3PIPL

Crystal structure of the synergistic antibiotic pair lankamycin and lankacidin in complex with the large ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords RIBOSOMAL 23S RNA
publication title Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
pubmed doi rcsb
total genus 13
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3pipL01
1K9MO 1VQON 1VQ8N 4WFNL 5GAEP 1Q7YO 3PIOL 3CMEN 1VQ6N 3CPWM 3CCLN 3CMAN 3CCMN 3CCUN 1Q81O 4WFBL 1M1KO 3CCJN 1VQMN 4IOAL 1K73O 4U67L 3CC7N 5JVHL 1VQ9N 2QA4N 1K8AO 1KD1O 3DLLL 2QEXN 1VQPN 1ILYA 3CCQN 3CCRN 5JVGL 5GAGP 3PIPL 1W2BM 2OTLN 3J7ZO 1Q82O 1OVYA 4WFAL 3CD6N 3CC4N 1QVFM 1VQ5N 2ZJPL 1JJ2M 2ZJQL 1YJNN 1QVGM 1YITN 1KQSM 1VQKN 4WCEL 5HL7L 1KC8O 1VQ4N 1YJWN 3CF5L 5DM7L 1VQLN 1VQ7N 3I55N 4IO9L 3CCEN 1M90O 3G71N 1YI2N 1YIJN 5GADP 5H1SQ 3CXCM 2ZJRL 1N8RO 1YHQN 3CC2N 4UY8O 2OTJN 1VQNN 5MLCQ 4IOCL 5DM6L 3OW2M 5GAHP 3G6EN 1YJ9N 1Q86O 1NJIO 3I56N 4WF9L 1S72N 3CCSN 3G4SN 3CCVN
chains in the Genus database with same CATH superfamily
4H4MA 4H5NA 3NMUA 3K5LA 4W5TA 3UIQA 4XIUA 3OYBA 4B1YB 2FBTA 1LAVA 4E7LA 1NK6A 4N41A 4DR2K 1U4BA 1IH7A 4FLVA 5M1FA 4A62A 5JS2A 5FPEA 3E1YA 4BRAA 5FDLA 4LF9K 4PKHA 3E01A 5KTQA 2FSKA 1C0FA 3AVFA 2VG5A 4FPAA 3O1BA 3CIPA 2QK9A 1BISA 1K73O 4A61A 1BUPA 3NF8A 3T1YK 4ELVA 1QTMA 1ILYA 3ZX0A 4BRNA 2PY5A 2FF6A 4BE1A 3DMJA 5AQPA 3KD5E 1TVRA 1T6CA 4RW4A 4BRKA 4BC2A 3BZKA 4ICLA 4JN4A 5FROA 2W41A 3R6MA 3KK2A 2Q0RA 1NK0A 1CXUA 4Y1CA 3CM5A 5HL7L 2IVPA 3WXLA 1U6ZA 3HL8A 3O4NA 3QETA 1TKTA 4RWTA 5HLFA 3L0QA 4JK9A 2W6LA 1WSFA 3O4QA 5AQTA 2HHUA 2GUPA 4CJVA 1VSIA 1IBLK 4YOYA 3E9PA 3KHYA 3U3YA 4I6MA 2G8IA 1JKHA 4Q5VA 2DFHA 4IJNA 1RDBA 1Q86O 1NJIO 3VF6A 1I39A 3I8DA 1RT5A 3NH0A 3L8BA 1D8YA 2D0BA 3VEXA 2HHTA 3CYMA 5AZIB 3I0RA 4JEPA 4CK1A 5HRPA 3DYAA 4CERA 2NRHA 3AA3A 3VEZA 1O1WA 2PFUA 2YKMA 1NGGA 4B9SA 5AQNA 3SQ0A 1DT9A 3VTHA 4FCYA 2RN2A 5BN8A 4E0DA 1HNXK 2Q2RA 1NU0A 4CJ3A 4EFHA 3JSMA 3KLFA 1KVAA 2X6SA 5AQMA 4B3SK 3TAEA 1GOBA 4CJRA 1OH6A 2DPNA 2E8AA 1VQPN 4I9QA 3HO1A 2A6AA 3CCRN 1YXQA 1L3UA 5BR9A 2E88A 1SL0A 1U47A 1K8KB 2B4JA 3M8PA 4F2SA 3H1VX 1QHAA 2F96A 5C2DA 5K14A 3PY8A 4IXCA 2ZF5O 2VGNA 4OPHA 5CYQA 1KAYA 2QWPA 3K5OA 4BRMA 1N6QA 2DY4A 3U9ZA 4A59A 1BI4B 3L2QA 2BTFA 1BA0A 4KV8A 4Y1DA 3SUOA 2D1KA 4M7XA 3PX6A 1HKBA 2HF4A 3L4IA 3PX0A 5EVZA 5AQJA 2E4LA 1EX4A 2AP1A 3FFIA 1C1CA 3I55N 4HCCA 4KPYA 1VSHA 1OH5A 1U04A 2O8CA 4JKBA 3WNEA 3SPYA 5C10A 3QO9A 1RBSA 2QM1A 3KJVA 4B9TA 3ASMA 2R7YA 1HR0K 3ISNC 3J7YP 4EZ6A 3QNOA 5DM6L 5DMRA 4B3TK 3QBWA 1VAZA 3G6EN 3EN9A 3M1FA 3MN5A 3V81A 4FJ9A 1CZAN 4F9OA 1TK8A 5F0XA 4ISEA 3WXMB 1L5UA 1HRHA 1WSGA 3UE5A 3O3HA 3ZEUA 3O8MA 4DR6K 3QEIA 3CJ1A 3ENHA 2G8UA 3QDKA 2O8CB 3TARA 2J4RA 2QWRA 4FJGA 4KRFA 2KLAA 5E84A 3U4LA 1LWEA 4WYBA 2EX3A 3RRGA 4JI7K 2E1ZA 2HNDA 2P9PA 5J2NA 2HNZA 1QZ5A 3DWLA 2O4GA 2A42A 3LDNA 1WBDA 1U49A 4LFCK 4M3TA 4C1NI 2GX9A 4X62K 3J81O 2D0AA 1Q9YA 4KBOA 5LJWA 4OO1J 1EO1A 3ZEUB 3MK6A 3DXKA 2XO7A 2D0OA 1XMQK 3VQAA 3R3LA 1RDWX 3O9TA 3LPTA 5ADXH 3TAQA 3V9WA 1C0TA 4DV6K 4JI8K 1IO2A 3FR0A 2F7TA 4BE0A 3THVA 4A2AA 1G15A 1EKEA 4KTQA 4CK3A 2A1SA 2HF3A 4H8KA 3LDSA 2ASPA 4B1UB 1TUYA 4DHYA 4EIAA 2UUBK 3IRXA 1OVYA 4C8LA 3SAHA 3CM6A 3O08A 5A2QO 4B3MK 1HNVA 4E7IA 4TSXA 3RVCA 2BUPA 4DV5K 4KHWA 4LC9B 1LWCA 3AV9A 4ISGA 2P9SA 1Q9XA 5D3GA 5C12A 4CEZA 3ZSYA 4KI6A 5KPRA 2I7NA 1IBKK 2B6AA 4H03B 4WQ5C 4DR5K 3O4WA 5TKYA 2NNWA 2G8FA 4IJAA 3WNGA 3O9UA 5H1SQ 1FXXA 4DQPA 4HUFA 4BE2A 3KTQA 2QXFA 3VGMA 1IKXA 1BL3A 2VG6A 4AHCA 4FWNA 4IOCL 2P9SB 1N32K 4RW9A 3HP6A 2UU9K 2D0CA 4GVMA 4M3UA 4U7BA 3AVJA 3V9ZA 1HLUA 3A2FA 4LFAK 3VQ8A 2YV0X 3ULEB 3RTVA 4KAZA 4XH4A 3BUZB 4CHOA 1KLNA 4R79A 4CJFA 5M1KA 2O8DB 3WEEA 4L8RB 3VF2A 1SKWA 3D2EA 4ISFA 4FJIA 2KFZA 3ZX2A 2W40A 3QINA 3R8EA 1S6QA 2XY7A 3ZSQA 1TKXA 4CF2A 4E1NA 2P9KA 4OPJA 4QS7A 4BC3A 3CCJN 1VQMN 3ZT0A 5SZTA 5JLHA 3DXMA 3EKUA 3UB5A 4WE1A 3OS2A 3QIOA 2OYQA 2YHWA 3HVTA 1X9SA 2Q1NA 4DKWA 3D2EB 3KWIA 4I2QA 5BR8K 3RRHA 4FJ8A 4R5PA 3TU5A 4JS5A 1JCGA 4GY2B 3LZJA 2A3ZA 4O5BA 5GAGP 3Q7BA 5C42A 2QTDA 3ENBA 3KWGA 2P9KB 4M42A 1Q82O 1KVBA 1H1VA 3AVAA 5AQUA 1T44A 2KTQA 1U45A 3CETA 3O3FA 2HBMA 4BACA 1WAFA 4MO4A 3H6EA 3DXMB 3W3DA 2VWBA 2OPQA 3H1QA 3V1OA 1NJYA 5C15A 4CJKA 1BA1A 3S3NA 4AH9A 4CEQA 4IG3A 1A5XA 3PV8A 4QAGA 4CGHA 3AA2A 4O0JA 1NJXA 2ZGZA 4BGBA 3PUFA 4NB4A 1JLBA 2GBZA 3T1AA 1A5VA 3K59A 3D2FA 1RBUA 3HP9A 5BPMA 3L3UA 3VETA 2QWQA 4J2EA 3VQCA 2HHVA 1QQCA 4BY9C 1YT3A 2XY6A 1DTQA 3VQ6A 4C23A 3PX4A 4J2AA 5AQGA 3THYA 2WOMA 3HTVA 4CW7B 4FZYA 3O9RA 3AO5A 1OH7A 4JKHA 3LP2A 3NVKA 4NLCA 4B1WB 1BHLA 3TSUA 3BF3A 3PSIA 5J2PA 4KH5A 3OYIA 2RF2A 4B3RK 3PSFA 1Q8IA 1CZ9A 3CCLN 4FWQA 1RILA 1EWQA 2P9LA 2X74A 1HX1A 4E7KA 3THYB 1IKVA 3F9KA 4KFBA 3LP0A 4FWKA 1SV5A 4N5SA 3EZ5A 4ZTFA 4JK7A 4U67L 3CC7N 1QE1A 3SPZA 2AA4A 5J2MA 4H0XB 4O55A 1GLAG 1I3AA 2GWKA 5AQVA 3RSEB 3OYDA 4X64K 3KK7A 4DQ8A 1E3MA 3P4IA 2G8HA 3CQ8A 4RW6A 3KZBA 4CEDA 5AZJA 5BRHA 2P9LB 3I8BA 4IBNA 4FO0A 4KHQA 4IG0A 4E3SA 3A0IX 4BR4A 3OYKA 3ZETA 2HHWA 4BDZA 4KHPK 1RT1A 3VEVA 3BZCA 5EOYA 1RTHA 2IGIA 3P38A 4FOEA 1HQEA 4FL9A 1RNHA 1YF5L 3K9KA 3PO4A 4FXDA 5AZJB 1NOYA 2AJQA 4JD2B 3JAMO 5F1XA 1C0MA 4OKKA 5AQYA 3ZETB 2CGLA 5AFUA 3DLBA 1VSDA 2KZZA 5FPNA 2YHYA 3OA9A 4OJRA 3QFPA 4C8NA 1HNWK 3CQYA 2XRIA 4GW6A 1TKZA 3EL2A 1YJ9N 3WUHA 3LZIA 3NFAA 3LP1A 1NGBA 3KKSA 1E4GT 1VQON 3VQEA 4PWDA 2O8BA 4DSEA 1GLLO 2NRVA 3AVBA 1VSJA 3F5TA 4DTJA 4BREA 4DU4A 3MXIA 1RBRA 1VQ6N 4RCHA 5E26A 4YOVA 4HTUA 3C65A 3GE1A 4KHNA 1CXQA 3CCMN 3HM8A 1QS4A 4F2RA 3V6DA 3OYFA 3EYZA 2Z1HA 5AQRA 3T3FA 2YNGA 3ZCMA 4FVUA 2O8BB 4NXMK 2A41A 1C6VA 1IBMK 4CHPA 2HHHK 4M3ZA 4BR5A 1S1WA 3IS9A 1YVUA 2YX6A 4CEBA 5JVGL 2O8FB 4BG9A 2Q3SA 3NCIA 4FYDA 2NZTA 2EHGA 4FSVA 3ATVA 3T7ZA 1NK5A 4CK2A 1UA1A 3VQ5A 4LY7A 4BVOA 3HI0A 1JLQA 2Y1JA 3OBWA 4CZFA 1WN7A 5AQIA 4CGFA 1TL3A 1ZBHA 1EXQA 2QI2A 4JI0K 3AVLA 4CZKA 1T8EA 1KC8O 2UXDK 3SCXA 1SL1A 4M41A 5DM7L 3MCPA 2FSNA 2OZMA 3ZSOA 1NMNA 3B6OA 2Q36A 4DTXA 4CJTA 1XI1A 3CCEN 3D6RA 3MECA 4BRLA 1NGIA 1YI2N 3NBPA 1EWRA 1KCFA 3MXMA 4HUGA 3QMLA 4BRHA 3K5NA 3VQPA 5C25A 4B9VA 4CF8A 4CIEA 5HRNA 4CGIA 3ZSZA 1Q18A 4EZ9A 3SK3A 3H3OB 2YNIA 3KVGA 3IFRA 4FK4A 1KRPA 3UKRB 2V7YA 3OJUA 5AQLA 3LALA 2NRZA 4GVEA 5AZIA 1SQKA 3VOVA 4N56A 4Q0BA 3VQBA 1Q7YO 3EE8A 1NM1A 4KI4A 5M1PA 4DV0K 5AQKA 4JI5K 1FK9A 4CEFA 3CERA 2DTUA 1EQYA 1NK4A 4BRCA 4N47A 3GOIA 3CQXA 1GOCA 2YCHA 2QKKA 3A5MC 4BC4A 4WFBL 3A5LC 5CZ2A 4IOAL 1VSKA 4ZHRA 4NCBA 4DV7K 3VGKA 3ZX3A 1DEJA 4FLZA 3PO5A 1RDAA 1WSEA 1W9HA 3VERA 3SAGA 4GKJK 3ZT2A 1W7AA 1NGJA 1BQNA 5KRSA 1S1XA 1TAUA 1K8KA 1WLJA 3NGIA 2P9IB 1RBVA 3DOKA 2CH5A 1TYQB 4LSLA 1S3XA 3AY9A 4CZGA 1JJ2M 1YJNN 1BI4A 4M3YA 1P8ZA 1Y97A 2G8KA 4BVPA 3E9OA 5KPZA 4KO0A 4PKIA 4H0OA 4EHUA 4CZMA 4RG8A 4CJSA 1Y64A 3O3GA 2E6LA 4DSLA 2VWJA 1C1AA 1JCFA 4M7YA 4EHTA 3IKMA 2I5JA 1UA0A 4FJHA 2ZGYA 3QFUA 2ZJRL 4CECA 3CC2N 1T3VA 2OTJN 5JLFA 4FM2A 5F2RA 4ZTJA 4B08A 3TAGA 3O1WA 3F2KA 4OPKA 1VRUA 4HVJA 2IS3A 1NOZA 1ESVA 3MEEA 4DQIA 5KGXA 1ZBLA 3O80A 3OJSA 3SV4A 1TK0A 4IDHA 3CCSN 3KIOA 4PHTX 1OKJA 2VCPA 3AVGA 4J2DA 3KK3A 5T7BA 3VEYA 4CJ7A 4DCHA 4LSNA 5E41A 2QWLA 4E19A 1XHXA 3CMEN 1N5YA 2WUSA 3HPHA 3VEWA 4CEOA 1RT7A 4O5FA 4YHHK 3AVNA 3K58A 5HRRA 5LY3A 4F3OA 1IG8A 4C8MA 4DS4A 1GLCG 5LJVA 4B1XB 2QWNA 2JWLA 1TL1A 3R1XA 3KLGA 4Y0WA 2O8EA 2HHQA 2ITMA 4CVNE 2DFFA 2NRWA 3CCQN 3CJ7A 1N34K 1SL2A 3MDQA 4YOTA 3V1RA 3PIPL 2ZE2A 4CBWA 5GIPA 3OYAA 1JCEA 1F21A 4A2BA 2IOCA 1YVNA 1DTTA 2VYPA 4CF9A 2HHXA 3IDHA 1RTJA 3QERA 1VQ5N 4Z4IA 5IT9O 5KRTA 4DR3K 4DFJA 1RT4A 4K43A 3M6GA 3DOLA 1VQ4N 4K42A 1T7PA 3ZSXA 2O8EB 4J2BA 2KHOA 1DKGD 5M1OA 4CZHA 3CI5A 1NWKA 3O9QA 3VTIA 3BDPA 3ID8A 3OBYA 3OYMA 1XC9A 4FPBA 4CD1A 3OYHA 3TSPA 1ASVA 3ZYYX 3HOSA 5HBMA 3DM2A 2BE2A 4BWJA 4AHTA 1NMDA 1ZBSA 5ELZA 2V7ZA 4FW1A 2ZD1A 2HW3A 4LFBK 1NGFA 2HSTA 4CZJA 4NCAA 4DQQA 4RTFD 3ULEA 5HOOA 2XHBA 1VSEA 3DLGA 3RMBA 3ZSVA 4DSJA 4NCGA 2OPSA 3CCVN 1S6PA 2O8DA 2D5RA 3F73A 3WXIA 4YDUA 3C6AA 2ASMA 3HXMA 4H5VA 1VRTA 3PIOL 2O4IA 2WBNA 1D5AA 4O44A 3TTCA 3CPWM 1LOTB 1I94K 3W0LA 3J80O 4UQGA 2X78A 1RDCA 4CHYA 3CCUN 3DLRA 3FGUA 3WQUA 3TI0A 3SBTA 2XY8A 4XEIA 1RT6A 1WSIA 5KQDA 1XNQK 3DLLL 1GLEG 4FLWA 3SQ1A 1RDDA 3RMDA 4QS9A 4LH5A 4OGEA 3SJHA 3V9SA 3JYTA 4DTNA 3NF6A 4MLEA 3V4IA 4XH5A 1FKPA 1HYZA 5LMNK 3VGLA 3OYJA 3CC4N 3L3VA 4DTMA 3QEPA 4YOXA 1HNZK 4IFYA 3H3NO 1MU2A 3C95A 3SZ2A 4DV3K 3SLCA 3PLAA 3AA4A 4CJWA 1YJWN 3N4QA 4BR7A 3HPOA 1GOAA 3FE1A 4JS4A 5EY4A 1BU6O 3CFPA 4DFMA 1IKWA 2OPRA 1NK9A 3G71N 2A40A 4A5BA 5AQSA 3AAQA 1W0HA 1S5JA 4AHSA 5CHIA 4DU3A 3RR7A 1S9EA 4J8FA 1WBBA 4AILC 4BRDA 4FM1A 1L3VA 4C1NK 4EP5A 2GELA 3MEGA 3QEWA 3VENA 3DLEA 2Q31A 3C0BA 3BEXA 2QKBA 1HUXA 4DFKA 4WFNL 3KLIA 2GUIA 1HMVA 1Z05A 4GV6A 2CGJA 5AR0A 2P9UA 4CZIA 4BRFA 4DTRA 3EKSA 3V9XA 2KFNA 1JLAA 1DGKN 3P5JA 5CYMA 3THWB 3C6UA 3KKRA 1NGDA 4CFAA 4EAHD 4CZEA 2OANA 2FXUA 1HNIA 1BIUA 1KFDA 2VGMA 4Z94A 1XNRK 5JVHL 1LV5A 4YOUA 2QEXN 1ATSA 3AVCA 3RSEA 3A5OC 1S1TA 3AARA 4NXNK 4E89A 2P9UB 5BPLA 3BF1A 3D45A 2UXBK 4DQSA 1QQNA 4HUEA 4KHYA 3AVIA 4JKDA 2YNHA 2OTLN 3J7ZO 2WTUA 1QSYA 5BPNA 1P90A 3KLEA 2E2OA 4W5QA 4LF4K 1R0AA 1WSJA 1WB9A 3THXB 5I9EB 1BG3A 3HK2A 4LF8K 3CF5L 1T03A 2IVNA 1VQ7N 4CF1A 2ASOA 3B6PA 2E2PA 4GV9A 1LW2A 3OTOK 4OLBA 3SYZA 5J1EA 3LANA 1TV6A 5SWMA 2WFBA 4BRGA 4JD2A 1XMOK 5HROA 4HHTA 5GINA 3VQDA 3S9HA 3M8SA 5MLCQ 2OZSA 3U6FA 3OYLA 3CFRA 2F8SA 4ID5A 1JXBA 1KXPA 1HPMA 2WONA 3HYFA 5GAHP 1KTQA 3AA5X 1SKSA 3OS1A 1HJRA 2NRTA 4JKGA 4XH1A 2GWJA 3O9SA 1S72N 3P39A 1UWBA 3OYEA 5GADP 3MWTA 2G8WA 2X6NA 3MWPA 4JNEA 3HM9A 4HWIA 5AQZA 4CGGA 2P9NA 3ZT4A 4AM6A 2NRXA 1FW6A 3IUCA 4C8KA 4DR1K 3NH1A 4DUYK 5KQ8A 3BP8A 4NYNA 2WC9A 4I2PA 1HQUA 1V4SA 4JKAA 4JKGB 3T1HK 1S1VA 4CGDA 4LF7K 4ELTA 4BQLA 3NHGA 1KD1O 1RGIA 3P83D 2P9NB 3DLKA 4QOZB 3TPQA 4KHUA 4AHUA 3MCAB 3HSTB 4CGJA 2Q97A 2O8FA 5CY4A 4N76A 2GV9A 4JHDA 2OA8A 4KTZA 4OKEA 3RR8A 4DR4K 4H0YB 3TSQA 1E4FT 2JWKA 4H0PA 4FW2A 3EY1A 4JKCA 3L4QA 3NVMA 1J6ZA 3VEOA 4DQRA 1HYSA 4CHQA 1IKYA 2UUCK 3SV3A 1TGOA 1BQMA 2ZJQL 3SI6A 3MAQA 3HBTA 1YITN 4B9QA 1NLVA 1HPZA 1NKCA 1J5EK 2B5JA 5C24A 3V9UA 5TKWA 1MWKA 1RTDA 4BR9A 4JHDB 1LWFA 3NAEA 5ADXA 4PQUA 5M1NA 1T6DA 3C7NA 1HJOA 2RPIA 4H4OA 1XQSC 2EWSA 3NDKA 4M63C 3WQTA 4BRIA 3P31A 1GLJO 3OYCA 3C6HA 2BGGA 4HTLA 4OVLA 3SAFA 4FZXC 1CLQA 1JLCA 1KLMA 1U48A 2HHSA 3I0SA 3HJFA 4B9NA 1KAXA 3UKRA 4CJLA 1IG9A 3I33A 1MA9B 3FLCO 4E1MA 4YFUA 1L3TA 5EU7A 2RHKA 4ILGB 2HOEA 3WNFA 3C7NB 5AQOA 1S9GA 3MMVA 3VN5A 5AJ3K 4DTUA 3SUPA 4JKEA 1VQ8N 4K8XA 1ATNA 5LMUK 1RBTA 2Y1IA 4O4GA 3M5RA 1TK5A 4JI6K 4KB1A 4CFBA 4WQ4A 1FJGK 4IO8A 3VMFB 1ZBUA 2V52B 3V1QA 4FJXA 1NJZA 4K41A 2F8TA 4NYFA 2UUAK 4DMNA 4QCLA 3L2UA 3VA0A 2QA4N 3AO1A 3NGYA 4X66K 4PY5A 3CFOA 4FLYA 5AQHA 2IAJA 4Z4HA 4FOIA 4ILJA 1HYVA 4CJQA 3RMAA 4YOWA 1JLFA 4DV4K 4JI4K 4DLEA 4BDPA 3P1GA 3VQ4A 1QZ6A 5GIOA 4CEEA 4LH4A 2P9IA 5BRDA 4JKFA 5FPDA 1TYQA 3SUNA 5I3UA 5CR4A 3AO4A 4BDYA 3R9PA 1TUUA 1J53A 2OCEA 1NKBA 2HNYA 3H45C 3MN9A 1J54A 3LDLA 1X9JA 1QSLA 5LL6Z 3MX5A 3NF9A 3IG1A 4MFBA 1TKDA 2ZQBA 3OVNA 2QWOA 4B9MA 4IFVA 5HP1A 4JK8A 4Z4GA 3FFKB 3U3GA 3RWUA 5BREA 4FLXA 1J9AA 5AQXA 1K6YA 1BOTO 1X9WA 1NK7A 4IKFA 3TABA 3EO3A 2HBJA 4OX9K 4IDKA 1NG9A 3OHRA 1GLFO 4FJKA 3IMXA 4JI2K 4MO5A 4CHNA 1OH8A 1ITGA 3ZLJA 4FVMA 1BO5O 2CGKA 1QSSA 4DLGA 2P1JA 3U9DA 2BDPA 1Z26A 3K57A 3VA3A 4OPAA 3DJCA 3CJ9A 4I6MB 1XHZA 4JRPA 3AVKA 4BRQA 1MDUB 3JXUA 2UYTA 4MDAA 4K0KK 1EETA 3AVHA 4BR0A 1ZYQA 1T05A 2NUBA 1OVQA 1WSHA 2QWMA 3EE9A 4BROA 3TANA 2VQEK 1LW0A 5CZ1A 3G0ZA 2UXCK 3AGKA 3DRPA 4IFEA 4GKKK 1A5WA 4DTPA 2FC0A 4PL8A 4B8CA 3CMAN 2V51B 2D4WA 3VQ9A 1WOQA 2PAVA 4CJ4A 3A8YA 3ATUA 1N33K 1ZBIA 4O8KA 3HZ6A 4YDUC 1J5OA 5EXWA 1GLBG 3H08A 3HPGA 3SQ4A 1QHTA 4DSIA 2E2QA 4M3XA 2HVIA 4I7FA 1V4TA 3UKUA 4AM7A 4CJUA 3JS6A 2P5OA 4K8ZA 1QQMA 4QS8A 3ITHA 2ZWHA 4X65K 3QESA 1NKEA 3GG4A 3CJCA 4O8UA 2A1RA 4W5OA 3VPZA 1XWLA 4FJLA 5JICA 4B1VA 4FK2A 3H46O 5AFUH 4H5WA 4JV5K 4CBUA 2FLOA 4OGCA 1FKOA 3QIPA 3G10A 3S3MA 3UKUB 1KQSM 3G25A 1BCMA 4PA1A 4WCEL 3MX2A 1IV0A 3LM2A 4FLUA 2VQFK 4NO7A 4BQZA 1BCOA 1JLEA 4CCHA 2HMIA 3D0PA 4DS5A 2YHAA 4FWLA 3QNNA 1NJWA 1C1BA 1DLOA 4CIGA 4Z4EA 3CXCM 2A5XA 1KVCA 1ZBFA 4AHVA 4CJPA 1RFQA 3TAFA 4GNIA 1RTIA 4GV3A 1UAXA 3J8AA 3K2PA 2BH1A 4H0VB 3K5MA 2KKZA 4K25A 2CH6A 1BGXT 4FJ7A 3O5BA 4YORA 2KQ2A 3OW2M 4CHZA 3I56N 2D0PA 1WUAA 1WAJA 3LDPA 2NLXA 5HRSA 1SKRA 3G4SN 2W6KA 1K9MO 3SQ2A 4GMJB 1D9DA 3MEDA 4H5TA 4FJ5A 4CEAA 5GAEP 4DTOA 5JMVA 5DK5A 1C0UA 4FJMA 4KTWA 2ZM6K 3S41A 4CI6A 2G8VA 4BC5A 4F8RA 4ELUA 3ALYA 2IIRA 1L3SA 4CFCA 2P9PB 2PYJA 5BN9A 2PZSA 2IC3A 4BGAA 3NE6A 3GDQA 1X3NA 3T19A 4DWIA 3FZHA 1X1PA 3DXKB 4B9UA 1VSMA 3QICA 1D9FA 5AQQA 4B1ZA 3WXJA 2HBLA 2IDOA 2ETJA 4DFPA 3SMPA 1BIZA 1X9MA 1ASUA 4I9LA 3ZT3A 3KD1E 3SBGA 2Q0UA 3LDQA 2P51A 4IEIA 3KK1A 1B9FA 3WT0A 3OYNA 3L2VA 1NK8A 4M3WA 1SS6A 3QBXA 1XUPO 4FLTA 5AQWA 4CESA 3QEVA 4YNQA 3SUQA 4FWPA 4DV1K 2RKIA 1Z25A 3CPEA 3VESA 1VQKN 5AQFA 1B92A 3NGZA 3QLHA 4B3OA 1YTAA 2YJFA 3SJJA 3C94A 1ZXOA 2YI1A 2Z1GA 3NH2A 4FWOA 4Z0UA 4JYAK 2HBKA 3DI6A 2BANA 3Q7CA 4DSFA 4LF5K 1REVA 4KH6A 4CFDA 4DF8A 1BDGA 3MN6A 1G99A 4W5NA 4UY8O 4DV2K 5BRFA 2FSJA 1VQNN 4DR7K 3LDOA 3CG7A 2XY5A 4FWSA 3HSCA 3OYGA 3FZLA 2HVHA 1ZC6A 4PUOA 2W42A 2ATQA 2FBVA 2VWKA 3FZKA 4KH4A 3J7AP 1RT2A 3GBTA 3F9MA 2KZMA 3O6WA 4YY3K 2YHBA 3WEEB 1NGHA 4A5AA 1VSFA 1X3MA 3OY9A 1SZ2A 4DUZK 3DRSA 3TTDA 1MWMA 4JI1K 5FRNA 2VG7A 4FK0A 2F9WA 1JL1A 3LWLA 4G1QA 3THWA 2P5GA 1M1KO 1WNSA 3C6TA 4EP4A 1RT3A 1BWFO 4H5RA 1VK0A 4DB3A 4E7JA 4H0TB 3HVRA 3T69A 1K8AO 3ZT1A 4FWMA 4DF4A 2LSNA 2Z1JA 1JL2A 3HOTA 3BY5A 3DAWA 3DRRA 5M1QA 3AO2A 4JAXA 3RMCA 1W2BM 2DFEA 2JGUA 3AGRA 4DSKA 4A57A 4WFAL 4PL7A 1CZBA 3A5NC 1SAZA 4MLHA 3LPUA 3HT3A 4F3TA 2KW4A 2YKNA 4WQ5A 1QVFM 4OLAA 3EZWA 2E20A 3L2RA 4RW7A 4JRQA 1KSPA 3SNNA 4CE9A 4O0IA 1QVGM 3THXA 3FZMA 3SMSA 3M8RA 5J2QA 5CE3A 1O13A 3FZFA 3DLHA 4FZZA 4DU1A 4CD3A 3QEXA 3S3OA 1TAQA 5FLXO 1VSLA 2E6MA 1VHXA 4RW8A 3WXKA 4BRPA 3LAMA 4KKOA 2QXLA 4IO9L 2Z1IA 3AVMA 3L6QA 3LM9A 1YIJN 4CJEA 4CIFA 1YAGA 4IZ9A 4JI3K 1ATRA 1XC3A 2F4VK 3D2FB 1YHQN 4C8OA 3AO3A 1D4XA 1S22A 4KB0A 1C0GA 1UOCA 4M3RA 3CHWA 3TR8A 1QQOA 3D7EO 3GL1A 3OS0A 4E1JA 1EP4A 3NF7A 5FPMA 4WF9L 4IWVA 3CJAA 1IJJA 4F4KA 1LAWA 2PBDA 4BR2A 3BGRA 3QB0A 4ILHA 4OKJA 2YNFA 3LAKA 1R59O 2E2NA 2YJEA 3K9JA 1NGCA 4CF0A 1Z6RA 3TWHA 3CJBA 4CJ5A 2ITGA 2YHXA 1KFSA 3LWMA 2IVOA 2I7PA 4Z4CA 3EEQA 3MN7A 1HKCA 1Q81O 2H3GX 5C2FA 2GEMA 4HCBA 2FBYA 1U2VA 4JLHA 3M3ZA 3LL3A 4FJJA 2HB5A 2NRRA 2F9TA 3TAPA 1VQ9N 4LD0A 4BG8A 1HKGA 3L2WA 2GTDA 5JS1A 4MDBA 1YUWA 2FF3B 4WQ4C 3TTFA 3VF4A 3ID6A 4IOXA 2RE2A 3ENOA 5IWAK 3ULDA 4CBXA 5KGWA 2E5LK 4Z4FA 4FWRA 4KREA 3ZSRA 3M8QA 1S1UA 3E66A 3CD6N 4DG1A 2HMPA 2PYLA 1RCHA 5I42A 1U2VB 2ZJPL 1W97L 1N36K 1SUQA 5FRMA 1YTUA 1ASWA 3K0SA 4V19S 4PKGA 1B9DA 4ID1A 3AAPA 4L3QA 1NNEA 4CZLA 3VQQA 4LF6K 4AHRA 1VQLN 4W5RA 3LP3A 5B8HA 4G9ZA 4AQYK 3TAMA 4NLBA 3MXJA 1NBWA 2JLEA 3U8XA 3VQ7A 4E7HA 1JXEA 4FM0A 1LCUA 1NGAA 3B8AX 1M90O 3WNHA 2FBXA 4AF1A 4BWMA 1NGEA 3ZSWA 1JLGA 2QW9A 4MQ3A 4B9LA 1N8RO 4IEEA 2OPPA 5KPTA 4FJNA 5EX5A 3E9LA 3N4PA 5C0YA 1KAZA 4KHSA 4M45A 3KLHA 5KI6A 1GLDG 1RDUA 4DTSA 3IAYA 4B8AB 2E1YA 3HRGA
chains in the Genus database with same CATH topology
3NMUA 4H5NA 3NVKA 4NLCA 4B1WB 2QWMA 3EE9A 4BROA 3TSUA 3BF3A 3WXIA 4YDUA 4KH5A 3C6AA 2ASMA 4B1YB 4H5VA 3AGKA 3PIOL 4IFEA 2WBNA 3TTCA 3CPWM 1LOTB 3CCLN 4PL8A 3CMAN 2V51B 2D4WA 3W0LA 4FWQA 1WOQA 5M1FA 2PAVA 4A62A 3A8YA 5FPEA 3ATUA 3E1YA 2P9LA 3CCUN 1HX1A 4BRAA 4O8KA 3FGUA 3HZ6A 4PKHA 4YDUC 2FSKA 1C0FA 4FWKA 5EXWA 3WQUA 3SBTA 1GLBG 4XEIA 4FPAA 3O1BA 2E2QA 3CIPA 1K73O 1V4TA 4A61A 1BUPA 4JK7A 4U67L 5KQDA 3CC7N 3UKUA 4AM7A 3JS6A 3DLLL 1GLEG 1QQMA 4QS8A 2ZWHA 2AA4A 4H0XB 1GLAG 3RSEB 2GWKA 5AQVA 3ZX0A 1ILYA 4BRNA 3GG4A 3CJCA 4O8UA 2FF6A 3KK7A 4QS9A 3VPZA 3P4IA 4DQ8A 5AQPA 3SJHA 5JICA 1T6CA 3KZBA 4B1VA 4MLEA 5AZJA 3H46O 5AFUH 4XH5A 5BRHA 2P9LB 4H5WA 3VGLA 4BRKA 3I8BA 4BC2A 3CC4N 4CBUA 4JN4A 4FO0A 2FLOA 3A0IX 2W41A 3R6MA 4BR4A 4YOXA 3ZETA 3H3NO 2Q0RA 3UKUB 1KQSM 3G25A 3VEVA 3SLCA 4WCEL 5HL7L 2IVPA 3MX2A 5EOYA 3PLAA 1YJWN 3LM2A 3P38A 4FOEA 3WXLA 1U6ZA 4NO7A 3N4QA 4BR7A 4FL9A 3FE1A 4BQZA 5EY4A 1YF5L 1BU6O 3K9KA 4RWTA 5AZJB 3L0QA 4JK9A 4FWLA 3G71N 4PHTX 2A40A 4A5BA 5AQSA 3CXCM 5AQTA 4JD2B 2A5XA 3AAQA 2GUPA 5F1XA 1RFQA 5AQYA 3ZETB 2CGLA 4GNIA 5CHIA 3E9PA 4YOYA 3J8AA 5AFUA 3KHYA 4GV3A 2BH1A 4H0VB 4I6MA 4J8FA 5FPNA 2KKZA 2YHYA 2CH6A 3OA9A 4K25A 4BRDA 3QFPA 3O5BA 4YORA 3OW2M 3CQYA 1YJ9N 3EL2A 4IJNA 3WUHA 1Q86O 4C1NK 1NJIO 3I56N 2D0PA 3VF6A 2GELA 1WUAA 3LDPA 2NLXA 3VENA 3C0BA 2Q31A 3BEXA 3G4SN 1NGBA 1K9MO 1E4GT 3VEXA 1VQON 1HUXA 1GLLO 2NRVA 5AZIB 4H5TA 4WFNL 4JEPA 5GAEP 1Z05A 3F5TA 4BREA 5JMVA 4GV6A 2NRHA 3VEZA 1VQ6N 4RCHA 2CGJA 2PFUA 2P9UA 5AR0A 4CZIA 3S41A 4BRFA 4CI6A 5E26A 3EKSA 4BC5A 4YOVA 3C65A 2IIRA 3GE1A 1DGKN 2P9PB 1NGGA 3CCMN 3HM8A 5BN9A 5AQNA 1DT9A 3VTHA 4BGAA 1NGDA 4EAHD 5BN8A 4CZEA 3GDQA 1X3NA 2OANA 2FXUA 2Q2RA 5AQRA 3FZHA 2VGMA 4EFHA 3DXKB 4Z94A 4FVUA 3QICA 2A41A 5AQMA 5JVHL 5AQQA 4B1ZA 4YOUA 2QEXN 1ATSA 2DPNA 3WXJA 3RSEA 2E8AA 3A5OC 1VQPN 2HBLA 4BR5A 3AARA 2YX6A 2A6AA 3CCRN 1YXQA 2P9UB 4BG9A 3SMPA 3BF1A 5BPLA 5BR9A 2E88A 5JVGL 1QQNA 1K8KB 3H1VX 1QHAA 2NZTA 4JKDA 4FSVA 3SBGA 3J7ZO 2Q0UA 3LDQA 2OTLN 3ATVA 3T7ZA 4IEIA 5C2DA 3WT0A 4IXCA 1SS6A 2ZF5O 2VGNA 5BPNA 1P90A 3QBXA 1XUPO 4BVOA 3HI0A 2E2OA 4OPHA 5AQWA 1KAYA 2QWPA 3OBWA 4CZFA 4FWPA 5AQIA 4BRMA 3U9ZA 4A59A 2QI2A 3CPEA 3VESA 1VQKN 4CZKA 5AQFA 2BTFA 1KC8O 1BA0A 5I9EB 1BG3A 2D1KA 2YJFA 3CF5L 4M7XA 1HKBA 2HF4A 2IVNA 3L4IA 3MCPA 5EVZA 5AQJA 2FSNA 5DM7L 1VQ7N 2ASOA 2E2PA 4GV9A 2AP1A 1ZXOA 2Q36A 2YI1A 4FWOA 3I55N 3CCEN 2HBKA 3D6RA 3Q7CA 4BRLA 1NGIA 2WFBA 4BRGA 1YI2N 4KH6A 4JD2A 4JKBA 1BDGA 3QMLA 4BRHA 3MN6A 1G99A 5C10A 5GINA 4UY8O 2QM1A 5BRFA 2FSJA 1VQNN 3LDOA 5MLCQ 4FWSA 1Q18A 5DM6L 3HSCA 1KXPA 1HPMA 3H3OB 3QBWA 1VAZA 3SK3A 3EN9A 3M1FA 3MN5A 5GAHP 3FZLA 1CZAN 3KVGA 3G6EN 3IFRA 4F9OA 2NRTA 3UKRB 4JKGA 4XH1A 5F0XA 1ZC6A 2GWJA 3O9SA 3FZKA 4ISEA 2V7YA 3P39A 4KH4A 3WXMB 1S72N 5GADP 3UE5A 3GBTA 3F9MA 5AQLA 3ZEUA 3MWTA 3O8MA 3MWPA 2NRZA 3O6WA 3CJ1A 4GVEA 5AZIA 1SQKA 3ENHA 4JNEA 3VOVA 1NGHA 4HWIA 3WEEB 3QDKA 4A5AA 5AQZA 1X3MA 2P9NA 2J4RA 1SZ2A 3EE8A 2QWRA 3TTDA 1NM1A 1Q7YO 4AM6A 2KLAA 2NRXA 5E84A 5M1PA 5AQKA 3U4LA 1MWMA 3CERA 4WYBA 1EQYA 4BRCA 3IUCA 2F9WA 3GOIA 3CQXA 5KQ8A 2E1ZA 2YCHA 2P9PA 3BP8A 2WC9A 3A5MC 4BC4A 1QZ5A 3DWLA 4WFBL 2A42A 1V4SA 3A5LC 3LDNA 4JKAA 4JKGB 1M1KO 4C1NI 2GX9A 4IOAL 4KBOA 1BWFO 4H5RA 5LJWA 4OO1J 1EO1A 3ZEUB 4DB3A 3MK6A 3DXKA 2D0OA 4H0TB 4BQLA 3VGKA 3R3LA 1DEJA 1RDWX 3O9TA 3ZX3A 3T69A 1K8AO 5ADXH 1KD1O 1RGIA 2P9NB 3TPQA 4FWMA 3VERA 3FR0A 3SAGA 3MCAB 2F7TA 2Q97A 3HOTA 4A2AA 1NGJA 4JHDA 3DAWA 2HF3A 5M1QA 1K8KA 1E4FT 2JWKA 4H0YB 4JAXA 3TSQA 3AGRA 1W2BM 2ASPA 4H0PA 2P9IB 4B1UB 1TUYA 4DHYA 4EIAA 2CH5A 4A57A 1OVYA 4JKCA 4WFAL 4PL7A 1TYQB 3SAHA 3L4QA 3NVMA 3A5NC 1SAZA 4MLHA 1J6ZA 3O08A 3VEOA 4WQ5A 1QVFM 1S3XA 3EZWA 2E20A 3AY9A 4CZGA 1JJ2M 3RVCA 2BUPA 2ZJQL 1YJNN 1QVGM 3FZMA 4LC9B 3HBTA 4ISGA 3SMSA 4B9QA 1NLVA 1P8ZA 1YITN 2P9SA 5CE3A 1O13A 4BVPA 3E9OA 5KPZA 3FZFA 5C12A 5TKWA 4PKIA 1MWKA 4H0OA 4EHUA 4CZMA 4CD3A 5KPRA 2I7NA 1Y64A 4BR9A 4JHDB 4H03B 4WQ5C 3WXKA 3O4WA 4BRPA 5ADXA 2QXLA 2NNWA 5TKYA 5M1NA 1JCFA 4IJAA 4IO9L 1T6DA 3C7NA 1HJOA 3L6QA 3O9UA 4M7YA 4EHTA 3IKMA 3LM9A 1YIJN 5H1SQ 1YAGA 4IZ9A 1XQSC 1ATRA 2EWSA 4M63C 1XC3A 2ZGYA 3QFUA 2ZJRL 3D2FB 3WQTA 3P31A 4BRIA 1YHQN 1GLJO 3CC2N 1T3VA 3C6HA 3VGMA 2OTJN 5JLFA 1D4XA 1S22A 5F2RA 1C0GA 4HTLA 3SAFA 3CHWA 4FWNA 3O1WA 1QQOA 3F2KA 4IOCL 2P9SB 3D7EO 4U7BA 1ESVA 1HLUA 3GL1A 4E1JA 3O80A 5FPMA 1KAXA 3UKRA 3ULEB 4WF9L 3I33A 4IDHA 4IWVA 1MA9B 3FLCO 3BUZB 3CJAA 4XH4A 1IJJA 4R79A 3CCSN 2RHKA 2HOEA 2PBDA 3MMVA 1OKJA 2VCPA 3C7NB 4ILGB 5AQOA 3QB0A 4ILHA 4BR2A 4JKEA 5M1KA 1VQ8N 3WEEA 3VF2A 1R59O 1ATNA 2E2NA 3VEYA 2YJEA 3K9JA 4CJ7A 4DCHA 1NGCA 3D2EA 1Z6RA 4ISFA 2QWLA 3CJBA 3ZX2A 3CMEN 2W40A 2WUSA 3R8EA 3M5RA 2YHXA 3VEWA 2IVOA 2I7PA 4O5FA 2P9KA 3MN7A 1HKCA 1Q81O 4WQ4A 4IO8A 4QS7A 3VMFB 2H3GX 2V52B 4BC3A 5C2FA 3CCJN 5LY3A 1VQMN 2GEMA 1IG8A 1U2VA 3M3ZA 3LL3A 4K41A 5JLHA 1GLCG 2NRRA 3DXMA 2F9TA 5LJVA 3EKUA 3UB5A 4B1XB 1VQ9N 2QA4N 4BG8A 2QWNA 2YHWA 1HKGA 2JWLA 2Q1NA 2GTDA 3R1XA 4DKWA 3D2EB 3KWIA 4MDBA 4Y0WA 5AQHA 1YUWA 2ITMA 4FOIA 2FF3B 4WQ4C 4ILJA 3TTFA 2NRWA 3CCQN 3CJ7A 3TU5A 3VF4A 4YOWA 3ID6A 1JCGA 4GY2B 2RE2A 3ENOA 3MDQA 4IOXA 2A3ZA 4CBXA 4YOTA 5GAGP 3Q7BA 3PIPL 1QZ6A 4FWRA 2QTDA 3ENBA 5GIOA 3KWGA 4CBWA 2P9IA 2P9KB 5GIPA 5BRDA 1Q82O 1H1VA 4JKFA 3E66A 1TYQA 5FPDA 3CD6N 1JCEA 5CR4A 1T44A 5AQUA 4A2BA 2HMPA 3CETA 1TUUA 1YVNA 2HBMA 3R9PA 1U2VB 2VYPA 3H45C 3MN9A 3IDHA 1VQ5N 2ZJPL 1W97L 4MO4A 3LDLA 3H6EA 3DXMB 3W3DA 2VWBA 1X9JA 3MX5A 3H1QA 4PKGA 3AAPA 4L3QA 4K43A 3M6GA 4CZLA 2QWOA 5C15A 1VQ4N 4K42A 1BA1A 2KHOA 4JK8A 1DKGD 5M1OA 3FFKB 1VQLN 4CZHA 3CI5A 1NWKA 3O9QA 3VTIA 5B8HA 5BREA 5AQXA 3ID8A 3OBYA 1BOTO 4G9ZA 4NLBA 1NBWA 2ZGZA 3EO3A 4FPBA 4BGBA 2HBJA 3U8XA 4CD1A 1LCUA 1NGAA 3B8AX 1M90O 3OHRA 1GLFO 3TSPA 3ZYYX 4NB4A 3HOSA 4AF1A 3IMXA 4MO5A 1NGEA 1BO5O 2CGKA 2QW9A 3D2FA 1N8RO 4IEEA 5BPMA 1NMDA 3U9DA 1ZBSA 5ELZA 5KPTA 2V7ZA 2QWQA 3DJCA 4OPAA 3CJ9A 5EX5A 3VETA 4I6MB 3E9LA 3N4PA 1NGFA 4BRQA 4BY9C 5C0YA 1MDUB 1KAZA 2HSTA 3JXUA 2UYTA 4C23A 4MDAA 4CZJA 5AQGA 4RTFD 3ULEA 1GLDG 3HTVA 5HOOA 1RDUA 4BR0A 3O9RA 2E1YA 4JKHA 3HRGA 3CCVN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M O;  1VQO N;  1VQ8 N;  4WFN L;  5GAE P;  1Q7Y O;  3PIO L;  3CME N;  1VQ6 N;  3CPW M;  3CCL N;  3CMA N;  3CCM N;  3CCU N;  1Q81 O;  4WFB L;  1M1K O;  3CCJ N;  1VQM N;  4IOA L;  1K73 O;  4U67 L;  3CC7 N;  5JVH L;  1VQ9 N;  2QA4 N;  1K8A O;  1KD1 O;  3DLL L;  2QEX N;  1VQP N;  1ILY A;  3CCQ N;  3CCR N;  5JVG L;  5GAG P;  3PIP L;  1W2B M;  2OTL N;  3J7Z O;  1Q82 O;  1OVY A;  4WFA L;  3CD6 N;  3CC4 N;  1QVF M;  1VQ5 N;  2ZJP L;  1JJ2 M;  2ZJQ L;  1YJN N;  1QVG M;  1YIT N;  1KQS M;  1VQK N;  4WCE L;  5HL7 L;  1KC8 O;  1VQ4 N;  1YJW N;  3CF5 L;  5DM7 L;  1VQL N;  1VQ7 N;  3I55 N;  4IO9 L;  3CCE N;  1M90 O;  3G71 N;  1YI2 N;  1YIJ N;  5GAD P;  5H1S Q;  3CXC M;  2ZJR L;  1N8R O;  1YHQ N;  3CC2 N;  4UY8 O;  2OTJ N;  1VQN N;  5MLC Q;  4IOC L;  5DM6 L;  3OW2 M;  5GAH P;  3G6E N;  1YJ9 N;  1Q86 O;  1NJI O;  3I56 N;  4WF9 L;  1S72 N;  3CCS N;  3G4S N;  3CCV N; 
#chains in the Genus database with same CATH topology
 4H4M A;  4H5N A;  3NMU A;  3K5L A;  4W5T A;  3UIQ A;  4XIU A;  3OYB A;  4B1Y B;  2FBT A;  1LAV A;  4E7L A;  1NK6 A;  4N41 A;  4DR2 K;  1U4B A;  1IH7 A;  4FLV A;  5M1F A;  4A62 A;  5JS2 A;  5FPE A;  3E1Y A;  4BRA A;  5FDL A;  4LF9 K;  4PKH A;  3E01 A;  5KTQ A;  2FSK A;  1C0F A;  3AVF A;  2VG5 A;  4FPA A;  3O1B A;  3CIP A;  2QK9 A;  1BIS A;  1K73 O;  4A61 A;  1BUP A;  3NF8 A;  3T1Y K;  4ELV A;  1QTM A;  1ILY A;  3ZX0 A;  4BRN A;  2PY5 A;  2FF6 A;  4BE1 A;  3DMJ A;  5AQP A;  3KD5 E;  1TVR A;  1T6C A;  4RW4 A;  4BRK A;  4BC2 A;  3BZK A;  4ICL A;  4JN4 A;  5FRO A;  2W41 A;  3R6M A;  3KK2 A;  2Q0R A;  1NK0 A;  1CXU A;  4Y1C A;  3CM5 A;  5HL7 L;  2IVP A;  3WXL A;  1U6Z A;  3HL8 A;  3O4N A;  3QET A;  1TKT A;  4RWT A;  5HLF A;  3L0Q A;  4JK9 A;  2W6L A;  1WSF A;  3O4Q A;  5AQT A;  2HHU A;  2GUP A;  4CJV A;  1VSI A;  1IBL K;  4YOY A;  3E9P A;  3KHY A;  3U3Y A;  4I6M A;  2G8I A;  1JKH A;  4Q5V A;  2DFH A;  4IJN A;  1RDB A;  1Q86 O;  1NJI O;  3VF6 A;  1I39 A;  3I8D A;  1RT5 A;  3NH0 A;  3L8B A;  1D8Y A;  2D0B A;  3VEX A;  2HHT A;  3CYM A;  5AZI B;  3I0R A;  4JEP A;  4CK1 A;  5HRP A;  3DYA A;  4CER A;  2NRH A;  3AA3 A;  3VEZ A;  1O1W A;  2PFU A;  2YKM A;  1NGG A;  4B9S A;  5AQN A;  3SQ0 A;  1DT9 A;  3VTH A;  4FCY A;  2RN2 A;  5BN8 A;  4E0D A;  1HNX K;  2Q2R A;  1NU0 A;  4CJ3 A;  4EFH A;  3JSM A;  3KLF A;  1KVA A;  2X6S A;  5AQM A;  4B3S K;  3TAE A;  1GOB A;  4CJR A;  1OH6 A;  2DPN A;  2E8A A;  1VQP N;  4I9Q A;  3HO1 A;  2A6A A;  3CCR N;  1YXQ A;  1L3U A;  5BR9 A;  2E88 A;  1SL0 A;  1U47 A;  1K8K B;  2B4J A;  3M8P A;  4F2S A;  3H1V X;  1QHA A;  2F96 A;  5C2D A;  5K14 A;  3PY8 A;  4IXC A;  2ZF5 O;  2VGN A;  4OPH A;  5CYQ A;  1KAY A;  2QWP A;  3K5O A;  4BRM A;  1N6Q A;  2DY4 A;  3U9Z A;  4A59 A;  1BI4 B;  3L2Q A;  2BTF A;  1BA0 A;  4KV8 A;  4Y1D A;  3SUO A;  2D1K A;  4M7X A;  3PX6 A;  1HKB A;  2HF4 A;  3L4I A;  3PX0 A;  5EVZ A;  5AQJ A;  2E4L A;  1EX4 A;  2AP1 A;  3FFI A;  1C1C A;  3I55 N;  4HCC A;  4KPY A;  1VSH A;  1OH5 A;  1U04 A;  2O8C A;  4JKB A;  3WNE A;  3SPY A;  5C10 A;  3QO9 A;  1RBS A;  2QM1 A;  3KJV A;  4B9T A;  3ASM A;  2R7Y A;  1HR0 K;  3ISN C;  3J7Y P;  4EZ6 A;  3QNO A;  5DM6 L;  5DMR A;  4B3T K;  3QBW A;  1VAZ A;  3G6E N;  3EN9 A;  3M1F A;  3MN5 A;  3V81 A;  4FJ9 A;  1CZA N;  4F9O A;  1TK8 A;  5F0X A;  4ISE A;  3WXM B;  1L5U A;  1HRH A;  1WSG A;  3UE5 A;  3O3H A;  3ZEU A;  3O8M A;  4DR6 K;  3QEI A;  3CJ1 A;  3ENH A;  2G8U A;  3QDK A;  2O8C B;  3TAR A;  2J4R A;  2QWR A;  4FJG A;  4KRF A;  2KLA A;  5E84 A;  3U4L A;  1LWE A;  4WYB A;  2EX3 A;  3RRG A;  4JI7 K;  2E1Z A;  2HND A;  2P9P A;  5J2N A;  2HNZ A;  1QZ5 A;  3DWL A;  2O4G A;  2A42 A;  3LDN A;  1WBD A;  1U49 A;  4LFC K;  4M3T A;  4C1N I;  2GX9 A;  4X62 K;  3J81 O;  2D0A A;  1Q9Y A;  4KBO A;  5LJW A;  4OO1 J;  1EO1 A;  3ZEU B;  3MK6 A;  3DXK A;  2XO7 A;  2D0O A;  1XMQ K;  3VQA A;  3R3L A;  1RDW X;  3O9T A;  3LPT A;  5ADX H;  3TAQ A;  3V9W A;  1C0T A;  4DV6 K;  4JI8 K;  1IO2 A;  3FR0 A;  2F7T A;  4BE0 A;  3THV A;  4A2A A;  1G15 A;  1EKE A;  4KTQ A;  4CK3 A;  2A1S A;  2HF3 A;  4H8K A;  3LDS A;  2ASP A;  4B1U B;  1TUY A;  4DHY A;  4EIA A;  2UUB K;  3IRX A;  1OVY A;  4C8L A;  3SAH A;  3CM6 A;  3O08 A;  5A2Q O;  4B3M K;  1HNV A;  4E7I A;  4TSX A;  3RVC A;  2BUP A;  4DV5 K;  4KHW A;  4LC9 B;  1LWC A;  3AV9 A;  4ISG A;  2P9S A;  1Q9X A;  5D3G A;  5C12 A;  4CEZ A;  3ZSY A;  4KI6 A;  5KPR A;  2I7N A;  1IBK K;  2B6A A;  4H03 B;  4WQ5 C;  4DR5 K;  3O4W A;  5TKY A;  2NNW A;  2G8F A;  4IJA A;  3WNG A;  3O9U A;  5H1S Q;  1FXX A;  4DQP A;  4HUF A;  4BE2 A;  3KTQ A;  2QXF A;  3VGM A;  1IKX A;  1BL3 A;  2VG6 A;  4AHC A;  4FWN A;  4IOC L;  2P9S B;  1N32 K;  4RW9 A;  3HP6 A;  2UU9 K;  2D0C A;  4GVM A;  4M3U A;  4U7B A;  3AVJ A;  3V9Z A;  1HLU A;  3A2F A;  4LFA K;  3VQ8 A;  2YV0 X;  3ULE B;  3RTV A;  4KAZ A;  4XH4 A;  3BUZ B;  4CHO A;  1KLN A;  4R79 A;  4CJF A;  5M1K A;  2O8D B;  3WEE A;  4L8R B;  3VF2 A;  1SKW A;  3D2E A;  4ISF A;  4FJI A;  2KFZ A;  3ZX2 A;  2W40 A;  3QIN A;  3R8E A;  1S6Q A;  2XY7 A;  3ZSQ A;  1TKX A;  4CF2 A;  4E1N A;  2P9K A;  4OPJ A;  4QS7 A;  4BC3 A;  3CCJ N;  1VQM N;  3ZT0 A;  5SZT A;  5JLH A;  3DXM A;  3EKU A;  3UB5 A;  4WE1 A;  3OS2 A;  3QIO A;  2OYQ A;  2YHW A;  3HVT A;  1X9S A;  2Q1N A;  4DKW A;  3D2E B;  3KWI A;  4I2Q A;  5BR8 K;  3RRH A;  4FJ8 A;  4R5P A;  3TU5 A;  4JS5 A;  1JCG A;  4GY2 B;  3LZJ A;  2A3Z A;  4O5B A;  5GAG P;  3Q7B A;  5C42 A;  2QTD A;  3ENB A;  3KWG A;  2P9K B;  4M42 A;  1Q82 O;  1KVB A;  1H1V A;  3AVA A;  5AQU A;  1T44 A;  2KTQ A;  1U45 A;  3CET A;  3O3F A;  2HBM A;  4BAC A;  1WAF A;  4MO4 A;  3H6E A;  3DXM B;  3W3D A;  2VWB A;  2OPQ A;  3H1Q A;  3V1O A;  1NJY A;  5C15 A;  4CJK A;  1BA1 A;  3S3N A;  4AH9 A;  4CEQ A;  4IG3 A;  1A5X A;  3PV8 A;  4QAG A;  4CGH A;  3AA2 A;  4O0J A;  1NJX A;  2ZGZ A;  4BGB A;  3PUF A;  4NB4 A;  1JLB A;  2GBZ A;  3T1A A;  1A5V A;  3K59 A;  3D2F A;  1RBU A;  3HP9 A;  5BPM A;  3L3U A;  3VET A;  2QWQ A;  4J2E A;  3VQC A;  2HHV A;  1QQC A;  4BY9 C;  1YT3 A;  2XY6 A;  1DTQ A;  3VQ6 A;  4C23 A;  3PX4 A;  4J2A A;  5AQG A;  3THY A;  2WOM A;  3HTV A;  4CW7 B;  4FZY A;  3O9R A;  3AO5 A;  1OH7 A;  4JKH A;  3LP2 A;  3NVK A;  4NLC A;  4B1W B;  1BHL A;  3TSU A;  3BF3 A;  3PSI A;  5J2P A;  4KH5 A;  3OYI A;  2RF2 A;  4B3R K;  3PSF A;  1Q8I A;  1CZ9 A;  3CCL N;  4FWQ A;  1RIL A;  1EWQ A;  2P9L A;  2X74 A;  1HX1 A;  4E7K A;  3THY B;  1IKV A;  3F9K A;  4KFB A;  3LP0 A;  4FWK A;  1SV5 A;  4N5S A;  3EZ5 A;  4ZTF A;  4JK7 A;  4U67 L;  3CC7 N;  1QE1 A;  3SPZ A;  2AA4 A;  5J2M A;  4H0X B;  4O55 A;  1GLA G;  1I3A A;  2GWK A;  5AQV A;  3RSE B;  3OYD A;  4X64 K;  3KK7 A;  4DQ8 A;  1E3M A;  3P4I A;  2G8H A;  3CQ8 A;  4RW6 A;  3KZB A;  4CED A;  5AZJ A;  5BRH A;  2P9L B;  3I8B A;  4IBN A;  4FO0 A;  4KHQ A;  4IG0 A;  4E3S A;  3A0I X;  4BR4 A;  3OYK A;  3ZET A;  2HHW A;  4BDZ A;  4KHP K;  1RT1 A;  3VEV A;  3BZC A;  5EOY A;  1RTH A;  2IGI A;  3P38 A;  4FOE A;  1HQE A;  4FL9 A;  1RNH A;  1YF5 L;  3K9K A;  3PO4 A;  4FXD A;  5AZJ B;  1NOY A;  2AJQ A;  4JD2 B;  3JAM O;  5F1X A;  1C0M A;  4OKK A;  5AQY A;  3ZET B;  2CGL A;  5AFU A;  3DLB A;  1VSD A;  2KZZ A;  5FPN A;  2YHY A;  3OA9 A;  4OJR A;  3QFP A;  4C8N A;  1HNW K;  3CQY A;  2XRI A;  4GW6 A;  1TKZ A;  3EL2 A;  1YJ9 N;  3WUH A;  3LZI A;  3NFA A;  3LP1 A;  1NGB A;  3KKS A;  1E4G T;  1VQO N;  3VQE A;  4PWD A;  2O8B A;  4DSE A;  1GLL O;  2NRV A;  3AVB A;  1VSJ A;  3F5T A;  4DTJ A;  4BRE A;  4DU4 A;  3MXI A;  1RBR A;  1VQ6 N;  4RCH A;  5E26 A;  4YOV A;  4HTU A;  3C65 A;  3GE1 A;  4KHN A;  1CXQ A;  3CCM N;  3HM8 A;  1QS4 A;  4F2R A;  3V6D A;  3OYF A;  3EYZ A;  2Z1H A;  5AQR A;  3T3F A;  2YNG A;  3ZCM A;  4FVU A;  2O8B B;  4NXM K;  2A41 A;  1C6V A;  1IBM K;  4CHP A;  2HHH K;  4M3Z A;  4BR5 A;  1S1W A;  3IS9 A;  1YVU A;  2YX6 A;  4CEB A;  5JVG L;  2O8F B;  4BG9 A;  2Q3S A;  3NCI A;  4FYD A;  2NZT A;  2EHG A;  4FSV A;  3ATV A;  3T7Z A;  1NK5 A;  4CK2 A;  1UA1 A;  3VQ5 A;  4LY7 A;  4BVO A;  3HI0 A;  1JLQ A;  2Y1J A;  3OBW A;  4CZF A;  1WN7 A;  5AQI A;  4CGF A;  1TL3 A;  1ZBH A;  1EXQ A;  2QI2 A;  4JI0 K;  3AVL A;  4CZK A;  1T8E A;  1KC8 O;  2UXD K;  3SCX A;  1SL1 A;  4M41 A;  5DM7 L;  3MCP A;  2FSN A;  2OZM A;  3ZSO A;  1NMN A;  3B6O A;  2Q36 A;  4DTX A;  4CJT A;  1XI1 A;  3CCE N;  3D6R A;  3MEC A;  4BRL A;  1NGI A;  1YI2 N;  3NBP A;  1EWR A;  1KCF A;  3MXM A;  4HUG A;  3QML A;  4BRH A;  3K5N A;  3VQP A;  5C25 A;  4B9V A;  4CF8 A;  4CIE A;  5HRN A;  4CGI A;  3ZSZ A;  1Q18 A;  4EZ9 A;  3SK3 A;  3H3O B;  2YNI A;  3KVG A;  3IFR A;  4FK4 A;  1KRP A;  3UKR B;  2V7Y A;  3OJU A;  5AQL A;  3LAL A;  2NRZ A;  4GVE A;  5AZI A;  1SQK A;  3VOV A;  4N56 A;  4Q0B A;  3VQB A;  1Q7Y O;  3EE8 A;  1NM1 A;  4KI4 A;  5M1P A;  4DV0 K;  5AQK A;  4JI5 K;  1FK9 A;  4CEF A;  3CER A;  2DTU A;  1EQY A;  1NK4 A;  4BRC A;  4N47 A;  3GOI A;  3CQX A;  1GOC A;  2YCH A;  2QKK A;  3A5M C;  4BC4 A;  4WFB L;  3A5L C;  5CZ2 A;  4IOA L;  1VSK A;  4ZHR A;  4NCB A;  4DV7 K;  3VGK A;  3ZX3 A;  1DEJ A;  4FLZ A;  3PO5 A;  1RDA A;  1WSE A;  1W9H A;  3VER A;  3SAG A;  4GKJ K;  3ZT2 A;  1W7A A;  1NGJ A;  1BQN A;  5KRS A;  1S1X A;  1TAU A;  1K8K A;  1WLJ A;  3NGI A;  2P9I B;  1RBV A;  3DOK A;  2CH5 A;  1TYQ B;  4LSL A;  1S3X A;  3AY9 A;  4CZG A;  1JJ2 M;  1YJN N;  1BI4 A;  4M3Y A;  1P8Z A;  1Y97 A;  2G8K A;  4BVP A;  3E9O A;  5KPZ A;  4KO0 A;  4PKI A;  4H0O A;  4EHU A;  4CZM A;  4RG8 A;  4CJS A;  1Y64 A;  3O3G A;  2E6L A;  4DSL A;  2VWJ A;  1C1A A;  1JCF A;  4M7Y A;  4EHT A;  3IKM A;  2I5J A;  1UA0 A;  4FJH A;  2ZGY A;  3QFU A;  2ZJR L;  4CEC A;  3CC2 N;  1T3V A;  2OTJ N;  5JLF A;  4FM2 A;  5F2R A;  4ZTJ A;  4B08 A;  3TAG A;  3O1W A;  3F2K A;  4OPK A;  1VRU A;  4HVJ A;  2IS3 A;  1NOZ A;  1ESV A;  3MEE A;  4DQI A;  5KGX A;  1ZBL A;  3O80 A;  3OJS A;  3SV4 A;  1TK0 A;  4IDH A;  3CCS N;  3KIO A;  4PHT X;  1OKJ A;  2VCP A;  3AVG A;  4J2D A;  3KK3 A;  5T7B A;  3VEY A;  4CJ7 A;  4DCH A;  4LSN A;  5E41 A;  2QWL A;  4E19 A;  1XHX A;  3CME N;  1N5Y A;  2WUS A;  3HPH A;  3VEW A;  4CEO A;  1RT7 A;  4O5F A;  4YHH K;  3AVN A;  3K58 A;  5HRR A;  5LY3 A;  4F3O A;  1IG8 A;  4C8M A;  4DS4 A;  1GLC G;  5LJV A;  4B1X B;  2QWN A;  2JWL A;  1TL1 A;  3R1X A;  3KLG A;  4Y0W A;  2O8E A;  2HHQ A;  2ITM A;  4CVN E;  2DFF A;  2NRW A;  3CCQ N;  3CJ7 A;  1N34 K;  1SL2 A;  3MDQ A;  4YOT A;  3V1R A;  3PIP L;  2ZE2 A;  4CBW A;  5GIP A;  3OYA A;  1JCE A;  1F21 A;  4A2B A;  2IOC A;  1YVN A;  1DTT A;  2VYP A;  4CF9 A;  2HHX A;  3IDH A;  1RTJ A;  3QER A;  1VQ5 N;  4Z4I A;  5IT9 O;  5KRT A;  4DR3 K;  4DFJ A;  1RT4 A;  4K43 A;  3M6G A;  3DOL A;  1VQ4 N;  4K42 A;  1T7P A;  3ZSX A;  2O8E B;  4J2B A;  2KHO A;  1DKG D;  5M1O A;  4CZH A;  3CI5 A;  1NWK A;  3O9Q A;  3VTI A;  3BDP A;  3ID8 A;  3OBY A;  3OYM A;  1XC9 A;  4FPB A;  4CD1 A;  3OYH A;  3TSP A;  1ASV A;  3ZYY X;  3HOS A;  5HBM A;  3DM2 A;  2BE2 A;  4BWJ A;  4AHT A;  1NMD A;  1ZBS A;  5ELZ A;  2V7Z A;  4FW1 A;  2ZD1 A;  2HW3 A;  4LFB K;  1NGF A;  2HST A;  4CZJ A;  4NCA A;  4DQQ A;  4RTF D;  3ULE A;  5HOO A;  2XHB A;  1VSE A;  3DLG A;  3RMB A;  3ZSV A;  4DSJ A;  4NCG A;  2OPS A;  3CCV N;  1S6P A;  2O8D A;  2D5R A;  3F73 A;  3WXI A;  4YDU A;  3C6A A;  2ASM A;  3HXM A;  4H5V A;  1VRT A;  3PIO L;  2O4I A;  2WBN A;  1D5A A;  4O44 A;  3TTC A;  3CPW M;  1LOT B;  1I94 K;  3W0L A;  3J80 O;  4UQG A;  2X78 A;  1RDC A;  4CHY A;  3CCU N;  3DLR A;  3FGU A;  3WQU A;  3TI0 A;  3SBT A;  2XY8 A;  4XEI A;  1RT6 A;  1WSI A;  5KQD A;  1XNQ K;  3DLL L;  1GLE G;  4FLW A;  3SQ1 A;  1RDD A;  3RMD A;  4QS9 A;  4LH5 A;  4OGE A;  3SJH A;  3V9S A;  3JYT A;  4DTN A;  3NF6 A;  4MLE A;  3V4I A;  4XH5 A;  1FKP A;  1HYZ A;  5LMN K;  3VGL A;  3OYJ A;  3CC4 N;  3L3V A;  4DTM A;  3QEP A;  4YOX A;  1HNZ K;  4IFY A;  3H3N O;  1MU2 A;  3C95 A;  3SZ2 A;  4DV3 K;  3SLC A;  3PLA A;  3AA4 A;  4CJW A;  1YJW N;  3N4Q A;  4BR7 A;  3HPO A;  1GOA A;  3FE1 A;  4JS4 A;  5EY4 A;  1BU6 O;  3CFP A;  4DFM A;  1IKW A;  2OPR A;  1NK9 A;  3G71 N;  2A40 A;  4A5B A;  5AQS A;  3AAQ A;  1W0H A;  1S5J A;  4AHS A;  5CHI A;  4DU3 A;  3RR7 A;  1S9E A;  4J8F A;  1WBB A;  4AIL C;  4BRD A;  4FM1 A;  1L3V A;  4C1N K;  4EP5 A;  2GEL A;  3MEG A;  3QEW A;  3VEN A;  3DLE A;  2Q31 A;  3C0B A;  3BEX A;  2QKB A;  1HUX A;  4DFK A;  4WFN L;  3KLI A;  2GUI A;  1HMV A;  1Z05 A;  4GV6 A;  2CGJ A;  5AR0 A;  2P9U A;  4CZI A;  4BRF A;  4DTR A;  3EKS A;  3V9X A;  2KFN A;  1JLA A;  1DGK N;  3P5J A;  5CYM A;  3THW B;  3C6U A;  3KKR A;  1NGD A;  4CFA A;  4EAH D;  4CZE A;  2OAN A;  2FXU A;  1HNI A;  1BIU A;  1KFD A;  2VGM A;  4Z94 A;  1XNR K;  5JVH L;  1LV5 A;  4YOU A;  2QEX N;  1ATS A;  3AVC A;  3RSE A;  3A5O C;  1S1T A;  3AAR A;  4NXN K;  4E89 A;  2P9U B;  5BPL A;  3BF1 A;  3D45 A;  2UXB K;  4DQS A;  1QQN A;  4HUE A;  4KHY A;  3AVI A;  4JKD A;  2YNH A;  2OTL N;  3J7Z O;  2WTU A;  1QSY A;  5BPN A;  1P90 A;  3KLE A;  2E2O A;  4W5Q A;  4LF4 K;  1R0A A;  1WSJ A;  1WB9 A;  3THX B;  5I9E B;  1BG3 A;  3HK2 A;  4LF8 K;  3CF5 L;  1T03 A;  2IVN A;  1VQ7 N;  4CF1 A;  2ASO A;  3B6P A;  2E2P A;  4GV9 A;  1LW2 A;  3OTO K;  4OLB A;  3SYZ A;  5J1E A;  3LAN A;  1TV6 A;  5SWM A;  2WFB A;  4BRG A;  4JD2 A;  1XMO K;  5HRO A;  4HHT A;  5GIN A;  3VQD A;  3S9H A;  3M8S A;  5MLC Q;  2OZS A;  3U6F A;  3OYL A;  3CFR A;  2F8S A;  4ID5 A;  1JXB A;  1KXP A;  1HPM A;  2WON A;  3HYF A;  5GAH P;  1KTQ A;  3AA5 X;  1SKS A;  3OS1 A;  1HJR A;  2NRT A;  4JKG A;  4XH1 A;  2GWJ A;  3O9S A;  1S72 N;  3P39 A;  1UWB A;  3OYE A;  5GAD P;  3MWT A;  2G8W A;  2X6N A;  3MWP A;  4JNE A;  3HM9 A;  4HWI A;  5AQZ A;  4CGG A;  2P9N A;  3ZT4 A;  4AM6 A;  2NRX A;  1FW6 A;  3IUC A;  4C8K A;  4DR1 K;  3NH1 A;  4DUY K;  5KQ8 A;  3BP8 A;  4NYN A;  2WC9 A;  4I2P A;  1HQU A;  1V4S A;  4JKA A;  4JKG B;  3T1H K;  1S1V A;  4CGD A;  4LF7 K;  4ELT A;  4BQL A;  3NHG A;  1KD1 O;  1RGI A;  3P83 D;  2P9N B;  3DLK A;  4QOZ B;  3TPQ A;  4KHU A;  4AHU A;  3MCA B;  3HST B;  4CGJ A;  2Q97 A;  2O8F A;  5CY4 A;  4N76 A;  2GV9 A;  4JHD A;  2OA8 A;  4KTZ A;  4OKE A;  3RR8 A;  4DR4 K;  4H0Y B;  3TSQ A;  1E4F T;  2JWK A;  4H0P A;  4FW2 A;  3EY1 A;  4JKC A;  3L4Q A;  3NVM A;  1J6Z A;  3VEO A;  4DQR A;  1HYS A;  4CHQ A;  1IKY A;  2UUC K;  3SV3 A;  1TGO A;  1BQM A;  2ZJQ L;  3SI6 A;  3MAQ A;  3HBT A;  1YIT N;  4B9Q A;  1NLV A;  1HPZ A;  1NKC A;  1J5E K;  2B5J A;  5C24 A;  3V9U A;  5TKW A;  1MWK A;  1RTD A;  4BR9 A;  4JHD B;  1LWF A;  3NAE A;  5ADX A;  4PQU A;  5M1N A;  1T6D A;  3C7N A;  1HJO A;  2RPI A;  4H4O A;  1XQS C;  2EWS A;  3NDK A;  4M63 C;  3WQT A;  4BRI A;  3P31 A;  1GLJ O;  3OYC A;  3C6H A;  2BGG A;  4HTL A;  4OVL A;  3SAF A;  4FZX C;  1CLQ A;  1JLC A;  1KLM A;  1U48 A;  2HHS A;  3I0S A;  3HJF A;  4B9N A;  1KAX A;  3UKR A;  4CJL A;  1IG9 A;  3I33 A;  1MA9 B;  3FLC O;  4E1M A;  4YFU A;  1L3T A;  5EU7 A;  2RHK A;  4ILG B;  2HOE A;  3WNF A;  3C7N B;  5AQO A;  1S9G A;  3MMV A;  3VN5 A;  5AJ3 K;  4DTU A;  3SUP A;  4JKE A;  1VQ8 N;  4K8X A;  1ATN A;  5LMU K;  1RBT A;  2Y1I A;  4O4G A;  3M5R A;  1TK5 A;  4JI6 K;  4KB1 A;  4CFB A;  4WQ4 A;  1FJG K;  4IO8 A;  3VMF B;  1ZBU A;  2V52 B;  3V1Q A;  4FJX A;  1NJZ A;  4K41 A;  2F8T A;  4NYF A;  2UUA K;  4DMN A;  4QCL A;  3L2U A;  3VA0 A;  2QA4 N;  3AO1 A;  3NGY A;  4X66 K;  4PY5 A;  3CFO A;  4FLY A;  5AQH A;  2IAJ A;  4Z4H A;  4FOI A;  4ILJ A;  1HYV A;  4CJQ A;  3RMA A;  4YOW A;  1JLF A;  4DV4 K;  4JI4 K;  4DLE A;  4BDP A;  3P1G A;  3VQ4 A;  1QZ6 A;  5GIO A;  4CEE A;  4LH4 A;  2P9I A;  5BRD A;  4JKF A;  5FPD A;  1TYQ A;  3SUN A;  5I3U A;  5CR4 A;  3AO4 A;  4BDY A;  3R9P A;  1TUU A;  1J53 A;  2OCE A;  1NKB A;  2HNY A;  3H45 C;  3MN9 A;  1J54 A;  3LDL A;  1X9J A;  1QSL A;  5LL6 Z;  3MX5 A;  3NF9 A;  3IG1 A;  4MFB A;  1TKD A;  2ZQB A;  3OVN A;  2QWO A;  4B9M A;  4IFV A;  5HP1 A;  4JK8 A;  4Z4G A;  3FFK B;  3U3G A;  3RWU A;  5BRE A;  4FLX A;  1J9A A;  5AQX A;  1K6Y A;  1BOT O;  1X9W A;  1NK7 A;  4IKF A;  3TAB A;  3EO3 A;  2HBJ A;  4OX9 K;  4IDK A;  1NG9 A;  3OHR A;  1GLF O;  4FJK A;  3IMX A;  4JI2 K;  4MO5 A;  4CHN A;  1OH8 A;  1ITG A;  3ZLJ A;  4FVM A;  1BO5 O;  2CGK A;  1QSS A;  4DLG A;  2P1J A;  3U9D A;  2BDP A;  1Z26 A;  3K57 A;  3VA3 A;  4OPA A;  3DJC A;  3CJ9 A;  4I6M B;  1XHZ A;  4JRP A;  3AVK A;  4BRQ A;  1MDU B;  3JXU A;  2UYT A;  4MDA A;  4K0K K;  1EET A;  3AVH A;  4BR0 A;  1ZYQ A;  1T05 A;  2NUB A;  1OVQ A;  1WSH A;  2QWM A;  3EE9 A;  4BRO A;  3TAN A;  2VQE K;  1LW0 A;  5CZ1 A;  3G0Z A;  2UXC K;  3AGK A;  3DRP A;  4IFE A;  4GKK K;  1A5W A;  4DTP A;  2FC0 A;  4PL8 A;  4B8C A;  3CMA N;  2V51 B;  2D4W A;  3VQ9 A;  1WOQ A;  2PAV A;  4CJ4 A;  3A8Y A;  3ATU A;  1N33 K;  1ZBI A;  4O8K A;  3HZ6 A;  4YDU C;  1J5O A;  5EXW A;  1GLB G;  3H08 A;  3HPG A;  3SQ4 A;  1QHT A;  4DSI A;  2E2Q A;  4M3X A;  2HVI A;  4I7F A;  1V4T A;  3UKU A;  4AM7 A;  4CJU A;  3JS6 A;  2P5O A;  4K8Z A;  1QQM A;  4QS8 A;  3ITH A;  2ZWH A;  4X65 K;  3QES A;  1NKE A;  3GG4 A;  3CJC A;  4O8U A;  2A1R A;  4W5O A;  3VPZ A;  1XWL A;  4FJL A;  5JIC A;  4B1V A;  4FK2 A;  3H46 O;  5AFU H;  4H5W A;  4JV5 K;  4CBU A;  2FLO A;  4OGC A;  1FKO A;  3QIP A;  3G10 A;  3S3M A;  3UKU B;  1KQS M;  3G25 A;  1BCM A;  4PA1 A;  4WCE L;  3MX2 A;  1IV0 A;  3LM2 A;  4FLU A;  2VQF K;  4NO7 A;  4BQZ A;  1BCO A;  1JLE A;  4CCH A;  2HMI A;  3D0P A;  4DS5 A;  2YHA A;  4FWL A;  3QNN A;  1NJW A;  1C1B A;  1DLO A;  4CIG A;  4Z4E A;  3CXC M;  2A5X A;  1KVC A;  1ZBF A;  4AHV A;  4CJP A;  1RFQ A;  3TAF A;  4GNI A;  1RTI A;  4GV3 A;  1UAX A;  3J8A A;  3K2P A;  2BH1 A;  4H0V B;  3K5M A;  2KKZ A;  4K25 A;  2CH6 A;  1BGX T;  4FJ7 A;  3O5B A;  4YOR A;  2KQ2 A;  3OW2 M;  4CHZ A;  3I56 N;  2D0P A;  1WUA A;  1WAJ A;  3LDP A;  2NLX A;  5HRS A;  1SKR A;  3G4S N;  2W6K A;  1K9M O;  3SQ2 A;  4GMJ B;  1D9D A;  3MED A;  4H5T A;  4FJ5 A;  4CEA A;  5GAE P;  4DTO A;  5JMV A;  5DK5 A;  1C0U A;  4FJM A;  4KTW A;  2ZM6 K;  3S41 A;  4CI6 A;  2G8V A;  4BC5 A;  4F8R A;  4ELU A;  3ALY A;  2IIR A;  1L3S A;  4CFC A;  2P9P B;  2PYJ A;  5BN9 A;  2PZS A;  2IC3 A;  4BGA A;  3NE6 A;  3GDQ A;  1X3N A;  3T19 A;  4DWI A;  3FZH A;  1X1P A;  3DXK B;  4B9U A;  1VSM A;  3QIC A;  1D9F A;  5AQQ A;  4B1Z A;  3WXJ A;  2HBL A;  2IDO A;  2ETJ A;  4DFP A;  3SMP A;  1BIZ A;  1X9M A;  1ASU A;  4I9L A;  3ZT3 A;  3KD1 E;  3SBG A;  2Q0U A;  3LDQ A;  2P51 A;  4IEI A;  3KK1 A;  1B9F A;  3WT0 A;  3OYN A;  3L2V A;  1NK8 A;  4M3W A;  1SS6 A;  3QBX A;  1XUP O;  4FLT A;  5AQW A;  4CES A;  3QEV A;  4YNQ A;  3SUQ A;  4FWP A;  4DV1 K;  2RKI A;  1Z25 A;  3CPE A;  3VES A;  1VQK N;  5AQF A;  1B92 A;  3NGZ A;  3QLH A;  4B3O A;  1YTA A;  2YJF A;  3SJJ A;  3C94 A;  1ZXO A;  2YI1 A;  2Z1G A;  3NH2 A;  4FWO A;  4Z0U A;  4JYA K;  2HBK A;  3DI6 A;  2BAN A;  3Q7C A;  4DSF A;  4LF5 K;  1REV A;  4KH6 A;  4CFD A;  4DF8 A;  1BDG A;  3MN6 A;  1G99 A;  4W5N A;  4UY8 O;  4DV2 K;  5BRF A;  2FSJ A;  1VQN N;  4DR7 K;  3LDO A;  3CG7 A;  2XY5 A;  4FWS A;  3HSC A;  3OYG A;  3FZL A;  2HVH A;  1ZC6 A;  4PUO A;  2W42 A;  2ATQ A;  2FBV A;  2VWK A;  3FZK A;  4KH4 A;  3J7A P;  1RT2 A;  3GBT A;  3F9M A;  2KZM A;  3O6W A;  4YY3 K;  2YHB A;  3WEE B;  1NGH A;  4A5A A;  1VSF A;  1X3M A;  3OY9 A;  1SZ2 A;  4DUZ K;  3DRS A;  3TTD A;  1MWM A;  4JI1 K;  5FRN A;  2VG7 A;  4FK0 A;  2F9W A;  1JL1 A;  3LWL A;  4G1Q A;  3THW A;  2P5G A;  1M1K O;  1WNS A;  3C6T A;  4EP4 A;  1RT3 A;  1BWF O;  4H5R A;  1VK0 A;  4DB3 A;  4E7J A;  4H0T B;  3HVR A;  3T69 A;  1K8A O;  3ZT1 A;  4FWM A;  4DF4 A;  2LSN A;  2Z1J A;  1JL2 A;  3HOT A;  3BY5 A;  3DAW A;  3DRR A;  5M1Q A;  3AO2 A;  4JAX A;  3RMC A;  1W2B M;  2DFE A;  2JGU A;  3AGR A;  4DSK A;  4A57 A;  4WFA L;  4PL7 A;  1CZB A;  3A5N C;  1SAZ A;  4MLH A;  3LPU A;  3HT3 A;  4F3T A;  2KW4 A;  2YKN A;  4WQ5 A;  1QVF M;  4OLA A;  3EZW A;  2E20 A;  3L2R A;  4RW7 A;  4JRQ A;  1KSP A;  3SNN A;  4CE9 A;  4O0I A;  1QVG M;  3THX A;  3FZM A;  3SMS A;  3M8R A;  5J2Q A;  5CE3 A;  1O13 A;  3FZF A;  3DLH A;  4FZZ A;  4DU1 A;  4CD3 A;  3QEX A;  3S3O A;  1TAQ A;  5FLX O;  1VSL A;  2E6M A;  1VHX A;  4RW8 A;  3WXK A;  4BRP A;  3LAM A;  4KKO A;  2QXL A;  4IO9 L;  2Z1I A;  3AVM A;  3L6Q A;  3LM9 A;  1YIJ N;  4CJE A;  4CIF A;  1YAG A;  4IZ9 A;  4JI3 K;  1ATR A;  1XC3 A;  2F4V K;  3D2F B;  1YHQ N;  4C8O A;  3AO3 A;  1D4X A;  1S22 A;  4KB0 A;  1C0G A;  1UOC A;  4M3R A;  3CHW A;  3TR8 A;  1QQO A;  3D7E O;  3GL1 A;  3OS0 A;  4E1J A;  1EP4 A;  3NF7 A;  5FPM A;  4WF9 L;  4IWV A;  3CJA A;  1IJJ A;  4F4K A;  1LAW A;  2PBD A;  4BR2 A;  3BGR A;  3QB0 A;  4ILH A;  4OKJ A;  2YNF A;  3LAK A;  1R59 O;  2E2N A;  2YJE A;  3K9J A;  1NGC A;  4CF0 A;  1Z6R A;  3TWH A;  3CJB A;  4CJ5 A;  2ITG A;  2YHX A;  1KFS A;  3LWM A;  2IVO A;  2I7P A;  4Z4C A;  3EEQ A;  3MN7 A;  1HKC A;  1Q81 O;  2H3G X;  5C2F A;  2GEM A;  4HCB A;  2FBY A;  1U2V A;  4JLH A;  3M3Z A;  3LL3 A;  4FJJ A;  2HB5 A;  2NRR A;  2F9T A;  3TAP A;  1VQ9 N;  4LD0 A;  4BG8 A;  1HKG A;  3L2W A;  2GTD A;  5JS1 A;  4MDB A;  1YUW A;  2FF3 B;  4WQ4 C;  3TTF A;  3VF4 A;  3ID6 A;  4IOX A;  2RE2 A;  3ENO A;  5IWA K;  3ULD A;  4CBX A;  5KGW A;  2E5L K;  4Z4F A;  4FWR A;  4KRE A;  3ZSR A;  3M8Q A;  1S1U A;  3E66 A;  3CD6 N;  4DG1 A;  2HMP A;  2PYL A;  1RCH A;  5I42 A;  1U2V B;  2ZJP L;  1W97 L;  1N36 K;  1SUQ A;  5FRM A;  1YTU A;  1ASW A;  3K0S A;  4V19 S;  4PKG A;  1B9D A;  4ID1 A;  3AAP A;  4L3Q A;  1NNE A;  4CZL A;  3VQQ A;  4LF6 K;  4AHR A;  1VQL N;  4W5R A;  3LP3 A;  5B8H A;  4G9Z A;  4AQY K;  3TAM A;  4NLB A;  3MXJ A;  1NBW A;  2JLE A;  3U8X A;  3VQ7 A;  4E7H A;  1JXE A;  4FM0 A;  1LCU A;  1NGA A;  3B8A X;  1M90 O;  3WNH A;  2FBX A;  4AF1 A;  4BWM A;  1NGE A;  3ZSW A;  1JLG A;  2QW9 A;  4MQ3 A;  4B9L A;  1N8R O;  4IEE A;  2OPP A;  5KPT A;  4FJN A;  5EX5 A;  3E9L A;  3N4P A;  5C0Y A;  1KAZ A;  4KHS A;  4M45 A;  3KLH A;  5KI6 A;  1GLD G;  1RDU A;  4DTS A;  3IAY A;  4B8A B;  2E1Y A;  3HRG A; 
#chains in the Genus database with same CATH homology
 3NMU A;  4H5N A;  3NVK A;  4NLC A;  4B1W B;  2QWM A;  3EE9 A;  4BRO A;  3TSU A;  3BF3 A;  3WXI A;  4YDU A;  4KH5 A;  3C6A A;  2ASM A;  4B1Y B;  4H5V A;  3AGK A;  3PIO L;  4IFE A;  2WBN A;  3TTC A;  3CPW M;  1LOT B;  3CCL N;  4PL8 A;  3CMA N;  2V51 B;  2D4W A;  3W0L A;  4FWQ A;  1WOQ A;  5M1F A;  2PAV A;  4A62 A;  3A8Y A;  5FPE A;  3ATU A;  3E1Y A;  2P9L A;  3CCU N;  1HX1 A;  4BRA A;  4O8K A;  3FGU A;  3HZ6 A;  4PKH A;  4YDU C;  2FSK A;  1C0F A;  4FWK A;  5EXW A;  3WQU A;  3SBT A;  1GLB G;  4XEI A;  4FPA A;  3O1B A;  2E2Q A;  3CIP A;  1K73 O;  1V4T A;  4A61 A;  1BUP A;  4JK7 A;  4U67 L;  5KQD A;  3CC7 N;  3UKU A;  4AM7 A;  3JS6 A;  3DLL L;  1GLE G;  1QQM A;  4QS8 A;  2ZWH A;  2AA4 A;  4H0X B;  1GLA G;  3RSE B;  2GWK A;  5AQV A;  3ZX0 A;  1ILY A;  4BRN A;  3GG4 A;  3CJC A;  4O8U A;  2FF6 A;  3KK7 A;  4QS9 A;  3VPZ A;  3P4I A;  4DQ8 A;  5AQP A;  3SJH A;  5JIC A;  1T6C A;  3KZB A;  4B1V A;  4MLE A;  5AZJ A;  3H46 O;  5AFU H;  4XH5 A;  5BRH A;  2P9L B;  4H5W A;  3VGL A;  4BRK A;  3I8B A;  4BC2 A;  3CC4 N;  4CBU A;  4JN4 A;  4FO0 A;  2FLO A;  3A0I X;  2W41 A;  3R6M A;  4BR4 A;  4YOX A;  3ZET A;  3H3N O;  2Q0R A;  3UKU B;  1KQS M;  3G25 A;  3VEV A;  3SLC A;  4WCE L;  5HL7 L;  2IVP A;  3MX2 A;  5EOY A;  3PLA A;  1YJW N;  3LM2 A;  3P38 A;  4FOE A;  3WXL A;  1U6Z A;  4NO7 A;  3N4Q A;  4BR7 A;  4FL9 A;  3FE1 A;  4BQZ A;  5EY4 A;  1YF5 L;  1BU6 O;  3K9K A;  4RWT A;  5AZJ B;  3L0Q A;  4JK9 A;  4FWL A;  3G71 N;  4PHT X;  2A40 A;  4A5B A;  5AQS A;  3CXC M;  5AQT A;  4JD2 B;  2A5X A;  3AAQ A;  2GUP A;  5F1X A;  1RFQ A;  5AQY A;  3ZET B;  2CGL A;  4GNI A;  5CHI A;  3E9P A;  4YOY A;  3J8A A;  5AFU A;  3KHY A;  4GV3 A;  2BH1 A;  4H0V B;  4I6M A;  4J8F A;  5FPN A;  2KKZ A;  2YHY A;  2CH6 A;  3OA9 A;  4K25 A;  4BRD A;  3QFP A;  3O5B A;  4YOR A;  3OW2 M;  3CQY A;  1YJ9 N;  3EL2 A;  4IJN A;  3WUH A;  1Q86 O;  4C1N K;  1NJI O;  3I56 N;  2D0P A;  3VF6 A;  2GEL A;  1WUA A;  3LDP A;  2NLX A;  3VEN A;  3C0B A;  2Q31 A;  3BEX A;  3G4S N;  1NGB A;  1K9M O;  1E4G T;  3VEX A;  1VQO N;  1HUX A;  1GLL O;  2NRV A;  5AZI B;  4H5T A;  4WFN L;  4JEP A;  5GAE P;  1Z05 A;  3F5T A;  4BRE A;  5JMV A;  4GV6 A;  2NRH A;  3VEZ A;  1VQ6 N;  4RCH A;  2CGJ A;  2PFU A;  2P9U A;  5AR0 A;  4CZI A;  3S41 A;  4BRF A;  4CI6 A;  5E26 A;  3EKS A;  4BC5 A;  4YOV A;  3C65 A;  2IIR A;  3GE1 A;  1DGK N;  2P9P B;  1NGG A;  3CCM N;  3HM8 A;  5BN9 A;  5AQN A;  1DT9 A;  3VTH A;  4BGA A;  1NGD A;  4EAH D;  5BN8 A;  4CZE A;  3GDQ A;  1X3N A;  2OAN A;  2FXU A;  2Q2R A;  5AQR A;  3FZH A;  2VGM A;  4EFH A;  3DXK B;  4Z94 A;  4FVU A;  3QIC A;  2A41 A;  5AQM A;  5JVH L;  5AQQ A;  4B1Z A;  4YOU A;  2QEX N;  1ATS A;  2DPN A;  3WXJ A;  3RSE A;  2E8A A;  3A5O C;  1VQP N;  2HBL A;  4BR5 A;  3AAR A;  2YX6 A;  2A6A A;  3CCR N;  1YXQ A;  2P9U B;  4BG9 A;  3SMP A;  3BF1 A;  5BPL A;  5BR9 A;  2E88 A;  5JVG L;  1QQN A;  1K8K B;  3H1V X;  1QHA A;  2NZT A;  4JKD A;  4FSV A;  3SBG A;  3J7Z O;  2Q0U A;  3LDQ A;  2OTL N;  3ATV A;  3T7Z A;  4IEI A;  5C2D A;  3WT0 A;  4IXC A;  1SS6 A;  2ZF5 O;  2VGN A;  5BPN A;  1P90 A;  3QBX A;  1XUP O;  4BVO A;  3HI0 A;  2E2O A;  4OPH A;  5AQW A;  1KAY A;  2QWP A;  3OBW A;  4CZF A;  4FWP A;  5AQI A;  4BRM A;  3U9Z A;  4A59 A;  2QI2 A;  3CPE A;  3VES A;  1VQK N;  4CZK A;  5AQF A;  2BTF A;  1KC8 O;  1BA0 A;  5I9E B;  1BG3 A;  2D1K A;  2YJF A;  3CF5 L;  4M7X A;  1HKB A;  2HF4 A;  2IVN A;  3L4I A;  3MCP A;  5EVZ A;  5AQJ A;  2FSN A;  5DM7 L;  1VQ7 N;  2ASO A;  2E2P A;  4GV9 A;  2AP1 A;  1ZXO A;  2Q36 A;  2YI1 A;  4FWO A;  3I55 N;  3CCE N;  2HBK A;  3D6R A;  3Q7C A;  4BRL A;  1NGI A;  2WFB A;  4BRG A;  1YI2 N;  4KH6 A;  4JD2 A;  4JKB A;  1BDG A;  3QML A;  4BRH A;  3MN6 A;  1G99 A;  5C10 A;  5GIN A;  4UY8 O;  2QM1 A;  5BRF A;  2FSJ A;  1VQN N;  3LDO A;  5MLC Q;  4FWS A;  1Q18 A;  5DM6 L;  3HSC A;  1KXP A;  1HPM A;  3H3O B;  3QBW A;  1VAZ A;  3SK3 A;  3EN9 A;  3M1F A;  3MN5 A;  5GAH P;  3FZL A;  1CZA N;  3KVG A;  3G6E N;  3IFR A;  4F9O A;  2NRT A;  3UKR B;  4JKG A;  4XH1 A;  5F0X A;  1ZC6 A;  2GWJ A;  3O9S A;  3FZK A;  4ISE A;  2V7Y A;  3P39 A;  4KH4 A;  3WXM B;  1S72 N;  5GAD P;  3UE5 A;  3GBT A;  3F9M A;  5AQL A;  3ZEU A;  3MWT A;  3O8M A;  3MWP A;  2NRZ A;  3O6W A;  3CJ1 A;  4GVE A;  5AZI A;  1SQK A;  3ENH A;  4JNE A;  3VOV A;  1NGH A;  4HWI A;  3WEE B;  3QDK A;  4A5A A;  5AQZ A;  1X3M A;  2P9N A;  2J4R A;  1SZ2 A;  3EE8 A;  2QWR A;  3TTD A;  1NM1 A;  1Q7Y O;  4AM6 A;  2KLA A;  2NRX A;  5E84 A;  5M1P A;  5AQK A;  3U4L A;  1MWM A;  3CER A;  4WYB A;  1EQY A;  4BRC A;  3IUC A;  2F9W A;  3GOI A;  3CQX A;  5KQ8 A;  2E1Z A;  2YCH A;  2P9P A;  3BP8 A;  2WC9 A;  3A5M C;  4BC4 A;  1QZ5 A;  3DWL A;  4WFB L;  2A42 A;  1V4S A;  3A5L C;  3LDN A;  4JKA A;  4JKG B;  1M1K O;  4C1N I;  2GX9 A;  4IOA L;  4KBO A;  1BWF O;  4H5R A;  5LJW A;  4OO1 J;  1EO1 A;  3ZEU B;  4DB3 A;  3MK6 A;  3DXK A;  2D0O A;  4H0T B;  4BQL A;  3VGK A;  3R3L A;  1DEJ A;  1RDW X;  3O9T A;  3ZX3 A;  3T69 A;  1K8A O;  5ADX H;  1KD1 O;  1RGI A;  2P9N B;  3TPQ A;  4FWM A;  3VER A;  3FR0 A;  3SAG A;  3MCA B;  2F7T A;  2Q97 A;  3HOT A;  4A2A A;  1NGJ A;  4JHD A;  3DAW A;  2HF3 A;  5M1Q A;  1K8K A;  1E4F T;  2JWK A;  4H0Y B;  4JAX A;  3TSQ A;  3AGR A;  1W2B M;  2ASP A;  4H0P A;  2P9I B;  4B1U B;  1TUY A;  4DHY A;  4EIA A;  2CH5 A;  4A57 A;  1OVY A;  4JKC A;  4WFA L;  4PL7 A;  1TYQ B;  3SAH A;  3L4Q A;  3NVM A;  3A5N C;  1SAZ A;  4MLH A;  1J6Z A;  3O08 A;  3VEO A;  4WQ5 A;  1QVF M;  1S3X A;  3EZW A;  2E20 A;  3AY9 A;  4CZG A;  1JJ2 M;  3RVC A;  2BUP A;  2ZJQ L;  1YJN N;  1QVG M;  3FZM A;  4LC9 B;  3HBT A;  4ISG A;  3SMS A;  4B9Q A;  1NLV A;  1P8Z A;  1YIT N;  2P9S A;  5CE3 A;  1O13 A;  4BVP A;  3E9O A;  5KPZ A;  3FZF A;  5C12 A;  5TKW A;  4PKI A;  1MWK A;  4H0O A;  4EHU A;  4CZM A;  4CD3 A;  5KPR A;  2I7N A;  1Y64 A;  4BR9 A;  4JHD B;  4H03 B;  4WQ5 C;  3WXK A;  3O4W A;  4BRP A;  5ADX A;  2QXL A;  2NNW A;  5TKY A;  5M1N A;  1JCF A;  4IJA A;  4IO9 L;  1T6D A;  3C7N A;  1HJO A;  3L6Q A;  3O9U A;  4M7Y A;  4EHT A;  3IKM A;  3LM9 A;  1YIJ N;  5H1S Q;  1YAG A;  4IZ9 A;  1XQS C;  1ATR A;  2EWS A;  4M63 C;  1XC3 A;  2ZGY A;  3QFU A;  2ZJR L;  3D2F B;  3WQT A;  3P31 A;  4BRI A;  1YHQ N;  1GLJ O;  3CC2 N;  1T3V A;  3C6H A;  3VGM A;  2OTJ N;  5JLF A;  1D4X A;  1S22 A;  5F2R A;  1C0G A;  4HTL A;  3SAF A;  3CHW A;  4FWN A;  3O1W A;  1QQO A;  3F2K A;  4IOC L;  2P9S B;  3D7E O;  4U7B A;  1ESV A;  1HLU A;  3GL1 A;  4E1J A;  3O80 A;  5FPM A;  1KAX A;  3UKR A;  3ULE B;  4WF9 L;  3I33 A;  4IDH A;  4IWV A;  1MA9 B;  3FLC O;  3BUZ B;  3CJA A;  4XH4 A;  1IJJ A;  4R79 A;  3CCS N;  2RHK A;  2HOE A;  2PBD A;  3MMV A;  1OKJ A;  2VCP A;  3C7N B;  4ILG B;  5AQO A;  3QB0 A;  4ILH A;  4BR2 A;  4JKE A;  5M1K A;  1VQ8 N;  3WEE A;  3VF2 A;  1R59 O;  1ATN A;  2E2N A;  3VEY A;  2YJE A;  3K9J A;  4CJ7 A;  4DCH A;  1NGC A;  3D2E A;  1Z6R A;  4ISF A;  2QWL A;  3CJB A;  3ZX2 A;  3CME N;  2W40 A;  2WUS A;  3R8E A;  3M5R A;  2YHX A;  3VEW A;  2IVO A;  2I7P A;  4O5F A;  2P9K A;  3MN7 A;  1HKC A;  1Q81 O;  4WQ4 A;  4IO8 A;  4QS7 A;  3VMF B;  2H3G X;  2V52 B;  4BC3 A;  5C2F A;  3CCJ N;  5LY3 A;  1VQM N;  2GEM A;  1IG8 A;  1U2V A;  3M3Z A;  3LL3 A;  4K41 A;  5JLH A;  1GLC G;  2NRR A;  3DXM A;  2F9T A;  5LJV A;  3EKU A;  3UB5 A;  4B1X B;  1VQ9 N;  2QA4 N;  4BG8 A;  2QWN A;  2YHW A;  1HKG A;  2JWL A;  2Q1N A;  2GTD A;  3R1X A;  4DKW A;  3D2E B;  3KWI A;  4MDB A;  4Y0W A;  5AQH A;  1YUW A;  2ITM A;  4FOI A;  2FF3 B;  4WQ4 C;  4ILJ A;  3TTF A;  2NRW A;  3CCQ N;  3CJ7 A;  3TU5 A;  3VF4 A;  4YOW A;  3ID6 A;  1JCG A;  4GY2 B;  2RE2 A;  3ENO A;  3MDQ A;  4IOX A;  2A3Z A;  4CBX A;  4YOT A;  5GAG P;  3Q7B A;  3PIP L;  1QZ6 A;  4FWR A;  2QTD A;  3ENB A;  5GIO A;  3KWG A;  4CBW A;  2P9I A;  2P9K B;  5GIP A;  5BRD A;  1Q82 O;  1H1V A;  4JKF A;  3E66 A;  1TYQ A;  5FPD A;  3CD6 N;  1JCE A;  5CR4 A;  1T44 A;  5AQU A;  4A2B A;  2HMP A;  3CET A;  1TUU A;  1YVN A;  2HBM A;  3R9P A;  1U2V B;  2VYP A;  3H45 C;  3MN9 A;  3IDH A;  1VQ5 N;  2ZJP L;  1W97 L;  4MO4 A;  3LDL A;  3H6E A;  3DXM B;  3W3D A;  2VWB A;  1X9J A;  3MX5 A;  3H1Q A;  4PKG A;  3AAP A;  4L3Q A;  4K43 A;  3M6G A;  4CZL A;  2QWO A;  5C15 A;  1VQ4 N;  4K42 A;  1BA1 A;  2KHO A;  4JK8 A;  1DKG D;  5M1O A;  3FFK B;  1VQL N;  4CZH A;  3CI5 A;  1NWK A;  3O9Q A;  3VTI A;  5B8H A;  5BRE A;  5AQX A;  3ID8 A;  3OBY A;  1BOT O;  4G9Z A;  4NLB A;  1NBW A;  2ZGZ A;  3EO3 A;  4FPB A;  4BGB A;  2HBJ A;  3U8X A;  4CD1 A;  1LCU A;  1NGA A;  3B8A X;  1M90 O;  3OHR A;  1GLF O;  3TSP A;  3ZYY X;  4NB4 A;  3HOS A;  4AF1 A;  3IMX A;  4MO5 A;  1NGE A;  1BO5 O;  2CGK A;  2QW9 A;  3D2F A;  1N8R O;  4IEE A;  5BPM A;  1NMD A;  3U9D A;  1ZBS A;  5ELZ A;  5KPT A;  2V7Z A;  2QWQ A;  3DJC A;  4OPA A;  3CJ9 A;  5EX5 A;  3VET A;  4I6M B;  3E9L A;  3N4P A;  1NGF A;  4BRQ A;  4BY9 C;  5C0Y A;  1MDU B;  1KAZ A;  2HST A;  3JXU A;  2UYT A;  4C23 A;  4MDA A;  4CZJ A;  5AQG A;  4RTF D;  3ULE A;  1GLD G;  3HTV A;  5HOO A;  1RDU A;  4BR0 A;  3O9R A;  2E1Y A;  4JKH A;  3HRG A;  3CCV N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...