3PIPL

Crystal structure of the synergistic antibiotic pair lankamycin and lankacidin in complex with the large ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
104
structure length
104
Chain Sequence
b'RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL 23S RNA
publication title Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 13
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3pipL01
5JVGL 3CCUN 3CCSN 3CF5L 5JVHL 1M1KO 3CCEN 3PIOL 1VQ7N 3J7ZO 1QVGM 1KQSM 3CCRN 4WFAL 1KD1O 1Q82O 5GAHP 3DLLL 1YI2N 3CD6N 1VQMN 3I56N 3CC7N 3CPWM 1VQPN 4WCEL 1ILYA 4IOAL 1YJ9N 1S72N 4WF9L 1VQ8N 1YITN 3CMAN 1QVFM 1K8AO 1K73O 3G4SN 4IO9L 4UY8O 4WFNL 1VQON 3CCMN 1VQ6N 1Q81O 2ZJRL 3I55N 4IOCL 1VQ4N 1Q86O 2ZJPL 5GADP 1VQNN 3CXCM 1JJ2M 3G6EN 1NJIO 1W2BM 1YIJN 5MLCQ 3CC2N 1VQLN 2QEXN 1OVYA 3CCJN 3G71N 1VQ5N 1YJWN 1VQ9N 1YHQN 1N8RO 3CCLN 4WFBL 5HL7L 5DM6L 3CCQN 3CMEN 3CC4N 2QA4N 5GAEP 3CCVN 1YJNN 1Q7YO 4U67L 3OW2M 1VQKN 2ZJQL 3PIPL 2OTJN 1K9MO 5DM7L 2OTLN 5GAGP 1KC8O 5H1SQ 1M90O
chains in the Genus database with same CATH superfamily
4KHUA 4CJSA 4YFUA 2A1RA 1QE1A 5CZ1A 1MA9B 1L3VA 3KKSA 5HBMA 4N76A 5AQFA 2Q31A 2I5JA 2QXFA 4DV2K 3V9SA 3NCIA 1XHZA 2RHKA 3SAHA 1TKXA 4CZHA 4FWMA 2WONA 3K9JA 5HRNA 1UOCA 3HT3A 2KQ2A 3LWLA 4ILJA 3QBWA 4LSNA 2O8DB 1VQPN 3GG4A 3VQBA 2VWBA 4AM7A 2ZWHA 3S3OA 1SKWA 1YJ9N 1WSHA 3ENHA 3ZSWA 3LZIA 3JXUA 4DTMA 1HYZA 4CJKA 1U4BA 1WSEA 4B3TK 4N56A 1SS6A 1NJZA 4DG1A 4C23A 3ASMA 3CMAN 3VPZA 1QVFM 4JS5A 3SUQA 4J8FA 3C0BA 1DTTA 4BQZA 3A2FA 1ATNA 3TAMA 3NE6A 1TK8A 1KAZA 2XHBA 4DB3A 3OYLA 4JI0K 5T7BA 2FF3B 2XO7A 2R7YA 4CBUA 4GY2B 3TTDA 5CR4A 2YNGA 1JL2A 3OY9A 4JV5K 1XWLA 4KAZA 2NRTA 1U2VA 3DLBA 4Z4EA 3P4IA 3CJCA 2QEXN 1BUPA 5I9EB 3QEWA 2QK9A 2A6AA 5AQKA 4M3ZA 2A3ZA 2RPIA 2G8IA 5IWAK 4BRGA 2V7YA 2GTDA 5AQZA 1SKRA 1QQCA 3WEEB 4E7HA 1VRUA 3LAMA 2NZTA 2OANA 4AHSA 3CETA 3H46O 3K5LA 5FRMA 5F2RA 4C8NA 2E4LA 2A1SA 4U7BA 2RN2A 4CZLA 4E0DA 2ZJQL 3VQEA 3RMCA 4KV8A 4NYNA 4BWMA 5GAGP 3QNOA 1S22A 1NJWA 4ELVA 3WNFA 4Z4CA 4W5QA 3O9UA 1ASWA 2D0OA 2BDPA 2RKIA 4ISGA 2E2NA 4BGBA 5C24A 3ZLJA 5AQXA 3ZSYA 1OVQA 1HNWK 3WQTA 4GNIA 4NYFA 5KGXA 3QERA 3G10A 4H8KA 3DMJA 2Q0UA 4CJLA 1N33K 2X6NA 4J2DA 2FSJA 3SQ1A 2O8EB 3CJ7A 1BG3A 2GBZA 3MCAB 2J4RA 1EO1A 4BY9C 4WCEL 4EHUA 3EZWA 3K0SA 3TI0A 3JAMO 2D0BA 2UXCK 3L0QA 2V7ZA 4EAHD 3U4LA 1K73O 5F0XA 2ASMA 1NOYA 5J1EA 3MN5A 1RCHA 2OPPA 4LF5K 1JLQA 1HMVA 2KFZA 3AA4A 3O8MA 4OKJA 2Q3SA 4KHQA 4IXCA 3C6HA 4LF4K 1GLLO 3NFAA 5GADP 1BWFO 1VQNN 3KLHA 1LAVA 4M42A 3J8AA 3I8DA 1VRTA 1NK0A 3SQ2A 1NGIA 1NGJA 4RWTA 4OJRA 2AJQA 4FWKA 1J5OA 2YHAA 2FSNA 4F2SA 4XIUA 3F9MA 3CCQN 1XC9A 4OKKA 4NLBA 5FDLA 5D3GA 2YJFA 3EL2A 2QKKA 1WLJA 3TWHA 1YJNN 2VG5A 3K5OA 4L3QA 4JKBA 3SAFA 3W3DA 4O0IA 2HNYA 4IWVA 4M45A 4KB0A 4GVEA 3VGKA 1DKGD 1IG8A 4DMNA 5HRSA 4LF8K 4BRDA 3P1GA 5GIOA 1NG9A 5AQYA 4FWSA 4KFBA 3O80A 3RRGA 1S5JA 1WSGA 3AO5A 1RDBA 4K41A 2EX3A 2Q36A 3LDPA 3L4IA 3L2UA 4CGHA 1ESVA 4Y1CA 4AHUA 3FGUA 4N47A 2ATQA 2ITGA 3KD5E 4OX9K 1TYQA 3AVBA 2ASPA 2VQEK 2VQFK 5LMUK 2CGKA 3MECA 5AQOA 4H0YB 1UWBA 1JLEA 4XH1A 4FZZA 3ZETB 1D9DA 3P39A 4M7YA 3BEXA 2O8BB 4AHRA 4RG8A 3RRHA 1NMNA 2FBXA 1HQUA 3PX0A 5AQVA 1C0UA 1XUPO 2ZJRL 4LF7K 4R5PA 1Z26A 4CK1A 4CEEA 4CBWA 4I6MB 5AQRA 4DFJA 4DUZK 3H45C 1BO5O 3FZLA 2IVPA 4ID5A 1RGIA 3G71N 3RTVA 3QNNA 4JI5K 4E89A 2P9KA 3AV9A 1S6QA 3SPZA 3O08A 4H5NA 1RT5A 1IG9A 1W7AA 1NBWA 3AVFA 4KB1A 3PX4A 2HHUA 4KPYA 2BTFA 1SL0A 2HHSA 2KFNA 1RT6A 4FJGA 3CQ8A 4U67L 2QW9A 3VQ4A 3OW2M 3ZX3A 2WUSA 4OLBA 1S1TA 1K9MO 2OTLN 2OCEA 3KKRA 4FW2A 2KTQA 4H0XB 3EKUA 3WXLA 4IBNA 1ZC6A 1T44A 4ISFA 2P1JA 1S1WA 3U6FA 4BRHA 4DV5K 4Z0UA 3QEXA 2B6AA 3PIOL 5AQHA 4N41A 4KBOA 2PYJA 4CF8A 5IT9O 4FSVA 3TSPA 3QFPA 4DV4K 5C25A 5FLXO 2GUPA 3A0IX 4DHYA 4CK3A 1HNXK 2XY6A 2ZQBA 3OYBA 4H4MA 4J2AA 1W97L 4YDUA 2VWJA 2E6MA 1GLFO 3UKUA 2VWKA 3NBPA 3Q7CA 5BRDA 1YXQA 4LH5A 1FKPA 3SBTA 3AA5X 3NH2A 4JHDA 2WBNA 1OKJA 3CJAA 5AR0A 3BY5A 5LL6Z 4FW1A 4CI6A 3MX5A 4IO9L 4UY8O 1IBLK 5AQUA 1BCOA 2G8WA 1VSLA 3PV8A 1A5WA 1BU6O 1J6ZA 1RBUA 3AO3A 1TV6A 1Y97A 3RMDA 2Z1JA 1S1UA 3ULEB 3UE5A 3CXCM 1JJ2M 2JWLA 1W2BM 5BR8K 5JS2A 4DTRA 1OVYA 1HR0K 5EVZA 1RBTA 2QXLA 3DXKB 1NGFA 4IO8A 5LJVA 2Q97A 2P9SA 1YHQN 1IJJA 3OS2A 2ZE2A 2CGLA 1VK0A 5CE3A 4BRFA 4W5TA 5AQQA 1WB9A 1SAZA 3L3UA 3OYGA 4CEAA 1RBVA 4DF8A 2E2QA 2OZSA 3VEZA 2HVIA 4CEDA 3DOKA 2BH1A 3CQXA 4CEZA 2O4GA 1W0HA 4BC3A 3SV4A 3ZT1A 3C94A 1IKWA 4CJTA 5J2NA 4RTFD 3CCUN 4F4KA 3VESA 1BI4A 3UB5A 1HPMA 1HJOA 1A5XA 3AY9A 1S3XA 1RDWX 5KRTA 4F9OA 1Z6RA 4ISEA 4YOYA 4K8ZA 1QVGM 5F1XA 3VF6A 2VYPA 1RNHA 3SI6A 4B9VA 3N4PA 3OYHA 4FOEA 5JLFA 4HVJA 3NH0A 3VQDA 4JS4A 3VA0A 4H4OA 3LPTA 3MAQA 3G0ZA 2E8AA 4CJVA 4CGGA 4DSFA 5CY4A 2FF6A 2PFUA 1ATSA 2DFEA 4CEOA 1U47A 5HP1A 1N36K 4X62K 3KTQA 3I0SA 2UUAK 4FYDA 3DXMA 3QO9A 3TU5A 4DCHA 5J2MA 5AQSA 3SQ4A 4MDAA 3KHYA 1EWQA 1BISA 3DJCA 4DU4A 3CJ1A 2UYTA 4L8RB 4JD2A 3VQ8A 4JYAK 1BQNA 1LAWA 1XHXA 5CYMA 3RVCA 3WNEA 4YORA 2OPSA 4E1NA 1NJIO 3O9SA 1T7PA 1NK8A 4HHTA 1QZ6A 1DEJA 4QS8A 4RW9A 4I7FA 2YKMA 3AVIA 3D7EO 3THWA 2IOCA 4DU1A 3D2EB 4EP4A 3MDQA 3O4NA 3MXJA 4FL9A 3EN9A 3B8AX 4KI4A 4FOIA 2Q2RA 4KI6A 3T7ZA 4BE1A 3CERA 1Q7YO 4FLZA 4JAXA 4DQPA 4F8RA 4NCGA 4FLXA 2UUCK 3D6RA 3NDKA 1NGDA 5AFUA 1QQNA 3CPEA 4DFKA 1OH5A 3PO5A 1GOBA 1T03A 4DR2K 1M90O 1DLOA 2XY8A 2KKZA 3MEEA 3P38A 2PYLA 2HW3A 1HQEA 3QICA 4OO1J 4DSLA 4PKHA 1RTDA 3V6DA 2HHXA 4JRQA 4JEPA 3RWUA 4PHTX 2BE2A 1YVUA 1X9MA 4WYBA 5BPLA 3DLHA 3CM6A 3J7ZO 4CJFA 2E2OA 3J7AP 4GMJB 3RMAA 1RT7A 4PA1A 4CEBA 4FK2A 3HO1A 2I7PA 1Z05A 4H03B 4DKWA 3CD6N 4CHPA 4OKEA 4YNQA 4M3TA 1Q8IA 4BR5A 3VEWA 2BGGA 1VSFA 1CZBA 2OPQA 2DFHA 4OGEA 1YVNA 1ILYA 4BRPA 3D2FB 4XH5A 3LP2A 3MN7A 2GV9A 3MK6A 4DSKA 3O3FA 4HTLA 1T6DA 1U2VB 1UA1A 4JI4K 4WFNL 3SNNA 3GL1A 4CZKA 2IGIA 5CHIA 1VQ6N 3VN5A 3GE1A 4CJ5A 2YKNA 2YI1A 1RT4A 3WUHA 3SCXA 4KH6A 1Q86O 3L2VA 2ZJPL 2E1ZA 2P9PB 4AHTA 1LWCA 4BR2A 1HYVA 3MEGA 4FPBA 3CC2N 3RSEA 3AVCA 2HHQA 2XY7A 3B6PA 4FWLA 1W9HA 3NMUA 2P5GA 2Y1JA 4NXMK 5M1OA 4DF4A 5AQWA 4Z4FA 2DFFA 3CMEN 1NGGA 3I33A 1KLNA 2QTDA 4M3UA 5LY3A 1ATRA 2Q1NA 4FJXA 3DWLA 5M1KA 5M1FA 2FXUA 5E84A 3DM2A 4CGDA 1SQKA 5EU7A 1XNQK 3KK3A 1Q9XA 1D9FA 4B1WB 5BN9A 1KCFA 3F9KA 3N4QA 4CHOA 1JLBA 4CZJA 5FPDA 4DR3K 5AJ3K 5DMRA 1X9SA 2QWPA 3UIQA 4JKHA 5JVHL 4CF0A 1CZAN 1HUXA 3VEXA 1T8EA 3U3GA 3F2KA 3TARA 4IG0A 4CIFA 1L5UA 2UU9K 3MCPA 1NK5A 4YHHK 3VQ7A 3LP1A 4CHQA 2X6SA 4B1XB 2HF3A 2O8DA 1NJXA 3OBYA 3QBXA 1XI1A 3QIOA 1KVAA 4DTOA 1J5EK 3BGRA 3VQCA 4FJHA 4LFAK 3ZT2A 1S72N 3H6EA 4BR9A 1XQSC 4MQ3A 4HWIA 4BE0A 3EZ5A 1VSHA 1JLGA 2Z1GA 4OLAA 3D45A 3K2PA 3V81A 5C2FA 3JSMA 4E19A 3WQUA 4E1MA 2NRWA 3ZSZA 4C1NI 4M3YA 2GX9A 2YV0X 1IH7A 2P9LA 3KWIA 4E3SA 2YNFA 4UQGA 4IOCL 3LM9A 2VCPA 5EOYA 4CGJA 4OGCA 4FJJA 5KRSA 1NLVA 2B5JA 4G1QA 2V51B 3OS0A 4H5TA 3V1QA 3THXA 1N32K 4Q0BA 4JKDA 3TTFA 5MLCQ 1T6CA 2UUBK 2FSKA 3QFUA 3WEEA 2HHVA 4C8KA 5BRHA 3FR0A 1C0MA 4XEIA 3OJUA 1TUYA 5HL7L 4V19S 2YHWA 4YDUC 5HOOA 1BIZA 2QKBA 1BGXT 1C0TA 3U9ZA 2B4JA 4O44A 2Q0RA 2GWKA 5ADXA 1VQKN 4CZFA 3EE8A 4ID1A 4A59A 4JLHA 3CHWA 1N34K 2EHGA 3ZYYX 2DPNA 3NGYA 4CBXA 4FPAA 2ITMA 1F21A 4E7IA 5KI6A 1TKZA 5HLFA 1Q18A 3IKMA 4DFPA 1C0GA 1KTQA 4DR6K 3HJFA 4CERA 4W5NA 1WBDA 2HBLA 1X9WA 4K25A 4BC4A 4DLEA 1VQ7N 1CXQA 5K14A 1SV5A 2F7TA 5J2QA 1TYQB 4DU3A 2HMPA 3ZT0A 4IFVA 1IKVA 4FM1A 3DAWA 4ILHA 1ZBUA 4KH5A 5E41A 1SL1A 3LDNA 4FLYA 3P31A 4BWJA 1P90A 5EY4A 4Q5VA 4EZ9A 2NNWA 4NLCA 2A41A 1RT1A 4ZTFA 1TL3A 1KAYA 2P9NB 4B3OA 3R8EA 4RW4A 4DR4K 1S1XA 3OYNA 4MLEA 4BVPA 1KXPA 3D0PA 4LD0A 2LSNA 1VSKA 4FCYA 1L3TA 3L4QA 4CJUA 3AGKA 4B08A 4KHSA 4FK4A 3ZEUB 3LDLA 1NM1A 3TR8A 4FLVA 1JKHA 1J9AA 1TK0A 3OBWA 1TL1A 1MDUB 1NKBA 2O8FB 2A40A 3HOSA 1G15A 4BC2A 1VSDA 3VQ9A 5KQ8A 3DLGA 4K0KK 1BA1A 5EXWA 4H0OA 4GW6A 5HRRA 4CGFA 3M3ZA 1VSEA 4WQ5C 2IAJA 4B8AB 4DV3K 4BC5A 3CC4N 3PX6A 3JYTA 4WQ4C 4FZYA 3T1AA 3S3NA 2F8TA 4BRNA 3J80O 3BZCA 4A57A 1HNIA 4KHYA 2ZF5O 4RW8A 3QMLA 3O4QA 3M8QA 3PY8A 1A5VA 2YHYA 4F2RA 3V1RA 1B92A 2ETJA 3C7NB 3PUFA 1I3AA 5AZJB 1WUAA 5LJWA 1WN7A 4HTUA 3A5OC 3QINA 4CEQA 4CF2A 4E7LA 3A5NC 3SAGA 2P9IB 1NK9A 2NLXA 3O9RA 4MDBA 3SUPA 3ZX0A 1SUQA 4O8KA 1GOAA 3OS1A 4C8LA 4N5SA 1U49A 4B9UA 4FWQA 5C10A 3HPHA 2IDOA 1D4XA 3HP6A 4QCLA 3LDOA 1KD1O 3KK7A 4DTNA 4QAGA 1QSLA 4DQIA 1IKXA 2HB5A 5BR9A 3ULDA 1YI2N 1QS4A 3SJHA 3MMVA 4WE1A 4KH4A 3FZMA 3G25A 2E2PA 3LAKA 3ZETA 1BHLA 1P8ZA 2JWKA 4DUYK 4AQYK 2ZD1A 3GBTA 3L2WA 1RBRA 2E1YA 4WF9L 1YITN 1VSJA 2VG6A 4KO0A 1WSJA 2HBKA 3IUCA 2D0AA 4C1NK 4YOVA 4H5VA 4I6MA 3KK2A 3NHGA 4IKFA 3MWPA 3M8SA 3CFOA 4O4GA 2P9SB 3J81O 5BPMA 4B8CA 4X65K 1BA0A 2E88A 1H1VA 3IDHA 1EXQA 3LPUA 4LC9B 3HSTB 2BANA 4YOTA 1Y64A 3L3VA 3VERA 1RFQA 3ZX2A 4FWOA 4BR7A 1TAQA 2GWJA 4JKAA 3DLRA 4CE9A 3UKRB 4IFEA 3BF3A 4F3TA 5GAEP 5CYQA 3SBGA 5TKWA 4MFBA 1NMDA 2HBJA 3QEIA 1K8KA 2P9UA 3JS6A 2O4IA 4DTXA 3FFIA 1V4SA 5C12A 2OTJN 4BG9A 5AQTA 3ID8A 1C1AA 3P5JA 1RBSA 1OH6A 3HPGA 4EHTA 1MWMA 5KQDA 4BRCA 4JKGB 2NRXA 2XRIA 5JVGL 1VHXA 4CZGA 1R0AA 2E5LK 3CQYA 5AQGA 3VA3A 3WXKA 3HK2A 3AO4A 4PUOA 3WXMB 3EYZA 3HBTA 2JLEA 4CJ7A 2HHTA 4I2PA 4CESA 5JMVA 1X3NA 3MN6A 2YX6A 4CJ4A 1HLUA 3OYCA 4PWDA 5GAHP 2HVHA 5C15A 2RF2A 3V9UA 2YCHA 3TPQA 4CD1A 2IS3A 5KPRA 3C65A 1T05A 4LH4A 3VQQA 5HRPA 4CD3A 3HPOA 3ITHA 4IZ9A 2CH6A 3AVMA 1O1WA 3H3OB 3ZSQA 2KLAA 4DV0K 3LL3A 2PZSA 1VQ8N 4YOUA 1UAXA 1HJRA 1S1VA 4I2QA 4CHZA 1K8AO 2IIRA 4O5FA 3ZSOA 4MO5A 3KJVA 1HKGA 4DR1K 1NK6A 3F5TA 4B3MK 1YT3A 3LP0A 3FZFA 3LANA 1JXBA 3ULEA 1K6YA 2E20A 2BUPA 4WQ5A 3ZCMA 4AHVA 4OPHA 4BVOA 3THWB 2D0CA 1HRHA 4BGAA 2VG7A 3DXKA 3HTVA 4WQ4A 4A5AA 1ZBHA 4CCHA 3E1YA 4DSEA 1GLBG 3HP9A 4JK9A 1FJGK 1NGCA 2WOMA 1XNRK 5AQNA 3MN9A 5FPMA 4M3RA 2F9WA 2HMIA 1ZBIA 2HF4A 3I8BA 1YTAA 3IMXA 3PSFA 4AF1A 3ATVA 4CK2A 1BQMA 3KK1A 3HSCA 4IEEA 2VGMA 3VTHA 4IJNA 3H3NO 3HL8A 5M1NA 2YNHA 2FBVA 3THYA 4B3SK 3WXIA 3NF7A 3H08A 4PKIA 3VQAA 2W42A 2JGUA 3A5MC 3WT0A 2XY5A 3QIPA 3AO1A 3L2RA 4MO4A 2O8CB 1JXEA 3A5LC 5KTQA 3CCSN 3RR8A 4C8OA 4EFHA 5BREA 1JLFA 4W5OA 1C6VA 1S9GA 4B1UB 4IJAA 4FLUA 3SZ2A 1WOQA 2VGNA 1LCUA 3LALA 3O1WA 3NAEA 1KFDA 1RDUA 3SJJA 2WTUA 1J54A 3SYZA 3VQPA 1HKCA 1RDDA 4CFCA 3LP3A 3DRRA 4JI8K 2GEMA 3DLLL 1TKDA 1VQMN 3I56N 5DK5A 5AZIA 5KPZA 4MLHA 1LV5A 3OYJA 4M41A 3SUNA 3U9DA 4BRLA 5B8HA 4DV1K 2ZGZA 3PO4A 4IEIA 3AVHA 2HOEA 4DS5A 2A5XA 3K5NA 1QQMA 2D5RA 2OZMA 3B6OA 1WAJA 3G4SN 2OYQA 5GIPA 1X9JA 3WXJA 1RTJA 4QS7A 3E9LA 5BPNA 4EZ6A 2A42A 4A2AA 4BDYA 3OYMA 1X1PA 3O3HA 1WBBA 3OYEA 3TAFA 4DSIA 1ZBLA 1TAUA 4FO0A 3H1QA 1EKEA 1FXXA 3BZKA 3E01A 3EKSA 4O0JA 4B1VA 4BG8A 1LW2A 1YJWN 1VQ9N 2KHOA 1KFSA 4Y1DA 4E7KA 1ITGA 4WFBL 3CCLN 2DTUA 3NVKA 3ZT3A 3K58A 2OPRA 4Z4HA 4OPJA 3ZSRA 3BDPA 3AGRA 2ZM6K 4JN4A 4CZEA 4ILGB 4ELTA 4IDHA 1JCGA 4BR4A 4NCAA 4KHWA 4ZHRA 1RTHA 3VF2A 3O5BA 1J53A 3C95A 2H3GX 2UXBK 2QWOA 1RT2A 4IDKA 2WFBA 3LM2A 4BE2A 3S9HA 1NKEA 1EWRA 4IG3A 4JI2K 4XH4A 3QESA 1U6ZA 4CGIA 1N6QA 2P51A 2FBYA 3T1HK 3AVAA 1KRPA 4DQQA 3ZSXA 4BRAA 1RT3A 3EY1A 1O13A 3F73A 4BDZA 3V4IA 1R59O 3OYKA 4FJIA 2PBDA 3KLFA 2ASOA 4HUGA 4FLTA 4JI7K 3NH1A 3R3LA 1IO2A 2Z1HA 4JK8A 2GELA 3KVGA 1KAXA 4PL7A 3ENOA 3E9OA 1MWKA 4OVLA 4DTUA 3U3YA 5KPTA 3O9TA 4BR0A 2YJEA 3BF1A 1NJYA 4FJNA 3CM5A 3L6QA 3MWTA 1ASUA 3D2FA 4B9SA 3KWGA 1B9FA 3U8XA 4JK7A 2AA4A 3DYAA 4IOAL 2P9LB 3EO3A 4FVMA 5JICA 4YY3K 1U45A 4DTJA 3AVGA 3ENBA 4J2EA 4JKCA 5TKYA 3NGZA 2F4VK 1KSPA 4BROA 3THXB 1TK5A 1ASVA 3HVTA 5AQLA 1NK4A 3HM8A 2P9PA 3SLCA 5JS1A 3DLKA 4ZTJA 5EX5A 2QM1A 4H5RA 1QSSA 4B9QA 4GV9A 4CIEA 3PLAA 4K42A 3K59A 5FRNA 3G6EN 4Y0WA 1TGOA 2G8VA 2HSTA 3NVMA 3THVA 1JCFA 3VMFB 1FW6A 4CFBA 3NGIA 1YAGA 1N8RO 3IAYA 4W5RA 4DSJA 1EX4A 2W6KA 4CF1A 5BRFA 3OVNA 4FJ5A 3Q7BA 1L3SA 2HNDA 3DOLA 4H0VB 4FJ7A 3NF8A 3OYAA 3WNGA 3I0RA 1DTQA 2G8FA 3AVLA 2V52B 2QWMA 5H1SQ 1TKTA 3VOVA 1RTIA 4JKEA 5JLHA 5SWMA 3T3FA 3T69A 3LZJA 4FJKA 2D4WA 2HHHK 4QS9A 1NGBA 4E1JA 1S6PA 1NU0A 4DQSA 3VF4A 1QTMA 4Z4IA 3HYFA 4M7XA 4I9QA 3PSIA 2HHWA 3KLEA 2G8UA 2QWNA 2FC0A 1YTUA 3K57A 5KGWA 3CCRN 1I39A 2CGJA 1DGKN 1RILA 4FK0A 5AQPA 4E7JA 4G9ZA 3SV3A 4DV7K 2FBTA 1HYSA 1YF5L 3QLHA 1NKCA 3OYDA 3SK3A 3CPWM 1GLAG 3AAQA 3FLCO 3RMBA 2YHBA 1BCMA 5A2QO 3LDSA 4FM0A 4KRFA 4JI6K 4DR5K 2O8EA 1ZBFA 1REVA 3DI6A 3FE1A 2Z1IA 5M1PA 5GINA 1N5YA 3O3GA 3VEOA 4KHPK 2FLOA 3RR7A 5C42A 3AARA 5AQJA 3I55N 4IOXA 4PY5A 4F3OA 2NUBA 1WSIA 4B1YB 4FVUA 2DY4A 2NRZA 2I7NA 3TAEA 2W6LA 5AQIA 3DRPA 3ID6A 1HNVA 4BREA 1BIUA 1KLMA 3M6GA 3ZT4A 3NF9A 3OYIA 3HM9A 4A2BA 1E4FT 1HKBA 4AHCA 4CJWA 1HX1A 2P9KB 4LF6K 3MXIA 1E3MA 2NRRA 1TVRA 3R6MA 1BL3A 3FFKB 1LW0A 1GLEG 3AVJA 1WNSA 4TSXA 4LFCK 4CJEA 4FWRA 3CFRA 4O55A 4NB4A 1HNZK 5DM7L 1QZ5A 3O6WA 5SZTA 3AVNA 3OYFA 3OHRA 1KC8O 3M8PA 3VQ6A 3KLGA 1SL2A 3R1XA 4CHNA 2HBMA 4O5BA 4NCBA 3CF5L 1JL1A 3OJSA 2F96A 3P83D 1S9EA 4KTZA 1M1KO 1C0FA 3CCEN 2QWLA 3QB0A 2KZMA 3NF6A 4CF9A 1U48A 3AVKA 1WAFA 3IRXA 1GLCG 4FJ8A 4WFAL 4DQRA 2P9NA 4JI3K 4KHNA 1VSIA 3M5RA 1LOTB 4HCBA 4CHYA 4CJPA 3TANA 1B9DA 3TAPA 3HVRA 2E6LA 2YHXA 2QI2A 3ALYA 3AA3A 3AA2A 5M1QA 3V1OA 4GKKK 3SPYA 3ZEUA 5AFUH 1L3UA 2GUIA 5E26A 4DV6K 4C8MA 4PL8A 3HRGA 1VAZA 4ICLA 3LWMA 5AQMA 3VTIA 4FXDA 4B9LA 4KTWA 3UKUB 4ELUA 3IG1A 3VGLA 4YOWA 2O8FA 3MEDA 5I42A 3T19A 3CCMN 1EP4A 2D0PA 4JHDB 3ISNC 3DRSA 2D1KA 3GDQA 4LY7A 4DLGA 2G8HA 3VEVA 2Y1IA 3CIPA 1NGHA 4DFMA 2O8BA 1Q9YA 4B1ZA 1Z25A 4CFAA 3R9PA 4CIGA 3HXMA 3AO2A 3CCJN 3L8BA 4BQLA 4OPKA 3V9WA 1QQOA 4H5WA 1K8KB 2P9UB 1OH7A 3WNHA 4FZXC 3O1BA 4Z94A 1HPZA 3CJBA 2ZGYA 3LDQA 4DWIA 2CH5A 3VEYA 2F9TA 4A62A 4CZIA 2OA8A 3ATUA 3CI5A 3C7NA 5AZJA 4O8UA 5FROA 4CW7B 3E9PA 2UXDK 1BOTO 2YNIA 3V9ZA 5J2PA 4YOXA 5LMNK 4X64K 5C2DA 4AM6A 2P9IA 4EP5A 4JKFA 1KVBA 1IBMK 1WSFA 3TSUA 5ELZA 4M63C 4KREA 3SMPA 4KKOA 1KVCA 1BI4B 3CG7A 3TTCA 1G99A 4J2BA 5I3UA 3C6TA 5FPNA 1LWFA 4HCCA 4AH9A 1D5AA 3MX2A 1XMOK 2KW4A 2QWQA 4CVNE 1CLQA 1QSYA 2X78A 1CZ9A 4IFYA 4LFBK 2G8KA 1IKYA 4QOZB 3HZ6A 3S3MA 3E66A 3TSQA 1I94K 4DTSA 1YUWA 2IC3A 4Z4GA 1NOZA 3BUZB 3H1VX 4JNEA 1SZ2A 4OPAA 5BN8A 4B9MA 4GKJK 3DXMB 1VQON 3ZSVA 1VSMA 4JRPA 3FZHA 4I9LA 1VQ4N 4K8XA 1QHTA 2X74A 5FPEA 1TUUA 5CZ2A 2NRHA 3EEQA 2PAVA 4GV3A 3UKRA 1YIJN 2EWSA 4JD2B 1VQLN 3VETA 3TAQA 4FM2A 1EQYA 3CYMA 1VQ5N 4LF9K 4BACA 3THYB 3VQ5A 4DR7K 1GLDG 4CECA 1NGEA 4RW7A 4HUEA 1JCEA 1CXUA 3AAPA 5DM6L 1RDCA 2QA4N 2RE2A 3M1FA 2PY5A 4K43A 4CEFA 3C6UA 4GVMA 4LSLA 4BRKA 4KTQA 1NNEA 3VENA 4JKGA 3SMSA 3T1YK 3KLIA 3PIPL 3O9QA 3V9XA 3KZBA 4DS4A 1IV0A 3EE9A 3A8YA 4A5BA 4JI1K 3K9KA 4A61A 1GLJO 5C0YA 1T3VA 1DT9A 4BRIA 4FJLA 4PQUA 3K5MA 2KZZA 3HOTA 1U04A 4FWPA 2W41A 4BRMA 4AILC 5AZIB 3C6AA 2IVNA 1LWEA 2HNZA 3QEVA 2F8SA 1SKSA 3S41A 1KQSM 4BRQA 4CJQA 3FZKA 3IS9A 1Q82O 2NRVA 1EETA 3DLEA 3VGMA 3M8RA 1FKOA 3L2QA 3QETA 1UA0A 1XMQK 3CC7N 3SQ0A 4FLWA 4B9TA 5ADXH 3IFRA 3MXMA 1ZBSA 4BDPA 2W40A 3O4WA 3SUOA 4CZMA 1GOCA 4M3WA 1IBKK 4CJ3A 3HI0A 1V4TA 1JLAA 1RDAA 4DTPA 3TAGA 1NGAA 4RCHA 3TABA 4FWNA 1BDGA 1E4GT 3CJ9A 4EIAA 1Q81O 1OH8A 1C1CA 4PKGA 4M3XA 1XC3A 3BP8A 4NO7A 3J7YP 5HROA 4NXNK 2AP1A 4DQ8A 4FJMA 4X66K 2P5OA 1JLCA 1X3MA 4H0PA 1NK7A 4HUFA 3OTOK 4RW6A 4B3RK 4CFDA 1MU2A 1ZXOA 2IVOA 3QEPA 3RSEB 1QHAA 3KIOA 4H0TB 1ZYQA 1D8YA 3CCVN 3OA9A 1NWKA 1FK9A 4B9NA 4FJ9A 1C1BA 3GOIA 3CFPA 3W0LA 2O8CA 4R79A 2QWRA 2WC9A 3D2EA 3QDKA 3KD1E 4GV6A 4CJRA
chains in the Genus database with same CATH topology
4RTFD 5LJWA 3CCUN 4JKEA 1MA9B 3A5OC 3VESA 5JLHA 3UB5A 1HPMA 1HJOA 3T69A 3A5NC 2D4WA 3SAGA 2P9IB 2Q31A 4QS9A 5AQFA 1NGBA 2NLXA 4E1JA 3AY9A 3O9RA 4MDBA 1S3XA 3VF4A 3ZX0A 4O8KA 1RDWX 4M7XA 4F9OA 1Z6RA 4ISEA 4YOYA 2RHKA 4FWQA 5C10A 5F1XA 2QWNA 3VF6A 1QVGM 2VYPA 3SAHA 1D4XA 3CCRN 2CGJA 1DGKN 3N4PA 4CZHA 4FWMA 3LDOA 5AQPA 4FOEA 1KD1O 3KK7A 5JLFA 4G9ZA 3K9JA 1YF5L 5BR9A 1YI2N 3SJHA 3MMVA 4ILJA 4KH4A 3QBWA 2E8AA 3SK3A 3FZMA 3G25A 2E2PA 2FF6A 2PFUA 3ZETA 1ATSA 1P8ZA 2JWKA 3CPWM 1VQPN 3GG4A 2VWBA 4AM7A 1GLAG 2ZWHA 1YJ9N 3AAQA 3FLCO 3ENHA 3GBTA 3JXUA 1SS6A 4C23A 3DXMA 2E1YA 4WF9L 3TU5A 1YITN 4DCHA 3CMAN 3VPZA 1QVFM 5AQSA 2HBKA 3C0BA 4J8FA 3IUCA 3KHYA 4MDAA 4BQZA 3FE1A 5M1PA 1ATNA 3DJCA 4C1NK 5GINA 4YOVA 3VEOA 3CJ1A 1KAZA 4H5VA 2UYTA 4I6MA 4DB3A 3MWPA 2FLOA 3AARA 5AQJA 3I55N 2FF3B 2P9SB 4IOXA 4JD2A 4CBUA 5BPMA 4B1YB 4FVUA 4GY2B 2NRZA 3TTDA 1BA0A 2E88A 2I7NA 5CR4A 1H1VA 3RVCA 4YORA 3IDHA 5AQIA 4LC9B 3ID6A 2NRTA 3O9SA 1NJIO 1U2VA 3P4IA 4BREA 3CJCA 4YOTA 1BUPA 1QZ6A 1DEJA 1Y64A 5I9EB 3M6GA 4QS8A 2QEXN 3VERA 1RFQA 3ZX2A 2A6AA 4FWOA 4BR7A 3D7EO 5AQKA 2GWJA 4JKAA 2A3ZA 4A2BA 3D2EB 1E4FT 3UKRB 3MDQA 1HKBA 4IFEA 3BF3A 4BRGA 2V7YA 2GTDA 5AQZA 4FL9A 3EN9A 1YIJN 3WEEB 3B8AX 4FOIA 5GAEP 2NZTA 2Q2RA 2OANA 1HX1A 2P9KB 5TKWA 3SBGA 3T7ZA 3CETA 3H46O 1NMDA 2HBJA 2NRRA 3VOVA 3R6MA 3FFKB 3CERA 1Q7YO 1GLEG 5F2RA 4JAXA 1K8KA 4U7BA 2P9UA 3JS6A 4CZLA 4FWRA 3D6RA 1V4SA 5C12A 1NGDA 5AFUA 2ZJQL 2OTJN 4BG9A 5AQTA 1QQNA 3CPEA 4NB4A 3ID8A 5DM7L 1QZ5A 3O6WA 5GAGP 3OHRA 1KC8O 4EHTA 1S22A 1M90O 3R1XA 1MWMA 2HBMA 4BRCA 4JKGB 2NRXA 5KQDA 5JVGL 2KKZA 3O9UA 3P38A 3CF5L 2D0OA 3QICA 4CZGA 4OO1J 4ISGA 3CQYA 2E2NA 4PKHA 4BGBA 5AQGA 4JEPA 1M1KO 4PHTX 1C0FA 3WXKA 3CCEN 5AQXA 4WYBA 5BPLA 2QWLA 3QB0A 3WXMB 3J7ZO 3HBTA 3WQTA 2E2OA 4GNIA 4CJ7A 1GLCG 5JMVA 1X3NA 3MN6A 2YX6A 4WFAL 1HLUA 2I7PA 2Q0UA 1Z05A 5GAHP 4H03B 5C15A 2FSJA 2P9NA 4DKWA 2YCHA 3CJ7A 3CD6N 3TPQA 4CD1A 5KPRA 1BG3A 3C65A 3M5RA 1LOTB 3MCAB 2J4RA 4BR5A 3VEWA 4CD3A 2YHXA 1EO1A 1YVNA 4BY9C 2QI2A 4WCEL 4IZ9A 4EHUA 1ILYA 4BRPA 2CH6A 3H3OB 3D2FB 3EZWA 4XH5A 5M1QA 2KLAA 3LL3A 3ZEUA 5AFUH 3MN7A 5E26A 3MK6A 3L0QA 4YOUA 4PL8A 3HRGA 1VAZA 1VQ8N 2V7ZA 4EAHD 5AQMA 3U4LA 3VTIA 5F0XA 1K73O 1K8AO 3UKUB 2ASMA 2IIRA 4O5FA 3MN5A 4MO5A 1HKGA 4HTLA 3F5TA 1T6DA 1U2VB 3VGLA 4WFNL 4YOWA 3CCMN 3GL1A 3ULEA 3FZFA 4CZKA 5CHIA 2E20A 2BUPA 4WQ5A 1VQ6N 3O8MA 4OPHA 2D0PA 3GE1A 4JHDB 4BVOA 2D1KA 2YI1A 3GDQA 4IXCA 3WUHA 4KH6A 3C6HA 4BGAA 1Q86O 3VEVA 3CIPA 1GLLO 2ZJPL 1NGHA 3DXKA 2E1ZA 1BWFO 2P9PB 3HTVA 5GADP 1VQNN 4WQ4A 4A5AA 4B1ZA 3E1YA 4BR2A 3R9PA 4FPBA 3CC2N 1GLBG 3J8AA 4JK9A 3RSEA 3CCJN 1NGIA 4BQLA 1NGJA 1NGCA 1QQOA 4RWTA 4H5WA 4FWLA 1K8KB 4FWKA 3MN9A 5AQNA 3NMUA 2FSNA 2P9UB 5FPMA 5M1OA 5AQWA 3F9MA 3CCQN 2F9WA 3O1BA 3CMEN 4NLBA 4Z94A 2HF4A 3CJBA 2YJFA 2ZGYA 3LDQA 3I8BA 1NGGA 2CH5A 3EL2A 2QTDA 2F9TA 3I33A 3IMXA 3VEYA 3ATVA 1ATRA 4A62A 4AF1A 5LY3A 3HSCA 4IEEA 4CZIA 1YJNN 2Q1NA 2VGMA 3ATUA 3CI5A 4IJNA 3H3NO 4L3QA 3VTHA 3C7NA 4JKBA 3SAFA 3DWLA 5M1NA 5M1KA 5AZJA 3W3DA 5M1FA 3WXIA 4O8UA 4IWVA 2FXUA 4PKIA 5E84A 3E9PA 4GVEA 1BOTO 3A5MC 1SQKA 3VGKA 3WT0A 4YOXA 1DKGD 1IG8A 4MO4A 5C2DA 4AM6A 5BN9A 2P9IA 4B1WB 3A5LC 4JKFA 3N4QA 4BRDA 3CCSN 5GIOA 4CZJA 5FPDA 4EFHA 5BREA 3TSUA 5AQYA 2QWPA 4JKHA 5ELZA 4FWSA 1CZAN 4M63C 5JVHL 3O80A 1HUXA 4IJAA 3VEXA 4B1UB 3SMPA 1WOQA 2VGNA 3F2KA 1LCUA 3O1WA 4K41A 1RDUA 3TTCA 2Q36A 1G99A 3MCPA 3LDPA 5FPNA 3L4IA 1HKCA 1ESVA 4B1XB 2HF3A 3MX2A 3FGUA 2QWQA 2GEMA 3DLLL 3OBYA 3QBXA 1VQMN 3I56N 5AZIA 5KPZA 1TYQA 4MLHA 2ASPA 3HZ6A 2CGKA 3E66A 3U9DA 4BRLA 5AQOA 4H0YB 5B8HA 1S72N 2ZGZA 3TSQA 3H6EA 4XH1A 4BR9A 1XQSC 4HWIA 1YUWA 3ZETB 4IEIA 2HOEA 2A5XA 3P39A 1QQMA 4M7YA 3BEXA 5C2FA 3BUZB 3H1VX 4JNEA 3G4SN 1SZ2A 4OPAA 3WQUA 5BN8A 5GIPA 2NRWA 1X9JA 3DXMB 3WXJA 1VQON 4C1NI 4QS7A 2GX9A 3E9LA 5AQVA 5BPNA 2P9LA 3KWIA 1XUPO 3FZHA 2ZJRL 4IOCL 2A42A 4A2AA 3LM9A 1VQ4N 2VCPA 5EOYA 4CBWA 5FPEA 1TUUA 2NRHA 1NLVA 4I6MB 2V51B 5AQRA 4H5TA 2PAVA 3H45C 1BO5O 4GV3A 3FZLA 2IVPA 4JKDA 3TTFA 3UKRA 1RGIA 2EWSA 1T6CA 4FO0A 4JD2B 5MLCQ 1VQLN 3H1QA 2FSKA 3VETA 3QFUA 3WEEA 3G71N 1EQYA 5BRHA 3EKSA 1VQ5N 2P9KA 4B1VA 4BG8A 1GLDG 3FR0A 3O08A 1NGEA 2KHOA 1YJWN 1VQ9N 4H5NA 1JCEA 4WFBL 3CCLN 4XEIA 3AAPA 1TUYA 5HL7L 5DM6L 3NVKA 2YHWA 4YDUC 1NBWA 5HOOA 2QA4N 2RE2A 3M1FA 4K43A 3AGRA 4JN4A 4CZEA 4ILGB 2BTFA 3U9ZA 4IDHA 1JCGA 4BR4A 4BRKA 2Q0RA 2GWKA 3VF2A 3O5BA 4U67L 5ADXA 2H3GX 2QWOA 2QW9A 3VENA 3OW2M 1VQKN 3ZX3A 2WFBA 4JKGA 3SMSA 3LM2A 4CZFA 2WUSA 3EE8A 4A59A 3PIPL 3O9QA 3KZBA 4XH4A 1U6ZA 1K9MO 2OTLN 3CHWA 3EE9A 3A8YA 4A5BA 3K9KA 4A61A 3ZYYX 2DPNA 1GLJO 4H0XB 4CBXA 3EKUA 4FPAA 3WXLA 2ITMA 1ZC6A 4BRAA 5C0YA 1T3VA 1Q18A 1T44A 4ISFA 1O13A 3IKMA 1C0GA 1DT9A 1R59O 2PBDA 4BRIA 2ASOA 3R3LA 4BRHA 3HOTA 2HBLA 4K25A 4BC4A 4JK8A 2GELA 3PIOL 3KVGA 1KAXA 4FWPA 2W41A 4BRMA 4PL7A 1VQ7N 5AQHA 3ENOA 3E9OA 1MWKA 3C6AA 4KBOA 2F7TA 5AZIB 1TYQB 2IVNA 2HMPA 5KPTA 3O9TA 3S41A 1KQSM 4FSVA 3TSPA 4BR0A 3QFPA 2YJEA 4BRQA 3BF1A 3DAWA 4ILHA 4KH5A 3FZKA 3LDNA 1Q82O 2GUPA 3A0IX 3L6QA 2NRVA 3MWTA 4DHYA 3P31A 3VGMA 1P90A 5EY4A 3D2FA 2NNWA 4NLCA 2A41A 3KWGA 3U8XA 3CC7N 1KAYA 4JK7A 2P9NB 3R8EA 2AA4A 1W97L 4YDUA 5ADXH 1GLFO 4IOAL 3UKUA 3IFRA 4MLEA 4BVPA 2P9LB 3EO3A 5BRDA 3Q7CA 1KXPA 1YXQA 1ZBSA 5JICA 3ENBA 2W40A 4JKCA 5TKYA 3O4WA 4CZMA 3HI0A 3SBTA 3L4QA 1V4TA 4BROA 3AGKA 4JHDA 2WBNA 1OKJA 3CJAA 5AR0A 4CI6A 1NGAA 3MX5A 4RCHA 5AQLA 4IO9L 3ZEUB 4UY8O 3LDLA 1BDGA 1NM1A 3HM8A 4FWNA 5AQUA 1E4GT 2P9PA 3SLCA 1BU6O 1J6ZA 3CJ9A 5EX5A 4EIAA 4PKGA 3OBWA 1Q81O 2QM1A 1XC3A 3BP8A 4H5RA 4NO7A 1MDUB 4B9QA 4GV9A 2A40A 3HOSA 4BC2A 3ULEB 2AP1A 4DQ8A 3PLAA 4K42A 3UE5A 3CXCM 5KQ8A 1JJ2M 3G6EN 1BA1A 2JWLA 4Y0WA 5EXWA 1W2BM 4H0OA 1X3MA 2HSTA 4H0PA 1OVYA 3M3ZA 5EVZA 3NVMA 1JCFA 3VMFB 2QXLA 3DXKB 1NGFA 1ZXOA 4IO8A 4WQ5C 5LJVA 2IVOA 2Q97A 4BC5A 2P9SA 1YAGA 1YHQN 1N8RO 3RSEB 3CC4N 1IJJA 1QHAA 4H0TB 2CGLA 5CE3A 4BRFA 3CCVN 5AQQA 3OA9A 4WQ4C 1NWKA 5BRFA 1SAZA 3Q7BA 4BRNA 4A57A 2E2QA 3VEZA 3GOIA 2ZF5O 3W0LA 4H0VB 4R79A 2QWRA 2WC9A 3QMLA 2BH1A 3D2EA 3QDKA 2YHYA 3CQXA 4BC3A 3C7NB 2V52B 4GV6A 2QWMA 5H1SQ 5AZJB 1WUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JVG L;  3CCU N;  3CCS N;  3CF5 L;  5JVH L;  1M1K O;  3CCE N;  3PIO L;  1VQ7 N;  3J7Z O;  1QVG M;  1KQS M;  3CCR N;  4WFA L;  1KD1 O;  1Q82 O;  5GAH P;  3DLL L;  1YI2 N;  3CD6 N;  1VQM N;  3I56 N;  3CC7 N;  3CPW M;  1VQP N;  4WCE L;  1ILY A;  4IOA L;  1YJ9 N;  1S72 N;  4WF9 L;  1VQ8 N;  1YIT N;  3CMA N;  1QVF M;  1K8A O;  1K73 O;  3G4S N;  4IO9 L;  4UY8 O;  4WFN L;  1VQO N;  3CCM N;  1VQ6 N;  1Q81 O;  2ZJR L;  3I55 N;  4IOC L;  1VQ4 N;  1Q86 O;  2ZJP L;  5GAD P;  1VQN N;  3CXC M;  1JJ2 M;  3G6E N;  1NJI O;  1W2B M;  1YIJ N;  5MLC Q;  3CC2 N;  1VQL N;  2QEX N;  1OVY A;  3CCJ N;  3G71 N;  1VQ5 N;  1YJW N;  1VQ9 N;  1YHQ N;  1N8R O;  3CCL N;  4WFB L;  5HL7 L;  5DM6 L;  3CCQ N;  3CME N;  3CC4 N;  2QA4 N;  5GAE P;  3CCV N;  1YJN N;  1Q7Y O;  4U67 L;  3OW2 M;  1VQK N;  2ZJQ L;  3PIP L;  2OTJ N;  1K9M O;  5DM7 L;  2OTL N;  5GAG P;  1KC8 O;  5H1S Q;  1M90 O; 
#chains in the Genus database with same CATH topology
 4KHU A;  4CJS A;  4YFU A;  2A1R A;  1QE1 A;  5CZ1 A;  1MA9 B;  1L3V A;  3KKS A;  5HBM A;  4N76 A;  5AQF A;  2Q31 A;  2I5J A;  2QXF A;  4DV2 K;  3V9S A;  3NCI A;  1XHZ A;  2RHK A;  3SAH A;  1TKX A;  4CZH A;  4FWM A;  2WON A;  3K9J A;  5HRN A;  1UOC A;  3HT3 A;  2KQ2 A;  3LWL A;  4ILJ A;  3QBW A;  4LSN A;  2O8D B;  1VQP N;  3GG4 A;  3VQB A;  2VWB A;  4AM7 A;  2ZWH A;  3S3O A;  1SKW A;  1YJ9 N;  1WSH A;  3ENH A;  3ZSW A;  3LZI A;  3JXU A;  4DTM A;  1HYZ A;  4CJK A;  1U4B A;  1WSE A;  4B3T K;  4N56 A;  1SS6 A;  1NJZ A;  4DG1 A;  4C23 A;  3ASM A;  3CMA N;  3VPZ A;  1QVF M;  4JS5 A;  3SUQ A;  4J8F A;  3C0B A;  1DTT A;  4BQZ A;  3A2F A;  1ATN A;  3TAM A;  3NE6 A;  1TK8 A;  1KAZ A;  2XHB A;  4DB3 A;  3OYL A;  4JI0 K;  5T7B A;  2FF3 B;  2XO7 A;  2R7Y A;  4CBU A;  4GY2 B;  3TTD A;  5CR4 A;  2YNG A;  1JL2 A;  3OY9 A;  4JV5 K;  1XWL A;  4KAZ A;  2NRT A;  1U2V A;  3DLB A;  4Z4E A;  3P4I A;  3CJC A;  2QEX N;  1BUP A;  5I9E B;  3QEW A;  2QK9 A;  2A6A A;  5AQK A;  4M3Z A;  2A3Z A;  2RPI A;  2G8I A;  5IWA K;  4BRG A;  2V7Y A;  2GTD A;  5AQZ A;  1SKR A;  1QQC A;  3WEE B;  4E7H A;  1VRU A;  3LAM A;  2NZT A;  2OAN A;  4AHS A;  3CET A;  3H46 O;  3K5L A;  5FRM A;  5F2R A;  4C8N A;  2E4L A;  2A1S A;  4U7B A;  2RN2 A;  4CZL A;  4E0D A;  2ZJQ L;  3VQE A;  3RMC A;  4KV8 A;  4NYN A;  4BWM A;  5GAG P;  3QNO A;  1S22 A;  1NJW A;  4ELV A;  3WNF A;  4Z4C A;  4W5Q A;  3O9U A;  1ASW A;  2D0O A;  2BDP A;  2RKI A;  4ISG A;  2E2N A;  4BGB A;  5C24 A;  3ZLJ A;  5AQX A;  3ZSY A;  1OVQ A;  1HNW K;  3WQT A;  4GNI A;  4NYF A;  5KGX A;  3QER A;  3G10 A;  4H8K A;  3DMJ A;  2Q0U A;  4CJL A;  1N33 K;  2X6N A;  4J2D A;  2FSJ A;  3SQ1 A;  2O8E B;  3CJ7 A;  1BG3 A;  2GBZ A;  3MCA B;  2J4R A;  1EO1 A;  4BY9 C;  4WCE L;  4EHU A;  3EZW A;  3K0S A;  3TI0 A;  3JAM O;  2D0B A;  2UXC K;  3L0Q A;  2V7Z A;  4EAH D;  3U4L A;  1K73 O;  5F0X A;  2ASM A;  1NOY A;  5J1E A;  3MN5 A;  1RCH A;  2OPP A;  4LF5 K;  1JLQ A;  1HMV A;  2KFZ A;  3AA4 A;  3O8M A;  4OKJ A;  2Q3S A;  4KHQ A;  4IXC A;  3C6H A;  4LF4 K;  1GLL O;  3NFA A;  5GAD P;  1BWF O;  1VQN N;  3KLH A;  1LAV A;  4M42 A;  3J8A A;  3I8D A;  1VRT A;  1NK0 A;  3SQ2 A;  1NGI A;  1NGJ A;  4RWT A;  4OJR A;  2AJQ A;  4FWK A;  1J5O A;  2YHA A;  2FSN A;  4F2S A;  4XIU A;  3F9M A;  3CCQ N;  1XC9 A;  4OKK A;  4NLB A;  5FDL A;  5D3G A;  2YJF A;  3EL2 A;  2QKK A;  1WLJ A;  3TWH A;  1YJN N;  2VG5 A;  3K5O A;  4L3Q A;  4JKB A;  3SAF A;  3W3D A;  4O0I A;  2HNY A;  4IWV A;  4M45 A;  4KB0 A;  4GVE A;  3VGK A;  1DKG D;  1IG8 A;  4DMN A;  5HRS A;  4LF8 K;  4BRD A;  3P1G A;  5GIO A;  1NG9 A;  5AQY A;  4FWS A;  4KFB A;  3O80 A;  3RRG A;  1S5J A;  1WSG A;  3AO5 A;  1RDB A;  4K41 A;  2EX3 A;  2Q36 A;  3LDP A;  3L4I A;  3L2U A;  4CGH A;  1ESV A;  4Y1C A;  4AHU A;  3FGU A;  4N47 A;  2ATQ A;  2ITG A;  3KD5 E;  4OX9 K;  1TYQ A;  3AVB A;  2ASP A;  2VQE K;  2VQF K;  5LMU K;  2CGK A;  3MEC A;  5AQO A;  4H0Y B;  1UWB A;  1JLE A;  4XH1 A;  4FZZ A;  3ZET B;  1D9D A;  3P39 A;  4M7Y A;  3BEX A;  2O8B B;  4AHR A;  4RG8 A;  3RRH A;  1NMN A;  2FBX A;  1HQU A;  3PX0 A;  5AQV A;  1C0U A;  1XUP O;  2ZJR L;  4LF7 K;  4R5P A;  1Z26 A;  4CK1 A;  4CEE A;  4CBW A;  4I6M B;  5AQR A;  4DFJ A;  4DUZ K;  3H45 C;  1BO5 O;  3FZL A;  2IVP A;  4ID5 A;  1RGI A;  3G71 N;  3RTV A;  3QNN A;  4JI5 K;  4E89 A;  2P9K A;  3AV9 A;  1S6Q A;  3SPZ A;  3O08 A;  4H5N A;  1RT5 A;  1IG9 A;  1W7A A;  1NBW A;  3AVF A;  4KB1 A;  3PX4 A;  2HHU A;  4KPY A;  2BTF A;  1SL0 A;  2HHS A;  2KFN A;  1RT6 A;  4FJG A;  3CQ8 A;  4U67 L;  2QW9 A;  3VQ4 A;  3OW2 M;  3ZX3 A;  2WUS A;  4OLB A;  1S1T A;  1K9M O;  2OTL N;  2OCE A;  3KKR A;  4FW2 A;  2KTQ A;  4H0X B;  3EKU A;  3WXL A;  4IBN A;  1ZC6 A;  1T44 A;  4ISF A;  2P1J A;  1S1W A;  3U6F A;  4BRH A;  4DV5 K;  4Z0U A;  3QEX A;  2B6A A;  3PIO L;  5AQH A;  4N41 A;  4KBO A;  2PYJ A;  4CF8 A;  5IT9 O;  4FSV A;  3TSP A;  3QFP A;  4DV4 K;  5C25 A;  5FLX O;  2GUP A;  3A0I X;  4DHY A;  4CK3 A;  1HNX K;  2XY6 A;  2ZQB A;  3OYB A;  4H4M A;  4J2A A;  1W97 L;  4YDU A;  2VWJ A;  2E6M A;  1GLF O;  3UKU A;  2VWK A;  3NBP A;  3Q7C A;  5BRD A;  1YXQ A;  4LH5 A;  1FKP A;  3SBT A;  3AA5 X;  3NH2 A;  4JHD A;  2WBN A;  1OKJ A;  3CJA A;  5AR0 A;  3BY5 A;  5LL6 Z;  4FW1 A;  4CI6 A;  3MX5 A;  4IO9 L;  4UY8 O;  1IBL K;  5AQU A;  1BCO A;  2G8W A;  1VSL A;  3PV8 A;  1A5W A;  1BU6 O;  1J6Z A;  1RBU A;  3AO3 A;  1TV6 A;  1Y97 A;  3RMD A;  2Z1J A;  1S1U A;  3ULE B;  3UE5 A;  3CXC M;  1JJ2 M;  2JWL A;  1W2B M;  5BR8 K;  5JS2 A;  4DTR A;  1OVY A;  1HR0 K;  5EVZ A;  1RBT A;  2QXL A;  3DXK B;  1NGF A;  4IO8 A;  5LJV A;  2Q97 A;  2P9S A;  1YHQ N;  1IJJ A;  3OS2 A;  2ZE2 A;  2CGL A;  1VK0 A;  5CE3 A;  4BRF A;  4W5T A;  5AQQ A;  1WB9 A;  1SAZ A;  3L3U A;  3OYG A;  4CEA A;  1RBV A;  4DF8 A;  2E2Q A;  2OZS A;  3VEZ A;  2HVI A;  4CED A;  3DOK A;  2BH1 A;  3CQX A;  4CEZ A;  2O4G A;  1W0H A;  4BC3 A;  3SV4 A;  3ZT1 A;  3C94 A;  1IKW A;  4CJT A;  5J2N A;  4RTF D;  3CCU N;  4F4K A;  3VES A;  1BI4 A;  3UB5 A;  1HPM A;  1HJO A;  1A5X A;  3AY9 A;  1S3X A;  1RDW X;  5KRT A;  4F9O A;  1Z6R A;  4ISE A;  4YOY A;  4K8Z A;  1QVG M;  5F1X A;  3VF6 A;  2VYP A;  1RNH A;  3SI6 A;  4B9V A;  3N4P A;  3OYH A;  4FOE A;  5JLF A;  4HVJ A;  3NH0 A;  3VQD A;  4JS4 A;  3VA0 A;  4H4O A;  3LPT A;  3MAQ A;  3G0Z A;  2E8A A;  4CJV A;  4CGG A;  4DSF A;  5CY4 A;  2FF6 A;  2PFU A;  1ATS A;  2DFE A;  4CEO A;  1U47 A;  5HP1 A;  1N36 K;  4X62 K;  3KTQ A;  3I0S A;  2UUA K;  4FYD A;  3DXM A;  3QO9 A;  3TU5 A;  4DCH A;  5J2M A;  5AQS A;  3SQ4 A;  4MDA A;  3KHY A;  1EWQ A;  1BIS A;  3DJC A;  4DU4 A;  3CJ1 A;  2UYT A;  4L8R B;  4JD2 A;  3VQ8 A;  4JYA K;  1BQN A;  1LAW A;  1XHX A;  5CYM A;  3RVC A;  3WNE A;  4YOR A;  2OPS A;  4E1N A;  1NJI O;  3O9S A;  1T7P A;  1NK8 A;  4HHT A;  1QZ6 A;  1DEJ A;  4QS8 A;  4RW9 A;  4I7F A;  2YKM A;  3AVI A;  3D7E O;  3THW A;  2IOC A;  4DU1 A;  3D2E B;  4EP4 A;  3MDQ A;  3O4N A;  3MXJ A;  4FL9 A;  3EN9 A;  3B8A X;  4KI4 A;  4FOI A;  2Q2R A;  4KI6 A;  3T7Z A;  4BE1 A;  3CER A;  1Q7Y O;  4FLZ A;  4JAX A;  4DQP A;  4F8R A;  4NCG A;  4FLX A;  2UUC K;  3D6R A;  3NDK A;  1NGD A;  5AFU A;  1QQN A;  3CPE A;  4DFK A;  1OH5 A;  3PO5 A;  1GOB A;  1T03 A;  4DR2 K;  1M90 O;  1DLO A;  2XY8 A;  2KKZ A;  3MEE A;  3P38 A;  2PYL A;  2HW3 A;  1HQE A;  3QIC A;  4OO1 J;  4DSL A;  4PKH A;  1RTD A;  3V6D A;  2HHX A;  4JRQ A;  4JEP A;  3RWU A;  4PHT X;  2BE2 A;  1YVU A;  1X9M A;  4WYB A;  5BPL A;  3DLH A;  3CM6 A;  3J7Z O;  4CJF A;  2E2O A;  3J7A P;  4GMJ B;  3RMA A;  1RT7 A;  4PA1 A;  4CEB A;  4FK2 A;  3HO1 A;  2I7P A;  1Z05 A;  4H03 B;  4DKW A;  3CD6 N;  4CHP A;  4OKE A;  4YNQ A;  4M3T A;  1Q8I A;  4BR5 A;  3VEW A;  2BGG A;  1VSF A;  1CZB A;  2OPQ A;  2DFH A;  4OGE A;  1YVN A;  1ILY A;  4BRP A;  3D2F B;  4XH5 A;  3LP2 A;  3MN7 A;  2GV9 A;  3MK6 A;  4DSK A;  3O3F A;  4HTL A;  1T6D A;  1U2V B;  1UA1 A;  4JI4 K;  4WFN L;  3SNN A;  3GL1 A;  4CZK A;  2IGI A;  5CHI A;  1VQ6 N;  3VN5 A;  3GE1 A;  4CJ5 A;  2YKN A;  2YI1 A;  1RT4 A;  3WUH A;  3SCX A;  4KH6 A;  1Q86 O;  3L2V A;  2ZJP L;  2E1Z A;  2P9P B;  4AHT A;  1LWC A;  4BR2 A;  1HYV A;  3MEG A;  4FPB A;  3CC2 N;  3RSE A;  3AVC A;  2HHQ A;  2XY7 A;  3B6P A;  4FWL A;  1W9H A;  3NMU A;  2P5G A;  2Y1J A;  4NXM K;  5M1O A;  4DF4 A;  5AQW A;  4Z4F A;  2DFF A;  3CME N;  1NGG A;  3I33 A;  1KLN A;  2QTD A;  4M3U A;  5LY3 A;  1ATR A;  2Q1N A;  4FJX A;  3DWL A;  5M1K A;  5M1F A;  2FXU A;  5E84 A;  3DM2 A;  4CGD A;  1SQK A;  5EU7 A;  1XNQ K;  3KK3 A;  1Q9X A;  1D9F A;  4B1W B;  5BN9 A;  1KCF A;  3F9K A;  3N4Q A;  4CHO A;  1JLB A;  4CZJ A;  5FPD A;  4DR3 K;  5AJ3 K;  5DMR A;  1X9S A;  2QWP A;  3UIQ A;  4JKH A;  5JVH L;  4CF0 A;  1CZA N;  1HUX A;  3VEX A;  1T8E A;  3U3G A;  3F2K A;  3TAR A;  4IG0 A;  4CIF A;  1L5U A;  2UU9 K;  3MCP A;  1NK5 A;  4YHH K;  3VQ7 A;  3LP1 A;  4CHQ A;  2X6S A;  4B1X B;  2HF3 A;  2O8D A;  1NJX A;  3OBY A;  3QBX A;  1XI1 A;  3QIO A;  1KVA A;  4DTO A;  1J5E K;  3BGR A;  3VQC A;  4FJH A;  4LFA K;  3ZT2 A;  1S72 N;  3H6E A;  4BR9 A;  1XQS C;  4MQ3 A;  4HWI A;  4BE0 A;  3EZ5 A;  1VSH A;  1JLG A;  2Z1G A;  4OLA A;  3D45 A;  3K2P A;  3V81 A;  5C2F A;  3JSM A;  4E19 A;  3WQU A;  4E1M A;  2NRW A;  3ZSZ A;  4C1N I;  4M3Y A;  2GX9 A;  2YV0 X;  1IH7 A;  2P9L A;  3KWI A;  4E3S A;  2YNF A;  4UQG A;  4IOC L;  3LM9 A;  2VCP A;  5EOY A;  4CGJ A;  4OGC A;  4FJJ A;  5KRS A;  1NLV A;  2B5J A;  4G1Q A;  2V51 B;  3OS0 A;  4H5T A;  3V1Q A;  3THX A;  1N32 K;  4Q0B A;  4JKD A;  3TTF A;  5MLC Q;  1T6C A;  2UUB K;  2FSK A;  3QFU A;  3WEE A;  2HHV A;  4C8K A;  5BRH A;  3FR0 A;  1C0M A;  4XEI A;  3OJU A;  1TUY A;  5HL7 L;  4V19 S;  2YHW A;  4YDU C;  5HOO A;  1BIZ A;  2QKB A;  1BGX T;  1C0T A;  3U9Z A;  2B4J A;  4O44 A;  2Q0R A;  2GWK A;  5ADX A;  1VQK N;  4CZF A;  3EE8 A;  4ID1 A;  4A59 A;  4JLH A;  3CHW A;  1N34 K;  2EHG A;  3ZYY X;  2DPN A;  3NGY A;  4CBX A;  4FPA A;  2ITM A;  1F21 A;  4E7I A;  5KI6 A;  1TKZ A;  5HLF A;  1Q18 A;  3IKM A;  4DFP A;  1C0G A;  1KTQ A;  4DR6 K;  3HJF A;  4CER A;  4W5N A;  1WBD A;  2HBL A;  1X9W A;  4K25 A;  4BC4 A;  4DLE A;  1VQ7 N;  1CXQ A;  5K14 A;  1SV5 A;  2F7T A;  5J2Q A;  1TYQ B;  4DU3 A;  2HMP A;  3ZT0 A;  4IFV A;  1IKV A;  4FM1 A;  3DAW A;  4ILH A;  1ZBU A;  4KH5 A;  5E41 A;  1SL1 A;  3LDN A;  4FLY A;  3P31 A;  4BWJ A;  1P90 A;  5EY4 A;  4Q5V A;  4EZ9 A;  2NNW A;  4NLC A;  2A41 A;  1RT1 A;  4ZTF A;  1TL3 A;  1KAY A;  2P9N B;  4B3O A;  3R8E A;  4RW4 A;  4DR4 K;  1S1X A;  3OYN A;  4MLE A;  4BVP A;  1KXP A;  3D0P A;  4LD0 A;  2LSN A;  1VSK A;  4FCY A;  1L3T A;  3L4Q A;  4CJU A;  3AGK A;  4B08 A;  4KHS A;  4FK4 A;  3ZEU B;  3LDL A;  1NM1 A;  3TR8 A;  4FLV A;  1JKH A;  1J9A A;  1TK0 A;  3OBW A;  1TL1 A;  1MDU B;  1NKB A;  2O8F B;  2A40 A;  3HOS A;  1G15 A;  4BC2 A;  1VSD A;  3VQ9 A;  5KQ8 A;  3DLG A;  4K0K K;  1BA1 A;  5EXW A;  4H0O A;  4GW6 A;  5HRR A;  4CGF A;  3M3Z A;  1VSE A;  4WQ5 C;  2IAJ A;  4B8A B;  4DV3 K;  4BC5 A;  3CC4 N;  3PX6 A;  3JYT A;  4WQ4 C;  4FZY A;  3T1A A;  3S3N A;  2F8T A;  4BRN A;  3J80 O;  3BZC A;  4A57 A;  1HNI A;  4KHY A;  2ZF5 O;  4RW8 A;  3QML A;  3O4Q A;  3M8Q A;  3PY8 A;  1A5V A;  2YHY A;  4F2R A;  3V1R A;  1B92 A;  2ETJ A;  3C7N B;  3PUF A;  1I3A A;  5AZJ B;  1WUA A;  5LJW A;  1WN7 A;  4HTU A;  3A5O C;  3QIN A;  4CEQ A;  4CF2 A;  4E7L A;  3A5N C;  3SAG A;  2P9I B;  1NK9 A;  2NLX A;  3O9R A;  4MDB A;  3SUP A;  3ZX0 A;  1SUQ A;  4O8K A;  1GOA A;  3OS1 A;  4C8L A;  4N5S A;  1U49 A;  4B9U A;  4FWQ A;  5C10 A;  3HPH A;  2IDO A;  1D4X A;  3HP6 A;  4QCL A;  3LDO A;  1KD1 O;  3KK7 A;  4DTN A;  4QAG A;  1QSL A;  4DQI A;  1IKX A;  2HB5 A;  5BR9 A;  3ULD A;  1YI2 N;  1QS4 A;  3SJH A;  3MMV A;  4WE1 A;  4KH4 A;  3FZM A;  3G25 A;  2E2P A;  3LAK A;  3ZET A;  1BHL A;  1P8Z A;  2JWK A;  4DUY K;  4AQY K;  2ZD1 A;  3GBT A;  3L2W A;  1RBR A;  2E1Y A;  4WF9 L;  1YIT N;  1VSJ A;  2VG6 A;  4KO0 A;  1WSJ A;  2HBK A;  3IUC A;  2D0A A;  4C1N K;  4YOV A;  4H5V A;  4I6M A;  3KK2 A;  3NHG A;  4IKF A;  3MWP A;  3M8S A;  3CFO A;  4O4G A;  2P9S B;  3J81 O;  5BPM A;  4B8C A;  4X65 K;  1BA0 A;  2E88 A;  1H1V A;  3IDH A;  1EXQ A;  3LPU A;  4LC9 B;  3HST B;  2BAN A;  4YOT A;  1Y64 A;  3L3V A;  3VER A;  1RFQ A;  3ZX2 A;  4FWO A;  4BR7 A;  1TAQ A;  2GWJ A;  4JKA A;  3DLR A;  4CE9 A;  3UKR B;  4IFE A;  3BF3 A;  4F3T A;  5GAE P;  5CYQ A;  3SBG A;  5TKW A;  4MFB A;  1NMD A;  2HBJ A;  3QEI A;  1K8K A;  2P9U A;  3JS6 A;  2O4I A;  4DTX A;  3FFI A;  1V4S A;  5C12 A;  2OTJ N;  4BG9 A;  5AQT A;  3ID8 A;  1C1A A;  3P5J A;  1RBS A;  1OH6 A;  3HPG A;  4EHT A;  1MWM A;  5KQD A;  4BRC A;  4JKG B;  2NRX A;  2XRI A;  5JVG L;  1VHX A;  4CZG A;  1R0A A;  2E5L K;  3CQY A;  5AQG A;  3VA3 A;  3WXK A;  3HK2 A;  3AO4 A;  4PUO A;  3WXM B;  3EYZ A;  3HBT A;  2JLE A;  4CJ7 A;  2HHT A;  4I2P A;  4CES A;  5JMV A;  1X3N A;  3MN6 A;  2YX6 A;  4CJ4 A;  1HLU A;  3OYC A;  4PWD A;  5GAH P;  2HVH A;  5C15 A;  2RF2 A;  3V9U A;  2YCH A;  3TPQ A;  4CD1 A;  2IS3 A;  5KPR A;  3C65 A;  1T05 A;  4LH4 A;  3VQQ A;  5HRP A;  4CD3 A;  3HPO A;  3ITH A;  4IZ9 A;  2CH6 A;  3AVM A;  1O1W A;  3H3O B;  3ZSQ A;  2KLA A;  4DV0 K;  3LL3 A;  2PZS A;  1VQ8 N;  4YOU A;  1UAX A;  1HJR A;  1S1V A;  4I2Q A;  4CHZ A;  1K8A O;  2IIR A;  4O5F A;  3ZSO A;  4MO5 A;  3KJV A;  1HKG A;  4DR1 K;  1NK6 A;  3F5T A;  4B3M K;  1YT3 A;  3LP0 A;  3FZF A;  3LAN A;  1JXB A;  3ULE A;  1K6Y A;  2E20 A;  2BUP A;  4WQ5 A;  3ZCM A;  4AHV A;  4OPH A;  4BVO A;  3THW B;  2D0C A;  1HRH A;  4BGA A;  2VG7 A;  3DXK A;  3HTV A;  4WQ4 A;  4A5A A;  1ZBH A;  4CCH A;  3E1Y A;  4DSE A;  1GLB G;  3HP9 A;  4JK9 A;  1FJG K;  1NGC A;  2WOM A;  1XNR K;  5AQN A;  3MN9 A;  5FPM A;  4M3R A;  2F9W A;  2HMI A;  1ZBI A;  2HF4 A;  3I8B A;  1YTA A;  3IMX A;  3PSF A;  4AF1 A;  3ATV A;  4CK2 A;  1BQM A;  3KK1 A;  3HSC A;  4IEE A;  2VGM A;  3VTH A;  4IJN A;  3H3N O;  3HL8 A;  5M1N A;  2YNH A;  2FBV A;  3THY A;  4B3S K;  3WXI A;  3NF7 A;  3H08 A;  4PKI A;  3VQA A;  2W42 A;  2JGU A;  3A5M C;  3WT0 A;  2XY5 A;  3QIP A;  3AO1 A;  3L2R A;  4MO4 A;  2O8C B;  1JXE A;  3A5L C;  5KTQ A;  3CCS N;  3RR8 A;  4C8O A;  4EFH A;  5BRE A;  1JLF A;  4W5O A;  1C6V A;  1S9G A;  4B1U B;  4IJA A;  4FLU A;  3SZ2 A;  1WOQ A;  2VGN A;  1LCU A;  3LAL A;  3O1W A;  3NAE A;  1KFD A;  1RDU A;  3SJJ A;  2WTU A;  1J54 A;  3SYZ A;  3VQP A;  1HKC A;  1RDD A;  4CFC A;  3LP3 A;  3DRR A;  4JI8 K;  2GEM A;  3DLL L;  1TKD A;  1VQM N;  3I56 N;  5DK5 A;  5AZI A;  5KPZ A;  4MLH A;  1LV5 A;  3OYJ A;  4M41 A;  3SUN A;  3U9D A;  4BRL A;  5B8H A;  4DV1 K;  2ZGZ A;  3PO4 A;  4IEI A;  3AVH A;  2HOE A;  4DS5 A;  2A5X A;  3K5N A;  1QQM A;  2D5R A;  2OZM A;  3B6O A;  1WAJ A;  3G4S N;  2OYQ A;  5GIP A;  1X9J A;  3WXJ A;  1RTJ A;  4QS7 A;  3E9L A;  5BPN A;  4EZ6 A;  2A42 A;  4A2A A;  4BDY A;  3OYM A;  1X1P A;  3O3H A;  1WBB A;  3OYE A;  3TAF A;  4DSI A;  1ZBL A;  1TAU A;  4FO0 A;  3H1Q A;  1EKE A;  1FXX A;  3BZK A;  3E01 A;  3EKS A;  4O0J A;  4B1V A;  4BG8 A;  1LW2 A;  1YJW N;  1VQ9 N;  2KHO A;  1KFS A;  4Y1D A;  4E7K A;  1ITG A;  4WFB L;  3CCL N;  2DTU A;  3NVK A;  3ZT3 A;  3K58 A;  2OPR A;  4Z4H A;  4OPJ A;  3ZSR A;  3BDP A;  3AGR A;  2ZM6 K;  4JN4 A;  4CZE A;  4ILG B;  4ELT A;  4IDH A;  1JCG A;  4BR4 A;  4NCA A;  4KHW A;  4ZHR A;  1RTH A;  3VF2 A;  3O5B A;  1J53 A;  3C95 A;  2H3G X;  2UXB K;  2QWO A;  1RT2 A;  4IDK A;  2WFB A;  3LM2 A;  4BE2 A;  3S9H A;  1NKE A;  1EWR A;  4IG3 A;  4JI2 K;  4XH4 A;  3QES A;  1U6Z A;  4CGI A;  1N6Q A;  2P51 A;  2FBY A;  3T1H K;  3AVA A;  1KRP A;  4DQQ A;  3ZSX A;  4BRA A;  1RT3 A;  3EY1 A;  1O13 A;  3F73 A;  4BDZ A;  3V4I A;  1R59 O;  3OYK A;  4FJI A;  2PBD A;  3KLF A;  2ASO A;  4HUG A;  4FLT A;  4JI7 K;  3NH1 A;  3R3L A;  1IO2 A;  2Z1H A;  4JK8 A;  2GEL A;  3KVG A;  1KAX A;  4PL7 A;  3ENO A;  3E9O A;  1MWK A;  4OVL A;  4DTU A;  3U3Y A;  5KPT A;  3O9T A;  4BR0 A;  2YJE A;  3BF1 A;  1NJY A;  4FJN A;  3CM5 A;  3L6Q A;  3MWT A;  1ASU A;  3D2F A;  4B9S A;  3KWG A;  1B9F A;  3U8X A;  4JK7 A;  2AA4 A;  3DYA A;  4IOA L;  2P9L B;  3EO3 A;  4FVM A;  5JIC A;  4YY3 K;  1U45 A;  4DTJ A;  3AVG A;  3ENB A;  4J2E A;  4JKC A;  5TKY A;  3NGZ A;  2F4V K;  1KSP A;  4BRO A;  3THX B;  1TK5 A;  1ASV A;  3HVT A;  5AQL A;  1NK4 A;  3HM8 A;  2P9P A;  3SLC A;  5JS1 A;  3DLK A;  4ZTJ A;  5EX5 A;  2QM1 A;  4H5R A;  1QSS A;  4B9Q A;  4GV9 A;  4CIE A;  3PLA A;  4K42 A;  3K59 A;  5FRN A;  3G6E N;  4Y0W A;  1TGO A;  2G8V A;  2HST A;  3NVM A;  3THV A;  1JCF A;  3VMF B;  1FW6 A;  4CFB A;  3NGI A;  1YAG A;  1N8R O;  3IAY A;  4W5R A;  4DSJ A;  1EX4 A;  2W6K A;  4CF1 A;  5BRF A;  3OVN A;  4FJ5 A;  3Q7B A;  1L3S A;  2HND A;  3DOL A;  4H0V B;  4FJ7 A;  3NF8 A;  3OYA A;  3WNG A;  3I0R A;  1DTQ A;  2G8F A;  3AVL A;  2V52 B;  2QWM A;  5H1S Q;  1TKT A;  3VOV A;  1RTI A;  4JKE A;  5JLH A;  5SWM A;  3T3F A;  3T69 A;  3LZJ A;  4FJK A;  2D4W A;  2HHH K;  4QS9 A;  1NGB A;  4E1J A;  1S6P A;  1NU0 A;  4DQS A;  3VF4 A;  1QTM A;  4Z4I A;  3HYF A;  4M7X A;  4I9Q A;  3PSI A;  2HHW A;  3KLE A;  2G8U A;  2QWN A;  2FC0 A;  1YTU A;  3K57 A;  5KGW A;  3CCR N;  1I39 A;  2CGJ A;  1DGK N;  1RIL A;  4FK0 A;  5AQP A;  4E7J A;  4G9Z A;  3SV3 A;  4DV7 K;  2FBT A;  1HYS A;  1YF5 L;  3QLH A;  1NKC A;  3OYD A;  3SK3 A;  3CPW M;  1GLA G;  3AAQ A;  3FLC O;  3RMB A;  2YHB A;  1BCM A;  5A2Q O;  3LDS A;  4FM0 A;  4KRF A;  4JI6 K;  4DR5 K;  2O8E A;  1ZBF A;  1REV A;  3DI6 A;  3FE1 A;  2Z1I A;  5M1P A;  5GIN A;  1N5Y A;  3O3G A;  3VEO A;  4KHP K;  2FLO A;  3RR7 A;  5C42 A;  3AAR A;  5AQJ A;  3I55 N;  4IOX A;  4PY5 A;  4F3O A;  2NUB A;  1WSI A;  4B1Y B;  4FVU A;  2DY4 A;  2NRZ A;  2I7N A;  3TAE A;  2W6L A;  5AQI A;  3DRP A;  3ID6 A;  1HNV A;  4BRE A;  1BIU A;  1KLM A;  3M6G A;  3ZT4 A;  3NF9 A;  3OYI A;  3HM9 A;  4A2B A;  1E4F T;  1HKB A;  4AHC A;  4CJW A;  1HX1 A;  2P9K B;  4LF6 K;  3MXI A;  1E3M A;  2NRR A;  1TVR A;  3R6M A;  1BL3 A;  3FFK B;  1LW0 A;  1GLE G;  3AVJ A;  1WNS A;  4TSX A;  4LFC K;  4CJE A;  4FWR A;  3CFR A;  4O55 A;  4NB4 A;  1HNZ K;  5DM7 L;  1QZ5 A;  3O6W A;  5SZT A;  3AVN A;  3OYF A;  3OHR A;  1KC8 O;  3M8P A;  3VQ6 A;  3KLG A;  1SL2 A;  3R1X A;  4CHN A;  2HBM A;  4O5B A;  4NCB A;  3CF5 L;  1JL1 A;  3OJS A;  2F96 A;  3P83 D;  1S9E A;  4KTZ A;  1M1K O;  1C0F A;  3CCE N;  2QWL A;  3QB0 A;  2KZM A;  3NF6 A;  4CF9 A;  1U48 A;  3AVK A;  1WAF A;  3IRX A;  1GLC G;  4FJ8 A;  4WFA L;  4DQR A;  2P9N A;  4JI3 K;  4KHN A;  1VSI A;  3M5R A;  1LOT B;  4HCB A;  4CHY A;  4CJP A;  3TAN A;  1B9D A;  3TAP A;  3HVR A;  2E6L A;  2YHX A;  2QI2 A;  3ALY A;  3AA3 A;  3AA2 A;  5M1Q A;  3V1O A;  4GKK K;  3SPY A;  3ZEU A;  5AFU H;  1L3U A;  2GUI A;  5E26 A;  4DV6 K;  4C8M A;  4PL8 A;  3HRG A;  1VAZ A;  4ICL A;  3LWM A;  5AQM A;  3VTI A;  4FXD A;  4B9L A;  4KTW A;  3UKU B;  4ELU A;  3IG1 A;  3VGL A;  4YOW A;  2O8F A;  3MED A;  5I42 A;  3T19 A;  3CCM N;  1EP4 A;  2D0P A;  4JHD B;  3ISN C;  3DRS A;  2D1K A;  3GDQ A;  4LY7 A;  4DLG A;  2G8H A;  3VEV A;  2Y1I A;  3CIP A;  1NGH A;  4DFM A;  2O8B A;  1Q9Y A;  4B1Z A;  1Z25 A;  4CFA A;  3R9P A;  4CIG A;  3HXM A;  3AO2 A;  3CCJ N;  3L8B A;  4BQL A;  4OPK A;  3V9W A;  1QQO A;  4H5W A;  1K8K B;  2P9U B;  1OH7 A;  3WNH A;  4FZX C;  3O1B A;  4Z94 A;  1HPZ A;  3CJB A;  2ZGY A;  3LDQ A;  4DWI A;  2CH5 A;  3VEY A;  2F9T A;  4A62 A;  4CZI A;  2OA8 A;  3ATU A;  3CI5 A;  3C7N A;  5AZJ A;  4O8U A;  5FRO A;  4CW7 B;  3E9P A;  2UXD K;  1BOT O;  2YNI A;  3V9Z A;  5J2P A;  4YOX A;  5LMN K;  4X64 K;  5C2D A;  4AM6 A;  2P9I A;  4EP5 A;  4JKF A;  1KVB A;  1IBM K;  1WSF A;  3TSU A;  5ELZ A;  4M63 C;  4KRE A;  3SMP A;  4KKO A;  1KVC A;  1BI4 B;  3CG7 A;  3TTC A;  1G99 A;  4J2B A;  5I3U A;  3C6T A;  5FPN A;  1LWF A;  4HCC A;  4AH9 A;  1D5A A;  3MX2 A;  1XMO K;  2KW4 A;  2QWQ A;  4CVN E;  1CLQ A;  1QSY A;  2X78 A;  1CZ9 A;  4IFY A;  4LFB K;  2G8K A;  1IKY A;  4QOZ B;  3HZ6 A;  3S3M A;  3E66 A;  3TSQ A;  1I94 K;  4DTS A;  1YUW A;  2IC3 A;  4Z4G A;  1NOZ A;  3BUZ B;  3H1V X;  4JNE A;  1SZ2 A;  4OPA A;  5BN8 A;  4B9M A;  4GKJ K;  3DXM B;  1VQO N;  3ZSV A;  1VSM A;  4JRP A;  3FZH A;  4I9L A;  1VQ4 N;  4K8X A;  1QHT A;  2X74 A;  5FPE A;  1TUU A;  5CZ2 A;  2NRH A;  3EEQ A;  2PAV A;  4GV3 A;  3UKR A;  1YIJ N;  2EWS A;  4JD2 B;  1VQL N;  3VET A;  3TAQ A;  4FM2 A;  1EQY A;  3CYM A;  1VQ5 N;  4LF9 K;  4BAC A;  3THY B;  3VQ5 A;  4DR7 K;  1GLD G;  4CEC A;  1NGE A;  4RW7 A;  4HUE A;  1JCE A;  1CXU A;  3AAP A;  5DM6 L;  1RDC A;  2QA4 N;  2RE2 A;  3M1F A;  2PY5 A;  4K43 A;  4CEF A;  3C6U A;  4GVM A;  4LSL A;  4BRK A;  4KTQ A;  1NNE A;  3VEN A;  4JKG A;  3SMS A;  3T1Y K;  3KLI A;  3PIP L;  3O9Q A;  3V9X A;  3KZB A;  4DS4 A;  1IV0 A;  3EE9 A;  3A8Y A;  4A5B A;  4JI1 K;  3K9K A;  4A61 A;  1GLJ O;  5C0Y A;  1T3V A;  1DT9 A;  4BRI A;  4FJL A;  4PQU A;  3K5M A;  2KZZ A;  3HOT A;  1U04 A;  4FWP A;  2W41 A;  4BRM A;  4AIL C;  5AZI B;  3C6A A;  2IVN A;  1LWE A;  2HNZ A;  3QEV A;  2F8S A;  1SKS A;  3S41 A;  1KQS M;  4BRQ A;  4CJQ A;  3FZK A;  3IS9 A;  1Q82 O;  2NRV A;  1EET A;  3DLE A;  3VGM A;  3M8R A;  1FKO A;  3L2Q A;  3QET A;  1UA0 A;  1XMQ K;  3CC7 N;  3SQ0 A;  4FLW A;  4B9T A;  5ADX H;  3IFR A;  3MXM A;  1ZBS A;  4BDP A;  2W40 A;  3O4W A;  3SUO A;  4CZM A;  1GOC A;  4M3W A;  1IBK K;  4CJ3 A;  3HI0 A;  1V4T A;  1JLA A;  1RDA A;  4DTP A;  3TAG A;  1NGA A;  4RCH A;  3TAB A;  4FWN A;  1BDG A;  1E4G T;  3CJ9 A;  4EIA A;  1Q81 O;  1OH8 A;  1C1C A;  4PKG A;  4M3X A;  1XC3 A;  3BP8 A;  4NO7 A;  3J7Y P;  5HRO A;  4NXN K;  2AP1 A;  4DQ8 A;  4FJM A;  4X66 K;  2P5O A;  1JLC A;  1X3M A;  4H0P A;  1NK7 A;  4HUF A;  3OTO K;  4RW6 A;  4B3R K;  4CFD A;  1MU2 A;  1ZXO A;  2IVO A;  3QEP A;  3RSE B;  1QHA A;  3KIO A;  4H0T B;  1ZYQ A;  1D8Y A;  3CCV N;  3OA9 A;  1NWK A;  1FK9 A;  4B9N A;  4FJ9 A;  1C1B A;  3GOI A;  3CFP A;  3W0L A;  2O8C A;  4R79 A;  2QWR A;  2WC9 A;  3D2E A;  3QDK A;  3KD1 E;  4GV6 A;  4CJR A; 
#chains in the Genus database with same CATH homology
 4RTF D;  5LJW A;  3CCU N;  4JKE A;  1MA9 B;  3A5O C;  3VES A;  5JLH A;  3UB5 A;  1HPM A;  1HJO A;  3T69 A;  3A5N C;  2D4W A;  3SAG A;  2P9I B;  2Q31 A;  4QS9 A;  5AQF A;  1NGB A;  2NLX A;  4E1J A;  3AY9 A;  3O9R A;  4MDB A;  1S3X A;  3VF4 A;  3ZX0 A;  4O8K A;  1RDW X;  4M7X A;  4F9O A;  1Z6R A;  4ISE A;  4YOY A;  2RHK A;  4FWQ A;  5C10 A;  5F1X A;  2QWN A;  3VF6 A;  1QVG M;  2VYP A;  3SAH A;  1D4X A;  3CCR N;  2CGJ A;  1DGK N;  3N4P A;  4CZH A;  4FWM A;  3LDO A;  5AQP A;  4FOE A;  1KD1 O;  3KK7 A;  5JLF A;  4G9Z A;  3K9J A;  1YF5 L;  5BR9 A;  1YI2 N;  3SJH A;  3MMV A;  4ILJ A;  4KH4 A;  3QBW A;  2E8A A;  3SK3 A;  3FZM A;  3G25 A;  2E2P A;  2FF6 A;  2PFU A;  3ZET A;  1ATS A;  1P8Z A;  2JWK A;  3CPW M;  1VQP N;  3GG4 A;  2VWB A;  4AM7 A;  1GLA G;  2ZWH A;  1YJ9 N;  3AAQ A;  3FLC O;  3ENH A;  3GBT A;  3JXU A;  1SS6 A;  4C23 A;  3DXM A;  2E1Y A;  4WF9 L;  3TU5 A;  1YIT N;  4DCH A;  3CMA N;  3VPZ A;  1QVF M;  5AQS A;  2HBK A;  3C0B A;  4J8F A;  3IUC A;  3KHY A;  4MDA A;  4BQZ A;  3FE1 A;  5M1P A;  1ATN A;  3DJC A;  4C1N K;  5GIN A;  4YOV A;  3VEO A;  3CJ1 A;  1KAZ A;  4H5V A;  2UYT A;  4I6M A;  4DB3 A;  3MWP A;  2FLO A;  3AAR A;  5AQJ A;  3I55 N;  2FF3 B;  2P9S B;  4IOX A;  4JD2 A;  4CBU A;  5BPM A;  4B1Y B;  4FVU A;  4GY2 B;  2NRZ A;  3TTD A;  1BA0 A;  2E88 A;  2I7N A;  5CR4 A;  1H1V A;  3RVC A;  4YOR A;  3IDH A;  5AQI A;  4LC9 B;  3ID6 A;  2NRT A;  3O9S A;  1NJI O;  1U2V A;  3P4I A;  4BRE A;  3CJC A;  4YOT A;  1BUP A;  1QZ6 A;  1DEJ A;  1Y64 A;  5I9E B;  3M6G A;  4QS8 A;  2QEX N;  3VER A;  1RFQ A;  3ZX2 A;  2A6A A;  4FWO A;  4BR7 A;  3D7E O;  5AQK A;  2GWJ A;  4JKA A;  2A3Z A;  4A2B A;  3D2E B;  1E4F T;  3UKR B;  3MDQ A;  1HKB A;  4IFE A;  3BF3 A;  4BRG A;  2V7Y A;  2GTD A;  5AQZ A;  4FL9 A;  3EN9 A;  1YIJ N;  3WEE B;  3B8A X;  4FOI A;  5GAE P;  2NZT A;  2Q2R A;  2OAN A;  1HX1 A;  2P9K B;  5TKW A;  3SBG A;  3T7Z A;  3CET A;  3H46 O;  1NMD A;  2HBJ A;  2NRR A;  3VOV A;  3R6M A;  3FFK B;  3CER A;  1Q7Y O;  1GLE G;  5F2R A;  4JAX A;  1K8K A;  4U7B A;  2P9U A;  3JS6 A;  4CZL A;  4FWR A;  3D6R A;  1V4S A;  5C12 A;  1NGD A;  5AFU A;  2ZJQ L;  2OTJ N;  4BG9 A;  5AQT A;  1QQN A;  3CPE A;  4NB4 A;  3ID8 A;  5DM7 L;  1QZ5 A;  3O6W A;  5GAG P;  3OHR A;  1KC8 O;  4EHT A;  1S22 A;  1M90 O;  3R1X A;  1MWM A;  2HBM A;  4BRC A;  4JKG B;  2NRX A;  5KQD A;  5JVG L;  2KKZ A;  3O9U A;  3P38 A;  3CF5 L;  2D0O A;  3QIC A;  4CZG A;  4OO1 J;  4ISG A;  3CQY A;  2E2N A;  4PKH A;  4BGB A;  5AQG A;  4JEP A;  1M1K O;  4PHT X;  1C0F A;  3WXK A;  3CCE N;  5AQX A;  4WYB A;  5BPL A;  2QWL A;  3QB0 A;  3WXM B;  3J7Z O;  3HBT A;  3WQT A;  2E2O A;  4GNI A;  4CJ7 A;  1GLC G;  5JMV A;  1X3N A;  3MN6 A;  2YX6 A;  4WFA L;  1HLU A;  2I7P A;  2Q0U A;  1Z05 A;  5GAH P;  4H03 B;  5C15 A;  2FSJ A;  2P9N A;  4DKW A;  2YCH A;  3CJ7 A;  3CD6 N;  3TPQ A;  4CD1 A;  5KPR A;  1BG3 A;  3C65 A;  3M5R A;  1LOT B;  3MCA B;  2J4R A;  4BR5 A;  3VEW A;  4CD3 A;  2YHX A;  1EO1 A;  1YVN A;  4BY9 C;  2QI2 A;  4WCE L;  4IZ9 A;  4EHU A;  1ILY A;  4BRP A;  2CH6 A;  3H3O B;  3D2F B;  3EZW A;  4XH5 A;  5M1Q A;  2KLA A;  3LL3 A;  3ZEU A;  5AFU H;  3MN7 A;  5E26 A;  3MK6 A;  3L0Q A;  4YOU A;  4PL8 A;  3HRG A;  1VAZ A;  1VQ8 N;  2V7Z A;  4EAH D;  5AQM A;  3U4L A;  3VTI A;  5F0X A;  1K73 O;  1K8A O;  3UKU B;  2ASM A;  2IIR A;  4O5F A;  3MN5 A;  4MO5 A;  1HKG A;  4HTL A;  3F5T A;  1T6D A;  1U2V B;  3VGL A;  4WFN L;  4YOW A;  3CCM N;  3GL1 A;  3ULE A;  3FZF A;  4CZK A;  5CHI A;  2E20 A;  2BUP A;  4WQ5 A;  1VQ6 N;  3O8M A;  4OPH A;  2D0P A;  3GE1 A;  4JHD B;  4BVO A;  2D1K A;  2YI1 A;  3GDQ A;  4IXC A;  3WUH A;  4KH6 A;  3C6H A;  4BGA A;  1Q86 O;  3VEV A;  3CIP A;  1GLL O;  2ZJP L;  1NGH A;  3DXK A;  2E1Z A;  1BWF O;  2P9P B;  3HTV A;  5GAD P;  1VQN N;  4WQ4 A;  4A5A A;  4B1Z A;  3E1Y A;  4BR2 A;  3R9P A;  4FPB A;  3CC2 N;  1GLB G;  3J8A A;  4JK9 A;  3RSE A;  3CCJ N;  1NGI A;  4BQL A;  1NGJ A;  1NGC A;  1QQO A;  4RWT A;  4H5W A;  4FWL A;  1K8K B;  4FWK A;  3MN9 A;  5AQN A;  3NMU A;  2FSN A;  2P9U B;  5FPM A;  5M1O A;  5AQW A;  3F9M A;  3CCQ N;  2F9W A;  3O1B A;  3CME N;  4NLB A;  4Z94 A;  2HF4 A;  3CJB A;  2YJF A;  2ZGY A;  3LDQ A;  3I8B A;  1NGG A;  2CH5 A;  3EL2 A;  2QTD A;  2F9T A;  3I33 A;  3IMX A;  3VEY A;  3ATV A;  1ATR A;  4A62 A;  4AF1 A;  5LY3 A;  3HSC A;  4IEE A;  4CZI A;  1YJN N;  2Q1N A;  2VGM A;  3ATU A;  3CI5 A;  4IJN A;  3H3N O;  4L3Q A;  3VTH A;  3C7N A;  4JKB A;  3SAF A;  3DWL A;  5M1N A;  5M1K A;  5AZJ A;  3W3D A;  5M1F A;  3WXI A;  4O8U A;  4IWV A;  2FXU A;  4PKI A;  5E84 A;  3E9P A;  4GVE A;  1BOT O;  3A5M C;  1SQK A;  3VGK A;  3WT0 A;  4YOX A;  1DKG D;  1IG8 A;  4MO4 A;  5C2D A;  4AM6 A;  5BN9 A;  2P9I A;  4B1W B;  3A5L C;  4JKF A;  3N4Q A;  4BRD A;  3CCS N;  5GIO A;  4CZJ A;  5FPD A;  4EFH A;  5BRE A;  3TSU A;  5AQY A;  2QWP A;  4JKH A;  5ELZ A;  4FWS A;  1CZA N;  4M63 C;  5JVH L;  3O80 A;  1HUX A;  4IJA A;  3VEX A;  4B1U B;  3SMP A;  1WOQ A;  2VGN A;  3F2K A;  1LCU A;  3O1W A;  4K41 A;  1RDU A;  3TTC A;  2Q36 A;  1G99 A;  3MCP A;  3LDP A;  5FPN A;  3L4I A;  1HKC A;  1ESV A;  4B1X B;  2HF3 A;  3MX2 A;  3FGU A;  2QWQ A;  2GEM A;  3DLL L;  3OBY A;  3QBX A;  1VQM N;  3I56 N;  5AZI A;  5KPZ A;  1TYQ A;  4MLH A;  2ASP A;  3HZ6 A;  2CGK A;  3E66 A;  3U9D A;  4BRL A;  5AQO A;  4H0Y B;  5B8H A;  1S72 N;  2ZGZ A;  3TSQ A;  3H6E A;  4XH1 A;  4BR9 A;  1XQS C;  4HWI A;  1YUW A;  3ZET B;  4IEI A;  2HOE A;  2A5X A;  3P39 A;  1QQM A;  4M7Y A;  3BEX A;  5C2F A;  3BUZ B;  3H1V X;  4JNE A;  3G4S N;  1SZ2 A;  4OPA A;  3WQU A;  5BN8 A;  5GIP A;  2NRW A;  1X9J A;  3DXM B;  3WXJ A;  1VQO N;  4C1N I;  4QS7 A;  2GX9 A;  3E9L A;  5AQV A;  5BPN A;  2P9L A;  3KWI A;  1XUP O;  3FZH A;  2ZJR L;  4IOC L;  2A42 A;  4A2A A;  3LM9 A;  1VQ4 N;  2VCP A;  5EOY A;  4CBW A;  5FPE A;  1TUU A;  2NRH A;  1NLV A;  4I6M B;  2V51 B;  5AQR A;  4H5T A;  2PAV A;  3H45 C;  1BO5 O;  4GV3 A;  3FZL A;  2IVP A;  4JKD A;  3TTF A;  3UKR A;  1RGI A;  2EWS A;  1T6C A;  4FO0 A;  4JD2 B;  5MLC Q;  1VQL N;  3H1Q A;  2FSK A;  3VET A;  3QFU A;  3WEE A;  3G71 N;  1EQY A;  5BRH A;  3EKS A;  1VQ5 N;  2P9K A;  4B1V A;  4BG8 A;  1GLD G;  3FR0 A;  3O08 A;  1NGE A;  2KHO A;  1YJW N;  1VQ9 N;  4H5N A;  1JCE A;  4WFB L;  3CCL N;  4XEI A;  3AAP A;  1TUY A;  5HL7 L;  5DM6 L;  3NVK A;  2YHW A;  4YDU C;  1NBW A;  5HOO A;  2QA4 N;  2RE2 A;  3M1F A;  4K43 A;  3AGR A;  4JN4 A;  4CZE A;  4ILG B;  2BTF A;  3U9Z A;  4IDH A;  1JCG A;  4BR4 A;  4BRK A;  2Q0R A;  2GWK A;  3VF2 A;  3O5B A;  4U67 L;  5ADX A;  2H3G X;  2QWO A;  2QW9 A;  3VEN A;  3OW2 M;  1VQK N;  3ZX3 A;  2WFB A;  4JKG A;  3SMS A;  3LM2 A;  4CZF A;  2WUS A;  3EE8 A;  4A59 A;  3PIP L;  3O9Q A;  3KZB A;  4XH4 A;  1U6Z A;  1K9M O;  2OTL N;  3CHW A;  3EE9 A;  3A8Y A;  4A5B A;  3K9K A;  4A61 A;  3ZYY X;  2DPN A;  1GLJ O;  4H0X B;  4CBX A;  3EKU A;  4FPA A;  3WXL A;  2ITM A;  1ZC6 A;  4BRA A;  5C0Y A;  1T3V A;  1Q18 A;  1T44 A;  4ISF A;  1O13 A;  3IKM A;  1C0G A;  1DT9 A;  1R59 O;  2PBD A;  4BRI A;  2ASO A;  3R3L A;  4BRH A;  3HOT A;  2HBL A;  4K25 A;  4BC4 A;  4JK8 A;  2GEL A;  3PIO L;  3KVG A;  1KAX A;  4FWP A;  2W41 A;  4BRM A;  4PL7 A;  1VQ7 N;  5AQH A;  3ENO A;  3E9O A;  1MWK A;  3C6A A;  4KBO A;  2F7T A;  5AZI B;  1TYQ B;  2IVN A;  2HMP A;  5KPT A;  3O9T A;  3S41 A;  1KQS M;  4FSV A;  3TSP A;  4BR0 A;  3QFP A;  2YJE A;  4BRQ A;  3BF1 A;  3DAW A;  4ILH A;  4KH5 A;  3FZK A;  3LDN A;  1Q82 O;  2GUP A;  3A0I X;  3L6Q A;  2NRV A;  3MWT A;  4DHY A;  3P31 A;  3VGM A;  1P90 A;  5EY4 A;  3D2F A;  2NNW A;  4NLC A;  2A41 A;  3KWG A;  3U8X A;  3CC7 N;  1KAY A;  4JK7 A;  2P9N B;  3R8E A;  2AA4 A;  1W97 L;  4YDU A;  5ADX H;  1GLF O;  4IOA L;  3UKU A;  3IFR A;  4MLE A;  4BVP A;  2P9L B;  3EO3 A;  5BRD A;  3Q7C A;  1KXP A;  1YXQ A;  1ZBS A;  5JIC A;  3ENB A;  2W40 A;  4JKC A;  5TKY A;  3O4W A;  4CZM A;  3HI0 A;  3SBT A;  3L4Q A;  1V4T A;  4BRO A;  3AGK A;  4JHD A;  2WBN A;  1OKJ A;  3CJA A;  5AR0 A;  4CI6 A;  1NGA A;  3MX5 A;  4RCH A;  5AQL A;  4IO9 L;  3ZEU B;  4UY8 O;  3LDL A;  1BDG A;  1NM1 A;  3HM8 A;  4FWN A;  5AQU A;  1E4G T;  2P9P A;  3SLC A;  1BU6 O;  1J6Z A;  3CJ9 A;  5EX5 A;  4EIA A;  4PKG A;  3OBW A;  1Q81 O;  2QM1 A;  1XC3 A;  3BP8 A;  4H5R A;  4NO7 A;  1MDU B;  4B9Q A;  4GV9 A;  2A40 A;  3HOS A;  4BC2 A;  3ULE B;  2AP1 A;  4DQ8 A;  3PLA A;  4K42 A;  3UE5 A;  3CXC M;  5KQ8 A;  1JJ2 M;  3G6E N;  1BA1 A;  2JWL A;  4Y0W A;  5EXW A;  1W2B M;  4H0O A;  1X3M A;  2HST A;  4H0P A;  1OVY A;  3M3Z A;  5EVZ A;  3NVM A;  1JCF A;  3VMF B;  2QXL A;  3DXK B;  1NGF A;  1ZXO A;  4IO8 A;  4WQ5 C;  5LJV A;  2IVO A;  2Q97 A;  4BC5 A;  2P9S A;  1YAG A;  1YHQ N;  1N8R O;  3RSE B;  3CC4 N;  1IJJ A;  1QHA A;  4H0T B;  2CGL A;  5CE3 A;  4BRF A;  3CCV N;  5AQQ A;  3OA9 A;  4WQ4 C;  1NWK A;  5BRF A;  1SAZ A;  3Q7B A;  4BRN A;  4A57 A;  2E2Q A;  3VEZ A;  3GOI A;  2ZF5 O;  3W0L A;  4H0V B;  4R79 A;  2QWR A;  2WC9 A;  3QML A;  2BH1 A;  3D2E A;  3QDK A;  2YHY A;  3CQX A;  4BC3 A;  3C7N B;  2V52 B;  4GV6 A;  2QWM A;  5H1S Q;  5AZJ B;  1WUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...