4CHOA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 52
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4choA00
4C8KA 1KVAA 1W9HA 4RW9A 4CHNA 3K57A 3DLGA 4CK3A 3HT3A 3KLEA 4BE0A 3P1GA 4FM1A 4DTRA 4CJQA 1B9FA 2I5JA 3VN5A 4AHUA 4JS4A 4DFJA 2FBXA 2JLEA 4CJLA 3OYLA 3RTVA 1NJWA 3ZSYA 4E7JA 4K8ZA 1IKXA 4DSFA 1RBTA 1TL1A 3NF9A 4CIFA 1HRHA 3KD5E 3JYTA 3I0SA 1VSKA 3VQ5A 4DTOA 1NK5A 1L3TA 3QO9A 1SKSA 2BDPA 1ZBIA 2XRIA 4FK4A 2ETJA 2VG6A 4KPYA 3ISNC 4J2EA 3L3UA 3UIQA 3OVNA 1D8YA 5C25A 1HQUA 3SQ2A 2BANA 4CGFA 1NK8A 3I0RA 3SQ4A 1SKWA 4FJHA 4Z4EA 2OYQA 1LW0A 5EU7A 1G15A 4B9TA 2YNHA 1BHLA 4FCYA 2W42A 3V9WA 4OGCA 2DTUA 4CF0A 3DI6A 2O4GA 1A5XA 2DFFA 5CY4A 4JRQA 4EZ6A 5FROA 4F2RA 1S9EA 1LV5A 1QTMA 2AJQA 3SCXA 3AA2A 1J54A 4NYNA 4LD0A 3TARA 3MXJA 3D0PA 3NF6A 3V6DA 1YVUA 4KHSA 1WSEA 3VQ8A 1S5JA 3NDKA 3KK3A 3L2QA 3L8BA 3QIPA 1NK6A 1NJXA 3LWLA 3AVNA 2G8FA 3RMAA 3PX0A 4LY7A 2YNIA 3AV9A 3EYZA 3OYDA 4Z4GA 3D45A 3K5LA 4ELUA 4CHPA 4CEQA 3RWUA 3LAKA 2OZMA 2GUIA 4CJRA 3U3YA 4KHWA 4DSLA 4DSJA 3MAQA 5KTQA 3O3HA 1ASWA 3OS1A 1RILA 4M3XA 2Y1JA 5CYMA 2F8TA 3ZT3A 4C8LA 4O55A 3OYGA 4Z4FA 2ATQA 3ZT4A 1Q9XA 5HP1A 5DMRA 4ZHRA 1S1VA 4CF1A 1EXQA 1DTTA 3VQ6A 1RTIA 3HM9A 1I39A 1KVCA 2D0CA 3DLKA 3NH1A 3OYKA 1FKPA 1F21A 1LWEA 1LWCA 1UOCA 4CJ4A 2YKNA 4Z4IA 2PYJA 4DTPA 3HJFA 4MQ3A 3VQBA 1N6QA 4E19A 4CFBA 3TWHA 3U6FA 4B8AB 3WNGA 3KIOA 3TI0A 2B4JA 4I9QA 1U47A 4FJ5A 2HNDA 3K58A 4M45A 1JXBA 4OJRA 2EX3A 4CECA 1BISA 3QETA 4N5SA 5DK5A 4CGHA 1L3UA 4LH4A 3QESA 2HVIA 1SKRA 4KB1A 4I7FA 2PY5A 4CJTA 1DTQA 3O3FA 1J9AA 1YTAA 1X9SA 1C6VA 1J5OA 4JS5A 3KLIA 4M3WA 4ZTFA 3IG1A 3OYIA 4CJWA 1U4BA 2FBVA 2NUBA 3NGYA 4BDZA 1CZ9A 4CEFA 3L2WA 4C8OA 2HNZA 1SV5A 4ZTJA 2HHTA 2P51A 3KJVA 3CFOA 4YFUA 1JLCA 1D5AA 1RNHA 4W5QA 3LALA 3AVCA 2X78A 3H08A 4FJLA 5FRMA 3OYCA 2IOCA 1TKTA 2RN2A 3P83D 3BDPA 3DOKA 3V9XA 4NCAA 4DQPA 4OLAA 4CJ5A 3PV8A 4FZYA 1B92A 1TKXA 3CM5A 2IC3A 4DTMA 5HLFA 4E1NA 4B9NA 1S6QA 3IAYA 2P1JA 3VQEA 1SL2A 3IRXA 2JGUA 4OVLA 5HBMA 4M3UA 3SQ1A 3LANA 3F73A 1U48A 4GW6A 4CF2A 4CCHA 1U45A 1T8EA 4O0IA 3ALYA 1RTJA 3ZSWA 4E1MA 4B3OA 4IFVA 3OYFA 2ZD1A 1RBUA 2F96A 3SNNA 5J2QA 2KW4A 3ZSRA 3HPOA 2PYLA 3NH2A 1XC9A 3L2UA 4FZZA 4FYDA 1Z25A 4B8CA 2E6MA 4FLUA 4PQUA 1BQMA 1ASUA 4CESA 5T7BA 4OGEA 5E41A 4M3YA 3S3MA 5KGXA 1EKEA 4W5TA 3K5MA 2GBZA 2HW3A 3HYFA 3LAMA 4NCBA 1WLJA 3HXMA 4RW8A 3DRPA 3JSMA 4CHYA 3C95A 2QXFA 4KTZA 1U04A 4CJPA 4Q0BA 2HVHA 1KVBA 1KFSA 3AVAA 3HL8A 3QINA 4W5RA 4DFPA 3DLHA 3ITHA 1L5UA 1Q8IA 1C1AA 3QLHA 3ZT0A 4XIUA 3QERA 4DF8A 4CJ3A 3TANA 3OJUA 1A5WA 4FJ9A 1IKVA 4O44A 1JLBA 1TK0A 4ELTA 4BWMA 2X74A 4KI6A 4DSKA 3LDSA 1HNVA 4DQIA 2YNFA 3AO4A 4DS4A 3LP3A 3NFAA 2Z1JA 4GVMA 4FW2A 2HHUA 3V9ZA 4FK0A 3AO3A 4F3TA 4AHCA 3OYHA 3AA4A 4Y1CA 3NE6A 3KKRA 4YNQA 2XY7A 5KGWA 1WNSA 1WN7A 4KB0A 4OKJA 3OYJA 4N56A 2OZSA 4KHNA 1N5YA 4KHQA 4I2QA 3NAEA 3B6OA 5JS2A 2OPPA 5CZ1A 4OKEA 3SUQA 5HRSA 2RF2A 1JLEA 2E4LA 2YHBA 4KHUA 3C6UA 4BACA 2KZMA 5I3UA 2XHBA 5K14A 4DF4A 3IS9A 3C94A 3CM6A 5KI6A 2Z1GA 1HNIA 4Z0UA 1WSIA 1TK8A 3EY1A 4CEAA 1VRUA 3AVFA 4I2PA 1NJZA 2XY6A 1C0MA 1C1BA 3TAGA 3AO2A 1RT5A 4BE2A 4FJ7A 1HPZA 4RG8A 1HMVA 4C8NA 5KRSA 2ZE2A 2Y1IA 4L8RB 3HVRA 4CEZA 3PO5A 2ZQBA 3TAQA 1NKCA 2X6SA 3MEGA 4KTQA 4CIGA 3OS2A 3LP1A 1NJYA 1NOYA 2XY8A 1QS4A 4J2AA 2Z1IA 1BL3A 4HVJA 3RR8A 4KKOA 1VSMA 4NCGA 4M42A 2HHWA 3K5OA 1JLQA 2G8UA 4OPKA 4DU3A 4QOZB 1LWFA 4ID5A 4BE1A 1VSHA 4FK2A 3KD1E 3V1QA 1VSIA 3ZCMA 2XY5A 3PO4A 1BGXT 4CE9A 4LSNA 1VSEA 4CJKA 2EHGA 4FJKA 4IG0A 3DLRA 3L3VA 4CJFA 4OPJA 4K8XA 3AO1A 1HYVA 3HP9A 4CEDA 4QCLA 2XO7A 1T7PA 1ITGA 4DU4A 3BGRA 3S3NA 1D9DA 4FJMA 3HK2A 4JRPA 3SQ0A 3CFPA 4OKKA 4CJSA 2FBTA 1XI1A 2P5GA 1L3SA 1BCOA 3K2PA 4GMJB 1KLMA 4IBNA 4QAGA 3U3GA 1RDBA 3AA3A 2OPRA 3DRRA 1DLOA 3G0ZA 3VQ4A 1R0AA 1L3VA 1RTDA 2IGIA 1B9DA 5CYQA 3V9SA 3WNEA 5J1EA 4AH9A 3O4QA 3NGZA 2BE2A 4CEBA 2YV0X 1XWLA 2VG5A 3ZSOA 1WSHA 3NHGA 3RMDA 2Z1HA 1JLFA 3TAPA 4E89A 1LAVA 3SPZA 4E0DA 1VSJA 1GOCA 4AHTA 1BCMA 4O4GA 3AVGA 3RMBA 1SL0A 4E7LA 1NK0A 5HRRA 4BWJA 3LWMA 4E7KA 3NCIA 1RT6A 1BI4B 3ZSVA 1HYSA 1C0TA 4CGGA 4DSEA 3VA0A 3LZJA 5HRPA 1BIZA 1TAQA 4DTNA 1T03A 1QSYA 1FK9A 1QQCA 3M8PA 3OYEA 1QE1A 2G8KA 4KRFA 2G8WA 3DYAA 1RDAA 3WNFA 1RDCA 4EZ9A 3CYMA 3TABA 4DWIA 2VG7A 3OYMA 1WSGA 4AHRA 4CHOA 4KHYA 4DLEA 4FLTA 1JLGA 1ZBLA 1IG9A 3AVLA 4FJNA 3LPUA 4N76A 1TV6A 4LH5A 2YNGA 5JS1A 4PY5A 4B9SA 2OPQA 5FDLA 1KRPA 4DTXA 1XHZA 4JLHA 2KTQA 4HTUA 4HUGA 2G8HA 1JLAA 3PY8A 4DTUA 3LP2A 4CK2A 4BDPA 3HP6A 3C6TA 1CZBA 2PZSA 4I9LA 4DQRA 4FZXC 3DLBA 3KKSA 3M8RA 4DMNA 1KFDA 1RT2A 1FKOA 2A1SA 4DS5A 3QEIA 1Y97A 1S1XA 3FFIA 3V1OA 5I42A 2QKKA 4CGDA 1ZYQA 3KTQA 4H4MA 3AVIA 3DMJA 3RR7A 1C0UA 2VWJA 3THVA 1ZBFA 1WSJA 3ZSQA 4O5BA 1VSDA 1BI4A 4FJJA 3LZIA 1VK0A 3KK1A 3QNNA 4CK1A 1S1WA 2E6LA 3T1AA 1TK5A 5D3GA 1Q9YA 1TKDA 1UA0A 3AA5X 1Z26A 5HRNA 2G8IA 4FLWA 4CF8A 3QEXA 3QEWA 3K5NA 4B9UA 1KSPA 4G1QA 4DU1A 1BIUA 2BGGA 1RTHA 3VQPA 3V9UA 2G8VA 1WSFA 4HCBA 2HHXA 4LSLA 2A1RA 1SL1A 3KLHA 1CLQA 5SWMA 2O4IA 4CIEA 3OY9A 3NH0A 4J2DA 4CEEA 4DQQA 4AHVA 3SI6A 3MEDA 4HUEA 3QIOA 1HJRA 3KLFA 3SV4A 3E01A 3V4IA 2KZZA 3RMCA 3VQCA 3OS0A 3SUNA 2DFEA 4Z4HA 4N41A 3DRSA 1T05A 1UWBA 1UAXA 4E3SA 5CZ2A 4WE1A 4Q5VA 2IDOA 4E7IA 5J2NA 2ITGA 5J2PA 2D5RA 3I8DA 4CHZA 4KV8A 3S3OA 1NK9A 1REVA 1X9WA 1QSLA 1RT3A 3ZSXA 1X1PA 4PWDA 1RT7A 1ZBUA 1NOZA 1GOAA 1W0HA 2LSNA 1TGOA 1VSFA 4MFBA 1KTQA 3DOLA 2B5JA 1YTUA 1KCFA 3RRGA 5FRNA 3LP0A 1EX4A 4FLZA 5C24A 1RDDA 3M8QA 5HROA 3OYBA 1S1TA 1XHXA 3TAMA 1TL3A 4FJXA 3OYAA 4DSIA 3WNHA 3HO1A 3DM2A 3F9KA 3S9HA 3HSTB 1NKEA 1WAFA 1IKYA 4CJEA 4KREA 4H4OA 1S6PA 1JL1A 4CHQA 2Q3SA 1NK4A 4CJVA 4FJ8A 3PX4A 1WAJA 3HVTA 4O0JA 4RW4A 3AVMA 4CGJA 4EP4A 1JL2A 2B6AA 2RPIA 1VRTA 2IAJA 1U49A 4BDYA 4FLYA 4Z4CA 4AILC 2KFNA 4CF9A 2VWKA 1TKZA 4KFBA 3RRHA 3VA3A 4PUOA 4FLVA 1NKBA 1J53A 4HUFA 3SV3A 3ASMA 4FM0A 4DFKA 4ID1A 4E7HA 4FW1A 4HCCA 4IG3A 4DG1A 3CQ8A 1LW2A 4FJIA 4FVMA 4M3ZA 2D0AA 4F4KA 4DTSA 1K6YA 3ULDA 2RKIA 2QK9A 4UQGA 1BQNA 4FXDA 2OA8A 2KQ2A 4AHSA 1TVRA 4M41A 4OLBA 2GV9A 1HYZA 1UA1A 3G10A 1IH7A 1YT3A 2IS3A 1HQEA 1GOBA 1S9GA 3K59A 3NGIA 4N47A 3L2VA 4CJUA 4CFCA 1NK7A 4F3OA 1ASVA 2HB5A 3O3GA 2QKBA 4FJGA 4CGIA 4RW6A 1QSSA 2FC0A 2WONA 2R7YA 1TAUA 1ZBHA 3CG7A 4DFMA 3OJSA 3B6PA 3L2RA 4CEOA 4B9VA 3M8SA 3VQDA 5SZTA 1D9FA 1QHTA 3TR8A 4F8RA 3T3FA 4H8KA 1X9MA 4NYFA 4KTWA 1JXEA 4CFAA 4PA1A 4W5OA 5J2MA 3SUPA 1RCHA 3SUOA 2KFZA 1RBVA 1RBSA 3AVJA 1I3AA 3SJJA 3O4NA 4M3TA 3NF7A 3SYZA 4FLXA 2HHVA 3NBPA 4IFYA 4DLGA 4DQSA 2FBYA 1C1CA 3LPTA 4KI4A 3AVHA 4EP5A 3VQ9A 4FM2A 1IKWA 4W5NA 3CFRA 3AVBA 1EP4A 4IKFA 2HHQA 5C42A 3HPGA 2DFHA 2YHAA 3NF8A 3KLGA 3PX6A 4J2BA 2D0BA 4HHTA 4B9MA 1IO2A 4R5PA 3TAEA 1KLNA 1MU2A 1LAWA 4ICLA 3DLEA 4TSXA 3AVKA 3T19A 1S1UA 3AO5A 2WOMA 2P5OA 3SPYA 3P5JA 3QEPA 4KO0A 1VSLA 5KRTA 4M3RA 3MXIA 4F2SA 2HHSA 1CXUA 3VQAA 3A2FA 1O1WA 1RT4A 2OPSA 2X6NA 3VQ7A 3OYNA 1A5VA 2DY4A 3ZT2A 4ELVA 3ZT1A 4RW7A 3QEVA 4IDKA 3V1RA 1CXQA 4B08A 3MEEA 3MECA 1RT1A 3HPHA 3TAFA 2HMIA 1FXXA 3EZ5A 2F8SA 4CERA 4CFDA 1JKHA 3SZ2A 3QNOA 3MXMA 3V81A 4C8MA 4DTJA 4KAZA 2HNYA 1EETA 1SUQA 2YKMA 3PUFA 3KK2A 4Y1DA 4B9LA 3ZSZA 1RBRA 3VQQA
chains in the Genus database with same CATH superfamily
3DXMB 4C8KA 1W9HA 3D2EA 3QBWA 3K57A 3VN5A 4JS4A 4DFJA 5EXWA 4CJLA 4JK9A 1JCGA 4B3SK 3CC2N 4DV7K 3CJ1A 3JYTA 5AQNA 3VQ5A 1NK5A 3VF4A 3QO9A 5BRFA 2XRIA 1SS6A 4FK4A 1NNEA 5C25A 1HQUA 3IKMA 3O8MA 1VQ5N 3I0RA 1SKWA 4FJHA 3SK3A 1ATNA 1OH6A 2YNHA 4IOAL 2W42A 3V9WA 3ATUA 2DTUA 3DI6A 2YJFA 2DFFA 3L6QA 4GNIA 4JRQA 3CCLN 1JCEA 1QTMA 1U49A 1J54A 4LD0A 4KHSA 4AF1A 1YVUA 4DB3A 4V19S 3L2QA 3EZWA 1NJXA 3B8AX 4FWRA 3F9MA 2QWRA 5FPDA 3PX0A 3R3LA 3AV9A 3EYZA 4Z4GA 2P9PA 4BRMA 3HRGA 4ELUA 4CHPA 4CEQA 3RWUA 2GUIA 4CJRA 3U3YA 4DSJA 4IEEA 4FOEA 1XC3A 4M3XA 1ASWA 1Q86O 1RILA 2Y1JA 3OYGA 3ZT4A 4EFHA 2A42A 4ZHRA 1I39A 4GKJK 3CJCA 1LWCA 5LJVA 3NVKA 2ASOA 2O8DA 2QEXN 4E19A 3WNGA 3KIOA 2F9WA 5AQZA 5AQMA 3VEZA 2EX3A 3LDLA 3QETA 1SKRA 4KB1A 4IZ9A 1Q18A 4CJTA 1J9AA 3H3OB 4M63C 3IG1A 4CJWA 3TTDA 1IJJA 2P51A 3H1QA 3ENOA 3U9ZA 1I94K 1RNHA 4JNEA 3NVMA 3LALA 3H08A 2X78A 5FRMA 2IOCA 2QWPA 2OANA 3CJBA 5FPNA 2Q31A 1TKXA 2IC3A 2UYTA 2P1JA 1SL2A 3IRXA 5HBMA 3LANA 4GKKK 1VQKN 3U8XA 4GW6A 4Z94A 1FW6A 2VYPA 1D4XA 1RTJA 3ZSWA 4E1MA 3TU5A 4HTLA 3W3DA 3K0SA 5J2QA 3ZSRA 3N4PA 4NLBA 1BQMA 5T7BA 4FPBA 3S3MA 3D2FB 5KGXA 1EKEA 3K5MA 2GBZA 3HYFA 3LAMA 1VQ6N 3JSMA 4ISGA 4A59A 1G99A 3A8YA 3C95A 1U04A 1X9JA 4CJPA 2HVHA 3A5LC 1Q8IA 1C1AA 1ZXOA 3ZT0A 1IKVA 4O44A 1JLBA 4DUZK 3MCPA 4BWMA 1HNVA 3O9SA 4H5VA 4U67L 5AR0A 4DS4A 3VMFB 2HHUA 4F3TA 3OYHA 4Y1CA 4YNQA 5ELZA 4KB0A 1HKCA 3ZX0A 1XMOK 2YHBA 1BU6O 1V4TA 5K14A 4CZMA 3CM6A 1HNIA 4Z0UA 1WSIA 4M7YA 1QZ6A 2P9IA 1NJZA 1C1BA 4EHUA 1M1KO 3AO2A 4DR5K 1GLCG 4DUYK 2CGJA 3T1YK 4KHPK 2Q97A 3MWTA 3MEGA 2XY8A 2HMPA 2Z1IA 4HVJA 3M3ZA 4H5WA 3CMEN 2HHWA 4F9OA 1LWFA 4ID5A 3VTHA 3KD1E 4B1XB 3V1QA 1BGXT 4BGAA 4IG0A 4OPJA 3L3VA 4CJFA 4K8XA 3HP9A 2QWNA 4AM6A 4DU4A 4BRAA 4BRHA 4WFBL 4FJMA 1YITN 3SQ0A 2VGMA 3CFPA 4OKKA 2VQEK 1XI1A 3KWGA 4QAGA 2OPRA 3DRRA 1RTDA 1TYQA 3NGZA 1XWLA 3ZSOA 3CJ7A 3QDKA 1JLFA 4E89A 3SPZA 1NGBA 3CPEA 1SL0A 4E7LA 2IIRA 4E7KA 4LF8K 3ZSVA 1HYSA 5JVHL 3J7AP 3VA0A 5AZJA 4DTNA 4MO5A 3MN9A 4XH5A 4NO7A 1DEJA 5AQSA 4DKWA 4L3QA 4YY3K 2YCHA 3CYMA 4X62K 4DR7K 2ZJRL 1ZBLA 1JLGA 1NJIO 2YNGA 5JS1A 4PY5A 1XHZA 4HUGA 1JLAA 4DTUA 4CK2A 5AQPA 5C10A 2A5XA 4FZXC 3DLBA 1TUUA 4DMNA 1RT2A 2QKKA 5GADP 4R79A 2GEMA 1R59O 3RR7A 3HSCA 3ZSQA 2YHWA 1N33K 1VSDA 5ADXA 3J81O 4CK1A 2E6LA 2Q36A 4JI2K 3WQUA 4A61A 2ZJQL 1NGAA 5AQWA 1U2VB 3K5NA 1RTHA 3AAPA 3V9UA 1VQ4N 1SL1A 4FWLA 3KLHA 1CLQA 2O4IA 3NH0A 1SAZA 4CEEA 4EHTA 3SI6A 3CC4N 3QIOA 1HJRA 3KLFA 3RMCA 3SUNA 5AQGA 4XEIA 1UWBA 3DWLA 2PBDA 3DLLL 4CHZA 3S3OA 1REVA 1X1PA 4PWDA 2JWLA 1W0HA 5A2QO 3DOLA 2B5JA 3RRGA 3ZLJA 3THXB 3M6GA 1NMNA 4H0TB 4MLHA 5C24A 3M8QA 3WXMB 3CCMN 1QVGM 4JI5K 1TL3A 3PSIA 4DSIA 4H4OA 1NK4A 1WAJA 4O0JA 4RW4A 4EP4A 4JI1K 4CGJA 1JL2A 2B6AA 3G25A 4KFBA 3KWIA 2BUPA 3VA3A 4HUFA 1JJ2M 3J7ZO 3SV3A 5AQHA 4FM0A 4DFKA 4BRPA 4DG1A 2QK9A 3BZKA 3WXIA 4DR3K 4A5BA 4UQGA 1BQNA 4FXDA 2KQ2A 4M41A 4OLBA 2QTDA 3GG4A 3VESA 1UA1A 4ILHA 3MN5A 4PKIA 1QSSA 4IJNA 4DFMA 2O8BA 3SBTA 3B6PA 3MK6A 3L2RA 3TR8A 3HBTA 3T3FA 4H8KA 3VTIA 2UXDK 3CCSN 1JXEA 3IMXA 4CFAA 4C23A 4CZHA 2KFZA 1RBSA 3SAGA 1I3AA 3J7YP 3NF7A 3N4QA 4IFYA 1E4FT 2P9KA 3WT0A 2GELA 4EP5A 1IKWA 1YXQA 2E2QA 2QXLA 3AVBA 3O1WA 3S41A 3NF8A 3ZX3A 1IO2A 3TAEA 4ICLA 1GLEG 3U9DA 3DLEA 4JI4K 3SPYA 4IOXA 3MXIA 1WOQA 3A2FA 3HM8A 3ZETB 1RT4A 2DY4A 3ZT2A 1GLFO 4B08A 3D7EO 5AQOA 3WQTA 3EZ5A 3GE1A 4CFDA 1HNZK 3EKUA 3OHRA 5BR8K 3R6MA 3UE5A 4B9LA 5D3GA 4CIFA 3VQQA 4KH4A 4RW9A 4LC9B 3P1GA 1RFQA 4CJQA 4H0PA 4AHUA 2FBXA 2P9LA 1NJWA 4A2AA 5M1FA 2ZGYA 4E7JA 3QFUA 1RBTA 1TL1A 1L3TA 3I0SA 4DTOA 4BR9A 2FSKA 4BRDA 5AQRA 5JLHA 2VG6A 4KPYA 2ZGZA 4UY8O 2D4WA 4JKDA 3OW2M 4DV0K 3SQ2A 2OYQA 1G15A 4B9TA 3FLCO 1BHLA 4CZLA 5GIPA 1IBKK 2WUSA 4PL8A 4FO0A 3O80A 2W6LA 5AQTA 1A5XA 4F2RA 2HF4A 5CR4A 3AA2A 4NYNA 3V6DA 1IBLK 1S5JA 4DV5K 3QIPA 4IEIA 3SMSA 2G8FA 4BRCA 4LY7A 2WBNA 3OYDA 1DT9A 5AFUA 1MWMA 5MLCQ 2UXCK 3LAKA 4B3MK 5KTQA 3VEVA 3OS1A 5CYMA 3ZT3A 4C8LA 4Z4FA 5GIOA 1Q9XA 5HP1A 2NRWA 4DHYA 1XUPO 1S1VA 4LF6K 4CF1A 1EXQA 1DTTA 3DXMA 3L0QA 1FKPA 1W97L 1Z6RA 5M1NA 2NRXA 4CJ4A 2PYJA 4DTPA 3HJFA 4MQ3A 5C0YA 1N6QA 3U6FA 1C0FA 2B4JA 1TYQB 4I9QA 1K8KA 4LFCK 1U47A 4FJ5A 1MA9B 4M45A 4CECA 3C6AA 4N5SA 2CGLA 4LH4A 1DTQA 3O3FA 1YTAA 3TTCA 1C6VA 4JS5A 3KLIA 2NUBA 3NGYA 2A40A 4C8OA 2HNZA 1SV5A 4JKAA 3CFOA 3VEYA 3O9UA 4H0YB 3AVCA 4FJLA 5KQ8A 1ILYA 4MDAA 1TKTA 2P9NB 3BDPA 3DOKA 4NCAA 4DQPA 4CJ5A 5HLFA 1YJNN 3IAYA 3VQEA 4OVLA 1U48A 4CCHA 5AJ3K 4O0IA 1NGFA 4FWSA 1RBUA 4H5NA 4WFAL 2PYLA 3NH2A 1XC9A 3L2UA 4B8CA 2E6MA 4PQUA 4M3YA 3D2EB 4ISEA 2ASPA 4CI6A 1RGIA 3NMUA 3HXMA 3MWPA 2VWBA 2QXFA 4FWKA 3I33A 1KFSA 3HL8A 3QINA 1VQMN 3DLHA 3ITHA 2FF3B 2GUPA 4DF8A 4CJ3A 3BP8A 4FJ9A 1TK0A 4DSKA 3LDSA 1OH5A 1OH8A 3EL2A 5JLFA 2YNFA 2Z1JA 4FW2A 4FK0A 2VGNA 3AA4A 3KKRA 2GWJA 1OKJA 1WNSA 1WN7A 3DAWA 3FE1A 4N56A 4KHNA 3CJAA 3NAEA 3B6OA 3TTFA 1S72N 2OPPA 5CZ1A 4OKEA 4CD1A 2RF2A 1JLEA 3C6UA 2FSNA 1Z05A 4BACA 4DR4K 5LY3A 4ILJA 3C94A 1GLJO 3MCAB 4NXMK 3AVFA 2XY6A 1C0MA 4C1NK 1RT5A 3UKUA 1HPZA 4C8NA 4CZGA 4JI0K 2Y1IA 4FWQA 4KTQA 1NJYA 4YHHK 5AFUH 1VSMA 1XNQK 4OPKA 4DU3A 4QOZB 4BE1A 1VSHA 3SAFA 3PO4A 4CE9A 1RDWX 4CJKA 2EHGA 3DLRA 3AO1A 1HYVA 4CEDA 3K9JA 1EWRA 5I9EB 4QCLA 1ITGA 1HPMA 4BC5A 4LF4K 3S3NA 3G6EN 4JRPA 3HK2A 3CCQN 4CJSA 1NGDA 4RCHA 3CMAN 1QVFM 3E1YA 2P5GA 2HBLA 1BCOA 4GMJB 3U3GA 4CESA 4FLUA 1D8YA 3G0ZA 2O8CA 4JI8K 3JAMO 1B9DA 5CYQA 5J1EA 1YJWN 2BE2A 3Q7BA 4CEBA 1CZAN 3NHGA 2Z1HA 4E0DA 1VSJA 1KQSM 1GOCA 4AHTA 3AVGA 1S22A 1SQKA 4BWJA 1BIZA 1TAQA 1K8AO 3M8PA 1QE1A 4B3TK 2CH6A 2G8KA 4BROA 3GL1A 1RDAA 3WNFA 2FLOA 4JD2B 3OYMA 5GAGP 4NB4A 1NGEA 1TV6A 5FDLA 4B1UB 2KTQA 4JLHA 4HTUA 2G8HA 5F1XA 4BDPA 2GX9A 1MDUB 2QWQA 2A1SA 3P4IA 5I42A 4FWOA 4CGDA 1ZYQA 4H4MA 3AVIA 1N8RO 1C0UA 3DXKA 2VWJA 4YOTA 1WBDA 2V7YA 4FJJA 5AQJA 2A6AA 1XNRK 3AA5X 4CF8A 3QEWA 4JAXA 2EWSA 2HBMA 4Y0WA 1P90A 4DU1A 1BIUA 2BGGA 1WSFA 3CERA 4LSLA 5SWMA 4CIEA 3OY9A 3MMVA 4HUEA 3K9KA 1HKGA 4RWTA 4JEPA 3VQCA 2DFEA 4Z4HA 4J8FA 4GV3A 4E7IA 3FFKB 5J2NA 2ITGA 5J2PA 2D5RA 1QSLA 4KV8A 3CC7N 1KAXA 3ZETA 1RT3A 4CBWA 1HNXK 5JMVA 1NOZA 3EE9A 3PIOL 1TGOA 1KTQA 1KCFA 3E9LA 3KZBA 5HROA 1EO1A 3HO1A 3F9KA 1NKEA 4CJEA 3OA9A 4DR6K 2FSJA 1S6PA 4CHQA 2Q3SA 2GWKA 1IV0A 3AVMA 4FL9A 2RPIA 1VRTA 4FLYA 3T69A 1N36K 5CHIA 4DR1K 4FLVA 3L4QA 4ID1A 1OH7A 2OCEA 4YOXA 4IG3A 3CQ8A 2D0AA 4F4KA 5AQKA 3ULDA 4IXCA 2OA8A 2GV9A 1GLLO 3A0IX 3ATVA 2IS3A 1P8ZA 2KHOA 1HQEA 1NGJA 3VGMA 2Q2RA 2ZWHA 1NK7A 1ASVA 2HB5A 2QKBA 4RW6A 2PFUA 2QM1A 4PHTX 4AM7A 3AY9A 1BA0A 2HBJA 4XH4A 1NG9A 2BTFA 4CD3A 1X9MA 3SUOA 2F7TA 1RCHA 5BR9A 3AVJA 3EN9A 3SJJA 1XQSC 3NBPA 1C1CA 3LPTA 3VQ9A 4W5NA 3CFRA 4IKFA 1LCUA 3HPGA 1YJ9N 3KLGA 3PX6A 3QB0A 4HHTA 4B9MA 3ID8A 4JV5K 1IBMK 1LAWA 4TSXA 3AVKA 3AO5A 2P5OA 3P5JA 4FOIA 4KO0A 5KRTA 4F2SA 1Q81O 5E26A 2HHSA 3ENBA 3I8BA 3MDQA 1H1VA 2QA4N 4RW7A 3QEVA 3MEEA 3CIPA 1KD1O 2RE2A 1JKHA 1X3NA 1QZ5A 3H1VX 3RSEA 2O8EB 1SUQA 2YKMA 2J4RA 3KK2A 3G71N 4Y1DA 3D6RA 3ZSZA 1JXBA 4EAHD 3BZCA 4CHNA 3DLGA 3HT3A 3KLEA 4BE0A 4FM1A 3I56N 3UKRA 3CCUN 2I5JA 4WQ4A 2JLEA 3OYLA 3ZSYA 3PSFA 4A5AA 4K8ZA 2W40A 4H5RA 1HRHA 2UUAK 1VSKA 5BREA 1SKSA 2BDPA 1ZBIA 2P9SB 5HL7L 2P9UB 3UIQA 3QFPA 2BANA 4CGFA 2P9PB 4I6MA 5EU7A 2A41A 2D0OA 3CETA 1T6CA 4H5TA 4OGCA 3CQYA 4CF0A 1VQNN 2O4GA 1DKGD 1NM1A 3MN7A 1S9EA 1LV5A 3SCXA 4JI6K 3NF6A 4JK7A 4C1NI 1WSEA 3VQ8A 3VEXA 1NK6A 3LWLA 3AVNA 3ZX2A 3SBGA 4YOVA 2QW9A 3D45A 3K5LA 4BR4A 1V4SA 1BG3A 4KHWA 3GOIA 4DSLA 3CHWA 4CZIA 3CCVN 3E9PA 4OO1J 5DMRA 3VQ6A 2OTLN 4LF9K 2HSTA 3NH1A 2D0CA 3DLKA 5BPMA 3OYKA 4BRNA 1UOCA 2YKNA 4Z4IA 3E9OA 4KH6A 2HBKA 4CFBA 3TWHA 3TI0A 1J5EK 3TPQA 2HNDA 2E1ZA 4WQ4C 3K58A 4OJRA 1BISA 1ZC6A 2HVIA 4EIAA 5IWAK 2PY5A 1X9SA 2CH5A 1J5OA 5FPEA 4M3WA 3OYIA 4A2BA 4A57A 2FBVA 4FWNA 4CEFA 1VHXA 1WB9A 4ZTJA 3KJVA 1WUAA 1HKBA 1JLCA 3A5NC 4W5QA 2RN2A 3ID6A 3PV8A 4FZYA 1KAZA 1B92A 5AQXA 3CM5A 3D2FA 4JK8A 4B9NA 5EY4A 2QWMA 3O4WA 4WCEL 3SQ1A 4H0OA 3F73A 4CF2A 1T8EA 4K41A 2CGKA 4B3OA 2BH1A 4IFVA 3OYFA 2ZD1A 2F96A 2HHHK 1EQYA 2KW4A 2NRHA 4FZZA 1Z25A 1YI2N 2HW3A 3C6HA 4NCBA 1WLJA 2A3ZA 3MN6A 4IO8A 4CHYA 2IVPA 4Q0BA 2UU9K 4XIUA 3QLHA 4RTFD 1A5WA 4B1WB 4ELTA 4B1YB 5M1QA 2X74A 3J8AA 4JD2A 1KAYA 3LP3A 3NFAA 4GVMA 3V9ZA 3AO3A 3QICA 4AHCA 3NE6A 2XY7A 5KGWA 4BR0A 2KKZA 4JKGB 3OYJA 2OZSA 4IWVA 4B1VA 1N5YA 3TSQA 3C7NB 5B8HA 3SUQA 1NBWA 2E4LA 4AQYK 2KZMA 4YDUA 2XHBA 4DF4A 3IS9A 3OTOK 1OVYA 2Z1GA 1TK8A 4DV3K 2P9LB 1VRUA 4I2PA 3TAGA 3O5BA 4O8UA 4CZFA 2UUBK 4RG8A 5KRSA 1HMVA 4M7XA 3CI5A 4DCHA 3HVRA 3TAQA 1NKCA 2X6SA 3OS2A 3LP1A 1NOYA 3LM2A 3CPWM 1BL3A 4KKOA 3ULEA 4NCGA 4B1ZA 3K5OA 3LDQA 5KPZA 4BRFA 5TKWA 4FK2A 2Q1NA 1VSIA 3ZCMA 2XY5A 2NRVA 1VSEA 3T1HK 1JCFA 1BUPA 5GAEP 1T7PA 3UKUB 2E1YA 3BEXA 3CXCM 1D9DA 4QS8A 4IBNA 4BR7A 1R0AA 3FZLA 3O9RA 1L3VA 2IGIA 3V9SA 3WNEA 4AH9A 5JVGL 3GBTA 3WXKA 2YV0X 2AP1A 1BO5O 1WSHA 5AQVA 1YUWA 4FWMA 1LAVA 4GV6A 1QQNA 1N32K 1BCMA 4O4GA 3LWMA 1RT6A 4BY9C 3OBYA 4CGGA 4K0KK 3WXJA 1T03A 3BF1A 1QSYA 1FK9A 3KVGA 3DYAA 3W0LA 3M1FA 3HZ6A 5LJWA 4EZ9A 1GLBG 3TABA 4DWIA 1WSGA 4CHOA 4DLEA 3LPUA 1E4GT 4LH5A 4BR5A 2F9TA 2OPQA 1KRPA 3LP2A 4JKCA 3HP6A 3C6TA 2PZSA 4I9LA 3KKSA 3M8RA 1WBBA 1FKOA 4DS5A 3QEIA 1Y97A 1S1XA 2E2NA 3THYA 3DMJA 3EE8A 3CF5L 3THVA 3LDNA 1WSJA 3WEEB 4O5BA 4K42A 4BRIA 3LZIA 1HR0K 1VK0A 3FZHA 1S1WA 1TK5A 2O8FA 1Q9YA 1TKDA 3R9PA 3GDQA 5HRNA 3A5OC 4FLWA 2G8IA 3QEXA 4BVPA 3HOTA 1VQPN 1YVNA 3MX5A 4G1QA 3CCEN 2A1RA 4CVNE 1HX1A 4G9ZA 4AHVA 3VF2A 3MEDA 4CW7B 5KQDA 1W7AA 4B9QA 2E2OA 2IVNA 4LF5K 3VPZA 3SV4A 3V4IA 2ASMA 3P31A 4N41A 3SLCA 3DRSA 1T05A 1UAXA 4YDUC 4E3SA 2IDOA 1NK9A 1SZ2A 3ZSXA 5M1PA 1ZBUA 1K8KB 1GOAA 3TSPA 1VSFA 1YTUA 5FRNA 5AZIA 4K43A 4FLZA 1RDDA 3O1BA 1BOTO 5F0XA 1S1TA 3TAMA 2YHYA 4IFEA 3OYAA 3WNHA 4JKHA 3DM2A 3FZKA 3S9HA 1WAFA 1IKYA 4KREA 1QQMA 3PX4A 2WTUA 3C0BA 5BPNA 4JKFA 4BDYA 4AILC 4JYAK 2KFNA 2P9NA 4LF7K 1TKZA 3RRHA 1T3VA 4PUOA 4JI3K 1J53A 3ASMA 4QS9A 4FW1A 4M3ZA 4FJIA 1LW2A 4FVMA 5BN8A 1K6YA 2RKIA 1TVRA 2WFBA 1GLDG 3EO3A 3FGUA 2NLXA 2QWOA 1YT3A 3G10A 4LFBK 3VEOA 2E8AA 1S9GA 4WYBA 3K59A 3NGIA 4CJUA 4CFCA 4F3OA 5AQUA 4FJGA 4CGIA 4IO9L 2WONA 2R7YA 3CG7A 2E5LK 4CEOA 3M8SA 5M1OA 4A62A 5SZTA 1QHTA 3H3NO 5KPRA 5F2RA 2W6KA 4NYFA 2D0PA 3F2KA 4KTWA 4PA1A 3LDPA 4W5OA 2YHXA 3O4NA 4FLXA 4X64K 4DQSA 4YORA 1U6ZA 3MX2A 2FBYA 3AVHA 5BPLA 4FM2A 5BRDA 4H03B 5C12A 1EP4A 3KK7A 2ITMA 2DFHA 3UKRB 2YHAA 4JKBA 2D0BA 3FR0A 4YOYA 4R5PA 1MU2A 2VCPA 3T19A 4XH1A 1S1UA 3A5MC 2WOMA 3VOVA 3THXA 3QEPA 3T7ZA 1O1WA 4OX9K 2X6NA 2I7PA 4ELVA 3VGLA 4WQ5A 5DM6L 3MECA 1RT1A 5LMNK 3HPHA 2AA4A 3TAFA 1N34K 3VERA 3QNOA 3SZ2A 4U7BA 3IDHA 2JWKA 4KAZA 5AQFA 2P9KB 5CY4A 1IG9A 1KVAA 3R8EA 4DV4K 4CJ7A 4CK3A 2I7NA 4DTRA 1B9FA 3RTVA 2P9IB 1IKXA 1NWKA 4DSFA 3C7NA 1YHQN 4CBUA 3NF9A 1W2BM 3KD5E 4CBXA 3OBWA 1T6DA 3IFRA 2ETJA 3ISNC 4J2EA 3L3UA 3OVNA 1LOTB 1NK8A 4OPAA 4BRKA 3SQ4A 4Z4EA 1LW0A 4FCYA 2VQFK 3IUCA 2D1KA 3O08A 4EZ6A 5FROA 2AJQA 4KH5A 3TARA 3MXJA 3D0PA 3NDKA 3ENHA 4DV6K 3WUHA 1FJGK 3KK3A 1ATSA 3ZEUB 3L8BA 3BUZB 5IT9O 2WC9A 3RMAA 1VQ7N 2YNIA 1NGHA 2E20A 5M1KA 4BRLA 3J80O 3JXUA 4ILGB 2OZMA 3MAQA 2F8TA 3O3HA 4O55A 2ATQA 1X3MA 4JHDB 3SAHA 4MDBA 1NMDA 1RTIA 3HM9A 1KVCA 1GLAG 3AAQA 3P38A 1F21A 1LWEA 4JI7K 1VAZA 5AQIA 3VQBA 3L4IA 2NRRA 2O8CB 5AQQA 4B8AB 1VQLN 4BRGA 3BY5A 5DK5A 4CGHA 3THWB 1L3UA 3QESA 4I7FA 4ZTFA 1U4BA 3C65A 4BDZA 1CZ9A 3L2WA 4BC3A 2RHKA 2HHTA 4NXNK 4YFUA 4CZKA 1D5AA 4FSVA 3OYCA 3AGRA 3P83D 3V9XA 4OLAA 2DPNA 4ISFA 2O8DB 4DTMA 4E1NA 1S6QA 2JGUA 2E2PA 4M3UA 5TKYA 1HLUA 3WEEA 1U45A 5JICA 2O8FB 3ALYA 2PAVA 3THYB 3U4LA 3SNNA 3HPOA 2GTDA 4PL7A 1XMQK 4FYDA 2O8EA 1ASUA 4OGEA 5E41A 1K73O 2YI1A 3P39A 4W5TA 4YOWA 4BG8A 5GAHP 1EWQA 1ESVA 4RW8A 3DRPA 4OPHA 2KLAA 4KTZA 1KVBA 2NRZA 3AVAA 4W5RA 4DV2K 4DFPA 1L5UA 3QERA 3TANA 3OJUA 3PIPL 4KI6A 5C15A 4DQIA 3PLAA 4I6MB 5AQLA 3AO4A 5EVZA 2V7ZA 1NLVA 2YX6A 3LL3A 3O9TA 4BQLA 3HI0A 2NNWA 1ATRA 4OKJA 4KHQA 4I2QA 3H45C 5JS2A 4BR2A 4KHUA 5HRSA 3VGKA 2NRTA 5I3UA 4HWIA 1K9MO 2IVOA 5KI6A 1NGCA 4BC4A 3EY1A 4CEAA 5EOYA 3H6EA 5C2FA 4BE2A 4FJ7A 2ZE2A 3R1XA 4DV1K 1M90O 2QI2A 4L8RB 4CEZA 3PO5A 2ZQBA 4KBOA 4CIGA 1Q7YO 5LMUK 5LL6Z 2ZM6K 1QS4A 3EKSA 4J2AA 4BQZA 4M42A 3RR8A 1JLQA 1TUYA 5AQYA 2G8UA 1T44A 4FJKA 4LSNA 5ADXH 1O13A 4GV9A 4BVOA 2XO7A 3G4SN 2HF3A 3O6WA 3BGRA 2P9SA 3JS6A 3AARA 3M5RA 5HOOA 2FBTA 3KHYA 1L3SA 3K2PA 1KLMA 1RDBA 3AA3A 3VQ4A 1DLOA 1HNWK 3VEWA 3O4QA 4NLCA 3VETA 1BWFO 2VG5A 3RMDA 3RVCA 3TAPA 4BC2A 1HUXA 3RMBA 4FWPA 4H0VB 5HRRA 4JHDA 1NK0A 3NCIA 1BI4B 3VF6A 1C0TA 4DSEA 3LZJA 5HRPA 2ZF5O 1QQCA 4GY2B 1QHAA 2FF6A 3OYEA 4KRFA 2G8WA 4LFAK 2OTJN 1YIJN 4GVEA 3SMPA 1RDCA 4O5FA 2VG7A 4AHRA 4KHYA 4FLTA 3AVLA 3SJHA 4JN4A 4WF9L 4FJNA 4N76A 1J6ZA 4B9SA 4BG9A 4DTXA 3PY8A 1CZBA 4DQRA 2UUCK 1KFDA 4YOUA 3FFIA 3V1OA 4IDHA 1ZBSA 5BRHA 3KTQA 3CCJN 5FPMA 1ZBFA 4E1JA 3LM9A 3Q7CA 1BI4A 1MWKA 2NZTA 1C0GA 3KK1A 3QNNA 3DJCA 3T1AA 5C2DA 1UA0A 1DGKN 1Z26A 3ZYYX 4DQ8A 1HJOA 2UXBK 5KPTA 4B9UA 1KSPA 3VENA 4X65K 3VQPA 1VQ9N 2G8VA 4HCBA 2HHXA 3O9QA 2Q0RA 5CE3A 5BN9A 4J2DA 4DQQA 5DM7L 4JKGA 1E3MA 3E01A 2KZZA 3OS0A 2F4VK 1YF5L 4PKHA 3TSUA 2Q0UA 3BF3A 4WE1A 5CZ2A 5EX5A 4Q5VA 3I8DA 1X9WA 4MLEA 3I55N 1RT7A 2LSNA 3FZFA 4MFBA 1KC8O 5FLXO 2QWLA 2P9UA 3EEQA 3F5TA 3LP0A 1EX4A 3FZMA 4MO4A 2V52B 3OYBA 1XHXA 2FXUA 3WXLA 4FJXA 1RDUA 3HSTB 5GINA 4K25A 4FJ8A 1JL1A 4CJVA 3HVTA 4IOCL 2IAJA 4Z4CA 4CF9A 2VWKA 1NKBA 2YJEA 1NGIA 4BGBA 4E7HA 2O8BB 4HCCA 3DXKB 4DR2K 4DTSA 3AGKA 4H0XB 4AHSA 4BREA 1HYZA 1IH7A 2HOEA 1GOBA 4BRQA 3UB5A 4CZEA 4N47A 3L2VA 3ZEUA 3ULEB 4JKEA 3O3GA 3THWA 4PKGA 1NU0A 2FC0A 1Y64A 1BDGA 1TAUA 5E84A 2ZJPL 1ZBHA 2V51B 1S3XA 3OJSA 1KXPA 4B9VA 3CJ9A 3VQDA 3HOSA 1D9FA 4F8RA 3QBXA 3QMLA 4FPAA 4QS7A 5J2MA 5AZJB 3SUPA 1VQ8N 1RBVA 4WQ5C 1NGGA 4CZJA 3CD6N 4M3TA 3HTVA 3SYZA 4FVUA 2W41A 2HHVA 4DLGA 1OVQA 1U2VA 4B3RK 3H46O 4KI4A 1BA1A 3E66A 2H3GX 2HHQA 5C42A 5AZIB 4X66K 2E88A 4J2BA 3RSEB 1KLNA 3CQXA 1IG8A 4O8KA 1VSLA 4M3RA 1Q82O 3VQAA 1CXUA 2OPSA 3VQ7A 3OYNA 1A5VA 3ZT1A 1YAGA 4IDKA 3V1RA 1CXQA 3CCRN 4IJAA 4WFNL 2HMIA 3LDOA 1FXXA 2F8SA 1QQOA 4CERA 3MXMA 3V81A 4C8MA 4DTJA 1VQON 2HNYA 1EETA 5H1SQ 3PUFA 1RBRA
chains in the Genus database with same CATH topology
4C8KA 1KVAA 1W9HA 4RW9A 4CHNA 3K57A 3DLGA 4CK3A 3HT3A 3KLEA 4BE0A 3P1GA 4FM1A 4DTRA 4CJQA 1B9FA 2I5JA 3VN5A 4AHUA 4JS4A 4DFJA 2FBXA 2JLEA 4CJLA 3OYLA 3RTVA 1NJWA 3ZSYA 4E7JA 4K8ZA 1IKXA 4DSFA 1RBTA 1TL1A 3NF9A 4CIFA 1HRHA 3KD5E 3JYTA 3I0SA 1VSKA 3VQ5A 4DTOA 1NK5A 1L3TA 3QO9A 1SKSA 2BDPA 1ZBIA 2XRIA 4FK4A 2ETJA 2VG6A 4KPYA 3ISNC 4J2EA 3L3UA 3UIQA 3OVNA 1D8YA 5C25A 1HQUA 3SQ2A 2BANA 4CGFA 1NK8A 3I0RA 3SQ4A 1SKWA 4FJHA 4Z4EA 2OYQA 1LW0A 5EU7A 1G15A 4B9TA 2YNHA 1BHLA 4FCYA 2W42A 3V9WA 4OGCA 2DTUA 4CF0A 3DI6A 2O4GA 1A5XA 2DFFA 5CY4A 4JRQA 4EZ6A 5FROA 4F2RA 1S9EA 1LV5A 1QTMA 2AJQA 3SCXA 3AA2A 1J54A 4NYNA 4LD0A 3TARA 3MXJA 3D0PA 3NF6A 3V6DA 1YVUA 4KHSA 1WSEA 3VQ8A 1S5JA 3NDKA 3KK3A 3L2QA 3L8BA 3QIPA 1NK6A 1NJXA 3LWLA 3AVNA 2G8FA 3RMAA 3PX0A 4LY7A 2YNIA 3AV9A 3EYZA 3OYDA 4Z4GA 3D45A 3K5LA 4ELUA 4CHPA 4CEQA 3RWUA 3LAKA 2OZMA 2GUIA 4CJRA 3U3YA 4KHWA 4DSLA 4DSJA 3MAQA 5KTQA 3O3HA 1ASWA 3OS1A 1RILA 4M3XA 2Y1JA 5CYMA 2F8TA 3ZT3A 4C8LA 4O55A 3OYGA 4Z4FA 2ATQA 3ZT4A 1Q9XA 5HP1A 5DMRA 4ZHRA 1S1VA 4CF1A 1EXQA 1DTTA 3VQ6A 1RTIA 3HM9A 1I39A 1KVCA 2D0CA 3DLKA 3NH1A 3OYKA 1FKPA 1F21A 1LWEA 1LWCA 1UOCA 4CJ4A 2YKNA 4Z4IA 2PYJA 4DTPA 3HJFA 4MQ3A 3VQBA 1N6QA 4E19A 4CFBA 3TWHA 3U6FA 4B8AB 3WNGA 3KIOA 3TI0A 2B4JA 4I9QA 1U47A 4FJ5A 2HNDA 3K58A 4M45A 1JXBA 4OJRA 2EX3A 4CECA 1BISA 3QETA 4N5SA 5DK5A 4CGHA 1L3UA 4LH4A 3QESA 2HVIA 1SKRA 4KB1A 4I7FA 2PY5A 4CJTA 1DTQA 3O3FA 1J9AA 1YTAA 1X9SA 1C6VA 1J5OA 4JS5A 3KLIA 4M3WA 4ZTFA 3IG1A 3OYIA 4CJWA 1U4BA 2FBVA 2NUBA 3NGYA 4BDZA 1CZ9A 4CEFA 3L2WA 4C8OA 2HNZA 1SV5A 4ZTJA 2HHTA 2P51A 3KJVA 3CFOA 4YFUA 1JLCA 1D5AA 1RNHA 4W5QA 3LALA 3AVCA 2X78A 3H08A 4FJLA 5FRMA 3OYCA 2IOCA 1TKTA 2RN2A 3P83D 3BDPA 3DOKA 3V9XA 4NCAA 4DQPA 4OLAA 4CJ5A 3PV8A 4FZYA 1B92A 1TKXA 3CM5A 2IC3A 4DTMA 5HLFA 4E1NA 4B9NA 1S6QA 3IAYA 2P1JA 3VQEA 1SL2A 3IRXA 2JGUA 4OVLA 5HBMA 4M3UA 3SQ1A 3LANA 3F73A 1U48A 4GW6A 4CF2A 4CCHA 1U45A 1T8EA 4O0IA 3ALYA 1RTJA 3ZSWA 4E1MA 4B3OA 4IFVA 3OYFA 2ZD1A 1RBUA 2F96A 3SNNA 5J2QA 2KW4A 3ZSRA 3HPOA 2PYLA 3NH2A 1XC9A 3L2UA 4FZZA 4FYDA 1Z25A 4B8CA 2E6MA 4FLUA 4PQUA 1BQMA 1ASUA 4CESA 5T7BA 4OGEA 5E41A 4M3YA 3S3MA 5KGXA 1EKEA 4W5TA 3K5MA 2GBZA 2HW3A 3HYFA 3LAMA 4NCBA 1WLJA 3HXMA 4RW8A 3DRPA 3JSMA 4CHYA 3C95A 2QXFA 4KTZA 1U04A 4CJPA 4Q0BA 2HVHA 1KVBA 1KFSA 3AVAA 3HL8A 3QINA 4W5RA 4DFPA 3DLHA 3ITHA 1L5UA 1Q8IA 1C1AA 3QLHA 3ZT0A 4XIUA 3QERA 4DF8A 4CJ3A 3TANA 3OJUA 1A5WA 4FJ9A 1IKVA 4O44A 1JLBA 1TK0A 4ELTA 4BWMA 2X74A 4KI6A 4DSKA 3LDSA 1HNVA 4DQIA 2YNFA 3AO4A 4DS4A 3LP3A 3NFAA 2Z1JA 4GVMA 4FW2A 2HHUA 3V9ZA 4FK0A 3AO3A 4F3TA 4AHCA 3OYHA 3AA4A 4Y1CA 3NE6A 3KKRA 4YNQA 2XY7A 5KGWA 1WNSA 1WN7A 4KB0A 4OKJA 3OYJA 4N56A 2OZSA 4KHNA 1N5YA 4KHQA 4I2QA 3NAEA 3B6OA 5JS2A 2OPPA 5CZ1A 4OKEA 3SUQA 5HRSA 2RF2A 1JLEA 2E4LA 2YHBA 4KHUA 3C6UA 4BACA 2KZMA 5I3UA 2XHBA 5K14A 4DF4A 3IS9A 3C94A 3CM6A 5KI6A 2Z1GA 1HNIA 4Z0UA 1WSIA 1TK8A 3EY1A 4CEAA 1VRUA 3AVFA 4I2PA 1NJZA 2XY6A 1C0MA 1C1BA 3TAGA 3AO2A 1RT5A 4BE2A 4FJ7A 1HPZA 4RG8A 1HMVA 4C8NA 5KRSA 2ZE2A 2Y1IA 4L8RB 3HVRA 4CEZA 3PO5A 2ZQBA 3TAQA 1NKCA 2X6SA 3MEGA 4KTQA 4CIGA 3OS2A 3LP1A 1NJYA 1NOYA 2XY8A 1QS4A 4J2AA 2Z1IA 1BL3A 4HVJA 3RR8A 4KKOA 1VSMA 4NCGA 4M42A 2HHWA 3K5OA 1JLQA 2G8UA 4OPKA 4DU3A 4QOZB 1LWFA 4ID5A 4BE1A 1VSHA 4FK2A 3KD1E 3V1QA 1VSIA 3ZCMA 2XY5A 3PO4A 1BGXT 4CE9A 4LSNA 1VSEA 4CJKA 2EHGA 4FJKA 4IG0A 3DLRA 3L3VA 4CJFA 4OPJA 4K8XA 3AO1A 1HYVA 3HP9A 4CEDA 4QCLA 2XO7A 1T7PA 1ITGA 4DU4A 3BGRA 3S3NA 1D9DA 4FJMA 3HK2A 4JRPA 3SQ0A 3CFPA 4OKKA 4CJSA 2FBTA 1XI1A 2P5GA 1L3SA 1BCOA 3K2PA 4GMJB 1KLMA 4IBNA 4QAGA 3U3GA 1RDBA 3AA3A 2OPRA 3DRRA 1DLOA 3G0ZA 3VQ4A 1R0AA 1L3VA 1RTDA 2IGIA 1B9DA 5CYQA 3V9SA 3WNEA 5J1EA 4AH9A 3O4QA 3NGZA 2BE2A 4CEBA 2YV0X 1XWLA 2VG5A 3ZSOA 1WSHA 3NHGA 3RMDA 2Z1HA 1JLFA 3TAPA 4E89A 1LAVA 3SPZA 4E0DA 1VSJA 1GOCA 4AHTA 1BCMA 4O4GA 3AVGA 3RMBA 1SL0A 4E7LA 1NK0A 5HRRA 4BWJA 3LWMA 4E7KA 3NCIA 1RT6A 1BI4B 3ZSVA 1HYSA 1C0TA 4CGGA 4DSEA 3VA0A 3LZJA 5HRPA 1BIZA 1TAQA 4DTNA 1T03A 1QSYA 1FK9A 1QQCA 3M8PA 3OYEA 1QE1A 2G8KA 4KRFA 2G8WA 3DYAA 1RDAA 3WNFA 1RDCA 4EZ9A 3CYMA 3TABA 4DWIA 2VG7A 3OYMA 1WSGA 4AHRA 4CHOA 4KHYA 4DLEA 4FLTA 1JLGA 1ZBLA 1IG9A 3AVLA 4FJNA 3LPUA 4N76A 1TV6A 4LH5A 2YNGA 5JS1A 4PY5A 4B9SA 2OPQA 5FDLA 1KRPA 4DTXA 1XHZA 4JLHA 2KTQA 4HTUA 4HUGA 2G8HA 1JLAA 3PY8A 4DTUA 3LP2A 4CK2A 4BDPA 3HP6A 3C6TA 1CZBA 2PZSA 4I9LA 4DQRA 4FZXC 3DLBA 3KKSA 3M8RA 4DMNA 1KFDA 1RT2A 1FKOA 2A1SA 4DS5A 3QEIA 1Y97A 1S1XA 3FFIA 3V1OA 5I42A 2QKKA 4CGDA 1ZYQA 3KTQA 4H4MA 3AVIA 3DMJA 3RR7A 1C0UA 2VWJA 3THVA 1ZBFA 1WSJA 3ZSQA 4O5BA 1VSDA 1BI4A 4FJJA 3LZIA 1VK0A 3KK1A 3QNNA 4CK1A 1S1WA 2E6LA 3T1AA 1TK5A 5D3GA 1Q9YA 1TKDA 1UA0A 3AA5X 1Z26A 5HRNA 2G8IA 4FLWA 4CF8A 3QEXA 3QEWA 3K5NA 4B9UA 1KSPA 4G1QA 4DU1A 1BIUA 2BGGA 1RTHA 3VQPA 3V9UA 2G8VA 1WSFA 4HCBA 2HHXA 4LSLA 2A1RA 1SL1A 3KLHA 1CLQA 5SWMA 2O4IA 4CIEA 3OY9A 3NH0A 4J2DA 4CEEA 4DQQA 4AHVA 3SI6A 3MEDA 4HUEA 3QIOA 1HJRA 3KLFA 3SV4A 3E01A 3V4IA 2KZZA 3RMCA 3VQCA 3OS0A 3SUNA 2DFEA 4Z4HA 4N41A 3DRSA 1T05A 1UWBA 1UAXA 4E3SA 5CZ2A 4WE1A 4Q5VA 2IDOA 4E7IA 5J2NA 2ITGA 5J2PA 2D5RA 3I8DA 4CHZA 4KV8A 3S3OA 1NK9A 1REVA 1X9WA 1QSLA 1RT3A 3ZSXA 1X1PA 4PWDA 1RT7A 1ZBUA 1NOZA 1GOAA 1W0HA 2LSNA 1TGOA 1VSFA 4MFBA 1KTQA 3DOLA 2B5JA 1YTUA 1KCFA 3RRGA 5FRNA 3LP0A 1EX4A 4FLZA 5C24A 1RDDA 3M8QA 5HROA 3OYBA 1S1TA 1XHXA 3TAMA 1TL3A 4FJXA 3OYAA 4DSIA 3WNHA 3HO1A 3DM2A 3F9KA 3S9HA 3HSTB 1NKEA 1WAFA 1IKYA 4CJEA 4KREA 4H4OA 1S6PA 1JL1A 4CHQA 2Q3SA 1NK4A 4CJVA 4FJ8A 3PX4A 1WAJA 3HVTA 4O0JA 4RW4A 3AVMA 4CGJA 4EP4A 1JL2A 2B6AA 2RPIA 1VRTA 2IAJA 1U49A 4BDYA 4FLYA 4Z4CA 4AILC 2KFNA 4CF9A 2VWKA 1TKZA 4KFBA 3RRHA 3VA3A 4PUOA 4FLVA 1NKBA 1J53A 4HUFA 3SV3A 3ASMA 4FM0A 4DFKA 4ID1A 4E7HA 4FW1A 4HCCA 4IG3A 4DG1A 3CQ8A 1LW2A 4FJIA 4FVMA 4M3ZA 2D0AA 4F4KA 4DTSA 1K6YA 3ULDA 2RKIA 2QK9A 4UQGA 1BQNA 4FXDA 2OA8A 2KQ2A 4AHSA 1TVRA 4M41A 4OLBA 2GV9A 1HYZA 1UA1A 3G10A 1IH7A 1YT3A 2IS3A 1HQEA 1GOBA 1S9GA 3K59A 3NGIA 4N47A 3L2VA 4CJUA 4CFCA 1NK7A 4F3OA 1ASVA 2HB5A 3O3GA 2QKBA 4FJGA 4CGIA 4RW6A 1QSSA 2FC0A 2WONA 2R7YA 1TAUA 1ZBHA 3CG7A 4DFMA 3OJSA 3B6PA 3L2RA 4CEOA 4B9VA 3M8SA 3VQDA 5SZTA 1D9FA 1QHTA 3TR8A 4F8RA 3T3FA 4H8KA 1X9MA 4NYFA 4KTWA 1JXEA 4CFAA 4PA1A 4W5OA 5J2MA 3SUPA 1RCHA 3SUOA 2KFZA 1RBVA 1RBSA 3AVJA 1I3AA 3SJJA 3O4NA 4M3TA 3NF7A 3SYZA 4FLXA 2HHVA 3NBPA 4IFYA 4DLGA 4DQSA 2FBYA 1C1CA 3LPTA 4KI4A 3AVHA 4EP5A 3VQ9A 4FM2A 1IKWA 4W5NA 3CFRA 3AVBA 1EP4A 4IKFA 2HHQA 5C42A 3HPGA 2DFHA 2YHAA 3NF8A 3KLGA 3PX6A 4J2BA 2D0BA 4HHTA 4B9MA 1IO2A 4R5PA 3TAEA 1KLNA 1MU2A 1LAWA 4ICLA 3DLEA 4TSXA 3AVKA 3T19A 1S1UA 3AO5A 2WOMA 2P5OA 3SPYA 3P5JA 3QEPA 4KO0A 1VSLA 5KRTA 4M3RA 3MXIA 4F2SA 2HHSA 1CXUA 3VQAA 3A2FA 1O1WA 1RT4A 2OPSA 2X6NA 3VQ7A 3OYNA 1A5VA 2DY4A 3ZT2A 4ELVA 3ZT1A 4RW7A 3QEVA 4IDKA 3V1RA 1CXQA 4B08A 3MEEA 3MECA 1RT1A 3HPHA 3TAFA 2HMIA 1FXXA 3EZ5A 2F8SA 4CERA 4CFDA 1JKHA 3SZ2A 3QNOA 3MXMA 3V81A 4C8MA 4DTJA 4KAZA 2HNYA 1EETA 1SUQA 2YKMA 3PUFA 3KK2A 4Y1DA 4B9LA 3ZSZA 1RBRA 3VQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8K A;  1KVA A;  1W9H A;  4RW9 A;  4CHN A;  3K57 A;  3DLG A;  4CK3 A;  3HT3 A;  3KLE A;  4BE0 A;  3P1G A;  4FM1 A;  4DTR A;  4CJQ A;  1B9F A;  2I5J A;  3VN5 A;  4AHU A;  4JS4 A;  4DFJ A;  2FBX A;  2JLE A;  4CJL A;  3OYL A;  3RTV A;  1NJW A;  3ZSY A;  4E7J A;  4K8Z A;  1IKX A;  4DSF A;  1RBT A;  1TL1 A;  3NF9 A;  4CIF A;  1HRH A;  3KD5 E;  3JYT A;  3I0S A;  1VSK A;  3VQ5 A;  4DTO A;  1NK5 A;  1L3T A;  3QO9 A;  1SKS A;  2BDP A;  1ZBI A;  2XRI A;  4FK4 A;  2ETJ A;  2VG6 A;  4KPY A;  3ISN C;  4J2E A;  3L3U A;  3UIQ A;  3OVN A;  1D8Y A;  5C25 A;  1HQU A;  3SQ2 A;  2BAN A;  4CGF A;  1NK8 A;  3I0R A;  3SQ4 A;  1SKW A;  4FJH A;  4Z4E A;  2OYQ A;  1LW0 A;  5EU7 A;  1G15 A;  4B9T A;  2YNH A;  1BHL A;  4FCY A;  2W42 A;  3V9W A;  4OGC A;  2DTU A;  4CF0 A;  3DI6 A;  2O4G A;  1A5X A;  2DFF A;  5CY4 A;  4JRQ A;  4EZ6 A;  5FRO A;  4F2R A;  1S9E A;  1LV5 A;  1QTM A;  2AJQ A;  3SCX A;  3AA2 A;  1J54 A;  4NYN A;  4LD0 A;  3TAR A;  3MXJ A;  3D0P A;  3NF6 A;  3V6D A;  1YVU A;  4KHS A;  1WSE A;  3VQ8 A;  1S5J A;  3NDK A;  3KK3 A;  3L2Q A;  3L8B A;  3QIP A;  1NK6 A;  1NJX A;  3LWL A;  3AVN A;  2G8F A;  3RMA A;  3PX0 A;  4LY7 A;  2YNI A;  3AV9 A;  3EYZ A;  3OYD A;  4Z4G A;  3D45 A;  3K5L A;  4ELU A;  4CHP A;  4CEQ A;  3RWU A;  3LAK A;  2OZM A;  2GUI A;  4CJR A;  3U3Y A;  4KHW A;  4DSL A;  4DSJ A;  3MAQ A;  5KTQ A;  3O3H A;  1ASW A;  3OS1 A;  1RIL A;  4M3X A;  2Y1J A;  5CYM A;  2F8T A;  3ZT3 A;  4C8L A;  4O55 A;  3OYG A;  4Z4F A;  2ATQ A;  3ZT4 A;  1Q9X A;  5HP1 A;  5DMR A;  4ZHR A;  1S1V A;  4CF1 A;  1EXQ A;  1DTT A;  3VQ6 A;  1RTI A;  3HM9 A;  1I39 A;  1KVC A;  2D0C A;  3DLK A;  3NH1 A;  3OYK A;  1FKP A;  1F21 A;  1LWE A;  1LWC A;  1UOC A;  4CJ4 A;  2YKN A;  4Z4I A;  2PYJ A;  4DTP A;  3HJF A;  4MQ3 A;  3VQB A;  1N6Q A;  4E19 A;  4CFB A;  3TWH A;  3U6F A;  4B8A B;  3WNG A;  3KIO A;  3TI0 A;  2B4J A;  4I9Q A;  1U47 A;  4FJ5 A;  2HND A;  3K58 A;  4M45 A;  1JXB A;  4OJR A;  2EX3 A;  4CEC A;  1BIS A;  3QET A;  4N5S A;  5DK5 A;  4CGH A;  1L3U A;  4LH4 A;  3QES A;  2HVI A;  1SKR A;  4KB1 A;  4I7F A;  2PY5 A;  4CJT A;  1DTQ A;  3O3F A;  1J9A A;  1YTA A;  1X9S A;  1C6V A;  1J5O A;  4JS5 A;  3KLI A;  4M3W A;  4ZTF A;  3IG1 A;  3OYI A;  4CJW A;  1U4B A;  2FBV A;  2NUB A;  3NGY A;  4BDZ A;  1CZ9 A;  4CEF A;  3L2W A;  4C8O A;  2HNZ A;  1SV5 A;  4ZTJ A;  2HHT A;  2P51 A;  3KJV A;  3CFO A;  4YFU A;  1JLC A;  1D5A A;  1RNH A;  4W5Q A;  3LAL A;  3AVC A;  2X78 A;  3H08 A;  4FJL A;  5FRM A;  3OYC A;  2IOC A;  1TKT A;  2RN2 A;  3P83 D;  3BDP A;  3DOK A;  3V9X A;  4NCA A;  4DQP A;  4OLA A;  4CJ5 A;  3PV8 A;  4FZY A;  1B92 A;  1TKX A;  3CM5 A;  2IC3 A;  4DTM A;  5HLF A;  4E1N A;  4B9N A;  1S6Q A;  3IAY A;  2P1J A;  3VQE A;  1SL2 A;  3IRX A;  2JGU A;  4OVL A;  5HBM A;  4M3U A;  3SQ1 A;  3LAN A;  3F73 A;  1U48 A;  4GW6 A;  4CF2 A;  4CCH A;  1U45 A;  1T8E A;  4O0I A;  3ALY A;  1RTJ A;  3ZSW A;  4E1M A;  4B3O A;  4IFV A;  3OYF A;  2ZD1 A;  1RBU A;  2F96 A;  3SNN A;  5J2Q A;  2KW4 A;  3ZSR A;  3HPO A;  2PYL A;  3NH2 A;  1XC9 A;  3L2U A;  4FZZ A;  4FYD A;  1Z25 A;  4B8C A;  2E6M A;  4FLU A;  4PQU A;  1BQM A;  1ASU A;  4CES A;  5T7B A;  4OGE A;  5E41 A;  4M3Y A;  3S3M A;  5KGX A;  1EKE A;  4W5T A;  3K5M A;  2GBZ A;  2HW3 A;  3HYF A;  3LAM A;  4NCB A;  1WLJ A;  3HXM A;  4RW8 A;  3DRP A;  3JSM A;  4CHY A;  3C95 A;  2QXF A;  4KTZ A;  1U04 A;  4CJP A;  4Q0B A;  2HVH A;  1KVB A;  1KFS A;  3AVA A;  3HL8 A;  3QIN A;  4W5R A;  4DFP A;  3DLH A;  3ITH A;  1L5U A;  1Q8I A;  1C1A A;  3QLH A;  3ZT0 A;  4XIU A;  3QER A;  4DF8 A;  4CJ3 A;  3TAN A;  3OJU A;  1A5W A;  4FJ9 A;  1IKV A;  4O44 A;  1JLB A;  1TK0 A;  4ELT A;  4BWM A;  2X74 A;  4KI6 A;  4DSK A;  3LDS A;  1HNV A;  4DQI A;  2YNF A;  3AO4 A;  4DS4 A;  3LP3 A;  3NFA A;  2Z1J A;  4GVM A;  4FW2 A;  2HHU A;  3V9Z A;  4FK0 A;  3AO3 A;  4F3T A;  4AHC A;  3OYH A;  3AA4 A;  4Y1C A;  3NE6 A;  3KKR A;  4YNQ A;  2XY7 A;  5KGW A;  1WNS A;  1WN7 A;  4KB0 A;  4OKJ A;  3OYJ A;  4N56 A;  2OZS A;  4KHN A;  1N5Y A;  4KHQ A;  4I2Q A;  3NAE A;  3B6O A;  5JS2 A;  2OPP A;  5CZ1 A;  4OKE A;  3SUQ A;  5HRS A;  2RF2 A;  1JLE A;  2E4L A;  2YHB A;  4KHU A;  3C6U A;  4BAC A;  2KZM A;  5I3U A;  2XHB A;  5K14 A;  4DF4 A;  3IS9 A;  3C94 A;  3CM6 A;  5KI6 A;  2Z1G A;  1HNI A;  4Z0U A;  1WSI A;  1TK8 A;  3EY1 A;  4CEA A;  1VRU A;  3AVF A;  4I2P A;  1NJZ A;  2XY6 A;  1C0M A;  1C1B A;  3TAG A;  3AO2 A;  1RT5 A;  4BE2 A;  4FJ7 A;  1HPZ A;  4RG8 A;  1HMV A;  4C8N A;  5KRS A;  2ZE2 A;  2Y1I A;  4L8R B;  3HVR A;  4CEZ A;  3PO5 A;  2ZQB A;  3TAQ A;  1NKC A;  2X6S A;  3MEG A;  4KTQ A;  4CIG A;  3OS2 A;  3LP1 A;  1NJY A;  1NOY A;  2XY8 A;  1QS4 A;  4J2A A;  2Z1I A;  1BL3 A;  4HVJ A;  3RR8 A;  4KKO A;  1VSM A;  4NCG A;  4M42 A;  2HHW A;  3K5O A;  1JLQ A;  2G8U A;  4OPK A;  4DU3 A;  4QOZ B;  1LWF A;  4ID5 A;  4BE1 A;  1VSH A;  4FK2 A;  3KD1 E;  3V1Q A;  1VSI A;  3ZCM A;  2XY5 A;  3PO4 A;  1BGX T;  4CE9 A;  4LSN A;  1VSE A;  4CJK A;  2EHG A;  4FJK A;  4IG0 A;  3DLR A;  3L3V A;  4CJF A;  4OPJ A;  4K8X A;  3AO1 A;  1HYV A;  3HP9 A;  4CED A;  4QCL A;  2XO7 A;  1T7P A;  1ITG A;  4DU4 A;  3BGR A;  3S3N A;  1D9D A;  4FJM A;  3HK2 A;  4JRP A;  3SQ0 A;  3CFP A;  4OKK A;  4CJS A;  2FBT A;  1XI1 A;  2P5G A;  1L3S A;  1BCO A;  3K2P A;  4GMJ B;  1KLM A;  4IBN A;  4QAG A;  3U3G A;  1RDB A;  3AA3 A;  2OPR A;  3DRR A;  1DLO A;  3G0Z A;  3VQ4 A;  1R0A A;  1L3V A;  1RTD A;  2IGI A;  1B9D A;  5CYQ A;  3V9S A;  3WNE A;  5J1E A;  4AH9 A;  3O4Q A;  3NGZ A;  2BE2 A;  4CEB A;  2YV0 X;  1XWL A;  2VG5 A;  3ZSO A;  1WSH A;  3NHG A;  3RMD A;  2Z1H A;  1JLF A;  3TAP A;  4E89 A;  1LAV A;  3SPZ A;  4E0D A;  1VSJ A;  1GOC A;  4AHT A;  1BCM A;  4O4G A;  3AVG A;  3RMB A;  1SL0 A;  4E7L A;  1NK0 A;  5HRR A;  4BWJ A;  3LWM A;  4E7K A;  3NCI A;  1RT6 A;  1BI4 B;  3ZSV A;  1HYS A;  1C0T A;  4CGG A;  4DSE A;  3VA0 A;  3LZJ A;  5HRP A;  1BIZ A;  1TAQ A;  4DTN A;  1T03 A;  1QSY A;  1FK9 A;  1QQC A;  3M8P A;  3OYE A;  1QE1 A;  2G8K A;  4KRF A;  2G8W A;  3DYA A;  1RDA A;  3WNF A;  1RDC A;  4EZ9 A;  3CYM A;  3TAB A;  4DWI A;  2VG7 A;  3OYM A;  1WSG A;  4AHR A;  4CHO A;  4KHY A;  4DLE A;  4FLT A;  1JLG A;  1ZBL A;  1IG9 A;  3AVL A;  4FJN A;  3LPU A;  4N76 A;  1TV6 A;  4LH5 A;  2YNG A;  5JS1 A;  4PY5 A;  4B9S A;  2OPQ A;  5FDL A;  1KRP A;  4DTX A;  1XHZ A;  4JLH A;  2KTQ A;  4HTU A;  4HUG A;  2G8H A;  1JLA A;  3PY8 A;  4DTU A;  3LP2 A;  4CK2 A;  4BDP A;  3HP6 A;  3C6T A;  1CZB A;  2PZS A;  4I9L A;  4DQR A;  4FZX C;  3DLB A;  3KKS A;  3M8R A;  4DMN A;  1KFD A;  1RT2 A;  1FKO A;  2A1S A;  4DS5 A;  3QEI A;  1Y97 A;  1S1X A;  3FFI A;  3V1O A;  5I42 A;  2QKK A;  4CGD A;  1ZYQ A;  3KTQ A;  4H4M A;  3AVI A;  3DMJ A;  3RR7 A;  1C0U A;  2VWJ A;  3THV A;  1ZBF A;  1WSJ A;  3ZSQ A;  4O5B A;  1VSD A;  1BI4 A;  4FJJ A;  3LZI A;  1VK0 A;  3KK1 A;  3QNN A;  4CK1 A;  1S1W A;  2E6L A;  3T1A A;  1TK5 A;  5D3G A;  1Q9Y A;  1TKD A;  1UA0 A;  3AA5 X;  1Z26 A;  5HRN A;  2G8I A;  4FLW A;  4CF8 A;  3QEX A;  3QEW A;  3K5N A;  4B9U A;  1KSP A;  4G1Q A;  4DU1 A;  1BIU A;  2BGG A;  1RTH A;  3VQP A;  3V9U A;  2G8V A;  1WSF A;  4HCB A;  2HHX A;  4LSL A;  2A1R A;  1SL1 A;  3KLH A;  1CLQ A;  5SWM A;  2O4I A;  4CIE A;  3OY9 A;  3NH0 A;  4J2D A;  4CEE A;  4DQQ A;  4AHV A;  3SI6 A;  3MED A;  4HUE A;  3QIO A;  1HJR A;  3KLF A;  3SV4 A;  3E01 A;  3V4I A;  2KZZ A;  3RMC A;  3VQC A;  3OS0 A;  3SUN A;  2DFE A;  4Z4H A;  4N41 A;  3DRS A;  1T05 A;  1UWB A;  1UAX A;  4E3S A;  5CZ2 A;  4WE1 A;  4Q5V A;  2IDO A;  4E7I A;  5J2N A;  2ITG A;  5J2P A;  2D5R A;  3I8D A;  4CHZ A;  4KV8 A;  3S3O A;  1NK9 A;  1REV A;  1X9W A;  1QSL A;  1RT3 A;  3ZSX A;  1X1P A;  4PWD A;  1RT7 A;  1ZBU A;  1NOZ A;  1GOA A;  1W0H A;  2LSN A;  1TGO A;  1VSF A;  4MFB A;  1KTQ A;  3DOL A;  2B5J A;  1YTU A;  1KCF A;  3RRG A;  5FRN A;  3LP0 A;  1EX4 A;  4FLZ A;  5C24 A;  1RDD A;  3M8Q A;  5HRO A;  3OYB A;  1S1T A;  1XHX A;  3TAM A;  1TL3 A;  4FJX A;  3OYA A;  4DSI A;  3WNH A;  3HO1 A;  3DM2 A;  3F9K A;  3S9H A;  3HST B;  1NKE A;  1WAF A;  1IKY A;  4CJE A;  4KRE A;  4H4O A;  1S6P A;  1JL1 A;  4CHQ A;  2Q3S A;  1NK4 A;  4CJV A;  4FJ8 A;  3PX4 A;  1WAJ A;  3HVT A;  4O0J A;  4RW4 A;  3AVM A;  4CGJ A;  4EP4 A;  1JL2 A;  2B6A A;  2RPI A;  1VRT A;  2IAJ A;  1U49 A;  4BDY A;  4FLY A;  4Z4C A;  4AIL C;  2KFN A;  4CF9 A;  2VWK A;  1TKZ A;  4KFB A;  3RRH A;  3VA3 A;  4PUO A;  4FLV A;  1NKB A;  1J53 A;  4HUF A;  3SV3 A;  3ASM A;  4FM0 A;  4DFK A;  4ID1 A;  4E7H A;  4FW1 A;  4HCC A;  4IG3 A;  4DG1 A;  3CQ8 A;  1LW2 A;  4FJI A;  4FVM A;  4M3Z A;  2D0A A;  4F4K A;  4DTS A;  1K6Y A;  3ULD A;  2RKI A;  2QK9 A;  4UQG A;  1BQN A;  4FXD A;  2OA8 A;  2KQ2 A;  4AHS A;  1TVR A;  4M41 A;  4OLB A;  2GV9 A;  1HYZ A;  1UA1 A;  3G10 A;  1IH7 A;  1YT3 A;  2IS3 A;  1HQE A;  1GOB A;  1S9G A;  3K59 A;  3NGI A;  4N47 A;  3L2V A;  4CJU A;  4CFC A;  1NK7 A;  4F3O A;  1ASV A;  2HB5 A;  3O3G A;  2QKB A;  4FJG A;  4CGI A;  4RW6 A;  1QSS A;  2FC0 A;  2WON A;  2R7Y A;  1TAU A;  1ZBH A;  3CG7 A;  4DFM A;  3OJS A;  3B6P A;  3L2R A;  4CEO A;  4B9V A;  3M8S A;  3VQD A;  5SZT A;  1D9F A;  1QHT A;  3TR8 A;  4F8R A;  3T3F A;  4H8K A;  1X9M A;  4NYF A;  4KTW A;  1JXE A;  4CFA A;  4PA1 A;  4W5O A;  5J2M A;  3SUP A;  1RCH A;  3SUO A;  2KFZ A;  1RBV A;  1RBS A;  3AVJ A;  1I3A A;  3SJJ A;  3O4N A;  4M3T A;  3NF7 A;  3SYZ A;  4FLX A;  2HHV A;  3NBP A;  4IFY A;  4DLG A;  4DQS A;  2FBY A;  1C1C A;  3LPT A;  4KI4 A;  3AVH A;  4EP5 A;  3VQ9 A;  4FM2 A;  1IKW A;  4W5N A;  3CFR A;  3AVB A;  1EP4 A;  4IKF A;  2HHQ A;  5C42 A;  3HPG A;  2DFH A;  2YHA A;  3NF8 A;  3KLG A;  3PX6 A;  4J2B A;  2D0B A;  4HHT A;  4B9M A;  1IO2 A;  4R5P A;  3TAE A;  1KLN A;  1MU2 A;  1LAW A;  4ICL A;  3DLE A;  4TSX A;  3AVK A;  3T19 A;  1S1U A;  3AO5 A;  2WOM A;  2P5O A;  3SPY A;  3P5J A;  3QEP A;  4KO0 A;  1VSL A;  5KRT A;  4M3R A;  3MXI A;  4F2S A;  2HHS A;  1CXU A;  3VQA A;  3A2F A;  1O1W A;  1RT4 A;  2OPS A;  2X6N A;  3VQ7 A;  3OYN A;  1A5V A;  2DY4 A;  3ZT2 A;  4ELV A;  3ZT1 A;  4RW7 A;  3QEV A;  4IDK A;  3V1R A;  1CXQ A;  4B08 A;  3MEE A;  3MEC A;  1RT1 A;  3HPH A;  3TAF A;  2HMI A;  1FXX A;  3EZ5 A;  2F8S A;  4CER A;  4CFD A;  1JKH A;  3SZ2 A;  3QNO A;  3MXM A;  3V81 A;  4C8M A;  4DTJ A;  4KAZ A;  2HNY A;  1EET A;  1SUQ A;  2YKM A;  3PUF A;  3KK2 A;  4Y1D A;  4B9L A;  3ZSZ A;  1RBR A;  3VQQ A; 
#chains in the Genus database with same CATH topology
 3DXM B;  4C8K A;  1W9H A;  3D2E A;  3QBW A;  3K57 A;  3VN5 A;  4JS4 A;  4DFJ A;  5EXW A;  4CJL A;  4JK9 A;  1JCG A;  4B3S K;  3CC2 N;  4DV7 K;  3CJ1 A;  3JYT A;  5AQN A;  3VQ5 A;  1NK5 A;  3VF4 A;  3QO9 A;  5BRF A;  2XRI A;  1SS6 A;  4FK4 A;  1NNE A;  5C25 A;  1HQU A;  3IKM A;  3O8M A;  1VQ5 N;  3I0R A;  1SKW A;  4FJH A;  3SK3 A;  1ATN A;  1OH6 A;  2YNH A;  4IOA L;  2W42 A;  3V9W A;  3ATU A;  2DTU A;  3DI6 A;  2YJF A;  2DFF A;  3L6Q A;  4GNI A;  4JRQ A;  3CCL N;  1JCE A;  1QTM A;  1U49 A;  1J54 A;  4LD0 A;  4KHS A;  4AF1 A;  1YVU A;  4DB3 A;  4V19 S;  3L2Q A;  3EZW A;  1NJX A;  3B8A X;  4FWR A;  3F9M A;  2QWR A;  5FPD A;  3PX0 A;  3R3L A;  3AV9 A;  3EYZ A;  4Z4G A;  2P9P A;  4BRM A;  3HRG A;  4ELU A;  4CHP A;  4CEQ A;  3RWU A;  2GUI A;  4CJR A;  3U3Y A;  4DSJ A;  4IEE A;  4FOE A;  1XC3 A;  4M3X A;  1ASW A;  1Q86 O;  1RIL A;  2Y1J A;  3OYG A;  3ZT4 A;  4EFH A;  2A42 A;  4ZHR A;  1I39 A;  4GKJ K;  3CJC A;  1LWC A;  5LJV A;  3NVK A;  2ASO A;  2O8D A;  2QEX N;  4E19 A;  3WNG A;  3KIO A;  2F9W A;  5AQZ A;  5AQM A;  3VEZ A;  2EX3 A;  3LDL A;  3QET A;  1SKR A;  4KB1 A;  4IZ9 A;  1Q18 A;  4CJT A;  1J9A A;  3H3O B;  4M63 C;  3IG1 A;  4CJW A;  3TTD A;  1IJJ A;  2P51 A;  3H1Q A;  3ENO A;  3U9Z A;  1I94 K;  1RNH A;  4JNE A;  3NVM A;  3LAL A;  3H08 A;  2X78 A;  5FRM A;  2IOC A;  2QWP A;  2OAN A;  3CJB A;  5FPN A;  2Q31 A;  1TKX A;  2IC3 A;  2UYT A;  2P1J A;  1SL2 A;  3IRX A;  5HBM A;  3LAN A;  4GKK K;  1VQK N;  3U8X A;  4GW6 A;  4Z94 A;  1FW6 A;  2VYP A;  1D4X A;  1RTJ A;  3ZSW A;  4E1M A;  3TU5 A;  4HTL A;  3W3D A;  3K0S A;  5J2Q A;  3ZSR A;  3N4P A;  4NLB A;  1BQM A;  5T7B A;  4FPB A;  3S3M A;  3D2F B;  5KGX A;  1EKE A;  3K5M A;  2GBZ A;  3HYF A;  3LAM A;  1VQ6 N;  3JSM A;  4ISG A;  4A59 A;  1G99 A;  3A8Y A;  3C95 A;  1U04 A;  1X9J A;  4CJP A;  2HVH A;  3A5L C;  1Q8I A;  1C1A A;  1ZXO A;  3ZT0 A;  1IKV A;  4O44 A;  1JLB A;  4DUZ K;  3MCP A;  4BWM A;  1HNV A;  3O9S A;  4H5V A;  4U67 L;  5AR0 A;  4DS4 A;  3VMF B;  2HHU A;  4F3T A;  3OYH A;  4Y1C A;  4YNQ A;  5ELZ A;  4KB0 A;  1HKC A;  3ZX0 A;  1XMO K;  2YHB A;  1BU6 O;  1V4T A;  5K14 A;  4CZM A;  3CM6 A;  1HNI A;  4Z0U A;  1WSI A;  4M7Y A;  1QZ6 A;  2P9I A;  1NJZ A;  1C1B A;  4EHU A;  1M1K O;  3AO2 A;  4DR5 K;  1GLC G;  4DUY K;  2CGJ A;  3T1Y K;  4KHP K;  2Q97 A;  3MWT A;  3MEG A;  2XY8 A;  2HMP A;  2Z1I A;  4HVJ A;  3M3Z A;  4H5W A;  3CME N;  2HHW A;  4F9O A;  1LWF A;  4ID5 A;  3VTH A;  3KD1 E;  4B1X B;  3V1Q A;  1BGX T;  4BGA A;  4IG0 A;  4OPJ A;  3L3V A;  4CJF A;  4K8X A;  3HP9 A;  2QWN A;  4AM6 A;  4DU4 A;  4BRA A;  4BRH A;  4WFB L;  4FJM A;  1YIT N;  3SQ0 A;  2VGM A;  3CFP A;  4OKK A;  2VQE K;  1XI1 A;  3KWG A;  4QAG A;  2OPR A;  3DRR A;  1RTD A;  1TYQ A;  3NGZ A;  1XWL A;  3ZSO A;  3CJ7 A;  3QDK A;  1JLF A;  4E89 A;  3SPZ A;  1NGB A;  3CPE A;  1SL0 A;  4E7L A;  2IIR A;  4E7K A;  4LF8 K;  3ZSV A;  1HYS A;  5JVH L;  3J7A P;  3VA0 A;  5AZJ A;  4DTN A;  4MO5 A;  3MN9 A;  4XH5 A;  4NO7 A;  1DEJ A;  5AQS A;  4DKW A;  4L3Q A;  4YY3 K;  2YCH A;  3CYM A;  4X62 K;  4DR7 K;  2ZJR L;  1ZBL A;  1JLG A;  1NJI O;  2YNG A;  5JS1 A;  4PY5 A;  1XHZ A;  4HUG A;  1JLA A;  4DTU A;  4CK2 A;  5AQP A;  5C10 A;  2A5X A;  4FZX C;  3DLB A;  1TUU A;  4DMN A;  1RT2 A;  2QKK A;  5GAD P;  4R79 A;  2GEM A;  1R59 O;  3RR7 A;  3HSC A;  3ZSQ A;  2YHW A;  1N33 K;  1VSD A;  5ADX A;  3J81 O;  4CK1 A;  2E6L A;  2Q36 A;  4JI2 K;  3WQU A;  4A61 A;  2ZJQ L;  1NGA A;  5AQW A;  1U2V B;  3K5N A;  1RTH A;  3AAP A;  3V9U A;  1VQ4 N;  1SL1 A;  4FWL A;  3KLH A;  1CLQ A;  2O4I A;  3NH0 A;  1SAZ A;  4CEE A;  4EHT A;  3SI6 A;  3CC4 N;  3QIO A;  1HJR A;  3KLF A;  3RMC A;  3SUN A;  5AQG A;  4XEI A;  1UWB A;  3DWL A;  2PBD A;  3DLL L;  4CHZ A;  3S3O A;  1REV A;  1X1P A;  4PWD A;  2JWL A;  1W0H A;  5A2Q O;  3DOL A;  2B5J A;  3RRG A;  3ZLJ A;  3THX B;  3M6G A;  1NMN A;  4H0T B;  4MLH A;  5C24 A;  3M8Q A;  3WXM B;  3CCM N;  1QVG M;  4JI5 K;  1TL3 A;  3PSI A;  4DSI A;  4H4O A;  1NK4 A;  1WAJ A;  4O0J A;  4RW4 A;  4EP4 A;  4JI1 K;  4CGJ A;  1JL2 A;  2B6A A;  3G25 A;  4KFB A;  3KWI A;  2BUP A;  3VA3 A;  4HUF A;  1JJ2 M;  3J7Z O;  3SV3 A;  5AQH A;  4FM0 A;  4DFK A;  4BRP A;  4DG1 A;  2QK9 A;  3BZK A;  3WXI A;  4DR3 K;  4A5B A;  4UQG A;  1BQN A;  4FXD A;  2KQ2 A;  4M41 A;  4OLB A;  2QTD A;  3GG4 A;  3VES A;  1UA1 A;  4ILH A;  3MN5 A;  4PKI A;  1QSS A;  4IJN A;  4DFM A;  2O8B A;  3SBT A;  3B6P A;  3MK6 A;  3L2R A;  3TR8 A;  3HBT A;  3T3F A;  4H8K A;  3VTI A;  2UXD K;  3CCS N;  1JXE A;  3IMX A;  4CFA A;  4C23 A;  4CZH A;  2KFZ A;  1RBS A;  3SAG A;  1I3A A;  3J7Y P;  3NF7 A;  3N4Q A;  4IFY A;  1E4F T;  2P9K A;  3WT0 A;  2GEL A;  4EP5 A;  1IKW A;  1YXQ A;  2E2Q A;  2QXL A;  3AVB A;  3O1W A;  3S41 A;  3NF8 A;  3ZX3 A;  1IO2 A;  3TAE A;  4ICL A;  1GLE G;  3U9D A;  3DLE A;  4JI4 K;  3SPY A;  4IOX A;  3MXI A;  1WOQ A;  3A2F A;  3HM8 A;  3ZET B;  1RT4 A;  2DY4 A;  3ZT2 A;  1GLF O;  4B08 A;  3D7E O;  5AQO A;  3WQT A;  3EZ5 A;  3GE1 A;  4CFD A;  1HNZ K;  3EKU A;  3OHR A;  5BR8 K;  3R6M A;  3UE5 A;  4B9L A;  5D3G A;  4CIF A;  3VQQ A;  4KH4 A;  4RW9 A;  4LC9 B;  3P1G A;  1RFQ A;  4CJQ A;  4H0P A;  4AHU A;  2FBX A;  2P9L A;  1NJW A;  4A2A A;  5M1F A;  2ZGY A;  4E7J A;  3QFU A;  1RBT A;  1TL1 A;  1L3T A;  3I0S A;  4DTO A;  4BR9 A;  2FSK A;  4BRD A;  5AQR A;  5JLH A;  2VG6 A;  4KPY A;  2ZGZ A;  4UY8 O;  2D4W A;  4JKD A;  3OW2 M;  4DV0 K;  3SQ2 A;  2OYQ A;  1G15 A;  4B9T A;  3FLC O;  1BHL A;  4CZL A;  5GIP A;  1IBK K;  2WUS A;  4PL8 A;  4FO0 A;  3O80 A;  2W6L A;  5AQT A;  1A5X A;  4F2R A;  2HF4 A;  5CR4 A;  3AA2 A;  4NYN A;  3V6D A;  1IBL K;  1S5J A;  4DV5 K;  3QIP A;  4IEI A;  3SMS A;  2G8F A;  4BRC A;  4LY7 A;  2WBN A;  3OYD A;  1DT9 A;  5AFU A;  1MWM A;  5MLC Q;  2UXC K;  3LAK A;  4B3M K;  5KTQ A;  3VEV A;  3OS1 A;  5CYM A;  3ZT3 A;  4C8L A;  4Z4F A;  5GIO A;  1Q9X A;  5HP1 A;  2NRW A;  4DHY A;  1XUP O;  1S1V A;  4LF6 K;  4CF1 A;  1EXQ A;  1DTT A;  3DXM A;  3L0Q A;  1FKP A;  1W97 L;  1Z6R A;  5M1N A;  2NRX A;  4CJ4 A;  2PYJ A;  4DTP A;  3HJF A;  4MQ3 A;  5C0Y A;  1N6Q A;  3U6F A;  1C0F A;  2B4J A;  1TYQ B;  4I9Q A;  1K8K A;  4LFC K;  1U47 A;  4FJ5 A;  1MA9 B;  4M45 A;  4CEC A;  3C6A A;  4N5S A;  2CGL A;  4LH4 A;  1DTQ A;  3O3F A;  1YTA A;  3TTC A;  1C6V A;  4JS5 A;  3KLI A;  2NUB A;  3NGY A;  2A40 A;  4C8O A;  2HNZ A;  1SV5 A;  4JKA A;  3CFO A;  3VEY A;  3O9U A;  4H0Y B;  3AVC A;  4FJL A;  5KQ8 A;  1ILY A;  4MDA A;  1TKT A;  2P9N B;  3BDP A;  3DOK A;  4NCA A;  4DQP A;  4CJ5 A;  5HLF A;  1YJN N;  3IAY A;  3VQE A;  4OVL A;  1U48 A;  4CCH A;  5AJ3 K;  4O0I A;  1NGF A;  4FWS A;  1RBU A;  4H5N A;  4WFA L;  2PYL A;  3NH2 A;  1XC9 A;  3L2U A;  4B8C A;  2E6M A;  4PQU A;  4M3Y A;  3D2E B;  4ISE A;  2ASP A;  4CI6 A;  1RGI A;  3NMU A;  3HXM A;  3MWP A;  2VWB A;  2QXF A;  4FWK A;  3I33 A;  1KFS A;  3HL8 A;  3QIN A;  1VQM N;  3DLH A;  3ITH A;  2FF3 B;  2GUP A;  4DF8 A;  4CJ3 A;  3BP8 A;  4FJ9 A;  1TK0 A;  4DSK A;  3LDS A;  1OH5 A;  1OH8 A;  3EL2 A;  5JLF A;  2YNF A;  2Z1J A;  4FW2 A;  4FK0 A;  2VGN A;  3AA4 A;  3KKR A;  2GWJ A;  1OKJ A;  1WNS A;  1WN7 A;  3DAW A;  3FE1 A;  4N56 A;  4KHN A;  3CJA A;  3NAE A;  3B6O A;  3TTF A;  1S72 N;  2OPP A;  5CZ1 A;  4OKE A;  4CD1 A;  2RF2 A;  1JLE A;  3C6U A;  2FSN A;  1Z05 A;  4BAC A;  4DR4 K;  5LY3 A;  4ILJ A;  3C94 A;  1GLJ O;  3MCA B;  4NXM K;  3AVF A;  2XY6 A;  1C0M A;  4C1N K;  1RT5 A;  3UKU A;  1HPZ A;  4C8N A;  4CZG A;  4JI0 K;  2Y1I A;  4FWQ A;  4KTQ A;  1NJY A;  4YHH K;  5AFU H;  1VSM A;  1XNQ K;  4OPK A;  4DU3 A;  4QOZ B;  4BE1 A;  1VSH A;  3SAF A;  3PO4 A;  4CE9 A;  1RDW X;  4CJK A;  2EHG A;  3DLR A;  3AO1 A;  1HYV A;  4CED A;  3K9J A;  1EWR A;  5I9E B;  4QCL A;  1ITG A;  1HPM A;  4BC5 A;  4LF4 K;  3S3N A;  3G6E N;  4JRP A;  3HK2 A;  3CCQ N;  4CJS A;  1NGD A;  4RCH A;  3CMA N;  1QVF M;  3E1Y A;  2P5G A;  2HBL A;  1BCO A;  4GMJ B;  3U3G A;  4CES A;  4FLU A;  1D8Y A;  3G0Z A;  2O8C A;  4JI8 K;  3JAM O;  1B9D A;  5CYQ A;  5J1E A;  1YJW N;  2BE2 A;  3Q7B A;  4CEB A;  1CZA N;  3NHG A;  2Z1H A;  4E0D A;  1VSJ A;  1KQS M;  1GOC A;  4AHT A;  3AVG A;  1S22 A;  1SQK A;  4BWJ A;  1BIZ A;  1TAQ A;  1K8A O;  3M8P A;  1QE1 A;  4B3T K;  2CH6 A;  2G8K A;  4BRO A;  3GL1 A;  1RDA A;  3WNF A;  2FLO A;  4JD2 B;  3OYM A;  5GAG P;  4NB4 A;  1NGE A;  1TV6 A;  5FDL A;  4B1U B;  2KTQ A;  4JLH A;  4HTU A;  2G8H A;  5F1X A;  4BDP A;  2GX9 A;  1MDU B;  2QWQ A;  2A1S A;  3P4I A;  5I42 A;  4FWO A;  4CGD A;  1ZYQ A;  4H4M A;  3AVI A;  1N8R O;  1C0U A;  3DXK A;  2VWJ A;  4YOT A;  1WBD A;  2V7Y A;  4FJJ A;  5AQJ A;  2A6A A;  1XNR K;  3AA5 X;  4CF8 A;  3QEW A;  4JAX A;  2EWS A;  2HBM A;  4Y0W A;  1P90 A;  4DU1 A;  1BIU A;  2BGG A;  1WSF A;  3CER A;  4LSL A;  5SWM A;  4CIE A;  3OY9 A;  3MMV A;  4HUE A;  3K9K A;  1HKG A;  4RWT A;  4JEP A;  3VQC A;  2DFE A;  4Z4H A;  4J8F A;  4GV3 A;  4E7I A;  3FFK B;  5J2N A;  2ITG A;  5J2P A;  2D5R A;  1QSL A;  4KV8 A;  3CC7 N;  1KAX A;  3ZET A;  1RT3 A;  4CBW A;  1HNX K;  5JMV A;  1NOZ A;  3EE9 A;  3PIO L;  1TGO A;  1KTQ A;  1KCF A;  3E9L A;  3KZB A;  5HRO A;  1EO1 A;  3HO1 A;  3F9K A;  1NKE A;  4CJE A;  3OA9 A;  4DR6 K;  2FSJ A;  1S6P A;  4CHQ A;  2Q3S A;  2GWK A;  1IV0 A;  3AVM A;  4FL9 A;  2RPI A;  1VRT A;  4FLY A;  3T69 A;  1N36 K;  5CHI A;  4DR1 K;  4FLV A;  3L4Q A;  4ID1 A;  1OH7 A;  2OCE A;  4YOX A;  4IG3 A;  3CQ8 A;  2D0A A;  4F4K A;  5AQK A;  3ULD A;  4IXC A;  2OA8 A;  2GV9 A;  1GLL O;  3A0I X;  3ATV A;  2IS3 A;  1P8Z A;  2KHO A;  1HQE A;  1NGJ A;  3VGM A;  2Q2R A;  2ZWH A;  1NK7 A;  1ASV A;  2HB5 A;  2QKB A;  4RW6 A;  2PFU A;  2QM1 A;  4PHT X;  4AM7 A;  3AY9 A;  1BA0 A;  2HBJ A;  4XH4 A;  1NG9 A;  2BTF A;  4CD3 A;  1X9M A;  3SUO A;  2F7T A;  1RCH A;  5BR9 A;  3AVJ A;  3EN9 A;  3SJJ A;  1XQS C;  3NBP A;  1C1C A;  3LPT A;  3VQ9 A;  4W5N A;  3CFR A;  4IKF A;  1LCU A;  3HPG A;  1YJ9 N;  3KLG A;  3PX6 A;  3QB0 A;  4HHT A;  4B9M A;  3ID8 A;  4JV5 K;  1IBM K;  1LAW A;  4TSX A;  3AVK A;  3AO5 A;  2P5O A;  3P5J A;  4FOI A;  4KO0 A;  5KRT A;  4F2S A;  1Q81 O;  5E26 A;  2HHS A;  3ENB A;  3I8B A;  3MDQ A;  1H1V A;  2QA4 N;  4RW7 A;  3QEV A;  3MEE A;  3CIP A;  1KD1 O;  2RE2 A;  1JKH A;  1X3N A;  1QZ5 A;  3H1V X;  3RSE A;  2O8E B;  1SUQ A;  2YKM A;  2J4R A;  3KK2 A;  3G71 N;  4Y1D A;  3D6R A;  3ZSZ A;  1JXB A;  4EAH D;  3BZC A;  4CHN A;  3DLG A;  3HT3 A;  3KLE A;  4BE0 A;  4FM1 A;  3I56 N;  3UKR A;  3CCU N;  2I5J A;  4WQ4 A;  2JLE A;  3OYL A;  3ZSY A;  3PSF A;  4A5A A;  4K8Z A;  2W40 A;  4H5R A;  1HRH A;  2UUA K;  1VSK A;  5BRE A;  1SKS A;  2BDP A;  1ZBI A;  2P9S B;  5HL7 L;  2P9U B;  3UIQ A;  3QFP A;  2BAN A;  4CGF A;  2P9P B;  4I6M A;  5EU7 A;  2A41 A;  2D0O A;  3CET A;  1T6C A;  4H5T A;  4OGC A;  3CQY A;  4CF0 A;  1VQN N;  2O4G A;  1DKG D;  1NM1 A;  3MN7 A;  1S9E A;  1LV5 A;  3SCX A;  4JI6 K;  3NF6 A;  4JK7 A;  4C1N I;  1WSE A;  3VQ8 A;  3VEX A;  1NK6 A;  3LWL A;  3AVN A;  3ZX2 A;  3SBG A;  4YOV A;  2QW9 A;  3D45 A;  3K5L A;  4BR4 A;  1V4S A;  1BG3 A;  4KHW A;  3GOI A;  4DSL A;  3CHW A;  4CZI A;  3CCV N;  3E9P A;  4OO1 J;  5DMR A;  3VQ6 A;  2OTL N;  4LF9 K;  2HST A;  3NH1 A;  2D0C A;  3DLK A;  5BPM A;  3OYK A;  4BRN A;  1UOC A;  2YKN A;  4Z4I A;  3E9O A;  4KH6 A;  2HBK A;  4CFB A;  3TWH A;  3TI0 A;  1J5E K;  3TPQ A;  2HND A;  2E1Z A;  4WQ4 C;  3K58 A;  4OJR A;  1BIS A;  1ZC6 A;  2HVI A;  4EIA A;  5IWA K;  2PY5 A;  1X9S A;  2CH5 A;  1J5O A;  5FPE A;  4M3W A;  3OYI A;  4A2B A;  4A57 A;  2FBV A;  4FWN A;  4CEF A;  1VHX A;  1WB9 A;  4ZTJ A;  3KJV A;  1WUA A;  1HKB A;  1JLC A;  3A5N C;  4W5Q A;  2RN2 A;  3ID6 A;  3PV8 A;  4FZY A;  1KAZ A;  1B92 A;  5AQX A;  3CM5 A;  3D2F A;  4JK8 A;  4B9N A;  5EY4 A;  2QWM A;  3O4W A;  4WCE L;  3SQ1 A;  4H0O A;  3F73 A;  4CF2 A;  1T8E A;  4K41 A;  2CGK A;  4B3O A;  2BH1 A;  4IFV A;  3OYF A;  2ZD1 A;  2F96 A;  2HHH K;  1EQY A;  2KW4 A;  2NRH A;  4FZZ A;  1Z25 A;  1YI2 N;  2HW3 A;  3C6H A;  4NCB A;  1WLJ A;  2A3Z A;  3MN6 A;  4IO8 A;  4CHY A;  2IVP A;  4Q0B A;  2UU9 K;  4XIU A;  3QLH A;  4RTF D;  1A5W A;  4B1W B;  4ELT A;  4B1Y B;  5M1Q A;  2X74 A;  3J8A A;  4JD2 A;  1KAY A;  3LP3 A;  3NFA A;  4GVM A;  3V9Z A;  3AO3 A;  3QIC A;  4AHC A;  3NE6 A;  2XY7 A;  5KGW A;  4BR0 A;  2KKZ A;  4JKG B;  3OYJ A;  2OZS A;  4IWV A;  4B1V A;  1N5Y A;  3TSQ A;  3C7N B;  5B8H A;  3SUQ A;  1NBW A;  2E4L A;  4AQY K;  2KZM A;  4YDU A;  2XHB A;  4DF4 A;  3IS9 A;  3OTO K;  1OVY A;  2Z1G A;  1TK8 A;  4DV3 K;  2P9L B;  1VRU A;  4I2P A;  3TAG A;  3O5B A;  4O8U A;  4CZF A;  2UUB K;  4RG8 A;  5KRS A;  1HMV A;  4M7X A;  3CI5 A;  4DCH A;  3HVR A;  3TAQ A;  1NKC A;  2X6S A;  3OS2 A;  3LP1 A;  1NOY A;  3LM2 A;  3CPW M;  1BL3 A;  4KKO A;  3ULE A;  4NCG A;  4B1Z A;  3K5O A;  3LDQ A;  5KPZ A;  4BRF A;  5TKW A;  4FK2 A;  2Q1N A;  1VSI A;  3ZCM A;  2XY5 A;  2NRV A;  1VSE A;  3T1H K;  1JCF A;  1BUP A;  5GAE P;  1T7P A;  3UKU B;  2E1Y A;  3BEX A;  3CXC M;  1D9D A;  4QS8 A;  4IBN A;  4BR7 A;  1R0A A;  3FZL A;  3O9R A;  1L3V A;  2IGI A;  3V9S A;  3WNE A;  4AH9 A;  5JVG L;  3GBT A;  3WXK A;  2YV0 X;  2AP1 A;  1BO5 O;  1WSH A;  5AQV A;  1YUW A;  4FWM A;  1LAV A;  4GV6 A;  1QQN A;  1N32 K;  1BCM A;  4O4G A;  3LWM A;  1RT6 A;  4BY9 C;  3OBY A;  4CGG A;  4K0K K;  3WXJ A;  1T03 A;  3BF1 A;  1QSY A;  1FK9 A;  3KVG A;  3DYA A;  3W0L A;  3M1F A;  3HZ6 A;  5LJW A;  4EZ9 A;  1GLB G;  3TAB A;  4DWI A;  1WSG A;  4CHO A;  4DLE A;  3LPU A;  1E4G T;  4LH5 A;  4BR5 A;  2F9T A;  2OPQ A;  1KRP A;  3LP2 A;  4JKC A;  3HP6 A;  3C6T A;  2PZS A;  4I9L A;  3KKS A;  3M8R A;  1WBB A;  1FKO A;  4DS5 A;  3QEI A;  1Y97 A;  1S1X A;  2E2N A;  3THY A;  3DMJ A;  3EE8 A;  3CF5 L;  3THV A;  3LDN A;  1WSJ A;  3WEE B;  4O5B A;  4K42 A;  4BRI A;  3LZI A;  1HR0 K;  1VK0 A;  3FZH A;  1S1W A;  1TK5 A;  2O8F A;  1Q9Y A;  1TKD A;  3R9P A;  3GDQ A;  5HRN A;  3A5O C;  4FLW A;  2G8I A;  3QEX A;  4BVP A;  3HOT A;  1VQP N;  1YVN A;  3MX5 A;  4G1Q A;  3CCE N;  2A1R A;  4CVN E;  1HX1 A;  4G9Z A;  4AHV A;  3VF2 A;  3MED A;  4CW7 B;  5KQD A;  1W7A A;  4B9Q A;  2E2O A;  2IVN A;  4LF5 K;  3VPZ A;  3SV4 A;  3V4I A;  2ASM A;  3P31 A;  4N41 A;  3SLC A;  3DRS A;  1T05 A;  1UAX A;  4YDU C;  4E3S A;  2IDO A;  1NK9 A;  1SZ2 A;  3ZSX A;  5M1P A;  1ZBU A;  1K8K B;  1GOA A;  3TSP A;  1VSF A;  1YTU A;  5FRN A;  5AZI A;  4K43 A;  4FLZ A;  1RDD A;  3O1B A;  1BOT O;  5F0X A;  1S1T A;  3TAM A;  2YHY A;  4IFE A;  3OYA A;  3WNH A;  4JKH A;  3DM2 A;  3FZK A;  3S9H A;  1WAF A;  1IKY A;  4KRE A;  1QQM A;  3PX4 A;  2WTU A;  3C0B A;  5BPN A;  4JKF A;  4BDY A;  4AIL C;  4JYA K;  2KFN A;  2P9N A;  4LF7 K;  1TKZ A;  3RRH A;  1T3V A;  4PUO A;  4JI3 K;  1J53 A;  3ASM A;  4QS9 A;  4FW1 A;  4M3Z A;  4FJI A;  1LW2 A;  4FVM A;  5BN8 A;  1K6Y A;  2RKI A;  1TVR A;  2WFB A;  1GLD G;  3EO3 A;  3FGU A;  2NLX A;  2QWO A;  1YT3 A;  3G10 A;  4LFB K;  3VEO A;  2E8A A;  1S9G A;  4WYB A;  3K59 A;  3NGI A;  4CJU A;  4CFC A;  4F3O A;  5AQU A;  4FJG A;  4CGI A;  4IO9 L;  2WON A;  2R7Y A;  3CG7 A;  2E5L K;  4CEO A;  3M8S A;  5M1O A;  4A62 A;  5SZT A;  1QHT A;  3H3N O;  5KPR A;  5F2R A;  2W6K A;  4NYF A;  2D0P A;  3F2K A;  4KTW A;  4PA1 A;  3LDP A;  4W5O A;  2YHX A;  3O4N A;  4FLX A;  4X64 K;  4DQS A;  4YOR A;  1U6Z A;  3MX2 A;  2FBY A;  3AVH A;  5BPL A;  4FM2 A;  5BRD A;  4H03 B;  5C12 A;  1EP4 A;  3KK7 A;  2ITM A;  2DFH A;  3UKR B;  2YHA A;  4JKB A;  2D0B A;  3FR0 A;  4YOY A;  4R5P A;  1MU2 A;  2VCP A;  3T19 A;  4XH1 A;  1S1U A;  3A5M C;  2WOM A;  3VOV A;  3THX A;  3QEP A;  3T7Z A;  1O1W A;  4OX9 K;  2X6N A;  2I7P A;  4ELV A;  3VGL A;  4WQ5 A;  5DM6 L;  3MEC A;  1RT1 A;  5LMN K;  3HPH A;  2AA4 A;  3TAF A;  1N34 K;  3VER A;  3QNO A;  3SZ2 A;  4U7B A;  3IDH A;  2JWK A;  4KAZ A;  5AQF A;  2P9K B;  5CY4 A;  1IG9 A;  1KVA A;  3R8E A;  4DV4 K;  4CJ7 A;  4CK3 A;  2I7N A;  4DTR A;  1B9F A;  3RTV A;  2P9I B;  1IKX A;  1NWK A;  4DSF A;  3C7N A;  1YHQ N;  4CBU A;  3NF9 A;  1W2B M;  3KD5 E;  4CBX A;  3OBW A;  1T6D A;  3IFR A;  2ETJ A;  3ISN C;  4J2E A;  3L3U A;  3OVN A;  1LOT B;  1NK8 A;  4OPA A;  4BRK A;  3SQ4 A;  4Z4E A;  1LW0 A;  4FCY A;  2VQF K;  3IUC A;  2D1K A;  3O08 A;  4EZ6 A;  5FRO A;  2AJQ A;  4KH5 A;  3TAR A;  3MXJ A;  3D0P A;  3NDK A;  3ENH A;  4DV6 K;  3WUH A;  1FJG K;  3KK3 A;  1ATS A;  3ZEU B;  3L8B A;  3BUZ B;  5IT9 O;  2WC9 A;  3RMA A;  1VQ7 N;  2YNI A;  1NGH A;  2E20 A;  5M1K A;  4BRL A;  3J80 O;  3JXU A;  4ILG B;  2OZM A;  3MAQ A;  2F8T A;  3O3H A;  4O55 A;  2ATQ A;  1X3M A;  4JHD B;  3SAH A;  4MDB A;  1NMD A;  1RTI A;  3HM9 A;  1KVC A;  1GLA G;  3AAQ A;  3P38 A;  1F21 A;  1LWE A;  4JI7 K;  1VAZ A;  5AQI A;  3VQB A;  3L4I A;  2NRR A;  2O8C B;  5AQQ A;  4B8A B;  1VQL N;  4BRG A;  3BY5 A;  5DK5 A;  4CGH A;  3THW B;  1L3U A;  3QES A;  4I7F A;  4ZTF A;  1U4B A;  3C65 A;  4BDZ A;  1CZ9 A;  3L2W A;  4BC3 A;  2RHK A;  2HHT A;  4NXN K;  4YFU A;  4CZK A;  1D5A A;  4FSV A;  3OYC A;  3AGR A;  3P83 D;  3V9X A;  4OLA A;  2DPN A;  4ISF A;  2O8D B;  4DTM A;  4E1N A;  1S6Q A;  2JGU A;  2E2P A;  4M3U A;  5TKY A;  1HLU A;  3WEE A;  1U45 A;  5JIC A;  2O8F B;  3ALY A;  2PAV A;  3THY B;  3U4L A;  3SNN A;  3HPO A;  2GTD A;  4PL7 A;  1XMQ K;  4FYD A;  2O8E A;  1ASU A;  4OGE A;  5E41 A;  1K73 O;  2YI1 A;  3P39 A;  4W5T A;  4YOW A;  4BG8 A;  5GAH P;  1EWQ A;  1ESV A;  4RW8 A;  3DRP A;  4OPH A;  2KLA A;  4KTZ A;  1KVB A;  2NRZ A;  3AVA A;  4W5R A;  4DV2 K;  4DFP A;  1L5U A;  3QER A;  3TAN A;  3OJU A;  3PIP L;  4KI6 A;  5C15 A;  4DQI A;  3PLA A;  4I6M B;  5AQL A;  3AO4 A;  5EVZ A;  2V7Z A;  1NLV A;  2YX6 A;  3LL3 A;  3O9T A;  4BQL A;  3HI0 A;  2NNW A;  1ATR A;  4OKJ A;  4KHQ A;  4I2Q A;  3H45 C;  5JS2 A;  4BR2 A;  4KHU A;  5HRS A;  3VGK A;  2NRT A;  5I3U A;  4HWI A;  1K9M O;  2IVO A;  5KI6 A;  1NGC A;  4BC4 A;  3EY1 A;  4CEA A;  5EOY A;  3H6E A;  5C2F A;  4BE2 A;  4FJ7 A;  2ZE2 A;  3R1X A;  4DV1 K;  1M90 O;  2QI2 A;  4L8R B;  4CEZ A;  3PO5 A;  2ZQB A;  4KBO A;  4CIG A;  1Q7Y O;  5LMU K;  5LL6 Z;  2ZM6 K;  1QS4 A;  3EKS A;  4J2A A;  4BQZ A;  4M42 A;  3RR8 A;  1JLQ A;  1TUY A;  5AQY A;  2G8U A;  1T44 A;  4FJK A;  4LSN A;  5ADX H;  1O13 A;  4GV9 A;  4BVO A;  2XO7 A;  3G4S N;  2HF3 A;  3O6W A;  3BGR A;  2P9S A;  3JS6 A;  3AAR A;  3M5R A;  5HOO A;  2FBT A;  3KHY A;  1L3S A;  3K2P A;  1KLM A;  1RDB A;  3AA3 A;  3VQ4 A;  1DLO A;  1HNW K;  3VEW A;  3O4Q A;  4NLC A;  3VET A;  1BWF O;  2VG5 A;  3RMD A;  3RVC A;  3TAP A;  4BC2 A;  1HUX A;  3RMB A;  4FWP A;  4H0V B;  5HRR A;  4JHD A;  1NK0 A;  3NCI A;  1BI4 B;  3VF6 A;  1C0T A;  4DSE A;  3LZJ A;  5HRP A;  2ZF5 O;  1QQC A;  4GY2 B;  1QHA A;  2FF6 A;  3OYE A;  4KRF A;  2G8W A;  4LFA K;  2OTJ N;  1YIJ N;  4GVE A;  3SMP A;  1RDC A;  4O5F A;  2VG7 A;  4AHR A;  4KHY A;  4FLT A;  3AVL A;  3SJH A;  4JN4 A;  4WF9 L;  4FJN A;  4N76 A;  1J6Z A;  4B9S A;  4BG9 A;  4DTX A;  3PY8 A;  1CZB A;  4DQR A;  2UUC K;  1KFD A;  4YOU A;  3FFI A;  3V1O A;  4IDH A;  1ZBS A;  5BRH A;  3KTQ A;  3CCJ N;  5FPM A;  1ZBF A;  4E1J A;  3LM9 A;  3Q7C A;  1BI4 A;  1MWK A;  2NZT A;  1C0G A;  3KK1 A;  3QNN A;  3DJC A;  3T1A A;  5C2D A;  1UA0 A;  1DGK N;  1Z26 A;  3ZYY X;  4DQ8 A;  1HJO A;  2UXB K;  5KPT A;  4B9U A;  1KSP A;  3VEN A;  4X65 K;  3VQP A;  1VQ9 N;  2G8V A;  4HCB A;  2HHX A;  3O9Q A;  2Q0R A;  5CE3 A;  5BN9 A;  4J2D A;  4DQQ A;  5DM7 L;  4JKG A;  1E3M A;  3E01 A;  2KZZ A;  3OS0 A;  2F4V K;  1YF5 L;  4PKH A;  3TSU A;  2Q0U A;  3BF3 A;  4WE1 A;  5CZ2 A;  5EX5 A;  4Q5V A;  3I8D A;  1X9W A;  4MLE A;  3I55 N;  1RT7 A;  2LSN A;  3FZF A;  4MFB A;  1KC8 O;  5FLX O;  2QWL A;  2P9U A;  3EEQ A;  3F5T A;  3LP0 A;  1EX4 A;  3FZM A;  4MO4 A;  2V52 B;  3OYB A;  1XHX A;  2FXU A;  3WXL A;  4FJX A;  1RDU A;  3HST B;  5GIN A;  4K25 A;  4FJ8 A;  1JL1 A;  4CJV A;  3HVT A;  4IOC L;  2IAJ A;  4Z4C A;  4CF9 A;  2VWK A;  1NKB A;  2YJE A;  1NGI A;  4BGB A;  4E7H A;  2O8B B;  4HCC A;  3DXK B;  4DR2 K;  4DTS A;  3AGK A;  4H0X B;  4AHS A;  4BRE A;  1HYZ A;  1IH7 A;  2HOE A;  1GOB A;  4BRQ A;  3UB5 A;  4CZE A;  4N47 A;  3L2V A;  3ZEU A;  3ULE B;  4JKE A;  3O3G A;  3THW A;  4PKG A;  1NU0 A;  2FC0 A;  1Y64 A;  1BDG A;  1TAU A;  5E84 A;  2ZJP L;  1ZBH A;  2V51 B;  1S3X A;  3OJS A;  1KXP A;  4B9V A;  3CJ9 A;  3VQD A;  3HOS A;  1D9F A;  4F8R A;  3QBX A;  3QML A;  4FPA A;  4QS7 A;  5J2M A;  5AZJ B;  3SUP A;  1VQ8 N;  1RBV A;  4WQ5 C;  1NGG A;  4CZJ A;  3CD6 N;  4M3T A;  3HTV A;  3SYZ A;  4FVU A;  2W41 A;  2HHV A;  4DLG A;  1OVQ A;  1U2V A;  4B3R K;  3H46 O;  4KI4 A;  1BA1 A;  3E66 A;  2H3G X;  2HHQ A;  5C42 A;  5AZI B;  4X66 K;  2E88 A;  4J2B A;  3RSE B;  1KLN A;  3CQX A;  1IG8 A;  4O8K A;  1VSL A;  4M3R A;  1Q82 O;  3VQA A;  1CXU A;  2OPS A;  3VQ7 A;  3OYN A;  1A5V A;  3ZT1 A;  1YAG A;  4IDK A;  3V1R A;  1CXQ A;  3CCR N;  4IJA A;  4WFN L;  2HMI A;  3LDO A;  1FXX A;  2F8S A;  1QQO A;  4CER A;  3MXM A;  3V81 A;  4C8M A;  4DTJ A;  1VQO N;  2HNY A;  1EET A;  5H1S Q;  3PUF A;  1RBR A; 
#chains in the Genus database with same CATH homology
 4C8K A;  1KVA A;  1W9H A;  4RW9 A;  4CHN A;  3K57 A;  3DLG A;  4CK3 A;  3HT3 A;  3KLE A;  4BE0 A;  3P1G A;  4FM1 A;  4DTR A;  4CJQ A;  1B9F A;  2I5J A;  3VN5 A;  4AHU A;  4JS4 A;  4DFJ A;  2FBX A;  2JLE A;  4CJL A;  3OYL A;  3RTV A;  1NJW A;  3ZSY A;  4E7J A;  4K8Z A;  1IKX A;  4DSF A;  1RBT A;  1TL1 A;  3NF9 A;  4CIF A;  1HRH A;  3KD5 E;  3JYT A;  3I0S A;  1VSK A;  3VQ5 A;  4DTO A;  1NK5 A;  1L3T A;  3QO9 A;  1SKS A;  2BDP A;  1ZBI A;  2XRI A;  4FK4 A;  2ETJ A;  2VG6 A;  4KPY A;  3ISN C;  4J2E A;  3L3U A;  3UIQ A;  3OVN A;  1D8Y A;  5C25 A;  1HQU A;  3SQ2 A;  2BAN A;  4CGF A;  1NK8 A;  3I0R A;  3SQ4 A;  1SKW A;  4FJH A;  4Z4E A;  2OYQ A;  1LW0 A;  5EU7 A;  1G15 A;  4B9T A;  2YNH A;  1BHL A;  4FCY A;  2W42 A;  3V9W A;  4OGC A;  2DTU A;  4CF0 A;  3DI6 A;  2O4G A;  1A5X A;  2DFF A;  5CY4 A;  4JRQ A;  4EZ6 A;  5FRO A;  4F2R A;  1S9E A;  1LV5 A;  1QTM A;  2AJQ A;  3SCX A;  3AA2 A;  1J54 A;  4NYN A;  4LD0 A;  3TAR A;  3MXJ A;  3D0P A;  3NF6 A;  3V6D A;  1YVU A;  4KHS A;  1WSE A;  3VQ8 A;  1S5J A;  3NDK A;  3KK3 A;  3L2Q A;  3L8B A;  3QIP A;  1NK6 A;  1NJX A;  3LWL A;  3AVN A;  2G8F A;  3RMA A;  3PX0 A;  4LY7 A;  2YNI A;  3AV9 A;  3EYZ A;  3OYD A;  4Z4G A;  3D45 A;  3K5L A;  4ELU A;  4CHP A;  4CEQ A;  3RWU A;  3LAK A;  2OZM A;  2GUI A;  4CJR A;  3U3Y A;  4KHW A;  4DSL A;  4DSJ A;  3MAQ A;  5KTQ A;  3O3H A;  1ASW A;  3OS1 A;  1RIL A;  4M3X A;  2Y1J A;  5CYM A;  2F8T A;  3ZT3 A;  4C8L A;  4O55 A;  3OYG A;  4Z4F A;  2ATQ A;  3ZT4 A;  1Q9X A;  5HP1 A;  5DMR A;  4ZHR A;  1S1V A;  4CF1 A;  1EXQ A;  1DTT A;  3VQ6 A;  1RTI A;  3HM9 A;  1I39 A;  1KVC A;  2D0C A;  3DLK A;  3NH1 A;  3OYK A;  1FKP A;  1F21 A;  1LWE A;  1LWC A;  1UOC A;  4CJ4 A;  2YKN A;  4Z4I A;  2PYJ A;  4DTP A;  3HJF A;  4MQ3 A;  3VQB A;  1N6Q A;  4E19 A;  4CFB A;  3TWH A;  3U6F A;  4B8A B;  3WNG A;  3KIO A;  3TI0 A;  2B4J A;  4I9Q A;  1U47 A;  4FJ5 A;  2HND A;  3K58 A;  4M45 A;  1JXB A;  4OJR A;  2EX3 A;  4CEC A;  1BIS A;  3QET A;  4N5S A;  5DK5 A;  4CGH A;  1L3U A;  4LH4 A;  3QES A;  2HVI A;  1SKR A;  4KB1 A;  4I7F A;  2PY5 A;  4CJT A;  1DTQ A;  3O3F A;  1J9A A;  1YTA A;  1X9S A;  1C6V A;  1J5O A;  4JS5 A;  3KLI A;  4M3W A;  4ZTF A;  3IG1 A;  3OYI A;  4CJW A;  1U4B A;  2FBV A;  2NUB A;  3NGY A;  4BDZ A;  1CZ9 A;  4CEF A;  3L2W A;  4C8O A;  2HNZ A;  1SV5 A;  4ZTJ A;  2HHT A;  2P51 A;  3KJV A;  3CFO A;  4YFU A;  1JLC A;  1D5A A;  1RNH A;  4W5Q A;  3LAL A;  3AVC A;  2X78 A;  3H08 A;  4FJL A;  5FRM A;  3OYC A;  2IOC A;  1TKT A;  2RN2 A;  3P83 D;  3BDP A;  3DOK A;  3V9X A;  4NCA A;  4DQP A;  4OLA A;  4CJ5 A;  3PV8 A;  4FZY A;  1B92 A;  1TKX A;  3CM5 A;  2IC3 A;  4DTM A;  5HLF A;  4E1N A;  4B9N A;  1S6Q A;  3IAY A;  2P1J A;  3VQE A;  1SL2 A;  3IRX A;  2JGU A;  4OVL A;  5HBM A;  4M3U A;  3SQ1 A;  3LAN A;  3F73 A;  1U48 A;  4GW6 A;  4CF2 A;  4CCH A;  1U45 A;  1T8E A;  4O0I A;  3ALY A;  1RTJ A;  3ZSW A;  4E1M A;  4B3O A;  4IFV A;  3OYF A;  2ZD1 A;  1RBU A;  2F96 A;  3SNN A;  5J2Q A;  2KW4 A;  3ZSR A;  3HPO A;  2PYL A;  3NH2 A;  1XC9 A;  3L2U A;  4FZZ A;  4FYD A;  1Z25 A;  4B8C A;  2E6M A;  4FLU A;  4PQU A;  1BQM A;  1ASU A;  4CES A;  5T7B A;  4OGE A;  5E41 A;  4M3Y A;  3S3M A;  5KGX A;  1EKE A;  4W5T A;  3K5M A;  2GBZ A;  2HW3 A;  3HYF A;  3LAM A;  4NCB A;  1WLJ A;  3HXM A;  4RW8 A;  3DRP A;  3JSM A;  4CHY A;  3C95 A;  2QXF A;  4KTZ A;  1U04 A;  4CJP A;  4Q0B A;  2HVH A;  1KVB A;  1KFS A;  3AVA A;  3HL8 A;  3QIN A;  4W5R A;  4DFP A;  3DLH A;  3ITH A;  1L5U A;  1Q8I A;  1C1A A;  3QLH A;  3ZT0 A;  4XIU A;  3QER A;  4DF8 A;  4CJ3 A;  3TAN A;  3OJU A;  1A5W A;  4FJ9 A;  1IKV A;  4O44 A;  1JLB A;  1TK0 A;  4ELT A;  4BWM A;  2X74 A;  4KI6 A;  4DSK A;  3LDS A;  1HNV A;  4DQI A;  2YNF A;  3AO4 A;  4DS4 A;  3LP3 A;  3NFA A;  2Z1J A;  4GVM A;  4FW2 A;  2HHU A;  3V9Z A;  4FK0 A;  3AO3 A;  4F3T A;  4AHC A;  3OYH A;  3AA4 A;  4Y1C A;  3NE6 A;  3KKR A;  4YNQ A;  2XY7 A;  5KGW A;  1WNS A;  1WN7 A;  4KB0 A;  4OKJ A;  3OYJ A;  4N56 A;  2OZS A;  4KHN A;  1N5Y A;  4KHQ A;  4I2Q A;  3NAE A;  3B6O A;  5JS2 A;  2OPP A;  5CZ1 A;  4OKE A;  3SUQ A;  5HRS A;  2RF2 A;  1JLE A;  2E4L A;  2YHB A;  4KHU A;  3C6U A;  4BAC A;  2KZM A;  5I3U A;  2XHB A;  5K14 A;  4DF4 A;  3IS9 A;  3C94 A;  3CM6 A;  5KI6 A;  2Z1G A;  1HNI A;  4Z0U A;  1WSI A;  1TK8 A;  3EY1 A;  4CEA A;  1VRU A;  3AVF A;  4I2P A;  1NJZ A;  2XY6 A;  1C0M A;  1C1B A;  3TAG A;  3AO2 A;  1RT5 A;  4BE2 A;  4FJ7 A;  1HPZ A;  4RG8 A;  1HMV A;  4C8N A;  5KRS A;  2ZE2 A;  2Y1I A;  4L8R B;  3HVR A;  4CEZ A;  3PO5 A;  2ZQB A;  3TAQ A;  1NKC A;  2X6S A;  3MEG A;  4KTQ A;  4CIG A;  3OS2 A;  3LP1 A;  1NJY A;  1NOY A;  2XY8 A;  1QS4 A;  4J2A A;  2Z1I A;  1BL3 A;  4HVJ A;  3RR8 A;  4KKO A;  1VSM A;  4NCG A;  4M42 A;  2HHW A;  3K5O A;  1JLQ A;  2G8U A;  4OPK A;  4DU3 A;  4QOZ B;  1LWF A;  4ID5 A;  4BE1 A;  1VSH A;  4FK2 A;  3KD1 E;  3V1Q A;  1VSI A;  3ZCM A;  2XY5 A;  3PO4 A;  1BGX T;  4CE9 A;  4LSN A;  1VSE A;  4CJK A;  2EHG A;  4FJK A;  4IG0 A;  3DLR A;  3L3V A;  4CJF A;  4OPJ A;  4K8X A;  3AO1 A;  1HYV A;  3HP9 A;  4CED A;  4QCL A;  2XO7 A;  1T7P A;  1ITG A;  4DU4 A;  3BGR A;  3S3N A;  1D9D A;  4FJM A;  3HK2 A;  4JRP A;  3SQ0 A;  3CFP A;  4OKK A;  4CJS A;  2FBT A;  1XI1 A;  2P5G A;  1L3S A;  1BCO A;  3K2P A;  4GMJ B;  1KLM A;  4IBN A;  4QAG A;  3U3G A;  1RDB A;  3AA3 A;  2OPR A;  3DRR A;  1DLO A;  3G0Z A;  3VQ4 A;  1R0A A;  1L3V A;  1RTD A;  2IGI A;  1B9D A;  5CYQ A;  3V9S A;  3WNE A;  5J1E A;  4AH9 A;  3O4Q A;  3NGZ A;  2BE2 A;  4CEB A;  2YV0 X;  1XWL A;  2VG5 A;  3ZSO A;  1WSH A;  3NHG A;  3RMD A;  2Z1H A;  1JLF A;  3TAP A;  4E89 A;  1LAV A;  3SPZ A;  4E0D A;  1VSJ A;  1GOC A;  4AHT A;  1BCM A;  4O4G A;  3AVG A;  3RMB A;  1SL0 A;  4E7L A;  1NK0 A;  5HRR A;  4BWJ A;  3LWM A;  4E7K A;  3NCI A;  1RT6 A;  1BI4 B;  3ZSV A;  1HYS A;  1C0T A;  4CGG A;  4DSE A;  3VA0 A;  3LZJ A;  5HRP A;  1BIZ A;  1TAQ A;  4DTN A;  1T03 A;  1QSY A;  1FK9 A;  1QQC A;  3M8P A;  3OYE A;  1QE1 A;  2G8K A;  4KRF A;  2G8W A;  3DYA A;  1RDA A;  3WNF A;  1RDC A;  4EZ9 A;  3CYM A;  3TAB A;  4DWI A;  2VG7 A;  3OYM A;  1WSG A;  4AHR A;  4CHO A;  4KHY A;  4DLE A;  4FLT A;  1JLG A;  1ZBL A;  1IG9 A;  3AVL A;  4FJN A;  3LPU A;  4N76 A;  1TV6 A;  4LH5 A;  2YNG A;  5JS1 A;  4PY5 A;  4B9S A;  2OPQ A;  5FDL A;  1KRP A;  4DTX A;  1XHZ A;  4JLH A;  2KTQ A;  4HTU A;  4HUG A;  2G8H A;  1JLA A;  3PY8 A;  4DTU A;  3LP2 A;  4CK2 A;  4BDP A;  3HP6 A;  3C6T A;  1CZB A;  2PZS A;  4I9L A;  4DQR A;  4FZX C;  3DLB A;  3KKS A;  3M8R A;  4DMN A;  1KFD A;  1RT2 A;  1FKO A;  2A1S A;  4DS5 A;  3QEI A;  1Y97 A;  1S1X A;  3FFI A;  3V1O A;  5I42 A;  2QKK A;  4CGD A;  1ZYQ A;  3KTQ A;  4H4M A;  3AVI A;  3DMJ A;  3RR7 A;  1C0U A;  2VWJ A;  3THV A;  1ZBF A;  1WSJ A;  3ZSQ A;  4O5B A;  1VSD A;  1BI4 A;  4FJJ A;  3LZI A;  1VK0 A;  3KK1 A;  3QNN A;  4CK1 A;  1S1W A;  2E6L A;  3T1A A;  1TK5 A;  5D3G A;  1Q9Y A;  1TKD A;  1UA0 A;  3AA5 X;  1Z26 A;  5HRN A;  2G8I A;  4FLW A;  4CF8 A;  3QEX A;  3QEW A;  3K5N A;  4B9U A;  1KSP A;  4G1Q A;  4DU1 A;  1BIU A;  2BGG A;  1RTH A;  3VQP A;  3V9U A;  2G8V A;  1WSF A;  4HCB A;  2HHX A;  4LSL A;  2A1R A;  1SL1 A;  3KLH A;  1CLQ A;  5SWM A;  2O4I A;  4CIE A;  3OY9 A;  3NH0 A;  4J2D A;  4CEE A;  4DQQ A;  4AHV A;  3SI6 A;  3MED A;  4HUE A;  3QIO A;  1HJR A;  3KLF A;  3SV4 A;  3E01 A;  3V4I A;  2KZZ A;  3RMC A;  3VQC A;  3OS0 A;  3SUN A;  2DFE A;  4Z4H A;  4N41 A;  3DRS A;  1T05 A;  1UWB A;  1UAX A;  4E3S A;  5CZ2 A;  4WE1 A;  4Q5V A;  2IDO A;  4E7I A;  5J2N A;  2ITG A;  5J2P A;  2D5R A;  3I8D A;  4CHZ A;  4KV8 A;  3S3O A;  1NK9 A;  1REV A;  1X9W A;  1QSL A;  1RT3 A;  3ZSX A;  1X1P A;  4PWD A;  1RT7 A;  1ZBU A;  1NOZ A;  1GOA A;  1W0H A;  2LSN A;  1TGO A;  1VSF A;  4MFB A;  1KTQ A;  3DOL A;  2B5J A;  1YTU A;  1KCF A;  3RRG A;  5FRN A;  3LP0 A;  1EX4 A;  4FLZ A;  5C24 A;  1RDD A;  3M8Q A;  5HRO A;  3OYB A;  1S1T A;  1XHX A;  3TAM A;  1TL3 A;  4FJX A;  3OYA A;  4DSI A;  3WNH A;  3HO1 A;  3DM2 A;  3F9K A;  3S9H A;  3HST B;  1NKE A;  1WAF A;  1IKY A;  4CJE A;  4KRE A;  4H4O A;  1S6P A;  1JL1 A;  4CHQ A;  2Q3S A;  1NK4 A;  4CJV A;  4FJ8 A;  3PX4 A;  1WAJ A;  3HVT A;  4O0J A;  4RW4 A;  3AVM A;  4CGJ A;  4EP4 A;  1JL2 A;  2B6A A;  2RPI A;  1VRT A;  2IAJ A;  1U49 A;  4BDY A;  4FLY A;  4Z4C A;  4AIL C;  2KFN A;  4CF9 A;  2VWK A;  1TKZ A;  4KFB A;  3RRH A;  3VA3 A;  4PUO A;  4FLV A;  1NKB A;  1J53 A;  4HUF A;  3SV3 A;  3ASM A;  4FM0 A;  4DFK A;  4ID1 A;  4E7H A;  4FW1 A;  4HCC A;  4IG3 A;  4DG1 A;  3CQ8 A;  1LW2 A;  4FJI A;  4FVM A;  4M3Z A;  2D0A A;  4F4K A;  4DTS A;  1K6Y A;  3ULD A;  2RKI A;  2QK9 A;  4UQG A;  1BQN A;  4FXD A;  2OA8 A;  2KQ2 A;  4AHS A;  1TVR A;  4M41 A;  4OLB A;  2GV9 A;  1HYZ A;  1UA1 A;  3G10 A;  1IH7 A;  1YT3 A;  2IS3 A;  1HQE A;  1GOB A;  1S9G A;  3K59 A;  3NGI A;  4N47 A;  3L2V A;  4CJU A;  4CFC A;  1NK7 A;  4F3O A;  1ASV A;  2HB5 A;  3O3G A;  2QKB A;  4FJG A;  4CGI A;  4RW6 A;  1QSS A;  2FC0 A;  2WON A;  2R7Y A;  1TAU A;  1ZBH A;  3CG7 A;  4DFM A;  3OJS A;  3B6P A;  3L2R A;  4CEO A;  4B9V A;  3M8S A;  3VQD A;  5SZT A;  1D9F A;  1QHT A;  3TR8 A;  4F8R A;  3T3F A;  4H8K A;  1X9M A;  4NYF A;  4KTW A;  1JXE A;  4CFA A;  4PA1 A;  4W5O A;  5J2M A;  3SUP A;  1RCH A;  3SUO A;  2KFZ A;  1RBV A;  1RBS A;  3AVJ A;  1I3A A;  3SJJ A;  3O4N A;  4M3T A;  3NF7 A;  3SYZ A;  4FLX A;  2HHV A;  3NBP A;  4IFY A;  4DLG A;  4DQS A;  2FBY A;  1C1C A;  3LPT A;  4KI4 A;  3AVH A;  4EP5 A;  3VQ9 A;  4FM2 A;  1IKW A;  4W5N A;  3CFR A;  3AVB A;  1EP4 A;  4IKF A;  2HHQ A;  5C42 A;  3HPG A;  2DFH A;  2YHA A;  3NF8 A;  3KLG A;  3PX6 A;  4J2B A;  2D0B A;  4HHT A;  4B9M A;  1IO2 A;  4R5P A;  3TAE A;  1KLN A;  1MU2 A;  1LAW A;  4ICL A;  3DLE A;  4TSX A;  3AVK A;  3T19 A;  1S1U A;  3AO5 A;  2WOM A;  2P5O A;  3SPY A;  3P5J A;  3QEP A;  4KO0 A;  1VSL A;  5KRT A;  4M3R A;  3MXI A;  4F2S A;  2HHS A;  1CXU A;  3VQA A;  3A2F A;  1O1W A;  1RT4 A;  2OPS A;  2X6N A;  3VQ7 A;  3OYN A;  1A5V A;  2DY4 A;  3ZT2 A;  4ELV A;  3ZT1 A;  4RW7 A;  3QEV A;  4IDK A;  3V1R A;  1CXQ A;  4B08 A;  3MEE A;  3MEC A;  1RT1 A;  3HPH A;  3TAF A;  2HMI A;  1FXX A;  3EZ5 A;  2F8S A;  4CER A;  4CFD A;  1JKH A;  3SZ2 A;  3QNO A;  3MXM A;  3V81 A;  4C8M A;  4DTJ A;  4KAZ A;  2HNY A;  1EET A;  1SUQ A;  2YKM A;  3PUF A;  3KK2 A;  4Y1D A;  4B9L A;  3ZSZ A;  1RBR A;  3VQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...