3C6TA

Crystal structure of hiv reverse transcriptase in complex with inhibitor 14
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
559
structure length
559
Chain Sequence
NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The design and synthesis of diaryl ether second generation HIV-1 non-nucleoside reverse transcriptase inhibitors (NNRTIs) with enhanced potency versus key clinical mutations.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase
total genus 150
structure length 559
sequence length 559
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3c6tA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6tA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6tA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6tA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3c6tA05
2OPRA 3AA2A 4IFYB 4N5SA 3KMSA 3MFHA 4FW1A 2D0BA 1XI1A 1ZYQA 4RNOA 4M3YA 2W7OA 1RAJA 3C94A 1IH7A 1S0OA 2OPPA 2F8EX 3VQAA 1U04A 4ED1A 1SV5B 4IRCA 1SKWA 2D3UA 5F8IA 4NRUA 2YKMB 1JKHB 4WFYA 4G3IA 1DLOB 3Q8RB 4DL4A 4PA1A 4QOZB 2AGPA 4ECRA 1RT7B 3CQ8A 4QWBA 3OSPA 1HNIB 2FVRA 1L3TA 5F8MA 5CY4A 3MEGA 3BSNA 1ITGA 3M8PB 5KFQA 4NLPA 3O3FA 3CFPA 4DEZA 4DTJA 1IKWA 1JXLA 4Z4IA 3OYBA 3OYGA 1RTHA 4K4UA 3QERA 1REVB 2BGGA 1NNDA 4URSA 4O0JA 2HNZA 1S0MA 3V1OA 4L8RB 4Q0BA 1VRTB 4HUEA 4HUFA 3T19A 1HPZB 4B08A 1LAVA 2QKKA 1Z26A 4DQPA 3GIKA 3HPOA 4DLGA 4IR9A 1ASVA 1L3VA 1FKPA 2HHQA 3QGGA 2EC0A 1HYSB 3B6OA 4RUCA 2WONB 5EWEA 4OPKA 1C1CA 4OLBA 4FLUA 3QO9B 1KHVA 4HVJA 1I3AA 2R8JA 3H59A 3CM5A 4I2QA 2DY4A 4MFBB 1W25A 1UWBA 3OHAA 2AJQA 3QO9A 2IOCA 3DLRA 5FROA 2AU0A 3OYDA 1RT2A 4RNHA 1FKPB 3KLHB 3OLAA 1S6PB 3HVTB 3OL6A 3TAPA 1WAFA 5HBMA 4ICLB 2X6NA 4KRFA 2P51A 1VSHA 3Q8QB 4ZVGA 3DLKB 1VSIA 3G6XA 3KNAA 1JLAB 2FJXA 1RT3B 4Q0BB 2F8TA 1Q9YA 1S9GB 1S1UB 4IKAA 5KG0A 2R2UA 4KHNA 4DSKA 4JV0A 3KHGA 4ECVA 3T5LA 4PUOB 4KSEB 1WN7A 1NK9A 5C25B 3ULDA 2RPIA 2HB5A 1IKWB 4B9TA 5F8HA 4CFCA 3DLHA 2QXFA 4JS4A 2I5JB 1U48A 1YT3A 4R5PA 1CSJA 4NLUA 3A2FA 1RTDB 4O44A 2YNHA 3MEDA 4Y1DA 5EDWA 4KKOB 4CF9A 3OYFA 1RBUA 1TKTB 3ASMA 3EY1A 4FJNA 5L1IA 2FBVA 1C6VA 1RTDA 3U3YA 5KFNA 1ZETA 4F4YA 4CGIA 3OS1A 3DOKA 1TKZB 5KFGA 3H08A 3KD5E 1SV5A 2I5JA 4M3RA 1NHVA 4DQRA 4DU3A 3SZ2A 4DTSA 3E01B 2IC3B 2OPPB 2XCAA 3KK2B 4URQU 4OVLA 2ATLA 4OGCA 1QQCA 4DLEA 3I0RA 4MK8A 1NK7A 3KJVB 1BCOA 3AO2A 2PY5A 4PQUB 3CDEA 3NL0A 2Z1IA 2C2DA 4YP3A 4OKKA 3V81B 4ELVA 1LWEB 4FJGA 4F2RA 1S10A 1FXXA 3HT3A 2HAIA 1Q8IA 3DYAB 4WFZA 3HYFA 4CJVA 3SUPA 4CF1A 1ZBFA 1HYZA 3AVBA 4CJ5A 4Z0UA 2QK9A 1HYVA 4ED2A 5JS1A 3G86A 3IS9A 4DG1A 1R0AA 3NH2A 2R8HA 3IG1B 5KGWA 1VSKA 2ASJA 5KFJA 1ZBLA 4JRQA 4CK3A 4IG3A 4KO0A 2E9TA 3DRSA 4I2PA 5F8GA 5KRSA 1S6QA 4G1QB 3NF9A 1SKSA 3ZSRA 4YQWA 4CJLA 3LALA 3JYTA 3NAHA 4KAZA 3SUOA 4AH9A 1S1WB 4HCCA 3VQCA 1TV6B 3H98A 3VA0A 4NYNA 3KLIB 1JLEA 4MK9A 3KK3A 3RBEA 4NYZA 3GIJA 4JV1A 5DMRA 5KT4A 1NK0A 1SL2A 4Q44A 4JS5A 3C6UA 3H5YA 5KFZA 4AHRA 4CJPA 4DTUA 2YNFA 3VQ7A 1YTUA 4KHRA 1T7PA 1GX6A 1N6QA 4TXSA 3O3HA 3NGIA 4KHQA 2QE5A 3BSCA 2ALZA 1VSJA 1TK8A 4ZPCA 2XY5A 1XHZA 4B9VA 4M41A 1U4BA 1C0TB 2BRLA 1QSYA 4H4OA 2XGQA 4F4XA 3VQ4A 3IN5A 3VN5A 4RW4A 4ECWA 1QS4A 4ED8A 4DQQA 2IAJB 2XI2A 4IG0B 5KG6A 1Y97A 4RW9A 4OKJA 1DLOA 1JLBA 4FJ7A 4LSNA 3L2QA 4FLWA 3RRHA 2ATQA 3LPTA 5KFXA 4CK1A 2R8GA 2C2RA 3LAKA 4ZP9A 4CERA 1G15A 4RNMA 1VSMA 3L3UA 3WNHA 2ILYA 3PVXA 3OJUA 4J2EA 3OYEA 1HQEB 3OHBA 2KZMA 4W5OA 2FBYA 2Z1JA 4FJ5A 1NJXA 4RNNA 3IAYA 5L1LA 4DS4A 1BISA 3AVCA 2C22A 2AX0A 4UQGA 1QAJA 1B9DA 1FK9A 1VK0A 3P1GA 2G8WA 2C2EA 4Z4CA 4DU4A 5KFYA 3PHEA 4ED3A 1RYRA 2JEJA 3OL9A 4DWIA 1C0UA 4ELTA 1LWFA 4ZVHA 1LW0B 3DM2B 4IR1A 3L2UA 4B9UA 3NHGA 5CZ1A 3KK1B 3LZIA 2X74A 2XHBA 1XR7A 4MKAA 4RW7A 3KK3B 1SH3A 4B9MA 4ZPDA 4N56A 4DTRA 1N5YA 1RA7A 4F3OA 1S1WA 3SQ1A 3NAIA 4FJ8A 1RDDA 3DOLA 2E6MA 1GOAA 4AHCA 5KFPA 5DLFA 1C1AA 5KFHA 1BQNB 4NLSA 1EKEA 1IKXA 2W42A 3PW4A 2Y1IA 3OYHA 3K5LA 1EETB 1RBSA 4IG0A 3QYYA 4TLRA 3RB4A 2ZQBA 1JL2A 1UOCA 2XO7A 3IG1A 4PWDA 3HM9A 3HP9A 4DG1B 4ECYA 3NGYA 3PW2A 3DRRB 1BQMB 2FVPA 3BREA 3CWJA 1C0TA 2QKBA 4H4MB 3GILA 4DQSA 5DGBA 5E41A 3I0SA 4M95A 3NGDA 3RAQA 4AHTA 1TGOA 4E1NA 3DMJA 3SUNA 3OL7A 3M8QB 1KVAA 4KHUA 3KTQA 1TKXB 3MR5A 4WXOA 1EX4A 2KFNA 5KFUA 3PY8A 5I3UA 4RG8A 3PV8A 1JLGA 5EWGA 3G6YA 1QUVA 3ISNC 4J9NA 1BCMA 3KLIA 5CYMB 2W8KA 3LP1A 5T7BA 2E6LA 3PX0A 5C5JA 2VG7B 3V6DA 3QIDA 3PW5A 2FBTA 4BE0A 4YR3A 4E7LA 4E1MA 3QIPA 3BQ1A 3H5XA 1JX4A 2P5GA 3VA3A 4FBUA 3TAMA 4DTXA 1C1BB 2Z1HA 4K50A 4Q43A 4TYAA 1WSGA 4ZPBA 3DLGA 3FFIB 4ECTA 4Z4EA 3KKSA 1RT5B 2VG6B 3LANA 3IS9B 3LWMA 3K57A 4CEFA 1S9EA 2YNGB 1TKTA 5DK5A 3HJFA 3M9OB 3TVKA 4NLGA 4J9MA 2WB4A 4K4WA 4KAIA 3CJ0A 4FZZA 2A1SA 4IDKA 3OL8A 3CM6A 1Q9XA 3AVIA 2FBXA 4CFDA 2KTQA 4CEAA 3MXJA 4EP5A 2RKIA 2BQ3A 1WLJA 1JLCA 1LWEA 2FLNA 4O3NA 3V81A 2OZMA 4DF4A 5KRTA 2VWJA 4Y2CA 4C8OA 3H40A 2YHAA 5DQGA 1D8YA 3FQKA 1TAQA 3HPGA 4I7FA 4DL3A 3O3GA 3S3OA 4OLAA 1X9SA 3K58A 3T3FA 1TP7A 3L2VA 1LW2A 2DTUA 3AVKA 1S1XA 2E9ZA 4OGEA 2IC3A 5DQIA 3M8RA 4ICLA 3N6MA 3Q8SB 3TAEA 3QZ8A 4IKFA 1L5UA 3PO5A 4IDKB 4M3WA 2EHGA 2B4JA 4CIFA 3GYNA 3WNFA 2HW3A 1NJYA 3HVWA 2OYQA 5HLFA 4CGGA 4MFBA 3PJWA 3NF7A 3D28A 2F8SA 3AA5X 4R5PB 3U3GA 4H8KA 3BQ2A 1N48A 3FFIA 4CGFA 4M45A 4Z4HA 4QWCA 2WONA 5KG2A 2GC8A 1HYSA 1HMVA 3TI0A 4BDPA 3OYLA 4DSFA 3V6DB 1RBRA 1RTJA 5HRRA 1VRTA 1ASUA 3OYKA 2YHBA 2R7YA 2HNZB 3THVA 4O3PA 3ZSYA 4Z4FA 1U49A 1RTHB 4Q45A 3BSOA 1MMLA 4DL7A 4GC7A 1S6PA 3SFUA 3V9WA 3AVFA 4LY7A 3DMJB 3RTVA 1HMVB 3PO4A 4JV2A 1K1QA 3NE6A 2HHUA 5J2NA 3KHHA 2XI3A 2W9AA 1SUQA 3PJXA 4EO8A 2GIQA 5KFEA 4K4YA 4BDYA 3MEGB 3GQCA 2OH2A 1UAXA 3EZUA 3GIMA 1RDCA 2RN2A 2A1RA 3LPUA 1QE1B 2R8IA 3V4IB 5EWFA 2HWHA 3DI6A 4OJRA 3ICLA 5KI6A 4DSLA 3MR6A 3RB6A 3EZ5A 3NGZA 4E7HA 1HNVB 4W5NA 2GUIA 1L3SA 5HRNA 1S97A 2WOMB 5SWMA 4CJWA 3ZSQA 4I7FB 3KK1A 3O4QA 1XR5A 2X78A 3PUFA 4IRKA 2FJWA 1C0UB 1WSIA 3CDUA 1W0HA 3VQSA 3M9NB 4QPXA 4E7JA 4TYBA 5KFFA 1HQUB 4QAGA 1FK9B 3LWLA 2AGQA 1FKOA 4DFMA 4HKQA 2R2SA 3QGHA 4LSLA 1QTMA 2W7PA 1N56A 4OPJA 2DPJA 2C28A 3KLGB 3OYJA 1Z25A 2CKWA 3MECB 1IKYB 1RT7A 2IM0A 1MU2A 4ECUA 4ECSA 4TQRA 2BDPA 4CFBA 2VG5B 1GOBA 4KFBA 4FK2A 4LSNB 4XIUA 3B6PA 2BE2B 3BSAA 1TL3A 4F3TA 1RYSA 2OPRB 2VG7A 3AVMA 5FRNA 4FK0A 3QEVA 3VQQA 3AO5A 3P5JA 4RW6A 4CHNA 4C8NA 4TY9A 2RF2A 3AO1A 3LP2A 3HXMA 4CCHA 3N6NA 4WE1B 5HRPA 2G8VA 4KB1A 5I3UB 4W5TA 3SJJA 4B8CA 1BIUA 4R0EA 1VSLA 3PR4A 4N47A 5HROA 3RMBA 4TY8B 4CE9A 3IGVA 3MF5A 3KLFA 2YKNA 3ZT2A 4B9SA 3I5BA 2RF2B 4BACA 3WNEA 3VQ9A 4B9LA 2J6SA 3EPGA 2FLPA 3RMCA 1RNHA 4DTOA 5KGXA 2G8KA 1WSJA 3DRPB 4NCGA 2J6UA 5C24B 1DTTA 4CHQA 4ED6A 2UVVA 1S6QB 1EETA 2UUWA 3BGRB 4AHUA 2BE2A 5DQHA 1BIZA 3WNGA 3BGRA 4DFPA 2D3ZA 1IKXB 3PW0A 1K1SA 4CEBA 1S1TB 4DL2A 4FBTA 2R2TA 4J9LA 1GX5A 3UQSA 3G6VA 4ZTFA 3OYIA 3VQ8A 3DOLB 2VWKA 1CXQA 1S48A 3TABA 2HNDA 5C42B 4FZYA 5KG5A 2B6AB 2IM3A 2P5OA 3H4BA 2YKNB 1J5OA 1TL1A 4EZ9A 3PZPA 3OYNA 2XWYA 3BQ0A 5DG8A 3ZSZA 4NLQA 4FLZA 5J2QA 4FJKA 3QEWA 1LWFB 2DFHA 4CEEA 4CESA 1KRPA 3V1QA 4DSIA 4Q5VA 1I39A 5L1JA 1EP4B 5KFOA 4EYHB 4FXDA 2ZKUA 3SV3A 4HTUA 4EZ6A 1RILA 3QEIA 4QW9A 3OYAA 1IKVA 4TSXA 2PYLA 3QESA 4YNQA 3CJ4A 4BDZA 3NAEA 3KOAA 1J9AA 2XY6A 1RT1A 3I0RB 5FDLA 4EBEA 3KK2A 1HQEA 4WYWA 2HNYB 4FJMA 1S5JA 1RBTA 3E01A 3RR7A 4N41A 4NLDA 3K59A 4IRDA 3LP0A 4F8RA 3SQ2A 2ITGA 1TKZA 1Z4UA 4XPCA 5I42A 5KFDA 3OLBA 3NF6A 1JLBB 5SZTA 3DI6B 1JLQA 3IRXB 4IFVA 4C8MA 4KHYA 1IKYA 4F4WA 1QE1A 3H2LA 4KHMA 4N76A 3NH1A 2I1RA 1JIHA 3KLGA 1RDBA 4ED7A 3NDKA 3OJSA 3ZSOA 2QV6A 4M3ZA 5KG1A 5T14A 3AO4A 5F8NA 2B5JB 3L8BA 4Z4GA 1OS5A 3V6KA 5J2NB 4ZVEA 2Q3SA 1WSHA 4NLXA 4YR2A 4GVMA 2UUTA 4O0IA 4KBIA 1VRUB 5KFIA 5C25A 2YNFB 2D5RA 2IA6A 5KTQA 4CGJA 1NKBA 3UR0A 1KFSA 1KHWA 2WOMA 1RT3A 1JLEB 2DFFA 5D3GA 4WYLA 3SPYA 4B8AB 4IQXA 1RTJB 1HNVA 4O3QA 4FCYA 4ECXA 4M94A 3CFRA 1TQLA 5DLGA 4YR0A 4XO0A 5F8JA 1S1VA 3ZT0A 4JLHA 2D0CA 1RT2B 3MEEA 1B9FA 3V4IA 1IG9A 4Y1CA 3TR8A 2O5DA 2HMIB 5J2PA 5JXSA 2IMWP 2UVWA 1RT6A 3ISND 4FJ9A 2JGUA 1CXUA 1WNSA 5F9NA 4K4ZA 4NLOA 4LQ3A 3HL8A 2D7SA 3QEXA 3AVNA 3MEEB 1SH0A 2IDOA 3DYAA 4KPYA 1QHTA 2ZD1A 5DGAA 3C6TA 1XC9A 4E0DA 4BE2A 4W5RA 2HHXA 1RTIB 3NMAA 3FRZA 4ECZA 5CYQB 5HP1B 4FLYA 4MKBA 4O55A 1LW2B 3QETA 2YNIA 3S9HA 2AGOA 3ZCMA 3TWHA 2IM2A 3KLVA 4RNFA 1TVRA 1S9FA 5J2MB 5KFRA 4WZMA 4CF2A 3OVNA 4CJQA 1JLCB 1KFDA 4RUAA 4J9OA 3DOKB 3H4DA 3GV7B 4KI6A 4U7CA 5KFVA 1KSPA 3CVKA 3CG7A 2BQRA 4Y2AA 4DL6A 3QIOA 5KG4A 2RDIA 3QNNA 3V9XA 3PX6A 1SL1A 4CEQA 5F9LA 1JKHA 4ECQA 4FJIA 5J1EB 1RT5A 5I42B 4GMJB 1JXBA 4FS2A 3E51A 4JRPA 3AO3A 4KHSA 1A5XA 1ZTWA 4U6PA 3RAXA 2V4RA 4F4KA 4QWAA 2AX1A 2VA3A 4CJ4A 4MK7A 3MTKA 3LP1B 4RW8A 3DLEB 2ASDA 3ZSVA 5JUMA 4RZRA 1JLAA 5CYQA 4QCLA 3H5UA 3K5NA 3V6HA 4DMNA 4GC6A 2HVIA 3HVTA 2XY8A 2ZE2A 2Z1GA 5J2QB 5L9XA 4ED0A 3ALYA 3H5SA 4E7IA 3OYMA 4CF8A 4CIGA 5F8LA 4B3OA 4AILC 4EP4A 2WHOA 3SQ0A 1SH2A 3SV4A 2R2RA 2RDJA 2YNGA 1D1UA 1S49A 1S9EB 4KREA 3AVJA 1S4FA 4I2QB 2G8IA 1LV5A 2XGPA 2VG6A 4LQ9A 4CEZA 1KLNA 4Q8FA 1LWCB 2HMIA 3TAGA 1S1TA 1C1CB 1T3NA 1IM4A 4DTPA 3DLBA 4ZPAA 1WSEA 3TAMB 4ZP7A 3LZJA 1D5AA 1WAJA 3QIPB 5KFLA 1U45A 1TAUA 1JXEA 3PR5B 2FJVA 4NCBA 3HSTB 1KLMB 2DFEA 1QAIA 5CYMA 3CJ5A 2IBKA 4IOBA 1BI4B 3QLHB 4O3SA 2D0AA 4CJSA 4MIBA 2BR0A 2ETJA 1JLGB 4NRTA 1T8EA 5HROB 1REVA 3CFOA 4J9QA 4EO6A 4FM0A 2FVQA 3LP3A 4DFJA 2HHWA 2IS3A 1ZTTA 4DU1A 3UPFA 3I0SB 3UIQA 4ZMMA 3LP2B 4IH5A 4CEOA 4H4MA 3S3NA 3MXMA 4NLTA 2JC1A 4E89A 2G8UA 2O4IA 4NCAA 1VSEA 4KI4A 1HJRA 3K5MA 3M8PA 4DTNA 3HK2A 3NCIA 4CJUA 2DPIA 2WRMA 4IH7A 4PWDB 3K5OA 1HNIA 4NLRA 4KTQA 1HRHA 3PX4A 3I5AA 2WTFA 5KG3A 3D45A 1T94A 5KT3A 4LD0A 4O3RA 1TK0A 3MR2A 4KE5A 4CJFA 2VG5A 1JLFA 4ZVFA 3RB0A 4JUZA 2F96A 3G0ZA 2KFZA 3KLEB 3T5KA 3AVLA 4KTZA 2J6TA 4FYDA 4MQ3A 1N5YB 3SYZA 1K6YA 3CO9A 3GV8B 4XPEA 4TN2A 2BQUA 1TK5A 4MH8A 4RW4B 4RW7B 4IFYA 4GW6A 3VQDA 3HHKA 4H4OB 4K4TA 3QINA 3V9SA 1HARA 3CJ3A 4WXWA 2OPSA 3AA4A 3SNNA 4K8XA 4DSEA 1HQUA 2IJFA 3SFGA 2AQ4A 1X9WA 3T1AA 4K4SA 4CECA 3AA3A 1LAWA 3M8SA 3GIIA 3MAQA 5FRMA 4ID5A 3T5JA 4CJEA 1BI4A 2D41A 2HWIA 4OKEA 3KLEA 1TV6A 1D0EA 2HNDB 2CJQA 3CJ2A 5EUHA 1JLFB 3JYTB 4KV8B 4LH5A 4RW9B 3DRSB 4I2PB 3VQBA 4EBCA 1ASWA 5KFAA 5K14B 4C8LA 2E4LA 2IAJA 1R0AB 5KFMA 4BWJA 1RDRA 4DSJA 3KHLA 1U09A 1WNEA 1ZBHA 5DG7A 4NLWA 3DRPA 1I6JA 3KHRA 3AV9A 4WFXA 4QWEA 2KW4A 4H54A 4TY8A 4B9NA 1N6QB 3TAFA 4FJLA 4CFAA 1IO2A 3S3MA 4J2AA 1ZBUA 3V9ZA 4R8UA 4M42A 3MXIA 4J9SA 4NLVA 3NF8A 4WZQA 4RW6B 3QLHA 4FLXA 1CLQA 3ZT1A 3DLEA 4RW8B 1NOZA 1XHXA 1NKCA 3HKWA 4J9KA 4X2BA 2W9CB 4F4ZA 3F73A 2R8KA 5CZ2A 2O4GA 4CEDA 2XCPA 2IJNA 2LSNA 2GBZA 1SL0A 4IG3B 3D5MA 3ZT3A 4EEYA 4EYIB 4NZ0A 1CZ9A 1LWCA 1NK8A 1J53A 4QWDA 2JEIA 4O4GB 1EXQA 4HHTA 1O1WA 2IGIA 4IBNA 1RCHA 3L3VA 2BANB 1T05A 3NFAA 3SI8A 4KKOA 2ASLA 2YNHB 3MEDB 4FVMA 4O44B 4LSLB 2PYJA 2YV0X 4ZP8A 5JS2A 5KG7A 4F2SA 3OSNA 3Q8PB 3N6LA 1B92A 4ID1A 3BR9A 4CJ3A 5KFSA 4O3OA 3NBPA 2W9BB 3LDSA 3FSIA 3BDPA 3QEPA 1S1XB 1TVRB 1UA1A 3T5HA 1J54A 4PQUA 5KFWA 3TQ1A 3CYMA 2FLLA 2YNIB 4K8ZA 4FJXA 1S9GA 4K4XA 4E3SA 5HP1A 2JC0A 2ILZA 4OL8A 2FVSA 2XY7A 2WCXA 5HBMB 1N4LA 1XWLA 2RKIB 5KFTA 4HYKA 3C6TB 4CGDA 5J1EA 2IM1A 4J9PA 1KTQA 2PZSA 3KLHA 1KCFA 4ZTJA 5KT2A 3I8DA 1T05B 5KFCA 3C95A 4FJJA 2OZSA 1JL1A 3V1RA 2GV9A 4O4GA 3ZT4A 3L2RA 1D9FA 3GV5B 5KT7A 1RT6B 2P1JA 3BJYA 3HO1A 4PY5A 4DS5A 5J2PB 1SUQB 3DLGB 3I5CA 3O4NA 4CHYA 4HCBA 4KHWA 1C1BA 4BE1A 5J2MA 3L2WA 3D0PA 3HVRA 4CHZA 1RT4B 3JSMA 4E7KA 4W5QA 4PUOA 3RBDA 1YTAA 4CK2A 3SCXA 2HVHA 4CF0A 1S1UA 4KTWA 5D3GB 4CJTA 1L3UA 3SPZA 3DLKA 1NK5A 1RTIA 3VQ6A 1D9DA 4R8UB 1A5WA 3ZSWA 3AVAA 3KIOA 4HUGA 3JSMB 1RT4A 2ZD1B 3NH0A 4FLVA 4URGA 4KB7A 2GIRA 2V4QA 1UWBB 3V9UA 2B5JA 3OS2A 5KFBA 3P83D 2UVRA 2JLEA 5L1KA 3SI6A 5HLFB 3KKRA 4FW2A 3SQ4A 1NJWA 2V0NA 1BHLA 3HPHA 3RWUA 3M9MB 1NK6A 1X1PA 1QSLA 3CIZA 3OYCA 1S1VB 4KV8A 4M3UA 3EPIA 2G8FA 2FVCA 4YMEA 4NLYA 2KQ2A 1NJZA 1HPZA 4I9QA 4FM1A 2HNYA 4J9RA 3KMQA 3TAQA 2BRKA 4ID5B 1A5VA 4K4VA 5KT6A 1KVBA 2FC0A 4RU9A 4DL5A 1LW0A 3DM2A 4Y34A 4FM2A 2UVUA 1VRUA 1W9HA 3NBPB 2W9BA 3DDKA 2OPQA 1C2PA 2XRIA 3RMDA 1RDAA 3NKYA 4DTMA 4DF8A 1F21A 3EYZA 1NKEA 1RA6A 3ITHB 2HHSA 4ZHRA 1YVFA 4IH6A 4O5BA 1VSDA 2X6SA 1WSFA 1U47A 3KD1E 4Y3CA 2BANA 2B6AA 4O4RA 2WK4A 3AVHA 2V9WA 5C42A 4AHVA 2B43A 4J2DA 3F9KA 1JLQB 3IRXA 4IFVB 1S0NA 2OA8A 3U6FA 4M3TA 3K2PA 1NHUA 1BGXT 2YKMA 4E19A 1QSSA 5HRSA 3MR3A 3OS0A 3FDSA 2KZZA 1UA0A 3LP0B 1XR6A 3PW7A 3AVGA 1VSFA 4YFUA 1YVUA 1DTTB 4FS1A 5FDLB 4NYFA 3VQ5A 3ZSXA 1C0MA 3QNOA 2W9CA 3VQPA 4NCGB 3G10A 4Q8EA 1RT1B 4DQIA 4CGHA 5KT5A 3UDLA 1NOYA 4ZP6A 4QW8A 1IKVB 4CIEA 4EBDA 4BWMA 4CHPA 2Y1JA 3SUQA 3KLFB 1EP4A 4DFKA 3RR8A 1TKXA 2G8HA 1SKRA 3M8QA 3C6UB 3LAMA 3QGIA 3VQEA 1T03B 1X9MA 4WE1A 1TL1B 3CDWA 1J5OB 3MFIA 4CJRA 4LH4A 2AWZA 2HHVA 3FQLA 3RMAA 4J2BA 1DTQA 1BQMA 3DRRA 1KLMA 4CJKA 2EX3A 2E9RX 4ELUA 4G1QA 5K14A 1TL3B 4MIAA 4FZXC 3QZ7A 4KO0B 4FK4A 1BQNA 2JEGA 3V6JA 3RRGA 2XC9A 1KVCA 4KFBB 5C24A 1RBVA 1TKDA 4C8KA 2NUBA 1NK4A 1MU2B 1GOCA 4TQSA 3MECA 1DTQB 2HHTA 4FJHA 4B3OB 4ZHRB 5KFKA 1BL3A 4CHOA 3ITHA 1T03A 4FLTA 2VA2A 3OY9A 4KB0A 3IGNA 1CZBA 1FKOB 2ZE2B 3RB3A 4AHSA 2OPQB 3HP6A 5EU7A 2OPSB 3TARA 5DG9A 2W8LA 4I9LA 3HVAA 3TANA 2JEFA 3KJVA 4F50A 1ZBIA 4M3XA
chains in the Genus database with same CATH superfamily
2ZBPA 4IFYB 3DJCA 4ISFA 3V4MA 1S4EA 4R25A 4M3YA 1XN9A 1NWKA 1S0OA 4ZCIA 4B1VA 1N33F 4TLQA 3C0BA 1U04A 5IOLA 2CIMA 5F8IA 3C19A 3M1VA 2KM8C 1IJFB 4OLPA 4WFYA 1NRKA 2V69A 3GP9A 1IG8A 4QOZB 3CE8A 1RT7B 3SQGB 4ECRA 3CQ8A 3OSPA 1HNIB 1L3TA 3QT6A 5F8MA 2YWFA 1YJNS 3DGPB 3BSNA 2KHDA 2WBRA 2VQFJ 5KFQA 3GTYX 3OTBA 1KVIA 2E20A 1WG4A 1Y3KA 4DEZA 4DTJA 1VJWA 3MI7X 4H4KA 1IKWA 1R8HA 2HPUA 3LO3A 3HLUA 2HGMA 5SUHA 1Q4RA 5CYJA 2BA9A 2K7JA 4U96A 2ZITA 2HFSA 3GYXB 4CLUA 4L8RB 2COLA 4Q0BA 4DV5J 2DHHA 2CPEA 4HUFA 1EWRA 3I82A 4B08A 2GV1A 2VD3A 3GIKA 3R5BA 2E66A 1BMQB 1PG5B 1HYSB 2W4CA 5FPMA 2HQ3A 4FLUA 3QO9B 4I64A 1KHVA 1WBDA 3CMAN 2P9IB 1I3AA 4ZLLA 3CM5A 2HBLA 3IRWP 3GE9A 4MFBB 3ZTPA 4CH0S 1R8BA 2M0GB 4ILGB 4TKTA 2WAQD 2HQGA 2JFKA 3H20A 3DLRA 2BEFA 3AGRA 2HHHK 2HHHJ 4C7QA 2CZ4A 1D9AA 3VENA 1FKPB 2YBVA 3P5BP 4I6YA 4C0BA 3CCUN 3CCMS 2ZNYA 3OL6A 1SJ4P 1NPKA 4OIXA 2RB7A 4X4RA 4ICLB 2X6NA 3FNNA 1VQOS 5FJ4A 2QYCA 3TVZA 2UZAA 1TYQA 3QWUA 1JLAB 1RT3B 1YQHA 3AOAA 1U6FA 4KHNA 4C3LA 2Z30B 3GLJA 4JV0A 3O9UA 4ECVA 2AYBA 4QYRA 1DAXA 5F0UA 2HB5A 5CQGA 2W24A 2FDNA 1U48A 4BBYA 3UI3A 3H3OB 3ET6A 2CJKA 4R5PA 4NLUA 4DOZA 2H3GX 5HN0A 1RTDB 3PHTA 2D3OR 3POTA 2Z4PA 5EDWA 5A8KB 1W26A 3OYFA 1RAFB 2MDAA 1RBUA 3J7Z5 2Q1NA 4FJNA 5L1IA 2FBVA 4FYWB 1RTDA 4M7XA 1SC3B 2L9WA 5KFNA 1ZETA 1Z6RA 3A13A 2KT3A 4DR5J 2P9LB 3VEZA 1SS6A 1YJ7A 3DOKA 1TKZB 2MJNA 4M3RA 1NHVA 4V19S 4DU3A 2IC3B 1WDTA 2OPPB 3N4PA 3MM8A 1HWIA 2FHJD 4USWA 1K73O 4OHWA 1YHQS 1NK7A 4K0KF 2C2MB 1BCOA 3AO2A 2PY5A 1E6VB 2RRAA 2CNNB 1OSDA 4DV4J 4YP3A 2ZH3A 4PG6A 4KQZA 4ELVA 2APOA 1LWEB 3PACA 4FJGA 2F7VA 4CLLA 3EKSA 2WBMA 4ETXA 4B3RK 3DU5A 5ETTA 4PXDA 2W2PP 3DYAB 4WFZA 1WJ9A 4LF5J 1RU2A 1VC5A 1VCTA 2EG1A 4Z0UA 5JS1A 4BRCA 1P27B 4OYMA 1U2VB 3IS9A 2R8HA 4C1NI 4NI2A 1FWLA 3HDSA 4A5AA 2XLKA 1RHKB 2CGKA 3CCLS 4I2PA 4Y0WA 5FLXY 2IDLA 3NF9A 4TVAB 2B9YA 2GIFA 4KAZA 2HZCA 5LSRA 1IQZA 2YKAA 4F67A 3KLIB 3M6VA 3ZX0A 4JV1A 4BRNA 5KT4A 3H1QA 4FPRA 4ILJA 5KFZA 3AH6A 1Q5VA 1GX6A 4TXSA 3IR6B 4K43A 5LOQA 2E1PA 2QE5A 2ALZA 2RS2A 2WVEA 1DJ0A 2XSJA 4Y2KA 2VQEK 2KXNB 5F3ZA 4Y6IA 3W9IA 4H4OA 1JXVA 1VQ7S 3O1LA 5IT9U 2CPYA 2OEMA 3VQ4A 3QGPA 4ED8A 3CDAA 4JI4J 4OHXA 2GZOA 3CW2C 2V7YA 1DLOA 3KUGA 3NG8A 3KJQB 4LSNA 5IWAK 4FLWA 3RRHA 5FPEA 5I3PA 5LSOA 3HI9A 3LAKA 2C2RA 3WNHA 3OJUA 3EGVA 2XHWA 3OYEA 3OHBA 4M5HA 4PKGA 4OX9F 1QVGM 4RNNA 1YDLA 1WC6A 5L1LA 1VQ5S 2FY1A 3TJ9A 4FZVA 2AX0A 2KKZA 2ABYA 4Z4CA 1WF2A 4DU4A 2MZJA 3PHEA 3BPSP 2CZVC 3OL9A 3IAM9 2HRYA 4X4QA 1C0UA 4ZVHA 1P6TA 3DM2B 1Q86T 3L2UA 3NHGA 5CZ1A 1EJ7L 4MKAA 4RW7A 2ZFHA 1WI8A 4DTRA 3F0NA 1RHRB 1OVQA 3OFEA 4M5JA 3DOLA 3CJCA 1XMQF 2DITA 1C1AA 1NM2A 1VQ5N 1IKXA 3B54A 1TFWA 2Y1IA 3OYHA 4J5OA 4PPZA 3P4UB 3QYYA 1G3OA 2JZ5A 3U9DA 2XO7A 4NI2B 4PWDA 3TTCA 3PW2A 3CD0A 3HKZD 1WHYA 1OO0B 1HR0F 3DHXA 3Q22A 3CJ8A 2Z2LA 2Z57B 3ULEA 4H4MB 4DQSA 4DUZK 4X4VA 2MZTA 5D4NA 2MEWA 3OVAA 1VQLN 4EUVA 1KVAA 2AF6A 2FF6A 4Z7CA 2VC0A 1VMBA 4WXOA 2KFNA 5KFUA 1RBOB 2UUAJ 4LF4K 2HZAA 2GAGC 4A4JA 1BCMA 3LP1A 2E6LA 3PX0A 5THWA 3GG4A 5BRDA 2HAFA 2FBTA 4CD1A 3HOSA 3IMXA 4YR3A 4E7LA 3Q24A 4E1MA 3QIPA 3M2UB 1AZSB 3VA3A 3NNAA 4RU2A 2Y3YA 3T9NA 3DRXA 1UWAA 3PCOB 2N7CA 4FSVA 2XG8A 3BO2A 3LWMA 4ILMA 1S9EA 3U27A 3H0PA 3DCAA 2BVZA 4A8KA 3MMJA 1WACA 2X7IA 2JFDA 4J9MA 3TVYA 1LNQA 2PFFB 4FZZA 3WIUA 2A1SA 4EHTA 1OQ6A 3CM6A 2V6AA 1HUXA 2KTQA 4CEAA 4EP5A 5CCMA 3SCKE 1S0VA 4LF8J 4IWVA 4HVZA 1E6YA 5B0CA 2E1RA 2ZNZA 4ES2A 1RAHB 3FQKA 1TR0A 1SBRA 1KVJA 2C2OB 3CC4N 3S3OA 4ED4A 3K58A 1TP7A 5ADZA 1XNQK 4MTPA 3X3UA 3AVKA 3OR1B 2HK3A 5DQIA 3M8RA 4A8XA 1BWFO 4ICLA 1BUPA 1HHQA 2KXHA 3DXBA 3QZ8A 4IJNA 3CHWA 3THWB 4IDKB 1VK8A 2DGVA 2LFVA 2B4JA 1CJKA 3WNFA 2LLZA 3D3BJ 1DKGD 2G2YA 2PC6A 1UL3A 5HK4A 3LGNA 4CGGA 2F8HA 4UUXA 4AXJA 3PSIA 3D28A 3MPWA 5CH7B 2Y0BB 1MN7A 2HMPA 2PO4A 2XHCA 1M1KT 3FFIA 2EXUA 2EG2A 5HMWA 1CPZA 4JI7F 4AUKA 1IBCB 1HBOB 1FWKA 2EPIA 1YTYA 4RUBA 3V6DB 1VRQC 1JCEA 2LXIA 1ASUA 3OYKA 1N36J 3KG0A 4ZVOB 4QR0A 3THTA 4Z4FA 8ATCB 4Q45A 5ETKA 1MMLA 1HBMB 4EFHA 3UN3A 3DMJB 3PO4A 4JV2A 1K1QA 3F5TA 2ZZNA 2HHUA 2NRVA 4NB4A 2VJUA 3KHHA 1HD0A 4HACB 2W9AA 1UPMB 4P7TA 4LF7K 3W2VB 4GVEA 2Q43A 2JDJA 4BDYA 4MYTA 5ETRA 1T02A 2OH2A 1UAXA 1RDCA 3SJHA 2A1RA 1U1RA 2R8IA 1PYOB 3VGLA 5EWFA 3KWGA 2LKZA 3MOZA 3ID6A 1Q8LA 4A8QA 3MHYA 2UXBF 2XYGB 2J4RA 3CMES 1FXDA 4JEPA 5AQKA 4E7HA 2L48A 1HNXF 4K0KJ 3A4TA 1TL7B 1IBLF 4CJWA 3ZSQA 2GMHA 5J1NA 3E9OA 5AQTA 1N5TA 5LMNF 2X78A 4IRKA 1RLDA 1WSIA 1X5SA 1W0HA 1XUPO 3M9NB 4QPXA 3R7NB 5KFFA 3DLLL 1FK9B 3LWLA 2AGQA 1FKOA 1F5AA 4DFMA 3H1VX 3MUVP 3I6PA 2J76E 1QTMA 2W7PA 4X66K 1N56A 2C3OA 1RP5A 3KLGB 4W92B 2QEXN 1S99A 1FJ7A 2GS8A 4PYAA 1IKYB 2IM0A 4ECUA 2FTRA 1SVDA 4FK2A 4KFBA 5L8RC 4OYIA 3JS9A 3GG1A 4L75A 1VQMN 4XIUA 3B6PA 4WQ4C 4C11A 2BE2B 2OMOA 1HLWA 4ZK7M 2CPFA 4NLCA 3IWXA 3ZZUA 2OPRB 1FNXH 5FRNA 4FK0A 1YJRA 4K41A 3AO5A 4C8NA 4U8VA 3JS6A 3LP2A 3AXKA 1YLXA 3DLLQ 1U0SA 3HXMA 4YY3F 2G8VA 3HHLD 3ATVA 4ZVSB 4CLZA 2W2OP 2V4JB 4O8KA 1Q81O 4YB6A 3PR4A 5HROA 4CE9A 3AJ2A 3VAMA 3KLFA 3U8XA 2YKNA 2QL7B 1T9VA 3ZT2A 2RF2B 2J6SA 3EPGA 3RMCA 4YORA 1RNHA 5DDOC 1VC0A 4JI5F 2G8KA 1WSJA 3DRPB 3CJRA 1VFJA 3MMVA 4GKKK 1NGFA 3TX0A 5KPZA 4ED6A 4DPYA 1RWVB 2O67A 1ACMB 1EETA 2CH5A 3BGRB 4AHUA 2ZBCA 4DFPA 4NASA 1TL4A 1B7YB 4FBTA 4NA3A 3QT8A 4UZCA 1KR4A 5KG5A 1AROP 2IM3A 2NQPA 2FHOB 2YKNB 3NNHA 1TL1A 4EZ9A 2BJ1A 3BS9A 2PEHA 2E7WA 4FLZA 4JOUA 4AQYJ 1XMOJ 1APSA 2IMOA 3V1QA 3PYFA 4U7UK 4CH1A 5L1JA 4FXDA 2DPNA 3G6ES 4EZ6A 2MKHA 4DB3A 3UKUB 3QEIA 2KHOA 3OYAA 1IKVA 4E1JA 1CEZA 4PEOA 2DIUA 1ESVA 1J9AA 2PI5A 4FL9A 4AL7A 2XB2D 4X4UA 2OANA 3QB0A 2DXEA 2HNYB 2AZ1A 4RBTA 4UY8T 5ETMA 1H2VZ 2HZVA 3SQ2A 3UE2A 2ITGA 3FFKB 3TU5A 5I42A 5KFDA 4ZPWR 3EICA 2PA8D 1Q5YA 4OPAA 1DY3A 5BR8J 1JLQA 2NXCA 4C8MA 4KHYA 1JMTA 1B7FA 1QVFM 3NH1A 1JIHA 3KLGA 2QWRA 4R0JA 3NDKA 4ANDA 4JI1J 3J81U 3VESA 1I94F 5T14A 3AO4A 3DDIA 5F8NA 4Z4GA 3AJ1A 5BRFA 3D1HA 3GL1A 3AAQA 4NLXA 4O0IA 3LGHA 4ZKAA 4KBIA 3W9JA 5KFIA 1ZBSA 4ZIVA 4H5NA 4BR9A 2IA6A 3CJ1A 1NKBA 3VEYA 4AL5A 2BJEA 2MSTA 1KFSA 5I9EB 3VR1A 2VPZB 2QIFA 4K7QA 5D3GA 4WYLA 2ZZMA 5M1FA 4FCYA 5JVGQ 5DDQC 5F8JA 1WUAA 3NGRA 1S1VA 4WKYA 1MWQA 2D0CA 1SQFA 3D1QA 3DOMA 4PG7A 3MEEA 1B9FA 2YQ3A 5E3PA 3V4IA 3Q7BA 1WELA 2JLFA 4C0OC 5BR8K 5EHHA 4JI7K 1LQ9A 3L6QA 3W2VA 3K17A 3UKRB 4K4ZA 2DNQA 4HACA 4AFFA 2GMJA 2ASPA 1CS4A 2DHXA 4KYZA 1QHTA 1X8DA 2ZD1A 4DR2K 1RHQB 1RSCA 3N5BA 1F2GA 5GMDA 4BE2A 1U1PA 3BH7B 1E4FT 3UD3P 1RCOB 2CUYA 5GAGU 3SIPB 3QRQA 2YY3A 2BTFA 5A0YB 1KP6A 3CCLN 2SXLA 2Q31A 1FE0A 4B02A 5HJXA 3M8YA 2IM2A 3F56A 4OX7A 1S9FA 5ETQA 5J2MB 5KFRA 4WZMA 1IN0A 4GVBA 3H4DA 1DGKN 2H51B 3JTOA 1Q79A 3VGKA 2W1BA 1MWMA 5B0DA 2M3DA 4XAKA 3CG7A 4Y2AA 2IDEA 4AQYF 1XMOF 3CCTA 1NBWA 4CEQA 3THWA 2AEJA 1Q7LB 5LL6d 3VGUA 4JKFA 1M5VC 5I42B 2N4CA 2U2FA 1JXBA 5B08A 3MGJA 4JRPA 3CQXA 4KHSA 1U24A 4OYZA 3QDKA 2DR8A 4FN5A 1RI7A 1P9QC 1JJCB 4UF4A 4CJ4A 2CQHA 3DLEB 3AB4B 2OAUA 1F1BB 1ICEB 3OTDA 5JUMA 3ZSVA 2IPOB 2R7XA 2AIRB 3EVWA 1H7XA 3MCAB 2IA0A 4ZVRB 2GELA 5LM7E 4Q7AA 4C6AA 2PT0A 2DHSA 4DPOA 5J2QB 5E26A 4YN3B 2P8IA 1VJQA 3CMEN 5GAEI 1YBTA 4YDUA 4B3OA 1NGAA 2R2RA 4DR2F 1S9EB 1S4FA 4CLPA 1XNRJ 3FGVA 5C7PA 2D69A 2YH0A 3ENWA 1RWXB 1OMSA 4CT8A 3CMAS 3M2VA 1T3NA 4DTPA 1VBXA 3RBZA 4ZP7A 4CZEA 4IUFA 2XMMA 1BUXA 3QIPB 3I8BA 1U26A 1NH8A 3HSTB 1KLMB 4DZ6A 2DFEA 2ADCA 3NGKA 3QLHB 5DZ7A 2D0AA 3AA8A 2L3MA 4MIBA 2BR0A 5HROB 3VF0B 4EO6A 4DFJA 5FLXU 2HIQA 3C2PA 2IS3A 2CQ2A 3I0SB 4IXCA 3GR0A 2F4VK 2F7TA 2DNOA 5K5MA 3DXMB 3G71N 3S3NA 3MXMA 1TU0B 2E2QA 4E89A 2O4IA 4NCAA 2UUBK 3K5MA 3TW0A 3HK2A 4DTNA 3NCIA 3QFWA 1JNRB 3K5OA 3ILOA 3I5AA 4O0NA 3D45A 4LD0A 1XERA 3FR0A 5HVGA 2GAHC 3MX5A 3MR2A 2VG5A 1JLFA 4X4NA 1HLUA 1NGCA 1VI7A 3O5TB 3G0ZA 3T5KA 3AVLA 2J6TA 3SYZA 1S59A 4PG5A 1NM1A 5GMKa 4XPEA 4CRJA 2C2ZB 2MKKA 4RW4B 3MPUB 1FWPA 2HURA 4GW6A 3HHKA 1VLOA 3BF4A 2ZEJA 4UOGA 3MPYA 3QINA 2EI5A 5AFUH 3V9SA 4B1YB 4WXWA 3BYRA 3AA4A 3RBXA 4TU9A 4DSEA 1V4SA 1HQUA 3SFGA 4K4SA 2CNLB 4KH0B 4BHQA 3GIIA 2ZHAA 5AXMA 4LRAA 3T5JA 1BI4A 5BPMA 2HWIA 3TUPA 1D0EA 4B3MK 1HWLA 2HNDB 2UUBJ 2WUSA 5EUHA 3UCGA 2F65A 1NGBA 4YOUA 2DD8S 3JYTB 4N77A 3TA1A 3K89A 4FWRA 1YJNN 4LH5A 2UV8A 2OTJN 2R7RA 2YKOA 3AA9A 3FZHA 4JI6K 4RCHA 3KHLA 1U09A 3NLCA 3W3DA 1K9MO 4A8YA 1S77D 2YHWA 3VEXA 4BRDA 2B4OA 1RWOB 2VQFF 2D1CA 4BRFA 2QWMA 2OKQA 2UUBF 4CFAA 4H5TA 4J2AA 3T1HF 1ZS6A 3FJ2A 1KDNA 3W66A 3K0SA 2WB1D 4NLVA 3OFHA 3NF8A 1KEKA 1H6KX 2GA7A 4FWNA 3A5LC 1IWAA 2CQDA 1ZC6A 3VAIA 2VGMA 1GXTA 2B8QA 2XCPA 2LSNA 2VWBA 2CQBA 3JSRA 4EYIB 5AQFA 1NCLA 4NZ0A 1WOSA 1NK8A 1J53A 3EGWB 3O2IA 3B4MA 3A12A 4OI1A 4IBNA 3QMLA 1JCFA 1YJ9S 4LSLB 1WC0A 5K8MA 2OP5A 5KG7A 2VFRA 1YIJS 2ZWHA 1GLCG 4F2SA 2EFVA 3Q8PB 1M5PC 4CJ3A 2GEMA 1NSQA 5KFSA 3FSIA 2KYXA 2PAVA 1WI6A 3QEPA 3UW1A 3T5HA 1E6VA 2QSFA 2HFNA 1Q7YO 3TEHB 4LBPA 1IR0A 5AXKA 2LQJA 2F63A 4DV0F 1SPBP 3ZZYA 3JAMO 1Z2LA 2KG0A 3UDEA 2WCXA 2Y9HA 2DISA 1FI4A 3EGNA 3C6TB 4CGDA 1WD6A 4F25A 1RAIB 3BBFA 1KCFA 1OH6A 1S7IA 2X1BA 5C2CA 2O8CA 1QD1A 1A0OB 5KT2A 5DETA 4E2FB 3OVBA 4CZGA 2I9SA 2J0XA 5A8KA 4OQJA 1JL1A 3M2RA 3THYA 5D15A 3BN7A 4DS5A 2CJBA 3KDNA 1B0PA 2VASA 3QAUA 4M1KA 1HD1A 4HCBA 2XZDB 5MLCV 1VQNN 2EBGA 4DR3J 2QLXA 4ZDNA 1EO1A 1XEZA 3RBDA 1YJ9N 4C8ZA 3RUBL 3SCXA 3FSYA 5AJ3F 1FXRA 4X4OA 1S76D 2AHOB 1R7IA 3TUJC 1NMDA 3OFGA 3I4HX 2BKOA 4FPBA 4CLYA 3AAPA 1A5WA 2PN6A 1V3SA 1Y0HA 2V7ZA 2XTJP 4UOHA 3AVAA 2C3UA 5L38A 4NEZA 2ZD1B 3EDQB 2OFHX 5CZXA 5JMNA 2V52B 2LP4A 3ULEB 1SQKA 1WTBA 2HYIB 4KB7A 2GIRA 2V4QA 5M1PA 2I7NA 2XBPA 3FLCO 1T9UA 3HSGA 3P83D 2BACA 3CUNA 5HLFB 4JV5J 1BOTO 1NB7A 2K1RB 1BA0A 4USMA 3MN7A 2PD1A 3SQ4A 2OSQA 2OMLA 2G0CA 3VGSA 2WVDA 2FVCA 1M1KO 4NLYA 4BR0A 2G1DA 1HPZA 2MHNA 4J9RA 3KMQA 3O1WA 4GMKA 4BROA 3ZZPA 3LM9A 3DM2A 1Y5LB 4YS2A 1MA9B 2JNJA 2VC1A 4JV5F 4FF4A 1W9HA 4GKJJ 2OPQA 3MN9A 2RJZA 1Y3JA 1VBZA 1N5VA 2W41A 1F21A 3LDQA 1UTAA 1RA6A 5D6GA 1ZPWX 4IH6A 2CPIA 2RVJA 1WHVA 4O4RA 3SQGA 2V9WA 5D4LA 4AHVA 3F9KA 1JLQB 3PRVA 2HBQB 4JI4F 1BGXT 1QM9A 3AODA 5HRSA 3CNQP 3FDSA 1SC6A 2ZH6A 3GCWP 3P45B 5EXWA 3AVGA 1XQSC 3MM5B 2I6WA 4FS1A 3ZSXA 1YGYA 2NXNA 1P90A 4JKHA 4Q8EA 2CPDA 1OPZA 3E3XA 2VFTA 2VONA 4QW8A 1ZAVA 3MUTP 3CT9A 1FO1A 2G8HA 2H48B 2DY1A 3M8QA 4DPWA 1TL1B 2EK6A 2J5AA 2VFUA 4CJRA 3QT7A 2DHGA 4ZIWA 1CVJA 4HDHA 3NGSA 3ZFVA 2KT2A 3HD2A 2DR9A 1DTQA 1MWKA 1R27B 4ZVQB 4CLKA 3DRRA 2B7CB 3KNGA 3LOUA 1ITPA 2EWSA 3O1BA 4RR5A 4ELUA 4Y65A 5HMXA 2EBEA 2E5LF 1TL3B 4MIAA 4YOXA 5EN1A 1BQNA 2JEGA 4DX7A 4AXIA 3HOTA 1TKDA 2NUBA 3R7BB 3S6EA 2CXEA 4FJHA 2YI1A 4ZA1A 1CQNA 3T1HK 2XLIA 1Y7PA 3W0LA 2FSJA 2VA2A 2HQFA 4WYBA 3HHLA 2K3KA 4J90A 4HT7A 1RK8A 1MMDA 4AHSA 4DV7K 4JI3F 3BZKA 2V8GA 2BJ3A 3HP6A 3VETA 4YDXA 5ETLA 4LF7J 4DV1F 2MTLA 4JI2J 1ZBTA 2O66A 4F50A 4IOAL 4DDFA 1VQPS 1RABB 4N5SA 1ZYQA 5GAGP 2W7OA 2F8EX 4TU8A 3NGUA 1TUUA 3DDNA 4R79A 4H5WA 1SV5B 4IRCA 4MIWA 2DH7A 2DCLA 1BE4A 3ENVA 4PR6A 1SAZA 4KH6A 2NZTA 3Q8RB 3BP8A 1HBNA 1F3FA 1GAOA 1K44A 2AGPA 1IBMK 4GV9A 4DPUA 2FVRA 4DX6A 1LWXA 3MEGA 1ITGA 3I96A 2GWJA 3WXKA 2JH3A 4WIIA 5C2FA 2EW9A 4GKJF 3O3FA 4C9DA 1V3ZA 1JXLA 3THPA 4WQ4A 2RE2A 4H5RA 3QERA 1REVB 1R31A 2BGGA 4LFCJ 3KG4A 1LXNA 3W9HA 2QKKA 1YJVA 3CEDA 4IR9A 1ASVA 1L3VA 5HATA 3WC2A 1FKPA 3HSJA 3QGGA 1GFWB 3BGFA 1FERA 1I51B 3HSZA 1OY9A 1HNZK 1UFKA 4OPKA 4RO0A 1C1CA 2OD6A 4OLBA 2PGCA 3A5MC 4I2QA 3MM9B 1FEEA 1W25A 4CO3A 4DR5K 1R8CA 5H1SV 3QO9A 2H4WB 3D9BA 2IOCA 2CYYA 4LIRA 3FGUA 5FROA 2X3GA 2AU0A 1RT2A 3OYDA 2J8SA 3J7A1 1BWEA 1U8SA 4PQAA 1S6PB 3OLAA 1RTZA 1FRHA 3D54A 1IM6A 3TAPA 3P3DA 5LL6Z 1VR6A 1R59O 1VSHA 3Q8QB 4ZVGA 5AXLA 3U7JA 1VSIA 3G6XA 2OFGX 4Q0BB 2BJ7A 1S9GB 1S1UB 2R2UA 2L9DA 4BRHA 3ILJA 3ZNJ1 2DNNA 2GHVC 3L4QA 3T5LA 4PUOB 1HKCA 2BE9B 1WN7A 1OJ4A 3JSBA 3ULDA 2RPIA 1XBWA 1IKWB 2DB1A 3B4DA 4X4PA 1UEKA 3UDVA 1RWNB 3UB5A 2DNKA 4PRFA 1F9HA 5T7LB 1RCXB 2DRBA 1CSJA 5B7WA 1EQYA 2IYIA 2NRZA 3R6GB 3VVUA 4KKOB 4MO4A 1ZA1B 1F2HA 3EY1A 1Q82T 3IWLA 2HS0A 4F4YA 2XMWA 1BLUA 4CGIA 3FBFA 3H08A 5T7LA 4P74A 4YDUC 2I5JA 2XMVA 2JJ4D 2M7SA 3PKYA 3SZ2A 1FD2A 2BH1A 5HVHA 4BQLA 2XCAA 4URQU 2DGTA 2ATLA 2CQ0A 4DLEA 4LFBF 3FZMA 3B6BA 3KJVB 5AQWA 3OTOK 2UUCK 4PQUB 2UUCJ 3G8QA 2CFXA 1K0VA 2Z1IA 3H2UB 3VWSA 4JKGB 1S10A 3D2WA 2HAIA 3SUPA 2HHPA 4OJHA 1CJUA 4JI4K 4QR2A 3VZHA 3AVBA 1EAYC 1F6TA 3D0IE 4Z2XA 5BPLA 4ED2A 3UN5A 2B9XA 3R97A 4DV7F 3AD9C 3G86A 4PYDA 4DG1A 1R0AA 3U1MA 5IFMA 2DVIA 1ZAWA 1UFWA 1ZBLA 3BDEA 2ZDOA 3VOVA 2E9TA 3DRSA 2G0IA 5F8GA 4BLGA 4U8YA 1M5SA 3ZSRA 3LPEA 1RISA 4TNOA 3O80A 1TZ0A 3MMAB 2QYGA 3PYGA 3L09A 4F0MA 3EVOA 2XLJA 4I67A 4HCCA 5AQLA 3IDHA 5JLHA 3VA0A 1F5CA 4XK8C 3SAHA 3CCZA 4MK9A 4DR1F 2MKYA 1OKJA 4G65A 4FKYA 2MQNA 3QNWB 3GBTA 1NK0A 4NA2A 3C6UA 3H5YA 3DU6A 4AHRA 2YNFA 3DGVA 1JB0C 4KHRA 3E9LA 3NGIA 4IO9Q 3BSCA 1VSJA 1WC4A 4ZPCA 3OA9A 1Q16B 1RAEB 3IN5A 4RW4A 2IAJB 5D4PA 1Y97A 2GMLA 4WIQA 4MO5A 4DV6F 5AQPA 3BBBA 4M5DA 3LPTA 3OTOF 3K7RA 3ZYYX 4CERA 1G15A 1VSMA 2ILYA 3VCDA 2GX9A 4BREA 3MCNA 4AM7A 2YKPA 1HQEB 2G13A 4WPAA 4CYUB 1GMUA 2NUUG 5G0RB 4DUZJ 4YB5A 3IAYA 1RHUB 2DGUA 3OTEA 1HNZF 4DS4A 3AVCA 2C22A 4UQGA 3UKUA 1VK0A 3TZWA 3P1GA 2C2EA 4ED3A 4BR5A 1VQ7N 1RYRA 4NXMK 1LWFA 4IR1A 1LW0B 3EL2A 4B9UA 4DPXA 1HX1A 2XHBA 2ASMA 4WFNQ 2IYGA 1TL7A 2FZCB 2ZH4A 2VZ9A 4F3OA 3SQ1A 2KH9A 4FJ8A 4UQTA 1RDDA 5GIPA 5IM0A 3FKBA 4AHCA 3CD6N 1RAOA 2ZH2A 3U1LA 5KFHA 1BQNB 1EKEA 2C2KB 2BUNA 4FYXB 3EVMA 2CNOB 3K5LA 1EETB 1RBSA 1G4CA 4IG0A 1P1TA 3MAAB 1UOCA 2W6KA 3HP9A 4MDBA 2NREA 1SQGA 1FDAA 3CWJA 1C0TA 2QKBA 2Y1RI 2I7PA 3GILA 5DGBA 3SUNA 3DMJA 3M8QB 1PAUB 5K8NA 3VGMA 3MR5A 4YOEA 1EX4A 5I3UA 1X5OA 3V5RA 4MT1A 4RG8A 3ENQA 5BJRA 2F40A 5EWGA 3G6YA 5AE3A 4J9NA 4OX9K 5CYMB 3L9ZA 2W8KA 5T7BA 5I3QA 5A2QO 5A8RB 2QA2A 3QIDA 1NJIT 3PW5A 2KG1A 3B8HA 3BQ1A 3TZZA 3KUHA 2LEPA 1XMQK 1VQPN 4ZPBA 3FFIB 4ENOA 4Z4EA 3KKSA 1X60A 2VG6B 2MQPA 1B0TA 3LANA 2FXUA 1NB2A 3WX8A 4IZ9A 4RWXA 2YTCA 1G99A 1NLVA 2E5JA 4EHUA 3CJ0A 3LDPA 2LYVA 4IDKA 3OL8A 4LFAF 3AVIA 2FBXA 3QQCD 4MYUA 2CGLA 3MXJA 4IQMA 2RKIA 2BQ3A 1WLJA 3CXCM 4UZBA 1LWEA 4GVBB 2XNRA 1F5BA 3H8YA 2OZMA 3VPZA 1Y00A 2H5EA 1RAGB 1TUWA 2YHAA 5DQGA 2H3EB 1D8YA 4RKUC 2QXLA 2E2PA 3GE1A 4I7FA 1YI2N 5CD4H 4DL3A 4X62K 4NXNJ 4OLAA 2GVZA 1XNRF 1C0FA 2E9ZA 2IC3A 3I33A 2YX4A 2B9EA 3D4JA 2AV5A 3Q8SB 4F36A 3J81Y 4USTA 3A8JA 3MX2A 1L5UA 3M7VA 3MPDA 4X84A 1M5KC 2YQ1A 3GYNA 3CIMA 1NJYA 3S41A 2HK2A 3QBXA 1NAQA 2AJ4A 3CCES 3PG9A 2DR6A 2MQMA 1O5JA 1N0VC 1UJ6A 2ZWPA 4R5PB 3AA5X 3U3GA 2KT5A 2V51B 4M5LA 3VEOA 1SXLA 3O6WA 4AT1B 2GC8A 2KRBA 2P6TA 4BDPA 3OYLA 2QC3A 3VALA 1VQKS 7FDRA 1RBRA 1RTJA 3VGVA 5HRRA 3G9CA 1VRTA 3MZIA 2MQ8A 1Y4ZB 5GVQA 3CDBA 4P10A 3THVA 3ZSYA 1RTHB 2QWLA 3Q89A 3UCUP 2BKPA 4DL7A 4GC7A 4PWWA 3V9WA 2XI3A 3O4WA 5HJYA 2LECA 4JI2K 2AJ2A 4DR7K 4LBHA 4D3GA 3MEGB 1R3NA 2F3JA 3EZUA 4DBQA 2HWHA 5IC6B 3OBYA 3TUIC 5KI6A 4DSLA 2P9EA 3RB6A 4I6MA 4L76A 3KWMA 1N54B 4W5NA 3LF0A 2GUIA 4CVNE 1KXPA 1HKAA 1HWKA 4ZOSA 1RWUA 2YWWA 3KK1A 3W64A 1XR5A 3PUFA 5AQUA 1N0UA 1GQEA 1C0UB 4RTFD 2QTDA 4E7JA 4TYBA 3ZTOA 5C12A 4B1UB 3HHLB 1XTZA 1REGX 3WXLA 4LSLA 2IRXA 5D77A 3DGPA 4RUHA 3OYJA 1Z25A 4B3TJ 4M5MA 2DNZA 2P9NB 1RT7A 2GWKA 4TQRA 4DR1K 1HL6A 4ANCA 2BDPA 4C1NK 4CFBA 1GOBA 4DR3K 2KLAA 1FFSB 2KJWA 4LRFA 2N7YA 4LF8K 3BZCA 2RQKA 4KH5A 1WG1A 4Q2MA 1UZDA 2O8FB 4F3TA 3A8YA 4NMXA 4QS8A 1RYSA 3M6WA 2VYPA 4BRQA 1VOMA 3QEVA 1KD1T 3P5JA 3KZBA 1VQ4N 4FP9A 3WT0A 3AAWB 2YWKA 4CCHA 2V8DA 1KKHA 5HRPA 2BKNA 2A41A 4BR4A 4B8CA 2RRBA 2ZOMA 3FZ2A 1VSLA 1KVKA 1FX2A 3SDEB 3BO3A 4DV6K 2CWKA 2GGPA 4B9SA 4PKDB 3ZZTA 5EX0A 2P9SA 1FNOA 4NCGA 2CPJA 3KDOA 1WEYA 5C24B 3MM5A 2NSCA 1LK7A 2YH1A 4JYAK 4JYAJ 1HNWJ 2BE2A 5DQHA 1KD1O 2Z2MA 1K1SA 3CJQA 1S1TB 4DL2A 2XSFA 3UQSA 2O8DB 3PLAA 1QTNB 4OYWA 3TABA 4C3MA 2P9UB 4B17A 4ZLPA 4USUA 3ADAC 2GGPB 1J5OA 3NWGA 3PZPA 4CP5A 3BQ0A 1S72N 4A59A 2DRDA 2VF3A 4CESA 2DFHA 3ZX3A 4A8OA 3LDLA 1OVYA 2UU9K 1YITS 4CZCA 3A3OB 1I39A 5M1QA 4EYHB 1M5OC 4HTUA 5M2RA 1RILA 1QHAA 2PYLA 3TA0A 3QESA 3CJ4A 3NAEA 3PTWA 4JP8A 4LF4F 3HULA 1CBKA 3KK2A 4WYWA 4LBIA 4P2MA 1RBTA 3RR7A 2ZJPQ 4EU0A 4NLDA 3EDRB 1TKZA 1Z4UA 4J91A 1IJJA 4PHTX 1RFQA 5CHCB 1JLBB 2VBYA 4JK9A 5SZTA 2JWLA 2QEXS 1VLYA 4U7BA 5HMZA 3H2LA 4KHMA 4N76A 4CO1A 1HHTP 3W7BA 1RDBA 2GX8A 3TWZA 3ZSOA 3IFEA 4GNIA 2VL1A 1VS3A 4DJBA 1OS5A 4A5BA 1AB8A 2EFPA 2RDDA 3CO0P 2PFUA 5J2NB 4ZVEA 2KFYA 1P1LA 1WSHA 2UUTA 3RGIA 1VRUB 3PJ9A 5M2UA 4B3SK 3GFZA 3R6MA 3G25A 1B3TA 3IC1A 1FEHA 3UD5A 3MPVA 3QSIA 1K9MT 2P9KA 1FRIA 1RDUA 5AQXA 1WSRA 2BJ9A 3UR0A 3D66A 1RT3A 1G2EA 2DFFA 3AOBA 1TYQB 3SPYA 4IQXA 1WOOA 4O3QA 4ECXA 1TQLA 3WXIA 1N52B 4HTJA 2A42A 3ZT0A 4JLHA 4BC3A 5DO2A 2VHGA 5J2PA 2ZM6K 2UVWA 3D1OA 4DUTA 2Y8YA 5LJVA 1U2VA 3O8MA 4FJ9A 5D8HB 4FF2A 3M8ZA 1CXUA 4X65J 1WNSA 3SCLE 5F9NA 4X65K 4NLOA 2A18A 3HL8A 3QEXA 3UNGC 4ZCLA 1N8RT 3AVNA 1EKRA 5CZVA 1SH0A 2IVNA 3H2VE 3DYAA 1XNRK 1PYTA 2D0PA 3TTFA 3P31A 3MDFA 4W5RA 2F9JA 4USHA 2B4VA 4YOWA 3TX8A 3NMAA 3FRZA 4FF3A 4ECZA 2HF4A 4DR3F 4B3SJ 4JI6F 1UVMA 3C6HA 1RLCL 3U9ZA 2N3LA 2HBKA 5BR9A 3KFWX 1Y10A 4L3QA 2ZBIA 5LMUJ 4CF2A 1JLCB 3M6UA 2WTUA 2CADA 4NL5A 4KI6A 2C2NA 2NYIA 4U7CA 2FGCA 2XS2A 5D0EA 3Q2TC 3CVKA 5GAHI 3WBZA 1YAGA 3QIOA 4HTLA 5KG4A 3QNNA 3L95X 3V9XA 3VHQA 2NS1B 2Q3PA 4CT9A 1ZZFA 4DR4J 1RT5A 3CD5A 2E44A 2ZOGA 3R6LB 4GMJB 2HRTA 1NNEA 2E2NA 3E51A 2LVWA 3PYEA 3CB4A 3A8IA 2X1GA 3GR1A 4QWAA 1Q18A 2P9GA 3O9RA 1RZMA 2M52A 4FXVA 2OIHA 4MK7A 4RW8A 2ASDA 2DBBA 3FE1A 3WEEB 3G71S 1WUUA 4DV0J 3JQJA 4QCLA 3K5NA 3V6HA 3Q8VA 4LF7F 4GC6A 3GMGA 2HVIA 2ZE2A 1KQSR 2E1MC 5LXYA 3ALYA 5AQNA 2VPYB 2CNKB 4C97A 3AT1B 4CIGA 3T1YF 2GO9A 4AILC 4BRIA 3DXKB 4JAXA 1SH2A 2RDJA 4CBWA 3MCPA 3AVJA 2FB0A 3Q23A 3C15A 1Y5NB 2VG6A 4BRLA 3SXLA 1LWCB 2HMIA 3TAGA 1S1TA 3DLBA 4GO5X 4FNIA 4YUDA 2F8MA 2ZVIA 3LZJA 1D5AA 1AA1B 5KFLA 3CPEA 1C4AA 3QFUA 3P8BB 4BVOA 1WKKA 1QAIA 5CYMA 2UXBJ 3CJ5A 3FCVA 4HHJA 4IOBA 1DQ8A 1O0PA 4FF1A 3Q7CA 1WC1A 4RWTA 2FGOA 1X5PA 1PBUA 1KOOA 5AZIA 2CDQA 4ER8A 2H5JB 2RAQA 3CC7S 4JNEA 1HR0J 4IH5A 2O8EB 2JC1A 2KL8A 1KONA 4J7CA 4H5VA 2DH9A 2YVSA 4KI4A 3R5GA 3DHWC 4P2XA 3HMJG 1HNIA 4NLRA 4FWSA 3VMFB 1HRHA 1V9OA 5KG3A 2WTFA 2MSSA 1UZHA 5IT0A 1TK0A 5M1OA 2GJIA 4CJFA 1XQIA 5IM0B 2K3IA 2VH7A 4JI6J 4ZVFA 3M05A 3RB0A 1YX2A 4JUZA 1N5QA 4LREA 3KLEB 4KTZA 3SCJE 2G2OA 1K6YA 3CO9A 3GV8B 2BQUA 1TK5A 4WK1A 1X3NA 1CC7A 3VQDA 4WBFA 4HI1A 4BC7A 1T9XA 2HG4A 4K4TA 1V3RA 3PXGa 1YVNA 3AY0A 1NEEA 2DR7A 3J80Y 1X9WA 4UOCA 1PCAA 2R4FA 2V94A 4JBCA 5KOWA 4OZLA 2ZH7A 3R1HA 1J5EJ 2DRAA 2UYTA 4B1WB 4OJ1A 4FWPA 3LGMA 1SCJB 1BU6O 3OUYB 2VQEJ 2D41A 4JI2F 4UT4A 4OKEA 3ATUA 2CJQA 3QRPA 1RDWX 3MCOA 4NXNK 3NMUA 1BXNA 3QJJA 3J80U 1YUWA 4M5DB 4KV8B 1QVFR 1J6ZA 1R43A 4PAAA 3DXSX 4I2PB 3VQBA 2RRNA 2V8HA 1ASWA 2CJAA 1PGZA 1OY8A 4C8LA 2QW9A 3EE3A 3BGUA 3BBCA 2IAJA 1YIJN 4DSJA 5DG7A 3DRPA 2X3DA 2MGZA 3AV9A 4DR5F 2LQBA 4WFXA 1O51A 3AD7C 4B9NA 3X1LB 1Y5IB 1IO2A 3EZOA 3T1YJ 1ZBUA 3V9ZA 2AD9A 2OJ3A 2X51A 5M1KA 1U1LA 5AQMA 1FCAA 2YX7A 5JVHQ 4NXMJ 3K9KA 4H0VB 1DARA 1NOZA 1XHXA 3N79A 2NXJA 4F4ZA 2R8KA 5CZ2A 2O4GA 4N8OA 1VQKN 2IJNA 2GBZA 1SL0A 1ZOTA 4IG3B 1U0HA 3D5MA 3ZT3A 4DUYF 1CZ9A 1LWCA 4OZJA 3CD7A 2IVFB 3ZNUA 4QWDA 4HHTA 4C4WA 2BANB 5E2QA 2ASLA 4O44B 3OT9A 5BXIA 2PYJA 4OJ3A 1H2UX 4WF9Q 5JS2A 3R5JB 1SC1B 2V67A 1ZA2B 3H46O 3N6LA 4ID1A 3N01A 4DCPB 1K8AO 2W9BB 2GCFA 1S1XB 2VCPA 1TVRB 2J7UA 2ZBQA 4DV1J 4PQUA 1K8KB 2F9TA 5KFWA 2UXCF 3J7AP 3TQ1A 2YNIB 4K8ZA 4E3SA 3KXDA 1RHJB 3SSSA 4QOTA 2E29A 2ILZA 4OL8A 2FVSA 5HBMB 1FKAF 1CLFA 2VOPA 1YBUA 3RG6A 5J1EA 2XULA 1KTQA 2QRRA 4USKA 1DEJA 2YWEA 3EKUA 2X1FA 4AD6A 5KFCA 4CJ7A 3UKRA 1K8AT 2RU3A 1RWMB 1TMMA 3V1RA 1CULB 2JHEA 1D9FA 4USIA 5KT7A 1RT6B 3HO1A 3VAGA 2EFGA 3AOCA 2B3TB 2EKNA 1G1XA 4CHYA 2L41A 1C1BA 3L2WA 4YOTA 4E7KA 2J0WA 3RAMA 3AXMA 3I31A 4ZVTB 4OX9J 4C0HA 4PUOA 3MCMA 3TOQA 4CK2A 4DV2J 1NPRA 3G8SA 4X66F 4LFCF 1S1UA 5D3GB 5HMYA 1S12A 3N9UC 1P9YA 1RTIA 3QJPA 1D9DA 2FC9A 1CJVA 2Y8WA 4GO7X 4CM2A 4WJBA 3CETA 3JSMB 5DDPC 4M5IA 5H9EJ 2VICA 3NH0A 4FLVA 1H73A 4QIVA 1N32J 1MN9A 2FLOA 3OTCA 4URGA 1KQKA 1V5IB 1FJEB 4IEEA 2PE8A 4JKCA 1UWBB 4EAHD 1UP1A 5KFBA 2CG4A 1XJWB 5GAHU 1YRTA 1YK9A 1U1QA 4DR4F 4EMDA 2KVIA 2MY7A 2VV5A 1NK6A 1QSLA 4JI5J 3OYCA 4KV8A 3SQOP 4C98A 1AFIA 3CI5A 3BB5A 2KQ2A 2GVDA 3TRGA 4FM1A 1D09B 2HNYA 3CJAA 5AZJA 2BRKA 4ID5B 2ZKTA 2QI2A 2J7KA 1XK8A 1J2VA 2DGQA 4KBOA 1KVBA 4ZCMA 2FC0A 4F3QA 3JQMA 2AMCB 1LW0A 3DRYA 1WWHA 3H7HB 4FM2A 5KPRA 2UVUA 3AB2B 4B3RF 1VRUA 3NBPB 3DDKA 2MKSA 2XRIA 1VISA 3G2XA 5LY3A 3NKYA 1UVNA 3ZEUB 2R7SA 2CWXA 2E1ZA 3KK7A 3ENHA 1NKEA 3ITHB 5B09A 1B4SA 1GLLO 2HHSA 1UEVA 1IBKJ 2X6SA 2DNPA 4DV5K 4K2XA 2WK4A 3AVHA 4PPDA 2B43A 1S0NA 4JK7A 2FHJA 2W40A 2OA8A 3A3PB 4M3TA 5AR0A 1NHUA 4PXCA 2J9DE 1U2RA 2G2ZA 2MQQA 3GZ7A 1WSVA 3BV8A 3WDOA 2V34A 2QWPA 3LP0B 2DK2A 2N4DA 3C6AA 1VSFA 4CZKA 3J81O 2JVOA 3M2UA 4YFUA 4GV3A 2LDIA 2EVZA 1DTTB 3VQ5A 2F9WA 2LEBA 2W9CA 3G10A 2MHEA 4WCEQ 1GLFO 3UDLA 1NOYA 3WXMB 2ATCB 4CIEA 2WFBA 2FJBB 2ROPA 4ALZA 2MJUA 2V4JA 3KHYA 2M70A 1SKRA 3C6UB 2D1KA 3QGIA 1X9MA 3KG1A 1J5OB 1HFEL 2B0GA 2AWZA 2HHVA 5GAHP 3GJTB 2R7WA 2QLJB 1BQMA 3J7ZT 4CJKA 1Q53A 4CDIA 3MMAA 2EX3A 2O8DA 4G1IA 2E9RX 1KAXA 3CJSA 3EX7B 1UW9A 1BHNA 4JI8F 4Y2IA 4B3TK 2Y1LB 1JK9B 4L73A 2M5YA 1W7WA 4WFNL 5JVHL 4FZXC 1S5ZA 2RT3A 4KO0B 2CPHA 1YKWA 2Q66A 5C24A 4LUBA 3ONQA 1M90T 4DU8A 4C8KA 4J9UE 1HQ2A 1DT9A 3OQ2A 1GOCA 2BUPA 4TQSA 3MECA 2OTLN 1NZ8A 4ES1A 1EX8A 3WXJA 1HI0P 1B0VA 2R7TA 4FLTA 3OY9A 4KB0A 3M6XA 1CZBA 2ZE2B 4QPTA 1U25A 2AJ0A 5TKWA 3BKUA 5EU7A 3DAWA 2H1YA 3TANA 2JEFA 2QWOA 4M3XA 3MFHA 4OYOA 1XI1A 3J81j 1RAJA 3JSYA 3C94A 4V19J 2AEMA 3JQKA 4ED1A 3O08A 1SKWA 1U1KA 2YQ0A 4H0YB 4NRUA 4HT5A 1VQ4S 1RBAA 2BMBA 1DLOB 4G3IA 4DL4A 4PA1A 4A8FA 2BBEA 2DT9A 4E98A 5B0AA 4HLBA 2P9NA 1FF2A 4UOFA 2JWNA 3SAGA 3IAS9 4F0KA 5CY4A 3QICA 3R27A 4NLPA 1YZ6A 3D6TB 3C66A 3HCXA 3A5OC 2O8EA 2OHDA 2ZJRL 2Z8QA 4YEAA 2RS8A 3D6MB 1X4EA 1NDLA 3C14A 3HJVA 4CZIA 4CLFA 1D4XA 1HBMA 3C7NB 2QO3A 5KQ8A 2R7QA 3M32B 3Q0AA 1NNDA 4URSA 3BYPA 4O0JA 2HNZA 1S0MA 4O8UA 1ZPVA 2XMUA 5HVFA 2V2ZA 4OLOA 1FRKA 4HUEA 2VKRA 1HPZB 1LAVA 1Z26A 4DQPA 4DR1J 3TQEA 1IVZA 4NE9C 3HPOA 3TTDA 4DLGA 2IIRA 2V2KA 1HBOA 5HL7Q 4HH0A 4DL0C 2HHQA 3GJSB 3NS7B 4CM0A 2D0OA 2QM1A 4DCJB 3B6OA 4RUCA 5EWEA 3ZZ0A 2W2NP 3AQPA 3EGZA 4NYPA 5AFUA 2R8JA 3H59A 2PIIA 5GINA 2DEJA 1EHWA 3OHAA 3DXKA 4KR0B 3LQVA 2GJFA 2Q6CA 2UXDJ 4DV3F 3KLHB 2DTJA 4G9ZA 3HVTB 3IBCB 5KAKA 1WAFA 5HBMA 3KUEA 5FPDA 3QJLA 2UUAF 1S72S 3DLKB 1JJ2R 2K2PA 3KNAA 3EZWA 3J7AN 2F8TA 4YY3K 5JMVA 4OPHA 4DSKA 1HKBA 3HSDA 4KSEB 4A2BA 1NK9A 5L9NA 2ASYA 4M8LA 1JJ2M 2R9LA 4CFCA 3DLHA 2QXFA 4ILHA 4JS4A 1T9YA 4I4BA 4M5KA 1MNEA 4LF6J 3A2FA 4O44A 2YNHA 3MEDA 3ZZZA 4AL6A 4JK8A 4Y1DA 4CF9A 3BGLA 1TKTB 3Q86A 3PIOL 1MDUB 4PZVA 1X0FA 2U1AA 4QQBA 2YHYA 1WORA 1LEOA 5KFGA 1Q81T 3KD5E 1SV5A 1YJWS 2CJYB 2WSCC 4DTSA 3DC2A 1UVJA 4GKKF 3E01B 2UXDK 3VEVA 3KK2B 3W5ZA 4OVLA 4OGCA 3I0RA 3GONA 4MK8A 3E2EA 5HL7L 2JOQA 3EWGA 3CDEA 3ZZRA 3NL0A 2A6MA 2C2DA 4BGAA 4OKKA 3V81B 3BEXA 1FXXA 1Q8IA 4C3KA 1PJ5A 3HYFA 4CJVA 3GDQA 4Z7YA 1URNA 2LXUA 4KGZB 4CNZA 4MJKA 1VYAA 1GLBG 1RADB 3NH2A 1VSKA 4ZVPB 2HF3A 3G82B 4M5GA 4CK3A 1BO5O 3TJ8A 5KRSA 4G1QB 1JQGA 1SKSA 1O13A 3NAHA 4A8MP 3SUOA 2A6AA 3GSIA 1S1WB 3FRYA 4EK2A 3D2EB 3H98A 4NYNA 2OLWA 3RBEA 3GIJA 3THXB 1SL2A 4Q44A 3M32A 4JS5A 1BY9A 1GLDG 5RUBA 3GFYA 1AXQA 3VQ7A 2ZC4A 5AQSA 1YTUA 2CVEA 3R8YA 3R9LA 1T7PA 5DJBA 1N6QA 4LJMA 3O3HA 4PL8A 4HI2A 5BR8F 1TK8A 4B9VA 2XY5A 1KC8T 2RQ4A 5BPNA 4M41A 1ZAXA 1C0TB 2CJ9A 2XNQA 2BRLA 3ELHA 1UMJA 5IV3A 1LXJA 5ITHA 3W3SA 4IG0B 5KG6A 2QJ3A 3BR8A 3P96A 3HI0A 3NOGA 4OX6A 4A47A 4RW9A 1JLBA 3P49B 4FJ7A 3L2QA 3M4XA 3OXGA 4CK1A 2R8GA 4ZP9A 3K9JA 2HGNA 3MUMP 3PVXA 1NJXA 1SB6A 4BS2A 2CQ1A 3I9V9 1YI2S 1GTEA 3SSQA 4CI0B 1QAJA 1B9DA 2G8WA 5KFYA 2JEJA 1PO6A 2A2CA 5GAEP 2G1HA 2P9PA 3KK1B 2X74A 1XR7A 2E88A 3MOJB 3L7UA 1WB9A 1SH3A 5DDRC 4B9MA 4ZPDA 4NA1A 2W2QP 6AT1B 4DV1K 4DQ8A 1QQNA 1MWZA 2Q36A 1S1WA 4JKBA 3NAIA 3RU0A 5IT9Y 2E6MA 3D67A 1QUPA 3RRKA 4KGXB 5DLFA 2D4WA 1T95A 2D9OA 1GTHA 3PW4A 3DLJA 2UXBK 1NMNA 3RB4A 2ZQBA 3TR5A 4JKEA 1N32K 1JL2A 2GQCA 4ECYA 3NGYA 2WVCA 1LK5A 2P9SB 1FJCA 3R2DJ 1HW9A 1BQMB 2M4MA 5H1SQ 5CCLA 4XTTA 1W7AA 1NUEA 5CXTA 3DFEA 3GG0A 2HHHF 5E41A 2J8AA 3I0SA 4M95A 3NGDA 3RAQA 4AHTA 1TGOA 4E1NA 1B70B 3OL7A 4BRKA 3D6FB 4KY3A 3I32A 3IWNC 5H9FK 4UY8O 1XNQF 3PV8A 1JLGA 1I5OB 4NOHA 4ZLNA 1QUVA 3ISNC 2ZBRA 3WEEA 3CCVS 2AYEA 3BGOP 5C5JA 2VG7B 2BYCA 3O9QA 2FSKA 2IVMA 4BE0A 1JX4A 2P5GA 1BC6A 1SIWB 1WSGA 4K5SA 4ECTA 3IXQA 1QQOA 1RT5B 4JN4A 4ZCKA 3K57A 3F2KA 2QL9B 3THYB 3NS5A 2FJDB 2J9CA 2YNGB 4FDFA 2HFUA 1TKTA 4DV3K 5J1PA 1I94K 3RZAA 4BRPA 5DK5A 2MLZA 3M9OB 4NLGA 3POTB 2WB4A 3A8EA 4KAIA 5B0EA 5AQHA 2QGFB 4BC2A 2DEIA 2C3PA 2OCEA 1JLCA 1HR0K 3SMPA 4JI0K 1TELA 4DF4A 2VWJA 2QWNA 4C8OA 4JI5K 4W90B 1Z1ZA 1TAQA 5H9FJ 1X9SA 3L2VA 1LW2A 2DTUA 4OI3A 5DM7Q 3D3CJ 1UETA 1RJJA 3L4BC 4OGEA 2GHWA 3N6MA 5EGYA 5IWAJ 2Z2ZA 3IO1A 3C8YA 4IKFA 4H03B 3UFCX 4M3WA 3ZETA 3T41A 4M63A 1U02A 5EVZA 4CIFA 2GQQA 5E3QA 2HW3A 1WHWA 3HVWA 1NH7A 1XC3A 4MFBA 1YSJA 2F8SA 2UXDF 5DM6Q 2AEFA 4H8KA 4CZJA 3BQ2A 2AT1B 2I0XA 4M45A 4Z4HA 5KG2A 3CJTA 1HYSA 1HMVA 3TI0A 2RSQA 2B56A 3QBWA 1WHXA 4RLEA 5A0YA 1E4GT 2YHBA 2P9KB 2HNZB 4O3PA 3OXLA 1U49A 3MCSA 2YKQA 2B8PA 1FFWB 1S6PA 3P4IA 5F1XA 4QYZK 4LY7A 1H0HB 5J2NA 3MMBB 4X64F 1RQ0A 4WFBQ 3PJXA 1NGEA 5JICA 2V9KA 1T3OA 1MMNA 4DV5F 4CW7B 3VAHA 4P52A 1ZM3A 1Q1KA 1PILA 1QE1B 4KRWA 3VTHA 3V4IB 5IQ6A 3OHRA 1VQYA 2JVRA 4L72B 1Q95G 5IT9O 1Y64A 3W2WA 3GCXP 3WX4A 3EZ5A 2DXDA 2VBWA 1NZAA 1HNVB 5ETVA 3AQOA 2VU5A 5HRNA 1S97A 1ZM9A 4U67L 2WW4A 1A6LA 3OFFA 4I7FB 1GMWA 5GAGI 3G87A 1BA1A 3O4QA 4BRMA 4P71A 2CPZA 4LFBK 1OQ3A 2A3JA 2O8BA 4FYVB 1HQUB 4A57A 3G96A 1K0TA 3TYTA 5E3CA 1FESA 1WKLA 2R2SA 4HKQA 4LMZA 2WW8A 2EK1A 1AW0A 4OPJA 2DPJA 3FVYA 2C28A 1OIAA 2CKWA 4IO9L 2VDIA 3MECB 2JWKA 2D3O1 4L6V3 2JL9A 2ROEA 1UEUA 2VG5B 4B9QA 3BZQA 3CCQN 1AT1B 3HHDA 3BSAA 2DNRA 1N36K 1QVGR 2XZTB 4LVOP 3JAMY 3WZ0A 2D74B 3E8OA 3AO1A 2AYGA 2E1AA 4G6VB 1RU1A 3N6NA 4WE1B 3SDEA 4WFAL 5EOYA 5I3UB 4W5TA 2A0FB 1N34K 4KPCA 4LIWA 4R0EA 2MLXA 3D7SB 4N47A 3RMBA 3CJ9A 3CCJN 3IGVA 3MF5A 4GY2B 3MM6A 4BACA 2CDRB 4MKVA 3VQ9A 4B9LA 4ERDA 4QIEA 5KGXA 1SC4B 3OD2A 3ETMA 4DV4F 1DTTA 4CHQA 1S79A 2NXUA 2VB6A 3EUNA 5D4OA 3MAAA 4P75A 1S6QB 3EXYA 1BIZA 3BGRA 2F1FA 4NEYA 3C16B 2D3ZA 1FDDA 3PW0A 5E33A 2R2TA 1TMJA 2IBOA 3NP5A 4H0OA 4LF5F 5JVGL 3VQ8A 2VWKA 1CXQA 4DV2K 4E8UA 4LR8A 4FZYA 2B6AB 1FNMA 6FD1A 2E8AA 2P5OA 1D8ZA 4LF1A 2A40A 3A1YG 3CC7N 3H4BA 3CF5L 3NMRA 2DCUB 4OZ0A 2PBDA 4YOVA 3OYNA 4J9VA 2CQPA 2XWYA 5DG8A 3ZSZA 4NLQA 3TEGA 5J2QA 4FJKA 3QEWA 1LWFB 4CEEA 4U7UD 4JKGA 3UD4P 4X66J 1EP4B 1GH8A 4CIOA 2ZKUA 3SV3A 4CH7A 3GJQB 3M30A 3PM9A 4YNQA 1FFGB 2ZHBA 4DZDA 3TP2A 2XY6A 1RGIA 2GW8A 5BREA 5D0GA 3SEOA 5FDLA 1CZAN 4EBEA 4CYUA 1HQEA 2P5VA 2GUPA 1C0GA 4FJMA 3A8KA 4N41A 2XM3A 5HQLA 4FWQA 3FEZA 3ILIA 4F8RA 4S0MA 4ZN3A 4I6MB 3J7ZO 1NXIA 1PJ6A 1NMEB 3OLBA 2BABA 3DI6B 3MN5A 4FPAA 2XEXA 4OYXA 1IKYA 4F4WA 3PRBA 2X1AA 3OJSA 3J7YU 3OVSA 2QV6A 1FXLA 3H6EA 3TSUA 1N5SA 3CJ7A 3FCWA 1SQEA 2DGSA 2NPIA 3UDCA 4IOAQ 3EXCX 5A2QU 4BY9C 2XYPB 4LC9B 2FIUA 4CLSA 4GVMA 1S6OA 5C25A 2YNFB 2D5RA 2RUSA 2KXFA 1IBLK 2VBZA 5T41A 2DGXA 2PMWA 2YWHA 4J37A 1VQ9S 1KHWA 5L46A 1JLEB 4Y2MA 3ENAA 1RTJB 1HNVA 4M94A 4M5NA 3NY0A 5DLGA 4YR0A 4XO0A 2NRTA 2HFZA 1IR1A 3LL3A 3UN2A 4FVUA 1RT2B 1IG9A 4XH1A 3TR8A 2O5DA 2HMIB 2QMUB 4NYOA 3PEJA 2ACYA 1RT6A 3I56S 2V50A 1ILYA 1CULA 2JGUA 2CQIA 1IBMJ 2IRYA 3UVJB 2VJVA 1MROA 4LQ3A 4AM6A 3I55N 3MEEB 4P72A 4WKRA 4KPYA 3JTPA 1XC9A 4E0DA 3HF5A 1HNXK 2NNWA 5CYQB 5HP1B 3FBCA 4FLYA 4MKBA 4O55A 4DV4K 1HJOA 3NCPA 2YNIA 3TSQA 1RKIA 2DYAA 4XEIA 3N4QA 1K8KA 1X4GA 3ZCMA 2HLUA 1TVRA 4DN0A 3JXUA 4X65F 3L4IA 4LF5K 2VPXB 4RUAA 2ZJPL 3EM1A 5HAOA 2EKYA 3C46A 2ZGYA