1VSLA

Asv integrase core domain d64n mutation with zinc cation
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTNFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (INTEGRASE)
publication title Structural basis for inactivating mutations and pH-dependent activity of avian sarcoma virus integrase.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
molecule tags Hydrolase
total genus 55
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vslA00
3MXJA 4CJTA 1C0MA 1TL3A 4YNQA 3OYEA 1C6VA 1ZYQA 3VQCA 1NKEA 4E7KA 3A2FA 1MU2A 4NYNA 3RR8A 4CF2A 4Z4IA 3ZT4A 3ZCMA 1RTJA 1RNHA 1IO2A 1K6YA 1SV5A 2D0BA 2HHWA 1HRHA 4JRQA 4CGHA 4DSIA 3HP9A 3RMCA 3RMDA 1RBVA 3VN5A 4CJVA 4ID5A 3AA2A 3VA3A 1KTQA 3I0RA 4OLBA 3KJVA 1CZBA 4F3TA 1UWBA 1D9DA 2BDPA 4FK4A 5FRMA 2HW3A 4EP5A 2YNHA 3MAQA 4AILC 4OLAA 2XO7A 1VK0A 4IKFA 4HHTA 1JKHA 2FBYA 2YHBA 3NF8A 4KO0A 4BWMA 1Q9YA 3THVA 4CJWA 2D0CA 1KCFA 3SV3A 4IG3A 4PWDA 1HYVA 4I2QA 3D0PA 4DFPA 3AO5A 1HYSA 1LWFA 3MECA 4LSNA 1KVAA 4HUEA 4FLUA 4C8OA 3SUPA 3KD1E 1WSEA 3DOKA 3KKRA 3VQ4A 3PY8A 4CFBA 4CHYA 3PX6A 4OGEA 1TKTA 4QOZB 4HCCA 3AO3A 3AVCA 2FC0A 4M41A 3PX0A 4O0JA 1RTHA 1VSJA 3ZSOA 3ULDA 3KLEA 1TAQA 4DS4A 2OYQA 1TKDA 4J2BA 1HYZA 3BGRA 3SUNA 5FRNA 2RF2A 2FBVA 4AHTA 3HP6A 1NJZA 2Z1IA 3LP1A 4DSKA 3VQ8A 4FJ7A 4DTUA 1FXXA 4CEQA 1YTAA 3KLIA 3LP2A 3ZSRA 1T05A 3RWUA 2DFEA 1IG9A 3IS9A 1RDCA 1RBSA 4FLZA 3SQ4A 1SL2A 2G8FA 3TANA 2AJQA 3IAYA 2HVIA 3AO4A 3TAQA 5HP1A 1Z26A 4CEZA 5D3GA 3DM2A 1VSMA 1EETA 1HMVA 4H4OA 3HYFA 5FROA 4DLEA 1D5AA 1HNVA 4CGIA 1QTMA 4KPYA 1BISA 4DTXA 1L3UA 1SL0A 4CJQA 4E1NA 4DQPA 1TVRA 3WNEA 3ZSXA 3P5JA 4CIGA 3ZT1A 3L8BA 3AVKA 1LW0A 4E7HA 1VSHA 3DLHA 1EX4A 2HNYA 4CEFA 2I5JA 1VSFA 4R5PA 3QEPA 1LWCA 2B5JA 3DI6A 5CZ2A 4CE9A 3T3FA 3MEEA 1TK5A 1LAVA 4H8KA 4CEEA 4C8LA 4CHPA 3K59A 2HMIA 4OJRA 3K2PA 3WNHA 4AHSA 1S1XA 3LP3A 2PYLA 3PV8A 4DFJA 2HVHA 1WAJA 3RMAA 3QIOA 1HNIA 1BHLA 3AO2A 3HM9A 1B92A 2Y1JA 1S9GA 2B4JA 5HRSA 4CJ5A 3TAFA 3UIQA 3HO1A 1N6QA 4DTRA 3AVLA 3HPGA 3S9HA 1QSLA 1KVCA 3QO9A 3CFOA 1ASWA 3LPUA 3VQBA 4N76A 1S1VA 1JLBA 1RDAA 2HHXA 3RRGA 1GOCA 4LSLA 2G8WA 3AVHA 4DQQA 4C8KA 2F8TA 2DY4A 4Z4HA 1RBRA 4Z0UA 4FM0A 3SI6A 1IKXA 4NCGA 4RG8A 2KQ2A 3KK2A 1CZ9A 1WSGA 4M3XA 3SV4A 3FFIA 4DTJA 3OYCA 1BGXT 4DSLA 1VSDA 2F8SA 3OYKA 4DTPA 2GBZA 3O3FA 3NCIA 3QNNA 3TAEA 4I2PA 2E4LA 2HNZA 5KGWA 1XI1A 4JS4A 3U6FA 4QAGA 2HHQA 1TL1A 4CJUA 3TARA 2XY7A 2KFNA 2HHUA 1CLQA 5I3UA 1FK9A 2ATQA 1RT3A 3VQDA 1XC9A 4KHQA 4E0DA 2IDOA 4W5OA 3DMJA 5HRRA 4JRPA 4BDZA 4CIFA 4FW2A 3OY9A 1KFSA 1ASVA 2YKNA 4KHUA 1D9FA 2JLEA 2OPRA 3HPOA 4HUFA 3VQ9A 3K58A 3C6UA 2NUBA 2Z1HA 3CFPA 1C0TA 4RW9A 3KD5E 3B6PA 1SUQA 3OYAA 3SJJA 1EXQA 4CF1A 3NHGA 4FVMA 4OKEA 1JL2A 1NKBA 3RMBA 5DMRA 1G15A 1WAFA 1L5UA 2YNFA 1RT4A 4Q0BA 4N56A 3DLBA 1JLCA 1WLJA 4KFBA 4K8XA 3U3YA 4M42A 1NK5A 5SZTA 1VSEA 3EZ5A 4NYFA 4AHCA 3VA0A 3ZSWA 2JGUA 3OJUA 1EP4A 3OYGA 3M8PA 1L3VA 2KTQA 4O5BA 1CXQA 5KI6A 3DLGA 4M3ZA 3HSTB 1A5WA 1UA1A 4EZ6A 1C1AA 3TAMA 3LDSA 3O4QA 4CJFA 5FDLA 1QSYA 2PZSA 4CK3A 5DK5A 3AVAA 1WSIA 1SKSA 4AHUA 1NJXA 4FJLA 1DTTA 1ITGA 4DFMA 3TAGA 4I9QA 1IH7A 5C24A 4N47A 3PO5A 4BDPA 4KAZA 1S1UA 2P1JA 4Y1DA 1VRUA 2P51A 4O4GA 4CF9A 1JLQA 3L2UA 1B9FA 4FM1A 3TI0A 4ZTFA 1J5OA 2QXFA 4M3YA 3OYFA 3EY1A 4DTNA 2XY5A 4GMJB 1CXUA 4CHZA 5J2NA 2G8UA 4I9LA 4FZXC 1BCOA 4B9TA 4Z4EA 2DTUA 1ZBUA 3AVBA 2YKMA 3S3OA 2VWKA 1JLGA 2A1SA 4E7IA 3NDKA 4KTWA 3OYDA 3SNNA 4N41A 3AV9A 3C95A 4LY7A 1DTQA 4O0IA 1IKWA 2Z1GA 3H08A 4LD0A 1RCHA 3ZT2A 4DTMA 1RT5A 4FLVA 1RDBA 3PO4A 1SL1A 1BIUA 4JLHA 3K5LA 3SUOA 4FJ5A 4K8ZA 4DS5A 1HPZA 3OYLA 3LP0A 4FLYA 1BCMA 3K57A 1U45A 4B3OA 4DTOA 1LW2A 3V1OA 1BI4A 1W0HA 2ZD1A 4YFUA 3OYMA 3E01A 4DSJA 4LH4A 3VQ5A 4AHVA 1TKXA 1YTUA 3JYTA 2QKBA 3ZSZA 1NOYA 3RTVA 4G1QA 4RW8A 1KVBA 1LAWA 2X6SA 3OYIA 3L2WA 4DQRA 2W42A 1NK6A 3ASMA 4C8NA 4CEBA 1WN7A 2E6LA 4F2RA 4RW7A 1L3SA 3M8RA 3VQAA 2GV9A 3DLKA 3K5OA 4CFCA 2RKIA 1J9AA 2YNIA 1IKVA 2DFFA 3HL8A 4E7JA 4LH5A 3I8DA 3QEVA 4FJHA 4CJKA 2XRIA 4FJXA 3HT3A 5HROA 4ELVA 1RBTA 2IGIA 3VQPA 5HRPA 4FCYA 4O55A 4DLGA 4FJ9A 3HK2A 4B9LA 1LV5A 4CGFA 3CM6A 4KHYA 4IG0A 4M3UA 4FLTA 3V9SA 3NF7A 3QEWA 4JS5A 3JSMA 4PUOA 1QS4A 5HLFA 5CYQA 5KGXA 2BGGA 3LPTA 4FLXA 3V9WA 4B8AB 1TK0A 1U49A 2KZZA 4CHQA 2X74A 4MQ3A 3KKSA 1X9MA 2X78A 4KHNA 1KLNA 4FJNA 2D0AA 3DRPA 2O4IA 1RT2A 3B6OA 3KIOA 1WSFA 5CY4A 4C8MA 1C1CA 3AVJA 4E1MA 3V81A 4NCAA 4CIEA 1NK7A 4Z4FA 1ZBHA 4AH9A 4B9UA 2YV0X 1JL1A 4O44A 1GOAA 3LWLA 4ICLA 3VQ6A 4ZHRA 3OYNA 2FBXA 1FKOA 3TAPA 1Z25A 4M3TA 4ID1A 2O4GA 3SYZA 4BE1A 4DG1A 1B9DA 2KW4A 4CJRA 3OS1A 3OS2A 5C25A 2KZMA 4UQGA 4B08A 5JS1A 1JLFA 3HXMA 4MFBA 3AA3A 1L3TA 4OPKA 3DRRA 1U04A 4IBNA 3SPZA 2Q3SA 3C6TA 3L2QA 3C94A 3LZJA 3ITHA 5EU7A 4CJSA 4CK2A 4W5RA 1U4BA 4ELTA 4FJIA 3OVNA 4PA1A 4FK2A 1ZBIA 3G0ZA 2EX3A 1LWEA 3QINA 5SWMA 1X9SA 4KTQA 3HJFA 1DLOA 4DQIA 2IC3A 1YVUA 3NAEA 1XHZA 3MEGA 4J2EA 4FYDA 4CFDA 4W5QA 3TR8A 1WSHA 2ZE2A 1JLAA 1BI4B 2HNDA 4CERA 2D5RA 1ZBFA 3DLRA 3L3VA 4OPJA 2G8VA 3AVIA 3DYAA 3IG1A 4OVLA 3RR7A 2OPSA 3S3NA 3OYBA 1SKWA 4W5TA 2XY6A 4Y1CA 5E41A 4KB0A 4KHSA 3QIPA 1BL3A 4Z4CA 3OS0A 3EYZA 3CFRA 3NBPA 1X9WA 1EKEA 3AVNA 1O1WA 4I7FA 4Q5VA 4E3SA 3QEXA 1S9EA 3SPYA 1TV6A 3QERA 3AVFA 4HVJA 3T19A 1VSLA 3KK3A 2X6NA 2R7YA 4FZZA 4CEOA 1NK4A 3NFAA 4E7LA 2RN2A 2VG5A 1TAUA 3TWHA 3PX4A 3AO1A 1TK8A 3DOLA 1QE1A 2EHGA 3TABA 4J2AA 1U47A 4KI6A 3CYMA 3KTQA 1NJYA 3OYJA 3NE6A 2VG7A 4KKOA 5T7BA 3VQQA 2P5GA 1RTIA 3KLHA 4FM2A 1U48A 3L3UA 4DU1A 4Z4GA 4DSFA 1XHXA 1BIZA 3LALA 2DFHA 2LSNA 1NK8A 5HBMA 4F2SA 4J2DA 1TGOA 1ZBLA 4ELUA 3ZSYA 3QNOA 3WNGA 4CHNA 5K14A 3T1AA 5KRTA 3L2RA 1REVA 1NK9A 2QK9A 3V9UA 1KLMA 1I3AA 4B8CA 3LZIA 3ALYA 4CECA 3KLFA 4B9VA 4FJGA 3O3HA 4HUGA 3NGYA 2PY5A 5JS2A 3L2VA 3OYHA 5CZ1A 3ISNC 1IKYA 3QESA 3LANA 4WE1A 5J2MA 1SKRA 5J2QA 3SUQA 4BWJA 2KFZA 1WSJA 4N5SA 1VSIA 4M45A 5C42A 3M8SA 1XWLA 3D45A 4DFKA 4DU3A 3WNFA 1RT1A 3AVMA 3HVTA 4OGCA 3DLEA 3U3GA 2FBTA 4TSXA 4IFVA 4KV8A 2Y1IA 3CQ8A 3PUFA 4B9NA 2WONA 4EZ9A 2XHBA 1Q8IA 1NK0A 3LAMA 5I42A 1NJWA 3V9ZA 4CF0A 1RT6A 4CJ3A 1Q9XA 2IOCA 3F9KA 4F4KA 1JLEA 4GW6A 1W9HA 4GVMA 1JXBA 3K5MA 2OPQA 1RILA 4M3RA 1S6PA 1HQUA 3NH1A 1FKPA 1KFDA 3BDPA 2IS3A 3MEDA 3RRHA 3QETA 4PY5A 1RT7A 4F3OA 3VQ7A 2ETJA 1BQMA 3M8QA 3V6DA 1TKZA 3S3MA 4CCHA 2G8KA 4DTSA 4FK0A 4KHWA 4FXDA 2ITGA 4CGDA 3SQ2A 1UOCA 4FJMA 2VG6A 3KK1A 3SQ1A 4W5NA 4CEAA 2B6AA 4F8RA 3SZ2A 3NF6A 4RW4A 4BACA 4HCBA 1HJRA 2YHAA 2ZQBA 4CGJA 1ASUA 4CJLA 4CESA 1T7PA 4KTZA 5KTQA 4OKJA 3AA4A 2BANA 3HPHA 3MXIA 4CJPA 4BE2A 4B9SA 4KREA 4CGGA 4E89A 2P5OA 4FW1A 2YNGA 4CJ4A 4CF8A 2OZMA 1S5JA 1VSKA 2F96A 3VQEA 1A5VA 2OPPA 4FJKA 3I0SA 4DMNA 3CM5A 3V4IA 1NKCA 5CYMA 2QKKA 3IRXA 3F73A 3LAKA 4B9MA 4FJ8A 1HQEA 2G8IA 1X1PA 2HB5A 4CHOA 1C1BA 4EP4A 2IAJA 3DRSA 1J53A 3V1QA 1F21A 3O4NA 4IFYA 1BQNA 5J2PA 2HHVA 2GUIA 4ZTJA 1JXEA 4XIUA 2A1RA 5J1EA 4DF4A 1KRPA 4DU4A 4FLWA 1QQCA 1RBUA 1S1WA 2VWJA 4DSEA 4CK1A 1R0AA 1UA0A 2G8HA 3O3GA 4L8RB 1QSSA 1T8EA 1YT3A 3QLHA 4DQSA 3NH0A 4NCBA 2XY8A 4E19A 1QHTA 2RPIA 3G10A 4OKKA 4M3WA 4PQUA 1A5XA 3ZT0A 4BDYA 2OA8A 4FJJA 1S6QA 3V9XA 4DWIA 4CFAA 3NH2A 1Y97A 3K5NA 3NGIA 4HTUA 4KI4A 4QCLA 1J54A 4BE0A 2HHSA 2WOMA 3P83D 4CEDA 1UAXA 1I39A 3V1RA 3HVRA 1T03A 1KSPA 3P1GA 5KRSA 1S1TA 3NGZA 3SCXA 1WNSA 1RDDA 4IDKA 2E6MA 3KLGA 3AA5X 4H4MA 3QEIA 3MXMA 5HRNA 3NF9A 4AHRA 3ZSVA 3ZSQA 4KB1A 2PYJA 3OJSA 1GOBA 3SQ0A 2BE2A 1VRTA 3LWMA 2Z1JA 2OZSA 4KRFA 4FZYA 4CJEA 1D8YA 2HHTA 3AVGA 3ZT3A 4DF8A 1NOZA 1N5YA 1RTDA 4RW6A 3CG7A 1C0UA
chains in the Genus database with same CATH superfamily
1S72N 3OYEA 1ZYQA 1C6VA 4FWLA 2F9WA 3CD6N 4E7KA 1MU2A 1KD1O 2CH6A 1RNHA 2WFBA 2O8BA 3HP9A 5AQWA 2A42A 3RMDA 3VN5A 3ENHA 5BN9A 4RCHA 5DM6L 3FZMA 3E9OA 1VK0A 2V7ZA 1JKHA 2FBYA 3NF8A 4KO0A 5M1QA 4GKJK 2D0CA 4WQ5C 3R9PA 1IG8A 1KCFA 1HYVA 4I2QA 3D0PA 1T6DA 1OH7A 1HKGA 3WXKA 3ENOA 1HYSA 4LSNA 3CCSN 2JWKA 4C8OA 3SUPA 4DB3A 3KKRA 4QOZB 2E2PA 4BR7A 4OGEA 4HCCA 3AVCA 3KLEA 1Q7YO 1TAQA 1TKDA 2RF2A 1NJZA 4DTUA 2UU9K 4CEQA 2ZGYA 3LL3A 1RDCA 3SQ4A 4KHPK 3AGKA 2G8FA 3IAYA 3I55N 5AQQA 3DM2A 1VSMA 1EETA 4X65K 2QWMA 3HYFA 5FROA 1HNVA 1R59O 4H5RA 3EN9A 3WNEA 3ZT1A 1KAYA 2UYTA 3C7NB 4CEFA 2I5JA 3HM8A 1LWCA 4AF1A 5AFUH 3T3FA 4H8KA 2FSKA 4JKEA 3K2PA 4K42A 4AHSA 2PYLA 3RMAA 1HNIA 5F0XA 3CF5L 3C0BA 5HRSA 4CJ5A 1N6QA 3TTFA 2ZF5O 1KVCA 3QO9A 3CFOA 3VF4A 3VQBA 2E2OA 2QA4N 2Q97A 4BC3A 1RDAA 2HHXA 1GOCA 2F8TA 3AVHA 3LM9A 4BR2A 5AQJA 3CCJN 2O8EB 4CD3A 5GAGP 2PBDA 1IKXA 4NCGA 4RG8A 5AQFA 2KQ2A 2P9UB 1WSGA 1Q18A 3HBTA 1HPMA 5BPMA 1P8ZA 5GAEP 2V7YA 4DTPA 1D4XA 3ZEUA 3TAEA 5M1OA 2HNZA 5BN8A 3CCRN 3AY9A 2I7PA 4CJUA 4IEIA 2KFNA 1FK9A 1KAZA 3PSFA 2IDOA 4E0DA 5HRRA 4FW2A 4CJ7A 1JJ2M 4G9ZA 1V4SA 2NUBA 2Z1HA 4CW7B 3KD5E 2IIRA 1GLFO 1NMDA 5LMUK 3OYAA 2HSTA 4FVMA 1NKBA 4JI0K 3P31A 4FPBA 1WAFA 2YNFA 2WBNA 1RT4A 3WT0A 4Q0BA 4M7XA 1JLCA 1WLJA 3GE1A 2OANA 1DGKN 4M42A 4AHCA 3ZSWA 4JKGB 4LF6K 3CCQN 2J4RA 5A2QO 1CXQA 3DLGA 2ITMA 3MCAB 2A3ZA 3TTCA 1UA1A 4MDAA 1C1AA 3TAMA 4NO7A 5AQUA 3LDSA 1QSYA 3A5OC 4MLHA 1SKSA 4AHUA 4FJLA 1DTTA 1YI2N 1IH7A 5C24A 4KAZA 1EO1A 4Y1DA 1VRUA 1NGGA 4CF9A 4ZTFA 1YXQA 3L2UA 4BC5A 4FM1A 1J5OA 2HBJA 3OYFA 5AQIA 3FZLA 4I9LA 4YOVA 1BCOA 3AVBA 3G71N 2VWKA 4E7IA 5I9EB 3OYDA 3DXKB 1LOTB 4N41A 3C95A 4C1NI 3VEVA 3VPZA 2P9NB 3H08A 4IFEA 5AFUA 2FLOA 4FLVA 3ZLJA 1SL1A 4JLHA 4FJ5A 4DS5A 1HPZA 3OYLA 5JMVA 3PSIA 1LW2A 4IJNA 1E4FT 3D2EA 4LH4A 4AHVA 4DR3K 1TKXA 3JYTA 3CIPA 1NOYA 4RW8A 1KVBA 4WYBA 3OYIA 3L2WA 4DQRA 3ASMA 4CEBA 3ATVA 3AGRA 1L3SA 3M8RA 1IKVA 2DFFA 2AA4A 4LH5A 4FJHA 4CJKA 1RBTA 4EHUA 1TUYA 5HRPA 4NXNK 4DLGA 4FJ9A 4C1NK 1VQLN 3CM6A 1DKGD 3V9SA 3NF7A 1FJGK 4PUOA 1BA0A 1QS4A 4BR0A 4IOXA 5CYQA 5HLFA 4RTFD 2V52B 2UXBK 1U49A 2KZZA 3KKSA 5JVGL 5MLCQ 3VTIA 4YDUA 3CETA 4K41A 3V81A 3AVJA 2YCHA 4LF7K 4Z4FA 4CIEA 3VEYA 4FOEA 1JL1A 4O44A 3VQ6A 4ZHRA 2F4VK 3OYNA 1FKOA 4M3TA 2ZM6K 4CZMA 3SLCA 1JLFA 3HXMA 3AA3A 1BWFO 2W6KA 3RVCA 4MO4A 1U2VB 3C94A 3LZJA 5EU7A 4CJSA 3C6AA 1U4BA 1C0GA 4FJIA 2VGNA 3GBTA 1ESVA 4KTQA 3VF2A 4YOYA 1XHZA 4OO1J 3WXMB 2ZE2A 2P9LA 1BI4B 3UKUA 4JI7K 3VEXA 2FF3B 2YHWA 5AQMA 2P9PB 3L3VA 1NGBA 3S3NA 4KHSA 4BRDA 3U9DA 4Z4CA 4H03B 5KPZA 3QEXA 4E3SA 2QEXN 3AVFA 4HVJA 4YORA 4XH4A 4FZZA 1NK4A 4E7LA 1HLUA 2HMPA 3N4PA 4CZJA 3AO1A 1TK8A 3MWPA 5DM7L 4GV9A 2QWRA 3NE6A 4KKOA 4BGBA 4DU1A 5M1PA 4Z4GA 4J2DA 1TGOA 5M1NA 3ZSYA 5K14A 3L2RA 1NK9A 2QK9A 3F2KA 4B8CA 4JAXA 2PY5A 4JEPA 4M7YA 3TSPA 1SKRA 5J2MA 5J2QA 1WSJA 4N5SA 1M1KO 4DFKA 2E88A 1ATSA 3HVTA 3DLEA 3IDHA 4IFVA 4CZEA 4H0YB 3CQ8A 2Y1IA 4DR6K 3VETA 3LAMA 4BRCA 1HNXK 4CF0A 1RT6A 4F4KA 1JLEA 4GW6A 4GVMA 1ILYA 2E2NA 2GX9A 2OPQA 3K5MA 1S6PA 1KFDA 1C0FA 3MEDA 2O8CA 4CI6A 4DV1K 2G8KA 4DTSA 4IXCA 1BO5O 4CGDA 2ASMA 1V4TA 5BREA 4RW4A 4BACA 2YHAA 2D0PA 3SMSA 2FSJA 1T7PA 4FWNA 4OKJA 3AA4A 3HPHA 3MXIA 4CJPA 2HHHK 4FW1A 3CERA 4CJ4A 3QBWA 2OZMA 3VQEA 2F96A 4FJKA 4DMNA 4DV6K 2QKKA 3VGKA 1LCUA 4JHDB 4A57A 1HQEA 1X1PA 5ADXH 1C1BA 2IAJA 5AQLA 3V1QA 4IFYA 3W0LA 1BQNA 4WFAL 4FWMA 4ZTJA 5BRHA 1JXEA 2A1RA 5J1EA 1FW6A 1XQSC 3DXMB 1QSSA 1T8EA 3QLHA 4E19A 1QHTA 4JKBA 3VF6A 2GWJA 1A5XA 4CZIA 4O5FA 3V9XA 1RDWX 3Q7BA 2IVOA 4CEDA 5ELZA 1UAXA 4ISGA 4JI3K 4KHNA 3M1FA 5KRSA 3NGZA 1WNSA 4YY3K 4H4MA 3ZSVA 3EKSA 4BVPA 5GADP 3AVGA 1N5YA 4FWPA 1C0UA 2IVPA 3C7NA 1C0MA 1TL3A 3A2FA 3RR8A 4WQ5A 4Z4IA 3ZT4A 5IT9O 1BUPA 1RTJA 3ZCMA 2D0BA 1GLAG 4CGHA 4DSIA 3CJ7A 3WEEB 2ZJQL 3OBYA 3CCEN 4O8KA 4LF5K 3I0RA 4OLBA 3U8XA 1CZBA 4F3TA 1UWBA 4ILJA 5FRMA 1BG3A 4EP5A 4OLAA 3MAQA 3FZFA 1XNRK 2YHBA 4NB4A 3GG4A 3THVA 3VESA 4O8UA 4PWDA 2O8EA 2P9UA 3MECA 3KD1E 1WSEA 3VQ4A 4GNIA 5C10A 4CFBA 3PX6A 3AO3A 1NMNA 4BRLA 3PX0A 4O0JA 1RTHA 1VSJA 1VQ8N 3CCMN 2OYQA 2A5XA 3W3DA 3ZYYX 4J2BA 3BGRA 5FRNA 4DSKA 4FJ7A 4Z94A 3RWUA 2DFEA 4PKIA 1IG9A 3IS9A 3EZWA 1RBSA 3CPEA 4FLZA 1ATNA 1SL2A 3BY5A 1Z26A 5HP1A 1YJ9N 3BP8A 1HMVA 1D5AA 5ADXA 3QB0A 1BISA 5BPNA 3ZSXA 3H3OB 1LW0A 1VSHA 1EX4A 3MWTA 3QEPA 4B9QA 4CE9A 4JKCA 4JKGA 2OTLN 1LAVA 2UXCK 4CEEA 3K59A 3WNHA 1S1XA 3A5NC 1BHLA 2O8DB 4K0KK 3O9SA 1S9GA 1MWMA 3MX5A 3TAFA 3HO1A 4DTRA 3HPGA 2KKZA 1QSLA 4MDBA 2ZGZA 1MDUB 2FXUA 3CMEN 4N76A 3MCPA 1VQON 4B1XB 4FOIA 3UB5A 2G8WA 2DY4A 1J6ZA 3J81O 5AQTA 3FR0A 1VSDA 3DXKA 2F8SA 2P9NA 3O3FA 3NCIA 2BTFA 5KQDA 4IOCL 4QAGA 1RFQA 5I3UA 2P9SB 4JRPA 4BDZA 3DMJA 3OY9A 1KFSA 2YKNA 3CMAN 2JLEA 3HPOA 3VQ9A 3C6UA 3H3NO 4RW9A 1SUQA 1EXQA 1S3XA 5AQKA 3NHGA 4OKEA 1JL2A 1GLCG 3WXIA 2ASPA 1SQKA 3U3YA 1VSEA 5AQRA 3VA0A 2JGUA 1DEJA 3OJUA 1L3VA 1HX1A 2KTQA 5GIPA 4BREA 4EHTA 5KI6A 4M3ZA 3HSTB 4EZ6A 4A59A 4CJFA 3FLCO 4JKFA 2PAVA 3AVAA 3LDPA 1NGCA 1ITGA 3CJCA 4DFMA 3TAGA 4I9QA 4BDPA 3PO5A 5AJ3K 2P51A 3R1XA 4A5AA 1N32K 1B9FA 2VWBA 2IVNA 3EY1A 3L0QA 4GMJB 3OTOK 2G8UA 1TYQB 4B9TA 4Z4EA 3O80A 3AV9A 4BRPA 4LF4K 3H6EA 4O0IA 1U2VA 2D4WA 4DTMA 4NLCA 5HL7L 1RDBA 2HF3A 1BIUA 3NVMA 1BCMA 3K57A 1U45A 4B3OA 1BI4A 4DSJA 2P9PA 2P9IB 1ZBSA 4U7BA 3RTVA 4CBUA 2BUPA 2X6SA 3A5LC 1WN7A 1JCGA 2E6LA 4F2RA 2GV9A 3DLKA 3KK7A 2QXLA 5EX5A 4FVUA 1RGIA 4FJXA 3HT3A 5HROA 2IGIA 3ZETB 4Y0WA 3HK2A 1Z6RA 4B9LA 3LDOA 4CGFA 3HOSA 4IG0A 1VQ5N 5LJVA 4X64K 4M3UA 4FLTA 3JSMA 5EY4A 1CZAN 4XEIA 3QBXA 1TK0A 2VYPA 4MQ3A 1NWKA 2FF6A 1X9MA 1KLNA 2HBLA 4FJNA 3DRPA 2O4IA 4E1MA 5CY4A 1WSFA 1C1CA 3CQXA 4AH9A 4H0TB 4B9UA 2YV0X 2ZWHA 3LWLA 1GOAA 4ICLA 2FBXA 1YAGA 4DG1A 2KW4A 3FFKB 4H5NA 3MN7A 4CJRA 3OS2A 4UQGA 3O9QA 1L3TA 3LDQA 3UE5A 4OPKA 1E3MA 4B1YB 1HNZK 1SZ2A 5AQSA 2Q3SA 4KHQA 3D7EO 3BZKA 4PA1A 1ZBIA 5SWMA 2GEMA 5AQHA 1DLOA 2Q1NA 4DQIA 3MEGA 4J2EA 2YHXA 1JLAA 5AZIB 3M6GA 2D5RA 1ZBFA 5FLXO 3P38A 4KB0A 3F5TA 4EIAA 3UKRB 1BL3A 2WC9A 3OS0A 4Q5VA 3AVNA 3SPYA 3EE9A 3ATUA 1OVYA 1VSLA 3KK3A 4CD1A 2E1ZA 5FPEA 2RN2A 4FWOA 5TKYA 2EHGA 4JHDA 3GL1A 1P90A 4JI8K 4J2AA 1U47A 1HNWK 3CYMA 3G6EN 1NJYA 5CHIA 3JAMO 2UUBK 3VEWA 3B8AX 3KLHA 1U48A 3DXMA 3RSEB 1NK8A 2DFHA 4F2SA 5FPMA 1KLMA 1I3AA 3O9TA 4CVNE 1VQ4N 3LDNA 4H0PA 3ALYA 3KLFA 1OH8A 3O3HA 4HUGA 3NGYA 4DCHA 3ISNC 4A62A 3QESA 3M8SA 4M45A 4IDHA 4BR4A 5IWAK 3WNFA 3U3GA 2FBTA 4TSXA 4KV8A 3CC2N 2WONA 3THWB 2XHBA 1XC3A 5I42A 4AM7A 4CJ3A 2IOCA 3F9KA 5FPDA 3NH1A 4M3RA 2QM1A 3J7YP 1RT7A 4F3OA 1O13A 5KPTA 3O1BA 3V6DA 3LDLA 5B8HA 4FJMA 3KK1A 4W5NA 4CEAA 4F8RA 3SZ2A 3NF6A 1HJRA 4YOWA 1OVQA 3WEEA 2ZQBA 1ASUA 4KTZA 4B1WB 5KTQA 3HSCA 4BC4A 1K73O 3OBWA 3WQTA 2V51B 2P5OA 4DV4K 4CF8A 1VSKA 4BRFA 1IBKK 1A5VA 1NBWA 1NJIO 3IRXA 3F73A 4B9MA 4FJ8A 4CHOA 1RDUA 3DRSA 1HJOA 2GUIA 2NRHA 4XIUA 4DF4A 2RE2A 1RBUA 1S1WA 2VWJA 4DSEA 4L8RB 4H5WA 3O3GA 2QWNA 1TUUA 4DQSA 3IFRA 4DV0K 3Q7CA 4JKAA 3CC7N 3I33A 3ID6A 3PIPL 2OA8A 3M5RA 4DWIA 3VOVA 4CFAA 1Y97A 3K5NA 4HTUA 4BE0A 2HHSA 2WOMA 3P83D 4BRHA 1KSPA 5E84A 1S1TA 3SCXA 4MO5A 4DQ8A 3P4IA 1T44A 3QFPA 1KRPA 4B3SK 3QEIA 5HRNA 4AHRA 5F2RA 3SQ0A 3VMFB 1H1VA 3TU5A 3O6WA 1VRTA 2OZSA 4FZYA 4CJEA 3ZT3A 4I6MB 5FPNA 4YNQA 1HKBA 3T1YK 3VQCA 4NYNA 1XNQK 2WTUA 4CF2A 1SV5A 1IO2A 2HHWA 1HRHA 4JRQA 3RMCA 1RBVA 4CJVA 2DPNA 4FSVA 3VA3A 3SMPA 2O8DA 5C0YA 3TSQA 1QQMA 2BDPA 3HOTA 2KLAA 2YNHA 2XO7A 2NNWA 1NU0A 4BRNA 4IKFA 4BWMA 4IG3A 4WQ4C 2NZTA 3AO5A 1KVAA 4HUEA 4YOUA 4YOXA 3DOKA 2HF4A 4JI4K 4CHYA 1TKTA 2FC0A 4M41A 3ZSOA 3ULDA 1NM1A 3C65A 2CGKA 3THXB 5AQVA 3VGLA 2HBMA 3SUNA 4AHTA 3HP6A 2W41A 2Z1IA 2OCEA 1Q81O 1N8RO 2P9SA 1N33K 4JI5K 1YTAA 3VEZA 2Q2RA 3TANA 2HVIA 5EOYA 4CEZA 1X3MA 1QTMA 4FWQA 2P9KA 1X3NA 1L3UA 1SL0A 4U67L 3P5JA 5M1KA 3AVKA 3DLHA 1K8AO 4DUZK 2B5JA 3DI6A 3ID8A 5CZ2A 1X9JA 3MEEA 1TK5A 4C8LA 3PIOL 2HMIA 3LP3A 3PV8A 4KH4A 2HVHA 3U4LA 3QIOA 5AQPA 5JVHL 2NRRA 4BRIA 1ASWA 3LPUA 4K25A 3EKUA 1IV0A 2VQFK 1S1VA 1JLBA 3CCLN 3RRGA 4DQQA 4Z4HA 4BR5A 4Z0UA 4FWSA 4NLBA 1TYQA 4KBOA 3KK2A 3O4WA 4B1UB 3SV4A 3OYCA 4HTLA 4XH1A 3IMXA 2GBZA 4LFCK 5KGWA 2NRXA 3OW2M 2YI1A 1YJWN 1TL1A 3TARA 2XY7A 1W2BM 3A5MC 1XC9A 4W5OA 2E20A 1VQPN 4CIFA 4DHYA 1GLLO 1D9FA 4HUFA 2OPRA 4PKGA 2GTDA 2P9IA 3K58A 3VERA 3R3LA 4JI1K 3CFPA 3ZX0A 3B6PA 4A2AA 1EWQA 4CF1A 2A41A 1G15A 1L5UA 3CJBA 4PKHA 4K8XA 3ZETA 2YJFA 4WCEL 3EZ5A 4NYFA 3J7AP 2D0OA 3M8PA 1VQKN 3K0SA 1A5WA 4GV3A 1QZ5A 4JN4A 3O4QA 3ULEB 4LFBK 4CK3A 5DK5A 1WSIA 4BGAA 1NGAA 3ENBA 2CH5A 4N47A 3CXCM 1S1UA 1VHXA 3TI0A 4O4GA 1JLQA 4M3YA 1I94K 1KC8O 4DTNA 2XY5A 3R8EA 1CXUA 4CHZA 2GWKA 4FZXC 2VQEK 3F9MA 2YKMA 1JLGA 3ZX2A 3SNNA 4H5VA 3WXLA 4LD0A 3ZT2A 1RCHA 2KHOA 3CI5A 3CCVN 1XUPO 3FE1A 3SUOA 4AM6A 3LP0A 4FLYA 4DTOA 4L3QA 5AZIA 3V1OA 1W0HA 2ZD1A 3E01A 4KH6A 4IO9L 5KQ8A 3VQ5A 1GLDG 4JNEA 5TKWA 5CR4A 4C8NA 4RW7A 3EL2A 3UKRA 3VQAA 3K5OA 3GOIA 2RKIA 1J9AA 5AQNA 2YX6A 3I8DA 4DUYK 2XRIA 3QICA 3H1QA 4FCYA 4O55A 3O5BA 1LV5A 4X66K 4KHYA 3E9PA 4EFHA 4IWVA 3QEWA 5AQOA 5KGXA 2BGGA 3LPTA 3RSEA 1XMOK 2O8FB 3G4SN 4AQYK 4LFAK 2X74A 1NG9A 1HR0K 2X78A 1ZXOA 3L6QA 1NGDA 4OPAA 3MX2A 3KIOA 1ZBHA 4WF9L 1YUWA 1MA9B 3GDQA 1Z25A 3OHRA 4CBXA 3SYZA 1B9DA 1W7AA 2KZMA 5C25A 1QQNA 4A61A 4B08A 4MFBA 3THWA 3DRRA 1U04A 3SPZA 4ELTA 4JK9A 4B1ZA 4CK2A 4W5RA 3OVNA 4FK2A 4JI6K 1U6ZA 2WUSA 4PHTX 1X9SA 3AAQA 4MLEA 3NAEA 1YVUA 4FYDA 2FSNA 4CFDA 4W5QA 1KXPA 4LF9K 2QWQA 2HNDA 2P9KB 4EAHD 3HRGA 1EQYA 3BZCA 3DYAA 3IG1A 4OVLA 2G8VA 1YJNN 3OYBA 1NGEA 1YIJN 4Y1CA 5E41A 3EYZA 3CFRA 3O1WA 4BQLA 1X9WA 1EKEA 3P39A 1O1WA 4I7FA 1S9EA 1TV6A 4FO0A 5EXWA 2X6NA 3KZBA 4IO8A 4KH5A 5HOOA 1TAUA 3HTVA 3TWHA 3PX4A 3DOLA 3VGMA 2UXDK 1N34K 4KI6A 3CJ9A 2VG7A 3I8BA 5BPLA 3HI0A 5T7BA 1RTIA 3L4QA 1QVGM 3L3UA 4DSFA 1DT9A 1ZBLA 4ELUA 3DLLL 3QNOA 3T1AA 3V9UA 4BRAA 3LZIA 4B9VA 4FJGA 5JS2A 3AAPA 3L2VA 3OYHA 1VQMN 5CZ1A 4WE1A 2KFZA 4BWJA 1YHQN 1VSIA 5C42A 1XWLA 3D45A 4OX9K 4DU3A 4HWIA 1RT1A 3CQYA 4OGCA 1XMQK 4XH5A 4EZ9A 4ILHA 1NK0A 4QS9A 1NJWA 4YHHK 1Q9XA 3H1VX 4IOAL 4DR5K 4ISFA 1ATRA 1W9HA 4DR1K 1FKPA 2IS3A 3RRHA 4I6MA 4PY5A 2NRVA 4H0OA 4B3TK 1BQMA 3S3MA 1TKZA 4CCHA 4FK0A 4JYAK 4BRGA 3SQ2A 3SAGA 3SQ1A 2E1YA 2B6AA 3NMUA 3SJHA 4CESA 3BF3A 2BANA 1OH6A 4KREA 4CGGA 4E89A 1GLJO 2OTJN 2YNGA 1OH5A 1S5JA 1NLVA 3I0SA 3V4IA 3EEQA 3R6MA 4JD2B 2UUCK 3THYB 5AZJB 3LAKA 4DR2K 2NLXA 1NGJA 2HB5A 3WQUA 4EP4A 3VEOA 1J53A 1ZC6A 4CZGA 1F21A 3O4NA 1YITN 2QTDA 4CK1A 1R0AA 1UA0A 1YT3A 3NH0A 4NCBA 4BVOA 2XY8A 1WOQA 2YJEA 3THXA 3KWGA 4M3WA 4PQUA 4BRMA 3ZT0A 4BDYA 3E66A 4A5BA 4FJJA 3MN5A 1T3VA 3NH2A 4QCLA 1K8KA 2PFUA 2NRTA 3V1RA 1I39A 3OA9A 2GUPA 3P1GA 3E9LA 2NRWA 3KLGA 3AA5X 4E1JA 3NF9A 3ZSQA 2PYJA 2JWLA 1KQSM 5C2FA 2BE2A 2W40A 1NOZA 4RW6A 1VQ9N 3MXJA 4CJTA 1NKEA 2RHKA 2D1KA 3D2FB 3S41A 1K6YA 3L4IA 4WQ4A 4ID5A 3AA2A 1KTQA 4GV6A 1BU6O 3KJVA 1D9DA 4K43A 1S22A 1GLEG 5M1FA 4FK4A 4RWTA 4AILC 4HHTA 2YHYA 2ZJRL 4WFBL 1HKCA 1Q9YA 5LMNK 4CJWA 3AARA 3I56N 3VTHA 3SV3A 4DFPA 1LWFA 4FLUA 5BRFA 2E5LK 4IZ9A 1CLQA 3PY8A 1BA1A 4DS4A 1WB9A 5GIOA 1HYZA 2F9TA 1K9MO 2FBVA 3LP1A 3VQ8A 1FXXA 3KLIA 3LP2A 3ZSRA 1T05A 3C6HA 3A0IX 3D6RA 1G99A 2AJQA 1BDGA 3O8MA 1E4GT 3AO4A 4DV5K 3TAQA 5D3GA 4H4OA 5BR9A 4DLEA 2HBKA 4CGIA 4KPYA 4DTXA 2QWLA 4CJQA 4E1NA 4DQPA 1TVRA 4CIGA 1HUXA 3L8BA 1VQ6N 2AP1A 4BQZA 4E7HA 4B3MK 2HNYA 4M63C 1VSFA 4R5PA 4CHPA 2EWSA 2O8BB 4OJRA 4V19S 4DFJA 1VQ7N 1WAJA 3AO2A 4BR9A 3HM9A 1B92A 3ULEA 2Y1JA 2B4JA 3UIQA 3AVLA 3S9HA 5C2DA 5LY3A 3MN6A 4H0XB 4LSLA 4C8KA 1SS6A 3CPWM 1RBRA 4FM0A 3SI6A 3T1HK 4PL7A 1CZ9A 4X62K 4M3XA 3FFIA 2QW9A 4DTJA 1BGXT 3BF1A 3DAWA 4BRQA 4DSLA 4R79A 1QVFM 3OYKA 3QNNA 4I2PA 2E4LA 4BROA 3U9ZA 1XI1A 5EVZA 4JS4A 3U6FA 5JLFA 2HHQA 2HHUA 3MN9A 3VQDA 2ATQA 1RT3A 3LM2A 1ASVA 4KHUA 3O08A 1NGHA 5JLHA 5LL6Z 1C0TA 4QS7A 4JI2K 4BC2A 3SJJA 2Q36A 3O9UA 3QMLA 5DMRA 3RMBA 3J7ZO 4N56A 3DLBA 4KFBA 1WBDA 1NK5A 5SZTA 4IEEA 3MK6A 1EP4A 3OYGA 5C12A 2BH1A 4O5BA 2A6AA 3N4QA 3H45C 1WUAA 2Q0UA 3O9RA 5FDLA 2O8FA 2PZSA 1N36K 5E26A 1NJXA 1BOTO 3BUZB 1JCFA 1NGFA 4OPHA 2P1JA 2QXFA 2F7TA 5J2NA 2DTUA 1ZBUA 3S3OA 4J8FA 2A1SA 3K9KA 3NDKA 4KTWA 4CZKA 4LY7A 1DTQA 1K8KB 1IKWA 2H3GX 2Z1GA 3ZEUB 1RT5A 3G25A 3PO4A 3K5LA 4K8ZA 4JV5K 1J5EK 5H1SQ 4DV3K 4YFUA 3OYMA 1YTUA 3VENA 5KPRA 2QKBA 2Q0RA 3ZSZA 4G1QA 1NK6A 1LAWA 2W42A 5AR0A 3H46O 4DV2K 1T6CA 4B3RK 4H5TA 4CFCA 5BRDA 2YNIA 3HL8A 4E7JA 3QEVA 4ILGB 2VGMA 4ELVA 3VQPA 5F1XA 5BR8K 3WUHA 4DKWA 4IJAA 4JK8A 2CGLA 3KWIA 2ASOA 4JS5A 4FPAA 4CBWA 4FLXA 5GAHP 3SBGA 4B8AB 3V9WA 4ISEA 2E2QA 4CHQA 4BG9A 3WXJA 3T7ZA 4DV7K 3M3ZA 1QQOA 1YVNA 4BRKA 2D0AA 3QFUA 1RT2A 3B6OA 4NCAA 4C8MA 2UUAK 2E8AA 4C23A 1NK7A 4BY9C 3SAFA 3TAPA 4ID1A 2O4GA 4BE1A 1EWRA 3OS1A 1SAZA 5AQZA 5JS1A 4BG8A 4YOTA 5AQXA 2QWPA 4IBNA 3C6TA 3EE8A 3L2QA 3ITHA 4CZFA 4YDUC 3G0ZA 2EX3A 1LWEA 3E1YA 3QINA 3HJFA 2IC3A 1WBBA 3TR8A 1WSHA 3D2EB 4CERA 1Z05A 3DLRA 2W6LA 4OPJA 3AVIA 3RR7A 2OPSA 1SKWA 3IKMA 3J80O 4W5TA 3CJ1A 2XY6A 3QIPA 3FZKA 4PL8A 3NBPA 1YF5L 2VCPA 1QHAA 3MDQA 3QERA 3T19A 4JK7A 2R7YA 4CEOA 3NFAA 2VG5A 4H0VB 4JD2A 1QE1A 3THYA 5AZJA 3TABA 3T69A 3TPQA 1GLBG 3KTQA 2QWOA 5CE3A 3OYJA 3TTDA 3PLAA 3VQQA 2P5GA 3DWLA 3FZHA 4LF8K 4FM2A 1IJJA 2ZJPL 1XHXA 1BIZA 3LALA 2LSNA 5HBMA 1MWKA 2I7NA 3WNGA 4CHNA 5KRTA 1REVA 2HOEA 4CECA 4CZLA 1VAZA 2Q31A 4WFNL 1IKYA 3LANA 4B1VA 5AQGA 3SUQA 1JCEA 1OKJA 4DR4K 3AVMA 3PUFA 4B9NA 1Q8IA 4FL9A 3ZX3A 3V9ZA 3CHWA 1Q82O 3JS6A 1JXBA 2HW3A 1RILA 2QI2A 1HQUA 3BDPA 1NNEA 3QETA 4QS8A 4JKHA 3VQ7A 3CJAA 3JXUA 5LJWA 4F9OA 2P9LB 2ETJA 3M8QA 4FXDA 4KHWA 3UKUB 2ITGA 1UOCA 2VG6A 3D2FA 1QZ6A 3CCUN 4GVEA 4HCBA 4CGJA 4CJLA 3FGUA 5GINA 4UY8O 4GKKK 3QDKA 3A8YA 1Y64A 4BE2A 4B9SA 4DR7K 2OPPA 3CM5A 1NKCA 2GELA 5CYMA 2CGJA 1M90O 1Q86O 3K9JA 2G8IA 3KVGA 3IUCA 4GY2B 5J2PA 1NGIA 2HHVA 1IBMK 5AQYA 3BEXA 4JKDA 2NRZA 1IBLK 4DU4A 4FLWA 1VQNN 1QQCA 2G8HA 3CC4N 4FWKA 3SK3A 3DJCA 4FWRA 5JICA 2RPIA 3G10A 4OKKA 3KHYA 1W97L 1S6QA 4KI4A 3NGIA 1J54A 2A40A 3HVRA 4CZHA 1T03A 4NXMK 1KAXA 3SAHA 3SBTA 1RDDA 4IDKA 2E6MA 5C15A 3J8AA 3MXMA 4A2BA 4KB1A 3OJSA 3NVKA 3EO3A 1GOBA 3LWMA 2Z1JA 4LC9B 4KRFA 3HZ6A 3MMVA 1D8YA 2HHTA 4DF8A 2O8CB 1RTDA 3CG7A 3TSUA
chains in the Genus database with same CATH topology
3MXJA 4CJTA 1C0MA 1TL3A 4YNQA 3OYEA 1C6VA 1ZYQA 3VQCA 1NKEA 4E7KA 3A2FA 1MU2A 4NYNA 3RR8A 4CF2A 4Z4IA 3ZT4A 3ZCMA 1RTJA 1RNHA 1IO2A 1K6YA 1SV5A 2D0BA 2HHWA 1HRHA 4JRQA 4CGHA 4DSIA 3HP9A 3RMCA 3RMDA 1RBVA 3VN5A 4CJVA 4ID5A 3AA2A 3VA3A 1KTQA 3I0RA 4OLBA 3KJVA 1CZBA 4F3TA 1UWBA 1D9DA 2BDPA 4FK4A 5FRMA 2HW3A 4EP5A 2YNHA 3MAQA 4AILC 4OLAA 2XO7A 1VK0A 4IKFA 4HHTA 1JKHA 2FBYA 2YHBA 3NF8A 4KO0A 4BWMA 1Q9YA 3THVA 4CJWA 2D0CA 1KCFA 3SV3A 4IG3A 4PWDA 1HYVA 4I2QA 3D0PA 4DFPA 3AO5A 1HYSA 1LWFA 3MECA 4LSNA 1KVAA 4HUEA 4FLUA 4C8OA 3SUPA 3KD1E 1WSEA 3DOKA 3KKRA 3VQ4A 3PY8A 4CFBA 4CHYA 3PX6A 4OGEA 1TKTA 4QOZB 4HCCA 3AO3A 3AVCA 2FC0A 4M41A 3PX0A 4O0JA 1RTHA 1VSJA 3ZSOA 3ULDA 3KLEA 1TAQA 4DS4A 2OYQA 1TKDA 4J2BA 1HYZA 3BGRA 3SUNA 5FRNA 2RF2A 2FBVA 4AHTA 3HP6A 1NJZA 2Z1IA 3LP1A 4DSKA 3VQ8A 4FJ7A 4DTUA 1FXXA 4CEQA 1YTAA 3KLIA 3LP2A 3ZSRA 1T05A 3RWUA 2DFEA 1IG9A 3IS9A 1RDCA 1RBSA 4FLZA 3SQ4A 1SL2A 2G8FA 3TANA 2AJQA 3IAYA 2HVIA 3AO4A 3TAQA 5HP1A 1Z26A 4CEZA 5D3GA 3DM2A 1VSMA 1EETA 1HMVA 4H4OA 3HYFA 5FROA 4DLEA 1D5AA 1HNVA 4CGIA 1QTMA 4KPYA 1BISA 4DTXA 1L3UA 1SL0A 4CJQA 4E1NA 4DQPA 1TVRA 3WNEA 3ZSXA 3P5JA 4CIGA 3ZT1A 3L8BA 3AVKA 1LW0A 4E7HA 1VSHA 3DLHA 1EX4A 2HNYA 4CEFA 2I5JA 1VSFA 4R5PA 3QEPA 1LWCA 2B5JA 3DI6A 5CZ2A 4CE9A 3T3FA 3MEEA 1TK5A 1LAVA 4H8KA 4CEEA 4C8LA 4CHPA 3K59A 2HMIA 4OJRA 3K2PA 3WNHA 4AHSA 1S1XA 3LP3A 2PYLA 3PV8A 4DFJA 2HVHA 1WAJA 3RMAA 3QIOA 1HNIA 1BHLA 3AO2A 3HM9A 1B92A 2Y1JA 1S9GA 2B4JA 5HRSA 4CJ5A 3TAFA 3UIQA 3HO1A 1N6QA 4DTRA 3AVLA 3HPGA 3S9HA 1QSLA 1KVCA 3QO9A 3CFOA 1ASWA 3LPUA 3VQBA 4N76A 1S1VA 1JLBA 1RDAA 2HHXA 3RRGA 1GOCA 4LSLA 2G8WA 3AVHA 4DQQA 4C8KA 2F8TA 2DY4A 4Z4HA 1RBRA 4Z0UA 4FM0A 3SI6A 1IKXA 4NCGA 4RG8A 2KQ2A 3KK2A 1CZ9A 1WSGA 4M3XA 3SV4A 3FFIA 4DTJA 3OYCA 1BGXT 4DSLA 1VSDA 2F8SA 3OYKA 4DTPA 2GBZA 3O3FA 3NCIA 3QNNA 3TAEA 4I2PA 2E4LA 2HNZA 5KGWA 1XI1A 4JS4A 3U6FA 4QAGA 2HHQA 1TL1A 4CJUA 3TARA 2XY7A 2KFNA 2HHUA 1CLQA 5I3UA 1FK9A 2ATQA 1RT3A 3VQDA 1XC9A 4KHQA 4E0DA 2IDOA 4W5OA 3DMJA 5HRRA 4JRPA 4BDZA 4CIFA 4FW2A 3OY9A 1KFSA 1ASVA 2YKNA 4KHUA 1D9FA 2JLEA 2OPRA 3HPOA 4HUFA 3VQ9A 3K58A 3C6UA 2NUBA 2Z1HA 3CFPA 1C0TA 4RW9A 3KD5E 3B6PA 1SUQA 3OYAA 3SJJA 1EXQA 4CF1A 3NHGA 4FVMA 4OKEA 1JL2A 1NKBA 3RMBA 5DMRA 1G15A 1WAFA 1L5UA 2YNFA 1RT4A 4Q0BA 4N56A 3DLBA 1JLCA 1WLJA 4KFBA 4K8XA 3U3YA 4M42A 1NK5A 5SZTA 1VSEA 3EZ5A 4NYFA 4AHCA 3VA0A 3ZSWA 2JGUA 3OJUA 1EP4A 3OYGA 3M8PA 1L3VA 2KTQA 4O5BA 1CXQA 5KI6A 3DLGA 4M3ZA 3HSTB 1A5WA 1UA1A 4EZ6A 1C1AA 3TAMA 3LDSA 3O4QA 4CJFA 5FDLA 1QSYA 2PZSA 4CK3A 5DK5A 3AVAA 1WSIA 1SKSA 4AHUA 1NJXA 4FJLA 1DTTA 1ITGA 4DFMA 3TAGA 4I9QA 1IH7A 5C24A 4N47A 3PO5A 4BDPA 4KAZA 1S1UA 2P1JA 4Y1DA 1VRUA 2P51A 4O4GA 4CF9A 1JLQA 3L2UA 1B9FA 4FM1A 3TI0A 4ZTFA 1J5OA 2QXFA 4M3YA 3OYFA 3EY1A 4DTNA 2XY5A 4GMJB 1CXUA 4CHZA 5J2NA 2G8UA 4I9LA 4FZXC 1BCOA 4B9TA 4Z4EA 2DTUA 1ZBUA 3AVBA 2YKMA 3S3OA 2VWKA 1JLGA 2A1SA 4E7IA 3NDKA 4KTWA 3OYDA 3SNNA 4N41A 3AV9A 3C95A 4LY7A 1DTQA 4O0IA 1IKWA 2Z1GA 3H08A 4LD0A 1RCHA 3ZT2A 4DTMA 1RT5A 4FLVA 1RDBA 3PO4A 1SL1A 1BIUA 4JLHA 3K5LA 3SUOA 4FJ5A 4K8ZA 4DS5A 1HPZA 3OYLA 3LP0A 4FLYA 1BCMA 3K57A 1U45A 4B3OA 4DTOA 1LW2A 3V1OA 1BI4A 1W0HA 2ZD1A 4YFUA 3OYMA 3E01A 4DSJA 4LH4A 3VQ5A 4AHVA 1TKXA 1YTUA 3JYTA 2QKBA 3ZSZA 1NOYA 3RTVA 4G1QA 4RW8A 1KVBA 1LAWA 2X6SA 3OYIA 3L2WA 4DQRA 2W42A 1NK6A 3ASMA 4C8NA 4CEBA 1WN7A 2E6LA 4F2RA 4RW7A 1L3SA 3M8RA 3VQAA 2GV9A 3DLKA 3K5OA 4CFCA 2RKIA 1J9AA 2YNIA 1IKVA 2DFFA 3HL8A 4E7JA 4LH5A 3I8DA 3QEVA 4FJHA 4CJKA 2XRIA 4FJXA 3HT3A 5HROA 4ELVA 1RBTA 2IGIA 3VQPA 5HRPA 4FCYA 4O55A 4DLGA 4FJ9A 3HK2A 4B9LA 1LV5A 4CGFA 3CM6A 4KHYA 4IG0A 4M3UA 4FLTA 3V9SA 3NF7A 3QEWA 4JS5A 3JSMA 4PUOA 1QS4A 5HLFA 5CYQA 5KGXA 2BGGA 3LPTA 4FLXA 3V9WA 4B8AB 1TK0A 1U49A 2KZZA 4CHQA 2X74A 4MQ3A 3KKSA 1X9MA 2X78A 4KHNA 1KLNA 4FJNA 2D0AA 3DRPA 2O4IA 1RT2A 3B6OA 3KIOA 1WSFA 5CY4A 4C8MA 1C1CA 3AVJA 4E1MA 3V81A 4NCAA 4CIEA 1NK7A 4Z4FA 1ZBHA 4AH9A 4B9UA 2YV0X 1JL1A 4O44A 1GOAA 3LWLA 4ICLA 3VQ6A 4ZHRA 3OYNA 2FBXA 1FKOA 3TAPA 1Z25A 4M3TA 4ID1A 2O4GA 3SYZA 4BE1A 4DG1A 1B9DA 2KW4A 4CJRA 3OS1A 3OS2A 5C25A 2KZMA 4UQGA 4B08A 5JS1A 1JLFA 3HXMA 4MFBA 3AA3A 1L3TA 4OPKA 3DRRA 1U04A 4IBNA 3SPZA 2Q3SA 3C6TA 3L2QA 3C94A 3LZJA 3ITHA 5EU7A 4CJSA 4CK2A 4W5RA 1U4BA 4ELTA 4FJIA 3OVNA 4PA1A 4FK2A 1ZBIA 3G0ZA 2EX3A 1LWEA 3QINA 5SWMA 1X9SA 4KTQA 3HJFA 1DLOA 4DQIA 2IC3A 1YVUA 3NAEA 1XHZA 3MEGA 4J2EA 4FYDA 4CFDA 4W5QA 3TR8A 1WSHA 2ZE2A 1JLAA 1BI4B 2HNDA 4CERA 2D5RA 1ZBFA 3DLRA 3L3VA 4OPJA 2G8VA 3AVIA 3DYAA 3IG1A 4OVLA 3RR7A 2OPSA 3S3NA 3OYBA 1SKWA 4W5TA 2XY6A 4Y1CA 5E41A 4KB0A 4KHSA 3QIPA 1BL3A 4Z4CA 3OS0A 3EYZA 3CFRA 3NBPA 1X9WA 1EKEA 3AVNA 1O1WA 4I7FA 4Q5VA 4E3SA 3QEXA 1S9EA 3SPYA 1TV6A 3QERA 3AVFA 4HVJA 3T19A 1VSLA 3KK3A 2X6NA 2R7YA 4FZZA 4CEOA 1NK4A 3NFAA 4E7LA 2RN2A 2VG5A 1TAUA 3TWHA 3PX4A 3AO1A 1TK8A 3DOLA 1QE1A 2EHGA 3TABA 4J2AA 1U47A 4KI6A 3CYMA 3KTQA 1NJYA 3OYJA 3NE6A 2VG7A 4KKOA 5T7BA 3VQQA 2P5GA 1RTIA 3KLHA 4FM2A 1U48A 3L3UA 4DU1A 4Z4GA 4DSFA 1XHXA 1BIZA 3LALA 2DFHA 2LSNA 1NK8A 5HBMA 4F2SA 4J2DA 1TGOA 1ZBLA 4ELUA 3ZSYA 3QNOA 3WNGA 4CHNA 5K14A 3T1AA 5KRTA 3L2RA 1REVA 1NK9A 2QK9A 3V9UA 1KLMA 1I3AA 4B8CA 3LZIA 3ALYA 4CECA 3KLFA 4B9VA 4FJGA 3O3HA 4HUGA 3NGYA 2PY5A 5JS2A 3L2VA 3OYHA 5CZ1A 3ISNC 1IKYA 3QESA 3LANA 4WE1A 5J2MA 1SKRA 5J2QA 3SUQA 4BWJA 2KFZA 1WSJA 4N5SA 1VSIA 4M45A 5C42A 3M8SA 1XWLA 3D45A 4DFKA 4DU3A 3WNFA 1RT1A 3AVMA 3HVTA 4OGCA 3DLEA 3U3GA 2FBTA 4TSXA 4IFVA 4KV8A 2Y1IA 3CQ8A 3PUFA 4B9NA 2WONA 4EZ9A 2XHBA 1Q8IA 1NK0A 3LAMA 5I42A 1NJWA 3V9ZA 4CF0A 1RT6A 4CJ3A 1Q9XA 2IOCA 3F9KA 4F4KA 1JLEA 4GW6A 1W9HA 4GVMA 1JXBA 3K5MA 2OPQA 1RILA 4M3RA 1S6PA 1HQUA 3NH1A 1FKPA 1KFDA 3BDPA 2IS3A 3MEDA 3RRHA 3QETA 4PY5A 1RT7A 4F3OA 3VQ7A 2ETJA 1BQMA 3M8QA 3V6DA 1TKZA 3S3MA 4CCHA 2G8KA 4DTSA 4FK0A 4KHWA 4FXDA 2ITGA 4CGDA 3SQ2A 1UOCA 4FJMA 2VG6A 3KK1A 3SQ1A 4W5NA 4CEAA 2B6AA 4F8RA 3SZ2A 3NF6A 4RW4A 4BACA 4HCBA 1HJRA 2YHAA 2ZQBA 4CGJA 1ASUA 4CJLA 4CESA 1T7PA 4KTZA 5KTQA 4OKJA 3AA4A 2BANA 3HPHA 3MXIA 4CJPA 4BE2A 4B9SA 4KREA 4CGGA 4E89A 2P5OA 4FW1A 2YNGA 4CJ4A 4CF8A 2OZMA 1S5JA 1VSKA 2F96A 3VQEA 1A5VA 2OPPA 4FJKA 3I0SA 4DMNA 3CM5A 3V4IA 1NKCA 5CYMA 2QKKA 3IRXA 3F73A 3LAKA 4B9MA 4FJ8A 1HQEA 2G8IA 1X1PA 2HB5A 4CHOA 1C1BA 4EP4A 2IAJA 3DRSA 1J53A 3V1QA 1F21A 3O4NA 4IFYA 1BQNA 5J2PA 2HHVA 2GUIA 4ZTJA 1JXEA 4XIUA 2A1RA 5J1EA 4DF4A 1KRPA 4DU4A 4FLWA 1QQCA 1RBUA 1S1WA 2VWJA 4DSEA 4CK1A 1R0AA 1UA0A 2G8HA 3O3GA 4L8RB 1QSSA 1T8EA 1YT3A 3QLHA 4DQSA 3NH0A 4NCBA 2XY8A 4E19A 1QHTA 2RPIA 3G10A 4OKKA 4M3WA 4PQUA 1A5XA 3ZT0A 4BDYA 2OA8A 4FJJA 1S6QA 3V9XA 4DWIA 4CFAA 3NH2A 1Y97A 3K5NA 3NGIA 4HTUA 4KI4A 4QCLA 1J54A 4BE0A 2HHSA 2WOMA 3P83D 4CEDA 1UAXA 1I39A 3V1RA 3HVRA 1T03A 1KSPA 3P1GA 5KRSA 1S1TA 3NGZA 3SCXA 1WNSA 1RDDA 4IDKA 2E6MA 3KLGA 3AA5X 4H4MA 3QEIA 3MXMA 5HRNA 3NF9A 4AHRA 3ZSVA 3ZSQA 4KB1A 2PYJA 3OJSA 1GOBA 3SQ0A 2BE2A 1VRTA 3LWMA 2Z1JA 2OZSA 4KRFA 4FZYA 4CJEA 1D8YA 2HHTA 3AVGA 3ZT3A 4DF8A 1NOZA 1N5YA 1RTDA 4RW6A 3CG7A 1C0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MXJ A;  4CJT A;  1C0M A;  1TL3 A;  4YNQ A;  3OYE A;  1C6V A;  1ZYQ A;  3VQC A;  1NKE A;  4E7K A;  3A2F A;  1MU2 A;  4NYN A;  3RR8 A;  4CF2 A;  4Z4I A;  3ZT4 A;  3ZCM A;  1RTJ A;  1RNH A;  1IO2 A;  1K6Y A;  1SV5 A;  2D0B A;  2HHW A;  1HRH A;  4JRQ A;  4CGH A;  4DSI A;  3HP9 A;  3RMC A;  3RMD A;  1RBV A;  3VN5 A;  4CJV A;  4ID5 A;  3AA2 A;  3VA3 A;  1KTQ A;  3I0R A;  4OLB A;  3KJV A;  1CZB A;  4F3T A;  1UWB A;  1D9D A;  2BDP A;  4FK4 A;  5FRM A;  2HW3 A;  4EP5 A;  2YNH A;  3MAQ A;  4AIL C;  4OLA A;  2XO7 A;  1VK0 A;  4IKF A;  4HHT A;  1JKH A;  2FBY A;  2YHB A;  3NF8 A;  4KO0 A;  4BWM A;  1Q9Y A;  3THV A;  4CJW A;  2D0C A;  1KCF A;  3SV3 A;  4IG3 A;  4PWD A;  1HYV A;  4I2Q A;  3D0P A;  4DFP A;  3AO5 A;  1HYS A;  1LWF A;  3MEC A;  4LSN A;  1KVA A;  4HUE A;  4FLU A;  4C8O A;  3SUP A;  3KD1 E;  1WSE A;  3DOK A;  3KKR A;  3VQ4 A;  3PY8 A;  4CFB A;  4CHY A;  3PX6 A;  4OGE A;  1TKT A;  4QOZ B;  4HCC A;  3AO3 A;  3AVC A;  2FC0 A;  4M41 A;  3PX0 A;  4O0J A;  1RTH A;  1VSJ A;  3ZSO A;  3ULD A;  3KLE A;  1TAQ A;  4DS4 A;  2OYQ A;  1TKD A;  4J2B A;  1HYZ A;  3BGR A;  3SUN A;  5FRN A;  2RF2 A;  2FBV A;  4AHT A;  3HP6 A;  1NJZ A;  2Z1I A;  3LP1 A;  4DSK A;  3VQ8 A;  4FJ7 A;  4DTU A;  1FXX A;  4CEQ A;  1YTA A;  3KLI A;  3LP2 A;  3ZSR A;  1T05 A;  3RWU A;  2DFE A;  1IG9 A;  3IS9 A;  1RDC A;  1RBS A;  4FLZ A;  3SQ4 A;  1SL2 A;  2G8F A;  3TAN A;  2AJQ A;  3IAY A;  2HVI A;  3AO4 A;  3TAQ A;  5HP1 A;  1Z26 A;  4CEZ A;  5D3G A;  3DM2 A;  1VSM A;  1EET A;  1HMV A;  4H4O A;  3HYF A;  5FRO A;  4DLE A;  1D5A A;  1HNV A;  4CGI A;  1QTM A;  4KPY A;  1BIS A;  4DTX A;  1L3U A;  1SL0 A;  4CJQ A;  4E1N A;  4DQP A;  1TVR A;  3WNE A;  3ZSX A;  3P5J A;  4CIG A;  3ZT1 A;  3L8B A;  3AVK A;  1LW0 A;  4E7H A;  1VSH A;  3DLH A;  1EX4 A;  2HNY A;  4CEF A;  2I5J A;  1VSF A;  4R5P A;  3QEP A;  1LWC A;  2B5J A;  3DI6 A;  5CZ2 A;  4CE9 A;  3T3F A;  3MEE A;  1TK5 A;  1LAV A;  4H8K A;  4CEE A;  4C8L A;  4CHP A;  3K59 A;  2HMI A;  4OJR A;  3K2P A;  3WNH A;  4AHS A;  1S1X A;  3LP3 A;  2PYL A;  3PV8 A;  4DFJ A;  2HVH A;  1WAJ A;  3RMA A;  3QIO A;  1HNI A;  1BHL A;  3AO2 A;  3HM9 A;  1B92 A;  2Y1J A;  1S9G A;  2B4J A;  5HRS A;  4CJ5 A;  3TAF A;  3UIQ A;  3HO1 A;  1N6Q A;  4DTR A;  3AVL A;  3HPG A;  3S9H A;  1QSL A;  1KVC A;  3QO9 A;  3CFO A;  1ASW A;  3LPU A;  3VQB A;  4N76 A;  1S1V A;  1JLB A;  1RDA A;  2HHX A;  3RRG A;  1GOC A;  4LSL A;  2G8W A;  3AVH A;  4DQQ A;  4C8K A;  2F8T A;  2DY4 A;  4Z4H A;  1RBR A;  4Z0U A;  4FM0 A;  3SI6 A;  1IKX A;  4NCG A;  4RG8 A;  2KQ2 A;  3KK2 A;  1CZ9 A;  1WSG A;  4M3X A;  3SV4 A;  3FFI A;  4DTJ A;  3OYC A;  1BGX T;  4DSL A;  1VSD A;  2F8S A;  3OYK A;  4DTP A;  2GBZ A;  3O3F A;  3NCI A;  3QNN A;  3TAE A;  4I2P A;  2E4L A;  2HNZ A;  5KGW A;  1XI1 A;  4JS4 A;  3U6F A;  4QAG A;  2HHQ A;  1TL1 A;  4CJU A;  3TAR A;  2XY7 A;  2KFN A;  2HHU A;  1CLQ A;  5I3U A;  1FK9 A;  2ATQ A;  1RT3 A;  3VQD A;  1XC9 A;  4KHQ A;  4E0D A;  2IDO A;  4W5O A;  3DMJ A;  5HRR A;  4JRP A;  4BDZ A;  4CIF A;  4FW2 A;  3OY9 A;  1KFS A;  1ASV A;  2YKN A;  4KHU A;  1D9F A;  2JLE A;  2OPR A;  3HPO A;  4HUF A;  3VQ9 A;  3K58 A;  3C6U A;  2NUB A;  2Z1H A;  3CFP A;  1C0T A;  4RW9 A;  3KD5 E;  3B6P A;  1SUQ A;  3OYA A;  3SJJ A;  1EXQ A;  4CF1 A;  3NHG A;  4FVM A;  4OKE A;  1JL2 A;  1NKB A;  3RMB A;  5DMR A;  1G15 A;  1WAF A;  1L5U A;  2YNF A;  1RT4 A;  4Q0B A;  4N56 A;  3DLB A;  1JLC A;  1WLJ A;  4KFB A;  4K8X A;  3U3Y A;  4M42 A;  1NK5 A;  5SZT A;  1VSE A;  3EZ5 A;  4NYF A;  4AHC A;  3VA0 A;  3ZSW A;  2JGU A;  3OJU A;  1EP4 A;  3OYG A;  3M8P A;  1L3V A;  2KTQ A;  4O5B A;  1CXQ A;  5KI6 A;  3DLG A;  4M3Z A;  3HST B;  1A5W A;  1UA1 A;  4EZ6 A;  1C1A A;  3TAM A;  3LDS A;  3O4Q A;  4CJF A;  5FDL A;  1QSY A;  2PZS A;  4CK3 A;  5DK5 A;  3AVA A;  1WSI A;  1SKS A;  4AHU A;  1NJX A;  4FJL A;  1DTT A;  1ITG A;  4DFM A;  3TAG A;  4I9Q A;  1IH7 A;  5C24 A;  4N47 A;  3PO5 A;  4BDP A;  4KAZ A;  1S1U A;  2P1J A;  4Y1D A;  1VRU A;  2P51 A;  4O4G A;  4CF9 A;  1JLQ A;  3L2U A;  1B9F A;  4FM1 A;  3TI0 A;  4ZTF A;  1J5O A;  2QXF A;  4M3Y A;  3OYF A;  3EY1 A;  4DTN A;  2XY5 A;  4GMJ B;  1CXU A;  4CHZ A;  5J2N A;  2G8U A;  4I9L A;  4FZX C;  1BCO A;  4B9T A;  4Z4E A;  2DTU A;  1ZBU A;  3AVB A;  2YKM A;  3S3O A;  2VWK A;  1JLG A;  2A1S A;  4E7I A;  3NDK A;  4KTW A;  3OYD A;  3SNN A;  4N41 A;  3AV9 A;  3C95 A;  4LY7 A;  1DTQ A;  4O0I A;  1IKW A;  2Z1G A;  3H08 A;  4LD0 A;  1RCH A;  3ZT2 A;  4DTM A;  1RT5 A;  4FLV A;  1RDB A;  3PO4 A;  1SL1 A;  1BIU A;  4JLH A;  3K5L A;  3SUO A;  4FJ5 A;  4K8Z A;  4DS5 A;  1HPZ A;  3OYL A;  3LP0 A;  4FLY A;  1BCM A;  3K57 A;  1U45 A;  4B3O A;  4DTO A;  1LW2 A;  3V1O A;  1BI4 A;  1W0H A;  2ZD1 A;  4YFU A;  3OYM A;  3E01 A;  4DSJ A;  4LH4 A;  3VQ5 A;  4AHV A;  1TKX A;  1YTU A;  3JYT A;  2QKB A;  3ZSZ A;  1NOY A;  3RTV A;  4G1Q A;  4RW8 A;  1KVB A;  1LAW A;  2X6S A;  3OYI A;  3L2W A;  4DQR A;  2W42 A;  1NK6 A;  3ASM A;  4C8N A;  4CEB A;  1WN7 A;  2E6L A;  4F2R A;  4RW7 A;  1L3S A;  3M8R A;  3VQA A;  2GV9 A;  3DLK A;  3K5O A;  4CFC A;  2RKI A;  1J9A A;  2YNI A;  1IKV A;  2DFF A;  3HL8 A;  4E7J A;  4LH5 A;  3I8D A;  3QEV A;  4FJH A;  4CJK A;  2XRI A;  4FJX A;  3HT3 A;  5HRO A;  4ELV A;  1RBT A;  2IGI A;  3VQP A;  5HRP A;  4FCY A;  4O55 A;  4DLG A;  4FJ9 A;  3HK2 A;  4B9L A;  1LV5 A;  4CGF A;  3CM6 A;  4KHY A;  4IG0 A;  4M3U A;  4FLT A;  3V9S A;  3NF7 A;  3QEW A;  4JS5 A;  3JSM A;  4PUO A;  1QS4 A;  5HLF A;  5CYQ A;  5KGX A;  2BGG A;  3LPT A;  4FLX A;  3V9W A;  4B8A B;  1TK0 A;  1U49 A;  2KZZ A;  4CHQ A;  2X74 A;  4MQ3 A;  3KKS A;  1X9M A;  2X78 A;  4KHN A;  1KLN A;  4FJN A;  2D0A A;  3DRP A;  2O4I A;  1RT2 A;  3B6O A;  3KIO A;  1WSF A;  5CY4 A;  4C8M A;  1C1C A;  3AVJ A;  4E1M A;  3V81 A;  4NCA A;  4CIE A;  1NK7 A;  4Z4F A;  1ZBH A;  4AH9 A;  4B9U A;  2YV0 X;  1JL1 A;  4O44 A;  1GOA A;  3LWL A;  4ICL A;  3VQ6 A;  4ZHR A;  3OYN A;  2FBX A;  1FKO A;  3TAP A;  1Z25 A;  4M3T A;  4ID1 A;  2O4G A;  3SYZ A;  4BE1 A;  4DG1 A;  1B9D A;  2KW4 A;  4CJR A;  3OS1 A;  3OS2 A;  5C25 A;  2KZM A;  4UQG A;  4B08 A;  5JS1 A;  1JLF A;  3HXM A;  4MFB A;  3AA3 A;  1L3T A;  4OPK A;  3DRR A;  1U04 A;  4IBN A;  3SPZ A;  2Q3S A;  3C6T A;  3L2Q A;  3C94 A;  3LZJ A;  3ITH A;  5EU7 A;  4CJS A;  4CK2 A;  4W5R A;  1U4B A;  4ELT A;  4FJI A;  3OVN A;  4PA1 A;  4FK2 A;  1ZBI A;  3G0Z A;  2EX3 A;  1LWE A;  3QIN A;  5SWM A;  1X9S A;  4KTQ A;  3HJF A;  1DLO A;  4DQI A;  2IC3 A;  1YVU A;  3NAE A;  1XHZ A;  3MEG A;  4J2E A;  4FYD A;  4CFD A;  4W5Q A;  3TR8 A;  1WSH A;  2ZE2 A;  1JLA A;  1BI4 B;  2HND A;  4CER A;  2D5R A;  1ZBF A;  3DLR A;  3L3V A;  4OPJ A;  2G8V A;  3AVI A;  3DYA A;  3IG1 A;  4OVL A;  3RR7 A;  2OPS A;  3S3N A;  3OYB A;  1SKW A;  4W5T A;  2XY6 A;  4Y1C A;  5E41 A;  4KB0 A;  4KHS A;  3QIP A;  1BL3 A;  4Z4C A;  3OS0 A;  3EYZ A;  3CFR A;  3NBP A;  1X9W A;  1EKE A;  3AVN A;  1O1W A;  4I7F A;  4Q5V A;  4E3S A;  3QEX A;  1S9E A;  3SPY A;  1TV6 A;  3QER A;  3AVF A;  4HVJ A;  3T19 A;  1VSL A;  3KK3 A;  2X6N A;  2R7Y A;  4FZZ A;  4CEO A;  1NK4 A;  3NFA A;  4E7L A;  2RN2 A;  2VG5 A;  1TAU A;  3TWH A;  3PX4 A;  3AO1 A;  1TK8 A;  3DOL A;  1QE1 A;  2EHG A;  3TAB A;  4J2A A;  1U47 A;  4KI6 A;  3CYM A;  3KTQ A;  1NJY A;  3OYJ A;  3NE6 A;  2VG7 A;  4KKO A;  5T7B A;  3VQQ A;  2P5G A;  1RTI A;  3KLH A;  4FM2 A;  1U48 A;  3L3U A;  4DU1 A;  4Z4G A;  4DSF A;  1XHX A;  1BIZ A;  3LAL A;  2DFH A;  2LSN A;  1NK8 A;  5HBM A;  4F2S A;  4J2D A;  1TGO A;  1ZBL A;  4ELU A;  3ZSY A;  3QNO A;  3WNG A;  4CHN A;  5K14 A;  3T1A A;  5KRT A;  3L2R A;  1REV A;  1NK9 A;  2QK9 A;  3V9U A;  1KLM A;  1I3A A;  4B8C A;  3LZI A;  3ALY A;  4CEC A;  3KLF A;  4B9V A;  4FJG A;  3O3H A;  4HUG A;  3NGY A;  2PY5 A;  5JS2 A;  3L2V A;  3OYH A;  5CZ1 A;  3ISN C;  1IKY A;  3QES A;  3LAN A;  4WE1 A;  5J2M A;  1SKR A;  5J2Q A;  3SUQ A;  4BWJ A;  2KFZ A;  1WSJ A;  4N5S A;  1VSI A;  4M45 A;  5C42 A;  3M8S A;  1XWL A;  3D45 A;  4DFK A;  4DU3 A;  3WNF A;  1RT1 A;  3AVM A;  3HVT A;  4OGC A;  3DLE A;  3U3G A;  2FBT A;  4TSX A;  4IFV A;  4KV8 A;  2Y1I A;  3CQ8 A;  3PUF A;  4B9N A;  2WON A;  4EZ9 A;  2XHB A;  1Q8I A;  1NK0 A;  3LAM A;  5I42 A;  1NJW A;  3V9Z A;  4CF0 A;  1RT6 A;  4CJ3 A;  1Q9X A;  2IOC A;  3F9K A;  4F4K A;  1JLE A;  4GW6 A;  1W9H A;  4GVM A;  1JXB A;  3K5M A;  2OPQ A;  1RIL A;  4M3R A;  1S6P A;  1HQU A;  3NH1 A;  1FKP A;  1KFD A;  3BDP A;  2IS3 A;  3MED A;  3RRH A;  3QET A;  4PY5 A;  1RT7 A;  4F3O A;  3VQ7 A;  2ETJ A;  1BQM A;  3M8Q A;  3V6D A;  1TKZ A;  3S3M A;  4CCH A;  2G8K A;  4DTS A;  4FK0 A;  4KHW A;  4FXD A;  2ITG A;  4CGD A;  3SQ2 A;  1UOC A;  4FJM A;  2VG6 A;  3KK1 A;  3SQ1 A;  4W5N A;  4CEA A;  2B6A A;  4F8R A;  3SZ2 A;  3NF6 A;  4RW4 A;  4BAC A;  4HCB A;  1HJR A;  2YHA A;  2ZQB A;  4CGJ A;  1ASU A;  4CJL A;  4CES A;  1T7P A;  4KTZ A;  5KTQ A;  4OKJ A;  3AA4 A;  2BAN A;  3HPH A;  3MXI A;  4CJP A;  4BE2 A;  4B9S A;  4KRE A;  4CGG A;  4E89 A;  2P5O A;  4FW1 A;  2YNG A;  4CJ4 A;  4CF8 A;  2OZM A;  1S5J A;  1VSK A;  2F96 A;  3VQE A;  1A5V A;  2OPP A;  4FJK A;  3I0S A;  4DMN A;  3CM5 A;  3V4I A;  1NKC A;  5CYM A;  2QKK A;  3IRX A;  3F73 A;  3LAK A;  4B9M A;  4FJ8 A;  1HQE A;  2G8I A;  1X1P A;  2HB5 A;  4CHO A;  1C1B A;  4EP4 A;  2IAJ A;  3DRS A;  1J53 A;  3V1Q A;  1F21 A;  3O4N A;  4IFY A;  1BQN A;  5J2P A;  2HHV A;  2GUI A;  4ZTJ A;  1JXE A;  4XIU A;  2A1R A;  5J1E A;  4DF4 A;  1KRP A;  4DU4 A;  4FLW A;  1QQC A;  1RBU A;  1S1W A;  2VWJ A;  4DSE A;  4CK1 A;  1R0A A;  1UA0 A;  2G8H A;  3O3G A;  4L8R B;  1QSS A;  1T8E A;  1YT3 A;  3QLH A;  4DQS A;  3NH0 A;  4NCB A;  2XY8 A;  4E19 A;  1QHT A;  2RPI A;  3G10 A;  4OKK A;  4M3W A;  4PQU A;  1A5X A;  3ZT0 A;  4BDY A;  2OA8 A;  4FJJ A;  1S6Q A;  3V9X A;  4DWI A;  4CFA A;  3NH2 A;  1Y97 A;  3K5N A;  3NGI A;  4HTU A;  4KI4 A;  4QCL A;  1J54 A;  4BE0 A;  2HHS A;  2WOM A;  3P83 D;  4CED A;  1UAX A;  1I39 A;  3V1R A;  3HVR A;  1T03 A;  1KSP A;  3P1G A;  5KRS A;  1S1T A;  3NGZ A;  3SCX A;  1WNS A;  1RDD A;  4IDK A;  2E6M A;  3KLG A;  3AA5 X;  4H4M A;  3QEI A;  3MXM A;  5HRN A;  3NF9 A;  4AHR A;  3ZSV A;  3ZSQ A;  4KB1 A;  2PYJ A;  3OJS A;  1GOB A;  3SQ0 A;  2BE2 A;  1VRT A;  3LWM A;  2Z1J A;  2OZS A;  4KRF A;  4FZY A;  4CJE A;  1D8Y A;  2HHT A;  3AVG A;  3ZT3 A;  4DF8 A;  1NOZ A;  1N5Y A;  1RTD A;  4RW6 A;  3CG7 A;  1C0U A; 
#chains in the Genus database with same CATH topology
 1S72 N;  3OYE A;  1ZYQ A;  1C6V A;  4FWL A;  2F9W A;  3CD6 N;  4E7K A;  1MU2 A;  1KD1 O;  2CH6 A;  1RNH A;  2WFB A;  2O8B A;  3HP9 A;  5AQW A;  2A42 A;  3RMD A;  3VN5 A;  3ENH A;  5BN9 A;  4RCH A;  5DM6 L;  3FZM A;  3E9O A;  1VK0 A;  2V7Z A;  1JKH A;  2FBY A;  3NF8 A;  4KO0 A;  5M1Q A;  4GKJ K;  2D0C A;  4WQ5 C;  3R9P A;  1IG8 A;  1KCF A;  1HYV A;  4I2Q A;  3D0P A;  1T6D A;  1OH7 A;  1HKG A;  3WXK A;  3ENO A;  1HYS A;  4LSN A;  3CCS N;  2JWK A;  4C8O A;  3SUP A;  4DB3 A;  3KKR A;  4QOZ B;  2E2P A;  4BR7 A;  4OGE A;  4HCC A;  3AVC A;  3KLE A;  1Q7Y O;  1TAQ A;  1TKD A;  2RF2 A;  1NJZ A;  4DTU A;  2UU9 K;  4CEQ A;  2ZGY A;  3LL3 A;  1RDC A;  3SQ4 A;  4KHP K;  3AGK A;  2G8F A;  3IAY A;  3I55 N;  5AQQ A;  3DM2 A;  1VSM A;  1EET A;  4X65 K;  2QWM A;  3HYF A;  5FRO A;  1HNV A;  1R59 O;  4H5R A;  3EN9 A;  3WNE A;  3ZT1 A;  1KAY A;  2UYT A;  3C7N B;  4CEF A;  2I5J A;  3HM8 A;  1LWC A;  4AF1 A;  5AFU H;  3T3F A;  4H8K A;  2FSK A;  4JKE A;  3K2P A;  4K42 A;  4AHS A;  2PYL A;  3RMA A;  1HNI A;  5F0X A;  3CF5 L;  3C0B A;  5HRS A;  4CJ5 A;  1N6Q A;  3TTF A;  2ZF5 O;  1KVC A;  3QO9 A;  3CFO A;  3VF4 A;  3VQB A;  2E2O A;  2QA4 N;  2Q97 A;  4BC3 A;  1RDA A;  2HHX A;  1GOC A;  2F8T A;  3AVH A;  3LM9 A;  4BR2 A;  5AQJ A;  3CCJ N;  2O8E B;  4CD3 A;  5GAG P;  2PBD A;  1IKX A;  4NCG A;  4RG8 A;  5AQF A;  2KQ2 A;  2P9U B;  1WSG A;  1Q18 A;  3HBT A;  1HPM A;  5BPM A;  1P8Z A;  5GAE P;  2V7Y A;  4DTP A;  1D4X A;  3ZEU A;  3TAE A;  5M1O A;  2HNZ A;  5BN8 A;  3CCR N;  3AY9 A;  2I7P A;  4CJU A;  4IEI A;  2KFN A;  1FK9 A;  1KAZ A;  3PSF A;  2IDO A;  4E0D A;  5HRR A;  4FW2 A;  4CJ7 A;  1JJ2 M;  4G9Z A;  1V4S A;  2NUB A;  2Z1H A;  4CW7 B;  3KD5 E;  2IIR A;  1GLF O;  1NMD A;  5LMU K;  3OYA A;  2HST A;  4FVM A;  1NKB A;  4JI0 K;  3P31 A;  4FPB A;  1WAF A;  2YNF A;  2WBN A;  1RT4 A;  3WT0 A;  4Q0B A;  4M7X A;  1JLC A;  1WLJ A;  3GE1 A;  2OAN A;  1DGK N;  4M42 A;  4AHC A;  3ZSW A;  4JKG B;  4LF6 K;  3CCQ N;  2J4R A;  5A2Q O;  1CXQ A;  3DLG A;  2ITM A;  3MCA B;  2A3Z A;  3TTC A;  1UA1 A;  4MDA A;  1C1A A;  3TAM A;  4NO7 A;  5AQU A;  3LDS A;  1QSY A;  3A5O C;  4MLH A;  1SKS A;  4AHU A;  4FJL A;  1DTT A;  1YI2 N;  1IH7 A;  5C24 A;  4KAZ A;  1EO1 A;  4Y1D A;  1VRU A;  1NGG A;  4CF9 A;  4ZTF A;  1YXQ A;  3L2U A;  4BC5 A;  4FM1 A;  1J5O A;  2HBJ A;  3OYF A;  5AQI A;  3FZL A;  4I9L A;  4YOV A;  1BCO A;  3AVB A;  3G71 N;  2VWK A;  4E7I A;  5I9E B;  3OYD A;  3DXK B;  1LOT B;  4N41 A;  3C95 A;  4C1N I;  3VEV A;  3VPZ A;  2P9N B;  3H08 A;  4IFE A;  5AFU A;  2FLO A;  4FLV A;  3ZLJ A;  1SL1 A;  4JLH A;  4FJ5 A;  4DS5 A;  1HPZ A;  3OYL A;  5JMV A;  3PSI A;  1LW2 A;  4IJN A;  1E4F T;  3D2E A;  4LH4 A;  4AHV A;  4DR3 K;  1TKX A;  3JYT A;  3CIP A;  1NOY A;  4RW8 A;  1KVB A;  4WYB A;  3OYI A;  3L2W A;  4DQR A;  3ASM A;  4CEB A;  3ATV A;  3AGR A;  1L3S A;  3M8R A;  1IKV A;  2DFF A;  2AA4 A;  4LH5 A;  4FJH A;  4CJK A;  1RBT A;  4EHU A;  1TUY A;  5HRP A;  4NXN K;  4DLG A;  4FJ9 A;  4C1N K;  1VQL N;  3CM6 A;  1DKG D;  3V9S A;  3NF7 A;  1FJG K;  4PUO A;  1BA0 A;  1QS4 A;  4BR0 A;  4IOX A;  5CYQ A;  5HLF A;  4RTF D;  2V52 B;  2UXB K;  1U49 A;  2KZZ A;  3KKS A;  5JVG L;  5MLC Q;  3VTI A;  4YDU A;  3CET A;  4K41 A;  3V81 A;  3AVJ A;  2YCH A;  4LF7 K;  4Z4F A;  4CIE A;  3VEY A;  4FOE A;  1JL1 A;  4O44 A;  3VQ6 A;  4ZHR A;  2F4V K;  3OYN A;  1FKO A;  4M3T A;  2ZM6 K;  4CZM A;  3SLC A;  1JLF A;  3HXM A;  3AA3 A;  1BWF O;  2W6K A;  3RVC A;  4MO4 A;  1U2V B;  3C94 A;  3LZJ A;  5EU7 A;  4CJS A;  3C6A A;  1U4B A;  1C0G A;  4FJI A;  2VGN A;  3GBT A;  1ESV A;  4KTQ A;  3VF2 A;  4YOY A;  1XHZ A;  4OO1 J;  3WXM B;  2ZE2 A;  2P9L A;  1BI4 B;  3UKU A;  4JI7 K;  3VEX A;  2FF3 B;  2YHW A;  5AQM A;  2P9P B;  3L3V A;  1NGB A;  3S3N A;  4KHS A;  4BRD A;  3U9D A;  4Z4C A;  4H03 B;  5KPZ A;  3QEX A;  4E3S A;  2QEX N;  3AVF A;  4HVJ A;  4YOR A;  4XH4 A;  4FZZ A;  1NK4 A;  4E7L A;  1HLU A;  2HMP A;  3N4P A;  4CZJ A;  3AO1 A;  1TK8 A;  3MWP A;  5DM7 L;  4GV9 A;  2QWR A;  3NE6 A;  4KKO A;  4BGB A;  4DU1 A;  5M1P A;  4Z4G A;  4J2D A;  1TGO A;  5M1N A;  3ZSY A;  5K14 A;  3L2R A;  1NK9 A;  2QK9 A;  3F2K A;  4B8C A;  4JAX A;  2PY5 A;  4JEP A;  4M7Y A;  3TSP A;  1SKR A;  5J2M A;  5J2Q A;  1WSJ A;  4N5S A;  1M1K O;  4DFK A;  2E88 A;  1ATS A;  3HVT A;  3DLE A;  3IDH A;  4IFV A;  4CZE A;  4H0Y B;  3CQ8 A;  2Y1I A;  4DR6 K;  3VET A;  3LAM A;  4BRC A;  1HNX K;  4CF0 A;  1RT6 A;  4F4K A;  1JLE A;  4GW6 A;  4GVM A;  1ILY A;  2E2N A;  2GX9 A;  2OPQ A;  3K5M A;  1S6P A;  1KFD A;  1C0F A;  3MED A;  2O8C A;  4CI6 A;  4DV1 K;  2G8K A;  4DTS A;  4IXC A;  1BO5 O;  4CGD A;  2ASM A;  1V4T A;  5BRE A;  4RW4 A;  4BAC A;  2YHA A;  2D0P A;  3SMS A;  2FSJ A;  1T7P A;  4FWN A;  4OKJ A;  3AA4 A;  3HPH A;  3MXI A;  4CJP A;  2HHH K;  4FW1 A;  3CER A;  4CJ4 A;  3QBW A;  2OZM A;  3VQE A;  2F96 A;  4FJK A;  4DMN A;  4DV6 K;  2QKK A;  3VGK A;  1LCU A;  4JHD B;  4A57 A;  1HQE A;  1X1P A;  5ADX H;  1C1B A;  2IAJ A;  5AQL A;  3V1Q A;  4IFY A;  3W0L A;  1BQN A;  4WFA L;  4FWM A;  4ZTJ A;  5BRH A;  1JXE A;  2A1R A;  5J1E A;  1FW6 A;  1XQS C;  3DXM B;  1QSS A;  1T8E A;  3QLH A;  4E19 A;  1QHT A;  4JKB A;  3VF6 A;  2GWJ A;  1A5X A;  4CZI A;  4O5F A;  3V9X A;  1RDW X;  3Q7B A;  2IVO A;  4CED A;  5ELZ A;  1UAX A;  4ISG A;  4JI3 K;  4KHN A;  3M1F A;  5KRS A;  3NGZ A;  1WNS A;  4YY3 K;  4H4M A;  3ZSV A;  3EKS A;  4BVP A;  5GAD P;  3AVG A;  1N5Y A;  4FWP A;  1C0U A;  2IVP A;  3C7N A;  1C0M A;  1TL3 A;  3A2F A;  3RR8 A;  4WQ5 A;  4Z4I A;  3ZT4 A;  5IT9 O;  1BUP A;  1RTJ A;  3ZCM A;  2D0B A;  1GLA G;  4CGH A;  4DSI A;  3CJ7 A;  3WEE B;  2ZJQ L;  3OBY A;  3CCE N;  4O8K A;  4LF5 K;  3I0R A;  4OLB A;  3U8X A;  1CZB A;  4F3T A;  1UWB A;  4ILJ A;  5FRM A;  1BG3 A;  4EP5 A;  4OLA A;  3MAQ A;  3FZF A;  1XNR K;  2YHB A;  4NB4 A;  3GG4 A;  3THV A;  3VES A;  4O8U A;  4PWD A;  2O8E A;  2P9U A;  3MEC A;  3KD1 E;  1WSE A;  3VQ4 A;  4GNI A;  5C10 A;  4CFB A;  3PX6 A;  3AO3 A;  1NMN A;  4BRL A;  3PX0 A;  4O0J A;  1RTH A;  1VSJ A;  1VQ8 N;  3CCM N;  2OYQ A;  2A5X A;  3W3D A;  3ZYY X;  4J2B A;  3BGR A;  5FRN A;  4DSK A;  4FJ7 A;  4Z94 A;  3RWU A;  2DFE A;  4PKI A;  1IG9 A;  3IS9 A;  3EZW A;  1RBS A;  3CPE A;  4FLZ A;  1ATN A;  1SL2 A;  3BY5 A;  1Z26 A;  5HP1 A;  1YJ9 N;  3BP8 A;  1HMV A;  1D5A A;  5ADX A;  3QB0 A;  1BIS A;  5BPN A;  3ZSX A;  3H3O B;  1LW0 A;  1VSH A;  1EX4 A;  3MWT A;  3QEP A;  4B9Q A;  4CE9 A;  4JKC A;  4JKG A;  2OTL N;  1LAV A;  2UXC K;  4CEE A;  3K59 A;  3WNH A;  1S1X A;  3A5N C;  1BHL A;  2O8D B;  4K0K K;  3O9S A;  1S9G A;  1MWM A;  3MX5 A;  3TAF A;  3HO1 A;  4DTR A;  3HPG A;  2KKZ A;  1QSL A;  4MDB A;  2ZGZ A;  1MDU B;  2FXU A;  3CME N;  4N76 A;  3MCP A;  1VQO N;  4B1X B;  4FOI A;  3UB5 A;  2G8W A;  2DY4 A;  1J6Z A;  3J81 O;  5AQT A;  3FR0 A;  1VSD A;  3DXK A;  2F8S A;  2P9N A;  3O3F A;  3NCI A;  2BTF A;  5KQD A;  4IOC L;  4QAG A;  1RFQ A;  5I3U A;  2P9S B;  4JRP A;  4BDZ A;  3DMJ A;  3OY9 A;  1KFS A;  2YKN A;  3CMA N;  2JLE A;  3HPO A;  3VQ9 A;  3C6U A;  3H3N O;  4RW9 A;  1SUQ A;  1EXQ A;  1S3X A;  5AQK A;  3NHG A;  4OKE A;  1JL2 A;  1GLC G;  3WXI A;  2ASP A;  1SQK A;  3U3Y A;  1VSE A;  5AQR A;  3VA0 A;  2JGU A;  1DEJ A;  3OJU A;  1L3V A;  1HX1 A;  2KTQ A;  5GIP A;  4BRE A;  4EHT A;  5KI6 A;  4M3Z A;  3HST B;  4EZ6 A;  4A59 A;  4CJF A;  3FLC O;  4JKF A;  2PAV A;  3AVA A;  3LDP A;  1NGC A;  1ITG A;  3CJC A;  4DFM A;  3TAG A;  4I9Q A;  4BDP A;  3PO5 A;  5AJ3 K;  2P51 A;  3R1X A;  4A5A A;  1N32 K;  1B9F A;  2VWB A;  2IVN A;  3EY1 A;  3L0Q A;  4GMJ B;  3OTO K;  2G8U A;  1TYQ B;  4B9T A;  4Z4E A;  3O80 A;  3AV9 A;  4BRP A;  4LF4 K;  3H6E A;  4O0I A;  1U2V A;  2D4W A;  4DTM A;  4NLC A;  5HL7 L;  1RDB A;  2HF3 A;  1BIU A;  3NVM A;  1BCM A;  3K57 A;  1U45 A;  4B3O A;  1BI4 A;  4DSJ A;  2P9P A;  2P9I B;  1ZBS A;  4U7B A;  3RTV A;  4CBU A;  2BUP A;  2X6S A;  3A5L C;  1WN7 A;  1JCG A;  2E6L A;  4F2R A;  2GV9 A;  3DLK A;  3KK7 A;  2QXL A;  5EX5 A;  4FVU A;  1RGI A;  4FJX A;  3HT3 A;  5HRO A;  2IGI A;  3ZET B;  4Y0W A;  3HK2 A;  1Z6R A;  4B9L A;  3LDO A;  4CGF A;  3HOS A;  4IG0 A;  1VQ5 N;  5LJV A;  4X64 K;  4M3U A;  4FLT A;  3JSM A;  5EY4 A;  1CZA N;  4XEI A;  3QBX A;  1TK0 A;  2VYP A;  4MQ3 A;  1NWK A;  2FF6 A;  1X9M A;  1KLN A;  2HBL A;  4FJN A;  3DRP A;  2O4I A;  4E1M A;  5CY4 A;  1WSF A;  1C1C A;  3CQX A;  4AH9 A;  4H0T B;  4B9U A;  2YV0 X;  2ZWH A;  3LWL A;  1GOA A;  4ICL A;  2FBX A;  1YAG A;  4DG1 A;  2KW4 A;  3FFK B;  4H5N A;  3MN7 A;  4CJR A;  3OS2 A;  4UQG A;  3O9Q A;  1L3T A;  3LDQ A;  3UE5 A;  4OPK A;  1E3M A;  4B1Y B;  1HNZ K;  1SZ2 A;  5AQS A;  2Q3S A;  4KHQ A;  3D7E O;  3BZK A;  4PA1 A;  1ZBI A;  5SWM A;  2GEM A;  5AQH A;  1DLO A;  2Q1N A;  4DQI A;  3MEG A;  4J2E A;  2YHX A;  1JLA A;  5AZI B;  3M6G A;  2D5R A;  1ZBF A;  5FLX O;  3P38 A;  4KB0 A;  3F5T A;  4EIA A;  3UKR B;  1BL3 A;  2WC9 A;  3OS0 A;  4Q5V A;  3AVN A;  3SPY A;  3EE9 A;  3ATU A;  1OVY A;  1VSL A;  3KK3 A;  4CD1 A;  2E1Z A;  5FPE A;  2RN2 A;  4FWO A;  5TKY A;  2EHG A;  4JHD A;  3GL1 A;  1P90 A;  4JI8 K;  4J2A A;  1U47 A;  1HNW K;  3CYM A;  3G6E N;  1NJY A;  5CHI A;  3JAM O;  2UUB K;  3VEW A;  3B8A X;  3KLH A;  1U48 A;  3DXM A;  3RSE B;  1NK8 A;  2DFH A;  4F2S A;  5FPM A;  1KLM A;  1I3A A;  3O9T A;  4CVN E;  1VQ4 N;  3LDN A;  4H0P A;  3ALY A;  3KLF A;  1OH8 A;  3O3H A;  4HUG A;  3NGY A;  4DCH A;  3ISN C;  4A62 A;  3QES A;  3M8S A;  4M45 A;  4IDH A;  4BR4 A;  5IWA K;  3WNF A;  3U3G A;  2FBT A;  4TSX A;  4KV8 A;  3CC2 N;  2WON A;  3THW B;  2XHB A;  1XC3 A;  5I42 A;  4AM7 A;  4CJ3 A;  2IOC A;  3F9K A;  5FPD A;  3NH1 A;  4M3R A;  2QM1 A;  3J7Y P;  1RT7 A;  4F3O A;  1O13 A;  5KPT A;  3O1B A;  3V6D A;  3LDL A;  5B8H A;  4FJM A;  3KK1 A;  4W5N A;  4CEA A;  4F8R A;  3SZ2 A;  3NF6 A;  1HJR A;  4YOW A;  1OVQ A;  3WEE A;  2ZQB A;  1ASU A;  4KTZ A;  4B1W B;  5KTQ A;  3HSC A;  4BC4 A;  1K73 O;  3OBW A;  3WQT A;  2V51 B;  2P5O A;  4DV4 K;  4CF8 A;  1VSK A;  4BRF A;  1IBK K;  1A5V A;  1NBW A;  1NJI O;  3IRX A;  3F73 A;  4B9M A;  4FJ8 A;  4CHO A;  1RDU A;  3DRS A;  1HJO A;  2GUI A;  2NRH A;  4XIU A;  4DF4 A;  2RE2 A;  1RBU A;  1S1W A;  2VWJ A;  4DSE A;  4L8R B;  4H5W A;  3O3G A;  2QWN A;  1TUU A;  4DQS A;  3IFR A;  4DV0 K;  3Q7C A;  4JKA A;  3CC7 N;  3I33 A;  3ID6 A;  3PIP L;  2OA8 A;  3M5R A;  4DWI A;  3VOV A;  4CFA A;  1Y97 A;  3K5N A;  4HTU A;  4BE0 A;  2HHS A;  2WOM A;  3P83 D;  4BRH A;  1KSP A;  5E84 A;  1S1T A;  3SCX A;  4MO5 A;  4DQ8 A;  3P4I A;  1T44 A;  3QFP A;  1KRP A;  4B3S K;  3QEI A;  5HRN A;  4AHR A;  5F2R A;  3SQ0 A;  3VMF B;  1H1V A;  3TU5 A;  3O6W A;  1VRT A;  2OZS A;  4FZY A;  4CJE A;  3ZT3 A;  4I6M B;  5FPN A;  4YNQ A;  1HKB A;  3T1Y K;  3VQC A;  4NYN A;  1XNQ K;  2WTU A;  4CF2 A;  1SV5 A;  1IO2 A;  2HHW A;  1HRH A;  4JRQ A;  3RMC A;  1RBV A;  4CJV A;  2DPN A;  4FSV A;  3VA3 A;  3SMP A;  2O8D A;  5C0Y A;  3TSQ A;  1QQM A;  2BDP A;  3HOT A;  2KLA A;  2YNH A;  2XO7 A;  2NNW A;  1NU0 A;  4BRN A;  4IKF A;  4BWM A;  4IG3 A;  4WQ4 C;  2NZT A;  3AO5 A;  1KVA A;  4HUE A;  4YOU A;  4YOX A;  3DOK A;  2HF4 A;  4JI4 K;  4CHY A;  1TKT A;  2FC0 A;  4M41 A;  3ZSO A;  3ULD A;  1NM1 A;  3C65 A;  2CGK A;  3THX B;  5AQV A;  3VGL A;  2HBM A;  3SUN A;  4AHT A;  3HP6 A;  2W41 A;  2Z1I A;  2OCE A;  1Q81 O;  1N8R O;  2P9S A;  1N33 K;  4JI5 K;  1YTA A;  3VEZ A;  2Q2R A;  3TAN A;  2HVI A;  5EOY A;  4CEZ A;  1X3M A;  1QTM A;  4FWQ A;  2P9K A;  1X3N A;  1L3U A;  1SL0 A;  4U67 L;  3P5J A;  5M1K A;  3AVK A;  3DLH A;  1K8A O;  4DUZ K;  2B5J A;  3DI6 A;  3ID8 A;  5CZ2 A;  1X9J A;  3MEE A;  1TK5 A;  4C8L A;  3PIO L;  2HMI A;  3LP3 A;  3PV8 A;  4KH4 A;  2HVH A;  3U4L A;  3QIO A;  5AQP A;  5JVH L;  2NRR A;  4BRI A;  1ASW A;  3LPU A;  4K25 A;  3EKU A;  1IV0 A;  2VQF K;  1S1V A;  1JLB A;  3CCL N;  3RRG A;  4DQQ A;  4Z4H A;  4BR5 A;  4Z0U A;  4FWS A;  4NLB A;  1TYQ A;  4KBO A;  3KK2 A;  3O4W A;  4B1U B;  3SV4 A;  3OYC A;  4HTL A;  4XH1 A;  3IMX A;  2GBZ A;  4LFC K;  5KGW A;  2NRX A;  3OW2 M;  2YI1 A;  1YJW N;  1TL1 A;  3TAR A;  2XY7 A;  1W2B M;  3A5M C;  1XC9 A;  4W5O A;  2E20 A;  1VQP N;  4CIF A;  4DHY A;  1GLL O;  1D9F A;  4HUF A;  2OPR A;  4PKG A;  2GTD A;  2P9I A;  3K58 A;  3VER A;  3R3L A;  4JI1 K;  3CFP A;  3ZX0 A;  3B6P A;  4A2A A;  1EWQ A;  4CF1 A;  2A41 A;  1G15 A;  1L5U A;  3CJB A;  4PKH A;  4K8X A;  3ZET A;  2YJF A;  4WCE L;  3EZ5 A;  4NYF A;  3J7A P;  2D0O A;  3M8P A;  1VQK N;  3K0S A;  1A5W A;  4GV3 A;  1QZ5 A;  4JN4 A;  3O4Q A;  3ULE B;  4LFB K;  4CK3 A;  5DK5 A;  1WSI A;  4BGA A;  1NGA A;  3ENB A;  2CH5 A;  4N47 A;  3CXC M;  1S1U A;  1VHX A;  3TI0 A;  4O4G A;  1JLQ A;  4M3Y A;  1I94 K;  1KC8 O;  4DTN A;  2XY5 A;  3R8E A;  1CXU A;  4CHZ A;  2GWK A;  4FZX C;  2VQE K;  3F9M A;  2YKM A;  1JLG A;  3ZX2 A;  3SNN A;  4H5V A;  3WXL A;  4LD0 A;  3ZT2 A;  1RCH A;  2KHO A;  3CI5 A;  3CCV N;  1XUP O;  3FE1 A;  3SUO A;  4AM6 A;  3LP0 A;  4FLY A;  4DTO A;  4L3Q A;  5AZI A;  3V1O A;  1W0H A;  2ZD1 A;  3E01 A;  4KH6 A;  4IO9 L;  5KQ8 A;  3VQ5 A;  1GLD G;  4JNE A;  5TKW A;  5CR4 A;  4C8N A;  4RW7 A;  3EL2 A;  3UKR A;  3VQA A;  3K5O A;  3GOI A;  2RKI A;  1J9A A;  5AQN A;  2YX6 A;  3I8D A;  4DUY K;  2XRI A;  3QIC A;  3H1Q A;  4FCY A;  4O55 A;  3O5B A;  1LV5 A;  4X66 K;  4KHY A;  3E9P A;  4EFH A;  4IWV A;  3QEW A;  5AQO A;  5KGX A;  2BGG A;  3LPT A;  3RSE A;  1XMO K;  2O8F B;  3G4S N;  4AQY K;  4LFA K;  2X74 A;  1NG9 A;  1HR0 K;  2X78 A;  1ZXO A;  3L6Q A;  1NGD A;  4OPA A;  3MX2 A;  3KIO A;  1ZBH A;  4WF9 L;  1YUW A;  1MA9 B;  3GDQ A;  1Z25 A;  3OHR A;  4CBX A;  3SYZ A;  1B9D A;  1W7A A;  2KZM A;  5C25 A;  1QQN A;  4A61 A;  4B08 A;  4MFB A;  3THW A;  3DRR A;  1U04 A;  3SPZ A;  4ELT A;  4JK9 A;  4B1Z A;  4CK2 A;  4W5R A;  3OVN A;  4FK2 A;  4JI6 K;  1U6Z A;  2WUS A;  4PHT X;  1X9S A;  3AAQ A;  4MLE A;  3NAE A;  1YVU A;  4FYD A;  2FSN A;  4CFD A;  4W5Q A;  1KXP A;  4LF9 K;  2QWQ A;  2HND A;  2P9K B;  4EAH D;  3HRG A;  1EQY A;  3BZC A;  3DYA A;  3IG1 A;  4OVL A;  2G8V A;  1YJN N;  3OYB A;  1NGE A;  1YIJ N;  4Y1C A;  5E41 A;  3EYZ A;  3CFR A;  3O1W A;  4BQL A;  1X9W A;  1EKE A;  3P39 A;  1O1W A;  4I7F A;  1S9E A;  1TV6 A;  4FO0 A;  5EXW A;  2X6N A;  3KZB A;  4IO8 A;  4KH5 A;  5HOO A;  1TAU A;  3HTV A;  3TWH A;  3PX4 A;  3DOL A;  3VGM A;  2UXD K;  1N34 K;  4KI6 A;  3CJ9 A;  2VG7 A;  3I8B A;  5BPL A;  3HI0 A;  5T7B A;  1RTI A;  3L4Q A;  1QVG M;  3L3U A;  4DSF A;  1DT9 A;  1ZBL A;  4ELU A;  3DLL L;  3QNO A;  3T1A A;  3V9U A;  4BRA A;  3LZI A;  4B9V A;  4FJG A;  5JS2 A;  3AAP A;  3L2V A;  3OYH A;  1VQM N;  5CZ1 A;  4WE1 A;  2KFZ A;  4BWJ A;  1YHQ N;  1VSI A;  5C42 A;  1XWL A;  3D45 A;  4OX9 K;  4DU3 A;  4HWI A;  1RT1 A;  3CQY A;  4OGC A;  1XMQ K;  4XH5 A;  4EZ9 A;  4ILH A;  1NK0 A;  4QS9 A;  1NJW A;  4YHH K;  1Q9X A;  3H1V X;  4IOA L;  4DR5 K;  4ISF A;  1ATR A;  1W9H A;  4DR1 K;  1FKP A;  2IS3 A;  3RRH A;  4I6M A;  4PY5 A;  2NRV A;  4H0O A;  4B3T K;  1BQM A;  3S3M A;  1TKZ A;  4CCH A;  4FK0 A;  4JYA K;  4BRG A;  3SQ2 A;  3SAG A;  3SQ1 A;  2E1Y A;  2B6A A;  3NMU A;  3SJH A;  4CES A;  3BF3 A;  2BAN A;  1OH6 A;  4KRE A;  4CGG A;  4E89 A;  1GLJ O;  2OTJ N;  2YNG A;  1OH5 A;  1S5J A;  1NLV A;  3I0S A;  3V4I A;  3EEQ A;  3R6M A;  4JD2 B;  2UUC K;  3THY B;  5AZJ B;  3LAK A;  4DR2 K;  2NLX A;  1NGJ A;  2HB5 A;  3WQU A;  4EP4 A;  3VEO A;  1J53 A;  1ZC6 A;  4CZG A;  1F21 A;  3O4N A;  1YIT N;  2QTD A;  4CK1 A;  1R0A A;  1UA0 A;  1YT3 A;  3NH0 A;  4NCB A;  4BVO A;  2XY8 A;  1WOQ A;  2YJE A;  3THX A;  3KWG A;  4M3W A;  4PQU A;  4BRM A;  3ZT0 A;  4BDY A;  3E66 A;  4A5B A;  4FJJ A;  3MN5 A;  1T3V A;  3NH2 A;  4QCL A;  1K8K A;  2PFU A;  2NRT A;  3V1R A;  1I39 A;  3OA9 A;  2GUP A;  3P1G A;  3E9L A;  2NRW A;  3KLG A;  3AA5 X;  4E1J A;  3NF9 A;  3ZSQ A;  2PYJ A;  2JWL A;  1KQS M;  5C2F A;  2BE2 A;  2W40 A;  1NOZ A;  4RW6 A;  1VQ9 N;  3MXJ A;  4CJT A;  1NKE A;  2RHK A;  2D1K A;  3D2F B;  3S41 A;  1K6Y A;  3L4I A;  4WQ4 A;  4ID5 A;  3AA2 A;  1KTQ A;  4GV6 A;  1BU6 O;  3KJV A;  1D9D A;  4K43 A;  1S22 A;  1GLE G;  5M1F A;  4FK4 A;  4RWT A;  4AIL C;  4HHT A;  2YHY A;  2ZJR L;  4WFB L;  1HKC A;  1Q9Y A;  5LMN K;  4CJW A;  3AAR A;  3I56 N;  3VTH A;  3SV3 A;  4DFP A;  1LWF A;  4FLU A;  5BRF A;  2E5L K;  4IZ9 A;  1CLQ A;  3PY8 A;  1BA1 A;  4DS4 A;  1WB9 A;  5GIO A;  1HYZ A;  2F9T A;  1K9M O;  2FBV A;  3LP1 A;  3VQ8 A;  1FXX A;  3KLI A;  3LP2 A;  3ZSR A;  1T05 A;  3C6H A;  3A0I X;  3D6R A;  1G99 A;  2AJQ A;  1BDG A;  3O8M A;  1E4G T;  3AO4 A;  4DV5 K;  3TAQ A;  5D3G A;  4H4O A;  5BR9 A;  4DLE A;  2HBK A;  4CGI A;  4KPY A;  4DTX A;  2QWL A;  4CJQ A;  4E1N A;  4DQP A;  1TVR A;  4CIG A;  1HUX A;  3L8B A;  1VQ6 N;  2AP1 A;  4BQZ A;  4E7H A;  4B3M K;  2HNY A;  4M63 C;  1VSF A;  4R5P A;  4CHP A;  2EWS A;  2O8B B;  4OJR A;  4V19 S;  4DFJ A;  1VQ7 N;  1WAJ A;  3AO2 A;  4BR9 A;  3HM9 A;  1B92 A;  3ULE A;  2Y1J A;  2B4J A;  3UIQ A;  3AVL A;  3S9H A;  5C2D A;  5LY3 A;  3MN6 A;  4H0X B;  4LSL A;  4C8K A;  1SS6 A;  3CPW M;  1RBR A;  4FM0 A;  3SI6 A;  3T1H K;  4PL7 A;  1CZ9 A;  4X62 K;  4M3X A;  3FFI A;  2QW9 A;  4DTJ A;  1BGX T;  3BF1 A;  3DAW A;  4BRQ A;  4DSL A;  4R79 A;  1QVF M;  3OYK A;  3QNN A;  4I2P A;  2E4L A;  4BRO A;  3U9Z A;  1XI1 A;  5EVZ A;  4JS4 A;  3U6F A;  5JLF A;  2HHQ A;  2HHU A;  3MN9 A;  3VQD A;  2ATQ A;  1RT3 A;  3LM2 A;  1ASV A;  4KHU A;  3O08 A;  1NGH A;  5JLH A;  5LL6 Z;  1C0T A;  4QS7 A;  4JI2 K;  4BC2 A;  3SJJ A;  2Q36 A;  3O9U A;  3QML A;  5DMR A;  3RMB A;  3J7Z O;  4N56 A;  3DLB A;  4KFB A;  1WBD A;  1NK5 A;  5SZT A;  4IEE A;  3MK6 A;  1EP4 A;  3OYG A;  5C12 A;  2BH1 A;  4O5B A;  2A6A A;  3N4Q A;  3H45 C;  1WUA A;  2Q0U A;  3O9R A;  5FDL A;  2O8F A;  2PZS A;  1N36 K;  5E26 A;  1NJX A;  1BOT O;  3BUZ B;  1JCF A;  1NGF A;  4OPH A;  2P1J A;  2QXF A;  2F7T A;  5J2N A;  2DTU A;  1ZBU A;  3S3O A;  4J8F A;  2A1S A;  3K9K A;  3NDK A;  4KTW A;  4CZK A;  4LY7 A;  1DTQ A;  1K8K B;  1IKW A;  2H3G X;  2Z1G A;  3ZEU B;  1RT5 A;  3G25 A;  3PO4 A;  3K5L A;  4K8Z A;  4JV5 K;  1J5E K;  5H1S Q;  4DV3 K;  4YFU A;  3OYM A;  1YTU A;  3VEN A;  5KPR A;  2QKB A;  2Q0R A;  3ZSZ A;  4G1Q A;  1NK6 A;  1LAW A;  2W42 A;  5AR0 A;  3H46 O;  4DV2 K;  1T6C A;  4B3R K;  4H5T A;  4CFC A;  5BRD A;  2YNI A;  3HL8 A;  4E7J A;  3QEV A;  4ILG B;  2VGM A;  4ELV A;  3VQP A;  5F1X A;  5BR8 K;  3WUH A;  4DKW A;  4IJA A;  4JK8 A;  2CGL A;  3KWI A;  2ASO A;  4JS5 A;  4FPA A;  4CBW A;  4FLX A;  5GAH P;  3SBG A;  4B8A B;  3V9W A;  4ISE A;  2E2Q A;  4CHQ A;  4BG9 A;  3WXJ A;  3T7Z A;  4DV7 K;  3M3Z A;  1QQO A;  1YVN A;  4BRK A;  2D0A A;  3QFU A;  1RT2 A;  3B6O A;  4NCA A;  4C8M A;  2UUA K;  2E8A A;  4C23 A;  1NK7 A;  4BY9 C;  3SAF A;  3TAP A;  4ID1 A;  2O4G A;  4BE1 A;  1EWR A;  3OS1 A;  1SAZ A;  5AQZ A;  5JS1 A;  4BG8 A;  4YOT A;  5AQX A;  2QWP A;  4IBN A;  3C6T A;  3EE8 A;  3L2Q A;  3ITH A;  4CZF A;  4YDU C;  3G0Z A;  2EX3 A;  1LWE A;  3E1Y A;  3QIN A;  3HJF A;  2IC3 A;  1WBB A;  3TR8 A;  1WSH A;  3D2E B;  4CER A;  1Z05 A;  3DLR A;  2W6L A;  4OPJ A;  3AVI A;  3RR7 A;  2OPS A;  1SKW A;  3IKM A;  3J80 O;  4W5T A;  3CJ1 A;  2XY6 A;  3QIP A;  3FZK A;  4PL8 A;  3NBP A;  1YF5 L;  2VCP A;  1QHA A;  3MDQ A;  3QER A;  3T19 A;  4JK7 A;  2R7Y A;  4CEO A;  3NFA A;  2VG5 A;  4H0V B;  4JD2 A;  1QE1 A;  3THY A;  5AZJ A;  3TAB A;  3T69 A;  3TPQ A;  1GLB G;  3KTQ A;  2QWO A;  5CE3 A;  3OYJ A;  3TTD A;  3PLA A;  3VQQ A;  2P5G A;  3DWL A;  3FZH A;  4LF8 K;  4FM2 A;  1IJJ A;  2ZJP L;  1XHX A;  1BIZ A;  3LAL A;  2LSN A;  5HBM A;  1MWK A;  2I7N A;  3WNG A;  4CHN A;  5KRT A;  1REV A;  2HOE A;  4CEC A;  4CZL A;  1VAZ A;  2Q31 A;  4WFN L;  1IKY A;  3LAN A;  4B1V A;  5AQG A;  3SUQ A;  1JCE A;  1OKJ A;  4DR4 K;  3AVM A;  3PUF A;  4B9N A;  1Q8I A;  4FL9 A;  3ZX3 A;  3V9Z A;  3CHW A;  1Q82 O;  3JS6 A;  1JXB A;  2HW3 A;  1RIL A;  2QI2 A;  1HQU A;  3BDP A;  1NNE A;  3QET A;  4QS8 A;  4JKH A;  3VQ7 A;  3CJA A;  3JXU A;  5LJW A;  4F9O A;  2P9L B;  2ETJ A;  3M8Q A;  4FXD A;  4KHW A;  3UKU B;  2ITG A;  1UOC A;  2VG6 A;  3D2F A;  1QZ6 A;  3CCU N;  4GVE A;  4HCB A;  4CGJ A;  4CJL A;  3FGU A;  5GIN A;  4UY8 O;  4GKK K;  3QDK A;  3A8Y A;  1Y64 A;  4BE2 A;  4B9S A;  4DR7 K;  2OPP A;  3CM5 A;  1NKC A;  2GEL A;  5CYM A;  2CGJ A;  1M90 O;  1Q86 O;  3K9J A;  2G8I A;  3KVG A;  3IUC A;  4GY2 B;  5J2P A;  1NGI A;  2HHV A;  1IBM K;  5AQY A;  3BEX A;  4JKD A;  2NRZ A;  1IBL K;  4DU4 A;  4FLW A;  1VQN N;  1QQC A;  2G8H A;  3CC4 N;  4FWK A;  3SK3 A;  3DJC A;  4FWR A;  5JIC A;  2RPI A;  3G10 A;  4OKK A;  3KHY A;  1W97 L;  1S6Q A;  4KI4 A;  3NGI A;  1J54 A;  2A40 A;  3HVR A;  4CZH A;  1T03 A;  4NXM K;  1KAX A;  3SAH A;  3SBT A;  1RDD A;  4IDK A;  2E6M A;  5C15 A;  3J8A A;  3MXM A;  4A2B A;  4KB1 A;  3OJS A;  3NVK A;  3EO3 A;  1GOB A;  3LWM A;  2Z1J A;  4LC9 B;  4KRF A;  3HZ6 A;  3MMV A;  1D8Y A;  2HHT A;  4DF8 A;  2O8C B;  1RTD A;  3CG7 A;  3TSU A; 
#chains in the Genus database with same CATH homology
 3MXJ A;  4CJT A;  1C0M A;  1TL3 A;  4YNQ A;  3OYE A;  1C6V A;  1ZYQ A;  3VQC A;  1NKE A;  4E7K A;  3A2F A;  1MU2 A;  4NYN A;  3RR8 A;  4CF2 A;  4Z4I A;  3ZT4 A;  3ZCM A;  1RTJ A;  1RNH A;  1IO2 A;  1K6Y A;  1SV5 A;  2D0B A;  2HHW A;  1HRH A;  4JRQ A;  4CGH A;  4DSI A;  3HP9 A;  3RMC A;  3RMD A;  1RBV A;  3VN5 A;  4CJV A;  4ID5 A;  3AA2 A;  3VA3 A;  1KTQ A;  3I0R A;  4OLB A;  3KJV A;  1CZB A;  4F3T A;  1UWB A;  1D9D A;  2BDP A;  4FK4 A;  5FRM A;  2HW3 A;  4EP5 A;  2YNH A;  3MAQ A;  4AIL C;  4OLA A;  2XO7 A;  1VK0 A;  4IKF A;  4HHT A;  1JKH A;  2FBY A;  2YHB A;  3NF8 A;  4KO0 A;  4BWM A;  1Q9Y A;  3THV A;  4CJW A;  2D0C A;  1KCF A;  3SV3 A;  4IG3 A;  4PWD A;  1HYV A;  4I2Q A;  3D0P A;  4DFP A;  3AO5 A;  1HYS A;  1LWF A;  3MEC A;  4LSN A;  1KVA A;  4HUE A;  4FLU A;  4C8O A;  3SUP A;  3KD1 E;  1WSE A;  3DOK A;  3KKR A;  3VQ4 A;  3PY8 A;  4CFB A;  4CHY A;  3PX6 A;  4OGE A;  1TKT A;  4QOZ B;  4HCC A;  3AO3 A;  3AVC A;  2FC0 A;  4M41 A;  3PX0 A;  4O0J A;  1RTH A;  1VSJ A;  3ZSO A;  3ULD A;  3KLE A;  1TAQ A;  4DS4 A;  2OYQ A;  1TKD A;  4J2B A;  1HYZ A;  3BGR A;  3SUN A;  5FRN A;  2RF2 A;  2FBV A;  4AHT A;  3HP6 A;  1NJZ A;  2Z1I A;  3LP1 A;  4DSK A;  3VQ8 A;  4FJ7 A;  4DTU A;  1FXX A;  4CEQ A;  1YTA A;  3KLI A;  3LP2 A;  3ZSR A;  1T05 A;  3RWU A;  2DFE A;  1IG9 A;  3IS9 A;  1RDC A;  1RBS A;  4FLZ A;  3SQ4 A;  1SL2 A;  2G8F A;  3TAN A;  2AJQ A;  3IAY A;  2HVI A;  3AO4 A;  3TAQ A;  5HP1 A;  1Z26 A;  4CEZ A;  5D3G A;  3DM2 A;  1VSM A;  1EET A;  1HMV A;  4H4O A;  3HYF A;  5FRO A;  4DLE A;  1D5A A;  1HNV A;  4CGI A;  1QTM A;  4KPY A;  1BIS A;  4DTX A;  1L3U A;  1SL0 A;  4CJQ A;  4E1N A;  4DQP A;  1TVR A;  3WNE A;  3ZSX A;  3P5J A;  4CIG A;  3ZT1 A;  3L8B A;  3AVK A;  1LW0 A;  4E7H A;  1VSH A;  3DLH A;  1EX4 A;  2HNY A;  4CEF A;  2I5J A;  1VSF A;  4R5P A;  3QEP A;  1LWC A;  2B5J A;  3DI6 A;  5CZ2 A;  4CE9 A;  3T3F A;  3MEE A;  1TK5 A;  1LAV A;  4H8K A;  4CEE A;  4C8L A;  4CHP A;  3K59 A;  2HMI A;  4OJR A;  3K2P A;  3WNH A;  4AHS A;  1S1X A;  3LP3 A;  2PYL A;  3PV8 A;  4DFJ A;  2HVH A;  1WAJ A;  3RMA A;  3QIO A;  1HNI A;  1BHL A;  3AO2 A;  3HM9 A;  1B92 A;  2Y1J A;  1S9G A;  2B4J A;  5HRS A;  4CJ5 A;  3TAF A;  3UIQ A;  3HO1 A;  1N6Q A;  4DTR A;  3AVL A;  3HPG A;  3S9H A;  1QSL A;  1KVC A;  3QO9 A;  3CFO A;  1ASW A;  3LPU A;  3VQB A;  4N76 A;  1S1V A;  1JLB A;  1RDA A;  2HHX A;  3RRG A;  1GOC A;  4LSL A;  2G8W A;  3AVH A;  4DQQ A;  4C8K A;  2F8T A;  2DY4 A;  4Z4H A;  1RBR A;  4Z0U A;  4FM0 A;  3SI6 A;  1IKX A;  4NCG A;  4RG8 A;  2KQ2 A;  3KK2 A;  1CZ9 A;  1WSG A;  4M3X A;  3SV4 A;  3FFI A;  4DTJ A;  3OYC A;  1BGX T;  4DSL A;  1VSD A;  2F8S A;  3OYK A;  4DTP A;  2GBZ A;  3O3F A;  3NCI A;  3QNN A;  3TAE A;  4I2P A;  2E4L A;  2HNZ A;  5KGW A;  1XI1 A;  4JS4 A;  3U6F A;  4QAG A;  2HHQ A;  1TL1 A;  4CJU A;  3TAR A;  2XY7 A;  2KFN A;  2HHU A;  1CLQ A;  5I3U A;  1FK9 A;  2ATQ A;  1RT3 A;  3VQD A;  1XC9 A;  4KHQ A;  4E0D A;  2IDO A;  4W5O A;  3DMJ A;  5HRR A;  4JRP A;  4BDZ A;  4CIF A;  4FW2 A;  3OY9 A;  1KFS A;  1ASV A;  2YKN A;  4KHU A;  1D9F A;  2JLE A;  2OPR A;  3HPO A;  4HUF A;  3VQ9 A;  3K58 A;  3C6U A;  2NUB A;  2Z1H A;  3CFP A;  1C0T A;  4RW9 A;  3KD5 E;  3B6P A;  1SUQ A;  3OYA A;  3SJJ A;  1EXQ A;  4CF1 A;  3NHG A;  4FVM A;  4OKE A;  1JL2 A;  1NKB A;  3RMB A;  5DMR A;  1G15 A;  1WAF A;  1L5U A;  2YNF A;  1RT4 A;  4Q0B A;  4N56 A;  3DLB A;  1JLC A;  1WLJ A;  4KFB A;  4K8X A;  3U3Y A;  4M42 A;  1NK5 A;  5SZT A;  1VSE A;  3EZ5 A;  4NYF A;  4AHC A;  3VA0 A;  3ZSW A;  2JGU A;  3OJU A;  1EP4 A;  3OYG A;  3M8P A;  1L3V A;  2KTQ A;  4O5B A;  1CXQ A;  5KI6 A;  3DLG A;  4M3Z A;  3HST B;  1A5W A;  1UA1 A;  4EZ6 A;  1C1A A;  3TAM A;  3LDS A;  3O4Q A;  4CJF A;  5FDL A;  1QSY A;  2PZS A;  4CK3 A;  5DK5 A;  3AVA A;  1WSI A;  1SKS A;  4AHU A;  1NJX A;  4FJL A;  1DTT A;  1ITG A;  4DFM A;  3TAG A;  4I9Q A;  1IH7 A;  5C24 A;  4N47 A;  3PO5 A;  4BDP A;  4KAZ A;  1S1U A;  2P1J A;  4Y1D A;  1VRU A;  2P51 A;  4O4G A;  4CF9 A;  1JLQ A;  3L2U A;  1B9F A;  4FM1 A;  3TI0 A;  4ZTF A;  1J5O A;  2QXF A;  4M3Y A;  3OYF A;  3EY1 A;  4DTN A;  2XY5 A;  4GMJ B;  1CXU A;  4CHZ A;  5J2N A;  2G8U A;  4I9L A;  4FZX C;  1BCO A;  4B9T A;  4Z4E A;  2DTU A;  1ZBU A;  3AVB A;  2YKM A;  3S3O A;  2VWK A;  1JLG A;  2A1S A;  4E7I A;  3NDK A;  4KTW A;  3OYD A;  3SNN A;  4N41 A;  3AV9 A;  3C95 A;  4LY7 A;  1DTQ A;  4O0I A;  1IKW A;  2Z1G A;  3H08 A;  4LD0 A;  1RCH A;  3ZT2 A;  4DTM A;  1RT5 A;  4FLV A;  1RDB A;  3PO4 A;  1SL1 A;  1BIU A;  4JLH A;  3K5L A;  3SUO A;  4FJ5 A;  4K8Z A;  4DS5 A;  1HPZ A;  3OYL A;  3LP0 A;  4FLY A;  1BCM A;  3K57 A;  1U45 A;  4B3O A;  4DTO A;  1LW2 A;  3V1O A;  1BI4 A;  1W0H A;  2ZD1 A;  4YFU A;  3OYM A;  3E01 A;  4DSJ A;  4LH4 A;  3VQ5 A;  4AHV A;  1TKX A;  1YTU A;  3JYT A;  2QKB A;  3ZSZ A;  1NOY A;  3RTV A;  4G1Q A;  4RW8 A;  1KVB A;  1LAW A;  2X6S A;  3OYI A;  3L2W A;  4DQR A;  2W42 A;  1NK6 A;  3ASM A;  4C8N A;  4CEB A;  1WN7 A;  2E6L A;  4F2R A;  4RW7 A;  1L3S A;  3M8R A;  3VQA A;  2GV9 A;  3DLK A;  3K5O A;  4CFC A;  2RKI A;  1J9A A;  2YNI A;  1IKV A;  2DFF A;  3HL8 A;  4E7J A;  4LH5 A;  3I8D A;  3QEV A;  4FJH A;  4CJK A;  2XRI A;  4FJX A;  3HT3 A;  5HRO A;  4ELV A;  1RBT A;  2IGI A;  3VQP A;  5HRP A;  4FCY A;  4O55 A;  4DLG A;  4FJ9 A;  3HK2 A;  4B9L A;  1LV5 A;  4CGF A;  3CM6 A;  4KHY A;  4IG0 A;  4M3U A;  4FLT A;  3V9S A;  3NF7 A;  3QEW A;  4JS5 A;  3JSM A;  4PUO A;  1QS4 A;  5HLF A;  5CYQ A;  5KGX A;  2BGG A;  3LPT A;  4FLX A;  3V9W A;  4B8A B;  1TK0 A;  1U49 A;  2KZZ A;  4CHQ A;  2X74 A;  4MQ3 A;  3KKS A;  1X9M A;  2X78 A;  4KHN A;  1KLN A;  4FJN A;  2D0A A;  3DRP A;  2O4I A;  1RT2 A;  3B6O A;  3KIO A;  1WSF A;  5CY4 A;  4C8M A;  1C1C A;  3AVJ A;  4E1M A;  3V81 A;  4NCA A;  4CIE A;  1NK7 A;  4Z4F A;  1ZBH A;  4AH9 A;  4B9U A;  2YV0 X;  1JL1 A;  4O44 A;  1GOA A;  3LWL A;  4ICL A;  3VQ6 A;  4ZHR A;  3OYN A;  2FBX A;  1FKO A;  3TAP A;  1Z25 A;  4M3T A;  4ID1 A;  2O4G A;  3SYZ A;  4BE1 A;  4DG1 A;  1B9D A;  2KW4 A;  4CJR A;  3OS1 A;  3OS2 A;  5C25 A;  2KZM A;  4UQG A;  4B08 A;  5JS1 A;  1JLF A;  3HXM A;  4MFB A;  3AA3 A;  1L3T A;  4OPK A;  3DRR A;  1U04 A;  4IBN A;  3SPZ A;  2Q3S A;  3C6T A;  3L2Q A;  3C94 A;  3LZJ A;  3ITH A;  5EU7 A;  4CJS A;  4CK2 A;  4W5R A;  1U4B A;  4ELT A;  4FJI A;  3OVN A;  4PA1 A;  4FK2 A;  1ZBI A;  3G0Z A;  2EX3 A;  1LWE A;  3QIN A;  5SWM A;  1X9S A;  4KTQ A;  3HJF A;  1DLO A;  4DQI A;  2IC3 A;  1YVU A;  3NAE A;  1XHZ A;  3MEG A;  4J2E A;  4FYD A;  4CFD A;  4W5Q A;  3TR8 A;  1WSH A;  2ZE2 A;  1JLA A;  1BI4 B;  2HND A;  4CER A;  2D5R A;  1ZBF A;  3DLR A;  3L3V A;  4OPJ A;  2G8V A;  3AVI A;  3DYA A;  3IG1 A;  4OVL A;  3RR7 A;  2OPS A;  3S3N A;  3OYB A;  1SKW A;  4W5T A;  2XY6 A;  4Y1C A;  5E41 A;  4KB0 A;  4KHS A;  3QIP A;  1BL3 A;  4Z4C A;  3OS0 A;  3EYZ A;  3CFR A;  3NBP A;  1X9W A;  1EKE A;  3AVN A;  1O1W A;  4I7F A;  4Q5V A;  4E3S A;  3QEX A;  1S9E A;  3SPY A;  1TV6 A;  3QER A;  3AVF A;  4HVJ A;  3T19 A;  1VSL A;  3KK3 A;  2X6N A;  2R7Y A;  4FZZ A;  4CEO A;  1NK4 A;  3NFA A;  4E7L A;  2RN2 A;  2VG5 A;  1TAU A;  3TWH A;  3PX4 A;  3AO1 A;  1TK8 A;  3DOL A;  1QE1 A;  2EHG A;  3TAB A;  4J2A A;  1U47 A;  4KI6 A;  3CYM A;  3KTQ A;  1NJY A;  3OYJ A;  3NE6 A;  2VG7 A;  4KKO A;  5T7B A;  3VQQ A;  2P5G A;  1RTI A;  3KLH A;  4FM2 A;  1U48 A;  3L3U A;  4DU1 A;  4Z4G A;  4DSF A;  1XHX A;  1BIZ A;  3LAL A;  2DFH A;  2LSN A;  1NK8 A;  5HBM A;  4F2S A;  4J2D A;  1TGO A;  1ZBL A;  4ELU A;  3ZSY A;  3QNO A;  3WNG A;  4CHN A;  5K14 A;  3T1A A;  5KRT A;  3L2R A;  1REV A;  1NK9 A;  2QK9 A;  3V9U A;  1KLM A;  1I3A A;  4B8C A;  3LZI A;  3ALY A;  4CEC A;  3KLF A;  4B9V A;  4FJG A;  3O3H A;  4HUG A;  3NGY A;  2PY5 A;  5JS2 A;  3L2V A;  3OYH A;  5CZ1 A;  3ISN C;  1IKY A;  3QES A;  3LAN A;  4WE1 A;  5J2M A;  1SKR A;  5J2Q A;  3SUQ A;  4BWJ A;  2KFZ A;  1WSJ A;  4N5S A;  1VSI A;  4M45 A;  5C42 A;  3M8S A;  1XWL A;  3D45 A;  4DFK A;  4DU3 A;  3WNF A;  1RT1 A;  3AVM A;  3HVT A;  4OGC A;  3DLE A;  3U3G A;  2FBT A;  4TSX A;  4IFV A;  4KV8 A;  2Y1I A;  3CQ8 A;  3PUF A;  4B9N A;  2WON A;  4EZ9 A;  2XHB A;  1Q8I A;  1NK0 A;  3LAM A;  5I42 A;  1NJW A;  3V9Z A;  4CF0 A;  1RT6 A;  4CJ3 A;  1Q9X A;  2IOC A;  3F9K A;  4F4K A;  1JLE A;  4GW6 A;  1W9H A;  4GVM A;  1JXB A;  3K5M A;  2OPQ A;  1RIL A;  4M3R A;  1S6P A;  1HQU A;  3NH1 A;  1FKP A;  1KFD A;  3BDP A;  2IS3 A;  3MED A;  3RRH A;  3QET A;  4PY5 A;  1RT7 A;  4F3O A;  3VQ7 A;  2ETJ A;  1BQM A;  3M8Q A;  3V6D A;  1TKZ A;  3S3M A;  4CCH A;  2G8K A;  4DTS A;  4FK0 A;  4KHW A;  4FXD A;  2ITG A;  4CGD A;  3SQ2 A;  1UOC A;  4FJM A;  2VG6 A;  3KK1 A;  3SQ1 A;  4W5N A;  4CEA A;  2B6A A;  4F8R A;  3SZ2 A;  3NF6 A;  4RW4 A;  4BAC A;  4HCB A;  1HJR A;  2YHA A;  2ZQB A;  4CGJ A;  1ASU A;  4CJL A;  4CES A;  1T7P A;  4KTZ A;  5KTQ A;  4OKJ A;  3AA4 A;  2BAN A;  3HPH A;  3MXI A;  4CJP A;  4BE2 A;  4B9S A;  4KRE A;  4CGG A;  4E89 A;  2P5O A;  4FW1 A;  2YNG A;  4CJ4 A;  4CF8 A;  2OZM A;  1S5J A;  1VSK A;  2F96 A;  3VQE A;  1A5V A;  2OPP A;  4FJK A;  3I0S A;  4DMN A;  3CM5 A;  3V4I A;  1NKC A;  5CYM A;  2QKK A;  3IRX A;  3F73 A;  3LAK A;  4B9M A;  4FJ8 A;  1HQE A;  2G8I A;  1X1P A;  2HB5 A;  4CHO A;  1C1B A;  4EP4 A;  2IAJ A;  3DRS A;  1J53 A;  3V1Q A;  1F21 A;  3O4N A;  4IFY A;  1BQN A;  5J2P A;  2HHV A;  2GUI A;  4ZTJ A;  1JXE A;  4XIU A;  2A1R A;  5J1E A;  4DF4 A;  1KRP A;  4DU4 A;  4FLW A;  1QQC A;  1RBU A;  1S1W A;  2VWJ A;  4DSE A;  4CK1 A;  1R0A A;  1UA0 A;  2G8H A;  3O3G A;  4L8R B;  1QSS A;  1T8E A;  1YT3 A;  3QLH A;  4DQS A;  3NH0 A;  4NCB A;  2XY8 A;  4E19 A;  1QHT A;  2RPI A;  3G10 A;  4OKK A;  4M3W A;  4PQU A;  1A5X A;  3ZT0 A;  4BDY A;  2OA8 A;  4FJJ A;  1S6Q A;  3V9X A;  4DWI A;  4CFA A;  3NH2 A;  1Y97 A;  3K5N A;  3NGI A;  4HTU A;  4KI4 A;  4QCL A;  1J54 A;  4BE0 A;  2HHS A;  2WOM A;  3P83 D;  4CED A;  1UAX A;  1I39 A;  3V1R A;  3HVR A;  1T03 A;  1KSP A;  3P1G A;  5KRS A;  1S1T A;  3NGZ A;  3SCX A;  1WNS A;  1RDD A;  4IDK A;  2E6M A;  3KLG A;  3AA5 X;  4H4M A;  3QEI A;  3MXM A;  5HRN A;  3NF9 A;  4AHR A;  3ZSV A;  3ZSQ A;  4KB1 A;  2PYJ A;  3OJS A;  1GOB A;  3SQ0 A;  2BE2 A;  1VRT A;  3LWM A;  2Z1J A;  2OZS A;  4KRF A;  4FZY A;  4CJE A;  1D8Y A;  2HHT A;  3AVG A;  3ZT3 A;  4DF8 A;  1NOZ A;  1N5Y A;  1RTD A;  4RW6 A;  3CG7 A;  1C0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...