1VSLA

Asv integrase core domain d64n mutation with zinc cation
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTNFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (INTEGRASE)
publication title Structural basis for inactivating mutations and pH-dependent activity of avian sarcoma virus integrase.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
molecule tags Hydrolase
total genus 55
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vslA00
4CF8A 5CZ1A 4CJPA 3HP9A 2WONA 3OYLA 2X6SA 4Z4IA 5C24A 1JLCA 2FBYA 1NOZA 5CY4A 3HVRA 1FKPA 1EX4A 3CM5A 3ISNC 3HPHA 4ID1A 4LSLA 1UAXA 5KRTA 3HT3A 1L3UA 4CGDA 4PUOA 3M8PA 4KHSA 4E7JA 3QIOA 2YNHA 4CESA 3JSMA 2HHXA 4E3SA 3G0ZA 3SUQA 2YNFA 4OJRA 4AHSA 1U45A 1NK9A 1J9AA 4OGEA 3I0SA 3RR7A 2HHWA 4DSEA 1BCMA 1KVBA 2A1SA 1W0HA 4O55A 4CHNA 4FM2A 3MAQA 2D0CA 3THVA 3OYJA 1LV5A 3HYFA 4FJHA 3IG1A 4FM1A 4DTXA 3SZ2A 3OVNA 3ZT1A 5J1EA 1TKDA 3LP1A 4FK4A 1VRUA 2RKIA 3SI6A 4BWMA 3OS2A 1ASVA 4FLZA 4DU3A 4F2RA 4CIFA 4B3OA 4CHOA 3TAMA 4G1QA 4KPYA 1QHTA 1VSHA 1BCOA 1Y97A 1RILA 4I2PA 4W5OA 4DS4A 3TAQA 1ASWA 2KTQA 1CLQA 3RMCA 4J2EA 1HNVA 1U49A 4KI6A 2HHSA 4HUGA 4B9UA 2KZMA 5SZTA 3TAFA 1L5UA 4FJXA 3NE6A 3V9XA 1U47A 4KAZA 5SWMA 3AV9A 2X78A 3LPUA 3QNOA 4KHQA 3SUOA 1GOCA 2PYJA 3HPOA 4F3OA 1TAUA 1YVUA 1WAJA 1GOBA 3HVTA 3EY1A 2BE2A 3S3NA 1KRPA 1HJRA 4RW8A 3OYFA 3PUFA 5FDLA 3OYGA 1D8YA 1RT3A 4ELTA 3NF8A 3V1OA 2OPPA 4ID5A 4LD0A 3U3GA 3C95A 4CFCA 4JRQA 3K5MA 1HRHA 4OPJA 3LZIA 4HUFA 1XC9A 4B9MA 3L8BA 1A5VA 3SPYA 4C8KA 3RMBA 3BGRA 4HCBA 3EYZA 4AHUA 3K59A 3O4QA 3E01A 1ASUA 2I5JA 4PQUA 3QO9A 2P5GA 1S1WA 3MEEA 1TK8A 1BI4A 2HHQA 1VSLA 4M3RA 3T19A 4CJFA 4CERA 3AVHA 4YNQA 4Z0UA 4PY5A 4C8OA 1REVA 3IRXA 2ZQBA 2P1JA 4Y1CA 1ZBLA 2PY5A 3D45A 3K2PA 1NKCA 5KI6A 3QEVA 4F8RA 1I3AA 1Q9XA 3VQPA 3HPGA 3CFRA 4Q5VA 2D0BA 1TL1A 1TKTA 2XRIA 3AVBA 4DS5A 4CEDA 4KHNA 4KI4A 4ZHRA 1EETA 1BGXT 5HP1A 1JLGA 1CZBA 3DYAA 3M8QA 4IFVA 3OYDA 4OKJA 4KRFA 4KTQA 2FBVA 1SKWA 1WSHA 5FRNA 4IFYA 4LY7A 4CHPA 2PZSA 4FZXC 4M3UA 2FC0A 1BQNA 3ZSRA 1VSJA 1L3VA 1DTQA 2RN2A 3LP3A 3ALYA 3ZSVA 4CIGA 4W5QA 3K58A 2GV9A 4B9TA 3I8DA 1S9GA 4DSIA 1EXQA 3ASMA 1ZBUA 1BL3A 2X6NA 4M3XA 3RTVA 1JKHA 3S3OA 3WNGA 3AVNA 1JL2A 4FLWA 1WLJA 3K57A 3NGZA 4DTUA 1F21A 1XI1A 5K14A 4KTWA 4RW4A 4BE0A 4KREA 3NGIA 1VK0A 2QKKA 2OZMA 1A5XA 1C0UA 4FJ9A 4WE1A 3KKSA 1WSIA 5HRNA 3OYKA 3LDSA 3MXMA 1J5OA 4M42A 3AA4A 3L2WA 1HNIA 3DLRA 4MFBA 4R5PA 1KVCA 4ELUA 4IBNA 1UA1A 4CEFA 1BIUA 1NK7A 4DQIA 4FLYA 3WNHA 4DLGA 4C8LA 1SKSA 4E7HA 4NCAA 2FBTA 4FJJA 3VQAA 3HJFA 4CJSA 4CJUA 3DLBA 4I2QA 3AO4A 4FLXA 4W5RA 2G8WA 2IAJA 4DG1A 4E1NA 2HNDA 3K5LA 1QSSA 1VRTA 1LAVA 4FW2A 1SL2A 4DSJA 2XY7A 1NJZA 1T03A 3BDPA 4N47A 3CFPA 1T7PA 4N41A 3SV4A 1KCFA 1JXEA 2FBXA 4FVMA 4LH4A 3AVFA 5CYQA 3SYZA 3V9SA 4FYDA 2DTUA 3OYAA 1JLEA 2W42A 1QS4A 3SUPA 4GMJB 3UIQA 3NF6A 2HNYA 3PY8A 4OGCA 3VQQA 2BDPA 3KD1E 3V9WA 2XHBA 1VSMA 2BANA 4Z4CA 1C1CA 2EX3A 3WNEA 1ZBHA 1QSLA 4M45A 1JXBA 3P83D 5T7BA 4DU1A 3VA0A 3KLHA 3NFAA 3KK1A 1HYVA 3CFOA 3ZSZA 3RMAA 4OLAA 1TKZA 4ICLA 3U6FA 4E7LA 1N6QA 4M3TA 2YKMA 4QAGA 2OA8A 2IC3A 1UOCA 2HHVA 1HQEA 3QNNA 1UWBA 4RW9A 4DTOA 4HUEA 3IAYA 3PO4A 3ZSOA 4Z4HA 1EP4A 2VG5A 1HQUA 2JGUA 1EKEA 3OJSA 3K5NA 3DM2A 2LSNA 5DMRA 3MECA 3KLFA 4CE9A 4CJLA 2G8FA 3B6OA 3QINA 1NK0A 1MU2A 5J2MA 4I9QA 1SKRA 3U3YA 4O0JA 4FM0A 4CF2A 4CHZA 3DRSA 5E41A 2VG6A 5J2QA 4Z4GA 5JS1A 1BQMA 3DMJA 4DTJA 1S1TA 5EU7A 1YTUA 1NJYA 1RBTA 4AILC 4JS4A 1K6YA 2YNGA 4ZTFA 1KFSA 4F2SA 4UQGA 5HROA 1VSDA 5I42A 1IKYA 4CJKA 2Q3SA 3V81A 3TAPA 2OZSA 5KGWA 3ITHA 3VQDA 1CXUA 1CZ9A 3OYBA 4B8CA 2G8VA 2QXFA 2IDOA 4DQSA 1BI4B 5J2NA 4BWJA 3LPTA 1NJWA 2ETJA 4DWIA 4KB0A 3G10A 1Q9YA 4KO0A 1FKOA 1TKXA 1B9FA 3F9KA 4CEAA 4CK2A 4CK3A 4ELVA 1JL1A 4CGFA 3SCXA 1ZBIA 4I9LA 3DLGA 1GOAA 3VA3A 4M41A 3MEGA 4CHQA 4YFUA 4TSXA 2D0AA 1W9HA 1TAQA 4RW6A 3PX0A 4CEBA 1L3TA 1RT7A 2QK9A 2D5RA 3MEDA 3JYTA 3QEIA 1BISA 1SUQA 3OYEA 1X9SA 4NYNA 2WOMA 4BDZA 1RDDA 4DFPA 1RDAA 1RCHA 1HYZA 4FCYA 1T8EA 3ZSXA 2XY5A 3K5OA 3RRHA 1IG9A 4CEOA 3AVIA 2DFEA 2IOCA 3NGYA 1IO2A 4HTUA 4DQRA 4IKFA 4JLHA 3ULDA 2P5OA 3M8RA 1NK8A 3M8SA 3L3UA 4JRPA 3HSTB 4HHTA 3L3VA 2G8HA 3KIOA 3ZSYA 3ZCMA 4BACA 2G8IA 3WNFA 3VQ9A 1ITGA 1U48A 3RR8A 1VSEA 4E0DA 4E7KA 3NAEA 4CJ3A 4DSKA 4H4OA 4DTSA 3VN5A 4CF1A 3TAEA 4PA1A 4CFDA 3ZT3A 4H8KA 2A1RA 4OVLA 1IH7A 3AVJA 3LAMA 1TK5A 3LWMA 4W5TA 4CEQA 3OY9A 2HHTA 1KFDA 1NK5A 4OKEA 3CG7A 3IS9A 1TL3A 5KRSA 4BDYA 4KHYA 2O4IA 4RG8A 4QCLA 1D9FA 1D9DA 4LSNA 1TGOA 3V1QA 3LWLA 1C0TA 3QERA 1KLMA 3AO2A 3AA5X 1KTQA 3HM9A 2IS3A 3CQ8A 4FJMA 3AVAA 4AHTA 1TK0A 4CGIA 3OS0A 2XY6A 4DSFA 1NK4A 1FXXA 1KLNA 2YV0X 3L2VA 4RW7A 3VQ7A 4F3TA 5J2PA 1NOYA 1SL1A 1KVAA 4DFMA 4M3YA 1C1BA 2HB5A 3SQ1A 2JLEA 3NH0A 2ATQA 1C0MA 3PV8A 3VQBA 4AH9A 3NCIA 1S1XA 2NUBA 3O3FA 3P5JA 4DFJA 3SQ0A 1XWLA 2RPIA 1S1VA 2P51A 2GUIA 3FFIA 5HBMA 1RDBA 1S6PA 1C6VA 1QSYA 3SQ4A 3RRGA 3V1RA 1QE1A 4EZ6A 3SNNA 4DQPA 3HK2A 3SQ2A 1QQCA 1A5WA 1RNHA 1NKBA 4CJVA 3L2UA 2BGGA 5I3UA 4CJWA 4OPKA 4EZ9A 3AVKA 1HYSA 2X74A 1WNSA 3KLIA 1T05A 1Q8IA 1RT1A 1JLQA 2R7YA 3CYMA 2IGIA 4C8NA 4FK0A 3KKRA 3QETA 4CEZA 4CFAA 1RBVA 3MXJA 5KTQA 2YKNA 2ZD1A 4E89A 4M3WA 4GVMA 1DTTA 4MQ3A 4J2AA 2QKBA 2Y1IA 2DY4A 5HRPA 4N56A 3V9UA 1Z25A 4EP5A 4EP4A 4ZTJA 1YTAA 3KD5E 1RBUA 1X1PA 1RT5A 4OLBA 4AHCA 3TARA 1D5AA 3ZT0A 4FW1A 3AVMA 3V9ZA 4PWDA 3QEWA 2ZE2A 4K8ZA 3QESA 4I7FA 5FRMA 1CXQA 1RTDA 4M3ZA 4DTMA 1S9EA 1XHXA 1IKXA 2VG7A 2HNZA 3LALA 3LP2A 3VQ4A 5HLFA 3HP6A 4B9VA 4B8AB 1O1WA 2Z1JA 4H4MA 3KLEA 2Y1JA 1R0AA 2OPQA 3SUNA 4FXDA 4GW6A 1BHLA 2RF2A 3C6UA 3NF9A 1X9MA 1UA0A 3T1AA 1B9DA 3PX6A 2KFNA 3AA3A 1IKVA 4CECA 4IDKA 3QEXA 3DLKA 3DOLA 3DRRA 5DK5A 4N76A 3RWUA 3QLHA 1LWEA 5FROA 1I39A 4CJEA 2B6AA 4E1MA 1DLOA 2F8SA 1SL0A 1KSPA 4FLTA 4DU4A 1WN7A 1WSEA 3MXIA 5D3GA 2E6LA 3QIPA 4C8MA 4CJQA 1X9WA 4CK1A 4XIUA 4E19A 1C1AA 4KB1A 2Z1IA 3S3MA 3QEPA 3ZSQA 3TR8A 4FLVA 4FJ7A 3KLGA 1VSIA 4B9SA 2KZZA 5CZ2A 4BE2A 3OS1A 3PX4A 4CGHA 1S5JA 1BIZA 2VWJA 4DF4A 2KW4A 4DTRA 1RT6A 4CJTA 4CCHA 4L8RB 4IG0A 3OJUA 3NHGA 3DOKA 1NJXA 2B4JA 5KGXA 2XY8A 4NCBA 3ZSWA 1VSKA 1RBSA 1J54A 2DFHA 3DRPA 4CJ4A 1ZYQA 4DQQA 1U4BA 2G8UA 1LWFA 4FJ8A 3SJJA 4AHVA 4CHYA 3EZ5A 4KV8A 4E7IA 1JLBA 3C94A 1XHZA 2OYQA 1WAFA 4K8XA 1SV5A 1TVRA 3H08A 2GBZA 1ZBFA 4B08A 1HPZA 4FLUA 4DF8A 1IKWA 3O3GA 3OYIA 1VSFA 1WSGA 3OYMA 1LAWA 2F96A 3NF7A 1RTJA 3TI0A 1JLAA 3AO3A 2E6MA 3VQ6A 3OYCA 3VQEA 3OYHA 2KQ2A 1JLFA 3I0RA 3HXMA 4DMNA 4F4KA 4FJKA 4KHWA 2YHAA 3HO1A 1G15A 4KKOA 3LANA 3HL8A 4FK2A 3KK3A 3V6DA 1QTMA 4DTPA 1J53A 4B9NA 1FK9A 3B6PA 4FJNA 2HVHA 3A2FA 3NDKA 3O4NA 3T3FA 3P1GA 3AVCA 3TANA 1N5YA 1LW2A 4DTNA 3LP0A 4IG3A 4J2BA 1NKEA 4FJGA 3AO5A 4NCGA 3VQ5A 2HW3A 3L2QA 4DLEA 1B92A 2VWKA 3VQ8A 2HVIA 4KHUA 3O3HA 3NH1A 1L3SA 2ITGA 4CJ5A 3TAGA 1LWCA 4CIEA 4DFKA 1TV6A 3VQCA 1RTIA 2PYLA 4BE1A 1YT3A 2HMIA 4Z4EA 4KFBA 3TWHA 2Z1GA 2O4GA 1S1UA 4W5NA 1LW0A 3DLEA 1RTHA 3KK2A 4KTZA 1HMVA 3LAKA 1RDCA 3AO1A 4FJLA 3S9HA 1S6QA 4JS5A 5JS2A 3NH2A 3L2RA 3AVGA 2G8KA 4NYFA 3KJVA 4CFBA 4CF0A 4FJ5A 2OPRA 3AA2A 4O4GA 1RT4A 4N5SA 3RMDA 1Z26A 4LH5A 3C6TA 2YNIA 4CF9A 4CGJA 4CEEA 1NK6A 3DLHA 4Z4FA 3SPZA 2KFZA 3D0PA 4HCCA 2HHUA 4Y1DA 2F8TA 3DI6A 2YHBA 3LZJA 3KTQA 4Q0BA 3ZT2A 4QOZB 4FZZA 2DFFA 5C25A 4FZYA 2B5JA 5HRSA 2E4LA 2OPSA 3NBPA 3PO5A 1U04A 4AHRA 2EHGA 4CJRA 4BDPA 1WSFA 2AJQA 4O5BA 3SV3A 4O44A 2XO7A 4FJIA 1RT2A 4DSLA 4J2DA 5HRRA 3TABA 3V4IA 4CGGA 5CYMA 3ZT4A 3F73A 4O0IA 1RBRA 5C42A 2Z1HA 3AVLA 3OYNA 1WSJA 4OKKA 4HVJA 4B9LA 3CM6A
chains in the Genus database with same CATH superfamily
5BREA 2X6SA 5C24A 1JLCA 2FBYA 5AQWA 4FYDA 4ID1A 3J7ZO 2DTUA 3HPHA 1UAXA 4BC2A 2O8BA 4E7JA 3G0ZA 2RE2A 2YNFA 1G99A 4AHSA 1U45A 4OGEA 5AR0A 2HHWA 4O55A 2OCEA 3MAQA 4NLBA 1YI2N 3IG1A 2GWKA 1KQSM 1NU0A 3I8BA 2O8FB 3THWA 5J1EA 4YHHK 3LP1A 4H5RA 3OS2A 1J5EK 4CHOA 4G1QA 1BA1A 1Y97A 2FLOA 4W5OA 3CCMN 4BG8A 3RMCA 3O5BA 1M1KO 2HHSA 4BR0A 3TAFA 3NE6A 3V9XA 3CJ7A 5SWMA 2X78A 5AQKA 3J8AA 3OW2M 4F3OA 1TAUA 3HVTA 4MLEA 3EY1A 2ASPA 3E9OA 3H1QA 4X64K 4J8FA 4RW8A 3OYFA 5FDLA 3OYGA 3S41A 1D8YA 3NF8A 5FLXO 3ULEA 4JRQA 4WCEL 3LZIA 1XC9A 3C6AA 3EE9A 5AQQA 4DR7K 3VEXA 3BGRA 3EYZA 2OTLN 2P5GA 3MEEA 1TK8A 3RSEB 1VSLA 3T19A 3QBWA 3ZX0A 5AQVA 4YNQA 3MX2A 4CZHA 1ZBLA 1X3MA 5KI6A 1I3AA 3VQPA 5A2QO 3VGKA 4Q5VA 2ZF5O 4A62A 4KHNA 1SS6A 2P9LB 4ZHRA 3WXJA 5F2RA 3O9SA 3E9LA 4NB4A 1CZBA 4IFVA 2QA4N 2QWRA 4LFAK 2WUSA 3OYDA 4KRFA 5F0XA 4BRKA 1K8KB 1OH5A 4B1VA 1WSHA 1GLAG 1KAYA 4IFYA 4M3UA 1BQNA 3MN7A 3MWPA 2RN2A 2YHWA 1NG9A 4M3XA 3ASMA 2X6NA 3RTVA 3TPQA 3H3NO 1XNRK 3LDNA 3K57A 1Q18A 4DTUA 4JI1K 1BA0A 4BE0A 2OZMA 3MXMA 3OYKA 2A40A 4M42A 4DV2K 3WQTA 3R1XA 1UA1A 3L4IA 4DQIA 4DLGA 1DKGD 4E7HA 5AZJA 3VQAA 1IBMK 4H5NA 4I2QA 2V7ZA 3AO4A 3VF6A 4W5RA 2A41A 2G8WA 1NGEA 4BY9C 2XY7A 1NGIA 2P9PB 1T03A 3MN9A 3CFPA 1VQ7N 4N41A 3SV4A 3BZKA 1GLLO 3SYZA 3V9SA 3VMFB 3CCUN 1U6ZA 4GMJB 1QVGM 2HNYA 1NGFA 2XHBA 1YJWN 1C1CA 2YHXA 3IDHA 1QZ5A 3P83D 2ZGYA 3VA0A 1VQNN 3CFOA 3U6FA 3GG4A 3U9DA 2OA8A 2IC3A 5TKWA 3QNNA 3IAYA 4ILHA 1EP4A 2P9NB 3FZLA 1LOTB 3DM2A 1RDUA 3B6OA 2PAVA 2F7TA 3VGLA 4I9QA 2QM1A 4JI6K 5J2QA 1BU6O 1NJYA 4AILC 2YNGA 4FPBA 4F2SA 4UQGA 5HROA 4CJKA 1HUXA 3V81A 2OZSA 4DR5K 1CZ9A 3BY5A 3OYBA 3CETA 2G8VA 1NNEA 2QXFA 2IDOA 3RVCA 4DQSA 5J2NA 1Q81O 4BWJA 3J81O 1YVNA 3G10A 1Q9YA 4CEAA 4JI2K 4ELVA 2NRZA 1HLUA 1BDGA 4JKGA 4CI6A 1NGDA 4H03B 4X62K 4YFUA 4RCHA 1W9HA 1TAQA 1L3TA 1RT7A 2QK9A 4JI4K 3EZWA 1X9SA 3OYEA 3O9UA 4H0YB 3SJHA 4FCYA 1T8EA 3ZSXA 3K5OA 3RRHA 4ISGA 2IOCA 1IO2A 4HTUA 1C0FA 2GWJA 3DWLA 3M8SA 3L3UA 3L3VA 1SAZA 4K43A 2IVPA 3T1YK 1ITGA 3GBTA 4JK8A 3G4SN 3RR8A 3NAEA 3SLCA 3VN5A 2A1RA 4CFDA 3AVJA 3OY9A 2HHTA 4OKEA 4DV0K 4CZGA 1TL3A 5KRSA 4KHYA 4BC3A 1HNZK 4QCLA 1D9FA 3CJAA 3ZX3A 3V1QA 1T3VA 3AO2A 1VQ5N 2NRTA 1KTQA 2PFUA 1TK0A 3OS0A 4DSFA 2YV0X 5LJVA 4RW7A 3W3DA 1NOYA 1SL1A 1Z05A 4M3YA 3SQ1A 3NH0A 1DEJA 2ATQA 3PV8A 2ZJPL 3O3FA 2P51A 5CHIA 2GUIA 1QSYA 1QE1A 1OVYA 3EEQA 3GOIA 1RNHA 1NKBA 3EKSA 4EZ9A 3AVKA 3HZ6A 1WNSA 3KLIA 4JI8K 2J4RA 1RT1A 3EKUA 1NGCA 1TYQA 5KTQA 3IMXA 4E89A 4MQ3A 3FZKA 2Y1IA 4WQ5A 3SMSA 1RBUA 4AHCA 3ENOA 3V9ZA 3AVMA 3QEWA 2ZE2A 2CH5A 3QESA 1CXQA 2QTDA 4M3ZA 2HNZA 2P9SA 3LALA 3R8EA 1R59O 2Z1JA 3KZBA 5M1NA 1BHLA 2RF2A 3C6UA 3NF9A 3CMAN 1X9MA 3T1AA 5C10A 1LCUA 1RFQA 5AQZA 2KFNA 4DR2K 2HF4A 2P9IB 5DK5A 4N76A 1LWEA 2QI2A 4E1MA 3DXKB 1VQ4N 3E9PA 4U7BA 3CQXA 3MXIA 3QIPA 4CJQA 5JICA 1X9WA 4XIUA 4E19A 2W6LA 1C1AA 3S3MA 2O8FA 4FJ7A 4PHTX 1VSIA 3KLGA 1E3MA 4DF4A 4DTRA 3NHGA 1XQSC 2B4JA 5KGXA 4NCBA 5AFUH 3ZSWA 2G8UA 4MO4A 1U4BA 2BTFA 1LWFA 2WC9A 1K8AO 1JCEA 4FWKA 3H08A 4YY3K 4LF7K 2D0OA 4FLUA 4H5VA 1VSFA 1WSGA 4PKGA 3OYMA 1DT9A 3NF7A 3AO3A 1ATSA 3OYCA 4PL8A 5LY3A 2YHAA 3HL8A 3KK3A 3V6DA 4DTPA 4FJNA 4DV3K 1SQKA 1EQYA 4CVNE 3T3FA 3P1GA 3TANA 2P9KB 4DTNA 4AQYK 1NKEA 3VQ5A 3L2QA 2Q0RA 2O8EB 2Q36A 4BQLA 1LWCA 4CIEA 3G6EN 1N34K 3TWHA 1S1UA 4QS8A 5E26A 5LJWA 1S6QA 3P39A 4NYFA 3KJVA 3P31A 1K8KA 4O4GA 3RMDA 2UXBK 2VQFK 3MCAB 1E4GT 3D0PA 4Y1DA 2DFFA 2B5JA 3PO5A 4FWQA 1U04A 4BROA 1NGJA 4CJRA 2UUBK 3DJCA 2AJQA 3R3LA 3SV3A 2XO7A 1VQ6N 3ATVA 2WFBA 4JKAA 4A59A 3ZX2A 4CGGA 5CYMA 3ZT4A 4O0IA 4JNEA 4CF8A 3MWTA 1NOZA 3HVRA 1FKPA 1OH6A 3L4QA 1L3UA 4CGDA 1HKBA 4PUOA 3NVKA 3QIOA 4GKJK 2YNHA 4CESA 3OTOK 2HHXA 3BEXA 1O13A 5JMVA 3CCJN 4ISFA 3SAGA 2A1SA 2GX9A 1NGBA 4FM2A 2D0CA 3THVA 3HYFA 1P90A 5CE3A 1NGGA 3IFRA 3OVNA 3ZT1A 4FK4A 4F2RA 4BWMA 1BG3A 5EX5A 1YJ9N 4BC5A 2YJFA 1QHTA 2KTQA 5JLFA 5AQSA 2P9NA 2YI1A 3MMVA 1HNVA 1U49A 2IIRA 4HUGA 3BF1A 4B9UA 5SZTA 4FJXA 2BUPA 4BRDA 1U47A 4FWMA 1GOCA 1YVUA 1C0GA 2D4WA 4YDUC 3BF3A 1KRPA 1HJRA 5GADP 4H0VB 3C95A 4FWPA 1HRHA 3K5MA 1QVFM 3L8BA 1A5VA 5C15A 3SBGA 2E20A 1J6ZA 4AHUA 4PQUA 3O4QA 1ASUA 1S1WA 4KH6A 5ADXA 2NRVA 2KKZA 4DB3A 3JS6A 1GLJO 3AVHA 2FXUA 3P38A 3QMLA 4XH1A 3T7ZA 4JI3K 2UUAK 4B1YB 4PY5A 2ZQBA 4Y1CA 3CJCA 5BPNA 3EL2A 1KAZA 4A61A 2PY5A 1XMQK 1VQ9N 1Q9XA 4JHDA 4U67L 3HPGA 3CFRA 3T1HK 1TKTA 3DXMA 4A5BA 3VOVA 1GLEG 3HOTA 1JLGA 1W7AA 2CGKA 4IJNA 2P9UA 3CC4N 3D7EO 2PZSA 3D2EB 3LP3A 4CBUA 4CIGA 4W5QA 2GV9A 1S9GA 2W6KA 1EXQA 3SK3A 1BL3A 1JKHA 1JL2A 3AVNA 3BP8A 2A5XA 1WLJA 1F21A 5DM6L 4KTWA 2QKKA 4PKIA 4FJ9A 4WE1A 3KKSA 5HRNA 4MFBA 4FPAA 4IFEA 3VGMA 1BIUA 3VEWA 3UKUB 4NCAA 3DLBA 4FWRA 3O1BA 3GL1A 5M1FA 3NVMA 4I6MB 4FVMA 3TU5A 3AVFA 4EAHD 5BPMA 3OYAA 1JLEA 4CZJA 2W42A 5FPEA 1T6DA 3PY8A 4OGCA 3M5RA 1VSMA 2BANA 3QBXA 4DU1A 3NFAA 1IJJA 3RMAA 4OLAA 4QAGA 2GELA 1UOCA 2HHVA 1JCFA 4RW9A 2D1KA 4DTOA 2EWSA 4Z4HA 4H0PA 3KWIA 2JGUA 5EY4A 4XH5A 3P4IA 3OJSA 3HM8A 3WT0A 3CQYA 4DV1K 3TTFA 4WYBA 1SKRA 4FM0A 4CHZA 3DRSA 1X3NA 4C1NI 3DMJA 4C1NK 4DTJA 2O8DB 3FZHA 3O08A 3VTIA 5LL6Z 4ZTFA 1IKYA 4M63C 1QZ6A 3ITHA 4FWNA 2YX6A 4KH4A 4GY2B 1BI4B 3LPTA 2ETJA 4DWIA 3DXKA 4KO0A 1TKXA 4CK3A 4DV5K 4CGFA 3CCSN 4QS7A 5AQJA 3ZETB 1GOAA 3VA3A 4BRCA 4TSXA 3PX0A 1V4TA 1VQLN 4FO0A 4BRQA 3QEIA 1TUUA 1SUQA 4MLHA 1XNQK 4BDZA 1HYZA 3LM2A 1IG9A 2DFEA 3VESA 3NGYA 4IZ9A 4DQRA 1GLDG 3MDQA 4JEPA 2V7YA 4DR3K 3M8RA 5BN8A 4JRPA 4HHTA 4B3SK 2G8IA 1YJNN 3WNFA 3EO3A 3F2KA 2E2QA 4E7KA 4DSKA 3J80O 2WTUA 3AGKA 4CF1A 3TTDA 3ZT3A 3MN6A 3UKRB 4O8KA 2A3ZA 1NK5A 5C2DA 4YORA 3CG7A 4M7YA 4E1JA 4BDYA 2O4IA 4RG8A 1D9DA 2HBKA 1ILYA 1TGOA 3LWLA 3QERA 3AA5X 2JWLA 2AA4A 3THYB 2XY6A 3L2VA 4WQ4C 4JAXA 1KVAA 4DR6K 3CD6N 2JLEA 3VEZA 1C0MA 3ENHA 1VQON 4AH9A 1S1XA 4CZIA 2RPIA 1S1VA 3FFIA 5HBMA 1C6VA 3SBTA 3RRGA 4RTFD 3SNNA 3SQ2A 1QQCA 4JKBA 5I3UA 2KHOA 4JKCA 1HYSA 3D2FA 2F9TA 1JLQA 3CYMA 3QETA 1M90O 3MXJA 4M3WA 4BRIA 2A42A 1ATRA 4BRHA 4IEEA 1Z25A 4EP4A 4FOEA 2O8CB 1X1PA 1RT5A 3TARA 1D5AA 1WOQA 1ZBSA 3FZMA 4GVEA 1XHXA 4YOXA 4B9VA 1X9JA 4KBOA 3HP6A 2NNWA 2Y1JA 2OPQA 3SUNA 4FXDA 1UA0A 1HKCA 3HI0A 2YCHA 2VQEK 1IKVA 3DOLA 3RWUA 3FZFA 3H3OB 4CJEA 1WN7A 3BZCA 2IVNA 3O4WA 5D3GA 2E6LA 3Q7CA 2Q97A 3QEPA 4FLVA 3OHRA 4B9SA 4BE2A 4CGHA 1S5JA 3OBYA 4CD3A 4R79A 1RT6A 3VF4A 4L8RB 1WBBA 2FF3B 3DOKA 4XEIA 3THXB 3L6QA 3CPWM 1VSKA 1RBSA 1J54A 2DFHA 3DRPA 5JS1A 2UUCK 1NGAA 5GIPA 4CZEA 1XHZA 1TVRA 4WFBL 2GBZA 3E1YA 1ZBFA 2VCPA 3GDQA 1HPZA 4DF8A 1IKWA 3OYIA 4JD2B 1LAWA 1JLAA 3WXLA 2VGNA 3VQ6A 5LMNK 3VQEA 2ZJQL 4FJKA 5AQUA 4DUZK 2UXDK 3MCPA 3O4NA 3AVCA 5JVGL 1LW2A 3PSIA 4FJGA 4GKKK 4NCGA 4DLEA 3J7AP 1B92A 3VQ8A 4IO8A 4B1XB 1NGHA 4C23A 2HVIA 4KHUA 3NH1A 4BRMA 2QWPA 2ITGA 3PSFA 5BN9A 1TV6A 3VQCA 2O4GA 1LW0A 3M1FA 3DLEA 1RTHA 1K73O 2FSNA 3S9HA 1VQMN 4DCHA 4OO1J 3QICA 5JS2A 2G8KA 3L2RA 4Z94A 4CFBA 3CCVN 3BUZB 2OPRA 3ZEUB 1RT4A 3VETA 1IV0A 1Z26A 2YNIA 4X66K 5HOOA 4BGAA 4IXCA 2KFZA 2HHUA 4X65K 2F8TA 3DI6A 2YHBA 3KTQA 5HRSA 2E4LA 2FSKA 4GV6A 4BDPA 4LF6K 4O5BA 4O44A 3O9QA 1RT2A 4ILJA 3TSQA 1ATNA 5KQ8A 3UKUA 4BRNA 1RBRA 4CZFA 2Z1HA 4B9LA 2WONA 3OYLA 2UXCK 1EX4A 3ISNC 4LSLA 2QWOA 5IT9O 4KHSA 4FL9A 3EE8A 4I6MA 4E3SA 3R6MA 3SUQA 1NK9A 3PIPL 4GV9A 3RR7A 2E2OA 4OPAA 1BCMA 1KVBA 1W0HA 3AGRA 4CHNA 5DM7L 3OYJA 3C0BA 4FM1A 2HSTA 4MO5A 5C12A 4V19S 5GINA 2QXLA 1TKDA 1VRUA 3SI6A 4FLZA 1ASVA 4K42A 3TAMA 4I2PA 1BCOA 1RILA 1EO1A 4LFBK 4KI6A 1L5UA 4DV4K 3KK7A 4DKWA 3ULEB 1WAJA 2ZM6K 2BE2A 3FE1A 3S3NA 3PUFA 4ELTA 3V1OA 3AAQA 3F9MA 4WF9L 1OKJA 3U3GA 4CFCA 4OPJA 2E5LK 4C8KA 3RMBA 4HCBA 3K59A 3E01A 3H46O 1IG8A 4CZLA 3WXIA 4QS9A 3VPZA 1BI4A 4NLCA 4M3RA 1ZXOA 3CJ1A 4NXMK 1MWKA 3D45A 3CC2N 3QEVA 4JK9A 4F8RA 3RSEA 2HBLA 4BR9A 4DS5A 4CEDA 4YDUA 4H5WA 5KQDA 4Y0WA 3DYAA 5GAHP 1EWQA 2FBVA 4BVOA 3I55N 2P9LA 1SKWA 4CHPA 4FZXC 4OX9K 2FC0A 3ZSRA 1VSJA 1S22A 2ZJRL 1DTQA 1L3VA 2VGMA 3ZSVA 4B9TA 4B1WB 3I8DA 3CJBA 3K0SA 1ZBUA 3S3OA 3WNGA 2A6AA 1XI1A 4KREA 1YUWA 4IJAA 3AA4A 3L2WA 1HNIA 4R5PA 4IBNA 4CEFA 4FSVA 2OTJN 3JAMO 3WNHA 4YOVA 4C8LA 3C65A 3HTVA 1SKSA 2FBTA 1KD1O 4FWSA 4CJSA 4BG9A 5AQLA 2HHHK 4IOXA 4DG1A 3K5LA 5BRHA 1LAVA 1SL2A 3AAPA 4DSJA 1NJZA 3BDPA 4IEIA 5EOYA 5CYQA 5KPRA 2CH6A 4CW7B 3O9TA 1QS4A 2UU9K 2BH1A 2P9PA 3UIQA 3VQQA 2BDPA 3V9WA 3LDOA 4Z4CA 2EX3A 2QEXN 3WNEA 1ZBHA 3D6RA 3KK1A 3ZSZA 1Y64A 5AQXA 4CZMA 1Q82O 1TKZA 4ICLA 4E7LA 3JXUA 2NZTA 2QW9A 1SZ2A 1Q86O 4OPHA 1UWBA 3PO4A 3H1VX 5BR9A 4FOIA 2O8CA 3MECA 5ADXH 3KLFA 3HOSA 3O8MA 3CPEA 3U3YA 4O0JA 2HBMA 5CR4A 4CF2A 1N33K 4Z4GA 4GV3A 1IBLK 4JS4A 1VSDA 5B8HA 5I42A 2Q31A 5KGWA 1CXUA 5FPDA 2E2PA 4CD1A 4BREA 4KB0A 1XUPO 4CK2A 4JI7K 4CBXA 3DLGA 1BUPA 4M41A 3MEGA 4DR1K 2D0AA 4RW6A 4CEBA 5IWAK 3TTCA 3AY9A 5H1SQ 1BISA 4NYNA 1RDDA 3VEOA 1RDAA 3THXA 1VQ8N 4CEOA 3AVIA 3CHWA 4IKFA 1GLCG 4JLHA 1U2VB 1QQNA 2ITMA 3HSTB 1YF5L 3FR0A 3LDQA 3KVGA 1HJOA 3KIOA 3WUHA 4JD2A 5AQFA 1U48A 1VSEA 4DTSA 4BR4A 3VF2A 1NBWA 3TAEA 4PA1A 1VAZA 4L3QA 4OVLA 1IH7A 2VYPA 1Q7YO 4XH4A 1TK5A 3Q7BA 2E1ZA 3KWGA 4W5TA 4CEQA 4MDAA 1KFDA 5AQPA 1N8RO 1Z6RA 1V4SA 1C0TA 4BC4A 3QFUA 3CCQN 3HM9A 2IS3A 3CQ8A 4FJMA 4AHTA 1KLNA 1RDWX 5TKYA 3K9KA 1YXQA 4F3TA 4DFMA 1C1BA 2HB5A 1E4FT 3N4PA 3NCIA 4M7XA 2NUBA 3M6GA 1S6PA 1W97L 4YOYA 3SQ4A 5AQMA 3O9RA 4DQPA 2F4VK 1TYQB 4CJVA 3I33A 2DPNA 3L2UA 1RGIA 1HKGA 3VENA 1T05A 2R7YA 2IGIA 3KKRA 4CEZA 1RBVA 2YKNA 2ZD1A 3TSUA 3HBTA 4GVMA 4J2AA 2QKBA 2DY4A 5HRPA 4EP5A 4ZTJA 2P9SB 3KD5E 4WQ4A 4BRGA 1S72N 1HNXK 1ZC6A 4O8UA 4PWDA 3ID6A 4K8ZA 1RTDA 4DTMA 4DHYA 3LP2A 3VQ4A 5HLFA 1O1WA 4O5FA 2F9WA 1JCGA 3DAWA 4FWOA 5HL7L 4LFCK 5AQRA 3MK6A 3C7NB 4IDKA 4AM7A 2HOEA 3DRRA 3QLHA 1DGKN 4BVPA 1I39A 2B6AA 1KSPA 4DU4A 5M1KA 2W40A 2P9IA 5FPNA 4FWLA 4KB1A 4JKEA 2Z1IA 5GAEP 3ZSQA 5CZ2A 1BIZA 2VWJA 4CJTA 4CCHA 2QWQA 4NO7A 2HMPA 1NJXA 4CJ4A 4FJ8A 4DQQA 1OH7A 4AHVA 4CHYA 3EZ5A 4E7IA 1JLBA 3C94A 4JKHA 2OYQA 4CBWA 4B08A 4AF1A 2NRRA 3CC7N 3U9ZA 2KQ2A 3WXMB 1JLFA 3HXMA 4F4KA 4DMNA 2QWNA 4KHWA 1IBKK 1G15A 4KKOA 3LANA 4JI0K 4FK2A 1QTMA 1J53A 4B9NA 3B6PA 3NDKA 1N5YA 4YOWA 1NMDA 3LP0A 4IG3A 4J2BA 3AO5A 1D4XA 4A2BA 3VTHA 4BR7A 3O3HA 5AJ3K 1L3SA 2P9KA 3TAGA 4DFKA 1RTIA 5BRFA 3C6HA 1YT3A 4WFAL 2HMIA 4Z4EA 2O8EA 4IO9L 1HMVA 1VQKN 4GNIA 4FJLA 1GLFO 5M1PA 4JS5A 3NH2A 3AVGA 1KAXA 4CF0A 4F9OA 4FJ5A 1NM1A 2RHKA 4UY8O 3C6TA 4CF9A 4CGJA 1NK6A 3DLHA 3SPZA 3LZJA 4Q0BA 4PKHA 2OANA 1BWFO 2OPSA 5C0YA 4AHRA 1WSFA 2KLAA 2Q2RA 2QWMA 1W2BM 3SAHA 5HRRA 2YJEA 1N36K 5FPMA 4K41A 3CM6A 1NK4A 5CZ1A 4CJPA 3HP9A 5C2FA 4A2AA 4Z4IA 5CY4A 3CM5A 3HT3A 5KRTA 4B1UB 3CCLN 1KXPA 3M8PA 3JSMA 4OJRA 1J9AA 4PL7A 3I0SA 4DSEA 3A5MC 4H0XB 1QHAA 1YHQN 1LV5A 4FJHA 4KHPK 4DTXA 3SZ2A 3A5LC 4B3TK 2RKIA 5I9EB 4DU3A 4CIFA 4B3OA 1P8ZA 3PLAA 4KPYA 3TAQA 1VSHA 4DS4A 1CLQA 1ASWA 4J2EA 3U8XA 2KZMA 4JYAK 4KAZA 3AV9A 3LPUA 3QNOA 1HR0K 4KHQA 3A8YA 3SUOA 2PYJA 1NLVA 3H6EA 3HPOA 4LF8K 1GOBA 3FGUA 4K25A 5AQGA 3VERA 3O1WA 4DV6K 3CIPA 1RT3A 2OPPA 4ID5A 4LD0A 4HUFA 4B9MA 2ZWHA 4LF4K 3SPYA 5BPLA 4AM6A 4LF5K 2VWBA 5F1XA 3FFKB 3LDPA 3VEYA 3KHYA 2I5JA 3O80A 3QO9A 4JHDB 2HHQA 4CJFA 4JKDA 2Q0UA 4CERA 3F5TA 3DXMB 4Z0UA 4NXNK 4C8OA 2YHYA 1REVA 3IRXA 2P1JA 3R9PA 3ATUA 3K2PA 1NKCA 3CF5L 3ENBA 3VEVA 2D0BA 1TL1A 2XRIA 3AVBA 3MX5A 2P9UB 3TSPA 4EFHA 4KI4A 4H0TB 2V51B 5LMUK 1EETA 1BGXT 5HP1A 4DV7K 3M8QA 4H5TA 4OKJA 4LC9B 4KTQA 5FRNA 4LY7A 3IKMA 1U2VA 2I7NA 3WEEB 1NMNA 3ALYA 5AZIB 3K58A 4DSIA 4FLWA 3D2EA 5M1OA 3NGZA 3L0QA 5K14A 4RW4A 3NGIA 1VK0A 1A5XA 1C0UA 2AP1A 3LDSA 1J5OA 1WSIA 1OH8A 3DLRA 4ELUA 1KVCA 1NK7A 4FLYA 1VHXA 4A57A 4DR4K 4FJJA 3HJFA 5JLHA 4CJUA 4FLXA 2IAJA 4E1NA 1KC8O 2HNDA 5JVHL 4YOTA 1QSSA 1VRTA 4FW2A 2E1YA 2GUPA 4JKFA 4N47A 1T7PA 2O8BB 1HPMA 4EHUA 1KCFA 1JXEA 2FBXA 4LH4A 4BR5A 3SUPA 2UYTA 3NF6A 3KD1E 4EIAA 1WUAA 1QSLA 4M45A 1JXBA 5T7BA 3KLHA 3THWB 1HYVA 3QDKA 2V52B 4H0OA 1N6QA 4M3TA 2YKMA 1YIJN 1HQEA 4HUEA 3ZSOA 4EHTA 2VG5A 4IWVA 2I7PA 1HQUA 3MN5A 4B1ZA 1EWRA 3LDLA 1EKEA 3T69A 3K5NA 2LSNA 5DMRA 3J7YP 2G8FA 4CE9A 4CJLA 3A0IX 3QINA 1NK0A 1MU2A 5J2MA 4FVUA 3QFPA 2HBJA 5E41A 2VG6A 4HTLA 1BQMA 4JI5K 1S1TA 5EU7A 5BRDA 1YTUA 1RBTA 4JN4A 1K6YA 2HF3A 3ID8A 2Q1NA 1KFSA 5E84A 1T6CA 2Q3SA 3TAPA 3SAFA 5EVZA 3VQDA 2O8DA 4YOUA 3C7NA 2NRWA 4B8CA 4ISEA 3N4QA 1NJWA 2NRXA 1FKOA 1B9FA 3F9KA 1JL1A 3SCXA 1ZBIA 3DLLL 4I9LA 3CMEN 4G9ZA 4CHQA 5GIOA 3CCRN 5AQHA 1T44A 2D5RA 3M3ZA 2W41A 3MEDA 3JYTA 3ZETA 4DFPA 2WOMA 5EXWA 1HNWK 1RCHA 2XY5A 5AQIA 1QQMA 3QB0A 3ULDA 2P5OA 3HRGA 1NK8A 3ZLJA 3I56N 2H3GX 4MDBA 4BRAA 2G8HA 1WB9A 3ZSYA 3ZCMA 4BACA 4RWTA 4DQ8A 3VQ9A 4E0DA 3B8AX 1N32K 4CJ3A 1I94K 1MDUB 4H4OA 2ZGZA 4H8KA 3LAMA 3LWMA 4JV5K 4WFNL 4K0KK 3IS9A 5AFUA 5AQYA 4LSNA 3UKRA 1GLBG 5AZJB 1KLMA 2JWKA 3AVAA 4CGIA 4WQ5C 1FXXA 1OVQA 1XC3A 2FF6A 3VQ7A 5J2PA 4IOAL 3VQBA 3K9JA 4DFJA 3P5JA 3THYA 3SQ0A 4BRPA 1XWLA 1FW6A 3CXCM 3D2FB 1RDBA 3CERA 3H45C 3V1RA 4B9QA 4EZ6A 3HK2A 3GE1A 1A5WA 5ELZA 2BGGA 4CJWA 4OPKA 3NMUA 2X74A 3A5OC 1Q8IA 5KPTA 4C8NA 4JK7A 4FK0A 2CGLA 3PIOL 2QWLA 4CFAA 2NLXA 1DTTA 5AQOA 5M1QA 2PBDA 4N56A 3V9UA 3WQUA 1VQPN 1YTAA 4OLBA 4B3RK 2CGJA 3OA9A 1HX1A 4FW1A 3ZT0A 4BR2A 5FRMA 4I7FA 1S9EA 1IKXA 2VG7A 2FSJA 3G71N 4B8AB 4H4MA 3KLEA 1R0AA 1BOTO 4GW6A 3FLCO 1NJIO 1B9DA 3PX6A 4B3MK 3AA3A 5AQNA 4CECA 4HWIA 3G25A 5MLCQ 3U4LA 3DLKA 3QEXA 5FROA 2D0PA 1DLOA 1MWMA 2GEMA 1SL0A 2F8SA 4FLTA 1WSEA 4JKGB 4C8MA 4CK1A 4CZKA 1CZAN 3TR8A 2KZZA 1XMOK 3PX4A 3LL3A 3OS1A 2KW4A 4IDHA 4IG0A 3OJUA 4BQZA 3UE5A 2GTDA 2XY8A 1ZYQA 3O6WA 1QQOA 3E66A 3SJJA 4KV8A 3EN9A 4BRFA 1H1VA 1WAFA 4K8XA 1SV5A 1BO5O 2IVOA 3O3GA 2F96A 3AARA 1RTJA 3TI0A 2ASOA 2E6MA 3OYHA 3W0LA 5BR8K 3I0RA 1FJGK 2WBNA 3HO1A 3ZYYX 4BGBA 2E2NA 2HVHA 5KPZA 1FK9A 3A2FA 3CCEN 3HSCA 2ASMA 2HW3A 1NWKA 2VWKA 4IOCL 3CJ9A 2E88A 4CJ5A 3SMPA 2NRHA 2PYLA 4BE1A 1YITN 4KFBA 2Z1GA 4BRLA 4W5NA 3KK2A 4KTZA 2E8AA 3LAKA 1RDCA 3AO1A 3UB5A 3CI5A 1MA9B 5AQTA 3AA2A 4N5SA 4ILGB 4LH5A 3WEEA 4CEEA 4Z4FA 1WBDA 4KH5A 5AZIA 1JJ2M 4HCCA 1S3XA 3ZT2A 4QOZB 3ZEUA 4FZZA 4FZYA 5C25A 3NBPA 1ESVA 1YAGA 4A5AA 2EHGA 3LM9A 3WXKA 3OBWA 5GAGP 4FJIA 1K9MO 4DUYK 4DSLA 1TUYA 4J2DA 4LF9K 4CJ7A 3A5NC 3V4IA 3TABA 3F73A 5C42A 3IUCA 3AVLA 3OYNA 1WSJA 4OKKA 4HVJA
chains in the Genus database with same CATH topology
4CF8A 5CZ1A 4CJPA 3HP9A 2WONA 3OYLA 2X6SA 4Z4IA 5C24A 1JLCA 2FBYA 1NOZA 5CY4A 3HVRA 1FKPA 1EX4A 3CM5A 3ISNC 3HPHA 4ID1A 4LSLA 1UAXA 5KRTA 3HT3A 1L3UA 4CGDA 4PUOA 3M8PA 4KHSA 4E7JA 3QIOA 2YNHA 4CESA 3JSMA 2HHXA 4E3SA 3G0ZA 3SUQA 2YNFA 4OJRA 4AHSA 1U45A 1NK9A 1J9AA 4OGEA 3I0SA 3RR7A 2HHWA 4DSEA 1BCMA 1KVBA 2A1SA 1W0HA 4O55A 4CHNA 4FM2A 3MAQA 2D0CA 3THVA 3OYJA 1LV5A 3HYFA 4FJHA 3IG1A 4FM1A 4DTXA 3SZ2A 3OVNA 3ZT1A 5J1EA 1TKDA 3LP1A 4FK4A 1VRUA 2RKIA 3SI6A 4BWMA 3OS2A 1ASVA 4FLZA 4DU3A 4F2RA 4CIFA 4B3OA 4CHOA 3TAMA 4G1QA 4KPYA 1QHTA 1VSHA 1BCOA 1Y97A 1RILA 4I2PA 4W5OA 4DS4A 3TAQA 1ASWA 2KTQA 1CLQA 3RMCA 4J2EA 1HNVA 1U49A 4KI6A 2HHSA 4HUGA 4B9UA 2KZMA 5SZTA 3TAFA 1L5UA 4FJXA 3NE6A 3V9XA 1U47A 4KAZA 5SWMA 3AV9A 2X78A 3LPUA 3QNOA 4KHQA 3SUOA 1GOCA 2PYJA 3HPOA 4F3OA 1TAUA 1YVUA 1WAJA 1GOBA 3HVTA 3EY1A 2BE2A 3S3NA 1KRPA 1HJRA 4RW8A 3OYFA 3PUFA 5FDLA 3OYGA 1D8YA 1RT3A 4ELTA 3NF8A 3V1OA 2OPPA 4ID5A 4LD0A 3U3GA 3C95A 4CFCA 4JRQA 3K5MA 1HRHA 4OPJA 3LZIA 4HUFA 1XC9A 4B9MA 3L8BA 1A5VA 3SPYA 4C8KA 3RMBA 3BGRA 4HCBA 3EYZA 4AHUA 3K59A 3O4QA 3E01A 1ASUA 2I5JA 4PQUA 3QO9A 2P5GA 1S1WA 3MEEA 1TK8A 1BI4A 2HHQA 1VSLA 4M3RA 3T19A 4CJFA 4CERA 3AVHA 4YNQA 4Z0UA 4PY5A 4C8OA 1REVA 3IRXA 2ZQBA 2P1JA 4Y1CA 1ZBLA 2PY5A 3D45A 3K2PA 1NKCA 5KI6A 3QEVA 4F8RA 1I3AA 1Q9XA 3VQPA 3HPGA 3CFRA 4Q5VA 2D0BA 1TL1A 1TKTA 2XRIA 3AVBA 4DS5A 4CEDA 4KHNA 4KI4A 4ZHRA 1EETA 1BGXT 5HP1A 1JLGA 1CZBA 3DYAA 3M8QA 4IFVA 3OYDA 4OKJA 4KRFA 4KTQA 2FBVA 1SKWA 1WSHA 5FRNA 4IFYA 4LY7A 4CHPA 2PZSA 4FZXC 4M3UA 2FC0A 1BQNA 3ZSRA 1VSJA 1L3VA 1DTQA 2RN2A 3LP3A 3ALYA 3ZSVA 4CIGA 4W5QA 3K58A 2GV9A 4B9TA 3I8DA 1S9GA 4DSIA 1EXQA 3ASMA 1ZBUA 1BL3A 2X6NA 4M3XA 3RTVA 1JKHA 3S3OA 3WNGA 3AVNA 1JL2A 4FLWA 1WLJA 3K57A 3NGZA 4DTUA 1F21A 1XI1A 5K14A 4KTWA 4RW4A 4BE0A 4KREA 3NGIA 1VK0A 2QKKA 2OZMA 1A5XA 1C0UA 4FJ9A 4WE1A 3KKSA 1WSIA 5HRNA 3OYKA 3LDSA 3MXMA 1J5OA 4M42A 3AA4A 3L2WA 1HNIA 3DLRA 4MFBA 4R5PA 1KVCA 4ELUA 4IBNA 1UA1A 4CEFA 1BIUA 1NK7A 4DQIA 4FLYA 3WNHA 4DLGA 4C8LA 1SKSA 4E7HA 4NCAA 2FBTA 4FJJA 3VQAA 3HJFA 4CJSA 4CJUA 3DLBA 4I2QA 3AO4A 4FLXA 4W5RA 2G8WA 2IAJA 4DG1A 4E1NA 2HNDA 3K5LA 1QSSA 1VRTA 1LAVA 4FW2A 1SL2A 4DSJA 2XY7A 1NJZA 1T03A 3BDPA 4N47A 3CFPA 1T7PA 4N41A 3SV4A 1KCFA 1JXEA 2FBXA 4FVMA 4LH4A 3AVFA 5CYQA 3SYZA 3V9SA 4FYDA 2DTUA 3OYAA 1JLEA 2W42A 1QS4A 3SUPA 4GMJB 3UIQA 3NF6A 2HNYA 3PY8A 4OGCA 3VQQA 2BDPA 3KD1E 3V9WA 2XHBA 1VSMA 2BANA 4Z4CA 1C1CA 2EX3A 3WNEA 1ZBHA 1QSLA 4M45A 1JXBA 3P83D 5T7BA 4DU1A 3VA0A 3KLHA 3NFAA 3KK1A 1HYVA 3CFOA 3ZSZA 3RMAA 4OLAA 1TKZA 4ICLA 3U6FA 4E7LA 1N6QA 4M3TA 2YKMA 4QAGA 2OA8A 2IC3A 1UOCA 2HHVA 1HQEA 3QNNA 1UWBA 4RW9A 4DTOA 4HUEA 3IAYA 3PO4A 3ZSOA 4Z4HA 1EP4A 2VG5A 1HQUA 2JGUA 1EKEA 3OJSA 3K5NA 3DM2A 2LSNA 5DMRA 3MECA 3KLFA 4CE9A 4CJLA 2G8FA 3B6OA 3QINA 1NK0A 1MU2A 5J2MA 4I9QA 1SKRA 3U3YA 4O0JA 4FM0A 4CF2A 4CHZA 3DRSA 5E41A 2VG6A 5J2QA 4Z4GA 5JS1A 1BQMA 3DMJA 4DTJA 1S1TA 5EU7A 1YTUA 1NJYA 1RBTA 4AILC 4JS4A 1K6YA 2YNGA 4ZTFA 1KFSA 4F2SA 4UQGA 5HROA 1VSDA 5I42A 1IKYA 4CJKA 2Q3SA 3V81A 3TAPA 2OZSA 5KGWA 3ITHA 3VQDA 1CXUA 1CZ9A 3OYBA 4B8CA 2G8VA 2QXFA 2IDOA 4DQSA 1BI4B 5J2NA 4BWJA 3LPTA 1NJWA 2ETJA 4DWIA 4KB0A 3G10A 1Q9YA 4KO0A 1FKOA 1TKXA 1B9FA 3F9KA 4CEAA 4CK2A 4CK3A 4ELVA 1JL1A 4CGFA 3SCXA 1ZBIA 4I9LA 3DLGA 1GOAA 3VA3A 4M41A 3MEGA 4CHQA 4YFUA 4TSXA 2D0AA 1W9HA 1TAQA 4RW6A 3PX0A 4CEBA 1L3TA 1RT7A 2QK9A 2D5RA 3MEDA 3JYTA 3QEIA 1BISA 1SUQA 3OYEA 1X9SA 4NYNA 2WOMA 4BDZA 1RDDA 4DFPA 1RDAA 1RCHA 1HYZA 4FCYA 1T8EA 3ZSXA 2XY5A 3K5OA 3RRHA 1IG9A 4CEOA 3AVIA 2DFEA 2IOCA 3NGYA 1IO2A 4HTUA 4DQRA 4IKFA 4JLHA 3ULDA 2P5OA 3M8RA 1NK8A 3M8SA 3L3UA 4JRPA 3HSTB 4HHTA 3L3VA 2G8HA 3KIOA 3ZSYA 3ZCMA 4BACA 2G8IA 3WNFA 3VQ9A 1ITGA 1U48A 3RR8A 1VSEA 4E0DA 4E7KA 3NAEA 4CJ3A 4DSKA 4H4OA 4DTSA 3VN5A 4CF1A 3TAEA 4PA1A 4CFDA 3ZT3A 4H8KA 2A1RA 4OVLA 1IH7A 3AVJA 3LAMA 1TK5A 3LWMA 4W5TA 4CEQA 3OY9A 2HHTA 1KFDA 1NK5A 4OKEA 3CG7A 3IS9A 1TL3A 5KRSA 4BDYA 4KHYA 2O4IA 4RG8A 4QCLA 1D9FA 1D9DA 4LSNA 1TGOA 3V1QA 3LWLA 1C0TA 3QERA 1KLMA 3AO2A 3AA5X 1KTQA 3HM9A 2IS3A 3CQ8A 4FJMA 3AVAA 4AHTA 1TK0A 4CGIA 3OS0A 2XY6A 4DSFA 1NK4A 1FXXA 1KLNA 2YV0X 3L2VA 4RW7A 3VQ7A 4F3TA 5J2PA 1NOYA 1SL1A 1KVAA 4DFMA 4M3YA 1C1BA 2HB5A 3SQ1A 2JLEA 3NH0A 2ATQA 1C0MA 3PV8A 3VQBA 4AH9A 3NCIA 1S1XA 2NUBA 3O3FA 3P5JA 4DFJA 3SQ0A 1XWLA 2RPIA 1S1VA 2P51A 2GUIA 3FFIA 5HBMA 1RDBA 1S6PA 1C6VA 1QSYA 3SQ4A 3RRGA 3V1RA 1QE1A 4EZ6A 3SNNA 4DQPA 3HK2A 3SQ2A 1QQCA 1A5WA 1RNHA 1NKBA 4CJVA 3L2UA 2BGGA 5I3UA 4CJWA 4OPKA 4EZ9A 3AVKA 1HYSA 2X74A 1WNSA 3KLIA 1T05A 1Q8IA 1RT1A 1JLQA 2R7YA 3CYMA 2IGIA 4C8NA 4FK0A 3KKRA 3QETA 4CEZA 4CFAA 1RBVA 3MXJA 5KTQA 2YKNA 2ZD1A 4E89A 4M3WA 4GVMA 1DTTA 4MQ3A 4J2AA 2QKBA 2Y1IA 2DY4A 5HRPA 4N56A 3V9UA 1Z25A 4EP5A 4EP4A 4ZTJA 1YTAA 3KD5E 1RBUA 1X1PA 1RT5A 4OLBA 4AHCA 3TARA 1D5AA 3ZT0A 4FW1A 3AVMA 3V9ZA 4PWDA 3QEWA 2ZE2A 4K8ZA 3QESA 4I7FA 5FRMA 1CXQA 1RTDA 4M3ZA 4DTMA 1S9EA 1XHXA 1IKXA 2VG7A 2HNZA 3LALA 3LP2A 3VQ4A 5HLFA 3HP6A 4B9VA 4B8AB 1O1WA 2Z1JA 4H4MA 3KLEA 2Y1JA 1R0AA 2OPQA 3SUNA 4FXDA 4GW6A 1BHLA 2RF2A 3C6UA 3NF9A 1X9MA 1UA0A 3T1AA 1B9DA 3PX6A 2KFNA 3AA3A 1IKVA 4CECA 4IDKA 3QEXA 3DLKA 3DOLA 3DRRA 5DK5A 4N76A 3RWUA 3QLHA 1LWEA 5FROA 1I39A 4CJEA 2B6AA 4E1MA 1DLOA 2F8SA 1SL0A 1KSPA 4FLTA 4DU4A 1WN7A 1WSEA 3MXIA 5D3GA 2E6LA 3QIPA 4C8MA 4CJQA 1X9WA 4CK1A 4XIUA 4E19A 1C1AA 4KB1A 2Z1IA 3S3MA 3QEPA 3ZSQA 3TR8A 4FLVA 4FJ7A 3KLGA 1VSIA 4B9SA 2KZZA 5CZ2A 4BE2A 3OS1A 3PX4A 4CGHA 1S5JA 1BIZA 2VWJA 4DF4A 2KW4A 4DTRA 1RT6A 4CJTA 4CCHA 4L8RB 4IG0A 3OJUA 3NHGA 3DOKA 1NJXA 2B4JA 5KGXA 2XY8A 4NCBA 3ZSWA 1VSKA 1RBSA 1J54A 2DFHA 3DRPA 4CJ4A 1ZYQA 4DQQA 1U4BA 2G8UA 1LWFA 4FJ8A 3SJJA 4AHVA 4CHYA 3EZ5A 4KV8A 4E7IA 1JLBA 3C94A 1XHZA 2OYQA 1WAFA 4K8XA 1SV5A 1TVRA 3H08A 2GBZA 1ZBFA 4B08A 1HPZA 4FLUA 4DF8A 1IKWA 3O3GA 3OYIA 1VSFA 1WSGA 3OYMA 1LAWA 2F96A 3NF7A 1RTJA 3TI0A 1JLAA 3AO3A 2E6MA 3VQ6A 3OYCA 3VQEA 3OYHA 2KQ2A 1JLFA 3I0RA 3HXMA 4DMNA 4F4KA 4FJKA 4KHWA 2YHAA 3HO1A 1G15A 4KKOA 3LANA 3HL8A 4FK2A 3KK3A 3V6DA 1QTMA 4DTPA 1J53A 4B9NA 1FK9A 3B6PA 4FJNA 2HVHA 3A2FA 3NDKA 3O4NA 3T3FA 3P1GA 3AVCA 3TANA 1N5YA 1LW2A 4DTNA 3LP0A 4IG3A 4J2BA 1NKEA 4FJGA 3AO5A 4NCGA 3VQ5A 2HW3A 3L2QA 4DLEA 1B92A 2VWKA 3VQ8A 2HVIA 4KHUA 3O3HA 3NH1A 1L3SA 2ITGA 4CJ5A 3TAGA 1LWCA 4CIEA 4DFKA 1TV6A 3VQCA 1RTIA 2PYLA 4BE1A 1YT3A 2HMIA 4Z4EA 4KFBA 3TWHA 2Z1GA 2O4GA 1S1UA 4W5NA 1LW0A 3DLEA 1RTHA 3KK2A 4KTZA 1HMVA 3LAKA 1RDCA 3AO1A 4FJLA 3S9HA 1S6QA 4JS5A 5JS2A 3NH2A 3L2RA 3AVGA 2G8KA 4NYFA 3KJVA 4CFBA 4CF0A 4FJ5A 2OPRA 3AA2A 4O4GA 1RT4A 4N5SA 3RMDA 1Z26A 4LH5A 3C6TA 2YNIA 4CF9A 4CGJA 4CEEA 1NK6A 3DLHA 4Z4FA 3SPZA 2KFZA 3D0PA 4HCCA 2HHUA 4Y1DA 2F8TA 3DI6A 2YHBA 3LZJA 3KTQA 4Q0BA 3ZT2A 4QOZB 4FZZA 2DFFA 5C25A 4FZYA 2B5JA 5HRSA 2E4LA 2OPSA 3NBPA 3PO5A 1U04A 4AHRA 2EHGA 4CJRA 4BDPA 1WSFA 2AJQA 4O5BA 3SV3A 4O44A 2XO7A 4FJIA 1RT2A 4DSLA 4J2DA 5HRRA 3TABA 3V4IA 4CGGA 5CYMA 3ZT4A 3F73A 4O0IA 1RBRA 5C42A 2Z1HA 3AVLA 3OYNA 1WSJA 4OKKA 4HVJA 4B9LA 3CM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CF8 A;  5CZ1 A;  4CJP A;  3HP9 A;  2WON A;  3OYL A;  2X6S A;  4Z4I A;  5C24 A;  1JLC A;  2FBY A;  1NOZ A;  5CY4 A;  3HVR A;  1FKP A;  1EX4 A;  3CM5 A;  3ISN C;  3HPH A;  4ID1 A;  4LSL A;  1UAX A;  5KRT A;  3HT3 A;  1L3U A;  4CGD A;  4PUO A;  3M8P A;  4KHS A;  4E7J A;  3QIO A;  2YNH A;  4CES A;  3JSM A;  2HHX A;  4E3S A;  3G0Z A;  3SUQ A;  2YNF A;  4OJR A;  4AHS A;  1U45 A;  1NK9 A;  1J9A A;  4OGE A;  3I0S A;  3RR7 A;  2HHW A;  4DSE A;  1BCM A;  1KVB A;  2A1S A;  1W0H A;  4O55 A;  4CHN A;  4FM2 A;  3MAQ A;  2D0C A;  3THV A;  3OYJ A;  1LV5 A;  3HYF A;  4FJH A;  3IG1 A;  4FM1 A;  4DTX A;  3SZ2 A;  3OVN A;  3ZT1 A;  5J1E A;  1TKD A;  3LP1 A;  4FK4 A;  1VRU A;  2RKI A;  3SI6 A;  4BWM A;  3OS2 A;  1ASV A;  4FLZ A;  4DU3 A;  4F2R A;  4CIF A;  4B3O A;  4CHO A;  3TAM A;  4G1Q A;  4KPY A;  1QHT A;  1VSH A;  1BCO A;  1Y97 A;  1RIL A;  4I2P A;  4W5O A;  4DS4 A;  3TAQ A;  1ASW A;  2KTQ A;  1CLQ A;  3RMC A;  4J2E A;  1HNV A;  1U49 A;  4KI6 A;  2HHS A;  4HUG A;  4B9U A;  2KZM A;  5SZT A;  3TAF A;  1L5U A;  4FJX A;  3NE6 A;  3V9X A;  1U47 A;  4KAZ A;  5SWM A;  3AV9 A;  2X78 A;  3LPU A;  3QNO A;  4KHQ A;  3SUO A;  1GOC A;  2PYJ A;  3HPO A;  4F3O A;  1TAU A;  1YVU A;  1WAJ A;  1GOB A;  3HVT A;  3EY1 A;  2BE2 A;  3S3N A;  1KRP A;  1HJR A;  4RW8 A;  3OYF A;  3PUF A;  5FDL A;  3OYG A;  1D8Y A;  1RT3 A;  4ELT A;  3NF8 A;  3V1O A;  2OPP A;  4ID5 A;  4LD0 A;  3U3G A;  3C95 A;  4CFC A;  4JRQ A;  3K5M A;  1HRH A;  4OPJ A;  3LZI A;  4HUF A;  1XC9 A;  4B9M A;  3L8B A;  1A5V A;  3SPY A;  4C8K A;  3RMB A;  3BGR A;  4HCB A;  3EYZ A;  4AHU A;  3K59 A;  3O4Q A;  3E01 A;  1ASU A;  2I5J A;  4PQU A;  3QO9 A;  2P5G A;  1S1W A;  3MEE A;  1TK8 A;  1BI4 A;  2HHQ A;  1VSL A;  4M3R A;  3T19 A;  4CJF A;  4CER A;  3AVH A;  4YNQ A;  4Z0U A;  4PY5 A;  4C8O A;  1REV A;  3IRX A;  2ZQB A;  2P1J A;  4Y1C A;  1ZBL A;  2PY5 A;  3D45 A;  3K2P A;  1NKC A;  5KI6 A;  3QEV A;  4F8R A;  1I3A A;  1Q9X A;  3VQP A;  3HPG A;  3CFR A;  4Q5V A;  2D0B A;  1TL1 A;  1TKT A;  2XRI A;  3AVB A;  4DS5 A;  4CED A;  4KHN A;  4KI4 A;  4ZHR A;  1EET A;  1BGX T;  5HP1 A;  1JLG A;  1CZB A;  3DYA A;  3M8Q A;  4IFV A;  3OYD A;  4OKJ A;  4KRF A;  4KTQ A;  2FBV A;  1SKW A;  1WSH A;  5FRN A;  4IFY A;  4LY7 A;  4CHP A;  2PZS A;  4FZX C;  4M3U A;  2FC0 A;  1BQN A;  3ZSR A;  1VSJ A;  1L3V A;  1DTQ A;  2RN2 A;  3LP3 A;  3ALY A;  3ZSV A;  4CIG A;  4W5Q A;  3K58 A;  2GV9 A;  4B9T A;  3I8D A;  1S9G A;  4DSI A;  1EXQ A;  3ASM A;  1ZBU A;  1BL3 A;  2X6N A;  4M3X A;  3RTV A;  1JKH A;  3S3O A;  3WNG A;  3AVN A;  1JL2 A;  4FLW A;  1WLJ A;  3K57 A;  3NGZ A;  4DTU A;  1F21 A;  1XI1 A;  5K14 A;  4KTW A;  4RW4 A;  4BE0 A;  4KRE A;  3NGI A;  1VK0 A;  2QKK A;  2OZM A;  1A5X A;  1C0U A;  4FJ9 A;  4WE1 A;  3KKS A;  1WSI A;  5HRN A;  3OYK A;  3LDS A;  3MXM A;  1J5O A;  4M42 A;  3AA4 A;  3L2W A;  1HNI A;  3DLR A;  4MFB A;  4R5P A;  1KVC A;  4ELU A;  4IBN A;  1UA1 A;  4CEF A;  1BIU A;  1NK7 A;  4DQI A;  4FLY A;  3WNH A;  4DLG A;  4C8L A;  1SKS A;  4E7H A;  4NCA A;  2FBT A;  4FJJ A;  3VQA A;  3HJF A;  4CJS A;  4CJU A;  3DLB A;  4I2Q A;  3AO4 A;  4FLX A;  4W5R A;  2G8W A;  2IAJ A;  4DG1 A;  4E1N A;  2HND A;  3K5L A;  1QSS A;  1VRT A;  1LAV A;  4FW2 A;  1SL2 A;  4DSJ A;  2XY7 A;  1NJZ A;  1T03 A;  3BDP A;  4N47 A;  3CFP A;  1T7P A;  4N41 A;  3SV4 A;  1KCF A;  1JXE A;  2FBX A;  4FVM A;  4LH4 A;  3AVF A;  5CYQ A;  3SYZ A;  3V9S A;  4FYD A;  2DTU A;  3OYA A;  1JLE A;  2W42 A;  1QS4 A;  3SUP A;  4GMJ B;  3UIQ A;  3NF6 A;  2HNY A;  3PY8 A;  4OGC A;  3VQQ A;  2BDP A;  3KD1 E;  3V9W A;  2XHB A;  1VSM A;  2BAN A;  4Z4C A;  1C1C A;  2EX3 A;  3WNE A;  1ZBH A;  1QSL A;  4M45 A;  1JXB A;  3P83 D;  5T7B A;  4DU1 A;  3VA0 A;  3KLH A;  3NFA A;  3KK1 A;  1HYV A;  3CFO A;  3ZSZ A;  3RMA A;  4OLA A;  1TKZ A;  4ICL A;  3U6F A;  4E7L A;  1N6Q A;  4M3T A;  2YKM A;  4QAG A;  2OA8 A;  2IC3 A;  1UOC A;  2HHV A;  1HQE A;  3QNN A;  1UWB A;  4RW9 A;  4DTO A;  4HUE A;  3IAY A;  3PO4 A;  3ZSO A;  4Z4H A;  1EP4 A;  2VG5 A;  1HQU A;  2JGU A;  1EKE A;  3OJS A;  3K5N A;  3DM2 A;  2LSN A;  5DMR A;  3MEC A;  3KLF A;  4CE9 A;  4CJL A;  2G8F A;  3B6O A;  3QIN A;  1NK0 A;  1MU2 A;  5J2M A;  4I9Q A;  1SKR A;  3U3Y A;  4O0J A;  4FM0 A;  4CF2 A;  4CHZ A;  3DRS A;  5E41 A;  2VG6 A;  5J2Q A;  4Z4G A;  5JS1 A;  1BQM A;  3DMJ A;  4DTJ A;  1S1T A;  5EU7 A;  1YTU A;  1NJY A;  1RBT A;  4AIL C;  4JS4 A;  1K6Y A;  2YNG A;  4ZTF A;  1KFS A;  4F2S A;  4UQG A;  5HRO A;  1VSD A;  5I42 A;  1IKY A;  4CJK A;  2Q3S A;  3V81 A;  3TAP A;  2OZS A;  5KGW A;  3ITH A;  3VQD A;  1CXU A;  1CZ9 A;  3OYB A;  4B8C A;  2G8V A;  2QXF A;  2IDO A;  4DQS A;  1BI4 B;  5J2N A;  4BWJ A;  3LPT A;  1NJW A;  2ETJ A;  4DWI A;  4KB0 A;  3G10 A;  1Q9Y A;  4KO0 A;  1FKO A;  1TKX A;  1B9F A;  3F9K A;  4CEA A;  4CK2 A;  4CK3 A;  4ELV A;  1JL1 A;  4CGF A;  3SCX A;  1ZBI A;  4I9L A;  3DLG A;  1GOA A;  3VA3 A;  4M41 A;  3MEG A;  4CHQ A;  4YFU A;  4TSX A;  2D0A A;  1W9H A;  1TAQ A;  4RW6 A;  3PX0 A;  4CEB A;  1L3T A;  1RT7 A;  2QK9 A;  2D5R A;  3MED A;  3JYT A;  3QEI A;  1BIS A;  1SUQ A;  3OYE A;  1X9S A;  4NYN A;  2WOM A;  4BDZ A;  1RDD A;  4DFP A;  1RDA A;  1RCH A;  1HYZ A;  4FCY A;  1T8E A;  3ZSX A;  2XY5 A;  3K5O A;  3RRH A;  1IG9 A;  4CEO A;  3AVI A;  2DFE A;  2IOC A;  3NGY A;  1IO2 A;  4HTU A;  4DQR A;  4IKF A;  4JLH A;  3ULD A;  2P5O A;  3M8R A;  1NK8 A;  3M8S A;  3L3U A;  4JRP A;  3HST B;  4HHT A;  3L3V A;  2G8H A;  3KIO A;  3ZSY A;  3ZCM A;  4BAC A;  2G8I A;  3WNF A;  3VQ9 A;  1ITG A;  1U48 A;  3RR8 A;  1VSE A;  4E0D A;  4E7K A;  3NAE A;  4CJ3 A;  4DSK A;  4H4O A;  4DTS A;  3VN5 A;  4CF1 A;  3TAE A;  4PA1 A;  4CFD A;  3ZT3 A;  4H8K A;  2A1R A;  4OVL A;  1IH7 A;  3AVJ A;  3LAM A;  1TK5 A;  3LWM A;  4W5T A;  4CEQ A;  3OY9 A;  2HHT A;  1KFD A;  1NK5 A;  4OKE A;  3CG7 A;  3IS9 A;  1TL3 A;  5KRS A;  4BDY A;  4KHY A;  2O4I A;  4RG8 A;  4QCL A;  1D9F A;  1D9D A;  4LSN A;  1TGO A;  3V1Q A;  3LWL A;  1C0T A;  3QER A;  1KLM A;  3AO2 A;  3AA5 X;  1KTQ A;  3HM9 A;  2IS3 A;  3CQ8 A;  4FJM A;  3AVA A;  4AHT A;  1TK0 A;  4CGI A;  3OS0 A;  2XY6 A;  4DSF A;  1NK4 A;  1FXX A;  1KLN A;  2YV0 X;  3L2V A;  4RW7 A;  3VQ7 A;  4F3T A;  5J2P A;  1NOY A;  1SL1 A;  1KVA A;  4DFM A;  4M3Y A;  1C1B A;  2HB5 A;  3SQ1 A;  2JLE A;  3NH0 A;  2ATQ A;  1C0M A;  3PV8 A;  3VQB A;  4AH9 A;  3NCI A;  1S1X A;  2NUB A;  3O3F A;  3P5J A;  4DFJ A;  3SQ0 A;  1XWL A;  2RPI A;  1S1V A;  2P51 A;  2GUI A;  3FFI A;  5HBM A;  1RDB A;  1S6P A;  1C6V A;  1QSY A;  3SQ4 A;  3RRG A;  3V1R A;  1QE1 A;  4EZ6 A;  3SNN A;  4DQP A;  3HK2 A;  3SQ2 A;  1QQC A;  1A5W A;  1RNH A;  1NKB A;  4CJV A;  3L2U A;  2BGG A;  5I3U A;  4CJW A;  4OPK A;  4EZ9 A;  3AVK A;  1HYS A;  2X74 A;  1WNS A;  3KLI A;  1T05 A;  1Q8I A;  1RT1 A;  1JLQ A;  2R7Y A;  3CYM A;  2IGI A;  4C8N A;  4FK0 A;  3KKR A;  3QET A;  4CEZ A;  4CFA A;  1RBV A;  3MXJ A;  5KTQ A;  2YKN A;  2ZD1 A;  4E89 A;  4M3W A;  4GVM A;  1DTT A;  4MQ3 A;  4J2A A;  2QKB A;  2Y1I A;  2DY4 A;  5HRP A;  4N56 A;  3V9U A;  1Z25 A;  4EP5 A;  4EP4 A;  4ZTJ A;  1YTA A;  3KD5 E;  1RBU A;  1X1P A;  1RT5 A;  4OLB A;  4AHC A;  3TAR A;  1D5A A;  3ZT0 A;  4FW1 A;  3AVM A;  3V9Z A;  4PWD A;  3QEW A;  2ZE2 A;  4K8Z A;  3QES A;  4I7F A;  5FRM A;  1CXQ A;  1RTD A;  4M3Z A;  4DTM A;  1S9E A;  1XHX A;  1IKX A;  2VG7 A;  2HNZ A;  3LAL A;  3LP2 A;  3VQ4 A;  5HLF A;  3HP6 A;  4B9V A;  4B8A B;  1O1W A;  2Z1J A;  4H4M A;  3KLE A;  2Y1J A;  1R0A A;  2OPQ A;  3SUN A;  4FXD A;  4GW6 A;  1BHL A;  2RF2 A;  3C6U A;  3NF9 A;  1X9M A;  1UA0 A;  3T1A A;  1B9D A;  3PX6 A;  2KFN A;  3AA3 A;  1IKV A;  4CEC A;  4IDK A;  3QEX A;  3DLK A;  3DOL A;  3DRR A;  5DK5 A;  4N76 A;  3RWU A;  3QLH A;  1LWE A;  5FRO A;  1I39 A;  4CJE A;  2B6A A;  4E1M A;  1DLO A;  2F8S A;  1SL0 A;  1KSP A;  4FLT A;  4DU4 A;  1WN7 A;  1WSE A;  3MXI A;  5D3G A;  2E6L A;  3QIP A;  4C8M A;  4CJQ A;  1X9W A;  4CK1 A;  4XIU A;  4E19 A;  1C1A A;  4KB1 A;  2Z1I A;  3S3M A;  3QEP A;  3ZSQ A;  3TR8 A;  4FLV A;  4FJ7 A;  3KLG A;  1VSI A;  4B9S A;  2KZZ A;  5CZ2 A;  4BE2 A;  3OS1 A;  3PX4 A;  4CGH A;  1S5J A;  1BIZ A;  2VWJ A;  4DF4 A;  2KW4 A;  4DTR A;  1RT6 A;  4CJT A;  4CCH A;  4L8R B;  4IG0 A;  3OJU A;  3NHG A;  3DOK A;  1NJX A;  2B4J A;  5KGX A;  2XY8 A;  4NCB A;  3ZSW A;  1VSK A;  1RBS A;  1J54 A;  2DFH A;  3DRP A;  4CJ4 A;  1ZYQ A;  4DQQ A;  1U4B A;  2G8U A;  1LWF A;  4FJ8 A;  3SJJ A;  4AHV A;  4CHY A;  3EZ5 A;  4KV8 A;  4E7I A;  1JLB A;  3C94 A;  1XHZ A;  2OYQ A;  1WAF A;  4K8X A;  1SV5 A;  1TVR A;  3H08 A;  2GBZ A;  1ZBF A;  4B08 A;  1HPZ A;  4FLU A;  4DF8 A;  1IKW A;  3O3G A;  3OYI A;  1VSF A;  1WSG A;  3OYM A;  1LAW A;  2F96 A;  3NF7 A;  1RTJ A;  3TI0 A;  1JLA A;  3AO3 A;  2E6M A;  3VQ6 A;  3OYC A;  3VQE A;  3OYH A;  2KQ2 A;  1JLF A;  3I0R A;  3HXM A;  4DMN A;  4F4K A;  4FJK A;  4KHW A;  2YHA A;  3HO1 A;  1G15 A;  4KKO A;  3LAN A;  3HL8 A;  4FK2 A;  3KK3 A;  3V6D A;  1QTM A;  4DTP A;  1J53 A;  4B9N A;  1FK9 A;  3B6P A;  4FJN A;  2HVH A;  3A2F A;  3NDK A;  3O4N A;  3T3F A;  3P1G A;  3AVC A;  3TAN A;  1N5Y A;  1LW2 A;  4DTN A;  3LP0 A;  4IG3 A;  4J2B A;  1NKE A;  4FJG A;  3AO5 A;  4NCG A;  3VQ5 A;  2HW3 A;  3L2Q A;  4DLE A;  1B92 A;  2VWK A;  3VQ8 A;  2HVI A;  4KHU A;  3O3H A;  3NH1 A;  1L3S A;  2ITG A;  4CJ5 A;  3TAG A;  1LWC A;  4CIE A;  4DFK A;  1TV6 A;  3VQC A;  1RTI A;  2PYL A;  4BE1 A;  1YT3 A;  2HMI A;  4Z4E A;  4KFB A;  3TWH A;  2Z1G A;  2O4G A;  1S1U A;  4W5N A;  1LW0 A;  3DLE A;  1RTH A;  3KK2 A;  4KTZ A;  1HMV A;  3LAK A;  1RDC A;  3AO1 A;  4FJL A;  3S9H A;  1S6Q A;  4JS5 A;  5JS2 A;  3NH2 A;  3L2R A;  3AVG A;  2G8K A;  4NYF A;  3KJV A;  4CFB A;  4CF0 A;  4FJ5 A;  2OPR A;  3AA2 A;  4O4G A;  1RT4 A;  4N5S A;  3RMD A;  1Z26 A;  4LH5 A;  3C6T A;  2YNI A;  4CF9 A;  4CGJ A;  4CEE A;  1NK6 A;  3DLH A;  4Z4F A;  3SPZ A;  2KFZ A;  3D0P A;  4HCC A;  2HHU A;  4Y1D A;  2F8T A;  3DI6 A;  2YHB A;  3LZJ A;  3KTQ A;  4Q0B A;  3ZT2 A;  4QOZ B;  4FZZ A;  2DFF A;  5C25 A;  4FZY A;  2B5J A;  5HRS A;  2E4L A;  2OPS A;  3NBP A;  3PO5 A;  1U04 A;  4AHR A;  2EHG A;  4CJR A;  4BDP A;  1WSF A;  2AJQ A;  4O5B A;  3SV3 A;  4O44 A;  2XO7 A;  4FJI A;  1RT2 A;  4DSL A;  4J2D A;  5HRR A;  3TAB A;  3V4I A;  4CGG A;  5CYM A;  3ZT4 A;  3F73 A;  4O0I A;  1RBR A;  5C42 A;  2Z1H A;  3AVL A;  3OYN A;  1WSJ A;  4OKK A;  4HVJ A;  4B9L A;  3CM6 A; 
#chains in the Genus database with same CATH topology
 5BRE A;  2X6S A;  5C24 A;  1JLC A;  2FBY A;  5AQW A;  4FYD A;  4ID1 A;  3J7Z O;  2DTU A;  3HPH A;  1UAX A;  4BC2 A;  2O8B A;  4E7J A;  3G0Z A;  2RE2 A;  2YNF A;  1G99 A;  4AHS A;  1U45 A;  4OGE A;  5AR0 A;  2HHW A;  4O55 A;  2OCE A;  3MAQ A;  4NLB A;  1YI2 N;  3IG1 A;  2GWK A;  1KQS M;  1NU0 A;  3I8B A;  2O8F B;  3THW A;  5J1E A;  4YHH K;  3LP1 A;  4H5R A;  3OS2 A;  1J5E K;  4CHO A;  4G1Q A;  1BA1 A;  1Y97 A;  2FLO A;  4W5O A;  3CCM N;  4BG8 A;  3RMC A;  3O5B A;  1M1K O;  2HHS A;  4BR0 A;  3TAF A;  3NE6 A;  3V9X A;  3CJ7 A;  5SWM A;  2X78 A;  5AQK A;  3J8A A;  3OW2 M;  4F3O A;  1TAU A;  3HVT A;  4MLE A;  3EY1 A;  2ASP A;  3E9O A;  3H1Q A;  4X64 K;  4J8F A;  4RW8 A;  3OYF A;  5FDL A;  3OYG A;  3S41 A;  1D8Y A;  3NF8 A;  5FLX O;  3ULE A;  4JRQ A;  4WCE L;  3LZI A;  1XC9 A;  3C6A A;  3EE9 A;  5AQQ A;  4DR7 K;  3VEX A;  3BGR A;  3EYZ A;  2OTL N;  2P5G A;  3MEE A;  1TK8 A;  3RSE B;  1VSL A;  3T19 A;  3QBW A;  3ZX0 A;  5AQV A;  4YNQ A;  3MX2 A;  4CZH A;  1ZBL A;  1X3M A;  5KI6 A;  1I3A A;  3VQP A;  5A2Q O;  3VGK A;  4Q5V A;  2ZF5 O;  4A62 A;  4KHN A;  1SS6 A;  2P9L B;  4ZHR A;  3WXJ A;  5F2R A;  3O9S A;  3E9L A;  4NB4 A;  1CZB A;  4IFV A;  2QA4 N;  2QWR A;  4LFA K;  2WUS A;  3OYD A;  4KRF A;  5F0X A;  4BRK A;  1K8K B;  1OH5 A;  4B1V A;  1WSH A;  1GLA G;  1KAY A;  4IFY A;  4M3U A;  1BQN A;  3MN7 A;  3MWP A;  2RN2 A;  2YHW A;  1NG9 A;  4M3X A;  3ASM A;  2X6N A;  3RTV A;  3TPQ A;  3H3N O;  1XNR K;  3LDN A;  3K57 A;  1Q18 A;  4DTU A;  4JI1 K;  1BA0 A;  4BE0 A;  2OZM A;  3MXM A;  3OYK A;  2A40 A;  4M42 A;  4DV2 K;  3WQT A;  3R1X A;  1UA1 A;  3L4I A;  4DQI A;  4DLG A;  1DKG D;  4E7H A;  5AZJ A;  3VQA A;  1IBM K;  4H5N A;  4I2Q A;  2V7Z A;  3AO4 A;  3VF6 A;  4W5R A;  2A41 A;  2G8W A;  1NGE A;  4BY9 C;  2XY7 A;  1NGI A;  2P9P B;  1T03 A;  3MN9 A;  3CFP A;  1VQ7 N;  4N41 A;  3SV4 A;  3BZK A;  1GLL O;  3SYZ A;  3V9S A;  3VMF B;  3CCU N;  1U6Z A;  4GMJ B;  1QVG M;  2HNY A;  1NGF A;  2XHB A;  1YJW N;  1C1C A;  2YHX A;  3IDH A;  1QZ5 A;  3P83 D;  2ZGY A;  3VA0 A;  1VQN N;  3CFO A;  3U6F A;  3GG4 A;  3U9D A;  2OA8 A;  2IC3 A;  5TKW A;  3QNN A;  3IAY A;  4ILH A;  1EP4 A;  2P9N B;  3FZL A;  1LOT B;  3DM2 A;  1RDU A;  3B6O A;  2PAV A;  2F7T A;  3VGL A;  4I9Q A;  2QM1 A;  4JI6 K;  5J2Q A;  1BU6 O;  1NJY A;  4AIL C;  2YNG A;  4FPB A;  4F2S A;  4UQG A;  5HRO A;  4CJK A;  1HUX A;  3V81 A;  2OZS A;  4DR5 K;  1CZ9 A;  3BY5 A;  3OYB A;  3CET A;  2G8V A;  1NNE A;  2QXF A;  2IDO A;  3RVC A;  4DQS A;  5J2N A;  1Q81 O;  4BWJ A;  3J81 O;  1YVN A;  3G10 A;  1Q9Y A;  4CEA A;  4JI2 K;  4ELV A;  2NRZ A;  1HLU A;  1BDG A;  4JKG A;  4CI6 A;  1NGD A;  4H03 B;  4X62 K;  4YFU A;  4RCH A;  1W9H A;  1TAQ A;  1L3T A;  1RT7 A;  2QK9 A;  4JI4 K;  3EZW A;  1X9S A;  3OYE A;  3O9U A;  4H0Y B;  3SJH A;  4FCY A;  1T8E A;  3ZSX A;  3K5O A;  3RRH A;  4ISG A;  2IOC A;  1IO2 A;  4HTU A;  1C0F A;  2GWJ A;  3DWL A;  3M8S A;  3L3U A;  3L3V A;  1SAZ A;  4K43 A;  2IVP A;  3T1Y K;  1ITG A;  3GBT A;  4JK8 A;  3G4S N;  3RR8 A;  3NAE A;  3SLC A;  3VN5 A;  2A1R A;  4CFD A;  3AVJ A;  3OY9 A;  2HHT A;  4OKE A;  4DV0 K;  4CZG A;  1TL3 A;  5KRS A;  4KHY A;  4BC3 A;  1HNZ K;  4QCL A;  1D9F A;  3CJA A;  3ZX3 A;  3V1Q A;  1T3V A;  3AO2 A;  1VQ5 N;  2NRT A;  1KTQ A;  2PFU A;  1TK0 A;  3OS0 A;  4DSF A;  2YV0 X;  5LJV A;  4RW7 A;  3W3D A;  1NOY A;  1SL1 A;  1Z05 A;  4M3Y A;  3SQ1 A;  3NH0 A;  1DEJ A;  2ATQ A;  3PV8 A;  2ZJP L;  3O3F A;  2P51 A;  5CHI A;  2GUI A;  1QSY A;  1QE1 A;  1OVY A;  3EEQ A;  3GOI A;  1RNH A;  1NKB A;  3EKS A;  4EZ9 A;  3AVK A;  3HZ6 A;  1WNS A;  3KLI A;  4JI8 K;  2J4R A;  1RT1 A;  3EKU A;  1NGC A;  1TYQ A;  5KTQ A;  3IMX A;  4E89 A;  4MQ3 A;  3FZK A;  2Y1I A;  4WQ5 A;  3SMS A;  1RBU A;  4AHC A;  3ENO A;  3V9Z A;  3AVM A;  3QEW A;  2ZE2 A;  2CH5 A;  3QES A;  1CXQ A;  2QTD A;  4M3Z A;  2HNZ A;  2P9S A;  3LAL A;  3R8E A;  1R59 O;  2Z1J A;  3KZB A;  5M1N A;  1BHL A;  2RF2 A;  3C6U A;  3NF9 A;  3CMA N;  1X9M A;  3T1A A;  5C10 A;  1LCU A;  1RFQ A;  5AQZ A;  2KFN A;  4DR2 K;  2HF4 A;  2P9I B;  5DK5 A;  4N76 A;  1LWE A;  2QI2 A;  4E1M A;  3DXK B;  1VQ4 N;  3E9P A;  4U7B A;  3CQX A;  3MXI A;  3QIP A;  4CJQ A;  5JIC A;  1X9W A;  4XIU A;  4E19 A;  2W6L A;  1C1A A;  3S3M A;  2O8F A;  4FJ7 A;  4PHT X;  1VSI A;  3KLG A;  1E3M A;  4DF4 A;  4DTR A;  3NHG A;  1XQS C;  2B4J A;  5KGX A;  4NCB A;  5AFU H;  3ZSW A;  2G8U A;  4MO4 A;  1U4B A;  2BTF A;  1LWF A;  2WC9 A;  1K8A O;  1JCE A;  4FWK A;  3H08 A;  4YY3 K;  4LF7 K;  2D0O A;  4FLU A;  4H5V A;  1VSF A;  1WSG A;  4PKG A;  3OYM A;  1DT9 A;  3NF7 A;  3AO3 A;  1ATS A;  3OYC A;  4PL8 A;  5LY3 A;  2YHA A;  3HL8 A;  3KK3 A;  3V6D A;  4DTP A;  4FJN A;  4DV3 K;  1SQK A;  1EQY A;  4CVN E;  3T3F A;  3P1G A;  3TAN A;  2P9K B;  4DTN A;  4AQY K;  1NKE A;  3VQ5 A;  3L2Q A;  2Q0R A;  2O8E B;  2Q36 A;  4BQL A;  1LWC A;  4CIE A;  3G6E N;  1N34 K;  3TWH A;  1S1U A;  4QS8 A;  5E26 A;  5LJW A;  1S6Q A;  3P39 A;  4NYF A;  3KJV A;  3P31 A;  1K8K A;  4O4G A;  3RMD A;  2UXB K;  2VQF K;  3MCA B;  1E4G T;  3D0P A;  4Y1D A;  2DFF A;  2B5J A;  3PO5 A;  4FWQ A;  1U04 A;  4BRO A;  1NGJ A;  4CJR A;  2UUB K;  3DJC A;  2AJQ A;  3R3L A;  3SV3 A;  2XO7 A;  1VQ6 N;  3ATV A;  2WFB A;  4JKA A;  4A59 A;  3ZX2 A;  4CGG A;  5CYM A;  3ZT4 A;  4O0I A;  4JNE A;  4CF8 A;  3MWT A;  1NOZ A;  3HVR A;  1FKP A;  1OH6 A;  3L4Q A;  1L3U A;  4CGD A;  1HKB A;  4PUO A;  3NVK A;  3QIO A;  4GKJ K;  2YNH A;  4CES A;  3OTO K;  2HHX A;  3BEX A;  1O13 A;  5JMV A;  3CCJ N;  4ISF A;  3SAG A;  2A1S A;  2GX9 A;  1NGB A;  4FM2 A;  2D0C A;  3THV A;  3HYF A;  1P90 A;  5CE3 A;  1NGG A;  3IFR A;  3OVN A;  3ZT1 A;  4FK4 A;  4F2R A;  4BWM A;  1BG3 A;  5EX5 A;  1YJ9 N;  4BC5 A;  2YJF A;  1QHT A;  2KTQ A;  5JLF A;  5AQS A;  2P9N A;  2YI1 A;  3MMV A;  1HNV A;  1U49 A;  2IIR A;  4HUG A;  3BF1 A;  4B9U A;  5SZT A;  4FJX A;  2BUP A;  4BRD A;  1U47 A;  4FWM A;  1GOC A;  1YVU A;  1C0G A;  2D4W A;  4YDU C;  3BF3 A;  1KRP A;  1HJR A;  5GAD P;  4H0V B;  3C95 A;  4FWP A;  1HRH A;  3K5M A;  1QVF M;  3L8B A;  1A5V A;  5C15 A;  3SBG A;  2E20 A;  1J6Z A;  4AHU A;  4PQU A;  3O4Q A;  1ASU A;  1S1W A;  4KH6 A;  5ADX A;  2NRV A;  2KKZ A;  4DB3 A;  3JS6 A;  1GLJ O;  3AVH A;  2FXU A;  3P38 A;  3QML A;  4XH1 A;  3T7Z A;  4JI3 K;  2UUA K;  4B1Y B;  4PY5 A;  2ZQB A;  4Y1C A;  3CJC A;  5BPN A;  3EL2 A;  1KAZ A;  4A61 A;  2PY5 A;  1XMQ K;  1VQ9 N;  1Q9X A;  4JHD A;  4U67 L;  3HPG A;  3CFR A;  3T1H K;  1TKT A;  3DXM A;  4A5B A;  3VOV A;  1GLE G;  3HOT A;  1JLG A;  1W7A A;  2CGK A;  4IJN A;  2P9U A;  3CC4 N;  3D7E O;  2PZS A;  3D2E B;  3LP3 A;  4CBU A;  4CIG A;  4W5Q A;  2GV9 A;  1S9G A;  2W6K A;  1EXQ A;  3SK3 A;  1BL3 A;  1JKH A;  1JL2 A;  3AVN A;  3BP8 A;  2A5X A;  1WLJ A;  1F21 A;  5DM6 L;  4KTW A;  2QKK A;  4PKI A;  4FJ9 A;  4WE1 A;  3KKS A;  5HRN A;  4MFB A;  4FPA A;  4IFE A;  3VGM A;  1BIU A;  3VEW A;  3UKU B;  4NCA A;  3DLB A;  4FWR A;  3O1B A;  3GL1 A;  5M1F A;  3NVM A;  4I6M B;  4FVM A;  3TU5 A;  3AVF A;  4EAH D;  5BPM A;  3OYA A;  1JLE A;  4CZJ A;  2W42 A;  5FPE A;  1T6D A;  3PY8 A;  4OGC A;  3M5R A;  1VSM A;  2BAN A;  3QBX A;  4DU1 A;  3NFA A;  1IJJ A;  3RMA A;  4OLA A;  4QAG A;  2GEL A;  1UOC A;  2HHV A;  1JCF A;  4RW9 A;  2D1K A;  4DTO A;  2EWS A;  4Z4H A;  4H0P A;  3KWI A;  2JGU A;  5EY4 A;  4XH5 A;  3P4I A;  3OJS A;  3HM8 A;  3WT0 A;  3CQY A;  4DV1 K;  3TTF A;  4WYB A;  1SKR A;  4FM0 A;  4CHZ A;  3DRS A;  1X3N A;  4C1N I;  3DMJ A;  4C1N K;  4DTJ A;  2O8D B;  3FZH A;  3O08 A;  3VTI A;  5LL6 Z;  4ZTF A;  1IKY A;  4M63 C;  1QZ6 A;  3ITH A;  4FWN A;  2YX6 A;  4KH4 A;  4GY2 B;  1BI4 B;  3LPT A;  2ETJ A;  4DWI A;  3DXK A;  4KO0 A;  1TKX A;  4CK3 A;  4DV5 K;  4CGF A;  3CCS N;  4QS7 A;  5AQJ A;  3ZET B;  1GOA A;  3VA3 A;  4BRC A;  4TSX A;  3PX0 A;  1V4T A;  1VQL N;  4FO0 A;  4BRQ A;  3QEI A;  1TUU A;  1SUQ A;  4MLH A;  1XNQ K;  4BDZ A;  1HYZ A;  3LM2 A;  1IG9 A;  2DFE A;  3VES A;  3NGY A;  4IZ9 A;  4DQR A;  1GLD G;  3MDQ A;  4JEP A;  2V7Y A;  4DR3 K;  3M8R A;  5BN8 A;  4JRP A;  4HHT A;  4B3S K;  2G8I A;  1YJN N;  3WNF A;  3EO3 A;  3F2K A;  2E2Q A;  4E7K A;  4DSK A;  3J80 O;  2WTU A;  3AGK A;  4CF1 A;  3TTD A;  3ZT3 A;  3MN6 A;  3UKR B;  4O8K A;  2A3Z A;  1NK5 A;  5C2D A;  4YOR A;  3CG7 A;  4M7Y A;  4E1J A;  4BDY A;  2O4I A;  4RG8 A;  1D9D A;  2HBK A;  1ILY A;  1TGO A;  3LWL A;  3QER A;  3AA5 X;  2JWL A;  2AA4 A;  3THY B;  2XY6 A;  3L2V A;  4WQ4 C;  4JAX A;  1KVA A;  4DR6 K;  3CD6 N;  2JLE A;  3VEZ A;  1C0M A;  3ENH A;  1VQO N;  4AH9 A;  1S1X A;  4CZI A;  2RPI A;  1S1V A;  3FFI A;  5HBM A;  1C6V A;  3SBT A;  3RRG A;  4RTF D;  3SNN A;  3SQ2 A;  1QQC A;  4JKB A;  5I3U A;  2KHO A;  4JKC A;  1HYS A;  3D2F A;  2F9T A;  1JLQ A;  3CYM A;  3QET A;  1M90 O;  3MXJ A;  4M3W A;  4BRI A;  2A42 A;  1ATR A;  4BRH A;  4IEE A;  1Z25 A;  4EP4 A;  4FOE A;  2O8C B;  1X1P A;  1RT5 A;  3TAR A;  1D5A A;  1WOQ A;  1ZBS A;  3FZM A;  4GVE A;  1XHX A;  4YOX A;  4B9V A;  1X9J A;  4KBO A;  3HP6 A;  2NNW A;  2Y1J A;  2OPQ A;  3SUN A;  4FXD A;  1UA0 A;  1HKC A;  3HI0 A;  2YCH A;  2VQE K;  1IKV A;  3DOL A;  3RWU A;  3FZF A;  3H3O B;  4CJE A;  1WN7 A;  3BZC A;  2IVN A;  3O4W A;  5D3G A;  2E6L A;  3Q7C A;  2Q97 A;  3QEP A;  4FLV A;  3OHR A;  4B9S A;  4BE2 A;  4CGH A;  1S5J A;  3OBY A;  4CD3 A;  4R79 A;  1RT6 A;  3VF4 A;  4L8R B;  1WBB A;  2FF3 B;  3DOK A;  4XEI A;  3THX B;  3L6Q A;  3CPW M;  1VSK A;  1RBS A;  1J54 A;  2DFH A;  3DRP A;  5JS1 A;  2UUC K;  1NGA A;  5GIP A;  4CZE A;  1XHZ A;  1TVR A;  4WFB L;  2GBZ A;  3E1Y A;  1ZBF A;  2VCP A;  3GDQ A;  1HPZ A;  4DF8 A;  1IKW A;  3OYI A;  4JD2 B;  1LAW A;  1JLA A;  3WXL A;  2VGN A;  3VQ6 A;  5LMN K;  3VQE A;  2ZJQ L;  4FJK A;  5AQU A;  4DUZ K;  2UXD K;  3MCP A;  3O4N A;  3AVC A;  5JVG L;  1LW2 A;  3PSI A;  4FJG A;  4GKK K;  4NCG A;  4DLE A;  3J7A P;  1B92 A;  3VQ8 A;  4IO8 A;  4B1X B;  1NGH A;  4C23 A;  2HVI A;  4KHU A;  3NH1 A;  4BRM A;  2QWP A;  2ITG A;  3PSF A;  5BN9 A;  1TV6 A;  3VQC A;  2O4G A;  1LW0 A;  3M1F A;  3DLE A;  1RTH A;  1K73 O;  2FSN A;  3S9H A;  1VQM N;  4DCH A;  4OO1 J;  3QIC A;  5JS2 A;  2G8K A;  3L2R A;  4Z94 A;  4CFB A;  3CCV N;  3BUZ B;  2OPR A;  3ZEU B;  1RT4 A;  3VET A;  1IV0 A;  1Z26 A;  2YNI A;  4X66 K;  5HOO A;  4BGA A;  4IXC A;  2KFZ A;  2HHU A;  4X65 K;  2F8T A;  3DI6 A;  2YHB A;  3KTQ A;  5HRS A;  2E4L A;  2FSK A;  4GV6 A;  4BDP A;  4LF6 K;  4O5B A;  4O44 A;  3O9Q A;  1RT2 A;  4ILJ A;  3TSQ A;  1ATN A;  5KQ8 A;  3UKU A;  4BRN A;  1RBR A;  4CZF A;  2Z1H A;  4B9L A;  2WON A;  3OYL A;  2UXC K;  1EX4 A;  3ISN C;  4LSL A;  2QWO A;  5IT9 O;  4KHS A;  4FL9 A;  3EE8 A;  4I6M A;  4E3S A;  3R6M A;  3SUQ A;  1NK9 A;  3PIP L;  4GV9 A;  3RR7 A;  2E2O A;  4OPA A;  1BCM A;  1KVB A;  1W0H A;  3AGR A;  4CHN A;  5DM7 L;  3OYJ A;  3C0B A;  4FM1 A;  2HST A;  4MO5 A;  5C12 A;  4V19 S;  5GIN A;  2QXL A;  1TKD A;  1VRU A;  3SI6 A;  4FLZ A;  1ASV A;  4K42 A;  3TAM A;  4I2P A;  1BCO A;  1RIL A;  1EO1 A;  4LFB K;  4KI6 A;  1L5U A;  4DV4 K;  3KK7 A;  4DKW A;  3ULE B;  1WAJ A;  2ZM6 K;  2BE2 A;  3FE1 A;  3S3N A;  3PUF A;  4ELT A;  3V1O A;  3AAQ A;  3F9M A;  4WF9 L;  1OKJ A;  3U3G A;  4CFC A;  4OPJ A;  2E5L K;  4C8K A;  3RMB A;  4HCB A;  3K59 A;  3E01 A;  3H46 O;  1IG8 A;  4CZL A;  3WXI A;  4QS9 A;  3VPZ A;  1BI4 A;  4NLC A;  4M3R A;  1ZXO A;  3CJ1 A;  4NXM K;  1MWK A;  3D45 A;  3CC2 N;  3QEV A;  4JK9 A;  4F8R A;  3RSE A;  2HBL A;  4BR9 A;  4DS5 A;  4CED A;  4YDU A;  4H5W A;  5KQD A;  4Y0W A;  3DYA A;  5GAH P;  1EWQ A;  2FBV A;  4BVO A;  3I55 N;  2P9L A;  1SKW A;  4CHP A;  4FZX C;  4OX9 K;  2FC0 A;  3ZSR A;  1VSJ A;  1S22 A;  2ZJR L;  1DTQ A;  1L3V A;  2VGM A;  3ZSV A;  4B9T A;  4B1W B;  3I8D A;  3CJB A;  3K0S A;  1ZBU A;  3S3O A;  3WNG A;  2A6A A;  1XI1 A;  4KRE A;  1YUW A;  4IJA A;  3AA4 A;  3L2W A;  1HNI A;  4R5P A;  4IBN A;  4CEF A;  4FSV A;  2OTJ N;  3JAM O;  3WNH A;  4YOV A;  4C8L A;  3C65 A;  3HTV A;  1SKS A;  2FBT A;  1KD1 O;  4FWS A;  4CJS A;  4BG9 A;  5AQL A;  2HHH K;  4IOX A;  4DG1 A;  3K5L A;  5BRH A;  1LAV A;  1SL2 A;  3AAP A;  4DSJ A;  1NJZ A;  3BDP A;  4IEI A;  5EOY A;  5CYQ A;  5KPR A;  2CH6 A;  4CW7 B;  3O9T A;  1QS4 A;  2UU9 K;  2BH1 A;  2P9P A;  3UIQ A;  3VQQ A;  2BDP A;  3V9W A;  3LDO A;  4Z4C A;  2EX3 A;  2QEX N;  3WNE A;  1ZBH A;  3D6R A;  3KK1 A;  3ZSZ A;  1Y64 A;  5AQX A;  4CZM A;  1Q82 O;  1TKZ A;  4ICL A;  4E7L A;  3JXU A;  2NZT A;  2QW9 A;  1SZ2 A;  1Q86 O;  4OPH A;  1UWB A;  3PO4 A;  3H1V X;  5BR9 A;  4FOI A;  2O8C A;  3MEC A;  5ADX H;  3KLF A;  3HOS A;  3O8M A;  3CPE A;  3U3Y A;  4O0J A;  2HBM A;  5CR4 A;  4CF2 A;  1N33 K;  4Z4G A;  4GV3 A;  1IBL K;  4JS4 A;  1VSD A;  5B8H A;  5I42 A;  2Q31 A;  5KGW A;  1CXU A;  5FPD A;  2E2P A;  4CD1 A;  4BRE A;  4KB0 A;  1XUP O;  4CK2 A;  4JI7 K;  4CBX A;  3DLG A;  1BUP A;  4M41 A;  3MEG A;  4DR1 K;  2D0A A;  4RW6 A;  4CEB A;  5IWA K;  3TTC A;  3AY9 A;  5H1S Q;  1BIS A;  4NYN A;  1RDD A;  3VEO A;  1RDA A;  3THX A;  1VQ8 N;  4CEO A;  3AVI A;  3CHW A;  4IKF A;  1GLC G;  4JLH A;  1U2V B;  1QQN A;  2ITM A;  3HST B;  1YF5 L;  3FR0 A;  3LDQ A;  3KVG A;  1HJO A;  3KIO A;  3WUH A;  4JD2 A;  5AQF A;  1U48 A;  1VSE A;  4DTS A;  4BR4 A;  3VF2 A;  1NBW A;  3TAE A;  4PA1 A;  1VAZ A;  4L3Q A;  4OVL A;  1IH7 A;  2VYP A;  1Q7Y O;  4XH4 A;  1TK5 A;  3Q7B A;  2E1Z A;  3KWG A;  4W5T A;  4CEQ A;  4MDA A;  1KFD A;  5AQP A;  1N8R O;  1Z6R A;  1V4S A;  1C0T A;  4BC4 A;  3QFU A;  3CCQ N;  3HM9 A;  2IS3 A;  3CQ8 A;  4FJM A;  4AHT A;  1KLN A;  1RDW X;  5TKY A;  3K9K A;  1YXQ A;  4F3T A;  4DFM A;  1C1B A;  2HB5 A;  1E4F T;  3N4P A;  3NCI A;  4M7X A;  2NUB A;  3M6G A;  1S6P A;  1W97 L;  4YOY A;  3SQ4 A;  5AQM A;  3O9R A;  4DQP A;  2F4V K;  1TYQ B;  4CJV A;  3I33 A;  2DPN A;  3L2U A;  1RGI A;  1HKG A;  3VEN A;  1T05 A;  2R7Y A;  2IGI A;  3KKR A;  4CEZ A;  1RBV A;  2YKN A;  2ZD1 A;  3TSU A;  3HBT A;  4GVM A;  4J2A A;  2QKB A;  2DY4 A;  5HRP A;  4EP5 A;  4ZTJ A;  2P9S B;  3KD5 E;  4WQ4 A;  4BRG A;  1S72 N;  1HNX K;  1ZC6 A;  4O8U A;  4PWD A;  3ID6 A;  4K8Z A;  1RTD A;  4DTM A;  4DHY A;  3LP2 A;  3VQ4 A;  5HLF A;  1O1W A;  4O5F A;  2F9W A;  1JCG A;  3DAW A;  4FWO A;  5HL7 L;  4LFC K;  5AQR A;  3MK6 A;  3C7N B;  4IDK A;  4AM7 A;  2HOE A;  3DRR A;  3QLH A;  1DGK N;  4BVP A;  1I39 A;  2B6A A;  1KSP A;  4DU4 A;  5M1K A;  2W40 A;  2P9I A;  5FPN A;  4FWL A;  4KB1 A;  4JKE A;  2Z1I A;  5GAE P;  3ZSQ A;  5CZ2 A;  1BIZ A;  2VWJ A;  4CJT A;  4CCH A;  2QWQ A;  4NO7 A;  2HMP A;  1NJX A;  4CJ4 A;  4FJ8 A;  4DQQ A;  1OH7 A;  4AHV A;  4CHY A;  3EZ5 A;  4E7I A;  1JLB A;  3C94 A;  4JKH A;  2OYQ A;  4CBW A;  4B08 A;  4AF1 A;  2NRR A;  3CC7 N;  3U9Z A;  2KQ2 A;  3WXM B;  1JLF A;  3HXM A;  4F4K A;  4DMN A;  2QWN A;  4KHW A;  1IBK K;  1G15 A;  4KKO A;  3LAN A;  4JI0 K;  4FK2 A;  1QTM A;  1J53 A;  4B9N A;  3B6P A;  3NDK A;  1N5Y A;  4YOW A;  1NMD A;  3LP0 A;  4IG3 A;  4J2B A;  3AO5 A;  1D4X A;  4A2B A;  3VTH A;  4BR7 A;  3O3H A;  5AJ3 K;  1L3S A;  2P9K A;  3TAG A;  4DFK A;  1RTI A;  5BRF A;  3C6H A;  1YT3 A;  4WFA L;  2HMI A;  4Z4E A;  2O8E A;  4IO9 L;  1HMV A;  1VQK N;  4GNI A;  4FJL A;  1GLF O;  5M1P A;  4JS5 A;  3NH2 A;  3AVG A;  1KAX A;  4CF0 A;  4F9O A;  4FJ5 A;  1NM1 A;  2RHK A;  4UY8 O;  3C6T A;  4CF9 A;  4CGJ A;  1NK6 A;  3DLH A;  3SPZ A;  3LZJ A;  4Q0B A;  4PKH A;  2OAN A;  1BWF O;  2OPS A;  5C0Y A;  4AHR A;  1WSF A;  2KLA A;  2Q2R A;  2QWM A;  1W2B M;  3SAH A;  5HRR A;  2YJE A;  1N36 K;  5FPM A;  4K41 A;  3CM6 A;  1NK4 A;  5CZ1 A;  4CJP A;  3HP9 A;  5C2F A;  4A2A A;  4Z4I A;  5CY4 A;  3CM5 A;  3HT3 A;  5KRT A;  4B1U B;  3CCL N;  1KXP A;  3M8P A;  3JSM A;  4OJR A;  1J9A A;  4PL7 A;  3I0S A;  4DSE A;  3A5M C;  4H0X B;  1QHA A;  1YHQ N;  1LV5 A;  4FJH A;  4KHP K;  4DTX A;  3SZ2 A;  3A5L C;  4B3T K;  2RKI A;  5I9E B;  4DU3 A;  4CIF A;  4B3O A;  1P8Z A;  3PLA A;  4KPY A;  3TAQ A;  1VSH A;  4DS4 A;  1CLQ A;  1ASW A;  4J2E A;  3U8X A;  2KZM A;  4JYA K;  4KAZ A;  3AV9 A;  3LPU A;  3QNO A;  1HR0 K;  4KHQ A;  3A8Y A;  3SUO A;  2PYJ A;  1NLV A;  3H6E A;  3HPO A;  4LF8 K;  1GOB A;  3FGU A;  4K25 A;  5AQG A;  3VER A;  3O1W A;  4DV6 K;  3CIP A;  1RT3 A;  2OPP A;  4ID5 A;  4LD0 A;  4HUF A;  4B9M A;  2ZWH A;  4LF4 K;  3SPY A;  5BPL A;  4AM6 A;  4LF5 K;  2VWB A;  5F1X A;  3FFK B;  3LDP A;  3VEY A;  3KHY A;  2I5J A;  3O80 A;  3QO9 A;  4JHD B;  2HHQ A;  4CJF A;  4JKD A;  2Q0U A;  4CER A;  3F5T A;  3DXM B;  4Z0U A;  4NXN K;  4C8O A;  2YHY A;  1REV A;  3IRX A;  2P1J A;  3R9P A;  3ATU A;  3K2P A;  1NKC A;  3CF5 L;  3ENB A;  3VEV A;  2D0B A;  1TL1 A;  2XRI A;  3AVB A;  3MX5 A;  2P9U B;  3TSP A;  4EFH A;  4KI4 A;  4H0T B;  2V51 B;  5LMU K;  1EET A;  1BGX T;  5HP1 A;  4DV7 K;  3M8Q A;  4H5T A;  4OKJ A;  4LC9 B;  4KTQ A;  5FRN A;  4LY7 A;  3IKM A;  1U2V A;  2I7N A;  3WEE B;  1NMN A;  3ALY A;  5AZI B;  3K58 A;  4DSI A;  4FLW A;  3D2E A;  5M1O A;  3NGZ A;  3L0Q A;  5K14 A;  4RW4 A;  3NGI A;  1VK0 A;  1A5X A;  1C0U A;  2AP1 A;  3LDS A;  1J5O A;  1WSI A;  1OH8 A;  3DLR A;  4ELU A;  1KVC A;  1NK7 A;  4FLY A;  1VHX A;  4A57 A;  4DR4 K;  4FJJ A;  3HJF A;  5JLH A;  4CJU A;  4FLX A;  2IAJ A;  4E1N A;  1KC8 O;  2HND A;  5JVH L;  4YOT A;  1QSS A;  1VRT A;  4FW2 A;  2E1Y A;  2GUP A;  4JKF A;  4N47 A;  1T7P A;  2O8B B;  1HPM A;  4EHU A;  1KCF A;  1JXE A;  2FBX A;  4LH4 A;  4BR5 A;  3SUP A;  2UYT A;  3NF6 A;  3KD1 E;  4EIA A;  1WUA A;  1QSL A;  4M45 A;  1JXB A;  5T7B A;  3KLH A;  3THW B;  1HYV A;  3QDK A;  2V52 B;  4H0O A;  1N6Q A;  4M3T A;  2YKM A;  1YIJ N;  1HQE A;  4HUE A;  3ZSO A;  4EHT A;  2VG5 A;  4IWV A;  2I7P A;  1HQU A;  3MN5 A;  4B1Z A;  1EWR A;  3LDL A;  1EKE A;  3T69 A;  3K5N A;  2LSN A;  5DMR A;  3J7Y P;  2G8F A;  4CE9 A;  4CJL A;  3A0I X;  3QIN A;  1NK0 A;  1MU2 A;  5J2M A;  4FVU A;  3QFP A;  2HBJ A;  5E41 A;  2VG6 A;  4HTL A;  1BQM A;  4JI5 K;  1S1T A;  5EU7 A;  5BRD A;  1YTU A;  1RBT A;  4JN4 A;  1K6Y A;  2HF3 A;  3ID8 A;  2Q1N A;  1KFS A;  5E84 A;  1T6C A;  2Q3S A;  3TAP A;  3SAF A;  5EVZ A;  3VQD A;  2O8D A;  4YOU A;  3C7N A;  2NRW A;  4B8C A;  4ISE A;  3N4Q A;  1NJW A;  2NRX A;  1FKO A;  1B9F A;  3F9K A;  1JL1 A;  3SCX A;  1ZBI A;  3DLL L;  4I9L A;  3CME N;  4G9Z A;  4CHQ A;  5GIO A;  3CCR N;  5AQH A;  1T44 A;  2D5R A;  3M3Z A;  2W41 A;  3MED A;  3JYT A;  3ZET A;  4DFP A;  2WOM A;  5EXW A;  1HNW K;  1RCH A;  2XY5 A;  5AQI A;  1QQM A;  3QB0 A;  3ULD A;  2P5O A;  3HRG A;  1NK8 A;  3ZLJ A;  3I56 N;  2H3G X;  4MDB A;  4BRA A;  2G8H A;  1WB9 A;  3ZSY A;  3ZCM A;  4BAC A;  4RWT A;  4DQ8 A;  3VQ9 A;  4E0D A;  3B8A X;  1N32 K;  4CJ3 A;  1I94 K;  1MDU B;  4H4O A;  2ZGZ A;  4H8K A;  3LAM A;  3LWM A;  4JV5 K;  4WFN L;  4K0K K;  3IS9 A;  5AFU A;  5AQY A;  4LSN A;  3UKR A;  1GLB G;  5AZJ B;  1KLM A;  2JWK A;  3AVA A;  4CGI A;  4WQ5 C;  1FXX A;  1OVQ A;  1XC3 A;  2FF6 A;  3VQ7 A;  5J2P A;  4IOA L;  3VQB A;  3K9J A;  4DFJ A;  3P5J A;  3THY A;  3SQ0 A;  4BRP A;  1XWL A;  1FW6 A;  3CXC M;  3D2F B;  1RDB A;  3CER A;  3H45 C;  3V1R A;  4B9Q A;  4EZ6 A;  3HK2 A;  3GE1 A;  1A5W A;  5ELZ A;  2BGG A;  4CJW A;  4OPK A;  3NMU A;  2X74 A;  3A5O C;  1Q8I A;  5KPT A;  4C8N A;  4JK7 A;  4FK0 A;  2CGL A;  3PIO L;  2QWL A;  4CFA A;  2NLX A;  1DTT A;  5AQO A;  5M1Q A;  2PBD A;  4N56 A;  3V9U A;  3WQU A;  1VQP N;  1YTA A;  4OLB A;  4B3R K;  2CGJ A;  3OA9 A;  1HX1 A;  4FW1 A;  3ZT0 A;  4BR2 A;  5FRM A;  4I7F A;  1S9E A;  1IKX A;  2VG7 A;  2FSJ A;  3G71 N;  4B8A B;  4H4M A;  3KLE A;  1R0A A;  1BOT O;  4GW6 A;  3FLC O;  1NJI O;  1B9D A;  3PX6 A;  4B3M K;  3AA3 A;  5AQN A;  4CEC A;  4HWI A;  3G25 A;  5MLC Q;  3U4L A;  3DLK A;  3QEX A;  5FRO A;  2D0P A;  1DLO A;  1MWM A;  2GEM A;  1SL0 A;  2F8S A;  4FLT A;  1WSE A;  4JKG B;  4C8M A;  4CK1 A;  4CZK A;  1CZA N;  3TR8 A;  2KZZ A;  1XMO K;  3PX4 A;  3LL3 A;  3OS1 A;  2KW4 A;  4IDH A;  4IG0 A;  3OJU A;  4BQZ A;  3UE5 A;  2GTD A;  2XY8 A;  1ZYQ A;  3O6W A;  1QQO A;  3E66 A;  3SJJ A;  4KV8 A;  3EN9 A;  4BRF A;  1H1V A;  1WAF A;  4K8X A;  1SV5 A;  1BO5 O;  2IVO A;  3O3G A;  2F96 A;  3AAR A;  1RTJ A;  3TI0 A;  2ASO A;  2E6M A;  3OYH A;  3W0L A;  5BR8 K;  3I0R A;  1FJG K;  2WBN A;  3HO1 A;  3ZYY X;  4BGB A;  2E2N A;  2HVH A;  5KPZ A;  1FK9 A;  3A2F A;  3CCE N;  3HSC A;  2ASM A;  2HW3 A;  1NWK A;  2VWK A;  4IOC L;  3CJ9 A;  2E88 A;  4CJ5 A;  3SMP A;  2NRH A;  2PYL A;  4BE1 A;  1YIT N;  4KFB A;  2Z1G A;  4BRL A;  4W5N A;  3KK2 A;  4KTZ A;  2E8A A;  3LAK A;  1RDC A;  3AO1 A;  3UB5 A;  3CI5 A;  1MA9 B;  5AQT A;  3AA2 A;  4N5S A;  4ILG B;  4LH5 A;  3WEE A;  4CEE A;  4Z4F A;  1WBD A;  4KH5 A;  5AZI A;  1JJ2 M;  4HCC A;  1S3X A;  3ZT2 A;  4QOZ B;  3ZEU A;  4FZZ A;  4FZY A;  5C25 A;  3NBP A;  1ESV A;  1YAG A;  4A5A A;  2EHG A;  3LM9 A;  3WXK A;  3OBW A;  5GAG P;  4FJI A;  1K9M O;  4DUY K;  4DSL A;  1TUY A;  4J2D A;  4LF9 K;  4CJ7 A;  3A5N C;  3V4I A;  3TAB A;  3F73 A;  5C42 A;  3IUC A;  3AVL A;  3OYN A;  1WSJ A;  4OKK A;  4HVJ A; 
#chains in the Genus database with same CATH homology
 4CF8 A;  5CZ1 A;  4CJP A;  3HP9 A;  2WON A;  3OYL A;  2X6S A;  4Z4I A;  5C24 A;  1JLC A;  2FBY A;  1NOZ A;  5CY4 A;  3HVR A;  1FKP A;  1EX4 A;  3CM5 A;  3ISN C;  3HPH A;  4ID1 A;  4LSL A;  1UAX A;  5KRT A;  3HT3 A;  1L3U A;  4CGD A;  4PUO A;  3M8P A;  4KHS A;  4E7J A;  3QIO A;  2YNH A;  4CES A;  3JSM A;  2HHX A;  4E3S A;  3G0Z A;  3SUQ A;  2YNF A;  4OJR A;  4AHS A;  1U45 A;  1NK9 A;  1J9A A;  4OGE A;  3I0S A;  3RR7 A;  2HHW A;  4DSE A;  1BCM A;  1KVB A;  2A1S A;  1W0H A;  4O55 A;  4CHN A;  4FM2 A;  3MAQ A;  2D0C A;  3THV A;  3OYJ A;  1LV5 A;  3HYF A;  4FJH A;  3IG1 A;  4FM1 A;  4DTX A;  3SZ2 A;  3OVN A;  3ZT1 A;  5J1E A;  1TKD A;  3LP1 A;  4FK4 A;  1VRU A;  2RKI A;  3SI6 A;  4BWM A;  3OS2 A;  1ASV A;  4FLZ A;  4DU3 A;  4F2R A;  4CIF A;  4B3O A;  4CHO A;  3TAM A;  4G1Q A;  4KPY A;  1QHT A;  1VSH A;  1BCO A;  1Y97 A;  1RIL A;  4I2P A;  4W5O A;  4DS4 A;  3TAQ A;  1ASW A;  2KTQ A;  1CLQ A;  3RMC A;  4J2E A;  1HNV A;  1U49 A;  4KI6 A;  2HHS A;  4HUG A;  4B9U A;  2KZM A;  5SZT A;  3TAF A;  1L5U A;  4FJX A;  3NE6 A;  3V9X A;  1U47 A;  4KAZ A;  5SWM A;  3AV9 A;  2X78 A;  3LPU A;  3QNO A;  4KHQ A;  3SUO A;  1GOC A;  2PYJ A;  3HPO A;  4F3O A;  1TAU A;  1YVU A;  1WAJ A;  1GOB A;  3HVT A;  3EY1 A;  2BE2 A;  3S3N A;  1KRP A;  1HJR A;  4RW8 A;  3OYF A;  3PUF A;  5FDL A;  3OYG A;  1D8Y A;  1RT3 A;  4ELT A;  3NF8 A;  3V1O A;  2OPP A;  4ID5 A;  4LD0 A;  3U3G A;  3C95 A;  4CFC A;  4JRQ A;  3K5M A;  1HRH A;  4OPJ A;  3LZI A;  4HUF A;  1XC9 A;  4B9M A;  3L8B A;  1A5V A;  3SPY A;  4C8K A;  3RMB A;  3BGR A;  4HCB A;  3EYZ A;  4AHU A;  3K59 A;  3O4Q A;  3E01 A;  1ASU A;  2I5J A;  4PQU A;  3QO9 A;  2P5G A;  1S1W A;  3MEE A;  1TK8 A;  1BI4 A;  2HHQ A;  1VSL A;  4M3R A;  3T19 A;  4CJF A;  4CER A;  3AVH A;  4YNQ A;  4Z0U A;  4PY5 A;  4C8O A;  1REV A;  3IRX A;  2ZQB A;  2P1J A;  4Y1C A;  1ZBL A;  2PY5 A;  3D45 A;  3K2P A;  1NKC A;  5KI6 A;  3QEV A;  4F8R A;  1I3A A;  1Q9X A;  3VQP A;  3HPG A;  3CFR A;  4Q5V A;  2D0B A;  1TL1 A;  1TKT A;  2XRI A;  3AVB A;  4DS5 A;  4CED A;  4KHN A;  4KI4 A;  4ZHR A;  1EET A;  1BGX T;  5HP1 A;  1JLG A;  1CZB A;  3DYA A;  3M8Q A;  4IFV A;  3OYD A;  4OKJ A;  4KRF A;  4KTQ A;  2FBV A;  1SKW A;  1WSH A;  5FRN A;  4IFY A;  4LY7 A;  4CHP A;  2PZS A;  4FZX C;  4M3U A;  2FC0 A;  1BQN A;  3ZSR A;  1VSJ A;  1L3V A;  1DTQ A;  2RN2 A;  3LP3 A;  3ALY A;  3ZSV A;  4CIG A;  4W5Q A;  3K58 A;  2GV9 A;  4B9T A;  3I8D A;  1S9G A;  4DSI A;  1EXQ A;  3ASM A;  1ZBU A;  1BL3 A;  2X6N A;  4M3X A;  3RTV A;  1JKH A;  3S3O A;  3WNG A;  3AVN A;  1JL2 A;  4FLW A;  1WLJ A;  3K57 A;  3NGZ A;  4DTU A;  1F21 A;  1XI1 A;  5K14 A;  4KTW A;  4RW4 A;  4BE0 A;  4KRE A;  3NGI A;  1VK0 A;  2QKK A;  2OZM A;  1A5X A;  1C0U A;  4FJ9 A;  4WE1 A;  3KKS A;  1WSI A;  5HRN A;  3OYK A;  3LDS A;  3MXM A;  1J5O A;  4M42 A;  3AA4 A;  3L2W A;  1HNI A;  3DLR A;  4MFB A;  4R5P A;  1KVC A;  4ELU A;  4IBN A;  1UA1 A;  4CEF A;  1BIU A;  1NK7 A;  4DQI A;  4FLY A;  3WNH A;  4DLG A;  4C8L A;  1SKS A;  4E7H A;  4NCA A;  2FBT A;  4FJJ A;  3VQA A;  3HJF A;  4CJS A;  4CJU A;  3DLB A;  4I2Q A;  3AO4 A;  4FLX A;  4W5R A;  2G8W A;  2IAJ A;  4DG1 A;  4E1N A;  2HND A;  3K5L A;  1QSS A;  1VRT A;  1LAV A;  4FW2 A;  1SL2 A;  4DSJ A;  2XY7 A;  1NJZ A;  1T03 A;  3BDP A;  4N47 A;  3CFP A;  1T7P A;  4N41 A;  3SV4 A;  1KCF A;  1JXE A;  2FBX A;  4FVM A;  4LH4 A;  3AVF A;  5CYQ A;  3SYZ A;  3V9S A;  4FYD A;  2DTU A;  3OYA A;  1JLE A;  2W42 A;  1QS4 A;  3SUP A;  4GMJ B;  3UIQ A;  3NF6 A;  2HNY A;  3PY8 A;  4OGC A;  3VQQ A;  2BDP A;  3KD1 E;  3V9W A;  2XHB A;  1VSM A;  2BAN A;  4Z4C A;  1C1C A;  2EX3 A;  3WNE A;  1ZBH A;  1QSL A;  4M45 A;  1JXB A;  3P83 D;  5T7B A;  4DU1 A;  3VA0 A;  3KLH A;  3NFA A;  3KK1 A;  1HYV A;  3CFO A;  3ZSZ A;  3RMA A;  4OLA A;  1TKZ A;  4ICL A;  3U6F A;  4E7L A;  1N6Q A;  4M3T A;  2YKM A;  4QAG A;  2OA8 A;  2IC3 A;  1UOC A;  2HHV A;  1HQE A;  3QNN A;  1UWB A;  4RW9 A;  4DTO A;  4HUE A;  3IAY A;  3PO4 A;  3ZSO A;  4Z4H A;  1EP4 A;  2VG5 A;  1HQU A;  2JGU A;  1EKE A;  3OJS A;  3K5N A;  3DM2 A;  2LSN A;  5DMR A;  3MEC A;  3KLF A;  4CE9 A;  4CJL A;  2G8F A;  3B6O A;  3QIN A;  1NK0 A;  1MU2 A;  5J2M A;  4I9Q A;  1SKR A;  3U3Y A;  4O0J A;  4FM0 A;  4CF2 A;  4CHZ A;  3DRS A;  5E41 A;  2VG6 A;  5J2Q A;  4Z4G A;  5JS1 A;  1BQM A;  3DMJ A;  4DTJ A;  1S1T A;  5EU7 A;  1YTU A;  1NJY A;  1RBT A;  4AIL C;  4JS4 A;  1K6Y A;  2YNG A;  4ZTF A;  1KFS A;  4F2S A;  4UQG A;  5HRO A;  1VSD A;  5I42 A;  1IKY A;  4CJK A;  2Q3S A;  3V81 A;  3TAP A;  2OZS A;  5KGW A;  3ITH A;  3VQD A;  1CXU A;  1CZ9 A;  3OYB A;  4B8C A;  2G8V A;  2QXF A;  2IDO A;  4DQS A;  1BI4 B;  5J2N A;  4BWJ A;  3LPT A;  1NJW A;  2ETJ A;  4DWI A;  4KB0 A;  3G10 A;  1Q9Y A;  4KO0 A;  1FKO A;  1TKX A;  1B9F A;  3F9K A;  4CEA A;  4CK2 A;  4CK3 A;  4ELV A;  1JL1 A;  4CGF A;  3SCX A;  1ZBI A;  4I9L A;  3DLG A;  1GOA A;  3VA3 A;  4M41 A;  3MEG A;  4CHQ A;  4YFU A;  4TSX A;  2D0A A;  1W9H A;  1TAQ A;  4RW6 A;  3PX0 A;  4CEB A;  1L3T A;  1RT7 A;  2QK9 A;  2D5R A;  3MED A;  3JYT A;  3QEI A;  1BIS A;  1SUQ A;  3OYE A;  1X9S A;  4NYN A;  2WOM A;  4BDZ A;  1RDD A;  4DFP A;  1RDA A;  1RCH A;  1HYZ A;  4FCY A;  1T8E A;  3ZSX A;  2XY5 A;  3K5O A;  3RRH A;  1IG9 A;  4CEO A;  3AVI A;  2DFE A;  2IOC A;  3NGY A;  1IO2 A;  4HTU A;  4DQR A;  4IKF A;  4JLH A;  3ULD A;  2P5O A;  3M8R A;  1NK8 A;  3M8S A;  3L3U A;  4JRP A;  3HST B;  4HHT A;  3L3V A;  2G8H A;  3KIO A;  3ZSY A;  3ZCM A;  4BAC A;  2G8I A;  3WNF A;  3VQ9 A;  1ITG A;  1U48 A;  3RR8 A;  1VSE A;  4E0D A;  4E7K A;  3NAE A;  4CJ3 A;  4DSK A;  4H4O A;  4DTS A;  3VN5 A;  4CF1 A;  3TAE A;  4PA1 A;  4CFD A;  3ZT3 A;  4H8K A;  2A1R A;  4OVL A;  1IH7 A;  3AVJ A;  3LAM A;  1TK5 A;  3LWM A;  4W5T A;  4CEQ A;  3OY9 A;  2HHT A;  1KFD A;  1NK5 A;  4OKE A;  3CG7 A;  3IS9 A;  1TL3 A;  5KRS A;  4BDY A;  4KHY A;  2O4I A;  4RG8 A;  4QCL A;  1D9F A;  1D9D A;  4LSN A;  1TGO A;  3V1Q A;  3LWL A;  1C0T A;  3QER A;  1KLM A;  3AO2 A;  3AA5 X;  1KTQ A;  3HM9 A;  2IS3 A;  3CQ8 A;  4FJM A;  3AVA A;  4AHT A;  1TK0 A;  4CGI A;  3OS0 A;  2XY6 A;  4DSF A;  1NK4 A;  1FXX A;  1KLN A;  2YV0 X;  3L2V A;  4RW7 A;  3VQ7 A;  4F3T A;  5J2P A;  1NOY A;  1SL1 A;  1KVA A;  4DFM A;  4M3Y A;  1C1B A;  2HB5 A;  3SQ1 A;  2JLE A;  3NH0 A;  2ATQ A;  1C0M A;  3PV8 A;  3VQB A;  4AH9 A;  3NCI A;  1S1X A;  2NUB A;  3O3F A;  3P5J A;  4DFJ A;  3SQ0 A;  1XWL A;  2RPI A;  1S1V A;  2P51 A;  2GUI A;  3FFI A;  5HBM A;  1RDB A;  1S6P A;  1C6V A;  1QSY A;  3SQ4 A;  3RRG A;  3V1R A;  1QE1 A;  4EZ6 A;  3SNN A;  4DQP A;  3HK2 A;  3SQ2 A;  1QQC A;  1A5W A;  1RNH A;  1NKB A;  4CJV A;  3L2U A;  2BGG A;  5I3U A;  4CJW A;  4OPK A;  4EZ9 A;  3AVK A;  1HYS A;  2X74 A;  1WNS A;  3KLI A;  1T05 A;  1Q8I A;  1RT1 A;  1JLQ A;  2R7Y A;  3CYM A;  2IGI A;  4C8N A;  4FK0 A;  3KKR A;  3QET A;  4CEZ A;  4CFA A;  1RBV A;  3MXJ A;  5KTQ A;  2YKN A;  2ZD1 A;  4E89 A;  4M3W A;  4GVM A;  1DTT A;  4MQ3 A;  4J2A A;  2QKB A;  2Y1I A;  2DY4 A;  5HRP A;  4N56 A;  3V9U A;  1Z25 A;  4EP5 A;  4EP4 A;  4ZTJ A;  1YTA A;  3KD5 E;  1RBU A;  1X1P A;  1RT5 A;  4OLB A;  4AHC A;  3TAR A;  1D5A A;  3ZT0 A;  4FW1 A;  3AVM A;  3V9Z A;  4PWD A;  3QEW A;  2ZE2 A;  4K8Z A;  3QES A;  4I7F A;  5FRM A;  1CXQ A;  1RTD A;  4M3Z A;  4DTM A;  1S9E A;  1XHX A;  1IKX A;  2VG7 A;  2HNZ A;  3LAL A;  3LP2 A;  3VQ4 A;  5HLF A;  3HP6 A;  4B9V A;  4B8A B;  1O1W A;  2Z1J A;  4H4M A;  3KLE A;  2Y1J A;  1R0A A;  2OPQ A;  3SUN A;  4FXD A;  4GW6 A;  1BHL A;  2RF2 A;  3C6U A;  3NF9 A;  1X9M A;  1UA0 A;  3T1A A;  1B9D A;  3PX6 A;  2KFN A;  3AA3 A;  1IKV A;  4CEC A;  4IDK A;  3QEX A;  3DLK A;  3DOL A;  3DRR A;  5DK5 A;  4N76 A;  3RWU A;  3QLH A;  1LWE A;  5FRO A;  1I39 A;  4CJE A;  2B6A A;  4E1M A;  1DLO A;  2F8S A;  1SL0 A;  1KSP A;  4FLT A;  4DU4 A;  1WN7 A;  1WSE A;  3MXI A;  5D3G A;  2E6L A;  3QIP A;  4C8M A;  4CJQ A;  1X9W A;  4CK1 A;  4XIU A;  4E19 A;  1C1A A;  4KB1 A;  2Z1I A;  3S3M A;  3QEP A;  3ZSQ A;  3TR8 A;  4FLV A;  4FJ7 A;  3KLG A;  1VSI A;  4B9S A;  2KZZ A;  5CZ2 A;  4BE2 A;  3OS1 A;  3PX4 A;  4CGH A;  1S5J A;  1BIZ A;  2VWJ A;  4DF4 A;  2KW4 A;  4DTR A;  1RT6 A;  4CJT A;  4CCH A;  4L8R B;  4IG0 A;  3OJU A;  3NHG A;  3DOK A;  1NJX A;  2B4J A;  5KGX A;  2XY8 A;  4NCB A;  3ZSW A;  1VSK A;  1RBS A;  1J54 A;  2DFH A;  3DRP A;  4CJ4 A;  1ZYQ A;  4DQQ A;  1U4B A;  2G8U A;  1LWF A;  4FJ8 A;  3SJJ A;  4AHV A;  4CHY A;  3EZ5 A;  4KV8 A;  4E7I A;  1JLB A;  3C94 A;  1XHZ A;  2OYQ A;  1WAF A;  4K8X A;  1SV5 A;  1TVR A;  3H08 A;  2GBZ A;  1ZBF A;  4B08 A;  1HPZ A;  4FLU A;  4DF8 A;  1IKW A;  3O3G A;  3OYI A;  1VSF A;  1WSG A;  3OYM A;  1LAW A;  2F96 A;  3NF7 A;  1RTJ A;  3TI0 A;  1JLA A;  3AO3 A;  2E6M A;  3VQ6 A;  3OYC A;  3VQE A;  3OYH A;  2KQ2 A;  1JLF A;  3I0R A;  3HXM A;  4DMN A;  4F4K A;  4FJK A;  4KHW A;  2YHA A;  3HO1 A;  1G15 A;  4KKO A;  3LAN A;  3HL8 A;  4FK2 A;  3KK3 A;  3V6D A;  1QTM A;  4DTP A;  1J53 A;  4B9N A;  1FK9 A;  3B6P A;  4FJN A;  2HVH A;  3A2F A;  3NDK A;  3O4N A;  3T3F A;  3P1G A;  3AVC A;  3TAN A;  1N5Y A;  1LW2 A;  4DTN A;  3LP0 A;  4IG3 A;  4J2B A;  1NKE A;  4FJG A;  3AO5 A;  4NCG A;  3VQ5 A;  2HW3 A;  3L2Q A;  4DLE A;  1B92 A;  2VWK A;  3VQ8 A;  2HVI A;  4KHU A;  3O3H A;  3NH1 A;  1L3S A;  2ITG A;  4CJ5 A;  3TAG A;  1LWC A;  4CIE A;  4DFK A;  1TV6 A;  3VQC A;  1RTI A;  2PYL A;  4BE1 A;  1YT3 A;  2HMI A;  4Z4E A;  4KFB A;  3TWH A;  2Z1G A;  2O4G A;  1S1U A;  4W5N A;  1LW0 A;  3DLE A;  1RTH A;  3KK2 A;  4KTZ A;  1HMV A;  3LAK A;  1RDC A;  3AO1 A;  4FJL A;  3S9H A;  1S6Q A;  4JS5 A;  5JS2 A;  3NH2 A;  3L2R A;  3AVG A;  2G8K A;  4NYF A;  3KJV A;  4CFB A;  4CF0 A;  4FJ5 A;  2OPR A;  3AA2 A;  4O4G A;  1RT4 A;  4N5S A;  3RMD A;  1Z26 A;  4LH5 A;  3C6T A;  2YNI A;  4CF9 A;  4CGJ A;  4CEE A;  1NK6 A;  3DLH A;  4Z4F A;  3SPZ A;  2KFZ A;  3D0P A;  4HCC A;  2HHU A;  4Y1D A;  2F8T A;  3DI6 A;  2YHB A;  3LZJ A;  3KTQ A;  4Q0B A;  3ZT2 A;  4QOZ B;  4FZZ A;  2DFF A;  5C25 A;  4FZY A;  2B5J A;  5HRS A;  2E4L A;  2OPS A;  3NBP A;  3PO5 A;  1U04 A;  4AHR A;  2EHG A;  4CJR A;  4BDP A;  1WSF A;  2AJQ A;  4O5B A;  3SV3 A;  4O44 A;  2XO7 A;  4FJI A;  1RT2 A;  4DSL A;  4J2D A;  5HRR A;  3TAB A;  3V4I A;  4CGG A;  5CYM A;  3ZT4 A;  3F73 A;  4O0I A;  1RBR A;  5C42 A;  2Z1H A;  3AVL A;  3OYN A;  1WSJ A;  4OKK A;  4HVJ A;  4B9L A;  3CM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...