3C6TA

Crystal structure of hiv reverse transcriptase in complex with inhibitor 14
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
559
structure length
559
Chain Sequence
NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase
publication title The design and synthesis of diaryl ether second generation HIV-1 non-nucleoside reverse transcriptase inhibitors (NNRTIs) with enhanced potency versus key clinical mutations.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 150
structure length 559
sequence length 559
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3c6tA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6tA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6tA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6tA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3c6tA05
3DLEB 5KFTA 3SCXA 2R2RA 4KHSA 5KFMA 5J1EA 3I0RA 3RAQA 2JGUA 3EYZA 4BE1A 4OKJA 4JV1A 1U4BA 3MEEB 4MFBB 2CJQA 3PW2A 4KTZA 2KQ2A 1QAIA 1RT6A 1BCOA 4G1QA 4LSNA 2E4LA 2IM2A 1QQCA 1IKVA 2XHBA 1NNDA 4F4ZA 4TY9A 3OSNA 4DL6A 4PQUA 1S6QA 1U47A 5KFZA 5DQGA 2ASLA 3NFAA 3V4IA 3PY8A 4ZPAA 4TLRA 3PJWA 4DL4A 4CHQA 3OS0A 3H4BA 3NGZA 3MTKA 3F73A 4H4MA 3DM2A 2LSNA 3BSOA 1JLFB 3V6DB 2XWYA 4M41A 1NJWA 3ZSQA 1JXBA 4Z4GA 4EO8A 3IRXB 1KRPA 1BIUA 3QO9B 3KNAA 1HYVA 1KSPA 2GUIA 3DI6A 1TKTB 4U7CA 1FXXA 3FRZA 3VN5A 3KK1A 3KJVB 4YR3A 4KO0B 4KTWA 4FJ9A 4IR9A 4FLXA 1C0TB 2W42A 4CIFA 4XPCA 2HNZB 2IC3A 2D7SA 3NBPA 2HHQA 2YNFA 4JV2A 3CJ0A 3DYAA 3T5KA 3K59A 2R8GA 1IKWB 1S9EA 1N5YA 3LAKA 4O3NA 1NJXA 5F9LA 4QW9A 4DMNA 4HUFA 5E41A 1Z25A 4DSLA 1VK0A 3NKYA 2BE2A 4F8RA 4O3OA 4DLGA 1J54A 1S1TA 2X74A 2Z1IA 4OPJA 2A1RA 5KG6A 5KFIA 1JL1A 3CJ4A 5L1IA 1HARA 4J9QA 2YNHA 4CJ3A 3G6XA 5KG2A 5CZ2A 3SQ1A 2YKMB 2ATQA 1TK5A 3T3FA 2OZSA 1NOYA 3QGIA 4R8UB 2AWZA 4DFPA 1D0EA 4EZ9A 4CGDA 1RYRA 2ALZA 1I39A 4MKBA 1RTJB 3WNHA 4I9QA 1RT1A 3OS2A 3HVTA 4NLSA 1G15A 2O4IA 1S9FA 2HHTA 3QEPA 3BQ1A 3MECA 4M3UA 3ITHB 3SFUA 4WZMA 4F2SA 5KFAA 1NK8A 2IM1A 5KFBA 4RNHA 4JS5A 3CDEA 2R8IA 4J9SA 1VRTB 4Z4CA 1QE1B 1NJZA 5DG8A 3QLHB 4IH5A 3RRGA 1LW0A 4F2RA 4OKEA 4LD0A 4ZVHA 3KLGA 4FBTA 4O4RA 3KD1E 4KREA 3ZSWA 4NYZA 4CGIA 1IKYB 1RA7A 4WXOA 3TVKA 1D9DA 4NYNA 3HJFA 4IFVB 4WYLA 2P5GA 1Q9XA 5C42B 4AHVA 4AHSA 4M3TA 4ED8A 3G0ZA 4J2DA 3AVKA 2IOCA 3UIQA 5KFFA 1JLGB 5EU7A 5DG9A 3GV8B 4CGFA 1J53A 4R5PB 1UOCA 2OZMA 3SV4A 3DRSB 3C6UB 2J6TA 3V81B 3AVJA 4ECZA 3LPUA 2VG7B 4ED0A 3OYCA 5KG1A 4KHRA 3V6KA 4IKAA 1RT7B 2VG5A 4ZVEA 2C2RA 3AVIA 3MF5A 2B43A 1S9GB 3BJYA 3VQCA 4M3RA 4DTRA 4BDPA 1QHTA 3LP2B 4AHCA 2QV6A 2BQUA 3M8QA 3OYNA 3VQ5A 2B5JA 3QGHA 4O5BA 1DTQA 1DTTB 4JV0A 4QPXA 2EC0A 2V0NA 3DLGA 4PA1A 1NKEA 1S48A 3LP0A 4J9NA 4FM2A 2AQ4A 1BI4A 1LAVA 1UAXA 3C95A 4CGGA 3SNNA 3V9SA 2QKBA 2BRLA 2GIRA 5HP1A 4CK3A 2GC8A 3T5HA 3HPGA 4Y2CA 4CJ4A 4B08A 2Q3SA 2FBTA 3M9MB 4CHZA 5J2MB 1RTHB 2X78A 3L3VA 2D0AA 4ECUA 5KFYA 3NCIA 1EETA 4ICLA 3S9HA 1SUQB 1NJYA 3NE6A 1EKEA 4H54A 5HRRA 3ZSRA 2E9ZA 2BQ3A 3P5JA 2QE5A 2P51A 1TKDA 1K1QA 2DFEA 1VSDA 3AVBA 4TYBA 3LDSA 3DOLB 3CM5A 2ASDA 1FK9A 1U48A 3KTQA 1HNVA 3DMJA 3OL6A 3AVAA 4F4XA 3V9UA 4LQ9A 1QSYA 4XPEA 2HW3A 2FLNA 3HPOA 4ED6A 1A5VA 4FBUA 3IAYA 3B6PA 1L5UA 1RCHA 2HWHA 3JYTB 3BQ0A 4DSEA 5SWMA 2HB5A 4CF1A 2UVRA 2OPRA 4DL7A 1EXQA 2E9RX 3ZT4A 4B9UA 3S3NA 4IDKB 3MEDB 3KHHA 1TL1A 5C25B 3DRPB 3UR0A 1X1PA 1RTIA 2FJVA 3CYMA 4CFAA 1C0UB 4AILC 2YNGB 1T05A 2UUWA 4FJJA 1ASUA 4B9VA 1UA0A 1JLEA 1WNEA 2BDPA 1WNSA 3H4DA 4CF2A 2R8KA 2XY7A 3SUQA 1LW2B 4FK0A 4EYHB 4B9SA 3Q8QB 2KZMA 1LWCB 4FJIA 2ZE2A 1S10A 3TAPA 1JIHA 2JEJA 2C28A 1N6QB 2HHUA 1S1VA 3M8PA 1S97A 4TQRA 2HNYA 4RW4A 2G8FA 1TK0A 1JLQB 1N4LA 2UVWA 1WLJA 4DF4A 1R0AA 4NLUA 1U49A 3VQEA 4JS4A 3RB6A 5SZTA 3KLFB 5DLFA 4EP5A 2OPQA 2X6SA 3U3GA 4FJ7A 1SH3A 4ZPDA 4K4WA 4AHRA 4KI4A 4DQSA 2RKIB 1CXUA 4KHWA 3E01B 3AVLA 3FFIA 1SKRA 3I5AA 5KGXA 3OYBA 1N48A 2G8KA 2C2EA 3HL8A 1LWFB 3MEEA 4E0DA 5KTQA 5L1JA 4E7IA 1XR6A 3KLIA 5KFDA 3VQAA 1ZETA 3NMAA 4NLGA 2A1SA 1HQEB 2IS3A 4DU3A 4E1NA 3LWLA 4IG3B 3KK2A 2JC0A 4UQGA 4ZMMA 2DY4A 4E89A 4LY7A 3V9WA 1X9WA 1RBSA 1KLMB 1NKCA 5F8GA 2XY8A 1VSIA 2XC9A 4M3WA 4TN2A 3AVNA 2W9CB 1J5OA 4KHMA 1RDCA 3LP1B 3OSPA 5T14A 3ZT0A 2XY5A 3SUPA 4PWDB 4RW8B 3KIOA 1XHZA 4YQWA 4RU9A 4E7KA 4KPYA 1JLFA 3V6DA 5KGWA 4E7HA 3M8RA 1VSLA 3IRXA 5CZ1A 4O55A 2O4GA 1HMVB 4OGCA 4FK2A 1HNIA 4URQU 1NHVA 1TKTA 4I2PB 3EZ5A 1WSGA 3KJVA 2JEFA 3WNEA 3OYEA 4Z4FA 1TAUA 4Q45A 3LPTA 4Y2AA 2XGQA 3K5LA 2HNZA 1Q8IA 5KRSA 3WNGA 2F8SA 1WAJA 2IAJB 4ZP9A 3NH0A 2B4JA 3TQ1A 4O0IA 1C2PA 3QINA 4I7FB 1RNHA 1IKWA 3RBEA 4DTMA 1RT2B 4K8ZA 4C8MA 3AVCA 1I3AA 3K57A 4DTNA 4NYFA 4ECVA 3ZSYA 4FLWA 4IH7A 1A5XA 3S3MA 4W5RA 4YR0A 4CGHA 2W8KA 4WZQA 1WSIA 3VQ8A 1MMLA 3LAMA 1MU2A 3LP3A 3Q8PB 2RDJA 3NAHA 3TAFA 2YKMA 1BQMB 2WOMB 3T5JA 3HHKA 3HKWA 1BL3A 4CIEA 4NLTA 4HUEA 4R8UA 1Z26A 3CQ8A 1T03B 2HHWA 1IKXB 2G8VA 1TV6B 4BE2A 1RTJA 4ECTA 3BR9A 3QZ8A 5KFXA 2Z1JA 2P5OA 1HJRA 2VWJA 4WFYA 3FDSA 4ED2A 3NH2A 4FXDA 4Q43A 4M3YA 1D5AA 2FBYA 5KRTA 2GV9A 4JRQA 4CFDA 3CDWA 4IBNA 4DTPA 3PX6A 3PHEA 1JLAA 1VRTA 1QE1A 2FVRA 1ZBUA 3DLKB 4MK9A 3F9KA 2FVSA 1S1XA 1D1UA 3CFPA 4KSEB 3RMDA 4FJ5A 4TY8B 3KHGA 1CZ9A 2PYJA 1LWEB 3OL8A 1IKYA 1SV5B 4DL2A 2P1JA 3GV5B 3SFGA 2I5JB 4W5NA 3KLEB 2FC0A 3MFHA 4ED7A 3NF9A 4IFVA 3RB4A 5C42A 4F4WA 1KHWA 3DLHA 2ETJA 3L2UA 1IM4A 1JLBA 3I5CA 4O3QA 1JLGA 1RT4A 4R5PA 3AA5X 1A5WA 3ZSOA 4FJHA 3UDLA 2W8LA 3C6UA 3IS9A 4KAIA 3M9OB 3V81A 2XY6A 4OLAA 3KLHB 3ALYA 4LH5A 4K4VA 5KFCA 2X6NA 2OPSA 4O4GA 4M42A 4XIUA 1C1CB 4QWAA 1NK0A 1RDDA 1RT7A 4AHUA 2V4QA 4OL8A 5F8LA 1S9GA 5HLFB 1YT3A 2IDOA 4CJVA 3VQ4A 4CEEA 1FKOB 2C2DA 4B3OB 5KFKA 3PW4A 3MXIA 1JXLA 5DQHA 4L8RB 3QYYA 1SL1A 1HQUB 3FQKA 2ZD1B 3TWHA 2HNDB 2YKNB 1YVUA 1KCFA 3AO2A 3E51A 4YR2A 3PX4A 1TKZA 3TAQA 5C5JA 4BE0A 3VQQA 3AA4A 2IM0A 1W9HA 5L1LA 4W5TA 1RT3B 4RNMA 4I2QB 3H40A 4FJMA 4F3TA 1KTQA 4ECRA 3PUFA 1JKHB 2KZZA 4ECWA 4IG0B 4CJLA 4FZYA 4YMEA 1RBUA 4DF8A 5J2MA 1RTHA 3AVMA 1ZTWA 3BGRB 3GIIA 4O3PA 3GQCA 1T3NA 4CF9A 5DLGA 1RYSA 3EPIA 1VRUA 3HXMA 3Q8SB 3H2LA 5F8NA 4FJKA 2IMWP 3QESA 4H4OA 2HHXA 3TR8A 3CDUA 4KHNA 1VSJA 5F8HA 1J9AA 4CHYA 3DOLA 3EY1A 5J1EB 3D45A 1WAFA 3C6TB 2WCXA 1IO2A 4YP3A 4LSLB 4CEAA 5EUHA 2WK4A 1LV5A 2ITGA 4CJWA 3K5MA 3G6YA 5C24B 4RW9B 4K4YA 1IKVB 3HM9A 1UWBA 3NGYA 2HHSA 1ITGA 4CF8A 4IDKA 3MEDA 3DLRA 1UA1A 3DRPA 4CEBA 4NLVA 4BWMA 4HKQA 3V1OA 2KW4A 4RNOA 1C0UA 1TVRB 4W5OA 4URGA 1B9FA 3HSTB 3CO9A 3EZUA 1WN7A 1SL2A 2YNGA 3BSAA 3PR4A 1TK8A 5D3GB 3NF8A 3SZ2A 2NUBA 4J9KA 1YTAA 2IBKA 4ZTJA 3OYDA 4FJXA 3PV8A 3SYZA 3BSNA 1KVBA 2VA3A 3HT3A 3DRRB 1LWCA 1HRHA 1BQNB 3OYJA 4CIGA 5T7BA 4FM0A 2BQRA 4OPKA 3KK1B 3HYFA 4CK2A 1N6QA 4OJRA 2AX1A 4H8KA 4FCYA 1KHVA 4CJEA 3SUNA 1JLQA 3PVXA 3IN5A 1NKBA 3CM6A 3TAMA 3H98A 3DOKB 4CJFA 4U6PA 3HVAA 4AH9A 4KFBB 3DYAB 4QW8A 2JLEA 3KLFA 3RRHA 3SI8A 2HWIA 4J9PA 1RBVA 4IQXA 1CXQA 4FW2A 4CJRA 1Q9YA 4DS4A 1QUVA 2FVPA 1XR7A 4FVMA 3QNNA 1GX6A 2D0BA 5CYMB 3UQSA 1S1TB 5FROA 4ZTFA 5F8IA 1LWFA 1ZTTA 4IRDA 4CECA 1L3VA 4B9TA 4O44A 4ID5B 3TAGA 4ZPCA 1C1BB 2FJXA 3NF6A 1KVCA 3CFRA 3N6NA 2R2SA 3V6HA 3V9XA 3OYIA 2IJFA 1XWLA 2W7PA 3PZPA 4HCCA 5JS1A 1HQEA 3P83D 3HO1A 3PW5A 4CESA 4GMJB 4IG3A 2HAIA 3V6JA 3RB0A 2ILZA 4E7LA 4NCGB 3I5BA 5I3UA 4QCLA 3ULDA 3I8DA 2OPPA 1RILA 3TANA 3AVGA 4N41A 5CYQB 1QSLA 4PUOA 2W9CA 3AO4A 3LP1A 2XGPA 3CIZA 2XI2A 1W25A 1ZYQA 4PWDA 4ZP7A 5K14B 4RW8A 3L2RA 4FJGA 4B8CA 3LZJA 4DEZA 3KOAA 3KLGB 3AA3A 4CEQA 4C8LA 4TQSA 4MH8A 5FRNA 4CERA 1HMVA 4DSFA 3DLBA 4Y3CA 5EWGA 4DFJA 1U04A 1TKXB 4EZ6A 3MR6A 2V9WA 4EEYA 4I2PA 5KT3A 2BR0A 3IGNA 5FDLA 4QWBA 3O4QA 2VG6A 2XI3A 4KHYA 4FJNA 3BREA 5HRPA 3NH1A 3MEGB 2IAJA 3P1GA 4RW7B 4IRKA 4CEOA 4ID1A 4FLUA 4IFYB 4I7FA 4DTXA 4FS2A 2YNIB 4CHPA 3OYMA 1RT2A 3GILA 2DFFA 4CEDA 4FLVA 5KFEA 4CJQA 2F96A 4FZZA 4KKOA 4K4SA 3QEVA 5F9NA 3NAIA 4FJ8A 2YV0X 2R8JA 1GOAA 2O5DA 4FS1A 3ZSXA 1O1WA 3EPGA 3O4NA 5KT5A 4EBDA 1BQMA 2WOMA 3M8QB 4JRPA 5EWEA 3TI0A 1S4FA 5KG3A 2XCAA 5FRMA 3N6MA 2GIQA 2AU0A 3DLEA 1L3UA 1T03A 3VQPA 1DTQB 2IGIA 3VQ9A 4DFMA 1IKXA 1TV6A 4ZPBA 4RW6B 4HHTA 4CFBA 3VA0A 2J6SA 4MFBA 2HMIB 4FYDA 4KE5A 3OL7A 1HYZA 3PW0A 1JLCB 4KI6A 3NGDA 3ZT3A 4ECQA 4DTOA 2AGQA 4RNFA 3VQSA 1D8YA 3L2VA 1S0NA 3SPYA 1VSFA 4CHOA 4Z4HA 3DLKA 4DU4A 3NDKA 4Q0BB 4DQRA 2WTFA 3QEIA 3IG1B 4Q5VA 1BISA 1X9SA 3O3FA 1S49A 3D0PA 3AO3A 1WSHA 2D41A 3NF7A 4KHQA 3C94A 1FKPB 3PR5B 4QWEA 4ED1A 1IG9A 3CJ3A 2I5JA 1VSKA 3KLEA 4O3SA 4Q8EA 5HROB 3DMJB 1YTUA 2AJQA 3H5XA 1QAJA 3L3UA 1RBTA 3QNOA 4CF0A 4IKFA 1WSEA 2PZSA 4ZP8A 3QO9A 5DQIA 3ICLA 4DLEA 3RTVA 3KLHA 3MFIA 3FSIA 1QSSA 3U3YA 1JL2A 2UVUA 1JX4A 2G8UA 4KO0A 1C1CA 4DSIA 1C0TA 1IH7A 1WSJA 3G10A 4RUAA 1S6PB 5HLFA 2E6MA 4ZHRB 5I42B 1HYSB 5J2NB 4ECSA 4B3OA 4CJKA 3TABA 3L2QA 4WXWA 4CJTA 1HQUA 3IGVA 1RDAA 1BHLA 2ZD1A 4J9LA 2YKNA 4NCAA 3VQDA 1SKWA 5HBMB 3THVA 3ASMA 2VA2A 1YVFA 4KV8B 4C8OA 1TGOA 2ZE2B 2HVHA 1RT3A 1SL0A 4I2QA 5KFQA 5KT4A 2RF2B 1ZBLA 1JKHA 1EP4B 2HNYB 4IG0A 1XR5A 5KFPA 3V1QA 1LAWA 3SQ4A 3BGRA 4GVMA 3KMSA 4Z4IA 4E19A 1RT5B 2HHVA 3SJJA 2Z1HA 3KLVA 2OPQB 3SQ0A 4OLBA 4MKAA 2XO7A 3ITHA 3OYAA 3HVWA 4WYWA 4CJPA 3FFIB 4DQPA 3M8SA 2QXFA 3C6TA 3T1AA 4B9MA 3H59A 3QLHA 4F4KA 4LSLA 4MK7A 2W9AA 2J6UA 1S1UB 3RB3A 5KG4A 1RBRA 3KLIB 4Z4EA 3KKRA 3OY9A 4NLPA 3ISNC 4ELVA 1KVAA 5CY4A 5C24A 4RW9A 1GOCA 4GC6A 5J2QB 2XRIA 4CE9A 4DG1B 3KK2B 4J9RA 3L8BA 4HTUA 4OKKA 1RTDB 2IJNA 3GYNA 3I0SB 3QIDA 4EBCA 2G8WA 5KFHA 4M94A 1Y97A 4DL5A 1T94A 1TVRA 3DRSA 2JEGA 3NHGA 2R7YA 1XI1A 5J2PB 4N56A 1X9MA 2ZQBA 1J5OB 5JS2A 2BANB 2ASJA 2ATLA 5D3GA 2VG7A 4Y34A 5KFSA 4NLWA 1SH0A 4J2AA 1Z4UA 4BDZA 1DLOB 3DRRA 4URSA 5KG0A 5KG7A 1BQNA 3MXJA 3LP2A 1HNIB 1TQLA 4BACA 3HK2A 5L1KA 2YHBA 1CSJA 4WE1B 4RZRA 3KHRA 5KFUA 1DTTA 3ZCMA 3DOKA 2WONB 1NHUA 2R2TA 4KFBA 1RA6A 4NLRA 5KG5A 1TAQA 4KHUA 2FLLA 4FLZA 1REVB 1KLNA 3CJ2A 3ZT2A 2FVQA 1I6JA 3ISND 1TL3B 4CJSA 2EX3A 3KK3B 2FBXA 4W5QA 1B9DA 1JXEA 5CYMA 3TAEA 3BQ2A 5DGAA 1S1WB 3OLBA 3GIKA 3QIPB 2W9BB 4ID5A 2B6AB 1MU2B 3V1RA 1SUQA 4OGEA 1C1BA 1HPZB 3RR8A 3JSMB 3HP6A 3QETA 3PO5A 2DTUA 3TARA 1VSMA 2D3UA 3OJSA 4O0JA 4B9LA 2IA6A 3I0RB 4QAGA 4DL3A 3KD5E 3K2PA 4PY5A 2D5RA 2OA8A 2ZKUA 4E3SA 3PX0A 1NK6A 1L3TA 4NCGA 2ILYA 3ZSZA 4EP4A 4IR1A 4TSXA 1RT6B 5DK5A 1QTMA 5CYQA 4HYKA 4ELUA 4IH6A 3JYTA 4G1QB 4LSNB 3PJXA 1NOZA 1EX4A 2Z1GA 3SPZA 3HP9A 1JLAB 5K14A 5KI6A 1S1XB 3OYHA 2KTQA 2DPJA 3S3OA 2V4RA 1RDBA 4DQIA 2RPIA 4DFKA 3H5SA 4PQUB 1S6QB 5C25A 5KT7A 3QERA 1NK9A 2RN2A 4DU1A 3V4IB 3AO1A 4FW1A 3QIOA 4O3RA 5DMRA 5F8JA 2G8IA 2AX0A 1S5JA 2PY5A 4MK8A 1TKXA 4M45A 3D5MA 4Y1CA 5JXSA 4KTQA 1C6VA 3Q8RB 3VQ7A 4H4MB 3KKSA 3DM2B 1JLBB 3LANA 1LW2A 2WRMA 3H5YA 3KHLA 2D0CA 3RR7A 4RG8A 4ZP6A 1RT4B 3MEGA 4RW7A 2QKKA 4KB7A 3OYKA 4IFYA 3IS9B 4K4TA 4NLXA 4K4XA 2YNIA 4DWIA 3QGGA 2FBVA 3LZIA 3HVRA 3DI6B 4EBEA 4BDYA 4IRCA 3T5LA 4DTSA 2OPSB 4O4GB 2DFHA 1B92A 2IC3B 3NBPB 2YNFB 2BGGA 4DS5A 3K58A 3CG7A 4K4UA 1L3SA 3LWMA 1S9EB 4EO6A 4KAZA 1N5YB 3QZ7A 4DTUA 2RKIA 1NK7A 3MXMA 4TXSA 3E01A 2BE2B 3CWJA 4M3XA 2E9TA 4NLQA 2R8HA 5L9XA 1TKZB 4N47A 4RW6A 1CZBA 4FZXC 1SKSA 4J9MA 4FK4A 2HMIA 3U6FA 2YNHB 3KMQA 3OVNA 3GIMA 1N56A 1WSFA 4F4YA 1JLCA 2OYQA 4ZVFA 4R0EA 4CHNA 4X2BA 4HVJA 2F8TA 1GOBA 4Q0BA 3IG1A 4HCBA 4YNQA 1RT1B 4RNNA 3HVTB 4DTJA 1VRUB 1FKPA 1KLMA 3MECB 4MIAA 2PYLA 4H4OB 4NLOA 3T19A 4CK1A 3OS1A 4ECYA 3ZT1A 5HROA 5DG7A 4N76A 3AV9A 4NRTA 1LW0B 4Q44A 4GC7A 2AGOA 2KFZA 4NCBA 3CJ5A 2HVIA 4QWCA 3BSCA 2UVVA 3L2WA 4XO0A 1BIZA 4G3IA 4FM1A 3NGIA 3OL9A 4FLYA 3A2FA 5KFOA 4ZVGA 4J2BA 4KB1A 1UWBB 4KB0A 1VSHA 4JLHA 5KFVA 3NAEA 4ECXA 1C1AA 1XHXA 3B6OA 4M3ZA 1S0MA 3RWUA 1S6PA 4ZHRA 5I42A 3QEXA 1XC9A 1HYSA 5J2NA 3RMBA 5KFLA 3AA2A 1VSEA 3RAXA 3SQ2A 3SI6A 1U45A 4MQ3A 1T7PA 2RDIA 3M9NB 2FLPA 4DSKA 2AGPA 3DDKA 3SV3A 4E7JA 3GV7B 3AVFA 4BWJA 5HBMA 4CJUA 3OYGA 4KBIA 4C8NA 2VG5B 4KV8A 3MR5A 5EDWA 3BDPA 4E1MA 3NL0A 2F8EX 3MR2A 1K6YA 1ZBHA 1RDRA 4JUZA 2CKWA 3H08A 4CGJA 4MIBA 3SUOA 1T8EA 4B8AB 4NRUA 2RF2A 2YHAA 4YFUA 1NK5A 1EP4A 2QK9A 2B5JB 5F8MA 1ZBIA 3TAMB 1F21A 3DLGB 4HUGA 2I1RA 3OHBA 4F50A 2W7OA 4CFCA 3LP0B 1RT5A 4Y1DA 1U09A 1BI4B 1TP7A 3K5OA 2XCPA 5HP1B 4NLDA 2UUTA 3GIJA 4K4ZA 3HPHA 4LH4A 3CVKA 5KFWA 2C22A 3OLAA 4ED3A 2Y1IA 4O44B 1EETB 4ICLB 1S1UA 4Z0UA 4OVLA 4TY8A 2KFNA 1LWEA 4QWDA 3ZSVA 2JEIA 5KT6A 1GX5A 1SV5A 2FJWA 3RMCA 4AHTA 5J2QA 1FK9B 3MR3A 3UPFA 4DG1A 3RBDA 1HNVB 1KFSA 4I9LA 4GW6A 3OJUA 1RTDA 3OHAA 4Q8FA 5I3UB 3I0SA 4IOBA 4K50A 2OPPB 4KRFA 1QS4A 4DSJA 4J2EA 4CEZA 3OYFA 1K1SA 3RMAA 1S0OA 4FJLA 4M95A 3LALA 4CJ5A 2D3ZA 1KFDA 4EYIB 5J2PA 4PUOB 3O3HA 4FLTA 1C0MA 2FVCA 2BANA 2DPIA 2OPRB 2VWKA 4J9OA 4F3OA 4C8KA 2JC1A 4B9NA 5KFRA 3QEWA 3MAQA 2WHOA 2G8HA 1DLOA 1TL1B 3FQLA 3VQ6A 1RTIB 3OYLA 3D28A 3V9ZA 2IM3A 4QOZB 1FKOA 3PW7A 3H5UA 4NLYA 4TYAA 3AVHA 1CLQA 1T05B 4DQQA 4N5SA 3PO4A 1SH2A 3O3GA 4ELTA 1JLEB 5KT2A 4WE1A 2GBZA 3WNFA 2HNDA 1ASVA 2OH2A 4NZ0A 5FDLB 5JUMA 2VG6B 1ASWA 2WONA 5KFNA 2R2UA 1NK4A 1REVA 1BCMA 4WFXA 4LQ3A 1TL3A 5KFJA 4WFZA 5KFGA 3KK3A 1RAJA 5EWFA 3VQBA 2WB4A 1S1VB 1OS5A 3M8PB 2Y1JA 4KKOB 1BGXT 3G86A 4RW4B 1D9FA 1W0HA 5HRNA 2E6LA 3VA3A 1S1WA 1R0AB 3G6VA 3QIPA 2W9BA 5HRSA 3CFOA 2B6AA 1ZBFA 4CEFA 3AO5A 4K8XA 5DGBA 1HPZA 3K5NA 3N6LA 4CCHA 2EHGA 2BRKA 4RUCA 3JSMA
chains in the Genus database with same CATH superfamily
2HBZB 1K8AT 3WT0A 1CJKA 5J1EA 4ZLNA 1DGKN 4OKJA 2JH3A 4LF9F 3HHLD 2PFFB 4DB3A 2W2PP 5C0YA 1IBLK 2KQ2A 1QAIA 1SQFA 3AJDA 3PSFA 3J81U 2XLIA 2AHOB 1AFIA 3R5DA 1U8WA 2ZJPQ 3I32A 4TY9A 4OX9J 4PQUA 1EAYC 2HK2A 3VALA 1HL6A 1FDBA 2V2ZA 4CD1A 4CLPA 4TLRA 2ITMA 4FWNA 3OS0A 4LR7A 4FPAA 5C2GA 4R79A 2B9WA 1WKKA 1X5TA 1T44A 2XWYA 4M41A 5FLXU 3BP8A 1B64A 4LF6K 4JI1J 4EO8A 2Z2YB 3IMQJ 2O8BA 1Y4ZB 1XERA 3CC2N 3I31A 3W5YA 1HYVA 2Q0UA 1HR0K 3MAAA 3DI6A 4YR3A 4FJ9A 4K5SA 2HBYB 4KH0B 4TVAB 3KYLA 1Y0HA 2W2OP 3C2PA 2HHQA 1WF0A 2HFVA 4M5DA 1IBLJ 3MN6A 4PABA 3ZFVA 1N5YA 3EWGA 5FJ4A 3UCUP 2O01C 4HUFA 4DSLA 2Y0SD 4ZKAA 3GYXB 1IJEB 3MCPA 2Z2MA 4ER8A 3A5LC 4BC4A 1S1TA 5KG6A 3QMLA 2XM3A 1ROFA 2LLZA 2V94A 3CJ4A 3HSGA 4F3QA 4MJKA 3BO3A 1FJGJ 1M1KT 1H3DA 5DDRC 2ATQA 4IQMA 3QFHA 3B54A 4BGBA 3J7YP 2HIQA 3IUCA 2A2DA 4MKBA 2EFGA 2VICA 2CZ4A 4Z37A 3WNHA 4NLSA 1S9FA 2HHTA 3QEPA 4LF4F 4LREA 1NGGA 4LF5K 3ITHB 2V2QA 3W9HA 4DUZK 5E0OA 2W2NP 4IZ9A 3BYPA 1HR0J 3CDEA 2R8IA 2LDIA 3QLHB 4IH5A 2O8CA 1MN9A 2HFOA 4F0MA 1J5EK 4LVNP 3OVAA 1T3OA 4DV5F 5BN9A 3GYGA 4NYZA 3TVKA 1Y10A 3HJFA 3WEEB 2O8DA 2P5GA 1U6ZA 3HSJA 1N5QA 4AHSA 1IQTA 2YHYA 3D3CJ 3MPVA 3UIQA 2LA4A 5KFFA 5AQPA 2DK2A 1N33K 3GV8B 1J53A 2OZMA 1W26A 3O9SA 3TX8A 3PJ9A 5LMNK 3O6WA 1WBBA 2Y1LB 1TFWA 2J6TA 2KH9A 1P9QC 1MROB 4P72A 3GJQB 4ECZA 3GLJA 2AYGA 3NNHA 3DXKB 5KG1A 1DJ0A 1TL5A 3V6KA 4IKAA 4OYAA 3M32B 2C2RA 2LQ9A 3CO0P 2XZWA 3KUHA 1VJQA 2QV6A 4LF5J 3M8QA 4DUZJ 4JEPA 2GZOA 3OYNA 3R1XA 1RFQA 2B5JA 1PJ7A 3BY5A 2MKCA 4JV0A 2XNQA 2V0NA 2YCHA 2MLYA 5CABA 4FM2A 1Y5LB 2IHR1 2HAFA 3FCWA 3L4QA 1R8AA 3V9SA 1FT8A 1HIYA 4CK3A 4WPAA 3T5HA 3HPGA 2P9EA 4Y2CA 4AF1A 3CW2C 5LM7E 4RUHA 2CYYA 3IFEA 1EETA 4ICLA 5EVZA 3S9HA 1HNXK 1SUQB 2C3UA 4JI3F 1N33J 1Y5NB 1YHQS 5LMNJ 2LECA 3P5JA 1X4AA 1TKDA 1K1QA 2DFEA 1K0VA 3AVBA 3CM5A 3EDRB 2ACYA 1U48A 3CJKA 3KTQA 3DMJA 1RADB 1CBKA 4F4XA 1YBAA 4LQ9A 1F9HA 3IO1A 3EKSA 1S59A 4ED6A 3IAYA 9ATCB 1RCHA 4OZ0A 4DSEA 2HB5A 3CJ1A 2OSRA 2OPRA 2ZDPA 3MXHP 3BF1A 1Y9OA 2HQCA 4YB6A 3PRDA 3BGLA 1U1MA 4A5BA 5IT9U 2QFIA 3SXLA 2B8PA 4AILC 3O3LA 4NEYA 2YNGB 2UUWA 1A9NB 1WNEA 2XSJA 4P6QA 2FHJA 3I8BA 4OJHA 3HOTA 3TAPA 1HNXJ 2KB2A 2ZH9A 4DU8A 2HHUA 4TQRA 2RUSA 3I87A 1TK0A 3R2CJ 1R8HA 1UFKA 2RDDA 4JS4A 3T6JA 3RB6A 2F65A 2ZBIA 4EP5A 2OPQA 1LEOA 1U2FA 2NREA 4A46A 1M5OC 3E01B 3QJPA 1LK5A 1SJFA 3THWB 3I5AA 2G8KA 1RGIA 4C9DA 1DARA 5CQGA 3HL8A 1LWFB 1RHQB 2BKOA 3W9IA 2CUYA 5L1JA 4E7IA 1CC8A 1RQ0A 1S99A 2GX9A 3KLIA 4A8KA 4ZCIA 5D77A 3VQAA 1NUEA 4USTA 3PRBA 5D4PA 3ZZ0A 4ERDA 4L74A 2BE7D 2A1SA 4BRHA 2IS3A 3M7VA 3LWLA 3N0VA 4M5KA 3HOSA 2JC0A 3PTWA 3ZC4A 4UQGA 4ZMMA 1K73O 3ZTOA 4TU8A 4E89A 2FHMA 2GQCA 1NKCA 3QGPA 1RCXB 2NRZA 2JSXA 2JWLA 4M3WA 4TN2A 3Q7BA 1S22A 3LP1B 1HBUB 5KQ8A 3SEOA 4PWDB 3ZTRA 1XHZA 4DXLA 1M90O 2XBPA 4KPYA 4E7HA 1S5ZA 2FF3B 2CGJA 3EZ5A 3WNEA 3OYEA 2I9SA 2SXLA 4B3TF 2O66A 2XHWA 2HZAA 4Y2AA 8AT1B 1RAAB 2K1RA 3K5LA 1MWKA 4ZJOA 3U27A 4ZK7M 2F8SA 3BH6B 2ADCA 4ZP9A 3NH0A 5J1PA 3TQ1A 4YB5A 3PG9A 4L73A 4DTMA 4FSVA 1MW7A 3ZYYX 3PKYA 4C8MA 2ZJQQ 2XHCA 1OPZA 1RWUA 2A3ZA 3ZSYA 4CO0A 3OD2A 4RLEA 4FLWA 1TR0A 1F9FA 1FFGB 2N7YA 4A47A 4W5RA 3K8WA 4YR0A 4H4KA 1IBKK 4WZQA 3M1VB 5HQLA 3VQ8A 3HRGA 3LP3A 1JJ2M 2D0PA 1WKJA 2MQQA 3TAFA 1V6HA 4DPTA 1N5SA 1BL3A 4CIEA 4TKTA 4NLTA 2M88A 2VHGA 3SBTA 3KG1A 2G8VA 4NA3A 2ZHOA 1GLBG 3QZ8A 3RG6A 1NB2A 5KFXA 4UY8T 2Z1JA 1HJRA 4WFYA 3NH2A 4QIWD 2WZ1A 3TTFA 3TUJC 4CLUA 1ATNA 2PDAA 3PX6A 1HWUA 4BRCA 1JLAA 1ZBUA 3CD6N 3H1VX 3RMDA 4TY8B 1VLOA 2HRUA 2CQBA 3OL8A 1NGFA 4QU6A 4ED7A 3ENAA 3WEEA 1XMBA 4F4WA 5I3PA 3NVMA 3L2UA 1QHAA 1K44A 3MCMA 2DB1A 4MYUA 5K8MA 3FBFA 3ZSOA 3FZKA 1U1NA 3UDLA 1TYQB 4FVUA 4OJ1A 3L4BC 4WFNL 3KLHB 3OW2M 1BWFO 4K4VA 1PCAA 1UAWA 1S7HA 3DXKA 1HWJA 4O4GA 2OEJA 4XIUA 2CPIA 4QWAA 3M32A 4OL8A 5F8LA 2PI4A 2OP5A 1YT3A 3PLAA 2R7TA 4ILJA 3VQ4A 1E4FT 4B3OB 4DDFA 5KFKA 1PAEX 4L8RB 2OD4A 1HQUB 2ZWPA 2YQ3A 3TWHA 4XH5A 2HNDB 1ACMB 4PYAA 3E51A 1B3TA 4QIEA 3VQQA 2IM0A 2LMIA 4WIQA 1JB0C 2QL5B 3P5TL 2Y9HA 1RT3B 1OYEA 1KDNA 1T9VA 4FJMA 2GJIA 3L0QA 4ECRA 3CULA 1ATSA 4DR2K 4DF8A 1RBUA 4O3PA 4OHXA 3FEZA 4CF9A 3VV2B 3EPIA 2E8AA 1C4AA 2OFGX 4KHPF 2BZ2A 3GJRB 3QESA 3DLJA 2V34A 3MN9A 1W2BR 3PEJA 5KPZA 4L6V3 2H9ZA 3UCGA 4N7TA 5L8RC 1QQMA 3R7NB 2QSWA 4DUYK 2HK3A 2WK4A 3TTDA 4DV6F 1IQZA 1RZMA 1G3OA 2FTRA 2E1RA 1YBTA 5C24B 4OYMA 1UW9A 2G1HA 4K4YA 1SJ4P 3NGYA 3H42A 2PMZD 2DXEA 4PRFA 2JLFA 4ILMA 2HOEA 5ADZA 5B0BA 4EFAC 1R8PA 1YI2N 1T3VA 1NPKA 3SSQA 3J80U 1Q18A 3CO9A 3EZUA 4YDXA 1WN7A 2AV5A 1D9AA 1SL2A 2YNGA 4P71A 4FDFA 3BSAA 1UWAA 4JK7A 4DHVA 4J9KA 3AOCA 4CZIA 4DR2J 4QQBA 4JV5K 3BSNA 4USIA 2EW9A 3QATA 4BHQA 1EQMA 5T7BA 4HWIA 3CNQP 4OZLA 4OPKA 2BKNA 3HYFA 3FBEA 4BRNA 2M8DB 4FWQA 1YRUA 2BM0A 3CM6A 2CQDA 3GSDA 1TL7B 3CJTA 4AH9A 2X3GA 3DYAB 4QW8A 2LP4A 1NG9A 2M4MA 3IM9A 5B0DA 4DUYJ 2HWIA 2ROPA 3CDAA 2PI5A 1RBVA 4QIVA 3OFHA 4DS4A 3H2VE 3TOQA 2L41A 4FVMA 1S77D 3THWA 2D0BA 5CYMB 4ZCKA 1HWIA 4MIWA 5F8IA 1LWFA 3TSQA 5GAEU 4B9TA 2QJ3A 2XO6A 3TAGA 2C2OB 1C1BB 3E9LA 4AM7A 2R2SA 3JTPA 3OYIA 2CIMA 2HBKA 3AQPA 1UVLA 2F4VF 2XS2A 2MQMA 2HGNA 2HAIA 1MLAA 3I5BA 2FIUA 2IMOA 3JSYA 4JV5J 3W5ZA 3ULDA 2ZBRA 3I8DA 5EXWA 5CAAA 3O8WA 4I68A 2GA7A 1Z1ZA 3LP1A 1HBUA 3FGVA 3R6LB 4I56A 4PWDA 4ZP7A 5A0YA 2GQQA 1EWRA 4FJGA 1WORA 3BEXA 3LZJA 3KLGB 2ALYB 1MWYA 4JD2B 5FRNA 3QBCA 5FD1A 4DSFA 3DLBA 4Y3CA 5EWGA 2I0XA 5MLCV 2YWEA 4EEYA 3JSBA 1XNRF 4DR3K 3VAGA 4MO4A 2VG6A 3QB0A 5HRPA 3MEGB 1OPIA 1NLVA 4ZVQB 4CYUB 2YNIB 1FVSA 3PYDA 1UW4A 5IZHA 2V68A 1JWWA 1MWZA 4B1VA 1U24A 4FWSA 1SC3B 4FZZA 2GWKA 3MM7B 3NAIA 4FJ8A 4ZLJA 2NRRA 4FS1A 3M1VA 2RHKA 1O1WA 5C12A 3EPGA 1K8KB 4BRLA 1Q8KA 2ASOA 5EWEA 2XYGB 4O8UA 1S4FA 4NWBA 2I7PA 2GIQA 3VETA 3KHYA 2GHVC 4OZ1A 2UU9K 1XBWA 4RW6B 3HSCA 3VA0A 4USWA 4MFBA 3F44A 2R7XA 4FYDA 2OD6A 4KE5A 3ENBA 1CZAN 1JLCB 2AJFE 3NGDA 4JI7F 2KRBA 4DTOA 4RNFA 2ZH8A 3O1BA 4GV9A 3L2VA 3CCEN 3L7UA 1VSFA 1QQNA 4CHOA 4BC3A 3MZIA 4Q0BB 4DQRA 2CWKA 1GMUA 1BA1A 2EWSA 4Q5VA 1BISA 4IOXA 3DXMA 1FFSB 3D0HE 3AO3A 1IJFB 1WSHA 2D41A 2MQLA 2WVBA 4BROA 4M7XA 3UDCA 1IG9A 3CJ3A 4CRJA 3W0LA 2P9IB 3IAM9 3ZXWA 4EWTA 1RBTA 3DC2A 1T11A 4FWLA 3ZZOA 4X64F 2CJKA 4H0XB 1TYQA 3QO9A 5DQIA 5C10A 2VCPA 3KLHA 2Z0GA 1UKUA 4DV0F 1QSSA 3J7ZO 1FD2A 2VBZA 3CXCR 1BG3A 4DSIA 4LVOP 2UU9J 4RUAA 1S6PB 2Q2RA 4X4SA 5I42B 1YLXA 2K06A 3SDEB 5J2NB 4ECSA 4B3OA 4Y00A 3BN4A 4GV3A 3L2QA 1HQUA 3CHWA 2VOOA 3NNAA 4ALZA 4NCAA 3THVA 1YI2S 2F7VA 3PCOB 2ZE2B 4BR9A 1NU0A 1OY8A 1RT3A 3THTA 2J9DA 4HDHA 2DNLA 2RF2B 4A8WA 2E29A 1JCGA 2HNYB 2H3GX 4XH1A 4A8OA 5CYJA 4AM6A 4QJVA 4OMFG 4Z4IA 3EX7B 1RT5B 3M2VB 4DV4K 4OLBA 5M1PA 3EGWB 4XK8C 3TEGA 5IWAF 4WYWA 4FWKA 2Y8WA 1RWOB 2ZZNA 2NXEA 3T1AA 2GX8A 5ETRA 5A2QY 3SSSA 3PIOL 1RBRA 2JWNA 4Z4EA 2AMCB 2ADBA 1F2HA 3VERA 3KUGA 5GINA 4NLPA 1SC6A 5C24A 1C4CA 3LDNA 2BVZA 3C14B 4GC6A 2ZWHA 5AQGA 2YBVA 5LL6Z 1YTYA 3L8BA 1NDPA 5LY3A 2KFYA 2EBEA 3QIDA 4EBCA 2NYHA 5KAKA 3ENWA 3DU6A 5EX3A 1Y97A 1T94A 3QJJA 1HKBA 5J2PB 1WC6A 2ASJA 1N32F 2VG7A 5KFSA 3NMUA 4ILHA 5GAHI 2ZM6F 2VBYA 5AZJB 4DV4J 3LP2A 1HNIB 4ISGA 2W6LA 2BJEA 3D2WA 1CSJA 4CTAB 2RNEA 3QSYB 4EGLA 1DTTA 2LA6A 1JNRB 2WONB 1TL7A 3M2UA 3RRKA 2FLLA 1UZHA 2MZSA 3CJ2A 3ZT2A 4CJSA 1QVGM 4N77A 2RB7A 4LSZB 1WUUA 3HHLB 2VBXA 5CYMA 3TAEA 3BQ2A 3K7RA 1WHVA 2VBWA 5IOLA 3OTBA 3QIPB 1BUPA 3AOAA 1C1BA 4DPUA 1U2VB 2DH9A 3JSMB 4DI6A 3RUBL 3QETA 3PO5A 2DTUA 2KG1A 3OVSA 2D3UA 1ZXOA 1RDUA 3MTJA 2W1BA 2JLGA 3KD5E 4BGAA 2OA8A 2MKIA 2ZKUA 1L3TA 3TR5A 3N4WA 5E5NA 3ZSZA 5M1FA 1FDNA 4FYVB 4TSXA 3SAGA 2X1GA 4J9UE 2QMWA 2V8VA 5DK5A 1VJWA 4HYKA 3JYTA 4G1QB 4ZVRB 3SCJE 3SMPA 4EHTA 2Z1GA 3HP9A 4V19S 2XTJP 4LF9K 1S1XB 4H0OA 2BM1A 2V4RA 3AAPA 2J9EA 3GP9A 5AXKA 5C25A 3DOMB 3C7NB 4JD2A 2RN2A 3W3DA 4DU1A 1HBNB 4NO7A 3CCES 4JI5F 4M45A 3D5MA 5ETVA 5HK4A 5JXSA 1NCLA 1XJWB 1C6VA 3VAHA 2YWGA 3FSXA 4H4MB 4PPZA 4CLWA 4CO3A 2VQFF 1KQSR 3DN9A 1ZAVA 1H6KX 3KHLA 2AP1A 4RG8A 4ZP6A 3MEGA 4YEAA 3R5BA 4KB7A 4WFAQ 3NCQA 3ULEB 4K4TA 4ZVUB 4CYUA 2YNIA 4CZKA 2VFTA 4IRCA 2R7QA 2K7JA 4DTSA 2OPSB 3B4DA 5LSRA 3MM7A 3FGUA 2AT1B 3MMBB 5CHIA 5BJRA 1Q86O 2NUHA 4DS5A 1IBMK 1L3SA 4KAZA 2NR0A 4DCJB 2AKWB 4IO8A 2BE2B 3CWJA 4LF9J 3I55S 1TKZB 4RW6A 5E3AA 1SKSA 1UP1A 4NEZA 4OHZA 2VDIA 2VL1A 3KMQA 1RBOB 3GIMA 1N56A 1WSFA 3CQYA 3UW1A 1JLCA 4R0EA 2BH1A 3GIRA 3M6XA 1SJQA 2EPIA 2QWPA 4IO9Q 4ZVOB 2HKEA 4Q0BA 1X0PA 1DRZA 4FNIA 2RS2A 1KLMA 4LFAF 2PYLA 3WC0A 4H4OB 1F60B 3IWNC 3OS1A 2KYXA 4RBVA 3DDNA 3M4XA 3ETOA 1FX4A 5DG7A 4N76A 1K73T 4OYWA 3L95X 4Q44A 1SB6A 4LF4K 5L46A 4NCBA 3S8SA 5CXTA 2DRAA 2JFKA 1FDDA 2UVVA 4CH7A 2XB2D 1V9OA 4DV1F 3MN7A 1DBDA 2YXLA 3D6HB 1UWBB 5D0EA 4JLHA 2PMWA 2F9TA 5KFVA 1XHXA 3B6OA 2XG8A 3MPYA 1S0MA 3RWUA 4M3ZA 3SLCA 4DV5K 1WG5A 4CNYA 1S6PA 2FZKB 2VFRA 3VTHA 5I42A 3SDEA 3WQPA 5J2NA 3RMBA 1VQPN 3AA2A 1Q5YA 1G99A 3E66A 4B3MF 1M0SA 3P4IA 3SI6A 2QWQA 2O8EA 3U8XA 1WI8A 1URRA 2YWHA 2V50A 4DSKA 1VQKN 1HBOB 4E7JA 4BWJA 4CJUA 3ZZPA 4C8NA 4A8XA 3THYB 3ZZRA 2VV5A 4ZVTB 3NL0A 1RDRA 1MWMA 2CKWA 1P1TA 3H08A 3SUOA 4DZDA 4B8AB 2RF2A 1F6TA 2DEIA 2V69A 1XNQF 2D3OR 4OX6A 2KT2A 5BYQA 2VPYB 3CD0A 1VC5A 3QWUA 4LF4J 1QM9A 2LVWA 2FHJD 5B8HA 1RT5A 3M2VA 5GAGU 3LM9A 1G4CA 1UJ6A 2J7UA 2XCPA 4C11B 3FZHA 3SIPB 5AE2A 2UUAF 4NI2B 1UVIA 1KP6A 3HPHA 1Y64A 3WXIA 4CI6A 4Z0UA 1O6XA 4DV5J 2KFNA 1NMDA 4RCHA 1MWQA 4MTPA 3ZSVA 4GKKK 2Q79A 2G9OA 2NQPA 1SV5A 3RSEB 5D4OA 4XTTA 3C14A 4NA2A 3D6RA 3MR3A 3TJ8A 2CJYB 2M70A 4RX6A 4JI3K 5B0AA 3BO2A 1YF5L 1FWKA 4DSJA 5GAHP 3VEXA 3LTOA 5IC6B 4J2EA 3HTVA 3HFKA 4XH4A 3LALA 3IM8A 5J2PA 3OBIA 4PUOB 4UTGA 4FLTA 2HHHF 1GLAG 4GNIA 4MMOA 1HD1A 4J9OA 1ZZFA 5KFRA 5AZIB 3R8EA 2G8HA 2HQGA 1TL1B 3FQLA 4WKYA 4OZ5A 3O9UA 1RTIB 3THPA 3IMXA 3OYLA 3HHLC 3V9ZA 1VHXA 1KQSM 1S0VA 1WTBA 5AZJA 2EFNA 4YOTA 1FKOA 3H5UA 3C16A 4WCEL 4P2MA 2ZH4A 2MJUA 5BPNA 4N5SA 1SH2A 3UKUA 1IN0A 5M1NA 1ASVA 4NZ0A 3UR3C 2WONA 3R97A 2R2UA 1UMJA 1YRTA 4ZPVR 5HMXA 4GKKJ 3M8WA 2WB4A 3CCVS 4KKOB 4LF1A 3SK3A 2CXEA 2BJ7A 3MMAB 4KH4A 1NDLA 3N28A 4ZN1A 3EEQA 2E6LA 1Q7YT 6FDRA 4WKRA 1R0AB 3TX0A 2W41A 3QIPA 4QR1A 4JI3J 3L7OA 2EXUA 4K8XA 1U0SA 3IAS9 5DGBA 1PYOB 2GJFA 1SXLA 4CCHA 1U2VA 2BRKA 3JSMA 3W64A 3WBZA 1GXTA 2XS5A 2W4DA 3DLEB 5KFTA 3GBTA 2IVNA 3E9PA 2R2RA 2YKAA 4J9VA 2RD5C 2G0JA 4A2BA 4JV1A 3FNNA 1U4BA 1UEKA 2RRBA 3MEEB 3FR0A 4QR2A 3OFFA 3PW2A 3MN5A 2DNNA 2HWTA 2DHSA 4A48A 4LF7F 4G1QA 1QQCA 2RAQA 1IKVA 3N5FA 4U9RA 1ITPA 1NNDA 3CT9A 4F4ZA 2OSQA 2D69A 2IIHA 2P9KB 3DOMA 3C7NA 5KFZA 5DQGA 2ASLA 1GXUA 1FEEA 4EU0A 1HBNA 4CNZA 3PJWA 4CHQA 5CR4A 4Y28C 3TZXA 3SMZA 4UZCA 4YY3F 3GFYA 1WD6A 3AXKA 2XZDB 3OR2B 1N34F 4H4MA 1WC4A 2LSNA 1NJWA 3ZSQA 3ZETB 3H90A 3IRXB 1BIUA 3ULEA 4K0KF 1KSPA 1X4GA 2GUIA 2H4WB 2K7KA 4FOEA 2OEKA 2OTLS 5AJ3K 5CCLA 1HNWF 4NXMF 2RE2A 3FCHA 5HJXA 3MMBA 4CLFA 3G82B 4CZFA 2W42A 4JYAF 5A8KB 4JV2A 2VYPA 2ZZTA 3DRXA 3G9CA 3HLUA 1S4EA 1YUWA 3LAKA 3GG0A 5D8HB 4QW9A 1KTVA 5E41A 2ZHAA 1Z25A 1VK0A 4MT1A 5BR9A 2BE2A 4DLGA 2N4CA 1J54A 3KJQB 2Z1IA 4OPJA 2G4BA 3WUHA 5KFIA 2DGSA 3Q8UA 1YVNA 1U1RA 2FC8A 5KG2A 4B1WB 1LOUA 5G0RB 1TK5A 3T3FA 4JKCA 1L3KA 4P74A 1NOYA 3NS7B 4DFPA 4CGDA 2MKKA 3NXZA 1DHMA 2ALZA 3IBFB 1E6VB 3AHPA 1N0UA 1G15A 2O4IA 5DM7Q 5IS2A 1WEXA 3W63A 5F3TA 2AZ1A 5KFAA 3MHYA 2IM1A 5KFBA 3EUNA 3FK4A 4RNHA 4NZ7A 4J9SA 1VRTB 1QE1B 2J0QD 5AJ3J 3RRGA 2ZEJA 3V2UC 4WFBL 2I8EA 4LD0A 1Z6RA 1VMBA 4J5OA 4HTLA 2G2ZA 2MEWA 1E6YA 2RQCA 3ZSWA 3CDBA 1B7YB 3NP5A 1LQ9A 2OUGA 4M63C 1IKYB 4ILGB 2XQCA 1Q9XA 2YWWA 4J2DA 1AROP 9RUBA 2UUBF 4QYZK 1VQ7N 2DNOA 5DG9A 2FHKA 4KC5A 2NLWA 1GTHA 2RHQB 3AVJA 3W9JA 2ERRA 1HWKA 3J7AN 2NZTA 3JB9k 4OI3A 1RWNB 1HBOA 2GFFA 1QJHA 5AE3A 3THYA 5FPNA 1EB0A 3MF5A 3T1YF 2C1EB 4DTRA 4BDPA 3WDOA 3VPZA 2BQUA 5IQ6A 2KJVA 3KDOA 2ZVSA 3TSPA 1FNXH 3CJRA 2WVFA 1W7AA 4Z94A 3IR5B 4Z2XA 5AXMA 4O5BA 4PA1A 4H03B 3R6GB 1NKEA 2MQOA 1DQ9A 4PXDA 2AQ4A 5AE1A 2R7VA 4E98A 1S57A 2QKBA 2GIRA 4V19J 4ZITA 2JJ4D 4C11A 1R6VA 5DS7A 2HGLA 1ZAXA 3MWBA 4NI2A 3ENOA 3B8AX 1NH7A 4OIXA 2JNJA 2QIFA 2VASA 2QYGA 4PG8A 2FBTA 2Q3SA 2D0AA 2M9KA 3NCIA 5KFYA 4QYZJ 2OHDA 1GEHA 3OBWA 3NE6A 2KM8B 3RBXA 2E9ZA 5F0XA 2VWBA 2P51A 3RSEA 2X51A 1NWKA 2CGKA 3RW6A 3G6EN 3LDSA 4NMXA 5KPRA 4LBHA 1FKAF 4DR5F 2A0FB 2P6SA 3V9UA 4KHPK 3ATUA 5LXRA 2FLNA 4OHVA 3FZLA 3GJSB 2HWHA 5EY4A 3BQ0A 2CQGA 5SWMA 2UVRA 2MTLA 3TP2A 4BR4A 5KOWA 2RIJA 4B9UA 1PJ6A 1BU6O 5AZIA 3KHHA 1TL1A 3VEYA 4DV6K 3DRPB 1U8SA 2WVEA 1RTIA 2Z58B 2XMAA 3QT6A 2GGPA 4CLLA 3CMES 3D3BJ 3HD1A 4MYTA 3W2VB 3BDEA 4FJJA 3TQEA 1UA0A 2QXLA 4CF2A 2XY7A 2WTUA 1LW2B 3JAMY 2GCFA 1EIYB 4EYHB 4B9SA 1RE1B 1QVFR 1VHFA 1T95A 4FJIA 3AQOA 2NPIA 4MDBA 5JVGQ 3H25A 3AA8A 4FWPA 5E3RA 1N6QB 4I6MB 3MMAA 1GAOA 4B17A 1JLQB 2UVWA 2DCUB 1NM2A 1R0AA 3VQEA 4R0JA 4OYOA 4KHPJ 2U2FA 5SZTA 3KLFB 5DLFA 3BGFA 4C3LA 5MLCQ 3U3GA 3P38A 4FJ7A 1SH3A 3MX5A 3QT5A 3W61A 1VQ6N 2ZH5A 2RKIB 3F5TA 3AVLA 1W7WA 2DIUA 4W4MA 4X4TA 3WXKA 2VOPA 3MEEA 1Q82O 5KTQA 1SJRA 4DV6J 3H2UB 3R7BB 5JMVA 4OV6A 1NSPA 1ZETA 4BVOA 2VDHA 1SZ2A 3QT7A 1T9YA 1HQEB 4DU3A 2V2KA 3OR1A 3FLCO 3HT0A 2EFQA 4QR0A 3BBFA 3K8VA 2XZTB 3V9WA 2B4VA 1RBSA 1YJ9N 1NGHA 2F4VK 1VSIA 4IYQA 3OSPA 5T14A 2XY5A 2XMKA 3OR2A 3IWXA 4RW8B 3TZWA 5IC4B 1GK8A 2RU3A 3ZETA 2MKYA 4NZ6A 3IRXA 3GMGA 2CNNB 3CCJS 2O4GA 1HMVB 1BA0A 3FCVA 4URQU 2M2BA 3ZEUB 3QWPA 4JP8A 3LPTA 2DGVA 2D4WA 2PA3A 2MQ8A 3G82A 2Q0RA 4CT9A 1UPPA 2MZJA 1Q8IA 5A8KA 4EUVA 1WAJA 4I6AA 2B4JA 1RNHA 4HHUA 3RBEA 4LR9A 4YDUC 2O8FA 4K8ZA 4XDDA 4QS9A 3AVCA 3DRYA 5C2DA 2N82B 1DZ5A 3K57A 3EVMA 5BR8F 4NYFA 1VQ7S 3CCQN 1ICEB 1GLEG 3P5BP 1ZBSA 4X4RA 3CIMA 2WC9A 1WSIA 3LAMA 3Q8PB 5C2CA 4CZGA 3MM6B 1QD1A 2X7IA 2AF6A 3T5JA 2F4VJ 2PGCA 3CPWR 4ISFA 2B3TB 2MYFA 5G0RA 3HHKA 2HQFA 3U7JA 3VZHA 1ZM3A 2IRUA 2BJ8A 2EC2A 2G0IA 2KXHA 4YDUA 5IT4A 3AA9A 2NXUA 3MMCB 4FXDA 4BREA 2J9CA 1OIAA 5KRTA 2GV9A 2PFDA 3AGRA 2ZVIA 4OJ3A 1VRTA 1QE1A 2FVRA 2IFXA 2YY3A 2P5VA 2BUPA 3F9KA 3CFPA 2U1AA 3VTIA 5K8OA 4UT4A 3HMJG 3QDKA 3BS9A 3CCRN 1LWEB 2DR5A 3SJHA 3H6EA 1IKYA 3GV5B 3CJSA 2IVYA 2HS3A 5JVHQ 4OJGA 2LCWA 4KPCA 1YIJS 4G1PA 1VQ4N 2ETJA 4FWOA 4OYZA 4X4VA 2B4PA 2CQ3A 3AA5X 1A5WA 3IS9A 4CZEA 1FRLA 2Q31A 3UKRB 2XY6A 4OLAA 3ALYA 2Z2ZA 5EOYA 1VQYA 2JX2A 1CJTB 2X6NA 5EN1A 4M42A 1NK0A 3I96A 2F40A 4X64K 2ATCB 2HLTA 5HLFB 3UD5A 4CJVA 4KGKA 5F0WA 2C2DA 4DV0K 3PW4A 5DQHA 2WBNA 5E2QA 1SL1A 3CCSS 3ZZYA 3SQOP 2HBMA 4DCHA 2DHHA 1KS2A 3D9BA 2ZJRQ 2HVEA 4YR2A 1AUDA 3PX4A 5C5JA 2MY7A 3TTCA 3ULHA 4CIOA 2IDLA 2B51A 4N8NA 4I2QB 1KTQA 3PUFA 1JKHB 3QT8A 4ECWA 2KZZA 3VEVA 2CQIA 4P75A 4CJLA 4DX8H 4BG9A 1GT8A 4YMEA 1ZTWA 1JK9B 3OV7A 3BGRB 1T3NA 3GQCA 3CCLN 4O5FA 3TA1A 1WUAA 2L48A 1YG0A 5DM6Q 4C7QA 3HXMA 1SIWB 2B7BB 4UY8O 4IOCL 1TTHB 2IMWP 1B4SA 3EVOA 3TR8A 2EFPA 2F1FA 1D4XA 4KHNA 1VSJA 1J9AA 2YPYA 5J1EB 1WAFA 1M1GA 4CJ7A 1IR2A 1F0XA 2WCXA 4BG8A 3PFOA 4YP3A 3MCOA 3EMTA 4X64J 1W97L 4GVEA 1VQ6S 4LF2A 2ITGA 4CJWA 1NGCA 4U95A 5IWAK 1FCAA 2P9LA 5M2RA 3K5MA 4DV0J 3FZFA 2FYXA 3H45C 4RW9B 2UXCF 2WB1D 4CF8A 1FXRA 1UA1A 3DRPA 4CEBA 2CDQA 4NLVA 4NE9C 1R0CB 4Z7YA 4HKQA 2KW4A 1TVRB 2H3EB 3W2VA 2KKZA 4EHUA 1YTAA 2IBKA 4LF8F 4FJXA 2DJWA 4K2JA 3PV8A 1YQHA 2P9SB 4Y0FA 1BQNB 4PG4A 4CIGA 4FM0A 4A8FA 2BQRA 1N32K 4W90B 1N6QA 3GJTB 3QNWB 2ZH7A 1WACA 4H8KA 4I6MA 4FCYA 2WW4A 1KHVA 5MAOA 4CJEA 2BJ9A 3SUNA 2ZM6K 5M1QA 1JLQA 3PVXA 3TAMA 2HZVA 5CD4H 2KHOA 4M5DB 2JLEA 3KLFA 4C0BA 4KGXB 5IWAJ 4CJRA 5SUHA 1N8RO 1QUVA 3VGUA 4CWBA 2QO3A 1XR7A 3CPWM 3Q86A 2GO8A 1YRXA 1S1TB 1JJ4A 1UCNA 4CECA 3I9ZA 2DH8A 1VIXA 1BOTO 1FHTA 2QWOA 4OI0A 3V6HA 2MB0B 4KR0B 1AZSB 3T6BA 4LFBF 2EBGA 5JS1A 3OTOK 1HQEA 3P83D 3PW5A 4WQ4C 3X3UA 4DR7F 4CESA 4GMJB 3V6JA 4RBUA 4A8MP 5IT0A 5I3UA 2OPPA 1SPBP 5A2QU 3AVGA 5CYQB 1OYDA 1PKUA 3DNCA 1WC3A 5HI7A 1N5VA 1N32J 4DU7A 1EX8A 5DZ7A 3VVUA 4C97A 1BHNA 2XGPA 2XI2A 4ZS6A 3EDQB 4P73A 3G8TA 2IY5B 2CPXA 4RW8A 2FY8A 3VAKA 1VQ5S 3KOAA 2ZM6J 2D1CA 2A6AA 3PIPL 4IO1A 2HFUA 2MDAA 1IUJA 2E7WA 4YHHK 1HMVA 3GG4A 1U04A 1CJUB 3MR6A 2V9WA 1QY7A 3ZEUA 3KVGA 2XMWA 4LUBA 1WB9A 2H5JB 5KT3A 1BQXA 2BR0A 3W8GA 3CCRS 5FDLA 3O4QA 3CJ9A 2XI3A 1OH7A 4FJNA 2FSKA 3BREA 4ANEA 4RW7B 4IRKA 4CEOA 4FLUA 4JI5K 5B09A 4IFYB 4KQZA 4DTXA 4FS2A 3VR1A 1O0PA 3EXYA 4CEDA 3MM8B 3OTOJ 4K4SA 1YJRA 3QEVA 4IEEA 4D3GA 1FE4A 2EG1A 2O5DA 3C19A 4CBXA 2DR9A 3FUYA 3O4NA 2AW0A 3M8QB 4HT5A 1PC5A 4JRPA 3TI0A 3KXDA 3N6MA 3ONQA 3CD5A 1F3FA 1ZAWA 1T9TA 3VQPA 3VQ9A 2YWFA 2NXCA 1VQNS 3O1WA 3AY9A 4ZPBA 2DNPA 4RO0A 1WG1A 2J6SA 2HMIB 2A42A 3MMCA 3OL7A 1HYZA 1S6OA 4ZCLA 3ZT3A 2V63A 2AGQA 4O0NA 2MKHA 4W98A 1Q0NA 1S0NA 3SPYA 4M8LA 2BJ1A 4Z4HA 3J81O 1X9SA 4FPRA 1S49A 5HVGA 1YJUA 3C94A 1FKPB 1RHUB 4JI5J 2XEXA 4PKGA 3Q8VA 3PR5B 4FN5A 2FSNA 4LF6F 3EGZA 2E20A 2CNOB 4HI1A 3CJKB 5F41A 3CCLS 1HR0F 3DMJB 1YTUA 1QAJA 3L3UA 4IXCA 2YQ1A 4LFAK 2WSEC 5ETOA 1KAYA 1BDGA 2PZSA 2CQ0A 1X3MA 5FLXO 2FUG9 3OFEA 2YWKA 3NCPA 3FSIA 1CJTA 3U3YA 2QYCA 3S7RA 4KO0A 2KO1A 1C0TA 2DISA 1IH7A 1WSJA 4PXCA 1BC6A 3G10A 4DV1K 5HLFA 2E6MA 3PXGa 4F02A 2CQ2A 2YX7A 5ETPA 1EHWA 1PJ5A 2ASPA 3SBGA 4ITSA 3IGVA 3AD9C 4J9LA 1FXLA 4OX9K 3LO3A 2VPXB 3G71N 2WW8A 3ASMA 2O67A 5FPDA 1PC4A 2ABYA 3GR1A 4I2QA 3CCTA 3G8QA 1ZZNA 3FE1A 1NM1A 5KOXA 1JKHA 1T9UA 2W2MP 2E5GA 2O1PA 1BMQB 3V1QA 1LAWA 3SQ4A 3BGRA 3KMSA 1YJWN 1QUPA 4PWWA 5ETTA 3HBTA 1T9WA 4LFAJ 2HHVA 2CQ4A 3SJJA 2Z1HA 1X8DA 2OPQB 3BR8A 2H5IB 3SQ0A 3G2XA 2XO7A 4BRPA 3KG0A 1LXNA 1J5EF 1WTFA 3BO4A 4BRQA 5AXLA 3TYTA 4DQPA 1VC0A 3M8SA 1Q8BA 1EKSA 1U6BA 2QXFA 3AJ2A 1DURA 4F4KA 1UTAA 2DGOA 2IJRA 3EL2A 5D15A 1VQSA 2XULA 3KLIB 4DV1J 3KKRA 4WTOB 3IKMA 3OY9A 3CUNA 2Z57B 2XS7A 4FXWA 2MZ1A 4RW9A 3BZKA 3LW5C 5J2QB 2LQJA 1GQEA 4DG1B 4HTUA 1YITS 1H2TZ 3GYNA 1FJGK 1HX1A 4B3MJ 1O13A 1YJVA 1TVRA 3DRSA 2JEGA 1FERA 1ZPWX 4HL9A 1X9MA 4K42A 3WXJA 1NLKL 3LPEA 1JCEA 4Y34A 3K2YA 3MCNA 3MK6A 4LBPA 1Z4UA 1HKAA 3SAFA 2P9SA 4ANDA 5KG0A 2HHHK 1BQNA 2Q43A 3ZNUA 1TQLA 4M5GA 3CJAA 3T9ZA 3NWGA 3HK2A 2HEKA 5L1KA 3KDNA 4TU7A 2K1RB 2PC6A 3QQCD 2N7CA 3ZCMA 3I9V9 1NHUA 2QL7B 1RA6A 5KG5A 3LOUA 1TL4A 3HFVA 1NGJA 1RJJA 2ZZMA 3MPWA 2QA4N 4FLZA 2J8SA 4LRBA 1T0TV 2ZOGA 2FVQA 3DGPB 1FNOA 5E33A 3ISND 2GAHC 3M2RB 1HNXF 5EGYA 3C15B 2UUAJ 4GKJF 2FBXA 3QICA 3I56N 3QJLA 4PYDA 4ED5A 1V3SA 2QLXA 1URNA 1HWLA 3DJCA 3P49B 1BUXA 1REGX 3GIKA 2W9BB 4USHA 3V1RA 4OGEA 2YPZA 1HPZB 2UXBF 2E5HA 3HP6A 1AZSA 4B3RF 2ASYA 1N36F 2X3DA 3ZX2A 3I0RB 4USVA 4E3SA 1V5IB 4EK2A 4WBFA 2Q1NA 4DV7F 4EP4A 2VPWB 2E7VA 3TNVA 3O4WA 2QN6B 2HHHJ 5CYQA 3A8YA 4LSNB 4ZIWA 4F4AA 3P96A 4OZNA 2EFVA 1EX4A 1JLAB 3W60A 4OQJA 4QU7A 3OYHA 2KTQA 4KGZB 1RDBA 2KLAA 4GO7X 2RPIA 1S6QB 5KT7A 3V4IB 4LF7K 3AO1A 1ZA2B 3QIOA 1BE4A 5F8JA 2L3MA 2G8IA 2PY5A 1S5JA 1NGIA 2MXYA 5IT9O 1CJUA 4MK8A 2QMXA 4C0HA 4Y1CA 2DRDA 3VQ7A 4LRCA 3KKSA 2HHPA 3LANA 3IR7B 3H5YA 3ZO7A 4X62F 2D0CA 3SMSA 4RW7A 2CZVC 3F41A 1RU1A 3ATVA 3OYKA 4IFYA 3AFGA 4YY3K 5CZXA 4NLXA 2E66A 5HJYA 4DWIA 3QGGA 2FBVA 2WSCC 3GR0A 1N34K 3T5LA 3F9MA 2KT5A 2CJXB 1YJ7A 3MM8A 1I3OB 4O4GB 1WDTA 3FFKB 2HVZA 2J5AA 2IC3B 2FDNA 2Q6BA 3UWTA 4K0KK 3O1LA 4XAKA 3K58A 3E1YA 2BEFA 4K4UA 3GZ7A 3LWMA 1H74A 2L08A 1S9EB 4EO6A 5GIPA 1HNWK 1FRIA 4NXMK 1CEZA 3W62A 3QZ7A 4A2AA 1NK7A 4TXSA 4M3XA 2CQHA 2H65B 4NLQA 3OVBA 1V3ZA 5L9XA 4N47A 2EWHA 1Z2ZA 4J9MA 2HMIA 1NJIT 3OXGA 2CPYA 4LF7J 2H51B 3FEYB 1GXLA 3G71S 2J0XA 1XEZA 3MD3A 1Q82T 1U1OA 1GOBA 4B9QA 3A8EA 4KH1B 4RNNA 2C3PA 3HVTB 4DTJA 2DNZA 1FKPA 2UP1A 1IBCB 3RGIA 4NLOA 4YY3J 3L6QA 4CK1A 1P8ZA 4WF9L 4ECYA 4OZ2A 4DPOA 1N34J 1LNQA 1YJWS 3AV9A 3KKFA 5ETQA 2KFZA 1NH8A 2A6OA 1S6UA 1RK8A 4DPXA 3ZX3A 4K0KJ 5GAEI 1T6CA 4XO0A 3GFHA 4G3IA 3NGIA 3RW7A 5RUBA 3A2FA 4ES1A 4ZVGA 1HNWJ 4NXMJ 3NY0A 2F8HA 1VSHA 4JYAJ 1BO5O 3L4IA 3V5RA 1X4EA 3LDLA 1O8BA 3AY0A 5JLHA 3QEXA 2BKPA 4UOFA 3N4QA 4BR5A 2PA8D 1O5JA 1IBKF 2E1PA 2BUNA 3RAXA 1WSRA 1X4DA 1B0TA 1U45A 4MQ3A 3UN2A 2RDIA 4WQ5A 2CJAA 4EFHA 2RJZA 3GV7B 4QBUA 3J7AP 2VG5B 5EDWA 5HMWA 4WFNQ 2F8EX 4CO4A 1PSDA 3MR2A 1ZBHA 1AA1B 2LXUA 4JUZA 2DNKA 2PT0A 4USJC 1S76D 3O5TB 2YHAA 3H8YA 2E2QA 3CJBA 1ZBIA 5F8MA 3W2WB 2R7OA 2J0SD 3T1YK 1RLDA 1HW9A 3DLGB 3H46O 3OHBA 2WFBA 4F50A 3TVZA 3VF6A 1BI4B 1TUYA 4HH0A 1TP7A 3K5OA 1BXNA 1FJEB 1RDWX 3BGUA 5HP1B 1YZ7A 3GIJA 3TPQA 3H3NO 1RSCA 2CZ9A 1X0FA 3CVKA 1NXIA 2WBMA 4CM0A 2QA4S 4ED3A 1JJCB 2Y1IA 4EIAA 2JOQA 2F8MA 2L9WA 3I56S 2JEIA 1U2RA 1GX5A 1MNEA 2FJWA 5J2QA 1FK9B 4DG1A 3OTCA 1KFSA 2UUBJ 4GW6A 1UJ4A 2XMUA 3FRYA 4IOBA 2F9DA 4K50A 1QS4A 4CEZA 3RMAA 1S0OA 2F5GA 1CPZA 2D3ZA 1KFDA 1RP5A 1F5CA 2UYTA 1C0MA 2RU9A 4DR5K 4U7UK 5A0YB 3MI7X 3ZLJA 1X5PA 2JC1A 1WHYA 3AD8C 3MAQA 3T1YJ 3VQ6A 3D0IE 5E26A 4QOZB 4NLYA 4H4KC 4C98A 1CLQA 4DQQA 2QTWA 3PO4A 3O3GA 5G4DA 4AL7A 1JLEB 2I38A 1NNEA 3PM9A 3HHEA 2VG6B 1EZZB 1X60A 1ASWA 1GLDG 4DR2F 1R59O 4DX6A 2A5XA 5D0GA 3DGPA 5KFJA 3M2RA 4WFZA 3QBXA 3C15A 1RAJA 4OI4A 5EWFA 2CRLA 2VH7A 3VQBA 3DWLA 3R27A 3M8PB 4B3SF 2QI2A 1W0HA 2H54B 2NYIA 5HRSA 2W9BA 1ZBFA 4ED4A 4CEFA 3C8YA 2Z4PA 3AO5A 2YHWA 2KKHA 1HPZA 3K5NA 3H3OB 1TMJA 3N6LA 1U7LA 2EHGA 4CZCA 1KONA 1P8GA 5HO4A 3SCXA 2AJ4A 4DR5J 4KHSA 5KFMA 3I0RA 6FD1A 2JGUA 4CI0B 2V8HA 4WYBA 4MFBB 3M6UA 2CJQA 4QOTA 4KTZA 2EKNA 1G7CB 4OLPA 4LSNA 2MPUA 3GFZA 4H5NA 4DX7A 2E4LA 2J0WA 2IM2A 3LH2S 2FLOA 3AAQA 5BYSA 4FWMA 2RUGA 3OSNA 4DL6A 1WC1A 1S6QA 1U47A 3DXMB 4UY85 3D4JA 3V4IA 1IR1A 2YH0A 3PY8A 3QFUA 2F4FA 4BVPA 3QBWA 2MQPA 5LXYA 2CG8A 2HS4A 3TO8A 1SJ3P 3DGVA 3J80O 1OO0B 4DCPB 2PN6A 5C7PA 3BSOA 1TUWA 1JLFB 1EJ7L 2PIIA 5AQIA 4Y65A 1KAXA 3QO9B 1PGZA 2VQEK 2QWRA 2JL9A 1FD8A 1TKTB 1TELA 1FXXA 1FRJA 3KK1A 1R27B 2KT3A 1APSA 4HLBA 4FLXA 1PYTA 4CIFA 4JI8F 2HNZB 2IC3A 4A5AA 2HFZA 2D7SA 4NXNF 3U1LA 3CJ0A 4D3HA 3T5KA 2R8GA 1S9EA 3JAMU 2OO4A 3HSZA 5F9LA 1NJXA 5B0GA 4DMNA 3Q0AA 1DAXA 4F8RA 2XLKA 4O3OA 2DNGA 1PIEA 3T1HF 2A1RA 3BKFA 1JL1A 3U9DA 1Q7YO 5L1IA 1R7IA 3G6XA 1N8RT 5CZ2A 3SQ1A 5BR8K 1YGYA 2RVJA 3QGIA 2AWZA 1D0EA 2A3JA 1RYRA 2E5IA 4H0VB 2ZF5O 3EE9A 1RTJB 4I9QA 2A10A 3HVTA 3KZBA 1VQ9S 3L3CA 1NAQA 3CF5L 3M8ZA 5GAEP 3SFUA 4F2SA 2VQEJ 3NGKA 2AJ2A 4HVZA 1RBAA 4WWSA 4F7VA 2QLBB 3BZQA 1R6YA 1NJZA 5LSLA 5DG8A 1RXOB 3OTDA 4OKEA 4ZVHA 4DR3F 4IEIA 4PXEA 2E1YA 1OMSA 1XUPO 1RA7A 1DQAA 1D9DA 2ASMA 3QAEA 4CH1A 4G65A 4AHVA 1RABB 4M3TA 4ED8A 3G0ZA 2HSTA 1HFEL 1KD1O 1H98A 3NEKA 2DGQA 2IOCA 2JWKA 5EU7A 1WC5A 2JFDA 4CGFA 1UOCA 1Y11A 1UETA 3FEXB 3SV4A 2V7YA 3EZOA 5BR8J 5D6GA 2E1MC 5HL7L 2VG7B 1N88A 4Q2MA 3HSDA 3US5A 3OYCA 1HHSA 4KHRA 4FOIA 4JI4K 1RT7B 2VG5A 2C2ZB 4ZVEA 4P2XA 3AVIA 2B43A 1I94F 4M3RA 2HPUA 1GLFO 3U02A 3LP2B 4DX5A 1HNZF 1GMWA 4MLEA 2FJDB 2LQBA 4EMDA 3W8PA 4OHWA 3VQ5A 3TSUA 5ETKA 3W2WA 3QGHA 2ACMA 3OXFA 1DTQA 1DTTB 2R3VA 4QPXA 2M5YA 3DLGA 3M2UB 5LJVA 2DNMA 1S48A 3OT9A 1GLCG 1BI4A 4BR7A 3C95A 3SNNA 3S41A 4CD3A 2IA0A 2DY9A 5HP1A 1OSDA 4CJ4A 2CNLB 5LSOA 3SBMA 2N3OA 3H0PA 1PBAA 4CHZA 1RTHB 3HD2A 3L3VA 3AT1B 1WOPA 3HI0A 5AQOA 2RQKA 3FMWA 3ZSRA 3W3SA 2ZH2A 2BQ3A 4DOZA 3FC9A 5ETNA 3AARA 1WSVA 1VQMN 1Q78A 4KBOA 3DOLB 3CJ7A 2CQCA 1FK9A 2ASDA 1XMOF 3FZBA 3R9PA 4ES3A 3THXB 1QSYA 4JI4J 2HW3A 1SC4B 3S1TA 2XMMA 4KGVB 1A5VA 2J7WA 4HI2A 4RBTA 3B6PA 3E9OA 2LQ8A 3JYTB 1RKJA 4CF1A 2GMLA 1EXQA 2E9RX 3ZT4A 3PIOQ 3S3NA 4IDKB 3MEDB 5C25B 3UR0A 4V1Ak 2FJVA 4ENOA 4NYOA 1C0UB 4X4UA 4FWRA 1UVKA 3CEDA 3KFWX 1G2EA 3LGNA 2UXCK 2HFSA 1FTCA 3EE8A 3AJ1A 1U1QA 4JN4A 4F9OA 4LT6A 1ASUA 4B9VA 3ZX0A 1D3WA 3DXSX 1JLEA 3HJVA 1JQGA 2V4JB 3H4DA 2BDPA 2R8KA 2I7NA 3Q8QB 3TRGA 2MLXA 3WQTA 1JIHA 4FXVA 1X5OA 2HLUA 1EO1A 3P6YC 1RAOA 4LIRA 4LF8K 3M8PA 1S97A 3EGVA 7AT1B 4EI2A 3WZ0A 3D1OA 1OSCA 1N4LA 1CS4B 4DF4A 1SS6A 1U49A 4NLBA 3IBCB 5A6WA 3D6MB 2X1AA 4JBCA 2DPNA 2GV1A 2V8PA 1VOMA 4K4WA 3ADAC 4DQSA 1RBLA 1CXUA 1VISA 5A6PA 2D3O1 4BRMA 3FFIA 1SKRA 2J76E 4K8RA 4IOAL 2X1FA 3OYBA 1N48A 1VQ8N 4A8YA 3UCZP 3EVWA 1RAGB 5I9EB 3VGMA 5D78A 1XR6A 4RR5A 4PCQA 1LKZA 4DHYA 4JKAA 4UUWA 3EZWA 3RYLA 2Z8QA 3NMAA 2UXCJ 4H0PA 2K8GA 4YOYA 3Q23A 1V4TA 4JKEA 4E1NA 5B08A 4IG3B 3KK2A 1W2BM 1SKUB 4PG6A 2CA9A 2UV8A 2DY4A 4LY7A 2V6AA 1X9WA 1KLMB 4Y0WA 4LFBK 5GAGI 1YXQA 4BBYA 2XC9A 4DR7K 2W9CB 1J5OA 4KHMA 3KWMA 1TUVA 3ZT0A 4LF8J 4RU9A 5DO2A 4E7KA 1JLFA 2DVIA 3O80A 4C4WA 1TU0B 2QA1A 5CZ1A 4O55A 2P9UB 4OGCA 4FK2A 3UE2A 5I4MA 1NHVA 1TKTA 2ZBCA 2L9NA 4I2PB 2FGOA 2JEFA 1NGDA 4Z4FA 4Q45A 2HSEB 2WBRA 2XGQA 1GLLO 2HNZA 5GADU 1F3VA 2LEPA 4OV1A 5K9FA 2IAJB 3I55N 1KKHA 4PG7A 4O0IA 1C2PA 3QINA 4BS2A 1RT2B 2O8EB 1LK7A 3UFCX 1BLUA 3CCMS 2LYVA 1Y00A 1HLUA 1A5XA 2GVDA 4CGHA 3H7HB 2V9KA 3MD1A 1WELA 3HZGA 4AQYF 3CJCA 1MU2A 1DEJA 4QZVB 2RDJA 2YHXA 4LFBJ 2YKPA 5E3PA 4DV2F 1SIZA 4DR7J 3A5MC 2RMLA 2BX6A 2BW2A 1IKXB 5AR0A 1TV6B 1RTJA 4ECTA 3BR9A 1HI0P 2P5OA 4DZ6A 3B8HA 3FDSA 5AQKA 4LFCF 1B0PA 4M3YA 3DU5A 1D5AA 2FBYA 4JRQA 3CDWA 2M7SA 3OUYA 3PHEA 3MCAB 4MK9A 2FVSA 1TUUA 3P4UB 1B70B 3FBBA 3TA2A 1CZ9A 1G1XA 2ZH3A 4L3QA 2E88A 1SV5B 4WIIA 4DL2A 4KY3A 4W5NA 3KLEB 2FC0A 2XMVA 3NF9A 3ILIA 3MGJA 3K9JA 1KHWA 1SQEA 1TUGB 3CQXA 1JLBA 5EX0A 3QPIA 4O3QA 2E1AA 1RT4A 1SI9A 1G6BA 3NGUA 1VQMS 4KAIA 1IBMF 3WXMB 3M9OB 3C66A 4LH5A 3JQKA 1KC8O 4KH5A 4X66F 2OMOA 4G9ZA 1C1CB 4LBIA 1RDDA 1RT7A 4BRGA 3ENVA 1YJTA 4CLSA 2UUCF 4YDDB 1KR4A 2MLZA 2V4QA 4FF1A 4FPIA 2R7UA 4CEEA 2M52A 1FKOB 3NCRA 3C16B 4WJBA 3SCKE 3H1QA 2DXFA 3QYYA 4DKWA 3ET6B 2KL8A 3UKUB 1V3RA 3IR6B 1X4FA 2YKNB 2ZWOA 1KCFA 4JI2F 3AO2A 4X4NA 1WG4A 3AXMA 2B4UA 4BE0A 3N01A 3TUIC 3MUMP 1W9HA 2ZNZA 4W5TA 3VCDA 2ZNYA 1JJHA 4RNMA 4P7TA 3VQTA 1J6ZA 2VU5A 4IG0B 5AQNA 1RTHA 3GIIA 4GRSA 5IM0B 1RYSA 4JKFA 1VRUA 3Q8SB 4USUA 5F8NA 1RAHB 1FF2A 4LF6J 2HHXA 3CB4A 5F8HA 1UPMB 4OX8A 3DOLA 3DXBA 3D45A 4AL6A 3L09A 3JTOA 3KG4A 3THXA 4CEAA 4LRFA 4I67A 5LMUF 2NRXA 5EUHA 1VBYA 3M05A 4IDHA 3KUEA 3R1LA 3LPYA 2VF3A 2B7CB 2V67A 4PZVA 3G6YA 1VQ8S 1IKVB 3HM9A 2FGCA 4ZA1A 3VAIA 2HHSA 1U2CA 2W40A 1ITGA 4C1NI 4IDKA 3MEDA 3DLRA 2VFUA 3AOBA 2D9PA 2GQ2A 1AT1B 2ZITA 4C1NK 4BWMA 1J2VA 3V1OA 1FJ7A 1C0UA 2CQPA 4K25A 4W5OA 4URGA 1B9FA 3HSTB 4JKHA 2JDJA 3T69A 4JB8B 4NB4A 3PR4A 1TK8A 3NF8A 2V4JA 3SZ2A 1VQOS 2NUBA 1OH6A 4H5WA 2XMTA 4ZTJA 1NMEB 3CXCM 3CCVN 1FRXA 3SYZA 2C3MA 2E5LF 3DRRB 5B0FA 3CC4S 3ZZZA 1ZPVA 3N4PA 1BWEA 2NCKL 4HDGA 3JQMA 3O6QA 4OJRA 4KT0C 3MM5B 4AD6A 4ES2A 4BQLA 2VZ9A 3IN5A 1CS4A 3C6AA 4CJFA 1RWMB 3HVAA 1JJ2R 1Q7LB 4KFBB 1B0VA 2KXNB 4DPWA 3SI8A 2NZCA 1J5EJ 4WCEQ 4M5MA 4J9PA 3OHRA 2Q3PA 1CXQA 4KJIA 3J7YU 1Q9YA 3H20A 2FJBB 2GEMA 3HDSA 2FVPA 4GKKF 3QNNA 1GX6A 2J8AA 2I2YA 5FROA 4ZTFA 4JNEA 1WOOA 3PEHA 2ZJPL 5KQDA 5TKYA 1L3VA 4O44A 1IJJA 4ZPCA 2FJXA 2PEBA 4GKJK 5GAGP 3KK7A 2FJAB 5HSPA 1XWLA 2IJFA 3PZPA 4HCCA 2A6MA 3Q7CA 4FZVA 3T9NA 3F56A 3C46A 4IG3A 1Q95G 4M5JA 4QCLA 3NOGA 2UXBK 1RILA 3A3OB 2HVDA 4B3RK 3IFRA 1N36K 4N41A 1QSLA 2W9CA 3CIZA 1W25A 4BR0A 4RUBA 4A59A 3HCXA 4DV7K 2ZDOA 2OTLN 2GNKA 3O8MA 5DDQC 1E6YB 4PKDB 2O3DA 2P9UA 5GMDA 3OW2R 2P9PB 2YJEA 1XC3A 1TKXB 4I2PA 2GWJA 3SCIE 1KNZA 3PYEA 1B7FA 2OJ3A 2LXFA 4NX9A 2DBBA 2P2CB 4QWBA 1NBWA 3AGKA 5DDOC 3NH1A 3NS6A 2IAJA 3I33A 4ID1A 3M5RA 2FY1A 1CULB 3O9RA 1RT2A 4GKJJ 2DFFA 2CPJA 5L9NA 5AQJA 4FLVA 4CJQA 3BGOP 2F96A 1YZ6A 4Y2IA 1RGVA 4X62K 1RI7A 2GMJA 1R0BG 5AQSA 5HMZA 4CDIA 2ZHBA 1WHXA 4CZJA 3TA0A 2YV0X 2R8JA 1GOAA 3CC2S 2DCLA 4QYRA 2C2NA 2VPZB 3NOCA 2UXBJ 3AB2B 3EE3A 3D2EA 5KT5A 4B3RJ 4PHTX 1H38A 4EBDA 1N36J 4OYIA 1NPPA 4KRWA 3MOZA 3LL3A 4ZDNA 5HQ8A 2AU0A 5B7WA 4C3MA 2OKQA 4DFMA 5H9EK 2IGIA 2RS8A 1IKXA 1TV6A 3D68A 4DV7J 2OIHA 4HHTA 4CFBA 3I4HX 2XNRA 2W25A 4CZLA 4PKIA 2ZGZA 4A61A 1YDLA 2LEAA 3PW0A 4KI6A 2AEFA 3V4MA 2UXDF 4YN3B 4DR1F 2BABA 1UZDA 1NSAA 1M5HA 1X9JA 1QZ5A 2MHEA 3R5AA 2WTFA 3QEIA 3IG1B 2DO0A 3O3FA 4RKUC 3D0PA 3SSRA 2VJVA 4KHQA 1HBMB 2YJFA 4QWEA 3ENHA 4HHHA 1H1VA 3D2FB 5AQTA 5HATA 3KLEA 5GMEA 2GHPA 4Q8EA 5HROB 3C6HA 4KYZA 1M5PC 2HRYA 2AJQA 4X62J 4A8SA 5AJ3F 3AH6A 1WEYA 2J4RA 3U9ZA 3TJAA 3ICLA 4F36A 4DLEA 2CAJA 3RTVA 4WFBQ 3SCLE 2YQ0A 3HKZD 1JL2A 2UVUA 1JX4A 2G8UA 3MURP 1C1CA 2BW7A 5H9EJ 2LKZA 2GGPB 4DR4F 5LOQA 4C48A 4WP3A