4YY3K

30s ribosomal subunit- higb complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4yy3K00
1N32K 1XMOK 5LL6Z 4LF9K 4JI1K 1HR0K 3OTOK 3JAMO 4JI3K 4DR6K 2VQEK 4JI6K 4LFAK 4DV0K 4DR2K 1J5EK 1IBKK 4LFCK 1XNRK 4LF6K 4NXNK 4X62K 4JI5K 5LMUK 4X65K 1HNWK 1HNZK 4NXMK 4JI8K 4K0KK 3J7YP 4JV5K 4DUYK 4GKJK 2ZM6K 4LF7K 5AJ3K 2UUAK 4JI4K 4DV7K 3J7AP 3T1HK 5FLXO 4DR7K 4LF4K 5IWAK 4JI0K 4DR3K 4V19S 4DV1K 4X66K 4OX9K 4GKKK 1XMQK 3T1YK 4CW7B 1IBMK 5IT9O 3J80O 1I94K 2UXBK 2UUCK 4B3MK 4YY3K 4DV4K 4B3RK 4DR1K 4YHHK 4JYAK 4LF5K 4DV6K 1HNXK 2UXCK 4LFBK 4JI2K 4CVNE 2UUBK 1XNQK 2VQFK 2UU9K 4KHPK 4DR5K 4DV3K 4DR4K 2E5LK 1IBLK 4B3TK 4X64K 2HHHK 4B3SK 2UXDK 4DUZK 1N36K 4JI7K 4DV2K 1N33K 1FJGK 4DV5K 2F4VK 5A2QO 5LMNK 4LF8K 4AQYK 3J81O 1N34K 5BR8K
chains in the Genus database with same CATH superfamily
4H0VB 4WF9L 3SV3A 3M5RA 3V4IA 4FJ7A 3NDKA 4KTWA 2EX3A 4DG1A 5AZJB 5AQGA 1RTIA 2HHXA 1FK9A 5FPMA 2BH1A 3LL3A 1S22A 2HNYA 3NAEA 4E1JA 3ULDA 2HHSA 1EQYA 1U48A 2JWLA 4XH5A 5AQUA 3HPHA 3L3UA 3NBPA 5J2MA 3VENA 1CXUA 4Y1DA 1HNWK 4Q0BA 1JKHA 5KGXA 4BGAA 4KRFA 4DUYK 4I9LA 3VGKA 3EKUA 1T6CA 4DU1A 2PBDA 3C7NB 2QWPA 4IJAA 3L8BA 5AQRA 4JI4K 1NK4A 5AQXA 4LH4A 1IV0A 1BA1A 4KREA 4BRFA 1VQ4N 1WSGA 3V9WA 4DR7K 1NOZA 1YITN 3GBTA 4HTLA 4E1MA 2HBKA 4X66K 1Q8IA 4O55A 3VQEA 4AF1A 1GLJO 3F9KA 3CPEA 2YV0X 5K14A 1OH7A 4FOEA 4CJWA 5SZTA 3E9LA 4WQ5A 1H1VA 3EE8A 4YY3K 1ZBSA 4UQGA 4K43A 5JICA 1TKDA 3ENHA 4LF5K 3WXIA 2IVPA 1NJIO 5F2RA 2G8UA 4DTJA 1EXQA 4B9VA 2UU9K 1BI4A 3RR8A 3DM2A 5GAEP 3ZSVA 3LWMA 4B3TK 1RT5A 4N56A 1C1BA 4CEDA 2HHHK 4AHCA 2WONA 2QTDA 4DTNA 4DCHA 3CI5A 4DV2K 4KH5A 2KZMA 4DWIA 1QQCA 4Z4FA 5AFUH 3AGKA 1SKRA 2QW9A 3VQ6A 4GV9A 1LAWA 4HUGA 1WAFA 3IRXA 3KVGA 4A5AA 4NCGA 4FCYA 3ZT2A 4H0YB 3LDSA 2CH5A 2IVOA 5AFUA 2W42A 3KTQA 3AO3A 2HBLA 3ZT0A 1BHLA 3QEIA 2ASMA 4CI6A 1MWKA 3O1WA 4LFAK 1WOQA 2O8DB 3ZETB 4DSJA 1J5EK 3CCUN 1X1PA 3QEVA 3D2EB 4DTXA 1LW2A 4KBOA 5M1NA 1NGGA 4CIFA 4X62K 4FJ5A 1SQKA 1BO5O 4HVJA 3J7YP 2QWLA 4RW4A 4I9QA 5J2QA 4PY5A 2NNWA 4U7BA 5LJVA 2CGLA 2NRXA 4C8LA 4GMJB 3CJBA 3MN7A 4N5SA 3PO4A 3OHRA 3OYDA 3T1HK 3A5LC 5JLHA 4CCHA 1HYSA 3VMFB 1B9DA 1BU6O 3UB5A 3AA5X 3T1AA 2HBMA 4CJEA 1S9GA 4JI0K 4OGEA 4DTRA 4FLUA 4EAHD 3V9XA 2YHBA 1KLMA 1C0GA 4N47A 4BWMA 4HTUA 1CLQA 1C0FA 1HPMA 2ITGA 3OBYA 3ZYYX 3HSCA 1NKBA 2H3GX 3OY9A 5JLFA 3SZ2A 3SPZA 4NO7A 1U04A 1VQ9N 3F9MA 3O08A 3NH0A 1NJYA 3OS2A 1JLAA 3MN9A 2FF3B 3AGRA 2XY5A 3TABA 1XC9A 1BIUA 2YKNA 4DV6K 3KK1A 3LP1A 2E2QA 4L3QA 4BRPA 4FSVA 3MWPA 3LDLA 3O80A 5AQIA 1IG9A 5LY3A 4Z4GA 1Z6RA 2O8CB 2FSKA 3MEEA 1VQNN 1HYZA 2NRRA 4BR9A 1N36K 3AO5A 2PY5A 1NJWA 2OPSA 1ZBHA 4CHQA 3BP8A 4DTPA 3RMDA 4A2BA 4M3UA 1VSFA 3E1YA 2WBNA 2VWBA 3HRGA 2HHVA 1J54A 4JKEA 3TPQA 3G6EN 1HKGA 3E01A 1LWEA 5AQZA 3AVIA 4KI6A 1RCHA 4JI6K 4PL7A 1Q7YO 3P83D 2O8BA 4YOYA 4DS5A 4J2EA 1JCGA 5CE3A 3CG7A 2GX9A 3CCMN 4EZ6A 3ZT3A 3QERA 4MQ3A 2V51B 4J2BA 1WSIA 4EHTA 4IOCL 4E89A 4JAXA 5M1KA 4PA1A 3W0LA 2G8WA 1ZBLA 5AJ3K 4IJNA 3MCPA 1VQ8N 4DFJA 1G15A 5AQHA 4YOVA 1Z05A 4IO9L 3QFPA 1VSEA 3AVLA 3DJCA 2W6KA 4A57A 2GELA 1ZYQA 2VGMA 4CBUA 4KHWA 1IKXA 1WLJA 1DEJA 3KK7A 4RTFD 1XMQK 1GLFO 1RDUA 4NLCA 3ID6A 2P9NA 4CJVA 4XEIA 2YCHA 5KQDA 3CCLN 3VOVA 1KVAA 4EIAA 4FLTA 1YTUA 4BRMA 3L2VA 4YORA 3M6GA 4FLWA 3GL1A 3KD1E 1NGFA 1U47A 3DLHA 1QE1A 3ZETA 2VG5A 1A5WA 4PQUA 1U2VB 1YI2N 1NBWA 3EZWA 2IOCA 4CJLA 4OKJA 1RGIA 2D5RA 3FFKB 1T3VA 1DGKN 5B8HA 2D0CA 4B9SA 4H0PA 2EHGA 5CHIA 1RILA 1YAGA 4I2PA 3OBWA 1RBTA 3TI0A 5LMNK 1JCEA 4IFEA 1NU0A 1W7AA 3THWB 3MDQA 4CGFA 1ESVA 3MAQA 4FWRA 3TANA 1HRHA 1IKWA 4LF9K 4ZTJA 1RDDA 1W9HA 4JI1K 1HR0K 4C8OA 2ASPA 2P9KA 4B9QA 5GAGP 3JAMO 4ILJA 2EWSA 4F2SA 1VQ6N 4O0IA 1KLNA 1KVCA 4IBNA 1XUPO 3VQDA 2HHWA 4BQZA 3CCEN 3V1RA 4RW7A 5J2PA 4CHOA 2BE2A 2GUPA 3L2WA 3QIPA 4CEZA 3OS0A 3PUFA 3RRHA 3VPZA 4BR7A 2HB5A 2PFUA 2B4JA 4MDBA 4H5RA 3UIQA 4IOAL 2RN2A 5KPRA 2V7ZA 1RBSA 4QS7A 5MLCQ 3EL2A 1QSYA 5HRNA 3NHGA 3K58A 2GWJA 4JD2A 2Z1JA 4J2DA 1WB9A 1KRPA 4HUEA 4B9UA 4B1UB 5ADXA 1GLEG 4DQSA 4M45A 1NGCA 1S1XA 5M1QA 4H4OA 3LDQA 1IBMK 1B9FA 4JKCA 3S3MA 3NVKA 3MK6A 4CD3A 4CJSA 1NK6A 1DT9A 3G10A 3RMCA 3AVJA 5HLFA 3TSUA 4YHHK 4JYAK 4PL8A 3EN9A 2UUBK 3LAKA 5GIOA 2A6AA 1JLCA 1IKVA 2QI2A 4BWJA 3C65A 3C6HA 3H3NO 4KFBA 4DTSA 3S41A 5M1FA 1RT1A 3KLHA 3MX2A 4B3OA 4CJ7A 2OPQA 3JSMA 3G4SN 3LP3A 5BREA 1FKOA 2KFNA 1T44A 5KPZA 4LD0A 2YHXA 1HYVA 3THVA 1X3MA 2ATQA 1XMOK 2IS3A 3QFUA 3Q7BA 3ISNC 2YI1A 3N4PA 3AVCA 4FOIA 1S1TA 2ZQBA 5SWMA 2J4RA 5I42A 1L3UA 1MWMA 1RDAA 5KRTA 4M3WA 3CQ8A 3ALYA 3G0ZA 3SQ2A 4AHUA 4R79A 5EVZA 1LW0A 4B1XB 4BR0A 2ASOA 3SMPA 5KTQA 3HOTA 3A2FA 3AVHA 3MXIA 3AO4A 4I7FA 2QM1A 1BDGA 4JI8K 1TAQA 3PLAA 3NVMA 4CZEA 4LF7K 3SYZA 3D2FB 3KLGA 3CPWM 4CE9A 1TV6A 2KW4A 4CZHA 3W3DA 4BRAA 1SZ2A 3C6UA 3BZCA 1NGEA 5AQPA 1E3MA 5AQTA 4KO0A 3ZLJA 2WFBA 1E4FT 1J9AA 1NKCA 4CF9A 1YVNA 4M7XA 3UKRB 4ELTA 1LAVA 4GKKK 1VRTA 4CZLA 1HQUA 4JKDA 2OTJN 3WXLA 3H1VX 3LANA 3IUCA 4GY2B 4DR1K 1KXPA 4CEOA 1S3XA 4CIGA 1X9JA 4BR2A 3GOIA 4PHTX 2YNFA 3LPTA 3VF2A 1BOTO 3OJUA 2X74A 5C15A 4PKGA 1NLVA 2P9NB 3R1XA 4CGJA 3SJJA 4Z4CA 3IKMA 4W5RA 4A62A 1QHAA 3ATUA 3VTHA 2FBYA 4FL9A 4H8KA 2PZSA 1RDBA 3H6EA 1A5XA 4F4KA 4YOXA 4BRIA 2Z1GA 3HL8A 2FBVA 3OYBA 1YF5L 3TWHA 3WXKA 3DOKA 2OPPA 2Q3SA 1HKCA 3O9RA 4CF1A 3J81O 5CZ2A 1KQSM 1D4XA 3RSEB 4BDYA 2XHBA 4JK9A 3K5MA 1GLLO 3QDKA 5AZJA 1L3TA 3CCJN 4JI3K 1VSDA 1J5OA 4FZXC 3E9OA 4DQ8A 3DMJA 1KAXA 3ZSRA 3M8QA 3PV8A 4MLEA 4DS4A 3HVRA 4DF8A 1YUWA 3CC4N 3DLKA 2NZTA 1W2BM 1NWKA 4XH4A 3ZX2A 3BF1A 2QWQA 4PKIA 2JWKA 3HZ6A 5AR0A 2E2OA 3CCVN 3VEXA 3CQXA 5FPEA 2FF6A 1D5AA 3K5OA 4E0DA 4KPYA 5FLXO 3SAHA 2VWKA 1VRUA 4Z4EA 2P9PB 4KAZA 4DR3K 3CJ9A 2HMPA 3KZBA 3B8AX 4DV1K 1GLDG 3SCXA 1C0UA 3MXJA 1EX4A 1GOBA 3J80O 1KFSA 1JL2A 2OZMA 3BZKA 1KAZA 4GVMA 5T7BA 5HRPA 3U6FA 2UXBK 3NF9A 1Q82O 4B3RK 1UWBA 4ISFA 1NK7A 4B8CA 4O8KA 4FWOA 4HHTA 3H45C 4O44A 4ILGB 4F8RA 5M1OA 4LH5A 5ELZA 3FLCO 1E4GT 5H1SQ 4AHVA 3WUHA 2IVNA 4GV3A 2W6LA 1S9EA 3KWIA 4B8AB 2A1SA 1OH5A 3P1GA 3U9ZA 3T7ZA 3KLIA 3WNHA 3O4WA 5C24A 3V9UA 2KKZA 5A2QO 2KZZA 1A5VA 2QKBA 3R6MA 3UKUA 3SQ1A 3CJ1A 3LM9A 2IIRA 4CEAA 3SK3A 4CIEA 4FK4A 3RMBA 1HLUA 3CJCA 1TUYA 1S5JA 1LV5A 2ZGYA 1YT3A 3KWGA 3LP0A 2WTUA 4A2AA 4CGIA 2P5OA 4IWVA 1BIZA 3LDPA 4H0OA 4FJLA 5C2DA 1VQ7N 1JXBA 4HCBA 3WNFA 1K8AO 1X9SA 2P1JA 3TAEA 1RT4A 4FWSA 2V52B 1QQMA 3VF4A 4BROA 1U45A 4K0KK 4BDPA 2E2NA 3TAMA 1VQPN 3EY1A 2E6MA 4I2QA 2GBZA 3TU5A 2Y1JA 3FZKA 4CEEA 3F5TA 3E9PA 3O9SA 4A61A 3DRRA 1SAZA 4QAGA 2QK9A 3MWTA 4BGBA 3QETA 3FGUA 4FWKA 1C0TA 3OYKA 4ICLA 1D9FA 2D1KA 5I9EB 1U49A 3O3FA 1X3NA 3VETA 4YDUA 2NUBA 1G99A 4WFBL 4W5QA 1NK0A 4MDAA 4NYFA 4IEEA 3HPOA 2VGNA 3NF7A 4BREA 3BGRA 1P90A 3MN5A 4FWPA 5F0XA 4UY8O 3JYTA 1HJRA 3ZEUB 4JI2K 3UKRA 4JRPA 3LAMA 3CCSN 1D8YA 1TAUA 3O5BA 1SKWA 3OYFA 2PAVA 3OVNA 3SV4A 1NMDA 1NNEA 4M3YA 4DSLA 3RVCA 4B1VA 5KGWA 3O9UA 3OYAA 4AH9A 3ZSWA 4AHTA 4FJIA 1EKEA 3PX6A 3CERA 4KTZA 3VN5A 2VG7A 2O8EA 4H5TA 2E6LA 3P4IA 3TR8A 1GLBG 3ZEUA 5BR8K 2F8SA 4RW6A 3AVBA 2O4GA 3NCIA 1JLFA 5AQNA 3V9SA 3WXMB 2ZJPL 3M3ZA 1JXEA 4BC2A 1ILYA 1VSMA 2P9SB 1KVBA 4CJPA 5BRHA 3THXA 4FPAA 4FW1A 3OYEA 3OYMA 4E7HA 4DKWA 4KTQA 4BVOA 1JCFA 4EHUA 4U67L 1EWQA 1KTQA 4FVUA 3U9DA 2NLXA 4LF6K 4NXNK 2B6AA 3LALA 4IO8A 2Y1IA 3D6RA 5LMUK 1IH7A 3PX4A 4JLHA 3IS9A 4CJFA 2KLAA 2G8FA 1BISA 4DLGA 2E1ZA 2E88A 3L4QA 1Q9YA 1DTTA 4JHDA 4A59A 4DU3A 4FYDA 4JNEA 2HHUA 1QQNA 3OS1A 1QVFM 2JLEA 5KQ8A 4I6MA 4CHZA 3VGMA 3K5LA 4WCEL 4FJXA 3RWUA 4CJQA 3FZHA 3RSEA 3O3HA 3DLBA 4FLXA 1M1KO 1Z26A 2NRZA 5GIPA 2ZF5O 3C94A 4OPKA 3E66A 5JS1A 3HO1A 2UYTA 3BF3A 3P39A 3HSTB 4EZ9A 4CF8A 5JVGL 2YHWA 4DTUA 2JGUA 5AQKA 2Q31A 4CVNE 4LSNA 4FK0A 2P5GA 2ZJQL 4B1YB 1NK9A 5DMRA 3TARA 5EU7A 4JN4A 4KHUA 5AZIB 3ASMA 3H3OB 4RCHA 4CJTA 3PY8A 4FM0A 4DV5K 4BG8A 4BRHA 4XIUA 1N6QA 2F4VK 3QBXA 1RT7A 4AQYK 1NM1A 2YNIA 3VGLA 3U3YA 4BRCA 4DMNA 3D0PA 4FLYA 2HF3A 1QSSA 3WQUA 4CD1A 1BCMA 3GG4A 3MMVA 1WBBA 4KKOA 4CERA 2E8AA 3DWLA 1CZBA 4YOUA 4FJKA 1SV5A 1TL1A 1XQSC 3LDOA 3L2QA 3THXB 1XHZA 4CZMA 3NF8A 1XNRK 1YJ9N 2NRTA 1V4SA 1J53A 3DLLL 4JKHA 5BPMA 5AQVA 4C8NA 4QCLA 1KCFA 2HF4A 4JKFA 3AO1A 1KFDA 4FWMA 3TTFA 4CGGA 4B9LA 3G71N 2A41A 2YHAA 2HVIA 3OJSA 3R8EA 4M63C 3J7AP 2XO7A 2F8TA 2KFZA 2FBTA 4CEFA 4EFHA 4LF4K 1BL3A 2YNHA 4FJJA 3AV9A 3CIPA 1RDCA 4OO1J 2HW3A 1CXQA 1HMVA 3AAPA 4RW9A 4C1NI 3NH2A 3HM9A 1T8EA 1N5YA 3R9PA 3S9HA 1NGJA 4E7LA 2G8HA 4OLAA 5IT9O 1S1UA 4OVLA 2G8VA 4BRQA 1QHTA 1BQNA 3PSFA 5C12A 3IDHA 3SJHA 4B3MK 1VSIA 2A42A 4MO5A 4XH1A 3FZLA 1X9WA 4O0JA 3O1BA 4DSKA 2Q1NA 5C2FA 3SAGA 1TUUA 4CGDA 2O8EB 1MU2A 2GUIA 3KJVA 3QEPA 2IDOA 4BVPA 2RPIA 3VEZA 4DV3K 3A5NC 3RTVA 4J2AA 2ZE2A 3CQYA 1BCOA 3BY5A 4JK7A 4JHDB 1RTJA 4B3SK 3M8PA 4M3RA 1GLCG 1RBRA 3H08A 3ZX3A 2DFHA 3WEEB 3EZ5A 3SBGA 1ZXOA 3V1QA 3TTCA 4H5NA 1WSFA 1CZAN 3L0QA 3JS6A 3SPYA 1N34K 4DLEA 1N32K 4M3TA 2FSNA 1FW6A 1BI4B 5HOOA 3EO3A 1MA9B 4CZFA 3O4QA 3VQ5A 3MXMA 4CESA 4DR6K 4DV0K 4GV6A 1VQON 3SBTA 3VEVA 1WUAA 3A5OC 1RT6A 2OANA 3HI0A 4F9OA 3C0BA 1VQLN 5CY4A 5J1EA 1M90O 1W97L 3VQ9A 1LCUA 5JVHL 4CFCA 2BANA 2A40A 3DLRA 1RT3A 2Q36A 4FZZA 2E2PA 4PUOA 2O4IA 1LOTB 4FW2A 1ASWA 5BRDA 4IKFA 2DFEA 3KKSA 4ISEA 3TAQA 1JJ2M 3NH1A 4LY7A 2QA4N 4WQ4A 2HHTA 2X6SA 2CGKA 4BDZA 3M8SA 3TAGA 2X6NA 1NK8A 3ENBA 5AQYA 3FZMA 3A5MC 1KD1O 4BRLA 4DTOA 4FWQA 1HQEA 1HX1A 3DXKA 3O4NA 3VQBA 4DQRA 4OKKA 2UUCK 1SL0A 4B1WB 4IG3A 1HNVA 2YJEA 1S1WA 4C8KA 4ISGA 3QB0A 3P38A 1UA1A 4KHNA 2VQFK 1XI1A 1EP4A 2YNGA 3LZIA 4B9TA 4DQPA 3ATVA 3G25A 2Q0RA 5M1PA 2CH6A 4DU4A 4DHYA 1QZ6A 2QXFA 3C6AA 4AHSA 3VQPA 4OPAA 2OPRA 1HUXA 4MFBA 3CMAN 1K8KB 4I6MB 1Y97A 1RBVA 2ITMA 4ELUA 4RW8A 1SL1A 2ZWHA 3AVKA 3WQTA 4DF4A 1NK5A 2P9LB 4FWLA 4A5BA 4Z4HA 1R0AA 4BE2A 4G1QA 1NJZA 2P51A 3VEWA 3OW2M 4DSFA 4E7JA 2Z1HA 4CJ4A 3HK2A 3VF6A 4K41A 4BC5A 3EEQA 3KHYA 5F1XA 2HVHA 1BWFO 5CYMA 1HNZK 4E1NA 3AARA 1GLAG 3DRPA 4PKHA 5BPNA 1NGIA 4JS5A 3EE9A 1EWRA 3OA9A 3OYCA 2ETJA 1TYQA 1IKYA 4QS9A 1FKPA 4BRGA 1L3SA 3L4IA 1RT2A 3VEOA 3I8DA 2QXLA 3F73A 1OVYA 2F7TA 2OA8A 1BUPA 1S72N 1YVUA 4K42A 4JK8A 4IDHA 4FK2A 4CBXA 4BRDA 2HHQA 5AQOA 4HCCA 4N76A 3VEYA 4BQLA 3F2KA 4TSXA 3O9QA 4JKBA 4Z4IA 2VYPA 4C23A 1I94K 1W0HA 3KD5E 1QSLA 3DLEA 1T05A 4K8XA 3MN6A 3O9TA 3GE1A 3HYFA 2W41A 4LSLA 4O5FA 2QWRA 4GNIA 4Z94A 2V7YA 3VQ8A 1P8ZA 3O8MA 1VAZA 4LFBK 1EO1A 4EP4A 3ZT4A 5DM6L 1C1AA 4DR4K 3J7ZO 3KK2A 3QICA 2P9SA 3I0SA 1NMNA 5FPNA 2KQ2A 1NG9A 2UXDK 1J6ZA 3IG1A 3KLFA 4JI7K 2BGGA 3AVAA 2O8DA 1RBUA 4B9NA 3LPUA 3LZJA 3U3GA 4CHYA 3AA2A 2P9PA 2Q97A 3CCQN 1MDUB 1UA0A 2HOEA 2VG6A 3PX0A 1WSJA 3RRGA 2KTQA 5LL6Z 3OYNA 3HXMA 1FXXA 3CXCM 2AA4A 4KHQA 2FC0A 3CFRA 3BUZB 2E20A 3K9KA 1CZ9A 3QEWA 3OYGA 2QKKA 2DPNA 2ZGZA 4M41A 3WEEA 2QEXN 3ZSQA 4JKGB 4W5OA 2XY7A 1O13A 3SUPA 1VK0A 2I7PA 4E3SA 4Q5VA 1K6YA 4CZIA 4FZYA 1VSJA 4WFAL 3NFAA 3S3NA 1ITGA 3QESA 1T03A 4H0XB 1KC8O 2I7NA 5JS2A 1OKJA 3HJFA 3AAQA 3LP2A 3WT0A 4JRQA 3H1QA 1RFQA 3L2RA 3THYA 1WN7A 4KB1A 3JXUA 1I39A 4DSEA 2UUAK 4IG0A 3OYLA 1KAYA 1QZ5A 1TVRA 3IAYA 3K59A 4B1ZA 2P9IB 4DSIA 3CD6N 4KH4A 4WQ5C 4QS8A 3KKRA 3WNGA 3TTDA 4QOZB 1ZBIA 4NLBA 4H03B 1RNHA 3NMUA 1LWFA 4BRNA 1ASUA 4H0TB 1B92A 2O8CA 3GDQA 1VSHA 3BDPA 3SUNA 5KRSA 1RTDA 4E7KA 1Q86O 2HBJA 5EOYA 1QVGM 3ULEB 4RWTA 4HUFA 4JD2B 1HNXK 5TKWA 4KHYA 4FVMA 4CFBA 3T19A 2I5JA 5AQFA 4N41A 3T69A 1D9DA 1BGXT 4X64K 4ID5A 1TL3A 3DXKB 2D0AA 3DYAA 5KI6A 3CJ7A 4Z0UA 1ASVA 3D7EO 4M42A 3NGZA 3I55N 1TKTA 2PYLA 1RDWX 4O8UA 4AM7A 4FXDA 4ID1A 4BC3A 3VESA 3THWA 3CC2N 4BC4A 5J2NA 1NJXA 3A8YA 3VERA 3OTOK 3QINA 5AZIA 3L2UA 1REVA 4KHSA 2RHKA 3DXMB 4GVEA 1HPZA 1TGOA 4AM6A 1N8RO 3TSQA 3CF5L 4NCBA 4IFVA 2HNZA 3PO5A 4BR5A 1Y64A 4JI5K 1ZBFA 3CETA 4X65K 3VQQA 4CJRA 2A5XA 4IDKA 4JV5K 1NGDA 3J8AA 4BR4A 4OPJA 3DRSA 4HWIA 4IXCA 4YFUA 3OYJA 4BE1A 3L3VA 3CCRN 1SS6A 3FR0A 3DOLA 2DFFA 3RR7A 1L5UA 4CZKA 3VQ4A 5GINA 2Q0UA 3UKUB 2G8IA 1Q18A 4FJNA 5C25A 2FBXA 3VQCA 1NGHA 2XRIA 2BDPA 3CJAA 4M3ZA 4FJ8A 1TYQB 4CZJA 2LSNA 4G9ZA 3HOSA 3AVGA 2DTUA 1IJJA 2PYJA 4CECA 4DV4K 3V81A 4F2RA 2HNDA 3HVTA 1Q81O 3VQ7A 3QLHA 1SKSA 1NGAA 3ID8A 1XNQK 2O8FB 1SL2A 1BG3A 4DR5K 1WAJA 3P5JA 1IBLK 2QWOA 3AVMA 3N4QA 4CFDA 5AQSA 2YKMA 3NGIA 3AY9A 2E1YA 4JKGA 4K8ZA 4F3TA 3SAFA 4CK2A 4LF8K 3QNNA 4M7YA 1F21A 2P9UA 1TK8A 4YNQA 3TSPA 4FJGA 5KPTA 2P9LA 3EYZA 1OVQA 2O8FA 3KLEA 2WC9A 5FRMA 4MLHA 5C10A 2YHYA 5FPDA 1KSPA 3CMEN 3THYB 3HP6A 3D45A 2D0BA 5DK5A 4CBWA 1Z25A 4DB3A 4CFAA 1TK0A 2B5JA 3ZSYA 4LFCK 2F9WA 3C95A 3MX5A 2F96A 5E41A 4JEPA 3IMXA 2P9IA 1S6PA 3V6DA 5AQQA 1VQMN 1WBDA 2P9UB 2OTLN 2BTFA 4H5WA 4W5TA 4NXMK 1U6ZA 4H4MA 4GKJK 1S6QA 4WQ4C 2P9KB 1JLGA 1JLEA 4Y0WA 1XHXA 3T3FA 1K9MO 1WNSA 3HT3A 4KI4A 3ITHA 3KIOA 4OKEA 4AHRA 5DM7L 3PSIA 5BRFA 2GV9A 1ATNA 3M1FA 3IFRA 4V19S 4CK3A 5CR4A 1YIJN 4OX9K 5HL7L 3DI6A 3SMSA 4DFKA 1Q9XA 4CZGA 4BG9A 3K5NA 1EETA 3U4LA 3A0IX 2YJFA 5HBMA 2R7YA 3I8BA 2HMIA 3ENOA 4L8RB 3HPGA 5EXWA 1K73O 3FZFA 3DAWA 5HRRA 2UXCK 1DKGD 3ZT1A 5GADP 4WFNL 3SQ0A 2Q2RA 4WE1A 4KHPK 3H46O 4RG8A 5AQMA 3HP9A 2GWKA 3L6QA 1JLQA 4CHNA 1I3AA 3LWLA 2VWJA 3SNNA 1HNIA 1YHQN 2D0OA 2GEMA 1T7PA 3FE1A 3OYIA 4CJ3A 1U4BA 3EKSA 4J8FA 1NOYA 5BN9A 2RE2A 1N33K 3VQAA 2QWMA 4BACA 1C0MA 1BA0A 4JS4A 3MCAB 1C6VA 1WSEA 3I0RA 1NGBA 4CF2A 1LWCA 4FJ9A 3B6PA 1OH6A 5AQWA 4FPBA 2ZJRL 3NF6A 3CC7N 4H5VA 1HKBA 5E84A 1NKEA 2AJQA 1GOCA 4DR2K 1IBKK 4KV8A 5ADXH 1K8KA 4YOWA 3SQ4A 4IOXA 5EY4A 4BRKA 2BUPA 2RKIA 3AA3A 1BQMA 2W40A 1DTQA 3ZSZA 5HROA 2QWNA 2HSTA 1X9MA 4OPHA 3K57A 4DTMA 3KK3A 3HTVA 4FO0A 1YJWN 3U8XA 3QEXA 2CGJA 3LM2A 4YDUC 3C6TA 5GAHP 4DQIA 4CF0A 3FFIA 2ZD1A 4OJRA 4K25A 4ZHRA 4FM1A 2RF2A 3CFPA 4R5PA 5IWAK 3MECA 3K9JA 3PIOL 4C1NK 4FM2A 4BY9C 3CM6A 5I3UA 4CJKA 3T1YK 1ATRA 1JLBA 3AO2A 4OGCA 3K2PA 4EP5A 5AQLA 5C42A 3MEDA 1QS4A 5FROA 3ZSXA 4CJUA 4OLBA 2NRWA 3D2EA 4CEQA 2NRHA 5TKYA 3SLCA 5HRSA 4CGHA 3OYHA 5FDLA 1UOCA 4GW6A 3TAPA 3S3OA 3AVNA 2E5LK 3QNOA 2WOMA 4FLVA 1ZC6A 1JL1A 3HM8A 4IEIA 1S1VA 3PIPL 1QTMA 4NCAA 3UE5A 2WUSA 4YOTA 3D2FA 4FWNA 2KHOA 5AQJA 5D3GA 3AVFA 1FJGK 2A3ZA 1U2VA 1VSLA 1SUQA 3TAFA 3O6WA 2A1RA 1VSKA 3I56N 1V4TA 1ATSA 5BN8A 2E4LA 1IO2A 3WNEA 4KH6A 5BPLA 4F3OA 1YJNN 1DLOA 1GOAA 3CM5A 3M8RA 3WXJA 3DLGA 4ILHA 1TKXA 3QO9A 4M3XA 4PWDA 3P31A 3DXMA 2VQEK 5C0YA 2IC3A 2XY8A 1VHXA 2G8KA 3HBTA 4IFYA 4FLZA 1XC3A 3O3GA 3CFOA 2X78A 4NB4A 4CEBA 2OCEA 3SUQA 4JKAA 3QMLA 1OH8A 3ZSOA 1TKZA 2ZM6K 4W5NA 1C1CA 1HJOA 5BR9A 3VA0A 3RMAA 3C7NA 2XY6A 3QBWA 5EX5A 2IGIA 4FJHA 4DV7K 5FRNA 2AP1A 1YXQA 3CHWA 4NYNA 3ZCMA 3CYMA 3VA3A 3Q7CA 4CHPA 1R59O 3R3LA 4ZTFA 1ZBUA 3NGYA 4DFMA 5E26A 3V1OA 2OYQA 4O5BA 4CW7B 2IAJA 3MEGA 3K0SA 4MO4A 2D0PA 5LJWA 2VCPA 4IZ9A 4Y1CA 3LDNA 5JMVA 4CK1A 2YX6A 2NRVA 5CZ1A 1TK5A 4O4GA 1O1WA 2DY4A 4AILC 2O8BB 2D4WA 2OZSA 4CJ5A 1QQOA 3ZX0A 4B9MA 3AA4A 4KB0A 4C8MA 4WYBA 4LC9B 2GTDA 5CYQA 1VQKN 1IG8A 2Z1IA 2FXUA 3SI6A 5HP1A 4E7IA 1WSHA 1YTAA 4B08A 1XWLA 1UAXA 3QIOA 4DFPA 1T6DA 3NE6A 2F9TA 2FLOA 4DUZK 3B6OA 3VTIA 1VQ5N 4ELVA 4E19A 4BE0A 3V9ZA 1L3VA 3ULEA 2FSJA 4DQQA 1RTHA 3BEXA 3SUOA 4FJMA 3I33A
chains in the Genus database with same CATH topology
1N32K 1XMOK 5LL6Z 4LF9K 4JI1K 1HR0K 3OTOK 3JAMO 4JI3K 4DR6K 2VQEK 4JI6K 4LFAK 4DV0K 4DR2K 1J5EK 1IBKK 4LFCK 1XNRK 4LF6K 4NXNK 4X62K 4JI5K 5LMUK 4X65K 1HNWK 1HNZK 4NXMK 4JI8K 4K0KK 3J7YP 4JV5K 4DUYK 4GKJK 2ZM6K 4LF7K 5AJ3K 2UUAK 4JI4K 4DV7K 3J7AP 3T1HK 5FLXO 4DR7K 4LF4K 5IWAK 4JI0K 4DR3K 4V19S 4DV1K 4X66K 4OX9K 4GKKK 1XMQK 3T1YK 4CW7B 1IBMK 5IT9O 3J80O 1I94K 2UXBK 2UUCK 4B3MK 4YY3K 4DV4K 4B3RK 4DR1K 4YHHK 4JYAK 4LF5K 4DV6K 1HNXK 2UXCK 4LFBK 4JI2K 4CVNE 2UUBK 1XNQK 2VQFK 2UU9K 4KHPK 4DR5K 4DV3K 4DR4K 2E5LK 1IBLK 4B3TK 4X64K 2HHHK 4B3SK 2UXDK 4DUZK 1N36K 4JI7K 4DV2K 1N33K 1FJGK 4DV5K 2F4VK 5A2QO 5LMNK 4LF8K 4AQYK 3J81O 1N34K 5BR8K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N32 K;  1XMO K;  5LL6 Z;  4LF9 K;  4JI1 K;  1HR0 K;  3OTO K;  3JAM O;  4JI3 K;  4DR6 K;  2VQE K;  4JI6 K;  4LFA K;  4DV0 K;  4DR2 K;  1J5E K;  1IBK K;  4LFC K;  1XNR K;  4LF6 K;  4NXN K;  4X62 K;  4JI5 K;  5LMU K;  4X65 K;  1HNW K;  1HNZ K;  4NXM K;  4JI8 K;  4K0K K;  3J7Y P;  4JV5 K;  4DUY K;  4GKJ K;  2ZM6 K;  4LF7 K;  5AJ3 K;  2UUA K;  4JI4 K;  4DV7 K;  3J7A P;  3T1H K;  5FLX O;  4DR7 K;  4LF4 K;  5IWA K;  4JI0 K;  4DR3 K;  4V19 S;  4DV1 K;  4X66 K;  4OX9 K;  4GKK K;  1XMQ K;  3T1Y K;  4CW7 B;  1IBM K;  5IT9 O;  3J80 O;  1I94 K;  2UXB K;  2UUC K;  4B3M K;  4YY3 K;  4DV4 K;  4B3R K;  4DR1 K;  4YHH K;  4JYA K;  4LF5 K;  4DV6 K;  1HNX K;  2UXC K;  4LFB K;  4JI2 K;  4CVN E;  2UUB K;  1XNQ K;  2VQF K;  2UU9 K;  4KHP K;  4DR5 K;  4DV3 K;  4DR4 K;  2E5L K;  1IBL K;  4B3T K;  4X64 K;  2HHH K;  4B3S K;  2UXD K;  4DUZ K;  1N36 K;  4JI7 K;  4DV2 K;  1N33 K;  1FJG K;  4DV5 K;  2F4V K;  5A2Q O;  5LMN K;  4LF8 K;  4AQY K;  3J81 O;  1N34 K;  5BR8 K; 
#chains in the Genus database with same CATH topology
 4H0V B;  4WF9 L;  3SV3 A;  3M5R A;  3V4I A;  4FJ7 A;  3NDK A;  4KTW A;  2EX3 A;  4DG1 A;  5AZJ B;  5AQG A;  1RTI A;  2HHX A;  1FK9 A;  5FPM A;  2BH1 A;  3LL3 A;  1S22 A;  2HNY A;  3NAE A;  4E1J A;  3ULD A;  2HHS A;  1EQY A;  1U48 A;  2JWL A;  4XH5 A;  5AQU A;  3HPH A;  3L3U A;  3NBP A;  5J2M A;  3VEN A;  1CXU A;  4Y1D A;  1HNW K;  4Q0B A;  1JKH A;  5KGX A;  4BGA A;  4KRF A;  4DUY K;  4I9L A;  3VGK A;  3EKU A;  1T6C A;  4DU1 A;  2PBD A;  3C7N B;  2QWP A;  4IJA A;  3L8B A;  5AQR A;  4JI4 K;  1NK4 A;  5AQX A;  4LH4 A;  1IV0 A;  1BA1 A;  4KRE A;  4BRF A;  1VQ4 N;  1WSG A;  3V9W A;  4DR7 K;  1NOZ A;  1YIT N;  3GBT A;  4HTL A;  4E1M A;  2HBK A;  4X66 K;  1Q8I A;  4O55 A;  3VQE A;  4AF1 A;  1GLJ O;  3F9K A;  3CPE A;  2YV0 X;  5K14 A;  1OH7 A;  4FOE A;  4CJW A;  5SZT A;  3E9L A;  4WQ5 A;  1H1V A;  3EE8 A;  4YY3 K;  1ZBS A;  4UQG A;  4K43 A;  5JIC A;  1TKD A;  3ENH A;  4LF5 K;  3WXI A;  2IVP A;  1NJI O;  5F2R A;  2G8U A;  4DTJ A;  1EXQ A;  4B9V A;  2UU9 K;  1BI4 A;  3RR8 A;  3DM2 A;  5GAE P;  3ZSV A;  3LWM A;  4B3T K;  1RT5 A;  4N56 A;  1C1B A;  4CED A;  2HHH K;  4AHC A;  2WON A;  2QTD A;  4DTN A;  4DCH A;  3CI5 A;  4DV2 K;  4KH5 A;  2KZM A;  4DWI A;  1QQC A;  4Z4F A;  5AFU H;  3AGK A;  1SKR A;  2QW9 A;  3VQ6 A;  4GV9 A;  1LAW A;  4HUG A;  1WAF A;  3IRX A;  3KVG A;  4A5A A;  4NCG A;  4FCY A;  3ZT2 A;  4H0Y B;  3LDS A;  2CH5 A;  2IVO A;  5AFU A;  2W42 A;  3KTQ A;  3AO3 A;  2HBL A;  3ZT0 A;  1BHL A;  3QEI A;  2ASM A;  4CI6 A;  1MWK A;  3O1W A;  4LFA K;  1WOQ A;  2O8D B;  3ZET B;  4DSJ A;  1J5E K;  3CCU N;  1X1P A;  3QEV A;  3D2E B;  4DTX A;  1LW2 A;  4KBO A;  5M1N A;  1NGG A;  4CIF A;  4X62 K;  4FJ5 A;  1SQK A;  1BO5 O;  4HVJ A;  3J7Y P;  2QWL A;  4RW4 A;  4I9Q A;  5J2Q A;  4PY5 A;  2NNW A;  4U7B A;  5LJV A;  2CGL A;  2NRX A;  4C8L A;  4GMJ B;  3CJB A;  3MN7 A;  4N5S A;  3PO4 A;  3OHR A;  3OYD A;  3T1H K;  3A5L C;  5JLH A;  4CCH A;  1HYS A;  3VMF B;  1B9D A;  1BU6 O;  3UB5 A;  3AA5 X;  3T1A A;  2HBM A;  4CJE A;  1S9G A;  4JI0 K;  4OGE A;  4DTR A;  4FLU A;  4EAH D;  3V9X A;  2YHB A;  1KLM A;  1C0G A;  4N47 A;  4BWM A;  4HTU A;  1CLQ A;  1C0F A;  1HPM A;  2ITG A;  3OBY A;  3ZYY X;  3HSC A;  1NKB A;  2H3G X;  3OY9 A;  5JLF A;  3SZ2 A;  3SPZ A;  4NO7 A;  1U04 A;  1VQ9 N;  3F9M A;  3O08 A;  3NH0 A;  1NJY A;  3OS2 A;  1JLA A;  3MN9 A;  2FF3 B;  3AGR A;  2XY5 A;  3TAB A;  1XC9 A;  1BIU A;  2YKN A;  4DV6 K;  3KK1 A;  3LP1 A;  2E2Q A;  4L3Q A;  4BRP A;  4FSV A;  3MWP A;  3LDL A;  3O80 A;  5AQI A;  1IG9 A;  5LY3 A;  4Z4G A;  1Z6R A;  2O8C B;  2FSK A;  3MEE A;  1VQN N;  1HYZ A;  2NRR A;  4BR9 A;  1N36 K;  3AO5 A;  2PY5 A;  1NJW A;  2OPS A;  1ZBH A;  4CHQ A;  3BP8 A;  4DTP A;  3RMD A;  4A2B A;  4M3U A;  1VSF A;  3E1Y A;  2WBN A;  2VWB A;  3HRG A;  2HHV A;  1J54 A;  4JKE A;  3TPQ A;  3G6E N;  1HKG A;  3E01 A;  1LWE A;  5AQZ A;  3AVI A;  4KI6 A;  1RCH A;  4JI6 K;  4PL7 A;  1Q7Y O;  3P83 D;  2O8B A;  4YOY A;  4DS5 A;  4J2E A;  1JCG A;  5CE3 A;  3CG7 A;  2GX9 A;  3CCM N;  4EZ6 A;  3ZT3 A;  3QER A;  4MQ3 A;  2V51 B;  4J2B A;  1WSI A;  4EHT A;  4IOC L;  4E89 A;  4JAX A;  5M1K A;  4PA1 A;  3W0L A;  2G8W A;  1ZBL A;  5AJ3 K;  4IJN A;  3MCP A;  1VQ8 N;  4DFJ A;  1G15 A;  5AQH A;  4YOV A;  1Z05 A;  4IO9 L;  3QFP A;  1VSE A;  3AVL A;  3DJC A;  2W6K A;  4A57 A;  2GEL A;  1ZYQ A;  2VGM A;  4CBU A;  4KHW A;  1IKX A;  1WLJ A;  1DEJ A;  3KK7 A;  4RTF D;  1XMQ K;  1GLF O;  1RDU A;  4NLC A;  3ID6 A;  2P9N A;  4CJV A;  4XEI A;  2YCH A;  5KQD A;  3CCL N;  3VOV A;  1KVA A;  4EIA A;  4FLT A;  1YTU A;  4BRM A;  3L2V A;  4YOR A;  3M6G A;  4FLW A;  3GL1 A;  3KD1 E;  1NGF A;  1U47 A;  3DLH A;  1QE1 A;  3ZET A;  2VG5 A;  1A5W A;  4PQU A;  1U2V B;  1YI2 N;  1NBW A;  3EZW A;  2IOC A;  4CJL A;  4OKJ A;  1RGI A;  2D5R A;  3FFK B;  1T3V A;  1DGK N;  5B8H A;  2D0C A;  4B9S A;  4H0P A;  2EHG A;  5CHI A;  1RIL A;  1YAG A;  4I2P A;  3OBW A;  1RBT A;  3TI0 A;  5LMN K;  1JCE A;  4IFE A;  1NU0 A;  1W7A A;  3THW B;  3MDQ A;  4CGF A;  1ESV A;  3MAQ A;  4FWR A;  3TAN A;  1HRH A;  1IKW A;  4LF9 K;  4ZTJ A;  1RDD A;  1W9H A;  4JI1 K;  1HR0 K;  4C8O A;  2ASP A;  2P9K A;  4B9Q A;  5GAG P;  3JAM O;  4ILJ A;  2EWS A;  4F2S A;  1VQ6 N;  4O0I A;  1KLN A;  1KVC A;  4IBN A;  1XUP O;  3VQD A;  2HHW A;  4BQZ A;  3CCE N;  3V1R A;  4RW7 A;  5J2P A;  4CHO A;  2BE2 A;  2GUP A;  3L2W A;  3QIP A;  4CEZ A;  3OS0 A;  3PUF A;  3RRH A;  3VPZ A;  4BR7 A;  2HB5 A;  2PFU A;  2B4J A;  4MDB A;  4H5R A;  3UIQ A;  4IOA L;  2RN2 A;  5KPR A;  2V7Z A;  1RBS A;  4QS7 A;  5MLC Q;  3EL2 A;  1QSY A;  5HRN A;  3NHG A;  3K58 A;  2GWJ A;  4JD2 A;  2Z1J A;  4J2D A;  1WB9 A;  1KRP A;  4HUE A;  4B9U A;  4B1U B;  5ADX A;  1GLE G;  4DQS A;  4M45 A;  1NGC A;  1S1X A;  5M1Q A;  4H4O A;  3LDQ A;  1IBM K;  1B9F A;  4JKC A;  3S3M A;  3NVK A;  3MK6 A;  4CD3 A;  4CJS A;  1NK6 A;  1DT9 A;  3G10 A;  3RMC A;  3AVJ A;  5HLF A;  3TSU A;  4YHH K;  4JYA K;  4PL8 A;  3EN9 A;  2UUB K;  3LAK A;  5GIO A;  2A6A A;  1JLC A;  1IKV A;  2QI2 A;  4BWJ A;  3C65 A;  3C6H A;  3H3N O;  4KFB A;  4DTS A;  3S41 A;  5M1F A;  1RT1 A;  3KLH A;  3MX2 A;  4B3O A;  4CJ7 A;  2OPQ A;  3JSM A;  3G4S N;  3LP3 A;  5BRE A;  1FKO A;  2KFN A;  1T44 A;  5KPZ A;  4LD0 A;  2YHX A;  1HYV A;  3THV A;  1X3M A;  2ATQ A;  1XMO K;  2IS3 A;  3QFU A;  3Q7B A;  3ISN C;  2YI1 A;  3N4P A;  3AVC A;  4FOI A;  1S1T A;  2ZQB A;  5SWM A;  2J4R A;  5I42 A;  1L3U A;  1MWM A;  1RDA A;  5KRT A;  4M3W A;  3CQ8 A;  3ALY A;  3G0Z A;  3SQ2 A;  4AHU A;  4R79 A;  5EVZ A;  1LW0 A;  4B1X B;  4BR0 A;  2ASO A;  3SMP A;  5KTQ A;  3HOT A;  3A2F A;  3AVH A;  3MXI A;  3AO4 A;  4I7F A;  2QM1 A;  1BDG A;  4JI8 K;  1TAQ A;  3PLA A;  3NVM A;  4CZE A;  4LF7 K;  3SYZ A;  3D2F B;  3KLG A;  3CPW M;  4CE9 A;  1TV6 A;  2KW4 A;  4CZH A;  3W3D A;  4BRA A;  1SZ2 A;  3C6U A;  3BZC A;  1NGE A;  5AQP A;  1E3M A;  5AQT A;  4KO0 A;  3ZLJ A;  2WFB A;  1E4F T;  1J9A A;  1NKC A;  4CF9 A;  1YVN A;  4M7X A;  3UKR B;  4ELT A;  1LAV A;  4GKK K;  1VRT A;  4CZL A;  1HQU A;  4JKD A;  2OTJ N;  3WXL A;  3H1V X;  3LAN A;  3IUC A;  4GY2 B;  4DR1 K;  1KXP A;  4CEO A;  1S3X A;  4CIG A;  1X9J A;  4BR2 A;  3GOI A;  4PHT X;  2YNF A;  3LPT A;  3VF2 A;  1BOT O;  3OJU A;  2X74 A;  5C15 A;  4PKG A;  1NLV A;  2P9N B;  3R1X A;  4CGJ A;  3SJJ A;  4Z4C A;  3IKM A;  4W5R A;  4A62 A;  1QHA A;  3ATU A;  3VTH A;  2FBY A;  4FL9 A;  4H8K A;  2PZS A;  1RDB A;  3H6E A;  1A5X A;  4F4K A;  4YOX A;  4BRI A;  2Z1G A;  3HL8 A;  2FBV A;  3OYB A;  1YF5 L;  3TWH A;  3WXK A;  3DOK A;  2OPP A;  2Q3S A;  1HKC A;  3O9R A;  4CF1 A;  3J81 O;  5CZ2 A;  1KQS M;  1D4X A;  3RSE B;  4BDY A;  2XHB A;  4JK9 A;  3K5M A;  1GLL O;  3QDK A;  5AZJ A;  1L3T A;  3CCJ N;  4JI3 K;  1VSD A;  1J5O A;  4FZX C;  3E9O A;  4DQ8 A;  3DMJ A;  1KAX A;  3ZSR A;  3M8Q A;  3PV8 A;  4MLE A;  4DS4 A;  3HVR A;  4DF8 A;  1YUW A;  3CC4 N;  3DLK A;  2NZT A;  1W2B M;  1NWK A;  4XH4 A;  3ZX2 A;  3BF1 A;  2QWQ A;  4PKI A;  2JWK A;  3HZ6 A;  5AR0 A;  2E2O A;  3CCV N;  3VEX A;  3CQX A;  5FPE A;  2FF6 A;  1D5A A;  3K5O A;  4E0D A;  4KPY A;  5FLX O;  3SAH A;  2VWK A;  1VRU A;  4Z4E A;  2P9P B;  4KAZ A;  4DR3 K;  3CJ9 A;  2HMP A;  3KZB A;  3B8A X;  4DV1 K;  1GLD G;  3SCX A;  1C0U A;  3MXJ A;  1EX4 A;  1GOB A;  3J80 O;  1KFS A;  1JL2 A;  2OZM A;  3BZK A;  1KAZ A;  4GVM A;  5T7B A;  5HRP A;  3U6F A;  2UXB K;  3NF9 A;  1Q82 O;  4B3R K;  1UWB A;  4ISF A;  1NK7 A;  4B8C A;  4O8K A;  4FWO A;  4HHT A;  3H45 C;  4O44 A;  4ILG B;  4F8R A;  5M1O A;  4LH5 A;  5ELZ A;  3FLC O;  1E4G T;  5H1S Q;  4AHV A;  3WUH A;  2IVN A;  4GV3 A;  2W6L A;  1S9E A;  3KWI A;  4B8A B;  2A1S A;  1OH5 A;  3P1G A;  3U9Z A;  3T7Z A;  3KLI A;  3WNH A;  3O4W A;  5C24 A;  3V9U A;  2KKZ A;  5A2Q O;  2KZZ A;  1A5V A;  2QKB A;  3R6M A;  3UKU A;  3SQ1 A;  3CJ1 A;  3LM9 A;  2IIR A;  4CEA A;  3SK3 A;  4CIE A;  4FK4 A;  3RMB A;  1HLU A;  3CJC A;  1TUY A;  1S5J A;  1LV5 A;  2ZGY A;  1YT3 A;  3KWG A;  3LP0 A;  2WTU A;  4A2A A;  4CGI A;  2P5O A;  4IWV A;  1BIZ A;  3LDP A;  4H0O A;  4FJL A;  5C2D A;  1VQ7 N;  1JXB A;  4HCB A;  3WNF A;  1K8A O;  1X9S A;  2P1J A;  3TAE A;  1RT4 A;  4FWS A;  2V52 B;  1QQM A;  3VF4 A;  4BRO A;  1U45 A;  4K0K K;  4BDP A;  2E2N A;  3TAM A;  1VQP N;  3EY1 A;  2E6M A;  4I2Q A;  2GBZ A;  3TU5 A;  2Y1J A;  3FZK A;  4CEE A;  3F5T A;  3E9P A;  3O9S A;  4A61 A;  3DRR A;  1SAZ A;  4QAG A;  2QK9 A;  3MWT A;  4BGB A;  3QET A;  3FGU A;  4FWK A;  1C0T A;  3OYK A;  4ICL A;  1D9F A;  2D1K A;  5I9E B;  1U49 A;  3O3F A;  1X3N A;  3VET A;  4YDU A;  2NUB A;  1G99 A;  4WFB L;  4W5Q A;  1NK0 A;  4MDA A;  4NYF A;  4IEE A;  3HPO A;  2VGN A;  3NF7 A;  4BRE A;  3BGR A;  1P90 A;  3MN5 A;  4FWP A;  5F0X A;  4UY8 O;  3JYT A;  1HJR A;  3ZEU B;  4JI2 K;  3UKR A;  4JRP A;  3LAM A;  3CCS N;  1D8Y A;  1TAU A;  3O5B A;  1SKW A;  3OYF A;  2PAV A;  3OVN A;  3SV4 A;  1NMD A;  1NNE A;  4M3Y A;  4DSL A;  3RVC A;  4B1V A;  5KGW A;  3O9U A;  3OYA A;  4AH9 A;  3ZSW A;  4AHT A;  4FJI A;  1EKE A;  3PX6 A;  3CER A;  4KTZ A;  3VN5 A;  2VG7 A;  2O8E A;  4H5T A;  2E6L A;  3P4I A;  3TR8 A;  1GLB G;  3ZEU A;  5BR8 K;  2F8S A;  4RW6 A;  3AVB A;  2O4G A;  3NCI A;  1JLF A;  5AQN A;  3V9S A;  3WXM B;  2ZJP L;  3M3Z A;  1JXE A;  4BC2 A;  1ILY A;  1VSM A;  2P9S B;  1KVB A;  4CJP A;  5BRH A;  3THX A;  4FPA A;  4FW1 A;  3OYE A;  3OYM A;  4E7H A;  4DKW A;  4KTQ A;  4BVO A;  1JCF A;  4EHU A;  4U67 L;  1EWQ A;  1KTQ A;  4FVU A;  3U9D A;  2NLX A;  4LF6 K;  4NXN K;  2B6A A;  3LAL A;  4IO8 A;  2Y1I A;  3D6R A;  5LMU K;  1IH7 A;  3PX4 A;  4JLH A;  3IS9 A;  4CJF A;  2KLA A;  2G8F A;  1BIS A;  4DLG A;  2E1Z A;  2E88 A;  3L4Q A;  1Q9Y A;  1DTT A;  4JHD A;  4A59 A;  4DU3 A;  4FYD A;  4JNE A;  2HHU A;  1QQN A;  3OS1 A;  1QVF M;  2JLE A;  5KQ8 A;  4I6M A;  4CHZ A;  3VGM A;  3K5L A;  4WCE L;  4FJX A;  3RWU A;  4CJQ A;  3FZH A;  3RSE A;  3O3H A;  3DLB A;  4FLX A;  1M1K O;  1Z26 A;  2NRZ A;  5GIP A;  2ZF5 O;  3C94 A;  4OPK A;  3E66 A;  5JS1 A;  3HO1 A;  2UYT A;  3BF3 A;  3P39 A;  3HST B;  4EZ9 A;  4CF8 A;  5JVG L;  2YHW A;  4DTU A;  2JGU A;  5AQK A;  2Q31 A;  4CVN E;  4LSN A;  4FK0 A;  2P5G A;  2ZJQ L;  4B1Y B;  1NK9 A;  5DMR A;  3TAR A;  5EU7 A;  4JN4 A;  4KHU A;  5AZI B;  3ASM A;  3H3O B;  4RCH A;  4CJT A;  3PY8 A;  4FM0 A;  4DV5 K;  4BG8 A;  4BRH A;  4XIU A;  1N6Q A;  2F4V K;  3QBX A;  1RT7 A;  4AQY K;  1NM1 A;  2YNI A;  3VGL A;  3U3Y A;  4BRC A;  4DMN A;  3D0P A;  4FLY A;  2HF3 A;  1QSS A;  3WQU A;  4CD1 A;  1BCM A;  3GG4 A;  3MMV A;  1WBB A;  4KKO A;  4CER A;  2E8A A;  3DWL A;  1CZB A;  4YOU A;  4FJK A;  1SV5 A;  1TL1 A;  1XQS C;  3LDO A;  3L2Q A;  3THX B;  1XHZ A;  4CZM A;  3NF8 A;  1XNR K;  1YJ9 N;  2NRT A;  1V4S A;  1J53 A;  3DLL L;  4JKH A;  5BPM A;  5AQV A;  4C8N A;  4QCL A;  1KCF A;  2HF4 A;  4JKF A;  3AO1 A;  1KFD A;  4FWM A;  3TTF A;  4CGG A;  4B9L A;  3G71 N;  2A41 A;  2YHA A;  2HVI A;  3OJS A;  3R8E A;  4M63 C;  3J7A P;  2XO7 A;  2F8T A;  2KFZ A;  2FBT A;  4CEF A;  4EFH A;  4LF4 K;  1BL3 A;  2YNH A;  4FJJ A;  3AV9 A;  3CIP A;  1RDC A;  4OO1 J;  2HW3 A;  1CXQ A;  1HMV A;  3AAP A;  4RW9 A;  4C1N I;  3NH2 A;  3HM9 A;  1T8E A;  1N5Y A;  3R9P A;  3S9H A;  1NGJ A;  4E7L A;  2G8H A;  4OLA A;  5IT9 O;  1S1U A;  4OVL A;  2G8V A;  4BRQ A;  1QHT A;  1BQN A;  3PSF A;  5C12 A;  3IDH A;  3SJH A;  4B3M K;  1VSI A;  2A42 A;  4MO5 A;  4XH1 A;  3FZL A;  1X9W A;  4O0J A;  3O1B A;  4DSK A;  2Q1N A;  5C2F A;  3SAG A;  1TUU A;  4CGD A;  2O8E B;  1MU2 A;  2GUI A;  3KJV A;  3QEP A;  2IDO A;  4BVP A;  2RPI A;  3VEZ A;  4DV3 K;  3A5N C;  3RTV A;  4J2A A;  2ZE2 A;  3CQY A;  1BCO A;  3BY5 A;  4JK7 A;  4JHD B;  1RTJ A;  4B3S K;  3M8P A;  4M3R A;  1GLC G;  1RBR A;  3H08 A;  3ZX3 A;  2DFH A;  3WEE B;  3EZ5 A;  3SBG A;  1ZXO A;  3V1Q A;  3TTC A;  4H5N A;  1WSF A;  1CZA N;  3L0Q A;  3JS6 A;  3SPY A;  1N34 K;  4DLE A;  1N32 K;  4M3T A;  2FSN A;  1FW6 A;  1BI4 B;  5HOO A;  3EO3 A;  1MA9 B;  4CZF A;  3O4Q A;  3VQ5 A;  3MXM A;  4CES A;  4DR6 K;  4DV0 K;  4GV6 A;  1VQO N;  3SBT A;  3VEV A;  1WUA A;  3A5O C;  1RT6 A;  2OAN A;  3HI0 A;  4F9O A;  3C0B A;  1VQL N;  5CY4 A;  5J1E A;  1M90 O;  1W97 L;  3VQ9 A;  1LCU A;  5JVH L;  4CFC A;  2BAN A;  2A40 A;  3DLR A;  1RT3 A;  2Q36 A;  4FZZ A;  2E2P A;  4PUO A;  2O4I A;  1LOT B;  4FW2 A;  1ASW A;  5BRD A;  4IKF A;  2DFE A;  3KKS A;  4ISE A;  3TAQ A;  1JJ2 M;  3NH1 A;  4LY7 A;  2QA4 N;  4WQ4 A;  2HHT A;  2X6S A;  2CGK A;  4BDZ A;  3M8S A;  3TAG A;  2X6N A;  1NK8 A;  3ENB A;  5AQY A;  3FZM A;  3A5M C;  1KD1 O;  4BRL A;  4DTO A;  4FWQ A;  1HQE A;  1HX1 A;  3DXK A;  3O4N A;  3VQB A;  4DQR A;  4OKK A;  2UUC K;  1SL0 A;  4B1W B;  4IG3 A;  1HNV A;  2YJE A;  1S1W A;  4C8K A;  4ISG A;  3QB0 A;  3P38 A;  1UA1 A;  4KHN A;  2VQF K;  1XI1 A;  1EP4 A;  2YNG A;  3LZI A;  4B9T A;  4DQP A;  3ATV A;  3G25 A;  2Q0R A;  5M1P A;  2CH6 A;  4DU4 A;  4DHY A;  1QZ6 A;  2QXF A;  3C6A A;  4AHS A;  3VQP A;  4OPA A;  2OPR A;  1HUX A;  4MFB A;  3CMA N;  1K8K B;  4I6M B;  1Y97 A;  1RBV A;  2ITM A;  4ELU A;  4RW8 A;  1SL1 A;  2ZWH A;  3AVK A;  3WQT A;  4DF4 A;  1NK5 A;  2P9L B;  4FWL A;  4A5B A;  4Z4H A;  1R0A A;  4BE2 A;  4G1Q A;  1NJZ A;  2P51 A;  3VEW A;  3OW2 M;  4DSF A;  4E7J A;  2Z1H A;  4CJ4 A;  3HK2 A;  3VF6 A;  4K41 A;  4BC5 A;  3EEQ A;  3KHY A;  5F1X A;  2HVH A;  1BWF O;  5CYM A;  1HNZ K;  4E1N A;  3AAR A;  1GLA G;  3DRP A;  4PKH A;  5BPN A;  1NGI A;  4JS5 A;  3EE9 A;  1EWR A;  3OA9 A;  3OYC A;  2ETJ A;  1TYQ A;  1IKY A;  4QS9 A;  1FKP A;  4BRG A;  1L3S A;  3L4I A;  1RT2 A;  3VEO A;  3I8D A;  2QXL A;  3F73 A;  1OVY A;  2F7T A;  2OA8 A;  1BUP A;  1S72 N;  1YVU A;  4K42 A;  4JK8 A;  4IDH A;  4FK2 A;  4CBX A;  4BRD A;  2HHQ A;  5AQO A;  4HCC A;  4N76 A;  3VEY A;  4BQL A;  3F2K A;  4TSX A;  3O9Q A;  4JKB A;  4Z4I A;  2VYP A;  4C23 A;  1I94 K;  1W0H A;  3KD5 E;  1QSL A;  3DLE A;  1T05 A;  4K8X A;  3MN6 A;  3O9T A;  3GE1 A;  3HYF A;  2W41 A;  4LSL A;  4O5F A;  2QWR A;  4GNI A;  4Z94 A;  2V7Y A;  3VQ8 A;  1P8Z A;  3O8M A;  1VAZ A;  4LFB K;  1EO1 A;  4EP4 A;  3ZT4 A;  5DM6 L;  1C1A A;  4DR4 K;  3J7Z O;  3KK2 A;  3QIC A;  2P9S A;  3I0S A;  1NMN A;  5FPN A;  2KQ2 A;  1NG9 A;  2UXD K;  1J6Z A;  3IG1 A;  3KLF A;  4JI7 K;  2BGG A;  3AVA A;  2O8D A;  1RBU A;  4B9N A;  3LPU A;  3LZJ A;  3U3G A;  4CHY A;  3AA2 A;  2P9P A;  2Q97 A;  3CCQ N;  1MDU B;  1UA0 A;  2HOE A;  2VG6 A;  3PX0 A;  1WSJ A;  3RRG A;  2KTQ A;  5LL6 Z;  3OYN A;  3HXM A;  1FXX A;  3CXC M;  2AA4 A;  4KHQ A;  2FC0 A;  3CFR A;  3BUZ B;  2E20 A;  3K9K A;  1CZ9 A;  3QEW A;  3OYG A;  2QKK A;  2DPN A;  2ZGZ A;  4M41 A;  3WEE A;  2QEX N;  3ZSQ A;  4JKG B;  4W5O A;  2XY7 A;  1O13 A;  3SUP A;  1VK0 A;  2I7P A;  4E3S A;  4Q5V A;  1K6Y A;  4CZI A;  4FZY A;  1VSJ A;  4WFA L;  3NFA A;  3S3N A;  1ITG A;  3QES A;  1T03 A;  4H0X B;  1KC8 O;  2I7N A;  5JS2 A;  1OKJ A;  3HJF A;  3AAQ A;  3LP2 A;  3WT0 A;  4JRQ A;  3H1Q A;  1RFQ A;  3L2R A;  3THY A;  1WN7 A;  4KB1 A;  3JXU A;  1I39 A;  4DSE A;  2UUA K;  4IG0 A;  3OYL A;  1KAY A;  1QZ5 A;  1TVR A;  3IAY A;  3K59 A;  4B1Z A;  2P9I B;  4DSI A;  3CD6 N;  4KH4 A;  4WQ5 C;  4QS8 A;  3KKR A;  3WNG A;  3TTD A;  4QOZ B;  1ZBI A;  4NLB A;  4H03 B;  1RNH A;  3NMU A;  1LWF A;  4BRN A;  1ASU A;  4H0T B;  1B92 A;  2O8C A;  3GDQ A;  1VSH A;  3BDP A;  3SUN A;  5KRS A;  1RTD A;  4E7K A;  1Q86 O;  2HBJ A;  5EOY A;  1QVG M;  3ULE B;  4RWT A;  4HUF A;  4JD2 B;  1HNX K;  5TKW A;  4KHY A;  4FVM A;  4CFB A;  3T19 A;  2I5J A;  5AQF A;  4N41 A;  3T69 A;  1D9D A;  1BGX T;  4X64 K;  4ID5 A;  1TL3 A;  3DXK B;  2D0A A;  3DYA A;  5KI6 A;  3CJ7 A;  4Z0U A;  1ASV A;  3D7E O;  4M42 A;  3NGZ A;  3I55 N;  1TKT A;  2PYL A;  1RDW X;  4O8U A;  4AM7 A;  4FXD A;  4ID1 A;  4BC3 A;  3VES A;  3THW A;  3CC2 N;  4BC4 A;  5J2N A;  1NJX A;  3A8Y A;  3VER A;  3OTO K;  3QIN A;  5AZI A;  3L2U A;  1REV A;  4KHS A;  2RHK A;  3DXM B;  4GVE A;  1HPZ A;  1TGO A;  4AM6 A;  1N8R O;  3TSQ A;  3CF5 L;  4NCB A;  4IFV A;  2HNZ A;  3PO5 A;  4BR5 A;  1Y64 A;  4JI5 K;  1ZBF A;  3CET A;  4X65 K;  3VQQ A;  4CJR A;  2A5X A;  4IDK A;  4JV5 K;  1NGD A;  3J8A A;  4BR4 A;  4OPJ A;  3DRS A;  4HWI A;  4IXC A;  4YFU A;  3OYJ A;  4BE1 A;  3L3V A;  3CCR N;  1SS6 A;  3FR0 A;  3DOL A;  2DFF A;  3RR7 A;  1L5U A;  4CZK A;  3VQ4 A;  5GIN A;  2Q0U A;  3UKU B;  2G8I A;  1Q18 A;  4FJN A;  5C25 A;  2FBX A;  3VQC A;  1NGH A;  2XRI A;  2BDP A;  3CJA A;  4M3Z A;  4FJ8 A;  1TYQ B;  4CZJ A;  2LSN A;  4G9Z A;  3HOS A;  3AVG A;  2DTU A;  1IJJ A;  2PYJ A;  4CEC A;  4DV4 K;  3V81 A;  4F2R A;  2HND A;  3HVT A;  1Q81 O;  3VQ7 A;  3QLH A;  1SKS A;  1NGA A;  3ID8 A;  1XNQ K;  2O8F B;  1SL2 A;  1BG3 A;  4DR5 K;  1WAJ A;  3P5J A;  1IBL K;  2QWO A;  3AVM A;  3N4Q A;  4CFD A;  5AQS A;  2YKM A;  3NGI A;  3AY9 A;  2E1Y A;  4JKG A;  4K8Z A;  4F3T A;  3SAF A;  4CK2 A;  4LF8 K;  3QNN A;  4M7Y A;  1F21 A;  2P9U A;  1TK8 A;  4YNQ A;  3TSP A;  4FJG A;  5KPT A;  2P9L A;  3EYZ A;  1OVQ A;  2O8F A;  3KLE A;  2WC9 A;  5FRM A;  4MLH A;  5C10 A;  2YHY A;  5FPD A;  1KSP A;  3CME N;  3THY B;  3HP6 A;  3D45 A;  2D0B A;  5DK5 A;  4CBW A;  1Z25 A;  4DB3 A;  4CFA A;  1TK0 A;  2B5J A;  3ZSY A;  4LFC K;  2F9W A;  3C95 A;  3MX5 A;  2F96 A;  5E41 A;  4JEP A;  3IMX A;  2P9I A;  1S6P A;  3V6D A;  5AQQ A;  1VQM N;  1WBD A;  2P9U B;  2OTL N;  2BTF A;  4H5W A;  4W5T A;  4NXM K;  1U6Z A;  4H4M A;  4GKJ K;  1S6Q A;  4WQ4 C;  2P9K B;  1JLG A;  1JLE A;  4Y0W A;  1XHX A;  3T3F A;  1K9M O;  1WNS A;  3HT3 A;  4KI4 A;  3ITH A;  3KIO A;  4OKE A;  4AHR A;  5DM7 L;  3PSI A;  5BRF A;  2GV9 A;  1ATN A;  3M1F A;  3IFR A;  4V19 S;  4CK3 A;  5CR4 A;  1YIJ N;  4OX9 K;  5HL7 L;  3DI6 A;  3SMS A;  4DFK A;  1Q9X A;  4CZG A;  4BG9 A;  3K5N A;  1EET A;  3U4L A;  3A0I X;  2YJF A;  5HBM A;  2R7Y A;  3I8B A;  2HMI A;  3ENO A;  4L8R B;  3HPG A;  5EXW A;  1K73 O;  3FZF A;  3DAW A;  5HRR A;  2UXC K;  1DKG D;  3ZT1 A;  5GAD P;  4WFN L;  3SQ0 A;  2Q2R A;  4WE1 A;  4KHP K;  3H46 O;  4RG8 A;  5AQM A;  3HP9 A;  2GWK A;  3L6Q A;  1JLQ A;  4CHN A;  1I3A A;  3LWL A;  2VWJ A;  3SNN A;  1HNI A;  1YHQ N;  2D0O A;  2GEM A;  1T7P A;  3FE1 A;  3OYI A;  4CJ3 A;  1U4B A;  3EKS A;  4J8F A;  1NOY A;  5BN9 A;  2RE2 A;  1N33 K;  3VQA A;  2QWM A;  4BAC A;  1C0M A;  1BA0 A;  4JS4 A;  3MCA B;  1C6V A;  1WSE A;  3I0R A;  1NGB A;  4CF2 A;  1LWC A;  4FJ9 A;  3B6P A;  1OH6 A;  5AQW A;  4FPB A;  2ZJR L;  3NF6 A;  3CC7 N;  4H5V A;  1HKB A;  5E84 A;  1NKE A;  2AJQ A;  1GOC A;  4DR2 K;  1IBK K;  4KV8 A;  5ADX H;  1K8K A;  4YOW A;  3SQ4 A;  4IOX A;  5EY4 A;  4BRK A;  2BUP A;  2RKI A;  3AA3 A;  1BQM A;  2W40 A;  1DTQ A;  3ZSZ A;  5HRO A;  2QWN A;  2HST A;  1X9M A;  4OPH A;  3K57 A;  4DTM A;  3KK3 A;  3HTV A;  4FO0 A;  1YJW N;  3U8X A;  3QEX A;  2CGJ A;  3LM2 A;  4YDU C;  3C6T A;  5GAH P;  4DQI A;  4CF0 A;  3FFI A;  2ZD1 A;  4OJR A;  4K25 A;  4ZHR A;  4FM1 A;  2RF2 A;  3CFP A;  4R5P A;  5IWA K;  3MEC A;  3K9J A;  3PIO L;  4C1N K;  4FM2 A;  4BY9 C;  3CM6 A;  5I3U A;  4CJK A;  3T1Y K;  1ATR A;  1JLB A;  3AO2 A;  4OGC A;  3K2P A;  4EP5 A;  5AQL A;  5C42 A;  3MED A;  1QS4 A;  5FRO A;  3ZSX A;  4CJU A;  4OLB A;  2NRW A;  3D2E A;  4CEQ A;  2NRH A;  5TKY A;  3SLC A;  5HRS A;  4CGH A;  3OYH A;  5FDL A;  1UOC A;  4GW6 A;  3TAP A;  3S3O A;  3AVN A;  2E5L K;  3QNO A;  2WOM A;  4FLV A;  1ZC6 A;  1JL1 A;  3HM8 A;  4IEI A;  1S1V A;  3PIP L;  1QTM A;  4NCA A;  3UE5 A;  2WUS A;  4YOT A;  3D2F A;  4FWN A;  2KHO A;  5AQJ A;  5D3G A;  3AVF A;  1FJG K;  2A3Z A;  1U2V A;  1VSL A;  1SUQ A;  3TAF A;  3O6W A;  2A1R A;  1VSK A;  3I56 N;  1V4T A;  1ATS A;  5BN8 A;  2E4L A;  1IO2 A;  3WNE A;  4KH6 A;  5BPL A;  4F3O A;  1YJN N;  1DLO A;  1GOA A;  3CM5 A;  3M8R A;  3WXJ A;  3DLG A;  4ILH A;  1TKX A;  3QO9 A;  4M3X A;  4PWD A;  3P31 A;  3DXM A;  2VQE K;  5C0Y A;  2IC3 A;  2XY8 A;  1VHX A;  2G8K A;  3HBT A;  4IFY A;  4FLZ A;  1XC3 A;  3O3G A;  3CFO A;  2X78 A;  4NB4 A;  4CEB A;  2OCE A;  3SUQ A;  4JKA A;  3QML A;  1OH8 A;  3ZSO A;  1TKZ A;  2ZM6 K;  4W5N A;  1C1C A;  1HJO A;  5BR9 A;  3VA0 A;  3RMA A;  3C7N A;  2XY6 A;  3QBW A;  5EX5 A;  2IGI A;  4FJH A;  4DV7 K;  5FRN A;  2AP1 A;  1YXQ A;  3CHW A;  4NYN A;  3ZCM A;  3CYM A;  3VA3 A;  3Q7C A;  4CHP A;  1R59 O;  3R3L A;  4ZTF A;  1ZBU A;  3NGY A;  4DFM A;  5E26 A;  3V1O A;  2OYQ A;  4O5B A;  4CW7 B;  2IAJ A;  3MEG A;  3K0S A;  4MO4 A;  2D0P A;  5LJW A;  2VCP A;  4IZ9 A;  4Y1C A;  3LDN A;  5JMV A;  4CK1 A;  2YX6 A;  2NRV A;  5CZ1 A;  1TK5 A;  4O4G A;  1O1W A;  2DY4 A;  4AIL C;  2O8B B;  2D4W A;  2OZS A;  4CJ5 A;  1QQO A;  3ZX0 A;  4B9M A;  3AA4 A;  4KB0 A;  4C8M A;  4WYB A;  4LC9 B;  2GTD A;  5CYQ A;  1VQK N;  1IG8 A;  2Z1I A;  2FXU A;  3SI6 A;  5HP1 A;  4E7I A;  1WSH A;  1YTA A;  4B08 A;  1XWL A;  1UAX A;  3QIO A;  4DFP A;  1T6D A;  3NE6 A;  2F9T A;  2FLO A;  4DUZ K;  3B6O A;  3VTI A;  1VQ5 N;  4ELV A;  4E19 A;  4BE0 A;  3V9Z A;  1L3V A;  3ULE A;  2FSJ A;  4DQQ A;  1RTH A;  3BEX A;  3SUO A;  4FJM A;  3I33 A; 
#chains in the Genus database with same CATH homology
 1N32 K;  1XMO K;  5LL6 Z;  4LF9 K;  4JI1 K;  1HR0 K;  3OTO K;  3JAM O;  4JI3 K;  4DR6 K;  2VQE K;  4JI6 K;  4LFA K;  4DV0 K;  4DR2 K;  1J5E K;  1IBK K;  4LFC K;  1XNR K;  4LF6 K;  4NXN K;  4X62 K;  4JI5 K;  5LMU K;  4X65 K;  1HNW K;  1HNZ K;  4NXM K;  4JI8 K;  4K0K K;  3J7Y P;  4JV5 K;  4DUY K;  4GKJ K;  2ZM6 K;  4LF7 K;  5AJ3 K;  2UUA K;  4JI4 K;  4DV7 K;  3J7A P;  3T1H K;  5FLX O;  4DR7 K;  4LF4 K;  5IWA K;  4JI0 K;  4DR3 K;  4V19 S;  4DV1 K;  4X66 K;  4OX9 K;  4GKK K;  1XMQ K;  3T1Y K;  4CW7 B;  1IBM K;  5IT9 O;  3J80 O;  1I94 K;  2UXB K;  2UUC K;  4B3M K;  4YY3 K;  4DV4 K;  4B3R K;  4DR1 K;  4YHH K;  4JYA K;  4LF5 K;  4DV6 K;  1HNX K;  2UXC K;  4LFB K;  4JI2 K;  4CVN E;  2UUB K;  1XNQ K;  2VQF K;  2UU9 K;  4KHP K;  4DR5 K;  4DV3 K;  4DR4 K;  2E5L K;  1IBL K;  4B3T K;  4X64 K;  2HHH K;  4B3S K;  2UXD K;  4DUZ K;  1N36 K;  4JI7 K;  4DV2 K;  1N33 K;  1FJG K;  4DV5 K;  2F4V K;  5A2Q O;  5LMN K;  4LF8 K;  4AQY K;  3J81 O;  1N34 K;  5BR8 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...