4YY3K

30s ribosomal subunit- higb complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4yy3K00
5IWAK 4DR1K 2UU9K 4LF7K 4JI8K 4DV2K 1IBKK 4DR6K 1N36K 4JYAK 1IBMK 2ZM6K 1IBLK 4CVNE 2UUBK 5AJ3K 3JAMO 4K0KK 5IT9O 5FLXO 4LF4K 4KHPK 1XNQK 4DUZK 4X65K 2UXDK 2VQFK 4B3SK 1I94K 1XMQK 1N34K 4DR3K 4LFBK 4CW7B 4YY3K 4JI5K 3J7AP 4X62K 2VQEK 1HNZK 1HNXK 4DV6K 1N32K 4NXMK 4OX9K 4JI7K 4X66K 4JI2K 1XMOK 4V19S 4GKKK 4DR4K 4B3TK 4JI0K 4LF5K 1HNWK 3T1HK 1FJGK 4DR5K 3J80O 4DV7K 2UUAK 3T1YK 2UUCK 3J81O 4JI4K 5LMUK 3J7YP 4DR7K 4B3RK 4DV5K 4LFCK 1N33K 5A2QO 2UXCK 4JV5K 4DV4K 4DR2K 1J5EK 2HHHK 4JI1K 3OTOK 4X64K 2UXBK 4DV0K 4LF6K 4DV1K 1XNRK 4NXNK 4JI6K 4B3MK 4LFAK 4DUYK 1HR0K 4GKJK 4JI3K 4LF8K 2F4VK 2E5LK 5LMNK 4LF9K 5BR8K 5LL6Z 4DV3K 4YHHK 4AQYK
chains in the Genus database with same CATH superfamily
3B6PA 3NE6A 1HYSA 4NYNA 2E2NA 3C6TA 3VQ7A 3P38A 5CR4A 5EU7A 4IDKA 3HVRA 1GLJO 2DFEA 2X74A 5BR9A 4PKGA 3QNNA 3D2EB 4DHYA 4CZFA 1JLGA 1X3NA 2X6SA 2YKMA 3UE5A 3KLGA 1IG9A 4CGHA 2ZE2A 4E7IA 2A5XA 2NUBA 2HMPA 2G8WA 3K9JA 4NCBA 1BG3A 4LFBK 4O5FA 3D7EO 3SQ1A 3LPTA 1HNXK 4YDUC 1VK0A 3HK2A 3CCQN 2A3ZA 1HQUA 3MDQA 1RT6A 4NXMK 4DQ8A 5E41A 3HO1A 3SMPA 3PX0A 3M8SA 4V19S 3R9PA 2Z1JA 5AQRA 4JRPA 1MA9B 4ZTJA 3P31A 4NCGA 4ILJA 2E8AA 4LF5K 4GVMA 1RTIA 3MEDA 4DMNA 3HBTA 3MXIA 3PIPL 3LWMA 4EHTA 3VEWA 3MCAB 5JLFA 4Y1DA 4KHSA 2FSNA 4GV3A 1IKWA 2HOEA 2UYTA 4BR0A 2Q2RA 5DK5A 1KXPA 4CI6A 2HVIA 1VSMA 4HTUA 1LWEA 3QBXA 4I9LA 1TYQA 2P9PA 2ASOA 1HPZA 1RBSA 3OYDA 2FBYA 1ZC6A 4YOYA 4GMJB 4YORA 1U48A 3IG1A 3TI0A 3CMAN 2HBJA 1BI4B 1EETA 1L5UA 4CJRA 4M45A 2IVNA 1NOYA 1SL1A 3AO1A 1QQMA 1JL2A 5SWMA 5I3UA 3IUCA 1JLQA 1KD1O 5KPZA 4FM2A 3VEVA 2BH1A 3AY9A 4CJPA 1U49A 2OPQA 4KKOA 3UKRB 1L3UA 4OPHA 1FXXA 3Q7BA 5M1QA 4J2AA 4B9UA 1OH8A 3PO4A 1D9DA 3M6GA 4FJHA 4ISGA 1RILA 3HSCA 4ID5A 2P9SA 3GE1A 1OKJA 4FL9A 5C10A 4BRHA 4DTJA 1LAVA 1NK0A 4CJWA 2YV0X 1NOZA 1EWRA 4X65K 1VSHA 2RF2A 3LM9A 4QS9A 3FZKA 2FC0A 4E0DA 3P4IA 4IEIA 3NMUA 2QW9A 4YOWA 4M3XA 3HPHA 4FK0A 1ASWA 2OTJN 2O8BA 4BR4A 1IH7A 3DLLL 1KRPA 3T1AA 1S9GA 4OO1J 5FPEA 3CFRA 3ID8A 4FK4A 1RBRA 2PFUA 3F9KA 4U7BA 3KWIA 3TABA 4B9MA 5AQIA 4B9SA 2GWJA 3OS0A 2KQ2A 3CERA 1UWBA 1RNHA 4RW7A 2GTDA 4Q5VA 4M3TA 3HM8A 1VQ6N 4NB4A 1M90O 2WONA 4DG1A 5JS1A 3ALYA 3H1VX 1NGCA 3OYFA 3RMCA 4DR7K 2F9WA 1GLFO 3C7NB 3QFUA 3EO3A 4DV5K 1N33K 4JKEA 3PO5A 3WNHA 3AVIA 3TARA 3V9UA 3S41A 2HHHK 1Q7YO 2VYPA 4B9NA 4DWIA 1NJIO 3FZFA 4PKHA 1HKBA 4EFHA 2OPSA 4BDYA 2Z1IA 4JRQA 4M41A 4DF4A 1EO1A 4LF6K 4CFDA 3ZT1A 4EHUA 5GIOA 1TUYA 3OHRA 1ITGA 1F21A 4FM1A 1SUQA 2D0CA 3CG7A 2P5GA 3OBWA 4JKAA 5BR8K 4CBXA 3U3YA 5HRRA 1P90A 1BCMA 1C1AA 4B9QA 3R3LA 2WBNA 4Y1CA 1SKSA 3G6EN 3CFPA 4JYAK 4Z4FA 1ZBHA 1RTDA 3TAQA 3RR7A 2UUBK 3NF7A 5AJ3K 3SV3A 3H46O 1B9DA 1GOAA 2YKNA 3CJBA 1RT2A 1NBWA 2Y1JA 1JL1A 2E1ZA 1Q8IA 4ILHA 2ZWHA 5AZJA 1XMQK 3ZETB 2NRVA 2FXUA 2PBDA 1N34K 5HRPA 4FM0A 2GX9A 4CEBA 3ITHA 3K2PA 3O08A 2VQEK 3HM9A 1B92A 4EZ6A 4BWMA 4RW9A 4OX9K 1HJOA 2GUPA 5AFUH 3OYJA 3CCEN 4WYBA 4AF1A 1X9JA 4GKKK 3WXIA 4O4GA 4RW4A 5AQWA 4KH6A 4E7JA 4LD0A 2CGKA 1IJJA 3E66A 1WLJA 2BDPA 1J54A 1TAQA 3EYZA 1HLUA 4ZHRA 1NK4A 5AQJA 5C15A 3OYGA 1JKHA 3IFRA 2Q3SA 1T05A 2HHSA 5FPDA 4CGIA 4PA1A 4QOZB 4FCYA 1LAWA 5JVGL 4JI4K 1U45A 5J2QA 2W41A 3H3NO 3BDPA 4DTNA 3IDHA 3KD1E 4DTPA 4DR2K 5M1KA 1YTAA 3WT0A 5CZ1A 3F5TA 4CD3A 3F2KA 1J9AA 1J53A 4DV0K 2IVPA 2NZTA 3CI5A 3VESA 3C6AA 4WE1A 1XNRK 2XY8A 3RMBA 3V81A 3ZEUB 4FJ7A 1DGKN 3E9PA 2ZJQL 1RTHA 1XUPO 3FZMA 1UOCA 3OS1A 2IGIA 5AQLA 2A6AA 4J2EA 3LDNA 1OH7A 5LL6Z 4IJNA 3DI6A 3O3GA 1VQKN 1Q9YA 2YNFA 3HYFA 1TKZA 5C42A 4WFAL 4IXCA 4CJSA 1BDGA 3EL2A 3DLHA 4DFKA 5J2MA 2JWKA 3SMSA 1VQ9N 1FKOA 4DB3A 4HUFA 1S1WA 4K0KK 4LF4K 2E6LA 2ZF5O 1TKTA 2E4LA 2UXDK 3AO4A 5AQSA 4HWIA 4BGBA 3AA2A 4BC3A 3VQ5A 4DR3K 3TR8A 2YJFA 1BUPA 4FJGA 3OYBA 4CJ5A 4KO0A 1A5XA 2HSTA 3KLIA 3ENOA 3WEEB 4RG8A 1NGHA 4JI2K 2A42A 2V51B 4FWNA 3QICA 3DXKB 3ENBA 3D2FA 4PQUA 3O9RA 3B6OA 3DMJA 1NGDA 2A40A 2OZMA 5FRMA 1X9SA 1C0UA 3BZCA 5SZTA 1HKGA 2P9PB 2UUAK 1ESVA 1NGFA 4IFVA 3PSFA 3OYKA 1RDAA 3MCPA 1C1CA 4B08A 3C0BA 3BGRA 4CZLA 2LSNA 4FJ8A 2HHTA 4H5RA 2P9LA 2E2PA 3Q7CA 4DV4K 4PKIA 3WNGA 1JLFA 4FW2A 5EX5A 4BRGA 5CYMA 3NVMA 1TKXA 3R1XA 1VQ5N 4CCHA 2EWSA 1IV0A 4Z4IA 3WXMB 3VQAA 3AVGA 3SI6A 1SS6A 4M7XA 3MN7A 5C2FA 4B3MK 3O80A 1LW0A 3CCJN 3OA9A 4EAHD 2XY7A 1MWMA 5DMRA 1K8KB 4FPBA 4CZMA 4DTXA 3V1RA 5FDLA 5LMNK 2Q0RA 4FOIA 3NBPA 4DTOA 1KVBA 3CC7N 1VSEA 4MQ3A 1WBDA 4HUGA 4DR1K 4UQGA 3O3HA 2DTUA 1GOCA 5KPRA 1BWFO 1VRTA 1Z25A 3KZBA 5AQNA 3CJ1A 3HOSA 3VGKA 4BDZA 4E1JA 1HYVA 4KHWA 4A2BA 2G8HA 3SCXA 4M3ZA 3HT3A 3ZYYX 2OZSA 1MU2A 4CJQA 3KJVA 3VA3A 3AVCA 3S3OA 3OYAA 3TPQA 4CJTA 3J7AP 3CJCA 1NGGA 2IAJA 4NYFA 3OYMA 4M3UA 1TV6A 5AQOA 4BRQA 3PX6A 1DTQA 3BEXA 3A8YA 4JI0K 3T7ZA 4R5PA 2O4GA 5I42A 4JKFA 1X9WA 4CJEA 1NMNA 2V7ZA 4FXDA 1Z26A 3TANA 4CZGA 3THWA 4BQLA 1G99A 3H3OB 2GEMA 1BA0A 3LP3A 4DSKA 2FSJA 4BRKA 3OS2A 1H1VA 2ASMA 3LDQA 5AZIA 3UKUA 1NU0A 1KLNA 2QA4N 4CIEA 3C94A 5AQYA 3E9LA 5CYQA 3GG4A 3ULEB 4MLHA 2NLXA 1Q86O 1GLEG 4FPAA 2PZSA 1HR0K 2GWKA 3NAEA 5KGWA 1RBTA 5LJWA 1A5WA 4OPKA 2O8EB 1HNVA 3VPZA 4LF9K 3L4IA 4FLUA 4JEPA 3OYIA 1Z05A 2YHBA 1VSLA 3KK7A 3M8RA 3BF1A 3QETA 3D45A 3A5OC 5M1PA 3FFIA 3QNOA 4H5VA 4NO7A 4YFUA 1JLBA 5ELZA 2FBXA 2Q36A 4WCEL 3O9QA 3I8DA 1HX1A 3FE1A 4J2BA 3LDSA 3ULDA 1L3TA 1NWKA 4FWKA 2F8SA 5LY3A 2A1RA 4N41A 2HB5A 3I33A 3SAFA 4CHNA 4IKFA 1RGIA 4BROA 3CMEN 3RSEA 3L2QA 2PYJA 4X62K 4CHPA 3QEPA 3K5OA 3QEVA 3LDPA 4JI7K 1GLAG 3LZIA 1W0HA 3AA4A 3F73A 1RTJA 2QK9A 4PY5A 3L2VA 4LC9B 4DR4K 4JKDA 4A62A 2ITGA 1E4FT 4CF1A 4QCLA 1K73O 4JS4A 5AR0A 3W3DA 2P9KA 4KHUA 3CQXA 1BIUA 4OLAA 1RDCA 2HNYA 1XQSC 3SYZA 3U9ZA 3LP2A 4DKWA 1QVGM 4LFCK 3VF6A 2P9IA 5M1FA 5J2NA 1LW2A 1VQMN 1ATRA 4JK7A 2ZJRL 1YITN 1O13A 2E1YA 1FW6A 3RMAA 2A1SA 4OLBA 3NGIA 2Q31A 3ZX0A 4FJNA 3VMFB 4DFMA 4I6MA 3QBWA 3VERA 3SPYA 4GKJK 2VGNA 2NRTA 4FSVA 4F3TA 3U8XA 2E5LK 2O8FA 4B1WB 5B8HA 1WSHA 3AO3A 3O1WA 4YHHK 4BR9A 2B6AA 1XHZA 4HVJA 4BG9A 4CEZA 4JAXA 5J1EA 3KK3A 4H5TA 2IVOA 3HRGA 1OVYA 2IIRA 4CECA 4YNQA 2XHBA 2ZM6K 2WTUA 3G10A 4H0YB 4CEOA 5GADP 3KKRA 5BPNA 3WXJA 4WQ4A 1M1KO 1O1WA 1YXQA 1ASUA 2KW4A 4I7FA 3PIOL 2CGJA 4E7LA 4DUZK 4H0OA 2I5JA 1ZBLA 4O0JA 3E1YA 1KAXA 1SQKA 3HPGA 3ZT4A 4B1XB 3VETA 4CESA 1X9MA 3AAQA 3AGKA 4YY3K 4JI5K 3DOKA 3L8BA 3PX4A 3K5NA 3HP6A 1Y97A 1CZBA 5KTQA 3AA5X 1TAUA 1P8ZA 2P9NA 4CGDA 4CIFA 3ZSVA 2QKKA 2YHAA 2VWJA 3O4QA 1KSPA 4FJ9A 4XEIA 2VG5A 1C0FA 1FJGK 4K42A 4H4MA 1ZXOA 5CHIA 5H1SQ 2G8KA 4KPYA 4Z4GA 2IC3A 2FLOA 4WQ4C 3J7ZO 3U4LA 1YTUA 1OH6A 1VSIA 1REVA 2FSKA 2WOMA 3J7YP 1VAZA 4IFYA 3MECA 1VSJA 4RCHA 3IS9A 4CF0A 1WAFA 1RT1A 4UY8O 3QMLA 4B1VA 4IO8A 2XY6A 2O8CA 4WFBL 3R6MA 4Z4EA 4LFAK 2HF4A 4IG0A 4EP4A 3S3MA 4OVLA 3RTVA 4F8RA 3AO2A 4CBUA 3QIOA 4NCAA 4IEEA 2ZGZA 3ISNC 4DV3K 2J4RA 4W5RA 2E2OA 4GW6A 2D0BA 3AVLA 2GUIA 4JNEA 4W5NA 4MDAA 1N36K 4A61A 2E20A 5E84A 2IDOA 3LAKA 1NG9A 3I56N 3NGYA 3I55N 2NRZA 5BREA 5HP1A 1JXEA 3MN6A 3P39A 4F9OA 2O8DB 4B3SK 4JKGA 4OPAA 4DLEA 1N5YA 4FLXA 4CJ4A 4IOAL 4AILC 2D0OA 2VWKA 2P9UB 1Z6RA 4BWJA 1YUWA 1ATNA 4AHCA 4HTLA 1XMOK 1RBVA 4RW8A 1TK8A 4BRFA 3CHWA 4QS8A 1G15A 2HHUA 1WNSA 5HBMA 2OTLN 3OW2M 1QTMA 3HTVA 1YT3A 3CCVN 1V4SA 4FLTA 4FW1A 1ZYQA 2HHXA 4WF9L 3K0SA 1WSIA 3UKUB 4CJUA 5KGXA 3KVGA 4YOUA 4DFJA 4A2AA 3TWHA 3L2WA 3SPZA 4C23A 4DQQA 4Z94A 5LMUK 1VQ7N 3K9KA 1UA1A 3C6HA 2UXCK 4F3OA 3EKUA 1QS4A 1NGEA 1NNEA 2QKBA 5MLCQ 1KCFA 2BE2A 4JI1K 3ZT3A 3THXA 4XIUA 5BN9A 1BQNA 1QSSA 3WXLA 4JD2B 5JVHL 3I0SA 3QINA 4DTUA 3SJJA 5C0YA 3DRSA 3QEIA 1BISA 3NF9A 4FWOA 4FWRA 3A5LC 4BR7A 4BRIA 3VQ9A 3VN5A 4FWSA 2RN2A 2DFFA 1KVAA 3TU5A 5C2DA 4E19A 4A57A 4Y0WA 3OYLA 4E1MA 4FJ5A 1U2VA 5J2PA 1SL0A 4O8UA 4GY2B 3KD5E 5DM7L 4DV2K 4DR6K 3L6QA 1RT3A 1X3MA 3D2EA 3SUNA 3TAGA 3SJHA 4JN4A 1GLCG 3DLEA 3JAMO 1J6ZA 3P83D 5KPTA 4B9VA 4FK2A 3T69A 4F4KA 2FF3B 4RWTA 5GINA 1KC8O 1I94K 4MDBA 4O8KA 4O55A 1NKBA 4I2QA 3WUHA 3J8AA 4GV6A 4M42A 3ATVA 4KHQA 4OJRA 1T03A 1UAXA 1GLDG 2FBTA 1TUUA 2E2QA 4FJLA 4W5TA 3EZ5A 4X66K 4BACA 2KHOA 4DTMA 2CH5A 1NGBA 1QQOA 1ASVA 3O9UA 4BVOA 3LZJA 1RCHA 1YIJN 3AVFA 3SAGA 3GOIA 3AARA 4AM6A 3VQEA 1SAZA 3CCUN 3DLRA 4PL8A 2BUPA 3ZT2A 4BDPA 2P9IB 3RWUA 1GLLO 1Q82O 3TAFA 2G8UA 3JXUA 4H4OA 4QAGA 4KHYA 3RVCA 3IRXA 1BI4A 3VEOA 3U9DA 3A2FA 4FOEA 4HCCA 4MO4A 4FWLA 4GVEA 4KTWA 1BQMA 4ID1A 4KFBA 4CEFA 3OY9A 1T44A 2E6MA 3VA0A 1FK9A 4CFCA 4C8LA 2QWOA 3HVTA 3EE8A 1R0AA 1TYQB 2KLAA 1HYZA 1ZBFA 1YAGA 3OBYA 4JI6K 4DFPA 3T3FA 1BGXT 1XC3A 1CXQA 4ELUA 4JI3K 3TAPA 3JSMA 4BR2A 3THVA 3W0LA 4R79A 1XC9A 1SKWA 4ICLA 3TAMA 4IG3A 3AVKA 5AQGA 4AQYK 4KI4A 3MAQA 3C95A 3EEQA 3NHGA 1LV5A 2WUSA 2YNIA 3D0PA 3FZLA 3M8QA 1U6ZA 1D5AA 1QSLA 1VQON 2W6KA 2NRHA 4G9ZA 1NK6A 2P1JA 3GL1A 3SK3A 3VQCA 2NRXA 1EX4A 4BC4A 1SL2A 4CHYA 4N56A 4DU3A 4FJJA 1S22A 4AH9A 3LDOA 2P9SB 3GDQA 3ZT0A 1JJ2M 2EX3A 4FJXA 2A41A 1D8YA 4LY7A 5I9EB 1HRHA 1CZAN 3RRHA 3HZ6A 3MX2A 4CD1A 4BE2A 1NJXA 3HJFA 4Z4HA 5F1XA 3A5MC 3LP0A 1VSDA 2O8BB 4MFBA 3QEXA 3QB0A 5GAEP 2Q1NA 3HPOA 1W2BM 4PUOA 4GV9A 4TSXA 4K8XA 4N76A 3G25A 1W9HA 3LL3A 4C8MA 4CFBA 4IWVA 4M3RA 4FYDA 4DR5K 4JK8A 5EXWA 3C7NA 3VGMA 3MEGA 3VF2A 2QWPA 3AO5A 3MXMA 2XRIA 2ITMA 3J81O 4BREA 2DPNA 1FKPA 4U67L 5ADXA 4H0XB 4E1NA 5BRHA 1TK5A 2F8TA 1TL1A 2D1KA 4BR5A 4BQZA 1YVUA 3SUQA 2ASPA 4B8CA 3TSUA 4JS5A 4KAZA 5D3GA 1YJ9N 1S72N 1NKEA 1WAJA 1WSGA 4CJKA 2EHGA 3WNEA 1QSYA 2G8VA 3VQPA 4JHDA 1HQEA 3H1QA 1WSFA 4L8RB 3EKSA 3IAYA 2F4VK 2FF6A 3WQUA 3WXKA 4CHQA 3VOVA 2QXFA 2HNZA 5AQQA 1C0MA 1OVQA 4XH1A 1VSKA 2Q97A 3LPUA 3K5MA 5GAHP 3VTHA 2IS3A 2G8FA 3M3ZA 4FZYA 3O5BA 3AA3A 4JKGB 3OJSA 4FJKA 1RT4A 3ZETA 4GNIA 3IKMA 3CPEA 5AQXA 3AV9A 2BGGA 2AP1A 4LH5A 1NK8A 3DLBA 3AGRA 1RT5A 3VEXA 4DSFA 2VCPA 3CYMA 2RKIA 3O9SA 1IKXA 1KAZA 3ENHA 1S1UA 1EWQA 1TKDA 4DQPA 1KVCA 3BUZB 3L3UA 5AQPA 5AZJB 4H03B 3E01A 3EZWA 2ZGYA 5TKWA 4JLHA 4CEQA 3M1FA 3NCIA 4QS7A 4CE9A 4BG8A 2V7YA 2RHKA 1S9EA 2KFZA 4PL7A 3HL8A 5KI6A 2QEXN 3OYEA 2B4JA 2KKZA 4CZJA 2CH6A 1WN7A 2F9TA 2E88A 1YF5L 4DLGA 1NJYA 2PAVA 1I39A 2HBKA 4JK9A 1YVNA 3GBTA 3CPWM 3CD6N 2X78A 1IKVA 1XWLA 4B1UB 2O4IA 4B8AB 4DTRA 5A2QO 3VQ6A 2HF3A 4AHSA 3O3FA 3ZEUA 1YJNN 4X64K 3AVNA 3LANA 4DU1A 3EY1A 3PSIA 4PHTX 2VWBA 4DV1K 5F2RA 4EZ9A 1U2VB 3E9OA 4CJVA 1S1VA 1WB9A 3PV8A 3U6FA 2QI2A 2YHXA 2PYLA 1I3AA 3DJCA 5T7BA 3CCLN 4BVPA 3AVHA 2G8IA 1QHAA 4N47A 1VRUA 4BRAA 1KAYA 2UU9K 4AHVA 4JI8K 1IBKK 4YOVA 3A0IX 4O44A 4C8OA 4DS5A 3EN9A 4EIAA 1RDWX 3NF8A 5E26A 3THYA 3LALA 5HLFA 1KFSA 1NKCA 4DSJA 2JGUA 4O5BA 4J8FA 4AHTA 1RDUA 1NK5A 3SZ2A 5IT9O 1K9MO 3H6EA 1XNQK 1Q18A 2VG6A 1VQLN 2HBMA 2OCEA 3CQ8A 5C25A 2WFBA 1EKEA 1QZ5A 4FO0A 4MO5A 3WEEA 4CEDA 3FGUA 3CQYA 2GBZA 2YX6A 3KLFA 1NGIA 1UA0A 1QQCA 1HPMA 4HCBA 3K58A 3NGZA 3KK1A 5FROA 3DXKA 3D6RA 4LSLA 3ZX3A 5BN8A 2HBLA 4B9TA 4DQIA 1KTQA 3I8BA 4K41A 3VQ8A 3MWPA 4K25A 1JXBA 4KH5A 4EP5A 2BANA 4N5SA 5FRNA 3SLCA 3TSQA 1ATSA 4CGJA 3S9HA 4KREA 4CIGA 2HHQA 4CGGA 3FZHA 5HRNA 3G0ZA 2OPRA 4CEEA 4IOXA 3KHYA 3VEZA 1VQ8N 3LAMA 5AQVA 4CEAA 1S1TA 1E3MA 2BTFA 5KQ8A 3CCMN 3D2FB 3QERA 3HP9A 1TGOA 3WNFA 4FLZA 3DXMA 2KTQA 2DY4A 1CXUA 5HRSA 3DRPA 4CHOA 3VENA 2RPIA 1RDDA 4OGCA 3CM5A 1SKRA 2AJQA 2WC9A 3LWLA 3MK6A 4H0TB 3RR8A 3KLHA 2ETJA 1VQNN 1L3VA 4H5NA 4CBWA 4F2SA 1LCUA 1S3XA 2P9LB 1K8KA 1W7AA 3QO9A 1V4TA 4E3SA 3NH1A 1K6YA 4KRFA 4IBNA 4H5WA 3SQ4A 4H8KA 1YI2N 4LF8K 4RTFD 4CK2A 4OKEA 2Z1HA 3CIPA 4AM7A 1EP4A 3O4NA 3CF5L 3MXJA 5FPNA 3FR0A 4AHRA 3EE9A 4ILGB 3AVAA 4JKCA 1DT9A 2GELA 3VGLA 1D4XA 3DWLA 1Q9XA 3HOTA 3LDLA 2YCHA 4CVNE 1JLEA 1W97L 1N8RO 3V4IA 1XHXA 3A5NC 4IOCL 4FZZA 5HROA 3ZX2A 4Z4CA 3CC4N 3CETA 1BHLA 4KB1A 3QIPA 3SQ0A 2ZJPL 4H0PA 1BA1A 4XH5A 3M5RA 3SAHA 3K5LA 3V6DA 4B1ZA 1Y64A 4ZTFA 4BRLA 4WFNL 3VQDA 4AHUA 1NM1A 5JICA 5BRFA 1J5OA 4B3OA 2VGMA 2HHWA 4I9QA 3OVNA 4BE1A 1VQ4N 3KLEA 4B9LA 3DOLA 5JLHA 1VSFA 4FLVA 3H08A 3G71N 3PLAA 1BU6O 3ASMA 1DLOA 2I7PA 4BE0A 3R8EA 4RW6A 3T1YK 1U04A 4ISEA 3DAWA 4BC2A 1QZ6A 1JLCA 3L0QA 2ZQBA 1LWFA 5C12A 1TK0A 1QE1A 2W40A 4OKJA 3UB5A 3THWB 5F0XA 1SZ2A 2NRRA 4JHDB 3ULEA 2RE2A 3OYNA 1J5EK 4I2PA 1BIZA 2JLEA 1JCEA 4FWMA 5BRDA 3V9XA 3CJ9A 2HMIA 5AZIB 4ELVA 5ADXH 2O8EA 1NK7A 3PY8A 5GIPA 3V9WA 4DSLA 3K57A 3NVKA 5KRSA 3NFAA 2QWLA 2I7NA 4CZIA 3SUPA 3MX5A 2YJEA 3L3VA 1TVRA 4BRNA 3H45C 4FWPA 3SNNA 2KFNA 2YHYA 3VF4A 1U47A 2D0AA 4IJAA 1LOTB 1VQPN 4LF7K 3HI0A 4B1YB 2OPPA 5KQDA 3O1BA 3VTIA 4CJ3A 1ZBUA 4DS4A 1JCFA 4BRDA 3T19A 4KB0A 1RT7A 3ZSZA 5AQZA 4BC5A 4W5QA 2VQFK 3MEEA 3NF6A 3TSPA 2QTDA 3HXMA 3AVJA 1U4BA 4LSNA 3AVMA 3MN9A 4IDHA 1L3SA 4HHTA 4C1NI 1EQYA 1S1XA 2HVHA 3BZKA 3V9ZA 1KFDA 1S5JA 5TKYA 2V52B 2CGLA 2X6NA 5CZ2A 4CFAA 4M3WA 3O4WA 4O0IA 4BRPA 3C6UA 4KBOA 3JYTA 2GV9A 4BRMA 3RSEB 1HJRA 1KQSM 3RMDA 2KZMA 1HKCA 4C8NA 3CCSN 4DQSA 4K8ZA 3ZSRA 5DM6L 1HNWK 3P1GA 1QQNA 5LJVA 3QEWA 3T1HK 3S3NA 2B5JA 3CM6A 4KV8A 2YHWA 5HOOA 3NDKA 1VHXA 2UUCK 1T3VA 4KHNA 2P9KB 3DM2A 3V9SA 3WQTA 3QLHA 4DQRA 3V1OA 5JMVA 3UIQA 3SV4A 1ZBSA 1QVFM 4CJ7A 3OYHA 2R7YA 4CZEA 3ID6A 1BOTO 4A5AA 5CE3A 1N6QA 4NXNK 4NLCA 1NJWA 1HNIA 3SBGA 4KI6A 3ZSWA 3BY5A 3THYB 1T7PA 3KK2A 3KTQA 2QM1A 3DYAA 4I6MB 3L2RA 4K43A 5IWAK 4M3YA 3HSTB 3G4SN 3PUFA 3AVBA 2O8FB 1DKGD 4A59A 2OA8A 3ZSYA 4L3QA 3DLKA 3UKRA 4YOXA 4E7KA 3AAPA 1BO5O 3B8AX 3F9MA 4IZ9A 5FPMA 5FLXO 1E4GT 2QWNA 3VQBA 1XI1A 3QDKA 4WQ5A 3N4QA 2Q0UA 3IMXA 3O8MA 2KZZA 2H3GX 1GOBA 1MWKA 4CGFA 2F96A 3KIOA 4C8KA 4CW7B 3BP8A 1WUAA 3N4PA 1C6VA 1C0TA 1GLBG 1HNZK 4BGAA 4DV6K 5KRTA 3SQ2A 1N32K 3M8PA 2AA4A 5K14A 3K59A 4C1NK 4E89A 4CF9A 3CCRN 2DFHA 3O9TA 1CZ9A 4CF2A 4FVUA 2P5OA 4JKBA 3NH0A 5AQKA 2VG7A 1RDBA 3DXMB 1T8EA 4DCHA 2P9NB 4CZKA 2QWQA 3NH2A 3FFKB 5AQHA 4DV7K 3TTCA 5GAGP 4H0VB 1Q81O 4G1QA 1R59O 4CZHA 2QWRA 3CXCM 3ZCMA 3VEYA 3SUOA 4WQ5C 1YHQN 3DLGA 3TAEA 3QFPA 4B3RK 5M1OA 2XY5A 3KKSA 4FLWA 5AQTA 1MDUB 1WSEA 3C65A 1JLAA 1YJWN 2YNHA 3CJAA 2UXBK 2W6LA 3MN5A 2W42A 2ATQA 3DRRA 3LM2A 1B9FA 3ZLJA 3MWTA 1EXQA 1T6CA 2P51A 5BPLA 5EVZA 1ZBIA 4CJLA 4CERA 4XH4A 2D4WA 1JCGA 1LWCA 2Z1GA 2D5RA 4KTZA 1D9FA 2O8CB 4JKHA 2IOCA 3TTDA 5BPMA 1BL3A 1WBBA 1ILYA 3VQQA 3CC2N 3LP1A 4HUEA 3FLCO 3BF3A 2HW3A 5HL7L 4LH4A 5EOYA 1BCOA 2O8DA 1IBMK 1C0GA 4M63C 3ZSOA 3CFOA 1IG8A 1IBLK 1RBUA 1RFQA 4OPJA 1NK9A 3O6WA 1QHTA 1X1PA 3QESA 2NNWA 3ZSXA 4KHPK 1CLQA 4CHZA 3OJUA 4FZXC 1DEJA 2P9UA 5AFUA 3MMVA 2HHVA 3KWGA 4MLEA 5AQUA 4DSEA 5AQFA 2FBVA 4BRCA 5EY4A 4KTQA 4YOTA 2F7TA 2HNDA 3L4QA 4Z0UA 4FLYA 1WSJA 1K8AO 2PY5A 1NGAA 1S6QA 1T6DA 5JS2A 4PWDA 1NJZA 2QXLA 4KH4A 4CF8A 1SV5A 2ZD1A 4OKKA 2YI1A 4B3TK 1NLVA 4CJFA 4FWQA 3CJ7A 4E7HA 1TL3A 1NGJA 2YNGA 3P5JA 4FVMA 2JWLA 3OYCA 3U3GA 4DF8A 4M7YA 2Y1IA 4DU4A 3J80O 2XO7A 3ATUA 3I0RA 1OH5A 4Q0BA 2OYQA 1C1BA 3VQ4A 3RRGA 4FJIA 3L2UA 4DTSA 1S6PA 1IO2A 4JD2A 4NLBA 1IKYA 3ZSQA 5M1NA 4IO9L 4FJMA 4JV5K 1HMVA 4OGEA 2OANA 4CK1A 4IFEA 3SBTA 3OTOK 4DSIA 5AQMA 2D0PA 1NMDA 1DTTA 3V1QA 4BY9C 4CK3A 4ELTA 1A5VA 1HUXA 5C24A 1KLMA 4DUYK 3THXB 4W5OA 4ISFA 4YDUA 2QWMA 2NRWA 4F2RA 4A5BA 3TTFA 1WOQA 4J2DA 3JS6A 5CY4A
chains in the Genus database with same CATH topology
5IWAK 4DR1K 2UU9K 4LF7K 4JI8K 4DV2K 1IBKK 4DR6K 1N36K 4JYAK 1IBMK 2ZM6K 1IBLK 4CVNE 2UUBK 5AJ3K 3JAMO 4K0KK 5IT9O 5FLXO 4LF4K 4KHPK 1XNQK 4DUZK 4X65K 2UXDK 2VQFK 4B3SK 1I94K 1XMQK 1N34K 4DR3K 4LFBK 4CW7B 4YY3K 4JI5K 3J7AP 4X62K 2VQEK 1HNZK 1HNXK 4DV6K 1N32K 4NXMK 4OX9K 4JI7K 4X66K 4JI2K 1XMOK 4V19S 4GKKK 4DR4K 4B3TK 4JI0K 4LF5K 1HNWK 3T1HK 1FJGK 4DR5K 3J80O 4DV7K 2UUAK 3T1YK 2UUCK 3J81O 4JI4K 5LMUK 3J7YP 4DR7K 4B3RK 4DV5K 4LFCK 1N33K 5A2QO 2UXCK 4JV5K 4DV4K 4DR2K 1J5EK 2HHHK 4JI1K 3OTOK 4X64K 2UXBK 4DV0K 4LF6K 4DV1K 1XNRK 4NXNK 4JI6K 4B3MK 4LFAK 4DUYK 1HR0K 4GKJK 4JI3K 4LF8K 2F4VK 2E5LK 5LMNK 4LF9K 5BR8K 5LL6Z 4DV3K 4YHHK 4AQYK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWA K;  4DR1 K;  2UU9 K;  4LF7 K;  4JI8 K;  4DV2 K;  1IBK K;  4DR6 K;  1N36 K;  4JYA K;  1IBM K;  2ZM6 K;  1IBL K;  4CVN E;  2UUB K;  5AJ3 K;  3JAM O;  4K0K K;  5IT9 O;  5FLX O;  4LF4 K;  4KHP K;  1XNQ K;  4DUZ K;  4X65 K;  2UXD K;  2VQF K;  4B3S K;  1I94 K;  1XMQ K;  1N34 K;  4DR3 K;  4LFB K;  4CW7 B;  4YY3 K;  4JI5 K;  3J7A P;  4X62 K;  2VQE K;  1HNZ K;  1HNX K;  4DV6 K;  1N32 K;  4NXM K;  4OX9 K;  4JI7 K;  4X66 K;  4JI2 K;  1XMO K;  4V19 S;  4GKK K;  4DR4 K;  4B3T K;  4JI0 K;  4LF5 K;  1HNW K;  3T1H K;  1FJG K;  4DR5 K;  3J80 O;  4DV7 K;  2UUA K;  3T1Y K;  2UUC K;  3J81 O;  4JI4 K;  5LMU K;  3J7Y P;  4DR7 K;  4B3R K;  4DV5 K;  4LFC K;  1N33 K;  5A2Q O;  2UXC K;  4JV5 K;  4DV4 K;  4DR2 K;  1J5E K;  2HHH K;  4JI1 K;  3OTO K;  4X64 K;  2UXB K;  4DV0 K;  4LF6 K;  4DV1 K;  1XNR K;  4NXN K;  4JI6 K;  4B3M K;  4LFA K;  4DUY K;  1HR0 K;  4GKJ K;  4JI3 K;  4LF8 K;  2F4V K;  2E5L K;  5LMN K;  4LF9 K;  5BR8 K;  5LL6 Z;  4DV3 K;  4YHH K;  4AQY K; 
#chains in the Genus database with same CATH topology
 3B6P A;  3NE6 A;  1HYS A;  4NYN A;  2E2N A;  3C6T A;  3VQ7 A;  3P38 A;  5CR4 A;  5EU7 A;  4IDK A;  3HVR A;  1GLJ O;  2DFE A;  2X74 A;  5BR9 A;  4PKG A;  3QNN A;  3D2E B;  4DHY A;  4CZF A;  1JLG A;  1X3N A;  2X6S A;  2YKM A;  3UE5 A;  3KLG A;  1IG9 A;  4CGH A;  2ZE2 A;  4E7I A;  2A5X A;  2NUB A;  2HMP A;  2G8W A;  3K9J A;  4NCB A;  1BG3 A;  4LFB K;  4O5F A;  3D7E O;  3SQ1 A;  3LPT A;  1HNX K;  4YDU C;  1VK0 A;  3HK2 A;  3CCQ N;  2A3Z A;  1HQU A;  3MDQ A;  1RT6 A;  4NXM K;  4DQ8 A;  5E41 A;  3HO1 A;  3SMP A;  3PX0 A;  3M8S A;  4V19 S;  3R9P A;  2Z1J A;  5AQR A;  4JRP A;  1MA9 B;  4ZTJ A;  3P31 A;  4NCG A;  4ILJ A;  2E8A A;  4LF5 K;  4GVM A;  1RTI A;  3MED A;  4DMN A;  3HBT A;  3MXI A;  3PIP L;  3LWM A;  4EHT A;  3VEW A;  3MCA B;  5JLF A;  4Y1D A;  4KHS A;  2FSN A;  4GV3 A;  1IKW A;  2HOE A;  2UYT A;  4BR0 A;  2Q2R A;  5DK5 A;  1KXP A;  4CI6 A;  2HVI A;  1VSM A;  4HTU A;  1LWE A;  3QBX A;  4I9L A;  1TYQ A;  2P9P A;  2ASO A;  1HPZ A;  1RBS A;  3OYD A;  2FBY A;  1ZC6 A;  4YOY A;  4GMJ B;  4YOR A;  1U48 A;  3IG1 A;  3TI0 A;  3CMA N;  2HBJ A;  1BI4 B;  1EET A;  1L5U A;  4CJR A;  4M45 A;  2IVN A;  1NOY A;  1SL1 A;  3AO1 A;  1QQM A;  1JL2 A;  5SWM A;  5I3U A;  3IUC A;  1JLQ A;  1KD1 O;  5KPZ A;  4FM2 A;  3VEV A;  2BH1 A;  3AY9 A;  4CJP A;  1U49 A;  2OPQ A;  4KKO A;  3UKR B;  1L3U A;  4OPH A;  1FXX A;  3Q7B A;  5M1Q A;  4J2A A;  4B9U A;  1OH8 A;  3PO4 A;  1D9D A;  3M6G A;  4FJH A;  4ISG A;  1RIL A;  3HSC A;  4ID5 A;  2P9S A;  3GE1 A;  1OKJ A;  4FL9 A;  5C10 A;  4BRH A;  4DTJ A;  1LAV A;  1NK0 A;  4CJW A;  2YV0 X;  1NOZ A;  1EWR A;  4X65 K;  1VSH A;  2RF2 A;  3LM9 A;  4QS9 A;  3FZK A;  2FC0 A;  4E0D A;  3P4I A;  4IEI A;  3NMU A;  2QW9 A;  4YOW A;  4M3X A;  3HPH A;  4FK0 A;  1ASW A;  2OTJ N;  2O8B A;  4BR4 A;  1IH7 A;  3DLL L;  1KRP A;  3T1A A;  1S9G A;  4OO1 J;  5FPE A;  3CFR A;  3ID8 A;  4FK4 A;  1RBR A;  2PFU A;  3F9K A;  4U7B A;  3KWI A;  3TAB A;  4B9M A;  5AQI A;  4B9S A;  2GWJ A;  3OS0 A;  2KQ2 A;  3CER A;  1UWB A;  1RNH A;  4RW7 A;  2GTD A;  4Q5V A;  4M3T A;  3HM8 A;  1VQ6 N;  4NB4 A;  1M90 O;  2WON A;  4DG1 A;  5JS1 A;  3ALY A;  3H1V X;  1NGC A;  3OYF A;  3RMC A;  4DR7 K;  2F9W A;  1GLF O;  3C7N B;  3QFU A;  3EO3 A;  4DV5 K;  1N33 K;  4JKE A;  3PO5 A;  3WNH A;  3AVI A;  3TAR A;  3V9U A;  3S41 A;  2HHH K;  1Q7Y O;  2VYP A;  4B9N A;  4DWI A;  1NJI O;  3FZF A;  4PKH A;  1HKB A;  4EFH A;  2OPS A;  4BDY A;  2Z1I A;  4JRQ A;  4M41 A;  4DF4 A;  1EO1 A;  4LF6 K;  4CFD A;  3ZT1 A;  4EHU A;  5GIO A;  1TUY A;  3OHR A;  1ITG A;  1F21 A;  4FM1 A;  1SUQ A;  2D0C A;  3CG7 A;  2P5G A;  3OBW A;  4JKA A;  5BR8 K;  4CBX A;  3U3Y A;  5HRR A;  1P90 A;  1BCM A;  1C1A A;  4B9Q A;  3R3L A;  2WBN A;  4Y1C A;  1SKS A;  3G6E N;  3CFP A;  4JYA K;  4Z4F A;  1ZBH A;  1RTD A;  3TAQ A;  3RR7 A;  2UUB K;  3NF7 A;  5AJ3 K;  3SV3 A;  3H46 O;  1B9D A;  1GOA A;  2YKN A;  3CJB A;  1RT2 A;  1NBW A;  2Y1J A;  1JL1 A;  2E1Z A;  1Q8I A;  4ILH A;  2ZWH A;  5AZJ A;  1XMQ K;  3ZET B;  2NRV A;  2FXU A;  2PBD A;  1N34 K;  5HRP A;  4FM0 A;  2GX9 A;  4CEB A;  3ITH A;  3K2P A;  3O08 A;  2VQE K;  3HM9 A;  1B92 A;  4EZ6 A;  4BWM A;  4RW9 A;  4OX9 K;  1HJO A;  2GUP A;  5AFU H;  3OYJ A;  3CCE N;  4WYB A;  4AF1 A;  1X9J A;  4GKK K;  3WXI A;  4O4G A;  4RW4 A;  5AQW A;  4KH6 A;  4E7J A;  4LD0 A;  2CGK A;  1IJJ A;  3E66 A;  1WLJ A;  2BDP A;  1J54 A;  1TAQ A;  3EYZ A;  1HLU A;  4ZHR A;  1NK4 A;  5AQJ A;  5C15 A;  3OYG A;  1JKH A;  3IFR A;  2Q3S A;  1T05 A;  2HHS A;  5FPD A;  4CGI A;  4PA1 A;  4QOZ B;  4FCY A;  1LAW A;  5JVG L;  4JI4 K;  1U45 A;  5J2Q A;  2W41 A;  3H3N O;  3BDP A;  4DTN A;  3IDH A;  3KD1 E;  4DTP A;  4DR2 K;  5M1K A;  1YTA A;  3WT0 A;  5CZ1 A;  3F5T A;  4CD3 A;  3F2K A;  1J9A A;  1J53 A;  4DV0 K;  2IVP A;  2NZT A;  3CI5 A;  3VES A;  3C6A A;  4WE1 A;  1XNR K;  2XY8 A;  3RMB A;  3V81 A;  3ZEU B;  4FJ7 A;  1DGK N;  3E9P A;  2ZJQ L;  1RTH A;  1XUP O;  3FZM A;  1UOC A;  3OS1 A;  2IGI A;  5AQL A;  2A6A A;  4J2E A;  3LDN A;  1OH7 A;  5LL6 Z;  4IJN A;  3DI6 A;  3O3G A;  1VQK N;  1Q9Y A;  2YNF A;  3HYF A;  1TKZ A;  5C42 A;  4WFA L;  4IXC A;  4CJS A;  1BDG A;  3EL2 A;  3DLH A;  4DFK A;  5J2M A;  2JWK A;  3SMS A;  1VQ9 N;  1FKO A;  4DB3 A;  4HUF A;  1S1W A;  4K0K K;  4LF4 K;  2E6L A;  2ZF5 O;  1TKT A;  2E4L A;  2UXD K;  3AO4 A;  5AQS A;  4HWI A;  4BGB A;  3AA2 A;  4BC3 A;  3VQ5 A;  4DR3 K;  3TR8 A;  2YJF A;  1BUP A;  4FJG A;  3OYB A;  4CJ5 A;  4KO0 A;  1A5X A;  2HST A;  3KLI A;  3ENO A;  3WEE B;  4RG8 A;  1NGH A;  4JI2 K;  2A42 A;  2V51 B;  4FWN A;  3QIC A;  3DXK B;  3ENB A;  3D2F A;  4PQU A;  3O9R A;  3B6O A;  3DMJ A;  1NGD A;  2A40 A;  2OZM A;  5FRM A;  1X9S A;  1C0U A;  3BZC A;  5SZT A;  1HKG A;  2P9P B;  2UUA K;  1ESV A;  1NGF A;  4IFV A;  3PSF A;  3OYK A;  1RDA A;  3MCP A;  1C1C A;  4B08 A;  3C0B A;  3BGR A;  4CZL A;  2LSN A;  4FJ8 A;  2HHT A;  4H5R A;  2P9L A;  2E2P A;  3Q7C A;  4DV4 K;  4PKI A;  3WNG A;  1JLF A;  4FW2 A;  5EX5 A;  4BRG A;  5CYM A;  3NVM A;  1TKX A;  3R1X A;  1VQ5 N;  4CCH A;  2EWS A;  1IV0 A;  4Z4I A;  3WXM B;  3VQA A;  3AVG A;  3SI6 A;  1SS6 A;  4M7X A;  3MN7 A;  5C2F A;  4B3M K;  3O80 A;  1LW0 A;  3CCJ N;  3OA9 A;  4EAH D;  2XY7 A;  1MWM A;  5DMR A;  1K8K B;  4FPB A;  4CZM A;  4DTX A;  3V1R A;  5FDL A;  5LMN K;  2Q0R A;  4FOI A;  3NBP A;  4DTO A;  1KVB A;  3CC7 N;  1VSE A;  4MQ3 A;  1WBD A;  4HUG A;  4DR1 K;  4UQG A;  3O3H A;  2DTU A;  1GOC A;  5KPR A;  1BWF O;  1VRT A;  1Z25 A;  3KZB A;  5AQN A;  3CJ1 A;  3HOS A;  3VGK A;  4BDZ A;  4E1J A;  1HYV A;  4KHW A;  4A2B A;  2G8H A;  3SCX A;  4M3Z A;  3HT3 A;  3ZYY X;  2OZS A;  1MU2 A;  4CJQ A;  3KJV A;  3VA3 A;  3AVC A;  3S3O A;  3OYA A;  3TPQ A;  4CJT A;  3J7A P;  3CJC A;  1NGG A;  2IAJ A;  4NYF A;  3OYM A;  4M3U A;  1TV6 A;  5AQO A;  4BRQ A;  3PX6 A;  1DTQ A;  3BEX A;  3A8Y A;  4JI0 K;  3T7Z A;  4R5P A;  2O4G A;  5I42 A;  4JKF A;  1X9W A;  4CJE A;  1NMN A;  2V7Z A;  4FXD A;  1Z26 A;  3TAN A;  4CZG A;  3THW A;  4BQL A;  1G99 A;  3H3O B;  2GEM A;  1BA0 A;  3LP3 A;  4DSK A;  2FSJ A;  4BRK A;  3OS2 A;  1H1V A;  2ASM A;  3LDQ A;  5AZI A;  3UKU A;  1NU0 A;  1KLN A;  2QA4 N;  4CIE A;  3C94 A;  5AQY A;  3E9L A;  5CYQ A;  3GG4 A;  3ULE B;  4MLH A;  2NLX A;  1Q86 O;  1GLE G;  4FPA A;  2PZS A;  1HR0 K;  2GWK A;  3NAE A;  5KGW A;  1RBT A;  5LJW A;  1A5W A;  4OPK A;  2O8E B;  1HNV A;  3VPZ A;  4LF9 K;  3L4I A;  4FLU A;  4JEP A;  3OYI A;  1Z05 A;  2YHB A;  1VSL A;  3KK7 A;  3M8R A;  3BF1 A;  3QET A;  3D45 A;  3A5O C;  5M1P A;  3FFI A;  3QNO A;  4H5V A;  4NO7 A;  4YFU A;  1JLB A;  5ELZ A;  2FBX A;  2Q36 A;  4WCE L;  3O9Q A;  3I8D A;  1HX1 A;  3FE1 A;  4J2B A;  3LDS A;  3ULD A;  1L3T A;  1NWK A;  4FWK A;  2F8S A;  5LY3 A;  2A1R A;  4N41 A;  2HB5 A;  3I33 A;  3SAF A;  4CHN A;  4IKF A;  1RGI A;  4BRO A;  3CME N;  3RSE A;  3L2Q A;  2PYJ A;  4X62 K;  4CHP A;  3QEP A;  3K5O A;  3QEV A;  3LDP A;  4JI7 K;  1GLA G;  3LZI A;  1W0H A;  3AA4 A;  3F73 A;  1RTJ A;  2QK9 A;  4PY5 A;  3L2V A;  4LC9 B;  4DR4 K;  4JKD A;  4A62 A;  2ITG A;  1E4F T;  4CF1 A;  4QCL A;  1K73 O;  4JS4 A;  5AR0 A;  3W3D A;  2P9K A;  4KHU A;  3CQX A;  1BIU A;  4OLA A;  1RDC A;  2HNY A;  1XQS C;  3SYZ A;  3U9Z A;  3LP2 A;  4DKW A;  1QVG M;  4LFC K;  3VF6 A;  2P9I A;  5M1F A;  5J2N A;  1LW2 A;  1VQM N;  1ATR A;  4JK7 A;  2ZJR L;  1YIT N;  1O13 A;  2E1Y A;  1FW6 A;  3RMA A;  2A1S A;  4OLB A;  3NGI A;  2Q31 A;  3ZX0 A;  4FJN A;  3VMF B;  4DFM A;  4I6M A;  3QBW A;  3VER A;  3SPY A;  4GKJ K;  2VGN A;  2NRT A;  4FSV A;  4F3T A;  3U8X A;  2E5L K;  2O8F A;  4B1W B;  5B8H A;  1WSH A;  3AO3 A;  3O1W A;  4YHH K;  4BR9 A;  2B6A A;  1XHZ A;  4HVJ A;  4BG9 A;  4CEZ A;  4JAX A;  5J1E A;  3KK3 A;  4H5T A;  2IVO A;  3HRG A;  1OVY A;  2IIR A;  4CEC A;  4YNQ A;  2XHB A;  2ZM6 K;  2WTU A;  3G10 A;  4H0Y B;  4CEO A;  5GAD P;  3KKR A;  5BPN A;  3WXJ A;  4WQ4 A;  1M1K O;  1O1W A;  1YXQ A;  1ASU A;  2KW4 A;  4I7F A;  3PIO L;  2CGJ A;  4E7L A;  4DUZ K;  4H0O A;  2I5J A;  1ZBL A;  4O0J A;  3E1Y A;  1KAX A;  1SQK A;  3HPG A;  3ZT4 A;  4B1X B;  3VET A;  4CES A;  1X9M A;  3AAQ A;  3AGK A;  4YY3 K;  4JI5 K;  3DOK A;  3L8B A;  3PX4 A;  3K5N A;  3HP6 A;  1Y97 A;  1CZB A;  5KTQ A;  3AA5 X;  1TAU A;  1P8Z A;  2P9N A;  4CGD A;  4CIF A;  3ZSV A;  2QKK A;  2YHA A;  2VWJ A;  3O4Q A;  1KSP A;  4FJ9 A;  4XEI A;  2VG5 A;  1C0F A;  1FJG K;  4K42 A;  4H4M A;  1ZXO A;  5CHI A;  5H1S Q;  2G8K A;  4KPY A;  4Z4G A;  2IC3 A;  2FLO A;  4WQ4 C;  3J7Z O;  3U4L A;  1YTU A;  1OH6 A;  1VSI A;  1REV A;  2FSK A;  2WOM A;  3J7Y P;  1VAZ A;  4IFY A;  3MEC A;  1VSJ A;  4RCH A;  3IS9 A;  4CF0 A;  1WAF A;  1RT1 A;  4UY8 O;  3QML A;  4B1V A;  4IO8 A;  2XY6 A;  2O8C A;  4WFB L;  3R6M A;  4Z4E A;  4LFA K;  2HF4 A;  4IG0 A;  4EP4 A;  3S3M A;  4OVL A;  3RTV A;  4F8R A;  3AO2 A;  4CBU A;  3QIO A;  4NCA A;  4IEE A;  2ZGZ A;  3ISN C;  4DV3 K;  2J4R A;  4W5R A;  2E2O A;  4GW6 A;  2D0B A;  3AVL A;  2GUI A;  4JNE A;  4W5N A;  4MDA A;  1N36 K;  4A61 A;  2E20 A;  5E84 A;  2IDO A;  3LAK A;  1NG9 A;  3I56 N;  3NGY A;  3I55 N;  2NRZ A;  5BRE A;  5HP1 A;  1JXE A;  3MN6 A;  3P39 A;  4F9O A;  2O8D B;  4B3S K;  4JKG A;  4OPA A;  4DLE A;  1N5Y A;  4FLX A;  4CJ4 A;  4IOA L;  4AIL C;  2D0O A;  2VWK A;  2P9U B;  1Z6R A;  4BWJ A;  1YUW A;  1ATN A;  4AHC A;  4HTL A;  1XMO K;  1RBV A;  4RW8 A;  1TK8 A;  4BRF A;  3CHW A;  4QS8 A;  1G15 A;  2HHU A;  1WNS A;  5HBM A;  2OTL N;  3OW2 M;  1QTM A;  3HTV A;  1YT3 A;  3CCV N;  1V4S A;  4FLT A;  4FW1 A;  1ZYQ A;  2HHX A;  4WF9 L;  3K0S A;  1WSI A;  3UKU B;  4CJU A;  5KGX A;  3KVG A;  4YOU A;  4DFJ A;  4A2A A;  3TWH A;  3L2W A;  3SPZ A;  4C23 A;  4DQQ A;  4Z94 A;  5LMU K;  1VQ7 N;  3K9K A;  1UA1 A;  3C6H A;  2UXC K;  4F3O A;  3EKU A;  1QS4 A;  1NGE A;  1NNE A;  2QKB A;  5MLC Q;  1KCF A;  2BE2 A;  4JI1 K;  3ZT3 A;  3THX A;  4XIU A;  5BN9 A;  1BQN A;  1QSS A;  3WXL A;  4JD2 B;  5JVH L;  3I0S A;  3QIN A;  4DTU A;  3SJJ A;  5C0Y A;  3DRS A;  3QEI A;  1BIS A;  3NF9 A;  4FWO A;  4FWR A;  3A5L C;  4BR7 A;  4BRI A;  3VQ9 A;  3VN5 A;  4FWS A;  2RN2 A;  2DFF A;  1KVA A;  3TU5 A;  5C2D A;  4E19 A;  4A57 A;  4Y0W A;  3OYL A;  4E1M A;  4FJ5 A;  1U2V A;  5J2P A;  1SL0 A;  4O8U A;  4GY2 B;  3KD5 E;  5DM7 L;  4DV2 K;  4DR6 K;  3L6Q A;  1RT3 A;  1X3M A;  3D2E A;  3SUN A;  3TAG A;  3SJH A;  4JN4 A;  1GLC G;  3DLE A;  3JAM O;  1J6Z A;  3P83 D;  5KPT A;  4B9V A;  4FK2 A;  3T69 A;  4F4K A;  2FF3 B;  4RWT A;  5GIN A;  1KC8 O;  1I94 K;  4MDB A;  4O8K A;  4O55 A;  1NKB A;  4I2Q A;  3WUH A;  3J8A A;  4GV6 A;  4M42 A;  3ATV A;  4KHQ A;  4OJR A;  1T03 A;  1UAX A;  1GLD G;  2FBT A;  1TUU A;  2E2Q A;  4FJL A;  4W5T A;  3EZ5 A;  4X66 K;  4BAC A;  2KHO A;  4DTM A;  2CH5 A;  1NGB A;  1QQO A;  1ASV A;  3O9U A;  4BVO A;  3LZJ A;  1RCH A;  1YIJ N;  3AVF A;  3SAG A;  3GOI A;  3AAR A;  4AM6 A;  3VQE A;  1SAZ A;  3CCU N;  3DLR A;  4PL8 A;  2BUP A;  3ZT2 A;  4BDP A;  2P9I B;  3RWU A;  1GLL O;  1Q82 O;  3TAF A;  2G8U A;  3JXU A;  4H4O A;  4QAG A;  4KHY A;  3RVC A;  3IRX A;  1BI4 A;  3VEO A;  3U9D A;  3A2F A;  4FOE A;  4HCC A;  4MO4 A;  4FWL A;  4GVE A;  4KTW A;  1BQM A;  4ID1 A;  4KFB A;  4CEF A;  3OY9 A;  1T44 A;  2E6M A;  3VA0 A;  1FK9 A;  4CFC A;  4C8L A;  2QWO A;  3HVT A;  3EE8 A;  1R0A A;  1TYQ B;  2KLA A;  1HYZ A;  1ZBF A;  1YAG A;  3OBY A;  4JI6 K;  4DFP A;  3T3F A;  1BGX T;  1XC3 A;  1CXQ A;  4ELU A;  4JI3 K;  3TAP A;  3JSM A;  4BR2 A;  3THV A;  3W0L A;  4R79 A;  1XC9 A;  1SKW A;  4ICL A;  3TAM A;  4IG3 A;  3AVK A;  5AQG A;  4AQY K;  4KI4 A;  3MAQ A;  3C95 A;  3EEQ A;  3NHG A;  1LV5 A;  2WUS A;  2YNI A;  3D0P A;  3FZL A;  3M8Q A;  1U6Z A;  1D5A A;  1QSL A;  1VQO N;  2W6K A;  2NRH A;  4G9Z A;  1NK6 A;  2P1J A;  3GL1 A;  3SK3 A;  3VQC A;  2NRX A;  1EX4 A;  4BC4 A;  1SL2 A;  4CHY A;  4N56 A;  4DU3 A;  4FJJ A;  1S22 A;  4AH9 A;  3LDO A;  2P9S B;  3GDQ A;  3ZT0 A;  1JJ2 M;  2EX3 A;  4FJX A;  2A41 A;  1D8Y A;  4LY7 A;  5I9E B;  1HRH A;  1CZA N;  3RRH A;  3HZ6 A;  3MX2 A;  4CD1 A;  4BE2 A;  1NJX A;  3HJF A;  4Z4H A;  5F1X A;  3A5M C;  3LP0 A;  1VSD A;  2O8B B;  4MFB A;  3QEX A;  3QB0 A;  5GAE P;  2Q1N A;  3HPO A;  1W2B M;  4PUO A;  4GV9 A;  4TSX A;  4K8X A;  4N76 A;  3G25 A;  1W9H A;  3LL3 A;  4C8M A;  4CFB A;  4IWV A;  4M3R A;  4FYD A;  4DR5 K;  4JK8 A;  5EXW A;  3C7N A;  3VGM A;  3MEG A;  3VF2 A;  2QWP A;  3AO5 A;  3MXM A;  2XRI A;  2ITM A;  3J81 O;  4BRE A;  2DPN A;  1FKP A;  4U67 L;  5ADX A;  4H0X B;  4E1N A;  5BRH A;  1TK5 A;  2F8T A;  1TL1 A;  2D1K A;  4BR5 A;  4BQZ A;  1YVU A;  3SUQ A;  2ASP A;  4B8C A;  3TSU A;  4JS5 A;  4KAZ A;  5D3G A;  1YJ9 N;  1S72 N;  1NKE A;  1WAJ A;  1WSG A;  4CJK A;  2EHG A;  3WNE A;  1QSY A;  2G8V A;  3VQP A;  4JHD A;  1HQE A;  3H1Q A;  1WSF A;  4L8R B;  3EKS A;  3IAY A;  2F4V K;  2FF6 A;  3WQU A;  3WXK A;  4CHQ A;  3VOV A;  2QXF A;  2HNZ A;  5AQQ A;  1C0M A;  1OVQ A;  4XH1 A;  1VSK A;  2Q97 A;  3LPU A;  3K5M A;  5GAH P;  3VTH A;  2IS3 A;  2G8F A;  3M3Z A;  4FZY A;  3O5B A;  3AA3 A;  4JKG B;  3OJS A;  4FJK A;  1RT4 A;  3ZET A;  4GNI A;  3IKM A;  3CPE A;  5AQX A;  3AV9 A;  2BGG A;  2AP1 A;  4LH5 A;  1NK8 A;  3DLB A;  3AGR A;  1RT5 A;  3VEX A;  4DSF A;  2VCP A;  3CYM A;  2RKI A;  3O9S A;  1IKX A;  1KAZ A;  3ENH A;  1S1U A;  1EWQ A;  1TKD A;  4DQP A;  1KVC A;  3BUZ B;  3L3U A;  5AQP A;  5AZJ B;  4H03 B;  3E01 A;  3EZW A;  2ZGY A;  5TKW A;  4JLH A;  4CEQ A;  3M1F A;  3NCI A;  4QS7 A;  4CE9 A;  4BG8 A;  2V7Y A;  2RHK A;  1S9E A;  2KFZ A;  4PL7 A;  3HL8 A;  5KI6 A;  2QEX N;  3OYE A;  2B4J A;  2KKZ A;  4CZJ A;  2CH6 A;  1WN7 A;  2F9T A;  2E88 A;  1YF5 L;  4DLG A;  1NJY A;  2PAV A;  1I39 A;  2HBK A;  4JK9 A;  1YVN A;  3GBT A;  3CPW M;  3CD6 N;  2X78 A;  1IKV A;  1XWL A;  4B1U B;  2O4I A;  4B8A B;  4DTR A;  5A2Q O;  3VQ6 A;  2HF3 A;  4AHS A;  3O3F A;  3ZEU A;  1YJN N;  4X64 K;  3AVN A;  3LAN A;  4DU1 A;  3EY1 A;  3PSI A;  4PHT X;  2VWB A;  4DV1 K;  5F2R A;  4EZ9 A;  1U2V B;  3E9O A;  4CJV A;  1S1V A;  1WB9 A;  3PV8 A;  3U6F A;  2QI2 A;  2YHX A;  2PYL A;  1I3A A;  3DJC A;  5T7B A;  3CCL N;  4BVP A;  3AVH A;  2G8I A;  1QHA A;  4N47 A;  1VRU A;  4BRA A;  1KAY A;  2UU9 K;  4AHV A;  4JI8 K;  1IBK K;  4YOV A;  3A0I X;  4O44 A;  4C8O A;  4DS5 A;  3EN9 A;  4EIA A;  1RDW X;  3NF8 A;  5E26 A;  3THY A;  3LAL A;  5HLF A;  1KFS A;  1NKC A;  4DSJ A;  2JGU A;  4O5B A;  4J8F A;  4AHT A;  1RDU A;  1NK5 A;  3SZ2 A;  5IT9 O;  1K9M O;  3H6E A;  1XNQ K;  1Q18 A;  2VG6 A;  1VQL N;  2HBM A;  2OCE A;  3CQ8 A;  5C25 A;  2WFB A;  1EKE A;  1QZ5 A;  4FO0 A;  4MO5 A;  3WEE A;  4CED A;  3FGU A;  3CQY A;  2GBZ A;  2YX6 A;  3KLF A;  1NGI A;  1UA0 A;  1QQC A;  1HPM A;  4HCB A;  3K58 A;  3NGZ A;  3KK1 A;  5FRO A;  3DXK A;  3D6R A;  4LSL A;  3ZX3 A;  5BN8 A;  2HBL A;  4B9T A;  4DQI A;  1KTQ A;  3I8B A;  4K41 A;  3VQ8 A;  3MWP A;  4K25 A;  1JXB A;  4KH5 A;  4EP5 A;  2BAN A;  4N5S A;  5FRN A;  3SLC A;  3TSQ A;  1ATS A;  4CGJ A;  3S9H A;  4KRE A;  4CIG A;  2HHQ A;  4CGG A;  3FZH A;  5HRN A;  3G0Z A;  2OPR A;  4CEE A;  4IOX A;  3KHY A;  3VEZ A;  1VQ8 N;  3LAM A;  5AQV A;  4CEA A;  1S1T A;  1E3M A;  2BTF A;  5KQ8 A;  3CCM N;  3D2F B;  3QER A;  3HP9 A;  1TGO A;  3WNF A;  4FLZ A;  3DXM A;  2KTQ A;  2DY4 A;  1CXU A;  5HRS A;  3DRP A;  4CHO A;  3VEN A;  2RPI A;  1RDD A;  4OGC A;  3CM5 A;  1SKR A;  2AJQ A;  2WC9 A;  3LWL A;  3MK6 A;  4H0T B;  3RR8 A;  3KLH A;  2ETJ A;  1VQN N;  1L3V A;  4H5N A;  4CBW A;  4F2S A;  1LCU A;  1S3X A;  2P9L B;  1K8K A;  1W7A A;  3QO9 A;  1V4T A;  4E3S A;  3NH1 A;  1K6Y A;  4KRF A;  4IBN A;  4H5W A;  3SQ4 A;  4H8K A;  1YI2 N;  4LF8 K;  4RTF D;  4CK2 A;  4OKE A;  2Z1H A;  3CIP A;  4AM7 A;  1EP4 A;  3O4N A;  3CF5 L;  3MXJ A;  5FPN A;  3FR0 A;  4AHR A;  3EE9 A;  4ILG B;  3AVA A;  4JKC A;  1DT9 A;  2GEL A;  3VGL A;  1D4X A;  3DWL A;  1Q9X A;  3HOT A;  3LDL A;  2YCH A;  4CVN E;  1JLE A;  1W97 L;  1N8R O;  3V4I A;  1XHX A;  3A5N C;  4IOC L;  4FZZ A;  5HRO A;  3ZX2 A;  4Z4C A;  3CC4 N;  3CET A;  1BHL A;  4KB1 A;  3QIP A;  3SQ0 A;  2ZJP L;  4H0P A;  1BA1 A;  4XH5 A;  3M5R A;  3SAH A;  3K5L A;  3V6D A;  4B1Z A;  1Y64 A;  4ZTF A;  4BRL A;  4WFN L;  3VQD A;  4AHU A;  1NM1 A;  5JIC A;  5BRF A;  1J5O A;  4B3O A;  2VGM A;  2HHW A;  4I9Q A;  3OVN A;  4BE1 A;  1VQ4 N;  3KLE A;  4B9L A;  3DOL A;  5JLH A;  1VSF A;  4FLV A;  3H08 A;  3G71 N;  3PLA A;  1BU6 O;  3ASM A;  1DLO A;  2I7P A;  4BE0 A;  3R8E A;  4RW6 A;  3T1Y K;  1U04 A;  4ISE A;  3DAW A;  4BC2 A;  1QZ6 A;  1JLC A;  3L0Q A;  2ZQB A;  1LWF A;  5C12 A;  1TK0 A;  1QE1 A;  2W40 A;  4OKJ A;  3UB5 A;  3THW B;  5F0X A;  1SZ2 A;  2NRR A;  4JHD B;  3ULE A;  2RE2 A;  3OYN A;  1J5E K;  4I2P A;  1BIZ A;  2JLE A;  1JCE A;  4FWM A;  5BRD A;  3V9X A;  3CJ9 A;  2HMI A;  5AZI B;  4ELV A;  5ADX H;  2O8E A;  1NK7 A;  3PY8 A;  5GIP A;  3V9W A;  4DSL A;  3K57 A;  3NVK A;  5KRS A;  3NFA A;  2QWL A;  2I7N A;  4CZI A;  3SUP A;  3MX5 A;  2YJE A;  3L3V A;  1TVR A;  4BRN A;  3H45 C;  4FWP A;  3SNN A;  2KFN A;  2YHY A;  3VF4 A;  1U47 A;  2D0A A;  4IJA A;  1LOT B;  1VQP N;  4LF7 K;  3HI0 A;  4B1Y B;  2OPP A;  5KQD A;  3O1B A;  3VTI A;  4CJ3 A;  1ZBU A;  4DS4 A;  1JCF A;  4BRD A;  3T19 A;  4KB0 A;  1RT7 A;  3ZSZ A;  5AQZ A;  4BC5 A;  4W5Q A;  2VQF K;  3MEE A;  3NF6 A;  3TSP A;  2QTD A;  3HXM A;  3AVJ A;  1U4B A;  4LSN A;  3AVM A;  3MN9 A;  4IDH A;  1L3S A;  4HHT A;  4C1N I;  1EQY A;  1S1X A;  2HVH A;  3BZK A;  3V9Z A;  1KFD A;  1S5J A;  5TKY A;  2V52 B;  2CGL A;  2X6N A;  5CZ2 A;  4CFA A;  4M3W A;  3O4W A;  4O0I A;  4BRP A;  3C6U A;  4KBO A;  3JYT A;  2GV9 A;  4BRM A;  3RSE B;  1HJR A;  1KQS M;  3RMD A;  2KZM A;  1HKC A;  4C8N A;  3CCS N;  4DQS A;  4K8Z A;  3ZSR A;  5DM6 L;  1HNW K;  3P1G A;  1QQN A;  5LJV A;  3QEW A;  3T1H K;  3S3N A;  2B5J A;  3CM6 A;  4KV8 A;  2YHW A;  5HOO A;  3NDK A;  1VHX A;  2UUC K;  1T3V A;  4KHN A;  2P9K B;  3DM2 A;  3V9S A;  3WQT A;  3QLH A;  4DQR A;  3V1O A;  5JMV A;  3UIQ A;  3SV4 A;  1ZBS A;  1QVF M;  4CJ7 A;  3OYH A;  2R7Y A;  4CZE A;  3ID6 A;  1BOT O;  4A5A A;  5CE3 A;  1N6Q A;  4NXN K;  4NLC A;  1NJW A;  1HNI A;  3SBG A;  4KI6 A;  3ZSW A;  3BY5 A;  3THY B;  1T7P A;  3KK2 A;  3KTQ A;  2QM1 A;  3DYA A;  4I6M B;  3L2R A;  4K43 A;  5IWA K;  4M3Y A;  3HST B;  3G4S N;  3PUF A;  3AVB A;  2O8F B;  1DKG D;  4A59 A;  2OA8 A;  3ZSY A;  4L3Q A;  3DLK A;  3UKR A;  4YOX A;  4E7K A;  3AAP A;  1BO5 O;  3B8A X;  3F9M A;  4IZ9 A;  5FPM A;  5FLX O;  1E4G T;  2QWN A;  3VQB A;  1XI1 A;  3QDK A;  4WQ5 A;  3N4Q A;  2Q0U A;  3IMX A;  3O8M A;  2KZZ A;  2H3G X;  1GOB A;  1MWK A;  4CGF A;  2F96 A;  3KIO A;  4C8K A;  4CW7 B;  3BP8 A;  1WUA A;  3N4P A;  1C6V A;  1C0T A;  1GLB G;  1HNZ K;  4BGA A;  4DV6 K;  5KRT A;  3SQ2 A;  1N32 K;  3M8P A;  2AA4 A;  5K14 A;  3K59 A;  4C1N K;  4E89 A;  4CF9 A;  3CCR N;  2DFH A;  3O9T A;  1CZ9 A;  4CF2 A;  4FVU A;  2P5O A;  4JKB A;  3NH0 A;  5AQK A;  2VG7 A;  1RDB A;  3DXM B;  1T8E A;  4DCH A;  2P9N B;  4CZK A;  2QWQ A;  3NH2 A;  3FFK B;  5AQH A;  4DV7 K;  3TTC A;  5GAG P;  4H0V B;  1Q81 O;  4G1Q A;  1R59 O;  4CZH A;  2QWR A;  3CXC M;  3ZCM A;  3VEY A;  3SUO A;  4WQ5 C;  1YHQ N;  3DLG A;  3TAE A;  3QFP A;  4B3R K;  5M1O A;  2XY5 A;  3KKS A;  4FLW A;  5AQT A;  1MDU B;  1WSE A;  3C65 A;  1JLA A;  1YJW N;  2YNH A;  3CJA A;  2UXB K;  2W6L A;  3MN5 A;  2W42 A;  2ATQ A;  3DRR A;  3LM2 A;  1B9F A;  3ZLJ A;  3MWT A;  1EXQ A;  1T6C A;  2P51 A;  5BPL A;  5EVZ A;  1ZBI A;  4CJL A;  4CER A;  4XH4 A;  2D4W A;  1JCG A;  1LWC A;  2Z1G A;  2D5R A;  4KTZ A;  1D9F A;  2O8C B;  4JKH A;  2IOC A;  3TTD A;  5BPM A;  1BL3 A;  1WBB A;  1ILY A;  3VQQ A;  3CC2 N;  3LP1 A;  4HUE A;  3FLC O;  3BF3 A;  2HW3 A;  5HL7 L;  4LH4 A;  5EOY A;  1BCO A;  2O8D A;  1IBM K;  1C0G A;  4M63 C;  3ZSO A;  3CFO A;  1IG8 A;  1IBL K;  1RBU A;  1RFQ A;  4OPJ A;  1NK9 A;  3O6W A;  1QHT A;  1X1P A;  3QES A;  2NNW A;  3ZSX A;  4KHP K;  1CLQ A;  4CHZ A;  3OJU A;  4FZX C;  1DEJ A;  2P9U A;  5AFU A;  3MMV A;  2HHV A;  3KWG A;  4MLE A;  5AQU A;  4DSE A;  5AQF A;  2FBV A;  4BRC A;  5EY4 A;  4KTQ A;  4YOT A;  2F7T A;  2HND A;  3L4Q A;  4Z0U A;  4FLY A;  1WSJ A;  1K8A O;  2PY5 A;  1NGA A;  1S6Q A;  1T6D A;  5JS2 A;  4PWD A;  1NJZ A;  2QXL A;  4KH4 A;  4CF8 A;  1SV5 A;  2ZD1 A;  4OKK A;  2YI1 A;  4B3T K;  1NLV A;  4CJF A;  4FWQ A;  3CJ7 A;  4E7H A;  1TL3 A;  1NGJ A;  2YNG A;  3P5J A;  4FVM A;  2JWL A;  3OYC A;  3U3G A;  4DF8 A;  4M7Y A;  2Y1I A;  4DU4 A;  3J80 O;  2XO7 A;  3ATU A;  3I0R A;  1OH5 A;  4Q0B A;  2OYQ A;  1C1B A;  3VQ4 A;  3RRG A;  4FJI A;  3L2U A;  4DTS A;  1S6P A;  1IO2 A;  4JD2 A;  4NLB A;  1IKY A;  3ZSQ A;  5M1N A;  4IO9 L;  4FJM A;  4JV5 K;  1HMV A;  4OGE A;  2OAN A;  4CK1 A;  4IFE A;  3SBT A;  3OTO K;  4DSI A;  5AQM A;  2D0P A;  1NMD A;  1DTT A;  3V1Q A;  4BY9 C;  4CK3 A;  4ELT A;  1A5V A;  1HUX A;  5C24 A;  1KLM A;  4DUY K;  3THX B;  4W5O A;  4ISF A;  4YDU A;  2QWM A;  2NRW A;  4F2R A;  4A5B A;  3TTF A;  1WOQ A;  4J2D A;  3JS6 A;  5CY4 A; 
#chains in the Genus database with same CATH homology
 5IWA K;  4DR1 K;  2UU9 K;  4LF7 K;  4JI8 K;  4DV2 K;  1IBK K;  4DR6 K;  1N36 K;  4JYA K;  1IBM K;  2ZM6 K;  1IBL K;  4CVN E;  2UUB K;  5AJ3 K;  3JAM O;  4K0K K;  5IT9 O;  5FLX O;  4LF4 K;  4KHP K;  1XNQ K;  4DUZ K;  4X65 K;  2UXD K;  2VQF K;  4B3S K;  1I94 K;  1XMQ K;  1N34 K;  4DR3 K;  4LFB K;  4CW7 B;  4YY3 K;  4JI5 K;  3J7A P;  4X62 K;  2VQE K;  1HNZ K;  1HNX K;  4DV6 K;  1N32 K;  4NXM K;  4OX9 K;  4JI7 K;  4X66 K;  4JI2 K;  1XMO K;  4V19 S;  4GKK K;  4DR4 K;  4B3T K;  4JI0 K;  4LF5 K;  1HNW K;  3T1H K;  1FJG K;  4DR5 K;  3J80 O;  4DV7 K;  2UUA K;  3T1Y K;  2UUC K;  3J81 O;  4JI4 K;  5LMU K;  3J7Y P;  4DR7 K;  4B3R K;  4DV5 K;  4LFC K;  1N33 K;  5A2Q O;  2UXC K;  4JV5 K;  4DV4 K;  4DR2 K;  1J5E K;  2HHH K;  4JI1 K;  3OTO K;  4X64 K;  2UXB K;  4DV0 K;  4LF6 K;  4DV1 K;  1XNR K;  4NXN K;  4JI6 K;  4B3M K;  4LFA K;  4DUY K;  1HR0 K;  4GKJ K;  4JI3 K;  4LF8 K;  2F4V K;  2E5L K;  5LMN K;  4LF9 K;  5BR8 K;  5LL6 Z;  4DV3 K;  4YHH K;  4AQY K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...