3PIPL

Crystal structure of the synergistic antibiotic pair lankamycin and lankacidin in complex with the large ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL 23S RNA
publication title Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 13
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3pipL01
2ZJPL 1VQ6N 1M1KO 5MLCQ 3CCUN 1KD1O 1VQ4N 3CMEN 5GAEP 1VQNN 3CD6N 4U67L 3I55N 5GAGP 2ZJRL 5DM6L 4WFNL 3CC2N 3CC7N 1QVGM 1S72N 5GAHP 3CXCM 1W2BM 4IO9L 4IOCL 1VQON 1VQ5N 3G6EN 1N8RO 1K73O 3G4SN 5GADP 3CMAN 3CF5L 2QEXN 1YIJN 1KC8O 3I56N 3PIPL 1YITN 3CCMN 3CC4N 1QVFM 2OTJN 3CCSN 5JVGL 1YJ9N 1NJIO 3CCVN 1VQLN 1YJNN 1M90O 1VQ8N 1Q86O 1VQ7N 4IOAL 1JJ2M 1YJWN 1VQPN 5JVHL 3CCRN 3CPWM 2OTLN 1Q7YO 3CCLN 1Q81O 3PIOL 4WCEL 1KQSM 1K9MO 1VQMN 5DM7L 3OW2M 3CCQN 1YI2N 1Q82O 1VQ9N 1K8AO 3DLLL 3G71N 1YHQN 1OVYA 4UY8O 3J7ZO 5HL7L 2QA4N 5H1SQ 1VQKN 4WF9L 4WFAL 4WFBL 3CCJN 3CCEN 2ZJQL 1ILYA
chains in the Genus database with same CATH superfamily
2HB5A 1QE1A 3WNFA 3M8QA 1C0GA 4KB0A 1RTJA 1VHXA 1BO5O 5C12A 4DTNA 1WNSA 2DFHA 2CH6A 5AFUH 4JK9A 4DQPA 4MO4A 1P90A 1JL1A 4MO5A 1GLDG 1YVNA 5AQGA 4J8FA 4CHPA 2AA4A 2WTUA 2CH5A 3OYDA 4CK3A 5AQMA 3QEIA 3KHYA 4WQ5A 4ZHRA 2O8CB 4GKJK 4IOCL 1LCUA 4DSIA 1IKYA 3C95A 2HNYA 2UXCK 1HR0K 4DR7K 2UXDK 3CJCA 5EY4A 2QWQA 3GE1A 4CZMA 1RTHA 3KK1A 2Q3SA 5M1OA 4H0YB 3OBYA 3TU5A 1JXBA 3R3LA 3SBTA 2B6AA 3F9MA 1NWKA 2O4IA 3IMXA 4E0DA 1N34K 2CGJA 2NLXA 3S9HA 3SUPA 4CF2A 2A5XA 1E4GT 1JJ2M 2RN2A 1EO1A 3CM5A 1WAJA 4CJRA 3D2FA 5JVHL 1Z25A 3H3NO 4IZ9A 4JKGB 3VQ9A 3AVKA 4JI4K 4F3OA 1Q7YO 4ELTA 4OLAA 1DGKN 4KKOA 1VSFA 3EZWA 3J81O 5HLFA 1VSKA 2P9KB 5AQSA 1IV0A 4K42A 3CJ1A 1NGHA 1K9MO 1NOYA 4LH4A 2G8HA 3OW2M 4CERA 2P5GA 1K6YA 1HKCA 1DTQA 4DTUA 3AVGA 3G25A 3U3YA 1TUUA 3LDSA 4E7KA 3L2VA 4CI6A 2FF3B 1BUPA 3TAMA 4DV7K 3N4QA 2LSNA 3BZCA 2VQFK 1CZBA 3UB5A 1DTTA 1VQ6N 2X6SA 1VQ4N 1EP4A 3SYZA 4DV0K 4DU3A 1VQNN 4BRIA 3OYNA 2E5LK 3I55N 4JK8A 4JI5K 1EQYA 3V9SA 5AJ3K 2AJQA 4JI2K 4B9MA 1CXQA 4BDZA 3WXJA 3KLGA 2OPQA 2VGNA 5C10A 1W97L 3U6FA 1D5AA 1VQ5N 3Q7CA 2IGIA 1SKWA 2QEXN 3DLBA 4FLXA 3HYFA 1IG9A 3VQEA 3VTHA 1BU6O 2GWJA 1S1TA 3IFRA 3HO1A 1L3VA 2KFNA 1T6CA 3KLHA 3LAMA 5FPDA 4OO1J 3ULDA 3BY5A 3PUFA 1HNXK 4C8OA 4DV1K 4RG8A 5EU7A 3HPHA 4IWVA 4FXDA 3R6MA 3DLKA 4CZJA 4BWMA 4IFVA 2HVHA 1L3SA 3IG1A 5AQXA 2JLEA 3AA5X 2FC0A 2OA8A 5FRMA 5IT9O 4CZFA 2W42A 1NOZA 5SWMA 2KW4A 4DTOA 3AVLA 4RW7A 4NXMK 1JLAA 1HQEA 2E2QA 4FJLA 3D0PA 5JLFA 3DLEA 4O5BA 4CBUA 1WSFA 4CZHA 2O8BA 4BG8A 3GBTA 3VOVA 1DLOA 4B08A 2OPSA 4ID5A 2WONA 4BGAA 4CJ7A 3GG4A 3O3HA 3ENHA 3LWMA 1HX1A 3VQ8A 1NK9A 1TKXA 3BDPA 3CCJN 4DSLA 5I3UA 4HHTA 3H46O 1OH5A 3CJBA 4XEIA 4W5OA 3C94A 3TAFA 4LF9K 3I0SA 4A5AA 4IDHA 2UU9K 3IS9A 5AQWA 3OYBA 3NFAA 1N6QA 3RRGA 3HM8A 5CZ2A 1BCOA 2P9LA 1XQSC 2GX9A 3V9ZA 4LH5A 4Y1CA 2P9LB 3FGUA 3SQ2A 2YHXA 3ZT2A 2BANA 5KPZA 4KHUA 2G8KA 3AY9A 1WBDA 3HJFA 2P9PB 3MN7A 1EKEA 4GMJB 4IEIA 4B1WB 1NK4A 4N76A 3V9WA 1HYSA 1QHAA 3VETA 1U48A 4DLEA 3E9PA 4IFEA 1SQKA 3ENOA 3D45A 4XH5A 1NGIA 4J2AA 3CJ7A 4WE1A 3CCMN 1S22A 4A2AA 1DEJA 1XMOK 4ILHA 4EHTA 4I9LA 2HBKA 1HNVA 4FOEA 3ZX0A 4KV8A 3BUZB 4CHZA 1NJZA 3U8XA 4W5NA 1YVUA 4CEZA 2FBTA 4JD2A 4IG0A 4DB3A 4O44A 3CCRN 3QEVA 1S5JA 1HNIA 3OYKA 3KLEA 1JKHA 1ZYQA 4K0KK 4H5VA 2QWLA 4XH1A 2E6MA 5EVZA 1HMVA 5CR4A 4JKFA 1VRUA 2DFEA 1YI2N 1C0UA 4YHHK 2F96A 3VA3A 3A8YA 1QSYA 3QFUA 4W5RA 4OLBA 1JLBA 4OGCA 2OZMA 3SPZA 3HVTA 3M5RA 3NCIA 2X78A 3CCEN 5AZIB 3EKSA 3HM9A 2YHWA 3RR8A 1X9WA 1VSMA 5AZJA 4E7HA 4FK2A 2KQ2A 2UXBK 4M63C 5B8HA 4BRAA 4C8KA 2UUCK 3SK3A 4CJVA 2A1RA 2DFFA 3S41A 3O4NA 5M1NA 3MN5A 4FJ5A 3CC2N 5AQOA 4DF4A 4B3MK 4F8RA 4DFJA 4RTFD 4C1NK 4FO0A 3MX2A 3OS0A 2FLOA 5F1XA 2ZE2A 3D7EO 5T7BA 2O8EB 3KD5E 1ATNA 3ISNC 4BR0A 4Q0BA 2HHQA 3QDKA 4JKEA 5BRFA 1BQNA 3J7YP 3KK7A 2F4VK 2Z1JA 1TAUA 1RDBA 4PUOA 1NGDA 1E4FT 5AQQA 2D0OA 5GIOA 3C7NA 4DFKA 4H5RA 4NCAA 3SBGA 5LY3A 3L6QA 4HUEA 1IH7A 3K9KA 3VQDA 4CJKA 3IRXA 3VF4A 3DWLA 4DSKA 1H1VA 4B1UB 2J4RA 2EWSA 4N56A 4B1XB 4JHDA 2P51A 3WEEA 1NKEA 3PSFA 2VGMA 1UWBA 3FZFA 3WXIA 3SUQA 1LWCA 3WEEB 3VGLA 1T8EA 2A40A 1NK5A 3CFOA 4DV4K 1J5OA 4FJ9A 4HCCA 4FVMA 4Z4GA 3TAGA 1JLQA 1Q8IA 4BDYA 4G9ZA 3RTVA 4N41A 3SQ1A 4A57A 3NHGA 3ZX3A 4ZTFA 4DQQA 1KVAA 2PYJA 3EKUA 5KQ8A 4DTXA 3K9JA 1X3NA 3M8PA 1S1UA 3O9RA 4NLCA 2YHYA 3K59A 2IVOA 5EOYA 1WSEA 4EP4A 2NRVA 4ISEA 3V1QA 1A5WA 3CETA 1JXEA 5AQUA 5ADXH 3K2PA 3WNHA 4WFAL 1U2VA 3L2UA 4ILJA 5E41A 3NH2A 4EZ6A 4NXNK 5FPMA 3QO9A 1RGIA 5I9EB 5BN9A 2YKNA 1U2VB 5AQPA 1KLNA 1ZBFA 4A61A 1IBKK 2ZD1A 3AVBA 3RR7A 4C8NA 3O9UA 3CM6A 5KPTA 4JV5K 3EY1A 3MEGA 4O8KA 4NCBA 1TGOA 4JKHA 4WFNL 2PFUA 1BQMA 1RT6A 3WXKA 2QK9A 3AVFA 4YOUA 4BRPA 4DFMA 3DLGA 2KHOA 4DQ8A 5C25A 4JS4A 2ASOA 4DR4K 4LC9B 1RDWX 4CEOA 3QNNA 2HHWA 2WBNA 2YX6A 2WC9A 2QWOA 3NF6A 1GLBG 4CFDA 1GLLO 4AM7A 1KC8O 1S3XA 4H4MA 3F73A 3DXKB 3LP3A 2KKZA 3QFPA 2OTJN 3L3UA 5CHIA 1SV5A 1JL2A 3THXA 2OCEA 1T03A 4KRFA 4CJWA 3KKRA 1OVQA 3NF7A 1RBTA 2CGKA 3VTIA 4I6MA 4JNEA 1YAGA 4W5QA 5M1KA 4IG3A 4JN4A 4Y0WA 4ELVA 4FCYA 4A2BA 1ASWA 3DMJA 1NM1A 5FROA 3NE6A 2O4GA 2Q1NA 3CQ8A 3PIOL 4LD0A 2F7TA 2A6AA 1FJGK 4I9QA 4LY7A 2P9UB 4DU1A 3NGYA 2ASMA 3SUOA 2F8TA 1QTMA 3VEOA 3ALYA 4DSEA 3E1YA 3KK3A 3CQXA 1B92A 1QQOA 4U7BA 3HXMA 1KAXA 4Z94A 4KAZA 4H8KA 1OVYA 3H3OB 1OH6A 1NGBA 2W6LA 5CYQA 1GLCG 1EETA 4CJSA 3K5OA 4DQSA 2B4JA 3D6RA 3DXMB 4DG1A 5HBMA 3KD1E 4WYBA 1VSLA 3BGRA 2NRZA 3VGKA 3NH0A 4BRCA 4CJTA 5BPNA 2P9IA 3E01A 4B9VA 2FBXA 4FL9A 4CEFA 3IKMA 1KAYA 4CW7B 4H0VB 1NK8A 5AQJA 1W7AA 3C6AA 4CBWA 4KHPK 1KVBA 1ZBSA 4LF7K 3DOKA 3M1FA 4L3QA 3LWLA 3LP0A 3VQ7A 2NRWA 4ELUA 3TAQA 5HRRA 2NNWA 4O8UA 1N36K 4JRQA 3CHWA 3V4IA 4M3UA 3TSQA 4CIEA 1JLGA 2QI2A 4CGIA 2E88A 4BACA 2HSTA 1X9SA 3J7AP 5BREA 4LFBK 1R0AA 1C0TA 1TKZA 1ZBHA 4CHYA 3PIPL 3RRHA 4H5NA 4DV6K 4JI6K 4CGDA 5F0XA 3SV4A 3LZIA 3ID6A 5KTQA 3M8RA 5LJWA 4DTRA 4KTQA 2O8CA 3QIOA 4Z4HA 3KVGA 4B3OA 3F5TA 3KJVA 4DU4A 4AHVA 3V6DA 3P38A 2E1YA 3RMAA 2AP1A 2HF4A 3OYLA 1FXXA 4FJMA 1T44A 3QBXA 4YY3K 2D5RA 3KLIA 4PY5A 4BE1A 3THVA 1RT3A 4E7JA 4CD1A 1X1PA 3VESA 3P39A 2D0BA 3CI5A 1RT4A 3MAQA 3LDQA 4HTUA 1KLMA 3CCQN 1J54A 2G8VA 3W3DA 5BN8A 3W0LA 2UUAK 3O4QA 4Z4EA 4EZ9A 5J1EA 4K8XA 2VG6A 4JKGA 1T6DA 5E84A 1WOQA 3J7ZO 2Y1IA 3TTCA 1ASUA 4RCHA 1HNZK 2G8UA 2D0PA 3RSEB 2P9KA 3J80O 2QM1A 2W41A 3KTQA 4WFBL 5GINA 2HBLA 4KBOA 2ZJQL 4JKAA 1SUQA 4YOXA 1ZBIA 3SLCA 2FBYA 2HMIA 3BP8A 2QWMA 4OJRA 1YTUA 2HHVA 4PKGA 4JI3K 3MCAB 5LMUK 3TAPA 4PA1A 3K5NA 4BRFA 3B6OA 1TVRA 1D8YA 1SZ2A 4IEEA 1W2BM 2HBJA 1BISA 2GBZA 2HHHK 2E4LA 5GADP 5AQFA 2RF2A 4R79A 1SAZA 4FJ7A 2PBDA 2E20A 3BF3A 1NGFA 4CESA 3WUHA 1GOCA 4CHNA 4R5PA 4CD3A 1QZ6A 2KTQA 3CCSN 5JVGL 1FKOA 3LALA 3U3GA 1REVA 2IIRA 4HTLA 3O3GA 1FKPA 1RTIA 2YI1A 2VWJA 4FWRA 3SQ4A 1HUXA 1UA0A 3MMVA 1KAZA 3AVNA 3WNEA 1UOCA 1XUPO 3B6PA 3THWB 4CF1A 1D4XA 5AR0A 4B9NA 1XNQK 2H3GX 2VG7A 1NGCA 3KIOA 1BA0A 5E26A 4GY2B 1DKGD 1I39A 1XWLA 1HPMA 3P5JA 3FLCO 2IVPA 1WSGA 2F9TA 4KH5A 3AA3A 3LM9A 3MXJA 1KQSM 4M3YA 4IBNA 1VQMN 4OPHA 4X64K 1I3AA 1RBUA 3ZSOA 4F4KA 4FK0A 1CLQA 3MECA 3OYFA 3ZSRA 2VYPA 1MA9B 2VWBA 4BC2A 1TV6A 2RHKA 4RW4A 3V81A 1SL1A 5HL7L 1MWKA 2E6LA 5H1SQ 1Z6RA 3JS6A 4FZXC 4DF8A 4M3WA 4B1ZA 2V7YA 5C24A 3AV9A 4FWOA 2VQEK 4DSFA 5AFUA 3E9LA 2ZWHA 4JKDA 3CIPA 3TABA 4C8LA 2P9NB 1NK0A 4B1VA 5CY4A 3JAMO 3UKUA 3A5LC 2IS3A 3O9SA 2F9WA 2Q36A 3UIQA 5C2DA 1TKDA 3UKUB 3AA4A 1C1CA 5GAGP 4NB4A 1NU0A 3AVAA 3I8BA 2BUPA 3R9PA 3FZLA 4M45A 3MXIA 4WQ4C 3ZSYA 4YOVA 4YDUC 4DCHA 3T1AA 4DR3K 5AQZA 5J2QA 2YJFA 4JRPA 4JI7K 3DYAA 1WAFA 4CZEA 4KREA 3RWUA 3SAFA 5FDLA 2V52B 3P4IA 3EEQA 4CJ4A 2WFBA 4MQ3A 2OYQA 1C0MA 2NRTA 3I33A 3VQ6A 2ASPA 3O80A 4PKIA 3I56N 4BGBA 1ZC6A 5KGWA 1YT3A 2Q2RA 2HF3A 3L8BA 3PX4A 3SQ0A 3IUCA 4LF4K 1TL1A 4B1YB 1NJIO 3SCXA 4LSLA 2P9PA 3NF8A 3RMBA 4BVOA 5TKWA 3TAEA 3F9KA 4FJJA 4CJLA 4FJIA 1NGGA 3FR0A 2Z1IA 4B3RK 3BF1A 4X62K 3RMCA 3QNOA 4RW6A 1SKSA 4EAHD 3LPUA 4FLWA 3T1HK 4AF1A 4NLBA 4GV6A 1XNRK 3HP6A 5DMRA 1Q81O 3MN9A 5J2PA 2JWLA 3HP9A 3HK2A 3TWHA 4CZLA 3DLLL 3P83D 1RT5A 4DFPA 3ZT3A 1WLJA 2ZF5O 4EP5A 3OBWA 5HRNA 2GTDA 4TSXA 4WQ4A 4FLZA 1BIUA 1BIZA 1Y97A 2HHUA 4GVMA 4YDUA 5HP1A 3JSMA 4BRGA 3DOLA 4IXCA 2E1ZA 4FLVA 3CERA 5JICA 3VQ4A 2ZJPL 4DQRA 4BRQA 4HWIA 5JLHA 3FFKB 4JI1K 4CGJA 4FWMA 4CEAA 2XY5A 1OKJA 3P1GA 5F2RA 4K43A 1KD1O 3E66A 3OTOK 3IAYA 4AH9A 4BR7A 1JCFA 5AZIA 4FW1A 4CF8A 4CGFA 2YV0X 4DV2K 3MWTA 1K73O 2A3ZA 4FPAA 4GKKK 2R7YA 3EN9A 2Q0RA 4H5WA 4E1JA 4KH6A 4H0XB 4I2QA 3MEDA 4G1QA 1RDCA 3H6EA 5M1PA 3HOTA 3OHRA 3THYA 3ZX2A 3M6GA 3THYB 3O9QA 3AGKA 4BE0A 3CCVN 4I7FA 1M90O 4BR5A 4LF5K 1VQ7N 2O8EA 3HTVA 3NDKA 2RE2A 3VENA 4B9LA 3QINA 5K14A 3CFRA 3ATVA 2Z1HA 1KXPA 3K5LA 2IVNA 4CFCA 1C1BA 1TL3A 3VQCA 2I5JA 3AO4A 5CE3A 1RBRA 4KTZA 1Q82O 3L2QA 1J9AA 3VEZA 4E1MA 3OS1A 1WBBA 1IJJA 4YFUA 4IJNA 1WSJA 4Q5VA 4UY8O 3ID8A 3OYCA 2A42A 5BR8K 4BE2A 4DLGA 4IKFA 3K57A 3L4QA 4MLHA 3PY8A 4B3SK 4LFCK 4ID1A 4BC5A 4FW2A 4H5TA 2Z1GA 2E2PA 1VAZA 4FJNA 5DK5A 1MU2A 3HSCA 3UKRB 4M41A 5MLCQ 5FRNA 3T19A 1KRPA 3QERA 4ZTJA 4DV3K 4U67L 1SL0A 4LF6K 3AAQA 2YNHA 4DTJA 3PX6A 4CJPA 3A5MC 1WSIA 3A0IX 3ATUA 3ZSVA 4Z4CA 3MWPA 1GLJO 2WOMA 1RILA 1E3MA 3H08A 2D1KA 4BRKA 1XHXA 4MFBA 4E1NA 3ZT1A 5J2NA 2FXUA 1X3MA 3C6TA 3PO5A 4IFYA 1CXUA 3C6HA 4AQYK 3MX5A 4O0IA 1NJWA 4PL8A 1XC3A 4H0PA 3HL8A 1BCMA 3E9OA 4OKEA 3QBWA 3VF2A 2VG5A 3EE9A 3AO5A 1LWFA 4FJ8A 1FK9A 4CJ3A 5BPMA 5HROA 4QS8A 3OYMA 2O8DB 3L3VA 1WUAA 3HZ6A 4JS5A 1QVFM 3SJJA 1IKXA 3QMLA 2RKIA 1YXQA 1V4TA 4JLHA 2QWRA 5C2FA 4PWDA 4W5TA 4CGGA 4KHWA 2P1JA 4O5FA 5C15A 4CHQA 4X66K 5KRTA 1Q9XA 4QAGA 4BQZA 4AHRA 2P9SB 4JI0K 3DXKA 3SI6A 4XIUA 1NK6A 4FM0A 1S1VA 3HVRA 1XMQK 3OJUA 5C0YA 1IBMK 2ITMA 3AAPA 1F21A 2QTDA 3TSUA 4LF8K 4FWPA 3QB0A 4OKKA 4CFBA 3ASMA 3VEVA 5AQHA 3V9UA 1T7PA 3OY9A 3T69A 1QHTA 5KGXA 3WXLA 4RWTA 4C23A 1EWRA 3KK2A 3NF9A 1WSHA 3LDPA 2RPIA 3T7ZA 2KZMA 2G8WA 3VQPA 4CE9A 4L8RB 5IWAK 4X65K 1LW2A 3QESA 3SZ2A 4KHNA 1GLFO 2P9UA 3KKSA 3OS2A 1MDUB 3OYJA 4H03B 4CK2A 4BR9A 1ILYA 1NGJA 1V4SA 5CZ1A 3V1OA 2DY4A 3SAGA 4OPJA 4FWSA 4M3RA 2EX3A 3TI0A 4FJXA 2FBVA 3DXMA 4CBXA 3LZJA 1HKGA 3EZ5A 3OJSA 1HJOA 1BDGA 1BI4B 3ZETB 1HLUA 3ZCMA 1JCEA 1QVGM 4PL7A 1HQUA 1S72N 3AARA 4KHYA 3QLHA 3CXCM 4FJGA 3AVCA 4B8AB 3QEXA 2JWKA 4C8MA 1RBVA 4FYDA 3OYAA 2HOEA 4BQLA 3IDHA 4YORA 4PKHA 3AVHA 3VERA 4AM6A 2IOCA 4O0JA 1ASVA 3BEXA 3L4IA 3ZSZA 4JAXA 4CJFA 5SZTA 2Q97A 5EXWA 1JLFA 3FE1A 5J2MA 3HOSA 4OX9K 1K8KB 4DTSA 1VQLN 1UA1A 4DR6K 5LL6Z 3OYIA 1S1WA 2FF6A 3LM2A 2YNIA 4QS7A 3O1WA 2ATQA 2WUSA 4M7XA 1GLEG 4DS5A 1VQPN 4CEBA 4I2PA 2P5OA 3FZKA 3JXUA 3QICA 5KRSA 4FLYA 2FSKA 2JGUA 2V7ZA 4DUYK 3D2EB 4BRLA 5AQVA 4CVNE 1CZAN 1QS4A 3V9XA 3H1VX 4FLTA 5ADXA 3EO3A 4CF0A 1W0HA 1KCFA 4B9UA 3V1RA 3Q7BA 1YHQN 1RFQA 3CJ9A 1X9MA 2HMPA 2E2NA 4DTMA 4KI6A 1RBSA 5JMVA 2QA4N 1L5UA 4CJUA 4WF9L 2NRRA 4NYFA 3A5NC 1TYQA 4IJAA 3L2RA 4B8CA 3QETA 1TYQB 1YUWA 1YTAA 4DTPA 1T3VA 1R59O 4MDAA 1BA1A 4NO7A 1U04A 3CD6N 3VQAA 4EHUA 2YKMA 3RSEA 3C6UA 3N4PA 1NNEA 3CG7A 2OPRA 4YNQA 4ISFA 4PHTX 5AQIA 4YOYA 4FVUA 4BVPA 4NCGA 4KPYA 4GW6A 4LSNA 4BRMA 3ZLJA 3VN5A 3I8DA 1L3UA 3O3FA 5GAHP 3AVMA 5FPNA 4OGEA 4H0TB 3DM2A 2ETJA 1EXQA 2HNDA 1YIJN 1LW0A 2HVIA 1VSEA 3LAKA 3ZSXA 3WNGA 2ZGYA 1KFDA 3D2FB 1N33K 4DHYA 4GV3A 4MDBA 1TK0A 1ATRA 3CC4N 1RT7A 2A1SA 3LDLA 1BG3A 2EHGA 4KHQA 3L2WA 4CEQA 2YHAA 3ZT4A 3CQYA 1VSHA 3P31A 3K58A 2A41A 3GOIA 2D0AA 1JLEA 1SS6A 2XY6A 1S9EA 1O1WA 4EIAA 3CPWM 3CCLN 3TARA 4BY9C 4CK1A 3PSIA 4CFAA 1J53A 3S3MA 4NYNA 3QIPA 4K25A 3JYTA 2QKBA 4FWQA 3THWA 1VK0A 1QSSA 2QXLA 4GNIA 1JCGA 3TTFA 1Q9YA 5BRHA 3G71N 2G8IA 3BZKA 5KI6A 1NLVA 2B5JA 3EYZA 4M3TA 1KSPA 5HOOA 5JS1A 1VQKN 3HT3A 3U9ZA 4BRNA 2CGLA 4AHTA 1ZBUA 4UQGA 4YOTA 1W9HA 4HVJA 3AO2A 3PO4A 3M3ZA 1OH8A 5CYMA 4BWJA 4AHCA 2XO7A 1GOAA 4A62A 4A5BA 2ZJRL 5DM6L 2DPNA 3OA9A 5FLXO 2QKKA 1SKRA 4CCHA 2YHBA 4FM2A 1S6QA 4K8ZA 5AQLA 2HHTA 5AQKA 2P9NA 4F2RA 1I94K 3ZSWA 4J2BA 3GDQA 4CEDA 3GL1A 3VQ5A 1RCHA 4O55A 4KI4A 3CPEA 1C0FA 4JKBA 4DQIA 2OANA 2NRHA 4KFBA 3TSPA 1BWFO 3AA2A 4J2EA 2NRXA 4IDKA 4O4GA 4IOXA 3AO3A 4CEEA 2XHBA 4GV9A 4PQUA 2X74A 1RTDA 3H1QA 4RW9A 3LPTA 1J5EK 1Q86O 1D9FA 1RDAA 1U45A 3C0BA 1VSDA 1YJWN 2O8BB 4OPKA 3G10A 3PX0A 3FZMA 3KWIA 4B3TK 4M3ZA 4DV5K 3DLRA 4FJHA 2DTUA 3DRPA 1NG9A 3FFIA 2V51B 2QWPA 3S3NA 3SUNA 1K8AO 1VQ9N 3C65A 3DAWA 3SMSA 2BE2A 1QZ5A 1Y64A 5BR9A 3SPYA 3LDNA 4IO8A 1T05A 4KTWA 1QQMA 3NH1A 3OYEA 1XI1A 1GLAG 1VSIA 1A5VA 3A5OC 1TAQA 4F2SA 4DKWA 3MN6A 3ITHA 1QQNA 1ATSA 3EE8A 3LL3A 3U4LA 1HNWK 5KPRA 1SL2A 5FPEA 3MDQA 3PV8A 1ITGA 1O13A 3VQBA 1TK5A 2GUPA 4DR2K 3LDOA 2QXFA 3VEYA 1RT2A 3OYHA 3CMEN 1TKTA 4EFHA 5GAEP 3KLFA 1GOBA 2HBMA 4QS9A 3HPGA 2PAVA 1BGXT 3TR8A 1XHZA 1EX4A 2GUIA 3SNNA 3WQTA 2F8SA 4GVEA 3ZEUA 1HRHA 3CC7N 4E89A 4DR1K 1UAXA 3ZEUB 4B9SA 2Q31A 2VCPA 4FJKA 3H45C 1ESVA 3OYGA 3HSTB 4KHSA 1VQON 1KFSA 1B9DA 3G6EN 1S6PA 3G4SN 3CF5L 4BDPA 1LAWA 4F9OA 3O4WA 2YNGA 3NGZA 4CJ5A 4JD2B 4OVLA 2W40A 3NAEA 3K0SA 5LMNK 5HRSA 4BR2A 3SV3A 4H4OA 3QEPA 1QSLA 3LANA 4FPBA 4AILC 4H0OA 3K5MA 3O8MA 4K41A 2BDPA 3NMUA 3I0RA 5M1FA 2I7PA 1VQ8N 4KH4A 3RMDA 2X6NA 4Z0UA 1VSJA 4JI8K 4JEPA 1VRTA 3UE5A 1U6ZA 3ENBA 2OZSA 2KFZA 4XH4A 1S9GA 3NVKA 3AVIA 4CHOA 4FWNA 2GELA 4N47A 1WN7A 1U4BA 4C1NI 1RT1A 3VQQA 5KQDA 1HYVA 1S1XA 1HYZA 3PLAA 4ICLA 4HCBA 2I7NA 1NK7A 5AZJB 1NBWA 4E7LA 1FW6A 3F2KA 3OVNA 3DRSA 2BGGA 2ZGZA 2QWNA 2ITGA 1IKVA 3DI6A 4FZZA 2D4WA 3HPOA 3MXMA 1RDUA 2KZZA 1BHLA 3VA0A 1Q18A 3VGMA 5I42A 1ZXOA 3EL2A 2BH1A 4JKCA 5GIPA 4CIFA 5BRDA 4FOIA 5EX5A 4E19A 3R8EA 1DT9A 1B9FA 3TANA 4OKJA 4CF9A 3WXMB 4DUZK 3QEWA 4CIGA 3R1XA 3FZHA 3KWGA 3J8AA 1NKCA 1A5XA 2PZSA 3CFPA 3SMPA 5BPLA 3L0QA 4F3TA 3C7NB 4E3SA 3UKRA 1D9DA 1HJRA 3G0ZA 1N8RO 1IG8A 3T3FA 2Y1JA 3VEXA 4BROA 4DMNA 1N32K 3SJHA 4DWIA 1HPZA 1NMNA 2QW9A 4MLEA 4BC4A 4Z4FA 3NGIA 4DSJA 1NGEA 1YITN 3ZSQA 5JS2A 5TKYA 4JHDB 4B9QA 1IBLK 1KVCA 2NZTA 4AHSA 1YF5L 2YJEA 1YJ9N 3VF6A 1IO2A 2ZM6K 4CGHA 1LAVA 1YJNN 2FSJA 1NGAA 4IOAL 2G8FA 4HUFA 4FM1A 3WT0A 3S3OA 2IAJA 2Q0UA 3HBTA 3O6WA 4BR4A 4FK4A 4CJQA 3HI0A 1ZBLA 2YCHA 3DJCA 2O8DA 3T1YK 1MWMA 1P8ZA 5AQNA 2E2OA 1Z05A 4V19S 4QOZB 5D3GA 3WQUA 5C42A 2HHSA 5DM7L 3O5BA 2UUBK 4M7YA 1IKWA 5AQRA 1BL3A 2P9SA 3TTDA 1OH7A 3NVMA 4CZIA 3HRGA 3VMFB 1KTQA 1C1AA 4JK7A 2YNFA 4Y1DA 4BRDA 5A2QO 5AQTA 4DR5K 2UYTA 3A2FA 1NJXA 4YOWA 1NJYA 3B8AX 1TUYA 1RDDA 4ISGA 2IC3A 4KO0A 3SAHA 2W6KA 4FZYA 4CZGA 1M1KO 2O8FA 2FSNA 1NMDA 3CCUN 2XY8A 3MEEA 3VPZA 4BREA 1X9JA 2O8FB 3CYMA 3LP1A 2HW3A 2GEMA 4FWLA 3ZYYX 4OPAA 3O08A 3ZT0A 4FWKA 1L3TA 1NKBA 3TPQA 1U49A 2HHXA 2OPPA 4RW8A 1XC9A 3MCPA 1C6VA 3THXB 2NUBA 1N5YA 1Z26A 4IO9L 3U9DA 3DLHA 4I6MB 4CZKA 3CMAN 4E7IA 2KLAA 4N5SA 1U47A 3O9TA 1HKBA 1RNHA 1BI4A 3ZETA 1LV5A 3ULEA 3MK6A 3NBPA 4ILGB 5ELZA 3ULEB 4FLUA 4Z4IA 4CECA 2PY5A 5HRPA 2XRIA 1WB9A 2VWKA 4AHUA 4HUGA 3CJAA 3AVJA 1G15A 2PYLA 1QQCA 4WQ5C 3KZBA 4CJEA 2ZQBA 1BOTO 3RVCA 4B9TA 3AO1A 1G99A 2OTLN 5LJVA 4JYAK 1LOTB 1TK8A 2GV9A 4WCEL 1CZ9A 1JLCA 4DS4A 1K8KA 3AGRA 5M1QA 2GWKA 3M8SA 3DRRA 4J2DA 2HNZA 4M3XA 2IDOA 2P9IB 4BC3A 1LWEA 3LP2A 2D0CA 4BRHA 4KB1A 3VEWA 4QCLA 1J6ZA 2XY7A 4M42A 2E8AA 4FSVA 3D2EA 1EWQA 3O1BA 4A59A 4LFAK 4BG9A 2BTFA 5AQYA
chains in the Genus database with same CATH topology
2ZJPL 4YOTA 5AQPA 4HWIA 4BRQA 3FFKB 5JLHA 4FWMA 1C0GA 1OKJA 4A61A 3M3ZA 5F2RA 4K43A 1BO5O 1KD1O 3E66A 5C12A 3O9UA 2CH6A 5AFUH 4JK9A 5KPTA 4MO4A 4A62A 1P90A 4A5BA 4MO5A 4BR7A 1GLDG 1YVNA 5DM6L 2ZJRL 1JCFA 4O8KA 5AQGA 4J8FA 2DPNA 3OA9A 4JKHA 2AA4A 4WFNL 2PFUA 5AZIA 2CH5A 3WXKA 4YOUA 5AQMA 5AQLA 4BRPA 3KHYA 5AQKA 2P9NA 2KHOA 4DQ8A 4WQ5A 3GDQA 2ASOA 4LC9B 4IOCL 1RDWX 3GL1A 2WBNA 1LCUA 2YX6A 3MWTA 1K73O 2WC9A 2QWOA 2A3ZA 4FPAA 1GLBG 1GLLO 3EN9A 3CJCA 1C0FA 2Q0RA 3CPEA 2QWQA 5EY4A 4H5WA 3GE1A 4JKBA 4KH6A 4E1JA 1S3XA 4CZMA 1KC8O 2OANA 2NRHA 4H0XB 5M1OA 3TSPA 3DXKB 2KKZA 3OBYA 1BWFO 3H6EA 4H0YB 3TU5A 3QFPA 3R3LA 2NRXA 3SBTA 2OTJN 5M1PA 5CHIA 3OHRA 3F9MA 3HOTA 3ZX2A 1NWKA 4IOXA 3M6GA 3IMXA 4GV9A 3O9QA 3AGKA 3H1QA 2CGKA 3VTIA 3CCVN 2CGJA 2NLXA 4I6MA 4JNEA 4BR5A 1M90O 1YAGA 1VQ7N 1Q86O 3HTVA 2A5XA 5M1KA 1E4GT 2RE2A 3VENA 1JJ2M 3C0BA 1EO1A 4JN4A 4Y0WA 1YJWN 4A2BA 3D2FA 3ATVA 5JVHL 1KXPA 1NM1A 3H3NO 4IZ9A 4JKGB 1Q7YO 2Q1NA 2IVNA 3FZMA 3KWIA 1DGKN 3EZWA 3PIOL 2F7TA 2A6AA 2P9KB 5AQSA 4K42A 5CE3A 2P9UB 3CJ1A 1NGHA 1K9MO 2ASMA 3OW2M 2V51B 2QWPA 3VEOA 1Q82O 1K8AO 1VQ9N 3C65A 3DAWA 3E1YA 3VEZA 3CQXA 3SMSA 1QQOA 4U7BA 1QZ5A 1Y64A 1KAXA 1HKCA 5BR9A 3LDNA 1IJJA 4IO8A 4Z94A 4IJNA 1QQMA 1OVYA 3H3OB 1NGBA 4UY8O 1GLAG 3G25A 3ID8A 1GLCG 2A42A 3A5OC 3L4QA 4MLHA 4DKWA 1TUUA 3D6RA 3MN6A 3DXMB 4CI6A 4BC5A 2FF3B 1BUPA 4WYBA 1QQNA 4H5TA 1ATSA 3EE8A 3LL3A 3U4LA 3N4QA 5KPRA 2NRZA 3VGKA 5FPEA 2E2PA 3MDQA 1VAZA 3UB5A 1VQ6N 4BRCA 3HSCA 1O13A 3UKRB 2P9IA 2GUPA 5BPNA 5MLCQ 3LDOA 3VEYA 4FL9A 1VQ4N 3CMEN 4EFHA 5GAEP 3IKMA 1KAYA 1VQNN 4U67L 4H0VB 4BRIA 2HBMA 4QS9A 3I55N 5AQJA 3C6AA 4CBWA 4JK8A 2PAVA 3AAQA 1EQYA 1ZBSA 3WQTA 3A5MC 3M1FA 3A0IX 3ATUA 4L3QA 4GVEA 3ZEUA 3MWPA 3WXJA 1GLJO 2NRWA 3CC7N 3ZEUB 2D1KA 2Q31A 4BRKA 2NNWA 2VCPA 2VGNA 4O8UA 3H45C 1ESVA 5C10A 3CHWA 1W97L 2FXUA 1X3MA 1VQ5N 3C6HA 3Q7CA 1VQON 3MX5A 3G6EN 4PL8A 1XC3A 4H0PA 3G4SN 3TSQA 2QEXN 3CF5L 2QI2A 2E88A 3E9OA 3QBWA 3VTHA 3VF2A 2HSTA 4F9OA 3O4WA 1BU6O 2GWJA 5BREA 3IFRA 3EE9A 1T6CA 5FPDA 4OO1J 5BPMA 3PIPL 4JD2B 4QS8A 4H5NA 1WUAA 3HZ6A 1QVFM 5F0XA 2W40A 3QMLA 1YXQA 1V4TA 3ID6A 4IWVA 5LJWA 4BR2A 4FPBA 2QWRA 4H0OA 5C2FA 3O8MA 4K41A 3NMUA 3KVGA 5M1FA 3F5TA 3R6MA 4CZJA 2I7PA 3P38A 2E1YA 1VQ8N 4KH4A 4O5FA 2AP1A 5C15A 2HF4A 4JEPA 5AQXA 4BQZA 3UE5A 1T44A 1U6ZA 2P9SB 3ENBA 4XH4A 3DXKA 3QBXA 3NVKA 4CZFA 4FWNA 2GELA 4CD1A 5C0YA 2ITMA 3VESA 3P39A 3AAPA 4C1NI 2QTDA 3CI5A 3TSUA 3LDQA 2E2QA 4FWPA 3QB0A 5KQDA 3CCQN 3VEVA 5AQHA 3PLAA 3W3DA 5BN8A 5JLFA 2I7NA 3W0LA 4CBUA 3T69A 4AM7A 5AZJB 3WXLA 4RWTA 4C23A 4CZHA 1NBWA 4BG8A 3F2KA 3GBTA 3LDPA 4JKGA 1T6DA 5E84A 1WOQA 3T7ZA 3VOVA 3J7ZO 4BGAA 4CJ7A 3TTCA 3GG4A 2ZGZA 3ENHA 4RCHA 2QWNA 2D0PA 3RSEB 1HX1A 2P9KA 2QM1A 2D4WA 2W41A 1GLFO 2P9UA 4WFBL 1MDUB 3CCJN 4H03B 5GINA 2HBLA 4KBOA 2ZJQL 1RDUA 4JKAA 4BR9A 4YOXA 1ILYA 1NGJA 1Q18A 3H46O 3VGMA 1ZXOA 3EL2A 3SLCA 2BH1A 3CJBA 4JKCA 4XEIA 5GIPA 1V4SA 3BP8A 2QWMA 5BRDA 4A5AA 4FOIA 4IDHA 5EX5A 4PKGA 5AQWA 3MCAB 3SAGA 3R8EA 1DT9A 3HM8A 4FWSA 3WXMB 2P9LA 3R1XA 3DXMA 1XQSC 2GX9A 3FZHA 3KWGA 4CBXA 3J8AA 1HKGA 4BRFA 2P9LB 3FGUA 3SMPA 5BPLA 1HJOA 2YHXA 1BDGA 3L0QA 3ZETB 1HLUA 1JCEA 1SZ2A 1QVGM 4IEEA 3C7NB 4PL7A 5KPZA 1S72N 3AARA 3AY9A 3UKRA 2P9PB 3MN7A 3CXCM 1W2BM 2HBJA 1N8RO 1IG8A 4IEIA 4B1WB 5GADP 2JWKA 5AQFA 1QHAA 3VEXA 4BROA 2HOEA 3SJHA 3IDHA 3VETA 4BQLA 4R79A 4YORA 3E9PA 1SAZA 2PBDA 2E20A 4IFEA 2QW9A 4MLEA 4PKHA 3VERA 3BF3A 1SQKA 1NGFA 3ENOA 4AM6A 4BC4A 3WUHA 3BEXA 4XH5A 1NGIA 1NGEA 3L4IA 1YITN 3CJ7A 3CCMN 1S22A 4JAXA 5TKYA 4JHDB 4B9QA 4A2AA 4CD3A 1DEJA 1QZ6A 2NZTA 3CCSN 2Q97A 5EXWA 1YF5L 3FE1A 5JVGL 2YJEA 4ILHA 4EHTA 1YJ9N 2IIRA 4HTLA 3HOSA 2HBKA 3VF6A 2YI1A 4FWRA 4FOEA 3ZX0A 1HUXA 3MMVA 1KAZA 1K8KB 1VQLN 1YJNN 2FSJA 3BUZB 1XUPO 1NGAA 4IOAL 3U8XA 1D4XA 5AR0A 3WT0A 2H3GX 2Q0UA 2FF6A 3LM2A 1NGCA 3HBTA 3O6WA 4QS7A 3O1WA 4BR4A 2WUSA 3HI0A 1GLEG 2YCHA 3DJCA 4JD2A 4M7XA 4DB3A 1VQPN 1BA0A 1MWMA 1P8ZA 3CCRN 5E26A 4GY2B 5AQNA 2E2OA 1DKGD 1Z05A 3FZKA 1HPMA 3JXUA 3QICA 3FLCO 2FSKA 2IVPA 4H5VA 2F9TA 2QWLA 4KH5A 4XH1A 3LM9A 5EVZA 2V7ZA 3D2EB 3WQUA 4BRLA 1KQSM 5CR4A 1VQMN 5AQVA 4JKFA 5DM7L 4OPHA 1CZAN 3O5BA 1YI2N 3H1VX 4M7YA 5AQRA 5ADXA 3EO3A 3A8YA 1MA9B 2VYPA 2VWBA 3Q7BA 1YHQN 2P9SA 3TTDA 1RFQA 3CJ9A 3NVMA 4CZIA 3HRGA 3VMFB 3QFUA 2HMPA 4BC2A 2E2NA 4JK7A 2RHKA 5HL7L 4BRDA 5JMVA 1MWKA 2QA4N 5H1SQ 1Z6RA 3JS6A 5AQTA 2UYTA 3M5RA 4WF9L 2NRRA 4B1ZA 2V7YA 4YOWA 4FWOA 3A5NC 3B8AX 1TYQA 1TUYA 5AZIB 3CCEN 4IJAA 4ISGA 5AFUA 3EKSA 3E9LA 3SAHA 2YHWA 2ZWHA 4JKDA 1TYQB 1YUWA 3CIPA 4CZGA 1T3VA 2P9NB 1M1KO 1R59O 4B1VA 5AZJA 2FSNA 4MDAA 1NMDA 3UKUA 3CCUN 1BA1A 4M63C 3A5LC 4NO7A 3VPZA 3O9SA 1X9JA 2F9WA 2Q36A 4BREA 4BRAA 5B8HA 5C2DA 3CD6N 3SK3A 3UKUB 5GAGP 2GEMA 4FWLA 4EHUA 3ZYYX 4OPAA 3O08A 3S41A 3RSEA 4NB4A 3I8BA 3N4PA 4FWKA 2BUPA 5M1NA 3MN5A 3R9PA 3FZLA 4ISFA 4PHTX 5AQIA 4WQ4C 3TPQA 4YOYA 3CC2N 4BVPA 4FVUA 4YOVA 4YDUC 5AQOA 4DCHA 3MCPA 4BRMA 5AQZA 4RTFD 2YJFA 4C1NK 4FO0A 3MX2A 4CZEA 5GAHP 4IO9L 2FLOA 5FPNA 3SAFA 3U9DA 4H0TB 2V52B 3P4IA 5F1XA 3D7EO 4I6MB 2WFBA 4CZKA 3CMAN 2NRTA 3I33A 1ATNA 1YIJN 4BR0A 2KLAA 2ASPA 3QDKA 4JKEA 3O80A 2ZGYA 5BRFA 4PKIA 3I56N 3KK7A 3D2FB 3O9TA 4BGBA 1ZC6A 4DHYA 1NGDA 1E4FT 4GV3A 5AQQA 1HKBA 2D0OA 2Q2RA 4MDBA 1ATRA 2HF3A 3ZETA 3ULEA 3MK6A 5GIOA 3CC4N 3IUCA 3C7NA 4ILGB 4H5RA 5ELZA 4B1YB 1NJIO 3LDLA 3SBGA 3ULEB 2P9PA 5LY3A 1BG3A 3L6QA 4BVOA 5TKWA 3K9KA 1NGGA 3CQYA 3P31A 3FR0A 3VF4A 2A41A 3DWLA 3GOIA 3CJAA 3BF1A 1SS6A 1H1VA 4WQ5C 4EAHD 4B1UB 3KZBA 2J4RA 2EWSA 4AF1A 4NLBA 4GV6A 1BOTO 4B1XB 3RVCA 4EIAA 4JHDA 1G99A 3WEEA 3CPWM 2OTLN 3CCLN 2VGMA 4BY9C 5LJVA 3FZFA 1LOTB 3WXIA 3WEEB 3VGLA 1Q81O 2A40A 4WCEL 1K8KA 3AGRA 3MN9A 2JWLA 4K25A 5M1QA 4FWQA 4CZLA 3DLLL 2QXLA 2GWKA 4G9ZA 4GNIA 1JCGA 4A57A 3TTFA 3ZX3A 5BRHA 2P9IB 4BC3A 3G71N 2ZF5O 3OBWA 2GTDA 3EKUA 5KQ8A 3K9JA 1X3NA 4WQ4A 4BRHA 1NLVA 3O9RA 4NLCA 2YHYA 2IVOA 4YDUA 5EOYA 3VEWA 2NRVA 1J6ZA 4ISEA 3CETA 5HOOA 4BRGA 2E8AA 5AQUA 4FSVA 5ADXH 1VQKN 4IXCA 3D2EA 2E1ZA 4WFAL 3U9ZA 3O1BA 1U2VA 4A59A 4BG9A 4ILJA 4BRNA 2CGLA 2BTFA 5FPMA 1RGIA 3CERA 5BN9A 5AQYA 5I9EB 5JICA 1U2VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJP L;  1VQ6 N;  1M1K O;  5MLC Q;  3CCU N;  1KD1 O;  1VQ4 N;  3CME N;  5GAE P;  1VQN N;  3CD6 N;  4U67 L;  3I55 N;  5GAG P;  2ZJR L;  5DM6 L;  4WFN L;  3CC2 N;  3CC7 N;  1QVG M;  1S72 N;  5GAH P;  3CXC M;  1W2B M;  4IO9 L;  4IOC L;  1VQO N;  1VQ5 N;  3G6E N;  1N8R O;  1K73 O;  3G4S N;  5GAD P;  3CMA N;  3CF5 L;  2QEX N;  1YIJ N;  1KC8 O;  3I56 N;  3PIP L;  1YIT N;  3CCM N;  3CC4 N;  1QVF M;  2OTJ N;  3CCS N;  5JVG L;  1YJ9 N;  1NJI O;  3CCV N;  1VQL N;  1YJN N;  1M90 O;  1VQ8 N;  1Q86 O;  1VQ7 N;  4IOA L;  1JJ2 M;  1YJW N;  1VQP N;  5JVH L;  3CCR N;  3CPW M;  2OTL N;  1Q7Y O;  3CCL N;  1Q81 O;  3PIO L;  4WCE L;  1KQS M;  1K9M O;  1VQM N;  5DM7 L;  3OW2 M;  3CCQ N;  1YI2 N;  1Q82 O;  1VQ9 N;  1K8A O;  3DLL L;  3G71 N;  1YHQ N;  1OVY A;  4UY8 O;  3J7Z O;  5HL7 L;  2QA4 N;  5H1S Q;  1VQK N;  4WF9 L;  4WFA L;  4WFB L;  3CCJ N;  3CCE N;  2ZJQ L;  1ILY A; 
#chains in the Genus database with same CATH topology
 2HB5 A;  1QE1 A;  3WNF A;  3M8Q A;  1C0G A;  4KB0 A;  1RTJ A;  1VHX A;  1BO5 O;  5C12 A;  4DTN A;  1WNS A;  2DFH A;  2CH6 A;  5AFU H;  4JK9 A;  4DQP A;  4MO4 A;  1P90 A;  1JL1 A;  4MO5 A;  1GLD G;  1YVN A;  5AQG A;  4J8F A;  4CHP A;  2AA4 A;  2WTU A;  2CH5 A;  3OYD A;  4CK3 A;  5AQM A;  3QEI A;  3KHY A;  4WQ5 A;  4ZHR A;  2O8C B;  4GKJ K;  4IOC L;  1LCU A;  4DSI A;  1IKY A;  3C95 A;  2HNY A;  2UXC K;  1HR0 K;  4DR7 K;  2UXD K;  3CJC A;  5EY4 A;  2QWQ A;  3GE1 A;  4CZM A;  1RTH A;  3KK1 A;  2Q3S A;  5M1O A;  4H0Y B;  3OBY A;  3TU5 A;  1JXB A;  3R3L A;  3SBT A;  2B6A A;  3F9M A;  1NWK A;  2O4I A;  3IMX A;  4E0D A;  1N34 K;  2CGJ A;  2NLX A;  3S9H A;  3SUP A;  4CF2 A;  2A5X A;  1E4G T;  1JJ2 M;  2RN2 A;  1EO1 A;  3CM5 A;  1WAJ A;  4CJR A;  3D2F A;  5JVH L;  1Z25 A;  3H3N O;  4IZ9 A;  4JKG B;  3VQ9 A;  3AVK A;  4JI4 K;  4F3O A;  1Q7Y O;  4ELT A;  4OLA A;  1DGK N;  4KKO A;  1VSF A;  3EZW A;  3J81 O;  5HLF A;  1VSK A;  2P9K B;  5AQS A;  1IV0 A;  4K42 A;  3CJ1 A;  1NGH A;  1K9M O;  1NOY A;  4LH4 A;  2G8H A;  3OW2 M;  4CER A;  2P5G A;  1K6Y A;  1HKC A;  1DTQ A;  4DTU A;  3AVG A;  3G25 A;  3U3Y A;  1TUU A;  3LDS A;  4E7K A;  3L2V A;  4CI6 A;  2FF3 B;  1BUP A;  3TAM A;  4DV7 K;  3N4Q A;  2LSN A;  3BZC A;  2VQF K;  1CZB A;  3UB5 A;  1DTT A;  1VQ6 N;  2X6S A;  1VQ4 N;  1EP4 A;  3SYZ A;  4DV0 K;  4DU3 A;  1VQN N;  4BRI A;  3OYN A;  2E5L K;  3I55 N;  4JK8 A;  4JI5 K;  1EQY A;  3V9S A;  5AJ3 K;  2AJQ A;  4JI2 K;  4B9M A;  1CXQ A;  4BDZ A;  3WXJ A;  3KLG A;  2OPQ A;  2VGN A;  5C10 A;  1W97 L;  3U6F A;  1D5A A;  1VQ5 N;  3Q7C A;  2IGI A;  1SKW A;  2QEX N;  3DLB A;  4FLX A;  3HYF A;  1IG9 A;  3VQE A;  3VTH A;  1BU6 O;  2GWJ A;  1S1T A;  3IFR A;  3HO1 A;  1L3V A;  2KFN A;  1T6C A;  3KLH A;  3LAM A;  5FPD A;  4OO1 J;  3ULD A;  3BY5 A;  3PUF A;  1HNX K;  4C8O A;  4DV1 K;  4RG8 A;  5EU7 A;  3HPH A;  4IWV A;  4FXD A;  3R6M A;  3DLK A;  4CZJ A;  4BWM A;  4IFV A;  2HVH A;  1L3S A;  3IG1 A;  5AQX A;  2JLE A;  3AA5 X;  2FC0 A;  2OA8 A;  5FRM A;  5IT9 O;  4CZF A;  2W42 A;  1NOZ A;  5SWM A;  2KW4 A;  4DTO A;  3AVL A;  4RW7 A;  4NXM K;  1JLA A;  1HQE A;  2E2Q A;  4FJL A;  3D0P A;  5JLF A;  3DLE A;  4O5B A;  4CBU A;  1WSF A;  4CZH A;  2O8B A;  4BG8 A;  3GBT A;  3VOV A;  1DLO A;  4B08 A;  2OPS A;  4ID5 A;  2WON A;  4BGA A;  4CJ7 A;  3GG4 A;  3O3H A;  3ENH A;  3LWM A;  1HX1 A;  3VQ8 A;  1NK9 A;  1TKX A;  3BDP A;  3CCJ N;  4DSL A;  5I3U A;  4HHT A;  3H46 O;  1OH5 A;  3CJB A;  4XEI A;  4W5O A;  3C94 A;  3TAF A;  4LF9 K;  3I0S A;  4A5A A;  4IDH A;  2UU9 K;  3IS9 A;  5AQW A;  3OYB A;  3NFA A;  1N6Q A;  3RRG A;  3HM8 A;  5CZ2 A;  1BCO A;  2P9L A;  1XQS C;  2GX9 A;  3V9Z A;  4LH5 A;  4Y1C A;  2P9L B;  3FGU A;  3SQ2 A;  2YHX A;  3ZT2 A;  2BAN A;  5KPZ A;  4KHU A;  2G8K A;  3AY9 A;  1WBD A;  3HJF A;  2P9P B;  3MN7 A;  1EKE A;  4GMJ B;  4IEI A;  4B1W B;  1NK4 A;  4N76 A;  3V9W A;  1HYS A;  1QHA A;  3VET A;  1U48 A;  4DLE A;  3E9P A;  4IFE A;  1SQK A;  3ENO A;  3D45 A;  4XH5 A;  1NGI A;  4J2A A;  3CJ7 A;  4WE1 A;  3CCM N;  1S22 A;  4A2A A;  1DEJ A;  1XMO K;  4ILH A;  4EHT A;  4I9L A;  2HBK A;  1HNV A;  4FOE A;  3ZX0 A;  4KV8 A;  3BUZ B;  4CHZ A;  1NJZ A;  3U8X A;  4W5N A;  1YVU A;  4CEZ A;  2FBT A;  4JD2 A;  4IG0 A;  4DB3 A;  4O44 A;  3CCR N;  3QEV A;  1S5J A;  1HNI A;  3OYK A;  3KLE A;  1JKH A;  1ZYQ A;  4K0K K;  4H5V A;  2QWL A;  4XH1 A;  2E6M A;  5EVZ A;  1HMV A;  5CR4 A;  4JKF A;  1VRU A;  2DFE A;  1YI2 N;  1C0U A;  4YHH K;  2F96 A;  3VA3 A;  3A8Y A;  1QSY A;  3QFU A;  4W5R A;  4OLB A;  1JLB A;  4OGC A;  2OZM A;  3SPZ A;  3HVT A;  3M5R A;  3NCI A;  2X78 A;  3CCE N;  5AZI B;  3EKS A;  3HM9 A;  2YHW A;  3RR8 A;  1X9W A;  1VSM A;  5AZJ A;  4E7H A;  4FK2 A;  2KQ2 A;  2UXB K;  4M63 C;  5B8H A;  4BRA A;  4C8K A;  2UUC K;  3SK3 A;  4CJV A;  2A1R A;  2DFF A;  3S41 A;  3O4N A;  5M1N A;  3MN5 A;  4FJ5 A;  3CC2 N;  5AQO A;  4DF4 A;  4B3M K;  4F8R A;  4DFJ A;  4RTF D;  4C1N K;  4FO0 A;  3MX2 A;  3OS0 A;  2FLO A;  5F1X A;  2ZE2 A;  3D7E O;  5T7B A;  2O8E B;  3KD5 E;  1ATN A;  3ISN C;  4BR0 A;  4Q0B A;  2HHQ A;  3QDK A;  4JKE A;  5BRF A;  1BQN A;  3J7Y P;  3KK7 A;  2F4V K;  2Z1J A;  1TAU A;  1RDB A;  4PUO A;  1NGD A;  1E4F T;  5AQQ A;  2D0O A;  5GIO A;  3C7N A;  4DFK A;  4H5R A;  4NCA A;  3SBG A;  5LY3 A;  3L6Q A;  4HUE A;  1IH7 A;  3K9K A;  3VQD A;  4CJK A;  3IRX A;  3VF4 A;  3DWL A;  4DSK A;  1H1V A;  4B1U B;  2J4R A;  2EWS A;  4N56 A;  4B1X B;  4JHD A;  2P51 A;  3WEE A;  1NKE A;  3PSF A;  2VGM A;  1UWB A;  3FZF A;  3WXI A;  3SUQ A;  1LWC A;  3WEE B;  3VGL A;  1T8E A;  2A40 A;  1NK5 A;  3CFO A;  4DV4 K;  1J5O A;  4FJ9 A;  4HCC A;  4FVM A;  4Z4G A;  3TAG A;  1JLQ A;  1Q8I A;  4BDY A;  4G9Z A;  3RTV A;  4N41 A;  3SQ1 A;  4A57 A;  3NHG A;  3ZX3 A;  4ZTF A;  4DQQ A;  1KVA A;  2PYJ A;  3EKU A;  5KQ8 A;  4DTX A;  3K9J A;  1X3N A;  3M8P A;  1S1U A;  3O9R A;  4NLC A;  2YHY A;  3K59 A;  2IVO A;  5EOY A;  1WSE A;  4EP4 A;  2NRV A;  4ISE A;  3V1Q A;  1A5W A;  3CET A;  1JXE A;  5AQU A;  5ADX H;  3K2P A;  3WNH A;  4WFA L;  1U2V A;  3L2U A;  4ILJ A;  5E41 A;  3NH2 A;  4EZ6 A;  4NXN K;  5FPM A;  3QO9 A;  1RGI A;  5I9E B;  5BN9 A;  2YKN A;  1U2V B;  5AQP A;  1KLN A;  1ZBF A;  4A61 A;  1IBK K;  2ZD1 A;  3AVB A;  3RR7 A;  4C8N A;  3O9U A;  3CM6 A;  5KPT A;  4JV5 K;  3EY1 A;  3MEG A;  4O8K A;  4NCB A;  1TGO A;  4JKH A;  4WFN L;  2PFU A;  1BQM A;  1RT6 A;  3WXK A;  2QK9 A;  3AVF A;  4YOU A;  4BRP A;  4DFM A;  3DLG A;  2KHO A;  4DQ8 A;  5C25 A;  4JS4 A;  2ASO A;  4DR4 K;  4LC9 B;  1RDW X;  4CEO A;  3QNN A;  2HHW A;  2WBN A;  2YX6 A;  2WC9 A;  2QWO A;  3NF6 A;  1GLB G;  4CFD A;  1GLL O;  4AM7 A;  1KC8 O;  1S3X A;  4H4M A;  3F73 A;  3DXK B;  3LP3 A;  2KKZ A;  3QFP A;  2OTJ N;  3L3U A;  5CHI A;  1SV5 A;  1JL2 A;  3THX A;  2OCE A;  1T03 A;  4KRF A;  4CJW A;  3KKR A;  1OVQ A;  3NF7 A;  1RBT A;  2CGK A;  3VTI A;  4I6M A;  4JNE A;  1YAG A;  4W5Q A;  5M1K A;  4IG3 A;  4JN4 A;  4Y0W A;  4ELV A;  4FCY A;  4A2B A;  1ASW A;  3DMJ A;  1NM1 A;  5FRO A;  3NE6 A;  2O4G A;  2Q1N A;  3CQ8 A;  3PIO L;  4LD0 A;  2F7T A;  2A6A A;  1FJG K;  4I9Q A;  4LY7 A;  2P9U B;  4DU1 A;  3NGY A;  2ASM A;  3SUO A;  2F8T A;  1QTM A;  3VEO A;  3ALY A;  4DSE A;  3E1Y A;  3KK3 A;  3CQX A;  1B92 A;  1QQO A;  4U7B A;  3HXM A;  1KAX A;  4Z94 A;  4KAZ A;  4H8K A;  1OVY A;  3H3O B;  1OH6 A;  1NGB A;  2W6L A;  5CYQ A;  1GLC G;  1EET A;  4CJS A;  3K5O A;  4DQS A;  2B4J A;  3D6R A;  3DXM B;  4DG1 A;  5HBM A;  3KD1 E;  4WYB A;  1VSL A;  3BGR A;  2NRZ A;  3VGK A;  3NH0 A;  4BRC A;  4CJT A;  5BPN A;  2P9I A;  3E01 A;  4B9V A;  2FBX A;  4FL9 A;  4CEF A;  3IKM A;  1KAY A;  4CW7 B;  4H0V B;  1NK8 A;  5AQJ A;  1W7A A;  3C6A A;  4CBW A;  4KHP K;  1KVB A;  1ZBS A;  4LF7 K;  3DOK A;  3M1F A;  4L3Q A;  3LWL A;  3LP0 A;  3VQ7 A;  2NRW A;  4ELU A;  3TAQ A;  5HRR A;  2NNW A;  4O8U A;  1N36 K;  4JRQ A;  3CHW A;  3V4I A;  4M3U A;  3TSQ A;  4CIE A;  1JLG A;  2QI2 A;  4CGI A;  2E88 A;  4BAC A;  2HST A;  1X9S A;  3J7A P;  5BRE A;  4LFB K;  1R0A A;  1C0T A;  1TKZ A;  1ZBH A;  4CHY A;  3PIP L;  3RRH A;  4H5N A;  4DV6 K;  4JI6 K;  4CGD A;  5F0X A;  3SV4 A;  3LZI A;  3ID6 A;  5KTQ A;  3M8R A;  5LJW A;  4DTR A;  4KTQ A;  2O8C A;  3QIO A;  4Z4H A;  3KVG A;  4B3O A;  3F5T A;  3KJV A;  4DU4 A;  4AHV A;  3V6D A;  3P38 A;  2E1Y A;  3RMA A;  2AP1 A;  2HF4 A;  3OYL A;  1FXX A;  4FJM A;  1T44 A;  3QBX A;  4YY3 K;  2D5R A;  3KLI A;  4PY5 A;  4BE1 A;  3THV A;  1RT3 A;  4E7J A;  4CD1 A;  1X1P A;  3VES A;  3P39 A;  2D0B A;  3CI5 A;  1RT4 A;  3MAQ A;  3LDQ A;  4HTU A;  1KLM A;  3CCQ N;  1J54 A;  2G8V A;  3W3D A;  5BN8 A;  3W0L A;  2UUA K;  3O4Q A;  4Z4E A;  4EZ9 A;  5J1E A;  4K8X A;  2VG6 A;  4JKG A;  1T6D A;  5E84 A;  1WOQ A;  3J7Z O;  2Y1I A;  3TTC A;  1ASU A;  4RCH A;  1HNZ K;  2G8U A;  2D0P A;  3RSE B;  2P9K A;  3J80 O;  2QM1 A;  2W41 A;  3KTQ A;  4WFB L;  5GIN A;  2HBL A;  4KBO A;  2ZJQ L;  4JKA A;  1SUQ A;  4YOX A;  1ZBI A;  3SLC A;  2FBY A;  2HMI A;  3BP8 A;  2QWM A;  4OJR A;  1YTU A;  2HHV A;  4PKG A;  4JI3 K;  3MCA B;  5LMU K;  3TAP A;  4PA1 A;  3K5N A;  4BRF A;  3B6O A;  1TVR A;  1D8Y A;  1SZ2 A;  4IEE A;  1W2B M;  2HBJ A;  1BIS A;  2GBZ A;  2HHH K;  2E4L A;  5GAD P;  5AQF A;  2RF2 A;  4R79 A;  1SAZ A;  4FJ7 A;  2PBD A;  2E20 A;  3BF3 A;  1NGF A;  4CES A;  3WUH A;  1GOC A;  4CHN A;  4R5P A;  4CD3 A;  1QZ6 A;  2KTQ A;  3CCS N;  5JVG L;  1FKO A;  3LAL A;  3U3G A;  1REV A;  2IIR A;  4HTL A;  3O3G A;  1FKP A;  1RTI A;  2YI1 A;  2VWJ A;  4FWR A;  3SQ4 A;  1HUX A;  1UA0 A;  3MMV A;  1KAZ A;  3AVN A;  3WNE A;  1UOC A;  1XUP O;  3B6P A;  3THW B;  4CF1 A;  1D4X A;  5AR0 A;  4B9N A;  1XNQ K;  2H3G X;  2VG7 A;  1NGC A;  3KIO A;  1BA0 A;  5E26 A;  4GY2 B;  1DKG D;  1I39 A;  1XWL A;  1HPM A;  3P5J A;  3FLC O;  2IVP A;  1WSG A;  2F9T A;  4KH5 A;  3AA3 A;  3LM9 A;  3MXJ A;  1KQS M;  4M3Y A;  4IBN A;  1VQM N;  4OPH A;  4X64 K;  1I3A A;  1RBU A;  3ZSO A;  4F4K A;  4FK0 A;  1CLQ A;  3MEC A;  3OYF A;  3ZSR A;  2VYP A;  1MA9 B;  2VWB A;  4BC2 A;  1TV6 A;  2RHK A;  4RW4 A;  3V81 A;  1SL1 A;  5HL7 L;  1MWK A;  2E6L A;  5H1S Q;  1Z6R A;  3JS6 A;  4FZX C;  4DF8 A;  4M3W A;  4B1Z A;  2V7Y A;  5C24 A;  3AV9 A;  4FWO A;  2VQE K;  4DSF A;  5AFU A;  3E9L A;  2ZWH A;  4JKD A;  3CIP A;  3TAB A;  4C8L A;  2P9N B;  1NK0 A;  4B1V A;  5CY4 A;  3JAM O;  3UKU A;  3A5L C;  2IS3 A;  3O9S A;  2F9W A;  2Q36 A;  3UIQ A;  5C2D A;  1TKD A;  3UKU B;  3AA4 A;  1C1C A;  5GAG P;  4NB4 A;  1NU0 A;  3AVA A;  3I8B A;  2BUP A;  3R9P A;  3FZL A;  4M45 A;  3MXI A;  4WQ4 C;  3ZSY A;  4YOV A;  4YDU C;  4DCH A;  3T1A A;  4DR3 K;  5AQZ A;  5J2Q A;  2YJF A;  4JRP A;  4JI7 K;  3DYA A;  1WAF A;  4CZE A;  4KRE A;  3RWU A;  3SAF A;  5FDL A;  2V52 B;  3P4I A;  3EEQ A;  4CJ4 A;  2WFB A;  4MQ3 A;  2OYQ A;  1C0M A;  2NRT A;  3I33 A;  3VQ6 A;  2ASP A;  3O80 A;  4PKI A;  3I56 N;  4BGB A;  1ZC6 A;  5KGW A;  1YT3 A;  2Q2R A;  2HF3 A;  3L8B A;  3PX4 A;  3SQ0 A;  3IUC A;  4LF4 K;  1TL1 A;  4B1Y B;  1NJI O;  3SCX A;  4LSL A;  2P9P A;  3NF8 A;  3RMB A;  4BVO A;  5TKW A;  3TAE A;  3F9K A;  4FJJ A;  4CJL A;  4FJI A;  1NGG A;  3FR0 A;  2Z1I A;  4B3R K;  3BF1 A;  4X62 K;  3RMC A;  3QNO A;  4RW6 A;  1SKS A;  4EAH D;  3LPU A;  4FLW A;  3T1H K;  4AF1 A;  4NLB A;  4GV6 A;  1XNR K;  3HP6 A;  5DMR A;  1Q81 O;  3MN9 A;  5J2P A;  2JWL A;  3HP9 A;  3HK2 A;  3TWH A;  4CZL A;  3DLL L;  3P83 D;  1RT5 A;  4DFP A;  3ZT3 A;  1WLJ A;  2ZF5 O;  4EP5 A;  3OBW A;  5HRN A;  2GTD A;  4TSX A;  4WQ4 A;  4FLZ A;  1BIU A;  1BIZ A;  1Y97 A;  2HHU A;  4GVM A;  4YDU A;  5HP1 A;  3JSM A;  4BRG A;  3DOL A;  4IXC A;  2E1Z A;  4FLV A;  3CER A;  5JIC A;  3VQ4 A;  2ZJP L;  4DQR A;  4BRQ A;  4HWI A;  5JLH A;  3FFK B;  4JI1 K;  4CGJ A;  4FWM A;  4CEA A;  2XY5 A;  1OKJ A;  3P1G A;  5F2R A;  4K43 A;  1KD1 O;  3E66 A;  3OTO K;  3IAY A;  4AH9 A;  4BR7 A;  1JCF A;  5AZI A;  4FW1 A;  4CF8 A;  4CGF A;  2YV0 X;  4DV2 K;  3MWT A;  1K73 O;  2A3Z A;  4FPA A;  4GKK K;  2R7Y A;  3EN9 A;  2Q0R A;  4H5W A;  4E1J A;  4KH6 A;  4H0X B;  4I2Q A;  3MED A;  4G1Q A;  1RDC A;  3H6E A;  5M1P A;  3HOT A;  3OHR A;  3THY A;  3ZX2 A;  3M6G A;  3THY B;  3O9Q A;  3AGK A;  4BE0 A;  3CCV N;  4I7F A;  1M90 O;  4BR5 A;  4LF5 K;  1VQ7 N;  2O8E A;  3HTV A;  3NDK A;  2RE2 A;  3VEN A;  4B9L A;  3QIN A;  5K14 A;  3CFR A;  3ATV A;  2Z1H A;  1KXP A;  3K5L A;  2IVN A;  4CFC A;  1C1B A;  1TL3 A;  3VQC A;  2I5J A;  3AO4 A;  5CE3 A;  1RBR A;  4KTZ A;  1Q82 O;  3L2Q A;  1J9A A;  3VEZ A;  4E1M A;  3OS1 A;  1WBB A;  1IJJ A;  4YFU A;  4IJN A;  1WSJ A;  4Q5V A;  4UY8 O;  3ID8 A;  3OYC A;  2A42 A;  5BR8 K;  4BE2 A;  4DLG A;  4IKF A;  3K57 A;  3L4Q A;  4MLH A;  3PY8 A;  4B3S K;  4LFC K;  4ID1 A;  4BC5 A;  4FW2 A;  4H5T A;  2Z1G A;  2E2P A;  1VAZ A;  4FJN A;  5DK5 A;  1MU2 A;  3HSC A;  3UKR B;  4M41 A;  5MLC Q;  5FRN A;  3T19 A;  1KRP A;  3QER A;  4ZTJ A;  4DV3 K;  4U67 L;  1SL0 A;  4LF6 K;  3AAQ A;  2YNH A;  4DTJ A;  3PX6 A;  4CJP A;  3A5M C;  1WSI A;  3A0I X;  3ATU A;  3ZSV A;  4Z4C A;  3MWP A;  1GLJ O;  2WOM A;  1RIL A;  1E3M A;  3H08 A;  2D1K A;  4BRK A;  1XHX A;  4MFB A;  4E1N A;  3ZT1 A;  5J2N A;  2FXU A;  1X3M A;  3C6T A;  3PO5 A;  4IFY A;  1CXU A;  3C6H A;  4AQY K;  3MX5 A;  4O0I A;  1NJW A;  4PL8 A;  1XC3 A;  4H0P A;  3HL8 A;  1BCM A;  3E9O A;  4OKE A;  3QBW A;  3VF2 A;  2VG5 A;  3EE9 A;  3AO5 A;  1LWF A;  4FJ8 A;  1FK9 A;  4CJ3 A;  5BPM A;  5HRO A;  4QS8 A;  3OYM A;  2O8D B;  3L3V A;  1WUA A;  3HZ6 A;  4JS5 A;  1QVF M;  3SJJ A;  1IKX A;  3QML A;  2RKI A;  1YXQ A;  1V4T A;  4JLH A;  2QWR A;  5C2F A;  4PWD A;  4W5T A;  4CGG A;  4KHW A;  2P1J A;  4O5F A;  5C15 A;  4CHQ A;  4X66 K;  5KRT A;  1Q9X A;  4QAG A;  4BQZ A;  4AHR A;  2P9S B;  4JI0 K;  3DXK A;  3SI6 A;  4XIU A;  1NK6 A;  4FM0 A;  1S1V A;  3HVR A;  1XMQ K;  3OJU A;  5C0Y A;  1IBM K;  2ITM A;  3AAP A;  1F21 A;  2QTD A;  3TSU A;  4LF8 K;  4FWP A;  3QB0 A;  4OKK A;  4CFB A;  3ASM A;  3VEV A;  5AQH A;  3V9U A;  1T7P A;  3OY9 A;  3T69 A;  1QHT A;  5KGX A;  3WXL A;  4RWT A;  4C23 A;  1EWR A;  3KK2 A;  3NF9 A;  1WSH A;  3LDP A;  2RPI A;  3T7Z A;  2KZM A;  2G8W A;  3VQP A;  4CE9 A;  4L8R B;  5IWA K;  4X65 K;  1LW2 A;  3QES A;  3SZ2 A;  4KHN A;  1GLF O;  2P9U A;  3KKS A;  3OS2 A;  1MDU B;  3OYJ A;  4H03 B;  4CK2 A;  4BR9 A;  1ILY A;  1NGJ A;  1V4S A;  5CZ1 A;  3V1O A;  2DY4 A;  3SAG A;  4OPJ A;  4FWS A;  4M3R A;  2EX3 A;  3TI0 A;  4FJX A;  2FBV A;  3DXM A;  4CBX A;  3LZJ A;  1HKG A;  3EZ5 A;  3OJS A;  1HJO A;  1BDG A;  1BI4 B;  3ZET B;  1HLU A;  3ZCM A;  1JCE A;  1QVG M;  4PL7 A;  1HQU A;  1S72 N;  3AAR A;  4KHY A;  3QLH A;  3CXC M;  4FJG A;  3AVC A;  4B8A B;  3QEX A;  2JWK A;  4C8M A;  1RBV A;  4FYD A;  3OYA A;  2HOE A;  4BQL A;  3IDH A;  4YOR A;  4PKH A;  3AVH A;  3VER A;  4AM6 A;  2IOC A;  4O0J A;  1ASV A;  3BEX A;  3L4I A;  3ZSZ A;  4JAX A;  4CJF A;  5SZT A;  2Q97 A;  5EXW A;  1JLF A;  3FE1 A;  5J2M A;  3HOS A;  4OX9 K;  1K8K B;  4DTS A;  1VQL N;  1UA1 A;  4DR6 K;  5LL6 Z;  3OYI A;  1S1W A;  2FF6 A;  3LM2 A;  2YNI A;  4QS7 A;  3O1W A;  2ATQ A;  2WUS A;  4M7X A;  1GLE G;  4DS5 A;  1VQP N;  4CEB A;  4I2P A;  2P5O A;  3FZK A;  3JXU A;  3QIC A;  5KRS A;  4FLY A;  2FSK A;  2JGU A;  2V7Z A;  4DUY K;  3D2E B;  4BRL A;  5AQV A;  4CVN E;  1CZA N;  1QS4 A;  3V9X A;  3H1V X;  4FLT A;  5ADX A;  3EO3 A;  4CF0 A;  1W0H A;  1KCF A;  4B9U A;  3V1R A;  3Q7B A;  1YHQ N;  1RFQ A;  3CJ9 A;  1X9M A;  2HMP A;  2E2N A;  4DTM A;  4KI6 A;  1RBS A;  5JMV A;  2QA4 N;  1L5U A;  4CJU A;  4WF9 L;  2NRR A;  4NYF A;  3A5N C;  1TYQ A;  4IJA A;  3L2R A;  4B8C A;  3QET A;  1TYQ B;  1YUW A;  1YTA A;  4DTP A;  1T3V A;  1R59 O;  4MDA A;  1BA1 A;  4NO7 A;  1U04 A;  3CD6 N;  3VQA A;  4EHU A;  2YKM A;  3RSE A;  3C6U A;  3N4P A;  1NNE A;  3CG7 A;  2OPR A;  4YNQ A;  4ISF A;  4PHT X;  5AQI A;  4YOY A;  4FVU A;  4BVP A;  4NCG A;  4KPY A;  4GW6 A;  4LSN A;  4BRM A;  3ZLJ A;  3VN5 A;  3I8D A;  1L3U A;  3O3F A;  5GAH P;  3AVM A;  5FPN A;  4OGE A;  4H0T B;  3DM2 A;  2ETJ A;  1EXQ A;  2HND A;  1YIJ N;  1LW0 A;  2HVI A;  1VSE A;  3LAK A;  3ZSX A;  3WNG A;  2ZGY A;  1KFD A;  3D2F B;  1N33 K;  4DHY A;  4GV3 A;  4MDB A;  1TK0 A;  1ATR A;  3CC4 N;  1RT7 A;  2A1S A;  3LDL A;  1BG3 A;  2EHG A;  4KHQ A;  3L2W A;  4CEQ A;  2YHA A;  3ZT4 A;  3CQY A;  1VSH A;  3P31 A;  3K58 A;  2A41 A;  3GOI A;  2D0A A;  1JLE A;  1SS6 A;  2XY6 A;  1S9E A;  1O1W A;  4EIA A;  3CPW M;  3CCL N;  3TAR A;  4BY9 C;  4CK1 A;  3PSI A;  4CFA A;  1J53 A;  3S3M A;  4NYN A;  3QIP A;  4K25 A;  3JYT A;  2QKB A;  4FWQ A;  3THW A;  1VK0 A;  1QSS A;  2QXL A;  4GNI A;  1JCG A;  3TTF A;  1Q9Y A;  5BRH A;  3G71 N;  2G8I A;  3BZK A;  5KI6 A;  1NLV A;  2B5J A;  3EYZ A;  4M3T A;  1KSP A;  5HOO A;  5JS1 A;  1VQK N;  3HT3 A;  3U9Z A;  4BRN A;  2CGL A;  4AHT A;  1ZBU A;  4UQG A;  4YOT A;  1W9H A;  4HVJ A;  3AO2 A;  3PO4 A;  3M3Z A;  1OH8 A;  5CYM A;  4BWJ A;  4AHC A;  2XO7 A;  1GOA A;  4A62 A;  4A5B A;  2ZJR L;  5DM6 L;  2DPN A;  3OA9 A;  5FLX O;  2QKK A;  1SKR A;  4CCH A;  2YHB A;  4FM2 A;  1S6Q A;  4K8Z A;  5AQL A;  2HHT A;  5AQK A;  2P9N A;  4F2R A;  1I94 K;  3ZSW A;  4J2B A;  3GDQ A;  4CED A;  3GL1 A;  3VQ5 A;  1RCH A;  4O55 A;  4KI4 A;  3CPE A;  1C0F A;  4JKB A;  4DQI A;  2OAN A;  2NRH A;  4KFB A;  3TSP A;  1BWF O;  3AA2 A;  4J2E A;  2NRX A;  4IDK A;  4O4G A;  4IOX A;  3AO3 A;  4CEE A;  2XHB A;  4GV9 A;  4PQU A;  2X74 A;  1RTD A;  3H1Q A;  4RW9 A;  3LPT A;  1J5E K;  1Q86 O;  1D9F A;  1RDA A;  1U45 A;  3C0B A;  1VSD A;  1YJW N;  2O8B B;  4OPK A;  3G10 A;  3PX0 A;  3FZM A;  3KWI A;  4B3T K;  4M3Z A;  4DV5 K;  3DLR A;  4FJH A;  2DTU A;  3DRP A;  1NG9 A;  3FFI A;  2V51 B;  2QWP A;  3S3N A;  3SUN A;  1K8A O;  1VQ9 N;  3C65 A;  3DAW A;  3SMS A;  2BE2 A;  1QZ5 A;  1Y64 A;  5BR9 A;  3SPY A;  3LDN A;  4IO8 A;  1T05 A;  4KTW A;  1QQM A;  3NH1 A;  3OYE A;  1XI1 A;  1GLA G;  1VSI A;  1A5V A;  3A5O C;  1TAQ A;  4F2S A;  4DKW A;  3MN6 A;  3ITH A;  1QQN A;  1ATS A;  3EE8 A;  3LL3 A;  3U4L A;  1HNW K;  5KPR A;  1SL2 A;  5FPE A;  3MDQ A;  3PV8 A;  1ITG A;  1O13 A;  3VQB A;  1TK5 A;  2GUP A;  4DR2 K;  3LDO A;  2QXF A;  3VEY A;  1RT2 A;  3OYH A;  3CME N;  1TKT A;  4EFH A;  5GAE P;  3KLF A;  1GOB A;  2HBM A;  4QS9 A;  3HPG A;  2PAV A;  1BGX T;  3TR8 A;  1XHZ A;  1EX4 A;  2GUI A;  3SNN A;  3WQT A;  2F8S A;  4GVE A;  3ZEU A;  1HRH A;  3CC7 N;  4E89 A;  4DR1 K;  1UAX A;  3ZEU B;  4B9S A;  2Q31 A;  2VCP A;  4FJK A;  3H45 C;  1ESV A;  3OYG A;  3HST B;  4KHS A;  1VQO N;  1KFS A;  1B9D A;  3G6E N;  1S6P A;  3G4S N;  3CF5 L;  4BDP A;  1LAW A;  4F9O A;  3O4W A;  2YNG A;  3NGZ A;  4CJ5 A;  4JD2 B;  4OVL A;  2W40 A;  3NAE A;  3K0S A;  5LMN K;  5HRS A;  4BR2 A;  3SV3 A;  4H4O A;  3QEP A;  1QSL A;  3LAN A;  4FPB A;  4AIL C;  4H0O A;  3K5M A;  3O8M A;  4K41 A;  2BDP A;  3NMU A;  3I0R A;  5M1F A;  2I7P A;  1VQ8 N;  4KH4 A;  3RMD A;  2X6N A;  4Z0U A;  1VSJ A;  4JI8 K;  4JEP A;  1VRT A;  3UE5 A;  1U6Z A;  3ENB A;  2OZS A;  2KFZ A;  4XH4 A;  1S9G A;  3NVK A;  3AVI A;  4CHO A;  4FWN A;  2GEL A;  4N47 A;  1WN7 A;  1U4B A;  4C1N I;  1RT1 A;  3VQQ A;  5KQD A;  1HYV A;  1S1X A;  1HYZ A;  3PLA A;  4ICL A;  4HCB A;  2I7N A;  1NK7 A;  5AZJ B;  1NBW A;  4E7L A;  1FW6 A;  3F2K A;  3OVN A;  3DRS A;  2BGG A;  2ZGZ A;  2QWN A;  2ITG A;  1IKV A;  3DI6 A;  4FZZ A;  2D4W A;  3HPO A;  3MXM A;  1RDU A;  2KZZ A;  1BHL A;  3VA0 A;  1Q18 A;  3VGM A;  5I42 A;  1ZXO A;  3EL2 A;  2BH1 A;  4JKC A;  5GIP A;  4CIF A;  5BRD A;  4FOI A;  5EX5 A;  4E19 A;  3R8E A;  1DT9 A;  1B9F A;  3TAN A;  4OKJ A;  4CF9 A;  3WXM B;  4DUZ K;  3QEW A;  4CIG A;  3R1X A;  3FZH A;  3KWG A;  3J8A A;  1NKC A;  1A5X A;  2PZS A;  3CFP A;  3SMP A;  5BPL A;  3L0Q A;  4F3T A;  3C7N B;  4E3S A;  3UKR A;  1D9D A;  1HJR A;  3G0Z A;  1N8R O;  1IG8 A;  3T3F A;  2Y1J A;  3VEX A;  4BRO A;  4DMN A;  1N32 K;  3SJH A;  4DWI A;  1HPZ A;  1NMN A;  2QW9 A;  4MLE A;  4BC4 A;  4Z4F A;  3NGI A;  4DSJ A;  1NGE A;  1YIT N;  3ZSQ A;  5JS2 A;  5TKY A;  4JHD B;  4B9Q A;  1IBL K;  1KVC A;  2NZT A;  4AHS A;  1YF5 L;  2YJE A;  1YJ9 N;  3VF6 A;  1IO2 A;  2ZM6 K;  4CGH A;  1LAV A;  1YJN N;  2FSJ A;  1NGA A;  4IOA L;  2G8F A;  4HUF A;  4FM1 A;  3WT0 A;  3S3O A;  2IAJ A;  2Q0U A;  3HBT A;  3O6W A;  4BR4 A;  4FK4 A;  4CJQ A;  3HI0 A;  1ZBL A;  2YCH A;  3DJC A;  2O8D A;  3T1Y K;  1MWM A;  1P8Z A;  5AQN A;  2E2O A;  1Z05 A;  4V19 S;  4QOZ B;  5D3G A;  3WQU A;  5C42 A;  2HHS A;  5DM7 L;  3O5B A;  2UUB K;  4M7Y A;  1IKW A;  5AQR A;  1BL3 A;  2P9S A;  3TTD A;  1OH7 A;  3NVM A;  4CZI A;  3HRG A;  3VMF B;  1KTQ A;  1C1A A;  4JK7 A;  2YNF A;  4Y1D A;  4BRD A;  5A2Q O;  5AQT A;  4DR5 K;  2UYT A;  3A2F A;  1NJX A;  4YOW A;  1NJY A;  3B8A X;  1TUY A;  1RDD A;  4ISG A;  2IC3 A;  4KO0 A;  3SAH A;  2W6K A;  4FZY A;  4CZG A;  1M1K O;  2O8F A;  2FSN A;  1NMD A;  3CCU N;  2XY8 A;  3MEE A;  3VPZ A;  4BRE A;  1X9J A;  2O8F B;  3CYM A;  3LP1 A;  2HW3 A;  2GEM A;  4FWL A;  3ZYY X;  4OPA A;  3O08 A;  3ZT0 A;  4FWK A;  1L3T A;  1NKB A;  3TPQ A;  1U49 A;  2HHX A;  2OPP A;  4RW8 A;  1XC9 A;  3MCP A;  1C6V A;  3THX B;  2NUB A;  1N5Y A;  1Z26 A;  4IO9 L;  3U9D A;  3DLH A;  4I6M B;  4CZK A;  3CMA N;  4E7I A;  2KLA A;  4N5S A;  1U47 A;  3O9T A;  1HKB A;  1RNH A;  1BI4 A;  3ZET A;  1LV5 A;  3ULE A;  3MK6 A;  3NBP A;  4ILG B;  5ELZ A;  3ULE B;  4FLU A;  4Z4I A;  4CEC A;  2PY5 A;  5HRP A;  2XRI A;  1WB9 A;  2VWK A;  4AHU A;  4HUG A;  3CJA A;  3AVJ A;  1G15 A;  2PYL A;  1QQC A;  4WQ5 C;  3KZB A;  4CJE A;  2ZQB A;  1BOT O;  3RVC A;  4B9T A;  3AO1 A;  1G99 A;  2OTL N;  5LJV A;  4JYA K;  1LOT B;  1TK8 A;  2GV9 A;  4WCE L;  1CZ9 A;  1JLC A;  4DS4 A;  1K8K A;  3AGR A;  5M1Q A;  2GWK A;  3M8S A;  3DRR A;  4J2D A;  2HNZ A;  4M3X A;  2IDO A;  2P9I B;  4BC3 A;  1LWE A;  3LP2 A;  2D0C A;  4BRH A;  4KB1 A;  3VEW A;  4QCL A;  1J6Z A;  2XY7 A;  4M42 A;  2E8A A;  4FSV A;  3D2E A;  1EWQ A;  3O1B A;  4A59 A;  4LFA K;  4BG9 A;  2BTF A;  5AQY A; 
#chains in the Genus database with same CATH homology
 2ZJP L;  4YOT A;  5AQP A;  4HWI A;  4BRQ A;  3FFK B;  5JLH A;  4FWM A;  1C0G A;  1OKJ A;  4A61 A;  3M3Z A;  5F2R A;  4K43 A;  1BO5 O;  1KD1 O;  3E66 A;  5C12 A;  3O9U A;  2CH6 A;  5AFU H;  4JK9 A;  5KPT A;  4MO4 A;  4A62 A;  1P90 A;  4A5B A;  4MO5 A;  4BR7 A;  1GLD G;  1YVN A;  5DM6 L;  2ZJR L;  1JCF A;  4O8K A;  5AQG A;  4J8F A;  2DPN A;  3OA9 A;  4JKH A;  2AA4 A;  4WFN L;  2PFU A;  5AZI A;  2CH5 A;  3WXK A;  4YOU A;  5AQM A;  5AQL A;  4BRP A;  3KHY A;  5AQK A;  2P9N A;  2KHO A;  4DQ8 A;  4WQ5 A;  3GDQ A;  2ASO A;  4LC9 B;  4IOC L;  1RDW X;  3GL1 A;  2WBN A;  1LCU A;  2YX6 A;  3MWT A;  1K73 O;  2WC9 A;  2QWO A;  2A3Z A;  4FPA A;  1GLB G;  1GLL O;  3EN9 A;  3CJC A;  1C0F A;  2Q0R A;  3CPE A;  2QWQ A;  5EY4 A;  4H5W A;  3GE1 A;  4JKB A;  4KH6 A;  4E1J A;  1S3X A;  4CZM A;  1KC8 O;  2OAN A;  2NRH A;  4H0X B;  5M1O A;  3TSP A;  3DXK B;  2KKZ A;  3OBY A;  1BWF O;  3H6E A;  4H0Y B;  3TU5 A;  3QFP A;  3R3L A;  2NRX A;  3SBT A;  2OTJ N;  5M1P A;  5CHI A;  3OHR A;  3F9M A;  3HOT A;  3ZX2 A;  1NWK A;  4IOX A;  3M6G A;  3IMX A;  4GV9 A;  3O9Q A;  3AGK A;  3H1Q A;  2CGK A;  3VTI A;  3CCV N;  2CGJ A;  2NLX A;  4I6M A;  4JNE A;  4BR5 A;  1M90 O;  1YAG A;  1VQ7 N;  1Q86 O;  3HTV A;  2A5X A;  5M1K A;  1E4G T;  2RE2 A;  3VEN A;  1JJ2 M;  3C0B A;  1EO1 A;  4JN4 A;  4Y0W A;  1YJW N;  4A2B A;  3D2F A;  3ATV A;  5JVH L;  1KXP A;  1NM1 A;  3H3N O;  4IZ9 A;  4JKG B;  1Q7Y O;  2Q1N A;  2IVN A;  3FZM A;  3KWI A;  1DGK N;  3EZW A;  3PIO L;  2F7T A;  2A6A A;  2P9K B;  5AQS A;  4K42 A;  5CE3 A;  2P9U B;  3CJ1 A;  1NGH A;  1K9M O;  2ASM A;  3OW2 M;  2V51 B;  2QWP A;  3VEO A;  1Q82 O;  1K8A O;  1VQ9 N;  3C65 A;  3DAW A;  3E1Y A;  3VEZ A;  3CQX A;  3SMS A;  1QQO A;  4U7B A;  1QZ5 A;  1Y64 A;  1KAX A;  1HKC A;  5BR9 A;  3LDN A;  1IJJ A;  4IO8 A;  4Z94 A;  4IJN A;  1QQM A;  1OVY A;  3H3O B;  1NGB A;  4UY8 O;  1GLA G;  3G25 A;  3ID8 A;  1GLC G;  2A42 A;  3A5O C;  3L4Q A;  4MLH A;  4DKW A;  1TUU A;  3D6R A;  3MN6 A;  3DXM B;  4CI6 A;  4BC5 A;  2FF3 B;  1BUP A;  4WYB A;  1QQN A;  4H5T A;  1ATS A;  3EE8 A;  3LL3 A;  3U4L A;  3N4Q A;  5KPR A;  2NRZ A;  3VGK A;  5FPE A;  2E2P A;  3MDQ A;  1VAZ A;  3UB5 A;  1VQ6 N;  4BRC A;  3HSC A;  1O13 A;  3UKR B;  2P9I A;  2GUP A;  5BPN A;  5MLC Q;  3LDO A;  3VEY A;  4FL9 A;  1VQ4 N;  3CME N;  4EFH A;  5GAE P;  3IKM A;  1KAY A;  1VQN N;  4U67 L;  4H0V B;  4BRI A;  2HBM A;  4QS9 A;  3I55 N;  5AQJ A;  3C6A A;  4CBW A;  4JK8 A;  2PAV A;  3AAQ A;  1EQY A;  1ZBS A;  3WQT A;  3A5M C;  3M1F A;  3A0I X;  3ATU A;  4L3Q A;  4GVE A;  3ZEU A;  3MWP A;  3WXJ A;  1GLJ O;  2NRW A;  3CC7 N;  3ZEU B;  2D1K A;  2Q31 A;  4BRK A;  2NNW A;  2VCP A;  2VGN A;  4O8U A;  3H45 C;  1ESV A;  5C10 A;  3CHW A;  1W97 L;  2FXU A;  1X3M A;  1VQ5 N;  3C6H A;  3Q7C A;  1VQO N;  3MX5 A;  3G6E N;  4PL8 A;  1XC3 A;  4H0P A;  3G4S N;  3TSQ A;  2QEX N;  3CF5 L;  2QI2 A;  2E88 A;  3E9O A;  3QBW A;  3VTH A;  3VF2 A;  2HST A;  4F9O A;  3O4W A;  1BU6 O;  2GWJ A;  5BRE A;  3IFR A;  3EE9 A;  1T6C A;  5FPD A;  4OO1 J;  5BPM A;  3PIP L;  4JD2 B;  4QS8 A;  4H5N A;  1WUA A;  3HZ6 A;  1QVF M;  5F0X A;  2W40 A;  3QML A;  1YXQ A;  1V4T A;  3ID6 A;  4IWV A;  5LJW A;  4BR2 A;  4FPB A;  2QWR A;  4H0O A;  5C2F A;  3O8M A;  4K41 A;  3NMU A;  3KVG A;  5M1F A;  3F5T A;  3R6M A;  4CZJ A;  2I7P A;  3P38 A;  2E1Y A;  1VQ8 N;  4KH4 A;  4O5F A;  2AP1 A;  5C15 A;  2HF4 A;  4JEP A;  5AQX A;  4BQZ A;  3UE5 A;  1T44 A;  1U6Z A;  2P9S B;  3ENB A;  4XH4 A;  3DXK A;  3QBX A;  3NVK A;  4CZF A;  4FWN A;  2GEL A;  4CD1 A;  5C0Y A;  2ITM A;  3VES A;  3P39 A;  3AAP A;  4C1N I;  2QTD A;  3CI5 A;  3TSU A;  3LDQ A;  2E2Q A;  4FWP A;  3QB0 A;  5KQD A;  3CCQ N;  3VEV A;  5AQH A;  3PLA A;  3W3D A;  5BN8 A;  5JLF A;  2I7N A;  3W0L A;  4CBU A;  3T69 A;  4AM7 A;  5AZJ B;  3WXL A;  4RWT A;  4C23 A;  4CZH A;  1NBW A;  4BG8 A;  3F2K A;  3GBT A;  3LDP A;  4JKG A;  1T6D A;  5E84 A;  1WOQ A;  3T7Z A;  3VOV A;  3J7Z O;  4BGA A;  4CJ7 A;  3TTC A;  3GG4 A;  2ZGZ A;  3ENH A;  4RCH A;  2QWN A;  2D0P A;  3RSE B;  1HX1 A;  2P9K A;  2QM1 A;  2D4W A;  2W41 A;  1GLF O;  2P9U A;  4WFB L;  1MDU B;  3CCJ N;  4H03 B;  5GIN A;  2HBL A;  4KBO A;  2ZJQ L;  1RDU A;  4JKA A;  4BR9 A;  4YOX A;  1ILY A;  1NGJ A;  1Q18 A;  3H46 O;  3VGM A;  1ZXO A;  3EL2 A;  3SLC A;  2BH1 A;  3CJB A;  4JKC A;  4XEI A;  5GIP A;  1V4S A;  3BP8 A;  2QWM A;  5BRD A;  4A5A A;  4FOI A;  4IDH A;  5EX5 A;  4PKG A;  5AQW A;  3MCA B;  3SAG A;  3R8E A;  1DT9 A;  3HM8 A;  4FWS A;  3WXM B;  2P9L A;  3R1X A;  3DXM A;  1XQS C;  2GX9 A;  3FZH A;  3KWG A;  4CBX A;  3J8A A;  1HKG A;  4BRF A;  2P9L B;  3FGU A;  3SMP A;  5BPL A;  1HJO A;  2YHX A;  1BDG A;  3L0Q A;  3ZET B;  1HLU A;  1JCE A;  1SZ2 A;  1QVG M;  4IEE A;  3C7N B;  4PL7 A;  5KPZ A;  1S72 N;  3AAR A;  3AY9 A;  3UKR A;  2P9P B;  3MN7 A;  3CXC M;  1W2B M;  2HBJ A;  1N8R O;  1IG8 A;  4IEI A;  4B1W B;  5GAD P;  2JWK A;  5AQF A;  1QHA A;  3VEX A;  4BRO A;  2HOE A;  3SJH A;  3IDH A;  3VET A;  4BQL A;  4R79 A;  4YOR A;  3E9P A;  1SAZ A;  2PBD A;  2E20 A;  4IFE A;  2QW9 A;  4MLE A;  4PKH A;  3VER A;  3BF3 A;  1SQK A;  1NGF A;  3ENO A;  4AM6 A;  4BC4 A;  3WUH A;  3BEX A;  4XH5 A;  1NGI A;  1NGE A;  3L4I A;  1YIT N;  3CJ7 A;  3CCM N;  1S22 A;  4JAX A;  5TKY A;  4JHD B;  4B9Q A;  4A2A A;  4CD3 A;  1DEJ A;  1QZ6 A;  2NZT A;  3CCS N;  2Q97 A;  5EXW A;  1YF5 L;  3FE1 A;  5JVG L;  2YJE A;  4ILH A;  4EHT A;  1YJ9 N;  2IIR A;  4HTL A;  3HOS A;  2HBK A;  3VF6 A;  2YI1 A;  4FWR A;  4FOE A;  3ZX0 A;  1HUX A;  3MMV A;  1KAZ A;  1K8K B;  1VQL N;  1YJN N;  2FSJ A;  3BUZ B;  1XUP O;  1NGA A;  4IOA L;  3U8X A;  1D4X A;  5AR0 A;  3WT0 A;  2H3G X;  2Q0U A;  2FF6 A;  3LM2 A;  1NGC A;  3HBT A;  3O6W A;  4QS7 A;  3O1W A;  4BR4 A;  2WUS A;  3HI0 A;  1GLE G;  2YCH A;  3DJC A;  4JD2 A;  4M7X A;  4DB3 A;  1VQP N;  1BA0 A;  1MWM A;  1P8Z A;  3CCR N;  5E26 A;  4GY2 B;  5AQN A;  2E2O A;  1DKG D;  1Z05 A;  3FZK A;  1HPM A;  3JXU A;  3QIC A;  3FLC O;  2FSK A;  2IVP A;  4H5V A;  2F9T A;  2QWL A;  4KH5 A;  4XH1 A;  3LM9 A;  5EVZ A;  2V7Z A;  3D2E B;  3WQU A;  4BRL A;  1KQS M;  5CR4 A;  1VQM N;  5AQV A;  4JKF A;  5DM7 L;  4OPH A;  1CZA N;  3O5B A;  1YI2 N;  3H1V X;  4M7Y A;  5AQR A;  5ADX A;  3EO3 A;  3A8Y A;  1MA9 B;  2VYP A;  2VWB A;  3Q7B A;  1YHQ N;  2P9S A;  3TTD A;  1RFQ A;  3CJ9 A;  3NVM A;  4CZI A;  3HRG A;  3VMF B;  3QFU A;  2HMP A;  4BC2 A;  2E2N A;  4JK7 A;  2RHK A;  5HL7 L;  4BRD A;  5JMV A;  1MWK A;  2QA4 N;  5H1S Q;  1Z6R A;  3JS6 A;  5AQT A;  2UYT A;  3M5R A;  4WF9 L;  2NRR A;  4B1Z A;  2V7Y A;  4YOW A;  4FWO A;  3A5N C;  3B8A X;  1TYQ A;  1TUY A;  5AZI B;  3CCE N;  4IJA A;  4ISG A;  5AFU A;  3EKS A;  3E9L A;  3SAH A;  2YHW A;  2ZWH A;  4JKD A;  1TYQ B;  1YUW A;  3CIP A;  4CZG A;  1T3V A;  2P9N B;  1M1K O;  1R59 O;  4B1V A;  5AZJ A;  2FSN A;  4MDA A;  1NMD A;  3UKU A;  3CCU N;  1BA1 A;  4M63 C;  3A5L C;  4NO7 A;  3VPZ A;  3O9S A;  1X9J A;  2F9W A;  2Q36 A;  4BRE A;  4BRA A;  5B8H A;  5C2D A;  3CD6 N;  3SK3 A;  3UKU B;  5GAG P;  2GEM A;  4FWL A;  4EHU A;  3ZYY X;  4OPA A;  3O08 A;  3S41 A;  3RSE A;  4NB4 A;  3I8B A;  3N4P A;  4FWK A;  2BUP A;  5M1N A;  3MN5 A;  3R9P A;  3FZL A;  4ISF A;  4PHT X;  5AQI A;  4WQ4 C;  3TPQ A;  4YOY A;  3CC2 N;  4BVP A;  4FVU A;  4YOV A;  4YDU C;  5AQO A;  4DCH A;  3MCP A;  4BRM A;  5AQZ A;  4RTF D;  2YJF A;  4C1N K;  4FO0 A;  3MX2 A;  4CZE A;  5GAH P;  4IO9 L;  2FLO A;  5FPN A;  3SAF A;  3U9D A;  4H0T B;  2V52 B;  3P4I A;  5F1X A;  3D7E O;  4I6M B;  2WFB A;  4CZK A;  3CMA N;  2NRT A;  3I33 A;  1ATN A;  1YIJ N;  4BR0 A;  2KLA A;  2ASP A;  3QDK A;  4JKE A;  3O80 A;  2ZGY A;  5BRF A;  4PKI A;  3I56 N;  3KK7 A;  3D2F B;  3O9T A;  4BGB A;  1ZC6 A;  4DHY A;  1NGD A;  1E4F T;  4GV3 A;  5AQQ A;  1HKB A;  2D0O A;  2Q2R A;  4MDB A;  1ATR A;  2HF3 A;  3ZET A;  3ULE A;  3MK6 A;  5GIO A;  3CC4 N;  3IUC A;  3C7N A;  4ILG B;  4H5R A;  5ELZ A;  4B1Y B;  1NJI O;  3LDL A;  3SBG A;  3ULE B;  2P9P A;  5LY3 A;  1BG3 A;  3L6Q A;  4BVO A;  5TKW A;  3K9K A;  1NGG A;  3CQY A;  3P31 A;  3FR0 A;  3VF4 A;  2A41 A;  3DWL A;  3GOI A;  3CJA A;  3BF1 A;  1SS6 A;  1H1V A;  4WQ5 C;  4EAH D;  4B1U B;  3KZB A;  2J4R A;  2EWS A;  4AF1 A;  4NLB A;  4GV6 A;  1BOT O;  4B1X B;  3RVC A;  4EIA A;  4JHD A;  1G99 A;  3WEE A;  3CPW M;  2OTL N;  3CCL N;  2VGM A;  4BY9 C;  5LJV A;  3FZF A;  1LOT B;  3WXI A;  3WEE B;  3VGL A;  1Q81 O;  2A40 A;  4WCE L;  1K8K A;  3AGR A;  3MN9 A;  2JWL A;  4K25 A;  5M1Q A;  4FWQ A;  4CZL A;  3DLL L;  2QXL A;  2GWK A;  4G9Z A;  4GNI A;  1JCG A;  4A57 A;  3TTF A;  3ZX3 A;  5BRH A;  2P9I B;  4BC3 A;  3G71 N;  2ZF5 O;  3OBW A;  2GTD A;  3EKU A;  5KQ8 A;  3K9J A;  1X3N A;  4WQ4 A;  4BRH A;  1NLV A;  3O9R A;  4NLC A;  2YHY A;  2IVO A;  4YDU A;  5EOY A;  3VEW A;  2NRV A;  1J6Z A;  4ISE A;  3CET A;  5HOO A;  4BRG A;  2E8A A;  5AQU A;  4FSV A;  5ADX H;  1VQK N;  4IXC A;  3D2E A;  2E1Z A;  4WFA L;  3U9Z A;  3O1B A;  1U2V A;  4A59 A;  4BG9 A;  4ILJ A;  4BRN A;  2CGL A;  2BTF A;  5FPM A;  1RGI A;  3CER A;  5BN9 A;  5AQY A;  5I9E B;  5JIC A;  1U2V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...