3C6TA

Crystal structure of hiv reverse transcriptase in complex with inhibitor 14
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
559
structure length
559
Chain Sequence
NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The design and synthesis of diaryl ether second generation HIV-1 non-nucleoside reverse transcriptase inhibitors (NNRTIs) with enhanced potency versus key clinical mutations.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase
total genus 150
structure length 559
sequence length 559
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3c6tA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6tA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6tA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6tA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3c6tA05
4JV2A 3WNFA 5KFPA 3CG7A 3BSCA 1Y97A 4CK1A 1HJRA 1T03A 1QSYA 2QKBA 4MIBA 2B5JB 4ELVA 4FLZA 4ZHRA 1LW0B 4KTZA 3F73A 4NYNA 3ZSVA 1DLOA 4B9MA 4DG1B 3MXJA 1FKOB 4KV8A 1KHWA 3AVNA 1DTQA 4AH9A 1QTMA 4KHNA 4CGDA 2C2DA 1TK8A 2AX1A 3NHGA 1GOAA 4JRPA 3QIPA 2A1RA 2QKKA 3L2VA 4XIUA 4FJIA 2D7SA 4EBDA 4DQIA 1QAIA 4YR0A 1XR6A 2RPIA 2OPSA 4ID5A 3HPOA 2IAJA 3LAKA 1NKBA 3DRSB 2YHAA 2XY5A 5CYMA 4GVMA 4KHQA 2RN2A 4DEZA 4CESA 3SJJA 3DLRA 2IM0A 1TK5A 2P5GA 3MFIA 3D45A 4F3TA 3SQ2A 3RR7A 1RYSA 4BWJA 3OYGA 2OPRA 4Z4GA 2VG7B 2W42A 3GILA 2P1JA 3OL7A 3F9KA 2WK4A 5KFIA 1J5OB 4DFMA 3TWHA 4PWDA 3OYEA 1JLAA 5KT6A 2ALZA 3OYIA 2D0BA 4K4TA 2VG6A 1VSJA 1WSGA 4DTNA 1U09A 5KFXA 3E01A 2IMWP 3CJ4A 2DFFA 4ED2A 2YV0X 5CYQA 1JLFA 4G1QA 4FJ5A 2IDOA 4CK2A 4QCLA 3DLHA 3CM6A 3FFIA 1HQUB 4CHPA 4W5QA 4AHSA 4Y3CA 1C0TA 2J6TA 5J2MB 1JLCA 4F4XA 4E1MA 4IDKA 4ZVHA 1IKVA 3SCXA 1TKDA 1UA0A 4J9MA 3IGNA 3QEIA 3LALA 4B9VA 1RDAA 1RT1B 3EYZA 3PW4A 4J9LA 1TKTA 3TAMB 2W7PA 4QWAA 3NFAA 4TY8A 3C94A 2R2RA 2HHSA 1K1SA 4ZPAA 4ECVA 4NLRA 3BJYA 4IFVA 1RILA 1HYSA 3HK2A 4EYHB 4RUAA 4KFBB 4FM0A 4HYKA 3SUPA 3H2LA 4YNQA 1A5VA 4ZVGA 4FJ7A 2IBKA 1TKTB 3PZPA 1VK0A 1ZBFA 4NCAA 1D1UA 2KFNA 1TAQA 2JEGA 5FRMA 4I2QB 3JYTB 1EKEA 4KI4A 5KGWA 3AVIA 1J54A 4DTSA 3ULDA 4Q5VA 4OJRA 3PR5B 3KLIB 4JV0A 2YHBA 5CYMB 1SKWA 5KFEA 4NLXA 4F8RA 1RT4A 2JLEA 2OYQA 4C8KA 2WTFA 3V9WA 2DPJA 3BSNA 3D0PA 4YR3A 3NL0A 4CFBA 4TN2A 3T19A 2AGPA 4ECYA 2KTQA 1LWEA 2WB4A 4CJKA 1RT6A 1S5JA 3GIMA 4CJ3A 3QIOA 1S9FA 4CJVA 2XCAA 3I0RB 2XCPA 2YNHA 4JS5A 2C28A 1C0UB 4RW8B 2KZMA 4RU9A 4DTUA 2GC8A 4I9LA 4CE9A 4CGJA 2DFEA 1RTJB 2R2SA 3RB4A 4ICLB 4FW2A 4I2PA 3OYMA 4MKBA 5F8GA 4PA1A 1NHVA 4N47A 1T05B 3CIZA 4ED1A 1NJYA 3DRPA 3KLEA 4YQWA 1N4LA 1ITGA 3HPGA 3DMJB 1RBVA 4FJMA 4IQXA 5F8NA 4KHUA 4O5BA 4CF9A 4DL4A 1N5YA 1C2PA 1MMLA 4ICLA 3DLKA 3MXMA 1WSHA 3V1RA 2GIRA 4OKJA 2E9TA 3SFUA 1REVB 4J9PA 3RTVA 2R8IA 5JXSA 2XHBA 1WNEA 4XPCA 4KBIA 1VRTA 4TYBA 2Z1JA 5KG2A 2VA3A 3OYAA 4O4GB 5FDLB 1HQUA 4XPEA 4IFYB 4CJSA 4E89A 3DOKB 4IRCA 5KT4A 1TL3A 3OY9A 4ED7A 3DRRA 4E7LA 3KTQA 4KHSA 1SL1A 3KLVA 4ECUA 4ZP9A 4CEFA 4E0DA 1U47A 5KFLA 1KCFA 4AHTA 3SFGA 3RBDA 1JL2A 3I0SB 3DM2B 4RNHA 5KT5A 1Q8IA 3DDKA 2IM3A 3KHGA 4WZMA 1HYZA 4HCBA 4M3WA 3K2PA 4K4VA 4ED8A 3CM5A 2P51A 3M8PA 3K5OA 3OHBA 1W25A 5L9XA 1JKHB 1C1BA 1NJXA 3AVHA 4FLXA 2PYJA 3FRZA 3QNNA 5DG7A 2PY5A 3OHAA 4CGGA 2VA2A 1S1XB 4MKAA 3MECA 1CXQA 4KKOB 3H98A 3OYKA 1LWEB 4ZPCA 1NK7A 2FVSA 2HNZA 4RW6B 4HUFA 1RT3A 3U3YA 3OLAA 4K4XA 3H5UA 4LY7A 2AGQA 3RR8A 3I5AA 4ECZA 4M42A 4EO8A 3DRRB 3MEGA 5HRNA 3DOLB 3RMCA 4MQ3A 3CJ2A 1JLEA 2X6SA 2IAJB 1DLOB 2R8HA 4YP3A 4ZTFA 2GBZA 1VRTB 1X1PA 2D0CA 1MU2A 5DQGA 3SZ2A 4EZ6A 1S6QB 4W5TA 4ZPBA 4O0JA 2OPRB 3GV7B 1S1TA 4IG3A 5HLFA 4CFDA 4O44B 1NK0A 1ZTTA 4KB7A 1YT3A 4KAIA 2DFHA 3HYFA 4RW4A 3NGIA 3MEEB 5C24B 4DWIA 4DU1A 1NK9A 4NLDA 2ETJA 3UR0A 4WFZA 4MFBB 5KFSA 2R8GA 4ZPDA 3E51A 1QQCA 1UWBB 1S9EB 3NAIA 3RMBA 4IKFA 4LQ3A 4U7CA 4OKKA 1S6PA 3OJSA 4U6PA 4M3TA 2HVHA 1JLEB 3ZT1A 2D3UA 2E4LA 3ZSRA 1ZBLA 4CEOA 3V6DA 1SH3A 4ED6A 3PJWA 4URQU 1S0OA 3KD5E 4ED3A 5KFNA 3OVNA 2X6NA 1N48A 3NDKA 4H54A 3S3OA 4Q8FA 3WNEA 3T5LA 3SPZA 1S48A 2W8LA 2D0AA 4WE1B 3L3UA 2JGUA 4X2BA 1J9AA 1D9DA 5T14A 4WE1A 3OYJA 3RWUA 4I2QA 2FJWA 4OLBA 4NRUA 1LW2A 3SI6A 3MEDB 2Z1GA 4DTJA 2FJXA 1RA7A 4DQQA 4H4OB 4CEDA 2G8FA 5F9LA 4K4ZA 3O3GA 3QYYA 4Z4FA 3KLHA 4CGIA 3QNOA 4ZVEA 1TGOA 5FROA 1JLCB 4LSNB 2GV9A 1X9WA 1ZBHA 1NOZA 4ELUA 4J9OA 2I5JB 3Q8SB 4O3RA 4CJEA 1S6PB 4E7IA 4F3OA 2XWYA 4CHZA 1BHLA 3LPTA 4DSJA 1ASVA 3LP1B 3QEVA 2E9ZA 1UWBA 2WRMA 4FJKA 5KFQA 1Z25A 4N76A 3G6XA 4FZYA 4FS1A 3OYBA 4JUZA 3OYNA 1T94A 2FBTA 4IG3B 3V81A 1L3TA 4O4GA 5FDLA 5KG4A 2W9CA 1JLFB 3N6LA 1XHXA 3LAMA 1T3NA 3RMDA 5KFAA 2WONA 3V6DB 1HPZB 4KHWA 3ALYA 3PO5A 1VRUA 4KO0B 2KQ2A 5KFBA 4J9SA 2HHXA 4DSKA 4I7FB 2BE2B 3GIKA 1T05A 3AVAA 1TAUA 1TKZA 1WSIA 5C25B 4JRQA 3SUOA 4I7FA 3RB3A 1B92A 3HVTA 2ASLA 1C0TB 1BGXT 2HVIA 3M9MB 3BQ2A 3VN5A 2AU0A 4AHRA 1RBSA 1C0UA 3LZJA 2W8KA 1GX5A 3OSPA 2G8VA 4DLGA 2BE2A 1KHVA 4B3OA 3CJ3A 4CECA 3RBEA 1S1UB 4RG8A 3HVTB 3MAQA 2JEJA 2AGOA 5KFVA 2OPSB 3K58A 2DY4A 3AA3A 1JLBB 4Y2CA 4J2AA 1UAXA 3T5JA 4J9RA 3JSMB 5HP1A 1ZETA 4ID1A 4CEBA 4QWDA 2VG5B 4N5SA 5SWMA 2B4JA 4J2DA 2F8SA 2XY6A 2Y1JA 4YR2A 4FJJA 2E6MA 1KSPA 4DG1A 4M3UA 4Z0UA 2F96A 4CIGA 2JEIA 2O4IA 3IN5A 2BDPA 4WFYA 3V81B 3RB6A 4CHQA 1RT6B 2ASJA 3K5LA 4B9NA 3QLHA 1VSLA 4O0IA 3HP6A 3PR4A 4J9KA 5KG5A 2WOMA 2FLLA 4DQRA 4QAGA 4IOBA 3UIQA 3UQSA 4NYZA 2YNFA 2DTUA 1S9GA 3LANA 4FBTA 2PZSA 2B6AB 2XY7A 5KFKA 1XHZA 1NK6A 3KLHB 3E01B 3N6NA 3PX6A 2RDJA 3V1OA 5F8HA 4FS2A 2HAIA 4E7HA 3NH0A 1RT7A 1RT2B 1RDBA 2Z1HA 1LWCA 4E19A 2BRKA 2GIQA 4B8CA 1SKSA 4KI6A 3A2FA 1EETA 3NKYA 3SQ4A 2R2TA 4O55A 3OS2A 4DL2A 3AVLA 1HYSB 4EEYA 3RB0A 2BQUA 4B9TA 1RNHA 4PY5A 3KK2A 1LAWA 2X78A 4RNNA 3TAQA 4ZP8A 3I0RA 3O3FA 3KK1A 3QGIA 2AJQA 4CF1A 1TV6B 3PX4A 3WNGA 4J2BA 4QOZB 4KE5A 4PUOA 4EZ9A 5KGXA 3VQQA 4ID5B 5JS1A 3K59A 5KFZA 1JLQB 2YKNB 3IG1B 5KFOA 4M41A 4O44A 4IG0A 4K8ZA 2PYLA 4MK7A 4H4OA 3PW2A 4CJPA 4DSIA 3QO9A 3AVMA 3KK3A 2UUTA 4M95A 5FRNA 5EWEA 1ASUA 3H59A 4FJNA 2HWIA 3I5BA 2BANA 3CJ0A 4BE0A 1K6YA 5L1LA 4KTWA 5HLFB 1NKCA 2VG5A 1T03B 4K4UA 4Q43A 2IC3A 2YKMA 4FJHA 1I6JA 1BQMB 4WFXA 1S6QA 3PO4A 4CJQA 4DFPA 1GOBA 5KT3A 5SZTA 3NH1A 3B6OA 3OSNA 3DYAA 4R8UB 3SI8A 3PHEA 1KTQA 5KFUA 1RBRA 3DLGA 3V4IB 4O3SA 1HMVB 5HBMB 2F8TA 3KKSA 3CFRA 4BDYA 4CEAA 5KI6A 1N6QA 1TV6A 4RW9A 4ZP6A 1I3AA 4QW8A 2OZSA 3IAYA 1IKYB 1IH7A 3S3NA 2IJFA 4JV1A 3VQ8A 3KK2B 4IRKA 1RT4B 4PQUA 2V4RA 2QXFA 2D3ZA 1S1VA 3I8DA 1KRPA 5T7BA 2LSNA 4DQPA 4NCGB 3ZSZA 1QE1B 1RT3B 1EP4B 2I5JA 2B5JA 3U3GA 4IH7A 4NLYA 4AHVA 1KLNA 1BIZA 4DU4A 4FJ9A 3G86A 3PJXA 4DMNA 2V4QA 1CZ9A 3PVXA 2BR0A 3C95A 4OGEA 3LWMA 4HUGA 4R5PB 3TI0A 4LSLB 1X9SA 2UVRA 4TYAA 3AA5X 3EZUA 1TL3B 2D5RA 5HBMA 5DGAA 5KG7A 4PWDB 3I0SA 2KZZA 1HNIB 3ASMA 2HHTA 1HQEB 3H4DA 4RW7B 1GOCA 4NLGA 2AWZA 1BCMA 2HWHA 4YFUA 1U04A 3C6UB 1CXUA 3S9HA 1TKXB 3P1GA 4RW7A 4RZRA 5KG1A 2ASDA 5HROB 3L2WA 1U49A 3EY1A 1JLBA 5CYQB 3QERA 4QW9A 5KFCA 3LP1A 1NKEA 3IS9A 1BQMA 1R0AA 4K4YA 4N41A 4KREA 3DLEB 4IKAA 3OLBA 2IS3A 3SUNA 5KFGA 3GV5B 3VQBA 1ZBIA 2QK9A 3HVAA 2WCXA 1NK4A 1TL1A 4Y2AA 3Q8QB 1WSEA 4C8MA 3QESA 1QE1A 4MH8A 4HKQA 4CJWA 3CQ8A 3V6JA 3NE6A 4RW9B 2HHQA 1A5XA 3Q8RB 2YNHB 3LZIA 4KSEB 3ZSOA 4ZP7A 4HCCA 3AO3A 2HNYA 1VSMA 1JXEA 1Q9YA 4ECQA 3V9XA 1S9EA 1RTJA 3KHHA 2ILYA 1KLMB 3OS1A 5KFFA 1Z4UA 3C6TB 3NGDA 1EP4A 3L8BA 1S1WB 3MEEA 5KFWA 4ECTA 1BIUA 1O1WA 3DI6A 1RTHA 2FJVA 1RTDB 3OYLA 3ISNC 1DTTA 1X9MA 2IC3B 3HL8A 4IFVB 4FK4A 4W5NA 4TY9A 1WAFA 3SQ0A 4DLEA 2BGGA 3VQEA 2FVPA 5I3UA 1N56A 3V9ZA 4MK9A 2ATQA 4M3ZA 1S1XA 3T5KA 1L3VA 4Y34A 2R8JA 3ICLA 3AVFA 4K4WA 4CGHA 3PY8A 3AVJA 3ITHA 2EC0A 3VQ5A 3KMSA 2HHVA 2FBYA 3B6PA 4TQSA 1DTTB 3QZ8A 5KFHA 3SYZA 3TR8A 3ZT2A 4O3QA 4Z4IA 4CF0A 2KFZA 4H4MA 4M94A 2JEFA 3NAEA 1YTAA 1S49A 4OVLA 3TAFA 2EX3A 4FM2A 3TAGA 4CGFA 1NOYA 4RUCA 3QLHB 1XI1A 3FDSA 3FSIA 1VSKA 2BQ3A 3NCIA 3IRXA 5HRSA 4CJTA 5CY4A 1A5WA 3M8PB 1W0HA 2FVCA 5L1JA 5KFMA 2VG6B 1LWFB 4Z4CA 1T7PA 3KNAA 2XI3A 2HHWA 4H8KA 2A1SA 1S9GB 2YNGB 5D3GA 1QS4A 4CJLA 1U4BA 4ECXA 3GIJA 1ZBUA 1L3SA 4Y1DA 4TY8B 3LPUA 4JS4A 1B9FA 5J2NA 2IA6A 1TVRA 1N6QB 4B9LA 4F2RA 4WXOA 3DOKA 3VQPA 2J6SA 1FKPA 4CJRA 3KLFA 4DS4A 3V9SA 3VQ9A 3H5YA 3P5JA 3RAXA 2ATLA 3EPGA 3QEWA 3TAPA 3AVCA 3GIIA 4E7JA 2OPPB 4BE1A 3LP0B 3BREA 4I9QA 1JLGB 4G3IA 1U48A 1TQLA 4ZMMA 1S97A 3NF7A 1CSJA 4ECRA 2ZKUA 3QGHA 4C8OA 2FVQA 4G1QB 2J6UA 4OPKA 4IR1A 4CIFA 1S4FA 3THVA 2GUIA 4K8XA 4M3XA 3OYFA 4DL3A 1RT5B 2RF2A 4MIAA 1VSFA 4Q45A 1G15A 3TQ1A 3AVBA 2G8UA 4FK0A 3NAHA 3LP2B 3HT3A 4F4YA 5F8LA 2FLPA 4FK2A 2W9AA 1BQNB 2HNZB 4FLYA 1FK9B 4F50A 3L2RA 1UA1A 1RTHB 4DU3A 5DGBA 2G8WA 3IRXB 5I42A 4B08A 4FCYA 3AO2A 3PV8A 4IR9A 3TVKA 1SH2A 5KT7A 3D28A 4L8RB 4RNFA 1JLAB 3OYDA 3G6VA 4DTRA 2XY8A 3MR3A 5F9NA 3H4BA 1SV5B 4ECWA 4DL7A 3KLFB 3H08A 2RF2B 3OL8A 2W9BB 4MK8A 1CZBA 5KFRA 4NLWA 3VQAA 1IKXB 3MECB 1D9FA 4LSLA 4KKOA 3KMQA 4QPXA 5L1IA 2Z1IA 5JUMA 3M9OB 4NLVA 2R2UA 4PQUB 4B9UA 3HPHA 2YNIB 5F8MA 1RTIB 4DTOA 2OPQA 2HMIB 3M9NB 4E1NA 3KLGA 4B8AB 3C6UA 4HUEA 4NLSA 4NLQA 3H40A 3MFHA 4BE2A 4FYDA 1RDDA 4QWBA 4CF2A 3V4IA 5HROA 2CJQA 4PUOB 5L1KA 1XR7A 2QV6A 3CDWA 3D5MA 4NCGA 3UDLA 1Z26A 4TSXA 1ZYQA 1IKYA 5DG8A 3IS9B 3SUQA 4CHOA 1BI4A 2OPQB 1YVFA 5J2QA 4CERA 1C1AA 2W9BA 3ZT0A 5D3GB 1YVUA 2R7YA 4Z4HA 3UPFA 4ZVFA 4M45A 3DYAB 4R8UA 1KFDA 1TKXA 2IOCA 2W7OA 1RAJA 3OYHA 1IKXA 4BDZA 3NMAA 3AV9A 3DLKB 3NBPB 1RTDA 1S10A 3IG1A 4NZ0A 4E7KA 1FXXA 4F4KA 3KKRA 3KLGB 5C42B 5E41A 3KK3B 3WNHA 2F8EX 3AO1A 3DMJA 2I1RA 1SH0A 3KK1B 5F8IA 2FBXA 3VQDA 3KD1E 5KT2A 1IG9A 5KG0A 4NRTA 1NK8A 2E6LA 5C24A 2VG7A 3PUFA 2ZQBA 1VSDA 4GC6A 4CCHA 1RCHA 3G0ZA 3U6FA 4YMEA 3QO9B 4HTUA 2HHUA 4K4SA 3HO1A 3VA3A 4FXDA 2BQRA 2HB5A 3HP9A 2IGIA 3IGVA 2ZE2A 3L2QA 1WSJA 4J9QA 4DF8A 5I3UB 1FK9A 1RT7B 5KG6A 1WN7A 4Q8EA 2XC9A 3AA2A 3BR9A 1BI4B 4EP5A 5I42B 4QWEA 1KVBA 3LDSA 4URGA 4DSLA 5HRRA 3HHKA 3VQCA 4JLHA 1JX4A 2UVWA 5K14A 4FJGA 4FLVA 1W9HA 4CEZA 1TL1B 1Q9XA 4LH4A 2FC0A 3ZT3A 3LWLA 1SL0A 3LP0A 3SV3A 3QEXA 4LQ9A 4HHTA 2G8IA 1MU2B 3QIDA 2BANB 3TAMA 4LH5A 2UUWA 2WHOA 3AVKA 2UVVA 4NYFA 1EXQA 4FM1A 4RNOA 4EP4A 2VWJA 2O4GA 4DL6A 4IFYA 3SPYA 3PW7A 3ZT4A 3QEPA 1WAJA 2RKIB 3AO4A 3QINA 1C6VA 1JL1A 4J2EA 1R0AB 1KFSA 1L3UA 5EU7A 3HSTB 5HRPA 4C8LA 3RRGA 3RAQA 3DLBA 1OS5A 4ELTA 2JC1A 4QWCA 4KPYA 4WZQA 3VQ4A 3FFIB 3MEDA 3BGRB 1C1CA 2IJNA 5KRTA 1K1QA 2IM1A 1JLGA 4KRFA 1QSLA 2WONB 4OLAA 4C8NA 4O3PA 3TAEA 4AILC 3JYTA 4FLWA 4ZHRB 3K57A 4O3NA 2FBVA 4KAZA 2ITGA 4DTMA 4FJXA 3LP3A 3K5MA 1TVRB 4CFAA 5DG9A 1JXLA 4CJ4A 3RMAA 3ZSXA 3VA0A 4Z4EA 1WNSA 3V9UA 4DFKA 3MR2A 3PW0A 4KB0A 4WYLA 3NGYA 4AHCA 3HXMA 1BCOA 3ZSQA 1KVAA 5J1EB 1VSIA 5KRSA 5C25A 1HRHA 1L5UA 4TXSA 1NJZA 1HNVA 3O4NA 4DSEA 5KFJA 4UQGA 1S1UA 3DLEA 1VRUB 1HYVA 4CJ5A 4RW8A 1JIHA 4IH5A 3CWJA 2HNYB 3VQSA 3CVKA 4CHNA 5EUHA 3BDPA 4F4WA 3T1AA 1RBUA 1IKVB 3M8SA 3RRHA 1QSSA 3QIPB 1EX4A 2OA8A 3MR6A 3QETA 4EYIB 1SUQA 4W5OA 3DI6B 3CDEA 4NLPA 5K14B 3H5XA 3ZSWA 3KHLA 3MR5A 1SUQB 1T8EA 3AA4A 1FKPB 2Y1IA 2YKMB 1NJWA 1QUVA 4FW1A 4CF8A 4MFBA 3V6KA 5DQHA 1DTQB 3KHRA 5J2PB 4M3YA 5DLFA 3G10A 3CFPA 2B43A 3FQLA 1VSHA 1I39A 1UOCA 3ISND 2D41A 3C6TA 1RT2A 1HPZA 1D8YA 2HNDA 2HW3A 4WXWA 2XI2A 4GMJB 2OPPA 3MXIA 1RDRA 2YKNA 4RNMA 2P5OA 4F4ZA 1LW0A 5J2PA 4CK3A 4FZXC 2C22A 1LWCB 5C5JA 1RT5A 1C1BB 1CLQA 3T5HA 1D0EA 4FVMA 3EZ5A 2XO7A 3H5SA 4GW6A 2ILZA 1S0NA 4DSFA 5C42A 5J2NB 4IG0B 1ASWA 3NF9A 1QAJA 3TANA 4ECSA 1LV5A 2QE5A 5J1EA 5KTQA 3JSMA 3PW5A 3VQ7A 4RW6A 3HVWA 1NHUA 4DTPA 4KO0A 3M8QA 3GQCA 4B9SA 3V6HA 5EWFA 1LWFA 2AX0A 1JXBA 3SNNA 1BISA 4IDKB 1EETB 4EBCA 4E3SA 4IBNA 3TABA 4R0EA 3BQ0A 1HNIA 1C1CB 3QGGA 4BACA 4TLRA 4LSNA 4O3OA 2XRIA 3CDUA 2ZE2B 5DQIA 5J2QB 1J53A 2JC0A 1IKWA 2O5DA 1XWLA 3KJVB 2HNDB 1WSFA 3TARA 5J2MA 4NCBA 4CIEA 3M8QB 3V1QA 3VQ6A 1HARA 2E9RX 1TP7A 4H4MB 2YNFB 3DM2A 4EO6A 3AO5A 4FJLA 1QHTA 4HVJA 1J5OA 2BRLA 4CEQA 4BWMA 2XGQA 4O4RA 1SV5A 4ZTJA 4RW4B 4TQRA 1B9DA 2EHGA 5CZ2A 2X74A 2WOMB 3ZSYA 2UVUA 1IKWB 4OGCA 1HQEA 1S1VB 4LD0A 5DLGA 4KHYA 2HMIA 4W5RA 3ITHB 2Q3SA 1XR5A 3NGZA 1RA6A 3FQKA 1U45A 5KFYA 3K5NA 4J9NA 2W9CB 4EBEA 3CO9A 2C2EA 2XGPA 5CZ1A 1SKRA 1HMVA 3HM9A 3MTKA 1S1TB 3MEGB 4B3OB 3OL6A 3BQ1A 2ZD1A 4IRDA 4CJFA 2OZMA 1ZTWA 4DF4A 3OJUA 4ED0A 3I5CA 1TKZB 1REVA 4DS5A 3S3MA 3KIOA 3L3VA 4OKEA 2G8HA 1KLMA 4F2SA 1TK0A 4DFJA 3OL9A 1C0MA 4FLUA 4CFCA 2R8KA 3T3FA 5HP1B 3KLIA 2OH2A 4CEEA 1KVCA 3L2UA 4FLTA 4OPJA 4FZZA 3AVGA 3G6YA 5DMRA 4FBUA 3LP2A 2B6AA 2CKWA 2FVRA 1GX6A 1N5YB 4M3RA 4KHRA 3NH2A 2FLNA 3N6MA 4FJ8A 1RDCA 3DLGB 1NNDA 3O4QA 3DRSA 5F8JA 1FKOA 4KV8B 4XO0A 3CYMA 3EPIA 3OS0A 3KJVA 3MF5A 4K50A 3ZCMA 5EWGA 3BSAA 4NLUA 4IH6A 2KW4A 5JS2A 4NLOA 4N56A 4GC7A 3DOLA 1JKHA 2G8KA 3QZ7A 2DPIA 1D5AA 1HNVB 5KG3A 4AHUA 4OL8A 3HVRA 1JLQA 3GV8B 4CHYA 3HJFA 4Q44A 3NF6A 4BDPA 2NUBA 2ZD1B 3HKWA 3Q8PB 4I2PB 3BGRA 3NF8A 3NBPA 3GYNA 1LW2B 2AQ4A 1S0MA 2V0NA 1YTUA 4CJUA 4Q0BB 3CJ5A 5EDWA 2RDIA 4URSA 1WLJA 2VWKA 1NK5A 4KB1A 4KTQA 3M8RA 2YNIA 3BSOA 4NLTA 3OYCA 5KFTA 1RYRA 4DL5A 3CFOA 4KFBA 3SV4A 3SQ1A 1LAVA 2RKIA 4WYWA 5KFDA 2C2RA 4Q0BA 4DQSA 1RTIA 2YNGA 1BQNA 3KOAA 1VSEA 5DK5A 1IO2A 4KHMA 2IM2A 3O3HA 1SL2A 2V9WA 1RT1A 3DRPB 3KLEB 1XC9A 3PX0A 4DTXA 4Y1CA 1S1WA 1F21A 4R5PA 1RBTA 3P83D 1BL3A 1IM4A
chains in the Genus database with same CATH superfamily
1I5OB 3CG7A 2BE7D 4CO3A 2B5JB 2X3GA 4FLZA 1F2HA 3UVJA 1LW0B 4L6V3 4LRFA 3FR0A 3AGRA 3QT5A 2J8SA 1IBMK 1A9NB 1P6TA 2ASYA 3IR6B 1XQIA 2AX1A 3NHGA 1VQON 1FDDA 3L2VA 3CQYA 2D7SA 4ZOSA 4YR0A 2J5AA 2OPSA 2L9NA 3HPOA 4V1Ak 1Q16B 2IAJA 1CVJA 2K1RA 5AQWA 4LIRA 2MY8A 2CPHA 1I51B 2IDEA 3SJJA 3T7ZA 1VQPN 4N8NA 4FVUA 3PIOL 4CIOA 1KTVA 2P5GA 5EX0A 1RYSA 3O6QA 4GKKJ 4HHJA 2OPRA 3FFKB 2QMUB 5AQGA 3HZ6A 2VG7B 1XEZA 1NSPA 4OYZA 2DY9A 2WK4A 5KFIA 1J5OB 2HBMA 4DV4F 3QATA 2W41A 3TVYA 4AQYK 4KT0C 5KT6A 2ALZA 3OYIA 2D0BA 4J37A 3ZZOA 3KXDA 1VSJA 5HMYA 3J7YI 5AQSA 3CJ4A 1JMTA 1JLFA 2GQCA 2UUCK 4A61A 2QM1A 3A5MC 3FFIA 1MWYA 1HQUB 4Y3CA 1C0TA 1M90O 3TUJC 2VBYA 4FPBA 4IDKA 1XNRJ 3SCXA 2EPIA 1UA0A 4W92B 5HMZA 3IGNA 3LALA 4ZCIA 4DR4F 3TU5A 2AP1A 2HGMA 2CZ4A 1NCLA 4FXWA 3VHQA 3TAMB 2GHWA 4QWAA 1WWHA 1FRKA 3PACA 2QYCA 3BJYA 2VFTA 3C19A 2HBZB 4LFBJ 3CC2S 4NLCA 3HK2A 5BYSA 4HHHA 4FM0A 3SQGA 3U9DA 4YNQA 1A5VA 4ZVGA 2ZUGA 3PZPA 1VK0A 2CDRB 4KH1B 3I6PA 5B0GA 4NCAA 3O1BA 4M1KA 4FZVA 2KXHA 1EKEA 2QLJB 1Q8LA 1SQEA 3NNCA 1DQ9A 4JV0A 1Q81O 5CYMB 4WQ5A 5BPNA 3H2VE 1YIJN 1VQNN 2JLEA 4OHZA 5ADZA 3NS5A 3EGVA 1GNKA 2QC3A 1AFIA 4CFBA 5ETSA 2FHJD 4TN2A 1XMQJ 4ETXA 2A40A 1KWMA 7FD1A 5FPMA 3TX8A 1RT6A 2X7IA 2XMWA 1CS4B 1HLWA 2DKOB 1S22A 6AT1B 4OZ0A 4LVNP 3ET6A 4HLBA 1AZSA 2R2SA 2P9NA 3L4QA 3H8YA 2AHOB 2O66A 4MKBA 4PA1A 1NHVA 4OHXA 2I7NA 1IVZA 4K5RA 4YQWA 4G9ZA 1RBVA 2Z58B 5F8NA 2J0SD 2FJDB 1ATSA 1U0SA 4AM6A 2ZBCA 4C0HA 4DCJB 2QL5B 1VISA 3DLKA 3MXMA 3KJNB 4EHTA 1AXQA 1VMBA 2C42A 3HX9A 5BYRA 4Z37A 2VPZB 3FEZA 2E5IA 3PSFA 2ZOFA 2BUNA 3OYAA 5FDLB 4XPEA 1HQUA 2E2OA 4E89A 5BRDA 4IRCA 4WFNQ 3J80U 3DRRA 3WXKA 3O6WA 3KLVA 4ECUA 4ZP9A 2ZBQA 3TZYA 1K9MO 2BKOA 2NUUG 1NDLA 5IWAF 4FPRA 1UKUA 1KCFA 4AHTA 3T1HK 1F2GA 3CD7A 3HM8A 1H2TZ 2IM3A 1HYZA 4JKDA 4HCBA 4M3WA 3K2PA 2JVRA 5GMEA 1X4AA 4X65J 2ITMA 5IQQA 1D4XA 3CM5A 2P51A 3I32A 2NXCA 3G82B 2LMIA 2I8EA 5L9XA 1X9JA 4F9OA 3BGLA 2K7JA 3AVHA 1RLDA 2PYJA 5FD1A 5DG7A 3OHAA 4CGGA 2H65B 1NBEB 1JCFA 3MECA 2RNEA 4DR1F 3H98A 3BS9A 2XLKA 3GJRB 4OFZA 1IJEB 5LT5A 1HBUB 4HUFA 3U1LA 1RT3A 3U3YA 3OLAA 1FTCA 4FYXB 2VJUA 2DH8A 2HLTA 2ZH1A 5H9EJ 4M42A 1HR0F 3DRRB 3MEGA 5HRNA 3DOLB 2B9WA 2IVYA 4OX7A 1XC3A 3ENVA 3MD1A 1N5VA 9RUBA 2CFXA 3CJ8A 5HL7Q 2IVOA 4BHQA 3H7HB 2QLXA 3H0PA 2UP1A 4EZ6A 3OR1A 1RWMB 4ZPBA 2OPRB 5ETOA 4ZLNA 3I4PA 4O44B 1OYEA 4YDXA 1NMDA 3WEEA 4KB7A 1VQ8N 5E33A 2C3OA 1VS3A 4AXJA 2Z4PA 4RW4A 3DNCA 2YWEA 2LCWA 1NK9A 2ETJA 4WFZA 1Q53A 4MFBB 5KFSA 3NNHA 1CC7A 3DRYA 1BUPA 4BG8A 4YHHK 1ZS6A 3NAIA 4X4RA 3GE1A 3RMBA 4IKFA 3ENOA 4JI3F 2F4VK 2Z0GA 3R6MA 3OJSA 4U6PA 3UWTA 2E5JA 2J7WA 4FF1A 1SH3A 3TZWA 3GFYA 4ED3A 4AL6A 3OVNA 1N48A 2Z56B 4ER8A 1VQ7S 5A8KA 2Q43A 3ONQA 3NDKA 3G4SN 3R5AA 3T5LA 1NB7A 4YB1P 2D0AA 2C3UA 2VB6A 2NUHA 1D9DA 5T14A 2E44A 4B1VA 2FJWA 4QIWD 3FZLA 3SI6A 3MEDB 4DV3F 4DTJA 2N3OA 2O8BB 4H4OB 1WI6A 3BF1A 5ETPA 4LMZA 3QFWA 1TUUA 1FVSA 2BW7A 1LFPA 3W9JA 2GV9A 5C2GA 1ZBHA 3Q8SB 4E7IA 2HVEA 2N4DA 4ITSA 1FJCA 3SLCA 3K0JA 4CHZA 1NSAA 3LP1B 3THWB 2CPJA 2P9GA 2WRMA 4GV9A 1VGYA 1VQ5N 2V67A 3QICA 5MLCV 4FJKA 5IQ6A 2E1RA 4ZCMA 2O8EB 3JQJA 1C4CA 2KB2A 4OO1J 4FS1A 2Q6CA 2HGLA 4JUZA 1T94A 1F5BA 1X4FA 3CCZA 1FE0A 2CQ3A 4FYYB 4FYWB 2DH9A 1BA1A 3WQTA 3V81A 2KH9A 5M1NA 1IQTA 2WAQD 3S41A 3J81O 1M5PC 3LAMA 1X5OA 2WONA 3CJSA 3V6DB 4OYBA 4OYAA 1HPZB 4OHWA 2E66A 4KHWA 3ALYA 2M52A 1FE4A 2KQ2A 5KFBA 4J9SA 3T1YK 4WFBQ 2BE2B 2B0GA 1MSWD 1T05A 1NPPA 5C25B 3HMJG 4CH0S 3QSIA 3OW2R 4O0NA 4RPFA 2GELA 1B92A 3W66A 3C65A 3FC9A 3SAFA 4U7BA 3GOIA 3BQ2A 3VN5A 1QUPA 1KD1O 1RHMB 1GX5A 2J9DA 1HNWK 2MQPA 4NA3A 3P6YC 2XZWA 2CAJA 1NSKL 1B0VA 4ZIWA 1J2VA 2CDQA 2DHGA 3HVTB 1KR4A 2JEJA 2AGOA 3MPWA 3K58A 2VC1A 1BWVA 3FZFA 1JLBB 1HWLA 2FB0A 4X4TA 1ZETA 2YPZA 4N5SA 4ZVOB 2GGPA 3O2IA 4YR2A 2E6MA 2PEBA 5AZJA 4DG1A 4JI7J 4PKGA 3LGMA 3V81B 4R25A 3K5LA 4LF4F 3HULA 3B78A 3QLHA 3VQTA 3RRKA 3HHDA 4J9KA 4U67Q 3JXOA 3UIQA 4LF7F 3UQSA 3R2CJ 2YNFA 4CI0B 3FCVA 4ANDA 2B6AB 2MZTA 1XHZA 3E01B 1YJNN 1VQ7N 4Y6IA 4LBPA 2C2OB 2DNMA 2RRBA 1HPMA 3NOGA 1GMUA 2BRKA 1E3MA 2HBRB 4QIFA 1SKSA 4B8CA 3AAPA 1W2BR 2H54B 3O44A 3SQ4A 4NX9A 4JI5K 4LF7J 4BC7A 3OS2A 1UFKA 3BPSP 4DL2A 1K44A 1HYSB 2HOEA 3R9PA 4XH1A 3WIUA 2X78A 4RNNA 3TAQA 3CDBA 2DBBA 3I0RA 5AE2A 4O8KA 1HJOA 2ZWOA 4CF1A 2YBVA 3GL1A 4GV3A 3ID6A 2EKYA 3X1LB 3PX4A 3WNGA 3L6QA 3ZX0A 4NO7A 4PUOA 5KGXA 3VQQA 1JWWA 5JS1A 4CWBA 2CPEA 3IG1B 2QEXN 3HHLD 1FRMA 2CNOB 2PYLA 1HWUA 2Q1NA 3QRPA 2ZC3A 3LTOA 2CQPA 4M95A 1ASUA 4HL9A 3S7RA 2HWIA 2RU3A 3CJ0A 4QQBA 3IKMA 4PHTX 1OKJA 3J8AA 2JLGA 5HLFB 1T03B 3CMAN 2VPYB 1HL6A 3EX7B 1UW9A 1H7WA 3PO4A 4RUBA 2V8VA 4DFPA 1KQSR 2ZWPA 4QR2A 2VUGA 3OSNA 1QY7A 2YKAA 3SI8A 2IA0A 3WEEB 1XNRK 1NM2A 3FMWA 5K8NA 3AD7C 3K89A 2V2VA 3L9ZA 3CFRA 4BDYA 1TV6A 4OI6A 3TWZA 4ZP6A 1I3AA 5CXTA 3VV2B 2VICA 2PA8D 4QW8A 4JI0K 3S3NA 2WSEC 4JHDA 4BVOA 1GMVA 5DDQC 4CLUA 5AQJA 1FVQA 1RT4B 2BM0A 2V4RA 2QXFA 2CNNB 4H4KC 4DQPA 3ID8A 4WCEQ 1RT3B 1EP4B 2E1MC 5RUBA 2WBNA 3ZZZA 4AHVA 4ZVPB 4KGXB 2UXCJ 3C95A 4OGEA 4GKKK 4HUGA 2XS7A 4R5PB 1IV0A 4CJ7A 2RQ4A 4LF4K 2B4OA 3I0SA 1HNIB 2JVOA 3H4DA 4RW7B 4AF1A 1P1TA 4DV4K 2XM3A 2DJWA 2GVDA 2R42A 1ACMB 2HK3A 3S9HA 4DV1J 3UE2A 2LKZA 4RZRA 5KG1A 3R5GA 2ASDA 2ZJPL 4ERDA 4EWTA 3DOMA 1U49A 1VJWA 2E1CA 3QERA 4C2MA 3LP1A 2EG2A 1QAYA 3ZFVA 4K4YA 2YY3A 4F3QA 4IKAA 3SUNA 5KFGA 3GV5B 1GTEA 2NXJA 4Y2AA 4LF1A 1UJ5A 3TPQA 3QESA 4PG7A 2E5LK 3NCRA 1Y4ZB 3ZTPA 4B3SK 4I0WA 4RW9B 5EHHA 3MD3A 1S72S 1HNZF 2ADCA 3R1HA 3D54A 4ZP7A 5DM6L 1TMJA 1CJUA 2HNYA 1Q9YA 1DGKN 4C1NI 2ILYA 4ISEA 2V63A 1KLMB 5KFFA 4RR5A 1T6DA 4OYXA 5E3QA 3L8BA 3QT6A 2OKQA 1BIUA 2FJVA 2HBQB 3D1HA 4C8ZA 3ZLJA 1GLJO 1V3SA 4IFVB 4W5NA 4A48A 3SQ0A 2BGGA 3VQEA 1V9OA 2QEXS 4L72B 5I3UA 3CF5L 1L3VA 4KJIA 1QZ6A 2R8JA 1T9UA 1XBWA 2ZC4A 3GCXP 2ZJQL 2HHHK 1IBLF 3LDQA 1N54B 1X4DA 2LQBA 2HHVA 1YJTA 1H98A 2H3GX 4TQSA 1DTTB 3OHRA 2WVBA 5KFHA 3SYZA 4UY8T 2RSQA 2ZGZA 2CJBA 3TRGA 3BH7B 3IA0A 3FE1A 2ZNZA 5H1SQ 4N8OA 3IO1A 4M94A 2OHDA 2JEFA 2FHKA 4JI4K 1YTAA 1S49A 4OVLA 3CJCA 3GFHA 3N4PA 2EX3A 4CLPA 3C14B 4LFAJ 3FGUA 1S4EA 5AQNA 3GE9A 3W62A 1NOYA 4JKHA 1ZAVA 2DNPA 2EEYA 3AQOA 3QBCA 1VSKA 4DV1F 3TJ9A 4CLTA 5LSOA 5HOOA 3FEYB 5A6WA 3D7EO 3WIVA 4OYMA 2NZCA 4ANCA 1MN7A 2EFPA 1RWKB 2A1SA 3EE9A 5KAKA 2SXLA 2AEJA 3F9MA 4QBUA 4Z7YA 4Y1DA 1B4SA 4JS4A 5J2NA 2QA1A 2F63A 5IWAK 1TVRA 1N6QB 4DR5K 4F2RA 1NDCA 3GBTA 1DARA 3VQ9A 2W2MP 1S5ZA 3GIIA 3NVKA 4DR4J 4H5TA 2UXDJ 3BREA 4WIIA 1V4SA 2PBDA 3THXA 5B08A 2IYIA 3NF7A 4UTGA 3MMAA 3QPIA 2VBWA 1CSJA 4ECRA 2NLXA 1Z05A 4PR6A 2FVQA 4G1QB 1OPIA 3M2VB 2EG1A 4IR1A 1S4FA 2XSJA 2GUIA 3MMCA 3HI9A 3J7ZT 3THVA 4PPZA 4PYDA 4DBQA 2V7YA 5IT0A 2RF2A 1VSFA 2XSJB 1Q82T 2VKRA 3AVBA 3NAHA 4BC3A 3G6ES 2W9AA 2IY5B 1S99A 2FC9A 1FEHA 3A12A 3QQCD 5ETKA 1X3NA 2V2ZA 1FK9B 1BLUA 1VLOA 4F50A 3PEJA 3L2RA 1U2RA 3AH6A 1PSDA 1R43A 2HBJA 2G8WA 3P4UB 1TUWA 2WBMA 5C7PA 4LVOP 2MGZB 3G8SA 1JLAB 3OYDA 4DTRA 3N0VA 3BPDA 3H4BA 4ECWA 2Y1LB 1IBKF 2XBPA 2PSZA 2RF2B 2RILA 2W9BB 2E20A 2ZUAA 4MK8A 4WYBA 1SQGA 2CNLB 3M32B 3OBYA 3I33A 2J9CA 4FYVB 4QPXA 3M9OB 4J5OA 1FRIA 1UVLA 3HPHA 1KP6A 5IM0A 3AB2B 4CLYA 4JHDB 2OPQA 4USTA 4MLHA 3LA0A 4UT4A 4HUEA 4GVBB 1S76D 5K5MA 1UEUA 1RDDA 1WKJA 1VR6A 4M5NA 3UNYA 2CJQA 1FJGK 2AJ1A 3CC4S 3OVSA 5A6PA 2K7KA 2M7SA 1JJ2R 3SUQA 1BI4A 1N32K 3PCOB 3I56S 3FUYA 1C1AA 3ZT0A 2PMWA 1AUDA 1FXLA 3FNNA 3R5JB 4PKHA 4PXEA 3DYAB 2Q97A 4KH5A 4ZITA 3A5OC 3O9QA 1SCJB 2IOCA 4K25A 4BDZA 2RS2A 3AV9A 2CJKA 3EXCX 1RHRB 4FWPA 4IOCQ 3IG1A 2GNKA 2ZVIA 3KKRA 2QFJA 1XQSC 1TUVA 4P7TA 3F5TA 4JV5F 2Q3PA 4I1TA 4CYUA 3U1MA 2DH7A 3M7VA 3TEHB 1SC1B 1YJWN 3PUFA 4P71A 3W3SA 2AZ3A 3D7SB 1BA0A 3G0ZA 1BDGA 4PXDA 4UZBA 2MEWA 1NU0A 3Q7BA 4BBYA 4JN4A 3BO3A 2IGIA 2ZE2A 3OW2M 4LJMA 5I3UB 4F25A 3CCTA 3PRDA 2E7XA 4BCAA 3GONA 2YQ0A 4PPDA 4DR3J 5CA5A 4DV5J 4CLLA 2OTJS 5CHCB 4URGA 4DSLA 2KO1A 3BYRA 3HHKA 3SSRA 5IT9Y 4CEZA 4BR5A 1Q9XA 1VBKA 1L3KA 2UXBF 1YI2N 4ILGB 4PCQA 3B4DA 4YORA 4LF8K 3LPYA 4OLOA 1WEZA 1FD8A 1MU2B 3QIDA 2BANB 4YOEA 1UCNA 3TAMA 1TL7A 4BRGA 3VTHA 2ZM6J 4EP4A 3MM9A 2M88A 2VWBA 3HFKA 4WJBA 2DGWA 1WORA 5HRPA 2VQFJ 4C8LA 4FNHA 3DLBA 4ELTA 2G0CA 2JNJA 4QWCA 2VODA 1MNEA 3FFIB 3EO3A 5LM7E 2CQHA 3CMAS 3MR7A 1T3VA 2VHGA 4KRFA 1QSLA 1CEZA 4FKXA 1Q7YO 4C8NA 2A3JA 3C7NA 4O3PA 4G1IA 2IRUA 1G7CB 2W25A 5L9NA 5E0OA 3VGLA 2BJEA 4DTMA 4JI1F 3LP3A 4DV3K 5DG9A 2ZITA 1SJ3P 4DV7K 5I3PA 4BGAA 2OSQA 4CJ4A 4K5SA 1DQAA 1VBZA 3V9UA 4DFKA 3MR2A 3DLLQ 2CA9A 4X64K 1FFSB 1VSIA 5C25A 1L5UA 2A18A 3ADAC 3ZX2A 4I56A 1EQMA 1M5HA 1JJHA 5KFJA 4UQGA 1BU6O 1S1UA 3MM8B 5AQTA 1BQXA 1JIHA 4C0BA 3I96A 3CWJA 2P9IA 1V5IB 5EUHA 1NO8A 3BDPA 4K8RA 1NGAA 1R0BG 2DXFA 2B9EA 2EBGA 1FXDA 4I6YA 3ELHA 1SUQA 3CDEA 5K14B 5T7LA 3ZC4A 2X1BA 1SUQB 4BRFA 3ENHA 1RQ0A 4NXMK 3EUNA 2YKMB 1NJWA 4FW1A 1Q95G 4U9RA 4C3MA 3UKRA 3C7NB 4AUKA 4OJHA 1E4FT 3AAWB 4MAKA 3SCKE 3IBWA 1UOCA 3ISND 1HKAA 4DUYF 4W4MA 4J90A 1RT2A 1HPZA 2HNDA 2QFIA 3TR5A 1DRZA 4OYIA 4QR0A 3MXIA 3R6LB 5FLXO 2O8FA 1GXLA 5L8RC 2P5OA 3BB5A 4CK3A 1Y10A 2C22A 5C5JA 4QYZK 5B8HA 1CLQA 1RGIA 3D0GE 4FVMA 1YKWA 5ETVA 5EGYA 3EZ5A 3D3CJ 4GO5X 2XO7A 1QVFR 5AQOA 2CJAA 2E8AA 3OBWA 3DRXA 4EMDA 4DV7J 4WU3A 2QE5A 5J1EA 1MA9B 3VQ7A 1XNQK 4S0MA 2BOAA 3M8QA 5EWFA 1FFGB 4E3SA 3ZZ0A 2YX4A 4IBNA 4WKYA 3HLUA 3D1QA 1E4GT 3KUEA 4TLRA 2ZVSA 5D4OA 3CDUA 2ZE2B 1J53A 2HZVA 4C8YA 2GX9A 2O5DA 2HBLA 3J7A1 3NOCA 5J2MA 2HQFA 1IXKA 2CPIA 1HWIA 2HRTA 4EO6A 5GIPA 4YOWA 1QHTA 4ED5A 1T9VA 2BRLA 5BRFA 1B0TA 2CG8A 3J7ZO 4PEOA 4RW4B 4DV0K 1B9DA 3D68A 5CCMA 2WOMB 3ZSYA 2G13A 1HQEA 4KQZA 4JI1K 2VV5A 2HKEA 3ITHB 3MAHA 3NGZA 3FQKA 1HNXK 1U45A 2VBZA 4NYPA 2MQOA 2W9CB 2VONA 5CZ1A 2XMTA 2O8DB 3HM9A 3MEGB 4LF2A 3CJ1A 4O8UA 1GLEG 2M0GB 1ZTWA 3OJUA 2U1AA 4DS5A 5J1PA 4OKEA 1KLMA 3OFFA 2PMHA 2DR5A 3EMTA 2WZ1A 4BG9A 4C0OC 3T3FA 1KVCA 4FLTA 1OJ4A 4OPJA 5DMRA 3LP2A 3C15A 1UVNA 3MCSA 3TJ8A 4M3RA 1CJKB 4KHRA 2PEHA 2FLNA 1RDCA 2V9KA 4UUXA 4CO1A 5AFUH 2MZJA 3O4QA 1FNOA 4KV8B 2RRNA 1WOSA 2YX6A 3VGKA 1MMNA 2HHPA 5I3QA 3ZCMA 3BSAA 4HH1A 3K0SA 1DEJA 2KW4A 5JS2A 1HBNB 3TOQA 4M5KA 4NLOA 4NI2B 4N56A 4GC7A 3DOLA 3CB4A 3QZ7A 2DPIA 1OSDA 5ETNA 4B17A 5KG3A 4CHYA 2MKKA 1U2CA 3LPEA 2ZD1B 3HKWA 4B1ZA 3NBPA 2XHCA 2AQ4A 2WW8A 2MZ1A 4GO7X 2RDIA 1N34F 3RU0A 3TA2A 3GG1A 4URSA 2FSKA 1YLXA 2BZ2A 2VWKA 4MT1A 4KTQA 1VQ4N 2FLOA 3VENA 1VQKS 2PDAA 2DYAA 4M5LA 3IXQA 2V34A 3BZQA 3C6HA 4DL5A 3CFOA 3WUHA 5JVGQ 4DQSA 4LRCA 2ZHAA 4DV2K 2GJIA 5F2RA 2DGTA 3O3HA 2OTLN 1RT1A 4DTXA 4Y1CA 1UFWA 1Y5NB 1S1WA 1F21A 3S1TA 1BL3A 2CZVC 4JV2A 3AXKA 1YI2S 4CK1A 1HJRA 1QSYA 4MIBA 1HHTP 5CR4A 3O80A 4ELVA 2KLAA 3L09A 4ZHRA 3KWIA 1VI7A 4BRHA 1NNEA 3ZSVA 4X64J 4DG1B 4N7TA 4KV8A 3AVNA 3MMBB 4AH9A 4PWUA 3VF4A 2P9PA 2FJEB 2C2DA 1TK8A 3D6MB 3HT0A 2LU1A 3THPA 4XIUA 4FJIA 4DQIA 2MZQA 4P75A 1XR6A 2RPIA 4ID5A 1IR1A 1CLFA 3JB9k 2WVDA 4DV4J 2XY5A 4EGLA 5CYMA 2RVJA 4GVMA 2RN2A 3BUZB 3HRGA 4DJBA 1W26A 4LF4J 3BKFA 2EWHA 3RR7A 4DV0F 4BWJA 1SZ2A 4B3MF 1QAXA 5BN9A 2W42A 3U1NA 3GILA 4EAHD 3F9KA 1HNXF 4OHYA 1TZ0A 2Z2ZA 3D2FA 1SQKA 2E1YA 5JVHL 1YAGA 4PWDA 1JLAA 1UVJA 3US5A 3PRVA 4K42A 3VCDA 2IMWP 1MMDA 4QCLA 4HTLA 2CQ1A 3DLHA 1HBMB 4NE9C 4CHPA 2MKCA 4LR7A 3J7Z5 1GFWB 4AHSA 5J2MB 1JLCA 1PYSB 4E1MA 4WFBL 1FWKA 1SB6A 3CXCR 2OTJN 5LSLA 2QWLA 2HK2A 3AHPA 3QEIA 2HURA 1RDAA 3CJ9A 3ZZYA 4WQ4C 1OVQA 3DXSX 2U2FA 3EYZA 2D9OA 1KQFB 1EB0A 1HQ2A 2B8PA 1NJIT 2GUPA 4TY8A 1K1SA 3W2WB 4M5HA 3QRQA 4ZVSB 4WWSA 4IFVA 4ZVUB 4FL9A 3CPWM 4JBCA 4EYHB 1XK8A 2XLIA 4DPUA 3SJHA 1ZAWA 3R2DJ 2IBKA 4CBXA 4E8UA 2NSCA 1TAQA 1Q7LB 2HGNA 1J54A 4DTSA 1UEKA 4Q5VA 3EKUA 1VC5A 2ZGYA 1SKWA 2Q31A 4NLXA 5IZHA 2LEPA 4KRWA 4Y00A 3OUYA 2OYQA 3D0PA 2E5GA 3NL0A 3NGKA 4AE5A 3A5LC 2AGPA 1FFWB 4ECYA 1JJ4A 1LWEA 2WB4A 3D6HB 2NZ4A 1DY3A 4FDFA 5T7LB 2YNHA 4JS5A 2CIMA 3VVUA 1FJGJ 3O9SA 4RW8B 3TO8A 1XERA 4Y2IA 4DTUA 4CE9A 2RQMA 2DFEA 3IDHA 4X66K 3RB4A 1RSCA 5CHIA 4I2PA 4JKGA 1NB2A 1UTAA 4AL5A 1XMOK 1QDUB 1T05B 3D0IE 4ED1A 2A2CA 1U2FA 3HPGA 5EX3A 4FJMA 4IQXA 1KONA 2C3MA 5BR8K 4KC5A 4TU9A 1XJWB 2VU5A 5AE1A 1UWAA 3O9TA 4EK2A 3W5XA 2RHKA 3AGKA 3F41A 1TR0A 3RTVA 2R8IA 5JXSA 5HVGA 1WNEA 4TYBA 1VRTA 3GWCA 2KHCA 3VAIA 1F9FA 3RBZA 2XMAA 3CETA 1RDUA 1RJJA 4HHUA 1FNMA 1SL1A 1Y64A 4B3MK 1HNWJ 4E0DA 1U47A 5AQUA 2J7KA 3JQKA 3GFZA 5KFLA 3HSCA 4ENOA 3PIPL 3I0SB 1IBKK 4RNHA 3JAMY 1Q8IA 3GU0A 4WZMA 4DU8A 1LFWA 3KG1A 4ED8A 1GT8A 4MYTA 4HTIA 3WBZA 2BJ1A 2DB1A 1W25A 1KKHA 4LFCF 1WF2A 2OELA 2VH7A 2W4DA 4DV5F 5D15A 3T1YJ 2PY5A 4TLQA 4HACA 1K0VA 1R31A 1WB9A 2WTUA 4ZPCA 1NK7A 3Q0AA 2FGOA 5AR0A 2HNZA 1RCOB 4K4XA 4L3NA 4MDBA 2XYPB 3MWBA 3BGUA 3L7PA 3BN7A 2F9WA 4RCHA 3PLAA 2ZZMA 3CC4N 3M8YA 2N4CA 3CJ2A 1JLEA 2F9DA 2FY1A 4ZTFA 1X1PA 3CSKA 1YJNS 4W5TA 2W4CA 1FWPA 5GAGI 3OXGA 4IG3A 3A0IX 5HLFA 1NK0A 1ZTTA 1YT3A 1OO0B 3HYFA 3PDNA 1SI9A 1T9XA 4FWKA 4IWVA 4XDDA 5C24B 1R8CA 4DWIA 3H3OB 1FW6A 2P9UB 4NLDA 1VHIA 1LQ9A 1NGCA 3CCRS 5GINA 4X62K 1QQCA 5KQ8A 1PC4A 4GVEA 1UWBB 1SJQA 1YJ9N 1BMQB 1BE4A 2OGUA 3WC0A 3D2WA 3IMQJ 1OQ6A 2ZH9A 4UY8O 3PFOA 3EEQA 4M5GA 4M3TA 4NZ7A 3DN9A 1YSJA 3ZSRA 4IEEA 4CEOA 4WPAA 4ED6A 4URQU 2UV8A 1S0OA 1X5PA 4KH0B 1RU2A 2X6NA 4NA2A 2AJFE 3OUYB 4OZ1A 2E2PA 3AJ1A 4DCPB 3R97A 3A8KA 4LF7K 2KJVA 4RJVA 1FJGF 2W8LA 4USHA 4DR2F 3L3UA 3OR2B 3NVMA 4HWIA 4X2BA 3R27A 1J9AA 4DUZJ 1HBOB 3OYJA 2ZH2A 3ZETB 4OLBA 4NRUA 5LOQA 4MKVA 1X8DA 4ZK7M 5M1KA 4DQQA 4CEDA 3QYYA 4Z4FA 2VZ9A 4CGIA 3QNOA 4ZVEA 3UNGC 3TA0A 4LSNB 4J9OA 2I5JB 4CJEA 2PE8A 3W2WA 4M5JA 5JJBA 4C3LA 3NXZA 1BHLA 2RDDA 4DSJA 1ASVA 3AODA 1X7VA 4R0JA 1F1BB 1UWBA 1CPZA 2ROPA 5B0FA 4A62A 1X3MA 2XS5A 4ISGA 3QT8A 3ZXWA 4RWWA 4FZYA 3OA9A 1U6BA 3OYBA 3OYNA 4FXVA 3DJCA 3M3ZA 4IG3B 1RUSA 3NGSA 4LRAA 2O8BA 4JB8B 2BV3A 3IR5B 2ZH6A 3G9CA 1NGGA 2J0WA 4O4GA 3LM2A 3MCOA 3OFEA 3ETMA 4USUA 2YWFA 3CJKB 3LL3A 4I7FB 3GIKA 3ZZPA 1TKZA 4Y65A 3KUHA 1Q86O 2AIRB 1WHYA 2F9JA 4I7FA 1RWOB 1DBDA 3KHYA 4H0VB 2YWKA 2QWNA 5LMUF 1RBSA 1CJKA 1YJUA 2GX8A 1VFJA 3OSPA 2P9SB 4CRJA 5E84A 1CS4A 3FJ2A 4DLGA 2BE2A 4W90B 2PFDA 3D6TB 2AF6A 4CECA 2R7RA 1GLDG 1S1UB 3MM8A 2BACA 2Z30B 3TUIC 1WEXA 3QJJA 5KFVA 1I94K 3G4SS 2OPSB 1RB0A 1T9YA 3D3BJ 4Y2CA 5A2QO 2P9CA 4J2AA 3A5NC 2MLYA 5F1XA 2LU2A 4A8XA 2LECA 4OZ5A 5SWMA 2QRRA 2B4JA 2F8SA 2XY6A 4FJJA 3DGVA 4M3UA 4Z0UA 2F96A 4QS9A 4WFYA 3RB6A 2XMJA 1QM9A 4B9NA 4JNEA 4GV6A 3VAHA 4EI2A 4Y28C 3HP6A 4X62F 2KYXA 3ZZUA 2XS2A 2WOMA 3T41A 4U96A 4DQRA 2Y3YA 4IOBA 3W63A 2LDIA 2A3ZA 2I38A 4NWBA 4NYZA 2GEMA 3CC7S 3GJQB 4BC9A 3GSIA 1S9GA 2HQ3A 4FBTA 1O13A 4K59A 1NK6A 2CQ2A 3N6NA 3FSYA 3PX6A 2YWGA 2RDJA 4OZNA 5F8HA 4TU8A 1HNZK 1UPPA 1TELA 1RT2B 2Z1HA 3ENQA 4E19A 1MDUB 4YOYA 4O23A 1EX8A 2CPDA 3D67A 3PSIA 4GVLA 3A2FA 4DUZK 3NKYA 4C1NK 2DNOA 4YB7A 2R2TA 2A6OA 4O55A 3PYDA 5HATA 3UO0A 2D0PA 3R7SB 4EEYA 3RB0A 4U67L 1ZBTA 4ZDNA 3O3FA 2AJQA 1FDBA 3M2UB 5AQYA 1TV6B 4DV3J 1HBNA 2GAHC 2MHEA 2DHAA 5B0DA 2FIUA 4QOZB 5AQFA 3CEDA 2ZOMA 3A13A 1U1NA 2P9UA 3K59A 2ZEJA 5KFZA 2O8FB 4OHVA 4OYWA 3J7AP 1IWGA 4H4OA 5A2QY 1HUXA 2NRXA 3KK3A 2UUTA 4JK7A 3SQOP 1G6BA 2BANA 1IBMF 1CC8A 1PJ5A 1K6YA 4KTWA 3CJBA 3B82A 3JS9A 1NKCA 2F4VF 3CC2N 2LXFA 2JLFA 2XZDB 2YKMA 1BQMB 3OR1B 3E9LA 4KGMA 3NCQA 4YDUC 5KT3A 1I3OB 1WC1A 4KH4A 2Y1RI 2FJAB 2E2NA 2WFBA 1RBRA 3DLGA 3V4IB 5LXYA 2AZ1A 4O3SA 5HBMB 2XLJA 2CGLA 2VC0A 4CT9A 2EXUA 3IRWP 1IKYB 5HMXA 1RAHB 1WC5A 3IFEA 1H38A 3GFXA 5LJ3Y 3MCNA 4B3TF 1WDDA 3KKFA 4JAXA 4I64A 3A4TA 2D3ZA 1S1VA 2EC2A 1KRPA 1AUSL 2N3LA 5T7BA 3FCHA 4IQMA 4JI2K 3GDQA 2BXJA 3U3GA 1KLNA 2P9KA 4DU4A 2V4QA 4C11B 1VJQA 3PVXA 3SDEA 3LWMA 2ZF5O 1N52B 3VAKA 4LSLB 1X9SA 1HR0K 3EZUA 1TL3B 3EGZA 3SMSA 3ZTSA 4PWDB 2BH1A 5AQZA 5F0XA 3ASMA 2VDHA 4NLGA 2AWZA 1BCMA 5A8KB 1RWXB 1U04A 4BC2A 3C6UB 1CXUA 5A2QU 3UCUP 2HIYA 5HROB 1GAOA 1BG3A 2XYGB 5KFCA 4ZJOA 3GYGA 4WTYA 1IBMJ 1BQMA 1LWXA 2J0XA 2V8GA 2HQDA 4HTJA 5HQLA 2IS3A 3CCMS 4ZA1A 5IV3A 1TL1A 1A0OB 4DR2J 4HKQA 4NEYA 3QMLA 4CJWA 4OV1A 1ZM9A 3NE6A 2ZBIA 3PYFA 3EXYA 2E5HA 3BEXA 3Q8RB 1V4TA 4JK9A 1S72N 3FRYA 1OH5A 3ZSOA 4RTFD 1PAUB 4CQ1A 4CDIA 1YHQS 4HCCA 3AO3A 2I6WA 5FIIA 2MKJA 1S9EA 1AZSB 3L95X 3SMZA 4OJ1A 3BKUA 4A8YA 2A41A 1Z4UA 3CCSS 3QSYB 2XZTB 3JSRA 3NGDA 4UOCA 2NLWA 3H6EA 2H51B 1S1WB 3E66A 3MEEA 4ECTA 1RTHA 2D74B 3PNIA 4F02A 4JI8F 4RL1A 3CCES 3OYLA 4CH1A 1YJRA 3H1QA 4FK4A 4TY9A 3KVGA 1WAFA 4IOAL 2ZKTA 1N56A 4JV5K 4MK9A 1RLCL 2DGQA 3MUMP 3T5KA 2XNQA 4F0MA 4CZCA 4K4WA 5B09A 2LEBA 1NMEB 3VQ5A 3KMSA 1DURA 2IMOA 2XG8A 3MTJA 3ZT2A 2A6MA 4O3QA 3C2PA 2KFZA 1RKIA 5JLHA 2F4VJ 3NAEA 2FHMA 3MEKA 4FM2A 5ETTA 3TAGA 4RUCA 2DO0A 3FDSA 1XMOF 4V19J 4ALZA 1WBBA 2HPUA 2QMWA 2X51A 3NCIA 3D4JA 3RG6A 5CY4A 4BRIA 3M8PB 3TX0A 1W0HA 3W5YA 2CZ9A 1LWFB 2XI3A 2HHWA 2MKHA 2Q6BA 2WVEA 2OEKA 5D3GA 1TMMA 4FPAA 4CJLA 4ECXA 3GIJA 1L3SA 2GA7A 3E2EA 3LPUA 4B1UB 2IA6A 2V8PA 1VQLS 4WXOA 3WX4A 3DOKA 3VQPA 5D4LA 1FKPA 4CJRA 4DS4A 3V9SA 5A8RA 3P3DA 3P5JA 2ATLA 3TAPA 2BJ7A 2A0FB 3J81U 4BE1A 3M32A 1U48A 1C4AA 3HSGA 2E88A 5IOLA 1TQLA 1S97A 2UUCF 5TKWA 2CWKA 3MMCB 1MG7A 2NNWA 2ZKUA 3QGHA 5L46A 3J80O 4OPKA 3MMAB 4K8XA 3CD6S 3EWGA 1SJ1A 3OYFA 4DL3A 1YWXA 5ITHA 1SJRA 3HFVA 1FJEB 5GADI 4Q45A 3C66A 3TQ1A 4X65K 4C23A 3LP2B 3C15B 1YRTA 4B3RF 3QFUA 4FK2A 2XB2D 1WF0A 1BQNB 1VK8A 1I1GA 5D0EA 1MROB 2GWJA 3CCUS 2EFGA 3CD0A 4DU3A 2KHOA 3IRXB 4B08A 2HYIB 3AO2A 5GIOA 1UZHA 4ZKAA 4RNFA 3EDRB 2V50A 2BKNA 3G6VA 2XY8A 2A10A 4V19X 3UKUB 3L7OA 1R59O 4XAKA 1SV5B 4DPXA 1EWRA 2N7CA 3KLFB 1ICEB 2BKPA 1GEHA 3AQPA 5G0RB 4CBUA 2PO4A 4UW2A 1CZBA 2UXCF 4NLWA 3W0LA 1D9FA 4LSLA 1JJCB 5ETLA 5AZIA 4B9UA 3QDKA 4X64F 4OX9K 2Q36A 5M1PA 1NJIO 3BY5A 1EHWA 2HMIB 1UP1A 4TU7A 1Q7YT 1R8HA 5C0YA 3MFHA 4DV2J 2E1ZA 4CW7B 4BE2A 5ELZA 4QWBA 4CF2A 1NUEA 4CNYA 5L1KA 1XR7A 2AV5A 3JTOA 3UDLA 4LF9K 1ZYQA 3ZTOA 1IKYA 2X3DA 3FMBA 3WXIA 2OPQB 4CERA 1U2VB 4PG6A 1KVIA 4MKYA 2EFVA 2YQ1A 4LF6K 1X4HA 2FSNA 4ZVFA 3G8TA 3VGSA 4MIWA 2MDAA 4M45A 5AE3A 3SBGA 1IKXA 3ILIA 1N34J 5BRHA 4K41A 1RTDA 1S10A 3EDQB 4D3HA 1RABB 4DV1K 3MUVP 3MOJB 4F4KA 4E1JA 1X4GA 5E41A 3KK3B 3W60A 2F8EX 4U7UD 5SUHA 2NRHA 5BYQA 3KK1B 5F8IA 2FBXA 1RACB 5E3AA 5KG0A 2IVNA 4MO4A 4NRTA 1NK8A 1HHQA 2ZQBA 5KOXA 1VSDA 3SK3A 5E3CA 1RCHA 3U6FA 3THYA 4B3TK 3KZBA 3CXCM 4HTUA 3J80Y 4K4SA 2D69A 3VA3A 1RBAA 3TNVA 2HB5A 3SXLA 3VAMA 4IOXA 3J7YP 5LMUJ 3L2QA 1WSJA 4J9QA 4DF8A 3MCPA 3DOMB 2V8HA 1ZA1B 4DHYA 3LOUA 2QMXA 2V2QA 2XC9A 3OV7A 3BR9A 3E1YA 3VEWA 1V3RA 4QWEA 2JRSA 5DO2A 1ZOTA 5E26A 4JLHA 1JX4A 4FJGA 1W9HA 1YX2A 1VQLN 4LH4A 3L7UA 3R3LA 4P2XA 1PYTA 3ZT3A 3LWLA 4B3RJ 4HI2A 3SV3A 3QEXA 4LQ9A 4K43A 1NBWA 4YY3K 2WHOA 2C2KB 3AVKA 5I4MA 2IIHA 4RNOA 3MUTP 1FT8A 2E1PA 4IFYA 3QEPA 3ZT4A 1WAJA 3HD2A 5BPMA 2F1FA 2HRYA 4ILMA 1U24A 1H74A 3NCPA 2GAGC 1C6VA 3QINA 4J2EA 2HQCA 5EU7A 5AJ3J 4AL7A 1R8PA 2BTFA 3CJAA 1WEYA 3SQGB 3OTOJ 3RAQA 4DR1K 2LQ8A 2JC1A 4WZQA 2IJNA 3M30A 3MZIA 1VQPS 3QBXA 1CJVA 3NP5A 3GR0A 3JYTA 2UXBJ 3AOAA 4H5RA 2QWRA 3K57A 3PJ9A 3CCEN 5B7WA 1Z6RA 3JAMO 3EKSA 4K0KJ 2QSFA 2V4JA 3CGIA 3QWUA 1JXLA 3VEXA 3NRBA 3MM6B 3ZSXA 3IWLA 4Z4EA 1LXNA 4KB0A 4P73A 4R79A 1ZAXA 1BCOA 1P8ZA 4JKAA 3ZSQA 1HRHA 1W2BM 4JI5J 4TXSA 1NJZA 4ZPVR 1HNVA 2KM8C 4LF6F 4J9UE 2G2OA 4RW8A 2D1KA 4LFAF 5M1QA 3VQSA 1U26A 2Q0RA 2NYHA 2OLWA 4CZMA 4F4WA 3T1AA 1IKVB 1P9YA 4XK8C 3QETA 4OMFG 1URNA 4W5OA 3CJ7A 4DX6A 2DR7A 3DGPA 3H5XA 1YBTA 3BM7A 3CMES 3I4HX 1FKPB 5AFUA 4MFBA 3G96A 3LDPA 5DQHA 1DTQB 1FA0A 2GO9A 2FPHX 1SQFA 5DLFA 1HW9A 2ASMA 3G10A 2B43A 4JI7K 3F44A 3C6TA 3ATVA 5AXKA 2V69A 4BRKA 3T69A 4ZJQA 4WXWA 2XI2A 3TUZC 1RDRA 3CCRN 2ASOA 2FZGB 3ULEB 2EI5A 4I6AA 4RNMA 3UN3A 4WFAL 1LW0A 5J2PA 2NXNA 3HOTA 3UB5A 4LF9F 4RO0A 1NHKL 4I4BA 2AEMA 3T5HA 1HLUA 4ZCLA 4H5NA 2EVZA 4DSFA 2V52B 5C42A 4IG0B 1ASWA 4L3QA 1UMJA 2NZTA 1QAJA 2YQ3A 1I94F 2H3EB 3JSMA 1TL4A 3PW5A 3KDNA 1HBUA 3B8AX 1ZM2A 2OIHA 5IS2A 4WP9A 2AX0A 4L73A 1JXBA 4JI5F 3SNNA 5IC6B 2GO8A 1HNIA 1C1CB 3H25A 3I55S 1W97L 4BACA 1EKRA 3VF0B 5DQIA 5J2QB 2JC0A 4BROA 3W8GA 3R9LA 3OXFA 1DT9A 2XMKA 1Y5LB 2HNDB 1WSFA 3TARA 4ZVTB 1NGBA 4CIEA 5CYJA 2IVPA 2E9RX 2L3MA 2AYGA 3AO5A 4FJLA 4BR4A 1KOHA 2HVZA 4UOFA 3LF0A 4BWMA 1U1OA 1E6VA 1SV5A 5FLXU 4TQRA 4PKDB 3UKRB 4JOUA 2VQFF 2W6KA 2UVUA 1IKWB 3J7YU 2CNKB 5LXRA 5DLGA 4W5RA 4CO2A 2Z2LA 4ILLA 3ULEA 3EVOA 4YDDB 1S6OA 2QWQA 4IFEA 4WF9L 2C2EA 1EKSA 1QHAA 2DK2A 3THXB 4DV5K 3T6BA 4B3OB 5FLXY 2KXFA 2MLXA 4IEIA 4CJFA 2OZMA 2NQPA 3S3MA 1REVA 2BE9B 3L3VA 2DNYA 1R89A 2BJ3A 3GG0A 2LLZA 2P9PB 2D0OA 5HP1B 4G1PA 3LDOA 3FSXA 2D1CA 3G6YA 3UD4P 2CKWA 1S77D 2DRAA 3IAM9 1BXNA 2NXEA 3NH2A 1HI8A 2ATCB 3L0QA 3N6MA 3P96A 4FJ8A 1SIZA 4BGBA 3DLGB 4U8YA 2C2ZB 3DRSA 4LF5K 3HKZD 3EPIA 3OS0A 2QX0A 3KJVA 3A3PB 4K50A 1UVKA 3UVJB 4IH6A 4LT6A 1URRA 2W6LA 1Y9OA 1UZDA 5EVZA 3AJ2A 5B0CA 3U8XA 3I9ZA 2G8KA 1D5AA 4RBTA 1HNVB 1CQNA 4CT8A 5M1FA 4AHUA 2O3DA 3BGFA 5HL7L 3M2RA 3VVTA 1JLQA 3GSDA 3GV8B 4Y2MA 3HJFA 3UN5A 4U7UK 1GH8A 3NF6A 4I2PB 2A42A 3WXLA 3BGRA 3DFEA 1S0MA 2V0NA 4CJUA 1WHWA 3MMBA 4Q0BB 3CJ5A 4IZ9A 4EFAC 3RBXA 2JFKA 2NRWA 2EWSA 2HFSA 3Q24A 2HF3A 2AJ2A 3PEHA 5AQIA 2PGCA 3BSOA 1ZXOA 1OMSA 3ILJA 2P8IA 1YIJS 4YOXA 5KFTA 4M5DB 4OI1A 4JI8J 2IFXA 3SV4A 1OY6A 1UJ4A 1LAVA 2RKIA 4F26A 1LOTB 2GQQA 2YNGA 3KOAA 1VSEA 1IO2A 4A8WA 4JI4F 2IM2A 1SL2A 1QTNB 3DRPB 3KLEB 2B56A 3PX0A 3C14A 3WNFA 5KFPA 3CC7N 3DDNA 3EVWA 2MQ8A 4Y0FA 2QKBA 3BGOP 4BVPA 4X4SA 2EW9A 4JI6J 1YGYA 1PIEA 1U1RA 2R9LA 4NYNA 2JH3A 1DLOA 4NXMF 1KHWA 2BM1A 1DTQA 4KHNA 1QTMA 1OQ3A 2HFNA 2UV8G 2GCFA 2I0XA 5JVGL 3HHNB 3QIPA 2QKKA 4CM0A 4ATNA 2HG4A 4CZEA 1IG8A 3A1YG 5HSPA 3LAKA 1NKBA 3BBFA 3DRSB 4X4QA 4RWTA 1BOTO 4JI6F 2CQ0A 4D3GA 1TK5A 2B51A 5F3TA 3IR7B 3R8EA 1IUJA 3MFIA 4LREA 1P8GA 4F3TA 1O0PA 2PA3A 3OYGA 4FOEA 2CGJA 3JXUA 1OIAA 2P1JA 1XNQF 2IYGA 2VD3A 4A8OA 2F8HA 1F3VA 1SAZA 4M63C 2VG6A 1NRKA 5T41A 1T11A 1U09A 2NYIA 1OSCA 2Z2MA 5KFXA 2DFFA 2YV0X 5CYQA 4FJ5A 2UXDK 4TVAB 2OEJA 2R7XA 4CK2A 1X4BA 3IUCA 4A5BA 3CM6A 5BR8J 3EL2A 4W5QA 3U4LA 2J6TA 5AXLA 4F4XA 1ILYA 3X3UA 4ZVHA 1IKVA 2H5JB 1CJVB 1TKDA 4I67A 3CIMA 4Y0WA 5IM0B 4NL5A 1RWWB 3Q86A 1RT1B 5DZ7A 3PW4A 4DI6A 4UUWA 1G2EA 4I6MA 2OMLA 1KDNA 2W7PA 3VETA 3WC2A 4GKJK 3NFAA 4DDFA 1HA1A 2R2RA 2HHSA 3POTB 4CP5A 4I69A 5F3ZA 3HSZA 3FZ2A 3ZETA 1HYSA 1UVIA 3M1VB 1C0GA 4PXCA 3RSEA 3K7RA 4BRDA 2BX6A 1TKTB 1XNQJ 3IBFB 3BYPA 1OY8A 1D1UA 2CXEA 3O9RA 2KFNA 1T44A 5FRMA 2W40A 2MLZA 4QIVA 4I2QB 4P6QA 3JYTB 2UUAF 4KI4A 4YOTA 5KGWA 3VMFB 3N9UC 3TTFA 1VQ8S 4Z94A 4OJRA 3PR5B 2FC8A 4ILJA 5JMVA 4DPTA 2QWMA 1RZMA 1RT4A 2KG0A 3WXJA 1DJ0A 1RAAB 3I55N 1IR0A 1RADB 3KWGA 3TP2A 3V9WA 2HBYB 3K2YA 4OX8A 3BSNA 1AROP 5D77A 4YR3A 1GLLO 2Q0UA 1YG0A 3T19A 4CZIA 1Q82O 4DV2F 1N5TA 4GNIA 1SJ4P 2QWPA 3GIMA 3I9V9 4DCOB 2XCAA 3I0RB 2DNNA 1S9FA 4CJVA 4IJAA 1C0UB 5K8MA 1NGHA 2E2QA 1RAFB 4LUBA 2EKNA 2J7UA 2KZMA 4RU9A 1WELA 4OZ3A 3GLJA 4XH5A 1RAEB 4ICLB 4FW2A 3OYMA 4ZPTR 2QA2A 1FRLA 4N47A 4F7VA 2M70A 3CIZA 3RYLA 1NJYA 4LFBF 5C2FA 3EM1A 2M3DA 1DFDA 4CF9A 4DL4A 1N5YA 1C2PA 3UN2A 4C97A 1KS2A 3R1XA 2DXDA 2WSCC 3HSDA 4ZVQB 1FERA 1UAWA 2RH3A 3E9PA 3ILOA 2QYGA 3QNWB 3BV8A 3SFUA 1OH8A 4J9PA 1J6ZA 3MWPA 2XHBA 1FKAF 1IBCB 4EFHA 4A2AA 4XPCA 3UDEA 4KBIA 5KPRA 3A8EA 4O4GB 3S8SA 4IFYB 2O67A 4CJSA 1K73O 3DOKB 5DM7Q 3DHXA 5KT4A 1TL3A 4WQ5C 3NS6A 2IIRA 2K3KA 2XULA 3WX8A 3NWGA 4E7LA 1VQ5S 3KTQA 4BLGA 5LJWA 2AKWB 2FF6A 4B1WB 2D4WA 4P10A 1WSVA 2ZFHA 2JWNA 3H2UB 1GMWD 1T6CA 1V3ZA 2MJNA 4BC4A 1JL2A 3DM2B 4KGVB 3DDKA 2JFDA 1IBKJ 3KHGA 2EFNA 1TL5A 2JJ4D 3M8PA 2W2QP 1Q78A 3OHBA 1N8RO 2HS0A 1C1BA 2GHPA 3AY0A 2C3PA 4OYOA 4FLXA 2HQGA 3FRZA 2WSFC 5H9FJ 1S1XB 4HT5A 4MKAA 1LWEB 2H48B 3NNAA 1FXRA 3KNGA 4RW6B 3AFGA 2ZOGA 2DNGA 2MMYA 4DR4K 3H5UA 5GAEU 4LY7A 5K20B 3B6BA 1Q4RA 3PIPQ 3I5AA 2YHWA 4B3RK 3OR2A 4YB5A 2QA4G 5LMNJ 3DAWA 4L3KA 5IWAJ 2DNQA 1DQ8A 3RUBL 4Q2MA 2X6SA 3CCVN 2IAJB 1DLOB 3TYTA 2RMLA 4DR3K 1MU2A 1QJHA 2R7SA 2ZNYA 2Q2RA 4O0JA 4QOTA 4CFDA 1R7IA 4PABA 2GQ2A 3CCMN 1YRUA 2KG1A 4QIEA 5D78A 3MEEB 3AD9C 4DU1A 4DR6K 4NXNF 4QS7A 4WK3A 2KVIA 2IRYA 3O8WA 1U1LA 2XWXA 4ZPDA 4WQ4A 4A2BA 1S9EB 2YX7A 2FSJA 1VIOA 3Q2SC 3CI5A 3UDVA 3Q8VA 1TFWA 4LQ3A 4U7CA 3F2KA 4OKKA 1FHTA 1TTHB 2HVHA 2E4LA 1ZBLA 1WHVA 1JNZB 3DXMA 3V6DA 3RJMB 4IDHA 3PJWA 3KD5E 4G65A 5GADU 1H2VZ 3UR3C 2NR0A 5EY4A 1QQNA 3G87A 1R3NA 3WNEA 4CZJA 1XUPO 3EGNA 2PI5A 2R7OA 2CG4A 3CCWA 2BA9A 5LSRA 3LDLA 2KT2A 2OI2A 4HR2A 1U25A 1HI1A 5CABA 2Z1GA 2FJXA 3THWA 1UEVA 1JNRB 3I56N 3SAGA 5FROA 5DJBA 2V7ZA 4IO9Q 2V8DA 1S57A 4ELUA 4F3OA 4OV6A 2HWTA 2XWYA 2B4VA 3LPTA 3WDOA 2DNZA 4B1YB 1HFEL 2ZH8A 4A57A 4DN9A 2CVEA 3FLCO 5KFQA 1Z25A 1YITS 3G6XA 3W1YC 3TZZA 1RWPB 3Q89A 4BR2A 4YOVA 4X66F 1FESA 1NXIA 1WACA 2WVCA 4DUTA 1G4CA 1KBRA 5KG4A 1R6VA 1JLFB 4X4PA 3SBMA 2LQJA 2VPWB 1T3NA 3RMDA 1VQSA 4DKWA 2COLA 4IO1A 2CYYA 2BEFA 4P74A 4BR7A 1VRUA 4KO0B 3I82A 4RKUC 1YK9A 5HAOA 7AT1B 3PYGA 3MMVA 4LFCK 3I87A 1P9QC 3AVAA 1TAUA 1BUXA 2QTDA 2OAUA 2HS3A 2RJZA 2RQKA 4CH7A 1S6UA 5AQRA 5DDPC 3DXMB 2HVIA 4CLSA 3N4QA 2UUBJ 3V2UC 3CCUN 2AU0A 4AHRA 1UPMB 1C0UA 3LZJA 4LFCJ 4YEAA 2W8KA 1GXUA 5E2QA 1RXOB 1A7GE 1KHVA 1KD1T 4B3OA 3CJ3A 4C48A 3RBEA 4RG8A 2DGXA 5AJ3K 3MAQA 4KHPF 1H3DA 2C2NA 1WI8A 2DVIA 1UAXA 2VL1A 2DR8A 4JD2B 2KL8A 3JSMB 3K17A 4J9RA 4O5FA 3UE5A 4C9DA 4CVNE 4QWDA 2VG5B 2LA6A 1VQNS 2I9SA 3HJVA 4JI3K 4CD1A 3VZHA 2PC6A 1JB0C 3MURP 3QT7A 3IN5A 3MOZA 2BDPA 1RT6B 2ASJA 1HKGA 3TTCA 1CJTA 5IXUA 2V6AA 1B7YB 3KWMA 1EARA 1VSLA 4O0IA 4P2SA 2D3OR 2UUAK 3QGPA 1VLYA 5C15A 5JMNA 4BR0A 2RHSB 4B1XB 3F56A 2DTUA 3LANA 2PZSA 2XY7A 5KFKA 3KLHB 4FWSA 2N7YA 2CQIA 3JTPA 4DX8H 2DPNA 4PRFA 3V1OA 5AQKA 1SJFA 4FS2A 1N8RT 1V5VA 3NH0A 1RT7A 4UZCA 1RDBA 3CHWA 1LWCA 4DCHA 1PAEX 2CQBA 2WVFA 3DWLA 2YI1A 4KI6A 5EN1A 1FRHA 1Q5VA 2VOPA 4A8SA 3UKUA 1VBXA 3DLJA 1M90T 4IUFA 2D3O1 2AEFA 3B8HA 1E6YA 4B9TA 4PY5A 1RNHA 2PAVA 3KK2A 4BY9C 2GJFA 2OO4A 1LAWA 2LFVA 4J91A 3N79A 4DMZA 4V19S 5HVFA 3TQEA 4M63A 2YKOA 1N34K 2KVQE 3MMJA 2MGZA 3KG4A 3KDOA 2JDJA 1WF1A 4USIA 1TYQA 5D0RA 4ID5B 2QG9B 3BO4A 2ZWHA 1JLQB 3WQPA 2BJDA 4M41A 4GVBA 5KPTA 4MK7A 2AMCB 4DSIA 3N5FA 4OX6A 3QO9A 3O4WA 3HDSA 2JOQA 1CULB 1VQYA 4PWWA 3TTDA 4YHHF 2M8DB 4BQLA 4CTAB 9ATCB 2Q66A 2PI4A 1GLFO 2VG5A 5FPDA 4K4UA 4NI2A 4DV6K 2MQMA 4WCEL 4UF4A 1S6QA 3SCLE 1P27B 2LXIA 1S7HA 4CJQA 3SAHA 1GOBA 3MPDA 5JLFA 3DYAA 3EVMA 1T9WA 3PHEA 3HI0A 4LF8J 2P6TA 4Q7AA 2GVZB 4OZ2A 2F8TA 3I8BA 2W2OP 1IBLJ 2YHXA 3DDIA 3VGVA 2DO4A 1Y3KA 7FDRA 3DU6A 5CH7B 3PG9A 2OZSA 5HMWA 1IH7A 1DHMA 2GS8A 4NMXA 4JV1A 3VQ8A 4IRKA 3AARA 3IMXA 4PQUA 1O5JA 2XMVA 1KC8T 2LSNA 3LGHA 2W2PP 2O8EA 1VQ4S 4CM2A 5BR9A 4IH7A 3PFEA 1BIZA 4FJ9A 3G86A 1CZ9A 1FDNA 1JJ2M 1J5EF 2KXNB 2BR0A 4AM7A 1PKUA 5IFMA 4TYAA 3AA5X 2FDNA 4ILRA 5HBMA 3A8JA 2JWLA 4FP9A 1HQEB 4LF8F 1GOCA 2IHR1 4BQZA 5THWA 3ATUA 2UXCK 2CQGA 1TKXB 3N4WA 4RW7A 3SDEB 1MN9A 4X65F 2DHSA 2YH0A 1M5VC 3L2WA 2DCUB 5CYQB 8RUCA 4QW9A 3CCJS 2HFVA 1YZ6A 3VOVA 3CCQN 1NKEA 3IS9A 1R0AA 2ZBPA 3OLBA 4JI6K 1O6XA 1ZBIA 2QK9A 3HVAA 2WCXA 3Q8QB 1RFQA 1WSEA 1VOMA 2HSEB 1N32J 3DXKB 1N33J 2HMPA 4RLEA 2HHQA 4OZJA 3GP9A 2QSWA 2NPIA 4PG8A 2RT3A 4NPOA 2QTWA 4K2XA 3Q23A 2YNHB 3LZIA 4KSEB 1SC6A 2DR9A 2RHQB 3Q2TC 1YTYA 1U1QA 1VSMA 4MYUA 2ZJPQ 3E9OA 4ECQA 1RTJA 3M8WA 3KHHA 3C6TB 4ZJLA 1NZAA 4QYRA 4RBUA 5KFWA 1O1WA 3DI6A 1G3OA 1APSA 3ISNC 1DTTA 4ZN3A 3FZMA 1N5SA 1VQ9N 1M0SA 2FVPA 1ZM3A 3V9ZA 2NRZA 2YWHA 2ATQA 4M3ZA 2GFFA 2PT0A 3O9UA 1PO6A 3HFZB 3MPYA 4CYUB 3NMUA 3AVJA 1UFLA 3DKDA 2VGMA 2EC0A 3QZ8A 1K8AT 2DHXA 3TR8A 2HFOA 2FD2A 3OT9A 2DGUA 3ZZRA 2P9LA 4H4MA 2M9KA 4C7QA 4OPAA 4LF5J 3JS6A 1VDHA 1WTBA 3WHIA 4JV5J 3DU5A 4YDUA 3S6EA 4IOAQ 3G8QA 2P9IB 4CGFA 4CZFA 1Q86T 2QA4N 3QLHB 4C11A 1XI1A 3ZX3A 2VQEJ 1HNZJ 5GAGP 3O1LA 1N5QA 2J76E 2BQ3A 3QFPA 3IRXA 4LFBK 1NPKA 4CJTA 4FVCA 3MM6A 1U7LA 3PKMA 1JXVA 5D4PA 2FVCA 4H0XB 5KFMA 4Z4CA 2BW2A 1RI7A 4H8KA 1S9GB 2DGSA 2FQQB 4YY3F 1U1KA 5CD4A 2J0QD 2F7TA 3NS7B 4E2FB 1B70B 4YY3J 1FWLA 4ZIVA 1B9FA 4B9LA 4WFAQ 1S12A 1QZ5A 2ASPA