2F7TA

Crystal structure of the catalytic domain of mos1 mariner transposase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
227
structure length
204
Chain Sequence
b'WVPHELNERQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWIFFVNPKKTMLCVWWDQSGVIYYELLKPGETVNAARYQQQLINLNRALQRKRPEYQKRQHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mos1 transposase
publication title Mechanism of Mos1 transposition: insights from structural analysis
pubmed doi rcsb
source organism Drosophila mauritiana
molecule tags Dna binding protein
total genus 72
structure length 204
sequence length 227
ec nomenclature
pdb deposition date 2005-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01359 Transposase_1 Transposase (partial DDE domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.470 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2f7tA00
4MDBA 3F2KA 4R79A 5CR4A 3HOSA 5HOOA 3HOTA 3K9JA 4U7BA 2F7TA 4MDAA 3K9KA
chains in the Genus database with same CATH superfamily
3IUCA 4K41A 1D8YA 3VGKA 3ZSRA 3NE6A 3TAQA 1C0UA 1VSFA 4KKOA 3HO1A 3GDQA 3AVAA 1SS6A 1JLCA 4CHOA 3I33A 1W9HA 1WAJA 4FPAA 2QA4N 3THYB 2XY6A 1WUAA 1EXQA 3MXMA 5AFUA 4ELTA 3CQ8A 3D2EB 1WSGA 2HB5A 4BRLA 4ISEA 4CBWA 3CCUN 1S9EA 4CHQA 1TVRA 4M3RA 1IH7A 3D6RA 3VEWA 4ISFA 4BREA 3CJ9A 1QE1A 4LC9B 3DLRA 4FOIA 1NNEA 1JCGA 1DTQA 3J7ZO 1K6YA 4BC5A 4XH1A 3NH2A 3NAEA 5GAHP 3SUPA 3S3OA 4K42A 2Q31A 4YOYA 4H4MA 1JLGA 2Z1HA 3EKSA 4NYFA 5EU7A 4ZTFA 5FRNA 1SKWA 3NF9A 1L3TA 4Y1DA 4H03B 4K0KK 2F9TA 4B1ZA 2OZSA 1HLUA 3LALA 2G8VA 2CGJA 4IG3A 1GLAG 4O8UA 1TAUA 4CJLA 5AQMA 4X65K 5F1XA 4CECA 4BDYA 2QWMA 3P83D 4U7BA 2W40A 4DR1K 3V81A 2IIRA 1H1VA 1WBDA 3AVIA 1VSDA 4L8RB 1SZ2A 4R5PA 3MEEA 3QFUA 4BVPA 3CC4N 2O8CA 1S1VA 4YOWA 1S1WA 4KHSA 3ZETA 3MN7A 3HZ6A 5AFUH 5C2DA 1TK0A 2QWNA 4F2SA 4JHDB 3TSQA 1WLJA 2EHGA 4O0JA 5C0YA 4A5BA 1BCMA 1HNXK 4AHTA 1N33K 1MWMA 1Q9YA 1BUPA 2QWPA 1TYQB 4DV7K 1S72N 4J2BA 4HUGA 3TSPA 1L5UA 3R8EA 1NK9A 3CJ7A 2O8FA 3P38A 1L3VA 4IOCL 4AQYK 3PX4A 2IS3A 3NF6A 4OPAA 2VCPA 4FJJA 1BGXT 4JYAK 3U9ZA 2D0BA 1XHXA 3HK2A 1U49A 2HHQA 4JD2A 4AF1A 3LDLA 3O08A 1RT1A 3K5LA 3DOLA 1U6ZA 3O3HA 2HF4A 3MXIA 4KI4A 3KIOA 1GLDG 1LWEA 2Y1IA 3HOTA 4H0YB 3RMDA 1ZBLA 2P9NB 4CJ3A 3J7YP 3NGZA 3C95A 3ZSZA 4Q5VA 3ZX3A 5HP1A 4QAGA 4I7FA 3MWTA 1G15A 4CGDA 2E5LK 1KAYA 2BE2A 1RT6A 5CZ1A 1S6PA 1LAVA 1WSEA 1CZ9A 3L6QA 2D5RA 2BDPA 4DS5A 3WQTA 4H4OA 4JKAA 3QO9A 3VQEA 3THWA 2OTJN 2RF2A 2FC0A 2GELA 3RMBA 4N5SA 3VQQA 4FWLA 1W97L 2ASOA 1JCEA 1NM1A 3DXKB 4WF9L 3K5OA 4JKBA 1YJNN 4KBOA 4AILC 5M1FA 3SQ4A 3O9SA 3H08A 1C0MA 2G8FA 3JSMA 2UXDK 4DR2K 4J2DA 1OVYA 4XH4A 1XNQK 4CF0A 4M42A 4E19A 4E1MA 3VN5A 5J1EA 5AQVA 3WNHA 3C6AA 1C1CA 4OLBA 3ATVA 5KQ8A 3DJCA 3PO4A 3F2KA 1WSFA 4IEIA 1RFQA 1T03A 2GEMA 2LSNA 4CJSA 4F2RA 4W5RA 1YJWN 3LDOA 1BIZA 2ZF5O 5I42A 2A1SA 3OYCA 4JI3K 1HRHA 4ICLA 1TGOA 4DQQA 1RTHA 5BRHA 1QVGM 4BR2A 2PZSA 1WN7A 3I8DA 2P51A 5DM7L 2HF3A 3KK7A 4IXCA 3L8BA 2F8SA 4CJ4A 3NF7A 3FFIA 4KH6A 2G8KA 2F4VK 3DRRA 2X78A 4DG1A 5JVHL 1ILYA 2XO7A 3N4QA 2ITMA 1NGAA 3HSCA 4JS5A 2O8CB 2ZGZA 1RNHA 3DYAA 3LZIA 4CZJA 1QHTA 3MXJA 4FSVA 4HUEA 4E7IA 3TAEA 3M3ZA 1IV0A 2OTLN 4GMJB 2O8EA 3IMXA 5J2MA 2DFHA 4A61A 1VQPN 4LSNA 1ZYQA 1NJXA 4BRPA 3WNFA 3OYMA 4FLZA 3SMSA 3LP2A 1E4GT 1X9MA 1YTUA 3R1XA 4QCLA 5KTQA 4M7XA 2NNWA 1NJYA 1VQ6N 2YJFA 3VEOA 3CFRA 3UKRA 2GV9A 2OANA 4XEIA 1Q86O 1VSHA 5CE3A 3O6WA 4I2PA 1V4SA 4CJWA 3SQ1A 3OYIA 3VA3A 3UB5A 2VWKA 1VSMA 2DFEA 3DLEA 1Z05A 3NMUA 3C7NA 3VQBA 4DR4K 4R79A 2QKBA 3CJBA 4HVJA 4B3MK 3K2PA 2G8WA 1Z6RA 2KTQA 2P9UB 4KHQA 3QNOA 1UA0A 4FW2A 1GLLO 4ILHA 2P9LA 3AVMA 1MU2A 3LM9A 3AO5A 3V1QA 1QQNA 1GOBA 4A59A 3QNNA 4LF7K 1VK0A 3CFPA 1SL0A 4CGHA 3L2RA 4FZXC 3LP1A 3D7EO 2E6LA 4KHUA 1TV6A 3QINA 4CJKA 4CIFA 1Q9XA 3MMVA 3UKUA 3VOVA 2VQFK 4CHZA 4BGBA 4GKJK 5AQKA 4CEFA 1T3VA 3O80A 1VRUA 2P9PA 1CZBA 4PL7A 2UUBK 3QEWA 4CJUA 1NMNA 3OYGA 3VEYA 2HHUA 3CC2N 3VERA 4F9OA 4LH4A 1VSJA 4EAHD 2Q36A 4C8KA 4CJ5A 4K25A 4JKGA 2E2PA 4Z4HA 2QTDA 5JVGL 4BWJA 4CF1A 2ASPA 4B1XB 3NBPA 3AA4A 2Q2RA 3FZLA 4FWQA 4CFCA 1TL3A 5FPMA 3R9PA 3HTVA 4CK1A 1C1AA 1IBKK 1KFSA 4FWOA 4RW8A 2ZJRL 5FPDA 5JS1A 2A41A 2IOCA 1VSKA 4FJ7A 3U6FA 3WXJA 2CH6A 2PBDA 3AV9A 1BQNA 3EYZA 2O4GA 2BH1A 2WFBA 3O9RA 1LCUA 1IKWA 3C65A 2RPIA 4A62A 3KKSA 3SK3A 3VQDA 4CEZA 4H0TB 3QBWA 3HOSA 4BACA 1NG9A 1VSLA 1HKGA 1I39A 2NRWA 3ZT1A 3GG4A 2P1JA 2W42A 5AZIA 4BG8A 3ENBA 3L2QA 3ZT4A 5KPTA 4EFHA 3DLLL 3SAGA 4OPHA 4FJ8A 2UUCK 1HYSA 1X9WA 4OPJA 2OPSA 4GVMA 4ZHRA 1XQSC 2I5JA 5C25A 4BE2A 4FJHA 3I8BA 4M3WA 3R3LA 3VQ5A 4CVNE 5JICA 2JLEA 2W41A 1OH5A 4FVMA 1XUPO 1K8KA 3OW2M 2BUPA 3LDQA 3MCPA 1QS4A 1Q7YO 3OYNA 4DQIA 1ASUA 5BREA 4WCEL 4DS4A 1HNZK 4DV4K 2P9LB 2UXBK 3M6GA 4X64K 3A5MC 5AQJA 3MX2A 5AQUA 1XI1A 2QW9A 3ENHA 3BZKA 4IFYA 3TTCA 5BPMA 4LF4K 4PL8A 3LDSA 2NRZA 2E2OA 4KO0A 3NVMA 5AQZA 4CD1A 4CZLA 1KVCA 2R7YA 3MDQA 2HNDA 4DB3A 2HMIA 1RBVA 4BR0A 3AA2A 3LM2A 1HQEA 3PUFA 5AZJA 5EX5A 3RRHA 1BI4A 2GX9A 3DLKA 1RGIA 2WUSA 4AM7A 1L3UA 1HNVA 4I6MA 3TANA 3CM6A 2A1RA 4W5TA 3WT0A 1TKZA 2BGGA 2ETJA 1T05A 2DY4A 5FPEA 3SAHA 3LZJA 4B3SK 2PFUA 1KTQA 2AA4A 1GLJO 4MFBA 4LF5K 1T44A 3AVLA 2OZMA 3SUQA 2KZZA 1R0AA 2OPQA 4CJFA 3IRXA 3TI0A 2X6SA 3KWGA 5GIPA 1UOCA 1RBUA 1QHAA 4LF9K 4BG9A 1N32K 1YJ9N 1EWQA 3VQCA 2HW3A 4FWPA 1LWFA 4CBUA 1NK6A 1KAXA 1FXXA 4CEOA 3SNNA 4DV6K 3VF4A 1TK5A 4BVOA 3DMJA 1TAQA 1C0FA 2QWRA 4CGJA 3SV4A 4B9MA 2Z1JA 3CJCA 4DTRA 3IKMA 4IEEA 4Y1CA 4FJNA 5B8HA 1BU6O 5FPNA 3BUZB 2Q97A 4CJTA 5DM6L 4W5QA 1WB9A 4LFCK 3SUOA 4CCHA 2UUAK 1TKTA 2XHBA 1T7PA 3CCRN 3VF6A 4FLXA 3ASMA 1C0TA 4LFBK 3G10A 1IKXA 2HHVA 5KRSA 1WSHA 4FZZA 4CZFA 3CYMA 2DTUA 3FE1A 4CZMA 5GAEP 4PA1A 4CESA 3RMAA 4DSKA 1HR0K 5C10A 1EP4A 1NMDA 1D4XA 1QTMA 4BRGA 4WFAL 3QEPA 3QEVA 3NVKA 2O8DB 5BRFA 2XY7A 3KD5E 2XY8A 4JI2K 3SJHA 2QXFA 1HYVA 4PKHA 2GTDA 3KHYA 3KLGA 2Q1NA 2IDOA 1NJWA 1NOYA 3ULEA 2JWLA 4Z4IA 4CK2A 3WXKA 2G8UA 4BR4A 3NGYA 2GBZA 4PUOA 2D0CA 4DTSA 3HPOA 4NYNA 2QEXN 2HVIA 2E4LA 4YOTA 4FLTA 1NGHA 4HWIA 4QS8A 4LSLA 5C15A 1J9AA 4CZIA 2IVOA 3MCAB 4FWKA 4C23A 1P8ZA 1BISA 1X9SA 1NGDA 4OVLA 1RDWX 3CHWA 1EO1A 5EOYA 2P9KB 3TTDA 4K43A 2NRRA 3M8SA 1RBSA 3ZEUA 2YKMA 1YIJN 4I6MB 1VRTA 4H8KA 1L3SA 4WQ5A 2Z1GA 3BP8A 2HOEA 3RR7A 5EY4A 4C8MA 4O44A 4BRQA 1YITN 2YNGA 3PSFA 1JXBA 1ATRA 1KD1O 2WBNA 1RDUA 3H46O 4B3RK 1ZXOA 3QIOA 4C8LA 3JAMO 4IKFA 4MO5A 1QZ6A 4CFBA 3C6HA 4YDUA 4E0DA 3T69A 1S5JA 3DLGA 4BRIA 5SZTA 4BRCA 3NCIA 1OKJA 1U4BA 3L3UA 1I94K 4JEPA 2HHSA 3ZX2A 4KFBA 4O4GA 4AHCA 4CZGA 1VQKN 2IC3A 5KPZA 3DWLA 3CC7N 3M8QA 1KFDA 3VQ8A 4DCHA 1BOTO 2ZGYA 3LANA 4B9LA 3RSEA 4IJNA 3TR8A 4RTFD 3EE8A 3E9PA 3DLHA 3QESA 3AO2A 4YHHK 1HPZA 3HP9A 2E88A 2KQ2A 3V1OA 4E7LA 5KRTA 1K8AO 4YOVA 3DRSA 4BDZA 3QIPA 3FZFA 3HL8A 1SKSA 3MN5A 4FK2A 3C94A 4JAXA 3CCJN 2NZTA 4ILGB 1A5XA 4CZKA 4FVUA 5DK5A 3OTOK 3PX0A 4OPKA 4RG8A 4J2EA 3EE9A 4BRFA 3FLCO 3KKRA 3ULDA 4KHNA 1FJGK 3S9HA 1ZBUA 4DLGA 4Q0BA 2A6AA 3TAPA 4N47A 2A42A 5M1OA 3O4NA 4IFEA 5EXWA 2E2QA 4BR5A 3ULEB 4UQGA 1WAFA 3SQ0A 3QLHA 3O1BA 2KKZA 3FR0A 4BR9A 1SL1A 3KWIA 3KJVA 4HCBA 3MK6A 4BRKA 3F73A 4KHPK 3MX5A 3QB0A 3TU5A 3CF5L 2HMPA 4DTPA 4LD0A 4GY2B 4GV6A 3KTQA 4C1NK 4U67L 2IGIA 4E89A 2IVNA 3TABA 4O5BA 3G25A 1RT5A 1XHZA 3HVRA 3SI6A 3ZEUB 2FBXA 1HPMA 1SV5A 4BY9C 4HHTA 1NK8A 1TK8A 4QS7A 1VQ5N 2J4RA 4H5NA 4OKKA 2QWOA 2QKKA 2B5JA 3NH0A 5I9EB 5LY3A 3KK3A 1KVBA 1KLMA 2YX6A 3VTHA 5C24A 1Q8IA 1S6QA 3CETA 3MWPA 5HBMA 3PLAA 3KD1E 1S3XA 4YY3K 4DLEA 3LPUA 1KLNA 1BHLA 3WXLA 4OGCA 2IVPA 3K9JA 1J53A 3ATUA 1ESVA 3AVCA 3VF2A 5KQDA 5E41A 4DV1K 1VHXA 3MECA 3KK1A 3I56N 5AQRA 2GUPA 4KB0A 3SYZA 2V51B 4DUZK 4KHYA 4DTMA 1X1PA 3ZETB 1NLVA 1VQ9N 3SV3A 4M3ZA 4X62K 4IO9L 3OYBA 1KQSM 4FJKA 3VQPA 3CCMN 3J8AA 3O4QA 1WBBA 3ZSVA 3RSEB 1NGCA 4NCGA 3B6OA 2HNYA 1I3AA 2RHKA 1IO2A 5J2NA 2QI2A 2O8FB 2CGLA 1GOCA 4CZHA 1KSPA 4FYDA 3JS6A 4NXMK 4M3UA 4IBNA 3NDKA 3AAQA 3K59A 4H5TA 4JD2B 1YXQA 1BIUA 1T6CA 3M8PA 5AQHA 2P9IA 2NLXA 4KV8A 4OGEA 4GKKK 4W5NA 3U3GA 5AQNA 4DV0K 1TKDA 1B92A 4B1UB 3VENA 3OBYA 3QETA 5F0XA 1RT2A 5HRRA 4FM0A 4I9LA 3J7AP 5M1KA 3OS0A 2D0OA 4DFPA 4DWIA 1OH8A 3CCSN 3CM5A 3AVFA 1NGBA 3GE1A 3THWB 2Y1JA 2ITGA 5BR9A 3CJ1A 3MEDA 4HTLA 2QWLA 3SAFA 4IJAA 2YHYA 4DV2K 4DTUA 3LL3A 4BRAA 4YORA 3E9LA 2KHOA 4IO8A 1BWFO 3A0IX 4BDPA 4BC4A 1ASVA 3G71N 4M3YA 1YVUA 4DTXA 4Z4FA 3MN6A 2YJEA 4B3OA 3PV8A 2A5XA 1M1KO 3AGRA 3GOIA 3WEEA 3RRGA 1XMOK 5ADXA 1N6QA 5HL7L 4WQ4C 2YCHA 5C2FA 3K5NA 4CJPA 2E2NA 1CLQA 1GOAA 2FXUA 1Q18A 5LMUK 4DU4A 1XC3A 5GINA 4B1VA 1REVA 1D9FA 1JKHA 4E7KA 1DLOA 1YUWA 3D2FA 4FK4A 4CEEA 4BWMA 3SCXA 5AQGA 2WONA 3N4PA 4DTNA 1SKRA 1WSIA 2F96A 5SWMA 1NKCA 4IFVA 4TSXA 3UIQA 2G8HA 2VG5A 1J5EK 1Y64A 2HBKA 4N56A 3E1YA 2E20A 4B8AB 3NFAA 2VQEK 4AHVA 3CCQN 3RR8A 4JK9A 3CPEA 5DMRA 1JLQA 5LL6Z 3O9TA 1RCHA 4B9UA 5K14A 1QSSA 4Z4EA 4RCHA 2Q0RA 2O8EB 2AP1A 3AO4A 1CZAN 1WOQA 4XH5A 4Z4CA 5ADXH 3SJJA 1TL1A 2P9SA 4H0PA 2OA8A 3ZSYA 2FSNA 2FF6A 3WNEA 4F4KA 1OH7A 1S22A 3U4LA 5HLFA 2VG7A 4KH5A 1IBLK 2KFNA 4O5FA 3L4IA 3PY8A 3HPGA 2YV0X 4ELUA 4NCBA 3MN9A 3HYFA 1EX4A 3ZSWA 4DSLA 3P39A 2HNZA 1KC8O 4GNIA 3UKRB 3LAKA 5JMVA 4H5RA 3AVNA 3T1YK 4B9SA 1RTJA 3A2FA 5HRNA 3U8XA 3FGUA 1CXUA 2B4JA 4B3TK 4CJQA 3HM8A 4JK8A 2V7YA 1VQ7N 4DF8A 3C7NB 3KLIA 3KVGA 4DKWA 4CHPA 3LWLA 3AO1A 2NRHA 1B9DA 4DR5K 3K9KA 1NGEA 2KW4A 3ZYYX 1UA1A 2VYPA 5GAGP 5MLCQ 1NK7A 4KH4A 2B6AA 5J2PA 5KI6A 1LW2A 3VEZA 3FFKB 3GL1A 3BZCA 2PYJA 1X3MA 4NCAA 3LDNA 4YOUA 1KCFA 5M1NA 4LF6K 3AA3A 1YVNA 3SUNA 4Z4GA 3EN9A 4IOXA 3UKUB 1QQMA 4BE1A 5AQYA 4B9NA 3Q7CA 5GIOA 4CEBA 1ATSA 3WEEB 3EO3A 3KK2A 4Y0WA 2PYLA 2P9PB 4FJGA 2P5GA 3VQ6A 3PSIA 3OYDA 1HQUA 4B1YB 2VGNA 2D4WA 3NHGA 1QQOA 1GLCG 3JYTA 2A3ZA 4WE1A 4FM2A 3VA0A 5EVZA 1JLAA 4FM1A 4FJ9A 3O8MA 1S9GA 2FLOA 3CQXA 2JGUA 4JKGB 4JN4A 3THXA 1NJZA 2UU9K 3V4IA 3CD6N 3P4IA 3AY9A 1V4TA 1WNSA 3QDKA 2AJQA 3V6DA 2CH5A 5A2QO 3AGKA 3OJSA 5CYMA 5H1SQ 5E84A 1CXQA 4JS4A 3BGRA 4JRPA 2X74A 1NBWA 4JKFA 4DSIA 4N76A 4JI7K 1F21A 1QSYA 4FWRA 3ZSOA 3BF3A 3KLEA 1RT3A 4DQPA 3TSUA 1SL2A 3AARA 4JKDA 3OYEA 4B8CA 4CF9A 1IKVA 2YHXA 1SUQA 3VTIA 5AQIA 1DTTA 2ZQBA 1HJRA 4MLHA 4NLCA 3TWHA 1J5OA 1C1BA 4MO4A 4IZ9A 1MDUB 3C0BA 3BY5A 1TUYA 4PQUA 5BR8K 1NK4A 1IG9A 4JLHA 1RTIA 3U9DA 4OX9K 3LP0A 1XC9A 4E3SA 3J80O 4JHDA 4N41A 3L4QA 5AZIB 4ILJA 4FLUA 4M3XA 1TYQA 3O3FA 3V9WA 3DM2A 3SQ2A 2FSJA 4NXNK 4BROA 3K58A 4DSFA 1ZBHA 3HXMA 2YNHA 4RW6A 1RDBA 3A5LC 2XRIA 4MLEA 4FJIA 1W7AA 4CFDA 2YKNA 1G99A 3AVGA 3LPTA 3TAGA 3IG1A 1U04A 3O1WA 3OHRA 3CMAN 1VQ4N 1FK9A 3QFPA 3AVKA 3WQUA 2F9WA 5AQXA 3IFRA 3EZWA 1K8KB 1QSLA 4DMNA 5T7BA 4EHTA 2P9NA 3OS1A 4EZ6A 5CZ2A 3DAWA 4M45A 4DTJA 1LWCA 1ITGA 3QBXA 4CBXA 2F8TA 4DV3K 3VGLA 3M5RA 1HUXA 4NB4A 3HPHA 4CHYA 4JI0K 4GV3A 5AR0A 3H1VX 1C0GA 3TTFA 1VQNN 1C6VA 1X3NA 1KXPA 3CCLN 2NRTA 3OY9A 2E8AA 3L2UA 4AHUA 4A5AA 4BC3A 2G8IA 1U2VA 3NH1A 1YHQN 5AZJB 1NJIO 1XNRK 4DUYK 4RW4A 4MQ3A 3DXKA 4LFAK 4OLAA 3PX6A 2UYTA 5FDLA 1BI4B 3K0SA 1GLEG 5KGXA 2HHHK 3W3DA 2XY5A 3T1AA 3D0PA 1LV5A 5FLXO 4M41A 1ZBSA 4F3OA 5IWAK 1TUUA 2NUBA 3LWMA 2VWBA 4PKIA 1JL2A 3THXB 1UAXA 2KFZA 4RW9A 2NRVA 3ZSQA 5AQFA 4B9TA 4E1JA 2YI1A 4DFKA 1HNIA 4DFMA 2ZJPL 1NU0A 3OYLA 3V9XA 3A8YA 4IDHA 1KAZA 1NOZA 4FO0A 3A5NC 3E9OA 4A2BA 4G9ZA 3VMFB 4KTZA 1EQYA 3SMPA 4V19S 4B9QA 2ZJQL 1Z26A 4IDKA 4DF4A 4CF2A 4GVEA 3MEGA 1ZBFA 4CF8A 1N5YA 4GV9A 4OKJA 4EHUA 3R6MA 1NGFA 4FK0A 5CHIA 4OJRA 4JRQA 1NWKA 1W0HA 1IBMK 3ENOA 4PKGA 3DI6A 3WXIA 1BG3A 3E01A 4XIUA 1R59O 4BC2A 3D45A 3AVBA 4K8XA 3IS9A 3CCEN 4PWDA 1XWLA 3QICA 4E1NA 4EP4A 3OA9A 2RKIA 1U45A 3KZBA 3Q7BA 1JLFA 3BDPA 4FL9A 5I3UA 3C6UA 2FSKA 1RBRA 5C42A 4ELVA 3FZMA 1S1UA 1YF5L 4J8FA 3EY1A 1ASWA 3JXUA 4KRFA 4DV5K 1VQLN 4CIGA 3CCVN 3AAPA 2P5OA 4X66K 3LP3A 4GW6A 3S3MA 4DHYA 3GBTA 3HRGA 1O13A 5CR4A 3LDPA 4H5WA 3H6EA 4FWMA 3QMLA 2H3GX 1GLBG 2V7ZA 2E1ZA 2FBYA 3THVA 4FCYA 3IAYA 2EX3A 3F9KA 4I9QA 1XMQK 3VESA 4BQZA 3ZLJA 5CYQA 4G1QA 4B1WB 3J81O 3RWUA 3E66A 3CMEN 5JLFA 3KLFA 3HBTA 2P9UA 3EL2A 2RE2A 3H3NO 4H0OA 4WFBL 1DKGD 3SZ2A 2Q0UA 3VGMA 4I2QA 3VQ9A 2V52B 4JI5K 2HVHA 3AVJA 1A5VA 4JKEA 1U2VB 3MAQA 2PAVA 1T6DA 2NRXA 4FWNA 5HRSA 3CPWM 4PHTX 4KAZA 1DT9A 5D3GA 2QM1A 4JKHA 4LF8K 4CEQA 3RMCA 4PY5A 3SBGA 3AO3A 4A2AA 1TKXA 1RTDA 5AQQA 4IWVA 5JS2A 1VQMN 4FJMA 3CQYA 4AHRA 4JI4K 3OYAA 2GUIA 4DTOA 2ZWHA 4KTQA 2ATQA 4NO7A 3PIOL 1YAGA 1JLEA 3CG7A 2E1YA 4BRMA 4JNEA 1JLBA 1QZ5A 2FBVA 2HSTA 1LOTB 4RW7A 4DQRA 2HBJA 3T19A 3IDHA 2HBMA 4BE0A 3H1QA 4CW7B 5KPRA 3ID6A 4H0XB 1HNWK 1RILA 3HJFA 5F2RA 5LJWA 5BPNA 1YT3A 2KLAA 4B9VA 4CJRA 1BQMA 4QOZB 1NGGA 1J6ZA 1OVQA 1SQKA 1UWBA 2VWJA 1JJ2M 3KLHA 4FLYA 2JWKA 4YOXA 4IOAL 1S1XA 3ZCMA 4CJ7A 1B9FA 3DRPA 1BA1A 4MDAA 3T1HK 4B08A 1RT4A 4C1NI 4EZ9A 4KB1A 3OYJA 4KHWA 5ELZA 3G6EN 3ID8A 4DQ8A 3K5MA 4Z94A 4E7HA 4DU1A 1BCOA 1FW6A 1FKOA 1Q81O 1Z25A 3FZHA 1HKBA 4WYBA 5BN9A 5LMNK 2YNIA 1QQCA 3AVHA 4CD3A 2GWJA 4FW1A 2O4IA 3V9UA 1RDCA 4DSJA 3ISNC 4K8ZA 1K9MO 4A57A 1NGIA 3VQAA 1M90O 4FJLA 5HOOA 3P5JA 1HMVA 2X6NA 4Z0UA 3TPQA 1A5WA 3OYKA 5AQWA 4C8NA 4YFUA 1EWRA 5HRPA 2W6LA 3B8AX 1N34K 3H45C 1BA0A 1ZC6A 4FJ5A 5BRDA 3SBTA 1RT7A 4BRDA 3VPZA 4AHSA 2HBLA 4OO1J 2HHWA 3VQ4A 1HKCA 1NKBA 4O8KA 4LH5A 1EETA 4KTWA 3DLBA 2YHWA 3QEIA 2EWSA 3F5TA 2VGMA 4DSEA 2D0AA 1U48A 4ID1A 4CJVA 3CERA 3I0RA 1P90A 3OS2A 1IJJA 2QXLA 5TKYA 1RDAA 4DR7K 1IKYA 4F3TA 2W6KA 3O3GA 2Z1IA 4LY7A 2I7NA 4JI6K 3OJUA 1D9DA 3HI0A 4DFJA 3O9UA 3P31A 3HT3A 2OCEA 1U47A 4ISGA 3CIPA 3S41A 2O8BA 3DXMA 4BRNA 5AQLA 3ITHA 1VQON 4C8OA 3TAMA 4M63C 3F9MA 1JL1A 3O9QA 4FWSA 5BN8A 1K73O 1J54A 5C12A 3B6PA 3ZT2A 4YNQA 3LAMA 3ZT3A 4CGFA 4DU3A 1D5AA 1VSIA 3BF1A 2ZM6K 2OPRA 2OPPA 3VEXA 4AM6A 1SAZA 4HUFA 3CXCM 3OVNA 3SPZA 4BRHA 4QS9A 3PIPL 1O1WA 3BEXA 3G0ZA 4CFAA 3I0SA 3SLCA 5HROA 5AJ3K 2KZMA 4KREA 2QWQA 2E6MA 4NLBA 1HYZA 2DFFA 3L0QA 4CJEA 1BL3A 3CFOA 3L3VA 1NKEA 5TKWA 5FROA 2HHXA 3EZ5A 4ZTJA 1ATNA 3VETA 2P9IB 1RDDA 4MDBA 3DOKA 4F8RA 3O5BA 4FLWA 2FF3B 3T3FA 2BTFA 1N36K 3C6TA 4EP5A 2HHTA 5AQSA 3FZKA 2YNFA 1E4FT 4CIEA 3OYFA 2WOMA 1NK0A 1QVFM 4FZYA 3HM9A 1E3MA 5AQTA 2O8DA 4DQSA 3CI5A 4HCCA 1RBTA 2I7PA 2YHAA 4WQ4A 4L3QA 4FJXA 4DR3K 5E26A 3VQ7A 4CEAA 4BGAA 4H0VB 1MWKA 3EEQA 3ZT0A 4FLVA 2YHBA 5JLHA 3NGIA 3TARA 2RN2A 4OKEA 1T8EA 2WTUA 4CGIA 3O4WA 2D0PA 3CJAA 3THYA 2OYQA 3ALYA 4CE9A 1JXEA 5AQPA 2ZE2A 1HX1A 3ZX0A 4JI8K 3D2EA 4FXDA 3QERA 3W0LA 4BQLA 4CZEA 5J2QA 3S3NA 2BANA 1W2BM 1YTAA 2P9KA 3L2WA 4KPYA 4E7JA 4JI1K 1OH6A 1NK5A 3ZSXA 3K57A 3HSTB 3M1FA 4M7YA 3U3YA 4RWTA 3I55N 3V9SA 1IG8A 4M3TA 1KVAA 1VAZA 3D2FB 3EKUA 3RVCA 4FPBA 2IAJA 1X9JA 4JK7A 1BO5O 3T7ZA 3NF8A 4BR7A 2O8BB 3DXMB 1EKEA 1N8RO 5FRMA 3UE5A 1WSJA 3VEVA 1DEJA 4JKCA 1JCFA 1Q82O 4WFNL 4JV5K 4CHNA 2ASMA 3V9ZA 1LAWA 1DGKN 2Q3SA 1Y97A 2FBTA 4CGGA 3V1RA 2D1KA 3QEXA 5GADP 4WQ5C 2QK9A 3RTVA 1VSEA 1YI2N 1GLFO 5BPLA 4W5OA 2P9SB 2UXCK 4UY8O 3WNGA 3SPYA 4J2AA 2GWKA 1FKPA 1KRPA 3WUHA 2PY5A 2DPNA 3TAFA 4AH9A 1NGJA 4YDUC 4KI6A 2CGKA 1MA9B 4DR6K 2F7TA 3M8RA 4O0IA 2WC9A 3H3OB 1BDGA 1VQ8N 4CERA 3OYHA 5AQOA 5KGWA 2A40A 5LJVA 4CI6A 1S1TA 3PO5A 2ZD1A 4H5VA 3HP6A 4HTUA 4CEDA 5CY4A 3WXMB 4FOEA 4IG0A 2VG6A 5IT9O 3OBWA 3G4SN 1HJOA 1LW0A 4CK3A 4ID5A 4EIAA 4O55A 5M1PA 3AA5X 3A5OC 5M1QA 3HVTA 1ZBIA 3P1GA 3L2VA
chains in the Genus database with same CATH topology
2P9LB 3IUCA 4K41A 3M6GA 3HBTA 4HTLA 2QWLA 3VGKA 2P9UA 3EL2A 2RE2A 3H3NO 3A5MC 4IJAA 3SAFA 5AQJA 3GDQA 2YHYA 3MX2A 4H0OA 1SS6A 5AQUA 3I33A 4WFBL 3LL3A 1DKGD 2QW9A 3ENHA 4YORA 3E9LA 2KHOA 4IO8A 4BRAA 3TTCA 5BPMA 4PL8A 2Q0UA 1BWFO 2NRZA 3A0IX 3VGMA 4BC4A 4FPAA 2E2OA 2V52B 3G71N 2QA4N 3MN6A 3NVMA 5AQZA 2YJEA 4CD1A 4JKEA 1U2VB 4CZLA 1WUAA 3MDQA 2A5XA 4DB3A 2PAVA 1T6DA 5AFUA 2NRXA 3AGRA 4FWNA 3GOIA 3WEEA 4BR0A 1M1KO 3CPWM 4PHTX 5ADXA 3D2EB 3LM2A 5AZJA 1DT9A 2QM1A 4JKHA 5HL7L 4WQ4C 2YCHA 4BRLA 5EX5A 4ISEA 4CBWA 5C2FA 3CCUN 3SBGA 2GX9A 1RGIA 2WUSA 4AM7A 4I6MA 2E2NA 4A2AA 3D6RA 2FXUA 3VEWA 3WT0A 4ISFA 4BREA 5AQQA 3CJ9A 1Q18A 4LC9B 4FOIA 4IWVA 1VQMN 5FPEA 1JCGA 3SAHA 3J7ZO 1XC3A 2PFUA 2AA4A 3CQYA 1GLJO 4BC5A 1T44A 4XH1A 5GINA 4B1VA 5GAHP 2ZWHA 4K42A 2Q31A 4NO7A 4YOYA 3PIOL 3EKSA 1YAGA 2E1YA 4BRMA 4JNEA 1YUWA 3KWGA 1QZ5A 3D2FA 5GIPA 1QHAA 4H03B 4BG9A 1YJ9N 2F9TA 2HSTA 4B1ZA 1LOTB 1HLUA 4FWPA 2HBJA 2CGJA 5AQGA 4CBUA 1GLAG 1KAXA 3IDHA 4O8UA 3N4PA 2HBMA 3VF4A 5AQMA 4BVOA 5F1XA 3H1QA 5KPRA 1C0FA 2QWMA 4U7BA 2QWRA 3ID6A 1Y64A 4H0XB 2HBKA 2W40A 3E1YA 2IIRA 5F2RA 5BPNA 5LJWA 2KLAA 2E20A 1H1VA 3CCQN 4JK9A 3CPEA 1SZ2A 3CJCA 3IKMA 3O9TA 4IEEA 5B8HA 1NGGA 3QFUA 1BU6O 4BVPA 3CC4N 1J6ZA 4RCHA 5FPNA 3BUZB 1SQKA 2Q0RA 4YOWA 2Q97A 2AP1A 3MN7A 3HZ6A 5AFUH 2JWKA 3ZETA 5C2DA 5DM6L 2QWNA 1CZAN 4YOXA 4IOAL 1WOQA 4XH5A 4JHDB 5ADXH 3TSQA 2P9SA 4H0PA 4CJ7A 5C0YA 4A5BA 3CCRN 2FSNA 2FF6A 1BA1A 1MWMA 1S22A 1BUPA 2QWPA 1TYQB 4MDAA 3U4LA 3VF6A 1S72N 4KH5A 3TSPA 4O5FA 3R8EA 4C1NI 3L4IA 3CJ7A 5ELZA 3G6EN 3P38A 4CZFA 3ID8A 4DQ8A 4Z94A 3FE1A 4IOCL 3MN9A 4CZMA 5GAEP 4OPAA 3P39A 1KC8O 2VCPA 4GNIA 3UKRB 1Q81O 3FZHA 5JMVA 4H5RA 3U9ZA 1HKBA 4WYBA 5C10A 4JD2A 5BN9A 3LDLA 3O08A 4AF1A 3U8XA 3FGUA 1U6ZA 2HF4A 1NMDA 3HM8A 1D4XA 4CD3A 1GLDG 2GWJA 4JK8A 2V7YA 4BRGA 4WFAL 1VQ7N 3NVKA 3C7NB 3HOTA 5BRFA 4H0YB 2P9NB 3KVGA 4DKWA 4A57A 1K9MO 3SJHA 1NGIA 4PKHA 2NRHA 1M90O 5HOOA 2GTDA 3KHYA 2Q1NA 3K9KA 1NGEA 3ZX3A 3ULEA 3ZYYX 3TPQA 2VYPA 5GAGP 3MWTA 2JWLA 5AQWA 3WXKA 5MLCQ 4KH4A 1KAYA 4BR4A 3VEZA 3L6QA 3WQTA 3FFKB 4JKAA 2OTJN 3B8AX 3GL1A 3H45C 2QEXN 1BA0A 1X3MA 1ZC6A 3LDNA 4YOTA 2GELA 5BRDA 4YOUA 1NGHA 4HWIA 3SBTA 5M1NA 4BRDA 4QS8A 4FWLA 1W97L 1YVNA 3VPZA 2HBLA 2ASOA 5C15A 1JCEA 3EN9A 1NM1A 3DXKB 4CZIA 4OO1J 4IOXA 3UKUB 2IVOA 3MCAB 1QQMA 4FWKA 1HKCA 4C23A 4O8KA 4JKBA 1P8ZA 4WF9L 1YJNN 4KBOA 5AQYA 1NGDA 3Q7CA 5M1FA 5GIOA 1RDWX 2YHWA 1ATSA 3WEEB 2EWSA 3F5TA 3CHWA 2VGMA 3EO3A 3O9SA 4Y0WA 1EO1A 5EOYA 2P9PB 2P9KB 3TTDA 4K43A 1OVYA 2NRRA 4XH4A 3CERA 1P90A 3ZEUA 1IJJA 2QXLA 4B1YB 2VGNA 5TKYA 2D4WA 1QQOA 1GLCG 2A3ZA 1YIJN 4I6MB 5EVZA 5AQVA 3O8MA 3C6AA 2FLOA 4WQ5A 3CQXA 4JN4A 4JKGB 3BP8A 3CD6N 3ATVA 5KQ8A 2HOEA 2I7NA 3DJCA 3P4IA 3AY9A 3F2KA 1V4TA 3QDKA 5EY4A 2CH5A 4IEIA 4BRQA 3AGKA 1RFQA 3HI0A 1YITN 1ATRA 3O9UA 3P31A 1KD1O 2GEMA 2WBNA 1RDUA 1YJWN 3LDOA 5H1SQ 5E84A 4ISGA 2ZF5O 3CIPA 3H46O 3S41A 1ZXOA 3DXMA 4BRNA 5AQLA 1VQON 4M63C 3F9MA 1NBWA 4JKFA 3O9QA 4FWSA 1K73O 5BN8A 5BRHA 4MO5A 1QZ6A 1QVGM 4BR2A 3C6HA 5C12A 4FWRA 4YDUA 5DM7L 2HF3A 3BF3A 3T69A 3KK7A 3TSUA 4BRIA 4BRCA 4IXCA 3AARA 3BF1A 1OKJA 4JKDA 3VEXA 4AM6A 1SAZA 4KH6A 3CXCM 4JEPA 4BRHA 2YHXA 4QS9A 3PIPL 3BEXA 3ZX2A 5JVHL 1ILYA 4CZGA 3VTIA 5AQIA 1VQKN 3N4QA 2ITMA 4MLHA 5KPZA 1NGAA 3HSCA 4NLCA 3SLCA 2ZGZA 3DWLA 3CC7N 4MO4A 4CZJA 4DCHA 4IZ9A 1BOTO 1MDUB 2ZGYA 3C0BA 4FSVA 1TUYA 3RSEA 3M3ZA 4IJNA 4RTFD 2QWQA 3EE8A 3E9PA 4NLBA 2OTLN 3U9DA 3L0QA 3IMXA 4JHDA 3L4QA 5AZIB 2E88A 4ILJA 4A61A 1VQPN 1K8AO 4YOVA 3FZFA 5TKWA 1TYQA 3MN5A 4BRPA 2FSJA 4JAXA 1ATNA 4BROA 3CCJN 2NZTA 4ILGB 3SMSA 3VETA 4CZKA 1E4GT 2P9IB 4FVUA 4MDBA 3A5LC 3R1XA 3O5BA 4M7XA 2FF3B 4MLEA 2BTFA 2NNWA 1VQ6N 2YJFA 5AQSA 3FZKA 1G99A 3VEOA 3UKRA 3EE9A 4BRFA 2OANA 3FLCO 4XEIA 1Q86O 1E4FT 3O1WA 5CE3A 3O6WA 3OHRA 3CMAN 1V4SA 1VQ4N 2A6AA 1QVFM 3QFPA 3WQUA 2F9WA 2A42A 5AQXA 3IFRA 3EZWA 1K8KB 5M1OA 3UB5A 4IFEA 5AQTA 1Z05A 3CI5A 3NMUA 3C7NA 5EXWA 2I7PA 4EHTA 4WQ4A 4L3QA 2E2QA 2P9NA 4R79A 4BR5A 3CJBA 3ULEB 3DAWA 5E26A 3QBXA 1Z6RA 4CBXA 2P9UB 3O1BA 2KKZA 3FR0A 4BR9A 3KWIA 4BGAA 4H0VB 1MWKA 1GLLO 3M5RA 1HUXA 2P9LA 3MK6A 4ILHA 4NB4A 3VGLA 4BRKA 5JLHA 4GV3A 3LM9A 5AR0A 3MX5A 1QQNA 3H1VX 3QB0A 1C0GA 3TTFA 4A59A 1JJ2M 3TU5A 1VQNN 3CF5L 1X3NA 2HMPA 1KXPA 3CCLN 2NRTA 3O4WA 2D0PA 2E8AA 3CJAA 4GY2B 4GV6A 4C1NK 3D7EO 4A5AA 4BC3A 4U67L 1U2VA 1YHQN 2IVNA 5AZJB 1NJIO 5AQPA 3DXKA 3G25A 1HX1A 3ZX0A 3MMVA 3UKUA 3VOVA 2UYTA 3D2EA 1GLEG 3W0LA 4BQLA 4BGBA 3W3DA 4CZEA 5AQKA 1T3VA 3ZEUB 3O80A 1ZBSA 2P9PA 1W2BM 1TUUA 2P9KA 2VWBA 4PL7A 4PKIA 1HPMA 3VEYA 3CC2N 3VERA 4F9OA 4BY9C 3M1FA 4QS7A 4M7YA 4EAHD 2Q36A 1VQ5N 4RWTA 2J4RA 2NRVA 4H5NA 3I55N 1IG8A 2QWOA 4K25A 5AQFA 1VAZA 4E1JA 2YI1A 3D2FB 4JKGA 5I9EB 3EKUA 5LY3A 3RVCA 4FPBA 2E2PA 2YX6A 2ZJPL 3VTHA 3A8YA 1X9JA 3CETA 3MWPA 4JK7A 1BO5O 3T7ZA 2QTDA 5JVGL 4IDHA 3PLAA 4BR7A 1KAZA 4FO0A 4A2BA 1S3XA 3A5NC 3DXMB 3E9OA 4G9ZA 2ASPA 1N8RO 3VMFB 4B1XB 3UE5A 1EQYA 3SMPA 3WXLA 3VEVA 4B9QA 1DEJA 2ZJQL 4JKCA 2IVPA 1JCFA 3FZLA 2Q2RA 3K9JA 4FWQA 4GVEA 3ATUA 1ESVA 3VF2A 5KQDA 1Q82O 5FPMA 3R9PA 4WFNL 3HTVA 4GV9A 4EHUA 2ASMA 3R6MA 1NGFA 4FWOA 1DGKN 5CHIA 1NWKA 3I56N 5AQRA 2GUPA 2ZJRL 2D1KA 5FPDA 2V51B 4WQ5C 2A41A 5GADP 3ENOA 4PKGA 3WXJA 3WXIA 1BG3A 3ZETB 1YI2N 1NLVA 1GLFO 2CH6A 2PBDA 1VQ9N 5BPLA 4IO9L 1KQSM 1R59O 2P9SB 4BC2A 2BH1A 2WFBA 4UY8O 3O9RA 3CCMN 3J8AA 3CCEN 1LCUA 3RSEB 3QICA 1NGCA 3C65A 3OA9A 4A62A 3SK3A 2RHKA 2GWKA 3KZBA 3Q7BA 2QI2A 4H0TB 3QBWA 4FL9A 3HOSA 1HKGA 2NRWA 3WUHA 2CGLA 2DPNA 3GG4A 2FSKA 4CZHA 1NGJA 4YDUC 3FZMA 2CGKA 3JS6A 1MA9B 1YF5L 4J8FA 2F7TA 5AZIA 4BG8A 3ENBA 2WC9A 3H3OB 3JXUA 3AAQA 1BDGA 1VQLN 4H5TA 4JD2B 1VQ8N 1YXQA 3CCVN 3AAPA 5AQOA 1T6CA 2A40A 5LJVA 4CI6A 4DHYA 5KPTA 5AQHA 2P9IA 4H5VA 4EFHA 3SAGA 3GBTA 3HRGA 4OPHA 3DLLL 1O13A 2NLXA 3WXMB 4FOEA 5AQNA 5CR4A 3LDPA 4H5WA 1XQSC 4B1UB 3H6EA 3VENA 3I8BA 4FWMA 3OBWA 3OBYA 3CMEN 3QMLA 3G4SN 1HJOA 2H3GX 3R3LA 1GLBG 5F0XA 5JICA 2V7ZA 2E1ZA 4EIAA 2W41A 5M1KA 5M1PA 1XUPO 2D0OA 1K8KA 3A5OC 3VESA 5M1QA 4BQZA 3OW2M 3CCSN 2BUPA 3LDQA 3MCPA 1Q7YO 1NGBA 3GE1A 5BREA 4B1WB 4WCEL 3E66A 5BR9A 3CJ1A 5JLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MDB A;  3F2K A;  4R79 A;  5CR4 A;  3HOS A;  5HOO A;  3HOT A;  3K9J A;  4U7B A;  2F7T A;  4MDA A;  3K9K A; 
#chains in the Genus database with same CATH topology
 3IUC A;  4K41 A;  1D8Y A;  3VGK A;  3ZSR A;  3NE6 A;  3TAQ A;  1C0U A;  1VSF A;  4KKO A;  3HO1 A;  3GDQ A;  3AVA A;  1SS6 A;  1JLC A;  4CHO A;  3I33 A;  1W9H A;  1WAJ A;  4FPA A;  2QA4 N;  3THY B;  2XY6 A;  1WUA A;  1EXQ A;  3MXM A;  5AFU A;  4ELT A;  3CQ8 A;  3D2E B;  1WSG A;  2HB5 A;  4BRL A;  4ISE A;  4CBW A;  3CCU N;  1S9E A;  4CHQ A;  1TVR A;  4M3R A;  1IH7 A;  3D6R A;  3VEW A;  4ISF A;  4BRE A;  3CJ9 A;  1QE1 A;  4LC9 B;  3DLR A;  4FOI A;  1NNE A;  1JCG A;  1DTQ A;  3J7Z O;  1K6Y A;  4BC5 A;  4XH1 A;  3NH2 A;  3NAE A;  5GAH P;  3SUP A;  3S3O A;  4K42 A;  2Q31 A;  4YOY A;  4H4M A;  1JLG A;  2Z1H A;  3EKS A;  4NYF A;  5EU7 A;  4ZTF A;  5FRN A;  1SKW A;  3NF9 A;  1L3T A;  4Y1D A;  4H03 B;  4K0K K;  2F9T A;  4B1Z A;  2OZS A;  1HLU A;  3LAL A;  2G8V A;  2CGJ A;  4IG3 A;  1GLA G;  4O8U A;  1TAU A;  4CJL A;  5AQM A;  4X65 K;  5F1X A;  4CEC A;  4BDY A;  2QWM A;  3P83 D;  4U7B A;  2W40 A;  4DR1 K;  3V81 A;  2IIR A;  1H1V A;  1WBD A;  3AVI A;  1VSD A;  4L8R B;  1SZ2 A;  4R5P A;  3MEE A;  3QFU A;  4BVP A;  3CC4 N;  2O8C A;  1S1V A;  4YOW A;  1S1W A;  4KHS A;  3ZET A;  3MN7 A;  3HZ6 A;  5AFU H;  5C2D A;  1TK0 A;  2QWN A;  4F2S A;  4JHD B;  3TSQ A;  1WLJ A;  2EHG A;  4O0J A;  5C0Y A;  4A5B A;  1BCM A;  1HNX K;  4AHT A;  1N33 K;  1MWM A;  1Q9Y A;  1BUP A;  2QWP A;  1TYQ B;  4DV7 K;  1S72 N;  4J2B A;  4HUG A;  3TSP A;  1L5U A;  3R8E A;  1NK9 A;  3CJ7 A;  2O8F A;  3P38 A;  1L3V A;  4IOC L;  4AQY K;  3PX4 A;  2IS3 A;  3NF6 A;  4OPA A;  2VCP A;  4FJJ A;  1BGX T;  4JYA K;  3U9Z A;  2D0B A;  1XHX A;  3HK2 A;  1U49 A;  2HHQ A;  4JD2 A;  4AF1 A;  3LDL A;  3O08 A;  1RT1 A;  3K5L A;  3DOL A;  1U6Z A;  3O3H A;  2HF4 A;  3MXI A;  4KI4 A;  3KIO A;  1GLD G;  1LWE A;  2Y1I A;  3HOT A;  4H0Y B;  3RMD A;  1ZBL A;  2P9N B;  4CJ3 A;  3J7Y P;  3NGZ A;  3C95 A;  3ZSZ A;  4Q5V A;  3ZX3 A;  5HP1 A;  4QAG A;  4I7F A;  3MWT A;  1G15 A;  4CGD A;  2E5L K;  1KAY A;  2BE2 A;  1RT6 A;  5CZ1 A;  1S6P A;  1LAV A;  1WSE A;  1CZ9 A;  3L6Q A;  2D5R A;  2BDP A;  4DS5 A;  3WQT A;  4H4O A;  4JKA A;  3QO9 A;  3VQE A;  3THW A;  2OTJ N;  2RF2 A;  2FC0 A;  2GEL A;  3RMB A;  4N5S A;  3VQQ A;  4FWL A;  1W97 L;  2ASO A;  1JCE A;  1NM1 A;  3DXK B;  4WF9 L;  3K5O A;  4JKB A;  1YJN N;  4KBO A;  4AIL C;  5M1F A;  3SQ4 A;  3O9S A;  3H08 A;  1C0M A;  2G8F A;  3JSM A;  2UXD K;  4DR2 K;  4J2D A;  1OVY A;  4XH4 A;  1XNQ K;  4CF0 A;  4M42 A;  4E19 A;  4E1M A;  3VN5 A;  5J1E A;  5AQV A;  3WNH A;  3C6A A;  1C1C A;  4OLB A;  3ATV A;  5KQ8 A;  3DJC A;  3PO4 A;  3F2K A;  1WSF A;  4IEI A;  1RFQ A;  1T03 A;  2GEM A;  2LSN A;  4CJS A;  4F2R A;  4W5R A;  1YJW N;  3LDO A;  1BIZ A;  2ZF5 O;  5I42 A;  2A1S A;  3OYC A;  4JI3 K;  1HRH A;  4ICL A;  1TGO A;  4DQQ A;  1RTH A;  5BRH A;  1QVG M;  4BR2 A;  2PZS A;  1WN7 A;  3I8D A;  2P51 A;  5DM7 L;  2HF3 A;  3KK7 A;  4IXC A;  3L8B A;  2F8S A;  4CJ4 A;  3NF7 A;  3FFI A;  4KH6 A;  2G8K A;  2F4V K;  3DRR A;  2X78 A;  4DG1 A;  5JVH L;  1ILY A;  2XO7 A;  3N4Q A;  2ITM A;  1NGA A;  3HSC A;  4JS5 A;  2O8C B;  2ZGZ A;  1RNH A;  3DYA A;  3LZI A;  4CZJ A;  1QHT A;  3MXJ A;  4FSV A;  4HUE A;  4E7I A;  3TAE A;  3M3Z A;  1IV0 A;  2OTL N;  4GMJ B;  2O8E A;  3IMX A;  5J2M A;  2DFH A;  4A61 A;  1VQP N;  4LSN A;  1ZYQ A;  1NJX A;  4BRP A;  3WNF A;  3OYM A;  4FLZ A;  3SMS A;  3LP2 A;  1E4G T;  1X9M A;  1YTU A;  3R1X A;  4QCL A;  5KTQ A;  4M7X A;  2NNW A;  1NJY A;  1VQ6 N;  2YJF A;  3VEO A;  3CFR A;  3UKR A;  2GV9 A;  2OAN A;  4XEI A;  1Q86 O;  1VSH A;  5CE3 A;  3O6W A;  4I2P A;  1V4S A;  4CJW A;  3SQ1 A;  3OYI A;  3VA3 A;  3UB5 A;  2VWK A;  1VSM A;  2DFE A;  3DLE A;  1Z05 A;  3NMU A;  3C7N A;  3VQB A;  4DR4 K;  4R79 A;  2QKB A;  3CJB A;  4HVJ A;  4B3M K;  3K2P A;  2G8W A;  1Z6R A;  2KTQ A;  2P9U B;  4KHQ A;  3QNO A;  1UA0 A;  4FW2 A;  1GLL O;  4ILH A;  2P9L A;  3AVM A;  1MU2 A;  3LM9 A;  3AO5 A;  3V1Q A;  1QQN A;  1GOB A;  4A59 A;  3QNN A;  4LF7 K;  1VK0 A;  3CFP A;  1SL0 A;  4CGH A;  3L2R A;  4FZX C;  3LP1 A;  3D7E O;  2E6L A;  4KHU A;  1TV6 A;  3QIN A;  4CJK A;  4CIF A;  1Q9X A;  3MMV A;  3UKU A;  3VOV A;  2VQF K;  4CHZ A;  4BGB A;  4GKJ K;  5AQK A;  4CEF A;  1T3V A;  3O80 A;  1VRU A;  2P9P A;  1CZB A;  4PL7 A;  2UUB K;  3QEW A;  4CJU A;  1NMN A;  3OYG A;  3VEY A;  2HHU A;  3CC2 N;  3VER A;  4F9O A;  4LH4 A;  1VSJ A;  4EAH D;  2Q36 A;  4C8K A;  4CJ5 A;  4K25 A;  4JKG A;  2E2P A;  4Z4H A;  2QTD A;  5JVG L;  4BWJ A;  4CF1 A;  2ASP A;  4B1X B;  3NBP A;  3AA4 A;  2Q2R A;  3FZL A;  4FWQ A;  4CFC A;  1TL3 A;  5FPM A;  3R9P A;  3HTV A;  4CK1 A;  1C1A A;  1IBK K;  1KFS A;  4FWO A;  4RW8 A;  2ZJR L;  5FPD A;  5JS1 A;  2A41 A;  2IOC A;  1VSK A;  4FJ7 A;  3U6F A;  3WXJ A;  2CH6 A;  2PBD A;  3AV9 A;  1BQN A;  3EYZ A;  2O4G A;  2BH1 A;  2WFB A;  3O9R A;  1LCU A;  1IKW A;  3C65 A;  2RPI A;  4A62 A;  3KKS A;  3SK3 A;  3VQD A;  4CEZ A;  4H0T B;  3QBW A;  3HOS A;  4BAC A;  1NG9 A;  1VSL A;  1HKG A;  1I39 A;  2NRW A;  3ZT1 A;  3GG4 A;  2P1J A;  2W42 A;  5AZI A;  4BG8 A;  3ENB A;  3L2Q A;  3ZT4 A;  5KPT A;  4EFH A;  3DLL L;  3SAG A;  4OPH A;  4FJ8 A;  2UUC K;  1HYS A;  1X9W A;  4OPJ A;  2OPS A;  4GVM A;  4ZHR A;  1XQS C;  2I5J A;  5C25 A;  4BE2 A;  4FJH A;  3I8B A;  4M3W A;  3R3L A;  3VQ5 A;  4CVN E;  5JIC A;  2JLE A;  2W41 A;  1OH5 A;  4FVM A;  1XUP O;  1K8K A;  3OW2 M;  2BUP A;  3LDQ A;  3MCP A;  1QS4 A;  1Q7Y O;  3OYN A;  4DQI A;  1ASU A;  5BRE A;  4WCE L;  4DS4 A;  1HNZ K;  4DV4 K;  2P9L B;  2UXB K;  3M6G A;  4X64 K;  3A5M C;  5AQJ A;  3MX2 A;  5AQU A;  1XI1 A;  2QW9 A;  3ENH A;  3BZK A;  4IFY A;  3TTC A;  5BPM A;  4LF4 K;  4PL8 A;  3LDS A;  2NRZ A;  2E2O A;  4KO0 A;  3NVM A;  5AQZ A;  4CD1 A;  4CZL A;  1KVC A;  2R7Y A;  3MDQ A;  2HND A;  4DB3 A;  2HMI A;  1RBV A;  4BR0 A;  3AA2 A;  3LM2 A;  1HQE A;  3PUF A;  5AZJ A;  5EX5 A;  3RRH A;  1BI4 A;  2GX9 A;  3DLK A;  1RGI A;  2WUS A;  4AM7 A;  1L3U A;  1HNV A;  4I6M A;  3TAN A;  3CM6 A;  2A1R A;  4W5T A;  3WT0 A;  1TKZ A;  2BGG A;  2ETJ A;  1T05 A;  2DY4 A;  5FPE A;  3SAH A;  3LZJ A;  4B3S K;  2PFU A;  1KTQ A;  2AA4 A;  1GLJ O;  4MFB A;  4LF5 K;  1T44 A;  3AVL A;  2OZM A;  3SUQ A;  2KZZ A;  1R0A A;  2OPQ A;  4CJF A;  3IRX A;  3TI0 A;  2X6S A;  3KWG A;  5GIP A;  1UOC A;  1RBU A;  1QHA A;  4LF9 K;  4BG9 A;  1N32 K;  1YJ9 N;  1EWQ A;  3VQC A;  2HW3 A;  4FWP A;  1LWF A;  4CBU A;  1NK6 A;  1KAX A;  1FXX A;  4CEO A;  3SNN A;  4DV6 K;  3VF4 A;  1TK5 A;  4BVO A;  3DMJ A;  1TAQ A;  1C0F A;  2QWR A;  4CGJ A;  3SV4 A;  4B9M A;  2Z1J A;  3CJC A;  4DTR A;  3IKM A;  4IEE A;  4Y1C A;  4FJN A;  5B8H A;  1BU6 O;  5FPN A;  3BUZ B;  2Q97 A;  4CJT A;  5DM6 L;  4W5Q A;  1WB9 A;  4LFC K;  3SUO A;  4CCH A;  2UUA K;  1TKT A;  2XHB A;  1T7P A;  3CCR N;  3VF6 A;  4FLX A;  3ASM A;  1C0T A;  4LFB K;  3G10 A;  1IKX A;  2HHV A;  5KRS A;  1WSH A;  4FZZ A;  4CZF A;  3CYM A;  2DTU A;  3FE1 A;  4CZM A;  5GAE P;  4PA1 A;  4CES A;  3RMA A;  4DSK A;  1HR0 K;  5C10 A;  1EP4 A;  1NMD A;  1D4X A;  1QTM A;  4BRG A;  4WFA L;  3QEP A;  3QEV A;  3NVK A;  2O8D B;  5BRF A;  2XY7 A;  3KD5 E;  2XY8 A;  4JI2 K;  3SJH A;  2QXF A;  1HYV A;  4PKH A;  2GTD A;  3KHY A;  3KLG A;  2Q1N A;  2IDO A;  1NJW A;  1NOY A;  3ULE A;  2JWL A;  4Z4I A;  4CK2 A;  3WXK A;  2G8U A;  4BR4 A;  3NGY A;  2GBZ A;  4PUO A;  2D0C A;  4DTS A;  3HPO A;  4NYN A;  2QEX N;  2HVI A;  2E4L A;  4YOT A;  4FLT A;  1NGH A;  4HWI A;  4QS8 A;  4LSL A;  5C15 A;  1J9A A;  4CZI A;  2IVO A;  3MCA B;  4FWK A;  4C23 A;  1P8Z A;  1BIS A;  1X9S A;  1NGD A;  4OVL A;  1RDW X;  3CHW A;  1EO1 A;  5EOY A;  2P9K B;  3TTD A;  4K43 A;  2NRR A;  3M8S A;  1RBS A;  3ZEU A;  2YKM A;  1YIJ N;  4I6M B;  1VRT A;  4H8K A;  1L3S A;  4WQ5 A;  2Z1G A;  3BP8 A;  2HOE A;  3RR7 A;  5EY4 A;  4C8M A;  4O44 A;  4BRQ A;  1YIT N;  2YNG A;  3PSF A;  1JXB A;  1ATR A;  1KD1 O;  2WBN A;  1RDU A;  3H46 O;  4B3R K;  1ZXO A;  3QIO A;  4C8L A;  3JAM O;  4IKF A;  4MO5 A;  1QZ6 A;  4CFB A;  3C6H A;  4YDU A;  4E0D A;  3T69 A;  1S5J A;  3DLG A;  4BRI A;  5SZT A;  4BRC A;  3NCI A;  1OKJ A;  1U4B A;  3L3U A;  1I94 K;  4JEP A;  2HHS A;  3ZX2 A;  4KFB A;  4O4G A;  4AHC A;  4CZG A;  1VQK N;  2IC3 A;  5KPZ A;  3DWL A;  3CC7 N;  3M8Q A;  1KFD A;  3VQ8 A;  4DCH A;  1BOT O;  2ZGY A;  3LAN A;  4B9L A;  3RSE A;  4IJN A;  3TR8 A;  4RTF D;  3EE8 A;  3E9P A;  3DLH A;  3QES A;  3AO2 A;  4YHH K;  1HPZ A;  3HP9 A;  2E88 A;  2KQ2 A;  3V1O A;  4E7L A;  5KRT A;  1K8A O;  4YOV A;  3DRS A;  4BDZ A;  3QIP A;  3FZF A;  3HL8 A;  1SKS A;  3MN5 A;  4FK2 A;  3C94 A;  4JAX A;  3CCJ N;  2NZT A;  4ILG B;  1A5X A;  4CZK A;  4FVU A;  5DK5 A;  3OTO K;  3PX0 A;  4OPK A;  4RG8 A;  4J2E A;  3EE9 A;  4BRF A;  3FLC O;  3KKR A;  3ULD A;  4KHN A;  1FJG K;  3S9H A;  1ZBU A;  4DLG A;  4Q0B A;  2A6A A;  3TAP A;  4N47 A;  2A42 A;  5M1O A;  3O4N A;  4IFE A;  5EXW A;  2E2Q A;  4BR5 A;  3ULE B;  4UQG A;  1WAF A;  3SQ0 A;  3QLH A;  3O1B A;  2KKZ A;  3FR0 A;  4BR9 A;  1SL1 A;  3KWI A;  3KJV A;  4HCB A;  3MK6 A;  4BRK A;  3F73 A;  4KHP K;  3MX5 A;  3QB0 A;  3TU5 A;  3CF5 L;  2HMP A;  4DTP A;  4LD0 A;  4GY2 B;  4GV6 A;  3KTQ A;  4C1N K;  4U67 L;  2IGI A;  4E89 A;  2IVN A;  3TAB A;  4O5B A;  3G25 A;  1RT5 A;  1XHZ A;  3HVR A;  3SI6 A;  3ZEU B;  2FBX A;  1HPM A;  1SV5 A;  4BY9 C;  4HHT A;  1NK8 A;  1TK8 A;  4QS7 A;  1VQ5 N;  2J4R A;  4H5N A;  4OKK A;  2QWO A;  2QKK A;  2B5J A;  3NH0 A;  5I9E B;  5LY3 A;  3KK3 A;  1KVB A;  1KLM A;  2YX6 A;  3VTH A;  5C24 A;  1Q8I A;  1S6Q A;  3CET A;  3MWP A;  5HBM A;  3PLA A;  3KD1 E;  1S3X A;  4YY3 K;  4DLE A;  3LPU A;  1KLN A;  1BHL A;  3WXL A;  4OGC A;  2IVP A;  3K9J A;  1J53 A;  3ATU A;  1ESV A;  3AVC A;  3VF2 A;  5KQD A;  5E41 A;  4DV1 K;  1VHX A;  3MEC A;  3KK1 A;  3I56 N;  5AQR A;  2GUP A;  4KB0 A;  3SYZ A;  2V51 B;  4DUZ K;  4KHY A;  4DTM A;  1X1P A;  3ZET B;  1NLV A;  1VQ9 N;  3SV3 A;  4M3Z A;  4X62 K;  4IO9 L;  3OYB A;  1KQS M;  4FJK A;  3VQP A;  3CCM N;  3J8A A;  3O4Q A;  1WBB A;  3ZSV A;  3RSE B;  1NGC A;  4NCG A;  3B6O A;  2HNY A;  1I3A A;  2RHK A;  1IO2 A;  5J2N A;  2QI2 A;  2O8F B;  2CGL A;  1GOC A;  4CZH A;  1KSP A;  4FYD A;  3JS6 A;  4NXM K;  4M3U A;  4IBN A;  3NDK A;  3AAQ A;  3K59 A;  4H5T A;  4JD2 B;  1YXQ A;  1BIU A;  1T6C A;  3M8P A;  5AQH A;  2P9I A;  2NLX A;  4KV8 A;  4OGE A;  4GKK K;  4W5N A;  3U3G A;  5AQN A;  4DV0 K;  1TKD A;  1B92 A;  4B1U B;  3VEN A;  3OBY A;  3QET A;  5F0X A;  1RT2 A;  5HRR A;  4FM0 A;  4I9L A;  3J7A P;  5M1K A;  3OS0 A;  2D0O A;  4DFP A;  4DWI A;  1OH8 A;  3CCS N;  3CM5 A;  3AVF A;  1NGB A;  3GE1 A;  3THW B;  2Y1J A;  2ITG A;  5BR9 A;  3CJ1 A;  3MED A;  4HTL A;  2QWL A;  3SAF A;  4IJA A;  2YHY A;  4DV2 K;  4DTU A;  3LL3 A;  4BRA A;  4YOR A;  3E9L A;  2KHO A;  4IO8 A;  1BWF O;  3A0I X;  4BDP A;  4BC4 A;  1ASV A;  3G71 N;  4M3Y A;  1YVU A;  4DTX A;  4Z4F A;  3MN6 A;  2YJE A;  4B3O A;  3PV8 A;  2A5X A;  1M1K O;  3AGR A;  3GOI A;  3WEE A;  3RRG A;  1XMO K;  5ADX A;  1N6Q A;  5HL7 L;  4WQ4 C;  2YCH A;  5C2F A;  3K5N A;  4CJP A;  2E2N A;  1CLQ A;  1GOA A;  2FXU A;  1Q18 A;  5LMU K;  4DU4 A;  1XC3 A;  5GIN A;  4B1V A;  1REV A;  1D9F A;  1JKH A;  4E7K A;  1DLO A;  1YUW A;  3D2F A;  4FK4 A;  4CEE A;  4BWM A;  3SCX A;  5AQG A;  2WON A;  3N4P A;  4DTN A;  1SKR A;  1WSI A;  2F96 A;  5SWM A;  1NKC A;  4IFV A;  4TSX A;  3UIQ A;  2G8H A;  2VG5 A;  1J5E K;  1Y64 A;  2HBK A;  4N56 A;  3E1Y A;  2E20 A;  4B8A B;  3NFA A;  2VQE K;  4AHV A;  3CCQ N;  3RR8 A;  4JK9 A;  3CPE A;  5DMR A;  1JLQ A;  5LL6 Z;  3O9T A;  1RCH A;  4B9U A;  5K14 A;  1QSS A;  4Z4E A;  4RCH A;  2Q0R A;  2O8E B;  2AP1 A;  3AO4 A;  1CZA N;  1WOQ A;  4XH5 A;  4Z4C A;  5ADX H;  3SJJ A;  1TL1 A;  2P9S A;  4H0P A;  2OA8 A;  3ZSY A;  2FSN A;  2FF6 A;  3WNE A;  4F4K A;  1OH7 A;  1S22 A;  3U4L A;  5HLF A;  2VG7 A;  4KH5 A;  1IBL K;  2KFN A;  4O5F A;  3L4I A;  3PY8 A;  3HPG A;  2YV0 X;  4ELU A;  4NCB A;  3MN9 A;  3HYF A;  1EX4 A;  3ZSW A;  4DSL A;  3P39 A;  2HNZ A;  1KC8 O;  4GNI A;  3UKR B;  3LAK A;  5JMV A;  4H5R A;  3AVN A;  3T1Y K;  4B9S A;  1RTJ A;  3A2F A;  5HRN A;  3U8X A;  3FGU A;  1CXU A;  2B4J A;  4B3T K;  4CJQ A;  3HM8 A;  4JK8 A;  2V7Y A;  1VQ7 N;  4DF8 A;  3C7N B;  3KLI A;  3KVG A;  4DKW A;  4CHP A;  3LWL A;  3AO1 A;  2NRH A;  1B9D A;  4DR5 K;  3K9K A;  1NGE A;  2KW4 A;  3ZYY X;  1UA1 A;  2VYP A;  5GAG P;  5MLC Q;  1NK7 A;  4KH4 A;  2B6A A;  5J2P A;  5KI6 A;  1LW2 A;  3VEZ A;  3FFK B;  3GL1 A;  3BZC A;  2PYJ A;  1X3M A;  4NCA A;  3LDN A;  4YOU A;  1KCF A;  5M1N A;  4LF6 K;  3AA3 A;  1YVN A;  3SUN A;  4Z4G A;  3EN9 A;  4IOX A;  3UKU B;  1QQM A;  4BE1 A;  5AQY A;  4B9N A;  3Q7C A;  5GIO A;  4CEB A;  1ATS A;  3WEE B;  3EO3 A;  3KK2 A;  4Y0W A;  2PYL A;  2P9P B;  4FJG A;  2P5G A;  3VQ6 A;  3PSI A;  3OYD A;  1HQU A;  4B1Y B;  2VGN A;  2D4W A;  3NHG A;  1QQO A;  1GLC G;  3JYT A;  2A3Z A;  4WE1 A;  4FM2 A;  3VA0 A;  5EVZ A;  1JLA A;  4FM1 A;  4FJ9 A;  3O8M A;  1S9G A;  2FLO A;  3CQX A;  2JGU A;  4JKG B;  4JN4 A;  3THX A;  1NJZ A;  2UU9 K;  3V4I A;  3CD6 N;  3P4I A;  3AY9 A;  1V4T A;  1WNS A;  3QDK A;  2AJQ A;  3V6D A;  2CH5 A;  5A2Q O;  3AGK A;  3OJS A;  5CYM A;  5H1S Q;  5E84 A;  1CXQ A;  4JS4 A;  3BGR A;  4JRP A;  2X74 A;  1NBW A;  4JKF A;  4DSI A;  4N76 A;  4JI7 K;  1F21 A;  1QSY A;  4FWR A;  3ZSO A;  3BF3 A;  3KLE A;  1RT3 A;  4DQP A;  3TSU A;  1SL2 A;  3AAR A;  4JKD A;  3OYE A;  4B8C A;  4CF9 A;  1IKV A;  2YHX A;  1SUQ A;  3VTI A;  5AQI A;  1DTT A;  2ZQB A;  1HJR A;  4MLH A;  4NLC A;  3TWH A;  1J5O A;  1C1B A;  4MO4 A;  4IZ9 A;  1MDU B;  3C0B A;  3BY5 A;  1TUY A;  4PQU A;  5BR8 K;  1NK4 A;  1IG9 A;  4JLH A;  1RTI A;  3U9D A;  4OX9 K;  3LP0 A;  1XC9 A;  4E3S A;  3J80 O;  4JHD A;  4N41 A;  3L4Q A;  5AZI B;  4ILJ A;  4FLU A;  4M3X A;  1TYQ A;  3O3F A;  3V9W A;  3DM2 A;  3SQ2 A;  2FSJ A;  4NXN K;  4BRO A;  3K58 A;  4DSF A;  1ZBH A;  3HXM A;  2YNH A;  4RW6 A;  1RDB A;  3A5L C;  2XRI A;  4MLE A;  4FJI A;  1W7A A;  4CFD A;  2YKN A;  1G99 A;  3AVG A;  3LPT A;  3TAG A;  3IG1 A;  1U04 A;  3O1W A;  3OHR A;  3CMA N;  1VQ4 N;  1FK9 A;  3QFP A;  3AVK A;  3WQU A;  2F9W A;  5AQX A;  3IFR A;  3EZW A;  1K8K B;  1QSL A;  4DMN A;  5T7B A;  4EHT A;  2P9N A;  3OS1 A;  4EZ6 A;  5CZ2 A;  3DAW A;  4M45 A;  4DTJ A;  1LWC A;  1ITG A;  3QBX A;  4CBX A;  2F8T A;  4DV3 K;  3VGL A;  3M5R A;  1HUX A;  4NB4 A;  3HPH A;  4CHY A;  4JI0 K;  4GV3 A;  5AR0 A;  3H1V X;  1C0G A;  3TTF A;  1VQN N;  1C6V A;  1X3N A;  1KXP A;  3CCL N;  2NRT A;  3OY9 A;  2E8A A;  3L2U A;  4AHU A;  4A5A A;  4BC3 A;  2G8I A;  1U2V A;  3NH1 A;  1YHQ N;  5AZJ B;  1NJI O;  1XNR K;  4DUY K;  4RW4 A;  4MQ3 A;  3DXK A;  4LFA K;  4OLA A;  3PX6 A;  2UYT A;  5FDL A;  1BI4 B;  3K0S A;  1GLE G;  5KGX A;  2HHH K;  3W3D A;  2XY5 A;  3T1A A;  3D0P A;  1LV5 A;  5FLX O;  4M41 A;  1ZBS A;  4F3O A;  5IWA K;  1TUU A;  2NUB A;  3LWM A;  2VWB A;  4PKI A;  1JL2 A;  3THX B;  1UAX A;  2KFZ A;  4RW9 A;  2NRV A;  3ZSQ A;  5AQF A;  4B9T A;  4E1J A;  2YI1 A;  4DFK A;  1HNI A;  4DFM A;  2ZJP L;  1NU0 A;  3OYL A;  3V9X A;  3A8Y A;  4IDH A;  1KAZ A;  1NOZ A;  4FO0 A;  3A5N C;  3E9O A;  4A2B A;  4G9Z A;  3VMF B;  4KTZ A;  1EQY A;  3SMP A;  4V19 S;  4B9Q A;  2ZJQ L;  1Z26 A;  4IDK A;  4DF4 A;  4CF2 A;  4GVE A;  3MEG A;  1ZBF A;  4CF8 A;  1N5Y A;  4GV9 A;  4OKJ A;  4EHU A;  3R6M A;  1NGF A;  4FK0 A;  5CHI A;  4OJR A;  4JRQ A;  1NWK A;  1W0H A;  1IBM K;  3ENO A;  4PKG A;  3DI6 A;  3WXI A;  1BG3 A;  3E01 A;  4XIU A;  1R59 O;  4BC2 A;  3D45 A;  3AVB A;  4K8X A;  3IS9 A;  3CCE N;  4PWD A;  1XWL A;  3QIC A;  4E1N A;  4EP4 A;  3OA9 A;  2RKI A;  1U45 A;  3KZB A;  3Q7B A;  1JLF A;  3BDP A;  4FL9 A;  5I3U A;  3C6U A;  2FSK A;  1RBR A;  5C42 A;  4ELV A;  3FZM A;  1S1U A;  1YF5 L;  4J8F A;  3EY1 A;  1ASW A;  3JXU A;  4KRF A;  4DV5 K;  1VQL N;  4CIG A;  3CCV N;  3AAP A;  2P5O A;  4X66 K;  3LP3 A;  4GW6 A;  3S3M A;  4DHY A;  3GBT A;  3HRG A;  1O13 A;  5CR4 A;  3LDP A;  4H5W A;  3H6E A;  4FWM A;  3QML A;  2H3G X;  1GLB G;  2V7Z A;  2E1Z A;  2FBY A;  3THV A;  4FCY A;  3IAY A;  2EX3 A;  3F9K A;  4I9Q A;  1XMQ K;  3VES A;  4BQZ A;  3ZLJ A;  5CYQ A;  4G1Q A;  4B1W B;  3J81 O;  3RWU A;  3E66 A;  3CME N;  5JLF A;  3KLF A;  3HBT A;  2P9U A;  3EL2 A;  2RE2 A;  3H3N O;  4H0O A;  4WFB L;  1DKG D;  3SZ2 A;  2Q0U A;  3VGM A;  4I2Q A;  3VQ9 A;  2V52 B;  4JI5 K;  2HVH A;  3AVJ A;  1A5V A;  4JKE A;  1U2V B;  3MAQ A;  2PAV A;  1T6D A;  2NRX A;  4FWN A;  5HRS A;  3CPW M;  4PHT X;  4KAZ A;  1DT9 A;  5D3G A;  2QM1 A;  4JKH A;  4LF8 K;  4CEQ A;  3RMC A;  4PY5 A;  3SBG A;  3AO3 A;  4A2A A;  1TKX A;  1RTD A;  5AQQ A;  4IWV A;  5JS2 A;  1VQM N;  4FJM A;  3CQY A;  4AHR A;  4JI4 K;  3OYA A;  2GUI A;  4DTO A;  2ZWH A;  4KTQ A;  2ATQ A;  4NO7 A;  3PIO L;  1YAG A;  1JLE A;  3CG7 A;  2E1Y A;  4BRM A;  4JNE A;  1JLB A;  1QZ5 A;  2FBV A;  2HST A;  1LOT B;  4RW7 A;  4DQR A;  2HBJ A;  3T19 A;  3IDH A;  2HBM A;  4BE0 A;  3H1Q A;  4CW7 B;  5KPR A;  3ID6 A;  4H0X B;  1HNW K;  1RIL A;  3HJF A;  5F2R A;  5LJW A;  5BPN A;  1YT3 A;  2KLA A;  4B9V A;  4CJR A;  1BQM A;  4QOZ B;  1NGG A;  1J6Z A;  1OVQ A;  1SQK A;  1UWB A;  2VWJ A;  1JJ2 M;  3KLH A;  4FLY A;  2JWK A;  4YOX A;  4IOA L;  1S1X A;  3ZCM A;  4CJ7 A;  1B9F A;  3DRP A;  1BA1 A;  4MDA A;  3T1H K;  4B08 A;  1RT4 A;  4C1N I;  4EZ9 A;  4KB1 A;  3OYJ A;  4KHW A;  5ELZ A;  3G6E N;  3ID8 A;  4DQ8 A;  3K5M A;  4Z94 A;  4E7H A;  4DU1 A;  1BCO A;  1FW6 A;  1FKO A;  1Q81 O;  1Z25 A;  3FZH A;  1HKB A;  4WYB A;  5BN9 A;  5LMN K;  2YNI A;  1QQC A;  3AVH A;  4CD3 A;  2GWJ A;  4FW1 A;  2O4I A;  3V9U A;  1RDC A;  4DSJ A;  3ISN C;  4K8Z A;  1K9M O;  4A57 A;  1NGI A;  3VQA A;  1M90 O;  4FJL A;  5HOO A;  3P5J A;  1HMV A;  2X6N A;  4Z0U A;  3TPQ A;  1A5W A;  3OYK A;  5AQW A;  4C8N A;  4YFU A;  1EWR A;  5HRP A;  2W6L A;  3B8A X;  1N34 K;  3H45 C;  1BA0 A;  1ZC6 A;  4FJ5 A;  5BRD A;  3SBT A;  1RT7 A;  4BRD A;  3VPZ A;  4AHS A;  2HBL A;  4OO1 J;  2HHW A;  3VQ4 A;  1HKC A;  1NKB A;  4O8K A;  4LH5 A;  1EET A;  4KTW A;  3DLB A;  2YHW A;  3QEI A;  2EWS A;  3F5T A;  2VGM A;  4DSE A;  2D0A A;  1U48 A;  4ID1 A;  4CJV A;  3CER A;  3I0R A;  1P90 A;  3OS2 A;  1IJJ A;  2QXL A;  5TKY A;  1RDA A;  4DR7 K;  1IKY A;  4F3T A;  2W6K A;  3O3G A;  2Z1I A;  4LY7 A;  2I7N A;  4JI6 K;  3OJU A;  1D9D A;  3HI0 A;  4DFJ A;  3O9U A;  3P31 A;  3HT3 A;  2OCE A;  1U47 A;  4ISG A;  3CIP A;  3S41 A;  2O8B A;  3DXM A;  4BRN A;  5AQL A;  3ITH A;  1VQO N;  4C8O A;  3TAM A;  4M63 C;  3F9M A;  1JL1 A;  3O9Q A;  4FWS A;  5BN8 A;  1K73 O;  1J54 A;  5C12 A;  3B6P A;  3ZT2 A;  4YNQ A;  3LAM A;  3ZT3 A;  4CGF A;  4DU3 A;  1D5A A;  1VSI A;  3BF1 A;  2ZM6 K;  2OPR A;  2OPP A;  3VEX A;  4AM6 A;  1SAZ A;  4HUF A;  3CXC M;  3OVN A;  3SPZ A;  4BRH A;  4QS9 A;  3PIP L;  1O1W A;  3BEX A;  3G0Z A;  4CFA A;  3I0S A;  3SLC A;  5HRO A;  5AJ3 K;  2KZM A;  4KRE A;  2QWQ A;  2E6M A;  4NLB A;  1HYZ A;  2DFF A;  3L0Q A;  4CJE A;  1BL3 A;  3CFO A;  3L3V A;  1NKE A;  5TKW A;  5FRO A;  2HHX A;  3EZ5 A;  4ZTJ A;  1ATN A;  3VET A;  2P9I B;  1RDD A;  4MDB A;  3DOK A;  4F8R A;  3O5B A;  4FLW A;  2FF3 B;  3T3F A;  2BTF A;  1N36 K;  3C6T A;  4EP5 A;  2HHT A;  5AQS A;  3FZK A;  2YNF A;  1E4F T;  4CIE A;  3OYF A;  2WOM A;  1NK0 A;  1QVF M;  4FZY A;  3HM9 A;  1E3M A;  5AQT A;  2O8D A;  4DQS A;  3CI5 A;  4HCC A;  1RBT A;  2I7P A;  2YHA A;  4WQ4 A;  4L3Q A;  4FJX A;  4DR3 K;  5E26 A;  3VQ7 A;  4CEA A;  4BGA A;  4H0V B;  1MWK A;  3EEQ A;  3ZT0 A;  4FLV A;  2YHB A;  5JLH A;  3NGI A;  3TAR A;  2RN2 A;  4OKE A;  1T8E A;  2WTU A;  4CGI A;  3O4W A;  2D0P A;  3CJA A;  3THY A;  2OYQ A;  3ALY A;  4CE9 A;  1JXE A;  5AQP A;  2ZE2 A;  1HX1 A;  3ZX0 A;  4JI8 K;  3D2E A;  4FXD A;  3QER A;  3W0L A;  4BQL A;  4CZE A;  5J2Q A;  3S3N A;  2BAN A;  1W2B M;  1YTA A;  2P9K A;  3L2W A;  4KPY A;  4E7J A;  4JI1 K;  1OH6 A;  1NK5 A;  3ZSX A;  3K57 A;  3HST B;  3M1F A;  4M7Y A;  3U3Y A;  4RWT A;  3I55 N;  3V9S A;  1IG8 A;  4M3T A;  1KVA A;  1VAZ A;  3D2F B;  3EKU A;  3RVC A;  4FPB A;  2IAJ A;  1X9J A;  4JK7 A;  1BO5 O;  3T7Z A;  3NF8 A;  4BR7 A;  2O8B B;  3DXM B;  1EKE A;  1N8R O;  5FRM A;  3UE5 A;  1WSJ A;  3VEV A;  1DEJ A;  4JKC A;  1JCF A;  1Q82 O;  4WFN L;  4JV5 K;  4CHN A;  2ASM A;  3V9Z A;  1LAW A;  1DGK N;  2Q3S A;  1Y97 A;  2FBT A;  4CGG A;  3V1R A;  2D1K A;  3QEX A;  5GAD P;  4WQ5 C;  2QK9 A;  3RTV A;  1VSE A;  1YI2 N;  1GLF O;  5BPL A;  4W5O A;  2P9S B;  2UXC K;  4UY8 O;  3WNG A;  3SPY A;  4J2A A;  2GWK A;  1FKP A;  1KRP A;  3WUH A;  2PY5 A;  2DPN A;  3TAF A;  4AH9 A;  1NGJ A;  4YDU C;  4KI6 A;  2CGK A;  1MA9 B;  4DR6 K;  2F7T A;  3M8R A;  4O0I A;  2WC9 A;  3H3O B;  1BDG A;  1VQ8 N;  4CER A;  3OYH A;  5AQO A;  5KGW A;  2A40 A;  5LJV A;  4CI6 A;  1S1T A;  3PO5 A;  2ZD1 A;  4H5V A;  3HP6 A;  4HTU A;  4CED A;  5CY4 A;  3WXM B;  4FOE A;  4IG0 A;  2VG6 A;  5IT9 O;  3OBW A;  3G4S N;  1HJO A;  1LW0 A;  4CK3 A;  4ID5 A;  4EIA A;  4O55 A;  5M1P A;  3AA5 X;  3A5O C;  5M1Q A;  3HVT A;  1ZBI A;  3P1G A;  3L2V A; 
#chains in the Genus database with same CATH homology
 2P9L B;  3IUC A;  4K41 A;  3M6G A;  3HBT A;  4HTL A;  2QWL A;  3VGK A;  2P9U A;  3EL2 A;  2RE2 A;  3H3N O;  3A5M C;  4IJA A;  3SAF A;  5AQJ A;  3GDQ A;  2YHY A;  3MX2 A;  4H0O A;  1SS6 A;  5AQU A;  3I33 A;  4WFB L;  3LL3 A;  1DKG D;  2QW9 A;  3ENH A;  4YOR A;  3E9L A;  2KHO A;  4IO8 A;  4BRA A;  3TTC A;  5BPM A;  4PL8 A;  2Q0U A;  1BWF O;  2NRZ A;  3A0I X;  3VGM A;  4BC4 A;  4FPA A;  2E2O A;  2V52 B;  3G71 N;  2QA4 N;  3MN6 A;  3NVM A;  5AQZ A;  2YJE A;  4CD1 A;  4JKE A;  1U2V B;  4CZL A;  1WUA A;  3MDQ A;  2A5X A;  4DB3 A;  2PAV A;  1T6D A;  5AFU A;  2NRX A;  3AGR A;  4FWN A;  3GOI A;  3WEE A;  4BR0 A;  1M1K O;  3CPW M;  4PHT X;  5ADX A;  3D2E B;  3LM2 A;  5AZJ A;  1DT9 A;  2QM1 A;  4JKH A;  5HL7 L;  4WQ4 C;  2YCH A;  4BRL A;  5EX5 A;  4ISE A;  4CBW A;  5C2F A;  3CCU N;  3SBG A;  2GX9 A;  1RGI A;  2WUS A;  4AM7 A;  4I6M A;  2E2N A;  4A2A A;  3D6R A;  2FXU A;  3VEW A;  3WT0 A;  4ISF A;  4BRE A;  5AQQ A;  3CJ9 A;  1Q18 A;  4LC9 B;  4FOI A;  4IWV A;  1VQM N;  5FPE A;  1JCG A;  3SAH A;  3J7Z O;  1XC3 A;  2PFU A;  2AA4 A;  3CQY A;  1GLJ O;  4BC5 A;  1T44 A;  4XH1 A;  5GIN A;  4B1V A;  5GAH P;  2ZWH A;  4K42 A;  2Q31 A;  4NO7 A;  4YOY A;  3PIO L;  3EKS A;  1YAG A;  2E1Y A;  4BRM A;  4JNE A;  1YUW A;  3KWG A;  1QZ5 A;  3D2F A;  5GIP A;  1QHA A;  4H03 B;  4BG9 A;  1YJ9 N;  2F9T A;  2HST A;  4B1Z A;  1LOT B;  1HLU A;  4FWP A;  2HBJ A;  2CGJ A;  5AQG A;  4CBU A;  1GLA G;  1KAX A;  3IDH A;  4O8U A;  3N4P A;  2HBM A;  3VF4 A;  5AQM A;  4BVO A;  5F1X A;  3H1Q A;  5KPR A;  1C0F A;  2QWM A;  4U7B A;  2QWR A;  3ID6 A;  1Y64 A;  4H0X B;  2HBK A;  2W40 A;  3E1Y A;  2IIR A;  5F2R A;  5BPN A;  5LJW A;  2KLA A;  2E20 A;  1H1V A;  3CCQ N;  4JK9 A;  3CPE A;  1SZ2 A;  3CJC A;  3IKM A;  3O9T A;  4IEE A;  5B8H A;  1NGG A;  3QFU A;  1BU6 O;  4BVP A;  3CC4 N;  1J6Z A;  4RCH A;  5FPN A;  3BUZ B;  1SQK A;  2Q0R A;  4YOW A;  2Q97 A;  2AP1 A;  3MN7 A;  3HZ6 A;  5AFU H;  2JWK A;  3ZET A;  5C2D A;  5DM6 L;  2QWN A;  1CZA N;  4YOX A;  4IOA L;  1WOQ A;  4XH5 A;  4JHD B;  5ADX H;  3TSQ A;  2P9S A;  4H0P A;  4CJ7 A;  5C0Y A;  4A5B A;  3CCR N;  2FSN A;  2FF6 A;  1BA1 A;  1MWM A;  1S22 A;  1BUP A;  2QWP A;  1TYQ B;  4MDA A;  3U4L A;  3VF6 A;  1S72 N;  4KH5 A;  3TSP A;  4O5F A;  3R8E A;  4C1N I;  3L4I A;  3CJ7 A;  5ELZ A;  3G6E N;  3P38 A;  4CZF A;  3ID8 A;  4DQ8 A;  4Z94 A;  3FE1 A;  4IOC L;  3MN9 A;  4CZM A;  5GAE P;  4OPA A;  3P39 A;  1KC8 O;  2VCP A;  4GNI A;  3UKR B;  1Q81 O;  3FZH A;  5JMV A;  4H5R A;  3U9Z A;  1HKB A;  4WYB A;  5C10 A;  4JD2 A;  5BN9 A;  3LDL A;  3O08 A;  4AF1 A;  3U8X A;  3FGU A;  1U6Z A;  2HF4 A;  1NMD A;  3HM8 A;  1D4X A;  4CD3 A;  1GLD G;  2GWJ A;  4JK8 A;  2V7Y A;  4BRG A;  4WFA L;  1VQ7 N;  3NVK A;  3C7N B;  3HOT A;  5BRF A;  4H0Y B;  2P9N B;  3KVG A;  4DKW A;  4A57 A;  1K9M O;  3SJH A;  1NGI A;  4PKH A;  2NRH A;  1M90 O;  5HOO A;  2GTD A;  3KHY A;  2Q1N A;  3K9K A;  1NGE A;  3ZX3 A;  3ULE A;  3ZYY X;  3TPQ A;  2VYP A;  5GAG P;  3MWT A;  2JWL A;  5AQW A;  3WXK A;  5MLC Q;  4KH4 A;  1KAY A;  4BR4 A;  3VEZ A;  3L6Q A;  3WQT A;  3FFK B;  4JKA A;  2OTJ N;  3B8A X;  3GL1 A;  3H45 C;  2QEX N;  1BA0 A;  1X3M A;  1ZC6 A;  3LDN A;  4YOT A;  2GEL A;  5BRD A;  4YOU A;  1NGH A;  4HWI A;  3SBT A;  5M1N A;  4BRD A;  4QS8 A;  4FWL A;  1W97 L;  1YVN A;  3VPZ A;  2HBL A;  2ASO A;  5C15 A;  1JCE A;  3EN9 A;  1NM1 A;  3DXK B;  4CZI A;  4OO1 J;  4IOX A;  3UKU B;  2IVO A;  3MCA B;  1QQM A;  4FWK A;  1HKC A;  4C23 A;  4O8K A;  4JKB A;  1P8Z A;  4WF9 L;  1YJN N;  4KBO A;  5AQY A;  1NGD A;  3Q7C A;  5M1F A;  5GIO A;  1RDW X;  2YHW A;  1ATS A;  3WEE B;  2EWS A;  3F5T A;  3CHW A;  2VGM A;  3EO3 A;  3O9S A;  4Y0W A;  1EO1 A;  5EOY A;  2P9P B;  2P9K B;  3TTD A;  4K43 A;  1OVY A;  2NRR A;  4XH4 A;  3CER A;  1P90 A;  3ZEU A;  1IJJ A;  2QXL A;  4B1Y B;  2VGN A;  5TKY A;  2D4W A;  1QQO A;  1GLC G;  2A3Z A;  1YIJ N;  4I6M B;  5EVZ A;  5AQV A;  3O8M A;  3C6A A;  2FLO A;  4WQ5 A;  3CQX A;  4JN4 A;  4JKG B;  3BP8 A;  3CD6 N;  3ATV A;  5KQ8 A;  2HOE A;  2I7N A;  3DJC A;  3P4I A;  3AY9 A;  3F2K A;  1V4T A;  3QDK A;  5EY4 A;  2CH5 A;  4IEI A;  4BRQ A;  3AGK A;  1RFQ A;  3HI0 A;  1YIT N;  1ATR A;  3O9U A;  3P31 A;  1KD1 O;  2GEM A;  2WBN A;  1RDU A;  1YJW N;  3LDO A;  5H1S Q;  5E84 A;  4ISG A;  2ZF5 O;  3CIP A;  3H46 O;  3S41 A;  1ZXO A;  3DXM A;  4BRN A;  5AQL A;  1VQO N;  4M63 C;  3F9M A;  1NBW A;  4JKF A;  3O9Q A;  4FWS A;  1K73 O;  5BN8 A;  5BRH A;  4MO5 A;  1QZ6 A;  1QVG M;  4BR2 A;  3C6H A;  5C12 A;  4FWR A;  4YDU A;  5DM7 L;  2HF3 A;  3BF3 A;  3T69 A;  3KK7 A;  3TSU A;  4BRI A;  4BRC A;  4IXC A;  3AAR A;  3BF1 A;  1OKJ A;  4JKD A;  3VEX A;  4AM6 A;  1SAZ A;  4KH6 A;  3CXC M;  4JEP A;  4BRH A;  2YHX A;  4QS9 A;  3PIP L;  3BEX A;  3ZX2 A;  5JVH L;  1ILY A;  4CZG A;  3VTI A;  5AQI A;  1VQK N;  3N4Q A;  2ITM A;  4MLH A;  5KPZ A;  1NGA A;  3HSC A;  4NLC A;  3SLC A;  2ZGZ A;  3DWL A;  3CC7 N;  4MO4 A;  4CZJ A;  4DCH A;  4IZ9 A;  1BOT O;  1MDU B;  2ZGY A;  3C0B A;  4FSV A;  1TUY A;  3RSE A;  3M3Z A;  4IJN A;  4RTF D;  2QWQ A;  3EE8 A;  3E9P A;  4NLB A;  2OTL N;  3U9D A;  3L0Q A;  3IMX A;  4JHD A;  3L4Q A;  5AZI B;  2E88 A;  4ILJ A;  4A61 A;  1VQP N;  1K8A O;  4YOV A;  3FZF A;  5TKW A;  1TYQ A;  3MN5 A;  4BRP A;  2FSJ A;  4JAX A;  1ATN A;  4BRO A;  3CCJ N;  2NZT A;  4ILG B;  3SMS A;  3VET A;  4CZK A;  1E4G T;  2P9I B;  4FVU A;  4MDB A;  3A5L C;  3R1X A;  3O5B A;  4M7X A;  2FF3 B;  4MLE A;  2BTF A;  2NNW A;  1VQ6 N;  2YJF A;  5AQS A;  3FZK A;  1G99 A;  3VEO A;  3UKR A;  3EE9 A;  4BRF A;  2OAN A;  3FLC O;  4XEI A;  1Q86 O;  1E4F T;  3O1W A;  5CE3 A;  3O6W A;  3OHR A;  3CMA N;  1V4S A;  1VQ4 N;  2A6A A;  1QVF M;  3QFP A;  3WQU A;  2F9W A;  2A42 A;  5AQX A;  3IFR A;  3EZW A;  1K8K B;  5M1O A;  3UB5 A;  4IFE A;  5AQT A;  1Z05 A;  3CI5 A;  3NMU A;  3C7N A;  5EXW A;  2I7P A;  4EHT A;  4WQ4 A;  4L3Q A;  2E2Q A;  2P9N A;  4R79 A;  4BR5 A;  3CJB A;  3ULE B;  3DAW A;  5E26 A;  3QBX A;  1Z6R A;  4CBX A;  2P9U B;  3O1B A;  2KKZ A;  3FR0 A;  4BR9 A;  3KWI A;  4BGA A;  4H0V B;  1MWK A;  1GLL O;  3M5R A;  1HUX A;  2P9L A;  3MK6 A;  4ILH A;  4NB4 A;  3VGL A;  4BRK A;  5JLH A;  4GV3 A;  3LM9 A;  5AR0 A;  3MX5 A;  1QQN A;  3H1V X;  3QB0 A;  1C0G A;  3TTF A;  4A59 A;  1JJ2 M;  3TU5 A;  1VQN N;  3CF5 L;  1X3N A;  2HMP A;  1KXP A;  3CCL N;  2NRT A;  3O4W A;  2D0P A;  2E8A A;  3CJA A;  4GY2 B;  4GV6 A;  4C1N K;  3D7E O;  4A5A A;  4BC3 A;  4U67 L;  1U2V A;  1YHQ N;  2IVN A;  5AZJ B;  1NJI O;  5AQP A;  3DXK A;  3G25 A;  1HX1 A;  3ZX0 A;  3MMV A;  3UKU A;  3VOV A;  2UYT A;  3D2E A;  1GLE G;  3W0L A;  4BQL A;  4BGB A;  3W3D A;  4CZE A;  5AQK A;  1T3V A;  3ZEU B;  3O80 A;  1ZBS A;  2P9P A;  1W2B M;  1TUU A;  2P9K A;  2VWB A;  4PL7 A;  4PKI A;  1HPM A;  3VEY A;  3CC2 N;  3VER A;  4F9O A;  4BY9 C;  3M1F A;  4QS7 A;  4M7Y A;  4EAH D;  2Q36 A;  1VQ5 N;  4RWT A;  2J4R A;  2NRV A;  4H5N A;  3I55 N;  1IG8 A;  2QWO A;  4K25 A;  5AQF A;  1VAZ A;  4E1J A;  2YI1 A;  3D2F B;  4JKG A;  5I9E B;  3EKU A;  5LY3 A;  3RVC A;  4FPB A;  2E2P A;  2YX6 A;  2ZJP L;  3VTH A;  3A8Y A;  1X9J A;  3CET A;  3MWP A;  4JK7 A;  1BO5 O;  3T7Z A;  2QTD A;  5JVG L;  4IDH A;  3PLA A;  4BR7 A;  1KAZ A;  4FO0 A;  4A2B A;  1S3X A;  3A5N C;  3DXM B;  3E9O A;  4G9Z A;  2ASP A;  1N8R O;  3VMF B;  4B1X B;  3UE5 A;  1EQY A;  3SMP A;  3WXL A;  3VEV A;  4B9Q A;  1DEJ A;  2ZJQ L;  4JKC A;  2IVP A;  1JCF A;  3FZL A;  2Q2R A;  3K9J A;  4FWQ A;  4GVE A;  3ATU A;  1ESV A;  3VF2 A;  5KQD A;  1Q82 O;  5FPM A;  3R9P A;  4WFN L;  3HTV A;  4GV9 A;  4EHU A;  2ASM A;  3R6M A;  1NGF A;  4FWO A;  1DGK N;  5CHI A;  1NWK A;  3I56 N;  5AQR A;  2GUP A;  2ZJR L;  2D1K A;  5FPD A;  2V51 B;  4WQ5 C;  2A41 A;  5GAD P;  3ENO A;  4PKG A;  3WXJ A;  3WXI A;  1BG3 A;  3ZET B;  1YI2 N;  1NLV A;  1GLF O;  2CH6 A;  2PBD A;  1VQ9 N;  5BPL A;  4IO9 L;  1KQS M;  1R59 O;  2P9S B;  4BC2 A;  2BH1 A;  2WFB A;  4UY8 O;  3O9R A;  3CCM N;  3J8A A;  3CCE N;  1LCU A;  3RSE B;  3QIC A;  1NGC A;  3C65 A;  3OA9 A;  4A62 A;  3SK3 A;  2RHK A;  2GWK A;  3KZB A;  3Q7B A;  2QI2 A;  4H0T B;  3QBW A;  4FL9 A;  3HOS A;  1HKG A;  2NRW A;  3WUH A;  2CGL A;  2DPN A;  3GG4 A;  2FSK A;  4CZH A;  1NGJ A;  4YDU C;  3FZM A;  2CGK A;  3JS6 A;  1MA9 B;  1YF5 L;  4J8F A;  2F7T A;  5AZI A;  4BG8 A;  3ENB A;  2WC9 A;  3H3O B;  3JXU A;  3AAQ A;  1BDG A;  1VQL N;  4H5T A;  4JD2 B;  1VQ8 N;  1YXQ A;  3CCV N;  3AAP A;  5AQO A;  1T6C A;  2A40 A;  5LJV A;  4CI6 A;  4DHY A;  5KPT A;  5AQH A;  2P9I A;  4H5V A;  4EFH A;  3SAG A;  3GBT A;  3HRG A;  4OPH A;  3DLL L;  1O13 A;  2NLX A;  3WXM B;  4FOE A;  5AQN A;  5CR4 A;  3LDP A;  4H5W A;  1XQS C;  4B1U B;  3H6E A;  3VEN A;  3I8B A;  4FWM A;  3OBW A;  3OBY A;  3CME N;  3QML A;  3G4S N;  1HJO A;  2H3G X;  3R3L A;  1GLB G;  5F0X A;  5JIC A;  2V7Z A;  2E1Z A;  4EIA A;  2W41 A;  5M1K A;  5M1P A;  1XUP O;  2D0O A;  1K8K A;  3A5O C;  3VES A;  5M1Q A;  4BQZ A;  3OW2 M;  3CCS N;  2BUP A;  3LDQ A;  3MCP A;  1Q7Y O;  1NGB A;  3GE1 A;  5BRE A;  4B1W B;  4WCE L;  3E66 A;  5BR9 A;  3CJ1 A;  5JLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...