4CHOA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 52
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4choA00
2EHGA 3AV9A 1TV6A 2WOMA 4CJWA 3KJVA 4DTMA 1NK8A 2A1SA 3LPTA 3NBPA 4CJTA 4RG8A 3QEWA 4ELVA 4CCHA 3U3GA 3QLHA 2VG6A 3ALYA 2IAJA 3QEIA 1QHTA 4PA1A 5JS2A 3OYLA 4DFMA 2VWJA 5CZ1A 4E7KA 1RILA 1IO2A 1J5OA 4FJHA 2Z1IA 3DMJA 4NCGA 4O44A 4O0IA 4UQGA 4DSKA 3EZ5A 3V6DA 4I2PA 3IAYA 5FRMA 4KHQA 2GBZA 4DSEA 1KLNA 1RBRA 3KK1A 3LP3A 3VQ7A 1EETA 2B6AA 1HNIA 4DTRA 4RW8A 3M8SA 5HROA 1NK0A 2OPRA 1WSHA 3SUPA 3LAKA 3L2VA 2DFEA 4FLXA 4CFAA 3SYZA 1TAQA 3RR8A 2ZQBA 4DTNA 1LWFA 1U47A 3ZT4A 4M3UA 1VK0A 1HPZA 1Z26A 3ZSYA 4CEBA 3ZSQA 1A5XA 1XHZA 4F4KA 3KK2A 4KHNA 1FKPA 1C1BA 1RT5A 3C95A 4HVJA 1S1UA 1S1VA 1UA0A 1ASVA 4DTUA 1TL3A 1TL1A 1Q8IA 4JS4A 4IDKA 3QIPA 5KRTA 2IS3A 2AJQA 3OYFA 3K5LA 3OJUA 3OY9A 3HK2A 1JLEA 3IG1A 1L3UA 1GOBA 1RDCA 4IKFA 1VSLA 4Z0UA 1BQMA 2XY5A 1T03A 4QCLA 4KV8A 1HYSA 2OPQA 1IKXA 3V1QA 3PX4A 1ZBLA 5HRNA 1VSDA 1ZYQA 4YFUA 3QEVA 1TKTA 1T7PA 3RRGA 4F8RA 4J2DA 1UOCA 3OYIA 4M3TA 1X1PA 2HNYA 1VSEA 4IFYA 3RRHA 3PY8A 3QEXA 3PO5A 4OPKA 4DS5A 4GMJB 4FLVA 3ZSOA 1RT7A 3LPUA 4YNQA 3NHGA 4DQRA 3NDKA 1JLGA 3SV3A 4BWJA 2XY6A 3IRXA 3JYTA 4HUFA 2KZMA 3O4QA 2PYJA 3THVA 4DMNA 3D0PA 1RTHA 4FJ7A 4H4MA 3DRPA 4LSLA 4CGJA 3AO3A 4OGEA 4IG3A 4EZ6A 4CEAA 4BDPA 3NGZA 1TGOA 2OPSA 5HRSA 2OZMA 4DSLA 4OLBA 1RBTA 1BHLA 3NF8A 3I0SA 1BI4A 4Z4CA 3S9HA 1RBVA 2G8IA 4FZXC 4CIFA 1TAUA 3HPGA 4OPJA 4FM2A 1RTDA 4CEFA 1NJWA 3PO4A 4CEDA 3HT3A 4FJLA 4J2AA 2X6SA 1NOYA 4FJKA 2HB5A 3HM9A 3CG7A 2OA8A 1GOCA 3HXMA 4KHSA 5HRPA 4MFBA 1RT1A 4KFBA 4AHSA 1X9SA 1S9GA 4KRFA 3RMAA 4RW9A 1U04A 2WONA 3HJFA 3KLEA 3NF6A 3PX0A 3KKRA 4JS5A 4FJ5A 3PUFA 4JLHA 3HL8A 4EP5A 4CK3A 2FBYA 1BQNA 3DOLA 3SJJA 1U48A 1A5WA 4DLEA 1SKRA 5CYMA 5KI6A 2G8HA 2OYQA 1EKEA 3HYFA 4FLWA 4O55A 1O1WA 3SCXA 1NK9A 3TARA 4DTPA 4CJ5A 4LD0A 1RBSA 4CFBA 2HNZA 4IG0A 1ASWA 5FROA 1LW0A 5SWMA 3OYDA 4DQPA 4CJEA 4KB1A 4ZTJA 2IGIA 4Y1CA 4E7HA 1SL2A 2KFNA 4HHTA 1S5JA 3BGRA 3LP1A 3WNFA 2KW4A 4CF0A 3QNNA 3S3OA 3K2PA 1TK5A 1CXUA 4Q0BA 1I3AA 3C94A 5EU7A 4DLGA 2HW3A 3O4NA 2FBTA 4KHYA 4FJ8A 4FZYA 2YNFA 3G0ZA 4CERA 3KTQA 1LAWA 3C6UA 4CJ4A 4K8ZA 2HHXA 3L2RA 4BACA 4B8AB 2JGUA 5CY4A 5KGXA 2QK9A 2GUIA 3KIOA 2E4LA 4CEQA 4C8LA 1RT6A 1JLAA 4I2QA 4M45A 4NYFA 4ELUA 2VG7A 4DQIA 3NCIA 4DU1A 1SV5A 4AILC 4DF8A 4LH5A 3OYAA 4FK2A 1KVAA 3L3VA 1T8EA 3EYZA 3NH1A 4E3SA 3VQ4A 1LWEA 3AVBA 2YV0X 3ZCMA 4AHVA 3QETA 2D0AA 3VQAA 1LV5A 2G8FA 3HP9A 3SI6A 2PZSA 4NYNA 4XIUA 3TAQA 4F3OA 1R0AA 3RMDA 4B9NA 4FYDA 4KI6A 3ZT3A 1EXQA 2QKKA 5HLFA 3OYGA 3OYNA 4DU4A 4N76A 1FK9A 1MU2A 2ITGA 3NF7A 1XC9A 3VQ5A 4CF2A 1WSFA 3LDSA 2Z1GA 2G8WA 1ZBFA 3LANA 3KLIA 4FLYA 3V81A 4DWIA 2G8KA 1ASUA 1YTUA 1RNHA 1TKXA 4Q5VA 2HNDA 5KRSA 3LZIA 3M8PA 3ZSWA 1BISA 2DY4A 1WAFA 2KTQA 3O3GA 1VRUA 2QXFA 3QIOA 1L3SA 1QQCA 1EP4A 4DTOA 4BDZA 3O3FA 4B8CA 1SL1A 3HO1A 4O4GA 3ASMA 3OS1A 1JLCA 3SPYA 4FCYA 1IKVA 3V1RA 2R7YA 4CHYA 3L3UA 3QERA 4F2SA 1GOAA 1DLOA 2Z1JA 5C25A 4CJSA 1HRHA 4ZHRA 1ZBUA 3FFIA 3G10A 2QKBA 3OYKA 4PQUA 4GVMA 4C8NA 3E01A 1IKWA 5FDLA 3AO1A 3QESA 1RCHA 2HVHA 1VSMA 4FLTA 3A2FA 3ZSXA 3VQ8A 3ZT2A 3VQ6A 1XHXA 1I39A 4BDYA 4CJUA 4L8RB 2O4IA 5J2MA 4IBNA 3MEGA 2HHWA 4CJ3A 1WSIA 4BWMA 4FVMA 5SZTA 1TK0A 5J2QA 1JLFA 1SUQA 4E1NA 4B9MA 3JSMA 2Y1JA 2VWKA 1UAXA 1J53A 1C0MA 2B4JA 4FM1A 3VQPA 3SUNA 3TANA 3OYBA 2IDOA 2P5OA 1A5VA 2JLEA 2PYLA 3CM5A 1J54A 3AVKA 1KSPA 4M3XA 3AA3A 4E7IA 4E1MA 3LP0A 3T1AA 4CHZA 3V9ZA 3RMBA 2EX3A 2G8VA 1NK6A 3SQ1A 1RDBA 4EP4A 1QS4A 5CZ2A 5I3UA 3HSTB 1Q9YA 1S9EA 3B6OA 3QNOA 5D3GA 1VSFA 1BCMA 1NKCA 1HQUA 3RMCA 2XY7A 2IC3A 4OKEA 4AHUA 4CEOA 4M41A 4CJKA 3VN5A 1JXBA 4KHUA 4W5QA 3AVFA 1FXXA 4KPYA 4Z4FA 1FKOA 2YKMA 2G8UA 1VSIA 3TAEA 1RDDA 2Z1HA 4FK0A 3NGIA 1B9DA 1JKHA 1TVRA 3HPHA 4Z4HA 1N5YA 4M3YA 1Z25A 2DFHA 4FJNA 4KTZA 4AHRA 1U49A 2YHBA 1QE1A 1WAJA 3HP6A 4FW1A 3SPZA 1LW2A 4B9UA 3H08A 4HCCA 1NJYA 4FZZA 1BIZA 3QINA 3SNNA 4KTQA 4Z4GA 3QEPA 1HJRA 1Y97A 4BE0A 2HHSA 4DFKA 4DFPA 2D0CA 3OS2A 1U45A 3DLBA 3P5JA 3ZT0A 1W9HA 4EZ9A 3V9WA 1C0UA 4ID1A 2HHTA 1VSHA 1WNSA 3HVTA 3WNGA 1RT3A 3V9XA 3L2WA 1NOZA 3SUOA 2OPPA 2RN2A 3KLHA 1KFSA 2F96A 2HHUA 2BE2A 3OYMA 3SV4A 2KFZA 4M3WA 5K14A 5J1EA 4DTXA 3AVHA 1YTAA 4C8MA 1KFDA 3KK3A 4I7FA 2KQ2A 5J2PA 1NJZA 1JLBA 1XWLA 5HP1A 4BE2A 3VQCA 2ZD1A 4FM0A 3ZT1A 4OKJA 1VRTA 4CEZA 4DFJA 2RF2A 3C6TA 4CJVA 1HQEA 2D0BA 3DLRA 1NK5A 4O0JA 1QSLA 4B9SA 5FRNA 1S6PA 1CLQA 4CHOA 3U6FA 1QSYA 2ETJA 1KCFA 1S6QA 4N5SA 3OS0A 4JRPA 3AVCA 3TAPA 1VSJA 3D45A 4QOZB 1ZBIA 1IH7A 4KREA 4M3RA 4NCAA 1WSGA 4ID5A 3NH0A 3TAGA 3AVLA 1G15A 3EY1A 2ATQA 3CFPA 2OZSA 4F3TA 1WN7A 4Y1DA 2BGGA 4OJRA 5C42A 3MAQA 3OYHA 4W5RA 2F8SA 4K8XA 2X78A 1HNVA 2YNHA 4B9LA 3BDPA 3M8RA 3K58A 3B6PA 3CFOA 1K6YA 3DRRA 2B5JA 4RW4A 4E19A 4FJGA 4FJJA 4DQQA 4E0DA 1NK7A 1N6QA 2FBXA 4KI4A 1TKZA 3CM6A 3KD5E 5KTQA 1F21A 3TAMA 3DOKA 1BL3A 2YKNA 3IS9A 4KO0A 3O3HA 4DS4A 3V4IA 2HHQA 5E41A 1QSSA 4I9QA 4HUGA 2HMIA 3VQDA 3VA3A 4OGCA 3ULDA 3CQ8A 3PV8A 1D9DA 3AO4A 1HYVA 4DSJA 2X6NA 3NFAA 4DG1A 1RTIA 4ZTFA 3LALA 1KTQA 4FJIA 4CESA 3CFRA 5HBMA 4RW7A 3VQ9A 1D9FA 5I42A 3RTVA 3AVJA 4CEEA 3NAEA 2VG5A 3L2QA 1W0HA 3NGYA 2XO7A 4F2RA 1TKDA 3TABA 4B9VA 3ITHA 2I5JA 1L3VA 4DU3A 3DLGA 3VQQA 1NKEA 4B08A 1S1WA 4CFCA 1IG9A 3OYCA 3KKSA 1LAVA 3F9KA 2W42A 3KLGA 4HTUA 2GV9A 3AVIA 4CK2A 2Y1IA 4CHNA 4W5TA 3ISNC 5DMRA 3HPOA 3V9SA 4N41A 3KLFA 4R5PA 1DTTA 1VSKA 3AVNA 4CECA 4W5NA 4HCBA 1JLQA 1RTJA 4CJFA 4O5BA 3AA5X 3K5OA 3CYMA 4OVLA 3LP2A 4QAGA 3L8BA 1CXQA 1S1TA 4CGFA 3MXMA 4B9TA 3DLHA 4PUOA 1CZBA 1C1CA 1JL1A 2Q3SA 4J2EA 4Z4IA 3AVGA 3LWMA 1JXEA 4I9LA 4CF8A 3MECA 4DTSA 4B3OA 4RW6A 4C8OA 4AHTA 1NK4A 3WNHA 4DSFA 4CHPA 3MEDA 1RT4A 3OYEA 1SL0A 3M8QA 4M42A 2YNGA 4PY5A 2RPIA 4CGGA 4FJMA 2FC0A 3F73A 3KD1E 1B92A 3P83D 4H4OA 4LH4A 1HYZA 2FBVA 4CIEA 3SUQA 1SKSA 2YNIA 3TI0A 4NCBA 2F8TA 2P1JA 3DRSA 3DM2A 3LWLA 3SQ0A 2A1RA 1REVA 3AA4A 4KTWA 1C1AA 2XRIA 4CIGA 3LZJA 3TAFA 4ELTA 5DK5A 4N47A 1C6VA 4GW6A 3AO2A 1S1XA 4CF1A 1X9WA 2HHVA 3VQBA 3U3YA 3K5MA 1RT2A 2ZE2A 3NH2A 1L3TA 4MQ3A 3NE6A 3DYAA 1ITGA 4LSNA 4C8KA 2YHAA 1Q9XA 4CGDA 5JS1A 3AVAA 3K57A 1UWBA 3I8DA 1UA1A 1NKBA 4CK1A 3RWUA 2NUBA 2BANA 3DLEA 3ZSVA 4AHCA 3I0RA 1IKYA 3OYJA 3MXIA 3T3FA 4CHQA 2X74A 3SQ2A 3SQ4A 4Z4EA 1KVCA 1HMVA 4KKOA 1U4BA 3MXJA 5CYQA 2E6MA 5KGWA 1RBUA 1D5AA 2XY8A 3PX6A 3NF9A 4CJPA 3K59A 3OJSA 3MEEA 2D5RA 5C24A 4E7LA 1L5UA 4FJ9A 1YVUA 3AVMA 4E89A 4CGIA 1CZ9A 4W5OA 3QO9A 3AO5A 5HRRA 4KB0A 1NJXA 3T19A 4CJLA 1BI4B 1B9FA 4AH9A 4J2BA 4HUEA 4FXDA 4H8KA 4G1QA 1BIUA 3ZSZA 1KRPA 1BGXT 4WE1A 4CF9A 4KAZA 5J2NA 3SZ2A 1TK8A 4CFDA 1WSEA 3V1OA 2IOCA 4FLZA 3S3NA 4CE9A 4DTJA 4BE1A 4DSIA 3DI6A 2XHBA 1J9AA 4CJRA 3OVNA 4KHWA 1ZBHA 1LWCA 2BDPA 2DTUA 4IFVA 4M3ZA 1SKWA 3LAMA 3RR7A 3P1GA 4CGHA 1D8YA 1YT3A 4CJQA 1X9MA 1WSJA 1EX4A 4JRQA 4FJXA 4FW2A 1KVBA 3AA2A 5T7BA 1RDAA 3ZSRA 3K5NA 4OKKA 1KLMA 4DF4A 3UIQA 1T05A 1DTQA 2HVIA 3TR8A 1WLJA 1C0TA 2O4GA 4FLUA 1XI1A 4FK4A 3DLKA 4DQSA 3L2UA 2PY5A 1BCOA 2LSNA 3VQEA 2P51A 2RKIA 4TSXA 4N56A 4E7JA 4LY7A 4ICLA 1QTMA 1JL2A 3VA0A 2DFFA 4PWDA 3HVRA 2E6LA 3S3MA 3V9UA 2KZZA 2P5GA 3WNEA 4OLAA 3TWHA
chains in the Genus database with same CATH superfamily
1TV6A 3O08A 4RWTA 3C7NA 3QEWA 4ELVA 4CCHA 2HF4A 3QLHA 2VG6A 3ALYA 2FSJA 1QHTA 1JCGA 3A5LC 4KH6A 1J5OA 1QZ6A 3OW2M 4H5RA 5AQYA 3LDOA 4NCGA 3EE9A 4I2PA 5FRMA 4B1VA 2NZTA 1RBRA 3OBWA 3CJ1A 3VQ7A 1EETA 4ISEA 3D2FB 2OPRA 4QS8A 2DFEA 4B1XB 3SYZA 1DT9A 3RR8A 2YHYA 1VK0A 1HPZA 3D2EA 4CEBA 3O1WA 3ZSQA 1A5XA 3THWB 2GTDA 4A2AA 3KK2A 3THXB 1NGDA 3C95A 1UA0A 1S1VA 2OCEA 4L3QA 1TL1A 3CQYA 5AZIA 4IDKA 5KRTA 3HTVA 2P9KB 1ATSA 3OY9A 3HK2A 2V7ZA 3IG1A 1RDCA 2XY5A 1NM1A 4WQ4A 1ZYQA 1TKTA 3OYIA 4IFYA 1VSEA 5AFUA 2I7NA 4HWIA 3CCMN 4FLVA 3ZYYX 2XY6A 3JXUA 3JYTA 2PYJA 4IO9L 4FJ7A 4H4MA 4CGJA 3AO3A 2E5LK 1C0GA 3K9JA 4CEAA 5I9EB 4BDPA 5HRSA 2QEXN 2OZMA 1RBTA 4JHDA 3TTDA 4GNIA 1TAUA 1RTDA 1T3VA 4J2AA 4FJKA 2HB5A 3CC2N 1EQYA 4DB3A 4KHSA 1RT1A 4A5BA 1P8ZA 3CQXA 4GKKK 2UUBK 3KKRA 3PUFA 4JK8A 2FBYA 1BQNA 3SJJA 3CMEN 4NXNK 3BF3A 2OYQA 3AAQA 4FLWA 1O1WA 1QHAA 4CJ5A 4FWQA 3OYDA 2HNZA 2QWLA 2IGIA 1OH5A 4IJAA 5M1NA 1S5JA 1TK5A 3WNFA 2KW4A 4JKDA 4PKHA 4Q0BA 4A2BA 5EU7A 4U7BA 5HL7L 5C0YA 4FJ8A 2YNFA 3C6UA 4YHHK 1ATNA 2JGUA 4CEQA 5KPTA 1BA1A 2O8CA 4LH5A 4FK2A 1KVAA 1KXPA 1W2BM 3R1XA 4H5WA 4C23A 3EYZA 1VQLN 5GADP 4E3SA 4WCEL 4QS7A 3LL3A 3SI6A 4XIUA 3CCUN 4F3OA 3MCPA 2JWKA 4DV0K 4KI6A 3ZT3A 4IOCL 4DU4A 3CCEN 4N76A 2ITGA 3THWA 2Z1GA 2VGNA 4LF4K 1SAZA 1BG3A 5FPDA 3KLIA 3S41A 2CGLA 3EZWA 2P9UB 2DY4A 1WAFA 2KKZA 3O80A 1IG8A 4BDZA 1SZ2A 1SL1A 2P9IB 3ASMA 3E9OA 4FCYA 4JI6K 3V1RA 4CHYA 3L3UA 1CZAN 2QKBA 3OYKA 3G4SN 4GVMA 3QESA 1XHXA 1FW6A 4IBNA 3MEGA 4CI6A 3VF4A 4V19S 3VGMA 3ZX0A 2F9WA 1SUQA 3T1HK 1T6DA 3J7YP 3JSMA 1J53A 3VQPA 3FZLA 3OYBA 1XUPO 1HJOA 2P5OA 5EXWA 1A5VA 1V4TA 3JAMO 1KSPA 3AA3A 3RMBA 4E1MA 4CHZA 3V9ZA 1NK6A 3C65A 3SQ1A 3CCQN 4OO1J 4JD2B 3B6OA 4PL7A 3QNOA 3SAGA 2UXCK 4JKGA 1HQUA 1K9MO 5F1XA 4AHUA 2P9PA 4W5QA 5B8HA 4M7XA 5CHIA 2Z1HA 1B9DA 4M3YA 2BUPA 4YOVA 2DFHA 2HSTA 4BRCA 2YHBA 3J7AP 3HP6A 4B9UA 1NJYA 3SNNA 2VCPA 3QEPA 2HHSA 3JS6A 4DFPA 2D0CA 3BZKA 4CW7B 4UY8O 1C0UA 1K73O 4B1UB 5BPMA 1NOZA 4JI0K 2RN2A 2F4VK 1SS6A 3OYMA 3SV4A 2KFZA 5K14A 3L0QA 3KK3A 1YTAA 5KPRA 3UKRA 5J2PA 3H46O 2FSNA 4FM0A 2CH5A 5TKWA 1OVYA 3VERA 2RF2A 1QSLA 4B9SA 1NK5A 3NMUA 2ETJA 1S6QA 2QI2A 3TAPA 3D45A 3SMSA 1KQSM 1ZBIA 4YOTA 5EY4A 2P9UA 4BR5A 5BN8A 2BGGA 3MAQA 2A41A 2F8SA 1YXQA 2X78A 5F0XA 2YNHA 3BDPA 5AQSA 1K6YA 4E19A 4FJGA 1FJGK 1Q81O 3O8MA 4E0DA 1TKZA 3CM6A 3KD5E 3H1QA 3IS9A 4KO0A 3E1YA 4I9QA 4HUGA 3VQDA 3DXMB 3PV8A 3CQ8A 1D9DA 4LF9K 4DG1A 1RTIA 4CESA 4RW7A 4JKFA 4YOYA 3RTVA 3AVJA 1EWRA 3M3ZA 4CVNE 3TU5A 4DV3K 5AQJA 1VQON 3AGKA 3T7ZA 3VQQA 3VPZA 1S1WA 1XC3A 4BC2A 1IG9A 3RVCA 3WT0A 2W42A 3KLGA 3VMFB 2D4WA 4CHNA 5JLFA 4N41A 2HOEA 4WFAL 3VEVA 3KLFA 2NRHA 3AVNA 4HCBA 4WQ4C 1JLQA 4BE0A 4QAGA 3AA5X 3K5OA 4OVLA 3LP2A 3IMXA 5AQWA 5FPNA 3DLHA 5LY3A 4PUOA 2Q3SA 4CD3A 4Z4IA 3UB5A 3MECA 4C8OA 5DM7L 1GLJO 1E3MA 1RT4A 1SL0A 3M8QA 2YNGA 2RPIA 4ISGA 4FJMA 3IFRA 2A40A 1B92A 3P83D 4IOAL 2YNIA 3TI0A 2P1JA 1NGHA 3SQ0A 2A1RA 4CIGA 4ELTA 4FL9A 3TAFA 5E84A 2F7TA 3VEZA 3FLCO 4GW6A 3VTHA 4A57A 1S1XA 4B9QA 3H3NO 2H3GX 3CCJN 3VENA 3DYAA 4DV7K 3K57A 1NKBA 2ZJQL 1NGFA 1Q18A 3EEQA 2NUBA 4FVUA 2GWKA 3MX5A 2PFUA 3P38A 3SQ4A 1GLEG 4CZEA 4KKOA 5CYQA 4IOXA 2E6MA 5KGWA 4H0OA 1D5AA 2NNWA 4DV2K 3NF9A 2AA4A 4E7LA 4IXCA 4E89A 2QA4N 4XH1A 4CJLA 1RFQA 4CD1A 5KPZA 3BEXA 4H8KA 4CZGA 1BGXT 4CF9A 4KAZA 5J2NA 3V1OA 1KAYA 4BE1A 1TUYA 1R59O 3DI6A 1J9AA 5MLCQ 2XHBA 1HNZK 1ZBHA 2BDPA 1XQSC 4M3ZA 4BRIA 3RR7A 4CGHA 3DXMA 1EX4A 3FFKB 1RDAA 4FOIA 1T05A 1JJ2M 1Y64A 4JN4A 2HBMA 1HR0K 5C10A 4FLUA 3L2UA 2LSNA 2P51A 4TSXA 3ZETA 2O8DB 2KZZA 3AY9A 3WNEA 4RCHA 3KTQA 3AV9A 4DTMA 1NK8A 3LPTA 3NBPA 4FWOA 2NRVA 4CBUA 5GAEP 2ASOA 2IAJA 1ILYA 2GWJA 4I6MA 4A59A 4CBXA 3I33A 5CZ1A 4E7KA 1NGGA 1NGEA 1WOQA 2Z1IA 4O44A 4UQGA 3EZ5A 3IAYA 1WUAA 4KHQA 4O8UA 4CZLA 2B6AA 4RW8A 5HROA 1NK0A 3L6QA 4EHTA 2A6AA 4FLXA 4CFAA 1TAQA 4MO4A 4DTNA 1LWFA 4BQLA 1U47A 1YJWN 1Z26A 5A2QO 3FZMA 4BVOA 1KAZA 2UUAK 1FKPA 3O5BA 1Q8IA 3F5TA 2QWPA 3QIPA 1HPMA 2IS3A 2AJQA 3OJUA 1YIJN 1L3UA 4FSVA 4WF9L 2P9SB 1T03A 4QCLA 2OPQA 1IKXA 3PX4A 5HRNA 1VSDA 1E4GT 4YFUA 3QEVA 2D0OA 1T7PA 3RRGA 4J2DA 4DUZK 3PY8A 1NMDA 1RDWX 4LF8K 3ZSOA 3LPUA 4X64K 5BR8K 4YNQA 3NDKA 2VQFK 5F2RA 3O4QA 1K8KA 2P9NB 3BF1A 3THVA 2ZJRL 2BH1A 3GL1A 1Z05A 4IG3A 1X9JA 4FWPA 4AM6A 4EZ6A 2HBJA 4LFAK 1TGOA 4OLBA 2FF6A 1T6CA 3ULEA 1BHLA 3I0SA 1RBVA 5AQFA 1NJWA 2X6SA 3N4PA 3HM9A 3HXMA 1YVNA 1K8AO 1HNXK 4MFBA 4AHSA 5LL6Z 5AQKA 1S9GA 4PHTX 1X9SA 3RMAA 3KLEA 3PX0A 2IVNA 4EP5A 5BRHA 2FXUA 3OBYA 4CK3A 2G8HA 3IDHA 5IT9O 4O55A 3TARA 1ZBSA 1RBSA 2YX6A 4IG0A 5SWMA 5AQPA 3WXIA 3KZBA 5EOYA 3O4NA 4BY9C 5M1OA 4H03B 2FBTA 4JK9A 4MLEA 3EN9A 2O8DA 3WUHA 1NG9A 3J7ZO 3QBWA 3L2RA 1NGIA 5CY4A 5KGXA 2QK9A 3D6RA 3I55N 3TSQA 3M1FA 4M45A 4NYFA 5AQOA 4ELUA 4DQIA 1SV5A 5E26A 4AILC 4NO7A 4H0PA 4DR5K 3GE1A 4JEPA 1LV5A 4A5AA 2G8FA 3O1BA 5M1FA 4NYNA 3TAQA 4B9NA 4FYDA 1EXQA 4A62A 2QKKA 5HLFA 5BPNA 1MU2A 1WSFA 4IDHA 4BR0A 2G8KA 2P9LB 3LZIA 3M8PA 3VF2A 4GV6A 2AP1A 4MO5A 3KWIA 4LF7K 2KTQA 3QIOA 1VQNN 3QDKA 4B8CA 3HM8A 4O4GA 3HI0A 2O8EB 4YDUA 4AM7A 2YHWA 2R7YA 1GLFO 4F2SA 1GOAA 4OPAA 3EKSA 4ZHRA 1ZBUA 1V4SA 1IKWA 4XH5A 5FDLA 2UXDK 3SAFA 3ZSXA 3VQ8A 3VQ6A 5J2MA 2HHWA 1WSIA 3J81O 1TK0A 2QWRA 4BRMA 4E1NA 2Q0RA 4B9MA 1QZ5A 5GIPA 2HHHK 1HKGA 2PYLA 1J54A 4E7IA 1NNEA 4EP4A 1QS4A 1NGAA 5C2FA 2HBKA 5D3GA 4CBWA 4CZMA 1X3NA 4CEOA 3H1VX 3ID8A 3VN5A 1JXBA 2G8UA 4DR6K 4H5VA 3TAEA 4FK0A 1YUWA 4Z4HA 1HUXA 2Q1NA 4FJNA 1WAJA 5KQ8A 2E88A 3H08A 4HCCA 3SMPA 3QINA 4JI3K 1HJRA 1Y97A 3DLBA 3OS2A 1YJNN 1W9HA 2YJEA 3V9WA 4ID1A 3SBGA 2HHTA 3IKMA 1WNSA 3HVTA 5AJ3K 1YHQN 1Q7YO 2BTFA 4MDBA 3GDQA 2HHUA 5J1EA 3MX2A 4DTXA 4YOXA 3R9PA 4C8MA 2HBLA 4I7FA 2KQ2A 3VQCA 4JNEA 4BRPA 4DFJA 3C6TA 4WQ5A 1HQEA 5FRNA 4JV5K 1CLQA 3KK7A 2HMPA 4CHOA 2WFBA 3U6FA 1KCFA 4N5SA 3AVCA 4B1ZA 4QOZB 2KLAA 3O6WA 3LM9A 1VQ8N 1HKCA 3EY1A 5AZJB 3CC7N 2OZSA 4MDAA 1WN7A 3D2FA 4Y1DA 4OJRA 5C42A 2Q97A 4K8XA 1HNVA 5KQDA 3K9KA 2E2OA 2V52B 3B6PA 3H6EA 3T1YK 2O8EA 1BDGA 3THXA 1NK7A 3AARA 4CZKA 2YKNA 3MWTA 5E41A 1QSSA 4KHNA 2HMIA 3M5RA 2P9KA 4YY3K 1HYVA 4ZTFA 3NFAA 3LALA 4FJIA 1D9FA 1BWFO 4CEEA 3L2QA 3NGYA 3WQTA 3ITHA 3DLGA 3Q7BA 3R6MA 1G99A 4E1JA 2GV9A 4W5TA 3ISNC 3NVKA 2VGMA 4ILHA 4R5PA 1QVFM 1RTJA 1VQ5N 4FJXA 3CYMA 4BRHA 3MXMA 1NGJA 5CR4A 1C1CA 3LDQA 3U8XA 4BGBA 4CZJA 3AVGA 4CF8A 2Q0UA 3W3DA 1VQ4N 1NK4A 3WNHA 5C12A 4FO0A 4M42A 3J80O 1SKSA 3O9UA 4NCBA 2F8TA 3DRSA 3DM2A 3AAPA 4KTWA 5IWAK 5DK5A 1C6VA 2HF3A 4PL8A 4DR7K 2E2PA 2ZE2A 2E20A 1L3TA 4IJNA 1ITGA 4AQYK 1M1KO 1Q9XA 5JS1A 3AVAA 1UA1A 3OTOK 2VQEK 4R79A 2BANA 4AHCA 4MLHA 1KD1O 1LOTB 3CIPA 4CHQA 4JKHA 1U4BA 3MXJA 1RBUA 4CJPA 3OJSA 5C24A 4BG9A 3WEEB 4FJ9A 3G71N 3QO9A 3AO5A 5HRRA 4KB0A 2ZGZA 2NRXA 1B9FA 4AH9A 5C15A 4HUEA 4FXDA 1KRPA 4WE1A 1N36K 1TK8A 4CFDA 1WSEA 2IIRA 2IOCA 4FLZA 3S3NA 4CE9A 3BZCA 4DSIA 4CJRA 3I8BA 1NLVA 4KHWA 2DTUA 3MN7A 1XMQK 3WXKA 1SKWA 3P1GA 1NU0A 1X9MA 4JRQA 4FW2A 1KVBA 3ZSRA 1U2VB 4FWNA 2P9IA 1WLJA 3EL2A 4DQSA 3WXLA 1BCOA 3VQEA 4N56A 2RKIA 4QS9A 1JL2A 3BY5A 3VA0A 3SLCA 3S3MA 2O4IA 1S72N 2EHGA 3ZX3A 4GVEA 2A1SA 4RG8A 3U3GA 3TTFA 4BREA 4K42A 3QEIA 5JS2A 4DFMA 3H45C 2VWJA 1RILA 3E9LA 1IO2A 4C1NK 4DSKA 2QXLA 2QWQA 3V6DA 1KLNA 3KK1A 3THYB 4DR1K 1VQPN 3SAHA 4X62K 4DTRA 4WYBA 1WSHA 4Y0WA 3LAKA 3CPWM 2ZM6K 4JD2A 3CJ7A 5BREA 4M3UA 4F4KA 3J8AA 1ASVA 4DTUA 3PLAA 4JS4A 4JI1K 3EKUA 3OYFA 1W97L 4BGAA 4BRNA 1Q86O 1BQMA 3SBTA 4KV8A 3LDLA 3V1QA 4F8RA 5FPEA 1X1PA 2HNYA 2ZWHA 3QEXA 4OPKA 4GMJB 3LM2A 3MN5A 1YITN 3NHGA 5AQTA 4DQRA 4X66K 1JLGA 4BWJA 2O8BB 3CCVN 3D0PA 1RTHA 1MDUB 3WEEA 4CZFA 4LSLA 4OGEA 4DSLA 3FGUA 4M63C 5BRDA 4Z4CA 3T69A 5FLXO 4BRQA 4OPJA 4FJLA 4FPBA 3HT3A 2RE2A 3O9SA 4FWRA 4IWVA 1NOYA 2OA8A 1GOCA 4JKCA 3CCLN 1N34K 4KFBA 3L4QA 4KRFA 4RW9A 3ENOA 4M7YA 2QW9A 3NF6A 4DLEA 3UE5A 1SKRA 5KI6A 3HYFA 1J6ZA 1NK9A 4DTPA 4LD0A 4CFBA 5FROA 1ASWA 3ATUA 5AQZA 2KFNA 4CJEA 1SL2A 3FR0A 3BGRA 3QNNA 4WQ5C 5JVHL 4CF0A 4B1WB 3K2PA 4ILJA 1I3AA 4DLGA 5AQMA 1J5EK 3G0ZA 4K8ZA 1TYQB 2HHXA 4BACA 4B8AB 1W7AA 3KIOA 4C8LA 1NJIO 1JLAA 2A3ZA 3DAWA 2VG7A 2QTDA 3NCIA 4A61A 3G6EN 4DF8A 3OYAA 3L3VA 1GLLO 3VEWA 1LWEA 3ZCMA 2YV0X 4AHVA 3QETA 1KAXA 4DV4K 3HP9A 1WBBA 2PZSA 3CI5A 4LF5K 3M6GA 3Q7CA 1HKBA 4BR9A 2GEMA 1FK9A 1XC9A 3VQ5A 4YOUA 5M1PA 4B3TK 3CERA 2G8WA 4GKJK 4GY2B 4DR2K 1RNHA 4Q5VA 3MN9A 2HNDA 5KRSA 2GX9A 1BISA 3U4LA 1U6ZA 3KWGA 3O3GA 1VRUA 2QXFA 2YI1A 1L3SA 4BRKA 1QQCA 3FZKA 3O3FA 2O8FB 3DJCA 5BRFA 3OS1A 3SPYA 3QERA 1DLOA 5JICA 2Z1JA 3TSUA 5C25A 2DPNA 1HRHA 2E2NA 4CJSA 3VOVA 3FFIA 3G10A 4C8NA 4RTFD 4F9OA 1VSMA 4FLTA 4DUYK 3ZT2A 4BDYA 1VQ7N 4L8RB 1I39A 3CCSN 2O8BA 2UYTA 3C7NB 2A5XA 4ISFA 1WBDA 2WC9A 4FVMA 3KHYA 2Y1JA 2B4JA 3SUNA 5AR0A 2IDOA 5M1QA 1OVQA 2JLEA 1RGIA 3VESA 3LP0A 3T1AA 5GIOA 1RDBA 3PSFA 5CZ2A 5I3UA 1IJJA 3HSTB 1S9EA 3D2EB 2NRWA 1HX1A 2XY7A 1GLBG 4OKEA 4M41A 4OX9K 1D4XA 5AZIB 1FKOA 2YKMA 4FOEA 3VETA 1JCEA 4B3RK 1JKHA 1TVRA 1N5YA 1Z25A 1HNWK 1DKGD 1QE1A 4IFEA 3DLLL 1GLCG 4DV1K 1NGCA 4FZZA 4KTQA 4AF1A 4EZ9A 4EFHA 4BC3A 2PAVA 3WNGA 1Z6RA 3C6HA 3V9XA 3SUOA 3KLHA 2NRRA 1KFSA 2F96A 2BE2A 1VHXA 4ILGB 4HTLA 5GAGP 1NJZA 4JHDB 2FLOA 1JLBA 5AQQA 4BE2A 1OH8A 3CJBA 4OKJA 4CEZA 4YORA 2YCHA 1VQ6N 3W0LA 4CJVA 3A8YA 1S6PA 3OS0A 4JRPA 1YJ9N 1IH7A 4NCAA 4ID5A 3TAGA 2ATQA 4BRAA 3CFPA 3MCAB 4DHYA 3CFOA 4O8KA 3DRRA 5AQIA 4FJJA 4DQQA 1N6QA 2FBXA 5KTQA 1F21A 3DOKA 4DS4A 4NLBA 3V4IA 3MN6A 3VA3A 3ULDA 5JLHA 2F9TA 4DSJA 2X6NA 2P9SA 1DGKN 1T44A 5AQNA 5HBMA 5I42A 1N33K 2VG5A 1W0HA 1TKDA 3TABA 4B9VA 2O8CB 3QFPA 1L3VA 4DU3A 2NRTA 3P31A 1NKEA 4B08A 4BR2A 4CFCA 3KKSA 3F9KA 4DR4K 1QVGM 3AVIA 2P9NA 3BP8A 4CK2A 2Y1IA 2WTUA 2Q2RA 1DTTA 4CECA 1N8RO 4W5NA 4FWLA 2IVOA 2IVPA 4O5BA 3PSIA 1CZBA 1JL1A 5JVGL 3LWMA 1JXEA 4AHTA 4DSFA 1NMNA 1VAZA 3MEDA 3OYEA 4PY5A 2D1KA 1O13A 3KD1E 1OKJA 3HJFA 1HYZA 2UU9K 3KVGA 3LWLA 1IBLK 5AQGA 3AA4A 4H0TB 3LZJA 3ID6A 3AO2A 4CF1A 4K41A 4PKIA 3U3YA 3K5MA 3ZX2A 4XH4A 4LSNA 3FZFA 2YHAA 4CGDA 3CF5L 1Q82O 3FZHA 2OANA 4B3SK 3ZSVA 3OYJA 4KHPK 3RSEB 4Z4EA 2CGKA 1HMVA 5TKYA 1JCFA 2XY8A 4LC9B 3K59A 3WXMB 5AQHA 3H3OB 4CGIA 1CZ9A 3EO3A 1NJXA 4JKGB 4JI4K 1BI4B 1QQNA 2QWMA 2W6LA 3CJ9A 1BIUA 3ZSZA 2P9PB 2E8AA 4IEIA 2CH6A 4DTJA 2EWSA 3OVNA 4NB4A 1LWCA 4IFVA 3WQUA 2P9LA 3LDPA 2ASPA 4CZIA 3VF6A 3AA2A 2ITMA 4PKGA 3VGLA 5T7BA 3K5NA 1GLDG 1KLMA 3TR8A 4FK4A 3EE8A 3DLKA 2PY5A 4LY7A 4ICLA 1QTMA 5LJVA 3ENHA 2DFFA 4PWDA 2E6LA 3V9UA 4OLAA 4KH4A 3UKRB 4IZ9A 3MMVA 2WOMA 4BR4A 5AQUA 3IUCA 4CJWA 3KJVA 3QB0A 1N32K 4CJTA 4BQZA 4JI5K 3U9ZA 5BR9A 2YJFA 4PA1A 3ATVA 3OYLA 3PIOL 4FJHA 2GELA 4O0IA 3DMJA 1XMOK 1QQMA 1BO5O 2GBZA 4DSEA 3LP3A 3TTCA 1HNIA 3M8SA 3SUPA 3L2VA 3GG4A 2ZQBA 1TUUA 3ZT4A 3ZSYA 1XHZA 3CC4N 1ZC6A 5JMVA 1RT5A 1C1BA 4B3MK 4H0YB 4HVJA 1S1UA 4KBOA 3VGKA 3HZ6A 1TL3A 4EAHD 4O5FA 4K25A 3K5LA 2ZGYA 3MWPA 1JLEA 1GOBA 2QM1A 4IKFA 1VSLA 2KHOA 4Z0UA 4BRDA 1GLAG 1ZBLA 4M3TA 1UOCA 3RRHA 3PO5A 4H0VB 3RSEA 4DS5A 1RT7A 1BOTO 3SV3A 3IRXA 3CXCM 4HUFA 2KZMA 4DMNA 4LFBK 3DRPA 3NGZA 2OPSA 4K43A 3NF8A 1BI4A 3S9HA 2G8IA 4FZXC 2I7PA 4CIFA 3HPGA 5M1KA 4FM2A 4KREA 4CEFA 3PO4A 4CEDA 4WFBL 3F2KA 3ENBA 4BVPA 1I94K 2E1ZA 3CG7A 5AFUH 4C1NI 5HRPA 4BRFA 1U04A 2WONA 3ZEUB 5ADXA 4FJ5A 4JS5A 3VEOA 4JLHA 3HL8A 1U48A 4KI4A 3DOLA 1A5WA 3D7EO 5CYMA 3B8AX 5AZJA 1EKEA 3SCXA 2VWBA 4IEEA 3DXKB 4DV6K 4DQ8A 4DQPA 1LW0A 3ZLJA 4KB1A 4ZTJA 4Y1CA 4E7HA 4HHTA 3OHRA 3LP1A 3S3OA 4JI2K 1CXUA 3C94A 2HW3A 1X3MA 4JYAK 1NGBA 4KHYA 4GV3A 4FZYA 4CERA 3HBTA 1LAWA 3QICA 4CJ4A 1M90O 4EIAA 2GUIA 3SJHA 2E4LA 5LMNK 4DR3K 1RT6A 1OH6A 1EO1A 4I2QA 3HSCA 2NLXA 4DU1A 1LCUA 3O9RA 3L4IA 1T8EA 1RDUA 3NH1A 3A5MC 2NRZA 5AQLA 4OPHA 3AVBA 3VQ4A 2D0AA 1C0FA 3VQAA 5DM6L 1R0AA 3RMDA 4B1YB 1XNRK 3OYGA 3OYNA 3QFUA 4YDUC 3NF7A 2OTLN 4CF2A 3LDSA 3VEXA 1ZBFA 3LANA 4FLYA 3V81A 4DWIA 1YTUA 1ASUA 1TKXA 4H0XB 3BUZB 3ZSWA 1MWMA 3P4IA 5H1SQ 1KC8O 2UUCK 1EP4A 4BROA 4DTOA 1ESVA 3HO1A 1JLCA 3R8EA 1IKVA 4CZHA 4X65K 1VQKN 3HRGA 3ZETB 3QBXA 4PQUA 3E01A 3AO1A 2HVHA 1RCHA 4G9ZA 3WXJA 1NBWA 3A2FA 5LJWA 4IO8A 4CJUA 3AGRA 4CJ3A 4DV5K 2Q31A 3QMLA 4BWMA 5SZTA 3GOIA 5J2QA 1JLFA 4I6MB 1SQKA 4BR7A 2QWNA 1YF5L 2VWKA 1UAXA 1C0MA 4FM1A 3TANA 5AQXA 3F9MA 3CM5A 3AVKA 4M3XA 1VQ9N 1IBMK 5HOOA 2EX3A 2G8VA 2VYPA 3CETA 3ZEUA 1Q9YA 5LMUK 4NXMK 1VSFA 3GBTA 1BCMA 1NKCA 3RMCA 1QQOA 2IC3A 4CJKA 3O9TA 1ZXOA 4KHUA 3DXKA 3AVFA 1FXXA 4KPYA 4EHUA 4Z4FA 2W40A 1VSIA 1RDDA 3MK6A 1HLUA 3NGIA 2WBNA 3HPHA 4LF6K 4KTZA 4AHRA 1U49A 3FE1A 3VTIA 4FW1A 3SPZA 1LW2A 4Z4GA 1BIZA 4DFKA 2J4RA 1U45A 1EWQA 4JI7K 1U2VA 3A0IX 3P5JA 3ZT0A 2UXBK 3K0SA 5BPLA 1VSHA 1K8KB 3O4WA 1RT3A 2V7YA 3L2WA 2D0PA 2OPPA 3DWLA 3N4QA 3I56N 3CPEA 3UKUB 4M3WA 2FSKA 3ULEB 1MWKA 3AVHA 4K0KK 1KFDA 3E9PA 5ADXH 1XWLA 5HP1A 3A5OC 2ZD1A 3ZT1A 4YOWA 1VRTA 2D0BA 3DLRA 4O0JA 3CCRN 2YHXA 1QSYA 4BC5A 4H5TA 3E66A 1VSJA 3G25A 2ZF5O 4M3RA 1WSGA 3NH0A 3THYA 3AVLA 1G15A 1S22A 4F3TA 3OYHA 4W5RA 4B9LA 3M8RA 3K58A 4RW4A 2B5JA 2E1YA 4KH5A 2GUPA 3U9DA 1NWKA 3TAMA 1IV0A 1BL3A 3O3HA 2HHQA 3TPQA 4OGCA 3AO4A 1MA9B 1KTQA 3CFRA 3VQ9A 3R3LA 4JAXA 3NAEA 2OTJN 5GAHP 2WUSA 2XO7A 4F2RA 2W6KA 2I5JA 3CJCA 3PIPL 3OYCA 1LAVA 2Q36A 2W41A 4HTUA 4J8FA 2ZJPL 1DEJA 5DMRA 3HPOA 3V9SA 3CJAA 1VQMN 1BA0A 1VSKA 4Z94A 3MDQA 4CJFA 4B9TA 4BC4A 3L8BA 4BG8A 1CXQA 1S1TA 4CGFA 2E2QA 3C0BA 4J2EA 5EVZA 4H5NA 4JKBA 4I9LA 4DTSA 4B3OA 4RW6A 4CHPA 4CGGA 2FC0A 5EX5A 3F73A 4H4OA 4LH4A 5AQVA 3C6AA 1HYSA 2ASMA 2FBVA 1BUPA 4XEIA 4CIEA 4WFNL 3SUQA 2PBDA 1E4FT 1REVA 1C1AA 2XRIA 4JKAA 3NVMA 4N47A 5GINA 1X9WA 2HHVA 3VQBA 4CJ7A 3CD6N 1RT2A 1YI2N 3NH2A 4MQ3A 5BN9A 4JI8K 3A5NC 3NE6A 4DKWA 4C8KA 1XNQK 1UWBA 3I8DA 3OA9A 5AQRA 4CK1A 3UKUA 3RWUA 3DLEA 1TYQA 3I0RA 1IKYA 3MXIA 3T3FA 5FPMA 2X74A 3VEYA 3SQ2A 1KVCA 4FWKA 1YAGA 4DCHA 4LFCK 2JWLA 1ATRA 4FWMA 3PX6A 4JKEA 3MEEA 2D5RA 1L5UA 1YVUA 3AVMA 4JK7A 2V51B 4W5OA 3T19A 1S3XA 4BRGA 5ELZA 2QWOA 3P39A 4J2BA 4BRLA 3CHWA 4G1QA 3HOSA 3LDNA 3SZ2A 5C2DA 3HOTA 3TSPA 2FF3B 4U67L 3LAMA 1OH7A 1D8YA 1WB9A 1YT3A 2A42A 4NLCA 4CJQA 1WSJA 4FWSA 4OKKA 4DF4A 3UIQA 1DTQA 3CMAN 2HVIA 2O8FA 5CE3A 4FPAA 1C0TA 2O4GA 1BU6O 1XI1A 1IBKK 3O9QA 1P90A 4E7JA 1H1VA 2RHKA 4GV9A 3HVRA 2CGJA 2P5GA 3SK3A 3TWHA
chains in the Genus database with same CATH topology
2EHGA 3AV9A 1TV6A 2WOMA 4CJWA 3KJVA 4DTMA 1NK8A 2A1SA 3LPTA 3NBPA 4CJTA 4RG8A 3QEWA 4ELVA 4CCHA 3U3GA 3QLHA 2VG6A 3ALYA 2IAJA 3QEIA 1QHTA 4PA1A 5JS2A 3OYLA 4DFMA 2VWJA 5CZ1A 4E7KA 1RILA 1IO2A 1J5OA 4FJHA 2Z1IA 3DMJA 4NCGA 4O44A 4O0IA 4UQGA 4DSKA 3EZ5A 3V6DA 4I2PA 3IAYA 5FRMA 4KHQA 2GBZA 4DSEA 1KLNA 1RBRA 3KK1A 3LP3A 3VQ7A 1EETA 2B6AA 1HNIA 4DTRA 4RW8A 3M8SA 5HROA 1NK0A 2OPRA 1WSHA 3SUPA 3LAKA 3L2VA 2DFEA 4FLXA 4CFAA 3SYZA 1TAQA 3RR8A 2ZQBA 4DTNA 1LWFA 1U47A 3ZT4A 4M3UA 1VK0A 1HPZA 1Z26A 3ZSYA 4CEBA 3ZSQA 1A5XA 1XHZA 4F4KA 3KK2A 4KHNA 1FKPA 1C1BA 1RT5A 3C95A 4HVJA 1S1UA 1S1VA 1UA0A 1ASVA 4DTUA 1TL3A 1TL1A 1Q8IA 4JS4A 4IDKA 3QIPA 5KRTA 2IS3A 2AJQA 3OYFA 3K5LA 3OJUA 3OY9A 3HK2A 1JLEA 3IG1A 1L3UA 1GOBA 1RDCA 4IKFA 1VSLA 4Z0UA 1BQMA 2XY5A 1T03A 4QCLA 4KV8A 1HYSA 2OPQA 1IKXA 3V1QA 3PX4A 1ZBLA 5HRNA 1VSDA 1ZYQA 4YFUA 3QEVA 1TKTA 1T7PA 3RRGA 4F8RA 4J2DA 1UOCA 3OYIA 4M3TA 1X1PA 2HNYA 1VSEA 4IFYA 3RRHA 3PY8A 3QEXA 3PO5A 4OPKA 4DS5A 4GMJB 4FLVA 3ZSOA 1RT7A 3LPUA 4YNQA 3NHGA 4DQRA 3NDKA 1JLGA 3SV3A 4BWJA 2XY6A 3IRXA 3JYTA 4HUFA 2KZMA 3O4QA 2PYJA 3THVA 4DMNA 3D0PA 1RTHA 4FJ7A 4H4MA 3DRPA 4LSLA 4CGJA 3AO3A 4OGEA 4IG3A 4EZ6A 4CEAA 4BDPA 3NGZA 1TGOA 2OPSA 5HRSA 2OZMA 4DSLA 4OLBA 1RBTA 1BHLA 3NF8A 3I0SA 1BI4A 4Z4CA 3S9HA 1RBVA 2G8IA 4FZXC 4CIFA 1TAUA 3HPGA 4OPJA 4FM2A 1RTDA 4CEFA 1NJWA 3PO4A 4CEDA 3HT3A 4FJLA 4J2AA 2X6SA 1NOYA 4FJKA 2HB5A 3HM9A 3CG7A 2OA8A 1GOCA 3HXMA 4KHSA 5HRPA 4MFBA 1RT1A 4KFBA 4AHSA 1X9SA 1S9GA 4KRFA 3RMAA 4RW9A 1U04A 2WONA 3HJFA 3KLEA 3NF6A 3PX0A 3KKRA 4JS5A 4FJ5A 3PUFA 4JLHA 3HL8A 4EP5A 4CK3A 2FBYA 1BQNA 3DOLA 3SJJA 1U48A 1A5WA 4DLEA 1SKRA 5CYMA 5KI6A 2G8HA 2OYQA 1EKEA 3HYFA 4FLWA 4O55A 1O1WA 3SCXA 1NK9A 3TARA 4DTPA 4CJ5A 4LD0A 1RBSA 4CFBA 2HNZA 4IG0A 1ASWA 5FROA 1LW0A 5SWMA 3OYDA 4DQPA 4CJEA 4KB1A 4ZTJA 2IGIA 4Y1CA 4E7HA 1SL2A 2KFNA 4HHTA 1S5JA 3BGRA 3LP1A 3WNFA 2KW4A 4CF0A 3QNNA 3S3OA 3K2PA 1TK5A 1CXUA 4Q0BA 1I3AA 3C94A 5EU7A 4DLGA 2HW3A 3O4NA 2FBTA 4KHYA 4FJ8A 4FZYA 2YNFA 3G0ZA 4CERA 3KTQA 1LAWA 3C6UA 4CJ4A 4K8ZA 2HHXA 3L2RA 4BACA 4B8AB 2JGUA 5CY4A 5KGXA 2QK9A 2GUIA 3KIOA 2E4LA 4CEQA 4C8LA 1RT6A 1JLAA 4I2QA 4M45A 4NYFA 4ELUA 2VG7A 4DQIA 3NCIA 4DU1A 1SV5A 4AILC 4DF8A 4LH5A 3OYAA 4FK2A 1KVAA 3L3VA 1T8EA 3EYZA 3NH1A 4E3SA 3VQ4A 1LWEA 3AVBA 2YV0X 3ZCMA 4AHVA 3QETA 2D0AA 3VQAA 1LV5A 2G8FA 3HP9A 3SI6A 2PZSA 4NYNA 4XIUA 3TAQA 4F3OA 1R0AA 3RMDA 4B9NA 4FYDA 4KI6A 3ZT3A 1EXQA 2QKKA 5HLFA 3OYGA 3OYNA 4DU4A 4N76A 1FK9A 1MU2A 2ITGA 3NF7A 1XC9A 3VQ5A 4CF2A 1WSFA 3LDSA 2Z1GA 2G8WA 1ZBFA 3LANA 3KLIA 4FLYA 3V81A 4DWIA 2G8KA 1ASUA 1YTUA 1RNHA 1TKXA 4Q5VA 2HNDA 5KRSA 3LZIA 3M8PA 3ZSWA 1BISA 2DY4A 1WAFA 2KTQA 3O3GA 1VRUA 2QXFA 3QIOA 1L3SA 1QQCA 1EP4A 4DTOA 4BDZA 3O3FA 4B8CA 1SL1A 3HO1A 4O4GA 3ASMA 3OS1A 1JLCA 3SPYA 4FCYA 1IKVA 3V1RA 2R7YA 4CHYA 3L3UA 3QERA 4F2SA 1GOAA 1DLOA 2Z1JA 5C25A 4CJSA 1HRHA 4ZHRA 1ZBUA 3FFIA 3G10A 2QKBA 3OYKA 4PQUA 4GVMA 4C8NA 3E01A 1IKWA 5FDLA 3AO1A 3QESA 1RCHA 2HVHA 1VSMA 4FLTA 3A2FA 3ZSXA 3VQ8A 3ZT2A 3VQ6A 1XHXA 1I39A 4BDYA 4CJUA 4L8RB 2O4IA 5J2MA 4IBNA 3MEGA 2HHWA 4CJ3A 1WSIA 4BWMA 4FVMA 5SZTA 1TK0A 5J2QA 1JLFA 1SUQA 4E1NA 4B9MA 3JSMA 2Y1JA 2VWKA 1UAXA 1J53A 1C0MA 2B4JA 4FM1A 3VQPA 3SUNA 3TANA 3OYBA 2IDOA 2P5OA 1A5VA 2JLEA 2PYLA 3CM5A 1J54A 3AVKA 1KSPA 4M3XA 3AA3A 4E7IA 4E1MA 3LP0A 3T1AA 4CHZA 3V9ZA 3RMBA 2EX3A 2G8VA 1NK6A 3SQ1A 1RDBA 4EP4A 1QS4A 5CZ2A 5I3UA 3HSTB 1Q9YA 1S9EA 3B6OA 3QNOA 5D3GA 1VSFA 1BCMA 1NKCA 1HQUA 3RMCA 2XY7A 2IC3A 4OKEA 4AHUA 4CEOA 4M41A 4CJKA 3VN5A 1JXBA 4KHUA 4W5QA 3AVFA 1FXXA 4KPYA 4Z4FA 1FKOA 2YKMA 2G8UA 1VSIA 3TAEA 1RDDA 2Z1HA 4FK0A 3NGIA 1B9DA 1JKHA 1TVRA 3HPHA 4Z4HA 1N5YA 4M3YA 1Z25A 2DFHA 4FJNA 4KTZA 4AHRA 1U49A 2YHBA 1QE1A 1WAJA 3HP6A 4FW1A 3SPZA 1LW2A 4B9UA 3H08A 4HCCA 1NJYA 4FZZA 1BIZA 3QINA 3SNNA 4KTQA 4Z4GA 3QEPA 1HJRA 1Y97A 4BE0A 2HHSA 4DFKA 4DFPA 2D0CA 3OS2A 1U45A 3DLBA 3P5JA 3ZT0A 1W9HA 4EZ9A 3V9WA 1C0UA 4ID1A 2HHTA 1VSHA 1WNSA 3HVTA 3WNGA 1RT3A 3V9XA 3L2WA 1NOZA 3SUOA 2OPPA 2RN2A 3KLHA 1KFSA 2F96A 2HHUA 2BE2A 3OYMA 3SV4A 2KFZA 4M3WA 5K14A 5J1EA 4DTXA 3AVHA 1YTAA 4C8MA 1KFDA 3KK3A 4I7FA 2KQ2A 5J2PA 1NJZA 1JLBA 1XWLA 5HP1A 4BE2A 3VQCA 2ZD1A 4FM0A 3ZT1A 4OKJA 1VRTA 4CEZA 4DFJA 2RF2A 3C6TA 4CJVA 1HQEA 2D0BA 3DLRA 1NK5A 4O0JA 1QSLA 4B9SA 5FRNA 1S6PA 1CLQA 4CHOA 3U6FA 1QSYA 2ETJA 1KCFA 1S6QA 4N5SA 3OS0A 4JRPA 3AVCA 3TAPA 1VSJA 3D45A 4QOZB 1ZBIA 1IH7A 4KREA 4M3RA 4NCAA 1WSGA 4ID5A 3NH0A 3TAGA 3AVLA 1G15A 3EY1A 2ATQA 3CFPA 2OZSA 4F3TA 1WN7A 4Y1DA 2BGGA 4OJRA 5C42A 3MAQA 3OYHA 4W5RA 2F8SA 4K8XA 2X78A 1HNVA 2YNHA 4B9LA 3BDPA 3M8RA 3K58A 3B6PA 3CFOA 1K6YA 3DRRA 2B5JA 4RW4A 4E19A 4FJGA 4FJJA 4DQQA 4E0DA 1NK7A 1N6QA 2FBXA 4KI4A 1TKZA 3CM6A 3KD5E 5KTQA 1F21A 3TAMA 3DOKA 1BL3A 2YKNA 3IS9A 4KO0A 3O3HA 4DS4A 3V4IA 2HHQA 5E41A 1QSSA 4I9QA 4HUGA 2HMIA 3VQDA 3VA3A 4OGCA 3ULDA 3CQ8A 3PV8A 1D9DA 3AO4A 1HYVA 4DSJA 2X6NA 3NFAA 4DG1A 1RTIA 4ZTFA 3LALA 1KTQA 4FJIA 4CESA 3CFRA 5HBMA 4RW7A 3VQ9A 1D9FA 5I42A 3RTVA 3AVJA 4CEEA 3NAEA 2VG5A 3L2QA 1W0HA 3NGYA 2XO7A 4F2RA 1TKDA 3TABA 4B9VA 3ITHA 2I5JA 1L3VA 4DU3A 3DLGA 3VQQA 1NKEA 4B08A 1S1WA 4CFCA 1IG9A 3OYCA 3KKSA 1LAVA 3F9KA 2W42A 3KLGA 4HTUA 2GV9A 3AVIA 4CK2A 2Y1IA 4CHNA 4W5TA 3ISNC 5DMRA 3HPOA 3V9SA 4N41A 3KLFA 4R5PA 1DTTA 1VSKA 3AVNA 4CECA 4W5NA 4HCBA 1JLQA 1RTJA 4CJFA 4O5BA 3AA5X 3K5OA 3CYMA 4OVLA 3LP2A 4QAGA 3L8BA 1CXQA 1S1TA 4CGFA 3MXMA 4B9TA 3DLHA 4PUOA 1CZBA 1C1CA 1JL1A 2Q3SA 4J2EA 4Z4IA 3AVGA 3LWMA 1JXEA 4I9LA 4CF8A 3MECA 4DTSA 4B3OA 4RW6A 4C8OA 4AHTA 1NK4A 3WNHA 4DSFA 4CHPA 3MEDA 1RT4A 3OYEA 1SL0A 3M8QA 4M42A 2YNGA 4PY5A 2RPIA 4CGGA 4FJMA 2FC0A 3F73A 3KD1E 1B92A 3P83D 4H4OA 4LH4A 1HYZA 2FBVA 4CIEA 3SUQA 1SKSA 2YNIA 3TI0A 4NCBA 2F8TA 2P1JA 3DRSA 3DM2A 3LWLA 3SQ0A 2A1RA 1REVA 3AA4A 4KTWA 1C1AA 2XRIA 4CIGA 3LZJA 3TAFA 4ELTA 5DK5A 4N47A 1C6VA 4GW6A 3AO2A 1S1XA 4CF1A 1X9WA 2HHVA 3VQBA 3U3YA 3K5MA 1RT2A 2ZE2A 3NH2A 1L3TA 4MQ3A 3NE6A 3DYAA 1ITGA 4LSNA 4C8KA 2YHAA 1Q9XA 4CGDA 5JS1A 3AVAA 3K57A 1UWBA 3I8DA 1UA1A 1NKBA 4CK1A 3RWUA 2NUBA 2BANA 3DLEA 3ZSVA 4AHCA 3I0RA 1IKYA 3OYJA 3MXIA 3T3FA 4CHQA 2X74A 3SQ2A 3SQ4A 4Z4EA 1KVCA 1HMVA 4KKOA 1U4BA 3MXJA 5CYQA 2E6MA 5KGWA 1RBUA 1D5AA 2XY8A 3PX6A 3NF9A 4CJPA 3K59A 3OJSA 3MEEA 2D5RA 5C24A 4E7LA 1L5UA 4FJ9A 1YVUA 3AVMA 4E89A 4CGIA 1CZ9A 4W5OA 3QO9A 3AO5A 5HRRA 4KB0A 1NJXA 3T19A 4CJLA 1BI4B 1B9FA 4AH9A 4J2BA 4HUEA 4FXDA 4H8KA 4G1QA 1BIUA 3ZSZA 1KRPA 1BGXT 4WE1A 4CF9A 4KAZA 5J2NA 3SZ2A 1TK8A 4CFDA 1WSEA 3V1OA 2IOCA 4FLZA 3S3NA 4CE9A 4DTJA 4BE1A 4DSIA 3DI6A 2XHBA 1J9AA 4CJRA 3OVNA 4KHWA 1ZBHA 1LWCA 2BDPA 2DTUA 4IFVA 4M3ZA 1SKWA 3LAMA 3RR7A 3P1GA 4CGHA 1D8YA 1YT3A 4CJQA 1X9MA 1WSJA 1EX4A 4JRQA 4FJXA 4FW2A 1KVBA 3AA2A 5T7BA 1RDAA 3ZSRA 3K5NA 4OKKA 1KLMA 4DF4A 3UIQA 1T05A 1DTQA 2HVIA 3TR8A 1WLJA 1C0TA 2O4GA 4FLUA 1XI1A 4FK4A 3DLKA 4DQSA 3L2UA 2PY5A 1BCOA 2LSNA 3VQEA 2P51A 2RKIA 4TSXA 4N56A 4E7JA 4LY7A 4ICLA 1QTMA 1JL2A 3VA0A 2DFFA 4PWDA 3HVRA 2E6LA 3S3MA 3V9UA 2KZZA 2P5GA 3WNEA 4OLAA 3TWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EHG A;  3AV9 A;  1TV6 A;  2WOM A;  4CJW A;  3KJV A;  4DTM A;  1NK8 A;  2A1S A;  3LPT A;  3NBP A;  4CJT A;  4RG8 A;  3QEW A;  4ELV A;  4CCH A;  3U3G A;  3QLH A;  2VG6 A;  3ALY A;  2IAJ A;  3QEI A;  1QHT A;  4PA1 A;  5JS2 A;  3OYL A;  4DFM A;  2VWJ A;  5CZ1 A;  4E7K A;  1RIL A;  1IO2 A;  1J5O A;  4FJH A;  2Z1I A;  3DMJ A;  4NCG A;  4O44 A;  4O0I A;  4UQG A;  4DSK A;  3EZ5 A;  3V6D A;  4I2P A;  3IAY A;  5FRM A;  4KHQ A;  2GBZ A;  4DSE A;  1KLN A;  1RBR A;  3KK1 A;  3LP3 A;  3VQ7 A;  1EET A;  2B6A A;  1HNI A;  4DTR A;  4RW8 A;  3M8S A;  5HRO A;  1NK0 A;  2OPR A;  1WSH A;  3SUP A;  3LAK A;  3L2V A;  2DFE A;  4FLX A;  4CFA A;  3SYZ A;  1TAQ A;  3RR8 A;  2ZQB A;  4DTN A;  1LWF A;  1U47 A;  3ZT4 A;  4M3U A;  1VK0 A;  1HPZ A;  1Z26 A;  3ZSY A;  4CEB A;  3ZSQ A;  1A5X A;  1XHZ A;  4F4K A;  3KK2 A;  4KHN A;  1FKP A;  1C1B A;  1RT5 A;  3C95 A;  4HVJ A;  1S1U A;  1S1V A;  1UA0 A;  1ASV A;  4DTU A;  1TL3 A;  1TL1 A;  1Q8I A;  4JS4 A;  4IDK A;  3QIP A;  5KRT A;  2IS3 A;  2AJQ A;  3OYF A;  3K5L A;  3OJU A;  3OY9 A;  3HK2 A;  1JLE A;  3IG1 A;  1L3U A;  1GOB A;  1RDC A;  4IKF A;  1VSL A;  4Z0U A;  1BQM A;  2XY5 A;  1T03 A;  4QCL A;  4KV8 A;  1HYS A;  2OPQ A;  1IKX A;  3V1Q A;  3PX4 A;  1ZBL A;  5HRN A;  1VSD A;  1ZYQ A;  4YFU A;  3QEV A;  1TKT A;  1T7P A;  3RRG A;  4F8R A;  4J2D A;  1UOC A;  3OYI A;  4M3T A;  1X1P A;  2HNY A;  1VSE A;  4IFY A;  3RRH A;  3PY8 A;  3QEX A;  3PO5 A;  4OPK A;  4DS5 A;  4GMJ B;  4FLV A;  3ZSO A;  1RT7 A;  3LPU A;  4YNQ A;  3NHG A;  4DQR A;  3NDK A;  1JLG A;  3SV3 A;  4BWJ A;  2XY6 A;  3IRX A;  3JYT A;  4HUF A;  2KZM A;  3O4Q A;  2PYJ A;  3THV A;  4DMN A;  3D0P A;  1RTH A;  4FJ7 A;  4H4M A;  3DRP A;  4LSL A;  4CGJ A;  3AO3 A;  4OGE A;  4IG3 A;  4EZ6 A;  4CEA A;  4BDP A;  3NGZ A;  1TGO A;  2OPS A;  5HRS A;  2OZM A;  4DSL A;  4OLB A;  1RBT A;  1BHL A;  3NF8 A;  3I0S A;  1BI4 A;  4Z4C A;  3S9H A;  1RBV A;  2G8I A;  4FZX C;  4CIF A;  1TAU A;  3HPG A;  4OPJ A;  4FM2 A;  1RTD A;  4CEF A;  1NJW A;  3PO4 A;  4CED A;  3HT3 A;  4FJL A;  4J2A A;  2X6S A;  1NOY A;  4FJK A;  2HB5 A;  3HM9 A;  3CG7 A;  2OA8 A;  1GOC A;  3HXM A;  4KHS A;  5HRP A;  4MFB A;  1RT1 A;  4KFB A;  4AHS A;  1X9S A;  1S9G A;  4KRF A;  3RMA A;  4RW9 A;  1U04 A;  2WON A;  3HJF A;  3KLE A;  3NF6 A;  3PX0 A;  3KKR A;  4JS5 A;  4FJ5 A;  3PUF A;  4JLH A;  3HL8 A;  4EP5 A;  4CK3 A;  2FBY A;  1BQN A;  3DOL A;  3SJJ A;  1U48 A;  1A5W A;  4DLE A;  1SKR A;  5CYM A;  5KI6 A;  2G8H A;  2OYQ A;  1EKE A;  3HYF A;  4FLW A;  4O55 A;  1O1W A;  3SCX A;  1NK9 A;  3TAR A;  4DTP A;  4CJ5 A;  4LD0 A;  1RBS A;  4CFB A;  2HNZ A;  4IG0 A;  1ASW A;  5FRO A;  1LW0 A;  5SWM A;  3OYD A;  4DQP A;  4CJE A;  4KB1 A;  4ZTJ A;  2IGI A;  4Y1C A;  4E7H A;  1SL2 A;  2KFN A;  4HHT A;  1S5J A;  3BGR A;  3LP1 A;  3WNF A;  2KW4 A;  4CF0 A;  3QNN A;  3S3O A;  3K2P A;  1TK5 A;  1CXU A;  4Q0B A;  1I3A A;  3C94 A;  5EU7 A;  4DLG A;  2HW3 A;  3O4N A;  2FBT A;  4KHY A;  4FJ8 A;  4FZY A;  2YNF A;  3G0Z A;  4CER A;  3KTQ A;  1LAW A;  3C6U A;  4CJ4 A;  4K8Z A;  2HHX A;  3L2R A;  4BAC A;  4B8A B;  2JGU A;  5CY4 A;  5KGX A;  2QK9 A;  2GUI A;  3KIO A;  2E4L A;  4CEQ A;  4C8L A;  1RT6 A;  1JLA A;  4I2Q A;  4M45 A;  4NYF A;  4ELU A;  2VG7 A;  4DQI A;  3NCI A;  4DU1 A;  1SV5 A;  4AIL C;  4DF8 A;  4LH5 A;  3OYA A;  4FK2 A;  1KVA A;  3L3V A;  1T8E A;  3EYZ A;  3NH1 A;  4E3S A;  3VQ4 A;  1LWE A;  3AVB A;  2YV0 X;  3ZCM A;  4AHV A;  3QET A;  2D0A A;  3VQA A;  1LV5 A;  2G8F A;  3HP9 A;  3SI6 A;  2PZS A;  4NYN A;  4XIU A;  3TAQ A;  4F3O A;  1R0A A;  3RMD A;  4B9N A;  4FYD A;  4KI6 A;  3ZT3 A;  1EXQ A;  2QKK A;  5HLF A;  3OYG A;  3OYN A;  4DU4 A;  4N76 A;  1FK9 A;  1MU2 A;  2ITG A;  3NF7 A;  1XC9 A;  3VQ5 A;  4CF2 A;  1WSF A;  3LDS A;  2Z1G A;  2G8W A;  1ZBF A;  3LAN A;  3KLI A;  4FLY A;  3V81 A;  4DWI A;  2G8K A;  1ASU A;  1YTU A;  1RNH A;  1TKX A;  4Q5V A;  2HND A;  5KRS A;  3LZI A;  3M8P A;  3ZSW A;  1BIS A;  2DY4 A;  1WAF A;  2KTQ A;  3O3G A;  1VRU A;  2QXF A;  3QIO A;  1L3S A;  1QQC A;  1EP4 A;  4DTO A;  4BDZ A;  3O3F A;  4B8C A;  1SL1 A;  3HO1 A;  4O4G A;  3ASM A;  3OS1 A;  1JLC A;  3SPY A;  4FCY A;  1IKV A;  3V1R A;  2R7Y A;  4CHY A;  3L3U A;  3QER A;  4F2S A;  1GOA A;  1DLO A;  2Z1J A;  5C25 A;  4CJS A;  1HRH A;  4ZHR A;  1ZBU A;  3FFI A;  3G10 A;  2QKB A;  3OYK A;  4PQU A;  4GVM A;  4C8N A;  3E01 A;  1IKW A;  5FDL A;  3AO1 A;  3QES A;  1RCH A;  2HVH A;  1VSM A;  4FLT A;  3A2F A;  3ZSX A;  3VQ8 A;  3ZT2 A;  3VQ6 A;  1XHX A;  1I39 A;  4BDY A;  4CJU A;  4L8R B;  2O4I A;  5J2M A;  4IBN A;  3MEG A;  2HHW A;  4CJ3 A;  1WSI A;  4BWM A;  4FVM A;  5SZT A;  1TK0 A;  5J2Q A;  1JLF A;  1SUQ A;  4E1N A;  4B9M A;  3JSM A;  2Y1J A;  2VWK A;  1UAX A;  1J53 A;  1C0M A;  2B4J A;  4FM1 A;  3VQP A;  3SUN A;  3TAN A;  3OYB A;  2IDO A;  2P5O A;  1A5V A;  2JLE A;  2PYL A;  3CM5 A;  1J54 A;  3AVK A;  1KSP A;  4M3X A;  3AA3 A;  4E7I A;  4E1M A;  3LP0 A;  3T1A A;  4CHZ A;  3V9Z A;  3RMB A;  2EX3 A;  2G8V A;  1NK6 A;  3SQ1 A;  1RDB A;  4EP4 A;  1QS4 A;  5CZ2 A;  5I3U A;  3HST B;  1Q9Y A;  1S9E A;  3B6O A;  3QNO A;  5D3G A;  1VSF A;  1BCM A;  1NKC A;  1HQU A;  3RMC A;  2XY7 A;  2IC3 A;  4OKE A;  4AHU A;  4CEO A;  4M41 A;  4CJK A;  3VN5 A;  1JXB A;  4KHU A;  4W5Q A;  3AVF A;  1FXX A;  4KPY A;  4Z4F A;  1FKO A;  2YKM A;  2G8U A;  1VSI A;  3TAE A;  1RDD A;  2Z1H A;  4FK0 A;  3NGI A;  1B9D A;  1JKH A;  1TVR A;  3HPH A;  4Z4H A;  1N5Y A;  4M3Y A;  1Z25 A;  2DFH A;  4FJN A;  4KTZ A;  4AHR A;  1U49 A;  2YHB A;  1QE1 A;  1WAJ A;  3HP6 A;  4FW1 A;  3SPZ A;  1LW2 A;  4B9U A;  3H08 A;  4HCC A;  1NJY A;  4FZZ A;  1BIZ A;  3QIN A;  3SNN A;  4KTQ A;  4Z4G A;  3QEP A;  1HJR A;  1Y97 A;  4BE0 A;  2HHS A;  4DFK A;  4DFP A;  2D0C A;  3OS2 A;  1U45 A;  3DLB A;  3P5J A;  3ZT0 A;  1W9H A;  4EZ9 A;  3V9W A;  1C0U A;  4ID1 A;  2HHT A;  1VSH A;  1WNS A;  3HVT A;  3WNG A;  1RT3 A;  3V9X A;  3L2W A;  1NOZ A;  3SUO A;  2OPP A;  2RN2 A;  3KLH A;  1KFS A;  2F96 A;  2HHU A;  2BE2 A;  3OYM A;  3SV4 A;  2KFZ A;  4M3W A;  5K14 A;  5J1E A;  4DTX A;  3AVH A;  1YTA A;  4C8M A;  1KFD A;  3KK3 A;  4I7F A;  2KQ2 A;  5J2P A;  1NJZ A;  1JLB A;  1XWL A;  5HP1 A;  4BE2 A;  3VQC A;  2ZD1 A;  4FM0 A;  3ZT1 A;  4OKJ A;  1VRT A;  4CEZ A;  4DFJ A;  2RF2 A;  3C6T A;  4CJV A;  1HQE A;  2D0B A;  3DLR A;  1NK5 A;  4O0J A;  1QSL A;  4B9S A;  5FRN A;  1S6P A;  1CLQ A;  4CHO A;  3U6F A;  1QSY A;  2ETJ A;  1KCF A;  1S6Q A;  4N5S A;  3OS0 A;  4JRP A;  3AVC A;  3TAP A;  1VSJ A;  3D45 A;  4QOZ B;  1ZBI A;  1IH7 A;  4KRE A;  4M3R A;  4NCA A;  1WSG A;  4ID5 A;  3NH0 A;  3TAG A;  3AVL A;  1G15 A;  3EY1 A;  2ATQ A;  3CFP A;  2OZS A;  4F3T A;  1WN7 A;  4Y1D A;  2BGG A;  4OJR A;  5C42 A;  3MAQ A;  3OYH A;  4W5R A;  2F8S A;  4K8X A;  2X78 A;  1HNV A;  2YNH A;  4B9L A;  3BDP A;  3M8R A;  3K58 A;  3B6P A;  3CFO A;  1K6Y A;  3DRR A;  2B5J A;  4RW4 A;  4E19 A;  4FJG A;  4FJJ A;  4DQQ A;  4E0D A;  1NK7 A;  1N6Q A;  2FBX A;  4KI4 A;  1TKZ A;  3CM6 A;  3KD5 E;  5KTQ A;  1F21 A;  3TAM A;  3DOK A;  1BL3 A;  2YKN A;  3IS9 A;  4KO0 A;  3O3H A;  4DS4 A;  3V4I A;  2HHQ A;  5E41 A;  1QSS A;  4I9Q A;  4HUG A;  2HMI A;  3VQD A;  3VA3 A;  4OGC A;  3ULD A;  3CQ8 A;  3PV8 A;  1D9D A;  3AO4 A;  1HYV A;  4DSJ A;  2X6N A;  3NFA A;  4DG1 A;  1RTI A;  4ZTF A;  3LAL A;  1KTQ A;  4FJI A;  4CES A;  3CFR A;  5HBM A;  4RW7 A;  3VQ9 A;  1D9F A;  5I42 A;  3RTV A;  3AVJ A;  4CEE A;  3NAE A;  2VG5 A;  3L2Q A;  1W0H A;  3NGY A;  2XO7 A;  4F2R A;  1TKD A;  3TAB A;  4B9V A;  3ITH A;  2I5J A;  1L3V A;  4DU3 A;  3DLG A;  3VQQ A;  1NKE A;  4B08 A;  1S1W A;  4CFC A;  1IG9 A;  3OYC A;  3KKS A;  1LAV A;  3F9K A;  2W42 A;  3KLG A;  4HTU A;  2GV9 A;  3AVI A;  4CK2 A;  2Y1I A;  4CHN A;  4W5T A;  3ISN C;  5DMR A;  3HPO A;  3V9S A;  4N41 A;  3KLF A;  4R5P A;  1DTT A;  1VSK A;  3AVN A;  4CEC A;  4W5N A;  4HCB A;  1JLQ A;  1RTJ A;  4CJF A;  4O5B A;  3AA5 X;  3K5O A;  3CYM A;  4OVL A;  3LP2 A;  4QAG A;  3L8B A;  1CXQ A;  1S1T A;  4CGF A;  3MXM A;  4B9T A;  3DLH A;  4PUO A;  1CZB A;  1C1C A;  1JL1 A;  2Q3S A;  4J2E A;  4Z4I A;  3AVG A;  3LWM A;  1JXE A;  4I9L A;  4CF8 A;  3MEC A;  4DTS A;  4B3O A;  4RW6 A;  4C8O A;  4AHT A;  1NK4 A;  3WNH A;  4DSF A;  4CHP A;  3MED A;  1RT4 A;  3OYE A;  1SL0 A;  3M8Q A;  4M42 A;  2YNG A;  4PY5 A;  2RPI A;  4CGG A;  4FJM A;  2FC0 A;  3F73 A;  3KD1 E;  1B92 A;  3P83 D;  4H4O A;  4LH4 A;  1HYZ A;  2FBV A;  4CIE A;  3SUQ A;  1SKS A;  2YNI A;  3TI0 A;  4NCB A;  2F8T A;  2P1J A;  3DRS A;  3DM2 A;  3LWL A;  3SQ0 A;  2A1R A;  1REV A;  3AA4 A;  4KTW A;  1C1A A;  2XRI A;  4CIG A;  3LZJ A;  3TAF A;  4ELT A;  5DK5 A;  4N47 A;  1C6V A;  4GW6 A;  3AO2 A;  1S1X A;  4CF1 A;  1X9W A;  2HHV A;  3VQB A;  3U3Y A;  3K5M A;  1RT2 A;  2ZE2 A;  3NH2 A;  1L3T A;  4MQ3 A;  3NE6 A;  3DYA A;  1ITG A;  4LSN A;  4C8K A;  2YHA A;  1Q9X A;  4CGD A;  5JS1 A;  3AVA A;  3K57 A;  1UWB A;  3I8D A;  1UA1 A;  1NKB A;  4CK1 A;  3RWU A;  2NUB A;  2BAN A;  3DLE A;  3ZSV A;  4AHC A;  3I0R A;  1IKY A;  3OYJ A;  3MXI A;  3T3F A;  4CHQ A;  2X74 A;  3SQ2 A;  3SQ4 A;  4Z4E A;  1KVC A;  1HMV A;  4KKO A;  1U4B A;  3MXJ A;  5CYQ A;  2E6M A;  5KGW A;  1RBU A;  1D5A A;  2XY8 A;  3PX6 A;  3NF9 A;  4CJP A;  3K59 A;  3OJS A;  3MEE A;  2D5R A;  5C24 A;  4E7L A;  1L5U A;  4FJ9 A;  1YVU A;  3AVM A;  4E89 A;  4CGI A;  1CZ9 A;  4W5O A;  3QO9 A;  3AO5 A;  5HRR A;  4KB0 A;  1NJX A;  3T19 A;  4CJL A;  1BI4 B;  1B9F A;  4AH9 A;  4J2B A;  4HUE A;  4FXD A;  4H8K A;  4G1Q A;  1BIU A;  3ZSZ A;  1KRP A;  1BGX T;  4WE1 A;  4CF9 A;  4KAZ A;  5J2N A;  3SZ2 A;  1TK8 A;  4CFD A;  1WSE A;  3V1O A;  2IOC A;  4FLZ A;  3S3N A;  4CE9 A;  4DTJ A;  4BE1 A;  4DSI A;  3DI6 A;  2XHB A;  1J9A A;  4CJR A;  3OVN A;  4KHW A;  1ZBH A;  1LWC A;  2BDP A;  2DTU A;  4IFV A;  4M3Z A;  1SKW A;  3LAM A;  3RR7 A;  3P1G A;  4CGH A;  1D8Y A;  1YT3 A;  4CJQ A;  1X9M A;  1WSJ A;  1EX4 A;  4JRQ A;  4FJX A;  4FW2 A;  1KVB A;  3AA2 A;  5T7B A;  1RDA A;  3ZSR A;  3K5N A;  4OKK A;  1KLM A;  4DF4 A;  3UIQ A;  1T05 A;  1DTQ A;  2HVI A;  3TR8 A;  1WLJ A;  1C0T A;  2O4G A;  4FLU A;  1XI1 A;  4FK4 A;  3DLK A;  4DQS A;  3L2U A;  2PY5 A;  1BCO A;  2LSN A;  3VQE A;  2P51 A;  2RKI A;  4TSX A;  4N56 A;  4E7J A;  4LY7 A;  4ICL A;  1QTM A;  1JL2 A;  3VA0 A;  2DFF A;  4PWD A;  3HVR A;  2E6L A;  3S3M A;  3V9U A;  2KZZ A;  2P5G A;  3WNE A;  4OLA A;  3TWH A; 
#chains in the Genus database with same CATH topology
 1TV6 A;  3O08 A;  4RWT A;  3C7N A;  3QEW A;  4ELV A;  4CCH A;  2HF4 A;  3QLH A;  2VG6 A;  3ALY A;  2FSJ A;  1QHT A;  1JCG A;  3A5L C;  4KH6 A;  1J5O A;  1QZ6 A;  3OW2 M;  4H5R A;  5AQY A;  3LDO A;  4NCG A;  3EE9 A;  4I2P A;  5FRM A;  4B1V A;  2NZT A;  1RBR A;  3OBW A;  3CJ1 A;  3VQ7 A;  1EET A;  4ISE A;  3D2F B;  2OPR A;  4QS8 A;  2DFE A;  4B1X B;  3SYZ A;  1DT9 A;  3RR8 A;  2YHY A;  1VK0 A;  1HPZ A;  3D2E A;  4CEB A;  3O1W A;  3ZSQ A;  1A5X A;  3THW B;  2GTD A;  4A2A A;  3KK2 A;  3THX B;  1NGD A;  3C95 A;  1UA0 A;  1S1V A;  2OCE A;  4L3Q A;  1TL1 A;  3CQY A;  5AZI A;  4IDK A;  5KRT A;  3HTV A;  2P9K B;  1ATS A;  3OY9 A;  3HK2 A;  2V7Z A;  3IG1 A;  1RDC A;  2XY5 A;  1NM1 A;  4WQ4 A;  1ZYQ A;  1TKT A;  3OYI A;  4IFY A;  1VSE A;  5AFU A;  2I7N A;  4HWI A;  3CCM N;  4FLV A;  3ZYY X;  2XY6 A;  3JXU A;  3JYT A;  2PYJ A;  4IO9 L;  4FJ7 A;  4H4M A;  4CGJ A;  3AO3 A;  2E5L K;  1C0G A;  3K9J A;  4CEA A;  5I9E B;  4BDP A;  5HRS A;  2QEX N;  2OZM A;  1RBT A;  4JHD A;  3TTD A;  4GNI A;  1TAU A;  1RTD A;  1T3V A;  4J2A A;  4FJK A;  2HB5 A;  3CC2 N;  1EQY A;  4DB3 A;  4KHS A;  1RT1 A;  4A5B A;  1P8Z A;  3CQX A;  4GKK K;  2UUB K;  3KKR A;  3PUF A;  4JK8 A;  2FBY A;  1BQN A;  3SJJ A;  3CME N;  4NXN K;  3BF3 A;  2OYQ A;  3AAQ A;  4FLW A;  1O1W A;  1QHA A;  4CJ5 A;  4FWQ A;  3OYD A;  2HNZ A;  2QWL A;  2IGI A;  1OH5 A;  4IJA A;  5M1N A;  1S5J A;  1TK5 A;  3WNF A;  2KW4 A;  4JKD A;  4PKH A;  4Q0B A;  4A2B A;  5EU7 A;  4U7B A;  5HL7 L;  5C0Y A;  4FJ8 A;  2YNF A;  3C6U A;  4YHH K;  1ATN A;  2JGU A;  4CEQ A;  5KPT A;  1BA1 A;  2O8C A;  4LH5 A;  4FK2 A;  1KVA A;  1KXP A;  1W2B M;  3R1X A;  4H5W A;  4C23 A;  3EYZ A;  1VQL N;  5GAD P;  4E3S A;  4WCE L;  4QS7 A;  3LL3 A;  3SI6 A;  4XIU A;  3CCU N;  4F3O A;  3MCP A;  2JWK A;  4DV0 K;  4KI6 A;  3ZT3 A;  4IOC L;  4DU4 A;  3CCE N;  4N76 A;  2ITG A;  3THW A;  2Z1G A;  2VGN A;  4LF4 K;  1SAZ A;  1BG3 A;  5FPD A;  3KLI A;  3S41 A;  2CGL A;  3EZW A;  2P9U B;  2DY4 A;  1WAF A;  2KKZ A;  3O80 A;  1IG8 A;  4BDZ A;  1SZ2 A;  1SL1 A;  2P9I B;  3ASM A;  3E9O A;  4FCY A;  4JI6 K;  3V1R A;  4CHY A;  3L3U A;  1CZA N;  2QKB A;  3OYK A;  3G4S N;  4GVM A;  3QES A;  1XHX A;  1FW6 A;  4IBN A;  3MEG A;  4CI6 A;  3VF4 A;  4V19 S;  3VGM A;  3ZX0 A;  2F9W A;  1SUQ A;  3T1H K;  1T6D A;  3J7Y P;  3JSM A;  1J53 A;  3VQP A;  3FZL A;  3OYB A;  1XUP O;  1HJO A;  2P5O A;  5EXW A;  1A5V A;  1V4T A;  3JAM O;  1KSP A;  3AA3 A;  3RMB A;  4E1M A;  4CHZ A;  3V9Z A;  1NK6 A;  3C65 A;  3SQ1 A;  3CCQ N;  4OO1 J;  4JD2 B;  3B6O A;  4PL7 A;  3QNO A;  3SAG A;  2UXC K;  4JKG A;  1HQU A;  1K9M O;  5F1X A;  4AHU A;  2P9P A;  4W5Q A;  5B8H A;  4M7X A;  5CHI A;  2Z1H A;  1B9D A;  4M3Y A;  2BUP A;  4YOV A;  2DFH A;  2HST A;  4BRC A;  2YHB A;  3J7A P;  3HP6 A;  4B9U A;  1NJY A;  3SNN A;  2VCP A;  3QEP A;  2HHS A;  3JS6 A;  4DFP A;  2D0C A;  3BZK A;  4CW7 B;  4UY8 O;  1C0U A;  1K73 O;  4B1U B;  5BPM A;  1NOZ A;  4JI0 K;  2RN2 A;  2F4V K;  1SS6 A;  3OYM A;  3SV4 A;  2KFZ A;  5K14 A;  3L0Q A;  3KK3 A;  1YTA A;  5KPR A;  3UKR A;  5J2P A;  3H46 O;  2FSN A;  4FM0 A;  2CH5 A;  5TKW A;  1OVY A;  3VER A;  2RF2 A;  1QSL A;  4B9S A;  1NK5 A;  3NMU A;  2ETJ A;  1S6Q A;  2QI2 A;  3TAP A;  3D45 A;  3SMS A;  1KQS M;  1ZBI A;  4YOT A;  5EY4 A;  2P9U A;  4BR5 A;  5BN8 A;  2BGG A;  3MAQ A;  2A41 A;  2F8S A;  1YXQ A;  2X78 A;  5F0X A;  2YNH A;  3BDP A;  5AQS A;  1K6Y A;  4E19 A;  4FJG A;  1FJG K;  1Q81 O;  3O8M A;  4E0D A;  1TKZ A;  3CM6 A;  3KD5 E;  3H1Q A;  3IS9 A;  4KO0 A;  3E1Y A;  4I9Q A;  4HUG A;  3VQD A;  3DXM B;  3PV8 A;  3CQ8 A;  1D9D A;  4LF9 K;  4DG1 A;  1RTI A;  4CES A;  4RW7 A;  4JKF A;  4YOY A;  3RTV A;  3AVJ A;  1EWR A;  3M3Z A;  4CVN E;  3TU5 A;  4DV3 K;  5AQJ A;  1VQO N;  3AGK A;  3T7Z A;  3VQQ A;  3VPZ A;  1S1W A;  1XC3 A;  4BC2 A;  1IG9 A;  3RVC A;  3WT0 A;  2W42 A;  3KLG A;  3VMF B;  2D4W A;  4CHN A;  5JLF A;  4N41 A;  2HOE A;  4WFA L;  3VEV A;  3KLF A;  2NRH A;  3AVN A;  4HCB A;  4WQ4 C;  1JLQ A;  4BE0 A;  4QAG A;  3AA5 X;  3K5O A;  4OVL A;  3LP2 A;  3IMX A;  5AQW A;  5FPN A;  3DLH A;  5LY3 A;  4PUO A;  2Q3S A;  4CD3 A;  4Z4I A;  3UB5 A;  3MEC A;  4C8O A;  5DM7 L;  1GLJ O;  1E3M A;  1RT4 A;  1SL0 A;  3M8Q A;  2YNG A;  2RPI A;  4ISG A;  4FJM A;  3IFR A;  2A40 A;  1B92 A;  3P83 D;  4IOA L;  2YNI A;  3TI0 A;  2P1J A;  1NGH A;  3SQ0 A;  2A1R A;  4CIG A;  4ELT A;  4FL9 A;  3TAF A;  5E84 A;  2F7T A;  3VEZ A;  3FLC O;  4GW6 A;  3VTH A;  4A57 A;  1S1X A;  4B9Q A;  3H3N O;  2H3G X;  3CCJ N;  3VEN A;  3DYA A;  4DV7 K;  3K57 A;  1NKB A;  2ZJQ L;  1NGF A;  1Q18 A;  3EEQ A;  2NUB A;  4FVU A;  2GWK A;  3MX5 A;  2PFU A;  3P38 A;  3SQ4 A;  1GLE G;  4CZE A;  4KKO A;  5CYQ A;  4IOX A;  2E6M A;  5KGW A;  4H0O A;  1D5A A;  2NNW A;  4DV2 K;  3NF9 A;  2AA4 A;  4E7L A;  4IXC A;  4E89 A;  2QA4 N;  4XH1 A;  4CJL A;  1RFQ A;  4CD1 A;  5KPZ A;  3BEX A;  4H8K A;  4CZG A;  1BGX T;  4CF9 A;  4KAZ A;  5J2N A;  3V1O A;  1KAY A;  4BE1 A;  1TUY A;  1R59 O;  3DI6 A;  1J9A A;  5MLC Q;  2XHB A;  1HNZ K;  1ZBH A;  2BDP A;  1XQS C;  4M3Z A;  4BRI A;  3RR7 A;  4CGH A;  3DXM A;  1EX4 A;  3FFK B;  1RDA A;  4FOI A;  1T05 A;  1JJ2 M;  1Y64 A;  4JN4 A;  2HBM A;  1HR0 K;  5C10 A;  4FLU A;  3L2U A;  2LSN A;  2P51 A;  4TSX A;  3ZET A;  2O8D B;  2KZZ A;  3AY9 A;  3WNE A;  4RCH A;  3KTQ A;  3AV9 A;  4DTM A;  1NK8 A;  3LPT A;  3NBP A;  4FWO A;  2NRV A;  4CBU A;  5GAE P;  2ASO A;  2IAJ A;  1ILY A;  2GWJ A;  4I6M A;  4A59 A;  4CBX A;  3I33 A;  5CZ1 A;  4E7K A;  1NGG A;  1NGE A;  1WOQ A;  2Z1I A;  4O44 A;  4UQG A;  3EZ5 A;  3IAY A;  1WUA A;  4KHQ A;  4O8U A;  4CZL A;  2B6A A;  4RW8 A;  5HRO A;  1NK0 A;  3L6Q A;  4EHT A;  2A6A A;  4FLX A;  4CFA A;  1TAQ A;  4MO4 A;  4DTN A;  1LWF A;  4BQL A;  1U47 A;  1YJW N;  1Z26 A;  5A2Q O;  3FZM A;  4BVO A;  1KAZ A;  2UUA K;  1FKP A;  3O5B A;  1Q8I A;  3F5T A;  2QWP A;  3QIP A;  1HPM A;  2IS3 A;  2AJQ A;  3OJU A;  1YIJ N;  1L3U A;  4FSV A;  4WF9 L;  2P9S B;  1T03 A;  4QCL A;  2OPQ A;  1IKX A;  3PX4 A;  5HRN A;  1VSD A;  1E4G T;  4YFU A;  3QEV A;  2D0O A;  1T7P A;  3RRG A;  4J2D A;  4DUZ K;  3PY8 A;  1NMD A;  1RDW X;  4LF8 K;  3ZSO A;  3LPU A;  4X64 K;  5BR8 K;  4YNQ A;  3NDK A;  2VQF K;  5F2R A;  3O4Q A;  1K8K A;  2P9N B;  3BF1 A;  3THV A;  2ZJR L;  2BH1 A;  3GL1 A;  1Z05 A;  4IG3 A;  1X9J A;  4FWP A;  4AM6 A;  4EZ6 A;  2HBJ A;  4LFA K;  1TGO A;  4OLB A;  2FF6 A;  1T6C A;  3ULE A;  1BHL A;  3I0S A;  1RBV A;  5AQF A;  1NJW A;  2X6S A;  3N4P A;  3HM9 A;  3HXM A;  1YVN A;  1K8A O;  1HNX K;  4MFB A;  4AHS A;  5LL6 Z;  5AQK A;  1S9G A;  4PHT X;  1X9S A;  3RMA A;  3KLE A;  3PX0 A;  2IVN A;  4EP5 A;  5BRH A;  2FXU A;  3OBY A;  4CK3 A;  2G8H A;  3IDH A;  5IT9 O;  4O55 A;  3TAR A;  1ZBS A;  1RBS A;  2YX6 A;  4IG0 A;  5SWM A;  5AQP A;  3WXI A;  3KZB A;  5EOY A;  3O4N A;  4BY9 C;  5M1O A;  4H03 B;  2FBT A;  4JK9 A;  4MLE A;  3EN9 A;  2O8D A;  3WUH A;  1NG9 A;  3J7Z O;  3QBW A;  3L2R A;  1NGI A;  5CY4 A;  5KGX A;  2QK9 A;  3D6R A;  3I55 N;  3TSQ A;  3M1F A;  4M45 A;  4NYF A;  5AQO A;  4ELU A;  4DQI A;  1SV5 A;  5E26 A;  4AIL C;  4NO7 A;  4H0P A;  4DR5 K;  3GE1 A;  4JEP A;  1LV5 A;  4A5A A;  2G8F A;  3O1B A;  5M1F A;  4NYN A;  3TAQ A;  4B9N A;  4FYD A;  1EXQ A;  4A62 A;  2QKK A;  5HLF A;  5BPN A;  1MU2 A;  1WSF A;  4IDH A;  4BR0 A;  2G8K A;  2P9L B;  3LZI A;  3M8P A;  3VF2 A;  4GV6 A;  2AP1 A;  4MO5 A;  3KWI A;  4LF7 K;  2KTQ A;  3QIO A;  1VQN N;  3QDK A;  4B8C A;  3HM8 A;  4O4G A;  3HI0 A;  2O8E B;  4YDU A;  4AM7 A;  2YHW A;  2R7Y A;  1GLF O;  4F2S A;  1GOA A;  4OPA A;  3EKS A;  4ZHR A;  1ZBU A;  1V4S A;  1IKW A;  4XH5 A;  5FDL A;  2UXD K;  3SAF A;  3ZSX A;  3VQ8 A;  3VQ6 A;  5J2M A;  2HHW A;  1WSI A;  3J81 O;  1TK0 A;  2QWR A;  4BRM A;  4E1N A;  2Q0R A;  4B9M A;  1QZ5 A;  5GIP A;  2HHH K;  1HKG A;  2PYL A;  1J54 A;  4E7I A;  1NNE A;  4EP4 A;  1QS4 A;  1NGA A;  5C2F A;  2HBK A;  5D3G A;  4CBW A;  4CZM A;  1X3N A;  4CEO A;  3H1V X;  3ID8 A;  3VN5 A;  1JXB A;  2G8U A;  4DR6 K;  4H5V A;  3TAE A;  4FK0 A;  1YUW A;  4Z4H A;  1HUX A;  2Q1N A;  4FJN A;  1WAJ A;  5KQ8 A;  2E88 A;  3H08 A;  4HCC A;  3SMP A;  3QIN A;  4JI3 K;  1HJR A;  1Y97 A;  3DLB A;  3OS2 A;  1YJN N;  1W9H A;  2YJE A;  3V9W A;  4ID1 A;  3SBG A;  2HHT A;  3IKM A;  1WNS A;  3HVT A;  5AJ3 K;  1YHQ N;  1Q7Y O;  2BTF A;  4MDB A;  3GDQ A;  2HHU A;  5J1E A;  3MX2 A;  4DTX A;  4YOX A;  3R9P A;  4C8M A;  2HBL A;  4I7F A;  2KQ2 A;  3VQC A;  4JNE A;  4BRP A;  4DFJ A;  3C6T A;  4WQ5 A;  1HQE A;  5FRN A;  4JV5 K;  1CLQ A;  3KK7 A;  2HMP A;  4CHO A;  2WFB A;  3U6F A;  1KCF A;  4N5S A;  3AVC A;  4B1Z A;  4QOZ B;  2KLA A;  3O6W A;  3LM9 A;  1VQ8 N;  1HKC A;  3EY1 A;  5AZJ B;  3CC7 N;  2OZS A;  4MDA A;  1WN7 A;  3D2F A;  4Y1D A;  4OJR A;  5C42 A;  2Q97 A;  4K8X A;  1HNV A;  5KQD A;  3K9K A;  2E2O A;  2V52 B;  3B6P A;  3H6E A;  3T1Y K;  2O8E A;  1BDG A;  3THX A;  1NK7 A;  3AAR A;  4CZK A;  2YKN A;  3MWT A;  5E41 A;  1QSS A;  4KHN A;  2HMI A;  3M5R A;  2P9K A;  4YY3 K;  1HYV A;  4ZTF A;  3NFA A;  3LAL A;  4FJI A;  1D9F A;  1BWF O;  4CEE A;  3L2Q A;  3NGY A;  3WQT A;  3ITH A;  3DLG A;  3Q7B A;  3R6M A;  1G99 A;  4E1J A;  2GV9 A;  4W5T A;  3ISN C;  3NVK A;  2VGM A;  4ILH A;  4R5P A;  1QVF M;  1RTJ A;  1VQ5 N;  4FJX A;  3CYM A;  4BRH A;  3MXM A;  1NGJ A;  5CR4 A;  1C1C A;  3LDQ A;  3U8X A;  4BGB A;  4CZJ A;  3AVG A;  4CF8 A;  2Q0U A;  3W3D A;  1VQ4 N;  1NK4 A;  3WNH A;  5C12 A;  4FO0 A;  4M42 A;  3J80 O;  1SKS A;  3O9U A;  4NCB A;  2F8T A;  3DRS A;  3DM2 A;  3AAP A;  4KTW A;  5IWA K;  5DK5 A;  1C6V A;  2HF3 A;  4PL8 A;  4DR7 K;  2E2P A;  2ZE2 A;  2E20 A;  1L3T A;  4IJN A;  1ITG A;  4AQY K;  1M1K O;  1Q9X A;  5JS1 A;  3AVA A;  1UA1 A;  3OTO K;  2VQE K;  4R79 A;  2BAN A;  4AHC A;  4MLH A;  1KD1 O;  1LOT B;  3CIP A;  4CHQ A;  4JKH A;  1U4B A;  3MXJ A;  1RBU A;  4CJP A;  3OJS A;  5C24 A;  4BG9 A;  3WEE B;  4FJ9 A;  3G71 N;  3QO9 A;  3AO5 A;  5HRR A;  4KB0 A;  2ZGZ A;  2NRX A;  1B9F A;  4AH9 A;  5C15 A;  4HUE A;  4FXD A;  1KRP A;  4WE1 A;  1N36 K;  1TK8 A;  4CFD A;  1WSE A;  2IIR A;  2IOC A;  4FLZ A;  3S3N A;  4CE9 A;  3BZC A;  4DSI A;  4CJR A;  3I8B A;  1NLV A;  4KHW A;  2DTU A;  3MN7 A;  1XMQ K;  3WXK A;  1SKW A;  3P1G A;  1NU0 A;  1X9M A;  4JRQ A;  4FW2 A;  1KVB A;  3ZSR A;  1U2V B;  4FWN A;  2P9I A;  1WLJ A;  3EL2 A;  4DQS A;  3WXL A;  1BCO A;  3VQE A;  4N56 A;  2RKI A;  4QS9 A;  1JL2 A;  3BY5 A;  3VA0 A;  3SLC A;  3S3M A;  2O4I A;  1S72 N;  2EHG A;  3ZX3 A;  4GVE A;  2A1S A;  4RG8 A;  3U3G A;  3TTF A;  4BRE A;  4K42 A;  3QEI A;  5JS2 A;  4DFM A;  3H45 C;  2VWJ A;  1RIL A;  3E9L A;  1IO2 A;  4C1N K;  4DSK A;  2QXL A;  2QWQ A;  3V6D A;  1KLN A;  3KK1 A;  3THY B;  4DR1 K;  1VQP N;  3SAH A;  4X62 K;  4DTR A;  4WYB A;  1WSH A;  4Y0W A;  3LAK A;  3CPW M;  2ZM6 K;  4JD2 A;  3CJ7 A;  5BRE A;  4M3U A;  4F4K A;  3J8A A;  1ASV A;  4DTU A;  3PLA A;  4JS4 A;  4JI1 K;  3EKU A;  3OYF A;  1W97 L;  4BGA A;  4BRN A;  1Q86 O;  1BQM A;  3SBT A;  4KV8 A;  3LDL A;  3V1Q A;  4F8R A;  5FPE A;  1X1P A;  2HNY A;  2ZWH A;  3QEX A;  4OPK A;  4GMJ B;  3LM2 A;  3MN5 A;  1YIT N;  3NHG A;  5AQT A;  4DQR A;  4X66 K;  1JLG A;  4BWJ A;  2O8B B;  3CCV N;  3D0P A;  1RTH A;  1MDU B;  3WEE A;  4CZF A;  4LSL A;  4OGE A;  4DSL A;  3FGU A;  4M63 C;  5BRD A;  4Z4C A;  3T69 A;  5FLX O;  4BRQ A;  4OPJ A;  4FJL A;  4FPB A;  3HT3 A;  2RE2 A;  3O9S A;  4FWR A;  4IWV A;  1NOY A;  2OA8 A;  1GOC A;  4JKC A;  3CCL N;  1N34 K;  4KFB A;  3L4Q A;  4KRF A;  4RW9 A;  3ENO A;  4M7Y A;  2QW9 A;  3NF6 A;  4DLE A;  3UE5 A;  1SKR A;  5KI6 A;  3HYF A;  1J6Z A;  1NK9 A;  4DTP A;  4LD0 A;  4CFB A;  5FRO A;  1ASW A;  3ATU A;  5AQZ A;  2KFN A;  4CJE A;  1SL2 A;  3FR0 A;  3BGR A;  3QNN A;  4WQ5 C;  5JVH L;  4CF0 A;  4B1W B;  3K2P A;  4ILJ A;  1I3A A;  4DLG A;  5AQM A;  1J5E K;  3G0Z A;  4K8Z A;  1TYQ B;  2HHX A;  4BAC A;  4B8A B;  1W7A A;  3KIO A;  4C8L A;  1NJI O;  1JLA A;  2A3Z A;  3DAW A;  2VG7 A;  2QTD A;  3NCI A;  4A61 A;  3G6E N;  4DF8 A;  3OYA A;  3L3V A;  1GLL O;  3VEW A;  1LWE A;  3ZCM A;  2YV0 X;  4AHV A;  3QET A;  1KAX A;  4DV4 K;  3HP9 A;  1WBB A;  2PZS A;  3CI5 A;  4LF5 K;  3M6G A;  3Q7C A;  1HKB A;  4BR9 A;  2GEM A;  1FK9 A;  1XC9 A;  3VQ5 A;  4YOU A;  5M1P A;  4B3T K;  3CER A;  2G8W A;  4GKJ K;  4GY2 B;  4DR2 K;  1RNH A;  4Q5V A;  3MN9 A;  2HND A;  5KRS A;  2GX9 A;  1BIS A;  3U4L A;  1U6Z A;  3KWG A;  3O3G A;  1VRU A;  2QXF A;  2YI1 A;  1L3S A;  4BRK A;  1QQC A;  3FZK A;  3O3F A;  2O8F B;  3DJC A;  5BRF A;  3OS1 A;  3SPY A;  3QER A;  1DLO A;  5JIC A;  2Z1J A;  3TSU A;  5C25 A;  2DPN A;  1HRH A;  2E2N A;  4CJS A;  3VOV A;  3FFI A;  3G10 A;  4C8N A;  4RTF D;  4F9O A;  1VSM A;  4FLT A;  4DUY K;  3ZT2 A;  4BDY A;  1VQ7 N;  4L8R B;  1I39 A;  3CCS N;  2O8B A;  2UYT A;  3C7N B;  2A5X A;  4ISF A;  1WBD A;  2WC9 A;  4FVM A;  3KHY A;  2Y1J A;  2B4J A;  3SUN A;  5AR0 A;  2IDO A;  5M1Q A;  1OVQ A;  2JLE A;  1RGI A;  3VES A;  3LP0 A;  3T1A A;  5GIO A;  1RDB A;  3PSF A;  5CZ2 A;  5I3U A;  1IJJ A;  3HST B;  1S9E A;  3D2E B;  2NRW A;  1HX1 A;  2XY7 A;  1GLB G;  4OKE A;  4M41 A;  4OX9 K;  1D4X A;  5AZI B;  1FKO A;  2YKM A;  4FOE A;  3VET A;  1JCE A;  4B3R K;  1JKH A;  1TVR A;  1N5Y A;  1Z25 A;  1HNW K;  1DKG D;  1QE1 A;  4IFE A;  3DLL L;  1GLC G;  4DV1 K;  1NGC A;  4FZZ A;  4KTQ A;  4AF1 A;  4EZ9 A;  4EFH A;  4BC3 A;  2PAV A;  3WNG A;  1Z6R A;  3C6H A;  3V9X A;  3SUO A;  3KLH A;  2NRR A;  1KFS A;  2F96 A;  2BE2 A;  1VHX A;  4ILG B;  4HTL A;  5GAG P;  1NJZ A;  4JHD B;  2FLO A;  1JLB A;  5AQQ A;  4BE2 A;  1OH8 A;  3CJB A;  4OKJ A;  4CEZ A;  4YOR A;  2YCH A;  1VQ6 N;  3W0L A;  4CJV A;  3A8Y A;  1S6P A;  3OS0 A;  4JRP A;  1YJ9 N;  1IH7 A;  4NCA A;  4ID5 A;  3TAG A;  2ATQ A;  4BRA A;  3CFP A;  3MCA B;  4DHY A;  3CFO A;  4O8K A;  3DRR A;  5AQI A;  4FJJ A;  4DQQ A;  1N6Q A;  2FBX A;  5KTQ A;  1F21 A;  3DOK A;  4DS4 A;  4NLB A;  3V4I A;  3MN6 A;  3VA3 A;  3ULD A;  5JLH A;  2F9T A;  4DSJ A;  2X6N A;  2P9S A;  1DGK N;  1T44 A;  5AQN A;  5HBM A;  5I42 A;  1N33 K;  2VG5 A;  1W0H A;  1TKD A;  3TAB A;  4B9V A;  2O8C B;  3QFP A;  1L3V A;  4DU3 A;  2NRT A;  3P31 A;  1NKE A;  4B08 A;  4BR2 A;  4CFC A;  3KKS A;  3F9K A;  4DR4 K;  1QVG M;  3AVI A;  2P9N A;  3BP8 A;  4CK2 A;  2Y1I A;  2WTU A;  2Q2R A;  1DTT A;  4CEC A;  1N8R O;  4W5N A;  4FWL A;  2IVO A;  2IVP A;  4O5B A;  3PSI A;  1CZB A;  1JL1 A;  5JVG L;  3LWM A;  1JXE A;  4AHT A;  4DSF A;  1NMN A;  1VAZ A;  3MED A;  3OYE A;  4PY5 A;  2D1K A;  1O13 A;  3KD1 E;  1OKJ A;  3HJF A;  1HYZ A;  2UU9 K;  3KVG A;  3LWL A;  1IBL K;  5AQG A;  3AA4 A;  4H0T B;  3LZJ A;  3ID6 A;  3AO2 A;  4CF1 A;  4K41 A;  4PKI A;  3U3Y A;  3K5M A;  3ZX2 A;  4XH4 A;  4LSN A;  3FZF A;  2YHA A;  4CGD A;  3CF5 L;  1Q82 O;  3FZH A;  2OAN A;  4B3S K;  3ZSV A;  3OYJ A;  4KHP K;  3RSE B;  4Z4E A;  2CGK A;  1HMV A;  5TKY A;  1JCF A;  2XY8 A;  4LC9 B;  3K59 A;  3WXM B;  5AQH A;  3H3O B;  4CGI A;  1CZ9 A;  3EO3 A;  1NJX A;  4JKG B;  4JI4 K;  1BI4 B;  1QQN A;  2QWM A;  2W6L A;  3CJ9 A;  1BIU A;  3ZSZ A;  2P9P B;  2E8A A;  4IEI A;  2CH6 A;  4DTJ A;  2EWS A;  3OVN A;  4NB4 A;  1LWC A;  4IFV A;  3WQU A;  2P9L A;  3LDP A;  2ASP A;  4CZI A;  3VF6 A;  3AA2 A;  2ITM A;  4PKG A;  3VGL A;  5T7B A;  3K5N A;  1GLD G;  1KLM A;  3TR8 A;  4FK4 A;  3EE8 A;  3DLK A;  2PY5 A;  4LY7 A;  4ICL A;  1QTM A;  5LJV A;  3ENH A;  2DFF A;  4PWD A;  2E6L A;  3V9U A;  4OLA A;  4KH4 A;  3UKR B;  4IZ9 A;  3MMV A;  2WOM A;  4BR4 A;  5AQU A;  3IUC A;  4CJW A;  3KJV A;  3QB0 A;  1N32 K;  4CJT A;  4BQZ A;  4JI5 K;  3U9Z A;  5BR9 A;  2YJF A;  4PA1 A;  3ATV A;  3OYL A;  3PIO L;  4FJH A;  2GEL A;  4O0I A;  3DMJ A;  1XMO K;  1QQM A;  1BO5 O;  2GBZ A;  4DSE A;  3LP3 A;  3TTC A;  1HNI A;  3M8S A;  3SUP A;  3L2V A;  3GG4 A;  2ZQB A;  1TUU A;  3ZT4 A;  3ZSY A;  1XHZ A;  3CC4 N;  1ZC6 A;  5JMV A;  1RT5 A;  1C1B A;  4B3M K;  4H0Y B;  4HVJ A;  1S1U A;  4KBO A;  3VGK A;  3HZ6 A;  1TL3 A;  4EAH D;  4O5F A;  4K25 A;  3K5L A;  2ZGY A;  3MWP A;  1JLE A;  1GOB A;  2QM1 A;  4IKF A;  1VSL A;  2KHO A;  4Z0U A;  4BRD A;  1GLA G;  1ZBL A;  4M3T A;  1UOC A;  3RRH A;  3PO5 A;  4H0V B;  3RSE A;  4DS5 A;  1RT7 A;  1BOT O;  3SV3 A;  3IRX A;  3CXC M;  4HUF A;  2KZM A;  4DMN A;  4LFB K;  3DRP A;  3NGZ A;  2OPS A;  4K43 A;  3NF8 A;  1BI4 A;  3S9H A;  2G8I A;  4FZX C;  2I7P A;  4CIF A;  3HPG A;  5M1K A;  4FM2 A;  4KRE A;  4CEF A;  3PO4 A;  4CED A;  4WFB L;  3F2K A;  3ENB A;  4BVP A;  1I94 K;  2E1Z A;  3CG7 A;  5AFU H;  4C1N I;  5HRP A;  4BRF A;  1U04 A;  2WON A;  3ZEU B;  5ADX A;  4FJ5 A;  4JS5 A;  3VEO A;  4JLH A;  3HL8 A;  1U48 A;  4KI4 A;  3DOL A;  1A5W A;  3D7E O;  5CYM A;  3B8A X;  5AZJ A;  1EKE A;  3SCX A;  2VWB A;  4IEE A;  3DXK B;  4DV6 K;  4DQ8 A;  4DQP A;  1LW0 A;  3ZLJ A;  4KB1 A;  4ZTJ A;  4Y1C A;  4E7H A;  4HHT A;  3OHR A;  3LP1 A;  3S3O A;  4JI2 K;  1CXU A;  3C94 A;  2HW3 A;  1X3M A;  4JYA K;  1NGB A;  4KHY A;  4GV3 A;  4FZY A;  4CER A;  3HBT A;  1LAW A;  3QIC A;  4CJ4 A;  1M90 O;  4EIA A;  2GUI A;  3SJH A;  2E4L A;  5LMN K;  4DR3 K;  1RT6 A;  1OH6 A;  1EO1 A;  4I2Q A;  3HSC A;  2NLX A;  4DU1 A;  1LCU A;  3O9R A;  3L4I A;  1T8E A;  1RDU A;  3NH1 A;  3A5M C;  2NRZ A;  5AQL A;  4OPH A;  3AVB A;  3VQ4 A;  2D0A A;  1C0F A;  3VQA A;  5DM6 L;  1R0A A;  3RMD A;  4B1Y B;  1XNR K;  3OYG A;  3OYN A;  3QFU A;  4YDU C;  3NF7 A;  2OTL N;  4CF2 A;  3LDS A;  3VEX A;  1ZBF A;  3LAN A;  4FLY A;  3V81 A;  4DWI A;  1YTU A;  1ASU A;  1TKX A;  4H0X B;  3BUZ B;  3ZSW A;  1MWM A;  3P4I A;  5H1S Q;  1KC8 O;  2UUC K;  1EP4 A;  4BRO A;  4DTO A;  1ESV A;  3HO1 A;  1JLC A;  3R8E A;  1IKV A;  4CZH A;  4X65 K;  1VQK N;  3HRG A;  3ZET B;  3QBX A;  4PQU A;  3E01 A;  3AO1 A;  2HVH A;  1RCH A;  4G9Z A;  3WXJ A;  1NBW A;  3A2F A;  5LJW A;  4IO8 A;  4CJU A;  3AGR A;  4CJ3 A;  4DV5 K;  2Q31 A;  3QML A;  4BWM A;  5SZT A;  3GOI A;  5J2Q A;  1JLF A;  4I6M B;  1SQK A;  4BR7 A;  2QWN A;  1YF5 L;  2VWK A;  1UAX A;  1C0M A;  4FM1 A;  3TAN A;  5AQX A;  3F9M A;  3CM5 A;  3AVK A;  4M3X A;  1VQ9 N;  1IBM K;  5HOO A;  2EX3 A;  2G8V A;  2VYP A;  3CET A;  3ZEU A;  1Q9Y A;  5LMU K;  4NXM K;  1VSF A;  3GBT A;  1BCM A;  1NKC A;  3RMC A;  1QQO A;  2IC3 A;  4CJK A;  3O9T A;  1ZXO A;  4KHU A;  3DXK A;  3AVF A;  1FXX A;  4KPY A;  4EHU A;  4Z4F A;  2W40 A;  1VSI A;  1RDD A;  3MK6 A;  1HLU A;  3NGI A;  2WBN A;  3HPH A;  4LF6 K;  4KTZ A;  4AHR A;  1U49 A;  3FE1 A;  3VTI A;  4FW1 A;  3SPZ A;  1LW2 A;  4Z4G A;  1BIZ A;  4DFK A;  2J4R A;  1U45 A;  1EWQ A;  4JI7 K;  1U2V A;  3A0I X;  3P5J A;  3ZT0 A;  2UXB K;  3K0S A;  5BPL A;  1VSH A;  1K8K B;  3O4W A;  1RT3 A;  2V7Y A;  3L2W A;  2D0P A;  2OPP A;  3DWL A;  3N4Q A;  3I56 N;  3CPE A;  3UKU B;  4M3W A;  2FSK A;  3ULE B;  1MWK A;  3AVH A;  4K0K K;  1KFD A;  3E9P A;  5ADX H;  1XWL A;  5HP1 A;  3A5O C;  2ZD1 A;  3ZT1 A;  4YOW A;  1VRT A;  2D0B A;  3DLR A;  4O0J A;  3CCR N;  2YHX A;  1QSY A;  4BC5 A;  4H5T A;  3E66 A;  1VSJ A;  3G25 A;  2ZF5 O;  4M3R A;  1WSG A;  3NH0 A;  3THY A;  3AVL A;  1G15 A;  1S22 A;  4F3T A;  3OYH A;  4W5R A;  4B9L A;  3M8R A;  3K58 A;  4RW4 A;  2B5J A;  2E1Y A;  4KH5 A;  2GUP A;  3U9D A;  1NWK A;  3TAM A;  1IV0 A;  1BL3 A;  3O3H A;  2HHQ A;  3TPQ A;  4OGC A;  3AO4 A;  1MA9 B;  1KTQ A;  3CFR A;  3VQ9 A;  3R3L A;  4JAX A;  3NAE A;  2OTJ N;  5GAH P;  2WUS A;  2XO7 A;  4F2R A;  2W6K A;  2I5J A;  3CJC A;  3PIP L;  3OYC A;  1LAV A;  2Q36 A;  2W41 A;  4HTU A;  4J8F A;  2ZJP L;  1DEJ A;  5DMR A;  3HPO A;  3V9S A;  3CJA A;  1VQM N;  1BA0 A;  1VSK A;  4Z94 A;  3MDQ A;  4CJF A;  4B9T A;  4BC4 A;  3L8B A;  4BG8 A;  1CXQ A;  1S1T A;  4CGF A;  2E2Q A;  3C0B A;  4J2E A;  5EVZ A;  4H5N A;  4JKB A;  4I9L A;  4DTS A;  4B3O A;  4RW6 A;  4CHP A;  4CGG A;  2FC0 A;  5EX5 A;  3F73 A;  4H4O A;  4LH4 A;  5AQV A;  3C6A A;  1HYS A;  2ASM A;  2FBV A;  1BUP A;  4XEI A;  4CIE A;  4WFN L;  3SUQ A;  2PBD A;  1E4F T;  1REV A;  1C1A A;  2XRI A;  4JKA A;  3NVM A;  4N47 A;  5GIN A;  1X9W A;  2HHV A;  3VQB A;  4CJ7 A;  3CD6 N;  1RT2 A;  1YI2 N;  3NH2 A;  4MQ3 A;  5BN9 A;  4JI8 K;  3A5N C;  3NE6 A;  4DKW A;  4C8K A;  1XNQ K;  1UWB A;  3I8D A;  3OA9 A;  5AQR A;  4CK1 A;  3UKU A;  3RWU A;  3DLE A;  1TYQ A;  3I0R A;  1IKY A;  3MXI A;  3T3F A;  5FPM A;  2X74 A;  3VEY A;  3SQ2 A;  1KVC A;  4FWK A;  1YAG A;  4DCH A;  4LFC K;  2JWL A;  1ATR A;  4FWM A;  3PX6 A;  4JKE A;  3MEE A;  2D5R A;  1L5U A;  1YVU A;  3AVM A;  4JK7 A;  2V51 B;  4W5O A;  3T19 A;  1S3X A;  4BRG A;  5ELZ A;  2QWO A;  3P39 A;  4J2B A;  4BRL A;  3CHW A;  4G1Q A;  3HOS A;  3LDN A;  3SZ2 A;  5C2D A;  3HOT A;  3TSP A;  2FF3 B;  4U67 L;  3LAM A;  1OH7 A;  1D8Y A;  1WB9 A;  1YT3 A;  2A42 A;  4NLC A;  4CJQ A;  1WSJ A;  4FWS A;  4OKK A;  4DF4 A;  3UIQ A;  1DTQ A;  3CMA N;  2HVI A;  2O8F A;  5CE3 A;  4FPA A;  1C0T A;  2O4G A;  1BU6 O;  1XI1 A;  1IBK K;  3O9Q A;  1P90 A;  4E7J A;  1H1V A;  2RHK A;  4GV9 A;  3HVR A;  2CGJ A;  2P5G A;  3SK3 A;  3TWH A; 
#chains in the Genus database with same CATH homology
 2EHG A;  3AV9 A;  1TV6 A;  2WOM A;  4CJW A;  3KJV A;  4DTM A;  1NK8 A;  2A1S A;  3LPT A;  3NBP A;  4CJT A;  4RG8 A;  3QEW A;  4ELV A;  4CCH A;  3U3G A;  3QLH A;  2VG6 A;  3ALY A;  2IAJ A;  3QEI A;  1QHT A;  4PA1 A;  5JS2 A;  3OYL A;  4DFM A;  2VWJ A;  5CZ1 A;  4E7K A;  1RIL A;  1IO2 A;  1J5O A;  4FJH A;  2Z1I A;  3DMJ A;  4NCG A;  4O44 A;  4O0I A;  4UQG A;  4DSK A;  3EZ5 A;  3V6D A;  4I2P A;  3IAY A;  5FRM A;  4KHQ A;  2GBZ A;  4DSE A;  1KLN A;  1RBR A;  3KK1 A;  3LP3 A;  3VQ7 A;  1EET A;  2B6A A;  1HNI A;  4DTR A;  4RW8 A;  3M8S A;  5HRO A;  1NK0 A;  2OPR A;  1WSH A;  3SUP A;  3LAK A;  3L2V A;  2DFE A;  4FLX A;  4CFA A;  3SYZ A;  1TAQ A;  3RR8 A;  2ZQB A;  4DTN A;  1LWF A;  1U47 A;  3ZT4 A;  4M3U A;  1VK0 A;  1HPZ A;  1Z26 A;  3ZSY A;  4CEB A;  3ZSQ A;  1A5X A;  1XHZ A;  4F4K A;  3KK2 A;  4KHN A;  1FKP A;  1C1B A;  1RT5 A;  3C95 A;  4HVJ A;  1S1U A;  1S1V A;  1UA0 A;  1ASV A;  4DTU A;  1TL3 A;  1TL1 A;  1Q8I A;  4JS4 A;  4IDK A;  3QIP A;  5KRT A;  2IS3 A;  2AJQ A;  3OYF A;  3K5L A;  3OJU A;  3OY9 A;  3HK2 A;  1JLE A;  3IG1 A;  1L3U A;  1GOB A;  1RDC A;  4IKF A;  1VSL A;  4Z0U A;  1BQM A;  2XY5 A;  1T03 A;  4QCL A;  4KV8 A;  1HYS A;  2OPQ A;  1IKX A;  3V1Q A;  3PX4 A;  1ZBL A;  5HRN A;  1VSD A;  1ZYQ A;  4YFU A;  3QEV A;  1TKT A;  1T7P A;  3RRG A;  4F8R A;  4J2D A;  1UOC A;  3OYI A;  4M3T A;  1X1P A;  2HNY A;  1VSE A;  4IFY A;  3RRH A;  3PY8 A;  3QEX A;  3PO5 A;  4OPK A;  4DS5 A;  4GMJ B;  4FLV A;  3ZSO A;  1RT7 A;  3LPU A;  4YNQ A;  3NHG A;  4DQR A;  3NDK A;  1JLG A;  3SV3 A;  4BWJ A;  2XY6 A;  3IRX A;  3JYT A;  4HUF A;  2KZM A;  3O4Q A;  2PYJ A;  3THV A;  4DMN A;  3D0P A;  1RTH A;  4FJ7 A;  4H4M A;  3DRP A;  4LSL A;  4CGJ A;  3AO3 A;  4OGE A;  4IG3 A;  4EZ6 A;  4CEA A;  4BDP A;  3NGZ A;  1TGO A;  2OPS A;  5HRS A;  2OZM A;  4DSL A;  4OLB A;  1RBT A;  1BHL A;  3NF8 A;  3I0S A;  1BI4 A;  4Z4C A;  3S9H A;  1RBV A;  2G8I A;  4FZX C;  4CIF A;  1TAU A;  3HPG A;  4OPJ A;  4FM2 A;  1RTD A;  4CEF A;  1NJW A;  3PO4 A;  4CED A;  3HT3 A;  4FJL A;  4J2A A;  2X6S A;  1NOY A;  4FJK A;  2HB5 A;  3HM9 A;  3CG7 A;  2OA8 A;  1GOC A;  3HXM A;  4KHS A;  5HRP A;  4MFB A;  1RT1 A;  4KFB A;  4AHS A;  1X9S A;  1S9G A;  4KRF A;  3RMA A;  4RW9 A;  1U04 A;  2WON A;  3HJF A;  3KLE A;  3NF6 A;  3PX0 A;  3KKR A;  4JS5 A;  4FJ5 A;  3PUF A;  4JLH A;  3HL8 A;  4EP5 A;  4CK3 A;  2FBY A;  1BQN A;  3DOL A;  3SJJ A;  1U48 A;  1A5W A;  4DLE A;  1SKR A;  5CYM A;  5KI6 A;  2G8H A;  2OYQ A;  1EKE A;  3HYF A;  4FLW A;  4O55 A;  1O1W A;  3SCX A;  1NK9 A;  3TAR A;  4DTP A;  4CJ5 A;  4LD0 A;  1RBS A;  4CFB A;  2HNZ A;  4IG0 A;  1ASW A;  5FRO A;  1LW0 A;  5SWM A;  3OYD A;  4DQP A;  4CJE A;  4KB1 A;  4ZTJ A;  2IGI A;  4Y1C A;  4E7H A;  1SL2 A;  2KFN A;  4HHT A;  1S5J A;  3BGR A;  3LP1 A;  3WNF A;  2KW4 A;  4CF0 A;  3QNN A;  3S3O A;  3K2P A;  1TK5 A;  1CXU A;  4Q0B A;  1I3A A;  3C94 A;  5EU7 A;  4DLG A;  2HW3 A;  3O4N A;  2FBT A;  4KHY A;  4FJ8 A;  4FZY A;  2YNF A;  3G0Z A;  4CER A;  3KTQ A;  1LAW A;  3C6U A;  4CJ4 A;  4K8Z A;  2HHX A;  3L2R A;  4BAC A;  4B8A B;  2JGU A;  5CY4 A;  5KGX A;  2QK9 A;  2GUI A;  3KIO A;  2E4L A;  4CEQ A;  4C8L A;  1RT6 A;  1JLA A;  4I2Q A;  4M45 A;  4NYF A;  4ELU A;  2VG7 A;  4DQI A;  3NCI A;  4DU1 A;  1SV5 A;  4AIL C;  4DF8 A;  4LH5 A;  3OYA A;  4FK2 A;  1KVA A;  3L3V A;  1T8E A;  3EYZ A;  3NH1 A;  4E3S A;  3VQ4 A;  1LWE A;  3AVB A;  2YV0 X;  3ZCM A;  4AHV A;  3QET A;  2D0A A;  3VQA A;  1LV5 A;  2G8F A;  3HP9 A;  3SI6 A;  2PZS A;  4NYN A;  4XIU A;  3TAQ A;  4F3O A;  1R0A A;  3RMD A;  4B9N A;  4FYD A;  4KI6 A;  3ZT3 A;  1EXQ A;  2QKK A;  5HLF A;  3OYG A;  3OYN A;  4DU4 A;  4N76 A;  1FK9 A;  1MU2 A;  2ITG A;  3NF7 A;  1XC9 A;  3VQ5 A;  4CF2 A;  1WSF A;  3LDS A;  2Z1G A;  2G8W A;  1ZBF A;  3LAN A;  3KLI A;  4FLY A;  3V81 A;  4DWI A;  2G8K A;  1ASU A;  1YTU A;  1RNH A;  1TKX A;  4Q5V A;  2HND A;  5KRS A;  3LZI A;  3M8P A;  3ZSW A;  1BIS A;  2DY4 A;  1WAF A;  2KTQ A;  3O3G A;  1VRU A;  2QXF A;  3QIO A;  1L3S A;  1QQC A;  1EP4 A;  4DTO A;  4BDZ A;  3O3F A;  4B8C A;  1SL1 A;  3HO1 A;  4O4G A;  3ASM A;  3OS1 A;  1JLC A;  3SPY A;  4FCY A;  1IKV A;  3V1R A;  2R7Y A;  4CHY A;  3L3U A;  3QER A;  4F2S A;  1GOA A;  1DLO A;  2Z1J A;  5C25 A;  4CJS A;  1HRH A;  4ZHR A;  1ZBU A;  3FFI A;  3G10 A;  2QKB A;  3OYK A;  4PQU A;  4GVM A;  4C8N A;  3E01 A;  1IKW A;  5FDL A;  3AO1 A;  3QES A;  1RCH A;  2HVH A;  1VSM A;  4FLT A;  3A2F A;  3ZSX A;  3VQ8 A;  3ZT2 A;  3VQ6 A;  1XHX A;  1I39 A;  4BDY A;  4CJU A;  4L8R B;  2O4I A;  5J2M A;  4IBN A;  3MEG A;  2HHW A;  4CJ3 A;  1WSI A;  4BWM A;  4FVM A;  5SZT A;  1TK0 A;  5J2Q A;  1JLF A;  1SUQ A;  4E1N A;  4B9M A;  3JSM A;  2Y1J A;  2VWK A;  1UAX A;  1J53 A;  1C0M A;  2B4J A;  4FM1 A;  3VQP A;  3SUN A;  3TAN A;  3OYB A;  2IDO A;  2P5O A;  1A5V A;  2JLE A;  2PYL A;  3CM5 A;  1J54 A;  3AVK A;  1KSP A;  4M3X A;  3AA3 A;  4E7I A;  4E1M A;  3LP0 A;  3T1A A;  4CHZ A;  3V9Z A;  3RMB A;  2EX3 A;  2G8V A;  1NK6 A;  3SQ1 A;  1RDB A;  4EP4 A;  1QS4 A;  5CZ2 A;  5I3U A;  3HST B;  1Q9Y A;  1S9E A;  3B6O A;  3QNO A;  5D3G A;  1VSF A;  1BCM A;  1NKC A;  1HQU A;  3RMC A;  2XY7 A;  2IC3 A;  4OKE A;  4AHU A;  4CEO A;  4M41 A;  4CJK A;  3VN5 A;  1JXB A;  4KHU A;  4W5Q A;  3AVF A;  1FXX A;  4KPY A;  4Z4F A;  1FKO A;  2YKM A;  2G8U A;  1VSI A;  3TAE A;  1RDD A;  2Z1H A;  4FK0 A;  3NGI A;  1B9D A;  1JKH A;  1TVR A;  3HPH A;  4Z4H A;  1N5Y A;  4M3Y A;  1Z25 A;  2DFH A;  4FJN A;  4KTZ A;  4AHR A;  1U49 A;  2YHB A;  1QE1 A;  1WAJ A;  3HP6 A;  4FW1 A;  3SPZ A;  1LW2 A;  4B9U A;  3H08 A;  4HCC A;  1NJY A;  4FZZ A;  1BIZ A;  3QIN A;  3SNN A;  4KTQ A;  4Z4G A;  3QEP A;  1HJR A;  1Y97 A;  4BE0 A;  2HHS A;  4DFK A;  4DFP A;  2D0C A;  3OS2 A;  1U45 A;  3DLB A;  3P5J A;  3ZT0 A;  1W9H A;  4EZ9 A;  3V9W A;  1C0U A;  4ID1 A;  2HHT A;  1VSH A;  1WNS A;  3HVT A;  3WNG A;  1RT3 A;  3V9X A;  3L2W A;  1NOZ A;  3SUO A;  2OPP A;  2RN2 A;  3KLH A;  1KFS A;  2F96 A;  2HHU A;  2BE2 A;  3OYM A;  3SV4 A;  2KFZ A;  4M3W A;  5K14 A;  5J1E A;  4DTX A;  3AVH A;  1YTA A;  4C8M A;  1KFD A;  3KK3 A;  4I7F A;  2KQ2 A;  5J2P A;  1NJZ A;  1JLB A;  1XWL A;  5HP1 A;  4BE2 A;  3VQC A;  2ZD1 A;  4FM0 A;  3ZT1 A;  4OKJ A;  1VRT A;  4CEZ A;  4DFJ A;  2RF2 A;  3C6T A;  4CJV A;  1HQE A;  2D0B A;  3DLR A;  1NK5 A;  4O0J A;  1QSL A;  4B9S A;  5FRN A;  1S6P A;  1CLQ A;  4CHO A;  3U6F A;  1QSY A;  2ETJ A;  1KCF A;  1S6Q A;  4N5S A;  3OS0 A;  4JRP A;  3AVC A;  3TAP A;  1VSJ A;  3D45 A;  4QOZ B;  1ZBI A;  1IH7 A;  4KRE A;  4M3R A;  4NCA A;  1WSG A;  4ID5 A;  3NH0 A;  3TAG A;  3AVL A;  1G15 A;  3EY1 A;  2ATQ A;  3CFP A;  2OZS A;  4F3T A;  1WN7 A;  4Y1D A;  2BGG A;  4OJR A;  5C42 A;  3MAQ A;  3OYH A;  4W5R A;  2F8S A;  4K8X A;  2X78 A;  1HNV A;  2YNH A;  4B9L A;  3BDP A;  3M8R A;  3K58 A;  3B6P A;  3CFO A;  1K6Y A;  3DRR A;  2B5J A;  4RW4 A;  4E19 A;  4FJG A;  4FJJ A;  4DQQ A;  4E0D A;  1NK7 A;  1N6Q A;  2FBX A;  4KI4 A;  1TKZ A;  3CM6 A;  3KD5 E;  5KTQ A;  1F21 A;  3TAM A;  3DOK A;  1BL3 A;  2YKN A;  3IS9 A;  4KO0 A;  3O3H A;  4DS4 A;  3V4I A;  2HHQ A;  5E41 A;  1QSS A;  4I9Q A;  4HUG A;  2HMI A;  3VQD A;  3VA3 A;  4OGC A;  3ULD A;  3CQ8 A;  3PV8 A;  1D9D A;  3AO4 A;  1HYV A;  4DSJ A;  2X6N A;  3NFA A;  4DG1 A;  1RTI A;  4ZTF A;  3LAL A;  1KTQ A;  4FJI A;  4CES A;  3CFR A;  5HBM A;  4RW7 A;  3VQ9 A;  1D9F A;  5I42 A;  3RTV A;  3AVJ A;  4CEE A;  3NAE A;  2VG5 A;  3L2Q A;  1W0H A;  3NGY A;  2XO7 A;  4F2R A;  1TKD A;  3TAB A;  4B9V A;  3ITH A;  2I5J A;  1L3V A;  4DU3 A;  3DLG A;  3VQQ A;  1NKE A;  4B08 A;  1S1W A;  4CFC A;  1IG9 A;  3OYC A;  3KKS A;  1LAV A;  3F9K A;  2W42 A;  3KLG A;  4HTU A;  2GV9 A;  3AVI A;  4CK2 A;  2Y1I A;  4CHN A;  4W5T A;  3ISN C;  5DMR A;  3HPO A;  3V9S A;  4N41 A;  3KLF A;  4R5P A;  1DTT A;  1VSK A;  3AVN A;  4CEC A;  4W5N A;  4HCB A;  1JLQ A;  1RTJ A;  4CJF A;  4O5B A;  3AA5 X;  3K5O A;  3CYM A;  4OVL A;  3LP2 A;  4QAG A;  3L8B A;  1CXQ A;  1S1T A;  4CGF A;  3MXM A;  4B9T A;  3DLH A;  4PUO A;  1CZB A;  1C1C A;  1JL1 A;  2Q3S A;  4J2E A;  4Z4I A;  3AVG A;  3LWM A;  1JXE A;  4I9L A;  4CF8 A;  3MEC A;  4DTS A;  4B3O A;  4RW6 A;  4C8O A;  4AHT A;  1NK4 A;  3WNH A;  4DSF A;  4CHP A;  3MED A;  1RT4 A;  3OYE A;  1SL0 A;  3M8Q A;  4M42 A;  2YNG A;  4PY5 A;  2RPI A;  4CGG A;  4FJM A;  2FC0 A;  3F73 A;  3KD1 E;  1B92 A;  3P83 D;  4H4O A;  4LH4 A;  1HYZ A;  2FBV A;  4CIE A;  3SUQ A;  1SKS A;  2YNI A;  3TI0 A;  4NCB A;  2F8T A;  2P1J A;  3DRS A;  3DM2 A;  3LWL A;  3SQ0 A;  2A1R A;  1REV A;  3AA4 A;  4KTW A;  1C1A A;  2XRI A;  4CIG A;  3LZJ A;  3TAF A;  4ELT A;  5DK5 A;  4N47 A;  1C6V A;  4GW6 A;  3AO2 A;  1S1X A;  4CF1 A;  1X9W A;  2HHV A;  3VQB A;  3U3Y A;  3K5M A;  1RT2 A;  2ZE2 A;  3NH2 A;  1L3T A;  4MQ3 A;  3NE6 A;  3DYA A;  1ITG A;  4LSN A;  4C8K A;  2YHA A;  1Q9X A;  4CGD A;  5JS1 A;  3AVA A;  3K57 A;  1UWB A;  3I8D A;  1UA1 A;  1NKB A;  4CK1 A;  3RWU A;  2NUB A;  2BAN A;  3DLE A;  3ZSV A;  4AHC A;  3I0R A;  1IKY A;  3OYJ A;  3MXI A;  3T3F A;  4CHQ A;  2X74 A;  3SQ2 A;  3SQ4 A;  4Z4E A;  1KVC A;  1HMV A;  4KKO A;  1U4B A;  3MXJ A;  5CYQ A;  2E6M A;  5KGW A;  1RBU A;  1D5A A;  2XY8 A;  3PX6 A;  3NF9 A;  4CJP A;  3K59 A;  3OJS A;  3MEE A;  2D5R A;  5C24 A;  4E7L A;  1L5U A;  4FJ9 A;  1YVU A;  3AVM A;  4E89 A;  4CGI A;  1CZ9 A;  4W5O A;  3QO9 A;  3AO5 A;  5HRR A;  4KB0 A;  1NJX A;  3T19 A;  4CJL A;  1BI4 B;  1B9F A;  4AH9 A;  4J2B A;  4HUE A;  4FXD A;  4H8K A;  4G1Q A;  1BIU A;  3ZSZ A;  1KRP A;  1BGX T;  4WE1 A;  4CF9 A;  4KAZ A;  5J2N A;  3SZ2 A;  1TK8 A;  4CFD A;  1WSE A;  3V1O A;  2IOC A;  4FLZ A;  3S3N A;  4CE9 A;  4DTJ A;  4BE1 A;  4DSI A;  3DI6 A;  2XHB A;  1J9A A;  4CJR A;  3OVN A;  4KHW A;  1ZBH A;  1LWC A;  2BDP A;  2DTU A;  4IFV A;  4M3Z A;  1SKW A;  3LAM A;  3RR7 A;  3P1G A;  4CGH A;  1D8Y A;  1YT3 A;  4CJQ A;  1X9M A;  1WSJ A;  1EX4 A;  4JRQ A;  4FJX A;  4FW2 A;  1KVB A;  3AA2 A;  5T7B A;  1RDA A;  3ZSR A;  3K5N A;  4OKK A;  1KLM A;  4DF4 A;  3UIQ A;  1T05 A;  1DTQ A;  2HVI A;  3TR8 A;  1WLJ A;  1C0T A;  2O4G A;  4FLU A;  1XI1 A;  4FK4 A;  3DLK A;  4DQS A;  3L2U A;  2PY5 A;  1BCO A;  2LSN A;  3VQE A;  2P51 A;  2RKI A;  4TSX A;  4N56 A;  4E7J A;  4LY7 A;  4ICL A;  1QTM A;  1JL2 A;  3VA0 A;  2DFF A;  4PWD A;  3HVR A;  2E6L A;  3S3M A;  3V9U A;  2KZZ A;  2P5G A;  3WNE A;  4OLA A;  3TWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...