3P31A

Crystal structure of the ns1 effector domain from influenza a/vietnam/1203/2004 (h5n1) virus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
120
structure length
120
Chain Sequence
b'PASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIKMDQAIMDKTIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTGEDVKNAIGVLIGGLEWNDNTVRVTETIQRFAWR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nonstructural protein 1
publication title X-ray structures of the NS1 effector domain from highly pathogenic influenza A/Vietnam/1203/2004 (H5N1) virus
rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 33
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3p31A00
3KWGA 3O9QA 3P39A 3D6RA 3EE9A 3L4QA 3O9RA 3P31A 3F5TA 3OA9A 3O9TA 2KKZA 3P38A 3RVCA 3O9SA 2RHKA 3EE8A 4OPAA 3O9UA 2GX9A 4OPHA 3M5RA 3KWIA
chains in the Genus database with same CATH superfamily
1Q7YO 3THVA 5B8HA 4CEFA 2E2NA 3OHRA 4BR2A 5E26A 1MWKA 1S9GA 3TTCA 3CPEA 2G8HA 3NCIA 2FXUA 3IUCA 3NVKA 1RTJA 1WAFA 2ITGA 4OPAA 3QESA 1WOQA 5M1OA 2R7YA 4BDYA 3O80A 5GAHP 5AQOA 3VQ4A 4KBOA 1DTTA 4JD2B 2HHHK 3J80O 4CECA 3SZ2A 3VPZA 3A5LC 3OYJA 1T7PA 4DQPA 3M6GA 2QK9A 1NJXA 3VEWA 3TAQA 4H0VB 3CMEN 4O0JA 3ZT0A 4M3YA 1GOCA 1CXQA 4BRHA 1LWFA 3F9MA 4JKGB 4E1NA 3SLCA 3SQ4A 5AQSA 3HPHA 4H5NA 4DV2K 2F8TA 3THXA 3QB0A 3JXUA 1G99A 4YOWA 4DQSA 3AAQA 3A8YA 1K73O 1KLNA 1S1TA 4KB0A 4BVOA 3SBTA 1S22A 2E2QA 2E20A 2P9LB 1XMQK 3RSEA 1T3VA 1KXPA 3C0BA 3LM9A 4X62K 4H5VA 4KTWA 3O8MA 3IRXA 3AGKA 1BCOA 4KI4A 2BUPA 4DB3A 4C1NK 4IDKA 3BY5A 1NGCA 3K0SA 2CH5A 2NRRA 3F5TA 1NK5A 3R8EA 2FSJA 3HZ6A 5H1SQ 4IOCL 3H3OB 1RILA 5D3GA 1ZBIA 2F7TA 3H46O 3U3GA 4KFBA 2PY5A 4ISFA 3CCMN 4B9SA 2OPRA 3AVLA 2ZGYA 4CK3A 2HNDA 4CF8A 5LY3A 4FJKA 3GE1A 4FZXC 2ZM6K 1DEJA 3JYTA 3DLKA 1HR0K 4CE9A 3KWGA 3O5BA 2EHGA 5BRFA 4JHDA 1HPMA 3GOIA 4FM0A 2BGGA 3PSFA 4RW7A 4FJMA 1GLCG 1HKGA 3CC4N 3RRHA 4CESA 3FZHA 1VQKN 3BZCA 3HVTA 3VETA 3SAGA 1KVBA 3MDQA 3QMLA 1W2BM 3OYEA 2P1JA 1I39A 1TL3A 3Q7BA 5AZIB 3PIPL 4BVPA 3L2QA 4HTUA 2KZZA 3LDNA 5TKWA 2VQFK 4DR3K 4DSFA 3B6PA 4FJIA 5C25A 2O8EB 1NGJA 1WLJA 1KLMA 3CFPA 3VF2A 3OYKA 2HHVA 4EIAA 5J1EA 2OYQA 1WSIA 2LSNA 3IG1A 4DR5K 5E84A 1D9DA 1BQMA 4CJWA 3OY9A 4RW9A 1EWRA 2XY5A 5BN9A 2FBYA 4EAHD 3HJFA 3NGYA 2DY4A 3PO4A 4C8OA 3D2FB 2E1YA 1Q18A 1HKBA 4KHQA 3B8AX 2E5LK 4FZZA 4K42A 2QWPA 3S3MA 5EX5A 1VSFA 5J2MA 4CJ3A 3QEXA 3KVGA 4WE1A 3T1AA 2VCPA 4H0TB 1TGOA 3U6FA 5T7BA 3ATVA 4Q5VA 4FOEA 1BU6O 3ZX0A 5JLFA 1BIUA 1U6ZA 2O4GA 5FDLA 5C10A 2Q0UA 4FVMA 4DS5A 4BR0A 3MEDA 2P9SA 2Q2RA 2GBZA 1IG8A 4FLWA 2HVIA 3NHGA 3CCEN 2X6SA 5EU7A 3PIOL 4I7FA 4C23A 1ASUA 3VGLA 3P1GA 1YJ9N 4N56A 4W5TA 2P9UA 2E4LA 1VQON 1R59O 5MLCQ 3NF7A 4ZTJA 4BR7A 4DTPA 2OTLN 4B9UA 5HRRA 2O8DA 3L8BA 1QHTA 1VRUA 2X74A 2KFZA 4CZMA 2D0OA 1NOZA 3VERA 1W9HA 3F9KA 3U9ZA 4H0OA 1ITGA 2QWMA 4Z4CA 4CHYA 4A62A 4PKIA 2FBXA 3HYFA 4BGBA 1RT7A 2D0AA 3MN7A 1CXUA 3MCAB 4OGEA 1TAQA 3O3FA 1SL0A 3VOVA 3CJBA 4DSEA 3NF9A 2HW3A 2YNFA 1TKDA 4PA1A 1S1VA 3G6EN 4CHPA 3HTVA 1MU2A 4PKHA 4B1WB 5GIOA 4N41A 4I6MB 4JYAK 1LOTB 1NGHA 4M63C 4G1QA 3ZETB 3G71N 4BQLA 4CHNA 4DR7K 3V9WA 4F2RA 1BOTO 1RGIA 3I8BA 5C15A 2P9NB 1R0AA 2A5XA 4C8LA 4XH4A 2A42A 5KRTA 1NK8A 3P83D 2E8AA 1NBWA 4LF8K 3S9HA 3U3YA 3KIOA 4PKGA 3DXMA 4W5RA 1QQOA 5GAEP 3B6OA 5ELZA 3OYFA 5BR8K 4A2BA 4DQQA 2E6MA 1QE1A 4F8RA 5F1XA 5DM6L 4HVJA 2I7PA 4KO0A 4E1MA 1FKPA 2HB5A 1JCGA 1ILYA 1I3AA 4IOXA 3KK2A 4N76A 1BO5O 2Z1GA 1QVFM 4IFEA 3VEXA 4MO5A 4HCCA 2WOMA 5AQMA 4DR1K 5I3UA 4K41A 4L3QA 2IC3A 5DK5A 3PLAA 1VSIA 1E3MA 1MWMA 4B3RK 1BI4B 4M3RA 3DLEA 4BE2A 5J2NA 3S3OA 5IT9O 3C6UA 2P9IA 3R3LA 1T44A 3O3GA 4JK8A 4CERA 3AVFA 3GDQA 5KQDA 3DRSA 5HLFA 1HPZA 2VG7A 1RBSA 4KHSA 2E2PA 2QWRA 3TAGA 4Z4IA 3E66A 1SV5A 3LDSA 2E88A 3IKMA 3CJ7A 4E7HA 4WF9L 3TANA 4HCBA 2HHWA 4MDBA 2BTFA 2VWJA 1ZBHA 4CW7B 3AA3A 4FWKA 2FBVA 4KH4A 5AQUA 5KGWA 4QS7A 3KWIA 3BEXA 3SV3A 1BA1A 1HJOA 1GLDG 3E9PA 4JKBA 1YTUA 3ULEA 2VGNA 5AQWA 4FM1A 1SKRA 4A5BA 3BP8A 4LF5K 3KKRA 2HHXA 3OYHA 3KK1A 1B92A 3SPZA 2Q31A 4JKDA 3CI5A 1SKSA 4IOAL 1DLOA 4M42A 2ZJRL 3H3NO 1RDWX 4IXCA 4CGFA 5FPMA 1BQNA 4AM7A 3K5NA 3E9OA 3VQBA 4DV5K 4FM2A 1RFQA 1RDCA 3R6MA 3QEWA 3AVAA 3VENA 4B9TA 1IBMK 4CJ7A 3RWUA 4GV3A 1HNZK 4FJGA 2QKBA 3THYB 4QS9A 1IJJA 1S9EA 3DRRA 1RDAA 4WFBL 4JS5A 3SI6A 3FZMA 4JRQA 4J8FA 4BGAA 1XNQK 4R79A 2G8VA 4FCYA 4B1XB 4FLUA 2OZSA 1K8AO 3I8DA 3O9TA 5AQRA 3QERA 3J7YP 4DQIA 4FZYA 4CIGA 1VQNN 4KREA 4KAZA 4YDUA 3PUFA 1Y97A 1VRTA 3UKRA 4CVNE 3FLCO 4KHNA 1BIZA 2Z1HA 3L3VA 1D5AA 3M3ZA 1RBUA 3L4IA 4QCLA 4LSLA 3GG4A 1OVYA 1U2VB 3RMDA 2KQ2A 4KPYA 1N5YA 4X64K 3EE8A 3NVMA 4CJLA 2VG5A 5LJWA 2AJQA 2UU9K 2P9KA 1Z05A 1JJ2M 3ZYYX 3VESA 4CHZA 2O8BA 4M7YA 4FWSA 2BE2A 1D9FA 4BRPA 4NLCA 2G8KA 2YCHA 3WXJA 4CD3A 1GOAA 5AQHA 3ID8A 3ZSWA 1O1WA 2QXLA 3F2KA 4DWIA 5C24A 1C0GA 5AQFA 4YOTA 4ZTFA 4DFJA 4CFDA 1S5JA 4O44A 1C1BA 4CJUA 1L3UA 3LAMA 4BACA 5KGXA 1HNVA 3MMVA 1WSJA 3SAHA 4IJAA 5EY4A 5LJVA 1ZXOA 2VYPA 2KZMA 5J2QA 1E4GT 4NLBA 1NJWA 1B9FA 1KTQA 3QEVA 5HROA 3AA2A 4Y1CA 2HNYA 3I33A 4DTRA 3DOKA 2YX6A 4AHVA 4Z4HA 2NRTA 5CYMA 4IJNA 4IO8A 4XH1A 2NRZA 3PX4A 2F8SA 1ZBUA 2Z1IA 3CIPA 4CJEA 1WUAA 4TSXA 5AQPA 3LDPA 1Z6RA 2OANA 2P9PB 2XY7A 1IKYA 3O3HA 4RW6A 1ASVA 3DXKA 4JHDB 2FSNA 1N34K 3ZSYA 1TAUA 2ASOA 4FJ9A 3EZ5A 2XO7A 2GTDA 5AQGA 1GLFO 1REVA 4OLBA 3NE6A 1QHAA 3IMXA 4C8NA 3CC2N 1TL1A 4WCEL 2HF3A 1TK0A 3QBWA 3QEIA 3O9QA 1K9MO 4QAGA 1EO1A 3DYAA 3LDLA 1NK0A 2ASMA 4AHSA 2IVNA 1J6ZA 4LC9B 3O4NA 4ICLA 3HL8A 3UIQA 4Z4FA 4LH4A 1RBRA 1KVCA 3C95A 3HOSA 4ISEA 1OKJA 4EFHA 4CF1A 1Q86O 3QFPA 5BRHA 2PZSA 4CGIA 4PL8A 5M1QA 1SUQA 1Q9YA 2PFUA 2FSKA 3HP9A 1P90A 4FSVA 2VQEK 3OJUA 3AAPA 3OYMA 3ZCMA 4BRAA 1BDGA 4O8KA 1IBLK 4BE0A 4CHQA 3NF6A 3AVJA 4LH5A 1NK9A 1X9WA 3QICA 3UKUA 2W42A 1M1KO 2XY8A 2DPNA 5GAGP 1YAGA 1UA0A 2NRWA 1EKEA 3CJ1A 1S1WA 4KI6A 3VQCA 2HVHA 4RWTA 1VQ9N 4CD1A 5LMUK 2WTUA 2HNZA 3A0IX 3TU5A 2XRIA 3AO1A 4WQ5C 3MWTA 2OZMA 3LPUA 2AP1A 4L8RB 4DSLA 4Z0UA 3RR7A 3VA0A 1KRPA 4N47A 4HUFA 1SL2A 4B3OA 3ZEUA 2P9UB 4DTJA 1Z25A 1BL3A 4YDUC 4O55A 2QI2A 3DAWA 3R1XA 1LW2A 3MXJA 1J5OA 1NKEA 4IG3A 3WXIA 3IFRA 1KQSM 3RMBA 1FXXA 3DM2A 3SAFA 3V9SA 4DU3A 3QIOA 4DFMA 1U49A 5FPEA 4HTLA 1N8RO 4DV4K 2OPPA 3KK3A 3AO5A 4LFCK 3DMJA 5FROA 5M1NA 1DT9A 5J2PA 2RHKA 3NH2A 2Q0RA 3MN9A 2Z1JA 1FKOA 5JICA 3AVGA 4HWIA 4ELTA 4OPHA 4AHTA 4CZLA 4LSNA 1W7AA 1ZBLA 3D45A 2E1ZA 4J2DA 3TAEA 1GLEG 4FPAA 1VQ6N 1XMOK 1QQCA 4YOVA 3C65A 4IEIA 3ZT4A 1X9JA 2JGUA 3DJCA 3DXMB 4FWNA 1NG9A 3AVHA 2QA4N 1RNHA 1HUXA 1QQNA 4HUEA 3EN9A 3SQ1A 4JKAA 4FPBA 5CR4A 3OBYA 5HBMA 3FGUA 3ZX3A 3HXMA 3JAMO 2QEXN 3QETA 2Y1JA 5BPLA 2O8FA 1U48A 4LD0A 1IKWA 4PY5A 1VQ7N 4E3SA 2ZF5O 2F96A 3M8PA 4KHYA 3J7ZO 3C7NA 3AVMA 4E0DA 1IBKK 3QNNA 4FWRA 2H3GX 4KKOA 2W41A 5CY4A 4CFBA 3K5OA 4CF2A 3DLBA 3NH1A 1TYQA 4IDHA 2HBJA 4DSKA 3WUHA 1U4BA 1QSSA 1WSHA 2CGKA 3FE1A 3VQDA 3WT0A 4CCHA 1FK9A 1ATNA 2YNIA 1XNRK 1QS4A 3FFIA 2HHQA 1C0MA 2AA4A 2D4WA 3FZFA 2IAJA 4F2SA 1VK0A 3MN5A 3ZSXA 5AQJA 1ZC6A 3DLRA 4DV7K 3JSMA 1EQYA 4JKHA 5CZ1A 2YHYA 4Y1DA 3AO4A 1RDUA 3RTVA 4FJ8A 3O9UA 4CJ5A 3C6AA 4CZKA 5ADXA 4DS4A 1BGXT 1LWEA 3HP6A 3L6QA 1T6DA 2QM1A 3K9KA 3P39A 1NGGA 3TSQA 2HMPA 4FJJA 4FWPA 1YXQA 2Q1NA 1U45A 5BR9A 3I56N 1HNIA 1SKWA 3RVCA 3LL3A 3MCPA 4I2PA 4B1VA 3LP1A 3MEEA 2YJEA 3SUNA 1CZBA 4UY8O 1A5VA 2HMIA 1SS6A 3RMCA 2UYTA 4QS8A 5EVZA 4JD2A 4BC2A 2WUSA 2I7NA 4EHUA 5M1KA 3ZSVA 4IFYA 4XIUA 4YOXA 1X3MA 2QWLA 3TTFA 4AM6A 1U04A 4DF4A 4O5FA 4KRFA 3QNOA 1TKTA 5C2FA 1LV5A 1RBTA 1L3VA 3O9SA 1YJWN 2F4VK 3EKSA 3QIPA 4DV6K 4KHPK 4OGCA 1Q8IA 4FWLA 1T05A 3AO3A 4CJQA 1KCFA 4BR9A 3TAPA 4AHRA 5K14A 3CCRN 3A5OC 4EP5A 1WSFA 4FLYA 4CEQA 4X66K 2OTJN 1NKCA 4OPKA 1C6VA 1YJNN 4DTSA 3AVIA 5KQ8A 1V4SA 3S41A 2F9WA 4AHUA 4OX9K 4KTQA 2QTDA 3OS2A 3CCUN 3RR8A 4KTZA 3SUOA 1XQSC 3ISNC 4B1YB 1RT2A 3O4WA 1VQMN 4OO1J 3LWLA 1GLLO 4BC4A 4GMJB 4PQUA 1NWKA 2VGMA 4PL7A 4DSJA 4IWVA 3CG7A 4CJRA 3LP0A 1VAZA 4LF4K 1JLQA 4CJSA 5M1FA 3VMFB 4K25A 2FF3B 1C1CA 3VGKA 1HNWK 2A40A 1RT3A 3U9DA 3TTDA 4ILHA 4JAXA 4YORA 2P9KB 4DLEA 3CYMA 4FJHA 5E41A 1WB9A 2PAVA 2GV9A 3ZSOA 1QVGM 3AA5X 5A2QO 4JNEA 5JLHA 1QSLA 3SJJA 3VEOA 4A61A 4KHWA 2GUIA 1N36K 3NFAA 4JKEA 1VQ5N 4CJKA 1K8KB 2O8EA 2ZJPL 1BA0A 3MK6A 3AO2A 3D7EO 4DMNA 4DFPA 2EWSA 1U47A 1JL1A 1ZBSA 4E1JA 2W6KA 4NYFA 2KFNA 2A1SA 3O1WA 2IS3A 1S3XA 3P38A 3OYIA 1XUPO 4XH5A 1JL2A 5GADP 2FLOA 2Q3SA 4O4GA 3WEEA 5AR0A 1YTAA 3VQ7A 1S6PA 3I55N 3WNHA 3K59A 1OH7A 4ZHRA 1T8EA 4FVUA 3ASMA 2G8UA 1QQMA 3TAFA 2PBDA 4OPJA 1TUUA 1J53A 3DXKB 3VEYA 4DTOA 3MXIA 2IOCA 2QWNA 2ETJA 4OLAA 3VQPA 5AZJA 2UUBK 4Z4GA 1JLEA 1YVUA 2YV0X 3KLGA 2KLAA 3CM6A 1JLBA 4Q0BA 5BPMA 4FWMA 1Q9XA 1XWLA 4K43A 1WSGA 1S1UA 4NXMK 4KH5A 5AQNA 3VQQA 1NNEA 4E7KA 2NRXA 3AGRA 5HOOA 3OA9A 1C0UA 4DR6K 4BRDA 3NDKA 4CK1A 3DLLL 3LP3A 1Y64A 3SMSA 5HRSA 4FXDA 4CF0A 4BROA 3EZWA 4CGGA 3HM8A 4KH6A 5AQLA 4MFBA 2HHUA 1FJGK 4BRMA 4CFAA 3OYNA 5C0YA 1NMNA 3BDPA 4GVEA 4WQ4A 2YNGA 3TWHA 3UE5A 5FPDA 3KLFA 4WQ5A 4BRCA 4DTUA 3OYLA 5I42A 2GWKA 5JVGL 2W40A 3EL2A 1BUPA 1SQKA 1O13A 1NM1A 4CEBA 2KKZA 4DKWA 1NOYA 2NRHA 2ZGZA 4Y0WA 4AHCA 1OH8A 3NH0A 4H0XB 2V51B 5AFUA 4HHTA 5CE3A 3J8AA 2B6AA 3ZSQA 3EEQA 3UKUB 3D0PA 3O08A 1NMDA 4IEEA 4CJPA 1DKGD 5LMNK 4LF6K 4RG8A 2RKIA 1E4FT 4J2AA 3ZETA 4JI3K 4JKCA 4H5TA 2CGLA 1X3NA 5F2RA 3CJCA 4IFVA 2O4IA 3VQ9A 3AV9A 4LY7A 3CQ8A 2ATQA 4FYDA 2CH6A 4BRKA 3K5MA 1NGEA 3SBGA 2VG6A 4BG8A 1EXQA 1LAWA 4BRFA 2UUAK 3QO9A 4GW6A 1JLGA 2V52B 3ZEUB 3ZSRA 5FLXO 3THXB 1W0HA 1N32K 4EZ9A 4JK9A 5CZ2A 4E7LA 1RTDA 3ATUA 3L0QA 1EP4A 3N4QA 5AQIA 3RSEB 4PUOA 2HF4A 1VSEA 1KAZA 1RBVA 4YNQA 3LDQA 4B9MA 5KPRA 1UA1A 1KAYA 1S6QA 4A2AA 3CMAN 4B1UB 3LWMA 1XHZA 2QW9A 1KFDA 3CM5A 1JCFA 4B9LA 1BG3A 1ZYQA 2F9TA 1BI4A 1A5XA 1TUYA 3BF3A 3C6TA 3KKSA 4E19A 3HSCA 3FZKA 2X6NA 3PX0A 3T7ZA 3KZBA 4FJNA 3VGMA 3AVBA 5BREA 1OH6A 2Q36A 4CJTA 3SUPA 3H45C 1C1AA 1F21A 4CK2A 3OS1A 4IKFA 3MXMA 3HBTA 4CGJA 1UWBA 1YITN 5AQTA 4U67L 3PV8A 4DHYA 1YUWA 1UAXA 2YI1A 3VQ6A 3CC7N 2YHXA 4IG0A 4CGHA 4JV5K 3T1YK 3V81A 3QINA 4DF8A 4CZEA 4ID5A 4DQRA 2O8FB 4W5OA 3DRPA 2OCEA 2J4RA 1JCEA 4M45A 3WNGA 3BF1A 4A59A 4MLHA 4MDAA 4NB4A 4O5BA 5GINA 3M1FA 3G4SN 2Y1IA 1FW6A 1HYZA 2NNWA 4H03B 5EXWA 3D6RA 4BWMA 1X9SA 1KD1O 1ESVA 4F3TA 5SZTA 1TV6A 5CYQA 4FJ5A 2OA8A 1VSHA 1JLFA 4F9OA 3KTQA 3I0SA 3LP2A 3D2EA 3K5LA 4OKKA 2D0PA 1NGAA 1J5EK 1WSEA 3CJ9A 3A2FA 3MEGA 1IH7A 3EY1A 3WNFA 4CZJA 1GLAG 4J2BA 1N33K 4ILGB 5FRNA 4FJLA 4R5PA 2XY6A 5KRSA 2UXCK 1RTHA 2JWKA 3KLHA 3DLGA 3DOLA 3ALYA 3CERA 1JLCA 4FOIA 3CHWA 1OH5A 3NGIA 3OYAA 2FF6A 1RCHA 5EOYA 3CCQN 4J2EA 4WQ4C 4FJ7A 2P9SB 4FL9A 4OKJA 2HBKA 3J81O 4YY3K 3QLHA 4BC3A 1KC8O 4M3TA 1S1XA 2RE2A 3C6HA 3VQEA 1NLVA 5JMVA 2PYLA 1VSDA 3ZX2A 1WAJA 4KHUA 3SYZA 4C8KA 2WC9A 4M3UA 4W5NA 4B8CA 1U2VA 2NRVA 4AF1A 4ILJA 3T69A 1KVAA 5HRPA 4CBWA 1MA9B 3ULDA 3HPGA 2WBNA 4RTFD 2O8DB 1GLBG 1EX4A 3QFUA 3L2UA 3HPOA 3H1VX 1DGKN 1CZAN 4FLTA 4CEZA 1L3TA 3CETA 1WBBA 5HP1A 1L3SA 2VWBA 3K58A 3EO3A 1NK7A 1VQPN 3PX6A 1BHLA 2YHAA 3V1RA 2JLEA 4B3SK 1TKZA 1WNSA 1YT3A 1WBDA 1QSYA 3H1QA 3CQYA 4BRNA 3KHYA 2YHWA 4EP4A 4BR5A 1VHXA 2WFBA 2QKKA 4FK4A 1RTIA 2G8WA 1IKVA 4DV3K 2RF2A 1IV0A 2UXBK 5GIPA 5AQKA 3HK2A 4H0YB 1XHXA 2D0BA 4CEDA 1DTQA 3EKUA 2D5RA 1T03A 3RMAA 5ADXH 1QZ5A 2HSTA 4CEAA 2RN2A 3K9JA 4B3MK 2P9PA 4GY2B 4B9NA 3BZKA 3V9ZA 2XHBA 3HRGA 4CBXA 3KD5E 4EZ6A 3THWA 4FO0A 3L2WA 4G9ZA 4DLGA 1GLJO 3HOTA 4K8ZA 4LFBK 2UXDK 3T3FA 4C8MA 3KLIA 4CI6A 1NGFA 4NCBA 1NGBA 4K0KK 4DR4K 3WQUA 5I9EB 4CF9A 3V9UA 4RW8A 3MN6A 4JN4A 2OPSA 3N4PA 4AILC 3OBWA 4GV6A 2YJFA 3Q7CA 1KAXA 4CHOA 3MX2A 2P9IB 2O8CA 2A3ZA 3H08A 3DWLA 3M8RA 3ZT2A 3CXCM 4M3WA 5AQVA 4IO9L 4BDPA 3LM2A 1A5WA 2YNHA 3VF4A 4DFKA 3VTIA 1VQ8N 3L2RA 1HMVA 2QWOA 3IS9A 4NCGA 1Q82O 3SUQA 1OVQA 1XC3A 3WEEB 4JI5K 2FBTA 2W6LA 2GELA 5FRMA 4X65K 4JI8K 5BPNA 4LFAK 3V1OA 1IG9A 4I9LA 3MX5A 4JI1K 1YI2N 1VSKA 4IBNA 5AQYA 4BC5A 3OYDA 4M41A 4CIEA 3MWPA 3KLEA 1W97L 2KW4A 3ULEB 3HSTB 2IDOA 3V6DA 2X78A 4PHTX 5AZJB 5LL6Z 1CLQA 4DG1A 5JS1A 2YHBA 5KI6A 2KHOA 3G10A 4DSIA 1HX1A 3T1HK 1LCUA 4NYNA 5AQZA 3M8SA 4V19S 4FJXA 3LZIA 3L3UA 3KD1E 4BG9A 4JK7A 2OPQA 3SPYA 5TKYA 5F0XA 3GBTA 1RT5A 3L2VA 5BN8A 3V9XA 3J7AP 4JI4K 4ISGA 3KJVA 4JKGA 4BRIA 5AQQA 3FFKB 3U8XA 1B9DA 4CEEA 1EWQA 4YFUA 4E7IA 3W3DA 1RT4A 1L5UA 1HLUA 3AY9A 4BDZA 3CCVN 1TVRA 3NAEA 2RPIA 3DLHA 3P31A 4OVLA 2P9LA 4H4MA 2QWQA 5DM7L 4CZFA 3P5JA 3OJSA 4BWJA 3ZT3A 4O0IA 4YOUA 1KFSA 2FC0A 2HOEA 4BY9C 2Q97A 3UKRB 5KPZA 5CHIA 3TSPA 4F3OA 3EE9A 1VSJA 3HT3A 2DFEA 4C1NI 2V7ZA 1ZBFA 2BDPA 2HHSA 1YIJN 3BGRA 4FK0A 3AVCA 4OKEA 4RCHA 5C12A 3G25A 4CJ4A 2I5JA 3FR0A 4UQGA 4E7JA 4H8KA 4XEIA 4DU4A 3O1BA 3SV4A 1VQ4N 3KK7A 2IVPA 4AQYK 1GOBA 4LF9K 3QDKA 4BR4A 3LDOA 2YKNA 3WXLA 1YF5L 5C42A 1UOCA 1VQLN 2O8BB 4I9QA 4M3XA 3RRGA 1TK5A 2BANA 2IVOA 2A1RA 1I94K 3TABA 3SJHA 3CCLN 4WFAL 4H5WA 5AZIA 2NLXA 5JVHL 4FK2A 3CJAA 4FWQA 3OW2M 3OTOK 3ZLJA 3AARA 4A57A 3NMUA 1YHQN 4MLEA 2PYJA 3HI0A 3DI6A 2ITMA 1XI1A 3U4LA 2ASPA 4H5RA 3SQ0A 4HUGA 1T6CA 1JLAA 1HQEA 3E9LA 3V1QA 3UB5A 4DTNA 2EX3A 2JWLA 4IZ9A 4GVMA 3NF8A 3TR8A 3LALA 3CQXA 3C94A 4Z94A 4RW4A 4H4OA 3TSUA 3O6WA 4B3TK 4BRLA 3D2FA 4M3ZA 2A6AA 3AA4A 2HBMA 3NGZA 3AVNA 4CJFA 5M1PA 4FLZA 1G15A 3SQ2A 3HM9A 4WYBA 3ZT1A 3WQTA 2D1KA 3ZSZA 4BREA 2D0CA 2V7YA 4BE1A 3SK3A 3S3NA 5SWMA 1HYVA 4U7BA 1RDBA 5AFUH 4CBUA 2DTUA 3VTHA 2G8IA 4FW1A 3K2PA 1NJYA 3NBPA 4JRPA 2ZD1A 4FLXA 3VN5A 3WNEA 4F4KA 4CFCA 1JKHA 2B5JA 4DTMA 1VSMA 2GWJA 3A5NC 4GKKK 1SL1A 3TPQA 3PO5A 1HNXK 3IDHA 1HRHA 4O8UA 1XC9A 1ATRA 1P8ZA 3OYCA 3V4IA 1NU0A 4MQ3A 3BUZB 3I0RA 3P4IA 1LW0A 1YVNA 3L4QA 2HBLA 3FZLA 4JI2K 3WXKA 2ZJQL 2ZWHA 4DV0K 1LAVA 4KB1A 3VEZA 3EYZA 3TAMA 3HO1A 2ZQBA 3MAQA 1EETA 4CGDA 4WFNL 3T19A 4M7XA 1JXEA 3ITHA 5HL7L 3D2EB 4PWDA 1BWFO 3ID6A 3H6EA 4GKJK 1H1VA 3OS0A 3CD6N 1CZ9A 3SNNA 2WONA 1HKCA 3PSIA 4MO4A 1D8YA 3VQ5A 4I6MA 3JS6A 2KTQA 1WN7A 5KPTA 1M90O 4FW2A 1NJZA 4B9VA 3VEVA 1RDDA 1NJIO 1HQUA 4A5AA 4Z4EA 2P51A 4JEPA 4JKFA 2P9NA 3GL1A 2G8FA 4CIFA 3CFRA 1JXBA 3F73A 4QOZB 5KTQA 4DU1A 3O4QA 1NGDA 4CZGA 2B4JA 4CEOA 1TK8A 1TKXA 3M8QA 2DFHA 4JLHA 2HHTA 4W5QA 3MECA 4JS4A 1KSPA 1BCMA 3K57A 1VSLA 3TARA 3CFOA 4DUYK 3CCJN 4BRGA 3G0ZA 5FPNA 3M5RA 1NK4A 1NKBA 4B9QA 2BH1A 4YHHK 1J9AA 3QBXA 2UUCK 3ENBA 4CJVA 4DCHA 4OJRA 1C0FA 3CCSN 3O9RA 4JI6K 1X1PA 1V4TA 4DQ8A 4FWOA 4I2QA 1K6YA 4ID1A 3VF6A 4ELUA 1Q81O 4CZIA 1J54A 3VQ8A 1K8KA 3WXMB 1HYSA 2DFFA 4JI0K 4LF7K 2GUPA 2NZTA 4N5SA 4DV1K 5IWAK 1IKXA 1LWCA 4YOYA 4B8AB 3ENHA 1SZ2A 4GV9A 3CF5L 3LZJA 3IAYA 1S72N 2E2OA 1ASWA 4CZHA 3PY8A 3VA3A 4DTXA 4H0PA 2GX9A 2GEMA 2ZE2A 2E6LA 3HVRA 2A41A 1N6QA 3CPWM 2NUBA 1SAZA 2YKMA 3SCXA 5AJ3K 5DMRA 1BISA 2P5OA 3OYGA 4NO7A 1NK6A 2P5GA 2QXFA 3LANA 3SMPA 3W0LA 1NGIA 5BRDA 5JS2A 1MDUB 2VWKA 3THWB 1X9MA 1IO2A 3LPTA 3C7NB 4AH9A 3E1YA 5AQXA 1QTMA 3VQAA 4B08A 4EHTA 4K8XA 5C2DA 2CGJA 1TYQB 1HJRA 3QEPA 1ATSA 5HRNA 4KV8A 4ELVA 1QZ6A 4FLVA 1C0TA 3AVKA 2IGIA 2IIRA 3OYBA 1Z26A 1D4XA 3TI0A 3E01A 3R9PA 4DUZK 2O8CB 3OVNA 4BRQA 4NXNK 4NCAA 4DR2K 1RT1A 4JI7K 3LAKA 3ENOA 3THYA 4E89A 3A5MC 4B1ZA 4BQZA 1RT6A 4GNIA
chains in the Genus database with same CATH topology
1Q7YO 3M3ZA 3OBWA 4GV6A 3L4IA 2YJFA 5B8HA 2PAVA 3Q7CA 1KAXA 2E2NA 3OHRA 4BR2A 3MX2A 2P9IB 1QVGM 5E26A 2A3ZA 1MWKA 3DWLA 3TTCA 3CXCM 3GG4A 1OVYA 4JNEA 5AQVA 1U2VB 5JLHA 3CPEA 4IO9L 3LM2A 2FXUA 3IUCA 3VF4A 3NVKA 3EE8A 3NVMA 3VEOA 4A61A 4OPAA 3VTIA 5LJWA 1VQ8N 2P9KA 2QWOA 1Z05A 1WOQA 4JKEA 1JJ2M 5M1OA 3ZYYX 1VQ5N 3VESA 1Q82O 3O80A 5GAHP 1XC3A 5AQOA 3WEEB 4M7YA 2GELA 4FWSA 1K8KB 4BRPA 4KBOA 4NLCA 4JD2B 2ZJPL 1BA0A 3MK6A 5BPNA 3VPZA 3D7EO 2YCHA 3A5LC 2EWSA 3WXJA 4CD3A 3MX5A 5AQHA 1ZBSA 3ID8A 1YI2N 4E1JA 2QXLA 5AQYA 4BC5A 3O1WA 3F2KA 3M6GA 1S3XA 1C0GA 3P38A 5AQFA 3VEWA 4YOTA 3MWPA 1XUPO 4XH5A 1W97L 3ULEB 5GADP 2FLOA 4H0VB 3CMEN 3WEEA 5AR0A 4PHTX 5AZJB 4BRHA 3MMVA 3I55N 3F9MA 4JKGB 3SAHA 3SLCA 4FVUA 4IJAA 5EY4A 2KHOA 5LJVA 1ZXOA 4H5NA 5AQSA 1HX1A 1LCUA 2VYPA 5AQZA 3QB0A 1QQMA 3JXUA 1G99A 1E4GT 4YOWA 4NLBA 3AAQA 3A8YA 2PBDA 1K73O 1TUUA 4BVOA 3SBTA 4BG9A 1S22A 4JK7A 2E2QA 3DXKB 5TKYA 3VEYA 5F0XA 3GBTA 3I33A 2QWNA 2E20A 2P9LB 2YX6A 5BN8A 2NRTA 4IJNA 4IO8A 4ISGA 5AZJA 3RSEA 4XH1A 2NRZA 1T3VA 4JKGA 4BRIA 1KXPA 3C0BA 3LM9A 3FFKB 5AQQA 4H5VA 2KLAA 3CIPA 3O8MA 3U8XA 5BPMA 3AGKA 4FWMA 4K43A 2BUPA 1WUAA 5AQPA 4DB3A 3LDPA 1Z6RA 4C1NK 2OANA 3W3DA 4KH5A 2P9PB 1HLUA 3AY9A 5AQNA 1NGCA 3CCVN 2NRXA 3DXKA 4JHDB 2CH5A 3AGRA 2FSNA 2NRRA 3P31A 5HOOA 2P9LA 3F5TA 3R8EA 2FSJA 3OA9A 3HZ6A 2QWQA 5H1SQ 4IOCL 3H3OB 4BRDA 5DM7L 2ASOA 4CZFA 3DLLL 2F7TA 3H46O 1Y64A 2GTDA 4ISFA 5AQGA 3SMSA 3CCMN 1GLFO 4BROA 3EZWA 4YOUA 2ZGYA 3HM8A 4KH6A 5AQLA 1QHAA 3IMXA 2HOEA 5LY3A 3GE1A 3CC2N 4BRMA 4WCEL 1DEJA 2HF3A 4BY9C 5C0YA 3QBWA 2Q97A 3KWGA 3O5BA 4GVEA 4WQ4A 3UKRB 3O9QA 5BRFA 4JHDA 3UE5A 5KPZA 1HPMA 3GOIA 5FPDA 3TSPA 5CHIA 4WQ5A 4BRCA 1K9MO 3EE9A 1GLCG 2GWKA 5JVGL 1EO1A 2W40A 3EL2A 4C1NI 1BUPA 1SQKA 1HKGA 3CC4N 1O13A 2V7ZA 3LDLA 2ASMA 1YIJN 1NM1A 2IVNA 3FZHA 1J6ZA 1VQKN 4LC9B 2KKZA 3VETA 3SAGA 5C12A 3MDQA 4RCHA 3G25A 4DKWA 3FR0A 2NRHA 3QMLA 4XEIA 1W2BM 3O1BA 3Q7BA 2ZGZA 3KK7A 4Y0WA 5AZIB 3PIPL 2IVPA 1VQ4N 4H0XB 4BVPA 2V51B 5AFUA 3HOSA 3QDKA 4ISEA 4BR4A 5CE3A 3LDOA 3J8AA 1OKJA 3LDNA 3WXLA 4EFHA 1YF5L 5TKWA 1VQLN 1Q86O 3QFPA 3UKUB 5BRHA 3O08A 1NMDA 4IEEA 1DKGD 1NGJA 4PL8A 5M1QA 2IVOA 3VF2A 3CCLN 3SJHA 2PFUA 4WFAL 2FSKA 1E4FT 3ZETA 4JKCA 4EIAA 4H5TA 2CGLA 1P90A 4H5WA 5AZIA 4FSVA 1X3NA 5F2RA 3AAPA 2NLXA 3CJCA 5E84A 4BRAA 5JVHL 3CJAA 1BDGA 4FWQA 4O8KA 3OW2M 3QICA 3AARA 2CH6A 4A57A 3NMUA 1YHQN 4MLEA 5BN9A 3HI0A 4BRKA 2ITMA 1NGEA 3UKUA 1M1KO 3SBGA 4EAHD 4BG8A 3U4LA 2ASPA 4H5RA 1T6CA 2DPNA 4BRFA 3D2FB 2E1YA 1Q18A 1HKBA 1YAGA 5GAGP 2V52B 3B8AX 3ZEUB 3E9LA 4K42A 2NRWA 2QWPA 3CJ1A 5EX5A 4JK9A 3UB5A 4RWTA 3KVGA 2JWLA 1VQ9N 4IZ9A 4CD1A 3A0IX 3ATUA 2VCPA 4H0TB 3TU5A 4WQ5C 3MWTA 3CQXA 3L0QA 3N4QA 5AQIA 4Z94A 3RSEB 2AP1A 3ATVA 2HF4A 4FOEA 1BU6O 3TSUA 3O6WA 4BRLA 1KAZA 3D2FA 3ZX0A 2A6AA 3LDQA 2HBMA 5JLFA 3ZEUA 2P9UB 1U6ZA 5C10A 5KPRA 5M1PA 1KAYA 2Q0UA 4YDUC 2QI2A 4A2AA 3DAWA 3CMAN 3R1XA 4BR0A 4B1UB 2QW9A 4WYBA 1JCFA 2P9SA 1BG3A 2Q2RA 3WQTA 2D1KA 2F9TA 4BREA 1IG8A 3WXIA 2V7YA 3SK3A 1TUYA 3CCEN 4U7BA 3IFRA 3BF3A 5AFUH 3PIOL 1KQSM 4CBUA 4C23A 3VGLA 1YJ9N 3VTHA 3SAFA 2P9UA 3HSCA 3FZKA 1VQON 3T7ZA 1R59O 5FPEA 4HTLA 5MLCQ 3KZBA 1N8RO 4BR7A 3VGMA 2OTLN 5BREA 2Q36A 3H45C 4CZMA 5M1NA 1DT9A 2D0OA 2RHKA 2GWJA 3A5NC 3VERA 2Q0RA 3MN9A 3U9ZA 3TPQA 4H0OA 2QWMA 5JICA 3HBTA 1YITN 4A62A 4PKIA 5AQTA 4HWIA 4BGBA 4U67L 3IDHA 4OPHA 4DHYA 4O8UA 1ATRA 1YUWA 3MN7A 4CZLA 3MCAB 2YI1A 1P8ZA 3CC7N 2YHXA 2E1ZA 3VOVA 3BUZB 3CJBA 3P4IA 4CZEA 1GLEG 1YVNA 4FPAA 3L4QA 2HBLA 3FZLA 3WXKA 3G6EN 2ZJQL 2ZWHA 3HTVA 1VQ6N 4YOVA 3C65A 4IEIA 4PKHA 4B1WB 5GIOA 2J4RA 1JCEA 1X9JA 4I6MB 3VEZA 3BF1A 4A59A 3DJCA 3DXMB 4WFNL 1LOTB 1NGHA 4FWNA 4M63C 2QA4N 3ZETB 4MLHA 4M7XA 4MDAA 1HUXA 4NB4A 4BQLA 1QQNA 3G71N 3EN9A 5HL7L 5GINA 3D2EB 4JKAA 4FPBA 3M1FA 3OBYA 1BWFO 5CR4A 3G4SN 3ID6A 3FGUA 2NNWA 3H6EA 3ZX3A 1H1VA 1BOTO 1RGIA 3I8BA 5C15A 2QEXN 2P9NB 3CD6N 2A5XA 4H03B 5BPLA 1HKCA 4XH4A 5EXWA 3D6RA 1KD1O 4MO4A 1ESVA 1VQ7N 2A42A 2ZF5O 4I6MA 3J7ZO 2E8AA 1NBWA 3C7NA 3JS6A 4FWRA 2H3GX 2W41A 3DXMA 4PKGA 5KPTA 1M90O 4F9OA 3VEVA 1QQOA 1TYQA 2HBJA 4IDHA 3D2EA 5ELZA 3WUHA 5GAEP 4A5AA 1NJIO 2D0PA 1NGAA 3CJ9A 2CGKA 3FE1A 4JEPA 4A2BA 3WT0A 4JKFA 2P9NA 3GL1A 1ATNA 4CZJA 1GLAG 4ILGB 2AA4A 5F1XA 2D4WA 1NGDA 4CZGA 5DM6L 2I7PA 2JWKA 3FZFA 1JCGA 3CERA 1ILYA 3MN5A 4IOXA 4FOIA 3CHWA 1BO5O 5AQJA 2FF6A 1QVFM 4IFEA 1ZC6A 3VEXA 5EOYA 1EQYA 4JKHA 4MO5A 3CCQN 2YHYA 5AQMA 4WQ4C 4K41A 1RDUA 4L3QA 3CCJN 3PLAA 2P9SB 4FL9A 2HBKA 3O9UA 4BRGA 1MWMA 3C6AA 4CZKA 5FPNA 4BC3A 1KC8O 3M5RA 5ADXA 2RE2A 3C6HA 4B9QA 1NLVA 2BH1A 5JMVA 3ZX2A 2P9IA 3L6QA 1T6DA 2QM1A 3QBXA 3K9KA 2WC9A 3R3LA 1T44A 3ENBA 3P39A 1NGGA 4JK8A 3TSQA 4DCHA 2HMPA 1U2VA 4FWPA 1YXQA 1C0FA 2Q1NA 2NRVA 4AF1A 3GDQA 4ILJA 3T69A 3CCSN 3O9RA 5KQDA 5BR9A 3I56N 4DQ8A 1V4TA 4FWOA 4CBWA 1MA9B 3RVCA 2WBNA 3LL3A 2E2PA 2QWRA 3MCPA 4RTFD 1GLBG 3VF6A 4B1VA 3E66A 2YJEA 3QFUA 4CZIA 2E88A 3IKMA 1Q81O 3CJ7A 4WF9L 4UY8O 4MDBA 2BTFA 3H1VX 1K8KA 1SS6A 1DGKN 1CZAN 2UYTA 4FWKA 4QS8A 4KH4A 4JD2A 5EVZA 4QS7A 5AQUA 3WXMB 2WUSA 4BC2A 2I7NA 4EHUA 3KWIA 3BEXA 5M1KA 4YOXA 1BA1A 1HJOA 1X3MA 2GUPA 2NZTA 1GLDG 2QWLA 3CETA 4YOYA 3TTFA 4AM6A 3ENHA 1SZ2A 4GV9A 4O5FA 3E9PA 4JKBA 2VWBA 5C2FA 3CF5L 3ULEA 3EO3A 2VGNA 1VQPN 5AQWA 1S72N 2E2OA 3O9SA 3BP8A 4A5BA 1YJWN 3EKSA 4CZHA 4H0PA 2GX9A 2GEMA 4FWLA 3H1QA 3CQYA 2Q31A 4JKDA 4BRNA 3KHYA 3CI5A 2A41A 2YHWA 4IOAL 4BR9A 4BR5A 3CPWM 2ZJRL 3H3NO 1SAZA 1RDWX 2WFBA 4IXCA 5FPMA 3CCRN 4AM7A 3A5OC 4NO7A 5GIPA 3E9OA 5AQKA 2OTJN 1RFQA 3SMPA 3R6MA 3W0LA 1NGIA 5BRDA 1YJNN 1MDUB 4H0YB 3VENA 5KQ8A 4CJ7A 3EKUA 1V4SA 3S41A 3C7NB 3E1YA 5AQXA 4GV3A 2F9WA 4EHTA 5ADXH 1QZ5A 5C2DA 2CGJA 2QTDA 2HSTA 3CCUN 4QS9A 1IJJA 1TYQB 3K9JA 2P9PA 4GY2B 4WFBL 1ATSA 3FZMA 4J8FA 4BGAA 1XQSC 4B1YB 4R79A 1QZ6A 3O4WA 1VQMN 4OO1J 1GLLO 3HRGA 4CBXA 4BC4A 2IIRA 4B1XB 1D4XA 4FO0A 1NWKA 2VGMA 3R9PA 4PL7A 4IWVA 1K8AO 4G9ZA 4BRQA 3O9TA 1GLJO 5AQRA 1VAZA 3HOTA 5M1FA 3VMFB 4K25A 2FF3B 1VQNN 3VGKA 3ENOA 2A40A 4YDUA 4CI6A 1NGFA 3A5MC 1NGBA 3WQUA 5I9EB 4B1ZA 3U9DA 3TTDA 3UKRA 4BQZA 4GNIA 4ILHA 4JAXA 3MN6A 3FLCO 4JN4A 2P9KB 4YORA 3N4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWG A;  3O9Q A;  3P39 A;  3D6R A;  3EE9 A;  3L4Q A;  3O9R A;  3P31 A;  3F5T A;  3OA9 A;  3O9T A;  2KKZ A;  3P38 A;  3RVC A;  3O9S A;  2RHK A;  3EE8 A;  4OPA A;  3O9U A;  2GX9 A;  4OPH A;  3M5R A;  3KWI A; 
#chains in the Genus database with same CATH topology
 1Q7Y O;  3THV A;  5B8H A;  4CEF A;  2E2N A;  3OHR A;  4BR2 A;  5E26 A;  1MWK A;  1S9G A;  3TTC A;  3CPE A;  2G8H A;  3NCI A;  2FXU A;  3IUC A;  3NVK A;  1RTJ A;  1WAF A;  2ITG A;  4OPA A;  3QES A;  1WOQ A;  5M1O A;  2R7Y A;  4BDY A;  3O80 A;  5GAH P;  5AQO A;  3VQ4 A;  4KBO A;  1DTT A;  4JD2 B;  2HHH K;  3J80 O;  4CEC A;  3SZ2 A;  3VPZ A;  3A5L C;  3OYJ A;  1T7P A;  4DQP A;  3M6G A;  2QK9 A;  1NJX A;  3VEW A;  3TAQ A;  4H0V B;  3CME N;  4O0J A;  3ZT0 A;  4M3Y A;  1GOC A;  1CXQ A;  4BRH A;  1LWF A;  3F9M A;  4JKG B;  4E1N A;  3SLC A;  3SQ4 A;  5AQS A;  3HPH A;  4H5N A;  4DV2 K;  2F8T A;  3THX A;  3QB0 A;  3JXU A;  1G99 A;  4YOW A;  4DQS A;  3AAQ A;  3A8Y A;  1K73 O;  1KLN A;  1S1T A;  4KB0 A;  4BVO A;  3SBT A;  1S22 A;  2E2Q A;  2E20 A;  2P9L B;  1XMQ K;  3RSE A;  1T3V A;  1KXP A;  3C0B A;  3LM9 A;  4X62 K;  4H5V A;  4KTW A;  3O8M A;  3IRX A;  3AGK A;  1BCO A;  4KI4 A;  2BUP A;  4DB3 A;  4C1N K;  4IDK A;  3BY5 A;  1NGC A;  3K0S A;  2CH5 A;  2NRR A;  3F5T A;  1NK5 A;  3R8E A;  2FSJ A;  3HZ6 A;  5H1S Q;  4IOC L;  3H3O B;  1RIL A;  5D3G A;  1ZBI A;  2F7T A;  3H46 O;  3U3G A;  4KFB A;  2PY5 A;  4ISF A;  3CCM N;  4B9S A;  2OPR A;  3AVL A;  2ZGY A;  4CK3 A;  2HND A;  4CF8 A;  5LY3 A;  4FJK A;  3GE1 A;  4FZX C;  2ZM6 K;  1DEJ A;  3JYT A;  3DLK A;  1HR0 K;  4CE9 A;  3KWG A;  3O5B A;  2EHG A;  5BRF A;  4JHD A;  1HPM A;  3GOI A;  4FM0 A;  2BGG A;  3PSF A;  4RW7 A;  4FJM A;  1GLC G;  1HKG A;  3CC4 N;  3RRH A;  4CES A;  3FZH A;  1VQK N;  3BZC A;  3HVT A;  3VET A;  3SAG A;  1KVB A;  3MDQ A;  3QML A;  1W2B M;  3OYE A;  2P1J A;  1I39 A;  1TL3 A;  3Q7B A;  5AZI B;  3PIP L;  4BVP A;  3L2Q A;  4HTU A;  2KZZ A;  3LDN A;  5TKW A;  2VQF K;  4DR3 K;  4DSF A;  3B6P A;  4FJI A;  5C25 A;  2O8E B;  1NGJ A;  1WLJ A;  1KLM A;  3CFP A;  3VF2 A;  3OYK A;  2HHV A;  4EIA A;  5J1E A;  2OYQ A;  1WSI A;  2LSN A;  3IG1 A;  4DR5 K;  5E84 A;  1D9D A;  1BQM A;  4CJW A;  3OY9 A;  4RW9 A;  1EWR A;  2XY5 A;  5BN9 A;  2FBY A;  4EAH D;  3HJF A;  3NGY A;  2DY4 A;  3PO4 A;  4C8O A;  3D2F B;  2E1Y A;  1Q18 A;  1HKB A;  4KHQ A;  3B8A X;  2E5L K;  4FZZ A;  4K42 A;  2QWP A;  3S3M A;  5EX5 A;  1VSF A;  5J2M A;  4CJ3 A;  3QEX A;  3KVG A;  4WE1 A;  3T1A A;  2VCP A;  4H0T B;  1TGO A;  3U6F A;  5T7B A;  3ATV A;  4Q5V A;  4FOE A;  1BU6 O;  3ZX0 A;  5JLF A;  1BIU A;  1U6Z A;  2O4G A;  5FDL A;  5C10 A;  2Q0U A;  4FVM A;  4DS5 A;  4BR0 A;  3MED A;  2P9S A;  2Q2R A;  2GBZ A;  1IG8 A;  4FLW A;  2HVI A;  3NHG A;  3CCE N;  2X6S A;  5EU7 A;  3PIO L;  4I7F A;  4C23 A;  1ASU A;  3VGL A;  3P1G A;  1YJ9 N;  4N56 A;  4W5T A;  2P9U A;  2E4L A;  1VQO N;  1R59 O;  5MLC Q;  3NF7 A;  4ZTJ A;  4BR7 A;  4DTP A;  2OTL N;  4B9U A;  5HRR A;  2O8D A;  3L8B A;  1QHT A;  1VRU A;  2X74 A;  2KFZ A;  4CZM A;  2D0O A;  1NOZ A;  3VER A;  1W9H A;  3F9K A;  3U9Z A;  4H0O A;  1ITG A;  2QWM A;  4Z4C A;  4CHY A;  4A62 A;  4PKI A;  2FBX A;  3HYF A;  4BGB A;  1RT7 A;  2D0A A;  3MN7 A;  1CXU A;  3MCA B;  4OGE A;  1TAQ A;  3O3F A;  1SL0 A;  3VOV A;  3CJB A;  4DSE A;  3NF9 A;  2HW3 A;  2YNF A;  1TKD A;  4PA1 A;  1S1V A;  3G6E N;  4CHP A;  3HTV A;  1MU2 A;  4PKH A;  4B1W B;  5GIO A;  4N41 A;  4I6M B;  4JYA K;  1LOT B;  1NGH A;  4M63 C;  4G1Q A;  3ZET B;  3G71 N;  4BQL A;  4CHN A;  4DR7 K;  3V9W A;  4F2R A;  1BOT O;  1RGI A;  3I8B A;  5C15 A;  2P9N B;  1R0A A;  2A5X A;  4C8L A;  4XH4 A;  2A42 A;  5KRT A;  1NK8 A;  3P83 D;  2E8A A;  1NBW A;  4LF8 K;  3S9H A;  3U3Y A;  3KIO A;  4PKG A;  3DXM A;  4W5R A;  1QQO A;  5GAE P;  3B6O A;  5ELZ A;  3OYF A;  5BR8 K;  4A2B A;  4DQQ A;  2E6M A;  1QE1 A;  4F8R A;  5F1X A;  5DM6 L;  4HVJ A;  2I7P A;  4KO0 A;  4E1M A;  1FKP A;  2HB5 A;  1JCG A;  1ILY A;  1I3A A;  4IOX A;  3KK2 A;  4N76 A;  1BO5 O;  2Z1G A;  1QVF M;  4IFE A;  3VEX A;  4MO5 A;  4HCC A;  2WOM A;  5AQM A;  4DR1 K;  5I3U A;  4K41 A;  4L3Q A;  2IC3 A;  5DK5 A;  3PLA A;  1VSI A;  1E3M A;  1MWM A;  4B3R K;  1BI4 B;  4M3R A;  3DLE A;  4BE2 A;  5J2N A;  3S3O A;  5IT9 O;  3C6U A;  2P9I A;  3R3L A;  1T44 A;  3O3G A;  4JK8 A;  4CER A;  3AVF A;  3GDQ A;  5KQD A;  3DRS A;  5HLF A;  1HPZ A;  2VG7 A;  1RBS A;  4KHS A;  2E2P A;  2QWR A;  3TAG A;  4Z4I A;  3E66 A;  1SV5 A;  3LDS A;  2E88 A;  3IKM A;  3CJ7 A;  4E7H A;  4WF9 L;  3TAN A;  4HCB A;  2HHW A;  4MDB A;  2BTF A;  2VWJ A;  1ZBH A;  4CW7 B;  3AA3 A;  4FWK A;  2FBV A;  4KH4 A;  5AQU A;  5KGW A;  4QS7 A;  3KWI A;  3BEX A;  3SV3 A;  1BA1 A;  1HJO A;  1GLD G;  3E9P A;  4JKB A;  1YTU A;  3ULE A;  2VGN A;  5AQW A;  4FM1 A;  1SKR A;  4A5B A;  3BP8 A;  4LF5 K;  3KKR A;  2HHX A;  3OYH A;  3KK1 A;  1B92 A;  3SPZ A;  2Q31 A;  4JKD A;  3CI5 A;  1SKS A;  4IOA L;  1DLO A;  4M42 A;  2ZJR L;  3H3N O;  1RDW X;  4IXC A;  4CGF A;  5FPM A;  1BQN A;  4AM7 A;  3K5N A;  3E9O A;  3VQB A;  4DV5 K;  4FM2 A;  1RFQ A;  1RDC A;  3R6M A;  3QEW A;  3AVA A;  3VEN A;  4B9T A;  1IBM K;  4CJ7 A;  3RWU A;  4GV3 A;  1HNZ K;  4FJG A;  2QKB A;  3THY B;  4QS9 A;  1IJJ A;  1S9E A;  3DRR A;  1RDA A;  4WFB L;  4JS5 A;  3SI6 A;  3FZM A;  4JRQ A;  4J8F A;  4BGA A;  1XNQ K;  4R79 A;  2G8V A;  4FCY A;  4B1X B;  4FLU A;  2OZS A;  1K8A O;  3I8D A;  3O9T A;  5AQR A;  3QER A;  3J7Y P;  4DQI A;  4FZY A;  4CIG A;  1VQN N;  4KRE A;  4KAZ A;  4YDU A;  3PUF A;  1Y97 A;  1VRT A;  3UKR A;  4CVN E;  3FLC O;  4KHN A;  1BIZ A;  2Z1H A;  3L3V A;  1D5A A;  3M3Z A;  1RBU A;  3L4I A;  4QCL A;  4LSL A;  3GG4 A;  1OVY A;  1U2V B;  3RMD A;  2KQ2 A;  4KPY A;  1N5Y A;  4X64 K;  3EE8 A;  3NVM A;  4CJL A;  2VG5 A;  5LJW A;  2AJQ A;  2UU9 K;  2P9K A;  1Z05 A;  1JJ2 M;  3ZYY X;  3VES A;  4CHZ A;  2O8B A;  4M7Y A;  4FWS A;  2BE2 A;  1D9F A;  4BRP A;  4NLC A;  2G8K A;  2YCH A;  3WXJ A;  4CD3 A;  1GOA A;  5AQH A;  3ID8 A;  3ZSW A;  1O1W A;  2QXL A;  3F2K A;  4DWI A;  5C24 A;  1C0G A;  5AQF A;  4YOT A;  4ZTF A;  4DFJ A;  4CFD A;  1S5J A;  4O44 A;  1C1B A;  4CJU A;  1L3U A;  3LAM A;  4BAC A;  5KGX A;  1HNV A;  3MMV A;  1WSJ A;  3SAH A;  4IJA A;  5EY4 A;  5LJV A;  1ZXO A;  2VYP A;  2KZM A;  5J2Q A;  1E4G T;  4NLB A;  1NJW A;  1B9F A;  1KTQ A;  3QEV A;  5HRO A;  3AA2 A;  4Y1C A;  2HNY A;  3I33 A;  4DTR A;  3DOK A;  2YX6 A;  4AHV A;  4Z4H A;  2NRT A;  5CYM A;  4IJN A;  4IO8 A;  4XH1 A;  2NRZ A;  3PX4 A;  2F8S A;  1ZBU A;  2Z1I A;  3CIP A;  4CJE A;  1WUA A;  4TSX A;  5AQP A;  3LDP A;  1Z6R A;  2OAN A;  2P9P B;  2XY7 A;  1IKY A;  3O3H A;  4RW6 A;  1ASV A;  3DXK A;  4JHD B;  2FSN A;  1N34 K;  3ZSY A;  1TAU A;  2ASO A;  4FJ9 A;  3EZ5 A;  2XO7 A;  2GTD A;  5AQG A;  1GLF O;  1REV A;  4OLB A;  3NE6 A;  1QHA A;  3IMX A;  4C8N A;  3CC2 N;  1TL1 A;  4WCE L;  2HF3 A;  1TK0 A;  3QBW A;  3QEI A;  3O9Q A;  1K9M O;  4QAG A;  1EO1 A;  3DYA A;  3LDL A;  1NK0 A;  2ASM A;  4AHS A;  2IVN A;  1J6Z A;  4LC9 B;  3O4N A;  4ICL A;  3HL8 A;  3UIQ A;  4Z4F A;  4LH4 A;  1RBR A;  1KVC A;  3C95 A;  3HOS A;  4ISE A;  1OKJ A;  4EFH A;  4CF1 A;  1Q86 O;  3QFP A;  5BRH A;  2PZS A;  4CGI A;  4PL8 A;  5M1Q A;  1SUQ A;  1Q9Y A;  2PFU A;  2FSK A;  3HP9 A;  1P90 A;  4FSV A;  2VQE K;  3OJU A;  3AAP A;  3OYM A;  3ZCM A;  4BRA A;  1BDG A;  4O8K A;  1IBL K;  4BE0 A;  4CHQ A;  3NF6 A;  3AVJ A;  4LH5 A;  1NK9 A;  1X9W A;  3QIC A;  3UKU A;  2W42 A;  1M1K O;  2XY8 A;  2DPN A;  5GAG P;  1YAG A;  1UA0 A;  2NRW A;  1EKE A;  3CJ1 A;  1S1W A;  4KI6 A;  3VQC A;  2HVH A;  4RWT A;  1VQ9 N;  4CD1 A;  5LMU K;  2WTU A;  2HNZ A;  3A0I X;  3TU5 A;  2XRI A;  3AO1 A;  4WQ5 C;  3MWT A;  2OZM A;  3LPU A;  2AP1 A;  4L8R B;  4DSL A;  4Z0U A;  3RR7 A;  3VA0 A;  1KRP A;  4N47 A;  4HUF A;  1SL2 A;  4B3O A;  3ZEU A;  2P9U B;  4DTJ A;  1Z25 A;  1BL3 A;  4YDU C;  4O55 A;  2QI2 A;  3DAW A;  3R1X A;  1LW2 A;  3MXJ A;  1J5O A;  1NKE A;  4IG3 A;  3WXI A;  3IFR A;  1KQS M;  3RMB A;  1FXX A;  3DM2 A;  3SAF A;  3V9S A;  4DU3 A;  3QIO A;  4DFM A;  1U49 A;  5FPE A;  4HTL A;  1N8R O;  4DV4 K;  2OPP A;  3KK3 A;  3AO5 A;  4LFC K;  3DMJ A;  5FRO A;  5M1N A;  1DT9 A;  5J2P A;  2RHK A;  3NH2 A;  2Q0R A;  3MN9 A;  2Z1J A;  1FKO A;  5JIC A;  3AVG A;  4HWI A;  4ELT A;  4OPH A;  4AHT A;  4CZL A;  4LSN A;  1W7A A;  1ZBL A;  3D45 A;  2E1Z A;  4J2D A;  3TAE A;  1GLE G;  4FPA A;  1VQ6 N;  1XMO K;  1QQC A;  4YOV A;  3C65 A;  4IEI A;  3ZT4 A;  1X9J A;  2JGU A;  3DJC A;  3DXM B;  4FWN A;  1NG9 A;  3AVH A;  2QA4 N;  1RNH A;  1HUX A;  1QQN A;  4HUE A;  3EN9 A;  3SQ1 A;  4JKA A;  4FPB A;  5CR4 A;  3OBY A;  5HBM A;  3FGU A;  3ZX3 A;  3HXM A;  3JAM O;  2QEX N;  3QET A;  2Y1J A;  5BPL A;  2O8F A;  1U48 A;  4LD0 A;  1IKW A;  4PY5 A;  1VQ7 N;  4E3S A;  2ZF5 O;  2F96 A;  3M8P A;  4KHY A;  3J7Z O;  3C7N A;  3AVM A;  4E0D A;  1IBK K;  3QNN A;  4FWR A;  2H3G X;  4KKO A;  2W41 A;  5CY4 A;  4CFB A;  3K5O A;  4CF2 A;  3DLB A;  3NH1 A;  1TYQ A;  4IDH A;  2HBJ A;  4DSK A;  3WUH A;  1U4B A;  1QSS A;  1WSH A;  2CGK A;  3FE1 A;  3VQD A;  3WT0 A;  4CCH A;  1FK9 A;  1ATN A;  2YNI A;  1XNR K;  1QS4 A;  3FFI A;  2HHQ A;  1C0M A;  2AA4 A;  2D4W A;  3FZF A;  2IAJ A;  4F2S A;  1VK0 A;  3MN5 A;  3ZSX A;  5AQJ A;  1ZC6 A;  3DLR A;  4DV7 K;  3JSM A;  1EQY A;  4JKH A;  5CZ1 A;  2YHY A;  4Y1D A;  3AO4 A;  1RDU A;  3RTV A;  4FJ8 A;  3O9U A;  4CJ5 A;  3C6A A;  4CZK A;  5ADX A;  4DS4 A;  1BGX T;  1LWE A;  3HP6 A;  3L6Q A;  1T6D A;  2QM1 A;  3K9K A;  3P39 A;  1NGG A;  3TSQ A;  2HMP A;  4FJJ A;  4FWP A;  1YXQ A;  2Q1N A;  1U45 A;  5BR9 A;  3I56 N;  1HNI A;  1SKW A;  3RVC A;  3LL3 A;  3MCP A;  4I2P A;  4B1V A;  3LP1 A;  3MEE A;  2YJE A;  3SUN A;  1CZB A;  4UY8 O;  1A5V A;  2HMI A;  1SS6 A;  3RMC A;  2UYT A;  4QS8 A;  5EVZ A;  4JD2 A;  4BC2 A;  2WUS A;  2I7N A;  4EHU A;  5M1K A;  3ZSV A;  4IFY A;  4XIU A;  4YOX A;  1X3M A;  2QWL A;  3TTF A;  4AM6 A;  1U04 A;  4DF4 A;  4O5F A;  4KRF A;  3QNO A;  1TKT A;  5C2F A;  1LV5 A;  1RBT A;  1L3V A;  3O9S A;  1YJW N;  2F4V K;  3EKS A;  3QIP A;  4DV6 K;  4KHP K;  4OGC A;  1Q8I A;  4FWL A;  1T05 A;  3AO3 A;  4CJQ A;  1KCF A;  4BR9 A;  3TAP A;  4AHR A;  5K14 A;  3CCR N;  3A5O C;  4EP5 A;  1WSF A;  4FLY A;  4CEQ A;  4X66 K;  2OTJ N;  1NKC A;  4OPK A;  1C6V A;  1YJN N;  4DTS A;  3AVI A;  5KQ8 A;  1V4S A;  3S41 A;  2F9W A;  4AHU A;  4OX9 K;  4KTQ A;  2QTD A;  3OS2 A;  3CCU N;  3RR8 A;  4KTZ A;  3SUO A;  1XQS C;  3ISN C;  4B1Y B;  1RT2 A;  3O4W A;  1VQM N;  4OO1 J;  3LWL A;  1GLL O;  4BC4 A;  4GMJ B;  4PQU A;  1NWK A;  2VGM A;  4PL7 A;  4DSJ A;  4IWV A;  3CG7 A;  4CJR A;  3LP0 A;  1VAZ A;  4LF4 K;  1JLQ A;  4CJS A;  5M1F A;  3VMF B;  4K25 A;  2FF3 B;  1C1C A;  3VGK A;  1HNW K;  2A40 A;  1RT3 A;  3U9D A;  3TTD A;  4ILH A;  4JAX A;  4YOR A;  2P9K B;  4DLE A;  3CYM A;  4FJH A;  5E41 A;  1WB9 A;  2PAV A;  2GV9 A;  3ZSO A;  1QVG M;  3AA5 X;  5A2Q O;  4JNE A;  5JLH A;  1QSL A;  3SJJ A;  3VEO A;  4A61 A;  4KHW A;  2GUI A;  1N36 K;  3NFA A;  4JKE A;  1VQ5 N;  4CJK A;  1K8K B;  2O8E A;  2ZJP L;  1BA0 A;  3MK6 A;  3AO2 A;  3D7E O;  4DMN A;  4DFP A;  2EWS A;  1U47 A;  1JL1 A;  1ZBS A;  4E1J A;  2W6K A;  4NYF A;  2KFN A;  2A1S A;  3O1W A;  2IS3 A;  1S3X A;  3P38 A;  3OYI A;  1XUP O;  4XH5 A;  1JL2 A;  5GAD P;  2FLO A;  2Q3S A;  4O4G A;  3WEE A;  5AR0 A;  1YTA A;  3VQ7 A;  1S6P A;  3I55 N;  3WNH A;  3K59 A;  1OH7 A;  4ZHR A;  1T8E A;  4FVU A;  3ASM A;  2G8U A;  1QQM A;  3TAF A;  2PBD A;  4OPJ A;  1TUU A;  1J53 A;  3DXK B;  3VEY A;  4DTO A;  3MXI A;  2IOC A;  2QWN A;  2ETJ A;  4OLA A;  3VQP A;  5AZJ A;  2UUB K;  4Z4G A;  1JLE A;  1YVU A;  2YV0 X;  3KLG A;  2KLA A;  3CM6 A;  1JLB A;  4Q0B A;  5BPM A;  4FWM A;  1Q9X A;  1XWL A;  4K43 A;  1WSG A;  1S1U A;  4NXM K;  4KH5 A;  5AQN A;  3VQQ A;  1NNE A;  4E7K A;  2NRX A;  3AGR A;  5HOO A;  3OA9 A;  1C0U A;  4DR6 K;  4BRD A;  3NDK A;  4CK1 A;  3DLL L;  3LP3 A;  1Y64 A;  3SMS A;  5HRS A;  4FXD A;  4CF0 A;  4BRO A;  3EZW A;  4CGG A;  3HM8 A;  4KH6 A;  5AQL A;  4MFB A;  2HHU A;  1FJG K;  4BRM A;  4CFA A;  3OYN A;  5C0Y A;  1NMN A;  3BDP A;  4GVE A;  4WQ4 A;  2YNG A;  3TWH A;  3UE5 A;  5FPD A;  3KLF A;  4WQ5 A;  4BRC A;  4DTU A;  3OYL A;  5I42 A;  2GWK A;  5JVG L;  2W40 A;  3EL2 A;  1BUP A;  1SQK A;  1O13 A;  1NM1 A;  4CEB A;  2KKZ A;  4DKW A;  1NOY A;  2NRH A;  2ZGZ A;  4Y0W A;  4AHC A;  1OH8 A;  3NH0 A;  4H0X B;  2V51 B;  5AFU A;  4HHT A;  5CE3 A;  3J8A A;  2B6A A;  3ZSQ A;  3EEQ A;  3UKU B;  3D0P A;  3O08 A;  1NMD A;  4IEE A;  4CJP A;  1DKG D;  5LMN K;  4LF6 K;  4RG8 A;  2RKI A;  1E4F T;  4J2A A;  3ZET A;  4JI3 K;  4JKC A;  4H5T A;  2CGL A;  1X3N A;  5F2R A;  3CJC A;  4IFV A;  2O4I A;  3VQ9 A;  3AV9 A;  4LY7 A;  3CQ8 A;  2ATQ A;  4FYD A;  2CH6 A;  4BRK A;  3K5M A;  1NGE A;  3SBG A;  2VG6 A;  4BG8 A;  1EXQ A;  1LAW A;  4BRF A;  2UUA K;  3QO9 A;  4GW6 A;  1JLG A;  2V52 B;  3ZEU B;  3ZSR A;  5FLX O;  3THX B;  1W0H A;  1N32 K;  4EZ9 A;  4JK9 A;  5CZ2 A;  4E7L A;  1RTD A;  3ATU A;  3L0Q A;  1EP4 A;  3N4Q A;  5AQI A;  3RSE B;  4PUO A;  2HF4 A;  1VSE A;  1KAZ A;  1RBV A;  4YNQ A;  3LDQ A;  4B9M A;  5KPR A;  1UA1 A;  1KAY A;  1S6Q A;  4A2A A;  3CMA N;  4B1U B;  3LWM A;  1XHZ A;  2QW9 A;  1KFD A;  3CM5 A;  1JCF A;  4B9L A;  1BG3 A;  1ZYQ A;  2F9T A;  1BI4 A;  1A5X A;  1TUY A;  3BF3 A;  3C6T A;  3KKS A;  4E19 A;  3HSC A;  3FZK A;  2X6N A;  3PX0 A;  3T7Z A;  3KZB A;  4FJN A;  3VGM A;  3AVB A;  5BRE A;  1OH6 A;  2Q36 A;  4CJT A;  3SUP A;  3H45 C;  1C1A A;  1F21 A;  4CK2 A;  3OS1 A;  4IKF A;  3MXM A;  3HBT A;  4CGJ A;  1UWB A;  1YIT N;  5AQT A;  4U67 L;  3PV8 A;  4DHY A;  1YUW A;  1UAX A;  2YI1 A;  3VQ6 A;  3CC7 N;  2YHX A;  4IG0 A;  4CGH A;  4JV5 K;  3T1Y K;  3V81 A;  3QIN A;  4DF8 A;  4CZE A;  4ID5 A;  4DQR A;  2O8F B;  4W5O A;  3DRP A;  2OCE A;  2J4R A;  1JCE A;  4M45 A;  3WNG A;  3BF1 A;  4A59 A;  4MLH A;  4MDA A;  4NB4 A;  4O5B A;  5GIN A;  3M1F A;  3G4S N;  2Y1I A;  1FW6 A;  1HYZ A;  2NNW A;  4H03 B;  5EXW A;  3D6R A;  4BWM A;  1X9S A;  1KD1 O;  1ESV A;  4F3T A;  5SZT A;  1TV6 A;  5CYQ A;  4FJ5 A;  2OA8 A;  1VSH A;  1JLF A;  4F9O A;  3KTQ A;  3I0S A;  3LP2 A;  3D2E A;  3K5L A;  4OKK A;  2D0P A;  1NGA A;  1J5E K;  1WSE A;  3CJ9 A;  3A2F A;  3MEG A;  1IH7 A;  3EY1 A;  3WNF A;  4CZJ A;  1GLA G;  4J2B A;  1N33 K;  4ILG B;  5FRN A;  4FJL A;  4R5P A;  2XY6 A;  5KRS A;  2UXC K;  1RTH A;  2JWK A;  3KLH A;  3DLG A;  3DOL A;  3ALY A;  3CER A;  1JLC A;  4FOI A;  3CHW A;  1OH5 A;  3NGI A;  3OYA A;  2FF6 A;  1RCH A;  5EOY A;  3CCQ N;  4J2E A;  4WQ4 C;  4FJ7 A;  2P9S B;  4FL9 A;  4OKJ A;  2HBK A;  3J81 O;  4YY3 K;  3QLH A;  4BC3 A;  1KC8 O;  4M3T A;  1S1X A;  2RE2 A;  3C6H A;  3VQE A;  1NLV A;  5JMV A;  2PYL A;  1VSD A;  3ZX2 A;  1WAJ A;  4KHU A;  3SYZ A;  4C8K A;  2WC9 A;  4M3U A;  4W5N A;  4B8C A;  1U2V A;  2NRV A;  4AF1 A;  4ILJ A;  3T69 A;  1KVA A;  5HRP A;  4CBW A;  1MA9 B;  3ULD A;  3HPG A;  2WBN A;  4RTF D;  2O8D B;  1GLB G;  1EX4 A;  3QFU A;  3L2U A;  3HPO A;  3H1V X;  1DGK N;  1CZA N;  4FLT A;  4CEZ A;  1L3T A;  3CET A;  1WBB A;  5HP1 A;  1L3S A;  2VWB A;  3K58 A;  3EO3 A;  1NK7 A;  1VQP N;  3PX6 A;  1BHL A;  2YHA A;  3V1R A;  2JLE A;  4B3S K;  1TKZ A;  1WNS A;  1YT3 A;  1WBD A;  1QSY A;  3H1Q A;  3CQY A;  4BRN A;  3KHY A;  2YHW A;  4EP4 A;  4BR5 A;  1VHX A;  2WFB A;  2QKK A;  4FK4 A;  1RTI A;  2G8W A;  1IKV A;  4DV3 K;  2RF2 A;  1IV0 A;  2UXB K;  5GIP A;  5AQK A;  3HK2 A;  4H0Y B;  1XHX A;  2D0B A;  4CED A;  1DTQ A;  3EKU A;  2D5R A;  1T03 A;  3RMA A;  5ADX H;  1QZ5 A;  2HST A;  4CEA A;  2RN2 A;  3K9J A;  4B3M K;  2P9P A;  4GY2 B;  4B9N A;  3BZK A;  3V9Z A;  2XHB A;  3HRG A;  4CBX A;  3KD5 E;  4EZ6 A;  3THW A;  4FO0 A;  3L2W A;  4G9Z A;  4DLG A;  1GLJ O;  3HOT A;  4K8Z A;  4LFB K;  2UXD K;  3T3F A;  4C8M A;  3KLI A;  4CI6 A;  1NGF A;  4NCB A;  1NGB A;  4K0K K;  4DR4 K;  3WQU A;  5I9E B;  4CF9 A;  3V9U A;  4RW8 A;  3MN6 A;  4JN4 A;  2OPS A;  3N4P A;  4AIL C;  3OBW A;  4GV6 A;  2YJF A;  3Q7C A;  1KAX A;  4CHO A;  3MX2 A;  2P9I B;  2O8C A;  2A3Z A;  3H08 A;  3DWL A;  3M8R A;  3ZT2 A;  3CXC M;  4M3W A;  5AQV A;  4IO9 L;  4BDP A;  3LM2 A;  1A5W A;  2YNH A;  3VF4 A;  4DFK A;  3VTI A;  1VQ8 N;  3L2R A;  1HMV A;  2QWO A;  3IS9 A;  4NCG A;  1Q82 O;  3SUQ A;  1OVQ A;  1XC3 A;  3WEE B;  4JI5 K;  2FBT A;  2W6L A;  2GEL A;  5FRM A;  4X65 K;  4JI8 K;  5BPN A;  4LFA K;  3V1O A;  1IG9 A;  4I9L A;  3MX5 A;  4JI1 K;  1YI2 N;  1VSK A;  4IBN A;  5AQY A;  4BC5 A;  3OYD A;  4M41 A;  4CIE A;  3MWP A;  3KLE A;  1W97 L;  2KW4 A;  3ULE B;  3HST B;  2IDO A;  3V6D A;  2X78 A;  4PHT X;  5AZJ B;  5LL6 Z;  1CLQ A;  4DG1 A;  5JS1 A;  2YHB A;  5KI6 A;  2KHO A;  3G10 A;  4DSI A;  1HX1 A;  3T1H K;  1LCU A;  4NYN A;  5AQZ A;  3M8S A;  4V19 S;  4FJX A;  3LZI A;  3L3U A;  3KD1 E;  4BG9 A;  4JK7 A;  2OPQ A;  3SPY A;  5TKY A;  5F0X A;  3GBT A;  1RT5 A;  3L2V A;  5BN8 A;  3V9X A;  3J7A P;  4JI4 K;  4ISG A;  3KJV A;  4JKG A;  4BRI A;  5AQQ A;  3FFK B;  3U8X A;  1B9D A;  4CEE A;  1EWQ A;  4YFU A;  4E7I A;  3W3D A;  1RT4 A;  1L5U A;  1HLU A;  3AY9 A;  4BDZ A;  3CCV N;  1TVR A;  3NAE A;  2RPI A;  3DLH A;  3P31 A;  4OVL A;  2P9L A;  4H4M A;  2QWQ A;  5DM7 L;  4CZF A;  3P5J A;  3OJS A;  4BWJ A;  3ZT3 A;  4O0I A;  4YOU A;  1KFS A;  2FC0 A;  2HOE A;  4BY9 C;  2Q97 A;  3UKR B;  5KPZ A;  5CHI A;  3TSP A;  4F3O A;  3EE9 A;  1VSJ A;  3HT3 A;  2DFE A;  4C1N I;  2V7Z A;  1ZBF A;  2BDP A;  2HHS A;  1YIJ N;  3BGR A;  4FK0 A;  3AVC A;  4OKE A;  4RCH A;  5C12 A;  3G25 A;  4CJ4 A;  2I5J A;  3FR0 A;  4UQG A;  4E7J A;  4H8K A;  4XEI A;  4DU4 A;  3O1B A;  3SV4 A;  1VQ4 N;  3KK7 A;  2IVP A;  4AQY K;  1GOB A;  4LF9 K;  3QDK A;  4BR4 A;  3LDO A;  2YKN A;  3WXL A;  1YF5 L;  5C42 A;  1UOC A;  1VQL N;  2O8B B;  4I9Q A;  4M3X A;  3RRG A;  1TK5 A;  2BAN A;  2IVO A;  2A1R A;  1I94 K;  3TAB A;  3SJH A;  3CCL N;  4WFA L;  4H5W A;  5AZI A;  2NLX A;  5JVH L;  4FK2 A;  3CJA A;  4FWQ A;  3OW2 M;  3OTO K;  3ZLJ A;  3AAR A;  4A57 A;  3NMU A;  1YHQ N;  4MLE A;  2PYJ A;  3HI0 A;  3DI6 A;  2ITM A;  1XI1 A;  3U4L A;  2ASP A;  4H5R A;  3SQ0 A;  4HUG A;  1T6C A;  1JLA A;  1HQE A;  3E9L A;  3V1Q A;  3UB5 A;  4DTN A;  2EX3 A;  2JWL A;  4IZ9 A;  4GVM A;  3NF8 A;  3TR8 A;  3LAL A;  3CQX A;  3C94 A;  4Z94 A;  4RW4 A;  4H4O A;  3TSU A;  3O6W A;  4B3T K;  4BRL A;  3D2F A;  4M3Z A;  2A6A A;  3AA4 A;  2HBM A;  3NGZ A;  3AVN A;  4CJF A;  5M1P A;  4FLZ A;  1G15 A;  3SQ2 A;  3HM9 A;  4WYB A;  3ZT1 A;  3WQT A;  2D1K A;  3ZSZ A;  4BRE A;  2D0C A;  2V7Y A;  4BE1 A;  3SK3 A;  3S3N A;  5SWM A;  1HYV A;  4U7B A;  1RDB A;  5AFU H;  4CBU A;  2DTU A;  3VTH A;  2G8I A;  4FW1 A;  3K2P A;  1NJY A;  3NBP A;  4JRP A;  2ZD1 A;  4FLX A;  3VN5 A;  3WNE A;  4F4K A;  4CFC A;  1JKH A;  2B5J A;  4DTM A;  1VSM A;  2GWJ A;  3A5N C;  4GKK K;  1SL1 A;  3TPQ A;  3PO5 A;  1HNX K;  3IDH A;  1HRH A;  4O8U A;  1XC9 A;  1ATR A;  1P8Z A;  3OYC A;  3V4I A;  1NU0 A;  4MQ3 A;  3BUZ B;  3I0R A;  3P4I A;  1LW0 A;  1YVN A;  3L4Q A;  2HBL A;  3FZL A;  4JI2 K;  3WXK A;  2ZJQ L;  2ZWH A;  4DV0 K;  1LAV A;  4KB1 A;  3VEZ A;  3EYZ A;  3TAM A;  3HO1 A;  2ZQB A;  3MAQ A;  1EET A;  4CGD A;  4WFN L;  3T19 A;  4M7X A;  1JXE A;  3ITH A;  5HL7 L;  3D2E B;  4PWD A;  1BWF O;  3ID6 A;  3H6E A;  4GKJ K;  1H1V A;  3OS0 A;  3CD6 N;  1CZ9 A;  3SNN A;  2WON A;  1HKC A;  3PSI A;  4MO4 A;  1D8Y A;  3VQ5 A;  4I6M A;  3JS6 A;  2KTQ A;  1WN7 A;  5KPT A;  1M90 O;  4FW2 A;  1NJZ A;  4B9V A;  3VEV A;  1RDD A;  1NJI O;  1HQU A;  4A5A A;  4Z4E A;  2P51 A;  4JEP A;  4JKF A;  2P9N A;  3GL1 A;  2G8F A;  4CIF A;  3CFR A;  1JXB A;  3F73 A;  4QOZ B;  5KTQ A;  4DU1 A;  3O4Q A;  1NGD A;  4CZG A;  2B4J A;  4CEO A;  1TK8 A;  1TKX A;  3M8Q A;  2DFH A;  4JLH A;  2HHT A;  4W5Q A;  3MEC A;  4JS4 A;  1KSP A;  1BCM A;  3K57 A;  1VSL A;  3TAR A;  3CFO A;  4DUY K;  3CCJ N;  4BRG A;  3G0Z A;  5FPN A;  3M5R A;  1NK4 A;  1NKB A;  4B9Q A;  2BH1 A;  4YHH K;  1J9A A;  3QBX A;  2UUC K;  3ENB A;  4CJV A;  4DCH A;  4OJR A;  1C0F A;  3CCS N;  3O9R A;  4JI6 K;  1X1P A;  1V4T A;  4DQ8 A;  4FWO A;  4I2Q A;  1K6Y A;  4ID1 A;  3VF6 A;  4ELU A;  1Q81 O;  4CZI A;  1J54 A;  3VQ8 A;  1K8K A;  3WXM B;  1HYS A;  2DFF A;  4JI0 K;  4LF7 K;  2GUP A;  2NZT A;  4N5S A;  4DV1 K;  5IWA K;  1IKX A;  1LWC A;  4YOY A;  4B8A B;  3ENH A;  1SZ2 A;  4GV9 A;  3CF5 L;  3LZJ A;  3IAY A;  1S72 N;  2E2O A;  1ASW A;  4CZH A;  3PY8 A;  3VA3 A;  4DTX A;  4H0P A;  2GX9 A;  2GEM A;  2ZE2 A;  2E6L A;  3HVR A;  2A41 A;  1N6Q A;  3CPW M;  2NUB A;  1SAZ A;  2YKM A;  3SCX A;  5AJ3 K;  5DMR A;  1BIS A;  2P5O A;  3OYG A;  4NO7 A;  1NK6 A;  2P5G A;  2QXF A;  3LAN A;  3SMP A;  3W0L A;  1NGI A;  5BRD A;  5JS2 A;  1MDU B;  2VWK A;  3THW B;  1X9M A;  1IO2 A;  3LPT A;  3C7N B;  4AH9 A;  3E1Y A;  5AQX A;  1QTM A;  3VQA A;  4B08 A;  4EHT A;  4K8X A;  5C2D A;  2CGJ A;  1TYQ B;  1HJR A;  3QEP A;  1ATS A;  5HRN A;  4KV8 A;  4ELV A;  1QZ6 A;  4FLV A;  1C0T A;  3AVK A;  2IGI A;  2IIR A;  3OYB A;  1Z26 A;  1D4X A;  3TI0 A;  3E01 A;  3R9P A;  4DUZ K;  2O8C B;  3OVN A;  4BRQ A;  4NXN K;  4NCA A;  4DR2 K;  1RT1 A;  4JI7 K;  3LAK A;  3ENO A;  3THY A;  4E89 A;  3A5M C;  4B1Z A;  4BQZ A;  1RT6 A;  4GNI A; 
#chains in the Genus database with same CATH homology
 1Q7Y O;  3M3Z A;  3OBW A;  4GV6 A;  3L4I A;  2YJF A;  5B8H A;  2PAV A;  3Q7C A;  1KAX A;  2E2N A;  3OHR A;  4BR2 A;  3MX2 A;  2P9I B;  1QVG M;  5E26 A;  2A3Z A;  1MWK A;  3DWL A;  3TTC A;  3CXC M;  3GG4 A;  1OVY A;  4JNE A;  5AQV A;  1U2V B;  5JLH A;  3CPE A;  4IO9 L;  3LM2 A;  2FXU A;  3IUC A;  3VF4 A;  3NVK A;  3EE8 A;  3NVM A;  3VEO A;  4A61 A;  4OPA A;  3VTI A;  5LJW A;  1VQ8 N;  2P9K A;  2QWO A;  1Z05 A;  1WOQ A;  4JKE A;  1JJ2 M;  5M1O A;  3ZYY X;  1VQ5 N;  3VES A;  1Q82 O;  3O80 A;  5GAH P;  1XC3 A;  5AQO A;  3WEE B;  4M7Y A;  2GEL A;  4FWS A;  1K8K B;  4BRP A;  4KBO A;  4NLC A;  4JD2 B;  2ZJP L;  1BA0 A;  3MK6 A;  5BPN A;  3VPZ A;  3D7E O;  2YCH A;  3A5L C;  2EWS A;  3WXJ A;  4CD3 A;  3MX5 A;  5AQH A;  1ZBS A;  3ID8 A;  1YI2 N;  4E1J A;  2QXL A;  5AQY A;  4BC5 A;  3O1W A;  3F2K A;  3M6G A;  1S3X A;  1C0G A;  3P38 A;  5AQF A;  3VEW A;  4YOT A;  3MWP A;  1XUP O;  4XH5 A;  1W97 L;  3ULE B;  5GAD P;  2FLO A;  4H0V B;  3CME N;  3WEE A;  5AR0 A;  4PHT X;  5AZJ B;  4BRH A;  3MMV A;  3I55 N;  3F9M A;  4JKG B;  3SAH A;  3SLC A;  4FVU A;  4IJA A;  5EY4 A;  2KHO A;  5LJV A;  1ZXO A;  4H5N A;  5AQS A;  1HX1 A;  1LCU A;  2VYP A;  5AQZ A;  3QB0 A;  1QQM A;  3JXU A;  1G99 A;  1E4G T;  4YOW A;  4NLB A;  3AAQ A;  3A8Y A;  2PBD A;  1K73 O;  1TUU A;  4BVO A;  3SBT A;  4BG9 A;  1S22 A;  4JK7 A;  2E2Q A;  3DXK B;  5TKY A;  3VEY A;  5F0X A;  3GBT A;  3I33 A;  2QWN A;  2E20 A;  2P9L B;  2YX6 A;  5BN8 A;  2NRT A;  4IJN A;  4IO8 A;  4ISG A;  5AZJ A;  3RSE A;  4XH1 A;  2NRZ A;  1T3V A;  4JKG A;  4BRI A;  1KXP A;  3C0B A;  3LM9 A;  3FFK B;  5AQQ A;  4H5V A;  2KLA A;  3CIP A;  3O8M A;  3U8X A;  5BPM A;  3AGK A;  4FWM A;  4K43 A;  2BUP A;  1WUA A;  5AQP A;  4DB3 A;  3LDP A;  1Z6R A;  4C1N K;  2OAN A;  3W3D A;  4KH5 A;  2P9P B;  1HLU A;  3AY9 A;  5AQN A;  1NGC A;  3CCV N;  2NRX A;  3DXK A;  4JHD B;  2CH5 A;  3AGR A;  2FSN A;  2NRR A;  3P31 A;  5HOO A;  2P9L A;  3F5T A;  3R8E A;  2FSJ A;  3OA9 A;  3HZ6 A;  2QWQ A;  5H1S Q;  4IOC L;  3H3O B;  4BRD A;  5DM7 L;  2ASO A;  4CZF A;  3DLL L;  2F7T A;  3H46 O;  1Y64 A;  2GTD A;  4ISF A;  5AQG A;  3SMS A;  3CCM N;  1GLF O;  4BRO A;  3EZW A;  4YOU A;  2ZGY A;  3HM8 A;  4KH6 A;  5AQL A;  1QHA A;  3IMX A;  2HOE A;  5LY3 A;  3GE1 A;  3CC2 N;  4BRM A;  4WCE L;  1DEJ A;  2HF3 A;  4BY9 C;  5C0Y A;  3QBW A;  2Q97 A;  3KWG A;  3O5B A;  4GVE A;  4WQ4 A;  3UKR B;  3O9Q A;  5BRF A;  4JHD A;  3UE5 A;  5KPZ A;  1HPM A;  3GOI A;  5FPD A;  3TSP A;  5CHI A;  4WQ5 A;  4BRC A;  1K9M O;  3EE9 A;  1GLC G;  2GWK A;  5JVG L;  1EO1 A;  2W40 A;  3EL2 A;  4C1N I;  1BUP A;  1SQK A;  1HKG A;  3CC4 N;  1O13 A;  2V7Z A;  3LDL A;  2ASM A;  1YIJ N;  1NM1 A;  2IVN A;  3FZH A;  1J6Z A;  1VQK N;  4LC9 B;  2KKZ A;  3VET A;  3SAG A;  5C12 A;  3MDQ A;  4RCH A;  3G25 A;  4DKW A;  3FR0 A;  2NRH A;  3QML A;  4XEI A;  1W2B M;  3O1B A;  3Q7B A;  2ZGZ A;  3KK7 A;  4Y0W A;  5AZI B;  3PIP L;  2IVP A;  1VQ4 N;  4H0X B;  4BVP A;  2V51 B;  5AFU A;  3HOS A;  3QDK A;  4ISE A;  4BR4 A;  5CE3 A;  3LDO A;  3J8A A;  1OKJ A;  3LDN A;  3WXL A;  4EFH A;  1YF5 L;  5TKW A;  1VQL N;  1Q86 O;  3QFP A;  3UKU B;  5BRH A;  3O08 A;  1NMD A;  4IEE A;  1DKG D;  1NGJ A;  4PL8 A;  5M1Q A;  2IVO A;  3VF2 A;  3CCL N;  3SJH A;  2PFU A;  4WFA L;  2FSK A;  1E4F T;  3ZET A;  4JKC A;  4EIA A;  4H5T A;  2CGL A;  1P90 A;  4H5W A;  5AZI A;  4FSV A;  1X3N A;  5F2R A;  3AAP A;  2NLX A;  3CJC A;  5E84 A;  4BRA A;  5JVH L;  3CJA A;  1BDG A;  4FWQ A;  4O8K A;  3OW2 M;  3QIC A;  3AAR A;  2CH6 A;  4A57 A;  3NMU A;  1YHQ N;  4MLE A;  5BN9 A;  3HI0 A;  4BRK A;  2ITM A;  1NGE A;  3UKU A;  1M1K O;  3SBG A;  4EAH D;  4BG8 A;  3U4L A;  2ASP A;  4H5R A;  1T6C A;  2DPN A;  4BRF A;  3D2F B;  2E1Y A;  1Q18 A;  1HKB A;  1YAG A;  5GAG P;  2V52 B;  3B8A X;  3ZEU B;  3E9L A;  4K42 A;  2NRW A;  2QWP A;  3CJ1 A;  5EX5 A;  4JK9 A;  3UB5 A;  4RWT A;  3KVG A;  2JWL A;  1VQ9 N;  4IZ9 A;  4CD1 A;  3A0I X;  3ATU A;  2VCP A;  4H0T B;  3TU5 A;  4WQ5 C;  3MWT A;  3CQX A;  3L0Q A;  3N4Q A;  5AQI A;  4Z94 A;  3RSE B;  2AP1 A;  3ATV A;  2HF4 A;  4FOE A;  1BU6 O;  3TSU A;  3O6W A;  4BRL A;  1KAZ A;  3D2F A;  3ZX0 A;  2A6A A;  3LDQ A;  2HBM A;  5JLF A;  3ZEU A;  2P9U B;  1U6Z A;  5C10 A;  5KPR A;  5M1P A;  1KAY A;  2Q0U A;  4YDU C;  2QI2 A;  4A2A A;  3DAW A;  3CMA N;  3R1X A;  4BR0 A;  4B1U B;  2QW9 A;  4WYB A;  1JCF A;  2P9S A;  1BG3 A;  2Q2R A;  3WQT A;  2D1K A;  2F9T A;  4BRE A;  1IG8 A;  3WXI A;  2V7Y A;  3SK3 A;  1TUY A;  3CCE N;  4U7B A;  3IFR A;  3BF3 A;  5AFU H;  3PIO L;  1KQS M;  4CBU A;  4C23 A;  3VGL A;  1YJ9 N;  3VTH A;  3SAF A;  2P9U A;  3HSC A;  3FZK A;  1VQO N;  3T7Z A;  1R59 O;  5FPE A;  4HTL A;  5MLC Q;  3KZB A;  1N8R O;  4BR7 A;  3VGM A;  2OTL N;  5BRE A;  2Q36 A;  3H45 C;  4CZM A;  5M1N A;  1DT9 A;  2D0O A;  2RHK A;  2GWJ A;  3A5N C;  3VER A;  2Q0R A;  3MN9 A;  3U9Z A;  3TPQ A;  4H0O A;  2QWM A;  5JIC A;  3HBT A;  1YIT N;  4A62 A;  4PKI A;  5AQT A;  4HWI A;  4BGB A;  4U67 L;  3IDH A;  4OPH A;  4DHY A;  4O8U A;  1ATR A;  1YUW A;  3MN7 A;  4CZL A;  3MCA B;  2YI1 A;  1P8Z A;  3CC7 N;  2YHX A;  2E1Z A;  3VOV A;  3BUZ B;  3CJB A;  3P4I A;  4CZE A;  1GLE G;  1YVN A;  4FPA A;  3L4Q A;  2HBL A;  3FZL A;  3WXK A;  3G6E N;  2ZJQ L;  2ZWH A;  3HTV A;  1VQ6 N;  4YOV A;  3C65 A;  4IEI A;  4PKH A;  4B1W B;  5GIO A;  2J4R A;  1JCE A;  1X9J A;  4I6M B;  3VEZ A;  3BF1 A;  4A59 A;  3DJC A;  3DXM B;  4WFN L;  1LOT B;  1NGH A;  4FWN A;  4M63 C;  2QA4 N;  3ZET B;  4MLH A;  4M7X A;  4MDA A;  1HUX A;  4NB4 A;  4BQL A;  1QQN A;  3G71 N;  3EN9 A;  5HL7 L;  5GIN A;  3D2E B;  4JKA A;  4FPB A;  3M1F A;  3OBY A;  1BWF O;  5CR4 A;  3G4S N;  3ID6 A;  3FGU A;  2NNW A;  3H6E A;  3ZX3 A;  1H1V A;  1BOT O;  1RGI A;  3I8B A;  5C15 A;  2QEX N;  2P9N B;  3CD6 N;  2A5X A;  4H03 B;  5BPL A;  1HKC A;  4XH4 A;  5EXW A;  3D6R A;  1KD1 O;  4MO4 A;  1ESV A;  1VQ7 N;  2A42 A;  2ZF5 O;  4I6M A;  3J7Z O;  2E8A A;  1NBW A;  3C7N A;  3JS6 A;  4FWR A;  2H3G X;  2W41 A;  3DXM A;  4PKG A;  5KPT A;  1M90 O;  4F9O A;  3VEV A;  1QQO A;  1TYQ A;  2HBJ A;  4IDH A;  3D2E A;  5ELZ A;  3WUH A;  5GAE P;  4A5A A;  1NJI O;  2D0P A;  1NGA A;  3CJ9 A;  2CGK A;  3FE1 A;  4JEP A;  4A2B A;  3WT0 A;  4JKF A;  2P9N A;  3GL1 A;  1ATN A;  4CZJ A;  1GLA G;  4ILG B;  2AA4 A;  5F1X A;  2D4W A;  1NGD A;  4CZG A;  5DM6 L;  2I7P A;  2JWK A;  3FZF A;  1JCG A;  3CER A;  1ILY A;  3MN5 A;  4IOX A;  4FOI A;  3CHW A;  1BO5 O;  5AQJ A;  2FF6 A;  1QVF M;  4IFE A;  1ZC6 A;  3VEX A;  5EOY A;  1EQY A;  4JKH A;  4MO5 A;  3CCQ N;  2YHY A;  5AQM A;  4WQ4 C;  4K41 A;  1RDU A;  4L3Q A;  3CCJ N;  3PLA A;  2P9S B;  4FL9 A;  2HBK A;  3O9U A;  4BRG A;  1MWM A;  3C6A A;  4CZK A;  5FPN A;  4BC3 A;  1KC8 O;  3M5R A;  5ADX A;  2RE2 A;  3C6H A;  4B9Q A;  1NLV A;  2BH1 A;  5JMV A;  3ZX2 A;  2P9I A;  3L6Q A;  1T6D A;  2QM1 A;  3QBX A;  3K9K A;  2WC9 A;  3R3L A;  1T44 A;  3ENB A;  3P39 A;  1NGG A;  4JK8 A;  3TSQ A;  4DCH A;  2HMP A;  1U2V A;  4FWP A;  1YXQ A;  1C0F A;  2Q1N A;  2NRV A;  4AF1 A;  3GDQ A;  4ILJ A;  3T69 A;  3CCS N;  3O9R A;  5KQD A;  5BR9 A;  3I56 N;  4DQ8 A;  1V4T A;  4FWO A;  4CBW A;  1MA9 B;  3RVC A;  2WBN A;  3LL3 A;  2E2P A;  2QWR A;  3MCP A;  4RTF D;  1GLB G;  3VF6 A;  4B1V A;  3E66 A;  2YJE A;  3QFU A;  4CZI A;  2E88 A;  3IKM A;  1Q81 O;  3CJ7 A;  4WF9 L;  4UY8 O;  4MDB A;  2BTF A;  3H1V X;  1K8K A;  1SS6 A;  1DGK N;  1CZA N;  2UYT A;  4FWK A;  4QS8 A;  4KH4 A;  4JD2 A;  5EVZ A;  4QS7 A;  5AQU A;  3WXM B;  2WUS A;  4BC2 A;  2I7N A;  4EHU A;  3KWI A;  3BEX A;  5M1K A;  4YOX A;  1BA1 A;  1HJO A;  1X3M A;  2GUP A;  2NZT A;  1GLD G;  2QWL A;  3CET A;  4YOY A;  3TTF A;  4AM6 A;  3ENH A;  1SZ2 A;  4GV9 A;  4O5F A;  3E9P A;  4JKB A;  2VWB A;  5C2F A;  3CF5 L;  3ULE A;  3EO3 A;  2VGN A;  1VQP N;  5AQW A;  1S72 N;  2E2O A;  3O9S A;  3BP8 A;  4A5B A;  1YJW N;  3EKS A;  4CZH A;  4H0P A;  2GX9 A;  2GEM A;  4FWL A;  3H1Q A;  3CQY A;  2Q31 A;  4JKD A;  4BRN A;  3KHY A;  3CI5 A;  2A41 A;  2YHW A;  4IOA L;  4BR9 A;  4BR5 A;  3CPW M;  2ZJR L;  3H3N O;  1SAZ A;  1RDW X;  2WFB A;  4IXC A;  5FPM A;  3CCR N;  4AM7 A;  3A5O C;  4NO7 A;  5GIP A;  3E9O A;  5AQK A;  2OTJ N;  1RFQ A;  3SMP A;  3R6M A;  3W0L A;  1NGI A;  5BRD A;  1YJN N;  1MDU B;  4H0Y B;  3VEN A;  5KQ8 A;  4CJ7 A;  3EKU A;  1V4S A;  3S41 A;  3C7N B;  3E1Y A;  5AQX A;  4GV3 A;  2F9W A;  4EHT A;  5ADX H;  1QZ5 A;  5C2D A;  2CGJ A;  2QTD A;  2HST A;  3CCU N;  4QS9 A;  1IJJ A;  1TYQ B;  3K9J A;  2P9P A;  4GY2 B;  4WFB L;  1ATS A;  3FZM A;  4J8F A;  4BGA A;  1XQS C;  4B1Y B;  4R79 A;  1QZ6 A;  3O4W A;  1VQM N;  4OO1 J;  1GLL O;  3HRG A;  4CBX A;  4BC4 A;  2IIR A;  4B1X B;  1D4X A;  4FO0 A;  1NWK A;  2VGM A;  3R9P A;  4PL7 A;  4IWV A;  1K8A O;  4G9Z A;  4BRQ A;  3O9T A;  1GLJ O;  5AQR A;  1VAZ A;  3HOT A;  5M1F A;  3VMF B;  4K25 A;  2FF3 B;  1VQN N;  3VGK A;  3ENO A;  2A40 A;  4YDU A;  4CI6 A;  1NGF A;  3A5M C;  1NGB A;  3WQU A;  5I9E B;  4B1Z A;  3U9D A;  3TTD A;  3UKR A;  4BQZ A;  4GNI A;  4ILH A;  4JAX A;  3MN6 A;  3FLC O;  4JN4 A;  2P9K B;  4YOR A;  3N4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...