3C6TA

Crystal structure of hiv reverse transcriptase in complex with inhibitor 14
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
559
structure length
559
Chain Sequence
NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The design and synthesis of diaryl ether second generation HIV-1 non-nucleoside reverse transcriptase inhibitors (NNRTIs) with enhanced potency versus key clinical mutations.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase
total genus 150
structure length 559
sequence length 559
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3c6tA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6tA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6tA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6tA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3c6tA05
1X9MA 1J5OB 4KHQA 4CGIA 5KFNA 3CM5A 3MXIA 4XIUA 5J2NA 1T05A 1NK9A 5T7BA 4N56A 1VSKA 5KFQA 4I9QA 2WRMA 1XHZA 1LW2B 1S48A 4CEBA 5DLFA 1K1SA 3ZCMA 3SUOA 3RAXA 3Q8RB 4RG8A 1EP4B 2PYJA 4B9TA 2WONB 3QETA 3Q8QB 4CHPA 4MIBA 4C8MA 3V9ZA 2D7SA 3BDPA 4ECWA 2KZZA 2W7OA 3H5SA 4H4OB 3OYAA 4KO0A 2RDJA 2AX0A 4B8CA 1NK4A 5C24A 2CJQA 4FJJA 3K59A 4CEEA 5KFIA 1JL1A 3G0ZA 1NK8A 4DFPA 1KLMB 1TKTB 2C2DA 4IH5A 1YTAA 1JXLA 2FBVA 4KPYA 1RDRA 1HYSA 1N48A 3QEXA 1JLBB 1F21A 4OLAA 3DLRA 4FJIA 3AA5X 4NYFA 2DY4A 3KLGA 3VQDA 3TVKA 3S9HA 4IKAA 4I2PB 4ZP7A 5KGXA 2OA8A 4NLDA 4DL5A 3VQ4A 3OYKA 1NHVA 4O0JA 1KRPA 3OYDA 1N5YB 5KFWA 2HVIA 5D3GA 3MECA 1R0AB 2IJFA 4CGDA 2W9CA 1RT5A 1VRTA 4BDZA 1WLJA 3DYAB 3NBPA 4UQGA 3M8PB 2XY8A 3O3FA 2W9BA 3PX6A 1KVCA 4WE1B 4TXSA 5F8GA 3RBEA 1RT7B 4N47A 4B08A 3CDEA 3DRSA 4FLXA 1D5AA 4ECRA 1S1VA 3O4QA 1U4BA 4OJRA 2XY6A 1HQEB 1TKXB 4RW9A 4O5BA 3TWHA 3CJ2A 4DF8A 4Z4FA 1RCHA 1RT3A 2ASLA 1LWCB 1S0OA 1WSEA 4IG3B 4E0DA 3CYMA 4CJEA 1U45A 1RDDA 4AHVA 3LP1B 1C0TB 4R5PA 4C8LA 1TK5A 3V81A 4BDPA 4C8KA 1QAIA 4ZVEA 3QLHB 1SV5A 3V1RA 3PX4A 3HK2A 4JS4A 3PJWA 3CFPA 2XO7A 4FW1A 4B3OB 4DQPA 4DFJA 4NCGB 4Z4IA 3BSNA 3PW2A 2C2RA 3DRPA 3KK2A 3OLAA 1RT2A 4ZMMA 4LD0A 3F9KA 1TKDA 2HMIB 2X6SA 4IG0A 3MR6A 5KFJA 2JGUA 1LWCA 5KFGA 5HLFB 1QTMA 1TKTA 5KFKA 3DLEB 4YQWA 4WFXA 1NK0A 3I5AA 4LQ9A 1HQEA 1TKXA 4OPKA 2HWHA 4M41A 2W42A 3QZ7A 4TSXA 4EYHB 1NK6A 2HB5A 4FJMA 3ITHA 4CGGA 5L9XA 2EC0A 3WNEA 2A1SA 1RTJB 4OKEA 4NLWA 4FLTA 4IR1A 1WSGA 2YKNA 3H08A 2UVRA 3VA3A 1B92A 1ZTTA 4ZP9A 3L2UA 4CCHA 3AA2A 3NFAA 1FK9B 1IM4A 4OLBA 1IKYB 4KI6A 3CJ4A 4FS1A 5KFHA 3K5MA 4KHSA 2GV9A 2R8JA 5FRMA 1EXQA 4IDKA 3KHLA 1LAVA 1JLCA 5KG2A 1LW0A 1KVBA 2DFFA 1RBSA 2OPSA 4ZP8A 4URGA 3L2QA 4CFBA 4K4SA 1JLBA 4EP4A 4CJRA 3IN5A 5J2PB 3QO9B 3ZSQA 4EBCA 2GUIA 2XY5A 4LH4A 4JS5A 3H4DA 1IKXB 1S97A 3AA3A 4Z4HA 1XR5A 3KHGA 1CZ9A 3Q8SB 3LP0A 3RB0A 4BACA 4AHUA 2KZMA 4O3NA 4RU9A 4LSLB 3IGVA 1HNIA 1MMLA 4ED1A 4W5NA 4I2QB 3G10A 3O3GA 1EETB 2Y1JA 5DGAA 3SPZA 4CJFA 2E9ZA 4CJWA 3KLHA 5HP1A 4Z4EA 3NF6A 3HXMA 4QWDA 3NAEA 3DRRB 4IKFA 3G6XA 1VSDA 1BISA 3MEDA 4QW9A 3QIOA 4RW7B 4MK8A 3MTKA 1KLMA 2ILYA 1KLNA 1C1CB 2BQ3A 3EY1A 1S9GA 3C6UA 3TAPA 2UUTA 1HJRA 5KFCA 1JLAB 2JEFA 5HRPA 4PWDB 4DFMA 3U3YA 4CJSA 3TAMA 4Y2AA 1S6QA 5EWFA 3HT3A 4LQ3A 1C0UB 3F73A 4N76A 3GV5B 3NBPB 4Z4CA 1NK5A 3OYBA 4RUAA 3K57A 1ZETA 4FBTA 1R0AA 3QLHA 2ALZA 1MU2A 4R8UB 1T7PA 5KGWA 4TYAA 2YHAA 3ULDA 3FSIA 4KTZA 4TN2A 2IM3A 3M8QB 4WYWA 3MEEA 2F96A 3HM9A 1RT3B 2HHQA 4NLYA 5F8MA 2V0NA 3S3NA 2GC8A 1LWEA 3FFIB 4B9SA 4YNQA 3HSTB 5E41A 5EUHA 4QWCA 1VSJA 4HKQA 3T1AA 3CJ0A 4O44A 3KLEA 2IOCA 3ZSYA 4RNMA 3QGGA 4CJTA 2R2SA 4H8KA 4J9RA 3EYZA 1SL0A 3M9OB 2HHXA 3AVBA 3M8PA 3AO5A 1XR7A 4DTNA 1RA7A 4TQRA 1QSSA 4GC6A 4DL6A 1SH0A 3PR5B 4OPJA 2AX1A 3SI6A 5KFEA 1BIZA 2IA6A 3ZSXA 3LPTA 2D0BA 2W9AA 5KI6A 4K4TA 5KRSA 3OS1A 3ZT2A 3RR7A 4J2EA 1LWFA 4FK2A 4KHUA 2VG6A 3AO2A 1BHLA 4DU3A 2P5GA 1CZBA 4BWMA 5J2NB 1T05B 5DQIA 2J6UA 4Z0UA 1U49A 1S5JA 2QV6A 3M9NB 4I2PA 1TAUA 4IOBA 1RILA 3NMAA 1BQNA 2KFNA 3HVRA 3H40A 1TL3B 4CIGA 3I5CA 3EZUA 3QO9A 4FJGA 3RRGA 5C25A 3PHEA 1L3SA 1RAJA 2OH2A 3KLFA 4Q8FA 3V9UA 4RUCA 4Q0BA 3V1QA 4TY8A 2E9TA 1A5WA 1JLFA 4TQSA 3SZ2A 3OS2A 4K4ZA 4ED2A 2XGPA 4IFVB 1JLFB 5CYQB 2ASJA 1T8EA 3CVKA 4J2BA 1BIUA 3HO1A 4QCLA 3K5NA 4IRDA 3SQ4A 3GIIA 3N6MA 4CJKA 1HPZB 4DQRA 1RTDA 1JLEB 2HNZA 3LP3A 2WOMA 3I0RA 2F8SA 1UA1A 3LAKA 3H5UA 1LW2A 4BE2A 3QGIA 4B9UA 3N6LA 3I0RB 3DMJA 1JLQA 5KFOA 3KLEB 5SWMA 1HNVB 3H5XA 1YT3A 2IS3A 2ASDA 1S49A 4H4OA 4RNHA 5KFZA 1NJWA 1ZBFA 3S3OA 4J2AA 1EETA 3NKYA 1FKPB 5KTQA 1MU2B 4E19A 2Z1GA 3E01B 4CF0A 4AHSA 4FJ5A 4CESA 1HQUB 3NAHA 4DG1A 1RA6A 4OKKA 3RB4A 3MFIA 3HJFA 3QESA 3AVKA 2D3UA 2CKWA 1GOBA 3VQ6A 3B6PA 1JLAA 1Q8IA 5EWEA 4CF1A 2IGIA 1JLQB 3HVTA 4CK2A 1VSEA 3AO4A 3SCXA 3DM2A 4F3TA 1J54A 1WAFA 1TVRB 1IH7A 1JXEA 4CHQA 4GVMA 1HRHA 1L3UA 4NLRA 4R8UA 3Q8PB 4FJNA 5T14A 3MECB 3PUFA 3IG1A 1NK7A 3EPIA 3QYYA 4GW6A 2AWZA 4I2QA 2WTFA 4DS5A 1HARA 1C1BB 1D9DA 3NE6A 2JLEA 3MXMA 1I3AA 4WZQA 1N6QB 3HP9A 3V6DB 3KHHA 4FLZA 2P5OA 4Q5VA 3H2LA 3TQ1A 3K2PA 1YVUA 1UAXA 5KT5A 2ITGA 3GV7B 1JLGA 3H98A 4HCBA 3NGZA 2IC3A 4TY9A 2BQUA 3DLHA 3DLGA 5KG3A 2WB4A 4PY5A 2GIRA 3AVLA 3PVXA 2BR0A 3MEGA 2AGQA 4ECYA 4MKAA 3PV8A 1SL1A 3KJVA 2C22A 4ELVA 4JV2A 1JX4A 2B6AB 3I8DA 1ZBHA 4KB1A 2QXFA 1GOAA 1RYSA 1KHWA 4IDKB 1T3NA 1VSMA 4KV8B 3K5LA 4F4XA 3E01A 3C95A 3PW5A 1J53A 4CF9A 1DTQA 1RBTA 1U48A 2D0AA 4FJ7A 3DDKA 3HPOA 3P5JA 4MK7A 3BSAA 4QAGA 3AVNA 4F4YA 4HTUA 4KTWA 3TAFA 1IKXA 4Q44A 2ZD1B 4LY7A 5JXSA 1S9GB 1VK0A 1RT6B 1Z26A 2IAJA 3D45A 3QIPA 2G8VA 4ZPBA 1CSJA 3NAIA 3BGRB 4E7LA 3EZ5A 1RTIA 5HRNA 1VRTB 4M3ZA 4E7HA 2OPRA 2FJVA 3LAMA 3PY8A 2BRLA 2HNDA 2ZKUA 3KIOA 5KG1A 4ICLB 5JS2A 4FM2A 5I42B 2HNDB 4TLRA 2BE2A 3HPGA 3EPGA 3OL7A 5DG7A 4HUFA 1N56A 2QKBA 4ZVGA 2O4GA 4ZVFA 3DLGB 3P83D 4M3TA 2FJXA 1WSFA 3NGDA 4CEDA 3KLGB 4RNOA 4XO0A 1RT1A 5KFSA 2V9WA 1Q9XA 3FQLA 1L3VA 3AO1A 3QERA 2OPQB 1G15A 4FLUA 5F8JA 4NCGA 1FKOB 1ASUA 3PW7A 3KD1E 3HL8A 3LP2A 3CJ3A 2HNZB 3VQ9A 4KHYA 3JYTA 3I0SA 4FZXC 4QPXA 4RZRA 3ALYA 4AHTA 4CK1A 3ISND 3KMSA 1S1XB 2O4IA 3TR8A 3CJ5A 2YNFB 1REVA 4W5RA 1BQNB 3THVA 1S6QB 2XC9A 3L3UA 4NYZA 1S4FA 1SKWA 2FBTA 2IMWP 3MAQA 5DLGA 4GC7A 2UUWA 3PW4A 2F8EX 1XHXA 1RDBA 1KTQA 1IO2A 2E6LA 4ECTA 3NF7A 2JC1A 1B9DA 4RW4B 4JUZA 1S0MA 5KFVA 1GX6A 5KFRA 1EX4A 1B9FA 4F4KA 2OZSA 4RW6B 3V6DA 1CXUA 5KRTA 3SUQA 2FLLA 1UA0A 1JXBA 1Q9YA 4O3OA 4J9LA 1GOCA 1C1BA 3AO3A 4FS2A 4C8OA 3OL8A 2G8KA 3TABA 4ED0A 1OS5A 3IAYA 3MFHA 1C0UA 4CGFA 4R5PB 4BDYA 4RW9B 4YP3A 2RPIA 3CDUA 1VSFA 4FCYA 2IAJB 3GQCA 1HMVB 3NH2A 5HBMB 2IC3B 1K1QA 2OYQA 3K5OA 3RMBA 5KFXA 2Z1HA 4ED7A 1IKVA 1TV6B 1RT6A 3SYZA 1RNHA 2B43A 3QNNA 3LZIA 1RTHA 2HHSA 4KO0B 2RKIB 4CF8A 1D0EA 4DS4A 4CE9A 3OYEA 2AU0A 1BCOA 1QHTA 1LW0B 3VQ8A 1D8YA 4ID1A 3RWUA 3RMDA 2JEGA 1QAJA 3SQ1A 4HUGA 1S9FA 5KT6A 4K50A 4CK3A 3BQ2A 2D0CA 4E1MA 4NLGA 1TL1B 3SQ2A 5DG8A 4FZZA 4KREA 4FBUA 3V81B 4KFBB 1RT4B 1HNVA 4CJ3A 3T5HA 4J2DA 1C1CA 1IKVB 2F8TA 1NHUA 3ZT0A 2XCPA 2DFEA 4ELTA 4ED8A 4DLGA 3ZSZA 3BGRA 4B8AB 1W25A 3NHGA 4O4GB 4OGEA 3TAMB 1D1UA 2D41A 2HWIA 3LPUA 3MXJA 4FZYA 4QWAA 4N41A 2BGGA 3DI6A 4NLVA 4CJ4A 1HYVA 4PA1A 1C0MA 2HMIA 2YNIA 4DL4A 4B9NA 3E51A 2Y1IA 3UDLA 4DTOA 3UIQA 2D3ZA 3OS0A 4WE1A 2X6NA 4EZ9A 4DL3A 2RF2B 1S10A 4W5QA 3SNNA 4PUOA 2XCAA 4MQ3A 5KT3A 1DTQB 4XPEA 3LDSA 2KTQA 4LSNA 1S1UB 1C2PA 4KB0A 1BQMA 4WXOA 5L1LA 2PZSA 4EYIB 2XHBA 1QSYA 3OYCA 3CFRA 1NOYA 5FROA 4FLWA 4X2BA 1TK8A 2HHVA 5JS1A 4CECA 3ZSOA 4DWIA 2AGPA 1IG9A 4M3RA 1TV6A 4RNFA 3DI6B 3NL0A 3ZT1A 3L2VA 5HRSA 2W9BB 1S1TB 4DF4A 5K14A 3O4NA 3OLBA 1BL3A 2KQ2A 3L8BA 2PYLA 1QUVA 4B9LA 4IG0B 1T03B 1ZBUA 1S1XA 3G6VA 3DOLA 1C1AA 4BE1A 2VWJA 4CFDA 4DMNA 3QEPA 1KCFA 2VG7A 4PUOB 3PO4A 3TAQA 2QKKA 3S3MA 1CXQA 3P1GA 3V6HA 2DFHA 4I7FA 5SZTA 2VG7B 3VQSA 2VA2A 1ZYQA 3KK1B 3TARA 3T5LA 3T19A 1JL2A 3KKSA 4RNNA 4M3XA 1KSPA 2XRIA 2ETJA 5C25B 3PJXA 2FJWA 1JLGB 2G8HA 3ZSWA 1SKSA 2E9RX 4DTPA 3HPHA 5KFMA 1TKZB 4ZPDA 2V4RA 4NLUA 1L5UA 2XWYA 3MR2A 1N6QA 2G8IA 3VQ5A 4ZHRB 5KT7A 5F8NA 3BR9A 1QS4A 3OJSA 2HHTA 4CGHA 3JYTB 4DTSA 2A1RA 4OVLA 4B9MA 4O0IA 5F9LA 4W5TA 3NH1A 4F4WA 2ILZA 1RYRA 4JLHA 3IRXA 1NJXA 4HHTA 2QE5A 3TAEA 2HNYA 3SFGA 3DM2B 3GYNA 4Y1CA 2R8IA 2DPIA 1KFSA 5C5JA 3FQKA 1T94A 4AHCA 3HVTB 3KJVB 3IG1B 4KBIA 3AVMA 4Y2CA 3SUPA 1S0NA 2RKIA 1HMVA 2FVPA 4KHMA 4DSLA 1TVRA 1SUQA 3NGIA 2Z1IA 1RT2B 2C2EA 4ZTJA 4E7IA 4ECZA 3PZPA 3LALA 2ATQA 4DFKA 3OY9A 4Z4GA 2RN2A 5HLFA 4YMEA 4DTMA 5C24B 3KNAA 1GX5A 3CWJA 1HQUA 3QINA 3SUNA 4JRQA 5EU7A 3ASMA 4B9VA 2HNYB 1XWLA 2BE2B 4CGJA 4DU1A 2RF2A 1X1PA 5KT2A 1ZBIA 2YKMB 5CZ1A 3KK3B 1U47A 1VRUA 1XC9A 3CIZA 5KG4A 2VWKA 5KFBA 4EO8A 2G8FA 1N4LA 1ASWA 4HCCA 3RR8A 2HW3A 4M3WA 3NGYA 4PWDA 3HVAA 4MFBB 3KLFB 4MIAA 1UWBB 3DMJB 3QZ8A 3V9SA 5KFTA 3BJYA 2YV0X 2C28A 4K8ZA 4O4GA 2IDOA 3V4IB 3M9MB 3QIPB 3NF8A 4DEZA 1J9AA 3V6JA 1UOCA 3PO5A 3VA0A 4EP5A 2WCXA 1L3TA 5JUMA 3AV9A 4Q43A 4FW2A 4O55A 2FVSA 4NCAA 4DLEA 3KHRA 3HYFA 1QQCA 3KKRA 4CFAA 3UQSA 4PQUA 1I39A 5HROA 4FK4A 4IRCA 4ICLA 4PQUB 4DU4A 2UVVA 3GIJA 5J1EB 4WYLA 3ITHB 1N5YA 2YNIB 5L1IA 2FLPA 1RTIB 4W5OA 3KLIB 2G8WA 3KTQA 2QK9A 4U6PA 2IBKA 4FJ8A 3M8SA 4AH9A 2BANA 1SUQB 3HKWA 3ZSVA 3QIDA 4EZ6A 1FXXA 4DTUA 4KKOB 2W8LA 4O3PA 3DRPB 3KK2B 3FDSA 4EBDA 3VQQA 1TAQA 5FDLA 4RW7A 3LWMA 4CHOA 4O3RA 3QNOA 3SPYA 1WAJA 2HHUA 4IRKA 2DTUA 4FXDA 4FVMA 5DGBA 4DSEA 3BSOA 3OL9A 2IJNA 3MF5A 3HVWA 3ICLA 4QW8A 3SV3A 1KVAA 3NH0A 3RB6A 1TL3A 2Z1JA 2XI3A 3V6KA 3BQ1A 3H5YA 3IS9A 3QEIA 4O44B 1LV5A 5FRNA 4E7KA 5L1JA 4J9SA 3OYLA 3DLBA 2R8HA 4FLVA 4ELUA 5F8LA 3KOAA 4CJ5A 4K4XA 1RBRA 3UPFA 1WSIA 1JLCB 1A5XA 4J9OA 4AHRA 1BI4A 1Z25A 3RMCA 3KLVA 3CDWA 4Y3CA 5HP1B 3SFUA 4Y34A 4Y1DA 4WFYA 4NLTA 3QEWA 3ZT4A 3RRHA 3DOKB 4I7FB 3O3HA 2YNHB 3DOKA 4CHYA 1SL2A 1BGXT 2YNGB 5HRRA 4NCBA 4ECQA 4F2RA 4IG3A 4ZPCA 4QWBA 1D9FA 4K8XA 3WNFA 4CHNA 3OSPA 5F8IA 2BANB 5DMRA 3SI8A 4CJLA 4IQXA 4N5SA 3CO9A 4URSA 3T5JA 2J6SA 2WHOA 4F8RA 4NZ0A 1UWBA 2X74A 3MR3A 5DQHA 1NJYA 4ECVA 3OSNA 2VG5A 2VG6B 3D5MA 1RDCA 1CLQA 3L3VA 3IRXB 4ECSA 1C6VA 3KMQA 4CJUA 2R8KA 5CYQA 2FVRA 1KFDA 2AQ4A 3ZT3A 1TK0A 4DTRA 4NRTA 4CIEA 4J9NA 1SV5B 1YTUA 1WSHA 4I9LA 1TP7A 3KK1A 5CYMA 4B3OA 4KE5A 4EBEA 2OZMA 4IH7A 2Q3SA 1RTHB 4KI4A 2VA3A 3IGNA 3AVIA 1HNIB 4M3UA 3VQPA 4L8RB 1SH3A 4NLQA 3SJJA 5DQGA 4ZVHA 3QGHA 3LANA 1U09A 2E6MA 5C42A 4CIFA 3D28A 3NF9A 1RT7A 3VQAA 3VQBA 3H59A 3OYJA 4FJKA 2WOMB 4K4UA 4MH8A 4YFUA 3HP6A 3MEEB 3G6YA 1RT4A 4KHRA 4ECXA 4IR9A 3T3FA 1REVB 3QEVA 3OYHA 4MFBA 5J1EA 1ASVA 4KTQA 4WZMA 2LSNA 4IFYB 4CEQA 4KAZA 3OVNA 4M42A 1HYZA 3VN5A 4DQSA 1RTJA 3NCIA 4M95A 4RW8B 2G8UA 1FKOA 3L2RA 1FKPA 1TKZA 2R2TA 2BDPA 5KG7A 1RT1B 1NKCA 4J9QA 1S1WA 5I3UB 3WNHA 4F2SA 3M8QA 1BCMA 1K6YA 1NKBA 5KFPA 4J9MA 4G1QA 3C6TA 2YNFA 4H4MB 2GIQA 4ID5B 3L2WA 4DSIA 4NYNA 4DQQA 3V1OA 3M8RA 4QWEA 3KLHB 4CJQA 3LZJA 3TANA 1TL1A 2UVWA 5DK5A 2EHGA 1VRUB 3KLIA 4Q45A 2GBZA 3KK3A 4KRFA 2O5DA 4KHNA 3RB3A 3NDKA 4YR0A 3RMAA 4FJLA 4OKJA 3AVFA 4DSFA 3C6UB 2HAIA 1EP4A 4RW4A 1TQLA 1RBVA 4NLSA 1VSHA 3AVJA 5EDWA 1Z4UA 3H4BA 2I5JB 1DTTB 3AA4A 4KKOA 2FBYA 2JEIA 1JKHA 2B5JB 2R8GA 1ITGA 4URQU 2HVHA 3KD5E 1DTTA 5L1KA 4ECUA 5EWGA 1WNEA 2RDIA 1I6JA 3OL6A 4KB7A 4J9PA 1BQMB 1KHVA 5KFFA 4FM0A 5CY4A 3RAQA 3SV4A 4R0EA 4FK0A 5KT4A 3DYAA 2IM1A 2R7YA 1SKRA 2XI2A 1S6PA 2YHBA 1VSLA 4ZHRA 4LSLA 1NKEA 4FYDA 4F3OA 1VSIA 2OPRB 3PX0A 2PY5A 4KSEB 4DTXA 5KFLA 2OPPB 2FBXA 3DLKB 4MK9A 4Q8EA 1S9EA 3K58A 3V4IA 2OPSB 4GMJB 4DL7A 4FLYA 1J5OA 4EEYA 5KG0A 4DG1B 1LAWA 1SH2A 1HYSB 3MEDB 2ZE2A 1XR6A 3HHKA 2YNGA 1LWEB 3FFIA 3BQ0A 5I42A 1DLOA 4F4ZA 5J2MB 2YNHA 3VQEA 3WNGA 4U7CA 2I1RA 3OYFA 4O3SA 5KFAA 5J2MA 4ED3A 4CEOA 2BQRA 4IFYA 3G86A 2JEJA 3MEGB 4AILC 4M94A 4TYBA 3U6FA 4BE0A 3V9WA 3GV8B 1A5VA 5K14B 2IM0A 1NNDA 3OJUA 4DL2A 5I3UA 4KAIA 4FJHA 2OPPA 1IKWB 1S9EB 2B5JA 4ID5A 5J2PA 2KW4A 4MKBA 3VQCA 1S1VB 4K4VA 1NOZA 1IKWA 3A2FA 4HVJA 3LWLA 3C94A 4YR3A 3GILA 2NUBA 3I0SB 2DPJA 4CEAA 2XGQA 3CM6A 4DSKA 1RTDB 2YKMA 4E7JA 5HROB 4WFZA 5KFUA 4NLOA 5KFDA 1DLOB 4NLPA 1IKYA 1NJZA 5CYMB 4DTJA 4F50A 4NRUA 4IFVA 2YKNB 2UVUA 4OL8A 2J6TA 1QE1B 3OYNA 1W0HA 4FJ9A 4H54A 3GIKA 2P1JA 3DOLB 2FVQA 3JSMA 3DLKA 4YR2A 3OHAA 3C6TB 4H4MA 4M3YA 4IH6A 1WSJA 4M45A 3ZSRA 2EX3A 3JSMB 2R2RA 4FJXA 3SQ0A 4CERA 2FVCA 3DLEA 2KFZA 1Y97A 1WNSA 5F9NA 4DSJA 4KFBA 1TGOA 4RW8A 2ZD1A 2W7PA 4ZTFA 3IS9B 5KG5A 4O4RA 1QE1A 1S6PB 3UR0A 2WK4A 3AVCA 4JV0A 1RT5B 5J2QA 1ZTWA 4Q0BB 1RDAA 5KFYA 3BSCA 4TY8B 3LP1A 3TI0A 2OPQA 2JC0A 4NLXA 4KHWA 4KV8A 2HHWA 4CFCA 1BI4B 2AGOA 5C42B 4XPCA 2VG5B 1W9HA 4CEZA 3TAGA 1U04A 4CF2A 2I5JA 2B6AA 4CEFA 4OGCA 4CJPA 3RBDA 1JKHB 4O3QA 1JLEA 3V9XA 3DRRA 3RTVA 1HPZA 3T5KA 2ZQBA 5KG6A 3DRSB 1S1UA 3AVAA 2V4QA 4LSNB 1XI1A 3GIMA 4FM1A 1LWFB 5DG9A 3AVHA 2FLNA 4ZP6A 4K4YA 2D5RA 4WXWA 3PR4A 4JV1A 2AJQA 2IM2A 1X9SA 1EKEA 1QSLA 3LP0B 3N6NA 1FK9A 5D3GB 4HYKA 1YVFA 3CFOA 3AVGA 5J2QB 4RW6A 5CZ2A 4J9KA 3B6OA 2XY7A 2BRKA 4G3IA 3MR5A 1S1TA 4HUEA 3LP2B 4E89A 4EO6A 1S1WB 2E4LA 3PW0A 5FDLB 3OHBA 2B4JA 1RBUA 3OYMA 2ZE2B 4K4WA 4CJVA 1ZBLA 2R2UA 2P51A 2X78A 1JIHA 3BREA 3CQ8A 5HBMA 4LH5A 4QOZB 4ZPAA 2FC0A 3VQ7A 4IBNA 4E1NA 1X9WA 3OYIA 1WN7A 4CHZA 1C0TA 2WONA 3ISNC 4E3SA 3U3GA 3OYGA 4JRPA 3CG7A 4C8NA 2W9CB 3D0PA 5F8HA 4ED6A 1O1WA 1T03A 3FRZA 2W8KA 4DQIA 3I5BA 4G1QB 2ATLA 4BWJA
chains in the Genus database with same CATH superfamily
3ENQA 2MQMA 3Q8UA 3EDQB 3W3SA 1QVFM 2OUGA 5IWAF 1BA0A 5KFNA 3MXIA 4RWWA 3GFHA 5J2NA 1T05A 5T7BA 1UTAA 1HX1A 5FPDA 2RJZA 3I56N 2WRMA 2FSKA 3RSEA 1S48A 3M3ZA 3MEKA 5DLFA 3BV8A 3ZCMA 2PN6A 3FGUA 4B9TA 3MCNA 2H54B 3QETA 3V9ZA 2D7SA 2PFDA 4ECWA 3OYAA 4PXBA 2ZH8A 4CM0A 3TEHB 5BYRA 5T7LA 1FEHA 5DO2A 5AQWA 2CJQA 4OHYA 5A6WA 3K59A 2R7XA 2YPZA 4DFPA 4X64F 3T7ZA 2QLFB 3EM1A 3VZHA 2KRRA 1JLBB 3O80A 3T69A 3D67A 3DXKB 3DLRA 2F8HA 2DY4A 3LPYA 2RQCA 1FE0A 1NGAA 3BR8A 2OA8A 4HDGA 3RUBL 3CCMN 4WK3A 1IBKK 4H0TB 4OMFG 1NJIT 3OYDA 1UJ4A 2YXLA 3QWPA 1BE4A 1H7WA 1U7LA 1RT5A 4FVUA 1VRTA 3MM8B 4BDZA 1WLJA 2HSEB 2MQ8A 2Z0GA 4UZCA 5JLFA 1DJ0A 1OYEA 3MAHA 4JI7F 4LIRA 3O3FA 1KVCA 5AQOA 3WIUA 4B02A 4X4NA 1RT7B 4B08A 3CDEA 4K5RA 4ECRA 3E66A 2WBMA 1P8ZA 2XQCA 2ASLA 3M30B 3DN9A 2GVDA 4E0DA 4CJEA 1Q95G 3LP1B 3AGRA 3CD6N 1TK5A 3V81A 1J6ZA 2H4YB 2CNLB 1QAIA 4ZVEA 3D6TB 4LF4F 4JS4A 2LYVA 1TL7B 3CFPA 2A2DA 1HFEL 4B3OB 4DV6J 4NCGB 2FSJA 3MPUB 3NS7B 4Z4IA 3PW2A 3S6EA 3CJSA 2GQCA 3OLAA 4ZMMA 2HMIB 4DCOB 2MZTA 3H7HB 3W64A 3L4BC 4IUFA 4JD2B 2B7BB 3I5AA 1PO6A 5F0XA 2UU9F 4H0OA 2HWHA 2W42A 4TSXA 2BE7D 1NK6A 3SAHA 2A5XA 2YPYA 4DR3K 2IRYA 2W4PA 4EAHD 3M1VA 3R6MA 1VQNN 3C15A 3H08A 2KO1A 4FXWA 1ZTTA 1N88A 2RQMA 3AA2A 1FK9B 1IM4A 1NEEA 3U4LA 1U6BA 1IKYB 4DUYF 3D1HA 3DC2A 4XH1A 1EXQA 5HO4A 2DFFA 3LDPA 2OPSA 2VPWB 1JLBA 3A3PB 4UY8O 3H2UB 4LUBA 5GADP 1KWMA 5LJ3Y 4CZIA 4JS5A 4CP5A 3EKSA 2VU5A 3H4DA 1HL6A 3FNNA 2G0JA 5CD4H 1S97A 2RVJA 2MY8A 4IYQA 4BACA 4RU9A 1HBMA 3NOGA 2B0GA 4DV4F 1MMLA 5U47A 2E1CA 3PFOA 2MQQA 4I2QB 3HSZA 1MMDA 2Y1JA 5DGAA 2BJ1A 4CJFA 3JAMO 1T44A 5HP1A 3KJQB 3MN6A 2AIRB 2E1AA 4IKFA 1D09B 3GCWP 3R7SB 3G25A 2UUAF 1KN6A 5K8MA 1XBWA 2IFXA 3H1QA 4F25A 1KLMA 1CULB 1GT8A 3H3NO 2UUBF 3DDNA 5D4PA 1OSDA 3I55S 5KFCA 5HRPA 2F5GA 4DFMA 4O0NA 3TAMA 1S6QA 4DV0K 3NNAA 1SC6A 1PJ5A 4DX7A 3K57A 3VQTA 4BC9A 3QLHA 4ES1A 5KGWA 4JK8A 2YHAA 4RPFA 2LECA 1TUYA 2CA9A 3SJHA 2QM1A 3D6RA 3SQGB 5C15A 3MEEA 1YLXA 3VAHA 3HOSA 3HM9A 4NLYA 1HNXK 1RQ0A 2V0NA 4FF4A 4QWCA 5CXTA 1FFSB 3X3UA 4O44A 2DXFA 2OTJN 1VS3A 3D7EO 4RNMA 3F0NA 4CJTA 2R2SA 2YY3A 3BKTA 4H8KA 4Q7AA 2ZM6J 1SL0A 1XR7A 2E88A 3UKRB 4BC2A 4FNHA 3MAAB 3QRPA 3C46A 1HD1A 1HHTP 4IOCL 2QSWA 4DL6A 1SH0A 3PR5B 2QWLA 2AX1A 5KFEA 4M7YA 3MDFA 3W9JA 2IA6A 2VFRA 3WDOA 3UW1A 4GKJK 3R9PA 1WSRA 3THTA 4DR4K 4CZLA 1XNRJ 4XEIA 1EARA 3BM7A 1CZBA 4Z0UA 3KVGA 4N77A 1IQTA 3E9PA 2XYHB 2DNKA 4I2PA 2IYGA 5GIPA 1TAUA 2GWKA 1FNOA 1BQNA 2KFNA 3BH6B 3H40A 3IC1A 4J91A 3I5CA 3EZUA 1FKAF 3QO9A 1RADB 2KHCA 2XZDB 1ICEB 5HAOA 1LFPA 2ADCA 2ASPA 5BR8J 2OH2A 1PJ7A 4Q8FA 2FD2A 4Q0BA 2BM1A 3MD1A 1JLFA 3SAGA 4UY8T 1JLFB 1G3OA 5CYQB 1T8EA 4RO0A 3SQ4A 3GIIA 1SVDA 2B4OA 5CHIA 1VRQC 4DQRA 1RTDA 2AJFE 1UA1A 3THPA 3LAKA 3UDEA 2BTFA 1PYTA 3QGIA 5M2RA 3I0RB 4FOIA 4PXEA 3FR0A 5E3QA 1YIJN 4U67L 5HVHA 1CJTA 2O8FB 1S49A 3B4DA 4LF2A 1VISA 2PC6A 1GXTA 2P2CB 4U95A 3S3OA 2YVSA 4CW7B 4DUTA 1FW6A 2HG4A 1ZM4A 4PKGA 3TX8A 1YX2A 1IBCB 1Y10A 4YOTA 2Z1GA 1NB2A 3N28A 2YCHA 2DGTA 4CF0A 2FZGB 4YB5A 2HURA 4CESA 1HQUB 1W2BM 2J0WA 4BGAA 5AQYA 2LU2A 2V6AA 1RA6A 3MFIA 1F9EB 3HJFA 1XMOK 3GONA 4LFAF 3QRRA 1YJRA 2CKWA 4OLPA 1X4AA 2MKSA 2M9KA 1JLQB 4A2BA 4DUZK 2E5JA 1D9AA 3SCXA 3DM2A 1TVRB 4GVMA 4Y2IA 4NLRA 2I38A 4FJNA 3MECB 5HJYA 1CJVB 5AZJB 1NK7A 3QYYA 4GW6A 3J7A1 1TUWA 4I2QA 4LBIA 2WTFA 3FSYA 3ZZTA 4LFAK 3CQYA 1HARA 1C1BB 4LJMA 5DDRC 2YKQA 3R5BA 2YI1A 4WZQA 3LO3A 3F41A 3V6DB 3FZHA 2P5OA 1J5EF 1YVUA 2M2BA 3PSFA 2QA1A 4OLOA 2XMTA 3O3LA 1FVSA 4X4QA 2IC3A 4BVOA 1KDNA 3W60A 2DT9A 4DHYA 3AD7C 2K3IA 1FRMA 2K1RA 2WB4A 1JJCB 4PY5A 3SCJE 3AVLA 4UOCA 2PI5A 1U02A 2WB1D 5CZXA 5E3RA 4C7QA 4LF5J 3H90A 3B6BA 3I8DA 4E8UA 4NWBA 4IDKB 4KV8B 3HHNB 4F4XA 2C2KB 3AAWB 1GLCG 3C95A 1P9YA 3AQPA 3AARA 2YX6A 1DTQA 1RGIA 1O51A 1I94F 4QBUA 3FGVA 2XS7A 5ITHA 3R1HA 1U48A 4WKYA 3K7RA 2CJKA 4KH4A 3HPOA 3CCSS 3J7ZT 1VC5A 2VIHA 5HJXA 3AXKA 3GJQB 3C7NB 1FWPA 2Q1NA 4KTWA 2FZCB 2GTDA 2HK3A 4UOFA 3LOUA 1HKAA 3K2YA 1SXLA 1RT6B 3LM2A 4ES3A 4JOUA 4A46A 1OH7A 2G8VA 4ZPBA 2V2KA 1N34J 3JTNA 5ADZA 4B3SF 1NG9A 5HRNA 2QTWA 2P9IA 1VRTB 3MM8A 3O44A 2FJVA 1RKIA 3PY8A 2F40A 1P1TA 4GKKK 2ZKUA 3KIOA 2AYGA 5KG1A 2QLWA 4JI8F 3NY0A 2CZVC 1HNWF 3KJNB 2M7SA 2R7TA 4K43A 3HPGA 1WG1A 3OL7A 5E2QA 2A6MA 5DG7A 4HUFA 4ZVGA 4DV2F 3GSIA 3OTDA 2GO9A 3G8TA 2MQLA 3NGDA 4CEDA 3B78A 4RNOA 1UW4A 3CW2C 2DTJA 1L3VA 4A8XA 3QERA 2OPQB 4IOAQ 2E7WA 3CCVS 4FLUA 4NCGA 4ZCIA 3N0VA 3PW7A 1EIYB 2KVIA 3HL8A 4DN9A 2N82B 1NGBA 1KQGB 5TKWA 3I0SA 1B64A 4QPXA 3ALYA 4PCQA 4ILHA 1T95A 2J0XA 3TA1A 1RUSA 3KMSA 3A0IX 2J9DE 1LCUA 3GE1A 2KM8B 3DXBA 2O4IA 3CJ5A 2AEMA 3J8AA 3IXQA 4PR6A 1HI0P 1KQFB 2H4WB 1HNZK 4FXVA 4YDDB 8AT1B 5C2FA 5DLGA 1ZZNA 4GC7A 4DV4J 2W6LA 4LFBK 4RW4B 3OD2A 4RU2A 2HGLA 5KFVA 1RU1A 5C2CA 2WBNA 4RW6B 3V6DA 5AZJA 4UW2A 2B9EA 4ZCMA 3QFHA 1JXBA 3DNCA 1Q9YA 4O3OA 2OCEA 1C1BA 3AO3A 1IWAA 4FS2A 4KHPF 1YJVA 4DR4F 4ED0A 1OS5A 3IAYA 2EFQA 2ZM6K 2HKEA 2HS0A 1C0UA 4CGFA 4R5PB 2RHKA 4BDYA 4BCAA 2IAJB 2XMWA 3GQCA 3CC2N 3PJ9A 3SMSA 4NXMF 2IC3B 1SPBP 3K5OA 2Z1HA 2PMZD 4ED7A 5CCLA 1UVKA 2Z2LA 1TYQA 1PJ6A 3SYZA 2B43A 3QNNA 2E7XA 3W2VB 2NRWA 1D0EA 3VTHA 3QT8A 1BCOA 4JKBA 2G9OA 4GVBA 2XSFA 3CCWA 3D6MB 2XNRA 4HUGA 1IBKJ 1S9FA 3ONQA 5FPEA 5M2UA 1Z2ZA 3BQ2A 5H9FJ 4E1MA 1SJFA 4BBYA 4EFAC 3T5HA 1HA1A 1IKVB 2F8TA 5MLCQ 3ZT0A 2DIVA 2WW8A 3BKUA 4DV7K 2C2MB 4O4GB 4FZYA 2ZOGA 1KQSM 3EE9A 1N0UA 1HYVA 2FZKB 4WFNL 4B1ZA 3NOCA 4B9NA 2Z2YB 1HPMA 3FZFA 4FPRA 4DX8H 4ATNA 3G4SN 4OYOA 1RWWB 5ETOA 5DRKA 4EZ9A 3QNWB 1S10A 4DKWA 4W5QA 1RLDA 2HBZB 4H0XB 4PUOA 4DZDA 4MQ3A 4LF9F 4XPEA 2VZ9A 5CHCB 4Q2MA 1ELOA 2J9CA 1DHMA 4FF2A 1S1UB 1BQMA 5IXUA 2CJYB 4EYIB 2XHBA 3ENOA 3OYCA 4A61A 1BY9A 1NOYA 4A4JA 3DWLA 4TNOA 3ZSOA 3MM6B 1T9XA 4DWIA 2GIFA 2AGPA 3CJBA 1IG9A 2VOPA 4M3RA 5GAHI 3O1WA 2V67A 3DDIA 1BWFO 5GMEA 1AFJA 2ZWPA 3ZT1A 5HRSA 2W9BB 1K8KA 1S1TB 2E1ZA 1HWKA 2KQ2A 1UCNA 2PYLA 1QUVA 5BYQA 1HW8A 4IG0B 1S1XA 1I5OB 2G1HA 2VWJA 3VGUA 4CFDA 2M0GB 2E20A 3HX9A 2HAFA 4PUOB 2QKKA 3S3MA 2ZJRL 1CXQA 3M6VA 1RDUA 3EN9A 2AZ3A 3T19A 4QS7A 2EEYA 3KKSA 4ANCA 3BY5A 5ETVA 4DR6J 1KSPA 1SJ4P 2OMOA 2RS8A 4CO3A 5BJRA 5GADI 3PJXA 1RK8A 4QIWD 3VF2A 1JLGB 2E9RX 5IT4A 4DTPA 5J1PA 1TKZB 5D0EA 5JMVA 4ZPDA 3BO3A 2Q6BA 3P38A 1L5UA 2XWYA 1YI2S 3I55N 1N6QA 2EFNA 4PXDA 5F8NA 5IM0A 3BR9A 2GMJA 4FWNA 3OJSA 1XMBA 1Q1KA 3NLCA 5AFUH 2YX7A 5IWAJ 5F9LA 1ZAWA 2ILZA 3UDCA 3IRXA 3SFGA 2IRUA 2VKRA 3MMBB 2DPIA 2ZC4A 1RAIB 3FQKA 4HLBA 3EZWA 1T94A 3IBWA 3MZIA 4WTYA 1QDUB 5FLXU 1JXVA 3HVTB 2YWGA 4LR8A 3KJVB 3Q83A 3VEZA 3C16A 4KHMA 4ZN3A 4H5WA 2Q2RA 1NJIO 1KTVA 1RT2B 2DEJA 3AXMA 2C2EA 4MMOA 4ZTJA 1NMEB 1MN7A 4ECZA 1JJHA 2QL9B 2ATQA 4DFKA 4Z4GA 4YMEA 2M70A 4CBXA 4I1TA 3QINA 3SUNA 2DD8S 3I87A 4OYBA 3R7BB 4JRQA 4JI6K 5C7PA 4O23A 4B9VA 4GVBB 2NCKL 2A10A 3MCMA 2KVQE 1HI8A 4CGJA 3W0LA 5J1NA 2Z58B 3QFPA 2V2VA 2YKMB 3KK3B 1VRUA 4LFBF 3CIZA 5KG4A 3CD7A 3P31A 1OQ6A 4KIAA 2LQJA 4MIAA 1UWBB 4KY3A 4O4GA 2IDOA 3V4IB 1NXIA 3DGVA 3M9MB 3CF5Q 1J9AA 2L3MA 3AA9A 2B51A 1FJCA 4BRMA 4Q43A 3UD3P 4FW2A 4ANEA 2BW2A 2F9DA 3SBTA 2VKZG 3MOZA 3HYFA 1UJ6A 3KKRA 5GINA 4CFAA 3UQSA 2O8BA 1DBDA 4CZJA 4FF3A 1WG4A 2PI4A 4PL7A 3VMFB 2NREA 1SC3B 2D9PA 2B56A 5L1IA 2FLPA 4NMLA 2ZBPA 5BR8K 4PPDA 2VQEJ 1WI8A 4BRLA 4AH9A 4ED5A 3GLJA 1AA1B 3WEEB 1SUQB 2OFGX 1FJ7A 1RWUA 2AW0A 2DIUA 4EBDA 3OTEA 3GOIA 4RW7A 4LVNP 3ISZA 1UPMB 3QNOA 4BREA 2HHUA 1WAJA 4IRKA 4FXDA 2XNQA 2CJBA 3M2VB 4M5LA 3ZTOA 2R7OA 4FVMA 1RHQB 3BSOA 2DCUB 4OX9J 3JXOA 1UJ5A 4QW8A 1O8BA 3NH0A 3THXA 3MUVP 2CPEA 3CDAA 2Z1JA 4HT7A 3IS9A 2DNHA 2YH1A 1KEKA 1LV5A 3OR2B 2LKZA 5FRNA 2J0SD 3MWTA 4E7KA 2HZCA 5L1JA 1Q53A 2O8CB 2HFZA 3KOAA 4K4XA 2C3UA 4QU6A 1JLCB 3D2FB 4J9OA 2NPFA 2GAHC 1QAXA 1N36F 1TL4A 2KJWA 3HZ6A 1U2CA 2V5HG 2QFIA 5AQFA 4JYAK 1REGX 4CO1A 4DR1J 3LH2S 4IOCQ 3H2VE 2EG1A 3DOKA 1SL2A 1V3RA 3AB4B 2DGSA 3NGRA 1D9FA 4K8XA 4KGMA 4USJC 3CCVN 4RUHA 3SI8A 5B7WA 2YX4A 2YKAA 1YGYA 2IJRA 3MM5A 4CJLA 4N5SA 4URSA 4KH1B 1KC8T 1VAZA 3LGNA 3MR3A 2PA8D 5DQHA 1K73T 2Z2MA 2VG6B 3CT9A 3HDSA 1LOUA 4ECSA 3GWCA 3KMQA 2ZGYA 2JH3A 1FRJA 5BR9A 3CCZA 5L38A 3QRQA 2VJVA 3UNYA 3BYPA 3M6UA 3M1FA 2MSTA 4J9NA 1JQGA 3M2RA 1Q5VA 3RSEB 2VFVA 2NYIA 4JI0F 5B0AA 1NGHA 1DAXA 4QYZK 1RTHB 2QG9B 3ZTRA 4KI4A 2K1RB 3TYTA 1VQ6N 3AVIA 3K8WA 3LF0A 4ZLJA 4C0BA 2NXNA 3SJJA 5DQGA 5E33A 3QGHA 1YHQN 1U09A 4USWA 2FHJA 3MMCB 4JI1F 3T1YF 3VQBA 4YB6A 3C19A 1RHKB 2WOMB 4K4UA 2B8PA 3G6YA 2VBYA 4ECXA 4MDAA 1REVB 1S76D 3OYHA 4GKJJ 2P9UA 5J1EA 4L73A 2O1PA 4WZMA 2I0XA 2NXUA 3VN5A 1XMOF 2AEFA 5ETLA 1RHUB 3WC2A 2VCPA 4RW8B 2M88A 2G8UA 1FKOA 4QQBA 2E5LK 5KG7A 3P4IA 2Z8QA 1G6BA 4DR6F 5I3UB 3WNHA 3GG4A 5HI7A 3QAEA 1BCMA 5B0CA 4ZK7M 4G1QA 1FDNA 3CJ7A 4ID5B 3JSYA 3PG9A 3V1OA 1YJWN 3TANA 3N4PA 2WVCA 3WQPA 5K8PA 2QWOA 4M5IA 1VRUB 4Q45A 3KK3A 3AJ1A 4QIVA 4NE9C 3RG6A 4KRFA 2O5DA 1OH5A 1HR0J 4KH0B 4KHNA 3RB3A 1ATNA 4OKJA 2CH5A 3OVSA 3OV7A 1Y11A 4PWWA 1YRUA 3IUCA 2V9KA 2DRAA 4GNIA 5EDWA 4HHHA 3ENHA 1Z4UA 3H4BA 2EI5A 5G4DA 2I5JB 3MN5A 3O5BA 4RR5A 3C16B 4KKOA 2FBYA 2JEIA 2HF4A 1YRXA 4URQU 3VOVA 5EWGA 2FIUA 2YBVA 5G0RB 1I6JA 1YZ6A 4AFFA 3TVYA 4WQ4C 4M5HA 1PGZA 1QQMA 2GGPB 5KFFA 1ATRA 1OYDA 1HBNA 3RAQA 1ZA1B 4QU7A 5IT9Y 2OTJS 3CCTA 3HLUA 2HFVA 2ZKTA 4P7TA 1NGDA 2R7YA 2D1CA 2XI2A 3I6PA 3HKZD 3IAM9 4NMXA 1VSLA 2W7AA 1NKEA 2RRBA 4CLTA 2DY9A 2OPRB 2VDIA 3PX0A 2D4WA 2PY5A 4OPHA 3CB4A 9ATCB 3G9CA 3NCPA 3K58A 2J9EA 4J9VA 4EEYA 3C6HA 3ULEA 3TW0A 2RUSA 3WBZA 2DO0A 4W92B 1WOQA 3BQ0A 5I42A 1DLOA 2KB2A 3VQEA 4CLWA 1Q18A 1VQPS 1MWMA 4U7CA 3OYFA 3CJ1A 1UL3A 3CDBA 4M94A 4TYBA 3IR7B 4BE0A 3GV8B 4K25A 1F5AA 4CLPA 4F4AA 6FDRA 3JTPA 5I3UA 3UCGA 4ID5A 4N8OA 4WFBL 5AQUA 3MURP 1IKWA 2DITA 1VQKS 2WSFC 3BN4A 2DB1A 1V5IB 4DSKA 4B1XB 1SCJB 5HROB 3CUNA 2F7VA 2L08A 4NLOA 1HQ2A 2DGOA 2EC2A 3W5YA 4DTJA 2VFTA 2F9JA 1DT9A 4F50A 3ZTPA 5IFMA 1RBLA 3HHLB 1VQKN 2P9KA 4KH6A 3OXFA 1HBMB 3IR6B 4H54A 3DOLB 3AH6A 3ZX0A 3DLKA 3CJAA 1CULA 3SQ0A 4PG6A 2FVCA 2ZFHA 4F04B 2QWNA 1Y97A 4BG8A 3FCVA 3MPVA 1N5VA 5ETQA 2DY1A 4RW8A 4Z7CA 3N5BA 4ZTFA 4O4RA 5LM7E 2DH7A 3JQJA 3FK4A 4K0KJ 1F3VA 3AVCA 4CO5A 1X5OA 3VALA 2OAUA 2P8IA 1ZTWA 4YS2A 4K5SA 4DPTA 1N32K 4NLXA 2RDDA 2HHWA 1BI4B 1B7YB 4XPCA 5HMZA 2J7UA 1W9HA 2ZZTA 1QM9A 2CGKA 3FJ2A 2DGQA 4MKYA 4CEZA 4JYAJ 3SLCA 1K47A 3GG0A 4OGCA 4V19J 1OH6A 2RQ4A 3LGHA 4X4RA 3SAFA 4O3QA 1JLEA 4MO4A 2ZQBA 3DRSB 4YHHK 5HVFA 3OW2M 4JI8J 2G0IA 2GFFA 3GIMA 4FYXB 4YY3J 5F0UA 4WF9L 1DARA 2H3GX 3RVCA 5DG9A 3NEKA 2FLNA 1NMNA 5IT9O 3NGUA 3G71N 4V1Ak 3A8YA 2CDQA 4ZPVR 3PR4A 4JV1A 1X9SA 3BEGB 1FK9A 2VASA 5M1OA 3CFOA 4IXCA 3AVGA 5J2QB 1FJGF 1UVNA 2HBJA 5A6PA 4E89A 3O2IA 1S1WB 4KH5A 4ZVUB 1A9NB 4OI1A 2PSZA 4RJVA 1ZBLA 2R2UA 3NCRA 2X78A 4P2FA 2AYMA 3BREA 2XZTB 1OSCA 1N8RO 2HVEA 1WBDA 3DLLL 3T1YJ 3PIOL 4LH5A 5GAHU 1M5HA 3KYLA 2JHEA 4IBNA 1FRXA 3A1YG 5M1PA 2CH6A 1S72S 2DNGA 4BRHA 3OT9A 1HWIA 4HL9A 2C2OB 1WN7A 1VQ9S 3MPYA 1O0PA 4DN0A 3U3GA 4E3SA 4JRPA 4LF1A 5F8HA 3L7OA 4ED6A 3CMAS 4BLGA 3E3XA 2Q79A 2W8KA 3EUNA 4DQIA 3I5BA 3J7AN 4BWJA 1X9MA 3O9RA 4DV7F 4KHQA 2NR0A 5LOQA 5F1XA 5IC4B 2VGNA 3CM5A 3H25A 2KFYA 4N56A 4DZ6A 4X65F 1UVMA 2B4UA 1VSKA 2A1BA 5KFQA 1LW2B 3M2VA 3O5TB 1K1SA 3SUOA 3Q8RB 4RG8A 4U8YA 1EP4B 1ZM2A 5FPNA 3W5XA 3W61A 5EOYA 2OI2A 3ZNUA 3O6QA 5AE2A 2W7OA 2KZZA 4H4OB 1CJVA 3H8YA 2F65A 1ITPA 2LQ5A 4ZCLA 4E98A 2B3TB 4CVNE 2AX0A 4B8CA 1NK4A 1MNEA 3OUYB 5ETPA 5DETA 2E2OA 1XERA 1U1PA 4CEEA 1JL1A 1M5VC 1NK8A 5GAGU 2WVFA 2V34A 4I67A 4KPYA 2YHYA 3MGJA 3I31A 4LR7A 4OLAA 4X4SA 3ZO7A 4NYFA 1KVKA 4JBCA 4O8UA 3ETMA 4C4WA 2QWQA 4IKAA 4ZP7A 1GTHA 3DJCA 3IBFB 3GZ7A 4DL5A 1MWQA 1MN9A 1NHVA 2V8DA 4O0JA 1KRPA 3AHPA 4L6V3 3SCKE 3MECA 4BC4A 1R0AB 1EWRA 4CI0B 4CGDA 1VQ5S 5FIIA 2G2ZA 1E4FT 3DOMA 3NS5A 2W9CA 3PFEA 5GAHP 2AF6A 3DYAB 3CCJN 3NBPA 1G1XA 3EE8A 3M8PB 4KRWA 3PX6A 4H0VB 4WE1B 1B0PA 1RZMA 1VOMA 4TXSA 5F8GA 3DXKA 2UXDF 2ZJRQ 1WKLA 2DGXA 5LJVA 3DRSA 1KAYA 3FZBA 4M5GA 4FLXA 2I8EA 1F2GA 2VQFF 1NZAA 4BR9A 3DGPB 1VQMN 4RW9A 3TWHA 3CF5L 3UKUB 1T9TA 3MXHP 1RT3A 1PBAA 1WSEA 3CYMA 1U45A 4USMA 1XIQA 1RSCA 5LSRA 4ANDA 2FHKA 2MY7A 1JJ2R 3O1LA 3A5MC 2VQEF 5JVHL 1SJQA 2MZSA 2L48A 2AA4A 1VHFA 3VF0B 4DQPA 4LFCJ 4DR6K 4OYIA 4CLLA 2PFUA 1CC7A 4Z2XA 4CZFA 3DRPA 4LD0A 1RT2A 3MHYA 3F9KA 1KVIA 2P9CA 2X6SA 4IG0A 4QZVB 1WDDA 2JGUA 1LWCA 5EX0A 4UOHA 2Y8WA 2QLBB 1XNQF 1TKTA 3A5NC 2XS2A 4WFXA 1HQEA 1TKXA 4M41A 5HL7L 4DUYK 3ITHA 1C0FA 4CGGA 1RTJB 2IIRA 1CJUA 3HHLA 2EKNA 1NAQA 1B92A 3L2UA 4CCHA 3NFAA 3CJ4A 2UXBJ 4FS1A 4MAKA 3CPWR 1ZA2B 5FLXO 2PEHA 3J80Y 4IZ9A 1VIXA 1LAVA 2GQ2A 5KG2A 5AZIA 1LW0A 1CBKA 1KVBA 3WQTA 2HBRB 4UOGA 1QUPA 3FFKB 4A57A 5E5NA 4CJRA 2KHDA 3TZZA 3IN5A 5AQRA 3QO9B 3ZSQA 4DPWA 2XY5A 4LH4A 1S4EA 4WCEL 1IKXB 3D1QA 3PM9A 2HRYA 4J8FA 3K9KA 4Z4HA 1DY3A 1XR5A 3NCQA 3NNHA 3Q8SB 2HQ3A 2KZMA 4O3NA 3KG1A 4C8ZA 1HNIA 2D1KA 1DZ5A 4G1IA 3G10A 4I6YA 1KVJA 2LDIA 4KHPK 4CJWA 4XK8C 5A8RA 3NF6A 3HXMA 3AT1B 4QWDA 4X66K 3DRRB 3G6XA 1BISA 5KOXA 4QW9A 4MK8A 3MTKA 1Q81T 2UV8G 3OTOJ 1S9GA 3TAPA 1JLAB 4PWDB 4CJSA 2XHWA 3GL1A 3GTYX 4LF9K 1C0UB 2RHQB 3LDNA 3GV5B 3VESA 4Z4CA 3L7PA 4OX7A 3OYBA 4RUAA 3CETA 3O9SA 2CPXA 1LKZA 1HW9A 1ZETA 2D3OR 1KXPA 1MU2A 4R8UB 1T7PA 3ULDA 3FSIA 4KTZA 3G8QA 4TN2A 2W2NP 2E1YA 2A6OA 2F96A 1RT3B 5F8MA 3S3NA 2GC8A 5KAKA 4JAXA 4ZVQB 4K2JA 1X9JA 5E41A 4P2XA 1VSJA 4HKQA 4DV5K 3I9V9 2VJUA 1FCAA 1XK8A 2OIHA 3KLEA 5AQVA 2IOCA 3BBCA 2CFXA 3VGKA 3QGGA 2DEIA 5D15A 4HH1A 4DR7F 2N3OA 4JK7A 3EYZA 3CJKB 3QT5A 1AFIA 1NZ8A 3M8PA 3AO5A 3VGLA 4DTNA 4CO4A 1NSAA 1OY8A 4LMZA 1QSSA 3QFWA 1QLNA 1RBOB 3A8JA 3LPTA 1BHNA 2W9AA 5KRSA 3VAMA 1E6VB 3G82B 3GDQA 2VQFK 4J2EA 3I32A 3OBYA 2UU9J 4NXMK 2EG2A 4NL5A 3AO2A 4AUKA 3CD0A 4G1PA 5IV3A 3M9NB 2Q43A 2MLXA 5D4LA 1OQ3A 3UO0A 2P9SB 3THWA 2LFVA 5C25A 2ZVSA 3PHEA 1UWAA 2HIQA 1WI6A 3KLFA 3O8WA 3V9UA 2A2CA 4EUVA 4B1VA 1X5PA 3SZ2A 3ZZPA 4K4ZA 1M1KO 1TZ0A 2BKNA 2V50A 2CQCA 4ED2A 2XGPA 1VBYA 1Q16B 1NWKA 5BXIA 3IAS9 2ZH7A 5LMNK 2QWRA 1YI2N 3K5NA 4IRDA 4QIGA 2DNMA 1GMWD 4CJKA 5LL6d 2WOMA 1IBKF 4FZVA 2F8SA 3AAQA 3CCEN 1SC1B 5F0WA 1T3VA 1LW2A 2MLYA 4WWSA 3DMJA 2JVRA 5KFOA 3G71S 2BJ3A 2L9WA 2DO4A 4RBUA 2AYEA 1OIAA 2IS3A 1VQLN 4AE5A 5D4NA 4H4OA 1WC0A 2B4PA 3DFEA 4RNHA 2ZH2A 1ZBFA 1EETA 3R6LB 2OD4A 3NKYA 2ZJQL 3SCLE 1NHKL 3FZLA 4DCJB 1JNZB 1UFLA 2FY1A 5K20B 5LMUJ 4DG1A 2HGNA 1YAGA 5B0EA 2Q97A 3RJMB 3B6PA 2GVDB 4CF1A 2IGIA 5FJ4A 2X1FA 4LREA 1VSEA 4JI8K 5T7LB 3NGSA 4V19X 4EI2A 5T14A 4RLEA 3TR5A 4DPUA 2AWZA 3VEVA 4DS5A 3J81O 1Q78A 5LSLA 2IDEA 2JLEA 4FL9A 2ZF5O 3KHHA 4FLZA 2ITGA 4CBUA 3QGPA 5ADXA 4LFAJ 2X7IA 3NGZA 5DM6L 2CZ4A 5MAOA 5E3AA 1Y3KA 3AOAA 3X1LB 3PVXA 2OMLA 1I94K 2BR0A 3TVZA 2AGQA 1SL1A 1DFDA 4I4BA 4ELVA 1PCAA 4QOTA 4JV2A 1JX4A 3BUZB 3VCDA 4DV2J 1QVGR 2FC9A 3K5LA 4CF9A 3Q22A 1RBTA 2D0AA 4FJ7A 3DDKA 2DNQA 1GXLA 1Q8LA 4MK7A 1TU0B 2YQ3A 4CH1A 2GAGC 4F4YA 3TJ9A 1QQNA 3CGIA 2J9DA 1FD8A 4ERDA 3WIVA 2JVOA 3RGIA 2W01A 4X4TA 2AYBA 1PAEX 4Y00A 3D45A 4LIWA 3SSRA 4DR2F 2PBDA 4JI5F 2HWTA 1WOOA 3PYDA 3NAIA 3FRYA 3G82A 4CRJA 3EZ5A 4M3ZA 2MGZB 4ZIVA 5DDQC 3L4IA 3GSDA 3TNVA 2K06A 4DX6A 2BOPA 4JKHA 4G9ZA 2BRLA 2Z30B 2ZBCA 2KKHA 1CC8A 2FJDB 5JS2A 1HD0A 3VVTA 2HNDB 1VLOA 3EPGA 1SJ3P 1TTHB 1N56A 2QKBA 1Y00A 2HFUA 4NO7A 4XH4A 2BW7A 3P83D 1WSFA 1GLLO 1B3TA 4OZJA 4F0KA 4LF4K 1BXNA 4XO0A 1Q9XA 1Y5NB 2OFHX 3O6WA 4AL7A 1NGEA 4X65K 5F8JA 2MQNA 4HH0A 4RWTA 3KD1E 4ILRA 4LF7F 3BF1A 3CJ3A 3VQ9A 3PSIA 4FZXC 2V4JA 5ETKA 2HZVA 4HTIA 1BG3A 4LF8F 5AQHA 4AYBD 3GR0A 4USUA 1BQNB 1YXQA 1UPPA 1PYOB 2C1EB 2IMWP 3H3OB 4EIAA 3B82A 2CJXB 4GVLA 1UVLA 4HEA9 1KTQA 1IO2A 2BKOA 2EK6A 3NNCA 5LY3A 1RCOB 5ELZA 3N4WA 2JC1A 5AQNA 1GX6A 1B9FA 3MMJA 2OZSA 1CXUA 3SUQA 4DBQA 2BKPA 2XSJA 5I3PA 4JEPA 2GELA 2V4JB 4A8WA 5JLHA 3CMES 2G8KA 4P9SA 3MFHA 3OFFA 2FF6A 2YWHA 2RPIA 1F1BB 1VSFA 3GR1A 2XEXA 1XQIA 5EX3A 3NH2A 5HBMB 2OYQA 5KFXA 2DH9A 3E9OA 3WXJA 1R0CB 2IA0A 1W7WA 2XSJB 4NA1A 1QVFR 4DS4A 4CE9A 3OYEA 1VQ4S 1KAZA 1LW0B 4KT0C 5GAEI 1D8YA 2JEGA 2GX8A 2MZRA 2GGPA 4ILMA 1D4XA 3C2PA 3ZX2A 4CZEA 5DG8A 4JI6J 3CJ8A 2KYXA 3BGUA 4IOXA 2YQ0A 4BC7A 4CJ3A 5HOOA 3PRBA 2KL8A 4JI4K 3I56S 2XCPA 5IT9U 2F4VF 4ED8A 1YITS 3ZSZA 2ZVIA 2R7SA 1TFYA 3TAMB 2HWIA 3PKYA 3LPUA 3MXJA 3HSGA 4NLVA 3MUMP 1FXRA 2YNIA 3VR1A 4DL4A 3E51A 3UDLA 2D3ZA 4WE1A 2X6NA 2BABA 4DL3A 2RF2B 1XNQK 2F7TA 3LDSA 2KTQA 4AD6A 4LSNA 2DRDA 2V8HA 3R2DJ 2QYCA 5GAEP 1S22A 3C15B 1QSYA 1T9YA 2Q0RA 2DXDA 4L72B 1SZ2A 2YWKA 3OFEA 4EMDA 4IEIA 1IV0A 1G2EA 5FROA 2DHAA 3ZEUA 5JS1A 5AFUA 4DR2J 3AOCA 4IO9Q 3FBCA 1NH8A 4YOWA 3OTCA 3NL0A 4M8LA 5K8NA 4I6WA 1WACA 1BL3A 3UE2A 3L8BA 2VODA 2R4FA 1T03B 3M2UB 1ZBUA 2IVPA 4W90B 1C1AA 1GK8A 2I6WA 4DMNA 1SQFA 1KCFA 1IQZA 4M5DB 4PKHA 4V19S 3OHRA 2G2YA 3P1GA 4GO5X 5SZTA 3HCXA 2Z56B 3RAMA 2LQBA 1ZYQA 1NH7A 2LDYA 1JL2A 2MKCA 8RUCA 3VEWA 2ETJA 3MX5A 3M30A 2FJWA 1EO1A 3ZC4A 2PGCA 1FEEA 1RB0A 2ROPA 1T02A 1R8AA 4BRNA 2UUBJ 2G8IA 3VQ5A 1XMQF 5I3QA 4YB1P 4FNIA 1F0XA 3IBCB 4B9MA 4W5TA 4BHQA 4F4WA 1VQ7N 4JLHA 4DR4J 2QE5A 4NI2B 4Z7YA 2EWSA 3GYNA 4Y1CA 1FWKA 1ZPVA 4H5TA 3EWGA 4LT6A 5IC6B 2XYPB 3AVMA 3L4QA 3N9UC 4Y2CA 4JKAA 1A0OB 2NPIA 4R0JA 3N4QA 4C1NK 4E7IA 1FA0A 3PZPA 3LALA 2ROEA 5ETMA 3MM5B 4B3RJ 4DTMA 3OUYA 5BRDA 1YSJA 3MDQA 2DNLA 1PYSB 4FF1A 4ZITA 3NGKA 1XWLA 1T6DA 3SQOP 3W9HA 1Q7LB 4IDHA 2VPYB 5KT2A 3R5JB 5AXKA 3VGVA 1XC9A 1VIOA 2LU1A 2G8FA 2WVDA 1N4LA 4HCCA 3RR8A 3TSPA 3NGYA 2HQIA 1N32J 3KLFB 4C2MA 3R5CA 2X3GA 1N36K 4USIA 3CCQN 3R27A 4FPAA 4B3TK 1FDBA 4K8ZA 3W5ZA 3BH7B 4EGLA 2O8CA 2F1FA 1WHYA 3QJJA 2VICA 1L3TA 3T1HJ 4M5JA 4FWLA 1OH8A 3WEEA 3KHRA 1FRIA 1NBWA 2MDAA 1I39A 2R3VA 2E5LJ 4FWOA 3TSUA 4ICLA 2ZH3A 2CXEA 2DNNA 3GIJA 2QWPA 2KG1A 2NS1B 1WSVA 4W5OA 3TQEA 4Y28C 2J8SA 1A7GE 2ZNZA 3KTQA 1NM2A 1X60A 3ZETA 2BMBA 4QYZJ 3CXCM 3ZSVA 4M1KA 3IMXA 4DI6A 1N34F 1Z1ZA 2EWHA 4O3PA 3KK2B 3FDSA 3TO8A 3VQQA 1TAQA 1U1OA 4IOAL 1RDWX 1U2FA 5M1NA 4O3RA 2EVZA 1XMQK 3H46O 3IR5B 1HIYA 2CNKB 2BM0A 2E29A 4DSEA 1JNRB 1H38A 4DV0J 3ICLA 3SV3A 3G6ES 2JLFA 3HFKA 1KVAA 1GFWB 3UCUP 3GIRA 2E8AA 2XI3A 1X5TA 3ULHA 1Y7PA 3DLBA 2R8HA 4FLVA 5IS2A 3FKBA 5C2DA 4CJ5A 1WSIA 2O66A 1A5XA 2CRLA 1BI4A 4Y3CA 4F3QA 5EY4A 4JI6F 5D6GA 3QEWA 3OBWA 1M90O 3HULA 3LDQA 3O3HA 2OSQA 4OX9K 2AJ1A 4OZ1A 2J4RA 3Q24A 2ASMA 5A2QU 3HM8A 2BEFA 1NMDA 2BX6A 2O8FA 4IG3A 4X64K 1H2TZ 5TKYA 1S99A 3WNFA 1T11A 4CHNA 2BANB 4IQXA 3CO9A 5CE3A 2WHOA 1UWBA 4WTOB 1NJYA 4ECVA 2VG5A 3L3VA 3IRXB 4TLQA 6FD1A 3NMRA 3KWGA 5CYQA 2IRXA 2XM3A 2KJVA 2BH1A 4CIEA 1SV5B 4I9LA 4M5MA 1OKJA 5CYMA 1HNXF 3MMAA 4EBEA 4IH7A 2Q3SA 1WORA 3MCPA 3CJRA 3IGNA 1HNIB 4LF5K 4L8RB 1SH3A 4NLQA 1S57A 3LANA 2E6MA 5C42A 4CIFA 4PXCA 2XMAA 1J27A 1U8WA 3VEXA 4RL1A 3OYJA 3VTIA 4MH8A 3MEEB 4X65J 3EL2A 3UVJB 3T3FA 4JI0K 4BGBA 3ADAC 3QEVA 3RW6A 1ASVA 1P6TA 4KTQA 2UZAA 2LSNA 4E1JA 4K59A 4DV7J 4KAZA 3M8YA 4M42A 4P6QA 2ZZMA 3ZZYA 1NBEB 3R5AA 3Q8VA 4CLUA 2QC3A 2GVZB 2VBWA 2XMJA 4NXNF 3L2RA 1FKPA 3MAAA 1TKZA 2R2TA 2BDPA 1RT1B 4CDIA 5E0OA 2E5IA 2V69A 1FDAA 2GMLA 3DHXA 3UD4P 1MMNA 4F2SA 2GA7A 4JHDB 3SSSA 5KFPA 4ZJLA 2GIQA 2CQHA 4DSIA 2IBOA 4NYNA 3PIPQ 4DQQA 4QWEA 3U27A 1UFWA 2C3PA 2UVWA 4JP8A 3O8MA 2EHGA 1SQGA 2F8MA 3KLIA 1E4GT 2GBZA 2QSFA 2QT7A 4OZ5A 4QJVA 3CMQA 1KC8O 1OY9A 1X4FA 1QZ5A 3W65A 3W1YC 1VHXA 3T1HF 2HZAA 4FJLA 4YR0A 4P2MA 3KDNA 2R7VA 4DSFA 4C98A 2HAIA 3D9BA 1VYAA 1TQLA 1RBVA 1EWQA 4NLSA 3AVJA 2NRTA 2ZH6A 2NXEA 2QEXS 1CLFA 2DHXA 3K0JA 3SMPA 3PYEA 4F0HA 1TYQB 2HVHA 1HLWA 2IY5B 3A5OC 2RDIA 2Q3PA 4DUZF 4KC5A 2LEBA 4KB7A 1BQMB 1KHVA 2QMWA 3BKFA 4LF7K 3PXGa 5D0GA 1XUPO 1GLAG 5HANA 2YWEA 4BRAA 3D4JA 3SV4A 3WUHA 1S5ZA 5KT4A 1SKRA 3DYAA 3M8WA 4A8FA 2ALYB 4B3MJ 2YHBA 5M1KA 4ZHRA 4FYDA 1B99A 4F3OA 4DPXA 2E7VA 3MOJB 3R3LA 4RX6A 4OI3A 4KSEB 1N8RT 4DTXA 5JICA 5KFLA 2OPPB 2FBXA 4BR5A 4MK9A 4Q8EA 1OVYA 1S9EA 4IJAA 2OPSB 1PILA 1VBXA 4DL7A 4GMJB 4FO0A 1R7IA 4FLYA 1SH2A 2A3JA 2ZE2A 2LQ9A 5CABA 4BQZA 4LRBA 1LWEB 3FFIA 3ET6A 4K41A 1VJQA 2CPIA 1HBOA 2CPYA 4B3TJ 1S59A 2GJIA 4WIIA 1TL7A 3CNQP 4NXNJ 4O3SA 2G0CA 3GPAA 5KFAA 5J2MA 2BQRA 1CJKA 2MHEA 4FN5A 1I51B 2GHVC 5AQPA 1W2IA 2QL5B 3V9WA 3W62A 2VD3A 4N8NA 4I6AA 5D78A 5K14B 2IM0A 1NNDA 4DL2A 3R3TA 5GMKa 3MMVA 5D0RA 4OZNA 2M8HA 3BPSP 3Q7CA 3MI7X 2LA6A 1X4BA 4CLZA 4MKBA 3VQCA 4K4VA 1F9HA 4NZ7A 2QA2A 2IDLA 4CT9A 3ENBA 5AQMA 5GADU 3I0SB 3CM6A 4OYPA 4WFZA 5KFUA 3FEZA 5KFDA 3AD8C 3FE1A 3KZBA 1S79A 1IKYA 4E2FB 5EXWA 4IFVA 1UVIA 3NS6A 1RTZA 3PACA 2B8QA 1QE1B 3OYNA 2OELA 4ED4A 3GIKA 3UE5A 3QICA 1VQ9N 4DJBA 3OHAA 3C6TB 2JZ5A 4IH6A 1WSJA 3U1MA 4NXNK 4M45A 1VHIA 2MJUA 3DLEA 2KFZA 3SMZA 4DSJA 4YHHJ 3NP5A 4FYVB 1ZC6A 3C8YA 1TGOA 1UAWA 1B0VA 1TMMA 3IS9B 1YJNN 2U1AA 4HT5A 3Q23A 1QE1A 1S6PB 3UR0A 3T41A 1RT5B 1GMUA 4WFBQ 5J2QA 3WHIA 3GMGA 3ZZUA 2A41A 5KFYA 3BSCA 2RRAA 4YOYA 3LP1A 2OPQA 1MDUB 1HHSA 2JC0A 4YY3F 4KHWA 3MD3A 2P9IB 4KV8A 2AEJA 2NQPA 3VWSA 2R9LA 1U0SA 2AV5A 3LPEA 2VOOA 1LK7A 4CJPA 4DPYA 1Y5LB 3ENVA 3J7YI 3RBDA 1JKHB 4BR2A 2VBXA 5F3ZA 4X62F 2FJEB 2AJ0A 2FLOA 1LWFB 2R7UA 5D4OA 2FC8A 2LXFA 4P74A 4K4YA 2RIJA 3J80U 1VQPN 1OY6A 2P9NA 2IM2A 1RLCL 4M5KA 1QSLA 1EKEA 5BN9A 3LP0B 3BBFA 2HPUA 4J9KA 4C3KA 3P45B 4KR0B 1ZOTA 4G3IA 1EKSA 3LP2B 3ZLJA 3LDLA 2CUYA 2BJDA 2ZE2B 1BDGA 4CJVA 4EWTA 3LGMA 4C3MA 1S12A 4HVZA 2J5AA 3WT0A 1NRKA 4DV3J 1WC1A 1QTNB 3PEJA 2FC0A 1BOTO 1HNZJ 4QR0A 1R31A 4NI2A 4JB8B 3EGVA 4E1NA 1F5BA 4JKFA 4CHZA 3ISNC 1B70B 3OYGA 4C8NA 3CG7A 4DX5A 4WP9A 1S77D 4TVAB 1EHWA 2JRSA 4I0WA 1WG5A 2V68A 2PD1A 3A13A 1T03A 1H6KX 2LVWA 3FRZA 4C1NI 3AJDA 3T6JA 2ATLA 3MR2A 1T3OA 3SDEA 1FRLA 3GFXA 2ITMA 4CZKA 4CGIA 4YOUA 4GKJF 3QJPA 3ZEUB 5ETRA 2QA4S 1XHZA 4CTAB 5KQDA 1IBLF 3DXMA 4ZDNA 2P9KB 1GLBG 3RAXA 3EGZA 2PYJA 4F7VA 4JI2J 2JLGA 3GU0A 3GE9A 4C8MA 2JSXA 3BDPA 2DGVA 3H5SA 4BRDA 5AQZA 2BYCA 4KO0A 2DHGA 1ROFA 2W4CA 2HVZA 1ATSA 4F0MA 2RDJA 2RQKA 4FJJA 1M1KT 2NRRA 2FY8A 4ETZA 5K8OA 1T0TV 5IQ6A 1YTAA 2FBVA 3VVUA 1YHQS 1WF2A 2AJ2A 1F21A 2K7JA 3KLGA 3T9NA 1VQ6S 1LXNA 3VQDA 3TVKA 5B0DA 2DBBA 4I2PB 5CQGA 5KGXA 3AFGA 3VQ4A 3OYKA 1N5YB 5KFWA 1AROP 1U1LA 2HVIA 2ZNYA 3H6EA 1YVNA 1APSA 3B8AX 5IZHA 3MWPA 3W7BA 4JI7K 1H0HB 4K0KK 4UQGA 1O13A 4L75A 3VAIA 2QXLA 2W9BA 4CT8A 3B54A 1KAXA 3ID6A 4B3TF 4A8KA 4N47A 2UUAK 2A0FB 2Y0SD 3I96A 1D5AA 1EZZB 1S1VA 3O4QA 1H7XA 1U4BA 3QWUA 1XMQJ 4HACA 1HQEB 1TKXB 3OBIA 5M1QA 4Z4FA 2KDOA 2MSSA 1S0OA 2H3EB 1KBRA 5GAGI 4LR9A 1RDDA 5B0BA 1S72N 2E5LF 4AHVA 1C0TB 2MMYA 4C8LA 2N3LA 4IO8A 3QLHB 1SV5A 4LFCF 3HK2A 4IO9L 3OPKA 2VPXB 1N5SA 2PO4A 3IA0A 4AXJA 2FTRA 2LXIA 1WC6A 3H45C 2C2RA 1YJ9N 3ZXWA 4Y0FA 4KGZB 4C6AA 3MR6A 4NLCA 3LDOA 1VQ4N 1H3DA 5KFGA 5HLFB 4KGVB 3ZYYX 5KFKA 1Y4ZB 3BP8A 2MJNA 3EO3A 3CD5A 4OPKA 4EYHB 4FJMA 5L9XA 3R8YA 3DU5A 4UTGA 2A1SA 3L0QA 2H65B 4OKEA 2O01C 4NLWA 4FLTA 4DR2K 4IR1A 2VHGA 1WSGA 3G4SS 1ZH5A 3VA3A 3QFUA 4ZP9A 2HFSA 1GEHA 3R2CJ 1W97L 4WKRA 5KFHA 3K5MA 4UY85 1FTCA 3EGWB 5D0HA 4KHSA 3NG8A 4LF6J 4JV5K 1Q86O 3AGKA 1WJ9A 1RBSA 1QZ6A 4URGA 3L2QA 2HBYB 1X4GA 4CFBA 4K4SA 1AXQA 4EP4A 5AQIA 5J2PB 2HF3A 2GUIA 1KONA 2GUPA 2DNZA 2QW9A 5IV4A 2FGOA 1GMVA 2AT1B 2WSEC 1CZ9A 3O9TA 1NSKL 4O5FA 4LSLB 2XTJP 1PC5A 2WFBA 4ED1A 3AD9C 2DCLA 4W5NA 1M1GA 4FWQA 4C3LA 2E9ZA 3CO0P 3CC4S 4U7UD 3KLHA 3TP2A 4HTJA 3Q8YA 4Z4EA 2ADBA 3NAEA 1Q79A 1VSDA 2YWWA 3MEDA 1FE4A 2FXUA 2EKYA 3CCLN 1X3MA 5JVGQ 1MA9B 1VQMS 1FT8A 2AP1A 3BEXA 3ATVA 2BQ3A 3EY1A 1KS2A 3C6UA 1X4EA 1HJRA 2UXBK 2KU7A 2GNKA 1PC4A 4Y2AA 3D2EB 5EWFA 3HT3A 4YOXA 4ZA1A 3NBPB 1NK5A 3Q0AA 1O6XA 1SB6A 4BC5A 2CADA 4FBTA 1R0AA 4DR1F 2XB2D 2RILA 2ALZA 2FHMA 4TYAA 3G2XA 2X51A 3M8QB 2HHHK 1UEUA 4CZMA 1Y3JA 4W98A 5LJWA 4CO2A 2B9XA 4ZVRB 3CJ0A 3M4XA 4LC9B 5HMXA 1R43A 3FZKA 3G96A 3MM9A 3KHYA 3B8HA 2E5GA 2CVEA 3M9OB 2HHXA 1YBTA 4X4VA 2ZOFA 5AJ3K 4IQMA 1LOTB 3CULA 3OR2A 4OPJA 5ADXH 1BIZA 3N5FA 4K4TA 2IVOA 3RR7A 3ZT2A 2EXUA 2XMMA 2HOEA 1LWFA 4FK2A 3U9DA 1EKRA 1S7IA 4Y65A 2VG6A 2Y1LB 3UFCX 1BHLA 4DU3A 2P5GA 3ATUA 5J2NB 1T05B 1IWGA 5DQIA 2J6UA 5B8HA 4LF7J 1X0FA 1U49A 2HBKA 3ZX3A 1S5JA 1T9VA 2RD5C 1K9MT 2CG4A 2QV6A 5JVHQ 5CCMA 5EHHA 1RILA 2XLKA 3NMAA 3HVRA 1Q8BA 2CQBA 3OXGA 1L3SA 1RAJA 2XMUA 2FUG9 2P9PB 4RUCA 4NA2A 2D0OA 2E9TA 1A5WA 4TQSA 1C4AA 1JCFA 2IYIA 4K0KF 4IFVB 4WP8A 2ASJA 3CVKA 4J2BA 1BIUA 3CPWM 3HO1A 4QCLA 3BGLA 1UMJA 2E5HA 3N6MA 2P9LB 3LM9A 4H5VA 2QX0A 1QQOA 3M8ZA 4TU8A 1G7CB 1JLEB 2HNZA 3OTBA 2FHOB 2A40A 4C11B 5DZ6A 3H5UA 4B1WB 1K8AT 4BE2A 4B9UA 3G8SA 3N6LA 1JLQA 4LF9J 5L8RC 4I6MA 3UCZP 3KLEB 1HNVB 3H5XA 4P10A 1GLEG 1YT3A 5AJ3F 2ASDA 5CZVA 4JI5J 1F5CA 3OW2R 5KFZA 1NJWA 3THXB 4J2AA 4DV2K 2B9YA 3IM8A 3UN3A 1U24A 1Y9OA 5KTQA 4GMKA 4TU9A 1TUGB 4AHSA 1J5EK 2CQ0A 2HQCA 5E7OB 4FWMA 2KT5A 4OKKA 2VGMA 3QESA 3AVKA 4KYZA 4A62A 2DNPA 2QFJA 1JLAA 2CG8A 1Q8IA 5KPZA 1IR0A 2NXJA 4FWRA 3HBTA 3JSBA 2CQDA 3RW7A 1WF1A 2FB0A 4CK2A 1F6TA 1YWXA 3AO4A 4F3TA 2JWNA 1IH7A 1JXEA 2UXBF 1HRHA 1G99A 4R8UA 2UUBK 3ZNJ1 5AJ3J 4S0MA 4F9OA 3CC7S 4FWKA 1H73A 1YJNS 2COLA 2RU9A 3V2UC 4CJ7A 1FRKA 3CJTA 1D9DA 3NE6A 3MXMA 4A8MP 1I3AA 4HDHA 3UNGC 5E26A 2UUAJ 2R42A 3W2WB 3HP9A 4M63A 3R6GB 3H2LA 4PYDA 3K2PA 6AT1B 1UAXA 5KT5A 3D68A 2KN4A 2H51B 1R8CA 1DQ8A 4B1UB 1FWLA 4HCBA 4TY9A 2QGFB 3R5DA 1Q5YA 3FBFA 3T6BA 3DLGA 1EJ7L 3IFEA 4L3NA 1FERA 1BWVA 2NNWA 2E66A 3KJVA 2AKWB 3DLLQ 3VAKA 2B6AB 1ZBHA 4KB1A 2QXFA 1GLJO 1WB9A 4JKDA 1KHWA 4HI2A 3PLAA 5B0FA 1E6YA 4A47A 2BJEA 3TWZA 3AY9A 3PW5A 1J53A 3W9IA 3KDOA 1ZBSA 1WDTA 3CCJS 2GHPA 3P5JA 3BSAA 4QAGA 3JQKA 3L09A 4PABA 4M7XA 4HTUA 3TAFA 2VQFJ 1WHXA 1IKXA 3UR3C 1VQON 2KLAA 2PA3A 1S9GB 1EQ0A 1VK0A 1Z26A 1N33J 2O3DA 2DVIA 4CWBA 1SBRA 2D69A 1LXJA 3TA2A 3HSCA 4E7LA 4NA3A 1RTIA 5SUHA 3VEOA 2ZHAA 1YUWA 2BE9B 2OPRA 5AR0A 2EFGA 4EK2A 5K9FA 4P2SA 4WFAL 3BZKA 2LP4A 2OHDA 3UN2A 4OO1J 4FM2A 5I42B 2ZITA 2QA4G 2NRXA 3UB5A 2BVZA 4KQZA 1QHAA 1IJJA 3U1LA 4ISGA 1M1HA 2UXCF 4YDUC 1YRTA 1HNWJ 1U25A 5GIOA 4PAAA 4ES2A 3BZQA 4C0HA 2O4GA 3DLGB 4M3TA 1JMTA 4EU0A 4B3MK 2U2FA 3KLGB 4BR4A 1RT1A 3C66A 5KFSA 2V9WA 2KT3A 5THWA 1RAGB 1P1LA 1AUDA 1FKOB 4DV3K 5C2GA 3ZZ0A 1CS4B 1H98A 8ATCB 4KHYA 4CK1A 1CVJA 2EFOA 1M0SA 1RBAA 1IR1A 1S1XB 3TR8A 3UVJA 3CI5A 3O08A 3QATA 2VF3A 1REVA 1QY7A 4W5RA 4P7VA 3IMQJ 3FC9A 1IR2A 3THVA 1B0TA 1RAOA 1S6QB 2XC9A 4DV1K 1S4FA 4BRIA 3E8OA 1F60B 2UUWA 2ZHBA 1Q4RA 1FFGB 2K7KA 2LA4A 1B9DA 4JUZA 1Y0HA 2WTUA 1YBUA 4X66J 1X4HA 5KRTA 4L3QA 1UA0A 2FLLA 1MROA 4A59A 4HI1A 1QVGM 4J9LA 2GO8A 1GOCA 1XEZA 2HFOA 2W24A 2C3YA 2NSBA 3JQMA 4RW9B 2DR9A 2N4CA 2JOQA 1PIEA 4NLBA 3VF6A 2DHHA 1HMVB 2QLJB 2XMKA 2HGMA 5IT0A 1K1QA 3EICA 4B3RK 1IKVA 2V94A 4NPOA 1CQMA 3OTOF 3UN5A 1BA1A 2W2PP 1RNHA 3LZIA 1RTHA 2HHSA 4KO0B 2RKIB 4CF8A 3J81Y 1QHTA 3BF3A 3SQ1A 2HQGA 5KT6A 2HIYA 4WU3A 3HZGA 2D0CA 4QIFA 4NLGA 1TL1B 3SQ2A 1K9MO 4KREA 4FBUA 3V81B 4KFBB 1EQYA 3QBXA 1HNVA 2P6TA 4J2DA 2EFPA 1C1CA 1H2VZ 1IJFB 2DFEA 4HWIA 3D3CJ 2V51B 1LK5A 4B8AB 3CXCR 3NHGA 4OGEA 1D1UA 4QWAA 4N41A 3DI6A 4CJ4A 3EJMA 2XLJA 4PA1A 2YTCA 3MPDA 2HMIA 4H4KC 2CAJA 3KWIA 4U96A 2A18A 1RKJA 4DTOA 3S8SA 2ASYA 1ZXOA 2FDNA 5RUBA 3PCOB 3TRGA 4UF4A 1ESVA 4WBFA 1SC4B 2XCAA 4DV0F 5KT3A 5T41A 3MTJA 2V2QA 3I4PA 4KB0A 3BO4A 5L1LA 2WUSA 1WF0A 2BJ8A 4PKIA 2VH7A 5AQTA 2P9PA 4A48A 3P3DA 4X2BA 2HHVA 2FF3B 2J8AA 2Y9HA 2ATCB 3FZMA 3R1LA 1TV6A 3DI6B 2E1RA 3P39A 3C14A 4DQ8A 2OEKA 1FO1A 1RHMB 3L2VA 4Y2KA 3EKUA 3SIPB 4DF4A 4K42A 2DGWA 4BRCA 5A2QO 5K14A 3OLBA 2GJ2A 1K0TA 1MWKA 4B9LA 3HHDA 3G6VA 5ETNA 2VG7A 9RUBA 4CLSA 3PO4A 3E9LA 4BY9C 2IVMA 2DFHA 2VG7B 2VA2A 1HBOB 3KK1B 3TARA 3T5LA 1SIZA 4YHHF 4RNNA 4M3XA 1XNRF 4LF5F 5C25B 3J81U 3E1YA 1DKGD 3H20A 2CZ9A 3I9ZA 2MQOA 1SKSA 3HPHA 2IIHA 1Q82T 4BS2A 2BXJA 5KFMA 2KH9A 2V4RA 1NNEA 4L3KA 3SSQA 1TL5A 2X1GA 1N32F 1QS4A 4CGHA 3JYTB 3VGSA 2ZWOA 4DTSA 2A1RA 2DR6A 4OVLA 3N01A 1IXKA 1VFJA 3NH1A 1OMSA 1RYRA 1YF5L 4OX6A 1JJ4A 2RH3A 2R8IA 3OTOK 4UUWA 3D3BJ 4B3RF 3ET6B 1ZZFA 5H1SV 2WVBA 1PKUA 1R6YA 3VAJA 4DCPB 2RKIA 5EGYA 1HMVA 2K2PA 4DSLA 1TVRA 1VQ7S 1SUQA 2CYYA 1I1GA