4CHOA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 52
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4choA00
2DFFA 3C95A 1B9FA 1ZYQA 3VQPA 3RMAA 3V1OA 4E19A 4M3XA 1WN7A 4KHYA 4O5BA 4Q0BA 3AVIA 3KK3A 1QSLA 4Z4FA 1WSHA 3U3YA 4EP5A 5E41A 4ZHRA 3RTVA 4EZ9A 3RRGA 4OGEA 4KHSA 1XHZA 3QO9A 3F73A 1JL1A 3SV3A 3V9UA 4DS5A 1I39A 4DTOA 4M3UA 4ID5A 1VSLA 3LP3A 4I2PA 1JLEA 4N5SA 4CGJA 3IG1A 4OPKA 4FW2A 3L2QA 3M8RA 3QETA 1KFSA 1SV5A 1RT7A 1SKRA 1RTDA 2HHTA 2KZZA 3T3FA 3VQ8A 3T1AA 3AA2A 3K59A 4BDPA 3VQCA 2XY5A 3SUPA 4W5TA 3KLFA 3AV9A 4CCHA 1VSEA 3SPZA 1X9WA 4F8RA 4F3TA 2A1RA 3OYIA 4QAGA 3CYMA 3SYZA 4KREA 3O3HA 4PQUA 4DFKA 4DTPA 4CEDA 1U47A 3MEGA 3DLEA 3HPHA 3ULDA 3S9HA 2XY7A 3LDSA 3OYMA 1RBVA 1TAQA 2OPPA 1UAXA 3AVAA 4Z4GA 2OZSA 4FLZA 5C42A 3U6FA 1NK4A 3OYCA 3L2UA 1A5VA 1S1TA 3QLHA 1SKWA 1TK0A 5SWMA 1XHXA 4HCBA 4M3WA 3DLGA 4KTWA 4DSFA 4CF1A 3RMDA 2GV9A 3UIQA 1Z25A 4IG3A 4DLEA 1KRPA 1RCHA 4FK4A 4LH4A 1KTQA 1T8EA 2HW3A 3MXJA 3VQEA 1JKHA 4ZTFA 4W5NA 2E4LA 3SPYA 4FZZA 1JLBA 1BHLA 4AH9A 1D5AA 3SQ0A 3VQDA 1EP4A 3WNGA 2YNGA 4B9SA 1TKTA 5KI6A 4F4KA 4CGDA 3ZSQA 4HUGA 1RT2A 4DQIA 4NYFA 4K8XA 3C6UA 3QEWA 1QQCA 2XRIA 3DLRA 1RT4A 4W5RA 1ZBIA 2DTUA 4FYDA 1QTMA 4DLGA 1NKEA 3KK2A 1Q8IA 3TI0A 3C94A 1C1AA 4E7HA 1RBUA 1ASVA 1J9AA 3G10A 3I8DA 1R0AA 4J2AA 3O3FA 4JS5A 4JS4A 5CYQA 4KV8A 3CM5A 1S1XA 4IDKA 3QESA 1NJWA 4GVMA 2D0BA 4FJ8A 5J2NA 1Y97A 3I0RA 2G8KA 4FJHA 2ZD1A 2G8VA 3WNFA 3IS9A 4KI6A 4Z4IA 1NK0A 3NFAA 3SCXA 4O55A 3HO1A 3O4NA 1HQUA 1JLAA 5C25A 4KB1A 4CF8A 2HHUA 1NOZA 1RNHA 4BWMA 1VRTA 2YKNA 1SKSA 1B92A 3QIOA 1HQEA 3VQ7A 2XY6A 3OYLA 4FK2A 4DTUA 2ZE2A 2BANA 3AVGA 3TR8A 1QSYA 4CHQA 4KTQA 4QCLA 4AHVA 1L5UA 5FROA 5J1EA 1TV6A 2VG6A 4DTJA 3TANA 3L2RA 5HLFA 2G8UA 3PX4A 3ZSOA 4CFAA 2BDPA 3NGYA 2G8WA 3IAYA 4FXDA 4DSIA 4OLAA 3MECA 3DOKA 1EXQA 2ITGA 1S5JA 1KLNA 2BE2A 3KLIA 3PY8A 3SNNA 2Z1JA 4RG8A 4DTNA 1WLJA 4I9LA 3DLBA 4E3SA 1RBTA 4IG0A 3NF6A 3KD5E 4CJQA 1S6QA 2KQ2A 3DRSA 3V1RA 3VQ9A 1U48A 4UQGA 1Q9YA 4F2SA 4L8RB 1W9HA 4CEOA 4FJGA 4CERA 3BGRA 2P5OA 5K14A 3CFOA 4FJLA 3C6TA 3QEPA 1BI4B 1L3SA 1HYVA 2P5GA 4KHUA 3HL8A 4AHUA 3RRHA 2X6NA 4CJEA 4KRFA 2KW4A 3QINA 5C24A 4OKJA 1T03A 4FJMA 3IRXA 4ELTA 4M3ZA 2DY4A 4DFPA 2Y1IA 2Z1HA 3O4QA 3HSTB 2YHBA 3L8BA 2QKKA 3HXMA 3E01A 3L3UA 3NF9A 3ZT0A 1WSIA 5JS2A 4XIUA 3HVTA 3TAFA 1IKYA 4DSLA 4DSEA 2FBVA 1GOCA 3AVCA 4FLWA 5HP1A 3AO1A 4CJFA 4JRQA 4C8MA 2PYLA 2P51A 4NCBA 3MEEA 2Z1IA 4B8AB 2O4IA 1HPZA 4OKEA 3V81A 3WNHA 1N6QA 3ITHA 1LAVA 1BISA 5KRSA 3TWHA 3VN5A 4AHSA 4I9QA 1S1UA 3PX6A 4B9NA 1ZBHA 4IFYA 4CIEA 2EHGA 3S3MA 2G8FA 4OJRA 5CY4A 4OGCA 1VRUA 4LSLA 1TGOA 1DLOA 4H4MA 3NH1A 3B6OA 3ZSZA 3NH0A 2JGUA 3M8QA 3S3NA 4E1MA 4C8OA 3ZT4A 1RDDA 1VSMA 4BACA 5DMRA 1RTIA 3CFRA 3VA0A 2IDOA 1KCFA 4CJVA 2PY5A 4KPYA 2IAJA 3TAQA 3AA5X 3T19A 4YFUA 5KRTA 4CF0A 3ZT1A 1WNSA 3LP2A 4CJUA 1BI4A 4KB0A 1VK0A 4Z4EA 5JS1A 1VSHA 2YNHA 4MQ3A 3ASMA 4DU4A 4CK1A 3VQ5A 3SJJA 4E7IA 4CEBA 3DOLA 4N47A 4FJKA 2WONA 3ZSVA 4E89A 4M3RA 4DMNA 3M8SA 1TAUA 4DTRA 3TAMA 3DYAA 1EX4A 1EETA 3LAMA 2YV0X 1C1BA 1RDBA 2D5RA 1BCMA 1T7PA 1WSFA 2VWKA 3LZJA 4CEAA 1TVRA 1C0MA 4CJTA 3NAEA 5SZTA 4DG1A 4O0IA 4Q5VA 3SUOA 4HUEA 4AHRA 3VQ4A 4CEEA 1HYZA 1XWLA 3EY1A 3AVLA 3ISNC 4EZ6A 4QOZB 2OPSA 4FZYA 4F2RA 1HMVA 4KAZA 1QSSA 1ASWA 4O0JA 4K8ZA 4N76A 1S9GA 4I7FA 2PYJA 1O1WA 2HHQA 1F21A 4JLHA 4CJLA 1BL3A 3KKRA 2ZQBA 1G15A 4CHYA 2HNDA 1ITGA 4W5QA 2OZMA 4E0DA 4PY5A 2D0CA 1S1VA 3TAPA 4DWIA 4B9TA 5FDLA 2IGIA 1BCOA 1JLCA 1RT5A 4BDZA 2JLEA 2YNFA 4CGGA 1I3AA 3ZCMA 3KLGA 1LWEA 3QERA 3AO3A 1FXXA 1KVAA 3K2PA 4G1QA 4C8NA 4DQQA 3DLKA 1KSPA 1J54A 1QE1A 3NE6A 2IC3A 4PUOA 4IKFA 3L2VA 1HNIA 1RT3A 3P1GA 1NKBA 2F8SA 4KKOA 3HP6A 2KFNA 1J53A 4I2QA 2FBTA 4AHCA 4PA1A 3KKSA 3OJSA 4DTMA 1SL2A 3V9ZA 3TAGA 5HROA 1VSFA 1HRHA 1RT6A 3ZSXA 1TL1A 3ZT3A 5KTQA 1GOAA 1ZBUA 4HTUA 1ZBLA 4FLVA 2HHXA 3RMCA 1IKXA 1QS4A 1WAFA 1C6VA 3LAKA 4E1NA 3HT3A 3VQ6A 3I0SA 4M3YA 3OS2A 1CXQA 1RBRA 4KTZA 3OYAA 1JL2A 4BE0A 1YTUA 2X74A 4W5OA 4LD0A 1A5WA 3OS1A 1T05A 3OYKA 3SUQA 3HPOA 1X9MA 1NOYA 4ZTJA 3PUFA 4CIFA 1ZBFA 1UWBA 4CEZA 3V4IA 1TK8A 2G8HA 4EP4A 3NBPA 2FC0A 3ALYA 1RT1A 3CM6A 2YKMA 2DFHA 5CZ2A 4FVMA 2GBZA 1D8YA 4CJPA 2XHBA 4JRPA 3DMJA 2KZMA 4OVLA 4DTSA 3AO4A 3TAEA 1UA0A 4LY7A 1VSIA 3P83D 4DTXA 1L3VA 2HNYA 3OYJA 1RILA 5HRRA 2HMIA 1FKOA 1RDCA 1S9EA 1UA1A 1JLQA 3SQ2A 3L2WA 4M3TA 1SUQA 1LW2A 2QKBA 3OVNA 1HNVA 4CEQA 1EKEA 2RF2A 5HRNA 1NJYA 4FJNA 3ZSRA 1DTTA 4HCCA 2KTQA 2I5JA 4FW1A 2ETJA 1X9SA 5HRSA 4CGIA 4B9UA 2E6MA 4CGFA 3K57A 3OYBA 2HHSA 1C0TA 1IKVA 1REVA 3NF7A 4CJSA 1JLGA 1XC9A 3WNEA 3LWLA 3H08A 1TKDA 3G0ZA 2DFEA 4Y1CA 1NK7A 1FKPA 3D0PA 3RR7A 3KJVA 3F9KA 4CGHA 1Q9XA 4ELVA 1LAWA 5CZ1A 2O4GA 1IO2A 4DU3A 1JXEA 3M8PA 3K58A 3AA3A 1U04A 3MEDA 4CHOA 3V9SA 1NK8A 3QEVA 1W0HA 2Y1JA 3LP0A 4CFDA 4KHQA 2FBXA 1L3UA 2W42A 3VA3A 3SQ4A 2P1JA 4IBNA 5CYMA 2HVIA 3JSMA 3BDPA 4FK0A 2F96A 3K5LA 4N56A 4F3OA 4B08A 2G8IA 5FRMA 4O4GA 4Z4HA 4H8KA 3AA4A 4FJ9A 3AVFA 4HVJA 3NHGA 4LH5A 4CFBA 4FJXA 4B3OA 4CIGA 2HVHA 1BIUA 2OYQA 1S6PA 3NH2A 3V6DA 3NCIA 1RTJA 3VQQA 5KGWA 4OLBA 3OYGA 3PX0A 5FRNA 4CE9A 4CJ3A 4FM2A 1NJZA 4KHWA 5D3GA 2B6AA 1WSGA 4OPJA 3AO5A 1WSJA 3NF8A 1NK5A 1WAJA 3OY9A 3QNNA 4GW6A 3O3GA 2RPIA 4B8CA 4CEFA 4CESA 3DLHA 4M41A 4R5PA 1NK6A 3LP1A 1VSKA 3QIPA 5DK5A 4CECA 2FBYA 4ID1A 3V1QA 4YNQA 3V9XA 4KI4A 4DQSA 3QEXA 5I42A 3SI6A 3VQBA 1LV5A 3KLHA 4WE1A 5J2PA 4FM1A 2B4JA 4ELUA 1C0UA 3DM2A 4NCAA 3RMBA 1C1CA 4LSNA 3HJFA 4J2DA 3AVJA 3D45A 3AVMA 3LANA 2VWJA 4BDYA 2Z1GA 3SV4A 1HYSA 2RN2A 2OA8A 4CFCA 3KIOA 2HHVA 2HB5A 3LWMA 4M45A 2QK9A 3NGIA 3MXIA 3LPTA 1KVCA 3LALA 2IOCA 4DU1A 4H4OA 2NUBA 4BWJA 3TABA 3B6PA 3DI6A 4CF2A 2LSNA 4NCGA 5HRPA 3NDKA 4E7KA 4HUFA 2B5JA 1LWCA 1TL3A 1RBSA 4C8LA 3SUNA 2PZSA 3DRRA 3QEIA 1U4BA 4PWDA 1ASUA 4RW8A 4CJKA 5J2QA 4FLXA 1CZBA 4RW6A 3JYTA 1NJXA 3CFPA 4Z4CA 2D0AA 2XO7A 4FJ5A 1VSJA 4DSJA 1GOBA 4DQRA 2Q3SA 4N41A 1KLMA 3OYNA 4CK2A 3TARA 1CLQA 4CF9A 3S3OA 3HP9A 3HYFA 1D9DA 1U45A 2BGGA 1JXBA 3PO5A 1KFDA 3AO2A 4Y1DA 3MAQA 1YVUA 2X6SA 5KGXA 1A5XA 4J2BA 1BQMA 1WSEA 3AVKA 4RW9A 1NK9A 2GUIA 5HBMA 1YTAA 1J5OA 4RW7A 1MU2A 3AVNA 2IS3A 4GMJB 5T7BA 4FLYA 3V9WA 5J2MA 1JLFA 3PV8A 2YHAA 3HPGA 1VSDA 4CJRA 2AJQA 1BIZA 3SZ2A 3K5MA 1YT3A 3L3VA 3QNOA 1NKCA 2OPQA 4C8KA 4DFJA 5EU7A 2X78A 4CHPA 3DRPA 2HHWA 4DFMA 2YNIA 4FM0A 4E7JA 3ZSWA 4DF4A 4ICLA 3OJUA 4DF8A 3THVA 1IKWA 3ZT2A 4CHZA 1CZ9A 4B9VA 1RDAA 1S1WA 4CJWA 3LPUA 4DS4A 5I3UA 1U49A 3RR8A 3EZ5A 4NYNA 4FCYA 3HM9A 1HJRA 1K6YA 4DSKA 4FJIA 3NGZA 3KLEA 4IFVA 1UOCA 4O44A 4BE2A 2RKIA 3OYFA 3KD1E 3AVHA 3EYZA 3CG7A 1IH7A 2EX3A 3U3GA 1LWFA 4CHNA 1Z26A 3SQ1A 4HHTA 1SL0A 3HK2A 4FLTA 3OS0A 1RTHA 3P5JA 1CXUA 1FK9A 1D9FA 4RW4A 4FJJA 3K5NA 1BQNA 1DTQA 3PO4A 2VG5A 2WOMA 1BGXT 4CK3A 4OKKA 4TSXA 2R7YA 3MXMA 2QXFA 4AILC 4DQPA 4B9LA 3K5OA 2E6LA 3OYHA 4FLUA 1X1PA 2HNZA 3OYEA 4E7LA 1SL1A 1N5YA 2A1SA 4KFBA 3CQ8A 3FFIA 3AVBA 3KK1A 3LZIA 3OYDA 4M42A 1B9DA 4FJ7A 3ZSYA 2ATQA 1KVBA 3HVRA 2OPRA 4CJ5A 1L3TA 3VQAA 4CJ4A 4BE1A 3KTQA 1TK5A 4J2EA 4KO0A 1LW0A 4FZXC 2KFZA 2VG7A 2XY8A 1IG9A 1QHTA 1TKXA 4B9MA 4MFBA 4KHNA 3RWUA 4AHTA 1XI1A 4Z0UA 3A2FA 2F8TA 1TKZA
chains in the Genus database with same CATH superfamily
3C95A 1B9FA 4AM7A 4E19A 1WN7A 4KHYA 3VERA 3AVIA 5JVHL 4BY9C 3U3YA 4ZHRA 5MLCQ 2KKZA 3QO9A 1HPMA 2ASOA 4YOYA 4CW7B 1VSLA 4BR0A 3LP3A 4I2PA 4N5SA 2WFBA 4O8UA 4CGJA 3IG1A 1RDUA 4OPKA 4FW2A 3M8RA 1RT7A 1HNXK 2UUBK 3ZX3A 3VQ8A 3CIPA 1WUAA 3T1AA 4BDPA 3M3ZA 4F8RA 4JYAK 4F3TA 2A40A 1HUXA 4PQUA 3DLEA 4DV5K 1W2BM 3LDSA 3MN7A 3UKRA 1OVQA 3OYMA 2O8EA 4Z4GA 4FL9A 2OZSA 4FLZA 3U6FA 3OYCA 1A5VA 4M3WA 3VGMA 3R3LA 4DLEA 2FXUA 1JJ2M 4FWOA 4JKBA 1JKHA 4W5NA 1K8AO 1JLBA 1Z05A 4BRFA 1D5AA 2YNGA 4F4KA 4CGDA 3ZSQA 4HUGA 4DQIA 3R1XA 5M1NA 2P9KA 2XRIA 1VQLN 2DTUA 1WBBA 3TI0A 3ULEB 3WT0A 4IDHA 3I8BA 1J9AA 4JS4A 1Q86O 5IT9O 3QESA 5AQUA 4H0PA 2VWBA 3I0RA 4CVNE 1VQMN 3SCXA 4O55A 5C12A 3WXKA 1JLAA 4H5NA 3ATUA 3QIOA 3OYLA 1QSYA 4KTQA 2HBLA 4AHVA 3THWB 5J1EA 2PBDA 5BRFA 2VG6A 4NLBA 2VQFK 2BDPA 3L2RA 4CFAA 2G8WA 1KLNA 1S5JA 2BE2A 3KLIA 1YJNN 2Z1JA 5GINA 1U48A 3VQ9A 1Q9YA 4CEOA 2P5OA 3C6TA 3QEPA 2P5GA 1HYVA 4AHUA 1DKGD 4XEIA 2Y1IA 3HSTB 3ZT0A 1WSIA 4IWVA 1IKYA 1HR0K 2P9SB 4FLWA 4C8MA 4JV5K 4OKEA 3WNHA 3ITHA 5DM7L 3O80A 3KVGA 1S1UA 1ZBHA 2EHGA 1KAXA 1VRUA 4LSLA 1YHQN 3NH0A 2JGUA 3I55N 2V7ZA 3SJHA 3CFRA 4CJVA 1NMNA 2PY5A 2IVOA 4A2AA 3AGRA 4YFUA 4BRQA 2QI2A 1X3NA 1HNZK 3CPEA 3ZT1A 4CJUA 3HI0A 4KB0A 1VSHA 1V4SA 3U4LA 3QFUA 3C7NA 4BR9A 2QWNA 3DOLA 1N34K 1RGIA 4V19S 2WONA 3ZSVA 4M3RA 4DTRA 3TAMA 3FR0A 4WF9L 3IKMA 2YX6A 1RDBA 2D5RA 1T7PA 5AQSA 3LZJA 4CEAA 1N32K 4CJTA 1TUUA 4K43A 3P39A 4DG1A 4AHRA 3VQ4A 1SS6A 2FF6A 1HYZA 3W0LA 4B3RK 4O0JA 1JCFA 1O1WA 2HHQA 1Q81O 4YDUA 2YCHA 3KKRA 1G15A 2HNDA 5BN8A 4E0DA 4W5QA 4PY5A 4DWIA 1P8ZA 5FDLA 3LDPA 1BCOA 5I9EB 3PIPL 2H3GX 4CGGA 5EVZA 3H45C 3QERA 1FXXA 1KVAA 4G1QA 1J54A 1NMDA 2HMPA 5JVGL 1KD1O 1O13A 3BY5A 2FLOA 2F8SA 2E2OA 1J53A 1V4TA 4I2QA 4CZFA 1VQON 4KH6A 2IVNA 1HRHA 3O8MA 1ZBUA 4FLVA 2ASMA 1IKXA 3CF5L 2I7PA 4M3YA 2A42A 5C2FA 4J8FA 3OS1A 4FSVA 1T05A 3OYKA 1IBLK 1VQ5N 2HF3A 3QDKA 1NOYA 2OTJN 2O8EB 3ID8A 1UWBA 3V4IA 3EL2A 2W6LA 3NBPA 1N33K 2HF4A 3ALYA 1RT1A 5CZ2A 4JRPA 3DMJA 4IO9L 3H1VX 3AO4A 1VSIA 3P83D 4DTXA 4DR3K 1RDCA 3L2WA 3D2FB 3OVNA 4PKIA 5HRNA 4FJNA 1DTTA 1X9SA 2ZF5O 4DV7K 4CGIA 2CH5A 1C0TA 1IKVA 4C1NK 1JLGA 4LFBK 3G0ZA 3RR7A 4CGHA 4ELVA 1LAWA 1M1KO 1HX1A 1JXEA 4M7XA 3AA3A 1U04A 3HBTA 4BRKA 3MMVA 4BG9A 2CGLA 3B8AX 2P9IB 4JD2A 4KHQA 3KK7A 1YJWN 1TUYA 2YHXA 3SQ4A 2UXDK 3QMLA 3JSMA 3OA9A 4N56A 4F3OA 2G8IA 2GWJA 1VQ6N 3AA4A 4DV0K 1E4FT 1BIUA 4LF7K 4IO8A 1GLCG 3OYGA 2AA4A 4CE9A 4CJ3A 3D6RA 3O6WA 3AO5A 3OY9A 4MDAA 4BGAA 4GW6A 3O3GA 2RPIA 1YITN 3DLHA 3FZMA 4OO1J 4G9ZA 3LP1A 1VSKA 3QIPA 4CECA 1VQPN 2GWKA 5J2PA 2B4JA 1QZ5A 1C0UA 1NGBA 3DM2A 2ASPA 3LANA 4JI5K 4CBUA 3SV4A 2VCPA 3KIOA 2HB5A 1T6CA 1GLJO 3D2FA 4B3SK 3NGIA 3MXIA 2W6KA 1KVCA 5TKYA 2WTUA 3TABA 1BUPA 3DI6A 1QVGM 2UUCK 4CF2A 3I56N 4E7KA 1KXPA 4JI6K 3EKSA 4HUFA 1TL3A 4M63C 4JI8K 3T7ZA 4JKHA 2HSTA 2D0AA 4RCHA 5AQHA 1IJJA 3TARA 3HP9A 3AO2A 2E88A 4BVOA 2QWPA 3E1YA 4J2BA 3VF4A 1WSEA 4RW9A 4JN4A 1NK9A 5HBMA 5BPNA 1YTAA 1J5OA 3V9WA 5T7BA 4JKCA 1JLFA 2FSJA 3VENA 3HPGA 3TSQA 1VSDA 3Q7BA 1E3MA 3QNOA 3LM2A 2X78A 4H03B 4FM0A 5LMUK 4DF4A 4DF8A 1CZ9A 1S1WA 1JCGA 1SAZA 3LPUA 1C0GA 5M1PA 3H3OB 3O08A 1W7AA 3UKRB 4NYNA 4FCYA 3KLEA 3VTHA 4BE2A 4X66K 3KD1E 1IH7A 2BTFA 2EX3A 3AAQA 4HHTA 3HK2A 4A57A 3DAWA 1CXUA 4EHTA 4DHYA 3FLCO 1DTQA 3MCPA 5A2QO 4TSXA 3MXMA 4FLUA 4OLBA 3OYEA 1N5YA 3CQ8A 3D2EA 4B1WB 1BA1A 4JKGB 1B9DA 3O5BA 2O8BA 4NXMK 3ZX2A 2ATQA 2OPRA 1L3TA 3KTQA 4J2EA 4B1VA 4DR1K 4KHNA 3RWUA 4AHTA 1X3MA 3RMAA 3HSCA 2YI1A 5KPRA 4M3XA 4O5BA 4XH1A 4JK7A 5E41A 3RTVA 3RRGA 3H46O 4NLCA 3V9UA 4JI2K 4ID5A 4BRDA 1W97L 2E2PA 1RTDA 2HHTA 2KZZA 3T3FA 3EE9A 2P9NA 3AA2A 3SLCA 3AV9A 1VSEA 3SPZA 2YHWA 1XC3A 2D4WA 4FWLA 3O3HA 1U47A 3MEGA 3ULDA 2A41A 3S9HA 1TAQA 5AQPA 5C42A 4FOIA 3QLHA 1S72N 1XNRK 1XHXA 3A5OC 3UIQA 1Z25A 4IG3A 1KRPA 1KTQA 1E4GT 4ZTFA 1OH5A 2E4LA 1BHLA 4BRNA 4B9SA 1TKTA 5KI6A 4K8XA 1RT2A 1NLVA 4ISGA 3O1WA 3DLRA 1RT4A 4W5RA 1ZBIA 1QTMA 3SBTA 5FLXO 4CD1A 3KK2A 5HL7L 4DV3K 3T1YK 4WYBA 3TU5A 4E7HA 5AQTA 4BR7A 1IBMK 3G10A 3I8DA 4O8KA 2V52B 3THWA 4JS5A 5CYQA 4FPBA 3CJ1A 4FJ8A 2ZWHA 4A62A 4A5BA 5J2NA 3TSPA 4Z4IA 4KB1A 1YJ9N 1NGFA 1NOZA 1RNHA 3DWLA 3VQ7A 1M90O 4DTUA 2ZE2A 3VEVA 3TR8A 4CHQA 3MX5A 1NNEA 3ZSOA 4DSIA 3CI5A 1DEJA 3VETA 4DV2K 1RBTA 2PFUA 4IG0A 3KD5E 1KAYA 1JCEA 2KLAA 4OX9K 1L3SA 2HHHK 1BI4B 2V7YA 1RDWX 3M6GA 2X6NA 4B3TK 2GELA 2KW4A 1T03A 3IRXA 4DFPA 1MWMA 2YHBA 3VEXA 4EFHA 3L3UA 3NF9A 3TAFA 1CZAN 2FBVA 1GOCA 4YOWA 4CJFA 3W3DA 2P51A 3THYB 4B8AB 3V81A 1BISA 3TWHA 3VN5A 4I9QA 3PX6A 4B9NA 4IFYA 4CZIA 5CY4A 4OGCA 3CCSN 1TGOA 1DLOA 3NH1A 3ZSZA 4X62K 3S3NA 3VEOA 4C8OA 1RDDA 2ITMA 3RSEA 4BACA 5DMRA 1RTIA 2QKBA 2IDOA 2JWKA 2W41A 3U9DA 1BOTO 2J4RA 5BRHA 3VGKA 3LP2A 1VK0A 4MQ3A 4JI3K 3E9OA 4E7IA 3CJCA 4CEBA 3CC4N 4CBXA 1NBWA 4NB4A 1BCMA 5AZJA 1K8KB 4OPHA 1TVRA 3CETA 5SZTA 4Q5VA 5AQIA 4QOZB 3VEWA 4K8ZA 3E9PA 1S3XA 1S9GA 3C65A 4CJLA 1BL3A 2D0CA 3TAPA 3MX2A 3OBWA 1RT5A 2YNFA 1ZC6A 1VAZA 1LWEA 4C8NA 3K2PA 1C0FA 3DLKA 3NE6A 2IC3A 5AQVA 3P1GA 4HTLA 1NGIA 4JI0K 2KFNA 4DTMA 4AHCA 1SL2A 3AGKA 1VSFA 3IUCA 3ZSXA 1RT6A 3TTFA 5KTQA 1GOAA 1ZBLA 4DKWA 2HHXA 4H0OA 1QS4A 2NRWA 4JK8A 4K42A 3VQ6A 3I0SA 1RBRA 3VF2A 1JL2A 4W5OA 4LD0A 4KBOA 3QFPA 5M1OA 1X9MA 3ID6A 4DR2K 1ZBFA 4CEZA 3HOSA 3VESA 5F2RA 4EP4A 2FC0A 3CM6A 2YKMA 2GBZA 1D8YA 2KZMA 4FOEA 4OVLA 5BREA 4DTSA 4A5AA 2IVPA 3TAEA 1UA0A 4LY7A 3K9KA 1L3VA 5KQDA 1HJOA 3NVMA 1EWQA 4BRAA 5HRRA 4WQ5A 1UA1A 1JLQA 3FFKB 3SQ2A 3FGUA 4M3TA 3ULEA 1LW2A 1HNVA 5M1KA 1EKEA 4JK9A 1N8RO 3EZWA 3ZSRA 2QWRA 1YXQA 4NO7A 1NGJA 5C2DA 4CGFA 3OYBA 1FW6A 3H08A 4Y1CA 1NK7A 3D0PA 4DU3A 5GAEP 3K58A 3UKUB 2P9LA 1HKGA 2CGJA 4CHOA 2E1ZA 1VQ9N 3V9SA 2QWLA 4BRPA 2W42A 1HKCA 3VA3A 3L6QA 3E66A 2HVIA 4FWPA 4BROA 4GV6A 2P9UB 3WXMB 4B08A 2E1YA 4B1UB 5FRMA 4FJ9A 3AVFA 4HVJA 4FJXA 4B3OA 4CIGA 2OYQA 1S6PA 3NH2A 2VYPA 2O8CB 1XUPO 2ZGYA 5GIPA 3CQYA 4ILHA 2B6AA 5AQOA 4QS7A 4DCHA 4CESA 1HKBA 3L4IA 1NK6A 2F4VK 4BR2A 3V1QA 3V9XA 4KI4A 3QEXA 5I42A 3GBTA 4WE1A 4JHDA 3ZEUB 1C1CA 1OVYA 4BQLA 4HWIA 3D45A 3AVMA 2RN2A 4CFCA 2HHVA 5LJWA 4M45A 4H0VB 4IFEA 3WEEB 3CQXA 3LPTA 4DU1A 3IFRA 5AQKA 4H4OA 2NUBA 4BWJA 4BQZA 3B6PA 4PHTX 3VEYA 2V51B 1LWCA 1RBSA 4JI1K 3SUNA 3DRRA 3QEIA 3BZCA 3DXKA 4PWDA 5AQNA 1ASUA 5FPNA 2NRRA 4FLXA 3JYTA 4ISFA 4I6MB 2FF3B 3O9UA 1D4XA 4FJ5A 1VSJA 4FWKA 1GOBA 3VMFB 3CCVN 2HBKA 1KLMA 1CLQA 2OCEA 4MO5A 3HYFA 4CF9A 3S3OA 1U45A 5TKWA 1JXBA 3CCJN 2VGMA 4CZKA 3E9LA 2X6SA 1BQMA 3SBGA 2GUIA 3OTOK 4GMJB 4H5TA 3L4QA 1IV0A 2AJQA 3D7EO 5F0XA 5DM6L 1NKCA 2OPQA 2UYTA 1BA0A 3P31A 4DFJA 4CHPA 4BVPA 4RWTA 3TSUA 1S22A 1TYQA 3PLAA 4ICLA 1IKWA 4B9VA 2HBJA 4DS4A 2QXLA 3ZETA 5I3UA 2Q36A 3EZ5A 4DSKA 1K6YA 3NGZA 4IOAL 5FPMA 4JKFA 3AVHA 4FWRA 3CG7A 3EYZA 1X9JA 4QS8A 1LWFA 5JMVA 1Z26A 3SQ1A 1K9MO 1SL0A 4FLTA 3OS0A 1RTHA 1YF5L 3ENOA 4FJJA 4RW4A 1NGEA 3K5NA 2NZTA 3PO4A 2WOMA 2YJEA 3IDHA 1VQ4N 2R7YA 2QXFA 1U2VB 2E6LA 3CCEN 4BRIA 3OYHA 4E7LA 3FFIA 4M42A 3F9MA 1KVBA 2KFZA 2VG7A 2F9TA 4H5WA 3A2FA 5BR9A 1ZYQA 1WB9A 3V1OA 4Q0BA 3KK3A 1QSLA 1WSHA 4A2BA 4EZ9A 4CZLA 2E20A 4IEEA 2E8AA 1JL1A 4DTOA 1I39A 4M3UA 2NRTA 1YVNA 4GV9A 4JNEA 1JLEA 3ZX0A 3L2QA 1WBDA 1KFSA 5KQ8A 3K59A 1OH8A 3VQCA 3SUPA 4CCHA 3J80O 1X9WA 2A1RA 3OYIA 4QAGA 4KREA 3GG4A 4DFKA 4DTPA 1YAGA 4CEDA 3HPHA 1QQOA 2OANA 2XY7A 2ZJPL 1RBVA 1UAXA 3AVAA 1MWKA 1S1TA 1SKWA 1MA9B 1TK0A 4HCBA 4CF1A 3RMDA 2GV9A 3CMEN 4FK4A 3CJBA 4LH4A 1T8EA 4IJNA 3MXJA 3SAGA 2HW3A 4LF4K 4DB3A 4FZZA 1EWRA 4AH9A 3SQ0A 4DUYK 3WNGA 3HRGA 3CXCM 1T44A 2I7NA 1QQCA 2ZM6K 4DLGA 3I33A 2F9WA 2NRXA 2FSNA 1RBUA 3EN9A 3FZKA 1FJGK 4PL7A 1NJWA 2G8KA 4YHHK 4FJHA 2ZD1A 4U67L 2G8VA 3IS9A 4BGBA 3NFAA 3HO1A 3O4NA 2UU9K 1VRTA 2YKNA 3MN9A 1SKSA 1HQEA 2XY6A 4FK2A 3AVGA 4LFAK 1XNQK 4ISEA 4QCLA 3SAHA 4B9QA 4AQYK 4LF9K 5AQRA 2UUAK 3TANA 3PX4A 5AZIA 4DUZK 4OLAA 3DOKA 4CBWA 2GTDA 3SNNA 4RG8A 4DTNA 1WLJA 3DLBA 4GKJK 3NF6A 4CJQA 1S6QA 2KQ2A 3DRSA 3V1RA 4L8RB 4F2SA 1ILYA 3AARA 1Q82O 4CERA 2HBMA 3P38A 4FJLA 4KHUA 5C10A 3HL8A 3R9PA 5HOOA 4KRFA 4CJEA 3QINA 5C24A 4OKJA 4FJMA 4M3ZA 4ELTA 4MO4A 4BC2A 3SMSA 3L8BA 3RSEB 2QKKA 5AFUH 4GKKK 4F9OA 3THXA 4BR4A 4A61A 1NGAA 4BRHA 2O8DA 4DSLA 4DSEA 3AVCA 5HP1A 3AO1A 4JRQA 5AQZA 3MEEA 4EIAA 2O4IA 1HPZA 4FPAA 5LY3A 1LAVA 4AHSA 4CIEA 3K0SA 2UXCK 3LM9A 4H4MA 1GLBG 4E1MA 5EY4A 4FO0A 1WOQA 3ZT4A 1VSMA 4KPYA 2Q2RA 1KCFA 2IAJA 3AA5X 3T19A 2Q0UA 5KRTA 4CF0A 1BI4A 1BU6O 2YNHA 3ASMA 2NRHA 5AQFA 3VQ5A 3SJJA 4BR5A 3ATVA 5AR0A 4N47A 3S41A 4DMNA 3M8SA 3DYAA 1EX4A 3VPZA 1EETA 2YV0X 1C1BA 4GY2B 4JKEA 3NAEA 4O0IA 3SUOA 3DXMB 4CEEA 1XWLA 5EOYA 3AVLA 3ISNC 4EZ6A 2OPSA 1HMVA 4KAZA 1QSSA 4ILJA 2AP1A 1Q7YO 3CC2N 2Q97A 4I7FA 1H1VA 2PYJA 5ADXA 3PIOL 2ZQBA 3QBWA 5C0YA 1ITGA 2OZMA 2E2QA 1S1VA 4KHPK 2IGIA 1JLCA 4EHUA 1ZXOA 2BH1A 3ZCMA 4X65K 3KLGA 4C23A 3SMPA 2QWMA 1QE1A 3LL3A 4IKFA 4JI4K 1HNIA 2WBNA 1NKBA 2JWLA 2A3ZA 3HP6A 1ATNA 3KKSA 3OJSA 3CJ9A 3MN5A 3V9ZA 5CE3A 1HNWK 3LDOA 1TL1A 3ZT3A 1Q18A 3RMCA 1C6VA 3LAKA 4E1NA 3OS2A 4CJ7A 1NG9A 3MK6A 4BE0A 1YTUA 2X74A 4FWQA 5AZIB 2ZJRL 3WXIA 3SUQA 3TTDA 4IEIA 2P9PB 1TK8A 3JXUA 3VF6A 4IOCL 4FVMA 4CJPA 2XHBA 4H0YB 2P9NB 5KPZA 4FWNA 3UE5A 1QQMA 1KAZA 4K0KK 3DXMA 3FZHA 3OYJA 2HMIA 1FKOA 1SUQA 3IMXA 3WXJA 4CEQA 4DR7K 2RF2A 1NJYA 2NNWA 2KTQA 3BZKA 4FW1A 3BEXA 2ETJA 3MCAB 3CD6N 2GEMA 2Q1NA 2E6MA 3C6HA 4CJSA 4YORA 3WNEA 3LWLA 1XC9A 2O8FA 3NVKA 3CCQN 3F9KA 3UB5A 2O4GA 3WXLA 2O8BB 3MEDA 3GE1A 2Q0RA 1NK8A 2Y1JA 1W0HA 1U2VA 3LP0A 4CFDA 1R59O 2O8CA 1L3UA 4ILGB 4AM6A 1Z6RA 5CYMA 3MWPA 3O9RA 3BDPA 4FK0A 2ZJQL 2F96A 1J6ZA 2P9UA 1ESVA 1Y64A 2D0PA 4O4GA 5BN9A 1OKJA 5AQYA 4H8KA 4WCEL 3NHGA 4LC9B 2HVHA 3EEQA 3NCIA 5KGWA 3QBXA 4MDBA 5AQQA 5FRNA 3VOVA 1NJZA 1VQ7N 5JICA 4E1JA 1WSJA 1NK5A 3UKUA 4CEFA 4B8CA 5DK5A 2FBYA 4YNQA 2O8FB 1LV5A 3VQBA 3KLHA 4ELUA 2CGKA 2E5LK 3BF1A 4NCAA 4LSNA 3HJFA 4J2DA 3AVJA 2VWJA 1VHXA 2OA8A 5GAHP 4LF8K 2QK9A 4DV4K 3KHYA 3LALA 2IOCA 3T1HK 3MWTA 5HRPA 2LSNA 4NCGA 3WQTA 3CMAN 4C8LA 3ZYYX 2OTLN 2PZSA 1U4BA 4H5RA 4RW8A 2P9PA 1K73O 5J2QA 4RW6A 3CFPA 1MDUB 2F7TA 4L3QA 4IOXA 4JKDA 4DQRA 2Q31A 3DJCA 2Q3SA 4N41A 3BUZB 4CK2A 4WFNL 3TTCA 2A5XA 3PO5A 1KFDA 3H6EA 4Y1DA 3MAQA 1YVUA 4BC3A 4Z94A 3BP8A 1A5XA 3AVKA 2UXBK 1QZ6A 1MU2A 3AVNA 2IS3A 3O9QA 1NU0A 3PV8A 2YHAA 3H1QA 4CJRA 1BIZA 3SZ2A 3CCLN 4KH5A 1YUWA 3LDQA 3DRPA 1GLAG 5LL6Z 2HHWA 4CZGA 4DFMA 1OH6A 3KZBA 4CJWA 3J8AA 4WFAL 3TPQA 1NM1A 4GV3A 1U49A 3RR8A 3AAPA 3HM9A 1HJRA 2NRVA 3O4WA 3G4SN 3QICA 4IFVA 1UOCA 3U8XA 5BPMA 2RKIA 3DXKB 5AQLA 5GADP 4FWMA 3U3GA 4CD3A 3U9ZA 4CHNA 4YY3K 4BREA 1XQSC 4B1YB 3BF3A 1BGXT 2P9IA 2KHOA 3J7ZO 4AILC 3K5OA 5AQJA 4BG8A 1SL1A 4LF6K 4BRGA 1GLEG 2A1SA 4KFBA 5AZJB 1SQKA 4IZ9A 2QM1A 3WQUA 4CJ5A 4CJ4A 4BE1A 3ENBA 4KO0A 4R79A 1LW0A 4FZXC 1TKXA 3EKUA 4MFBA 1NWKA 1XI1A 4Z0UA 2YJFA 2F8TA 2DFFA 3O9TA 3VQPA 4Z4FA 4EP5A 4JKGA 4OGEA 4KHSA 1XHZA 3F73A 2HOEA 3SV3A 4DS5A 4LF5K 5AQGA 3QETA 1SV5A 1SKRA 2XY5A 4W5TA 3KLFA 3JS6A 5AFUA 4U7BA 4H5VA 3THYA 3CYMA 3SYZA 3VEZA 5AJ3K 1J5EK 5AQMA 2OPPA 3F2KA 3THXB 3Q7CA 5M1QA 2ZGZA 3QB0A 1NK4A 3L2UA 3CCRN 4CZMA 5SWMA 3CJ7A 4BC4A 3DLGA 4KTWA 4DSFA 1TYQB 4MLHA 5JLFA 1RCHA 3VQEA 1BWFO 4WQ4C 4OPAA 3SPYA 3A5MC 4RTFD 4GVEA 3VQDA 1EP4A 4H0XB 3J7YP 4NYFA 3C6UA 3QEWA 5EX5A 4FYDA 1NKEA 1T6DA 4YOVA 1Q8IA 3C94A 1C1AA 5CR4A 1ASVA 3EE8A 1R0AA 4J2AA 3KWIA 4CZEA 3O3FA 1OH7A 4KV8A 3CM5A 1S1XA 4I6MA 4IDKA 4GVMA 2D0BA 1QQNA 1Y97A 3WNFA 1VQ8N 4KI6A 3EO3A 1NK0A 3PSIA 1HQUA 5C25A 4IJAA 4CF8A 3ZLJA 2HHUA 4BWMA 1B92A 4DR6K 5KPTA 2BANA 4YOTA 5F1XA 3CJAA 3SAFA 2QW9A 1L5UA 4PKHA 5FROA 1VQNN 1TV6A 5FPDA 4DTJA 5HLFA 2G8UA 3IAYA 3NGYA 3SK3A 4FXDA 3MECA 1GLLO 3O9SA 1EXQA 2ITGA 1ZBSA 3PY8A 4BRMA 4CZHA 3J81O 3RVCA 4I9LA 4E3SA 4JKAA 4UQGA 4FWSA 3G6EN 1W9HA 4FJGA 3BGRA 5K14A 3CFOA 4DR4K 3RRHA 2QWOA 2DY4A 2NRZA 2Z1HA 3O4QA 5BRDA 3HXMA 3E01A 4EAHD 5JS2A 4XIUA 3HVTA 3N4QA 4GNIA 4H0TB 4A59A 2QTDA 3CCUN 4DV1K 3CERA 3CHWA 2PYLA 4NCBA 2Z1IA 5JLHA 1N6QA 5KRSA 3CC7N 1HLUA 2G8FA 3S3MA 4OJRA 1GLFO 1LCUA 5GAGP 1N36K 3B6OA 2QA4N 3M8QA 1QHAA 1ATRA 3VA0A 1SZ2A 2P9LB 3TAQA 4CI6A 1WNSA 4Z4EA 5JS1A 4DU4A 4CK1A 3FE1A 5H1SQ 4FJKA 4E89A 4XH5A 3CPWM 1TAUA 3LAMA 4NXNK 3D2EB 1NGCA 1WSFA 2VWKA 1C0MA 4B3MK 4X64K 1GLDG 4HUEA 5ELZA 2RE2A 2WUSA 3EY1A 4FZYA 4MLEA 4F2RA 2QEXN 1ASWA 4N76A 4CZJA 5B8HA 1F21A 4JLHA 4CHYA 1YI2N 2O8DB 4B9TA 1DGKN 3FZLA 1BDGA 4BDZA 2JLEA 1I3AA 4WQ5C 3AO3A 4DQQA 1KSPA 1NJIO 2P9KB 3LDNA 2A6AA 3HTVA 4PUOA 5EXWA 1DT9A 3L2VA 1RT3A 4KKOA 2FBTA 3GL1A 3K9JA 4PA1A 3TAGA 3CCMN 5LMNK 5HROA 1LOTB 4WQ4A 2FSKA 2IIRA 4O5FA 4HTUA 3OBYA 3R6MA 1IG8A 1NGDA 1WAFA 3VGLA 1P90A 5ADXH 4QS9A 3HT3A 3L0QA 3OW2M 1CXQA 4KTZA 1VQKN 3OYAA 1A5WA 3LDLA 4LFCK 3N4PA 3JAMO 1I94K 2BUPA 3HPOA 2NLXA 4ZTJA 3PUFA 3M5RA 1QVFM 4CIFA 4M7YA 2G8HA 3NMUA 3DLLL 2DFHA 4B1XB 4YOUA 1NGGA 2HNYA 3F5TA 4JI7K 1RILA 1RFQA 1S9EA 1K8KA 3M1FA 4HCCA 1KC8O 2I5JA 5HRSA 4B9UA 3K57A 2HHSA 4JHDB 1REVA 3NF7A 2QWQA 4XH4A 1EO1A 3C7NB 3VTIA 1TKDA 2DFEA 1FKPA 3KJVA 1Q9XA 5CZ1A 1IO2A 4KH4A 3M8PA 4IXCA 3MN6A 4AF1A 3QEVA 3HZ6A 3OHRA 2GX9A 3KWGA 2FBXA 3O1BA 2VGNA 1T3VA 3G25A 4PKGA 4DV6K 2P1JA 4IBNA 3K5LA 5AQWA 3MDQA 4Z4HA 3A5LC 3J7AP 2P9SA 4LH5A 4CFBA 4JD2B 3V6DA 1RTJA 3VQQA 4UY8O 3PX0A 4FM2A 4KHWA 5D3GA 1WSGA 4OPJA 3NF8A 1WAJA 3QNNA 2W40A 5C15A 4BRCA 4FVUA 3ENHA 4M41A 4R5PA 4WFBL 4ID1A 4DQSA 3SI6A 3H3NO 4FM1A 2EWSA 2RHKA 3PSFA 1BG3A 3RMBA 5BR8K 2CH6A 4BDYA 2Z1GA 1HYSA 5IWAK 5E84A 3LWMA 1YIJN 2VQEK 1XMOK 3NDKA 3C0BA 2B5JA 3A5NC 4CJKA 1CZBA 1NJXA 4Z4CA 4Y0WA 2XO7A 3P4IA 4DSJA 3ZETB 2D1KA 1EQYA 3OYNA 3AY9A 2WC9A 1D9DA 4YOXA 5M1FA 2BGGA 5GIOA 5KGXA 3C6AA 4K25A 5E26A 2D0OA 4RW7A 4YDUC 4FLYA 5J2MA 4JEPA 1ATSA 3K5MA 1YT3A 3L3VA 4C1NI 4K41A 4C8KA 5EU7A 2YNIA 4E7JA 5BPLA 3ZSWA 3OJUA 3THVA 3ZT2A 4CHZA 5CHIA 1RDAA 1U6ZA 1IBKK 2GUPA 2YHYA 3HM8A 3A0IX 3GOIA 4FJIA 3G71N 1BO5O 4O44A 4DR5K 3OYFA 3FZFA 4JAXA 2E2NA 4BRLA 3T69A 2DPNA 1XMQK 3P5JA 1FK9A 1D9FA 4DQ8A 5FPEA 4B1ZA 1BQNA 2VG5A 4PL8A 4CK3A 4OKKA 4DQPA 4B9LA 3WEEA 2PAVA 1X1PA 2HNZA 4BC5A 3AVBA 3A8YA 3KK1A 3LZIA 1G99A 3OYDA 1NGHA 5LJVA 3ZSYA 4FJ7A 3R8EA 3HVRA 3VQAA 3HOTA 3ZEUA 1TK5A 1KQSM 5AQXA 2XY8A 3WUHA 1QHTA 1IG9A 4B9MA 3GDQA 1TKZA
chains in the Genus database with same CATH topology
2DFFA 3C95A 1B9FA 1ZYQA 3VQPA 3RMAA 3V1OA 4E19A 4M3XA 1WN7A 4KHYA 4O5BA 4Q0BA 3AVIA 3KK3A 1QSLA 4Z4FA 1WSHA 3U3YA 4EP5A 5E41A 4ZHRA 3RTVA 4EZ9A 3RRGA 4OGEA 4KHSA 1XHZA 3QO9A 3F73A 1JL1A 3SV3A 3V9UA 4DS5A 1I39A 4DTOA 4M3UA 4ID5A 1VSLA 3LP3A 4I2PA 1JLEA 4N5SA 4CGJA 3IG1A 4OPKA 4FW2A 3L2QA 3M8RA 3QETA 1KFSA 1SV5A 1RT7A 1SKRA 1RTDA 2HHTA 2KZZA 3T3FA 3VQ8A 3T1AA 3AA2A 3K59A 4BDPA 3VQCA 2XY5A 3SUPA 4W5TA 3KLFA 3AV9A 4CCHA 1VSEA 3SPZA 1X9WA 4F8RA 4F3TA 2A1RA 3OYIA 4QAGA 3CYMA 3SYZA 4KREA 3O3HA 4PQUA 4DFKA 4DTPA 4CEDA 1U47A 3MEGA 3DLEA 3HPHA 3ULDA 3S9HA 2XY7A 3LDSA 3OYMA 1RBVA 1TAQA 2OPPA 1UAXA 3AVAA 4Z4GA 2OZSA 4FLZA 5C42A 3U6FA 1NK4A 3OYCA 3L2UA 1A5VA 1S1TA 3QLHA 1SKWA 1TK0A 5SWMA 1XHXA 4HCBA 4M3WA 3DLGA 4KTWA 4DSFA 4CF1A 3RMDA 2GV9A 3UIQA 1Z25A 4IG3A 4DLEA 1KRPA 1RCHA 4FK4A 4LH4A 1KTQA 1T8EA 2HW3A 3MXJA 3VQEA 1JKHA 4ZTFA 4W5NA 2E4LA 3SPYA 4FZZA 1JLBA 1BHLA 4AH9A 1D5AA 3SQ0A 3VQDA 1EP4A 3WNGA 2YNGA 4B9SA 1TKTA 5KI6A 4F4KA 4CGDA 3ZSQA 4HUGA 1RT2A 4DQIA 4NYFA 4K8XA 3C6UA 3QEWA 1QQCA 2XRIA 3DLRA 1RT4A 4W5RA 1ZBIA 2DTUA 4FYDA 1QTMA 4DLGA 1NKEA 3KK2A 1Q8IA 3TI0A 3C94A 1C1AA 4E7HA 1RBUA 1ASVA 1J9AA 3G10A 3I8DA 1R0AA 4J2AA 3O3FA 4JS5A 4JS4A 5CYQA 4KV8A 3CM5A 1S1XA 4IDKA 3QESA 1NJWA 4GVMA 2D0BA 4FJ8A 5J2NA 1Y97A 3I0RA 2G8KA 4FJHA 2ZD1A 2G8VA 3WNFA 3IS9A 4KI6A 4Z4IA 1NK0A 3NFAA 3SCXA 4O55A 3HO1A 3O4NA 1HQUA 1JLAA 5C25A 4KB1A 4CF8A 2HHUA 1NOZA 1RNHA 4BWMA 1VRTA 2YKNA 1SKSA 1B92A 3QIOA 1HQEA 3VQ7A 2XY6A 3OYLA 4FK2A 4DTUA 2ZE2A 2BANA 3AVGA 3TR8A 1QSYA 4CHQA 4KTQA 4QCLA 4AHVA 1L5UA 5FROA 5J1EA 1TV6A 2VG6A 4DTJA 3TANA 3L2RA 5HLFA 2G8UA 3PX4A 3ZSOA 4CFAA 2BDPA 3NGYA 2G8WA 3IAYA 4FXDA 4DSIA 4OLAA 3MECA 3DOKA 1EXQA 2ITGA 1S5JA 1KLNA 2BE2A 3KLIA 3PY8A 3SNNA 2Z1JA 4RG8A 4DTNA 1WLJA 4I9LA 3DLBA 4E3SA 1RBTA 4IG0A 3NF6A 3KD5E 4CJQA 1S6QA 2KQ2A 3DRSA 3V1RA 3VQ9A 1U48A 4UQGA 1Q9YA 4F2SA 4L8RB 1W9HA 4CEOA 4FJGA 4CERA 3BGRA 2P5OA 5K14A 3CFOA 4FJLA 3C6TA 3QEPA 1BI4B 1L3SA 1HYVA 2P5GA 4KHUA 3HL8A 4AHUA 3RRHA 2X6NA 4CJEA 4KRFA 2KW4A 3QINA 5C24A 4OKJA 1T03A 4FJMA 3IRXA 4ELTA 4M3ZA 2DY4A 4DFPA 2Y1IA 2Z1HA 3O4QA 3HSTB 2YHBA 3L8BA 2QKKA 3HXMA 3E01A 3L3UA 3NF9A 3ZT0A 1WSIA 5JS2A 4XIUA 3HVTA 3TAFA 1IKYA 4DSLA 4DSEA 2FBVA 1GOCA 3AVCA 4FLWA 5HP1A 3AO1A 4CJFA 4JRQA 4C8MA 2PYLA 2P51A 4NCBA 3MEEA 2Z1IA 4B8AB 2O4IA 1HPZA 4OKEA 3V81A 3WNHA 1N6QA 3ITHA 1LAVA 1BISA 5KRSA 3TWHA 3VN5A 4AHSA 4I9QA 1S1UA 3PX6A 4B9NA 1ZBHA 4IFYA 4CIEA 2EHGA 3S3MA 2G8FA 4OJRA 5CY4A 4OGCA 1VRUA 4LSLA 1TGOA 1DLOA 4H4MA 3NH1A 3B6OA 3ZSZA 3NH0A 2JGUA 3M8QA 3S3NA 4E1MA 4C8OA 3ZT4A 1RDDA 1VSMA 4BACA 5DMRA 1RTIA 3CFRA 3VA0A 2IDOA 1KCFA 4CJVA 2PY5A 4KPYA 2IAJA 3TAQA 3AA5X 3T19A 4YFUA 5KRTA 4CF0A 3ZT1A 1WNSA 3LP2A 4CJUA 1BI4A 4KB0A 1VK0A 4Z4EA 5JS1A 1VSHA 2YNHA 4MQ3A 3ASMA 4DU4A 4CK1A 3VQ5A 3SJJA 4E7IA 4CEBA 3DOLA 4N47A 4FJKA 2WONA 3ZSVA 4E89A 4M3RA 4DMNA 3M8SA 1TAUA 4DTRA 3TAMA 3DYAA 1EX4A 1EETA 3LAMA 2YV0X 1C1BA 1RDBA 2D5RA 1BCMA 1T7PA 1WSFA 2VWKA 3LZJA 4CEAA 1TVRA 1C0MA 4CJTA 3NAEA 5SZTA 4DG1A 4O0IA 4Q5VA 3SUOA 4HUEA 4AHRA 3VQ4A 4CEEA 1HYZA 1XWLA 3EY1A 3AVLA 3ISNC 4EZ6A 4QOZB 2OPSA 4FZYA 4F2RA 1HMVA 4KAZA 1QSSA 1ASWA 4O0JA 4K8ZA 4N76A 1S9GA 4I7FA 2PYJA 1O1WA 2HHQA 1F21A 4JLHA 4CJLA 1BL3A 3KKRA 2ZQBA 1G15A 4CHYA 2HNDA 1ITGA 4W5QA 2OZMA 4E0DA 4PY5A 2D0CA 1S1VA 3TAPA 4DWIA 4B9TA 5FDLA 2IGIA 1BCOA 1JLCA 1RT5A 4BDZA 2JLEA 2YNFA 4CGGA 1I3AA 3ZCMA 3KLGA 1LWEA 3QERA 3AO3A 1FXXA 1KVAA 3K2PA 4G1QA 4C8NA 4DQQA 3DLKA 1KSPA 1J54A 1QE1A 3NE6A 2IC3A 4PUOA 4IKFA 3L2VA 1HNIA 1RT3A 3P1GA 1NKBA 2F8SA 4KKOA 3HP6A 2KFNA 1J53A 4I2QA 2FBTA 4AHCA 4PA1A 3KKSA 3OJSA 4DTMA 1SL2A 3V9ZA 3TAGA 5HROA 1VSFA 1HRHA 1RT6A 3ZSXA 1TL1A 3ZT3A 5KTQA 1GOAA 1ZBUA 4HTUA 1ZBLA 4FLVA 2HHXA 3RMCA 1IKXA 1QS4A 1WAFA 1C6VA 3LAKA 4E1NA 3HT3A 3VQ6A 3I0SA 4M3YA 3OS2A 1CXQA 1RBRA 4KTZA 3OYAA 1JL2A 4BE0A 1YTUA 2X74A 4W5OA 4LD0A 1A5WA 3OS1A 1T05A 3OYKA 3SUQA 3HPOA 1X9MA 1NOYA 4ZTJA 3PUFA 4CIFA 1ZBFA 1UWBA 4CEZA 3V4IA 1TK8A 2G8HA 4EP4A 3NBPA 2FC0A 3ALYA 1RT1A 3CM6A 2YKMA 2DFHA 5CZ2A 4FVMA 2GBZA 1D8YA 4CJPA 2XHBA 4JRPA 3DMJA 2KZMA 4OVLA 4DTSA 3AO4A 3TAEA 1UA0A 4LY7A 1VSIA 3P83D 4DTXA 1L3VA 2HNYA 3OYJA 1RILA 5HRRA 2HMIA 1FKOA 1RDCA 1S9EA 1UA1A 1JLQA 3SQ2A 3L2WA 4M3TA 1SUQA 1LW2A 2QKBA 3OVNA 1HNVA 4CEQA 1EKEA 2RF2A 5HRNA 1NJYA 4FJNA 3ZSRA 1DTTA 4HCCA 2KTQA 2I5JA 4FW1A 2ETJA 1X9SA 5HRSA 4CGIA 4B9UA 2E6MA 4CGFA 3K57A 3OYBA 2HHSA 1C0TA 1IKVA 1REVA 3NF7A 4CJSA 1JLGA 1XC9A 3WNEA 3LWLA 3H08A 1TKDA 3G0ZA 2DFEA 4Y1CA 1NK7A 1FKPA 3D0PA 3RR7A 3KJVA 3F9KA 4CGHA 1Q9XA 4ELVA 1LAWA 5CZ1A 2O4GA 1IO2A 4DU3A 1JXEA 3M8PA 3K58A 3AA3A 1U04A 3MEDA 4CHOA 3V9SA 1NK8A 3QEVA 1W0HA 2Y1JA 3LP0A 4CFDA 4KHQA 2FBXA 1L3UA 2W42A 3VA3A 3SQ4A 2P1JA 4IBNA 5CYMA 2HVIA 3JSMA 3BDPA 4FK0A 2F96A 3K5LA 4N56A 4F3OA 4B08A 2G8IA 5FRMA 4O4GA 4Z4HA 4H8KA 3AA4A 4FJ9A 3AVFA 4HVJA 3NHGA 4LH5A 4CFBA 4FJXA 4B3OA 4CIGA 2HVHA 1BIUA 2OYQA 1S6PA 3NH2A 3V6DA 3NCIA 1RTJA 3VQQA 5KGWA 4OLBA 3OYGA 3PX0A 5FRNA 4CE9A 4CJ3A 4FM2A 1NJZA 4KHWA 5D3GA 2B6AA 1WSGA 4OPJA 3AO5A 1WSJA 3NF8A 1NK5A 1WAJA 3OY9A 3QNNA 4GW6A 3O3GA 2RPIA 4B8CA 4CEFA 4CESA 3DLHA 4M41A 4R5PA 1NK6A 3LP1A 1VSKA 3QIPA 5DK5A 4CECA 2FBYA 4ID1A 3V1QA 4YNQA 3V9XA 4KI4A 4DQSA 3QEXA 5I42A 3SI6A 3VQBA 1LV5A 3KLHA 4WE1A 5J2PA 4FM1A 2B4JA 4ELUA 1C0UA 3DM2A 4NCAA 3RMBA 1C1CA 4LSNA 3HJFA 4J2DA 3AVJA 3D45A 3AVMA 3LANA 2VWJA 4BDYA 2Z1GA 3SV4A 1HYSA 2RN2A 2OA8A 4CFCA 3KIOA 2HHVA 2HB5A 3LWMA 4M45A 2QK9A 3NGIA 3MXIA 3LPTA 1KVCA 3LALA 2IOCA 4DU1A 4H4OA 2NUBA 4BWJA 3TABA 3B6PA 3DI6A 4CF2A 2LSNA 4NCGA 5HRPA 3NDKA 4E7KA 4HUFA 2B5JA 1LWCA 1TL3A 1RBSA 4C8LA 3SUNA 2PZSA 3DRRA 3QEIA 1U4BA 4PWDA 1ASUA 4RW8A 4CJKA 5J2QA 4FLXA 1CZBA 4RW6A 3JYTA 1NJXA 3CFPA 4Z4CA 2D0AA 2XO7A 4FJ5A 1VSJA 4DSJA 1GOBA 4DQRA 2Q3SA 4N41A 1KLMA 3OYNA 4CK2A 3TARA 1CLQA 4CF9A 3S3OA 3HP9A 3HYFA 1D9DA 1U45A 2BGGA 1JXBA 3PO5A 1KFDA 3AO2A 4Y1DA 3MAQA 1YVUA 2X6SA 5KGXA 1A5XA 4J2BA 1BQMA 1WSEA 3AVKA 4RW9A 1NK9A 2GUIA 5HBMA 1YTAA 1J5OA 4RW7A 1MU2A 3AVNA 2IS3A 4GMJB 5T7BA 4FLYA 3V9WA 5J2MA 1JLFA 3PV8A 2YHAA 3HPGA 1VSDA 4CJRA 2AJQA 1BIZA 3SZ2A 3K5MA 1YT3A 3L3VA 3QNOA 1NKCA 2OPQA 4C8KA 4DFJA 5EU7A 2X78A 4CHPA 3DRPA 2HHWA 4DFMA 2YNIA 4FM0A 4E7JA 3ZSWA 4DF4A 4ICLA 3OJUA 4DF8A 3THVA 1IKWA 3ZT2A 4CHZA 1CZ9A 4B9VA 1RDAA 1S1WA 4CJWA 3LPUA 4DS4A 5I3UA 1U49A 3RR8A 3EZ5A 4NYNA 4FCYA 3HM9A 1HJRA 1K6YA 4DSKA 4FJIA 3NGZA 3KLEA 4IFVA 1UOCA 4O44A 4BE2A 2RKIA 3OYFA 3KD1E 3AVHA 3EYZA 3CG7A 1IH7A 2EX3A 3U3GA 1LWFA 4CHNA 1Z26A 3SQ1A 4HHTA 1SL0A 3HK2A 4FLTA 3OS0A 1RTHA 3P5JA 1CXUA 1FK9A 1D9FA 4RW4A 4FJJA 3K5NA 1BQNA 1DTQA 3PO4A 2VG5A 2WOMA 1BGXT 4CK3A 4OKKA 4TSXA 2R7YA 3MXMA 2QXFA 4AILC 4DQPA 4B9LA 3K5OA 2E6LA 3OYHA 4FLUA 1X1PA 2HNZA 3OYEA 4E7LA 1SL1A 1N5YA 2A1SA 4KFBA 3CQ8A 3FFIA 3AVBA 3KK1A 3LZIA 3OYDA 4M42A 1B9DA 4FJ7A 3ZSYA 2ATQA 1KVBA 3HVRA 2OPRA 4CJ5A 1L3TA 3VQAA 4CJ4A 4BE1A 3KTQA 1TK5A 4J2EA 4KO0A 1LW0A 4FZXC 2KFZA 2VG7A 2XY8A 1IG9A 1QHTA 1TKXA 4B9MA 4MFBA 4KHNA 3RWUA 4AHTA 1XI1A 4Z0UA 3A2FA 2F8TA 1TKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DFF A;  3C95 A;  1B9F A;  1ZYQ A;  3VQP A;  3RMA A;  3V1O A;  4E19 A;  4M3X A;  1WN7 A;  4KHY A;  4O5B A;  4Q0B A;  3AVI A;  3KK3 A;  1QSL A;  4Z4F A;  1WSH A;  3U3Y A;  4EP5 A;  5E41 A;  4ZHR A;  3RTV A;  4EZ9 A;  3RRG A;  4OGE A;  4KHS A;  1XHZ A;  3QO9 A;  3F73 A;  1JL1 A;  3SV3 A;  3V9U A;  4DS5 A;  1I39 A;  4DTO A;  4M3U A;  4ID5 A;  1VSL A;  3LP3 A;  4I2P A;  1JLE A;  4N5S A;  4CGJ A;  3IG1 A;  4OPK A;  4FW2 A;  3L2Q A;  3M8R A;  3QET A;  1KFS A;  1SV5 A;  1RT7 A;  1SKR A;  1RTD A;  2HHT A;  2KZZ A;  3T3F A;  3VQ8 A;  3T1A A;  3AA2 A;  3K59 A;  4BDP A;  3VQC A;  2XY5 A;  3SUP A;  4W5T A;  3KLF A;  3AV9 A;  4CCH A;  1VSE A;  3SPZ A;  1X9W A;  4F8R A;  4F3T A;  2A1R A;  3OYI A;  4QAG A;  3CYM A;  3SYZ A;  4KRE A;  3O3H A;  4PQU A;  4DFK A;  4DTP A;  4CED A;  1U47 A;  3MEG A;  3DLE A;  3HPH A;  3ULD A;  3S9H A;  2XY7 A;  3LDS A;  3OYM A;  1RBV A;  1TAQ A;  2OPP A;  1UAX A;  3AVA A;  4Z4G A;  2OZS A;  4FLZ A;  5C42 A;  3U6F A;  1NK4 A;  3OYC A;  3L2U A;  1A5V A;  1S1T A;  3QLH A;  1SKW A;  1TK0 A;  5SWM A;  1XHX A;  4HCB A;  4M3W A;  3DLG A;  4KTW A;  4DSF A;  4CF1 A;  3RMD A;  2GV9 A;  3UIQ A;  1Z25 A;  4IG3 A;  4DLE A;  1KRP A;  1RCH A;  4FK4 A;  4LH4 A;  1KTQ A;  1T8E A;  2HW3 A;  3MXJ A;  3VQE A;  1JKH A;  4ZTF A;  4W5N A;  2E4L A;  3SPY A;  4FZZ A;  1JLB A;  1BHL A;  4AH9 A;  1D5A A;  3SQ0 A;  3VQD A;  1EP4 A;  3WNG A;  2YNG A;  4B9S A;  1TKT A;  5KI6 A;  4F4K A;  4CGD A;  3ZSQ A;  4HUG A;  1RT2 A;  4DQI A;  4NYF A;  4K8X A;  3C6U A;  3QEW A;  1QQC A;  2XRI A;  3DLR A;  1RT4 A;  4W5R A;  1ZBI A;  2DTU A;  4FYD A;  1QTM A;  4DLG A;  1NKE A;  3KK2 A;  1Q8I A;  3TI0 A;  3C94 A;  1C1A A;  4E7H A;  1RBU A;  1ASV A;  1J9A A;  3G10 A;  3I8D A;  1R0A A;  4J2A A;  3O3F A;  4JS5 A;  4JS4 A;  5CYQ A;  4KV8 A;  3CM5 A;  1S1X A;  4IDK A;  3QES A;  1NJW A;  4GVM A;  2D0B A;  4FJ8 A;  5J2N A;  1Y97 A;  3I0R A;  2G8K A;  4FJH A;  2ZD1 A;  2G8V A;  3WNF A;  3IS9 A;  4KI6 A;  4Z4I A;  1NK0 A;  3NFA A;  3SCX A;  4O55 A;  3HO1 A;  3O4N A;  1HQU A;  1JLA A;  5C25 A;  4KB1 A;  4CF8 A;  2HHU A;  1NOZ A;  1RNH A;  4BWM A;  1VRT A;  2YKN A;  1SKS A;  1B92 A;  3QIO A;  1HQE A;  3VQ7 A;  2XY6 A;  3OYL A;  4FK2 A;  4DTU A;  2ZE2 A;  2BAN A;  3AVG A;  3TR8 A;  1QSY A;  4CHQ A;  4KTQ A;  4QCL A;  4AHV A;  1L5U A;  5FRO A;  5J1E A;  1TV6 A;  2VG6 A;  4DTJ A;  3TAN A;  3L2R A;  5HLF A;  2G8U A;  3PX4 A;  3ZSO A;  4CFA A;  2BDP A;  3NGY A;  2G8W A;  3IAY A;  4FXD A;  4DSI A;  4OLA A;  3MEC A;  3DOK A;  1EXQ A;  2ITG A;  1S5J A;  1KLN A;  2BE2 A;  3KLI A;  3PY8 A;  3SNN A;  2Z1J A;  4RG8 A;  4DTN A;  1WLJ A;  4I9L A;  3DLB A;  4E3S A;  1RBT A;  4IG0 A;  3NF6 A;  3KD5 E;  4CJQ A;  1S6Q A;  2KQ2 A;  3DRS A;  3V1R A;  3VQ9 A;  1U48 A;  4UQG A;  1Q9Y A;  4F2S A;  4L8R B;  1W9H A;  4CEO A;  4FJG A;  4CER A;  3BGR A;  2P5O A;  5K14 A;  3CFO A;  4FJL A;  3C6T A;  3QEP A;  1BI4 B;  1L3S A;  1HYV A;  2P5G A;  4KHU A;  3HL8 A;  4AHU A;  3RRH A;  2X6N A;  4CJE A;  4KRF A;  2KW4 A;  3QIN A;  5C24 A;  4OKJ A;  1T03 A;  4FJM A;  3IRX A;  4ELT A;  4M3Z A;  2DY4 A;  4DFP A;  2Y1I A;  2Z1H A;  3O4Q A;  3HST B;  2YHB A;  3L8B A;  2QKK A;  3HXM A;  3E01 A;  3L3U A;  3NF9 A;  3ZT0 A;  1WSI A;  5JS2 A;  4XIU A;  3HVT A;  3TAF A;  1IKY A;  4DSL A;  4DSE A;  2FBV A;  1GOC A;  3AVC A;  4FLW A;  5HP1 A;  3AO1 A;  4CJF A;  4JRQ A;  4C8M A;  2PYL A;  2P51 A;  4NCB A;  3MEE A;  2Z1I A;  4B8A B;  2O4I A;  1HPZ A;  4OKE A;  3V81 A;  3WNH A;  1N6Q A;  3ITH A;  1LAV A;  1BIS A;  5KRS A;  3TWH A;  3VN5 A;  4AHS A;  4I9Q A;  1S1U A;  3PX6 A;  4B9N A;  1ZBH A;  4IFY A;  4CIE A;  2EHG A;  3S3M A;  2G8F A;  4OJR A;  5CY4 A;  4OGC A;  1VRU A;  4LSL A;  1TGO A;  1DLO A;  4H4M A;  3NH1 A;  3B6O A;  3ZSZ A;  3NH0 A;  2JGU A;  3M8Q A;  3S3N A;  4E1M A;  4C8O A;  3ZT4 A;  1RDD A;  1VSM A;  4BAC A;  5DMR A;  1RTI A;  3CFR A;  3VA0 A;  2IDO A;  1KCF A;  4CJV A;  2PY5 A;  4KPY A;  2IAJ A;  3TAQ A;  3AA5 X;  3T19 A;  4YFU A;  5KRT A;  4CF0 A;  3ZT1 A;  1WNS A;  3LP2 A;  4CJU A;  1BI4 A;  4KB0 A;  1VK0 A;  4Z4E A;  5JS1 A;  1VSH A;  2YNH A;  4MQ3 A;  3ASM A;  4DU4 A;  4CK1 A;  3VQ5 A;  3SJJ A;  4E7I A;  4CEB A;  3DOL A;  4N47 A;  4FJK A;  2WON A;  3ZSV A;  4E89 A;  4M3R A;  4DMN A;  3M8S A;  1TAU A;  4DTR A;  3TAM A;  3DYA A;  1EX4 A;  1EET A;  3LAM A;  2YV0 X;  1C1B A;  1RDB A;  2D5R A;  1BCM A;  1T7P A;  1WSF A;  2VWK A;  3LZJ A;  4CEA A;  1TVR A;  1C0M A;  4CJT A;  3NAE A;  5SZT A;  4DG1 A;  4O0I A;  4Q5V A;  3SUO A;  4HUE A;  4AHR A;  3VQ4 A;  4CEE A;  1HYZ A;  1XWL A;  3EY1 A;  3AVL A;  3ISN C;  4EZ6 A;  4QOZ B;  2OPS A;  4FZY A;  4F2R A;  1HMV A;  4KAZ A;  1QSS A;  1ASW A;  4O0J A;  4K8Z A;  4N76 A;  1S9G A;  4I7F A;  2PYJ A;  1O1W A;  2HHQ A;  1F21 A;  4JLH A;  4CJL A;  1BL3 A;  3KKR A;  2ZQB A;  1G15 A;  4CHY A;  2HND A;  1ITG A;  4W5Q A;  2OZM A;  4E0D A;  4PY5 A;  2D0C A;  1S1V A;  3TAP A;  4DWI A;  4B9T A;  5FDL A;  2IGI A;  1BCO A;  1JLC A;  1RT5 A;  4BDZ A;  2JLE A;  2YNF A;  4CGG A;  1I3A A;  3ZCM A;  3KLG A;  1LWE A;  3QER A;  3AO3 A;  1FXX A;  1KVA A;  3K2P A;  4G1Q A;  4C8N A;  4DQQ A;  3DLK A;  1KSP A;  1J54 A;  1QE1 A;  3NE6 A;  2IC3 A;  4PUO A;  4IKF A;  3L2V A;  1HNI A;  1RT3 A;  3P1G A;  1NKB A;  2F8S A;  4KKO A;  3HP6 A;  2KFN A;  1J53 A;  4I2Q A;  2FBT A;  4AHC A;  4PA1 A;  3KKS A;  3OJS A;  4DTM A;  1SL2 A;  3V9Z A;  3TAG A;  5HRO A;  1VSF A;  1HRH A;  1RT6 A;  3ZSX A;  1TL1 A;  3ZT3 A;  5KTQ A;  1GOA A;  1ZBU A;  4HTU A;  1ZBL A;  4FLV A;  2HHX A;  3RMC A;  1IKX A;  1QS4 A;  1WAF A;  1C6V A;  3LAK A;  4E1N A;  3HT3 A;  3VQ6 A;  3I0S A;  4M3Y A;  3OS2 A;  1CXQ A;  1RBR A;  4KTZ A;  3OYA A;  1JL2 A;  4BE0 A;  1YTU A;  2X74 A;  4W5O A;  4LD0 A;  1A5W A;  3OS1 A;  1T05 A;  3OYK A;  3SUQ A;  3HPO A;  1X9M A;  1NOY A;  4ZTJ A;  3PUF A;  4CIF A;  1ZBF A;  1UWB A;  4CEZ A;  3V4I A;  1TK8 A;  2G8H A;  4EP4 A;  3NBP A;  2FC0 A;  3ALY A;  1RT1 A;  3CM6 A;  2YKM A;  2DFH A;  5CZ2 A;  4FVM A;  2GBZ A;  1D8Y A;  4CJP A;  2XHB A;  4JRP A;  3DMJ A;  2KZM A;  4OVL A;  4DTS A;  3AO4 A;  3TAE A;  1UA0 A;  4LY7 A;  1VSI A;  3P83 D;  4DTX A;  1L3V A;  2HNY A;  3OYJ A;  1RIL A;  5HRR A;  2HMI A;  1FKO A;  1RDC A;  1S9E A;  1UA1 A;  1JLQ A;  3SQ2 A;  3L2W A;  4M3T A;  1SUQ A;  1LW2 A;  2QKB A;  3OVN A;  1HNV A;  4CEQ A;  1EKE A;  2RF2 A;  5HRN A;  1NJY A;  4FJN A;  3ZSR A;  1DTT A;  4HCC A;  2KTQ A;  2I5J A;  4FW1 A;  2ETJ A;  1X9S A;  5HRS A;  4CGI A;  4B9U A;  2E6M A;  4CGF A;  3K57 A;  3OYB A;  2HHS A;  1C0T A;  1IKV A;  1REV A;  3NF7 A;  4CJS A;  1JLG A;  1XC9 A;  3WNE A;  3LWL A;  3H08 A;  1TKD A;  3G0Z A;  2DFE A;  4Y1C A;  1NK7 A;  1FKP A;  3D0P A;  3RR7 A;  3KJV A;  3F9K A;  4CGH A;  1Q9X A;  4ELV A;  1LAW A;  5CZ1 A;  2O4G A;  1IO2 A;  4DU3 A;  1JXE A;  3M8P A;  3K58 A;  3AA3 A;  1U04 A;  3MED A;  4CHO A;  3V9S A;  1NK8 A;  3QEV A;  1W0H A;  2Y1J A;  3LP0 A;  4CFD A;  4KHQ A;  2FBX A;  1L3U A;  2W42 A;  3VA3 A;  3SQ4 A;  2P1J A;  4IBN A;  5CYM A;  2HVI A;  3JSM A;  3BDP A;  4FK0 A;  2F96 A;  3K5L A;  4N56 A;  4F3O A;  4B08 A;  2G8I A;  5FRM A;  4O4G A;  4Z4H A;  4H8K A;  3AA4 A;  4FJ9 A;  3AVF A;  4HVJ A;  3NHG A;  4LH5 A;  4CFB A;  4FJX A;  4B3O A;  4CIG A;  2HVH A;  1BIU A;  2OYQ A;  1S6P A;  3NH2 A;  3V6D A;  3NCI A;  1RTJ A;  3VQQ A;  5KGW A;  4OLB A;  3OYG A;  3PX0 A;  5FRN A;  4CE9 A;  4CJ3 A;  4FM2 A;  1NJZ A;  4KHW A;  5D3G A;  2B6A A;  1WSG A;  4OPJ A;  3AO5 A;  1WSJ A;  3NF8 A;  1NK5 A;  1WAJ A;  3OY9 A;  3QNN A;  4GW6 A;  3O3G A;  2RPI A;  4B8C A;  4CEF A;  4CES A;  3DLH A;  4M41 A;  4R5P A;  1NK6 A;  3LP1 A;  1VSK A;  3QIP A;  5DK5 A;  4CEC A;  2FBY A;  4ID1 A;  3V1Q A;  4YNQ A;  3V9X A;  4KI4 A;  4DQS A;  3QEX A;  5I42 A;  3SI6 A;  3VQB A;  1LV5 A;  3KLH A;  4WE1 A;  5J2P A;  4FM1 A;  2B4J A;  4ELU A;  1C0U A;  3DM2 A;  4NCA A;  3RMB A;  1C1C A;  4LSN A;  3HJF A;  4J2D A;  3AVJ A;  3D45 A;  3AVM A;  3LAN A;  2VWJ A;  4BDY A;  2Z1G A;  3SV4 A;  1HYS A;  2RN2 A;  2OA8 A;  4CFC A;  3KIO A;  2HHV A;  2HB5 A;  3LWM A;  4M45 A;  2QK9 A;  3NGI A;  3MXI A;  3LPT A;  1KVC A;  3LAL A;  2IOC A;  4DU1 A;  4H4O A;  2NUB A;  4BWJ A;  3TAB A;  3B6P A;  3DI6 A;  4CF2 A;  2LSN A;  4NCG A;  5HRP A;  3NDK A;  4E7K A;  4HUF A;  2B5J A;  1LWC A;  1TL3 A;  1RBS A;  4C8L A;  3SUN A;  2PZS A;  3DRR A;  3QEI A;  1U4B A;  4PWD A;  1ASU A;  4RW8 A;  4CJK A;  5J2Q A;  4FLX A;  1CZB A;  4RW6 A;  3JYT A;  1NJX A;  3CFP A;  4Z4C A;  2D0A A;  2XO7 A;  4FJ5 A;  1VSJ A;  4DSJ A;  1GOB A;  4DQR A;  2Q3S A;  4N41 A;  1KLM A;  3OYN A;  4CK2 A;  3TAR A;  1CLQ A;  4CF9 A;  3S3O A;  3HP9 A;  3HYF A;  1D9D A;  1U45 A;  2BGG A;  1JXB A;  3PO5 A;  1KFD A;  3AO2 A;  4Y1D A;  3MAQ A;  1YVU A;  2X6S A;  5KGX A;  1A5X A;  4J2B A;  1BQM A;  1WSE A;  3AVK A;  4RW9 A;  1NK9 A;  2GUI A;  5HBM A;  1YTA A;  1J5O A;  4RW7 A;  1MU2 A;  3AVN A;  2IS3 A;  4GMJ B;  5T7B A;  4FLY A;  3V9W A;  5J2M A;  1JLF A;  3PV8 A;  2YHA A;  3HPG A;  1VSD A;  4CJR A;  2AJQ A;  1BIZ A;  3SZ2 A;  3K5M A;  1YT3 A;  3L3V A;  3QNO A;  1NKC A;  2OPQ A;  4C8K A;  4DFJ A;  5EU7 A;  2X78 A;  4CHP A;  3DRP A;  2HHW A;  4DFM A;  2YNI A;  4FM0 A;  4E7J A;  3ZSW A;  4DF4 A;  4ICL A;  3OJU A;  4DF8 A;  3THV A;  1IKW A;  3ZT2 A;  4CHZ A;  1CZ9 A;  4B9V A;  1RDA A;  1S1W A;  4CJW A;  3LPU A;  4DS4 A;  5I3U A;  1U49 A;  3RR8 A;  3EZ5 A;  4NYN A;  4FCY A;  3HM9 A;  1HJR A;  1K6Y A;  4DSK A;  4FJI A;  3NGZ A;  3KLE A;  4IFV A;  1UOC A;  4O44 A;  4BE2 A;  2RKI A;  3OYF A;  3KD1 E;  3AVH A;  3EYZ A;  3CG7 A;  1IH7 A;  2EX3 A;  3U3G A;  1LWF A;  4CHN A;  1Z26 A;  3SQ1 A;  4HHT A;  1SL0 A;  3HK2 A;  4FLT A;  3OS0 A;  1RTH A;  3P5J A;  1CXU A;  1FK9 A;  1D9F A;  4RW4 A;  4FJJ A;  3K5N A;  1BQN A;  1DTQ A;  3PO4 A;  2VG5 A;  2WOM A;  1BGX T;  4CK3 A;  4OKK A;  4TSX A;  2R7Y A;  3MXM A;  2QXF A;  4AIL C;  4DQP A;  4B9L A;  3K5O A;  2E6L A;  3OYH A;  4FLU A;  1X1P A;  2HNZ A;  3OYE A;  4E7L A;  1SL1 A;  1N5Y A;  2A1S A;  4KFB A;  3CQ8 A;  3FFI A;  3AVB A;  3KK1 A;  3LZI A;  3OYD A;  4M42 A;  1B9D A;  4FJ7 A;  3ZSY A;  2ATQ A;  1KVB A;  3HVR A;  2OPR A;  4CJ5 A;  1L3T A;  3VQA A;  4CJ4 A;  4BE1 A;  3KTQ A;  1TK5 A;  4J2E A;  4KO0 A;  1LW0 A;  4FZX C;  2KFZ A;  2VG7 A;  2XY8 A;  1IG9 A;  1QHT A;  1TKX A;  4B9M A;  4MFB A;  4KHN A;  3RWU A;  4AHT A;  1XI1 A;  4Z0U A;  3A2F A;  2F8T A;  1TKZ A; 
#chains in the Genus database with same CATH topology
 3C95 A;  1B9F A;  4AM7 A;  4E19 A;  1WN7 A;  4KHY A;  3VER A;  3AVI A;  5JVH L;  4BY9 C;  3U3Y A;  4ZHR A;  5MLC Q;  2KKZ A;  3QO9 A;  1HPM A;  2ASO A;  4YOY A;  4CW7 B;  1VSL A;  4BR0 A;  3LP3 A;  4I2P A;  4N5S A;  2WFB A;  4O8U A;  4CGJ A;  3IG1 A;  1RDU A;  4OPK A;  4FW2 A;  3M8R A;  1RT7 A;  1HNX K;  2UUB K;  3ZX3 A;  3VQ8 A;  3CIP A;  1WUA A;  3T1A A;  4BDP A;  3M3Z A;  4F8R A;  4JYA K;  4F3T A;  2A40 A;  1HUX A;  4PQU A;  3DLE A;  4DV5 K;  1W2B M;  3LDS A;  3MN7 A;  3UKR A;  1OVQ A;  3OYM A;  2O8E A;  4Z4G A;  4FL9 A;  2OZS A;  4FLZ A;  3U6F A;  3OYC A;  1A5V A;  4M3W A;  3VGM A;  3R3L A;  4DLE A;  2FXU A;  1JJ2 M;  4FWO A;  4JKB A;  1JKH A;  4W5N A;  1K8A O;  1JLB A;  1Z05 A;  4BRF A;  1D5A A;  2YNG A;  4F4K A;  4CGD A;  3ZSQ A;  4HUG A;  4DQI A;  3R1X A;  5M1N A;  2P9K A;  2XRI A;  1VQL N;  2DTU A;  1WBB A;  3TI0 A;  3ULE B;  3WT0 A;  4IDH A;  3I8B A;  1J9A A;  4JS4 A;  1Q86 O;  5IT9 O;  3QES A;  5AQU A;  4H0P A;  2VWB A;  3I0R A;  4CVN E;  1VQM N;  3SCX A;  4O55 A;  5C12 A;  3WXK A;  1JLA A;  4H5N A;  3ATU A;  3QIO A;  3OYL A;  1QSY A;  4KTQ A;  2HBL A;  4AHV A;  3THW B;  5J1E A;  2PBD A;  5BRF A;  2VG6 A;  4NLB A;  2VQF K;  2BDP A;  3L2R A;  4CFA A;  2G8W A;  1KLN A;  1S5J A;  2BE2 A;  3KLI A;  1YJN N;  2Z1J A;  5GIN A;  1U48 A;  3VQ9 A;  1Q9Y A;  4CEO A;  2P5O A;  3C6T A;  3QEP A;  2P5G A;  1HYV A;  4AHU A;  1DKG D;  4XEI A;  2Y1I A;  3HST B;  3ZT0 A;  1WSI A;  4IWV A;  1IKY A;  1HR0 K;  2P9S B;  4FLW A;  4C8M A;  4JV5 K;  4OKE A;  3WNH A;  3ITH A;  5DM7 L;  3O80 A;  3KVG A;  1S1U A;  1ZBH A;  2EHG A;  1KAX A;  1VRU A;  4LSL A;  1YHQ N;  3NH0 A;  2JGU A;  3I55 N;  2V7Z A;  3SJH A;  3CFR A;  4CJV A;  1NMN A;  2PY5 A;  2IVO A;  4A2A A;  3AGR A;  4YFU A;  4BRQ A;  2QI2 A;  1X3N A;  1HNZ K;  3CPE A;  3ZT1 A;  4CJU A;  3HI0 A;  4KB0 A;  1VSH A;  1V4S A;  3U4L A;  3QFU A;  3C7N A;  4BR9 A;  2QWN A;  3DOL A;  1N34 K;  1RGI A;  4V19 S;  2WON A;  3ZSV A;  4M3R A;  4DTR A;  3TAM A;  3FR0 A;  4WF9 L;  3IKM A;  2YX6 A;  1RDB A;  2D5R A;  1T7P A;  5AQS A;  3LZJ A;  4CEA A;  1N32 K;  4CJT A;  1TUU A;  4K43 A;  3P39 A;  4DG1 A;  4AHR A;  3VQ4 A;  1SS6 A;  2FF6 A;  1HYZ A;  3W0L A;  4B3R K;  4O0J A;  1JCF A;  1O1W A;  2HHQ A;  1Q81 O;  4YDU A;  2YCH A;  3KKR A;  1G15 A;  2HND A;  5BN8 A;  4E0D A;  4W5Q A;  4PY5 A;  4DWI A;  1P8Z A;  5FDL A;  3LDP A;  1BCO A;  5I9E B;  3PIP L;  2H3G X;  4CGG A;  5EVZ A;  3H45 C;  3QER A;  1FXX A;  1KVA A;  4G1Q A;  1J54 A;  1NMD A;  2HMP A;  5JVG L;  1KD1 O;  1O13 A;  3BY5 A;  2FLO A;  2F8S A;  2E2O A;  1J53 A;  1V4T A;  4I2Q A;  4CZF A;  1VQO N;  4KH6 A;  2IVN A;  1HRH A;  3O8M A;  1ZBU A;  4FLV A;  2ASM A;  1IKX A;  3CF5 L;  2I7P A;  4M3Y A;  2A42 A;  5C2F A;  4J8F A;  3OS1 A;  4FSV A;  1T05 A;  3OYK A;  1IBL K;  1VQ5 N;  2HF3 A;  3QDK A;  1NOY A;  2OTJ N;  2O8E B;  3ID8 A;  1UWB A;  3V4I A;  3EL2 A;  2W6L A;  3NBP A;  1N33 K;  2HF4 A;  3ALY A;  1RT1 A;  5CZ2 A;  4JRP A;  3DMJ A;  4IO9 L;  3H1V X;  3AO4 A;  1VSI A;  3P83 D;  4DTX A;  4DR3 K;  1RDC A;  3L2W A;  3D2F B;  3OVN A;  4PKI A;  5HRN A;  4FJN A;  1DTT A;  1X9S A;  2ZF5 O;  4DV7 K;  4CGI A;  2CH5 A;  1C0T A;  1IKV A;  4C1N K;  1JLG A;  4LFB K;  3G0Z A;  3RR7 A;  4CGH A;  4ELV A;  1LAW A;  1M1K O;  1HX1 A;  1JXE A;  4M7X A;  3AA3 A;  1U04 A;  3HBT A;  4BRK A;  3MMV A;  4BG9 A;  2CGL A;  3B8A X;  2P9I B;  4JD2 A;  4KHQ A;  3KK7 A;  1YJW N;  1TUY A;  2YHX A;  3SQ4 A;  2UXD K;  3QML A;  3JSM A;  3OA9 A;  4N56 A;  4F3O A;  2G8I A;  2GWJ A;  1VQ6 N;  3AA4 A;  4DV0 K;  1E4F T;  1BIU A;  4LF7 K;  4IO8 A;  1GLC G;  3OYG A;  2AA4 A;  4CE9 A;  4CJ3 A;  3D6R A;  3O6W A;  3AO5 A;  3OY9 A;  4MDA A;  4BGA A;  4GW6 A;  3O3G A;  2RPI A;  1YIT N;  3DLH A;  3FZM A;  4OO1 J;  4G9Z A;  3LP1 A;  1VSK A;  3QIP A;  4CEC A;  1VQP N;  2GWK A;  5J2P A;  2B4J A;  1QZ5 A;  1C0U A;  1NGB A;  3DM2 A;  2ASP A;  3LAN A;  4JI5 K;  4CBU A;  3SV4 A;  2VCP A;  3KIO A;  2HB5 A;  1T6C A;  1GLJ O;  3D2F A;  4B3S K;  3NGI A;  3MXI A;  2W6K A;  1KVC A;  5TKY A;  2WTU A;  3TAB A;  1BUP A;  3DI6 A;  1QVG M;  2UUC K;  4CF2 A;  3I56 N;  4E7K A;  1KXP A;  4JI6 K;  3EKS A;  4HUF A;  1TL3 A;  4M63 C;  4JI8 K;  3T7Z A;  4JKH A;  2HST A;  2D0A A;  4RCH A;  5AQH A;  1IJJ A;  3TAR A;  3HP9 A;  3AO2 A;  2E88 A;  4BVO A;  2QWP A;  3E1Y A;  4J2B A;  3VF4 A;  1WSE A;  4RW9 A;  4JN4 A;  1NK9 A;  5HBM A;  5BPN A;  1YTA A;  1J5O A;  3V9W A;  5T7B A;  4JKC A;  1JLF A;  2FSJ A;  3VEN A;  3HPG A;  3TSQ A;  1VSD A;  3Q7B A;  1E3M A;  3QNO A;  3LM2 A;  2X78 A;  4H03 B;  4FM0 A;  5LMU K;  4DF4 A;  4DF8 A;  1CZ9 A;  1S1W A;  1JCG A;  1SAZ A;  3LPU A;  1C0G A;  5M1P A;  3H3O B;  3O08 A;  1W7A A;  3UKR B;  4NYN A;  4FCY A;  3KLE A;  3VTH A;  4BE2 A;  4X66 K;  3KD1 E;  1IH7 A;  2BTF A;  2EX3 A;  3AAQ A;  4HHT A;  3HK2 A;  4A57 A;  3DAW A;  1CXU A;  4EHT A;  4DHY A;  3FLC O;  1DTQ A;  3MCP A;  5A2Q O;  4TSX A;  3MXM A;  4FLU A;  4OLB A;  3OYE A;  1N5Y A;  3CQ8 A;  3D2E A;  4B1W B;  1BA1 A;  4JKG B;  1B9D A;  3O5B A;  2O8B A;  4NXM K;  3ZX2 A;  2ATQ A;  2OPR A;  1L3T A;  3KTQ A;  4J2E A;  4B1V A;  4DR1 K;  4KHN A;  3RWU A;  4AHT A;  1X3M A;  3RMA A;  3HSC A;  2YI1 A;  5KPR A;  4M3X A;  4O5B A;  4XH1 A;  4JK7 A;  5E41 A;  3RTV A;  3RRG A;  3H46 O;  4NLC A;  3V9U A;  4JI2 K;  4ID5 A;  4BRD A;  1W97 L;  2E2P A;  1RTD A;  2HHT A;  2KZZ A;  3T3F A;  3EE9 A;  2P9N A;  3AA2 A;  3SLC A;  3AV9 A;  1VSE A;  3SPZ A;  2YHW A;  1XC3 A;  2D4W A;  4FWL A;  3O3H A;  1U47 A;  3MEG A;  3ULD A;  2A41 A;  3S9H A;  1TAQ A;  5AQP A;  5C42 A;  4FOI A;  3QLH A;  1S72 N;  1XNR K;  1XHX A;  3A5O C;  3UIQ A;  1Z25 A;  4IG3 A;  1KRP A;  1KTQ A;  1E4G T;  4ZTF A;  1OH5 A;  2E4L A;  1BHL A;  4BRN A;  4B9S A;  1TKT A;  5KI6 A;  4K8X A;  1RT2 A;  1NLV A;  4ISG A;  3O1W A;  3DLR A;  1RT4 A;  4W5R A;  1ZBI A;  1QTM A;  3SBT A;  5FLX O;  4CD1 A;  3KK2 A;  5HL7 L;  4DV3 K;  3T1Y K;  4WYB A;  3TU5 A;  4E7H A;  5AQT A;  4BR7 A;  1IBM K;  3G10 A;  3I8D A;  4O8K A;  2V52 B;  3THW A;  4JS5 A;  5CYQ A;  4FPB A;  3CJ1 A;  4FJ8 A;  2ZWH A;  4A62 A;  4A5B A;  5J2N A;  3TSP A;  4Z4I A;  4KB1 A;  1YJ9 N;  1NGF A;  1NOZ A;  1RNH A;  3DWL A;  3VQ7 A;  1M90 O;  4DTU A;  2ZE2 A;  3VEV A;  3TR8 A;  4CHQ A;  3MX5 A;  1NNE A;  3ZSO A;  4DSI A;  3CI5 A;  1DEJ A;  3VET A;  4DV2 K;  1RBT A;  2PFU A;  4IG0 A;  3KD5 E;  1KAY A;  1JCE A;  2KLA A;  4OX9 K;  1L3S A;  2HHH K;  1BI4 B;  2V7Y A;  1RDW X;  3M6G A;  2X6N A;  4B3T K;  2GEL A;  2KW4 A;  1T03 A;  3IRX A;  4DFP A;  1MWM A;  2YHB A;  3VEX A;  4EFH A;  3L3U A;  3NF9 A;  3TAF A;  1CZA N;  2FBV A;  1GOC A;  4YOW A;  4CJF A;  3W3D A;  2P51 A;  3THY B;  4B8A B;  3V81 A;  1BIS A;  3TWH A;  3VN5 A;  4I9Q A;  3PX6 A;  4B9N A;  4IFY A;  4CZI A;  5CY4 A;  4OGC A;  3CCS N;  1TGO A;  1DLO A;  3NH1 A;  3ZSZ A;  4X62 K;  3S3N A;  3VEO A;  4C8O A;  1RDD A;  2ITM A;  3RSE A;  4BAC A;  5DMR A;  1RTI A;  2QKB A;  2IDO A;  2JWK A;  2W41 A;  3U9D A;  1BOT O;  2J4R A;  5BRH A;  3VGK A;  3LP2 A;  1VK0 A;  4MQ3 A;  4JI3 K;  3E9O A;  4E7I A;  3CJC A;  4CEB A;  3CC4 N;  4CBX A;  1NBW A;  4NB4 A;  1BCM A;  5AZJ A;  1K8K B;  4OPH A;  1TVR A;  3CET A;  5SZT A;  4Q5V A;  5AQI A;  4QOZ B;  3VEW A;  4K8Z A;  3E9P A;  1S3X A;  1S9G A;  3C65 A;  4CJL A;  1BL3 A;  2D0C A;  3TAP A;  3MX2 A;  3OBW A;  1RT5 A;  2YNF A;  1ZC6 A;  1VAZ A;  1LWE A;  4C8N A;  3K2P A;  1C0F A;  3DLK A;  3NE6 A;  2IC3 A;  5AQV A;  3P1G A;  4HTL A;  1NGI A;  4JI0 K;  2KFN A;  4DTM A;  4AHC A;  1SL2 A;  3AGK A;  1VSF A;  3IUC A;  3ZSX A;  1RT6 A;  3TTF A;  5KTQ A;  1GOA A;  1ZBL A;  4DKW A;  2HHX A;  4H0O A;  1QS4 A;  2NRW A;  4JK8 A;  4K42 A;  3VQ6 A;  3I0S A;  1RBR A;  3VF2 A;  1JL2 A;  4W5O A;  4LD0 A;  4KBO A;  3QFP A;  5M1O A;  1X9M A;  3ID6 A;  4DR2 K;  1ZBF A;  4CEZ A;  3HOS A;  3VES A;  5F2R A;  4EP4 A;  2FC0 A;  3CM6 A;  2YKM A;  2GBZ A;  1D8Y A;  2KZM A;  4FOE A;  4OVL A;  5BRE A;  4DTS A;  4A5A A;  2IVP A;  3TAE A;  1UA0 A;  4LY7 A;  3K9K A;  1L3V A;  5KQD A;  1HJO A;  3NVM A;  1EWQ A;  4BRA A;  5HRR A;  4WQ5 A;  1UA1 A;  1JLQ A;  3FFK B;  3SQ2 A;  3FGU A;  4M3T A;  3ULE A;  1LW2 A;  1HNV A;  5M1K A;  1EKE A;  4JK9 A;  1N8R O;  3EZW A;  3ZSR A;  2QWR A;  1YXQ A;  4NO7 A;  1NGJ A;  5C2D A;  4CGF A;  3OYB A;  1FW6 A;  3H08 A;  4Y1C A;  1NK7 A;  3D0P A;  4DU3 A;  5GAE P;  3K58 A;  3UKU B;  2P9L A;  1HKG A;  2CGJ A;  4CHO A;  2E1Z A;  1VQ9 N;  3V9S A;  2QWL A;  4BRP A;  2W42 A;  1HKC A;  3VA3 A;  3L6Q A;  3E66 A;  2HVI A;  4FWP A;  4BRO A;  4GV6 A;  2P9U B;  3WXM B;  4B08 A;  2E1Y A;  4B1U B;  5FRM A;  4FJ9 A;  3AVF A;  4HVJ A;  4FJX A;  4B3O A;  4CIG A;  2OYQ A;  1S6P A;  3NH2 A;  2VYP A;  2O8C B;  1XUP O;  2ZGY A;  5GIP A;  3CQY A;  4ILH A;  2B6A A;  5AQO A;  4QS7 A;  4DCH A;  4CES A;  1HKB A;  3L4I A;  1NK6 A;  2F4V K;  4BR2 A;  3V1Q A;  3V9X A;  4KI4 A;  3QEX A;  5I42 A;  3GBT A;  4WE1 A;  4JHD A;  3ZEU B;  1C1C A;  1OVY A;  4BQL A;  4HWI A;  3D45 A;  3AVM A;  2RN2 A;  4CFC A;  2HHV A;  5LJW A;  4M45 A;  4H0V B;  4IFE A;  3WEE B;  3CQX A;  3LPT A;  4DU1 A;  3IFR A;  5AQK A;  4H4O A;  2NUB A;  4BWJ A;  4BQZ A;  3B6P A;  4PHT X;  3VEY A;  2V51 B;  1LWC A;  1RBS A;  4JI1 K;  3SUN A;  3DRR A;  3QEI A;  3BZC A;  3DXK A;  4PWD A;  5AQN A;  1ASU A;  5FPN A;  2NRR A;  4FLX A;  3JYT A;  4ISF A;  4I6M B;  2FF3 B;  3O9U A;  1D4X A;  4FJ5 A;  1VSJ A;  4FWK A;  1GOB A;  3VMF B;  3CCV N;  2HBK A;  1KLM A;  1CLQ A;  2OCE A;  4MO5 A;  3HYF A;  4CF9 A;  3S3O A;  1U45 A;  5TKW A;  1JXB A;  3CCJ N;  2VGM A;  4CZK A;  3E9L A;  2X6S A;  1BQM A;  3SBG A;  2GUI A;  3OTO K;  4GMJ B;  4H5T A;  3L4Q A;  1IV0 A;  2AJQ A;  3D7E O;  5F0X A;  5DM6 L;  1NKC A;  2OPQ A;  2UYT A;  1BA0 A;  3P31 A;  4DFJ A;  4CHP A;  4BVP A;  4RWT A;  3TSU A;  1S22 A;  1TYQ A;  3PLA A;  4ICL A;  1IKW A;  4B9V A;  2HBJ A;  4DS4 A;  2QXL A;  3ZET A;  5I3U A;  2Q36 A;  3EZ5 A;  4DSK A;  1K6Y A;  3NGZ A;  4IOA L;  5FPM A;  4JKF A;  3AVH A;  4FWR A;  3CG7 A;  3EYZ A;  1X9J A;  4QS8 A;  1LWF A;  5JMV A;  1Z26 A;  3SQ1 A;  1K9M O;  1SL0 A;  4FLT A;  3OS0 A;  1RTH A;  1YF5 L;  3ENO A;  4FJJ A;  4RW4 A;  1NGE A;  3K5N A;  2NZT A;  3PO4 A;  2WOM A;  2YJE A;  3IDH A;  1VQ4 N;  2R7Y A;  2QXF A;  1U2V B;  2E6L A;  3CCE N;  4BRI A;  3OYH A;  4E7L A;  3FFI A;  4M42 A;  3F9M A;  1KVB A;  2KFZ A;  2VG7 A;  2F9T A;  4H5W A;  3A2F A;  5BR9 A;  1ZYQ A;  1WB9 A;  3V1O A;  4Q0B A;  3KK3 A;  1QSL A;  1WSH A;  4A2B A;  4EZ9 A;  4CZL A;  2E20 A;  4IEE A;  2E8A A;  1JL1 A;  4DTO A;  1I39 A;  4M3U A;  2NRT A;  1YVN A;  4GV9 A;  4JNE A;  1JLE A;  3ZX0 A;  3L2Q A;  1WBD A;  1KFS A;  5KQ8 A;  3K59 A;  1OH8 A;  3VQC A;  3SUP A;  4CCH A;  3J80 O;  1X9W A;  2A1R A;  3OYI A;  4QAG A;  4KRE A;  3GG4 A;  4DFK A;  4DTP A;  1YAG A;  4CED A;  3HPH A;  1QQO A;  2OAN A;  2XY7 A;  2ZJP L;  1RBV A;  1UAX A;  3AVA A;  1MWK A;  1S1T A;  1SKW A;  1MA9 B;  1TK0 A;  4HCB A;  4CF1 A;  3RMD A;  2GV9 A;  3CME N;  4FK4 A;  3CJB A;  4LH4 A;  1T8E A;  4IJN A;  3MXJ A;  3SAG A;  2HW3 A;  4LF4 K;  4DB3 A;  4FZZ A;  1EWR A;  4AH9 A;  3SQ0 A;  4DUY K;  3WNG A;  3HRG A;  3CXC M;  1T44 A;  2I7N A;  1QQC A;  2ZM6 K;  4DLG A;  3I33 A;  2F9W A;  2NRX A;  2FSN A;  1RBU A;  3EN9 A;  3FZK A;  1FJG K;  4PL7 A;  1NJW A;  2G8K A;  4YHH K;  4FJH A;  2ZD1 A;  4U67 L;  2G8V A;  3IS9 A;  4BGB A;  3NFA A;  3HO1 A;  3O4N A;  2UU9 K;  1VRT A;  2YKN A;  3MN9 A;  1SKS A;  1HQE A;  2XY6 A;  4FK2 A;  3AVG A;  4LFA K;  1XNQ K;  4ISE A;  4QCL A;  3SAH A;  4B9Q A;  4AQY K;  4LF9 K;  5AQR A;  2UUA K;  3TAN A;  3PX4 A;  5AZI A;  4DUZ K;  4OLA A;  3DOK A;  4CBW A;  2GTD A;  3SNN A;  4RG8 A;  4DTN A;  1WLJ A;  3DLB A;  4GKJ K;  3NF6 A;  4CJQ A;  1S6Q A;  2KQ2 A;  3DRS A;  3V1R A;  4L8R B;  4F2S A;  1ILY A;  3AAR A;  1Q82 O;  4CER A;  2HBM A;  3P38 A;  4FJL A;  4KHU A;  5C10 A;  3HL8 A;  3R9P A;  5HOO A;  4KRF A;  4CJE A;  3QIN A;  5C24 A;  4OKJ A;  4FJM A;  4M3Z A;  4ELT A;  4MO4 A;  4BC2 A;  3SMS A;  3L8B A;  3RSE B;  2QKK A;  5AFU H;  4GKK K;  4F9O A;  3THX A;  4BR4 A;  4A61 A;  1NGA A;  4BRH A;  2O8D A;  4DSL A;  4DSE A;  3AVC A;  5HP1 A;  3AO1 A;  4JRQ A;  5AQZ A;  3MEE A;  4EIA A;  2O4I A;  1HPZ A;  4FPA A;  5LY3 A;  1LAV A;  4AHS A;  4CIE A;  3K0S A;  2UXC K;  3LM9 A;  4H4M A;  1GLB G;  4E1M A;  5EY4 A;  4FO0 A;  1WOQ A;  3ZT4 A;  1VSM A;  4KPY A;  2Q2R A;  1KCF A;  2IAJ A;  3AA5 X;  3T19 A;  2Q0U A;  5KRT A;  4CF0 A;  1BI4 A;  1BU6 O;  2YNH A;  3ASM A;  2NRH A;  5AQF A;  3VQ5 A;  3SJJ A;  4BR5 A;  3ATV A;  5AR0 A;  4N47 A;  3S41 A;  4DMN A;  3M8S A;  3DYA A;  1EX4 A;  3VPZ A;  1EET A;  2YV0 X;  1C1B A;  4GY2 B;  4JKE A;  3NAE A;  4O0I A;  3SUO A;  3DXM B;  4CEE A;  1XWL A;  5EOY A;  3AVL A;  3ISN C;  4EZ6 A;  2OPS A;  1HMV A;  4KAZ A;  1QSS A;  4ILJ A;  2AP1 A;  1Q7Y O;  3CC2 N;  2Q97 A;  4I7F A;  1H1V A;  2PYJ A;  5ADX A;  3PIO L;  2ZQB A;  3QBW A;  5C0Y A;  1ITG A;  2OZM A;  2E2Q A;  1S1V A;  4KHP K;  2IGI A;  1JLC A;  4EHU A;  1ZXO A;  2BH1 A;  3ZCM A;  4X65 K;  3KLG A;  4C23 A;  3SMP A;  2QWM A;  1QE1 A;  3LL3 A;  4IKF A;  4JI4 K;  1HNI A;  2WBN A;  1NKB A;  2JWL A;  2A3Z A;  3HP6 A;  1ATN A;  3KKS A;  3OJS A;  3CJ9 A;  3MN5 A;  3V9Z A;  5CE3 A;  1HNW K;  3LDO A;  1TL1 A;  3ZT3 A;  1Q18 A;  3RMC A;  1C6V A;  3LAK A;  4E1N A;  3OS2 A;  4CJ7 A;  1NG9 A;  3MK6 A;  4BE0 A;  1YTU A;  2X74 A;  4FWQ A;  5AZI B;  2ZJR L;  3WXI A;  3SUQ A;  3TTD A;  4IEI A;  2P9P B;  1TK8 A;  3JXU A;  3VF6 A;  4IOC L;  4FVM A;  4CJP A;  2XHB A;  4H0Y B;  2P9N B;  5KPZ A;  4FWN A;  3UE5 A;  1QQM A;  1KAZ A;  4K0K K;  3DXM A;  3FZH A;  3OYJ A;  2HMI A;  1FKO A;  1SUQ A;  3IMX A;  3WXJ A;  4CEQ A;  4DR7 K;  2RF2 A;  1NJY A;  2NNW A;  2KTQ A;  3BZK A;  4FW1 A;  3BEX A;  2ETJ A;  3MCA B;  3CD6 N;  2GEM A;  2Q1N A;  2E6M A;  3C6H A;  4CJS A;  4YOR A;  3WNE A;  3LWL A;  1XC9 A;  2O8F A;  3NVK A;  3CCQ N;  3F9K A;  3UB5 A;  2O4G A;  3WXL A;  2O8B B;  3MED A;  3GE1 A;  2Q0R A;  1NK8 A;  2Y1J A;  1W0H A;  1U2V A;  3LP0 A;  4CFD A;  1R59 O;  2O8C A;  1L3U A;  4ILG B;  4AM6 A;  1Z6R A;  5CYM A;  3MWP A;  3O9R A;  3BDP A;  4FK0 A;  2ZJQ L;  2F96 A;  1J6Z A;  2P9U A;  1ESV A;  1Y64 A;  2D0P A;  4O4G A;  5BN9 A;  1OKJ A;  5AQY A;  4H8K A;  4WCE L;  3NHG A;  4LC9 B;  2HVH A;  3EEQ A;  3NCI A;  5KGW A;  3QBX A;  4MDB A;  5AQQ A;  5FRN A;  3VOV A;  1NJZ A;  1VQ7 N;  5JIC A;  4E1J A;  1WSJ A;  1NK5 A;  3UKU A;  4CEF A;  4B8C A;  5DK5 A;  2FBY A;  4YNQ A;  2O8F B;  1LV5 A;  3VQB A;  3KLH A;  4ELU A;  2CGK A;  2E5L K;  3BF1 A;  4NCA A;  4LSN A;  3HJF A;  4J2D A;  3AVJ A;  2VWJ A;  1VHX A;  2OA8 A;  5GAH P;  4LF8 K;  2QK9 A;  4DV4 K;  3KHY A;  3LAL A;  2IOC A;  3T1H K;  3MWT A;  5HRP A;  2LSN A;  4NCG A;  3WQT A;  3CMA N;  4C8L A;  3ZYY X;  2OTL N;  2PZS A;  1U4B A;  4H5R A;  4RW8 A;  2P9P A;  1K73 O;  5J2Q A;  4RW6 A;  3CFP A;  1MDU B;  2F7T A;  4L3Q A;  4IOX A;  4JKD A;  4DQR A;  2Q31 A;  3DJC A;  2Q3S A;  4N41 A;  3BUZ B;  4CK2 A;  4WFN L;  3TTC A;  2A5X A;  3PO5 A;  1KFD A;  3H6E A;  4Y1D A;  3MAQ A;  1YVU A;  4BC3 A;  4Z94 A;  3BP8 A;  1A5X A;  3AVK A;  2UXB K;  1QZ6 A;  1MU2 A;  3AVN A;  2IS3 A;  3O9Q A;  1NU0 A;  3PV8 A;  2YHA A;  3H1Q A;  4CJR A;  1BIZ A;  3SZ2 A;  3CCL N;  4KH5 A;  1YUW A;  3LDQ A;  3DRP A;  1GLA G;  5LL6 Z;  2HHW A;  4CZG A;  4DFM A;  1OH6 A;  3KZB A;  4CJW A;  3J8A A;  4WFA L;  3TPQ A;  1NM1 A;  4GV3 A;  1U49 A;  3RR8 A;  3AAP A;  3HM9 A;  1HJR A;  2NRV A;  3O4W A;  3G4S N;  3QIC A;  4IFV A;  1UOC A;  3U8X A;  5BPM A;  2RKI A;  3DXK B;  5AQL A;  5GAD P;  4FWM A;  3U3G A;  4CD3 A;  3U9Z A;  4CHN A;  4YY3 K;  4BRE A;  1XQS C;  4B1Y B;  3BF3 A;  1BGX T;  2P9I A;  2KHO A;  3J7Z O;  4AIL C;  3K5O A;  5AQJ A;  4BG8 A;  1SL1 A;  4LF6 K;  4BRG A;  1GLE G;  2A1S A;  4KFB A;  5AZJ B;  1SQK A;  4IZ9 A;  2QM1 A;  3WQU A;  4CJ5 A;  4CJ4 A;  4BE1 A;  3ENB A;  4KO0 A;  4R79 A;  1LW0 A;  4FZX C;  1TKX A;  3EKU A;  4MFB A;  1NWK A;  1XI1 A;  4Z0U A;  2YJF A;  2F8T A;  2DFF A;  3O9T A;  3VQP A;  4Z4F A;  4EP5 A;  4JKG A;  4OGE A;  4KHS A;  1XHZ A;  3F73 A;  2HOE A;  3SV3 A;  4DS5 A;  4LF5 K;  5AQG A;  3QET A;  1SV5 A;  1SKR A;  2XY5 A;  4W5T A;  3KLF A;  3JS6 A;  5AFU A;  4U7B A;  4H5V A;  3THY A;  3CYM A;  3SYZ A;  3VEZ A;  5AJ3 K;  1J5E K;  5AQM A;  2OPP A;  3F2K A;  3THX B;  3Q7C A;  5M1Q A;  2ZGZ A;  3QB0 A;  1NK4 A;  3L2U A;  3CCR N;  4CZM A;  5SWM A;  3CJ7 A;  4BC4 A;  3DLG A;  4KTW A;  4DSF A;  1TYQ B;  4MLH A;  5JLF A;  1RCH A;  3VQE A;  1BWF O;  4WQ4 C;  4OPA A;  3SPY A;  3A5M C;  4RTF D;  4GVE A;  3VQD A;  1EP4 A;  4H0X B;  3J7Y P;  4NYF A;  3C6U A;  3QEW A;  5EX5 A;  4FYD A;  1NKE A;  1T6D A;  4YOV A;  1Q8I A;  3C94 A;  1C1A A;  5CR4 A;  1ASV A;  3EE8 A;  1R0A A;  4J2A A;  3KWI A;  4CZE A;  3O3F A;  1OH7 A;  4KV8 A;  3CM5 A;  1S1X A;  4I6M A;  4IDK A;  4GVM A;  2D0B A;  1QQN A;  1Y97 A;  3WNF A;  1VQ8 N;  4KI6 A;  3EO3 A;  1NK0 A;  3PSI A;  1HQU A;  5C25 A;  4IJA A;  4CF8 A;  3ZLJ A;  2HHU A;  4BWM A;  1B92 A;  4DR6 K;  5KPT A;  2BAN A;  4YOT A;  5F1X A;  3CJA A;  3SAF A;  2QW9 A;  1L5U A;  4PKH A;  5FRO A;  1VQN N;  1TV6 A;  5FPD A;  4DTJ A;  5HLF A;  2G8U A;  3IAY A;  3NGY A;  3SK3 A;  4FXD A;  3MEC A;  1GLL O;  3O9S A;  1EXQ A;  2ITG A;  1ZBS A;  3PY8 A;  4BRM A;  4CZH A;  3J81 O;  3RVC A;  4I9L A;  4E3S A;  4JKA A;  4UQG A;  4FWS A;  3G6E N;  1W9H A;  4FJG A;  3BGR A;  5K14 A;  3CFO A;  4DR4 K;  3RRH A;  2QWO A;  2DY4 A;  2NRZ A;  2Z1H A;  3O4Q A;  5BRD A;  3HXM A;  3E01 A;  4EAH D;  5JS2 A;  4XIU A;  3HVT A;  3N4Q A;  4GNI A;  4H0T B;  4A59 A;  2QTD A;  3CCU N;  4DV1 K;  3CER A;  3CHW A;  2PYL A;  4NCB A;  2Z1I A;  5JLH A;  1N6Q A;  5KRS A;  3CC7 N;  1HLU A;  2G8F A;  3S3M A;  4OJR A;  1GLF O;  1LCU A;  5GAG P;  1N36 K;  3B6O A;  2QA4 N;  3M8Q A;  1QHA A;  1ATR A;  3VA0 A;  1SZ2 A;  2P9L B;  3TAQ A;  4CI6 A;  1WNS A;  4Z4E A;  5JS1 A;  4DU4 A;  4CK1 A;  3FE1 A;  5H1S Q;  4FJK A;  4E89 A;  4XH5 A;  3CPW M;  1TAU A;  3LAM A;  4NXN K;  3D2E B;  1NGC A;  1WSF A;  2VWK A;  1C0M A;  4B3M K;  4X64 K;  1GLD G;  4HUE A;  5ELZ A;  2RE2 A;  2WUS A;  3EY1 A;  4FZY A;  4MLE A;  4F2R A;  2QEX N;  1ASW A;  4N76 A;  4CZJ A;  5B8H A;  1F21 A;  4JLH A;  4CHY A;  1YI2 N;  2O8D B;  4B9T A;  1DGK N;  3FZL A;  1BDG A;  4BDZ A;  2JLE A;  1I3A A;  4WQ5 C;  3AO3 A;  4DQQ A;  1KSP A;  1NJI O;  2P9K B;  3LDN A;  2A6A A;  3HTV A;  4PUO A;  5EXW A;  1DT9 A;  3L2V A;  1RT3 A;  4KKO A;  2FBT A;  3GL1 A;  3K9J A;  4PA1 A;  3TAG A;  3CCM N;  5LMN K;  5HRO A;  1LOT B;  4WQ4 A;  2FSK A;  2IIR A;  4O5F A;  4HTU A;  3OBY A;  3R6M A;  1IG8 A;  1NGD A;  1WAF A;  3VGL A;  1P90 A;  5ADX H;  4QS9 A;  3HT3 A;  3L0Q A;  3OW2 M;  1CXQ A;  4KTZ A;  1VQK N;  3OYA A;  1A5W A;  3LDL A;  4LFC K;  3N4P A;  3JAM O;  1I94 K;  2BUP A;  3HPO A;  2NLX A;  4ZTJ A;  3PUF A;  3M5R A;  1QVF M;  4CIF A;  4M7Y A;  2G8H A;  3NMU A;  3DLL L;  2DFH A;  4B1X B;  4YOU A;  1NGG A;  2HNY A;  3F5T A;  4JI7 K;  1RIL A;  1RFQ A;  1S9E A;  1K8K A;  3M1F A;  4HCC A;  1KC8 O;  2I5J A;  5HRS A;  4B9U A;  3K57 A;  2HHS A;  4JHD B;  1REV A;  3NF7 A;  2QWQ A;  4XH4 A;  1EO1 A;  3C7N B;  3VTI A;  1TKD A;  2DFE A;  1FKP A;  3KJV A;  1Q9X A;  5CZ1 A;  1IO2 A;  4KH4 A;  3M8P A;  4IXC A;  3MN6 A;  4AF1 A;  3QEV A;  3HZ6 A;  3OHR A;  2GX9 A;  3KWG A;  2FBX A;  3O1B A;  2VGN A;  1T3V A;  3G25 A;  4PKG A;  4DV6 K;  2P1J A;  4IBN A;  3K5L A;  5AQW A;  3MDQ A;  4Z4H A;  3A5L C;  3J7A P;  2P9S A;  4LH5 A;  4CFB A;  4JD2 B;  3V6D A;  1RTJ A;  3VQQ A;  4UY8 O;  3PX0 A;  4FM2 A;  4KHW A;  5D3G A;  1WSG A;  4OPJ A;  3NF8 A;  1WAJ A;  3QNN A;  2W40 A;  5C15 A;  4BRC A;  4FVU A;  3ENH A;  4M41 A;  4R5P A;  4WFB L;  4ID1 A;  4DQS A;  3SI6 A;  3H3N O;  4FM1 A;  2EWS A;  2RHK A;  3PSF A;  1BG3 A;  3RMB A;  5BR8 K;  2CH6 A;  4BDY A;  2Z1G A;  1HYS A;  5IWA K;  5E84 A;  3LWM A;  1YIJ N;  2VQE K;  1XMO K;  3NDK A;  3C0B A;  2B5J A;  3A5N C;  4CJK A;  1CZB A;  1NJX A;  4Z4C A;  4Y0W A;  2XO7 A;  3P4I A;  4DSJ A;  3ZET B;  2D1K A;  1EQY A;  3OYN A;  3AY9 A;  2WC9 A;  1D9D A;  4YOX A;  5M1F A;  2BGG A;  5GIO A;  5KGX A;  3C6A A;  4K25 A;  5E26 A;  2D0O A;  4RW7 A;  4YDU C;  4FLY A;  5J2M A;  4JEP A;  1ATS A;  3K5M A;  1YT3 A;  3L3V A;  4C1N I;  4K41 A;  4C8K A;  5EU7 A;  2YNI A;  4E7J A;  5BPL A;  3ZSW A;  3OJU A;  3THV A;  3ZT2 A;  4CHZ A;  5CHI A;  1RDA A;  1U6Z A;  1IBK K;  2GUP A;  2YHY A;  3HM8 A;  3A0I X;  3GOI A;  4FJI A;  3G71 N;  1BO5 O;  4O44 A;  4DR5 K;  3OYF A;  3FZF A;  4JAX A;  2E2N A;  4BRL A;  3T69 A;  2DPN A;  1XMQ K;  3P5J A;  1FK9 A;  1D9F A;  4DQ8 A;  5FPE A;  4B1Z A;  1BQN A;  2VG5 A;  4PL8 A;  4CK3 A;  4OKK A;  4DQP A;  4B9L A;  3WEE A;  2PAV A;  1X1P A;  2HNZ A;  4BC5 A;  3AVB A;  3A8Y A;  3KK1 A;  3LZI A;  1G99 A;  3OYD A;  1NGH A;  5LJV A;  3ZSY A;  4FJ7 A;  3R8E A;  3HVR A;  3VQA A;  3HOT A;  3ZEU A;  1TK5 A;  1KQS M;  5AQX A;  2XY8 A;  3WUH A;  1QHT A;  1IG9 A;  4B9M A;  3GDQ A;  1TKZ A; 
#chains in the Genus database with same CATH homology
 2DFF A;  3C95 A;  1B9F A;  1ZYQ A;  3VQP A;  3RMA A;  3V1O A;  4E19 A;  4M3X A;  1WN7 A;  4KHY A;  4O5B A;  4Q0B A;  3AVI A;  3KK3 A;  1QSL A;  4Z4F A;  1WSH A;  3U3Y A;  4EP5 A;  5E41 A;  4ZHR A;  3RTV A;  4EZ9 A;  3RRG A;  4OGE A;  4KHS A;  1XHZ A;  3QO9 A;  3F73 A;  1JL1 A;  3SV3 A;  3V9U A;  4DS5 A;  1I39 A;  4DTO A;  4M3U A;  4ID5 A;  1VSL A;  3LP3 A;  4I2P A;  1JLE A;  4N5S A;  4CGJ A;  3IG1 A;  4OPK A;  4FW2 A;  3L2Q A;  3M8R A;  3QET A;  1KFS A;  1SV5 A;  1RT7 A;  1SKR A;  1RTD A;  2HHT A;  2KZZ A;  3T3F A;  3VQ8 A;  3T1A A;  3AA2 A;  3K59 A;  4BDP A;  3VQC A;  2XY5 A;  3SUP A;  4W5T A;  3KLF A;  3AV9 A;  4CCH A;  1VSE A;  3SPZ A;  1X9W A;  4F8R A;  4F3T A;  2A1R A;  3OYI A;  4QAG A;  3CYM A;  3SYZ A;  4KRE A;  3O3H A;  4PQU A;  4DFK A;  4DTP A;  4CED A;  1U47 A;  3MEG A;  3DLE A;  3HPH A;  3ULD A;  3S9H A;  2XY7 A;  3LDS A;  3OYM A;  1RBV A;  1TAQ A;  2OPP A;  1UAX A;  3AVA A;  4Z4G A;  2OZS A;  4FLZ A;  5C42 A;  3U6F A;  1NK4 A;  3OYC A;  3L2U A;  1A5V A;  1S1T A;  3QLH A;  1SKW A;  1TK0 A;  5SWM A;  1XHX A;  4HCB A;  4M3W A;  3DLG A;  4KTW A;  4DSF A;  4CF1 A;  3RMD A;  2GV9 A;  3UIQ A;  1Z25 A;  4IG3 A;  4DLE A;  1KRP A;  1RCH A;  4FK4 A;  4LH4 A;  1KTQ A;  1T8E A;  2HW3 A;  3MXJ A;  3VQE A;  1JKH A;  4ZTF A;  4W5N A;  2E4L A;  3SPY A;  4FZZ A;  1JLB A;  1BHL A;  4AH9 A;  1D5A A;  3SQ0 A;  3VQD A;  1EP4 A;  3WNG A;  2YNG A;  4B9S A;  1TKT A;  5KI6 A;  4F4K A;  4CGD A;  3ZSQ A;  4HUG A;  1RT2 A;  4DQI A;  4NYF A;  4K8X A;  3C6U A;  3QEW A;  1QQC A;  2XRI A;  3DLR A;  1RT4 A;  4W5R A;  1ZBI A;  2DTU A;  4FYD A;  1QTM A;  4DLG A;  1NKE A;  3KK2 A;  1Q8I A;  3TI0 A;  3C94 A;  1C1A A;  4E7H A;  1RBU A;  1ASV A;  1J9A A;  3G10 A;  3I8D A;  1R0A A;  4J2A A;  3O3F A;  4JS5 A;  4JS4 A;  5CYQ A;  4KV8 A;  3CM5 A;  1S1X A;  4IDK A;  3QES A;  1NJW A;  4GVM A;  2D0B A;  4FJ8 A;  5J2N A;  1Y97 A;  3I0R A;  2G8K A;  4FJH A;  2ZD1 A;  2G8V A;  3WNF A;  3IS9 A;  4KI6 A;  4Z4I A;  1NK0 A;  3NFA A;  3SCX A;  4O55 A;  3HO1 A;  3O4N A;  1HQU A;  1JLA A;  5C25 A;  4KB1 A;  4CF8 A;  2HHU A;  1NOZ A;  1RNH A;  4BWM A;  1VRT A;  2YKN A;  1SKS A;  1B92 A;  3QIO A;  1HQE A;  3VQ7 A;  2XY6 A;  3OYL A;  4FK2 A;  4DTU A;  2ZE2 A;  2BAN A;  3AVG A;  3TR8 A;  1QSY A;  4CHQ A;  4KTQ A;  4QCL A;  4AHV A;  1L5U A;  5FRO A;  5J1E A;  1TV6 A;  2VG6 A;  4DTJ A;  3TAN A;  3L2R A;  5HLF A;  2G8U A;  3PX4 A;  3ZSO A;  4CFA A;  2BDP A;  3NGY A;  2G8W A;  3IAY A;  4FXD A;  4DSI A;  4OLA A;  3MEC A;  3DOK A;  1EXQ A;  2ITG A;  1S5J A;  1KLN A;  2BE2 A;  3KLI A;  3PY8 A;  3SNN A;  2Z1J A;  4RG8 A;  4DTN A;  1WLJ A;  4I9L A;  3DLB A;  4E3S A;  1RBT A;  4IG0 A;  3NF6 A;  3KD5 E;  4CJQ A;  1S6Q A;  2KQ2 A;  3DRS A;  3V1R A;  3VQ9 A;  1U48 A;  4UQG A;  1Q9Y A;  4F2S A;  4L8R B;  1W9H A;  4CEO A;  4FJG A;  4CER A;  3BGR A;  2P5O A;  5K14 A;  3CFO A;  4FJL A;  3C6T A;  3QEP A;  1BI4 B;  1L3S A;  1HYV A;  2P5G A;  4KHU A;  3HL8 A;  4AHU A;  3RRH A;  2X6N A;  4CJE A;  4KRF A;  2KW4 A;  3QIN A;  5C24 A;  4OKJ A;  1T03 A;  4FJM A;  3IRX A;  4ELT A;  4M3Z A;  2DY4 A;  4DFP A;  2Y1I A;  2Z1H A;  3O4Q A;  3HST B;  2YHB A;  3L8B A;  2QKK A;  3HXM A;  3E01 A;  3L3U A;  3NF9 A;  3ZT0 A;  1WSI A;  5JS2 A;  4XIU A;  3HVT A;  3TAF A;  1IKY A;  4DSL A;  4DSE A;  2FBV A;  1GOC A;  3AVC A;  4FLW A;  5HP1 A;  3AO1 A;  4CJF A;  4JRQ A;  4C8M A;  2PYL A;  2P51 A;  4NCB A;  3MEE A;  2Z1I A;  4B8A B;  2O4I A;  1HPZ A;  4OKE A;  3V81 A;  3WNH A;  1N6Q A;  3ITH A;  1LAV A;  1BIS A;  5KRS A;  3TWH A;  3VN5 A;  4AHS A;  4I9Q A;  1S1U A;  3PX6 A;  4B9N A;  1ZBH A;  4IFY A;  4CIE A;  2EHG A;  3S3M A;  2G8F A;  4OJR A;  5CY4 A;  4OGC A;  1VRU A;  4LSL A;  1TGO A;  1DLO A;  4H4M A;  3NH1 A;  3B6O A;  3ZSZ A;  3NH0 A;  2JGU A;  3M8Q A;  3S3N A;  4E1M A;  4C8O A;  3ZT4 A;  1RDD A;  1VSM A;  4BAC A;  5DMR A;  1RTI A;  3CFR A;  3VA0 A;  2IDO A;  1KCF A;  4CJV A;  2PY5 A;  4KPY A;  2IAJ A;  3TAQ A;  3AA5 X;  3T19 A;  4YFU A;  5KRT A;  4CF0 A;  3ZT1 A;  1WNS A;  3LP2 A;  4CJU A;  1BI4 A;  4KB0 A;  1VK0 A;  4Z4E A;  5JS1 A;  1VSH A;  2YNH A;  4MQ3 A;  3ASM A;  4DU4 A;  4CK1 A;  3VQ5 A;  3SJJ A;  4E7I A;  4CEB A;  3DOL A;  4N47 A;  4FJK A;  2WON A;  3ZSV A;  4E89 A;  4M3R A;  4DMN A;  3M8S A;  1TAU A;  4DTR A;  3TAM A;  3DYA A;  1EX4 A;  1EET A;  3LAM A;  2YV0 X;  1C1B A;  1RDB A;  2D5R A;  1BCM A;  1T7P A;  1WSF A;  2VWK A;  3LZJ A;  4CEA A;  1TVR A;  1C0M A;  4CJT A;  3NAE A;  5SZT A;  4DG1 A;  4O0I A;  4Q5V A;  3SUO A;  4HUE A;  4AHR A;  3VQ4 A;  4CEE A;  1HYZ A;  1XWL A;  3EY1 A;  3AVL A;  3ISN C;  4EZ6 A;  4QOZ B;  2OPS A;  4FZY A;  4F2R A;  1HMV A;  4KAZ A;  1QSS A;  1ASW A;  4O0J A;  4K8Z A;  4N76 A;  1S9G A;  4I7F A;  2PYJ A;  1O1W A;  2HHQ A;  1F21 A;  4JLH A;  4CJL A;  1BL3 A;  3KKR A;  2ZQB A;  1G15 A;  4CHY A;  2HND A;  1ITG A;  4W5Q A;  2OZM A;  4E0D A;  4PY5 A;  2D0C A;  1S1V A;  3TAP A;  4DWI A;  4B9T A;  5FDL A;  2IGI A;  1BCO A;  1JLC A;  1RT5 A;  4BDZ A;  2JLE A;  2YNF A;  4CGG A;  1I3A A;  3ZCM A;  3KLG A;  1LWE A;  3QER A;  3AO3 A;  1FXX A;  1KVA A;  3K2P A;  4G1Q A;  4C8N A;  4DQQ A;  3DLK A;  1KSP A;  1J54 A;  1QE1 A;  3NE6 A;  2IC3 A;  4PUO A;  4IKF A;  3L2V A;  1HNI A;  1RT3 A;  3P1G A;  1NKB A;  2F8S A;  4KKO A;  3HP6 A;  2KFN A;  1J53 A;  4I2Q A;  2FBT A;  4AHC A;  4PA1 A;  3KKS A;  3OJS A;  4DTM A;  1SL2 A;  3V9Z A;  3TAG A;  5HRO A;  1VSF A;  1HRH A;  1RT6 A;  3ZSX A;  1TL1 A;  3ZT3 A;  5KTQ A;  1GOA A;  1ZBU A;  4HTU A;  1ZBL A;  4FLV A;  2HHX A;  3RMC A;  1IKX A;  1QS4 A;  1WAF A;  1C6V A;  3LAK A;  4E1N A;  3HT3 A;  3VQ6 A;  3I0S A;  4M3Y A;  3OS2 A;  1CXQ A;  1RBR A;  4KTZ A;  3OYA A;  1JL2 A;  4BE0 A;  1YTU A;  2X74 A;  4W5O A;  4LD0 A;  1A5W A;  3OS1 A;  1T05 A;  3OYK A;  3SUQ A;  3HPO A;  1X9M A;  1NOY A;  4ZTJ A;  3PUF A;  4CIF A;  1ZBF A;  1UWB A;  4CEZ A;  3V4I A;  1TK8 A;  2G8H A;  4EP4 A;  3NBP A;  2FC0 A;  3ALY A;  1RT1 A;  3CM6 A;  2YKM A;  2DFH A;  5CZ2 A;  4FVM A;  2GBZ A;  1D8Y A;  4CJP A;  2XHB A;  4JRP A;  3DMJ A;  2KZM A;  4OVL A;  4DTS A;  3AO4 A;  3TAE A;  1UA0 A;  4LY7 A;  1VSI A;  3P83 D;  4DTX A;  1L3V A;  2HNY A;  3OYJ A;  1RIL A;  5HRR A;  2HMI A;  1FKO A;  1RDC A;  1S9E A;  1UA1 A;  1JLQ A;  3SQ2 A;  3L2W A;  4M3T A;  1SUQ A;  1LW2 A;  2QKB A;  3OVN A;  1HNV A;  4CEQ A;  1EKE A;  2RF2 A;  5HRN A;  1NJY A;  4FJN A;  3ZSR A;  1DTT A;  4HCC A;  2KTQ A;  2I5J A;  4FW1 A;  2ETJ A;  1X9S A;  5HRS A;  4CGI A;  4B9U A;  2E6M A;  4CGF A;  3K57 A;  3OYB A;  2HHS A;  1C0T A;  1IKV A;  1REV A;  3NF7 A;  4CJS A;  1JLG A;  1XC9 A;  3WNE A;  3LWL A;  3H08 A;  1TKD A;  3G0Z A;  2DFE A;  4Y1C A;  1NK7 A;  1FKP A;  3D0P A;  3RR7 A;  3KJV A;  3F9K A;  4CGH A;  1Q9X A;  4ELV A;  1LAW A;  5CZ1 A;  2O4G A;  1IO2 A;  4DU3 A;  1JXE A;  3M8P A;  3K58 A;  3AA3 A;  1U04 A;  3MED A;  4CHO A;  3V9S A;  1NK8 A;  3QEV A;  1W0H A;  2Y1J A;  3LP0 A;  4CFD A;  4KHQ A;  2FBX A;  1L3U A;  2W42 A;  3VA3 A;  3SQ4 A;  2P1J A;  4IBN A;  5CYM A;  2HVI A;  3JSM A;  3BDP A;  4FK0 A;  2F96 A;  3K5L A;  4N56 A;  4F3O A;  4B08 A;  2G8I A;  5FRM A;  4O4G A;  4Z4H A;  4H8K A;  3AA4 A;  4FJ9 A;  3AVF A;  4HVJ A;  3NHG A;  4LH5 A;  4CFB A;  4FJX A;  4B3O A;  4CIG A;  2HVH A;  1BIU A;  2OYQ A;  1S6P A;  3NH2 A;  3V6D A;  3NCI A;  1RTJ A;  3VQQ A;  5KGW A;  4OLB A;  3OYG A;  3PX0 A;  5FRN A;  4CE9 A;  4CJ3 A;  4FM2 A;  1NJZ A;  4KHW A;  5D3G A;  2B6A A;  1WSG A;  4OPJ A;  3AO5 A;  1WSJ A;  3NF8 A;  1NK5 A;  1WAJ A;  3OY9 A;  3QNN A;  4GW6 A;  3O3G A;  2RPI A;  4B8C A;  4CEF A;  4CES A;  3DLH A;  4M41 A;  4R5P A;  1NK6 A;  3LP1 A;  1VSK A;  3QIP A;  5DK5 A;  4CEC A;  2FBY A;  4ID1 A;  3V1Q A;  4YNQ A;  3V9X A;  4KI4 A;  4DQS A;  3QEX A;  5I42 A;  3SI6 A;  3VQB A;  1LV5 A;  3KLH A;  4WE1 A;  5J2P A;  4FM1 A;  2B4J A;  4ELU A;  1C0U A;  3DM2 A;  4NCA A;  3RMB A;  1C1C A;  4LSN A;  3HJF A;  4J2D A;  3AVJ A;  3D45 A;  3AVM A;  3LAN A;  2VWJ A;  4BDY A;  2Z1G A;  3SV4 A;  1HYS A;  2RN2 A;  2OA8 A;  4CFC A;  3KIO A;  2HHV A;  2HB5 A;  3LWM A;  4M45 A;  2QK9 A;  3NGI A;  3MXI A;  3LPT A;  1KVC A;  3LAL A;  2IOC A;  4DU1 A;  4H4O A;  2NUB A;  4BWJ A;  3TAB A;  3B6P A;  3DI6 A;  4CF2 A;  2LSN A;  4NCG A;  5HRP A;  3NDK A;  4E7K A;  4HUF A;  2B5J A;  1LWC A;  1TL3 A;  1RBS A;  4C8L A;  3SUN A;  2PZS A;  3DRR A;  3QEI A;  1U4B A;  4PWD A;  1ASU A;  4RW8 A;  4CJK A;  5J2Q A;  4FLX A;  1CZB A;  4RW6 A;  3JYT A;  1NJX A;  3CFP A;  4Z4C A;  2D0A A;  2XO7 A;  4FJ5 A;  1VSJ A;  4DSJ A;  1GOB A;  4DQR A;  2Q3S A;  4N41 A;  1KLM A;  3OYN A;  4CK2 A;  3TAR A;  1CLQ A;  4CF9 A;  3S3O A;  3HP9 A;  3HYF A;  1D9D A;  1U45 A;  2BGG A;  1JXB A;  3PO5 A;  1KFD A;  3AO2 A;  4Y1D A;  3MAQ A;  1YVU A;  2X6S A;  5KGX A;  1A5X A;  4J2B A;  1BQM A;  1WSE A;  3AVK A;  4RW9 A;  1NK9 A;  2GUI A;  5HBM A;  1YTA A;  1J5O A;  4RW7 A;  1MU2 A;  3AVN A;  2IS3 A;  4GMJ B;  5T7B A;  4FLY A;  3V9W A;  5J2M A;  1JLF A;  3PV8 A;  2YHA A;  3HPG A;  1VSD A;  4CJR A;  2AJQ A;  1BIZ A;  3SZ2 A;  3K5M A;  1YT3 A;  3L3V A;  3QNO A;  1NKC A;  2OPQ A;  4C8K A;  4DFJ A;  5EU7 A;  2X78 A;  4CHP A;  3DRP A;  2HHW A;  4DFM A;  2YNI A;  4FM0 A;  4E7J A;  3ZSW A;  4DF4 A;  4ICL A;  3OJU A;  4DF8 A;  3THV A;  1IKW A;  3ZT2 A;  4CHZ A;  1CZ9 A;  4B9V A;  1RDA A;  1S1W A;  4CJW A;  3LPU A;  4DS4 A;  5I3U A;  1U49 A;  3RR8 A;  3EZ5 A;  4NYN A;  4FCY A;  3HM9 A;  1HJR A;  1K6Y A;  4DSK A;  4FJI A;  3NGZ A;  3KLE A;  4IFV A;  1UOC A;  4O44 A;  4BE2 A;  2RKI A;  3OYF A;  3KD1 E;  3AVH A;  3EYZ A;  3CG7 A;  1IH7 A;  2EX3 A;  3U3G A;  1LWF A;  4CHN A;  1Z26 A;  3SQ1 A;  4HHT A;  1SL0 A;  3HK2 A;  4FLT A;  3OS0 A;  1RTH A;  3P5J A;  1CXU A;  1FK9 A;  1D9F A;  4RW4 A;  4FJJ A;  3K5N A;  1BQN A;  1DTQ A;  3PO4 A;  2VG5 A;  2WOM A;  1BGX T;  4CK3 A;  4OKK A;  4TSX A;  2R7Y A;  3MXM A;  2QXF A;  4AIL C;  4DQP A;  4B9L A;  3K5O A;  2E6L A;  3OYH A;  4FLU A;  1X1P A;  2HNZ A;  3OYE A;  4E7L A;  1SL1 A;  1N5Y A;  2A1S A;  4KFB A;  3CQ8 A;  3FFI A;  3AVB A;  3KK1 A;  3LZI A;  3OYD A;  4M42 A;  1B9D A;  4FJ7 A;  3ZSY A;  2ATQ A;  1KVB A;  3HVR A;  2OPR A;  4CJ5 A;  1L3T A;  3VQA A;  4CJ4 A;  4BE1 A;  3KTQ A;  1TK5 A;  4J2E A;  4KO0 A;  1LW0 A;  4FZX C;  2KFZ A;  2VG7 A;  2XY8 A;  1IG9 A;  1QHT A;  1TKX A;  4B9M A;  4MFB A;  4KHN A;  3RWU A;  4AHT A;  1XI1 A;  4Z0U A;  3A2F A;  2F8T A;  1TKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...