3P31A

Crystal structure of the ns1 effector domain from influenza a/vietnam/1203/2004 (h5n1) virus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
120
structure length
120
Chain Sequence
PASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIKMDQAIMDKTIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTGEDVKNAIGVLIGGLEWNDNTVRVTETIQRFAWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of the NS1 effector domain from highly pathogenic influenza A/Vietnam/1203/2004 (H5N1) virus
rcsb
source organism Influenza a virus
molecule tags Viral protein
molecule keywords Nonstructural protein 1
total genus 33
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3p31A00
3KWGA 4OPAA 3RVCA 3O9RA 3M5RA 2KKZA 3EE9A 3P31A 3O9SA 4OPHA 3KWIA 3EE8A 2RHKA 3O9UA 3D6RA 2GX9A 3L4QA 3O9QA 3O9TA 3OA9A 3P39A 3F5TA 3P38A
chains in the Genus database with same CATH superfamily
4FZXC 1GLBG 1IG8A 3WXKA 4DSLA 1Z05A 3AGKA 3IS9A 3BF1A 4KHQA 4H0VB 2QM1A 4EIAA 1RDCA 1OH5A 3VF6A 5HROA 1TK5A 3QNOA 4FJXA 4M7XA 4HCBA 5FPMA 3CPEA 3SAGA 4CGDA 1YTUA 2D4WA 4MDAA 2CH6A 1YUWA 2A5XA 1BOTO 2YJEA 1YAGA 1NGFA 2PZSA 3U8XA 4DU4A 3O9RA 1JL1A 3OS1A 1G15A 3VQ5A 4GNIA 3K5LA 4IBNA 2HMPA 4M3RA 4CF9A 1VRUA 1QSLA 3ZSOA 5JVHL 5JLHA 1JKHA 1N36K 4KH5A 3VQ9A 1XI1A 2GWKA 2D1KA 3TSQA 4HUEA 4CJ4A 3V4IA 3TU5A 4BROA 4KH6A 3WXIA 1NU0A 5AZJB 3FZMA 3VGMA 3IMXA 1X1PA 4K8ZA 1NGDA 5ELZA 1W0HA 4CI6A 1QZ6A 2G8HA 3M1FA 3P5JA 4FM0A 3IAYA 2CGKA 5HRRA 4CGIA 4CJ5A 1IKVA 3NH2A 4M3YA 1VSJA 2HB5A 4JKGB 3SV3A 1NK5A 3ZCMA 1TYQA 2KLAA 4KB0A 2OCEA 3NF6A 1XNQK 3NGZA 3DXMA 4DMNA 2Z1IA 1DEJA 4XH4A 3RMAA 5CZ1A 3D2EA 2O8CB 1N5YA 3ZEUA 4M42A 4DSIA 1YIJN 3A8YA 4JV5K 3MXMA 3LDSA 5CE3A 1C6VA 4BRAA 3L4QA 1K8KA 3QFUA 4CEZA 1U49A 1RBSA 4IEEA 3VQPA 3CCSN 4MQ3A 4B3SK 1K8AO 1WSJA 4FWLA 2NRTA 2HHWA 1KVBA 3ID8A 3PSFA 3EE9A 3RRHA 1GLEG 4KPYA 4CJTA 4CGHA 3LP0A 3QERA 4DSKA 1ILYA 3DJCA 2YHAA 5JLFA 4JYAK 3OA9A 2QKBA 1DTQA 4QS9A 1IBLK 3AA4A 2IOCA 4PY5A 3OYAA 4DV4K 4BACA 1JLGA 1JLAA 4LY7A 4CEFA 5T7BA 2HOEA 4WE1A 3OW2M 1QQMA 1VK0A 5IWAK 4F3TA 2FSJA 3A2FA 4IG3A 3VEWA 4J2EA 1U45A 4H5WA 1D8YA 2FSNA 2NNWA 3CC4N 2XO7A 4W5OA 4BRQA 3THWB 3D6RA 1TK0A 1RT1A 1N34K 3SQ4A 4JKHA 3MEGA 3BY5A 4CF1A 4BE0A 4JI6K 1IBKK 1RTHA 1QQNA 2P9LA 2JWLA 3VQBA 3ZT0A 2E2PA 1SS6A 4IOXA 1NK4A 3D2FA 4YOTA 3P83D 2NRXA 3VGLA 4BY9C 3VOVA 2IVPA 2AJQA 3VQ4A 3KK7A 5HOOA 1A5VA 4BGAA 1NOZA 1NK9A 1CLQA 1IO2A 3ZX0A 3RTVA 4CZMA 3CQXA 2Z1GA 3RSEB 4PWDA 1R0AA 1LWCA 3B6PA 3HSTB 2OTJN 2P9UB 4CJPA 4ELVA 2NRWA 2O4GA 4JKFA 1D9DA 1U4BA 3OTOK 2P9PB 1HMVA 4AQYK 2YNHA 4OPKA 2ZJPL 4O5FA 3VESA 4CFAA 3J7ZO 3OYMA 1UA0A 2E2OA 5C25A 3VEZA 3VQAA 4C1NI 5JMVA 2BGGA 3KHYA 1U04A 2W41A 3CFRA 2XY6A 4PA1A 4Z4HA 1RT5A 4H4MA 4BRIA 3C65A 3THVA 3AAPA 5EX5A 3EZWA 3MX2A 4K8XA 4FJIA 2QW9A 4E89A 4WFNL 4BR0A 3D7EO 3OBWA 3M3ZA 2Q97A 1YHQN 1IG9A 3HVTA 1VQ5N 3LAKA 4OVLA 3K2PA 1NKEA 4O0IA 2G8KA 2RHKA 2YHBA 2FSKA 3DWLA 4YOXA 1KXPA 3TWHA 2QXLA 3ZT2A 3QB0A 1Z6RA 3LP1A 4DSEA 3LL3A 4ICLA 3LM9A 1RNHA 3ISNC 4JI5K 1WBDA 4EZ9A 4CJ7A 2Q2RA 4EHUA 3SMSA 2QWQA 4CJEA 3AARA 3V6DA 1T6DA 2W6LA 3AVKA 5ADXH 3VGKA 4BC4A 2O8BB 4IO9L 3I8DA 4AHSA 5HBMA 4FWRA 4M45A 4CFCA 4CF2A 2KQ2A 1T05A 2O8DB 4KV8A 2BUPA 5CYMA 3K57A 1K9MO 1IKXA 5BREA 3ZETA 2A40A 3TTCA 5M1QA 5AQOA 3VN5A 1Z25A 4EAHD 3NH0A 2O8BA 3NCIA 3NH1A 1VQLN 1GLAG 3K9JA 4J8FA 5DK5A 3VF2A 3V9ZA 1CZAN 4BR7A 1XWLA 3QFPA 4B8CA 1KAZA 3GG4A 2E1ZA 1NGBA 4AHVA 3HI0A 3AGRA 4ISEA 1VQ6N 1HNXK 3AVAA 1I94K 4CHOA 2QWNA 4RW4A 4FWPA 3K58A 1ZBHA 4PL7A 4CFDA 4E7HA 4Y1CA 2VYPA 1ESVA 4CIGA 2XY7A 4G1QA 3O9UA 3QLHA 2GEMA 3THXB 4JN4A 3EKSA 1RDWX 2JWKA 5E84A 1SKSA 2VG5A 3L8BA 1V4SA 4W5RA 3RR7A 3VEOA 4BE2A 1TL1A 3EL2A 2XY5A 4N56A 1IH7A 3IUCA 5AQQA 1RDAA 2BE2A 1VQKN 3J81O 2OZSA 3UKRA 4Z4CA 1BGXT 1HLUA 3K9KA 2O8EB 1X9SA 2YHYA 1BHLA 2HHUA 3IDHA 2OA8A 2Q0UA 1OH6A 1GOCA 4CHZA 3NMUA 4GV6A 4JI1K 4CF8A 3HT3A 4U7BA 4LF4K 4E1MA 1NK8A 4B1WB 2V52B 3NVMA 3OYCA 3ZX2A 3IFRA 2E2QA 1SL0A 3MN9A 2KTQA 3I0SA 3T1HK 3KLEA 3M8SA 5BR8K 4E19A 2OPRA 2RF2A 1BL3A 3O9QA 4LD0A 1I3AA 4MLEA 2G8WA 3SQ1A 5M1OA 1NWKA 1B92A 3I0RA 1LV5A 4B9UA 4LF8K 1TGOA 3G10A 4I6MA 4KREA 4KKOA 5KPTA 3F9KA 1TKZA 4DFMA 2YI1A 3FFIA 4FPAA 3MX5A 3S41A 3U6FA 4ISFA 1MWKA 4PQUA 4FJGA 1KD1O 1QVFM 2A6AA 4FJNA 4CJLA 2JGUA 2ASOA 3DXKA 1JCGA 1QHTA 5LL6Z 3SLCA 1ZBFA 2NZTA 5BRHA 2O8EA 3SQ0A 2HNYA 4DF4A 3TTFA 4B3RK 3O9SA 3E66A 4BRLA 2NUBA 3VTIA 1OVQA 3HM9A 1UOCA 2X74A 1BU6O 1BI4B 2P9KA 3D0PA 1YF5L 4JK8A 4DTRA 1G99A 3NGIA 1EP4A 1MA9B 4PUOA 5AQNA 2QWPA 2B5JA 2BTFA 1BDGA 3CJ9A 3ZYYX 5AQYA 1JJ2M 1BQMA 4EP4A 4H0YB 3K5NA 4FZYA 4N47A 5CHIA 3QEXA 4F2SA 4PHTX 1WB9A 1S1TA 3GDQA 4H5VA 5C24A 4O55A 3ZSWA 1C0MA 4AHRA 3PV8A 2BANA 1U48A 3OYKA 1L3VA 3ID6A 5FRNA 4YFUA 1A5XA 3FR0A 2QEXN 4CIFA 1BA1A 4A62A 4XIUA 3MEDA 4IOCL 1VSHA 4O44A 4IFVA 4BC5A 4I9QA 3V9WA 3THYB 4KB1A 3CPWM 5C42A 3TABA 3R6MA 3R3LA 4RG8A 4CF0A 3ULDA 5SWMA 4DSJA 4I2QA 3V9UA 4DQPA 3LZIA 5BPMA 4ZTFA 2P1JA 4F9OA 5AQLA 4HTUA 2ASPA 4CJKA 1GLJO 4Q5VA 3E9OA 4N41A 1ZBUA 3OYDA 3VA3A 2O8DA 4MFBA 3CG7A 2YHWA 3OHRA 4DCHA 4O8KA 2HSTA 4DQ8A 1E4FT 4X62K 2HW3A 1RDUA 3LPUA 1S9EA 4CZEA 4DS5A 4NCBA 2W42A 1TV6A 3H08A 4JRPA 3AVIA 3O3HA 3VF4A 5BR9A 1DLOA 1NJIO 4H03B 3CIPA 3O80A 4FOIA 1Q18A 4OKEA 3IRXA 3KLFA 2EHGA 5CY4A 1FK9A 4WQ4A 4H0TB 3HK2A 5KPRA 3AO2A 2F4VK 4E3SA 3ULEB 4KHPK 3SUQA 3ZEUB 4CD1A 4RTFD 3GBTA 1KAXA 1SL2A 4PKIA 2P9PA 4NXNK 5J2PA 4E1NA 2EWSA 5KQDA 4Z4IA 2YCHA 4DTMA 1TL3A 3AY9A 3NF9A 3PIPL 3HXMA 3UKUA 4U67L 3O1WA 1RDDA 4FOEA 3HBTA 3L4IA 3OJUA 4W5NA 4BRGA 3VEYA 1BA0A 3WNGA 5I3UA 2NLXA 1Q86O 4OKKA 1FKOA 4DLEA 3NGYA 3QDKA 4F2RA 1RBUA 1YJ9N 4CZIA 3OBYA 5B8HA 5HRSA 3QNNA 4DFKA 3TAFA 2YKNA 3M8PA 2P51A 3D45A 1LWEA 2D0BA 1T03A 4CJSA 1VSMA 4WQ5A 4CHNA 3LDOA 5A2QO 4KI4A 2NRZA 3UIQA 4Z4EA 3EO3A 4YOWA 1ATRA 4CGGA 4CZLA 1VQ8N 4IFYA 2KZZA 3TAPA 1JXBA 4E7LA 3BP8A 1KCFA 2WTUA 3KWIA 4B8AB 3L2VA 2GUIA 3KK3A 2P5OA 1HYSA 1T6CA 3MN7A 3QINA 1HNZK 3BDPA 3TAMA 1W97L 4FLXA 2RE2A 2F9TA 4AHUA 2D0OA 3WEEA 3KWGA 3HP6A 3IG1A 3RRGA 4CJRA 2HHHK 1Q81O 4CK3A 3H1QA 4JKBA 4R79A 4ILHA 1D4XA 3C6AA 2P9SB 3OS2A 4BR4A 1QQCA 1XHZA 5KRSA 3M6GA 4KI6A 1WSIA 3HP9A 1LW0A 1RT4A 1U2VA 3SI6A 3QBXA 5JS2A 3AO4A 3PIOL 4AF1A 1JXEA 3I55N 2VWBA 2P9IA 2YNGA 3JS6A 4DFPA 4B1ZA 2FF6A 3CQ8A 3VTHA 4E1JA 4FJHA 4FYDA 1C0FA 3L2RA 1RFQA 4IO8A 3MWPA 3V1QA 2VQEK 1NGJA 1WNSA 4FWMA 4I9LA 1ZBLA 2F8SA 3ENOA 4K0KK 1N32K 1RGIA 2CGJA 2O8CA 2P9KB 3MEEA 1Z26A 3VEXA 4YOUA 4KTWA 4BGBA 2VCPA 1KTQA 2QKKA 1HNVA 3M8RA 2G8FA 3CXCM 5HL7L 4X64K 4JI3K 1SUQA 5CYQA 5EXWA 3J7AP 5M1NA 4DV7K 3ITHA 5EY4A 5AQZA 3DI6A 5KPZA 4DQSA 3C94A 2Q0RA 3O3GA 1F21A 3AVHA 5BRDA 4YOYA 3OYNA 4JI7K 1VQ7N 3SAHA 3MWTA 2XY8A 3S3MA 3BUZB 3HYFA 2PBDA 1BUPA 4M7YA 4PKHA 1BI4A 4IDHA 1X9MA 4FLZA 3SCXA 4CECA 4BRKA 2Z1HA 2P9IB 4CZJA 3THXA 3THWA 1RCHA 2HF3A 2HHSA 1RT6A 1NKCA 3IKMA 3EYZA 1XNRK 5HLFA 3MXJA 4I7FA 4FCYA 4DLGA 2HVHA 2UUAK 4KH4A 4LH4A 4WQ4C 4DF8A 2QWRA 4JD2A 3P1GA 1S6QA 2G8UA 4H5TA 1ZBIA 4HUGA 2HVIA 1A5WA 3TARA 2H3GX 2RN2A 4CVNE 4CZGA 3CJ1A 4JKCA 2F8TA 3KKRA 3CYMA 1WAJA 3VQCA 3T69A 4OX9K 3NF8A 4X66K 4GY2B 4JI4K 4BR5A 3FZKA 2KKZA 3DLKA 1GLLO 1LCUA 1WAFA 2PYLA 3VQQA 2D0PA 4AILC 3WXMB 1U6ZA 2ZE2A 5LJVA 3U3GA 2VGMA 3K5MA 5I42A 3THYA 1TUUA 4FWNA 3WNHA 1RTJA 4DFJA 3CC7N 4F8RA 5KGXA 2ZM6K 2FBYA 3ZT3A 3CCRN 5AZIB 2WONA 1FXXA 5KTQA 1C1AA 1NOYA 4NB4A 4BRDA 1VHXA 2YKMA 2HHTA 4OPJA 3DRRA 3KIOA 4FSVA 1ZYQA 1J54A 3O4NA 5AQTA 4LF7K 4KHSA 2X78A 3DMJA 1YJWN 3UKUB 2IDOA 5C10A 3NHGA 3QEWA 3SYZA 1NK7A 1K6YA 3H6EA 4IFEA 3RMDA 4LF6K 2WUSA 4DTPA 4OPHA 4JNEA 3RR8A 1P90A 3SJJA 2XRIA 3HZ6A 1EETA 3ZT4A 4CERA 1HKCA 5BPLA 4CFBA 1BIUA 4B3MK 5ADXA 1HKGA 2A1RA 4FLUA 3SUOA 4M3WA 3FLCO 4OKJA 3LWMA 4BR9A 3CCLN 3WNFA 5AQKA 3HTVA 1NK0A 3I56N 4RW8A 1VQ9N 5JICA 1HQUA 2A42A 4HVJA 3LWLA 4B08A 4CEEA 2VQFK 3S9HA 5FPEA 2WOMA 3L2WA 1RDBA 3CCMN 1SKWA 4C8NA 4FVMA 1TK8A 2E88A 1NGIA 3QEIA 2FLOA 1SAZA 4YOVA 3KK1A 5LJWA 5H1SQ 1NG9A 5AQXA 3OYEA 2Q31A 3DOKA 1W2BM 3G25A 1T7PA 2GWJA 4K41A 3HL8A 3AVGA 3TANA 1MDUB 3OJSA 4DV3K 4FJ5A 1ZBSA 3P31A 1BISA 2VG6A 3OYIA 3DLLL 3VEVA 4B9QA 1RBTA 2OYQA 4JKDA 2CGLA 3ZT1A 4YDUC 1IBMK 3ZLJA 4EP5A 3KK2A 4DV2K 5GADP 2V51B 3MECA 4CGJA 3KLGA 1KAYA 4DSFA 4ILGB 4B9SA 2WFBA 3VA0A 2QK9A 4BR2A 3FZLA 4JKEA 3H3NO 4IZ9A 2D0AA 1XMQK 5LY3A 3CF5L 1VSDA 3V1RA 1YVUA 5BRFA 4ISGA 3JXUA 4ILJA 4JS5A 3PX0A 2UXBK 1L3UA 2GX9A 3ASMA 2IS3A 3DXKB 4FJKA 4JKGA 3I8BA 1X3MA 3NE6A 4M63C 3KTQA 1GOBA 3LAMA 3WUHA 1N8RO 3VETA 4CJUA 3PY8A 4HWIA 3JAMO 5AZIA 3SNNA 2VWJA 3KKSA 3C6UA 1UAXA 4FWQA 2HBLA 3OS0A 2GBZA 4FLVA 3HPHA 4DTUA 1QTMA 3AAQA 4KHNA 5D3GA 4NLBA 3C6HA 2B6AA 1KVCA 3L6QA 3LDQA 3I33A 4KFBA 3G4SN 1MU2A 2ZF5O 4DQIA 1QVGM 1L3SA 2Y1IA 4IJAA 2I5JA 3TSPA 3K0SA 4M3TA 2UYTA 1NLVA 1QE1A 3T1AA 3LALA 4DTJA 4HHTA 2BDPA 1X3NA 4H4OA 1BIZA 3OYLA 4KHYA 3WT0A 4RW6A 3RVCA 4OLAA 2A1SA 4Z94A 4DR7K 1HNWK 2DY4A 1LOTB 2ATQA 4AM6A 1S1VA 5C2FA 3AVNA 2R7YA 3T7ZA 5AQWA 3T19A 3U9DA 4J2BA 3HOSA 4FJ7A 1VQNN 1KSPA 4LF9K 3DM2A 1EWRA 3PO5A 1RBVA 4IJNA 2G8VA 1YXQA 3PX4A 1HNIA 3A5OC 1HUXA 4BREA 4BDYA 3CFPA 3KLHA 3J80O 1U2VB 3NAEA 1WSEA 3NBPA 3VQEA 3DLRA 3MDQA 2VWKA 4IXCA 4OO1J 2HF4A 3QETA 1NMNA 1EO1A 4B3OA 1EXQA 3C6TA 1TYQB 3DYAA 4IEIA 4J2AA 1TKTA 1YI2N 3U9ZA 1NJWA 1HYVA 1E3MA 1VSFA 4L3QA 2ASMA 2KFZA 1VSLA 3FFKB 3RMBA 1YTAA 2P9UA 3TR8A 3WEEB 1SQKA 5LMUK 4NLCA 2IAJA 4RCHA 4BG8A 3MXIA 4WCEL 4DV6K 4XH5A 2NRHA 1DKGD 1BCMA 1CXUA 4YY3K 1NKBA 3VQ6A 2Q3SA 4UQGA 3F73A 3CCUN 2OTLN 4FL9A 2LSNA 2PY5A 1NM1A 4XH1A 1BO5O 3KZBA 1C1CA 2E4LA 2HNDA 3O9TA 2YJFA 3LP3A 4AH9A 2P9LB 1V4TA 5AQUA 4EZ6A 4WYBA 4GKKK 3UB5A 3SUNA 1Y64A 2A41A 4C1NK 4CGFA 4R5PA 3A5NC 3T1YK 2QWMA 1DTTA 1KVAA 4XEIA 4CK1A 2E2NA 3L2UA 2KFNA 3DOLA 4YORA 4GVMA 1CZ9A 3E9LA 5AQIA 4H5RA 4FZZA 2ZD1A 3HJFA 1KLNA 3FZHA 1TKDA 2KZMA 4IWVA 1GLDG 1ITGA 1LAWA 2Y1JA 3HM8A 4BRNA 2ITMA 2P9NA 4CEAA 3LPTA 1QSYA 2IVNA 1JLQA 1JCFA 4JI8K 3ZSYA 4F3OA 2GV9A 1HPMA 1L3TA 1IKYA 4NXMK 1I39A 1GOAA 4FJ9A 5FPNA 1TUYA 4CK2A 4NO7A 1Q8IA 3F2KA 2UXDK 3KD1E 4CBXA 2FF3B 1XHXA 1S3XA 4Y0WA 3CCVN 5EOYA 1KQSM 4IKFA 3ZSZA 5AQSA 5DM7L 3AVJA 4OPAA 3JSMA 4JRQA 1NGGA 4BRPA 2I7PA 3BF3A 5JVGL 2F96A 4DTNA 2WC9A 4B1YB 4ID1A 2IC3A 3MN5A 3ZSVA 4K42A 5E41A 1S1UA 3SAFA 3ZSQA 3U3YA 4HTLA 4H0XB 4FM2A 2YNFA 3UE5A 3C95A 4DWIA 4YDUA 1EQYA 3DLBA 4DV1K 3M5RA 3T3FA 2ZJQL 2ITGA 3L0QA 1SV5A 5F0XA 4HUFA 4JEPA 5M1PA 2UUCK 4PL8A 1HJOA 2ZWHA 2ZGYA 1B9DA 3A0IX 5FPDA 5GAHP 4DB3A 3JYTA 2O8FB 3RWUA 4E7JA 2ZQBA 3CI5A 1X9WA 3O1BA 2HHXA 3CJ7A 3NFAA 4CJQA 1NGCA 1NMDA 2NRVA 4B9TA 4FVUA 3ENHA 1VQ4N 3MCAB 1ASVA 4I2PA 2RKIA 4OJRA 1UWBA 4JKAA 2KW4A 5FRMA 5GIPA 4JHDA 3SJHA 1EKEA 2PAVA 3C7NA 1XUPO 2HBMA 3BEXA 1HR0K 4FJMA 5KQ8A 3C0BA 1S9GA 1OH7A 3O5BA 4A2BA 3GE1A 3LM2A 3CFOA 1IV0A 4LFAK 4KO0A 3TAEA 1KFSA 4ZHRA 5HP1A 5AR0A 3QESA 3CC2N 1WSGA 3PSIA 1WSFA 3RSEA 4AHCA 4DV0K 4WF9L 3CCEN 4O4GA 5C12A 1IJJA 4FWSA 3AVLA 4B9NA 3HRGA 4FWKA 2DFHA 1H1VA 4Z4GA 1TKXA 2E5LK 4CEOA 4KAZA 1REVA 4PKGA 5FROA 4N5SA 1C0GA 4BRCA 4M41A 4C8LA 3RMCA 2HBJA 1EX4A 4DKWA 4V19S 1BQNA 4CZFA 3CCJN 2AA4A 1HKBA 4FK0A 2E20A 3ZX3A 3LP2A 4B3TK 3FE1A 4NYNA 2FC0A 3F5TA 1ASUA 3VQ8A 4G9ZA 3QEPA 4AHTA 1KC8O 2X6SA 4WFAL 4CZHA 1KLMA 1WOQA 1HPZA 3VERA 4FK4A 3L3VA 2PYJA 4H0PA 1S1XA 1IKWA 3O4QA 3LDPA 4DR1K 4KBOA 3CD6N 2QA4N 3CJCA 5AFUH 3CMAN 2Q1NA 3MAQA 1HRHA 4BQLA 1XC9A 4EFHA 4K43A 4CESA 4FW1A 4FO0A 3MN6A 2UXCK 2FXUA 2HBKA 3R9PA 1VQPN 1QHAA 3E1YA 5C2DA 2YHXA 4W5TA 4YHHK 3AVFA 3TSUA 4DQQA 3SPZA 2Q36A 2V7YA 1NGAA 1JCEA 3N4QA 3TTDA 2ZJRL 4H5NA 2I7NA 1Q9YA 3D2FB 3G6EN 1YITN 2NRRA 5E26A 4KHWA 4OLBA 1K8KB 1TAQA 2KHOA 1N33K 4BQZA 2E8AA 5AQPA 3NF7A 4ZTJA 5J2QA 4WQ5C 1WSHA 3LDLA 3BZCA 3DRPA 3AO5A 4KTQA 3WQUA 4HCCA 2FBTA 3OY9A 1OH8A 1Q7YO 1QS4A 4B1VA 1OVYA 2HHVA 2UU9K 1QZ5A 5I9EB 4LF5K 3BZKA 1CZBA 3MCPA 1HX1A 1UA1A 3QMLA 5F1XA 4DR3K 3KJVA 4IG0A 4B9MA 3A5MC 1WUAA 3AA5X 5M1KA 1NJYA 3DLHA 4E7IA 5AQVA 3W0LA 1JLCA 1QQOA 1RT2A 4FWOA 4MDBA 3R8EA 3K59A 3AO3A 3AA3A 3QEVA 4K25A 1M1KO 3CMEN 3AV9A 4YNQA 1J5OA 4QS8A 5GINA 4C8OA 1XMOK 2F7TA 1Q9XA 4MO5A 4A57A 4M3UA 4A5BA 3J8AA 5AQHA 3ULEA 4JK9A 2GELA 3EEQA 3CCQN 4ID5A 2WBNA 2ETJA 1ASWA 2CH5A 2E1YA 4GVEA 4TSXA 3VPZA 3DLEA 1NGEA 3R1XA 4UY8O 1NJXA 3PX6A 4FXDA 4BRFA 5J2MA 2DFFA 4CW7B 4EHTA 2QWOA 4DQRA 4BC3A 1P8ZA 1J9AA 5K14A 3SPYA 4JI0K 5DMRA 1RILA 1S72N 4CHPA 3QICA 3OYJA 4DUZK 4JD2B 3MK6A 3PLAA 5AQJA 3QBWA 3O6WA 3F9MA 4A2AA 2YX6A 1YJNN 1C0UA 3V81A 3GL1A 3SZ2A 3KLIA 3P39A 5BN9A 4FM1A 3A5LC 4BG9A 3WQTA 1JL2A 1QSSA 3TAQA 5HRPA 3GOIA 4FJJA 1T3VA 1CXQA 5MLCQ 3HPOA 2FBVA 3HVRA 1X9JA 4LSLA 4FJ8A 1TVRA 3V9XA 1SZ2A 5GAGP 4CJVA 5J1EA 4DR5K 4O8UA 5SZTA 1S6PA 4DR6K 1FKPA 1VRTA 3MMVA 2A3ZA 3TAGA 3AVCA 1HQEA 3HOTA 2IIRA 4LFCK 1LAVA 5AQFA 3S3NA 3AVBA 1DGKN 3V9SA 3DLGA 4CEDA 4CEBA 3OYHA 4FJLA 4Q0BA 4WFBL 3FGUA 3G71N 5C15A 2BH1A 1WN7A 1GLCG 1D5AA 3OVNA 1NBWA 5AQMA 4BDZA 2X6NA 2O4IA 3PO4A 3S3OA 4Z4FA 1FW6A 3CQYA 5FDLA 2P5GA 1J6ZA 5BPNA 2AP1A 4CJFA 4M3ZA 2B4JA 1OKJA 3SV4A 3CERA 1LWFA 1XC3A 5AQRA 4CCHA 4FLTA 1T44A 3AA2A 3CM6A 2HMIA 4N76A 3VMFB 1TAUA 4CBUA 4LH5A 3QIPA 1NNEA 4JLHA 1YVNA 1ATNA 3P4IA 1MWMA 4J2DA 1ATSA 4DUYK 4O5BA 3K5OA 4DG1A 3ENBA 4DR4K 1S1WA 1E4GT 4B1XB 4GMJB 1BG3A 1WLJA 2OANA 1C0TA 4Z0UA 1JLBA 2DFEA 4JI2K 4DU3A 4BDPA 4JS4A 3L3UA 3KD5E 2OZMA 5AFUA 1K73O 2FBXA 2QTDA 4OGEA 2J4RA 3W3DA 4BVPA 4FK2A 3E01A 4A61A 5GIOA 1HJRA 4BE1A 4LSNA 3EE8A 4CJ3A 1Q82O 3SBGA 2XHBA 4X65K 4NCGA 4FW2A 1VAZA 1ZXOA 4BC2A 3NVKA 1VSKA 3H1VX 5JS1A 3ATVA 2W6KA 1RT7A 4BVOA 3OYFA 1W9HA 3H3OB 4RW7A 1VQMN 3WXLA 5AQGA 5AZJA 3ATUA 2DPNA 5LMNK 4M3XA 1RBRA 3LANA 3H46O 4FPBA 3VQ7A 2P9NB 3B6OA 4LC9B 1W7AA 1RTIA 2YV0X 3O4WA 3M8QA 4IDKA 4O0JA 3NDKA 4BRMA 4GKJK 4DTXA 4BWJA 1L5UA 2QXFA 2PFUA 5GAEP 4DR2K 1JLFA 4C8MA 4AM7A 3TPQA 4CBWA 4B1UB 3N4PA 1VSEA 3CHWA 4FLYA 2E6MA 3DXMB 3DRSA 3G0ZA 3AO1A 3B8AX 3HO1A 3ZSRA 1EWQA 3O3FA 1R59O 4E0DA 3WNEA 3ZSXA 2Z1JA 1NJZA 4B9LA 1B9FA 3FZFA 3O08A 5J2NA 2VGNA 4E7KA 1KFDA 3H45C 2QI2A 2UUBK 2GTDA 3VQDA 4RWTA 4LFBK 1BCOA 3ZETB 1HYZA 4H0OA 3E9PA 4H8KA 2QWLA 4L8RB 4ELUA 1O1WA 4RW9A 4A59A 4CEQA 4A5AA 3HPGA 2OPSA 3AVMA 4JK7A 4CHQA 1C1BA 4KRFA 1WBBA 1NK6A 2E6LA 1SKRA 2DTUA 4DTOA 4CJWA 4GW6A 4QAGA 4DS4A 3LZJA 3EKUA 4GV3A 3EY1A 3CM5A 5KRTA 3HSCA 4Y1DA 3D2EB 3CETA 1LW2A 3J7YP 4DV5K 5DM6L 4W5QA 3ALYA 1T8EA 4BWMA 2W40A 1U47A 4KTZA 3LDNA 5TKWA 1O13A 4MO4A 1N6QA 5F2RA 1Y97A 4BRHA 2P9SA 3L2QA 4B9VA 1J5EK 3EZ5A 2JLEA 1VQON 1D9FA 4IOAL 1S5JA 1YT3A 4CHYA 5KI6A 3V1OA 3WXJA 1XQSC 5TKYA 1DT9A 5EVZA 2VG7A 4OGCA 3PUFA 4I6MB 4CIEA 2OPPA 1SL1A 3QIOA 5CR4A 4JHDB 4QS7A 5C0YA 5AJ3K 5HRNA 3QO9A 3C7NB 4NYFA 2HNZA 4DU1A 1BWFO 3O8MA 3SK3A 5IT9O 3OYGA 4GV9A 2IGIA 2HHQA 4FLWA 5FLXO 4CZKA 4QCLA 2ZGZA 4C8KA 4MLHA 1VSIA 3DAWA 4CE9A 2OPQA 4CD3A 4JAXA 1GLFO 1KRPA 3BGRA 3U4LA 4F4KA 3SUPA 2O8FA 4NCAA 3SBTA 2GUPA 2RPIA 3CJBA 3Q7CA 2IVOA 2V7ZA 5M1FA 3SQ2A 1M90O 5BN8A 2YNIA 5KGWA 2D0CA 3P38A 3KVGA 2F9WA 1NGHA 4ELTA 3UKRB 5EU7A 1ZC6A 1S22A 3Q7BA 4KHUA 4C23A 2EX3A 4DHYA 1RT3A 3CJAA 4DTSA 1RTDA 3EN9A 5CZ2A 3OYBA 3VENA 1FJGK 2D5RA 1JLEA 4QOZB 1J53A 3TI0A 2G8IA 3SMPA
chains in the Genus database with same CATH topology
1GLBG 4BQLA 2Q31A 4EFHA 1IG8A 3WXKA 3G25A 1W2BM 1G99A 1Z05A 3AGKA 4K43A 2GWJA 1MA9B 3BF1A 4K41A 5AQNA 2QWPA 1MDUB 4FO0A 2BTFA 1BDGA 2QM1A 3CJ9A 3MN6A 4H0VB 3ZYYX 4EIAA 5AQYA 1ZBSA 2FXUA 2HBKA 3P31A 3R9PA 3VF6A 1VQPN 1JJ2M 3DLLL 3VEVA 1QHAA 4B9QA 3E1YA 4H0YB 5C2DA 2YHXA 4JKDA 2CGLA 4M7XA 5FPMA 3CPEA 3SAGA 4YDUC 3TSUA 5CHIA 2Q36A 2D4WA 2V7YA 4MDAA 1NGAA 5GADP 1JCEA 2V51B 3N4QA 4PHTX 3TTDA 2CH6A 1KAYA 1YUWA 3GDQA 2I7NA 2A5XA 1BOTO 4H5VA 4H5NA 3D2FB 4ILGB 2YJEA 1YAGA 2WFBA 1NGFA 3G6EN 1YITN 2NRRA 5E26A 3U8XA 1K8KB 4BR2A 2KHOA 3FZLA 3O9RA 4JKEA 3H3NO 3ID6A 4IZ9A 4BQZA 2E8AA 5AQPA 5LY3A 3CF5L 4WQ5C 3LDLA 4GNIA 2HMPA 3FR0A 2QEXN 5BRFA 1BA1A 3WQUA 5JVHL 4ISGA 3JXUA 4ILJA 4A62A 5JLHA 1Q7YO 4KH5A 4IOCL 2GWKA 2GX9A 4B1VA 1OVYA 2D1KA 3DXKB 3TSQA 4JKGA 4BC5A 1QZ5A 5I9EB 3I8BA 1X3MA 3TU5A 3MCPA 4BROA 4KH6A 3WXIA 3CPWM 1HX1A 3R6MA 3R3LA 5AZJB 4M63C 3FZMA 3WUHA 3QMLA 3VGMA 5F1XA 3VETA 3IMXA 1N8RO 4HWIA 3A5MC 5AZIA 1NGDA 5BPMA 1WUAA 5ELZA 4CI6A 5M1KA 1QZ6A 5AQVA 4F9OA 5AQLA 2ASPA 3M1FA 4FWQA 3W0LA 1GLJO 2HBLA 2CGKA 1QQOA 4FWOA 4MDBA 3E9OA 3R8EA 4JKGB 4K25A 1M1KO 3CMEN 3AAQA 2YHWA 3OHRA 1TYQA 2KLAA 4DCHA 4NLBA 3C6HA 4O8KA 2HSTA 3L6QA 4QS8A 4DQ8A 5GINA 1E4FT 3LDQA 3I33A 1RDUA 3DXMA 4CZEA 2F7TA 3G4SN 4MO5A 4A57A 2ZF5O 4A5BA 1DEJA 4XH4A 3J8AA 5AQHA 1QVGM 3ULEA 4JK9A 3D2EA 2GELA 4IJAA 3ZEUA 3TSPA 3CCQN 3VF4A 5BR9A 1NJIO 2UYTA 2WBNA 3A8YA 4H03B 1YIJN 3CIPA 3O80A 1NLVA 1Q18A 4FOIA 2CH5A 2E1YA 4GVEA 3VPZA 5CE3A 4BRAA 1NGEA 3R1XA 3L4QA 1K8KA 4UY8O 3QFUA 1X3NA 4WQ4A 4H0TB 4BRFA 5KPRA 4EHTA 2QWOA 4IEEA 3WT0A 3CCSN 4BC3A 3RVCA 1P8ZA 1K8AO 4Z94A 4FWLA 1LOTB 3ULEB 2NRTA 3ID8A 4AM6A 3EE9A 3ZEUB 1S72N 3QICA 4CD1A 5C2FA 1GLEG 4RTFD 3GBTA 1KAXA 5AQWA 3T7ZA 4JD2B 3U9DA 4PKIA 2P9PA 3MK6A 3HOSA 3PLAA 5AQJA 1VQNN 3QBWA 3O6WA 3F9MA 4A2AA 2EWSA 2YX6A 1YJNN 1ILYA 3DJCA 5KQDA 2YCHA 3GL1A 5JLFA 3OA9A 3P39A 4IJNA 5BN9A 3A5LC 3AY9A 4QS9A 1YXQA 4BG9A 3PIPL 3WQTA 3A5OC 1HUXA 4BREA 3UKUA 4U67L 3O1WA 2HOEA 4FOEA 3HBTA 3OW2M 1QQMA 3GOIA 3L4IA 1T3VA 4BRGA 1U2VB 2FSJA 3VEYA 1BA0A 5MLCQ 2NLXA 3MDQA 3VEWA 4IXCA 1Q86O 4OO1J 2HF4A 4H5WA 3QDKA 1EO1A 1YJ9N 2FSNA 2NNWA 4CZIA 3OBYA 1X9JA 1TYQB 3CC4N 4IEIA 5B8HA 4BRQA 1YI2N 1SZ2A 3U9ZA 3D6RA 5GAGP 4O8UA 4L3QA 2ASMA 2ZJRL 3FFKB 4JKHA 3MMVA 2A3ZA 4WQ5A 3LDOA 3HOTA 2NRZA 1QQNA 2P9UA 2P9LA 2JWLA 3EO3A 2IIRA 3WEEB 1ATRA 5AQFA 2E2PA 1SS6A 4IOXA 1SQKA 4CZLA 4NLCA 3D2FA 4YOTA 1DGKN 1VQ8N 4RCHA 4BG8A 4WCEL 3BP8A 4XH5A 2NRHA 2NRXA 3VGLA 3FGUA 1DKGD 3VOVA 2IVPA 4WFBL 3G71N 4BY9C 3KWIA 5C15A 3KK7A 5HOOA 2BH1A 3CCUN 2OTLN 4FL9A 1GLCG 1NM1A 4XH1A 1BO5O 4BGAA 1T6CA 3MN7A 1NBWA 3KZBA 5AQMA 3ZX0A 4CZMA 3CQXA 2YJFA 3CQYA 3O9TA 1W97L 3RSEB 2RE2A 2OTJN 1J6ZA 5BPNA 2P9UB 2AP1A 2F9TA 1V4TA 2D0OA 2P9LB 3KWGA 4WYBA 5AQUA 3WEEA 2NRWA 4JKFA 3UB5A 1OKJA 1Y64A 2A41A 3CERA 1XC3A 5AQRA 1Q81O 2P9PB 3H1QA 1T44A 4JKBA 4C1NK 4R79A 4ILHA 4O5FA 3VESA 2ZJPL 3J7ZO 3A5NC 2E2OA 1D4XA 3VMFB 3C6AA 2P9SB 2QWMA 3VEZA 4CBUA 4C1NI 5JMVA 3KHYA 4XEIA 4BR4A 1YVNA 1ATNA 3P4IA 1MWMA 2E2NA 2W41A 3M6GA 1ATSA 4YORA 3C65A 4BRIA 3ENBA 3AAPA 5EX5A 3EZWA 3MX2A 3E9LA 1U2VA 1E4GT 4B1XB 2QW9A 3QBXA 5AQIA 4H5RA 1BG3A 4WFNL 4AF1A 4BR0A 3D7EO 3PIOL 2OANA 2P9IA 2VWBA 3I55N 3JS6A 3OBWA 3FZHA 4B1ZA 3M3ZA 2FF6A 2Q97A 4IWVA 3VTHA 5AFUA 1YHQN 1K73O 4E1JA 2QTDA 2J4RA 1C0FA 1GLDG 1RFQA 4IO8A 3MWPA 3W3DA 4BVPA 1NGJA 1VQ5N 4FWMA 3HM8A 4A61A 5GIOA 4BRNA 2ITMA 2P9NA 3ENOA 3EE8A 1RGIA 2RHKA 3DWLA 2FSKA 1Q82O 2CGJA 3SBGA 4YOXA 1KXPA 2QXLA 2IVNA 2P9KB 1JCFA 1VAZA 3VEXA 1ZXOA 3QB0A 1Z6RA 4BC2A 3NVKA 4YOUA 3H1VX 4BGBA 2VCPA 3LL3A 3ATVA 4BVOA 3LM9A 3CXCM 3H3OB 1HPMA 1VQMN 3WXLA 5HL7L 5AQGA 5AZJA 4CJ7A 2Q2RA 4EHUA 3ATUA 3SMSA 2QWQA 2DPNA 5FPNA 3AARA 1TUYA 3H46O 1T6DA 5ADXH 4NO7A 3VGKA 4FPBA 5EXWA 4BC4A 2P9NB 4IO9L 5M1NA 4LC9B 3F2KA 5EY4A 3O4WA 4FWRA 5AQZA 4CBXA 2FF3B 5KPZA 4BRMA 2Q0RA 1S3XA 4Y0WA 2PFUA 5GAEP 5BRDA 3CCVN 2BUPA 4AM7A 5EOYA 1KQSM 3TPQA 4CBWA 4B1UB 4YOYA 5AQSA 5DM7L 3N4PA 4OPAA 1K9MO 3CHWA 1VQ7N 3SAHA 1NGGA 3MWTA 4BRPA 3DXMB 5BREA 2I7PA 3BUZB 3ZETA 2A40A 3BF3A 3TTCA 5JVGL 5M1QA 3B8AX 5AQOA 4EAHD 2PBDA 1BUPA 4M7YA 4PKHA 2WC9A 4B1YB 1R59O 4IDHA 1VQLN 1GLAG 3K9JA 3MN5A 4J8FA 3VF2A 3FZFA 3O08A 4K42A 1CZAN 2VGNA 3SAFA 4BR7A 4BRKA 4HTLA 3QFPA 2P9IB 3H45C 2QI2A 4H0XB 1KAZA 4CZJA 3GG4A 2E1ZA 3UE5A 1NGBA 2HF3A 2GTDA 3HI0A 1EQYA 3AGRA 4YDUA 4RWTA 4ISEA 1VQ6N 3M5RA 3ZETB 3IKMA 4H0OA 3E9PA 4YOWA 2QWNA 3L0QA 2ZJQL 2QWLA 4FWPA 5F0XA 4PL7A 4A59A 4JEPA 2VYPA 5M1PA 1ESVA 4KH4A 4WQ4C 4A5AA 2QWRA 4PL8A 4JD2A 4H5TA 4JK7A 1HJOA 3O9UA 2ZWHA 2ZGYA 3A0IX 2GEMA 5FPDA 5GAHP 2H3GX 4DB3A 4JN4A 3EKSA 4CZGA 3CJ1A 2JWKA 1RDWX 4JKCA 5E84A 3EKUA 3CI5A 4GV3A 1V4SA 3T69A 3O1BA 3VEOA 3CJ7A 1NGCA 3HSCA 3EL2A 4GY2B 4BR5A 1NMDA 3D2EB 3CETA 3FZKA 2NRVA 3IUCA 5AQQA 2KKZA 1VQKN 4FVUA 5DM6L 3UKRA 1GLLO 3ENHA 1LCUA 1HLUA 1VQ4N 3MCAB 2W40A 3K9KA 2D0PA 3WXMB 1U6ZA 5LJVA 4JKAA 2VGMA 3LDNA 5TKWA 1O13A 4MO4A 5GIPA 4JHDA 3SJHA 2YHYA 1TUUA 4FWNA 5F2RA 4BRHA 2P9SA 2PAVA 3IDHA 2Q0UA 3C7NA 1XUPO 3CC7N 3NMUA 4GV6A 1VQON 2HBMA 3BEXA 3CCRN 5AZIB 4U7BA 4IOAL 5KQ8A 3WXJA 4B1WB 1XQSC 5TKYA 2V52B 3NVMA 1DT9A 5EVZA 3ZX2A 4NB4A 3IFRA 2E2QA 3C0BA 4I6MB 3MN9A 3O5BA 4BRDA 4A2BA 3GE1A 3LM2A 5CR4A 4JHDB 4FSVA 4QS7A 5C0YA 3C7NB 5AQTA 5AR0A 3CC2N 3O9QA 1BWFO 3O8MA 1YJWN 3UKUB 4MLEA 5C10A 3RSEA 4WF9L 3CCEN 3SK3A 5C12A 5M1OA 4GV9A 1IJJA 4FWSA 1NWKA 3HRGA 4FWKA 4CZKA 2ZGZA 3H6EA 4MLHA 4I6MA 1H1VA 3DAWA 4IFEA 5KPTA 2WUSA 4PKGA 4CD3A 1C0GA 1GLFO 2YI1A 4FPAA 4JAXA 4JNEA 4OPHA 2HBJA 3U4LA 4BRCA 4DKWA 1P90A 3MX5A 3HZ6A 3S41A 4CZFA 3CCJN 4ISFA 1HKCA 2GUPA 1HKBA 2AA4A 1MWKA 3CJBA 3Q7CA 3SBTA 5BPLA 2E20A 2IVOA 2V7ZA 3ZX3A 1HKGA 5ADXA 5M1FA 5BN8A 5H1SQ 3FE1A 1KD1O 1M90O 1QVFM 2A6AA 3F5TA 3FLCO 3P38A 4BR9A 3CCLN 4G9ZA 3KVGA 5AQKA 2ASOA 2F9WA 1NGHA 3DXKA 1JCGA 3HTVA 3UKRB 1VQ9N 3I56N 3SLCA 1ZC6A 1KC8O 4WFAL 2NZTA 1S22A 3Q7BA 4CZHA 5BRHA 5JICA 1WOQA 2A42A 3VERA 4C23A 4DHYA 3CJAA 3TTFA 3O9SA 4H0PA 3E66A 5FPEA 4BRLA 3EN9A 3CCMN 3VTIA 3LDPA 4KBOA 2E88A 1NGIA 3CD6N 2QA4N 3VENA 1BU6O 3CJCA 5AFUH 2FLOA 2P9KA 1SAZA 4YOVA 3CMAN 2Q1NA 5LJWA 1YF5L 4JK8A 3SMPA 5AQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWG A;  4OPA A;  3RVC A;  3O9R A;  3M5R A;  2KKZ A;  3EE9 A;  3P31 A;  3O9S A;  4OPH A;  3KWI A;  3EE8 A;  2RHK A;  3O9U A;  3D6R A;  2GX9 A;  3L4Q A;  3O9Q A;  3O9T A;  3OA9 A;  3P39 A;  3F5T A;  3P38 A; 
#chains in the Genus database with same CATH topology
 4FZX C;  1GLB G;  1IG8 A;  3WXK A;  4DSL A;  1Z05 A;  3AGK A;  3IS9 A;  3BF1 A;  4KHQ A;  4H0V B;  2QM1 A;  4EIA A;  1RDC A;  1OH5 A;  3VF6 A;  5HRO A;  1TK5 A;  3QNO A;  4FJX A;  4M7X A;  4HCB A;  5FPM A;  3CPE A;  3SAG A;  4CGD A;  1YTU A;  2D4W A;  4MDA A;  2CH6 A;  1YUW A;  2A5X A;  1BOT O;  2YJE A;  1YAG A;  1NGF A;  2PZS A;  3U8X A;  4DU4 A;  3O9R A;  1JL1 A;  3OS1 A;  1G15 A;  3VQ5 A;  4GNI A;  3K5L A;  4IBN A;  2HMP A;  4M3R A;  4CF9 A;  1VRU A;  1QSL A;  3ZSO A;  5JVH L;  5JLH A;  1JKH A;  1N36 K;  4KH5 A;  3VQ9 A;  1XI1 A;  2GWK A;  2D1K A;  3TSQ A;  4HUE A;  4CJ4 A;  3V4I A;  3TU5 A;  4BRO A;  4KH6 A;  3WXI A;  1NU0 A;  5AZJ B;  3FZM A;  3VGM A;  3IMX A;  1X1P A;  4K8Z A;  1NGD A;  5ELZ A;  1W0H A;  4CI6 A;  1QZ6 A;  2G8H A;  3M1F A;  3P5J A;  4FM0 A;  3IAY A;  2CGK A;  5HRR A;  4CGI A;  4CJ5 A;  1IKV A;  3NH2 A;  4M3Y A;  1VSJ A;  2HB5 A;  4JKG B;  3SV3 A;  1NK5 A;  3ZCM A;  1TYQ A;  2KLA A;  4KB0 A;  2OCE A;  3NF6 A;  1XNQ K;  3NGZ A;  3DXM A;  4DMN A;  2Z1I A;  1DEJ A;  4XH4 A;  3RMA A;  5CZ1 A;  3D2E A;  2O8C B;  1N5Y A;  3ZEU A;  4M42 A;  4DSI A;  1YIJ N;  3A8Y A;  4JV5 K;  3MXM A;  3LDS A;  5CE3 A;  1C6V A;  4BRA A;  3L4Q A;  1K8K A;  3QFU A;  4CEZ A;  1U49 A;  1RBS A;  4IEE A;  3VQP A;  3CCS N;  4MQ3 A;  4B3S K;  1K8A O;  1WSJ A;  4FWL A;  2NRT A;  2HHW A;  1KVB A;  3ID8 A;  3PSF A;  3EE9 A;  3RRH A;  1GLE G;  4KPY A;  4CJT A;  4CGH A;  3LP0 A;  3QER A;  4DSK A;  1ILY A;  3DJC A;  2YHA A;  5JLF A;  4JYA K;  3OA9 A;  2QKB A;  1DTQ A;  4QS9 A;  1IBL K;  3AA4 A;  2IOC A;  4PY5 A;  3OYA A;  4DV4 K;  4BAC A;  1JLG A;  1JLA A;  4LY7 A;  4CEF A;  5T7B A;  2HOE A;  4WE1 A;  3OW2 M;  1QQM A;  1VK0 A;  5IWA K;  4F3T A;  2FSJ A;  3A2F A;  4IG3 A;  3VEW A;  4J2E A;  1U45 A;  4H5W A;  1D8Y A;  2FSN A;  2NNW A;  3CC4 N;  2XO7 A;  4W5O A;  4BRQ A;  3THW B;  3D6R A;  1TK0 A;  1RT1 A;  1N34 K;  3SQ4 A;  4JKH A;  3MEG A;  3BY5 A;  4CF1 A;  4BE0 A;  4JI6 K;  1IBK K;  1RTH A;  1QQN A;  2P9L A;  2JWL A;  3VQB A;  3ZT0 A;  2E2P A;  1SS6 A;  4IOX A;  1NK4 A;  3D2F A;  4YOT A;  3P83 D;  2NRX A;  3VGL A;  4BY9 C;  3VOV A;  2IVP A;  2AJQ A;  3VQ4 A;  3KK7 A;  5HOO A;  1A5V A;  4BGA A;  1NOZ A;  1NK9 A;  1CLQ A;  1IO2 A;  3ZX0 A;  3RTV A;  4CZM A;  3CQX A;  2Z1G A;  3RSE B;  4PWD A;  1R0A A;  1LWC A;  3B6P A;  3HST B;  2OTJ N;  2P9U B;  4CJP A;  4ELV A;  2NRW A;  2O4G A;  4JKF A;  1D9D A;  1U4B A;  3OTO K;  2P9P B;  1HMV A;  4AQY K;  2YNH A;  4OPK A;  2ZJP L;  4O5F A;  3VES A;  4CFA A;  3J7Z O;  3OYM A;  1UA0 A;  2E2O A;  5C25 A;  3VEZ A;  3VQA A;  4C1N I;  5JMV A;  2BGG A;  3KHY A;  1U04 A;  2W41 A;  3CFR A;  2XY6 A;  4PA1 A;  4Z4H A;  1RT5 A;  4H4M A;  4BRI A;  3C65 A;  3THV A;  3AAP A;  5EX5 A;  3EZW A;  3MX2 A;  4K8X A;  4FJI A;  2QW9 A;  4E89 A;  4WFN L;  4BR0 A;  3D7E O;  3OBW A;  3M3Z A;  2Q97 A;  1YHQ N;  1IG9 A;  3HVT A;  1VQ5 N;  3LAK A;  4OVL A;  3K2P A;  1NKE A;  4O0I A;  2G8K A;  2RHK A;  2YHB A;  2FSK A;  3DWL A;  4YOX A;  1KXP A;  3TWH A;  2QXL A;  3ZT2 A;  3QB0 A;  1Z6R A;  3LP1 A;  4DSE A;  3LL3 A;  4ICL A;  3LM9 A;  1RNH A;  3ISN C;  4JI5 K;  1WBD A;  4EZ9 A;  4CJ7 A;  2Q2R A;  4EHU A;  3SMS A;  2QWQ A;  4CJE A;  3AAR A;  3V6D A;  1T6D A;  2W6L A;  3AVK A;  5ADX H;  3VGK A;  4BC4 A;  2O8B B;  4IO9 L;  3I8D A;  4AHS A;  5HBM A;  4FWR A;  4M45 A;  4CFC A;  4CF2 A;  2KQ2 A;  1T05 A;  2O8D B;  4KV8 A;  2BUP A;  5CYM A;  3K57 A;  1K9M O;  1IKX A;  5BRE A;  3ZET A;  2A40 A;  3TTC A;  5M1Q A;  5AQO A;  3VN5 A;  1Z25 A;  4EAH D;  3NH0 A;  2O8B A;  3NCI A;  3NH1 A;  1VQL N;  1GLA G;  3K9J A;  4J8F A;  5DK5 A;  3VF2 A;  3V9Z A;  1CZA N;  4BR7 A;  1XWL A;  3QFP A;  4B8C A;  1KAZ A;  3GG4 A;  2E1Z A;  1NGB A;  4AHV A;  3HI0 A;  3AGR A;  4ISE A;  1VQ6 N;  1HNX K;  3AVA A;  1I94 K;  4CHO A;  2QWN A;  4RW4 A;  4FWP A;  3K58 A;  1ZBH A;  4PL7 A;  4CFD A;  4E7H A;  4Y1C A;  2VYP A;  1ESV A;  4CIG A;  2XY7 A;  4G1Q A;  3O9U A;  3QLH A;  2GEM A;  3THX B;  4JN4 A;  3EKS A;  1RDW X;  2JWK A;  5E84 A;  1SKS A;  2VG5 A;  3L8B A;  1V4S A;  4W5R A;  3RR7 A;  3VEO A;  4BE2 A;  1TL1 A;  3EL2 A;  2XY5 A;  4N56 A;  1IH7 A;  3IUC A;  5AQQ A;  1RDA A;  2BE2 A;  1VQK N;  3J81 O;  2OZS A;  3UKR A;  4Z4C A;  1BGX T;  1HLU A;  3K9K A;  2O8E B;  1X9S A;  2YHY A;  1BHL A;  2HHU A;  3IDH A;  2OA8 A;  2Q0U A;  1OH6 A;  1GOC A;  4CHZ A;  3NMU A;  4GV6 A;  4JI1 K;  4CF8 A;  3HT3 A;  4U7B A;  4LF4 K;  4E1M A;  1NK8 A;  4B1W B;  2V52 B;  3NVM A;  3OYC A;  3ZX2 A;  3IFR A;  2E2Q A;  1SL0 A;  3MN9 A;  2KTQ A;  3I0S A;  3T1H K;  3KLE A;  3M8S A;  5BR8 K;  4E19 A;  2OPR A;  2RF2 A;  1BL3 A;  3O9Q A;  4LD0 A;  1I3A A;  4MLE A;  2G8W A;  3SQ1 A;  5M1O A;  1NWK A;  1B92 A;  3I0R A;  1LV5 A;  4B9U A;  4LF8 K;  1TGO A;  3G10 A;  4I6M A;  4KRE A;  4KKO A;  5KPT A;  3F9K A;  1TKZ A;  4DFM A;  2YI1 A;  3FFI A;  4FPA A;  3MX5 A;  3S41 A;  3U6F A;  4ISF A;  1MWK A;  4PQU A;  4FJG A;  1KD1 O;  1QVF M;  2A6A A;  4FJN A;  4CJL A;  2JGU A;  2ASO A;  3DXK A;  1JCG A;  1QHT A;  5LL6 Z;  3SLC A;  1ZBF A;  2NZT A;  5BRH A;  2O8E A;  3SQ0 A;  2HNY A;  4DF4 A;  3TTF A;  4B3R K;  3O9S A;  3E66 A;  4BRL A;  2NUB A;  3VTI A;  1OVQ A;  3HM9 A;  1UOC A;  2X74 A;  1BU6 O;  1BI4 B;  2P9K A;  3D0P A;  1YF5 L;  4JK8 A;  4DTR A;  1G99 A;  3NGI A;  1EP4 A;  1MA9 B;  4PUO A;  5AQN A;  2QWP A;  2B5J A;  2BTF A;  1BDG A;  3CJ9 A;  3ZYY X;  5AQY A;  1JJ2 M;  1BQM A;  4EP4 A;  4H0Y B;  3K5N A;  4FZY A;  4N47 A;  5CHI A;  3QEX A;  4F2S A;  4PHT X;  1WB9 A;  1S1T A;  3GDQ A;  4H5V A;  5C24 A;  4O55 A;  3ZSW A;  1C0M A;  4AHR A;  3PV8 A;  2BAN A;  1U48 A;  3OYK A;  1L3V A;  3ID6 A;  5FRN A;  4YFU A;  1A5X A;  3FR0 A;  2QEX N;  4CIF A;  1BA1 A;  4A62 A;  4XIU A;  3MED A;  4IOC L;  1VSH A;  4O44 A;  4IFV A;  4BC5 A;  4I9Q A;  3V9W A;  3THY B;  4KB1 A;  3CPW M;  5C42 A;  3TAB A;  3R6M A;  3R3L A;  4RG8 A;  4CF0 A;  3ULD A;  5SWM A;  4DSJ A;  4I2Q A;  3V9U A;  4DQP A;  3LZI A;  5BPM A;  4ZTF A;  2P1J A;  4F9O A;  5AQL A;  4HTU A;  2ASP A;  4CJK A;  1GLJ O;  4Q5V A;  3E9O A;  4N41 A;  1ZBU A;  3OYD A;  3VA3 A;  2O8D A;  4MFB A;  3CG7 A;  2YHW A;  3OHR A;  4DCH A;  4O8K A;  2HST A;  4DQ8 A;  1E4F T;  4X62 K;  2HW3 A;  1RDU A;  3LPU A;  1S9E A;  4CZE A;  4DS5 A;  4NCB A;  2W42 A;  1TV6 A;  3H08 A;  4JRP A;  3AVI A;  3O3H A;  3VF4 A;  5BR9 A;  1DLO A;  1NJI O;  4H03 B;  3CIP A;  3O80 A;  4FOI A;  1Q18 A;  4OKE A;  3IRX A;  3KLF A;  2EHG A;  5CY4 A;  1FK9 A;  4WQ4 A;  4H0T B;  3HK2 A;  5KPR A;  3AO2 A;  2F4V K;  4E3S A;  3ULE B;  4KHP K;  3SUQ A;  3ZEU B;  4CD1 A;  4RTF D;  3GBT A;  1KAX A;  1SL2 A;  4PKI A;  2P9P A;  4NXN K;  5J2P A;  4E1N A;  2EWS A;  5KQD A;  4Z4I A;  2YCH A;  4DTM A;  1TL3 A;  3AY9 A;  3NF9 A;  3PIP L;  3HXM A;  3UKU A;  4U67 L;  3O1W A;  1RDD A;  4FOE A;  3HBT A;  3L4I A;  3OJU A;  4W5N A;  4BRG A;  3VEY A;  1BA0 A;  3WNG A;  5I3U A;  2NLX A;  1Q86 O;  4OKK A;  1FKO A;  4DLE A;  3NGY A;  3QDK A;  4F2R A;  1RBU A;  1YJ9 N;  4CZI A;  3OBY A;  5B8H A;  5HRS A;  3QNN A;  4DFK A;  3TAF A;  2YKN A;  3M8P A;  2P51 A;  3D45 A;  1LWE A;  2D0B A;  1T03 A;  4CJS A;  1VSM A;  4WQ5 A;  4CHN A;  3LDO A;  5A2Q O;  4KI4 A;  2NRZ A;  3UIQ A;  4Z4E A;  3EO3 A;  4YOW A;  1ATR A;  4CGG A;  4CZL A;  1VQ8 N;  4IFY A;  2KZZ A;  3TAP A;  1JXB A;  4E7L A;  3BP8 A;  1KCF A;  2WTU A;  3KWI A;  4B8A B;  3L2V A;  2GUI A;  3KK3 A;  2P5O A;  1HYS A;  1T6C A;  3MN7 A;  3QIN A;  1HNZ K;  3BDP A;  3TAM A;  1W97 L;  4FLX A;  2RE2 A;  2F9T A;  4AHU A;  2D0O A;  3WEE A;  3KWG A;  3HP6 A;  3IG1 A;  3RRG A;  4CJR A;  2HHH K;  1Q81 O;  4CK3 A;  3H1Q A;  4JKB A;  4R79 A;  4ILH A;  1D4X A;  3C6A A;  2P9S B;  3OS2 A;  4BR4 A;  1QQC A;  1XHZ A;  5KRS A;  3M6G A;  4KI6 A;  1WSI A;  3HP9 A;  1LW0 A;  1RT4 A;  1U2V A;  3SI6 A;  3QBX A;  5JS2 A;  3AO4 A;  3PIO L;  4AF1 A;  1JXE A;  3I55 N;  2VWB A;  2P9I A;  2YNG A;  3JS6 A;  4DFP A;  4B1Z A;  2FF6 A;  3CQ8 A;  3VTH A;  4E1J A;  4FJH A;  4FYD A;  1C0F A;  3L2R A;  1RFQ A;  4IO8 A;  3MWP A;  3V1Q A;  2VQE K;  1NGJ A;  1WNS A;  4FWM A;  4I9L A;  1ZBL A;  2F8S A;  3ENO A;  4K0K K;  1N32 K;  1RGI A;  2CGJ A;  2O8C A;  2P9K B;  3MEE A;  1Z26 A;  3VEX A;  4YOU A;  4KTW A;  4BGB A;  2VCP A;  1KTQ A;  2QKK A;  1HNV A;  3M8R A;  2G8F A;  3CXC M;  5HL7 L;  4X64 K;  4JI3 K;  1SUQ A;  5CYQ A;  5EXW A;  3J7A P;  5M1N A;  4DV7 K;  3ITH A;  5EY4 A;  5AQZ A;  3DI6 A;  5KPZ A;  4DQS A;  3C94 A;  2Q0R A;  3O3G A;  1F21 A;  3AVH A;  5BRD A;  4YOY A;  3OYN A;  4JI7 K;  1VQ7 N;  3SAH A;  3MWT A;  2XY8 A;  3S3M A;  3BUZ B;  3HYF A;  2PBD A;  1BUP A;  4M7Y A;  4PKH A;  1BI4 A;  4IDH A;  1X9M A;  4FLZ A;  3SCX A;  4CEC A;  4BRK A;  2Z1H A;  2P9I B;  4CZJ A;  3THX A;  3THW A;  1RCH A;  2HF3 A;  2HHS A;  1RT6 A;  1NKC A;  3IKM A;  3EYZ A;  1XNR K;  5HLF A;  3MXJ A;  4I7F A;  4FCY A;  4DLG A;  2HVH A;  2UUA K;  4KH4 A;  4LH4 A;  4WQ4 C;  4DF8 A;  2QWR A;  4JD2 A;  3P1G A;  1S6Q A;  2G8U A;  4H5T A;  1ZBI A;  4HUG A;  2HVI A;  1A5W A;  3TAR A;  2H3G X;  2RN2 A;  4CVN E;  4CZG A;  3CJ1 A;  4JKC A;  2F8T A;  3KKR A;  3CYM A;  1WAJ A;  3VQC A;  3T69 A;  4OX9 K;  3NF8 A;  4X66 K;  4GY2 B;  4JI4 K;  4BR5 A;  3FZK A;  2KKZ A;  3DLK A;  1GLL O;  1LCU A;  1WAF A;  2PYL A;  3VQQ A;  2D0P A;  4AIL C;  3WXM B;  1U6Z A;  2ZE2 A;  5LJV A;  3U3G A;  2VGM A;  3K5M A;  5I42 A;  3THY A;  1TUU A;  4FWN A;  3WNH A;  1RTJ A;  4DFJ A;  3CC7 N;  4F8R A;  5KGX A;  2ZM6 K;  2FBY A;  3ZT3 A;  3CCR N;  5AZI B;  2WON A;  1FXX A;  5KTQ A;  1C1A A;  1NOY A;  4NB4 A;  4BRD A;  1VHX A;  2YKM A;  2HHT A;  4OPJ A;  3DRR A;  3KIO A;  4FSV A;  1ZYQ A;  1J54 A;  3O4N A;  5AQT A;  4LF7 K;  4KHS A;  2X78 A;  3DMJ A;  1YJW N;  3UKU B;  2IDO A;  5C10 A;  3NHG A;  3QEW A;  3SYZ A;  1NK7 A;  1K6Y A;  3H6E A;  4IFE A;  3RMD A;  4LF6 K;  2WUS A;  4DTP A;  4OPH A;  4JNE A;  3RR8 A;  1P90 A;  3SJJ A;  2XRI A;  3HZ6 A;  1EET A;  3ZT4 A;  4CER A;  1HKC A;  5BPL A;  4CFB A;  1BIU A;  4B3M K;  5ADX A;  1HKG A;  2A1R A;  4FLU A;  3SUO A;  4M3W A;  3FLC O;  4OKJ A;  3LWM A;  4BR9 A;  3CCL N;  3WNF A;  5AQK A;  3HTV A;  1NK0 A;  3I56 N;  4RW8 A;  1VQ9 N;  5JIC A;  1HQU A;  2A42 A;  4HVJ A;  3LWL A;  4B08 A;  4CEE A;  2VQF K;  3S9H A;  5FPE A;  2WOM A;  3L2W A;  1RDB A;  3CCM N;  1SKW A;  4C8N A;  4FVM A;  1TK8 A;  2E88 A;  1NGI A;  3QEI A;  2FLO A;  1SAZ A;  4YOV A;  3KK1 A;  5LJW A;  5H1S Q;  1NG9 A;  5AQX A;  3OYE A;  2Q31 A;  3DOK A;  1W2B M;  3G25 A;  1T7P A;  2GWJ A;  4K41 A;  3HL8 A;  3AVG A;  3TAN A;  1MDU B;  3OJS A;  4DV3 K;  4FJ5 A;  1ZBS A;  3P31 A;  1BIS A;  2VG6 A;  3OYI A;  3DLL L;  3VEV A;  4B9Q A;  1RBT A;  2OYQ A;  4JKD A;  2CGL A;  3ZT1 A;  4YDU C;  1IBM K;  3ZLJ A;  4EP5 A;  3KK2 A;  4DV2 K;  5GAD P;  2V51 B;  3MEC A;  4CGJ A;  3KLG A;  1KAY A;  4DSF A;  4ILG B;  4B9S A;  2WFB A;  3VA0 A;  2QK9 A;  4BR2 A;  3FZL A;  4JKE A;  3H3N O;  4IZ9 A;  2D0A A;  1XMQ K;  5LY3 A;  3CF5 L;  1VSD A;  3V1R A;  1YVU A;  5BRF A;  4ISG A;  3JXU A;  4ILJ A;  4JS5 A;  3PX0 A;  2UXB K;  1L3U A;  2GX9 A;  3ASM A;  2IS3 A;  3DXK B;  4FJK A;  4JKG A;  3I8B A;  1X3M A;  3NE6 A;  4M63 C;  3KTQ A;  1GOB A;  3LAM A;  3WUH A;  1N8R O;  3VET A;  4CJU A;  3PY8 A;  4HWI A;  3JAM O;  5AZI A;  3SNN A;  2VWJ A;  3KKS A;  3C6U A;  1UAX A;  4FWQ A;  2HBL A;  3OS0 A;  2GBZ A;  4FLV A;  3HPH A;  4DTU A;  1QTM A;  3AAQ A;  4KHN A;  5D3G A;  4NLB A;  3C6H A;  2B6A A;  1KVC A;  3L6Q A;  3LDQ A;  3I33 A;  4KFB A;  3G4S N;  1MU2 A;  2ZF5 O;  4DQI A;  1QVG M;  1L3S A;  2Y1I A;  4IJA A;  2I5J A;  3TSP A;  3K0S A;  4M3T A;  2UYT A;  1NLV A;  1QE1 A;  3T1A A;  3LAL A;  4DTJ A;  4HHT A;  2BDP A;  1X3N A;  4H4O A;  1BIZ A;  3OYL A;  4KHY A;  3WT0 A;  4RW6 A;  3RVC A;  4OLA A;  2A1S A;  4Z94 A;  4DR7 K;  1HNW K;  2DY4 A;  1LOT B;  2ATQ A;  4AM6 A;  1S1V A;  5C2F A;  3AVN A;  2R7Y A;  3T7Z A;  5AQW A;  3T19 A;  3U9D A;  4J2B A;  3HOS A;  4FJ7 A;  1VQN N;  1KSP A;  4LF9 K;  3DM2 A;  1EWR A;  3PO5 A;  1RBV A;  4IJN A;  2G8V A;  1YXQ A;  3PX4 A;  1HNI A;  3A5O C;  1HUX A;  4BRE A;  4BDY A;  3CFP A;  3KLH A;  3J80 O;  1U2V B;  3NAE A;  1WSE A;  3NBP A;  3VQE A;  3DLR A;  3MDQ A;  2VWK A;  4IXC A;  4OO1 J;  2HF4 A;  3QET A;  1NMN A;  1EO1 A;  4B3O A;  1EXQ A;  3C6T A;  1TYQ B;  3DYA A;  4IEI A;  4J2A A;  1TKT A;  1YI2 N;  3U9Z A;  1NJW A;  1HYV A;  1E3M A;  1VSF A;  4L3Q A;  2ASM A;  2KFZ A;  1VSL A;  3FFK B;  3RMB A;  1YTA A;  2P9U A;  3TR8 A;  3WEE B;  1SQK A;  5LMU K;  4NLC A;  2IAJ A;  4RCH A;  4BG8 A;  3MXI A;  4WCE L;  4DV6 K;  4XH5 A;  2NRH A;  1DKG D;  1BCM A;  1CXU A;  4YY3 K;  1NKB A;  3VQ6 A;  2Q3S A;  4UQG A;  3F73 A;  3CCU N;  2OTL N;  4FL9 A;  2LSN A;  2PY5 A;  1NM1 A;  4XH1 A;  1BO5 O;  3KZB A;  1C1C A;  2E4L A;  2HND A;  3O9T A;  2YJF A;  3LP3 A;  4AH9 A;  2P9L B;  1V4T A;  5AQU A;  4EZ6 A;  4WYB A;  4GKK K;  3UB5 A;  3SUN A;  1Y64 A;  2A41 A;  4C1N K;  4CGF A;  4R5P A;  3A5N C;  3T1Y K;  2QWM A;  1DTT A;  1KVA A;  4XEI A;  4CK1 A;  2E2N A;  3L2U A;  2KFN A;  3DOL A;  4YOR A;  4GVM A;  1CZ9 A;  3E9L A;  5AQI A;  4H5R A;  4FZZ A;  2ZD1 A;  3HJF A;  1KLN A;  3FZH A;  1TKD A;  2KZM A;  4IWV A;  1GLD G;  1ITG A;  1LAW A;  2Y1J A;  3HM8 A;  4BRN A;  2ITM A;  2P9N A;  4CEA A;  3LPT A;  1QSY A;  2IVN A;  1JLQ A;  1JCF A;  4JI8 K;  3ZSY A;  4F3O A;  2GV9 A;  1HPM A;  1L3T A;  1IKY A;  4NXM K;  1I39 A;  1GOA A;  4FJ9 A;  5FPN A;  1TUY A;  4CK2 A;  4NO7 A;  1Q8I A;  3F2K A;  2UXD K;  3KD1 E;  4CBX A;  2FF3 B;  1XHX A;  1S3X A;  4Y0W A;  3CCV N;  5EOY A;  1KQS M;  4IKF A;  3ZSZ A;  5AQS A;  5DM7 L;  3AVJ A;  4OPA A;  3JSM A;  4JRQ A;  1NGG A;  4BRP A;  2I7P A;  3BF3 A;  5JVG L;  2F96 A;  4DTN A;  2WC9 A;  4B1Y B;  4ID1 A;  2IC3 A;  3MN5 A;  3ZSV A;  4K42 A;  5E41 A;  1S1U A;  3SAF A;  3ZSQ A;  3U3Y A;  4HTL A;  4H0X B;  4FM2 A;  2YNF A;  3UE5 A;  3C95 A;  4DWI A;  4YDU A;  1EQY A;  3DLB A;  4DV1 K;  3M5R A;  3T3F A;  2ZJQ L;  2ITG A;  3L0Q A;  1SV5 A;  5F0X A;  4HUF A;  4JEP A;  5M1P A;  2UUC K;  4PL8 A;  1HJO A;  2ZWH A;  2ZGY A;  1B9D A;  3A0I X;  5FPD A;  5GAH P;  4DB3 A;  3JYT A;  2O8F B;  3RWU A;  4E7J A;  2ZQB A;  3CI5 A;  1X9W A;  3O1B A;  2HHX A;  3CJ7 A;  3NFA A;  4CJQ A;  1NGC A;  1NMD A;  2NRV A;  4B9T A;  4FVU A;  3ENH A;  1VQ4 N;  3MCA B;  1ASV A;  4I2P A;  2RKI A;  4OJR A;  1UWB A;  4JKA A;  2KW4 A;  5FRM A;  5GIP A;  4JHD A;  3SJH A;  1EKE A;  2PAV A;  3C7N A;  1XUP O;  2HBM A;  3BEX A;  1HR0 K;  4FJM A;  5KQ8 A;  3C0B A;  1S9G A;  1OH7 A;  3O5B A;  4A2B A;  3GE1 A;  3LM2 A;  3CFO A;  1IV0 A;  4LFA K;  4KO0 A;  3TAE A;  1KFS A;  4ZHR A;  5HP1 A;  5AR0 A;  3QES A;  3CC2 N;  1WSG A;  3PSI A;  1WSF A;  3RSE A;  4AHC A;  4DV0 K;  4WF9 L;  3CCE N;  4O4G A;  5C12 A;  1IJJ A;  4FWS A;  3AVL A;  4B9N A;  3HRG A;  4FWK A;  2DFH A;  1H1V A;  4Z4G A;  1TKX A;  2E5L K;  4CEO A;  4KAZ A;  1REV A;  4PKG A;  5FRO A;  4N5S A;  1C0G A;  4BRC A;  4M41 A;  4C8L A;  3RMC A;  2HBJ A;  1EX4 A;  4DKW A;  4V19 S;  1BQN A;  4CZF A;  3CCJ N;  2AA4 A;  1HKB A;  4FK0 A;  2E20 A;  3ZX3 A;  3LP2 A;  4B3T K;  3FE1 A;  4NYN A;  2FC0 A;  3F5T A;  1ASU A;  3VQ8 A;  4G9Z A;  3QEP A;  4AHT A;  1KC8 O;  2X6S A;  4WFA L;  4CZH A;  1KLM A;  1WOQ A;  1HPZ A;  3VER A;  4FK4 A;  3L3V A;  2PYJ A;  4H0P A;  1S1X A;  1IKW A;  3O4Q A;  3LDP A;  4DR1 K;  4KBO A;  3CD6 N;  2QA4 N;  3CJC A;  5AFU H;  3CMA N;  2Q1N A;  3MAQ A;  1HRH A;  4BQL A;  1XC9 A;  4EFH A;  4K43 A;  4CES A;  4FW1 A;  4FO0 A;  3MN6 A;  2UXC K;  2FXU A;  2HBK A;  3R9P A;  1VQP N;  1QHA A;  3E1Y A;  5C2D A;  2YHX A;  4W5T A;  4YHH K;  3AVF A;  3TSU A;  4DQQ A;  3SPZ A;  2Q36 A;  2V7Y A;  1NGA A;  1JCE A;  3N4Q A;  3TTD A;  2ZJR L;  4H5N A;  2I7N A;  1Q9Y A;  3D2F B;  3G6E N;  1YIT N;  2NRR A;  5E26 A;  4KHW A;  4OLB A;  1K8K B;  1TAQ A;  2KHO A;  1N33 K;  4BQZ A;  2E8A A;  5AQP A;  3NF7 A;  4ZTJ A;  5J2Q A;  4WQ5 C;  1WSH A;  3LDL A;  3BZC A;  3DRP A;  3AO5 A;  4KTQ A;  3WQU A;  4HCC A;  2FBT A;  3OY9 A;  1OH8 A;  1Q7Y O;  1QS4 A;  4B1V A;  1OVY A;  2HHV A;  2UU9 K;  1QZ5 A;  5I9E B;  4LF5 K;  3BZK A;  1CZB A;  3MCP A;  1HX1 A;  1UA1 A;  3QML A;  5F1X A;  4DR3 K;  3KJV A;  4IG0 A;  4B9M A;  3A5M C;  1WUA A;  3AA5 X;  5M1K A;  1NJY A;  3DLH A;  4E7I A;  5AQV A;  3W0L A;  1JLC A;  1QQO A;  1RT2 A;  4FWO A;  4MDB A;  3R8E A;  3K59 A;  3AO3 A;  3AA3 A;  3QEV A;  4K25 A;  1M1K O;  3CME N;  3AV9 A;  4YNQ A;  1J5O A;  4QS8 A;  5GIN A;  4C8O A;  1XMO K;  2F7T A;  1Q9X A;  4MO5 A;  4A57 A;  4M3U A;  4A5B A;  3J8A A;  5AQH A;  3ULE A;  4JK9 A;  2GEL A;  3EEQ A;  3CCQ N;  4ID5 A;  2WBN A;  2ETJ A;  1ASW A;  2CH5 A;  2E1Y A;  4GVE A;  4TSX A;  3VPZ A;  3DLE A;  1NGE A;  3R1X A;  4UY8 O;  1NJX A;  3PX6 A;  4FXD A;  4BRF A;  5J2M A;  2DFF A;  4CW7 B;  4EHT A;  2QWO A;  4DQR A;  4BC3 A;  1P8Z A;  1J9A A;  5K14 A;  3SPY A;  4JI0 K;  5DMR A;  1RIL A;  1S72 N;  4CHP A;  3QIC A;  3OYJ A;  4DUZ K;  4JD2 B;  3MK6 A;  3PLA A;  5AQJ A;  3QBW A;  3O6W A;  3F9M A;  4A2A A;  2YX6 A;  1YJN N;  1C0U A;  3V81 A;  3GL1 A;  3SZ2 A;  3KLI A;  3P39 A;  5BN9 A;  4FM1 A;  3A5L C;  4BG9 A;  3WQT A;  1JL2 A;  1QSS A;  3TAQ A;  5HRP A;  3GOI A;  4FJJ A;  1T3V A;  1CXQ A;  5MLC Q;  3HPO A;  2FBV A;  3HVR A;  1X9J A;  4LSL A;  4FJ8 A;  1TVR A;  3V9X A;  1SZ2 A;  5GAG P;  4CJV A;  5J1E A;  4DR5 K;  4O8U A;  5SZT A;  1S6P A;  4DR6 K;  1FKP A;  1VRT A;  3MMV A;  2A3Z A;  3TAG A;  3AVC A;  1HQE A;  3HOT A;  2IIR A;  4LFC K;  1LAV A;  5AQF A;  3S3N A;  3AVB A;  1DGK N;  3V9S A;  3DLG A;  4CED A;  4CEB A;  3OYH A;  4FJL A;  4Q0B A;  4WFB L;  3FGU A;  3G71 N;  5C15 A;  2BH1 A;  1WN7 A;  1GLC G;  1D5A A;  3OVN A;  1NBW A;  5AQM A;  4BDZ A;  2X6N A;  2O4I A;  3PO4 A;  3S3O A;  4Z4F A;  1FW6 A;  3CQY A;  5FDL A;  2P5G A;  1J6Z A;  5BPN A;  2AP1 A;  4CJF A;  4M3Z A;  2B4J A;  1OKJ A;  3SV4 A;  3CER A;  1LWF A;  1XC3 A;  5AQR A;  4CCH A;  4FLT A;  1T44 A;  3AA2 A;  3CM6 A;  2HMI A;  4N76 A;  3VMF B;  1TAU A;  4CBU A;  4LH5 A;  3QIP A;  1NNE A;  4JLH A;  1YVN A;  1ATN A;  3P4I A;  1MWM A;  4J2D A;  1ATS A;  4DUY K;  4O5B A;  3K5O A;  4DG1 A;  3ENB A;  4DR4 K;  1S1W A;  1E4G T;  4B1X B;  4GMJ B;  1BG3 A;  1WLJ A;  2OAN A;  1C0T A;  4Z0U A;  1JLB A;  2DFE A;  4JI2 K;  4DU3 A;  4BDP A;  4JS4 A;  3L3U A;  3KD5 E;  2OZM A;  5AFU A;  1K73 O;  2FBX A;  2QTD A;  4OGE A;  2J4R A;  3W3D A;  4BVP A;  4FK2 A;  3E01 A;  4A61 A;  5GIO A;  1HJR A;  4BE1 A;  4LSN A;  3EE8 A;  4CJ3 A;  1Q82 O;  3SBG A;  2XHB A;  4X65 K;  4NCG A;  4FW2 A;  1VAZ A;  1ZXO A;  4BC2 A;  3NVK A;  1VSK A;  3H1V X;  5JS1 A;  3ATV A;  2W6K A;  1RT7 A;  4BVO A;  3OYF A;  1W9H A;  3H3O B;  4RW7 A;  1VQM N;  3WXL A;  5AQG A;  5AZJ A;  3ATU A;  2DPN A;  5LMN K;  4M3X A;  1RBR A;  3LAN A;  3H46 O;  4FPB A;  3VQ7 A;  2P9N B;  3B6O A;  4LC9 B;  1W7A A;  1RTI A;  2YV0 X;  3O4W A;  3M8Q A;  4IDK A;  4O0J A;  3NDK A;  4BRM A;  4GKJ K;  4DTX A;  4BWJ A;  1L5U A;  2QXF A;  2PFU A;  5GAE P;  4DR2 K;  1JLF A;  4C8M A;  4AM7 A;  3TPQ A;  4CBW A;  4B1U B;  3N4P A;  1VSE A;  3CHW A;  4FLY A;  2E6M A;  3DXM B;  3DRS A;  3G0Z A;  3AO1 A;  3B8A X;  3HO1 A;  3ZSR A;  1EWQ A;  3O3F A;  1R59 O;  4E0D A;  3WNE A;  3ZSX A;  2Z1J A;  1NJZ A;  4B9L A;  1B9F A;  3FZF A;  3O08 A;  5J2N A;  2VGN A;  4E7K A;  1KFD A;  3H45 C;  2QI2 A;  2UUB K;  2GTD A;  3VQD A;  4RWT A;  4LFB K;  1BCO A;  3ZET B;  1HYZ A;  4H0O A;  3E9P A;  4H8K A;  2QWL A;  4L8R B;  4ELU A;  1O1W A;  4RW9 A;  4A59 A;  4CEQ A;  4A5A A;  3HPG A;  2OPS A;  3AVM A;  4JK7 A;  4CHQ A;  1C1B A;  4KRF A;  1WBB A;  1NK6 A;  2E6L A;  1SKR A;  2DTU A;  4DTO A;  4CJW A;  4GW6 A;  4QAG A;  4DS4 A;  3LZJ A;  3EKU A;  4GV3 A;  3EY1 A;  3CM5 A;  5KRT A;  3HSC A;  4Y1D A;  3D2E B;  3CET A;  1LW2 A;  3J7Y P;  4DV5 K;  5DM6 L;  4W5Q A;  3ALY A;  1T8E A;  4BWM A;  2W40 A;  1U47 A;  4KTZ A;  3LDN A;  5TKW A;  1O13 A;  4MO4 A;  1N6Q A;  5F2R A;  1Y97 A;  4BRH A;  2P9S A;  3L2Q A;  4B9V A;  1J5E K;  3EZ5 A;  2JLE A;  1VQO N;  1D9F A;  4IOA L;  1S5J A;  1YT3 A;  4CHY A;  5KI6 A;  3V1O A;  3WXJ A;  1XQS C;  5TKY A;  1DT9 A;  5EVZ A;  2VG7 A;  4OGC A;  3PUF A;  4I6M B;  4CIE A;  2OPP A;  1SL1 A;  3QIO A;  5CR4 A;  4JHD B;  4QS7 A;  5C0Y A;  5AJ3 K;  5HRN A;  3QO9 A;  3C7N B;  4NYF A;  2HNZ A;  4DU1 A;  1BWF O;  3O8M A;  3SK3 A;  5IT9 O;  3OYG A;  4GV9 A;  2IGI A;  2HHQ A;  4FLW A;  5FLX O;  4CZK A;  4QCL A;  2ZGZ A;  4C8K A;  4MLH A;  1VSI A;  3DAW A;  4CE9 A;  2OPQ A;  4CD3 A;  4JAX A;  1GLF O;  1KRP A;  3BGR A;  3U4L A;  4F4K A;  3SUP A;  2O8F A;  4NCA A;  3SBT A;  2GUP A;  2RPI A;  3CJB A;  3Q7C A;  2IVO A;  2V7Z A;  5M1F A;  3SQ2 A;  1M90 O;  5BN8 A;  2YNI A;  5KGW A;  2D0C A;  3P38 A;  3KVG A;  2F9W A;  1NGH A;  4ELT A;  3UKR B;  5EU7 A;  1ZC6 A;  1S22 A;  3Q7B A;  4KHU A;  4C23 A;  2EX3 A;  4DHY A;  1RT3 A;  3CJA A;  4DTS A;  1RTD A;  3EN9 A;  5CZ2 A;  3OYB A;  3VEN A;  1FJG K;  2D5R A;  1JLE A;  4QOZ B;  1J53 A;  3TI0 A;  2G8I A;  3SMP A; 
#chains in the Genus database with same CATH homology
 1GLB G;  4BQL A;  2Q31 A;  4EFH A;  1IG8 A;  3WXK A;  3G25 A;  1W2B M;  1G99 A;  1Z05 A;  3AGK A;  4K43 A;  2GWJ A;  1MA9 B;  3BF1 A;  4K41 A;  5AQN A;  2QWP A;  1MDU B;  4FO0 A;  2BTF A;  1BDG A;  2QM1 A;  3CJ9 A;  3MN6 A;  4H0V B;  3ZYY X;  4EIA A;  5AQY A;  1ZBS A;  2FXU A;  2HBK A;  3P31 A;  3R9P A;  3VF6 A;  1VQP N;  1JJ2 M;  3DLL L;  3VEV A;  1QHA A;  4B9Q A;  3E1Y A;  4H0Y B;  5C2D A;  2YHX A;  4JKD A;  2CGL A;  4M7X A;  5FPM A;  3CPE A;  3SAG A;  4YDU C;  3TSU A;  5CHI A;  2Q36 A;  2D4W A;  2V7Y A;  4MDA A;  1NGA A;  5GAD P;  1JCE A;  2V51 B;  3N4Q A;  4PHT X;  3TTD A;  2CH6 A;  1KAY A;  1YUW A;  3GDQ A;  2I7N A;  2A5X A;  1BOT O;  4H5V A;  4H5N A;  3D2F B;  4ILG B;  2YJE A;  1YAG A;  2WFB A;  1NGF A;  3G6E N;  1YIT N;  2NRR A;  5E26 A;  3U8X A;  1K8K B;  4BR2 A;  2KHO A;  3FZL A;  3O9R A;  4JKE A;  3H3N O;  3ID6 A;  4IZ9 A;  4BQZ A;  2E8A A;  5AQP A;  5LY3 A;  3CF5 L;  4WQ5 C;  3LDL A;  4GNI A;  2HMP A;  3FR0 A;  2QEX N;  5BRF A;  1BA1 A;  3WQU A;  5JVH L;  4ISG A;  3JXU A;  4ILJ A;  4A62 A;  5JLH A;  1Q7Y O;  4KH5 A;  4IOC L;  2GWK A;  2GX9 A;  4B1V A;  1OVY A;  2D1K A;  3DXK B;  3TSQ A;  4JKG A;  4BC5 A;  1QZ5 A;  5I9E B;  3I8B A;  1X3M A;  3TU5 A;  3MCP A;  4BRO A;  4KH6 A;  3WXI A;  3CPW M;  1HX1 A;  3R6M A;  3R3L A;  5AZJ B;  4M63 C;  3FZM A;  3WUH A;  3QML A;  3VGM A;  5F1X A;  3VET A;  3IMX A;  1N8R O;  4HWI A;  3A5M C;  5AZI A;  1NGD A;  5BPM A;  1WUA A;  5ELZ A;  4CI6 A;  5M1K A;  1QZ6 A;  5AQV A;  4F9O A;  5AQL A;  2ASP A;  3M1F A;  4FWQ A;  3W0L A;  1GLJ O;  2HBL A;  2CGK A;  1QQO A;  4FWO A;  4MDB A;  3E9O A;  3R8E A;  4JKG B;  4K25 A;  1M1K O;  3CME N;  3AAQ A;  2YHW A;  3OHR A;  1TYQ A;  2KLA A;  4DCH A;  4NLB A;  3C6H A;  4O8K A;  2HST A;  3L6Q A;  4QS8 A;  4DQ8 A;  5GIN A;  1E4F T;  3LDQ A;  3I33 A;  1RDU A;  3DXM A;  4CZE A;  2F7T A;  3G4S N;  4MO5 A;  4A57 A;  2ZF5 O;  4A5B A;  1DEJ A;  4XH4 A;  3J8A A;  5AQH A;  1QVG M;  3ULE A;  4JK9 A;  3D2E A;  2GEL A;  4IJA A;  3ZEU A;  3TSP A;  3CCQ N;  3VF4 A;  5BR9 A;  1NJI O;  2UYT A;  2WBN A;  3A8Y A;  4H03 B;  1YIJ N;  3CIP A;  3O80 A;  1NLV A;  1Q18 A;  4FOI A;  2CH5 A;  2E1Y A;  4GVE A;  3VPZ A;  5CE3 A;  4BRA A;  1NGE A;  3R1X A;  3L4Q A;  1K8K A;  4UY8 O;  3QFU A;  1X3N A;  4WQ4 A;  4H0T B;  4BRF A;  5KPR A;  4EHT A;  2QWO A;  4IEE A;  3WT0 A;  3CCS N;  4BC3 A;  3RVC A;  1P8Z A;  1K8A O;  4Z94 A;  4FWL A;  1LOT B;  3ULE B;  2NRT A;  3ID8 A;  4AM6 A;  3EE9 A;  3ZEU B;  1S72 N;  3QIC A;  4CD1 A;  5C2F A;  1GLE G;  4RTF D;  3GBT A;  1KAX A;  5AQW A;  3T7Z A;  4JD2 B;  3U9D A;  4PKI A;  2P9P A;  3MK6 A;  3HOS A;  3PLA A;  5AQJ A;  1VQN N;  3QBW A;  3O6W A;  3F9M A;  4A2A A;  2EWS A;  2YX6 A;  1YJN N;  1ILY A;  3DJC A;  5KQD A;  2YCH A;  3GL1 A;  5JLF A;  3OA9 A;  3P39 A;  4IJN A;  5BN9 A;  3A5L C;  3AY9 A;  4QS9 A;  1YXQ A;  4BG9 A;  3PIP L;  3WQT A;  3A5O C;  1HUX A;  4BRE A;  3UKU A;  4U67 L;  3O1W A;  2HOE A;  4FOE A;  3HBT A;  3OW2 M;  1QQM A;  3GOI A;  3L4I A;  1T3V A;  4BRG A;  1U2V B;  2FSJ A;  3VEY A;  1BA0 A;  5MLC Q;  2NLX A;  3MDQ A;  3VEW A;  4IXC A;  1Q86 O;  4OO1 J;  2HF4 A;  4H5W A;  3QDK A;  1EO1 A;  1YJ9 N;  2FSN A;  2NNW A;  4CZI A;  3OBY A;  1X9J A;  1TYQ B;  3CC4 N;  4IEI A;  5B8H A;  4BRQ A;  1YI2 N;  1SZ2 A;  3U9Z A;  3D6R A;  5GAG P;  4O8U A;  4L3Q A;  2ASM A;  2ZJR L;  3FFK B;  4JKH A;  3MMV A;  2A3Z A;  4WQ5 A;  3LDO A;  3HOT A;  2NRZ A;  1QQN A;  2P9U A;  2P9L A;  2JWL A;  3EO3 A;  2IIR A;  3WEE B;  1ATR A;  5AQF A;  2E2P A;  1SS6 A;  4IOX A;  1SQK A;  4CZL A;  4NLC A;  3D2F A;  4YOT A;  1DGK N;  1VQ8 N;  4RCH A;  4BG8 A;  4WCE L;  3BP8 A;  4XH5 A;  2NRH A;  2NRX A;  3VGL A;  3FGU A;  1DKG D;  3VOV A;  2IVP A;  4WFB L;  3G71 N;  4BY9 C;  3KWI A;  5C15 A;  3KK7 A;  5HOO A;  2BH1 A;  3CCU N;  2OTL N;  4FL9 A;  1GLC G;  1NM1 A;  4XH1 A;  1BO5 O;  4BGA A;  1T6C A;  3MN7 A;  1NBW A;  3KZB A;  5AQM A;  3ZX0 A;  4CZM A;  3CQX A;  2YJF A;  3CQY A;  3O9T A;  1W97 L;  3RSE B;  2RE2 A;  2OTJ N;  1J6Z A;  5BPN A;  2P9U B;  2AP1 A;  2F9T A;  1V4T A;  2D0O A;  2P9L B;  3KWG A;  4WYB A;  5AQU A;  3WEE A;  2NRW A;  4JKF A;  3UB5 A;  1OKJ A;  1Y64 A;  2A41 A;  3CER A;  1XC3 A;  5AQR A;  1Q81 O;  2P9P B;  3H1Q A;  1T44 A;  4JKB A;  4C1N K;  4R79 A;  4ILH A;  4O5F A;  3VES A;  2ZJP L;  3J7Z O;  3A5N C;  2E2O A;  1D4X A;  3VMF B;  3C6A A;  2P9S B;  2QWM A;  3VEZ A;  4CBU A;  4C1N I;  5JMV A;  3KHY A;  4XEI A;  4BR4 A;  1YVN A;  1ATN A;  3P4I A;  1MWM A;  2E2N A;  2W41 A;  3M6G A;  1ATS A;  4YOR A;  3C65 A;  4BRI A;  3ENB A;  3AAP A;  5EX5 A;  3EZW A;  3MX2 A;  3E9L A;  1U2V A;  1E4G T;  4B1X B;  2QW9 A;  3QBX A;  5AQI A;  4H5R A;  1BG3 A;  4WFN L;  4AF1 A;  4BR0 A;  3D7E O;  3PIO L;  2OAN A;  2P9I A;  2VWB A;  3I55 N;  3JS6 A;  3OBW A;  3FZH A;  4B1Z A;  3M3Z A;  2FF6 A;  2Q97 A;  4IWV A;  3VTH A;  5AFU A;  1YHQ N;  1K73 O;  4E1J A;  2QTD A;  2J4R A;  1C0F A;  1GLD G;  1RFQ A;  4IO8 A;  3MWP A;  3W3D A;  4BVP A;  1NGJ A;  1VQ5 N;  4FWM A;  3HM8 A;  4A61 A;  5GIO A;  4BRN A;  2ITM A;  2P9N A;  3ENO A;  3EE8 A;  1RGI A;  2RHK A;  3DWL A;  2FSK A;  1Q82 O;  2CGJ A;  3SBG A;  4YOX A;  1KXP A;  2QXL A;  2IVN A;  2P9K B;  1JCF A;  1VAZ A;  3VEX A;  1ZXO A;  3QB0 A;  1Z6R A;  4BC2 A;  3NVK A;  4YOU A;  3H1V X;  4BGB A;  2VCP A;  3LL3 A;  3ATV A;  4BVO A;  3LM9 A;  3CXC M;  3H3O B;  1HPM A;  1VQM N;  3WXL A;  5HL7 L;  5AQG A;  5AZJ A;  4CJ7 A;  2Q2R A;  4EHU A;  3ATU A;  3SMS A;  2QWQ A;  2DPN A;  5FPN A;  3AAR A;  1TUY A;  3H46 O;  1T6D A;  5ADX H;  4NO7 A;  3VGK A;  4FPB A;  5EXW A;  4BC4 A;  2P9N B;  4IO9 L;  5M1N A;  4LC9 B;  3F2K A;  5EY4 A;  3O4W A;  4FWR A;  5AQZ A;  4CBX A;  2FF3 B;  5KPZ A;  4BRM A;  2Q0R A;  1S3X A;  4Y0W A;  2PFU A;  5GAE P;  5BRD A;  3CCV N;  2BUP A;  4AM7 A;  5EOY A;  1KQS M;  3TPQ A;  4CBW A;  4B1U B;  4YOY A;  5AQS A;  5DM7 L;  3N4P A;  4OPA A;  1K9M O;  3CHW A;  1VQ7 N;  3SAH A;  1NGG A;  3MWT A;  4BRP A;  3DXM B;  5BRE A;  2I7P A;  3BUZ B;  3ZET A;  2A40 A;  3BF3 A;  3TTC A;  5JVG L;  5M1Q A;  3B8A X;  5AQO A;  4EAH D;  2PBD A;  1BUP A;  4M7Y A;  4PKH A;  2WC9 A;  4B1Y B;  1R59 O;  4IDH A;  1VQL N;  1GLA G;  3K9J A;  3MN5 A;  4J8F A;  3VF2 A;  3FZF A;  3O08 A;  4K42 A;  1CZA N;  2VGN A;  3SAF A;  4BR7 A;  4BRK A;  4HTL A;  3QFP A;  2P9I B;  3H45 C;  2QI2 A;  4H0X B;  1KAZ A;  4CZJ A;  3GG4 A;  2E1Z A;  3UE5 A;  1NGB A;  2HF3 A;  2GTD A;  3HI0 A;  1EQY A;  3AGR A;  4YDU A;  4RWT A;  4ISE A;  1VQ6 N;  3M5R A;  3ZET B;  3IKM A;  4H0O A;  3E9P A;  4YOW A;  2QWN A;  3L0Q A;  2ZJQ L;  2QWL A;  4FWP A;  5F0X A;  4PL7 A;  4A59 A;  4JEP A;  2VYP A;  5M1P A;  1ESV A;  4KH4 A;  4WQ4 C;  4A5A A;  2QWR A;  4PL8 A;  4JD2 A;  4H5T A;  4JK7 A;  1HJO A;  3O9U A;  2ZWH A;  2ZGY A;  3A0I X;  2GEM A;  5FPD A;  5GAH P;  2H3G X;  4DB3 A;  4JN4 A;  3EKS A;  4CZG A;  3CJ1 A;  2JWK A;  1RDW X;  4JKC A;  5E84 A;  3EKU A;  3CI5 A;  4GV3 A;  1V4S A;  3T69 A;  3O1B A;  3VEO A;  3CJ7 A;  1NGC A;  3HSC A;  3EL2 A;  4GY2 B;  4BR5 A;  1NMD A;  3D2E B;  3CET A;  3FZK A;  2NRV A;  3IUC A;  5AQQ A;  2KKZ A;  1VQK N;  4FVU A;  5DM6 L;  3UKR A;  1GLL O;  3ENH A;  1LCU A;  1HLU A;  1VQ4 N;  3MCA B;  2W40 A;  3K9K A;  2D0P A;  3WXM B;  1U6Z A;  5LJV A;  4JKA A;  2VGM A;  3LDN A;  5TKW A;  1O13 A;  4MO4 A;  5GIP A;  4JHD A;  3SJH A;  2YHY A;  1TUU A;  4FWN A;  5F2R A;  4BRH A;  2P9S A;  2PAV A;  3IDH A;  2Q0U A;  3C7N A;  1XUP O;  3CC7 N;  3NMU A;  4GV6 A;  1VQO N;  2HBM A;  3BEX A;  3CCR N;  5AZI B;  4U7B A;  4IOA L;  5KQ8 A;  3WXJ A;  4B1W B;  1XQS C;  5TKY A;  2V52 B;  3NVM A;  1DT9 A;  5EVZ A;  3ZX2 A;  4NB4 A;  3IFR A;  2E2Q A;  3C0B A;  4I6M B;  3MN9 A;  3O5B A;  4BRD A;  4A2B A;  3GE1 A;  3LM2 A;  5CR4 A;  4JHD B;  4FSV A;  4QS7 A;  5C0Y A;  3C7N B;  5AQT A;  5AR0 A;  3CC2 N;  3O9Q A;  1BWF O;  3O8M A;  1YJW N;  3UKU B;  4MLE A;  5C10 A;  3RSE A;  4WF9 L;  3CCE N;  3SK3 A;  5C12 A;  5M1O A;  4GV9 A;  1IJJ A;  4FWS A;  1NWK A;  3HRG A;  4FWK A;  4CZK A;  2ZGZ A;  3H6E A;  4MLH A;  4I6M A;  1H1V A;  3DAW A;  4IFE A;  5KPT A;  2WUS A;  4PKG A;  4CD3 A;  1C0G A;  1GLF O;  2YI1 A;  4FPA A;  4JAX A;  4JNE A;  4OPH A;  2HBJ A;  3U4L A;  4BRC A;  4DKW A;  1P90 A;  3MX5 A;  3HZ6 A;  3S41 A;  4CZF A;  3CCJ N;  4ISF A;  1HKC A;  2GUP A;  1HKB A;  2AA4 A;  1MWK A;  3CJB A;  3Q7C A;  3SBT A;  5BPL A;  2E20 A;  2IVO A;  2V7Z A;  3ZX3 A;  1HKG A;  5ADX A;  5M1F A;  5BN8 A;  5H1S Q;  3FE1 A;  1KD1 O;  1M90 O;  1QVF M;  2A6A A;  3F5T A;  3FLC O;  3P38 A;  4BR9 A;  3CCL N;  4G9Z A;  3KVG A;  5AQK A;  2ASO A;  2F9W A;  1NGH A;  3DXK A;  1JCG A;  3HTV A;  3UKR B;  1VQ9 N;  3I56 N;  3SLC A;  1ZC6 A;  1KC8 O;  4WFA L;  2NZT A;  1S22 A;  3Q7B A;  4CZH A;  5BRH A;  5JIC A;  1WOQ A;  2A42 A;  3VER A;  4C23 A;  4DHY A;  3CJA A;  3TTF A;  3O9S A;  4H0P A;  3E66 A;  5FPE A;  4BRL A;  3EN9 A;  3CCM N;  3VTI A;  3LDP A;  4KBO A;  2E88 A;  1NGI A;  3CD6 N;  2QA4 N;  3VEN A;  1BU6 O;  3CJC A;  5AFU H;  2FLO A;  2P9K A;  1SAZ A;  4YOV A;  3CMA N;  2Q1N A;  5LJW A;  1YF5 L;  4JK8 A;  3SMP A;  5AQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...