2F7TA

Crystal structure of the catalytic domain of mos1 mariner transposase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
227
structure length
204
Chain Sequence
WVPHELNERQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWIFFVNPKKTMLCVWWDQSGVIYYELLKPGETVNAARYQQQLINLNRALQRKRPEYQKRQHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Mos1 transposase
publication title Mechanism of Mos1 transposition: insights from structural analysis
pubmed doi rcsb
source organism Drosophila mauritiana
total genus 72
structure length 204
sequence length 227
ec nomenclature
pdb deposition date 2005-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01359 Transposase_1 Transposase (partial DDE domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.470 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2f7tA00
4R79A 4U7BA 4MDAA 4MDBA 5HOOA 3HOTA 3HOSA 3F2KA 3K9KA 5CR4A 2F7TA 3K9JA
chains in the Genus database with same CATH superfamily
1EWRA 4AHTA 1LAWA 3L2RA 4BE2A 2P9UA 4QAGA 4NCGA 4JKGB 1KLNA 4KB1A 3RSEB 3RWUA 4DTJA 1S9EA 4CZFA 3MN7A 4LF8K 1Z26A 5A2QO 3E9PA 4CI6A 5C12A 3CMEN 1RDAA 3IMXA 3OJSA 4CIGA 3KHYA 3SPYA 2E2QA 3AGRA 2VGMA 2FBTA 4LH5A 1L3SA 1D8YA 2VCPA 1X1PA 3AA2A 3MDQA 3OYFA 2AP1A 3AVFA 2QWOA 2X6NA 1XC3A 4O5BA 4C23A 1NOZA 3SI6A 4CHZA 1NJYA 3HBTA 5KQ8A 4IEIA 4FM0A 3MXIA 1B92A 4CJKA 4IFYA 3ZEUB 1GLJO 3K9KA 1NGEA 1RDBA 4KHYA 1W2BM 1CXUA 1WUAA 2IS3A 3K2PA 4J2EA 4BRAA 3MMVA 4Z4FA 4HTLA 3EE9A 5AQOA 3DLKA 3R6MA 1NGCA 1KD1O 2PFUA 4FXDA 1JLBA 1IKYA 4KO0A 4RW6A 2YHAA 5MLCQ 4FW1A 2HNZA 3SAFA 1TAQA 3VQBA 5DM7L 3VQ4A 3R8EA 3ID8A 4YOVA 3FR0A 4BREA 4FPBA 5BRHA 3AVCA 4FPAA 2DTUA 1WSFA 3DOLA 4JKCA 1XWLA 3NGZA 4DV6K 3LDOA 2QKKA 4JI1K 3HVRA 1XUPO 4GMJB 3P83D 2O8FA 4DQIA 1RT1A 3DXKB 4FO0A 3O9TA 3U9DA 3R9PA 4CHNA 4FLXA 3V4IA 3THXB 2CH6A 4JKFA 4H8KA 3ZSZA 3VOVA 4QS8A 3V9ZA 4EZ9A 4H03B 2UXBK 4B1WB 3V9SA 1BI4A 1O1WA 3LWLA 1M1KO 3SMSA 4KHPK 4IO8A 4B8CA 3VA0A 3WNHA 4QS7A 3KLFA 3L4IA 4CGDA 4PQUA 1ASVA 4CF1A 2V51B 3I0RA 3CG7A 3LZJA 2H3GX 2BANA 4CW7B 4C1NI 4CGIA 1R59O 4GKJK 5C15A 2OTLN 3WNEA 3K58A 4K42A 4KREA 1VK0A 3L6QA 3KLHA 2RPIA 4XH5A 5JS2A 4B9TA 3T3FA 3R3LA 4HUGA 3ULEA 3CJ9A 4BDPA 3SYZA 1W0HA 2IVNA 1YVUA 3T69A 2HBMA 1TUUA 4OKKA 3VF6A 3LDPA 2IOCA 4CJTA 4B9LA 4BC2A 4FWKA 1W97L 3MEGA 3P1GA 3M6GA 4H0TB 3SV3A 4H5NA 3VETA 3E66A 1HNWK 3NBPA 3NH2A 3KLGA 1J5EK 2HMIA 1RDWX 4YFUA 4RW8A 2KFNA 4WYBA 3HOSA 1I94K 2FC0A 1JLGA 3HT3A 4FM1A 1D4XA 5JICA 1ZBUA 3I55N 3HYFA 4W5NA 3LDNA 3UKRB 1HJOA 1JL2A 2VQFK 3MN9A 4OGEA 2QM1A 4CHOA 1T05A 1IBLK 5IT9O 4B9MA 1NJXA 3CI5A 1HYZA 3KWIA 3LP2A 4FK0A 3CM5A 1GLBG 4FZYA 4WE1A 3D6RA 1TV6A 1WSHA 4CJQA 1RTHA 1VSEA 1WSGA 2QKBA 3UB5A 1WAFA 1QTMA 4CGFA 4JEPA 1VQNN 4HUEA 2B4JA 4FCYA 4JI7K 1DTQA 1K73O 5GIOA 4CJ7A 4DQ8A 4DQSA 2FSNA 1VHXA 3NF7A 1QQMA 2OPQA 4MLHA 4B1XB 3EO3A 3OS0A 3CETA 2BTFA 3HP6A 2AJQA 4CK3A 4IZ9A 5AQMA 1NJWA 2PAVA 3IUCA 4AHUA 3HM8A 4M42A 5BRDA 3OYGA 3V9XA 1VQ5N 2FSKA 4OLAA 4DR2K 3MCPA 3L0QA 2AA4A 4NLCA 1YI2N 4O8KA 2E5LK 3OJUA 4IXCA 5GIPA 2O8FB 3G4SN 5C25A 3OYEA 1GOBA 1QSLA 1SZ2A 1HQUA 2DFHA 2W6LA 3QNNA 1P90A 3T1HK 2VG7A 5KRSA 4KHNA 2F7TA 3L4QA 1BI4B 5BREA 2P9PA 4JRQA 2IVOA 4BRLA 3IFRA 4BE1A 1VQLN 1NWKA 1Q9XA 1FXXA 4Z4IA 2W40A 3HP9A 5CE3A 1JCGA 4DV7K 1RT4A 3KK2A 3K59A 2XY5A 3LAMA 3TAGA 1N6QA 4O0JA 1VSKA 4V19S 2BH1A 3VQ8A 4FJMA 1GLFO 3DLEA 4OPAA 2XY7A 2OZSA 3H3OB 2HNYA 3ZLJA 4Y1CA 1QQCA 1QHTA 2F96A 4CJLA 2Q0UA 4FWQA 2KKZA 3VQ5A 5BPMA 3CC4N 4JI3K 4I2PA 3F9MA 1V4SA 3AVBA 3C94A 4E0DA 4NCAA 4WF9L 3CD6N 2OPSA 3C65A 1VSJA 3QMLA 3HSCA 3VQDA 3QESA 1RTDA 1L3UA 3N4PA 2A40A 1IG8A 3OYAA 3CFPA 1JL1A 1DKGD 5EXWA 4FJ9A 5F1XA 4ELVA 2ZWHA 4FWRA 1NK7A 5TKWA 1K8AO 1IBKK 3DLBA 5FRMA 4JRPA 3NCIA 4CZIA 1TKTA 1LOTB 2HVIA 3VEOA 1G99A 1QVGM 1E3MA 3CFRA 2VQEK 3QEWA 1QQNA 3CIPA 2XRIA 3DLRA 1YXQA 2GELA 4OPHA 1ILYA 4DV1K 1JCEA 4IDKA 1KCFA 3DYAA 2WFBA 3CJCA 3QINA 1R0AA 1I39A 3OA9A 3DLLL 3GE1A 1BUPA 4BQLA 4IJAA 4JK9A 3EZWA 3VEYA 3FZKA 4N41A 2W6KA 5C2FA 2CGLA 4ZHRA 1SAZA 3CPEA 1UWBA 5AQZA 3CQXA 4J8FA 1S1WA 4I9QA 1JLFA 3SJHA 4CJ3A 4FJLA 1GLCG 4PL7A 2JWKA 3ALYA 5I42A 3LP3A 4N76A 4PL8A 5AQNA 1JJ2M 3ZSQA 3PO5A 1NK6A 2WOMA 4DU3A 3THWA 1OH8A 4FJHA 1KLMA 3C6HA 5J2QA 5KRTA 3IG1A 4KAZA 1ASUA 3L3VA 3H45C 4DLGA 1WSIA 4M3UA 2QTDA 3NE6A 3BGRA 4W5TA 4EHUA 3HZ6A 3AAQA 4NYFA 1NBWA 1YAGA 1UAXA 4DS5A 4G9ZA 4I2QA 1ZBHA 1BIZA 1A5WA 1ZBFA 1VQ6N 4F4KA 3MN5A 1SKRA 1VQ4N 3OYNA 3PX6A 3ZSVA 2P9PB 5LJVA 3J80O 3ID6A 3OW2M 1HR0K 2RKIA 3QO9A 4LFCK 5AQJA 3HXMA 1HJRA 5FPDA 2HOEA 4JI8K 5M1QA 3DXMA 1M90O 4NCBA 1L5UA 4B9VA 1EXQA 4DV2K 1YJ9N 3A5NC 1HNXK 1KVAA 4YY3K 5DMRA 3SJJA 4M3RA 2EX3A 3G6EN 1YITN 3DRSA 4CEQA 1BA0A 3M1FA 3ATUA 1L3VA 1S5JA 4DQRA 4B3SK 4CEZA 2GUIA 4YHHK 1OVYA 1E4FT 1TVRA 4H5TA 2ZF5O 3HOTA 4Z94A 1FKOA 4DFJA 5FPNA 4AF1A 3TSPA 1QQOA 3D2EA 3KKSA 3H3NO 3O80A 4H0PA 4LF4K 5ADXH 5TKYA 4CJUA 1VQMN 4CCHA 2WTUA 1EX4A 4CJPA 1KTQA 4DUZK 3AAPA 3J7ZO 2FBVA 3SK3A 1BDGA 3NF6A 3NGYA 2DFEA 3PSFA 1LW0A 1HPZA 4O55A 2ETJA 4L8RB 3HSTB 3ZX3A 1VQ7N 5EY4A 2ATQA 2G8IA 3CXCM 3KD1E 1D9DA 1ASWA 3AA3A 1XNQK 2HNDA 3KK3A 5LY3A 5M1NA 2A6AA 4LF9K 1I3AA 2HBLA 4K41A 4OPKA 3S3OA 2NRZA 2A3ZA 3E01A 4KI6A 2HHXA 3ASMA 2GWJA 3QNOA 1TUYA 4JKDA 3O3HA 3JSMA 5AQPA 1N36K 4CBUA 3CMAN 4O44A 5B8HA 4KFBA 3THWB 1QE1A 3AVGA 4PKGA 3J7AP 3O4WA 4GV9A 2PYLA 4XH4A 3O4NA 3N4QA 3VTIA 1FK9A 3LPTA 4B9NA 3CF5L 1Z6RA 1S1UA 1MWKA 2HHSA 2O8DB 3K5LA 2E88A 4JS5A 1C1AA 4R5PA 3PSIA 2ASMA 4LSNA 3M3ZA 3O4QA 4CZMA 4BRPA 4DF4A 1K6YA 4CZKA 4RW9A 2YV0X 5AQWA 4CEFA 1C0GA 3SNNA 4J2AA 2ASPA 1KFSA 1ZC6A 4BRQA 2XY8A 4OKJA 3TWHA 1QZ6A 4CEBA 3DXMB 5T7BA 4K8XA 4FL9A 3I0SA 2YKMA 4CFBA 3P31A 5AQTA 4BROA 4ID5A 3QBWA 4CF9A 4ISGA 4FM2A 4CJSA 3OS1A 1GLAG 3HTVA 1Q18A 4CESA 3U4LA 3HPGA 3C6AA 3NF8A 4E3SA 4DQQA 3UKRA 1BWFO 3LDLA 3SCXA 4CERA 4CJEA 3K5NA 4AQYK 3D2EB 3SAHA 5J2PA 3H08A 3AY9A 1C0MA 1TKXA 5LMUK 3VQPA 4B9UA 1WSJA 1DLOA 1LAVA 4X62K 3O9QA 5JMVA 3MWTA 3I8BA 4PHTX 4FWPA 3VEZA 4LF6K 4JLHA 4UY8O 4IG0A 4LFAK 3VENA 4FJ7A 1HPMA 3PX0A 3V81A 2HHWA 2UUBK 2JLEA 2A1SA 3TI0A 3OYCA 1C1BA 1NGAA 3CERA 4Z4HA 2ZJRL 1YJNN 3MCAB 5AQKA 3HL8A 3ZSRA 3OTOK 4B8AB 3ENBA 3ZSWA 4CVNE 4H5VA 1KAYA 4BR7A 3JYTA 5K14A 4FJIA 4O0IA 4C1NK 4ID1A 1SQKA 4FJ8A 3AVJA 4H5RA 2OZMA 2Q97A 1XHZA 3ZYYX 1NK4A 1CZBA 3QERA 3KJVA 1VRTA 1HYSA 2V7ZA 4AM7A 3VQEA 4JKEA 4B3OA 2D1KA 4CBWA 3MN6A 2G8UA 3AVKA 3O5BA 3BEXA 3O08A 5BN8A 3TAPA 4CZEA 1MA9B 1S1XA 3L3UA 3ISNC 4CHQA 4A62A 5HLFA 3O3FA 2W42A 4I7FA 4LF7K 4FWOA 1IKWA 4FLWA 3VGMA 1EP4A 1HRHA 2ZGYA 2ITGA 4BVOA 1T6DA 3UE5A 4L3QA 4DB3A 2DY4A 4DV5K 1RBVA 2ITMA 3ZT4A 3ZT3A 2GEMA 3AVNA 5BPLA 4DSLA 4ICLA 3FFIA 2IAJA 2KZMA 5HRRA 3B6PA 1HKBA 4GNIA 4IKFA 2HF3A 2OANA 3EKUA 3FFKB 3DRPA 3W3DA 5CHIA 3RVCA 2HHTA 2VWJA 3E9OA 4ISEA 5GINA 4CK1A 1TK8A 2E20A 2NLXA 2OTJN 4CZGA 4KTZA 4FK2A 2YCHA 3AA5X 2YJEA 4B1YB 1IV0A 4F2SA 1EO1A 2FF6A 3VESA 2YHXA 2Q1NA 5AQXA 4M45A 4CHYA 1YJWN 5HRSA 2FSJA 4AHSA 4RWTA 4HWIA 5M1PA 2UU9K 3SUNA 1SL0A 1ZXOA 1U45A 1LV5A 2HF4A 3DAWA 5KGWA 3WXKA 4BACA 4JS4A 1NU0A 1IG9A 3L2VA 3Q7CA 4PKHA 1NKEA 5KTQA 3CCLN 4M3XA 1EETA 1C0UA 4FVUA 5GAHP 1KAXA 3MX5A 1YTUA 3MXJA 4YOUA 4DR1K 3SAGA 4AHRA 4JI5K 3G25A 1J6ZA 2F9TA 5AFUH 3O6WA 3RMBA 3A5MC 4KI4A 5KPTA 3MX2A 3PV8A 4DTRA 5M1KA 1QZ5A 2KZZA 1HX1A 4CK2A 2GBZA 1IBMK 2KFZA 3U8XA 3VQAA 1XQSC 1YUWA 3GDQA 4A61A 4OPJA 4JAXA 3CJ1A 2Z1IA 3KD5E 4X65K 4YOTA 3LDSA 4FZZA 2V52B 5ELZA 5EX5A 4DSJA 4FWMA 4B3RK 5HRPA 2E8AA 4JK7A 4M3TA 2P51A 4FJNA 3SMPA 1BG3A 1RT6A 4O4GA 1N8RO 2Q3SA 3O1BA 4QOZB 1BU6O 2NUBA 3QFPA 4BWJA 4QS9A 4FJGA 4BR0A 4YDUC 3VEWA 4FWLA 3ZX0A 4LC9B 3RMAA 4A57A 1RT5A 2YNFA 1T03A 2YJFA 1JCFA 3THYA 2A42A 3NF9A 2Q31A 3L2QA 4IOXA 4J2BA 3O1WA 1WAJA 1MU2A 4HVJA 2FLOA 1U6ZA 3ZSYA 3NVMA 4BRCA 4DKWA 1JLCA 1QSSA 4OO1J 4CZHA 3JXUA 2R7YA 5JLHA 1ZBSA 2GWKA 5D3GA 4JI0K 3SUQA 3HI0A 3DM2A 4BRIA 1VSLA 1NKBA 3D45A 2P1JA 4BDYA 3VQCA 4BR4A 1F21A 4C8OA 2I7NA 3I8DA 4JKHA 4BC4A 3CHWA 1CZAN 3KIOA 3ZT0A 4GW6A 4F9OA 3HO1A 1Q82O 3NH0A 3C7NA 4ZTJA 3EE8A 1RGIA 1C6VA 3DJCA 2PY5A 4CEEA 2V7YA 2G8FA 2G8HA 3NMUA 3OHRA 4FJXA 1REVA 3TTFA 3EZ5A 4K8ZA 1IO2A 4DFKA 4BRGA 4DTMA 3P4IA 4G1QA 5AQVA 1RTJA 2WC9A 1X3NA 4WFNL 4BR9A 4CEOA 1B9DA 3U3YA 3O9RA 5HRNA 3KLIA 4TSXA 3OYDA 1WB9A 4MDBA 2YX6A 3ULDA 4AHCA 4DR7K 3WNGA 3IS9A 3LZIA 2P9IA 4KKOA 4ZTFA 5C42A 1V4TA 3DI6A 2BDPA 1TK5A 4KHSA 4DTSA 3WXJA 5AQRA 3T1AA 3VGLA 3K9JA 3AA4A 3B8AX 5C2DA 5AQYA 2KW4A 1N5YA 3AVHA 3BY5A 3JAMO 4Z0UA 4Z4GA 3QBXA 3CCVN 3TARA 4CEAA 5FDLA 2NRTA 3WXMB 1HLUA 1IJJA 1NLVA 3VEVA 4A2BA 4IO9L 4RW4A 4KHUA 3LP0A 4CF8A 3IRXA 2I7PA 4CGGA 3NVKA 4FLZA 3VGKA 3OYLA 3LL3A 5AQSA 5FPMA 1LWEA 2QK9A 1TYQB 1WSEA 1NOYA 4KBOA 4CJWA 3ZX2A 1JLEA 3HPHA 1T7PA 2ZGZA 1NK8A 4JN4A 3A5OC 4BG9A 2ZJQL 1NG9A 2DPNA 2Q2RA 3M8SA 3F2KA 3CPWM 4GKKK 4IOCL 1RT3A 2UXCK 4NB4A 3EKSA 2O8DA 4Z4CA 4U67L 3F9KA 1OH7A 3WT0A 3THYB 3TU5A 4GVEA 1EQYA 1U2VA 3CC7N 3AVIA 4OX9K 4HCCA 5KI6A 3DOKA 4IG3A 4PKIA 4BRHA 4LSLA 1XMQK 4FYDA 1LWFA 4MFBA 3V6DA 1CLQA 4DTXA 2EWSA 2RF2A 2QWRA 2E2NA 4F3OA 3RTVA 3BP8A 4DTNA 4DSKA 4BWMA 2FBXA 1DT9A 2XO7A 3OY9A 5AZJA 3HVTA 3H1QA 4FLUA 1NKCA 2G8WA 2A5XA 5CYMA 2OPPA 5BPNA 2FXUA 2KHOA 2VG5A 3C7NB 4CJ5A 1BIUA 1VAZA 4OJRA 3TR8A 5E41A 4JV5K 3QICA 4EZ6A 2VYPA 1H1VA 1SV5A 4B08A 1SL1A 2QXLA 3HJFA 4GVMA 3OYMA 2X78A 1Q81O 2HW3A 5ADXA 4BVPA 4FLYA 3A0IX 4JKBA 5AQHA 1WBBA 2OA8A 4YNQA 3VQ9A 3E1YA 2NNWA 4M7XA 3AO2A 4KB0A 1W7AA 1KFDA 4JYAK 1A5XA 5HL7L 4W5QA 5J2NA 3RMCA 3M8PA 2D0AA 1VSMA 5FLXO 2ZJPL 1T3VA 2LSNA 3TANA 3DMJA 4LY7A 1VQ8N 1KSPA 1BO5O 4KV8A 4CIEA 2QWMA 2P9IB 3I56N 1ESVA 4BY9C 4DTUA 2UYTA 3ATVA 1W9HA 3P39A 2Z1HA 2OYQA 1JXEA 1RDCA 4EHTA 2E4LA 4WQ5A 1HYVA 3FZLA 3ZSOA 2QA4N 3RRGA 3SLCA 4H0VB 3T7ZA 5BR9A 4DS4A 1LCUA 1NJZA 1GLLO 3BDPA 3VTHA 2O8BA 4DLEA 4KH5A 3ZSXA 1LWCA 2D5RA 2HB5A 1S6QA 4ELTA 4BGBA 4CFCA 4U7BA 3AVLA 4Q5VA 3TTDA 4E7KA 4C8NA 3NDKA 3MXMA 2D4WA 1YTAA 2NRVA 3AVMA 1KVCA 2P9NA 3BZCA 4CD1A 4CIFA 1BCMA 2YNGA 1S22A 1YVNA 4CJVA 3CJ7A 1NGGA 1J54A 2I5JA 1JKHA 3WQTA 2P9LA 5AQLA 4LD0A 2W41A 2RN2A 4KHWA 3O3GA 1U2VB 3RR8A 2IIRA 4FWNA 3O8MA 1BL3A 1HKCA 1RT2A 4E1NA 2E6MA 3J7YP 1X3MA 3CQ8A 3L8BA 1GOCA 1T6CA 4HUFA 2E1ZA 1X9SA 2BUPA 2CGJA 4O5FA 3EYZA 2PBDA 1NK0A 4I6MA 3KVGA 3HK2A 3G0ZA 4YOYA 3Q7BA 4DFPA 4B3MK 5M1OA 3CQYA 4JI4K 5AZJB 3SBGA 4ISFA 3MEDA 1E4GT 4WQ5C 1ATNA 2KTQA 4JI2K 1VSDA 4BC3A 4JNEA 5CZ2A 3VPZA 4K25A 3SZ2A 2D0BA 2P5OA 3VMFB 4AM6A 5FRNA 2QWQA 3CCQN 1KQSM 3CC2N 1BISA 4FLVA 3IDHA 4A5AA 1VQ9N 4AH9A 3G10A 3CJBA 4A59A 4FWSA 4DR4K 3OYBA 4KTQA 3QFUA 1J9AA 1OVQA 4E7JA 5JVHL 3V9WA 3SQ1A 4PUOA 4FSVA 1TKZA 2RHKA 3QIPA 3A8YA 1HQEA 3EL2A 4CJRA 2QW9A 3CCUN 2GUPA 2A1RA 5GAGP 4O8UA 2HSTA 1XMOK 5AR0A 3GOIA 1S1TA 3MECA 3C6TA 3VF2A 3UKUB 2Q0RA 3TAMA 2F4VK 3V1RA 3KTQA 3V1QA 1MDUB 4E89A 4DV0K 2O8BB 2ZD1A 2IDOA 4M63C 1T8EA 4LFBK 4DMNA 4FJJA 4FVMA 4PA1A 4FJ5A 1GOAA 1TL1A 1IKVA 1S72N 1ZBLA 4FW2A 1NGDA 3OYHA 3CFOA 2HMPA 1IH7A 5AJ3K 4CJFA 1X9WA 4M3WA 3TAEA 2P9NB 3KKRA 1KVBA 4MQ3A 3M8RA 3AO5A 3AV9A 3G71N 4YOWA 3J8AA 2ZE2A 5E84A 1BOTO 3KZBA 3R1XA 2NRHA 1SUQA 2E2OA 3CYMA 2IC3A 3AVAA 2E6LA 1U49A 2P9LB 2IGIA 3QETA 5KPZA 3D0PA 3V9UA 4WQ4A 4CEDA 2G8KA 3VQ6A 4FJKA 1WN7A 2X74A 1VRUA 4N47A 1FKPA 1XNRK 1J5OA 3FZFA 4IEEA 2A41A 4E7HA 1KAZA 1G15A 4C8KA 3DLGA 5AQQA 3OYIA 4I6MB 4MO4A 4OVLA 3TAFA 1RT7A 1U04A 4YDUA 5LJWA 2F8TA 3MWPA 3S9HA 3MEEA 5KGXA 1OKJA 4Y1DA 1ATRA 1S9GA 2F8SA 2QEXN 2OCEA 1BCOA 1N34K 1UOCA 2GV9A 1VSFA 3S3NA 1Q7YO 3JS6A 5AQUA 3CCSN 4W5OA 1RBTA 4B1VA 3LANA 3FE1A 5JS1A 3O9SA 2Y1IA 2NZTA 1DGKN 5DK5A 5JVGL 5BN9A 4NO7A 1Z25A 3TABA 5AFUA 2HBKA 4BC5A 4GY2B 3OS2A 3ENHA 1RDDA 2BGGA 1D9FA 1DEJA 2KLAA 1RBRA 2FBYA 2P9UB 2QI2A 4KTWA 3QEXA 4BRDA 1SS6A 3SQ0A 1BHLA 4H5WA 2GTDA 3FZMA 4RTFD 3T19A 1WBDA 5KQDA 2YHBA 4FK4A 4JHDA 3SUOA 3HM9A 3VN5A 3J81O 1NNEA 4GV6A 1WLJA 1KC8O 1JXBA 1K8KA 4BR2A 3B6OA 3RMDA 4X66K 3WEEA 4DV3K 2NRRA 2CH5A 4RG8A 4DU4A 3ZETA 3SUPA 2P5GA 1Q8IA 3D7EO 4CFDA 2EHGA 4WQ4C 3A2FA 4IOAL 4QCLA 1TYQA 2YI1A 3GBTA 3H1VX 3T1YK 2Z1GA 3SBTA 3KK7A 1K9MO 1ITGA 5LL6Z 3WXLA 1BQNA 5EU7A 3TTCA 3VERA 3TAQA 4DSFA 4B9QA 1JLQA 4DSEA 4E19A 2JWLA 4KH6A 4IDHA 3O9UA 1L3TA 4BGAA 5F2RA 4JK8A 4EAHD 1J53A 5CR4A 1VQON 2VG6A 5EVZA 4M41A 3GG4A 4CZJA 2P9KA 4JD2A 4DR5K 5CY4A 3LWMA 1HMVA 3E9LA 3D2FA 3ZCMA 4F8RA 3OVNA 1Y97A 3AO1A 3LPUA 4CF2A 3F5TA 1O13A 4YORA 3SQ4A 3WQUA 3P5JA 1DTTA 1FJGK 2VWBA 5I9EB 4H0OA 1C0TA 2E2PA 2PYJA 3LDQA 5SWMA 2UUCK 2FF3B 5AZIA 4XIUA 3AARA 4JI6K 1BQMA 1NGJA 2P9SA 3EY1A 4IFVA 1YIJN 4GV3A 4HTUA 2ZM6K 1T44A 1NMNA 1Q86O 4XH1A 3QEPA 4DWIA 4KHQA 1P8ZA 3RRHA 1VSHA 1KXPA 3HPOA 4ILJA 4EP5A 3DLHA 4DUYK 4KPYA 2HHUA 1Q9YA 4ILGB 3M8QA 1XC9A 4CECA 2YKNA 2PZSA 1SKSA 1C0FA 4F3TA 3GL1A 4DV4K 1HNZK 1HNVA 4CF0A 4EP4A 3WXIA 4CE9A 1YT3A 5DM6L 3NAEA 1OH5A 1MWMA 1EWQA 3RR7A 3ULEB 1U4BA 4B3TK 3QIOA 4OGCA 4BDZA 3LALA 4BRNA 4K0KK 1RFQA 3QDKA 2YNIA 4NYNA 5JLFA 2VGNA 5GADP 2UXDK 4JKAA 4H0YB 1QHAA 4DU1A 3S3MA 1VQPN 4H4OA 4EFHA 2QWLA 4DSIA 5HOOA 2D0CA 2QWPA 3AO4A 4F2RA 4HCBA 5C0YA 3H6EA 5FPEA 4C8MA 2YNHA 2XHBA 5AQGA 4RCHA 4CJ4A 2D0PA 3U6FA 2KQ2A 3V1OA 3NFAA 4KH4A 4DFMA 2D0OA 5HP1A 1NM1A 2E1YA 2O8CA 2Z1JA 4FLTA 4WFBL 4JHDB 2UUAK 5IWAK 3HRGA 4CD3A 3NH1A 4E1JA 5F0XA 2X6SA 5KPRA 3EEQA 4AILC 3SPZA 1K8KB 1TK0A 2WUSA 3WEEB 4WCEL 2BE2A 3ZETB 3U9ZA 1N33K 3TPQA 3DWLA 3QEVA 2JGUA 1RNHA 1C1CA 3ITHA 4CBXA 1UA0A 2J4RA 3BF3A 5J2MA 4DHYA 4CFAA 1SL2A 4RW7A 3U3GA 1A5VA 4E7LA 1YF5L 4B1UB 4EIAA 1FW6A 2O8EA 3VQ7A 4AHVA 5I3UA 3NHGA 3BUZB 4C8LA 3K5MA 1HKGA 4W5RA 1CZ9A 1HNIA 4DG1A 5J1EA 2HVHA 5FROA 2HHVA 3CCRN 3WUHA 4BRKA 1NGFA 5LMNK 3IAYA 4M3YA 3TSQA 4KRFA 4X64K 4BRMA 3FLCO 4BR5A 3CCEN 1QS4A 1RCHA 3C0BA 5HROA 4R79A 3ZT2A 3OBWA 1OH6A 1GLDG 3OYJA 2P9KB 4JD2B 3L2UA 1RBUA 3AO3A 4E7IA 3FGUA 2DFFA 1NGIA 5C24A 4N56A 3D2FB 1ZBIA 3BF1A 1TL3A 1YHQN 2YHWA 4NLBA 1HUXA 3SQ2A 3PX4A 4M3ZA 4Q0BA 1XHXA 5E26A 1NJIO 4H0XB 1SKWA 3PLAA 5AQIA 4MO5A 3QB0A 4N5SA 2OPRA 3EN9A 4BRFA 5AZIB 2WONA 2P9SB 4MDAA 3TSUA 4UQGA 4CHPA 4OKEA 5EOYA 3QLHA 3K57A 2GX9A 4OLBA 3W0LA 4Z4EA 1TGOA 4H4MA 1RILA 1BA1A 1U48A 1VSIA 3ZT1A 3IKMA 3P38A 4A2AA 4MLEA 4J2DA 2O4GA 3LAKA 3VQQA 5M1FA 1B9FA 3PO4A 5BRFA 5CZ1A 1NMDA 2WBNA 2QXFA 3VA3A 3LM9A 4JKGA 1TAUA 2IVPA 3RSEA 1CXQA 1RTIA 1X9JA 4M7YA 1Z05A 3C95A 2G8VA 1D5AA 3LP1A 1VQKN 3MK6A 3SV4A 4ELUA 4CZLA 5H1SQ 2ASOA 4E1MA 1ZYQA 3NGIA 4BE0A 5AQFA 3UIQA 1WNSA 1S3XA 3A5LC 4LH4A 1RBSA 1NGHA 1KRPA 3ZEUA 1TKDA 4PWDA 4Y0WA 2O8CB 3UKUA 4YOXA 3I33A 4A5BA 4FOIA 4IBNA 1LW2A 4XEIA 3PY8A 4HHTA 4ILHA 4B9SA 3OBYA 2NRWA 1JLAA 3THVA 3F73A 4CGJA 2CGKA 3AGKA 5HBMA 4DF8A 4WFAL 2NRXA 5BR8K 1N32K 4PY5A 2O8EB 2RE2A 1BGXT 3CJAA 3OYKA 1ATSA 1U47A 3MAQA 1GLEG 3S41A 1Y64A 3CM6A 3DXKA 3KK1A 3L2WA 4CGHA 3THXA 3CCJN 1NK5A 2Q36A 3C6UA 4FOEA 2O4IA 4K43A 2YHYA 5CYQA 2VWKA 3VEXA 5GAEP 1XI1A 3PIOL 1QVFM 1WOQA 4DR6K 3DRRA 5SZTA 3VF4A 1UA1A 4DQPA 3ENOA 3M5RA 4B1ZA 3QEIA 4DTPA 4IWVA 5C10A 1NGBA 2B5JA 4DCHA 3K0SA 2HHQA 1RDUA 4FZXC 1EKEA 3KWGA 2B6AA 1X9MA 2QWNA 3KLEA 4BG8A 1S6PA 3CCMN 4LF5K 2HBJA 2HHHK 3LM2A 4I9LA 4BQZA 4DTOA 1S1VA 2F9WA 3PIPL 2Y1JA 2ZQBA 4DR3K 1QSYA 3H46O 4IFEA 4IJNA 2XY6A 3FZHA 3PUFA 3WNFA 1NK9A 1IKXA 3BZKA 4NXMK 3K5OA 4NXNK
chains in the Genus database with same CATH topology
1E4FT 3P4IA 5AQVA 4H5TA 5JVGL 2ZF5O 2P9UA 2WC9A 4NO7A 5BN9A 1X3NA 3HOTA 4WFNL 4Z94A 4JKGB 5AFUA 4BR9A 2HBKA 4BC5A 4GY2B 5FPNA 3RSEB 4AF1A 3ENHA 3TSPA 1QQOA 3D2EA 4CZFA 3MN7A 3H3NO 3O9RA 1DEJA 3O80A 4H0PA 2KLAA 5ADXH 2P9UB 2QI2A 3E9PA 2YX6A 4MDBA 5TKYA 4CI6A 5C12A 1VQMN 3CMEN 4BRDA 1SS6A 3IMXA 4H5WA 2P9IA 3KHYA 3AAPA 3J7ZO 2E2QA 3AGRA 2GTDA 2VGMA 3SK3A 1V4TA 2VCPA 3FZMA 4RTFD 1BDGA 3MDQA 5KQDA 2AP1A 2QWOA 3WXJA 1XC3A 4C23A 4JHDA 5AQRA 3VGLA 3HBTA 3K9JA 5KQ8A 4IEIA 4GV6A 3B8AX 3ZEUB 1GLJO 1KC8O 5C2DA 3K9KA 1K8KA 1NGEA 4BR2A 1W2BM 3ZX3A 1VQ7N 1WUAA 3WEEA 5EY4A 2NRRA 2CH5A 3CXCM 5AQYA 3ZETA 3MMVA 4BRAA 4HTLA 3EE9A 5AQOA 3D7EO 3R6MA 1NGCA 3QBXA 4WQ4C 1KD1O 3CCVN 2PFUA 4IOAL 2NRTA 3WXMB 1HLUA 1TYQA 2YI1A 5LY3A 5M1NA 3GBTA 2A6AA 3H1VX 1IJJA 3SBTA 5MLCQ 1NLVA 3VEVA 4A2BA 4IO9L 2HBLA 4K41A 3KK7A 3SAFA 1K9MO 5DM7L 2NRZA 2I7PA 3WXLA 2A3ZA 3R8EA 3TTCA 3ID8A 3VERA 4YOVA 3NVKA 3FR0A 4B9QA 3VGKA 3LL3A 5AQSA 5FPMA 4BREA 1TYQB 2GWJA 2JWLA 4KH6A 1TUYA 4FPBA 3O9UA 4IDHA 4JKDA 4KBOA 3ZX2A 5BRHA 2ZGZA 4FPAA 4BGAA 4JN4A 3A5OC 4JKCA 5F2RA 4JK8A 2DPNA 2Q2RA 5AQPA 4BG9A 3F2KA 4CBUA 3CMAN 3CPWM 4EAHD 5CR4A 5B8HA 4IOCL 3LDOA 1VQON 5EVZA 1XUPO 4PKGA 3GG4A 4NB4A 4CZJA 3EKSA 2P9KA 4JD2A 3O4WA 4GV9A 3DXKB 4FO0A 3O9TA 3U9DA 4XH4A 3R9PA 4U67L 3N4QA 2CH6A 3VTIA 3WT0A 3TU5A 3E9LA 4GVEA 3D2FA 4JKFA 3CF5L 1EQYA 1Z6RA 3VOVA 1U2VA 4QS8A 4H03B 1MWKA 3F5TA 4B1WB 3CC7N 1O13A 4YORA 1M1KO 3SMSA 2E88A 4IO8A 3WQUA 2VWBA 5I9EB 4H0OA 4PKIA 2E2PA 4BRHA 3LDQA 4QS7A 3L4IA 2FF3B 5AZIA 2ASMA 3M3ZA 4CZMA 3AARA 4BRPA 2V51B 4CZKA 2P9SA 2EWSA 1NGJA 1YIJN 2QWRA 2E2NA 4GV3A 2H3GX 5AQWA 3BP8A 1C0GA 4C1NI 1T44A 2ASPA 1Q86O 4XH1A 1R59O 1ZC6A 5C15A 2OTLN 1DT9A 1P8ZA 4BRQA 5AZJA 1KXPA 4K42A 4ILJA 3L6QA 1QZ6A 3H1QA 4XH5A 2A5XA 3DXMB 4ILGB 3R3LA 2FXUA 2KHOA 5BPNA 3ULEA 4FL9A 1C0FA 3CJ9A 3C7NB 1VAZA 2IVNA 3GL1A 3QICA 2VYPA 1H1VA 3WXIA 3P31A 5AQTA 3T69A 4BROA 2HBMA 2QXLA 5DM6L 1TUUA 3QBWA 4ISGA 3VF6A 1MWMA 3LDPA 3ULEB 1Q81O 1GLAG 4BC2A 3HTVA 4FWKA 4BVPA 5ADXA 4BRNA 1RFQA 1Q18A 3A0IX 3QDKA 1W97L 4JKBA 5AQHA 3M6GA 2VGNA 5JLFA 3U4LA 5GADP 3E1YA 3C6AA 4H0TB 4JKAA 4H0YB 4H5NA 1QHAA 2NNWA 4M7XA 3VETA 1VQPN 3E66A 4EFHA 2QWLA 3UKRA 1BWFO 3LDLA 1RDWX 5HOOA 2QWPA 5HL7L 3D2EB 4WYBA 3SAHA 3HOSA 3AY9A 5C0YA 3H6EA 5FPEA 1D4XA 5JICA 1T3VA 2ZJPL 3I55N 3O9QA 5JMVA 3MWTA 5AQGA 4RCHA 3LDNA 3I8BA 1BO5O 4PHTX 4FWPA 3UKRB 1HJOA 3VEZA 2QWMA 3MN9A 2D0PA 2P9IB 4UY8O 3I56N 3VENA 1HPMA 2QM1A 4KH4A 1ESVA 4BY9C 2UYTA 3ATVA 3P39A 2D0OA 1NM1A 2E1YA 1NGAA 3CERA 3CI5A 4WFBL 4JHDB 3KWIA 4EHTA 3HRGA 2ZJRL 4CD3A 1YJNN 1GLBG 4WQ5A 3FZLA 3MCAB 4E1JA 5F0XA 3D6RA 5KPRA 5AQKA 2QA4N 1K8KB 3SLCA 3UB5A 2WUSA 3ENBA 3WEEB 4H0VB 3T7ZA 4WCEL 5BR9A 4JEPA 1VQNN 3ZETB 1LCUA 1KAYA 1GLLO 4H5VA 3TPQA 3DWLA 3U9ZA 4BR7A 4CBXA 1K73O 2J4RA 3VTHA 3BF3A 5GIOA 4DHYA 4CJ7A 4KH5A 4C1NK 1SQKA 1YF5L 4H5RA 4DQ8A 2Q97A 4B1UB 3ZYYX 4EIAA 2FSNA 1QQMA 3BUZB 4MLHA 4B1XB 4BGBA 4U7BA 3EO3A 1HKGA 2V7ZA 4AM7A 3CETA 2BTFA 4JKEA 2D1KA 3TTDA 4CBWA 4IZ9A 3CCRN 5AQMA 3WUHA 4BRKA 1NGFA 3MN6A 2PAVA 3IUCA 3O5BA 3BEXA 3TSQA 3O08A 2D4WA 4BRMA 3HM8A 3FLCO 2NRVA 4BR5A 5BN8A 5BRDA 1VQ5N 2FSKA 4CZEA 3CCEN 1MA9B 3MCPA 3L0QA 3C0BA 2P9NA 2AA4A 4A62A 4NLCA 4R79A 4O8KA 1YI2N 4CD1A 3OBWA 4FWOA 1GLDG 4IXCA 3VGMA 5GIPA 2ZGYA 4BVOA 1S22A 1YVNA 1T6DA 2P9KB 4JD2B 4L3QA 3UE5A 4DB3A 3G4SN 3CJ7A 1NGGA 3FGUA 3WQTA 1NGIA 2P9LA 2ITMA 5AQLA 2GEMA 1SZ2A 2W41A 5BPLA 3D2FB 3BF1A 1U2VB 1P90A 1YHQN 1HKBA 4GNIA 2YHWA 2IIRA 1HUXA 4FWNA 2F7TA 4NLBA 3L4QA 2HF3A 2OANA 3EKUA 3FFKB 2P9PA 3O8MA 5BREA 5E26A 1NJIO 3W3DA 4H0XB 3PLAA 1HKCA 2IVOA 5AQIA 4MO5A 4BRLA 5CHIA 3IFRA 3RVCA 3QB0A 1X3MA 3E9OA 4ISEA 1VQLN 1T6CA 3EN9A 2E1ZA 5GINA 1NWKA 4BRFA 5AZIB 2BUPA 2CGJA 4O5FA 2W40A 2PBDA 5CE3A 1JCGA 3KVGA 4I6MA 2P9SB 2E20A 4MDAA 2NLXA 2OTJN 4CZGA 3TSUA 2YCHA 4YOYA 5EOYA 2BH1A 2YJEA 3Q7BA 5M1OA 3CQYA 1GLFO 5AZJB 3SBGA 4B1YB 2GX9A 4OPAA 3W0LA 4ISFA 3H3OB 1E4GT 4WQ5C 1BA1A 1EO1A 2FF6A 2Q0UA 1ATNA 3IKMA 2YHXA 3P38A 3VESA 4FWQA 4A2AA 2KKZA 2Q1NA 4MLEA 5AQXA 1YJWN 4BC3A 4JNEA 5BPMA 3VPZA 2FSJA 4RWTA 3CC4N 4HWIA 5M1PA 4K25A 3F9MA 1V4SA 5M1FA 1ZXOA 5BRFA 1NMDA 2HF4A 3DAWA 2WBNA 3VMFB 3WXKA 4AM6A 4WF9L 3CD6N 3LM9A 2QWQA 4JKGA 3CCQN 1KQSM 3CC2N 2IVPA 3C65A 3QMLA 3HSCA 3RSEA 3IDHA 3Q7CA 1X9JA 4PKHA 3CCLN 3N4PA 4A5AA 2A40A 4M7YA 4FVUA 1IG8A 1VQ9N 5GAHP 1KAXA 3MX5A 1Z05A 3CJBA 4A59A 1DKGD 4FWSA 5EXWA 3QFUA 4YOUA 5F1XA 2ZWHA 4FWRA 3SAGA 1VQKN 3MK6A 5TKWA 4CZLA 1K8AO 3G25A 5JVHL 5H1SQ 1J6ZA 2F9TA 5AFUH 4CZIA 2ASOA 3O6WA 1LOTB 3VEOA 1G99A 3A5MC 1QVGM 5KPTA 1QQNA 3MX2A 3CIPA 5AQFA 4FSVA 1S3XA 2RHKA 3A5LC 1YXQA 5M1KA 1NGHA 1QZ5A 2GELA 3ZEUA 4OPHA 3A8YA 1ILYA 1JCEA 3EL2A 1HX1A 2WFBA 3CJCA 2QW9A 3CCUN 4Y0WA 2GUPA 3OA9A 3DLLL 3GE1A 3U8XA 1BUPA 3UKUA 1XQSC 4BQLA 1YUWA 4YOXA 3GDQA 4IJAA 3I33A 4JK9A 3EZWA 4A61A 3VEYA 3FZKA 4A5BA 5GAGP 4FOIA 2HSTA 3CJ1A 4JAXA 4O8UA 5C2FA 4XEIA 2CGLA 5AR0A 3GOIA 4YOTA 1SAZA 3CPEA 5AQZA 3CQXA 4ILHA 4J8FA 3VF2A 3UKUB 2V52B 5ELZA 2Q0RA 5EX5A 4FWMA 3OBYA 2NRWA 2E8AA 3SJHA 4JK7A 1MDUB 1GLCG 4PL7A 2CGKA 3AGKA 3SMPA 4M63C 1BG3A 2JWKA 4WFAL 2NRXA 4PL8A 5AQNA 1N8RO 1JJ2M 2RE2A 3CJAA 3O1BA 1S72N 1BU6O 1NGDA 1ATSA 3QFPA 4QS9A 3C6HA 4BR0A 4YDUC 3VEWA 1GLEG 2HMPA 4FWLA 3S41A 1Y64A 3ZX0A 4LC9B 3DXKA 4A57A 3H45C 2YJFA 1JCFA 3CCJN 2A42A 2Q36A 2Q31A 2QTDA 4FOEA 2P9NB 4IOXA 4K43A 3O1WA 3G71N 4EHUA 4YOWA 2YHYA 3HZ6A 3AAQA 3J8AA 5E84A 1BOTO 3KZBA 3R1XA 1NBWA 2ZJQL 1VQ8N 2FLOA 1U6ZA 2NRHA 3VEXA 5GAEP 1YAGA 2E2OA 3PIOL 3NVMA 1QVFM 1WOQA 2P9LB 4BRCA 4G9ZA 1VQ6N 4DKWA 3VF4A 3MN5A 5KPZA 4OO1J 4CZHA 3ENOA 3JXUA 1VQ4N 3M5RA 4B1ZA 5JLHA 1ZBSA 4IWVA 4WQ4A 2GWKA 2P9PB 5C10A 5LJVA 1NGBA 3HI0A 4DCHA 3ID6A 4BRIA 3OW2M 3FZFA 4IEEA 2A41A 1RDUA 5AQJA 3KWGA 1KAZA 2QWNA 4BR4A 5FPDA 4BG8A 2HOEA 5AQQA 2I7NA 4I6MB 5M1QA 4MO4A 4JKHA 3DXMA 2HBJA 4BC4A 3CCMN 4YDUA 3CHWA 5LJWA 1CZAN 3LM2A 3MWPA 1M90O 4F9OA 4BQZA 1Q82O 2F9WA 3C7NA 1OKJA 3PIPL 3EE8A 1RGIA 1YJ9N 3A5NC 1ATRA 3H46O 4IFEA 4IJNA 3DJCA 2QEXN 3FZHA 2V7YA 3G6EN 1YITN 3NMUA 3OHRA 1Q7YO 3JS6A 3TTFA 5AQUA 3CCSN 1BA0A 4B1VA 3FE1A 3M1FA 3ATUA 3O9SA 2NZTA 4BRGA 1OVYA 1DGKN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R79 A;  4U7B A;  4MDA A;  4MDB A;  5HOO A;  3HOT A;  3HOS A;  3F2K A;  3K9K A;  5CR4 A;  2F7T A;  3K9J A; 
#chains in the Genus database with same CATH topology
 1EWR A;  4AHT A;  1LAW A;  3L2R A;  4BE2 A;  2P9U A;  4QAG A;  4NCG A;  4JKG B;  1KLN A;  4KB1 A;  3RSE B;  3RWU A;  4DTJ A;  1S9E A;  4CZF A;  3MN7 A;  4LF8 K;  1Z26 A;  5A2Q O;  3E9P A;  4CI6 A;  5C12 A;  3CME N;  1RDA A;  3IMX A;  3OJS A;  4CIG A;  3KHY A;  3SPY A;  2E2Q A;  3AGR A;  2VGM A;  2FBT A;  4LH5 A;  1L3S A;  1D8Y A;  2VCP A;  1X1P A;  3AA2 A;  3MDQ A;  3OYF A;  2AP1 A;  3AVF A;  2QWO A;  2X6N A;  1XC3 A;  4O5B A;  4C23 A;  1NOZ A;  3SI6 A;  4CHZ A;  1NJY A;  3HBT A;  5KQ8 A;  4IEI A;  4FM0 A;  3MXI A;  1B92 A;  4CJK A;  4IFY A;  3ZEU B;  1GLJ O;  3K9K A;  1NGE A;  1RDB A;  4KHY A;  1W2B M;  1CXU A;  1WUA A;  2IS3 A;  3K2P A;  4J2E A;  4BRA A;  3MMV A;  4Z4F A;  4HTL A;  3EE9 A;  5AQO A;  3DLK A;  3R6M A;  1NGC A;  1KD1 O;  2PFU A;  4FXD A;  1JLB A;  1IKY A;  4KO0 A;  4RW6 A;  2YHA A;  5MLC Q;  4FW1 A;  2HNZ A;  3SAF A;  1TAQ A;  3VQB A;  5DM7 L;  3VQ4 A;  3R8E A;  3ID8 A;  4YOV A;  3FR0 A;  4BRE A;  4FPB A;  5BRH A;  3AVC A;  4FPA A;  2DTU A;  1WSF A;  3DOL A;  4JKC A;  1XWL A;  3NGZ A;  4DV6 K;  3LDO A;  2QKK A;  4JI1 K;  3HVR A;  1XUP O;  4GMJ B;  3P83 D;  2O8F A;  4DQI A;  1RT1 A;  3DXK B;  4FO0 A;  3O9T A;  3U9D A;  3R9P A;  4CHN A;  4FLX A;  3V4I A;  3THX B;  2CH6 A;  4JKF A;  4H8K A;  3ZSZ A;  3VOV A;  4QS8 A;  3V9Z A;  4EZ9 A;  4H03 B;  2UXB K;  4B1W B;  3V9S A;  1BI4 A;  1O1W A;  3LWL A;  1M1K O;  3SMS A;  4KHP K;  4IO8 A;  4B8C A;  3VA0 A;  3WNH A;  4QS7 A;  3KLF A;  3L4I A;  4CGD A;  4PQU A;  1ASV A;  4CF1 A;  2V51 B;  3I0R A;  3CG7 A;  3LZJ A;  2H3G X;  2BAN A;  4CW7 B;  4C1N I;  4CGI A;  1R59 O;  4GKJ K;  5C15 A;  2OTL N;  3WNE A;  3K58 A;  4K42 A;  4KRE A;  1VK0 A;  3L6Q A;  3KLH A;  2RPI A;  4XH5 A;  5JS2 A;  4B9T A;  3T3F A;  3R3L A;  4HUG A;  3ULE A;  3CJ9 A;  4BDP A;  3SYZ A;  1W0H A;  2IVN A;  1YVU A;  3T69 A;  2HBM A;  1TUU A;  4OKK A;  3VF6 A;  3LDP A;  2IOC A;  4CJT A;  4B9L A;  4BC2 A;  4FWK A;  1W97 L;  3MEG A;  3P1G A;  3M6G A;  4H0T B;  3SV3 A;  4H5N A;  3VET A;  3E66 A;  1HNW K;  3NBP A;  3NH2 A;  3KLG A;  1J5E K;  2HMI A;  1RDW X;  4YFU A;  4RW8 A;  2KFN A;  4WYB A;  3HOS A;  1I94 K;  2FC0 A;  1JLG A;  3HT3 A;  4FM1 A;  1D4X A;  5JIC A;  1ZBU A;  3I55 N;  3HYF A;  4W5N A;  3LDN A;  3UKR B;  1HJO A;  1JL2 A;  2VQF K;  3MN9 A;  4OGE A;  2QM1 A;  4CHO A;  1T05 A;  1IBL K;  5IT9 O;  4B9M A;  1NJX A;  3CI5 A;  1HYZ A;  3KWI A;  3LP2 A;  4FK0 A;  3CM5 A;  1GLB G;  4FZY A;  4WE1 A;  3D6R A;  1TV6 A;  1WSH A;  4CJQ A;  1RTH A;  1VSE A;  1WSG A;  2QKB A;  3UB5 A;  1WAF A;  1QTM A;  4CGF A;  4JEP A;  1VQN N;  4HUE A;  2B4J A;  4FCY A;  4JI7 K;  1DTQ A;  1K73 O;  5GIO A;  4CJ7 A;  4DQ8 A;  4DQS A;  2FSN A;  1VHX A;  3NF7 A;  1QQM A;  2OPQ A;  4MLH A;  4B1X B;  3EO3 A;  3OS0 A;  3CET A;  2BTF A;  3HP6 A;  2AJQ A;  4CK3 A;  4IZ9 A;  5AQM A;  1NJW A;  2PAV A;  3IUC A;  4AHU A;  3HM8 A;  4M42 A;  5BRD A;  3OYG A;  3V9X A;  1VQ5 N;  2FSK A;  4OLA A;  4DR2 K;  3MCP A;  3L0Q A;  2AA4 A;  4NLC A;  1YI2 N;  4O8K A;  2E5L K;  3OJU A;  4IXC A;  5GIP A;  2O8F B;  3G4S N;  5C25 A;  3OYE A;  1GOB A;  1QSL A;  1SZ2 A;  1HQU A;  2DFH A;  2W6L A;  3QNN A;  1P90 A;  3T1H K;  2VG7 A;  5KRS A;  4KHN A;  2F7T A;  3L4Q A;  1BI4 B;  5BRE A;  2P9P A;  4JRQ A;  2IVO A;  4BRL A;  3IFR A;  4BE1 A;  1VQL N;  1NWK A;  1Q9X A;  1FXX A;  4Z4I A;  2W40 A;  3HP9 A;  5CE3 A;  1JCG A;  4DV7 K;  1RT4 A;  3KK2 A;  3K59 A;  2XY5 A;  3LAM A;  3TAG A;  1N6Q A;  4O0J A;  1VSK A;  4V19 S;  2BH1 A;  3VQ8 A;  4FJM A;  1GLF O;  3DLE A;  4OPA A;  2XY7 A;  2OZS A;  3H3O B;  2HNY A;  3ZLJ A;  4Y1C A;  1QQC A;  1QHT A;  2F96 A;  4CJL A;  2Q0U A;  4FWQ A;  2KKZ A;  3VQ5 A;  5BPM A;  3CC4 N;  4JI3 K;  4I2P A;  3F9M A;  1V4S A;  3AVB A;  3C94 A;  4E0D A;  4NCA A;  4WF9 L;  3CD6 N;  2OPS A;  3C65 A;  1VSJ A;  3QML A;  3HSC A;  3VQD A;  3QES A;  1RTD A;  1L3U A;  3N4P A;  2A40 A;  1IG8 A;  3OYA A;  3CFP A;  1JL1 A;  1DKG D;  5EXW A;  4FJ9 A;  5F1X A;  4ELV A;  2ZWH A;  4FWR A;  1NK7 A;  5TKW A;  1K8A O;  1IBK K;  3DLB A;  5FRM A;  4JRP A;  3NCI A;  4CZI A;  1TKT A;  1LOT B;  2HVI A;  3VEO A;  1G99 A;  1QVG M;  1E3M A;  3CFR A;  2VQE K;  3QEW A;  1QQN A;  3CIP A;  2XRI A;  3DLR A;  1YXQ A;  2GEL A;  4OPH A;  1ILY A;  4DV1 K;  1JCE A;  4IDK A;  1KCF A;  3DYA A;  2WFB A;  3CJC A;  3QIN A;  1R0A A;  1I39 A;  3OA9 A;  3DLL L;  3GE1 A;  1BUP A;  4BQL A;  4IJA A;  4JK9 A;  3EZW A;  3VEY A;  3FZK A;  4N41 A;  2W6K A;  5C2F A;  2CGL A;  4ZHR A;  1SAZ A;  3CPE A;  1UWB A;  5AQZ A;  3CQX A;  4J8F A;  1S1W A;  4I9Q A;  1JLF A;  3SJH A;  4CJ3 A;  4FJL A;  1GLC G;  4PL7 A;  2JWK A;  3ALY A;  5I42 A;  3LP3 A;  4N76 A;  4PL8 A;  5AQN A;  1JJ2 M;  3ZSQ A;  3PO5 A;  1NK6 A;  2WOM A;  4DU3 A;  3THW A;  1OH8 A;  4FJH A;  1KLM A;  3C6H A;  5J2Q A;  5KRT A;  3IG1 A;  4KAZ A;  1ASU A;  3L3V A;  3H45 C;  4DLG A;  1WSI A;  4M3U A;  2QTD A;  3NE6 A;  3BGR A;  4W5T A;  4EHU A;  3HZ6 A;  3AAQ A;  4NYF A;  1NBW A;  1YAG A;  1UAX A;  4DS5 A;  4G9Z A;  4I2Q A;  1ZBH A;  1BIZ A;  1A5W A;  1ZBF A;  1VQ6 N;  4F4K A;  3MN5 A;  1SKR A;  1VQ4 N;  3OYN A;  3PX6 A;  3ZSV A;  2P9P B;  5LJV A;  3J80 O;  3ID6 A;  3OW2 M;  1HR0 K;  2RKI A;  3QO9 A;  4LFC K;  5AQJ A;  3HXM A;  1HJR A;  5FPD A;  2HOE A;  4JI8 K;  5M1Q A;  3DXM A;  1M90 O;  4NCB A;  1L5U A;  4B9V A;  1EXQ A;  4DV2 K;  1YJ9 N;  3A5N C;  1HNX K;  1KVA A;  4YY3 K;  5DMR A;  3SJJ A;  4M3R A;  2EX3 A;  3G6E N;  1YIT N;  3DRS A;  4CEQ A;  1BA0 A;  3M1F A;  3ATU A;  1L3V A;  1S5J A;  4DQR A;  4B3S K;  4CEZ A;  2GUI A;  4YHH K;  1OVY A;  1E4F T;  1TVR A;  4H5T A;  2ZF5 O;  3HOT A;  4Z94 A;  1FKO A;  4DFJ A;  5FPN A;  4AF1 A;  3TSP A;  1QQO A;  3D2E A;  3KKS A;  3H3N O;  3O80 A;  4H0P A;  4LF4 K;  5ADX H;  5TKY A;  4CJU A;  1VQM N;  4CCH A;  2WTU A;  1EX4 A;  4CJP A;  1KTQ A;  4DUZ K;  3AAP A;  3J7Z O;  2FBV A;  3SK3 A;  1BDG A;  3NF6 A;  3NGY A;  2DFE A;  3PSF A;  1LW0 A;  1HPZ A;  4O55 A;  2ETJ A;  4L8R B;  3HST B;  3ZX3 A;  1VQ7 N;  5EY4 A;  2ATQ A;  2G8I A;  3CXC M;  3KD1 E;  1D9D A;  1ASW A;  3AA3 A;  1XNQ K;  2HND A;  3KK3 A;  5LY3 A;  5M1N A;  2A6A A;  4LF9 K;  1I3A A;  2HBL A;  4K41 A;  4OPK A;  3S3O A;  2NRZ A;  2A3Z A;  3E01 A;  4KI6 A;  2HHX A;  3ASM A;  2GWJ A;  3QNO A;  1TUY A;  4JKD A;  3O3H A;  3JSM A;  5AQP A;  1N36 K;  4CBU A;  3CMA N;  4O44 A;  5B8H A;  4KFB A;  3THW B;  1QE1 A;  3AVG A;  4PKG A;  3J7A P;  3O4W A;  4GV9 A;  2PYL A;  4XH4 A;  3O4N A;  3N4Q A;  3VTI A;  1FK9 A;  3LPT A;  4B9N A;  3CF5 L;  1Z6R A;  1S1U A;  1MWK A;  2HHS A;  2O8D B;  3K5L A;  2E88 A;  4JS5 A;  1C1A A;  4R5P A;  3PSI A;  2ASM A;  4LSN A;  3M3Z A;  3O4Q A;  4CZM A;  4BRP A;  4DF4 A;  1K6Y A;  4CZK A;  4RW9 A;  2YV0 X;  5AQW A;  4CEF A;  1C0G A;  3SNN A;  4J2A A;  2ASP A;  1KFS A;  1ZC6 A;  4BRQ A;  2XY8 A;  4OKJ A;  3TWH A;  1QZ6 A;  4CEB A;  3DXM B;  5T7B A;  4K8X A;  4FL9 A;  3I0S A;  2YKM A;  4CFB A;  3P31 A;  5AQT A;  4BRO A;  4ID5 A;  3QBW A;  4CF9 A;  4ISG A;  4FM2 A;  4CJS A;  3OS1 A;  1GLA G;  3HTV A;  1Q18 A;  4CES A;  3U4L A;  3HPG A;  3C6A A;  3NF8 A;  4E3S A;  4DQQ A;  3UKR A;  1BWF O;  3LDL A;  3SCX A;  4CER A;  4CJE A;  3K5N A;  4AQY K;  3D2E B;  3SAH A;  5J2P A;  3H08 A;  3AY9 A;  1C0M A;  1TKX A;  5LMU K;  3VQP A;  4B9U A;  1WSJ A;  1DLO A;  1LAV A;  4X62 K;  3O9Q A;  5JMV A;  3MWT A;  3I8B A;  4PHT X;  4FWP A;  3VEZ A;  4LF6 K;  4JLH A;  4UY8 O;  4IG0 A;  4LFA K;  3VEN A;  4FJ7 A;  1HPM A;  3PX0 A;  3V81 A;  2HHW A;  2UUB K;  2JLE A;  2A1S A;  3TI0 A;  3OYC A;  1C1B A;  1NGA A;  3CER A;  4Z4H A;  2ZJR L;  1YJN N;  3MCA B;  5AQK A;  3HL8 A;  3ZSR A;  3OTO K;  4B8A B;  3ENB A;  3ZSW A;  4CVN E;  4H5V A;  1KAY A;  4BR7 A;  3JYT A;  5K14 A;  4FJI A;  4O0I A;  4C1N K;  4ID1 A;  1SQK A;  4FJ8 A;  3AVJ A;  4H5R A;  2OZM A;  2Q97 A;  1XHZ A;  3ZYY X;  1NK4 A;  1CZB A;  3QER A;  3KJV A;  1VRT A;  1HYS A;  2V7Z A;  4AM7 A;  3VQE A;  4JKE A;  4B3O A;  2D1K A;  4CBW A;  3MN6 A;  2G8U A;  3AVK A;  3O5B A;  3BEX A;  3O08 A;  5BN8 A;  3TAP A;  4CZE A;  1MA9 B;  1S1X A;  3L3U A;  3ISN C;  4CHQ A;  4A62 A;  5HLF A;  3O3F A;  2W42 A;  4I7F A;  4LF7 K;  4FWO A;  1IKW A;  4FLW A;  3VGM A;  1EP4 A;  1HRH A;  2ZGY A;  2ITG A;  4BVO A;  1T6D A;  3UE5 A;  4L3Q A;  4DB3 A;  2DY4 A;  4DV5 K;  1RBV A;  2ITM A;  3ZT4 A;  3ZT3 A;  2GEM A;  3AVN A;  5BPL A;  4DSL A;  4ICL A;  3FFI A;  2IAJ A;  2KZM A;  5HRR A;  3B6P A;  1HKB A;  4GNI A;  4IKF A;  2HF3 A;  2OAN A;  3EKU A;  3FFK B;  3DRP A;  3W3D A;  5CHI A;  3RVC A;  2HHT A;  2VWJ A;  3E9O A;  4ISE A;  5GIN A;  4CK1 A;  1TK8 A;  2E20 A;  2NLX A;  2OTJ N;  4CZG A;  4KTZ A;  4FK2 A;  2YCH A;  3AA5 X;  2YJE A;  4B1Y B;  1IV0 A;  4F2S A;  1EO1 A;  2FF6 A;  3VES A;  2YHX A;  2Q1N A;  5AQX A;  4M45 A;  4CHY A;  1YJW N;  5HRS A;  2FSJ A;  4AHS A;  4RWT A;  4HWI A;  5M1P A;  2UU9 K;  3SUN A;  1SL0 A;  1ZXO A;  1U45 A;  1LV5 A;  2HF4 A;  3DAW A;  5KGW A;  3WXK A;  4BAC A;  4JS4 A;  1NU0 A;  1IG9 A;  3L2V A;  3Q7C A;  4PKH A;  1NKE A;  5KTQ A;  3CCL N;  4M3X A;  1EET A;  1C0U A;  4FVU A;  5GAH P;  1KAX A;  3MX5 A;  1YTU A;  3MXJ A;  4YOU A;  4DR1 K;  3SAG A;  4AHR A;  4JI5 K;  3G25 A;  1J6Z A;  2F9T A;  5AFU H;  3O6W A;  3RMB A;  3A5M C;  4KI4 A;  5KPT A;  3MX2 A;  3PV8 A;  4DTR A;  5M1K A;  1QZ5 A;  2KZZ A;  1HX1 A;  4CK2 A;  2GBZ A;  1IBM K;  2KFZ A;  3U8X A;  3VQA A;  1XQS C;  1YUW A;  3GDQ A;  4A61 A;  4OPJ A;  4JAX A;  3CJ1 A;  2Z1I A;  3KD5 E;  4X65 K;  4YOT A;  3LDS A;  4FZZ A;  2V52 B;  5ELZ A;  5EX5 A;  4DSJ A;  4FWM A;  4B3R K;  5HRP A;  2E8A A;  4JK7 A;  4M3T A;  2P51 A;  4FJN A;  3SMP A;  1BG3 A;  1RT6 A;  4O4G A;  1N8R O;  2Q3S A;  3O1B A;  4QOZ B;  1BU6 O;  2NUB A;  3QFP A;  4BWJ A;  4QS9 A;  4FJG A;  4BR0 A;  4YDU C;  3VEW A;  4FWL A;  3ZX0 A;  4LC9 B;  3RMA A;  4A57 A;  1RT5 A;  2YNF A;  1T03 A;  2YJF A;  1JCF A;  3THY A;  2A42 A;  3NF9 A;  2Q31 A;  3L2Q A;  4IOX A;  4J2B A;  3O1W A;  1WAJ A;  1MU2 A;  4HVJ A;  2FLO A;  1U6Z A;  3ZSY A;  3NVM A;  4BRC A;  4DKW A;  1JLC A;  1QSS A;  4OO1 J;  4CZH A;  3JXU A;  2R7Y A;  5JLH A;  1ZBS A;  2GWK A;  5D3G A;  4JI0 K;  3SUQ A;  3HI0 A;  3DM2 A;  4BRI A;  1VSL A;  1NKB A;  3D45 A;  2P1J A;  4BDY A;  3VQC A;  4BR4 A;  1F21 A;  4C8O A;  2I7N A;  3I8D A;  4JKH A;  4BC4 A;  3CHW A;  1CZA N;  3KIO A;  3ZT0 A;  4GW6 A;  4F9O A;  3HO1 A;  1Q82 O;  3NH0 A;  3C7N A;  4ZTJ A;  3EE8 A;  1RGI A;  1C6V A;  3DJC A;  2PY5 A;  4CEE A;  2V7Y A;  2G8F A;  2G8H A;  3NMU A;  3OHR A;  4FJX A;  1REV A;  3TTF A;  3EZ5 A;  4K8Z A;  1IO2 A;  4DFK A;  4BRG A;  4DTM A;  3P4I A;  4G1Q A;  5AQV A;  1RTJ A;  2WC9 A;  1X3N A;  4WFN L;  4BR9 A;  4CEO A;  1B9D A;  3U3Y A;  3O9R A;  5HRN A;  3KLI A;  4TSX A;  3OYD A;  1WB9 A;  4MDB A;  2YX6 A;  3ULD A;  4AHC A;  4DR7 K;  3WNG A;  3IS9 A;  3LZI A;  2P9I A;  4KKO A;  4ZTF A;  5C42 A;  1V4T A;  3DI6 A;  2BDP A;  1TK5 A;  4KHS A;  4DTS A;  3WXJ A;  5AQR A;  3T1A A;  3VGL A;  3K9J A;  3AA4 A;  3B8A X;  5C2D A;  5AQY A;  2KW4 A;  1N5Y A;  3AVH A;  3BY5 A;  3JAM O;  4Z0U A;  4Z4G A;  3QBX A;  3CCV N;  3TAR A;  4CEA A;  5FDL A;  2NRT A;  3WXM B;  1HLU A;  1IJJ A;  1NLV A;  3VEV A;  4A2B A;  4IO9 L;  4RW4 A;  4KHU A;  3LP0 A;  4CF8 A;  3IRX A;  2I7P A;  4CGG A;  3NVK A;  4FLZ A;  3VGK A;  3OYL A;  3LL3 A;  5AQS A;  5FPM A;  1LWE A;  2QK9 A;  1TYQ B;  1WSE A;  1NOY A;  4KBO A;  4CJW A;  3ZX2 A;  1JLE A;  3HPH A;  1T7P A;  2ZGZ A;  1NK8 A;  4JN4 A;  3A5O C;  4BG9 A;  2ZJQ L;  1NG9 A;  2DPN A;  2Q2R A;  3M8S A;  3F2K A;  3CPW M;  4GKK K;  4IOC L;  1RT3 A;  2UXC K;  4NB4 A;  3EKS A;  2O8D A;  4Z4C A;  4U67 L;  3F9K A;  1OH7 A;  3WT0 A;  3THY B;  3TU5 A;  4GVE A;  1EQY A;  1U2V A;  3CC7 N;  3AVI A;  4OX9 K;  4HCC A;  5KI6 A;  3DOK A;  4IG3 A;  4PKI A;  4BRH A;  4LSL A;  1XMQ K;  4FYD A;  1LWF A;  4MFB A;  3V6D A;  1CLQ A;  4DTX A;  2EWS A;  2RF2 A;  2QWR A;  2E2N A;  4F3O A;  3RTV A;  3BP8 A;  4DTN A;  4DSK A;  4BWM A;  2FBX A;  1DT9 A;  2XO7 A;  3OY9 A;  5AZJ A;  3HVT A;  3H1Q A;  4FLU A;  1NKC A;  2G8W A;  2A5X A;  5CYM A;  2OPP A;  5BPN A;  2FXU A;  2KHO A;  2VG5 A;  3C7N B;  4CJ5 A;  1BIU A;  1VAZ A;  4OJR A;  3TR8 A;  5E41 A;  4JV5 K;  3QIC A;  4EZ6 A;  2VYP A;  1H1V A;  1SV5 A;  4B08 A;  1SL1 A;  2QXL A;  3HJF A;  4GVM A;  3OYM A;  2X78 A;  1Q81 O;  2HW3 A;  5ADX A;  4BVP A;  4FLY A;  3A0I X;  4JKB A;  5AQH A;  1WBB A;  2OA8 A;  4YNQ A;  3VQ9 A;  3E1Y A;  2NNW A;  4M7X A;  3AO2 A;  4KB0 A;  1W7A A;  1KFD A;  4JYA K;  1A5X A;  5HL7 L;  4W5Q A;  5J2N A;  3RMC A;  3M8P A;  2D0A A;  1VSM A;  5FLX O;  2ZJP L;  1T3V A;  2LSN A;  3TAN A;  3DMJ A;  4LY7 A;  1VQ8 N;  1KSP A;  1BO5 O;  4KV8 A;  4CIE A;  2QWM A;  2P9I B;  3I56 N;  1ESV A;  4BY9 C;  4DTU A;  2UYT A;  3ATV A;  1W9H A;  3P39 A;  2Z1H A;  2OYQ A;  1JXE A;  1RDC A;  4EHT A;  2E4L A;  4WQ5 A;  1HYV A;  3FZL A;  3ZSO A;  2QA4 N;  3RRG A;  3SLC A;  4H0V B;  3T7Z A;  5BR9 A;  4DS4 A;  1LCU A;  1NJZ A;  1GLL O;  3BDP A;  3VTH A;  2O8B A;  4DLE A;  4KH5 A;  3ZSX A;  1LWC A;  2D5R A;  2HB5 A;  1S6Q A;  4ELT A;  4BGB A;  4CFC A;  4U7B A;  3AVL A;  4Q5V A;  3TTD A;  4E7K A;  4C8N A;  3NDK A;  3MXM A;  2D4W A;  1YTA A;  2NRV A;  3AVM A;  1KVC A;  2P9N A;  3BZC A;  4CD1 A;  4CIF A;  1BCM A;  2YNG A;  1S22 A;  1YVN A;  4CJV A;  3CJ7 A;  1NGG A;  1J54 A;  2I5J A;  1JKH A;  3WQT A;  2P9L A;  5AQL A;  4LD0 A;  2W41 A;  2RN2 A;  4KHW A;  3O3G A;  1U2V B;  3RR8 A;  2IIR A;  4FWN A;  3O8M A;  1BL3 A;  1HKC A;  1RT2 A;  4E1N A;  2E6M A;  3J7Y P;  1X3M A;  3CQ8 A;  3L8B A;  1GOC A;  1T6C A;  4HUF A;  2E1Z A;  1X9S A;  2BUP A;  2CGJ A;  4O5F A;  3EYZ A;  2PBD A;  1NK0 A;  4I6M A;  3KVG A;  3HK2 A;  3G0Z A;  4YOY A;  3Q7B A;  4DFP A;  4B3M K;  5M1O A;  3CQY A;  4JI4 K;  5AZJ B;  3SBG A;  4ISF A;  3MED A;  1E4G T;  4WQ5 C;  1ATN A;  2KTQ A;  4JI2 K;  1VSD A;  4BC3 A;  4JNE A;  5CZ2 A;  3VPZ A;  4K25 A;  3SZ2 A;  2D0B A;  2P5O A;  3VMF B;  4AM6 A;  5FRN A;  2QWQ A;  3CCQ N;  1KQS M;  3CC2 N;  1BIS A;  4FLV A;  3IDH A;  4A5A A;  1VQ9 N;  4AH9 A;  3G10 A;  3CJB A;  4A59 A;  4FWS A;  4DR4 K;  3OYB A;  4KTQ A;  3QFU A;  1J9A A;  1OVQ A;  4E7J A;  5JVH L;  3V9W A;  3SQ1 A;  4PUO A;  4FSV A;  1TKZ A;  2RHK A;  3QIP A;  3A8Y A;  1HQE A;  3EL2 A;  4CJR A;  2QW9 A;  3CCU N;  2GUP A;  2A1R A;  5GAG P;  4O8U A;  2HST A;  1XMO K;  5AR0 A;  3GOI A;  1S1T A;  3MEC A;  3C6T A;  3VF2 A;  3UKU B;  2Q0R A;  3TAM A;  2F4V K;  3V1R A;  3KTQ A;  3V1Q A;  1MDU B;  4E89 A;  4DV0 K;  2O8B B;  2ZD1 A;  2IDO A;  4M63 C;  1T8E A;  4LFB K;  4DMN A;  4FJJ A;  4FVM A;  4PA1 A;  4FJ5 A;  1GOA A;  1TL1 A;  1IKV A;  1S72 N;  1ZBL A;  4FW2 A;  1NGD A;  3OYH A;  3CFO A;  2HMP A;  1IH7 A;  5AJ3 K;  4CJF A;  1X9W A;  4M3W A;  3TAE A;  2P9N B;  3KKR A;  1KVB A;  4MQ3 A;  3M8R A;  3AO5 A;  3AV9 A;  3G71 N;  4YOW A;  3J8A A;  2ZE2 A;  5E84 A;  1BOT O;  3KZB A;  3R1X A;  2NRH A;  1SUQ A;  2E2O A;  3CYM A;  2IC3 A;  3AVA A;  2E6L A;  1U49 A;  2P9L B;  2IGI A;  3QET A;  5KPZ A;  3D0P A;  3V9U A;  4WQ4 A;  4CED A;  2G8K A;  3VQ6 A;  4FJK A;  1WN7 A;  2X74 A;  1VRU A;  4N47 A;  1FKP A;  1XNR K;  1J5O A;  3FZF A;  4IEE A;  2A41 A;  4E7H A;  1KAZ A;  1G15 A;  4C8K A;  3DLG A;  5AQQ A;  3OYI A;  4I6M B;  4MO4 A;  4OVL A;  3TAF A;  1RT7 A;  1U04 A;  4YDU A;  5LJW A;  2F8T A;  3MWP A;  3S9H A;  3MEE A;  5KGX A;  1OKJ A;  4Y1D A;  1ATR A;  1S9G A;  2F8S A;  2QEX N;  2OCE A;  1BCO A;  1N34 K;  1UOC A;  2GV9 A;  1VSF A;  3S3N A;  1Q7Y O;  3JS6 A;  5AQU A;  3CCS N;  4W5O A;  1RBT A;  4B1V A;  3LAN A;  3FE1 A;  5JS1 A;  3O9S A;  2Y1I A;  2NZT A;  1DGK N;  5DK5 A;  5JVG L;  5BN9 A;  4NO7 A;  1Z25 A;  3TAB A;  5AFU A;  2HBK A;  4BC5 A;  4GY2 B;  3OS2 A;  3ENH A;  1RDD A;  2BGG A;  1D9F A;  1DEJ A;  2KLA A;  1RBR A;  2FBY A;  2P9U B;  2QI2 A;  4KTW A;  3QEX A;  4BRD A;  1SS6 A;  3SQ0 A;  1BHL A;  4H5W A;  2GTD A;  3FZM A;  4RTF D;  3T19 A;  1WBD A;  5KQD A;  2YHB A;  4FK4 A;  4JHD A;  3SUO A;  3HM9 A;  3VN5 A;  3J81 O;  1NNE A;  4GV6 A;  1WLJ A;  1KC8 O;  1JXB A;  1K8K A;  4BR2 A;  3B6O A;  3RMD A;  4X66 K;  3WEE A;  4DV3 K;  2NRR A;  2CH5 A;  4RG8 A;  4DU4 A;  3ZET A;  3SUP A;  2P5G A;  1Q8I A;  3D7E O;  4CFD A;  2EHG A;  4WQ4 C;  3A2F A;  4IOA L;  4QCL A;  1TYQ A;  2YI1 A;  3GBT A;  3H1V X;  3T1Y K;  2Z1G A;  3SBT A;  3KK7 A;  1K9M O;  1ITG A;  5LL6 Z;  3WXL A;  1BQN A;  5EU7 A;  3TTC A;  3VER A;  3TAQ A;  4DSF A;  4B9Q A;  1JLQ A;  4DSE A;  4E19 A;  2JWL A;  4KH6 A;  4IDH A;  3O9U A;  1L3T A;  4BGA A;  5F2R A;  4JK8 A;  4EAH D;  1J53 A;  5CR4 A;  1VQO N;  2VG6 A;  5EVZ A;  4M41 A;  3GG4 A;  4CZJ A;  2P9K A;  4JD2 A;  4DR5 K;  5CY4 A;  3LWM A;  1HMV A;  3E9L A;  3D2F A;  3ZCM A;  4F8R A;  3OVN A;  1Y97 A;  3AO1 A;  3LPU A;  4CF2 A;  3F5T A;  1O13 A;  4YOR A;  3SQ4 A;  3WQU A;  3P5J A;  1DTT A;  1FJG K;  2VWB A;  5I9E B;  4H0O A;  1C0T A;  2E2P A;  2PYJ A;  3LDQ A;  5SWM A;  2UUC K;  2FF3 B;  5AZI A;  4XIU A;  3AAR A;  4JI6 K;  1BQM A;  1NGJ A;  2P9S A;  3EY1 A;  4IFV A;  1YIJ N;  4GV3 A;  4HTU A;  2ZM6 K;  1T44 A;  1NMN A;  1Q86 O;  4XH1 A;  3QEP A;  4DWI A;  4KHQ A;  1P8Z A;  3RRH A;  1VSH A;  1KXP A;  3HPO A;  4ILJ A;  4EP5 A;  3DLH A;  4DUY K;  4KPY A;  2HHU A;  1Q9Y A;  4ILG B;  3M8Q A;  1XC9 A;  4CEC A;  2YKN A;  2PZS A;  1SKS A;  1C0F A;  4F3T A;  3GL1 A;  4DV4 K;  1HNZ K;  1HNV A;  4CF0 A;  4EP4 A;  3WXI A;  4CE9 A;  1YT3 A;  5DM6 L;  3NAE A;  1OH5 A;  1MWM A;  1EWQ A;  3RR7 A;  3ULE B;  1U4B A;  4B3T K;  3QIO A;  4OGC A;  4BDZ A;  3LAL A;  4BRN A;  4K0K K;  1RFQ A;  3QDK A;  2YNI A;  4NYN A;  5JLF A;  2VGN A;  5GAD P;  2UXD K;  4JKA A;  4H0Y B;  1QHA A;  4DU1 A;  3S3M A;  1VQP N;  4H4O A;  4EFH A;  2QWL A;  4DSI A;  5HOO A;  2D0C A;  2QWP A;  3AO4 A;  4F2R A;  4HCB A;  5C0Y A;  3H6E A;  5FPE A;  4C8M A;  2YNH A;  2XHB A;  5AQG A;  4RCH A;  4CJ4 A;  2D0P A;  3U6F A;  2KQ2 A;  3V1O A;  3NFA A;  4KH4 A;  4DFM A;  2D0O A;  5HP1 A;  1NM1 A;  2E1Y A;  2O8C A;  2Z1J A;  4FLT A;  4WFB L;  4JHD B;  2UUA K;  5IWA K;  3HRG A;  4CD3 A;  3NH1 A;  4E1J A;  5F0X A;  2X6S A;  5KPR A;  3EEQ A;  4AIL C;  3SPZ A;  1K8K B;  1TK0 A;  2WUS A;  3WEE B;  4WCE L;  2BE2 A;  3ZET B;  3U9Z A;  1N33 K;  3TPQ A;  3DWL A;  3QEV A;  2JGU A;  1RNH A;  1C1C A;  3ITH A;  4CBX A;  1UA0 A;  2J4R A;  3BF3 A;  5J2M A;  4DHY A;  4CFA A;  1SL2 A;  4RW7 A;  3U3G A;  1A5V A;  4E7L A;  1YF5 L;  4B1U B;  4EIA A;  1FW6 A;  2O8E A;  3VQ7 A;  4AHV A;  5I3U A;  3NHG A;  3BUZ B;  4C8L A;  3K5M A;  1HKG A;  4W5R A;  1CZ9 A;  1HNI A;  4DG1 A;  5J1E A;  2HVH A;  5FRO A;  2HHV A;  3CCR N;  3WUH A;  4BRK A;  1NGF A;  5LMN K;  3IAY A;  4M3Y A;  3TSQ A;  4KRF A;  4X64 K;  4BRM A;  3FLC O;  4BR5 A;  3CCE N;  1QS4 A;  1RCH A;  3C0B A;  5HRO A;  4R79 A;  3ZT2 A;  3OBW A;  1OH6 A;  1GLD G;  3OYJ A;  2P9K B;  4JD2 B;  3L2U A;  1RBU A;  3AO3 A;  4E7I A;  3FGU A;  2DFF A;  1NGI A;  5C24 A;  4N56 A;  3D2F B;  1ZBI A;  3BF1 A;  1TL3 A;  1YHQ N;  2YHW A;  4NLB A;  1HUX A;  3SQ2 A;  3PX4 A;  4M3Z A;  4Q0B A;  1XHX A;  5E26 A;  1NJI O;  4H0X B;  1SKW A;  3PLA A;  5AQI A;  4MO5 A;  3QB0 A;  4N5S A;  2OPR A;  3EN9 A;  4BRF A;  5AZI B;  2WON A;  2P9S B;  4MDA A;  3TSU A;  4UQG A;  4CHP A;  4OKE A;  5EOY A;  3QLH A;  3K57 A;  2GX9 A;  4OLB A;  3W0L A;  4Z4E A;  1TGO A;  4H4M A;  1RIL A;  1BA1 A;  1U48 A;  1VSI A;  3ZT1 A;  3IKM A;  3P38 A;  4A2A A;  4MLE A;  4J2D A;  2O4G A;  3LAK A;  3VQQ A;  5M1F A;  1B9F A;  3PO4 A;  5BRF A;  5CZ1 A;  1NMD A;  2WBN A;  2QXF A;  3VA3 A;  3LM9 A;  4JKG A;  1TAU A;  2IVP A;  3RSE A;  1CXQ A;  1RTI A;  1X9J A;  4M7Y A;  1Z05 A;  3C95 A;  2G8V A;  1D5A A;  3LP1 A;  1VQK N;  3MK6 A;  3SV4 A;  4ELU A;  4CZL A;  5H1S Q;  2ASO A;  4E1M A;  1ZYQ A;  3NGI A;  4BE0 A;  5AQF A;  3UIQ A;  1WNS A;  1S3X A;  3A5L C;  4LH4 A;  1RBS A;  1NGH A;  1KRP A;  3ZEU A;  1TKD A;  4PWD A;  4Y0W A;  2O8C B;  3UKU A;  4YOX A;  3I33 A;  4A5B A;  4FOI A;  4IBN A;  1LW2 A;  4XEI A;  3PY8 A;  4HHT A;  4ILH A;  4B9S A;  3OBY A;  2NRW A;  1JLA A;  3THV A;  3F73 A;  4CGJ A;  2CGK A;  3AGK A;  5HBM A;  4DF8 A;  4WFA L;  2NRX A;  5BR8 K;  1N32 K;  4PY5 A;  2O8E B;  2RE2 A;  1BGX T;  3CJA A;  3OYK A;  1ATS A;  1U47 A;  3MAQ A;  1GLE G;  3S41 A;  1Y64 A;  3CM6 A;  3DXK A;  3KK1 A;  3L2W A;  4CGH A;  3THX A;  3CCJ N;  1NK5 A;  2Q36 A;  3C6U A;  4FOE A;  2O4I A;  4K43 A;  2YHY A;  5CYQ A;  2VWK A;  3VEX A;  5GAE P;  1XI1 A;  3PIO L;  1QVF M;  1WOQ A;  4DR6 K;  3DRR A;  5SZT A;  3VF4 A;  1UA1 A;  4DQP A;  3ENO A;  3M5R A;  4B1Z A;  3QEI A;  4DTP A;  4IWV A;  5C10 A;  1NGB A;  2B5J A;  4DCH A;  3K0S A;  2HHQ A;  1RDU A;  4FZX C;  1EKE A;  3KWG A;  2B6A A;  1X9M A;  2QWN A;  3KLE A;  4BG8 A;  1S6P A;  3CCM N;  4LF5 K;  2HBJ A;  2HHH K;  3LM2 A;  4I9L A;  4BQZ A;  4DTO A;  1S1V A;  2F9W A;  3PIP L;  2Y1J A;  2ZQB A;  4DR3 K;  1QSY A;  3H46 O;  4IFE A;  4IJN A;  2XY6 A;  3FZH A;  3PUF A;  3WNF A;  1NK9 A;  1IKX A;  3BZK A;  4NXM K;  3K5O A;  4NXN K; 
#chains in the Genus database with same CATH homology
 1E4F T;  3P4I A;  5AQV A;  4H5T A;  5JVG L;  2ZF5 O;  2P9U A;  2WC9 A;  4NO7 A;  5BN9 A;  1X3N A;  3HOT A;  4WFN L;  4Z94 A;  4JKG B;  5AFU A;  4BR9 A;  2HBK A;  4BC5 A;  4GY2 B;  5FPN A;  3RSE B;  4AF1 A;  3ENH A;  3TSP A;  1QQO A;  3D2E A;  4CZF A;  3MN7 A;  3H3N O;  3O9R A;  1DEJ A;  3O80 A;  4H0P A;  2KLA A;  5ADX H;  2P9U B;  2QI2 A;  3E9P A;  2YX6 A;  4MDB A;  5TKY A;  4CI6 A;  5C12 A;  1VQM N;  3CME N;  4BRD A;  1SS6 A;  3IMX A;  4H5W A;  2P9I A;  3KHY A;  3AAP A;  3J7Z O;  2E2Q A;  3AGR A;  2GTD A;  2VGM A;  3SK3 A;  1V4T A;  2VCP A;  3FZM A;  4RTF D;  1BDG A;  3MDQ A;  5KQD A;  2AP1 A;  2QWO A;  3WXJ A;  1XC3 A;  4C23 A;  4JHD A;  5AQR A;  3VGL A;  3HBT A;  3K9J A;  5KQ8 A;  4IEI A;  4GV6 A;  3B8A X;  3ZEU B;  1GLJ O;  1KC8 O;  5C2D A;  3K9K A;  1K8K A;  1NGE A;  4BR2 A;  1W2B M;  3ZX3 A;  1VQ7 N;  1WUA A;  3WEE A;  5EY4 A;  2NRR A;  2CH5 A;  3CXC M;  5AQY A;  3ZET A;  3MMV A;  4BRA A;  4HTL A;  3EE9 A;  5AQO A;  3D7E O;  3R6M A;  1NGC A;  3QBX A;  4WQ4 C;  1KD1 O;  3CCV N;  2PFU A;  4IOA L;  2NRT A;  3WXM B;  1HLU A;  1TYQ A;  2YI1 A;  5LY3 A;  5M1N A;  3GBT A;  2A6A A;  3H1V X;  1IJJ A;  3SBT A;  5MLC Q;  1NLV A;  3VEV A;  4A2B A;  4IO9 L;  2HBL A;  4K41 A;  3KK7 A;  3SAF A;  1K9M O;  5DM7 L;  2NRZ A;  2I7P A;  3WXL A;  2A3Z A;  3R8E A;  3TTC A;  3ID8 A;  3VER A;  4YOV A;  3NVK A;  3FR0 A;  4B9Q A;  3VGK A;  3LL3 A;  5AQS A;  5FPM A;  4BRE A;  1TYQ B;  2GWJ A;  2JWL A;  4KH6 A;  1TUY A;  4FPB A;  3O9U A;  4IDH A;  4JKD A;  4KBO A;  3ZX2 A;  5BRH A;  2ZGZ A;  4FPA A;  4BGA A;  4JN4 A;  3A5O C;  4JKC A;  5F2R A;  4JK8 A;  2DPN A;  2Q2R A;  5AQP A;  4BG9 A;  3F2K A;  4CBU A;  3CMA N;  3CPW M;  4EAH D;  5CR4 A;  5B8H A;  4IOC L;  3LDO A;  1VQO N;  5EVZ A;  1XUP O;  4PKG A;  3GG4 A;  4NB4 A;  4CZJ A;  3EKS A;  2P9K A;  4JD2 A;  3O4W A;  4GV9 A;  3DXK B;  4FO0 A;  3O9T A;  3U9D A;  4XH4 A;  3R9P A;  4U67 L;  3N4Q A;  2CH6 A;  3VTI A;  3WT0 A;  3TU5 A;  3E9L A;  4GVE A;  3D2F A;  4JKF A;  3CF5 L;  1EQY A;  1Z6R A;  3VOV A;  1U2V A;  4QS8 A;  4H03 B;  1MWK A;  3F5T A;  4B1W B;  3CC7 N;  1O13 A;  4YOR A;  1M1K O;  3SMS A;  2E88 A;  4IO8 A;  3WQU A;  2VWB A;  5I9E B;  4H0O A;  4PKI A;  2E2P A;  4BRH A;  3LDQ A;  4QS7 A;  3L4I A;  2FF3 B;  5AZI A;  2ASM A;  3M3Z A;  4CZM A;  3AAR A;  4BRP A;  2V51 B;  4CZK A;  2P9S A;  2EWS A;  1NGJ A;  1YIJ N;  2QWR A;  2E2N A;  4GV3 A;  2H3G X;  5AQW A;  3BP8 A;  1C0G A;  4C1N I;  1T44 A;  2ASP A;  1Q86 O;  4XH1 A;  1R59 O;  1ZC6 A;  5C15 A;  2OTL N;  1DT9 A;  1P8Z A;  4BRQ A;  5AZJ A;  1KXP A;  4K42 A;  4ILJ A;  3L6Q A;  1QZ6 A;  3H1Q A;  4XH5 A;  2A5X A;  3DXM B;  4ILG B;  3R3L A;  2FXU A;  2KHO A;  5BPN A;  3ULE A;  4FL9 A;  1C0F A;  3CJ9 A;  3C7N B;  1VAZ A;  2IVN A;  3GL1 A;  3QIC A;  2VYP A;  1H1V A;  3WXI A;  3P31 A;  5AQT A;  3T69 A;  4BRO A;  2HBM A;  2QXL A;  5DM6 L;  1TUU A;  3QBW A;  4ISG A;  3VF6 A;  1MWM A;  3LDP A;  3ULE B;  1Q81 O;  1GLA G;  4BC2 A;  3HTV A;  4FWK A;  4BVP A;  5ADX A;  4BRN A;  1RFQ A;  1Q18 A;  3A0I X;  3QDK A;  1W97 L;  4JKB A;  5AQH A;  3M6G A;  2VGN A;  5JLF A;  3U4L A;  5GAD P;  3E1Y A;  3C6A A;  4H0T B;  4JKA A;  4H0Y B;  4H5N A;  1QHA A;  2NNW A;  4M7X A;  3VET A;  1VQP N;  3E66 A;  4EFH A;  2QWL A;  3UKR A;  1BWF O;  3LDL A;  1RDW X;  5HOO A;  2QWP A;  5HL7 L;  3D2E B;  4WYB A;  3SAH A;  3HOS A;  3AY9 A;  5C0Y A;  3H6E A;  5FPE A;  1D4X A;  5JIC A;  1T3V A;  2ZJP L;  3I55 N;  3O9Q A;  5JMV A;  3MWT A;  5AQG A;  4RCH A;  3LDN A;  3I8B A;  1BO5 O;  4PHT X;  4FWP A;  3UKR B;  1HJO A;  3VEZ A;  2QWM A;  3MN9 A;  2D0P A;  2P9I B;  4UY8 O;  3I56 N;  3VEN A;  1HPM A;  2QM1 A;  4KH4 A;  1ESV A;  4BY9 C;  2UYT A;  3ATV A;  3P39 A;  2D0O A;  1NM1 A;  2E1Y A;  1NGA A;  3CER A;  3CI5 A;  4WFB L;  4JHD B;  3KWI A;  4EHT A;  3HRG A;  2ZJR L;  4CD3 A;  1YJN N;  1GLB G;  4WQ5 A;  3FZL A;  3MCA B;  4E1J A;  5F0X A;  3D6R A;  5KPR A;  5AQK A;  2QA4 N;  1K8K B;  3SLC A;  3UB5 A;  2WUS A;  3ENB A;  3WEE B;  4H0V B;  3T7Z A;  4WCE L;  5BR9 A;  4JEP A;  1VQN N;  3ZET B;  1LCU A;  1KAY A;  1GLL O;  4H5V A;  3TPQ A;  3DWL A;  3U9Z A;  4BR7 A;  4CBX A;  1K73 O;  2J4R A;  3VTH A;  3BF3 A;  5GIO A;  4DHY A;  4CJ7 A;  4KH5 A;  4C1N K;  1SQK A;  1YF5 L;  4H5R A;  4DQ8 A;  2Q97 A;  4B1U B;  3ZYY X;  4EIA A;  2FSN A;  1QQM A;  3BUZ B;  4MLH A;  4B1X B;  4BGB A;  4U7B A;  3EO3 A;  1HKG A;  2V7Z A;  4AM7 A;  3CET A;  2BTF A;  4JKE A;  2D1K A;  3TTD A;  4CBW A;  4IZ9 A;  3CCR N;  5AQM A;  3WUH A;  4BRK A;  1NGF A;  3MN6 A;  2PAV A;  3IUC A;  3O5B A;  3BEX A;  3TSQ A;  3O08 A;  2D4W A;  4BRM A;  3HM8 A;  3FLC O;  2NRV A;  4BR5 A;  5BN8 A;  5BRD A;  1VQ5 N;  2FSK A;  4CZE A;  3CCE N;  1MA9 B;  3MCP A;  3L0Q A;  3C0B A;  2P9N A;  2AA4 A;  4A62 A;  4NLC A;  4R79 A;  4O8K A;  1YI2 N;  4CD1 A;  3OBW A;  4FWO A;  1GLD G;  4IXC A;  3VGM A;  5GIP A;  2ZGY A;  4BVO A;  1S22 A;  1YVN A;  1T6D A;  2P9K B;  4JD2 B;  4L3Q A;  3UE5 A;  4DB3 A;  3G4S N;  3CJ7 A;  1NGG A;  3FGU A;  3WQT A;  1NGI A;  2P9L A;  2ITM A;  5AQL A;  2GEM A;  1SZ2 A;  2W41 A;  5BPL A;  3D2F B;  3BF1 A;  1U2V B;  1P90 A;  1YHQ N;  1HKB A;  4GNI A;  2YHW A;  2IIR A;  1HUX A;  4FWN A;  2F7T A;  4NLB A;  3L4Q A;  2HF3 A;  2OAN A;  3EKU A;  3FFK B;  2P9P A;  3O8M A;  5BRE A;  5E26 A;  1NJI O;  3W3D A;  4H0X B;  3PLA A;  1HKC A;  2IVO A;  5AQI A;  4MO5 A;  4BRL A;  5CHI A;  3IFR A;  3RVC A;  3QB0 A;  1X3M A;  3E9O A;  4ISE A;  1VQL N;  1T6C A;  3EN9 A;  2E1Z A;  5GIN A;  1NWK A;  4BRF A;  5AZI B;  2BUP A;  2CGJ A;  4O5F A;  2W40 A;  2PBD A;  5CE3 A;  1JCG A;  3KVG A;  4I6M A;  2P9S B;  2E20 A;  4MDA A;  2NLX A;  2OTJ N;  4CZG A;  3TSU A;  2YCH A;  4YOY A;  5EOY A;  2BH1 A;  2YJE A;  3Q7B A;  5M1O A;  3CQY A;  1GLF O;  5AZJ B;  3SBG A;  4B1Y B;  2GX9 A;  4OPA A;  3W0L A;  4ISF A;  3H3O B;  1E4G T;  4WQ5 C;  1BA1 A;  1EO1 A;  2FF6 A;  2Q0U A;  1ATN A;  3IKM A;  2YHX A;  3P38 A;  3VES A;  4FWQ A;  4A2A A;  2KKZ A;  2Q1N A;  4MLE A;  5AQX A;  1YJW N;  4BC3 A;  4JNE A;  5BPM A;  3VPZ A;  2FSJ A;  4RWT A;  3CC4 N;  4HWI A;  5M1P A;  4K25 A;  3F9M A;  1V4S A;  5M1F A;  1ZXO A;  5BRF A;  1NMD A;  2HF4 A;  3DAW A;  2WBN A;  3VMF B;  3WXK A;  4AM6 A;  4WF9 L;  3CD6 N;  3LM9 A;  2QWQ A;  4JKG A;  3CCQ N;  1KQS M;  3CC2 N;  2IVP A;  3C65 A;  3QML A;  3HSC A;  3RSE A;  3IDH A;  3Q7C A;  1X9J A;  4PKH A;  3CCL N;  3N4P A;  4A5A A;  2A40 A;  4M7Y A;  4FVU A;  1IG8 A;  1VQ9 N;  5GAH P;  1KAX A;  3MX5 A;  1Z05 A;  3CJB A;  4A59 A;  1DKG D;  4FWS A;  5EXW A;  3QFU A;  4YOU A;  5F1X A;  2ZWH A;  4FWR A;  3SAG A;  1VQK N;  3MK6 A;  5TKW A;  4CZL A;  1K8A O;  3G25 A;  5JVH L;  5H1S Q;  1J6Z A;  2F9T A;  5AFU H;  4CZI A;  2ASO A;  3O6W A;  1LOT B;  3VEO A;  1G99 A;  3A5M C;  1QVG M;  5KPT A;  1QQN A;  3MX2 A;  3CIP A;  5AQF A;  4FSV A;  1S3X A;  2RHK A;  3A5L C;  1YXQ A;  5M1K A;  1NGH A;  1QZ5 A;  2GEL A;  3ZEU A;  4OPH A;  3A8Y A;  1ILY A;  1JCE A;  3EL2 A;  1HX1 A;  2WFB A;  3CJC A;  2QW9 A;  3CCU N;  4Y0W A;  2GUP A;  3OA9 A;  3DLL L;  3GE1 A;  3U8X A;  1BUP A;  3UKU A;  1XQS C;  4BQL A;  1YUW A;  4YOX A;  3GDQ A;  4IJA A;  3I33 A;  4JK9 A;  3EZW A;  4A61 A;  3VEY A;  3FZK A;  4A5B A;  5GAG P;  4FOI A;  2HST A;  3CJ1 A;  4JAX A;  4O8U A;  5C2F A;  4XEI A;  2CGL A;  5AR0 A;  3GOI A;  4YOT A;  1SAZ A;  3CPE A;  5AQZ A;  3CQX A;  4ILH A;  4J8F A;  3VF2 A;  3UKU B;  2V52 B;  5ELZ A;  2Q0R A;  5EX5 A;  4FWM A;  3OBY A;  2NRW A;  2E8A A;  3SJH A;  4JK7 A;  1MDU B;  1GLC G;  4PL7 A;  2CGK A;  3AGK A;  3SMP A;  4M63 C;  1BG3 A;  2JWK A;  4WFA L;  2NRX A;  4PL8 A;  5AQN A;  1N8R O;  1JJ2 M;  2RE2 A;  3CJA A;  3O1B A;  1S72 N;  1BU6 O;  1NGD A;  1ATS A;  3QFP A;  4QS9 A;  3C6H A;  4BR0 A;  4YDU C;  3VEW A;  1GLE G;  2HMP A;  4FWL A;  3S41 A;  1Y64 A;  3ZX0 A;  4LC9 B;  3DXK A;  4A57 A;  3H45 C;  2YJF A;  1JCF A;  3CCJ N;  2A42 A;  2Q36 A;  2Q31 A;  2QTD A;  4FOE A;  2P9N B;  4IOX A;  4K43 A;  3O1W A;  3G71 N;  4EHU A;  4YOW A;  2YHY A;  3HZ6 A;  3AAQ A;  3J8A A;  5E84 A;  1BOT O;  3KZB A;  3R1X A;  1NBW A;  2ZJQ L;  1VQ8 N;  2FLO A;  1U6Z A;  2NRH A;  3VEX A;  5GAE P;  1YAG A;  2E2O A;  3PIO L;  3NVM A;  1QVF M;  1WOQ A;  2P9L B;  4BRC A;  4G9Z A;  1VQ6 N;  4DKW A;  3VF4 A;  3MN5 A;  5KPZ A;  4OO1 J;  4CZH A;  3ENO A;  3JXU A;  1VQ4 N;  3M5R A;  4B1Z A;  5JLH A;  1ZBS A;  4IWV A;  4WQ4 A;  2GWK A;  2P9P B;  5C10 A;  5LJV A;  1NGB A;  3HI0 A;  4DCH A;  3ID6 A;  4BRI A;  3OW2 M;  3FZF A;  4IEE A;  2A41 A;  1RDU A;  5AQJ A;  3KWG A;  1KAZ A;  2QWN A;  4BR4 A;  5FPD A;  4BG8 A;  2HOE A;  5AQQ A;  2I7N A;  4I6M B;  5M1Q A;  4MO4 A;  4JKH A;  3DXM A;  2HBJ A;  4BC4 A;  3CCM N;  4YDU A;  3CHW A;  5LJW A;  1CZA N;  3LM2 A;  3MWP A;  1M90 O;  4F9O A;  4BQZ A;  1Q82 O;  2F9W A;  3C7N A;  1OKJ A;  3PIP L;  3EE8 A;  1RGI A;  1YJ9 N;  3A5N C;  1ATR A;  3H46 O;  4IFE A;  4IJN A;  3DJC A;  2QEX N;  3FZH A;  2V7Y A;  3G6E N;  1YIT N;  3NMU A;  3OHR A;  1Q7Y O;  3JS6 A;  3TTF A;  5AQU A;  3CCS N;  1BA0 A;  4B1V A;  3FE1 A;  3M1F A;  3ATU A;  3O9S A;  2NZT A;  4BRG A;  1OVY A;  1DGK N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...