4YY3K

30s ribosomal subunit- higb complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4yy3K00
4DR4K 4JI7K 4JI8K 4DR3K 1J5EK 1IBMK 4LF9K 4LFAK 4AQYK 4DV0K 1IBLK 2F4VK 4DV2K 5IT9O 5A2QO 1FJGK 1XNRK 2UUBK 5LMNK 2VQFK 1HNZK 4JYAK 4YY3K 4DR2K 1N33K 2UXCK 4DV1K 5FLXO 5BR8K 4JI6K 3J7AP 4CVNE 4CW7B 3T1HK 4DV6K 1XMOK 2UU9K 2ZM6K 4JI2K 1XNQK 4JI0K 1N32K 4JV5K 4JI4K 4K0KK 4DR7K 1N36K 1XMQK 5IWAK 4JI5K 2UXDK 4X62K 2VQEK 4B3RK 1HR0K 4DV7K 1I94K 4DR6K 4B3SK 4LF5K 3J81O 4V19S 4KHPK 4JI1K 5AJ3K 1N34K 4LF8K 4X65K 4DUYK 1HNWK 5LL6Z 4X64K 4OX9K 3J80O 4DR1K 4NXNK 4DV4K 4B3MK 4DUZK 2E5LK 2UXBK 4LF6K 2HHHK 3T1YK 4DV3K 4DV5K 4JI3K 4LFBK 4YHHK 4B3TK 4LFCK 4GKJK 4X66K 2UUCK 4LF7K 4LF4K 3JAMO 1HNXK 4NXMK 3J7YP 5LMUK 4DR5K 2UUAK 3OTOK 1IBKK 4GKKK
chains in the Genus database with same CATH superfamily
3PX0A 3K5MA 3IMXA 3K5LA 3VQDA 1TL1A 4BG9A 1KCFA 1OH8A 1X3MA 3WT0A 3SAFA 4LSNA 4YDUC 1WN7A 1ZC6A 4DMNA 3LP2A 2KZMA 1IBLK 2KFNA 2HNDA 1JKHA 4CHPA 2I7NA 4TSXA 2HBKA 1VQNN 1KVCA 2D0PA 2HF4A 2YX6A 3OBWA 4BVOA 4DQ8A 4BE1A 1RTDA 2P9IB 3CFOA 3QBWA 3P31A 4JK7A 3SQ1A 3SQ4A 3CPEA 3BEXA 5BRDA 3CJCA 3U3YA 3H3NO 4NLCA 3B8AX 4CVNE 4OPHA 4JRQA 3LANA 3RMAA 1B9FA 1DLOA 2ZM6K 1O13A 2A1RA 1TVRA 3AO4A 5JS1A 3KKRA 4DS4A 1XNQK 1J5OA 2ITGA 3DYAA 4DTJA 1BHLA 4O0IA 1XMQK 5AQKA 3C6UA 3ATVA 5LJVA 2Q31A 3OY9A 1DKGD 1ESVA 3OYGA 1QQNA 3AVMA 4KREA 1JLFA 1SAZA 5FPDA 4B9MA 3C7NB 2WONA 4KKOA 3K57A 1NK6A 4CEEA 5FDLA 3ZX2A 4IJAA 4GV3A 2QI2A 1MA9B 1HNIA 3PUFA 3HYFA 4O5BA 4CEAA 4B9UA 3W0LA 1U48A 3O4QA 1HYVA 4IO9L 3VQPA 3SBTA 2YJEA 4NCBA 4FJIA 5AZIA 3ITHA 1BA1A 5EVZA 3FFIA 5B8HA 3GL1A 4CJFA 1ASWA 4EHTA 1K8AO 3T1AA 1JXEA 3DXMB 3NGIA 3MAQA 4FJ7A 1LOTB 1DGKN 1RTHA 3I33A 5HOOA 1TYQB 3CCVN 5JVHL 4DV5K 4FM1A 5J2PA 1W7AA 4W5RA 3DOLA 3MK6A 4PY5A 2YKMA 4DTOA 3H1QA 4CFDA 4NXMK 1VAZA 5EY4A 3TTDA 1QSYA 2FLOA 2P9NA 5E84A 3UKUA 2YNHA 4M41A 2QXFA 2CH6A 4CERA 1YJWN 3VGLA 5KI6A 1U6ZA 4IFVA 1CZ9A 1DEJA 1BCOA 2OCEA 4H4MA 4FWPA 3UIQA 4KAZA 1NBWA 1U49A 3VF2A 4CESA 4CJKA 4DG1A 4CJUA 1VHXA 3NFAA 4FL9A 4BRHA 4M3TA 3HRGA 3J8AA 3ZSOA 4DSIA 1C1AA 3D2FA 1D8YA 4BVPA 1RGIA 2ZGYA 4QS9A 2XO7A 4I6MB 1VSIA 4JAXA 4RCHA 3PO5A 5AQLA 2QK9A 4JD2A 5BN9A 3OS0A 4DS5A 1GLJO 3LP3A 1BDGA 3AGKA 3O4WA 2WUSA 4EP4A 2HHSA 3DLHA 2Q97A 4FCYA 3V9UA 3VQ6A 2NRXA 3WEEA 2P51A 1KD1O 4N56A 3MWPA 5EX5A 2FC0A 4AM7A 5M1OA 3A5OC 3ZEUB 1FXXA 4KH6A 4FLTA 1ASUA 4O8KA 1KRPA 1JCFA 3HP6A 4N76A 2O8EA 3TAMA 3HVTA 4H0YB 3O3FA 4DR1K 4FJNA 3WXIA 4DV4K 3R9PA 2KKZA 1RBTA 3R6MA 5C10A 3DM2A 4DSEA 2FSNA 3G4SN 1NGCA 4BRPA 3CERA 1FK9A 4M3ZA 3DJCA 2G8KA 4DQIA 2ZE2A 4KHUA 3H3OB 3CJ1A 3O9QA 3THWA 4BRCA 3EKUA 4FPAA 1QQCA 3VQ5A 3NH0A 4DR5K 4ZTJA 3L3VA 3NHGA 3QINA 3TSUA 1BIZA 1VSHA 1NKCA 1WOQA 3ZLJA 1S9EA 4KHNA 1RDWX 3DI6A 3S3NA 1ILYA 3VEZA 3IDHA 3K9JA 2GX9A 4Z4FA 3GDQA 4BRNA 1YJ9N 4WQ5C 4CJ7A 3SYZA 2VQFK 3SUQA 1ZYQA 5FLXO 2VG7A 3V9SA 4NCGA 2JWKA 1U2VA 1NKBA 5JLFA 3T1HK 5CE3A 4DU4A 2X6SA 2PBDA 3SNNA 4IJNA 3SQ2A 2ASMA 5I9EB 3A5MC 5JMVA 4CGFA 4CZHA 4AHVA 2A41A 3CCEN 4CIFA 3V1QA 5AZIB 2F8SA 1QHAA 3NVMA 4C8MA 3SUOA 3JSMA 4AHTA 3K5NA 4B3RK 3U8XA 3O3GA 4FJ9A 1ZBIA 4KV8A 3ZSVA 4BROA 4HUFA 1SKRA 1KAYA 4B1YB 3NVKA 2VWBA 1R0AA 4F4KA 4WFAL 4FZYA 1JXBA 1JCEA 2QXLA 4F8RA 5M1KA 4N41A 2P9NB 3UKUB 1C0MA 3LDNA 4CZIA 2V7ZA 2HBMA 1D4XA 3PX6A 2P9PB 3C6AA 5HL7L 1YUWA 3SI6A 4ID5A 2BGGA 3VPZA 5AQNA 1S72N 1XHZA 2WOMA 4A2AA 3WUHA 5CZ1A 4JI3K 4E7LA 3H08A 4BRLA 3MCAB 5BPMA 3QNNA 1REVA 3PIOL 1KTQA 1RBRA 1UA0A 3OYJA 4RWTA 3B6OA 3JAMO 3J7YP 3OYIA 3QEWA 5KGWA 5AR0A 1S5JA 4K41A 3VA0A 3ULEA 3O3HA 4CHNA 1E4FT 1XC3A 3CF5L 4FJHA 2J4RA 1L5UA 5DK5A 2CGJA 1QSLA 4IOAL 3VENA 3DRRA 3O4NA 2A5XA 4JD2B 3HP9A 3NF7A 4KTQA 3AVFA 1FJGK 3WXJA 2O8BA 3AA4A 3ISNC 2PYLA 2ZF5O 4AHSA 5AZJA 1D5AA 1TK0A 3WEEB 3TTCA 1BIUA 1HJRA 1SS6A 4FLWA 4KB0A 3AV9A 4IFYA 3LALA 2GUPA 4YOTA 1OVQA 3EZ5A 4CD1A 1FKOA 4LH4A 3RSEA 1RFQA 4CHYA 3GG4A 1IO2A 1Q9YA 4KPYA 4H5RA 3SAHA 3CM6A 3KLEA 2FXUA 3E9PA 2G8FA 2O8EB 3TSPA 1SKWA 2NLXA 1C1CA 1QVGM 2VQEK 4YFUA 2FSKA 4IDHA 1OKJA 4C8OA 3C94A 1I94K 3OHRA 1UA1A 5AFUH 4BDZA 1MDUB 1HKGA 4B3SK 3J81O 4PQUA 2RPIA 1GLBG 1HQEA 1W2BM 3L3UA 4EP5A 3THWB 3M8QA 4JS4A 2IDOA 5C42A 4XH4A 4X65K 4FJXA 4CZJA 2OPPA 3CIPA 4BC3A 4X64K 4OX9K 1RBUA 2YHWA 4H5NA 1S6PA 3ZSZA 3AA3A 4FJ5A 4DUZK 3JS6A 3KLFA 1JLEA 3CETA 5HRRA 3RMDA 4YOXA 4A5AA 1HYSA 4WCEL 3LPUA 1IKXA 1FKPA 1S22A 4OO1J 1KAZA 1YTAA 2VYPA 4FWOA 2FBYA 1UAXA 2P5GA 4CBUA 2D4WA 3F2KA 4H0XB 4YOWA 4OGCA 2IIRA 2XY5A 3ENBA 1B92A 4PHTX 5T7BA 1U2VB 3CJ7A 1U47A 3LWMA 4AQYK 4DV0K 1BI4A 4FWRA 5M1QA 3BUZB 3NH2A 4KTZA 3UB5A 3O9TA 1VQ6N 5AQWA 5J2QA 4CE9A 5JICA 3KZBA 3LDQA 3T3FA 2F7TA 2QWOA 1NJZA 3G25A 3HO1A 3DOKA 1D9FA 4QCLA 4LSLA 4B8AB 2YNIA 3A5LC 4BGAA 4FJMA 5CHIA 1MU2A 2HBLA 1RBVA 1GLAG 4CHQA 3VGKA 4F2SA 3QBXA 3SPZA 4OLBA 1HPMA 2GWJA 4JI5K 3RR8A 2DY4A 5H1SQ 3O8MA 5C12A 4DB3A 3PY8A 4BE2A 4JKCA 3HPHA 1NK4A 1NK0A 2PY5A 1KC8O 2P5OA 1NGBA 4V19S 4N47A 2RE2A 1EWRA 2HHUA 2OYQA 1K73O 1E4GT 3VQAA 2Q3SA 4IXCA 3VEXA 5AQIA 1JCGA 1BWFO 3SUPA 3WNEA 2YHXA 5LL6Z 3ULEB 5TKWA 3WNHA 3ASMA 4NXNK 3AY9A 2YV0X 2GEMA 3L2WA 3SK3A 3QEIA 2YKNA 1C0GA 1HMVA 4AILC 1CLQA 3U9DA 2G8WA 4WQ4A 3BF3A 4JK8A 4Z4EA 2PYJA 4H5TA 1RNHA 4FWLA 4PKIA 3G0ZA 1LAWA 1T7PA 3SLCA 2Q1NA 4DCHA 3D45A 3OS2A 4GKKK 3DWLA 1RT1A 3HBTA 3OYBA 1IKVA 5AZJB 3AGRA 1WAJA 1WSFA 2XRIA 1TV6A 3PIPL 2HF3A 2QEXN 2BANA 2OANA 2HSTA 1LAVA 3VERA 1S6QA 3IRXA 4FJ8A 2F4VK 4ILGB 1S1TA 3RSEB 3HSTB 4E19A 3O08A 4M3XA 2QKBA 4CJTA 1XNRK 1HNZK 4RW6A 4F2RA 4CJEA 3CXCM 1YAGA 4DF8A 5ADXH 4DSFA 1YJNN 2G8VA 1TL3A 2GUIA 4DFMA 4YOVA 4MFBA 5F0XA 1QZ5A 3V6DA 1SKSA 2Z1GA 2JWLA 3DLBA 2UU9K 2DFEA 2QM1A 3HOTA 3R3LA 4IOCL 4L8RB 4JLHA 3P39A 4KHQA 1NJWA 4EZ9A 2ZWHA 3T69A 3V9XA 3HM8A 4H0PA 3MN7A 3FE1A 4CF1A 4X62K 5AQHA 3HXMA 3CMEN 1NMDA 3AVJA 2JLEA 2HBJA 2HHTA 3NAEA 4HUGA 3TR8A 5FRNA 1JLQA 4PL7A 4F3TA 4PA1A 1YVNA 2Y1IA 2YI1A 4Y1DA 2IVOA 4FYDA 3VQ7A 5AJ3K 4DTXA 2LSNA 3KLHA 2O4GA 2HOEA 3KTQA 2XY8A 1TUUA 1VSDA 4HTLA 2O4IA 1HUXA 3RR7A 1IG9A 2WTUA 2F9TA 4RG8A 3C6TA 2H3GX 5JLHA 1X9JA 2A1SA 3I56N 1S1VA 3F9KA 5I42A 1TGOA 4FJKA 1H1VA 2I7PA 2QWNA 3CFRA 1KLNA 2OTJN 3OYLA 1L3UA 3NF8A 1TKTA 5LMUK 1KSPA 4CK2A 2Q0UA 1IBKK 2IS3A 5KQDA 4LF9K 4K25A 1C0FA 2CGKA 3CQXA 2FBXA 4IWVA 2QTDA 3ATUA 1J9AA 3T7ZA 3I55N 1QVFM 2ZJPL 2NRHA 1VQLN 4I2QA 4M3YA 2YJFA 4CJ3A 3BGRA 4OPJA 4BRQA 3I0SA 4Z4GA 4FPBA 1HKBA 3CI5A 3KD5E 4E1MA 3C0BA 4CBXA 2PZSA 4JI6K 4FWQA 3TSQA 3LZIA 3HT3A 1S1UA 4DFKA 1EETA 3J7ZO 1VSKA 1NNEA 2X6NA 4EIAA 1HRHA 2VG5A 1YVUA 2B6AA 5CY4A 2F96A 1TKZA 3HL8A 3DLRA 1NOZA 1HYZA 4ISEA 1CZBA 3HPGA 4C1NK 4JHDB 2QA4N 1TK8A 4DV7K 5AQRA 3DLEA 3HTVA 4DR6K 2NNWA 3NMUA 1CZAN 3C6HA 3ULDA 3F9MA 3SZ2A 1UWBA 3LDPA 5HRNA 2P9SA 1NGIA 1N5YA 3AVIA 4JKAA 2G8HA 4EHUA 1WBBA 3TPQA 4FXDA 4FOEA 1TAQA 2XY6A 5LJWA 3CC7N 2O8DB 1HLUA 4CZLA 4K8XA 1IH7A 2IOCA 3CHWA 1P90A 5BREA 2A42A 2E1YA 2QWRA 1VRTA 4MDAA 4RW7A 1JL2A 3MEDA 3OYNA 1L3VA 4CEBA 4PKHA 2KHOA 2ZQBA 3M3ZA 1G15A 2E6MA 3KHYA 3AO5A 4FLYA 3P83D 1NGDA 1J5EK 3PLAA 3HK2A 2NUBA 1LV5A 1WB9A 3S41A 1YXQA 3R1XA 5BR9A 1YITN 1VQ7N 3MMVA 3RWUA 1IKYA 4AHCA 5HRSA 5C2FA 4CF2A 3KLGA 1RTIA 3NDKA 4A61A 1U45A 2FF3B 1VQON 3V9ZA 4DTNA 3TWHA 1NG9A 4E7JA 3TI0A 1RT7A 2DFFA 3FZKA 3LM9A 3VEVA 3ZCMA 4YY3K 2OPQA 4CEFA 4JKDA 5AQSA 4FLVA 2BH1A 2F9WA 4FW2A 3TABA 4ELVA 3M8SA 4CCHA 3MXJA 5BPLA 4B9SA 3J7AP 4BQZA 1C1BA 4H5WA 4LC9B 3D7EO 1V4SA 2A6AA 4L3QA 2HHWA 3KIOA 1RILA 3BZKA 3CQYA 1VQKN 1VSJA 1EWQA 5FPNA 3GBTA 3E1YA 3NCIA 4AF1A 5KGXA 5IWAK 1NJYA 3DRSA 4AM6A 4M42A 3TAQA 4B9NA 3OYKA 4CJSA 3AVKA 3BP8A 1S1XA 1VQMN 1IG8A 4CZFA 3THXA 1J53A 3SCXA 3U6FA 1VK0A 3MCPA 3VMFB 1YI2N 1NJXA 3QEXA 1VQPN 1N34K 2NRRA 4FVUA 2JGUA 1Z05A 4R79A 5FRMA 4DQPA 3E66A 4KI4A 4J8FA 4DU3A 1VQ5N 1CXQA 3KWGA 4NLBA 5M1NA 3CCMN 4EAHD 5HP1A 3CJAA 5CR4A 2ITMA 1LCUA 2A3ZA 1RTJA 3HM9A 1WLJA 1QHTA 2D0OA 2UUCK 3D2EA 2Q0RA 1NGHA 4IBNA 4OKEA 5HROA 4N5SA 4GV6A 3VQ8A 1KFSA 4YOUA 4BREA 2VGNA 4J2BA 2RF2A 1GLCG 5I3UA 5GAGP 4MLEA 2WC9A 1X3NA 4BRDA 3VOVA 3I8BA 4Z4CA 4HCBA 1V4TA 2NZTA 4B3OA 2VWJA 4KB1A 3L4QA 1LWFA 2UUBK 2KFZA 4FZZA 1OVYA 1NGAA 2E88A 2QW9A 2ZJRL 3QESA 4FK0A 3TAGA 4ILJA 4CZEA 3QFPA 4H0TB 4BACA 3VQ9A 4LY7A 3D2FB 2HHQA 4M3WA 1QZ6A 3BF1A 3OYHA 3VESA 3DAWA 3VGMA 3LP0A 4GW6A 2P9SB 1WAFA 3H46O 2ATQA 4C23A 3HVRA 4ELUA 4O4GA 1XC9A 3A0IX 3LDLA 4DHYA 5GADP 5AQTA 3M1FA 1WBDA 3AVCA 1NGGA 3G6EN 3PX4A 1OH6A 4IO8A 2CGLA 1LW2A 1VRUA 3FZHA 1HJOA 4CF0A 4C8KA 1BL3A 4O0JA 4OJRA 5J2NA 3QLHA 3QEPA 4DUYK 4A5BA 3CQ8A 3L4IA 5AQZA 3KD1E 5AQOA 2WFBA 3DXKA 3DRPA 3K59A 2E5LK 4CBWA 5KPZA 1BO5O 3AAQA 4CGJA 3L2RA 1B9DA 3OYAA 4CJQA 4LFBK 1F21A 2W6KA 3LL3A 4BE0A 4CGIA 4KHWA 2D5RA 3L0QA 1SZ2A 3VEYA 3LM2A 2A40A 3KK3A 2NRZA 5KRSA 2EX3A 3CCUN 3OTOK 3QETA 4DR4K 3OVNA 1JLGA 3TAPA 4NCAA 4NO7A 4XH5A 1P8ZA 3MX2A 4LFAK 1TK5A 1RBSA 4IEEA 1OH7A 1WSHA 5E26A 5BRFA 1RT6A 4BRAA 5EOYA 2E4LA 1HNVA 4LH5A 1Q9XA 3VEOA 1ATNA 1T44A 5KQ8A 1NKEA 3MEEA 3H1VX 3QNOA 1LWCA 3BZCA 3QIOA 5BR8K 5ADXA 5AQJA 5M1FA 1BCMA 3EKSA 3THXB 4QS7A 5EXWA 4Q5VA 4B8CA 3I8DA 4DV6K 1RDAA 4B9LA 4IG3A 4JI2K 4JNEA 3RTVA 4QAGA 3SMSA 4CJ4A 4IZ9A 1EP4A 1EX4A 4H0VB 1N36K 3O5BA 5FPEA 2GBZA 3ZX3A 4OLAA 3VN5A 4M3UA 4IOXA 4GVMA 4CF8A 1M90O 1IJJA 2YNFA 1O1WA 4O5FA 5GIPA 3CCSN 3D6RA 4FSVA 3CC4N 3IS9A 3IAYA 1HR0K 4KRFA 1HQUA 4DSLA 5AQUA 4DU1A 2IGIA 1HX1A 4KHPK 2B4JA 3TARA 5HLFA 4UQGA 1IKWA 4JKGA 3WXLA 3D2EB 2D0AA 1XWLA 3P5JA 3UKRA 1LW0A 1L3TA 3EYZA 4ILHA 1A5WA 1FW6A 1RDUA 2AA4A 4B08A 4CGDA 4KTWA 5KTQA 3SUNA 3CJ9A 3HI0A 5BRHA 3OYEA 3DXMA 4MLHA 1BISA 3IUCA 4AHRA 4FO0A 2QKKA 1TYQA 4DWIA 1BQMA 3P1GA 3P4IA 3ZETA 4DQQA 4RTFD 2YHYA 1MWMA 1QE1A 1YTUA 4C8NA 3VF4A 1GLDG 3LAMA 3NF9A 4FWNA 5EU7A 4ZHRA 3KK2A 4E7HA 5AQYA 1RCHA 3CJBA 3CCQN 1GLFO 4CJVA 4OPAA 3BDPA 2Z1JA 1SQKA 1YF5L 3V1OA 3AO3A 4B1UB 3PSFA 4WE1A 5LMNK 4JYAK 4DR2K 2OPRA 2O8BB 4NYFA 2W41A 2KW4A 2BE2A 3MXIA 4MO5A 4WFBL 4B1XB 1BG3A 3EEQA 4BRMA 2D1KA 3MDQA 4FWSA 5DM7L 4A2BA 2VCPA 5GIOA 4BRIA 4CK3A 1WSJA 4JI0K 4JV5K 2Q2RA 3LDSA 2AJQA 1SUQA 4DTRA 4WQ4C 1D9DA 4K0KK 3QERA 1X9WA 1YIJN 4FOIA 1ZBLA 3DXKB 1BU6O 3KLIA 3ALYA 4BG8A 3IFRA 4CIEA 3ZT3A 1ATSA 4G9ZA 1BGXT 2P9UA 2G8UA 2O8CA 5GINA 1SL2A 3TAEA 3ZSWA 3KJVA 3ZSYA 4WYBA 4HCCA 4PUOA 3OBYA 3R8EA 4CI6A 1C6VA 3THVA 1I39A 4BC4A 1BA0A 4JKHA 3THYA 3K9KA 4XH1A 4CZKA 5BPNA 2Y1JA 4XEIA 1K8KA 4DSKA 4FZXC 2P9LA 5ELZA 5AQGA 4ZTFA 3QICA 2V52B 4K42A 1A5VA 4W5TA 2ASOA 3E9OA 4FJLA 4LFCK 4FK4A 3ID6A 2DTUA 3O1WA 4AHUA 2I5JA 5CYMA 2G8IA 5TKYA 3DLLL 4IDKA 2PFUA 4I9LA 2NRTA 3Q7CA 1VQ8N 2W6LA 5JS2A 3AARA 3C95A 4JI8K 1Q8IA 3SAGA 2HVHA 4BC2A 1JLCA 2E2OA 3NGZA 1WSIA 2KTQA 4KHYA 1BI4B 4GY2B 3QEVA 4BDPA 3WNGA 3G10A 3S3OA 3ZYYX 3OYCA 4B1WB 1EQYA 2Z1HA 1Z26A 5A2QO 3VF6A 4BDYA 1NLVA 1NGJA 1YHQN 2UXCK 4GMJB 4WF9L 3AVLA 4CJPA 4GVEA 2W40A 1QQOA 3E01A 4O44A 3UE5A 2E1ZA 1WUAA 1A5XA 4CJRA 5HBMA 4JK9A 3K5OA 4GNIA 3VETA 2CH5A 3NH1A 4JKGB 1XMOK 4FLXA 1ZXOA 1S9GA 3ZSRA 1U4BA 1Q82O 3UKRB 4A59A 4CJLA 4KBOA 1N6QA 4FVMA 4M7XA 3ZSXA 3RVCA 1T05A 4HUEA 1KXPA 3U4LA 3KK1A 4B9TA 1KAXA 5E41A 3M6GA 1T03A 4F9OA 2IAJA 2BTFA 1RT3A 4BR7A 3VQBA 4LF5K 4QS8A 4DSJA 3ZT1A 2KZZA 3JYTA 4OVLA 3RRGA 4I7FA 1YT3A 3LDOA 2HHVA 4LF8K 3L2QA 2O8FA 3ZETB 2RKIA 1WSEA 1HNWK 1S1WA 1W9HA 4BWJA 4JRPA 2PAVA 3V81A 2P9PA 3A5NC 3CCLN 4BC5A 1R59O 4IG0A 4CK1A 4CHZA 1W97L 5F2RA 4CECA 2KLAA 5C2DA 4JKFA 4JN4A 1GOAA 4CFAA 1NOYA 2HMPA 3ZT4A 4YNQA 1VSEA 2QWPA 3VTIA 3OA9A 2Q36A 1M1KO 1NMNA 3RMBA 4H5VA 4BY9C 3GOIA 4E3SA 4NB4A 3SMPA 4E7KA 5DMRA 4DR3K 4JEPA 2E8AA 1ZBHA 3EZWA 5J2MA 3F5TA 3W3DA 3RMCA 3VEWA 1XHXA 1Y64A 1HKCA 2FBVA 3HSCA 4FWMA 4MO4A 5IT9O 3TANA 1G99A 4GV9A 5AQXA 1K9MO 3EL2A 2OZMA 4PL8A 1U04A 2R7YA 2RHKA 2XY7A 2RN2A 1T3VA 5JVGL 5FPMA 5J1EA 3CC2N 4PWDA 3LWLA 1NM1A 2P9UB 4PKGA 2O8CB 4Z4HA 1RT2A 1Q18A 1VSFA 1ZBUA 4WFNL 1EO1A 4RW4A 5HRPA 2DPNA 3THYB 3K58A 2DFHA 3VQCA 1UOCA 1K8KB 5AQFA 1T8EA 4EZ6A 2P9LB 2F8TA 3ZT2A 2OPSA 4CF9A 5GAHP 2P9KA 5CYQA 4BRKA 4FK2A 5AQMA 1C0TA 3QDKA 3VTHA 2D0CA 3IKMA 2E2QA 2YCHA 4WQ5A 3NE6A 3SBGA 2NRWA 5C15A 4FWKA 1WNSA 4JI1K 1J6ZA 3WQUA 4Z4IA 3AVAA 3SQ0A 1JL1A 2ZD1A 1DT9A 3FZMA 4B1VA 3GE1A 3L6QA 4DTMA 3OJSA 2VG6A 4MDBA 2HNYA 3CG7A 5F1XA 3O80A 2ZJQL 4CEQA 4HWIA 4FJJA 5LY3A 3HJFA 4FW1A 4CZMA 1BUPA 4OKKA 3H45C 4LF6K 4E7IA 1Z25A 3VQ4A 4E1JA 3QB0A 4Y0WA 3LP1A 2EWSA 2OTLN 4B3TK 4F3OA 4GKJK 4X66K 3VA3A 5AFUA 3V9WA 2YHAA 4BGBA 1QS4A 4LF7K 3AVBA 3E9LA 4CHOA 3G71N 3DMJA 5KPTA 3OS1A 2P1JA 3N4PA 3H6EA 4JI7K 3Q7BA 5C0YA 1N8RO 4ISGA 4W5QA 3TTFA 3EE8A 1BQNA 1QQMA 3O9SA 1HPZA 1TAUA 5FROA 2VGMA 4IEIA 3ID8A 4KO0A 4ELTA 1Y97A 3O9RA 1ITGA 3NF6A 3B6PA 2HNZA 4BR2A 5MLCQ 3MX5A 4M3RA 1QSSA 4RW8A 3CCRN 3MXMA 3A8YA 4KI6A 4M45A 4K43A 4DQRA 3WXMB 1KLMA 3CD6N 2HVIA 1Q7YO 2ETJA 3TAFA 4CW7B 4E0DA 3FLCO 4FLZA 1GOBA 1SL0A 4B9QA 3FR0A 3CPWM 4JI4K 2O8FB 1GLLO 4W5OA 1MWKA 3ZX0A 3HPOA 1T6CA 3O1BA 3CM5A 1WSGA 4XIUA 1EKEA 2X74A 3NGYA 2UXDK 3M8RA 2FBTA 1NK7A 5C25A 3CMAN 3RRHA 3WQTA 4DTUA 2BUPA 1L3SA 5SZTA 2EHGA 4R5PA 4J2DA 4E89A 3OW2M 1Q81O 4CZGA 4DFJA 3QIPA 4AH9A 4H0OA 3CCJN 3WNFA 3AO1A 2GELA 4CGGA 1Q86O 4EFHA 3HOSA 1NK8A 1JLAA 3WXKA 3OJUA 3AVNA 3I0RA 3PSIA 3PV8A 1GLEG 1NJIO 3SV4A 2UXBK 5M1PA 1NK9A 2HHHK 4J2EA 3F73A 3T1YK 4DV3K 4FM2A 1ATRA 4O55A 3BY5A 2HHXA 3M8PA 3QMLA 3U3GA 4CEOA 3VQEA 3MEGA 4E1NA 1KVAA 3AVGA 3QFUA 2QWMA 1X1PA 2HW3A 3DLKA 4KHSA 3L2UA 4BR4A 3D0PA 3KWIA 3U9ZA 4HTUA 2UUAK 1KQSM 5SWMA 3FZLA 1XI1A 3L2VA 2IVNA 3EN9A 4C8LA 3TU5A 4W5NA 1JLBA 4DV2K 1SV5A 4BRGA 2V51B 5BN8A 2E2PA 4Y1CA 4A57A 1RT5A 1X9SA 1S3XA 3K0SA 3V4IA 1VSLA 4I2PA 2IC3A 2P9KB 4DV1K 1RDDA 1NWKA 3MECA 1KFDA 1ZBFA 1OH5A 5K14A 1NU0A 1IV0A 5AQPA 2QWQA 1N32K 3OYFA 3MWTA 1ZBSA 5AQQA 1XUPO 5KPRA 1I3AA 4J2AA 4DR7K 1X9MA 3SJJA 1NK5A 3SJHA 2P9IA 3PO4A 2OA8A 3K2PA 2OZSA 4B9VA 3FFKB 4FJGA 2V7YA 5D3GA 3KKSA 4CJWA 3EO3A 2WBNA 4JKEA 4CIGA 3LZJA 1DTQA 2ZGZA 4C1NI 4Q0BA 1VQ4N 4ID1A 2QWLA 4BQLA 3FGUA 1J54A 4IFEA 3MN5A 3T19A 4BR5A 3S3MA 1NGEA 3VQQA 4UY8O 3NBPA 2NRVA 3OYMA 2Z1IA 3C7NA 4KH4A 1VQ9N 2XHBA 3KVGA 4YHHK 1NGFA 3L8BA 4H03B 4CD3A 1TKDA 2GV9A 2AP1A 3AAPA 1C0UA 1K6YA 2YNGA 2B5JA 2YHBA 4LD0A 1IBMK 3IG1A 1RDCA 3MN6A 4HHTA 1TKXA 2W42A 3AA5X 1JJ2M 4YORA 4NYNA 4DKWA 1CXUA 3C65A 3AO2A 4O8UA 3AA2A 4CEZA 4OPKA 4Z0UA 4U7BA 4ICLA 3A2FA 3EE9A 2X78A 3SV3A 3JXUA 5GAEP 4H8KA 3LPTA 1XQSC 3LAKA 4JKBA 2IVPA 3KK7A 1N33K 4Z94A 1QTMA 4I9QA 1LWEA 5C24A 4DTPA 3CFPA 2FF6A 3QO9A 2D0BA 2ASPA 4K8ZA 3M5RA 1E3MA 2FSJA 1ASVA 1RDBA 4CJ5A 2E6LA 4OGEA 1GOCA 4DTSA 1T6DA 2E20A 3P38A 4KH5A 3ENOA 1Z6RA 2BDPA 4KFBA 4CFBA 4JHDA 1EXQA 1DTTA 2GWKA 4DLGA 4DQSA 4M63C 4G1QA 4CEDA 4H4OA 3EY1A 4BRFA 4MQ3A 4DLEA 4ISFA 1KVBA 3S9HA 4IKFA 3ENHA 4I6MA 1SL1A 5AQVA 1BOTO 4OKJA 4JS5A 4RW9A 3DLGA 4DFPA 4BWMA 4A62A 4FLUA 3OYDA 4CGHA 2KQ2A 4FM0A 5KRTA 5CZ2A 2E2NA 4M7YA 3HZ6A 4YDUA 5DM6L 4B1ZA 4HVJA 3ZT0A 3J80O 3AVHA 4B3MK 2O8DA 3SPYA 1VSMA 3FZFA 4DF4A 1RT4A 3O9UA 4YOYA 1TUYA 2HB5A 3CYMA 4QOZB 3MN9A 2VWKA 3N4QA 4BR9A 2HMIA 2GTDA 3ZEUA 4LF4K 3ZSQA 4BR0A 1HNXK 2UYTA 4U67L 4CFCA 3V1RA 1W0HA 3O6WA
chains in the Genus database with same CATH topology
4DR4K 4JI7K 4JI8K 4DR3K 1J5EK 1IBMK 4LF9K 4LFAK 4AQYK 4DV0K 1IBLK 2F4VK 4DV2K 5IT9O 5A2QO 1FJGK 1XNRK 2UUBK 5LMNK 2VQFK 1HNZK 4JYAK 4YY3K 4DR2K 1N33K 2UXCK 4DV1K 5FLXO 5BR8K 4JI6K 3J7AP 4CVNE 4CW7B 3T1HK 4DV6K 1XMOK 2UU9K 2ZM6K 4JI2K 1XNQK 4JI0K 1N32K 4JV5K 4JI4K 4K0KK 4DR7K 1N36K 1XMQK 5IWAK 4JI5K 2UXDK 4X62K 2VQEK 4B3RK 1HR0K 4DV7K 1I94K 4DR6K 4B3SK 4LF5K 3J81O 4V19S 4KHPK 4JI1K 5AJ3K 1N34K 4LF8K 4X65K 4DUYK 1HNWK 5LL6Z 4X64K 4OX9K 3J80O 4DR1K 4NXNK 4DV4K 4B3MK 4DUZK 2E5LK 2UXBK 4LF6K 2HHHK 3T1YK 4DV3K 4DV5K 4JI3K 4LFBK 4YHHK 4B3TK 4LFCK 4GKJK 4X66K 2UUCK 4LF7K 4LF4K 3JAMO 1HNXK 4NXMK 3J7YP 5LMUK 4DR5K 2UUAK 3OTOK 1IBKK 4GKKK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR4 K;  4JI7 K;  4JI8 K;  4DR3 K;  1J5E K;  1IBM K;  4LF9 K;  4LFA K;  4AQY K;  4DV0 K;  1IBL K;  2F4V K;  4DV2 K;  5IT9 O;  5A2Q O;  1FJG K;  1XNR K;  2UUB K;  5LMN K;  2VQF K;  1HNZ K;  4JYA K;  4YY3 K;  4DR2 K;  1N33 K;  2UXC K;  4DV1 K;  5FLX O;  5BR8 K;  4JI6 K;  3J7A P;  4CVN E;  4CW7 B;  3T1H K;  4DV6 K;  1XMO K;  2UU9 K;  2ZM6 K;  4JI2 K;  1XNQ K;  4JI0 K;  1N32 K;  4JV5 K;  4JI4 K;  4K0K K;  4DR7 K;  1N36 K;  1XMQ K;  5IWA K;  4JI5 K;  2UXD K;  4X62 K;  2VQE K;  4B3R K;  1HR0 K;  4DV7 K;  1I94 K;  4DR6 K;  4B3S K;  4LF5 K;  3J81 O;  4V19 S;  4KHP K;  4JI1 K;  5AJ3 K;  1N34 K;  4LF8 K;  4X65 K;  4DUY K;  1HNW K;  5LL6 Z;  4X64 K;  4OX9 K;  3J80 O;  4DR1 K;  4NXN K;  4DV4 K;  4B3M K;  4DUZ K;  2E5L K;  2UXB K;  4LF6 K;  2HHH K;  3T1Y K;  4DV3 K;  4DV5 K;  4JI3 K;  4LFB K;  4YHH K;  4B3T K;  4LFC K;  4GKJ K;  4X66 K;  2UUC K;  4LF7 K;  4LF4 K;  3JAM O;  1HNX K;  4NXM K;  3J7Y P;  5LMU K;  4DR5 K;  2UUA K;  3OTO K;  1IBK K;  4GKK K; 
#chains in the Genus database with same CATH topology
 3PX0 A;  3K5M A;  3IMX A;  3K5L A;  3VQD A;  1TL1 A;  4BG9 A;  1KCF A;  1OH8 A;  1X3M A;  3WT0 A;  3SAF A;  4LSN A;  4YDU C;  1WN7 A;  1ZC6 A;  4DMN A;  3LP2 A;  2KZM A;  1IBL K;  2KFN A;  2HND A;  1JKH A;  4CHP A;  2I7N A;  4TSX A;  2HBK A;  1VQN N;  1KVC A;  2D0P A;  2HF4 A;  2YX6 A;  3OBW A;  4BVO A;  4DQ8 A;  4BE1 A;  1RTD A;  2P9I B;  3CFO A;  3QBW A;  3P31 A;  4JK7 A;  3SQ1 A;  3SQ4 A;  3CPE A;  3BEX A;  5BRD A;  3CJC A;  3U3Y A;  3H3N O;  4NLC A;  3B8A X;  4CVN E;  4OPH A;  4JRQ A;  3LAN A;  3RMA A;  1B9F A;  1DLO A;  2ZM6 K;  1O13 A;  2A1R A;  1TVR A;  3AO4 A;  5JS1 A;  3KKR A;  4DS4 A;  1XNQ K;  1J5O A;  2ITG A;  3DYA A;  4DTJ A;  1BHL A;  4O0I A;  1XMQ K;  5AQK A;  3C6U A;  3ATV A;  5LJV A;  2Q31 A;  3OY9 A;  1DKG D;  1ESV A;  3OYG A;  1QQN A;  3AVM A;  4KRE A;  1JLF A;  1SAZ A;  5FPD A;  4B9M A;  3C7N B;  2WON A;  4KKO A;  3K57 A;  1NK6 A;  4CEE A;  5FDL A;  3ZX2 A;  4IJA A;  4GV3 A;  2QI2 A;  1MA9 B;  1HNI A;  3PUF A;  3HYF A;  4O5B A;  4CEA A;  4B9U A;  3W0L A;  1U48 A;  3O4Q A;  1HYV A;  4IO9 L;  3VQP A;  3SBT A;  2YJE A;  4NCB A;  4FJI A;  5AZI A;  3ITH A;  1BA1 A;  5EVZ A;  3FFI A;  5B8H A;  3GL1 A;  4CJF A;  1ASW A;  4EHT A;  1K8A O;  3T1A A;  1JXE A;  3DXM B;  3NGI A;  3MAQ A;  4FJ7 A;  1LOT B;  1DGK N;  1RTH A;  3I33 A;  5HOO A;  1TYQ B;  3CCV N;  5JVH L;  4DV5 K;  4FM1 A;  5J2P A;  1W7A A;  4W5R A;  3DOL A;  3MK6 A;  4PY5 A;  2YKM A;  4DTO A;  3H1Q A;  4CFD A;  4NXM K;  1VAZ A;  5EY4 A;  3TTD A;  1QSY A;  2FLO A;  2P9N A;  5E84 A;  3UKU A;  2YNH A;  4M41 A;  2QXF A;  2CH6 A;  4CER A;  1YJW N;  3VGL A;  5KI6 A;  1U6Z A;  4IFV A;  1CZ9 A;  1DEJ A;  1BCO A;  2OCE A;  4H4M A;  4FWP A;  3UIQ A;  4KAZ A;  1NBW A;  1U49 A;  3VF2 A;  4CES A;  4CJK A;  4DG1 A;  4CJU A;  1VHX A;  3NFA A;  4FL9 A;  4BRH A;  4M3T A;  3HRG A;  3J8A A;  3ZSO A;  4DSI A;  1C1A A;  3D2F A;  1D8Y A;  4BVP A;  1RGI A;  2ZGY A;  4QS9 A;  2XO7 A;  4I6M B;  1VSI A;  4JAX A;  4RCH A;  3PO5 A;  5AQL A;  2QK9 A;  4JD2 A;  5BN9 A;  3OS0 A;  4DS5 A;  1GLJ O;  3LP3 A;  1BDG A;  3AGK A;  3O4W A;  2WUS A;  4EP4 A;  2HHS A;  3DLH A;  2Q97 A;  4FCY A;  3V9U A;  3VQ6 A;  2NRX A;  3WEE A;  2P51 A;  1KD1 O;  4N56 A;  3MWP A;  5EX5 A;  2FC0 A;  4AM7 A;  5M1O A;  3A5O C;  3ZEU B;  1FXX A;  4KH6 A;  4FLT A;  1ASU A;  4O8K A;  1KRP A;  1JCF A;  3HP6 A;  4N76 A;  2O8E A;  3TAM A;  3HVT A;  4H0Y B;  3O3F A;  4DR1 K;  4FJN A;  3WXI A;  4DV4 K;  3R9P A;  2KKZ A;  1RBT A;  3R6M A;  5C10 A;  3DM2 A;  4DSE A;  2FSN A;  3G4S N;  1NGC A;  4BRP A;  3CER A;  1FK9 A;  4M3Z A;  3DJC A;  2G8K A;  4DQI A;  2ZE2 A;  4KHU A;  3H3O B;  3CJ1 A;  3O9Q A;  3THW A;  4BRC A;  3EKU A;  4FPA A;  1QQC A;  3VQ5 A;  3NH0 A;  4DR5 K;  4ZTJ A;  3L3V A;  3NHG A;  3QIN A;  3TSU A;  1BIZ A;  1VSH A;  1NKC A;  1WOQ A;  3ZLJ A;  1S9E A;  4KHN A;  1RDW X;  3DI6 A;  3S3N A;  1ILY A;  3VEZ A;  3IDH A;  3K9J A;  2GX9 A;  4Z4F A;  3GDQ A;  4BRN A;  1YJ9 N;  4WQ5 C;  4CJ7 A;  3SYZ A;  2VQF K;  3SUQ A;  1ZYQ A;  5FLX O;  2VG7 A;  3V9S A;  4NCG A;  2JWK A;  1U2V A;  1NKB A;  5JLF A;  3T1H K;  5CE3 A;  4DU4 A;  2X6S A;  2PBD A;  3SNN A;  4IJN A;  3SQ2 A;  2ASM A;  5I9E B;  3A5M C;  5JMV A;  4CGF A;  4CZH A;  4AHV A;  2A41 A;  3CCE N;  4CIF A;  3V1Q A;  5AZI B;  2F8S A;  1QHA A;  3NVM A;  4C8M A;  3SUO A;  3JSM A;  4AHT A;  3K5N A;  4B3R K;  3U8X A;  3O3G A;  4FJ9 A;  1ZBI A;  4KV8 A;  3ZSV A;  4BRO A;  4HUF A;  1SKR A;  1KAY A;  4B1Y B;  3NVK A;  2VWB A;  1R0A A;  4F4K A;  4WFA L;  4FZY A;  1JXB A;  1JCE A;  2QXL A;  4F8R A;  5M1K A;  4N41 A;  2P9N B;  3UKU B;  1C0M A;  3LDN A;  4CZI A;  2V7Z A;  2HBM A;  1D4X A;  3PX6 A;  2P9P B;  3C6A A;  5HL7 L;  1YUW A;  3SI6 A;  4ID5 A;  2BGG A;  3VPZ A;  5AQN A;  1S72 N;  1XHZ A;  2WOM A;  4A2A A;  3WUH A;  5CZ1 A;  4JI3 K;  4E7L A;  3H08 A;  4BRL A;  3MCA B;  5BPM A;  3QNN A;  1REV A;  3PIO L;  1KTQ A;  1RBR A;  1UA0 A;  3OYJ A;  4RWT A;  3B6O A;  3JAM O;  3J7Y P;  3OYI A;  3QEW A;  5KGW A;  5AR0 A;  1S5J A;  4K41 A;  3VA0 A;  3ULE A;  3O3H A;  4CHN A;  1E4F T;  1XC3 A;  3CF5 L;  4FJH A;  2J4R A;  1L5U A;  5DK5 A;  2CGJ A;  1QSL A;  4IOA L;  3VEN A;  3DRR A;  3O4N A;  2A5X A;  4JD2 B;  3HP9 A;  3NF7 A;  4KTQ A;  3AVF A;  1FJG K;  3WXJ A;  2O8B A;  3AA4 A;  3ISN C;  2PYL A;  2ZF5 O;  4AHS A;  5AZJ A;  1D5A A;  1TK0 A;  3WEE B;  3TTC A;  1BIU A;  1HJR A;  1SS6 A;  4FLW A;  4KB0 A;  3AV9 A;  4IFY A;  3LAL A;  2GUP A;  4YOT A;  1OVQ A;  3EZ5 A;  4CD1 A;  1FKO A;  4LH4 A;  3RSE A;  1RFQ A;  4CHY A;  3GG4 A;  1IO2 A;  1Q9Y A;  4KPY A;  4H5R A;  3SAH A;  3CM6 A;  3KLE A;  2FXU A;  3E9P A;  2G8F A;  2O8E B;  3TSP A;  1SKW A;  2NLX A;  1C1C A;  1QVG M;  2VQE K;  4YFU A;  2FSK A;  4IDH A;  1OKJ A;  4C8O A;  3C94 A;  1I94 K;  3OHR A;  1UA1 A;  5AFU H;  4BDZ A;  1MDU B;  1HKG A;  4B3S K;  3J81 O;  4PQU A;  2RPI A;  1GLB G;  1HQE A;  1W2B M;  3L3U A;  4EP5 A;  3THW B;  3M8Q A;  4JS4 A;  2IDO A;  5C42 A;  4XH4 A;  4X65 K;  4FJX A;  4CZJ A;  2OPP A;  3CIP A;  4BC3 A;  4X64 K;  4OX9 K;  1RBU A;  2YHW A;  4H5N A;  1S6P A;  3ZSZ A;  3AA3 A;  4FJ5 A;  4DUZ K;  3JS6 A;  3KLF A;  1JLE A;  3CET A;  5HRR A;  3RMD A;  4YOX A;  4A5A A;  1HYS A;  4WCE L;  3LPU A;  1IKX A;  1FKP A;  1S22 A;  4OO1 J;  1KAZ A;  1YTA A;  2VYP A;  4FWO A;  2FBY A;  1UAX A;  2P5G A;  4CBU A;  2D4W A;  3F2K A;  4H0X B;  4YOW A;  4OGC A;  2IIR A;  2XY5 A;  3ENB A;  1B92 A;  4PHT X;  5T7B A;  1U2V B;  3CJ7 A;  1U47 A;  3LWM A;  4AQY K;  4DV0 K;  1BI4 A;  4FWR A;  5M1Q A;  3BUZ B;  3NH2 A;  4KTZ A;  3UB5 A;  3O9T A;  1VQ6 N;  5AQW A;  5J2Q A;  4CE9 A;  5JIC A;  3KZB A;  3LDQ A;  3T3F A;  2F7T A;  2QWO A;  1NJZ A;  3G25 A;  3HO1 A;  3DOK A;  1D9F A;  4QCL A;  4LSL A;  4B8A B;  2YNI A;  3A5L C;  4BGA A;  4FJM A;  5CHI A;  1MU2 A;  2HBL A;  1RBV A;  1GLA G;  4CHQ A;  3VGK A;  4F2S A;  3QBX A;  3SPZ A;  4OLB A;  1HPM A;  2GWJ A;  4JI5 K;  3RR8 A;  2DY4 A;  5H1S Q;  3O8M A;  5C12 A;  4DB3 A;  3PY8 A;  4BE2 A;  4JKC A;  3HPH A;  1NK4 A;  1NK0 A;  2PY5 A;  1KC8 O;  2P5O A;  1NGB A;  4V19 S;  4N47 A;  2RE2 A;  1EWR A;  2HHU A;  2OYQ A;  1K73 O;  1E4G T;  3VQA A;  2Q3S A;  4IXC A;  3VEX A;  5AQI A;  1JCG A;  1BWF O;  3SUP A;  3WNE A;  2YHX A;  5LL6 Z;  3ULE B;  5TKW A;  3WNH A;  3ASM A;  4NXN K;  3AY9 A;  2YV0 X;  2GEM A;  3L2W A;  3SK3 A;  3QEI A;  2YKN A;  1C0G A;  1HMV A;  4AIL C;  1CLQ A;  3U9D A;  2G8W A;  4WQ4 A;  3BF3 A;  4JK8 A;  4Z4E A;  2PYJ A;  4H5T A;  1RNH A;  4FWL A;  4PKI A;  3G0Z A;  1LAW A;  1T7P A;  3SLC A;  2Q1N A;  4DCH A;  3D45 A;  3OS2 A;  4GKK K;  3DWL A;  1RT1 A;  3HBT A;  3OYB A;  1IKV A;  5AZJ B;  3AGR A;  1WAJ A;  1WSF A;  2XRI A;  1TV6 A;  3PIP L;  2HF3 A;  2QEX N;  2BAN A;  2OAN A;  2HST A;  1LAV A;  3VER A;  1S6Q A;  3IRX A;  4FJ8 A;  2F4V K;  4ILG B;  1S1T A;  3RSE B;  3HST B;  4E19 A;  3O08 A;  4M3X A;  2QKB A;  4CJT A;  1XNR K;  1HNZ K;  4RW6 A;  4F2R A;  4CJE A;  3CXC M;  1YAG A;  4DF8 A;  5ADX H;  4DSF A;  1YJN N;  2G8V A;  1TL3 A;  2GUI A;  4DFM A;  4YOV A;  4MFB A;  5F0X A;  1QZ5 A;  3V6D A;  1SKS A;  2Z1G A;  2JWL A;  3DLB A;  2UU9 K;  2DFE A;  2QM1 A;  3HOT A;  3R3L A;  4IOC L;  4L8R B;  4JLH A;  3P39 A;  4KHQ A;  1NJW A;  4EZ9 A;  2ZWH A;  3T69 A;  3V9X A;  3HM8 A;  4H0P A;  3MN7 A;  3FE1 A;  4CF1 A;  4X62 K;  5AQH A;  3HXM A;  3CME N;  1NMD A;  3AVJ A;  2JLE A;  2HBJ A;  2HHT A;  3NAE A;  4HUG A;  3TR8 A;  5FRN A;  1JLQ A;  4PL7 A;  4F3T A;  4PA1 A;  1YVN A;  2Y1I A;  2YI1 A;  4Y1D A;  2IVO A;  4FYD A;  3VQ7 A;  5AJ3 K;  4DTX A;  2LSN A;  3KLH A;  2O4G A;  2HOE A;  3KTQ A;  2XY8 A;  1TUU A;  1VSD A;  4HTL A;  2O4I A;  1HUX A;  3RR7 A;  1IG9 A;  2WTU A;  2F9T A;  4RG8 A;  3C6T A;  2H3G X;  5JLH A;  1X9J A;  2A1S A;  3I56 N;  1S1V A;  3F9K A;  5I42 A;  1TGO A;  4FJK A;  1H1V A;  2I7P A;  2QWN A;  3CFR A;  1KLN A;  2OTJ N;  3OYL A;  1L3U A;  3NF8 A;  1TKT A;  5LMU K;  1KSP A;  4CK2 A;  2Q0U A;  1IBK K;  2IS3 A;  5KQD A;  4LF9 K;  4K25 A;  1C0F A;  2CGK A;  3CQX A;  2FBX A;  4IWV A;  2QTD A;  3ATU A;  1J9A A;  3T7Z A;  3I55 N;  1QVF M;  2ZJP L;  2NRH A;  1VQL N;  4I2Q A;  4M3Y A;  2YJF A;  4CJ3 A;  3BGR A;  4OPJ A;  4BRQ A;  3I0S A;  4Z4G A;  4FPB A;  1HKB A;  3CI5 A;  3KD5 E;  4E1M A;  3C0B A;  4CBX A;  2PZS A;  4JI6 K;  4FWQ A;  3TSQ A;  3LZI A;  3HT3 A;  1S1U A;  4DFK A;  1EET A;  3J7Z O;  1VSK A;  1NNE A;  2X6N A;  4EIA A;  1HRH A;  2VG5 A;  1YVU A;  2B6A A;  5CY4 A;  2F96 A;  1TKZ A;  3HL8 A;  3DLR A;  1NOZ A;  1HYZ A;  4ISE A;  1CZB A;  3HPG A;  4C1N K;  4JHD B;  2QA4 N;  1TK8 A;  4DV7 K;  5AQR A;  3DLE A;  3HTV A;  4DR6 K;  2NNW A;  3NMU A;  1CZA N;  3C6H A;  3ULD A;  3F9M A;  3SZ2 A;  1UWB A;  3LDP A;  5HRN A;  2P9S A;  1NGI A;  1N5Y A;  3AVI A;  4JKA A;  2G8H A;  4EHU A;  1WBB A;  3TPQ A;  4FXD A;  4FOE A;  1TAQ A;  2XY6 A;  5LJW A;  3CC7 N;  2O8D B;  1HLU A;  4CZL A;  4K8X A;  1IH7 A;  2IOC A;  3CHW A;  1P90 A;  5BRE A;  2A42 A;  2E1Y A;  2QWR A;  1VRT A;  4MDA A;  4RW7 A;  1JL2 A;  3MED A;  3OYN A;  1L3V A;  4CEB A;  4PKH A;  2KHO A;  2ZQB A;  3M3Z A;  1G15 A;  2E6M A;  3KHY A;  3AO5 A;  4FLY A;  3P83 D;  1NGD A;  1J5E K;  3PLA A;  3HK2 A;  2NUB A;  1LV5 A;  1WB9 A;  3S41 A;  1YXQ A;  3R1X A;  5BR9 A;  1YIT N;  1VQ7 N;  3MMV A;  3RWU A;  1IKY A;  4AHC A;  5HRS A;  5C2F A;  4CF2 A;  3KLG A;  1RTI A;  3NDK A;  4A61 A;  1U45 A;  2FF3 B;  1VQO N;  3V9Z A;  4DTN A;  3TWH A;  1NG9 A;  4E7J A;  3TI0 A;  1RT7 A;  2DFF A;  3FZK A;  3LM9 A;  3VEV A;  3ZCM A;  4YY3 K;  2OPQ A;  4CEF A;  4JKD A;  5AQS A;  4FLV A;  2BH1 A;  2F9W A;  4FW2 A;  3TAB A;  4ELV A;  3M8S A;  4CCH A;  3MXJ A;  5BPL A;  4B9S A;  3J7A P;  4BQZ A;  1C1B A;  4H5W A;  4LC9 B;  3D7E O;  1V4S A;  2A6A A;  4L3Q A;  2HHW A;  3KIO A;  1RIL A;  3BZK A;  3CQY A;  1VQK N;  1VSJ A;  1EWQ A;  5FPN A;  3GBT A;  3E1Y A;  3NCI A;  4AF1 A;  5KGX A;  5IWA K;  1NJY A;  3DRS A;  4AM6 A;  4M42 A;  3TAQ A;  4B9N A;  3OYK A;  4CJS A;  3AVK A;  3BP8 A;  1S1X A;  1VQM N;  1IG8 A;  4CZF A;  3THX A;  1J53 A;  3SCX A;  3U6F A;  1VK0 A;  3MCP A;  3VMF B;  1YI2 N;  1NJX A;  3QEX A;  1VQP N;  1N34 K;  2NRR A;  4FVU A;  2JGU A;  1Z05 A;  4R79 A;  5FRM A;  4DQP A;  3E66 A;  4KI4 A;  4J8F A;  4DU3 A;  1VQ5 N;  1CXQ A;  3KWG A;  4NLB A;  5M1N A;  3CCM N;  4EAH D;  5HP1 A;  3CJA A;  5CR4 A;  2ITM A;  1LCU A;  2A3Z A;  1RTJ A;  3HM9 A;  1WLJ A;  1QHT A;  2D0O A;  2UUC K;  3D2E A;  2Q0R A;  1NGH A;  4IBN A;  4OKE A;  5HRO A;  4N5S A;  4GV6 A;  3VQ8 A;  1KFS A;  4YOU A;  4BRE A;  2VGN A;  4J2B A;  2RF2 A;  1GLC G;  5I3U A;  5GAG P;  4MLE A;  2WC9 A;  1X3N A;  4BRD A;  3VOV A;  3I8B A;  4Z4C A;  4HCB A;  1V4T A;  2NZT A;  4B3O A;  2VWJ A;  4KB1 A;  3L4Q A;  1LWF A;  2UUB K;  2KFZ A;  4FZZ A;  1OVY A;  1NGA A;  2E88 A;  2QW9 A;  2ZJR L;  3QES A;  4FK0 A;  3TAG A;  4ILJ A;  4CZE A;  3QFP A;  4H0T B;  4BAC A;  3VQ9 A;  4LY7 A;  3D2F B;  2HHQ A;  4M3W A;  1QZ6 A;  3BF1 A;  3OYH A;  3VES A;  3DAW A;  3VGM A;  3LP0 A;  4GW6 A;  2P9S B;  1WAF A;  3H46 O;  2ATQ A;  4C23 A;  3HVR A;  4ELU A;  4O4G A;  1XC9 A;  3A0I X;  3LDL A;  4DHY A;  5GAD P;  5AQT A;  3M1F A;  1WBD A;  3AVC A;  1NGG A;  3G6E N;  3PX4 A;  1OH6 A;  4IO8 A;  2CGL A;  1LW2 A;  1VRU A;  3FZH A;  1HJO A;  4CF0 A;  4C8K A;  1BL3 A;  4O0J A;  4OJR A;  5J2N A;  3QLH A;  3QEP A;  4DUY K;  4A5B A;  3CQ8 A;  3L4I A;  5AQZ A;  3KD1 E;  5AQO A;  2WFB A;  3DXK A;  3DRP A;  3K59 A;  2E5L K;  4CBW A;  5KPZ A;  1BO5 O;  3AAQ A;  4CGJ A;  3L2R A;  1B9D A;  3OYA A;  4CJQ A;  4LFB K;  1F21 A;  2W6K A;  3LL3 A;  4BE0 A;  4CGI A;  4KHW A;  2D5R A;  3L0Q A;  1SZ2 A;  3VEY A;  3LM2 A;  2A40 A;  3KK3 A;  2NRZ A;  5KRS A;  2EX3 A;  3CCU N;  3OTO K;  3QET A;  4DR4 K;  3OVN A;  1JLG A;  3TAP A;  4NCA A;  4NO7 A;  4XH5 A;  1P8Z A;  3MX2 A;  4LFA K;  1TK5 A;  1RBS A;  4IEE A;  1OH7 A;  1WSH A;  5E26 A;  5BRF A;  1RT6 A;  4BRA A;  5EOY A;  2E4L A;  1HNV A;  4LH5 A;  1Q9X A;  3VEO A;  1ATN A;  1T44 A;  5KQ8 A;  1NKE A;  3MEE A;  3H1V X;  3QNO A;  1LWC A;  3BZC A;  3QIO A;  5BR8 K;  5ADX A;  5AQJ A;  5M1F A;  1BCM A;  3EKS A;  3THX B;  4QS7 A;  5EXW A;  4Q5V A;  4B8C A;  3I8D A;  4DV6 K;  1RDA A;  4B9L A;  4IG3 A;  4JI2 K;  4JNE A;  3RTV A;  4QAG A;  3SMS A;  4CJ4 A;  4IZ9 A;  1EP4 A;  1EX4 A;  4H0V B;  1N36 K;  3O5B A;  5FPE A;  2GBZ A;  3ZX3 A;  4OLA A;  3VN5 A;  4M3U A;  4IOX A;  4GVM A;  4CF8 A;  1M90 O;  1IJJ A;  2YNF A;  1O1W A;  4O5F A;  5GIP A;  3CCS N;  3D6R A;  4FSV A;  3CC4 N;  3IS9 A;  3IAY A;  1HR0 K;  4KRF A;  1HQU A;  4DSL A;  5AQU A;  4DU1 A;  2IGI A;  1HX1 A;  4KHP K;  2B4J A;  3TAR A;  5HLF A;  4UQG A;  1IKW A;  4JKG A;  3WXL A;  3D2E B;  2D0A A;  1XWL A;  3P5J A;  3UKR A;  1LW0 A;  1L3T A;  3EYZ A;  4ILH A;  1A5W A;  1FW6 A;  1RDU A;  2AA4 A;  4B08 A;  4CGD A;  4KTW A;  5KTQ A;  3SUN A;  3CJ9 A;  3HI0 A;  5BRH A;  3OYE A;  3DXM A;  4MLH A;  1BIS A;  3IUC A;  4AHR A;  4FO0 A;  2QKK A;  1TYQ A;  4DWI A;  1BQM A;  3P1G A;  3P4I A;  3ZET A;  4DQQ A;  4RTF D;  2YHY A;  1MWM A;  1QE1 A;  1YTU A;  4C8N A;  3VF4 A;  1GLD G;  3LAM A;  3NF9 A;  4FWN A;  5EU7 A;  4ZHR A;  3KK2 A;  4E7H A;  5AQY A;  1RCH A;  3CJB A;  3CCQ N;  1GLF O;  4CJV A;  4OPA A;  3BDP A;  2Z1J A;  1SQK A;  1YF5 L;  3V1O A;  3AO3 A;  4B1U B;  3PSF A;  4WE1 A;  5LMN K;  4JYA K;  4DR2 K;  2OPR A;  2O8B B;  4NYF A;  2W41 A;  2KW4 A;  2BE2 A;  3MXI A;  4MO5 A;  4WFB L;  4B1X B;  1BG3 A;  3EEQ A;  4BRM A;  2D1K A;  3MDQ A;  4FWS A;  5DM7 L;  4A2B A;  2VCP A;  5GIO A;  4BRI A;  4CK3 A;  1WSJ A;  4JI0 K;  4JV5 K;  2Q2R A;  3LDS A;  2AJQ A;  1SUQ A;  4DTR A;  4WQ4 C;  1D9D A;  4K0K K;  3QER A;  1X9W A;  1YIJ N;  4FOI A;  1ZBL A;  3DXK B;  1BU6 O;  3KLI A;  3ALY A;  4BG8 A;  3IFR A;  4CIE A;  3ZT3 A;  1ATS A;  4G9Z A;  1BGX T;  2P9U A;  2G8U A;  2O8C A;  5GIN A;  1SL2 A;  3TAE A;  3ZSW A;  3KJV A;  3ZSY A;  4WYB A;  4HCC A;  4PUO A;  3OBY A;  3R8E A;  4CI6 A;  1C6V A;  3THV A;  1I39 A;  4BC4 A;  1BA0 A;  4JKH A;  3THY A;  3K9K A;  4XH1 A;  4CZK A;  5BPN A;  2Y1J A;  4XEI A;  1K8K A;  4DSK A;  4FZX C;  2P9L A;  5ELZ A;  5AQG A;  4ZTF A;  3QIC A;  2V52 B;  4K42 A;  1A5V A;  4W5T A;  2ASO A;  3E9O A;  4FJL A;  4LFC K;  4FK4 A;  3ID6 A;  2DTU A;  3O1W A;  4AHU A;  2I5J A;  5CYM A;  2G8I A;  5TKY A;  3DLL L;  4IDK A;  2PFU A;  4I9L A;  2NRT A;  3Q7C A;  1VQ8 N;  2W6L A;  5JS2 A;  3AAR A;  3C95 A;  4JI8 K;  1Q8I A;  3SAG A;  2HVH A;  4BC2 A;  1JLC A;  2E2O A;  3NGZ A;  1WSI A;  2KTQ A;  4KHY A;  1BI4 B;  4GY2 B;  3QEV A;  4BDP A;  3WNG A;  3G10 A;  3S3O A;  3ZYY X;  3OYC A;  4B1W B;  1EQY A;  2Z1H A;  1Z26 A;  5A2Q O;  3VF6 A;  4BDY A;  1NLV A;  1NGJ A;  1YHQ N;  2UXC K;  4GMJ B;  4WF9 L;  3AVL A;  4CJP A;  4GVE A;  2W40 A;  1QQO A;  3E01 A;  4O44 A;  3UE5 A;  2E1Z A;  1WUA A;  1A5X A;  4CJR A;  5HBM A;  4JK9 A;  3K5O A;  4GNI A;  3VET A;  2CH5 A;  3NH1 A;  4JKG B;  1XMO K;  4FLX A;  1ZXO A;  1S9G A;  3ZSR A;  1U4B A;  1Q82 O;  3UKR B;  4A59 A;  4CJL A;  4KBO A;  1N6Q A;  4FVM A;  4M7X A;  3ZSX A;  3RVC A;  1T05 A;  4HUE A;  1KXP A;  3U4L A;  3KK1 A;  4B9T A;  1KAX A;  5E41 A;  3M6G A;  1T03 A;  4F9O A;  2IAJ A;  2BTF A;  1RT3 A;  4BR7 A;  3VQB A;  4LF5 K;  4QS8 A;  4DSJ A;  3ZT1 A;  2KZZ A;  3JYT A;  4OVL A;  3RRG A;  4I7F A;  1YT3 A;  3LDO A;  2HHV A;  4LF8 K;  3L2Q A;  2O8F A;  3ZET B;  2RKI A;  1WSE A;  1HNW K;  1S1W A;  1W9H A;  4BWJ A;  4JRP A;  2PAV A;  3V81 A;  2P9P A;  3A5N C;  3CCL N;  4BC5 A;  1R59 O;  4IG0 A;  4CK1 A;  4CHZ A;  1W97 L;  5F2R A;  4CEC A;  2KLA A;  5C2D A;  4JKF A;  4JN4 A;  1GOA A;  4CFA A;  1NOY A;  2HMP A;  3ZT4 A;  4YNQ A;  1VSE A;  2QWP A;  3VTI A;  3OA9 A;  2Q36 A;  1M1K O;  1NMN A;  3RMB A;  4H5V A;  4BY9 C;  3GOI A;  4E3S A;  4NB4 A;  3SMP A;  4E7K A;  5DMR A;  4DR3 K;  4JEP A;  2E8A A;  1ZBH A;  3EZW A;  5J2M A;  3F5T A;  3W3D A;  3RMC A;  3VEW A;  1XHX A;  1Y64 A;  1HKC A;  2FBV A;  3HSC A;  4FWM A;  4MO4 A;  5IT9 O;  3TAN A;  1G99 A;  4GV9 A;  5AQX A;  1K9M O;  3EL2 A;  2OZM A;  4PL8 A;  1U04 A;  2R7Y A;  2RHK A;  2XY7 A;  2RN2 A;  1T3V A;  5JVG L;  5FPM A;  5J1E A;  3CC2 N;  4PWD A;  3LWL A;  1NM1 A;  2P9U B;  4PKG A;  2O8C B;  4Z4H A;  1RT2 A;  1Q18 A;  1VSF A;  1ZBU A;  4WFN L;  1EO1 A;  4RW4 A;  5HRP A;  2DPN A;  3THY B;  3K58 A;  2DFH A;  3VQC A;  1UOC A;  1K8K B;  5AQF A;  1T8E A;  4EZ6 A;  2P9L B;  2F8T A;  3ZT2 A;  2OPS A;  4CF9 A;  5GAH P;  2P9K A;  5CYQ A;  4BRK A;  4FK2 A;  5AQM A;  1C0T A;  3QDK A;  3VTH A;  2D0C A;  3IKM A;  2E2Q A;  2YCH A;  4WQ5 A;  3NE6 A;  3SBG A;  2NRW A;  5C15 A;  4FWK A;  1WNS A;  4JI1 K;  1J6Z A;  3WQU A;  4Z4I A;  3AVA A;  3SQ0 A;  1JL1 A;  2ZD1 A;  1DT9 A;  3FZM A;  4B1V A;  3GE1 A;  3L6Q A;  4DTM A;  3OJS A;  2VG6 A;  4MDB A;  2HNY A;  3CG7 A;  5F1X A;  3O80 A;  2ZJQ L;  4CEQ A;  4HWI A;  4FJJ A;  5LY3 A;  3HJF A;  4FW1 A;  4CZM A;  1BUP A;  4OKK A;  3H45 C;  4LF6 K;  4E7I A;  1Z25 A;  3VQ4 A;  4E1J A;  3QB0 A;  4Y0W A;  3LP1 A;  2EWS A;  2OTL N;  4B3T K;  4F3O A;  4GKJ K;  4X66 K;  3VA3 A;  5AFU A;  3V9W A;  2YHA A;  4BGB A;  1QS4 A;  4LF7 K;  3AVB A;  3E9L A;  4CHO A;  3G71 N;  3DMJ A;  5KPT A;  3OS1 A;  2P1J A;  3N4P A;  3H6E A;  4JI7 K;  3Q7B A;  5C0Y A;  1N8R O;  4ISG A;  4W5Q A;  3TTF A;  3EE8 A;  1BQN A;  1QQM A;  3O9S A;  1HPZ A;  1TAU A;  5FRO A;  2VGM A;  4IEI A;  3ID8 A;  4KO0 A;  4ELT A;  1Y97 A;  3O9R A;  1ITG A;  3NF6 A;  3B6P A;  2HNZ A;  4BR2 A;  5MLC Q;  3MX5 A;  4M3R A;  1QSS A;  4RW8 A;  3CCR N;  3MXM A;  3A8Y A;  4KI6 A;  4M45 A;  4K43 A;  4DQR A;  3WXM B;  1KLM A;  3CD6 N;  2HVI A;  1Q7Y O;  2ETJ A;  3TAF A;  4CW7 B;  4E0D A;  3FLC O;  4FLZ A;  1GOB A;  1SL0 A;  4B9Q A;  3FR0 A;  3CPW M;  4JI4 K;  2O8F B;  1GLL O;  4W5O A;  1MWK A;  3ZX0 A;  3HPO A;  1T6C A;  3O1B A;  3CM5 A;  1WSG A;  4XIU A;  1EKE A;  2X74 A;  3NGY A;  2UXD K;  3M8R A;  2FBT A;  1NK7 A;  5C25 A;  3CMA N;  3RRH A;  3WQT A;  4DTU A;  2BUP A;  1L3S A;  5SZT A;  2EHG A;  4R5P A;  4J2D A;  4E89 A;  3OW2 M;  1Q81 O;  4CZG A;  4DFJ A;  3QIP A;  4AH9 A;  4H0O A;  3CCJ N;  3WNF A;  3AO1 A;  2GEL A;  4CGG A;  1Q86 O;  4EFH A;  3HOS A;  1NK8 A;  1JLA A;  3WXK A;  3OJU A;  3AVN A;  3I0R A;  3PSI A;  3PV8 A;  1GLE G;  1NJI O;  3SV4 A;  2UXB K;  5M1P A;  1NK9 A;  2HHH K;  4J2E A;  3F73 A;  3T1Y K;  4DV3 K;  4FM2 A;  1ATR A;  4O55 A;  3BY5 A;  2HHX A;  3M8P A;  3QML A;  3U3G A;  4CEO A;  3VQE A;  3MEG A;  4E1N A;  1KVA A;  3AVG A;  3QFU A;  2QWM A;  1X1P A;  2HW3 A;  3DLK A;  4KHS A;  3L2U A;  4BR4 A;  3D0P A;  3KWI A;  3U9Z A;  4HTU A;  2UUA K;  1KQS M;  5SWM A;  3FZL A;  1XI1 A;  3L2V A;  2IVN A;  3EN9 A;  4C8L A;  3TU5 A;  4W5N A;  1JLB A;  4DV2 K;  1SV5 A;  4BRG A;  2V51 B;  5BN8 A;  2E2P A;  4Y1C A;  4A57 A;  1RT5 A;  1X9S A;  1S3X A;  3K0S A;  3V4I A;  1VSL A;  4I2P A;  2IC3 A;  2P9K B;  4DV1 K;  1RDD A;  1NWK A;  3MEC A;  1KFD A;  1ZBF A;  1OH5 A;  5K14 A;  1NU0 A;  1IV0 A;  5AQP A;  2QWQ A;  1N32 K;  3OYF A;  3MWT A;  1ZBS A;  5AQQ A;  1XUP O;  5KPR A;  1I3A A;  4J2A A;  4DR7 K;  1X9M A;  3SJJ A;  1NK5 A;  3SJH A;  2P9I A;  3PO4 A;  2OA8 A;  3K2P A;  2OZS A;  4B9V A;  3FFK B;  4FJG A;  2V7Y A;  5D3G A;  3KKS A;  4CJW A;  3EO3 A;  2WBN A;  4JKE A;  4CIG A;  3LZJ A;  1DTQ A;  2ZGZ A;  4C1N I;  4Q0B A;  1VQ4 N;  4ID1 A;  2QWL A;  4BQL A;  3FGU A;  1J54 A;  4IFE A;  3MN5 A;  3T19 A;  4BR5 A;  3S3M A;  1NGE A;  3VQQ A;  4UY8 O;  3NBP A;  2NRV A;  3OYM A;  2Z1I A;  3C7N A;  4KH4 A;  1VQ9 N;  2XHB A;  3KVG A;  4YHH K;  1NGF A;  3L8B A;  4H03 B;  4CD3 A;  1TKD A;  2GV9 A;  2AP1 A;  3AAP A;  1C0U A;  1K6Y A;  2YNG A;  2B5J A;  2YHB A;  4LD0 A;  1IBM K;  3IG1 A;  1RDC A;  3MN6 A;  4HHT A;  1TKX A;  2W42 A;  3AA5 X;  1JJ2 M;  4YOR A;  4NYN A;  4DKW A;  1CXU A;  3C65 A;  3AO2 A;  4O8U A;  3AA2 A;  4CEZ A;  4OPK A;  4Z0U A;  4U7B A;  4ICL A;  3A2F A;  3EE9 A;  2X78 A;  3SV3 A;  3JXU A;  5GAE P;  4H8K A;  3LPT A;  1XQS C;  3LAK A;  4JKB A;  2IVP A;  3KK7 A;  1N33 K;  4Z94 A;  1QTM A;  4I9Q A;  1LWE A;  5C24 A;  4DTP A;  3CFP A;  2FF6 A;  3QO9 A;  2D0B A;  2ASP A;  4K8Z A;  3M5R A;  1E3M A;  2FSJ A;  1ASV A;  1RDB A;  4CJ5 A;  2E6L A;  4OGE A;  1GOC A;  4DTS A;  1T6D A;  2E20 A;  3P38 A;  4KH5 A;  3ENO A;  1Z6R A;  2BDP A;  4KFB A;  4CFB A;  4JHD A;  1EXQ A;  1DTT A;  2GWK A;  4DLG A;  4DQS A;  4M63 C;  4G1Q A;  4CED A;  4H4O A;  3EY1 A;  4BRF A;  4MQ3 A;  4DLE A;  4ISF A;  1KVB A;  3S9H A;  4IKF A;  3ENH A;  4I6M A;  1SL1 A;  5AQV A;  1BOT O;  4OKJ A;  4JS5 A;  4RW9 A;  3DLG A;  4DFP A;  4BWM A;  4A62 A;  4FLU A;  3OYD A;  4CGH A;  2KQ2 A;  4FM0 A;  5KRT A;  5CZ2 A;  2E2N A;  4M7Y A;  3HZ6 A;  4YDU A;  5DM6 L;  4B1Z A;  4HVJ A;  3ZT0 A;  3J80 O;  3AVH A;  4B3M K;  2O8D A;  3SPY A;  1VSM A;  3FZF A;  4DF4 A;  1RT4 A;  3O9U A;  4YOY A;  1TUY A;  2HB5 A;  3CYM A;  4QOZ B;  3MN9 A;  2VWK A;  3N4Q A;  4BR9 A;  2HMI A;  2GTD A;  3ZEU A;  4LF4 K;  3ZSQ A;  4BR0 A;  1HNX K;  2UYT A;  4U67 L;  4CFC A;  3V1R A;  1W0H A;  3O6W A; 
#chains in the Genus database with same CATH homology
 4DR4 K;  4JI7 K;  4JI8 K;  4DR3 K;  1J5E K;  1IBM K;  4LF9 K;  4LFA K;  4AQY K;  4DV0 K;  1IBL K;  2F4V K;  4DV2 K;  5IT9 O;  5A2Q O;  1FJG K;  1XNR K;  2UUB K;  5LMN K;  2VQF K;  1HNZ K;  4JYA K;  4YY3 K;  4DR2 K;  1N33 K;  2UXC K;  4DV1 K;  5FLX O;  5BR8 K;  4JI6 K;  3J7A P;  4CVN E;  4CW7 B;  3T1H K;  4DV6 K;  1XMO K;  2UU9 K;  2ZM6 K;  4JI2 K;  1XNQ K;  4JI0 K;  1N32 K;  4JV5 K;  4JI4 K;  4K0K K;  4DR7 K;  1N36 K;  1XMQ K;  5IWA K;  4JI5 K;  2UXD K;  4X62 K;  2VQE K;  4B3R K;  1HR0 K;  4DV7 K;  1I94 K;  4DR6 K;  4B3S K;  4LF5 K;  3J81 O;  4V19 S;  4KHP K;  4JI1 K;  5AJ3 K;  1N34 K;  4LF8 K;  4X65 K;  4DUY K;  1HNW K;  5LL6 Z;  4X64 K;  4OX9 K;  3J80 O;  4DR1 K;  4NXN K;  4DV4 K;  4B3M K;  4DUZ K;  2E5L K;  2UXB K;  4LF6 K;  2HHH K;  3T1Y K;  4DV3 K;  4DV5 K;  4JI3 K;  4LFB K;  4YHH K;  4B3T K;  4LFC K;  4GKJ K;  4X66 K;  2UUC K;  4LF7 K;  4LF4 K;  3JAM O;  1HNX K;  4NXM K;  3J7Y P;  5LMU K;  4DR5 K;  2UUA K;  3OTO K;  1IBK K;  4GKK K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...