3P31A

Crystal structure of the ns1 effector domain from influenza a/vietnam/1203/2004 (h5n1) virus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
120
structure length
120
Chain Sequence
PASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIKMDQAIMDKTIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTGEDVKNAIGVLIGGLEWNDNTVRVTETIQRFAWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Nonstructural protein 1
publication title X-ray structures of the NS1 effector domain from highly pathogenic influenza A/Vietnam/1203/2004 (H5N1) virus
rcsb
source organism Influenza a virus
total genus 33
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3p31A00
3O9QA 3O9RA 3O9UA 3D6RA 3F5TA 3KWGA 3OA9A 3P38A 3P31A 3O9SA 3O9TA 3M5RA 2GX9A 3RVCA 3KWIA 4OPHA 3EE9A 3EE8A 2RHKA 3L4QA 3P39A 2KKZA 4OPAA
chains in the Genus database with same CATH superfamily
3ENOA 3QNOA 3C95A 1E3MA 5HP1A 3TAMA 2KFNA 3AV9A 3SUOA 1TVRA 4JI7K 2BDPA 2BUPA 2BE2A 3L6QA 3TAQA 3FZLA 1NJIO 3CJBA 3NGZA 3VQBA 3QEPA 3VQEA 3I0SA 4ICLA 1CLQA 4AHTA 1RGIA 1VQ7N 4PL8A 1OH7A 1OH5A 4KH4A 1TL3A 4A2AA 3ISNC 3WQUA 1T7PA 4AQYK 4PKHA 4H4OA 3FGUA 2O4GA 3IS9A 2E6MA 3M8SA 5JVHL 4CJPA 5FRMA 3RSEA 3CJ9A 1SV5A 3BZKA 1X3MA 4DTOA 4ISGA 1RBSA 3AVHA 3R9PA 2ASOA 3LZJA 3LM9A 3EE9A 4KKOA 1NMDA 5AR0A 4I7FA 3SJHA 4N5SA 3A5OC 1KVCA 2IS3A 3D2FB 1KXPA 4CD1A 2NZTA 4WFBL 3K5MA 1HQEA 4B9TA 4CBUA 4CE9A 3HOTA 3KWGA 4OJRA 5KI6A 2QWQA 4JHDA 2KZMA 1RT6A 2KTQA 3DMJA 1Q8IA 4B9UA 3C0BA 3WEEB 3QBWA 1NG9A 4EP4A 3OJSA 1HX1A 2OTLN 1BI4B 4W5OA 4B1WB 2G8FA 4BDPA 1WBDA 4BRCA 3PSIA 4F4KA 2UUCK 3TSPA 1REVA 3IRXA 2P1JA 4CJEA 3U9ZA 3QFPA 5AZIA 4F8RA 3MN6A 3THXB 3AY9A 4DSJA 3FZHA 1N32K 4KH6A 3TAGA 2FBVA 3IFRA 1J6ZA 4CF8A 5GAGP 3KHYA 3VQ5A 3T69A 3V9ZA 4DQIA 2F8SA 3SK3A 1HYSA 1KCFA 4CF0A 3LDSA 4DV5K 4F2RA 3S41A 3IMXA 4FJLA 4CJ3A 2IDOA 4JKDA 3DLKA 5I9EB 4F3TA 3VN5A 5AQIA 5EXWA 2F9WA 3TTFA 4IJNA 1VSDA 4JKGA 3K9KA 3VGMA 2YNHA 4I9LA 4O44A 3SBTA 3RRGA 4HHTA 3SPZA 4FJXA 3AVLA 4JI4K 4B1ZA 1XNRK 1JLFA 5JS2A 3MXMA 2F4VK 4FWQA 2HHVA 3VQ8A 4K41A 4QOZB 4BRQA 4GNIA 3VA0A 3BGRA 2KHOA 4OLAA 3B6OA 2HHSA 3M5RA 1WLJA 2VQFK 1BIUA 4BRMA 3IDHA 3C6TA 3V9SA 4H0OA 4BY9C 3VEVA 2HVIA 3PSFA 5AQVA 1R59O 3AO4A 3OYJA 2D5RA 4X62K 2D4WA 1NOZA 2UUBK 5J2NA 4C8OA 1TKTA 3J81O 3KVGA 2FF6A 3CYMA 5EX5A 4W5NA 2P9UA 2PAVA 4LF4K 3VOVA 3I8DA 1A5VA 1HRHA 4MDBA 3WUHA 3RSEB 4IXCA 4FZZA 4I2QA 4CHYA 5BREA 4CGFA 1L3UA 3VEXA 1C1CA 3BF1A 1VK0A 1XWLA 4DQRA 2O8DA 4RW4A 5KRTA 2D1KA 1J5OA 1Q81O 1HLUA 4JHDB 3KZBA 5JICA 4EZ9A 1L5UA 4B1UB 1XC9A 5J2MA 1QHTA 4H5TA 4DR1K 2RPIA 4BG8A 2PBDA 3EN9A 1X3NA 4CEOA 4JK7A 3UKUB 1EP4A 5AQMA 1XC3A 4CZLA 1VSKA 2ZGYA 3NBPA 1XHZA 4Z4FA 1TAUA 1W2BM 3RVCA 1Y64A 3Q7CA 1K8KB 4DQSA 3TAEA 3E01A 2P9NA 3VEYA 1N8RO 5C25A 2QI2A 4PQUA 4ILJA 4CZHA 4O5FA 5JS1A 4MO5A 3O3HA 4DU3A 1EWRA 5CY4A 3TSUA 2HHXA 4BR7A 5HOOA 5F0XA 4FL9A 1Y97A 1ZBHA 4E7IA 5CZ2A 4CF9A 5FROA 3LP3A 2QWMA 2O4IA 3SQ4A 3CQYA 4FLYA 4FWMA 5JMVA 1QSYA 2JWKA 3VEZA 3BP8A 4CJLA 2HF4A 1DTQA 4IBNA 3CJCA 1NJYA 3OYIA 3SYZA 1Z25A 4JKGB 4G1QA 3J7YP 1NGIA 4DTUA 3TU5A 4QS7A 3TI0A 3ZT2A 3ZX3A 1WSJA 4AF1A 1I39A 2V7YA 4ELTA 3P38A 5HRNA 1C0TA 1QZ5A 1WBBA 4B1VA 4DR5K 1VSIA 4GV6A 2JLEA 2RF2A 3AVBA 4JKFA 2HHWA 2HB5A 1ATRA 1KLNA 1IKXA 1KAZA 3KKSA 2NRZA 5M1OA 5GADP 4FJ9A 3LM2A 2O8BA 1NGAA 4DWIA 4JRPA 2ZE2A 3AA5X 1UA1A 3C7NB 1IG8A 4IO8A 1QSLA 4DMNA 1FW6A 5I3UA 5AQZA 4FM1A 2P9UB 5AQUA 3EE8A 3GL1A 5HLFA 1K8AO 4DSLA 4B1XB 4UY8O 3VERA 2UXBK 1GOAA 2CH5A 3VESA 3ZX2A 4FM0A 4AHSA 3DXMA 4BREA 4JKHA 4OKJA 1HPZA 1NGBA 3NGIA 1K9MO 4B3RK 4N56A 4IJAA 4CFDA 2NLXA 5B8HA 4E3SA 2O8DB 4DFMA 4BR0A 2UU9K 3HRGA 3OYKA 2BANA 4RW7A 5AQPA 5AQKA 3KLEA 3NCIA 4GKKK 2QA4N 1LWEA 2VWKA 3SMPA 4JAXA 1J5EK 1ILYA 2OPPA 1W7AA 4IFVA 4KHUA 1YVNA 4H5RA 5FPMA 3WQTA 2QWPA 5AQXA 3OYFA 1T8EA 3DI6A 1HNWK 4N41A 3HK2A 5AZJA 4DLEA 2P9NB 3H3OB 4DB3A 4CGIA 2IC3A 1ESVA 4L3QA 2P51A 2J4RA 4FJ7A 1U2VB 4GV9A 2NRRA 2A41A 1QQNA 1S5JA 4Y1CA 4E7LA 1QVFM 1XHXA 1HQUA 1V4TA 3DRSA 3MEDA 2PYJA 4KTQA 3G25A 4A61A 4IOCL 3ZEUB 2HF3A 1MWMA 1T3VA 3E9LA 2OPQA 3QO9A 1KTQA 4DTXA 1NNEA 3UKRB 3H1VX 3V9WA 4I9QA 4LF6K 2E5LK 2E6LA 2IVNA 4BE1A 1ZBFA 4LF7K 4XEIA 2AJQA 3EO3A 4FJKA 4PKIA 3LALA 4DUZK 1FKPA 3THVA 4E1JA 3W0LA 4FOEA 1LOTB 3ZSZA 2P9SA 2QKBA 1Q82O 4MQ3A 1E4GT 3SMSA 2O8BB 1IKVA 1JXEA 4MDAA 3DLBA 3CD6N 1C1AA 3SCXA 2KW4A 1NK6A 3VGLA 3AGRA 4KHNA 3CCMN 2IVOA 4E7HA 4BRLA 3OA9A 2VWJA 4WFNL 1RTIA 2YHXA 4Y0WA 2KLAA 2GX9A 4NYFA 4DQQA 3LAKA 2G8HA 4J2BA 3ZSWA 2X74A 3D2FA 4Z4HA 4DV6K 2I5JA 1K73O 3QIPA 4B8CA 1SUQA 2HHUA 4LY7A 3ITHA 3VQPA 4CHZA 3V4IA 3O4NA 2W42A 1D4XA 1WAJA 1OVQA 4E1NA 1KVBA 4CEEA 5GAEP 2D0BA 3QNNA 3F9KA 2LSNA 3WNFA 3O6WA 2F96A 1S6PA 3I0RA 3AVJA 2RKIA 1NK0A 3AO1A 3VQ4A 1EXQA 3FR0A 1Q86O 4CJFA 3VA3A 1U4BA 3J7ZO 4PL7A 2W6KA 4IO9L 5CR4A 2DFFA 5AZJB 3CC7N 4AHVA 3THXA 2BTFA 3D2EB 4R79A 4NXNK 1NU0A 3E9OA 4M3WA 2Q97A 3I56N 5KPZA 3QEWA 1ZXOA 4ELVA 4FZYA 2A42A 4GMJB 3ZT4A 3O3GA 2Z1JA 1WNSA 4CFBA 4AH9A 3S3MA 1RFQA 3M8RA 3F2KA 1S9EA 4FJJA 2GBZA 5HRRA 4BGAA 1VQON 5IT9O 3RTVA 2FSNA 1J53A 1JLBA 3AVFA 3A2FA 1WOQA 3ULEB 3JAMO 5KRSA 1IV0A 5LJWA 4XH1A 3OYMA 1TKDA 1NGGA 1QVGM 3HPGA 3LAMA 4CHPA 3NDKA 1C0MA 2QK9A 4C8MA 4KREA 3HPHA 3IG1A 4WQ5C 2NRTA 1LW0A 4NXMK 3BY5A 3CMAN 1NM1A 1NMNA 4CJVA 4BQLA 3EZWA 2YX6A 3G6EN 3TSQA 1OH8A 4YOXA 3KKRA 1MDUB 4CJQA 3MN9A 4JK9A 3VETA 3ULDA 4CESA 1HYZA 4C8LA 4F2SA 3VQ6A 3OTOK 2P9SB 3ZT1A 3LPTA 3G71N 3OS1A 4LFBK 3OYHA 3ZSRA 1N33K 2EX3A 3CM6A 4IOAL 1S1UA 2OZSA 1C1BA 1YUWA 2XY7A 2NUBA 3CC2N 4H5VA 3KK2A 3ZETB 4ID1A 4GVEA 3VQQA 1BQNA 2HSTA 4DG1A 3PX0A 3QICA 1EETA 2B4JA 3A5NC 1DEJA 4FVMA 3T1YK 3SQ1A 3AAPA 4DSFA 4RW6A 4FK2A 4ZTJA 4B9MA 5K14A 3VF6A 3CCQN 1RBTA 4BC5A 2QWOA 1RT7A 1P8ZA 2PY5A 3KIOA 3VENA 5CE3A 3RRHA 3E9PA 4DV0K 3DYAA 3CERA 1RT4A 3GOIA 2H3GX 4K8ZA 2B5JA 1C0UA 2HHTA 4HCBA 4LC9B 3HO1A 1NOYA 5LY3A 3O80A 2NRHA 2WBNA 5BR8K 3ALYA 2WFBA 3UKUA 4OKKA 4HUEA 2P9LB 3T3FA 1K8KA 5E84A 4X64K 3RMAA 4DU4A 5KGXA 2XY6A 5C10A 1JKHA 1O1WA 3DLHA 5J2PA 2DTUA 3AVKA 5DM6L 1CZBA 1HPMA 3OJUA 2QW9A 3LDLA 1TKZA 2WTUA 4M3YA 4WQ5A 5DK5A 1V4SA 2FXUA 3O1WA 4CJUA 4K42A 4KRFA 2V7ZA 4Z4IA 2DFHA 3NHGA 3P83D 1KLMA 3A8YA 1QHAA 3QBXA 3UE5A 4OPJA 5BRDA 4FVUA 5C2FA 4OGEA 4X66K 4HCCA 3VQAA 2A6AA 3M6GA 4CEZA 3ASMA 1TUYA 1TK8A 4KI4A 3BUZB 1JJ2M 3M3ZA 3TABA 3CFRA 1G99A 1SAZA 2UYTA 1VRTA 4WF9L 4RTFD 5GINA 1U49A 5AQRA 4BDYA 4DTMA 4M3ZA 4I2PA 4OX9K 4QAGA 2DPNA 4CZEA 4CGJA 5T7BA 5AQLA 3U8XA 3LZIA 4DV4K 2ZGZA 1W0HA 4BRNA 1VQLN 3OBYA 3NVMA 4DKWA 1DLOA 4BRGA 2ZWHA 1M1KO 1VQ6N 2EWSA 5AQQA 2YHYA 4BR5A 4F9OA 2CH6A 3SAFA 1QSSA 1JCEA 1RDUA 3C7NA 1NWKA 4H03B 1JLQA 1WSEA 3CJ1A 1RBUA 4CJ7A 1U45A 2YNIA 3L2UA 1I3AA 3C6UA 1GLBG 3MX2A 1N5YA 1OKJA 1HR0K 4IWVA 3AVGA 2FLOA 3DRRA 1JLCA 4IDKA 3L2VA 3HI0A 3NH0A 2G8KA 1OVYA 3WT0A 3FLCO 1T6CA 4CK2A 5SZTA 4W5TA 4FXDA 3LP2A 5AQHA 4KB0A 1BA0A 1LAVA 1LV5A 2IVPA 4CJ4A 2XHBA 4FWOA 1UOCA 3I33A 3KD1E 5AQTA 1FK9A 3BDPA 4JI6K 3IAYA 4FJGA 3DWLA 1RT5A 4IKFA 2XRIA 3K59A 4DLGA 3KK1A 2JGUA 3FFIA 4M45A 2HNZA 4CEQA 4U67L 5HL7L 3LWMA 1D9DA 4LD0A 4DS4A 4OLBA 3PLAA 1RDAA 1NK4A 2HBMA 3QB0A 1CZ9A 2DFEA 2OCEA 1TK5A 4DV3K 3DXKB 4IG3A 2V52B 3U3YA 2G8WA 3AO3A 3VTHA 5BPNA 4NO7A 1U2VA 2ZM6K 3SV3A 3S3OA 3UIQA 3OYCA 4DFJA 4CI6A 3R3LA 3ZSYA 1NGHA 3IKMA 4BR9A 5F1XA 3H45C 2E20A 2I7PA 1MWKA 4WQ4C 1YJWN 1ASWA 2Q0RA 1WAFA 3OYDA 3V1OA 3ZEUA 1HNZK 1YI2N 3GDQA 3L0QA 4J8FA 4DSKA 2YNGA 3NF6A 3ENBA 4GVMA 1E4FT 1FJGK 3UKRA 3KK3A 4Z4GA 1XMOK 3SAGA 1TL1A 4JS5A 2QWNA 2HBKA 2V51B 1DTTA 1NK8A 3HZ6A 3CETA 4CK3A 2B6AA 3CC4N 3O9SA 1D8YA 2ZJPL 1VQPN 2HNYA 3V9UA 4NLBA 1LAWA 3HVRA 3CCSN 4A59A 5TKWA 4OPHA 1ZBIA 4BRHA 3SUNA 2OPSA 1KFDA 3R1XA 1O13A 5ADXH 2IIRA 1WSHA 3SUPA 4NCBA 1CXQA 4K0KK 3ID8A 2CGLA 4ISFA 4I6MB 3VGKA 3QIOA 1HKCA 2Y1IA 2OZMA 3CCJN 2JWLA 3V9XA 3SUQA 2GELA 5AQNA 3MN5A 2PZSA 4DR4K 1N34K 4IEIA 1VQMN 2WUSA 3VEWA 1C0FA 2FBXA 1VAZA 1D9FA 4EZ6A 4QCLA 2HVHA 3QMLA 5ELZA 3NH1A 4B8AB 3K5OA 4AHRA 4BVPA 3TARA 2YKMA 4KHYA 2VWBA 3CIPA 2QWLA 1X9SA 1BQMA 4CBWA 5KQ8A 4C8KA 2YNFA 1BGXT 2ZJRL 1XUPO 1JLAA 1QQMA 4TSXA 3ZLJA 3J7AP 2A1SA 2QXLA 3GBTA 1VHXA 3JYTA 1Q18A 3NF8A 1MU2A 3M8QA 3AO5A 3T7ZA 3ZX0A 5M1QA 5FPEA 1U04A 3E66A 1ATNA 2QWRA 4DTPA 3AAQA 4LF8K 4YFUA 4CF2A 2QKKA 4BRFA 5HBMA 4M3TA 3D0PA 1HUXA 1KSPA 3LDNA 4LF5K 3NFAA 5M1KA 3HJFA 3O5BA 4KHWA 4IG0A 5LMUK 3C94A 2E4LA 3QEXA 1CZAN 2ITMA 2G8VA 3GG4A 2ZF5O 5FPNA 3ZSVA 1ZYQA 5AQGA 4FJHA 3LDOA 3PO4A 4MFBA 5C42A 4FPAA 3D2EA 2YV0X 5C2DA 1KFSA 5BR9A 2Z1GA 1SL1A 4YDUC 1GOCA 4WCEL 3CFOA 4CZGA 4FPBA 5D3GA 2VG6A 1A5WA 1JCGA 4CIFA 1A5XA 1WSFA 5J1EA 5E41A 3CJ7A 2CGJA 2G8UA 4N47A 1RTHA 2RE2A 2X6SA 4M7YA 1EQYA 1BISA 1FXXA 1RDDA 1NK5A 3DOLA 2OTJN 3WXJA 3VPZA 2GV9A 4CFCA 5C0YA 4FLXA 1ATSA 2HHHK 3ULEA 2E2QA 3LDQA 1R0AA 1TYQB 4C1NI 5KTQA 1K6YA 4FM2A 2HHQA 4FOIA 1B9FA 4E0DA 3K58A 3P1GA 4WE1A 3VMFB 1MA9B 2NRXA 2HBLA 2YCHA 4Q5VA 2KZZA 4FWPA 4FJIA 1NK7A 4IDHA 3EKSA 4IFEA 4JD2B 1M90O 3H1QA 2Q36A 3A5LC 1VSFA 4FCYA 2O8CA 2O8EB 3K5LA 4JI8K 1GLFO 3RR7A 4B3OA 2UXCK 4NLCA 4H8KA 1W9HA 1RDCA 1BL3A 3JS6A 3J80O 3RWUA 3SNNA 1GLJO 4H4MA 2XY8A 3KLIA 2A40A 3QERA 3C6HA 3MN7A 1GOBA 3EYZA 2QM1A 1GLCG 1Z6RA 2YKNA 3DLRA 5KPRA 2I7NA 1ZC6A 1QZ6A 1RT2A 2P9PA 4XH5A 2D0PA 2GWKA 2X6NA 3ZETA 4YOUA 1NLVA 3BEXA 3KK7A 3AVMA 3ZSOA 4QS8A 5AQJA 3CFPA 3CF5L 4HWIA 1S22A 4BWJA 4DV1K 4BE2A 5JVGL 1VQKN 4DR2K 4H0PA 1NGJA 4YY3K 4WFAL 3WXMB 1NGEA 3NAEA 4B3TK 4J2AA 3OVNA 1BCOA 2KKZA 3MXJA 4OPAA 4E89A 1S9GA 1S1VA 4KTWA 1NGCA 3J8AA 4L8RB 4YDUA 4B9SA 2QEXN 4AM7A 4K43A 4ZHRA 3NGYA 3THYA 1S1WA 1JLEA 2W41A 3I8BA 4DS5A 3AA2A 1UA0A 5LL6Z 1P90A 2XO7A 4MLEA 3MEEA 4DTRA 3MMVA 2P9LA 1SL0A 3OYBA 4AHCA 4JV5K 1T03A 2OA8A 3EEQA 4MLHA 4CGHA 4Z4CA 1VQ8N 1SZ2A 4NYNA 1RDBA 4CHOA 3OHRA 1HNXK 5KGWA 3SJJA 3KWIA 4BRIA 1WUAA 3HP6A 4JLHA 3VEOA 4BGBA 1B92A 3O08A 2XY5A 3ATVA 5AQWA 4KTZA 4DSIA 3BZCA 2P9IB 1KQSM 3FE1A 3DLEA 5KPTA 4IEEA 3CI5A 4CBXA 5FDLA 3G10A 4CZKA 3CCLN 4DQ8A 1WB9A 3HOSA 1YJ9N 4DU1A 1S1TA 3CQ8A 1Q9YA 4LSLA 1HNIA 2D0OA 1BCMA 5F2RA 3RMCA 2IOCA 4JKBA 4FSVA 4BQZA 2YHAA 4FWSA 4O4GA 1I94K 4CIGA 1VQNN 2YHWA 3FZFA 4RG8A 3CJAA 3AO2A 1S1XA 4C8NA 3QESA 2O8CB 5JLFA 4LH4A 4FYDA 4CZMA 1RTDA 2A3ZA 5KQDA 3WNGA 4CJKA 3F73A 3SI6A 1SQKA 3HM9A 5HRSA 1BA1A 3DAWA 1GLEG 4U7BA 3L2RA 3SLCA 5ADXA 2GUPA 4FW2A 1HYVA 4HTUA 3QLHA 4CF1A 4PUOA 1B9DA 3MCPA 3L2QA 4FLZA 3MX5A 1ZBLA 1XI1A 3QINA 4NB4A 4KV8A 4FJMA 3LL3A 2Q1NA 2ASMA 2P9PB 1G15A 4HUGA 3A5MC 4JKEA 4CGGA 2VGNA 3E1YA 4A62A 2AP1A 4CECA 4XH4A 1Q7YO 4CGDA 4KHQA 1WN7A 4ELUA 1UAXA 4AHUA 3R8EA 1KD1O 3H46O 4BWMA 4O8UA 4R5PA 3O9RA 4KB1A 3D6RA 4J2DA 2KQ2A 3HL8A 2P5GA 3THWA 5LJVA 1KC8O 4BC4A 1KVAA 1VRUA 4JK8A 4KAZA 3PIPL 3KTQA 1YF5L 1GLDG 1L3TA 3HP9A 3THYB 4CHQA 3CCVN 2P9KA 2UXDK 1ITGA 2HNDA 3TR8A 3SZ2A 2VG5A 2YI1A 3VF2A 3VQDA 2ASPA 3NH2A 1VSLA 5EU7A 4JI0K 3R6MA 4OPKA 4JN4A 4F3OA 1JL1A 1X9JA 2KFZA 3WNHA 1BG3A 3PY8A 1IBKK 3DXKA 3EZ5A 3WXIA 4FLWA 1QE1A 4JI1K 2ATQA 4HTLA 1H1VA 3OY9A 4Z0UA 2G8IA 1DKGD 5J2QA 4E7KA 3CQXA 3HYFA 5I42A 3O4QA 3DLLL 1IKYA 4KBOA 3NF7A 1SKRA 3OYLA 2ITGA 5M1PA 5HROA 2Q31A 4DTSA 1U48A 3D7EO 4JNEA 1LCUA 4BG9A 2ETJA 2FBTA 3L2WA 2IGIA 4X65K 1HNVA 5FLXO 3G0ZA 3RMBA 4GY2B 2O8FB 1TAQA 4RWTA 2W40A 3FZMA 3TANA 1IH7A 2CGKA 3OYEA 1IBLK 1RNHA 4FWNA 4C23A 2VYPA 5GIOA 2Q3SA 1XNQK 3NF9A 4CJWA 3RMDA 2Q0UA 4AILC 4A2BA 3MXIA 4Y1DA 2P5OA 2ZQBA 3L4QA 4I6MA 5AFUH 1LWFA 4AM6A 4BR4A 3K9JA 5TKYA 4NCGA 4GV3A 3O9UA 4FLUA 4ID5A 1YIJN 4DR6K 1N6QA 4BDZA 1YHQN 4W5RA 1LW2A 2FBYA 3CPEA 1C0GA 5C12A 2NNWA 2R7YA 1VSEA 4FLTA 3CCUN 5JLHA 3P5JA 4FJ8A 4H0TB 2DY4A 1JCFA 2E2NA 5CHIA 2A5XA 3CHWA 5M1FA 2RN2A 4PHTX 3N4PA 1Z26A 1EX4A 2OPRA 3N4QA 4CERA 5C15A 1RBRA 1JXBA 5DM7L 2E8AA 5BPLA 3LDPA 4CEAA 3U6FA 2BGGA 4J2EA 2FSJA 1NGDA 1IG9A 5BN8A 3THWB 1IJJA 1VSJA 4O0JA 1YTUA 2E2OA 4IFYA 1BDGA 3WXKA 1RCHA 3O9QA 4BC2A 3HT3A 4CJTA 1DGKN 5AQSA 1NKEA 2P9KB 3AGKA 1T05A 3QFUA 4O8KA 2Z1HA 3CMEN 4O55A 1L3SA 4OGCA 1ZBUA 3O9TA 4E1MA 4FO0A 1BU6O 5SWMA 2W6LA 1BOTO 3DOKA 1BUPA 4NCAA 5EY4A 1J9AA 3C65A 2F9TA 2Z1IA 4WYBA 5FPDA 1FKOA 1T44A 3LP0A 1WSGA 4A5AA 4BRPA 4FW1A 3M8PA 1L3VA 4M41A 5CYQA 3C6AA 4RCHA 3GE1A 5BRHA 4N76A 3P31A 4O5BA 4B3SK 3PIOL 2F8TA 2Q2RA 1NGFA 3AVIA 3U9DA 5AJ3K 3KLGA 4JYAK 3MK6A 2GTDA 2BH1A 2NRVA 5AZIB 2UUAK 1T6DA 1DT9A 4DR3K 4DF4A 1TYQA 2F7TA 3DRPA 4BVOA 2OANA 4LSNA 1KAXA 1HMVA 2VG7A 4GW6A 4KI6A 4M7XA 4B9VA 2YJEA 2FSKA 4E7JA 3VQ7A 3EL2A 3L4IA 4DFKA 3OW2M 4JD2A 4BRDA 3NMUA 2O8EA 1BHLA 5DMRA 4A5BA 3SQ2A 3ZSQA 3TTCA 1TUUA 1IBMK 4PY5A 1GLLO 2WOMA 2D0AA 3PX6A 4LFCK 4M3XA 2A1RA 1XMQK 3O3FA 3ZT0A 2Y1JA 4EHUA 2E88A 3QEIA 4G9ZA 4DR7K 4DV2K 2OYQA 1YXQA 4M3RA 3OS0A 3HTVA 3O8MA 4CD3A 4JI3K 4DTJA 2E2PA 3U4LA 5CZ1A 4M42A 1LWCA 4JS4A 3OYNA 1Z05A 4ISEA 4A57A 1VSMA 1QTMA 4CHNA 2X78A 1C6VA 1QS4A 4CJRA 3OS2A 4EIAA 4B1YB 3NE6A 4DSEA 3K5NA 5BRFA 2EHGA 4CW7B 1RILA 1WSIA 4BROA 3MAQA 3SAHA 2PFUA 1SKSA 4H5WA 3HPOA 2HBJA 4Z94A 3SBGA 2RHKA 3AA4A 4FWKA 3VF4A 3CCRN 4W5QA 4C1NK 5A2QO 2WONA 3B8AX 3CG7A 1ASUA 4YNQA 1HJOA 3WXLA 5C24A 1YJNN 2GEMA 4V19S 1VQ5N 4ILGB 4YOYA 2PYLA 4FWRA 3VTIA 3QDKA 4BR2A 4DTNA 4WQ4A 3BF3A 1GLAG 1BO5O 3HSCA 3V81A 3EKUA 3PV8A 3QETA 1RDWX 3ZT3A 3SQ0A 5AQOA 4YHHK 4M3UA 4YOWA 4B3MK 4FK4A 1W97L 3F9MA 3ID6A 4RW8A 1HJRA 3L8BA 1NK9A 4KO0A 5GAHP 1EWQA 3MDQA 1BIZA 4LFAK 4DF8A 4FK0A 4PKGA 3ZCMA 4ZTFA 1RT3A 1VQ9N 2VCPA 3H3NO 3LANA 4B9QA 3HVTA 1EKEA 4PWDA 2P9IA 3KJVA 2FF3B 3O1BA 4KH5A 1HKBA 3D45A 3JSMA 1RBVA 5LMNK 2ZD1A 3HBTA 3HM8A 4YOVA 3KLFA 3B6PA 4ILHA 1YAGA 3T19A 3MCAB 3OYAA 4BACA 2E1YA 5IWAK 3SPYA 4KHSA 3K0SA 5CYMA 4BC3A 4HVJA 1NKBA 3IUCA 4B08A 3WNEA 1KAYA 1ZBSA 4K25A 4B9NA 3NVKA 3TTDA 3DM2A 4CZIA 4HUFA 3KLHA 4FWLA 3FFKB 3FZKA 4JEPA 4CEDA 3MEGA 1VSHA 4FLVA 3M1FA 3F5TA 1TK0A 4FJ5A 1S72N 1X9MA 3G4SN 4CIEA 1TGOA 4BRAA 2HW3A 4EHTA 3AVCA 3CM5A 1ASVA 2NRWA 3LP1A 4JRQA 3ENHA 5AFUA 3QEVA 4KHPK 3PO5A 4YORA 1CXUA 1KRPA 3TAPA 1SKWA 4FJNA 1U47A 1NKCA 5BN9A 4BRKA 4LF9K 2E1ZA 5BPMA 2GWJA 3RR8A 3HSTB 1YTAA 4CK1A 2FC0A 4CCHA 3PX4A 3L3VA 4DHYA 1X1PA 2HMIA 5FRNA 3MWTA 4FZXC 4CEFA 3CPWM 4M63C 2QXFA 3DLGA 3H08A 1IO2A 3VQCA 3S3NA 3PUFA 1X9WA 4EFHA 5H1SQ 4CZFA 5EOYA 3L3UA 4YOTA 4JKCA 4O0IA 1U6ZA 3DXMB 1EO1A 4MO4A 3AVNA 5HRPA 3KD5E 5GIPA 3U3GA 4IOXA 4CFAA 3OBWA 1D5AA 4CJ5A 4GKJK 3P4IA 3DJCA 4QS9A 4XIUA 3MWPA 4OVLA 1S3XA 1YT3A 4K8XA 4Q0BA 3JXUA 4IZ9A 3HXMA 1SL2A 1N36K 4LH5A 1UWBA 1F21A 3ZYYX 2VGMA 1QQOA 3AA3A 3AARA 4CEBA 4Z4EA 2HOEA 5E26A 3LWLA 3SV4A 1NJZA 4B9LA 3WEEA 5M1NA 4OKEA 2D0CA 2IAJA 4CVNE 1VQ4N 4BE0A 3T1AA 3MECA 3I55N 1BI4A 4DFPA 3V6DA 5MLCQ 4DQPA 3V1QA 1YITN 4EP5A 3OYGA 4DV7K 4JI5K 5AQFA 4PA1A 1JL2A 3ATUA 3H6EA 4JKAA 1NBWA 3TAFA 2VQEK 1IKWA 3K2PA 3VQ9A 3CXCM 3T1HK 1XQSC 2ZJQL 2HMPA 4H5NA 5EVZA 5AQYA 4H0VB 1QQCA 3AVAA 3O4WA 4H0XB 1S6QA 3UB5A 3ZSXA 2YJFA 1Q9XA 1TKXA 2O8FA 1NJWA 1HKGA 2YHBA 3P39A 1RT1A 1OH6A 3LPUA 3CCEN 4CJSA 1BWFO 2WC9A 4DCHA 3Q7BA 1TV6A 3EY1A 4EAHD 3W3DA 4CZJA 1YVUA 3K57A 3TPQA 3TWHA 3A0IX 2GUIA 4OO1J 4E19A 2AA4A 2QTDA 4KPYA 4DUYK 1J54A 3S9HA 1RTJA 1SS6A 4RW9A 3V1RA 4UQGA 4KFBA 4H0YB 1JLGA 1NJXA 4JI2K
chains in the Genus database with same CATH topology
3ENOA 3K9JA 3ID8A 5TKYA 2CGLA 4GV3A 3O9UA 4ISFA 4I6MB 3W0LA 3VGKA 1HKCA 4FOEA 3CCJN 2JWLA 1LOTB 2GELA 5AQNA 1YIJN 3MN5A 2P9SA 2BUPA 4IEIA 1YHQN 3L6QA 1Q82O 3CPEA 2WUSA 1C0GA 3FZLA 3CJBA 2NNWA 5C12A 3OW2M 3VEWA 1E4GT 1NJIO 3SMSA 1C0FA 1VAZA 3QMLA 1RGIA 1VQ7N 5ELZA 4PL8A 4MDAA 3CCUN 5JLHA 3CD6N 4KH4A 4H0TB 4A2AA 1JCFA 2E2NA 3VGLA 3AGRA 4BVPA 5CHIA 2A5XA 3CHWA 3WQUA 5M1FA 4PHTX 3N4PA 3CCMN 4PKHA 2IVOA 3N4QA 2VWBA 3FGUA 5C15A 4BRLA 3CIPA 5DM7L 2E8AA 2QWLA 3OA9A 5KQ8A 4CBWA 5JVHL 5BPLA 2ZJRL 1XUPO 4WFNL 1QQMA 3LDPA 2YHXA 2QXLA 3GBTA 3RSEA 4Y0WA 2FSJA 1NGDA 1Q18A 3CJ9A 2KLAA 2GX9A 1X3MA 5BN8A 4ISGA 1IJJA 3R9PA 3T7ZA 5M1QA 3ZX0A 2ASOA 3D2FA 5FPEA 2E2OA 3LM9A 3EE9A 1K73O 1NMDA 5AR0A 3E66A 1ATNA 2QWRA 1BDGA 3AAQA 3SJHA 3A5OC 3WXKA 3D2FB 3O9QA 4BC2A 1KXPA 4CD1A 1DGKN 2NZTA 5AQSA 4BRFA 4WFBL 4CBUA 1D4XA 2P9KB 1HUXA 3AGKA 3HOTA 3KWGA 3QFUA 3LDNA 4O8KA 3CMEN 2QWQA 5M1KA 4JHDA 3O5BA 3O9TA 5GAEP 4FO0A 1BU6O 1BOTO 1CZAN 2ITMA 3C0BA 3GG4A 2ZF5O 1BUPA 3O6WA 5EY4A 3QBWA 3WEEB 3C65A 5FPNA 2F9TA 1HX1A 2OTLN 4WYBA 5FPDA 1T44A 5AQGA 3FR0A 1Q86O 3LDOA 4A5AA 4B1WB 4BRPA 4FPAA 4PL7A 3J7ZO 4BRCA 3D2EA 5CR4A 4IO9L 5AZJB 5C2DA 3CC7N 3TSPA 5BR9A 3C6AA 4RCHA 3GE1A 4YDUC 5BRHA 4WCEL 2BTFA 4CZGA 3P31A 3D2EB 4FPBA 4R79A 3U9ZA 3PIOL 3QFPA 3E9OA 5AZIA 1JCGA 1NGFA 2Q2RA 2Q97A 3MN6A 3AY9A 3U9DA 3CJ7A 2CGJA 5KPZA 3I56N 1ZXOA 2RE2A 3FZHA 3MK6A 4M7YA 2GTDA 2BH1A 2A42A 1EQYA 4KH6A 2NRVA 5AZIB 3IFRA 1T6DA 1DT9A 1J6ZA 2OTJN 5GAGP 3WXJA 3KHYA 1RFQA 3VPZA 3T69A 3F2KA 1TYQA 2F7TA 3SK3A 4BGAA 5C0YA 4BVOA 1ATSA 2OANA 1VQON 3ULEA 2E2QA 3LDQA 1TYQB 2FSNA 1KAXA 4C1NI 3S41A 3IMXA 4JKDA 1WOQA 4M7XA 3ULEB 5I9EB 4FOIA 2YJEA 5LJWA 4XH1A 2FSKA 5AQIA 5EXWA 1NGGA 3EL2A 3L4IA 3VMFB 4JD2A 1MA9B 2F9WA 2NRXA 3TTFA 2HBLA 4IJNA 2YCHA 4BRDA 3NMUA 1QVGM 4FWPA 4IDHA 4A5BA 3EKSA 4IFEA 4JD2B 4JKGA 3TTCA 3K9KA 1TUUA 3H1QA 1M90O 2Q36A 1GLLO 3A5LC 3VGMA 4WQ5C 2NRTA 3SBTA 1GLFO 4B1ZA 3CMAN 1NM1A 4NLCA 4FWQA 4EHUA 2E88A 4G9ZA 4BQLA 4K41A 4BRQA 3EZWA 4GNIA 2KHOA 2YX6A 3JS6A 3G6EN 1GLJO 3TSQA 4YOXA 1MDUB 3MN9A 1YXQA 4JK9A 3VETA 2A40A 3M5RA 3C6HA 3MN7A 3HTVA 2QM1A 1GLCG 3O8MA 1Z6RA 4CD3A 2P9SB 4BRMA 2E2PA 3U4LA 3G71N 3IDHA 2I7NA 5KPRA 1ZC6A 4H0OA 4BY9C 3VEVA 1QZ6A 2P9PA 1Z05A 2D0PA 4ISEA 4XH5A 2GWKA 4A57A 3ZETA 5AQVA 1R59O 4YOUA 4IOAL 2D4WA 1NLVA 1YUWA 3BEXA 3KK7A 4B1YB 4EIAA 3CC2N 4H5VA 3ZETB 4QS8A 5AQJA 5BRFA 4GVEA 3CF5L 2HSTA 3KVGA 2FF6A 4BROA 4HWIA 1S22A 5EX5A 2P9UA 2PAVA 3QICA 3SAHA 5JVGL 1VQKN 2PFUA 4H0PA 1NGJA 3VOVA 3A5NC 4H5WA 4WFAL 4MDBA 1DEJA 3WXMB 2HBJA 4Z94A 3SBGA 1NGEA 3WUHA 3RSEB 4IXCA 2RHKA 3AAPA 2KKZA 4FWKA 3VF4A 3CCRN 4OPAA 4C1NK 3B8AX 1HJOA 3VF6A 3CCQN 4BC5A 2QWOA 1NGCA 3J8AA 3WXLA 5BREA 1YJNN 1P8ZA 2GEMA 3VEXA 3VENA 5CE3A 4ILGB 4YDUA 1VQ5N 3E9PA 3BF1A 3CERA 4YOYA 2QEXN 4AM7A 4FWRA 3VTIA 3QDKA 4K43A 4BR2A 3GOIA 2H3GX 4WQ4A 3BF3A 2D1KA 1Q81O 1GLAG 2W41A 1HLUA 1BO5O 3I8BA 3HSCA 3KZBA 4JHDB 5JICA 3EKUA 4B1UB 1RDWX 5AQOA 1P90A 4LC9B 4YOWA 1W97L 4MLEA 5LY3A 3O80A 3F9MA 4H5TA 2NRHA 3ID6A 3MMVA 2WBNA 2P9LA 5GAHP 2WFBA 3UKUA 4BG8A 2PBDA 3EN9A 4MLHA 1X3NA 3MDQA 2P9LB 4JK7A 3UKUB 4PKGA 5AQMA 1K8KA 1XC3A 5E84A 1VQ8N 1VQ9N 2VCPA 1SZ2A 4CZLA 2ZGYA 3H3NO 3OHRA 5C10A 4B9QA 1W2BM 3RVCA 1Y64A 3Q7CA 1K8KB 3KWIA 4BRIA 1WUAA 5DM6L 2P9NA 3VEYA 3VEOA 4BGBA 1HPMA 2QI2A 3O08A 1N8RO 2P9IA 2QW9A 3LDLA 4ILJA 2FF3B 4CZHA 4O5FA 3ATVA 3O1BA 1HKBA 4KH5A 4WQ5A 5AQWA 1V4SA 4MO5A 2FXUA 2P9IB 3HBTA 1KQSM 3FE1A 3TSUA 3HM8A 3O1WA 4BR7A 4IEEA 5F0XA 3CI5A 4CBXA 5KPTA 4K42A 5HOOA 2V7ZA 4YOVA 4FL9A 4CZKA 3A8YA 4ILHA 3CCLN 1YAGA 1QHAA 3QBXA 3UE5A 4DQ8A 3HOSA 5BRDA 1YJ9N 3MCAB 4FVUA 5C2FA 2E1YA 2A6AA 3M6GA 2QWMA 2D0OA 5F2RA 1TUYA 3CQYA 4FWMA 5JMVA 3BUZB 4BC3A 4JKBA 1JJ2M 4FSVA 3M3ZA 4BQZA 3IUCA 2JWKA 1G99A 1SAZA 3BP8A 1KAYA 4FWSA 1ZBSA 4K25A 3VEZA 3NVKA 2HF4A 2UYTA 1VQNN 3TTDA 4WF9L 4RTFD 4CZIA 5GINA 3CJCA 2YHWA 3FZFA 4FWLA 3FFKB 3FZKA 3CJAA 4JEPA 5AQRA 4JKGB 1NGIA 3M1FA 3F5TA 5JLFA 3TU5A 4QS7A 2DPNA 4CZMA 3ZX3A 2A3ZA 5KQDA 4CZEA 4AF1A 2V7YA 3P38A 5AQLA 1SQKA 3U8XA 1QZ5A 1BA1A 2ZGZA 3DAWA 1S72N 4B1VA 4GV6A 1GLEG 4BRNA 3G4SN 4BRAA 4U7BA 1VQLN 4EHTA 3OBYA 3NVMA 4JKFA 4DKWA 3SLCA 5ADXA 4BRGA 2GUPA 2NRWA 3ENHA 5AFUA 1ATRA 2ZWHA 1KAZA 1M1KO 1VQ6N 2NRZA 4YORA 3MCPA 2EWSA 5AQQA 2YHYA 3MX5A 4BR5A 4F9OA 2CH6A 4NB4A 5M1OA 5GADP 3LM2A 3LL3A 5BN9A 2Q1NA 3SAFA 4BRKA 2ASMA 2P9PB 2E1ZA 1JCEA 2GWJA 5BPMA 3A5MC 1RDUA 3C7NA 4JKEA 2VGNA 3E1YA 4A62A 1NGAA 1NWKA 4H03B 2AP1A 3CJ1A 4XH4A 4DHYA 3C7NB 1Q7YO 1IG8A 4IO8A 4CJ7A 3MWTA 1GLBG 3MX2A 3CPWM 5AQZA 4M63C 2P9UB 5AQUA 1OKJA 3R8EA 3EE8A 3GL1A 1KD1O 1K8AO 3H46O 4IWVA 2FLOA 4O8UA 4B1XB 3HI0A 4UY8O 3VERA 3O9RA 4EFHA 1OVYA 2CH5A 3VESA 3WT0A 3ZX2A 5H1SQ 3FLCO 3D6RA 1T6CA 4CZFA 5EOYA 3DXMA 4BREA 5AQHA 1BA0A 4YOTA 4JKCA 1U6ZA 4JKHA 1K9MO 5LJVA 1NGBA 1KC8O 3DXMB 1EO1A 4MO4A 4BC4A 4IJAA 2IVPA 4FWOA 4JK8A 5GIPA 4IOXA 3PIPL 3I33A 1YF5L 2NLXA 1GLDG 3OBWA 5B8HA 5AQTA 3P4IA 3DJCA 4QS9A 4BR0A 3CCVN 3HRGA 3MWPA 1S3XA 3DWLA 2P9KA 3JXUA 4IZ9A 5AQPA 5AQKA 1VQMN 2YI1A 3VF2A 2ASPA 2QA4N 3ZYYX 2VGMA 1QQOA 3AARA 3SMPA 2HOEA 4JAXA 5E26A 3R6MA 4JN4A 4U67L 1ILYA 1X9JA 3WEEA 5M1NA 5HL7L 1BG3A 1VQ4N 3PLAA 3DXKA 3I55N 2HBMA 3QB0A 1YVNA 4H5RA 5MLCQ 5FPMA 3WQTA 3WXIA 1YITN 2QWPA 5AQXA 3DXKB 4HTLA 1H1VA 5AZJA 5AQFA 1DKGD 3ATUA 3H6EA 3CQXA 2V52B 2P9NB 3H3OB 4JKAA 1NBWA 3VTHA 5BPNA 4NO7A 1U2VA 3DLLL 4DB3A 3CXCM 4KBOA 1ESVA 1XQSC 2ZJQL 2HMPA 4H5NA 4L3QA 4CI6A 2J4RA 3R3LA 5EVZA 5M1PA 1U2VB 5AQYA 4GV9A 1NGHA 2NRRA 2Q31A 2A41A 3IKMA 4H0VB 4BR9A 1QQNA 5F1XA 3H45C 3O4WA 3D7EO 4JNEA 2E20A 4H0XB 3UB5A 1LCUA 2I7PA 1MWKA 4WQ4C 4BG9A 1QVFM 2YJFA 1YJWN 2Q0RA 3ZEUA 1V4TA 1YI2N 1HKGA 3GDQA 3G25A 4A61A 3P39A 4IOCL 3L0QA 4J8FA 3ZEUB 2HF3A 3CCEN 4GY2B 1MWMA 1T3VA 1BWFO 3E9LA 3ENBA 2WC9A 4DCHA 1E4FT 3UKRA 4RWTA 2W40A 3FZMA 3SAGA 2QWNA 2HBKA 3Q7BA 2V51B 2CGKA 4EAHD 3W3DA 3UKRB 4CZJA 4FWNA 4C23A 5GIOA 2VYPA 3HZ6A 3TPQA 3H1VX 3CETA 3CC4N 3O9SA 3A0IX 2ZJPL 1VQPN 4OO1J 4NLBA 2AA4A 2IVNA 2QTDA 3CCSN 4XEIA 4A59A 5TKWA 2Q0UA 4OPHA 1SS6A 4A2BA 3EO3A 4BRHA 4PKIA 3L4QA 3R1XA 4H0YB 1O13A 4I6MA 5ADXH 2IIRA 5AFUH 4AM6A 4BR4A 4E1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O9Q A;  3O9R A;  3O9U A;  3D6R A;  3F5T A;  3KWG A;  3OA9 A;  3P38 A;  3P31 A;  3O9S A;  3O9T A;  3M5R A;  2GX9 A;  3RVC A;  3KWI A;  4OPH A;  3EE9 A;  3EE8 A;  2RHK A;  3L4Q A;  3P39 A;  2KKZ A;  4OPA A; 
#chains in the Genus database with same CATH topology
 3ENO A;  3QNO A;  3C95 A;  1E3M A;  5HP1 A;  3TAM A;  2KFN A;  3AV9 A;  3SUO A;  1TVR A;  4JI7 K;  2BDP A;  2BUP A;  2BE2 A;  3L6Q A;  3TAQ A;  3FZL A;  1NJI O;  3CJB A;  3NGZ A;  3VQB A;  3QEP A;  3VQE A;  3I0S A;  4ICL A;  1CLQ A;  4AHT A;  1RGI A;  1VQ7 N;  4PL8 A;  1OH7 A;  1OH5 A;  4KH4 A;  1TL3 A;  4A2A A;  3ISN C;  3WQU A;  1T7P A;  4AQY K;  4PKH A;  4H4O A;  3FGU A;  2O4G A;  3IS9 A;  2E6M A;  3M8S A;  5JVH L;  4CJP A;  5FRM A;  3RSE A;  3CJ9 A;  1SV5 A;  3BZK A;  1X3M A;  4DTO A;  4ISG A;  1RBS A;  3AVH A;  3R9P A;  2ASO A;  3LZJ A;  3LM9 A;  3EE9 A;  4KKO A;  1NMD A;  5AR0 A;  4I7F A;  3SJH A;  4N5S A;  3A5O C;  1KVC A;  2IS3 A;  3D2F B;  1KXP A;  4CD1 A;  2NZT A;  4WFB L;  3K5M A;  1HQE A;  4B9T A;  4CBU A;  4CE9 A;  3HOT A;  3KWG A;  4OJR A;  5KI6 A;  2QWQ A;  4JHD A;  2KZM A;  1RT6 A;  2KTQ A;  3DMJ A;  1Q8I A;  4B9U A;  3C0B A;  3WEE B;  3QBW A;  1NG9 A;  4EP4 A;  3OJS A;  1HX1 A;  2OTL N;  1BI4 B;  4W5O A;  4B1W B;  2G8F A;  4BDP A;  1WBD A;  4BRC A;  3PSI A;  4F4K A;  2UUC K;  3TSP A;  1REV A;  3IRX A;  2P1J A;  4CJE A;  3U9Z A;  3QFP A;  5AZI A;  4F8R A;  3MN6 A;  3THX B;  3AY9 A;  4DSJ A;  3FZH A;  1N32 K;  4KH6 A;  3TAG A;  2FBV A;  3IFR A;  1J6Z A;  4CF8 A;  5GAG P;  3KHY A;  3VQ5 A;  3T69 A;  3V9Z A;  4DQI A;  2F8S A;  3SK3 A;  1HYS A;  1KCF A;  4CF0 A;  3LDS A;  4DV5 K;  4F2R A;  3S41 A;  3IMX A;  4FJL A;  4CJ3 A;  2IDO A;  4JKD A;  3DLK A;  5I9E B;  4F3T A;  3VN5 A;  5AQI A;  5EXW A;  2F9W A;  3TTF A;  4IJN A;  1VSD A;  4JKG A;  3K9K A;  3VGM A;  2YNH A;  4I9L A;  4O44 A;  3SBT A;  3RRG A;  4HHT A;  3SPZ A;  4FJX A;  3AVL A;  4JI4 K;  4B1Z A;  1XNR K;  1JLF A;  5JS2 A;  3MXM A;  2F4V K;  4FWQ A;  2HHV A;  3VQ8 A;  4K41 A;  4QOZ B;  4BRQ A;  4GNI A;  3VA0 A;  3BGR A;  2KHO A;  4OLA A;  3B6O A;  2HHS A;  3M5R A;  1WLJ A;  2VQF K;  1BIU A;  4BRM A;  3IDH A;  3C6T A;  3V9S A;  4H0O A;  4BY9 C;  3VEV A;  2HVI A;  3PSF A;  5AQV A;  1R59 O;  3AO4 A;  3OYJ A;  2D5R A;  4X62 K;  2D4W A;  1NOZ A;  2UUB K;  5J2N A;  4C8O A;  1TKT A;  3J81 O;  3KVG A;  2FF6 A;  3CYM A;  5EX5 A;  4W5N A;  2P9U A;  2PAV A;  4LF4 K;  3VOV A;  3I8D A;  1A5V A;  1HRH A;  4MDB A;  3WUH A;  3RSE B;  4IXC A;  4FZZ A;  4I2Q A;  4CHY A;  5BRE A;  4CGF A;  1L3U A;  3VEX A;  1C1C A;  3BF1 A;  1VK0 A;  1XWL A;  4DQR A;  2O8D A;  4RW4 A;  5KRT A;  2D1K A;  1J5O A;  1Q81 O;  1HLU A;  4JHD B;  3KZB A;  5JIC A;  4EZ9 A;  1L5U A;  4B1U B;  1XC9 A;  5J2M A;  1QHT A;  4H5T A;  4DR1 K;  2RPI A;  4BG8 A;  2PBD A;  3EN9 A;  1X3N A;  4CEO A;  4JK7 A;  3UKU B;  1EP4 A;  5AQM A;  1XC3 A;  4CZL A;  1VSK A;  2ZGY A;  3NBP A;  1XHZ A;  4Z4F A;  1TAU A;  1W2B M;  3RVC A;  1Y64 A;  3Q7C A;  1K8K B;  4DQS A;  3TAE A;  3E01 A;  2P9N A;  3VEY A;  1N8R O;  5C25 A;  2QI2 A;  4PQU A;  4ILJ A;  4CZH A;  4O5F A;  5JS1 A;  4MO5 A;  3O3H A;  4DU3 A;  1EWR A;  5CY4 A;  3TSU A;  2HHX A;  4BR7 A;  5HOO A;  5F0X A;  4FL9 A;  1Y97 A;  1ZBH A;  4E7I A;  5CZ2 A;  4CF9 A;  5FRO A;  3LP3 A;  2QWM A;  2O4I A;  3SQ4 A;  3CQY A;  4FLY A;  4FWM A;  5JMV A;  1QSY A;  2JWK A;  3VEZ A;  3BP8 A;  4CJL A;  2HF4 A;  1DTQ A;  4IBN A;  3CJC A;  1NJY A;  3OYI A;  3SYZ A;  1Z25 A;  4JKG B;  4G1Q A;  3J7Y P;  1NGI A;  4DTU A;  3TU5 A;  4QS7 A;  3TI0 A;  3ZT2 A;  3ZX3 A;  1WSJ A;  4AF1 A;  1I39 A;  2V7Y A;  4ELT A;  3P38 A;  5HRN A;  1C0T A;  1QZ5 A;  1WBB A;  4B1V A;  4DR5 K;  1VSI A;  4GV6 A;  2JLE A;  2RF2 A;  3AVB A;  4JKF A;  2HHW A;  2HB5 A;  1ATR A;  1KLN A;  1IKX A;  1KAZ A;  3KKS A;  2NRZ A;  5M1O A;  5GAD P;  4FJ9 A;  3LM2 A;  2O8B A;  1NGA A;  4DWI A;  4JRP A;  2ZE2 A;  3AA5 X;  1UA1 A;  3C7N B;  1IG8 A;  4IO8 A;  1QSL A;  4DMN A;  1FW6 A;  5I3U A;  5AQZ A;  4FM1 A;  2P9U B;  5AQU A;  3EE8 A;  3GL1 A;  5HLF A;  1K8A O;  4DSL A;  4B1X B;  4UY8 O;  3VER A;  2UXB K;  1GOA A;  2CH5 A;  3VES A;  3ZX2 A;  4FM0 A;  4AHS A;  3DXM A;  4BRE A;  4JKH A;  4OKJ A;  1HPZ A;  1NGB A;  3NGI A;  1K9M O;  4B3R K;  4N56 A;  4IJA A;  4CFD A;  2NLX A;  5B8H A;  4E3S A;  2O8D B;  4DFM A;  4BR0 A;  2UU9 K;  3HRG A;  3OYK A;  2BAN A;  4RW7 A;  5AQP A;  5AQK A;  3KLE A;  3NCI A;  4GKK K;  2QA4 N;  1LWE A;  2VWK A;  3SMP A;  4JAX A;  1J5E K;  1ILY A;  2OPP A;  1W7A A;  4IFV A;  4KHU A;  1YVN A;  4H5R A;  5FPM A;  3WQT A;  2QWP A;  5AQX A;  3OYF A;  1T8E A;  3DI6 A;  1HNW K;  4N41 A;  3HK2 A;  5AZJ A;  4DLE A;  2P9N B;  3H3O B;  4DB3 A;  4CGI A;  2IC3 A;  1ESV A;  4L3Q A;  2P51 A;  2J4R A;  4FJ7 A;  1U2V B;  4GV9 A;  2NRR A;  2A41 A;  1QQN A;  1S5J A;  4Y1C A;  4E7L A;  1QVF M;  1XHX A;  1HQU A;  1V4T A;  3DRS A;  3MED A;  2PYJ A;  4KTQ A;  3G25 A;  4A61 A;  4IOC L;  3ZEU B;  2HF3 A;  1MWM A;  1T3V A;  3E9L A;  2OPQ A;  3QO9 A;  1KTQ A;  4DTX A;  1NNE A;  3UKR B;  3H1V X;  3V9W A;  4I9Q A;  4LF6 K;  2E5L K;  2E6L A;  2IVN A;  4BE1 A;  1ZBF A;  4LF7 K;  4XEI A;  2AJQ A;  3EO3 A;  4FJK A;  4PKI A;  3LAL A;  4DUZ K;  1FKP A;  3THV A;  4E1J A;  3W0L A;  4FOE A;  1LOT B;  3ZSZ A;  2P9S A;  2QKB A;  1Q82 O;  4MQ3 A;  1E4G T;  3SMS A;  2O8B B;  1IKV A;  1JXE A;  4MDA A;  3DLB A;  3CD6 N;  1C1A A;  3SCX A;  2KW4 A;  1NK6 A;  3VGL A;  3AGR A;  4KHN A;  3CCM N;  2IVO A;  4E7H A;  4BRL A;  3OA9 A;  2VWJ A;  4WFN L;  1RTI A;  2YHX A;  4Y0W A;  2KLA A;  2GX9 A;  4NYF A;  4DQQ A;  3LAK A;  2G8H A;  4J2B A;  3ZSW A;  2X74 A;  3D2F A;  4Z4H A;  4DV6 K;  2I5J A;  1K73 O;  3QIP A;  4B8C A;  1SUQ A;  2HHU A;  4LY7 A;  3ITH A;  3VQP A;  4CHZ A;  3V4I A;  3O4N A;  2W42 A;  1D4X A;  1WAJ A;  1OVQ A;  4E1N A;  1KVB A;  4CEE A;  5GAE P;  2D0B A;  3QNN A;  3F9K A;  2LSN A;  3WNF A;  3O6W A;  2F96 A;  1S6P A;  3I0R A;  3AVJ A;  2RKI A;  1NK0 A;  3AO1 A;  3VQ4 A;  1EXQ A;  3FR0 A;  1Q86 O;  4CJF A;  3VA3 A;  1U4B A;  3J7Z O;  4PL7 A;  2W6K A;  4IO9 L;  5CR4 A;  2DFF A;  5AZJ B;  3CC7 N;  4AHV A;  3THX A;  2BTF A;  3D2E B;  4R79 A;  4NXN K;  1NU0 A;  3E9O A;  4M3W A;  2Q97 A;  3I56 N;  5KPZ A;  3QEW A;  1ZXO A;  4ELV A;  4FZY A;  2A42 A;  4GMJ B;  3ZT4 A;  3O3G A;  2Z1J A;  1WNS A;  4CFB A;  4AH9 A;  3S3M A;  1RFQ A;  3M8R A;  3F2K A;  1S9E A;  4FJJ A;  2GBZ A;  5HRR A;  4BGA A;  1VQO N;  5IT9 O;  3RTV A;  2FSN A;  1J53 A;  1JLB A;  3AVF A;  3A2F A;  1WOQ A;  3ULE B;  3JAM O;  5KRS A;  1IV0 A;  5LJW A;  4XH1 A;  3OYM A;  1TKD A;  1NGG A;  1QVG M;  3HPG A;  3LAM A;  4CHP A;  3NDK A;  1C0M A;  2QK9 A;  4C8M A;  4KRE A;  3HPH A;  3IG1 A;  4WQ5 C;  2NRT A;  1LW0 A;  4NXM K;  3BY5 A;  3CMA N;  1NM1 A;  1NMN A;  4CJV A;  4BQL A;  3EZW A;  2YX6 A;  3G6E N;  3TSQ A;  1OH8 A;  4YOX A;  3KKR A;  1MDU B;  4CJQ A;  3MN9 A;  4JK9 A;  3VET A;  3ULD A;  4CES A;  1HYZ A;  4C8L A;  4F2S A;  3VQ6 A;  3OTO K;  2P9S B;  3ZT1 A;  3LPT A;  3G71 N;  3OS1 A;  4LFB K;  3OYH A;  3ZSR A;  1N33 K;  2EX3 A;  3CM6 A;  4IOA L;  1S1U A;  2OZS A;  1C1B A;  1YUW A;  2XY7 A;  2NUB A;  3CC2 N;  4H5V A;  3KK2 A;  3ZET B;  4ID1 A;  4GVE A;  3VQQ A;  1BQN A;  2HST A;  4DG1 A;  3PX0 A;  3QIC A;  1EET A;  2B4J A;  3A5N C;  1DEJ A;  4FVM A;  3T1Y K;  3SQ1 A;  3AAP A;  4DSF A;  4RW6 A;  4FK2 A;  4ZTJ A;  4B9M A;  5K14 A;  3VF6 A;  3CCQ N;  1RBT A;  4BC5 A;  2QWO A;  1RT7 A;  1P8Z A;  2PY5 A;  3KIO A;  3VEN A;  5CE3 A;  3RRH A;  3E9P A;  4DV0 K;  3DYA A;  3CER A;  1RT4 A;  3GOI A;  2H3G X;  4K8Z A;  2B5J A;  1C0U A;  2HHT A;  4HCB A;  4LC9 B;  3HO1 A;  1NOY A;  5LY3 A;  3O80 A;  2NRH A;  2WBN A;  5BR8 K;  3ALY A;  2WFB A;  3UKU A;  4OKK A;  4HUE A;  2P9L B;  3T3F A;  1K8K A;  5E84 A;  4X64 K;  3RMA A;  4DU4 A;  5KGX A;  2XY6 A;  5C10 A;  1JKH A;  1O1W A;  3DLH A;  5J2P A;  2DTU A;  3AVK A;  5DM6 L;  1CZB A;  1HPM A;  3OJU A;  2QW9 A;  3LDL A;  1TKZ A;  2WTU A;  4M3Y A;  4WQ5 A;  5DK5 A;  1V4S A;  2FXU A;  3O1W A;  4CJU A;  4K42 A;  4KRF A;  2V7Z A;  4Z4I A;  2DFH A;  3NHG A;  3P83 D;  1KLM A;  3A8Y A;  1QHA A;  3QBX A;  3UE5 A;  4OPJ A;  5BRD A;  4FVU A;  5C2F A;  4OGE A;  4X66 K;  4HCC A;  3VQA A;  2A6A A;  3M6G A;  4CEZ A;  3ASM A;  1TUY A;  1TK8 A;  4KI4 A;  3BUZ B;  1JJ2 M;  3M3Z A;  3TAB A;  3CFR A;  1G99 A;  1SAZ A;  2UYT A;  1VRT A;  4WF9 L;  4RTF D;  5GIN A;  1U49 A;  5AQR A;  4BDY A;  4DTM A;  4M3Z A;  4I2P A;  4OX9 K;  4QAG A;  2DPN A;  4CZE A;  4CGJ A;  5T7B A;  5AQL A;  3U8X A;  3LZI A;  4DV4 K;  2ZGZ A;  1W0H A;  4BRN A;  1VQL N;  3OBY A;  3NVM A;  4DKW A;  1DLO A;  4BRG A;  2ZWH A;  1M1K O;  1VQ6 N;  2EWS A;  5AQQ A;  2YHY A;  4BR5 A;  4F9O A;  2CH6 A;  3SAF A;  1QSS A;  1JCE A;  1RDU A;  3C7N A;  1NWK A;  4H03 B;  1JLQ A;  1WSE A;  3CJ1 A;  1RBU A;  4CJ7 A;  1U45 A;  2YNI A;  3L2U A;  1I3A A;  3C6U A;  1GLB G;  3MX2 A;  1N5Y A;  1OKJ A;  1HR0 K;  4IWV A;  3AVG A;  2FLO A;  3DRR A;  1JLC A;  4IDK A;  3L2V A;  3HI0 A;  3NH0 A;  2G8K A;  1OVY A;  3WT0 A;  3FLC O;  1T6C A;  4CK2 A;  5SZT A;  4W5T A;  4FXD A;  3LP2 A;  5AQH A;  4KB0 A;  1BA0 A;  1LAV A;  1LV5 A;  2IVP A;  4CJ4 A;  2XHB A;  4FWO A;  1UOC A;  3I33 A;  3KD1 E;  5AQT A;  1FK9 A;  3BDP A;  4JI6 K;  3IAY A;  4FJG A;  3DWL A;  1RT5 A;  4IKF A;  2XRI A;  3K59 A;  4DLG A;  3KK1 A;  2JGU A;  3FFI A;  4M45 A;  2HNZ A;  4CEQ A;  4U67 L;  5HL7 L;  3LWM A;  1D9D A;  4LD0 A;  4DS4 A;  4OLB A;  3PLA A;  1RDA A;  1NK4 A;  2HBM A;  3QB0 A;  1CZ9 A;  2DFE A;  2OCE A;  1TK5 A;  4DV3 K;  3DXK B;  4IG3 A;  2V52 B;  3U3Y A;  2G8W A;  3AO3 A;  3VTH A;  5BPN A;  4NO7 A;  1U2V A;  2ZM6 K;  3SV3 A;  3S3O A;  3UIQ A;  3OYC A;  4DFJ A;  4CI6 A;  3R3L A;  3ZSY A;  1NGH A;  3IKM A;  4BR9 A;  5F1X A;  3H45 C;  2E20 A;  2I7P A;  1MWK A;  4WQ4 C;  1YJW N;  1ASW A;  2Q0R A;  1WAF A;  3OYD A;  3V1O A;  3ZEU A;  1HNZ K;  1YI2 N;  3GDQ A;  3L0Q A;  4J8F A;  4DSK A;  2YNG A;  3NF6 A;  3ENB A;  4GVM A;  1E4F T;  1FJG K;  3UKR A;  3KK3 A;  4Z4G A;  1XMO K;  3SAG A;  1TL1 A;  4JS5 A;  2QWN A;  2HBK A;  2V51 B;  1DTT A;  1NK8 A;  3HZ6 A;  3CET A;  4CK3 A;  2B6A A;  3CC4 N;  3O9S A;  1D8Y A;  2ZJP L;  1VQP N;  2HNY A;  3V9U A;  4NLB A;  1LAW A;  3HVR A;  3CCS N;  4A59 A;  5TKW A;  4OPH A;  1ZBI A;  4BRH A;  3SUN A;  2OPS A;  1KFD A;  3R1X A;  1O13 A;  5ADX H;  2IIR A;  1WSH A;  3SUP A;  4NCB A;  1CXQ A;  4K0K K;  3ID8 A;  2CGL A;  4ISF A;  4I6M B;  3VGK A;  3QIO A;  1HKC A;  2Y1I A;  2OZM A;  3CCJ N;  2JWL A;  3V9X A;  3SUQ A;  2GEL A;  5AQN A;  3MN5 A;  2PZS A;  4DR4 K;  1N34 K;  4IEI A;  1VQM N;  2WUS A;  3VEW A;  1C0F A;  2FBX A;  1VAZ A;  1D9F A;  4EZ6 A;  4QCL A;  2HVH A;  3QML A;  5ELZ A;  3NH1 A;  4B8A B;  3K5O A;  4AHR A;  4BVP A;  3TAR A;  2YKM A;  4KHY A;  2VWB A;  3CIP A;  2QWL A;  1X9S A;  1BQM A;  4CBW A;  5KQ8 A;  4C8K A;  2YNF A;  1BGX T;  2ZJR L;  1XUP O;  1JLA A;  1QQM A;  4TSX A;  3ZLJ A;  3J7A P;  2A1S A;  2QXL A;  3GBT A;  1VHX A;  3JYT A;  1Q18 A;  3NF8 A;  1MU2 A;  3M8Q A;  3AO5 A;  3T7Z A;  3ZX0 A;  5M1Q A;  5FPE A;  1U04 A;  3E66 A;  1ATN A;  2QWR A;  4DTP A;  3AAQ A;  4LF8 K;  4YFU A;  4CF2 A;  2QKK A;  4BRF A;  5HBM A;  4M3T A;  3D0P A;  1HUX A;  1KSP A;  3LDN A;  4LF5 K;  3NFA A;  5M1K A;  3HJF A;  3O5B A;  4KHW A;  4IG0 A;  5LMU K;  3C94 A;  2E4L A;  3QEX A;  1CZA N;  2ITM A;  2G8V A;  3GG4 A;  2ZF5 O;  5FPN A;  3ZSV A;  1ZYQ A;  5AQG A;  4FJH A;  3LDO A;  3PO4 A;  4MFB A;  5C42 A;  4FPA A;  3D2E A;  2YV0 X;  5C2D A;  1KFS A;  5BR9 A;  2Z1G A;  1SL1 A;  4YDU C;  1GOC A;  4WCE L;  3CFO A;  4CZG A;  4FPB A;  5D3G A;  2VG6 A;  1A5W A;  1JCG A;  4CIF A;  1A5X A;  1WSF A;  5J1E A;  5E41 A;  3CJ7 A;  2CGJ A;  2G8U A;  4N47 A;  1RTH A;  2RE2 A;  2X6S A;  4M7Y A;  1EQY A;  1BIS A;  1FXX A;  1RDD A;  1NK5 A;  3DOL A;  2OTJ N;  3WXJ A;  3VPZ A;  2GV9 A;  4CFC A;  5C0Y A;  4FLX A;  1ATS A;  2HHH K;  3ULE A;  2E2Q A;  3LDQ A;  1R0A A;  1TYQ B;  4C1N I;  5KTQ A;  1K6Y A;  4FM2 A;  2HHQ A;  4FOI A;  1B9F A;  4E0D A;  3K58 A;  3P1G A;  4WE1 A;  3VMF B;  1MA9 B;  2NRX A;  2HBL A;  2YCH A;  4Q5V A;  2KZZ A;  4FWP A;  4FJI A;  1NK7 A;  4IDH A;  3EKS A;  4IFE A;  4JD2 B;  1M90 O;  3H1Q A;  2Q36 A;  3A5L C;  1VSF A;  4FCY A;  2O8C A;  2O8E B;  3K5L A;  4JI8 K;  1GLF O;  3RR7 A;  4B3O A;  2UXC K;  4NLC A;  4H8K A;  1W9H A;  1RDC A;  1BL3 A;  3JS6 A;  3J80 O;  3RWU A;  3SNN A;  1GLJ O;  4H4M A;  2XY8 A;  3KLI A;  2A40 A;  3QER A;  3C6H A;  3MN7 A;  1GOB A;  3EYZ A;  2QM1 A;  1GLC G;  1Z6R A;  2YKN A;  3DLR A;  5KPR A;  2I7N A;  1ZC6 A;  1QZ6 A;  1RT2 A;  2P9P A;  4XH5 A;  2D0P A;  2GWK A;  2X6N A;  3ZET A;  4YOU A;  1NLV A;  3BEX A;  3KK7 A;  3AVM A;  3ZSO A;  4QS8 A;  5AQJ A;  3CFP A;  3CF5 L;  4HWI A;  1S22 A;  4BWJ A;  4DV1 K;  4BE2 A;  5JVG L;  1VQK N;  4DR2 K;  4H0P A;  1NGJ A;  4YY3 K;  4WFA L;  3WXM B;  1NGE A;  3NAE A;  4B3T K;  4J2A A;  3OVN A;  1BCO A;  2KKZ A;  3MXJ A;  4OPA A;  4E89 A;  1S9G A;  1S1V A;  4KTW A;  1NGC A;  3J8A A;  4L8R B;  4YDU A;  4B9S A;  2QEX N;  4AM7 A;  4K43 A;  4ZHR A;  3NGY A;  3THY A;  1S1W A;  1JLE A;  2W41 A;  3I8B A;  4DS5 A;  3AA2 A;  1UA0 A;  5LL6 Z;  1P90 A;  2XO7 A;  4MLE A;  3MEE A;  4DTR A;  3MMV A;  2P9L A;  1SL0 A;  3OYB A;  4AHC A;  4JV5 K;  1T03 A;  2OA8 A;  3EEQ A;  4MLH A;  4CGH A;  4Z4C A;  1VQ8 N;  1SZ2 A;  4NYN A;  1RDB A;  4CHO A;  3OHR A;  1HNX K;  5KGW A;  3SJJ A;  3KWI A;  4BRI A;  1WUA A;  3HP6 A;  4JLH A;  3VEO A;  4BGB A;  1B92 A;  3O08 A;  2XY5 A;  3ATV A;  5AQW A;  4KTZ A;  4DSI A;  3BZC A;  2P9I B;  1KQS M;  3FE1 A;  3DLE A;  5KPT A;  4IEE A;  3CI5 A;  4CBX A;  5FDL A;  3G10 A;  4CZK A;  3CCL N;  4DQ8 A;  1WB9 A;  3HOS A;  1YJ9 N;  4DU1 A;  1S1T A;  3CQ8 A;  1Q9Y A;  4LSL A;  1HNI A;  2D0O A;  1BCM A;  5F2R A;  3RMC A;  2IOC A;  4JKB A;  4FSV A;  4BQZ A;  2YHA A;  4FWS A;  4O4G A;  1I94 K;  4CIG A;  1VQN N;  2YHW A;  3FZF A;  4RG8 A;  3CJA A;  3AO2 A;  1S1X A;  4C8N A;  3QES A;  2O8C B;  5JLF A;  4LH4 A;  4FYD A;  4CZM A;  1RTD A;  2A3Z A;  5KQD A;  3WNG A;  4CJK A;  3F73 A;  3SI6 A;  1SQK A;  3HM9 A;  5HRS A;  1BA1 A;  3DAW A;  1GLE G;  4U7B A;  3L2R A;  3SLC A;  5ADX A;  2GUP A;  4FW2 A;  1HYV A;  4HTU A;  3QLH A;  4CF1 A;  4PUO A;  1B9D A;  3MCP A;  3L2Q A;  4FLZ A;  3MX5 A;  1ZBL A;  1XI1 A;  3QIN A;  4NB4 A;  4KV8 A;  4FJM A;  3LL3 A;  2Q1N A;  2ASM A;  2P9P B;  1G15 A;  4HUG A;  3A5M C;  4JKE A;  4CGG A;  2VGN A;  3E1Y A;  4A62 A;  2AP1 A;  4CEC A;  4XH4 A;  1Q7Y O;  4CGD A;  4KHQ A;  1WN7 A;  4ELU A;  1UAX A;  4AHU A;  3R8E A;  1KD1 O;  3H46 O;  4BWM A;  4O8U A;  4R5P A;  3O9R A;  4KB1 A;  3D6R A;  4J2D A;  2KQ2 A;  3HL8 A;  2P5G A;  3THW A;  5LJV A;  1KC8 O;  4BC4 A;  1KVA A;  1VRU A;  4JK8 A;  4KAZ A;  3PIP L;  3KTQ A;  1YF5 L;  1GLD G;  1L3T A;  3HP9 A;  3THY B;  4CHQ A;  3CCV N;  2P9K A;  2UXD K;  1ITG A;  2HND A;  3TR8 A;  3SZ2 A;  2VG5 A;  2YI1 A;  3VF2 A;  3VQD A;  2ASP A;  3NH2 A;  1VSL A;  5EU7 A;  4JI0 K;  3R6M A;  4OPK A;  4JN4 A;  4F3O A;  1JL1 A;  1X9J A;  2KFZ A;  3WNH A;  1BG3 A;  3PY8 A;  1IBK K;  3DXK A;  3EZ5 A;  3WXI A;  4FLW A;  1QE1 A;  4JI1 K;  2ATQ A;  4HTL A;  1H1V A;  3OY9 A;  4Z0U A;  2G8I A;  1DKG D;  5J2Q A;  4E7K A;  3CQX A;  3HYF A;  5I42 A;  3O4Q A;  3DLL L;  1IKY A;  4KBO A;  3NF7 A;  1SKR A;  3OYL A;  2ITG A;  5M1P A;  5HRO A;  2Q31 A;  4DTS A;  1U48 A;  3D7E O;  4JNE A;  1LCU A;  4BG9 A;  2ETJ A;  2FBT A;  3L2W A;  2IGI A;  4X65 K;  1HNV A;  5FLX O;  3G0Z A;  3RMB A;  4GY2 B;  2O8F B;  1TAQ A;  4RWT A;  2W40 A;  3FZM A;  3TAN A;  1IH7 A;  2CGK A;  3OYE A;  1IBL K;  1RNH A;  4FWN A;  4C23 A;  2VYP A;  5GIO A;  2Q3S A;  1XNQ K;  3NF9 A;  4CJW A;  3RMD A;  2Q0U A;  4AIL C;  4A2B A;  3MXI A;  4Y1D A;  2P5O A;  2ZQB A;  3L4Q A;  4I6M A;  5AFU H;  1LWF A;  4AM6 A;  4BR4 A;  3K9J A;  5TKY A;  4NCG A;  4GV3 A;  3O9U A;  4FLU A;  4ID5 A;  1YIJ N;  4DR6 K;  1N6Q A;  4BDZ A;  1YHQ N;  4W5R A;  1LW2 A;  2FBY A;  3CPE A;  1C0G A;  5C12 A;  2NNW A;  2R7Y A;  1VSE A;  4FLT A;  3CCU N;  5JLH A;  3P5J A;  4FJ8 A;  4H0T B;  2DY4 A;  1JCF A;  2E2N A;  5CHI A;  2A5X A;  3CHW A;  5M1F A;  2RN2 A;  4PHT X;  3N4P A;  1Z26 A;  1EX4 A;  2OPR A;  3N4Q A;  4CER A;  5C15 A;  1RBR A;  1JXB A;  5DM7 L;  2E8A A;  5BPL A;  3LDP A;  4CEA A;  3U6F A;  2BGG A;  4J2E A;  2FSJ A;  1NGD A;  1IG9 A;  5BN8 A;  3THW B;  1IJJ A;  1VSJ A;  4O0J A;  1YTU A;  2E2O A;  4IFY A;  1BDG A;  3WXK A;  1RCH A;  3O9Q A;  4BC2 A;  3HT3 A;  4CJT A;  1DGK N;  5AQS A;  1NKE A;  2P9K B;  3AGK A;  1T05 A;  3QFU A;  4O8K A;  2Z1H A;  3CME N;  4O55 A;  1L3S A;  4OGC A;  1ZBU A;  3O9T A;  4E1M A;  4FO0 A;  1BU6 O;  5SWM A;  2W6L A;  1BOT O;  3DOK A;  1BUP A;  4NCA A;  5EY4 A;  1J9A A;  3C65 A;  2F9T A;  2Z1I A;  4WYB A;  5FPD A;  1FKO A;  1T44 A;  3LP0 A;  1WSG A;  4A5A A;  4BRP A;  4FW1 A;  3M8P A;  1L3V A;  4M41 A;  5CYQ A;  3C6A A;  4RCH A;  3GE1 A;  5BRH A;  4N76 A;  3P31 A;  4O5B A;  4B3S K;  3PIO L;  2F8T A;  2Q2R A;  1NGF A;  3AVI A;  3U9D A;  5AJ3 K;  3KLG A;  4JYA K;  3MK6 A;  2GTD A;  2BH1 A;  2NRV A;  5AZI B;  2UUA K;  1T6D A;  1DT9 A;  4DR3 K;  4DF4 A;  1TYQ A;  2F7T A;  3DRP A;  4BVO A;  2OAN A;  4LSN A;  1KAX A;  1HMV A;  2VG7 A;  4GW6 A;  4KI6 A;  4M7X A;  4B9V A;  2YJE A;  2FSK A;  4E7J A;  3VQ7 A;  3EL2 A;  3L4I A;  4DFK A;  3OW2 M;  4JD2 A;  4BRD A;  3NMU A;  2O8E A;  1BHL A;  5DMR A;  4A5B A;  3SQ2 A;  3ZSQ A;  3TTC A;  1TUU A;  1IBM K;  4PY5 A;  1GLL O;  2WOM A;  2D0A A;  3PX6 A;  4LFC K;  4M3X A;  2A1R A;  1XMQ K;  3O3F A;  3ZT0 A;  2Y1J A;  4EHU A;  2E88 A;  3QEI A;  4G9Z A;  4DR7 K;  4DV2 K;  2OYQ A;  1YXQ A;  4M3R A;  3OS0 A;  3HTV A;  3O8M A;  4CD3 A;  4JI3 K;  4DTJ A;  2E2P A;  3U4L A;  5CZ1 A;  4M42 A;  1LWC A;  4JS4 A;  3OYN A;  1Z05 A;  4ISE A;  4A57 A;  1VSM A;  1QTM A;  4CHN A;  2X78 A;  1C6V A;  1QS4 A;  4CJR A;  3OS2 A;  4EIA A;  4B1Y B;  3NE6 A;  4DSE A;  3K5N A;  5BRF A;  2EHG A;  4CW7 B;  1RIL A;  1WSI A;  4BRO A;  3MAQ A;  3SAH A;  2PFU A;  1SKS A;  4H5W A;  3HPO A;  2HBJ A;  4Z94 A;  3SBG A;  2RHK A;  3AA4 A;  4FWK A;  3VF4 A;  3CCR N;  4W5Q A;  4C1N K;  5A2Q O;  2WON A;  3B8A X;  3CG7 A;  1ASU A;  4YNQ A;  1HJO A;  3WXL A;  5C24 A;  1YJN N;  2GEM A;  4V19 S;  1VQ5 N;  4ILG B;  4YOY A;  2PYL A;  4FWR A;  3VTI A;  3QDK A;  4BR2 A;  4DTN A;  4WQ4 A;  3BF3 A;  1GLA G;  1BO5 O;  3HSC A;  3V81 A;  3EKU A;  3PV8 A;  3QET A;  1RDW X;  3ZT3 A;  3SQ0 A;  5AQO A;  4YHH K;  4M3U A;  4YOW A;  4B3M K;  4FK4 A;  1W97 L;  3F9M A;  3ID6 A;  4RW8 A;  1HJR A;  3L8B A;  1NK9 A;  4KO0 A;  5GAH P;  1EWQ A;  3MDQ A;  1BIZ A;  4LFA K;  4DF8 A;  4FK0 A;  4PKG A;  3ZCM A;  4ZTF A;  1RT3 A;  1VQ9 N;  2VCP A;  3H3N O;  3LAN A;  4B9Q A;  3HVT A;  1EKE A;  4PWD A;  2P9I A;  3KJV A;  2FF3 B;  3O1B A;  4KH5 A;  1HKB A;  3D45 A;  3JSM A;  1RBV A;  5LMN K;  2ZD1 A;  3HBT A;  3HM8 A;  4YOV A;  3KLF A;  3B6P A;  4ILH A;  1YAG A;  3T19 A;  3MCA B;  3OYA A;  4BAC A;  2E1Y A;  5IWA K;  3SPY A;  4KHS A;  3K0S A;  5CYM A;  4BC3 A;  4HVJ A;  1NKB A;  3IUC A;  4B08 A;  3WNE A;  1KAY A;  1ZBS A;  4K25 A;  4B9N A;  3NVK A;  3TTD A;  3DM2 A;  4CZI A;  4HUF A;  3KLH A;  4FWL A;  3FFK B;  3FZK A;  4JEP A;  4CED A;  3MEG A;  1VSH A;  4FLV A;  3M1F A;  3F5T A;  1TK0 A;  4FJ5 A;  1S72 N;  1X9M A;  3G4S N;  4CIE A;  1TGO A;  4BRA A;  2HW3 A;  4EHT A;  3AVC A;  3CM5 A;  1ASV A;  2NRW A;  3LP1 A;  4JRQ A;  3ENH A;  5AFU A;  3QEV A;  4KHP K;  3PO5 A;  4YOR A;  1CXU A;  1KRP A;  3TAP A;  1SKW A;  4FJN A;  1U47 A;  1NKC A;  5BN9 A;  4BRK A;  4LF9 K;  2E1Z A;  5BPM A;  2GWJ A;  3RR8 A;  3HST B;  1YTA A;  4CK1 A;  2FC0 A;  4CCH A;  3PX4 A;  3L3V A;  4DHY A;  1X1P A;  2HMI A;  5FRN A;  3MWT A;  4FZX C;  4CEF A;  3CPW M;  4M63 C;  2QXF A;  3DLG A;  3H08 A;  1IO2 A;  3VQC A;  3S3N A;  3PUF A;  1X9W A;  4EFH A;  5H1S Q;  4CZF A;  5EOY A;  3L3U A;  4YOT A;  4JKC A;  4O0I A;  1U6Z A;  3DXM B;  1EO1 A;  4MO4 A;  3AVN A;  5HRP A;  3KD5 E;  5GIP A;  3U3G A;  4IOX A;  4CFA A;  3OBW A;  1D5A A;  4CJ5 A;  4GKJ K;  3P4I A;  3DJC A;  4QS9 A;  4XIU A;  3MWP A;  4OVL A;  1S3X A;  1YT3 A;  4K8X A;  4Q0B A;  3JXU A;  4IZ9 A;  3HXM A;  1SL2 A;  1N36 K;  4LH5 A;  1UWB A;  1F21 A;  3ZYY X;  2VGM A;  1QQO A;  3AA3 A;  3AAR A;  4CEB A;  4Z4E A;  2HOE A;  5E26 A;  3LWL A;  3SV4 A;  1NJZ A;  4B9L A;  3WEE A;  5M1N A;  4OKE A;  2D0C A;  2IAJ A;  4CVN E;  1VQ4 N;  4BE0 A;  3T1A A;  3MEC A;  3I55 N;  1BI4 A;  4DFP A;  3V6D A;  5MLC Q;  4DQP A;  3V1Q A;  1YIT N;  4EP5 A;  3OYG A;  4DV7 K;  4JI5 K;  5AQF A;  4PA1 A;  1JL2 A;  3ATU A;  3H6E A;  4JKA A;  1NBW A;  3TAF A;  2VQE K;  1IKW A;  3K2P A;  3VQ9 A;  3CXC M;  3T1H K;  1XQS C;  2ZJQ L;  2HMP A;  4H5N A;  5EVZ A;  5AQY A;  4H0V B;  1QQC A;  3AVA A;  3O4W A;  4H0X B;  1S6Q A;  3UB5 A;  3ZSX A;  2YJF A;  1Q9X A;  1TKX A;  2O8F A;  1NJW A;  1HKG A;  2YHB A;  3P39 A;  1RT1 A;  1OH6 A;  3LPU A;  3CCE N;  4CJS A;  1BWF O;  2WC9 A;  4DCH A;  3Q7B A;  1TV6 A;  3EY1 A;  4EAH D;  3W3D A;  4CZJ A;  1YVU A;  3K57 A;  3TPQ A;  3TWH A;  3A0I X;  2GUI A;  4OO1 J;  4E19 A;  2AA4 A;  2QTD A;  4KPY A;  4DUY K;  1J54 A;  3S9H A;  1RTJ A;  1SS6 A;  4RW9 A;  3V1R A;  4UQG A;  4KFB A;  4H0Y B;  1JLG A;  1NJX A;  4JI2 K; 
#chains in the Genus database with same CATH homology
 3ENO A;  3K9J A;  3ID8 A;  5TKY A;  2CGL A;  4GV3 A;  3O9U A;  4ISF A;  4I6M B;  3W0L A;  3VGK A;  1HKC A;  4FOE A;  3CCJ N;  2JWL A;  1LOT B;  2GEL A;  5AQN A;  1YIJ N;  3MN5 A;  2P9S A;  2BUP A;  4IEI A;  1YHQ N;  3L6Q A;  1Q82 O;  3CPE A;  2WUS A;  1C0G A;  3FZL A;  3CJB A;  2NNW A;  5C12 A;  3OW2 M;  3VEW A;  1E4G T;  1NJI O;  3SMS A;  1C0F A;  1VAZ A;  3QML A;  1RGI A;  1VQ7 N;  5ELZ A;  4PL8 A;  4MDA A;  3CCU N;  5JLH A;  3CD6 N;  4KH4 A;  4H0T B;  4A2A A;  1JCF A;  2E2N A;  3VGL A;  3AGR A;  4BVP A;  5CHI A;  2A5X A;  3CHW A;  3WQU A;  5M1F A;  4PHT X;  3N4P A;  3CCM N;  4PKH A;  2IVO A;  3N4Q A;  2VWB A;  3FGU A;  5C15 A;  4BRL A;  3CIP A;  5DM7 L;  2E8A A;  2QWL A;  3OA9 A;  5KQ8 A;  4CBW A;  5JVH L;  5BPL A;  2ZJR L;  1XUP O;  4WFN L;  1QQM A;  3LDP A;  2YHX A;  2QXL A;  3GBT A;  3RSE A;  4Y0W A;  2FSJ A;  1NGD A;  1Q18 A;  3CJ9 A;  2KLA A;  2GX9 A;  1X3M A;  5BN8 A;  4ISG A;  1IJJ A;  3R9P A;  3T7Z A;  5M1Q A;  3ZX0 A;  2ASO A;  3D2F A;  5FPE A;  2E2O A;  3LM9 A;  3EE9 A;  1K73 O;  1NMD A;  5AR0 A;  3E66 A;  1ATN A;  2QWR A;  1BDG A;  3AAQ A;  3SJH A;  3A5O C;  3WXK A;  3D2F B;  3O9Q A;  4BC2 A;  1KXP A;  4CD1 A;  1DGK N;  2NZT A;  5AQS A;  4BRF A;  4WFB L;  4CBU A;  1D4X A;  2P9K B;  1HUX A;  3AGK A;  3HOT A;  3KWG A;  3QFU A;  3LDN A;  4O8K A;  3CME N;  2QWQ A;  5M1K A;  4JHD A;  3O5B A;  3O9T A;  5GAE P;  4FO0 A;  1BU6 O;  1BOT O;  1CZA N;  2ITM A;  3C0B A;  3GG4 A;  2ZF5 O;  1BUP A;  3O6W A;  5EY4 A;  3QBW A;  3WEE B;  3C65 A;  5FPN A;  2F9T A;  1HX1 A;  2OTL N;  4WYB A;  5FPD A;  1T44 A;  5AQG A;  3FR0 A;  1Q86 O;  3LDO A;  4A5A A;  4B1W B;  4BRP A;  4FPA A;  4PL7 A;  3J7Z O;  4BRC A;  3D2E A;  5CR4 A;  4IO9 L;  5AZJ B;  5C2D A;  3CC7 N;  3TSP A;  5BR9 A;  3C6A A;  4RCH A;  3GE1 A;  4YDU C;  5BRH A;  4WCE L;  2BTF A;  4CZG A;  3P31 A;  3D2E B;  4FPB A;  4R79 A;  3U9Z A;  3PIO L;  3QFP A;  3E9O A;  5AZI A;  1JCG A;  1NGF A;  2Q2R A;  2Q97 A;  3MN6 A;  3AY9 A;  3U9D A;  3CJ7 A;  2CGJ A;  5KPZ A;  3I56 N;  1ZXO A;  2RE2 A;  3FZH A;  3MK6 A;  4M7Y A;  2GTD A;  2BH1 A;  2A42 A;  1EQY A;  4KH6 A;  2NRV A;  5AZI B;  3IFR A;  1T6D A;  1DT9 A;  1J6Z A;  2OTJ N;  5GAG P;  3WXJ A;  3KHY A;  1RFQ A;  3VPZ A;  3T69 A;  3F2K A;  1TYQ A;  2F7T A;  3SK3 A;  4BGA A;  5C0Y A;  4BVO A;  1ATS A;  2OAN A;  1VQO N;  3ULE A;  2E2Q A;  3LDQ A;  1TYQ B;  2FSN A;  1KAX A;  4C1N I;  3S41 A;  3IMX A;  4JKD A;  1WOQ A;  4M7X A;  3ULE B;  5I9E B;  4FOI A;  2YJE A;  5LJW A;  4XH1 A;  2FSK A;  5AQI A;  5EXW A;  1NGG A;  3EL2 A;  3L4I A;  3VMF B;  4JD2 A;  1MA9 B;  2F9W A;  2NRX A;  3TTF A;  2HBL A;  4IJN A;  2YCH A;  4BRD A;  3NMU A;  1QVG M;  4FWP A;  4IDH A;  4A5B A;  3EKS A;  4IFE A;  4JD2 B;  4JKG A;  3TTC A;  3K9K A;  1TUU A;  3H1Q A;  1M90 O;  2Q36 A;  1GLL O;  3A5L C;  3VGM A;  4WQ5 C;  2NRT A;  3SBT A;  1GLF O;  4B1Z A;  3CMA N;  1NM1 A;  4NLC A;  4FWQ A;  4EHU A;  2E88 A;  4G9Z A;  4BQL A;  4K41 A;  4BRQ A;  3EZW A;  4GNI A;  2KHO A;  2YX6 A;  3JS6 A;  3G6E N;  1GLJ O;  3TSQ A;  4YOX A;  1MDU B;  3MN9 A;  1YXQ A;  4JK9 A;  3VET A;  2A40 A;  3M5R A;  3C6H A;  3MN7 A;  3HTV A;  2QM1 A;  1GLC G;  3O8M A;  1Z6R A;  4CD3 A;  2P9S B;  4BRM A;  2E2P A;  3U4L A;  3G71 N;  3IDH A;  2I7N A;  5KPR A;  1ZC6 A;  4H0O A;  4BY9 C;  3VEV A;  1QZ6 A;  2P9P A;  1Z05 A;  2D0P A;  4ISE A;  4XH5 A;  2GWK A;  4A57 A;  3ZET A;  5AQV A;  1R59 O;  4YOU A;  4IOA L;  2D4W A;  1NLV A;  1YUW A;  3BEX A;  3KK7 A;  4B1Y B;  4EIA A;  3CC2 N;  4H5V A;  3ZET B;  4QS8 A;  5AQJ A;  5BRF A;  4GVE A;  3CF5 L;  2HST A;  3KVG A;  2FF6 A;  4BRO A;  4HWI A;  1S22 A;  5EX5 A;  2P9U A;  2PAV A;  3QIC A;  3SAH A;  5JVG L;  1VQK N;  2PFU A;  4H0P A;  1NGJ A;  3VOV A;  3A5N C;  4H5W A;  4WFA L;  4MDB A;  1DEJ A;  3WXM B;  2HBJ A;  4Z94 A;  3SBG A;  1NGE A;  3WUH A;  3RSE B;  4IXC A;  2RHK A;  3AAP A;  2KKZ A;  4FWK A;  3VF4 A;  3CCR N;  4OPA A;  4C1N K;  3B8A X;  1HJO A;  3VF6 A;  3CCQ N;  4BC5 A;  2QWO A;  1NGC A;  3J8A A;  3WXL A;  5BRE A;  1YJN N;  1P8Z A;  2GEM A;  3VEX A;  3VEN A;  5CE3 A;  4ILG B;  4YDU A;  1VQ5 N;  3E9P A;  3BF1 A;  3CER A;  4YOY A;  2QEX N;  4AM7 A;  4FWR A;  3VTI A;  3QDK A;  4K43 A;  4BR2 A;  3GOI A;  2H3G X;  4WQ4 A;  3BF3 A;  2D1K A;  1Q81 O;  1GLA G;  2W41 A;  1HLU A;  1BO5 O;  3I8B A;  3HSC A;  3KZB A;  4JHD B;  5JIC A;  3EKU A;  4B1U B;  1RDW X;  5AQO A;  1P90 A;  4LC9 B;  4YOW A;  1W97 L;  4MLE A;  5LY3 A;  3O80 A;  3F9M A;  4H5T A;  2NRH A;  3ID6 A;  3MMV A;  2WBN A;  2P9L A;  5GAH P;  2WFB A;  3UKU A;  4BG8 A;  2PBD A;  3EN9 A;  4MLH A;  1X3N A;  3MDQ A;  2P9L B;  4JK7 A;  3UKU B;  4PKG A;  5AQM A;  1K8K A;  1XC3 A;  5E84 A;  1VQ8 N;  1VQ9 N;  2VCP A;  1SZ2 A;  4CZL A;  2ZGY A;  3H3N O;  3OHR A;  5C10 A;  4B9Q A;  1W2B M;  3RVC A;  1Y64 A;  3Q7C A;  1K8K B;  3KWI A;  4BRI A;  1WUA A;  5DM6 L;  2P9N A;  3VEY A;  3VEO A;  4BGB A;  1HPM A;  2QI2 A;  3O08 A;  1N8R O;  2P9I A;  2QW9 A;  3LDL A;  4ILJ A;  2FF3 B;  4CZH A;  4O5F A;  3ATV A;  3O1B A;  1HKB A;  4KH5 A;  4WQ5 A;  5AQW A;  1V4S A;  4MO5 A;  2FXU A;  2P9I B;  3HBT A;  1KQS M;  3FE1 A;  3TSU A;  3HM8 A;  3O1W A;  4BR7 A;  4IEE A;  5F0X A;  3CI5 A;  4CBX A;  5KPT A;  4K42 A;  5HOO A;  2V7Z A;  4YOV A;  4FL9 A;  4CZK A;  3A8Y A;  4ILH A;  3CCL N;  1YAG A;  1QHA A;  3QBX A;  3UE5 A;  4DQ8 A;  3HOS A;  5BRD A;  1YJ9 N;  3MCA B;  4FVU A;  5C2F A;  2E1Y A;  2A6A A;  3M6G A;  2QWM A;  2D0O A;  5F2R A;  1TUY A;  3CQY A;  4FWM A;  5JMV A;  3BUZ B;  4BC3 A;  4JKB A;  1JJ2 M;  4FSV A;  3M3Z A;  4BQZ A;  3IUC A;  2JWK A;  1G99 A;  1SAZ A;  3BP8 A;  1KAY A;  4FWS A;  1ZBS A;  4K25 A;  3VEZ A;  3NVK A;  2HF4 A;  2UYT A;  1VQN N;  3TTD A;  4WF9 L;  4RTF D;  4CZI A;  5GIN A;  3CJC A;  2YHW A;  3FZF A;  4FWL A;  3FFK B;  3FZK A;  3CJA A;  4JEP A;  5AQR A;  4JKG B;  1NGI A;  3M1F A;  3F5T A;  5JLF A;  3TU5 A;  4QS7 A;  2DPN A;  4CZM A;  3ZX3 A;  2A3Z A;  5KQD A;  4CZE A;  4AF1 A;  2V7Y A;  3P38 A;  5AQL A;  1SQK A;  3U8X A;  1QZ5 A;  1BA1 A;  2ZGZ A;  3DAW A;  1S72 N;  4B1V A;  4GV6 A;  1GLE G;  4BRN A;  3G4S N;  4BRA A;  4U7B A;  1VQL N;  4EHT A;  3OBY A;  3NVM A;  4JKF A;  4DKW A;  3SLC A;  5ADX A;  4BRG A;  2GUP A;  2NRW A;  3ENH A;  5AFU A;  1ATR A;  2ZWH A;  1KAZ A;  1M1K O;  1VQ6 N;  2NRZ A;  4YOR A;  3MCP A;  2EWS A;  5AQQ A;  2YHY A;  3MX5 A;  4BR5 A;  4F9O A;  2CH6 A;  4NB4 A;  5M1O A;  5GAD P;  3LM2 A;  3LL3 A;  5BN9 A;  2Q1N A;  3SAF A;  4BRK A;  2ASM A;  2P9P B;  2E1Z A;  1JCE A;  2GWJ A;  5BPM A;  3A5M C;  1RDU A;  3C7N A;  4JKE A;  2VGN A;  3E1Y A;  4A62 A;  1NGA A;  1NWK A;  4H03 B;  2AP1 A;  3CJ1 A;  4XH4 A;  4DHY A;  3C7N B;  1Q7Y O;  1IG8 A;  4IO8 A;  4CJ7 A;  3MWT A;  1GLB G;  3MX2 A;  3CPW M;  5AQZ A;  4M63 C;  2P9U B;  5AQU A;  1OKJ A;  3R8E A;  3EE8 A;  3GL1 A;  1KD1 O;  1K8A O;  3H46 O;  4IWV A;  2FLO A;  4O8U A;  4B1X B;  3HI0 A;  4UY8 O;  3VER A;  3O9R A;  4EFH A;  1OVY A;  2CH5 A;  3VES A;  3WT0 A;  3ZX2 A;  5H1S Q;  3FLC O;  3D6R A;  1T6C A;  4CZF A;  5EOY A;  3DXM A;  4BRE A;  5AQH A;  1BA0 A;  4YOT A;  4JKC A;  1U6Z A;  4JKH A;  1K9M O;  5LJV A;  1NGB A;  1KC8 O;  3DXM B;  1EO1 A;  4MO4 A;  4BC4 A;  4IJA A;  2IVP A;  4FWO A;  4JK8 A;  5GIP A;  4IOX A;  3PIP L;  3I33 A;  1YF5 L;  2NLX A;  1GLD G;  3OBW A;  5B8H A;  5AQT A;  3P4I A;  3DJC A;  4QS9 A;  4BR0 A;  3CCV N;  3HRG A;  3MWP A;  1S3X A;  3DWL A;  2P9K A;  3JXU A;  4IZ9 A;  5AQP A;  5AQK A;  1VQM N;  2YI1 A;  3VF2 A;  2ASP A;  2QA4 N;  3ZYY X;  2VGM A;  1QQO A;  3AAR A;  3SMP A;  2HOE A;  4JAX A;  5E26 A;  3R6M A;  4JN4 A;  4U67 L;  1ILY A;  1X9J A;  3WEE A;  5M1N A;  5HL7 L;  1BG3 A;  1VQ4 N;  3PLA A;  3DXK A;  3I55 N;  2HBM A;  3QB0 A;  1YVN A;  4H5R A;  5MLC Q;  5FPM A;  3WQT A;  3WXI A;  1YIT N;  2QWP A;  5AQX A;  3DXK B;  4HTL A;  1H1V A;  5AZJ A;  5AQF A;  1DKG D;  3ATU A;  3H6E A;  3CQX A;  2V52 B;  2P9N B;  3H3O B;  4JKA A;  1NBW A;  3VTH A;  5BPN A;  4NO7 A;  1U2V A;  3DLL L;  4DB3 A;  3CXC M;  4KBO A;  1ESV A;  1XQS C;  2ZJQ L;  2HMP A;  4H5N A;  4L3Q A;  4CI6 A;  2J4R A;  3R3L A;  5EVZ A;  5M1P A;  1U2V B;  5AQY A;  4GV9 A;  1NGH A;  2NRR A;  2Q31 A;  2A41 A;  3IKM A;  4H0V B;  4BR9 A;  1QQN A;  5F1X A;  3H45 C;  3O4W A;  3D7E O;  4JNE A;  2E20 A;  4H0X B;  3UB5 A;  1LCU A;  2I7P A;  1MWK A;  4WQ4 C;  4BG9 A;  1QVF M;  2YJF A;  1YJW N;  2Q0R A;  3ZEU A;  1V4T A;  1YI2 N;  1HKG A;  3GDQ A;  3G25 A;  4A61 A;  3P39 A;  4IOC L;  3L0Q A;  4J8F A;  3ZEU B;  2HF3 A;  3CCE N;  4GY2 B;  1MWM A;  1T3V A;  1BWF O;  3E9L A;  3ENB A;  2WC9 A;  4DCH A;  1E4F T;  3UKR A;  4RWT A;  2W40 A;  3FZM A;  3SAG A;  2QWN A;  2HBK A;  3Q7B A;  2V51 B;  2CGK A;  4EAH D;  3W3D A;  3UKR B;  4CZJ A;  4FWN A;  4C23 A;  5GIO A;  2VYP A;  3HZ6 A;  3TPQ A;  3H1V X;  3CET A;  3CC4 N;  3O9S A;  3A0I X;  2ZJP L;  1VQP N;  4OO1 J;  4NLB A;  2AA4 A;  2IVN A;  2QTD A;  3CCS N;  4XEI A;  4A59 A;  5TKW A;  2Q0U A;  4OPH A;  1SS6 A;  4A2B A;  3EO3 A;  4BRH A;  4PKI A;  3L4Q A;  3R1X A;  4H0Y B;  1O13 A;  4I6M A;  5ADX H;  2IIR A;  5AFU H;  4AM6 A;  4BR4 A;  4E1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...