1VSLA

Asv integrase core domain d64n mutation with zinc cation
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTNFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for inactivating mutations and pH-dependent activity of avian sarcoma virus integrase.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
molecule tags Hydrolase
molecule keywords PROTEIN (INTEGRASE)
total genus 55
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vslA00
4FLXA 4KTWA 1NJZA 3V9WA 1B9DA 2YHBA 3AVAA 4CEEA 4DFKA 3OYBA 1XWLA 4H4MA 5FRNA 1T05A 3JYTA 5J2MA 4E7JA 1JLQA 4J2BA 1UWBA 4RW6A 2GBZA 3SUNA 1RDCA 4KTQA 3QEWA 4BWJA 4B9SA 1TK0A 3DLHA 4CCHA 4FZYA 4DU1A 4HCBA 3DLKA 1D9FA 4BE2A 1WNSA 1RT4A 3SQ0A 5KRTA 1Z25A 4BDPA 1SL2A 4FJMA 2KFNA 4CEAA 3DRPA 4KV8A 3K5NA 2F96A 2ZQBA 4CF2A 4W5TA 4F2SA 1NOZA 4FK4A 1RT6A 3HT3A 4CIGA 1TVRA 3AVIA 3C6UA 2X6SA 3LP3A 4CF0A 4DTRA 4E1NA 2XY5A 4DS5A 5JS1A 4BACA 1GOCA 1U04A 1Q8IA 2P51A 3NF7A 3OYLA 1HYVA 3HO1A 1C1AA 3DRSA 3OYDA 1X9SA 3AV9A 3T3FA 1SKWA 3O3HA 1U48A 1S1TA 3CFOA 2HMIA 4CEZA 1D8YA 1BCOA 4OGCA 4BDZA 4DTJA 4Q0BA 3L2QA 1D5AA 4FLZA 1RT1A 3VA0A 2PZSA 3RR8A 3L2RA 3MECA 2NUBA 3HSTB 1X9WA 3PV8A 2G8FA 4CFAA 5FROA 4KO0A 3EY1A 1RNHA 3V6DA 2RN2A 4PUOA 1KVAA 4E3SA 4FLUA 1LV5A 4KI6A 3VQ5A 1KLNA 1QSLA 3QIPA 3AO2A 2HHXA 3KLFA 3QEXA 2O4GA 1SV5A 1ASWA 3DLGA 3WNGA 4R5PA 3QO9A 3SQ4A 3K2PA 3MXJA 1S1WA 3SQ1A 5I42A 2D0CA 1BIUA 2Z1JA 1VSIA 1N5YA 4KB0A 3HL8A 3NGIA 3SJJA 2HNZA 2BGGA 1XI1A 4NYFA 4FM1A 5J2PA 3OYJA 1B9FA 4I9QA 1BL3A 1A5VA 4CESA 2KQ2A 3RMBA 3WNFA 1RTIA 1CLQA 2IOCA 4FJ5A 3LAKA 1Q9YA 2KW4A 3KD1E 5JS2A 1I39A 4DWIA 3ZT4A 2FBVA 4CJFA 4M3ZA 1S1UA 3P1GA 1NJXA 4PQUA 4DSIA 1KFDA 4CIEA 4DQSA 3KLGA 1S6QA 4IFYA 1YTAA 3AO3A 4EZ6A 5SWMA 5C25A 3OYKA 4B8CA 3M8SA 1BISA 4FCYA 1TK8A 1VSJA 3NCIA 1WN7A 1X9MA 4B9TA 2KZMA 2HNDA 4N47A 4CF8A 3TABA 4CJEA 5C42A 1DTQA 2B6AA 3VQEA 4IDKA 1ASVA 4RW8A 3L2UA 2LSNA 2HHSA 4B8AB 1S9EA 4M3RA 3PX0A 2P5GA 4E7HA 1VSMA 4KHYA 4OLBA 1RILA 2E4LA 4LSNA 4H4OA 3CM5A 4EP4A 3T1AA 4O0JA 3KLEA 3LZJA 3LANA 3SYZA 4DQIA 3O3FA 4WE1A 4M45A 3AA5X 1QSYA 4OJRA 3EZ5A 4FJXA 1KSPA 1ZBLA 1IKWA 1RBVA 4M3YA 3L3UA 5CZ2A 4O0IA 4DTPA 3OS2A 3F73A 1KTQA 4ZTFA 4C8KA 1I3AA 2E6LA 2HNYA 3EYZA 3SQ2A 4KI4A 3QERA 3L8BA 1RCHA 3AVKA 3AO5A 4CJWA 4FJLA 3CG7A 4DS4A 4CHNA 3NH2A 1U47A 4FLYA 4Z4GA 1TKXA 2ZD1A 1DTTA 4CECA 4CHPA 1Q9XA 2PYJA 4N41A 4IKFA 1WSFA 2HW3A 4FK0A 3SNNA 2XRIA 4JRPA 3TAEA 1KLMA 2YKMA 3TR8A 4OPKA 1WAFA 3UIQA 3VQ4A 4DG1A 3ASMA 3OYCA 2XHBA 4JS5A 4FJJA 1S9GA 4AHTA 2DFFA 1BQMA 4PA1A 1TL3A 2Z1GA 1CZBA 3PO4A 4K8ZA 2G8WA 1LW0A 2G8HA 1YVUA 4M41A 3V9UA 4FLVA 3K5MA 1NKBA 1C1CA 4O4GA 1EX4A 2HB5A 4CHOA 1D9DA 3RRGA 2HVIA 3KKRA 4HCCA 5HRSA 4EZ9A 4N5SA 3ZSOA 1BHLA 2DFEA 4Z4EA 3KLIA 4Y1DA 3VQAA 4RW4A 1JLEA 3DLEA 4AHVA 4DTXA 4CJSA 4FJ9A 2EX3A 1J9AA 3NF6A 3VQ9A 5CZ1A 2G8VA 4CE9A 1T03A 2OYQA 3LWLA 3OYMA 5EU7A 2OZMA 3SPZA 4FZZA 3BDPA 3NFAA 4CJQA 3OJSA 5SZTA 3SZ2A 1R0AA 5KGWA 3NDKA 4Z4HA 1KCFA 3ZSRA 1FXXA 3OY9A 1BQNA 5DK5A 1RTHA 1GOBA 3DM2A 3V1OA 4KREA 4AHRA 1SL1A 4CJTA 4G1QA 4GW6A 4CFDA 2D0BA 3KJVA 5FRMA 1RBTA 5DMRA 1EP4A 1UOCA 2KFZA 3NH1A 4LY7A 2HHWA 1TV6A 4GMJB 1BIZA 3G10A 3AVNA 4ID1A 4B9VA 1CXUA 3ZSXA 4DQRA 1U49A 1NK0A 1VRTA 1VSLA 2YNIA 3THVA 1L5UA 4KHSA 2OPRA 2Q3SA 4N56A 3KK1A 4DF4A 4KB1A 2B5JA 3NH0A 2BANA 1ZBUA 2RF2A 4AHUA 2OPPA 2W42A 2IAJA 3NHGA 4B9MA 5FDLA 3SUOA 4C8LA 2YNFA 4J2AA 3RMDA 4KFBA 4C8NA 1FKPA 2VWKA 4MFBA 5CYMA 1QHTA 3OYFA 1S6PA 2YNGA 2Y1IA 4Z4FA 1DLOA 1J54A 3ALYA 4E7IA 2HHQA 4DQPA 1G15A 1ITGA 4CF9A 3RRHA 2IGIA 4DQQA 1NK4A 1UA0A 3V1RA 1IO2A 3LPTA 2QXFA 3CFRA 4FJGA 4OLAA 1TKDA 4CGGA 3LAMA 3VQ6A 1C0TA 3AVCA 1J53A 3C94A 4H8KA 4YFUA 3TWHA 2OA8A 2XY8A 1VSDA 3VN5A 4W5NA 3KIOA 2OPQA 3OYEA 3IG1A 4CK3A 4LH4A 3V9SA 1NOYA 1TL1A 4CEQA 3B6PA 4CK1A 4DTNA 1LAVA 2HHTA 2ITGA 3C6TA 3DRRA 2JGUA 3O4NA 3LP2A 4BE0A 3MXMA 1S1XA 1CXQA 4CJPA 3PY8A 1HNIA 2FBXA 3C95A 2IC3A 3IRXA 1JXBA 1WSHA 3AO4A 1WLJA 4O5BA 5HBMA 1WSJA 4ICLA 1N6QA 2G8IA 1SKRA 4DSKA 1JKHA 3TAFA 3OVNA 1VSEA 3AVBA 4RW9A 1MU2A 5J1EA 1BCMA 1VSKA 3DMJA 3SUPA 1YTUA 4DSJA 1NK8A 4DLEA 1NKEA 3VQDA 4FZXC 3ZSQA 5HRPA 4Q5VA 4CIFA 5HLFA 1BI4B 3OYIA 4J2DA 3HPOA 4DSEA 4AILC 3QIOA 3QEIA 3PUFA 2E6MA 2IS3A 4LD0A 3KLHA 4DU3A 3RR7A 3OYAA 4DTSA 1TAUA 3CM6A 3G0ZA 3QLHA 1JLBA 1ZBHA 1A5XA 1O1WA 4CEBA 2G8UA 4YNQA 3PO5A 4HUEA 4BDYA 4DLGA 4E7LA 1NK7A 1ZYQA 4FLTA 3DOKA 4HHTA 3SPYA 4Z0UA 3HJFA 1WAJA 1SKSA 4CEFA 3IS9A 4RG8A 4JS4A 4DTMA 2A1RA 4FJIA 4KAZA 1XHXA 1HYSA 3D0PA 2GUIA 3TAGA 3QEPA 4NYNA 2O4IA 2RPIA 3RTVA 1L3VA 1ZBIA 3WNHA 1JXEA 1S5JA 1HYZA 3ZCMA 3ZSVA 3L2VA 1YT3A 3DLRA 3F9KA 4CJVA 4CJRA 3RMCA 3ZT1A 1NJWA 3WNEA 3B6OA 4FYDA 1RT7A 5T7BA 1XC9A 1JL1A 2AJQA 3VQPA 1ASUA 4LSLA 3LZIA 1TKTA 4ELUA 1A5WA 1RT3A 2VG7A 4MQ3A 2P5OA 4F3OA 4B9LA 1KRPA 3K58A 1VK0A 2XO7A 2BDPA 3QINA 3DI6A 1S1VA 3TAPA 2G8KA 1L3SA 3KTQA 4LH5A 2QKBA 1EETA 3SUQA 4OKEA 4K8XA 4FJ8A 1U45A 3JSMA 3CFPA 4ZHRA 1NJYA 1KVBA 3D45A 3CYMA 4O55A 4CHQA 1HMVA 3OJUA 1U4BA 1TK5A 1ZBFA 4FVMA 2X6NA 3VQCA 2EHGA 2DTUA 3CQ8A 4CJ5A 1RTDA 4M3XA 2B4JA 2GV9A 3I0RA 3O3GA 3I8DA 3IAYA 3ITHA 3K5OA 4B3OA 2XY7A 4E89A 5HP1A 1HRHA 2YNHA 4FXDA 2YKNA 1LW2A 1RDBA 3ZT2A 3BGRA 4BE1A 2HVHA 3FFIA 3M8PA 4RW7A 4HTUA 3NF9A 1VSFA 1C0MA 1IKVA 1KVCA 1C0UA 3AO1A 1B92A 1VRUA 4F8RA 3NGZA 1CZ9A 3HVTA 4IG3A 4B08A 1C6VA 1NK9A 3LWMA 1IKXA 5J2QA 4NCBA 4KHWA 3AVMA 5HRRA 3S3NA 1REVA 1UAXA 3LALA 1K6YA 5CY4A 1FKOA 3ZSYA 3QNNA 4JRQA 1RDDA 3DLBA 4E7KA 4L8RB 4HUFA 1L3UA 1Y97A 3LPUA 3LP1A 4I2PA 3TAMA 3HM9A 3ULDA 4DTUA 1IG9A 1IH7A 2PY5A 4I9LA 4KHUA 5KTQA 1RT2A 1W0HA 4KRFA 4KKOA 4CEOA 3HVRA 3AVGA 1F21A 1QE1A 4EP5A 1HNVA 4BWMA 1W9HA 3S3MA 5D3GA 5J2NA 3MAQA 2WONA 3HPGA 5HROA 2YV0X 1EKEA 3U3GA 3TARA 4TSXA 1TKZA 4W5RA 2QK9A 4FJHA 3NF8A 3NAEA 3U6FA 4DFPA 4FW1A 4M3WA 3ZT3A 1RBRA 4OPJA 5KI6A 4IBNA 3MEDA 4OVLA 4B9UA 4IG0A 4N76A 2A1SA 3VQQA 2WOMA 4FM0A 2PYLA 3LP0A 3KKSA 3I0SA 4CK2A 3OYGA 2Z1IA 3VQBA 4W5OA 2KTQA 4HVJA 4F3TA 3HPHA 3L2WA 1RBUA 4E0DA 4CGDA 1QTMA 4KHQA 4Y1CA 3KK3A 4E19A 4DU4A 4AH9A 2R7YA 4IFVA 2VG6A 1JL2A 4KPYA 4CGFA 4UQGA 3VQ8A 1LWFA 2Z1HA 4FJ7A 2P1JA 4C8OA 1BI4A 2YHAA 4CERA 1LWEA 4F4KA 3AVLA 1WSIA 4QOZB 1EXQA 4DTOA 4ID5A 4CHZA 1RBSA 2VWJA 1NK5A 2IDOA 2FBTA 4E1MA 4J2EA 3V9ZA 4XIUA 3TANA 3U3YA 2D5RA 3SCXA 1T8EA 3AVJA 4DSFA 4CGHA 1C1BA 3MEGA 4F2RA 3ZSWA 1IKYA 4OGEA 1NK6A 1SUQA 1VSHA 2JLEA 1LAWA 5E41A 2BE2A 4GVMA 3OYNA 4CF1A 4QAGA 1UA1A 3RWUA 4DFMA 5K14A 4DF8A 3AA4A 3QETA 3KD5E 1BGXT 1GOAA 2HHVA 2DY4A 5C24A 1XHZA 4CHYA 1JLFA 3MXIA 3SV3A 1SL0A 4JLHA 4OKKA 2I5JA 3HK2A 4ZTJA 4FLWA 2ETJA 2ZE2A 3L3VA 3P5JA 4FW2A 1QSSA 3S9HA 3M8RA 2OZSA 2HHUA 3MEEA 3K59A 3TI0A 4FK2A 1JLCA 1QQCA 4NCGA 3ISNC 4O44A 2Y1JA 2XY6A 1KFSA 3DOLA 4M3UA 4CJ4A 3ZSZA 5HRNA 4M3TA 1X1PA 1HJRA 4AHSA 4AHCA 3VQ7A 4CJLA 3K57A 3QEVA 3PX4A 1HPZA 2QKKA 4NCAA 3NBPA 1NKCA 1LWCA 3V9XA 3HP6A 1QS4A 2D0AA 3A2FA 3O4QA 3M8QA 4KTZA 4ELVA 4CJ3A 2F8SA 4QCLA 4DMNA 3K5LA 2FC0A 3AVFA 4FJKA 5KGXA 3AVHA 3RMAA 2DFHA 3H08A 3DYAA 4CGJA 3SI6A 2X74A 1TGOA 4PWDA 1T7PA 4FM2A 3NE6A 3P83D 3HXMA 3ZT0A 3OYHA 3HYFA 1J5OA 1TAQA 3HP9A 1HQEA 2KZZA 1RT5A 4HUGA 1RDAA 1Z26A 4FJNA 1WSGA 5I3UA 4I7FA 4ELTA 3V4IA 4CJUA 3SV4A 4DSLA 1WSEA 4CFCA 3V1QA 1L3TA 3QNOA 4Z4IA 4PY5A 4Z4CA 4CGIA 4CFBA 2F8TA 4B9NA 3T19A 3S3OA 2VG5A 2ATQA 3KK2A 4KHNA 3AA3A 1JLAA 2FBYA 3LDSA 3AA2A 3OS0A 4OKJA 1FK9A 2RKIA 4CJKA 5CYQA 3QESA 4M42A 4DFJA 1JLGA 4I2QA 3VA3A 3PX6A 3E01A 2X78A 1HQUA 1RTJA 4C8MA 2OPSA 4W5QA 4CEDA 3OS1A 3V81A 3TAQA 5KRSA 3NGYA
chains in the Genus database with same CATH superfamily
4YOWA 3TU5A 4A2BA 2J4RA 3KZBA 4DFKA 2ZGZA 3MN5A 1T05A 4IFEA 1UWBA 5BR8K 2GBZA 1X9JA 1RDCA 3E1YA 1YI2N 4KTQA 5AQFA 4CCHA 4DU1A 4HCBA 1WNSA 3A5MC 1LOTB 2ASPA 4BDPA 4FL9A 3BY5A 1SL2A 1YJNN 1RFQA 4FK4A 1RT6A 3ID6A 3AVIA 3LM2A 2X6SA 4A5BA 3LP3A 4CF0A 1K73O 5JS1A 1U04A 2HSTA 1Q8IA 3OYDA 4JI7K 3VGKA 5C12A 3KWGA 5JMVA 3EL2A 3CCJN 1S1TA 2O8CB 2ZJPL 3D7EO 3ULEB 3CCEN 4DV2K 4FLZA 1RT1A 2H3GX 3RR8A 3DJCA 3L2RA 3MECA 1U2VA 2RHKA 1HUXA 2G8FA 4CFAA 3MX2A 4LF7K 2UYTA 4B1VA 2RN2A 1Q7YO 4K42A 3VQ5A 4JHDA 3QIPA 2ZWHA 2O4GA 1Z6RA 1ASWA 4HWIA 3QO9A 3TSPA 1VHXA 3LDLA 3M1FA 2D1KA 5J2PA 1B9FA 4I9QA 1BL3A 1NGDA 3RMBA 3ATUA 3DXMB 1RTIA 3M3ZA 2IOCA 1CLQA 2KW4A 3OBYA 3AAPA 3D2FA 3MCAB 4JAXA 4DSIA 2HBJA 1T3VA 3KLGA 3E9LA 4BVOA 4CZFA 3NCIA 1WN7A 3HOSA 2W41A 3FR0A 3L0QA 5AQQA 4RW8A 3L2UA 1HJOA 1GLEG 2ZF5O 1VSMA 5AQLA 2QWQA 4EHTA 3A8YA 4EP4A 4DB3A 3T1AA 4O0JA 3O3FA 4WE1A 5BPMA 4OJRA 3EZ5A 3HBTA 1BA0A 5JICA 1RBVA 4B3SK 3L3UA 4NB4A 4DTPA 2KKZA 4C8KA 1I3AA 1KAZA 4CJWA 2E5LK 3CG7A 2F4VK 4JI1K 4FLYA 2NRVA 1XUPO 4GKJK 3SNNA 3TAEA 1KLMA 2YKMA 4JKGA 1GLAG 2O8BB 3ASMA 2DFFA 1BQMA 3VENA 1TL3A 2UUAK 1IJJA 3PO4A 3VEOA 4V19S 1NKBA 1C1CA 1EX4A 3RRGA 4CZJA 4HCCA 2FXUA 3ZSOA 4BR9A 3VQAA 2A41A 4FWSA 4X66K 3NF6A 4BC3A 3C7NB 3HI0A 4CE9A 2OYQA 2JWLA 4DV6K 3SPZA 4CJQA 1QQNA 1FXXA 3V1OA 4AHRA 3Q7BA 4CJTA 3NVMA 4GW6A 2D0BA 3MK6A 3R3LA 1YJWN 1UOCA 1OH5A 2FSKA 4GMJB 1BIZA 2WFBA 4ID1A 1JCEA 3ZSXA 1U49A 1L5UA 2OPRA 4N56A 3KK1A 5AQOA 3BF1A 3CCRN 4DF4A 4KB1A 2B5JA 3UKUA 3R1XA 2P9KA 1VQON 1ZBUA 2W42A 1KQSM 2IAJA 4AM6A 1BWFO 5CYMA 1QHTA 4JI6K 4Z4FA 2AP1A 4E7IA 2HHQA 4DKWA 1QZ6A 2QXFA 3CFRA 4CGGA 3LAMA 3AVCA 4H8KA 2OA8A 3VN5A 1VSDA 3KIOA 2OPQA 4LH4A 1S3XA 1LAVA 3VTIA 3QBXA 2HHTA 3C6TA 5GIPA 2JGUA 2Q0RA 3LP2A 5F1XA 4PL7A 3PY8A 2FBXA 3THWA 3IRXA 1N6QA 4ICLA 3FE1A 3TAFA 3AVBA 4RW9A 3SUPA 3DMJA 2E8AA 4DSJA 1NKEA 4FZXC 4E1JA 3ZSQA 5HRPA 4CIFA 1BI4B 3OYIA 5BRFA 2ZJQL 3QEIA 3PUFA 2E6MA 3RR7A 5GAGP 4OX9K 3TPQA 4CEBA 4HUEA 4DLGA 2O8FA 4FWRA 4NXNK 4HHTA 1HKBA 1SKSA 4JS4A 3IS9A 4RG8A 4DTMA 4KAZA 1XHXA 1MDUB 3TAGA 3QEPA 1C0GA 3QB0A 1L3VA 3C0BA 3WNHA 1JXEA 3HOTA 3EKUA 3DLRA 4CJRA 4B1YB 3DLLL 3KWIA 3R9PA 1ASUA 4BRLA 5AFUH 3J80O 1TKTA 4B9LA 3O5BA 2XO7A 1DT9A 4JKDA 4BRPA 1L3SA 3SUQA 4OKEA 4FJ8A 4K25A 4CZHA 4GY2B 3CCLN 4ZHRA 2F9TA 1KVBA 3CYMA 1KXPA 1OH7A 1ATRA 3I0RA 3U4LA 3ITHA 1ZC6A 4IOXA 2Q36A 2P9LB 1DKGD 5HP1A 3L4IA 1RDBA 1HPMA 2NRHA 3FFIA 1IKVA 1KVCA 1VRUA 4H03B 4YOYA 2PFUA 5BREA 1VQLN 3S3NA 1X3NA 5CY4A 1FKOA 4E7KA 2GUPA 3LPUA 5LMNK 2PY5A 4IJNA 1W0HA 4KRFA 4O8KA 3CCVN 4BRKA 1HNVA 1TUYA 2WONA 2YV0X 1TKZA 2QWMA 2QK9A 3ZT3A 5KI6A 4OVLA 3ZX3A 5KPTA 4N76A 2A1SA 4FM0A 2PYLA 2HBMA 2O8DB 3I0SA 3VQBA 5ADXH 1RBUA 1XC3A 1YUWA 4BR0A 4E0DA 4KHQA 3P39A 4DU4A 1WOQA 3P4IA 4KPYA 4UQGA 4C8OA 2YHAA 4CERA 4OO1J 4ILGB 4QOZB 1IBLK 1SAZA 1P8ZA 4DTOA 1RBSA 1NK5A 2FBTA 4JEPA 1OVQA 3H1QA 4BC4A 4E1MA 3CCUN 3TANA 3U3YA 1T8EA 3SBGA 1K8AO 4CGHA 5JVHL 4C1NI 1NK6A 3O9TA 4FWOA 3CETA 4B3MK 1VSHA 1UA1A 1HR0K 2CH5A 5C2FA 4DF8A 3AA4A 3KD5E 2HHVA 5C24A 4WCEL 4JV5K 5CR4A 4CZEA 3I55N 4X64K 3ZYYX 4ZTJA 1NGEA 3L3VA 3P5JA 3EE9A 1XMQK 3S9HA 2QWPA 3MEEA 1TYQA 3ISNC 2Y1JA 3DOLA 5EOYA 2ZJRL 1S22A 3K57A 1HJRA 4AHSA 2QKKA 3QEVA 4RCHA 1QS4A 3A2FA 3O4QA 3CMAN 5JVGL 3A5OC 2GELA 3LL3A 1WB9A 2FC0A 4FJKA 4DV0K 4I6MB 3L4QA 1T7PA 2O8DA 4GKKK 3O9SA 3ZT0A 3OYHA 3HYFA 5AQNA 5HL7L 1HQEA 3R8EA 5I3UA 4I7FA 3MN9A 4DV7K 3V4IA 3VF2A 4JNEA 5LJWA 4YHHK 4Z4IA 3QNOA 1VQPN 4Z4CA 4CFBA 3T19A 3S3OA 5C10A 2ATQA 1XNRK 3AA3A 2FBYA 3AA2A 4OKJA 1FK9A 4M42A 3R6MA 3VA3A 5AZIA 3PX6A 3E01A 4CEDA 3OS1A 3GG4A 3TTDA 3V9XA 1RGIA 4H5TA 4KTWA 3V9WA 3WXMB 2HMPA 4XEIA 4IEIA 3B8AX 5J2MA 4BWJA 4B9SA 1TK0A 1NMDA 3DLKA 4DQ8A 3UE5A 1QZ5A 1Z25A 5LL6Z 4CEAA 2V51B 3K5NA 4CW7B 3MMVA 4CF2A 1VQ5N 4W5TA 1NOZA 1TYQB 1TVRA 5M1OA 3C6UA 4DTRA 4BACA 4BRHA 1GOCA 3NF7A 3O1WA 3O3HA 2A6AA 2YX6A 3CFOA 5AJ3K 2WTUA 1NJIO 4OGCA 2WC9A 4DTJA 2RE2A 3L2QA 4JI8K 4BRGA 3HSTB 4BRIA 1W2BM 5FROA 3EY1A 2GEMA 1ZBSA 2NLXA 1KVAA 2PAVA 4JKFA 1KLNA 3AO2A 1GLCG 4PHTX 4R5PA 3K2PA 3SQ1A 1S1WA 2FSNA 5I42A 3A0IX 4WQ5C 3QDKA 3ZETB 3IMXA 3D2FB 1K8KA 4FM1A 1KC8O 3OYJA 4A61A 1A5VA 2YHYA 4CESA 1Q86O 5AQJA 5JS2A 3ZT4A 2FBVA 3ENBA 4M3ZA 1S1UA 3C6HA 4K0KK 2BTFA 4CIEA 4DQSA 4IFYA 1YTAA 3AO3A 2OTLN 4JHDB 4CVNE 2HHHK 3N4QA 2HNDA 1EQYA 4IDKA 4LF5K 4B8AB 3VETA 1JCGA 4JKEA 4E7HA 4OLBA 1RILA 5AFUA 4LSNA 2O8EA 3KLEA 3LZJA 3PIOL 4KHSA 3ZX0A 3A5LC 1ZBLA 2WBNA 4DV4K 1ZXOA 1VQ9N 3OS2A 1KTQA 4ZTFA 4M7XA 2E6LA 4IO9L 5EXWA 2NRXA 4IWVA 4FPBA 1RCHA 2A42A 3AVKA 3AO5A 4FJLA 2P9KB 4BQLA 4CHPA 1BA1A 4IKFA 4JRPA 2QTDA 1WAFA 2P9NB 3CXCM 2XHBA 4YDUC 3IDHA 2HOEA 4PA1A 2Z1GA 3HM8A 3A5NC 2G8HA 1YVUA 4FWPA 4FLVA 1Q82O 4O4GA 2HB5A 4PKHA 4EZ9A 4N5SA 5AQWA 1QHAA 2YCHA 4Z4EA 4Y1DA 5M1FA 4RW4A 1JLEA 2VYPA 4MO4A 4CZIA 4FJ9A 2EX3A 4EAHD 1J9AA 3VQ9A 4BQZA 2G8VA 1T03A 2E1ZA 3OYMA 5EU7A 3OJSA 5SZTA 3NDKA 3OY9A 5EVZA 1N8RO 1YHQN 3O9QA 1SL1A 4G1QA 4CFDA 4IOAL 4FPAA 2UXDK 1H1VA 3G25A 3VGMA 1Q81O 2HHWA 1TV6A 4H0PA 4B9VA 1VRTA 3THVA 1P90A 1BO5O 4OPAA 4AHUA 2I7NA 3BF3A 2YJFA 3SUOA 3RMDA 4C8NA 4DV5K 2Y1IA 1S6PA 2YNGA 3BP8A 5KPRA 4A5AA 1J54A 2IVOA 4DQPA 1G15A 1ITGA 2VWBA 4CF9A 4DR1K 4OLAA 4FJGA 2EWSA 1J53A 3C94A 5DM7L 4W5NA 3IG1A 4CK3A 1YJ9N 1NOYA 1TL1A 2UUCK 4YDUA 4DTNA 4BE0A 1S1XA 2CGJA 4RWTA 1N32K 3CJAA 4A62A 2IC3A 1WSHA 1WLJA 2QWOA 3AO4A 4O5BA 1WSJA 3LDQA 1OH8A 1SKRA 4DSKA 2W40A 4LFBK 3OVNA 1QQMA 1MU2A 1BCMA 4JI4K 1NK8A 4DLEA 3T1HK 4IEEA 4Q5VA 4GV9A 4DSEA 4AILC 2IS3A 3KLHA 3UKRA 3OYAA 3CM6A 3G0ZA 1A5XA 1O1WA 2P9UA 5JLFA 1NK7A 4CBWA 2HBLA 4BC2A 5A2QO 4Z0UA 4GV3A 1WAJA 2E2PA 4CEFA 3MN7A 3D0PA 2O4IA 3L2VA 4JKBA 2V7YA 3ZT1A 3CF5L 3B6OA 5T7BA 1XC9A 3E9OA 3VQPA 1E4FT 1RT3A 5ADXA 4F3OA 4JN4A 2GTDA 4QS9A 2BDPA 2FF6A 2O8CA 3TAPA 4ISEA 1NGBA 1GLFO 2QKBA 3O9UA 4K8XA 1U45A 2O8BA 3JSMA 3WXJA 3P38A 5AZJA 1NJYA 1NNEA 4O55A 1NBWA 3RSEA 1HMVA 1RDUA 4CJ5A 2GV9A 3K5OA 1VQ6N 5AQHA 2OTJN 1TUUA 4JD2B 4E89A 4CBUA 3H3OB 1LW2A 4BE1A 4RW7A 3SAFA 3CMEN 1C0MA 3CPEA 4JK7A 1B92A 2QWLA 1CZ9A 4IG3A 3K9JA 1IKXA 3AVMA 4BR7A 3LALA 1K6YA 3ZSYA 5IWAK 4WYBA 1RDDA 3CIPA 3DXKB 3CCSN 3DLBA 4HUFA 4PKIA 1L3UA 4BRCA 4U7BA 3LP1A 4DTUA 4B3TK 1IG9A 4CZMA 5KTQA 4AF1A 3THYA 3ZLJA 4YOTA 1QE1A 4EP5A 1YVNA 5ELZA 3S3MA 4BGAA 4H5VA 2ZGYA 5J2NA 5C0YA 4IXCA 3HPGA 5HROA 4BROA 4IO8A 5LJVA 2ZM6K 2VQFK 3LDNA 4IBNA 5BRDA 3H1VX 2WOMA 1BG3A 3DWLA 2KTQA 3LP0A 4CK2A 3KKSA 3EKSA 3W0LA 3QMLA 4HVJA 2W6LA 4CGDA 2UXBK 4AH9A 2JWKA 1JL2A 3EN9A 4FJ7A 1NU0A 1BI4A 1LWEA 4F4KA 3AVLA 1WSIA 3T69A 3TSQA 1EXQA 2VWJA 3VESA 4J2EA 4AM7A 1W7AA 4L3QA 3AVJA 1NG9A 3MEGA 1N34K 3ZSWA 4OGEA 1U2VB 5IT9O 2JLEA 5E41A 3RWUA 5K14A 3QETA 2DY4A 3FZLA 1JJ2M 4K41A 4CZKA 1HX1A 3QICA 5BPNA 4YOXA 4LF8K 3M6GA 3HZ6A 2ASMA 2ETJA 3FZMA 2HHUA 3T7ZA 3K59A 4FK2A 1JLCA 5TKWA 4NCGA 3FGUA 1KFSA 4H0VB 3L6QA 4M3UA 3VEXA 4AHCA 4BG9A 4NCAA 3UKUB 3NBPA 4JK9A 1LWCA 3THYB 4QCLA 4CJ7A 3BUZB 2X74A 4PWDA 3CQXA 1J5OA 3PIPL 3AGRA 1WSGA 4NLBA 4BG8A 4CJUA 4DSLA 4CFCA 3V1QA 4A2AA 1L3TA 2F8TA 3OBWA 4EFHA 4JD2A 1JLAA 4FWLA 3SLCA 4DR5K 3QESA 5FLXO 4IDHA 4I2QA 1HQUA 4A57A 1M1KO 2OPSA 4W5QA 2OCEA 1NGIA 4B1XB 5GAEP 4FLXA 3CD6N 4B3RK 1B9DA 2YHBA 2FF3B 3AVAA 4CEEA 3OYBA 1XWLA 4H4MA 5FRNA 4E7JA 3SUNA 3NVKA 4FZYA 3DLHA 5AZIB 4JKCA 1D9FA 4BE2A 3C6AA 2IVNA 3SQ0A 4BRMA 3FLCO 3S41A 2YHXA 2KFNA 5LY3A 2ZQBA 4F2SA 4MO5A 3GL1A 3O80A 4CIGA 3HT3A 2XY5A 4DS5A 2P51A 3HO1A 3DAWA 1O13A 5JLHA 1Y64A 3AV9A 1SKWA 2P9NA 1U48A 4I6MA 1VAZA 3VERA 4C1NK 1D5AA 3VA0A 1OKJA 4DR7K 1X9WA 3PV8A 4KO0A 4PUOA 4E3SA 4KI6A 1LV5A 1QSLA 4ILJA 2BH1A 3WNGA 3MXJA 5AQTA 3LM9A 3HL8A 3NGIA 4LF6K 2HNZA 3GOIA 1G99A 2HF3A 3N4PA 2KQ2A 5M1NA 3WNFA 4FJ5A 2GX9A 1Q9YA 3F5TA 3KD1E 1I39A 3W3DA 5C15A 4CJFA 1NJXA 4PQUA 3HTVA 1IG8A 1S6QA 5C25A 5AQMA 3OYKA 1BISA 3FZHA 4FCYA 1X9MA 3ID8A 3H6EA 3CJCA 1ASVA 4DCHA 2LSNA 2HHSA 3SJHA 1S9EA 3PX0A 2UXCK 4X62K 3VF6A 4H4OA 3CHWA 3CM5A 1K8KB 5AQPA 3SYZA 1HNWK 3LANA 4DQIA 3WQTA 1IKWA 3VTHA 3PLAA 1U6ZA 2CGKA 4M3YA 5CZ2A 4O0IA 3F73A 1DEJA 3PSFA 2HNYA 4YOUA 3SQ2A 4KI4A 4NO7A 3QERA 2ASOA 1W97L 3L8BA 3QFUA 3VGLA 4CHNA 3NH2A 1U47A 2GWJA 1TKXA 1DTTA 4CECA 4N41A 2HW3A 5AQIA 3TR8A 1XMOK 3UIQA 3VQ4A 2PBDA 4DG1A 4F9OA 4DUZK 3NMUA 1S9GA 4H5WA 4AHTA 3I33A 4J8FA 2G8WA 3V9UA 1KAXA 4CHOA 2D4WA 3KKRA 4DR6K 4NXMK 5HRSA 1BHLA 3KLIA 3DLEA 4CJSA 3GE1A 5KQDA 2OZMA 2P9LA 3BDPA 3SZ2A 4KH4A 1T44A 3VEVA 1KCFA 3ZSRA 5DK5A 3WEEA 4KREA 5AZJB 4LFCK 3KJVA 1RBTA 4B1UB 1EP4A 3K0SA 3OTOK 3AVNA 1VSLA 1NGGA 1IV0A 2Q3SA 5GIOA 3NH0A 2QI2A 3NHGA 4B9MA 3PSIA 5FDLA 4J2AA 2YNFA 1FKPA 2VWKA 4MFBA 5F2RA 2FLOA 1NK4A 2I7PA 2IGIA 4DQQA 1KAYA 3V1RA 1IO2A 3FZFA 1TKDA 3EO3A 1C0TA 3ZX2A 5AQXA 2P9UB 3M5RA 3TWHA 5EY4A 3OYEA 1NGFA 3G4SN 3VOVA 3V9SA 1QVGM 3UKRB 3JAMO 2BUPA 1T6CA 4BRNA 3O4NA 4CD3A 4MLHA 3CI5A 1HNIA 3C95A 4FJIA 1JXBA 2G8IA 3TTFA 1HLUA 1YTUA 3JXUA 3SMPA 4J2DA 2NRZA 3T1YK 4ISGA 1ZBHA 3CPWM 2G8UA 4YNQA 1M90O 3UB5A 1ZYQA 4FLTA 4XH1A 3SPYA 3AARA 2A1RA 1HYSA 2GUIA 4NYNA 2Q31A 2OANA 4MLEA 1S5JA 1HYZA 3ZCMA 3OHRA 1YT3A 3O6WA 3HSCA 3F9KA 3WNEA 3J7YP 4FYDA 1RT7A 3EZWA 1JL1A 2AJQA 3LZIA 4LSLA 4ELUA 1A5WA 4MQ3A 4BC5A 1YF5L 1S72N 3DI6A 5EX5A 3C65A 3JS6A 3KTQA 3WXIA 2HF4A 4DR2K 3CJ7A 3MX5A 4CHQA 3VEYA 3OJUA 4O8UA 1ZBFA 2EHGA 5BR9A 5BPLA 3CQ8A 4M3XA 5AQKA 2XY7A 2FSJA 5CE3A 5F0XA 3G6EN 4FXDA 2YKNA 2AA4A 5GAHP 3ZT2A 3BGRA 5M1QA 1YAGA 3M8PA 3ATVA 3NF9A 1VSFA 2E20A 3CCQN 1C0UA 4B08A 1C6VA 4DUYK 4KHWA 2W6KA 3H46O 1UAXA 5AQZA 4H0TB 4JRQA 3QNNA 4IJAA 2QA4N 4H0YB 3ULDA 4I2PA 3G71N 3HM9A 4CZGA 4I9LA 2NZTA 1RT2A 4KKOA 2D0OA 2GWKA 3AVGA 3F9MA 1F21A 1VQ4N 5D3GA 1X3MA 5AQYA 3FFKB 3U3GA 1WBDA 4W5RA 3AY9A 3NF8A 1Q18A 5GINA 3U6FA 3KHYA 3WXKA 4DFPA 4WFAL 4YY3K 4M3WA 1RBRA 1E4GT 4B9UA 4IG0A 2O8EB 3VQQA 4PKGA 1XQSC 4F3TA 4JI5K 3L2WA 1QTMA 4E19A 4K43A 4IFVA 2VGMA 4O5FA 1IBKK 1ATNA 2Z1HA 4QS7A 3D2EA 5KPZA 4ID5A 4CHZA 5AQUA 2IDOA 3V9ZA 4XIUA 5DM6L 3SCXA 4BR2A 4DSFA 2KHOA 1C1BA 4F2RA 4A59A 4FWKA 4WQ5A 4CBXA 3OYNA 5KQ8A 3WXLA 4DFMA 1BGXT 2O8FB 1GOAA 3H45C 1XHZA 1JLFA 3SV3A 3ZETA 5FPNA 4FOIA 2E1YA 2I5JA 3OW2M 3SAGA 4FW2A 1QSSA 2QM1A 3M8RA 3TI0A 1BOTO 1RDWX 3BZCA 1GLLO 3TTCA 4EHUA 4BY9C 4M3TA 4CJLA 3PX4A 1HPZA 3D2EB 3THWB 1DGKN 3SK3A 2D0AA 3M8QA 4KTZA 3SMSA 4CJ3A 1WBBA 4DMNA 3K5LA 5M1PA 3AVHA 3RMAA 3O4WA 3J81O 3DYAA 3H08A 4CGJA 3SI6A 1TGOA 4JI0K 4DV3K 3NE6A 1TAQA 3HP9A 2A40A 1RT5A 4HUGA 4FJNA 2KZZA 4R79A 4DHYA 3SV4A 1D4XA 3WUHA 1WSEA 3LDOA 3O9RA 4BR5A 4PY5A 3CC2N 2P9IA 1IBMK 5FPMA 4YOVA 4B9NA 2P9IB 3KK2A 4KHNA 2IVPA 4C23A 1NWKA 4LC9B 2RKIA 4CJKA 5CYQA 1JLGA 2P9SB 2X78A 4C8MA 1RTJA 3V81A 4BRDA 3EE8A 3TAQA 3NGYA 3D6RA 1WUAA 1NJZA 1Z05A 4JI2K 1OH6A 4KH5A 3JYTA 4J2BA 1JLQA 4B9QA 4RW6A 3QEWA 5B8HA 5E26A 1FW6A 1RT4A 4LF4K 5KRTA 3CJ1A 5AQGA 4FJMA 3WQUA 3DRPA 4KV8A 3GBTA 2F96A 2UUBK 4LFAK 5E84A 4E1NA 1GLBG 4M63C 3OYLA 1MWKA 1HYVA 1C1AA 3DRSA 1X9SA 3T3FA 4HTLA 4FWMA 2HMIA 4CEZA 5CHIA 1D8YA 1BCOA 4BDZA 2VGNA 4Q0BA 2PZSA 3CCMN 2NUBA 1BU6O 3V6DA 1RNHA 4B1WB 4FLUA 3TSUA 2HHXA 3KLFA 3QEXA 3H3NO 4Z94A 1SV5A 3DLGA 1SS6A 3SQ4A 1I94K 2V7ZA 2D0CA 1BIUA 2Z1JA 1VSIA 1N5YA 4KB0A 3SJJA 3VPZA 3GDQA 2BGGA 1XI1A 4NYFA 1VQMN 5BN9A 3LAKA 4DV1K 2WUSA 4DWIA 4WQ4A 1VQ8N 3AAQA 3P1GA 2Q97A 1KFDA 4H5NA 2E2OA 4EZ6A 1HNZK 5SWMA 4B8CA 3M8SA 1TK8A 1VSJA 1HNXK 4B9TA 2KZMA 4N47A 4BRAA 4CF8A 3TABA 3VEWA 4CJEA 2A3ZA 2D0PA 5C42A 1YIJN 1DTQA 2B6AA 3VQEA 3DXMA 4XH4A 4M3RA 2F7TA 4WF9L 2P5GA 4KHYA 2E4LA 2Q1NA 4B1ZA 4QS8A 4ISFA 4FJXA 4M45A 1QSYA 3AA5X 1KSPA 1YITN 1NM1A 3CC7N 3U8XA 4CI6A 3J8AA 3EYZA 4YORA 4DR4K 3C7NA 1NGCA 3I56N 5AR0A 4DS4A 4Z4GA 4WFNL 2ZD1A 2PYJA 1Q9XA 1R59O 1WSFA 1KD1O 4FK0A 2XRIA 3O1BA 4OPKA 3E9PA 4FWNA 2YJEA 1HKCA 3OYCA 4JS5A 4BGBA 4FJJA 3FZKA 1CZBA 4JKGB 4K8ZA 1ESVA 1BUPA 1LW0A 2P9SA 4M41A 3CJ9A 3K5MA 1D9DA 2HVIA 1GLDG 2Q2RA 2DFEA 4AHVA 4DTXA 4BRFA 1YXQA 5CZ1A 4EIAA 2NNWA 3LWLA 4FZZA 3NFAA 5GADP 1R0AA 5KGWA 4Z4HA 1EWQA 4JYAK 4U67L 1BQNA 2E2QA 3CJBA 1RTHA 4GNIA 1GOBA 3DM2A 4FOEA 3KVGA 5FRMA 2IIRA 5DMRA 2F9WA 2KFZA 3NH1A 4LY7A 3G10A 4PL8A 1CXUA 4DQRA 1NK0A 2YNIA 2P9PA 5BN8A 4NLCA 2UU9K 4FVUA 2BANA 2RF2A 2OPPA 3KK7A 2QXLA 4H5RA 2E2NA 4C8LA 4KFBA 5AQRA 3OYFA 1K9MO 1DLOA 3ALYA 4FSVA 3RRHA 1UA0A 3LPTA 4KHPK 3IFRA 3SBTA 3VQ6A 1NLVA 4YFUA 4UY8O 2XY8A 4JI3K 4CEQA 1OVYA 3B6PA 4CK1A 1NGJA 2ITGA 3DRRA 3WT0A 3MXMA 1CXQA 4CJPA 1BDGA 2NRTA 5HBMA 1NGAA 1VQNN 4BRQA 1ATSA 1JKHA 1GLJO 4JK8A 1VSEA 4JKAA 5J1EA 1VSKA 3IUCA 3VQDA 2Q0UA 5HLFA 3HPOA 3O08A 3MWPA 3QIOA 4DU3A 4LD0A 3K9KA 4DTSA 1TAUA 3QLHA 3THXB 1JLBA 3QBWA 2NRRA 3PO5A 4AQYK 4BDYA 4E7LA 1MWMA 3DOKA 1ILYA 3U9DA 3HJFA 4M7YA 4MDAA 2RPIA 3RTVA 4H0OA 1ZBIA 3ZSVA 3MDQA 1V4TA 3J7ZO 4CJVA 3RMCA 1NJWA 1N33K 1T6DA 1VQ7N 2KLAA 4KBOA 1N36K 2VG7A 2P5OA 1QVFM 1KRPA 3K58A 1VK0A 3QINA 2P9PB 5I9EB 3SAHA 1J5EK 1S1VA 2G8KA 4LH5A 4Y0WA 1EETA 1CZAN 3F2KA 3E66A 4GVEA 3CFPA 3D45A 1U4BA 1TK5A 1J6ZA 2YI1A 4FVMA 2X6NA 3EEQA 3VQCA 3P31A 2DTUA 2DPNA 1RTDA 4GV6A 2B4JA 3O3GA 3I8DA 3IAYA 4B3OA 4WFBL 4BR4A 1HRHA 1LCUA 2YNHA 2QWNA 1VQKN 2HVHA 2ITMA 5LMUK 4HTUA 5M1KA 3ENHA 3AO1A 4F8RA 3NGZA 3HVTA 3Q7CA 1NK9A 3LWMA 3RSEB 5J2QA 4NCBA 2QW9A 5HRRA 3O8MA 1REVA 1V4SA 4IZ9A 4RTFD 4L8RB 1Y97A 3TAMA 1IH7A 4KHUA 1SQKA 4CEOA 3HVRA 5C2DA 4BWMA 1W9HA 1QQOA 3MAQA 3HRGA 5FPDA 1EKEA 2HBKA 3CERA 5AQVA 5H1SQ 3TARA 4TSXA 3ZEUB 4FJHA 3NAEA 1FJGK 3VF4A 4LF9K 4FO0A 4FW1A 4OPJA 3MEDA 4BVPA 5FPEA 2YHWA 3OYGA 3BEXA 2Z1IA 4W5OA 4KH6A 3HPHA 4Y1CA 3KK3A 3RVCA 1SZ2A 2R7YA 2VG6A 4XH5A 4CGFA 3VQ8A 1LWFA 2P1JA 3LDPA 3VMFB 4BREA 2V52B 4CD1A 4X65K 2VCPA 2VQEK 1EO1A 4DR3K 2D5RA 3ENOA 4H0XB 1IKYA 2CH6A 1MA9B 1SUQA 5HOOA 2CGLA 1LAWA 3MWTA 2BE2A 4GVMA 4CF1A 4QAGA 1JCFA 4OPHA 3IKMA 5TKYA 4CHYA 4G9ZA 3MXIA 3MCPA 1SL0A 4JLHA 3THXA 3BZKA 4OKKA 3HK2A 4FLWA 2ZE2A 4JKHA 1EWRA 2OZSA 1QQCA 4O44A 3ZEUA 2XY6A 3OA9A 4CJ4A 3ZSZA 5HRNA 1X1PA 3VQ7A 4MDBA 1NKCA 3HP6A 2QWRA 3CQYA 3U9ZA 4ELVA 2F8SA 4IOCL 4FWQA 3ULEA 3AVFA 5KGXA 2DFHA 4WQ4C 2QEXN 2E88A 1E3MA 4CZLA 4ILHA 4FM2A 3P83D 3HXMA 3WEEB 1RDAA 1Z26A 3MN6A 1XNQK 3QFPA 4ELTA 5MLCQ 1NGHA 3VEZA 2A5XA 4CGIA 5BRHA 2NRWA 2VG5A 3LDSA 3OS0A 3I8BA 4DFJA 3AGKA 1HKGA 1NMNA 5AQSA 3CC4N 3J7AP 3DXKA 5KRSA 1C0FA
chains in the Genus database with same CATH topology
4FLXA 4KTWA 1NJZA 3V9WA 1B9DA 2YHBA 3AVAA 4CEEA 4DFKA 3OYBA 1XWLA 4H4MA 5FRNA 1T05A 3JYTA 5J2MA 4E7JA 1JLQA 4J2BA 1UWBA 4RW6A 2GBZA 3SUNA 1RDCA 4KTQA 3QEWA 4BWJA 4B9SA 1TK0A 3DLHA 4CCHA 4FZYA 4DU1A 4HCBA 3DLKA 1D9FA 4BE2A 1WNSA 1RT4A 3SQ0A 5KRTA 1Z25A 4BDPA 1SL2A 4FJMA 2KFNA 4CEAA 3DRPA 4KV8A 3K5NA 2F96A 2ZQBA 4CF2A 4W5TA 4F2SA 1NOZA 4FK4A 1RT6A 3HT3A 4CIGA 1TVRA 3AVIA 3C6UA 2X6SA 3LP3A 4CF0A 4DTRA 4E1NA 2XY5A 4DS5A 5JS1A 4BACA 1GOCA 1U04A 1Q8IA 2P51A 3NF7A 3OYLA 1HYVA 3HO1A 1C1AA 3DRSA 3OYDA 1X9SA 3AV9A 3T3FA 1SKWA 3O3HA 1U48A 1S1TA 3CFOA 2HMIA 4CEZA 1D8YA 1BCOA 4OGCA 4BDZA 4DTJA 4Q0BA 3L2QA 1D5AA 4FLZA 1RT1A 3VA0A 2PZSA 3RR8A 3L2RA 3MECA 2NUBA 3HSTB 1X9WA 3PV8A 2G8FA 4CFAA 5FROA 4KO0A 3EY1A 1RNHA 3V6DA 2RN2A 4PUOA 1KVAA 4E3SA 4FLUA 1LV5A 4KI6A 3VQ5A 1KLNA 1QSLA 3QIPA 3AO2A 2HHXA 3KLFA 3QEXA 2O4GA 1SV5A 1ASWA 3DLGA 3WNGA 4R5PA 3QO9A 3SQ4A 3K2PA 3MXJA 1S1WA 3SQ1A 5I42A 2D0CA 1BIUA 2Z1JA 1VSIA 1N5YA 4KB0A 3HL8A 3NGIA 3SJJA 2HNZA 2BGGA 1XI1A 4NYFA 4FM1A 5J2PA 3OYJA 1B9FA 4I9QA 1BL3A 1A5VA 4CESA 2KQ2A 3RMBA 3WNFA 1RTIA 1CLQA 2IOCA 4FJ5A 3LAKA 1Q9YA 2KW4A 3KD1E 5JS2A 1I39A 4DWIA 3ZT4A 2FBVA 4CJFA 4M3ZA 1S1UA 3P1GA 1NJXA 4PQUA 4DSIA 1KFDA 4CIEA 4DQSA 3KLGA 1S6QA 4IFYA 1YTAA 3AO3A 4EZ6A 5SWMA 5C25A 3OYKA 4B8CA 3M8SA 1BISA 4FCYA 1TK8A 1VSJA 3NCIA 1WN7A 1X9MA 4B9TA 2KZMA 2HNDA 4N47A 4CF8A 3TABA 4CJEA 5C42A 1DTQA 2B6AA 3VQEA 4IDKA 1ASVA 4RW8A 3L2UA 2LSNA 2HHSA 4B8AB 1S9EA 4M3RA 3PX0A 2P5GA 4E7HA 1VSMA 4KHYA 4OLBA 1RILA 2E4LA 4LSNA 4H4OA 3CM5A 4EP4A 3T1AA 4O0JA 3KLEA 3LZJA 3LANA 3SYZA 4DQIA 3O3FA 4WE1A 4M45A 3AA5X 1QSYA 4OJRA 3EZ5A 4FJXA 1KSPA 1ZBLA 1IKWA 1RBVA 4M3YA 3L3UA 5CZ2A 4O0IA 4DTPA 3OS2A 3F73A 1KTQA 4ZTFA 4C8KA 1I3AA 2E6LA 2HNYA 3EYZA 3SQ2A 4KI4A 3QERA 3L8BA 1RCHA 3AVKA 3AO5A 4CJWA 4FJLA 3CG7A 4DS4A 4CHNA 3NH2A 1U47A 4FLYA 4Z4GA 1TKXA 2ZD1A 1DTTA 4CECA 4CHPA 1Q9XA 2PYJA 4N41A 4IKFA 1WSFA 2HW3A 4FK0A 3SNNA 2XRIA 4JRPA 3TAEA 1KLMA 2YKMA 3TR8A 4OPKA 1WAFA 3UIQA 3VQ4A 4DG1A 3ASMA 3OYCA 2XHBA 4JS5A 4FJJA 1S9GA 4AHTA 2DFFA 1BQMA 4PA1A 1TL3A 2Z1GA 1CZBA 3PO4A 4K8ZA 2G8WA 1LW0A 2G8HA 1YVUA 4M41A 3V9UA 4FLVA 3K5MA 1NKBA 1C1CA 4O4GA 1EX4A 2HB5A 4CHOA 1D9DA 3RRGA 2HVIA 3KKRA 4HCCA 5HRSA 4EZ9A 4N5SA 3ZSOA 1BHLA 2DFEA 4Z4EA 3KLIA 4Y1DA 3VQAA 4RW4A 1JLEA 3DLEA 4AHVA 4DTXA 4CJSA 4FJ9A 2EX3A 1J9AA 3NF6A 3VQ9A 5CZ1A 2G8VA 4CE9A 1T03A 2OYQA 3LWLA 3OYMA 5EU7A 2OZMA 3SPZA 4FZZA 3BDPA 3NFAA 4CJQA 3OJSA 5SZTA 3SZ2A 1R0AA 5KGWA 3NDKA 4Z4HA 1KCFA 3ZSRA 1FXXA 3OY9A 1BQNA 5DK5A 1RTHA 1GOBA 3DM2A 3V1OA 4KREA 4AHRA 1SL1A 4CJTA 4G1QA 4GW6A 4CFDA 2D0BA 3KJVA 5FRMA 1RBTA 5DMRA 1EP4A 1UOCA 2KFZA 3NH1A 4LY7A 2HHWA 1TV6A 4GMJB 1BIZA 3G10A 3AVNA 4ID1A 4B9VA 1CXUA 3ZSXA 4DQRA 1U49A 1NK0A 1VRTA 1VSLA 2YNIA 3THVA 1L5UA 4KHSA 2OPRA 2Q3SA 4N56A 3KK1A 4DF4A 4KB1A 2B5JA 3NH0A 2BANA 1ZBUA 2RF2A 4AHUA 2OPPA 2W42A 2IAJA 3NHGA 4B9MA 5FDLA 3SUOA 4C8LA 2YNFA 4J2AA 3RMDA 4KFBA 4C8NA 1FKPA 2VWKA 4MFBA 5CYMA 1QHTA 3OYFA 1S6PA 2YNGA 2Y1IA 4Z4FA 1DLOA 1J54A 3ALYA 4E7IA 2HHQA 4DQPA 1G15A 1ITGA 4CF9A 3RRHA 2IGIA 4DQQA 1NK4A 1UA0A 3V1RA 1IO2A 3LPTA 2QXFA 3CFRA 4FJGA 4OLAA 1TKDA 4CGGA 3LAMA 3VQ6A 1C0TA 3AVCA 1J53A 3C94A 4H8KA 4YFUA 3TWHA 2OA8A 2XY8A 1VSDA 3VN5A 4W5NA 3KIOA 2OPQA 3OYEA 3IG1A 4CK3A 4LH4A 3V9SA 1NOYA 1TL1A 4CEQA 3B6PA 4CK1A 4DTNA 1LAVA 2HHTA 2ITGA 3C6TA 3DRRA 2JGUA 3O4NA 3LP2A 4BE0A 3MXMA 1S1XA 1CXQA 4CJPA 3PY8A 1HNIA 2FBXA 3C95A 2IC3A 3IRXA 1JXBA 1WSHA 3AO4A 1WLJA 4O5BA 5HBMA 1WSJA 4ICLA 1N6QA 2G8IA 1SKRA 4DSKA 1JKHA 3TAFA 3OVNA 1VSEA 3AVBA 4RW9A 1MU2A 5J1EA 1BCMA 1VSKA 3DMJA 3SUPA 1YTUA 4DSJA 1NK8A 4DLEA 1NKEA 3VQDA 4FZXC 3ZSQA 5HRPA 4Q5VA 4CIFA 5HLFA 1BI4B 3OYIA 4J2DA 3HPOA 4DSEA 4AILC 3QIOA 3QEIA 3PUFA 2E6MA 2IS3A 4LD0A 3KLHA 4DU3A 3RR7A 3OYAA 4DTSA 1TAUA 3CM6A 3G0ZA 3QLHA 1JLBA 1ZBHA 1A5XA 1O1WA 4CEBA 2G8UA 4YNQA 3PO5A 4HUEA 4BDYA 4DLGA 4E7LA 1NK7A 1ZYQA 4FLTA 3DOKA 4HHTA 3SPYA 4Z0UA 3HJFA 1WAJA 1SKSA 4CEFA 3IS9A 4RG8A 4JS4A 4DTMA 2A1RA 4FJIA 4KAZA 1XHXA 1HYSA 3D0PA 2GUIA 3TAGA 3QEPA 4NYNA 2O4IA 2RPIA 3RTVA 1L3VA 1ZBIA 3WNHA 1JXEA 1S5JA 1HYZA 3ZCMA 3ZSVA 3L2VA 1YT3A 3DLRA 3F9KA 4CJVA 4CJRA 3RMCA 3ZT1A 1NJWA 3WNEA 3B6OA 4FYDA 1RT7A 5T7BA 1XC9A 1JL1A 2AJQA 3VQPA 1ASUA 4LSLA 3LZIA 1TKTA 4ELUA 1A5WA 1RT3A 2VG7A 4MQ3A 2P5OA 4F3OA 4B9LA 1KRPA 3K58A 1VK0A 2XO7A 2BDPA 3QINA 3DI6A 1S1VA 3TAPA 2G8KA 1L3SA 3KTQA 4LH5A 2QKBA 1EETA 3SUQA 4OKEA 4K8XA 4FJ8A 1U45A 3JSMA 3CFPA 4ZHRA 1NJYA 1KVBA 3D45A 3CYMA 4O55A 4CHQA 1HMVA 3OJUA 1U4BA 1TK5A 1ZBFA 4FVMA 2X6NA 3VQCA 2EHGA 2DTUA 3CQ8A 4CJ5A 1RTDA 4M3XA 2B4JA 2GV9A 3I0RA 3O3GA 3I8DA 3IAYA 3ITHA 3K5OA 4B3OA 2XY7A 4E89A 5HP1A 1HRHA 2YNHA 4FXDA 2YKNA 1LW2A 1RDBA 3ZT2A 3BGRA 4BE1A 2HVHA 3FFIA 3M8PA 4RW7A 4HTUA 3NF9A 1VSFA 1C0MA 1IKVA 1KVCA 1C0UA 3AO1A 1B92A 1VRUA 4F8RA 3NGZA 1CZ9A 3HVTA 4IG3A 4B08A 1C6VA 1NK9A 3LWMA 1IKXA 5J2QA 4NCBA 4KHWA 3AVMA 5HRRA 3S3NA 1REVA 1UAXA 3LALA 1K6YA 5CY4A 1FKOA 3ZSYA 3QNNA 4JRQA 1RDDA 3DLBA 4E7KA 4L8RB 4HUFA 1L3UA 1Y97A 3LPUA 3LP1A 4I2PA 3TAMA 3HM9A 3ULDA 4DTUA 1IG9A 1IH7A 2PY5A 4I9LA 4KHUA 5KTQA 1RT2A 1W0HA 4KRFA 4KKOA 4CEOA 3HVRA 3AVGA 1F21A 1QE1A 4EP5A 1HNVA 4BWMA 1W9HA 3S3MA 5D3GA 5J2NA 3MAQA 2WONA 3HPGA 5HROA 2YV0X 1EKEA 3U3GA 3TARA 4TSXA 1TKZA 4W5RA 2QK9A 4FJHA 3NF8A 3NAEA 3U6FA 4DFPA 4FW1A 4M3WA 3ZT3A 1RBRA 4OPJA 5KI6A 4IBNA 3MEDA 4OVLA 4B9UA 4IG0A 4N76A 2A1SA 3VQQA 2WOMA 4FM0A 2PYLA 3LP0A 3KKSA 3I0SA 4CK2A 3OYGA 2Z1IA 3VQBA 4W5OA 2KTQA 4HVJA 4F3TA 3HPHA 3L2WA 1RBUA 4E0DA 4CGDA 1QTMA 4KHQA 4Y1CA 3KK3A 4E19A 4DU4A 4AH9A 2R7YA 4IFVA 2VG6A 1JL2A 4KPYA 4CGFA 4UQGA 3VQ8A 1LWFA 2Z1HA 4FJ7A 2P1JA 4C8OA 1BI4A 2YHAA 4CERA 1LWEA 4F4KA 3AVLA 1WSIA 4QOZB 1EXQA 4DTOA 4ID5A 4CHZA 1RBSA 2VWJA 1NK5A 2IDOA 2FBTA 4E1MA 4J2EA 3V9ZA 4XIUA 3TANA 3U3YA 2D5RA 3SCXA 1T8EA 3AVJA 4DSFA 4CGHA 1C1BA 3MEGA 4F2RA 3ZSWA 1IKYA 4OGEA 1NK6A 1SUQA 1VSHA 2JLEA 1LAWA 5E41A 2BE2A 4GVMA 3OYNA 4CF1A 4QAGA 1UA1A 3RWUA 4DFMA 5K14A 4DF8A 3AA4A 3QETA 3KD5E 1BGXT 1GOAA 2HHVA 2DY4A 5C24A 1XHZA 4CHYA 1JLFA 3MXIA 3SV3A 1SL0A 4JLHA 4OKKA 2I5JA 3HK2A 4ZTJA 4FLWA 2ETJA 2ZE2A 3L3VA 3P5JA 4FW2A 1QSSA 3S9HA 3M8RA 2OZSA 2HHUA 3MEEA 3K59A 3TI0A 4FK2A 1JLCA 1QQCA 4NCGA 3ISNC 4O44A 2Y1JA 2XY6A 1KFSA 3DOLA 4M3UA 4CJ4A 3ZSZA 5HRNA 4M3TA 1X1PA 1HJRA 4AHSA 4AHCA 3VQ7A 4CJLA 3K57A 3QEVA 3PX4A 1HPZA 2QKKA 4NCAA 3NBPA 1NKCA 1LWCA 3V9XA 3HP6A 1QS4A 2D0AA 3A2FA 3O4QA 3M8QA 4KTZA 4ELVA 4CJ3A 2F8SA 4QCLA 4DMNA 3K5LA 2FC0A 3AVFA 4FJKA 5KGXA 3AVHA 3RMAA 2DFHA 3H08A 3DYAA 4CGJA 3SI6A 2X74A 1TGOA 4PWDA 1T7PA 4FM2A 3NE6A 3P83D 3HXMA 3ZT0A 3OYHA 3HYFA 1J5OA 1TAQA 3HP9A 1HQEA 2KZZA 1RT5A 4HUGA 1RDAA 1Z26A 4FJNA 1WSGA 5I3UA 4I7FA 4ELTA 3V4IA 4CJUA 3SV4A 4DSLA 1WSEA 4CFCA 3V1QA 1L3TA 3QNOA 4Z4IA 4PY5A 4Z4CA 4CGIA 4CFBA 2F8TA 4B9NA 3T19A 3S3OA 2VG5A 2ATQA 3KK2A 4KHNA 3AA3A 1JLAA 2FBYA 3LDSA 3AA2A 3OS0A 4OKJA 1FK9A 2RKIA 4CJKA 5CYQA 3QESA 4M42A 4DFJA 1JLGA 4I2QA 3VA3A 3PX6A 3E01A 2X78A 1HQUA 1RTJA 4C8MA 2OPSA 4W5QA 4CEDA 3OS1A 3V81A 3TAQA 5KRSA 3NGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FLX A;  4KTW A;  1NJZ A;  3V9W A;  1B9D A;  2YHB A;  3AVA A;  4CEE A;  4DFK A;  3OYB A;  1XWL A;  4H4M A;  5FRN A;  1T05 A;  3JYT A;  5J2M A;  4E7J A;  1JLQ A;  4J2B A;  1UWB A;  4RW6 A;  2GBZ A;  3SUN A;  1RDC A;  4KTQ A;  3QEW A;  4BWJ A;  4B9S A;  1TK0 A;  3DLH A;  4CCH A;  4FZY A;  4DU1 A;  4HCB A;  3DLK A;  1D9F A;  4BE2 A;  1WNS A;  1RT4 A;  3SQ0 A;  5KRT A;  1Z25 A;  4BDP A;  1SL2 A;  4FJM A;  2KFN A;  4CEA A;  3DRP A;  4KV8 A;  3K5N A;  2F96 A;  2ZQB A;  4CF2 A;  4W5T A;  4F2S A;  1NOZ A;  4FK4 A;  1RT6 A;  3HT3 A;  4CIG A;  1TVR A;  3AVI A;  3C6U A;  2X6S A;  3LP3 A;  4CF0 A;  4DTR A;  4E1N A;  2XY5 A;  4DS5 A;  5JS1 A;  4BAC A;  1GOC A;  1U04 A;  1Q8I A;  2P51 A;  3NF7 A;  3OYL A;  1HYV A;  3HO1 A;  1C1A A;  3DRS A;  3OYD A;  1X9S A;  3AV9 A;  3T3F A;  1SKW A;  3O3H A;  1U48 A;  1S1T A;  3CFO A;  2HMI A;  4CEZ A;  1D8Y A;  1BCO A;  4OGC A;  4BDZ A;  4DTJ A;  4Q0B A;  3L2Q A;  1D5A A;  4FLZ A;  1RT1 A;  3VA0 A;  2PZS A;  3RR8 A;  3L2R A;  3MEC A;  2NUB A;  3HST B;  1X9W A;  3PV8 A;  2G8F A;  4CFA A;  5FRO A;  4KO0 A;  3EY1 A;  1RNH A;  3V6D A;  2RN2 A;  4PUO A;  1KVA A;  4E3S A;  4FLU A;  1LV5 A;  4KI6 A;  3VQ5 A;  1KLN A;  1QSL A;  3QIP A;  3AO2 A;  2HHX A;  3KLF A;  3QEX A;  2O4G A;  1SV5 A;  1ASW A;  3DLG A;  3WNG A;  4R5P A;  3QO9 A;  3SQ4 A;  3K2P A;  3MXJ A;  1S1W A;  3SQ1 A;  5I42 A;  2D0C A;  1BIU A;  2Z1J A;  1VSI A;  1N5Y A;  4KB0 A;  3HL8 A;  3NGI A;  3SJJ A;  2HNZ A;  2BGG A;  1XI1 A;  4NYF A;  4FM1 A;  5J2P A;  3OYJ A;  1B9F A;  4I9Q A;  1BL3 A;  1A5V A;  4CES A;  2KQ2 A;  3RMB A;  3WNF A;  1RTI A;  1CLQ A;  2IOC A;  4FJ5 A;  3LAK A;  1Q9Y A;  2KW4 A;  3KD1 E;  5JS2 A;  1I39 A;  4DWI A;  3ZT4 A;  2FBV A;  4CJF A;  4M3Z A;  1S1U A;  3P1G A;  1NJX A;  4PQU A;  4DSI A;  1KFD A;  4CIE A;  4DQS A;  3KLG A;  1S6Q A;  4IFY A;  1YTA A;  3AO3 A;  4EZ6 A;  5SWM A;  5C25 A;  3OYK A;  4B8C A;  3M8S A;  1BIS A;  4FCY A;  1TK8 A;  1VSJ A;  3NCI A;  1WN7 A;  1X9M A;  4B9T A;  2KZM A;  2HND A;  4N47 A;  4CF8 A;  3TAB A;  4CJE A;  5C42 A;  1DTQ A;  2B6A A;  3VQE A;  4IDK A;  1ASV A;  4RW8 A;  3L2U A;  2LSN A;  2HHS A;  4B8A B;  1S9E A;  4M3R A;  3PX0 A;  2P5G A;  4E7H A;  1VSM A;  4KHY A;  4OLB A;  1RIL A;  2E4L A;  4LSN A;  4H4O A;  3CM5 A;  4EP4 A;  3T1A A;  4O0J A;  3KLE A;  3LZJ A;  3LAN A;  3SYZ A;  4DQI A;  3O3F A;  4WE1 A;  4M45 A;  3AA5 X;  1QSY A;  4OJR A;  3EZ5 A;  4FJX A;  1KSP A;  1ZBL A;  1IKW A;  1RBV A;  4M3Y A;  3L3U A;  5CZ2 A;  4O0I A;  4DTP A;  3OS2 A;  3F73 A;  1KTQ A;  4ZTF A;  4C8K A;  1I3A A;  2E6L A;  2HNY A;  3EYZ A;  3SQ2 A;  4KI4 A;  3QER A;  3L8B A;  1RCH A;  3AVK A;  3AO5 A;  4CJW A;  4FJL A;  3CG7 A;  4DS4 A;  4CHN A;  3NH2 A;  1U47 A;  4FLY A;  4Z4G A;  1TKX A;  2ZD1 A;  1DTT A;  4CEC A;  4CHP A;  1Q9X A;  2PYJ A;  4N41 A;  4IKF A;  1WSF A;  2HW3 A;  4FK0 A;  3SNN A;  2XRI A;  4JRP A;  3TAE A;  1KLM A;  2YKM A;  3TR8 A;  4OPK A;  1WAF A;  3UIQ A;  3VQ4 A;  4DG1 A;  3ASM A;  3OYC A;  2XHB A;  4JS5 A;  4FJJ A;  1S9G A;  4AHT A;  2DFF A;  1BQM A;  4PA1 A;  1TL3 A;  2Z1G A;  1CZB A;  3PO4 A;  4K8Z A;  2G8W A;  1LW0 A;  2G8H A;  1YVU A;  4M41 A;  3V9U A;  4FLV A;  3K5M A;  1NKB A;  1C1C A;  4O4G A;  1EX4 A;  2HB5 A;  4CHO A;  1D9D A;  3RRG A;  2HVI A;  3KKR A;  4HCC A;  5HRS A;  4EZ9 A;  4N5S A;  3ZSO A;  1BHL A;  2DFE A;  4Z4E A;  3KLI A;  4Y1D A;  3VQA A;  4RW4 A;  1JLE A;  3DLE A;  4AHV A;  4DTX A;  4CJS A;  4FJ9 A;  2EX3 A;  1J9A A;  3NF6 A;  3VQ9 A;  5CZ1 A;  2G8V A;  4CE9 A;  1T03 A;  2OYQ A;  3LWL A;  3OYM A;  5EU7 A;  2OZM A;  3SPZ A;  4FZZ A;  3BDP A;  3NFA A;  4CJQ A;  3OJS A;  5SZT A;  3SZ2 A;  1R0A A;  5KGW A;  3NDK A;  4Z4H A;  1KCF A;  3ZSR A;  1FXX A;  3OY9 A;  1BQN A;  5DK5 A;  1RTH A;  1GOB A;  3DM2 A;  3V1O A;  4KRE A;  4AHR A;  1SL1 A;  4CJT A;  4G1Q A;  4GW6 A;  4CFD A;  2D0B A;  3KJV A;  5FRM A;  1RBT A;  5DMR A;  1EP4 A;  1UOC A;  2KFZ A;  3NH1 A;  4LY7 A;  2HHW A;  1TV6 A;  4GMJ B;  1BIZ A;  3G10 A;  3AVN A;  4ID1 A;  4B9V A;  1CXU A;  3ZSX A;  4DQR A;  1U49 A;  1NK0 A;  1VRT A;  1VSL A;  2YNI A;  3THV A;  1L5U A;  4KHS A;  2OPR A;  2Q3S A;  4N56 A;  3KK1 A;  4DF4 A;  4KB1 A;  2B5J A;  3NH0 A;  2BAN A;  1ZBU A;  2RF2 A;  4AHU A;  2OPP A;  2W42 A;  2IAJ A;  3NHG A;  4B9M A;  5FDL A;  3SUO A;  4C8L A;  2YNF A;  4J2A A;  3RMD A;  4KFB A;  4C8N A;  1FKP A;  2VWK A;  4MFB A;  5CYM A;  1QHT A;  3OYF A;  1S6P A;  2YNG A;  2Y1I A;  4Z4F A;  1DLO A;  1J54 A;  3ALY A;  4E7I A;  2HHQ A;  4DQP A;  1G15 A;  1ITG A;  4CF9 A;  3RRH A;  2IGI A;  4DQQ A;  1NK4 A;  1UA0 A;  3V1R A;  1IO2 A;  3LPT A;  2QXF A;  3CFR A;  4FJG A;  4OLA A;  1TKD A;  4CGG A;  3LAM A;  3VQ6 A;  1C0T A;  3AVC A;  1J53 A;  3C94 A;  4H8K A;  4YFU A;  3TWH A;  2OA8 A;  2XY8 A;  1VSD A;  3VN5 A;  4W5N A;  3KIO A;  2OPQ A;  3OYE A;  3IG1 A;  4CK3 A;  4LH4 A;  3V9S A;  1NOY A;  1TL1 A;  4CEQ A;  3B6P A;  4CK1 A;  4DTN A;  1LAV A;  2HHT A;  2ITG A;  3C6T A;  3DRR A;  2JGU A;  3O4N A;  3LP2 A;  4BE0 A;  3MXM A;  1S1X A;  1CXQ A;  4CJP A;  3PY8 A;  1HNI A;  2FBX A;  3C95 A;  2IC3 A;  3IRX A;  1JXB A;  1WSH A;  3AO4 A;  1WLJ A;  4O5B A;  5HBM A;  1WSJ A;  4ICL A;  1N6Q A;  2G8I A;  1SKR A;  4DSK A;  1JKH A;  3TAF A;  3OVN A;  1VSE A;  3AVB A;  4RW9 A;  1MU2 A;  5J1E A;  1BCM A;  1VSK A;  3DMJ A;  3SUP A;  1YTU A;  4DSJ A;  1NK8 A;  4DLE A;  1NKE A;  3VQD A;  4FZX C;  3ZSQ A;  5HRP A;  4Q5V A;  4CIF A;  5HLF A;  1BI4 B;  3OYI A;  4J2D A;  3HPO A;  4DSE A;  4AIL C;  3QIO A;  3QEI A;  3PUF A;  2E6M A;  2IS3 A;  4LD0 A;  3KLH A;  4DU3 A;  3RR7 A;  3OYA A;  4DTS A;  1TAU A;  3CM6 A;  3G0Z A;  3QLH A;  1JLB A;  1ZBH A;  1A5X A;  1O1W A;  4CEB A;  2G8U A;  4YNQ A;  3PO5 A;  4HUE A;  4BDY A;  4DLG A;  4E7L A;  1NK7 A;  1ZYQ A;  4FLT A;  3DOK A;  4HHT A;  3SPY A;  4Z0U A;  3HJF A;  1WAJ A;  1SKS A;  4CEF A;  3IS9 A;  4RG8 A;  4JS4 A;  4DTM A;  2A1R A;  4FJI A;  4KAZ A;  1XHX A;  1HYS A;  3D0P A;  2GUI A;  3TAG A;  3QEP A;  4NYN A;  2O4I A;  2RPI A;  3RTV A;  1L3V A;  1ZBI A;  3WNH A;  1JXE A;  1S5J A;  1HYZ A;  3ZCM A;  3ZSV A;  3L2V A;  1YT3 A;  3DLR A;  3F9K A;  4CJV A;  4CJR A;  3RMC A;  3ZT1 A;  1NJW A;  3WNE A;  3B6O A;  4FYD A;  1RT7 A;  5T7B A;  1XC9 A;  1JL1 A;  2AJQ A;  3VQP A;  1ASU A;  4LSL A;  3LZI A;  1TKT A;  4ELU A;  1A5W A;  1RT3 A;  2VG7 A;  4MQ3 A;  2P5O A;  4F3O A;  4B9L A;  1KRP A;  3K58 A;  1VK0 A;  2XO7 A;  2BDP A;  3QIN A;  3DI6 A;  1S1V A;  3TAP A;  2G8K A;  1L3S A;  3KTQ A;  4LH5 A;  2QKB A;  1EET A;  3SUQ A;  4OKE A;  4K8X A;  4FJ8 A;  1U45 A;  3JSM A;  3CFP A;  4ZHR A;  1NJY A;  1KVB A;  3D45 A;  3CYM A;  4O55 A;  4CHQ A;  1HMV A;  3OJU A;  1U4B A;  1TK5 A;  1ZBF A;  4FVM A;  2X6N A;  3VQC A;  2EHG A;  2DTU A;  3CQ8 A;  4CJ5 A;  1RTD A;  4M3X A;  2B4J A;  2GV9 A;  3I0R A;  3O3G A;  3I8D A;  3IAY A;  3ITH A;  3K5O A;  4B3O A;  2XY7 A;  4E89 A;  5HP1 A;  1HRH A;  2YNH A;  4FXD A;  2YKN A;  1LW2 A;  1RDB A;  3ZT2 A;  3BGR A;  4BE1 A;  2HVH A;  3FFI A;  3M8P A;  4RW7 A;  4HTU A;  3NF9 A;  1VSF A;  1C0M A;  1IKV A;  1KVC A;  1C0U A;  3AO1 A;  1B92 A;  1VRU A;  4F8R A;  3NGZ A;  1CZ9 A;  3HVT A;  4IG3 A;  4B08 A;  1C6V A;  1NK9 A;  3LWM A;  1IKX A;  5J2Q A;  4NCB A;  4KHW A;  3AVM A;  5HRR A;  3S3N A;  1REV A;  1UAX A;  3LAL A;  1K6Y A;  5CY4 A;  1FKO A;  3ZSY A;  3QNN A;  4JRQ A;  1RDD A;  3DLB A;  4E7K A;  4L8R B;  4HUF A;  1L3U A;  1Y97 A;  3LPU A;  3LP1 A;  4I2P A;  3TAM A;  3HM9 A;  3ULD A;  4DTU A;  1IG9 A;  1IH7 A;  2PY5 A;  4I9L A;  4KHU A;  5KTQ A;  1RT2 A;  1W0H A;  4KRF A;  4KKO A;  4CEO A;  3HVR A;  3AVG A;  1F21 A;  1QE1 A;  4EP5 A;  1HNV A;  4BWM A;  1W9H A;  3S3M A;  5D3G A;  5J2N A;  3MAQ A;  2WON A;  3HPG A;  5HRO A;  2YV0 X;  1EKE A;  3U3G A;  3TAR A;  4TSX A;  1TKZ A;  4W5R A;  2QK9 A;  4FJH A;  3NF8 A;  3NAE A;  3U6F A;  4DFP A;  4FW1 A;  4M3W A;  3ZT3 A;  1RBR A;  4OPJ A;  5KI6 A;  4IBN A;  3MED A;  4OVL A;  4B9U A;  4IG0 A;  4N76 A;  2A1S A;  3VQQ A;  2WOM A;  4FM0 A;  2PYL A;  3LP0 A;  3KKS A;  3I0S A;  4CK2 A;  3OYG A;  2Z1I A;  3VQB A;  4W5O A;  2KTQ A;  4HVJ A;  4F3T A;  3HPH A;  3L2W A;  1RBU A;  4E0D A;  4CGD A;  1QTM A;  4KHQ A;  4Y1C A;  3KK3 A;  4E19 A;  4DU4 A;  4AH9 A;  2R7Y A;  4IFV A;  2VG6 A;  1JL2 A;  4KPY A;  4CGF A;  4UQG A;  3VQ8 A;  1LWF A;  2Z1H A;  4FJ7 A;  2P1J A;  4C8O A;  1BI4 A;  2YHA A;  4CER A;  1LWE A;  4F4K A;  3AVL A;  1WSI A;  4QOZ B;  1EXQ A;  4DTO A;  4ID5 A;  4CHZ A;  1RBS A;  2VWJ A;  1NK5 A;  2IDO A;  2FBT A;  4E1M A;  4J2E A;  3V9Z A;  4XIU A;  3TAN A;  3U3Y A;  2D5R A;  3SCX A;  1T8E A;  3AVJ A;  4DSF A;  4CGH A;  1C1B A;  3MEG A;  4F2R A;  3ZSW A;  1IKY A;  4OGE A;  1NK6 A;  1SUQ A;  1VSH A;  2JLE A;  1LAW A;  5E41 A;  2BE2 A;  4GVM A;  3OYN A;  4CF1 A;  4QAG A;  1UA1 A;  3RWU A;  4DFM A;  5K14 A;  4DF8 A;  3AA4 A;  3QET A;  3KD5 E;  1BGX T;  1GOA A;  2HHV A;  2DY4 A;  5C24 A;  1XHZ A;  4CHY A;  1JLF A;  3MXI A;  3SV3 A;  1SL0 A;  4JLH A;  4OKK A;  2I5J A;  3HK2 A;  4ZTJ A;  4FLW A;  2ETJ A;  2ZE2 A;  3L3V A;  3P5J A;  4FW2 A;  1QSS A;  3S9H A;  3M8R A;  2OZS A;  2HHU A;  3MEE A;  3K59 A;  3TI0 A;  4FK2 A;  1JLC A;  1QQC A;  4NCG A;  3ISN C;  4O44 A;  2Y1J A;  2XY6 A;  1KFS A;  3DOL A;  4M3U A;  4CJ4 A;  3ZSZ A;  5HRN A;  4M3T A;  1X1P A;  1HJR A;  4AHS A;  4AHC A;  3VQ7 A;  4CJL A;  3K57 A;  3QEV A;  3PX4 A;  1HPZ A;  2QKK A;  4NCA A;  3NBP A;  1NKC A;  1LWC A;  3V9X A;  3HP6 A;  1QS4 A;  2D0A A;  3A2F A;  3O4Q A;  3M8Q A;  4KTZ A;  4ELV A;  4CJ3 A;  2F8S A;  4QCL A;  4DMN A;  3K5L A;  2FC0 A;  3AVF A;  4FJK A;  5KGX A;  3AVH A;  3RMA A;  2DFH A;  3H08 A;  3DYA A;  4CGJ A;  3SI6 A;  2X74 A;  1TGO A;  4PWD A;  1T7P A;  4FM2 A;  3NE6 A;  3P83 D;  3HXM A;  3ZT0 A;  3OYH A;  3HYF A;  1J5O A;  1TAQ A;  3HP9 A;  1HQE A;  2KZZ A;  1RT5 A;  4HUG A;  1RDA A;  1Z26 A;  4FJN A;  1WSG A;  5I3U A;  4I7F A;  4ELT A;  3V4I A;  4CJU A;  3SV4 A;  4DSL A;  1WSE A;  4CFC A;  3V1Q A;  1L3T A;  3QNO A;  4Z4I A;  4PY5 A;  4Z4C A;  4CGI A;  4CFB A;  2F8T A;  4B9N A;  3T19 A;  3S3O A;  2VG5 A;  2ATQ A;  3KK2 A;  4KHN A;  3AA3 A;  1JLA A;  2FBY A;  3LDS A;  3AA2 A;  3OS0 A;  4OKJ A;  1FK9 A;  2RKI A;  4CJK A;  5CYQ A;  3QES A;  4M42 A;  4DFJ A;  1JLG A;  4I2Q A;  3VA3 A;  3PX6 A;  3E01 A;  2X78 A;  1HQU A;  1RTJ A;  4C8M A;  2OPS A;  4W5Q A;  4CED A;  3OS1 A;  3V81 A;  3TAQ A;  5KRS A;  3NGY A; 
#chains in the Genus database with same CATH topology
 4YOW A;  3TU5 A;  4A2B A;  2J4R A;  3KZB A;  4DFK A;  2ZGZ A;  3MN5 A;  1T05 A;  4IFE A;  1UWB A;  5BR8 K;  2GBZ A;  1X9J A;  1RDC A;  3E1Y A;  1YI2 N;  4KTQ A;  5AQF A;  4CCH A;  4DU1 A;  4HCB A;  1WNS A;  3A5M C;  1LOT B;  2ASP A;  4BDP A;  4FL9 A;  3BY5 A;  1SL2 A;  1YJN N;  1RFQ A;  4FK4 A;  1RT6 A;  3ID6 A;  3AVI A;  3LM2 A;  2X6S A;  4A5B A;  3LP3 A;  4CF0 A;  1K73 O;  5JS1 A;  1U04 A;  2HST A;  1Q8I A;  3OYD A;  4JI7 K;  3VGK A;  5C12 A;  3KWG A;  5JMV A;  3EL2 A;  3CCJ N;  1S1T A;  2O8C B;  2ZJP L;  3D7E O;  3ULE B;  3CCE N;  4DV2 K;  4FLZ A;  1RT1 A;  2H3G X;  3RR8 A;  3DJC A;  3L2R A;  3MEC A;  1U2V A;  2RHK A;  1HUX A;  2G8F A;  4CFA A;  3MX2 A;  4LF7 K;  2UYT A;  4B1V A;  2RN2 A;  1Q7Y O;  4K42 A;  3VQ5 A;  4JHD A;  3QIP A;  2ZWH A;  2O4G A;  1Z6R A;  1ASW A;  4HWI A;  3QO9 A;  3TSP A;  1VHX A;  3LDL A;  3M1F A;  2D1K A;  5J2P A;  1B9F A;  4I9Q A;  1BL3 A;  1NGD A;  3RMB A;  3ATU A;  3DXM B;  1RTI A;  3M3Z A;  2IOC A;  1CLQ A;  2KW4 A;  3OBY A;  3AAP A;  3D2F A;  3MCA B;  4JAX A;  4DSI A;  2HBJ A;  1T3V A;  3KLG A;  3E9L A;  4BVO A;  4CZF A;  3NCI A;  1WN7 A;  3HOS A;  2W41 A;  3FR0 A;  3L0Q A;  5AQQ A;  4RW8 A;  3L2U A;  1HJO A;  1GLE G;  2ZF5 O;  1VSM A;  5AQL A;  2QWQ A;  4EHT A;  3A8Y A;  4EP4 A;  4DB3 A;  3T1A A;  4O0J A;  3O3F A;  4WE1 A;  5BPM A;  4OJR A;  3EZ5 A;  3HBT A;  1BA0 A;  5JIC A;  1RBV A;  4B3S K;  3L3U A;  4NB4 A;  4DTP A;  2KKZ A;  4C8K A;  1I3A A;  1KAZ A;  4CJW A;  2E5L K;  3CG7 A;  2F4V K;  4JI1 K;  4FLY A;  2NRV A;  1XUP O;  4GKJ K;  3SNN A;  3TAE A;  1KLM A;  2YKM A;  4JKG A;  1GLA G;  2O8B B;  3ASM A;  2DFF A;  1BQM A;  3VEN A;  1TL3 A;  2UUA K;  1IJJ A;  3PO4 A;  3VEO A;  4V19 S;  1NKB A;  1C1C A;  1EX4 A;  3RRG A;  4CZJ A;  4HCC A;  2FXU A;  3ZSO A;  4BR9 A;  3VQA A;  2A41 A;  4FWS A;  4X66 K;  3NF6 A;  4BC3 A;  3C7N B;  3HI0 A;  4CE9 A;  2OYQ A;  2JWL A;  4DV6 K;  3SPZ A;  4CJQ A;  1QQN A;  1FXX A;  3V1O A;  4AHR A;  3Q7B A;  4CJT A;  3NVM A;  4GW6 A;  2D0B A;  3MK6 A;  3R3L A;  1YJW N;  1UOC A;  1OH5 A;  2FSK A;  4GMJ B;  1BIZ A;  2WFB A;  4ID1 A;  1JCE A;  3ZSX A;  1U49 A;  1L5U A;  2OPR A;  4N56 A;  3KK1 A;  5AQO A;  3BF1 A;  3CCR N;  4DF4 A;  4KB1 A;  2B5J A;  3UKU A;  3R1X A;  2P9K A;  1VQO N;  1ZBU A;  2W42 A;  1KQS M;  2IAJ A;  4AM6 A;  1BWF O;  5CYM A;  1QHT A;  4JI6 K;  4Z4F A;  2AP1 A;  4E7I A;  2HHQ A;  4DKW A;  1QZ6 A;  2QXF A;  3CFR A;  4CGG A;  3LAM A;  3AVC A;  4H8K A;  2OA8 A;  3VN5 A;  1VSD A;  3KIO A;  2OPQ A;  4LH4 A;  1S3X A;  1LAV A;  3VTI A;  3QBX A;  2HHT A;  3C6T A;  5GIP A;  2JGU A;  2Q0R A;  3LP2 A;  5F1X A;  4PL7 A;  3PY8 A;  2FBX A;  3THW A;  3IRX A;  1N6Q A;  4ICL A;  3FE1 A;  3TAF A;  3AVB A;  4RW9 A;  3SUP A;  3DMJ A;  2E8A A;  4DSJ A;  1NKE A;  4FZX C;  4E1J A;  3ZSQ A;  5HRP A;  4CIF A;  1BI4 B;  3OYI A;  5BRF A;  2ZJQ L;  3QEI A;  3PUF A;  2E6M A;  3RR7 A;  5GAG P;  4OX9 K;  3TPQ A;  4CEB A;  4HUE A;  4DLG A;  2O8F A;  4FWR A;  4NXN K;  4HHT A;  1HKB A;  1SKS A;  4JS4 A;  3IS9 A;  4RG8 A;  4DTM A;  4KAZ A;  1XHX A;  1MDU B;  3TAG A;  3QEP A;  1C0G A;  3QB0 A;  1L3V A;  3C0B A;  3WNH A;  1JXE A;  3HOT A;  3EKU A;  3DLR A;  4CJR A;  4B1Y B;  3DLL L;  3KWI A;  3R9P A;  1ASU A;  4BRL A;  5AFU H;  3J80 O;  1TKT A;  4B9L A;  3O5B A;  2XO7 A;  1DT9 A;  4JKD A;  4BRP A;  1L3S A;  3SUQ A;  4OKE A;  4FJ8 A;  4K25 A;  4CZH A;  4GY2 B;  3CCL N;  4ZHR A;  2F9T A;  1KVB A;  3CYM A;  1KXP A;  1OH7 A;  1ATR A;  3I0R A;  3U4L A;  3ITH A;  1ZC6 A;  4IOX A;  2Q36 A;  2P9L B;  1DKG D;  5HP1 A;  3L4I A;  1RDB A;  1HPM A;  2NRH A;  3FFI A;  1IKV A;  1KVC A;  1VRU A;  4H03 B;  4YOY A;  2PFU A;  5BRE A;  1VQL N;  3S3N A;  1X3N A;  5CY4 A;  1FKO A;  4E7K A;  2GUP A;  3LPU A;  5LMN K;  2PY5 A;  4IJN A;  1W0H A;  4KRF A;  4O8K A;  3CCV N;  4BRK A;  1HNV A;  1TUY A;  2WON A;  2YV0 X;  1TKZ A;  2QWM A;  2QK9 A;  3ZT3 A;  5KI6 A;  4OVL A;  3ZX3 A;  5KPT A;  4N76 A;  2A1S A;  4FM0 A;  2PYL A;  2HBM A;  2O8D B;  3I0S A;  3VQB A;  5ADX H;  1RBU A;  1XC3 A;  1YUW A;  4BR0 A;  4E0D A;  4KHQ A;  3P39 A;  4DU4 A;  1WOQ A;  3P4I A;  4KPY A;  4UQG A;  4C8O A;  2YHA A;  4CER A;  4OO1 J;  4ILG B;  4QOZ B;  1IBL K;  1SAZ A;  1P8Z A;  4DTO A;  1RBS A;  1NK5 A;  2FBT A;  4JEP A;  1OVQ A;  3H1Q A;  4BC4 A;  4E1M A;  3CCU N;  3TAN A;  3U3Y A;  1T8E A;  3SBG A;  1K8A O;  4CGH A;  5JVH L;  4C1N I;  1NK6 A;  3O9T A;  4FWO A;  3CET A;  4B3M K;  1VSH A;  1UA1 A;  1HR0 K;  2CH5 A;  5C2F A;  4DF8 A;  3AA4 A;  3KD5 E;  2HHV A;  5C24 A;  4WCE L;  4JV5 K;  5CR4 A;  4CZE A;  3I55 N;  4X64 K;  3ZYY X;  4ZTJ A;  1NGE A;  3L3V A;  3P5J A;  3EE9 A;  1XMQ K;  3S9H A;  2QWP A;  3MEE A;  1TYQ A;  3ISN C;  2Y1J A;  3DOL A;  5EOY A;  2ZJR L;  1S22 A;  3K57 A;  1HJR A;  4AHS A;  2QKK A;  3QEV A;  4RCH A;  1QS4 A;  3A2F A;  3O4Q A;  3CMA N;  5JVG L;  3A5O C;  2GEL A;  3LL3 A;  1WB9 A;  2FC0 A;  4FJK A;  4DV0 K;  4I6M B;  3L4Q A;  1T7P A;  2O8D A;  4GKK K;  3O9S A;  3ZT0 A;  3OYH A;  3HYF A;  5AQN A;  5HL7 L;  1HQE A;  3R8E A;  5I3U A;  4I7F A;  3MN9 A;  4DV7 K;  3V4I A;  3VF2 A;  4JNE A;  5LJW A;  4YHH K;  4Z4I A;  3QNO A;  1VQP N;  4Z4C A;  4CFB A;  3T19 A;  3S3O A;  5C10 A;  2ATQ A;  1XNR K;  3AA3 A;  2FBY A;  3AA2 A;  4OKJ A;  1FK9 A;  4M42 A;  3R6M A;  3VA3 A;  5AZI A;  3PX6 A;  3E01 A;  4CED A;  3OS1 A;  3GG4 A;  3TTD A;  3V9X A;  1RGI A;  4H5T A;  4KTW A;  3V9W A;  3WXM B;  2HMP A;  4XEI A;  4IEI A;  3B8A X;  5J2M A;  4BWJ A;  4B9S A;  1TK0 A;  1NMD A;  3DLK A;  4DQ8 A;  3UE5 A;  1QZ5 A;  1Z25 A;  5LL6 Z;  4CEA A;  2V51 B;  3K5N A;  4CW7 B;  3MMV A;  4CF2 A;  1VQ5 N;  4W5T A;  1NOZ A;  1TYQ B;  1TVR A;  5M1O A;  3C6U A;  4DTR A;  4BAC A;  4BRH A;  1GOC A;  3NF7 A;  3O1W A;  3O3H A;  2A6A A;  2YX6 A;  3CFO A;  5AJ3 K;  2WTU A;  1NJI O;  4OGC A;  2WC9 A;  4DTJ A;  2RE2 A;  3L2Q A;  4JI8 K;  4BRG A;  3HST B;  4BRI A;  1W2B M;  5FRO A;  3EY1 A;  2GEM A;  1ZBS A;  2NLX A;  1KVA A;  2PAV A;  4JKF A;  1KLN A;  3AO2 A;  1GLC G;  4PHT X;  4R5P A;  3K2P A;  3SQ1 A;  1S1W A;  2FSN A;  5I42 A;  3A0I X;  4WQ5 C;  3QDK A;  3ZET B;  3IMX A;  3D2F B;  1K8K A;  4FM1 A;  1KC8 O;  3OYJ A;  4A61 A;  1A5V A;  2YHY A;  4CES A;  1Q86 O;  5AQJ A;  5JS2 A;  3ZT4 A;  2FBV A;  3ENB A;  4M3Z A;  1S1U A;  3C6H A;  4K0K K;  2BTF A;  4CIE A;  4DQS A;  4IFY A;  1YTA A;  3AO3 A;  2OTL N;  4JHD B;  4CVN E;  2HHH K;  3N4Q A;  2HND A;  1EQY A;  4IDK A;  4LF5 K;  4B8A B;  3VET A;  1JCG A;  4JKE A;  4E7H A;  4OLB A;  1RIL A;  5AFU A;  4LSN A;  2O8E A;  3KLE A;  3LZJ A;  3PIO L;  4KHS A;  3ZX0 A;  3A5L C;  1ZBL A;  2WBN A;  4DV4 K;  1ZXO A;  1VQ9 N;  3OS2 A;  1KTQ A;  4ZTF A;  4M7X A;  2E6L A;  4IO9 L;  5EXW A;  2NRX A;  4IWV A;  4FPB A;  1RCH A;  2A42 A;  3AVK A;  3AO5 A;  4FJL A;  2P9K B;  4BQL A;  4CHP A;  1BA1 A;  4IKF A;  4JRP A;  2QTD A;  1WAF A;  2P9N B;  3CXC M;  2XHB A;  4YDU C;  3IDH A;  2HOE A;  4PA1 A;  2Z1G A;  3HM8 A;  3A5N C;  2G8H A;  1YVU A;  4FWP A;  4FLV A;  1Q82 O;  4O4G A;  2HB5 A;  4PKH A;  4EZ9 A;  4N5S A;  5AQW A;  1QHA A;  2YCH A;  4Z4E A;  4Y1D A;  5M1F A;  4RW4 A;  1JLE A;  2VYP A;  4MO4 A;  4CZI A;  4FJ9 A;  2EX3 A;  4EAH D;  1J9A A;  3VQ9 A;  4BQZ A;  2G8V A;  1T03 A;  2E1Z A;  3OYM A;  5EU7 A;  3OJS A;  5SZT A;  3NDK A;  3OY9 A;  5EVZ A;  1N8R O;  1YHQ N;  3O9Q A;  1SL1 A;  4G1Q A;  4CFD A;  4IOA L;  4FPA A;  2UXD K;  1H1V A;  3G25 A;  3VGM A;  1Q81 O;  2HHW A;  1TV6 A;  4H0P A;  4B9V A;  1VRT A;  3THV A;  1P90 A;  1BO5 O;  4OPA A;  4AHU A;  2I7N A;  3BF3 A;  2YJF A;  3SUO A;  3RMD A;  4C8N A;  4DV5 K;  2Y1I A;  1S6P A;  2YNG A;  3BP8 A;  5KPR A;  4A5A A;  1J54 A;  2IVO A;  4DQP A;  1G15 A;  1ITG A;  2VWB A;  4CF9 A;  4DR1 K;  4OLA A;  4FJG A;  2EWS A;  1J53 A;  3C94 A;  5DM7 L;  4W5N A;  3IG1 A;  4CK3 A;  1YJ9 N;  1NOY A;  1TL1 A;  2UUC K;  4YDU A;  4DTN A;  4BE0 A;  1S1X A;  2CGJ A;  4RWT A;  1N32 K;  3CJA A;  4A62 A;  2IC3 A;  1WSH A;  1WLJ A;  2QWO A;  3AO4 A;  4O5B A;  1WSJ A;  3LDQ A;  1OH8 A;  1SKR A;  4DSK A;  2W40 A;  4LFB K;  3OVN A;  1QQM A;  1MU2 A;  1BCM A;  4JI4 K;  1NK8 A;  4DLE A;  3T1H K;  4IEE A;  4Q5V A;  4GV9 A;  4DSE A;  4AIL C;  2IS3 A;  3KLH A;  3UKR A;  3OYA A;  3CM6 A;  3G0Z A;  1A5X A;  1O1W A;  2P9U A;  5JLF A;  1NK7 A;  4CBW A;  2HBL A;  4BC2 A;  5A2Q O;  4Z0U A;  4GV3 A;  1WAJ A;  2E2P A;  4CEF A;  3MN7 A;  3D0P A;  2O4I A;  3L2V A;  4JKB A;  2V7Y A;  3ZT1 A;  3CF5 L;  3B6O A;  5T7B A;  1XC9 A;  3E9O A;  3VQP A;  1E4F T;  1RT3 A;  5ADX A;  4F3O A;  4JN4 A;  2GTD A;  4QS9 A;  2BDP A;  2FF6 A;  2O8C A;  3TAP A;  4ISE A;  1NGB A;  1GLF O;  2QKB A;  3O9U A;  4K8X A;  1U45 A;  2O8B A;  3JSM A;  3WXJ A;  3P38 A;  5AZJ A;  1NJY A;  1NNE A;  4O55 A;  1NBW A;  3RSE A;  1HMV A;  1RDU A;  4CJ5 A;  2GV9 A;  3K5O A;  1VQ6 N;  5AQH A;  2OTJ N;  1TUU A;  4JD2 B;  4E89 A;  4CBU A;  3H3O B;  1LW2 A;  4BE1 A;  4RW7 A;  3SAF A;  3CME N;  1C0M A;  3CPE A;  4JK7 A;  1B92 A;  2QWL A;  1CZ9 A;  4IG3 A;  3K9J A;  1IKX A;  3AVM A;  4BR7 A;  3LAL A;  1K6Y A;  3ZSY A;  5IWA K;  4WYB A;  1RDD A;  3CIP A;  3DXK B;  3CCS N;  3DLB A;  4HUF A;  4PKI A;  1L3U A;  4BRC A;  4U7B A;  3LP1 A;  4DTU A;  4B3T K;  1IG9 A;  4CZM A;  5KTQ A;  4AF1 A;  3THY A;  3ZLJ A;  4YOT A;  1QE1 A;  4EP5 A;  1YVN A;  5ELZ A;  3S3M A;  4BGA A;  4H5V A;  2ZGY A;  5J2N A;  5C0Y A;  4IXC A;  3HPG A;  5HRO A;  4BRO A;  4IO8 A;  5LJV A;  2ZM6 K;  2VQF K;  3LDN A;  4IBN A;  5BRD A;  3H1V X;  2WOM A;  1BG3 A;  3DWL A;  2KTQ A;  3LP0 A;  4CK2 A;  3KKS A;  3EKS A;  3W0L A;  3QML A;  4HVJ A;  2W6L A;  4CGD A;  2UXB K;  4AH9 A;  2JWK A;  1JL2 A;  3EN9 A;  4FJ7 A;  1NU0 A;  1BI4 A;  1LWE A;  4F4K A;  3AVL A;  1WSI A;  3T69 A;  3TSQ A;  1EXQ A;  2VWJ A;  3VES A;  4J2E A;  4AM7 A;  1W7A A;  4L3Q A;  3AVJ A;  1NG9 A;  3MEG A;  1N34 K;  3ZSW A;  4OGE A;  1U2V B;  5IT9 O;  2JLE A;  5E41 A;  3RWU A;  5K14 A;  3QET A;  2DY4 A;  3FZL A;  1JJ2 M;  4K41 A;  4CZK A;  1HX1 A;  3QIC A;  5BPN A;  4YOX A;  4LF8 K;  3M6G A;  3HZ6 A;  2ASM A;  2ETJ A;  3FZM A;  2HHU A;  3T7Z A;  3K59 A;  4FK2 A;  1JLC A;  5TKW A;  4NCG A;  3FGU A;  1KFS A;  4H0V B;  3L6Q A;  4M3U A;  3VEX A;  4AHC A;  4BG9 A;  4NCA A;  3UKU B;  3NBP A;  4JK9 A;  1LWC A;  3THY B;  4QCL A;  4CJ7 A;  3BUZ B;  2X74 A;  4PWD A;  3CQX A;  1J5O A;  3PIP L;  3AGR A;  1WSG A;  4NLB A;  4BG8 A;  4CJU A;  4DSL A;  4CFC A;  3V1Q A;  4A2A A;  1L3T A;  2F8T A;  3OBW A;  4EFH A;  4JD2 A;  1JLA A;  4FWL A;  3SLC A;  4DR5 K;  3QES A;  5FLX O;  4IDH A;  4I2Q A;  1HQU A;  4A57 A;  1M1K O;  2OPS A;  4W5Q A;  2OCE A;  1NGI A;  4B1X B;  5GAE P;  4FLX A;  3CD6 N;  4B3R K;  1B9D A;  2YHB A;  2FF3 B;  3AVA A;  4CEE A;  3OYB A;  1XWL A;  4H4M A;  5FRN A;  4E7J A;  3SUN A;  3NVK A;  4FZY A;  3DLH A;  5AZI B;  4JKC A;  1D9F A;  4BE2 A;  3C6A A;  2IVN A;  3SQ0 A;  4BRM A;  3FLC O;  3S41 A;  2YHX A;  2KFN A;  5LY3 A;  2ZQB A;  4F2S A;  4MO5 A;  3GL1 A;  3O80 A;  4CIG A;  3HT3 A;  2XY5 A;  4DS5 A;  2P51 A;  3HO1 A;  3DAW A;  1O13 A;  5JLH A;  1Y64 A;  3AV9 A;  1SKW A;  2P9N A;  1U48 A;  4I6M A;  1VAZ A;  3VER A;  4C1N K;  1D5A A;  3VA0 A;  1OKJ A;  4DR7 K;  1X9W A;  3PV8 A;  4KO0 A;  4PUO A;  4E3S A;  4KI6 A;  1LV5 A;  1QSL A;  4ILJ A;  2BH1 A;  3WNG A;  3MXJ A;  5AQT A;  3LM9 A;  3HL8 A;  3NGI A;  4LF6 K;  2HNZ A;  3GOI A;  1G99 A;  2HF3 A;  3N4P A;  2KQ2 A;  5M1N A;  3WNF A;  4FJ5 A;  2GX9 A;  1Q9Y A;  3F5T A;  3KD1 E;  1I39 A;  3W3D A;  5C15 A;  4CJF A;  1NJX A;  4PQU A;  3HTV A;  1IG8 A;  1S6Q A;  5C25 A;  5AQM A;  3OYK A;  1BIS A;  3FZH A;  4FCY A;  1X9M A;  3ID8 A;  3H6E A;  3CJC A;  1ASV A;  4DCH A;  2LSN A;  2HHS A;  3SJH A;  1S9E A;  3PX0 A;  2UXC K;  4X62 K;  3VF6 A;  4H4O A;  3CHW A;  3CM5 A;  1K8K B;  5AQP A;  3SYZ A;  1HNW K;  3LAN A;  4DQI A;  3WQT A;  1IKW A;  3VTH A;  3PLA A;  1U6Z A;  2CGK A;  4M3Y A;  5CZ2 A;  4O0I A;  3F73 A;  1DEJ A;  3PSF A;  2HNY A;  4YOU A;  3SQ2 A;  4KI4 A;  4NO7 A;  3QER A;  2ASO A;  1W97 L;  3L8B A;  3QFU A;  3VGL A;  4CHN A;  3NH2 A;  1U47 A;  2GWJ A;  1TKX A;  1DTT A;  4CEC A;  4N41 A;  2HW3 A;  5AQI A;  3TR8 A;  1XMO K;  3UIQ A;  3VQ4 A;  2PBD A;  4DG1 A;  4F9O A;  4DUZ K;  3NMU A;  1S9G A;  4H5W A;  4AHT A;  3I33 A;  4J8F A;  2G8W A;  3V9U A;  1KAX A;  4CHO A;  2D4W A;  3KKR A;  4DR6 K;  4NXM K;  5HRS A;  1BHL A;  3KLI A;  3DLE A;  4CJS A;  3GE1 A;  5KQD A;  2OZM A;  2P9L A;  3BDP A;  3SZ2 A;  4KH4 A;  1T44 A;  3VEV A;  1KCF A;  3ZSR A;  5DK5 A;  3WEE A;  4KRE A;  5AZJ B;  4LFC K;  3KJV A;  1RBT A;  4B1U B;  1EP4 A;  3K0S A;  3OTO K;  3AVN A;  1VSL A;  1NGG A;  1IV0 A;  2Q3S A;  5GIO A;  3NH0 A;  2QI2 A;  3NHG A;  4B9M A;  3PSI A;  5FDL A;  4J2A A;  2YNF A;  1FKP A;  2VWK A;  4MFB A;  5F2R A;  2FLO A;  1NK4 A;  2I7P A;  2IGI A;  4DQQ A;  1KAY A;  3V1R A;  1IO2 A;  3FZF A;  1TKD A;  3EO3 A;  1C0T A;  3ZX2 A;  5AQX A;  2P9U B;  3M5R A;  3TWH A;  5EY4 A;  3OYE A;  1NGF A;  3G4S N;  3VOV A;  3V9S A;  1QVG M;  3UKR B;  3JAM O;  2BUP A;  1T6C A;  4BRN A;  3O4N A;  4CD3 A;  4MLH A;  3CI5 A;  1HNI A;  3C95 A;  4FJI A;  1JXB A;  2G8I A;  3TTF A;  1HLU A;  1YTU A;  3JXU A;  3SMP A;  4J2D A;  2NRZ A;  3T1Y K;  4ISG A;  1ZBH A;  3CPW M;  2G8U A;  4YNQ A;  1M90 O;  3UB5 A;  1ZYQ A;  4FLT A;  4XH1 A;  3SPY A;  3AAR A;  2A1R A;  1HYS A;  2GUI A;  4NYN A;  2Q31 A;  2OAN A;  4MLE A;  1S5J A;  1HYZ A;  3ZCM A;  3OHR A;  1YT3 A;  3O6W A;  3HSC A;  3F9K A;  3WNE A;  3J7Y P;  4FYD A;  1RT7 A;  3EZW A;  1JL1 A;  2AJQ A;  3LZI A;  4LSL A;  4ELU A;  1A5W A;  4MQ3 A;  4BC5 A;  1YF5 L;  1S72 N;  3DI6 A;  5EX5 A;  3C65 A;  3JS6 A;  3KTQ A;  3WXI A;  2HF4 A;  4DR2 K;  3CJ7 A;  3MX5 A;  4CHQ A;  3VEY A;  3OJU A;  4O8U A;  1ZBF A;  2EHG A;  5BR9 A;  5BPL A;  3CQ8 A;  4M3X A;  5AQK A;  2XY7 A;  2FSJ A;  5CE3 A;  5F0X A;  3G6E N;  4FXD A;  2YKN A;  2AA4 A;  5GAH P;  3ZT2 A;  3BGR A;  5M1Q A;  1YAG A;  3M8P A;  3ATV A;  3NF9 A;  1VSF A;  2E20 A;  3CCQ N;  1C0U A;  4B08 A;  1C6V A;  4DUY K;  4KHW A;  2W6K A;  3H46 O;  1UAX A;  5AQZ A;  4H0T B;  4JRQ A;  3QNN A;  4IJA A;  2QA4 N;  4H0Y B;  3ULD A;  4I2P A;  3G71 N;  3HM9 A;  4CZG A;  4I9L A;  2NZT A;  1RT2 A;  4KKO A;  2D0O A;  2GWK A;  3AVG A;  3F9M A;  1F21 A;  1VQ4 N;  5D3G A;  1X3M A;  5AQY A;  3FFK B;  3U3G A;  1WBD A;  4W5R A;  3AY9 A;  3NF8 A;  1Q18 A;  5GIN A;  3U6F A;  3KHY A;  3WXK A;  4DFP A;  4WFA L;  4YY3 K;  4M3W A;  1RBR A;  1E4G T;  4B9U A;  4IG0 A;  2O8E B;  3VQQ A;  4PKG A;  1XQS C;  4F3T A;  4JI5 K;  3L2W A;  1QTM A;  4E19 A;  4K43 A;  4IFV A;  2VGM A;  4O5F A;  1IBK K;  1ATN A;  2Z1H A;  4QS7 A;  3D2E A;  5KPZ A;  4ID5 A;  4CHZ A;  5AQU A;  2IDO A;  3V9Z A;  4XIU A;  5DM6 L;  3SCX A;  4BR2 A;  4DSF A;  2KHO A;  1C1B A;  4F2R A;  4A59 A;  4FWK A;  4WQ5 A;  4CBX A;  3OYN A;  5KQ8 A;  3WXL A;  4DFM A;  1BGX T;  2O8F B;  1GOA A;  3H45 C;  1XHZ A;  1JLF A;  3SV3 A;  3ZET A;  5FPN A;  4FOI A;  2E1Y A;  2I5J A;  3OW2 M;  3SAG A;  4FW2 A;  1QSS A;  2QM1 A;  3M8R A;  3TI0 A;  1BOT O;  1RDW X;  3BZC A;  1GLL O;  3TTC A;  4EHU A;  4BY9 C;  4M3T A;  4CJL A;  3PX4 A;  1HPZ A;  3D2E B;  3THW B;  1DGK N;  3SK3 A;  2D0A A;  3M8Q A;  4KTZ A;  3SMS A;  4CJ3 A;  1WBB A;  4DMN A;  3K5L A;  5M1P A;  3AVH A;  3RMA A;  3O4W A;  3J81 O;  3DYA A;  3H08 A;  4CGJ A;  3SI6 A;  1TGO A;  4JI0 K;  4DV3 K;  3NE6 A;  1TAQ A;  3HP9 A;  2A40 A;  1RT5 A;  4HUG A;  4FJN A;  2KZZ A;  4R79 A;  4DHY A;  3SV4 A;  1D4X A;  3WUH A;  1WSE A;  3LDO A;  3O9R A;  4BR5 A;  4PY5 A;  3CC2 N;  2P9I A;  1IBM K;  5FPM A;  4YOV A;  4B9N A;  2P9I B;  3KK2 A;  4KHN A;  2IVP A;  4C23 A;  1NWK A;  4LC9 B;  2RKI A;  4CJK A;  5CYQ A;  1JLG A;  2P9S B;  2X78 A;  4C8M A;  1RTJ A;  3V81 A;  4BRD A;  3EE8 A;  3TAQ A;  3NGY A;  3D6R A;  1WUA A;  1NJZ A;  1Z05 A;  4JI2 K;  1OH6 A;  4KH5 A;  3JYT A;  4J2B A;  1JLQ A;  4B9Q A;  4RW6 A;  3QEW A;  5B8H A;  5E26 A;  1FW6 A;  1RT4 A;  4LF4 K;  5KRT A;  3CJ1 A;  5AQG A;  4FJM A;  3WQU A;  3DRP A;  4KV8 A;  3GBT A;  2F96 A;  2UUB K;  4LFA K;  5E84 A;  4E1N A;  1GLB G;  4M63 C;  3OYL A;  1MWK A;  1HYV A;  1C1A A;  3DRS A;  1X9S A;  3T3F A;  4HTL A;  4FWM A;  2HMI A;  4CEZ A;  5CHI A;  1D8Y A;  1BCO A;  4BDZ A;  2VGN A;  4Q0B A;  2PZS A;  3CCM N;  2NUB A;  1BU6 O;  3V6D A;  1RNH A;  4B1W B;  4FLU A;  3TSU A;  2HHX A;  3KLF A;  3QEX A;  3H3N O;  4Z94 A;  1SV5 A;  3DLG A;  1SS6 A;  3SQ4 A;  1I94 K;  2V7Z A;  2D0C A;  1BIU A;  2Z1J A;  1VSI A;  1N5Y A;  4KB0 A;  3SJJ A;  3VPZ A;  3GDQ A;  2BGG A;  1XI1 A;  4NYF A;  1VQM N;  5BN9 A;  3LAK A;  4DV1 K;  2WUS A;  4DWI A;  4WQ4 A;  1VQ8 N;  3AAQ A;  3P1G A;  2Q97 A;  1KFD A;  4H5N A;  2E2O A;  4EZ6 A;  1HNZ K;  5SWM A;  4B8C A;  3M8S A;  1TK8 A;  1VSJ A;  1HNX K;  4B9T A;  2KZM A;  4N47 A;  4BRA A;  4CF8 A;  3TAB A;  3VEW A;  4CJE A;  2A3Z A;  2D0P A;  5C42 A;  1YIJ N;  1DTQ A;  2B6A A;  3VQE A;  3DXM A;  4XH4 A;  4M3R A;  2F7T A;  4WF9 L;  2P5G A;  4KHY A;  2E4L A;  2Q1N A;  4B1Z A;  4QS8 A;  4ISF A;  4FJX A;  4M45 A;  1QSY A;  3AA5 X;  1KSP A;  1YIT N;  1NM1 A;  3CC7 N;  3U8X A;  4CI6 A;  3J8A A;  3EYZ A;  4YOR A;  4DR4 K;  3C7N A;  1NGC A;  3I56 N;  5AR0 A;  4DS4 A;  4Z4G A;  4WFN L;  2ZD1 A;  2PYJ A;  1Q9X A;  1R59 O;  1WSF A;  1KD1 O;  4FK0 A;  2XRI A;  3O1B A;  4OPK A;  3E9P A;  4FWN A;  2YJE A;  1HKC A;  3OYC A;  4JS5 A;  4BGB A;  4FJJ A;  3FZK A;  1CZB A;  4JKG B;  4K8Z A;  1ESV A;  1BUP A;  1LW0 A;  2P9S A;  4M41 A;  3CJ9 A;  3K5M A;  1D9D A;  2HVI A;  1GLD G;  2Q2R A;  2DFE A;  4AHV A;  4DTX A;  4BRF A;  1YXQ A;  5CZ1 A;  4EIA A;  2NNW A;  3LWL A;  4FZZ A;  3NFA A;  5GAD P;  1R0A A;  5KGW A;  4Z4H A;  1EWQ A;  4JYA K;  4U67 L;  1BQN A;  2E2Q A;  3CJB A;  1RTH A;  4GNI A;  1GOB A;  3DM2 A;  4FOE A;  3KVG A;  5FRM A;  2IIR A;  5DMR A;  2F9W A;  2KFZ A;  3NH1 A;  4LY7 A;  3G10 A;  4PL8 A;  1CXU A;  4DQR A;  1NK0 A;  2YNI A;  2P9P A;  5BN8 A;  4NLC A;  2UU9 K;  4FVU A;  2BAN A;  2RF2 A;  2OPP A;  3KK7 A;  2QXL A;  4H5R A;  2E2N A;  4C8L A;  4KFB A;  5AQR A;  3OYF A;  1K9M O;  1DLO A;  3ALY A;  4FSV A;  3RRH A;  1UA0 A;  3LPT A;  4KHP K;  3IFR A;  3SBT A;  3VQ6 A;  1NLV A;  4YFU A;  4UY8 O;  2XY8 A;  4JI3 K;  4CEQ A;  1OVY A;  3B6P A;  4CK1 A;  1NGJ A;  2ITG A;  3DRR A;  3WT0 A;  3MXM A;  1CXQ A;  4CJP A;  1BDG A;  2NRT A;  5HBM A;  1NGA A;  1VQN N;  4BRQ A;  1ATS A;  1JKH A;  1GLJ O;  4JK8 A;  1VSE A;  4JKA A;  5J1E A;  1VSK A;  3IUC A;  3VQD A;  2Q0U A;  5HLF A;  3HPO A;  3O08 A;  3MWP A;  3QIO A;  4DU3 A;  4LD0 A;  3K9K A;  4DTS A;  1TAU A;  3QLH A;  3THX B;  1JLB A;  3QBW A;  2NRR A;  3PO5 A;  4AQY K;  4BDY A;  4E7L A;  1MWM A;  3DOK A;  1ILY A;  3U9D A;  3HJF A;  4M7Y A;  4MDA A;  2RPI A;  3RTV A;  4H0O A;  1ZBI A;  3ZSV A;  3MDQ A;  1V4T A;  3J7Z O;  4CJV A;  3RMC A;  1NJW A;  1N33 K;  1T6D A;  1VQ7 N;  2KLA A;  4KBO A;  1N36 K;  2VG7 A;  2P5O A;  1QVF M;  1KRP A;  3K58 A;  1VK0 A;  3QIN A;  2P9P B;  5I9E B;  3SAH A;  1J5E K;  1S1V A;  2G8K A;  4LH5 A;  4Y0W A;  1EET A;  1CZA N;  3F2K A;  3E66 A;  4GVE A;  3CFP A;  3D45 A;  1U4B A;  1TK5 A;  1J6Z A;  2YI1 A;  4FVM A;  2X6N A;  3EEQ A;  3VQC A;  3P31 A;  2DTU A;  2DPN A;  1RTD A;  4GV6 A;  2B4J A;  3O3G A;  3I8D A;  3IAY A;  4B3O A;  4WFB L;  4BR4 A;  1HRH A;  1LCU A;  2YNH A;  2QWN A;  1VQK N;  2HVH A;  2ITM A;  5LMU K;  4HTU A;  5M1K A;  3ENH A;  3AO1 A;  4F8R A;  3NGZ A;  3HVT A;  3Q7C A;  1NK9 A;  3LWM A;  3RSE B;  5J2Q A;  4NCB A;  2QW9 A;  5HRR A;  3O8M A;  1REV A;  1V4S A;  4IZ9 A;  4RTF D;  4L8R B;  1Y97 A;  3TAM A;  1IH7 A;  4KHU A;  1SQK A;  4CEO A;  3HVR A;  5C2D A;  4BWM A;  1W9H A;  1QQO A;  3MAQ A;  3HRG A;  5FPD A;  1EKE A;  2HBK A;  3CER A;  5AQV A;  5H1S Q;  3TAR A;  4TSX A;  3ZEU B;  4FJH A;  3NAE A;  1FJG K;  3VF4 A;  4LF9 K;  4FO0 A;  4FW1 A;  4OPJ A;  3MED A;  4BVP A;  5FPE A;  2YHW A;  3OYG A;  3BEX A;  2Z1I A;  4W5O A;  4KH6 A;  3HPH A;  4Y1C A;  3KK3 A;  3RVC A;  1SZ2 A;  2R7Y A;  2VG6 A;  4XH5 A;  4CGF A;  3VQ8 A;  1LWF A;  2P1J A;  3LDP A;  3VMF B;  4BRE A;  2V52 B;  4CD1 A;  4X65 K;  2VCP A;  2VQE K;  1EO1 A;  4DR3 K;  2D5R A;  3ENO A;  4H0X B;  1IKY A;  2CH6 A;  1MA9 B;  1SUQ A;  5HOO A;  2CGL A;  1LAW A;  3MWT A;  2BE2 A;  4GVM A;  4CF1 A;  4QAG A;  1JCF A;  4OPH A;  3IKM A;  5TKY A;  4CHY A;  4G9Z A;  3MXI A;  3MCP A;  1SL0 A;  4JLH A;  3THX A;  3BZK A;  4OKK A;  3HK2 A;  4FLW A;  2ZE2 A;  4JKH A;  1EWR A;  2OZS A;  1QQC A;  4O44 A;  3ZEU A;  2XY6 A;  3OA9 A;  4CJ4 A;  3ZSZ A;  5HRN A;  1X1P A;  3VQ7 A;  4MDB A;  1NKC A;  3HP6 A;  2QWR A;  3CQY A;  3U9Z A;  4ELV A;  2F8S A;  4IOC L;  4FWQ A;  3ULE A;  3AVF A;  5KGX A;  2DFH A;  4WQ4 C;  2QEX N;  2E88 A;  1E3M A;  4CZL A;  4ILH A;  4FM2 A;  3P83 D;  3HXM A;  3WEE B;  1RDA A;  1Z26 A;  3MN6 A;  1XNQ K;  3QFP A;  4ELT A;  5MLC Q;  1NGH A;  3VEZ A;  2A5X A;  4CGI A;  5BRH A;  2NRW A;  2VG5 A;  3LDS A;  3OS0 A;  3I8B A;  4DFJ A;  3AGK A;  1HKG A;  1NMN A;  5AQS A;  3CC4 N;  3J7A P;  3DXK A;  5KRS A;  1C0F A; 
#chains in the Genus database with same CATH homology
 4FLX A;  4KTW A;  1NJZ A;  3V9W A;  1B9D A;  2YHB A;  3AVA A;  4CEE A;  4DFK A;  3OYB A;  1XWL A;  4H4M A;  5FRN A;  1T05 A;  3JYT A;  5J2M A;  4E7J A;  1JLQ A;  4J2B A;  1UWB A;  4RW6 A;  2GBZ A;  3SUN A;  1RDC A;  4KTQ A;  3QEW A;  4BWJ A;  4B9S A;  1TK0 A;  3DLH A;  4CCH A;  4FZY A;  4DU1 A;  4HCB A;  3DLK A;  1D9F A;  4BE2 A;  1WNS A;  1RT4 A;  3SQ0 A;  5KRT A;  1Z25 A;  4BDP A;  1SL2 A;  4FJM A;  2KFN A;  4CEA A;  3DRP A;  4KV8 A;  3K5N A;  2F96 A;  2ZQB A;  4CF2 A;  4W5T A;  4F2S A;  1NOZ A;  4FK4 A;  1RT6 A;  3HT3 A;  4CIG A;  1TVR A;  3AVI A;  3C6U A;  2X6S A;  3LP3 A;  4CF0 A;  4DTR A;  4E1N A;  2XY5 A;  4DS5 A;  5JS1 A;  4BAC A;  1GOC A;  1U04 A;  1Q8I A;  2P51 A;  3NF7 A;  3OYL A;  1HYV A;  3HO1 A;  1C1A A;  3DRS A;  3OYD A;  1X9S A;  3AV9 A;  3T3F A;  1SKW A;  3O3H A;  1U48 A;  1S1T A;  3CFO A;  2HMI A;  4CEZ A;  1D8Y A;  1BCO A;  4OGC A;  4BDZ A;  4DTJ A;  4Q0B A;  3L2Q A;  1D5A A;  4FLZ A;  1RT1 A;  3VA0 A;  2PZS A;  3RR8 A;  3L2R A;  3MEC A;  2NUB A;  3HST B;  1X9W A;  3PV8 A;  2G8F A;  4CFA A;  5FRO A;  4KO0 A;  3EY1 A;  1RNH A;  3V6D A;  2RN2 A;  4PUO A;  1KVA A;  4E3S A;  4FLU A;  1LV5 A;  4KI6 A;  3VQ5 A;  1KLN A;  1QSL A;  3QIP A;  3AO2 A;  2HHX A;  3KLF A;  3QEX A;  2O4G A;  1SV5 A;  1ASW A;  3DLG A;  3WNG A;  4R5P A;  3QO9 A;  3SQ4 A;  3K2P A;  3MXJ A;  1S1W A;  3SQ1 A;  5I42 A;  2D0C A;  1BIU A;  2Z1J A;  1VSI A;  1N5Y A;  4KB0 A;  3HL8 A;  3NGI A;  3SJJ A;  2HNZ A;  2BGG A;  1XI1 A;  4NYF A;  4FM1 A;  5J2P A;  3OYJ A;  1B9F A;  4I9Q A;  1BL3 A;  1A5V A;  4CES A;  2KQ2 A;  3RMB A;  3WNF A;  1RTI A;  1CLQ A;  2IOC A;  4FJ5 A;  3LAK A;  1Q9Y A;  2KW4 A;  3KD1 E;  5JS2 A;  1I39 A;  4DWI A;  3ZT4 A;  2FBV A;  4CJF A;  4M3Z A;  1S1U A;  3P1G A;  1NJX A;  4PQU A;  4DSI A;  1KFD A;  4CIE A;  4DQS A;  3KLG A;  1S6Q A;  4IFY A;  1YTA A;  3AO3 A;  4EZ6 A;  5SWM A;  5C25 A;  3OYK A;  4B8C A;  3M8S A;  1BIS A;  4FCY A;  1TK8 A;  1VSJ A;  3NCI A;  1WN7 A;  1X9M A;  4B9T A;  2KZM A;  2HND A;  4N47 A;  4CF8 A;  3TAB A;  4CJE A;  5C42 A;  1DTQ A;  2B6A A;  3VQE A;  4IDK A;  1ASV A;  4RW8 A;  3L2U A;  2LSN A;  2HHS A;  4B8A B;  1S9E A;  4M3R A;  3PX0 A;  2P5G A;  4E7H A;  1VSM A;  4KHY A;  4OLB A;  1RIL A;  2E4L A;  4LSN A;  4H4O A;  3CM5 A;  4EP4 A;  3T1A A;  4O0J A;  3KLE A;  3LZJ A;  3LAN A;  3SYZ A;  4DQI A;  3O3F A;  4WE1 A;  4M45 A;  3AA5 X;  1QSY A;  4OJR A;  3EZ5 A;  4FJX A;  1KSP A;  1ZBL A;  1IKW A;  1RBV A;  4M3Y A;  3L3U A;  5CZ2 A;  4O0I A;  4DTP A;  3OS2 A;  3F73 A;  1KTQ A;  4ZTF A;  4C8K A;  1I3A A;  2E6L A;  2HNY A;  3EYZ A;  3SQ2 A;  4KI4 A;  3QER A;  3L8B A;  1RCH A;  3AVK A;  3AO5 A;  4CJW A;  4FJL A;  3CG7 A;  4DS4 A;  4CHN A;  3NH2 A;  1U47 A;  4FLY A;  4Z4G A;  1TKX A;  2ZD1 A;  1DTT A;  4CEC A;  4CHP A;  1Q9X A;  2PYJ A;  4N41 A;  4IKF A;  1WSF A;  2HW3 A;  4FK0 A;  3SNN A;  2XRI A;  4JRP A;  3TAE A;  1KLM A;  2YKM A;  3TR8 A;  4OPK A;  1WAF A;  3UIQ A;  3VQ4 A;  4DG1 A;  3ASM A;  3OYC A;  2XHB A;  4JS5 A;  4FJJ A;  1S9G A;  4AHT A;  2DFF A;  1BQM A;  4PA1 A;  1TL3 A;  2Z1G A;  1CZB A;  3PO4 A;  4K8Z A;  2G8W A;  1LW0 A;  2G8H A;  1YVU A;  4M41 A;  3V9U A;  4FLV A;  3K5M A;  1NKB A;  1C1C A;  4O4G A;  1EX4 A;  2HB5 A;  4CHO A;  1D9D A;  3RRG A;  2HVI A;  3KKR A;  4HCC A;  5HRS A;  4EZ9 A;  4N5S A;  3ZSO A;  1BHL A;  2DFE A;  4Z4E A;  3KLI A;  4Y1D A;  3VQA A;  4RW4 A;  1JLE A;  3DLE A;  4AHV A;  4DTX A;  4CJS A;  4FJ9 A;  2EX3 A;  1J9A A;  3NF6 A;  3VQ9 A;  5CZ1 A;  2G8V A;  4CE9 A;  1T03 A;  2OYQ A;  3LWL A;  3OYM A;  5EU7 A;  2OZM A;  3SPZ A;  4FZZ A;  3BDP A;  3NFA A;  4CJQ A;  3OJS A;  5SZT A;  3SZ2 A;  1R0A A;  5KGW A;  3NDK A;  4Z4H A;  1KCF A;  3ZSR A;  1FXX A;  3OY9 A;  1BQN A;  5DK5 A;  1RTH A;  1GOB A;  3DM2 A;  3V1O A;  4KRE A;  4AHR A;  1SL1 A;  4CJT A;  4G1Q A;  4GW6 A;  4CFD A;  2D0B A;  3KJV A;  5FRM A;  1RBT A;  5DMR A;  1EP4 A;  1UOC A;  2KFZ A;  3NH1 A;  4LY7 A;  2HHW A;  1TV6 A;  4GMJ B;  1BIZ A;  3G10 A;  3AVN A;  4ID1 A;  4B9V A;  1CXU A;  3ZSX A;  4DQR A;  1U49 A;  1NK0 A;  1VRT A;  1VSL A;  2YNI A;  3THV A;  1L5U A;  4KHS A;  2OPR A;  2Q3S A;  4N56 A;  3KK1 A;  4DF4 A;  4KB1 A;  2B5J A;  3NH0 A;  2BAN A;  1ZBU A;  2RF2 A;  4AHU A;  2OPP A;  2W42 A;  2IAJ A;  3NHG A;  4B9M A;  5FDL A;  3SUO A;  4C8L A;  2YNF A;  4J2A A;  3RMD A;  4KFB A;  4C8N A;  1FKP A;  2VWK A;  4MFB A;  5CYM A;  1QHT A;  3OYF A;  1S6P A;  2YNG A;  2Y1I A;  4Z4F A;  1DLO A;  1J54 A;  3ALY A;  4E7I A;  2HHQ A;  4DQP A;  1G15 A;  1ITG A;  4CF9 A;  3RRH A;  2IGI A;  4DQQ A;  1NK4 A;  1UA0 A;  3V1R A;  1IO2 A;  3LPT A;  2QXF A;  3CFR A;  4FJG A;  4OLA A;  1TKD A;  4CGG A;  3LAM A;  3VQ6 A;  1C0T A;  3AVC A;  1J53 A;  3C94 A;  4H8K A;  4YFU A;  3TWH A;  2OA8 A;  2XY8 A;  1VSD A;  3VN5 A;  4W5N A;  3KIO A;  2OPQ A;  3OYE A;  3IG1 A;  4CK3 A;  4LH4 A;  3V9S A;  1NOY A;  1TL1 A;  4CEQ A;  3B6P A;  4CK1 A;  4DTN A;  1LAV A;  2HHT A;  2ITG A;  3C6T A;  3DRR A;  2JGU A;  3O4N A;  3LP2 A;  4BE0 A;  3MXM A;  1S1X A;  1CXQ A;  4CJP A;  3PY8 A;  1HNI A;  2FBX A;  3C95 A;  2IC3 A;  3IRX A;  1JXB A;  1WSH A;  3AO4 A;  1WLJ A;  4O5B A;  5HBM A;  1WSJ A;  4ICL A;  1N6Q A;  2G8I A;  1SKR A;  4DSK A;  1JKH A;  3TAF A;  3OVN A;  1VSE A;  3AVB A;  4RW9 A;  1MU2 A;  5J1E A;  1BCM A;  1VSK A;  3DMJ A;  3SUP A;  1YTU A;  4DSJ A;  1NK8 A;  4DLE A;  1NKE A;  3VQD A;  4FZX C;  3ZSQ A;  5HRP A;  4Q5V A;  4CIF A;  5HLF A;  1BI4 B;  3OYI A;  4J2D A;  3HPO A;  4DSE A;  4AIL C;  3QIO A;  3QEI A;  3PUF A;  2E6M A;  2IS3 A;  4LD0 A;  3KLH A;  4DU3 A;  3RR7 A;  3OYA A;  4DTS A;  1TAU A;  3CM6 A;  3G0Z A;  3QLH A;  1JLB A;  1ZBH A;  1A5X A;  1O1W A;  4CEB A;  2G8U A;  4YNQ A;  3PO5 A;  4HUE A;  4BDY A;  4DLG A;  4E7L A;  1NK7 A;  1ZYQ A;  4FLT A;  3DOK A;  4HHT A;  3SPY A;  4Z0U A;  3HJF A;  1WAJ A;  1SKS A;  4CEF A;  3IS9 A;  4RG8 A;  4JS4 A;  4DTM A;  2A1R A;  4FJI A;  4KAZ A;  1XHX A;  1HYS A;  3D0P A;  2GUI A;  3TAG A;  3QEP A;  4NYN A;  2O4I A;  2RPI A;  3RTV A;  1L3V A;  1ZBI A;  3WNH A;  1JXE A;  1S5J A;  1HYZ A;  3ZCM A;  3ZSV A;  3L2V A;  1YT3 A;  3DLR A;  3F9K A;  4CJV A;  4CJR A;  3RMC A;  3ZT1 A;  1NJW A;  3WNE A;  3B6O A;  4FYD A;  1RT7 A;  5T7B A;  1XC9 A;  1JL1 A;  2AJQ A;  3VQP A;  1ASU A;  4LSL A;  3LZI A;  1TKT A;  4ELU A;  1A5W A;  1RT3 A;  2VG7 A;  4MQ3 A;  2P5O A;  4F3O A;  4B9L A;  1KRP A;  3K58 A;  1VK0 A;  2XO7 A;  2BDP A;  3QIN A;  3DI6 A;  1S1V A;  3TAP A;  2G8K A;  1L3S A;  3KTQ A;  4LH5 A;  2QKB A;  1EET A;  3SUQ A;  4OKE A;  4K8X A;  4FJ8 A;  1U45 A;  3JSM A;  3CFP A;  4ZHR A;  1NJY A;  1KVB A;  3D45 A;  3CYM A;  4O55 A;  4CHQ A;  1HMV A;  3OJU A;  1U4B A;  1TK5 A;  1ZBF A;  4FVM A;  2X6N A;  3VQC A;  2EHG A;  2DTU A;  3CQ8 A;  4CJ5 A;  1RTD A;  4M3X A;  2B4J A;  2GV9 A;  3I0R A;  3O3G A;  3I8D A;  3IAY A;  3ITH A;  3K5O A;  4B3O A;  2XY7 A;  4E89 A;  5HP1 A;  1HRH A;  2YNH A;  4FXD A;  2YKN A;  1LW2 A;  1RDB A;  3ZT2 A;  3BGR A;  4BE1 A;  2HVH A;  3FFI A;  3M8P A;  4RW7 A;  4HTU A;  3NF9 A;  1VSF A;  1C0M A;  1IKV A;  1KVC A;  1C0U A;  3AO1 A;  1B92 A;  1VRU A;  4F8R A;  3NGZ A;  1CZ9 A;  3HVT A;  4IG3 A;  4B08 A;  1C6V A;  1NK9 A;  3LWM A;  1IKX A;  5J2Q A;  4NCB A;  4KHW A;  3AVM A;  5HRR A;  3S3N A;  1REV A;  1UAX A;  3LAL A;  1K6Y A;  5CY4 A;  1FKO A;  3ZSY A;  3QNN A;  4JRQ A;  1RDD A;  3DLB A;  4E7K A;  4L8R B;  4HUF A;  1L3U A;  1Y97 A;  3LPU A;  3LP1 A;  4I2P A;  3TAM A;  3HM9 A;  3ULD A;  4DTU A;  1IG9 A;  1IH7 A;  2PY5 A;  4I9L A;  4KHU A;  5KTQ A;  1RT2 A;  1W0H A;  4KRF A;  4KKO A;  4CEO A;  3HVR A;  3AVG A;  1F21 A;  1QE1 A;  4EP5 A;  1HNV A;  4BWM A;  1W9H A;  3S3M A;  5D3G A;  5J2N A;  3MAQ A;  2WON A;  3HPG A;  5HRO A;  2YV0 X;  1EKE A;  3U3G A;  3TAR A;  4TSX A;  1TKZ A;  4W5R A;  2QK9 A;  4FJH A;  3NF8 A;  3NAE A;  3U6F A;  4DFP A;  4FW1 A;  4M3W A;  3ZT3 A;  1RBR A;  4OPJ A;  5KI6 A;  4IBN A;  3MED A;  4OVL A;  4B9U A;  4IG0 A;  4N76 A;  2A1S A;  3VQQ A;  2WOM A;  4FM0 A;  2PYL A;  3LP0 A;  3KKS A;  3I0S A;  4CK2 A;  3OYG A;  2Z1I A;  3VQB A;  4W5O A;  2KTQ A;  4HVJ A;  4F3T A;  3HPH A;  3L2W A;  1RBU A;  4E0D A;  4CGD A;  1QTM A;  4KHQ A;  4Y1C A;  3KK3 A;  4E19 A;  4DU4 A;  4AH9 A;  2R7Y A;  4IFV A;  2VG6 A;  1JL2 A;  4KPY A;  4CGF A;  4UQG A;  3VQ8 A;  1LWF A;  2Z1H A;  4FJ7 A;  2P1J A;  4C8O A;  1BI4 A;  2YHA A;  4CER A;  1LWE A;  4F4K A;  3AVL A;  1WSI A;  4QOZ B;  1EXQ A;  4DTO A;  4ID5 A;  4CHZ A;  1RBS A;  2VWJ A;  1NK5 A;  2IDO A;  2FBT A;  4E1M A;  4J2E A;  3V9Z A;  4XIU A;  3TAN A;  3U3Y A;  2D5R A;  3SCX A;  1T8E A;  3AVJ A;  4DSF A;  4CGH A;  1C1B A;  3MEG A;  4F2R A;  3ZSW A;  1IKY A;  4OGE A;  1NK6 A;  1SUQ A;  1VSH A;  2JLE A;  1LAW A;  5E41 A;  2BE2 A;  4GVM A;  3OYN A;  4CF1 A;  4QAG A;  1UA1 A;  3RWU A;  4DFM A;  5K14 A;  4DF8 A;  3AA4 A;  3QET A;  3KD5 E;  1BGX T;  1GOA A;  2HHV A;  2DY4 A;  5C24 A;  1XHZ A;  4CHY A;  1JLF A;  3MXI A;  3SV3 A;  1SL0 A;  4JLH A;  4OKK A;  2I5J A;  3HK2 A;  4ZTJ A;  4FLW A;  2ETJ A;  2ZE2 A;  3L3V A;  3P5J A;  4FW2 A;  1QSS A;  3S9H A;  3M8R A;  2OZS A;  2HHU A;  3MEE A;  3K59 A;  3TI0 A;  4FK2 A;  1JLC A;  1QQC A;  4NCG A;  3ISN C;  4O44 A;  2Y1J A;  2XY6 A;  1KFS A;  3DOL A;  4M3U A;  4CJ4 A;  3ZSZ A;  5HRN A;  4M3T A;  1X1P A;  1HJR A;  4AHS A;  4AHC A;  3VQ7 A;  4CJL A;  3K57 A;  3QEV A;  3PX4 A;  1HPZ A;  2QKK A;  4NCA A;  3NBP A;  1NKC A;  1LWC A;  3V9X A;  3HP6 A;  1QS4 A;  2D0A A;  3A2F A;  3O4Q A;  3M8Q A;  4KTZ A;  4ELV A;  4CJ3 A;  2F8S A;  4QCL A;  4DMN A;  3K5L A;  2FC0 A;  3AVF A;  4FJK A;  5KGX A;  3AVH A;  3RMA A;  2DFH A;  3H08 A;  3DYA A;  4CGJ A;  3SI6 A;  2X74 A;  1TGO A;  4PWD A;  1T7P A;  4FM2 A;  3NE6 A;  3P83 D;  3HXM A;  3ZT0 A;  3OYH A;  3HYF A;  1J5O A;  1TAQ A;  3HP9 A;  1HQE A;  2KZZ A;  1RT5 A;  4HUG A;  1RDA A;  1Z26 A;  4FJN A;  1WSG A;  5I3U A;  4I7F A;  4ELT A;  3V4I A;  4CJU A;  3SV4 A;  4DSL A;  1WSE A;  4CFC A;  3V1Q A;  1L3T A;  3QNO A;  4Z4I A;  4PY5 A;  4Z4C A;  4CGI A;  4CFB A;  2F8T A;  4B9N A;  3T19 A;  3S3O A;  2VG5 A;  2ATQ A;  3KK2 A;  4KHN A;  3AA3 A;  1JLA A;  2FBY A;  3LDS A;  3AA2 A;  3OS0 A;  4OKJ A;  1FK9 A;  2RKI A;  4CJK A;  5CYQ A;  3QES A;  4M42 A;  4DFJ A;  1JLG A;  4I2Q A;  3VA3 A;  3PX6 A;  3E01 A;  2X78 A;  1HQU A;  1RTJ A;  4C8M A;  2OPS A;  4W5Q A;  4CED A;  3OS1 A;  3V81 A;  3TAQ A;  5KRS A;  3NGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...