3PIPL

Crystal structure of the synergistic antibiotic pair lankamycin and lankacidin in complex with the large ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords RIBOSOMAL 23S RNA
total genus 13
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3pipL01
3CCMN 1VQPN 1Q7YO 4WCEL 1YIJN 3OW2M 5DM7L 3CCEN 3CMEN 3CF5L 3CCVN 5GADP 1VQ6N 1ILYA 5GAHP 1VQ4N 3CD6N 3G6EN 1M1KO 3CMAN 1QVFM 1W2BM 1VQ8N 1YJWN 5HL7L 2QEXN 4U67L 4WFNL 5H1SQ 3CCJN 1VQLN 1QVGM 3CCSN 3PIPL 2OTLN 1K8AO 3G4SN 4UY8O 5GAGP 1VQNN 4WFAL 4IO9L 2QA4N 1M90O 1VQ7N 5GAEP 1VQKN 1YJ9N 1VQON 1KC8O 1K9MO 5DM6L 2OTJN 3PIOL 1Q81O 3I55N 3CCRN 3G71N 1YHQN 1S72N 1K73O 1KQSM 1NJIO 5MLCQ 3CPWM 3CC7N 5JVHL 3I56N 3CCLN 3CCUN 1VQMN 1Q82O 1N8RO 2ZJQL 3CC4N 1YJNN 1YI2N 4IOCL 1Q86O 1OVYA 3CCQN 3DLLL 1YITN 2ZJRL 3CC2N 4WFBL 3J7ZO 3CXCM 1VQ9N 4WF9L 5JVGL 2ZJPL 1JJ2M 1VQ5N 4IOAL 1KD1O
chains in the Genus database with same CATH superfamily
4FJ8A 1YIJN 1NJWA 2E2NA 3THXA 3P39A 1I94K 3QEPA 1IH7A 3NVKA 1JLQA 4EFHA 4I2PA 2G8WA 2CH5A 2VWJA 4IZ9A 1KLMA 4IO8A 1TL3A 4DSEA 5M1FA 3LP2A 5CYMA 3ZSZA 4U67L 1RDDA 5FPMA 1RGIA 1RT4A 1D5AA 3CCSN 4DTOA 3CFPA 4KAZA 3AGRA 1B9FA 3J81O 3LAKA 4KH6A 3VETA 1NGDA 1SV5A 1KRPA 2QA4N 4JKGA 1VK0A 3O8MA 4DU3A 3NVMA 2NRWA 1L3VA 1B92A 3NGYA 3QFPA 4PKHA 4OKJA 5CE3A 4FLXA 3QETA 1LW0A 3D2EB 3MX5A 4MLHA 4ELUA 1NJXA 1GLCG 3ZSQA 4J2AA 2CGLA 3AVJA 4OPJA 5SZTA 4JK8A 4DU1A 5FROA 3UB5A 4CE9A 1HLUA 3AVIA 1RBSA 2O8FB 1CZAN 1QQMA 4XH4A 4Z4IA 3VTHA 5BN8A 4FXDA 1IG8A 4LSNA 2Q2RA 3KK1A 4FOIA 3AA5X 3FGUA 3A5MC 1ATSA 3SJJA 4YOVA 1XMQK 5AZIA 1RBVA 3FFIA 1S9EA 2E1YA 2QM1A 4ICLA 4IOCL 3MEGA 3T69A 5BPLA 1OH6A 2YKNA 5M1QA 2ZJRL 4DV7K 4CIGA 4AH9A 3O6WA 4A2BA 3RR7A 4DB3A 1NK7A 3ZYYX 2P9LB 4PWDA 2FSKA 3KIOA 3WUHA 3VGLA 2P51A 3N4PA 2BTFA 4BR5A 4ELVA 3ALYA 2PZSA 2CGJA 2QWNA 3CJ7A 5T7BA 1BI4B 2DPNA 4DV6K 4GKJK 2P9UA 2E4LA 3CCEN 4YOWA 5FLXO 3VGMA 4X64K 5GADP 3HRGA 5BPNA 1WNSA 3OYIA 3SQ2A 1HNWK 5KRTA 3LDSA 4GVMA 4FVMA 4HTLA 4FLTA 4YDUA 4BR7A 4CBUA 1LV5A 3C95A 3G4SN 4OGEA 4A5AA 3ULDA 4N76A 3A5LC 3R9PA 1VQ7N 3M6GA 3C7NB 4CD3A 4CJLA 4DFMA 4CZEA 3D2EA 2OCEA 3QESA 1IJJA 1YT3A 3ATVA 3OVNA 4LC9B 5DM6L 4FM1A 3PIOL 3OY9A 2HOEA 1DTQA 2IVNA 4E7JA 1GLJO 1NMNA 3PX0A 3CCRN 4BVOA 1NMDA 4B3RK 3NF8A 3PV8A 3A2FA 5J1EA 4DR1K 4PA1A 1N32K 1I39A 2E2QA 3KD5E 3TSPA 4BREA 5C10A 1GLBG 1VSKA 3ZCMA 3ZSYA 3CJBA 3LM2A 1NK0A 5DMRA 5LMNK 3L2RA 3A8YA 1BOTO 5M1NA 2EHGA 3E66A 1NM1A 4FWQA 4ELTA 1BU6O 2FC0A 3MCPA 3NGIA 3VA0A 1VRUA 3C6TA 1TUUA 2YNGA 2D0PA 3B8AX 3Q7BA 1T6DA 2O4IA 1RT2A 4BRIA 4DLEA 5C25A 4CFCA 1HRHA 3C6UA 3AVAA 2ZGZA 4IOAL 2Z1HA 2B4JA 2IIRA 2F9WA 2YHYA 4AHUA 4BGAA 1K6YA 1Q7YO 4BR2A 3OW2M 1X9MA 3S3MA 4DSIA 2XO7A 1C1AA 3V4IA 2YI1A 1KCFA 3R8EA 3KLFA 4CGFA 4CGDA 3T7ZA 4BDYA 1RDWX 4HUGA 3AVCA 4H5WA 1C0TA 4ISEA 3VEZA 1WLJA 2HVHA 3AVLA 3EE8A 1QSSA 2VWBA 4WYBA 1HKCA 3EO3A 4I7FA 1NGFA 4FK2A 3L4IA 2ZE2A 3U9DA 2P9SB 3ZEUA 5E26A 1VAZA 2KW4A 4KHPK 4HUEA 4K43A 4PL8A 1N5YA 2EX3A 4LF6K 2E20A 1S3XA 2Q1NA 2I7NA 4CBWA 5J2MA 5AQMA 3H3NO 3OS1A 1W97L 3MEEA 3ZETA 4ZTFA 2KQ2A 3RVCA 5AFUA 4BY9C 5GIOA 2D5RA 5GAEP 4WQ4A 3AARA 3MX2A 1TL1A 4FJMA 5KQ8A 3ULEA 4IFVA 3WQUA 3O9TA 1VSDA 1GLDG 4NCGA 1J9AA 5KPZA 4A2AA 1J54A 4CECA 2E88A 4C8LA 2F7TA 4ILJA 1MWMA 1NGCA 3DAWA 3KWGA 3R1XA 1LWFA 2VG7A 1GLLO 4O55A 4B8AB 3NH1A 2YX6A 2XY6A 4BRFA 5ADXA 2XY8A 3FZHA 2RHKA 3HPGA 2Z1GA 3LDNA 2KLAA 1ZBHA 4CEAA 4LFCK 2H3GX 3VQ9A 1SZ2A 2IVPA 3KK7A 4DU4A 1S22A 4I2QA 1ATRA 4JI4K 3CJAA 1ASUA 2RKIA 4BROA 2HBLA 3OYMA 3ZT1A 1KAZA 4DSKA 4A59A 4H0TB 3SPZA 4O5FA 4BG8A 2FXUA 4JI5K 3B6PA 4DUYK 1DGKN 4I6MB 5EVZA 4KTWA 1BDGA 3CFRA 4C23A 2WFBA 2OZMA 4CJEA 3IS9A 4OKEA 1EQYA 3NCIA 3TABA 2E2OA 1SQKA 1XC3A 3DLKA 4OPAA 4BRNA 5AQOA 1BG3A 3VEYA 1YJWN 3DJCA 4M42A 1VSEA 2QXLA 3IAYA 1T05A 5AQTA 3CJCA 1GOCA 3HVRA 4DR5K 3SK3A 3QEXA 2KTQA 1IV0A 1HQUA 1CZ9A 1RTDA 3GL1A 3SQ4A 3LALA 3AAPA 1L3TA 4CFDA 3TTCA 2KZZA 3M3ZA 4H8KA 5DK5A 5AQXA 4RCHA 1OH7A 3DWLA 4B9QA 1VSIA 2ATQA 1U47A 1RT3A 3P38A 3FZKA 2GUPA 4KHNA 3KD1E 3OYLA 4CJ3A 2KZMA 4H4OA 2IDOA 3D6RA 3IUCA 4CD1A 5AQRA 3MWTA 4IJAA 2O8CA 4E89A 5EU7A 1S1UA 3SMPA 5F1XA 4EZ9A 2BANA 2RF2A 3DRSA 3OS2A 4FWNA 3CCUN 3G25A 4O0IA 4F2RA 3L2QA 1X9WA 4FJJA 4CBXA 4B1XB 5B8HA 2HB5A 3FZFA 3GOIA 3HM8A 2I5JA 4Q0BA 1E4FT 4DV0K 3THYB 4M3ZA 1JL2A 3ZT2A 4JS4A 2HHSA 5KGWA 3VEOA 2HNDA 4O5BA 3CXCM 4FPAA 5KQDA 4WF9L 4MDAA 1ZYQA 1V4TA 4XH5A 4E7KA 1W9HA 2VG5A 1QZ5A 1ASWA 1NBWA 1YUWA 4CZMA 4FJLA 4BR0A 3KLIA 4FJNA 2F9TA 1NK4A 5AQUA 1ILYA 1MA9B 1A5XA 1Y97A 1RDCA 3CG7A 5KTQA 5I42A 4DV1K 2P9SA 1JXEA 3G6EN 5LMUK 5AQHA 4FPBA 4JKGB 3TSQA 4B9SA 5AQGA 3SJHA 1JLFA 3HTVA 2NNWA 4HVJA 1XHZA 5BN9A 4IDHA 5ADXH 5HROA 1IKXA 4MDBA 2X78A 4BACA 4J2BA 1C0MA 3FZLA 3LP0A 3TAEA 2YNHA 4KHSA 5AQZA 4IO9L 1VQNN 3OYJA 1TK0A 1MWKA 5JLFA 2HF3A 3GBTA 4M3YA 3CQXA 3J7YP 1R59O 4JRPA 4KO0A 4KI6A 4AHSA 3BEXA 2YHAA 1WB9A 4OJRA 2F8SA 1C0UA 1K9MO 5LJWA 4DF4A 4L3QA 1BI4A 4CVNE 3SBTA 2G8HA 3NDKA 4B9UA 4B9LA 1JKHA 2E6MA 3TSUA 4O44A 2NZTA 4E1MA 4CZFA 1DTTA 3ZT0A 3QFUA 2BUPA 3QIOA 1QS4A 3BZCA 1X3NA 3A0IX 4AHVA 2HHXA 3QICA 4BC3A 1HMVA 3AA3A 3O1WA 3SUOA 2VG6A 3QLHA 2XY5A 2P9PB 3VPZA 5JVHL 4DQRA 3SUQA 1FK9A 1U6ZA 1JLCA 4CIFA 1RBUA 3M1FA 5A2QO 1WAJA 1N8RO 5C24A 3DRRA 4A5BA 4CGGA 2W41A 4CK1A 2Q0UA 4BWMA 3THYA 5HRSA 5AZJA 3NAEA 3ID6A 5IWAK 4YOYA 3M8SA 3K57A 2VGMA 3T1AA 3G0ZA 3L4QA 2O8CB 1ASVA 3SUPA 1NK8A 1O1WA 1VSLA 2RPIA 3MMVA 3RSEA 3V9ZA 3O3GA 1NOYA 4F4KA 3SAGA 3BDPA 1SAZA 1VQPN 4FYDA 2OPQA 2BGGA 3DI6A 3HVTA 2YHBA 2ZGYA 4DQSA 3UKRB 3VQ6A 4GKKK 2WBNA 2F4VK 1M1KO 4Z0UA 1QVFM 3W0LA 1WSEA 1RILA 4M3RA 1ATNA 2XY7A 4B3TK 5HL7L 5GIPA 1HQEA 3K0SA 4DR2K 5H1SQ 3VQ8A 4Z4FA 3SAHA 3WT0A 4FZYA 3F9MA 4OKKA 3LDQA 1NGAA 3AVKA 3VQCA 4DHYA 4H4MA 2FLOA 2X6NA 3WEEB 4CESA 5KI6A 2RN2A 3RRGA 2JLEA 2QKKA 2R7YA 3ITHA 3RR8A 1NGJA 5FPDA 3BY5A 2UXBK 2QWLA 3CHWA 3WQTA 3MWPA 3OS0A 2Q36A 2UU9K 3LANA 4JNEA 1QE1A 5TKYA 4RG8A 4DV5K 1EX4A 3RRHA 3I55N 1YTAA 4DR6K 4H0VB 1KQSM 4FW1A 1KVCA 1Z25A 1NOZA 1QHAA 3V6DA 1ESVA 3L6QA 3EY1A 2OANA 3VESA 3ZEUB 4CK2A 4FWOA 4RW9A 4B1VA 1BQMA 3TWHA 1IO2A 5M1KA 4DF8A 4RW7A 3BF1A 3THXB 3ZETB 1D9FA 4ID1A 3ZSOA 3K9JA 3LZJA 2O8DB 4HHTA 3WXKA 1HKGA 1WBBA 1NGEA 5KRSA 4E7LA 4FZZA 1QQCA 4MFBA 2QTDA 3V1OA 4MLEA 5AQPA 3HPOA 3DYAA 4CEFA 5AFUH 3UKUB 3EYZA 3AO1A 5FPEA 3NH0A 4CIEA 4X66K 2IAJA 2JGUA 4YY3K 4FJKA 3WXIA 4OLAA 4FM0A 1TKZA 2V52B 4H0PA 3VEVA 1S1WA 2D4WA 5M1OA 4GV3A 2E1ZA 3BP8A 3CD6N 4CJVA 4CHYA 4DTNA 1NK9A 1RT5A 2ITMA 3NH2A 4ISFA 2WOMA 4IFYA 5AQFA 1BL3A 1LWEA 3FFKB 4BRHA 1NWKA 4DSFA 3MECA 1RDAA 3U4LA 3V9XA 3LDPA 4OVLA 1XNQK 1CXQA 4CFBA 1NLVA 4BWJA 1EP4A 4CW7B 1U48A 4HUFA 4F3OA 2YHWA 2P5GA 2HBJA 4JI3K 4WFAL 3GDQA 2NRZA 2ZWHA 1WSFA 4DUZK 5ELZA 2QXFA 1XNRK 5CZ1A 3CETA 3UKRA 4CJWA 3JS6A 1KFDA 2HHVA 1HPZA 3RSEB 4E19A 1YJ9N 1XC9A 4BDZA 1HX1A 3FLCO 3BGRA 1KC8O 2XRIA 1H1VA 1QQNA 1HYVA 4B8CA 1FKPA 4CF8A 3O9UA 3CIPA 3H6EA 4KREA 3UIQA 1LOTB 2A1RA 1YHQN 3OYKA 4YFUA 2NLXA 4X62K 1NGHA 1U2VA 2X6SA 2O8BA 2A42A 1S1VA 3CC7N 3O9QA 4CZIA 1RCHA 4WE1A 4FJ9A 4DTSA 1NGBA 4PHTX 1ZBIA 2IOCA 3KVGA 2UUCK 1YI2N 5AQIA 1OVYA 2FF6A 2B6AA 1X3MA 3CC2N 1JXBA 1OKJA 3AAQA 3P1GA 4ZHRA 4DV4K 4KKOA 1WOQA 3ATUA 4M7YA 4FLWA 2A6AA 1L3UA 4W5RA 1ZBSA 3AVFA 3F2KA 4NYFA 4BRCA 3CQ8A 3VGKA 4DS5A 3C6AA 2VCPA 2ASPA 3CMEN 4FSVA 3CCVN 2E8AA 3HK2A 3QEWA 3WNHA 3CYMA 4CJUA 5GINA 4Z4CA 1W2BM 4BQLA 2QEXN 3OJUA 4G9ZA 3H46O 3HYFA 3IFRA 4DV2K 1GOAA 5LL6Z 2WC9A 4KV8A 1ITGA 5EXWA 3S3OA 5E41A 2HNYA 1K8KA 3S3NA 2Z1JA 4NB4A 1KLNA 3C65A 4CGHA 2QWPA 3JAMO 4IFEA 5AJ3K 4JN4A 2W6LA 3ZX3A 4YOXA 2HW3A 5IT9O 4DTXA 3V9WA 1OH8A 5J2NA 3TU5A 3SI6A 4M3XA 3DMJA 4CJKA 2HHQA 1DEJA 4DQ8A 4F8RA 3SBGA 1TGOA 4G1QA 1EXQA 3PSIA 1E4GT 2UUBK 1HR0K 1BCMA 4PY5A 4EZ6A 1CZBA 3T3FA 2JWLA 4O8UA 4N5SA 1T7PA 1S72N 4JI2K 4RW8A 3AO4A 3A5NC 2P9IB 3NF7A 3VEWA 3MXIA 4H5NA 4K42A 4B1WB 4B3SK 1C1BA 1GLFO 3OYHA 2PY5A 5AQKA 1Q82O 2Q0RA 4FWLA 4NLCA 3VQBA 4KTZA 3VENA 2FSNA 1JLEA 3ENBA 1NKBA 4OGCA 4CI6A 4W5QA 3D2FB 3LDOA 4BGBA 5AQNA 1N6QA 5JICA 4F3TA 1S5JA 2UUAK 4FLYA 2ASMA 1IKWA 1UOCA 3HP9A 5HRNA 3VTIA 4K41A 1T03A 4EHUA 1C1CA 3ZLJA 3IRXA 1Q9YA 3MXJA 3TAFA 4FVUA 3CI5A 3PO5A 3FE1A 1JJ2M 1KD1O 1YVUA 3CJ9A 3DXKB 2G8KA 2W40A 1VSMA 1ZC6A 5KGXA 4BE2A 3KLEA 1TAQA 1U04A 3C6HA 2FBTA 3WXLA 1QZ6A 3OYCA 3RWUA 4CHOA 1FJGK 1TYQB 4N41A 1YAGA 3N4QA 3AO2A 3MN6A 1TK5A 4RW4A 3MK6A 4O4GA 5AQSA 3O9SA 2VQFK 5F2RA 1MU2A 2A3ZA 4FJHA 4GV6A 2D0AA 4KFBA 5BPMA 4UY8O 3D2FA 4KI4A 4EAHD 4CHPA 1BISA 2GBZA 2DFFA 3QBWA 3CM6A 4JHDB 1X1PA 3QEIA 4JK9A 3AY9A 4JKCA 4IEIA 1RNHA 1BQNA 4FJ5A 4GW6A 2GTDA 3HXMA 3PSFA 1WSJA 3CJ1A 3MDQA 2Y1IA 4LY7A 3VQQA 3KHYA 1X9JA 4CJRA 2A5XA 1W0HA 5FRNA 3O4QA 4LFBK 4FJ7A 1JLAA 1XUPO 4MQ3A 1QTMA 1FXXA 4CJ5A 1DLOA 4CHZA 3T19A 5AQWA 4BRDA 4J2EA 4NYNA 3JXUA 2QWOA 3OA9A 4CJ7A 2J4RA 2O8FA 3O08A 3ENHA 4CEEA 1KVAA 1A5WA 4C8MA 4KBOA 3IG1A 4V19S 4B3MK 3C0BA 3VQDA 3QBXA 4M3TA 4BRAA 3V9SA 2PBDA 3VERA 4IBNA 4B9NA 5JLHA 5C0YA 4MO5A 3D7EO 3E1YA 4JHDA 3QO9A 5BRDA 4GY2B 2ZJPL 4Z4EA 3PUFA 4B9VA 3WXJA 3F9KA 4FZXC 3CCMN 4O0JA 4WCEL 2NRVA 3TPQA 1TAUA 4OPKA 4NCAA 2P9KB 2GWKA 4JI8K 3KJVA 2AP1A 2QW9A 1RBTA 3NFAA 4IOXA 1RTHA 4IXCA 4B1ZA 2IS3A 2OPSA 4QCLA 1HNXK 1GOBA 3AO5A 4JK7A 4BR4A 1KAYA 1KAXA 4MO4A 4WFNL 4CJQA 3CCJN 3ZT4A 2W42A 1VQLN 5SWMA 2A41A 1BA1A 4DFPA 1U45A 3KWIA 4YOUA 2GUIA 3PIPL 3E9OA 3O1BA 2CGKA 3A5OC 4KHWA 4DR3K 4KH4A 5TKWA 2YNIA 4JS5A 4DCHA 3CERA 3RMCA 5AZIB 4E1JA 3L2UA 4W5TA 4QS9A 1IG9A 2VQEK 4BC2A 3V81A 1WN7A 2V7YA 1HJRA 5BR8K 4C1NI 4Q5VA 4DTJA 1XMOK 1SUQA 3S41A 5AQVA 3OBYA 1LW2A 3FZMA 4EHTA 3EL2A 1Z26A 2G8UA 4L8RB 3HT3A 2F8TA 3E9LA 4I9QA 1LAVA 3VQ4A 3SNNA 3VQEA 3ZT3A 4CZLA 4DLGA 3L3UA 3M5RA 3QMLA 4BG9A 5KPRA 3IDHA 3PX4A 1OH5A 2KFZA 4CJPA 3K5OA 3SV3A 3TAMA 3NF9A 3WXMB 1F21A 3TR8A 3HSTB 3SQ1A 1GLAG 1XWLA 2P9NA 3U3GA 4FWSA 1C6VA 4H0YB 3B6OA 2Q97A 5JVGL 2DY4A 1UA0A 2YV0X 1VQ5N 1NNEA 3LDLA 3M8PA 4YHHK 5D3GA 2OYQA 5CR4A 5DM7L 5HP1A 1TYQA 4JI1K 4CF1A 1WSHA 1VQ6N 4JKAA 4H03B 3OYBA 4LF5K 1VQ4N 3MEDA 4CGJA 1IKVA 3CM5A 1SS6A 3LWLA 3VA3A 1NGIA 4CHNA 4H0XB 1J5OA 2HSTA 1QSYA 1T6CA 4AM7A 4JKFA 2WUSA 4B1YB 1XQSC 2YJEA 3PLAA 3ZSVA 3DM2A 5HBMA 3PY8A 4LFAK 2YNFA 5GAGP 3HPHA 3KTQA 2YCHA 3LL3A 4CK3A 3TARA 3P4IA 3W3DA 1WSGA 2E2PA 2D0OA 2P9KA 2HHWA 1M90O 4HCBA 2ITGA 1VQON 1NJZA 3VEXA 2KHOA 4PL7A 3OYAA 2ZM6K 4QAGA 4M3WA 3DLGA 3K5MA 1P8ZA 2G8FA 3TAGA 4ZTJA 4AILC 2W6KA 5C2FA 3RMAA 1BGXT 3EZWA 4U7BA 2F96A 4FO0A 4BRMA 1Q81O 1REVA 2BH1A 4O8KA 2BDPA 1TK8A 3G71N 3IMXA 4DQPA 4FLZA 4W5NA 1IBMK 4NXMK 2Q3SA 3WNFA 2QWQA 3BUZB 1JLBA 1Z05A 4OPHA 4EP4A 4C8OA 4DQIA 2OPPA 5F0XA 1BCOA 3GE1A 4C8KA 1Q86O 4M41A 2CH6A 2HF4A 5BRHA 4DFJA 4FJIA 2FBYA 4BDPA 2PYJA 3KKSA 2D0CA 3NGZA 1YITN 2OZSA 5BREA 3R3LA 4WFBL 1I3AA 4DWIA 4BVPA 4LH5A 3ENOA 4CJTA 4FK4A 3J7ZO 3O9RA 3LP3A 3OYNA 1HNZK 3J7AP 4LF7K 1DT9A 3AGKA 1RT7A 4DR7K 1HJOA 2HMPA 1P90A 4DTUA 3U6FA 1X9SA 3L3VA 5J2QA 4JKEA 4E1NA 3VF6A 4LD0A 4DMNA 3K58A 3AVNA 4C8NA 3O5BA 4EP5A 4JRQA 3ZSRA 3QDKA 1BO5O 3L8BA 4CJFA 1T44A 3TAQA 3EZ5A 3K5NA 3WEEA 1L5UA 2GV9A 1RT1A 2O8EB 4YORA 3IKMA 3HOSA 3OJSA 3I8DA 3DXKA 1NK6A 3OYGA 1V4SA 5CHIA 5CZ2A 3BF3A 4CGIA 3CQYA 2EWSA 4CF2A 2D1KA 1ZXOA 3VF2A 3SLCA 3RTVA 3DLRA 1VQKN 1S6PA 1SKWA 3LWMA 3M8RA 1LAWA 2DFHA 4XIUA 4BRLA 3HZ6A 3NBPA 2OTJN 4JI7K 3H45C 5AR0A 4GV9A 3SUNA 4AQYK 4JKDA 2HBMA 1EO1A 1UAXA 5LY3A 4KHYA 4N47A 4CHQA 5MLCQ 1NU0A 2Q31A 4A62A 3CPWM 2Y1JA 4KHQA 2V51B 2YKMA 3LP1A 1C0GA 4B9TA 2AJQA 3H08A 2ZJQL 3BZKA 2AA4A 2O8EA 2QWRA 3F5TA 4H5VA 1OVQA 2HHTA 4CEOA 4LF8K 5JS2A 4KTQA 4H5TA 3VN5A 3AA2A 4HTUA 3H3OB 4RWTA 4CJ4A 1VQ9N 5EX5A 3HJFA 4PUOA 3SCXA 3EEQA 4K8ZA 1JL1A 2NRXA 3OHRA 4JAXA 1QHTA 2X74A 1KXPA 2A1SA 5BRFA 4NXNK 4NO7A 1J5EK 2KFNA 4BRPA 3DLEA 3T1YK 1J53A 4CEQA 1N33K 1IBKK 1J6ZA 3NF6A 4ISGA 4E7HA 3I33A 5M1PA 3O80A 4YOTA 1FW6A 4DSJA 2G8IA 3SPYA 4KRFA 4QS8A 3AVHA 2QK9A 2OPRA 1EWQA 4YDUC 1TKTA 1WBDA 5AQQA 3ULEB 3ID8A 4ILHA 1QVGM 3S9HA 2RE2A 3NHGA 4FL9A 2OTLN 1HYSA 2GWJA 1IBLK 4FK0A 2E5LK 5FRMA 5E84A 4BC4A 1RDUA 4IG3A 3MXMA 1Z6RA 3HBTA 1W7AA 3HSCA 3P83D 2FBVA 3L2WA 4E0DA 3TTDA 1ZBLA 4XEIA 1CXUA 5I9EB 3L2VA 3WNGA 4FWPA 5C2DA 4FW2A 3AV9A 4JLHA 4JKBA 2I7PA 4E3SA 4JD2B 1S9GA 2O8BB 2VYPA 3VQPA 4FWMA 1WUAA 4RTFD 1JLGA 1HYZA 2PFUA 1N36K 3ZSWA 4BE1A 3PX6A 3ZSXA 4KB1A 1K8KB 4WQ4C 1HUXA 1VRTA 4Y1DA 2ZD1A 2IGIA 3U3YA 4F2SA 2GEMA 5EY4A 3PO4A 3RMBA 1JCEA 3K59A 2KKZA 3CC4N 4CZHA 4OO1J 1YJNN 3THVA 1HKBA 3LPUA 1WAFA 3THWB 4CF0A 3SAFA 2YJFA 2P9NB 4PKGA 4BC5A 3ISNC 4CEBA 2NRRA 1S1XA 4J8FA 4K8XA 1RBRA 2D0BA 3O3FA 3EN9A 3LZIA 3VQ7A 4TSXA 1SL2A 3OYFA 5EOYA 1CLQA 4CF9A 1U49A 4Z4HA 5CY4A 4DS4A 4JV5K 5JS1A 3KLGA 4KH5A 1KFSA 3TTFA 1JCGA 3QEVA 3SZ2A 1TV6A 2P9IA 3KK3A 2V7ZA 5GAHP 3O4WA 5HRRA 2NRHA 3QINA 4HCCA 2UYTA 3H1VX 3C94A 1YTUA 1ZBUA 4I6MA 1QSLA 3UE5A 4CJSA 1ZBFA 4IKFA 2Z1IA 4XH1A 1YVNA 3DRPA 4LSLA 3O3HA 3DLHA 4R5PA 3F73A 3MN9A 2PAVA 4OLBA 4IEEA 4WQ5A 4HWIA 2GX9A 2BE2A 1DKGD 2FSJA 2YHXA 3T1HK 4BE0A 4GVEA 4FM2A 5JMVA 1B9DA 1D4XA 3VQ5A 3CFOA 2G8VA 4JKHA 4FCYA 2WTUA 2QI2A 1NK5A 4M7XA 3DLBA 3MN7A 3SQ0A 5AQJA 4LF4K 3AVBA 2A40A 4Z94A 3AA4A 2OA8A 4F9OA 3DXMA 4IJNA 2P9LA 1K73O 3GG4A 3AO3A 3J80O 4LF9K 1LWCA 1UWBA 1NG9A 4ILGB 5K14A 5FPNA 1A5VA 3Q7CA 2VGNA 1BWFO 3I56N 3QB0A 1IKYA 1T3VA 4W5OA 4DG1A 2FBXA 4BRQA 2UXCK 4FJGA 4CZJA 3CPEA 1TKDA 4C1NK 3HOTA 2B5JA 1NKEA 1TUYA 3EE9A 3OBWA 1VSFA 4JD2A 1T8EA 1RFQA 1BA0A 1BIUA 1Q9XA 4LH4A 3E9PA 3ZX0A 4DTRA 1N34K 1RDBA 4GMJB 1S6QA 1EWRA 1G15A 3LAMA 4A57A 3TANA 1KVBA 4DV3K 2ASOA 3KK2A 3CMAN 2QKBA 3P5JA 4BRKA 5HOOA 4BQZA 3VQAA 4DTPA 3OYEA 3SYZA 1NJYA 1EKEA 1VSJA 4BR9A 1SKSA 3U8XA 4NCBA 3K2PA 2XHBA 3I8BA 3HM9A 2VWKA 3V9UA 2WONA 4CZGA 4QOZB 4IG0A 3M8QA 4IWVA 3AVMA 4CEZA 5HRPA 3QIPA 3G10A 1U2VB 4AHCA 4NLBA 4R79A 3OTOK 4EIAA 2NUBA 1JCFA 2ZF5O 3D0PA 1U4BA 3ZX2A 4B3OA 1RT6A 4DSLA 3D45A 2E6LA 2PYLA 4KB0A 4BRGA 1RTJA 3WNEA 3LM9A 4M63C 3KLHA 1HNVA 5AZJB 4J2DA 4IDKA 1Q18A 1SKRA 3RMDA 2ZQBA 3OYDA 4DQQA 1S1TA 3JYTA 3CCLN 1VQMN 4I9LA 4KHUA 3UKUA 4YNQA 4CCHA 5BR9A 3THWA 4PKIA 4JEPA 2HMIA 3J8AA 4B9MA 1MDUB 2P9PA 1QQOA 1XI1A 3H1QA 3VMFB 4X65K 1VSHA 3QNOA 4N56A 5I3UA 1EETA 3QERA 2GELA 2HBKA 1NGGA 3NMUA 3DOKA 5C15A 1Y64A 3K5LA 3P31A 3HP6A 4Y0WA 4FOEA 4AHRA 3LPTA 1FKOA 4JI6K 3TAPA 3DXMB 3EKSA 4RW6A 4WQ5C 4CERA 1KSPA 3HI0A 1XHXA 4DKWA 5C42A 2DTUA 3SMSA 3NE6A 1TVRA 1G99A 2P1JA 4DTMA 3CF5L 3JSMA 4CEDA 4DR4K 4E7IA 5LJVA 2DFEA 3EKUA 4B08A 5J2PA 3I0RA 4FWKA 2HVIA 1VQ8N 2HNZA 4FJXA 3AVGA 3O4NA 3QNNA 3MN5A 2JWKA 1GLEG 1SL0A 3HL8A 4K25A 3TI0A 4M3UA 1K8AO 4JYAK 4QS7A 3KZBA 1LCUA 1VHXA 2O4GA 4UQGA 1HPMA 4KPYA 1D9DA 5KPTA 4FLUA 1HNIA 4B1UB 1NKCA 3U9ZA 1BHLA 5AQLA 5HLFA 4Y1CA 5CYQA 1YXQA 4Z4GA 4AF1A 3FR0A 3E01A 4PQUA 2FF3B 4K0KK 1D8YA 3R6MA 4CFAA 5AQYA 4JI0K 1E3MA 1TKXA 3V1RA 4DFKA 4OX9K 2P9UB 1NJIO 3MCAB 3VF4A 2NRTA 3DOLA 2LSNA 3HO1A 2IC3A 2O8DA 1KTQA 2HHHK 4CZKA 1BUPA 3K9KA 4GNIA 3L0QA 1R0AA 1BIZA 3ASMA 1L3SA 2QWMA 4ID5A 3SV4A 3I0SA 5FDLA 4FWRA 3MAQA 3KKRA 3CCQN 2P5OA 2HHUA 3DLLL 4H0OA 1RTIA 4AM6A 1Q8IA 1WSIA 3V1QA 2IVOA 1O13A 4A61A 1UA1A 4H5RA 5C12A 1SL1A 2UXDK 3VOVA 4FLVA 1YF5L 4AHTA 3C7NA 1C0FA 2ETJA 4M45A
chains in the Genus database with same CATH topology
4BRPA 3CJ9A 3DXKB 1YIJN 1NBWA 1YUWA 4CZMA 2E2NA 2W40A 3P39A 4BR0A 1ZC6A 3NVKA 2F9TA 4EFHA 5AQUA 1ILYA 1MA9B 3C6HA 3WXLA 1J6ZA 4ISGA 1QZ6A 2P9SA 3I33A 2CH5A 5M1PA 3G6EN 3O80A 5AQHA 1TYQB 4FPBA 4IZ9A 4IO8A 4JKGB 4YOTA 1YAGA 3N4QA 3TSQA 5M1FA 5AQGA 4QS8A 3SJHA 3MN6A 4U67L 3MK6A 3HTVA 4YDUC 5AQSA 3O9SA 5FPMA 5AQQA 3ULEB 2NNWA 3ID8A 4ILHA 1RGIA 4IDHA 5BN9A 5F2RA 5ADXH 2A3ZA 4MDBA 1QVGM 2RE2A 3CCSN 4FL9A 4GV6A 2OTLN 2GWJA 3AGRA 3FZLA 5BPMA 5E84A 4KH6A 4UY8O 3VETA 1NGDA 3D2FA 5AQZA 4BC4A 4IO9L 1VQNN 1RDUA 1MWKA 2QA4N 4EAHD 1Z6RA 3HBTA 4JKGA 3O8MA 5JLFA 2HF3A 3GBTA 3HSCA 3NVMA 2NRWA 3QBWA 4JHDB 3CQXA 1R59O 3BEXA 3QFPA 3TTDA 4JK9A 4PKHA 5CE3A 3AY9A 3D2EB 3MX5A 4JKCA 4IEIA 4MLHA 4XEIA 1GLCG 5I9EB 2CGLA 1K9MO 5LJWA 4L3QA 4JK8A 4FWPA 3UB5A 5C2DA 1HLUA 3SBTA 2GTDA 2I7PA 4JKBA 3TSUA 2NZTA 4JD2B 1CZAN 4CZFA 1QQMA 2VYPA 3CJ1A 3MDQA 4FWMA 3QFUA 2BUPA 4XH4A 1X3NA 1X9JA 3A0IX 2A5XA 3KHYA 3QICA 3VTHA 4BC3A 1WUAA 4RTFD 5BN8A 1XUPO 3O1WA 1IG8A 2PFUA 2Q2RA 2P9PB 4FOIA 3VPZA 5JVHL 3FGUA 1U6ZA 5AQWA 4BRDA 3A5MC 1K8KB 1ATSA 4WQ4C 1HUXA 3M1FA 4YOVA 1N8RO 2GEMA 5EY4A 5AZIA 4A5BA 3JXUA 1JCEA 2KKZA 2QWOA 2W41A 3OA9A 4CJ7A 4CZHA 2J4RA 3CC4N 4OO1J 2E1YA 2QM1A 1YJNN 4IOCL 1HKBA 3T69A 3O08A 5BPLA 3ENHA 2Q0UA 4KBOA 2YJFA 2P9NB 4PKGA 4BC5A 3SAFA 2NRRA 5M1QA 3C0BA 2ZJRL 5AZJA 3ID6A 3QBXA 3O6WA 4BRAA 4A2BA 4J8FA 4YOYA 2PBDA 3VERA 4DB3A 3ZYYX 5JLHA 5C0YA 2VGMA 4MO5A 3D7EO 2P9LB 2FSKA 3E1YA 3EN9A 3L4QA 4JHDA 3WUHA 3VGLA 5BRDA 4GY2B 3N4PA 2BTFA 4BR5A 5EOYA 3MMVA 2ZJPL 3RSEA 2CGJA 2QWNA 3CJ7A 3WXJA 3SAGA 3CCMN 1SAZA 1VQPN 4WCEL 2NRVA 3TPQA 2DPNA 4KH5A 2P9UA 3TTFA 4YOWA 2ZGYA 3CCEN 1JCGA 2P9KB 3UKRB 3VGMA 5GADP 2P9IA 3HRGA 2GWKA 2V7ZA 5BPNA 2AP1A 2QW9A 5GAHP 4IOXA 4IXCA 4B1ZA 2WBNA 3O4WA 1M1KO 1QVFM 3W0LA 2NRHA 1ATNA 2UYTA 3H1VX 4JK7A 5HL7L 4I6MA 4BR4A 1KAYA 5GIPA 3UE5A 1KAXA 4MO4A 4WFNL 4XH1A 5H1SQ 1YVNA 3SAHA 3CCJN 3WT0A 3F9MA 1VQLN 3LDQA 4HTLA 2A41A 1BA1A 1NGAA 3MN9A 4YDUA 4BR7A 3KWIA 2PAVA 4YOUA 4CBUA 4DHYA 3PIPL 3E9OA 4IEEA 4WQ5A 2FLOA 3O1BA 4HWIA 2CGKA 2GX9A 3WEEB 3G4SN 1DKGD 2FSJA 3A5OC 2YHXA 4GVEA 4KH4A 5JMVA 4A5AA 1D4XA 3A5LC 5TKWA 3R9PA 4JKHA 1VQ7N 2QI2A 3CERA 3M6GA 5AZIB 4DCHA 4E1JA 3C7NB 4M7XA 4CD3A 4QS9A 1NGJA 5FPDA 3MN7A 4CZEA 3D2EA 4BC2A 2QWLA 3CHWA 3WQTA 1IJJA 5AQJA 2V7YA 3ATVA 3MWPA 4LC9B 4C1NI 5DM6L 2Q36A 4JNEA 2A40A 5TKYA 5AQVA 3S41A 3PIOL 4Z94A 3OBYA 2HOEA 3FZMA 2IVNA 3I55N 4EHTA 1GLJO 3EL2A 4F9OA 3CCRN 4BVOA 3DXMA 4IJNA 1NMDA 4H0VB 2P9LA 1K73O 1KQSM 3E9LA 3GG4A 1QHAA 1ESVA 4ILGB 3L6QA 5FPNA 3Q7CA 2VGNA 1BWFO 3I56N 2OANA 2E2QA 3VESA 3ZEUB 4CZLA 3M5RA 3QB0A 3TSPA 4BREA 5C10A 1GLBG 3CJBA 4FWOA 1T3VA 3QMLA 3LM2A 3IDHA 4BG9A 5KPRA 4B1VA 4BRQA 5M1KA 3A8YA 4CZJA 1BOTO 3WXMB 5M1NA 3BF1A 3E66A 3CPEA 1NM1A 3ZETB 4C1NK 1GLAG 3HOTA 2P9NA 4FWQA 1BU6O 1TUYA 3MCPA 3EE9A 3K9JA 3OBWA 4FWSA 1TUUA 4H0YB 3WXKA 1HKGA 4JD2A 2D0PA 3B8AX 3Q7BA 1T6DA 1NGEA 4BRIA 1RFQA 2Q97A 5JVGL 2QTDA 1BA0A 2ZGZA 4MLEA 5AQPA 1VQ5N 4IOAL 3LDLA 2IIRA 5AFUH 2YHYA 3E9PA 2F9WA 3ZX0A 3UKUB 4BGAA 1Q7YO 4BR2A 3OW2M 5CR4A 5FPEA 5DM7L 1TYQA 4A57A 2YI1A 1VQ6N 4JKAA 4H03B 3R8EA 3WXIA 2V52B 4H0PA 3VEVA 2D4WA 3T7ZA 1RDWX 5M1OA 2E1ZA 1VQ4N 3BP8A 2ASOA 4H5WA 4ISEA 3VEZA 4GV3A 3CD6N 3CMAN 2ITMA 3EE8A 1SS6A 4ISFA 2VWBA 4BRKA 4WYBA 5HOOA 5AQFA 4BQZA 1HKCA 3EO3A 1NGFA 3FFKB 3L4IA 3U9DA 1NGIA 2P9SB 4H0XB 4BRHA 1NWKA 3ZEUA 2HSTA 4BR9A 5E26A 1VAZA 1T6CA 3U4LA 3U8XA 3LDPA 4AM7A 4K43A 4JKFA 2WUSA 1NLVA 4PL8A 1XQSC 4B1YB 2YJEA 2E20A 3PLAA 3I8BA 1S3XA 2Q1NA 2YHWA 2I7NA 4CBWA 5AQMA 2HBJA 4CZGA 3H3NO 5GAGP 1W97L 3ZETA 4WFAL 2YCHA 3GDQA 3LL3A 2NRZA 2ZWHA 4IWVA 5ELZA 3RVCA 5AFUA 4BY9C 3P4IA 3W3DA 5GIOA 2E2PA 2D0OA 2P9KA 3CETA 3UKRA 1U2VB 3JS6A 1M90O 5GAEP 4NLBA 4WQ4A 3RSEB 1YJ9N 1VQON 4R79A 3VEXA 1HX1A 2KHOA 3FLCO 3AARA 4PL7A 3MX2A 4EIAA 1JCFA 1P8ZA 1KC8O 2ZF5O 3ULEA 1H1VA 5KQ8A 3WQUA 3O9TA 3ZX2A 1QQNA 1GLDG 5C2FA 5KPZA 3EZWA 3O9UA 4A2AA 4U7BA 3CIPA 3H6EA 4FO0A 4BRMA 2E88A 4BRGA 1Q81O 1LOTB 2BH1A 2F7TA 4ILJA 4O8KA 1MWMA 1NGCA 3DAWA 3KWGA 3R1XA 3LM9A 4M63C 3G71N 1YHQN 1GLLO 2NLXA 2YX6A 3IMXA 1NGHA 5AZJB 4BRFA 1U2VA 5ADXA 1Q18A 3FZHA 2A42A 2RHKA 3CC7N 3O9QA 2QWQA 3BUZB 3LDNA 3CCLN 1VQMN 1Z05A 4CZIA 2KLAA 4OPHA 3UKUA 2H3GX 5BR9A 1NGBA 4PKIA 4JEPA 4PHTX 3J8AA 1MDUB 2P9PA 3KVGA 1QQOA 3H1QA 3VMFB 1SZ2A 5F0XA 3GE1A 2IVPA 1YI2N 3KK7A 1S22A 1Q86O 5AQIA 1ATRA 3CJAA 1OVYA 2CH6A 1NGGA 2GELA 2HBKA 2HF4A 5BRHA 3NMUA 4BROA 2FF6A 2HBLA 1X3MA 1YITN 5C15A 3CC2N 5BREA 3R3LA 4WFBL 1KAZA 1OKJA 1Y64A 3AAQA 3P31A 4A59A 4BVPA 3ENOA 4H0TB 4O5FA 4Y0WA 4BG8A 3J7ZO 3O9RA 4FOEA 3DXMB 1WOQA 1DT9A 2FXUA 3EKSA 3AGKA 4WQ5C 1DGKN 3HI0A 4I6MB 1HJOA 4DKWA 3ATUA 4M7YA 5EVZA 1BDGA 2HMPA 2A6AA 3SMSA 1P90A 1ZBSA 3F2KA 4BRCA 4C23A 1G99A 2WFBA 4JKEA 3VGKA 3C6AA 2VCPA 2ASPA 3VF6A 1EQYA 3CMEN 3CF5L 4FSVA 3CCVN 2E2OA 2E8AA 1SQKA 1XC3A 5LJVA 3O5BA 3EKUA 4OPAA 5GINA 4FWKA 3QDKA 4BRNA 1BO5O 5AQOA 1W2BM 1VQ8N 1BG3A 3MN5A 3VEYA 1YJWN 4BQLA 1T44A 3DJCA 2QEXN 4G9ZA 3H46O 2JWKA 3IFRA 2QXLA 3WEEA 2WC9A 5AQTA 1GLEG 3CJCA 5EXWA 3SK3A 1K8KA 4YORA 4K25A 3IKMA 3HOSA 1K8AO 4NB4A 4QS7A 3C65A 3KZBA 1LCUA 2QWPA 3DXKA 3GL1A 4IFEA 1V4SA 3AAPA 5CHIA 4JN4A 1HPMA 3BF3A 3ZX3A 4YOXA 3TTCA 5KPTA 3CQYA 3M3ZA 2EWSA 4B1UB 5AQXA 4RCHA 3U9ZA 2D1KA 1ZXOA 3VF2A 3SLCA 3DWLA 1VQKN 4B9QA 5AQLA 3TU5A 1YXQA 3P38A 4BRLA 4AF1A 3FR0A 3FZKA 3HZ6A 1DEJA 2FF3B 2GUPA 4DQ8A 3SBGA 3R6MA 2OTJN 5AQYA 1E4GT 3D6RA 3IUCA 4CD1A 3H45C 5AR0A 4GV9A 2JWLA 4O8UA 4JKDA 2HBMA 5AQRA 3MWTA 4IJAA 2P9UB 1EO1A 1S72N 5LY3A 3SMPA 1NJIO 3MCAB 3VF4A 2NRTA 3A5NC 2P9IB 3VEWA 5F1XA 4H5NA 2Q31A 4K42A 4A62A 4B1WB 5MLCQ 3CPWM 4FWNA 2V51B 1GLFO 3CCUN 3G25A 4CZKA 1BUPA 3K9KA 4GNIA 5AQKA 1C0GA 3L0QA 1Q82O 2Q0RA 4FWLA 4NLCA 2QWMA 3VENA 2FSNA 4CBXA 2ZJQL 2AA4A 3ENBA 4B1XB 5B8HA 4FWRA 3FZFA 3GOIA 3HM8A 4CI6A 3D2FB 2QWRA 1E4FT 3CCQN 3LDOA 3F5TA 3DLLL 4BGBA 4H0OA 4H5VA 5AQNA 4AM6A 5JICA 2IVOA 1O13A 2ASMA 4A61A 3VEOA 4H5TA 3VTIA 3H3OB 4K41A 4H5RA 4EHUA 3CXCM 4FPAA 5KQDA 4RWTA 5C12A 1VQ9N 5EX5A 4WF9L 3VOVA 4MDAA 2NRXA 4FVUA 3CI5A 1V4TA 3OHRA 4JAXA 4XH5A 1KXPA 3FE1A 1YF5L 1JJ2M 1QZ5A 3C7NA 1C0FA 1KD1O 5BRFA 4NO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM N;  1VQP N;  1Q7Y O;  4WCE L;  1YIJ N;  3OW2 M;  5DM7 L;  3CCE N;  3CME N;  3CF5 L;  3CCV N;  5GAD P;  1VQ6 N;  1ILY A;  5GAH P;  1VQ4 N;  3CD6 N;  3G6E N;  1M1K O;  3CMA N;  1QVF M;  1W2B M;  1VQ8 N;  1YJW N;  5HL7 L;  2QEX N;  4U67 L;  4WFN L;  5H1S Q;  3CCJ N;  1VQL N;  1QVG M;  3CCS N;  3PIP L;  2OTL N;  1K8A O;  3G4S N;  4UY8 O;  5GAG P;  1VQN N;  4WFA L;  4IO9 L;  2QA4 N;  1M90 O;  1VQ7 N;  5GAE P;  1VQK N;  1YJ9 N;  1VQO N;  1KC8 O;  1K9M O;  5DM6 L;  2OTJ N;  3PIO L;  1Q81 O;  3I55 N;  3CCR N;  3G71 N;  1YHQ N;  1S72 N;  1K73 O;  1KQS M;  1NJI O;  5MLC Q;  3CPW M;  3CC7 N;  5JVH L;  3I56 N;  3CCL N;  3CCU N;  1VQM N;  1Q82 O;  1N8R O;  2ZJQ L;  3CC4 N;  1YJN N;  1YI2 N;  4IOC L;  1Q86 O;  1OVY A;  3CCQ N;  3DLL L;  1YIT N;  2ZJR L;  3CC2 N;  4WFB L;  3J7Z O;  3CXC M;  1VQ9 N;  4WF9 L;  5JVG L;  2ZJP L;  1JJ2 M;  1VQ5 N;  4IOA L;  1KD1 O; 
#chains in the Genus database with same CATH topology
 4FJ8 A;  1YIJ N;  1NJW A;  2E2N A;  3THX A;  3P39 A;  1I94 K;  3QEP A;  1IH7 A;  3NVK A;  1JLQ A;  4EFH A;  4I2P A;  2G8W A;  2CH5 A;  2VWJ A;  4IZ9 A;  1KLM A;  4IO8 A;  1TL3 A;  4DSE A;  5M1F A;  3LP2 A;  5CYM A;  3ZSZ A;  4U67 L;  1RDD A;  5FPM A;  1RGI A;  1RT4 A;  1D5A A;  3CCS N;  4DTO A;  3CFP A;  4KAZ A;  3AGR A;  1B9F A;  3J81 O;  3LAK A;  4KH6 A;  3VET A;  1NGD A;  1SV5 A;  1KRP A;  2QA4 N;  4JKG A;  1VK0 A;  3O8M A;  4DU3 A;  3NVM A;  2NRW A;  1L3V A;  1B92 A;  3NGY A;  3QFP A;  4PKH A;  4OKJ A;  5CE3 A;  4FLX A;  3QET A;  1LW0 A;  3D2E B;  3MX5 A;  4MLH A;  4ELU A;  1NJX A;  1GLC G;  3ZSQ A;  4J2A A;  2CGL A;  3AVJ A;  4OPJ A;  5SZT A;  4JK8 A;  4DU1 A;  5FRO A;  3UB5 A;  4CE9 A;  1HLU A;  3AVI A;  1RBS A;  2O8F B;  1CZA N;  1QQM A;  4XH4 A;  4Z4I A;  3VTH A;  5BN8 A;  4FXD A;  1IG8 A;  4LSN A;  2Q2R A;  3KK1 A;  4FOI A;  3AA5 X;  3FGU A;  3A5M C;  1ATS A;  3SJJ A;  4YOV A;  1XMQ K;  5AZI A;  1RBV A;  3FFI A;  1S9E A;  2E1Y A;  2QM1 A;  4ICL A;  4IOC L;  3MEG A;  3T69 A;  5BPL A;  1OH6 A;  2YKN A;  5M1Q A;  2ZJR L;  4DV7 K;  4CIG A;  4AH9 A;  3O6W A;  4A2B A;  3RR7 A;  4DB3 A;  1NK7 A;  3ZYY X;  2P9L B;  4PWD A;  2FSK A;  3KIO A;  3WUH A;  3VGL A;  2P51 A;  3N4P A;  2BTF A;  4BR5 A;  4ELV A;  3ALY A;  2PZS A;  2CGJ A;  2QWN A;  3CJ7 A;  5T7B A;  1BI4 B;  2DPN A;  4DV6 K;  4GKJ K;  2P9U A;  2E4L A;  3CCE N;  4YOW A;  5FLX O;  3VGM A;  4X64 K;  5GAD P;  3HRG A;  5BPN A;  1WNS A;  3OYI A;  3SQ2 A;  1HNW K;  5KRT A;  3LDS A;  4GVM A;  4FVM A;  4HTL A;  4FLT A;  4YDU A;  4BR7 A;  4CBU A;  1LV5 A;  3C95 A;  3G4S N;  4OGE A;  4A5A A;  3ULD A;  4N76 A;  3A5L C;  3R9P A;  1VQ7 N;  3M6G A;  3C7N B;  4CD3 A;  4CJL A;  4DFM A;  4CZE A;  3D2E A;  2OCE A;  3QES A;  1IJJ A;  1YT3 A;  3ATV A;  3OVN A;  4LC9 B;  5DM6 L;  4FM1 A;  3PIO L;  3OY9 A;  2HOE A;  1DTQ A;  2IVN A;  4E7J A;  1GLJ O;  1NMN A;  3PX0 A;  3CCR N;  4BVO A;  1NMD A;  4B3R K;  3NF8 A;  3PV8 A;  3A2F A;  5J1E A;  4DR1 K;  4PA1 A;  1N32 K;  1I39 A;  2E2Q A;  3KD5 E;  3TSP A;  4BRE A;  5C10 A;  1GLB G;  1VSK A;  3ZCM A;  3ZSY A;  3CJB A;  3LM2 A;  1NK0 A;  5DMR A;  5LMN K;  3L2R A;  3A8Y A;  1BOT O;  5M1N A;  2EHG A;  3E66 A;  1NM1 A;  4FWQ A;  4ELT A;  1BU6 O;  2FC0 A;  3MCP A;  3NGI A;  3VA0 A;  1VRU A;  3C6T A;  1TUU A;  2YNG A;  2D0P A;  3B8A X;  3Q7B A;  1T6D A;  2O4I A;  1RT2 A;  4BRI A;  4DLE A;  5C25 A;  4CFC A;  1HRH A;  3C6U A;  3AVA A;  2ZGZ A;  4IOA L;  2Z1H A;  2B4J A;  2IIR A;  2F9W A;  2YHY A;  4AHU A;  4BGA A;  1K6Y A;  1Q7Y O;  4BR2 A;  3OW2 M;  1X9M A;  3S3M A;  4DSI A;  2XO7 A;  1C1A A;  3V4I A;  2YI1 A;  1KCF A;  3R8E A;  3KLF A;  4CGF A;  4CGD A;  3T7Z A;  4BDY A;  1RDW X;  4HUG A;  3AVC A;  4H5W A;  1C0T A;  4ISE A;  3VEZ A;  1WLJ A;  2HVH A;  3AVL A;  3EE8 A;  1QSS A;  2VWB A;  4WYB A;  1HKC A;  3EO3 A;  4I7F A;  1NGF A;  4FK2 A;  3L4I A;  2ZE2 A;  3U9D A;  2P9S B;  3ZEU A;  5E26 A;  1VAZ A;  2KW4 A;  4KHP K;  4HUE A;  4K43 A;  4PL8 A;  1N5Y A;  2EX3 A;  4LF6 K;  2E20 A;  1S3X A;  2Q1N A;  2I7N A;  4CBW A;  5J2M A;  5AQM A;  3H3N O;  3OS1 A;  1W97 L;  3MEE A;  3ZET A;  4ZTF A;  2KQ2 A;  3RVC A;  5AFU A;  4BY9 C;  5GIO A;  2D5R A;  5GAE P;  4WQ4 A;  3AAR A;  3MX2 A;  1TL1 A;  4FJM A;  5KQ8 A;  3ULE A;  4IFV A;  3WQU A;  3O9T A;  1VSD A;  1GLD G;  4NCG A;  1J9A A;  5KPZ A;  4A2A A;  1J54 A;  4CEC A;  2E88 A;  4C8L A;  2F7T A;  4ILJ A;  1MWM A;  1NGC A;  3DAW A;  3KWG A;  3R1X A;  1LWF A;  2VG7 A;  1GLL O;  4O55 A;  4B8A B;  3NH1 A;  2YX6 A;  2XY6 A;  4BRF A;  5ADX A;  2XY8 A;  3FZH A;  2RHK A;  3HPG A;  2Z1G A;  3LDN A;  2KLA A;  1ZBH A;  4CEA A;  4LFC K;  2H3G X;  3VQ9 A;  1SZ2 A;  2IVP A;  3KK7 A;  4DU4 A;  1S22 A;  4I2Q A;  1ATR A;  4JI4 K;  3CJA A;  1ASU A;  2RKI A;  4BRO A;  2HBL A;  3OYM A;  3ZT1 A;  1KAZ A;  4DSK A;  4A59 A;  4H0T B;  3SPZ A;  4O5F A;  4BG8 A;  2FXU A;  4JI5 K;  3B6P A;  4DUY K;  1DGK N;  4I6M B;  5EVZ A;  4KTW A;  1BDG A;  3CFR A;  4C23 A;  2WFB A;  2OZM A;  4CJE A;  3IS9 A;  4OKE A;  1EQY A;  3NCI A;  3TAB A;  2E2O A;  1SQK A;  1XC3 A;  3DLK A;  4OPA A;  4BRN A;  5AQO A;  1BG3 A;  3VEY A;  1YJW N;  3DJC A;  4M42 A;  1VSE A;  2QXL A;  3IAY A;  1T05 A;  5AQT A;  3CJC A;  1GOC A;  3HVR A;  4DR5 K;  3SK3 A;  3QEX A;  2KTQ A;  1IV0 A;  1HQU A;  1CZ9 A;  1RTD A;  3GL1 A;  3SQ4 A;  3LAL A;  3AAP A;  1L3T A;  4CFD A;  3TTC A;  2KZZ A;  3M3Z A;  4H8K A;  5DK5 A;  5AQX A;  4RCH A;  1OH7 A;  3DWL A;  4B9Q A;  1VSI A;  2ATQ A;  1U47 A;  1RT3 A;  3P38 A;  3FZK A;  2GUP A;  4KHN A;  3KD1 E;  3OYL A;  4CJ3 A;  2KZM A;  4H4O A;  2IDO A;  3D6R A;  3IUC A;  4CD1 A;  5AQR A;  3MWT A;  4IJA A;  2O8C A;  4E89 A;  5EU7 A;  1S1U A;  3SMP A;  5F1X A;  4EZ9 A;  2BAN A;  2RF2 A;  3DRS A;  3OS2 A;  4FWN A;  3CCU N;  3G25 A;  4O0I A;  4F2R A;  3L2Q A;  1X9W A;  4FJJ A;  4CBX A;  4B1X B;  5B8H A;  2HB5 A;  3FZF A;  3GOI A;  3HM8 A;  2I5J A;  4Q0B A;  1E4F T;  4DV0 K;  3THY B;  4M3Z A;  1JL2 A;  3ZT2 A;  4JS4 A;  2HHS A;  5KGW A;  3VEO A;  2HND A;  4O5B A;  3CXC M;  4FPA A;  5KQD A;  4WF9 L;  4MDA A;  1ZYQ A;  1V4T A;  4XH5 A;  4E7K A;  1W9H A;  2VG5 A;  1QZ5 A;  1ASW A;  1NBW A;  1YUW A;  4CZM A;  4FJL A;  4BR0 A;  3KLI A;  4FJN A;  2F9T A;  1NK4 A;  5AQU A;  1ILY A;  1MA9 B;  1A5X A;  1Y97 A;  1RDC A;  3CG7 A;  5KTQ A;  5I42 A;  4DV1 K;  2P9S A;  1JXE A;  3G6E N;  5LMU K;  5AQH A;  4FPB A;  4JKG B;  3TSQ A;  4B9S A;  5AQG A;  3SJH A;  1JLF A;  3HTV A;  2NNW A;  4HVJ A;  1XHZ A;  5BN9 A;  4IDH A;  5ADX H;  5HRO A;  1IKX A;  4MDB A;  2X78 A;  4BAC A;  4J2B A;  1C0M A;  3FZL A;  3LP0 A;  3TAE A;  2YNH A;  4KHS A;  5AQZ A;  4IO9 L;  1VQN N;  3OYJ A;  1TK0 A;  1MWK A;  5JLF A;  2HF3 A;  3GBT A;  4M3Y A;  3CQX A;  3J7Y P;  1R59 O;  4JRP A;  4KO0 A;  4KI6 A;  4AHS A;  3BEX A;  2YHA A;  1WB9 A;  4OJR A;  2F8S A;  1C0U A;  1K9M O;  5LJW A;  4DF4 A;  4L3Q A;  1BI4 A;  4CVN E;  3SBT A;  2G8H A;  3NDK A;  4B9U A;  4B9L A;  1JKH A;  2E6M A;  3TSU A;  4O44 A;  2NZT A;  4E1M A;  4CZF A;  1DTT A;  3ZT0 A;  3QFU A;  2BUP A;  3QIO A;  1QS4 A;  3BZC A;  1X3N A;  3A0I X;  4AHV A;  2HHX A;  3QIC A;  4BC3 A;  1HMV A;  3AA3 A;  3O1W A;  3SUO A;  2VG6 A;  3QLH A;  2XY5 A;  2P9P B;  3VPZ A;  5JVH L;  4DQR A;  3SUQ A;  1FK9 A;  1U6Z A;  1JLC A;  4CIF A;  1RBU A;  3M1F A;  5A2Q O;  1WAJ A;  1N8R O;  5C24 A;  3DRR A;  4A5B A;  4CGG A;  2W41 A;  4CK1 A;  2Q0U A;  4BWM A;  3THY A;  5HRS A;  5AZJ A;  3NAE A;  3ID6 A;  5IWA K;  4YOY A;  3M8S A;  3K57 A;  2VGM A;  3T1A A;  3G0Z A;  3L4Q A;  2O8C B;  1ASV A;  3SUP A;  1NK8 A;  1O1W A;  1VSL A;  2RPI A;  3MMV A;  3RSE A;  3V9Z A;  3O3G A;  1NOY A;  4F4K A;  3SAG A;  3BDP A;  1SAZ A;  1VQP N;  4FYD A;  2OPQ A;  2BGG A;  3DI6 A;  3HVT A;  2YHB A;  2ZGY A;  4DQS A;  3UKR B;  3VQ6 A;  4GKK K;  2WBN A;  2F4V K;  1M1K O;  4Z0U A;  1QVF M;  3W0L A;  1WSE A;  1RIL A;  4M3R A;  1ATN A;  2XY7 A;  4B3T K;  5HL7 L;  5GIP A;  1HQE A;  3K0S A;  4DR2 K;  5H1S Q;  3VQ8 A;  4Z4F A;  3SAH A;  3WT0 A;  4FZY A;  3F9M A;  4OKK A;  3LDQ A;  1NGA A;  3AVK A;  3VQC A;  4DHY A;  4H4M A;  2FLO A;  2X6N A;  3WEE B;  4CES A;  5KI6 A;  2RN2 A;  3RRG A;  2JLE A;  2QKK A;  2R7Y A;  3ITH A;  3RR8 A;  1NGJ A;  5FPD A;  3BY5 A;  2UXB K;  2QWL A;  3CHW A;  3WQT A;  3MWP A;  3OS0 A;  2Q36 A;  2UU9 K;  3LAN A;  4JNE A;  1QE1 A;  5TKY A;  4RG8 A;  4DV5 K;  1EX4 A;  3RRH A;  3I55 N;  1YTA A;  4DR6 K;  4H0V B;  1KQS M;  4FW1 A;  1KVC A;  1Z25 A;  1NOZ A;  1QHA A;  3V6D A;  1ESV A;  3L6Q A;  3EY1 A;  2OAN A;  3VES A;  3ZEU B;  4CK2 A;  4FWO A;  4RW9 A;  4B1V A;  1BQM A;  3TWH A;  1IO2 A;  5M1K A;  4DF8 A;  4RW7 A;  3BF1 A;  3THX B;  3ZET B;  1D9F A;  4ID1 A;  3ZSO A;  3K9J A;  3LZJ A;  2O8D B;  4HHT A;  3WXK A;  1HKG A;  1WBB A;  1NGE A;  5KRS A;  4E7L A;  4FZZ A;  1QQC A;  4MFB A;  2QTD A;  3V1O A;  4MLE A;  5AQP A;  3HPO A;  3DYA A;  4CEF A;  5AFU H;  3UKU B;  3EYZ A;  3AO1 A;  5FPE A;  3NH0 A;  4CIE A;  4X66 K;  2IAJ A;  2JGU A;  4YY3 K;  4FJK A;  3WXI A;  4OLA A;  4FM0 A;  1TKZ A;  2V52 B;  4H0P A;  3VEV A;  1S1W A;  2D4W A;  5M1O A;  4GV3 A;  2E1Z A;  3BP8 A;  3CD6 N;  4CJV A;  4CHY A;  4DTN A;  1NK9 A;  1RT5 A;  2ITM A;  3NH2 A;  4ISF A;  2WOM A;  4IFY A;  5AQF A;  1BL3 A;  1LWE A;  3FFK B;  4BRH A;  1NWK A;  4DSF A;  3MEC A;  1RDA A;  3U4L A;  3V9X A;  3LDP A;  4OVL A;  1XNQ K;  1CXQ A;  4CFB A;  1NLV A;  4BWJ A;  1EP4 A;  4CW7 B;  1U48 A;  4HUF A;  4F3O A;  2YHW A;  2P5G A;  2HBJ A;  4JI3 K;  4WFA L;  3GDQ A;  2NRZ A;  2ZWH A;  1WSF A;  4DUZ K;  5ELZ A;  2QXF A;  1XNR K;  5CZ1 A;  3CET A;  3UKR A;  4CJW A;  3JS6 A;  1KFD A;  2HHV A;  1HPZ A;  3RSE B;  4E19 A;  1YJ9 N;  1XC9 A;  4BDZ A;  1HX1 A;  3FLC O;  3BGR A;  1KC8 O;  2XRI A;  1H1V A;  1QQN A;  1HYV A;  4B8C A;  1FKP A;  4CF8 A;  3O9U A;  3CIP A;  3H6E A;  4KRE A;  3UIQ A;  1LOT B;  2A1R A;  1YHQ N;  3OYK A;  4YFU A;  2NLX A;  4X62 K;  1NGH A;  1U2V A;  2X6S A;  2O8B A;  2A42 A;  1S1V A;  3CC7 N;  3O9Q A;  4CZI A;  1RCH A;  4WE1 A;  4FJ9 A;  4DTS A;  1NGB A;  4PHT X;  1ZBI A;  2IOC A;  3KVG A;  2UUC K;  1YI2 N;  5AQI A;  1OVY A;  2FF6 A;  2B6A A;  1X3M A;  3CC2 N;  1JXB A;  1OKJ A;  3AAQ A;  3P1G A;  4ZHR A;  4DV4 K;  4KKO A;  1WOQ A;  3ATU A;  4M7Y A;  4FLW A;  2A6A A;  1L3U A;  4W5R A;  1ZBS A;  3AVF A;  3F2K A;  4NYF A;  4BRC A;  3CQ8 A;  3VGK A;  4DS5 A;  3C6A A;  2VCP A;  2ASP A;  3CME N;  4FSV A;  3CCV N;  2E8A A;  3HK2 A;  3QEW A;  3WNH A;  3CYM A;  4CJU A;  5GIN A;  4Z4C A;  1W2B M;  4BQL A;  2QEX N;  3OJU A;  4G9Z A;  3H46 O;  3HYF A;  3IFR A;  4DV2 K;  1GOA A;  5LL6 Z;  2WC9 A;  4KV8 A;  1ITG A;  5EXW A;  3S3O A;  5E41 A;  2HNY A;  1K8K A;  3S3N A;  2Z1J A;  4NB4 A;  1KLN A;  3C65 A;  4CGH A;  2QWP A;  3JAM O;  4IFE A;  5AJ3 K;  4JN4 A;  2W6L A;  3ZX3 A;  4YOX A;  2HW3 A;  5IT9 O;  4DTX A;  3V9W A;  1OH8 A;  5J2N A;  3TU5 A;  3SI6 A;  4M3X A;  3DMJ A;  4CJK A;  2HHQ A;  1DEJ A;  4DQ8 A;  4F8R A;  3SBG A;  1TGO A;  4G1Q A;  1EXQ A;  3PSI A;  1E4G T;  2UUB K;  1HR0 K;  1BCM A;  4PY5 A;  4EZ6 A;  1CZB A;  3T3F A;  2JWL A;  4O8U A;  4N5S A;  1T7P A;  1S72 N;  4JI2 K;  4RW8 A;  3AO4 A;  3A5N C;  2P9I B;  3NF7 A;  3VEW A;  3MXI A;  4H5N A;  4K42 A;  4B1W B;  4B3S K;  1C1B A;  1GLF O;  3OYH A;  2PY5 A;  5AQK A;  1Q82 O;  2Q0R A;  4FWL A;  4NLC A;  3VQB A;  4KTZ A;  3VEN A;  2FSN A;  1JLE A;  3ENB A;  1NKB A;  4OGC A;  4CI6 A;  4W5Q A;  3D2F B;  3LDO A;  4BGB A;  5AQN A;  1N6Q A;  5JIC A;  4F3T A;  1S5J A;  2UUA K;  4FLY A;  2ASM A;  1IKW A;  1UOC A;  3HP9 A;  5HRN A;  3VTI A;  4K41 A;  1T03 A;  4EHU A;  1C1C A;  3ZLJ A;  3IRX A;  1Q9Y A;  3MXJ A;  3TAF A;  4FVU A;  3CI5 A;  3PO5 A;  3FE1 A;  1JJ2 M;  1KD1 O;  1YVU A;  3CJ9 A;  3DXK B;  2G8K A;  2W40 A;  1VSM A;  1ZC6 A;  5KGX A;  4BE2 A;  3KLE A;  1TAQ A;  1U04 A;  3C6H A;  2FBT A;  3WXL A;  1QZ6 A;  3OYC A;  3RWU A;  4CHO A;  1FJG K;  1TYQ B;  4N41 A;  1YAG A;  3N4Q A;  3AO2 A;  3MN6 A;  1TK5 A;  4RW4 A;  3MK6 A;  4O4G A;  5AQS A;  3O9S A;  2VQF K;  5F2R A;  1MU2 A;  2A3Z A;  4FJH A;  4GV6 A;  2D0A A;  4KFB A;  5BPM A;  4UY8 O;  3D2F A;  4KI4 A;  4EAH D;  4CHP A;  1BIS A;  2GBZ A;  2DFF A;  3QBW A;  3CM6 A;  4JHD B;  1X1P A;  3QEI A;  4JK9 A;  3AY9 A;  4JKC A;  4IEI A;  1RNH A;  1BQN A;  4FJ5 A;  4GW6 A;  2GTD A;  3HXM A;  3PSF A;  1WSJ A;  3CJ1 A;  3MDQ A;  2Y1I A;  4LY7 A;  3VQQ A;  3KHY A;  1X9J A;  4CJR A;  2A5X A;  1W0H A;  5FRN A;  3O4Q A;  4LFB K;  4FJ7 A;  1JLA A;  1XUP O;  4MQ3 A;  1QTM A;  1FXX A;  4CJ5 A;  1DLO A;  4CHZ A;  3T19 A;  5AQW A;  4BRD A;  4J2E A;  4NYN A;  3JXU A;  2QWO A;  3OA9 A;  4CJ7 A;  2J4R A;  2O8F A;  3O08 A;  3ENH A;  4CEE A;  1KVA A;  1A5W A;  4C8M A;  4KBO A;  3IG1 A;  4V19 S;  4B3M K;  3C0B A;  3VQD A;  3QBX A;  4M3T A;  4BRA A;  3V9S A;  2PBD A;  3VER A;  4IBN A;  4B9N A;  5JLH A;  5C0Y A;  4MO5 A;  3D7E O;  3E1Y A;  4JHD A;  3QO9 A;  5BRD A;  4GY2 B;  2ZJP L;  4Z4E A;  3PUF A;  4B9V A;  3WXJ A;  3F9K A;  4FZX C;  3CCM N;  4O0J A;  4WCE L;  2NRV A;  3TPQ A;  1TAU A;  4OPK A;  4NCA A;  2P9K B;  2GWK A;  4JI8 K;  3KJV A;  2AP1 A;  2QW9 A;  1RBT A;  3NFA A;  4IOX A;  1RTH A;  4IXC A;  4B1Z A;  2IS3 A;  2OPS A;  4QCL A;  1HNX K;  1GOB A;  3AO5 A;  4JK7 A;  4BR4 A;  1KAY A;  1KAX A;  4MO4 A;  4WFN L;  4CJQ A;  3CCJ N;  3ZT4 A;  2W42 A;  1VQL N;  5SWM A;  2A41 A;  1BA1 A;  4DFP A;  1U45 A;  3KWI A;  4YOU A;  2GUI A;  3PIP L;  3E9O A;  3O1B A;  2CGK A;  3A5O C;  4KHW A;  4DR3 K;  4KH4 A;  5TKW A;  2YNI A;  4JS5 A;  4DCH A;  3CER A;  3RMC A;  5AZI B;  4E1J A;  3L2U A;  4W5T A;  4QS9 A;  1IG9 A;  2VQE K;  4BC2 A;  3V81 A;  1WN7 A;  2V7Y A;  1HJR A;  5BR8 K;  4C1N I;  4Q5V A;  4DTJ A;  1XMO K;  1SUQ A;  3S41 A;  5AQV A;  3OBY A;  1LW2 A;  3FZM A;  4EHT A;  3EL2 A;  1Z26 A;  2G8U A;  4L8R B;  3HT3 A;  2F8T A;  3E9L A;  4I9Q A;  1LAV A;  3VQ4 A;  3SNN A;  3VQE A;  3ZT3 A;  4CZL A;  4DLG A;  3L3U A;  3M5R A;  3QML A;  4BG9 A;  5KPR A;  3IDH A;  3PX4 A;  1OH5 A;  2KFZ A;  4CJP A;  3K5O A;  3SV3 A;  3TAM A;  3NF9 A;  3WXM B;  1F21 A;  3TR8 A;  3HST B;  3SQ1 A;  1GLA G;  1XWL A;  2P9N A;  3U3G A;  4FWS A;  1C6V A;  4H0Y B;  3B6O A;  2Q97 A;  5JVG L;  2DY4 A;  1UA0 A;  2YV0 X;  1VQ5 N;  1NNE A;  3LDL A;  3M8P A;  4YHH K;  5D3G A;  2OYQ A;  5CR4 A;  5DM7 L;  5HP1 A;  1TYQ A;  4JI1 K;  4CF1 A;  1WSH A;  1VQ6 N;  4JKA A;  4H03 B;  3OYB A;  4LF5 K;  1VQ4 N;  3MED A;  4CGJ A;  1IKV A;  3CM5 A;  1SS6 A;  3LWL A;  3VA3 A;  1NGI A;  4CHN A;  4H0X B;  1J5O A;  2HST A;  1QSY A;  1T6C A;  4AM7 A;  4JKF A;  2WUS A;  4B1Y B;  1XQS C;  2YJE A;  3PLA A;  3ZSV A;  3DM2 A;  5HBM A;  3PY8 A;  4LFA K;  2YNF A;  5GAG P;  3HPH A;  3KTQ A;  2YCH A;  3LL3 A;  4CK3 A;  3TAR A;  3P4I A;  3W3D A;  1WSG A;  2E2P A;  2D0O A;  2P9K A;  2HHW A;  1M90 O;  4HCB A;  2ITG A;  1VQO N;  1NJZ A;  3VEX A;  2KHO A;  4PL7 A;  3OYA A;  2ZM6 K;  4QAG A;  4M3W A;  3DLG A;  3K5M A;  1P8Z A;  2G8F A;  3TAG A;  4ZTJ A;  4AIL C;  2W6K A;  5C2F A;  3RMA A;  1BGX T;  3EZW A;  4U7B A;  2F96 A;  4FO0 A;  4BRM A;  1Q81 O;  1REV A;  2BH1 A;  4O8K A;  2BDP A;  1TK8 A;  3G71 N;  3IMX A;  4DQP A;  4FLZ A;  4W5N A;  1IBM K;  4NXM K;  2Q3S A;  3WNF A;  2QWQ A;  3BUZ B;  1JLB A;  1Z05 A;  4OPH A;  4EP4 A;  4C8O A;  4DQI A;  2OPP A;  5F0X A;  1BCO A;  3GE1 A;  4C8K A;  1Q86 O;  4M41 A;  2CH6 A;  2HF4 A;  5BRH A;  4DFJ A;  4FJI A;  2FBY A;  4BDP A;  2PYJ A;  3KKS A;  2D0C A;  3NGZ A;  1YIT N;  2OZS A;  5BRE A;  3R3L A;  4WFB L;  1I3A A;  4DWI A;  4BVP A;  4LH5 A;  3ENO A;  4CJT A;  4FK4 A;  3J7Z O;  3O9R A;  3LP3 A;  3OYN A;  1HNZ K;  3J7A P;  4LF7 K;  1DT9 A;  3AGK A;  1RT7 A;  4DR7 K;  1HJO A;  2HMP A;  1P90 A;  4DTU A;  3U6F A;  1X9S A;  3L3V A;  5J2Q A;  4JKE A;  4E1N A;  3VF6 A;  4LD0 A;  4DMN A;  3K58 A;  3AVN A;  4C8N A;  3O5B A;  4EP5 A;  4JRQ A;  3ZSR A;  3QDK A;  1BO5 O;  3L8B A;  4CJF A;  1T44 A;  3TAQ A;  3EZ5 A;  3K5N A;  3WEE A;  1L5U A;  2GV9 A;  1RT1 A;  2O8E B;  4YOR A;  3IKM A;  3HOS A;  3OJS A;  3I8D A;  3DXK A;  1NK6 A;  3OYG A;  1V4S A;  5CHI A;  5CZ2 A;  3BF3 A;  4CGI A;  3CQY A;  2EWS A;  4CF2 A;  2D1K A;  1ZXO A;  3VF2 A;  3SLC A;  3RTV A;  3DLR A;  1VQK N;  1S6P A;  1SKW A;  3LWM A;  3M8R A;  1LAW A;  2DFH A;  4XIU A;  4BRL A;  3HZ6 A;  3NBP A;  2OTJ N;  4JI7 K;  3H45 C;  5AR0 A;  4GV9 A;  3SUN A;  4AQY K;  4JKD A;  2HBM A;  1EO1 A;  1UAX A;  5LY3 A;  4KHY A;  4N47 A;  4CHQ A;  5MLC Q;  1NU0 A;  2Q31 A;  4A62 A;  3CPW M;  2Y1J A;  4KHQ A;  2V51 B;  2YKM A;  3LP1 A;  1C0G A;  4B9T A;  2AJQ A;  3H08 A;  2ZJQ L;  3BZK A;  2AA4 A;  2O8E A;  2QWR A;  3F5T A;  4H5V A;  1OVQ A;  2HHT A;  4CEO A;  4LF8 K;  5JS2 A;  4KTQ A;  4H5T A;  3VN5 A;  3AA2 A;  4HTU A;  3H3O B;  4RWT A;  4CJ4 A;  1VQ9 N;  5EX5 A;  3HJF A;  4PUO A;  3SCX A;  3EEQ A;  4K8Z A;  1JL1 A;  2NRX A;  3OHR A;  4JAX A;  1QHT A;  2X74 A;  1KXP A;  2A1S A;  5BRF A;  4NXN K;  4NO7 A;  1J5E K;  2KFN A;  4BRP A;  3DLE A;  3T1Y K;  1J53 A;  4CEQ A;  1N33 K;  1IBK K;  1J6Z A;  3NF6 A;  4ISG A;  4E7H A;  3I33 A;  5M1P A;  3O80 A;  4YOT A;  1FW6 A;  4DSJ A;  2G8I A;  3SPY A;  4KRF A;  4QS8 A;  3AVH A;  2QK9 A;  2OPR A;  1EWQ A;  4YDU C;  1TKT A;  1WBD A;  5AQQ A;  3ULE B;  3ID8 A;  4ILH A;  1QVG M;  3S9H A;  2RE2 A;  3NHG A;  4FL9 A;  2OTL N;  1HYS A;  2GWJ A;  1IBL K;  4FK0 A;  2E5L K;  5FRM A;  5E84 A;  4BC4 A;  1RDU A;  4IG3 A;  3MXM A;  1Z6R A;  3HBT A;  1W7A A;  3HSC A;  3P83 D;  2FBV A;  3L2W A;  4E0D A;  3TTD A;  1ZBL A;  4XEI A;  1CXU A;  5I9E B;  3L2V A;  3WNG A;  4FWP A;  5C2D A;  4FW2 A;  3AV9 A;  4JLH A;  4JKB A;  2I7P A;  4E3S A;  4JD2 B;  1S9G A;  2O8B B;  2VYP A;  3VQP A;  4FWM A;  1WUA A;  4RTF D;  1JLG A;  1HYZ A;  2PFU A;  1N36 K;  3ZSW A;  4BE1 A;  3PX6 A;  3ZSX A;  4KB1 A;  1K8K B;  4WQ4 C;  1HUX A;  1VRT A;  4Y1D A;  2ZD1 A;  2IGI A;  3U3Y A;  4F2S A;  2GEM A;  5EY4 A;  3PO4 A;  3RMB A;  1JCE A;  3K59 A;  2KKZ A;  3CC4 N;  4CZH A;  4OO1 J;  1YJN N;  3THV A;  1HKB A;  3LPU A;  1WAF A;  3THW B;  4CF0 A;  3SAF A;  2YJF A;  2P9N B;  4PKG A;  4BC5 A;  3ISN C;  4CEB A;  2NRR A;  1S1X A;  4J8F A;  4K8X A;  1RBR A;  2D0B A;  3O3F A;  3EN9 A;  3LZI A;  3VQ7 A;  4TSX A;  1SL2 A;  3OYF A;  5EOY A;  1CLQ A;  4CF9 A;  1U49 A;  4Z4H A;  5CY4 A;  4DS4 A;  4JV5 K;  5JS1 A;  3KLG A;  4KH5 A;  1KFS A;  3TTF A;  1JCG A;  3QEV A;  3SZ2 A;  1TV6 A;  2P9I A;  3KK3 A;  2V7Z A;  5GAH P;  3O4W A;  5HRR A;  2NRH A;  3QIN A;  4HCC A;  2UYT A;  3H1V X;  3C94 A;  1YTU A;  1ZBU A;  4I6M A;  1QSL A;  3UE5 A;  4CJS A;  1ZBF A;  4IKF A;  2Z1I A;  4XH1 A;  1YVN A;  3DRP A;  4LSL A;  3O3H A;  3DLH A;  4R5P A;  3F73 A;  3MN9 A;  2PAV A;  4OLB A;  4IEE A;  4WQ5 A;  4HWI A;  2GX9 A;  2BE2 A;  1DKG D;  2FSJ A;  2YHX A;  3T1H K;  4BE0 A;  4GVE A;  4FM2 A;  5JMV A;  1B9D A;  1D4X A;  3VQ5 A;  3CFO A;  2G8V A;  4JKH A;  4FCY A;  2WTU A;  2QI2 A;  1NK5 A;  4M7X A;  3DLB A;  3MN7 A;  3SQ0 A;  5AQJ A;  4LF4 K;  3AVB A;  2A40 A;  4Z94 A;  3AA4 A;  2OA8 A;  4F9O A;  3DXM A;  4IJN A;  2P9L A;  1K73 O;  3GG4 A;  3AO3 A;  3J80 O;  4LF9 K;  1LWC A;  1UWB A;  1NG9 A;  4ILG B;  5K14 A;  5FPN A;  1A5V A;  3Q7C A;  2VGN A;  1BWF O;  3I56 N;  3QB0 A;  1IKY A;  1T3V A;  4W5O A;  4DG1 A;  2FBX A;  4BRQ A;  2UXC K;  4FJG A;  4CZJ A;  3CPE A;  1TKD A;  4C1N K;  3HOT A;  2B5J A;  1NKE A;  1TUY A;  3EE9 A;  3OBW A;  1VSF A;  4JD2 A;  1T8E A;  1RFQ A;  1BA0 A;  1BIU A;  1Q9X A;  4LH4 A;  3E9P A;  3ZX0 A;  4DTR A;  1N34 K;  1RDB A;  4GMJ B;  1S6Q A;  1EWR A;  1G15 A;  3LAM A;  4A57 A;  3TAN A;  1KVB A;  4DV3 K;  2ASO A;  3KK2 A;  3CMA N;  2QKB A;  3P5J A;  4BRK A;  5HOO A;  4BQZ A;  3VQA A;  4DTP A;  3OYE A;  3SYZ A;  1NJY A;  1EKE A;  1VSJ A;  4BR9 A;  1SKS A;  3U8X A;  4NCB A;  3K2P A;  2XHB A;  3I8B A;  3HM9 A;  2VWK A;  3V9U A;  2WON A;  4CZG A;  4QOZ B;  4IG0 A;  3M8Q A;  4IWV A;  3AVM A;  4CEZ A;  5HRP A;  3QIP A;  3G10 A;  1U2V B;  4AHC A;  4NLB A;  4R79 A;  3OTO K;  4EIA A;  2NUB A;  1JCF A;  2ZF5 O;  3D0P A;  1U4B A;  3ZX2 A;  4B3O A;  1RT6 A;  4DSL A;  3D45 A;  2E6L A;  2PYL A;  4KB0 A;  4BRG A;  1RTJ A;  3WNE A;  3LM9 A;  4M63 C;  3KLH A;  1HNV A;  5AZJ B;  4J2D A;  4IDK A;  1Q18 A;  1SKR A;  3RMD A;  2ZQB A;  3OYD A;  4DQQ A;  1S1T A;  3JYT A;  3CCL N;  1VQM N;  4I9L A;  4KHU A;  3UKU A;  4YNQ A;  4CCH A;  5BR9 A;  3THW A;  4PKI A;  4JEP A;  2HMI A;  3J8A A;  4B9M A;  1MDU B;  2P9P A;  1QQO A;  1XI1 A;  3H1Q A;  3VMF B;  4X65 K;  1VSH A;  3QNO A;  4N56 A;  5I3U A;  1EET A;  3QER A;  2GEL A;  2HBK A;  1NGG A;  3NMU A;  3DOK A;  5C15 A;  1Y64 A;  3K5L A;  3P31 A;  3HP6 A;  4Y0W A;  4FOE A;  4AHR A;  3LPT A;  1FKO A;  4JI6 K;  3TAP A;  3DXM B;  3EKS A;  4RW6 A;  4WQ5 C;  4CER A;  1KSP A;  3HI0 A;  1XHX A;  4DKW A;  5C42 A;  2DTU A;  3SMS A;  3NE6 A;  1TVR A;  1G99 A;  2P1J A;  4DTM A;  3CF5 L;  3JSM A;  4CED A;  4DR4 K;  4E7I A;  5LJV A;  2DFE A;  3EKU A;  4B08 A;  5J2P A;  3I0R A;  4FWK A;  2HVI A;  1VQ8 N;  2HNZ A;  4FJX A;  3AVG A;  3O4N A;  3QNN A;  3MN5 A;  2JWK A;  1GLE G;  1SL0 A;  3HL8 A;  4K25 A;  3TI0 A;  4M3U A;  1K8A O;  4JYA K;  4QS7 A;  3KZB A;  1LCU A;  1VHX A;  2O4G A;  4UQG A;  1HPM A;  4KPY A;  1D9D A;  5KPT A;  4FLU A;  1HNI A;  4B1U B;  1NKC A;  3U9Z A;  1BHL A;  5AQL A;  5HLF A;  4Y1C A;  5CYQ A;  1YXQ A;  4Z4G A;  4AF1 A;  3FR0 A;  3E01 A;  4PQU A;  2FF3 B;  4K0K K;  1D8Y A;  3R6M A;  4CFA A;  5AQY A;  4JI0 K;  1E3M A;  1TKX A;  3V1R A;  4DFK A;  4OX9 K;  2P9U B;  1NJI O;  3MCA B;  3VF4 A;  2NRT A;  3DOL A;  2LSN A;  3HO1 A;  2IC3 A;  2O8D A;  1KTQ A;  2HHH K;  4CZK A;  1BUP A;  3K9K A;  4GNI A;  3L0Q A;  1R0A A;  1BIZ A;  3ASM A;  1L3S A;  2QWM A;  4ID5 A;  3SV4 A;  3I0S A;  5FDL A;  4FWR A;  3MAQ A;  3KKR A;  3CCQ N;  2P5O A;  2HHU A;  3DLL L;  4H0O A;  1RTI A;  4AM6 A;  1Q8I A;  1WSI A;  3V1Q A;  2IVO A;  1O13 A;  4A61 A;  1UA1 A;  4H5R A;  5C12 A;  1SL1 A;  2UXD K;  3VOV A;  4FLV A;  1YF5 L;  4AHT A;  3C7N A;  1C0F A;  2ETJ A;  4M45 A; 
#chains in the Genus database with same CATH homology
 4BRP A;  3CJ9 A;  3DXK B;  1YIJ N;  1NBW A;  1YUW A;  4CZM A;  2E2N A;  2W40 A;  3P39 A;  4BR0 A;  1ZC6 A;  3NVK A;  2F9T A;  4EFH A;  5AQU A;  1ILY A;  1MA9 B;  3C6H A;  3WXL A;  1J6Z A;  4ISG A;  1QZ6 A;  2P9S A;  3I33 A;  2CH5 A;  5M1P A;  3G6E N;  3O80 A;  5AQH A;  1TYQ B;  4FPB A;  4IZ9 A;  4IO8 A;  4JKG B;  4YOT A;  1YAG A;  3N4Q A;  3TSQ A;  5M1F A;  5AQG A;  4QS8 A;  3SJH A;  3MN6 A;  4U67 L;  3MK6 A;  3HTV A;  4YDU C;  5AQS A;  3O9S A;  5FPM A;  5AQQ A;  3ULE B;  2NNW A;  3ID8 A;  4ILH A;  1RGI A;  4IDH A;  5BN9 A;  5F2R A;  5ADX H;  2A3Z A;  4MDB A;  1QVG M;  2RE2 A;  3CCS N;  4FL9 A;  4GV6 A;  2OTL N;  2GWJ A;  3AGR A;  3FZL A;  5BPM A;  5E84 A;  4KH6 A;  4UY8 O;  3VET A;  1NGD A;  3D2F A;  5AQZ A;  4BC4 A;  4IO9 L;  1VQN N;  1RDU A;  1MWK A;  2QA4 N;  4EAH D;  1Z6R A;  3HBT A;  4JKG A;  3O8M A;  5JLF A;  2HF3 A;  3GBT A;  3HSC A;  3NVM A;  2NRW A;  3QBW A;  4JHD B;  3CQX A;  1R59 O;  3BEX A;  3QFP A;  3TTD A;  4JK9 A;  4PKH A;  5CE3 A;  3AY9 A;  3D2E B;  3MX5 A;  4JKC A;  4IEI A;  4MLH A;  4XEI A;  1GLC G;  5I9E B;  2CGL A;  1K9M O;  5LJW A;  4L3Q A;  4JK8 A;  4FWP A;  3UB5 A;  5C2D A;  1HLU A;  3SBT A;  2GTD A;  2I7P A;  4JKB A;  3TSU A;  2NZT A;  4JD2 B;  1CZA N;  4CZF A;  1QQM A;  2VYP A;  3CJ1 A;  3MDQ A;  4FWM A;  3QFU A;  2BUP A;  4XH4 A;  1X3N A;  1X9J A;  3A0I X;  2A5X A;  3KHY A;  3QIC A;  3VTH A;  4BC3 A;  1WUA A;  4RTF D;  5BN8 A;  1XUP O;  3O1W A;  1IG8 A;  2PFU A;  2Q2R A;  2P9P B;  4FOI A;  3VPZ A;  5JVH L;  3FGU A;  1U6Z A;  5AQW A;  4BRD A;  3A5M C;  1K8K B;  1ATS A;  4WQ4 C;  1HUX A;  3M1F A;  4YOV A;  1N8R O;  2GEM A;  5EY4 A;  5AZI A;  4A5B A;  3JXU A;  1JCE A;  2KKZ A;  2QWO A;  2W41 A;  3OA9 A;  4CJ7 A;  4CZH A;  2J4R A;  3CC4 N;  4OO1 J;  2E1Y A;  2QM1 A;  1YJN N;  4IOC L;  1HKB A;  3T69 A;  3O08 A;  5BPL A;  3ENH A;  2Q0U A;  4KBO A;  2YJF A;  2P9N B;  4PKG A;  4BC5 A;  3SAF A;  2NRR A;  5M1Q A;  3C0B A;  2ZJR L;  5AZJ A;  3ID6 A;  3QBX A;  3O6W A;  4BRA A;  4A2B A;  4J8F A;  4YOY A;  2PBD A;  3VER A;  4DB3 A;  3ZYY X;  5JLH A;  5C0Y A;  2VGM A;  4MO5 A;  3D7E O;  2P9L B;  2FSK A;  3E1Y A;  3EN9 A;  3L4Q A;  4JHD A;  3WUH A;  3VGL A;  5BRD A;  4GY2 B;  3N4P A;  2BTF A;  4BR5 A;  5EOY A;  3MMV A;  2ZJP L;  3RSE A;  2CGJ A;  2QWN A;  3CJ7 A;  3WXJ A;  3SAG A;  3CCM N;  1SAZ A;  1VQP N;  4WCE L;  2NRV A;  3TPQ A;  2DPN A;  4KH5 A;  2P9U A;  3TTF A;  4YOW A;  2ZGY A;  3CCE N;  1JCG A;  2P9K B;  3UKR B;  3VGM A;  5GAD P;  2P9I A;  3HRG A;  2GWK A;  2V7Z A;  5BPN A;  2AP1 A;  2QW9 A;  5GAH P;  4IOX A;  4IXC A;  4B1Z A;  2WBN A;  3O4W A;  1M1K O;  1QVF M;  3W0L A;  2NRH A;  1ATN A;  2UYT A;  3H1V X;  4JK7 A;  5HL7 L;  4I6M A;  4BR4 A;  1KAY A;  5GIP A;  3UE5 A;  1KAX A;  4MO4 A;  4WFN L;  4XH1 A;  5H1S Q;  1YVN A;  3SAH A;  3CCJ N;  3WT0 A;  3F9M A;  1VQL N;  3LDQ A;  4HTL A;  2A41 A;  1BA1 A;  1NGA A;  3MN9 A;  4YDU A;  4BR7 A;  3KWI A;  2PAV A;  4YOU A;  4CBU A;  4DHY A;  3PIP L;  3E9O A;  4IEE A;  4WQ5 A;  2FLO A;  3O1B A;  4HWI A;  2CGK A;  2GX9 A;  3WEE B;  3G4S N;  1DKG D;  2FSJ A;  3A5O C;  2YHX A;  4GVE A;  4KH4 A;  5JMV A;  4A5A A;  1D4X A;  3A5L C;  5TKW A;  3R9P A;  4JKH A;  1VQ7 N;  2QI2 A;  3CER A;  3M6G A;  5AZI B;  4DCH A;  4E1J A;  3C7N B;  4M7X A;  4CD3 A;  4QS9 A;  1NGJ A;  5FPD A;  3MN7 A;  4CZE A;  3D2E A;  4BC2 A;  2QWL A;  3CHW A;  3WQT A;  1IJJ A;  5AQJ A;  2V7Y A;  3ATV A;  3MWP A;  4LC9 B;  4C1N I;  5DM6 L;  2Q36 A;  4JNE A;  2A40 A;  5TKY A;  5AQV A;  3S41 A;  3PIO L;  4Z94 A;  3OBY A;  2HOE A;  3FZM A;  2IVN A;  3I55 N;  4EHT A;  1GLJ O;  3EL2 A;  4F9O A;  3CCR N;  4BVO A;  3DXM A;  4IJN A;  1NMD A;  4H0V B;  2P9L A;  1K73 O;  1KQS M;  3E9L A;  3GG4 A;  1QHA A;  1ESV A;  4ILG B;  3L6Q A;  5FPN A;  3Q7C A;  2VGN A;  1BWF O;  3I56 N;  2OAN A;  2E2Q A;  3VES A;  3ZEU B;  4CZL A;  3M5R A;  3QB0 A;  3TSP A;  4BRE A;  5C10 A;  1GLB G;  3CJB A;  4FWO A;  1T3V A;  3QML A;  3LM2 A;  3IDH A;  4BG9 A;  5KPR A;  4B1V A;  4BRQ A;  5M1K A;  3A8Y A;  4CZJ A;  1BOT O;  3WXM B;  5M1N A;  3BF1 A;  3E66 A;  3CPE A;  1NM1 A;  3ZET B;  4C1N K;  1GLA G;  3HOT A;  2P9N A;  4FWQ A;  1BU6 O;  1TUY A;  3MCP A;  3EE9 A;  3K9J A;  3OBW A;  4FWS A;  1TUU A;  4H0Y B;  3WXK A;  1HKG A;  4JD2 A;  2D0P A;  3B8A X;  3Q7B A;  1T6D A;  1NGE A;  4BRI A;  1RFQ A;  2Q97 A;  5JVG L;  2QTD A;  1BA0 A;  2ZGZ A;  4MLE A;  5AQP A;  1VQ5 N;  4IOA L;  3LDL A;  2IIR A;  5AFU H;  2YHY A;  3E9P A;  2F9W A;  3ZX0 A;  3UKU B;  4BGA A;  1Q7Y O;  4BR2 A;  3OW2 M;  5CR4 A;  5FPE A;  5DM7 L;  1TYQ A;  4A57 A;  2YI1 A;  1VQ6 N;  4JKA A;  4H03 B;  3R8E A;  3WXI A;  2V52 B;  4H0P A;  3VEV A;  2D4W A;  3T7Z A;  1RDW X;  5M1O A;  2E1Z A;  1VQ4 N;  3BP8 A;  2ASO A;  4H5W A;  4ISE A;  3VEZ A;  4GV3 A;  3CD6 N;  3CMA N;  2ITM A;  3EE8 A;  1SS6 A;  4ISF A;  2VWB A;  4BRK A;  4WYB A;  5HOO A;  5AQF A;  4BQZ A;  1HKC A;  3EO3 A;  1NGF A;  3FFK B;  3L4I A;  3U9D A;  1NGI A;  2P9S B;  4H0X B;  4BRH A;  1NWK A;  3ZEU A;  2HST A;  4BR9 A;  5E26 A;  1VAZ A;  1T6C A;  3U4L A;  3U8X A;  3LDP A;  4AM7 A;  4K43 A;  4JKF A;  2WUS A;  1NLV A;  4PL8 A;  1XQS C;  4B1Y B;  2YJE A;  2E20 A;  3PLA A;  3I8B A;  1S3X A;  2Q1N A;  2YHW A;  2I7N A;  4CBW A;  5AQM A;  2HBJ A;  4CZG A;  3H3N O;  5GAG P;  1W97 L;  3ZET A;  4WFA L;  2YCH A;  3GDQ A;  3LL3 A;  2NRZ A;  2ZWH A;  4IWV A;  5ELZ A;  3RVC A;  5AFU A;  4BY9 C;  3P4I A;  3W3D A;  5GIO A;  2E2P A;  2D0O A;  2P9K A;  3CET A;  3UKR A;  1U2V B;  3JS6 A;  1M90 O;  5GAE P;  4NLB A;  4WQ4 A;  3RSE B;  1YJ9 N;  1VQO N;  4R79 A;  3VEX A;  1HX1 A;  2KHO A;  3FLC O;  3AAR A;  4PL7 A;  3MX2 A;  4EIA A;  1JCF A;  1P8Z A;  1KC8 O;  2ZF5 O;  3ULE A;  1H1V A;  5KQ8 A;  3WQU A;  3O9T A;  3ZX2 A;  1QQN A;  1GLD G;  5C2F A;  5KPZ A;  3EZW A;  3O9U A;  4A2A A;  4U7B A;  3CIP A;  3H6E A;  4FO0 A;  4BRM A;  2E88 A;  4BRG A;  1Q81 O;  1LOT B;  2BH1 A;  2F7T A;  4ILJ A;  4O8K A;  1MWM A;  1NGC A;  3DAW A;  3KWG A;  3R1X A;  3LM9 A;  4M63 C;  3G71 N;  1YHQ N;  1GLL O;  2NLX A;  2YX6 A;  3IMX A;  1NGH A;  5AZJ B;  4BRF A;  1U2V A;  5ADX A;  1Q18 A;  3FZH A;  2A42 A;  2RHK A;  3CC7 N;  3O9Q A;  2QWQ A;  3BUZ B;  3LDN A;  3CCL N;  1VQM N;  1Z05 A;  4CZI A;  2KLA A;  4OPH A;  3UKU A;  2H3G X;  5BR9 A;  1NGB A;  4PKI A;  4JEP A;  4PHT X;  3J8A A;  1MDU B;  2P9P A;  3KVG A;  1QQO A;  3H1Q A;  3VMF B;  1SZ2 A;  5F0X A;  3GE1 A;  2IVP A;  1YI2 N;  3KK7 A;  1S22 A;  1Q86 O;  5AQI A;  1ATR A;  3CJA A;  1OVY A;  2CH6 A;  1NGG A;  2GEL A;  2HBK A;  2HF4 A;  5BRH A;  3NMU A;  4BRO A;  2FF6 A;  2HBL A;  1X3M A;  1YIT N;  5C15 A;  3CC2 N;  5BRE A;  3R3L A;  4WFB L;  1KAZ A;  1OKJ A;  1Y64 A;  3AAQ A;  3P31 A;  4A59 A;  4BVP A;  3ENO A;  4H0T B;  4O5F A;  4Y0W A;  4BG8 A;  3J7Z O;  3O9R A;  4FOE A;  3DXM B;  1WOQ A;  1DT9 A;  2FXU A;  3EKS A;  3AGK A;  4WQ5 C;  1DGK N;  3HI0 A;  4I6M B;  1HJO A;  4DKW A;  3ATU A;  4M7Y A;  5EVZ A;  1BDG A;  2HMP A;  2A6A A;  3SMS A;  1P90 A;  1ZBS A;  3F2K A;  4BRC A;  4C23 A;  1G99 A;  2WFB A;  4JKE A;  3VGK A;  3C6A A;  2VCP A;  2ASP A;  3VF6 A;  1EQY A;  3CME N;  3CF5 L;  4FSV A;  3CCV N;  2E2O A;  2E8A A;  1SQK A;  1XC3 A;  5LJV A;  3O5B A;  3EKU A;  4OPA A;  5GIN A;  4FWK A;  3QDK A;  4BRN A;  1BO5 O;  5AQO A;  1W2B M;  1VQ8 N;  1BG3 A;  3MN5 A;  3VEY A;  1YJW N;  4BQL A;  1T44 A;  3DJC A;  2QEX N;  4G9Z A;  3H46 O;  2JWK A;  3IFR A;  2QXL A;  3WEE A;  2WC9 A;  5AQT A;  1GLE G;  3CJC A;  5EXW A;  3SK3 A;  1K8K A;  4YOR A;  4K25 A;  3IKM A;  3HOS A;  1K8A O;  4NB4 A;  4QS7 A;  3C65 A;  3KZB A;  1LCU A;  2QWP A;  3DXK A;  3GL1 A;  4IFE A;  1V4S A;  3AAP A;  5CHI A;  4JN4 A;  1HPM A;  3BF3 A;  3ZX3 A;  4YOX A;  3TTC A;  5KPT A;  3CQY A;  3M3Z A;  2EWS A;  4B1U B;  5AQX A;  4RCH A;  3U9Z A;  2D1K A;  1ZXO A;  3VF2 A;  3SLC A;  3DWL A;  1VQK N;  4B9Q A;  5AQL A;  3TU5 A;  1YXQ A;  3P38 A;  4BRL A;  4AF1 A;  3FR0 A;  3FZK A;  3HZ6 A;  1DEJ A;  2FF3 B;  2GUP A;  4DQ8 A;  3SBG A;  3R6M A;  2OTJ N;  5AQY A;  1E4G T;  3D6R A;  3IUC A;  4CD1 A;  3H45 C;  5AR0 A;  4GV9 A;  2JWL A;  4O8U A;  4JKD A;  2HBM A;  5AQR A;  3MWT A;  4IJA A;  2P9U B;  1EO1 A;  1S72 N;  5LY3 A;  3SMP A;  1NJI O;  3MCA B;  3VF4 A;  2NRT A;  3A5N C;  2P9I B;  3VEW A;  5F1X A;  4H5N A;  2Q31 A;  4K42 A;  4A62 A;  4B1W B;  5MLC Q;  3CPW M;  4FWN A;  2V51 B;  1GLF O;  3CCU N;  3G25 A;  4CZK A;  1BUP A;  3K9K A;  4GNI A;  5AQK A;  1C0G A;  3L0Q A;  1Q82 O;  2Q0R A;  4FWL A;  4NLC A;  2QWM A;  3VEN A;  2FSN A;  4CBX A;  2ZJQ L;  2AA4 A;  3ENB A;  4B1X B;  5B8H A;  4FWR A;  3FZF A;  3GOI A;  3HM8 A;  4CI6 A;  3D2F B;  2QWR A;  1E4F T;  3CCQ N;  3LDO A;  3F5T A;  3DLL L;  4BGB A;  4H0O A;  4H5V A;  5AQN A;  4AM6 A;  5JIC A;  2IVO A;  1O13 A;  2ASM A;  4A61 A;  3VEO A;  4H5T A;  3VTI A;  3H3O B;  4K41 A;  4H5R A;  4EHU A;  3CXC M;  4FPA A;  5KQD A;  4RWT A;  5C12 A;  1VQ9 N;  5EX5 A;  4WF9 L;  3VOV A;  4MDA A;  2NRX A;  4FVU A;  3CI5 A;  1V4T A;  3OHR A;  4JAX A;  4XH5 A;  1KXP A;  3FE1 A;  1YF5 L;  1JJ2 M;  1QZ5 A;  3C7N A;  1C0F A;  1KD1 O;  5BRF A;  4NO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...