2A A;  1T03 A;  1U49 A;  4RW7 A;  5A2Q O;  4M7Y A;  1QSS A;  4B9T A;  3KKR A;  1FKO A;  4WF9 L;  5KPR A;  1JLE A;  3KK3 A;  4BRK A;  1WSI A;  1QSL A;  1C0F A;  1VSJ A;  3THX B;  4HUF A;  1JJ2 M;  2BAN A;  2V51 B;  4AM6 A;  3DLH A;  3M5R A;  3MEE A;  3P38 A;  2GEL A;  2O8B A;  4BR7 A;  4RTF D;  2YNH A;  1BIU A;  2HND A;  3VF2 A;  3E9O A;  2G8V A;  4O55 A;  4FJL A;  5EX5 A;  1NLV A;  3SQ4 A;  5DMR A;  2OPR A;  1CXU A;  1FXX A;  4E19 A;  5CHI A;  1A5V A;  1C6V A;  1NGI A;  3TAE A;  1SZ2 A;  4DV5 K;  3HSC A;  5LY3 A;  4ILG B;  2OCE A;  4DS5 A;  3E9P A;  5AQI A;  4JEP A;  3WEE A;  1S9G A;  3VGM A;  3ZSW A;  3IMX A;  5KRT A;  3IS9 A;  4E7H A;  5GAE P;  4KBO A;  3HVR A;  3V9U A;  4KRE A;  1YVN A;  4MDA A;  3CCE N;  4NXM K;  4O5F A;  3LDL A;  4Z4H A;  4DKW A;  1ASV A;  4YOY A;  4DQQ A;  2Z1G A;  4KI4 A;  3VA0 A;  1RDA A;  3J7Z O;  1J54 A;  1B9F A;  1BA1 A;  1N6Q A;  3J7A P;  1SQK A;  4FWM A;  1EWR A;  4DV3 K;  5FPE A;  2FBT A;  3A5N C;  1J9A A;  3R6M A;  3TAP A;  2ITM A;  2O8C A;  1RTD A;  3BP8 A;  3WNG A;  3ATV A;  2PFU A;  1QQC A;  5HRS A;  5LMN K;  1J5E K;  4A5A A;  4FLY A;  4DQP A;  4BRD A;  1RFQ A;  1ASW A;  2XY7 A;  4B9S A;  4IO9 L;  3MN5 A;  4JKH A;  1NGD A;  5AR0 A;  3NH2 A;  4JI4 K;  1DT9 A;  4DMN A;  3O1W A;  4WE1 A;  4KB0 A;  4LD0 A;  1BO5 O;  3HK2 A;  1U4B A;  4BRA A;  4CFC A;  3CER A;  1KCF A;  2G8H A;  4FYD A;  2QI2 A;  2A40 A;  3QIO A;  3E66 A;  4W5Q A;  4M3Z A;  3KIO A;  4CZM A;  4W5N A;  2Z1H A;  4PL8 A;  5BRD A;  1X9M A;  2QXF A;  3SI6 A;  3OYH A;  3FFI A;  3AO4 A;  4JKE A;  3QER A;  2UUB K;  4OPH A;  4B9V A;  5AQO A;  2P9P B;  4DQS A;  5GAD P;  1RT2 A;  1KTQ A;  4CZK A;  2OPP A;  3AGR A;  3VET A;  3F9K A;  4W5R A;  2P9S B;  3M8P A;  5CYQ A;  2UU9 K;  3AVJ A;  4AHV A;  4I9L A;  4M42 A;  5JVH L;  2OPQ A;  5E26 A;  2O4I A;  4CEA A;  3HT3 A;  4A59 A;  3THW B;  3KZB A;  2CH5 A;  3CF5 L;  1KD1 O;  3VF6 A;  2E6M A;  4FJG A;  1W97 L;  5DK5 A;  1NGA A;  5BRH A;  1N5Y A;  3WNE A;  3LWL A;  1KRP A;  4LH5 A;  5FRN A;  2P9K A;  4BC2 A;  3QES A;  4B3S K;  4BRM A;  3ASM A;  4IOC L;  4BQL A;  4XH1 A;  3WXJ A;  1C1A A;  5CZ1 A;  3HOS A;  2W6L A;  2BUP A;  3WNH A;  5DM7 L;  3MN6 A;  3L4I A;  3O9R A;  1BCM A;  3F5T A;  1ATS A;  2Q31 A;  3C94 A;  5ELZ A;  1RDB A;  3CPE A;  4Z94 A;  4FPB A;  1Q82 O;  1L3T A;  4N76 A;  3C0B A;  4DTS A;  1X1P A;  4JI2 K;  5AZJ A;  2JGU A;  1TKZ A;  1RT1 A;  4Q5V A;  2HW3 A;  1WOQ A;  1VSD A;  2VG6 A;  4FJN A;  3HYF A;  1C0G A;  2VYP A;  4JI6 K;  1YJN N;  1ESV A;  2QA4 N;  1NWK A;  2YJE A;  4I6M A;  3EYZ A;  1TUY A;  4JI8 K;  3CM6 A;  1HYZ A;  4E0D A;  1OH7 A;  1OH5 A;  2W6K A;  4WYB A;  3D2E A;  5JLH A;  3W0L A;  1XUP O;  5HLF A;  4ZTJ A;  5JVG L;  4E7K A;  4A57 A;  2BGG A;  2HBM A;  4H5R A;  1KAZ A;  4CVN E;  1NK8 A;  4DV6 K;  1FW6 A;  2KW4 A;  5B8H A;  3LP2 A;  4WCE L;  1RBR A;  4CZJ A;  2D4W A;  4CJ5 A;  3FE1 A;  1DTT A;  4DV7 K;  4RW4 A;  3W3D A;  1RT7 A;  4LF8 K;  4MQ3 A;  2ZJR L;  3MWP A;  3MXM A;  5BN9 A;  5CE3 A;  2V52 B;  4YFU A;  1E3M A;  3CQY A;  1NKE A;  3B6O A;  4CGH A;  4OX9 K;  5LL6 Z;  3RSE A;  4M3R A;  3ENB A;  2FSN A;  3CCL N;  4FLT A;  4IZ9 A;  4DSJ A;  4N41 A;  2UYT A;  3K0S A;  3UKR A;  4FPA A;  3AAR A;  3DLR A;  4E7J A;  1VQL N;  3H45 C;  5ADX H;  3CCV N;  4B1W B;  4E3S A;  1WAF A;  3EKS A;  4RCH A;  1IKX A;  3VEV A;  4DR7 K;  3HPG A;  4CK3 A;  4DTR A;  3LDN A;  3LPU A;  5FRM A;  2P9I A;  4BC4 A;  4CJQ A;  3RMC A;  2HHQ A;  1ZBH A;  4CGF A;  2W40 A;  1NJY A;  3B6P A;  3QFP A;  4ID1 A;  3VN5 A;  1NK4 A;  3CQ8 A;  1VSL A;  3U9Z A;  4CJV A;  2RE2 A;  4YHH K;  1LW0 A;  5HRN A;  4H03 B;  3JSM A;  4K41 A;  3SUN A;  1G99 A;  4EFH A;  4CHO A;  1KSP A;  4A62 A;  3SQ2 A;  2O8E B;  2IVO A;  1NJW A;  4IOX A;  3OHR A;  3QEI A;  1QTM A;  4K43 A;  3V1O A;  3OYD A;  1YT3 A;  5M1F A;  3KLH A;  4LF6 K;  5I3U A;  4JK9 A;  3MCA B;  3L8B A;  2NRZ A;  4RG8 A;  3THX A;  1YJW N;  3FLC O;  3TAM A;  2YX6 A;  2ASP A;  1BU6 O;  3CD6 N;  4CE9 A;  4XH4 A;  2GWK A;  5JMV A;  5J2P A;  2P5O A;  1ZBF A;  3TSQ A;  3KHY A;  5FPD A;  3RWU A;  4A61 A;  4BRP A;  3QNO A;  2YNG A;  3EZW A;  4CF9 A;  2VWB A;  3OYN A;  2QWP A;  3Q7B A;  3TAR A;  4BRG A;  1LAV A;  3O3H A;  4YDU C;  4BG9 A;  1VQN N;  1LWC A;  3L2V A;  4FK0 A;  1YVU A;  4ZHR A;  4C23 A;  1WN7 A;  4FWR A;  4PKH A;  4HUG A;  4LC9 B;  1RT3 A;  2NRW A;  3EZ5 A;  1YXQ A;  4ISG A;  1YTA A;  4CES A;  4K0K K;  1BA0 A;  1HUX A;  3S3M A;  4LF4 K;  3O5B A;  5HP1 A;  4PL7 A;  1D9D A;  3DXK B;  3TAQ A;  2AA4 A;  3CC2 N;  2RKI A;  2YKM A;  4IOA L;  3DI6 A;  3ZT1 A;  5BR8 K;  3VEZ A;  3VQB A;  5GAG P;  5BPN A;  4FZY A;  4CJU A;  2ITG A;  4DTO A;  2I5J A;  3H3O B;  4M7X A;  1U6Z A;  4DTX A;  2BE2 A;  2E6L A;  3SJJ A;  1U45 A;  3P1G A;  4E1N A;  3E9L A;  2ETJ A;  1QSY A;  2D5R A;  2I7P A;  4FOE A;  4CGD A;  4BDZ A;  5D3G A;  4CCH A;  4X62 K;  4H0T B;  1N32 K;  1I94 K;  1JLQ A;  4E1J A;  1HNW K;  1I39 A;  4O44 A;  5KGX A;  4PY5 A;  4FSV A;  3JAM O;  3VTH A;  3A2F A;  3TAB A;  4DWI A;  1HQE A;  3CMA N;  4F4K A;  4A2A A;  3NGZ A;  3MX2 A;  2P9N B;  4EHT A;  4R5P A;  3TTD A;  4DU4 A;  1TKT A;  4B1Y B;  1JLC A;  4IEE A;  1QVF M;  1YIT N;  3WQU A;  4JKG B;  4CJT A;  1K8K B;  4JI3 K;  1Z05 A;  2G8F A;  1LAW A;  1QQN A;  4FJJ A;  2ZGY A;  1NG9 A;  1NNE A;  2ATQ A;  2HBJ A;  4IJA A;  4FLV A;  1NU0 A;  3JYT A;  4ISE A;  3BF3 A;  1Y64 A;  3ZYY X;  3THW A;  4QAG A;  3QEP A;  4CF1 A;  4KHY A;  2Y1I A;  1S1V A;  3M8S A;  2O4G A;  4CZF A;  3HRG A;  4IFE A;  2VWJ A;  2QWR A;  1BL3 A;  3S3O A;  3AO5 A;  3IG1 A;  3HO1 A;  2WBN A;  4H5W A;  3CFR A;  1X9S A;  4TSX A;  1GLB G;  3NAE A;  1B92 A;  2DPN A;  3VEN A;  4DFK A;  3A8Y A;  1F21 A;  2QWN A;  3G10 A;  3LWM A;  3KK7 A;  4G9Z A;  1VQ9 N;  3RRG A;  3ZX3 A;  3H46 O;  3MAQ A;  4E7I A;  2F96 A;  3TSP A;  1I3A A;  4DR5 K;  3OA9 A;  3CET A;  1NGH A;  2QTD A;  2VG5 A;  4LFA K;  1GLA G;  3BY5 A;  4JD2 B;  3Q7C A;  4FJ7 A;  3LDP A;  3FZM A;  3RSE B;  3CCM N;  3ZSR A;  2XO7 A;  1YUW A;  1VK0 A;  2F8T A;  3QIC A;  3SAG A;  4MFB A;  5F2R A;  4NO7 A;  1NGJ A;  3VQ6 A;  3ZT4 A;  3CJ1 A;  3ITH A;  3V1Q A;  4CIF A;  2F9W A;  4FLX A;  3L6Q A;  1VQ6 N;  1WB9 A;  3A5M C;  4C1N K;  3QEV A;  1XC3 A;  4QS8 A;  4H5T A;  4JAX A;  4FJX A;  5C25 A;  4BGA A;  3U6F A;  4HWI A;  1KAX A;  4BR0 A;  3T1A A;  4UY8 O;  3U3Y A;  1HNV A;  5SZT A;  4CEO A;  4CEC A;  4YOV A;  3V6D A;  3H1Q A;  1VSK A;  2X78 A;  1NGG A;  4JI7 K;  5EY4 A;  2XY6 A;  1IBK K;  2NRX A;  3IRX A;  1QE1 A;  2OTJ N;  1NJX A;  2QXL A;  1TAU A;  3MDQ A;  5I42 A;  5AQU A;  2PAV A;  5AFU H;  2ZM6 K;  4BG8 A;  4KV8 A;  4IKF A;  4FZZ A;  2UUC K;  5KPT A;  1KQS M;  4BC3 A;  4CD1 A;  2D0C A;  4LF7 K;  1IJJ A;  2RF2 A;  4U67 L;  3OS1 A;  1KC8 O;  3SBG A;  1KXP A;  3KTQ A;  4JKD A;  3BF1 A;  3RRH A;  1JLG A;  3VQ5 A;  3K9J A;  3LAM A;  3DLG A;  3ZEU A;  3K5O A;  3K5M A;  2HHT A;  4MLH A;  3OS2 A;  4N47 A;  4JI0 K;  2KZZ A;  1NGE A;  1U2V B;  5EOY A;  1C0T A;  1YAG A;  3EEQ A;  4CF8 A;  3O4W A;  3BZC A;  3NVK A;  3HST B;  4DTP A;  3OTO K;  2F9T A;  4FWL A;  3LPT A;  4KH4 A;  3L3V A;  1HMV A;  2FF3 B;  4DS4 A;  1RBV A;  3GBT A;  3HJF A;  3VQ8 A;  2OYQ A;  3KLI A;  4DCH A;  3A5O C;  5FPN A;  3FZH A;  1QVG M;  3MK6 A;  3K59 A;  5GAH P;  1X9J A;  3TI0 A;  3EN9 A;  1YIJ N;  1HQU A;  4A5B A;  4B9U A;  4DR2 K;  1NGC A;  5MLC Q;  2O8E A;  1RBT A;  1K6Y A;  3NFA A;  2IOC A;  3CG7 A;  4XH5 A;  1HNI A;  2KZM A;  3SMS A;  1IBL K;  4I2Q A;  3PSI A;  4O4G A;  3DM2 A;  3ENH A;  2B5J A;  2W41 A;  1JLB A;  5T7B A;  1Q9Y A;  4JI1 K;  4A2B A;  1QS4 A;  3EE8 A;  4BDP A;  1VHX A;  4B3R K;  4IG3 A;  1NGF A;  2FBX A;  4AM7 A;  3ZT2 A;  4H0O A;  1LWF A;  4FL9 A;  1UWB A;  4JK7 A;  3KWI A;  5H1S Q;  2Q0R A;  1Q7Y O;  4N56 A;  4JS4 A;  1VSM A;  5EXW A;  2ZQB A;  3DLE A;  2F4V K;  1BGX T;  3LDQ A;  3WQT A;  1OVQ A;  1UOC A;  4ZTF A;  5BRF A;  4DFP A;  1K8A O;  1WUA A;  3WXL A;  3CC7 N;  2OZM A;  1C1C A;  2NNW A;  2XHB A;  3U8X A;  1UAX A;  1REV A;  4CJW A;  1WSG A;  2D0P A;  5TKY A;  1TUU A;  3QBX A;  3L2W A;  1U48 A;  4IFV A;  5JS2 A;  1J5O A;  5AQG A;  3DXK A;  5IWA K;  1MU2 A;  2PYL A;  5AQF A;  2CGK A;  1MDU B;  2X6N A;  4XEI A;  2HF4 A;  3HPH A;  1VQM N;  3G6E N;  2A5X A;  3H3N O;  3OYL A;  2O8F B;  1VQ7 N;  4H5N A;  5C2D A;  1X9W A;  1VSI A;  4DG1 A;  4CF0 A;  4DU3 A;  3FZF A;  4DV1 K;  4FVM A;  4BR4 A;  4CIE A;  1NKB A;  4AHR A;  1V4T A;  3CCR N;  4F8R A;  3AAQ A;  1S6Q A;  3ALY A;  4BRN A;  4FCY A;  4LF5 K;  4B3M K;  4H8K A;  4FJH A;  3VQ4 A;  3OYC A;  4OKJ A;  1O1W A;  4GV9 A;  1XHZ A;  4DSK A;  4K8X A;  5KPZ A;  3NF9 A;  2PZS A;  3FR0 A;  3KD5 E;  2WFB A;  4DSI A;  2DFF A;  4OLB A;  1C0U A;  2P9N A;  1KAY A;  4HCC A;  1K73 O;  3P5J A;  2QWO A;  1TK5 A;  4Z4C A;  3V9Z A;  2A3Z A;  4O8U A;  1GLL O;  3TU5 A;  3KLF A;  4FM2 A;  4JKG A;  3LZJ A;  2WOM A;  3PO4 A;  1P90 A;  3AVL A;  1K8K A;  3I56 N;  3MXI A;  4QS7 A;  3AY9 A;  3D2F B;  1TGO A;  5J1E A;  4FJ5 A;  1Q8I A;  3LP1 A;  3OYE A;  3E1Y A;  3I8D A;  3OY9 A;  3KLE A;  3SCX A;  4FXD A;  1Q18 A;  1OKJ A;  2A6A A;  5AQK A;  3SQ1 A;  1ZBI A;  4Y1D A;  3T69 A;  3L2R A;  2E2N A;  2YHW A;  3AVF A;  4CZL A;  4DLG A;  4FLW A;  4JYA K;  3OYJ A;  5KQD A;  1IKV A;  1XHX A;  2QM1 A;  4CI6 A;  2G8U A;  3T1Y K;  3DJC A;  4CHZ A;  1VQP N;  4OKK A;  4KHN A;  1JLF A;  4ID5 A;  1OVY A;  3V4I A;  4AF1 A;  5CYM A;  5JIC A;  2GWJ A;  3PX6 A;  5FRO A;  2HOE A;  1DEJ A;  1JL1 A;  4CER A;  4GKK K;  1BHL A;  1NMN A;  3PUF A;  3CCU N;  4B8A B;  3EO3 A;  3TAG A;  3KJV A;  4DR3 K;  3J80 O;  4DR1 K;  3M8Q A;  3AVN A;  4DTN A;  3N4P A;  3ENO A;  4BWM A;  3HI0 A;  3ZLJ A;  1HKG A;  3O80 A;  1VQ4 N;  5AQN A;  3KVG A;  3OYF A;  3DMJ A;  1ATR A;  2Q2R A;  3UKU A;  4DTU A;  1HPM A;  1JL2 A;  4JD2 A;  1T3V A;  2VQE K;  5J2Q A;  3WXK A;  5M1O A;  1RDW X;  4CGI A;  4ICL A;  4FK2 A;  3BUZ B;  3THY B;  3OW2 M;  3DLB A;  4EZ9 A;  3ZEU B;  3ZCM A;  4CK1 A;  4UQG A;  3O4Q A;  3JS6 A;  4PUO A;  3IFR A;  3EKU A;  3M8R A;  3VES A;  4OGE A;  4U7B A;  2GTD A;  3DRP A;  3VQQ A;  2HNZ A;  3HPO A;  4K8Z A;  1Z25 A;  4C1N I;  4J2D A;  2E5L K;  1RBS A;  4F2R A;  4JKA A;  1NK5 A;  3K2P A;  4NB4 A;  3H6E A;  2VWK A;  1WLJ A;  4AH9 A;  1IBM K;  4KAZ A;  3C6U A;  5CY4 A;  1V4S A;  2KKZ A;  3WT0 A;  3IAY A;  1JXE A;  3HM8 A;  2XY5 A;  3QB0 A;  4BE0 A;  1DGK N;  3AO3 A;  3E01 A;  3ZSZ A;  3ZT0 A;  1JCG A;  4DR4 K;  2YHA A;  3H1V X;  3JXU A;  1SS6 A;  4CJ3 A;  3HP6 A;  1ATN A;  3OYK A;  3NDK A;  4F3O A;  1BQM A;  2ZWH A;  1S1X A;  2V7Y A;  3CQX A;  4ISF A;  4ILH A;  4CZE A;  3TR8 A;  4IJN A;  3TSU A;  4H0P A;  4JLH A;  3RMA A;  1ZBU A;  3AVI A;  3NH1 A;  1KLN A;  2YI1 A;  4KPY A;  4OPK A;  4NYN A;  4FJM A;  1TL1 A;  2HNY A;  5CR4 A;  1NK6 A;  3AVG A;  1KFD A;  1U2V A;  4AHT A;  1TKD A;  3VEX A;  3ZSQ A;  4JKF A;  4J2B A;  4IFY A;  4B1V A;  3HZ6 A;  4Z4F A;  1EO1 A;  3L3U A;  4G1Q A;  5AQJ A;  3J7Y P;  4FWP A;  4LY7 A;  1GOC A;  3SV4 A;  3OS0 A;  3AVK A;  1L3U A;  2ZJQ L;  3ZT3 A;  1XQS C;  3C6A A;  4CHN A;  1RT5 A;  1TYQ A;  1YHQ N;  3SPZ A;  3NVM A;  3OYA A;  1DTQ A;  5AQR A;  1U47 A;  2E1Y A;  1BIS A;  1SL0 A;  4MLE A;  4JV5 K;  3TTF A;  2P9L B;  1ITG A;  4B9L A;  1LV5 A;  4Y0W A;  2P1J A;  4JHD B;  4JKC A;  5TKW A;  3VOV A;  3NGY A;  3KK1 A;  1T05 A;  3AO1 A;  4BVO A;  1GLC G;  5BR9 A;  1SKW A;  3OJU A;  3RVC A;  3MN7 A;  4BRC A;  4GVE A;  1IO2 A;  2EHG A;  1YI2 N;  4WQ4 A;  5LJV A;  4Z4I A;  4CD3 A;  3PX4 A;  4DTJ A;  4OPA A;  4DV0 K;  4CW7 B;  1NK0 A;  1NBW A;  5FPM A;  2YJF A;  5AQP A;  3LM9 A;  4GV6 A;  3HOT A;  1T6C A;  3HXM A;  2QWL A;  3FFK B;  4BRH A;  1RBU A;  4B3T K;  4FJ8 A;  3O9T A;  3L2U A;  1DLO A;  5F1X A;  4NCB A;  2NUB A;  4CZG A;  2DFE A;  2B4J A;  3OJS A;  5C0Y A;  3ZX0 A;  3I0S A;  4CF2 A;  3SPY A;  5AQM A;  4OLA A;  5ADX A;  3P31 A;  3SLC A;  3LDO A;  5BRE A;  1EXQ A;  4BAC A;  2ZF5 O;  2YNI A;  4GVM A;  4IBN A;  3VEY A;  2O8D B;  3AAP A;  3OBW A;  3O8M A;  1XWL A;  1T7P A;  4ELV A;  2A41 A;  2WUS A;  2HHU A;  2PBD A;  4GNI A;  4I9Q A;  3O1B A;  1IKW A;  1G15 A;  4GY2 B;  4K25 A;  4B1U B;  2IAJ A;  4CGJ A;  1QHA A;  3C65 A;  1Y97 A;  5KQ8 A;  3KWG A;  1EKE A;  1RCH A;  1W0H A;  3BGR A;  1LOT B;  1RNH A;  1EWQ A;  3HM9 A;  2O8F A;  1N34 K;  2QKB A;  3ISN C;  3M6G A;  5LJW A;  2NZT A;  3DXM B;  4KTW A;  4DLE A;  4YOW A;  3ULE A;  4FWK A;  1EQY A;  4F9O A;  4F3T A;  3AVH A;  3SUP A;  1ASU A;  3VQD A;  1WSH A;  3SUQ A;  3WNF A;  3DWL A;  2FF6 A;  4NCG A;  2QWM A;  1EX4 A;  2YNF A;  2VGN A;  2Z1J A;  4BR5 A;  4JK8 A;  3C7N A;  3WUH A;  1VQ8 N;  4EZ6 A;  1HLU A;  3OYB A;  5FDL A;  2DFH A;  3SK3 A;  1D8Y A;  4AHU A;  3DYA A;  4KO0 A;  1MWM A;  2GV9 A;  3MED A;  3SAH A;  4L8R B;  1NM1 A;  4O0J A;  1GLJ O;  3U9D A;  1GOA A;  3CC4 N;  1N8R O;  1HYV A;  3V9S A;  3UKU B;  1JLA A;  2NRT A;  1BIZ A;  1Z26 A;  4B08 A;  4W5T A;  3T3F A;  3VQE A;  3SZ2 A;  3HVT A;  3ZSO A;  2HHX A;  4CHP A;  3NGI A;  4HTU A;  3D2F A;  4PA1 A;  1BI4 B;  3LM2 A;  4PKG A;  2FSJ A;  2W42 A;  3CCJ N;  2IIR A;  4BY9 C;  1U04 A;  4JS5 A;  1HPZ A;  3ZSV A;  1KVC A;  3WXI A;  3LL3 A;  3K57 A;  5C24 A;  3K5N A;  4M3W A;  1HKC A;  4RW9 A;  2AP1 A;  3UB5 A;  1NGB A;  4E89 A;  4YOX A;  1TL3 A;  3L4Q A;  4CEE A;  3VPZ A;  4HVJ A;  4DB3 A;  4BRI A;  2HVH A;  3U3G A;  5BN8 A;  2A1S A;  4AHC A;  4CHY A;  3P4I A;  4RW8 A;  4WQ5 A;  2HB5 A;  3P83 D;  5EVZ A;  4CJL A;  5KGW A;  1GLF O;  1A5W A;  1EP4 A;  4FWN A;  4CFB A;  1FK9 A;  4CJF A;  1W9H A;  3SNN A;  4MDB A;  2FBV A;  3N4Q A;  4NXN K;  3CHW A;  4CZH A;  5AJ3 K;  4H5V A;  1RT6 A;  3EY1 A;  4BDY A;  3AVB A;  2HHS A;  3K9K A;  3MCP A;  1MA9 B;  2KLA A;  4BVP A;  2UXC K;  3NHG A;  2CGL A;  4M3T A;  4E7L A;  2Q3S A;  1Z6R A;  3SMP A;  1NJI O;  3GDQ A;  3O3F A;  4BC5 A;  3CPW M;  4C8O A;  3ZSY A;  3THY A;  1T6D A;  3R3L A;  1S9E A;  1LW2 A;  1WSJ A;  3DRR A;  4HUE A;  2QK9 A;  4ELT A;  3NF6 A;  4KHW A;  3CCQ N;  2QEX N;  3BZK A;  3VGL A;  2P9U B;  3QIN A;  4AQY K;  1ZBL A;  1E4F T;  1SV5 A;  4B9N A;  4BRF A;  2EWS A;  2VG7 A;  3TPQ A;  4KHS A;  4CFD A;  2ZJP L;  2GUP A;  4HCB A;  2P5G A;  4H0X B;  1TYQ B;  2KTQ A;  4BRE A;  3SBT A;  3V1R A;  5IT9 O;  1S6P A;  2V7Z A;  5J2N A;  1JCE A;  5HRP A;  3C6H A;  3QIP A;  1XNQ K;  1QZ5 A;  4PHT X;  4LFB K;  4X65 K;  2E88 A;  1S1U A;  3I0R A;  3SQ0 A;  2EX3 A;  5HL7 L;  3HL8 A;  3MMV A;  4BR9 A;  3MN9 A;  3AV9 A;  4FOI A;  4EAH D;  5AZI B;  3SYZ A;  1GLE G;  3ZSX A;  2F8S A;  2FSK A;  1MWK A;  1WBB A;  4OKE A;  3QEW A;  4KTZ A;  4BRL A;  4O0I A;  2R7Y A;  3TWH A;  4QS9 A;  4KFB A;  2GEM A;  5HRR A;  1J53 A;  2BDP A;  5C12 A;  4DSL A;  2YV0 X;  3CJ9 A;  1W2B M;  5AQQ A;  2E4L A;  1RDU A;  1ILY A;  2GUI A;  3AO2 A;  4DU1 A;  2QKK A;  1XI1 A;  1QZ6 A;  1SKR A;  1Q9X A;  4B1X B;  4LSN A;  2DTU A;  4C8N A;  1ZC6 A;  2Q36 A;  3CJ7 A;  3OYG A;  1IV0 A;  1W7A A;  3G25 A;  1D5A A;  4DUY K;  2BH1 A;  4IXC A;  2OAN A;  5M1P A;  4L3Q A;  1K9M O;  2QW9 A;  3B8A X;  4CEQ A;  3S9H A;  1BUP A;  3O3G A;  4DV4 K;  3CCS N;  4B9Q A;  3VEO A;  3R9P A;  3CI5 A;  2VCP A;  2UUA K;  2P9L A;  4JHD A;  2KFN A;  3NH0 A;  1O13 A;  3RMB A;  1HR0 K;  4W5O A;  2IVP A;  3HTV A;  3ZX2 A;  4AIL C;  3WXM B;  2IVN A;  3D45 A;  4BE1 A;  1Q86 O;  2YHY A;  4JN4 A;  5I9E B;  1SKS A;  3UIQ A;  5AFU A;  3MXJ A;  3MEG A;  4PQU A;  2NRV A;  3QEX A;  1TVR A;  3DOK A;  3CJB A;  3ULE B;  3A0I X;  4C8L A;  3O9S A;  1NOZ A;  3RTV A;  1RT4 A;  4MO5 A;  3L2Q A;  4BWJ A;  1QQM A;  2E20 A;  4IG0 A;  1NOY A;  3AA2 A;  3BEX A;  3C6T A;  5E84 A;  4NYF A;  4JRP A;  2E1Z A;  3QLH A;  3VQ7 A;  2HHV A;  3C7N B;  4DV2 K;  4WFB L;  3PY8 A;  4DFJ A;  2HF3 A;  4KHQ A;  2HVI A;  2O8D A;  4Q0B A;  1RDC A;  4CGG A;  4EIA A;  4YOU A;  1DKG D;  3DLK A;  3SAF A;  3P39 A;  3V9W A;  1L5U A;  4KKO A;  5EU7 A;  1VRT A;  1SL1 A;  1M90 O;  3AVC A;  2Q1N A;  2X74 A;  1C1B A;  1RGI A;  5M1N A;  4LF9 K;  5AQV A;  2FXU A;  2H3G X;  2OA8 A;  3CM5 A;  3T1H K;  5AQX A;  1J6Z A;  4CEZ A; 
#chains in the Genus database with same CATH homology
 2VWJ A;  3QO9 A;  4DS5 A;  1BL3 A;  4NYN A;  3S3O A;  3AO5 A;  2OPS A;  3K5L A;  4HHT A;  1KFS A;  4FJM A;  1TL1 A;  1S9G A;  3IG1 A;  2HNY A;  3ZSW A;  3HO1 A;  5KRT A;  3IS9 A;  3CFR A;  3AVG A;  1NK6 A;  1KFD A;  4AHT A;  4E7H A;  1TKD A;  3HVR A;  4KRE A;  3ZSQ A;  3V9U A;  1X9S A;  4J2B A;  4IFY A;  4Z4F A;  4TSX A;  3L3U A;  3D0P A;  4G1Q A;  4DF4 A;  4Z4H A;  4LY7 A;  1ASV A;  4DQQ A;  1NK9 A;  2Z1G A;  1B92 A;  1GOC A;  5HBM A;  3NAE A;  1A5X A;  3OS0 A;  3AVK A;  3SV4 A;  4DFK A;  1L3U A;  4KI4 A;  3RR8 A;  3ZT3 A;  1F21 A;  4CHN A;  1RDA A;  3VA0 A;  3G10 A;  3LWM A;  1J54 A;  1RT5 A;  1B9F A;  3RRG A;  1N6Q A;  3SPZ A;  1WNS A;  3OYA A;  1DTQ A;  1U47 A;  5KI6 A;  3MAQ A;  4E7I A;  1BIS A;  4NCA A;  2F96 A;  1UA1 A;  5JS1 A;  1SL0 A;  1I3A A;  3AA3 A;  2FBT A;  2VG5 A;  1J9A A;  1ITG A;  5J2M A;  1LV5 A;  2HMI A;  4B9L A;  2P1J A;  4FJK A;  4B3O A;  3TAP A;  4FJ7 A;  3NGY A;  1WSF A;  3KK1 A;  3AO1 A;  1T05 A;  1RTD A;  2YHB A;  3WNG A;  3ZSR A;  2XO7 A;  1VK0 A;  4KHU A;  1SKW A;  1QQC A;  5HRS A;  2F8T A;  3OJU A;  4MFB A;  4C8M A;  4DQP A;  3AA5 X;  3AA4 A;  1IO2 A;  2EHG A;  5K14 A;  3VQ6 A;  3ZT4 A;  5HRO A;  2LSN A;  4F2S A;  4Z4I A;  3PX4 A;  4DTJ A;  3ITH A;  3V1Q A;  4CIF A;  1ASW A;  1RTI A;  2XY7 A;  4FLX A;  3SV3 A;  4B9S A;  4B9M A;  1NK0 A;  3QEV A;  1GOB A;  1NJZ A;  3HXM A;  4FJX A;  5C25 A;  3NH2 A;  3U6F A;  4DMN A;  1BI4 A;  1RBU A;  3LAK A;  4FJ8 A;  3L2U A;  1DLO A;  3T1A A;  4NCB A;  4WE1 A;  2D0A A;  4LD0 A;  4KB0 A;  2NUB A;  3OJS A;  2DFE A;  2B4J A;  1U4B A;  3HK2 A;  4CFC A;  1CLQ A;  2G8H A;  1KCF A;  3U3Y A;  3I0S A;  4FYD A;  2XY8 A;  1HNV A;  5SZT A;  3V81 A;  3QIO A;  4CEO A;  4CF2 A;  1RTJ A;  3SPY A;  4CEC A;  4OLA A;  3OYM A;  3V6D A;  4W5Q A;  4M3Z A;  4FM0 A;  1VSK A;  3KIO A;  1SL2 A;  2X78 A;  1HRH A;  3RR7 A;  2Z1H A;  4W5N A;  1FKP A;  2QXF A;  1EXQ A;  4H4O A;  3OYH A;  2XY6 A;  4CJE A;  3SI6 A;  3IRX A;  3FFI A;  1QE1 A;  4BAC A;  3AO4 A;  4KB1 A;  2YNI A;  4GVM A;  4IBN A;  3KK2 A;  3QER A;  1NJX A;  4B9V A;  1TAU A;  3MEC A;  5I42 A;  4N5S A;  4DQS A;  1XWL A;  1T7P A;  4JRQ A;  1RT2 A;  3DRS A;  4ELV A;  4KV8 A;  4IKF A;  1HYS A;  3LDS A;  4FZZ A;  1KTQ A;  2HHU A;  2OPP A;  4I9Q A;  3F9K A;  1IKW A;  4W5R A;  3M8P A;  5CYQ A;  1G15 A;  2FC0 A;  3AVJ A;  4AHV A;  3LAN A;  4I9L A;  4M42 A;  2D0C A;  2OPQ A;  2O4I A;  1TKX A;  2IAJ A;  2RF2 A;  4CEA A;  4CGJ A;  3HT3 A;  3OS1 A;  4ELU A;  1CXQ A;  3QET A;  2E6M A;  3LZI A;  4FJG A;  4CED A;  4FJI A;  5DK5 A;  1S5J A;  1Y97 A;  3KTQ A;  1N5Y A;  1EKE A;  3WNE A;  3RRH A;  1RCH A;  1CZB A;  3OYI A;  1W0H A;  3LWL A;  1KRP A;  3BGR A;  1ZYQ A;  1JLG A;  4LH5 A;  3VQ5 A;  2WON A;  4DSF A;  3LAM A;  5FRN A;  3VQP A;  1VSH A;  3DLG A;  1RNH A;  3QES A;  3ULD A;  1IH7 A;  3K5O A;  3HM9 A;  3K5M A;  2HHT A;  3OS2 A;  4N47 A;  2KZZ A;  1RIL A;  3ASM A;  2QKB A;  3ISN C;  1C0T A;  1BQN A;  2RN2 A;  3NE6 A;  4GMJ B;  4CF8 A;  1C1A A;  4KTW A;  5CZ1 A;  1QHT A;  4CHQ A;  4DLE A;  1D9F A;  3WNH A;  3HST B;  4DTP A;  4F3T A;  3AVH A;  3SUP A;  4BE2 A;  1BCM A;  3LPT A;  1ASU A;  5CZ2 A;  3VQD A;  3L3V A;  3LP3 A;  3V9X A;  1HMV A;  3C94 A;  1WSH A;  4DS4 A;  3SUQ A;  1RBV A;  3HJF A;  1RDB A;  3LP0 A;  3VQ8 A;  3WNF A;  2OYQ A;  3KLI A;  4NCG A;  1EX4 A;  2YNF A;  1L3T A;  4N76 A;  2Z1J A;  3K59 A;  1T8E A;  4DTS A;  1X1P A;  4OVL A;  3TI0 A;  2B6A A;  1HQU A;  1VSE A;  1TKZ A;  1RT1 A;  2IGI A;  2JGU A;  4CJP A;  4Q5V A;  5FDL A;  2DFH A;  1VSD A;  3OYB A;  2A1R A;  4B9U A;  2VG6 A;  1D8Y A;  4FJN A;  3HYF A;  4AHU A;  4DSE A;  3DYA A;  4KO0 A;  1RBT A;  2GV9 A;  1K6Y A;  3MED A;  3NFA A;  4L8R B;  2IOC A;  3CG7 A;  3NBP A;  4EP4 A;  4O0J A;  1HNI A;  2KZM A;  4I2Q A;  1GOA A;  4O4G A;  3DM2 A;  4Y1C A;  2B5J A;  1HYV A;  2ZE2 A;  3V9S A;  1JLB A;  1JLA A;  5SWM A;  1BIZ A;  1Z26 A;  4B08 A;  4W5T A;  3EYZ A;  5T7B A;  3T3F A;  3CM6 A;  1HYZ A;  3VQE A;  4CJR A;  3SZ2 A;  1Q9Y A;  3HVT A;  3ZSO A;  4E0D A;  2HHX A;  4CHP A;  1QS4 A;  3NGI A;  4HTU A;  1IG9 A;  1S1T A;  3TAN A;  4PA1 A;  4BDP A;  1EET A;  4DTM A;  1BI4 B;  2X6S A;  3H08 A;  4ZTJ A;  5HLF A;  1TK8 A;  4IG3 A;  4E7K A;  2BGG A;  2D0B A;  2W42 A;  2FBX A;  4IDK A;  3ZT2 A;  1NK8 A;  4CJK A;  1KVB A;  1LWF A;  3KD1 E;  1U04 A;  4QOZ B;  2KW4 A;  4JS5 A;  2OZS A;  2IDO A;  1HPZ A;  1UWB A;  3ZSV A;  1KVC A;  3LP2 A;  4N56 A;  3K57 A;  1RBR A;  5C24 A;  2XRI A;  1VSM A;  3K5N A;  4JS4 A;  2G8K A;  4M3W A;  2ZQB A;  3DLE A;  4CJ5 A;  4RW9 A;  1BGX T;  1DTT A;  4E89 A;  4FK4 A;  1TL3 A;  1UOC A;  4CEE A;  4ZTF A;  4M3X A;  4M41 A;  4RW4 A;  4HVJ A;  2RPI A;  4DFP A;  1RT7 A;  2OZM A;  1C1C A;  4M3Y A;  4MQ3 A;  3MXM A;  2ZD1 A;  4PQU A;  4YFU A;  3U3G A;  2XHB A;  2HVH A;  1UAX A;  1REV A;  3VA3 A;  4CJW A;  1NKE A;  2IS3 A;  1BCO A;  1WSG A;  2A1S A;  4AHC A;  3VQC A;  3B6O A;  1B9D A;  1X9M A;  4CHY A;  4CGH A;  4RW8 A;  4M3R A;  2HB5 A;  3P83 D;  3L2W A;  1U48 A;  4IFV A;  5JS2 A;  4CJL A;  4FLT A;  1J5O A;  4DSJ A;  4CFA A;  1TAQ A;  2YKN A;  3NF8 A;  5KGW A;  4N41 A;  3NCI A;  3CFO A;  5KRS A;  1MU2 A;  3DLR A;  4E7J A;  4OPJ A;  1A5W A;  1EP4 A;  1HJR A;  4CFB A;  2PYL A;  1FK9 A;  2X6N A;  4CJF A;  3HPH A;  1W9H A;  4E3S A;  1CZ9 A;  5E41 A;  2FBV A;  3SNN A;  3OYL A;  1WAF A;  1X9W A;  1RT6 A;  3VQ9 A;  3EY1 A;  4BDY A;  1IKX A;  3RMD A;  1VSI A;  2Z1I A;  3AVB A;  2JLE A;  4DG1 A;  4CF0 A;  4DU3 A;  4KI6 A;  2HHS A;  3HPG A;  4CK3 A;  4FW2 A;  3KLG A;  4DTR A;  3LPU A;  5FRM A;  1WSE A;  3NHG A;  4QCL A;  4FVM A;  4CIE A;  1KVA A;  4AHR A;  4DQR A;  4E7L A;  1NKB A;  4M3T A;  2Q3S A;  4F8R A;  4CJQ A;  3NF7 A;  3O3F A;  3RMC A;  4C8O A;  2HHQ A;  1ZBH A;  3ZSY A;  4CGF A;  1NJY A;  1S9E A;  3B6P A;  1S6Q A;  1LW2 A;  2GBZ A;  2IC3 A;  1WSJ A;  3ALY A;  3DRR A;  2P51 A;  4ID1 A;  3VN5 A;  4HUE A;  1NK4 A;  4CEF A;  3CQ8 A;  2QK9 A;  4FCY A;  4YNQ A;  4LH4 A;  1VSL A;  4ELT A;  3NF6 A;  3HP9 A;  4KHW A;  4H8K A;  4CJV A;  4FJH A;  3VQ4 A;  3OYC A;  1LW0 A;  4OKJ A;  5HRN A;  1O1W A;  3CYM A;  3JSM A;  1WAJ A;  1XHZ A;  3QIN A;  4RW6 A;  4EP5 A;  3SUN A;  4DSK A;  3S3N A;  1SV5 A;  1ZBL A;  4K8X A;  2AJQ A;  4CHO A;  3VQA A;  4B9N A;  3NF9 A;  2PZS A;  3KD5 E;  5C42 A;  4CJS A;  1KSP A;  2VG7 A;  4KHS A;  3SQ2 A;  4CFD A;  4DSI A;  2DFF A;  4FLZ A;  4FLU A;  3PO5 A;  1NJW A;  1C0U A;  2P5G A;  4HCB A;  4OLB A;  4FJ9 A;  4HCC A;  3O4N A;  2KTQ A;  2KFZ A;  3P5J A;  3QEI A;  2KQ2 A;  1TK5 A;  4Z4C A;  3V1R A;  3V9Z A;  1QTM A;  4M3U A;  3SUO A;  3V1O A;  1S6P A;  3OYD A;  1YT3 A;  3KLF A;  4FM2 A;  1JKH A;  3KLH A;  5J2N A;  3LZJ A;  5I3U A;  2WOM A;  5HRP A;  3PO4 A;  3AVL A;  4DQI A;  4OJR A;  4Z4E A;  3L8B A;  3QIP A;  2HW3 A;  4RG8 A;  3MXI A;  2G8I A;  4O5B A;  1S1U A;  1TGO A;  3I0R A;  5J1E A;  2Y1J A;  3SQ0 A;  4FJ5 A;  2EX3 A;  1Q8I A;  3AVA A;  3HL8 A;  3TAM A;  3LP1 A;  3OYE A;  3I8D A;  3OY9 A;  3KLE A;  3SCX A;  3AV9 A;  1YTU A;  4FXD A;  1UA0 A;  3SQ1 A;  4C8K A;  4CE9 A;  5J2P A;  3SYZ A;  2P5O A;  3T19 A;  1ZBI A;  3ZSX A;  1KLM A;  4E1M A;  4Y1D A;  2F8S A;  1ZBF A;  1L3S A;  3L2R A;  4CIG A;  3RWU A;  3AVF A;  4CK2 A;  2DY4 A;  1XC9 A;  3QNO A;  2YNG A;  4OKE A;  3QEW A;  4DLG A;  4KTZ A;  4O0I A;  4FLW A;  3OYJ A;  4CF9 A;  3OYN A;  1IKV A;  1XHX A;  3AVM A;  3C95 A;  2R7Y A;  3TAR A;  2G8U A;  1LAV A;  3O3H A;  1IKY A;  4CHZ A;  1VRU A;  3TWH A;  4OKK A;  4KHN A;  1LWC A;  3L2V A;  4KFB A;  1JLF A;  5HRR A;  4FK0 A;  1YVU A;  4ID5 A;  1J53 A;  4ZHR A;  3PV8 A;  3THV A;  1RTH A;  2BDP A;  1WN7 A;  3V4I A;  4DSL A;  2YV0 X;  4HUG A;  5CYM A;  2E4L A;  4GW6 A;  2FBY A;  3K58 A;  1RT3 A;  4B8C A;  5FRO A;  3PX6 A;  2GUI A;  3AO2 A;  4DU1 A;  1JL1 A;  3EZ5 A;  4KTQ A;  4CER A;  1LWE A;  1BHL A;  1XI1 A;  1NK7 A;  3PUF A;  3OVN A;  2QKK A;  1YTA A;  4CES A;  1SKR A;  1Q9X A;  1SUQ A;  4B8A B;  4LSN A;  3TAG A;  2DTU A;  4Z4G A;  3KJV A;  1L3V A;  4CJ4 A;  4C8N A;  4Z0U A;  4J2E A;  3OYG A;  4CEB A;  3S3M A;  3M8Q A;  1JXB A;  5HP1 A;  3PX0 A;  3AVN A;  1D5A A;  4DTN A;  1D9D A;  1R0A A;  3KKS A;  4OGC A;  4BWM A;  3TAQ A;  3DOL A;  4FZX C;  1TV6 A;  2RKI A;  2YKM A;  3TAF A;  4CEQ A;  3OYF A;  3DMJ A;  3S9H A;  3O3G A;  4DTU A;  3DI6 A;  1RDD A;  3ZT1 A;  1JL2 A;  4AHS A;  3VQB A;  4FZY A;  2KFN A;  4CJU A;  3NH0 A;  4DFM A;  2ITG A;  4DTO A;  2I5J A;  3RMB A;  3BDP A;  2HHW A;  1NKC A;  4H4M A;  4XIU A;  4W5O A;  5J2Q A;  2PY5 A;  4DTX A;  2PYJ A;  2BE2 A;  2E6L A;  4I7F A;  4CGI A;  3SJJ A;  1U45 A;  5KTQ A;  3P1G A;  4E1N A;  4AIL C;  4ICL A;  4FK2 A;  1VSF A;  2ETJ A;  1QSY A;  2D5R A;  4EZ6 A;  4CGD A;  3D45 A;  4BE1 A;  4BDZ A;  5D3G A;  3DLB A;  4PWD A;  4LSL A;  4DF8 A;  4CCH A;  4EZ9 A;  4M45 A;  3ZCM A;  4CK1 A;  4UQG A;  3O4Q A;  4PUO A;  4FM1 A;  1JLQ A;  3M8R A;  4I2P A;  1SKS A;  3UIQ A;  1I39 A;  4O44 A;  4OGE A;  4FW1 A;  4KRF A;  3MXJ A;  3DRP A;  3MEG A;  3VQQ A;  5KGX A;  4PY5 A;  2HNZ A;  3HPO A;  3CFP A;  3QNN A;  3QEX A;  1TVR A;  4K8Z A;  3F73 A;  3A2F A;  1Z25 A;  3LAL A;  3G0Z A;  3TAB A;  4DWI A;  1HQE A;  3DOK A;  4J2D A;  4F4K A;  1TK0 A;  3NGZ A;  2G8W A;  1C0M A;  4C8L A;  1RBS A;  4F2R A;  1NOZ A;  1S1W A;  1NK5 A;  3RTV A;  1RT4 A;  4R5P A;  3K2P A;  3L2Q A;  4DU4 A;  1TKT A;  4BWJ A;  1T03 A;  1U49 A;  4J2A A;  4RW7 A;  1QSS A;  1JLC A;  4IG0 A;  2VWK A;  1WLJ A;  4AH9 A;  4B9T A;  3KKR A;  1FKO A;  1NOY A;  4KAZ A;  3C6U A;  3AA2 A;  5CY4 A;  3IAY A;  4CJT A;  1JLE A;  1JXE A;  3C6T A;  3KK3 A;  4NYF A;  4JRP A;  1WSI A;  1QSL A;  3QLH A;  1VSJ A;  3VQ7 A;  2XY5 A;  2HHV A;  4HUF A;  2BAN A;  3PY8 A;  4BE0 A;  4DFJ A;  3DLH A;  2G8F A;  1LAW A;  3AO3 A;  3E01 A;  3MEE A;  3ZSZ A;  4KHQ A;  2HVI A;  4Q0B A;  3ZT0 A;  1RDC A;  4CGG A;  4FJJ A;  2YHA A;  4CJ3 A;  3HP6 A;  3OYK A;  3NDK A;  2ATQ A;  4F3O A;  1BQM A;  1BIU A;  2HND A;  2YNH A;  3DLK A;  1S1X A;  4FLV A;  4O55 A;  2G8V A;  4FJL A;  3V9W A;  3SQ4 A;  5DMR A;  2OPR A;  3JYT A;  1CXU A;  3TR8 A;  1FXX A;  4E19 A;  4KKO A;  5EU7 A;  1VRT A;  1SL1 A;  1L5U A;  3AVC A;  4JLH A;  4QAG A;  3QEP A;  4CF1 A;  2X74 A;  3RMA A;  1C1B A;  1ZBU A;  1A5V A;  1C6V A;  3AVI A;  3TAE A;  4KHY A;  2Y1I A;  1S1V A;  3NH1 A;  3M8S A;  2O4G A;  2OA8 A;  1KLN A;  3CM5 A;  4FLY A;  4KPY A;  4CEZ A;  4OPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...