5C25A

Crystal structure of hiv-1 reverse transcriptase in complex with 6-((4-((4-cyanophenyl)amino)-1,3,5-triazin-2-yl)amino)-5,7-dimethyl-2-naphthonitrile (jlj639), a non-nucleoside inhibitor
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE, P66 SUBUNIT
publication title Discovery and crystallography of bicyclic arylaminoazines as potent inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase, hydrolase/inhibitor
total genus 147
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5c25A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c25A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c25A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c25A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5c25A05
4C8KA 5J2QA 2ATQA 2R2RA 3LWLA 3SFUA 2EC0A 4DF8A 4B8AB 4WFYA 5KFFA 3MR2A 1HNIB 2F8EX 3FQKA 3FFIA 3N6MA 2VG7A 3KLIA 1RBSA 1KFDA 2F8TA 4MK9A 4FBUA 3GV7B 3GYNA 3NMAA 4FLZA 5J2PB 4WXOA 3OHAA 1SKRA 3HKWA 3AVKA 2IAJB 3B6PA 2AJQA 4KV8B 4N41A 3TAMB 4QWEA 4FJIA 3MECA 4ECTA 3RB4A 3RBDA 2YNFA 2FJWA 3PR4A 2DFEA 1QTMA 4NRTA 3EPGA 1VSJA 4DLGA 4RU9A 4JV0A 1C0TA 1LW2A 3BGRA 4WFZA 4DFPA 3SI6A 2WB4A 4M3TA 3U3YA 2XGQA 1QQCA 2HHXA 1NK4A 2DPIA 2C2EA 4ID1A 2WCXA 1FKPA 1JIHA 1BCOA 4NLWA 1N6QA 3GILA 4JV1A 2JGUA 4EZ9A 2X6NA 3NGIA 1T05A 2R7YA 1RA6A 3RMBA 2FVPA 3DRPA 4GMJB 2JC0A 3OYJA 3ZSWA 4I7FB 1RDRA 2FVCA 1D5AA 3CDUA 1A5XA 3CDWA 3KMQA 2C28A 3AVAA 3TANA 5HP1A 1QS4A 3BSOA 3QIDA 4O3SA 1KCFA 4MK7A 1HMVA 2BDPA 3CG7A 4FS2A 2HVHA 3V1OA 3HSTB 1JLCB 1RDAA 2IBKA 3CM6A 3DLRA 2FJVA 4NCBA 2VG5B 2OPRA 3M8SA 2RF2A 1EETB 3ICLA 4W5OA 5F8NA 4RNHA 3QEXA 2HHTA 4DSIA 2XO7A 3LALA 1DTQB 2XGPA 2BE2A 5KFPA 1EP4A 3AVNA 3CJ2A 4Z4HA 5CZ2A 3ZT1A 4FJKA 1TKTA 4DLEA 3NH2A 4IQXA 3EYZA 4DSLA 1KTQA 3NF9A 4K8XA 4CHNA 4CGHA 3SQ2A 3VQEA 1J5OA 3QINA 4ED7A 3QERA 1QHTA 3SUOA 1TGOA 3V6HA 2YNIA 1X9MA 2HHVA 5KG0A 1U04A 1TKZA 3NF8A 2QKKA 2XI2A 4MH8A 1RCHA 2G8IA 4KHUA 3OS1A 2JEFA 3FRZA 4RW9B 3OY9A 2AGPA 1NK9A 4YMEA 2YKNB 3NCIA 2B6AB 1F21A 4M3WA 5JS1A 4ZPBA 4IG0B 3GQCA 2ITGA 1NOYA 4I2PB 4NYZA 3DYAB 1KVBA 3DDKA 3I0SA 5F8JA 1RT3B 3QNNA 1HQUB 1TAQA 3V9UA 4K50A 3ZSZA 3HPHA 2W9BA 3QEPA 1ZTWA 3IG1A 4F2RA 1J53A 4RW8B 3G86A 4O44B 3ZSRA 4FJJA 1HNIA 5KFVA 3CVKA 3OYKA 4DG1A 2PZSA 3KK1B 4GVMA 2LSNA 3SUNA 1IKXA 1JLFA 4YFUA 3KLGA 4J2AA 3HVWA 3OJSA 5J2PA 3QIPA 4KKOB 3SQ4A 2IAJA 2IC3A 1RTIA 2E9TA 1NK0A 3K5NA 2XY8A 3C6UA 3MFHA 4QWBA 4JLHA 3PHEA 4AHVA 3KD1E 2FLLA 1KLNA 4BDZA 3T5KA 2QKBA 1HYSA 1U48A 1NOZA 5DGAA 4K8ZA 1TKXB 1CXUA 3AVGA 3Q8PB 3L3UA 1NNDA 4TQSA 1SKWA 5I3UB 4Q0BB 1NK8A 3L2RA 4OGEA 2VG6B 1K1QA 2GBZA 4NCGA 4IDKA 5DLFA 4HYKA 3HP9A 4TY8B 1JKHB 1TQLA 3AVHA 4I2QB 3NBPB 3CJ3A 3DOKB 1L5UA 3NHGA 5FDLB 2XHBA 3IS9A 4DTMA 3I0RA 1TK0A 2IJFA 1D1UA 4FJMA 3AV9A 3V6JA 1BI4A 3AO3A 4E7KA 3MEGA 1TKDA 3L2UA 2G8WA 4WYWA 1QSYA 3HVAA 4FBTA 4NLVA 5KFEA 3Q8QB 1GX5A 5KFRA 4EYHB 3AVMA 1LWEB 3DLEA 3K5OA 4RW6A 4DTPA 4ECYA 2G8KA 5F9LA 2R8IA 4BWJA 4CFBA 4Q8EA 3EY1A 4JS4A 2XY7A 3UDLA 1S6PB 2E6MA 1WNEA 4Y3CA 2D5RA 2G8UA 3L2VA 4OVLA 4M3ZA 3QESA 1S9FA 4KTQA 4ELVA 4E7LA 1IM4A 1WSJA 2IGIA 3T1AA 2QE5A 4CF8A 3MEDA 4ZHRB 1JLEB 4F3TA 3QGHA 1S0MA 2UVUA 3OYNA 4CCHA 1RYRA 4ZPAA 5KT2A 1SH2A 2R8GA 1NK7A 1EX4A 4QAGA 3LP2B 1ASVA 4KREA 4B3OB 4F4KA 4O3QA 3ASMA 2HW3A 4PUOB 5CZ1A 4ZPDA 3CFOA 3DLGA 1Q9YA 2YNGB 2YKNA 4NLGA 2GV9A 4IG0A 4R5PA 2OH2A 4ECVA 2ATLA 4FJNA 1VSDA 4IR9A 4BE2A 2E9RX 4DU4A 5J2QB 1I6JA 3U6FA 3ZT0A 1S9EA 1JXLA 2XRIA 3ZSQA 3MR3A 5DQGA 1RBVA 4O44A 3F73A 5KFBA 3V9SA 3FFIB 4DFMA 2VG7B 3KLIB 1QE1A 2HWIA 5KRTA 2DPJA 4FLTA 1IH7A 1WAFA 2HNYA 1EKEA 3QEWA 2B5JB 2XWYA 4IKAA 4KHMA 5KFUA 4FM2A 3TR8A 4H54A 3ITHA 1NHUA 2YV0X 4DQIA 1D8YA 3RAXA 5KFMA 3AA2A 1DTTA 4ZVFA 3MECB 4DTJA 2YNFB 4GC6A 4CJVA 4ICLB 4M45A 3HO1A 2VA3A 1C0UA 2ILYA 5DK5A 1LW2B 3BGRB 4RW7A 4CE9A 3SCXA 3S3OA 4FJ7A 4FLYA 4FJHA 4Q0BA 5F8LA 1K6YA 4YR2A 4HKQA 3PR5B 2VG6A 1N6QB 4N56A 4TY8A 3TI0A 2VA2A 1RNHA 2EHGA 1T05B 2X6SA 2AX0A 1RT6A 1NJXA 3NBPA 3KNAA 2Z1HA 3OS0A 3CJ4A 3DOKA 2KFZA 4CJFA 3CQ8A 4B9VA 4ED8A 4OPJA 3ALYA 3NGDA 2RPIA 5HP1B 1GOBA 3Q8RB 1HMVB 3G10A 2OZSA 4N76A 2PYLA 5F8MA 2IM1A 3EZ5A 4Q5VA 2R2UA 2OPRB 3DRRA 2IM0A 3GIIA 2RF2B 4M3UA 2R8KA 1SH3A 4YR0A 3GV5B 4RG8A 3I5AA 4NLUA 1RTDA 1L3VA 2ASDA 4DSKA 3DMJA 4ED0A 4WZQA 2W7PA 2OYQA 2WK4A 4JS5A 3SPZA 2BE2B 5CYMA 3DLKA 4EYIB 1EP4B 4DS4A 1ZBIA 5HRSA 3QGIA 1FXXA 3KIOA 1KLMA 4CFCA 4W5RA 2UUTA 2D41A 3OYEA 4J9SA 2X74A 3H40A 3MEEA 2W9AA 4CIGA 2F96A 4PY5A 3L8BA 4LSLA 4J9MA 3BQ1A 1TKZB 3TQ1A 3CM5A 4F50A 4KTZA 3OJUA 2B43A 4O3RA 3OLBA 1XHZA 1BHLA 4F4XA 3SFGA 4IR1A 1YT3A 4HTUA 2FBVA 2QV6A 4FZXC 2AQ4A 5DMRA 1C1AA 4WE1A 3AVLA 4DSFA 1S1XA 1TL3B 3I0SB 4CECA 3ULDA 2IOCA 3OYLA 3PX0A 4L8RB 3AVJA 4ZPCA 1RT5A 3ZT4A 1NKEA 4CEDA 4CHZA 2ZQBA 3RWUA 4FJGA 4EBEA 1SL0A 2W9BB 1QSSA 4TSXA 3TAQA 3IG1B 3VQQA 1S1UA 3HJFA 3LPUA 5SZTA 4DTOA 2WOMA 3PO5A 4KB0A 1HQEB 4OLAA 1UOCA 5L1LA 1NKBA 4KI4A 1SUQB 4QW9A 3M9NB 1LWFA 1RTHA 4DG1B 5HROA 4DFKA 1IKXB 1JLFB 4ED1A 3WNFA 1YTAA 5KI6A 3FQLA 3ZT2A 2HNZA 3KLEA 4AILC 3KLGB 3RB0A 3K2PA 4CGDA 4IH7A 1CXQA 1JLQA 4NLQA 2B5JA 3QIPB 3KK2A 5KFHA 4JUZA 2IC3B 3C95A 1RTIB 1RBUA 3HXMA 2C22A 4JV2A 3C6UB 5DG7A 3FDSA 4OKEA 1HYSB 2OPSB 4AHRA 4NYNA 4W5TA 1C1CA 1JL1A 4EBDA 4O4GB 3NF7A 1I39A 3VN5A 5KFAA 4NLSA 4H4OB 5J2NA 2ALZA 4RNOA 4ICLA 4N47A 5KFLA 4DL5A 5C5JA 4RZRA 5EU7A 4KB1A 4NCGB 4IDKB 3HYFA 1RDBA 4F3OA 1VSIA 3KHGA 3CFPA 4DTSA 4ELUA 3T5LA 2HHWA 4TYBA 3CIZA 1S1TA 5JUMA 4O4RA 3IS9B 1HNVB 3GIMA 3I0RB 3OYMA 1VRUA 3DLBA 2HMIA 4O3PA 1BI4B 4AHTA 5EWFA 3MEGB 4CGIA 1JLGB 4G3IA 2ZD1A 3MFIA 4F8RA 3PX4A 3RMCA 2A1SA 2BQRA 4FW1A 5KG3A 3TAFA 2XCPA 2ETJA 1VSFA 3DLEB 4RW6B 5KFKA 4CERA 5KFYA 4TQRA 1ZBLA 3OLAA 4ECRA 2IA6A 4K4VA 1W9HA 1NK5A 4FJXA 4B9SA 1T03A 4O3NA 3H5YA 4E19A 4LH4A 1RT1A 1S6QA 3CO9A 3WNEA 2UVRA 3PJXA 4I9QA 3MEDB 3MR6A 3KHRA 1C0MA 3PX6A 2OZMA 4U7CA 1S10A 4H4MA 4E1NA 3BQ0A 4KRFA 3EZUA 2P5GA 3AO1A 3DRSA 4ECZA 2V4QA 3SPYA 4NLPA 1U49A 2WRMA 4WYLA 3OYFA 1XWLA 1N4LA 4DFJA 1QUVA 5L9XA 4J9RA 4Y2CA 1BL3A 3T5HA 5E41A 3DLGB 3C6TA 1NJYA 1Z4UA 3LP0A 4R5PB 1GX6A 1ZBUA 1T94A 3SJJA 5KT7A 1TL3A 3QO9B 4LY7A 3BREA 4ECUA 2IMWP 3SUPA 4CJQA 3OSPA 4TY9A 4ECQA 1S9EB 3LP3A 4W5NA 4OJRA 5JXSA 4TN2A 4BDYA 1HQEA 1QE1B 3BQ2A 3TAGA 2KZZA 4C8OA 1SUQA 3BJYA 4GW6A 4CF2A 4KO0B 2HNYB 3SI8A 4QWAA 1JLAA 1IKVB 1FK9A 4KAIA 3BSCA 1VSHA 3ITHB 3TABA 4IRCA 4B9UA 3V81B 2BQ3A 3SYZA 4J2DA 3V9WA 1DTTB 4ECSA 5KFCA 2G8FA 4PA1A 1WSGA 3QIOA 2FJXA 5J2MA 1WLJA 4NLTA 1LWCA 4DTUA 5C25B 4FJLA 3N6LA 2OPSA 1U09A 4J9NA 3KLHA 3OL6A 3PW4A 3V1RA 4O4GA 2R8JA 3VQSA 1C0UB 4RW7B 4H4OA 5C24A 5HLFA 3O3FA 4HUGA 5HRNA 3DLHA 4B9MA 3M8QA 5EWGA 3I5BA 4BWMA 3H59A 2E4LA 3VQCA 3K58A 3ISNC 2Z1JA 4CEFA 5KT3A 3KOAA 3CWJA 2V9WA 1RT6B 4IRKA 1ZYQA 3H98A 4DQRA 4ZP8A 1S49A 4YR3A 1LW0A 1T3NA 1TVRA 3PZPA 1HNVA 5I42A 3LWMA 3O3HA 4CJWA 4XIUA 3K59A 3RRHA 4ZVHA 1JLGA 4R8UA 1HYVA 3JYTA 4OKJA 3PV8A 4CJSA 3O4NA 3OYIA 3DRRB 1GOAA 3S9HA 2Y1JA 3S3NA 2HWHA 2IM3A 4IFYA 5DQIA 2EX3A 1RTDB 4KPYA 3DMJB 2KQ2A 1WSHA 4Y1CA 3KK3A 4DL4A 4DQSA 1KFSA 5CYMB 2FBYA 3DLKB 4X2BA 2XY6A 1QSLA 4CJEA 1KLMB 5F8GA 5KRSA 2R2SA 4LQ3A 2HVIA 4B9TA 2GIRA 4HHTA 3TWHA 4PWDA 2Q3SA 3MEEB 5J1EA 3PUFA 1Z26A 2YNHA 3IGVA 4LSLB 4FM1A 4Z4EA 2KZMA 2D0BA 1TK5A 2DFHA 4NZ0A 3QLHA 4B9LA 2W8LA 4U6PA 1IKWA 4EEYA 5T14A 4ZVGA 5KFZA 3AA5X 4J2BA 4CEBA 2D7SA 2PYJA 1SV5A 4WE1B 4HCCA 1S1XB 3V9ZA 1BQNA 5K14A 1CSJA 1RT5B 3KLFA 3PVXA 3QO9A 4DQQA 1NKCA 4IKFA 3H4BA 3NFAA 1S1UB 1A5WA 1KRPA 1IG9A 5DGBA 4FLXA 4DU3A 2WOMB 4KFBA 3HP6A 1KHWA 1LAVA 3LANA 1NJWA 4ED6A 4QWCA 1LWFB 1RTHB 2RKIA 1UA1A 4DTXA 5HROB 2ASJA 1U45A 2HNZB 3ISND 4KO0A 3KLEB 3N6NA 4YNQA 1S97A 3MXMA 2WONA 3NAHA 2AGOA 1JLQB 1IKVA 4E3SA 4YP3A 4CGGA 3KK2B 5KG6A 4AHSA 1BIZA 2ZKUA 2C2DA 3NF6A 5HBMA 3NL0A 3H5XA 3IGNA 3ZSOA 5FRMA 4KHWA 3V81A 1N5YA 3DI6B 1RT4A 1C1CB 4WFXA 2JLEA 5C25A 5DG8A 4O3OA 3NE6A 3OYCA 1S1WA 2FBXA 5J2NB 2V4RA 3D45A 3PW0A 3VQAA 5EDWA 4O0IA 3RRGA 4RUAA 4IFVB 4HVJA 3V4IA 4CHOA 1TL1A 1YVUA 3BSAA 1GOCA 1WSIA 4M3XA 4Z4FA 1LAWA 1I3AA 3SUQA 1VK0A 4CEEA 2C2RA 3OL7A 1S1TB 3AVBA 3TVKA 5KFIA 3OHBA 4DL7A 4CEQA 3OYAA 1VRUB 4AHUA 3IRXA 2HMIB 4J2EA 3VQPA 2O4GA 3D5MA 1JLBA 2J6TA 1NHVA 2ZD1B 3T5JA 1TAUA 1RBTA 1B9FA 5JS2A 3CFRA 3M8PA 3MR5A 4UQGA 4MIAA 4M94A 3UQSA 4FVMA 1B9DA 2XY5A 2Z1GA 3CJ5A 1DLOB 4JRQA 4FJ8A 3V6DA 4KAZA 4DSEA 4MQ3A 2JEJA 4MKAA 2W8KA 2YHAA 5SWMA 3E51A 4QPXA 1T03B 4AH9A 2RDIA 3VQ4A 1ZBHA 4E7JA 4HCBA 3V1QA 4JRPA 4DS5A 1B92A 1HARA 1RT1B 1S6QB 1BCMA 5KFJA 5KFSA 2KTQA 1L3SA 4O55A 1YVFA 1J54A 4CJLA 5DG9A 5EUHA 4FZZA 4H4MB 3V6KA 2D3ZA 4J9QA 4HUFA 1VRTB 3DRSB 2IM2A 1FKOA 4KHRA 4DL3A 4WZMA 1RT7A 3RBEA 4LD0A 4BE1A 5CYQA 1RDCA 3KKRA 1BGXT 1HPZA 4KE5A 1C1BA 2PY5A 3C6TB 4F4ZA 3LP0B 3NDKA 2OPQA 2W42A 3AA3A 4FLWA 3I8DA 5KFWA 3LPTA 3H5UA 5KT6A 3GV8B 4ZTFA 3M9MB 4CIEA 3I5CA 4CJRA 3JSMA 3CDEA 2I5JA 3DOLA 2B4JA 1RTJA 4CJKA 3SZ2A 5KG5A 3K5MA 3PY8A 2R2TA 1T8EA 5KFQA 4E89A 5DLGA 3AO4A 5KG4A 1JLAB 4J9KA 1FK9B 2R8HA 1UA0A 2JEIA 2JC1A 5KG7A 3KJVA 1T7PA 3V9XA 4ECWA 5KTQA 3H5SA 2YKMB 3AVCA 5L1KA 3HT3A 4FLVA 3HHKA 4CK1A 4IG3A 5J2MB 3E01B 1LWCB 1CLQA 1LV5A 4EZ6A 3DI6A 4CJ5A 3KLHB 3RMDA 3H08A 3ZSVA 5C42B 4IRDA 5C24B 5HLFB 3QEVA 3G6VA 3RB6A 4NLOA 5KFNA 5FROA 3M8QB 1XR7A 2Y1IA 4IFVA 3TARA 4EO6A 3HVTA 4FK2A 3P83D 2J6UA 1RYSA 3NAIA 1SH0A 4PQUB 1LW0B 4KHSA 1WN7A 3L2QA 3Q8SB 4RNMA 4LH5A 4G1QB 5HRPA 1Q9XA 1TVRB 4Q45A 2E6LA 3RB3A 3OYDA 5I42B 5F8HA 1XR5A 1S9GA 4H8KA 4F4WA 1WSEA 2HNDA 1X1PA 4ID5A 1Y97A 4CEOA 3CYMA 1ZTTA 4R8UB 3JYTB 1KHVA 1J9AA 2UUWA 4HUEA 4KSEB 2Z1IA 1C6VA 2FBTA 4OKKA 4MIBA 4B8CA 3TAPA 3ZCMA 4TLRA 4CK2A 3LP1A 4TXSA 1TP7A 3F9KA 1HYZA 2HAIA 1DLOA 1REVA 2J6SA 3UIQA 1BQMA 4IFYB 4Z0UA 3LZJA 1S1VA 2FVRA 4EP4A 1D9DA 1NJZA 3KK3B 3VQDA 4CGJA 3D28A 3CJ0A 4OL8A 4DF4A 2HHSA 4J9LA 4Y1DA 4MFBA 4C8NA 1JX4A 1UWBA 5KFXA 4QOZB 3OVNA 5D3GA 4PWDB 4CHYA 1SL2A 3M8RA 1XHXA 4MKBA 2I1RA 1VRTA 5J1EB 5KFTA 1S0OA 2YNHB 1R0AA 3KHLA 4RW4A 4ZVEA 2AGQA 4GC7A 4KHQA 1IKYB 3QLHB 4QWDA 1IKWB 1KSPA 3HPGA 4OGCA 2HB5A 3LZIA 3S3MA 1RILA 1W0HA 1MU2A 1JL2A 3VQ9A 4FW2A 2UVVA 1SV5B 3RAQA 1BQNB 5K14B 1ZETA 4B9NA 3KLFB 3O4QA 2AWZA 4ED2A 2ZE2A 4ZP6A 1QAJA 4URGA 4KFBB 3G6XA 3EPIA 3RR7A 4O5BA 2HHUA 4KHNA 2G8VA 1TV6A 2RKIB 4J9PA 3DM2B 3U3GA 3HM9A 4FJ5A 3NGZA 5T7BA 2WONB 2AX1A 4CHPA 5HBMB 4M41A 2W9CB 2DFFA 4F2SA 4F4YA 3G6YA 1N5YB 1G15A 4LQ9A 4K4XA 1BIUA 2YKMA 1D0EA 4QW8A 2NUBA 4N5SA 4Q44A 2GIQA 1RT4B 2VWJA 1VSKA 3E01A 1N56A 4E1MA 2P5OA 4FZYA 3D0PA 4NLRA 2F8SA 3OYBA 4E7IA 4FJ9A 1S1WB 1S4FA 4K4WA 5DQHA 4FM0A 3SV3A 2BANB 5C42A 3V4IB 2IJNA 4ELTA 1TL1B 3MXIA 1TK8A 2DTUA 1X9WA 1WNSA 1KVAA 2ILZA 4KV8A 4AHCA 3T3FA 2BRLA 4FCYA 3A2FA 5KGWA 4DWIA 3LAMA 3TAMA 3QZ8A 2QXFA 1X9SA 5L1JA 4M42A 1BISA 3O3GA 3MXJA 3QGGA 4KBIA 2FVSA 1JXBA 1S48A 3SNNA 1SKSA 3VQ5A 4PQUA 3IRXB 4G1QA 1YTUA 2IS3A 1JLBB 4ED3A 4RNFA 3M9OB 4ZMMA 3HK2A 3AO5A 2BGGA 1O1WA 4KB7A 5KT5A 1RDDA 1XI1A 2XI3A 3RR8A 2HHQA 2BR0A 2O4IA 4QCLA 4NYFA 3M8PB 1CZ9A 3AA4A 4I7FA 4W5QA 5HRRA 4M95A 3V6DB 1ASUA 3OL9A 3PJWA 5F8IA 2XCAA 4BDPA 3KLVA 2OPPB 2RN2A 4CJPA 3QYYA 3MF5A 4IH6A 4LSNB 1QAIA 3LAKA 3AVIA 3SV4A 1JLCA 5KGXA 3KMSA 3NKYA 3NGYA 1WAJA 2VG5A 3VQBA 1XR6A 1EETA 3PO4A 1FKOB 1RT7B 3THVA 2IDOA 1DTQA 5CYQB 2CJQA 3VQ6A 2BQUA 4RNNA 1L3UA 1S5JA 3IAYA 1HPZB 4B08A 4M3RA 1IKYA 1C1BB 4OPKA 2RDJA 4RUCA 1RT2B 1UAXA 3B6OA 3UPFA 4CJ4A 2OPQB 4KI6A 2D0AA 2P51A 4DTNA 3SQ0A 3MTKA 4MK8A 2DY4A 5KFOA 4FK0A 4C8MA 3WNHA 1U4BA 2X78A 4IBNA 3JSMB 2GUIA 2I5JB 3DOLB 3UR0A 4RW9A 1RTJB 4Z4CA 4DMNA 4YQWA 2B6AA 4DL6A 4K4ZA 3IN5A 3BDPA 4I2PA 3DM2A 4FLUA 4BE0A 3DYAA 1C2PA 4Y34A 3PW7A 2FC0A 4FK4A 4XPEA 3QETA 4FS1A 2FVQA 2D3UA 1A5VA 3VQ8A 1RT3A 3H2LA 4BACA 1ITGA 1HQUA 4XO0A 3PW5A 4C8LA 4NLYA 3KJVB 5CY4A 3QEIA 4O0JA 3TAEA 4ECXA 3GIKA 4RW8A 3ZT3A 4CF1A 2W9CA 3HL8A 4IG3B 2GC8A 4CIFA 4CJTA 4DL2A 3OL8A 4DEZA 1EXQA 3K57A 3KK1A 5FRNA 4R0EA 5KG2A 3NH0A 2WTFA 4M3YA 1WSFA 4ZTJA 1IO2A 5L1IA 3NAEA 1JXEA 3NH1A 3VA0A 2BANA 4KKOA 4ZP9A 2W7OA 5KT4A 2XC9A 1SL1A 3LDSA 1CZBA 4EO8A 1Q8IA 4OLBA 3OS2A 2YHBA 4K4SA 4NLXA 1XC9A 3HVTB 3AO2A 2KFNA 3KHHA 1L3TA 4EP5A 4K4TA 4CHQA 1TKXA 1VSEA 2OA8A 1K1SA 3OYHA 2A1RA 1D9FA 1C0TB 4FXDA 2KW4A 3KTQA 1VSMA 1W25A 2VWKA 5I3UA 3GIJA 4KTWA 1S9GB 1FKPB 3WNGA 2ASLA 1VSLA 2HNDB 4ID5B 5KFDA 3VA3A 1JKHA 3MAQA 3RTVA 4CF0A 4I2QA 4DTRA 1RA7A 3DRPB 4IH5A 4E0DA 4WXWA 1MMLA 3P5JA 3LP1B 3HVRA 5KG1A 3L3VA 1RBRA 5FDLA 3QNOA 1REVB 3BSNA 3KD5E 3ZSYA 1BQMB 4EBCA 1ASWA 4NLDA 1S1VB 3ZSXA 1N48A 4ZP7A 4NRUA 3PW2A 1ZBFA 3P1GA 4XPCA 2OPPA 5EWEA 5KFGA 1NK6A 4LSNA 4CGFA 4Z4IA 1RAJA 4MFBB 3OSNA 1LWEA 4CJ3A 1UWBB 3H4DA 4CFDA 4J9OA 1S0NA 4CK3A 5D3GB 1Z25A 2E9ZA 4CFAA 3HPOA 4Q8FA 2AU0A 2JEGA 1S6PA 1R0AB 4URQU 3G0ZA 4RW4B 4NCAA 1OS5A 2BRKA 4Z4GA 4CEZA 4DU1A 3KKSA 3T19A 4E7HA 3RMAA 4Y2AA 1TKTB 2UVWA 2P1JA 3SQ1A 4DQPA 4Q43A 4FYDA 3VQ7A 4ZHRA 2WHOA 3K5LA 3BR9A 4URSA 1JLEA 3OYGA 1MU2B 1RT2A 1J5OB 2FLPA 4K4UA 2V0NA 4TYAA 2O5DA 4I9LA 3FSIA 2YNIB 3LP2A 3QZ7A 4KHYA 4B3OA 2ZE2B 4PUOA 4CJUA 2QK9A 2D0CA 3L2WA 4CF9A 2G8HA 3AVFA 4DSJA 1U47A 1TV6B 1HJRA 4CESA 5F9NA 2YNGA 4CEAA 1KVCA 4IOBA 4K4YA 2CKWA 3C94A 1HRHA 2FLNA
chains in the Genus database with same CATH superfamily
4C8KA 4QIFA 3Q89A 2R2RA 3SFUA 1E6VA 1KEKA 3K9JA 3MR2A 4HT5A 1TELA 1XMOK 1HNIB 1N52B 1FE0A 1Y7PA 2F8EX 4FVCA 3KLIA 2NS1B 2GMJA 2YHYA 2U2FA 2BJ9A 4FBUA 3NMAA 5I4MA 2VIHA 3DU6A 3OHAA 5K20B 2ZH8A 4P2SA 3W5ZA 4Y2KA 3M32A 3TSPA 4N41A 3C2PA 3TAMB 4QWEA 3HSDA 5AQRA 4NZ7A 5DDPC 2X3GA 4ECTA 3SIPB 2M88A 3CTRA 3RBDA 2YNFA 2FJWA 4BC4A 1DY3A 5AQTA 2U1AA 2E1YA 4JV0A 1C0TA 1I5OB 2RH3A 1RU1A 4OIXA 4M3TA 4JV5K 2IPOB 2RIJA 2DPIA 3W3DA 4ID1A 1BCOA 2OEKA 2BH1A 2EXUA 4JV1A 3HRGA 3T69A 4A59A 3RAMA 3OXFA 1P1TA 1HBMA 2HK2A 3NGIA 1MG7A 4B3SK 1RA6A 3DRPA 4I7FB 4M5DB 5AXMA 2FSNA 2C28A 3CULA 8ATCB 3ULEB 2C2MB 3BSOA 3R3LA 3R5GA 3BBFA 4GV6A 4MK7A 1HMVA 4OI4A 1X4AA 4FS2A 2HVHA 1R43A 2JH3A 3EDQB 1Q82O 4U67L 2V69A 4JOUA 2VKRA 1NGHA 1JLCB 2QT7A 3MR7A 2QYGA 3CM6A 3T1HF 4ISGA 4NCBA 2VG5B 2RF2A 4ZKAA 2V34A 3ICLA 5F8NA 3MPDA 2H5JB 2E8AA 1VQ9S 1ZC6A 4O0NA 2BE2A 2NXJA 3CIMA 1V5IB 2RJZA 4FJKA 2DGTA 5C2GA 2WC9A 3NH2A 4DR5K 3PNIA 4IQXA 3NF9A 3N0VA 3W9HA 4LF4F 3LPYA 1WC4A 1TGOA 2YNIA 1X9MA 2HHVA 1U04A 3NF8A 1H3DA 3O80A 1RCHA 3FZHA 5HMYA 2JEFA 4RW9B 2XB2D 4YMEA 4DV5K 5JS1A 4ZPBA 2ITGA 1IBKJ 1NOYA 2LEAA 4I56A 4PRFA 3DYAB 4PPDA 3DDKA 4HTLA 1HFEL 3QNNA 3WXJA 5D0RA 5FLXY 1TAQA 4ETZA 4K50A 2W2NP 4YDDB 2CPFA 5HL7L 3QEPA 4F2RA 4OX8A 3ZSRA 3LGMA 3UVJB 2XO6A 4DG1A 2B51A 2LSNA 1WI6A 4LREA 3KLGA 4J2AA 2VU5A 2Z0GA 5J2PA 3LTOA 1HLWA 2IAJA 4KGVB 3KKFA 3VVUA 4AL7A 3MTJA 2MZSA 1SC3B 4JI4J 3C6UA 4JLHA 3PHEA 4AHVA 2FLLA 3DLJA 4BDZA 2EI5A 1O8BA 4DPXA 4JN4A 4YDUA 2OD4A 1U1RA 4H5WA 1G3OA 1NNDA 3HD2A 2LEPA 1IJFB 2OGUA 4JI7J 4CH1A 5DLFA 4HYKA 2OEMA 1TQLA 4I2QB 3US5A 4G9ZA 4CO5A 1UMJA 2P9NB 4P71A 2MLXA 2ZGZA 3DOKB 2Y8YA 4FXWA 2HQGA 1GXLA 4O23A 3IS9A 4DTMA 1K8AT 1C0GA 4Y0FA 4HHJA 4ZIWA 4CT9A 3ENVA 4E7KA 5IWAK 3GIRA 2JVOA 5M1KA 2HOEA 2G8WA 3TZXA 4FBTA 3HX9A 1H73A 3B78A 1LWEB 3EDRB 4CLYA 5IQ6A 2KJWA 3T1YF 4KQZA 2KDOA 1WHXA 2VQFK 1XERA 4JS4A 1R6VA 2E6MA 1HWJA 4Y3CA 2D5RA 1TMMA 3ENAA 3KZBA 4M3ZA 5SUHA 4ELVA 4E7LA 1IM4A 1WSJA 2EKYA 3MEDA 1KQSR 4F3TA 3OYNA 1W7WA 2E7WA 5KT2A 2R8GA 3A8EA 3SMZA 1NK7A 4QAGA 1ASVA 4KREA 2OI2A 3OBYA 1RGIA 4V19J 2HW3A 3PACA 4RL1A 3DKDA 4A2BA 4DV7K 3DLGA 1Q9YA 3JAMY 4NWBA 4K25A 4NLGA 2GV9A 4JI0K 3MM7B 2RE1A 4OHYA 3C65A 4UUWA 1S57A 1KQKA 4B3RF 2ATLA 4YHHF 3T7ZA 4ILMA 3R5CA 4C11A 2DR7A 5G0RA 1NZ8A 2ZBCA 3HDSA 4DU4A 1FWKA 4H0PA 2Q6BA 4X4OA 4UY85 4AXIA 1I6JA 1KD1O 3ZT0A 1HW9A 4O44A 4FWPA 2DEJA 1RP5A 3CMAN 2E44A 4X65K 2DPJA 4EU0A 4CH0S 1WAFA 2HNYA 4PCQA 5AR0A 4USJC 2B5JB 3KJFB 5EOYA 5KFUA 1YX2A 3CJRA 4KGZB 4NI2B 4OZLA 3THYA 3RAXA 3AA2A 3O9TA 1ZM9A 2YKQA 1T3VA 3EZWA 4BRMA 4M7YA 3C46A 3I55S 4ICLB 3HO1A 2IDEA 5HVHA 2ILYA 3SCXA 5C2CA 3RRKA 1GAOA 3GE9A 4FJHA 1U0HB 1XIQA 2HS0A 1K6YA 4RLEA 3PR5B 1GXUA 1WC0A 1PJ6A 4FPRA 3MCMA 1K73O 3TI0A 4WQ4C 3M6UA 1VQ4N 1U02A 2AX0A 1RT6A 2CQIA 4ILLA 1WF2A 2YY3A 1PJ5A 2Z1HA 2JLGA 3O1WA 3UCUP 5E84A 4OPJA 1JCEA 4IO9L 3SBTA 2FD2A 3C14B 4JD2B 4USKA 3E9PA 1VMBA 3NGDA 2WFBA 2VBWA 3WX4A 3ZEUA 3Q8RB 5M1QA 2DK2A 2G13A 4N76A 3HSGA 2W4CA 5F8MA 4OPAA 3ZETA 2IM1A 3CDAA 2AZ1A 3NXZA 3DRRA 2QA4S 2DT9A 2R8KA 1IG8A 1TU0B 4RG8A 4C3MA 5IFMA 4I6MB 1RTDA 2ASDA 2DHGA 4DSKA 4DV2F 2E7VA 2W7PA 1T6DA 3ZTRA 5CYMA 3DLKA 1EP4B 5CQGA 2KRRA 1ZBIA 3VMFB 2BACA 5DDRC 4DR1F 4ENOA 3BO3A 1CC8A 2PDAA 3W61A 4BRLA 1Q5YA 2ZM6K 2J0XA 2DKOB 1TUUA 1YGYA 2AHOB 2W9AA 1N32F 3KNGA 4PY5A 4LSLA 3J7ZO 4KTZA 2E5LF 4U7BA 1XHZA 3OBWA 2ZVIA 2EFPA 3A5NC 2HHPA 3AD7C 4IYQA 2QV6A 1XQSC 1OYEA 4L8RB 3PX0A 3K0SA 3ZTPA 4AM6A 3RWUA 4FJGA 1Y10A 2HLTA 2W9BB 3NGKA 1N5TA 1SJ1A 3IG1B 3TYTA 1T44A 1HQEB 4LFBJ 4OLAA 1UOCA 4JI6F 2CQGA 4QW9A 4KBOA 3P4IA 1JLFB 2L9NA 1YTAA 2CJKA 4EMDA 2HNZA 3KLEA 3FZMA 4CGDA 3A4TA 3QRPA 3MMCA 3ELHA 4IH7A 3VOVA 3QIPB 2CQBA 1Q1KA 3C95A 3CC4S 3TU5A 4CLLA 2ITMA 2A1BA 9ATCB 4PXCA 3D2WA 3OXLA 1V3RA 5DG7A 3FDSA 4LIRA 4W5TA 4GMKA 3WXMB 3MN7A 1I39A 2HGLA 1UEVA 2HBKA 1S76D 3QBCA 2UV8A 4DR7F 5LMUF 3AY0A 3FSXA 3I87A 2E1AA 4DR3F 1VC5A 5EU7A 4KB1A 4C97A 1RWKB 2VH7A 3G87A 3HYFA 1SKUB 1YJ9S 4YY3K 5IC6B 1LOUA 1EAYC 1QTNB 2Z2LA 3JSYA 1NH8A 2FHOB 2QX0A 1EWQA 3G9CA 4LF6F 1QQOA 1WACA 3QMLA 1AXQA 4X62J 1VQOS 1KOHA 2NSCA 2GJ2A 1BI4B 3BGLA 2EFNA 5EWFA 2E7XA 2HVDA 1Z1ZA 4F8RA 2DRDA 4TNOA 1AUSL 3DOMB 3RMCA 1S5ZA 4AUKA 4MLEA 4TQRA 3OLAA 5AQOA 4KHPJ 5GAEI 1W9HA 1S79A 1YHQS 1FDAA 2XS5A 4M5JA 4FNHA 2CQCA 3H5YA 1AW0A 2EBGA 1JCFA 4E19A 2GGPB 2NYHA 4QU7A 3KDNA 4YOXA 2UVRA 3PJXA 2NPFA 1ESVA 4H4KC 4U7CA 1RAOA 2JJ4D 4KPCA 3BQ0A 2P5GA 4M5LA 2V4QA 2G4BA 3BZQA 3RSEB 1X60A 4WYLA 1KAZA 2MJNA 2GJIA 3M6WA 4DV1J 1BL3A 5EHHA 3W8GA 1NJYA 3LP0A 4I68A 2LU2A 4N8NA 4R5PB 4CLZA 1ZBUA 1T94A 4DCPB 1FNXH 3QO9B 4LY7A 2P9GA 4LFAJ 3BEXA 3ZNJ1 2B56A 4CJQA 1WC3A 4TY9A 1S9EB 1V3SA 3N79A 3NMRA 2O8FA 3OR1B 4M5GA 5JXSA 4OJRA 3DLLQ 5IV3A 3BQ2A 1MWKA 4OYOA 3BGFA 2FF3B 4EHTA 3CCMN 3DNCA 1W97L 1OPIA 1VSHA 1G1XA 2QYCA 3TABA 3V81B 1NNEA 3D3CJ 3V9WA 4ECSA 2HSEB 2G8FA 4HEA9 5J2MA 3J7YU 4JYAJ 5C25B 3EXYA 2F4VF 4CD1A 2OPSA 1U09A 3THXA 3UD4P 3OL6A 5M2PA 2R8JA 5HLFA 4HUGA 5BJRA 3W7BA 2E4LA 3MMBB 1C0FA 2P9IA 1H98A 1JQGA 3F44A 2YKAA 3VQCA 4N7TA 3EVMA 3J81U 1N34K 1ZYQA 3H98A 2UUAK 3O8MA 1Y00A 4ZP8A 4LF7J 2V51B 1U8SA 4OI0A 1XBWA 2J7KA 4CJWA 1X0PA 1HKCA 4XIUA 4OKJA 2O01C 3PV8A 3CJCA 4H0VB 4UW2A 3AARA 1ZZFA 1WG5A 1OH6A 2L9DA 1H2TZ 3OYIA 1GOAA 3S9HA 3PIOQ 2ADBA 3S3NA 2V8PA 2HWHA 4WFAQ 2OFHX 3HKZD 4P2MA 3L7UA 2H51B 4DL4A 3WXKA 5JVHL 5FPDA 4OX6A 4DR4K 3SSRA 5H9EK 1UVKA 2Z2YB 4KH4A 1VHXA 4DX6A 4OI3A 4CJEA 1KLMB 5F8GA 2GO9A 3TWHA 1CPZA 2V63A 1UJ6A 1T9VA 4GKJJ 3MEEB 4GV9A 2GVDB 1BA1A 3PUFA 3DDNA 3RBXA 4BVOA 4X4TA 4NZ0A 4B3TK 3KUHA 3OTOF 2W8LA 1EB0A 4K5SA 7FDRA 3AA5X 2ZDPA 3SXLA 4J2BA 4BC3A 4XK8C 2D7SA 4TU7A 1S1XB 5ETLA 3V9ZA 1Q86T 2AIRB 4DV3K 1BQNA 1K8AO 4UOCA 4ZVUB 4DQQA 2D69A 1H74A 3H4BA 1TUWA 3GMGA 4OV1A 3AH6A 1S1UB 1A5WA 2ZNZA 4FLXA 3EN9A 1LWFB 2WUSA 1UA1A 4RX6A 2E5JA 3DGPB 5CHIA 4DTXA 2QEXS 4KO0A 3MXMA 1JLQB 1WTFA 2L41A 4FPBA 4ILJA 1BIZA 1S7IA 3NF6A 5DZ7A 2BKOA 3IGNA 4KHWA 2KVIA 3VF0B 2Z56B 3NVMA 1C1CB 4O3OA 2HZAA 1VQPN 1U0SA 2LDYA 3D45A 4CM0A 2YKOA 1NB2A 2Q79A 4OO1J 5EDWA 5ETPA 4RUAA 2DISA 5D4LA 4XTTA 5LJWA 3V4IA 3HFZB 3I6PA 3TTCA 1H6KX 1GOCA 1WSIA 1I3AA 5JMVA 3ULHA 4CEEA 4A8MP 2L48A 4RPFA 1S1TB 2HRUA 3NRBA 3TVKA 4JI3J 3OHBA 3JS9A 3VGUA 4RKUC 3OYAA 2GS8A 5GADU 2HMIB 4FWNA 3IP0A 1JLBA 1SQEA 2VPZB 2YH1A 2NLWA 2F9DA 1FESA 4H03B 3LA0A 2HQDA 1HBOA 3M8PA 3SSQA 4MIAA 3M2VA 4FVMA 1F2HA 5E3RA 1B9DA 3JQJA 1M90T 3W63A 2HVZA 4CLPA 1W2BR 3V6DA 4KAZA 3O6QA 3UN2A 2YHAA 3HSCA 4C3KA 3VQ4A 4A8WA 5AT1B 1ZBHA 5E33A 3CPWR 1HARA 4P7VA 2JFKA 3U9ZA 3M6VA 2MGZB 3ATUA 3BF1A 3W0LA 5LSRA 1ZA2B 3CCLN 1V5VA 3GYGA 4H4MB 2V50A 1T0TV 1FKOA 2DB1A 4KHRA 1XNQJ 4WZMA 1WKLA 4FF1A 3C16B 1M5PC 2CJBA 5EN1A 4ZOSA 3J7YP 4XH1A 2LQJA 5CXTA 1BGXT 2ZWOA 4K59A 3C6TB 4ISEA 2GVZA 2Q66A 1CC7A 2ROEA 3CJTA 4X66J 4F4ZA 5LJ5Y 3TP2A 2EWHA 4FLWA 3I8DA 1WKKA 3O1BA 2PFFB 1VISA 5A6PA 1WEYA 3C8YA 1VCTA 5LL6d 1SI9A 3I5CA 4CJRA 5D15A 1JJ2R 2FZKB 2QA2A 2WZ1A 2R2TA 1T8EA 2KL8A 4E89A 3AO4A 1NGDA 4D3HA 5KG4A 4DR2F 3KUGA 3JSBA 1FHTA 3J8AA 4KY3A 3MHYA 3NGRA 1YZ6A 2HQFA 4MT1A 1T7PA 3HT0A 4FYYB 3UD5A 3UCZP 4X64J 2CUYA 3H5SA 3AVCA 1CJUA 5L1KA 3HT3A 4K5RA 3K8VA 4CZJA 3FUYA 3DI6A 2BMBA 3KLHB 2PFUA 2QTDA 1FFSB 3H08A 3VESA 4IRDA 3QJLA 4AXJA 2MJUA 5LXRA 5KFNA 2VF3A 1XR7A 2JOQA 2Y1IA 3C6HA 2M0GB 2PO4A 3BF3A 2POKA 4WP3A 5CD4A 2R7RA 2ZJRL 3HVTA 2UUBJ 3P83D 3VCDA 5D0HA 2B9XA 3PFEA 3BYPA 4JI5F 4JKFA 4DR6F 4IJNA 4LF9J 2CPHA 2PFDA 2AEMA 3SEOA 3NAIA 4AFFA 3L2QA 1Q9XA 4RNMA 4F36A 5HRPA 3IWXA 1TVRB 4Q45A 2E6LA 3RB3A 3Q22A 1RWVB 2DNRA 1S9GA 2A6AA 4F4WA 2OSRA 2HNDA 3S7RA 2DIVA 5FIIA 4CEOA 2OAUA 3JYTB 3ENWA 3KFWX 4KH5A 4KSEB 3VGTA 1C6VA 2FBTA 4PG5A 3VAJA 3ZCMA 4TLRA 4DCHA 3W64A 1SIWB 3AJ2A 1TP7A 1G2EA 1HYZA 1FTCA 1GH8A 1BQMA 2D0PA 4Z0UA 1S1VA 2OD6A 4RBTA 2RUSA 3X3UA 3KK3B 3VQDA 3N4WA 4CGJA 3QAUA 4HACA 4H4KA 3SCIE 1F3FA 2HHSA 4MFBA 1YI2S 3SQOP 5AQVA 1UWBA 4QOZB 1XNRJ 3N01A 3N9UC 3OVNA 1ITPA 5D3GA 4CHYA 2CWKA 1XMOF 1TYQB 4MKBA 1I51B 2B4UA 2ZZMA 2I1RA 1VRTA 3HMJG 1YIJN 1W7AA 1UP1A 2DGXA 3M6GA 3OXGA 2VPXB 5J1PA 4OGCA 4KH1B 1MU2A 3VQ9A 1SV5B 5IT9U 4JI7K 3RAQA 3K7RA 3JXUA 4JKHA 2MHEA 3ADAC 4B9NA 3KLFB 4ED2A 4ZVPB 3MEKA 4JB8B 4U67Q 4ZP6A 4DUYJ 4A8FA 1QAJA 3T6JA 2E5GA 4DUZK 3ILOA 2MQQA 5E26A 3RR7A 3N4PA 4JV5F 5GADP 2RKIB 4J9PA 5GIPA 3DM2B 3VR1A 3U3GA 4EFHA 5KOXA 5T7BA 3GB0A 5L8RC 4B3SF 3P49B 4CHPA 4USWA 2F9TA 1B0VA 3K17A 4M41A 5CYJA 1CEZA 4F2SA 2DFFA 4LUBA 4F4YA 3ZZOA 2QGFB 1N5YB 1UZHA 4LQ9A 4K4XA 2VGMA 4Q44A 1HR0F 3S8SA 1RT4B 2VWJA 1N56A 1GK8A 2P5OA 4NLRA 3OYBA 4E7IA 4FJ9A 1QVFM 4K2XA 1S1WB 1IQTA 4B3MK 1S4FA 4A4JA 5DQHA 3SV3A 3IA0A 2QJ3A 1BUXA 1N33K 1GLCG 2PD1A 2O66A 3VQTA 2DTUA 1WNSA 2UZAA 3PCOB 4AHCA 2DY1A 5IM0A 1K0TA 3UW1A 4FCYA 3MD1A 2HBJA 3TAMA 4CZIA 2RS2A 5E5NA 4M42A 1RKJA 4NASA 1FRXA 2XYPB 3VV2B 4KBIA 1YWXA 2NREA 3O9QA 2LU1A 1WWHA 5HL7Q 3QRRA 3OPKA 4RNFA 1BUPA 4QOTA 4DR5F 1ATNA 1VQ5N 4RBUA 1IBMJ 5KT5A 1RDDA 4BRQA 1XI1A 3RR8A 2P9CA 1JNRB 3AA4A 1KS2A 1RHQB 4I7FA 5MLCV 3AAQA 4W5QA 4M5DA 1CLFA 3M8YA 3EUNA 3HZGA 5F8IA 2M70A 2HKEA 4DV5F 3Q2SC 4G6VB 1UEUA 2ZC4A 3KLVA 4UY8O 3P31A 2RN2A 4CJPA 4IH6A 2DNZA 2A5XA 2K06A 4IZ9A 3SV4A 2A0FB 1JLCA 4JP8A 3CGIA 1EQMA 1SQKA 2VG5A 1BC6A 1XR6A 2P9KB 2COLA 3D1OA 2VPWB 1FO1A 2DNPA 3ZTOA 3RZAA 2W2QP 3THVA 2VOPA 2MYFA 3R7NB 2CJQA 2BQUA 2I2YA 1GQEA 2J9CA 3IAYA 3KHYA 4YB6A 4OPKA 2RDJA 1U2RA 2HK3A 1MMNA 3IFRA 3B6OA 3UPFA 1RDUA 2DITA 1VBYA 4KR0B 2J8SA 3C15B 3R2CJ 3JSRA 2X7IA 2JDJA 2LCWA 4K7QA 4C8MA 3WNHA 4LVOP 2X78A 3PYFA 3P5BP 3D6FB 2GUIA 2I5JB 3MN9A 1X4HA 3UR0A 4RW9A 2UU9J 3NG8A 3RU0A 1MN7A 1NGGA 3DYAA 4Y34A 1RK8A 4XPEA 4MDAA 1U26A 4A8KA 2VD3A 2V2ZA 4P74A 3Q0AA 3KJVB 1VJQA 3VEOA 3F5TA 1VDHA 3AY9A 7AT1B 2WVCA 3ZT3A 2G1HA 2BJ1A 1EKSA 2F65A 1VQYA 3AOAA 5ELZA 4CJTA 3AD9C 3CJBA 4DEZA 1EXQA 5IWAF 1OIAA 2LMIA 2P6TA 4DMZA 2VFUA 2MKSA 4PYAA 1IO2A 2K2PA 5L1IA 2JVRA 1U1QA 3BZKA 3HI9A 4DI6A 5KT4A 4ID8A 4PXBA 2XC9A 3LDSA 4OLBA 3OS2A 2VQFF 4K4SA 2VV5A 2KFNA 3QT5A 1N0UA 4K4TA 5AQIA 2OA8A 3DXMB 1D9FA 1C0TB 3D0HE 4FXDA 3VF6A 3KWIA 2P2CB 4H5NA 1Q86O 3FRYA 2VWKA 4KTWA 2I8EA 1B99A 3NS5A 4B17A 4ZJQA 1MDUB 4L3KA 5FJ4A 4I2QA 3P3DA 3J81Y 3DRPB 4IH5A 2P9NA 3MDQA 3LP1B 1TZ0A 4G65A 5KG1A 1CULA 1RBRA 4TU8A 2IBOA 1C4CA 1E3MA 4DV7F 1ASWA 4LFBK 2GCFA 2XULA 4JI0F 3U1NA 4ILGB 2ASOA 4ZP7A 2OPPA 2FY8A 1RAJA 4DX8H 3OSNA 1LWEA 2CNLB 3CJQA 4CJ3A 4NO7A 4NZ6A 3H4DA 1FWPA 5BR8J 3JTPA 1YRUA 4U7UD 3VAGA 3VEYA 4Q8FA 4C23A 4OYIA 2OKQA 1VFJA 4X65F 2QN6B 4OV6A 1QAYA 3FZKA 2EBEA 4Z4GA 4CEZA 3KKSA 2DTJA 1OSCA 2A3JA 3R9LA 3SAGA 4NEZA 2EK1A 4DV4J 2JLFA 3SSSA 3CC2S 3H3NO 4M7XA 1OYDA 2WBMA 2Q1NA 2QEXN 5ADZA 4IO9Q 1YJWN 1B4SA 2VGNA 2M8DB 2YNIB 3R7SB 5ITHA 4KHYA 3HD1A 2EK6A 3QJJA 2ZDOA 2ZE2B 4CJUA 3S01A 4ZDNA 2G8HA 2YQ3A 1HBNB 4DSJA 3R5JB 4YOWA 1T11A 4X62K 1GXTA 4ZK7M 2AYBA 3KJQB 1M90O 1KVCA 1X5TA 2FZGB 4K4YA 4F3MA 2QFJA 2MEWA 3EWGA 2CQ2A 3A3OB 2XZTB 2LA4A 2QW9A 1DQAA 2EC0A 4DF8A 4WFYA 2MQOA 5KFFA 2CZ4A 3FQKA 4NYPA 1UVLA 4KHPK 3N6MA 1VQ6N 3O5TB 3CCSN 2RILA 4ZCKA 4MK9A 1F9FA 3GV7B 4FLZA 5J2PB 4X4NA 3IM9A 2MZTA 3R27A 2AA4A 3AVKA 2IAJB 4WP9A 2PMWA 1XJWB 2K3IA 3B6PA 4NI2A 2MDAA 2AJQA 2UUCJ 3MCOA 2K7KA 1O0PA 1UL3A 4OHVA 4BR5A 2EFVA 1QTMA 1KXPA 3MWTA 2MSSA 4DLGA 4CTAB 4C1NK 4CBUA 4DFPA 2WB4A 5CHCB 4OMFG 3MM8B 1QQCA 1U0HA 2C2EA 1WHYA 4NLWA 4BG9A 3GILA 4NA1A 2ZM6F 4EZ9A 1F9EB 4AQYJ 5U47A 2NXCA 3PRDA 3WIVA 2FVPA 5HSPA 4LFAK 1SIZA 3T1HJ 3ZSWA 3TJ9A 4F0HA 1RDRA 4L73A 2FVCA 5K9FA 1HX1A 3ZZZA 2PIIA 3WX8A 3R6LB 1A5XA 3A0IX 3CDWA 5B0DA 3AVAA 4WP8A 3VF4A 1BQXA 2OEJA 3CEDA 3CD6N 4RUHA 5C0YA 2V5HG 3QQCD 1IV0A 1BOTO 2VBYA 4CO1A 4YOYA 3TZZA 2IBKA 2GZOA 3DLRA 2Z8QA 2FJVA 1SJQA 3Q83A 5BRHA 1EETB 1ATRA 2P9SA 1HUXA 3D54A 4I6MA 4B9QA 2BOAA 5B0FA 4DSIA 2XO7A 3LALA 1DTQB 5AE3A 5KFPA 4CWBA 1NM1A 3SK3A 1EP4A 3AVNA 2CRLA 2FDNA 4S0MA 5L9NA 2ZWHA 3ZT1A 4Y6IA 1TKTA 2DGOA 5IV4A 1UVJA 2BW7A 4PXDA 4Z7CA 4CHNA 2QMUB 3GP9A 3SQ2A 3VQEA 1J5OA 3QINA 4WCEL 2IVNA 3QERA 2EG1A 2LECA 1DEJA 2YWHA 1ZPWX 1K47A 3FZBA 5KG0A 2QIFA 1NDKA 1NGBA 4MH8A 1FE4A 5IC4B 4DPWA 2AGPA 2RB7A 1NK9A 1NSKL 2YWKA 2BW2A 2KXFA 4WBFA 3GQCA 4I2PB 3BZCA 1VJWA 3P38A 3AJ1A 3I96A 1HL6A 4YY3F 3SAFA 5GAHU 1HQUB 4FPAA 4DUTA 3ZSZA 3HPHA 3GFHA 2W9BA 1EKRA 1ZTWA 3IG1A 4O44B 4FJJA 4BRFA 1HWIA 2HMPA 5KFVA 1VQ7N 5GINA 1CJVB 3K2YA 4GVMA 1JLFA 5ETOA 4O8UA 4YFUA 1VK3A 3O9RA 1WG1A 3HVWA 4CD3A 3QIPA 2DEIA 4KKOB 4JI8K 2FJAB 2E9TA 1NH7A 3BPSP 3ZZTA 4R79A 2XY8A 3PEJA 3KD1E 1U48A 1NOZA 5DGAA 4K8ZA 2YXLA 3AVGA 3P4UB 2IIRA 1DHMA 3Q8PB 4UUXA 2CFXA 3PYGA 2FIUA 2YPZA 2JWLA 4WF9L 1J2VA 2CH6A 1K1QA 1NDLA 5B8HA 3HP9A 3AVHA 3ATVA 3CJ1A 3T1YJ 2W41A 1L5UA 3OR2B 2XHBA 1RWNB 5ETQA 1RAEB 4HTIA 1UVNA 2IJFA 1Y64A 3A5MC 2V8DA 5E3CA 3AV9A 3V6JA 1BI4A 2YH0A 5IT0A 3AO3A 5AQPA 2DJWA 3L2UA 4WYWA 1QSYA 1RU2A 3AGRA 5KFRA 3L4IA 3AVMA 4DTPA 3M30B 4FYXB 2HQIA 2ZUAA 5F9LA 4BG8A 4BWJA 4Q8EA 4HHHA 5AQXA 2XY7A 3UDLA 1WNEA 3OUYB 2AV5A 3UE2A 3VGLA 2GGPA 3QESA 1PILA 4ZPWR 1PAUB 2IGIA 3T1AA 3KWMA 2J76E 2QE5A 4CF8A 4ILHA 1JLEB 2ZBQA 2UVUA 1VQLS 2HSTA 4KIAA 4CCHA 3SDEB 4XDDA 2W2OP 1S22A 4ZPAA 1SH2A 2VC0A 3LP2B 4A8YA 3MUMP 3RSEA 3CCRS 3ZTSA 2YX6A 4F4KA 3ASMA 3G4SS 4PUOB 4MO4A 3CFOA 2Y8WA 3VWSA 4NOHA 4H5RA 1R0BG 2HBZB 2YCHA 2V68A 4RBVA 4IG0A 3NNAA 4R5PA 2LA6A 1TFWA 5IT9Y 2YWEA 4F4AA 1VSDA 4LJMA 3VGKA 1N34F 5LT5A 3FBBA 1KQGB 2UUAF 5J2QB 1DT9A 3PYDA 4DN9A 1S9EA 1Y3JA 1VQMS 3JXOA 3HJVA 1RBVA 4WKRA 3V9SA 3FFIB 5JICA 1A7GE 3EGZA 2HWIA 1KQFB 1PKUA 4W4MA 1EKEA 3QEWA 1VOMA 2BEFA 3K8WA 2VJUA 4FM2A 3TUZC 1RCXB 2YV0X 2EEYA 3OW2R 1JXVA 3FC9A 3MECB 2AKWB 3PSIA 4I67A 4FOEA 4CJVA 4M45A 1S72S 1YUWA 4DV0J 5DK5A 1LW2B 3BGRB 4DR4F 4CE9A 4X4RA 3RYLA 4FJ7A 4YR2A 4X4VA 3MWPA 4JKEA 3OFHA 3MMBA 3H46O 2VG6A 4ZS6A 1N6QB 2QTWA 3VERA 2VA2A 3SLCA 2EHGA 1DFDA 3MDFA 2X6SA 1NJXA 4JKDA 3W2VB 3KNAA 2KFZA 1QY7A 2CJXB 4B3TF 3AAWB 3MUTP 2B9WA 2RHSB 3I31A 2M3DA 1GOBA 4M8LA 1SVDA 5EVZA 2GAHC 1FDNA 4DV3F 1WEXA 2XEXA 4CLKA 4JI1K 3KXDA 4H5TA 3EZ5A 2RRBA 4JI2J 4F3QA 2ZH7A 5GAHP 2R2UA 2OPRB 1CS4B 4OX9K 3H1VX 4XAKA 3GV5B 4NLUA 1L3VA 2RMLA 2HQCA 2BE9B 4GKKK 2FYXA 2Q6CA 4EYIB 4DS4A 5HRSA 4XEIA 4IOXA 1FXXA 2AJFE 1KLMA 3LGNA 2XNQA 2UUTA 3OYEA 4M5IA 1DURA 4H0XB 4FPIA 1NLVA 3MEEA 2Z58B 3M4XA 2GVDA 4WFNL 2HYIB 1A0OB 5GMKa 1R27B 1TKZB 4F50A 4LF9K 1Q16B 5LY3A 2B43A 3OLBA 1SJFA 3IC1A 4PPZA 4I6YA 3E66A 2UXDK 4FOIA 2FY1A 1C1AA 1S1XA 3O6WA 5E3AA 1PBAA 5B0BA 2OLWA 4ZPCA 1B70B 2FJDB 1NKEA 2ZQBA 4EBEA 3M5RA 1SL0A 3TAQA 3VQQA 1S1UA 3CJ7A 2G2YA 2ASMA 3UE5A 1I1GA 2O8FB 4DTOA 3PO5A 1NO8A 2I9SA 3WHIA 2ZF5O 3M7VA 5L1LA 4KI4A 5HMWA 2DNQA 1LWFA 2JSXA 3QATA 3DGPA 1RWXB 4ED1A 5KI6A 3EO3A 3ZT2A 4PG4A 2NNWA 1GLJO 5LMUJ 1JLQA 4NLQA 5H1SQ 4USVA 5KFHA 4DR3J 2QRRA 4PKGA 2IJRA 3FSYA 2IC3B 3HM8A 1RTIB 5KPRA 1AA1B 3OTCA 4P10A 1ELOA 3GG1A 1XNRK 4KJIA 1UPMB 5BPNA 3CC7N 3VAHA 4OYAA 1FXLA 1OVYA 2OPSB 1WUAA 1C1CA 1UZDA 1X4CA 2DNLA 4NLSA 4RNOA 3CMEN 1NRKA 2ZH6A 4DL5A 2QO3A 1NZAA 2HG4A 3IMQJ 1M1KO 1Z2ZA 5EY4A 2YVSA 3TSUA 1SB6A 1LKZA 4A46A 2V2KA 1JJHA 4GV3A 1U1KA 1S1TA 1HKBA 2P8IA 3I0RB 5AXNA 4BC2A 4DUYK 2HMIA 4JK7A 4OYWA 3D1HA 5AQFA 3MEGB 4PYDA 1AYEA 2I38A 3PX4A 1H72C 1Z6RA 5DS7A 5FPMA 2EG2A 2HS3A 1LXJA 2ETJA 4RW6B 4CERA 4C1NI 3MAAB 2XLJA 5KFYA 4NLCA 2R7QA 3QFWA 2FLOA 4B9SA 1FRIA 3BDEA 3O4WA 2AF6A 3M8WA 2ZJRQ 3J7YI 2OELA 4LH4A 3CO9A 3WNEA 4LR7A 1Y9OA 3CCUN 2MGZA 1C0MA 5HAOA 3U7JA 1RSCA 3AFGA 4H4MA 4E1NA 1P1LA 3B8AX 4KRFA 1R0CB 2V6AA 1U49A 2WRMA 2AJ1A 2RVJA 3OYFA 3C16A 4ALZA 2RUGA 3CHWA 4DFJA 2Q0RA 2ZWPA 3PRBA 3T5HA 3C6TA 5E3PA 3R5AA 4A62A 2BJDA 2ZBPA 2RQCA 1TL3A 2FQQB 1IBMK 4IUFA 2IRYA 3LPEA 2IMWP 1U2CA 1N5VA 2G2OA 4ECQA 3DCAA 3LP3A 3MGJA 3PXGa 4RWWA 1SUQA 4CF2A 4KO0B 3SI8A 4QWAA 3BSCA 2KVQE 4XH5A 1BY9A 4IRCA 1QM9A 4B9UA 3FMBA 3BM7A 1MN9A 2G0JA 4J2DA 2AYGA 2H65B 1DTTB 1VBZA 3BPDA 5KFCA 3MD3A 3UB5A 4QZVB 1M1GA 4XDCA 3CCQN 1F9HA 3GJSB 1RCOB 4J9NA 3KLHA 4O4GA 3VQSA 1MLAA 4YB1P 3PIOL 4H4OA 3B6BA 3O3FA 3BY5A 3DLHA 5HRNA 4WIQA 4B9MA 5EWGA 3VZIA 1M5VC 2CGJA 1HPMA 1PCAA 4NXMJ 3F2KA 1R31A 3K58A 3CMAS 3UKUA 3CWJA 4JKCA 1S49A 3QSYB 1YJNN 1F0XA 4LR8A 1TVRA 3PZPA 3FGUA 3KVGA 3K59A 4YDUC 4ZVHA 3SQGB 1JLGA 4JI7F 3JYTA 2LFVA 5AE1A 1WUUA 1OWXA 1NBEB 3O4NA 1SQFA 3R7BB 4FYWB 3EZOA 3R6GB 3MURP 2XMAA 4DUZF 3J80U 1M5SA 3GR0A 3OFGA 3DMJB 4Y1CA 4CLFA 4IOAL 1UJ5A 4RO0A 3KK3A 1URRA 1U2FA 3U27A 4DQSA 5BREA 1TUVA 4C8ZA 3POTB 1QSLA 1NSPA 3FCHA 3BYRA 2IYGA 3W3SA 2GIRA 4HHTA 2Q3SA 2KHOA 1TYQA 4C0BA 1UETA 2HHHJ 2ALYB 2X1GA 4KC5A 3TA1A 1ZM3A 2KZMA 4H5VA 1TK5A 2DFHA 2AEJA 3JQMA 4B3MF 1S12A 2XZWA 2VCPA 1N33F 4CZHA 4EEYA 4ZVGA 3CF5L 5KFZA 1RWOB 1HHSA 2PYJA 2F7TA 1SV5A 4WE1B 2JNJA 2E1CA 5LJVA 4HCCA 4F02A 1X8DA 3GBTA 1WI8A 2KFYA 4CZMA 2DNKA 1RT5B 3KLFA 4OYPA 1NKCA 4IKFA 4LF8K 1HNWK 4FWQA 1OO0B 1KRPA 2GQCA 5DGBA 2WOMB 1QQMA 3HP6A 4U7UK 2L3MA 4QWCA 1RTHB 2RKIA 5HROB 4QIGA 1K9MT 3ISND 2CGKA 4YNQA 1S97A 3NAHA 2AGOA 3TO8A 3KK2B 2MKYA 4CGGA 1FXDA 1HNZK 4AHSA 3PKMA 2YI1A 4W98A 3NL0A 2GJFA 3ZSOA 1N5YA 4UF4A 4JKAA 4IJAA 3DI6B 5F1XA 1RT4A 4WFXA 1K44A 5DG8A 4O5FA 1NHKL 3TW0A 3F9MA 1S1WA 5J2NB 2IY5B 5I3PA 3DDIA 3PW0A 2GAGC 4LBPA 4ES1A 4GVLA 4CHOA 1YVUA 1YBAA 1IQZA 1WSRA 2DNMA 4M3XA 1FT8A 1KR4A 3Q8YA 3SUQA 1VK0A 2DR6A 3AVBA 3J7A1 5KFIA 1VK8A 3QDKA 4DL7A 4CEQA 3MZIA 5F2RA 1JK9B 4J2EA 1WG4A 1NGJA 4ZLNA 2O4GA 3D5MA 3DWLA 5A8KB 1DJ0A 2ZJQL 2ZD1B 1GTEA 2XMVA 5JS2A 1FXRA 3WEEA 4F26A 4UQGA 1C4AA 1FFWB 4JEPA 1M1HA 3CJ5A 4KGKA 4JRQA 2DHHA 4X4QA 2DNGA 3I4PA 2EVZA 4MKAA 4ER8A 1T03B 1EIYB 4AH9A 1OQ6A 2RDIA 4HACB 1YK9A 2E2OA 3TTDA 4E7JA 4P75A 4OZNA 1D8ZA 1UTAA 1BCMA 1RISA 2RD5C 4O55A 3O9UA 4M5KA 3WUHA 3CJ8A 5DG9A 2P9KA 2X51A 2UUCK 1VRTB 3CQXA 5D78A 1HA1A 1NPPA 3RBEA 1MROB 5GAGI 2Y0SD 1RDCA 1N5SA 3KKRA 2NZTA 4KE5A 2YKPA 1R3NA 2XS7A 4DPYA 4ZCMA 4CZCA 3R2DJ 4WYBA 3P5TL 4DR2J 2FHJD 4OZ1A 3WQTA 3C15A 1LFWA 4AQYK 4NXNJ 4ZTFA 4UOHA 4CIEA 4CIOA 3CDEA 2I5JA 4CT8A 2B4JA 1SPBP 4Y2IA 4KH6A 3EE3A 5DLGA 4LF5K 1WSVA 1JLAB 3W8PA 4J9KA 1FK9B 2R8HA 2IYIA 2JEIA 2D0OA 5E3QA 4V1Ak 3KJVA 3CSKA 3I4HX 3ENHA 2G1DA 4ECWA 2KO1A 5CCMA 1YITS 4FLVA 3U02A 4JI5J 1LWCB 4EZ6A 4DR6J 4LFBF 5EX0A 1V6HA 3UCGA 1BLUA 1XUPO 3QEVA 2ROPA 3MOJB 2ZITA 3M8QB 4J9UE 5HQ8A 4QS9A 1HNXK 5IM0B 3H25A 3FLCO 1WC1A 3PKYA 4EO6A 5A2QU 1ZPVA 2WW8A 3IR5B 1CG2A 2PSZA 2FB0A 2MZQA 4AM7A 3CCMS 2PMZD 2CGLA 3E3XA 1IBLK 4L75A 3LH2S 3DXMA 4MDBA 4LH5A 3L7PA 4GVBB 5I42B 2YPYA 1FFGB 1XR5A 4ZA1A 2MQ8A 2R3VA 4FKXA 1WD6A 1N36J 2UXCK 4UQTA 2ZVSA 1ZTTA 3T9ZA 4PXEA 2AP6A 2GIFA 2UUWA 4HUEA 3HHLB 4AT1B 4OKKA 4B8CA 4CK2A 3LP1A 4TXSA 5HJXA 3FFKB 1XMOJ 1FRKA 3CCWA 2FGCA 1HR0K 3LZJA 1MWZA 4X62F 4EP4A 3OV7A 1D9DA 4LF1A 1TL5A 3KK7A 3D28A 3CE8A 1FRHA 4NA2A 2RE2A 3K0JA 1FNOA 4LBHA 2FSJA 4LR9A 4DF4A 3CETA 2V8VA 1Y0HA 4PWDB 3FNNA 4JKBA 2J9DA 4KHPF 4EK2A 5J1EB 3ZNUA 3KHLA 2RQMA 1QDUB 2AGQA 4A5AA 5A8RA 1AZSA 3ZFVA 3IR7B 2C2OB 3GYXB 1KSPA 4CLUA 3LZIA 2QLWA 1RILA 1Q8LA 1FJCA 4YB7A 1JL2A 5BN9A 2VFVA 3CO0P 4B3SJ 2JWNA 3GCXP 1DGKN 5CAAA 2ZE2A 3G6EN 3GLJA 4KFBB 2QI2A 4E8UA 1HBNA 2HHUA 2G8VA 4A57A 3PEHA 3AQPA 3DN9A 2PI4A 3G71N 1RGVA 2DNNA 2MHNA 3BO4A 3VZHA 1I3OB 2ZC3A 3D68A 4LFAF 2E88A 3LDLA 5A0YB 5GAEU 3G6YA 1G15A 2YKMA 1D0EA 4QW8A 2NUBA 4MJKA 1NMNA 2GIQA 2A42A 3UKRA 1YVNA 4WCEQ 5M2RA 4MMOA 4DQ8A 2YHXA 4BRGA 3GE1A 4V19S 4QS8A 3I9ZA 5C42A 1WB9A 4AE5A 1LFPA 3H7HB 2WTUA 5MAOA 3MXIA 1KVAA 1HBUB 1X4BA 3T3FA 2IVPA 5HK4A 2XLIA 2KI2A 3C66A 1VQKS 2LKZA 4ATNA 3KUEA 1GLAG 1UAWA 2CQ1A 3O3GA 3MXJA 3QGGA 3L4BC 1JXBA 3KWGA 3OQ2A 1S48A 4CTAA 1NDPA 2VQEK 3CDBA 1YTUA 4DHVA 4K42A 4YUDA 3MM8A 5F41A 4M5NA 4C8YA 4ZMMA 2QL9B 4KB7A 2V94A 2XI3A 2HHQA 2O4IA 1TFYA 2VL1A 4ZN1A 1CULB 1VQPS 1V3ZA 2F4FA 2BVZA 5HRRA 4USHA 1YJTA 4I64A 4J37A 1OH8A 3TZYA 1KVIA 2B4VA 4CZEA 3NMUA 2ASYA 2QLBB 3FK4A 2OPPB 3S41A 3QYYA 3MF5A 1HLUA 1O6XA 1QAIA 1EO1A 3LAKA 2Q43A 3R8YA 3AVIA 1ICEB 3KMSA 2NRVA 3AAPA 3OTEA 4FWMA 1WAJA 4BRCA 3MX2A 2FHMA 4WF9Q 1EETA 3SJHA 5JJBA 2L9WA 2AT1B 2B0GA 1WHWA 3EICA 2IDOA 1DTQA 3H42A 3DXSX 4WKYA 4CDIA 4PG6A 1S5JA 1NLKL 1IKYA 1C1BB 1YZ7A 4DV0K 5KPTA 4JI8F 4TU9A 1J5EK 2CWXA 1F5AA 1UAXA 3G25A 1WC5A 4KI6A 2B7CB 3FKBA 5KAKA 1RI7A 4HR2A 2DY4A 1FI4A 3Q24A 4FK0A 1ZXOA 3P8BB 2G0CA 4QYZK 5K8NA 3C3LA 3B4MA 3JSMB 4Y00A 1PC5A 3DOLB 1FJ7A 4UZBA 1RTJB 2EFGA 2BM0A 2H5IB 1Q7YO 2MQNA 3CCLS 5FLXO 4I2PA 2WVDA 4I1TA 3EE8A 1C2PA 3MI7X 3PW7A 2FC0A 4FK4A 4FS1A 1A5VA 2D3UA 1NGIA 3WXIA 4GO7X 2R7OA 2X1BA 4BACA 1ITGA 1HQUA 4XO0A 2Y1RI 5CY4A 2ROGA 4F9OA 1NGFA 4JI2K 4ECXA 2VQFJ 3GIKA 4X4SA 2W9CA 4IG3B 4CIFA 1CJVA 5KG2A 2DGUA 3CUNA 3R5DA 2WTFA 1Q8KA 5LMNK 1GMWD 4ZTJA 1NPRA 2J0SD 1N8RT 2BANA 2XLKA 4KKOA 3PM9A 3D1QA 1SL1A 1W2IA 2YHBA 3D7EO 4WFBL 1AFJA 4I4BA 4OZ0A 5M1FA 3KHHA 4DB3A 3H6EA 1VC0A 4EP5A 4CHQA 2J0QD 2O8CA 1RAGB 1K1SA 2CVIA 1UWAA 2CQ0A 4FF4A 2KW4A 2QFIA 4DV7J 2QLJB 2W01A 2ASLA 3HHLD 1VSLA 4RCHA 3BN7A 5KFDA 3VA3A 4FWSA 1IXKA 2YHWA 4CBWA 4DTRA 1RA7A 1U6FA 3EVWA 4E0DA 1IBCB 3L3VA 3OR2A 4P2XA 3QNOA 1K9MO 1REVB 3SBGA 3KD5E 4EBCA 3AJDA 4NLDA 4RTFD 2R7WA 3U9DA 3SCLE 1N48A 2QXLA 1ZBFA 4XPCA 4YN3B 4BHQA 5BPMA 4LFCJ 3GPAA 4LSNA 1Q81T 4WPAA 1JCGA 4B1ZA 4LRDA 3M30A 3T9NA 2ZHAA 4J9OA 1YKWA 1S0NA 3LDOA 2P9SB 2Q31A 2E9ZA 5AZJA 2HGMA 2Y1LB 4FSVA 3J80Y 5GAEP 5DJBA 2EPIA 2B8PA 4URQU 4RW4B 3G0ZA 3OUYA 2BRKA 3BBBA 4A5BA 1TUYA 2EFOA 4U95A 2GHWA 4Y2AA 5T41A 1TKTB 3SQ1A 2FTRA 3VQ7A 1JLEA 5EGYA 1GT8A 2B4PA 1RT2A 4HTJA 1J5OB 4K0KK 1Q95G 1EQ0A 4K4UA 2V0NA 2GMLA 5C12A 3SDEA 2Y9HA 2O5DA 2E1PA 4I9LA 2ZBRA 3LP2A 4L3NA 2R7UA 2YJFA 2HRTA 2KHCA 5L46A 3V5RA 2GELA 4PUOA 2QK9A 3BN4A 3HBTA 2D0CA 2GEMA 2MMYA 3R6MA 4CF9A 3BV8A 3AVFA 4EI2A 4CESA 1M5HA 2BXJA 2EWSA 2HBRB 1RQ0A 4IOBA 5H9FJ 2P9PA 4YOUA 4B1WB 2W6LA 3ZZPA 3L3CA 2CKWA 3C94A 1YIJS 2FLNA 1HRHA 3AB2B 4BROA 2YBVA 3QNWB 5DM7L 1DAXA 5J2QA 3LWLA 2ATQA 3IBWA 4Q7AA 4L3QA 3NWRA 2VBXA 2BV3A 3MM6B 1AB8A 2DO0A 4WU2A 3FFIA 4CO4A 1RBSA 1KFDA 4CZLA 1RFQA 2H48B 4WXOA 4WFNQ 1RHRB 2D1CA 4JI1F 2CQHA 1U1LA 4C4WA 4OX9F 1VLYA 5HANA 4IEEA 1YQHA 4U8YA 3MECA 3RB4A 5E7OB 2DD8S 4GKKF 1BXNA 3TSQA 2RSQA 3PR4A 2DFEA 1ACMB 2FZCB 4NRTA 3EPGA 4A8SA 1LW2A 3BGRA 4B1YB 3BH6B 4WFZA 4TLQA 4M5HA 3U3YA 2NZCA 4K2JA 1NK4A 1P90A 3GFXA 5LSOA 3GJQB 1FKPA 3WZ0A 1P9YA 5BRDA 1N6QA 4FN5A 2JGUA 3RUBL 3NCQA 2A40A 5ETRA 2R7YA 1ZM2A 3RMBA 4GMJB 3OYJA 5IS2A 3W2VA 5GAHI 4LF9F 1D5AA 2OTJN 3WC2A 3EMTA 3CMQA 4W90B 4J5OA 4M63C 3LL3A 4IDHA 1QS4A 1G6BA 2UXDF 2XHWA 2BDPA 2AYEA 2ZH9A 2IIHA 1I94K 3V1OA 3M1FA 2CDQA 2QZ8A 1RAFB 2OPRA 1CS4A 5LJ3Y 3M8SA 4BRDA 3X1LB 2PI5A 4K8RA 2IHR1 3GTYX 2ACMA 5IQQA 3QEXA 2ATCB 4L72B 3NOGA 3SCKE 2C3UA 4FP9A 1VQ5S 2XGPA 3CD7A 2RQKA 4Z4HA 2UXBJ 1S4EA 2E20A 1ULRA 4DLEA 1VQ8N 3EYZA 4DSLA 1KTQA 3C0BA 2KXNB 1XNRF 4CGHA 1VIOA 4OZ5A 4BRHA 3IRWP 1QHTA 3SUOA 4NXMK 1FJGJ 1TKZA 5F0XA 3OS1A 2RU9A 1YITN 3OY9A 4AF1A 2YWWA 2XYGB 1RWPB 3NCIA 2B6AB 1N0VC 4IG0B 4OI6A 3VAFA 4ITSA 1RTZA 4QR2A 3E1YA 4N8OA 1ZBTA 5KQ8A 3PHTA 5F8JA 1OY9A 4EUVA 3V9UA 1S7HA 2HVEA 2ZZTA 4PL8A 4J9VA 3D6RA 2BUPA 1QJHA 3AOBA 2QG9B 1J53A 2XMWA 4DUYF 3HHDA 1V4SA 3NEKA 2V52B 2VFRA 3OYKA 1HI8A 1X5SA 4QIEA 3THPA 3UDEA 3KK1B 3N28A 2QSWA 3OJSA 3CNQP 2R7XA 4DL0C 2CH5A 2IC3A 3GG4A 1RTIA 4I6AA 2BE7D 1W26A 1NK0A 3WT0A 2K3KA 4TVAB 4CH7A 1KLNA 2Q2RA 2QKBA 2HHHK 1CXUA 1KC8T 5AXKA 3S1TA 2MXYA 5I3UB 1U25A 2DNYA 1RWUA 4IEIA 4OGEA 2VG6B 4WTOB 3ZC4A 4ANCA 1UFKA 3OVSA 5A2QY 3CJ3A 1M5KC 3UN5A 2XMKA 3LM9A 2LXUA 3R97A 4Z94A 1P9QC 3NHGA 3DXKA 3I0RA 2XSJB 3GFZA 4NEYA 5C15A 3LDPA 4ISFA 2DHSA 2V8GA 4HL9A 4USIA 1UEKA 2CVEA 3G8QA 1FWLA 1HWKA 3MEGA 1REGX 1TKDA 3P96A 3UNYA 3M2RB 1UFWA 3LO3A 1KD1T 2LXFA 2F40A 2F9JA 3Q8QB 5KFEA 1IBMF 4EAHD 2N4CA 4H0YB 2XQCA 4EYHB 4RW6A 3MAAA 4IQMA 2N82B 2QL5B 3EL2A 2AD9A 4BC9A 3HHLC 3Q8VA 4CO0A 3MCPA 1S6PB 2E5IA 2C3PA 2G8UA 5D0EA 4IWVA 4KTQA 2GUPA 3VAIA 3VEVA 3E8OA 3FEZA 4ZHRB 2WB1D 4FYVB 1S0MA 2V9KA 3QJPA 4ED4A 1VLOA 5D4OA 3F41A 1RYRA 1N34J 2CPJA 1NAQA 1EX4A 3K9KA 3MPYA 4B3OB 1YAGA 3RW7A 2O8EA 2D9PA 2YWGA 2Z57B 4DCJB 5CZ1A 4ZPDA 1K73T 1APSA 3A3NB 3LGHA 2YKNA 2R7SA 2KKHA 2OH2A 4FNIA 4FJNA 1RKIA 4IOAQ 4A8QA 3GR1A 4IR9A 2ZEJA 4BE2A 4OI1A 2WVBA 2FHJA 4BRNA 3TA0A 1VQKN 1JXLA 2M4MA 3ZSQA 1H2VZ 3MR3A 3F73A 5KFBA 2R7VA 4DFMA 2VG7B 5CD4H 2E66A 1YJWS 5KRTA 1KAYA 4FLTA 4WJBA 3CCTA 1IH7A 4USTA 2XWYA 4USUA 3MWBA 3DHWC 2FHKA 1NHUA 2MKCA 1D8YA 4MO5A 3ZLJA 3D9BA 4CW7B 3MOZA 3M1VA 1NU0A 2J8AA 1DTTA 1LCUA 3CF5Q 3RBZA 2KM8B 3JS6A 5G4DA 4OHXA 2JRSA 3GZ7A 3MMAB 5D4PA 4B3TJ 2ZJPL 2VA3A 5IXUA 4FLYA 4Q0BA 2A3ZA 1PG5B 5M2UA 1H7XA 4N56A 4DV3J 4TY8A 1ROFA 2BJ8A 1VQ6S 3OT9A 3R9PA 3CCSS 1T05B 4J7CA 3NBPA 1X4DA 2CQPA 2M7SA 2OFGX 3IMXA 2PEHA 4NXNK 1IM6A 4ED8A 2O8DA 5B0CA 3OA9A 3HHNB 1PYSB 3GWCA 3ALYA 1Q8BA 2CA9A 5HP1B 1RWWB 2HBMA 3SQGA 1HD1A 2OZSA 4CNYA 2PYLA 3VAKA 2C3OA 1NSQA 4CVNE 4LF8F 4AL6A 1HNWF 2VC1A 5AZIB 1FX4A 3GIIA 1Y11A 2MLYA 1RHJB 4YR0A 1N8RO 5CZXA 2XM3A 3DMJA 4A8OA 1K8KA 3D2EB 2OYQA 2WK4A 3ISZA 3PDNA 1MW7A 2CNOB 1XMQJ 4OYMA 3H2VE 3POTA 5GVQA 3KIOA 1FVSA 1HNZF 2AYMA 1FA0A 4QQBA 4CYUB 4CFCA 3MM9B 4W5RA 2AMCB 2D41A 3H1QA 3PTWA 3ET6B 5AQQA 4C6AA 2X74A 3CD6S 1P8ZA 3H40A 4CIGA 2ZJQQ 3F0NA 4DZ6A 3CXCR 3L8BA 4RWXA 4J9MA 3BQ1A 3TQ1A 3I56N 5AQJA 1XMBA 4WK3A 4DV6J 1EARA 1VS3A 4U96A 3A12A 2VB6A 3TX8A 1BHLA 3SFGA 1KOOA 4HTUA 1WOPA 2FBVA 4LT6A 3Q7CA 1SZ2A 1LWXA 4DX7A 4WE1A 1N36K 5AJ3J 1TL3B 3I0SB 1FNMA 2IOCA 3OYLA 2NRWA 1RT5A 2NYIA 2SXLA 3ZT4A 4CEDA 4QPTA 3B82A 3TNVA 3D4JA 5FPNA 3HJFA 1F2GA 3U1LA 3B8HA 2WOMA 4KB0A 1RADB 1Q81O 1SUQB 1RTHA 4F25A 5HROA 4DFKA 1IKXB 2M52A 5K8PA 2WSEC 3WNFA 2VONA 3CCEN 1QVGR 4KRWA 1BWFO 4AILC 3K2PA 3RB0A 4BR4A 3ZXWA 5M1NA 3KK2A 2Z4PA 3RG6A 2RRNA 1HYSB 1JL1A 4EBDA 4O4GB 3NF7A 3VN5A 5KFAA 1RE1B 4H4OB 5J2NA 4DXLA 3DGVA 4RZRA 4NCGB 4IDKB 1G4CA 4F3OA 1HQ2A 2DGQA 2UUCF 1HD0A 2HFZA 3OBIA 4ZJLA 3CFPA 1VQ7S 5LXYA 3UKUB 1LK5A 1U2VB 4M63A 1NB7A 2HHWA 2CPEA 4TYBA 1FD2A 3CIZA 2ERRA 4JNEA 2VZ9A 5JUMA 4O4RA 3HZEA 3ENOA 4YORA 3DLBA 3GL1A 3D66A 4CGIA 1JLGB 5A8KA 1IBKK 2ZKTA 2ZD1A 3H90A 3NNHA 2GHVC 3DJCA 4FW1A 3UD3P 2CJYB 5KG3A 4ZVOB 4AQYF 3I82A 1VSFA 3DLEB 2D9OA 1MWQA 1OQ3A 1ZBLA 4ECRA 2IA6A 4K4VA 4FJXA 3FVYA 1FEHA 1T03A 2VFTA 2Q36A 4RR5A 2A18A 4LF5F 4RUBA 1Z05A 4OZJA 3O3LA 4CLTA 2E5HA 1CJKA 3PX6A 5CA5A 4JI4K 3UO0A 3CCZA 3AO1A 4ECZA 1E4GT 3SAHA 4HH0A 4NLPA 1KVJA 3LW5C 1MROA 4ES2A 2AJ4A 1N4LA 3TVZA 1GLLO 4Y2CA 2C2ZB 2I7PA 3ILIA 1Z4UA 1HNXF 1R6YA 3DFEA 3SJJA 4ZCLA 3BREA 1BA0A 4OLOA 1AT1B 3TJ8A 4ECUA 2V7YA 2YX7A 3NCRA 1IBLF 1OY8A 1VHFA 3R5BA 1Y4ZB 3QFUA 1QE1B 2KXHA 2YWFA 3G82B 3M3ZA 3TAGA 2KZZA 2CPYA 4GW6A 2UXCF 2E1MC 2CQ4A 1JLAA 1FK9A 4KAIA 3M2UB 4UZCA 3O44A 3FZFA 3ITHB 1T9WA 3PG9A 1K0VA 3NNCA 4F0MA 3OHRA 2BQ3A 3CJKB 1IR0A 2P9UB 2HS4A 2QM1A 4MLHA 4EFAC 3CCJN 1WSGA 2FJXA 2NRRA 2WSCC 4NLTA 1LWCA 3N6LA 3PW4A 3V1RA 3D6MB 3HSJA 2UP1A 4KH0B 1C0UB 4RW7B 3A8IA 3M8QA 2BA9A 4FVUA 4BWMA 1GMWA 2VODA 1T9TA 3HFKA 2KG1A 4MKYA 3Q2TC 2FUG9 1RAHB 3ID8A 2NLXA 4J8FA 1WBBA 3Q8UA 4RJVA 4CEFA 5KT3A 1B0TA 1V4TA 4YR3A 2HF4A 2DR8A 2OTLS 1CQMA 1QHAA 2GV1A 1PYTA 1T3NA 1FD8A 3CD5A 4DUZJ 1HNVA 4GVBA 1X3NA 3BEGB 5I42A 5DZ6A 3LWMA 4IFEA 5AFUH 3O3HA 3WIUA 3L6QA 1AUDA 1JWWA 3CCVN 2PE8A 4LRAA 3WEEB 3BKTA 1VQNN 3HHLA 1UPPA 4CJSA 2XS2A 1GLBG 2FXUA 1X4EA 2IM3A 2EX3A 4KPYA 5D0GA 2P6SA 3R1LA 5D6GA 1X3MA 1YBUA 1KFSA 2FBYA 4B3MJ 4X2BA 1N33J 5AQHA 2XY6A 3BH7B 2OUGA 1IR1A 2R2SA 4LQ3A 3TA2A 2HVIA 2KH9A 1KC8O 2WW4A 4PWDA 4JBCA 1G7CB 3N5BA 3SBMA 5J1EA 4FKYA 2PAVA 4Z4EA 1WF0A 1SJ4P 4HVZA 4B9LA 4U6PA 3NVKA 5F0UA 1ZBSA 4G1PA 5T14A 2DH8A 1IWGA 2ACYA 4CEBA 3M05A 4HDHA 4PG8A 3JB9k 4YOVA 3PVXA 2AW0A 2HIYA 1RLCL 4DU8A 1Q5VA 1CJTB 3NFAA 4A47A 4OFZA 1U24A 2NRZA 4H0TB 4DU3A 4Y65A 1NDCA 4KFBA 3DRXA 4PWUA 2VQEF 1RAIB 3GFYA 1NJWA 3IO1A 2XMMA 5A8WB 2J5AA 3D0IE 4CZFA 1IKVA 4LFCK 4PABA 2J9DE 2NRXA 1LXNA 3Q23A 4DPTA 5A0YA 5FRMA 4DHYA 2QA4G 4QBUA 2JLEA 2F8MA 3NE6A 4EWTA 4HLBA 4NB4A 2FBXA 2F1FA 2GW8A 3VQAA 3D7SB