3C6TA

Crystal structure of hiv reverse transcriptase in complex with inhibitor 14
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
559
structure length
559
Chain Sequence
NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase
publication title The design and synthesis of diaryl ether second generation HIV-1 non-nucleoside reverse transcriptase inhibitors (NNRTIs) with enhanced potency versus key clinical mutations.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 150
structure length 559
sequence length 559
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3c6tA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6tA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6tA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6tA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3c6tA05
3C6UA 4G1QA 1VSKA 4GW6A 1U4BA 3K57A 2AQ4A 3ISND 1XC9A 3GV5B 4DQRA 4KHQA 5KFVA 1BQMB 2JEFA 3E01B 4ZTJA 3T19A 2GV9A 1HQEB 4B08A 3C6UB 2UVVA 4G1QB 1ASUA 4ED6A 3K59A 4JUZA 3KTQA 3VQDA 3KOAA 4CHNA 3RR7A 2KW4A 3NL0A 3M8SA 4KB7A 5DG8A 1K1SA 4N5SA 1NJZA 1SH0A 2DFFA 4I2PA 3N6NA 2UVWA 3I5BA 4C8KA 1KTQA 5HBMA 2GC8A 2BQ3A 4CIEA 1S1TA 2XI2A 3V9XA 5J1EA 4CESA 2E9TA 1HNVB 2Z1HA 3NHGA 4OL8A 2QKKA 5HBMB 3HXMA 4Y34A 1S1TB 3CDEA 4RG8A 5J1EB 4MK7A 5F9NA 2BGGA 3BGRA 4ECZA 1EXQA 1NHUA 2KQ2A 3EY1A 1JLBA 5KG5A 4NLUA 4FS2A 3SCXA 3BGRB 4ICLA 1RBUA 2IBKA 4AH9A 1JIHA 2D3UA 4BWMA 3SFGA 2WONA 3RWUA 3HK2A 2WRMA 3MR5A 1JLBB 1RT4A 4Q44A 1S49A 5J2NA 4FZYA 3HPGA 4ICLB 3ZSOA 3LWMA 3QNOA 1BI4A 2WONB 3KK3B 1HRHA 1WLJA 1DLOA 1LW0A 1S6PA 4F4WA 3CJ4A 5J2NB 2ETJA 3V1OA 3VN5A 1UWBB 3K5NA 4Q45A 4EBCA 3RB6A 1BI4B 1BIZA 3H40A 1S1VA 3OS1A 4FJMA 1LW0B 1S6PB 3O4QA 4CJFA 3CIZA 4IH6A 1W9HA 3AO2A 4WE1B 4M95A 4IRCA 2RN2A 4CJ4A 1S1VB 4KRFA 1S10A 1TKTA 1X1PA 5E41A 2I5JA 3MR2A 3O3FA 4E7JA 1S0MA 1R0AA 5T14A 4FW1A 2DFHA 3NAEA 4M3XA 2HHVA 4M3ZA 1TKTB 3P5JA 4J2BA 3G86A 4FW2A 4B3OA 4YR0A 2X6SA 3LPTA 4OKKA 4ED8A 1HQUA 1R0AB 3GV7B 1BISA 2E9ZA 2LSNA 3OYEA 5DQHA 4Z4GA 4J2EA 3TVKA 5D3GA 1BIUA 2X6NA 2AWZA 2CJQA 5F9LA 4M94A 4B3OB 1NK4A 4ZPDA 2HVHA 4FLWA 4U6PA 3CWJA 5KT5A 1HQUB 4YQWA 4CEQA 4KHWA 4WFYA 3SV3A 2J6TA 4I7FA 4CJ5A 3KHHA 3SI8A 5D3GB 4M3YA 1S6QA 3VQAA 4IRDA 1QS4A 4NLYA 2XWYA 1RDBA 3NF7A 3PR4A 1TL1A 1NK7A 1JLQA 1JXEA 1KFSA 5KFEA 3DLEA 4IG3A 1ASVA 1NJYA 1S6QB 1RBVA 1C0UA 2VG5A 5KRSA 3T3FA 4PY5A 4CGGA 1XR7A 3LPUA 2IOCA 4RW9A 3TABA 3SNNA 3KKSA 4NLSA 4AILC 1TL1B 1JLQB 1KCFA 3L8BA 2HNZA 4QWDA 3VA3A 3K58A 3OS2A 4CK1A 1S0OA 1KHVA 2PYJA 4FCYA 4OKJA 2VG5B 2W9BA 1RT6A 4RW9B 3E51A 3OLAA 2FVRA 4FJGA 4FM1A 2FLPA 4CF8A 5KG7A 2HNZB 5KFGA 3PY8A 3AVGA 4O55A 1U45A 1T05A 4K4VA 4ZHRA 2DY4A 3KD1E 1SL1A 2HAIA 1RT7A 1VSLA 4PQUA 1RDCA 3KLGB 1FKOB 4FJXA 3AVLA 3KIOA 4PWDA 5HRPA 4K4UA 3KJVA 4TXSA 5EU7A 2DPJA 1RT7B 3MEDA 2WHOA 2GIRA 4PQUB 4CECA 3FRZA 3OY9A 1VSIA 4WFZA 4WYWA 3N6LA 3OYKA 3ZSWA 2IM0A 3UR0A 4B9SA 1IH7A 3KK2B 3KJVB 1K6YA 4E7KA 2EHGA 5JUMA 4TLRA 2ZD1A 2YKMB 3HYFA 3MEDB 2B6AB 3KLHA 2XI3A 5KFNA 5KFUA 3CYMA 4MK8A 4DG1A 4F2RA 3UDLA 3PO5A 2OPQA 2W8LA 4OPKA 1NK6A 5KFMA 3UPFA 3TANA 4MH8A 2ZD1B 1VSHA 4OVLA 5L1IA 3ICLA 3KLHB 1NJWA 1ZYQA 4CJEA 5KT7A 4ED0A 1JXBA 5CYMA 4DG1B 4CGJA 3CQ8A 2OPQB 3PZPA 1QAJA 3QLHA 3LANA 3LAKA 4J9LA 3HVTB 4F4XA 4EO8A 2IJFA 1UA0A 4H4OA 3IN5A 3NE6A 4DSKA 3QLHB 4EEYA 4I9LA 4KHUA 2B5JA 4FK4A 1YVUA 3P1GA 4QPXA 1S9FA 1J53A 2J6SA 3JSMA 1A5WA 2D0BA 3MECA 4H4OB 2VWJA 3NAHA 5HRRA 4BE0A 4C8NA 3BJYA 5KFHA 4DLGA 3IGNA 1XWLA 2B5JB 2B43A 4O3OA 4MIAA 2P5OA 3PW5A 2UUTA 2HHUA 1S97A 2V4QA 2O5DA 4NLRA 2D3ZA 4MQ3A 4F3TA 1SKWA 4NLVA 1B9DA 2G8FA 4WXOA 3GV8B 2HNDB 5KFWA 4KHSA 1C1CA 4E7HA 4ZPAA 2QV6A 4I2QA 1KVBA 3VQSA 4QCLA 1IO2A 4O4GA 3V6HA 2R2SA 5F8NA 2P51A 3PJXA 1C1CB 3Q8SB 3ALYA 5DQIA 4I2QB 2BQRA 3QEWA 4JLHA 4AHTA 2X78A 4KPYA 4EP5A 4DL6A 3MAQA 3GQCA 4O4GB 3I0SA 4FVMA 1JLGB 2ZE2A 2VWKA 4W5QA 1WSGA 1S5JA 5KT4A 4KO0A 4TQSA 4U7CA 4Y2CA 4RNNA 4O0IA 3I0SB 1HYVA 3THVA 4ID1A 4QWBA 3L3VA 4NRUA 2AGOA 1S9EA 4HUEA 1BHLA 1BGXT 2AGPA 4E1NA 4DMNA 4KO0B 4ZP8A 4CHZA 4O4RA 5JXSA 3GIIA 1WSJA 4B9NA 4B9LA 5CZ2A 1TL3A 2R8HA 4F2SA 5KFTA 4QW8A 2Z1GA 3HPHA 1TK8A 2BR0A 1S9EB 2F8TA 1D8YA 4CJUA 5KFYA 3H08A 3FDSA 4WZMA 1VRUA 4R8UA 3PV8A 1TL3B 1RTDA 3DRSA 4TYBA 4RUCA 4ZVFA 3NAIA 4CFDA 2F8EX 4ZVHA 3AVNA 3KLFB 5KFLA 1NOYA 3MXIA 5EDWA 4E89A 1VRUB 4R8UB 3MEGA 2OA8A 1RTDB 2FBXA 4GVMA 2HWHA 5KTQA 4DS5A 3DRSB 3V1QA 3RBDA 3OYNA 4O3PA 3DOKB 4F50A 3TAFA 3MFIA 4KI4A 2EX3A 1IKVA 2W7PA 4FM0A 1JLFA 4ECTA 4CJQA 5KFKA 1HARA 4URQU 5DLGA 2XY6A 1TKZA 4CJVA 4FJIA 4Z4EA 4GMJB 4JV1A 3TAMA 1BCMA 1LAVA 1Z4UA 1IKVB 1RYSA 1ZBLA 1JLFB 3KNAA 4WYLA 1RT2A 4KTQA 4CJRA 5FROA 1S1UA 1TKZB 4E19A 4YR3A 3TAMB 5DLFA 3NFAA 2YNIA 3SJJA 3SI6A 5DGAA 4NCBA 2HHQA 3AVKA 4GC6A 2A1SA 1LV5A 2RDJA 2IGIA 1S1UB 1BQMA 2YNIB 3NCIA 4DTOA 4G3IA 3BQ2A 1A5VA 1RILA 1NHVA 3QGHA 2UVUA 1VSMA 4ZP6A 1UOCA 1RBSA 5KGWA 1NJXA 1SUQB 3OVNA 1ITGA 3F73A 3RB4A 4DL4A 5DK5A 3V81A 2JC0A 1VK0A 1JXLA 2IS3A 4CJSA 2G8WA 3V1RA 1L5UA 3BREA 2IMWP 1HNVA 2HHXA 3V9WA 1QSLA 4URSA 4Y1CA 4Z4FA 4DFPA 3V81B 4WFXA 5KG1A 3AA5X 1T3NA 3RR8A 4F3OA 3WNHA 4FLYA 3PW4A 3MTKA 3SZ2A 4O3NA 4IH5A 4K4SA 4IBNA 3MXMA 3NF9A 2R8KA 2BE2A 4DEZA 4FBUA 1Y97A 3CG7A 2HHTA 1S48A 4HUFA 2CKWA 3C95A 1D1UA 3H4BA 4NYZA 4DTXA 4FJKA 2E6LA 1SH3A 3ZSZA 4IKAA 3PX6A 5JS1A 3GIKA 4NYNA 2BE2B 1VSEA 3KLIA 1NKCA 3IAYA 4J9RA 3D5MA 3ZSXA 4IKFA 3FFIA 4BE2A 1C1BA 2IM2A 1LWCA 4LH4A 3KK3A 4J9MA 3M9OB 3KLIB 5L9XA 3MEEB 4AHCA 4NYFA 1N5YA 4TY9A 1FKPA 1UWBA 3FFIB 1L3SA 4AHRA 1C1BB 1W25A 1KVCA 1LWCB 4O3SA 4YMEA 2KTQA 4FLUA 3ASMA 4KE5A 4O3QA 1N5YB 3DLRA 3VQQA 3DRPA 4WE1A 3I8DA 1FKPB 1UA1A 5T7BA 4ZMMA 3HJFA 2JEJA 1ZTTA 5JS2A 2XRIA 4BDZA 4FJLA 5KFCA 3GILA 3AO3A 3DRPB 4DFMA 3EZUA 1RA6A 3D0PA 1C6VA 4M3UA 4BE1A 3OYDA 4M3RA 4C8LA 3OYGA 4CE9A 4CEFA 2WCXA 2XC9A 1KHWA 3IGVA 1KLMA 5KG4A 4IG0A 4B9TA 1CXQA 1QTMA 3QZ7A 4DTNA 2YKNA 1I3AA 2GIQA 3CFOA 1KLMB 3WNEA 5KG0A 2P1JA 4LH5A 4IG0B 4FLZA 1NK8A 1ASWA 2OZMA 3I0RB 4MIBA 3SQ4A 3I5AA 4FJHA 3K2PA 2JEIA 1DTQA 5F8MA 1JLCA 2FVPA 2YKNB 4FLTA 3OHBA 4FJJA 4N41A 3NH1A 4M41A 4C8OA 3KKRA 4DTMA 1B92A 2YHBA 4QWEA 3PW2A 3DI6A 4B9UA 1VSFA 2YV0X 2KFZA 1DTQB 1JLCB 1I39A 4Z4CA 3V9SA 1RCHA 4O0JA 1NK0A 1W0HA 3F9KA 4CCHA 3C94A 2ATLA 4OGCA 1C1AA 3DI6B 1WSIA 1KRPA 2ASLA 4ZP7A 1TAQA 3QETA 3VQ8A 5C24A 1YVFA 4OGEA 5KT3A 4ID5B 1Q8IA 2Y1IA 2YNGA 3GYNA 2VA2A 4IR9A 3QERA 1JL1A 2BRLA 4DSEA 1FK9A 4RW7A 4Q8EA 1ZBFA 1CXUA 5KGXA 1S9GA 3QNNA 2OH2A 2W8KA 4K4YA 4ECYA 1J9AA 5C24B 4O3RA 2W9CA 4KREA 3QINA 3PJWA 5F8LA 5C42A 1YTAA 5FRMA 1GX5A 2YNGB 1WAFA 4HVJA 3H5SA 4URGA 3KLGA 1FKOA 5DG7A 4N47A 3O3HA 1BQNA 1FK9B 4RW7B 1S9GB 4DF4A 2W9CB 1HMVA 4J2DA 5C42B 4CHYA 1Z26A 3AVJA 3V9UA 3ISNC 3LZIA 4DTRA 1BQNB 4IFVA 2A1RA 4DS4A 4BACA 3KK2A 4CEEA 1XR5A 4JV2A 3PX0A 3DLKA 2RKIA 2YKMA 5F8HA 3HHKA 1HMVB 3OLBA 2B6AA 1TV6A 2XY8A 1Q9YA 5KFSA 5HRSA 3NKYA 2E6MA 4CK2A 4KTWA 1T8EA 3OYMA 4IFVB 3HL8A 3SPYA 5SZTA 3TI0A 4FZZA 3T1AA 2FJWA 2D0AA 4IRKA 3DLKB 2RKIB 3VQPA 4ECVA 2WOMA 3HP9A 3HPOA 1XHZA 1TV6B 5CY4A 5KRTA 4DSLA 3BR9A 2XY7A 1S4FA 3DOLA 3G6YA 3OYCA 4E1MA 3TAPA 1SL0A 4FM2A 3AO5A 3HVTA 5EWEA 2UUWA 2WOMB 4CJ3A 1QAIA 1EKEA 4KHRA 3BQ0A 3AVBA 4KFBA 3H2LA 3TAEA 3G6XA 3U6FA 3DOLB 5KG3A 2QKBA 2YNFA 4DL2A 2R7YA 4FLXA 4M3TA 3BSOA 2IM3A 3I5CA 3SUOA 4EBDA 4AHSA 3T5JA 3VA0A 4KFBB 3AVMA 3ZT1A 1LAWA 4KI6A 1J54A 1RT3A 2YNFB 1IG9A 3RAQA 4IDKA 2HMIA 4CGDA 4X2BA 1CZ9A 5KFJA 3RAXA 2WB4A 1U47A 1FXXA 1GOCA 2C2RA 1L3UA 3BDPA 4J2AA 1RT3B 4DWIA 3QGIA 1T03B 2HNDA 4PA1A 3DRRA 4IDKB 1RT1A 2HMIB 2XCPA 1L3TA 3V6JA 2HB5A 4H54A 2JC1A 2BANA 5FRNA 4M45A 1S1WA 1JLAB 5C25A 1MMLA 4F4KA 4ED1A 3TQ1A 3HO1A 3DRRB 5KT6A 2OPPA 1RT1B 3MR3A 4ECUA 3CDUA 4JV0A 1NK9A 3RB0A 2VG6A 1XR6A 2BANB 3KLVA 2PY5A 2XO7A 3H98A 4C8MA 1S1WB 5C25B 3DM2A 1JLGA 3ZSVA 2OPPB 3LP2A 3ITHA 2HHWA 1RBRA 4CF1A 2VG6B 4CEBA 2HVIA 3PUFA 4LSNB 1Z25A 3DM2B 1U09A 3TARA 2YHAA 5KFPA 1NKBA 3PVXA 4TYAA 4B9MA 3LP2B 3ITHB 3OYAA 3OYHA 1I6JA 4LQ3A 3T5LA 4DU4A 3C6TA 1HJRA 3PW0A 1SL2A 3CVKA 4CFBA 4MFBA 3K5OA 4CFCA 3NH2A 3NGZA 4EZ9A 2KFNA 2AX0A 4RNFA 1JX4A 2UVRA 1K1QA 4ZVEA 2FBVA 2IDOA 4BWJA 4F4ZA 2IJNA 3CO9A 3KK1A 3S9HA 3ZCMA 3C6TB 4NRTA 3RMAA 4FK0A 4AHUA 4EP4A 4MFBB 1TGOA 4FLVA 4DL5A 4IR1A 2D7SA 4QAGA 3HSTB 3KLFA 4M3WA 3L2QA 3KK1B 4WZQA 4YP3A 4ZPCA 3CFPA 2WK4A 3A2FA 4K8XA 3DOKA 4ECQA 5KFOA 2YNHA 4ED2A 3VQ9A 1WNEA 3SUQA 2R8GA 4RUAA 2C28A 4EZ6A 1TK0A 2G8KA 4HCCA 4J9NA 1ZBUA 3KD5E 4KKOA 1WSFA 4ELUA 3KLEA 3CJ5A 3CJ0A 3PR5B 5HP1A 4KAZA 1QUVA 2YNHB 5I3UA 3RTVA 4DU1A 5KT2A 2X74A 1LW2A 4XIUA 4QWAA 4KKOB 3LALA 4CF0A 4HUGA 3KLEB 2IA6A 4WXWA 5KG2A 1GOBA 5C5JA 3S3MA 5HP1B 2C2DA 5I3UB 3OL9A 2KZZA 4IQXA 1RDAA 4Y1DA 3HM9A 5EWFA 1LW2B 4CF9A 2Z1IA 2E4LA 2NUBA 4HHTA 1D5AA 3LAMA 3BSAA 2ZQBA 1RDDA 2FBYA 4CEZA 2AGQA 3NBPA 1D0EA 1VRTA 2QK9A 4KV8A 1NOZA 2ILYA 3Q8PB 2FVCA 4E7IA 1NKEA 1SUQA 3U3YA 3NBPB 3MR6A 1VRTB 4KV8B 1TQLA 4NCGA 2F96A 1TKXA 3DLBA 4K50A 3B6PA 1ZETA 3WNGA 2E9RX 4H4MB 4DTUA 1Q9XA 3NF6A 1SKSA 2ITGA 2G8VA 4NCGB 2BDPA 3H5XA 1TKXB 5J2QB 2G8UA 4JS4A 5CZ1A 2I1RA 4DQPA 2RF2A 3AA4A 4GC7A 3HKWA 3ZSQA 1RTIA 3DLHA 4DQQA 4DTJA 1GX6A 4K8ZA 4CJLA 1N4LA 2RF2B 3DMJA 4KHNA 1HYZA 3SQ2A 3LZJA 3AO4A 1OS5A 1RTIB 1RT5A 3NGDA 3KHGA 4Z0UA 3HVAA 3TR8A 2JGUA 1YTUA 5SWMA 1WN7A 3DMJB 4DSJA 3RRHA 4RNMA 4CJPA 3S3NA 1RT5B 2FLLA 1DTTA 4I2PB 1C0TA 3NGIA 1ZTWA 3N6MA 2ATQA 4EO6A 4KSEB 3CJ3A 4CIGA 1RTHA 3AVAA 3SV4A 3MEEA 4QW9A 2WTFA 3PHEA 4B9VA 4KHMA 3QEVA 2R2UA 3CFRA 1DTTB 4B8AB 4KB0A 1C0TB 2DFEA 4ED7A 4FJ5A 1IKYA 4E0DA 4CEDA 4K4XA 3K5MA 3VQ4A 1RTHB 4HTUA 1CSJA 1KLNA 4KTZA 3VQCA 3NMAA 3DYAA 4L8RB 1QHTA 3OJSA 3QEXA 1IKYB 2AU0A 1EX4A 3CJ2A 3LP1A 3H59A 4RW6A 5I42A 3FSIA 4DQSA 4DLEA 2OPSA 4FK2A 5F8JA 3DYAB 4XPCA 3O4NA 4CK3A 3ULDA 2R2TA 1JKHA 3LP1B 4CHQA 3SYZA 5KFAA 2FJVA 5KI6A 4HKQA 4CEAA 4HCBA 4RW6B 1O1WA 1RT4B 1N48A 5I42B 3UIQA 1N56A 3HVWA 3ZT0A 2OPSB 4FS1A 2PZSA 4KB1A 3WNFA 1JKHB 3M9NB 1NK5A 3OL8A 1RAJA 1DLOB 3TWHA 4K4TA 5DG9A 4MK9A 5KFZA 4OKEA 2W42A 5EUHA 5F8GA 2Q3SA 2FBTA 3UQSA 1QQCA 2RDIA 4QWCA 3L3UA 2G8HA 5DQGA 3I0RA 1SH2A 1NNDA 4Z4HA 4ZVGA 3L2RA 2FVSA 4OLBA 4IH7A 3QO9A 5J2MA 3AO1A 3LDSA 2GBZA 4M42A 3B6OA 4R0EA 3Q8RB 4YFUA 1HNIA 4CGHA 4ZTFA 3RBEA 2FVQA 4XPEA 1REVA 3NDKA 4IOBA 5CYQA 2VG7A 1L3VA 3OYFA 3QO9B 5J2MB 4LQ9A 2I5JB 3IRXA 1T94A 4NLGA 4CFAA 4BDPA 3RB3A 1QSYA 1HNIB 2O4IA 3L2UA 1J5OA 4Q8FA 4K4ZA 4F4YA 3TAGA 1REVB 3M8QA 5CYQB 2VG7B 5KG6A 2IAJA 4RW8A 4FXDA 3IRXB 3Q8QB 3ZT3A 4F8RA 3IS9A 2JLEA 4ID5A 3AA3A 1ZBIA 1J5OB 3LP0A 5KFFA 4LD0A 3M8QB 3OL6A 4TSXA 1EP4A 3VQ7A 2IAJB 1YT3A 1C0MA 2DTUA 4J9PA 4RW8B 3M8PA 3KHLA 4DQIA 3IS9B 4R5PA 4J9OA 3OYIA 3LP0B 2QXFA 4I9QA 5K14A 4CJKA 1EP4B 2HW3A 4I7FB 3V9ZA 5KFXA 4OJRA 2D5RA 3QYYA 2QE5A 3M8PB 3U3GA 4DL3A 4R5PB 4NCAA 5HROA 1QSSA 5DGBA 5K14B 2R8JA 3DLEB 4IG3B 3OSNA 3QESA 1C0UB 2BQUA 4KHYA 3VQ6A 5F8IA 5HROB 1RA7A 3AVHA 3IG1A 4LSLA 1QE1A 2V0NA 1IKXA 1C2PA 1RDRA 3AVIA 3V6KA 2VA3A 3M9MB 2Y1JA 1XI1A 4ELTA 2ALZA 2W9BB 1RT6B 4Y2AA 2B4JA 3QIDA 4Y3CA 3LP3A 1X9SA 3IG1B 4LSLB 1QE1B 1VSJA 4J9QA 3EZ5A 1IKXB 1CZBA 4Z4IA 3MFHA 1WAJA 5J2PA 1T05B 3KHRA 4ZHRB 2HWIA 4EBEA 3GIJA 1BCOA 4FBTA 3MXJA 4NLPA 3FQKA 2AJQA 4NLOA 4DU3A 4NZ0A 4Q0BA 1WNSA 5J2PB 4PWDB 3SUPA 3EPGA 4CJWA 4Q0BB 4ECXA 3AA2A 3V4IA 3H5UA 4W5TA 1CLQA 2W7OA 1TKDA 3H5YA 1A5XA 4UQGA 4TN2A 3RMDA 4FJ8A 3OYBA 3ZT4A 5KFQA 2P5GA 2ILZA 1WSHA 3V4IB 2D41A 3G0ZA 1N6QA 1T03A 2FJXA 3CM5A 4YNQA 5EWGA 1WSEA 1VSDA 4J9KA 4DL7A 3D28A 4NLTA 3G6VA 1U04A 5CYMB 1JLAA 1N6QB 1IM4A 4E7LA 1SV5A 4CGFA 3CM6A 1SKRA 4OLAA 3H4DA 4NLQA 4CHOA 1X9WA 2XY5A 4RU9A 3OYLA 3AVCA 5FDLA 5L1JA 3CDWA 4CGIA 3BSNA 1EETA 4N76A 1SV5B 3OHAA 4Q43A 5L1KA 3HP6A 2OZSA 1U49A 4FJNA 1RBTA 2Z1JA 3SPZA 2XGQA 3RMBA 3S3OA 5KFIA 3JSMB 4H8KA 3KMSA 4BDYA 5FDLB 3SUNA 3GIMA 3HT3A 2D0CA 4E3SA 4TY8A 3MECB 4LSNA 1LWFA 1ZBHA 4W5RA 1EETB 3P83D 4CIFA 3EYZA 1XHXA 3QEPA 1S1XA 3TAQA 2IC3A 4K4WA 2G8IA 1D9DA 4JS5A 4DF8A 4XO0A 4TY8B 1LWFB 5DMRA 3QIOA 1JL2A 2IM1A 2ASJA 1RYRA 1S1XB 2IC3B 3SQ0A 4MKAA 4AHVA 3OL7A 4DFKA 4FJ7A 4ECWA 4ECSA 2ASDA 3O3GA 4Q5VA 4EYHB 2KZMA 5L1LA 2XHBA 4B8CA 2XGPA 2R8IA 3KMQA 2J6UA 3VQBA 1KSPA 2ZKUA 1B9FA 5HLFA 2FC0A 1F21A 3ZT2A 2HHSA 4ZPBA 5HRNA 1HYSA 5KFRA 1JLEA 3G10A 2ZE2B 4ED3A 1BL3A 4W5NA 3QEIA 2XCAA 4O44A 5HLFB 1U48A 2V4RA 1LWEA 4MKBA 2C2EA 2OPRA 1HYSB 1KVAA 4DTSA 1JLEB 1TP7A 1KFDA 4CF2A 2EC0A 4J9SA 3NF8A 3DDKA 3L2WA 3D45A 4W5OA 3HVRA 4O44B 1LWEB 4JRPA 4CJTA 3DLGA 4RNHA 2OPRB 4ZP9A 3BSCA 3QZ8A 1HPZA 3FQLA 4HYKA 4O5BA 4ECRA 3EPIA 3OSPA 3RRGA 1TVRA 1TK5A 3VQ5A 4RZRA 3M8RA 1IKWA 4RW4A 3DLGB 4DSIA 1HPZB 3K5LA 2PYLA 1TVRB 4KBIA 2DPIA 3ZSRA 3OS0A 1D9FA 4KAIA 1IKWB 4RW4B 1S0NA 4TQRA 1RTJA 2HNYA 2GUIA 3LWLA 2OYQA 1G15A 4YR2A 4DSFA 3PX4A 4RNOA 2RPIA 3BQ1A 3MF5A 4ELVA 2R2RA 4PUOA 3AVFA 4CEOA 3MEGB 3T5HA 3VQEA 3PO4A 3V6DA 1TAUA 4FJ9A 4CHPA 2V9WA 1RTJB 4NLXA 3PW7A 2AX1A 2HNYB 2BRKA 3OYJA 4N56A 4DFJA 1MU2A 2F8SA 4OPJA 4NLDA 4EYIB 1T7PA 3SFUA 4DTPA 3RMCA 3SQ1A 4PUOB 4FZXC 4IFYA 3V6DB 5KFDA 4FYDA 3AV9A 1UAXA 4CERA 2C22A 1MU2B 4QOZB 3JYTA 4H4MA 3ZSYA 3NGYA 3QIPA 3QGGA 4IFYB 4NLWA 5J2QA 2O4GA 3L2VA 1RT2B 1RNHA 3NH0A 3T5KA 1GOAA 2W9AA 3OJUA 4JRQA 3JYTB 5KFBA 4LY7A 3E01A 2JEGA 1X9MA 2FLNA 3QIPB 1HQEA
chains in the Genus database with same CATH superfamily
1ZS6A 2B7CB 1R43A 2F7VA 1GFWB 1U4BA 3K57A 1VJQA 2CUYA 1XC9A 4M5GA 3GV5B 4DQRA 1W7AA 5GAEP 2CA9A 3NMUA 1FERA 3FEZA 1BQMB 2JEFA 1HJOA 3R8YA 3E01B 4QIFA 3MM8B 4B08A 3C6UB 4G1QB 3MTJA 5L38A 1OO0B 3KOAA 3AQPA 3NL0A 4KB7A 5DG8A 3PEJA 3AODA 1K1SA 4C3LA 1QQMA 2DFFA 1M1KT 3LDNA 5F1XA 4FDFA 1BA0A 3DXKB 4W4MA 1L3KA 2GC8A 2DNOA 2BJDA 4M5JA 1VC5A 5CHIA 2C42A 1U6ZA 1S1TA 3BB5A 3V9XA 5J1EA 1S79A 3R8EA 3CMAS 2OD4A 2KH9A 3GCWP 1DEJA 2QKKA 5HBMB 3W65A 4CLUA 1FNOA 4CT8A 1CS4A 4Y34A 4PG6A 2EEYA 3J7AP 1NMDA 3CCTA 5F9NA 3TUZC 1HNZJ 1NJIO 3M30B 1EXQA 2ZJQL 3U02A 2V2ZA 3CCJN 1K9MT 1U1MA 5M2UA 4NLUA 1HNXF 2R7UA 1RBUA 2IBKA 4QJVA 1JIHA 4ZPTR 3RWUA 5DZ7A 2KT2A 3MMJA 4HI1A 3FVYA 1W2BR 1JJ4A 2NLWA 1MNEA 4Q44A 1VR6A 3E9PA 1TR0A 2UXCF 4ICLB 1BI4A 4PYAA 4GKKK 4XTTA 1DLOA 1LW0A 1S6PA 3BZCA 3C16A 4F4WA 1V3SA 1YZ7A 2Z8QA 2NRRA 3V1OA 4OJHA 8AT1B 1UWBB 3K5NA 4JEPA 2EFNA 3DOMB 1IBMK 4B3MJ 3OS1A 2HF3A 2YKPA 1T02A 3O4QA 4QBUA 4OI0A 4O23A 5F0UA 4DR3F 3U1NA 2H65B 3ZFVA 3AO2A 3AAQA 4IRCA 5EN1A 2KN4A 2MY8A 2RN2A 5GMDA 3GR0A 1S1VB 1H7WA 3AFGA 3MZIA 5ADZA 2ACMA 1CG2A 2YWHA 2HBMA 3MR2A 1VISA 2NXJA 5LJWA 2RNEA 2RHQB 1R6VA 3NAEA 3JAMY 3TA2A 4P2MA 4M3XA 3K17A 1Z1ZA 3J7YI 4M3ZA 2J0WA 1IVZA 3P5JA 4NPOA 5CH7B 4LFCK 1XBWA 4B3OA 2AF6A 4OKKA 3ZTPA 1HQUA 2D74B 3MCNA 4ALZA 1G2EA 3ENOA 2ZBIA 5D3GA 1BIUA 2CJQA 1CBKA 2HVHA 2Z2YB 3M8ZA 3QPIA 1MMNA 4YQWA 4CEQA 2KLAA 4DUZK 2ZNYA 4WFYA 1IJEB 2DGTA 4I7FA 2BUPA 3NOGA 3W3SA 1U26A 2V2KA 2I8EA 3VQAA 1N54B 3EWGA 2COLA 2OTLN 4NLYA 4X62F 2ZJPL 1SC3B 2BM0A 3NF7A 1JCFA 1KFSA 2FHOB 3C65A 2Q6BA 3L0QA 3TVZA 1K8KB 4DPYA 3DLEA 4IG3A 1ASVA 1NJYA 2HS3A 4P52A 2VG5A 1XR7A 4RW9A 3SNNA 2QWOA 2V6AA 3CCVS 2ACYA 1EWQA 4B3SJ 2HNZA 4WCEL 3K58A 4U96A 4CK1A 3FNNA 3EM1A 3G2XA 4LFBK 2ZH8A 3FMBA 3OLAA 4TNOA 4FJGA 3KYLA 4FM1A 1JXVA 2FLPA 5KG7A 2E1AA 3NVKA 2CPJA 3PY8A 3IR6B 4RCHA 5B0BA 1SL1A 3MM5A 3SCLE 3LPEA 3OTDA 3O9UA 1VSLA 1D3WA 3GBTA 1T0TV 4FJXA 3KIOA 4PWDA 2UUCF 5EU7A 4YN3B 2DPJA 3MCOA 1RT7B 1HW8A 2GIRA 1VSIA 4WFZA 2A41A 1QQNA 6FD1A 2HKEA 3KJVB 1K6YA 3ZX3A 3CJAA 2EHGA 2HS4A 2EG1A 2ZD1A 2M7SA 2XI3A 1FFGB 1VQ4S 2YHWA 4F2RA 3BDEA 3CW2C 2N7YA 3MMCA 2KHDA 3TANA 1UPMB 4OVLA 1VDHA 1ZYQA 1JXBA 3J7YP 3NGTA 2RS2A 2XO6A 1KN6A 3POTB 1BMQB 3A8IA 3HSCA 1H1VA 3HHLB 3GZ7A 3S6EA 5JVHQ 1FVSA 3CQYA 3NGUA 2QFJA 3NE6A 1T11A 1S4EA 4FO0A 3BYRA 3QLHB 2UU9K 2B5JA 1ZOTA 5IFMA 4QPXA 2J6SA 1SJFA 1JWWA 3CCJS 1VC0A 4H4OB 2VWJA 2KB2A 4FF1A 5AQNA 3SCKE 3IUCA 4LJMA 4O3OA 1NDLA 1TYQB 4Y65A 2UUTA 2HHUA 2O5DA 4B02A 1AZSB 4AE5A 2V52B 4LT6A 3CD5A 2GA7A 3JQJA 4L73A 4NLVA 1SKWA 2MKKA 4WXOA 1NZ8A 3GV8B 4GV6A 2NRWA 4ILRA 1FI4A 3CSKA 1WC1A 1C1CA 3BZQA 4YS2A 5BPNA 3DNCA 1IO2A 2H48B 2HZVA 2CPZA 4LF5J 5F8NA 1Q79A 3PJXA 1WF2A 3Q8SB 4RTFD 2BQRA 3QEWA 1NGFA 4AHTA 2J7WA 3SBGA 2PE8A 1IBLJ 4EIAA 4O4GB 3NGKA 3PG9A 4TKTA 2R7SA 1OSDA 1DAXA 2FGOA 1S5JA 5KT4A 2C3PA 4L3KA 4WJBA 4O0IA 3I0SB 2HS0A 2K7JA 2DGVA 3AD8C 4ID1A 4NRUA 3WUHA 2V2VA 2PFDA 4X4RA 4B9LA 1TL3A 2XZDB 3AY0A 2FC9A 1HBOB 1SJQA 2HFZA 4M5IA 2Z1GA 1TK8A 3HPHA 1TELA 1ZAWA 1DRZA 4LF7F 2XMAA 3O6QA 1CJUB 3DRSA 5C2FA 1O8BA 1FT8A 4RUCA 3Q89A 2F8EX 4AF1A 3D1HA 3HSZA 3AVNA 3O3LA 1NOYA 2OTLS 3N4PA 1U0SA 2OA8A 1RTDB 2DCLA 5KTQA 1RBOB 3G8SA 3C2PA 5T7LA 4WU3A 1VQ5N 2UUBF 5F0XA 4KI4A 3UI3A 2EX3A 1EARA 2BOPA 1Y00A 1FD2A 2W7PA 4JD2A 3V4MA 4CJQA 1UMJA 1RHQB 3HKZD 1VQ9S 5DLGA 3LPYA 3C14A 4CZEA 3TAMA 1BCMA 1EJ7L 3GIRA 1HNXK 2CDQA 1IKVB 5K8NA 4HLBA 1JLFB 3CCZA 4WYLA 1NLVA 3CCWA 4OHYA 4JI2F 3LDPA 5FROA 2JX2A 4E19A 3TOQA 2V63A 3MOZA 1LWXA 3SJJA 2UXCK 2AJ0A 3SI6A 3ZXWA 4NMLA 3WZ0A 1O51A 2A1SA 4JKAA 3DXBA 1BU6O 3OW2R 4ZIWA 1CJTB 3EKSA 2Z57B 4WFNL 1I3OB 1RILA 3QGHA 4ZA1A 3AHPA 4ES1A 1NJXA 1S6UA 3OVNA 4EHUA 1FEEA 3IAS9 2ZITA 4LRFA 1OYEA 4DL4A 4BRGA 4I56A 2HK2A 1Q81O 5IT9U 2DGOA 2VQFF 5JVGQ 5BN8A 3TWZA 1HNVA 5A2QU 1VJWA 3ET6A 3V9WA 3V81B 1K9MO 2KG0A 2O8FB 5KG1A 1GLBG 3GE9A 3EXYA 3RR8A 2WW4A 4NWBA 4F3OA 1VBZA 3WNHA 3N4WA 1ZM4A 3PW4A 1VYAA 3SZ2A 7FD1A 2RUGA 1RQ0A 3MXMA 1E3MA 2R8KA 1A6LA 5DDQC 3CG7A 4YOUA 4DHYA 1S48A 4QOTA 1N32J 3C95A 4NYZA 1YRTA 4FJKA 3JQKA 2FJAB 4NYNA 3HHNB 2RU9A 3Q7BA 2FSKA 3OUYA 3ZSXA 3FFIA 2IM2A 3KK3A 3T1HF 2GWKA 3MM7A 4ILGB 3G6EN 3MEEB 2E5JA 4DV6J 1XMBA 5HL7L 4JKCA 1WHWA 4ZCKA 2WSEC 1GLAG 4AHRA 1W25A 4ZVPB 4YMEA 4KE5A 2V50A 2R7TA 2VH7A 4OZ1A 1VQON 3HI9A 2NZ4A 1UA1A 3L7PA 3HJFA 3I33A 2RRAA 4Z7CA 5LT5A 3PRVA 2NRXA 3GILA 1YITN 5D15A 1RA6A 3ZNUA 4UOHA 1C6VA 4M3UA 4LBPA 2AJ1A 4C8LA 4C7QA 2X51A 3NNAA 3OYGA 5E3AA 3K5PA 4CE9A 3FZMA 1UEKA 4CEFA 2P9PA 4WTOB 1KLMA 2JLFA 5KG4A 5AQTA 2MQNA 4IG0A 1GH8A 1APSA 3NNHA 4E1JA 1CXQA 3PCOB 1WC0A 2GHVC 1I3AA 3CMEN 1AA1B 2GMLA 3WNEA 1WELA 5KG0A 2P1JA 5A8RB 4FLZA 5HMZA 2W01A 1VFJA 4CDIA 2JFDA 3I5AA 4ZPWR 4Y0WA 5F8MA 1JLCA 1F2HA 2CQIA 4N41A 2R7WA 3JSRA 1IUJA 4DTMA 4LF4F 4QWEA 2QWRA 2KFZA 4DV3K 3LQVA 2LDIA 3VERA 3X1LB 4PKHA 2X1BA 4OI4A 3WC0A 1VQ5S 3C94A 2OP5A 1C1AA 3VEXA 3CJKB 3SQOP 3DI6B 1TAQA 3VQ8A 2ZH9A 1G99A 1F60B 4ID5B 4QR0A 2RAQA 1UP1A 4IR9A 4I4BA 5CZXA 1JJHA 5DJBA 4RW7A 2PN6A 2HFOA 3QNNA 5DM6L 3I87A 4K4YA 1Q82T 5C24B 2W9CA 3QINA 2YNGB 1HLWA 4WK3A 3WC2A 2D3O1 3O3HA 1FK9B 1KQFB 2A3JA 3OFFA 2P6SA 1HMVA 5C42B 4CHYA 1Z26A 5DM7L 1T9TA 3ISNC 3CXCR 1QZ5A 3LZIA 2LQ9A 3AAWB 2L9DA 3DLKA 2RKIA 1Q5YA 3OVSA 4QS7A 2DH9A 2KJWA 1TV6A 4PG4A 2VBYA 3JAMU 4KTWA 3OYMA 3K9JA 4AL7A 3KUHA 1WTFA 4MO5A 1XHZA 2FHMA 2P9KB 2XWXA 4HWIA 4WWSA 2G0CA 2KFYA 2H4WB 4K0KF 3BKUA 3G6YA 2E1ZA 3TAPA 1VQ6S 4LF1A 3AO5A 4WTYA 2DXEA 2YH1A 4JYAJ 4C23A 5GIOA 1WEZA 3U6FA 5AQKA 4DV0F 2QKBA 2E5HA 1F3VA 4DL2A 4M3TA 2V8VA 2XM3A 4EBDA 1VQ7S 3CC4N 3I96A 1WWHA 2VICA 1MWQA 3EDQB 4LF7K 1NPRA 2YHXA 1WF0A 1TUGB 1J54A 2VC0A 1RT3A 2LU1A 4EUVA 2LU2A 4X2BA 3ULEA 4MMOA 2CNLB 1RAIB 4CT9A 2XS5A 1U47A 1RXOB 5A8KB 1KC8T 3KUGA 1FJCA 2OUGA 5BRFA 2DH7A 5CABA 5D0GA 4PA1A 4IDKB 2HB5A 5KOXA 3G6ES 1MSWD 2GHWA 2UUBK 3QMLA 1BQXA 1BOTO 4DR5F 4KGZB 4U8VA 1QD1A 3TQ1A 3DRRB 5BJRA 3R6LB 2UP1A 2ZUGA 3CTRA 3K2YA 1NK9A 2PGCA 3SDEB 1RSCA 3TX8A 4DV1K 1XR6A 4DR2J 4OYWA 4X84A 2XO7A 3QQCD 4K5RA 4C8MA 2LEAA 3DM2A 4F0KA 3MD1A 3VVTA 2OPPB 1WHYA 5IT9O 1NSPA 2HHWA 1RBRA 4CF1A 2P2CB 1ATRA 2VG6B 2Z2LA 3ZZTA 1DURA 1YITS 4JKGA 3PUFA 2H9ZA 3QT7A 5A2QO 2GHPA 5FLXO 3W3DA 1QTNB 3PVXA 4TYAA 3ITHB 3TTCA 1KXPA 4C4WA 4BHQA 4NASA 1S12A 1UVJA 5FPDA 4OYMA 2CVEA 1HKCA 3ATVA 1HJRA 3PW0A 3D4JA 2UV8A 2MLZA 2IJRA 3CMES 1XTZA 3CO9A 3DWLA 3KK1A 1VC6A 2R3VA 4NRTA 1NWKA 4FLVA 1XEZA 4IR1A 4G6VB 2L9WA 2D7SA 4QAGA 3KLFA 2C3YA 2J8SA 1JCGA 2QC3A 3W5YA 3MAAA 2AP1A 4MKVA 3DOKA 4CZHA 4ED2A 2UXDJ 3CJBA 1DY3A 4RUAA 3R5CA 2ABYA 4HCCA 4J9NA 2ZH4A 3KD5E 5GAHU 1WSFA 3KLEA 2R9LA 4IOXA 3B82A 5HP1A 4RBUA 1N36F 4I6MA 2D1KA 4DU1A 3AH6A 4XIUA 3L6QA 3SQGA 4AYBD 4X65F 4OI1A 3U8XA 4QIGA 5DRKA 2W2PP 3UCUP 1YBAA 2BJ9A 5I3UB 2LVWA 3T69A 3QWPA 3UCGA 4Y1DA 3O5TB 5EWFA 3PFEA 1S72N 1QVFM 3W2WB 2HWTA 3A8JA 2E4LA 3T1HK 2YJEA 2NUBA 3MI7X 3L3CA 1XMOF 4DR4K 2ZQBA 2FBYA 1NGDA 3DKDA 2NR0A 4CNZA 1X4GA 5ADXA 4KV8A 3UVJA 1U1QA 3L7OA 4E7IA 2RMLA 4P10A 1C0GA 3U3YA 2D4WA 3GOIA 2EBEA 1AFJA 2FJBB 4NCGA 1BY9A 2HBKA 3OR1A 3B8AX 5E0OA 1FWLA 1TMMA 4U7UK 2E2QA 3PTWA 3R7NB 2RU3A 4K50A 3B6PA 4FNIA 4CLFA 3TSQA 2ITGA 2FXUA 3H5XA 1TKXB 1V3ZA 3VGVA 2G8UA 3IO1A 4JS4A 3O8WA 4DUYF 1X4DA 4LF8J 2MKCA 3GJSB 3DLHA 1RHUB 4DTJA 1IBKJ 4OJGA 2CQ1A 1U8SA 4CJLA 1N4LA 4WP9A 1TU0B 4YOWA 3R2DJ 5IC4B 3KHGA 4Z0UA 4CLWA 3NS7B 3CC4S 4CI6A 3DMJB 3RRHA 4RNMA 1DTTA 1C0TA 3N6MA 4LF4K 4EO6A 5CD4A 5CCMA 2V8GA 4JBCA 4CIGA 1P8ZA 4QW9A 4UZCA 3QEVA 2DRAA 2OTJS 4B8AB 4IQMA 4AXJA 2P9NA 2WFBA 3VQ4A 2W1BA 3UD5A 2WBNA 2J4RA 4HTUA 4DCOB 4KTZA 4D3GA 5AZIB 3FCWA 3OJSA 3JAMO 3BR8A 4LVOP 4OZNA 3NWRA 5GAGU 4PPDA 1UETA 2OPSA 3DYAB 3O4NA 4WKYA 2OLWA 4OYZA 2FJVA 1RHRB 2QWPA 3V5RA 4LBHA 1N48A 1YJ9N 2H54B 1W26A 4FS1A 5A0YA 2HFNA 1JKHB 1SQEA 1RAJA 1EZZB 3EJMA 1DLOB 4B1WB 4OKEA 1EHWA 1MMDA 2W42A 5F8GA 2Q3SA 2G1HA 1YSJA 3FZBA 4I1TA 2J9DE 1Q78A 1XNQJ 3I0RA 1SH2A 2CG4A 1BO5O 4S0MA 4OLBA 3KFWX 3QO9A 3A5NC 4C11B 2GBZA 3UKRA 5IQ6A 1HNIA 2O8DA 2CNKB 2XHWA 3Q2SC 1D8ZA 4DPTA 1HUXA 2F9JA 4K0KK 5IWAJ 2VG7A 1L3VA 2I0XA 5J2MB 2KHCA 1T94A 4RUBA 3KJQB 4DR1J 5D0HA 4DX5A 5FPMA 3L2UA 5B09A 1J5OA 1J5EJ 4Q8FA 1V4SA 3M8QA 1I51B 3W1YC 3TUPA 2JWKA 1KVIA 2ZH3A 4DV0K 5CYQB 2FTRA 4PCQA 4DV2F 2J9CA 2CPFA 1WACA 3IRXB 1RZMA 3HZ6A 2NUHA 3ZT3A 1R31A 3AA3A 1YVNA 5KFFA 4LD0A 4TSXA 3VQ7A 1N34F 1RWNB 4ETXA 2EWHA 2E2PA 1BDGA 3PKYA 4R5PA 5BPMA 2DEJA 3F56A 1WEXA 4BY9C 4CJKA 5H1SV 1EP4B 2HW3A 4I7FB 3MPYA 2J8AA 5KFXA 1S72S 1H6KX 2CQ0A 4DL3A 2NRHA 1XMQJ 3HX9A 4BC3A 3NGRA 3CF5L 4DR5K 3DLEB 4IG3B 2Z58B 3QESA 2IVMA 2PEBA 2B4PA 5F8IA 1FRXA 5HROB 3AVHA 3L95X 3CI5A 2DRDA 1C2PA 3AVIA 2VA3A 2EFOA 1XI1A 2LYVA 1IR0A 4U8YA 4Y2AA 2B4JA 4Y3CA 1VSJA 4J9QA 2CJKA 4Z4IA 2QWMA 1ACMB 3VTIA 2DISA 2GIFA 4X4QA 2QZ8A 3FZLA 3MXJA 3P4UB 2MQOA 2MZRA 2P9IA 4NLOA 4NZ0A 1FE4A 4Q0BA 3QDKA 3O9QA 1JB0C 2VIHA 1H2UX 4ZJOA 5J2PB 2HBQB 4NEYA 4PWDB 1OH8A 1OH7A 3SUPA 2AZ1A 2A2CA 4PXCA 4ECXA 4W5TA 5AQMA 1ZBSA 2V8PA 5LMNF 1TKDA 2QWQA 1RWUA 3UW1A 3H5YA 3A3OB 4TN2A 3CCSN 2IMOA 2ROGA 1H7XA 5KFQA 4FWMA 2DXFA 1U24A 1WSHA 2D41A 3G0ZA 1N6QA 2ZM6J 4BQZA 1OWXA 3IXQA 1YJTA 4USKA 3WQTA 3NOCA 2QO3A 2W7AA 5IV3A 2EFPA 5JMVA 1JLAA 5DS7A 4CGFA 1SKRA 4NLQA 3JSBA 3RSEB 4CHOA 1X9WA 2OIHA 4FYWB 3DXSX 1WSRA 5AQWA 2Q43A 1N36K 2DR6A 3UN5A 4TLQA 1F3FA 4X65K 4N76A 1SV5B 2Z0GA 3OHAA 2MQMA 3HP6A 3KWGA 2ZGZA 1U49A 4LF6F 4JI1F 3N28A 4FNHA 4C8ZA 2ALYB 1HBUA 2QL9B 2ZOMA 3VR1A 3VV2B 3Q8VA 3SUNA 3D2WA 2K7KA 1NEEA 3HT3A 3QMQA 3ETOA 4LSNA 2MEWA 1LWFA 1ATNA 3RBXA 4W5RA 2F9DA 4CIFA 1XHXA 3QEPA 1S1XA 3CUNA 3QNWB 2NRVA 2IC3A 1XMOK 1C4CA 4BR4A 4F0HA 4UY8O 2WVDA 4Z2XA 4XO0A 4TY8B 1YJ9S 3NEKA 2LXUA 5AJ3J 1RYRA 3MMVA 5IQQA 3HFZB 4U7BA 4AHVA 4DFKA 3DRXA 4FJ7A 3OR2B 3GU0A 3CJTA 2LP4A 4V19J 2KZMA 2MQQA 4BG9A 5EY4A 4A2BA 3VQBA 3QJLA 1KSPA 5ITHA 1B9FA 5HLFA 2FC0A 2F4VF 5HI7A 3ZT2A 4DMZA 1YTYA 5HRNA 1HYSA 4BRAA 5KFRA 4KC5A 4W90B 2V67A 1X9JA 5AQRA 4BVPA 2QSWA 3GFXA 4RPFA 4JKDA 3QEIA 3PSIA 1U48A 1LWEA 4MKBA 1ITPA 4HDHA 3GDQA 1JLEB 5FPEA 1TP7A 2EC0A 4JI6K 1H38A 2ZBQA 2ZC3A 4W5OA 3C6AA 1X5PA 4JRPA 4CJTA 1U1PA 1NSKL 4ZCLA 4ZP9A 3BSCA 4RLEA 2V8DA 1HPZA 3N01A 3E66A 1IKWA 2B4VA 1EB0A 3HF5A 2IVYA 4WQ4A 2AYGA 1TVRB 2HLUA 3US5A 3QFUA 5E84A 3VVUA 2P5VA 1D9FA 4RW4B 4ZVUB 2DYAA 3VCDA 3LWLA 2GUIA 4YR2A 5KPRA 4RNOA 2RPIA 4RR5A 3VQEA 1TAUA 3D67A 1HBNA 1UFLA 4H0PA 2JSXA 4FJ9A 2V9WA 3PW7A 1WDTA 2HNYB 2AX1A 3OYJA 1HNZF 4NXMK 4IO9L 2CXEA 1S76D 5A6PA 4DFJA 3FEXB 3SQ1A 4FZXC 4I64A 5KFDA 5BYQA 5GAHP 5B0CA 3CB4A 4X4UA 1GK8A 5HMWA 1UAXA 2KU7A 3FFKB 4QOZB 1LK7A 5HQMA 2OMOA 3ZSYA 3GCXP 3B4MA 3QIPA 4FYVB 1JJCB 2O4GA 3NH0A 1RABB 2W9AA 5GAGI 2LECA 1GLLO 3JYTB 4OMFG 3E01A 1VBXA 1F5BA 2FLNA 2UZAA 2ZVIA 3IBFB 3MM8A 3C6UA 4G1QA 4K8RA 2VJUA 1VSKA 2AQ4A 3ISND 3MCMA 5E2QA 4KPCA 4B3MF 3T19A 2KL8A 3C7NB 1HQEB 4F36A 1OH5A 1P27B 4JK7A 3FZFA 3K59A 4NYOA 3DXKA 2F5GA 1PAEX 3E8OA 1YJWN 1GMVA 3RR7A 2XNRA 3MK6A 3M8SA 4YB5A 3SSRA 4KHPF 3MAHA 4NOHA 4L3NA 2M9KA 4JK8A 3D68A 3RVCA 3LDQA 2J0QD 4KH0B 5HBMA 3U4LA 2YCHA 2BQ3A 5J1PA 3MUTP 2CG8A 4JKBA 2XI2A 5DDRC 5LMUJ 2PMHA 1HNVB 1PBAA 2C3UA 2VB6A 3M30A 3NHGA 3HXMA 4WFAQ 4DV2K 4H5WA 3FJ2A 3HOTA 2DPNA 1BG3A 4FPAA 3QBWA 4RG8A 4JI7F 4MK7A 2BGGA 2N4DA 1EX8A 4QIVA 2I9SA 3BS9A 1Z6RA 5EX0A 2CZ9A 1N34K 5FJ4A 1NHUA 3EY1A 3GSDA 2RE2A 5KG5A 1RDUA 4BR9A 3BGRB 4ICLA 4AH9A 2D3UA 1OMSA 4BWMA 3SFGA 3MWTA 1KQSM 1RT4A 1Q7YT 1FDAA 2QA4G 1IWAA 1Z2ZA 3ZSOA 1KDNA 3DOMA 2KYXA 1VRQC 4BC7A 2WONB 3KK3B 1YJNN 4UQTA 3I82A 2RVJA 1QVGM 3TTDA 4B3SF 2CQGA 4CO0A 4NE9C 2ZH7A 3OXGA 1BIZA 3H40A 2E29A 1S1VA 1F5CA 4M7YA 4WFBQ 3BGUA 4IH6A 2B3TB 4A57A 3SMPA 4MKYA 4M95A 2G2YA 2K8GA 1CULA 1U2CA 2JH3A 4KRFA 1ZAXA 4GKJJ 4OV6A 2VHGA 4PG7A 4USWA 5E41A 5GAGP 2I5JA 1IJFB 4A46A 5GVQA 1P1LA 5M1PA 1RUSA 2PBDA 2E2NA 1TKTB 1NMNA 3G86A 4FW2A 2D9OA 3OBWA 3PYGA 1P9QC 3LPTA 3DFEA 4ED8A 5CAAA 1BISA 3J81Y 3CCEN 2E9ZA 2LSNA 2K1RB 5LMNK 2X6NA 3M05A 5F9LA 4M94A 4ZPDA 1F9EB 1Z05A 2DVIA 5KT5A 3D54A 4JB8B 2ROEA 2ZDOA 2J6TA 1K8KA 3F0NA 4M3YA 4JKEA 3BPDA 1QS4A 1VQSA 2D1CA 1NB7A 3F41A 2MQPA 1NK7A 4YDUA 1JXEA 3HOSA 4BROA 2HQGA 1RBVA 1W7WA 4PY5A 3D0IE 2X3GA 1RLCL 3TABA 2B0GA 1JQGA 4AILC 4NLSA 5JJBA 1PO6A 2K2PA 3ZZUA 4OX7A 1JLQB 2GQCA 4QWDA 3VA3A 1VQLN 3TZXA 3OS2A 3IMXA 1KHVA 3CPWR 4LF6K 4JI1K 3CC2N 1SB6A 2FVRA 2DBBA 5KFGA 2AW0A 2KI2A 2M52A 2HIQA 1NDKA 5BYSA 1RT7A 1FESA 4CZCA 4USTA 4CLSA 5K5MA 1RDCA 3AVLA 3F9MA 5HRPA 1VQ8N 4K4UA 4BGAA 3KJVA 3AOCA 4FWSA 4DHVA 1ILYA 3VAKA 4PWWA 4LF5F 1RTZA 3NS6A 5LXRA 3OY9A 2DR7A 4PL7A 3N6LA 1U02A 3OYKA 2IM0A 2PDAA 5CXTA 4B9SA 2E5LF 1YBTA 3HCXA 4NEZA 1IH7A 1KBRA 2GAGC 3O08A 3BEGB 1UJ4A 5AXNA 1YJWS 3MEDB 2G1DA 5KFUA 3CYMA 3JXUA 3R1XA 1PC5A 1XNRK 4R79A 3OBIA 2IYIA 4QQBA 3UDLA 1JJ2R 3PO5A 3O1BA 3POTA 4CBWA 2EXUA 5LJ5Y 4CZIA 3C8YA 2VPZB 3ICLA 3HHLA 3KLHB 1NJWA 2HOEA 4RBTA 5CYMA 4MLHA 3PZPA 3QLHA 3LAKA 1F2GA 3GR1A 4F4XA 3DLLQ 3BKFA 4H4OA 3IN5A 3IM9A 4OI6A 3U1LA 3D6HB 4DSKA 4DR7K 4GKKJ 3DJCA 4FK4A 3P1GA 5D4PA 1TYQA 2RD5C 4GVEA 2YHYA 1AZSA 4C8NA 2YH0A 5KFHA 4DLGA 3J81j 2NYIA 1IBMJ 4MIAA 1WC4A 3VF4A 4JI0K 1S97A 3CJSA 1EWRA 3NGSA 2ZC4A 5AXLA 1PILA 2M4MA 4CNYA 5I9EB 2G8FA 2W2OP 1YJNS 1T9VA 2F9TA 5D77A 2IPOB 2D0OA 1HNZK 1WOPA 4K41A 2BKPA 2DNPA 2VBXA 3AQOA 4O4GA 2ZWOA 4BBYA 3RZAA 1GEHA 3A5MC 4LFCJ 5DQIA 4P73A 1KQGB 4M5DB 4KPYA 3W9IA 3CPWM 1H98A 4ZKAA 4JI8K 3I0SA 2VWKA 1I94F 2FSJA 1LXNA 2I38A 1WSGA 4NLCA 3VGUA 3WIVA 1CEZA 4TQSA 2NNWA 1FDDA 2IFXA 4RNNA 2HHHF 4ED4A 4DUZJ 5E3PA 3UO0A 3WIUA 4B1UB 1HBOA 3C46A 1YUWA 3PHTA 3NRBA 1BGXT 1BHLA 2O8CB 4DMNA 4RJVA 4O4RA 1HWLA 3N4QA 2BMBA 1GLDG 2D69A 4BC2A 2R8HA 1CJUA 4LC9B 4QW8A 3CCES 3GLJA 2F8TA 1D8YA 2MPUA 4Y6IA 4KHPK 3CCQS 3ADAC 3MCSA 1RTDA 1FHTA 3DDNA 4LFBJ 2F63A 4ZVHA 3KLFB 3P31A 1NPKA 3SSQA 3MEGA 4GVMA 3W2VA 2GCFA 4O3PA 2AIRB 2BE7D 3DOKB 3C6HA 4ZPVR 2CFXA 4F50A 4PG5A 1OKJA 4JI7K 2ADCA 1IKVA 2DHHA 1RWXB 4FM0A 1JLFA 5E3QA 3KWMA 1WC3A 2LQJA 3R1LA 1N32F 1HARA 4IDHA 1Q86T 1VQNN 2KRRA 1RU2A 4QYRA 3KVGA 1TL5A 1ZBLA 1FJGJ 3T9ZA 3IKMA 3ZZRA 4CJRA 5BXIA 2GX8A 2ZDPA 1N88A 3Q22A 1TKZB 1CJTA 3NFAA 2VGNA 3FBBA 3ENBA 2HHQA 4WKRA 4DPUA 4AD6A 3AVKA 4DV6F 5C2GA 1LV5A 2IGIA 1S1UB 2CPXA 2OEJA 2AYBA 1VQ8S 4QU6A 2DIUA 1VCTA 2N82B 3NCIA 3TUJC 2VKZG 3BN7A 4OHZA 1WKKA 1VSMA 1UOCA 1RBSA 3HMJG 2IRXA 2BJ3A 4DXLA 5ETTA 3S41A 1OY8A 3V81A 1G1XA 2O8FA 2JC0A 4OI2A 1VK0A 4B1VA 2FC8A 2UU9J 3FZHA 4YUDA 3V1RA 3BREA 1B7YB 3IC1A 3V2UC 3G25A 4DV4J 4ER8A 1QSLA 4I6WA 4U7UD 2V34A 4X4NA 4LREA 5CCLA 4FLYA 1FRKA 3MTKA 5AZJB 2NZTA 4O3NA 4IH5A 3TVYA 4K4SA 1TMJA 2HBZB 4IBNA 2U2FA 2DITA 1Y97A 5D0EA 3VOVA 2CKWA 1D1UA 4DTXA 3K0SA 2DO4A 3T1YF 2HEKA 2GQQA 4IKAA 5K9FA 1UWAA 1DBDA 1R0BG 2GO9A 3H42A 2VOOA 1VSEA 3R3TA 4KIAA 4IKFA 3FSXA 3AARA 4LH4A 4JN4A 3M9OB 3ZTSA 3KLIB 3BEXA 3G9CA 1WBBA 2ZOGA 2WVBA 4ZLLA 1C1BB 5B0DA 3ASMA 1EQ0A 5ETOA 5IT4A 1N5YB 3DLRA 3VQQA 4WE1A 3I8DA 1FKPB 3CETA 4ZMMA 2JEJA 2EWSA 1V9OA 5JS2A 3K8VA 1O13A 3PM9A 3DRPB 3EZUA 2E20A 1FNXH 2VYPA 3A5LC 3U7JA 5M2PA 4M3RA 3A8EA 1MWZA 4OLPA 4K42A 2B7BB 4J9UE 2WCXA 3IGVA 2QW9A 1B0TA 2VDIA 5A8RA 2XB2D 3FGUA 3ILJA 5DM6Q 4B9TA 4EAHD 5IC6B 2E5LK 5BPLA 2E66A 3CFOA 3I0RB 2O01C 4MIBA 3PNIA 3MWBA 4KH1B 2I6WA 2RHKA 4J5OA 3IMQJ 4FLTA 4FJJA 4FXVA 3SMZA 2O8DB 3FCVA 1GLJO 3VGLA 2YQ1A 1Z2LA 3CJKA 3DI6A 1NO8A 4DR6F 4B9UA 2VFSA 5GMKa 1I39A 4PABA 4Z4CA 3V9SA 4O0JA 1NK0A 1T6CA 3F9KA 4CCHA 2ATLA 4OGCA 1A9NB 2UXCJ 2YBVA 4JI5F 3O80A 3MWPA 3QETA 5C24A 1YVFA 3W8PA 4OGEA 1Q8IA 2Y1IA 1NHKL 2YNGA 3DGPB 3GYNA 2VA2A 3QERA 1JL1A 4F25A 3ZZ0A 5FPNA 2NXCA 1FK9A 1WC6A 2ERRA 5A76A 4O3RA 1PC4A 2VOPA 5EOYA 5C42A 1YTAA 1GX5A 1WAFA 1M1HA 1FKOA 3CCUS 4KGMA 4ZJQA 3M8YA 3QRRA 4MIWA 4CH0S 2E7XA 1N52B 5CYJA 3V9UA 4CW7B 2Q31A 3ATUA 2IA0A 2N3LA 4C48A 2A1RA 4DS4A 4BACA 3MMBB 3TO8A 4JV2A 4X4SA 5JMNA 2YKMA 5F8HA 3HHKA 5EXWA 3L4IA 2P9KA 1QDUB 3TSUA 3VPZA 1HNWK 3D6MB 5HRSA 4CK2A 3HL8A 3HDSA 4P9SA 5SZTA 4BRIA 1CJKB 3L9ZA 1I94K 1REGX 3HPOA 4YOYA 2PD1A 2ZHBA 2AV5A 4DSLA 2CJBA 1Y5LB 3ZZYA 3J81U 1S4FA 2HHHK 4HT5A 1SL0A 4FM2A 3TZYA 3HVTA 2A10A 2UUWA 4CJ3A 1B70B 4OZ0A 4KHRA 3HTVA 3H2LA 2XSJB 2VDHA 3TAEA 3G6XA 2EK1A 2JVOA 4FLXA 2IM3A 3A0IX 3SUOA 1RWOB 3T5JA 4KFBB 3MM9B 5A8KA 1ATSA 5AE2A 1LAWA 5CHCB 2IVOA 2H4YB 3RAQA 4IDKA 3R6MA 2HRTA 3U9DA 1OJ4A 1KD1O 1E6YB 3FUYA 3AB4B 3CMAN 1NSAA 1XN9A 4HTJA 3WXLA 1FXXA 1GOCA 4YY3F 3I31A 1L3UA 1T9YA 3DRRA 1UW9A 4LUBA 2HMIB 3SCJE 4XK8C 2XCPA 3SDEA 1L3TA 3QFPA 2F7TA 1HHTP 5FRNA 2VFVA 1JLAB 1MMLA 2A40A 6AT1B 5KT6A 2OPPA 1RT1B 1LXJA 4JV0A 2ZVSA 3RB0A 2UV8G 2VG6A 2ZH5A 2Q79A 2R42A 3KG1A 2UYTA 5C25B 1ZPVA 3RBZA 1JLGA 2XZWA 1SJ3P 3ITHA 1WJ9A 3R5GA 4BRQA 3JXOA 3UKUA 2DXDA 4LSNB 3QSYB 2WVCA 5JVHL 2AD9A 2X7IA 3E1YA 3IM8A 4MO4A 3TARA 4CH1A 3UDCA 4CTAB 4DV6K 1NKBA 3ILOA 4CI0B 2FZKB 2LKZA 3Q7CA 3S01A 3T5LA 3CCRS 1ZPWX 3KG0A 2Q6CA 4EZ9A 3NGZA 4DV3J 2AX0A 1K1QA 3IP0A 2FBVA 2P9UB 2P6TA 3PIPQ 2IY5B 3S9HA 4FK0A 3C6TB 2WTUA 3RMAA 4AHUA 4MFBB 5B0GA 1M90O 4M63C 4DZDA 1FRHA 3THWB 1FF2A 4M3WA 2XLJA 3OBYA 2DGWA 4ZPCA 3CFPA 2Y8WA 1SBRA 3VGTA 4A8KA 1Q86O 4NL5A 3M5RA 2HQFA 3O4WA 2W6KA 1WC5A 3TTFA 1WNEA 2DR8A 1TK0A 2QXLA 2FYXA 5M1OA 3CJ0A 2NRZA 4OYAA 1T9UA 2YNHB 5I3UA 1JK9B 3RTVA 2NRTA 5KT2A 2X74A 2VFUA 2F4FA 1KP6A 4QWAA 3W2WA 3T1YK 5A8WB 4KKOB 3LALA 1NMEB 2IA6A 4WXWA 1TFWA 4FF2A 2IVNA 9RUBA 4WF9Q 1WB9A 4AQYF 3HM9A 1LW2B 1U0HB 3ENHA 2MMYA 3CC7N 4WP8A 2MQLA 3LAMA 4F7VA 4CEZA 1SQFA 4LRDA 1D0EA 3F2KA 5AQGA 1NOZA 4A8WA 4OPHA 3BO4A 1HBNB 4OLOA 4QR2A 1HIYA 2GELA 1YX2A 3EICA 5AXKA 3NBPB 1QY7A 3J80Y 5C12A 2M70A 2VF3A 2F96A 1TKXA 4J8FA 2PIIA 3ZZOA 3IWLA 3M2VB 1RACB 3WNGA 1Q9XA 2G8VA 3H0PA 4CLTA 4LF7J 5CZ1A 1Y7PA 2E1RA 3MCPA 3AA4A 4GC7A 3N0VA 2ZGYA 3HKWA 5HQ8A 4UOGA 4FF3A 3G82B 1NH7A 4DQQA 1GX6A 2BTFA 4K8ZA 5H9FK 3DMJA 2RIJA 4ANEA 1HYZA 3SQ2A 3LZJA 1VQ4N 1RTIB 4JKHA 5IV4A 2UUBJ 1M5SA 1M5VC 3HLUA 1YKWA 4ZDNA 3TR8A 2HIYA 1SI9A 3FLCO 2GV1A 3LGNA 2QA4N 4CJPA 3S3NA 1GTHA 1RT5B 4DV1J 4A2AA 1KONA 5D4LA 3U9ZA 3NGIA 1R7IA 3OV7A 2ATQA 3TJAA 4KSEB 3AJ1A 2N7CA 2JL9A 2POKA 3SV4A 4DR6K 2WTFA 3PHEA 1J5EF 4DJBA 2AA4A 5AZIA 4XH5A 5CR4A 4O5FA 2DFEA 4ED7A 1GXUA 4FJ5A 3K5MA 4RUHA 4JI5K 3AA9A 4KJIA 1MWYA 1RTHB 5DDOC 2YPZA 4CZMA 1KLNA 3NMAA 3DYAA 4F02A 4L8RB 4MYUA 1QHTA 3QEXA 3AY9A 4DDFA 5MLCQ 1EX4A 4KQZA 2VC1A 3H59A 3RUBL 1RKJA 3M7VA 3I4HX 1SVDA 4XDCA 2LQ5A 5F8JA 3P38A 3B78A 2FJDB 3J81O 2QL7B 2YKOA 1NLKL 2VQEF 4HTLA 3ULDA 1JKHA 4CHQA 4ILJA 5D4OA 4HKQA 5C2DA 1RT4B 1ZM3A 3DXMB 1N56A 3HVWA 4CZKA 2PZSA 2VFTA 4KGKA 2DY1A 4F26A 2VZ9A 1EIYB 3P8BB 4K4TA 4C11A 2GEMA 4USVA 5ETVA 1RWWB 2RDIA 3L3UA 5L8RC 5DQGA 2QMWA 4Z4HA 4ZVGA 4KH6A 3P6YC 3THXB 3D7EO 2OAUA 4IH7A 2A3ZA 5J2MA 3AO1A 3LDSA 4R0EA 2XLIA 4YFUA 3I4PA 3SAGA 2MKIA 2BJEA 3VESA 4CGHA 4OFZA 1HL6A 3RBEA 1CULB 4YEAA 2YI1A 2U1AA 1FTRA 3W66A 5CYQA 3OYFA 2XQCA 3PIOQ 1YIJN 4LQ9A 1AB8A 2I5JB 3IRXA 4RBVA 4NLGA 1AT1B 1Q4RA 2JJ4D 2HGNA 3TAGA 1X4BA 4F4YA 2RT3A 5KG6A 2Q1LA 4PPZA 1DQ9A 3Q8QB 5F3TA 2XULA 2R7VA 3T6BA 3VZHA 4DR4J 3ILIA 5KQDA 4HHHA 3ZTOA 1EP4A 3VWSA 1AROP 2IAJB 5ETSA 1BD6A 5B0FA 4DOZA 3O2IA 3KHLA 1N8RT 1D4XA 1F9HA 3SMSA 4J9OA 4JV5F 2BACA 2QXFA 3VEOA 4DCPB 4YY3K 4ZCIA 4JI3F 1LCUA 5SUHA 2V68A 3M8PB 4YHHF 3CJRA 3CC7S 5HANA 4YOEA 3W5ZA 1G6BA 4NCAA 5HROA 4PYDA 5I4MA 3ZTQA 2X1AA 2QSFA 1FJ7A 1YJUA 1VQ9N 3MPWA 2O8BB 3VQ6A 5GADU 1NCLA 3R9LA 1RDRA 4DV7F 3PEHA 2Y1JA 5LL6Z 1FRIA 4ELTA 4P2SA 3KK7A 2F1FA 1X9SA 3LP3A 1KVJA 1HLUA 2DNNA 5H9EJ 3EZ5A 1W2BM 2EFVA 2UXBF 1IKXB 4FXWA 1CZBA 4EU0A 3MFHA 5J2PA 1ZM9A 3CDAA 2XNQA 2HWIA 4EBEA 4MYTA 4ZLNA 5AQZA 5AJ3F 3EGVA 3W0LA 1WNSA 4PRFA 3NMRA 3H2UB 3H20A 1MROB 4CJWA 4KYZA 4B3RK 2HQIA 2LXFA 2R7OA 1B64A 3DN9A 4WQ4C 4C6AA 3MURP 1UFWA 3H45C 3O9TA 3D66A 2ZNZA 3Q0AA 4H5NA 2DTJA 3RMDA 4FJ8A 3OYBA 1UTAA 1FCAA 2ZHAA 2P5GA 2ZBCA 2QA4S 4OX9K 2V69A 2VPYB 1PAUB 1T03A 1QJHA 2FJXA 3CM5A 4YNQA 3RSEA 1T3OA 3RGIA 2HG4A 3VMFB 2J0SD 1DZ5A 2ZOFA 4OYXA 2Y0SD 3JTOA 4A47A 3J7A1 3G6VA 5CYMB 1IM4A 2OFGX 1SV5A 5M2RA 2LFVA 4LR7A 2WVFA 3LM9A 1SC4B 2XY5A 1HHQA 3SCIE 3CDWA 3CHWA 2C3OA 5EVZA 2OMLA 1UVNA 2PMZD 2ZH2A 4HACB 1U2FA 3S3OA 4AQYK 2B8QA 2D0CA 4TY8A 4CVNE 2JLGA 5HVGA 1TUYA 3BPSP 4RKUC 3EYZA 4QYZK 4K4WA 2G8IA 4JS5A 1P90A 3OR2A 1YXQA 3BO2A 4K0KJ 1WD6A 4H4KC 3H6EA 3WT0A 1YGYA 3OL7A 1H72C 4ECWA 3O3GA 4Q5VA 1BUPA 2ROPA 3UD4P 2KRBA 1V6HA 1H2VZ 4ERDA 4P72A 2XHBA 4B8CA 4DV0J 2R8IA 2RRBA 2ZKUA 4H5RA 2KM8B 4BGBA 1F21A 4K43A 4ZPBA 1PJ6A 4LMZA 1JLEA 1P8GA 3P3DA 4IO9Q 2RDDA 4ED5A 3EVOA 3ZYYX 2HMPA 1YIJS 2C2EA 5BR8F 4DTSA 3D0HE 1FFSB 1KFDA 2YWGA 4CF2A 3BV8A 3CULA 4ES2A 3NF8A 3KKFA 3QT6A 4BLGA 3L2WA 5G0RB 3EVMA 2PA3A 3D45A 3HVRA 4O44B 1B4SA 4RNHA 3VAFA 2OPRB 4Q2MA 3FQLA 4ECRA 1TVRA 1TK5A 1K8AT 1RHJB 4DR5J 3AOAA 3M6WA 4RW4A 3W9HA 4DSIA 3GFZA 4FWOA 1AYEA 4ES3A 2AEMA 1S0NA 1T44A 4U67Q 5MLCV 2HNYA 1NGCA 3WX4A 4BR7A 5THWA 1FFWB 3MEGB 1WOSA 4JKFA 3W2VB 3R27A 3UDVA 1RTJB 3O44A 2BRKA 4ILHA 2NYHA 4OPJA 4NLDA 4UUXA 5HMXA 2C1EB 5HAOA 4PUOB 3H25A 3V6DB 5C2CA 3MM6A 3P49B 2AT1B 3AV9A 4WYBA 4CERA 1MU2B 3JYTA 3LOUA 3BF3A 5J2QA 2VQEK 1OQ6A 2MYFA 3L2VA 1RNHA 4PKDB 1HI0P 1NRKA 2W2QP 1M1KO 2W4PA 3RJMB 5C10A 4XH1A 3C7NA 1HQEA 4ZVRB 1UW4A 2CZVC 3PYFA 4GW6A 4M5MA 3ZETB 3GONA 1OVYA 5B8HA 5KFVA 3MX2A 2G0IA 4ZTJA 3IBCB 1CJVB 1MN9A 4DR3K 2GMJA 2UVVA 1SQGA 3GP9A 4NXNF 1HKAA 4JUZA 3KTQA 4WP3A 4CHNA 1MN7A 2BJ1A 4FWLA 1FEHA 4N5SA 1NJZA 1SH0A 2CQPA 2CPYA 1N36J 4GKJF 4RWXA 2HGLA 3N6NA 4M5KA 2UVWA 1VQ6N 1MW7A 4C8KA 1TUWA 4X65J 4MLEA 4YDUC 1KTQA 2XYHB 4A8QA 3GWCA 3HHDA 4USJC 3G4SN 5G4DA 1VMBA 4CIEA 1SC1B 3CMQA 4CESA 4O8UA 2E9TA 1XERA 1QM9A 5RUBA 2DNYA 2OEMA 2Z30B 2BUNA 3J7Z5 1VQ7N 3FEYB 1XMOJ 1NH8A 4X66F 3BGRA 3U27A 1WSVA 3BBFA 2KQ2A 2ATCB 1WKLA 2OCEA 4FS2A 4X62K 3SCXA 2ASPA 4JV5K 1HA1A 1O0PA 2AMCB 3NLCA 2WONA 3HK2A 1X31C 2WRMA 3MR5A 4JI3K 1JLBB 3UR3C 1ESVA 1S49A 1SXLA 4YHHK 2XG8A 3O8MA 3J80U 2YWFA 1Q8LA 3R7BB 5K8OA 2YY3A 3TEHB 3SSSA 2CJAA 1HRHA 1NJIT 1JCEA 3CJ4A 3WXJA 1RB0A 5J2NB 2ETJA 3UNGC 2DJWA 3VN5A 1FKAF 5BR9A 4OPAA 1TUVA 3D1OA 4DV7K 4JI6J 3CIZA 3WBZA 2L41A 3VF0B 2D3OR 2NCKL 4X64F 2LQ8A 4WE1B 3HHLC 2F40A 2PT0A 4CJ4A 1QQOA 2UXBK 1S10A 1TKTA 1X1PA 2LQBA 3O3FA 3LO3A 2UUCK 1S0MA 4KH4A 1JNZB 3FK4A 4PQAA 4TU9A 2DFHA 5M1QA 5AJ3K 5LSLA 1NXIA 4FP9A 3EE9A 1EO1A 3BZKA 1UKUA 2WVEA 2JOQA 2K1RA 3OW2M 2DEIA 5LJVA 4DCJB 4YR0A 1NGGA 2K3IA 4IO1A 2V4JA 1R0AB 3GJTB 4EFAC 2Z56B 4H0VB 2NPFA 5DQHA 2Q97A 3TVKA 2AWZA 2R4FA 4U6PA 1WHXA 3CWJA 4NXMJ 3ONQA 4KHWA 5AT1B 1M5PC 4HHUA 2CRLA 1VHXA 4KRWA 1W2IA 3AD7C 3VGKA 2MZQA 3UN2A 3B4DA 3JTPA 4GMKA 1JLQA 4DKWA 2QLFB 5KFEA 1WI8A 1E6VA 1S6QB 2YWKA 1C0UA 3HFKA 3T3FA 5KRSA 4CGGA 2XMMA 4CO4A 2IOCA 2CADA 3KKSA 1TL1B 2KM8C 1KCFA 3L8BA 3UN3A 3S7RA 4GKKF 2CQBA 5HMYA 2PYJA 4FCYA 2OKQA 1RCXB 2W9BA 1RT6A 3E51A 4GVBB 4FOEA 3ENVA 4ILMA 3UNYA 1R3NA 2CDRB 1IBMF 2RUSA 4MDAA 4O55A 4CO3A 3W9JA 4AL5A 4ZHRA 2XYGB 3KD1E 1PGZA 2G9OA 1HI1A 2HYIB 1BWEA 4Y2KA 1EKSA 3KNGA 1NB2A 3ZX0A 3AA8A 1NM2A 2MSTA 4N8NA 1FKOB 8RUCA 3MN9A 2X1GA 3GMGA 4TXSA 1KAYA 2GNKA 1HWKA 3OPKA 1BUXA 2QWNA 3MEDA 1NNEA 2WHOA 1RWVB 2BH1A 4PQUB 4ANDA 4O0NA 4WYWA 4Y2MA 3AJ2A 3UR0A 3GG1A 2HURA 1S57A 4CD1A 5JUMA 4DV2J 2YKMB 3BO3A 2WAQD 3KLHA 5KFNA 5GADP 3IR7B 1RAHB 2BBEA 1RAAB 1ZA1B 4OPKA 1NK6A 1PKUA 1N34J 4Y28C 4MH8A 2UUAF 1ICEB 5L1IA 1T95A 3G4SS 1GLEG 4OX6A 5KT7A 5BR8K 1YDLA 4DG1B 4J37A 3H1VX 1CLFA 3CQ8A 2OPQB 2WB1D 1WI6A 4JI4J 2VGMA 3VQTA 3JS9A 3W5XA 4J9LA 3HVTB 2IJFA 4AT1B 2DNKA 4ZVQB 4CBUA 3TX0A 4DCHA 2QRRA 2EW9A 3CQXA 1UVLA 3M32B 2BW7A 4I9LA 5IT0A 2DGQA 1YVUA 4IOAQ 1S9FA 2AYMA 3JSMA 3J8AA 1VIOA 1A5WA 5DZ6A 2D0BA 4C1NK 1UCNA 2Y9HA 4C9DA 1DHMA 2BKNA 3IGNA 1XWLA 4LFBF 3R5BA 2B43A 2OTJN 1GNKA 3PW5A 2IIRA 1YI2S 4NLRA 2FZCB 2D3ZA 2OD6A 2R7RA 1B9DA 2VUGA 3M6VA 3FCHA 3THYB 2PEHA 5FD1A 5KFWA 4KHSA 4E7HA 4ZPAA 1KVBA 3VQSA 4DL0C 4QCLA 2MLXA 4M5DA 1ZBTA 5AE1A 2NXUA 2GGPB 3QFWA 4L3QA 1TTHB 3V6HA 4A8FA 3OTOF 2QMUB 4I68A 3I56N 4JI2K 5D78A 3ALYA 4IUFA 4I2QB 1FJGF 1KR4A 2X78A 4EP5A 4DL6A 3S1TA 3DGVA 1JLGB 4QU7A 5LMNJ 2O8CA 2E5IA 2QLXA 4OYPA 3UKUB 3ILLA 4K7QA 1HYVA 2XBPA 2AGOA 1J27A 4I6AA 4HUEA 3CXCM 1B7FA 4KO0B 4OZ5A 4ZP8A 4CHZA 2KKHA 4X4VA 3GG0A 4GO7X 1NGEA 4B9NA 1ULRA 3KJFB 5CZ2A 4NXNK 2ZKTA 5KFTA 5AQVA 3C19A 1S9EB 3AAPA 1BE4A 4EWTA 1O6XA 4CD3A 3FDSA 4WZMA 2VQFK 3R9PA 2GMHA 5FLXY 3PV8A 4KH5A 2RE1A 4G1PA 4TYBA 1T3VA 4ZVFA 3KG4A 3AGKA 3NAIA 4DV4F 4UOFA 4LF6J 4JI1J 5KQ8A 3W8GA 3MXIA 5EDWA 4E89A 4RL1A 3OHRA 2GW8A 1VRUB 4R8UB 4DX7A 2FBXA 1PYTA 2HWHA 2BX6A 4DS5A 2IDEA 3RBDA 2GVZB 2XMWA 3TAFA 2CH6A 1GXTA 5IXUA 1Y3KA 4X66K 1DQ8A 2RB7A 4ECTA 2W41A 2KO1A 5L46A 2NREA 2X3DA 4URQU 1IWGA 2XY6A 5AXMA 4DPXA 1TKZA 4Z4EA 2FD2A 4JV1A 4GMJB 1SJRA 3NS5A 1LAVA 1RYSA 1K0TA 3KNAA 1CQMA 3FZ2A 3NCRA 1NBWA 4KTQA 3GFHA 3VEWA 1S1UA 1Y5NB 3M3ZA 1RI7A 3UWTA 3MDFA 1HR0F 1RGIA 5EX3A 2B9EA 5DGAA 1VQPS 1T9XA 4M5NA 1URNA 1OQ3A 1U1KA 3CDBA 4CLZA 1XNRJ 2RDJA 4CH7A 2LA4A 2NUUG 2YWWA 2YNIB 4BR2A 3G71S 3JQMA 3LL3A 4G3IA 3BQ2A 3EL2A 1A5VA 1NHVA 2B4OA 4ZP6A 1S5ZA 1UFKA 5KGWA 4QS8A 3TPQA 2QT7A 2G2ZA 1Y5IB 4X64K 4DU7A 3OD2A 2MY7A 3UE5A 5D6GA 1YHQS 3FZKA 4LFAF 3F73A 2X1FA 4KBOA 3HJVA 3PJ9A 1NSQA 4DR7J 1JXLA 2IS3A 4CJSA 2G8WA 1L5UA 2Q3PA 4YB1P 5AZJA 3HBTA 1AXQA 4Y1CA 4DFPA 4CQ1A 4WFXA 3SIPB 1T3NA 4BRHA 2DNZA 1LEOA 4YOXA 2DK2A 4JI0J 4A62A 5HN0A 3NF9A 2CJYB 4FBUA 2VBZA 4K59A 1X4CA 4Q7AA 4HUFA 1Q81T 4LRCA 3H4BA 1OH6A 2HZAA 1Y11A 2E6LA 1FE0A 1SH3A 3ZSZA 1VQYA 2Z4PA 4R25A 2E7VA 3PX6A 5JS1A 2BE2B 4M63A 3KLIA 3OQ2A 1NKCA 1S99A 1U1NA 4J9RA 3D5MA 1D9AA 1FRLA 4CO2A 4BE2A 1C1BA 2GAHC 2W25A 4J9MA 4JI8J 3P5BP 1UJ5A 5HSPA 5L9XA 1KOOA 1RHKB 4NYFA 1N5YA 1S7HA 4HHJA 1FKPA 2P8IA 1L3SA 2QL5B 1VQMN 2WW8A 1KVCA 1LWCB 4YB7A 2QN6B 2KTQA 4FLUA 2A1BA 2A5XA 4O3QA 4V19X 2CJXB 3G87A 4H5TA 2CWXA 2VWBA 2CQ2A 3DRPA 3N5FA 2R7QA 3I56S 3RU0A 1ZTTA 2XRIA 2IYGA 4FJLA 5KFCA 2VONA 5LSRA 3BYPA 4BRDA 4L6V3 4DV5F 4WFAL 4DFMA 2PI4A 1X0FA 1IBCB 5I3PA 4BE1A 4KHPJ 3OYDA 3CCLN 3PYEA 1ZZFA 2HQDA 2C2OB 2C3MA 2B9XA 3GJRB 2DB1A 1OY9A 2XC9A 1M1GA 2NPIA 4HH0A 4EK2A 1HD0A 4JAXA 4PKIA 4HH1A 1QTMA 1NBEB 3QZ7A 4DTNA 2HSEB 2Y1LB 1UZDA 3FE1A 2IDLA 4QIEA 2E44A 2YPYA 3VALA 4JI7J 2DO0A 5ETKA 3KWIA 2NQPA 1X3NA 2FVPA 2YKNB 4JHDA 3OHBA 2UUAK 3PSFA 1WUUA 3KKRA 1Q95G 2OEKA 3R6GB 2M3DA 3PW2A 1Q82O 1VSFA 4LIWA 2YV0X 1DTQB 4WFBL 2YQ3A 2PI5A 2M2BA 1RCHA 3DGPA 1W0HA 4WU2A 1S6OA 2BV3A 2ZUAA 1U25A 3C15B 1WSIA 2ASLA 4ZP7A 2ZJRQ 2VBWA 5KT3A 1VAZA 1R27B 3DCAA 1BC6A 2BRLA 4DSEA 5AQFA 4Q8EA 1S7IA 1CXUA 1YRXA 2W8KA 4ECYA 3PJWA 5F8LA 5FRMA 5TKWA 3M1FA 4HVJA 4HVZA 4URGA 3KLGA 3MMBA 4QR1A 1S9GB 2KYZA 2ASOA 4DF4A 2BZ2A 3CD6S 5E33A 3EMTA 3D2EB 2CYYA 3I9ZA 4A61A 1BQNB 4P2FA 3KK2A 4CEEA 1CJKA 3OTOK 4L75A 2B6AA 4LF9F 1FJGK 4V19S 3NKYA 2E6MA 3C0BA 1T8EA 4IFVB 4OZ3A 3P4IA 2FJWA 2D0AA 2P9EA 4AL6A 4ECVA 3HP9A 5CY4A 2CQ3A 1IM6A 2XSJA 4CM0A 1C4AA 2WOMB 3HULA 1KC8O 4J90A 3TUIC 2V5HG 1UEUA 4KFBA 3MM9A 4QPTA 2YKQA 4YORA 1S59A 3DOLB 3SEOA 4CLLA 5E5NA 4DV3F 1WOOA 3M6GA 3I5CA 3R5DA 2DNQA 4AHSA 1X4EA 1E6YA 3VA0A 3AVMA 3ZT1A 1Y4ZB 2EKYA 4KI6A 5ETPA 4WQ5A 4OZLA 2YNFB 1IG9A 2HMIA 1MG7A 2F3JA 3QGPA 4F67A 2WB4A 3MUVP 4DV4K 4IOCQ 2XMKA 1H0HB 3O1WA 3BDPA 2O8EB 3F44A 4P6QA 2XMTA 2QJ3A 1T03B 2HNDA 3A4TA 2KKZA 4ISEA 5ELZA 1RT1A 4ISGA 3V6JA 4H54A 3LDLA 3NG8A 3TJ9A 2JWNA 3CEDA 5C25A 5GMEA 1SIWB 3WEEB 4ED1A 3HO1A 1VQMS 4OYIA 3CD7A 3QATA 4EMDA 5GAHI 1FTCA 2MZ1A 1VBKA 3UB5A 2PA8D 2BANB 3EO3A 3LW5C 2PY5A 3H98A 1S1WB 4GY2B 3ZSVA 4CTAA 2E5LJ 1BHNA 2HVIA 1HR0K 3CJ9A 2EG2A 3D2FA 3FBCA 3BP8A 1Z25A 3DLLL 2HVDA 2N3OA 2M8DB 3D6TB 2MJNA 1B0VA 1N33F 3WX8A 5KFPA 4CO1A 3LP2B 3EXCX 3CCLS 3OYHA 1LNQA 5LXYA 2P9UA 4KT0C 3RRKA 3CJ7A 3C6TA 4BR5A 3CVKA 4CFBA 4FWQA 4MFBA 2WSFC 1WBDA 3CJ1A 4DQ8A 3DLJA 4BWJA 4ZVEA 4RU2A 2CVIA 2IDOA 3THWA 2G2OA 4E2FB 2IJNA 4P2XA 4LFAK 2MTLA 4MAKA 1N5VA 2DGUA 3HHLD 4W98A 4DL5A 3FBEA 1GLFO 4DUYK 3HSTB 5E26A 4K2JA 2EKNA