5C25A

Crystal structure of hiv-1 reverse transcriptase in complex with 6-((4-((4-cyanophenyl)amino)-1,3,5-triazin-2-yl)amino)-5,7-dimethyl-2-naphthonitrile (jlj639), a non-nucleoside inhibitor
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery and crystallography of bicyclic arylaminoazines as potent inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase, hydrolase/inhibitor
molecule keywords HIV-1 REVERSE TRANSCRIPTASE, P66 SUBUNIT
total genus 147
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5c25A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c25A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c25A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c25A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5c25A05
4O4RA 1GOCA 3IRXA 3RWUA 4CHNA 3M8RA 4NYNA 2G8HA 1MU2A 3CWJA 3TAEA 1BQMB 4RNHA 4GW6A 3S3MA 3AA2A 2WRMA 1HJRA 3CJ0A 3AO1A 5I3UA 1XR6A 3KLFA 2NUBA 2I5JA 3K5LA 3QEXA 2DTUA 2XY8A 3QO9A 2JGUA 4C8MA 4Q45A 2HAIA 3RMBA 2J6UA 2E9ZA 3MR5A 4E3SA 3DYAA 1C1CA 4U7CA 5DLFA 4Y3CA 1BHLA 2KFNA 3I0SB 1FKOA 3B6OA 1REVB 4WZMA 3H40A 1YTAA 4L8RB 2OZSA 3L3UA 1MU2B 1RT4A 3PX6A 3NL0A 1NK5A 1N6QA 4LSLA 5KFZA 4O3SA 4FJMA 4TY9A 1RT3B 4DQQA 2V9WA 4M3RA 1L3TA 3LP1B 4U6PA 3HYFA 1KFSA 4OKJA 4DL5A 1D9FA 1JKHA 4K4UA 5DG7A 3KLEB 4K8ZA 3OL9A 3DMJA 2FVSA 3SCXA 4E89A 4IFYB 2OA8A 2WONA 4WFZA 4YR0A 4DQSA 1C1BA 3QIDA 3P1GA 1FKOB 3GYNA 3V1RA 2ALZA 4WE1B 4E1MA 2HMIA 4NLGA 2WOMA 1NNDA 3IGNA 3KOAA 3UPFA 3BGRB 1J5OB 2W9CA 4EBDA 4FCYA 4ZVEA 1EXQA 3AV9A 2ITGA 4J9QA 4I2PB 3CFRA 1EP4B 4OGEA 1RT2B 1TAQA 3OYJA 1JKHB 4FLXA 1LAWA 3KHHA 4KB7A 3TVKA 3RMCA 4O5BA 2IGIA 2KZZA 3K59A 3K58A 4ED6A 2ASJA 4KHUA 3LP3A 4ICLB 3ZSOA 4CEEA 4IH5A 3TARA 1VRUA 1CXQA 4CJTA 2DPJA 3BJYA 3NH1A 1NJXA 4ECZA 3IN5A 4R5PA 1FXXA 4MFBA 2C2DA 4EYHB 2B6AA 4CJWA 3KTQA 5HLFA 4IRKA 2RN2A 2IC3A 1CZ9A 1HNIA 2ZE2A 1S48A 4CK2A 5HBMA 3U3YA 1N4LA 4Q43A 4NLXA 1QSYA 3KMQA 4FLWA 3QESA 1LWEB 3LAMA 3T5HA 4R8UB 3OYDA 4E1NA 5KFRA 3GIMA 2ZD1A 3NAEA 3RB6A 1YVFA 1QQCA 1LWCA 3MXIA 3NE6A 4IFVA 4FZYA 3M8SA 3V4IA 3PW4A 4BWMA 5J2NB 4CFBA 4F2RA 1HNIB 3O3HA 1L3VA 4DU1A 5L9XA 3SV3A 1QS4A 4MK9A 4J9LA 1YTUA 2OPPB 4IRCA 2EC0A 4JUZA 4HYKA 1WAFA 4ECWA 5KG7A 4F3TA 3AVCA 4B08A 3H5UA 2YKNB 1T8EA 2XGPA 5CYQB 4C8LA 1VK0A 2C2EA 4ED2A 3VQ8A 4KPYA 1JL1A 5KGWA 5KFXA 3SFUA 2RPIA 4NCGB 1SKRA 4FBTA 3V4IB 4FZXC 4CFDA 2CKWA 1NK4A 1IM4A 4NZ0A 4I2PA 4GVMA 2YNHB 4M3UA 2D7SA 1TQLA 4EYIB 1Z4UA 3OYIA 5DQIA 3M9NB 1RTJB 1RDBA 4OVLA 1KSPA 1NHVA 2FBYA 3VQBA 4DF8A 4ED7A 5JS2A 4ED1A 2FJWA 2YNGA 3I0SA 2OPQB 2Z1HA 3NF9A 2Z1GA 2HHUA 2J6TA 3SQ4A 1NK7A 1QE1B 3RRHA 2EX3A 2YNFA 1U09A 2WB4A 2BDPA 1N56A 1J54A 1Q9XA 4JV2A 2XRIA 2HWHA 3ZT1A 4E7JA 4ZP6A 3QLHA 3PVXA 2C22A 2GBZA 4XIUA 4RW7B 5D3GB 4WZQA 5HBMB 4H4OA 4HUGA 3C6UB 3OY9A 5J2QB 2VG7B 3MR2A 2WONB 2IM0A 2G8WA 4KFBA 1TKTB 4FLTA 2W8LA 4FK2A 4JV0A 5L1LA 3KK3B 2PYLA 3O3GA 4MK8A 1C6VA 3NFAA 3CJ4A 1U45A 1SL2A 3CJ2A 4CGJA 4IG0A 3PZPA 3L3VA 4J9MA 2F8TA 1WSJA 4Z0UA 5KTQA 2XCPA 3UIQA 5FDLB 4EBEA 1UWBB 4YMEA 2JEIA 3KLGA 3RMAA 1KHWA 1GX6A 1XHZA 4ED3A 5KFYA 2EHGA 1C0TA 2HNYA 4G3IA 3UR0A 4O4GB 4I2QA 1HQEA 3U6FA 1HNVA 2YKMA 3PJXA 3G6YA 1N5YB 4Q0BA 1ZBIA 4H54A 5FROA 5J1EA 3CFOA 4IG3B 2A1SA 3AO4A 3PUFA 4I9LA 3WNGA 3AA4A 2JEJA 3CFPA 2W9BA 4NLUA 4IKAA 3OLBA 3QIPA 1WNSA 3OYAA 4NLOA 2IBKA 4CHOA 4I9QA 4Z4IA 2BQUA 1S1XB 3RBEA 2ZD1B 4FJNA 2KQ2A 5K14B 3NMAA 1KLNA 3V6KA 1XHXA 4QOZB 2FVPA 1RT5B 2AJQA 1GOBA 4CEZA 4ED8A 2W9CB 3HM9A 3VQPA 3PW0A 2AX0A 4CECA 1JLGA 4ECYA 3OYEA 4LH4A 4CJ4A 1UA0A 3JSMA 1TV6A 2W9BB 3QLHB 3KIOA 4TYBA 1RTIA 3BSOA 3K57A 4B9SA 2VG7A 2HNZB 3U3GA 4ZTJA 4FLYA 4YNQA 2AX1A 2YKNA 3H5SA 1RDDA 4NYFA 5J2PB 5K14A 2BR0A 5DQGA 5KFKA 2UVRA 4TXSA 2BE2A 4OKEA 3GQCA 3RR7A 2YHAA 3S3OA 1R0AA 3QINA 5J2MA 5HRSA 4TYAA 2KZMA 4B3OA 3LP2A 5KFIA 3ISND 4XPCA 3MR6A 4URSA 4N56A 3CG7A 4CJEA 4ECVA 2W9AA 5KFQA 4ZP8A 3RAQA 3OJUA 3BSNA 5FDLA 5CYMB 2ASLA 5DMRA 4CEFA 4CGGA 1HQUA 5J2PA 4M94A 3OSNA 1FKPA 3DOLB 4ZMMA 5KG3A 5KG4A 1JXEA 4YR2A 5I42B 2DY4A 4CFCA 4RNOA 4M45A 4DLGA 5DGBA 4CGHA 4CF9A 3KLFB 4ELTA 3I0RA 1RBVA 3I5BA 4QPXA 4FJ8A 5D3GA 4FM1A 4CCHA 4RUCA 1S1TB 2B4JA 2HHTA 4FW2A 4J9RA 1HRHA 5C24B 3OYBA 4DL6A 1NHUA 4FJ7A 2B5JA 3P83D 1IG9A 2BRKA 4B8CA 3SV4A 4FS1A 4CF0A 1S9FA 4F2SA 3AA3A 5DQHA 2FBTA 4DU4A 2IM1A 3MEGB 4DG1A 1JLGB 3VQ5A 3BSCA 4K4XA 2UVVA 5KFDA 3C95A 3BDPA 5FRMA 4FYDA 5KI6A 4BE0A 4WXWA 4QWEA 3QEIA 5EWEA 5KG5A 1CLQA 1X9MA 4J9OA 3BREA 2OPQA 3MEEB 5KT6A 4RG8A 5KFSA 3DRSA 4EO8A 3ASMA 4DFKA 3TI0A 2QKBA 1R0AB 1RDRA 1T3NA 1DTTA 3KLIB 2YNFB 3K5MA 4PA1A 1C1AA 5J1EB 3IGVA 1I3AA 4B3OB 4IDKA 5HROA 3BQ1A 4FM0A 2HVIA 1RCHA 4Z4CA 1RAJA 4E0DA 1NOYA 2ZKUA 4J2EA 1SKSA 3OYMA 1S1VB 1D1UA 4KTWA 3DI6A 3QIPB 5DLGA 2E9RX 3T19A 1EX4A 1LWFB 3DLKA 3KLVA 4M3XA 4EZ9A 3RRGA 2D3ZA 1NK0A 4ZVFA 4BDZA 3GV5B 4XPEA 3OYGA 1TL1B 1RTDA 3L2RA 1IKYA 4CJRA 4OGCA 3SZ2A 4J9KA 3VQDA 4Z4HA 3KMSA 4E7HA 4IBNA 4R5PB 1L3SA 3MECA 4KB0A 3F73A 5HLFB 4DTMA 4F3OA 3N6LA 1S6PA 4J2AA 3DOKB 4IH7A 5KFUA 3O3FA 1TV6B 4DSJA 3O4NA 4KHQA 2XCAA 2HVHA 1RTIB 4CEAA 4OPJA 1LW0A 3JYTB 1NKBA 3CO9A 1UWBA 4AHUA 4F4KA 1KCFA 4F8RA 2RDIA 1RBSA 2ZQBA 3H4BA 3TANA 5DGAA 1HQEB 3H98A 4O55A 2PY5A 3MECB 3EZUA 5JXSA 4Q0BB 2C28A 2XO7A 3LP2B 3Q8RB 2JC0A 3LDSA 3HP6A 3CQ8A 3VQ6A 1RT6B 3OVNA 4AHTA 4DTPA 1O1WA 3AVMA 2Y1IA 3G6XA 2XY7A 3QO9B 4LD0A 4MK7A 2R7YA 1ASWA 4CEOA 2O5DA 1LW0B 1KVBA 1D5AA 3OYFA 3DLEA 2R2UA 3PO4A 2GV9A 2LSNA 4ELVA 3RTVA 3MR3A 3PW5A 3PX0A 3HO1A 5KG2A 2WHOA 2R2RA 3MXMA 3DOLA 5EDWA 4IOBA 3TABA 5I42A 3NF7A 1SV5B 4ZP7A 4FLZA 4LSLB 1WNEA 4AHRA 1L3UA 3PX4A 4N41A 3LALA 3VQ9A 1S9GB 3BQ0A 3I5CA 1RT7A 3KLEA 2IA6A 1ASUA 3ZSWA 2HWIA 4G1QB 3ULDA 4CGIA 3ALYA 4DQRA 3MFIA 2X6SA 1Z25A 4EBCA 3KHGA 2FJXA 4LQ3A 1LV5A 4CJLA 4ID5A 3FFIB 4CEQA 1DLOA 2VG6A 2XI3A 1S0OA 1XR7A 2G8UA 4E7LA 4CGDA 4FK4A 3G86A 1EP4A 1I6JA 1IKVB 4HHTA 3GV7B 1D0EA 3ITHB 4DS4A 3CJ3A 3K5OA 4CJPA 4DTOA 4LQ9A 4JRPA 4CF8A 3D5MA 3JYTA 3KLHB 1CXUA 4RZRA 3ZT3A 3ZSRA 1XWLA 3VQEA 4IQXA 1VRUB 1NK8A 4Y1DA 2OPSA 3UDLA 2JLEA 2X78A 4CJ3A 4KAIA 3OYKA 3AVHA 3F9KA 1W0HA 1X9SA 4N76A 1T05B 1EETA 2IS3A 4B9MA 1RDCA 3NH0A 1JXBA 2DPIA 3V9ZA 1HARA 5F9LA 3H59A 4J9PA 1VRTB 2BQ3A 3WNFA 2IM3A 3C94A 1S5JA 4Y1CA 3T3FA 2B5JB 4MKBA 5F8IA 3OL7A 3TQ1A 4W5TA 3V1OA 4CIEA 2ASDA 4EEYA 3AO2A 2HNDB 5F8GA 3VQAA 1MMLA 5F8MA 2W8KA 1CZBA 3G6VA 1TAUA 1LWCB 4F4XA 4WFYA 1BQMA 3M8PB 4CJUA 4CHYA 3CDWA 4IKFA 3D0PA 3SUPA 3NH2A 4FJ9A 2OH2A 3KNAA 1T94A 5J2NA 5HRNA 4NLRA 3SQ0A 3DRPB 3DOKA 5KRSA 3S3NA 5DG8A 4O3OA 3CDEA 2OPPA 4DWIA 1G15A 2QV6A 2DFFA 4NCAA 3MEEA 4ECSA 2E6MA 3CM6A 4QAGA 5KT3A 4Y2AA 1VSDA 3QEWA 1RT5A 2BANA 4RW9A 3G10A 1ZTTA 3K5NA 3QIOA 1SKWA 4QW8A 4FJGA 1K6YA 3DLBA 1U49A 1ZTWA 3SFGA 4ZPCA 1TKXA 4RW4A 3KK1A 4KAZA 2YV0X 4KB1A 1NJWA 3ZT4A 2OPRA 1QHTA 1U47A 4DFMA 3KHRA 3OYCA 4DTXA 2HNZA 1RT4B 4NLSA 3V6HA 5C42B 2YNGB 3NBPA 5KT7A 4ED0A 3DRRB 2BANB 3AVAA 1RT1A 2VA3A 4FJIA 3PV8A 3KJVB 2AGQA 1IKXB 3LZIA 3DMJB 3HL8A 2HB5A 4FZZA 1C1BB 4DEZA 1BIUA 4B9NA 3OSPA 1BQNA 4FJXA 1W25A 3IG1A 4CJVA 3I5AA 5FRNA 3C6UA 3H4DA 2Y1JA 4M3ZA 5KFHA 3FQKA 3NDKA 2AGOA 5DK5A 4ZHRB 4RW6A 4K50A 2X6NA 4KTZA 4PQUB 3DLGA 2ILYA 2G8IA 4DQPA 4NYZA 1VSJA 1IO2A 4F4YA 1B9FA 3AA5X 4JS4A 1VSFA 1HMVB 2D3UA 4CFAA 1ZYQA 1TK8A 1S0NA 2YNIA 2UUTA 4ZVGA 4YP3A 2V4QA 3RB0A 4MH8A 2XHBA 2WCXA 1L5UA 3E51A 4DSIA 4FJLA 5KT5A 1HPZA 4DSFA 4FLVA 4OLBA 1BCMA 3HVTB 4R8UA 4KV8A 4RW6B 1VSMA 2O4IA 4Z4EA 1IH7A 2XY6A 4RNNA 3HJFA 4B9UA 4DTSA 4FBUA 4OPKA 4O4GA 4FJJA 2IMWP 1QSSA 2QKKA 1HMVA 1DTQA 1JLEB 2R8HA 3TAMB 3HKWA 3MAQA 3IS9A 3HPOA 3ZSVA 4F50A 5DG9A 5F8NA 3AO3A 3N6NA 4DSEA 2A1RA 3ZT2A 4IFVB 5KFNA 4QWAA 4Z4GA 4OL8A 3HVRA 2Z1IA 5KFMA 1REVA 4QWCA 3SI8A 4KTQA 4EP5A 5CZ2A 2OZMA 4I7FB 3VQSA 3SQ1A 4O0JA 2W7PA 2IDOA 4URQU 3IS9B 4KHNA 3PO5A 4DLEA 4BWJA 3LWLA 4NLPA 2R8JA 1D8YA 3ITHA 1RTJA 2X74A 4NRUA 5KFBA 3LANA 3MFHA 1U4BA 2G8VA 1JLFA 2DFHA 4IR9A 2JEGA 3CJ5A 5F8LA 1KLMA 4YR3A 4J9SA 4DTUA 3LPTA 4DL2A 3MEDA 5KFJA 3EZ5A 3BGRA 1J5OA 5J2MB 2FVCA 3ZCMA 3V6DB 4CJFA 3SQ2A 2P51A 5CZ1A 3MXJA 3WNEA 1VSHA 1EETB 3QEVA 2JEFA 5KG6A 4KHMA 4ECRA 3M8QB 3S9HA 3LAKA 2FLLA 3KKRA 4RW7A 3NGYA 3EPIA 4PY5A 1HPZB 3PY8A 2WOMB 3NHGA 1BCOA 4KFBB 3V9WA 4Q5VA 1QUVA 4KV8B 1HQUB 4BDPA 3VQCA 1A5WA 2RKIB 1BL3A 1W9HA 3QNOA 2BRLA 2V0NA 2W42A 3M9MB 4H4OB 2FJVA 4ECQA 1NKEA 3V81B 3TR8A 1S1WB 2Z1JA 4K4WA 3SUQA 3Q8SB 3SI6A 3IAYA 2IC3B 1RT6A 3PHEA 2XC9A 4HCCA 2VWKA 1JL2A 3IG1B 3L8BA 4GC7A 1IKWB 1S9EA 3NF6A 2GIRA 4IG0B 2HHSA 3DLEB 4BDYA 4DU3A 3SJJA 3KLGB 4CEDA 2XY5A 1J9AA 3AVJA 3HPGA 3AVIA 3DLGB 2AWZA 4QWBA 2F96A 1RYSA 3KK2A 4HCBA 5KT2A 3V9UA 1YVUA 5HRRA 2HHVA 4QW9A 1Q9YA 4DG1B 2G8KA 3ZSZA 4OJRA 2P5GA 4K8XA 4M3TA 4JRQA 1I39A 3SPZA 3C6TB 1Y97A 3A2FA 3HK2A 1TL3A 2R8IA 1ITGA 2ETJA 2R2SA 2QXFA 5C25B 1N5YA 3CDUA 4NLDA 4M42A 4RUAA 4JV1A 4C8NA 4KHRA 1RT1B 1VSEA 4Y2CA 5JS1A 3QYYA 3PR4A 3MEDB 3GILA 2GIQA 5KG1A 4HTUA 1DTTB 3KLIA 2RF2B 2OYQA 4NLWA 1JIHA 4KE5A 3RMDA 3T5KA 1S1XA 5C5JA 3M8QA 1XI1A 1IKVA 3C6TA 1K1SA 5CYQA 1SL0A 3VQ4A 3PW7A 4KBIA 1HYVA 3L2UA 4F4ZA 3QGIA 1LWFA 3DLKB 1N6QB 3PW2A 4WXOA 4ZHRA 3WNHA 5KT4A 4WFXA 3D28A 3G0ZA 5KFOA 4B8AB 1OS5A 4CF2A 2UVWA 1BI4A 5KFVA 4O3RA 3KD1E 2C2RA 3V81A 4H8KA 1WSEA 1S1WA 4TN2A 1TGOA 3Q8QB 3KKSA 3FSIA 1TK0A 4J9NA 4BE1A 4EZ6A 5KFFA 4E7IA 1EKEA 1RILA 2KTQA 1S9EB 2VA2A 5J2QA 4B9LA 4W5RA 3ICLA 3GV8B 2UUWA 2KW4A 1BIZA 5F8JA 1BGXT 1KLMB 2BGGA 5HP1B 4FVMA 1SH3A 3FDSA 1RTHB 3NGDA 3OS0A 3TWHA 1TK5A 3TAPA 3KHLA 3CM5A 3M8PA 4FJKA 4AHCA 2FLNA 5CYMA 4ICLA 3MTKA 4ECUA 3KK3A 4XO0A 4EO6A 4DFJA 3THVA 4RW8A 5KGXA 1ZBHA 4AILC 4M95A 2FBVA 2IOCA 1U48A 5C25A 4CHPA 3OL6A 4DL7A 1WSIA 4FM2A 3N6MA 1JLAB 1RTHA 4IH6A 1TKDA 3BQ2A 4IRDA 4M41A 1JLCB 4W5NA 3I0RB 5EUHA 4DTJA 4K4ZA 1SL1A 4HUFA 1HNVB 1S1TA 3QEPA 4CIFA 1HYSB 4N5SA 4I7FA 2FC0A 1QSLA 3VA0A 1CSJA 1GOAA 5L1JA 1IKWA 1NJYA 2R8KA 3QGGA 4M3WA 2WTFA 2D0AA 4F4WA 3ZSYA 3DDKA 5C42A 1JLFB 4DL4A 3AVGA 4K4TA 4C8OA 4DFPA 1S97A 4CGFA 5SWMA 3VQ7A 4GC6A 4DTNA 5KFPA 1JLCA 3NCIA 4CIGA 3FQLA 1BI4B 2V4RA 3QERA 1YT3A 3VQQA 3ZSQA 3NGZA 1T7PA 3LZJA 4MKAA 4Y34A 5KFEA 3CIZA 3OS2A 1JLBA 2HW3A 2XWYA 4YQWA 3T1AA 3I8DA 3EPGA 4NLTA 3PR5B 4LSNA 1ZBFA 4AHSA 2Q3SA 1WN7A 1ASVA 3LP1A 4IDKB 5HROB 1TKZB 4LY7A 2VG5A 1TL1A 1RTDB 2E9TA 1JLQA 4FJ5A 2RKIA 1UA1A 3JSMB 3FRZA 4B9VA 1S10A 3MF5A 4O44A 1C0MA 5SZTA 3EYZA 2RF2A 3CVKA 3UQSA 1LW2B 3H2LA 5F9NA 4CHZA 4AH9A 1D9DA 2VWJA 3OHAA 2HHQA 1A5XA 3L2WA 2FBXA 4O3NA 1IKYB 4FJHA 4DSKA 4TQRA 5EU7A 4LH5A 4LSNB 1N48A 1JXLA 4FW1A 5EWGA 3H08A 1TKZA 4OLAA 1LAVA 2PZSA 1UAXA 3PJWA 1QAIA 2IJFA 4HUEA 3AO5A 3OL8A 3AVKA 5KRTA 2BQRA 4TQSA 1RYRA 3HXMA 1C0UB 3DRPA 3RB3A 1KVCA 1FK9A 3QNNA 3NAHA 1FKPB 4ZP9A 3HVAA 3RBDA 2D0CA 2PYJA 5KG0A 1NOZA 1TL3B 4CF1A 2FLPA 4MFBB 1T03B 4GMJB 1RA7A 2ATQA 3DLRA 1TP7A 4E7KA 4ZPDA 4RW9B 1KHVA 1SV5A 1VSKA 2P5OA 4O3QA 2AQ4A 4DF4A 4ZTFA 5C24A 4HKQA 2KFZA 2UVUA 4FS2A 3E01B 3LPUA 1VSLA 2JC1A 4NLVA 2HHXA 1ZBUA 1FK9B 3RAXA 1C0TB 2HNYB 4FK0A 1X9WA 4X2BA 4I2QB 4KO0A 4W5QA 2HHWA 3NBPB 4PWDA 1T03A 3GIKA 1A5VA 4ZPAA 3BSAA 2O4GA 1JLAA 3LP0A 3L2QA 3BR9A 4C8KA 3MEGA 1RDAA 5KFGA 2VG5B 2IM2A 3AVBA 3TAFA 4EP4A 4CJQA 4NRTA 2YHBA 5EWFA 1WSFA 2WK4A 5CY4A 3V6DA 4QWDA 1HYSA 1XC9A 3AVLA 4MIAA 1LW2A 1SH0A 3HT3A 1RBRA 4QCLA 1S6QB 2QK9A 3AVFA 2GC8A 2XGQA 3OS1A 1RBTA 4CJ5A 4NCBA 4BACA 1HYZA 4E19A 4J2BA 3VN5A 3FFIA 4ID5B 2IJNA 4NCGA 4ZPBA 4PWDB 3LP0B 4KHSA 5HP1A 1WAJA 3QETA 1RBUA 3LWMA 4PQUA 4NLQA 4K4VA 2YNHA 1KTQA 4KKOA 4AHVA 1J53A 3K2PA 1S1VA 4DQIA 3KD5E 3H5YA 2IAJA 3DI6B 3HHKA 4KREA 4NLYA 2RDJA 4RNMA 1NJZA 3KLHA 1XR5A 3NKYA 4TY8B 3V9SA 1K1QA 1UOCA 3CYMA 1B9DA 1TVRA 2OPSB 2HMIB 3NAIA 3HPHA 2AU0A 5HRPA 1SUQB 5E41A 4PUOA 2AGPA 1T05A 5KFCA 2G8FA 1S6PB 3O4QA 4YFUA 3RR8A 4R0EA 3KK2B 2FVRA 4K4YA 2P1JA 4KHYA 1KVAA 3DYAB 4ZVHA 4O0IA 1C1CB 1JLEA 3E01A 4TY8A 3T5JA 1NK6A 3H5XA 3DLHA 1TVRB 3OYHA 4WYWA 3HSTB 3DM2A 1X1PA 5KFTA 4KI4A 4M3YA 4KO0B 1SUQA 3SYZA 4KI6A 4JS5A 4CJKA 1NK9A 3TAQA 3QGHA 4WYLA 1QAJA 2GUIA 1KRPA 3QZ7A 1ZETA 4UQGA 4ID1A 4KSEB 4H4MA 5JUMA 2QE5A 4URGA 2I1RA 3V1QA 1QTMA 1C0UA 4IFYA 1LWEA 4DS5A 3NF8A 3HP9A 3IRXB 3T5LA 1JLBB 1RT7B 5T7BA 1ZBLA 5KFAA 3Q8PB 4Z4FA 2YKMB 1RNHA 4G1QA 4TLRA 4IR1A 3OJSA 4O3PA 4FLUA 1NKCA 3EY1A 4IG3A 4DSLA 1TKXB 4RW4B 5I3UB 3KK1B 3HVWA 2B43A 4Q8EA 3DRRA 1JLQB 3SUOA 1S9GA 4KKOB 3ZSXA 2OPRB 1B92A 4KHWA 1U04A 4O44B 1SH2A 4CERA 3OYNA 1IKXA 1BISA 2J6SA 3QZ8A 4ECTA 2E4LA 1BQNB 3GIJA 2CJQA 3M9OB 5F8HA 4MIBA 1WSHA 2ATLA 4W5OA 3DRSB 4CE9A 4BE2A 1DLOB 2VG6B 4FXDA 4DTRA 3KJVA 2XI2A 4PUOB 2D41A 1JX4A 1RT3A 2B6AB 4ECXA 5KFLA 2W7OA 4DMNA 1F21A 5T14A 4TSXA 2ZE2B 1S1UB 1WLJA 3ISNC 3V6JA 4JLHA 2E6LA 1C2PA 3SPYA 3OLAA 1GX5A 4N47A 3SUNA 4KRFA 4OKKA 3D45A 1S6QA 1Q8IA 3ZT0A 3VA3A 2D0BA 2F8EX 5L1KA 1S0MA 2BE2B 4RW8B 2FVQA 4WE1A 2ILZA 1QE1A 1VRTA 4Q44A 2R8GA 3DM2B 3B6PA 4DL3A 1Z26A 4CK3A 1VSIA 3SNNA 3HVTA 3P5JA 4CJSA 4ELUA 4K4SA 1RA6A 1WSGA 4RU9A 4HVJA 2D5RA 4MQ3A 2F8SA 1S4FA 3L2VA 3AVNA 4CEBA 2R2TA 3OHBA 2HNDA 2YNIB 5KFWA 3NGIA 5L1IA 4Q8FA 1RT2A 3V9XA 2DFEA 4J2DA 4B9TA 2I5JB 1KFDA 1S1UA 4H4MB 2IAJB 4CK1A 4RNFA 3GIIA 3OYLA 1S49A 3RB4A 1DTQB 4CESA 3TAGA 1TKTA 4CHQA 3TAMA
chains in the Genus database with same CATH superfamily
2N4DA 1J27A 1FRIA 2NRWA 3HCXA 1FFGB 1GOCA 1WHWA 3IRXA 6AT1B 5HOOA 1U1OA 4CHNA 4OMFG 3M8RA 4O8UA 4OZLA 4R25A 5HK4A 3CQXA 3AA2A 2CQ4A 2WRMA 3D66A 4FF3A 3CJ0A 1XR6A 1X9JA 3QO9A 4Q45A 2EFVA 3BEGB 2J6UA 3MR5A 2P9IB 3D1QA 5DLFA 1UW4A 2P9UA 2HZAA 2LECA 4DV2K 1RAEB 4ZVPB 1N36J 1ZPWX 3GSIA 4WZMA 3H40A 1YTAA 1RT4A 3PX6A 3NL0A 5BN8A 3C8YA 3M2RB 1WHXA 3O6WA 3RUBL 4DQQA 2V9WA 2ZJPL 2VGNA 4PWWA 4BC2A 2CAJA 4DL5A 1D9FA 5DG7A 3KLEB 4XK8C 3OL9A 2JLFA 3CJCA 2AV5A 4B3TK 3QIDA 1F60B 4H5RA 3FJ2A 3P38A 4ZCMA 3GYNA 3V1RA 5J1NA 2ALZA 3ADAC 2MQLA 4E1MA 2V8HA 4DZ6A 2WOMA 3UFCX 3NMUA 2QFJA 4I4BA 4FCYA 4ZVEA 2RMLA 1OMSA 4DPWA 3S1TA 3CFRA 4BBYA 1RT2B 1TAQA 2ACYA 1JKHB 3OYJA 4FLXA 2Q1LA 2A18A 2YKPA 4O5BA 2IGIA 3BGUA 4ZPWR 3LP3A 4BR2A 3NY0A 4ICLB 3U1NA 3FBFA 3TARA 3GR0A 1VRUA 3PTWA 4Q7AA 5A0YA 4JK9A 3BJYA 3IN5A 3Q0AA 3D2WA 5AQOA 3IXQA 1HPMA 2B6AA 2KU7A 4M1KA 2QWPA 4IXCA 1S48A 2FHJA 5JMVA 2EK6A 4XH4A 1RISA 3VEWA 4ES2A 1LWEB 1MW7A 4E1NA 5KFRA 4F0KA 1FRHA 4HACA 3NAEA 5ELZA 1K8KB 2NCKL 2CZVC 1YVFA 2QSWA 4E8UA 3WXKA 3FZKA 4OHXA 4FZYA 4BWMA 1F5AA 4F2RA 1HNIB 3N4PA 4Z7CA 3J80O 1P8GA 3SV3A 1YTUA 1S12A 2HRYA 4DR2F 4ECWA 3HX9A 3AVCA 2PA8D 4F3TA 4JD2A 5DRKA 4B08A 4JI1J 3OFEA 4BC5A 2CXEA 4FYXB 5D6GA 1VK0A 1JL1A 5KFXA 3SFUA 4Y2IA 4LFAJ 3FZLA 3EVMA 5GVQA 1VRQC 1QVGR 1SKRA 2QLFB 4FZXC 4BS2A 3CMQA 4LF7K 3B4MA 1IM4A 2P5VA 4ZKAA 4GVMA 2QFIA 3OYIA 3AXMA 3VWSA 1LFWA 1RTJB 1KSPA 2J9EA 2PC6A 4S0MA 2CPXA 2YNGA 1W2IA 4FWRA 5D4NA 3I0SA 2Z1HA 3NF9A 3OW2M 3QBCA 4BRKA 1K8AO 4LFBF 1UFKA 2VPYB 2J6TA 2KT2A 3MUVP 3RRHA 4CLWA 2DTJA 1QZ5A 3QDKA 5U47A 1J54A 4JV2A 5JICA 4LFCJ 4BRPA 2H5JB 2HWHA 4E7JA 3DRXA 4NXMK 1WEXA 3Q2TC 3R5JB 2MSTA 3A5NC 4XIUA 2GBZA 1K73O 2ZFHA 2OMLA 4HUGA 1NJIT 3OY9A 1JQGA 2VG7B 3MR2A 4CLTA 3ZLJA 1D9AA 4NB4A 2CPJA 2ASPA 4MK8A 3O3GA 1C6VA 4Y0WA 3DXSX 4BRAA 3R9LA 1WSJA 3DLLQ 1KOOA 3R27A 2R7VA 5JVGL 4M8LA 1YI2S 3M1VA 3FGVA 3D9BA 3VCDA 4YMEA 3VV2B 2UV8A 4ED3A 5A0YB 4FOIA 2EHGA 3W5YA 4K2XA 4G3IA 2ZH1A 4O4GB 2WW4A 3EGVA 4NO7A 1HQEA 4FWKA 3IO1A 2YKMA 2F9WA 3G6YA 1N5YB 1VQKS 2AYBA 2LQJA 3W66A 4CM0A 2LU2A 3AO4A 2J7WA 4BG8A 4TU7A 2FQQB 4I9LA 2BE9B 5M1KA 2ZNYA 2QA2A 4OI0A 4NLUA 3VGVA 3OLBA 3QIPA 5FJ4A 1GXLA 1WNSA 4NLOA 3OYAA 2UUAK 4I9QA 2RHKA 5C7PA 1S1XB 1MN7A 1BLUA 4FSVA 3T9ZA 3QJLA 4WP3A 1NLVA 3C14A 3KNGA 4BC7A 2FIUA 3R2DJ 4BRCA 3AGKA 3RJMB 3UDVA 2C42A 3PW0A 4CECA 3K9KA 5BJRA 4LIRA 4EWTA 1UA0A 5AQFA 1RBOB 4AXJA 2F4VF 1YSJA 4FXVA 3KIOA 4TYBA 1FJGF 4U67Q 3K57A 4B9SA 5F0UA 4X66F 2ZOMA 4UOCA 2H3GX 4FLYA 1JJ2R 3MPWA 4NZ6A 3A8EA 4OX9F 1EQMA 3P5BP 2BR0A 5DQGA 4LFAF 1VYAA 4NMLA 2CPDA 3PRDA 4DV7F 3I9V9 2N4CA 5HRSA 1HKBA 2KG0A 4ZVOB 1YTYA 3LP2A 3ZX0A 3ISND 1TYQA 4XPCA 4UY85 1RHUB 1YAGA 1UEVA 2IRUA 3CG7A 4CJEA 5LMUF 4WU2A 4MO4A 3RAQA 5H9FJ 1NH7A 1WBBA 2ASLA 2HLUA 4CGGA 3TNVA 3WXMB 5J2PA 2B4PA 5T7LA 2MPUA 4CT9A 5I42B 2BEFA 5GAGU 2GO9A 3TJAA 2RE2A 4Z7YA 2Z2ZA 1KQFB 2DY4A 4ES3A 4RNOA 1RHQB 4DLGA 5DGBA 2M2BA 4H5VA 3U9ZA 3DKDA 3I5BA 4I69A 5D3GA 4FM1A 4RUCA 2B4JA 5AQKA 4J7CA 4WKRA 4J9RA 1BMQB 5C24B 4I6YA 2X1AA 1Q82T 5FLXU 4DL6A 3ISZA 2ZUGA 1W97L 2VWBA 4CD1A 3SV4A 1F5BA 1OVYA 4CF0A 2E5JA 2YTCA 3VETA 2LYVA 1IBKF 3SXLA 4IEIA 2Y1LB 4MT1A 3MEGB 1M1KT 3ILLA 2HFNA 1HNWK 5KI6A 4WXWA 3NVKA 3QQCD 2QT7A 3Q2SC 5E5NA 4J9OA 2OPQA 1Q53A 2B4UA 1N32K 4RG8A 5DZ6A 1MWKA 3BKUA 3Q8UA 3ASMA 2CWXA 5AFUA 4ANDA 2YNFB 3K5MA 1C1AA 5IQQA 2DIVA 3IGVA 3E66A 1IJFB 1I3AA 4FM0A 3BQ1A 5GADI 2MKCA 5HMYA 3LM2A 4AD6A 1IBLJ 2L9DA 4NEYA 3SJHA 3RZAA 4XH5A 4F0MA 3TA2A 3QIPB 2BKNA 4GNIA 1TR0A 1HR0J 4CZJA 2KXFA 3KLVA 2W6KA 5IOLA 3RRGA 2X51A 1R8AA 4NOHA 2D3ZA 2ZJRQ 4XPEA 3OYGA 1RTDA 3UDEA 4CJRA 4J9KA 3VQDA 4E7HA 5D4OA 2PBDA 4X4SA 1S79A 4KB0A 4OLPA 3IR5B 1WHVA 1CQNA 3N6LA 1OH5A 2UUBF 3O3FA 4DSJA 3T9NA 3W5XA 5AQJA 2KG1A 4KJIA 2CJBA 5K8MA 2IMOA 3EGZA 2RU3A 1IWGA 4NZ7A 2CQDA 4HR2A 4OPJA 1LW0A 2F8MA 5KQ8A 1NKBA 2EI5A 4AHUA 4JYAF 2ZH3A 1RBSA 2ZQBA 3F2KA 2M9KA 4P10A 4A5BA 3ULHA 3TANA 2DPNA 3H98A 2YXLA 2LQ8A 4X4PA 4X4NA 5JXSA 2C28A 1JXVA 3LP2B 2JC0A 2E5LF 3VQ6A 1RT6B 2PI5A 3OVNA 1NMEB 4DTPA 1O1WA 3FBEA 2RAQA 2J8SA 5E3PA 2XLJA 1HBUB 1Q95G 3EGWB 1ASWA 4CEOA 2O5DA 2OO4A 3CD6S 1F0XA 5AQMA 3OTCA 3OYFA 3DLEA 2GV9A 1KBRA 3RTVA 3C16B 2WHOA 3MXMA 3DOLA 3Q7CA 5LJ3Y 5ETTA 4A47A 3CDBA 4FLZA 1PBAA 3MPDA 4FL9A 3PX4A 2DNPA 3VVTA 1SJ3P 1MWQA 1RCXB 1FFWB 1S9GB 2CGLA 2ZBPA 4RTFD 2GMJA 2E5IA 1IUJA 4BRIA 3WHIA 3AA8A 3ULDA 3NS7B 4CGIA 4QU7A 5IT4A 1IBKJ 3MZIA 3MFIA 4BRQA 1N8RO 3KHGA 4B3RJ 4PXBA 4DCOB 4LQ3A 4H0PA 2VPXB 2Z2YB 4X65K 2QEXN 3M8ZA 4F3MA 2KHDA 4CGDA 4C1NI 5CZXA 3R8YA 5G4DA 3CNQP 3TZWA 3M32B 2ZGZA 3B6BA 4F0HA 1IKVB 2UU9J 4ZOSA 1WEYA 3GV7B 4CJPA 8RUCA 1Y9OA 4CF8A 4J9VA 3JYTA 3S01A 3UKRB 1CXUA 3ZSRA 3SEOA 1RKIA 2E1MC 4FYWB 1PJ6A 5K8PA 1OVQA 1N33J 5ETVA 2LVWA 3AVHA 1X9SA 1EETA 2IS3A 1X7VA 2Z4PA 3NH0A 4HDGA 3GYGA 3V9ZA 3GG1A 1QM9A 2KXNB 1HARA 2BQ3A 4KHPF 4OI4A 3G71N 4Y1CA 2V50A 1FNOA 3G8TA 2X1BA 3C16A 4W5TA 3CCES 3HHLA 2ASDA 1PILA 1NUEA 2W8KA 3B82A 3G6VA 1TAUA 4USHA 4NI2A 5GAEU 1X5OA 2CQCA 1UPPA 2Y8WA 5GMDA 3SQ0A 3KNAA 1T94A 5GAEP 4OJGA 4JP8A 2ATCB 4Q2LA 3WC0A 3L6QA 2O8DA 2KKHA 2OPPA 1N8RT 4DCPB 4H4KC 4FF4A 2ZHBA 1IWAA 3CM6A 4QAGA 2DGVA 1VSDA 4ZVTB 3QEWA 3GL1A 1DQ9A 1VQSA 3G10A 2CVIA 2ZWHA 2B9WA 5BR8K 2BJ3A 3H3NO 2MY8A 3SFGA 4ZPCA 4LF6F 4RW4A 3FEXB 4PG6A 1C0GA 4KB1A 4OZNA 2XYPB 3OVSA 1WELA 1U47A 5KPRA 3MXHP 2EKNA 4DR5K 4FKXA 4HHJA 4DTXA 1RT4B 3QBWA 4A8YA 2DNNA 1VQON 4USUA 4H4KA 1FESA 3DRRB 3DXKB 4AE5A 2PGCA 4AM6A 3ETOA 3KJVB 2AGQA 3LZIA 3DMJB 2PMHA 1G99A 5D8HB 5EHHA 4Y2KA 4OLOA 2HQIA 2CDQA 4D3HA 1BIUA 3CIMA 3W62A 3OSPA 4FJXA 2DJWA 4DR1J 5FRNA 3C6UA 4M3ZA 2DGWA 4LF5F 4Z94A 4JI0F 2YX1A 2P9NB 1WF2A 2X6NA 2WUSA 4BC9A 4KTZA 3MWBA 2F7VA 5AE3A 5BRFA 1WC1A 3AOCA 5AZIB 4F4YA 3CT9A 3AA5X 2ERRA 4FWLA 2C3OA 3G9CA 2IYIA 2OI2A 1NJIO 1ZYQA 3CJKB 3M4XA 4YP3A 2V4QA 3P5TL 4HHUA 3E51A 4DSIA 2EFPA 4FJLA 4OQJA 4FLVA 3PXGa 1XBWA 1BCMA 1IBCB 4R79A 3CHWA 4KV8A 2KO1A 2RH3A 4QYRA 4RW6B 2PDAA 3SBTA 1RTZA 2Z8QA 1N33F 1IH7A 1Y3JA 2XY6A 5C2DA 3GMGA 4FBUA 3ENBA 1NXIA 4HI2A 3HSZA 3LGHA 1YIJN 3G8QA 1Y11A 3OTBA 1HMVA 3NGKA 1DTQA 3RU0A 3R6GB 3TAMB 2O8CB 3D2FB 3IS9A 3CDAA 2UXBF 2HZCA 4UUXA 1GLAG 4RKUC 2FZKB 4LBPA 4UW2A 4DSEA 3CMES 4L74A 2B56A 3ONQA 4KT0C 4IFVB 4DX8H 4Z4GA 3HHLB 3HVRA 2Z1IA 5KFMA 4M5GA 4QWCA 4A8MP 3UNGC 4KTQA 2NLXA 1K44A 4I7FB 1TU0B 2UP1A 2CJYB 3THTA 4OI6A 2CG8A 3O80A 4B3RF 5LMNJ 2B7CB 1D8YA 7FD1A 4NRUA 4TNOA 2G8VA 2ZH7A 2P9CA 3CJ5A 5F8LA 1FDAA 4DTUA 5MAOA 3LPTA 3MEDA 3LDQA 4BRDA 4CZGA 4YOWA 3EZ5A 4GVBA 3BGRA 1J5OA 5J2MB 2FVCA 3SQ2A 3V6DB 4JEPA 3MXJA 5AZJB 3MM8A 5KG6A 5M1PA 1MG7A 3DAWA 1WKJA 3BPDA 4P74A 2FLLA 3K8WA 3M05A 4OYAA 3NGYA 3PY8A 2W24A 3NHGA 1BO5O 2MQMA 2DGSA 3FKBA 4H0YB 4DR2J 5JVHL 4KV8B 5IWAJ 3D1HA 1HQUB 1RHJB 2YWWA 1VJQA 2Z0GA 4JHDB 5CD4H 4CM2A 1T9TA 5AQVA 2BRLA 3TJ9A 1HNXF 3V81B 3QWUA 3TR8A 5E33A 2Z1JA 4A8QA 1KC8O 1X4CA 1XC3A 2XC9A 1M0SA 3MUTP 4NL5A 1S9EA 5IC6B 3OT9A 3W8PA 3SMPA 1YVNA 2B9XA 2HHSA 5DM6L 3DLEB 4BDYA 4LF4F 1B0PA 2DNYA 3THXB 4WFBQ 2EKYA 1HKGA 3CCUN 4GVLA 1J9AA 4K43A 3BP8A 4P2SA 1V4TA 3DLGB 2AWZA 2F96A 3E3XA 3VEVA 2C3MA 3ZTRA 4HCBA 2FC8A 2VC1A 1VQPN 4QW9A 1Q9YA 1X31C 1GH8A 3CF5Q 2H4YB 4U8VA 3Q7BA 4LF8J 3P4UB 2EFGA 3CXCR 5J1PA 4YOVA 4ZVQB 1BWFO 1SS6A 3K9JA 4BQLA 2R8IA 2I0XA 2LFVA 2QXFA 5DM7L 4NLDA 3DHWC 4F36A 3OR1B 3WDOA 1WF0A 3F56A 3IMQJ 3QB0A 4KHRA 2HFUA 4M5IA 1RWXB 3PR4A 1DTTB 3GDQA 1UW9A 4KE5A 2E1RA 1S1XA 2J7KA 5C5JA 1G4CA 1HBMB 1XI1A 1IKVA 4KYZA 3CETA 5ETPA 3KYLA 1K1SA 2G2OA 2PI4A 5BYQA 3M2VA 3L2UA 1LWFA 3PW2A 3EE8A 4BRMA 3CQYA 5KT4A 1VBXA 3D28A 3LW5C 1OS5A 3DCAA 1ZBSA 2COLA 2HF4A 5AQWA 3V81A 2YQ1A 1S1WA 1TYQB 4X4QA 2NXNA 1VAZA 3CIPA 3EKSA 4E7IA 1RILA 1YHQS 3C19A 1S9EB 2G0CA 5AQZA 2ZEJA 2Z57B 4W5RA 2HHPA 3N0VA 2X3DA 2MMYA 2QWRA 1MWYA 3GV8B 2DGUA 1KKHA 1H7WA 4Z2XA 3UD5A 3SMZA 3NGDA 4DV4F 1ZPVA 3TAPA 3VAKA 3CM5A 4NYOA 4U67L 3K89A 1DRZA 2HS3A 3KG0A 4JAXA 2FLNA 2E5LJ 4ICLA 4DV2J 4ECUA 3KK3A 3THWA 3AAQA 2W6LA 2IOCA 2RT3A 3BN4A 1DBDA 5C25A 2AP6A 3OL6A 4DL7A 3W1YC 1WSIA 2XMMA 1RTHA 4CYUA 1U6ZA 2DNMA 3BQ2A 3I9ZA 4M41A 1JLCB 1VQ9S 4HL9A 3FZBA 5KOWA 2P9KB 4LT6A 2KB2A 1E6VB 1RU1A 4LF9K 1YHQN 1AZSB 5AQYA 5CH7B 4L3NA 2R8KA 1QAYA 4DR2K 1FRXA 4M3WA 2D0AA 1ICEB 2XMAA 4DL4A 1H1VA 5IXUA 4HTLA 5FD1A 3UW1A 3WIVA 1GK8A 3EJMA 4DR1K 4UZCA 4P7TA 1YI2N 4OZJA 4HEA9 4JI1F 4J9UE 3QERA 3ZSQA 3NGZA 2KL8A 5HVHA 4C8ZA 3CIZA 1X5TA 2PMZD 3OS2A 1M5SA 3UD3P 1U2VB 2HW3A 4LR9A 2A40A 5A8KA 2CVEA 1FHTA 1R8HA 1ASVA 1UFLA 4IDKB 5HROB 4LY7A 2E9TA 4LMZA 2PO4A 2LCWA 3U1LA 4CLYA 2E1YA 3PYGA 1HNZJ 5L38A 1C0MA 1T44A 2RF2A 3CVKA 1EX8A 3VAHA 3QPIA 4AH9A 3RAMA 3CJ9A 2HHQA 3W2VA 1A5XA 1T9XA 4DR7K 4FJHA 4DSKA 1FO1A 4TQRA 3WZ0A 3SDEA 4LH5A 3MD3A 1KD1T 4KGZB 3UN3A 2YX6A 2FLOA 4WK1A 2JVRA 2PZSA 5C15A 1NMDA 2P6SA 1QAIA 1XN9A 1YQHA 1DFDA 4WP8A 5DO2A 2MGZA 1F3FA 2XMVA 3C3LA 5KRTA 3LOUA 1Q79A 2LXFA 2QLJB 1X0FA 5LXRA 3T1HF 3QNNA 5HL7L 3I82A 2PYJA 1CBKA 1E4FT 3QMLA 2WVFA 2GQQA 4E98A 3W2WB 1RLDA 4CRJA 3CCTA 4MFBB 1TFWA 1Y4ZB 1T03B 1EKRA 1FWPA 1Q7LB 4DV7J 1RA7A 5DDQC 4RW9B 3A0IX 4AF1A 1OQ3A 1U6FA 1BA1A 1IR1A 4ZVSB 2AQ4A 3QBXA 1I3OB 1RZMA 3J7YP 2VONA 2DGXA 1VSLA 1X3NA 2DY9A 3M1FA 2NREA 3G87A 4IDHA 2I2YA 1N32J 1KOHA 2OEMA 4LRDA 4KO0A 3CJ7A 3M6GA 3EICA 4MLHA 4ZPAA 2C3YA 3L2QA 4GKKF 5C2CA 1Y10A 5KFGA 2IM2A 2YKQA 3AVBA 4Z37A 2MTLA 2YHBA 4F7VA 1WC3A 2RQKA 2DR5A 2I6WA 4B3MJ 2L48A 3AVLA 2A2CA 4ISEA 1RBRA 4Y00A 1R27B 1U2CA 3OS1A 2V4JB 2XGQA 5GIPA 1B4SA 3BBCA 1RBTA 4NCBA 5CQGA 1PYOB 2E8AA 2NRZA 2IJNA 4ZPBA 5AQQA 4PWDB 4CBUA 2BE7D 3M32A 4KHSA 1WAJA 4ZITA 2CQ1A 3BO2A 3QETA 3LWMA 4PQUA 4NLQA 1XMQJ 1S57A 1DY3A 1VLOA 2CQIA 1J53A 1S1VA 3DI6B 2NXEA 3HHKA 4OIXA 4KREA 2VFUA 5HVFA 3AFGA 4DV5K 1XMBA 1NGIA 1WTBA 3VGSA 4NE9C 2MJUA 4IJAA 4KGXB 1NGDA 1K1QA 1UOCA 3POTB 3ZNJ1 5C2FA 3R5BA 3IM8A 2OPSB 2G0IA 4USWA 1KWMA 1VIOA 1NB7A 5HRPA 4K2JA 1T05A 5KFCA 2NUUG 1YRTA 4JYAK 2G8FA 2DCUB 1S6PB 1P1TA 3RR8A 2MEWA 3WT0A 4MTPA 1A9NB 3CEDA 2P1JA 3JSYA 1FRJA 4O0IA 2D0OA 3T5JA 5LJWA 1P6TA 2ZDPA 3KJFB 3PACA 1DARA 4WFNQ 3ZYYX 2KXHA 4CVNE 1G3OA 5KFTA 5AQGA 3CC2S 1SUQA 1T9UA 2CPHA 4KI6A 5M2RA 4JS5A 4CJKA 2OEJA 2Q43A 2F5GA 3TAQA 3CCMS 4WYLA 1QAJA 4CZFA 1KRPA 4UQGA 4A59A 1W7WA 3NS6A 1IN0A 2VBXA 3E2EA 4KSEB 4M5MA 4URGA 5HQ8A 4OX9J 3L4BC 1XMOF 2CADA 5HMWA 2GVDB 3C15A 1N36K 1FJEB 5GAEI 3LPEA 1JLBB 1RT7B 5T7BA 3C65A 1ZBLA 1WDTA 2DNRA 2NXJA 3Q8PB 1FRKA 4OFZA 1V5IB 4O3PA 1HFEL 4RW4B 5I3UB 2I38A 3P4IA 4A8FA 4Q8EA 2IIHA 3M6VA 1B92A 2W2MP 2C2NA 3QZ8A 2FDNA 3VTHA 5K9FA 5H1SV 2CPYA 3KUGA 5GIOA 1BQNB 1OJ4A 3GIJA 3KWMA 3M9OB 1JMTA 5F8HA 1GLLO 3SBGA 3R5AA 1VHFA 3DRSB 3JB9k 4YORA 4BE2A 1TMJA 4YOTA 1N34J 4DTRA 1RT3A 4DI6A 1FNMA 5KFLA 1QVGM 2EBGA 2W7OA 2A6AA 1R8BA 2ZE2B 2QTDA 3EN9A 4B02A 2O8BA 4CI6A 1HKCA 2PEBA 2E6LA 3J80Y 3H20A 4DV1J 3SUNA 2MQQA 2XWXA 3D45A 2MQOA 1Q8IA 2EWHA 1D4XA 4A8KA 2FVQA 1QE1A 2QWQA 2UZAA 2HFOA 1VRTA 1NDKA 1RAAB 1JK9B 1UZHA 1Y7PA 3HVTA 2ZJPQ 1AFJA 1DEJA 2C2MB 3ZEUB 2MDAA 2ROEA 4HVJA 1V3ZA 3D54A 2WVBA 4CEBA 5LL6d 2YNIB 5KFWA 5EOYA 3M6WA 1HQ2A 2G4BA 5BRHA 4EHUA 4RNFA 1LWXA 4MMOA 4PG7A 2OCEA 3TTCA 1S49A 1PKUA 1DTQB 4CESA 3TAGA 7AT1B 1NLKL 3D2FA 4O4RA 2G1HA 2A6MA 5L9NA 2AP1A 1SJFA 1XMQK 1HNZF 2G8HA 1H7XA 3TEGA 4BRGA 5IQ6A 4GW6A 3S3MA 4CO1A 1U8SA 3AQPA 1UFWA 1ZM9A 3BF1A 2FHKA 3KLFA 2NUBA 2I5JA 3K5LA 3QEXA 4C8MA 5ADXH 1FJGK 2HAIA 4X84A 4LFBJ 2U2FA 3GSDA 1HI0P 2K7KA 1S0VA 4ISFA 1C1CA 4U7CA 3SCJE 3NS5A 2XQCA 4Y3CA 5LXYA 5HVGA 3N5FA 1U2VA 3B6OA 5D77A 2AYEA 2MSSA 2KDOA 4L72B 1MU2B 1NK5A 1EQYA 1N6QA 2HKEA 1LK7A 4O3SA 1Z05A 1YJWN 3DLJA 3HYFA 1SPBP 1BWEA 2P9PB 4LF7J 5IV4A 3M6UA 3FGUA 1JKHA 1K73T 2NRTA 3SCXA 1X0PA 3TJ8A 3CSKA 2OA8A 4CP5A 1RJJA 4DQSA 3P1GA 5CZVA 3R5CA 4ZS6A 4H03B 1RADB 1RCOB 4NLGA 4WIIA 3KOAA 4EBDA 3BGRB 1J5OB 1PAUB 3DDNA 4Y6IA 1EXQA 3AV9A 1C4AA 2ITGA 3CPEA 2LA6A 4JHDA 4PYDA 4OGEA 3QSIA 4EIAA 3QT5A 1WHYA 3EVOA 5JVHQ 2KZZA 1VQKN 2ZUAA 3ZSOA 1U25A 4CEEA 2NPIA 4FWPA 1NJXA 3O2IA 4R5PA 4MFBA 3DNCA 3ZC4A 2WBRA 5HLFA 4CO4A 2J76E 1NSAA 4IRKA 1AFIA 2RN2A 2IC3A 2K7JA 2DEIA 3VEXA 2ZHOA 5HBMA 1WOSA 3H6EA 4NLXA 5AJ3J 3KMQA 2FTRA 3QESA 1Y3KA 3U1MA 3T5HA 4R8UB 3OYDA 5DDPC 4DHYA 2HQGA 2ZD1A 2CPEA 3V5RA 3D6MB 1CS4B 3PW4A 4ZLNA 1K9MO 4CFBA 4DCJB 4OYXA 4USMA 3THPA 3O3HA 1L3VA 5L9XA 1QJHA 1KNZA 1R7IA 1QS4A 4J9LA 3IWNC 4WF9Q 1YJ9N 3I56N 4BR4A 2EC0A 1V3SA 4HYKA 4IJNA 3WC2A 4JKEA 3HFVA 2YJEA 1SBRA 2E7XA 3N4WA 3H5UA 2YKNB 1T8EA 3ZTSA 3PYFA 2RRNA 5CYQB 2D4WA 4JI6K 4ED2A 4I68A 4KPYA 3VQ8A 2QMWA 4NCGB 4Y65A 4FBTA 3V4IB 3WIUA 5LSRA 3HI0A 1RABB 3WUHA 1NB2A 3T69A 4M3UA 1U02A 1Z4UA 5A76A 2MQ8A 3WQPA 1RDBA 4OVLA 3MK6A 1DJ0A 1NHVA 5IFMA 4DF8A 2FBYA 3JSBA 3VQBA 3QSYB 4JD2B 4ED1A 5M1OA 2AYGA 2OPQB 2VKZG 3UE5A 1NK7A 2WFBA 2QLWA 1U09A 2WB4A 2A5XA 2BW2A 2VDIA 1VBYA 3J7Z5 4V19X 5ETLA 2BKPA 2HHHK 2G8WA 4KFBA 5CE3A 2DHHA 1TKTB 4FLTA 5IV3A 4E1JA 1YX2A 5L1LA 1IBMF 3KK3B 2PYLA 3DXBA 3BYPA 1EHWA 3NFAA 1DURA 2M8HA 2DH8A 3BGFA 2GMLA 4CGJA 2HVZA 2QSFA 4IG0A 3PZPA 4EFHA 2VH7A 3PEHA 1CLFA 3PM9A 1N52B 2K2PA 1Q86O 3THWB 2OJ3A 4CO2A 3EE9A 1UJ4A 3AOAA 5FDLB 4OI3A 4R0JA 3O5BA 4NYPA 3MWTA 3H7HB 2HNYA 4MJKA 3MM7A 3W61A 4DV1F 1M1HA 3M2RA 1ZBIA 4H54A 3ATUA 1SXLA 5LMNK 3QICA 4IG3B 3ZZZA 4JKAA 1RBAA 4M7XA 3AA4A 5IT9U 2R7SA 3CFPA 3NCRA 3IWXA 4IKAA 2CH5A 3JTPA 2GVZA 2K8GA 4CHOA 1R3NA 4B3MF 4CIOA 2WVEA 4ETZA 2ZD1B 4FJNA 1MMNA 3TZZA 5K14B 2E7VA 3V6KA 3VR1A 4QOZB 4ZVRB 4IYQA 4ENOA 1GOBA 4CEZA 2GJ2A 4ED8A 2W9CB 3HM9A 2Q66A 3VQPA 3JTOA 4BC4A 1QQMA 3IKMA 1IJEB 2F3JA 1RXOB 5H9EJ 1SQKA 1YJ7A 3WEEA 1RTIA 4J90A 3BSOA 4WFNL 2HNZB 4DV0F 3U3GA 4A61A 4YNQA 2AX1A 5J2PB 2BE2A 4TVAB 4OKEA 1FXRA 3RR7A 3SLCA 2RUGA 3S3OA 3CD0A 4FO0A 3CUNA 1UVKA 4KH0B 3QINA 5J2MA 5G0RA 3M3ZA 2RIJA 2KZMA 3FZ2A 4B3OA 1HIYA 1F6TA 2W01A 1D09B 4URSA 4N56A 1SZ2A 4LF5K 1RP5A 4ZP8A 1JCFA 3MMVA 3OJUA 3BSNA 5FDLA 1WI6A 1L3KA 4CEFA 4B3SK 3VF2A 3D0IE 3KVGA 4GV9A 1FKPA 1BY9A 4I6MA 1K8KA 1EQ0A 3IFRA 3OVAA 5KG4A 2UXDF 2PEHA 1P9YA 1VQOS 1ATNA 2IFXA 2Y9HA 4CF9A 4ELTA 1XEZA 1WI8A 4QPXA 4FJ8A 2A41A 1DT9A 5BPNA 3MOZA 3OYBA 4DR3J 2W4CA 3UN2A 1NHUA 3LQVA 3VTIA 1UEUA 5ITHA 4L3QA 4ZLJA 2UU9F 3AA3A 1PC4A 1RWVB 2KRRA 5DQHA 1ZH5A 1QZ6A 3MCNA 5KOXA 3MPUB 3US5A 2XZTB 4DU4A 3K2YA 2DISA 5BREA 1NAQA 5KFDA 3C95A 5FRMA 3G6ES 3L4IA 3H0PA 4BE0A 5EGYA 4N7TA 3F5TA 4GVEA 5HATA 5SUHA 4FWNA 5GAGI 1MWMA 1YJNN 3HHLD 2ZVIA 2HHHF 5A8RB 5CAAA 2DGQA 1T3NA 1DTTA 5AQLA 4FWQA 5HQLA 3FEYB 2P9SB 2HVIA 1RCHA 3HHNB 2GAGC 3PKYA 2D74B 2HBMA 5D4LA 1NOYA 1S1VB 2I7PA 3QRRA 3T19A 2WBNA 2MLYA 2XB2D 2VICA 3DLKA 1XMOJ 1FRMA 4EZ9A 4LFAK 3BZKA 1XERA 4ZVFA 1I51B 2OEKA 1B99A 1IKYA 4OGCA 3SZ2A 3O6QA 4M5DA 1HBOA 2VOOA 2KFYA 4GRSA 3F73A 4CLSA 4C4WA 1GAOA 5L46A 4J2AA 3DOKB 2EFOA 1UZDA 3O4NA 4JI0K 1IM6A 1FD2A 2XCAA 1ZM3A 1WC6A 1RTIB 2ZH9A 2DKOB 1KP6A 1SJRA 3VGKA 3CO9A 2R7TA 2IDLA 4WBFA 1FRLA 4F4KA 1KCFA 1PSDA 4L3KA 2L08A 3H4BA 3D7SB 4JI3J 3ENAA 1HQEB 1WUAA 3TX0A 1UVNA 4BR5A 3A4TA 2PY5A 2XO7A 1XNQF 2C3PA 3CQ8A 1GLFO 4OHWA 3Q24A 4KH4A 4I67A 2KM8B 4F4AA 4MK7A 2QXLA 3RGIA 1ZAWA 3W65A 1K0VA 2R7UA 2N7CA 1LW0B 1B7YB 2P9IA 1TZ0A 1EZZB 1FX2A 2LSNA 2G0JA 3MR3A 2XLKA 3HO1A 4CYUB 2R2RA 1YJRA 2V9KA 3TABA 2NYHA 2I8EA 3NF7A 2DNQA 2CPIA 4AHRA 2NZTA 2ASYA 1ZAVA 3M2UB 3D0GE 3O8WA 2LU1A 4OJHA 3C15B 4B3SJ 2LKZA 3VQ9A 3I5CA 1NU0A 2MZRA 1RT7A 3KLEA 1NHKL 1HBUA 1VQYA 1IVZA 2G2YA 3TZXA 1EAYC 2PFDA 4DV4J 4DQRA 3ALYA 1HNZK 1YJ9S 4A2BA 1G7CB 3FFIB 2ZH6A 2FY8A 4CEQA 8AT1B 1ZAXA 3HRGA 2FXUA 2XMWA 4FK4A 4EMDA 3CCUS 4CBXA 3FCVA 1DQ8A 2CZ4A 1BDGA 1EP4A 1GXUA 4WTOB 3NG8A 2J9DE 1D0EA 1N5TA 3B8HA 4DTOA 3IDHA 3KLHB 3DGPB 1XWLA 3ENHA 4IQXA 1VRUB 4Y1DA 3NRBA 2DY1A 5F41A 4EGLA 2VU5A 4KAIA 2HS0A 3OYKA 4NI2B 3OV7A 3JS9A 1REGX 1RDCA 5IS2A 4W98A 1JXBA 1WC4A 2V69A 1LK5A 4WP9A 3H59A 1VRTB 1J5EF 4NA1A 2KJVA 1Q7YO 2IM3A 4ZPTR 3T3FA 2B5JB 5F8IA 2PMWA 3TQ1A 1HWUA 1BUPA 4K42A 5F8GA 3VQAA 2G9OA 5AE1A 2EEYA 4H5TA 4TU8A 4F4XA 1YJWS 4WFYA 2CDRB 3K7RA 2RNEA 4CJUA 4CHYA 2DR6A 2ZZTA 3HOTA 1URNA 5AJ3F 3DOKA 3ATVA 2EC2A 2JFDA 1UKUA 3Q83A 1KD1O 5KRSA 1HW8A 4DWIA 1G15A 2Z30B 3J7YU 3ENWA 4OO1J 2CQHA 4JKDA 2HBZB 2CQGA 1X4FA 4NCAA 1FX4A 2OD6A 3CCWA 2E6MA 2X1FA 1QQNA 3NOGA 2NS1B 4RW9A 3JQMA 4RLEA 2PT0A 1SKWA 5C0YA 1K6YA 4P52A 1APSA 1OH6A 3B8AX 2AJFE 2L9WA 1TKXA 3KK1A 1X4BA 2P9PA 2ZC4A 2YV0X 3ZT4A 4J37A 4DFMA 1DAXA 3KHRA 3LDOA 1N88A 4X64K 2HNZA 3F9MA 2YNGB 3NBPA 3C7NA 2UUCJ 1VR6A 5KT7A 2V51B 4ED0A 2QWLA 1K9MT 2HQFA 3MR7A 1OY9A 1ROFA 2M88A 4ID8A 2UXDK 1OIAA 2H54B 4DV1K 2UUBJ 3T1YF 2L41A 2HB5A 2VQEJ 4FZZA 3EDRB 2W2NP 4B9NA 3TYTA 5LT5A 4HI1A 3JAMU 1F9HA 1V5VA 3SBMA 4CJVA 3H4DA 4X4UA 3GFZA 3FQKA 3NDKA 2AGOA 4ZHRB 3CGIA 2X1GA 2MKKA 2KYZA 3A8JA 2G8IA 4NYZA 2JZ5A 2XEXA 1UJ6A 4JS4A 4CQ1A 1VSFA 4X4OA 4C0OC 3LTOA 2D3UA 2AJ2A 2UUTA 4ZVGA 4OX9K 3RB0A 2ZOFA 1HR0K 1HNXK 1HPZA 5AXLA 3V4MA 3TVZA 3VESA 1P27B 4CZLA 5D0HA 1R31A 4XTTA 1RAFB 4ILLA 2O4IA 5D78A 4HH0A 1WDDA 3ZZOA 2GFFA 4B9UA 1G1XA 1N33K 4DTSA 4QU6A 2E20A 4XDCA 3HZGA 1CS4A 1JCEA 4IO9L 4B1VA 4JV5K 2BJ1A 2RE1A 3VF0B 4YDUA 2A1BA 3SK3A 3BO4A 1SC4B 4QS9A 5DG9A 1T9YA 5LM7E 4JB8B 1NGGA 3A13A 5F8NA 3AO3A 2IIRA 2A1RA 3PIOQ 1MDUB 5KFNA 4QWAA 4LRAA 4OL8A 1REVA 2PFFB 3SI8A 1VQNN 4QS8A 4EP5A 1IBKK 1VQNS 5CZ2A 4B3RK 4O0JA 3MMAA 4URQU 2YHYA 3P39A 4ED4A 3PO5A 3IAM9 4DLEA 3KWIA 3ITHA 1U4BA 2DFHA 1TTHB 1FD8A 4DV0J 4IR9A 5HAOA 3E9PA 3VAMA 2ZH8A 1N0VC 4FNIA 2FD2A 5AQIA 1Y5IB 5EX0A 1RAGB 3JQKA 3J7ZO 1X8DA 1VQ9N 2CZ9A 4FNHA 2P51A 3SQGB 1EETB 3LDPA 2ZZMA 4DR3K 2FHMA 5GMEA 4ECRA 3LAKA 2HG4A 2YBVA 4DR6J 2UXBJ 1PC5A 1HPZB 2DH9A 1LKZA 4KFBB 3QNWB 5LOQA 4AL5A 3CCLN 4Q5VA 1QUVA 4PABA 3VQCA 9RUBA 2H9ZA 2DXDA 2ZJRL 3QATA 3AOBA 2NYIA 1HWJA 3TPQA 4JI5K 1QAXA 5AFUH 4K4WA 3SI6A 3IAYA 3PHEA 3IG1B 3FCHA 4OHVA 2CPFA 2DH7A 3NCPA 5JVGQ 3Q86A 1M5HA 3SJJA 1ZA2B 4DU3A 1VC0A 2OTJN 2ZH4A 5A8WB 1ATRA 4QWBA 1NSPA 3CCJN 1KAYA 2Q36A 4CH7A 4QIWD 5HRRA 2HHVA 5D0EA 4JI6F 1FDBA 3AB4B 3TA0A 4X62K 4YHHJ 2VQFF 2VBZA 4OJRA 2P5GA 4K8XA 4JRQA 2HYIB 1VQ8S 2ETJA 1F2HA 2E2NA 1YBAA 3WQTA 1S6UA 4OZ5A 4RUHA 5KG1A 4HTUA 2LXUA 1KONA 4P71A 2DNOA 1NM2A 4DR4K 2GVZB 2OYQA 4NLWA 3T5KA 5FPNA 2JOQA 3MAAB 4FZVA 2DNLA 2HOEA 5C12A 2D9PA 5JLHA 1V3RA 1SJ4P 3C6TA 3VQ4A 1FWKA 3CCVN 1HD0A 3W9HA 4F4ZA 3GJTB 1N6QB 4ED5A 4OI2A 2N3LA 3B78A 2V67A 3CMAN 4JI8F 5KFOA 3WXLA 2V7ZA 1LOTB 3HM8A 4CF2A 2NXUA 2OSQA 2EFQA 4H8KA 4TN2A 3MMAB 4WKYA 2GO8A 3J7AP 4N8NA 3KKSA 3FSIA 1TK0A 4BE1A 5KFFA 2A10A 2KTQA 5AQNA 2VA2A 5J2QA 4B9LA 2MJNA 3MUMP 1NZAA 3ICLA 2QI2A 3O1WA 1RE1B 2WSCC 1BQXA 1XQSC 5F8JA 2VFSA 4TKTA 4IOAQ 5LSLA 1WF1A 2XYHB 1SH3A 1RTHB 3OS0A 4BHQA 3AARA 3OFGA 1EIYB 2FUG9 5DJBA 1NZ8A 5CYMA 3G6EN 3MTKA 4IEEA 4XO0A 5H9FK 1RWOB 4DFJA 4ZJQA 4RW8A 1J2VA 2CYYA 4ZN1A 2W2OP 2YHWA 4AILC 4M95A 1GEHA 1U48A 3U4LA 4YHHK 2RQMA 5H9EK 4IH6A 4IRDA 2ZJQL 3ULEA 1M1KO 4W5NA 3I0RB 5EUHA 3MURP 4U95A 4DR6K 3MCOA 3N79A 1IV0A 3QEPA 2LEAA 2HBJA 4I7FA 5KPTA 2B3TB 4C11A 1CSJA 1GOAA 5L1JA 2XNRA 1IKWA 2CRLA 5F1XA 2E1CA 3NGUA 2WTFA 3ZETB 4F4WA 1O51A 3BGOP 2FPHX 4DFPA 5SWMA 3VQ7A 4GC6A 1GLJO 2DRDA 3ZZ0A 2OAUA 4J8FA 4JI5J 2M52A 1KVKA 1HWLA 3VEZA 3ZZPA 1ZS6A 2K1RB 4I0WA 4YB7A 1RDUA 2V52B 2R7OA 1YT3A 3U02A 3H3OB 2FZGB 1MMDA 5D4PA 5KFEA 4JI8J 4CW7B 1JJCB 3PJ9A 2MKIA 1JLBA 4DV2F 4M7YA 4DUYK 4YQWA 3IMXA 4WQ4C 5A8RA 3HMJG 4OPAA 3MHYA 4AHSA 3ILIA 3LP1A 2WZ1A 2YWEA 2P9LB 1NO8A 2RKIA 3EXYA 3JSMB 2K3IA 4PAAA 1Z6RA 5BN9A 3MF5A 5SZTA 4CZEA 3GZ7A 3UQSA 1LW2B 1D9DA 1NPKA 2VWJA 1RWWB 2BX6A 4LRFA 2R7RA 2CNLB 1U7LA 4JV5J 2DNKA 1IKYB 5ADZA 4LSNB 1JXLA 1QQOA 5EWGA 4JBCA 3H08A 1UWAA 2AJ1A 3A12A 5TKWA 2GHVC 1PAEX 2IJFA 3UNYA 2FY1A 5AXMA 3OL8A 4H5NA 3AVKA 1UJ5A 5HMZA 2BQRA 2V2VA 3OW2R 3DRPA 3RB3A 2B51A 2B0GA 3W2VB 3J80U 5M2PA 3SSRA 3I33A 3L7OA 3TQEA 4X4VA 3HVAA 3N9UC 1S6OA 1NOZA 2XSJA 1TL3B 4A4JA 4CF1A 4FVUA 1Q1KA 1R6VA 3MEKA 1YRXA 4WFAL 2PN6A 3HI9A 2ATQA 4IO1A 2BOPA 4E7KA 1F9FA 2A3ZA 1HWKA 1C0FA 1YLXA 1SV5A 4EK2A 4JKFA 2QWNA 5C24A 4LVOP 3VGMA 3E01B 2JC1A 4WIQA 3EMTA 4NLVA 1TELA 2C2OB 1XMOK 2IVFB 1Y64A 1C0TB 1H2VZ 2MHNA 2F4VJ 1X9WA 4X2BA 4I2QB 2HHWA 1AUSL 4PWDA 3GIKA 3BSAA 1U8WA 4PEOA 2F7TA 4PQAA 4W4MA 1FTCA 4C8KA 2VG5B 3TAFA 2MHEA 3FSYA 1WSFA 2WK4A 3O9SA 1FT8A 2F40A 3GJRB 2Q2RA 4MIAA 1FXLA 3HT3A 3VAGA 2HLTA 3J8AA 3VOVA 4QCLA 1Q7YT 3T6JA 3H1QA 5I9EB 4FYVB 1HYZA 4E19A 3KJQB 3CXCM 4ID5B 2DHSA 3DHXA 3V2UC 1H3DA 2BMBA 2ZJQQ 3MMJA 4O23A 2BVZA 4ITSA 2E1PA 1RBUA 2CNOB 4PG4A 3UD4P 4KKOA 1H74A 4YOEA 3ENOA 1FJCA 1Q81O 3K2PA 3H5YA 5E0OA 3VERA 4NLYA 3CERA 2H5EA 3R1HA 3HULA 2VCPA 3TTDA 3NKYA 1HNWF 2PFUA 5L8RC 4C48A 2GX8A 1EB0A 3NAIA 5DM6Q 4C9DA 1KQSR 2LQ9A 2ZM6F 4NXNF 4PUOA 3TUIC 1WG1A 2AGPA 2AJ4A 2Q97A 4DV3K 1T95A 3G25A 3O4QA 2FVRA 3IM9A 3OD2A 4A8XA 1RDWX 2JHEA 2V5HG 3G82A 4WQ4A 3VPZA 5ADXA 2O8EA 1KVAA 3DYAB 3G4SN 5IWAF 3PG9A 1JLEA 3E01A 4TY8A 5DDOC 1PGZA 1U1QA 2IYGA 1H38A 1AZSA 2FB0A 3BDEA 3J7AN 4I6WA 4WYWA 3HSTB 1X1PA 3CJBA 2W41A 4M3YA 1Y0HA 2M5YA 2J9DA 3HSDA 2B7BB 4J91A 3R7NB 1JJ4A 5GAGP 4GKKK 2LQ5A 3D68A 2HBQB 2QRRA 1OH7A 4X66K 3HHLC 1U6BA 3U9DA 3H25A 2QE5A 1I5OB 3LH2S 5AQUA 1X4HA 5LMUK 4A57A 2LP4A 3DN9A 1FI4A 3HP9A 4NXMF 1X5SA 2AEJA 1EJ7L 1VQ6N 4OYZA 2IBOA 2WSFC 1RHMB 1YITS 1HKAA 2BZ2A 4AM7A 1T6DA 4G1QA 4IR1A 3OJSA 2Q1NA 5FLXY 2E2OA 4DR1F 3GFHA 4X64J 1X4GA 3FRYA 3QFHA 3D2EA 4CERA 3M6XA 3BYRA 4DPYA 2J6SA 1BISA 2UXCF 3M8WA 3J7ZT 1U1MA 3AD9C 2KH9A 1UVMA 1NBEB 2UXDJ 2CJQA 3UR3C 2UYTA 3VZHA 4CE9A 3MCSA 4FXDA 3TW0A 1WB9A 2Q79A 3QJJA 4PUOB 2D41A 2B6AB 3IAS9 4ECXA 1ESVA 2A3JA 3AY9A 5AQSA 3IFEA 4LUBA 2DRBA 1Y5LB 4CZKA 4NLBA 4H5WA 4N47A 2L9NA 3HFKA 4KRFA 5A2QY 4OKKA 5B08A 3M30B 3ET6B 4HACB 5EY4A 3MTJA 2EBEA 1HD1A 4Q44A 3DM2B 3HFZB 4XDDA 1Z26A 1BOTO 1CC7A 1VSIA 2YQ0A 3AJDA 3SNNA 1U1RA 4CJSA 2ZH2A 3FE1A 1RA6A 4RU9A 2D5RA 4MQ3A 3R2CJ 3R1XA 1RSCA 3NGIA 3FFKB 1RT2A 3D6RA 3ULEB 2GNKA 4J2DA 2GQ2A 1S1UA 1UETA 2FJEB 4H4MB 4ZLPA 3GIIA 3OYLA 5DZ7A 4ILGB 4WJBA 3RBXA 2KYXA 2V8GA 4ZCIA 4LJMA 1MU2A 3BGLA 3CWJA 1HHSA 3GR1A 1BQMB 4RNHA 4WPAA 2AD9A 3AT1B 1HJRA 3AO1A 2RRBA 3UKUB 2DTUA 2RHSB 2JGUA 2V63A 2YPZA 2E9ZA 4E3SA 3DYAA 2ZWPA 1Q78A 3NGSA 4O5FA 3OTDA 4MLEA 1BHLA 3I0SB 1FKOA 2CGKA 3EEQA 1REVB 3SSSA 2OZSA 4LR8A 3L3UA 1ZXOA 3P96A 3HZ6A 2E2PA 4LSLA 3EXCX 5KFZA 3IUCA 4TY9A 3LP1B 1KFSA 1W2BM 2A0FB 1QD1A 2FSJA 3BR8A 2ZBIA 2GS8A 3DMJA 4E89A 2Q0RA 4IFYB 2WONA 4F67A 5BYSA 2R3VA 3A5MC 2AT1B 4USVA 1C1BA 1BU6O 2MLZA 2GGPB 5E84A 4M5HA 4IO8A 5B0DA 3ET6A 2O66A 2VJUA 1H2TZ 3N28A 2HMIA 1QUPA 3IGNA 2W9CA 5BYRA 3OUYB 3G8SA 1FXDA 4PL7A 1HNWJ 1H2UX 1EP4B 4AUKA 4G1PA 1LAWA 3PFOA 3KHHA 5LMUJ 5AZIA 3OTOK 2R7XA 2HVDA 4ANCA 2DRAA 3K59A 3K58A 2ASJA 1FW6A 2F9DA 2G13A 5IT0A 1I94K 3CC7S 4IH5A 1CXQA 2DXEA 2Q3PA 3NH1A 3QAEA 5G0RB 3S8SA 4ECZA 1FXXA 1GLEG 2GIFA 2GHWA 3KTQA 1XIQA 3ZXWA 5MLCQ 2KRBA 4M5KA 4Q43A 1QSYA 2DNHA 2E66A 4BVOA 3I87A 1JCGA 3ZFVA 3GIMA 3BM7A 2AEFA 3NCQA 4YB5A 3RB6A 2WVDA 4BRLA 1QQCA 1OPZA 1LWCA 2VFVA 3MXIA 1YRUA 4IFVA 4A46A 5AXKA 3V4IA 3CMAS 1R59O 4EU0A 4USKA 3VEYA 2V8DA 2VL1A 1GTHA 4MK9A 2C2KB 3ENVA 4IRCA 2B9EA 4BR7A 5KG7A 3MAAA 5LY3A 4P73A 2OTJS 3OTOJ 4C8LA 3CE8A 4AYBD 4NXNK 5EX5A 1Z2LA 5D15A 3CJTA 2SXLA 1FJGJ 2YNHB 3UCZP 2D7SA 3MM6A 4EYIB 4Y28C 4DX6A 5DQIA 1ACMB 2KJWA 4LSZB 1RWUA 3P3DA 1CJUB 4MO5A 2NRHA 4AXIA 4ED7A 2E1ZA 4IFEA 5DS7A 2FJWA 2Q31A 4JI6J 1RUSA 2DK2A 3F0NA 2HHUA 2KVQE 1ZM4A 2DYAA 1QE1B 3HHEA 3DU6A 1SVDA 4PXDA 4M5NA 3OBIA 1N56A 2UUAJ 1Q9XA 1OY6A 2QIFA 3D4JA 1OY8A 3ZT1A 3C6AA 4KH1B 3QLHA 2D1KA 1QVFR 2Y1RI 4RW7B 5D3GB 4H4OA 1CC8A 5J2QB 4AQYK 2WONB 2O8EB 2EG2A 2VKRA 3MOJB 4JV0A 1UVLA 3MM5B 4DU7A 1U45A 1SL2A 1LXJA 3HF5A 2QJ3A 2AIRB 1NH8A 3I55N 4Z0UA 2FJBB 3CJ1A 5KTQA 1V9OA 2NLWA 1VHIA 2XCPA 1YZ7A 4EBEA 2QW9A 3JQJA 2JEIA 3KLGA 3I6PA 3ILJA 4A2AA 1UCNA 1XHZA 3DWLA 4DR6F 5KFYA 2IVPA 3UR0A 4KPCA 3U6FA 5B0AA 2L3MA 3A3NB 4YDXA 4Q0BA 3MWPA 3CFOA 1QHAA 2A1SA 3PUFA 1VCTA 3CCMN 3QJPA 1M5OC 4CI0B 1CJUA 5LMNF 3Q23A 3QFUA 1WKKA 2BYCA 2NR0A 3L7UA 4PR6A 3CULA 1NG9A 2VOPA 3SAFA 3RBEA 2WBMA 3NMAA 1KLNA 3O08A 1H0HB 4AQYJ 1IBLF 2CUYA 4FPBA 2AX0A 3M2UA 3OYEA 4LH4A 4CJ4A 3JSMA 5HANA 3QLHB 9ATCB 2W9BB 2RS2A 5E3RA 4C8YA 1NNEA 3Q8YA 2VG7A 3CB4A 5H1SQ 5AT1B 2PAVA 3H5SA 3R6LB 1RDDA 2YJFA 4DCHA 5K14A 3S7RA 1OO0B 5KFKA 3SCIE 2YHAA 1Y5NB 2CQ2A 1Q18A 1E4GT 4TYAA 3FK4A 2OSRA 5KFIA 5CXTA 2GAHC 2V2ZA 1VHXA 3MR6A 3KG4A 3CCVS 2W9AA 5KFQA 1HHQA 3M1VB 2LEPA 3AAPA 5DMRA 2HBLA 4A8WA 3CCZA 4JOUA 3UVJA 4LF8F 2JVOA 4WTYA 3DOLB 4ZMMA 5KG3A 1KC8T 4KY3A 4YR2A 4GV3A 3GU0A 5IM0B 4HH1A 2ZH5A 1XNQK 1U2RA 4CGHA 1YJUA 4I6AA 3CJKA 4RUBA 4HWIA 1RBVA 4CCHA 2HHTA 4N8OA 3HSJA 5HSPA 4DR5F 2M8DB 1X4EA 1X4AA 2P9UB 4CNZA 3G4SS 4FJ7A 2B5JA 2CIMA 3P83D 1WBDA 4BLGA 2KM8C 3MX5A 4FS1A 3LM9A 2H3EB 4DUZJ 2GTDA 1SC1B 3FEZA 5MLCV 2BH1A 2E7WA 3BV8A 5E26A 2P9SA 4DG1A 4DR7F 5LJVA 4RBUA 4DUTA 2LDIA 1E6VA 3J7A1 4RBVA 2GWJA 2C1EB 3R7SB 3P31A 1FVSA 4QWEA 4ER8A 5EWEA 5KG5A 3R1LA 2ABYA 2DIUA 2GGPA 3TWZA 3BREA 1NMNA 4ETXA 5KT6A 5BXIA 3I4HX 2VPWB 3UE2A 3DRSA 2DHXA 3KLIB 3BKFA 2KI2A 3D6HB 4IDKA 5HROA 4A8SA 3DOMB 1RAJA 2VODA 4E0DA 4ALZA 2JWNA 1Q86T 2BUPA 2QLXA 2XHCA 4JI4F 3OYMA 2E9RX 2V68A 4K8RA 1EX4A 3IBWA 3R5GA 1NGFA 4M3XA 4E2FB 2R9LA 2CGJA 2ACMA 2Z58B 3GV5B 4BDZA 4WFAQ 5HJXA 2BJDA 1KAZA 1RLCL 2FJDB 2MZQA 1EO1A 1G6BA 3KMSA 4DPUA 4IBNA 3ETMA 2ZOGA 4BCAA 3E8OA 3MECA 2MZTA 4KGMA 4YOYA 4HHHA 5IWAK 5IC4B 4LF9F 2HVHA 3HBTA 3L3CA 3JYTB 1UWBA 5CA5A 4F8RA 2OFGX 2FHOB 3SQOP 2LMIA 3UN5A 1NGJA 1GTEA 3Q8RB 3HP6A 5AXNA 2WC9A 4BRNA 2EXUA 4AHTA 4CDIA 3NWRA 2FF6A 3G6XA 2XY7A 3GJQB 1GQEA 3JSRA 4ELVA 3T1YJ 3OPKA 3PX0A 1UVJA 4OHZA 4IOBA 4EFAC 5I42A 4BR0A 3OFFA 1MROA 1WG5A 1NDPA 1U24A 2QGFB 4N41A 2J0SD 3LALA 2VQEK 2BW7A 3TU5A 4OI1A 2FJAB 1VIXA 3EX7B 3ZETA 4OZ0A 3I96A 1K0TA 4G1QB 4BVPA 4DV6K 3A8IA 3OR1A 3W7BA 5HN0A 1KVJA 2X6SA 1Z25A 4JI4J 4EBCA 2XMJA 2M0GB 2FJXA 1QDUB 4CJLA 4BR9A 4DX5A 1DLOA 2VG6A 3PYDA 1XR7A 1S0OA 4E7LA 3WXJA 4HT7A 1FE4A 2OHDA 4BREA 3BZCA 1I6JA 3FCWA 4OV6A 2QMXA 2G2ZA 4KRWA 4B1ZA 3TVYA 4JKHA 3ITHB 4DS4A 4ES1A 3K5OA 2QLBB 5T41A 1WG4A 3D5MA 1RWPB 3ZX2A 4B3MK 3ZT3A 3NNHA 3VQEA 1NK8A 2OPSA 3KDNA 3UDLA 4RWXA 4GV6A 3ZO7A 4GY2B 4CJ3A 2HAFA 3HLUA 2VYPA 4DZDA 2HK3A 3N01A 1T05B 4AT1B 4QIFA 4B9MA 1PBUA 3AD8C 4WK3A 1AUDA 2DPIA 3TUZC 2ZF5O 5F9LA 3MMBB 4B3SF 5AQTA 3EZOA 4J9PA 3T1HJ 1CJVB 4QR1A 4LF4J 5FPDA 4OPHA 1S5JA 4RL1A 1UAWA 2OIHA 5GMKa 2XLIA 3O8MA 4CIEA 3AO2A 4EEYA 4JKCA 5K8OA 1F9EB 3CCQN 1CZBA 3FSXA 1BQMA 2AF6A 1A6LA 1WD6A 3CDWA 4IKFA 1M5KC 3NH2A 4RX6A 2CFXA 2OH2A 5HRNA 5J2NA 4YDDB 3DRPB 3LF0A 2F9JA 5LSOA 3S3NA 1FEEA 4O3OA 3VHQA 3CDEA 1CPZA 2AW0A 4ILHA 3MEEA 3H42A 3JXOA 4Y2AA 3C14B 2BANA 3MN6A 3OTOF 1ZTTA 4QW8A 2Y3YA 1LFPA 4FXWA 3AAWB 4KAZA 4CLFA 4FWMA 4CLPA 2YY3A 2NRVA 1NJWA 4AFFA 2OPRA 2HGNA 1S7IA 3TOQA 2KVIA 3OYCA 5A2QU 2P9GA 3CF5L 4NLSA 3CC7N 4MIWA 4JI7K 2R4FA 4CZMA 2PE8A 1I94F 4JI2K 1RT1A 2VA3A 4FJIA 3PV8A 3CTRA 1DQAA 1HI1A 5BPLA 1C1BB 4DEZA 1MA9B 5L39A 2J0WA 1BQNA 2DHAA 5ETOA 4QJVA 4NA2A 2QG9B 1BD6A 2QN6B 5KFHA 2Q6BA 1OKJA 2MKHA 3OFHA 5DK5A 3VEOA 4P75A 1FERA 4K0KK 1AT1B 4K50A 3MMCA 3QFPA 3DLGA 5I4MA 4DQPA 2HFZA 2JFKA 3HKZD 2VFTA 1B9FA 2RJZA 1O13A 1SC3B 2B4VA 1S0NA 3WX4A 2YNIA 2HS4A 2IRYA 2CH6A 5K20B 4MH8A 2JNJA 1X60A 3OQ2A 2XHBA 3SIPB 1L5UA 2FF3B 1K8AT 1PYTA 4OYPA 4DSFA 3IC1A 3LL3A 3EE3A 2F4VK 3HVTB 1KN6A 2EVZA 4RJVA 4WYBA 3HOSA 4RNNA 2QYGA 4I56A 2CG4A 1TUUA 1YDLA 2OGUA 3D0HE 4PG8A 1WEZA 4ZJOA 2QKKA 4O8KA 1YWXA 1JLEB 2BJ9A 5JLFA 3MAQA 4A5AA 3H45C 3ZSVA 3MMBA 3BF4A 1KS2A 3N6NA 1M90T 4NEZA 4HT5A 2RB7A 3VF6A 4M5JA 5LJ5Y 2A6OA 4K5RA 5B7WA 4CTAB 4LFCF 2OZMA 3LDNA 3VQSA 3SQ1A 2GX9A 2W7PA 3HJVA 1OPIA 1XQIA 2ZBQA 4KHNA 3IR6B 3BUZB 4U8YA 2C3UA 2VZ9A 1RTJA 3WEEB 4P2XA 4B9QA 5KFBA 1TUWA 3DGVA 4KIAA 3BN7A 3FVYA 3AB2B 2JEGA 1TUYA 4PKHA 1KLMA 1S99A 4J9SA 3BZQA 1BA0A 4MDAA 5ETSA 5IT9O 4X4TA 4GO5X 4CJFA 1S76D 3QEVA 1GNKA 1VQ4N 3H90A 3LO3A 3TUPA 4G65A 1HBMA 2J8AA 2V4JA 1YJTA 1YITN