5C25A

Crystal structure of hiv-1 reverse transcriptase in complex with 6-((4-((4-cyanophenyl)amino)-1,3,5-triazin-2-yl)amino)-5,7-dimethyl-2-naphthonitrile (jlj639), a non-nucleoside inhibitor
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE, P66 SUBUNIT
publication title Discovery and crystallography of bicyclic arylaminoazines as potent inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase, hydrolase/inhibitor
total genus 147
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5c25A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c25A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c25A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c25A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5c25A05
2HNZA 4CJWA 5KFIA 3B6PA 1N6QB 4IQXA 2HMIA 2FJWA 1JLFA 5I42B 1TL1A 2I5JB 1QS4A 3GV7B 3F9KA 2XCPA 3DLRA 2IM1A 2BANB 5JS2A 2KZMA 3H59A 2WB4A 4MIBA 2FC0A 1HNVA 4B9VA 1BQMA 3SUOA 3ISNC 4XPEA 1SH2A 2P5OA 4RW6A 3KJVA 2O5DA 2HWHA 4F3TA 4MH8A 1C0UA 3V81A 3KHLA 3P5JA 5F8LA 2AJQA 4KO0B 4NLQA 4NZ0A 3V6JA 3TANA 5L1KA 5KTQA 1W9HA 4RNHA 4NCGA 2DY4A 3G6VA 4Q43A 1U45A 1NJZA 3T1AA 2V4RA 3I8DA 3LP2B 4J9OA 5FDLB 3SFUA 4YMEA 1O1WA 2DPIA 2VWKA 3DM2B 1RYRA 3M8PA 3L2RA 3MR5A 3OYNA 1WN7A 3ZT4A 2E4LA 2GUIA 2P51A 3FDSA 4CCHA 4OPJA 1S9EB 4YR3A 4F2RA 2IJFA 5J1EA 4EYIB 4L8RB 4CK3A 3A2FA 2DFEA 2GBZA 4DSJA 4DLEA 3ITHB 1LWEA 4CGIA 5HLFB 5C25B 2YNHA 1LAVA 2GC8A 2Y1IA 3TAFA 4ZP9A 2QE5A 4I2QB 5DQGA 3CM6A 3L3VA 3AO1A 4DG1A 1RT3A 3OYJA 4LD0A 3PR5B 3DI6B 3RMDA 3D28A 2W9BB 4ZP6A 4N56A 3KMQA 3NF8A 4ZP8A 4FXDA 1T3NA 3DYAA 4OVLA 3CM5A 4H54A 4DF4A 1LW2A 2D0BA 5J2MB 1RDRA 5KFLA 1NKBA 4MK9A 4Q44A 4RW8B 1RT6A 3H4BA 3TAQA 3M8SA 3NKYA 1KVCA 1SL1A 3OSNA 5KG3A 3JYTB 2YKMB 4J9SA 5KFUA 2D7SA 3L3UA 1WSGA 3CG7A 2EHGA 4TYAA 3PW4A 2F8SA 3PW2A 5KFGA 4EBDA 1NK0A 1JXLA 4FLVA 2DFFA 2AGPA 3AO3A 1LW0B 3OYGA 3OHBA 3KKSA 1NOYA 2UUTA 2W7PA 1FKPA 1KHWA 3FFIB 3WNHA 1SH0A 1RT1B 4PY5A 3KHHA 1XC9A 2FJVA 2W9AA 5KFAA 4QWAA 3EZUA 3DLGA 1QHTA 4GW6A 1GX5A 1K1SA 3IN5A 4JRPA 1NJWA 4MK8A 4QOZB 3ZT3A 3AVBA 3KK1A 1TAUA 1UAXA 4GC6A 4IKAA 1VRUA 3C6TB 2EX3A 3H08A 4IKFA 2YNIA 5KFMA 1TV6B 4ECZA 3BQ2A 4ZHRB 4FBUA 2D0AA 3KNAA 3QYYA 3BSAA 4B8CA 2G8FA 1ASUA 4O3QA 1XR5A 1S1XB 5C42A 1CLQA 3NMAA 4M95A 2UVRA 3WNGA 4KHRA 3RAQA 3QEVA 4OKJA 5HRPA 3L2WA 4KKOA 1JLGB 2OZMA 4QAGA 2E9RX 3AA4A 4CJKA 1ZTTA 2YNGB 4K4TA 4DSLA 1IKWB 1N6QA 3V9WA 1HQEB 4EYHB 1JLAB 5KFJA 5KI6A 3VA0A 5I42A 4JS5A 1C1BA 2I5JA 2OPSB 2G8VA 2YNFB 3C6UB 5KFTA 1YT3A 4NLVA 5EWFA 3VQ7A 4NLYA 1SH3A 1BGXT 2UVVA 4ECTA 2RF2A 3NDKA 3VA3A 4KHUA 3BGRA 2R8JA 1HARA 4DTPA 4DLGA 4HUEA 4FLYA 4DU4A 3OVNA 4E19A 2V4QA 1SV5B 1NK6A 1XR7A 2HHQA 2QKBA 3T3FA 2HWIA 3PJWA 2P1JA 3AVNA 4IG0B 3UR0A 4H4OA 1TK5A 3O3FA 2PYLA 4OLBA 5E41A 2F8TA 3OS2A 5I3UB 3RB4A 1A5XA 1VSKA 5HROA 3CFPA 3KD1E 3I5CA 2ZQBA 4K4YA 1ASVA 5FRNA 4DL3A 3RTVA 4O44B 1J5OA 4O0JA 3HHKA 1JL1A 2KFZA 4WZMA 4FYDA 4NRUA 4O3PA 4RG8A 5KGXA 1BIZA 1TKDA 4WZQA 4NLOA 3OYFA 4CJ3A 2QV6A 5CZ2A 3ZSZA 4CGDA 1TKZB 1NKCA 1DTQB 3K2PA 5DQHA 2VG5A 2IC3A 4NYFA 3ZSXA 2X78A 2W8LA 4CHNA 3V4IB 2HNZB 3RR7A 4K4XA 1R0AB 4YQWA 4DSKA 5C25A 5KFCA 3E51A 3AVAA 4ED3A 4OPKA 1JLFB 3KKRA 1TL1B 4I2QA 4Z4CA 1KFDA 3DDKA 4AH9A 3SZ2A 3SQ0A 3K58A 4CJVA 4CIEA 4NCBA 1RBRA 3DI6A 3NGYA 5KRTA 4C8OA 4NLUA 1HNVB 4DSIA 2NUBA 1WSIA 4M3WA 4RW6B 3KJVB 2X6SA 3VQ9A 3V81B 3VQ8A 4GC7A 2VWJA 1WAFA 1KHVA 3ZT0A 4FJNA 4FJIA 3PJXA 4J9QA 4FZZA 3AA2A 4W5RA 3JYTA 1U49A 4NCGB 2V0NA 4ZVEA 1S9GA 1IM4A 4ECYA 3SUNA 1NK8A 5KG7A 4I7FB 3U3GA 3MTKA 1RCHA 1HMVA 1TK0A 4NLXA 5HBMA 2R2RA 3N6MA 4DTSA 3S3NA 1LW0A 3H2LA 3PV8A 4Y1CA 5K14A 2HNYA 1LWCA 1K6YA 1QAIA 5F9LA 3IGVA 1ASWA 4BACA 4DQIA 4CJTA 4FLTA 4E7HA 5J2PA 3K5NA 3DLKA 2HB5A 4CGGA 4ECXA 3NCIA 1HNIA 3AVCA 3CDUA 4B9NA 2B43A 3DLEB 1C0TB 5KFOA 1QAJA 3V1OA 1LWEB 5KG1A 3O4NA 2YNHB 4M3XA 4TQRA 4BE2A 3H5XA 4MK7A 4CESA 4DG1B 1D5AA 5KFHA 1RT3B 1RBUA 1VSEA 4HUFA 5DMRA 1HRHA 4KI6A 4ZHRA 4ELVA 5DLGA 2UVUA 3EYZA 3MEDB 4FJ9A 1ZBLA 2Z1HA 4FM2A 3DYAB 4DF8A 1VSDA 4FJJA 2HHVA 1LW2B 4JV1A 3PY8A 4LH4A 4RW4A 3PX4A 1RT6B 2WRMA 3TAGA 2QK9A 1EXQA 4OGEA 4URQU 1RDDA 1RA6A 3QESA 4FJKA 2HHWA 1L3VA 3CDWA 1IKWA 4TXSA 1NK9A 5L1LA 4ECQA 5DGBA 1JX4A 4ELUA 4Q5VA 3KLGA 2B6AA 1WSEA 2HVIA 2YNFA 4G1QA 2W8KA 4BDPA 4R5PA 1RT7A 1RYSA 4CEAA 3BSCA 2O4GA 3EZ5A 3LP3A 1S48A 3HVTA 4CK2A 5EWEA 3PUFA 1SV5A 5KGWA 1FKPB 1K1QA 3IAYA 4HHTA 1XI1A 1VSIA 4KTQA 2Z1GA 4F8RA 3OLBA 2HHUA 3RMAA 1IH7A 3K59A 3QLHB 5J2QB 4ZMMA 4QCLA 4M41A 4TN2A 4ZP7A 4BE1A 4I9QA 3KK1B 1QQCA 3HL8A 4FJXA 3QIPB 1VRUB 4LH5A 4CE9A 1U4BA 3DLBA 4J2BA 3O3HA 5CZ1A 4DQSA 4DQRA 4R8UA 3T19A 1CXQA 3OYEA 3RB6A 3VQAA 3FSIA 4X2BA 3KLHB 5C42B 4FLUA 3M8RA 2ASJA 4OKKA 2XC9A 4FJHA 4GMJB 1TAQA 3T5HA 1A5VA 5KFNA 4KKOB 2G8KA 1KLMA 3JSMA 3V4IA 4B08A 4WFXA 1ZYQA 4KRFA 4CJRA 1R0AA 1RDAA 2GIRA 3AVIA 3D0PA 2FBTA 5KT3A 1C1BB 4CHPA 2FVPA 4BDZA 3BR9A 5SWMA 4DU1A 4CHYA 2X6NA 2OYQA 4QWBA 2W7OA 4K4WA 2RF2B 3IG1A 3VN5A 2AWZA 3BGRB 3T5JA 5EUHA 3AO2A 4WFZA 3V9XA 3CJ4A 2RKIA 3LPUA 4W5OA 3I5BA 2Y1JA 3LZJA 4NLTA 4DU3A 4MIAA 4HUGA 4DTJA 3TAEA 3MR2A 4H4OB 4U7CA 4CEBA 3KTQA 2IBKA 1S0NA 4ED6A 3NGIA 1IKYA 5HROB 4KBIA 4I7FA 2CKWA 3Q8QB 3WNEA 4K4UA 4CGJA 4KHQA 1J5OB 1S97A 4WXWA 3Q8SB 3V9UA 3EY1A 2R2UA 4M42A 3OS1A 1RTJA 1B9DA 1W0HA 1GX6A 2XO7A 1IKXB 3AVGA 4CIFA 3IGNA 4Q8FA 1RNHA 1RT5A 4FS2A 2VA2A 1TVRB 4O4GB 4DTUA 2WHOA 1U47A 2VG5B 2IC3B 1Q9YA 3NFAA 1C6VA 1HPZB 3GV8B 4CEQA 2DTUA 1JIHA 1JLQB 2C2EA 3DLEA 1C0TA 4IH6A 3GV5B 3GYNA 2ZKUA 4RW7A 5KT5A 1A5WA 4OKEA 4PQUB 4F2SA 3NBPB 4CGFA 3UDLA 3KOAA 4CFCA 4TQSA 1L3TA 4O0IA 2OPRA 3MEDA 3RMBA 1VSFA 2Z1IA 5JS1A 3DMJB 3L2VA 2IM3A 3LZIA 2B5JB 3FQKA 1BCOA 4DTOA 4I2PA 4NLGA 3QEPA 4KHNA 4CF9A 2IGIA 4NRTA 1HJRA 2OA8A 1J9AA 3PW5A 1BIUA 1UOCA 4YFUA 1SL0A 1BL3A 4ZPBA 4AHCA 4DSFA 1S9GB 3KHGA 3HVWA 3MXJA 4MFBA 4B9MA 1HMVB 4DMNA 2KZZA 5DG9A 1YVUA 5HBMB 2YHAA 1ZBHA 4K8ZA 4UQGA 2JC0A 1RBVA 2VG6A 4CEFA 4O55A 3LANA 5K14B 2HNYB 1LWCB 1U04A 1GOBA 4CF1A 4F4XA 2A1SA 1Y97A 3G0ZA 4AILC 4HCBA 4RNMA 3MFIA 3QIDA 4HYKA 5J2PB 3DLKB 4M3UA 3KLIA 4Y1DA 1HNIB 3QLHA 5J2QA 4LQ9A 1BISA 2R2TA 2JEFA 2I1RA 4J2EA 1HQUA 2ASLA 3QIPA 1N5YA 3I5AA 4C8LA 1S1WB 5EWGA 3QGHA 1MU2A 3SUPA 5EU7A 2OH2A 2D5RA 2J6SA 4K4ZA 3H4DA 3THVA 3T5LA 3SQ2A 2E6LA 3KLHA 3MEGA 2ZE2A 4NYZA 4DL6A 1XHXA 4RW4B 3OSPA 4KHYA 1RAJA 4CFBA 3M9MB 3VQEA 5HP1A 4CEEA 1RTIA 3V6HA 3QNNA 1IO2A 1TL3A 3K57A 2FVQA 2BQ3A 5KT2A 4DL2A 3ZT1A 3ZSVA 4MKAA 3MAQA 3CDEA 3KLGB 4RNNA 4QWEA 4J9PA 2B6AB 3KK2A 4FS1A 4AHRA 4B9SA 4G1QB 3AO5A 4R5PB 2D0CA 1RT7B 3MR3A 3AVJA 1BI4A 3OYCA 3LPTA 4Z4HA 3HVTB 1MMLA 2XY5A 4KV8A 3LALA 3O4QA 4B3OA 1FXXA 4IFVA 1HYSB 4CJFA 4LSLA 3EPIA 4FLXA 3D5MA 4ID5A 4DL7A 2EC0A 1KLNA 4EO6A 3OLAA 1TKXA 4FBTA 3L8BA 5KFZA 5C24A 2KW4A 4NLWA 4HVJA 2JC1A 2OZSA 3VQPA 3QZ7A 4ZPDA 4AHUA 1EX4A 2JEIA 2BDPA 5C5JA 4DS4A 3GILA 1N56A 1QE1A 3M9OB 4IH5A 4YP3A 1JKHA 1NHUA 4Z4FA 1NHVA 1EETB 3IS9B 3ZCMA 4JUZA 4DWIA 4R8UB 4KREA 1I39A 1IKXA 4N41A 3VQBA 3LAKA 5CYMA 1ZETA 3LP0A 4K4VA 1TVRA 4O4GA 4RW9A 1RDBA 4WE1B 4F50A 4XO0A 3KLFB 4N47A 4DTNA 4DTRA 4E0DA 4KB0A 1GOCA 1KLMB 1HPZA 4KSEB 3JSMB 3HJFA 4NYNA 4C8NA 1JLQA 4QW8A 1EP4A 2BQUA 5HRNA 4C8KA 4Z4IA 4E1NA 1S1VB 4FK4A 3TAPA 3KD5E 2XCAA 3KMSA 5CY4A 2J6TA 4EO8A 2E9ZA 4PQUA 2W9CA 5DLFA 3NBPA 3V6KA 1JLBB 2ILYA 1ZBUA 4Z4EA 1ZTWA 3V9ZA 3IG1B 2O4IA 3FRZA 3H5UA 4DL4A 3QO9A 3DMJA 1NK4A 4ZVHA 2RKIB 2IJNA 1VSLA 3VQSA 1S6PA 2B5JA 4DFKA 1RA7A 4M94A 4CHZA 4EBEA 5D3GA 4MKBA 4NLSA 1RBSA 3ULDA 4ED0A 2G8HA 2IMWP 3DRRA 2R8IA 1VRTB 5HRSA 4O3SA 1IKYB 4Y2AA 3SPYA 3AV9A 1SKWA 3OYMA 4EP5A 3OYBA 4PWDA 2WOMA 1T03B 2ASDA 4JLHA 3HVRA 3Q8RB 4I9LA 3NAIA 4ZPAA 1NOZA 1RTJB 5T14A 2FBVA 4B8AB 4KFBB 3RB3A 2IM2A 4G3IA 3CYMA 1RT5B 3UIQA 2OPQA 4NLPA 3OY9A 3NAHA 1YTUA 2XRIA 1D1UA 5F9NA 1RBTA 1DTTB 3DOKA 3VQQA 5F8HA 2BE2A 4FZXC 3ISND 3RAXA 1KTQA 4B9LA 1W25A 2AX1A 4J9LA 3VQCA 1B92A 4K8XA 3HYFA 1S1WA 4N76A 4RW7B 2CJQA 4LSNA 4ZTJA 4FW2A 2VG7B 1L3UA 1EKEA 5F8NA 3CFRA 3AVKA 2BQRA 4LY7A 1L3SA 5KFPA 1BCMA 1GOAA 2OPRB 2B4JA 1JLCA 1RT2B 4FK0A 2HVHA 3ZSQA 3PW7A 4IRDA 1B9FA 3N6NA 3S3MA 3QGGA 4I2PB 3GQCA 2AQ4A 1YVFA 1G15A 3G86A 3LDSA 3MR6A 4CJSA 1QUVA 2XWYA 1Z25A 4DFPA 1S1UA 4MFBB 3OYLA 4WXOA 4OLAA 1VK0A 3CIZA 1NJXA 2FLLA 4Y34A 4CK1A 4RNFA 2VG6B 5T7BA 4FM0A 1VSJA 4KB1A 1HYSA 4CIGA 3ZSOA 1WLJA 3FQLA 2YKNA 1S1TA 1S0MA 3LWLA 4KTZA 3KLIB 2XY7A 3B6OA 3RR8A 4KHWA 2W42A 2F8EX 1RTHA 3QEIA 5CYQA 1HQUB 2D3ZA 1N5YB 4HKQA 2RDJA 1X9MA 3CJ5A 3PZPA 3V1QA 1MU2B 5KFEA 1EETA 3IS9A 4RNOA 2Z1JA 3I0SB 4BDYA 2BGGA 4BE0A 4IR9A 4FM1A 4TYBA 4CFAA 1I6JA 3MEGB 2ZE2B 4KE5A 4WE1A 3G10A 4O3RA 3KLFA 3OJSA 1S4FA 3ICLA 3RRGA 5KG4A 4CEOA 3KLEA 1QSSA 4FVMA 1FKOA 5HP1B 1RTIB 2WK4A 1XHZA 2JEGA 1DLOA 4DQQA 4DSEA 1TL3B 4FJLA 2ATQA 4ECVA 1QTMA 4Z0UA 4DFJA 1S1VA 3OL9A 5KG2A 3KK2B 4EZ9A 2AGOA 3G6XA 1JLBA 1RILA 3M9NB 1KRPA 1WAJA 1ZBFA 1BI4B 3SV3A 3GIMA 3UPFA 4KV8B 4CEDA 3HSTB 4B3OB 3Q8PB 2ITGA 4IFVB 3BQ0A 3L2QA 3SI6A 2J6UA 5KFKA 4CF0A 4LSLB 4DTMA 4CJLA 4ID5B 4CF8A 2OPPB 3TI0A 3U6FA 1CZBA 3I0RA 2E6MA 3V9SA 1NKEA 1TKXB 3OL8A 1C2PA 3KHRA 5C24B 4Q0BA 5JUMA 3S9HA 1ITGA 2XI2A 2UUWA 2Q3SA 1CZ9A 1FK9A 4OJRA 1VRTA 1L5UA 1T05A 1QE1B 4IRKA 1T03A 3QIOA 1JKHB 1S9FA 1RT4B 5DQIA 3PR4A 4ED8A 2VA3A 4CFDA 1BQNB 4KFBA 1CSJA 3DOLA 4M3ZA 5CYMB 3LP0B 1I3AA 4C8MA 1UWBA 4CECA 4RW9B 4XIUA 4O5BA 2XHBA 1XR6A 4URGA 1DTTA 5KT4A 1NNDA 1KFSA 4CERA 3VQDA 3PX0A 4FJMA 2C2DA 4CGHA 1EP4B 3CO9A 4YR2A 1JLEB 2AX0A 4U6PA 1SUQA 2ZD1B 4XPCA 3S3OA 1TKTA 4E3SA 2HHSA 1LWFB 3DRSA 2VG7A 2W9CB 3PVXA 1D8YA 3PX6A 4IFYA 3HT3A 1S6QA 5KRSA 4FJGA 4IH7A 3QEXA 4Q8EA 2V9WA 3MECB 4F4ZA 1RT2A 3QO9B 4ED1A 4CJEA 3PW0A 1S6PB 5J2NA 3M8QA 3SQ4A 4W5NA 4KB7A 3T5KA 4IRCA 2QKKA 4F4WA 1SL2A 3RWUA 4FLWA 5D3GB 1RTDB 3OYKA 1N4LA 4IDKB 3P1GA 3DRRB 2BRLA 1RDCA 2P5GA 4DEZA 4URSA 3K5MA 1IKVA 1X9SA 3OL7A 3ZSRA 4PWDB 3E01A 2WOMB 1WSJA 2UVWA 1S10A 5KFQA 4J2DA 4ECSA 1KVAA 4EZ6A 1S0OA 1KCFA 5FRMA 3ALYA 3NAEA 2OPQB 2XY8A 4E89A 3DOKB 3VQ6A 2BE2B 4ICLA 4TY8A 3NH2A 4FK2A 4YR0A 3HKWA 1QSLA 4CF2A 2E9TA 4J9MA 2PY5A 3DRPA 1C0MA 3H5SA 2FBYA 1VSHA 3U3YA 5KFYA 3KIOA 3LAMA 4DL5A 4LSNB 2QXFA 4ZVGA 3UQSA 3AVHA 3I0SA 3NF7A 4H4MA 4YNQA 3V1RA 2D41A 3RBEA 3GIKA 4CHOA 4IR1A 4DQPA 1JLCB 3NH0A 3AVMA 4B9TA 4FJ7A 4PUOA 4CJQA 4KHSA 4Y2CA 4QWDA 4KPYA 1Z26A 1C1CB 2WONB 3C94A 1NJYA 4O4RA 3NL0A 4KAZA 4E7LA 4KAIA 2G8UA 2IAJA 3NE6A 2A1RA 4DS5A 2FLNA 5KFWA 1HYVA 3HXMA 4JV2A 1VSMA 2YHBA 4FLZA 2R8HA 3SJJA 1T7PA 3HK2A 1S1UB 3MEEB 3KK3B 1J54A 1NK5A 3IRXA 1HYZA 2HNDA 4E1MA 2RN2A 1IG9A 1J53A 2ILZA 5KT7A 3CJ3A 2JLEA 4IBNA 1UA0A 3CVKA 2GV9A 3CJ2A 2G8IA 2OPPA 2IA6A 2YKNB 4CJ5A 5F8IA 1S1TB 4FJ8A 5KT6A 2BANA 2C22A 4FCYA 3HP6A 3K5LA 3SPZA 1RTHB 3V6DB 2G8WA 5CYQB 1OS5A 1X1PA 4KTWA 1N48A 5L1IA 4OL8A 3QNOA 4O3NA 4IG3B 3NF6A 4KO0A 3LP1B 1RT4A 5SZTA 3L2UA 3N6LA 1REVB 5KG0A 2XGPA 2RPIA 3QERA 2KTQA 3BJYA 1BQNA 5DK5A 3TAMB 4WYWA 2WTFA 1T94A 5DG7A 2R8KA 5KFRA 4NCAA 2C28A 1U09A 1XWLA 2AGQA 2F96A 1WNEA 3QZ8A 3WNFA 4AHTA 3LP2A 3KLEB 5FDLA 4ECWA 1FKOB 4WFYA 4RU9A 1D9FA 5KFFA 1DLOB 3DM2A 3TABA 1JLEA 3RMCA 4FZYA 2ZD1A 4F3OA 3ZSWA 4KI4A 1QSYA 4EEYA 3CFOA 4F4KA 4Z4GA 3SFGA 1LWFA 4F4YA 4JRQA 1S9EA 2R8GA 4QWCA 3QEWA 4CJUA 2FVSA 3D45A 2XI3A 3NF9A 3NGZA 3QETA 3ITHA 1KSPA 3MECA 3NHGA 5HLFA 2KFNA 2HMIB 3P83D 4ECRA 4ID1A 3ASMA 3H5YA 4J2AA 3RBDA 3SYZA 4ZTFA 4JS4A 3BDPA 3O3GA 3QINA 3I0RB 5KFXA 4M45A 3VQ4A 4Q0BB 1BHLA 3AA5X 2KQ2A 1RTDA 4E7IA 2W9BA 2HW3A 4IDKA 1FK9B 2DPJA 1BQMB 1JXBA 3BQ1A 1T05B 3OL6A 4RZRA 5J2MA 3CWJA 4TY9A 1C0UB 2ETJA 2DFHA 3AO4A 4RW8A 2IOCA 4ZVFA 4ELTA 3AVLA 4E7KA 5KFBA 4CJPA 3PO5A 1ZBIA 4M3TA 2C2RA 2YKMA 4FW1A 4AHVA 4FJ5A 4J9NA 3DOLB 2HAIA 3HPOA 4H8KA 3BSNA 2YV0X 3HO1A 1CXUA 1WNSA 1S49A 1UWBB 1TGOA 3PO4A 3H40A 2D3UA 4PA1A 2IDOA 5KFDA 4RUAA 1D0EA 1SUQB 1T8EA 3M8PB 5KG5A 1TKTB 4K50A 3HP9A 4W5QA 3AA3A 2FJXA 4WYLA 2BR0A 3RRHA 3ZSYA 3FFIA 2BRKA 1RT1A 3DRSB 2WCXA 1SKRA 2FBXA 4IFYB 5J1EB 3CQ8A 3OYHA 1S6QB 4KHMA 3OJUA 1Z4UA 1NK7A 4QW9A 4BWJA 2HHTA 4J9RA 3F73A 4NLDA 2XGQA 4GVMA 4TLRA 2JEJA 3C6TA 1C1CA 4HTUA 1X9WA 2WONA 3CJ0A 3HVAA 5J2NB 3M8QB 4RUCA 4B9UA 4JV0A 1TV6A 3SUQA 4ED2A 4OGCA 3BREA 3MFHA 4EP4A 4ZPCA 3HM9A 1SKSA 2IM0A 5KFSA 2PYJA 4O3OA 4M3RA 4DFMA 1S1XA 4Y3CA 5EDWA 3MEEA 1IKVB 3PHEA 3QGIA 3KK3A 3TWHA 3E01B 1Q8IA 2GIQA 2X74A 4W5TA 3H98A 1JLGA 3DLHA 5L9XA 4E7JA 2YNGA 1YTAA 3TQ1A 4ED7A 3LWMA 5KG6A 4M3YA 2AU0A 5KFVA 3SQ1A 4TSXA 1HQEA 1JLAA 3RB0A 5DG8A 2FLPA 2OPSA 4EBCA 2LSNA 3C6UA 3OYAA 4J9KA 4ECUA 1JXEA 1WSHA 4ICLB 2R2SA 1F21A 1LV5A 1LAWA 4TY8B 2RDIA 4BWMA 5DGAA 1U48A 3BSOA 5L1JA 1Q9XA 3OYIA 4DTXA 3DRPB 3V6DA 3TVKA 2JGUA 3OHAA 3KLVA 4LQ3A 3VQ5A 2XY6A 3SCXA 2PZSA 5F8JA 4IG3A 3LP1A 4IG0A 3OYDA 1REVA 3MXMA 4H4MB 2ATLA 3HPHA 3DLGB 4K4SA 3TAMA 3K5OA 5I3UA 4MQ3A 4R0EA 5F8MA 3MXIA 3NGDA 3SNNA 3EPGA 4PUOB 3ZT2A 4AHSA 1D9DA 1TQLA 4O44A 5JXSA 2YNIB 3SI8A 2R7YA 2ALZA 4CEZA 4HCCA 2IAJB 1TP7A 3SV4A 1KVBA 2FVRA 2FVCA 3AVFA 3HPGA 5FROA 4Q45A 4CHQA 4QPXA 1TK8A 1UA1A 1TKZA 3GIJA 3OS0A 3C95A 3TARA 4NLRA 1DTQA 1S5JA 2HHXA 1JL2A 5HRRA 3IRXB 3TR8A 3G6YA 2IS3A 2HNDB 1C1AA 3GIIA 4N5SA 5F8GA 3NH1A 3MF5A 4CJ4A 1WSFA 4IOBA
chains in the Genus database with same CATH superfamily
4BR4A 4ED4A 4LF2A 3B6PA 3BUZB 1N6QB 1T44A 1RCOB 4PXEA 2FJWA 4OI0A 5I42B 2I2YA 2HRYA 2HFSA 4CQ1A 1R7IA 2ATCB 2B51A 2IM1A 2X51A 3PCOB 2BANB 1B4SA 2VGMA 5JS2A 4BC7A 1OPZA 4JB8B 4MIBA 3PIPL 5B08A 3SUOA 3ISNC 2DNQA 3MM8B 1NRKA 1SH2A 1VS3A 2QC3A 2P5OA 4MH8A 1C0UA 2DNGA 2AJQA 4ETXA 4NZ0A 4AL5A 3TANA 1X4FA 3CHWA 2CWXA 4NCGA 4QIGA 3GB0A 3THWB 4Q43A 4K0KJ 2B9YA 2FHJD 4M5DB 1U8SA 1F2GA 1NGFA 3QFUA 2W6LA 4J9OA 2LDIA 2MQNA 2HZAA 2JWLA 2HK3A 2VWKA 3AQPA 2BOAA 3J7Z5 2HAFA 3L2RA 2PIIA 1KBRA 2HKEA 3MR5A 1Q86T 3D3CJ 5HOOA 4QR2A 2DHHA 1RWNB 3IBFB 3ZT4A 3JXOA 3FDSA 3H6EA 3VV2B 4EYIB 3L3CA 4L8RB 4CK3A 3T1YF 2DFEA 4CDIA 4DSJA 4DLEA 2IHR1 1NGJA 5C25B 3U9ZA 3A8EA 5HO4A 2Y1IA 2QE5A 4EK2A 2UXCF 3ZX3A 4I2QB 2E5GA 5GVQA 5DO2A 5CD4A 3FSYA 3UNYA 1AZSB 3EDRB 1V9OA 1CJVA 4FXDA 3DYAA 1VC0A 1X60A 3BEXA 4H54A 1LW2A 1SPBP 1V3SA 5H9EJ 2GMLA 1RP5A 3BP8A 2IVOA 5A2QO 4WFNQ 4CH0S 3P45B 3JYTB 5AXNA 2YKMB 1JCFA 2DVIA 2ZHOA 5KFUA 2D7SA 1WSGA 3POTA 4WQ4A 4JI8F 5KFGA 2OTLS 2YQ1A 2GAGC 4AF1A 4C7QA 2VH7A 3BO4A 1RAEB 2APOA 2DFFA 3I33A 1QM9A 3EE8A 3OYGA 1K0TA 2NNWA 2UUTA 1O13A 2FPHX 1GLJO 1KHWA 1HW8A 1SQEA 2XMTA 4LT6A 3KHHA 1GK8A 1D9AA 2W9AA 2LA6A 4U7UK 5E84A 3C19A 4QOZB 1NWKA 1UAXA 5MAOA 4IKAA 1VRUA 5BR8K 2YNIA 5A6WA 1E4GT 4ECZA 1FWKA 4FBUA 2D0AA 1R89A 5IM0B 3CIPA 4DV3J 4FXWA 3WNGA 5A6PA 1PC5A 2V2QA 1WUUA 3J8AA 1JLGB 2RU3A 2P9SB 2E9RX 3AA4A 4QAGA 4LMZA 2HQFA 4BR5A 4K4TA 2AYEA 3P4IA 1N6QA 4EYHB 1JLAB 1D09B 2AW0A 1FXDA 5L8RC 4I67A 5I42A 1C1BA 3SAHA 2OPSB 2HVEA 3IBWA 2HBJA 3VQ7A 4OI1A 2GZOA 2C2ZB 4ECTA 4OJGA 1FE4A 1ROFA 4DTPA 2R8JA 4I4BA 1SV5B 3VMFB 1XR7A 3B78A 2HHQA 2PI5A 1IV0A 3D2WA 2Q97A 2HWIA 3UR0A 3H1QA 1TK5A 3O3FA 2JFDA 3QFHA 5E41A 2F8TA 2YKQA 1M5HA 3OS2A 5I3UB 3BPDA 2BUPA 5HROA 3KD1E 2LMIA 4K4YA 2P9KB 3CUNA 1W97L 1Q8LA 2QA1A 2P9CA 2LU2A 1J5OA 1JL1A 3KDOA 1RHKB 3HFZB 1XMQJ 1WSRA 2D9OA 5KGXA 2EW9A 3PIPQ 4NLOA 3OYFA 3CSKA 3CQYA 4FPAA 5CD4H 1NKCA 1KOHA 3MCPA 2V7ZA 3K2PA 3HI0A 2IC3A 1C0GA 4AT1B 1JMTA 2CQGA 2YCHA 2X78A 5LM7E 1RB0A 4ZCIA 2W8LA 2XHWA 4CLLA 4GNIA 4K4XA 4YQWA 5BREA 1BUPA 5C25A 1NPKA 3NXZA 1I94F 3ILLA 4OPKA 1TL1B 4I2QA 2DCUB 3U27A 3CCTA 4Z4CA 3Q23A 3SJHA 4AH9A 4K8RA 3HHEA 4XEIA 3SZ2A 3K58A 4CJVA 4M63C 4NXMF 1CZAN 1RBRA 1YJUA 1O0PA 3NGYA 5BYQA 4DR5J 4C8OA 2NSBA 3F41A 2MQQA 1TUGB 1SQKA 3J7YP 4H0VB 4M3WA 4RW6B 1IUJA 2MY8A 3VQ9A 2M9KA 4GC7A 1VQPN 2BKNA 4FJIA 3PJXA 5ETOA 4FZZA 3JYTA 1DKGD 5JLHA 5KG7A 2JWNA 1BO5O 1RCHA 1TK0A 4NLXA 1SJ4P 4DTSA 4X4OA 3CD5A 4KPCA 3S3NA 2Z2ZA 2IRXA 5K14A 3OFGA 2B3TB 5F9LA 4U7UD 1S72S 1E6VA 3WXMB 3GP9A 3UVJB 4AL7A 1HNIA 2DD8S 3RBZA 3GTYX 2WSFC 3TA1A 2B43A 3DLEB 5KFOA 3V1OA 5KG1A 1KXPA 2NCKL 5D6GA 4TQRA 2C3OA 3H5XA 5JLFA 3NOGA 4I6WA 3IWLA 4MK7A 2CNNB 4X65K 2COLA 4DG1B 3ENBA 1RBUA 3BPSP 4IYQA 2I7NA 1QAYA 3HMJG 5DLGA 2P9NB 3ZETA 4K0KF 1RJJA 2YX4A 1NB2A 3FEXB 5IM0A 4FJJA 3DWLA 4ZCKA 2ZWOA 2F4VJ 2NLXA 3IUCA 4LH4A 2QXLA 4RW4A 4OZ2A 1RT6B 3J7AN 3PFOA 4QU6A 3FBBA 4URQU 1FEHA 2GO9A 1RK8A 3WQTA 2CVEA 2B6AA 1WSEA 3UDCA 2HVIA 4G1QA 4YDUA 4YS2A 4X4NA 4NZ6A 1RYSA 4CEAA 3BSCA 1EQ0A 3LP3A 2F1FA 1S48A 3CE8A 4AE5A 1SV5A 3U1MA 1N36K 3HBTA 1WTFA 2RHQB 4OYXA 1XI1A 1S3XA 1VSIA 1HWUA 3LM9A 2AP6A 4NZ7A 2HHUA 2CPFA 3VAGA 1IH7A 3SCIE 1MN7A 4B1YB 3A3OB 4M41A 4ZP7A 2K06A 3KK1B 3JS6A 3QIPB 5IWAJ 1T95A 4OI6A 2GWJA 4DQSA 4DQRA 4R8UA 4ZVRB 2VFUA 3G87A 3G9CA 3OYEA 1H2TZ 1VQON 2OIHA 5C42B 3M8RA 2MQMA 4OKKA 1HNZJ 2XC9A 4XH4A 4FJHA 3JTPA 1PJ5A 2ZJQQ 4WFXA 1ZYQA 1BWEA 2HZCA 2FSKA 3W9IA 3D0PA 3AAWB 5KT3A 5EGYA 2HBLA 1BQXA 5SWMA 2LQ5A 4KT0C 5KQDA 2EI5A 3DNCA 3LTOA 4FXVA 4QWBA 5GAGI 1X8DA 1YJTA 2W7OA 4J9VA 4OV1A 4FWLA 3ENAA 1XMOF 4A57A 5EUHA 3ZEUB 3W2VB 4WFZA 5BR8J 4Z37A 3V9XA 2RKIA 1KNZA 3HSGA 2QGFB 1K0VA 1MWZA 4DR2K 4X4VA 3CB4A 2ZWHA 4MIAA 4HUGA 2HHPA 4H4OB 4U7CA 3HDSA 4C98A 5EHHA 2IBKA 1UP1A 4C4WA 1S0NA 1VQ6S 4ED6A 5LXRA 4ZVUB 4I6AA 4P75A 2Q1LA 4FWPA 3FUYA 1Q5VA 3WNEA 4WXWA 3EY1A 3G71S 2FHOB 1W0HA 3VGVA 3I55S 4K41A 3TTCA 2LFVA 3C15B 4BRCA 1YWXA 5HVGA 4C97A 4UW2A 1DT9A 4W92B 4FS2A 2A0FB 2YHYA 3QRQA 2M8HA 2HQDA 2ROGA 3UCGA 3NFAA 1HPZB 4IJNA 2DTUA 2CPJA 2H4WB 2D3O1 3DLEA 3B4DA 2ZH5A 2ERRA 2ZH7A 5G0RA 2ZKUA 4FF1A 2PE8A 1RAHB 3C3LA 1F5AA 4RW7A 1A5WA 4OKEA 1CULA 4PQUB 3NBPB 3I56S 4FVUA 1H74A 4TQSA 2XTJP 3A8JA 4W90B 3ZXWA 1S59A 3DMJB 2NXEA 4X4SA 1ZPWX 5IT9U 2VBWA 1JQGA 2B5JB 3C6HA 2DGQA 3QEPA 2K2PA 3L9ZA 1VC6A 2XS2A 5KPTA 5TKWA 4LUBA 4YFUA 1SL0A 1BL3A 4WFAL 1Q18A 4ZPBA 1NUEA 1S9GB 2DR8A 2XSJA 3GLJA 1CG2A 1X5SA 4B9MA 4PAAA 3U7JA 4DMNA 1N32K 3M05A 1RWVB 4XDCA 1RBVA 2QN6B 2O8FA 4J37A 2VG6A 2A1BA 4O55A 4EIAA 2EBEA 1YJ7A 2JSXA 1H38A 4C48A 1BG3A 2MKSA 4M3UA 2Q36A 4MDAA 4LQ9A 3MXHP 2R2TA 3CJ1A 4P52A 3NY0A 2K3KA 3QIPA 5EWGA 2ZH2A 2ZOMA 3VEXA 3SUPA 4L6V3 2OH2A 2CXEA 2DNKA 3FBFA 4K4ZA 4X4UA 3H4DA 2RQ4A 3THVA 4ES3A 5F41A 2E6LA 1W2BR 1Q53A 2ZE2A 2XNQA 4DL6A 5EVZA 2VWBA 1LOUA 2XYHB 1XTZA 2E7WA 4CFBA 1TL3A 3CCVS 3K57A 2FVQA 4DOZA 2HQGA 3P8BB 4RNNA 4QWEA 4FS1A 4B9SA 3WIVA 4TU9A 3HI9A 3R6LB 2D0CA 2OFHX 2ZM6K 3NLCA 3HOTA 5E3QA 4A8FA 3NOCA 1UVJA 2KT3A 4KV8A 3LALA 4B3OA 4X65J 2BW2A 4KH0B 4ID5A 4DL7A 1TKXA 4FBTA 1X4EA 1UAWA 3P3DA 2MKCA 4AD6A 2KW4A 4NLWA 4LSZB 4O8UA 1VQNS 4DHYA 1FRXA 2XBPA 2F4VF 3V4MA 2P9LA 1J5EJ 2R3VA 3R5BA 1GLAG 1UW9A 1HNWF 2FHMA 5AXMA 1NHUA 2DY9A 2MPUA 2OGUA 4Z4FA 3MM9A 1R6VA 3E3XA 2DR5A 1QJHA 1I39A 2LEPA 3OXLA 3VQBA 3CTRA 1R59O 5A8KB 5CYMA 4ZVQB 3LP0A 3GYXB 4RW9A 1RDBA 4WE1B 3WC2A 3H46O 3KLFB 2AZ3A 4DTNA 2KXHA 3ENOA 1GOCA 1HPZA 2C2NA 3VALA 3IR7B 4C8NA 5A8RA 3CPWR 1EP4A 4LFBJ 1TFYA 4Z4IA 3Q22A 2OCEA 4OV6A 2QSFA 1S1VB 3KWIA 2XCAA 4CNYA 4F36A 1Q78A 3UD5A 1ZH5A 4PQUA 2W9CA 5DLFA 3NBPA 3V6KA 3U4LA 1ILYA 2ILYA 2V52B 4Z4EA 1ZTWA 3EKSA 3V9ZA 3HRGA 5IWAF 3FRZA 3H5UA 4Y2KA 4DL4A 2GQCA 4D3HA 3DMJA 2M70A 2I8EA 2CQ4A 2B5JA 5J1NA 1URNA 2RILA 3QMQA 3BF1A 1RFQA 1O51A 3CC7N 4NLSA 1YXQA 4ED0A 1HNZF 2IMWP 2IVPA 4A62A 4DN0A 5C10A 5HRSA 1NAQA 1GMUA 4O3SA 1IKYB 2O8CB 4ZS6A 3AV9A 2ZBQA 4PWDA 3OR1B 2WOMA 5IXUA 2V7YA 5FLXY 1NZAA 2MGZA 3Q8RB 3Q83A 3OVSA 4KFBB 3K5PA 3D54A 3GZ7A 3UR3C 2BM1A 5B0FA 2CPZA 5GAHI 2CWKA 1RT5B 1GLDG 3UIQA 3AAPA 1D1UA 1ZAWA 2E29A 3VQQA 4F7VA 3EDQB 3ISND 1FEEA 4YY3J 5AZJB 1W25A 2VPWB 4MJKA 9RUBA 4WFAQ 2CGKA 4M63A 2OMOA 1B92A 4L3QA 2WBRA 2CJQA 2QX0A 4LSNA 1VMBA 4FW2A 1L3UA 5F8NA 4OZJA 5E5NA 4Y28C 3CFRA 2V51B 2AKWB 2G0IA 3JSRA 3WZ0A 5KFPA 1GOAA 1NB7A 2OPRB 2Z56B 4OX9F 1V6HA 2C2OB 4DV4K 3VEZA 1NCLA 2PAVA 3EN9A 5GAGU 1LFWA 2KG0A 4WF9L 3TNVA 1QQOA 4I2PB 2VUGA 2XG8A 5FLXO 2WB1D 2GAHC 5BPNA 4PL8A 1VCTA 3GQCA 2O8EA 1G15A 3G86A 1QUVA 3B4MA 2CQ2A 1S1UA 4MFBB 1O8BA 1U1PA 3OYLA 3NCPA 3M5RA 3SQOP 3GJRB 3CIZA 1NJXA 5KPRA 2UP1A 4CK1A 2C42A 4RNFA 3ONQA 2F9DA 1VSJA 1P9YA 2DO4A 3ZSOA 1YIJN 1UTAA 3PIOL 1UJ6A 2IY5B 2AIRB 2DIVA 2FIUA 1N88A 2MKYA 1RTHA 3QEIA 5CYQA 2EKYA 4O23A 2ACYA 3PZPA 1MU2B 5KFEA 4RNOA 4OMFG 2Z1JA 2VF3A 3GR1A 4TYBA 2ZFHA 5C7PA 5M1NA 4IO9L 4KE5A 4WE1A 2A2CA 3G10A 3KLFA 1WC3A 5KG4A 3KLEA 1QSSA 2UUCK 1RTIB 2CNOB 2BEFA 3AA9A 4DSEA 2IA0A 5ETNA 5AZIA 4DFJA 1S1VA 3T9ZA 3OL9A 2UXBK 2E44A 4P2MA 5LSRA 4EZ9A 2JH3A 1R8PA 1WAJA 2IPOB 4UT4A 4GVEA 2J7KA 1FFGB 1HBMB 1TL4A 2CJAA 1RKIA 3UPFA 4CEDA 2DITA 2QL7B 3QSYB 3DXMA 4PL7A 4IFVB 3SI6A 2DGWA 4DTMA 1A6LA 3TI0A 1FDBA 4H0YB 4X64K 2E6MA 3D0HE 5D0EA 3V9SA 5C24B 4BC2A 5IOLA 1Q8BA 2QT7A 1FK9A 5EX0A 4OJRA 1L5UA 4KH1B 4YN3B 1T05A 2AA4A 4K42A 2O8CA 1Q8KA 3OR1A 4MAKA 2ZF5O 1VQ4N 2E5JA 1S9FA 4DPYA 2UUAJ 4YB7A 4KFBA 1ZBTA 3DOLA 4M3ZA 1VK8A 3OUYB 2DT9A 1UWBA 4XIUA 5IS2A 4WK3A 1XR6A 2EFOA 2IVMA 4URGA 5KT4A 1NNDA 3ZNUA 1S57A 4CLWA 4JKHA 2C2DA 4CGHA 4QIEA 1VQPS 4YR2A 1RAIB 1JLEB 2AX0A 5AJ3F 3BF3A 3H8YA 3VERA 1FRMA 2KI2A 1RAGB 2ZBIA 5D4PA 3C14B 4E3SA 1SBRA 4QIFA 2HHSA 1EQMA 3C6AA 2GHVC 2A40A 2CFXA 1J5EF 1VISA 1PBUA 1Z2ZA 4IFYA 1OJ4A 2V2ZA 3PX6A 3HT3A 4WU3A 4HDHA 4DR7K 3MPWA 2E1PA 2BA9A 4PPDA 3QT7A 4F4ZA 2YJEA 1UFWA 3UO0A 4CJEA 2GJFA 3PW0A 1UFKA 2H54B 2G2ZA 4W5NA 1N33J 1ESVA 5JVGL 1NGIA 1RTDB 1F1BB 1N4LA 3DRRB 1RDCA 1QUPA 4Y2MA 3A8IA 2PFUA 4IOAQ 2ROEA 2W25A 2KL8A 4LFBF 4H0XB 1N5TA 1KVAA 2ZKTA 4ZPWR 4CLUA 2P6SA 4LREA 1S0OA 1YRTA 1NSPA 3UDVA 1KCFA 1WHXA 3M2UA 3PJ9A 2D74B 2OJ3A 5FRMA 3O8MA 2Q31A 2XY8A 3KWGA 2HF4A 3DOKB 4TY8A 4YEAA 4FK2A 3AOAA 4LC9B 3LDOA 5K5MA 4YR0A 3M6VA 4DMZA 2E88A 4IO1A 2AJ4A 3CMQA 1VSHA 5KPZA 3KIOA 1Z6RA 1NSQA 2EBGA 4ZVGA 4FWMA 3NF7A 4H4MA 1EARA 3V1RA 4ZN1A 7FDRA 1S6UA 2RHKA 3RBXA 4CHOA 2QWRA 3MM5B 4IR1A 2YQ3A 2N7CA 3SAFA 4DL0C 2LLZA 3PHTA 2QWOA 4PUOA 4CJQA 4Y2CA 4QWDA 4I68A 1DFDA 1Z26A 2RJZA 4ZLNA 1WF2A 2Z4PA 2N4DA 3PIOQ 2A6OA 2NRWA 5AQHA 2M0GB 4KAZA 1N0UA 4KAIA 2NREA 4MTPA 2A1RA 1RDWX 5KFWA 1U6ZA 1HYVA 4JI4J 2F40A 4JV2A 1VSMA 2VFTA 2YHBA 1H73A 2CZVC 1AUSL 3SJJA 2FGOA 3OFHA 3EGVA 1T7PA 3HK2A 4A5AA 1S99A 4P2XA 2HIQA 3KK3B 4CW7B 4YY3F 1J54A 4CIOA 2DJWA 1HYZA 2HNDA 4DCJB 4E1MA 2XWXA 1J53A 3MCNA 1HBMA 3ILOA 3VGTA 1YDLA 4IBNA 1SKUB 1UA0A 1OYEA 4IO9Q 1TU0B 3CJ2A 4V19S 2W2MP 2IA6A 5EXWA 1VQOS 4CJ5A 2VD3A 4OLPA 2P9IB 5I9EB 4USKA 3J81j 4DV4J 3MMJA 1Q4RA 3SPZA 3V6DB 1SQGA 2HQ3A 3HHDA 2V2KA 2QSWA 2P9GA 4B3TK 2D1CA 1HR0F 1RBOB 3PLAA 4FOEA 4O3NA 4RWWA 4KO0A 3LP1B 1OIAA 3NF6A 2CQHA 5DK5A 3TAMB 5DG7A 2K7KA 5GAGP 4DI6A 3OUYA 4BR7A 1WC6A 1PAEX 3QZ8A 4P71A 3JQKA 3WBZA 5FDLA 4WFYA 4FWOA 4RU9A 5KFFA 3R8YA 3DM2A 3EZWA 1JLEA 2BJ1A 1UEVA 3PACA 5ITHA 3GU0A 3ZSWA 3GONA 3PRDA 3Q86A 2XMJA 2NRTA 2B4PA 4F4KA 1CS4B 3GG4A 2HHHK 4DR6F 1S9EA 2R8GA 5IV3A 3UD3P 4HL9A 1Q0NA 2FVSA 3FBCA 2XI3A 3NF9A 3ITHA 3NHGA 4BHQA 1U2CA 1WEXA 1FD8A 3THYA 2HMIB 3MCAB 3E9LA 4HHHA 4J2AA 3RBDA 4ZTFA 4HR2A 4AUKA 1CJKB 3QINA 3TSUA 2GMJA 2Y0BB 3QJPA 5ETMA 2DHGA 1NU4A 1RTDA 3FVYA 2HW3A 1U2VB 2HS3A 3TTDA 3DDNA 5IC4B 1HBOA 2OEJA 2XULA 3T1HK 3OBIA 1NDPA 5HQMA 4B3MF 5J2MA 3CWJA 1VQ9N 5LSOA 5BPMA 2UUCJ 2ETJA 2DFHA 2IOCA 5KFBA 3PO5A 1HNXJ 2W2PP 4OX8A 2C2RA 2UXBJ 4ISGA 4AHVA 4FJ5A 1RBLA 2PA3A 4H8KA 2GS8A 3R7SB 3HO1A 1CXUA 1RU2A 4FNHA 1VQ5N 2FC9A 2RT3A 2JLFA 4BRHA 3EGNA 3H40A 5AQNA 2CQBA 2DH8A 4JI5K 1M1HA 2O8BB 2J0XA 3NNHA 5D4LA 1RAFB 1FCAA 4X64J 3GCXP 3M8PB 5CZXA 2R7QA 1I1GA 3ZSYA 1HIYA 3FFIA 2BRKA 3C16B 2UUBJ 2X7IA 3O44A 3OYHA 2H5JB 3DXKB 2FD2A 2HHTA 1FNOA 4NLDA 4GVMA 4TLRA 2UUAF 2JEJA 3C6TA 1X9WA 1RHQB 3MMVA 4B9UA 1ZZNA 4ED2A 3MFHA 3AODA 2Q0UA 2JFKA 1Q82O 2YVSA 2RQKA 2VBZA 4GKJK 2PYJA 4O3OA 4M3RA 1S1XA 2YJFA 2E2OA 2HIYA 2LECA 4ZOSA 4WJBA 2I6WA 3KK3A 4LF9K 1X5OA 5AXLA 1RZMA 2BJDA 3HF5A 2PSZA 4E7JA 5AQYA 2O8DB 3NRBA 1YTAA 3WEEA 1YI2N 3P39A 1HQEA 1YAGA 3O3LA 4M5JA 5CH7B 3C6UA 1P8GA 1QLNA 2ITMA 3MD3A 4JI1K 2P9IA 2J9CA 3ILIA 4FN5A 4CBUA 2AEJA 5L1JA 1NGHA 3K2YA 2LDYA 1N33F 3V6DA 4DV5F 2JGUA 1VQ8N 3KLVA 1SC3B 3U9DA 1IJFB 5HMYA 3OTBA 3CCZA 2MZRA 3LP1A 4IG0A 2C3YA 2ATLA 4K4SA 3TAMA 2Q79A 4MQ3A 4H5TA 5F8MA 3ELHA 2G9OA 5M1QA 4Z7CA 4AHSA 1LFPA 1D9DA 4M8LA 1OY6A 4O44A 1N5VA 4PKDB 3SV4A 4DUYK 2FVCA 5FROA 4CHQA 3N4QA 3R1LA 1DTQA 3UWTA 1RSCA 1FX4A 4L72B 3SMZA 4N5SA 5F8GA 1EKSA 1WSFA 3UKRA 4C1NI 2HNZA 2IIRA 3VVTA 4HTLA 3TRGA 3NWGA 3I96A 2HMIA 2KM8C 3AH6A 3GJSB 3KG1A 4DX6A 4NEYA 1QS4A 3GV7B 1CJKA 3SCJE 2LP4A 2XCPA 2NZ4A 3AXKA 3N01A 2KZMA 4FZVA 2WB4A 4B9VA 1YZ6A 9ATCB 4KQZA 4XPEA 1KD1O 3M6GA 1UZHA 3KJVA 1Y5LB 1IXKA 3SSQA 4UUXA 4F3TA 3D6HB 3V81A 4TNOA 3KHLA 5F8LA 3HZGA 4JI4F 1VQKN 2PFDA 1WOOA 2VKZG 4YOYA 5KTQA 4UZBA 3H2VE 1XK8A 2RD5C 3X3UA 3L7OA 3D1OA 2AYGA 4QR0A 4P72A 4CM2A 1NJZA 3IMXA 2G2YA 4WWSA 3T1AA 4ALZA 3LP2B 1T9YA 3M8YA 4RCHA 3SFUA 2ASMA 1OH6A 4X66F 4RWTA 3CC7S 4JI0K 1QDUB 3M8PA 1RYRA 1BXNA 1WN7A 2GUIA 1B0PA 3W63A 4OPJA 1NGEA 5AQXA 4YR3A 2W7AA 3DN9A 4CZEA 1FNMA 2GBZA 1YITS 1PJ6A 1LWEA 3R27A 2YNHA 1RAOA 1GT8A 2UV8A 2W4DA 5E3CA 2MZSA 3CM6A 1FTRA 1BC6A 5GAHP 3L3VA 4LF7K 1RT3A 4KC5A 3PR5B 4LVNP 3Q24A 2GMHA 3IFEA 2XQCA 4ZP8A 3CM5A 3JAMY 1IBLJ 3X1LB 5M2RA 1NKBA 2ZJRL 4MK9A 3VEYA 4RW8B 2J8AA 2HOEA 1HPMA 1S7HA 2CPHA 3S1TA 4J9SA 2RSQA 3CG7A 2HHHJ 4TYAA 4EBDA 2AGPA 2V8VA 3AO3A 1LW0B 2GFFA 3GSDA 2WW8A 2QL5B 2W7PA 1K73O 1VR6A 2CNLB 5FD1A 3DGPB 1ZM3A 2YQ0A 4FPIA 3WNHA 2GVDA 2A42A 3AHPA 4OJHA 2PO4A 3F5TA 4QWAA 4ILRA 1GX5A 1K1SA 4JNEA 3IN5A 3T1HJ 1NJWA 3AVBA 4OPAA 1TAUA 4CO4A 3JAMO 3O1BA 1HNXF 1NGDA 1WOPA 4CO0A 4CBXA 5KFMA 1TV6B 4FSVA 3BQ2A 4DV6J 4ZHRB 3BSAA 3D2FB 2HS0A 4H4KA 2E1MC 1WEYA 3IAM9 5EY4A 3WXJA 2DR9A 3NMAA 4M95A 3RAQA 3QEVA 4JI5J 4OKJA 5AQKA 3L2WA 1UW4A 4MLHA 1FNXH 2XZDB 1M90O 2R7UA 3ENVA 2PFFB 2NRVA 4NXNK 4DSLA 2UUBF 2X1FA 3V9WA 1RAAB 2QMXA 5CQGA 3VPZA 2P9EA 1KQSR 4AFFA 3JXUA 1MROB 2DXDA 3MGJA 3G2XA 4JD2A 5EWFA 1HI8A 3ULEB 1SH3A 1BGXT 3NDKA 3J7ZT 1S4EA 3BGRA 1FVQA 4FLYA 4DU4A 3NGUA 2MSTA 4A59A 2VJVA 1Q82T 4OX6A 2VGNA 3PEJA 4CLTA 1K8KB 1U0HB 3T3FA 2FZCB 2P1JA 3RYLA 3MPYA 4ZJOA 4N77A 4DV0F 1A5XA 3RB4A 4LF9J 3A12A 4USUA 3FC9A 5F0WA 1T3VA 3ZZOA 5CZVA 4PG7A 3VESA 3I5CA 2ZQBA 2A5XA 1ASVA 4GO7X 1P27B 4DL3A 4NEZA 3HD2A 4J91A 4O0JA 3HHKA 2Y0SD 3TEHB 3ENQA 1R6YA 2KFZA 4NRUA 4LJMA 3M4XA 4O3PA 6FDRA 5FLXU 4CZCA 3O1LA 1TKDA 1NGCA 2GHWA 1P9QC 4CJ3A 2N4CA 5CZ2A 4P73A 4CGDA 1TKZB 1JK9B 4NB4A 1CJUA 3ZSXA 1N0VC 5DRKA 3V4IB 2MQ8A 3RG6A 1VQ4S 1DGKN 3O6QA 4ANCA 5LMNK 4DSKA 2XYGB 3U1NA 3BEGB 1JLFB 1Z2LA 4YHHK 3MD1A 4BRDA 4AYBD 1X4GA 1B99A 3LM2A 4BC9A 5GADU 3E66A 3SQ0A 5LXYA 3AGRA 1KOOA 4NCBA 3SK3A 1R8HA 4DX5A 3VENA 2PEHA 4LFAK 4NLUA 2MB0B 1HNVB 4DSIA 2E7XA 2NUBA 1DJ0A 2Y1LB 3VQ8A 4K2XA 2VWJA 1WAFA 3RJMB 1EKRA 3D6TB 1HW9A 2XSFA 1HWKA 4W98A 4ZIVA 2YTCA 3I9ZA 1IM4A 4ECYA 1NK8A 4FF4A 4I7FB 3U3GA 4M5MA 4HWIA 1QTNB 2YHXA 2MDAA 5GIPA 3N6MA 2HSTA 1NJIO 3CERA 1LW0A 3M30A 3TJ9A 3H2LA 1YHQN 3PV8A 2E1CA 3UB5A 1LWCA 2AEFA 1SCJB 1X5PA 3IDHA 3IGVA 1ASWA 3BBBA 4GRSA 1XQIA 2QMUB 4E7HA 2ZJRQ 2LQ9A 4HVZA 1UWAA 3N5BA 1DURA 4CGGA 1Y4ZB 3HHLC 3AVCA 4IEEA 2CNKB 3TQEA 1C0TB 4ILGB 3I87A 2KXFA 1AW0A 2M5YA 4BE2A 4U95A 2EFNA 3FKBA 4NI2B 4CESA 3PXGa 3M3ZA 3HHNB 1PYTA 2NRZA 5GIOA 4KI6A 4ZHRA 2EFGA 2Z1HA 5TKYA 2OTLN 4ZLJA 4FM2A 4DF8A 1VSDA 2B9EA 3QRRA 3PY8A 3T1YK 1YLXA 4RUHA 1Y5NB 2J9DA 3QBCA 1EXQA 4OGEA 4OJ1A 2WFBA 1RA6A 3GJTB 3SCKE 4PYDA 2UXCK 2F63A 5L1LA 4UY8O 4ECQA 3KYLA 3HULA 2FY8A 3MI7X 4U8VA 2W8KA 1HJOA 4A8XA 1VIOA 5C15A 1RT7A 1Y9OA 4JEPA 4BC4A 4CK2A 4YORA 3I82A 3PUFA 4NA2A 3GSIA 4LF7J 1FKPB 1TR0A 1UVMA 2IDLA 1K8KA 2Z1GA 3TUIC 3IAS9 3CJKB 3K59A 4Z2XA 2OKQA 5J2QB 1IBLF 3PKYA 1DBDA 4JI8K 3VAJA 2GV1A 3TA2A 4BE1A 1IR2A 3DLJA 1QQCA 4FJXA 4OYZA 3H45C 2D69A 1EO1A 3KFWX 3DLBA 2FXUA 4J2BA 2ZJPL 3O3HA 3PTWA 5CZ1A 2MZQA 3QBXA 2HHHF 3BGFA 3M8WA 1LQ9A 1CLFA 3VQAA 3FSIA 4K59A 3BB5A 1UETA 4OI3A 3G4SN 1WF1A 1D3WA 4KKOB 1KLMA 4FKYA 4P9SA 3V4IA 3VETA 1FO1A 4MKVA 1WOQA 3M6WA 4O5FA 3MR7A 4F0MA 4BCAA 3GFZA 5AQRA 4BDZA 2VOOA 3IA0A 1T9XA 3SSSA 1VI7A 2X6NA 2OYQA 1U24A 3K89A 3HZ6A 4DPOA 3RAMA 2Y1RI 2RF2B 5LJ3Y 3T5JA 3ZZPA 1UZDA 3AO2A 3CJ4A 4DV6F 2VQFF 4ER8A 4W5OA 4NLTA 3OFEA 3MR2A 2LQBA 3BN4A 5K20B 1M90T 5AQGA 3DJCA 2GQ2A 4KBIA 4CWBA 1IG8A 4I7FA 1W26A 4KHQA 3I4HX 3Q8SB 2IBOA 4NXNJ 2EG1A 2B8PA 4GV9A 1RTJA 1RISA 3FEZA 1GX6A 3FCWA 4UUWA 3P49B 2BV3A 3ULHA 2V68A 4CIFA 1RNHA 5FJ4A 2HGMA 3PSIA 2WHOA 2QWMA 4JYAJ 2VG5B 3WQPA 2E1YA 4RR5A 4WQ4C 1VQ9S 3A5NC 2ZZTA 2C2EA 1C0TA 3GV5B 2YH1A 2KXNB 1Y3KA 5HL7L 4QZVB 2DGXA 3CC4N 2NXNA 4F2SA 3C2PA 4N8NA 4CGFA 1VQ5S 1CC8A 2ZH6A 2MTLA 4CFCA 2WSEC 1Q16B 4XDDA 1H2UX 2YPYA 4ILJA 3Q8VA 3HCXA 2ZH1A 5HVFA 3O5TB 2Z1IA 5JS1A 2CGLA 2Q2RA 4QS7A 2L48A 3LZIA 2Q6BA 3OFFA 1J2VA 4KHNA 3M8ZA 3MWPA 2HPUA 2OA8A 3QT6A 2BVZA 1J9AA 1I94K 1BIUA 3R3LA 3OBWA 4AHCA 1KAXA 3KHGA 1HMVB 4NXMK 2JRSA 2KZZA 1WC5A 5DG9A 5HBMB 2QFIA 3ZX0A 4K8ZA 4UQGA 1IBMJ 5LMNJ 2LXIA 1WHYA 2KYXA 1QVGR 3O80A 2XLKA 1PYOB 4YHHJ 3IM9A 1HQ2A 3LANA 5HVHA 5I4MA 2HNYB 1N5SA 3UE2A 1U04A 2JNJA 4F4XA 1Y97A 5DDQC 3MFIA 4LFAJ 5J2PB 3DLKB 3KLIA 5AE1A 3P96A 5J2QA 3OHRA 1VGYA 2I1RA 1X31C 3THXB 1HQUA 3I5AA 5F2RA 2POKA 4OYPA 3NP5A 5K8OA 1YRUA 2BE9B 3QRPA 1XNQJ 2MQOA 2D5RA 1SC4B 4F3QA 2C3MA 1QQNA 4R0JA 4F67A 2P9UB 4DUZJ 3SQ2A 3PKMA 1NJIT 3MEGA 1SXLA 1HLWA 3TSPA 3DOMA 1RAJA 4ZPVR 3VQEA 5HP1A 1VJWA 2XO6A 3QNNA 1IO2A 1TZ0A 5F3TA 4DL2A 3ZSVA 2NPIA 1WKKA 4MKAA 4GKKF 3KLGB 3KK2A 2HFNA 1T6DA 4I6MB 1IBKJ 2QLXA 2ZJPQ 2EWHA 4R5PB 4C11B 4K0KK 4IOCL 1ZC6A 5DM7L 1BI4A 3LPTA 4CRJA 1YJNS 3C7NB 2IYIA 3HVTB 3R2CJ 1CJTB 2JOQA 2JVRA 2GA7A 1YJVA 4FLXA 4JKDA 2QZ8A 4MT1A 4BY9C 5LOQA 3BH7B 4EO6A 3OLAA 4A8QA 3ZZ0A 1MWKA 3L8BA 5M1KA 2OZSA 4AHUA 2CDRB 2RUSA 3O5BA 2AJ0A 5IT9O 1SC1B 3A1YG 4RKUC 2QMWA 2DNNA 3GIRA 3T1YJ 2PBDA 1N56A 3M32A 4GVBB 1CC7A 4YP3A 1JKHA 3QQCD 1EETB 2DHAA 4JUZA 1FA0A 2UXCJ 4KREA 3NGTA 3UFCX 2V8PA 1Q81O 4K4VA 2I9SA 3EL2A 4B1WB 4XO0A 3OTCA 4N8OA 2PMWA 4C3MA 4E0DA 4KB0A 2QJ3A 1W2BM 1W7AA 1XNRK 3HJFA 1TUUA 3JSMB 1WC0A 5H9EK 2H3GX 1FVSA 2B4VA 4NMXA 4EGLA 4NYNA 4ED5A 2W6KA 4B9QA 1VQKS 5HRNA 1N8RO 4E1NA 2DCLA 2LXFA 4I0WA 4CH1A 4PEOA 4UZCA 4EO8A 3R6GB 3IG1B 5CA5A 2BKPA 3QO9A 1O6XA 2MLXA 4ZVHA 1VSLA 1S6PA 4ZK7M 3I55N 1U0SA 4DFKA 1V4TA 4PG5A 1FE0A 2BM0A 2DEIA 5D3GA 1VJQA 1RBSA 3Q2SC 5AFUA 2G8HA 3EXCX 1VRTB 5HL7Q 3MMBB 4Y2AA 3SPYA 5I3PA 1SKWA 3OYMA 4EP5A 2ASDA 4JLHA 1HBNB 3MK6A 4I9LA 2AF6A 1NOZA 1XMOK 2FBVA 3RB3A 1RQ0A 4OYAA 2IM2A 1FERA 3EE3A 1RACB 4E8UA 3OY9A 5T41A 1YTUA 3OXFA 1RBTA 1DTTB 4CH7A 3IRWP 4TU8A 2BE2A 3CXCR 3RAXA 3IR6B 3ZTSA 4B9LA 4XH1A 2AX1A 4ZPTR 1PIEA 3DXBA 3CPWM 4K8XA 3HYFA 4TU7A 2V8DA 4RBUA 4XK8C 3RRKA 3CMEN 5BN8A 2BKOA 5KQ8A 1R43A 2B4JA 1XEZA 1JLCA 4FK0A 1YGYA 2HVHA 2RRNA 3PW7A 2V4JA 3SSRA 4LIRA 4ZJLA 6FD1A 1WWHA 3VF0B 1GXUA 5C2GA 1ZXOA 3Q2TC 4JYAF 3LDSA 1E4FT 1Z25A 4NA1A 3U02A 3LL3A 2FGCA 4WXOA 3D7EO 3MPUB 2F9TA 1AT1B 1YVNA 2RQMA 2N3OA 1NDKA 1SJ3P 3QBWA 2MMYA 4CIGA 1WLJA 4JV5K 3FQLA 1S1TA 3W9JA 2DKOB 5AR0A 4P6QA 3CO0P 3B6OA 3RR8A 4BQLA 2QA2A 4BRIA 1HKBA 2D3ZA 2CPEA 1N5YB 3CETA 4HKQA 1H72C 2RDJA 1X9MA 5L9NA 3GL1A 2Z30B 1BDGA 1EETA 3SLCA 4L3NA 4CO3A 1S6OA 2EKNA 5M1OA 2ZDPA 4FYVB 4FM1A 2DISA 3QSIA 1LK5A 4NXMJ 4ZCLA 1KKHA 1IBMF 5C12A 4DV1J 4ILMA 3W60A 4DR3F 4CEOA 3HKZD 2HYIB 2DRDA 2JEGA 4DQQA 4P10A 3TZYA 2ATQA 4A8SA 4ECVA 4Z0UA 3MX2A 2FQQB 1VQYA 2VASA 2PMZD 4ZLLA 3A0IX 4BGBA 2XYPB 2WAQD 5ELZA 3BO3A 4H0TB 3ILJA 2ASPA 1XNQF 2DGUA 4ITSA 1U1OA 1ATSA 5CAAA 4CF0A 4LSLB 4CJLA 5F0XA 2OPPB 1CZBA 1HL6A 4K25A 1JJHA 3KHRA 4DUZF 1KEKA 2HZVA 2XI2A 2OSRA 2UUWA 3O9RA 2YH0A 1G3OA 1VRTA 4B1XB 2Q43A 1EIYB 1P6TA 1QE1B 3AD9C 3FCHA 3QT5A 5D77A 4WTOB 4C9DA 3AJDA 3JAMU 3EGZA 1HBNA 2J5AA 2X3GA 4ED8A 3PR4A 2VPXB 3C8YA 1Y64A 1WSVA 2AP1A 1BQNB 3D68A 1H0HB 2B56A 2PEBA 4NX9A 2VC1A 1IBKF 2Z2YB 3MM6B 1I3AA 4C8MA 3L7UA 4CECA 1NGAA 4O5BA 2KHDA 1DTTA 3BGOP 3UKUB 4GMKA 2F4VK 4DR1F 2XZWA 2DGVA 3MOJB 3DCAA 4JKFA 4LBIA 1HNWK 1BA1A 4DBQA 4XPCA 3TVYA 3G96A 2JWKA 3KXDA 3CCJN 1LWFB 1ULRA 3LA0A 3PSFA 3VCDA 3PVXA 4DU8A 3KUGA 4JP8A 3QEXA 4Q8EA 4DDFA 3QFPA 3MECB 1G7CB 3MPVA 2IYGA 1YHQS 5J2NA 2CQCA 3OTEA 5E3PA 1Q81T 1Y11A 4A8OA 4KB7A 3T5KA 2V8GA 2EG2A 5C2CA 3RWUA 2UU9J 3MMCB 4X4TA 3VF6A 4BROA 2BRLA 2P5GA 1VQMN 4DEZA 4U9RA 3E9OA 2PGCA 4TVAB 2BH1A 1XNRJ 4C0OC 3QJJA 3E01A 1T9WA 1N8RT 2HBKA 3MMAA 3K8WA 2UVWA 5KFQA 1S76D 2SXLA 5HJXA 2OANA 5BPLA 5IWAK 1R31A 3VHQA 2Z2MA 2JHEA 1UL3A 3EVOA 3EJMA 4PWUA 3BY5A 3ALYA 2OPQB 2YKAA 5G4DA 5DM6L 4BG9A 3GDQA 2L9DA 2RRBA 1HNZK 4PG4A 4ICLA 3NH2A 1C0MA 5T7LB 2E2PA 2FBYA 3U3YA 4GY2B 1FDAA 4DL5A 3N5FA 2E20A 1NMDA 4JBCA 1EWRA 2DNHA 2QLWA 4EWTA 1OH8A 3CMAN 3GJQB 4YNQA 2NQPA 3RBEA 3CC2N 1HWJA 3AVMA 1IN0A 4KPYA 3C94A 3LGHA 3E8OA 1XMOJ 4H03B 2QLBB 3NE6A 3OTOF 3DU5A 3O9TA 3LGMA 4EAHD 3W61A 4FLZA 3Q89A 2R8HA 3DFEA 1RBAA 3MEEB 3IM8A 3BBCA 3IRXA 3HHLD 1Y3JA 2D0OA 2G1HA 5GMDA 4A8MP 4OX9K 1APSA 1G99A 5KT7A 4JKGB 2ZZMA 3CD0A 2JLEA 2GJ2A 1RKJA 3LDLA 2G8IA 5DS7A 1X0FA 2OPPA 1MDUB 2YKNB 1T6CA 5F8IA 2KJVA 2FJDB 3O08A 4GV6A 2BANA 3G4SS 4USWA 4FCYA 3K5LA 3I31A 5B0EA 3MM8A 3PFEA 3FZBA 3SQGB 3QWPA 5L1IA 4UF4A 2DRBA 5SZTA 4LR7A 1HX1A 5FIIA 3KKFA 5KG0A 2KTQA 2RPIA 2NRXA 3VF4A 3BJYA 1BQNA 4H5VA 2YBVA 1SJRA 4JK7A 1T94A 3M1VB 3AQOA 1U2RA 5KFRA 2PMHA 5U47A 4NCAA 4FWRA 2QYGA 4JI7J 4Z7YA 3THWA 4NMLA 3VGLA 2F96A 4M5DA 3WNFA 3PYFA 1FKOB 1DLOB 4LF5F 3TABA 2AJ1A 3RMCA 8RUCA 4FZYA 4F3OA 4JV5J 3BGLA 4CLZA 2UXDF 4Z4GA 3SFGA 2X3DA 1LWFA 4WCEL 1N5QA 4QWCA 1XIQA 4CJUA 4QPTA 3NGZA 3HZEA 1JJ2R 3QETA 3MECA 1FRKA 4JI2F 3TPQA 1HA1A 3WXIA 2FF3B 3SYZA 3BDPA 3O3GA 3I0RB 4CLKA 4M45A 3VQ4A 3FZFA 4Q0BB 1BHLA 3AA5X 1AZSA 3ETOA 4E7IA 4DV1F 4NYPA 2DHXA 1BQMB 1BU6O 4HH0A 3OL6A 3W2WB 4RZRA 2BMBA 4TY9A 3T9NA 3AO4A 3CC4S 2GJIA 3FZKA 4LF1A 1IJJA 4CJPA 3QNWB 3E2EA 4M3TA 1H98A 2YKMA 4FW1A 4AM7A 1BHNA 2HAIA 1R27B 3AFGA 2YV0X 1WNSA 1S77D 1TGOA 3PO4A 2GQQA 2KM8B 4B3SF 1T3OA 2VQEF 3QWUA 4PA1A 4EFAC 2VDIA 2QWLA 2IDOA 5KFDA 4MO4A 4DQ8A 4RUAA 4DPUA 3DC2A 1SUQB 5KG5A 1TKTB 3AA3A 4FP9A 2BR0A 4H5WA 4A2AA 3SXLA 1I51B 4FYXB 3DRSB 3CCMN 2ZUGA 1RGVA 1S6QB 2WW4A 4C3KA 4MMOA 5HI7A 1NPPA 2KHCA 1Z4UA 4BWJA 4RL1A 4CO2A 3CQXA 5DM6Q 2FJAB 2HFZA 3EMTA 4JKCA 3RZAA 3M8QB 4KR0B 4OGCA 1A9NB 4HLBA 4DXLA 5AQWA 5AJ3K 4ZPCA 3OBYA 1AB8A 1SKSA 1NZ8A 3GFXA 1FRHA 1A7GE 4PXBA 4Y3CA 2AJFE 5EDWA 1OO0B 3MEEA 1IKVB 1J5EK 2BX6A 2MQPA 1Q8IA 2X74A 3DRXA 1XUPO 1JLGA 4I6YA 3WDOA 2P9SA 2OSQA 3DLHA 3MAAB 1HNWJ 4AQYJ 4JKGA 3LWMA 4ED7A 3T6BA 3WIUA 4BQZA 3ISZA 3SQ1A 4X62J 1JLAA 1Q7YO 2HBRB 3RB0A 1BD6A 3CDBA 5DG8A 3S6EA 2BACA 3MWBA 2OPSA 1KN6A 2GNKA 3C66A 4O8KA 1WSHA 2FYXA 3RUBL 4DV7J 3MM7B 5DGAA 2QG9B 3BSOA 1Q9XA 1ZAXA 3OYIA 3MWTA 2QA4G 2OO4A 4C8ZA 4OYBA 1YF5L 3DRPB 3KWMA 4ETZA 3TVKA 3OHAA 4KH5A 5A0YB 3VQ5A 2K7JA 2XY6A 4LFBK 2UU9F 4W4MA 3H0PA 5IQ6A 1H7XA 3OYDA 5M1FA 1ZA2B 2MLZA 4WIQA 1VQ7N 3DLGB 5I3QA 4NE9C 1XNRF 5E3RA 5I3UA 2ZHAA 2GW8A 3MXIA 2P9KA 1NU0A 4IFEA 5AQJA 3SI8A 2IMOA 2ALZA 4CEZA 4IQMA 2CJ9A 2IAJB 1KVBA 3HPGA 4Q45A 4QPXA 4B3RF 4YOVA 4OPHA 3G8TA 1FRIA 2BJ9A 2WSCC 3VF2A 2F3JA 5E7OB 4OZ3A 1VHIA 4LBHA 1IQZA 3TX8A 4CJ4A 3QPIA 4CJWA 2E1ZA 2FY1A 1QAXA 4DCHA 1IQTA 4LFCK 5MLCQ 4IQXA 2KRBA 3MCMA 4CLSA 2D3OR 1TL1A 2I5JB 1FDNA 3F9KA 1FF2A 3DLRA 5JVHL 3UNGC 3Q8YA 3TU5A 2QYCA 3H59A 2FC0A 4JOUA 1EX8A 1BQMA 4YY3K 4RW6A 3TUJC 4BC5A 3P5JA 2E5HA 3PRBA 5L1KA 1W9HA 2E2QA 4RNHA 5CCLA 1UVNA 4A48A 1M5OC 1WDTA 3VWSA 1OWXA 4LF4J 3CD6S 3A5OC 1J27A 5H1SQ 4OX9J 3BN7A 3I8DA 3W5YA 1WHWA 2DPIA 1Q79A 4ZDNA 2HBQB 4CD1A 2OELA 2GVZB 1HR0K 2LKZA 4JI3J 3MN5A 4CCHA 3PDNA 2IJFA 3UVJA 2R9LA 4KHPF 4RLEA 4ILLA 5HLFB 2AD9A 3U1LA 1LAVA 2GC8A 2WBMA 3N79A 2CH5A 3TAFA 4ZP9A 2HBMA 3AY9A 3AO1A 4DG1A 2P9PB 3OYJA 3IC1A 4UY85 3OPKA 4F02A 4JI7F 3D28A 2W9BB 2P9NA 4ZP6A 5DZ6A 3CCLN 3NF8A 1VBZA 3D66A 1T3NA 4OVLA 2ADCA 2VPYB 1GLLO 4DR6K 4FF2A 4DF4A 2D0BA 3HX9A 4FNIA 5KFLA 4Q44A 3H4BA 1RT6A 1D8ZA 2CVIA 4JV5F 3NKYA 1KVCA 8AT1B 1ZZFA 3OSNA 5KG3A 2ROPA 1F0XA 4CVNE 3L3UA 3CMES 4C1NK 3HD1A 5D4NA 3GG0A 2EHGA 1URRA 5D0HA 3MUTP 3PW4A 2O1PA 2AYMA 3PW2A 1NK0A 2AEMA 1JXLA 4FLVA 2ZH9A 2CQ1A 2Y3YA 2GO8A 3MM7A 5THWA 3OHBA 4B3MK 1ATNA 4OFZA 3EGWB 1CPZA 1RT1B 4PY5A 3D3BJ 3CCQS 2FJVA 5KFAA 3K17A 1S7IA 3DLGA 3SEOA 2QRRA 1BWVA 3VAMA 4MK8A 4BRLA 3KJNB 3KK1A 4GC6A 3VTHA 4G65A 1EQYA 2EX3A 2CGJA 1IR1A 4IKFA 4J90A 2L41A 5AQOA 3W64A 1YSJA 3KNAA 1KAYA 1YJRA 1ASUA 4O3QA 2Q6CA 1XR5A 2GIFA 1RHUB 5C42A 5J1PA 2XLIA 5M2UA 1E6YB 4LR8A 2NXUA 1QZ5A 3NNAA 1ZTTA 3E9PA 2YNGB 3R8EA 4OO1J 2UUAK 4OX7A 5CR4A 3E1YA 2B9XA 3VA0A 3HTVA 2I7PA 2J0SD 3HHLB 2P5VA 2I5JA 2YNFB 5KFTA 3CGIA 3AJ2A 4NLYA 1AROP 2CADA 2UVVA 2DNYA 2IDEA 3O9QA 4OHWA 5HANA 4KHUA 1HARA 2HLUA 4DLGA 2HRTA 2CPDA 4E19A 3A3NB 3ZEUA 3W2VA 2DXFA 2V4QA 1NK6A 1HFEL 2LEBA 3Q7CA 4WPAA 4HHUA 5AJ3J 1ZAVA 3NVKA 4H4OA 1X7VA 2M3DA 3L4BC 1Y7PA 2ZEJA 2HFOA 1VSKA 1HBUB 3CFPA 2YWWA 5DJBA 5DZ7A 1PBAA 5FRNA 4AQYF 2W4CA 3RTVA 1Q1KA 2OD6A 2U1AA 2GELA 5JVHQ 1PCAA 3CF5L 4ANEA 4X62F 4WZMA 4FYDA 1N33K 4DV5K 4RG8A 3C15A 5D0RA 4FVCA 1KR4A 1FJCA 1WJ9A 2IRYA 3ZSZA 3ZTQA 1SS6A 2FHJA 4LF6J 2NRRA 4DV7F 2DO0A 5DQHA 4CTAB 4MYUA 3H20A 1KWMA 3RR7A 2OTJN 4DU7A 1JB0C 1R0AB 1GLBG 3TTFA 5KFCA 3E51A 2FUG9 4ED3A 5CE3A 3VGUA 3KKRA 3KVGA 1NMNA 2KH9A 1EAYC 5L39A 1HI0P 2LA4A 4CZGA 3AJ1A 4CIEA 4CZFA 4DR4J 1KQSM 1Q5YA 1MW7A 1VIXA 1SB6A 4MIWA 4FDFA 2YXLA 4PYAA 1X4BA 4PKIA 2X6SA 3FZ2A 1KHVA 4Q2LA 3C65A 3ZT0A 4FJNA 4J9QA 3CCJS 3AA2A 4PXCA 1KQFB 4QYZK 1U49A 4BREA 4NCGB 5KOWA 1S9GA 3VAKA 4QS8A 1H2VZ 2PT0A 4USMA 3I4PA 1RLDA 2R2RA 1YITN 4JKBA 4Y0FA 2NYIA 4LFCJ 2LQJA 1F5CA 3CCEN 3JQJA 1K8AO 2Y9HA 5BYSA 4JI4K 3MPDA 1F9FA 4DQIA 4BR0A 4CJTA 1VQMS 4CP5A 1NNEA 3K5NA 2HB5A 3D67A 3CDUA 4B9NA 1KC8O 2M88A 1NHKL 4KGKA 4F9OA 3F9MA 3G6EN 4M3XA 4ISFA 2R4FA 1DAXA 3R1HA 1R8CA 1PILA 2YWHA 2P6TA 5KFHA 4X66K 1VSEA 5DMRA 4LF4F 2C3PA 2UVUA 3EYZA 4FJ9A 1ZBLA 2MLYA 1ELOA 1XERA 2M8DB 2Y8YA 1DQ8A 5HAOA 3DYAB 2HHVA 1LW2B 3M7VA 2J7UA 4Q2MA 1LWXA 4KY3A 4M5GA 2XM3A 2WRMA 1HR0J 2QK9A 4HT5A 4JI3F 3P38A 2HHWA 4FJKA 3DKDA 3AOBA 3CDWA 1L3VA 4L74A 3CMAS 5FPEA 5DGBA 3VEVA 3CC2S 2QEXN 2YNFA 4C0BA 2VU5A 3MCSA 3T6JA 4BDPA 2CJYB 3D6FB 1VYAA 2O4GA 2WVDA 4JI6F 5AQLA 4QJVA 1RLCL 4PQAA 4OI4A 1K1QA 5K8PA 2CQPA 4HHTA 2Q1NA 3IAYA 1KTVA 4AXIA 4J7CA 3OLBA 4ZMMA 5M1PA 4DR6J 1VQSA 3SBGA 2E5IA 1VRUB 3G25A 5L38A 4CE9A 3B6BA 1U4BA 4A5BA 3AAQA 5LJVA 1PGZA 1EZZB 3DLLL 4G9ZA 4DV2F 2JL9A 5FPNA 4OYWA 5HQ8A 4RO0A 5A8KA 4X2BA 1OH5A 3KLHB 2ASJA 2RAQA 1TAQA 3T5HA 4OZ5A 1FTCA 2IIHA 4CTAA 5KFNA 2G8KA 4B3MJ 1U1RA 4KRFA 1R0AA 1HNXK 4ZCMA 3AVIA 2QL9B 1C1BB 1WG5A 2FVPA 3BM7A 4CHYA 3CF5Q 1CEZA 2AWZA 4A8KA 1UVLA 3ENHA 3V5RA 2KU7A 4RBVA 3DRYA 3NS7B 2M4MA 3UDEA 1Q7LB 5RUBA 4DTJA 5HJYA 2UUBK 3KTQA 2HS4A 4V19X 5CHIA 1NBWA 1IKYA 5HROB 1KVIA 2E8AA 4PZVA 2DNOA 2DNZA 1BWFO 1RWUA 3Q8QB 5JMVA 2YX6A 3P6YC 5AQFA 1FESA 4FWKA 4K4UA 1J5OB 3PEHA 3QB0A 2RNEA 5A2QY 2FJEB 1B9DA 4WKYA 1IKXB 3SAGA 1MWMA 3K9JA 1M5SA 4Q8FA 1U6BA 1RT5A 2XHCA 2AYBA 4O4GB 5AQIA 4DTUA 4HTIA 2IC3B 1Q9YA 2B7BB 4ZVPB 1YX2A 2PN6A 2BJEA 4DV0K 4YB1P 2W1BA 4CEQA 1JIHA 5AZJA 4CZLA 1JLQB 3GYNA 1F9EB 3BZQA 4ILHA 1UCNA 4M7YA 3GYGA 4HI2A 3FZHA 4FF3A 4F3MA 3IXQA 1AUDA 2VONA 1L3TA 2PI4A 5B0GA 2OPRA 3FE1A 1VSFA 3PNIA 2CJBA 3L2VA 2VFRA 1XMBA 1GFWB 4DV5J 4I2PA 2HF3A 4CF9A 3WX4A 2IGIA 3FFKB 3BO2A 1SQFA 4LF6F 4A61A 3PW5A 3EXYA 4QYRA 3CCMS 4L76A 2RE2A 2F7VA 3HVWA 4DZ6A 4MFBA 4P7TA 2RMLA 5SUHA 1YVUA 3ZNJ1 5ETRA 1ZBHA 1WELA 4H4KC 3JTOA 2JC0A 1WI6A 2CG8A 1M1KO 2A3JA 5A76A 4RTFD 5K14B 2NUHA 3B54A 4DR4F 1GOBA 5E2QA 4WF9Q 3MUMP 1E6VB 3SIPB 1ICEB 4CT9A 3QIDA 4WQ5A 3H3OB 1HNIB 4Z94A 4J2EA 3R9LA 3WC0A 2BE7D 2DB1A 5LMUF 3BDEA 2W2QP 2ASLA 4ZLPA 4C8LA 2YI1A 2KYZA 5ETLA 2VICA 2H65B 4L3KA 4IO8A 3FNNA 1MU2A 2Z58B 4NASA 1Z05A 4QYZJ 2J6SA 2QTWA 4NO7A 3ZETB 1YKWA 2MY7A 3G82B 3T5LA 4WK1A 3KLHA 5JJBA 3FEYB 1K8AT 4DX7A 4LFCF 1XHXA 4ZIWA 4RW4B 3BKTA 2ASYA 4CEEA 1RTIA 5HN0A 2B4OA 3PYDA 2BQ3A 4YUDA 1VQ7S 3AOCA 3UN2A 1FJGF 3K9KA 3CDEA 1KC8T 3F2KA 4J9PA 1BUXA 2YWEA 2B6AB 1L3KA 4G1QB 3AO5A 2XMKA 3JQMA 3CJRA 3DLLQ 3MR3A 1RU1A 1T9UA 2QLJB 3OYCA 4Z4HA 2DH9A 4LBPA 3QDKA 4IFVA 1QVGM 5GAEI 4CJFA 4X66J 3R1XA 1HI1A 2EC0A 2EWSA 3TSQA 2Q3PA 3S7RA 3OR2B 5C24A 2ZJQL 2JC1A 3RW7A 3TUPA 3GE1A 2CRLA 2BDPA 1FW6A 3VR1A 5C5JA 4M5IA 4DS4A 4M5KA 3GILA 3O2IA 4KRWA 1UJ4A 4IH5A 2ZNYA 3IS9B 3ZCMA 4BLGA 1T9VA 4M1KA 5M2PA 4DWIA 4R8UB 1IKXA 2MQLA 2DGSA 4N41A 3UN3A 4YB5A 1OQ6A 3GBTA 4O4GA 4F50A 1R3NA 1UPPA 4DTRA 1IBLK 1WOSA 3S8SA 3OQ2A 4KSEB 1JLQA 1RE1B 3QJLA 1TUWA 2BQUA 2YX1A 3ZZTA 4YOEA 4FK4A 2XMWA 3C14A 2IVYA 3KD5E 3LGNA 4RJVA 3EKUA 5CY4A 2J6TA 2E9ZA 2QFJA 3RGIA 3O6WA 1NG9A 3HOSA 3NS5A 3TR5A 1Y10A 4CJ7A 3F0NA 1MA9B 3ZX2A 4OYMA 2WBNA 1T0TV 1NK4A 2CPYA 2RKIB 1HLUA 2G0CA 3VQSA 2CZ4A 3BS9A 4NOHA 2ZH4A 4CHZA 4BGAA 1C4CA 4UOHA 3GG1A 3DRRA 3KK7A 5HMZA 1T03B 4HHJA 2DIUA 3D0GE 4F25A 2VC0A 2M7SA 4K2JA 2KFYA 2IVNA 4WIIA 2H9ZA 4DV6K 1WUAA 2VQFK 3QAUA 1LKZA 1QY7A 4DPWA 3CCLS 4JN4A 3NAHA 2XRIA 5BRDA 5F9NA 3MN7A 3DOKA 2CDQA 4WKRA 5CABA 5JVGQ 2ABYA 4USTA 3PYEA 5F8HA 4FZXC 3R5DA 4PABA 2AT1B 1Y0HA 2EC2A 4J9LA 2VFSA 5G0RB 1YJ9N 3MN6A 4N76A 4RW7B 4NL5A 1TUVA 3SMPA 4ZTJA 1CULB 4ZVTB 1X4AA 2VG7B 1EKEA 5K8NA 4WBFA 1AA1B 2OHDA 2QWQA 3AVKA 3NMRA 1L3SA 1BCMA 3MM5A 1SVDA 1U6FA 3ET6B 2MKIA 3G82A 4CZKA 1OYDA 3ZSQA