4CHOA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 52
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4choA00
4CF8A 2PY5A 1JKHA 4KTZA 1JLCA 4CERA 1ZYQA 1L3SA 1JLGA 3NH1A 1NJZA 2KZMA 1L3VA 5HRSA 4BE0A 4CJFA 3O3HA 4EP5A 3TAPA 4DF8A 1TAUA 1NJXA 2XRIA 2YNGA 1SV5A 4CEEA 5KGXA 3OY9A 1S1XA 3SPZA 4ZTFA 3S3MA 2KZZA 1EKEA 5E41A 2ZQBA 2YNHA 5CZ1A 1JL2A 3E01A 3LP1A 2XY6A 2QK9A 4BDPA 4Z4GA 3L2WA 3AO5A 4YNQA 3ZSXA 4DS5A 1K6YA 4Z0UA 1U4BA 4PY5A 3BDPA 3IAYA 3M8QA 4O0IA 4CJVA 1SL1A 1G15A 3L2VA 1O1WA 4CHNA 3NF6A 4LD0A 4LH4A 3KK1A 4DTUA 1REVA 4YFUA 1BGXT 4HUFA 5J1EA 3OYEA 3UIQA 3LWLA 3OVNA 4ELTA 4NCAA 2G8IA 3AO3A 1DTQA 1CLQA 3TI0A 4DU1A 3L2QA 3WNFA 3HK2A 1A5WA 5FROA 1IKXA 3IRXA 3O4QA 2P1JA 3MECA 1EX4A 4DMNA 3NF7A 1YVUA 1KRPA 4LSNA 4FJ8A 4CGGA 1RTHA 1U45A 2HVHA 2WOMA 1QTMA 3CQ8A 1HQEA 1XHZA 2Y1JA 4FK0A 5SWMA 3MEGA 3HL8A 3K58A 3KK3A 3SPYA 4CJ4A 4OKKA 1S1TA 4I9QA 3AA5X 1JL1A 3TR8A 3KK2A 5KTQA 2G8FA 2B5JA 3PUFA 2HHQA 1GOAA 3RMAA 4DTXA 2XY8A 3TAGA 4OKEA 1RT3A 4M3YA 2YNIA 3DRSA 4DQQA 1GOCA 1X1PA 3QEWA 4IG3A 1KVCA 3HVRA 3KD5E 5J2PA 4FK2A 4KV8A 2OPQA 4DTJA 1LW2A 3EZ5A 4N47A 1QSSA 1HMVA 3HPOA 2B6AA 2R7YA 3I0SA 3CFPA 4FJXA 4E89A 1NKCA 1NK7A 3VQ5A 3RTVA 3KKSA 3ZSVA 1S6PA 3OYCA 1VSFA 5K14A 4CEQA 3OYJA 4DLGA 3TAQA 3HT3A 3SUNA 2HHTA 4NYFA 4DTMA 3SQ0A 2PZSA 1U47A 1WSEA 1U49A 3AO4A 4B8CA 2X78A 3ALYA 4KAZA 1IG9A 1IKWA 2BANA 1ASVA 1A5VA 1RBTA 3OYGA 1R0AA 3DLBA 2HHWA 3V81A 3M8PA 4DSKA 4DU3A 4AHRA 4JS4A 4DWIA 4FJ7A 4IFVA 3OYLA 1JXBA 2Q3SA 3L3VA 3KD1E 2BDPA 5I42A 3ZT4A 1B92A 1FKOA 4N76A 2GUIA 2IOCA 3SNNA 1RT2A 4CEZA 4B9MA 3HPHA 5CYMA 3DLRA 2AJQA 1TVRA 4Q0BA 4BWMA 3VQ4A 4FK4A 1RT7A 1J53A 4E7JA 4FZXC 1S1UA 1RCHA 1RT5A 2DTUA 1J54A 2D0BA 2NUBA 3AVGA 3C95A 1TK8A 1C1BA 1VSDA 1NK5A 1UA0A 2FBXA 1Z26A 3LP3A 4FLYA 3U6FA 4FJIA 4Z4FA 2HHXA 1HJRA 1ZBLA 4HCBA 4AHSA 1FXXA 5C24A 4KI6A 3P5JA 2OZMA 4F8RA 3DLKA 3ISNC 1RBRA 2JLEA 3LPTA 4B9SA 4N41A 3DI6A 2YKNA 1JLEA 3ZSYA 1KVAA 4AH9A 1C1CA 4EZ9A 4E3SA 1RTIA 3HVTA 1BISA 1QS4A 1XWLA 3LZIA 4E1NA 1KLNA 4W5TA 1SKSA 3VQDA 3SQ2A 4FJ9A 1RBSA 1X9MA 1UWBA 3MXMA 4K8XA 4FM0A 2YKMA 1EETA 1JLBA 1TAQA 4I9LA 2Z1JA 4CIEA 3SCXA 1HYZA 2BE2A 3BGRA 4OPJA 3O3FA 1L3UA 1RDDA 2OYQA 3SYZA 3V9UA 3K5NA 1LW0A 4M3RA 4KHNA 4KHYA 3LDSA 4C8NA 4DQRA 3LP2A 3U3GA 3MXIA 4O0JA 1QSLA 3KTQA 4PWDA 3MXJA 1I3AA 1KCFA 2HMIA 4CFAA 1CXQA 2LSNA 1XI1A 1NK6A 3TAFA 3VQEA 3WNEA 4FYDA 1X9SA 2YV0X 4OVLA 1TKDA 3DLHA 4DFPA 1IKVA 4W5RA 4DSFA 2VWJA 4JRQA 1SKRA 4EZ6A 3ZSWA 3CM5A 3KLHA 4NCGA 4B9NA 4IKFA 3ITHA 4RW4A 4FM2A 1QHTA 3K5OA 4FLUA 1GOBA 4FJKA 3HP6A 1QQCA 1YTAA 3P83D 5HRRA 3IG1A 1ZBUA 3AA3A 3S9HA 4C8MA 2HNDA 3OS2A 4FM1A 1VSMA 3IS9A 4GMJB 3DYAA 4B9VA 3TABA 3VQ9A 4FJJA 4F3TA 2HHUA 2RF2A 4CECA 4M42A 3EYZA 4CEBA 3DRPA 5T7BA 1JLFA 2YHAA 4E7IA 2KFNA 3AVCA 4CJEA 1RBUA 3KLIA 3QIPA 5DK5A 1SKWA 3NH2A 4CJLA 2FC0A 1CZ9A 4I2QA 1IKYA 1VSKA 1NOYA 3AVMA 4CFDA 4OGCA 3SZ2A 3RR8A 2Y1IA 2G8WA 4FJNA 1N6QA 4Z4IA 4M3WA 1XC9A 1EP4A 3AVJA 4BDZA 3KKRA 4CIGA 1NKBA 4B9LA 4E0DA 1KTQA 1NK0A 4KHWA 5FDLA 3LAKA 4E19A 3V9ZA 3B6PA 3PX6A 4NCBA 4HUEA 5FRNA 3TANA 2X74A 1VRUA 1Q9XA 4DS4A 2RN2A 1RTDA 3PV8A 4CHYA 3OJUA 3L2RA 3VA3A 3AO1A 4CF1A 2DFEA 3ULDA 2HVIA 2Z1HA 3CFOA 2FBVA 4JS5A 1T8EA 3AVHA 3AV9A 2RKIA 3LANA 4DLEA 2DFHA 1BHLA 4DTOA 2GBZA 3AVIA 4CHQA 4W5OA 4FLZA 1JLQA 4DG1A 3KLGA 4CF0A 2PYLA 3MEEA 1WN7A 3V1OA 3NDKA 1LAWA 3ZT0A 4E7LA 1IH7A 3VQCA 3NGZA 4M3TA 4KREA 4RW8A 4DQPA 3QESA 5HP1A 1YTUA 3V6DA 1TL3A 3ZSQA 3NF8A 4IFYA 5KRTA 4DFMA 3ZT1A 3AVBA 3V1RA 3QEIA 1WNSA 2G8HA 3HPGA 4Y1DA 4KHQA 3MAQA 2KW4A 1U04A 1S9EA 4RW6A 3NGYA 4H4MA 1LWEA 1C0TA 1UAXA 4DQSA 5HRPA 3NGIA 4DU4A 3ZT3A 4CHZA 3V1QA 1UOCA 4DTNA 1RILA 3TARA 3C6TA 4Z4CA 4OPKA 4CJWA 2QKKA 4KB0A 5KI6A 3CG7A 3DOLA 1LAVA 5CZ2A 4AHVA 2XY7A 4QOZB 1TV6A 3AA4A 1KFDA 4CJ3A 3V4IA 4QCLA 3NBPA 3OYFA 3L8BA 2D0CA 2X6NA 4MFBA 3K59A 2F8TA 4C8KA 1RT4A 4FW2A 2P5OA 2F96A 2ZD1A 4CGHA 3VQAA 4FZYA 2KTQA 2E6LA 5D3GA 5SZTA 1MU2A 3CYMA 4OKJA 5KGWA 4PQUA 2ITGA 1HNIA 1WAJA 3KIOA 4WE1A 1WAFA 3H08A 4M3XA 3KLEA 3QNOA 4DSIA 2ATQA 4KB1A 3SQ4A 2FBTA 3DLEA 1F21A 4AILC 3LWMA 1WSGA 4E7HA 2XY5A 1BL3A 1LV5A 4B8AB 4J2DA 2KFZA 1VSHA 3HJFA 4HVJA 4IBNA 2HHSA 4E7KA 2IDOA 4LY7A 3U3YA 1D5AA 1Q8IA 4GW6A 4FCYA 4LSLA 1T03A 1VSLA 1RDBA 3FFIA 3NFAA 2BGGA 2VG7A 4CGJA 3QLHA 3PY8A 3JSMA 4W5NA 1SUQA 5HROA 3F9KA 5FRMA 3QINA 4RG8A 1TKZA 4EP4A 5DMRA 3QNNA 1KLMA 4CEDA 5JS2A 4J2AA 3HXMA 3A2FA 3KLFA 4FLXA 1RT6A 1W0HA 4Z4HA 3M8RA 4H4OA 3S3NA 1UA1A 1D9DA 2QKBA 4CJ5A 1RNHA 4CGFA 4KRFA 4FJ5A 3HP9A 4J2EA 4KKOA 3SUOA 2QXFA 4TSXA 3VQBA 2OPSA 4BDYA 1NOZA 2IS3A 3RRGA 4N5SA 3V9WA 4B08A 2D5RA 4NYNA 3OYDA 3B6OA 3DM2A 3PO4A 4AHCA 2HNZA 4FJLA 3DLGA 3TAMA 3M8SA 5J2NA 1J5OA 1T7PA 4FXDA 2EX3A 1BCOA 4KFBA 3SV4A 4KPYA 1L3TA 3OYMA 4O4GA 4IG0A 4FJMA 1B9FA 3K5MA 4Y1CA 1BCMA 3OS1A 4CK2A 2O4GA 4DTSA 4KI4A 3QETA 4ELUA 4HTUA 4BE2A 2DY4A 4ID1A 4LH5A 3SQ1A 2P51A 3K2PA 3CM6A 3O4NA 4B3OA 4N56A 1RTJA 1BQNA 3LZJA 4DFKA 3RMDA 2FBYA 4ID5A 4FLWA 4CFCA 4O55A 3VQQA 2OPPA 4M41A 1I39A 3JYTA 1Y97A 3K5LA 4CK1A 3S3OA 1WSHA 3OYAA 3WNHA 3ZSOA 3SV3A 4FLVA 4C8OA 2I5JA 3L3UA 4CK3A 2YHBA 4HCCA 1BI4A 3NE6A 3MEDA 1C6VA 1TGOA 4OLBA 3SJJA 4CEFA 5HLFA 2G8VA 1XHXA 4DQIA 3VN5A 1B9DA 4FJGA 1JLAA 2RPIA 1S1VA 1RBVA 3QEXA 3ZSRA 1VSEA 4H8KA 2P5GA 3QEPA 1KVBA 4CJPA 5EU7A 2VG6A 4G1QA 2A1RA 2B4JA 4DTRA 4OLAA 3KJVA 2E4LA 4ELVA 4R5PA 4M3UA 1YT3A 3WNGA 1TK0A 3C6UA 1LWFA 1QSYA 4ZHRA 2DFFA 3OYIA 4ZTJA 3AVFA 2ETJA 1JXEA 3ZCMA 3D0PA 5J2MA 5CY4A 1X9WA 3HM9A 2A1SA 1HPZA 3VQPA 2JGUA 4ICLA 4KO0A 4O5BA 4DFJA 4CHPA 1Q9YA 4RW9A 4BACA 2D0AA 4B9UA 4CIFA 4KTWA 4DSEA 1Z25A 4E1MA 3V9XA 3T19A 1VK0A 5CYQA 1WSFA 3NAEA 2HB5A 3LALA 4CF2A 5C25A 1U48A 1BIUA 2WONA 5JS1A 4K8ZA 1ZBIA 1NKEA 2GV9A 4CESA 3OS0A 2PYJA 4CF9A 3QERA 1TL1A 1C1AA 2IGIA 1S5JA 3LAMA 1EXQA 3ZT2A 4CJKA 4UQGA 3QO9A 3G0ZA 3VQ8A 4I7FA 3AVNA 2VWKA 3HO1A 4DF4A 4F2RA 4PA1A 4CGDA 1D9FA 1C0UA 1DTTA 1SL2A 4O44A 1BIZA 1DLOA 3RMCA 4B9TA 4JLHA 2Z1IA 4OJRA 1KSPA 3RRHA 2VG5A 3QIOA 3CFRA 4FVMA 3P1GA 4CHOA 2XO7A 4BE1A 1NK8A 4CCHA 4OGEA 1CZBA 4DTPA 4M45A 1SL0A 4CEOA 4FZZA 4F4KA 4J2BA 4KHSA 4M3ZA 1A5XA 1ZBHA 1ITGA 1T05A 5J2QA 4CJRA 4BWJA 1ASUA 3NH0A 2G8UA 5C42A 5I3UA 4FLTA 2IAJA 3RWUA 3RMBA 3SI6A 2OA8A 4DSLA 1KFSA 4FJHA 4Z4EA 3V9SA 3EY1A 4GVMA 1FKPA 1CXUA 4MQ3A 3OYBA 3I8DA 1HYSA 4PUOA 4F3OA 2HNYA 1L5UA 3NCIA 3SUPA 2OZSA 1N5YA 4C8LA 1WSJA 1ZBFA 3OJSA 1NK9A 2HW3A 4KTQA 3T3FA 3OYKA 1WSIA 4I2PA 1NJYA 3VQ7A 2OPRA 4CFBA 2IC3A 3K57A 3VA0A 2ZE2A 1NK4A 4DSJA 4CJQA 2E6MA 3HYFA 3DMJA 4CGIA 3LPUA 4HHTA 1S6QA 1TKTA 4F2SA 3OYNA 2G8KA 1LWCA 2YNFA 3G10A 1S9GA 2XHBA 1VRTA 3O3GA 1HQUA 1RDAA 4CJTA 3AVKA 4CJSA 3TAEA 3HSTB 3RR7A 4IDKA 1RDCA 3C94A 4QAGA 3ASMA 3LP0A 3D45A 1VSIA 1FK9A 2EHGA 2W42A 1D8YA 1BI4B 1C0MA 2Z1GA 3F73A 4RW7A 3L2UA 2KQ2A 4W5QA 1BQMA 4CJUA 4AHUA 4CE9A 3QEVA 3NHGA 4Q5VA 1VSJA 3PX4A 2HHVA 3T1AA 1TK5A 1RT1A 5HRNA 1J9AA 1ASWA 3OYHA 3THVA 1W9HA 3TWHA 1HRHA 3AVAA 5HBMA 2X6SA 4CEAA 5KRSA 3SUQA 2O4IA 1NJWA 4FW1A 4L8RB 3AA2A 4XIUA 1IO2A 3AO2A 1HNVA 4AHTA 1HYVA 3NF9A 3DRRA 3DOKA 3PO5A 1TKXA 3PX0A 4JRPA 3VQ6A 4HUGA 3ZSZA 1QE1A 3I0RA 4KHUA 3AVLA 1WLJA 1S1WA 2F8SA
chains in the Genus database with same CATH superfamily
1EQYA 1JLCA 3A0IX 2P9KA 4JI3K 3CETA 3THWA 1SV5A 3SK3A 3SPZA 3BF3A 4BDPA 3ZSXA 1U4BA 1HNXK 3N4PA 4FWNA 3AAPA 4E1JA 1XNRK 4CJVA 1G15A 3L2VA 3EKSA 3NF6A 1REVA 1BGXT 4HUFA 3CQXA 5J1EA 4NB4A 4ELTA 4NCAA 4B1WB 4PL8A 3J81O 5AQHA 5AQMA 3G4SN 4YHHK 2UXDK 4GV6A 2P1JA 1HUXA 3MECA 1EX4A 3OA9A 4JN4A 4DMNA 3U8XA 3OTOK 5BRFA 1KRPA 4LSNA 4AM6A 1RTHA 4JI4K 4CGGA 2WOMA 1HQEA 4GV9A 2O8CA 1R59O 3HL8A 3K58A 3KK3A 5ADXA 3SPYA 3CQYA 4OKKA 1S1TA 1CZAN 4EIAA 4H0VB 3PUFA 2VCPA 4H5NA 4JD2B 1RT3A 2YNIA 1GOCA 1X1PA 3QEWA 3CMEN 1JCGA 4FK2A 2OPQA 2QWOA 1QSSA 3HPOA 3CFPA 3WT0A 3KKSA 3OYCA 1VSFA 4JK9A 4CEQA 3TAQA 3DXKB 1XMQK 1NGDA 3N4QA 5E84A 5BN8A 2PZSA 3MDQA 4FWPA 1WSEA 4B8CA 1T6CA 3WEEB 3VEZA 4IFEA 2BANA 1IG9A 4KAZA 1RBTA 3OYGA 4UY8O 1QQMA 3M8PA 4DU3A 4JKFA 2PAVA 1NGJA 2BDPA 1NBWA 4BRQA 2YHYA 4H5TA 2HBJA 1YVNA 1YUWA 2WUSA 4ILGB 3VGKA 4BWMA 3GBTA 4PKIA 4E7JA 4JHDA 1RT5A 3CHWA 2HSTA 2NUBA 5EXWA 1C1BA 1QZ6A 1VSDA 4BRCA 1NK5A 2FBXA 1ESVA 4BRDA 2P9KB 4HCBA 4AHSA 5C24A 4F8RA 3FE1A 2YKNA 3THWB 1KVAA 4EZ9A 5AQQA 1RTIA 1BISA 1XWLA 4NXNK 1SZ2A 4W5TA 1YITN 1X9MA 3ENBA 2CGLA 1ATSA 3V9UA 4KHNA 1LW0A 3MXIA 5HOOA 4EAHD 3KTQA 1QSLA 2NNWA 4LF4K 3W0LA 3WXJA 3NVMA 4B9QA 1XI1A 4ISEA 4JKHA 4OVLA 4DFPA 4W5RA 4WQ4A 3ZSWA 3KLHA 5AR0A 2O8CB 5CR4A 4LF7K 4FJKA 1YTAA 3P83D 4JV5K 3OS2A 4BR0A 1YXQA 3IS9A 4GMJB 4FJJA 4F3TA 4IWVA 4M42A 4CECA 3VOVA 4JAXA 5T7BA 2YHAA 1GLBG 3AVCA 5DK5A 3KLIA 3R1XA 2FC0A 4BC2A 1NOYA 2NZTA 2D1KA 3PSIA 2NRRA 4YOYA 1EP4A 4BDZA 1NKBA 4E0DA 1NK0A 4E19A 3LAKA 1M1KO 3PX6A 4NCBA 1Q82O 3ATUA 4H0OA 3SBGA 2GUPA 3QICA 5DM7L 3AO1A 3ULDA 2DFEA 4LF5K 2Z1HA 4BR5A 2FBVA 1T8EA 3AVHA 1IG8A 2RKIA 3AV9A 3LANA 4CD1A 4DLEA 1BHLA 1NGGA 4DTOA 4W5OA 4BY9C 1SS6A 1WN7A 3V1OA 3ZT0A 3NGZA 3J7AP 4KREA 4DQPA 4JI6K 5C2FA 4DFMA 5KRTA 4B1UB 2E2QA 2VWBA 4JHDB 1NNEA 1M90O 4Z94A 4Y1DA 3VMFB 3MAQA 2P9UA 1VQ8N 3NGYA 4H4MA 4OPHA 3MCPA 3NGIA 1HPMA 2YJEA 4DU4A 2W41A 5AQLA 3G25A 3IFRA 1UOCA 3TARA 4DR2K 5F2RA 1IBLK 5FLXO 1LAVA 4YOWA 5CZ2A 4QOZB 1Y64A 3VEXA 3ID8A 4MFBA 1NG9A 1S72N 2E6LA 5D3GA 5SZTA 3VETA 1MU2A 3CYMA 5KGWA 1WAFA 3H08A 4DV2K 3SQ4A 4ILJA 2FBTA 2KFZA 4DCHA 3HJFA 2HHSA 2IDOA 1Q8IA 1C0FA 3FLCO 1T03A 1VSLA 3BZKA 1HNZK 4EP4A 1MDUB 3KZBA 2Q0UA 2UYTA 4H0TB 2UUAK 1W0HA 4J8FA 3M8RA 3S3NA 4JKDA 3FZFA 4CZJA 1RNHA 3CCJN 2KLAA 4JK7A 4FJ5A 3HP9A 1H1VA 4RTFD 3SUOA 3CJBA 1N36K 4BDYA 2OPSA 4M7XA 4C23A 1Q7YO 3V9WA 3OYDA 3BP8A 3DLGA 3M8SA 5J2NA 1W97L 1T7PA 2EX3A 4H5WA 3IDHA 1L3TA 1VQLN 1YJ9N 5AQJA 2O4GA 3LDOA 3QETA 4ELUA 4HTUA 4GVEA 4LH5A 3K2PA 3CM6A 4CJ7A 3R6MA 1BQNA 4DFKA 5BN9A 4CFCA 1XNQK 2OPPA 4M41A 4JKBA 3K5LA 3S3OA 3OYAA 1S3XA 3WNHA 3ZSOA 3SV3A 4FLVA 2I5JA 3MEDA 1C6VA 4RCHA 5M1FA 4DQIA 1XHXA 4OPAA 5M1OA 1BWFO 2RPIA 1NMNA 3WQTA 2P9UB 4H8KA 4BG9A 1KVBA 4CJPA 2B4JA 4DTRA 3KJVA 2E4LA 4K0KK 4M3UA 1LWFA 1QSYA 4ZHRA 4ZTJA 3OBYA 3ZX2A 2ETJA 3E9LA 1JXEA 3ZCMA 3D0PA 5J2MA 4KO0A 1Q9YA 3MN6A 1Z25A 4E1MA 2CGJA 1V4TA 2F7TA 4ISFA 3T19A 3NAEA 4CF2A 5BPMA 5C25A 5A2QO 4FWRA 5AQIA 1TL1A 1C1AA 1HKBA 1S5JA 2IGIA 4CJKA 3GE1A 1MA9B 3EO3A 4I7FA 4F2RA 4PA1A 1D9FA 1DTTA 1SL2A 4O44A 2NRTA 4B9TA 3RMCA 4FVMA 1CZBA 4A2AA 1N33K 4M45A 4YDUC 3MK6A 1SQKA 1A5XA 4X62K 1T05A 4CJRA 2G8UA 3RWUA 1GLDG 4DR7K 5GADP 2HBKA 1KC8O 3EY1A 3TSUA 2ZJRL 5TKWA 3NCIA 2OZSA 1NK9A 2HW3A 4I2PA 3UKUA 2E6MA 3F2KA 1S6QA 1TKTA 3OYNA 3G10A 2XHBA 3CERA 3Q7CA 3O3GA 2E2PA 4IDKA 3C94A 4B1XB 5AQZA 2YCHA 2YHWA 3LP0A 3UE5A 2EHGA 3QFPA 5BR8K 1D8YA 3HOTA 3C6AA 2BTFA 5BRHA 3F73A 3A8YA 3AGKA 4W5QA 4AHUA 1QVFM 3VF6A 1VSJA 4M63C 3O9QA 1RT1A 3THVA 3TWHA 3C7NA 3AVAA 3GOIA 5HBMA 5KRSA 4CEAA 3FZLA 3L4IA 1NJWA 3AA2A 2WTUA 5I9EB 2E88A 1HYVA 3PO5A 5KPRA 1E4FT 3ZSZA 3I0RA 1WLJA 4CBUA 3TU5A 1ZYQA 1L3SA 1JLGA 1O13A 5GIPA 1L3VA 3MWPA 4WQ5C 3O3HA 1VQPN 4OX9K 1TAUA 4CEEA 3CCLN 3S3MA 2KZZA 1EKEA 5E41A 5CZ1A 2FF3B 3EZWA 3LP1A 4FO0A 3L2WA 4EFHA 1K6YA 4K43A 2UU9K 3BDPA 4O0IA 4CHNA 4DTUA 4LH4A 3OYEA 3OVNA 2G8IA 1CLQA 3L2QA 2A42A 3WNFA 3HK2A 5FROA 3IRXA 4DB3A 4FWQA 1U45A 5AQKA 3CQ8A 4FK0A 2J4RA 4CZMA 3TR8A 2G8FA 2HHQA 3RMAA 2XY8A 4M3YA 3I33A 4CZIA 3GL1A 3UKUB 1ZBSA 3KD5E 3VF2A 3EZ5A 4DR1K 2B6AA 2R7YA 2GELA 2Q36A 1NK7A 3VQ5A 3RTVA 3MN5A 5K14A 3MX5A 3HT3A 3SJHA 4DTMA 3O08A 1U47A 1U49A 4H0XB 2IIRA 2IVOA 2UUCK 1BDGA 1IKWA 3C0BA 4DSKA 4AHRA 4DWIA 4A62A 4FJ7A 3E9OA 3OYLA 2Q3SA 1FW6A 1NJIO 5I42A 5JLFA 3C7NB 5JICA 4JK8A 1RT2A 4CEZA 4B9MA 2WC9A 3HPHA 5CYMA 3DLRA 2AJQA 4Q0BA 1NGBA 1YHQN 1VQKN 3QDKA 4FK4A 1RT7A 4LF6K 1RCHA 2DTUA 1N32K 3C95A 1UA0A 1Z26A 5LL6Z 3U6FA 5F1XA 5LJWA 3P5JA 4N41A 1NGFA 1JLEA 3ZSYA 4KHPK 3IKMA 1C1CA 4E3SA 4IO8A 3O1WA 3SAGA 4RWTA 1SKSA 3SQ2A 1RBSA 1UWBA 3MXMA 1W2BM 2O8FA 4FM0A 4I9LA 3T1HK 2O8EA 5BREA 5BPNA 3LDSA 3U3GA 3MXJA 2HMIA 4JI1K 1CXQA 2LSNA 1GLLO 3TAFA 3VQEA 2YV0X 1TKDA 3DLHA 1IKVA 4MLHA 5C10A 4HTLA 4JRQA 1T44A 3CM5A 4B9NA 4BRPA 3ITHA 4FLUA 3IG1A 2D0OA 1VSMA 2HHUA 3DYAA 2RF2A 4BRFA 3DRPA 1JLFA 4DR6K 1EWQA 1RBUA 1VAZA 3T1YK 3LDLA 1CZ9A 3CPWM 3O9TA 2OTLN 1ATNA 2FSNA 3SZ2A 2Q31A 4FJNA 4BQLA 4YDUA 1HKCA 5AQTA 1XMOK 1HR0K 3B6PA 4IEEA 5FRNA 1OKJA 3TANA 5AQSA 2GEMA 3L0QA 4XH5A 4DS4A 3P31A 3PV8A 3L2RA 3M1FA 4BREA 4QS8A 5JLHA 1VQ5N 2HVIA 4LC9B 4JS5A 2DFHA 4DQ8A 4MO5A 4CHQA 3KLGA 4CF0A 4E7LA 4M3TA 3VQCA 3QBXA 2OTJN 3AVBA 1WNSA 1NGCA 4XEIA 4FWMA 5GAEP 2ASMA 3GDQA 3KWIA 4CBWA 2KW4A 5AQRA 4RW6A 3THXA 1LWEA 3QMLA 1UAXA 3CC7N 2ZGZA 1GLAG 4NXMK 1QVGM 4DTNA 3C6TA 5AQVA 3M6GA 4Z4CA 3CG7A 3JS6A 5M1QA 3F5TA 2XY7A 2O8FB 4CJ3A 1X3NA 3V4IA 1VQ4N 1HNWK 3T7ZA 1VHXA 2O8EB 2X6NA 1RT4A 1BG3A 4CI6A 5GIOA 2ZGYA 3VGLA 5KQDA 2ITGA 3HRGA 1WAJA 4WE1A 1VQ6N 5DM6L 4KB1A 5JMVA 1F21A 1N34K 3CMAN 1LV5A 4A57A 2XY5A 1BL3A 1JJ2M 4HVJA 4E7KA 2P9SA 4LY7A 1P90A 2BGGA 4NLBA 4ILHA 2YI1A 3QLHA 4JKCA 1TKZA 4WQ5A 4DV0K 4MO4A 2GTDA 1NU0A 4FLXA 2QKBA 4KRFA 2QXFA 2V52B 2A3ZA 2CH6A 2CH5A 3GG4A 2YX6A 3DM2A 4AHCA 3TAMA 1J5OA 3G6EN 1WB9A 3OYMA 4R79A 1G99A 4IG0A 4IDHA 3VERA 4Y1CA 5GAGP 4BE2A 2DY4A 2P51A 4X65K 1RTJA 3LZJA 1E3MA 3TSPA 3RMDA 3CCRN 4ID5A 4O55A 3VEOA 1I39A 4CK3A 4U7BA 4HCCA 1BI4A 4IJNA 1TGOA 1KD1O 4OLBA 2G8VA 3P39A 5HLFA 3EL2A 3K9JA 1JLAA 4FPBA 3A5LC 2HMPA 5CE3A 3QEXA 1VSEA 4V19S 3THXB 4CD3A 4OLAA 4EZ6A 3C6UA 3D6RA 3OYIA 1X9WA 3MN9A 5CY4A 4O8KA 2A1SA 1HPZA 1WUAA 4ICLA 4BC3A 4DFJA 2O8DA 2VQEK 3U9DA 4DSEA 2EWSA 4CVNE 2ASPA 4K42A 1WSFA 2HHHK 2P9NA 1NMDA 1K73O 3CCSN 1NKEA 2HBLA 5C15A 4CESA 3QERA 3LAMA 3SLCA 1EXQA 1HLUA 3G0ZA 2BUPA 3H46O 4CGDA 1K9MO 1C0UA 1BIZA 4EHTA 2P9SB 1DLOA 4JLHA 4CCHA 1NK8A 1XQSC 4QS7A 4DTPA 4BRAA 3THYA 4GKKK 1ITGA 5J2QA 3FZKA 3NH0A 3CCMN 3CC2N 3CCUN 2FXUA 2A6AA 3V9SA 2RHKA 4FVUA 1FKPA 1CXUA 3OYBA 1HYSA 4PUOA 4WYBA 3ZYYX 1N5YA 1WSJA 1ZBFA 4KTQA 3VQ7A 2OPRA 2VGNA 3VA0A 2ZE2A 4IEIA 4CJQA 2NRHA 4F9OA 2YNFA 3ULEA 1VRTA 5FPEA 1OVYA 1RDAA 3BF1A 3CI5A 4CJTA 1NGIA 3CJAA 3HSTB 1GLFO 4BC4A 1BI4B 1VQ7N 4RW7A 3L2UA 5IWAK 4WFNL 2FF6A 4PL7A 4CBXA 4DHYA 4Q5VA 5LMUK 2HHVA 3T1AA 1TK5A 5KPTA 1ASWA 2O4IA 4A5BA 3WXIA 3AARA 4FW1A 4L8RB 4BVPA 3P38A 1HNVA 2O8DB 4G9ZA 1TKXA 2Q0RA 3PX0A 1VQMN 3O9RA 3FFKB 2P9LA 2IVPA 3AVLA 2F8SA 1JKHA 2P9NB 3MWTA 4CERA 4KH5A 3NH1A 1NJZA 3O4WA 4BE0A 4BGAA 1NJXA 2XRIA 3OY9A 1S1XA 4ZTFA 3WXKA 2ZQBA 2YNHA 3E01A 3VESA 2FSKA 3LM9A 3OHRA 3JAMO 4Z0UA 4PY5A 4H03B 4AQYK 3IAYA 5FPMA 4FSVA 3M8QA 4JEPA 3KK1A 4LD0A 4YFUA 2WBNA 3THYB 3I8BA 3UIQA 3LWLA 3AO3A 1DTQA 1QHAA 3TI0A 4DU1A 1A5WA 3O4QA 3S41A 1YVUA 4KH6A 4FJ8A 1Z6RA 4YOVA 2HVHA 1OVQA 2Y1JA 5SWMA 4CJ4A 4I9QA 3AA5X 1JL1A 3KK2A 5KTQA 5JVGL 2B5JA 3A5OC 3SAHA 1GOAA 3TAGA 3AAQA 3CD6N 3DRSA 4IZ9A 4DQQA 2GWKA 4H0YB 4CZFA 3HVRA 4KV8A 1LW2A 1HMVA 4FJXA 3L6QA 3ULEB 1NKCA 3MX2A 3OYJA 4DLGA 3SUNA 3J7ZO 2HHTA 4NYFA 3SQ0A 1NWKA 1A5VA 1R0AA 3DLBA 3I55N 3V81A 1TUYA 3H3NO 4JS4A 3DAWA 4H5RA 4IFVA 3L3VA 1IBKK 3KD1E 1NM1A 3ZT4A 3EKUA 2GUIA 2IOCA 3L4QA 3CXCM 5KQ8A 1Q18A 2P9LB 1J53A 5AFUH 1J54A 3E9PA 3AVGA 2ITMA 1TK8A 2ZJQL 3LP3A 4FLYA 2HHXA 1HJRA 2QWLA 2AP1A 2OZMA 3DLKA 3ISNC 3A5MC 4BRKA 3VENA 4O8UA 4B9SA 3DI6A 2P9PA 4JI8K 3HVTA 1QS4A 3RSEA 3CJ7A 1JCFA 3CJCA 3O80A 4FJ9A 2YKMA 1EETA 1TAQA 5LY3A 3W3DA 2Z1JA 3VEYA 4K41A 3SCXA 3BGRA 3O3FA 3SYZA 1XUPO 4CZGA 3K5NA 4KHYA 3LP2A 4O0JA 1LOTB 1I3AA 1KCFA 2V7YA 4CFAA 1NK6A 1W7AA 2Q1NA 4BG8A 1HJOA 1OH5A 1LCUA 2VWJA 1IJJA 1SKRA 3B8AX 4NCGA 3SAFA 4RW4A 2QA4N 4FM2A 3K5OA 1GLJO 3HP6A 5HRRA 3AA3A 3S9HA 4BR9A 4LFCK 2P9IA 3TABA 2PBDA 3EYZA 3WXMB 4CEBA 4E7IA 2JWLA 1E4GT 2HBMA 1NGHA 4I6MA 1NGEA 4CJEA 3NH2A 5TKYA 2HOEA 4CJLA 4I2QA 2QWNA 3HM8A 4GY2B 4CFDA 4QS9A 2Y1IA 1XC3A 2G8WA 4X66K 2DPNA 1N6QA 1VQNN 1XC9A 1V4SA 2VYPA 4B9LA 1KTQA 4KHWA 2HF3A 5FDLA 4MDBA 3QFUA 3V9ZA 3SMPA 2VGMA 5AZJA 3FGUA 2E8AA 1VRUA 2D4WA 3LDNA 2RN2A 3OJUA 4A61A 3VA3A 4CF1A 4FOIA 3CFOA 2GBZA 3R8EA 4DSIA 1JLQA 4DG1A 4WQ4C 3MEEA 1YAGA 1IH7A 4Y0WA 1P8ZA 4RW8A 4DR4K 4DR5K 3QESA 3M3ZA 4U67L 3ZSQA 4BROA 4IFYA 3V6DA 3SBTA 5AFUA 1MWKA 5BPLA 3O9SA 1J6ZA 4LF9K 3DJCA 2G8HA 3HPGA 1KXPA 2D0PA 1U04A 1S9EA 4NLCA 2ZJPL 2I7PA 3ZT3A 4CHZA 2E2NA 2P9PB 3VGMA 4OPKA 2QKKA 5MLCQ 2E1ZA 3RSEB 1DT9A 1TV6A 3I56N 1KAYA 3NBPA 3DLLL 2GWJA 3OYFA 3L8BA 2F8TA 2QWMA 1EWRA 2ZD1A 4CGHA 1S22A 3VQAA 2KTQA 4IXCA 1I94K 4OKJA 1Z05A 4PQUA 1HNIA 3AGRA 1OH6A 4YORA 3DLEA 3LWMA 4J2DA 4B8AB 4IOCL 1VSHA 4WFBL 4IBNA 2AA4A 3U3YA 1D5AA 3OBWA 3CJ1A 1RDBA 3NFAA 5AQWA 4CGJA 2QM1A 3JSMA 3PY8A 3F9KA 4RG8A 2ZM6K 3QNNA 1KLMA 1NLVA 1IV0A 4GV3A 5JS2A 4J2AA 3HXMA 3O8MA 1YI2N 2E2OA 1RT6A 4W5NA 1D4XA 1K8KA 3HTVA 3VEVA 4I6MB 4TSXA 3BUZB 1NOZA 2IS3A 3UKRA 1WBDA 3DXMA 3MMVA 4B08A 4IOXA 2A5XA 4JI7K 3B6OA 2YJFA 2HNZA 2QEXN 2ZWHA 4FWOA 5M1KA 3EE9A 4DUYK 4O4GA 4JI0K 5AZJB 3K5MA 4CK2A 3E66A 3HSCA 4ID1A 4DV3K 3SQ1A 3O4NA 3D7EO 3K9KA 4C1NK 4N56A 4MDAA 2FBYA 4A5AA 3CJ9A 5BRDA 3VQQA 2IVNA 1BOTO 2NLXA 1Y97A 4OO1J 1RFQA 3L3UA 1DEJA 3NE6A 5JVHL 5EX5A 3SJJA 2E20A 4CEFA 5C2DA 4FJGA 5HL7L 3HZ6A 5LJVA 1TYQA 4G1QA 2A1RA 2GX9A 4FOEA 4ELVA 1YT3A 4CW7B 4FWLA 3HM9A 3D2FA 3VQPA 2VQFK 1TUUA 4XH1A 4RW9A 4BACA 2D0AA 4B9UA 3ENOA 4BR7A 4BRIA 3ZETA 3V9XA 3QBWA 2HB5A 3LALA 1KQSM 1U48A 4L3QA 3KHYA 1BIUA 3KWGA 4K8ZA 3ZX3A 1ZBIA 2GV9A 3OS0A 4CF9A 3TTDA 3WUHA 4UQGA 3EN9A 3QO9A 3VQ8A 2VWKA 2Z1IA 3O6WA 4OJRA 1KSPA 2VG5A 2XO7A 4OGEA 4FZZA 3CIPA 4J2BA 2NRWA 5LMNK 1ZBHA 2UXBK 1SAZA 4BWJA 1ASUA 1K8KB 5C42A 4GKJK 5IT9O 3UKRB 1KFSA 1GLEG 3DXMB 4FJHA 4Z4EA 4GVMA 4F3OA 3MN7A 3H3OB 3OW2M 4X64K 1L5UA 1Q86O 3ZLJA 5GINA 3SUPA 3ID6A 4C8LA 5BR9A 3T3FA 3SMSA 5EVZA 1NJYA 4CFBA 2IC3A 1ATRA 5M1NA 3HYFA 4CGIA 3LPUA 4KH4A 4WCEL 2NRZA 5C0YA 1LWCA 2FLOA 4BC5A 4BR2A 1MWMA 1RDCA 3D45A 2W42A 4B1VA 3U4LA 4CZEA 3PIOL 1BQMA 4CE9A 3QEVA 2F4VK 3NHGA 3TPQA 1TYQB 5HRNA 4MLEA 1J9AA 1QZ5A 2KKZA 1HRHA 3SUQA 4BRLA 3FZMA 3D2FB 3DRRA 4YOXA 3P4IA 3VQ6A 4IJAA 3ZETB 1QE1A 4KHUA 3CF5L 3FZHA 4CF8A 4A2BA 2PY5A 4KTZA 2KZMA 5HRSA 4CJFA 4EP5A 3TAPA 4DF8A 3U9ZA 2YNGA 5KGXA 4WF9L 2OCEA 3AY9A 4HWIA 4YOTA 2RE2A 1JL2A 2XY6A 2QK9A 4Z4GA 4B3TK 3EE8A 3AO5A 4YNQA 1BO5O 4DS5A 3RVCA 4GNIA 4B3RK 2YHXA 1SL1A 1KAZA 1O1WA 5FPNA 3G71N 3BY5A 4ISGA 3VTHA 4JKAA 1NGAA 1IKXA 3NF7A 5AQXA 3CCQN 2I7NA 3UB5A 1QTMA 1XHZA 3MEGA 3VTIA 1YJNN 3CPEA 4DTXA 1IBMK 4OKEA 4JKGA 4PKHA 4IG3A 1KVCA 3K0SA 5J2PA 4DTJA 2QTDA 3JXUA 2Q2RA 4N47A 3I0SA 4E89A 3ZSVA 1S6PA 2NRXA 3WQUA 3ZEUA 3C65A 3O1BA 3LL3A 5B8HA 3AO4A 4JI2K 3VEWA 2X78A 3ALYA 1ASVA 2HHWA 4CZKA 4FL9A 1JXBA 1B92A 1FKOA 4N76A 3LDPA 3SNNA 1DGKN 1TVRA 4LFAK 5AZIA 4BQZA 3VQ4A 1KAXA 4FZXC 1S1UA 2F9TA 2D0BA 3CCVN 4CZLA 1FJGK 3LM2A 4FJIA 4Z4FA 2A40A 1ZBLA 1FXXA 2UUBK 4KI6A 1RBRA 2JLEA 3LPTA 2E5LK 1BUPA 4AH9A 3LZIA 4B1ZA 4E1NA 1KLNA 3PIPL 3VQDA 4IO9L 4FPAA 4K8XA 2A41A 4B1YB 1C0GA 1JLBA 4CIEA 1HYZA 2BE2A 4OPJA 1L3UA 1RDDA 2OYQA 4M3RA 4C8NA 4DQRA 1ZXOA 4PWDA 4AM7A 4O5FA 1VQON 1N8RO 4YY3K 3WNEA 3PSFA 4FYDA 1X9SA 4DSFA 4K25A 2E1YA 1EO1A 4BGBA 1DKGD 3ZX0A 2BH1A 4IKFA 1QHTA 2O8BA 1GOBA 1QQCA 1ZBUA 2ASOA 4KBOA 4C8MA 2HNDA 4JKGB 4FM1A 4B9VA 3CCEN 1BA1A 3VQ9A 1T6DA 4DR3K 2KFNA 1SKWA 3QIPA 1IKYA 1VSKA 2QXLA 3AVMA 4NO7A 4OGCA 1BA0A 3ZEUB 3RR8A 5GAHP 4Z4IA 4EHUA 4M3WA 3AVJA 3KKRA 5E26A 4CIGA 3TTFA 5CHIA 5FPDA 1ZC6A 3H1QA 5EOYA 4HUEA 3BZCA 5AQYA 2X74A 4JI5K 3CC4N 1Q9XA 1RTDA 3MCAB 4CHYA 4PHTX 3AVIA 3HI0A 4FLZA 2PYLA 2QW9A 3NDKA 1LAWA 4DV7K 5HP1A 1YJWN 3DWLA 5AZIB 1YTUA 1TL3A 3NF8A 4YOUA 1RDWX 4BR4A 3ZT1A 1OH8A 3QEIA 3V1RA 5AQPA 2KHOA 2V51B 4KHQA 4DKWA 1C0TA 4DQSA 5HRPA 4JYAK 3NVKA 3V1QA 3QB0A 1RILA 4JNEA 3D2EA 1K8AO 4KB0A 4CJWA 5KI6A 2W6LA 5AQNA 3DOLA 3HOSA 4AHVA 3R9PA 3AA4A 1KFDA 4QCLA 2D0CA 3K59A 4C8KA 4FW2A 2P5OA 2F96A 4FZYA 2JWKA 4AF1A 5AJ3K 3KIOA 4M3XA 3KLEA 3QNOA 2ATQA 5M1PA 4AILC 3O9UA 1WSGA 4E7HA 3BEXA 3ATVA 1WBBA 4GW6A 4FCYA 4LSLA 1RDUA 3FFIA 2VG7A 4BRHA 1SUQA 1U2VA 5HROA 1Q81O 5FRMA 3QINA 1JCEA 2O8BB 3EEQA 5DMRA 2UXCK 4B3SK 4LF8K 4CEDA 3HBTA 2QWRA 3FR0A 3A2FA 3KLFA 4DV5K 1UA1A 4Z4HA 4H4OA 1D9DA 4CJ5A 3TTCA 4CGFA 1ILYA 4J2EA 4KKOA 3VQBA 2ZF5O 3RRGA 4N5SA 2D5RA 4NYNA 3PO4A 4FJLA 4C1NI 3O5BA 1YIJN 4CZHA 1WOQA 4FXDA 4LFBK 1BCOA 4KFBA 3SV4A 4KPYA 5ELZA 3ENHA 2W40A 4FJMA 1B9FA 1BCMA 3OS1A 4KI4A 4DTSA 4B3OA 3R3LA 1RGIA 4FLWA 3TSQA 4H0PA 4M7YA 3JYTA 4CK1A 2W6KA 1WSHA 4C8OA 3KK7A 3F9MA 2YHBA 3KVGA 1VQ9N 5EY4A 4PKGA 3VN5A 1B9DA 3E1YA 3J8AA 1S1VA 1RBVA 3LDQA 3ZSRA 5C12A 1HX1A 2P5GA 3QEPA 5EU7A 2VG6A 5H1SQ 1QQNA 4R5PA 3WNGA 3VF4A 1TK0A 2DFFA 3AVFA 2Q97A 3D2EB 3C6HA 2JGUA 4O5BA 4CHPA 3T69A 1GLCG 1X3MA 4CIFA 4KTWA 3J7YP 4IOAL 1VK0A 5CYQA 2WONA 5JS1A 4B3MK 5AQGA 1HKGA 2PYJA 4DV1K 3IUCA 2H3GX 3ZT2A 2NRVA 3AVNA 3HO1A 4BRMA 4DF4A 4JKEA 2PFUA 5AQOA 3RRHA 3CFRA 3QIOA 4BE1A 3P1GA 4CHOA 1U2VB 2CGKA 1SL0A 4CEOA 4F4KA 4KHSA 4M3ZA 4FWSA 1BU6O 4XH4A 5I3UA 4DV6K 4FLTA 2IAJA 2WFBA 3RMBA 3SI6A 1J5EK 2OA8A 4DSLA 5AQUA 4MQ3A 3I8DA 4DUZK 3H45C 2HNYA 5ADXH 4A59A 4BVOA 1OH7A 3OJSA 4JD2A 2QWPA 4WFAL 3OYKA 1WSIA 1X9JA 5KPZA 3K57A 1NK4A 4DSJA 4BRNA 3DMJA 4HHTA 1T3VA 5AQFA 4F2SA 3M5RA 2G8KA 3NMUA 1S9GA 1U6ZA 4BRGA 1HQUA 2P9IB 3IMXA 3AVKA 4CJSA 2QI2A 3H6EA 3TAEA 3RR7A 4QAGA 3DXKA 2HF4A 3A5NC 3ASMA 1VSIA 1FK9A 4H5VA 1C0MA 2Z1GA 3J80O 2F9WA 2KQ2A 4CJUA 3WEEA 5F0XA 3VPZA 1YF5L 2V7ZA 3PX4A 2FSJA 3WXLA 3OYHA 1W9HA 3H1VX 3PLAA 1QQOA 2X6SA 2QWQA 4XIUA 1IO2A 3AO2A 2OANA 4AHTA 3NF9A 4DV4K 3DOKA 4JRPA 3Q7BA 4FWKA 4HUGA 1S1WA
chains in the Genus database with same CATH topology
4CF8A 2PY5A 1JKHA 4KTZA 1JLCA 4CERA 1ZYQA 1L3SA 1JLGA 3NH1A 1NJZA 2KZMA 1L3VA 5HRSA 4BE0A 4CJFA 3O3HA 4EP5A 3TAPA 4DF8A 1TAUA 1NJXA 2XRIA 2YNGA 1SV5A 4CEEA 5KGXA 3OY9A 1S1XA 3SPZA 4ZTFA 3S3MA 2KZZA 1EKEA 5E41A 2ZQBA 2YNHA 5CZ1A 1JL2A 3E01A 3LP1A 2XY6A 2QK9A 4BDPA 4Z4GA 3L2WA 3AO5A 4YNQA 3ZSXA 4DS5A 1K6YA 4Z0UA 1U4BA 4PY5A 3BDPA 3IAYA 3M8QA 4O0IA 4CJVA 1SL1A 1G15A 3L2VA 1O1WA 4CHNA 3NF6A 4LD0A 4LH4A 3KK1A 4DTUA 1REVA 4YFUA 1BGXT 4HUFA 5J1EA 3OYEA 3UIQA 3LWLA 3OVNA 4ELTA 4NCAA 2G8IA 3AO3A 1DTQA 1CLQA 3TI0A 4DU1A 3L2QA 3WNFA 3HK2A 1A5WA 5FROA 1IKXA 3IRXA 3O4QA 2P1JA 3MECA 1EX4A 4DMNA 3NF7A 1YVUA 1KRPA 4LSNA 4FJ8A 4CGGA 1RTHA 1U45A 2HVHA 2WOMA 1QTMA 3CQ8A 1HQEA 1XHZA 2Y1JA 4FK0A 5SWMA 3MEGA 3HL8A 3K58A 3KK3A 3SPYA 4CJ4A 4OKKA 1S1TA 4I9QA 3AA5X 1JL1A 3TR8A 3KK2A 5KTQA 2G8FA 2B5JA 3PUFA 2HHQA 1GOAA 3RMAA 4DTXA 2XY8A 3TAGA 4OKEA 1RT3A 4M3YA 2YNIA 3DRSA 4DQQA 1GOCA 1X1PA 3QEWA 4IG3A 1KVCA 3HVRA 3KD5E 5J2PA 4FK2A 4KV8A 2OPQA 4DTJA 1LW2A 3EZ5A 4N47A 1QSSA 1HMVA 3HPOA 2B6AA 2R7YA 3I0SA 3CFPA 4FJXA 4E89A 1NKCA 1NK7A 3VQ5A 3RTVA 3KKSA 3ZSVA 1S6PA 3OYCA 1VSFA 5K14A 4CEQA 3OYJA 4DLGA 3TAQA 3HT3A 3SUNA 2HHTA 4NYFA 4DTMA 3SQ0A 2PZSA 1U47A 1WSEA 1U49A 3AO4A 4B8CA 2X78A 3ALYA 4KAZA 1IG9A 1IKWA 2BANA 1ASVA 1A5VA 1RBTA 3OYGA 1R0AA 3DLBA 2HHWA 3V81A 3M8PA 4DSKA 4DU3A 4AHRA 4JS4A 4DWIA 4FJ7A 4IFVA 3OYLA 1JXBA 2Q3SA 3L3VA 3KD1E 2BDPA 5I42A 3ZT4A 1B92A 1FKOA 4N76A 2GUIA 2IOCA 3SNNA 1RT2A 4CEZA 4B9MA 3HPHA 5CYMA 3DLRA 2AJQA 1TVRA 4Q0BA 4BWMA 3VQ4A 4FK4A 1RT7A 1J53A 4E7JA 4FZXC 1S1UA 1RCHA 1RT5A 2DTUA 1J54A 2D0BA 2NUBA 3AVGA 3C95A 1TK8A 1C1BA 1VSDA 1NK5A 1UA0A 2FBXA 1Z26A 3LP3A 4FLYA 3U6FA 4FJIA 4Z4FA 2HHXA 1HJRA 1ZBLA 4HCBA 4AHSA 1FXXA 5C24A 4KI6A 3P5JA 2OZMA 4F8RA 3DLKA 3ISNC 1RBRA 2JLEA 3LPTA 4B9SA 4N41A 3DI6A 2YKNA 1JLEA 3ZSYA 1KVAA 4AH9A 1C1CA 4EZ9A 4E3SA 1RTIA 3HVTA 1BISA 1QS4A 1XWLA 3LZIA 4E1NA 1KLNA 4W5TA 1SKSA 3VQDA 3SQ2A 4FJ9A 1RBSA 1X9MA 1UWBA 3MXMA 4K8XA 4FM0A 2YKMA 1EETA 1JLBA 1TAQA 4I9LA 2Z1JA 4CIEA 3SCXA 1HYZA 2BE2A 3BGRA 4OPJA 3O3FA 1L3UA 1RDDA 2OYQA 3SYZA 3V9UA 3K5NA 1LW0A 4M3RA 4KHNA 4KHYA 3LDSA 4C8NA 4DQRA 3LP2A 3U3GA 3MXIA 4O0JA 1QSLA 3KTQA 4PWDA 3MXJA 1I3AA 1KCFA 2HMIA 4CFAA 1CXQA 2LSNA 1XI1A 1NK6A 3TAFA 3VQEA 3WNEA 4FYDA 1X9SA 2YV0X 4OVLA 1TKDA 3DLHA 4DFPA 1IKVA 4W5RA 4DSFA 2VWJA 4JRQA 1SKRA 4EZ6A 3ZSWA 3CM5A 3KLHA 4NCGA 4B9NA 4IKFA 3ITHA 4RW4A 4FM2A 1QHTA 3K5OA 4FLUA 1GOBA 4FJKA 3HP6A 1QQCA 1YTAA 3P83D 5HRRA 3IG1A 1ZBUA 3AA3A 3S9HA 4C8MA 2HNDA 3OS2A 4FM1A 1VSMA 3IS9A 4GMJB 3DYAA 4B9VA 3TABA 3VQ9A 4FJJA 4F3TA 2HHUA 2RF2A 4CECA 4M42A 3EYZA 4CEBA 3DRPA 5T7BA 1JLFA 2YHAA 4E7IA 2KFNA 3AVCA 4CJEA 1RBUA 3KLIA 3QIPA 5DK5A 1SKWA 3NH2A 4CJLA 2FC0A 1CZ9A 4I2QA 1IKYA 1VSKA 1NOYA 3AVMA 4CFDA 4OGCA 3SZ2A 3RR8A 2Y1IA 2G8WA 4FJNA 1N6QA 4Z4IA 4M3WA 1XC9A 1EP4A 3AVJA 4BDZA 3KKRA 4CIGA 1NKBA 4B9LA 4E0DA 1KTQA 1NK0A 4KHWA 5FDLA 3LAKA 4E19A 3V9ZA 3B6PA 3PX6A 4NCBA 4HUEA 5FRNA 3TANA 2X74A 1VRUA 1Q9XA 4DS4A 2RN2A 1RTDA 3PV8A 4CHYA 3OJUA 3L2RA 3VA3A 3AO1A 4CF1A 2DFEA 3ULDA 2HVIA 2Z1HA 3CFOA 2FBVA 4JS5A 1T8EA 3AVHA 3AV9A 2RKIA 3LANA 4DLEA 2DFHA 1BHLA 4DTOA 2GBZA 3AVIA 4CHQA 4W5OA 4FLZA 1JLQA 4DG1A 3KLGA 4CF0A 2PYLA 3MEEA 1WN7A 3V1OA 3NDKA 1LAWA 3ZT0A 4E7LA 1IH7A 3VQCA 3NGZA 4M3TA 4KREA 4RW8A 4DQPA 3QESA 5HP1A 1YTUA 3V6DA 1TL3A 3ZSQA 3NF8A 4IFYA 5KRTA 4DFMA 3ZT1A 3AVBA 3V1RA 3QEIA 1WNSA 2G8HA 3HPGA 4Y1DA 4KHQA 3MAQA 2KW4A 1U04A 1S9EA 4RW6A 3NGYA 4H4MA 1LWEA 1C0TA 1UAXA 4DQSA 5HRPA 3NGIA 4DU4A 3ZT3A 4CHZA 3V1QA 1UOCA 4DTNA 1RILA 3TARA 3C6TA 4Z4CA 4OPKA 4CJWA 2QKKA 4KB0A 5KI6A 3CG7A 3DOLA 1LAVA 5CZ2A 4AHVA 2XY7A 4QOZB 1TV6A 3AA4A 1KFDA 4CJ3A 3V4IA 4QCLA 3NBPA 3OYFA 3L8BA 2D0CA 2X6NA 4MFBA 3K59A 2F8TA 4C8KA 1RT4A 4FW2A 2P5OA 2F96A 2ZD1A 4CGHA 3VQAA 4FZYA 2KTQA 2E6LA 5D3GA 5SZTA 1MU2A 3CYMA 4OKJA 5KGWA 4PQUA 2ITGA 1HNIA 1WAJA 3KIOA 4WE1A 1WAFA 3H08A 4M3XA 3KLEA 3QNOA 4DSIA 2ATQA 4KB1A 3SQ4A 2FBTA 3DLEA 1F21A 4AILC 3LWMA 1WSGA 4E7HA 2XY5A 1BL3A 1LV5A 4B8AB 4J2DA 2KFZA 1VSHA 3HJFA 4HVJA 4IBNA 2HHSA 4E7KA 2IDOA 4LY7A 3U3YA 1D5AA 1Q8IA 4GW6A 4FCYA 4LSLA 1T03A 1VSLA 1RDBA 3FFIA 3NFAA 2BGGA 2VG7A 4CGJA 3QLHA 3PY8A 3JSMA 4W5NA 1SUQA 5HROA 3F9KA 5FRMA 3QINA 4RG8A 1TKZA 4EP4A 5DMRA 3QNNA 1KLMA 4CEDA 5JS2A 4J2AA 3HXMA 3A2FA 3KLFA 4FLXA 1RT6A 1W0HA 4Z4HA 3M8RA 4H4OA 3S3NA 1UA1A 1D9DA 2QKBA 4CJ5A 1RNHA 4CGFA 4KRFA 4FJ5A 3HP9A 4J2EA 4KKOA 3SUOA 2QXFA 4TSXA 3VQBA 2OPSA 4BDYA 1NOZA 2IS3A 3RRGA 4N5SA 3V9WA 4B08A 2D5RA 4NYNA 3OYDA 3B6OA 3DM2A 3PO4A 4AHCA 2HNZA 4FJLA 3DLGA 3TAMA 3M8SA 5J2NA 1J5OA 1T7PA 4FXDA 2EX3A 1BCOA 4KFBA 3SV4A 4KPYA 1L3TA 3OYMA 4O4GA 4IG0A 4FJMA 1B9FA 3K5MA 4Y1CA 1BCMA 3OS1A 4CK2A 2O4GA 4DTSA 4KI4A 3QETA 4ELUA 4HTUA 4BE2A 2DY4A 4ID1A 4LH5A 3SQ1A 2P51A 3K2PA 3CM6A 3O4NA 4B3OA 4N56A 1RTJA 1BQNA 3LZJA 4DFKA 3RMDA 2FBYA 4ID5A 4FLWA 4CFCA 4O55A 3VQQA 2OPPA 4M41A 1I39A 3JYTA 1Y97A 3K5LA 4CK1A 3S3OA 1WSHA 3OYAA 3WNHA 3ZSOA 3SV3A 4FLVA 4C8OA 2I5JA 3L3UA 4CK3A 2YHBA 4HCCA 1BI4A 3NE6A 3MEDA 1C6VA 1TGOA 4OLBA 3SJJA 4CEFA 5HLFA 2G8VA 1XHXA 4DQIA 3VN5A 1B9DA 4FJGA 1JLAA 2RPIA 1S1VA 1RBVA 3QEXA 3ZSRA 1VSEA 4H8KA 2P5GA 3QEPA 1KVBA 4CJPA 5EU7A 2VG6A 4G1QA 2A1RA 2B4JA 4DTRA 4OLAA 3KJVA 2E4LA 4ELVA 4R5PA 4M3UA 1YT3A 3WNGA 1TK0A 3C6UA 1LWFA 1QSYA 4ZHRA 2DFFA 3OYIA 4ZTJA 3AVFA 2ETJA 1JXEA 3ZCMA 3D0PA 5J2MA 5CY4A 1X9WA 3HM9A 2A1SA 1HPZA 3VQPA 2JGUA 4ICLA 4KO0A 4O5BA 4DFJA 4CHPA 1Q9YA 4RW9A 4BACA 2D0AA 4B9UA 4CIFA 4KTWA 4DSEA 1Z25A 4E1MA 3V9XA 3T19A 1VK0A 5CYQA 1WSFA 3NAEA 2HB5A 3LALA 4CF2A 5C25A 1U48A 1BIUA 2WONA 5JS1A 4K8ZA 1ZBIA 1NKEA 2GV9A 4CESA 3OS0A 2PYJA 4CF9A 3QERA 1TL1A 1C1AA 2IGIA 1S5JA 3LAMA 1EXQA 3ZT2A 4CJKA 4UQGA 3QO9A 3G0ZA 3VQ8A 4I7FA 3AVNA 2VWKA 3HO1A 4DF4A 4F2RA 4PA1A 4CGDA 1D9FA 1C0UA 1DTTA 1SL2A 4O44A 1BIZA 1DLOA 3RMCA 4B9TA 4JLHA 2Z1IA 4OJRA 1KSPA 3RRHA 2VG5A 3QIOA 3CFRA 4FVMA 3P1GA 4CHOA 2XO7A 4BE1A 1NK8A 4CCHA 4OGEA 1CZBA 4DTPA 4M45A 1SL0A 4CEOA 4FZZA 4F4KA 4J2BA 4KHSA 4M3ZA 1A5XA 1ZBHA 1ITGA 1T05A 5J2QA 4CJRA 4BWJA 1ASUA 3NH0A 2G8UA 5C42A 5I3UA 4FLTA 2IAJA 3RWUA 3RMBA 3SI6A 2OA8A 4DSLA 1KFSA 4FJHA 4Z4EA 3V9SA 3EY1A 4GVMA 1FKPA 1CXUA 4MQ3A 3OYBA 3I8DA 1HYSA 4PUOA 4F3OA 2HNYA 1L5UA 3NCIA 3SUPA 2OZSA 1N5YA 4C8LA 1WSJA 1ZBFA 3OJSA 1NK9A 2HW3A 4KTQA 3T3FA 3OYKA 1WSIA 4I2PA 1NJYA 3VQ7A 2OPRA 4CFBA 2IC3A 3K57A 3VA0A 2ZE2A 1NK4A 4DSJA 4CJQA 2E6MA 3HYFA 3DMJA 4CGIA 3LPUA 4HHTA 1S6QA 1TKTA 4F2SA 3OYNA 2G8KA 1LWCA 2YNFA 3G10A 1S9GA 2XHBA 1VRTA 3O3GA 1HQUA 1RDAA 4CJTA 3AVKA 4CJSA 3TAEA 3HSTB 3RR7A 4IDKA 1RDCA 3C94A 4QAGA 3ASMA 3LP0A 3D45A 1VSIA 1FK9A 2EHGA 2W42A 1D8YA 1BI4B 1C0MA 2Z1GA 3F73A 4RW7A 3L2UA 2KQ2A 4W5QA 1BQMA 4CJUA 4AHUA 4CE9A 3QEVA 3NHGA 4Q5VA 1VSJA 3PX4A 2HHVA 3T1AA 1TK5A 1RT1A 5HRNA 1J9AA 1ASWA 3OYHA 3THVA 1W9HA 3TWHA 1HRHA 3AVAA 5HBMA 2X6SA 4CEAA 5KRSA 3SUQA 2O4IA 1NJWA 4FW1A 4L8RB 3AA2A 4XIUA 1IO2A 3AO2A 1HNVA 4AHTA 1HYVA 3NF9A 3DRRA 3DOKA 3PO5A 1TKXA 3PX0A 4JRPA 3VQ6A 4HUGA 3ZSZA 1QE1A 3I0RA 4KHUA 3AVLA 1WLJA 1S1WA 2F8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CF8 A;  2PY5 A;  1JKH A;  4KTZ A;  1JLC A;  4CER A;  1ZYQ A;  1L3S A;  1JLG A;  3NH1 A;  1NJZ A;  2KZM A;  1L3V A;  5HRS A;  4BE0 A;  4CJF A;  3O3H A;  4EP5 A;  3TAP A;  4DF8 A;  1TAU A;  1NJX A;  2XRI A;  2YNG A;  1SV5 A;  4CEE A;  5KGX A;  3OY9 A;  1S1X A;  3SPZ A;  4ZTF A;  3S3M A;  2KZZ A;  1EKE A;  5E41 A;  2ZQB A;  2YNH A;  5CZ1 A;  1JL2 A;  3E01 A;  3LP1 A;  2XY6 A;  2QK9 A;  4BDP A;  4Z4G A;  3L2W A;  3AO5 A;  4YNQ A;  3ZSX A;  4DS5 A;  1K6Y A;  4Z0U A;  1U4B A;  4PY5 A;  3BDP A;  3IAY A;  3M8Q A;  4O0I A;  4CJV A;  1SL1 A;  1G15 A;  3L2V A;  1O1W A;  4CHN A;  3NF6 A;  4LD0 A;  4LH4 A;  3KK1 A;  4DTU A;  1REV A;  4YFU A;  1BGX T;  4HUF A;  5J1E A;  3OYE A;  3UIQ A;  3LWL A;  3OVN A;  4ELT A;  4NCA A;  2G8I A;  3AO3 A;  1DTQ A;  1CLQ A;  3TI0 A;  4DU1 A;  3L2Q A;  3WNF A;  3HK2 A;  1A5W A;  5FRO A;  1IKX A;  3IRX A;  3O4Q A;  2P1J A;  3MEC A;  1EX4 A;  4DMN A;  3NF7 A;  1YVU A;  1KRP A;  4LSN A;  4FJ8 A;  4CGG A;  1RTH A;  1U45 A;  2HVH A;  2WOM A;  1QTM A;  3CQ8 A;  1HQE A;  1XHZ A;  2Y1J A;  4FK0 A;  5SWM A;  3MEG A;  3HL8 A;  3K58 A;  3KK3 A;  3SPY A;  4CJ4 A;  4OKK A;  1S1T A;  4I9Q A;  3AA5 X;  1JL1 A;  3TR8 A;  3KK2 A;  5KTQ A;  2G8F A;  2B5J A;  3PUF A;  2HHQ A;  1GOA A;  3RMA A;  4DTX A;  2XY8 A;  3TAG A;  4OKE A;  1RT3 A;  4M3Y A;  2YNI A;  3DRS A;  4DQQ A;  1GOC A;  1X1P A;  3QEW A;  4IG3 A;  1KVC A;  3HVR A;  3KD5 E;  5J2P A;  4FK2 A;  4KV8 A;  2OPQ A;  4DTJ A;  1LW2 A;  3EZ5 A;  4N47 A;  1QSS A;  1HMV A;  3HPO A;  2B6A A;  2R7Y A;  3I0S A;  3CFP A;  4FJX A;  4E89 A;  1NKC A;  1NK7 A;  3VQ5 A;  3RTV A;  3KKS A;  3ZSV A;  1S6P A;  3OYC A;  1VSF A;  5K14 A;  4CEQ A;  3OYJ A;  4DLG A;  3TAQ A;  3HT3 A;  3SUN A;  2HHT A;  4NYF A;  4DTM A;  3SQ0 A;  2PZS A;  1U47 A;  1WSE A;  1U49 A;  3AO4 A;  4B8C A;  2X78 A;  3ALY A;  4KAZ A;  1IG9 A;  1IKW A;  2BAN A;  1ASV A;  1A5V A;  1RBT A;  3OYG A;  1R0A A;  3DLB A;  2HHW A;  3V81 A;  3M8P A;  4DSK A;  4DU3 A;  4AHR A;  4JS4 A;  4DWI A;  4FJ7 A;  4IFV A;  3OYL A;  1JXB A;  2Q3S A;  3L3V A;  3KD1 E;  2BDP A;  5I42 A;  3ZT4 A;  1B92 A;  1FKO A;  4N76 A;  2GUI A;  2IOC A;  3SNN A;  1RT2 A;  4CEZ A;  4B9M A;  3HPH A;  5CYM A;  3DLR A;  2AJQ A;  1TVR A;  4Q0B A;  4BWM A;  3VQ4 A;  4FK4 A;  1RT7 A;  1J53 A;  4E7J A;  4FZX C;  1S1U A;  1RCH A;  1RT5 A;  2DTU A;  1J54 A;  2D0B A;  2NUB A;  3AVG A;  3C95 A;  1TK8 A;  1C1B A;  1VSD A;  1NK5 A;  1UA0 A;  2FBX A;  1Z26 A;  3LP3 A;  4FLY A;  3U6F A;  4FJI A;  4Z4F A;  2HHX A;  1HJR A;  1ZBL A;  4HCB A;  4AHS A;  1FXX A;  5C24 A;  4KI6 A;  3P5J A;  2OZM A;  4F8R A;  3DLK A;  3ISN C;  1RBR A;  2JLE A;  3LPT A;  4B9S A;  4N41 A;  3DI6 A;  2YKN A;  1JLE A;  3ZSY A;  1KVA A;  4AH9 A;  1C1C A;  4EZ9 A;  4E3S A;  1RTI A;  3HVT A;  1BIS A;  1QS4 A;  1XWL A;  3LZI A;  4E1N A;  1KLN A;  4W5T A;  1SKS A;  3VQD A;  3SQ2 A;  4FJ9 A;  1RBS A;  1X9M A;  1UWB A;  3MXM A;  4K8X A;  4FM0 A;  2YKM A;  1EET A;  1JLB A;  1TAQ A;  4I9L A;  2Z1J A;  4CIE A;  3SCX A;  1HYZ A;  2BE2 A;  3BGR A;  4OPJ A;  3O3F A;  1L3U A;  1RDD A;  2OYQ A;  3SYZ A;  3V9U A;  3K5N A;  1LW0 A;  4M3R A;  4KHN A;  4KHY A;  3LDS A;  4C8N A;  4DQR A;  3LP2 A;  3U3G A;  3MXI A;  4O0J A;  1QSL A;  3KTQ A;  4PWD A;  3MXJ A;  1I3A A;  1KCF A;  2HMI A;  4CFA A;  1CXQ A;  2LSN A;  1XI1 A;  1NK6 A;  3TAF A;  3VQE A;  3WNE A;  4FYD A;  1X9S A;  2YV0 X;  4OVL A;  1TKD A;  3DLH A;  4DFP A;  1IKV A;  4W5R A;  4DSF A;  2VWJ A;  4JRQ A;  1SKR A;  4EZ6 A;  3ZSW A;  3CM5 A;  3KLH A;  4NCG A;  4B9N A;  4IKF A;  3ITH A;  4RW4 A;  4FM2 A;  1QHT A;  3K5O A;  4FLU A;  1GOB A;  4FJK A;  3HP6 A;  1QQC A;  1YTA A;  3P83 D;  5HRR A;  3IG1 A;  1ZBU A;  3AA3 A;  3S9H A;  4C8M A;  2HND A;  3OS2 A;  4FM1 A;  1VSM A;  3IS9 A;  4GMJ B;  3DYA A;  4B9V A;  3TAB A;  3VQ9 A;  4FJJ A;  4F3T A;  2HHU A;  2RF2 A;  4CEC A;  4M42 A;  3EYZ A;  4CEB A;  3DRP A;  5T7B A;  1JLF A;  2YHA A;  4E7I A;  2KFN A;  3AVC A;  4CJE A;  1RBU A;  3KLI A;  3QIP A;  5DK5 A;  1SKW A;  3NH2 A;  4CJL A;  2FC0 A;  1CZ9 A;  4I2Q A;  1IKY A;  1VSK A;  1NOY A;  3AVM A;  4CFD A;  4OGC A;  3SZ2 A;  3RR8 A;  2Y1I A;  2G8W A;  4FJN A;  1N6Q A;  4Z4I A;  4M3W A;  1XC9 A;  1EP4 A;  3AVJ A;  4BDZ A;  3KKR A;  4CIG A;  1NKB A;  4B9L A;  4E0D A;  1KTQ A;  1NK0 A;  4KHW A;  5FDL A;  3LAK A;  4E19 A;  3V9Z A;  3B6P A;  3PX6 A;  4NCB A;  4HUE A;  5FRN A;  3TAN A;  2X74 A;  1VRU A;  1Q9X A;  4DS4 A;  2RN2 A;  1RTD A;  3PV8 A;  4CHY A;  3OJU A;  3L2R A;  3VA3 A;  3AO1 A;  4CF1 A;  2DFE A;  3ULD A;  2HVI A;  2Z1H A;  3CFO A;  2FBV A;  4JS5 A;  1T8E A;  3AVH A;  3AV9 A;  2RKI A;  3LAN A;  4DLE A;  2DFH A;  1BHL A;  4DTO A;  2GBZ A;  3AVI A;  4CHQ A;  4W5O A;  4FLZ A;  1JLQ A;  4DG1 A;  3KLG A;  4CF0 A;  2PYL A;  3MEE A;  1WN7 A;  3V1O A;  3NDK A;  1LAW A;  3ZT0 A;  4E7L A;  1IH7 A;  3VQC A;  3NGZ A;  4M3T A;  4KRE A;  4RW8 A;  4DQP A;  3QES A;  5HP1 A;  1YTU A;  3V6D A;  1TL3 A;  3ZSQ A;  3NF8 A;  4IFY A;  5KRT A;  4DFM A;  3ZT1 A;  3AVB A;  3V1R A;  3QEI A;  1WNS A;  2G8H A;  3HPG A;  4Y1D A;  4KHQ A;  3MAQ A;  2KW4 A;  1U04 A;  1S9E A;  4RW6 A;  3NGY A;  4H4M A;  1LWE A;  1C0T A;  1UAX A;  4DQS A;  5HRP A;  3NGI A;  4DU4 A;  3ZT3 A;  4CHZ A;  3V1Q A;  1UOC A;  4DTN A;  1RIL A;  3TAR A;  3C6T A;  4Z4C A;  4OPK A;  4CJW A;  2QKK A;  4KB0 A;  5KI6 A;  3CG7 A;  3DOL A;  1LAV A;  5CZ2 A;  4AHV A;  2XY7 A;  4QOZ B;  1TV6 A;  3AA4 A;  1KFD A;  4CJ3 A;  3V4I A;  4QCL A;  3NBP A;  3OYF A;  3L8B A;  2D0C A;  2X6N A;  4MFB A;  3K59 A;  2F8T A;  4C8K A;  1RT4 A;  4FW2 A;  2P5O A;  2F96 A;  2ZD1 A;  4CGH A;  3VQA A;  4FZY A;  2KTQ A;  2E6L A;  5D3G A;  5SZT A;  1MU2 A;  3CYM A;  4OKJ A;  5KGW A;  4PQU A;  2ITG A;  1HNI A;  1WAJ A;  3KIO A;  4WE1 A;  1WAF A;  3H08 A;  4M3X A;  3KLE A;  3QNO A;  4DSI A;  2ATQ A;  4KB1 A;  3SQ4 A;  2FBT A;  3DLE A;  1F21 A;  4AIL C;  3LWM A;  1WSG A;  4E7H A;  2XY5 A;  1BL3 A;  1LV5 A;  4B8A B;  4J2D A;  2KFZ A;  1VSH A;  3HJF A;  4HVJ A;  4IBN A;  2HHS A;  4E7K A;  2IDO A;  4LY7 A;  3U3Y A;  1D5A A;  1Q8I A;  4GW6 A;  4FCY A;  4LSL A;  1T03 A;  1VSL A;  1RDB A;  3FFI A;  3NFA A;  2BGG A;  2VG7 A;  4CGJ A;  3QLH A;  3PY8 A;  3JSM A;  4W5N A;  1SUQ A;  5HRO A;  3F9K A;  5FRM A;  3QIN A;  4RG8 A;  1TKZ A;  4EP4 A;  5DMR A;  3QNN A;  1KLM A;  4CED A;  5JS2 A;  4J2A A;  3HXM A;  3A2F A;  3KLF A;  4FLX A;  1RT6 A;  1W0H A;  4Z4H A;  3M8R A;  4H4O A;  3S3N A;  1UA1 A;  1D9D A;  2QKB A;  4CJ5 A;  1RNH A;  4CGF A;  4KRF A;  4FJ5 A;  3HP9 A;  4J2E A;  4KKO A;  3SUO A;  2QXF A;  4TSX A;  3VQB A;  2OPS A;  4BDY A;  1NOZ A;  2IS3 A;  3RRG A;  4N5S A;  3V9W A;  4B08 A;  2D5R A;  4NYN A;  3OYD A;  3B6O A;  3DM2 A;  3PO4 A;  4AHC A;  2HNZ A;  4FJL A;  3DLG A;  3TAM A;  3M8S A;  5J2N A;  1J5O A;  1T7P A;  4FXD A;  2EX3 A;  1BCO A;  4KFB A;  3SV4 A;  4KPY A;  1L3T A;  3OYM A;  4O4G A;  4IG0 A;  4FJM A;  1B9F A;  3K5M A;  4Y1C A;  1BCM A;  3OS1 A;  4CK2 A;  2O4G A;  4DTS A;  4KI4 A;  3QET A;  4ELU A;  4HTU A;  4BE2 A;  2DY4 A;  4ID1 A;  4LH5 A;  3SQ1 A;  2P51 A;  3K2P A;  3CM6 A;  3O4N A;  4B3O A;  4N56 A;  1RTJ A;  1BQN A;  3LZJ A;  4DFK A;  3RMD A;  2FBY A;  4ID5 A;  4FLW A;  4CFC A;  4O55 A;  3VQQ A;  2OPP A;  4M41 A;  1I39 A;  3JYT A;  1Y97 A;  3K5L A;  4CK1 A;  3S3O A;  1WSH A;  3OYA A;  3WNH A;  3ZSO A;  3SV3 A;  4FLV A;  4C8O A;  2I5J A;  3L3U A;  4CK3 A;  2YHB A;  4HCC A;  1BI4 A;  3NE6 A;  3MED A;  1C6V A;  1TGO A;  4OLB A;  3SJJ A;  4CEF A;  5HLF A;  2G8V A;  1XHX A;  4DQI A;  3VN5 A;  1B9D A;  4FJG A;  1JLA A;  2RPI A;  1S1V A;  1RBV A;  3QEX A;  3ZSR A;  1VSE A;  4H8K A;  2P5G A;  3QEP A;  1KVB A;  4CJP A;  5EU7 A;  2VG6 A;  4G1Q A;  2A1R A;  2B4J A;  4DTR A;  4OLA A;  3KJV A;  2E4L A;  4ELV A;  4R5P A;  4M3U A;  1YT3 A;  3WNG A;  1TK0 A;  3C6U A;  1LWF A;  1QSY A;  4ZHR A;  2DFF A;  3OYI A;  4ZTJ A;  3AVF A;  2ETJ A;  1JXE A;  3ZCM A;  3D0P A;  5J2M A;  5CY4 A;  1X9W A;  3HM9 A;  2A1S A;  1HPZ A;  3VQP A;  2JGU A;  4ICL A;  4KO0 A;  4O5B A;  4DFJ A;  4CHP A;  1Q9Y A;  4RW9 A;  4BAC A;  2D0A A;  4B9U A;  4CIF A;  4KTW A;  4DSE A;  1Z25 A;  4E1M A;  3V9X A;  3T19 A;  1VK0 A;  5CYQ A;  1WSF A;  3NAE A;  2HB5 A;  3LAL A;  4CF2 A;  5C25 A;  1U48 A;  1BIU A;  2WON A;  5JS1 A;  4K8Z A;  1ZBI A;  1NKE A;  2GV9 A;  4CES A;  3OS0 A;  2PYJ A;  4CF9 A;  3QER A;  1TL1 A;  1C1A A;  2IGI A;  1S5J A;  3LAM A;  1EXQ A;  3ZT2 A;  4CJK A;  4UQG A;  3QO9 A;  3G0Z A;  3VQ8 A;  4I7F A;  3AVN A;  2VWK A;  3HO1 A;  4DF4 A;  4F2R A;  4PA1 A;  4CGD A;  1D9F A;  1C0U A;  1DTT A;  1SL2 A;  4O44 A;  1BIZ A;  1DLO A;  3RMC A;  4B9T A;  4JLH A;  2Z1I A;  4OJR A;  1KSP A;  3RRH A;  2VG5 A;  3QIO A;  3CFR A;  4FVM A;  3P1G A;  4CHO A;  2XO7 A;  4BE1 A;  1NK8 A;  4CCH A;  4OGE A;  1CZB A;  4DTP A;  4M45 A;  1SL0 A;  4CEO A;  4FZZ A;  4F4K A;  4J2B A;  4KHS A;  4M3Z A;  1A5X A;  1ZBH A;  1ITG A;  1T05 A;  5J2Q A;  4CJR A;  4BWJ A;  1ASU A;  3NH0 A;  2G8U A;  5C42 A;  5I3U A;  4FLT A;  2IAJ A;  3RWU A;  3RMB A;  3SI6 A;  2OA8 A;  4DSL A;  1KFS A;  4FJH A;  4Z4E A;  3V9S A;  3EY1 A;  4GVM A;  1FKP A;  1CXU A;  4MQ3 A;  3OYB A;  3I8D A;  1HYS A;  4PUO A;  4F3O A;  2HNY A;  1L5U A;  3NCI A;  3SUP A;  2OZS A;  1N5Y A;  4C8L A;  1WSJ A;  1ZBF A;  3OJS A;  1NK9 A;  2HW3 A;  4KTQ A;  3T3F A;  3OYK A;  1WSI A;  4I2P A;  1NJY A;  3VQ7 A;  2OPR A;  4CFB A;  2IC3 A;  3K57 A;  3VA0 A;  2ZE2 A;  1NK4 A;  4DSJ A;  4CJQ A;  2E6M A;  3HYF A;  3DMJ A;  4CGI A;  3LPU A;  4HHT A;  1S6Q A;  1TKT A;  4F2S A;  3OYN A;  2G8K A;  1LWC A;  2YNF A;  3G10 A;  1S9G A;  2XHB A;  1VRT A;  3O3G A;  1HQU A;  1RDA A;  4CJT A;  3AVK A;  4CJS A;  3TAE A;  3HST B;  3RR7 A;  4IDK A;  1RDC A;  3C94 A;  4QAG A;  3ASM A;  3LP0 A;  3D45 A;  1VSI A;  1FK9 A;  2EHG A;  2W42 A;  1D8Y A;  1BI4 B;  1C0M A;  2Z1G A;  3F73 A;  4RW7 A;  3L2U A;  2KQ2 A;  4W5Q A;  1BQM A;  4CJU A;  4AHU A;  4CE9 A;  3QEV A;  3NHG A;  4Q5V A;  1VSJ A;  3PX4 A;  2HHV A;  3T1A A;  1TK5 A;  1RT1 A;  5HRN A;  1J9A A;  1ASW A;  3OYH A;  3THV A;  1W9H A;  3TWH A;  1HRH A;  3AVA A;  5HBM A;  2X6S A;  4CEA A;  5KRS A;  3SUQ A;  2O4I A;  1NJW A;  4FW1 A;  4L8R B;  3AA2 A;  4XIU A;  1IO2 A;  3AO2 A;  1HNV A;  4AHT A;  1HYV A;  3NF9 A;  3DRR A;  3DOK A;  3PO5 A;  1TKX A;  3PX0 A;  4JRP A;  3VQ6 A;  4HUG A;  3ZSZ A;  1QE1 A;  3I0R A;  4KHU A;  3AVL A;  1WLJ A;  1S1W A;  2F8S A; 
#chains in the Genus database with same CATH topology
 1EQY A;  1JLC A;  3A0I X;  2P9K A;  4JI3 K;  3CET A;  3THW A;  1SV5 A;  3SK3 A;  3SPZ A;  3BF3 A;  4BDP A;  3ZSX A;  1U4B A;  1HNX K;  3N4P A;  4FWN A;  3AAP A;  4E1J A;  1XNR K;  4CJV A;  1G15 A;  3L2V A;  3EKS A;  3NF6 A;  1REV A;  1BGX T;  4HUF A;  3CQX A;  5J1E A;  4NB4 A;  4ELT A;  4NCA A;  4B1W B;  4PL8 A;  3J81 O;  5AQH A;  5AQM A;  3G4S N;  4YHH K;  2UXD K;  4GV6 A;  2P1J A;  1HUX A;  3MEC A;  1EX4 A;  3OA9 A;  4JN4 A;  4DMN A;  3U8X A;  3OTO K;  5BRF A;  1KRP A;  4LSN A;  4AM6 A;  1RTH A;  4JI4 K;  4CGG A;  2WOM A;  1HQE A;  4GV9 A;  2O8C A;  1R59 O;  3HL8 A;  3K58 A;  3KK3 A;  5ADX A;  3SPY A;  3CQY A;  4OKK A;  1S1T A;  1CZA N;  4EIA A;  4H0V B;  3PUF A;  2VCP A;  4H5N A;  4JD2 B;  1RT3 A;  2YNI A;  1GOC A;  1X1P A;  3QEW A;  3CME N;  1JCG A;  4FK2 A;  2OPQ A;  2QWO A;  1QSS A;  3HPO A;  3CFP A;  3WT0 A;  3KKS A;  3OYC A;  1VSF A;  4JK9 A;  4CEQ A;  3TAQ A;  3DXK B;  1XMQ K;  1NGD A;  3N4Q A;  5E84 A;  5BN8 A;  2PZS A;  3MDQ A;  4FWP A;  1WSE A;  4B8C A;  1T6C A;  3WEE B;  3VEZ A;  4IFE A;  2BAN A;  1IG9 A;  4KAZ A;  1RBT A;  3OYG A;  4UY8 O;  1QQM A;  3M8P A;  4DU3 A;  4JKF A;  2PAV A;  1NGJ A;  2BDP A;  1NBW A;  4BRQ A;  2YHY A;  4H5T A;  2HBJ A;  1YVN A;  1YUW A;  2WUS A;  4ILG B;  3VGK A;  4BWM A;  3GBT A;  4PKI A;  4E7J A;  4JHD A;  1RT5 A;  3CHW A;  2HST A;  2NUB A;  5EXW A;  1C1B A;  1QZ6 A;  1VSD A;  4BRC A;  1NK5 A;  2FBX A;  1ESV A;  4BRD A;  2P9K B;  4HCB A;  4AHS A;  5C24 A;  4F8R A;  3FE1 A;  2YKN A;  3THW B;  1KVA A;  4EZ9 A;  5AQQ A;  1RTI A;  1BIS A;  1XWL A;  4NXN K;  1SZ2 A;  4W5T A;  1YIT N;  1X9M A;  3ENB A;  2CGL A;  1ATS A;  3V9U A;  4KHN A;  1LW0 A;  3MXI A;  5HOO A;  4EAH D;  3KTQ A;  1QSL A;  2NNW A;  4LF4 K;  3W0L A;  3WXJ A;  3NVM A;  4B9Q A;  1XI1 A;  4ISE A;  4JKH A;  4OVL A;  4DFP A;  4W5R A;  4WQ4 A;  3ZSW A;  3KLH A;  5AR0 A;  2O8C B;  5CR4 A;  4LF7 K;  4FJK A;  1YTA A;  3P83 D;  4JV5 K;  3OS2 A;  4BR0 A;  1YXQ A;  3IS9 A;  4GMJ B;  4FJJ A;  4F3T A;  4IWV A;  4M42 A;  4CEC A;  3VOV A;  4JAX A;  5T7B A;  2YHA A;  1GLB G;  3AVC A;  5DK5 A;  3KLI A;  3R1X A;  2FC0 A;  4BC2 A;  1NOY A;  2NZT A;  2D1K A;  3PSI A;  2NRR A;  4YOY A;  1EP4 A;  4BDZ A;  1NKB A;  4E0D A;  1NK0 A;  4E19 A;  3LAK A;  1M1K O;  3PX6 A;  4NCB A;  1Q82 O;  3ATU A;  4H0O A;  3SBG A;  2GUP A;  3QIC A;  5DM7 L;  3AO1 A;  3ULD A;  2DFE A;  4LF5 K;  2Z1H A;  4BR5 A;  2FBV A;  1T8E A;  3AVH A;  1IG8 A;  2RKI A;  3AV9 A;  3LAN A;  4CD1 A;  4DLE A;  1BHL A;  1NGG A;  4DTO A;  4W5O A;  4BY9 C;  1SS6 A;  1WN7 A;  3V1O A;  3ZT0 A;  3NGZ A;  3J7A P;  4KRE A;  4DQP A;  4JI6 K;  5C2F A;  4DFM A;  5KRT A;  4B1U B;  2E2Q A;  2VWB A;  4JHD B;  1NNE A;  1M90 O;  4Z94 A;  4Y1D A;  3VMF B;  3MAQ A;  2P9U A;  1VQ8 N;  3NGY A;  4H4M A;  4OPH A;  3MCP A;  3NGI A;  1HPM A;  2YJE A;  4DU4 A;  2W41 A;  5AQL A;  3G25 A;  3IFR A;  1UOC A;  3TAR A;  4DR2 K;  5F2R A;  1IBL K;  5FLX O;  1LAV A;  4YOW A;  5CZ2 A;  4QOZ B;  1Y64 A;  3VEX A;  3ID8 A;  4MFB A;  1NG9 A;  1S72 N;  2E6L A;  5D3G A;  5SZT A;  3VET A;  1MU2 A;  3CYM A;  5KGW A;  1WAF A;  3H08 A;  4DV2 K;  3SQ4 A;  4ILJ A;  2FBT A;  2KFZ A;  4DCH A;  3HJF A;  2HHS A;  2IDO A;  1Q8I A;  1C0F A;  3FLC O;  1T03 A;  1VSL A;  3BZK A;  1HNZ K;  4EP4 A;  1MDU B;  3KZB A;  2Q0U A;  2UYT A;  4H0T B;  2UUA K;  1W0H A;  4J8F A;  3M8R A;  3S3N A;  4JKD A;  3FZF A;  4CZJ A;  1RNH A;  3CCJ N;  2KLA A;  4JK7 A;  4FJ5 A;  3HP9 A;  1H1V A;  4RTF D;  3SUO A;  3CJB A;  1N36 K;  4BDY A;  2OPS A;  4M7X A;  4C23 A;  1Q7Y O;  3V9W A;  3OYD A;  3BP8 A;  3DLG A;  3M8S A;  5J2N A;  1W97 L;  1T7P A;  2EX3 A;  4H5W A;  3IDH A;  1L3T A;  1VQL N;  1YJ9 N;  5AQJ A;  2O4G A;  3LDO A;  3QET A;  4ELU A;  4HTU A;  4GVE A;  4LH5 A;  3K2P A;  3CM6 A;  4CJ7 A;  3R6M A;  1BQN A;  4DFK A;  5BN9 A;  4CFC A;  1XNQ K;  2OPP A;  4M41 A;  4JKB A;  3K5L A;  3S3O A;  3OYA A;  1S3X A;  3WNH A;  3ZSO A;  3SV3 A;  4FLV A;  2I5J A;  3MED A;  1C6V A;  4RCH A;  5M1F A;  4DQI A;  1XHX A;  4OPA A;  5M1O A;  1BWF O;  2RPI A;  1NMN A;  3WQT A;  2P9U B;  4H8K A;  4BG9 A;  1KVB A;  4CJP A;  2B4J A;  4DTR A;  3KJV A;  2E4L A;  4K0K K;  4M3U A;  1LWF A;  1QSY A;  4ZHR A;  4ZTJ A;  3OBY A;  3ZX2 A;  2ETJ A;  3E9L A;  1JXE A;  3ZCM A;  3D0P A;  5J2M A;  4KO0 A;  1Q9Y A;  3MN6 A;  1Z25 A;  4E1M A;  2CGJ A;  1V4T A;  2F7T A;  4ISF A;  3T19 A;  3NAE A;  4CF2 A;  5BPM A;  5C25 A;  5A2Q O;  4FWR A;  5AQI A;  1TL1 A;  1C1A A;  1HKB A;  1S5J A;  2IGI A;  4CJK A;  3GE1 A;  1MA9 B;  3EO3 A;  4I7F A;  4F2R A;  4PA1 A;  1D9F A;  1DTT A;  1SL2 A;  4O44 A;  2NRT A;  4B9T A;  3RMC A;  4FVM A;  1CZB A;  4A2A A;  1N33 K;  4M45 A;  4YDU C;  3MK6 A;  1SQK A;  1A5X A;  4X62 K;  1T05 A;  4CJR A;  2G8U A;  3RWU A;  1GLD G;  4DR7 K;  5GAD P;  2HBK A;  1KC8 O;  3EY1 A;  3TSU A;  2ZJR L;  5TKW A;  3NCI A;  2OZS A;  1NK9 A;  2HW3 A;  4I2P A;  3UKU A;  2E6M A;  3F2K A;  1S6Q A;  1TKT A;  3OYN A;  3G10 A;  2XHB A;  3CER A;  3Q7C A;  3O3G A;  2E2P A;  4IDK A;  3C94 A;  4B1X B;  5AQZ A;  2YCH A;  2YHW A;  3LP0 A;  3UE5 A;  2EHG A;  3QFP A;  5BR8 K;  1D8Y A;  3HOT A;  3C6A A;  2BTF A;  5BRH A;  3F73 A;  3A8Y A;  3AGK A;  4W5Q A;  4AHU A;  1QVF M;  3VF6 A;  1VSJ A;  4M63 C;  3O9Q A;  1RT1 A;  3THV A;  3TWH A;  3C7N A;  3AVA A;  3GOI A;  5HBM A;  5KRS A;  4CEA A;  3FZL A;  3L4I A;  1NJW A;  3AA2 A;  2WTU A;  5I9E B;  2E88 A;  1HYV A;  3PO5 A;  5KPR A;  1E4F T;  3ZSZ A;  3I0R A;  1WLJ A;  4CBU A;  3TU5 A;  1ZYQ A;  1L3S A;  1JLG A;  1O13 A;  5GIP A;  1L3V A;  3MWP A;  4WQ5 C;  3O3H A;  1VQP N;  4OX9 K;  1TAU A;  4CEE A;  3CCL N;  3S3M A;  2KZZ A;  1EKE A;  5E41 A;  5CZ1 A;  2FF3 B;  3EZW A;  3LP1 A;  4FO0 A;  3L2W A;  4EFH A;  1K6Y A;  4K43 A;  2UU9 K;  3BDP A;  4O0I A;  4CHN A;  4DTU A;  4LH4 A;  3OYE A;  3OVN A;  2G8I A;  1CLQ A;  3L2Q A;  2A42 A;  3WNF A;  3HK2 A;  5FRO A;  3IRX A;  4DB3 A;  4FWQ A;  1U45 A;  5AQK A;  3CQ8 A;  4FK0 A;  2J4R A;  4CZM A;  3TR8 A;  2G8F A;  2HHQ A;  3RMA A;  2XY8 A;  4M3Y A;  3I33 A;  4CZI A;  3GL1 A;  3UKU B;  1ZBS A;  3KD5 E;  3VF2 A;  3EZ5 A;  4DR1 K;  2B6A A;  2R7Y A;  2GEL A;  2Q36 A;  1NK7 A;  3VQ5 A;  3RTV A;  3MN5 A;  5K14 A;  3MX5 A;  3HT3 A;  3SJH A;  4DTM A;  3O08 A;  1U47 A;  1U49 A;  4H0X B;  2IIR A;  2IVO A;  2UUC K;  1BDG A;  1IKW A;  3C0B A;  4DSK A;  4AHR A;  4DWI A;  4A62 A;  4FJ7 A;  3E9O A;  3OYL A;  2Q3S A;  1FW6 A;  1NJI O;  5I42 A;  5JLF A;  3C7N B;  5JIC A;  4JK8 A;  1RT2 A;  4CEZ A;  4B9M A;  2WC9 A;  3HPH A;  5CYM A;  3DLR A;  2AJQ A;  4Q0B A;  1NGB A;  1YHQ N;  1VQK N;  3QDK A;  4FK4 A;  1RT7 A;  4LF6 K;  1RCH A;  2DTU A;  1N32 K;  3C95 A;  1UA0 A;  1Z26 A;  5LL6 Z;  3U6F A;  5F1X A;  5LJW A;  3P5J A;  4N41 A;  1NGF A;  1JLE A;  3ZSY A;  4KHP K;  3IKM A;  1C1C A;  4E3S A;  4IO8 A;  3O1W A;  3SAG A;  4RWT A;  1SKS A;  3SQ2 A;  1RBS A;  1UWB A;  3MXM A;  1W2B M;  2O8F A;  4FM0 A;  4I9L A;  3T1H K;  2O8E A;  5BRE A;  5BPN A;  3LDS A;  3U3G A;  3MXJ A;  2HMI A;  4JI1 K;  1CXQ A;  2LSN A;  1GLL O;  3TAF A;  3VQE A;  2YV0 X;  1TKD A;  3DLH A;  1IKV A;  4MLH A;  5C10 A;  4HTL A;  4JRQ A;  1T44 A;  3CM5 A;  4B9N A;  4BRP A;  3ITH A;  4FLU A;  3IG1 A;  2D0O A;  1VSM A;  2HHU A;  3DYA A;  2RF2 A;  4BRF A;  3DRP A;  1JLF A;  4DR6 K;  1EWQ A;  1RBU A;  1VAZ A;  3T1Y K;  3LDL A;  1CZ9 A;  3CPW M;  3O9T A;  2OTL N;  1ATN A;  2FSN A;  3SZ2 A;  2Q31 A;  4FJN A;  4BQL A;  4YDU A;  1HKC A;  5AQT A;  1XMO K;  1HR0 K;  3B6P A;  4IEE A;  5FRN A;  1OKJ A;  3TAN A;  5AQS A;  2GEM A;  3L0Q A;  4XH5 A;  4DS4 A;  3P31 A;  3PV8 A;  3L2R A;  3M1F A;  4BRE A;  4QS8 A;  5JLH A;  1VQ5 N;  2HVI A;  4LC9 B;  4JS5 A;  2DFH A;  4DQ8 A;  4MO5 A;  4CHQ A;  3KLG A;  4CF0 A;  4E7L A;  4M3T A;  3VQC A;  3QBX A;  2OTJ N;  3AVB A;  1WNS A;  1NGC A;  4XEI A;  4FWM A;  5GAE P;  2ASM A;  3GDQ A;  3KWI A;  4CBW A;  2KW4 A;  5AQR A;  4RW6 A;  3THX A;  1LWE A;  3QML A;  1UAX A;  3CC7 N;  2ZGZ A;  1GLA G;  4NXM K;  1QVG M;  4DTN A;  3C6T A;  5AQV A;  3M6G A;  4Z4C A;  3CG7 A;  3JS6 A;  5M1Q A;  3F5T A;  2XY7 A;  2O8F B;  4CJ3 A;  1X3N A;  3V4I A;  1VQ4 N;  1HNW K;  3T7Z A;  1VHX A;  2O8E B;  2X6N A;  1RT4 A;  1BG3 A;  4CI6 A;  5GIO A;  2ZGY A;  3VGL A;  5KQD A;  2ITG A;  3HRG A;  1WAJ A;  4WE1 A;  1VQ6 N;  5DM6 L;  4KB1 A;  5JMV A;  1F21 A;  1N34 K;  3CMA N;  1LV5 A;  4A57 A;  2XY5 A;  1BL3 A;  1JJ2 M;  4HVJ A;  4E7K A;  2P9S A;  4LY7 A;  1P90 A;  2BGG A;  4NLB A;  4ILH A;  2YI1 A;  3QLH A;  4JKC A;  1TKZ A;  4WQ5 A;  4DV0 K;  4MO4 A;  2GTD A;  1NU0 A;  4FLX A;  2QKB A;  4KRF A;  2QXF A;  2V52 B;  2A3Z A;  2CH6 A;  2CH5 A;  3GG4 A;  2YX6 A;  3DM2 A;  4AHC A;  3TAM A;  1J5O A;  3G6E N;  1WB9 A;  3OYM A;  4R79 A;  1G99 A;  4IG0 A;  4IDH A;  3VER A;  4Y1C A;  5GAG P;  4BE2 A;  2DY4 A;  2P51 A;  4X65 K;  1RTJ A;  3LZJ A;  1E3M A;  3TSP A;  3RMD A;  3CCR N;  4ID5 A;  4O55 A;  3VEO A;  1I39 A;  4CK3 A;  4U7B A;  4HCC A;  1BI4 A;  4IJN A;  1TGO A;  1KD1 O;  4OLB A;  2G8V A;  3P39 A;  5HLF A;  3EL2 A;  3K9J A;  1JLA A;  4FPB A;  3A5L C;  2HMP A;  5CE3 A;  3QEX A;  1VSE A;  4V19 S;  3THX B;  4CD3 A;  4OLA A;  4EZ6 A;  3C6U A;  3D6R A;  3OYI A;  1X9W A;  3MN9 A;  5CY4 A;  4O8K A;  2A1S A;  1HPZ A;  1WUA A;  4ICL A;  4BC3 A;  4DFJ A;  2O8D A;  2VQE K;  3U9D A;  4DSE A;  2EWS A;  4CVN E;  2ASP A;  4K42 A;  1WSF A;  2HHH K;  2P9N A;  1NMD A;  1K73 O;  3CCS N;  1NKE A;  2HBL A;  5C15 A;  4CES A;  3QER A;  3LAM A;  3SLC A;  1EXQ A;  1HLU A;  3G0Z A;  2BUP A;  3H46 O;  4CGD A;  1K9M O;  1C0U A;  1BIZ A;  4EHT A;  2P9S B;  1DLO A;  4JLH A;  4CCH A;  1NK8 A;  1XQS C;  4QS7 A;  4DTP A;  4BRA A;  3THY A;  4GKK K;  1ITG A;  5J2Q A;  3FZK A;  3NH0 A;  3CCM N;  3CC2 N;  3CCU N;  2FXU A;  2A6A A;  3V9S A;  2RHK A;  4FVU A;  1FKP A;  1CXU A;  3OYB A;  1HYS A;  4PUO A;  4WYB A;  3ZYY X;  1N5Y A;  1WSJ A;  1ZBF A;  4KTQ A;  3VQ7 A;  2OPR A;  2VGN A;  3VA0 A;  2ZE2 A;  4IEI A;  4CJQ A;  2NRH A;  4F9O A;  2YNF A;  3ULE A;  1VRT A;  5FPE A;  1OVY A;  1RDA A;  3BF1 A;  3CI5 A;  4CJT A;  1NGI A;  3CJA A;  3HST B;  1GLF O;  4BC4 A;  1BI4 B;  1VQ7 N;  4RW7 A;  3L2U A;  5IWA K;  4WFN L;  2FF6 A;  4PL7 A;  4CBX A;  4DHY A;  4Q5V A;  5LMU K;  2HHV A;  3T1A A;  1TK5 A;  5KPT A;  1ASW A;  2O4I A;  4A5B A;  3WXI A;  3AAR A;  4FW1 A;  4L8R B;  4BVP A;  3P38 A;  1HNV A;  2O8D B;  4G9Z A;  1TKX A;  2Q0R A;  3PX0 A;  1VQM N;  3O9R A;  3FFK B;  2P9L A;  2IVP A;  3AVL A;  2F8S A;  1JKH A;  2P9N B;  3MWT A;  4CER A;  4KH5 A;  3NH1 A;  1NJZ A;  3O4W A;  4BE0 A;  4BGA A;  1NJX A;  2XRI A;  3OY9 A;  1S1X A;  4ZTF A;  3WXK A;  2ZQB A;  2YNH A;  3E01 A;  3VES A;  2FSK A;  3LM9 A;  3OHR A;  3JAM O;  4Z0U A;  4PY5 A;  4H03 B;  4AQY K;  3IAY A;  5FPM A;  4FSV A;  3M8Q A;  4JEP A;  3KK1 A;  4LD0 A;  4YFU A;  2WBN A;  3THY B;  3I8B A;  3UIQ A;  3LWL A;  3AO3 A;  1DTQ A;  1QHA A;  3TI0 A;  4DU1 A;  1A5W A;  3O4Q A;  3S41 A;  1YVU A;  4KH6 A;  4FJ8 A;  1Z6R A;  4YOV A;  2HVH A;  1OVQ A;  2Y1J A;  5SWM A;  4CJ4 A;  4I9Q A;  3AA5 X;  1JL1 A;  3KK2 A;  5KTQ A;  5JVG L;  2B5J A;  3A5O C;  3SAH A;  1GOA A;  3TAG A;  3AAQ A;  3CD6 N;  3DRS A;  4IZ9 A;  4DQQ A;  2GWK A;  4H0Y B;  4CZF A;  3HVR A;  4KV8 A;  1LW2 A;  1HMV A;  4FJX A;  3L6Q A;  3ULE B;  1NKC A;  3MX2 A;  3OYJ A;  4DLG A;  3SUN A;  3J7Z O;  2HHT A;  4NYF A;  3SQ0 A;  1NWK A;  1A5V A;  1R0A A;  3DLB A;  3I55 N;  3V81 A;  1TUY A;  3H3N O;  4JS4 A;  3DAW A;  4H5R A;  4IFV A;  3L3V A;  1IBK K;  3KD1 E;  1NM1 A;  3ZT4 A;  3EKU A;  2GUI A;  2IOC A;  3L4Q A;  3CXC M;  5KQ8 A;  1Q18 A;  2P9L B;  1J53 A;  5AFU H;  1J54 A;  3E9P A;  3AVG A;  2ITM A;  1TK8 A;  2ZJQ L;  3LP3 A;  4FLY A;  2HHX A;  1HJR A;  2QWL A;  2AP1 A;  2OZM A;  3DLK A;  3ISN C;  3A5M C;  4BRK A;  3VEN A;  4O8U A;  4B9S A;  3DI6 A;  2P9P A;  4JI8 K;  3HVT A;  1QS4 A;  3RSE A;  3CJ7 A;  1JCF A;  3CJC A;  3O80 A;  4FJ9 A;  2YKM A;  1EET A;  1TAQ A;  5LY3 A;  3W3D A;  2Z1J A;  3VEY A;  4K41 A;  3SCX A;  3BGR A;  3O3F A;  3SYZ A;  1XUP O;  4CZG A;  3K5N A;  4KHY A;  3LP2 A;  4O0J A;  1LOT B;  1I3A A;  1KCF A;  2V7Y A;  4CFA A;  1NK6 A;  1W7A A;  2Q1N A;  4BG8 A;  1HJO A;  1OH5 A;  1LCU A;  2VWJ A;  1IJJ A;  1SKR A;  3B8A X;  4NCG A;  3SAF A;  4RW4 A;  2QA4 N;  4FM2 A;  3K5O A;  1GLJ O;  3HP6 A;  5HRR A;  3AA3 A;  3S9H A;  4BR9 A;  4LFC K;  2P9I A;  3TAB A;  2PBD A;  3EYZ A;  3WXM B;  4CEB A;  4E7I A;  2JWL A;  1E4G T;  2HBM A;  1NGH A;  4I6M A;  1NGE A;  4CJE A;  3NH2 A;  5TKY A;  2HOE A;  4CJL A;  4I2Q A;  2QWN A;  3HM8 A;  4GY2 B;  4CFD A;  4QS9 A;  2Y1I A;  1XC3 A;  2G8W A;  4X66 K;  2DPN A;  1N6Q A;  1VQN N;  1XC9 A;  1V4S A;  2VYP A;  4B9L A;  1KTQ A;  4KHW A;  2HF3 A;  5FDL A;  4MDB A;  3QFU A;  3V9Z A;  3SMP A;  2VGM A;  5AZJ A;  3FGU A;  2E8A A;  1VRU A;  2D4W A;  3LDN A;  2RN2 A;  3OJU A;  4A61 A;  3VA3 A;  4CF1 A;  4FOI A;  3CFO A;  2GBZ A;  3R8E A;  4DSI A;  1JLQ A;  4DG1 A;  4WQ4 C;  3MEE A;  1YAG A;  1IH7 A;  4Y0W A;  1P8Z A;  4RW8 A;  4DR4 K;  4DR5 K;  3QES A;  3M3Z A;  4U67 L;  3ZSQ A;  4BRO A;  4IFY A;  3V6D A;  3SBT A;  5AFU A;  1MWK A;  5BPL A;  3O9S A;  1J6Z A;  4LF9 K;  3DJC A;  2G8H A;  3HPG A;  1KXP A;  2D0P A;  1U04 A;  1S9E A;  4NLC A;  2ZJP L;  2I7P A;  3ZT3 A;  4CHZ A;  2E2N A;  2P9P B;  3VGM A;  4OPK A;  2QKK A;  5MLC Q;  2E1Z A;  3RSE B;  1DT9 A;  1TV6 A;  3I56 N;  1KAY A;  3NBP A;  3DLL L;  2GWJ A;  3OYF A;  3L8B A;  2F8T A;  2QWM A;  1EWR A;  2ZD1 A;  4CGH A;  1S22 A;  3VQA A;  2KTQ A;  4IXC A;  1I94 K;  4OKJ A;  1Z05 A;  4PQU A;  1HNI A;  3AGR A;  1OH6 A;  4YOR A;  3DLE A;  3LWM A;  4J2D A;  4B8A B;  4IOC L;  1VSH A;  4WFB L;  4IBN A;  2AA4 A;  3U3Y A;  1D5A A;  3OBW A;  3CJ1 A;  1RDB A;  3NFA A;  5AQW A;  4CGJ A;  2QM1 A;  3JSM A;  3PY8 A;  3F9K A;  4RG8 A;  2ZM6 K;  3QNN A;  1KLM A;  1NLV A;  1IV0 A;  4GV3 A;  5JS2 A;  4J2A A;  3HXM A;  3O8M A;  1YI2 N;  2E2O A;  1RT6 A;  4W5N A;  1D4X A;  1K8K A;  3HTV A;  3VEV A;  4I6M B;  4TSX A;  3BUZ B;  1NOZ A;  2IS3 A;  3UKR A;  1WBD A;  3DXM A;  3MMV A;  4B08 A;  4IOX A;  2A5X A;  4JI7 K;  3B6O A;  2YJF A;  2HNZ A;  2QEX N;  2ZWH A;  4FWO A;  5M1K A;  3EE9 A;  4DUY K;  4O4G A;  4JI0 K;  5AZJ B;  3K5M A;  4CK2 A;  3E66 A;  3HSC A;  4ID1 A;  4DV3 K;  3SQ1 A;  3O4N A;  3D7E O;  3K9K A;  4C1N K;  4N56 A;  4MDA A;  2FBY A;  4A5A A;  3CJ9 A;  5BRD A;  3VQQ A;  2IVN A;  1BOT O;  2NLX A;  1Y97 A;  4OO1 J;  1RFQ A;  3L3U A;  1DEJ A;  3NE6 A;  5JVH L;  5EX5 A;  3SJJ A;  2E20 A;  4CEF A;  5C2D A;  4FJG A;  5HL7 L;  3HZ6 A;  5LJV A;  1TYQ A;  4G1Q A;  2A1R A;  2GX9 A;  4FOE A;  4ELV A;  1YT3 A;  4CW7 B;  4FWL A;  3HM9 A;  3D2F A;  3VQP A;  2VQF K;  1TUU A;  4XH1 A;  4RW9 A;  4BAC A;  2D0A A;  4B9U A;  3ENO A;  4BR7 A;  4BRI A;  3ZET A;  3V9X A;  3QBW A;  2HB5 A;  3LAL A;  1KQS M;  1U48 A;  4L3Q A;  3KHY A;  1BIU A;  3KWG A;  4K8Z A;  3ZX3 A;  1ZBI A;  2GV9 A;  3OS0 A;  4CF9 A;  3TTD A;  3WUH A;  4UQG A;  3EN9 A;  3QO9 A;  3VQ8 A;  2VWK A;  2Z1I A;  3O6W A;  4OJR A;  1KSP A;  2VG5 A;  2XO7 A;  4OGE A;  4FZZ A;  3CIP A;  4J2B A;  2NRW A;  5LMN K;  1ZBH A;  2UXB K;  1SAZ A;  4BWJ A;  1ASU A;  1K8K B;  5C42 A;  4GKJ K;  5IT9 O;  3UKR B;  1KFS A;  1GLE G;  3DXM B;  4FJH A;  4Z4E A;  4GVM A;  4F3O A;  3MN7 A;  3H3O B;  3OW2 M;  4X64 K;  1L5U A;  1Q86 O;  3ZLJ A;  5GIN A;  3SUP A;  3ID6 A;  4C8L A;  5BR9 A;  3T3F A;  3SMS A;  5EVZ A;  1NJY A;  4CFB A;  2IC3 A;  1ATR A;  5M1N A;  3HYF A;  4CGI A;  3LPU A;  4KH4 A;  4WCE L;  2NRZ A;  5C0Y A;  1LWC A;  2FLO A;  4BC5 A;  4BR2 A;  1MWM A;  1RDC A;  3D45 A;  2W42 A;  4B1V A;  3U4L A;  4CZE A;  3PIO L;  1BQM A;  4CE9 A;  3QEV A;  2F4V K;  3NHG A;  3TPQ A;  1TYQ B;  5HRN A;  4MLE A;  1J9A A;  1QZ5 A;  2KKZ A;  1HRH A;  3SUQ A;  4BRL A;  3FZM A;  3D2F B;  3DRR A;  4YOX A;  3P4I A;  3VQ6 A;  4IJA A;  3ZET B;  1QE1 A;  4KHU A;  3CF5 L;  3FZH A;  4CF8 A;  4A2B A;  2PY5 A;  4KTZ A;  2KZM A;  5HRS A;  4CJF A;  4EP5 A;  3TAP A;  4DF8 A;  3U9Z A;  2YNG A;  5KGX A;  4WF9 L;  2OCE A;  3AY9 A;  4HWI A;  4YOT A;  2RE2 A;  1JL2 A;  2XY6 A;  2QK9 A;  4Z4G A;  4B3T K;  3EE8 A;  3AO5 A;  4YNQ A;  1BO5 O;  4DS5 A;  3RVC A;  4GNI A;  4B3R K;  2YHX A;  1SL1 A;  1KAZ A;  1O1W A;  5FPN A;  3G71 N;  3BY5 A;  4ISG A;  3VTH A;  4JKA A;  1NGA A;  1IKX A;  3NF7 A;  5AQX A;  3CCQ N;  2I7N A;  3UB5 A;  1QTM A;  1XHZ A;  3MEG A;  3VTI A;  1YJN N;  3CPE A;  4DTX A;  1IBM K;  4OKE A;  4JKG A;  4PKH A;  4IG3 A;  1KVC A;  3K0S A;  5J2P A;  4DTJ A;  2QTD A;  3JXU A;  2Q2R A;  4N47 A;  3I0S A;  4E89 A;  3ZSV A;  1S6P A;  2NRX A;  3WQU A;  3ZEU A;  3C65 A;  3O1B A;  3LL3 A;  5B8H A;  3AO4 A;  4JI2 K;  3VEW A;  2X78 A;  3ALY A;  1ASV A;  2HHW A;  4CZK A;  4FL9 A;  1JXB A;  1B92 A;  1FKO A;  4N76 A;  3LDP A;  3SNN A;  1DGK N;  1TVR A;  4LFA K;  5AZI A;  4BQZ A;  3VQ4 A;  1KAX A;  4FZX C;  1S1U A;  2F9T A;  2D0B A;  3CCV N;  4CZL A;  1FJG K;  3LM2 A;  4FJI A;  4Z4F A;  2A40 A;  1ZBL A;  1FXX A;  2UUB K;  4KI6 A;  1RBR A;  2JLE A;  3LPT A;  2E5L K;  1BUP A;  4AH9 A;  3LZI A;  4B1Z A;  4E1N A;  1KLN A;  3PIP L;  3VQD A;  4IO9 L;  4FPA A;  4K8X A;  2A41 A;  4B1Y B;  1C0G A;  1JLB A;  4CIE A;  1HYZ A;  2BE2 A;  4OPJ A;  1L3U A;  1RDD A;  2OYQ A;  4M3R A;  4C8N A;  4DQR A;  1ZXO A;  4PWD A;  4AM7 A;  4O5F A;  1VQO N;  1N8R O;  4YY3 K;  3WNE A;  3PSF A;  4FYD A;  1X9S A;  4DSF A;  4K25 A;  2E1Y A;  1EO1 A;  4BGB A;  1DKG D;  3ZX0 A;  2BH1 A;  4IKF A;  1QHT A;  2O8B A;  1GOB A;  1QQC A;  1ZBU A;  2ASO A;  4KBO A;  4C8M A;  2HND A;  4JKG B;  4FM1 A;  4B9V A;  3CCE N;  1BA1 A;  3VQ9 A;  1T6D A;  4DR3 K;  2KFN A;  1SKW A;  3QIP A;  1IKY A;  1VSK A;  2QXL A;  3AVM A;  4NO7 A;  4OGC A;  1BA0 A;  3ZEU B;  3RR8 A;  5GAH P;  4Z4I A;  4EHU A;  4M3W A;  3AVJ A;  3KKR A;  5E26 A;  4CIG A;  3TTF A;  5CHI A;  5FPD A;  1ZC6 A;  3H1Q A;  5EOY A;  4HUE A;  3BZC A;  5AQY A;  2X74 A;  4JI5 K;  3CC4 N;  1Q9X A;  1RTD A;  3MCA B;  4CHY A;  4PHT X;  3AVI A;  3HI0 A;  4FLZ A;  2PYL A;  2QW9 A;  3NDK A;  1LAW A;  4DV7 K;  5HP1 A;  1YJW N;  3DWL A;  5AZI B;  1YTU A;  1TL3 A;  3NF8 A;  4YOU A;  1RDW X;  4BR4 A;  3ZT1 A;  1OH8 A;  3QEI A;  3V1R A;  5AQP A;  2KHO A;  2V51 B;  4KHQ A;  4DKW A;  1C0T A;  4DQS A;  5HRP A;  4JYA K;  3NVK A;  3V1Q A;  3QB0 A;  1RIL A;  4JNE A;  3D2E A;  1K8A O;  4KB0 A;  4CJW A;  5KI6 A;  2W6L A;  5AQN A;  3DOL A;  3HOS A;  4AHV A;  3R9P A;  3AA4 A;  1KFD A;  4QCL A;  2D0C A;  3K59 A;  4C8K A;  4FW2 A;  2P5O A;  2F96 A;  4FZY A;  2JWK A;  4AF1 A;  5AJ3 K;  3KIO A;  4M3X A;  3KLE A;  3QNO A;  2ATQ A;  5M1P A;  4AIL C;  3O9U A;  1WSG A;  4E7H A;  3BEX A;  3ATV A;  1WBB A;  4GW6 A;  4FCY A;  4LSL A;  1RDU A;  3FFI A;  2VG7 A;  4BRH A;  1SUQ A;  1U2V A;  5HRO A;  1Q81 O;  5FRM A;  3QIN A;  1JCE A;  2O8B B;  3EEQ A;  5DMR A;  2UXC K;  4B3S K;  4LF8 K;  4CED A;  3HBT A;  2QWR A;  3FR0 A;  3A2F A;  3KLF A;  4DV5 K;  1UA1 A;  4Z4H A;  4H4O A;  1D9D A;  4CJ5 A;  3TTC A;  4CGF A;  1ILY A;  4J2E A;  4KKO A;  3VQB A;  2ZF5 O;  3RRG A;  4N5S A;  2D5R A;  4NYN A;  3PO4 A;  4FJL A;  4C1N I;  3O5B A;  1YIJ N;  4CZH A;  1WOQ A;  4FXD A;  4LFB K;  1BCO A;  4KFB A;  3SV4 A;  4KPY A;  5ELZ A;  3ENH A;  2W40 A;  4FJM A;  1B9F A;  1BCM A;  3OS1 A;  4KI4 A;  4DTS A;  4B3O A;  3R3L A;  1RGI A;  4FLW A;  3TSQ A;  4H0P A;  4M7Y A;  3JYT A;  4CK1 A;  2W6K A;  1WSH A;  4C8O A;  3KK7 A;  3F9M A;  2YHB A;  3KVG A;  1VQ9 N;  5EY4 A;  4PKG A;  3VN5 A;  1B9D A;  3E1Y A;  3J8A A;  1S1V A;  1RBV A;  3LDQ A;  3ZSR A;  5C12 A;  1HX1 A;  2P5G A;  3QEP A;  5EU7 A;  2VG6 A;  5H1S Q;  1QQN A;  4R5P A;  3WNG A;  3VF4 A;  1TK0 A;  2DFF A;  3AVF A;  2Q97 A;  3D2E B;  3C6H A;  2JGU A;  4O5B A;  4CHP A;  3T69 A;  1GLC G;  1X3M A;  4CIF A;  4KTW A;  3J7Y P;  4IOA L;  1VK0 A;  5CYQ A;  2WON A;  5JS1 A;  4B3M K;  5AQG A;  1HKG A;  2PYJ A;  4DV1 K;  3IUC A;  2H3G X;  3ZT2 A;  2NRV A;  3AVN A;  3HO1 A;  4BRM A;  4DF4 A;  4JKE A;  2PFU A;  5AQO A;  3RRH A;  3CFR A;  3QIO A;  4BE1 A;  3P1G A;  4CHO A;  1U2V B;  2CGK A;  1SL0 A;  4CEO A;  4F4K A;  4KHS A;  4M3Z A;  4FWS A;  1BU6 O;  4XH4 A;  5I3U A;  4DV6 K;  4FLT A;  2IAJ A;  2WFB A;  3RMB A;  3SI6 A;  1J5E K;  2OA8 A;  4DSL A;  5AQU A;  4MQ3 A;  3I8D A;  4DUZ K;  3H45 C;  2HNY A;  5ADX H;  4A59 A;  4BVO A;  1OH7 A;  3OJS A;  4JD2 A;  2QWP A;  4WFA L;  3OYK A;  1WSI A;  1X9J A;  5KPZ A;  3K57 A;  1NK4 A;  4DSJ A;  4BRN A;  3DMJ A;  4HHT A;  1T3V A;  5AQF A;  4F2S A;  3M5R A;  2G8K A;  3NMU A;  1S9G A;  1U6Z A;  4BRG A;  1HQU A;  2P9I B;  3IMX A;  3AVK A;  4CJS A;  2QI2 A;  3H6E A;  3TAE A;  3RR7 A;  4QAG A;  3DXK A;  2HF4 A;  3A5N C;  3ASM A;  1VSI A;  1FK9 A;  4H5V A;  1C0M A;  2Z1G A;  3J80 O;  2F9W A;  2KQ2 A;  4CJU A;  3WEE A;  5F0X A;  3VPZ A;  1YF5 L;  2V7Z A;  3PX4 A;  2FSJ A;  3WXL A;  3OYH A;  1W9H A;  3H1V X;  3PLA A;  1QQO A;  2X6S A;  2QWQ A;  4XIU A;  1IO2 A;  3AO2 A;  2OAN A;  4AHT A;  3NF9 A;  4DV4 K;  3DOK A;  4JRP A;  3Q7B A;  4FWK A;  4HUG A;  1S1W A; 
#chains in the Genus database with same CATH homology
 4CF8 A;  2PY5 A;  1JKH A;  4KTZ A;  1JLC A;  4CER A;  1ZYQ A;  1L3S A;  1JLG A;  3NH1 A;  1NJZ A;  2KZM A;  1L3V A;  5HRS A;  4BE0 A;  4CJF A;  3O3H A;  4EP5 A;  3TAP A;  4DF8 A;  1TAU A;  1NJX A;  2XRI A;  2YNG A;  1SV5 A;  4CEE A;  5KGX A;  3OY9 A;  1S1X A;  3SPZ A;  4ZTF A;  3S3M A;  2KZZ A;  1EKE A;  5E41 A;  2ZQB A;  2YNH A;  5CZ1 A;  1JL2 A;  3E01 A;  3LP1 A;  2XY6 A;  2QK9 A;  4BDP A;  4Z4G A;  3L2W A;  3AO5 A;  4YNQ A;  3ZSX A;  4DS5 A;  1K6Y A;  4Z0U A;  1U4B A;  4PY5 A;  3BDP A;  3IAY A;  3M8Q A;  4O0I A;  4CJV A;  1SL1 A;  1G15 A;  3L2V A;  1O1W A;  4CHN A;  3NF6 A;  4LD0 A;  4LH4 A;  3KK1 A;  4DTU A;  1REV A;  4YFU A;  1BGX T;  4HUF A;  5J1E A;  3OYE A;  3UIQ A;  3LWL A;  3OVN A;  4ELT A;  4NCA A;  2G8I A;  3AO3 A;  1DTQ A;  1CLQ A;  3TI0 A;  4DU1 A;  3L2Q A;  3WNF A;  3HK2 A;  1A5W A;  5FRO A;  1IKX A;  3IRX A;  3O4Q A;  2P1J A;  3MEC A;  1EX4 A;  4DMN A;  3NF7 A;  1YVU A;  1KRP A;  4LSN A;  4FJ8 A;  4CGG A;  1RTH A;  1U45 A;  2HVH A;  2WOM A;  1QTM A;  3CQ8 A;  1HQE A;  1XHZ A;  2Y1J A;  4FK0 A;  5SWM A;  3MEG A;  3HL8 A;  3K58 A;  3KK3 A;  3SPY A;  4CJ4 A;  4OKK A;  1S1T A;  4I9Q A;  3AA5 X;  1JL1 A;  3TR8 A;  3KK2 A;  5KTQ A;  2G8F A;  2B5J A;  3PUF A;  2HHQ A;  1GOA A;  3RMA A;  4DTX A;  2XY8 A;  3TAG A;  4OKE A;  1RT3 A;  4M3Y A;  2YNI A;  3DRS A;  4DQQ A;  1GOC A;  1X1P A;  3QEW A;  4IG3 A;  1KVC A;  3HVR A;  3KD5 E;  5J2P A;  4FK2 A;  4KV8 A;  2OPQ A;  4DTJ A;  1LW2 A;  3EZ5 A;  4N47 A;  1QSS A;  1HMV A;  3HPO A;  2B6A A;  2R7Y A;  3I0S A;  3CFP A;  4FJX A;  4E89 A;  1NKC A;  1NK7 A;  3VQ5 A;  3RTV A;  3KKS A;  3ZSV A;  1S6P A;  3OYC A;  1VSF A;  5K14 A;  4CEQ A;  3OYJ A;  4DLG A;  3TAQ A;  3HT3 A;  3SUN A;  2HHT A;  4NYF A;  4DTM A;  3SQ0 A;  2PZS A;  1U47 A;  1WSE A;  1U49 A;  3AO4 A;  4B8C A;  2X78 A;  3ALY A;  4KAZ A;  1IG9 A;  1IKW A;  2BAN A;  1ASV A;  1A5V A;  1RBT A;  3OYG A;  1R0A A;  3DLB A;  2HHW A;  3V81 A;  3M8P A;  4DSK A;  4DU3 A;  4AHR A;  4JS4 A;  4DWI A;  4FJ7 A;  4IFV A;  3OYL A;  1JXB A;  2Q3S A;  3L3V A;  3KD1 E;  2BDP A;  5I42 A;  3ZT4 A;  1B92 A;  1FKO A;  4N76 A;  2GUI A;  2IOC A;  3SNN A;  1RT2 A;  4CEZ A;  4B9M A;  3HPH A;  5CYM A;  3DLR A;  2AJQ A;  1TVR A;  4Q0B A;  4BWM A;  3VQ4 A;  4FK4 A;  1RT7 A;  1J53 A;  4E7J A;  4FZX C;  1S1U A;  1RCH A;  1RT5 A;  2DTU A;  1J54 A;  2D0B A;  2NUB A;  3AVG A;  3C95 A;  1TK8 A;  1C1B A;  1VSD A;  1NK5 A;  1UA0 A;  2FBX A;  1Z26 A;  3LP3 A;  4FLY A;  3U6F A;  4FJI A;  4Z4F A;  2HHX A;  1HJR A;  1ZBL A;  4HCB A;  4AHS A;  1FXX A;  5C24 A;  4KI6 A;  3P5J A;  2OZM A;  4F8R A;  3DLK A;  3ISN C;  1RBR A;  2JLE A;  3LPT A;  4B9S A;  4N41 A;  3DI6 A;  2YKN A;  1JLE A;  3ZSY A;  1KVA A;  4AH9 A;  1C1C A;  4EZ9 A;  4E3S A;  1RTI A;  3HVT A;  1BIS A;  1QS4 A;  1XWL A;  3LZI A;  4E1N A;  1KLN A;  4W5T A;  1SKS A;  3VQD A;  3SQ2 A;  4FJ9 A;  1RBS A;  1X9M A;  1UWB A;  3MXM A;  4K8X A;  4FM0 A;  2YKM A;  1EET A;  1JLB A;  1TAQ A;  4I9L A;  2Z1J A;  4CIE A;  3SCX A;  1HYZ A;  2BE2 A;  3BGR A;  4OPJ A;  3O3F A;  1L3U A;  1RDD A;  2OYQ A;  3SYZ A;  3V9U A;  3K5N A;  1LW0 A;  4M3R A;  4KHN A;  4KHY A;  3LDS A;  4C8N A;  4DQR A;  3LP2 A;  3U3G A;  3MXI A;  4O0J A;  1QSL A;  3KTQ A;  4PWD A;  3MXJ A;  1I3A A;  1KCF A;  2HMI A;  4CFA A;  1CXQ A;  2LSN A;  1XI1 A;  1NK6 A;  3TAF A;  3VQE A;  3WNE A;  4FYD A;  1X9S A;  2YV0 X;  4OVL A;  1TKD A;  3DLH A;  4DFP A;  1IKV A;  4W5R A;  4DSF A;  2VWJ A;  4JRQ A;  1SKR A;  4EZ6 A;  3ZSW A;  3CM5 A;  3KLH A;  4NCG A;  4B9N A;  4IKF A;  3ITH A;  4RW4 A;  4FM2 A;  1QHT A;  3K5O A;  4FLU A;  1GOB A;  4FJK A;  3HP6 A;  1QQC A;  1YTA A;  3P83 D;  5HRR A;  3IG1 A;  1ZBU A;  3AA3 A;  3S9H A;  4C8M A;  2HND A;  3OS2 A;  4FM1 A;  1VSM A;  3IS9 A;  4GMJ B;  3DYA A;  4B9V A;  3TAB A;  3VQ9 A;  4FJJ A;  4F3T A;  2HHU A;  2RF2 A;  4CEC A;  4M42 A;  3EYZ A;  4CEB A;  3DRP A;  5T7B A;  1JLF A;  2YHA A;  4E7I A;  2KFN A;  3AVC A;  4CJE A;  1RBU A;  3KLI A;  3QIP A;  5DK5 A;  1SKW A;  3NH2 A;  4CJL A;  2FC0 A;  1CZ9 A;  4I2Q A;  1IKY A;  1VSK A;  1NOY A;  3AVM A;  4CFD A;  4OGC A;  3SZ2 A;  3RR8 A;  2Y1I A;  2G8W A;  4FJN A;  1N6Q A;  4Z4I A;  4M3W A;  1XC9 A;  1EP4 A;  3AVJ A;  4BDZ A;  3KKR A;  4CIG A;  1NKB A;  4B9L A;  4E0D A;  1KTQ A;  1NK0 A;  4KHW A;  5FDL A;  3LAK A;  4E19 A;  3V9Z A;  3B6P A;  3PX6 A;  4NCB A;  4HUE A;  5FRN A;  3TAN A;  2X74 A;  1VRU A;  1Q9X A;  4DS4 A;  2RN2 A;  1RTD A;  3PV8 A;  4CHY A;  3OJU A;  3L2R A;  3VA3 A;  3AO1 A;  4CF1 A;  2DFE A;  3ULD A;  2HVI A;  2Z1H A;  3CFO A;  2FBV A;  4JS5 A;  1T8E A;  3AVH A;  3AV9 A;  2RKI A;  3LAN A;  4DLE A;  2DFH A;  1BHL A;  4DTO A;  2GBZ A;  3AVI A;  4CHQ A;  4W5O A;  4FLZ A;  1JLQ A;  4DG1 A;  3KLG A;  4CF0 A;  2PYL A;  3MEE A;  1WN7 A;  3V1O A;  3NDK A;  1LAW A;  3ZT0 A;  4E7L A;  1IH7 A;  3VQC A;  3NGZ A;  4M3T A;  4KRE A;  4RW8 A;  4DQP A;  3QES A;  5HP1 A;  1YTU A;  3V6D A;  1TL3 A;  3ZSQ A;  3NF8 A;  4IFY A;  5KRT A;  4DFM A;  3ZT1 A;  3AVB A;  3V1R A;  3QEI A;  1WNS A;  2G8H A;  3HPG A;  4Y1D A;  4KHQ A;  3MAQ A;  2KW4 A;  1U04 A;  1S9E A;  4RW6 A;  3NGY A;  4H4M A;  1LWE A;  1C0T A;  1UAX A;  4DQS A;  5HRP A;  3NGI A;  4DU4 A;  3ZT3 A;  4CHZ A;  3V1Q A;  1UOC A;  4DTN A;  1RIL A;  3TAR A;  3C6T A;  4Z4C A;  4OPK A;  4CJW A;  2QKK A;  4KB0 A;  5KI6 A;  3CG7 A;  3DOL A;  1LAV A;  5CZ2 A;  4AHV A;  2XY7 A;  4QOZ B;  1TV6 A;  3AA4 A;  1KFD A;  4CJ3 A;  3V4I A;  4QCL A;  3NBP A;  3OYF A;  3L8B A;  2D0C A;  2X6N A;  4MFB A;  3K59 A;  2F8T A;  4C8K A;  1RT4 A;  4FW2 A;  2P5O A;  2F96 A;  2ZD1 A;  4CGH A;  3VQA A;  4FZY A;  2KTQ A;  2E6L A;  5D3G A;  5SZT A;  1MU2 A;  3CYM A;  4OKJ A;  5KGW A;  4PQU A;  2ITG A;  1HNI A;  1WAJ A;  3KIO A;  4WE1 A;  1WAF A;  3H08 A;  4M3X A;  3KLE A;  3QNO A;  4DSI A;  2ATQ A;  4KB1 A;  3SQ4 A;  2FBT A;  3DLE A;  1F21 A;  4AIL C;  3LWM A;  1WSG A;  4E7H A;  2XY5 A;  1BL3 A;  1LV5 A;  4B8A B;  4J2D A;  2KFZ A;  1VSH A;  3HJF A;  4HVJ A;  4IBN A;  2HHS A;  4E7K A;  2IDO A;  4LY7 A;  3U3Y A;  1D5A A;  1Q8I A;  4GW6 A;  4FCY A;  4LSL A;  1T03 A;  1VSL A;  1RDB A;  3FFI A;  3NFA A;  2BGG A;  2VG7 A;  4CGJ A;  3QLH A;  3PY8 A;  3JSM A;  4W5N A;  1SUQ A;  5HRO A;  3F9K A;  5FRM A;  3QIN A;  4RG8 A;  1TKZ A;  4EP4 A;  5DMR A;  3QNN A;  1KLM A;  4CED A;  5JS2 A;  4J2A A;  3HXM A;  3A2F A;  3KLF A;  4FLX A;  1RT6 A;  1W0H A;  4Z4H A;  3M8R A;  4H4O A;  3S3N A;  1UA1 A;  1D9D A;  2QKB A;  4CJ5 A;  1RNH A;  4CGF A;  4KRF A;  4FJ5 A;  3HP9 A;  4J2E A;  4KKO A;  3SUO A;  2QXF A;  4TSX A;  3VQB A;  2OPS A;  4BDY A;  1NOZ A;  2IS3 A;  3RRG A;  4N5S A;  3V9W A;  4B08 A;  2D5R A;  4NYN A;  3OYD A;  3B6O A;  3DM2 A;  3PO4 A;  4AHC A;  2HNZ A;  4FJL A;  3DLG A;  3TAM A;  3M8S A;  5J2N A;  1J5O A;  1T7P A;  4FXD A;  2EX3 A;  1BCO A;  4KFB A;  3SV4 A;  4KPY A;  1L3T A;  3OYM A;  4O4G A;  4IG0 A;  4FJM A;  1B9F A;  3K5M A;  4Y1C A;  1BCM A;  3OS1 A;  4CK2 A;  2O4G A;  4DTS A;  4KI4 A;  3QET A;  4ELU A;  4HTU A;  4BE2 A;  2DY4 A;  4ID1 A;  4LH5 A;  3SQ1 A;  2P51 A;  3K2P A;  3CM6 A;  3O4N A;  4B3O A;  4N56 A;  1RTJ A;  1BQN A;  3LZJ A;  4DFK A;  3RMD A;  2FBY A;  4ID5 A;  4FLW A;  4CFC A;  4O55 A;  3VQQ A;  2OPP A;  4M41 A;  1I39 A;  3JYT A;  1Y97 A;  3K5L A;  4CK1 A;  3S3O A;  1WSH A;  3OYA A;  3WNH A;  3ZSO A;  3SV3 A;  4FLV A;  4C8O A;  2I5J A;  3L3U A;  4CK3 A;  2YHB A;  4HCC A;  1BI4 A;  3NE6 A;  3MED A;  1C6V A;  1TGO A;  4OLB A;  3SJJ A;  4CEF A;  5HLF A;  2G8V A;  1XHX A;  4DQI A;  3VN5 A;  1B9D A;  4FJG A;  1JLA A;  2RPI A;  1S1V A;  1RBV A;  3QEX A;  3ZSR A;  1VSE A;  4H8K A;  2P5G A;  3QEP A;  1KVB A;  4CJP A;  5EU7 A;  2VG6 A;  4G1Q A;  2A1R A;  2B4J A;  4DTR A;  4OLA A;  3KJV A;  2E4L A;  4ELV A;  4R5P A;  4M3U A;  1YT3 A;  3WNG A;  1TK0 A;  3C6U A;  1LWF A;  1QSY A;  4ZHR A;  2DFF A;  3OYI A;  4ZTJ A;  3AVF A;  2ETJ A;  1JXE A;  3ZCM A;  3D0P A;  5J2M A;  5CY4 A;  1X9W A;  3HM9 A;  2A1S A;  1HPZ A;  3VQP A;  2JGU A;  4ICL A;  4KO0 A;  4O5B A;  4DFJ A;  4CHP A;  1Q9Y A;  4RW9 A;  4BAC A;  2D0A A;  4B9U A;  4CIF A;  4KTW A;  4DSE A;  1Z25 A;  4E1M A;  3V9X A;  3T19 A;  1VK0 A;  5CYQ A;  1WSF A;  3NAE A;  2HB5 A;  3LAL A;  4CF2 A;  5C25 A;  1U48 A;  1BIU A;  2WON A;  5JS1 A;  4K8Z A;  1ZBI A;  1NKE A;  2GV9 A;  4CES A;  3OS0 A;  2PYJ A;  4CF9 A;  3QER A;  1TL1 A;  1C1A A;  2IGI A;  1S5J A;  3LAM A;  1EXQ A;  3ZT2 A;  4CJK A;  4UQG A;  3QO9 A;  3G0Z A;  3VQ8 A;  4I7F A;  3AVN A;  2VWK A;  3HO1 A;  4DF4 A;  4F2R A;  4PA1 A;  4CGD A;  1D9F A;  1C0U A;  1DTT A;  1SL2 A;  4O44 A;  1BIZ A;  1DLO A;  3RMC A;  4B9T A;  4JLH A;  2Z1I A;  4OJR A;  1KSP A;  3RRH A;  2VG5 A;  3QIO A;  3CFR A;  4FVM A;  3P1G A;  4CHO A;  2XO7 A;  4BE1 A;  1NK8 A;  4CCH A;  4OGE A;  1CZB A;  4DTP A;  4M45 A;  1SL0 A;  4CEO A;  4FZZ A;  4F4K A;  4J2B A;  4KHS A;  4M3Z A;  1A5X A;  1ZBH A;  1ITG A;  1T05 A;  5J2Q A;  4CJR A;  4BWJ A;  1ASU A;  3NH0 A;  2G8U A;  5C42 A;  5I3U A;  4FLT A;  2IAJ A;  3RWU A;  3RMB A;  3SI6 A;  2OA8 A;  4DSL A;  1KFS A;  4FJH A;  4Z4E A;  3V9S A;  3EY1 A;  4GVM A;  1FKP A;  1CXU A;  4MQ3 A;  3OYB A;  3I8D A;  1HYS A;  4PUO A;  4F3O A;  2HNY A;  1L5U A;  3NCI A;  3SUP A;  2OZS A;  1N5Y A;  4C8L A;  1WSJ A;  1ZBF A;  3OJS A;  1NK9 A;  2HW3 A;  4KTQ A;  3T3F A;  3OYK A;  1WSI A;  4I2P A;  1NJY A;  3VQ7 A;  2OPR A;  4CFB A;  2IC3 A;  3K57 A;  3VA0 A;  2ZE2 A;  1NK4 A;  4DSJ A;  4CJQ A;  2E6M A;  3HYF A;  3DMJ A;  4CGI A;  3LPU A;  4HHT A;  1S6Q A;  1TKT A;  4F2S A;  3OYN A;  2G8K A;  1LWC A;  2YNF A;  3G10 A;  1S9G A;  2XHB A;  1VRT A;  3O3G A;  1HQU A;  1RDA A;  4CJT A;  3AVK A;  4CJS A;  3TAE A;  3HST B;  3RR7 A;  4IDK A;  1RDC A;  3C94 A;  4QAG A;  3ASM A;  3LP0 A;  3D45 A;  1VSI A;  1FK9 A;  2EHG A;  2W42 A;  1D8Y A;  1BI4 B;  1C0M A;  2Z1G A;  3F73 A;  4RW7 A;  3L2U A;  2KQ2 A;  4W5Q A;  1BQM A;  4CJU A;  4AHU A;  4CE9 A;  3QEV A;  3NHG A;  4Q5V A;  1VSJ A;  3PX4 A;  2HHV A;  3T1A A;  1TK5 A;  1RT1 A;  5HRN A;  1J9A A;  1ASW A;  3OYH A;  3THV A;  1W9H A;  3TWH A;  1HRH A;  3AVA A;  5HBM A;  2X6S A;  4CEA A;  5KRS A;  3SUQ A;  2O4I A;  1NJW A;  4FW1 A;  4L8R B;  3AA2 A;  4XIU A;  1IO2 A;  3AO2 A;  1HNV A;  4AHT A;  1HYV A;  3NF9 A;  3DRR A;  3DOK A;  3PO5 A;  1TKX A;  3PX0 A;  4JRP A;  3VQ6 A;  4HUG A;  3ZSZ A;  1QE1 A;  3I0R A;  4KHU A;  3AVL A;  1WLJ A;  1S1W A;  2F8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...