1VSLA

Asv integrase core domain d64n mutation with zinc cation
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTNFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (INTEGRASE)
publication title Structural basis for inactivating mutations and pH-dependent activity of avian sarcoma virus integrase.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
total genus 55
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vslA00
4E7IA 1BCOA 4CGDA 4CEZA 3OYDA 1FK9A 3TWHA 4BE0A 4JLHA 3O3FA 4M42A 2P1JA 2XY6A 3K58A 4DLEA 4I9LA 5I42A 2PYJA 3OYMA 1JXBA 3QETA 1I3AA 3LP3A 4KHNA 1REVA 4FYDA 1C1AA 4FJXA 2OA8A 1U49A 3HYFA 4E1NA 1KFDA 3QEIA 2QK9A 3NF8A 3C6UA 2YNFA 3OYHA 2FBXA 3ZSOA 1FKPA 2HHQA 2HHWA 4KRFA 3AVGA 1QSYA 1UA1A 2YV0X 1EP4A 4E7LA 3AO3A 3K5LA 2G8FA 1ITGA 1C1BA 3RR8A 4HTUA 2G8WA 1LWFA 3T1AA 1RT6A 1DTQA 3L2RA 3RMCA 3V6DA 1U45A 2OPPA 4J2BA 3F73A 4CF0A 3TARA 4FLYA 4FJNA 4ID1A 1A5WA 5HRPA 3FFIA 4DQSA 1TK5A 1Q9XA 1J54A 5J2NA 1JL1A 1TKDA 3AVAA 1SL0A 1RT4A 4HUEA 2YHAA 4CF8A 1QTMA 4HUFA 3ZSYA 1BGXT 3O4NA 1VSDA 3KK2A 1HYVA 3B6OA 5K14A 2FBYA 2O4IA 1WSJA 3LALA 3MECA 4RW6A 3ZT2A 5HP1A 2XY7A 4F3OA 3KK1A 5I3UA 3NF9A 4YNQA 4CHOA 5J2QA 4FJ8A 1NJYA 1JLQA 1GOCA 1XHZA 3L3UA 3AVIA 2HB5A 4CK3A 3SQ2A 4DFJA 1CZBA 3WNEA 4DU1A 3EY1A 4FZZA 3AA2A 2KTQA 3V1QA 2AJQA 4BACA 1BQNA 2ATQA 4B9TA 3RWUA 2IAJA 3U6FA 3C6TA 1BQMA 1S9GA 4O0JA 1BIZA 4KREA 2KFNA 3HVTA 4F4KA 1VRTA 3TR8A 4AHSA 1UA0A 1NJZA 3JSMA 3DRPA 4CEQA 1NKCA 1X9WA 4DFKA 2HHTA 1IH7A 3F9KA 1HJRA 4PY5A 1J9AA 3AVCA 3HPOA 4KHUA 4M3UA 4B8AB 1VSFA 4B8CA 4E3SA 1RDBA 2HMIA 3QINA 1RBUA 2YNHA 4NYFA 1RILA 4OJRA 4DF4A 1VSEA 2O4GA 1WNSA 4I2PA 1KVCA 4E1MA 1ZBHA 3NHGA 1Z26A 3AA4A 5C24A 3T19A 3RMBA 1JLAA 3LZIA 1RDDA 1TGOA 4KI6A 1NKBA 4AHRA 3DLBA 3ZSVA 4FZYA 4KTWA 1UOCA 4B9SA 3VQ8A 3QEPA 4CHPA 4ICLA 1SUQA 3TAMA 4ZHRA 1WSEA 1U4BA 1RTJA 4CEBA 4N5SA 3SNNA 1CXUA 4CHQA 1N5YA 1C6VA 4K8XA 1NK4A 1X9MA 2HHXA 3ITHA 3RMAA 4N56A 1KRPA 4N76A 4M3RA 1RBVA 4OKKA 3VQDA 1SKSA 3NGYA 3RTVA 2RF2A 1HPZA 3EYZA 3VQ6A 3RRHA 1LAVA 3WNHA 2IDOA 5KTQA 1VRUA 1NK9A 4FJMA 4PA1A 4N41A 4FW2A 2G8HA 1KTQA 3MEEA 2RPIA 3CM5A 3QIOA 3M8PA 3O3HA 3V9WA 2HHSA 1YVUA 1VSIA 4FJKA 3HXMA 4E7HA 2W42A 2P5OA 2E4LA 4CGJA 2IGIA 3HL8A 5J2MA 4CGGA 4G1QA 3BGRA 1TK8A 1D8YA 1RBSA 1S1VA 4FJJA 3CM6A 3G10A 3LANA 3OS2A 4C8MA 3AV9A 2FBTA 2QKBA 3KTQA 4C8NA 1W9HA 3AA5X 1U04A 3V9ZA 4DTOA 4DFPA 2XO7A 4CJTA 2D5RA 3HVRA 2ZD1A 2HNDA 3AO5A 1S6PA 1C0UA 2D0CA 2X78A 4FVMA 4KFBA 4N47A 3V1OA 3NE6A 3H08A 1IG9A 1EKEA 1VSJA 1TL1A 3HJFA 3KLGA 3OJUA 2PYLA 4I2QA 4DTMA 1LV5A 3U3GA 2BGGA 4B3OA 1ZBUA 4AHUA 3KKRA 4CF9A 1NK8A 1GOAA 3SUPA 4IKFA 3D45A 1HQEA 4YFUA 4KB0A 2VWKA 3RRGA 4KHWA 4CJWA 4RW8A 4FLWA 3ALYA 4DQPA 2F8SA 3NF7A 3MEGA 3OYBA 4B9MA 1JXEA 2A1RA 2Q3SA 3KKSA 4Z4FA 4UQGA 1J53A 1TKXA 2I5JA 4DMNA 1TK0A 5C25A 4DTSA 4DSIA 4HCBA 4PWDA 3ISNC 1YT3A 3AVLA 4CFAA 4CJ4A 1S1WA 4W5TA 3RR7A 1BHLA 3VQ5A 1BI4B 4CK1A 5T7BA 1QS4A 3K59A 3PY8A 1T05A 4KHYA 4OGEA 1TL3A 2DFEA 4GVMA 4DTNA 1KCFA 4OKEA 2G8IA 1CXQA 4IG3A 5HRNA 4O0IA 3A2FA 3HM9A 3ZSQA 3ZT0A 1S1XA 4DFMA 3U3YA 5CZ1A 3SQ1A 4CHNA 3QLHA 2YNGA 3V9XA 4IDKA 3V1RA 3S3MA 3MXMA 5HLFA 3K57A 3LP2A 3KLHA 1KFSA 3KJVA 3SUNA 1NOZA 3OYKA 4CEFA 4M3ZA 2XHBA 3LWLA 3L2QA 1CLQA 4M45A 4CJUA 3ZT4A 4HUGA 4FJIA 4JRPA 3AVFA 3M8QA 4CJ3A 3NF6A 4RW7A 4FJ9A 4OGCA 4KTZA 1YTUA 3TAEA 2EHGA 1IKVA 4LSNA 4CFBA 4PUOA 3VQCA 2HNZA 3O4QA 1L3VA 1ASUA 4BE2A 3SV4A 4C8OA 2RN2A 4C8KA 4M3YA 5JS1A 1KLNA 1C1CA 2G8KA 3AO1A 1CZ9A 1Y97A 3ZSWA 1SL2A 4RW4A 1FXXA 5SWMA 4HVJA 2OZSA 1RDCA 4MFBA 5FRMA 2DY4A 3VQAA 1SKRA 3ASMA 4M41A 3NFAA 2HW3A 4KI4A 1RDAA 3OYIA 2NUBA 4DSEA 4DU4A 3BDPA 2IS3A 4EP5A 1BIUA 5KRTA 4AILC 2F8TA 3MAQA 1T03A 1L3SA 1T8EA 1ZBIA 1NK6A 1S1TA 2ETJA 1HRHA 4Y1DA 4FCYA 4FLXA 3QEWA 3HPGA 2B4JA 3L3VA 4E0DA 1JLBA 1TVRA 4B9NA 3VQ4A 4HCCA 4W5RA 1QSLA 1L5UA 4FLVA 2P5GA 3QNOA 2YHBA 3QESA 4EZ6A 4DQQA 4CJKA 5HRRA 2D0AA 3VA3A 4CEAA 1LAWA 1ZBFA 3AA3A 1RCHA 2DTUA 3M8SA 4BDYA 3LDSA 2GBZA 4QAGA 2BDPA 4H8KA 3ULDA 1G15A 4BE1A 2Y1IA 1XHXA 4Z4IA 3LPTA 1RTDA 3IRXA 3DYAA 3VA0A 3L2VA 3NAEA 4F2RA 1JLGA 2WOMA 1SKWA 3KLIA 1S1UA 4IBNA 4AHTA 4F2SA 4E89A 1A5XA 3AVNA 1S5JA 3CG7A 4B08A 3SI6A 1IKXA 2X6SA 1IKWA 4LY7A 3MXJA 4HHTA 1X9SA 1J5OA 4OLBA 4DU3A 1WN7A 3TANA 2BE2A 4CE9A 4CIEA 3IG1A 3QERA 3S9HA 4NYNA 3OS0A 4KHSA 4FM1A 4DTXA 1D5AA 2EX3A 4DG1A 4FJHA 1RBTA 4BWJA 4NCGA 4CERA 4FLTA 3KK3A 2XY8A 4CIFA 3IAYA 4DSKA 5KRSA 3HP9A 4AHVA 1O1WA 1JKHA 3C95A 3VQBA 3TAPA 1RTIA 4IFYA 4J2AA 2VWJA 3TAFA 3TAGA 1B9FA 3AVKA 4KPYA 4B9UA 3VQQA 4FM0A 4CHYA 2PY5A 2QXFA 2PZSA 1KSPA 3HK2A 4Z0UA 1C0MA 4K8ZA 4AH9A 3OYGA 3P5JA 1NK7A 5J1EA 3OYNA 1LW2A 5J2PA 2XRIA 2G8VA 4EZ9A 4KTQA 4ELTA 2WONA 5JS2A 4OLAA 2ZQBA 4RG8A 2X6NA 1LWCA 2OZMA 1D9DA 1X1PA 5CYQA 3NCIA 4R5PA 3OY9A 3QO9A 1WSIA 3IS9A 3OJSA 1RBRA 2FC0A 4GW6A 2HVHA 3DRRA 4IG0A 3OYAA 1C0TA 4F3TA 2YKNA 5HROA 4W5OA 4M3XA 3OYEA 1RT5A 3UIQA 2D0BA 4Q5VA 3T3FA 1NJWA 3LP1A 4TSXA 4IFVA 4KV8A 2DFHA 1BI4A 3HP6A 1SV5A 2VG5A 4J2EA 1RT1A 1KLMA 3I8DA 1ASWA 1RT2A 4CJSA 4ELVA 2VG7A 1UAXA 2Z1JA 2GV9A 4DSFA 3C94A 4EP4A 4FK0A 2KW4A 4NCAA 4FK2A 3OYJA 1JLEA 5CZ2A 2Z1IA 3P1GA 3ZT1A 4CEDA 1IO2A 4C8LA 5FRNA 3S3OA 2FBVA 3HO1A 2Z1GA 3ZCMA 3WNGA 3TAQA 4LH4A 3DLEA 4Q0BA 3THVA 3CFRA 1S6QA 3PUFA 4W5QA 1RT3A 4PQUA 3V9SA 3I0RA 1QE1A 3SCXA 1YTAA 1ZYQA 1Z25A 3VQ9A 2B6AA 3KLEA 5C42A 1KVBA 1HQUA 3HSTB 1RNHA 1K6YA 3LAMA 4RW9A 2YKMA 3OYFA 3NDKA 1TV6A 4JRQA 2XY5A 2KFZA 3QEVA 1TAUA 4OPJA 4E7KA 4DTPA 3ZT3A 4QCLA 4DS5A 3LAKA 4W5NA 1WAFA 2E6LA 5FROA 4CGFA 4JS5A 4ZTJA 1Q9YA 5D3GA 2BANA 4ID5A 3L8BA 3NH1A 1XC9A 1D9FA 4O55A 4FXDA 2GUIA 3E01A 4NCBA 5KI6A 3AO4A 1KVAA 1WSGA 4LH5A 3QNNA 2HHUA 4LSLA 3AVMA 4WE1A 4FZXC 3PX6A 4CJPA 1EETA 3NGIA 3AVHA 3L2UA 4CJVA 4Z4CA 3V9UA 3SQ0A 4CJ5A 2JGUA 1WLJA 3TABA 3DLHA 2KZZA 4XIUA 3HT3A 4DQRA 1NJXA 1UWBA 3AO2A 4FJGA 4FJ7A 1TKZA 1TAQA 3I0SA 1WSHA 4O44A 4CECA 4Z4EA 3B6PA 4KHQA 5KGWA 4BWMA 3K5MA 3NBPA 3JYTA 2Z1HA 1NK5A 4FJ5A 4QOZB 1JLCA 2RKIA 4FJLA 4DWIA 1GOBA 3L2WA 3ZSRA 2KZMA 1WAJA 3DOKA 1BCMA 4CGHA 2ITGA 3G0ZA 3SJJA 2QKKA 4DQIA 3M8RA 4DS4A 4DF8A 4CESA 4DLGA 4DTUA 1ASVA 4KAZA 2LSNA 3SZ2A 4L8RB 3D0PA 3DI6A 3TI0A 3SUQA 3SQ4A 1RTHA 3VN5A 4CF1A 1L3UA 3SPYA 1Q8IA 3NH0A 4Z4HA 3OVNA 4E7JA 2R7YA 3K5OA 3DLRA 1F21A 2OPRA 4JS4A 3DLGA 3V4IA 3AVJA 3CYMA 1MU2A 3OYCA 1BISA 5CYMA 4J2DA 4B9LA 2HHVA 5DK5A 3ZSXA 4MQ3A 2HVIA 4ELUA 1B9DA 1QQCA 4FW1A 5FDLA 4KKOA 5E41A 2VG6A 1W0HA 4I7FA 3WNFA 3PO4A 4DTJA 3DLKA 4Z4GA 1RT7A 4GMJB 4CFDA 3CFOA 3MEDA 1HYSA 2ZE2A 1FKOA 2KQ2A 3PV8A 1HMVA 3NH2A 1VSMA 3LP0A 1BL3A 1QHTA 1I39A 4CJEA 3KLFA 3K2PA 4H4OA 1ZBLA 1L3TA 2F96A 4BDPA 3KIOA 4FLUA 3HPHA 5HBMA 5KGXA 1XI1A 5DMRA 1U47A 4Y1CA 4FLZA 2A1SA 1VSHA 4OKJA 3SUOA 2Y1JA 2OYQA 4LD0A 1VSKA 1WSFA 2E6MA 1DTTA 4I9QA 1SL1A 3ZSZA 3VQEA 1NOYA 1LW0A 2X74A 2OPSA 2P51A 4E19A 1S9EA 1EX4A 1IKYA 1JL2A 3CFPA 4CGIA 3S3NA 4M3WA 4DSJA 4ZTFA 3EZ5A 5HRSA 1JLFA 1N6QA 1HNIA 3PX0A 3OYLA 2IOCA 1U48A 3MXIA 3LZJA 1DLOA 2DFFA 3DRSA 5SZTA 4OVLA 4CJQA 1XWLA 1T7PA 2G8UA 1B92A 2IC3A 4CJRA 3O3GA 4DSLA 3V81A 1TKTA 3PX4A 4B9VA 3LPUA 4M3TA 3AVBA 3NGZA 4BDZA 1R0AA 4CEEA 3QEXA 4O5BA 4CEOA 3DM2A 1VSLA 3P83D 4CFCA 3KD5E 2HNYA 3SPZA 1LWEA 3CQ8A 4FK4A 5EU7A 1EXQA 4KO0A 2OPQA 3LWMA 3K5NA 4CK2A 1NK0A 4KB1A 1HNVA 1NKEA 3KD1E 3DOLA 3DMJA 4DTRA 3QIPA 3PO5A 4CHZA 4CJLA 2YNIA 3VQ7A 2B5JA 4OPKA 1HYZA 4CJFA 4CF2A 3RMDA 2JLEA 3SV3A 4H4MA 5CY4A 4CIGA 3SYZA 3OS1A 1VK0A 1A5VA 4O4GA 1QSSA 4CCHA 4F8RA 3VQPA 4AHCA 4FM2A
chains in the Genus database with same CATH superfamily
4XH4A 3OYDA 4BE0A 4JLHA 3O3FA 4M42A 5IT9O 2O8DB 3VTHA 5AQYA 4WQ4C 4DV0K 3QETA 5C2DA 1KXPA 3GE1A 3THYB 3KZBA 3NF8A 5C2FA 2FBXA 4LF4K 2YV0X 4CI6A 2G8FA 5BR9A 4H5WA 3RMCA 1U45A 4CBXA 1XMQK 2QXLA 3M3ZA 4FLYA 4ID1A 2HBJA 3VPZA 3AVAA 4CD3A 4HUFA 1WB9A 3M5RA 3B6OA 5K14A 2FBYA 1WSJA 3LALA 4RW6A 3ZT2A 3HOTA 2XY7A 5I3UA 3NF9A 3WUHA 5J2QA 1XHZA 4JI1K 3ENBA 1CZBA 3WNEA 4FZZA 2E1YA 2KTQA 2AJQA 1Q82O 3P38A 1BQNA 3U6FA 1S9GA 4O0JA 2KFNA 3QFPA 4AHSA 3QFUA 5AQVA 1UA0A 3JSMA 4DFKA 2HSTA 1HJRA 1T3VA 3HPOA 4YOTA 2HMIA 1WUAA 2F9TA 2YNHA 4NYFA 4X66K 3OW2M 2O4GA 1TUYA 4DR7K 3NHGA 1Z26A 1NM1A 5C24A 5M1QA 3AGKA 2V7ZA 2W40A 3S41A 4KI6A 3MCAB 4PHTX 3OHRA 4FZYA 4KTWA 3QEPA 3TAMA 1RTJA 1DEJA 4CHQA 3DXKA 4K8XA 1NK4A 3ITHA 2BUPA 1RGIA 1NG9A 3NGYA 4ISEA 2RF2A 3EYZA 3VQ6A 5KTQA 4ILJA 3SAHA 4PA1A 3JS6A 2G8HA 5AFUH 3KVGA 3FZKA 3QIOA 4KHUA 3HXMA 4MDBA 4BR4A 2E4LA 2IGIA 5J2MA 1RBSA 3DXKB 1S1VA 3CM6A 3LANA 1NMNA 2EWSA 3AA5X 1U04A 4DFPA 5I9EB 4A59A 2ZD1A 2HNDA 3AO5A 3NE6A 4N47A 1JJ2M 1EKEA 1TL1A 2PYLA 1JCFA 4BRHA 3U3GA 4B3OA 2E1ZA 1K8AO 1GOAA 4BG9A 3SUPA 1HQEA 4YFUA 2F8SA 3NF7A 1JXEA 2Q3SA 3KKSA 4UQGA 2I5JA 4HCBA 4DSIA 1HX1A 4CJ4A 4B9QA 4Z94A 3EKUA 4CK1A 1I94K 4KHYA 1GLLO 1TL3A 2G8IA 4O0IA 1FW6A 4GV9A 1HR0K 3ZSQA 3G25A 3BY5A 4IDKA 3V1RA 4LF9K 3KJVA 2XHBA 1IJJA 1YJNN 1HLUA 4FJIA 3AVFA 4KTZA 3VEOA 3TAEA 4CFBA 1S3XA 2WTUA 2DPNA 4UY8O 1ASUA 5AQJA 3CI5A 2G8KA 1CZ9A 1Y97A 3ZSWA 4RW4A 1FXXA 5SWMA 1RDCA 5FPNA 2DY4A 3FGUA 4DU4A 4GV6A 2E2OA 3MAQA 1ZBIA 2ETJA 4FCYA 4NXMK 3R8EA 1JLBA 3VQ4A 3R3LA 4HCCA 1QSLA 2WC9A 3DWLA 5HRRA 4JEPA 1ZBFA 3AA3A 1N33K 1BA0A 4MLEA 1LOTB 1G15A 4BE1A 3CIPA 2WOMA 1Q86O 2A42A 1KC8O 5KPZA 4E89A 1WBDA 1OKJA 1IKXA 1OH8A 4JK8A 4HHTA 1X9SA 1J5OA 1BUPA 2BE2A 5A2QO 4KH4A 3OS0A 4DTXA 3ULEA 2XY8A 4CIFA 3IUCA 5E26A 1MA9B 1O1WA 4BROA 4WFAL 2P9NB 1B9FA 3AVKA 4KPYA 3UB5A 2VCPA 3HK2A 4Z0UA 3SAFA 5J1EA 2G8VA 3IFRA 4EZ9A 2WONA 5JS2A 3MDQA 2X6NA 1LWCA 1VQ7N 2V7YA 2OZMA 4DQ8A 3J81O 3IS9A 5KPRA 1C0TA 4F3TA 4W5OA 4BR5A 3OYEA 1RT5A 4C1NK 4Q5VA 1BU6O 3HRGA 4CJ7A 2VG5A 5GAHP 1KLMA 2BH1A 2KHOA 1UAXA 4LFCK 5AQRA 1YXQA 1T6CA 2ZWHA 3JAMO 2JWKA 5FRNA 3HO1A 3WNGA 3TAQA 4LH4A 3Q7BA 3DLEA 3J80O 2A3ZA 2A41A 3V9SA 3P4IA 3SCXA 1VQPN 1Z25A 1KVBA 1RNHA 3THWB 3LAMA 1GLJO 3QEVA 5C15A 3LAKA 2KLAA 4W5NA 5FROA 1Q9YA 4PKGA 4ID5A 3NH1A 4O55A 3DXMA 1KVAA 2HHUA 4LSLA 3AVMA 3BZCA 2WBNA 5AQFA 2GX9A 4XIUA 4DQRA 1UWBA 1TKZA 3E9OA 3I0SA 1U2VA 3HZ6A 3DXMB 5KGWA 3K5MA 3NBPA 2O8CA 2RKIA 4FJLA 4GV3A 5AQSA 1WAJA 2Q0UA 4DQIA 4AM7A 4DF8A 3LDNA 1BG3A 4CESA 4PKIA 3SZ2A 1KAYA 3D0PA 1OVQA 1U2VB 4DR1K 3SPYA 2P9PA 3NH0A 4Z4HA 2O8CB 2R7YA 4FL9A 3DLLL 4JI2K 4JS4A 3DLGA 3FLCO 1MU2A 4ILGB 3OYCA 4K25A 1YJ9N 2HHVA 3ZSXA 2PFUA 3KK7A 1QQCA 5FDLA 2FSJA 5MLCQ 3DLKA 5AQMA 4K43A 3J8AA 4CFDA 1HYSA 2ZE2A 1FKOA 2P9PB 1I39A 2F96A 4FLUA 1U47A 5JICA 2A1SA 2Y1JA 1N34K 4PL7A 3ZSZA 3VQEA 2GWKA 1IKYA 4M3WA 4DR4K 4BRFA 1W7AA 3UE5A 3CCLN 1JLFA 3OYLA 3F2KA 1DLOA 1GLEG 3AAQA 1D4XA 2DFFA 3DRSA 5SZTA 2QA4N 1XWLA 1T7PA 1NGAA 4OPHA 2E8AA 3V81A 3EKSA 3O9SA 4CZLA 1R0AA 4CEEA 4CEOA 1VSLA 2P9UA 2HNYA 3SPZA 3H6EA 3K5NA 2OPQA 1NMDA 1HNVA 1KD1O 3KD1E 1NNEA 4DTRA 4BR7A 4IXCA 4MO4A 4OPKA 5CY4A 4CCHA 4F8RA 4M7XA 1NGDA 4AM6A 4E7IA 4FWSA 2P9UB 5BRHA 4HTLA 3ID6A 5LJWA 1JXBA 1I3AA 4KHNA 1REVA 3A5OC 3K0SA 4C23A 4FJXA 1U49A 1KFDA 4DR6K 3O5BA 4NLBA 2QK9A 2ASOA 4B3MK 3THXA 4KRFA 1UA1A 4IZ9A 1GLFO 3AO3A 1ITGA 1C1BA 1R59O 3D2FA 4JI8K 1RT6A 1DTQA 4WFNL 2OPPA 5EX5A 3F73A 2UXCK 3TARA 4FJNA 3FFIA 1TK5A 1J54A 1TKDA 5BRDA 2BTFA 4HUEA 2UUAK 3FZLA 3THXB 1M1KO 1VSDA 3KK2A 4F3OA 3D2FB 3FZMA 4YNQA 3VEWA 4FJ8A 5AQWA 3WT0A 3WXMB 2HB5A 4CK3A 4DFJA 3MK6A 1YITN 1XNRK 4NLCA 1BIZA 3HVTA 4F4KA 4LF6K 4LF7K 3ZX0A 1NJZA 2HHTA 3ZX2A 4CEQA 1NKCA 5LMUK 3B8AX 1VQKN 1J9AA 4B8CA 2PAVA 5EOYA 1OH5A 3QINA 3ZLJA 3PSFA 4DF4A 3UKRA 2P9KA 4I2PA 5JVGL 5M1FA 1ZBHA 3O9UA 3T19A 2O8BA 1RDDA 5CHIA 3F5TA 3VQ8A 4O8KA 4CHPA 1SUQA 1HKBA 1U4BA 1WSEA 3SNNA 4CEBA 1C6VA 3MN6A 2NRHA 4JK9A 4RCHA 3UKRB 1X9MA 4H0PA 1JCEA 5BN8A 4N56A 4N76A 4M3RA 3N4PA 2O8BB 3WXJA 3RRHA 1VRUA 3CPEA 1Y64A 4JNEA 1J6ZA 3MEEA 2RPIA 3V9WA 3NMUA 1YVUA 4B1XB 3VEVA 2W42A 4E7HA 1TK8A 3T1YK 4CGGA 3BF3A 4G9ZA 3OS2A 2FBTA 3HBTA 4NO7A 4C8NA 3H1QA 2O8DA 1W9HA 2XO7A 1E4GT 2CGLA 2HF4A 3FE1A 1IBMK 3D7EO 4BVPA 4DTMA 4BRLA 1LV5A 2F9WA 4CZIA 4OPAA 4CF9A 1NK8A 4IKFA 3D45A 1C0FA 3L6QA 4CJWA 3ALYA 4O8UA 1YJWN 3CC4N 1GLBG 3MEGA 3CQYA 4QS8A 3EE9A 4Z4FA 1O13A 4CZGA 1TKXA 5C25A 3SJHA 4DTSA 4PWDA 3LDLA 1NU0A 3AVLA 4CFAA 1S1WA 1BI4B 1P90A 4LC9B 3K59A 3R1XA 4H0TB 4L3QA 5GAEP 4JI3K 1KCFA 4OKEA 4IG3A 4DFMA 3ZT0A 3U3YA 4CHNA 3QLHA 5JVHL 3K57A 1QZ6A 1ZC6A 3C65A 1NOZA 4CEFA 1EO1A 3LWLA 1CLQA 4DHYA 4CJUA 3ZT4A 3M8QA 1YTUA 3NF6A 2P9LA 4JD2A 1KQSM 4PUOA 5EXWA 1VAZA 4C8OA 4J8FA 4JV5K 4M3YA 3OA9A 2ITMA 5BRFA 1ATRA 3VGLA 4BRQA 4HVJA 4YOWA 4M41A 3NFAA 1VQ8N 2WFBA 4KI4A 1RDAA 2NUBA 4DSEA 2P9LB 2F8TA 4JD2B 1NLVA 1HRHA 4Y1DA 3HPGA 3VGKA 3OBYA 3L3VA 4HWIA 4BRPA 1N8RO 1QVFM 3O08A 4B9NA 4IDHA 4W5RA 4FWMA 1L5UA 2P5GA 2NRVA 4GKKK 2D0AA 4GNIA 1Q81O 1LAWA 2CH6A 2BDPA 4H8KA 3ULDA 1XHXA 1RTDA 1RDWX 3NAEA 3CMEN 3KLIA 1S1UA 4U7BA 4B08A 4LY7A 4LFBK 1WN7A 2NRXA 3TANA 3FZFA 1ATSA 3IG1A 3ID8A 4KBOA 4NYNA 4KHSA 4FM1A 2HMPA 4DSKA 5KRSA 4AHVA 2A6AA 3H1VX 4A57A 1RTIA 4IFYA 3ZYYX 4FM0A 4PL8A 3WEEA 2PZSA 3OYGA 3VF4A 4B1WB 4WQ5A 3OYNA 4OLAA 4BRIA 4X64K 1ILYA 1D9DA 3D2EA 3M1FA 3QO9A 3OY9A 2HVHA 2ZM6K 3WEEB 4YDUC 2YKNA 2D0BA 2QWLA 3MN5A 1YIJN 3SMPA 2ASMA 3LP1A 3R6MA 4IFVA 4KV8A 2DFHA 2NRRA 1SV5A 4J2EA 3D2EB 4BVOA 1RT2A 3SAGA 4CD1A 1X3MA 2Z1JA 1W97L 4EP4A 2Q1NA 1JLEA 1Z6RA 5CZ2A 3P1GA 4CEDA 2FBVA 1IV0A 2IIRA 2E88A 3ZEUA 1HKCA 1QE1A 5CR4A 1YTAA 1ZYQA 3VQ9A 4CZMA 4JHDA 1HQUA 4E1JA 3HM8A 1K6YA 3OYFA 3HOSA 2YKMA 2KFZA 1TV6A 5BPNA 4E7KA 4KH6A 4DS5A 4X65K 1WAFA 2E6LA 4CGFA 5D3GA 4GVEA 4EHUA 3E01A 5KI6A 3AO4A 3ZEUB 4LH5A 4JHDB 4BG8A 4CJPA 1EETA 1VQNN 4JKBA 3O4WA 1YI2N 3CJ9A 1BWFO 3QICA 3M6GA 3V9UA 3CJAA 4CJ5A 2NRZA 1WLJA 5M1KA 4OO1J 2KZZA 1NJXA 4GY2B 3GL1A 4FJ7A 4CZKA 1TAQA 1WSHA 4O44A 2YX6A 4V19S 1VQMN 1IBLK 4FJ5A 3VEXA 1JLCA 2NRWA 4QOZB 2QW9A 3L2WA 2ITGA 3G0ZA 3SJJA 2WUSA 4DLGA 3AARA 3K9JA 4EAHD 5LY3A 3T1HK 2UXBK 3DI6A 3TI0A 3A0IX 4E7JA 3IKMA 5AQTA 4H0VB 3IDHA 3DLRA 3V4IA 2P9NA 3HI0A 4JI0K 1BISA 3W0LA 4J2DA 5DK5A 2HVIA 4MQ3A 4IOCL 4ELUA 3MX2A 3O1WA 3L0QA 3WNFA 4I7FA 3PO4A 4DTJA 4K41A 2E2NA 3NH2A 1VSMA 1X9JA 4BDPA 4FWLA 1XI1A 1GLAG 3NVMA 5HBMA 5DMRA 3SUOA 3TPQA 3A8YA 3GG4A 4LD0A 4DR5K 4FWOA 1GLCG 3SLCA 5IWAK 2P51A 1S9EA 3J7YP 1NGGA 4M63C 4CGIA 3S3NA 4DSJA 5HRSA 1HNIA 3LM9A 1HNXK 3D6RA 2IOCA 1U48A 3ZETA 4EFHA 1RDUA 1B92A 2IC3A 3CJ1A 3O3GA 1TKTA 3LPUA 4BDZA 4O5BA 2ZF5O 3P83D 3KD5E 3CPWM 3ZETB 1EXQA 4KO0A 5AZIA 3THWA 1NKEA 3CJ7A 3QIPA 3PO5A 3VQ7A 4DR3K 2B5JA 5AQIA 3RMDA 2JLEA 3SV3A 1QSSA 3SYZA 3OS1A 4O4GA 5M1OA 4DKWA 2YI1A 1YAGA 2P9IA 4CGDA 3O8MA 1HUXA 2XY6A 4YHHK 4I9LA 5AZIB 5I42A 2PYJA 4FOIA 4FYDA 1C1AA 4JAXA 5TKWA 2OA8A 1LCUA 5C0YA 3AY9A 3QEIA 3C6UA 4FPBA 5BPMA 2P9IB 3EN9A 2HHWA 3C0BA 3CHWA 4H5NA 4BY9C 1EP4A 2FXUA 2AA4A 4HTUA 2G8WA 3T1AA 2HBKA 2OCEA 3L2RA 4J2BA 4CF0A 4ISGA 4IO9L 4DQSA 1E4FT 2RHKA 4DR2K 1SL0A 5B8HA 5E84A 1BGXT 4WQ5C 5FPEA 4DV7K 2ZGYA 2Q31A 1V4SA 5HP1A 4B3SK 3MN9A 4R79A 5DM6L 1GOCA 4JKGA 3CF5L 3EY1A 3V1QA 5FPMA 5LJVA 3RWUA 2IAJA 1BQMA 2YHYA 4BR9A 3CMAN 4B1VA 4KREA 3CJBA 2ZJPL 3DRPA 3A5LC 1X9WA 1IH7A 4K42A 4JI5K 4PY5A 3AVCA 4JKGB 4M3UA 4B8AB 3A5NC 2UXDK 5ELZA 4OJRA 4DV5K 1VSEA 3MWPA 1WNSA 3FR0A 2KKZA 3RMBA 1JLAA 4FVUA 1T44A 3VENA 1NKBA 2UYTA 3DLBA 3ZSVA 4XH1A 4A61A 4B9SA 4QS7A 1K8KB 4ZHRA 4N5SA 1CXUA 1N5YA 1NGHA 3RMAA 1KRPA 4BGBA 1RBVA 4Y0WA 3VQDA 4DV1K 1HPZA 4H03B 3MCPA 1LAVA 3WNHA 2IDOA 4N41A 4FW2A 3T7ZA 3O3HA 3M8PA 1VSIA 4H0XB 4FJKA 4CGJA 3HL8A 1D8YA 2UU9K 2W41A 4FJJA 3G10A 4C8MA 2QKBA 2ZGZA 5GIPA 3PLAA 3PIOL 4CJTA 2D5RA 4DB3A 1S6PA 4A2AA 2X78A 3V1OA 4FVMA 1IG9A 2V52B 3HJFA 4I2QA 3BEXA 3CCJN 2BGGA 1ZBUA 4DV2K 3KKRA 2ASPA 1NBWA 3MX5A 4KB0A 4BRKA 2VWKA 4BRAA 3RRGA 4BRDA 4B9MA 4MDAA 2NZTA 1J53A 1TK0A 5GINA 3ISNC 4B3RK 2RE2A 1VQ4N 3MMVA 4W5TA 3RR7A 1HKGA 4FSVA 3PY8A 1SS6A 1ZXOA 2IVNA 4MLHA 3CCRN 4X62K 4IO8A 4DTNA 1S72N 3HM9A 1YHQN 3SQ1A 2YNGA 4XEIA 3LP2A 4M3ZA 3OYKA 3L2QA 3O6WA 4FPAA 1QHAA 2EHGA 4LSNA 4BR2A 3VQCA 3TSUA 2QWMA 3O4QA 3I8BA 1L3VA 4BE2A 3SV4A 2RN2A 5JS1A 3AO1A 2E5LK 5FRMA 4XH5A 3VQAA 4KHPK 2HW3A 2IS3A 4MO5A 5KRTA 1L3SA 1S1TA 3UKUB 3QEWA 4FLXA 3H46O 2B4JA 1NJIO 4E0DA 1EQYA 4B1ZA 1OH7A 4FLVA 1Q7YO 3QNOA 2VGNA 1IBKK 4IWVA 1Q18A 2E20A 1RCHA 4BDYA 4JK7A 3LDSA 3ENHA 5HOOA 5JMVA 3BZKA 4Z4IA 3IRXA 3DYAA 3VA0A 3L2VA 1BA1A 2P9SA 5BREA 3J7AP 1JLGA 1SKWA 4IBNA 4AHTA 1A5XA 3CG7A 3MWTA 3VTIA 2X6SA 5FPDA 4CE9A 4CIEA 4BRGA 3QERA 3S9HA 1D5AA 2EX3A 1RBTA 4BWJA 4NCGA 3QB0A 2P9SB 3TAPA 3VQBA 4WF9L 4DV3K 3TAFA 4B9UA 3VQQA 4DUYK 4CHYA 2PY5A 2QXFA 3SK3A 2W6LA 4K8ZA 3H3OB 3SMSA 4AH9A 1NK7A 5J2PA 4ELTA 2VGMA 4RG8A 2E2QA 3NCIA 4R5PA 3CC2N 3OJSA 1RBRA 5JLFA 4GW6A 2GTDA 4IG0A 3UIQA 3T3FA 3CCUN 1BI4A 3VESA 2FF6A 4BC5A 1K73O 3HP6A 1RT1A 3I8DA 2JWLA 4YY3K 1ASWA 4F9OA 4CJSA 2VG7A 2GV9A 1DKGD 3C94A 2NRTA 4FK0A 3U8XA 4PKHA 4IEIA 4NCAA 1T6DA 3OYJA 2Z1IA 3ZT1A 1VQ9N 1HNWK 3S3OA 2Z1GA 3ZCMA 4BRMA 3KHYA 3CFRA 1S6QA 3PUFA 2VQEK 4PQUA 4WCEL 3L4IA 2B6AA 4JI6K 3HSTB 5AQPA 4JRQA 4RW9A 3NDKA 3L4QA 2XY5A 2UUBK 4BR0A 1TAUA 5LL6Z 4OPJA 3DAWA 3ZT3A 4ZTJA 4JS5A 3RSEB 2BANA 5ADXA 3L8BA 1XC9A 1ATNA 4B1UB 1RFQA 1WSGA 2E2PA 4A62A 4WE1A 4FZXC 3U4LA 3L2UA 2OTJN 1EWQA 4IJNA 4WYBA 5KQDA 3TABA 3HT3A 4FJGA 3AO2A 5F0XA 4H5TA 1QZ5A 2HF3A 5AQOA 4BWMA 1H1VA 2Z1HA 1NK5A 2AP1A 1KAZA 4DWIA 1GOBA 3ZSRA 4CGHA 5EVZA 2QKKA 3M8RA 4DS4A 2CGJA 4DTUA 5GAGP 2LSNA 5CE3A 2PBDA 3SUQA 3VN5A 1L3UA 3SBGA 3OVNA 2IVOA 4AQYK 4FWKA 3VGMA 1VQON 4EIAA 2OPRA 3AVJA 3CYMA 2O8FA 5GIOA 3CCMN 2GELA 1YUWA 4YOYA 4FW1A 2YCHA 4JKDA 2I7PA 2W6KA 4Z4GA 4GMJB 3MEDA 3O9RA 3R9PA 3G71N 3PV8A 2KQ2A 4CZEA 3NVKA 3LP0A 1BL3A 3LDOA 1NGFA 2OANA 3K2PA 4H4OA 3WXKA 3E9PA 1YF5L 5F1XA 4H5VA 2CGKA 2O8FB 4Y1CA 4JKAA 4FLZA 4OX9K 1VSHA 4OKJA 3CJCA 2OYQA 1HJOA 1WSFA 3LL3A 4I9QA 3U9ZA 1SL1A 2FSKA 1U6ZA 5AQNA 2OPSA 3K9KA 4E19A 1EX4A 1JL2A 3GOIA 3CFPA 3CERA 2QI2A 3PX0A 4O5FA 1XMOK 3PIPL 3IMXA 3BP8A 4CJQA 1ZBSA 2G8UA 1NWKA 4DSLA 2J4RA 4B9VA 3AVBA 2D4WA 3NGZA 1DT9A 3QEXA 1E3MA 4CFCA 2HBMA 3OTOK 2Q2RA 1LWEA 3CQ8A 2UUCK 3VF6A 3DMJA 4CHZA 2GEMA 3TSQA 4CJLA 1HYZA 1IG8A 3VMFB 4CJFA 4CF2A 4CIGA 3EE8A 1A5VA 3LDQA 2HOEA 5AQGA 3VQPA 4DCHA 3WQUA 4AHCA 3U9DA 1BCOA 4CEZA 1FK9A 3TWHA 2D1KA 2P1JA 3K58A 4DLEA 1ESVA 4DUZK 4CZHA 1XQSC 4ILHA 3OYMA 2ZJQL 3LP3A 1V4TA 2YHXA 1BO5O 3HYFA 1SZ2A 4E1NA 2D0PA 4H5RA 2YNFA 3OYHA 3ZSOA 3AGRA 1FKPA 3WXLA 2HHQA 3AVGA 1QSYA 3W3DA 4E7LA 3K5LA 3RR8A 3I33A 1LWFA 1G99A 3G6EN 3EEQA 3O9TA 3V6DA 4FOEA 3C6HA 2A40A 1C0GA 1A5WA 5HRPA 1Q9XA 4ISFA 1P8ZA 5J2NA 1JL1A 5EY4A 1RT4A 4FWPA 1QTMA 2YHAA 4CF8A 3ZSYA 3O4NA 4JKCA 1HYVA 5M1PA 3PSIA 5TKYA 2O4IA 3GDQA 3MECA 3KK1A 4LF5K 4CHOA 1NJYA 2NNWA 4B3TK 1JLQA 2V51B 3L3UA 3AVIA 3E66A 3SQ2A 4DU1A 4FWNA 3AA2A 4BACA 3WQTA 2ATQA 4B9TA 3C6TA 3HTVA 2HHHK 1BDGA 1VRTA 3TR8A 3VEYA 3OBWA 3HSCA 3F9KA 1VSFA 2Q97A 4E3SA 1RDBA 4YOXA 3O80A 1RBUA 1RILA 3E9LA 4K0KK 1KVCA 4E1MA 3N4QA 3AA4A 3LZIA 1TGOA 4AHRA 1X3NA 2ZJRL 4BRNA 1UOCA 4ICLA 4B1YB 3CC7N 1VQ5N 1JCGA 3EL2A 4H0OA 1SAZA 2HHXA 4CBUA 5AQXA 4OKKA 5FLXO 1SKSA 3RTVA 4KH5A 1NK9A 4FJMA 2FSNA 1KTQA 3CM5A 2HHSA 2P5OA 3ENOA 4G1QA 3BGRA 2QWNA 3ULEB 3AV9A 3KTQA 4BC3A 4AF1A 3CCSN 5AQHA 1Z05A 3FFKB 3V9ZA 4DTOA 3HVRA 5JLHA 1C0UA 2D0CA 4KFBA 3H08A 1VSJA 4LFAK 3KLGA 5AFUA 3OJUA 3VEZA 1NGBA 2FF3B 3SBTA 4AHUA 3KWIA 3DJCA 4JN4A 1MDUB 4KHWA 3VF2A 4RW8A 4FLWA 4DQPA 1XUPO 3OYBA 3ZX3A 3AAPA 2A1RA 2YJFA 5BPLA 4NXNK 4DMNA 1DGKN 1YT3A 2GUPA 1BHLA 3EO3A 3VQ5A 4IOXA 1QS4A 5T7BA 1T05A 4OGEA 4YORA 2DFEA 2YHWA 4GVMA 4A5BA 3J7ZO 1NGJA 4WFBL 1CXQA 5HRNA 3A2FA 1S22A 1S1XA 5CZ1A 4FO0A 3V9XA 3S3MA 3MXMA 5HLFA 3KLHA 1KFSA 3SUNA 4RTFD 4M45A 4HUGA 4CZJA 3LDPA 4JRPA 2QWRA 5C10A 4CJ3A 4RW7A 4FJ9A 4OGCA 2FLOA 4LF8K 1IKVA 1VQ6N 4I6MA 2HNZA 4C8KA 1KLNA 1C1CA 3LM2A 4RWTA 1SL2A 5M1NA 5F2RA 2OZSA 4MFBA 4BC2A 1SKRA 3ASMA 3OYIA 3BDPA 4EP5A 1BIUA 3O9QA 4AILC 1T03A 4BQLA 1T8EA 4YOUA 1NK6A 4I6MB 3H45C 4FWQA 4NB4A 1TVRA 2YHBA 3MN7A 3QESA 4EZ6A 4DQQA 4CJKA 4IFEA 3VA3A 1K8KA 4CEAA 2D0OA 2YJEA 3CXCM 2DTUA 3M8SA 2GBZA 4QAGA 1SQKA 2Y1IA 4WQ4A 3LPTA 3BF1A 4F2RA 1HNZK 5AR0A 4F2SA 3AVNA 1S5JA 3SI6A 1IKWA 1NGCA 1TYQA 2NLXA 3MXJA 3GBTA 3VOVA 4CZFA 4DV4K 4OLBA 4DU3A 1YVNA 2A5XA 4A5AA 4IEEA 3ATVA 4DG1A 4FJHA 1NGIA 4CERA 4FLTA 3KK3A 3IAYA 2CH5A 3HP9A 3F9MA 3C95A 1JKHA 2VWBA 4J2AA 2VWJA 3TAGA 4QS9A 1XNQK 4M7YA 1TYQB 1KSPA 3TSPA 4DV6K 1C0MA 4H0YB 1QQOA 3P5JA 3VERA 1LW2A 2XRIA 4KTQA 4C1NI 2ZQBA 2Q0RA 1X1PA 5CYQA 1WBBA 3Q7CA 1WSIA 2FC0A 5BR8K 1VHXA 3DRRA 3OYAA 3CCEN 3BUZB 5HROA 4M3XA 3I56N 5BN9A 4A2BA 1N36K 4JKEA 1NJWA 2QEXN 4TSXA 2F7TA 1WOQA 1BOTO 4ELVA 4DSFA 3JXUA 2KW4A 4FK2A 3A5MC 5ADXH 1XC3A 4JI7K 4C8LA 3CD6N 2HBLA 1IO2A 3P39A 5KPTA 3P31A 3FZHA 4Q0BA 3THVA 4W5QA 1RT3A 5AQLA 3TTFA 1QQMA 3I0RA 1HPMA 3CETA 3KLEA 5C42A 4CVNE 2F4VK 2QM1A 4DTPA 4QCLA 2OTLN 1QVGM 1OH6A 4U67L 1QQNA 5AQKA 1D9FA 4EHTA 4FXDA 2GUIA 4NCBA 3UKUA 5AQQA 1KAXA 1NGEA 3QNNA 4JKHA 5KQ8A 4JKFA 3PX6A 3NGIA 3AVHA 1OVYA 1CZAN 4CJVA 3CQXA 4Z4CA 3SQ0A 1FJGK 4IOAL 2JGUA 3DLHA 3G4SN 1J5EK 4YOVA 3WXIA 2IVPA 4Z4EA 2QWQA 4CECA 1TUUA 3B6PA 4KHQA 3JYTA 4YDUA 5LMNK 5AQZA 5AJ3K 2I7NA 2KZMA 3DOKA 1BCMA 2Q36A 3H3NO 4FWRA 1ASVA 4KAZA 4CBWA 4L8RB 3QBWA 5C12A 3EZWA 2QTDA 3SQ4A 1RTHA 4CF1A 1Q8IA 5H1SQ 3TTDA 3I55N 3K5OA 3C7NA 1F21A 5AQUA 5CYMA 4B9LA 1N32K 1B9DA 4KKOA 5E41A 2VG6A 1W0HA 1RT7A 3T69A 3CFOA 2H3GX 2VYPA 1HMVA 3KLFA 1QHTA 4CJEA 1ZBLA 3C7NB 1L3TA 3KIOA 3HPHA 5KGXA 5HL7L 4BC4A 3QDKA 1MWKA 1VSKA 2E6MA 1DTTA 3VETA 2O8EA 1EWRA 1NOYA 1LW0A 2X74A 3CCVN 4BRCA 2QWPA 4IJAA 2P9KB 4ZTFA 3EZ5A 3QMLA 1N6QA 4JI4K 1K9MO 2GWJA 3MXIA 3LZJA 2VQFK 4OVLA 5AZJA 2O8EB 4BGAA 3TU5A 1W2BM 4CJRA 3PX4A 3RVCA 2QWOA 4M3TA 3O1BA 3TTCA 1M90O 4CW7B 3C6AA 3DM2A 3CCQN 4BREA 1GLDG 4FK4A 5EU7A 1NK0A 3LWMA 1VQLN 4CK2A 4KB1A 3KWGA 3ATUA 5DM7L 4BQZA 1MWMA 5AZJB 3DOLA 3QBXA 2YNIA 5GADP 4JYAK 4H4MA 1VK0A 3RSEA 3THYA 3E1YA 4GKJK 4FM2A
chains in the Genus database with same CATH topology
4E7IA 1BCOA 4CGDA 4CEZA 3OYDA 1FK9A 3TWHA 4BE0A 4JLHA 3O3FA 4M42A 2P1JA 2XY6A 3K58A 4DLEA 4I9LA 5I42A 2PYJA 3OYMA 1JXBA 3QETA 1I3AA 3LP3A 4KHNA 1REVA 4FYDA 1C1AA 4FJXA 2OA8A 1U49A 3HYFA 4E1NA 1KFDA 3QEIA 2QK9A 3NF8A 3C6UA 2YNFA 3OYHA 2FBXA 3ZSOA 1FKPA 2HHQA 2HHWA 4KRFA 3AVGA 1QSYA 1UA1A 2YV0X 1EP4A 4E7LA 3AO3A 3K5LA 2G8FA 1ITGA 1C1BA 3RR8A 4HTUA 2G8WA 1LWFA 3T1AA 1RT6A 1DTQA 3L2RA 3RMCA 3V6DA 1U45A 2OPPA 4J2BA 3F73A 4CF0A 3TARA 4FLYA 4FJNA 4ID1A 1A5WA 5HRPA 3FFIA 4DQSA 1TK5A 1Q9XA 1J54A 5J2NA 1JL1A 1TKDA 3AVAA 1SL0A 1RT4A 4HUEA 2YHAA 4CF8A 1QTMA 4HUFA 3ZSYA 1BGXT 3O4NA 1VSDA 3KK2A 1HYVA 3B6OA 5K14A 2FBYA 2O4IA 1WSJA 3LALA 3MECA 4RW6A 3ZT2A 5HP1A 2XY7A 4F3OA 3KK1A 5I3UA 3NF9A 4YNQA 4CHOA 5J2QA 4FJ8A 1NJYA 1JLQA 1GOCA 1XHZA 3L3UA 3AVIA 2HB5A 4CK3A 3SQ2A 4DFJA 1CZBA 3WNEA 4DU1A 3EY1A 4FZZA 3AA2A 2KTQA 3V1QA 2AJQA 4BACA 1BQNA 2ATQA 4B9TA 3RWUA 2IAJA 3U6FA 3C6TA 1BQMA 1S9GA 4O0JA 1BIZA 4KREA 2KFNA 3HVTA 4F4KA 1VRTA 3TR8A 4AHSA 1UA0A 1NJZA 3JSMA 3DRPA 4CEQA 1NKCA 1X9WA 4DFKA 2HHTA 1IH7A 3F9KA 1HJRA 4PY5A 1J9AA 3AVCA 3HPOA 4KHUA 4M3UA 4B8AB 1VSFA 4B8CA 4E3SA 1RDBA 2HMIA 3QINA 1RBUA 2YNHA 4NYFA 1RILA 4OJRA 4DF4A 1VSEA 2O4GA 1WNSA 4I2PA 1KVCA 4E1MA 1ZBHA 3NHGA 1Z26A 3AA4A 5C24A 3T19A 3RMBA 1JLAA 3LZIA 1RDDA 1TGOA 4KI6A 1NKBA 4AHRA 3DLBA 3ZSVA 4FZYA 4KTWA 1UOCA 4B9SA 3VQ8A 3QEPA 4CHPA 4ICLA 1SUQA 3TAMA 4ZHRA 1WSEA 1U4BA 1RTJA 4CEBA 4N5SA 3SNNA 1CXUA 4CHQA 1N5YA 1C6VA 4K8XA 1NK4A 1X9MA 2HHXA 3ITHA 3RMAA 4N56A 1KRPA 4N76A 4M3RA 1RBVA 4OKKA 3VQDA 1SKSA 3NGYA 3RTVA 2RF2A 1HPZA 3EYZA 3VQ6A 3RRHA 1LAVA 3WNHA 2IDOA 5KTQA 1VRUA 1NK9A 4FJMA 4PA1A 4N41A 4FW2A 2G8HA 1KTQA 3MEEA 2RPIA 3CM5A 3QIOA 3M8PA 3O3HA 3V9WA 2HHSA 1YVUA 1VSIA 4FJKA 3HXMA 4E7HA 2W42A 2P5OA 2E4LA 4CGJA 2IGIA 3HL8A 5J2MA 4CGGA 4G1QA 3BGRA 1TK8A 1D8YA 1RBSA 1S1VA 4FJJA 3CM6A 3G10A 3LANA 3OS2A 4C8MA 3AV9A 2FBTA 2QKBA 3KTQA 4C8NA 1W9HA 3AA5X 1U04A 3V9ZA 4DTOA 4DFPA 2XO7A 4CJTA 2D5RA 3HVRA 2ZD1A 2HNDA 3AO5A 1S6PA 1C0UA 2D0CA 2X78A 4FVMA 4KFBA 4N47A 3V1OA 3NE6A 3H08A 1IG9A 1EKEA 1VSJA 1TL1A 3HJFA 3KLGA 3OJUA 2PYLA 4I2QA 4DTMA 1LV5A 3U3GA 2BGGA 4B3OA 1ZBUA 4AHUA 3KKRA 4CF9A 1NK8A 1GOAA 3SUPA 4IKFA 3D45A 1HQEA 4YFUA 4KB0A 2VWKA 3RRGA 4KHWA 4CJWA 4RW8A 4FLWA 3ALYA 4DQPA 2F8SA 3NF7A 3MEGA 3OYBA 4B9MA 1JXEA 2A1RA 2Q3SA 3KKSA 4Z4FA 4UQGA 1J53A 1TKXA 2I5JA 4DMNA 1TK0A 5C25A 4DTSA 4DSIA 4HCBA 4PWDA 3ISNC 1YT3A 3AVLA 4CFAA 4CJ4A 1S1WA 4W5TA 3RR7A 1BHLA 3VQ5A 1BI4B 4CK1A 5T7BA 1QS4A 3K59A 3PY8A 1T05A 4KHYA 4OGEA 1TL3A 2DFEA 4GVMA 4DTNA 1KCFA 4OKEA 2G8IA 1CXQA 4IG3A 5HRNA 4O0IA 3A2FA 3HM9A 3ZSQA 3ZT0A 1S1XA 4DFMA 3U3YA 5CZ1A 3SQ1A 4CHNA 3QLHA 2YNGA 3V9XA 4IDKA 3V1RA 3S3MA 3MXMA 5HLFA 3K57A 3LP2A 3KLHA 1KFSA 3KJVA 3SUNA 1NOZA 3OYKA 4CEFA 4M3ZA 2XHBA 3LWLA 3L2QA 1CLQA 4M45A 4CJUA 3ZT4A 4HUGA 4FJIA 4JRPA 3AVFA 3M8QA 4CJ3A 3NF6A 4RW7A 4FJ9A 4OGCA 4KTZA 1YTUA 3TAEA 2EHGA 1IKVA 4LSNA 4CFBA 4PUOA 3VQCA 2HNZA 3O4QA 1L3VA 1ASUA 4BE2A 3SV4A 4C8OA 2RN2A 4C8KA 4M3YA 5JS1A 1KLNA 1C1CA 2G8KA 3AO1A 1CZ9A 1Y97A 3ZSWA 1SL2A 4RW4A 1FXXA 5SWMA 4HVJA 2OZSA 1RDCA 4MFBA 5FRMA 2DY4A 3VQAA 1SKRA 3ASMA 4M41A 3NFAA 2HW3A 4KI4A 1RDAA 3OYIA 2NUBA 4DSEA 4DU4A 3BDPA 2IS3A 4EP5A 1BIUA 5KRTA 4AILC 2F8TA 3MAQA 1T03A 1L3SA 1T8EA 1ZBIA 1NK6A 1S1TA 2ETJA 1HRHA 4Y1DA 4FCYA 4FLXA 3QEWA 3HPGA 2B4JA 3L3VA 4E0DA 1JLBA 1TVRA 4B9NA 3VQ4A 4HCCA 4W5RA 1QSLA 1L5UA 4FLVA 2P5GA 3QNOA 2YHBA 3QESA 4EZ6A 4DQQA 4CJKA 5HRRA 2D0AA 3VA3A 4CEAA 1LAWA 1ZBFA 3AA3A 1RCHA 2DTUA 3M8SA 4BDYA 3LDSA 2GBZA 4QAGA 2BDPA 4H8KA 3ULDA 1G15A 4BE1A 2Y1IA 1XHXA 4Z4IA 3LPTA 1RTDA 3IRXA 3DYAA 3VA0A 3L2VA 3NAEA 4F2RA 1JLGA 2WOMA 1SKWA 3KLIA 1S1UA 4IBNA 4AHTA 4F2SA 4E89A 1A5XA 3AVNA 1S5JA 3CG7A 4B08A 3SI6A 1IKXA 2X6SA 1IKWA 4LY7A 3MXJA 4HHTA 1X9SA 1J5OA 4OLBA 4DU3A 1WN7A 3TANA 2BE2A 4CE9A 4CIEA 3IG1A 3QERA 3S9HA 4NYNA 3OS0A 4KHSA 4FM1A 4DTXA 1D5AA 2EX3A 4DG1A 4FJHA 1RBTA 4BWJA 4NCGA 4CERA 4FLTA 3KK3A 2XY8A 4CIFA 3IAYA 4DSKA 5KRSA 3HP9A 4AHVA 1O1WA 1JKHA 3C95A 3VQBA 3TAPA 1RTIA 4IFYA 4J2AA 2VWJA 3TAFA 3TAGA 1B9FA 3AVKA 4KPYA 4B9UA 3VQQA 4FM0A 4CHYA 2PY5A 2QXFA 2PZSA 1KSPA 3HK2A 4Z0UA 1C0MA 4K8ZA 4AH9A 3OYGA 3P5JA 1NK7A 5J1EA 3OYNA 1LW2A 5J2PA 2XRIA 2G8VA 4EZ9A 4KTQA 4ELTA 2WONA 5JS2A 4OLAA 2ZQBA 4RG8A 2X6NA 1LWCA 2OZMA 1D9DA 1X1PA 5CYQA 3NCIA 4R5PA 3OY9A 3QO9A 1WSIA 3IS9A 3OJSA 1RBRA 2FC0A 4GW6A 2HVHA 3DRRA 4IG0A 3OYAA 1C0TA 4F3TA 2YKNA 5HROA 4W5OA 4M3XA 3OYEA 1RT5A 3UIQA 2D0BA 4Q5VA 3T3FA 1NJWA 3LP1A 4TSXA 4IFVA 4KV8A 2DFHA 1BI4A 3HP6A 1SV5A 2VG5A 4J2EA 1RT1A 1KLMA 3I8DA 1ASWA 1RT2A 4CJSA 4ELVA 2VG7A 1UAXA 2Z1JA 2GV9A 4DSFA 3C94A 4EP4A 4FK0A 2KW4A 4NCAA 4FK2A 3OYJA 1JLEA 5CZ2A 2Z1IA 3P1GA 3ZT1A 4CEDA 1IO2A 4C8LA 5FRNA 3S3OA 2FBVA 3HO1A 2Z1GA 3ZCMA 3WNGA 3TAQA 4LH4A 3DLEA 4Q0BA 3THVA 3CFRA 1S6QA 3PUFA 4W5QA 1RT3A 4PQUA 3V9SA 3I0RA 1QE1A 3SCXA 1YTAA 1ZYQA 1Z25A 3VQ9A 2B6AA 3KLEA 5C42A 1KVBA 1HQUA 3HSTB 1RNHA 1K6YA 3LAMA 4RW9A 2YKMA 3OYFA 3NDKA 1TV6A 4JRQA 2XY5A 2KFZA 3QEVA 1TAUA 4OPJA 4E7KA 4DTPA 3ZT3A 4QCLA 4DS5A 3LAKA 4W5NA 1WAFA 2E6LA 5FROA 4CGFA 4JS5A 4ZTJA 1Q9YA 5D3GA 2BANA 4ID5A 3L8BA 3NH1A 1XC9A 1D9FA 4O55A 4FXDA 2GUIA 3E01A 4NCBA 5KI6A 3AO4A 1KVAA 1WSGA 4LH5A 3QNNA 2HHUA 4LSLA 3AVMA 4WE1A 4FZXC 3PX6A 4CJPA 1EETA 3NGIA 3AVHA 3L2UA 4CJVA 4Z4CA 3V9UA 3SQ0A 4CJ5A 2JGUA 1WLJA 3TABA 3DLHA 2KZZA 4XIUA 3HT3A 4DQRA 1NJXA 1UWBA 3AO2A 4FJGA 4FJ7A 1TKZA 1TAQA 3I0SA 1WSHA 4O44A 4CECA 4Z4EA 3B6PA 4KHQA 5KGWA 4BWMA 3K5MA 3NBPA 3JYTA 2Z1HA 1NK5A 4FJ5A 4QOZB 1JLCA 2RKIA 4FJLA 4DWIA 1GOBA 3L2WA 3ZSRA 2KZMA 1WAJA 3DOKA 1BCMA 4CGHA 2ITGA 3G0ZA 3SJJA 2QKKA 4DQIA 3M8RA 4DS4A 4DF8A 4CESA 4DLGA 4DTUA 1ASVA 4KAZA 2LSNA 3SZ2A 4L8RB 3D0PA 3DI6A 3TI0A 3SUQA 3SQ4A 1RTHA 3VN5A 4CF1A 1L3UA 3SPYA 1Q8IA 3NH0A 4Z4HA 3OVNA 4E7JA 2R7YA 3K5OA 3DLRA 1F21A 2OPRA 4JS4A 3DLGA 3V4IA 3AVJA 3CYMA 1MU2A 3OYCA 1BISA 5CYMA 4J2DA 4B9LA 2HHVA 5DK5A 3ZSXA 4MQ3A 2HVIA 4ELUA 1B9DA 1QQCA 4FW1A 5FDLA 4KKOA 5E41A 2VG6A 1W0HA 4I7FA 3WNFA 3PO4A 4DTJA 3DLKA 4Z4GA 1RT7A 4GMJB 4CFDA 3CFOA 3MEDA 1HYSA 2ZE2A 1FKOA 2KQ2A 3PV8A 1HMVA 3NH2A 1VSMA 3LP0A 1BL3A 1QHTA 1I39A 4CJEA 3KLFA 3K2PA 4H4OA 1ZBLA 1L3TA 2F96A 4BDPA 3KIOA 4FLUA 3HPHA 5HBMA 5KGXA 1XI1A 5DMRA 1U47A 4Y1CA 4FLZA 2A1SA 1VSHA 4OKJA 3SUOA 2Y1JA 2OYQA 4LD0A 1VSKA 1WSFA 2E6MA 1DTTA 4I9QA 1SL1A 3ZSZA 3VQEA 1NOYA 1LW0A 2X74A 2OPSA 2P51A 4E19A 1S9EA 1EX4A 1IKYA 1JL2A 3CFPA 4CGIA 3S3NA 4M3WA 4DSJA 4ZTFA 3EZ5A 5HRSA 1JLFA 1N6QA 1HNIA 3PX0A 3OYLA 2IOCA 1U48A 3MXIA 3LZJA 1DLOA 2DFFA 3DRSA 5SZTA 4OVLA 4CJQA 1XWLA 1T7PA 2G8UA 1B92A 2IC3A 4CJRA 3O3GA 4DSLA 3V81A 1TKTA 3PX4A 4B9VA 3LPUA 4M3TA 3AVBA 3NGZA 4BDZA 1R0AA 4CEEA 3QEXA 4O5BA 4CEOA 3DM2A 1VSLA 3P83D 4CFCA 3KD5E 2HNYA 3SPZA 1LWEA 3CQ8A 4FK4A 5EU7A 1EXQA 4KO0A 2OPQA 3LWMA 3K5NA 4CK2A 1NK0A 4KB1A 1HNVA 1NKEA 3KD1E 3DOLA 3DMJA 4DTRA 3QIPA 3PO5A 4CHZA 4CJLA 2YNIA 3VQ7A 2B5JA 4OPKA 1HYZA 4CJFA 4CF2A 3RMDA 2JLEA 3SV3A 4H4MA 5CY4A 4CIGA 3SYZA 3OS1A 1VK0A 1A5VA 4O4GA 1QSSA 4CCHA 4F8RA 3VQPA 4AHCA 4FM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E7I A;  1BCO A;  4CGD A;  4CEZ A;  3OYD A;  1FK9 A;  3TWH A;  4BE0 A;  4JLH A;  3O3F A;  4M42 A;  2P1J A;  2XY6 A;  3K58 A;  4DLE A;  4I9L A;  5I42 A;  2PYJ A;  3OYM A;  1JXB A;  3QET A;  1I3A A;  3LP3 A;  4KHN A;  1REV A;  4FYD A;  1C1A A;  4FJX A;  2OA8 A;  1U49 A;  3HYF A;  4E1N A;  1KFD A;  3QEI A;  2QK9 A;  3NF8 A;  3C6U A;  2YNF A;  3OYH A;  2FBX A;  3ZSO A;  1FKP A;  2HHQ A;  2HHW A;  4KRF A;  3AVG A;  1QSY A;  1UA1 A;  2YV0 X;  1EP4 A;  4E7L A;  3AO3 A;  3K5L A;  2G8F A;  1ITG A;  1C1B A;  3RR8 A;  4HTU A;  2G8W A;  1LWF A;  3T1A A;  1RT6 A;  1DTQ A;  3L2R A;  3RMC A;  3V6D A;  1U45 A;  2OPP A;  4J2B A;  3F73 A;  4CF0 A;  3TAR A;  4FLY A;  4FJN A;  4ID1 A;  1A5W A;  5HRP A;  3FFI A;  4DQS A;  1TK5 A;  1Q9X A;  1J54 A;  5J2N A;  1JL1 A;  1TKD A;  3AVA A;  1SL0 A;  1RT4 A;  4HUE A;  2YHA A;  4CF8 A;  1QTM A;  4HUF A;  3ZSY A;  1BGX T;  3O4N A;  1VSD A;  3KK2 A;  1HYV A;  3B6O A;  5K14 A;  2FBY A;  2O4I A;  1WSJ A;  3LAL A;  3MEC A;  4RW6 A;  3ZT2 A;  5HP1 A;  2XY7 A;  4F3O A;  3KK1 A;  5I3U A;  3NF9 A;  4YNQ A;  4CHO A;  5J2Q A;  4FJ8 A;  1NJY A;  1JLQ A;  1GOC A;  1XHZ A;  3L3U A;  3AVI A;  2HB5 A;  4CK3 A;  3SQ2 A;  4DFJ A;  1CZB A;  3WNE A;  4DU1 A;  3EY1 A;  4FZZ A;  3AA2 A;  2KTQ A;  3V1Q A;  2AJQ A;  4BAC A;  1BQN A;  2ATQ A;  4B9T A;  3RWU A;  2IAJ A;  3U6F A;  3C6T A;  1BQM A;  1S9G A;  4O0J A;  1BIZ A;  4KRE A;  2KFN A;  3HVT A;  4F4K A;  1VRT A;  3TR8 A;  4AHS A;  1UA0 A;  1NJZ A;  3JSM A;  3DRP A;  4CEQ A;  1NKC A;  1X9W A;  4DFK A;  2HHT A;  1IH7 A;  3F9K A;  1HJR A;  4PY5 A;  1J9A A;  3AVC A;  3HPO A;  4KHU A;  4M3U A;  4B8A B;  1VSF A;  4B8C A;  4E3S A;  1RDB A;  2HMI A;  3QIN A;  1RBU A;  2YNH A;  4NYF A;  1RIL A;  4OJR A;  4DF4 A;  1VSE A;  2O4G A;  1WNS A;  4I2P A;  1KVC A;  4E1M A;  1ZBH A;  3NHG A;  1Z26 A;  3AA4 A;  5C24 A;  3T19 A;  3RMB A;  1JLA A;  3LZI A;  1RDD A;  1TGO A;  4KI6 A;  1NKB A;  4AHR A;  3DLB A;  3ZSV A;  4FZY A;  4KTW A;  1UOC A;  4B9S A;  3VQ8 A;  3QEP A;  4CHP A;  4ICL A;  1SUQ A;  3TAM A;  4ZHR A;  1WSE A;  1U4B A;  1RTJ A;  4CEB A;  4N5S A;  3SNN A;  1CXU A;  4CHQ A;  1N5Y A;  1C6V A;  4K8X A;  1NK4 A;  1X9M A;  2HHX A;  3ITH A;  3RMA A;  4N56 A;  1KRP A;  4N76 A;  4M3R A;  1RBV A;  4OKK A;  3VQD A;  1SKS A;  3NGY A;  3RTV A;  2RF2 A;  1HPZ A;  3EYZ A;  3VQ6 A;  3RRH A;  1LAV A;  3WNH A;  2IDO A;  5KTQ A;  1VRU A;  1NK9 A;  4FJM A;  4PA1 A;  4N41 A;  4FW2 A;  2G8H A;  1KTQ A;  3MEE A;  2RPI A;  3CM5 A;  3QIO A;  3M8P A;  3O3H A;  3V9W A;  2HHS A;  1YVU A;  1VSI A;  4FJK A;  3HXM A;  4E7H A;  2W42 A;  2P5O A;  2E4L A;  4CGJ A;  2IGI A;  3HL8 A;  5J2M A;  4CGG A;  4G1Q A;  3BGR A;  1TK8 A;  1D8Y A;  1RBS A;  1S1V A;  4FJJ A;  3CM6 A;  3G10 A;  3LAN A;  3OS2 A;  4C8M A;  3AV9 A;  2FBT A;  2QKB A;  3KTQ A;  4C8N A;  1W9H A;  3AA5 X;  1U04 A;  3V9Z A;  4DTO A;  4DFP A;  2XO7 A;  4CJT A;  2D5R A;  3HVR A;  2ZD1 A;  2HND A;  3AO5 A;  1S6P A;  1C0U A;  2D0C A;  2X78 A;  4FVM A;  4KFB A;  4N47 A;  3V1O A;  3NE6 A;  3H08 A;  1IG9 A;  1EKE A;  1VSJ A;  1TL1 A;  3HJF A;  3KLG A;  3OJU A;  2PYL A;  4I2Q A;  4DTM A;  1LV5 A;  3U3G A;  2BGG A;  4B3O A;  1ZBU A;  4AHU A;  3KKR A;  4CF9 A;  1NK8 A;  1GOA A;  3SUP A;  4IKF A;  3D45 A;  1HQE A;  4YFU A;  4KB0 A;  2VWK A;  3RRG A;  4KHW A;  4CJW A;  4RW8 A;  4FLW A;  3ALY A;  4DQP A;  2F8S A;  3NF7 A;  3MEG A;  3OYB A;  4B9M A;  1JXE A;  2A1R A;  2Q3S A;  3KKS A;  4Z4F A;  4UQG A;  1J53 A;  1TKX A;  2I5J A;  4DMN A;  1TK0 A;  5C25 A;  4DTS A;  4DSI A;  4HCB A;  4PWD A;  3ISN C;  1YT3 A;  3AVL A;  4CFA A;  4CJ4 A;  1S1W A;  4W5T A;  3RR7 A;  1BHL A;  3VQ5 A;  1BI4 B;  4CK1 A;  5T7B A;  1QS4 A;  3K59 A;  3PY8 A;  1T05 A;  4KHY A;  4OGE A;  1TL3 A;  2DFE A;  4GVM A;  4DTN A;  1KCF A;  4OKE A;  2G8I A;  1CXQ A;  4IG3 A;  5HRN A;  4O0I A;  3A2F A;  3HM9 A;  3ZSQ A;  3ZT0 A;  1S1X A;  4DFM A;  3U3Y A;  5CZ1 A;  3SQ1 A;  4CHN A;  3QLH A;  2YNG A;  3V9X A;  4IDK A;  3V1R A;  3S3M A;  3MXM A;  5HLF A;  3K57 A;  3LP2 A;  3KLH A;  1KFS A;  3KJV A;  3SUN A;  1NOZ A;  3OYK A;  4CEF A;  4M3Z A;  2XHB A;  3LWL A;  3L2Q A;  1CLQ A;  4M45 A;  4CJU A;  3ZT4 A;  4HUG A;  4FJI A;  4JRP A;  3AVF A;  3M8Q A;  4CJ3 A;  3NF6 A;  4RW7 A;  4FJ9 A;  4OGC A;  4KTZ A;  1YTU A;  3TAE A;  2EHG A;  1IKV A;  4LSN A;  4CFB A;  4PUO A;  3VQC A;  2HNZ A;  3O4Q A;  1L3V A;  1ASU A;  4BE2 A;  3SV4 A;  4C8O A;  2RN2 A;  4C8K A;  4M3Y A;  5JS1 A;  1KLN A;  1C1C A;  2G8K A;  3AO1 A;  1CZ9 A;  1Y97 A;  3ZSW A;  1SL2 A;  4RW4 A;  1FXX A;  5SWM A;  4HVJ A;  2OZS A;  1RDC A;  4MFB A;  5FRM A;  2DY4 A;  3VQA A;  1SKR A;  3ASM A;  4M41 A;  3NFA A;  2HW3 A;  4KI4 A;  1RDA A;  3OYI A;  2NUB A;  4DSE A;  4DU4 A;  3BDP A;  2IS3 A;  4EP5 A;  1BIU A;  5KRT A;  4AIL C;  2F8T A;  3MAQ A;  1T03 A;  1L3S A;  1T8E A;  1ZBI A;  1NK6 A;  1S1T A;  2ETJ A;  1HRH A;  4Y1D A;  4FCY A;  4FLX A;  3QEW A;  3HPG A;  2B4J A;  3L3V A;  4E0D A;  1JLB A;  1TVR A;  4B9N A;  3VQ4 A;  4HCC A;  4W5R A;  1QSL A;  1L5U A;  4FLV A;  2P5G A;  3QNO A;  2YHB A;  3QES A;  4EZ6 A;  4DQQ A;  4CJK A;  5HRR A;  2D0A A;  3VA3 A;  4CEA A;  1LAW A;  1ZBF A;  3AA3 A;  1RCH A;  2DTU A;  3M8S A;  4BDY A;  3LDS A;  2GBZ A;  4QAG A;  2BDP A;  4H8K A;  3ULD A;  1G15 A;  4BE1 A;  2Y1I A;  1XHX A;  4Z4I A;  3LPT A;  1RTD A;  3IRX A;  3DYA A;  3VA0 A;  3L2V A;  3NAE A;  4F2R A;  1JLG A;  2WOM A;  1SKW A;  3KLI A;  1S1U A;  4IBN A;  4AHT A;  4F2S A;  4E89 A;  1A5X A;  3AVN A;  1S5J A;  3CG7 A;  4B08 A;  3SI6 A;  1IKX A;  2X6S A;  1IKW A;  4LY7 A;  3MXJ A;  4HHT A;  1X9S A;  1J5O A;  4OLB A;  4DU3 A;  1WN7 A;  3TAN A;  2BE2 A;  4CE9 A;  4CIE A;  3IG1 A;  3QER A;  3S9H A;  4NYN A;  3OS0 A;  4KHS A;  4FM1 A;  4DTX A;  1D5A A;  2EX3 A;  4DG1 A;  4FJH A;  1RBT A;  4BWJ A;  4NCG A;  4CER A;  4FLT A;  3KK3 A;  2XY8 A;  4CIF A;  3IAY A;  4DSK A;  5KRS A;  3HP9 A;  4AHV A;  1O1W A;  1JKH A;  3C95 A;  3VQB A;  3TAP A;  1RTI A;  4IFY A;  4J2A A;  2VWJ A;  3TAF A;  3TAG A;  1B9F A;  3AVK A;  4KPY A;  4B9U A;  3VQQ A;  4FM0 A;  4CHY A;  2PY5 A;  2QXF A;  2PZS A;  1KSP A;  3HK2 A;  4Z0U A;  1C0M A;  4K8Z A;  4AH9 A;  3OYG A;  3P5J A;  1NK7 A;  5J1E A;  3OYN A;  1LW2 A;  5J2P A;  2XRI A;  2G8V A;  4EZ9 A;  4KTQ A;  4ELT A;  2WON A;  5JS2 A;  4OLA A;  2ZQB A;  4RG8 A;  2X6N A;  1LWC A;  2OZM A;  1D9D A;  1X1P A;  5CYQ A;  3NCI A;  4R5P A;  3OY9 A;  3QO9 A;  1WSI A;  3IS9 A;  3OJS A;  1RBR A;  2FC0 A;  4GW6 A;  2HVH A;  3DRR A;  4IG0 A;  3OYA A;  1C0T A;  4F3T A;  2YKN A;  5HRO A;  4W5O A;  4M3X A;  3OYE A;  1RT5 A;  3UIQ A;  2D0B A;  4Q5V A;  3T3F A;  1NJW A;  3LP1 A;  4TSX A;  4IFV A;  4KV8 A;  2DFH A;  1BI4 A;  3HP6 A;  1SV5 A;  2VG5 A;  4J2E A;  1RT1 A;  1KLM A;  3I8D A;  1ASW A;  1RT2 A;  4CJS A;  4ELV A;  2VG7 A;  1UAX A;  2Z1J A;  2GV9 A;  4DSF A;  3C94 A;  4EP4 A;  4FK0 A;  2KW4 A;  4NCA A;  4FK2 A;  3OYJ A;  1JLE A;  5CZ2 A;  2Z1I A;  3P1G A;  3ZT1 A;  4CED A;  1IO2 A;  4C8L A;  5FRN A;  3S3O A;  2FBV A;  3HO1 A;  2Z1G A;  3ZCM A;  3WNG A;  3TAQ A;  4LH4 A;  3DLE A;  4Q0B A;  3THV A;  3CFR A;  1S6Q A;  3PUF A;  4W5Q A;  1RT3 A;  4PQU A;  3V9S A;  3I0R A;  1QE1 A;  3SCX A;  1YTA A;  1ZYQ A;  1Z25 A;  3VQ9 A;  2B6A A;  3KLE A;  5C42 A;  1KVB A;  1HQU A;  3HST B;  1RNH A;  1K6Y A;  3LAM A;  4RW9 A;  2YKM A;  3OYF A;  3NDK A;  1TV6 A;  4JRQ A;  2XY5 A;  2KFZ A;  3QEV A;  1TAU A;  4OPJ A;  4E7K A;  4DTP A;  3ZT3 A;  4QCL A;  4DS5 A;  3LAK A;  4W5N A;  1WAF A;  2E6L A;  5FRO A;  4CGF A;  4JS5 A;  4ZTJ A;  1Q9Y A;  5D3G A;  2BAN A;  4ID5 A;  3L8B A;  3NH1 A;  1XC9 A;  1D9F A;  4O55 A;  4FXD A;  2GUI A;  3E01 A;  4NCB A;  5KI6 A;  3AO4 A;  1KVA A;  1WSG A;  4LH5 A;  3QNN A;  2HHU A;  4LSL A;  3AVM A;  4WE1 A;  4FZX C;  3PX6 A;  4CJP A;  1EET A;  3NGI A;  3AVH A;  3L2U A;  4CJV A;  4Z4C A;  3V9U A;  3SQ0 A;  4CJ5 A;  2JGU A;  1WLJ A;  3TAB A;  3DLH A;  2KZZ A;  4XIU A;  3HT3 A;  4DQR A;  1NJX A;  1UWB A;  3AO2 A;  4FJG A;  4FJ7 A;  1TKZ A;  1TAQ A;  3I0S A;  1WSH A;  4O44 A;  4CEC A;  4Z4E A;  3B6P A;  4KHQ A;  5KGW A;  4BWM A;  3K5M A;  3NBP A;  3JYT A;  2Z1H A;  1NK5 A;  4FJ5 A;  4QOZ B;  1JLC A;  2RKI A;  4FJL A;  4DWI A;  1GOB A;  3L2W A;  3ZSR A;  2KZM A;  1WAJ A;  3DOK A;  1BCM A;  4CGH A;  2ITG A;  3G0Z A;  3SJJ A;  2QKK A;  4DQI A;  3M8R A;  4DS4 A;  4DF8 A;  4CES A;  4DLG A;  4DTU A;  1ASV A;  4KAZ A;  2LSN A;  3SZ2 A;  4L8R B;  3D0P A;  3DI6 A;  3TI0 A;  3SUQ A;  3SQ4 A;  1RTH A;  3VN5 A;  4CF1 A;  1L3U A;  3SPY A;  1Q8I A;  3NH0 A;  4Z4H A;  3OVN A;  4E7J A;  2R7Y A;  3K5O A;  3DLR A;  1F21 A;  2OPR A;  4JS4 A;  3DLG A;  3V4I A;  3AVJ A;  3CYM A;  1MU2 A;  3OYC A;  1BIS A;  5CYM A;  4J2D A;  4B9L A;  2HHV A;  5DK5 A;  3ZSX A;  4MQ3 A;  2HVI A;  4ELU A;  1B9D A;  1QQC A;  4FW1 A;  5FDL A;  4KKO A;  5E41 A;  2VG6 A;  1W0H A;  4I7F A;  3WNF A;  3PO4 A;  4DTJ A;  3DLK A;  4Z4G A;  1RT7 A;  4GMJ B;  4CFD A;  3CFO A;  3MED A;  1HYS A;  2ZE2 A;  1FKO A;  2KQ2 A;  3PV8 A;  1HMV A;  3NH2 A;  1VSM A;  3LP0 A;  1BL3 A;  1QHT A;  1I39 A;  4CJE A;  3KLF A;  3K2P A;  4H4O A;  1ZBL A;  1L3T A;  2F96 A;  4BDP A;  3KIO A;  4FLU A;  3HPH A;  5HBM A;  5KGX A;  1XI1 A;  5DMR A;  1U47 A;  4Y1C A;  4FLZ A;  2A1S A;  1VSH A;  4OKJ A;  3SUO A;  2Y1J A;  2OYQ A;  4LD0 A;  1VSK A;  1WSF A;  2E6M A;  1DTT A;  4I9Q A;  1SL1 A;  3ZSZ A;  3VQE A;  1NOY A;  1LW0 A;  2X74 A;  2OPS A;  2P51 A;  4E19 A;  1S9E A;  1EX4 A;  1IKY A;  1JL2 A;  3CFP A;  4CGI A;  3S3N A;  4M3W A;  4DSJ A;  4ZTF A;  3EZ5 A;  5HRS A;  1JLF A;  1N6Q A;  1HNI A;  3PX0 A;  3OYL A;  2IOC A;  1U48 A;  3MXI A;  3LZJ A;  1DLO A;  2DFF A;  3DRS A;  5SZT A;  4OVL A;  4CJQ A;  1XWL A;  1T7P A;  2G8U A;  1B92 A;  2IC3 A;  4CJR A;  3O3G A;  4DSL A;  3V81 A;  1TKT A;  3PX4 A;  4B9V A;  3LPU A;  4M3T A;  3AVB A;  3NGZ A;  4BDZ A;  1R0A A;  4CEE A;  3QEX A;  4O5B A;  4CEO A;  3DM2 A;  1VSL A;  3P83 D;  4CFC A;  3KD5 E;  2HNY A;  3SPZ A;  1LWE A;  3CQ8 A;  4FK4 A;  5EU7 A;  1EXQ A;  4KO0 A;  2OPQ A;  3LWM A;  3K5N A;  4CK2 A;  1NK0 A;  4KB1 A;  1HNV A;  1NKE A;  3KD1 E;  3DOL A;  3DMJ A;  4DTR A;  3QIP A;  3PO5 A;  4CHZ A;  4CJL A;  2YNI A;  3VQ7 A;  2B5J A;  4OPK A;  1HYZ A;  4CJF A;  4CF2 A;  3RMD A;  2JLE A;  3SV3 A;  4H4M A;  5CY4 A;  4CIG A;  3SYZ A;  3OS1 A;  1VK0 A;  1A5V A;  4O4G A;  1QSS A;  4CCH A;  4F8R A;  3VQP A;  4AHC A;  4FM2 A; 
#chains in the Genus database with same CATH topology
 4XH4 A;  3OYD A;  4BE0 A;  4JLH A;  3O3F A;  4M42 A;  5IT9 O;  2O8D B;  3VTH A;  5AQY A;  4WQ4 C;  4DV0 K;  3QET A;  5C2D A;  1KXP A;  3GE1 A;  3THY B;  3KZB A;  3NF8 A;  5C2F A;  2FBX A;  4LF4 K;  2YV0 X;  4CI6 A;  2G8F A;  5BR9 A;  4H5W A;  3RMC A;  1U45 A;  4CBX A;  1XMQ K;  2QXL A;  3M3Z A;  4FLY A;  4ID1 A;  2HBJ A;  3VPZ A;  3AVA A;  4CD3 A;  4HUF A;  1WB9 A;  3M5R A;  3B6O A;  5K14 A;  2FBY A;  1WSJ A;  3LAL A;  4RW6 A;  3ZT2 A;  3HOT A;  2XY7 A;  5I3U A;  3NF9 A;  3WUH A;  5J2Q A;  1XHZ A;  4JI1 K;  3ENB A;  1CZB A;  3WNE A;  4FZZ A;  2E1Y A;  2KTQ A;  2AJQ A;  1Q82 O;  3P38 A;  1BQN A;  3U6F A;  1S9G A;  4O0J A;  2KFN A;  3QFP A;  4AHS A;  3QFU A;  5AQV A;  1UA0 A;  3JSM A;  4DFK A;  2HST A;  1HJR A;  1T3V A;  3HPO A;  4YOT A;  2HMI A;  1WUA A;  2F9T A;  2YNH A;  4NYF A;  4X66 K;  3OW2 M;  2O4G A;  1TUY A;  4DR7 K;  3NHG A;  1Z26 A;  1NM1 A;  5C24 A;  5M1Q A;  3AGK A;  2V7Z A;  2W40 A;  3S41 A;  4KI6 A;  3MCA B;  4PHT X;  3OHR A;  4FZY A;  4KTW A;  3QEP A;  3TAM A;  1RTJ A;  1DEJ A;  4CHQ A;  3DXK A;  4K8X A;  1NK4 A;  3ITH A;  2BUP A;  1RGI A;  1NG9 A;  3NGY A;  4ISE A;  2RF2 A;  3EYZ A;  3VQ6 A;  5KTQ A;  4ILJ A;  3SAH A;  4PA1 A;  3JS6 A;  2G8H A;  5AFU H;  3KVG A;  3FZK A;  3QIO A;  4KHU A;  3HXM A;  4MDB A;  4BR4 A;  2E4L A;  2IGI A;  5J2M A;  1RBS A;  3DXK B;  1S1V A;  3CM6 A;  3LAN A;  1NMN A;  2EWS A;  3AA5 X;  1U04 A;  4DFP A;  5I9E B;  4A59 A;  2ZD1 A;  2HND A;  3AO5 A;  3NE6 A;  4N47 A;  1JJ2 M;  1EKE A;  1TL1 A;  2PYL A;  1JCF A;  4BRH A;  3U3G A;  4B3O A;  2E1Z A;  1K8A O;  1GOA A;  4BG9 A;  3SUP A;  1HQE A;  4YFU A;  2F8S A;  3NF7 A;  1JXE A;  2Q3S A;  3KKS A;  4UQG A;  2I5J A;  4HCB A;  4DSI A;  1HX1 A;  4CJ4 A;  4B9Q A;  4Z94 A;  3EKU A;  4CK1 A;  1I94 K;  4KHY A;  1GLL O;  1TL3 A;  2G8I A;  4O0I A;  1FW6 A;  4GV9 A;  1HR0 K;  3ZSQ A;  3G25 A;  3BY5 A;  4IDK A;  3V1R A;  4LF9 K;  3KJV A;  2XHB A;  1IJJ A;  1YJN N;  1HLU A;  4FJI A;  3AVF A;  4KTZ A;  3VEO A;  3TAE A;  4CFB A;  1S3X A;  2WTU A;  2DPN A;  4UY8 O;  1ASU A;  5AQJ A;  3CI5 A;  2G8K A;  1CZ9 A;  1Y97 A;  3ZSW A;  4RW4 A;  1FXX A;  5SWM A;  1RDC A;  5FPN A;  2DY4 A;  3FGU A;  4DU4 A;  4GV6 A;  2E2O A;  3MAQ A;  1ZBI A;  2ETJ A;  4FCY A;  4NXM K;  3R8E A;  1JLB A;  3VQ4 A;  3R3L A;  4HCC A;  1QSL A;  2WC9 A;  3DWL A;  5HRR A;  4JEP A;  1ZBF A;  3AA3 A;  1N33 K;  1BA0 A;  4MLE A;  1LOT B;  1G15 A;  4BE1 A;  3CIP A;  2WOM A;  1Q86 O;  2A42 A;  1KC8 O;  5KPZ A;  4E89 A;  1WBD A;  1OKJ A;  1IKX A;  1OH8 A;  4JK8 A;  4HHT A;  1X9S A;  1J5O A;  1BUP A;  2BE2 A;  5A2Q O;  4KH4 A;  3OS0 A;  4DTX A;  3ULE A;  2XY8 A;  4CIF A;  3IUC A;  5E26 A;  1MA9 B;  1O1W A;  4BRO A;  4WFA L;  2P9N B;  1B9F A;  3AVK A;  4KPY A;  3UB5 A;  2VCP A;  3HK2 A;  4Z0U A;  3SAF A;  5J1E A;  2G8V A;  3IFR A;  4EZ9 A;  2WON A;  5JS2 A;  3MDQ A;  2X6N A;  1LWC A;  1VQ7 N;  2V7Y A;  2OZM A;  4DQ8 A;  3J81 O;  3IS9 A;  5KPR A;  1C0T A;  4F3T A;  4W5O A;  4BR5 A;  3OYE A;  1RT5 A;  4C1N K;  4Q5V A;  1BU6 O;  3HRG A;  4CJ7 A;  2VG5 A;  5GAH P;  1KLM A;  2BH1 A;  2KHO A;  1UAX A;  4LFC K;  5AQR A;  1YXQ A;  1T6C A;  2ZWH A;  3JAM O;  2JWK A;  5FRN A;  3HO1 A;  3WNG A;  3TAQ A;  4LH4 A;  3Q7B A;  3DLE A;  3J80 O;  2A3Z A;  2A41 A;  3V9S A;  3P4I A;  3SCX A;  1VQP N;  1Z25 A;  1KVB A;  1RNH A;  3THW B;  3LAM A;  1GLJ O;  3QEV A;  5C15 A;  3LAK A;  2KLA A;  4W5N A;  5FRO A;  1Q9Y A;  4PKG A;  4ID5 A;  3NH1 A;  4O55 A;  3DXM A;  1KVA A;  2HHU A;  4LSL A;  3AVM A;  3BZC A;  2WBN A;  5AQF A;  2GX9 A;  4XIU A;  4DQR A;  1UWB A;  1TKZ A;  3E9O A;  3I0S A;  1U2V A;  3HZ6 A;  3DXM B;  5KGW A;  3K5M A;  3NBP A;  2O8C A;  2RKI A;  4FJL A;  4GV3 A;  5AQS A;  1WAJ A;  2Q0U A;  4DQI A;  4AM7 A;  4DF8 A;  3LDN A;  1BG3 A;  4CES A;  4PKI A;  3SZ2 A;  1KAY A;  3D0P A;  1OVQ A;  1U2V B;  4DR1 K;  3SPY A;  2P9P A;  3NH0 A;  4Z4H A;  2O8C B;  2R7Y A;  4FL9 A;  3DLL L;  4JI2 K;  4JS4 A;  3DLG A;  3FLC O;  1MU2 A;  4ILG B;  3OYC A;  4K25 A;  1YJ9 N;  2HHV A;  3ZSX A;  2PFU A;  3KK7 A;  1QQC A;  5FDL A;  2FSJ A;  5MLC Q;  3DLK A;  5AQM A;  4K43 A;  3J8A A;  4CFD A;  1HYS A;  2ZE2 A;  1FKO A;  2P9P B;  1I39 A;  2F96 A;  4FLU A;  1U47 A;  5JIC A;  2A1S A;  2Y1J A;  1N34 K;  4PL7 A;  3ZSZ A;  3VQE A;  2GWK A;  1IKY A;  4M3W A;  4DR4 K;  4BRF A;  1W7A A;  3UE5 A;  3CCL N;  1JLF A;  3OYL A;  3F2K A;  1DLO A;  1GLE G;  3AAQ A;  1D4X A;  2DFF A;  3DRS A;  5SZT A;  2QA4 N;  1XWL A;  1T7P A;  1NGA A;  4OPH A;  2E8A A;  3V81 A;  3EKS A;  3O9S A;  4CZL A;  1R0A A;  4CEE A;  4CEO A;  1VSL A;  2P9U A;  2HNY A;  3SPZ A;  3H6E A;  3K5N A;  2OPQ A;  1NMD A;  1HNV A;  1KD1 O;  3KD1 E;  1NNE A;  4DTR A;  4BR7 A;  4IXC A;  4MO4 A;  4OPK A;  5CY4 A;  4CCH A;  4F8R A;  4M7X A;  1NGD A;  4AM6 A;  4E7I A;  4FWS A;  2P9U B;  5BRH A;  4HTL A;  3ID6 A;  5LJW A;  1JXB A;  1I3A A;  4KHN A;  1REV A;  3A5O C;  3K0S A;  4C23 A;  4FJX A;  1U49 A;  1KFD A;  4DR6 K;  3O5B A;  4NLB A;  2QK9 A;  2ASO A;  4B3M K;  3THX A;  4KRF A;  1UA1 A;  4IZ9 A;  1GLF O;  3AO3 A;  1ITG A;  1C1B A;  1R59 O;  3D2F A;  4JI8 K;  1RT6 A;  1DTQ A;  4WFN L;  2OPP A;  5EX5 A;  3F73 A;  2UXC K;  3TAR A;  4FJN A;  3FFI A;  1TK5 A;  1J54 A;  1TKD A;  5BRD A;  2BTF A;  4HUE A;  2UUA K;  3FZL A;  3THX B;  1M1K O;  1VSD A;  3KK2 A;  4F3O A;  3D2F B;  3FZM A;  4YNQ A;  3VEW A;  4FJ8 A;  5AQW A;  3WT0 A;  3WXM B;  2HB5 A;  4CK3 A;  4DFJ A;  3MK6 A;  1YIT N;  1XNR K;  4NLC A;  1BIZ A;  3HVT A;  4F4K A;  4LF6 K;  4LF7 K;  3ZX0 A;  1NJZ A;  2HHT A;  3ZX2 A;  4CEQ A;  1NKC A;  5LMU K;  3B8A X;  1VQK N;  1J9A A;  4B8C A;  2PAV A;  5EOY A;  1OH5 A;  3QIN A;  3ZLJ A;  3PSF A;  4DF4 A;  3UKR A;  2P9K A;  4I2P A;  5JVG L;  5M1F A;  1ZBH A;  3O9U A;  3T19 A;  2O8B A;  1RDD A;  5CHI A;  3F5T A;  3VQ8 A;  4O8K A;  4CHP A;  1SUQ A;  1HKB A;  1U4B A;  1WSE A;  3SNN A;  4CEB A;  1C6V A;  3MN6 A;  2NRH A;  4JK9 A;  4RCH A;  3UKR B;  1X9M A;  4H0P A;  1JCE A;  5BN8 A;  4N56 A;  4N76 A;  4M3R A;  3N4P A;  2O8B B;  3WXJ A;  3RRH A;  1VRU A;  3CPE A;  1Y64 A;  4JNE A;  1J6Z A;  3MEE A;  2RPI A;  3V9W A;  3NMU A;  1YVU A;  4B1X B;  3VEV A;  2W42 A;  4E7H A;  1TK8 A;  3T1Y K;  4CGG A;  3BF3 A;  4G9Z A;  3OS2 A;  2FBT A;  3HBT A;  4NO7 A;  4C8N A;  3H1Q A;  2O8D A;  1W9H A;  2XO7 A;  1E4G T;  2CGL A;  2HF4 A;  3FE1 A;  1IBM K;  3D7E O;  4BVP A;  4DTM A;  4BRL A;  1LV5 A;  2F9W A;  4CZI A;  4OPA A;  4CF9 A;  1NK8 A;  4IKF A;  3D45 A;  1C0F A;  3L6Q A;  4CJW A;  3ALY A;  4O8U A;  1YJW N;  3CC4 N;  1GLB G;  3MEG A;  3CQY A;  4QS8 A;  3EE9 A;  4Z4F A;  1O13 A;  4CZG A;  1TKX A;  5C25 A;  3SJH A;  4DTS A;  4PWD A;  3LDL A;  1NU0 A;  3AVL A;  4CFA A;  1S1W A;  1BI4 B;  1P90 A;  4LC9 B;  3K59 A;  3R1X A;  4H0T B;  4L3Q A;  5GAE P;  4JI3 K;  1KCF A;  4OKE A;  4IG3 A;  4DFM A;  3ZT0 A;  3U3Y A;  4CHN A;  3QLH A;  5JVH L;  3K57 A;  1QZ6 A;  1ZC6 A;  3C65 A;  1NOZ A;  4CEF A;  1EO1 A;  3LWL A;  1CLQ A;  4DHY A;  4CJU A;  3ZT4 A;  3M8Q A;  1YTU A;  3NF6 A;  2P9L A;  4JD2 A;  1KQS M;  4PUO A;  5EXW A;  1VAZ A;  4C8O A;  4J8F A;  4JV5 K;  4M3Y A;  3OA9 A;  2ITM A;  5BRF A;  1ATR A;  3VGL A;  4BRQ A;  4HVJ A;  4YOW A;  4M41 A;  3NFA A;  1VQ8 N;  2WFB A;  4KI4 A;  1RDA A;  2NUB A;  4DSE A;  2P9L B;  2F8T A;  4JD2 B;  1NLV A;  1HRH A;  4Y1D A;  3HPG A;  3VGK A;  3OBY A;  3L3V A;  4HWI A;  4BRP A;  1N8R O;  1QVF M;  3O08 A;  4B9N A;  4IDH A;  4W5R A;  4FWM A;  1L5U A;  2P5G A;  2NRV A;  4GKK K;  2D0A A;  4GNI A;  1Q81 O;  1LAW A;  2CH6 A;  2BDP A;  4H8K A;  3ULD A;  1XHX A;  1RTD A;  1RDW X;  3NAE A;  3CME N;  3KLI A;  1S1U A;  4U7B A;  4B08 A;  4LY7 A;  4LFB K;  1WN7 A;  2NRX A;  3TAN A;  3FZF A;  1ATS A;  3IG1 A;  3ID8 A;  4KBO A;  4NYN A;  4KHS A;  4FM1 A;  2HMP A;  4DSK A;  5KRS A;  4AHV A;  2A6A A;  3H1V X;  4A57 A;  1RTI A;  4IFY A;  3ZYY X;  4FM0 A;  4PL8 A;  3WEE A;  2PZS A;  3OYG A;  3VF4 A;  4B1W B;  4WQ5 A;  3OYN A;  4OLA A;  4BRI A;  4X64 K;  1ILY A;  1D9D A;  3D2E A;  3M1F A;  3QO9 A;  3OY9 A;  2HVH A;  2ZM6 K;  3WEE B;  4YDU C;  2YKN A;  2D0B A;  2QWL A;  3MN5 A;  1YIJ N;  3SMP A;  2ASM A;  3LP1 A;  3R6M A;  4IFV A;  4KV8 A;  2DFH A;  2NRR A;  1SV5 A;  4J2E A;  3D2E B;  4BVO A;  1RT2 A;  3SAG A;  4CD1 A;  1X3M A;  2Z1J A;  1W97 L;  4EP4 A;  2Q1N A;  1JLE A;  1Z6R A;  5CZ2 A;  3P1G A;  4CED A;  2FBV A;  1IV0 A;  2IIR A;  2E88 A;  3ZEU A;  1HKC A;  1QE1 A;  5CR4 A;  1YTA A;  1ZYQ A;  3VQ9 A;  4CZM A;  4JHD A;  1HQU A;  4E1J A;  3HM8 A;  1K6Y A;  3OYF A;  3HOS A;  2YKM A;  2KFZ A;  1TV6 A;  5BPN A;  4E7K A;  4KH6 A;  4DS5 A;  4X65 K;  1WAF A;  2E6L A;  4CGF A;  5D3G A;  4GVE A;  4EHU A;  3E01 A;  5KI6 A;  3AO4 A;  3ZEU B;  4LH5 A;  4JHD B;  4BG8 A;  4CJP A;  1EET A;  1VQN N;  4JKB A;  3O4W A;  1YI2 N;  3CJ9 A;  1BWF O;  3QIC A;  3M6G A;  3V9U A;  3CJA A;  4CJ5 A;  2NRZ A;  1WLJ A;  5M1K A;  4OO1 J;  2KZZ A;  1NJX A;  4GY2 B;  3GL1 A;  4FJ7 A;  4CZK A;  1TAQ A;  1WSH A;  4O44 A;  2YX6 A;  4V19 S;  1VQM N;  1IBL K;  4FJ5 A;  3VEX A;  1JLC A;  2NRW A;  4QOZ B;  2QW9 A;  3L2W A;  2ITG A;  3G0Z A;  3SJJ A;  2WUS A;  4DLG A;  3AAR A;  3K9J A;  4EAH D;  5LY3 A;  3T1H K;  2UXB K;  3DI6 A;  3TI0 A;  3A0I X;  4E7J A;  3IKM A;  5AQT A;  4H0V B;  3IDH A;  3DLR A;  3V4I A;  2P9N A;  3HI0 A;  4JI0 K;  1BIS A;  3W0L A;  4J2D A;  5DK5 A;  2HVI A;  4MQ3 A;  4IOC L;  4ELU A;  3MX2 A;  3O1W A;  3L0Q A;  3WNF A;  4I7F A;  3PO4 A;  4DTJ A;  4K41 A;  2E2N A;  3NH2 A;  1VSM A;  1X9J A;  4BDP A;  4FWL A;  1XI1 A;  1GLA G;  3NVM A;  5HBM A;  5DMR A;  3SUO A;  3TPQ A;  3A8Y A;  3GG4 A;  4LD0 A;  4DR5 K;  4FWO A;  1GLC G;  3SLC A;  5IWA K;  2P51 A;  1S9E A;  3J7Y P;  1NGG A;  4M63 C;  4CGI A;  3S3N A;  4DSJ A;  5HRS A;  1HNI A;  3LM9 A;  1HNX K;  3D6R A;  2IOC A;  1U48 A;  3ZET A;  4EFH A;  1RDU A;  1B92 A;  2IC3 A;  3CJ1 A;  3O3G A;  1TKT A;  3LPU A;  4BDZ A;  4O5B A;  2ZF5 O;  3P83 D;  3KD5 E;  3CPW M;  3ZET B;  1EXQ A;  4KO0 A;  5AZI A;  3THW A;  1NKE A;  3CJ7 A;  3QIP A;  3PO5 A;  3VQ7 A;  4DR3 K;  2B5J A;  5AQI A;  3RMD A;  2JLE A;  3SV3 A;  1QSS A;  3SYZ A;  3OS1 A;  4O4G A;  5M1O A;  4DKW A;  2YI1 A;  1YAG A;  2P9I A;  4CGD A;  3O8M A;  1HUX A;  2XY6 A;  4YHH K;  4I9L A;  5AZI B;  5I42 A;  2PYJ A;  4FOI A;  4FYD A;  1C1A A;  4JAX A;  5TKW A;  2OA8 A;  1LCU A;  5C0Y A;  3AY9 A;  3QEI A;  3C6U A;  4FPB A;  5BPM A;  2P9I B;  3EN9 A;  2HHW A;  3C0B A;  3CHW A;  4H5N A;  4BY9 C;  1EP4 A;  2FXU A;  2AA4 A;  4HTU A;  2G8W A;  3T1A A;  2HBK A;  2OCE A;  3L2R A;  4J2B A;  4CF0 A;  4ISG A;  4IO9 L;  4DQS A;  1E4F T;  2RHK A;  4DR2 K;  1SL0 A;  5B8H A;  5E84 A;  1BGX T;  4WQ5 C;  5FPE A;  4DV7 K;  2ZGY A;  2Q31 A;  1V4S A;  5HP1 A;  4B3S K;  3MN9 A;  4R79 A;  5DM6 L;  1GOC A;  4JKG A;  3CF5 L;  3EY1 A;  3V1Q A;  5FPM A;  5LJV A;  3RWU A;  2IAJ A;  1BQM A;  2YHY A;  4BR9 A;  3CMA N;  4B1V A;  4KRE A;  3CJB A;  2ZJP L;  3DRP A;  3A5L C;  1X9W A;  1IH7 A;  4K42 A;  4JI5 K;  4PY5 A;  3AVC A;  4JKG B;  4M3U A;  4B8A B;  3A5N C;  2UXD K;  5ELZ A;  4OJR A;  4DV5 K;  1VSE A;  3MWP A;  1WNS A;  3FR0 A;  2KKZ A;  3RMB A;  1JLA A;  4FVU A;  1T44 A;  3VEN A;  1NKB A;  2UYT A;  3DLB A;  3ZSV A;  4XH1 A;  4A61 A;  4B9S A;  4QS7 A;  1K8K B;  4ZHR A;  4N5S A;  1CXU A;  1N5Y A;  1NGH A;  3RMA A;  1KRP A;  4BGB A;  1RBV A;  4Y0W A;  3VQD A;  4DV1 K;  1HPZ A;  4H03 B;  3MCP A;  1LAV A;  3WNH A;  2IDO A;  4N41 A;  4FW2 A;  3T7Z A;  3O3H A;  3M8P A;  1VSI A;  4H0X B;  4FJK A;  4CGJ A;  3HL8 A;  1D8Y A;  2UU9 K;  2W41 A;  4FJJ A;  3G10 A;  4C8M A;  2QKB A;  2ZGZ A;  5GIP A;  3PLA A;  3PIO L;  4CJT A;  2D5R A;  4DB3 A;  1S6P A;  4A2A A;  2X78 A;  3V1O A;  4FVM A;  1IG9 A;  2V52 B;  3HJF A;  4I2Q A;  3BEX A;  3CCJ N;  2BGG A;  1ZBU A;  4DV2 K;  3KKR A;  2ASP A;  1NBW A;  3MX5 A;  4KB0 A;  4BRK A;  2VWK A;  4BRA A;  3RRG A;  4BRD A;  4B9M A;  4MDA A;  2NZT A;  1J53 A;  1TK0 A;  5GIN A;  3ISN C;  4B3R K;  2RE2 A;  1VQ4 N;  3MMV A;  4W5T A;  3RR7 A;  1HKG A;  4FSV A;  3PY8 A;  1SS6 A;  1ZXO A;  2IVN A;  4MLH A;  3CCR N;  4X62 K;  4IO8 A;  4DTN A;  1S72 N;  3HM9 A;  1YHQ N;  3SQ1 A;  2YNG A;  4XEI A;  3LP2 A;  4M3Z A;  3OYK A;  3L2Q A;  3O6W A;  4FPA A;  1QHA A;  2EHG A;  4LSN A;  4BR2 A;  3VQC A;  3TSU A;  2QWM A;  3O4Q A;  3I8B A;  1L3V A;  4BE2 A;  3SV4 A;  2RN2 A;  5JS1 A;  3AO1 A;  2E5L K;  5FRM A;  4XH5 A;  3VQA A;  4KHP K;  2HW3 A;  2IS3 A;  4MO5 A;  5KRT A;  1L3S A;  1S1T A;  3UKU B;  3QEW A;  4FLX A;  3H46 O;  2B4J A;  1NJI O;  4E0D A;  1EQY A;  4B1Z A;  1OH7 A;  4FLV A;  1Q7Y O;  3QNO A;  2VGN A;  1IBK K;  4IWV A;  1Q18 A;  2E20 A;  1RCH A;  4BDY A;  4JK7 A;  3LDS A;  3ENH A;  5HOO A;  5JMV A;  3BZK A;  4Z4I A;  3IRX A;  3DYA A;  3VA0 A;  3L2V A;  1BA1 A;  2P9S A;  5BRE A;  3J7A P;  1JLG A;  1SKW A;  4IBN A;  4AHT A;  1A5X A;  3CG7 A;  3MWT A;  3VTI A;  2X6S A;  5FPD A;  4CE9 A;  4CIE A;  4BRG A;  3QER A;  3S9H A;  1D5A A;  2EX3 A;  1RBT A;  4BWJ A;  4NCG A;  3QB0 A;  2P9S B;  3TAP A;  3VQB A;  4WF9 L;  4DV3 K;  3TAF A;  4B9U A;  3VQQ A;  4DUY K;  4CHY A;  2PY5 A;  2QXF A;  3SK3 A;  2W6L A;  4K8Z A;  3H3O B;  3SMS A;  4AH9 A;  1NK7 A;  5J2P A;  4ELT A;  2VGM A;  4RG8 A;  2E2Q A;  3NCI A;  4R5P A;  3CC2 N;  3OJS A;  1RBR A;  5JLF A;  4GW6 A;  2GTD A;  4IG0 A;  3UIQ A;  3T3F A;  3CCU N;  1BI4 A;  3VES A;  2FF6 A;  4BC5 A;  1K73 O;  3HP6 A;  1RT1 A;  3I8D A;  2JWL A;  4YY3 K;  1ASW A;  4F9O A;  4CJS A;  2VG7 A;  2GV9 A;  1DKG D;  3C94 A;  2NRT A;  4FK0 A;  3U8X A;  4PKH A;  4IEI A;  4NCA A;  1T6D A;  3OYJ A;  2Z1I A;  3ZT1 A;  1VQ9 N;  1HNW K;  3S3O A;  2Z1G A;  3ZCM A;  4BRM A;  3KHY A;  3CFR A;  1S6Q A;  3PUF A;  2VQE K;  4PQU A;  4WCE L;  3L4I A;  2B6A A;  4JI6 K;  3HST B;  5AQP A;  4JRQ A;  4RW9 A;  3NDK A;  3L4Q A;  2XY5 A;  2UUB K;  4BR0 A;  1TAU A;  5LL6 Z;  4OPJ A;  3DAW A;  3ZT3 A;  4ZTJ A;  4JS5 A;  3RSE B;  2BAN A;  5ADX A;  3L8B A;  1XC9 A;  1ATN A;  4B1U B;  1RFQ A;  1WSG A;  2E2P A;  4A62 A;  4WE1 A;  4FZX C;  3U4L A;  3L2U A;  2OTJ N;  1EWQ A;  4IJN A;  4WYB A;  5KQD A;  3TAB A;  3HT3 A;  4FJG A;  3AO2 A;  5F0X A;  4H5T A;  1QZ5 A;  2HF3 A;  5AQO A;  4BWM A;  1H1V A;  2Z1H A;  1NK5 A;  2AP1 A;  1KAZ A;  4DWI A;  1GOB A;  3ZSR A;  4CGH A;  5EVZ A;  2QKK A;  3M8R A;  4DS4 A;  2CGJ A;  4DTU A;  5GAG P;  2LSN A;  5CE3 A;  2PBD A;  3SUQ A;  3VN5 A;  1L3U A;  3SBG A;  3OVN A;  2IVO A;  4AQY K;  4FWK A;  3VGM A;  1VQO N;  4EIA A;  2OPR A;  3AVJ A;  3CYM A;  2O8F A;  5GIO A;  3CCM N;  2GEL A;  1YUW A;  4YOY A;  4FW1 A;  2YCH A;  4JKD A;  2I7P A;  2W6K A;  4Z4G A;  4GMJ B;  3MED A;  3O9R A;  3R9P A;  3G71 N;  3PV8 A;  2KQ2 A;  4CZE A;  3NVK A;  3LP0 A;  1BL3 A;  3LDO A;  1NGF A;  2OAN A;  3K2P A;  4H4O A;  3WXK A;  3E9P A;  1YF5 L;  5F1X A;  4H5V A;  2CGK A;  2O8F B;  4Y1C A;  4JKA A;  4FLZ A;  4OX9 K;  1VSH A;  4OKJ A;  3CJC A;  2OYQ A;  1HJO A;  1WSF A;  3LL3 A;  4I9Q A;  3U9Z A;  1SL1 A;  2FSK A;  1U6Z A;  5AQN A;  2OPS A;  3K9K A;  4E19 A;  1EX4 A;  1JL2 A;  3GOI A;  3CFP A;  3CER A;  2QI2 A;  3PX0 A;  4O5F A;  1XMO K;  3PIP L;  3IMX A;  3BP8 A;  4CJQ A;  1ZBS A;  2G8U A;  1NWK A;  4DSL A;  2J4R A;  4B9V A;  3AVB A;  2D4W A;  3NGZ A;  1DT9 A;  3QEX A;  1E3M A;  4CFC A;  2HBM A;  3OTO K;  2Q2R A;  1LWE A;  3CQ8 A;  2UUC K;  3VF6 A;  3DMJ A;  4CHZ A;  2GEM A;  3TSQ A;  4CJL A;  1HYZ A;  1IG8 A;  3VMF B;  4CJF A;  4CF2 A;  4CIG A;  3EE8 A;  1A5V A;  3LDQ A;  2HOE A;  5AQG A;  3VQP A;  4DCH A;  3WQU A;  4AHC A;  3U9D A;  1BCO A;  4CEZ A;  1FK9 A;  3TWH A;  2D1K A;  2P1J A;  3K58 A;  4DLE A;  1ESV A;  4DUZ K;  4CZH A;  1XQS C;  4ILH A;  3OYM A;  2ZJQ L;  3LP3 A;  1V4T A;  2YHX A;  1BO5 O;  3HYF A;  1SZ2 A;  4E1N A;  2D0P A;  4H5R A;  2YNF A;  3OYH A;  3ZSO A;  3AGR A;  1FKP A;  3WXL A;  2HHQ A;  3AVG A;  1QSY A;  3W3D A;  4E7L A;  3K5L A;  3RR8 A;  3I33 A;  1LWF A;  1G99 A;  3G6E N;  3EEQ A;  3O9T A;  3V6D A;  4FOE A;  3C6H A;  2A40 A;  1C0G A;  1A5W A;  5HRP A;  1Q9X A;  4ISF A;  1P8Z A;  5J2N A;  1JL1 A;  5EY4 A;  1RT4 A;  4FWP A;  1QTM A;  2YHA A;  4CF8 A;  3ZSY A;  3O4N A;  4JKC A;  1HYV A;  5M1P A;  3PSI A;  5TKY A;  2O4I A;  3GDQ A;  3MEC A;  3KK1 A;  4LF5 K;  4CHO A;  1NJY A;  2NNW A;  4B3T K;  1JLQ A;  2V51 B;  3L3U A;  3AVI A;  3E66 A;  3SQ2 A;  4DU1 A;  4FWN A;  3AA2 A;  4BAC A;  3WQT A;  2ATQ A;  4B9T A;  3C6T A;  3HTV A;  2HHH K;  1BDG A;  1VRT A;  3TR8 A;  3VEY A;  3OBW A;  3HSC A;  3F9K A;  1VSF A;  2Q97 A;  4E3S A;  1RDB A;  4YOX A;  3O80 A;  1RBU A;  1RIL A;  3E9L A;  4K0K K;  1KVC A;  4E1M A;  3N4Q A;  3AA4 A;  3LZI A;  1TGO A;  4AHR A;  1X3N A;  2ZJR L;  4BRN A;  1UOC A;  4ICL A;  4B1Y B;  3CC7 N;  1VQ5 N;  1JCG A;  3EL2 A;  4H0O A;  1SAZ A;  2HHX A;  4CBU A;  5AQX A;  4OKK A;  5FLX O;  1SKS A;  3RTV A;  4KH5 A;  1NK9 A;  4FJM A;  2FSN A;  1KTQ A;  3CM5 A;  2HHS A;  2P5O A;  3ENO A;  4G1Q A;  3BGR A;  2QWN A;  3ULE B;  3AV9 A;  3KTQ A;  4BC3 A;  4AF1 A;  3CCS N;  5AQH A;  1Z05 A;  3FFK B;  3V9Z A;  4DTO A;  3HVR A;  5JLH A;  1C0U A;  2D0C A;  4KFB A;  3H08 A;  1VSJ A;  4LFA K;  3KLG A;  5AFU A;  3OJU A;  3VEZ A;  1NGB A;  2FF3 B;  3SBT A;  4AHU A;  3KWI A;  3DJC A;  4JN4 A;  1MDU B;  4KHW A;  3VF2 A;  4RW8 A;  4FLW A;  4DQP A;  1XUP O;  3OYB A;  3ZX3 A;  3AAP A;  2A1R A;  2YJF A;  5BPL A;  4NXN K;  4DMN A;  1DGK N;  1YT3 A;  2GUP A;  1BHL A;  3EO3 A;  3VQ5 A;  4IOX A;  1QS4 A;  5T7B A;  1T05 A;  4OGE A;  4YOR A;  2DFE A;  2YHW A;  4GVM A;  4A5B A;  3J7Z O;  1NGJ A;  4WFB L;  1CXQ A;  5HRN A;  3A2F A;  1S22 A;  1S1X A;  5CZ1 A;  4FO0 A;  3V9X A;  3S3M A;  3MXM A;  5HLF A;  3KLH A;  1KFS A;  3SUN A;  4RTF D;  4M45 A;  4HUG A;  4CZJ A;  3LDP A;  4JRP A;  2QWR A;  5C10 A;  4CJ3 A;  4RW7 A;  4FJ9 A;  4OGC A;  2FLO A;  4LF8 K;  1IKV A;  1VQ6 N;  4I6M A;  2HNZ A;  4C8K A;  1KLN A;  1C1C A;  3LM2 A;  4RWT A;  1SL2 A;  5M1N A;  5F2R A;  2OZS A;  4MFB A;  4BC2 A;  1SKR A;  3ASM A;  3OYI A;  3BDP A;  4EP5 A;  1BIU A;  3O9Q A;  4AIL C;  1T03 A;  4BQL A;  1T8E A;  4YOU A;  1NK6 A;  4I6M B;  3H45 C;  4FWQ A;  4NB4 A;  1TVR A;  2YHB A;  3MN7 A;  3QES A;  4EZ6 A;  4DQQ A;  4CJK A;  4IFE A;  3VA3 A;  1K8K A;  4CEA A;  2D0O A;  2YJE A;  3CXC M;  2DTU A;  3M8S A;  2GBZ A;  4QAG A;  1SQK A;  2Y1I A;  4WQ4 A;  3LPT A;  3BF1 A;  4F2R A;  1HNZ K;  5AR0 A;  4F2S A;  3AVN A;  1S5J A;  3SI6 A;  1IKW A;  1NGC A;  1TYQ A;  2NLX A;  3MXJ A;  3GBT A;  3VOV A;  4CZF A;  4DV4 K;  4OLB A;  4DU3 A;  1YVN A;  2A5X A;  4A5A A;  4IEE A;  3ATV A;  4DG1 A;  4FJH A;  1NGI A;  4CER A;  4FLT A;  3KK3 A;  3IAY A;  2CH5 A;  3HP9 A;  3F9M A;  3C95 A;  1JKH A;  2VWB A;  4J2A A;  2VWJ A;  3TAG A;  4QS9 A;  1XNQ K;  4M7Y A;  1TYQ B;  1KSP A;  3TSP A;  4DV6 K;  1C0M A;  4H0Y B;  1QQO A;  3P5J A;  3VER A;  1LW2 A;  2XRI A;  4KTQ A;  4C1N I;  2ZQB A;  2Q0R A;  1X1P A;  5CYQ A;  1WBB A;  3Q7C A;  1WSI A;  2FC0 A;  5BR8 K;  1VHX A;  3DRR A;  3OYA A;  3CCE N;  3BUZ B;  5HRO A;  4M3X A;  3I56 N;  5BN9 A;  4A2B A;  1N36 K;  4JKE A;  1NJW A;  2QEX N;  4TSX A;  2F7T A;  1WOQ A;  1BOT O;  4ELV A;  4DSF A;  3JXU A;  2KW4 A;  4FK2 A;  3A5M C;  5ADX H;  1XC3 A;  4JI7 K;  4C8L A;  3CD6 N;  2HBL A;  1IO2 A;  3P39 A;  5KPT A;  3P31 A;  3FZH A;  4Q0B A;  3THV A;  4W5Q A;  1RT3 A;  5AQL A;  3TTF A;  1QQM A;  3I0R A;  1HPM A;  3CET A;  3KLE A;  5C42 A;  4CVN E;  2F4V K;  2QM1 A;  4DTP A;  4QCL A;  2OTL N;  1QVG M;  1OH6 A;  4U67 L;  1QQN A;  5AQK A;  1D9F A;  4EHT A;  4FXD A;  2GUI A;  4NCB A;  3UKU A;  5AQQ A;  1KAX A;  1NGE A;  3QNN A;  4JKH A;  5KQ8 A;  4JKF A;  3PX6 A;  3NGI A;  3AVH A;  1OVY A;  1CZA N;  4CJV A;  3CQX A;  4Z4C A;  3SQ0 A;  1FJG K;  4IOA L;  2JGU A;  3DLH A;  3G4S N;  1J5E K;  4YOV A;  3WXI A;  2IVP A;  4Z4E A;  2QWQ A;  4CEC A;  1TUU A;  3B6P A;  4KHQ A;  3JYT A;  4YDU A;  5LMN K;  5AQZ A;  5AJ3 K;  2I7N A;  2KZM A;  3DOK A;  1BCM A;  2Q36 A;  3H3N O;  4FWR A;  1ASV A;  4KAZ A;  4CBW A;  4L8R B;  3QBW A;  5C12 A;  3EZW A;  2QTD A;  3SQ4 A;  1RTH A;  4CF1 A;  1Q8I A;  5H1S Q;  3TTD A;  3I55 N;  3K5O A;  3C7N A;  1F21 A;  5AQU A;  5CYM A;  4B9L A;  1N32 K;  1B9D A;  4KKO A;  5E41 A;  2VG6 A;  1W0H A;  1RT7 A;  3T69 A;  3CFO A;  2H3G X;  2VYP A;  1HMV A;  3KLF A;  1QHT A;  4CJE A;  1ZBL A;  3C7N B;  1L3T A;  3KIO A;  3HPH A;  5KGX A;  5HL7 L;  4BC4 A;  3QDK A;  1MWK A;  1VSK A;  2E6M A;  1DTT A;  3VET A;  2O8E A;  1EWR A;  1NOY A;  1LW0 A;  2X74 A;  3CCV N;  4BRC A;  2QWP A;  4IJA A;  2P9K B;  4ZTF A;  3EZ5 A;  3QML A;  1N6Q A;  4JI4 K;  1K9M O;  2GWJ A;  3MXI A;  3LZJ A;  2VQF K;  4OVL A;  5AZJ A;  2O8E B;  4BGA A;  3TU5 A;  1W2B M;  4CJR A;  3PX4 A;  3RVC A;  2QWO A;  4M3T A;  3O1B A;  3TTC A;  1M90 O;  4CW7 B;  3C6A A;  3DM2 A;  3CCQ N;  4BRE A;  1GLD G;  4FK4 A;  5EU7 A;  1NK0 A;  3LWM A;  1VQL N;  4CK2 A;  4KB1 A;  3KWG A;  3ATU A;  5DM7 L;  4BQZ A;  1MWM A;  5AZJ B;  3DOL A;  3QBX A;  2YNI A;  5GAD P;  4JYA K;  4H4M A;  1VK0 A;  3RSE A;  3THY A;  3E1Y A;  4GKJ K;  4FM2 A; 
#chains in the Genus database with same CATH homology
 4E7I A;  1BCO A;  4CGD A;  4CEZ A;  3OYD A;  1FK9 A;  3TWH A;  4BE0 A;  4JLH A;  3O3F A;  4M42 A;  2P1J A;  2XY6 A;  3K58 A;  4DLE A;  4I9L A;  5I42 A;  2PYJ A;  3OYM A;  1JXB A;  3QET A;  1I3A A;  3LP3 A;  4KHN A;  1REV A;  4FYD A;  1C1A A;  4FJX A;  2OA8 A;  1U49 A;  3HYF A;  4E1N A;  1KFD A;  3QEI A;  2QK9 A;  3NF8 A;  3C6U A;  2YNF A;  3OYH A;  2FBX A;  3ZSO A;  1FKP A;  2HHQ A;  2HHW A;  4KRF A;  3AVG A;  1QSY A;  1UA1 A;  2YV0 X;  1EP4 A;  4E7L A;  3AO3 A;  3K5L A;  2G8F A;  1ITG A;  1C1B A;  3RR8 A;  4HTU A;  2G8W A;  1LWF A;  3T1A A;  1RT6 A;  1DTQ A;  3L2R A;  3RMC A;  3V6D A;  1U45 A;  2OPP A;  4J2B A;  3F73 A;  4CF0 A;  3TAR A;  4FLY A;  4FJN A;  4ID1 A;  1A5W A;  5HRP A;  3FFI A;  4DQS A;  1TK5 A;  1Q9X A;  1J54 A;  5J2N A;  1JL1 A;  1TKD A;  3AVA A;  1SL0 A;  1RT4 A;  4HUE A;  2YHA A;  4CF8 A;  1QTM A;  4HUF A;  3ZSY A;  1BGX T;  3O4N A;  1VSD A;  3KK2 A;  1HYV A;  3B6O A;  5K14 A;  2FBY A;  2O4I A;  1WSJ A;  3LAL A;  3MEC A;  4RW6 A;  3ZT2 A;  5HP1 A;  2XY7 A;  4F3O A;  3KK1 A;  5I3U A;  3NF9 A;  4YNQ A;  4CHO A;  5J2Q A;  4FJ8 A;  1NJY A;  1JLQ A;  1GOC A;  1XHZ A;  3L3U A;  3AVI A;  2HB5 A;  4CK3 A;  3SQ2 A;  4DFJ A;  1CZB A;  3WNE A;  4DU1 A;  3EY1 A;  4FZZ A;  3AA2 A;  2KTQ A;  3V1Q A;  2AJQ A;  4BAC A;  1BQN A;  2ATQ A;  4B9T A;  3RWU A;  2IAJ A;  3U6F A;  3C6T A;  1BQM A;  1S9G A;  4O0J A;  1BIZ A;  4KRE A;  2KFN A;  3HVT A;  4F4K A;  1VRT A;  3TR8 A;  4AHS A;  1UA0 A;  1NJZ A;  3JSM A;  3DRP A;  4CEQ A;  1NKC A;  1X9W A;  4DFK A;  2HHT A;  1IH7 A;  3F9K A;  1HJR A;  4PY5 A;  1J9A A;  3AVC A;  3HPO A;  4KHU A;  4M3U A;  4B8A B;  1VSF A;  4B8C A;  4E3S A;  1RDB A;  2HMI A;  3QIN A;  1RBU A;  2YNH A;  4NYF A;  1RIL A;  4OJR A;  4DF4 A;  1VSE A;  2O4G A;  1WNS A;  4I2P A;  1KVC A;  4E1M A;  1ZBH A;  3NHG A;  1Z26 A;  3AA4 A;  5C24 A;  3T19 A;  3RMB A;  1JLA A;  3LZI A;  1RDD A;  1TGO A;  4KI6 A;  1NKB A;  4AHR A;  3DLB A;  3ZSV A;  4FZY A;  4KTW A;  1UOC A;  4B9S A;  3VQ8 A;  3QEP A;  4CHP A;  4ICL A;  1SUQ A;  3TAM A;  4ZHR A;  1WSE A;  1U4B A;  1RTJ A;  4CEB A;  4N5S A;  3SNN A;  1CXU A;  4CHQ A;  1N5Y A;  1C6V A;  4K8X A;  1NK4 A;  1X9M A;  2HHX A;  3ITH A;  3RMA A;  4N56 A;  1KRP A;  4N76 A;  4M3R A;  1RBV A;  4OKK A;  3VQD A;  1SKS A;  3NGY A;  3RTV A;  2RF2 A;  1HPZ A;  3EYZ A;  3VQ6 A;  3RRH A;  1LAV A;  3WNH A;  2IDO A;  5KTQ A;  1VRU A;  1NK9 A;  4FJM A;  4PA1 A;  4N41 A;  4FW2 A;  2G8H A;  1KTQ A;  3MEE A;  2RPI A;  3CM5 A;  3QIO A;  3M8P A;  3O3H A;  3V9W A;  2HHS A;  1YVU A;  1VSI A;  4FJK A;  3HXM A;  4E7H A;  2W42 A;  2P5O A;  2E4L A;  4CGJ A;  2IGI A;  3HL8 A;  5J2M A;  4CGG A;  4G1Q A;  3BGR A;  1TK8 A;  1D8Y A;  1RBS A;  1S1V A;  4FJJ A;  3CM6 A;  3G10 A;  3LAN A;  3OS2 A;  4C8M A;  3AV9 A;  2FBT A;  2QKB A;  3KTQ A;  4C8N A;  1W9H A;  3AA5 X;  1U04 A;  3V9Z A;  4DTO A;  4DFP A;  2XO7 A;  4CJT A;  2D5R A;  3HVR A;  2ZD1 A;  2HND A;  3AO5 A;  1S6P A;  1C0U A;  2D0C A;  2X78 A;  4FVM A;  4KFB A;  4N47 A;  3V1O A;  3NE6 A;  3H08 A;  1IG9 A;  1EKE A;  1VSJ A;  1TL1 A;  3HJF A;  3KLG A;  3OJU A;  2PYL A;  4I2Q A;  4DTM A;  1LV5 A;  3U3G A;  2BGG A;  4B3O A;  1ZBU A;  4AHU A;  3KKR A;  4CF9 A;  1NK8 A;  1GOA A;  3SUP A;  4IKF A;  3D45 A;  1HQE A;  4YFU A;  4KB0 A;  2VWK A;  3RRG A;  4KHW A;  4CJW A;  4RW8 A;  4FLW A;  3ALY A;  4DQP A;  2F8S A;  3NF7 A;  3MEG A;  3OYB A;  4B9M A;  1JXE A;  2A1R A;  2Q3S A;  3KKS A;  4Z4F A;  4UQG A;  1J53 A;  1TKX A;  2I5J A;  4DMN A;  1TK0 A;  5C25 A;  4DTS A;  4DSI A;  4HCB A;  4PWD A;  3ISN C;  1YT3 A;  3AVL A;  4CFA A;  4CJ4 A;  1S1W A;  4W5T A;  3RR7 A;  1BHL A;  3VQ5 A;  1BI4 B;  4CK1 A;  5T7B A;  1QS4 A;  3K59 A;  3PY8 A;  1T05 A;  4KHY A;  4OGE A;  1TL3 A;  2DFE A;  4GVM A;  4DTN A;  1KCF A;  4OKE A;  2G8I A;  1CXQ A;  4IG3 A;  5HRN A;  4O0I A;  3A2F A;  3HM9 A;  3ZSQ A;  3ZT0 A;  1S1X A;  4DFM A;  3U3Y A;  5CZ1 A;  3SQ1 A;  4CHN A;  3QLH A;  2YNG A;  3V9X A;  4IDK A;  3V1R A;  3S3M A;  3MXM A;  5HLF A;  3K57 A;  3LP2 A;  3KLH A;  1KFS A;  3KJV A;  3SUN A;  1NOZ A;  3OYK A;  4CEF A;  4M3Z A;  2XHB A;  3LWL A;  3L2Q A;  1CLQ A;  4M45 A;  4CJU A;  3ZT4 A;  4HUG A;  4FJI A;  4JRP A;  3AVF A;  3M8Q A;  4CJ3 A;  3NF6 A;  4RW7 A;  4FJ9 A;  4OGC A;  4KTZ A;  1YTU A;  3TAE A;  2EHG A;  1IKV A;  4LSN A;  4CFB A;  4PUO A;  3VQC A;  2HNZ A;  3O4Q A;  1L3V A;  1ASU A;  4BE2 A;  3SV4 A;  4C8O A;  2RN2 A;  4C8K A;  4M3Y A;  5JS1 A;  1KLN A;  1C1C A;  2G8K A;  3AO1 A;  1CZ9 A;  1Y97 A;  3ZSW A;  1SL2 A;  4RW4 A;  1FXX A;  5SWM A;  4HVJ A;  2OZS A;  1RDC A;  4MFB A;  5FRM A;  2DY4 A;  3VQA A;  1SKR A;  3ASM A;  4M41 A;  3NFA A;  2HW3 A;  4KI4 A;  1RDA A;  3OYI A;  2NUB A;  4DSE A;  4DU4 A;  3BDP A;  2IS3 A;  4EP5 A;  1BIU A;  5KRT A;  4AIL C;  2F8T A;  3MAQ A;  1T03 A;  1L3S A;  1T8E A;  1ZBI A;  1NK6 A;  1S1T A;  2ETJ A;  1HRH A;  4Y1D A;  4FCY A;  4FLX A;  3QEW A;  3HPG A;  2B4J A;  3L3V A;  4E0D A;  1JLB A;  1TVR A;  4B9N A;  3VQ4 A;  4HCC A;  4W5R A;  1QSL A;  1L5U A;  4FLV A;  2P5G A;  3QNO A;  2YHB A;  3QES A;  4EZ6 A;  4DQQ A;  4CJK A;  5HRR A;  2D0A A;  3VA3 A;  4CEA A;  1LAW A;  1ZBF A;  3AA3 A;  1RCH A;  2DTU A;  3M8S A;  4BDY A;  3LDS A;  2GBZ A;  4QAG A;  2BDP A;  4H8K A;  3ULD A;  1G15 A;  4BE1 A;  2Y1I A;  1XHX A;  4Z4I A;  3LPT A;  1RTD A;  3IRX A;  3DYA A;  3VA0 A;  3L2V A;  3NAE A;  4F2R A;  1JLG A;  2WOM A;  1SKW A;  3KLI A;  1S1U A;  4IBN A;  4AHT A;  4F2S A;  4E89 A;  1A5X A;  3AVN A;  1S5J A;  3CG7 A;  4B08 A;  3SI6 A;  1IKX A;  2X6S A;  1IKW A;  4LY7 A;  3MXJ A;  4HHT A;  1X9S A;  1J5O A;  4OLB A;  4DU3 A;  1WN7 A;  3TAN A;  2BE2 A;  4CE9 A;  4CIE A;  3IG1 A;  3QER A;  3S9H A;  4NYN A;  3OS0 A;  4KHS A;  4FM1 A;  4DTX A;  1D5A A;  2EX3 A;  4DG1 A;  4FJH A;  1RBT A;  4BWJ A;  4NCG A;  4CER A;  4FLT A;  3KK3 A;  2XY8 A;  4CIF A;  3IAY A;  4DSK A;  5KRS A;  3HP9 A;  4AHV A;  1O1W A;  1JKH A;  3C95 A;  3VQB A;  3TAP A;  1RTI A;  4IFY A;  4J2A A;  2VWJ A;  3TAF A;  3TAG A;  1B9F A;  3AVK A;  4KPY A;  4B9U A;  3VQQ A;  4FM0 A;  4CHY A;  2PY5 A;  2QXF A;  2PZS A;  1KSP A;  3HK2 A;  4Z0U A;  1C0M A;  4K8Z A;  4AH9 A;  3OYG A;  3P5J A;  1NK7 A;  5J1E A;  3OYN A;  1LW2 A;  5J2P A;  2XRI A;  2G8V A;  4EZ9 A;  4KTQ A;  4ELT A;  2WON A;  5JS2 A;  4OLA A;  2ZQB A;  4RG8 A;  2X6N A;  1LWC A;  2OZM A;  1D9D A;  1X1P A;  5CYQ A;  3NCI A;  4R5P A;  3OY9 A;  3QO9 A;  1WSI A;  3IS9 A;  3OJS A;  1RBR A;  2FC0 A;  4GW6 A;  2HVH A;  3DRR A;  4IG0 A;  3OYA A;  1C0T A;  4F3T A;  2YKN A;  5HRO A;  4W5O A;  4M3X A;  3OYE A;  1RT5 A;  3UIQ A;  2D0B A;  4Q5V A;  3T3F A;  1NJW A;  3LP1 A;  4TSX A;  4IFV A;  4KV8 A;  2DFH A;  1BI4 A;  3HP6 A;  1SV5 A;  2VG5 A;  4J2E A;  1RT1 A;  1KLM A;  3I8D A;  1ASW A;  1RT2 A;  4CJS A;  4ELV A;  2VG7 A;  1UAX A;  2Z1J A;  2GV9 A;  4DSF A;  3C94 A;  4EP4 A;  4FK0 A;  2KW4 A;  4NCA A;  4FK2 A;  3OYJ A;  1JLE A;  5CZ2 A;  2Z1I A;  3P1G A;  3ZT1 A;  4CED A;  1IO2 A;  4C8L A;  5FRN A;  3S3O A;  2FBV A;  3HO1 A;  2Z1G A;  3ZCM A;  3WNG A;  3TAQ A;  4LH4 A;  3DLE A;  4Q0B A;  3THV A;  3CFR A;  1S6Q A;  3PUF A;  4W5Q A;  1RT3 A;  4PQU A;  3V9S A;  3I0R A;  1QE1 A;  3SCX A;  1YTA A;  1ZYQ A;  1Z25 A;  3VQ9 A;  2B6A A;  3KLE A;  5C42 A;  1KVB A;  1HQU A;  3HST B;  1RNH A;  1K6Y A;  3LAM A;  4RW9 A;  2YKM A;  3OYF A;  3NDK A;  1TV6 A;  4JRQ A;  2XY5 A;  2KFZ A;  3QEV A;  1TAU A;  4OPJ A;  4E7K A;  4DTP A;  3ZT3 A;  4QCL A;  4DS5 A;  3LAK A;  4W5N A;  1WAF A;  2E6L A;  5FRO A;  4CGF A;  4JS5 A;  4ZTJ A;  1Q9Y A;  5D3G A;  2BAN A;  4ID5 A;  3L8B A;  3NH1 A;  1XC9 A;  1D9F A;  4O55 A;  4FXD A;  2GUI A;  3E01 A;  4NCB A;  5KI6 A;  3AO4 A;  1KVA A;  1WSG A;  4LH5 A;  3QNN A;  2HHU A;  4LSL A;  3AVM A;  4WE1 A;  4FZX C;  3PX6 A;  4CJP A;  1EET A;  3NGI A;  3AVH A;  3L2U A;  4CJV A;  4Z4C A;  3V9U A;  3SQ0 A;  4CJ5 A;  2JGU A;  1WLJ A;  3TAB A;  3DLH A;  2KZZ A;  4XIU A;  3HT3 A;  4DQR A;  1NJX A;  1UWB A;  3AO2 A;  4FJG A;  4FJ7 A;  1TKZ A;  1TAQ A;  3I0S A;  1WSH A;  4O44 A;  4CEC A;  4Z4E A;  3B6P A;  4KHQ A;  5KGW A;  4BWM A;  3K5M A;  3NBP A;  3JYT A;  2Z1H A;  1NK5 A;  4FJ5 A;  4QOZ B;  1JLC A;  2RKI A;  4FJL A;  4DWI A;  1GOB A;  3L2W A;  3ZSR A;  2KZM A;  1WAJ A;  3DOK A;  1BCM A;  4CGH A;  2ITG A;  3G0Z A;  3SJJ A;  2QKK A;  4DQI A;  3M8R A;  4DS4 A;  4DF8 A;  4CES A;  4DLG A;  4DTU A;  1ASV A;  4KAZ A;  2LSN A;  3SZ2 A;  4L8R B;  3D0P A;  3DI6 A;  3TI0 A;  3SUQ A;  3SQ4 A;  1RTH A;  3VN5 A;  4CF1 A;  1L3U A;  3SPY A;  1Q8I A;  3NH0 A;  4Z4H A;  3OVN A;  4E7J A;  2R7Y A;  3K5O A;  3DLR A;  1F21 A;  2OPR A;  4JS4 A;  3DLG A;  3V4I A;  3AVJ A;  3CYM A;  1MU2 A;  3OYC A;  1BIS A;  5CYM A;  4J2D A;  4B9L A;  2HHV A;  5DK5 A;  3ZSX A;  4MQ3 A;  2HVI A;  4ELU A;  1B9D A;  1QQC A;  4FW1 A;  5FDL A;  4KKO A;  5E41 A;  2VG6 A;  1W0H A;  4I7F A;  3WNF A;  3PO4 A;  4DTJ A;  3DLK A;  4Z4G A;  1RT7 A;  4GMJ B;  4CFD A;  3CFO A;  3MED A;  1HYS A;  2ZE2 A;  1FKO A;  2KQ2 A;  3PV8 A;  1HMV A;  3NH2 A;  1VSM A;  3LP0 A;  1BL3 A;  1QHT A;  1I39 A;  4CJE A;  3KLF A;  3K2P A;  4H4O A;  1ZBL A;  1L3T A;  2F96 A;  4BDP A;  3KIO A;  4FLU A;  3HPH A;  5HBM A;  5KGX A;  1XI1 A;  5DMR A;  1U47 A;  4Y1C A;  4FLZ A;  2A1S A;  1VSH A;  4OKJ A;  3SUO A;  2Y1J A;  2OYQ A;  4LD0 A;  1VSK A;  1WSF A;  2E6M A;  1DTT A;  4I9Q A;  1SL1 A;  3ZSZ A;  3VQE A;  1NOY A;  1LW0 A;  2X74 A;  2OPS A;  2P51 A;  4E19 A;  1S9E A;  1EX4 A;  1IKY A;  1JL2 A;  3CFP A;  4CGI A;  3S3N A;  4M3W A;  4DSJ A;  4ZTF A;  3EZ5 A;  5HRS A;  1JLF A;  1N6Q A;  1HNI A;  3PX0 A;  3OYL A;  2IOC A;  1U48 A;  3MXI A;  3LZJ A;  1DLO A;  2DFF A;  3DRS A;  5SZT A;  4OVL A;  4CJQ A;  1XWL A;  1T7P A;  2G8U A;  1B92 A;  2IC3 A;  4CJR A;  3O3G A;  4DSL A;  3V81 A;  1TKT A;  3PX4 A;  4B9V A;  3LPU A;  4M3T A;  3AVB A;  3NGZ A;  4BDZ A;  1R0A A;  4CEE A;  3QEX A;  4O5B A;  4CEO A;  3DM2 A;  1VSL A;  3P83 D;  4CFC A;  3KD5 E;  2HNY A;  3SPZ A;  1LWE A;  3CQ8 A;  4FK4 A;  5EU7 A;  1EXQ A;  4KO0 A;  2OPQ A;  3LWM A;  3K5N A;  4CK2 A;  1NK0 A;  4KB1 A;  1HNV A;  1NKE A;  3KD1 E;  3DOL A;  3DMJ A;  4DTR A;  3QIP A;  3PO5 A;  4CHZ A;  4CJL A;  2YNI A;  3VQ7 A;  2B5J A;  4OPK A;  1HYZ A;  4CJF A;  4CF2 A;  3RMD A;  2JLE A;  3SV3 A;  4H4M A;  5CY4 A;  4CIG A;  3SYZ A;  3OS1 A;  1VK0 A;  1A5V A;  4O4G A;  1QSS A;  4CCH A;  4F8R A;  3VQP A;  4AHC A;  4FM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...