1VSLA

Asv integrase core domain d64n mutation with zinc cation
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
146
structure length
146
Chain Sequence
b'GLGPLQIWQTNFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (INTEGRASE)
publication title Structural basis for inactivating mutations and pH-dependent activity of avian sarcoma virus integrase.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
molecule tags Hydrolase
total genus 55
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vslA00
3LAMA 4KTZA 3VQDA 1C1AA 3AO5A 3QO9A 4OKEA 1C0MA 4OGEA 2FBTA 5J1EA 4DLGA 1FXXA 3OYCA 1K6YA 4CEZA 1KLNA 4M3TA 1BCOA 3OYMA 3WNFA 1SUQA 2YHBA 5FRNA 4FXDA 4FJGA 4M41A 3F73A 1YTUA 4KAZA 3TI0A 4PWDA 2PY5A 3LPUA 4I7FA 3HJFA 4I2QA 1QS4A 3ZSQA 3AVLA 4FJNA 2GUIA 4W5NA 2A1SA 3V1RA 3M8SA 1T7PA 4EP5A 2G8VA 3S3NA 3D0PA 1S6PA 4KREA 4M3WA 2HHVA 4M45A 1RCHA 1T05A 3ZSYA 3PX6A 2Z1IA 4I9LA 1NK7A 1QHTA 1JLEA 1C0TA 3RMAA 1TGOA 3WNGA 4J2EA 4AHCA 4CFDA 4HUEA 3S3MA 1FK9A 1RT2A 3JYTA 4DQSA 1Q9YA 3S3OA 4F4KA 1VK0A 4CJKA 2B5JA 4J2DA 4M3UA 3O4QA 1GOCA 3ALYA 2HMIA 3K58A 1EKEA 3P5JA 4DTOA 5CY4A 1LWFA 1HJRA 2YNFA 1RT6A 3MXIA 2HNDA 1TAUA 4KB0A 1XWLA 4DSEA 4ZTJA 1BQNA 1J9AA 1KFDA 3K5NA 3NDKA 4KFBA 4EZ6A 1BIZA 4KHUA 2BGGA 2IGIA 4CGFA 3NGYA 1N5YA 4AHUA 4BE2A 1CLQA 2IOCA 2KQ2A 2Y1IA 4LY7A 3TABA 1WSIA 3IS9A 3OYIA 1NJXA 1KRPA 1RDDA 3QLHA 3WNEA 4DQQA 4ELVA 1RT3A 4C8OA 2YKMA 5CZ2A 2IAJA 2KFNA 5KGXA 4KO0A 3T1AA 2Z1JA 1HYSA 1TKXA 1WNSA 3ITHA 4CF1A 3S9HA 3VQCA 1SL0A 2HHWA 1LAVA 1RTHA 1WSEA 4H8KA 3TANA 4CHQA 3VQ8A 4DQIA 1U47A 1KVBA 3M8QA 3TAQA 3O4NA 3SJJA 2D0AA 4KKOA 4KTWA 4CFBA 4W5TA 3C94A 3CG7A 3QEIA 3HO1A 3V81A 2QKBA 4DU3A 3KIOA 2AJQA 4HUGA 1RDBA 1ZBLA 3NF8A 1NJZA 4DTPA 1KSPA 3QIPA 1CZBA 2BANA 3P1GA 3P83D 3RMBA 3SI6A 4DWIA 5I42A 3NH0A 3NHGA 4KTQA 3AVMA 1RBSA 3QINA 2P51A 3AA2A 3KLEA 2FBYA 3KKRA 2XHBA 1JLAA 4CJTA 2KZZA 3AVIA 1NKCA 3AVNA 2ZQBA 2G8UA 3DOLA 2QXFA 1CZ9A 4FW1A 3NAEA 3TAPA 2ZE2A 2HHSA 1BL3A 3L3VA 1IG9A 3VQ6A 3SQ4A 4NYNA 3SUQA 4WE1A 4FJXA 4RW9A 2YNHA 3BGRA 2A1RA 4IG3A 1WSJA 5CYQA 5EU7A 2B4JA 4B9UA 2O4IA 3O3FA 2OZSA 2XY7A 3VQ4A 1VSKA 4QAGA 3L2QA 3OJSA 3CFPA 2ITGA 5KTQA 2VWJA 3PY8A 4G1QA 1IKVA 3L8BA 3TARA 4FW2A 1I39A 4M3RA 3ZCMA 3SNNA 4QOZB 4DQPA 3NGZA 3KK1A 1RT1A 2DFFA 1U49A 4FLWA 2P5OA 3VQQA 2XY6A 4CJQA 4FLVA 1SL1A 2HHUA 2EHGA 4CJRA 4CJFA 5I3UA 1T8EA 4FJ8A 4FZXC 4F2RA 4F3TA 4IKFA 1NK6A 3O3GA 3HXMA 4DTXA 1L3SA 4OGCA 1SKWA 1LW2A 3AVAA 1JLGA 1TL3A 3TWHA 1RT4A 3AO3A 4CIFA 2Z1GA 4N76A 5KI6A 4CEDA 4FVMA 4B9MA 1FKOA 1NOZA 4KI6A 3NGIA 3ZT2A 2KFZA 3K57A 1X1PA 4CGHA 3CFOA 3C6UA 4CEQA 4N5SA 3SV4A 1QTMA 3MAQA 1RBVA 1L3VA 1IKYA 2HNZA 2RPIA 3DRRA 4BE1A 2D0BA 4M42A 3KK2A 1BGXT 4Z4GA 1KTQA 3V9SA 4B9VA 3WNHA 4FLYA 4DG1A 1EX4A 3MEEA 5HLFA 4PUOA 1NK9A 5JS1A 3NBPA 3K5MA 2IC3A 3B6PA 3DMJA 3HSTB 3QNOA 4F8RA 4PQUA 3MEGA 4CF8A 4CHNA 4DSLA 3LAKA 4W5QA 3ISNC 3HK2A 2F8SA 3HPGA 4BDPA 1JLBA 3NFAA 4CFAA 4NCAA 1S1XA 3RMDA 3A2FA 3K5OA 3L2WA 1UA1A 1U45A 1TKDA 2O4GA 1S5JA 4OJRA 4E3SA 3DLBA 4E89A 1UWBA 4XIUA 1RDCA 3I8DA 1XI1A 4CJPA 3QESA 1IH7A 1ITGA 1LWCA 2B6AA 1ZYQA 4IDKA 2VG7A 3AV9A 3IG1A 3I0SA 3LP2A 1HNVA 1UAXA 2ETJA 5DK5A 4KB1A 4N41A 2WOMA 5J2PA 1S1VA 1KVAA 4CF0A 1SKRA 1NK0A 3MXJA 3QEPA 1NJWA 4PY5A 2VG5A 1JL1A 1J53A 4MFBA 4NCGA 4W5OA 3EZ5A 1XC9A 3SQ2A 3MECA 4Y1CA 3KD1E 2ATQA 2HW3A 4GW6A 4DS4A 3SUNA 1HYVA 1TK5A 5HBMA 2Q3SA 3LZJA 3QEXA 4J2AA 1YVUA 1L5UA 4B9TA 1BI4B 1I3AA 4W5RA 3VN5A 1RDAA 5HRRA 2Z1HA 2YNIA 4E1NA 3OYEA 4KRFA 3OYJA 3SV3A 3ASMA 5HP1A 5HRNA 1XHXA 4L8RB 3VQ9A 4JRQA 3ZT4A 1B9DA 3NCIA 4FLZA 1S6QA 3VQAA 2ZD1A 1RILA 2F8TA 2GV9A 3PX0A 1ZBIA 3QEVA 2HHTA 4K8XA 3OVNA 1JLCA 1W9HA 4DTUA 3LALA 4FLUA 5HROA 3AVHA 1O1WA 3VQEA 2WONA 3QIOA 3DM2A 4B8AB 3V9WA 3KK3A 3SCXA 4CK2A 4CEFA 3LANA 4PA1A 2X74A 4FM1A 3V9ZA 1C0UA 4ELUA 4RG8A 1RBRA 5FROA 1KCFA 5E41A 3SZ2A 3DLHA 1REVA 1S9GA 1VSFA 4DFJA 2HB5A 1ZBUA 4CHZA 1X9MA 4CJUA 4KHSA 2QK9A 2HNYA 3RR8A 4I2PA 4OLBA 1Q8IA 4CERA 2XY8A 4FK2A 2RN2A 5CZ1A 4AHSA 3AA4A 1ASWA 3T3FA 4B9LA 4N56A 2W42A 1WSFA 5SZTA 4FJ7A 4CHYA 3THVA 3NF7A 4E0DA 4FZZA 2F96A 2KTQA 1EXQA 1RBUA 3DLGA 4E7LA 3SUPA 1TK0A 3V9XA 3RRGA 2OYQA 5C24A 4DTSA 4CEEA 2X6NA 1D8YA 4NCBA 1VSEA 4AHVA 4DTRA 4RW6A 2G8IA 3SPZA 4RW7A 3HYFA 4KHYA 1JXBA 3ZT3A 4CK3A 1SL2A 2PYJA 1C1CA 4LD0A 4IFYA 3VQBA 2OZMA 3UIQA 3M8PA 2KW4A 4FM2A 3VA0A 3LP1A 3I0RA 4DTMA 1NK5A 4KHQA 1JLQA 4FJMA 1J54A 4RW8A 1NK4A 5D3GA 2X6SA 1VSHA 1A5XA 2XRIA 4CF2A 3ZSZA 3ZSXA 3K59A 1JKHA 4DU1A 2FBVA 4C8KA 1HYZA 1NKEA 3VA3A 3HP9A 3SUOA 4ZTFA 4FJKA 2D0CA 3KLFA 3SPYA 3PO5A 4KV8A 4IFVA 3OYAA 3DOKA 1YT3A 3KKSA 4GVMA 1TK8A 4CJWA 3ULDA 4B3OA 1KVCA 1VSIA 1HRHA 4OKJA 1ASUA 4AHRA 4O44A 3DI6A 2HHQA 3SQ1A 3JSMA 4E7IA 3CYMA 4ID5A 1TKZA 1KFSA 4CGDA 3MEDA 4Z4CA 4LH4A 4I9QA 4KHNA 4FJJA 1KLMA 3LPTA 5T7BA 4EP4A 4DF4A 4CECA 2VG6A 1TV6A 1CXQA 5DMRA 4CF9A 5C25A 4Z4IA 2OPPA 1FKPA 1S1TA 2BE2A 4CESA 4FLXA 5J2MA 3TAGA 3DRPA 1WN7A 1HQUA 2OA8A 3ZSRA 3KTQA 4Z4EA 3IRXA 3LWLA 3LWMA 2G8KA 3OYNA 2IS3A 3MXMA 2HVIA 2FBXA 1WLJA 4DSJA 3RTVA 3DRSA 4EZ9A 4OPKA 3OS2A 4CEOA 4Q0BA 1UOCA 4O4GA 1EETA 4BWJA 1RNHA 4KHWA 4DQRA 4DFMA 1LV5A 3QETA 4C8LA 3L2RA 3TAMA 4CJSA 5JS2A 3E01A 2BDPA 4FJHA 1L3UA 3NE6A 2DY4A 3FFIA 1TKTA 4YFUA 2RKIA 4FM0A 1WAJA 4TSXA 1D5AA 3VQ7A 4CHPA 3U6FA 4DSFA 5J2NA 4BE0A 1Q9XA 4DFKA 2VWKA 4CFCA 3NH2A 3O3HA 3HP6A 3AO1A 4BWMA 3OYKA 2G8WA 2JGUA 2YKNA 3AVCA 3AVKA 1S1WA 4HUFA 1QQCA 4CEBA 1N6QA 2HVHA 5HRPA 3TAFA 1ASVA 1B92A 4E19A 2Y1JA 3M8RA 4CEAA 3RMCA 3HM9A 3PUFA 4N47A 1BISA 1A5WA 4Q5VA 3L2UA 4OVLA 3QEWA 4F3OA 4C8NA 1RTIA 2KZMA 4MQ3A 3OJUA 1D9DA 2P5GA 3ZSWA 3KLIA 1LW0A 4O55A 4DFPA 3U3YA 3PO4A 4DSIA 4FK0A 2XY5A 1RT7A 1YTAA 4O5BA 3V1QA 4JS4A 1U48A 1D9FA 3RWUA 1VSMA 3DYAA 3AVFA 3PV8A 3HVRA 3HPOA 2E4LA 1TVRA 1VSDA 4IG0A 4OKKA 2EX3A 4CJ5A 4E7JA 3K2PA 4CJ3A 2PYLA 1S1UA 1G15A 1C6VA 1U04A 4JRPA 4HVJA 4M3XA 1NOYA 3V9UA 1IO2A 1JL2A 1EP4A 4FJ5A 4DU4A 4ID1A 4CK1A 2G8HA 3AVJA 3BDPA 4K8ZA 1QSYA 3RRHA 5FDLA 4CJ4A 3G0ZA 4O0IA 4Z0UA 3ZSOA 4CJVA 4E1MA 3SYZA 2D5RA 4DTNA 4ELTA 2NUBA 4Y1DA 4FLTA 2FC0A 1BIUA 1VSJA 1HNIA 3B6OA 4JLHA 1X9WA 4DSKA 1Z26A 4F2SA 3C6TA 2P1JA 2E6LA 4HCCA 4FYDA 4DS5A 4DLEA 3D45A 3NF9A 4E7HA 4OLAA 4HHTA 3V6DA 1C1BA 4BDYA 1HQEA 4CIGA 1GOAA 3DLRA 2QKKA 1XHZA 3V4IA 4CJLA 4QCLA 1WSHA 4OPJA 4CJEA 1BHLA 1IKWA 5SWMA 4DTJA 3HPHA 3OYGA 1BQMA 3K5LA 4ZHRA 3CFRA 3QNNA 3AVGA 3CM6A 2LSNA 3QERA 4M3YA 4Z4HA 3IAYA 1NKBA 4H4MA 3CQ8A 4HTUA 4B9NA 1JLFA 4IBNA 3VQ5A 2IDOA 4LSNA 4FZYA 1DTQA 4NYFA 3AO2A 4RW4A 3ZT0A 4FK4A 4R5PA 5K14A 3NH1A 3VQPA 1LAWA 3OS1A 4J2BA 1JXEA 4GMJB 4CIEA 2YV0X 1SV5A 1TAQA 4AHTA 2PZSA 3KLHA 1HMVA 1RTJA 2DFEA 3LDSA 1IKXA 1Z25A 3T19A 5C42A 1S9EA 3V1OA 4LSLA 4DF8A 3OYBA 1T03A 1ZBFA 2G8FA 2JLEA 1DLOA 1WAFA 1A5VA 1B9FA 1SKSA 4CCHA 3KLGA 3OYHA 3KD5E 3ZT1A 3G10A 4O0JA 3OY9A 3OS0A 3RR7A 4B9SA 1QSLA 4B08A 3EY1A 4B8CA 3U3GA 3AVBA 4CHOA 4AILC 1RTDA 4FJLA 4JS5A 1UA0A 2OPQA 2X78A 3AA3A 5KGWA 1ZBHA 3C95A 3OYDA 4FCYA 1WSGA 2R7YA 1W0HA 4ICLA 3TAEA 4DMNA 2DFHA 4KI4A 3L3UA 1LWEA 5HRSA 2YNGA 3PX4A 5FRMA 2E6MA 1X9SA 2DTUA 4BACA 4C8MA 2OPRA 1Y97A 1NK8A 3AA5X 2HHXA 4FJ9A 5J2QA 4HCBA 4KPYA 3L2VA 4BDZA 3DLKA 3LZIA 1F21A 3OYLA 4LH5A 1VSLA 3ZSVA 1DTTA 4CGGA 4M3ZA 2RF2A 4YNQA 1J5OA 3F9KA 2OPSA 3CM5A 1GOBA 4UQGA 1BCMA 3NF6A 3HT3A 4E7KA 3KJVA 1CXUA 2GBZA 1L3TA 5CYMA 2I5JA 4FJIA 3OYFA 3AO4A 4Z4FA 1MU2A 5KRTA 2XO7A 4CGJA 4H4OA 1BI4A 1RBTA 3SQ0A 3DLEA 3LP0A 1RT5A 1VRTA 1R0AA 1QE1A 3H08A 4CE9A 3HVTA 3EYZA 1HPZA 1QSSA 1U4BA 2YHAA 3LP3A 1TL1A 3HL8A 4CGIA 3TR8A 5KRSA 1VRUA 1NJYA 4AH9A
chains in the Genus database with same CATH superfamily
3F2KA 4NXNK 5J1EA 4OGEA 1C0MA 4CJ7A 3D6RA 4BR7A 3MCAB 4M3TA 2YHBA 5FRNA 3M6GA 1YTUA 4KAZA 3TI0A 4I2QA 4DR4K 3ID8A 2GUIA 2A1SA 4EP5A 2WC9A 3D0PA 5LJWA 1S6PA 5C10A 3HOSA 2D0PA 3ZSYA 3M1FA 1NK7A 1C0TA 4AHCA 5JVGL 3S3MA 5AZIA 2F4VK 1IBKK 3VEYA 3EEQA 4M3UA 3O4QA 3O9QA 3ALYA 2HMIA 3VF4A 3J80O 4DTOA 1HJRA 5GAHP 1RT6A 3BZKA 2O8DB 3CJCA 1TAUA 4KB0A 1MDUB 3CCUN 1Q7YO 4ZTJA 5AR0A 4IEIA 1BQNA 3EZWA 3OTOK 4EZ6A 1BIZA 3ENHA 3E9LA 3W3DA 2V7YA 1KAZA 2IOCA 4LY7A 1C0GA 4GNIA 4YOUA 1YJWN 5DM6L 3CCLN 3IDHA 1QVFM 1HYSA 1TKXA 1WNSA 5LMNK 3VQCA 4DQIA 1RTHA 2ZF5O 3VQ8A 1U47A 5AQZA 4KKOA 4KTWA 3DJCA 2AJQA 4NLBA 3NF8A 3QIPA 3ZETB 2BANA 3P1GA 4DWIA 2P9IB 5I42A 2F9TA 3NHGA 3AVMA 1WBBA 2QWOA 1Q81O 2KZZA 2G8UA 2ZE2A 2Q31A 4FJXA 2A1RA 2YNHA 3ZEUB 4JHDA 2OZSA 2QXLA 3VQ4A 3MX2A 4WQ4C 5KTQA 2VWJA 3L8BA 4B3TK 4M3RA 3SNNA 4NB4A 3RSEA 2ZJRL 4CJQA 2HHUA 4FSVA 4CJRA 4CJFA 4F2RA 4IKFA 1NK6A 2IVPA 5H1SQ 1DKGD 1BG3A 2ASOA 2CGLA 3TWHA 1NBWA 2UYTA 3PSFA 4H03B 3NGIA 3P39A 2KFZA 3K57A 3S41A 4CGHA 4LF5K 3F5TA 4GV9A 2NLXA 5GAEP 2OANA 1VHXA 4CZEA 1QTMA 3MAQA 1K9MO 1FJGK 1L3VA 2RPIA 2D0BA 5EXWA 1BGXT 4Z4GA 1N32K 4Y0WA 4BRDA 4B9VA 4FLYA 1EX4A 3MEEA 4PUOA 1NK9A 3B6PA 3CPWM 3C6AA 4E1JA 3HPGA 5AQQA 4B1WB 4BDPA 4NCAA 1GLEG 1TKDA 3DLLL 5ELZA 4E89A 3DLBA 1UWBA 3UKUB 1RDCA 4I6MB 4XIUA 5E26A 2NZTA 1XI1A 5AQOA 1IH7A 1ITGA 3TSPA 3CERA 1VQKN 1RFQA 2VG7A 4A5BA 4N41A 3JS6A 4BGAA 5J2PA 1QZ5A 4KBOA 4CZLA 1S1VA 2O8BB 4CF0A 1NK0A 2PAVA 3QEPA 2VG5A 1JL1A 1J53A 4MFBA 2KLAA 4NCGA 4W5OA 3SQ2A 2ATQA 4DS4A 3CPEA 1HYVA 1TK5A 2Q3SA 4J2AA 3R9PA 1I3AA 3IKMA 3VN5A 5HRRA 4KRFA 2Z1HA 2A41A 1VQLN 2O8CA 3ASMA 2E5LK 1N36K 1B9DA 1S6QA 1EQYA 1RDUA 3QEVA 1MA9B 3MX5A 4CZGA 5HROA 3AVHA 1O1WA 3R1XA 3VQEA 2WONA 3QIOA 4FWOA 3DM2A 3KK3A 2ZGZA 4CEFA 4FM1A 1C0UA 4LF9K 5FROA 3R6MA 5HL7L 5E41A 3SZ2A 1REVA 1S9GA 1LOTB 5MLCQ 1ZBUA 1OVYA 3LM2A 3NVKA 4FPBA 2E2QA 4CZIA 5JVHL 4CERA 2RN2A 4NXMK 4JNEA 3AA4A 4YOVA 1LCUA 2YJFA 2W42A 4E0DA 4FZZA 2ZGYA 3WQUA 2RHKA 4B1VA 1HX1A 1RBUA 5BR8K 3V9XA 3RRGA 1D8YA 5LL6Z 2G8IA 3H6EA 3HYFA 4BR4A 3C65A 3BUZB 1C1CA 4DTMA 1NK5A 4KHQA 4RW8A 3HM8A 3AGRA 2XRIA 5GAGP 4CF2A 3ZSZA 3ZSXA 2RE2A 3UKRB 2FBVA 4BVOA 2UU9K 1N8RO 3SUOA 4ZTFA 4IFVA 1YT3A 3KKSA 1BDGA 2J4RA 4B3OA 4BVPA 3C6HA 1HRHA 3SAGA 1ASUA 4ID5A 2NNWA 3VPZA 4FJJA 3LPTA 2A3ZA 1YJ9N 2BE2A 1S1TA 3DRPA 3KTQA 4Z4EA 2NRZA 4RCHA 2FBXA 3THYB 4DSJA 3WEEA 4H0YB 4PL8A 4DQRA 4DFMA 3UE5A 2E8AA 3L2RA 4ISGA 1OH7A 2BDPA 4B9QA 3ENBA 3FFIA 2F7TA 4FM0A 4KHPK 4TSXA 4CHPA 1TYQA 3VQ7A 3O9UA 5J2NA 2QW9A 3KVGA 3NH2A 3VERA 3AO1A 2HBJA 1YUWA 2YKNA 3AVKA 5BRFA 1SAZA 4JKDA 5C2FA 4E19A 2Y1JA 4IEEA 1K8AO 1VQPN 4C8NA 1U6ZA 3OJUA 1D9DA 2A5XA 3SBTA 3KLIA 4DSIA 2XY5A 1YTAA 3WXKA 4JS4A 1D9FA 3AVFA 4CZHA 1TVRA 4CJ3A 1S1UA 4IJNA 4M3XA 1NOYA 3V9UA 3MWTA 1JL2A 1EP4A 3CHWA 2G8HA 3K0SA 4BRCA 3RRHA 1BOTO 3QB0A 5TKWA 5CR4A 3VENA 3KK7A 4CJVA 3LDLA 5BRHA 4ELTA 4Y1DA 4FLTA 4FO0A 4HCCA 1Z26A 2E6LA 3TPQA 3MK6A 4O5FA 3V6DA 1GOAA 1XHZA 4QCLA 3ZX0A 1WSHA 4H0OA 3CJ7A 4YOXA 3K5LA 1BQMA 3QNNA 3CM6A 5AQVA 4Z4HA 5ADXA 3IAYA 1NKBA 4H4MA 3ULEA 1T3VA 5EOYA 2VYPA 2NRXA 4YDUC 2ASPA 4JN4A 5K14A 3NH1A 3FE1A 3OS1A 3FFKB 4GMJB 4CIEA 1RTJA 2DFEA 1Z25A 3T19A 2BTFA 1T03A 1DLOA 4A61A 3HTVA 3H1VX 1SKSA 3KLGA 3OYHA 1XC3A 4ILGB 3G10A 4O0JA 3CQXA 5FPEA 1QSLA 3TU5A 3AVBA 4CHOA 3E9OA 1G99A 2X78A 3OYDA 1W0HA 4B1YB 4DMNA 4R79A 2IVNA 4BACA 4C8MA 1Y97A 2QI2A 2W40A 3GOIA 5J2QA 4DUYK 4HCBA 1F21A 3LDQA 3OYLA 4CGGA 4H0VB 2OPSA 1Y64A 1WBDA 3CM5A 3HT3A 4WF9L 3VF6A 1GLCG 4DB3A 4FJIA 1SZ2A 3O6WA 4XH1A 2D4WA 4CGJA 1WB9A 3DLEA 4B1XB 1RT5A 4WFBL 3H08A 2YJEA 1QSSA 1NMNA 4JKEA 4B3RK 1HJOA 4IOAL 1TL1A 3HL8A 3DRSA 1A5VA 1NJYA 3BEXA 3VQDA 1KAXA 2Q2RA 2E2OA 2FBTA 1HNZK 1FXXA 1GLJO 1KLNA 1BCOA 4CZMA 2I7NA 4FXDA 4BRGA 4FJGA 4M41A 3K9KA 3F73A 5AQWA 3LPUA 5AQGA 3MWPA 4JI2K 3ZSQA 4LFBK 3C7NB 3AVLA 3V1RA 3M8SA 3QDKA 4KREA 4M3WA 4M45A 1VQ9N 1RCHA 3EO3A 2Z1IA 4FWQA 4BRHA 3MN5A 3RMAA 4JI8K 1BWFO 4J2EA 4MDBA 3JYTA 1Q9YA 3S3OA 4F4KA 1BU6O 2YCHA 4CJKA 4MDAA 5DM7L 3K58A 2AA4A 2HHHK 4JAXA 5AZJA 3A5MC 2CH6A 3MN7A 4BGBA 3C0BA 4JI7K 3MN9A 2HNDA 1XWLA 3OW2M 1J9AA 1KFDA 4OO1J 4KHUA 1N5YA 4AHUA 4KH5A 4BE2A 3OYIA 1NJXA 5F2RA 3WNEA 4DQQA 3THWA 1RT3A 5KGXA 3T1AA 3WQTA 3ITHA 3S9HA 1SL0A 4DKWA 2HHWA 1D4XA 1LAVA 4EHTA 1XNRK 1BUPA 2HSTA 3M8QA 3TAQA 2D0AA 4CFBA 4W5TA 4IZ9A 3HO1A 2QKBA 4DU3A 3IFRA 1ZBLA 4JD2B 3AGKA 3SI6A 3DAWA 3NH0A 4GY2B 4EHUA 1RBSA 3QINA 2P51A 3AA2A 4H5NA 5AQSA 1HNWK 1JLAA 4CJTA 1NKCA 4FW1A 3BP8A 1BL3A 3L3VA 5EU7A 3VEOA 4B1UB 3O3FA 4JI0K 3N4QA 4IOXA 1NGHA 2XY7A 1VSKA 4QAGA 4BROA 3OJSA 3PY8A 4G1QA 2GEMA 2E88A 3ZCMA 3O9RA 2DFFA 2P9KA 1NGIA 4FLWA 1VQ8N 2P5OA 2XY6A 4YHHK 2HBKA 4F3TA 1L3SA 1O13A 1TL3A 3G4SN 4CIFA 2Z1GA 4CEDA 4FVMA 5JLFA 4B9MA 4BR9A 1NOZA 2QEXN 1R59O 3CFOA 4IJAA 4CEQA 4JKAA 1OVQA 1RBVA 1IKYA 2BUPA 3DRRA 3KK2A 4QS9A 5M1FA 3WXMB 4CW7B 3CI5A 5JS1A 4X66K 3K5MA 4OPAA 3QNOA 4CF8A 4DSLA 4W5QA 2F8SA 3H45C 3NFAA 2P9PB 3L2WA 2O4GA 2VCPA 1S5JA 2WFBA 4M7YA 4E3SA 3J7AP 1HKBA 4CJPA 1LWCA 1XMOK 4BRNA 5C2DA 2H3GX 2ETJA 5DK5A 1JCEA 4C23A 1KVAA 3MXJA 4CI6A 3EZ5A 1QZ6A 4K43A 4FVUA 3SUNA 3QMLA 4QS8A 4PL7A 3TSUA 3QEXA 4E1NA 2YNIA 4LF7K 1XHXA 3VQ9A 4JRQA 2HBMA 3EN9A 4JKBA 4FLZA 4O8UA 4DR6K 3VQAA 1ZBIA 2HHTA 3LDPA 4MO5A 1W9HA 3LDNA 4FOIA 3D2FA 3V9WA 3LANA 2X74A 5A2QO 2CH5A 3DXKA 4DFJA 3OA9A 1X9MA 4I2PA 1IJJA 4FK2A 2XY8A 3D2EB 2W6LA 3THXA 4AHSA 1ASWA 3T3FA 4N56A 3NF7A 4WQ5A 1EXQA 4E7LA 4DTSA 4HWIA 4DTRA 1KAYA 4RW6A 1VQMN 3DXMA 3SPZA 3CD6N 1Q18A 4KHYA 1Z05A 3ZT3A 1S72N 4GVEA 4H5VA 1YVNA 3CCVN 4JK7A 4IFYA 3VQBA 5KQ8A 1NGBA 2QTDA 1J54A 1NK4A 5D3GA 5AFUH 1VSHA 4C1NI 3K59A 3H46O 4C8KA 1FW6A 4FJKA 4DV7K 3SPYA 3OYAA 3DOKA 3W0LA 3T7ZA 4OKJA 3JAMO 4AHRA 3DI6A 2UXCK 3SQ1A 2HHQA 4I9QA 4LH4A 1KLMA 4JI6K 3ATUA 4EP4A 3NMUA 1QQNA 1CXQA 1TV6A 1FKPA 2P9SB 4N76A 4CESA 1WN7A 1HQUA 3ZSRA 3IRXA 3LWMA 3OYNA 1U2VB 1WLJA 4FWNA 3RTVA 3OS2A 4CEOA 2V52B 3J8AA 4BWJA 5I9EB 4WYBA 3CJAA 3FLCO 2O8FB 2O8DA 4C8LA 4U67L 4MLHA 3TSQA 3GE1A 4CJSA 5JS2A 5AQJA 4FWPA 1XMQK 3U6FA 1E4GT 4CFCA 2G8WA 3G25A 3FZHA 3I33A 3OYKA 1X3NA 2JGUA 3AVCA 5M1NA 1N6QA 2HVHA 5HRPA 4L3QA 1B92A 4CEAA 4N47A 1A5WA 4Q5VA 3L2UA 4OVLA 3QEWA 1DGKN 4YOTA 3OHRA 4IO8A 1NM1A 4DV4K 4O55A 3PO4A 1U48A 3V1QA 4XH5A 3DYAA 3VTHA 4OPHA 4IG0A 3VF2A 1U04A 4JRPA 4HVJA 1KXPA 3GG4A 3ZETA 1Z6RA 3CCJN 3CCRN 2P9IA 4FJ5A 1OH5A 4CK1A 3AVJA 3BDPA 3EL2A 4K8ZA 2UUBK 5F0XA 4Z0UA 3ZSOA 2D5RA 4DTNA 2ZJQL 3Q7CA 3WT0A 2Q0UA 3ZEUA 3B6OA 4A59A 2P1JA 1RGIA 1GLFO 3O8MA 2FF3B 4K25A 3D45A 4WCEL 4FWSA 4HHTA 1HKGA 3DLRA 3U4LA 4CJLA 3G71N 1BHLA 3PLAA 3HPHA 3OYGA 4ZHRA 3AVGA 2NRHA 4M3YA 1VQ6N 4DV2K 1DEJA 4NYFA 3AO2A 4RW4A 4FK4A 4R5PA 4MLEA 4J2BA 1JXEA 1SV5A 4AHTA 3LDSA 1IKXA 1VQ4N 4NLCA 3BF3A 3OYBA 1ZBFA 2G8FA 2JLEA 1IV0A 4FWKA 3KD5E 3E9PA 4LF6K 2P9NB 5CE3A 3RR7A 3EY1A 4B8CA 4AILC 1RTDA 4FJLA 4JS5A 2Q97A 1UA0A 3A5NC 5KGWA 1WSGA 3RVCA 2YI1A 4ICLA 3UKUA 4I6MA 2F9WA 1NGJA 4F9OA 1OH8A 4CBWA 4KI4A 1LWEA 5HRSA 2DTUA 3L4QA 2E6MA 1HKCA 2OPRA 1NK8A 5BPLA 3CETA 4BDZA 3DLKA 2P9LB 4LH5A 1VSLA 2O8BA 2CGKA 4YNQA 1J5OA 1TUYA 1JCFA 1BCMA 3JXUA 4FOEA 2GBZA 3OYFA 2O8EB 5KRTA 4RWTA 4BRAA 4H4OA 4CZJA 1XUPO 1V4SA 3HVTA 1U4BA 2YHAA 4JK9A 5GADP 1E4FT 4CGIA 1X9SA 5M1PA 3T1YK 1C1AA 4PKIA 1W97L 2A40A 3OYCA 1K6YA 2HMPA 1SUQA 3IUCA 4JYAK 3WXLA 2Q36A 3U8XA 4PWDA 1QS4A 4W5NA 5GIOA 1T7PA 3S3NA 5JMVA 2HHVA 1T05A 4BC4A 3CIPA 3PX6A 4I9LA 1QHTA 1JLEA 2NRTA 1TGOA 4X65K 4DQSA 1RT2A 3L0QA 3P38A 1VK0A 4J2DA 3H1QA 3P5JA 5CY4A 1LWFA 2YNFA 3MXIA 3TTFA 3B8AX 1NGCA 4ISEA 2Q0RA 3P31A 4DUZK 3K5NA 4KFBA 1YIJN 2BGGA 2IGIA 3UKRA 3NGYA 2A6AA 4K41A 2Y1IA 3TABA 4JKHA 1KRPA 1RDDA 3ATVA 2E2PA 1M90O 4ELVA 4C8OA 5CZ2A 1X9JA 4BR0A 4KO0A 5IT9O 5AQXA 1WSEA 4H8KA 4CHQA 4YORA 3UB5A 1KVBA 2P9UB 3VEWA 3C94A 3SK3A 2IVOA 5KPZA 3V81A 3KIOA 3CQYA 3O4WA 1RDBA 1IG8A 1KSPA 1CZBA 3THYA 1HR0K 1T44A 1YJNN 2FBYA 3KKRA 3AVIA 3R3LA 3AVNA 1DT9A 1GLLO 2QXFA 3NAEA 2V7ZA 1IG9A 3SQ4A 3E66A 3BGRA 4IG3A 3MDQA 4B9UA 2O4IA 3L6QA 3SAHA 4LFCK 4B3SK 3L2QA 3CFPA 2ITGA 1C0FA 1IKVA 2GWJA 1RT1A 3NVMA 3VQQA 1XNQK 5AQRA 4FLVA 4K42A 2EHGA 3I8BA 5I3UA 1P90A 3VMFB 1Q86O 3O3GA 4JKGB 3HXMA 3MMVA 1MWMA 4OGCA 4CVNE 4CZKA 2QWLA 2V51B 5KI6A 2PBDA 4KI6A 3J7ZO 3ZT2A 4H0XB 4CBUA 3ENOA 3C6UA 4N5SA 1WUAA 4BE1A 3KHYA 4CD3A 1JJ2M 4BRPA 5HLFA 5KQDA 3HSTB 3MEGA 4CHNA 3ISNC 3HOTA 2JWKA 3I55N 3A2FA 3K5OA 4IFEA 1U45A 1N33K 4IDHA 4OJRA 3GDQA 2E1YA 4GKJK 3L4IA 3F9MA 3QESA 3A0IX 2GWKA 4BRMA 1W7AA 2B6AA 4IDKA 3AV9A 1HNVA 1UAXA 2GX9A 3VGLA 3SLCA 4ILHA 1NJWA 1ATSA 1XC9A 2A42A 3MECA 2HW3A 5HBMA 3K9JA 3LZJA 1YVUA 1L5UA 1BI4B 3PIPL 4W5RA 1RDAA 2GELA 3OYJA 4BREA 3SV3A 5HP1A 4L8RB 1NU0A 5AQLA 3ZT4A 1RILA 2F8TA 5FPMA 1JLCA 4DTUA 3LALA 1MWKA 1YITN 3AARA 3AAQA 5ADXH 3SCXA 4PA1A 2KHOA 4PKGA 3V9ZA 4ELUA 4RG8A 1RBRA 3O5BA 2FF6A 4Z94A 1VSFA 2HB5A 4CJUA 2ZM6K 2JWLA 3CMAN 5AQMA 1Q8IA 2E2NA 1VQ7N 3I56N 4B9LA 4FJ7A 3VTIA 3BZCA 5AZIB 5C15A 3DLGA 3SUPA 4GKKK 1VAZA 5C24A 4CEEA 1BA1A 2X6NA 4AHVA 4RW7A 4X64K 4LF8K 5GIPA 2IIRA 4B1ZA 1SL2A 5EVZA 4LD0A 2OZMA 3UIQA 3M8PA 5AJ3K 3A5OC 2QM1A 2KW4A 3WUHA 3LP1A 5LJVA 3I0RA 1JLQA 2X6SA 1A5XA 4CD1A 3O1BA 1KC8O 1JKHA 4DU1A 4FWMA 2UUCK 4BQZA 3HP9A 2ZJPL 4KV8A 4BR2A 4AM6A 2UUAK 4X62K 1TK8A 4XEIA 1OKJA 3CJ9A 4CJWA 3ULDA 1KVCA 1VSIA 1QQOA 3C7NA 4C1NK 4DR3K 4E7IA 1K8KA 1TKZA 1KFSA 4CGDA 3MEDA 4H5RA 2VG6A 5DMRA 5C25A 4DV0K 5FPDA 4Z4IA 2QKKA 2OA8A 4KH6A 2IS3A 3MXMA 2W41A 4EZ9A 2VGMA 2CGJA 3EE9A 1EETA 1RNHA 3MN6A 3DXMB 2NRWA 3QBWA 3O1WA 3QETA 3VEZA 3TAMA 4FWRA 2ZWHA 3CJBA 2UXDK 3E01A 4FJHA 5KPTA 1IBMK 1L3UA 3NE6A 4JHDB 2RKIA 4DSFA 4BE0A 5JLHA 4DFKA 4BWMA 4WQ4A 1S1WA 2NRVA 3RSEB 4CEBA 5AQFA 2FLOA 3M8RA 3HM9A 3PUFA 3N4PA 1RTIA 4MQ3A 2P5GA 4FK0A 4DV3K 3U3YA 1NJIO 3QFUA 3RWUA 4M7XA 1VSMA 3PV8A 2PYLA 4OKKA 4CJ5A 4JI4K 4E7JA 5GINA 1S3XA 4JD2A 3VETA 1KD1O 1YF5L 4DU4A 3H3NO 4DV6K 4WFAL 5TKYA 5FDLA 1BA0A 4E1MA 3P4IA 2FSKA 2FC0A 1BIUA 1HPMA 5BPNA 1HNIA 1X9WA 4JLHA 4DSKA 3M3ZA 5C0YA 4M63C 5AQUA 4DCHA 4DS5A 1X3MA 3GL1A 4CZFA 3NF9A 4E7HA 3A5LC 4OLAA 4DV5K 3FZLA 3CC4N 3Q7BA 1ESVA 1HQEA 4CIGA 1NGGA 3O08A 1Q82O 3WXJA 4OPJA 4YY3K 5AQTA 4DTJA 3CQ8A 4IWVA 3VQ5A 2VGNA 4IBNA 4PKHA 2IDOA 4EAHD 2FSJA 3O80A 1DTQA 1NGAA 3T1HK 2OTLN 1LAWA 5EY4A 2O8CB 1TAQA 3KLHA 1HMVA 2NRRA 5C42A 1S9EA 3V1OA 5AQIA 3J7YP 1ATRA 1ZC6A 1WAFA 4CCHA 3BY5A 3H3OB 3TTCA 3OS0A 2P9PA 3HI0A 3O9TA 1NG9A 3QBXA 2R7YA 4DR2K 3TAEA 1VQON 4BRQA 2DFHA 3L3UA 2YNGA 3PX4A 5FRMA 2DPNA 1BO5O 4CBXA 1NNEA 4BY9C 3VGMA 4LF4K 4KPYA 3LZIA 3ZYYX 3ZLJA 1DTTA 3TTDA 2YHWA 1VQNN 4BC3A 3NF6A 4E7KA 3KJVA 1CXUA 4Z4FA 4AQYK 3AO4A 1MU2A 5BREA 1R0AA 4IOCL 4CE9A 2QWPA 3EYZA 1HPZA 2HF3A 3LP3A 4IXCA 4A57A 5KRSA 1VRUA 4AH9A 1T6CA 4JV5K 2ITMA 3LAMA 4KTZA 4DQ8A 3AO5A 4OKEA 3QO9A 4DLGA 3OBYA 1QQMA 3CC2N 4CEZA 3OYMA 3WNFA 1QHAA 1SQKA 2PY5A 4I7FA 5KPRA 3HJFA 2FXUA 4FJNA 2G8VA 3ZX3A 3U9DA 5BPMA 3D2EA 4RTFD 4WQ5C 1EO1A 3KWGA 4JI1K 3WNGA 4CFDA 4HUEA 1FK9A 3OBWA 4KH4A 1NLVA 3CJ1A 2B5JA 3WEEB 2YHXA 2HOEA 1GOCA 4A2AA 1EKEA 1V4TA 4BG8A 1I94K 3FGUA 1YAGA 4DSEA 5CHIA 2QA4N 4UY8O 3NDKA 1ILYA 2GUPA 4CGFA 1TYQB 2GTDA 5JICA 1CLQA 2KQ2A 1WSIA 3IS9A 3QLHA 4QS7A 2YKMA 3CXCM 2IAJA 4HTLA 2KFNA 2Z1JA 4CF1A 3TANA 3PIOL 4FWLA 3O4NA 3SJJA 3QEIA 3CG7A 2P9SA 4HUGA 1NJZA 4DTPA 4BC2A 1U2VA 3P83D 3J81O 1YHQN 3RMBA 4KTQA 3KLEA 3VESA 2XHBA 2KKZA 3BF1A 3SBGA 2ZQBA 3DOLA 5M1QA 1CZ9A 4ILJA 3TAPA 2HHSA 2O8FA 2D1KA 3VQ6A 4NYNA 4LC9B 3SUQA 4WE1A 3SAFA 1H1VA 4RW9A 1WSJA 5CYQA 2B4JA 1NGFA 4BRKA 1NMDA 3QFPA 4G9ZA 1YXQA 3TARA 4FW2A 1I39A 4QOZB 4DQPA 3NGZA 1EWRA 3KK1A 1U49A 3MCPA 1ATNA 2Q1NA 2QWMA 1SL1A 5BN8A 4FJ8A 1T8EA 1HNXK 4FZXC 3FZKA 4DTXA 2VWBA 5AQNA 1SKWA 1LW2A 3AVAA 1JLGA 1GLDG 4DV1K 1RT4A 3AO3A 3ULEB 1FKOA 5EX5A 2WBNA 2D0OA 1X1PA 4YOYA 3R8EA 4YDUA 3SV4A 3SMSA 2HNZA 3U9ZA 4M42A 5HOOA 1E3MA 3ID6A 2WTUA 1KTQA 3V9SA 3WNHA 3EKUA 4A2BA 4DG1A 4GV6A 4JKCA 3NBPA 3CCQN 2IC3A 3DMJA 4F8RA 1RDWX 4PQUA 3HK2A 2I7PA 3LAKA 3T69A 1NGEA 1ZBSA 3E1YA 5AQYA 1JLBA 4CFAA 4BRFA 4U7BA 1S1XA 3RMDA 1UA1A 1TUUA 2UXBK 1SS6A 4A5AA 3I8DA 3DWLA 2E1ZA 1ZYQA 3IG1A 3I0SA 3LP2A 4KB1A 5M1KA 2YX6A 2WOMA 2E20A 1SKRA 5E84A 1IBLK 4PY5A 4Y1CA 3KD1E 4WFNL 4GW6A 4FL9A 4B9TA 3OYEA 2ASMA 4IO9L 5HRNA 4ISFA 3VGKA 4GV3A 3NCIA 2ZD1A 2GV9A 4BQLA 3PX0A 4K8XA 3OVNA 4BR5A 1K73O 4FLUA 2P9NA 5IWAK 4B8AB 4CK2A 2FSNA 1J5EK 2YHYA 1KCFA 3SJHA 3DLHA 4H0TB 3VEXA 2VQEK 4CHZA 4KHSA 4JEPA 2HNYA 3RR8A 1ZXOA 4OLBA 4BG9A 5CZ1A 5C12A 1NGDA 2P9LA 1WSFA 5SZTA 4CHYA 3THVA 4J8FA 2F96A 2KTQA 5BN9A 3CCSN 2OYQA 1TK0A 4NCBA 4B3MK 1VSEA 3PSIA 2O8EA 1JXBA 3FZFA 4CK3A 2PYJA 5AZJB 1NWKA 4FM2A 3VA0A 4JK8A 4FJMA 4YOWA 1S22A 2QWRA 1HYZA 5FLXO 1NKEA 3VA3A 2D0CA 3KLFA 3PO5A 4GVMA 3THWB 3FR0A 4OX9K 4O44A 3AY9A 3JSMA 3CYMA 3D7EO 4JI3K 4Z4CA 4KHNA 2HBLA 5T7BA 5BR9A 4DF4A 1GLBG 4CF9A 2OPPA 3TAGA 4FLXA 5J2MA 2QK9A 5BRDA 2HVIA 3LWLA 3GBTA 2G8KA 1HUXA 2W6KA 4OPKA 4A62A 4Q0BA 2PFUA 1UOCA 4O4GA 4KHWA 1VQ5N 1LV5A 4DHYA 3WXIA 2DY4A 3LL3A 1TKTA 4YFUA 1WAJA 1D5AA 5AQKA 1Q9XA 2VWKA 3HP6A 3M5RA 3O3HA 1QVGM 2WUSA 4EIAA 4HUFA 2P9KB 1QQCA 2QWQA 3G6EN 3TAFA 1ASVA 3RMCA 3LDOA 3A8YA 4H5TA 1BISA 3CMEN 4F3OA 2KZMA 5LY3A 3SMPA 3IMXA 3ZSWA 1LW0A 2BH1A 4DFPA 1RT7A 2P9UA 4O5BA 1K8KB 3CCEN 1OH6A 3HVRA 3HPOA 2E4LA 3LM9A 1VSDA 2EX3A 2OCEA 3K2PA 1G15A 1C6VA 4EFHA 4PHTX 1IO2A 4ID1A 1J6ZA 4H5WA 1JCGA 1QSYA 4CJ4A 4AF1A 3G0ZA 4O0IA 3SYZA 3KZBA 1W2BM 2NUBA 4AM7A 2QWNA 4XH4A 4BRIA 1VSJA 4F2SA 1WOQA 3C6TA 1KQSM 4FYDA 4DR5K 4JKFA 4DLEA 3HSCA 1HLUA 1C1BA 4BDYA 4LFAK 3V4IA 5B8HA 2EWSA 1EWQA 3HBTA 4JKGA 4CJEA 1N34K 1IKWA 5SWMA 3CFRA 5LMUK 2LSNA 3QERA 5FPNA 4FPAA 3CF5L 4HTUA 4B9NA 1JLFA 3HZ6A 1CZAN 4LSNA 4FZYA 3HRGA 3ZT0A 4DR1K 3VQPA 3CC7N 1XQSC 2VQFK 2YV0X 2PZSA 1T6DA 4NO7A 4LSLA 4DF8A 1M1KO 2AP1A 1B9FA 3ZT1A 3OY9A 4B9SA 4B08A 3QICA 3U3GA 4V19S 3D2FB 2OPQA 3O9SA 2OTJN 3AA3A 3KWIA 1ZBHA 3C95A 4FCYA 1YI2N 3DXKB 3VEVA 3EKSA 4DR7K 5F1XA 3AAPA 3AA5X 4H0PA 5AFUA 3THXB 4FJ9A 4K0KK 2HHXA 4O8KA 3L2VA 3CCMN 2HF4A 4M3ZA 3ZSVA 4MO4A 2RF2A 4JI5K 3VOVA 3F9KA 1GOBA 4UQGA 5AQPA 3FZMA 1L3TA 4BC5A 5CYMA 2I5JA 3ZX2A 3EE8A 2XO7A 1BI4A 1RBTA 3SQ0A 3LP0A 1VRTA 5M1OA 1QE1A 1GLAG 4BRLA 1P8ZA 5AQHA 3TR8A 4CECA
chains in the Genus database with same CATH topology
3LAMA 4KTZA 3VQDA 1C1AA 3AO5A 3QO9A 4OKEA 1C0MA 4OGEA 2FBTA 5J1EA 4DLGA 1FXXA 3OYCA 1K6YA 4CEZA 1KLNA 4M3TA 1BCOA 3OYMA 3WNFA 1SUQA 2YHBA 5FRNA 4FXDA 4FJGA 4M41A 3F73A 1YTUA 4KAZA 3TI0A 4PWDA 2PY5A 3LPUA 4I7FA 3HJFA 4I2QA 1QS4A 3ZSQA 3AVLA 4FJNA 2GUIA 4W5NA 2A1SA 3V1RA 3M8SA 1T7PA 4EP5A 2G8VA 3S3NA 3D0PA 1S6PA 4KREA 4M3WA 2HHVA 4M45A 1RCHA 1T05A 3ZSYA 3PX6A 2Z1IA 4I9LA 1NK7A 1QHTA 1JLEA 1C0TA 3RMAA 1TGOA 3WNGA 4J2EA 4AHCA 4CFDA 4HUEA 3S3MA 1FK9A 1RT2A 3JYTA 4DQSA 1Q9YA 3S3OA 4F4KA 1VK0A 4CJKA 2B5JA 4J2DA 4M3UA 3O4QA 1GOCA 3ALYA 2HMIA 3K58A 1EKEA 3P5JA 4DTOA 5CY4A 1LWFA 1HJRA 2YNFA 1RT6A 3MXIA 2HNDA 1TAUA 4KB0A 1XWLA 4DSEA 4ZTJA 1BQNA 1J9AA 1KFDA 3K5NA 3NDKA 4KFBA 4EZ6A 1BIZA 4KHUA 2BGGA 2IGIA 4CGFA 3NGYA 1N5YA 4AHUA 4BE2A 1CLQA 2IOCA 2KQ2A 2Y1IA 4LY7A 3TABA 1WSIA 3IS9A 3OYIA 1NJXA 1KRPA 1RDDA 3QLHA 3WNEA 4DQQA 4ELVA 1RT3A 4C8OA 2YKMA 5CZ2A 2IAJA 2KFNA 5KGXA 4KO0A 3T1AA 2Z1JA 1HYSA 1TKXA 1WNSA 3ITHA 4CF1A 3S9HA 3VQCA 1SL0A 2HHWA 1LAVA 1RTHA 1WSEA 4H8KA 3TANA 4CHQA 3VQ8A 4DQIA 1U47A 1KVBA 3M8QA 3TAQA 3O4NA 3SJJA 2D0AA 4KKOA 4KTWA 4CFBA 4W5TA 3C94A 3CG7A 3QEIA 3HO1A 3V81A 2QKBA 4DU3A 3KIOA 2AJQA 4HUGA 1RDBA 1ZBLA 3NF8A 1NJZA 4DTPA 1KSPA 3QIPA 1CZBA 2BANA 3P1GA 3P83D 3RMBA 3SI6A 4DWIA 5I42A 3NH0A 3NHGA 4KTQA 3AVMA 1RBSA 3QINA 2P51A 3AA2A 3KLEA 2FBYA 3KKRA 2XHBA 1JLAA 4CJTA 2KZZA 3AVIA 1NKCA 3AVNA 2ZQBA 2G8UA 3DOLA 2QXFA 1CZ9A 4FW1A 3NAEA 3TAPA 2ZE2A 2HHSA 1BL3A 3L3VA 1IG9A 3VQ6A 3SQ4A 4NYNA 3SUQA 4WE1A 4FJXA 4RW9A 2YNHA 3BGRA 2A1RA 4IG3A 1WSJA 5CYQA 5EU7A 2B4JA 4B9UA 2O4IA 3O3FA 2OZSA 2XY7A 3VQ4A 1VSKA 4QAGA 3L2QA 3OJSA 3CFPA 2ITGA 5KTQA 2VWJA 3PY8A 4G1QA 1IKVA 3L8BA 3TARA 4FW2A 1I39A 4M3RA 3ZCMA 3SNNA 4QOZB 4DQPA 3NGZA 3KK1A 1RT1A 2DFFA 1U49A 4FLWA 2P5OA 3VQQA 2XY6A 4CJQA 4FLVA 1SL1A 2HHUA 2EHGA 4CJRA 4CJFA 5I3UA 1T8EA 4FJ8A 4FZXC 4F2RA 4F3TA 4IKFA 1NK6A 3O3GA 3HXMA 4DTXA 1L3SA 4OGCA 1SKWA 1LW2A 3AVAA 1JLGA 1TL3A 3TWHA 1RT4A 3AO3A 4CIFA 2Z1GA 4N76A 5KI6A 4CEDA 4FVMA 4B9MA 1FKOA 1NOZA 4KI6A 3NGIA 3ZT2A 2KFZA 3K57A 1X1PA 4CGHA 3CFOA 3C6UA 4CEQA 4N5SA 3SV4A 1QTMA 3MAQA 1RBVA 1L3VA 1IKYA 2HNZA 2RPIA 3DRRA 4BE1A 2D0BA 4M42A 3KK2A 1BGXT 4Z4GA 1KTQA 3V9SA 4B9VA 3WNHA 4FLYA 4DG1A 1EX4A 3MEEA 5HLFA 4PUOA 1NK9A 5JS1A 3NBPA 3K5MA 2IC3A 3B6PA 3DMJA 3HSTB 3QNOA 4F8RA 4PQUA 3MEGA 4CF8A 4CHNA 4DSLA 3LAKA 4W5QA 3ISNC 3HK2A 2F8SA 3HPGA 4BDPA 1JLBA 3NFAA 4CFAA 4NCAA 1S1XA 3RMDA 3A2FA 3K5OA 3L2WA 1UA1A 1U45A 1TKDA 2O4GA 1S5JA 4OJRA 4E3SA 3DLBA 4E89A 1UWBA 4XIUA 1RDCA 3I8DA 1XI1A 4CJPA 3QESA 1IH7A 1ITGA 1LWCA 2B6AA 1ZYQA 4IDKA 2VG7A 3AV9A 3IG1A 3I0SA 3LP2A 1HNVA 1UAXA 2ETJA 5DK5A 4KB1A 4N41A 2WOMA 5J2PA 1S1VA 1KVAA 4CF0A 1SKRA 1NK0A 3MXJA 3QEPA 1NJWA 4PY5A 2VG5A 1JL1A 1J53A 4MFBA 4NCGA 4W5OA 3EZ5A 1XC9A 3SQ2A 3MECA 4Y1CA 3KD1E 2ATQA 2HW3A 4GW6A 4DS4A 3SUNA 1HYVA 1TK5A 5HBMA 2Q3SA 3LZJA 3QEXA 4J2AA 1YVUA 1L5UA 4B9TA 1BI4B 1I3AA 4W5RA 3VN5A 1RDAA 5HRRA 2Z1HA 2YNIA 4E1NA 3OYEA 4KRFA 3OYJA 3SV3A 3ASMA 5HP1A 5HRNA 1XHXA 4L8RB 3VQ9A 4JRQA 3ZT4A 1B9DA 3NCIA 4FLZA 1S6QA 3VQAA 2ZD1A 1RILA 2F8TA 2GV9A 3PX0A 1ZBIA 3QEVA 2HHTA 4K8XA 3OVNA 1JLCA 1W9HA 4DTUA 3LALA 4FLUA 5HROA 3AVHA 1O1WA 3VQEA 2WONA 3QIOA 3DM2A 4B8AB 3V9WA 3KK3A 3SCXA 4CK2A 4CEFA 3LANA 4PA1A 2X74A 4FM1A 3V9ZA 1C0UA 4ELUA 4RG8A 1RBRA 5FROA 1KCFA 5E41A 3SZ2A 3DLHA 1REVA 1S9GA 1VSFA 4DFJA 2HB5A 1ZBUA 4CHZA 1X9MA 4CJUA 4KHSA 2QK9A 2HNYA 3RR8A 4I2PA 4OLBA 1Q8IA 4CERA 2XY8A 4FK2A 2RN2A 5CZ1A 4AHSA 3AA4A 1ASWA 3T3FA 4B9LA 4N56A 2W42A 1WSFA 5SZTA 4FJ7A 4CHYA 3THVA 3NF7A 4E0DA 4FZZA 2F96A 2KTQA 1EXQA 1RBUA 3DLGA 4E7LA 3SUPA 1TK0A 3V9XA 3RRGA 2OYQA 5C24A 4DTSA 4CEEA 2X6NA 1D8YA 4NCBA 1VSEA 4AHVA 4DTRA 4RW6A 2G8IA 3SPZA 4RW7A 3HYFA 4KHYA 1JXBA 3ZT3A 4CK3A 1SL2A 2PYJA 1C1CA 4LD0A 4IFYA 3VQBA 2OZMA 3UIQA 3M8PA 2KW4A 4FM2A 3VA0A 3LP1A 3I0RA 4DTMA 1NK5A 4KHQA 1JLQA 4FJMA 1J54A 4RW8A 1NK4A 5D3GA 2X6SA 1VSHA 1A5XA 2XRIA 4CF2A 3ZSZA 3ZSXA 3K59A 1JKHA 4DU1A 2FBVA 4C8KA 1HYZA 1NKEA 3VA3A 3HP9A 3SUOA 4ZTFA 4FJKA 2D0CA 3KLFA 3SPYA 3PO5A 4KV8A 4IFVA 3OYAA 3DOKA 1YT3A 3KKSA 4GVMA 1TK8A 4CJWA 3ULDA 4B3OA 1KVCA 1VSIA 1HRHA 4OKJA 1ASUA 4AHRA 4O44A 3DI6A 2HHQA 3SQ1A 3JSMA 4E7IA 3CYMA 4ID5A 1TKZA 1KFSA 4CGDA 3MEDA 4Z4CA 4LH4A 4I9QA 4KHNA 4FJJA 1KLMA 3LPTA 5T7BA 4EP4A 4DF4A 4CECA 2VG6A 1TV6A 1CXQA 5DMRA 4CF9A 5C25A 4Z4IA 2OPPA 1FKPA 1S1TA 2BE2A 4CESA 4FLXA 5J2MA 3TAGA 3DRPA 1WN7A 1HQUA 2OA8A 3ZSRA 3KTQA 4Z4EA 3IRXA 3LWLA 3LWMA 2G8KA 3OYNA 2IS3A 3MXMA 2HVIA 2FBXA 1WLJA 4DSJA 3RTVA 3DRSA 4EZ9A 4OPKA 3OS2A 4CEOA 4Q0BA 1UOCA 4O4GA 1EETA 4BWJA 1RNHA 4KHWA 4DQRA 4DFMA 1LV5A 3QETA 4C8LA 3L2RA 3TAMA 4CJSA 5JS2A 3E01A 2BDPA 4FJHA 1L3UA 3NE6A 2DY4A 3FFIA 1TKTA 4YFUA 2RKIA 4FM0A 1WAJA 4TSXA 1D5AA 3VQ7A 4CHPA 3U6FA 4DSFA 5J2NA 4BE0A 1Q9XA 4DFKA 2VWKA 4CFCA 3NH2A 3O3HA 3HP6A 3AO1A 4BWMA 3OYKA 2G8WA 2JGUA 2YKNA 3AVCA 3AVKA 1S1WA 4HUFA 1QQCA 4CEBA 1N6QA 2HVHA 5HRPA 3TAFA 1ASVA 1B92A 4E19A 2Y1JA 3M8RA 4CEAA 3RMCA 3HM9A 3PUFA 4N47A 1BISA 1A5WA 4Q5VA 3L2UA 4OVLA 3QEWA 4F3OA 4C8NA 1RTIA 2KZMA 4MQ3A 3OJUA 1D9DA 2P5GA 3ZSWA 3KLIA 1LW0A 4O55A 4DFPA 3U3YA 3PO4A 4DSIA 4FK0A 2XY5A 1RT7A 1YTAA 4O5BA 3V1QA 4JS4A 1U48A 1D9FA 3RWUA 1VSMA 3DYAA 3AVFA 3PV8A 3HVRA 3HPOA 2E4LA 1TVRA 1VSDA 4IG0A 4OKKA 2EX3A 4CJ5A 4E7JA 3K2PA 4CJ3A 2PYLA 1S1UA 1G15A 1C6VA 1U04A 4JRPA 4HVJA 4M3XA 1NOYA 3V9UA 1IO2A 1JL2A 1EP4A 4FJ5A 4DU4A 4ID1A 4CK1A 2G8HA 3AVJA 3BDPA 4K8ZA 1QSYA 3RRHA 5FDLA 4CJ4A 3G0ZA 4O0IA 4Z0UA 3ZSOA 4CJVA 4E1MA 3SYZA 2D5RA 4DTNA 4ELTA 2NUBA 4Y1DA 4FLTA 2FC0A 1BIUA 1VSJA 1HNIA 3B6OA 4JLHA 1X9WA 4DSKA 1Z26A 4F2SA 3C6TA 2P1JA 2E6LA 4HCCA 4FYDA 4DS5A 4DLEA 3D45A 3NF9A 4E7HA 4OLAA 4HHTA 3V6DA 1C1BA 4BDYA 1HQEA 4CIGA 1GOAA 3DLRA 2QKKA 1XHZA 3V4IA 4CJLA 4QCLA 1WSHA 4OPJA 4CJEA 1BHLA 1IKWA 5SWMA 4DTJA 3HPHA 3OYGA 1BQMA 3K5LA 4ZHRA 3CFRA 3QNNA 3AVGA 3CM6A 2LSNA 3QERA 4M3YA 4Z4HA 3IAYA 1NKBA 4H4MA 3CQ8A 4HTUA 4B9NA 1JLFA 4IBNA 3VQ5A 2IDOA 4LSNA 4FZYA 1DTQA 4NYFA 3AO2A 4RW4A 3ZT0A 4FK4A 4R5PA 5K14A 3NH1A 3VQPA 1LAWA 3OS1A 4J2BA 1JXEA 4GMJB 4CIEA 2YV0X 1SV5A 1TAQA 4AHTA 2PZSA 3KLHA 1HMVA 1RTJA 2DFEA 3LDSA 1IKXA 1Z25A 3T19A 5C42A 1S9EA 3V1OA 4LSLA 4DF8A 3OYBA 1T03A 1ZBFA 2G8FA 2JLEA 1DLOA 1WAFA 1A5VA 1B9FA 1SKSA 4CCHA 3KLGA 3OYHA 3KD5E 3ZT1A 3G10A 4O0JA 3OY9A 3OS0A 3RR7A 4B9SA 1QSLA 4B08A 3EY1A 4B8CA 3U3GA 3AVBA 4CHOA 4AILC 1RTDA 4FJLA 4JS5A 1UA0A 2OPQA 2X78A 3AA3A 5KGWA 1ZBHA 3C95A 3OYDA 4FCYA 1WSGA 2R7YA 1W0HA 4ICLA 3TAEA 4DMNA 2DFHA 4KI4A 3L3UA 1LWEA 5HRSA 2YNGA 3PX4A 5FRMA 2E6MA 1X9SA 2DTUA 4BACA 4C8MA 2OPRA 1Y97A 1NK8A 3AA5X 2HHXA 4FJ9A 5J2QA 4HCBA 4KPYA 3L2VA 4BDZA 3DLKA 3LZIA 1F21A 3OYLA 4LH5A 1VSLA 3ZSVA 1DTTA 4CGGA 4M3ZA 2RF2A 4YNQA 1J5OA 3F9KA 2OPSA 3CM5A 1GOBA 4UQGA 1BCMA 3NF6A 3HT3A 4E7KA 3KJVA 1CXUA 2GBZA 1L3TA 5CYMA 2I5JA 4FJIA 3OYFA 3AO4A 4Z4FA 1MU2A 5KRTA 2XO7A 4CGJA 4H4OA 1BI4A 1RBTA 3SQ0A 3DLEA 3LP0A 1RT5A 1VRTA 1R0AA 1QE1A 3H08A 4CE9A 3HVTA 3EYZA 1HPZA 1QSSA 1U4BA 2YHAA 3LP3A 1TL1A 3HL8A 4CGIA 3TR8A 5KRSA 1VRUA 1NJYA 4AH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LAM A;  4KTZ A;  3VQD A;  1C1A A;  3AO5 A;  3QO9 A;  4OKE A;  1C0M A;  4OGE A;  2FBT A;  5J1E A;  4DLG A;  1FXX A;  3OYC A;  1K6Y A;  4CEZ A;  1KLN A;  4M3T A;  1BCO A;  3OYM A;  3WNF A;  1SUQ A;  2YHB A;  5FRN A;  4FXD A;  4FJG A;  4M41 A;  3F73 A;  1YTU A;  4KAZ A;  3TI0 A;  4PWD A;  2PY5 A;  3LPU A;  4I7F A;  3HJF A;  4I2Q A;  1QS4 A;  3ZSQ A;  3AVL A;  4FJN A;  2GUI A;  4W5N A;  2A1S A;  3V1R A;  3M8S A;  1T7P A;  4EP5 A;  2G8V A;  3S3N A;  3D0P A;  1S6P A;  4KRE A;  4M3W A;  2HHV A;  4M45 A;  1RCH A;  1T05 A;  3ZSY A;  3PX6 A;  2Z1I A;  4I9L A;  1NK7 A;  1QHT A;  1JLE A;  1C0T A;  3RMA A;  1TGO A;  3WNG A;  4J2E A;  4AHC A;  4CFD A;  4HUE A;  3S3M A;  1FK9 A;  1RT2 A;  3JYT A;  4DQS A;  1Q9Y A;  3S3O A;  4F4K A;  1VK0 A;  4CJK A;  2B5J A;  4J2D A;  4M3U A;  3O4Q A;  1GOC A;  3ALY A;  2HMI A;  3K58 A;  1EKE A;  3P5J A;  4DTO A;  5CY4 A;  1LWF A;  1HJR A;  2YNF A;  1RT6 A;  3MXI A;  2HND A;  1TAU A;  4KB0 A;  1XWL A;  4DSE A;  4ZTJ A;  1BQN A;  1J9A A;  1KFD A;  3K5N A;  3NDK A;  4KFB A;  4EZ6 A;  1BIZ A;  4KHU A;  2BGG A;  2IGI A;  4CGF A;  3NGY A;  1N5Y A;  4AHU A;  4BE2 A;  1CLQ A;  2IOC A;  2KQ2 A;  2Y1I A;  4LY7 A;  3TAB A;  1WSI A;  3IS9 A;  3OYI A;  1NJX A;  1KRP A;  1RDD A;  3QLH A;  3WNE A;  4DQQ A;  4ELV A;  1RT3 A;  4C8O A;  2YKM A;  5CZ2 A;  2IAJ A;  2KFN A;  5KGX A;  4KO0 A;  3T1A A;  2Z1J A;  1HYS A;  1TKX A;  1WNS A;  3ITH A;  4CF1 A;  3S9H A;  3VQC A;  1SL0 A;  2HHW A;  1LAV A;  1RTH A;  1WSE A;  4H8K A;  3TAN A;  4CHQ A;  3VQ8 A;  4DQI A;  1U47 A;  1KVB A;  3M8Q A;  3TAQ A;  3O4N A;  3SJJ A;  2D0A A;  4KKO A;  4KTW A;  4CFB A;  4W5T A;  3C94 A;  3CG7 A;  3QEI A;  3HO1 A;  3V81 A;  2QKB A;  4DU3 A;  3KIO A;  2AJQ A;  4HUG A;  1RDB A;  1ZBL A;  3NF8 A;  1NJZ A;  4DTP A;  1KSP A;  3QIP A;  1CZB A;  2BAN A;  3P1G A;  3P83 D;  3RMB A;  3SI6 A;  4DWI A;  5I42 A;  3NH0 A;  3NHG A;  4KTQ A;  3AVM A;  1RBS A;  3QIN A;  2P51 A;  3AA2 A;  3KLE A;  2FBY A;  3KKR A;  2XHB A;  1JLA A;  4CJT A;  2KZZ A;  3AVI A;  1NKC A;  3AVN A;  2ZQB A;  2G8U A;  3DOL A;  2QXF A;  1CZ9 A;  4FW1 A;  3NAE A;  3TAP A;  2ZE2 A;  2HHS A;  1BL3 A;  3L3V A;  1IG9 A;  3VQ6 A;  3SQ4 A;  4NYN A;  3SUQ A;  4WE1 A;  4FJX A;  4RW9 A;  2YNH A;  3BGR A;  2A1R A;  4IG3 A;  1WSJ A;  5CYQ A;  5EU7 A;  2B4J A;  4B9U A;  2O4I A;  3O3F A;  2OZS A;  2XY7 A;  3VQ4 A;  1VSK A;  4QAG A;  3L2Q A;  3OJS A;  3CFP A;  2ITG A;  5KTQ A;  2VWJ A;  3PY8 A;  4G1Q A;  1IKV A;  3L8B A;  3TAR A;  4FW2 A;  1I39 A;  4M3R A;  3ZCM A;  3SNN A;  4QOZ B;  4DQP A;  3NGZ A;  3KK1 A;  1RT1 A;  2DFF A;  1U49 A;  4FLW A;  2P5O A;  3VQQ A;  2XY6 A;  4CJQ A;  4FLV A;  1SL1 A;  2HHU A;  2EHG A;  4CJR A;  4CJF A;  5I3U A;  1T8E A;  4FJ8 A;  4FZX C;  4F2R A;  4F3T A;  4IKF A;  1NK6 A;  3O3G A;  3HXM A;  4DTX A;  1L3S A;  4OGC A;  1SKW A;  1LW2 A;  3AVA A;  1JLG A;  1TL3 A;  3TWH A;  1RT4 A;  3AO3 A;  4CIF A;  2Z1G A;  4N76 A;  5KI6 A;  4CED A;  4FVM A;  4B9M A;  1FKO A;  1NOZ A;  4KI6 A;  3NGI A;  3ZT2 A;  2KFZ A;  3K57 A;  1X1P A;  4CGH A;  3CFO A;  3C6U A;  4CEQ A;  4N5S A;  3SV4 A;  1QTM A;  3MAQ A;  1RBV A;  1L3V A;  1IKY A;  2HNZ A;  2RPI A;  3DRR A;  4BE1 A;  2D0B A;  4M42 A;  3KK2 A;  1BGX T;  4Z4G A;  1KTQ A;  3V9S A;  4B9V A;  3WNH A;  4FLY A;  4DG1 A;  1EX4 A;  3MEE A;  5HLF A;  4PUO A;  1NK9 A;  5JS1 A;  3NBP A;  3K5M A;  2IC3 A;  3B6P A;  3DMJ A;  3HST B;  3QNO A;  4F8R A;  4PQU A;  3MEG A;  4CF8 A;  4CHN A;  4DSL A;  3LAK A;  4W5Q A;  3ISN C;  3HK2 A;  2F8S A;  3HPG A;  4BDP A;  1JLB A;  3NFA A;  4CFA A;  4NCA A;  1S1X A;  3RMD A;  3A2F A;  3K5O A;  3L2W A;  1UA1 A;  1U45 A;  1TKD A;  2O4G A;  1S5J A;  4OJR A;  4E3S A;  3DLB A;  4E89 A;  1UWB A;  4XIU A;  1RDC A;  3I8D A;  1XI1 A;  4CJP A;  3QES A;  1IH7 A;  1ITG A;  1LWC A;  2B6A A;  1ZYQ A;  4IDK A;  2VG7 A;  3AV9 A;  3IG1 A;  3I0S A;  3LP2 A;  1HNV A;  1UAX A;  2ETJ A;  5DK5 A;  4KB1 A;  4N41 A;  2WOM A;  5J2P A;  1S1V A;  1KVA A;  4CF0 A;  1SKR A;  1NK0 A;  3MXJ A;  3QEP A;  1NJW A;  4PY5 A;  2VG5 A;  1JL1 A;  1J53 A;  4MFB A;  4NCG A;  4W5O A;  3EZ5 A;  1XC9 A;  3SQ2 A;  3MEC A;  4Y1C A;  3KD1 E;  2ATQ A;  2HW3 A;  4GW6 A;  4DS4 A;  3SUN A;  1HYV A;  1TK5 A;  5HBM A;  2Q3S A;  3LZJ A;  3QEX A;  4J2A A;  1YVU A;  1L5U A;  4B9T A;  1BI4 B;  1I3A A;  4W5R A;  3VN5 A;  1RDA A;  5HRR A;  2Z1H A;  2YNI A;  4E1N A;  3OYE A;  4KRF A;  3OYJ A;  3SV3 A;  3ASM A;  5HP1 A;  5HRN A;  1XHX A;  4L8R B;  3VQ9 A;  4JRQ A;  3ZT4 A;  1B9D A;  3NCI A;  4FLZ A;  1S6Q A;  3VQA A;  2ZD1 A;  1RIL A;  2F8T A;  2GV9 A;  3PX0 A;  1ZBI A;  3QEV A;  2HHT A;  4K8X A;  3OVN A;  1JLC A;  1W9H A;  4DTU A;  3LAL A;  4FLU A;  5HRO A;  3AVH A;  1O1W A;  3VQE A;  2WON A;  3QIO A;  3DM2 A;  4B8A B;  3V9W A;  3KK3 A;  3SCX A;  4CK2 A;  4CEF A;  3LAN A;  4PA1 A;  2X74 A;  4FM1 A;  3V9Z A;  1C0U A;  4ELU A;  4RG8 A;  1RBR A;  5FRO A;  1KCF A;  5E41 A;  3SZ2 A;  3DLH A;  1REV A;  1S9G A;  1VSF A;  4DFJ A;  2HB5 A;  1ZBU A;  4CHZ A;  1X9M A;  4CJU A;  4KHS A;  2QK9 A;  2HNY A;  3RR8 A;  4I2P A;  4OLB A;  1Q8I A;  4CER A;  2XY8 A;  4FK2 A;  2RN2 A;  5CZ1 A;  4AHS A;  3AA4 A;  1ASW A;  3T3F A;  4B9L A;  4N56 A;  2W42 A;  1WSF A;  5SZT A;  4FJ7 A;  4CHY A;  3THV A;  3NF7 A;  4E0D A;  4FZZ A;  2F96 A;  2KTQ A;  1EXQ A;  1RBU A;  3DLG A;  4E7L A;  3SUP A;  1TK0 A;  3V9X A;  3RRG A;  2OYQ A;  5C24 A;  4DTS A;  4CEE A;  2X6N A;  1D8Y A;  4NCB A;  1VSE A;  4AHV A;  4DTR A;  4RW6 A;  2G8I A;  3SPZ A;  4RW7 A;  3HYF A;  4KHY A;  1JXB A;  3ZT3 A;  4CK3 A;  1SL2 A;  2PYJ A;  1C1C A;  4LD0 A;  4IFY A;  3VQB A;  2OZM A;  3UIQ A;  3M8P A;  2KW4 A;  4FM2 A;  3VA0 A;  3LP1 A;  3I0R A;  4DTM A;  1NK5 A;  4KHQ A;  1JLQ A;  4FJM A;  1J54 A;  4RW8 A;  1NK4 A;  5D3G A;  2X6S A;  1VSH A;  1A5X A;  2XRI A;  4CF2 A;  3ZSZ A;  3ZSX A;  3K59 A;  1JKH A;  4DU1 A;  2FBV A;  4C8K A;  1HYZ A;  1NKE A;  3VA3 A;  3HP9 A;  3SUO A;  4ZTF A;  4FJK A;  2D0C A;  3KLF A;  3SPY A;  3PO5 A;  4KV8 A;  4IFV A;  3OYA A;  3DOK A;  1YT3 A;  3KKS A;  4GVM A;  1TK8 A;  4CJW A;  3ULD A;  4B3O A;  1KVC A;  1VSI A;  1HRH A;  4OKJ A;  1ASU A;  4AHR A;  4O44 A;  3DI6 A;  2HHQ A;  3SQ1 A;  3JSM A;  4E7I A;  3CYM A;  4ID5 A;  1TKZ A;  1KFS A;  4CGD A;  3MED A;  4Z4C A;  4LH4 A;  4I9Q A;  4KHN A;  4FJJ A;  1KLM A;  3LPT A;  5T7B A;  4EP4 A;  4DF4 A;  4CEC A;  2VG6 A;  1TV6 A;  1CXQ A;  5DMR A;  4CF9 A;  5C25 A;  4Z4I A;  2OPP A;  1FKP A;  1S1T A;  2BE2 A;  4CES A;  4FLX A;  5J2M A;  3TAG A;  3DRP A;  1WN7 A;  1HQU A;  2OA8 A;  3ZSR A;  3KTQ A;  4Z4E A;  3IRX A;  3LWL A;  3LWM A;  2G8K A;  3OYN A;  2IS3 A;  3MXM A;  2HVI A;  2FBX A;  1WLJ A;  4DSJ A;  3RTV A;  3DRS A;  4EZ9 A;  4OPK A;  3OS2 A;  4CEO A;  4Q0B A;  1UOC A;  4O4G A;  1EET A;  4BWJ A;  1RNH A;  4KHW A;  4DQR A;  4DFM A;  1LV5 A;  3QET A;  4C8L A;  3L2R A;  3TAM A;  4CJS A;  5JS2 A;  3E01 A;  2BDP A;  4FJH A;  1L3U A;  3NE6 A;  2DY4 A;  3FFI A;  1TKT A;  4YFU A;  2RKI A;  4FM0 A;  1WAJ A;  4TSX A;  1D5A A;  3VQ7 A;  4CHP A;  3U6F A;  4DSF A;  5J2N A;  4BE0 A;  1Q9X A;  4DFK A;  2VWK A;  4CFC A;  3NH2 A;  3O3H A;  3HP6 A;  3AO1 A;  4BWM A;  3OYK A;  2G8W A;  2JGU A;  2YKN A;  3AVC A;  3AVK A;  1S1W A;  4HUF A;  1QQC A;  4CEB A;  1N6Q A;  2HVH A;  5HRP A;  3TAF A;  1ASV A;  1B92 A;  4E19 A;  2Y1J A;  3M8R A;  4CEA A;  3RMC A;  3HM9 A;  3PUF A;  4N47 A;  1BIS A;  1A5W A;  4Q5V A;  3L2U A;  4OVL A;  3QEW A;  4F3O A;  4C8N A;  1RTI A;  2KZM A;  4MQ3 A;  3OJU A;  1D9D A;  2P5G A;  3ZSW A;  3KLI A;  1LW0 A;  4O55 A;  4DFP A;  3U3Y A;  3PO4 A;  4DSI A;  4FK0 A;  2XY5 A;  1RT7 A;  1YTA A;  4O5B A;  3V1Q A;  4JS4 A;  1U48 A;  1D9F A;  3RWU A;  1VSM A;  3DYA A;  3AVF A;  3PV8 A;  3HVR A;  3HPO A;  2E4L A;  1TVR A;  1VSD A;  4IG0 A;  4OKK A;  2EX3 A;  4CJ5 A;  4E7J A;  3K2P A;  4CJ3 A;  2PYL A;  1S1U A;  1G15 A;  1C6V A;  1U04 A;  4JRP A;  4HVJ A;  4M3X A;  1NOY A;  3V9U A;  1IO2 A;  1JL2 A;  1EP4 A;  4FJ5 A;  4DU4 A;  4ID1 A;  4CK1 A;  2G8H A;  3AVJ A;  3BDP A;  4K8Z A;  1QSY A;  3RRH A;  5FDL A;  4CJ4 A;  3G0Z A;  4O0I A;  4Z0U A;  3ZSO A;  4CJV A;  4E1M A;  3SYZ A;  2D5R A;  4DTN A;  4ELT A;  2NUB A;  4Y1D A;  4FLT A;  2FC0 A;  1BIU A;  1VSJ A;  1HNI A;  3B6O A;  4JLH A;  1X9W A;  4DSK A;  1Z26 A;  4F2S A;  3C6T A;  2P1J A;  2E6L A;  4HCC A;  4FYD A;  4DS5 A;  4DLE A;  3D45 A;  3NF9 A;  4E7H A;  4OLA A;  4HHT A;  3V6D A;  1C1B A;  4BDY A;  1HQE A;  4CIG A;  1GOA A;  3DLR A;  2QKK A;  1XHZ A;  3V4I A;  4CJL A;  4QCL A;  1WSH A;  4OPJ A;  4CJE A;  1BHL A;  1IKW A;  5SWM A;  4DTJ A;  3HPH A;  3OYG A;  1BQM A;  3K5L A;  4ZHR A;  3CFR A;  3QNN A;  3AVG A;  3CM6 A;  2LSN A;  3QER A;  4M3Y A;  4Z4H A;  3IAY A;  1NKB A;  4H4M A;  3CQ8 A;  4HTU A;  4B9N A;  1JLF A;  4IBN A;  3VQ5 A;  2IDO A;  4LSN A;  4FZY A;  1DTQ A;  4NYF A;  3AO2 A;  4RW4 A;  3ZT0 A;  4FK4 A;  4R5P A;  5K14 A;  3NH1 A;  3VQP A;  1LAW A;  3OS1 A;  4J2B A;  1JXE A;  4GMJ B;  4CIE A;  2YV0 X;  1SV5 A;  1TAQ A;  4AHT A;  2PZS A;  3KLH A;  1HMV A;  1RTJ A;  2DFE A;  3LDS A;  1IKX A;  1Z25 A;  3T19 A;  5C42 A;  1S9E A;  3V1O A;  4LSL A;  4DF8 A;  3OYB A;  1T03 A;  1ZBF A;  2G8F A;  2JLE A;  1DLO A;  1WAF A;  1A5V A;  1B9F A;  1SKS A;  4CCH A;  3KLG A;  3OYH A;  3KD5 E;  3ZT1 A;  3G10 A;  4O0J A;  3OY9 A;  3OS0 A;  3RR7 A;  4B9S A;  1QSL A;  4B08 A;  3EY1 A;  4B8C A;  3U3G A;  3AVB A;  4CHO A;  4AIL C;  1RTD A;  4FJL A;  4JS5 A;  1UA0 A;  2OPQ A;  2X78 A;  3AA3 A;  5KGW A;  1ZBH A;  3C95 A;  3OYD A;  4FCY A;  1WSG A;  2R7Y A;  1W0H A;  4ICL A;  3TAE A;  4DMN A;  2DFH A;  4KI4 A;  3L3U A;  1LWE A;  5HRS A;  2YNG A;  3PX4 A;  5FRM A;  2E6M A;  1X9S A;  2DTU A;  4BAC A;  4C8M A;  2OPR A;  1Y97 A;  1NK8 A;  3AA5 X;  2HHX A;  4FJ9 A;  5J2Q A;  4HCB A;  4KPY A;  3L2V A;  4BDZ A;  3DLK A;  3LZI A;  1F21 A;  3OYL A;  4LH5 A;  1VSL A;  3ZSV A;  1DTT A;  4CGG A;  4M3Z A;  2RF2 A;  4YNQ A;  1J5O A;  3F9K A;  2OPS A;  3CM5 A;  1GOB A;  4UQG A;  1BCM A;  3NF6 A;  3HT3 A;  4E7K A;  3KJV A;  1CXU A;  2GBZ A;  1L3T A;  5CYM A;  2I5J A;  4FJI A;  3OYF A;  3AO4 A;  4Z4F A;  1MU2 A;  5KRT A;  2XO7 A;  4CGJ A;  4H4O A;  1BI4 A;  1RBT A;  3SQ0 A;  3DLE A;  3LP0 A;  1RT5 A;  1VRT A;  1R0A A;  1QE1 A;  3H08 A;  4CE9 A;  3HVT A;  3EYZ A;  1HPZ A;  1QSS A;  1U4B A;  2YHA A;  3LP3 A;  1TL1 A;  3HL8 A;  4CGI A;  3TR8 A;  5KRS A;  1VRU A;  1NJY A;  4AH9 A; 
#chains in the Genus database with same CATH topology
 3F2K A;  4NXN K;  5J1E A;  4OGE A;  1C0M A;  4CJ7 A;  3D6R A;  4BR7 A;  3MCA B;  4M3T A;  2YHB A;  5FRN A;  3M6G A;  1YTU A;  4KAZ A;  3TI0 A;  4I2Q A;  4DR4 K;  3ID8 A;  2GUI A;  2A1S A;  4EP5 A;  2WC9 A;  3D0P A;  5LJW A;  1S6P A;  5C10 A;  3HOS A;  2D0P A;  3ZSY A;  3M1F A;  1NK7 A;  1C0T A;  4AHC A;  5JVG L;  3S3M A;  5AZI A;  2F4V K;  1IBK K;  3VEY A;  3EEQ A;  4M3U A;  3O4Q A;  3O9Q A;  3ALY A;  2HMI A;  3VF4 A;  3J80 O;  4DTO A;  1HJR A;  5GAH P;  1RT6 A;  3BZK A;  2O8D B;  3CJC A;  1TAU A;  4KB0 A;  1MDU B;  3CCU N;  1Q7Y O;  4ZTJ A;  5AR0 A;  4IEI A;  1BQN A;  3EZW A;  3OTO K;  4EZ6 A;  1BIZ A;  3ENH A;  3E9L A;  3W3D A;  2V7Y A;  1KAZ A;  2IOC A;  4LY7 A;  1C0G A;  4GNI A;  4YOU A;  1YJW N;  5DM6 L;  3CCL N;  3IDH A;  1QVF M;  1HYS A;  1TKX A;  1WNS A;  5LMN K;  3VQC A;  4DQI A;  1RTH A;  2ZF5 O;  3VQ8 A;  1U47 A;  5AQZ A;  4KKO A;  4KTW A;  3DJC A;  2AJQ A;  4NLB A;  3NF8 A;  3QIP A;  3ZET B;  2BAN A;  3P1G A;  4DWI A;  2P9I B;  5I42 A;  2F9T A;  3NHG A;  3AVM A;  1WBB A;  2QWO A;  1Q81 O;  2KZZ A;  2G8U A;  2ZE2 A;  2Q31 A;  4FJX A;  2A1R A;  2YNH A;  3ZEU B;  4JHD A;  2OZS A;  2QXL A;  3VQ4 A;  3MX2 A;  4WQ4 C;  5KTQ A;  2VWJ A;  3L8B A;  4B3T K;  4M3R A;  3SNN A;  4NB4 A;  3RSE A;  2ZJR L;  4CJQ A;  2HHU A;  4FSV A;  4CJR A;  4CJF A;  4F2R A;  4IKF A;  1NK6 A;  2IVP A;  5H1S Q;  1DKG D;  1BG3 A;  2ASO A;  2CGL A;  3TWH A;  1NBW A;  2UYT A;  3PSF A;  4H03 B;  3NGI A;  3P39 A;  2KFZ A;  3K57 A;  3S41 A;  4CGH A;  4LF5 K;  3F5T A;  4GV9 A;  2NLX A;  5GAE P;  2OAN A;  1VHX A;  4CZE A;  1QTM A;  3MAQ A;  1K9M O;  1FJG K;  1L3V A;  2RPI A;  2D0B A;  5EXW A;  1BGX T;  4Z4G A;  1N32 K;  4Y0W A;  4BRD A;  4B9V A;  4FLY A;  1EX4 A;  3MEE A;  4PUO A;  1NK9 A;  3B6P A;  3CPW M;  3C6A A;  4E1J A;  3HPG A;  5AQQ A;  4B1W B;  4BDP A;  4NCA A;  1GLE G;  1TKD A;  3DLL L;  5ELZ A;  4E89 A;  3DLB A;  1UWB A;  3UKU B;  1RDC A;  4I6M B;  4XIU A;  5E26 A;  2NZT A;  1XI1 A;  5AQO A;  1IH7 A;  1ITG A;  3TSP A;  3CER A;  1VQK N;  1RFQ A;  2VG7 A;  4A5B A;  4N41 A;  3JS6 A;  4BGA A;  5J2P A;  1QZ5 A;  4KBO A;  4CZL A;  1S1V A;  2O8B B;  4CF0 A;  1NK0 A;  2PAV A;  3QEP A;  2VG5 A;  1JL1 A;  1J53 A;  4MFB A;  2KLA A;  4NCG A;  4W5O A;  3SQ2 A;  2ATQ A;  4DS4 A;  3CPE A;  1HYV A;  1TK5 A;  2Q3S A;  4J2A A;  3R9P A;  1I3A A;  3IKM A;  3VN5 A;  5HRR A;  4KRF A;  2Z1H A;  2A41 A;  1VQL N;  2O8C A;  3ASM A;  2E5L K;  1N36 K;  1B9D A;  1S6Q A;  1EQY A;  1RDU A;  3QEV A;  1MA9 B;  3MX5 A;  4CZG A;  5HRO A;  3AVH A;  1O1W A;  3R1X A;  3VQE A;  2WON A;  3QIO A;  4FWO A;  3DM2 A;  3KK3 A;  2ZGZ A;  4CEF A;  4FM1 A;  1C0U A;  4LF9 K;  5FRO A;  3R6M A;  5HL7 L;  5E41 A;  3SZ2 A;  1REV A;  1S9G A;  1LOT B;  5MLC Q;  1ZBU A;  1OVY A;  3LM2 A;  3NVK A;  4FPB A;  2E2Q A;  4CZI A;  5JVH L;  4CER A;  2RN2 A;  4NXM K;  4JNE A;  3AA4 A;  4YOV A;  1LCU A;  2YJF A;  2W42 A;  4E0D A;  4FZZ A;  2ZGY A;  3WQU A;  2RHK A;  4B1V A;  1HX1 A;  1RBU A;  5BR8 K;  3V9X A;  3RRG A;  1D8Y A;  5LL6 Z;  2G8I A;  3H6E A;  3HYF A;  4BR4 A;  3C65 A;  3BUZ B;  1C1C A;  4DTM A;  1NK5 A;  4KHQ A;  4RW8 A;  3HM8 A;  3AGR A;  2XRI A;  5GAG P;  4CF2 A;  3ZSZ A;  3ZSX A;  2RE2 A;  3UKR B;  2FBV A;  4BVO A;  2UU9 K;  1N8R O;  3SUO A;  4ZTF A;  4IFV A;  1YT3 A;  3KKS A;  1BDG A;  2J4R A;  4B3O A;  4BVP A;  3C6H A;  1HRH A;  3SAG A;  1ASU A;  4ID5 A;  2NNW A;  3VPZ A;  4FJJ A;  3LPT A;  2A3Z A;  1YJ9 N;  2BE2 A;  1S1T A;  3DRP A;  3KTQ A;  4Z4E A;  2NRZ A;  4RCH A;  2FBX A;  3THY B;  4DSJ A;  3WEE A;  4H0Y B;  4PL8 A;  4DQR A;  4DFM A;  3UE5 A;  2E8A A;  3L2R A;  4ISG A;  1OH7 A;  2BDP A;  4B9Q A;  3ENB A;  3FFI A;  2F7T A;  4FM0 A;  4KHP K;  4TSX A;  4CHP A;  1TYQ A;  3VQ7 A;  3O9U A;  5J2N A;  2QW9 A;  3KVG A;  3NH2 A;  3VER A;  3AO1 A;  2HBJ A;  1YUW A;  2YKN A;  3AVK A;  5BRF A;  1SAZ A;  4JKD A;  5C2F A;  4E19 A;  2Y1J A;  4IEE A;  1K8A O;  1VQP N;  4C8N A;  1U6Z A;  3OJU A;  1D9D A;  2A5X A;  3SBT A;  3KLI A;  4DSI A;  2XY5 A;  1YTA A;  3WXK A;  4JS4 A;  1D9F A;  3AVF A;  4CZH A;  1TVR A;  4CJ3 A;  1S1U A;  4IJN A;  4M3X A;  1NOY A;  3V9U A;  3MWT A;  1JL2 A;  1EP4 A;  3CHW A;  2G8H A;  3K0S A;  4BRC A;  3RRH A;  1BOT O;  3QB0 A;  5TKW A;  5CR4 A;  3VEN A;  3KK7 A;  4CJV A;  3LDL A;  5BRH A;  4ELT A;  4Y1D A;  4FLT A;  4FO0 A;  4HCC A;  1Z26 A;  2E6L A;  3TPQ A;  3MK6 A;  4O5F A;  3V6D A;  1GOA A;  1XHZ A;  4QCL A;  3ZX0 A;  1WSH A;  4H0O A;  3CJ7 A;  4YOX A;  3K5L A;  1BQM A;  3QNN A;  3CM6 A;  5AQV A;  4Z4H A;  5ADX A;  3IAY A;  1NKB A;  4H4M A;  3ULE A;  1T3V A;  5EOY A;  2VYP A;  2NRX A;  4YDU C;  2ASP A;  4JN4 A;  5K14 A;  3NH1 A;  3FE1 A;  3OS1 A;  3FFK B;  4GMJ B;  4CIE A;  1RTJ A;  2DFE A;  1Z25 A;  3T19 A;  2BTF A;  1T03 A;  1DLO A;  4A61 A;  3HTV A;  3H1V X;  1SKS A;  3KLG A;  3OYH A;  1XC3 A;  4ILG B;  3G10 A;  4O0J A;  3CQX A;  5FPE A;  1QSL A;  3TU5 A;  3AVB A;  4CHO A;  3E9O A;  1G99 A;  2X78 A;  3OYD A;  1W0H A;  4B1Y B;  4DMN A;  4R79 A;  2IVN A;  4BAC A;  4C8M A;  1Y97 A;  2QI2 A;  2W40 A;  3GOI A;  5J2Q A;  4DUY K;  4HCB A;  1F21 A;  3LDQ A;  3OYL A;  4CGG A;  4H0V B;  2OPS A;  1Y64 A;  1WBD A;  3CM5 A;  3HT3 A;  4WF9 L;  3VF6 A;  1GLC G;  4DB3 A;  4FJI A;  1SZ2 A;  3O6W A;  4XH1 A;  2D4W A;  4CGJ A;  1WB9 A;  3DLE A;  4B1X B;  1RT5 A;  4WFB L;  3H08 A;  2YJE A;  1QSS A;  1NMN A;  4JKE A;  4B3R K;  1HJO A;  4IOA L;  1TL1 A;  3HL8 A;  3DRS A;  1A5V A;  1NJY A;  3BEX A;  3VQD A;  1KAX A;  2Q2R A;  2E2O A;  2FBT A;  1HNZ K;  1FXX A;  1GLJ O;  1KLN A;  1BCO A;  4CZM A;  2I7N A;  4FXD A;  4BRG A;  4FJG A;  4M41 A;  3K9K A;  3F73 A;  5AQW A;  3LPU A;  5AQG A;  3MWP A;  4JI2 K;  3ZSQ A;  4LFB K;  3C7N B;  3AVL A;  3V1R A;  3M8S A;  3QDK A;  4KRE A;  4M3W A;  4M45 A;  1VQ9 N;  1RCH A;  3EO3 A;  2Z1I A;  4FWQ A;  4BRH A;  3MN5 A;  3RMA A;  4JI8 K;  1BWF O;  4J2E A;  4MDB A;  3JYT A;  1Q9Y A;  3S3O A;  4F4K A;  1BU6 O;  2YCH A;  4CJK A;  4MDA A;  5DM7 L;  3K58 A;  2AA4 A;  2HHH K;  4JAX A;  5AZJ A;  3A5M C;  2CH6 A;  3MN7 A;  4BGB A;  3C0B A;  4JI7 K;  3MN9 A;  2HND A;  1XWL A;  3OW2 M;  1J9A A;  1KFD A;  4OO1 J;  4KHU A;  1N5Y A;  4AHU A;  4KH5 A;  4BE2 A;  3OYI A;  1NJX A;  5F2R A;  3WNE A;  4DQQ A;  3THW A;  1RT3 A;  5KGX A;  3T1A A;  3WQT A;  3ITH A;  3S9H A;  1SL0 A;  4DKW A;  2HHW A;  1D4X A;  1LAV A;  4EHT A;  1XNR K;  1BUP A;  2HST A;  3M8Q A;  3TAQ A;  2D0A A;  4CFB A;  4W5T A;  4IZ9 A;  3HO1 A;  2QKB A;  4DU3 A;  3IFR A;  1ZBL A;  4JD2 B;  3AGK A;  3SI6 A;  3DAW A;  3NH0 A;  4GY2 B;  4EHU A;  1RBS A;  3QIN A;  2P51 A;  3AA2 A;  4H5N A;  5AQS A;  1HNW K;  1JLA A;  4CJT A;  1NKC A;  4FW1 A;  3BP8 A;  1BL3 A;  3L3V A;  5EU7 A;  3VEO A;  4B1U B;  3O3F A;  4JI0 K;  3N4Q A;  4IOX A;  1NGH A;  2XY7 A;  1VSK A;  4QAG A;  4BRO A;  3OJS A;  3PY8 A;  4G1Q A;  2GEM A;  2E88 A;  3ZCM A;  3O9R A;  2DFF A;  2P9K A;  1NGI A;  4FLW A;  1VQ8 N;  2P5O A;  2XY6 A;  4YHH K;  2HBK A;  4F3T A;  1L3S A;  1O13 A;  1TL3 A;  3G4S N;  4CIF A;  2Z1G A;  4CED A;  4FVM A;  5JLF A;  4B9M A;  4BR9 A;  1NOZ A;  2QEX N;  1R59 O;  3CFO A;  4IJA A;  4CEQ A;  4JKA A;  1OVQ A;  1RBV A;  1IKY A;  2BUP A;  3DRR A;  3KK2 A;  4QS9 A;  5M1F A;  3WXM B;  4CW7 B;  3CI5 A;  5JS1 A;  4X66 K;  3K5M A;  4OPA A;  3QNO A;  4CF8 A;  4DSL A;  4W5Q A;  2F8S A;  3H45 C;  3NFA A;  2P9P B;  3L2W A;  2O4G A;  2VCP A;  1S5J A;  2WFB A;  4M7Y A;  4E3S A;  3J7A P;  1HKB A;  4CJP A;  1LWC A;  1XMO K;  4BRN A;  5C2D A;  2H3G X;  2ETJ A;  5DK5 A;  1JCE A;  4C23 A;  1KVA A;  3MXJ A;  4CI6 A;  3EZ5 A;  1QZ6 A;  4K43 A;  4FVU A;  3SUN A;  3QML A;  4QS8 A;  4PL7 A;  3TSU A;  3QEX A;  4E1N A;  2YNI A;  4LF7 K;  1XHX A;  3VQ9 A;  4JRQ A;  2HBM A;  3EN9 A;  4JKB A;  4FLZ A;  4O8U A;  4DR6 K;  3VQA A;  1ZBI A;  2HHT A;  3LDP A;  4MO5 A;  1W9H A;  3LDN A;  4FOI A;  3D2F A;  3V9W A;  3LAN A;  2X74 A;  5A2Q O;  2CH5 A;  3DXK A;  4DFJ A;  3OA9 A;  1X9M A;  4I2P A;  1IJJ A;  4FK2 A;  2XY8 A;  3D2E B;  2W6L A;  3THX A;  4AHS A;  1ASW A;  3T3F A;  4N56 A;  3NF7 A;  4WQ5 A;  1EXQ A;  4E7L A;  4DTS A;  4HWI A;  4DTR A;  1KAY A;  4RW6 A;  1VQM N;  3DXM A;  3SPZ A;  3CD6 N;  1Q18 A;  4KHY A;  1Z05 A;  3ZT3 A;  1S72 N;  4GVE A;  4H5V A;  1YVN A;  3CCV N;  4JK7 A;  4IFY A;  3VQB A;  5KQ8 A;  1NGB A;  2QTD A;  1J54 A;  1NK4 A;  5D3G A;  5AFU H;  1VSH A;  4C1N I;  3K59 A;  3H46 O;  4C8K A;  1FW6 A;  4FJK A;  4DV7 K;  3SPY A;  3OYA A;  3DOK A;  3W0L A;  3T7Z A;  4OKJ A;  3JAM O;  4AHR A;  3DI6 A;  2UXC K;  3SQ1 A;  2HHQ A;  4I9Q A;  4LH4 A;  1KLM A;  4JI6 K;  3ATU A;  4EP4 A;  3NMU A;  1QQN A;  1CXQ A;  1TV6 A;  1FKP A;  2P9S B;  4N76 A;  4CES A;  1WN7 A;  1HQU A;  3ZSR A;  3IRX A;  3LWM A;  3OYN A;  1U2V B;  1WLJ A;  4FWN A;  3RTV A;  3OS2 A;  4CEO A;  2V52 B;  3J8A A;  4BWJ A;  5I9E B;  4WYB A;  3CJA A;  3FLC O;  2O8F B;  2O8D A;  4C8L A;  4U67 L;  4MLH A;  3TSQ A;  3GE1 A;  4CJS A;  5JS2 A;  5AQJ A;  4FWP A;  1XMQ K;  3U6F A;  1E4G T;  4CFC A;  2G8W A;  3G25 A;  3FZH A;  3I33 A;  3OYK A;  1X3N A;  2JGU A;  3AVC A;  5M1N A;  1N6Q A;  2HVH A;  5HRP A;  4L3Q A;  1B92 A;  4CEA A;  4N47 A;  1A5W A;  4Q5V A;  3L2U A;  4OVL A;  3QEW A;  1DGK N;  4YOT A;  3OHR A;  4IO8 A;  1NM1 A;  4DV4 K;  4O55 A;  3PO4 A;  1U48 A;  3V1Q A;  4XH5 A;  3DYA A;  3VTH A;  4OPH A;  4IG0 A;  3VF2 A;  1U04 A;  4JRP A;  4HVJ A;  1KXP A;  3GG4 A;  3ZET A;  1Z6R A;  3CCJ N;  3CCR N;  2P9I A;  4FJ5 A;  1OH5 A;  4CK1 A;  3AVJ A;  3BDP A;  3EL2 A;  4K8Z A;  2UUB K;  5F0X A;  4Z0U A;  3ZSO A;  2D5R A;  4DTN A;  2ZJQ L;  3Q7C A;  3WT0 A;  2Q0U A;  3ZEU A;  3B6O A;  4A59 A;  2P1J A;  1RGI A;  1GLF O;  3O8M A;  2FF3 B;  4K25 A;  3D45 A;  4WCE L;  4FWS A;  4HHT A;  1HKG A;  3DLR A;  3U4L A;  4CJL A;  3G71 N;  1BHL A;  3PLA A;  3HPH A;  3OYG A;  4ZHR A;  3AVG A;  2NRH A;  4M3Y A;  1VQ6 N;  4DV2 K;  1DEJ A;  4NYF A;  3AO2 A;  4RW4 A;  4FK4 A;  4R5P A;  4MLE A;  4J2B A;  1JXE A;  1SV5 A;  4AHT A;  3LDS A;  1IKX A;  1VQ4 N;  4NLC A;  3BF3 A;  3OYB A;  1ZBF A;  2G8F A;  2JLE A;  1IV0 A;  4FWK A;  3KD5 E;  3E9P A;  4LF6 K;  2P9N B;  5CE3 A;  3RR7 A;  3EY1 A;  4B8C A;  4AIL C;  1RTD A;  4FJL A;  4JS5 A;  2Q97 A;  1UA0 A;  3A5N C;  5KGW A;  1WSG A;  3RVC A;  2YI1 A;  4ICL A;  3UKU A;  4I6M A;  2F9W A;  1NGJ A;  4F9O A;  1OH8 A;  4CBW A;  4KI4 A;  1LWE A;  5HRS A;  2DTU A;  3L4Q A;  2E6M A;  1HKC A;  2OPR A;  1NK8 A;  5BPL A;  3CET A;  4BDZ A;  3DLK A;  2P9L B;  4LH5 A;  1VSL A;  2O8B A;  2CGK A;  4YNQ A;  1J5O A;  1TUY A;  1JCF A;  1BCM A;  3JXU A;  4FOE A;  2GBZ A;  3OYF A;  2O8E B;  5KRT A;  4RWT A;  4BRA A;  4H4O A;  4CZJ A;  1XUP O;  1V4S A;  3HVT A;  1U4B A;  2YHA A;  4JK9 A;  5GAD P;  1E4F T;  4CGI A;  1X9S A;  5M1P A;  3T1Y K;  1C1A A;  4PKI A;  1W97 L;  2A40 A;  3OYC A;  1K6Y A;  2HMP A;  1SUQ A;  3IUC A;  4JYA K;  3WXL A;  2Q36 A;  3U8X A;  4PWD A;  1QS4 A;  4W5N A;  5GIO A;  1T7P A;  3S3N A;  5JMV A;  2HHV A;  1T05 A;  4BC4 A;  3CIP A;  3PX6 A;  4I9L A;  1QHT A;  1JLE A;  2NRT A;  1TGO A;  4X65 K;  4DQS A;  1RT2 A;  3L0Q A;  3P38 A;  1VK0 A;  4J2D A;  3H1Q A;  3P5J A;  5CY4 A;  1LWF A;  2YNF A;  3MXI A;  3TTF A;  3B8A X;  1NGC A;  4ISE A;  2Q0R A;  3P31 A;  4DUZ K;  3K5N A;  4KFB A;  1YIJ N;  2BGG A;  2IGI A;  3UKR A;  3NGY A;  2A6A A;  4K41 A;  2Y1I A;  3TAB A;  4JKH A;  1KRP A;  1RDD A;  3ATV A;  2E2P A;  1M90 O;  4ELV A;  4C8O A;  5CZ2 A;  1X9J A;  4BR0 A;  4KO0 A;  5IT9 O;  5AQX A;  1WSE A;  4H8K A;  4CHQ A;  4YOR A;  3UB5 A;  1KVB A;  2P9U B;  3VEW A;  3C94 A;  3SK3 A;  2IVO A;  5KPZ A;  3V81 A;  3KIO A;  3CQY A;  3O4W A;  1RDB A;  1IG8 A;  1KSP A;  1CZB A;  3THY A;  1HR0 K;  1T44 A;  1YJN N;  2FBY A;  3KKR A;  3AVI A;  3R3L A;  3AVN A;  1DT9 A;  1GLL O;  2QXF A;  3NAE A;  2V7Z A;  1IG9 A;  3SQ4 A;  3E66 A;  3BGR A;  4IG3 A;  3MDQ A;  4B9U A;  2O4I A;  3L6Q A;  3SAH A;  4LFC K;  4B3S K;  3L2Q A;  3CFP A;  2ITG A;  1C0F A;  1IKV A;  2GWJ A;  1RT1 A;  3NVM A;  3VQQ A;  1XNQ K;  5AQR A;  4FLV A;  4K42 A;  2EHG A;  3I8B A;  5I3U A;  1P90 A;  3VMF B;  1Q86 O;  3O3G A;  4JKG B;  3HXM A;  3MMV A;  1MWM A;  4OGC A;  4CVN E;  4CZK A;  2QWL A;  2V51 B;  5KI6 A;  2PBD A;  4KI6 A;  3J7Z O;  3ZT2 A;  4H0X B;  4CBU A;  3ENO A;  3C6U A;  4N5S A;  1WUA A;  4BE1 A;  3KHY A;  4CD3 A;  1JJ2 M;  4BRP A;  5HLF A;  5KQD A;  3HST B;  3MEG A;  4CHN A;  3ISN C;  3HOT A;  2JWK A;  3I55 N;  3A2F A;  3K5O A;  4IFE A;  1U45 A;  1N33 K;  4IDH A;  4OJR A;  3GDQ A;  2E1Y A;  4GKJ K;  3L4I A;  3F9M A;  3QES A;  3A0I X;  2GWK A;  4BRM A;  1W7A A;  2B6A A;  4IDK A;  3AV9 A;  1HNV A;  1UAX A;  2GX9 A;  3VGL A;  3SLC A;  4ILH A;  1NJW A;  1ATS A;  1XC9 A;  2A42 A;  3MEC A;  2HW3 A;  5HBM A;  3K9J A;  3LZJ A;  1YVU A;  1L5U A;  1BI4 B;  3PIP L;  4W5R A;  1RDA A;  2GEL A;  3OYJ A;  4BRE A;  3SV3 A;  5HP1 A;  4L8R B;  1NU0 A;  5AQL A;  3ZT4 A;  1RIL A;  2F8T A;  5FPM A;  1JLC A;  4DTU A;  3LAL A;  1MWK A;  1YIT N;  3AAR A;  3AAQ A;  5ADX H;  3SCX A;  4PA1 A;  2KHO A;  4PKG A;  3V9Z A;  4ELU A;  4RG8 A;  1RBR A;  3O5B A;  2FF6 A;  4Z94 A;  1VSF A;  2HB5 A;  4CJU A;  2ZM6 K;  2JWL A;  3CMA N;  5AQM A;  1Q8I A;  2E2N A;  1VQ7 N;  3I56 N;  4B9L A;  4FJ7 A;  3VTI A;  3BZC A;  5AZI B;  5C15 A;  3DLG A;  3SUP A;  4GKK K;  1VAZ A;  5C24 A;  4CEE A;  1BA1 A;  2X6N A;  4AHV A;  4RW7 A;  4X64 K;  4LF8 K;  5GIP A;  2IIR A;  4B1Z A;  1SL2 A;  5EVZ A;  4LD0 A;  2OZM A;  3UIQ A;  3M8P A;  5AJ3 K;  3A5O C;  2QM1 A;  2KW4 A;  3WUH A;  3LP1 A;  5LJV A;  3I0R A;  1JLQ A;  2X6S A;  1A5X A;  4CD1 A;  3O1B A;  1KC8 O;  1JKH A;  4DU1 A;  4FWM A;  2UUC K;  4BQZ A;  3HP9 A;  2ZJP L;  4KV8 A;  4BR2 A;  4AM6 A;  2UUA K;  4X62 K;  1TK8 A;  4XEI A;  1OKJ A;  3CJ9 A;  4CJW A;  3ULD A;  1KVC A;  1VSI A;  1QQO A;  3C7N A;  4C1N K;  4DR3 K;  4E7I A;  1K8K A;  1TKZ A;  1KFS A;  4CGD A;  3MED A;  4H5R A;  2VG6 A;  5DMR A;  5C25 A;  4DV0 K;  5FPD A;  4Z4I A;  2QKK A;  2OA8 A;  4KH6 A;  2IS3 A;  3MXM A;  2W41 A;  4EZ9 A;  2VGM A;  2CGJ A;  3EE9 A;  1EET A;  1RNH A;  3MN6 A;  3DXM B;  2NRW A;  3QBW A;  3O1W A;  3QET A;  3VEZ A;  3TAM A;  4FWR A;  2ZWH A;  3CJB A;  2UXD K;  3E01 A;  4FJH A;  5KPT A;  1IBM K;  1L3U A;  3NE6 A;  4JHD B;  2RKI A;  4DSF A;  4BE0 A;  5JLH A;  4DFK A;  4BWM A;  4WQ4 A;  1S1W A;  2NRV A;  3RSE B;  4CEB A;  5AQF A;  2FLO A;  3M8R A;  3HM9 A;  3PUF A;  3N4P A;  1RTI A;  4MQ3 A;  2P5G A;  4FK0 A;  4DV3 K;  3U3Y A;  1NJI O;  3QFU A;  3RWU A;  4M7X A;  1VSM A;  3PV8 A;  2PYL A;  4OKK A;  4CJ5 A;  4JI4 K;  4E7J A;  5GIN A;  1S3X A;  4JD2 A;  3VET A;  1KD1 O;  1YF5 L;  4DU4 A;  3H3N O;  4DV6 K;  4WFA L;  5TKY A;  5FDL A;  1BA0 A;  4E1M A;  3P4I A;  2FSK A;  2FC0 A;  1BIU A;  1HPM A;  5BPN A;  1HNI A;  1X9W A;  4JLH A;  4DSK A;  3M3Z A;  5C0Y A;  4M63 C;  5AQU A;  4DCH A;  4DS5 A;  1X3M A;  3GL1 A;  4CZF A;  3NF9 A;  4E7H A;  3A5L C;  4OLA A;  4DV5 K;  3FZL A;  3CC4 N;  3Q7B A;  1ESV A;  1HQE A;  4CIG A;  1NGG A;  3O08 A;  1Q82 O;  3WXJ A;  4OPJ A;  4YY3 K;  5AQT A;  4DTJ A;  3CQ8 A;  4IWV A;  3VQ5 A;  2VGN A;  4IBN A;  4PKH A;  2IDO A;  4EAH D;  2FSJ A;  3O80 A;  1DTQ A;  1NGA A;  3T1H K;  2OTL N;  1LAW A;  5EY4 A;  2O8C B;  1TAQ A;  3KLH A;  1HMV A;  2NRR A;  5C42 A;  1S9E A;  3V1O A;  5AQI A;  3J7Y P;  1ATR A;  1ZC6 A;  1WAF A;  4CCH A;  3BY5 A;  3H3O B;  3TTC A;  3OS0 A;  2P9P A;  3HI0 A;  3O9T A;  1NG9 A;  3QBX A;  2R7Y A;  4DR2 K;  3TAE A;  1VQO N;  4BRQ A;  2DFH A;  3L3U A;  2YNG A;  3PX4 A;  5FRM A;  2DPN A;  1BO5 O;  4CBX A;  1NNE A;  4BY9 C;  3VGM A;  4LF4 K;  4KPY A;  3LZI A;  3ZYY X;  3ZLJ A;  1DTT A;  3TTD A;  2YHW A;  1VQN N;  4BC3 A;  3NF6 A;  4E7K A;  3KJV A;  1CXU A;  4Z4F A;  4AQY K;  3AO4 A;  1MU2 A;  5BRE A;  1R0A A;  4IOC L;  4CE9 A;  2QWP A;  3EYZ A;  1HPZ A;  2HF3 A;  3LP3 A;  4IXC A;  4A57 A;  5KRS A;  1VRU A;  4AH9 A;  1T6C A;  4JV5 K;  2ITM A;  3LAM A;  4KTZ A;  4DQ8 A;  3AO5 A;  4OKE A;  3QO9 A;  4DLG A;  3OBY A;  1QQM A;  3CC2 N;  4CEZ A;  3OYM A;  3WNF A;  1QHA A;  1SQK A;  2PY5 A;  4I7F A;  5KPR A;  3HJF A;  2FXU A;  4FJN A;  2G8V A;  3ZX3 A;  3U9D A;  5BPM A;  3D2E A;  4RTF D;  4WQ5 C;  1EO1 A;  3KWG A;  4JI1 K;  3WNG A;  4CFD A;  4HUE A;  1FK9 A;  3OBW A;  4KH4 A;  1NLV A;  3CJ1 A;  2B5J A;  3WEE B;  2YHX A;  2HOE A;  1GOC A;  4A2A A;  1EKE A;  1V4T A;  4BG8 A;  1I94 K;  3FGU A;  1YAG A;  4DSE A;  5CHI A;  2QA4 N;  4UY8 O;  3NDK A;  1ILY A;  2GUP A;  4CGF A;  1TYQ B;  2GTD A;  5JIC A;  1CLQ A;  2KQ2 A;  1WSI A;  3IS9 A;  3QLH A;  4QS7 A;  2YKM A;  3CXC M;  2IAJ A;  4HTL A;  2KFN A;  2Z1J A;  4CF1 A;  3TAN A;  3PIO L;  4FWL A;  3O4N A;  3SJJ A;  3QEI A;  3CG7 A;  2P9S A;  4HUG A;  1NJZ A;  4DTP A;  4BC2 A;  1U2V A;  3P83 D;  3J81 O;  1YHQ N;  3RMB A;  4KTQ A;  3KLE A;  3VES A;  2XHB A;  2KKZ A;  3BF1 A;  3SBG A;  2ZQB A;  3DOL A;  5M1Q A;  1CZ9 A;  4ILJ A;  3TAP A;  2HHS A;  2O8F A;  2D1K A;  3VQ6 A;  4NYN A;  4LC9 B;  3SUQ A;  4WE1 A;  3SAF A;  1H1V A;  4RW9 A;  1WSJ A;  5CYQ A;  2B4J A;  1NGF A;  4BRK A;  1NMD A;  3QFP A;  4G9Z A;  1YXQ A;  3TAR A;  4FW2 A;  1I39 A;  4QOZ B;  4DQP A;  3NGZ A;  1EWR A;  3KK1 A;  1U49 A;  3MCP A;  1ATN A;  2Q1N A;  2QWM A;  1SL1 A;  5BN8 A;  4FJ8 A;  1T8E A;  1HNX K;  4FZX C;  3FZK A;  4DTX A;  2VWB A;  5AQN A;  1SKW A;  1LW2 A;  3AVA A;  1JLG A;  1GLD G;  4DV1 K;  1RT4 A;  3AO3 A;  3ULE B;  1FKO A;  5EX5 A;  2WBN A;  2D0O A;  1X1P A;  4YOY A;  3R8E A;  4YDU A;  3SV4 A;  3SMS A;  2HNZ A;  3U9Z A;  4M42 A;  5HOO A;  1E3M A;  3ID6 A;  2WTU A;  1KTQ A;  3V9S A;  3WNH A;  3EKU A;  4A2B A;  4DG1 A;  4GV6 A;  4JKC A;  3NBP A;  3CCQ N;  2IC3 A;  3DMJ A;  4F8R A;  1RDW X;  4PQU A;  3HK2 A;  2I7P A;  3LAK A;  3T69 A;  1NGE A;  1ZBS A;  3E1Y A;  5AQY A;  1JLB A;  4CFA A;  4BRF A;  4U7B A;  1S1X A;  3RMD A;  1UA1 A;  1TUU A;  2UXB K;  1SS6 A;  4A5A A;  3I8D A;  3DWL A;  2E1Z A;  1ZYQ A;  3IG1 A;  3I0S A;  3LP2 A;  4KB1 A;  5M1K A;  2YX6 A;  2WOM A;  2E20 A;  1SKR A;  5E84 A;  1IBL K;  4PY5 A;  4Y1C A;  3KD1 E;  4WFN L;  4GW6 A;  4FL9 A;  4B9T A;  3OYE A;  2ASM A;  4IO9 L;  5HRN A;  4ISF A;  3VGK A;  4GV3 A;  3NCI A;  2ZD1 A;  2GV9 A;  4BQL A;  3PX0 A;  4K8X A;  3OVN A;  4BR5 A;  1K73 O;  4FLU A;  2P9N A;  5IWA K;  4B8A B;  4CK2 A;  2FSN A;  1J5E K;  2YHY A;  1KCF A;  3SJH A;  3DLH A;  4H0T B;  3VEX A;  2VQE K;  4CHZ A;  4KHS A;  4JEP A;  2HNY A;  3RR8 A;  1ZXO A;  4OLB A;  4BG9 A;  5CZ1 A;  5C12 A;  1NGD A;  2P9L A;  1WSF A;  5SZT A;  4CHY A;  3THV A;  4J8F A;  2F96 A;  2KTQ A;  5BN9 A;  3CCS N;  2OYQ A;  1TK0 A;  4NCB A;  4B3M K;  1VSE A;  3PSI A;  2O8E A;  1JXB A;  3FZF A;  4CK3 A;  2PYJ A;  5AZJ B;  1NWK A;  4FM2 A;  3VA0 A;  4JK8 A;  4FJM A;  4YOW A;  1S22 A;  2QWR A;  1HYZ A;  5FLX O;  1NKE A;  3VA3 A;  2D0C A;  3KLF A;  3PO5 A;  4GVM A;  3THW B;  3FR0 A;  4OX9 K;  4O44 A;  3AY9 A;  3JSM A;  3CYM A;  3D7E O;  4JI3 K;  4Z4C A;  4KHN A;  2HBL A;  5T7B A;  5BR9 A;  4DF4 A;  1GLB G;  4CF9 A;  2OPP A;  3TAG A;  4FLX A;  5J2M A;  2QK9 A;  5BRD A;  2HVI A;  3LWL A;  3GBT A;  2G8K A;  1HUX A;  2W6K A;  4OPK A;  4A62 A;  4Q0B A;  2PFU A;  1UOC A;  4O4G A;  4KHW A;  1VQ5 N;  1LV5 A;  4DHY A;  3WXI A;  2DY4 A;  3LL3 A;  1TKT A;  4YFU A;  1WAJ A;  1D5A A;  5AQK A;  1Q9X A;  2VWK A;  3HP6 A;  3M5R A;  3O3H A;  1QVG M;  2WUS A;  4EIA A;  4HUF A;  2P9K B;  1QQC A;  2QWQ A;  3G6E N;  3TAF A;  1ASV A;  3RMC A;  3LDO A;  3A8Y A;  4H5T A;  1BIS A;  3CME N;  4F3O A;  2KZM A;  5LY3 A;  3SMP A;  3IMX A;  3ZSW A;  1LW0 A;  2BH1 A;  4DFP A;  1RT7 A;  2P9U A;  4O5B A;  1K8K B;  3CCE N;  1OH6 A;  3HVR A;  3HPO A;  2E4L A;  3LM9 A;  1VSD A;  2EX3 A;  2OCE A;  3K2P A;  1G15 A;  1C6V A;  4EFH A;  4PHT X;  1IO2 A;  4ID1 A;  1J6Z A;  4H5W A;  1JCG A;  1QSY A;  4CJ4 A;  4AF1 A;  3G0Z A;  4O0I A;  3SYZ A;  3KZB A;  1W2B M;  2NUB A;  4AM7 A;  2QWN A;  4XH4 A;  4BRI A;  1VSJ A;  4F2S A;  1WOQ A;  3C6T A;  1KQS M;  4FYD A;  4DR5 K;  4JKF A;  4DLE A;  3HSC A;  1HLU A;  1C1B A;  4BDY A;  4LFA K;  3V4I A;  5B8H A;  2EWS A;  1EWQ A;  3HBT A;  4JKG A;  4CJE A;  1N34 K;  1IKW A;  5SWM A;  3CFR A;  5LMU K;  2LSN A;  3QER A;  5FPN A;  4FPA A;  3CF5 L;  4HTU A;  4B9N A;  1JLF A;  3HZ6 A;  1CZA N;  4LSN A;  4FZY A;  3HRG A;  3ZT0 A;  4DR1 K;  3VQP A;  3CC7 N;  1XQS C;  2VQF K;  2YV0 X;  2PZS A;  1T6D A;  4NO7 A;  4LSL A;  4DF8 A;  1M1K O;  2AP1 A;  1B9F A;  3ZT1 A;  3OY9 A;  4B9S A;  4B08 A;  3QIC A;  3U3G A;  4V19 S;  3D2F B;  2OPQ A;  3O9S A;  2OTJ N;  3AA3 A;  3KWI A;  1ZBH A;  3C95 A;  4FCY A;  1YI2 N;  3DXK B;  3VEV A;  3EKS A;  4DR7 K;  5F1X A;  3AAP A;  3AA5 X;  4H0P A;  5AFU A;  3THX B;  4FJ9 A;  4K0K K;  2HHX A;  4O8K A;  3L2V A;  3CCM N;  2HF4 A;  4M3Z A;  3ZSV A;  4MO4 A;  2RF2 A;  4JI5 K;  3VOV A;  3F9K A;  1GOB A;  4UQG A;  5AQP A;  3FZM A;  1L3T A;  4BC5 A;  5CYM A;  2I5J A;  3ZX2 A;  3EE8 A;  2XO7 A;  1BI4 A;  1RBT A;  3SQ0 A;  3LP0 A;  1VRT A;  5M1O A;  1QE1 A;  1GLA G;  4BRL A;  1P8Z A;  5AQH A;  3TR8 A;  4CEC A; 
#chains in the Genus database with same CATH homology
 3LAM A;  4KTZ A;  3VQD A;  1C1A A;  3AO5 A;  3QO9 A;  4OKE A;  1C0M A;  4OGE A;  2FBT A;  5J1E A;  4DLG A;  1FXX A;  3OYC A;  1K6Y A;  4CEZ A;  1KLN A;  4M3T A;  1BCO A;  3OYM A;  3WNF A;  1SUQ A;  2YHB A;  5FRN A;  4FXD A;  4FJG A;  4M41 A;  3F73 A;  1YTU A;  4KAZ A;  3TI0 A;  4PWD A;  2PY5 A;  3LPU A;  4I7F A;  3HJF A;  4I2Q A;  1QS4 A;  3ZSQ A;  3AVL A;  4FJN A;  2GUI A;  4W5N A;  2A1S A;  3V1R A;  3M8S A;  1T7P A;  4EP5 A;  2G8V A;  3S3N A;  3D0P A;  1S6P A;  4KRE A;  4M3W A;  2HHV A;  4M45 A;  1RCH A;  1T05 A;  3ZSY A;  3PX6 A;  2Z1I A;  4I9L A;  1NK7 A;  1QHT A;  1JLE A;  1C0T A;  3RMA A;  1TGO A;  3WNG A;  4J2E A;  4AHC A;  4CFD A;  4HUE A;  3S3M A;  1FK9 A;  1RT2 A;  3JYT A;  4DQS A;  1Q9Y A;  3S3O A;  4F4K A;  1VK0 A;  4CJK A;  2B5J A;  4J2D A;  4M3U A;  3O4Q A;  1GOC A;  3ALY A;  2HMI A;  3K58 A;  1EKE A;  3P5J A;  4DTO A;  5CY4 A;  1LWF A;  1HJR A;  2YNF A;  1RT6 A;  3MXI A;  2HND A;  1TAU A;  4KB0 A;  1XWL A;  4DSE A;  4ZTJ A;  1BQN A;  1J9A A;  1KFD A;  3K5N A;  3NDK A;  4KFB A;  4EZ6 A;  1BIZ A;  4KHU A;  2BGG A;  2IGI A;  4CGF A;  3NGY A;  1N5Y A;  4AHU A;  4BE2 A;  1CLQ A;  2IOC A;  2KQ2 A;  2Y1I A;  4LY7 A;  3TAB A;  1WSI A;  3IS9 A;  3OYI A;  1NJX A;  1KRP A;  1RDD A;  3QLH A;  3WNE A;  4DQQ A;  4ELV A;  1RT3 A;  4C8O A;  2YKM A;  5CZ2 A;  2IAJ A;  2KFN A;  5KGX A;  4KO0 A;  3T1A A;  2Z1J A;  1HYS A;  1TKX A;  1WNS A;  3ITH A;  4CF1 A;  3S9H A;  3VQC A;  1SL0 A;  2HHW A;  1LAV A;  1RTH A;  1WSE A;  4H8K A;  3TAN A;  4CHQ A;  3VQ8 A;  4DQI A;  1U47 A;  1KVB A;  3M8Q A;  3TAQ A;  3O4N A;  3SJJ A;  2D0A A;  4KKO A;  4KTW A;  4CFB A;  4W5T A;  3C94 A;  3CG7 A;  3QEI A;  3HO1 A;  3V81 A;  2QKB A;  4DU3 A;  3KIO A;  2AJQ A;  4HUG A;  1RDB A;  1ZBL A;  3NF8 A;  1NJZ A;  4DTP A;  1KSP A;  3QIP A;  1CZB A;  2BAN A;  3P1G A;  3P83 D;  3RMB A;  3SI6 A;  4DWI A;  5I42 A;  3NH0 A;  3NHG A;  4KTQ A;  3AVM A;  1RBS A;  3QIN A;  2P51 A;  3AA2 A;  3KLE A;  2FBY A;  3KKR A;  2XHB A;  1JLA A;  4CJT A;  2KZZ A;  3AVI A;  1NKC A;  3AVN A;  2ZQB A;  2G8U A;  3DOL A;  2QXF A;  1CZ9 A;  4FW1 A;  3NAE A;  3TAP A;  2ZE2 A;  2HHS A;  1BL3 A;  3L3V A;  1IG9 A;  3VQ6 A;  3SQ4 A;  4NYN A;  3SUQ A;  4WE1 A;  4FJX A;  4RW9 A;  2YNH A;  3BGR A;  2A1R A;  4IG3 A;  1WSJ A;  5CYQ A;  5EU7 A;  2B4J A;  4B9U A;  2O4I A;  3O3F A;  2OZS A;  2XY7 A;  3VQ4 A;  1VSK A;  4QAG A;  3L2Q A;  3OJS A;  3CFP A;  2ITG A;  5KTQ A;  2VWJ A;  3PY8 A;  4G1Q A;  1IKV A;  3L8B A;  3TAR A;  4FW2 A;  1I39 A;  4M3R A;  3ZCM A;  3SNN A;  4QOZ B;  4DQP A;  3NGZ A;  3KK1 A;  1RT1 A;  2DFF A;  1U49 A;  4FLW A;  2P5O A;  3VQQ A;  2XY6 A;  4CJQ A;  4FLV A;  1SL1 A;  2HHU A;  2EHG A;  4CJR A;  4CJF A;  5I3U A;  1T8E A;  4FJ8 A;  4FZX C;  4F2R A;  4F3T A;  4IKF A;  1NK6 A;  3O3G A;  3HXM A;  4DTX A;  1L3S A;  4OGC A;  1SKW A;  1LW2 A;  3AVA A;  1JLG A;  1TL3 A;  3TWH A;  1RT4 A;  3AO3 A;  4CIF A;  2Z1G A;  4N76 A;  5KI6 A;  4CED A;  4FVM A;  4B9M A;  1FKO A;  1NOZ A;  4KI6 A;  3NGI A;  3ZT2 A;  2KFZ A;  3K57 A;  1X1P A;  4CGH A;  3CFO A;  3C6U A;  4CEQ A;  4N5S A;  3SV4 A;  1QTM A;  3MAQ A;  1RBV A;  1L3V A;  1IKY A;  2HNZ A;  2RPI A;  3DRR A;  4BE1 A;  2D0B A;  4M42 A;  3KK2 A;  1BGX T;  4Z4G A;  1KTQ A;  3V9S A;  4B9V A;  3WNH A;  4FLY A;  4DG1 A;  1EX4 A;  3MEE A;  5HLF A;  4PUO A;  1NK9 A;  5JS1 A;  3NBP A;  3K5M A;  2IC3 A;  3B6P A;  3DMJ A;  3HST B;  3QNO A;  4F8R A;  4PQU A;  3MEG A;  4CF8 A;  4CHN A;  4DSL A;  3LAK A;  4W5Q A;  3ISN C;  3HK2 A;  2F8S A;  3HPG A;  4BDP A;  1JLB A;  3NFA A;  4CFA A;  4NCA A;  1S1X A;  3RMD A;  3A2F A;  3K5O A;  3L2W A;  1UA1 A;  1U45 A;  1TKD A;  2O4G A;  1S5J A;  4OJR A;  4E3S A;  3DLB A;  4E89 A;  1UWB A;  4XIU A;  1RDC A;  3I8D A;  1XI1 A;  4CJP A;  3QES A;  1IH7 A;  1ITG A;  1LWC A;  2B6A A;  1ZYQ A;  4IDK A;  2VG7 A;  3AV9 A;  3IG1 A;  3I0S A;  3LP2 A;  1HNV A;  1UAX A;  2ETJ A;  5DK5 A;  4KB1 A;  4N41 A;  2WOM A;  5J2P A;  1S1V A;  1KVA A;  4CF0 A;  1SKR A;  1NK0 A;  3MXJ A;  3QEP A;  1NJW A;  4PY5 A;  2VG5 A;  1JL1 A;  1J53 A;  4MFB A;  4NCG A;  4W5O A;  3EZ5 A;  1XC9 A;  3SQ2 A;  3MEC A;  4Y1C A;  3KD1 E;  2ATQ A;  2HW3 A;  4GW6 A;  4DS4 A;  3SUN A;  1HYV A;  1TK5 A;  5HBM A;  2Q3S A;  3LZJ A;  3QEX A;  4J2A A;  1YVU A;  1L5U A;  4B9T A;  1BI4 B;  1I3A A;  4W5R A;  3VN5 A;  1RDA A;  5HRR A;  2Z1H A;  2YNI A;  4E1N A;  3OYE A;  4KRF A;  3OYJ A;  3SV3 A;  3ASM A;  5HP1 A;  5HRN A;  1XHX A;  4L8R B;  3VQ9 A;  4JRQ A;  3ZT4 A;  1B9D A;  3NCI A;  4FLZ A;  1S6Q A;  3VQA A;  2ZD1 A;  1RIL A;  2F8T A;  2GV9 A;  3PX0 A;  1ZBI A;  3QEV A;  2HHT A;  4K8X A;  3OVN A;  1JLC A;  1W9H A;  4DTU A;  3LAL A;  4FLU A;  5HRO A;  3AVH A;  1O1W A;  3VQE A;  2WON A;  3QIO A;  3DM2 A;  4B8A B;  3V9W A;  3KK3 A;  3SCX A;  4CK2 A;  4CEF A;  3LAN A;  4PA1 A;  2X74 A;  4FM1 A;  3V9Z A;  1C0U A;  4ELU A;  4RG8 A;  1RBR A;  5FRO A;  1KCF A;  5E41 A;  3SZ2 A;  3DLH A;  1REV A;  1S9G A;  1VSF A;  4DFJ A;  2HB5 A;  1ZBU A;  4CHZ A;  1X9M A;  4CJU A;  4KHS A;  2QK9 A;  2HNY A;  3RR8 A;  4I2P A;  4OLB A;  1Q8I A;  4CER A;  2XY8 A;  4FK2 A;  2RN2 A;  5CZ1 A;  4AHS A;  3AA4 A;  1ASW A;  3T3F A;  4B9L A;  4N56 A;  2W42 A;  1WSF A;  5SZT A;  4FJ7 A;  4CHY A;  3THV A;  3NF7 A;  4E0D A;  4FZZ A;  2F96 A;  2KTQ A;  1EXQ A;  1RBU A;  3DLG A;  4E7L A;  3SUP A;  1TK0 A;  3V9X A;  3RRG A;  2OYQ A;  5C24 A;  4DTS A;  4CEE A;  2X6N A;  1D8Y A;  4NCB A;  1VSE A;  4AHV A;  4DTR A;  4RW6 A;  2G8I A;  3SPZ A;  4RW7 A;  3HYF A;  4KHY A;  1JXB A;  3ZT3 A;  4CK3 A;  1SL2 A;  2PYJ A;  1C1C A;  4LD0 A;  4IFY A;  3VQB A;  2OZM A;  3UIQ A;  3M8P A;  2KW4 A;  4FM2 A;  3VA0 A;  3LP1 A;  3I0R A;  4DTM A;  1NK5 A;  4KHQ A;  1JLQ A;  4FJM A;  1J54 A;  4RW8 A;  1NK4 A;  5D3G A;  2X6S A;  1VSH A;  1A5X A;  2XRI A;  4CF2 A;  3ZSZ A;  3ZSX A;  3K59 A;  1JKH A;  4DU1 A;  2FBV A;  4C8K A;  1HYZ A;  1NKE A;  3VA3 A;  3HP9 A;  3SUO A;  4ZTF A;  4FJK A;  2D0C A;  3KLF A;  3SPY A;  3PO5 A;  4KV8 A;  4IFV A;  3OYA A;  3DOK A;  1YT3 A;  3KKS A;  4GVM A;  1TK8 A;  4CJW A;  3ULD A;  4B3O A;  1KVC A;  1VSI A;  1HRH A;  4OKJ A;  1ASU A;  4AHR A;  4O44 A;  3DI6 A;  2HHQ A;  3SQ1 A;  3JSM A;  4E7I A;  3CYM A;  4ID5 A;  1TKZ A;  1KFS A;  4CGD A;  3MED A;  4Z4C A;  4LH4 A;  4I9Q A;  4KHN A;  4FJJ A;  1KLM A;  3LPT A;  5T7B A;  4EP4 A;  4DF4 A;  4CEC A;  2VG6 A;  1TV6 A;  1CXQ A;  5DMR A;  4CF9 A;  5C25 A;  4Z4I A;  2OPP A;  1FKP A;  1S1T A;  2BE2 A;  4CES A;  4FLX A;  5J2M A;  3TAG A;  3DRP A;  1WN7 A;  1HQU A;  2OA8 A;  3ZSR A;  3KTQ A;  4Z4E A;  3IRX A;  3LWL A;  3LWM A;  2G8K A;  3OYN A;  2IS3 A;  3MXM A;  2HVI A;  2FBX A;  1WLJ A;  4DSJ A;  3RTV A;  3DRS A;  4EZ9 A;  4OPK A;  3OS2 A;  4CEO A;  4Q0B A;  1UOC A;  4O4G A;  1EET A;  4BWJ A;  1RNH A;  4KHW A;  4DQR A;  4DFM A;  1LV5 A;  3QET A;  4C8L A;  3L2R A;  3TAM A;  4CJS A;  5JS2 A;  3E01 A;  2BDP A;  4FJH A;  1L3U A;  3NE6 A;  2DY4 A;  3FFI A;  1TKT A;  4YFU A;  2RKI A;  4FM0 A;  1WAJ A;  4TSX A;  1D5A A;  3VQ7 A;  4CHP A;  3U6F A;  4DSF A;  5J2N A;  4BE0 A;  1Q9X A;  4DFK A;  2VWK A;  4CFC A;  3NH2 A;  3O3H A;  3HP6 A;  3AO1 A;  4BWM A;  3OYK A;  2G8W A;  2JGU A;  2YKN A;  3AVC A;  3AVK A;  1S1W A;  4HUF A;  1QQC A;  4CEB A;  1N6Q A;  2HVH A;  5HRP A;  3TAF A;  1ASV A;  1B92 A;  4E19 A;  2Y1J A;  3M8R A;  4CEA A;  3RMC A;  3HM9 A;  3PUF A;  4N47 A;  1BIS A;  1A5W A;  4Q5V A;  3L2U A;  4OVL A;  3QEW A;  4F3O A;  4C8N A;  1RTI A;  2KZM A;  4MQ3 A;  3OJU A;  1D9D A;  2P5G A;  3ZSW A;  3KLI A;  1LW0 A;  4O55 A;  4DFP A;  3U3Y A;  3PO4 A;  4DSI A;  4FK0 A;  2XY5 A;  1RT7 A;  1YTA A;  4O5B A;  3V1Q A;  4JS4 A;  1U48 A;  1D9F A;  3RWU A;  1VSM A;  3DYA A;  3AVF A;  3PV8 A;  3HVR A;  3HPO A;  2E4L A;  1TVR A;  1VSD A;  4IG0 A;  4OKK A;  2EX3 A;  4CJ5 A;  4E7J A;  3K2P A;  4CJ3 A;  2PYL A;  1S1U A;  1G15 A;  1C6V A;  1U04 A;  4JRP A;  4HVJ A;  4M3X A;  1NOY A;  3V9U A;  1IO2 A;  1JL2 A;  1EP4 A;  4FJ5 A;  4DU4 A;  4ID1 A;  4CK1 A;  2G8H A;  3AVJ A;  3BDP A;  4K8Z A;  1QSY A;  3RRH A;  5FDL A;  4CJ4 A;  3G0Z A;  4O0I A;  4Z0U A;  3ZSO A;  4CJV A;  4E1M A;  3SYZ A;  2D5R A;  4DTN A;  4ELT A;  2NUB A;  4Y1D A;  4FLT A;  2FC0 A;  1BIU A;  1VSJ A;  1HNI A;  3B6O A;  4JLH A;  1X9W A;  4DSK A;  1Z26 A;  4F2S A;  3C6T A;  2P1J A;  2E6L A;  4HCC A;  4FYD A;  4DS5 A;  4DLE A;  3D45 A;  3NF9 A;  4E7H A;  4OLA A;  4HHT A;  3V6D A;  1C1B A;  4BDY A;  1HQE A;  4CIG A;  1GOA A;  3DLR A;  2QKK A;  1XHZ A;  3V4I A;  4CJL A;  4QCL A;  1WSH A;  4OPJ A;  4CJE A;  1BHL A;  1IKW A;  5SWM A;  4DTJ A;  3HPH A;  3OYG A;  1BQM A;  3K5L A;  4ZHR A;  3CFR A;  3QNN A;  3AVG A;  3CM6 A;  2LSN A;  3QER A;  4M3Y A;  4Z4H A;  3IAY A;  1NKB A;  4H4M A;  3CQ8 A;  4HTU A;  4B9N A;  1JLF A;  4IBN A;  3VQ5 A;  2IDO A;  4LSN A;  4FZY A;  1DTQ A;  4NYF A;  3AO2 A;  4RW4 A;  3ZT0 A;  4FK4 A;  4R5P A;  5K14 A;  3NH1 A;  3VQP A;  1LAW A;  3OS1 A;  4J2B A;  1JXE A;  4GMJ B;  4CIE A;  2YV0 X;  1SV5 A;  1TAQ A;  4AHT A;  2PZS A;  3KLH A;  1HMV A;  1RTJ A;  2DFE A;  3LDS A;  1IKX A;  1Z25 A;  3T19 A;  5C42 A;  1S9E A;  3V1O A;  4LSL A;  4DF8 A;  3OYB A;  1T03 A;  1ZBF A;  2G8F A;  2JLE A;  1DLO A;  1WAF A;  1A5V A;  1B9F A;  1SKS A;  4CCH A;  3KLG A;  3OYH A;  3KD5 E;  3ZT1 A;  3G10 A;  4O0J A;  3OY9 A;  3OS0 A;  3RR7 A;  4B9S A;  1QSL A;  4B08 A;  3EY1 A;  4B8C A;  3U3G A;  3AVB A;  4CHO A;  4AIL C;  1RTD A;  4FJL A;  4JS5 A;  1UA0 A;  2OPQ A;  2X78 A;  3AA3 A;  5KGW A;  1ZBH A;  3C95 A;  3OYD A;  4FCY A;  1WSG A;  2R7Y A;  1W0H A;  4ICL A;  3TAE A;  4DMN A;  2DFH A;  4KI4 A;  3L3U A;  1LWE A;  5HRS A;  2YNG A;  3PX4 A;  5FRM A;  2E6M A;  1X9S A;  2DTU A;  4BAC A;  4C8M A;  2OPR A;  1Y97 A;  1NK8 A;  3AA5 X;  2HHX A;  4FJ9 A;  5J2Q A;  4HCB A;  4KPY A;  3L2V A;  4BDZ A;  3DLK A;  3LZI A;  1F21 A;  3OYL A;  4LH5 A;  1VSL A;  3ZSV A;  1DTT A;  4CGG A;  4M3Z A;  2RF2 A;  4YNQ A;  1J5O A;  3F9K A;  2OPS A;  3CM5 A;  1GOB A;  4UQG A;  1BCM A;  3NF6 A;  3HT3 A;  4E7K A;  3KJV A;  1CXU A;  2GBZ A;  1L3T A;  5CYM A;  2I5J A;  4FJI A;  3OYF A;  3AO4 A;  4Z4F A;  1MU2 A;  5KRT A;  2XO7 A;  4CGJ A;  4H4O A;  1BI4 A;  1RBT A;  3SQ0 A;  3DLE A;  3LP0 A;  1RT5 A;  1VRT A;  1R0A A;  1QE1 A;  3H08 A;  4CE9 A;  3HVT A;  3EYZ A;  1HPZ A;  1QSS A;  1U4B A;  2YHA A;  3LP3 A;  1TL1 A;  3HL8 A;  4CGI A;  3TR8 A;  5KRS A;  1VRU A;  1NJY A;  4AH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...