5C25A

Crystal structure of hiv-1 reverse transcriptase in complex with 6-((4-((4-cyanophenyl)amino)-1,3,5-triazin-2-yl)amino)-5,7-dimethyl-2-naphthonitrile (jlj639), a non-nucleoside inhibitor
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, hydrolase/inhibitor
molecule keywords HIV-1 REVERSE TRANSCRIPTASE, P66 SUBUNIT
publication title Discovery and crystallography of bicyclic arylaminoazines as potent inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
total genus 147
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5c25A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c25A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c25A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c25A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5c25A05
3HVTA 3KHLA 4EEYA 1Z26A 3JSMB 2GIRA 4ZVFA 4B9SA 1JLEB 2ZE2A 2ALZA 3KTQA 1RTJA 3DOLA 4FS1A 1KTQA 4M94A 4CECA 1SH3A 1JLFB 4Z4EA 2WONB 3SQ2A 4K8XA 3H98A 1RDRA 2KFZA 5C24A 1TL3B 3UIQA 4CJFA 3V1QA 1RBSA 2I1RA 3KIOA 4RNHA 2KTQA 4NRUA 5F8JA 2B5JA 2YKMA 1BGXT 4URGA 1WNSA 4ID5B 5E41A 1SKRA 4E3SA 3VQ5A 3OS1A 2GUIA 3PO5A 4DMNA 4YNQA 2WOMA 4DLGA 2Z1IA 1ZBFA 4RU9A 3AV9A 3ZSRA 3RBEA 3LP2A 3MEEB 4E19A 4W5TA 4I7FB 1RT5B 4IOBA 2FVRA 4LH4A 1KSPA 4HHTA 1RT3B 2BANB 4FW2A 1VSLA 3RR8A 2VA3A 2KZZA 4ZVHA 4FYDA 1LWEA 5CYMB 2I5JB 4WXOA 4M42A 2IA6A 4UQGA 3L8BA 5KG5A 3SFUA 3PR4A 3OYFA 3EY1A 4NLGA 3DM2A 4IKAA 3QO9A 3MEDB 2F8EX 1S0NA 1QQCA 1RBRA 2Y1JA 3RMDA 3AVLA 3KLFB 4CGFA 3H5SA 3D5MA 3LP1B 1NKEA 2ILZA 4FCYA 3TAEA 1JXLA 4KB0A 2YHAA 1SH2A 1XI1A 4HUFA 4Z4FA 4ICLA 1NKCA 1C1CA 4NLTA 4DWIA 5CZ1A 3CJ4A 1QSSA 4RW6A 3BSAA 2IDOA 4BE2A 3RB6A 4CGJA 4AHVA 4CJUA 1RYRA 4DG1B 3AVAA 3GYNA 1KVCA 4M95A 4J2BA 1LAVA 1JKHB 5KFEA 3AO1A 4OLBA 2RPIA 3NGDA 3VQAA 1TKZB 4O4GB 1FKPB 4NLQA 4IDKB 4IFVA 4K50A 4TSXA 2P5GA 4F3TA 1BIZA 3PY8A 4KTQA 1ASVA 5KFVA 4ECWA 4J9QA 3D0PA 1ZBIA 3KK1A 3OYDA 2W8KA 5J2NB 3HXMA 5EWEA 3ZSYA 4CJRA 4H4MB 1N6QB 1RT1B 3SUOA 1T3NA 1SH0A 4B9NA 2VWKA 3MFHA 1HNVB 3NF6A 4KFBB 3MR3A 3QNOA 3QETA 2XY6A 4I9LA 1S9FA 3NAIA 1KLMA 1NOYA 1R0AB 1ZETA 4Y1CA 4ED8A 1BQMB 3M8PB 1JX4A 4ECTA 3BGRA 5DG7A 4BDYA 1JLBB 2JLEA 4RW8B 4PA1A 3DLBA 4J9NA 1BI4B 3VN5A 4IR1A 3Q8SB 4ZMMA 2JEGA 2J6TA 3LAKA 3HPHA 4G3IA 4OKEA 1BQNB 4KAIA 4NCAA 3E01A 5FDLA 4IH5A 3KLVA 3DI6B 4CGDA 5KFZA 2IBKA 3KMSA 1C0UB 1C1BB 3SPYA 3FQLA 4Y34A 3PZPA 1ZTTA 3CDUA 1S1VB 2HNYA 3KMQA 1C0TA 4RG8A 2HMIA 4TYBA 2QE5A 2BQRA 3DLEA 4DLEA 5KG4A 4IR9A 1UAXA 5JXSA 4O44B 4KKOB 3ZSXA 2BGGA 4RUAA 1EP4B 5KT2A 2XCAA 3D45A 4Q0BA 3WNGA 1BI4A 4GVMA 2JC0A 2FLPA 5I42B 5KFIA 4M3XA 5I3UB 5J2QA 4CE9A 3EZUA 4QAGA 4KO0B 3M8SA 3PW7A 1JLAA 2WTFA 2XC9A 3ICLA 3T5KA 5F8LA 2W8LA 3SCXA 4CEBA 4CF9A 4LSNA 3K5NA 1NOZA 3Q8PB 1S1WA 3RAXA 1S1XB 3SV4A 1TVRA 1LWCA 5KG3A 3EZ5A 3OHAA 5KG1A 3MAQA 1HNIB 1FK9B 3DLKB 4H54A 3LWMA 1MU2A 4DU4A 2IC3A 1QAIA 2XRIA 5L1LA 1LW0B 1TP7A 4HTUA 4FLWA 4FW1A 1DLOB 3IG1A 1VSIA 1RBTA 2YHBA 4KHNA 3KLIB 4ED6A 3LZJA 1REVA 1CXQA 1SV5B 3DRRA 3HKWA 3SJJA 3UDLA 4DSEA 1S9EA 4B08A 1W0HA 3VQ7A 1HMVB 3AA3A 2HW3A 3H59A 4ECXA 4URQU 4IG3B 2XO7A 2FJVA 3AVJA 1FK9A 3H4BA 1CLQA 3OYEA 3ZCMA 2X6SA 1TL1B 1JLCA 1RA6A 2IM3A 1TAQA 2ZKUA 4R8UB 1T8EA 2YNGA 2R2TA 4FVMA 4TY9A 4ZVEA 3LP3A 3BSCA 2Z1HA 3QEXA 5DQGA 3OJUA 4Q5VA 2DTUA 1N4LA 1S0MA 1L3UA 2ZQBA 1TAUA 4KE5A 3ISNC 3OL9A 4EYHB 3KK2B 1KVAA 3H08A 3AO3A 3RBDA 2R7YA 4CK2A 1N56A 3G86A 4O0IA 1GX6A 4CJ4A 2OYQA 5KTQA 5F8HA 4CHYA 4J9LA 5J1EB 1T05A 5HROA 2HVIA 5KFCA 4ZPBA 1LW2B 1TKXA 1UOCA 4R8UA 4NLOA 2EX3A 2VG6B 4OKKA 4N76A 1RT6A 4W5QA 1DTQB 3RAQA 1RDAA 4E89A 3NBPB 3WNFA 4DFMA 1KHVA 4QWAA 5EUHA 2ASJA 4WZMA 4KI4A 1XWLA 5KFMA 3IRXB 3CDEA 3K2PA 3I0SB 2XY5A 3NH1A 5CYQA 1BIUA 2W9BB 3ZSZA 2C2DA 3V81A 1C1AA 3AVFA 1I39A 3MECB 4CJ5A 1NNDA 3OYBA 4CERA 2FBXA 4NLWA 2HAIA 4C8NA 4KSEB 2PYJA 4FJ9A 2G8WA 1CZ9A 4RW7B 1YVFA 2VWJA 4H8KA 1J54A 2OH2A 4PY5A 2ILYA 2X74A 4NLUA 4Z4HA 3PW0A 1HQEB 3IAYA 3UPFA 4EBEA 1RTDB 5L1IA 4C8MA 1B9DA 3NL0A 1QE1B 2HNZA 4ECZA 1WNEA 4IBNA 4JUZA 2V9WA 3OYJA 5KFOA 4IRDA 3C94A 4ZP6A 4EBDA 1RBVA 4J9SA 2A1SA 1ZTWA 3C6UB 2B43A 3KKRA 1VRUA 4YR3A 1WAFA 2FLLA 1JL1A 4PUOA 1SUQA 4NCBA 4C8OA 2HB5A 4ED0A 1X1PA 1VSKA 4CEOA 5DQHA 3TABA 2R8IA 3LALA 4R5PA 2XHBA 3VQDA 4IRKA 1IKYA 3RB4A 4FZZA 4O3RA 1KFSA 1IO2A 5CY4A 2YNFA 5JUMA 4JV1A 5KGXA 1LWFA 2YKNA 2ZD1B 3OYGA 3LP0B 2C28A 5C42B 1DTTB 3V4IB 5F8NA 4OPKA 4ZPAA 3AVMA 4JS5A 4LQ3A 4CFCA 1L5UA 4KHYA 2F8SA 1IKVA 3C6TA 1TKTB 2RF2A 3KNAA 4TQRA 2DPJA 3V6DB 4DTUA 2QKKA 2OPQA 2E9ZA 4J2DA 4WE1A 1QSLA 2AJQA 4PWDB 3JYTB 3L2QA 4CHQA 2RDJA 3IGNA 4CIEA 4C8LA 4PQUB 4AHUA 2ATLA 2O4IA 3ULDA 1IG9A 2W9AA 4RW9A 1IKWB 2P1JA 4IG0B 1KVBA 3MF5A 3HVTB 3QIDA 4ZTJA 2ZE2B 4WYWA 3DOLB 3IGVA 1RDDA 3P5JA 3V9UA 3GIIA 1EXQA 4EBCA 4NYFA 2YNHA 4KPYA 3AA2A 1QUVA 5KT6A 4AHCA 5C24B 4Y1DA 4FLTA 2E6LA 4FLUA 2VA2A 3QEWA 4IQXA 1VRTA 2B5JB 2O4GA 2YKMB 3DLHA 3MTKA 2XI2A 4IH6A 4CFDA 3HPOA 4E7KA 4FLVA 2IM1A 4QPXA 3CDWA 1S6QA 4F4XA 2WOMB 2IJNA 1Q8IA 3LP2B 4NLDA 3P83D 3AO4A 3TAMA 1TGOA 1K6YA 1WLJA 5KFBA 1HYSA 2GV9A 4IRCA 4EP5A 1GOBA 3M8QA 3MXJA 1HYZA 4E7HA 4FJ5A 4WXWA 4M3UA 4F4WA 1LWEB 5C25A 3ZT1A 3RR7A 4DU3A 3NCIA 2BE2A 3DM2B 1GX5A 4I2PA 3QO9B 1QTMA 2R2UA 2KZMA 3HO1A 2CKWA 2IS3A 4NYZA 2JEJA 1ZBUA 3SUNA 5DGBA 3KK3A 4M41A 4M3WA 4OLAA 3B6OA 3NDKA 4DFPA 1X9SA 4N5SA 1XR5A 2FC0A 3KLGA 4ICLB 1C1CB 3NF9A 1A5WA 1RYSA 5KFPA 1SL1A 4RW6B 3VQ9A 2HHSA 3TANA 4FK4A 3CJ3A 4F4ZA 5KFUA 2G8IA 3HM9A 1U49A 3DLGB 3GV5B 4LD0A 4B9UA 3OVNA 2QV6A 2W7PA 3KJVA 4K4TA 1JLGA 4IFVB 4O3NA 3V9XA 2W9CA 3OYMA 3F73A 3OL7A 3KK1B 4O3OA 4FJLA 4FJJA 4TYAA 1U45A 4QWEA 3U3YA 4HCBA 2EC0A 3SUPA 1L3TA 2HHTA 3CO9A 2E6MA 4ZHRA 3DLGA 1NHVA 1S5JA 4KAZA 1RCHA 1KLMB 4DL2A 5HRPA 3BGRB 2R8KA 4AHRA 4CGHA 1XC9A 4DTJA 1QSYA 4CK3A 3WNEA 4KV8A 4DTXA 2DFEA 2XI3A 4JRQA 3T1AA 3ZSWA 4DSKA 1JXBA 3E01B 5FDLB 4NLSA 2HHQA 1VSHA 3QGHA 4CJTA 3CJ5A 2OPRA 2D3ZA 1WSGA 3Q8QB 1GOCA 5FRNA 3L2RA 4GC7A 1CXUA 2G8KA 3AVCA 2HNYB 1C0TB 5HP1A 5DQIA 1FXXA 2AQ4A 1S49A 2HMIB 5KFJA 4J2EA 3AO2A 4YR2A 3DLEB 3PO4A 4ED3A 3FFIA 3H40A 4YMEA 5KG0A 4EYIB 4YR0A 4Q43A 3I0RA 4Q0BB 2WCXA 5KFSA 2FBTA 3SQ4A 5J2QB 3KOAA 1VSMA 1QAJA 4JLHA 4B3OA 2YV0X 4E7LA 4O55A 1JLAB 3PX4A 1VSDA 1RT7A 4NCGA 2P51A 4CHNA 1K1QA 4LSNB 4KRFA 1S1WB 2FVQA 1S1TA 1TVRB 1LWCB 3A2FA 3QEIA 4Q45A 4JV2A 4NZ0A 1YT3A 1Z4UA 4N47A 3LWLA 2ASDA 3MEGA 4CJVA 1RTHA 2JEIA 1MU2B 1U47A 1TKDA 2DY4A 2KFNA 2IC3B 4Y3CA 4DEZA 2J6UA 3VQ8A 3ISND 2X6NA 3CFPA 4ELVA 3RTVA 3IG1B 2R8HA 4CF1A 2ETJA 4GC6A 2B6AA 2UVUA 2VG7A 3NE6A 3U6FA 4BDZA 1REVB 3AO5A 4AILC 3V6HA 3DRPA 3DRRB 3AVGA 2FJWA 1ZBHA 2WB4A 1JXEA 1S9EB 1S9GA 4FJMA 4E7JA 3N6LA 4NLXA 4FZYA 4EO8A 5J2MA 1FKOA 4ZVGA 4FJ8A 2A1RA 4DL5A 1EX4A 3CVKA 1JLCB 4B8AB 4DL6A 2YNGB 2D41A 3ZT4A 2BQ3A 3ZT0A 4CESA 1KRPA 3HK2A 4KB1A 3QNNA 3NGIA 2C2EA 5J2PA 2D3UA 2BDPA 3DOKA 4M3TA 3F9KA 2G8UA 1BISA 3T19A 1Z25A 4FJNA 1LV5A 4CEZA 1JLQA 3HT3A 1T05B 3V9WA 1NJWA 5HROB 4BWJA 2AU0A 3N6MA 2FJXA 4QWBA 2E9TA 4LH5A 1S1UA 1TKXB 3EPIA 4DF4A 2Y1IA 5K14A 3QLHA 1UWBA 4KHSA 1RT6B 3TAGA 2V4QA 2BR0A 3DMJA 4FJKA 1EETA 1Q9XA 3BQ0A 1RA7A 5CYQB 2HVHA 2AGQA 2UVWA 3ZT3A 3V81B 1T03A 4E7IA 1B9FA 3OYIA 4EO6A 2XGPA 2V0NA 1YTUA 4ZTFA 5SWMA 1VSEA 2IAJA 1O1WA 2UVVA 4HVJA 1OS5A 5DLGA 1TK5A 4U7CA 4CEFA 4KHWA 3THVA 5KFGA 4HCCA 1RAJA 4MFBA 4FXDA 1YTAA 4CF0A 3OSNA 1NK0A 3ALYA 4DTOA 1KFDA 2KQ2A 3HHKA 5HLFA 2UUTA 4OGCA 4ECQA 3T5HA 1KCFA 4WYLA 2OZMA 2F8TA 4TY8A 2HNZB 4EZ6A 3VQ4A 3BR9A 3ITHA 1WAJA 3G10A 2XGQA 5SZTA 3KD5E 3OYNA 4MIBA 4K4YA 4O3SA 3NFAA 1X9MA 3NMAA 3K5MA 2QKBA 4ED7A 4NRTA 3K5OA 1VRUB 5KFFA 3QYYA 3OYCA 4CFBA 4I2QA 4ZP7A 3S3OA 4E1MA 4O3PA 1IKXB 5KT7A 4PUOB 4R0EA 4DTMA 1SUQB 3LZIA 3L3VA 4W5OA 1S10A 1QS4A 5JS1A 1J9AA 4ECYA 2G8FA 4R5PB 4OGEA 4E1NA 1SKWA 1IKYB 4CJ3A 1IH7A 4AHSA 2YNFB 3O3FA 4FK0A 1LWFB 2YKNB 4IH7A 5EU7A 4CJPA 3KHGA 3DYAA 4IFYA 1WSFA 1IKXA 2RKIA 4DSJA 1IKVB 4QWCA 3T5LA 3C6TB 2RF2B 4E0DA 4DSIA 4L8RB 4M3RA 1HPZA 4F3OA 4RW4A 3HL8A 4WZQA 4GW6A 2OPQB 4G1QA 4WE1B 3RB3A 3LDSA 4CFAA 3K57A 2XCPA 3NKYA 5KT3A 4BE1A 4CK1A 4W5NA 4ELUA 1TV6A 4RW9B 1YVUA 1ZBLA 3OLAA 3NGYA 3QIPA 1BL3A 3NAHA 1WN7A 4K4ZA 1S6PA 4BE0A 3DRSA 3OS0A 5D3GA 3KLHA 1RT2A 3BQ1A 3CM6A 3TAQA 4Q8FA 1CZBA 4HKQA 4QCLA 4J9KA 3RRGA 1HQUA 4CGGA 1U48A 3HP6A 3GV8B 3SZ2A 4DQPA 2YNHB 3BSNA 2ATQA 2GBZA 3IN5A 2ASLA 3NHGA 3OLBA 3AVHA 2V4RA 1VRTB 2F96A 3ZSOA 3O4QA 2FBYA 4CGIA 1XR7A 1WSHA 3AVIA 3QEPA 5F8MA 3TR8A 4F2RA 4B9TA 2E4LA 2IGIA 3HPGA 2VG5A 3VQSA 1S6QB 4CEEA 3NGZA 1EKEA 1RT4A 2HNDB 1SKSA 3S3MA 2OA8A 2OPPA 4XIUA 3O3GA 3FDSA 3MXIA 4DU1A 3TAMB 4LSLA 1HARA 4CJKA 1HYSB 3KLEA 3HJFA 5HBMA 3AVBA 3M8QB 3T5JA 3VQQA 4CF8A 3TQ1A 1J5OA 3AVKA 2PYLA 5F8IA 1G15A 4ECVA 1TK8A 2YNIA 4M45A 1I6JA 3HVWA 2OPSA 5C25B 4QWDA 4BWMA 4QOZB 5KG2A 1I3AA 2Z1JA 3V1RA 4RZRA 2IM0A 2BE2B 1RTIA 4I2PB 1SL0A 3AVNA 3SI6A 4MK9A 3IS9A 2HNDA 1LAWA 3KK3B 4WFXA 3U3GA 2IM2A 1D5AA 3SV3A 2JEFA 3KLGB 3KHRA 4B9MA 4N41A 4URSA 2P5OA 1RDBA 3B6PA 1HRHA 1S97A 2CJQA 3D28A 1RDCA 5KFNA 3NF7A 4RNFA 2D0CA 3TI0A 4YFUA 3I5CA 2LSNA 1K1SA 1XHXA 4W5RA 3CM5A 1B92A 2UUWA 1U4BA 5T14A 4JV0A 2C2RA 4MH8A 4ZP9A 1C6VA 1U04A 3KJVB 3TARA 4H4OA 2D5RA 3GIMA 4HUEA 1KLNA 4XPEA 3V6KA 4EP4A 3QZ7A 1T94A 1SL2A 1JLGB 3PUFA 3SI8A 2W9CB 1N5YA 3G6YA 2NUBA 2XY7A 3MFIA 4NYNA 4RNMA 3JSMA 2UVRA 1RBUA 4CHOA 1JLEA 2B4JA 4ELTA 3NAEA 1U09A 3KKSA 4IKFA 2RDIA 3VQPA 3PX0A 4ZHRB 1JLFA 3E51A 4RNNA 3SQ1A 2WONA 4FJGA 4DTSA 1TL3A 1C0MA 4J9OA 2G8VA 4WFYA 4YQWA 3PV8A 2AX1A 3VQCA 4J9MA 1XHZA 2PY5A 1C2PA 4I9QA 4CEAA 5F9NA 5KFAA 2IOCA 4KV8B 3CFOA 4ID5A 5KFDA 3HVRA 3QIOA 4CJQA 3OYAA 2OPRB 3ZSQA 4ECRA 5KFWA 4FBUA 4B9VA 4CHZA 3LAMA 5F9LA 3MEEA 2BQUA 2GIQA 3O3HA 4I7FA 1RT5A 1A5VA 5HP1B 4N56A 4Z4CA 3CIZA 3CYMA 1RT3A 5HRNA 2BANA 1W9HA 3FFIB 4MIAA 1N48A 4DF8A 1HJRA 2R2RA 4MKBA 3I0RB 4DQSA 3BDPA 5CYMA 2I5JA 5KG7A 2DFFA 5C5JA 5KGWA 2OZSA 3Q8RB 1KHWA 4YP3A 1WSIA 5L1KA 3MEDA 4QW8A 1TK0A 4B3OB 2E9RX 5JS2A 3HSTB 4RUCA 3C95A 5KT5A 3KLFA 4MK7A 4CEDA 1RT7B 4NCGB 3LP1A 1NK8A 4FM0A 3PW4A 4TN2A 4FM1A 4TXSA 1S1TB 4CEQA 3PHEA 3PJWA 1J53A 3CFRA 4FBTA 4X2BA 1S4FA 4HYKA 3OJSA 3WNHA 4XO0A 3PVXA 3MEGB 1NK6A 4DG1A 1X9WA 1RTHB 4ID1A 3OSPA 4B8CA 1JKHA 4F4KA 4LQ9A 4FJXA 3UQSA 2JGUA 3K5LA 4DL4A 1TKZA 4O4GA 5HRRA 4OPJA 1Q9YA 1FKPA 1W25A 2B6AB 2R8JA 2VG7B 3GIKA 3H2LA 3OYHA 2R8GA 4IDKA 4BACA 3DRPB 4KTWA 4Y2AA 2D7SA 2EHGA 2X78A 5EWGA 1S9GB 5J2NA 1NK7A 3MR5A 1D9DA 3QERA 3GQCA 4H4MA 5J2MB 1N6QA 4JS4A 3HP9A 1RT1A 3ZT2A 3GILA 1FKOB 4HUGA 3EYZA 1HNVA 4KFBA 4DQIA 4KREA 3G6XA 4NLPA 4FJHA 3CQ8A 1R0AA 3TAFA 3SFGA 1BQMA 5FRMA 3M8PA 4ECUA 4AH9A 2FBVA 2JC1A 1NJYA 3RMCA 1JLBA 4RW8A 1ASWA 3QINA 4K4SA 2RN2A 5L9XA 5KFTA 5J2PB 3SQ0A 1BQNA 3DOKB 3DI6A 2AWZA 4KHUA 1C0UA 1C1BA 4DTPA 4FK2A 3I5AA 5KRSA 1JLQB 3TWHA 3RRHA 1S1VA 3M8RA 3CJ0A 3LPUA 2AGPA 2HHXA 1S1UB 3QZ8A 1NJXA 5K14B 3DDKA 3QLHB 1UWBB 4O44A 4KKOA 3PW2A 5DG8A 1EP4A 3GIJA 3K59A 3TAPA 1L3SA 3DMJB 2DPIA 4FM2A 1NK9A 5I42A 5I3UA 4J9RA 1EETB 3SPZA 5KFYA 4KO0A 4CJEA 2ITGA 2HHUA 1A5XA 5DLFA 1T03B 4LY7A 1CSJA 2FVSA 4C8KA 3V1OA 1S1XA 2IAJB 3SNNA 3V6JA 1NJZA 3FSIA 4Y2CA 1WSEA 4Z0UA 4CJWA 4FLXA 2XY8A 4AHTA 4TQSA 3L2UA 5F8GA 1HNIA 4MFBB 3DLKA 3RWUA 5KFQA 5FROA 4DFKA 4O0JA 1D9FA 3M9MB 2W42A 4Z4IA 4KHMA 3UR0A 3OY9A 3L2WA 1LW0A 4DS5A 1DLOA 1UA1A 3ASMA 5HLFB 4ZP8A 4OL8A 4DQQA 3M9OB 4KB7A 1RILA 3BJYA 1XR6A 3KLIA 2HHVA 1F21A 4MQ3A 1ZYQA 4TY8B 1SV5A 4KBIA 3LANA 3ITHB 3MR2A 3BQ2A 5KT4A 5KFHA 1HMVA 3N6NA 5DGAA 3RMAA 3AA5X 3HVAA 3FQKA 3S3NA 4IG3A 5KFLA 4J2AA 4K4VA 2DFHA 2Q3SA 2J6SA 4DTNA 1TL1A 4DQRA 1L3VA 2WK4A 4I2QB 2FVCA 3G6VA 1JL2A 3FRZA 5KG6A 1NHUA 4NLYA 3QGIA 1NK5A 4DFJA 4FJ7A 4OJRA 3MR6A 4WFZA 3SUQA 3MXMA 4JRPA 4FZXC 5KI6A 4B9LA 2HWHA 3KK2A 1JIHA 1HYVA 4DTRA 2XWYA 4RNOA 5CZ2A 4CIFA 3PW5A 3OHBA 2R2SA 5J1EA 5KFRA 4ECSA 1ASUA 3DYAB 3OL6A 4KHQA 4FS2A 4TLRA 1LW2A 4IFYB 3EPGA 5T7BA 2RKIB 2VG6A 5HRSA 3QEVA 3RMBA 5L1JA 2D0BA 1DTQA 1BCMA 1HPZB 4RW4B 3NBPA 3H5XA 4G1QB 1BCOA 4KI6A 5DK5A 3OYLA 5DG9A 3M9NB 4QW9A 4F50A 3IRXA 3PR5B 3OYKA 5KFKA 4F2SA 3I0SA 3GV7B 1TV6B 3PX6A 3TVKA 2W9BA 3V9SA 3QIPB 4GMJB 4Q8EA 3L2VA 1S6PB 1VSJA 4EZ9A 3DRSB 5D3GB 2WHOA 3KLHB 1WSJA 1RT2B 3VQ6A 2PZSA 4K4UA 3MECA 1NKBA 5KRTA 2AGOA 4MKAA 1HQUB 3VQBA 2BRKA 4ZPDA 3CJ2A 4MK8A 4O3QA 2G8HA 1VK0A 3P1GA 4NLVA 3VA0A 3HYFA 4RW7A 4ZPCA 3PJXA 4CHPA 4CIGA 4KHRA 4U6PA 2W7OA 3OL8A 1RNHA 4Z4GA 2HHWA 2Z1GA 1HQEA 4ED1A 4CJSA 4DSLA 1RTDA 2BRLA 2VG5B 3SYZA 1QE1A 1ITGA 4F8RA 3OS2A 2KW4A 1RT4B 4K4XA 4KTZA 4OVLA 2OPPB 1Y97A 3L3UA 4FLYA 3H5YA 4M3YA 4LSLB 3LPTA 1BHLA 2C22A 3NF8A 4F4YA 3T3FA 3C6UA 3KLEB 5HBMB 4K4WA 4XPCA 1IM4A 1J5OB 4DL7A 3V9ZA 1GOAA 2YNIB 3K58A 5KFXA 1VSFA 2FVPA 2OPSB 3QESA 1T7PA 4DS4A 3CWJA 5DMRA 2HWIA 4DSFA 4M3ZA 1RTIB 1S0OA 3I5BA 1QHTA 3BREA 4BDPA 4K8ZA 3NH0A 3I8DA 3KHHA 2FLNA 3IS9B 2AX0A 2D0AA 2O5DA 3KD1E 4OKJA 1MMLA 2WRMA 2ZD1A 3QGGA 3LP0A 1NK4A 5C42A 5EWFA 2IJFA 1UA0A 5EDWA 3S9HA 4CCHA 1DTTA 3BSOA 3V4IA 4DL3A 1RTJB 4O4RA 3AA4A 4ED2A 1TKTA 1D8YA 3ZSVA 3V6DA 2QK9A 2GC8A 4CF2A 4O5BA 1D1UA 4J9PA 1S48A 3H5UA 4Q44A 4PWDA 3JYTA 3VQEA 4FJIA 4H4OB 1D0EA 3NH2A 2IMWP 4PQUA 3CG7A 3RB0A 3O4NA 4CJLA 1IKWA 1N5YB 3DLRA 4FLZA 4IG0A 1TQLA 3G0ZA 3H4DA 3VA3A 4NLRA 2QXFA
chains in the Genus database with same CATH superfamily
1Z26A 3JSMB 3DOLA 3E3XA 4FS1A 1KTQA 1TZ0A 2WBMA 1IN0A 4RWWA 1JLFB 1DY3A 2WONB 3UIQA 1CC7A 4CJFA 2MQ8A 1FJGK 3V1QA 4DV2J 1RBSA 3KIOA 4RNHA 4NRUA 2VICA 5K9FA 3MAAB 3L7UA 1WF1A 5LMUJ 1UVIA 2E7VA 1BGXT 4S0MA 4URGA 5E41A 1SKRA 2PA3A 4E3SA 2F8MA 3VQ5A 2R7OA 4OZ1A 5J1PA 4PCQA 2CGLA 1MN7A 2UU9F 3AV9A 3ZSRA 4LFBF 4FWQA 2GVDB 2X3GA 4I7FB 1RT5B 4IOBA 3QRQA 4Y65A 4LH4A 4WBFA 5AQTA 2ASMA 5HSPA 2BANB 3PYDA 1FERA 2RU3A 2KZZA 2UUAF 3D4JA 4UY8T 4ZJLA 4OZ2A 2OI2A 3EY1A 4PPDA 1B7FA 4K2JA 4FPRA 1UFWA 4ZKAA 1S0NA 3KKFA 1QQCA 2Y1JA 2C3MA 2CVIA 2GVZA 3AVLA 3H5SA 2WAQD 3M2UA 1APSA 2DEJA 4HUFA 4Z4FA 2KJVA 1ATNA 3FBBA 3W8PA 3WX4A 3NOCA 1BD6A 3FZKA 2B9EA 1ESVA 3I8BA 1CS4A 4BR9A 4CJUA 2LVWA 3EZOA 4X4RA 1KVCA 5C10A 5KFEA 3MPWA 4OLBA 1OJ4A 1FHTA 3VQAA 3WXMB 3NS5A 5FJ4A 4O4GB 2OO4A 3BB5A 3R5AA 2HVDA 4DPWA 3D2EA 1Z6RA 2XSJA 4DPTA 4TSXA 3PY8A 1BIZA 2OTLS 3D0PA 5CD4H 5J2NB 1HR0J 5AE2A 5EWEA 1N6QB 3WIVA 3UD5A 1T3NA 2M7SA 4B9NA 4KFBB 5I3PA 3FVYA 2XY6A 4I9LA 1RACB 1S9FA 3NAIA 1KLMA 1NOYA 4Y1CA 4ED8A 2HFNA 4LRAA 4BDYA 3GONA 1RK8A 2DVIA 4P2XA 3M5RA 1QVGR 2XMVA 5D4NA 2NYHA 4IO1A 3H6EA 2RRNA 4OI0A 3HPHA 4OKEA 3DU6A 4NCAA 1M0SA 3A3NB 2V63A 3PKYA 1PILA 4AM7A 1C0UB 1C1BB 2CPFA 4DR3F 3EKUA 1TR0A 2Z4PA 3EM1A 3KMQA 2VYPA 2LDIA 3QFHA 3DLEA 3JTPA 4UOHA 2O8CA 4CLKA 1SJFA 2GNKA 5SUHA 2HURA 4KGMA 2BGGA 2IVFB 2GQCA 4O8KA 4BROA 2XCAA 2VBYA 3VGSA 3D45A 2ZFHA 3MGJA 5I42B 1VQOS 3MR7A 5KFIA 4NASA 2Y8WA 5J2QA 4CE9A 3EZUA 4KO0B 1F5BA 3M8SA 1ZOTA 2QFJA 3PW7A 2Q79A 3ICLA 4DN0A 5IQQA 4CF9A 2XS5A 1K8AO 4AL5A 5F2RA 1S1XB 4ZJOA 1UVNA 3IM9A 2O8DB 5GAGU 1AB8A 5LSOA 1XC3A 3I9V9 1HNIB 2HQDA 4PXCA 4H54A 2FJBB 3WC0A 4X62K 1ZM4A 4KGXB 3UN3A 1TP7A 4HTUA 1VSIA 2JRSA 1OSCA 4KHNA 2WVCA 3HSJA 3SSQA 1REVA 1CXQA 2QMWA 2LKZA 1HBMB 3CCJS 4GO7X 5D4OA 5K8NA 1IBKK 4B08A 3CJCA 3A8IA 2K8GA 1WG1A 2G0JA 4RU2A 3H59A 4ECXA 3QDKA 2FJVA 3A5NC 3AVJA 4CNYA 2UXCK 2ZBPA 1M1KO 2DNOA 3J7ZT 3J80Y 5CZVA 2ZKUA 2OEMA 1T8EA 2R2TA 4ZVEA 3W9IA 4WQ4C 4QS9A 2K3KA 5FPEA 2Z1HA 3QEXA 1KOHA 3N01A 4J37A 1B0VA 4BC9A 2ZQBA 3ISNC 4EYHB 2AP1A 2HBQB 3KK2B 4MYTA 4CK2A 1HI1A 3G86A 4E8UA 3KG4A 3VAMA 3OXLA 1KD1T 4LF7F 1UVMA 4L74A 3TA1A 1YG0A 1RT6A 2R9LA 1ZM3A 1RDAA 4UY8O 3HOTA 3NBPB 3PRBA 1QDUB 1IM6A 1TU0B 2DH9A 2V50A 1BDGA 1RLDA 3GJSB 4WZMA 4CD3A 2P9SB 2E5LJ 3MMAB 3I0SB 1NAQA 4CZKA 3NH1A 1BIUA 3N4PA 3G4SN 4DR5F 4F25A 4LT6A 4PPZA 4CERA 2WBNA 3CUNA 3BF3A 3M32A 3FMWA 2PYJA 1DJ0A 2BKNA 4NEZA 5EN1A 4WTYA 1NWKA 1J54A 4M63C 2NCKL 2ZNZA 3KDNA 3J81Y 3IFEA 5ETLA 1YJWN 4PY5A 4USVA 3UDEA 2B3TB 2YWEA 3UPFA 2CPZA 4PYDA 2BYCA 1QE1B 2HNZA 3ENVA 4JUZA 4U7UK 1TELA 1F9EB 2FJDB 4P7TA 3SBMA 7FD1A 1PYSB 2RT3A 2O8BB 2P9NA 5M2UA 4PXDA 1RBVA 2OKQA 3DWLA 5AQGA 3C6UB 1H38A 3W2VB 3RU0A 4YR3A 1WAFA 1TMMA 1JL1A 3G82B 4JYAJ 3RVCA 1SUQA 4C8OA 2W4CA 4DV6K 4ED0A 1X1PA 1VSKA 1X4DA 5DQHA 2V34A 4ENOA 3VESA 3CC4S 3I55S 2IHR1 2XHBA 4TNOA 1S59A 3RB4A 4FZZA 2A3ZA 4LJMA 3U1NA 3Q7BA 1LWFA 1M5PC 1S7HA 1DT9A 3OYGA 1S76D 1SJRA 2BZ2A 4AQYF 4ZPAA 4CFCA 5AZJB 1FRHA 2F8SA 4JI5J 1RQ0A 4NXMJ 4CO1A 3ID6A 2LXUA 3Q8YA 1CJVA 5HI7A 2AIRB 4PKHA 1XMQF 2AEMA 4OX7A 3H45C 4HHUA 2RDJA 1IBMK 4LR9A 4JK8A 3PRVA 1Y5IB 4AHUA 2OD6A 2ATLA 3ULDA 2BUPA 4RW9A 5IOLA 2P1JA 4JI2F 2GJIA 2UXDF 4DR7K 4X66F 2QL5B 3OTOF 4CZIA 4V19J 4JKCA 3B82A 2PN6A 5IT9O 3ZFVA 4WYWA 1R6VA 2ZJPQ 4M1KA 1RSCA 1RDDA 1GTEA 3GIIA 5ADXA 4XK8C 4NYFA 2YNHA 4JI0F 1Q8KA 3W3DA 2PO4A 3OR1B 4FLTA 2F4FA 1X0FA 5IC6B 3QEWA 4H0XB 1G7CB 4OX8A 3NWRA 3L4BC 4WCEL 3CCES 3MCSA 2ZM6K 2XI2A 4E7KA 2IM1A 3CDWA 2DIUA 2IDEA 3VGMA 1HW9A 3VGKA 3D6HB 3D9BA 3A8EA 3LP2B 4NLDA 3CCLS 4WFAQ 4DR6K 4MKYA 1WLJA 1HYSA 4EP5A 4RJVA 1B7YB 3M8QA 2H9ZA 2XQCA 1DURA 2LA6A 2F7VA 2KHOA 4E7HA 4FJ5A 4WXWA 2ACYA 4F3MA 3P96A 3ZZPA 4F4WA 2XEXA 3HJVA 1RAAB 3P8BB 1RI7A 1FDNA 1HNZF 1GX5A 4I2PA 3KK7A 2SXLA 1W7WA 1N0UA 4USWA 4BR0A 4F9OA 3J7AN 1AROP 4M41A 5AQUA 1VQMN 1X9SA 4N5SA 3U1MA 2XYHB 1KD1O 2OCEA 2VASA 3MMCB 3H20A 3O9RA 1SJ4P 3TANA 1C0FA 4F4ZA 1G3OA 2B7BB 3GR1A 1LEOA 2UYTA 3CCUN 4LD0A 3GV5B 2BE9B 4LF1A 2BM1A 5K8MA 3M8ZA 2HBYB 3GMGA 3OVNA 4CLPA 2QV6A 3MM5A 2W7PA 3G71S 3KJVA 3CB4A 2O8FA 1KQKA 3OT9A 4PR6A 1N33F 3V9XA 1U8WA 3MM9B 3I32A 2QSFA 3OYMA 4NA2A 3MDQA 5LMNK 3BM7A 3OL7A 3T1YF 1N8RT 4QIGA 4BRHA 3BPDA 1OH8A 2V2ZA 2EC0A 3SUPA 2J9EA 1S77D 4MT1A 1L3TA 2QTWA 4KAZA 4P7VA 5FPNA 3D3BJ 2AT1B 5HRPA 1EQYA 2R8KA 2BJ3A 1N5VA 4P72A 2DO0A 5C2CA 2EWHA 2XI3A 4JRQA 1XNQJ 4GV3A 1IR2A 4NLSA 2HHQA 3QGHA 2OPRA 3W2WB 4USHA 3K17A 4O8UA 1Y9OA 1GOCA 3KUGA 1WKLA 4GC7A 4B1UB 1C0TB 2YH1A 3A4TA 2HMIB 5KFJA 4HLBA 4J2EA 1NGFA 1UEUA 4FYWB 2GO9A 1T95A 4Q43A 2OGUA 5FPDA 1OH6A 3QJJA 4L3QA 3GG1A 3W60A 1X7VA 3R2DJ 1P90A 4KGVB 2H3GX 2UU9J 5HQMA 4YORA 2V4JB 4NCGA 2HBZB 4JHDA 1XNRJ 3LDLA 3ZLJA 2B7CB 4ZVTB 1S1TA 1N88A 3C16A 3A8KA 2EFQA 3QEIA 1Q78A 2V6AA 2BW2A 4V19S 4ES1A 1Z4UA 3GCWP 2G1DA 2VDIA 2ASDA 4D3HA 4ETXA 2HHHK 1MU2B 1TKDA 2DY4A 4PZVA 4Y3CA 4DEZA 3EGVA 1HWIA 3ISND 2X6NA 5AQIA 5E84A 3RTVA 3IG1B 1SAZA 2ETJA 7AT1B 3C46A 4ZA1A 2B6AA 1Q8LA 1YGYA 2BBEA 2OAUA 3NE6A 3WC2A 2BOAA 3TEHB 3PXGa 2KKZA 3DRPA 1Q5VA 3M3ZA 2M0GB 2E7WA 3BPSP 1S9EB 4B3MK 3ZZUA 3N6LA 2FGOA 1MWQA 5J2MA 4EGLA 2XLKA 1FKOA 1FXRA 2A1RA 3UWTA 1X5OA 2DHSA 1JLCB 2Q0RA 3JXUA 4J5OA 5H9EK 3PDNA 1BE4A 4OYAA 2DGVA 2VHGA 1JQGA 4LFAK 4CESA 1KRPA 2GFFA 3HK2A 1YX2A 1SZ2A 1S79A 2VWBA 5J2PA 2D3UA 1VOMA 2MLZA 3T19A 4FJNA 4H4KA 3B54A 3ET6B 3HT3A 5IWAK 1WG5A 5GAEP 4LH5A 3EPIA 1UWBA 4PAAA 1F2GA 4LRDA 2UUBF 1QQNA 2QEXN 2VPXB 2V4QA 1AUSL 3DMJA 2H5EA 4AT1B 4DR3J 5CYQB 2VU5A 1G99A 4NO7A 2HVHA 2UVWA 3ZT3A 3MM7B 4M5JA 3OYIA 1N54B 4C8YA 2XGPA 2OEKA 1HX1A 4ZTFA 1HFEL 2LQ5A 2UVVA 3UKUA 2ZGZA 3MAHA 1T02A 4A46A 4CEFA 4OJ1A 3LO3A 3CPWM 2VCPA 4HCCA 3JSBA 5IQ6A 2DEIA 4FXDA 2X1AA 1NK0A 4AM6A 4I6YA 4DTOA 1KFDA 1ILYA 2GAHC 3CJKB 3HHKA 4LFCJ 2EEYA 5E2QA 5HATA 1RCXB 3T5HA 1BG3A 1JMTA 4CVNE 3BZCA 2QLFB 4A5BA 1N8RO 2BM0A 4EZ6A 4ISEA 1RWNB 3W65A 1NPKA 5M1OA 5SZTA 4K4YA 2JDJA 3NFAA 1X9MA 1WOPA 4WYBA 1UEKA 3HHLC 2HYIB 4ED7A 2VFRA 2LEBA 4JI7J 1YI2S 3D1HA 1IKXB 5KT7A 1CJKB 4LF5F 3TU5A 3EVMA 1WORA 3ADAC 4X4VA 3DLJA 1J9AA 2G8FA 4R5PB 1DRZA 4PG8A 4AHSA 1N0VC 2C2NA 2YNFB 2YKNB 5EU7A 3MCOA 3DYAA 3FCWA 1XMOF 1FD8A 1GLCG 1O13A 2QXLA 3WT0A 1IKXA 3G8TA 2MQQA 4QWCA 2DGXA 2RF2B 3LDPA 4M3RA 3VF6A 4WZQA 4GW6A 4GY2B 1QVFM 1SKUB 1VAZA 3K57A 2QWRA 3CHWA 4K25A 5EXWA 3D2FB 5KT3A 2V2KA 4ELUA 1TV6A 3OLAA 2AJ1A 3AD7C 1BL3A 4K4ZA 1S6PA 3AY9A 1VGYA 4BE0A 3CCMS 3BQ1A 4P6QA 1M90T 4I4BA 4Q8FA 1U0HB 2R3VA 1YHQS 4NPOA 4ILRA 3MCAB 2ATQA 2BXJA 4JKDA 2ASLA 4OJHA 1NGHA 3OLBA 2QL7B 2V4RA 2VQEF 3B4DA 3DN9A 4KH5A 4RWTA 3DXMB 3B8AX 3BN4A 3VWSA 2FBYA 3AY0A 2G0CA 4P75A 2XLIA 2IGIA 4IO9L 1PBAA 4EI2A 4CEEA 2MHNA 2HNDB 3MM8B 4FZVA 2YWFA 4NLCA 9ATCB 4TU8A 2A5XA 4M5KA 4WU2A 3TAMB 2X1BA 1D09B 4LSLA 1HARA 2LXIA 3ID8A 3GPAA 3VQQA 3PCOB 1F1BB 1CJUB 1G15A 3WX8A 4M45A 3HVWA 1C0GA 4OMFG 3PSIA 1NH7A 2AMCB 3V1RA 4BQLA 5DS7A 2IM0A 2BE2B 1IJFB 5BJRA 2POKA 4JI4K 3SQGA 5HN0A 2BOPA 2QM1A 4WPAA 2YX6A 2HNDA 2P9KB 3R27A 3KK3B 4WFXA 2IM2A 2LA4A 4RWXA 3KLGB 4B9MA 2V2QA 3PHTA 2ZWPA 1KC8T 4ANEA 3D6FB 1S97A 1LOTB 4LR7A 1FFSB 4A59A 3ENWA 4TKTA 1K47A 3M4XA 1K1SA 2CGKA 2OTLN 5E3RA 4P52A 4U9RA 1NGAA 4Y00A 2DGOA 3VOVA 3FBCA 2JVRA 1YZ6A 2VFUA 3TARA 4H4OA 2FLOA 3CD5A 2QMXA 1KLNA 1CJTB 1U8SA 1T94A 1SL2A 1JLGB 3SI8A 1NB2A 2QT7A 1N5YA 5DRKA 3V5RA 3G6YA 3RG6A 3FZBA 3R3TA 1KXPA 4NYNA 1NMDA 4RNMA 1RBUA 1N34J 4PXBA 2CQIA 5AQFA 4FWLA 2HLUA 2W6LA 3HSGA 4GVEA 2E66A 1XMQJ 4ZHRB 4DTSA 3HM8A 2HBLA 3Q22A 2C3UA 4B3TK 4I67A 2G8VA 4H0TB 2MKJA 2X51A 2GA7A 4WCEQ 3PV8A 3IBCB 3C14B 3ZX0A 3M2RB 4CEAA 3GWCA 4OYIA 4F26A 2G1HA 5F9NA 1WG4A 3D0GE 4KV8B 5IV3A 3QWPA 4OPAA 2RAQA 4ID5A 1CBKA 3MPUB 3HVRA 3DXSX 3QIOA 2FF3B 4ZPVR 4CJQA 3QGPA 3DRXA 4J7CA 4JI0J 1VQON 4OZ5A 2UUCJ 2PEBA 1GLFO 4M5IA 2KT5A 4AL7A 3MEEA 2CNNB 1GTHA 4DN9A 2A3JA 4LF6K 1RT3A 2C42A 5B08A 5BPMA 3FFIB 1SB6A 1RDWX 4GV6A 4RCHA 1HJRA 3DHXA 4MKBA 3M1FA 3BDPA 4Q2MA 4OLOA 4B3SF 2DFFA 2NLWA 3G25A 1GFWB 4F02A 5EX0A 3MDFA 5JS2A 3HSTB 3WEEB 3AB2B 1WBDA 3C95A 3ZTOA 3KLFA 1MG7A 1RT7B 1IBCB 4ZVUB 2GCFA 1K8KA 3SAGA 4TN2A 3DDIA 1VYAA 2QRRA 3GIRA 2NSBA 4DR4F 1J53A 1FEEA 1OQ6A 2NYIA 3SCIE 1PG5B 4XO0A 1HNZJ 4X64F 1Y4ZB 3CCJN 4FL9A 1RTHB 2DXEA 1YIJS 4F4KA 4XAKA 4FJXA 4DPYA 1H73A 3K5LA 2VKZG 1W25A 2MZRA 2R8JA 4F7VA 2R8GA 4IDKA 1PCAA 1EB0A 4C11A 2CQGA 2P9IB 2V69A 1FWKA 1NK7A 5K8OA 1M90O 2E2QA 3UDCA 1VQLS 4H4MA 1T9VA 3VR1A 4CYUB 3AD8C 4JS4A 1RT1A 4HUGA 1IQZA 3EYZA 1Y00A 2JHEA 4BRQA 3U9DA 4NLPA 4FJHA 1CLFA 4KT0C 3THTA 2VQFF 1BQMA 3M8PA 4AH9A 2JC1A 4QPTA 1JLBA 4RW8A 4UOCA 2AJ4A 3TUZC 2E7XA 3SDEB 5GAEU 4ZLNA 4K4SA 1HNXK 2AP6A 3O1BA 2RN2A 1RWOB 3QAEA 3H2UB 5FPMA 3NGKA 2DHXA 3DI6A 3WXIA 4RR5A 4FK2A 4JV5K 1JLQB 2DPNA 3TWHA 3M8RA 3CJ0A 4JI8F 2J8SA 3QLHB 4ZLPA 3AA9A 4O44A 5DG8A 1UCNA 1WELA 3GIJA 3BGUA 3TAPA 1A6LA 2FF6A 2B9YA 3LGHA 1N52B 2IVYA 4JI3K 2AJ0A 1Q1KA 4CJEA 2Z8QA 5A8WA 1WC6A 1VQPN 1VQ4N 1WKJA 1WHYA 3ULEA 3F0NA 3VAGA 4H5WA 3V1OA 3JB9k 3AOBA 2IIHA 2QLBB 3THYA 4AD6A 2FIUA 3I4HX 1J5EJ 2VUGA 5JJBA 3EICA 4ZCIA 2ZOMA 4AHTA 3O5BA 3L2UA 4ZN3A 4DUYF 2KYZA 4O0JA 1MMDA 4K0KK 3TO8A 1UA1A 1U1LA 4I6MA 4BRAA 3KLIA 2GQ2A 4DR1F 4TY8B 1SV5A 1JCGA 1PYOB 2BJ8A 3MR2A 1VJWA 5KFHA 1HMVA 2ZDPA 1P9QC 4EK2A 3M8WA 1WEXA 3HVAA 3S3NA 4N8OA 4B02A 3KYLA 3CC4N 3I55N 4QIFA 3OFHA 4J2AA 4K4VA 4OHVA 3MUTP 4ALZA 2MEWA 4OYBA 2WK4A 3HSCA 3ILJA 2VPZB 4FWMA 4NXNF 3TJ9A 1NHUA 4NLYA 2CADA 2FD2A 1NK5A 3GLJA 2D69A 1NDKA 3MD3A 4LF9F 4MLEA 3SUQA 2QGFB 2G0IA 5KI6A 3SAHA 1NRKA 1HYVA 4DTRA 5CZ2A 5HAOA 4DV0K 4DUTA 3W5YA 4Y0WA 1VQ9S 2R2SA 5KFRA 4H5TA 2XMMA 4KHQA 1NSPA 1E6YB 3GE1A 3D7SB 1LW2A 2VG6A 5AR0A 1SC1B 1IWAA 4EU0A 4L73A 4MDAA 3RW7A 3N5FA 3HTVA 3CMEN 4OYWA 4KI6A 3ZZOA 2PI5A 5DG9A 3M9NB 2PSZA 4A5AA 2JWKA 1FI4A 4AXIA 1FWPA 2W9BA 4GMJB 4BRCA 1EWRA 1HBUB 2X7IA 1IBLK 4EZ9A 1NSAA 4K8RA 2ZH7A 2UUBJ 3VQ6A 3GL1A 3C65A 3CCEN 1HQUB 3VQBA 1ATSA 3CJ2A 4X65F 2ITMA 3NVKA 4CZMA 3P1GA 4NLVA 3VA0A 4ZPCA 1RWUA 4KHRA 4JKGB 3QJPA 2W7OA 4OHWA 3VGUA 3CCLN 1BQXA 1X4EA 3CJ9A 3JTNA 3PRDA 4IOXA 5DJBA 4Z4GA 5MAOA 2Z1GA 2DY9A 1HQEA 3CETA 2KVQE 4ED1A 4CJSA 1T11A 2BRLA 5HJXA 4WKYA 5M1FA 2VG5B 4F8RA 3OHRA 5AQXA 3DAWA 2HBMA 4K4XA 2E2OA 3N79A 4FNIA 2OPPB 2G2YA 5C7PA 3IWLA 1U6FA 3VEOA 3AJ2A 3E1YA 3HCXA 3H5YA 2FJEB 3BO2A 1CULB 4DX7A 2I6WA 4YDUC 4L3NA 1J5OB 4ZPTR 3VZHA 2YNIB 5KFXA 3TZWA 1E6VA 3CWJA 3QMQA 2HWIA 4M3ZA 3R1LA 3VGLA 2ZC4A 5GAHP 2E5GA 2VL1A 4V19X 3I96A 5AJ3K 3O9QA 2DYAA 3NNAA 2D0AA 4CLTA 1WHXA 3CCSS 2G2OA 4RX6A 2BKPA 4YB6A 4HACB 1P9YA 3G71N 2BJ1A 1UW9A 2ZD1A 2IJFA 1UA0A 4LF5J 3S9HA 4CCHA 1DTTA 3WXLA 2K7KA 3NEKA 1RTJB 3PLAA 2VV5A 1D8YA 3VAIA 3E8OA 4R79A 1HNWF 3ILIA 4FF1A 4CF2A 5EOYA 2MSTA 4KHPF 1S48A 1UP1A 4L75A 4PWDA 1OIAA 4ILGB 2XYPB 2DHGA 3DLLL 3O4NA 4CJLA 1D9AA 1IKWA 1TQLA 1XMOJ 4U8VA 2DRBA 5CD4A 3HVTA 5ETRA 3KHLA 4EEYA 2MKSA 4OZ0A 2GIRA 1JLEB 1NXIA 2ALZA 1RTJA 2HLTA 3MCMA 1VQ6N 3P5TL 1OWXA 4DV3F 1VRQC 5CCMA 4CECA 3OBWA 1EQMA 4NZ6A 3TP2A 4XH4A 4K8XA 4YHHF 2PEHA 1RDRA 5C24A 1TL3B 2XSFA 4FPBA 1ZM2A 3S01A 1YKWA 2B5JA 3TUPA 2YKMA 2LEPA 1RBOB 2XLJA 1GLEG 2F8HA 1X3NA 4X4NA 1U2VB 1VQKS 1WD6A 3GFXA 3JTOA 3FEZA 4DMNA 4A57A 4DLGA 4BG8A 3G6ES 3I9ZA 4CT9A 2BJEA 4W5TA 1R59O 5L39A 1JJ2R 2VA3A 5M2PA 4G65A 3UI3A 4ZVHA 4FYDA 1LWEA 2I5JB 2IA6A 1WBBA 3L8BA 3SFUA 3OYFA 4IKAA 3CPEA 3QO9A 2F8EX 3RMDA 2AA4A 2OEJA 2JOQA 4JI1F 1X4BA 4FWOA 4LF8J 4DHYA 2DNKA 1X9JA 2ILZA 4UUWA 4FCYA 1JXLA 1MMNA 1PIEA 1F3VA 2IRUA 2YQ3A 1FCAA 3QICA 1S4EA 3M6XA 1NPRA 3AQOA 1RYRA 4DG1B 3AVAA 4EFAC 4M95A 3OBYA 3DGVA 1LAVA 1JKHB 2HZCA 3AO1A 2P5VA 3GU0A 4CH0S 4CLFA 2EKNA 3F2KA 4C9DA 5E3QA 4FNHA 1VC0A 1KS2A 1Y11A 5KFVA 4RBTA 1ZBIA 3KK1A 3N4WA 2W24A 4A8OA 1I94F 2O8EA 3HXMA 4OJ3A 3O2IA 1TYQA 4JI6K 2AEJA 2VPYB 4CJRA 2QC3A 2UXBJ 1PC5A 3UE5A 2VWKA 4KC5A 4EWTA 1HKGA 1R0AB 3GZ7A 2QA4G 2QWNA 5DG7A 1KQGB 5CHCB 4ISGA 1WTBA 4U7UD 4IR1A 4E98A 1XUPO 1PBUA 4HTLA 2DNPA 3LL3A 2IDLA 1BQNB 3E01A 5FDLA 5CA5A 4JOUA 4PEOA 2IMOA 5A76A 3QSYB 3HFZB 3OBIA 1T3OA 3FQLA 4Y34A 3S6EA 3CDUA 5FLXO 1S1VB 3PIOL 2HNYA 1ZXOA 3CCRS 3KDOA 4TYBA 2BQRA 1BHNA 4DLEA 5KG4A 2XHCA 3CF5Q 4KKOB 1I5OB 1YJ7A 4RUAA 1EP4B 4LRCA 1B0TA 4Q0BA 3OR2A 2RE2A 4GVMA 3V2UC 3WNGA 2FLPA 1WSVA 4M3XA 5I3UB 1GLAG 3T7ZA 4U67L 2WTFA 2XC9A 5F8LA 2W8LA 3L95X 1VC6A 4CEBA 3J81j 4JD2B 1FTRA 4LSNA 1VCTA 3AAWB 4OI3A 3NLCA 5JLFA 3AD9C 5HVGA 4LVOP 4C98A 3QPIA 1S1WA 2M88A 3SV4A 1TVRA 2NLXA 1YWXA 3EDRB 2J8AA 2HFOA 3S41A 2QLJB 1Q5YA 2NRHA 4FXWA 5KG1A 3MAQA 1NB7A 3E9PA 4RBVA 2MYFA 5MLCV 1H98A 3DLKB 1GK8A 2Q6CA 4DU4A 2IC3A 2XRIA 4M5LA 4FLWA 4UZBA 4C0OC 1KDNA 2D1CA 4BVOA 5LJ5Y 1YI2N 2YWKA 3DRRA 4NLBA 3HKWA 3MN9A 2P9UB 4DR2K 1ZBSA 3P5BP 1W0HA 4WQ4A 3A5MC 2HW3A 5BRHA 2GMLA 4URQU 4KH6A 4DPUA 3H4BA 3OYEA 4OI4A 1TL1B 4ETZA 3PSFA 1RA6A 2NPIA 3OJUA 2LQ9A 4PYAA 2DTUA 4QIEA 3JAMO 1L3UA 1TAUA 4KE5A 5BR8F 3OL9A 3EGWB 2DCLA 1KVAA 7FDRA 1SC6A 4CJ4A 1Y5LB 3POTB 2V52B 1AFIA 4J9LA 3FNNA 2VQFJ 5KFCA 1TKXA 1UOCA 4KGZB 1ZAXA 2EX3A 4N76A 3J7A1 4CBWA 4PL7A 4CLSA 3CCMN 2KB2A 2ZJRQ 1KHVA 2CFXA 2MJUA 5E7OB 4KI4A 3A5LC 5LSRA 1JJ4A 2HSEB 4B3RF 5KFMA 3OTDA 3CDEA 3UVJB 1T0TV 1TUWA 2QWMA 1OKJA 3ZSZA 3O5TB 3V81A 3VTHA 1I39A 3W0LA 1BU6O 4M63A 4CJ5A 4JBCA 3AGRA 3C7NB 5AE1A 2VOOA 1AYEA 1K0VA 4C8NA 3U02A 2G8WA 1CZ9A 2AD9A 1RJJA 2ZGYA 3BZQA 2LQJA 1V3SA 3EDQB 3R6GB 4H8KA 2DNLA 5HVHA 2E88A 1VQ7N 2R7TA 2ILYA 2X74A 4JK7A 1G1XA 4Z4HA 3PW0A 1YRXA 1RTDB 5L1IA 3SK3A 5AQPA 4ECZA 4IBNA 4QZVB 2GELA 1J2VA 4BCAA 1WB9A 3GB0A 4ZP6A 3GSIA 5FLXU 3VAHA 4DV4F 1W2IA 4A48A 4ZLLA 3R7NB 1RWXB 5LOQA 5GAHU 4NI2B 5HMXA 1ZTWA 2EPIA 2F7TA 2HFSA 2B43A 2DGSA 2VIHA 2FLLA 5AZIB 4F4AA 1YBTA 5AQKA 5KPRA 1TUYA 2DB1A 1HI0P 1EKRA 3LPYA 3L6QA 4CEOA 3EXYA 1GAOA 3LALA 4IRKA 4O3RA 1KFSA 4DV2F 1IO2A 5CY4A 2PGCA 3PACA 3N4QA 5JUMA 5KGXA 3U27A 5IS2A 3LP0B 5C42B 5LMUF 4GMKA 3V4IB 5AQWA 3JS9A 2KDOA 4LQ3A 4PG4A 4AL6A 1M5SA 3C6TA 1TKTB 4YY3J 5GINA 4DTUA 3HI9A 1DAXA 2OPQA 2JZ5A 2E9ZA 4WE1A 2AJQA 4CHQA 3HX9A 4CIEA 4C8LA 3ZTPA 4PQUB 1Q53A 4NE9C 1IG9A 3BDEA 1MWKA 4Z2XA 5F0WA 4IG0B 1X5TA 4GKJJ 3QIDA 1IVZA 2ZE2B 4CTAB 5ETOA 3IGVA 3AOAA 3X1LB 3P5JA 1YXQA 3UE2A 1QVGM 4LF4K 3R6MA 2Y1LB 4UTGA 2E1RA 3L7PA 5M1PA 2VBWA 3HRGA 1V4SA 5D6GA 2NQPA 2EWSA 3MTKA 2N3OA 2AV5A 5KOXA 4CRJA 3HPOA 4FLVA 1JWWA 4X65J 1RU2A 2WOMB 4CJ7A 4XH1A 3SXLA 2WBRA 2Y3YA 3GJQB 3MOJB 3SCLE 2PFDA 2Z2YB 1WC1A 3SSSA 5G4DA 1ZH5A 3JXOA 3O6WA 3MXJA 5M1KA 5AXMA 1IXKA 1UL3A 3DGPA 3RR7A 4DU3A 3O9UA 1KR4A 2PD1A 3NCIA 4BGAA 3O3LA 3DM2B 1QTMA 3F5TA 5CR4A 2KZMA 2CKWA 2XTJP 2IS3A 2UU9K 4LFBK 3SUNA 5DGBA 4CH1A 3NDKA 1YIJN 3IR7B 1O51A 4ICLB 1C1CB 2AEFA 4PQAA 1HBOB 1SL1A 2UUAK 4RW6B 2E1YA 2HHSA 1BOTO 1LFPA 5KFUA 3AT1B 2W41A 2AZ3A 1KAYA 1VQ8N 1NGBA 5ELZA 2YH0A 1VQLN 3BEXA 3IM8A 3DLLQ 1VBKA 4DUZJ 1EKSA 4IFVB 3ZZRA 2W9CA 3F73A 2FHKA 5LMNF 3T9ZA 3GDQA 3CD7A 4FJJA 1U45A 3U3YA 1HNWJ 1YITS 4HCBA 2LQ8A 5GADI 3R9LA 2E6MA 4OX9J 3I4PA 1NHVA 2N4CA 3R6LB 1S5JA 3CD0A 1U0SA 4A8MP 3BGRB 4AHRA 2DITA 1BLUA 5L46A 3TYTA 2VC1A 3QB0A 2DFEA 4DV3J 2GZOA 4DSKA 2JX2A 1NDLA 4CJTA 5G0RB 3Q8QB 5FRNA 2AKWB 2OLWA 4USUA 5HP1A 3AARA 4YR2A 1RHKB 5HO4A 3BN7A 2K1RB 3R5GA 1YJNS 3H40A 3VEVA 4YMEA 4EYIB 2J5AA 2QG9B 4YR0A 3MN7A 3D0IE 1RAOA 3I0RA 5ETMA 2WCXA 5KFSA 2FBTA 1FNMA 1VQMS 1VSMA 2W1BA 4B3OA 4DI6A 2YV0X 4WP3A 1JLAB 2K3IA 4DR3K 3PX4A 1VSDA 4CP5A 2P51A 4BLGA 3CC7S 4KRFA 2GWKA 2FVQA 2ZZNA 3ENQA 3IR6B 1LWCB 5AQQA 4O5FA 1IV0A 4Q45A 2I2YA 5J1NA 4JV2A 1YT3A 1WEZA 3M30B 1EX8A 3MEGA 3AGKA 2OP5A 2QO3A 4CJVA 2JEIA 1U47A 4DU8A 2J0QD 2Y0BB 3MWBA 5IT9Y 1U2RA 3CFPA 4JK9A 2R8HA 4CF1A 3KHYA 1ATRA 1ZA1B 2VG7A 2EKYA 1Q86T 4RUBA 2D4WA 3AO5A 4AILC 3AVGA 1VC5A 2FJWA 2A0FB 1RAFB 2WB4A 1ZBHA 1IUJA 3TVZA 4J90A 1P27B 1DQAA 2DXFA 4EO8A 2E5LF 1WI8A 4ZVGA 3US5A 3JQKA 1Z1ZA 4DL5A 2MGZA 1YJTA 1T6DA 2YJEA 3CTRA 2RUSA 4IQMA 4OHYA 4DL6A 2YNGB 3BEGB 2J0WA 1VQ9N 2BQ3A 1VBXA 3BYRA 3ZZYA 1VFJA 3NCQA 4EAHD 5AQLA 3J80U 1XBWA 4WQ5C 4FPAA 1KTVA 2C2EA 1F5AA 4M3TA 1OPIA 5ETTA 2BV3A 4Y6IA 1BISA 2D3OR 3W7BA 4JN4A 3PIOQ 4CEZA 5THWA 2W01A 1T05B 3H3OB 3V9WA 5HROB 2KVIA 3UKRA 1S1UA 5K14A 3ISZA 2GX9A 1KAXA 1WHVA 4BRFA 3J7YP 3O9TA 3GSDA 1KEKA 5F3ZA 1VK8A 4Z94A 1PJ6A 2N3LA 1U6ZA 4M5DB 5FD1A 1EETA 3CGIA 1Q9XA 1EWQA 2AGQA 2CQHA 1T03A 4LF7K 3C15A 1SJ3P 2EFOA 4JYAF 1BO5O 3BR8A 2GS8A 1VSEA 3FZ2A 2IAJA 1UW4A 4P2SA 3D6TB 4U7CA 4IUFA 4KHWA 5KFGA 3L7OA 1RAJA 3MX2A 1E4FT 4MFBA 1RAGB 2W25A 3M6UA 1YTAA 4N8NA 4C0HA 3BH6B 3ALYA 2Y1RI 4K7QA 2IVMA 2IA0A 1SVDA 3Q86A 4I69A 2ZH4A 3HHLA 4LUBA 4DR5K 3SCJE 4NXMF 2KO1A 3VQ4A 3BR9A 3J81U 3ITHA 1ZM9A 5TKYA 1X8DA 3S7RA 1WAJA 3G10A 1TFYA 2I8EA 3KD5E 2PIIA 3O1WA 4O3SA 4HDGA 3LGNA 3MXHP 1P6TA 3P4UB 3K5MA 2GO8A 3NMAA 3D54A 2QKBA 2OELA 5LSLA 2DR9A 4X62J 2BW7A 3CCSN 1VRUB 4I2QA 3IO1A 4O3PA 4PUOB 3HD2A 4KH1B 3G96A 1VS3A 3MCNA 2GTDA 4IJNA 1R8PA 1IBKJ 3AA8A 4ECYA 2Q31A 3A0IX 1OMSA 1SCJB 3NS6A 1IKYB 4FK0A 2UXCJ 1NJIT 4CJPA 3KHGA 3F41A 3DFEA 1WC0A 4WKRA 1WSFA 3TSQA 4DSIA 1IKVB 3T5LA 5KQDA 1Y0HA 2JL9A 3HL8A 2ROEA 4G1QA 2OUGA 3DXBA 1K9MT 3LDSA 4CFAA 2XCPA 2O66A 3NKYA 4NYOA 5JMNA 3CIMA 3PJ9A 4W5NA 2LFVA 4FYYB 3VEZA 3M2VB 1KQSR 1GMVA 4AQYK 3A8YA 5D3GA 3KLHA 5HK4A 5KOWA 1RT2A 3DOMB 1HLUA 4HKQA 1NUEA 3DCAA 5F0XA 3GV8B 2FSJA 2QYGA 1VQKN 3UD4P 1XMQK 2HKEA 3W66A 2GBZA 4DHVA 2QL9B 1UETA 2CH6A 3G6EN 4WFAL 3CC2S 3AVHA 5CABA 3D67A 1VRTB 2P2CB 3X3UA 3ZSOA 4JI2K 2UXDK 4CGIA 4X66K 1Q86O 1NLKL 3TR8A 4F2RA 3OTOK 2MJNA 3M6WA 3HPGA 1ZPWX 3VQSA 1S6QB 2DNHA 3DOMA 3NGZA 1EKEA 3ZZTA 1RT4A 1SKSA 1YLXA 1RKJA 3P49B 1VBYA 1DGKN 3EWGA 5BRDA 4XIUA 2M52A 4MLHA 3MXIA 1B3TA 4YUDA 3KUEA 2YJFA 1O6XA 5B0CA 3Q0AA 2NR0A 2P9LB 4CBUA 1F0XA 2PDAA 3TQ1A 2J7UA 5F8IA 2VJVA 2MY8A 4C48A 4QWDA 5C25B 2KHDA 1N5QA 2R7UA 3MUMP 1OYEA 5CXTA 1Z05A 4JI4F 4DV4J 2XM3A 3OUYB 2RQMA 2CJAA 5BN8A 4P2MA 4N41A 4OX6A 4CD1A 3L4IA 1Q8BA 1RDBA 1T44A 2I38A 4J91A 1F9FA 2CJQA 4QYRA 5ETSA 4RNFA 4YFUA 2ZNYA 2RS2A 2JVOA 1XNQF 5AQJA 4L3KA 1HNZK 1FFGB 4DV6J 3M6VA 2VONA 1IJJA 1B92A 2GGPA 2C2RA 4MH8A 2OHDA 4FN5A 4ZP9A 2J0SD 1M1KT 3G87A 1C6VA 4QS7A 1U04A 1PO6A 2D5RA 4HUEA 2I7PA 3OTCA 3L3CA 4XPEA 3V6KA 3QZ7A 4OO1J 4ZIVA 2IVPA 3BYPA 4KBOA 4JP8A 2CA9A 2VFSA 2WTUA 3HHDA 3JSMA 4CHOA 5HQ8A 4CIOA 2B4JA 1U09A 3PYEA 4IKFA 4N77A 1R8BA 3HF5A 3HZEA 4KIAA 2RDIA 4CBXA 3MPDA 2FGCA 3PX0A 3SCKE 1JLFA 4DPOA 1GLJO 2WONA 4FJGA 1AZSB 1XNRF 2EFVA 1HL6A 2CQ3A 1C0MA 4J9OA 1N33K 4WFYA 4YQWA 4C2MA 3D68A 4PWUA 1WF2A 3CJSA 2AX1A 3VQCA 3CCRN 1NGCA 3MAAA 1NLVA 2CPDA 4DR7J 4QS8A 3T1YK 5AXKA 1L3KA 1NGEA 2C2OB 3U8XA 1GQEA 3LGMA 2CVEA 3PKMA 3ZSQA 1MWYA 4B9VA 4K5RA 1NCLA 5F9LA 5ADXH 1VQNN 2GVDA 2GIQA 4I7FA 1RT5A 4N56A 3CYMA 2ADCA 2BANA 5A0YB 3TA2A 4C7QA 3U9ZA 4U96A 1N48A 1U1KA 2R2RA 3VAFA 4DQSA 3QBCA 4JKEA 1NGDA 3MD1A 2ZM6J 2OZSA 2M70A 3Q8RB 1BA1A 2BUNA 4YP3A 3VZIA 4QW8A 2E9RX 1WOSA 5B0FA 4RUCA 2EK6A 5KT5A 3SMPA 1HKCA 1NK8A 4FM0A 1URNA 1OY6A 2YWGA 6FD1A 3A12A 5LM7E 1S72S 1NJIO 2N4DA 4TXSA 2QWOA 4YDDB 1WHWA 3PHEA 2XMAA 2A6AA 4C23A 1YBUA 4QR1A 5CH7B 4HYKA 3OJSA 1FKAF 2XMUA 2MZ1A 1X9WA 4PG6A 4F04B 3OSPA 1K9MO 3IMQJ 3C6HA 4LQ9A 3CDAA 3Q89A 2HSTA 3IP0A 4O4GA 5HRRA 2MQOA 5D0HA 3D1QA 3MPYA 1RABB 4KTWA 2IRXA 3RZAA 1S9GB 5J2NA 1HBNB 2Q1LA 3MR5A 1D9DA 3GQCA 1N6QA 3HP9A 1BWEA 2DNRA 3KG1A 3T41A 2HRTA 3M8YA 4KFBA 3QSIA 4DQIA 2YXLA 3G6XA 8ATCB 2XB2D 4DL0C 3CQ8A 2DGUA 2BEFA 1CQMA 1LXNA 2FBVA 3GG4A 3FR0A 1NJYA 4AFFA 1M5OC 2Y9HA 4GNIA 5DZ7A 5H9FK 5LMNJ 1MROB 2HQFA 3WBZA 2ALYB 3DOKB 3J7YU 2XWXA 3HULA 4IOAQ 2A18A 1W2BR 1FJCA 4CZHA 1C0UA 1C1BA 5KRSA 2ZVSA 3K7RA 3RRHA 2PC6A 4LFCF 4JV5F 3LPUA 2AGPA 5A8KB 5K8PA 3JQJA 5CZXA 3QZ8A 1A7GE 3AFGA 4BC4A 1NK9A 5I42A 2GV1A 4KO0A 1GLLO 3W9JA 2B8PA 4JI3F 4JI7F 4JAXA 4BR4A 2J4RA 2F9JA 2M2BA 1PSDA 2B9WA 4LY7A 1CSJA 2FVSA 4QU6A 1S1XA 3SNNA 2UUBK 1NJZA 4WK1A 3FSIA 4CJWA 2O8DA 4FF3A 1YJ9S 5C2FA 1EHWA 4H4KC 4TQSA 2L08A 1HNIA 3H1VX 4DFKA 2OSRA 1D9FA 3FC9A 3AXKA 3OY9A 3UR0A 3L2WA 3I87A 2PE8A 4I0WA 5HLFB 4OL8A 2FPHX 2F4VK 4FDFA 5AQNA 1HBMA 5KT4A 4F0MA 1QAXA 3N6NA 3RMAA 3TX8A 2HHHJ 1WF0A 5A6PA 4XTTA 1R3NA 4A8FA 4C3LA 2VZ9A 5HVFA 2FZGB 2MKCA 4HI1A 1L3VA 1HHSA 2FSKA 2MSSA 1JL2A 1ZS6A 3D3CJ 4HL9A 2GMHA 3RYLA 3MR6A 4B3MJ 2HWHA 3KK2A 3G8QA 3IMXA 2NXCA 3PIPL 3CJ1A 2CJKA 3QJLA 4A8WA 4FS2A 4TLRA 1QM9A 5H9EJ 4IFYB 3EPGA 5T7BA 2RKIB 1H2TZ 3RMBA 4F3QA 1BCMA 1HPZB 5D15A 1KVJA 1JJHA 4RW4B 3NBPA 3H5XA 2CQ2A 1VQPS 5IM0B 3NGUA 1VQ4S 1BC6A 5DK5A 3ZETB 2P9SA 4Q7AA 1NH8A 4F50A 3MMAA 3OYKA 2QN6B 4F2SA 3I0SA 3GV7B 3PX6A 5AQYA 5IWAJ 3TVKA 1OO0B 3QIPB 4PKIA 4Q8EA 1XMOK 2AYEA 3DRSB 3DXKB 1WSJA 2WHOA 4ZLJA 5A8RB 2AGOA 4MKAA 5KPTA 1Y7PA 1OVYA 3ZEUB 1FVQA 4O3QA 2G8HA 4BR2A 5F0UA 4CHPA 1FF2A 2V8VA 1FO1A 4C3KA 1BXNA 2NRTA 5D0GA 1WEYA 2CPHA 3CMAS 1GXTA 4YDUA 1QE1A 3SJHA 2BABA 4GVBB 2GHVC 2RHSB 4CI0B 4BHQA 2O8BA 4ERDA 2EBGA 4P9SA 1V3RA 2EFPA 4ZK7M 5B0DA 1BHLA 2VQEK 3T3FA 3C6UA 3W2VA 3KLEB 5HBMB 2V8HA 1IM4A 4CZCA 3V9ZA 1GOAA 1H7XA 1VBZA 3PYFA 3RJMB 3G82A 1N34F 5EX3A 2OPSB 1T7PA 4IYQA 3WQTA 4DSFA 2X1GA 4X4OA 1RTIB 1S0OA 1FNOA 3I8DA 3KWMA 2E1PA 3IS9B 3CO0P 1FD2A 2AX0A 5T7LB 4RLEA 2O5DA 2HWTA 4DDFA 2XYGB 3KD1E 5B0EA 4KJIA 5D4PA 5GMEA 3W64A 2E44A 4BRIA 4IO8A 4OIXA 3QGGA 1IR0A 5EWFA 5AQOA 2HS0A 2Z56B 3CMES 2RILA 3MUVP 5AZJA 3AA4A 2J7KA 4ED2A 4DCJB 1CEZA 1QZ6A 5AT1B 2UUCF 2GC8A 5H1SQ 2RQCA 3QWUA 1YITN 3H5UA 3W3SA 2MQMA 2ERRA 1FVSA 1BY9A 4YOTA 3WQUA 3G0ZA 5B09A 4Y2MA 4GKKK 4FPIA 4B9SA 1Q7LB 1U1RA 1TTHB 3SAFA 4WWSA 4M94A 1UZDA 3CCZA 1SH3A 1UVKA 4DCHA 5ETKA 4LMZA 4Z4EA 3H98A 2ZHAA 2QTDA 3OR1A 2KFZA 5GMDA 3HDSA 2LEAA 3HT0A 4JB8B 2I1RA 1TL7B 2KTQA 5F8JA 1SQEA 3CULA 3RBXA 3OFFA 2PBDA 1D4XA 3OD2A 1YJNN 3CD6S 1JK9B 3ZO7A 1RZMA 2Q36A 4HHHA 2GUIA 4YNQA 2ZZTA 3MPVA 3RBEA 3LP2A 3OPKA 3O9SA 2MZQA 1KSPA 1F2HA 2ROPA 1FE0A 5I3QA 5A6WA 4OYOA 3VCDA 2AW0A 3MK6A 3CC7N 3HFVA 4HVZA 5CYMB 4WXOA 4M42A 4UQGA 3PTWA 3PR4A 4QJVA 4NLGA 3UO0A 3MEDB 3MM6B 3U1LA 1RBRA 5TKWA 3R5DA 3D5MA 4D3GA 5BPLA 3LP1B 2NUUG 2CJBA 3UCUP 4KB0A 2FUG9 1NKCA 1UZHA 2QA1A 5E33A 4NLTA 2MLYA 3ZTRA 3MMCA 1QSSA 1B64A 5B0AA 4KQZA 3RB6A 4B3SK 4CGJA 2YX7A 3D2WA 4OYPA 2WUSA 4JI4J 4J2BA 1F5CA 4BQZA 3NGDA 1GNKA 1TKZB 1FKPB 2ACMA 4QR0A 2JFDA 3M6GA 4K50A 2P5GA 1VQ6S 4F3TA 3MM9A 4KTQA 2E29A 4DR4K 1ASVA 4ECWA 4J9QA 4H0OA 5LXYA 3OYDA 3S1TA 5CHIA 4OV1A 3ZSYA 4MAKA 4X64K 4JI6F 1OQ3A 1SH0A 3NF6A 1HNVB 3MR3A 3QNOA 2F3JA 3QETA 2R4FA 2HIQA 1DFDA 3B6BA 4USTA 2M4MA 3UD3P 1ZETA 1N5TA 1JX4A 2JLEA 3SSRA 4LBPA 3DLBA 1BI4B 2KH9A 1J5EF 2QWPA 4DB3A 3CQXA 3CXCR 2J6TA 3O1LA 2CDRB 4G3IA 2BA9A 3W2WA 1RBAA 1U1OA 3KMSA 3SPYA 2J76E 1FJ7A 2VH7A 1C0TA 1FDBA 4B3TJ 2HMIA 1SQKA 3H7HB 2VQFK 5D0RA 2YKOA 3ZSXA 3IR5B 1AXQA 4FXVA 5KT2A 1RAEB 1WDDA 1UVJA 1BI4A 2JC0A 1P8GA 2DXDA 4I56A 1QUPA 4QAGA 5ITHA 2V4JA 2HFZA 2F65A 3SCXA 4LF6J 1NOZA 3Q8PB 3J7YI 4JI8K 2OFHX 3RAXA 3GFYA 2DNGA 2RB7A 1LKZA 1DARA 5KG3A 1M1GA 3T69A 2E1AA 3MMBB 3AHPA 3EZ5A 1B70B 5A2QY 2K2PA 2RRBA 3G9CA 1FK9B 3LWMA 3O80A 1MU2A 3NMRA 4FWNA 2OMLA 5L1LA 4QOTA 1LW0B 1AT1B 1DLOB 3IG1A 1RBTA 1VQ5S 4ED6A 3LZJA 3FEXB 4IEEA 3CCVS 1QQMA 3UDLA 5GVQA 3WUHA 1P1TA 1HIYA 1VIXA 3BKFA 4DR2F 1S9EA 3VQ7A 2FHMA 2W6KA 3THXB 4DUYK 4IG3B 3QT8A 1DEJA 1FK9A 3FZHA 3FZFA 2J9DE 2X6SA 5AXLA 3D6RA 1JLCA 1TAQA 3KG0A 4R8UB 2YHXA 4BC2A 2RJZA 4TY9A 2Q6BA 3ENAA 1YJVA 3BSCA 4DV5F 4DR1K 5KPZA 1WOOA 2GJFA 1N4LA 3EE8A 1S0MA 3F56A 2FSNA 1S7IA 5K5MA 2P9PB 1HHTP 2H51B 2JFKA 3H08A 3ENBA 1SJ1A 1NMEB 5JMVA 2OYQA 1A0OB 5KTQA 2MTLA 2G4BA 2QZ8A 5F8HA 4X4UA 1QQOA 4CHYA 3NS7B 3UNYA 5U47A 3ET6A 5J1EB 2K06A 2HVIA 4DV7F 4ZPBA 4NB4A 2B0GA 4R8UA 3EE3A 4NLOA 4OKKA 4NXNK 4W5QA 1DTQB 3RAQA 2Q2RA 4ILHA 3HOSA 4DV1K 2NRRA 1HNXJ 2JWNA 4DFMA 4LF9K 4QWAA 5D78A 2Z58B 2ASJA 3L09A 2DD8S 5JLHA 2OD4A 3LH2S 3IRXB 2LCWA 2XY5A 2BMBA 4W90B 1YJRA 4L6V3 4KRWA 4FYXB 5CYQA 4NMXA 4JV5J 2F63A 4UOFA 3UW1A 1H3DA 4ANCA 3CC2N 4EFHA 2PAVA 2CQCA 1C1AA 3MM7A 3AVFA 2W2PP 3Q2TC 4Y0FA 2KRBA 3MECB 2RD5C 1NZ8A 1NNDA 3OYBA 2FBXA 1VDHA 2HAIA 1WC5A 4KSEB 1X5PA 4RW7B 4B17A 1YVFA 4JI3J 2VWJA 1SQGA 2WVBA 1SC4B 2OH2A 4NZ7A 2ZH9A 4C8ZA 2WFBA 2JH3A 3CJKA 1NDCA 1FRIA 2R7QA 1M5VC 4NLUA 3IAYA 1UFLA 2XS7A 2IIRA 4C8MA 1JJ2M 1B9DA 3AH6A 5IT0A 1WNEA 2ZHOA 2VF3A 3ENHA 4Z37A 5KFOA 2C2ZB 2YVSA 2NRXA 1HLWA 4IRDA 1NGJA 4EBDA 4FSVA 3NCPA 3VAJA 1Q0NA 1RBLA 4EUVA 2EI5A 3ZX2A 2MZJA 4K0KJ 2RH3A 2I7NA 2WC9A 2VGNA 1CJKA 2HF3A 1FFWB 1KVKA 2FJAB 3A8JA 2AYGA 1F60B 3QNWB 1NMNA 3T1HF 2YPZA 3GJRB 1Q82T 4XDCA 3NGTA 4R5PA 3PIPQ 2CGJA 3VQDA 2EG2A 3THWB 4BVPA 2YNFA 1UFKA 2J9DA 2YKNA 2C28A 1ITPA 5EGYA 3BUZB 3UNGC 1L5UA 1GLBG 2RF2A 5D0EA 3OQ2A 3FZMA 4OLPA 2DPJA 3V6DB 2RS8A 4WU3A 2KLAA 2QKKA 3VETA 2ZC3A 4J2DA 2YI1A 3JYTB 3IGNA 2QA4S 3D2FA 4DV0J 3H0PA 1NSKL 3RSEB 1OY9A 1S0VA 2R7SA 5IV4A 3NGRA 2RHQB 4K2XA 3MF5A 2DK2A 4ZTJA 4C97A 4LC9B 2QJ3A 1XEZA 1AA1B 3DOLB 1U0HA 3R9PA 5BRFA 2NZTA 3PEHA 4EBCA 4KPYA 3AA2A 4KHPK 2KXHA 1QUVA 3OW2R 4LF8F 5KT6A 4Y1DA 2I0XA 1VQ7S 4FLUA 2JSXA 2VA2A 2D0OA 1DKGD 3NMUA 2EG1A 3DXMA 4OYXA 2GHWA 4IDHA 3VERA 1RLCL 2O4GA 2QMUB 1IBLJ 4RTFD 4M5MA 4IH6A 3BGOP 4QPXA 4DV3K 1KP6A 4F4XA 5GMKa 2DH8A 3AAQA 2A10A 4DZDA 3MM8A 3ULHA 1R43A 3A3OB 4H5RA 4YHHK 2HFVA 2HVZA 3P83D 3AO4A 3TAMA 1TGOA 1VHXA 3JAMY 3NY0A 3TTFA 5KFBA 1CPZA 2E2PA 1UJ5A 3ZX3A 3P39A 5AE3A 3ILOA 1HYZA 5GIOA 2VKRA 1CJUA 4C0BA 2Q1NA 1S72N 5MLCQ 4WIQA 3FSYA 1FWLA 3ZT1A 2BE2A 2UXBF 4HWIA 4WP8A 1TL4A 3FK4A 4H5NA 3HO1A 4NYZA 2GVZB 1ZBUA 4DCOB 2P9KA 3KK3A 4OFZA 1MW7A 4OLAA 4DFPA 3M2UB 3B6OA 3TQEA 4LRBA 2U1AA 3KLGA 2HRUA 2CQDA 2AJ2A 4P2FA 4P71A 3FBFA 1RYSA 5KFPA 1WUAA 3CJ3A 1CS4B 2G8IA 3HM9A 1ICEB 3DLGB 1QJHA 4CLZA 1F6TA 3WXJA 5AJ3J 4JI1K 4K4TA 2P9EA 1HWJA 1CJTA 3D2EB 4BGBA 1JLGA 4O3NA 2XSJB 2CAJA 1MNEA 2ZDOA 4O3OA 2V9KA 1FRJA 3CO9A 4ZHRA 3DLGA 5HMYA 3VTIA 1FRKA 1KLMB 4C4WA 5BXIA 3CF5L 4CGHA 2ASPA 4ATNA 3C14A 1QSYA 3M2RA 4OZLA 3WNEA 2YY3A 1I94K 4KV8A 4DTXA 3SQOP 1WI6A 3T1AA 3ZSWA 1JXBA 2RDDA 1WSGA 3CDBA 4QU7A 1K73T 1BWVA 1EARA 2G8KA 1R0BG 5DQIA 1FXXA 1VQYA 5LT5A 1S49A 3PO4A 3DLEB 3QFUA 2O8CB 3CW2C 3FFIA 4UW2A 3HSDA 4MO5A 1YQHA 5IT4A 3IC1A 4TU7A 2VODA 2KT2A 4ZVSB 2CPJA 5J2QB 1QAJA 3OFGA 4C3MA 4JLHA 5GADP 1Q82O 2XMKA 1FT8A 3WEEA 1YJ9N 1SBRA 5C2DA 5DDQC 1RT7A 2IPOB 4CHNA 3TTCA 3W5XA 4BC5A 1HW8A 1FDAA 1VMBA 1LQ9A 1VQ8S 2YWWA 2KHCA 3A2FA 2F40A 2VFTA 4DBQA 2M3DA 4OI1A 3MCPA 3LWLA 3MWTA 4A47A 2YKAA 2L41A 1RTHA 2KFNA 4PHTX 1TL5A 2HAFA 2J6UA 5H1SV 3VQ8A 1LNQA 4YOYA 4B9QA 1HI8A 4GC6A 3NRBA 2UVUA 2H5IB 3U6FA 1REVB 4W4MA 3QAUA 1T9UA 2P9IA 4JEPA 1JXEA 1KBRA 3ZZ0A 4KH4A 3TW0A 4FJMA 4HT5A 4E7JA 4JNEA 4FZYA 1PC4A 4CYUA 4WQ5A 3MI7X 1JB0C 2FHJD 1I3OB 2KT3A 2D41A 2B4OA 4K5SA 2YHYA 2W40A 3SDEA 5E0OA 3NGIA 2ZJRL 9RUBA 4BRLA 2J7WA 3K89A 4JI6J 1W26A 3LW5C 4CO4A 1HHQA 1FA0A 3F9KA 2G8UA 3VGTA 2DR7A 2GUPA 2CJ9A 4J9VA 1Z25A 2HFUA 1J6ZA 1JLQA 2GW8A 1PKUA 3HHLD 2FJXA 1PGZA 4QWBA 2E9TA 4DF4A 3HBTA 2Y1IA 2CYYA 2H54B 3QLHA 4KHSA 1RT6B 1RUSA 1ULRA 2B56A 2BR0A 3S8SA 4FJKA 5BR8K 2CDQA 1N36K 2VFVA 5AFUA 2J9CA 1H2VZ 4HH1A 4CI6A 4QYZK 1VK3A 4Y2KA 3HLUA 4RPFA 2V0NA 3LPEA 4Z7CA 2P9CA 1WUUA 1O1WA 4HVJA 1O5JA 2ABYA 3CMAN 1B4SA 1TK5A 3M32B 4AUKA 2NRWA 3EGZA 4B3RK 1R89A 3O6QA 3ELHA 5LL6Z 3HFKA 1N32K 2KQ2A 4OGCA 3IBWA 4ECQA 4CWBA 3UN2A 2XMJA 4JKBA 1KCFA 4WYLA 4BBYA 4YY3F 5HMZA 4TY8A 5HQLA 2HNZB 2QW9A 4WFNL 2XGQA 1FTCA 2P9NB 1NNEA 1BUXA 4NRTA 4V1Ak 3C6AA 3KWIA 1X31C 3K5OA 2J0XA 3R5CA 5EX5A 5KFFA 3FFKB 3PFEA 2QYCA 3TZXA 3QYYA 4CFBA 4DXLA 4GKJF 3S3OA 3N0VA 1RAIB 4Y28C 2NREA 4DTMA 3QBXA 4KR0B 1SUQB 3LZIA 1QTNB 3L3VA 5RUBA 4B1ZA 1YVNA 4DR2J 5JS1A 2MQLA 2ZWOA 3O44A 4OGEA 3OVSA 2V2VA 3O08A 4E1NA 4DV4K 4YOEA 3MN5A 3IRWP 4CJ3A 3ZNUA 1K73O 2A41A 3WZ0A 3CJ8A 2VBXA 3FEYB 3O3FA 3MWPA 1LWFB 1Q4RA 3CIPA 4ZCLA 5AXNA 3VHQA 3EN9A 3HHNB 2HEKA 2DKOB 1E6YA 1HD1A 4DV5J 3BBBA 4DSJA 3N9UC 4EIAA 4L8RB 4F3OA 1ZZFA 1CJVB 1WOQA 1YRTA 1Y3JA 3RB3A 2KG0A 1H7WA 2V8DA 4XH5A 4DV2K 4BE1A 4RW9B 1ZBLA 1UPPA 2QLWA 4DV7J 1ACMB 5LMUK 3NAHA 1HBUA 2GJ2A 1WN7A