3O4QA

Crystal structure of the rous associated virus integrase catalytic domain a182t in citrate buffer ph 6.2
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
145
structure length
136
Chain Sequence
LGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSFTSKSTREWLARWGIAHTTQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords integrase
publication title A crystal structure of the catalytic core domain of an avian sarcoma and leukemia virus integrase suggests an alternate dimeric assembly.
pubmed doi rcsb
source organism Rous sarcoma virus
total genus 50
structure length 136
sequence length 145
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3o4qA00
3K57A 4AHSA 1NK9A 3VQQA 3K5LA 1ASWA 2RN2A 1CXQA 3VQ4A 2DTUA 3SI6A 2E6LA 1RBTA 2OPSA 2X6NA 3C6TA 4Y1DA 4CESA 4CFBA 5HRNA 1JLEA 3TABA 1QSLA 4FJIA 3VQAA 5FROA 4N41A 1XI1A 2GUIA 3AVCA 3KLIA 3THVA 4CJWA 1NK8A 4AHCA 4DTSA 3VQEA 4CHOA 4FZZA 4KRFA 4LD0A 3S3OA 3ZT3A 1T03A 4NYNA 4HHTA 3OS0A 5I3UA 1KTQA 3AO4A 2HMIA 3BDPA 4PQUA 4F4KA 3AVNA 1W9HA 2YNIA 5JS1A 1X1PA 4O44A 4FLZA 3RMCA 3PO5A 4EP4A 3K5MA 4Z4FA 3V4IA 2DFHA 4L8RB 1WSHA 1R0AA 4ICLA 5DMRA 4CCHA 3JYTA 4FJXA 1RCHA 1FKPA 1SL1A 3ZCMA 5KGWA 3ZT4A 3OYAA 2KZZA 1UA0A 4CJ3A 1D9FA 5DK5A 4CFCA 4CEZA 1U04A 3QEWA 2O4IA 3PV8A 4B9MA 2LSNA 3DOLA 1VSEA 4ELVA 1NJWA 3OYNA 3O3FA 4DFMA 2QXFA 3F73A 5SZTA 4O4GA 1BIUA 2HW3A 3HL8A 3QETA 2HVIA 4FJNA 3B6PA 3NF8A 1ZBFA 3QEVA 4WE1A 4CGIA 2Y1IA 1RBSA 1KLNA 3HO1A 4W5NA 1TGOA 3MEEA 1JL1A 2OPQA 5KI6A 4KI6A 4QOZB 1UAXA 4Z4HA 4ZTFA 5E41A 3WNEA 1CZ9A 4I9LA 3AVMA 3TAGA 4K8XA 2P5GA 2BDPA 4CEOA 3D0PA 5C42A 5HRSA 3K58A 4DFPA 4CF2A 1NJXA 4H8KA 1S6PA 1TK8A 3QO9A 1W0HA 4FLYA 2OPRA 4RW6A 3CFRA 1KVAA 1Z25A 4DF4A 2G8KA 2Z1GA 4FXDA 2HHXA 2BGGA 2YNFA 1JLGA 3NF6A 3OJSA 4B9TA 4M3YA 3ZSYA 3K5OA 5CZ1A 4FJ7A 2BE2A 4CEEA 4W5TA 4BWMA 3CFPA 1T8EA 2HHQA 1L3TA 3MEDA 1NJZA 4FJKA 1IO2A 1ASVA 3E01A 4B9SA 2HB5A 3KLFA 2XHBA 1BIZA 1S1VA 4IG3A 4OLBA 1BCOA 4NCGA 4M3RA 1U45A 1BISA 1WNSA 3AVKA 3OYIA 1C6VA 2OA8A 1QE1A 1JL2A 1NK5A 4FJLA 1I3AA 4M3ZA 1NK4A 4I2PA 1IKWA 3ULDA 3C94A 4H4OA 1VSLA 5SWMA 1I39A 4CK1A 3NGZA 3HVRA 3SUOA 1NK6A 4FJHA 1VSJA 3RRGA 4LH4A 3ZSXA 2A1RA 1TL3A 3AA2A 3I8DA 3SQ0A 3SQ4A 3OYHA 5HBMA 4BWJA 2E6MA 1LAWA 3DI6A 4CIFA 1EETA 2DFEA 3SUPA 3S3MA 4CE9A 4ELTA 3K2PA 2IC3A 3EYZA 5HP1A 2ZD1A 3KD5E 3VA3A 4B3OA 2B5JA 1IH7A 4CJRA 2G8IA 2P5OA 2P51A 4CEFA 3NH0A 3NF7A 1SKSA 1QQCA 3ZSWA 3PO4A 1S9GA 1U49A 1IKYA 4KB1A 1WSJA 4E7IA 2W42A 1TKZA 2FBTA 1BI4B 3VQDA 2XO7A 3TWHA 4KHYA 1NKEA 1SKRA 1VSDA 4JLHA 1LWEA 3NCIA 1F21A 4W5QA 1C1BA 2YHBA 1KCFA 1BI4A 2IAJA 2A1SA 1EP4A 3PX4A 5D3GA 4N47A 3OYMA 1CXUA 1HYVA 3HP6A 2YNHA 1L3SA 4IBNA 1KFSA 3VQ9A 3V6DA 1JLBA 2XY8A 4CF1A 3M8PA 3EY1A 3LPUA 2KFZA 2I5JA 1KSPA 3OYJA 4ZTJA 2YKNA 3G10A 4JRPA 3OJUA 3B6OA 3T1AA 1DLOA 3MXMA 3ALYA 2E4LA 2HHTA 4DSEA 4LH5A 3VQPA 5KRSA 1VSIA 2VWKA 1TKTA 5CZ2A 4BDYA 2WOMA 2G8UA 2D5RA 2Z1HA 4PA1A 5T7BA 4Q0BA 3P83D 2HVHA 4DQQA 1LWFA 3IRXA 4Q5VA 3LZJA 1A5XA 4OKJA 4HUEA 4B8CA 4ZHRA 4CK3A 4ELUA 4CHQA 4DTJA 3ZSRA 2ZE2A 4CEBA 4CJVA 4KTQA 2KZMA 4CEDA 4TSXA 3SNNA 4B08A 3AO5A 4FK0A 3OYFA 5K14A 4DTMA 1WAFA 3VQ6A 4CJLA 4FYDA 4CIGA 4DLGA 3FFIA 4IG0A 4Z0UA 1KRPA 4IFYA 2KQ2A 3DM2A 4FLVA 4E7HA 3KIOA 2HHVA 1HNVA 1RDAA 1ZBLA 3MEGA 3L3UA 3I0SA 1RT4A 4OGEA 4KPYA 4KHWA 4RW9A 1WSEA 3V1OA 3DOKA 4CEQA 4LSNA 3RTVA 3SQ1A 3DRRA 3MXJA 4N5SA 1B92A 4N56A 4EZ9A 2YNGA 1ZYQA 4FLTA 4DSJA 2Z1JA 1BHLA 1VK0A 3IS9A 3WNFA 1S1UA 1K6YA 1YVUA 3LDSA 3U3YA 3TAMA 1C1CA 3WNGA 4BE0A 3PX6A 4O5BA 4NYFA 1JXEA 3CM6A 3L2QA 3PUFA 4O55A 3SYZA 4M3XA 4CHYA 3CFOA 4DS5A 4DFKA 3QEPA 3L2WA 4FK4A 5EU7A 3DLKA 4B9NA 3OYCA 2B6AA 1FXXA 3SCXA 4KTZA 1RDDA 1RDBA 3QINA 4RW7A 4I9QA 4HCCA 2HNZA 3AV9A 5KTQA 3RMDA 5J2MA 4FZYA 2OZSA 1WSGA 3HPGA 1IKVA 3L2RA 1TAUA 1Z26A 3NBPA 2X78A 3AA3A 3UIQA 1LWCA 1WSIA 4FJ9A 4FLXA 1U47A 4I2QA 4Z4GA 1RT1A 2WONA 4KAZA 1C0UA 3V9ZA 4YNQA 2YKMA 4HUFA 3V9SA 4OJRA 1UA1A 2O4GA 3KLHA 1YT3A 2IS3A 3ZT2A 1RTDA 3HPOA 3HP9A 4FM2A 4IKFA 3HSTB 4KKOA 3LP2A 3VQ5A 2KW4A 3KK2A 3LWLA 3K59A 1NOZA 4AHUA 1NK0A 3K5NA 3V9WA 1A5VA 3QERA 4CERA 1JLAA 1QHTA 3ASMA 3M8SA 4FZXC 4BE1A 3AO2A 3QNNA 1NK7A 2Q3SA 4RG8A 1LAVA 3O4NA 1KVCA 2Y1JA 3OYDA 1T7PA 4HCBA 4GMJB 1XC9A 3DLEA 4CHPA 3SUNA 1LW2A 1Y97A 3G0ZA 3CM5A 5FDLA 1D9DA 1BGXT 4CJ5A 2XRIA 4JS5A 3VN5A 2PZSA 4DSIA 2ZQBA 4PWDA 3HXMA 1UOCA 3LAKA 2RKIA 4IFVA 1C0MA 3AVHA 2NUBA 1VRUA 4DQSA 3D45A 1HQEA 2R7YA 3I0RA 3AVIA 3U6FA 4RW4A 4E89A 2VG7A 1SKWA 4BE2A 4KHNA 3H08A 3MECA 1N6QA 3DYAA 3S9HA 4CGDA 4DU1A 4CJUA 3OVNA 4JS4A 3V9UA 2DFFA 4LSLA 3L2UA 3IAYA 4KTWA 4CJEA 3T19A 4CIEA 3DMJA 4NCAA 2Z1IA 4CJKA 3QESA 2PYJA 2VWJA 4CGFA 3VQBA 3DLHA 4B9LA 1QS4A 1S1WA 4DFJA 2HNYA 3DRPA 5I42A 4KO0A 4MQ3A 3RMAA 4KHSA 1JKHA 4HTUA 3HYFA 3V1QA 3NFAA 3SQ2A 3AVFA 3LPTA 3P1GA 2IOCA 3OS2A 4CFAA 3HPHA 3MAQA 4KV8A 3L3VA 4B9UA 1HPZA 2XY5A 1WAJA 1J53A 4W5OA 4LY7A 4F8RA 1NJYA 5HRPA 1XHXA 3AO1A 3MXIA 3LP0A 1D8YA 3ZSOA 2D0CA 1YTAA 3C6UA 1WLJA 4E1NA 3S3NA 3OYLA 3TI0A 4DMNA 3LALA 3ZT0A 2FBVA 4OKKA 4R5PA 1HRHA 3KK1A 2F8SA 4BACA 3KLEA 4DSKA 1XHZA 1FK9A 1KFDA 1S1TA 4CJSA 4CF9A 3O3HA 4KREA 3TAPA 4M3WA 1J9AA 4DQIA 4QCLA 3F9KA 3IG1A 2GV9A 3AVGA 4DTRA 1U48A 4E19A 4AH9A 1RBUA 2HHUA 1JXBA 5HROA 1C0TA 2AJQA 3ZSZA 3ZSQA 1EXQA 1B9FA 1NKCA 4M42A 1RTJA 3LP1A 3ZSVA 1X9SA 3M8RA 2RPIA 4ID1A 2F8TA 1S5JA 2QK9A 4C8OA 3KKSA 2D0AA 1VRTA 3NGYA 5J1EA 4CJTA 2BANA 4UQGA 3OYEA 3KLGA 3L2VA 3QEXA 3SJJA 2KFNA 1S1XA 3P5JA 3T3FA 4DU4A 4CGGA 1NOYA 3TAEA 4E0DA 4CJ4A 1QSYA 4B9VA 3QIOA 1JLQA 3LZIA 3AVJA 1IKXA 2F96A 3LAMA 4CF0A 1VSHA 3SPZA 1Q9XA 4K8ZA 3AA5X 2FBYA 2FBXA 3HT3A 4Z4IA 2DY4A 3RR8A 1VSMA 2JLEA 4CJFA 4JRQA 3OY9A 3HK2A 5J2PA 4CECA 4FVMA 1Q9YA 1EKEA 3SPYA 3TR8A 4IDKA 3V81A 3QEIA 3KD1E 4CFDA 4QAGA 4C8NA 1X9WA 3OYKA 1GOCA 4CF8A 1TK5A 1IG9A 4E3SA 1TK0A 3LP3A 3KKRA 1GOAA 4J2DA 4FJ8A 3TARA 4DG1A 4DF8A 2PYLA 1ZBHA 2ITGA 1HYSA 4E7LA 1J5OA 4OLAA 4DLEA 1S9EA 5CY4A 2HHWA 3DLRA 4XIUA 3RRHA 1HMVA 3U3GA 1QTMA 4ID5A 3OYGA 1KLMA 1Q8IA 1RTIA 2VG5A 2KTQA 2YHAA 1MU2A 4E7KA 1TL1A 3V1RA 1RILA 4AHRA 3NDKA 5JS2A 1RBVA 4C8LA 4CHZA 1RT3A 2IGIA 3WNHA 4O0IA 1KVBA 5C25A 1T05A 1DTQA 1VSKA 2FC0A 3ITHA 3M8QA 4EZ6A 3NGIA 3SZ2A 4B8AB 4E1MA 2QKBA 4PUOA 3JSMA 5HLFA 3RR7A 3AVLA 4F2SA 1BL3A 3O4QA 1L3UA 4DSLA 4O0JA 4DTNA 3CG7A 3NF9A 3KJVA 2ETJA 5J2QA 4F3OA 4F3TA 1EX4A 1ASUA 2EHGA 4H4MA 4AHTA 4BDZA 1RTHA 3RWUA 1G15A 3OS1A 5KGXA 2JGUA 4DSFA 1BCMA 5FRNA 1YTUA 4KI4A 2G8VA 1J54A 4J2EA 1CLQA 1HYZA 1LW0A 4C8KA 2OZMA 3NE6A 3PY8A 4J2AA 4G1QA 4CGHA 3AVBA 3TAFA 1JLCA 3DRSA 3DLBA 1ZBUA 2ATQA 2B4JA 2OPPA 4OVLA 3DLGA 1A5WA 4FM1A 3KK3A 1LV5A 1TKDA 4C8MA 3VQ8A 4M41A 4AHVA 1RNHA 4E7JA 4AILC 2VG6A 3ZT1A 4FJ5A 4CK2A 4CEAA 4FJMA 1TV6A 4FCYA 2HHSA 2G8HA 4CJQA 4J2BA 1SUQA 1VSFA 3VQCA 4OPJA 1RT7A 4FK2A 4DU3A 3NH1A 4FJGA 5C24A 4FW2A 1L5UA 1C1AA 2G8FA 1JLFA 1WSFA 4GW6A 5J2NA 2HNDA 3L8BA 3A2FA 3V9XA 2QKKA 1SL2A 1RDCA 3NAEA 4CJPA 4FW1A 3RMBA 3VQ7A 4Z4EA 3BGRA 4KFBA 1REVA 1QSSA 3LWMA 1U4BA 1GOBA 1HQUA 3PX0A 1BQMA 4FJJA 4BDPA 2X6SA 1X9MA 2P1JA 3NH2A 3CQ8A 5KRTA 4KHUA 1TAQA 1CZBA 4FLUA 2XY6A 3KTQA 1B9DA 4FM0A 1WN7A 3VA0A 1SV5A 4DTPA 4M3UA 4DWIA 1RT2A 1UWBA 1D5AA 1BQNA 3C95A 4PY5A 1L3VA 2EX3A 4DTUA 1TVRA 5HRRA 2IDOA 3CYMA 1HNIA 4DTOA 2RF2A 3AA4A 1RT5A 3O3GA 1FKOA 3HVTA 3QLHA 3HM9A 4I7FA 1RBRA 3SV3A 1S6QA 4OKEA 4M45A 4HUGA 3HJFA 1O1WA 4FLWA 4MFBA 4Y1CA 4W5RA 4M3TA 3SV4A 1XWLA 4EP5A 1TKXA 3QIPA 2GBZA 1ITGA 3EZ5A 4OGCA 2XY7A 5FRMA 1DTTA 2OYQA 4F2RA 4DS4A 3QNOA 3SUQA 5CYMA 4OPKA 1N5YA 3OYBA 3TANA 4CGJA 4DQPA 2X74A 4NCBA 3TAQA 4KHQA 1RT6A 5CYQA 2YV0X 4KB0A 3ISNC 4DQRA 4GVMA 1SL0A 1NKBA 4HVJA 4N76A 4YFUA 4CHNA 4DTXA 1HJRA 3LANA 3AO3A 2G8WA 4RW8A 1ZBIA 2D0BA 2PY5A 3AVAA 3NHGA 4Z4CA
chains in the Genus database with same CATH superfamily
1KAYA 1CXQA 3HI0A 3VQ4A 3IFRA 4CZEA 2OPSA 3SI6A 4OLBA 5HRNA 1QSLA 1JLEA 4JKBA 3AVCA 4UY8O 4CJWA 3GL1A 4IZ9A 4DTSA 3VQEA 4CHOA 4KRFA 3ZT3A 4O44A 3K5MA 1H1VA 1J6ZA 5AQVA 5BN9A 4L8RB 2P9UA 4MDBA 4FWQA 4JI0K 1GLJO 2CGJA 4IO9L 1SL1A 3P38A 2KZZA 3OYAA 4CFCA 3QEWA 1TYQA 3PV8A 2QXFA 3F73A 2HVIA 4O4GA 2E8AA 2GELA 3CF5L 3B6PA 2E2NA 3NF8A 5EVZA 1RBSA 3Q7CA 5TKYA 1JL1A 5KI6A 4ZTFA 4BRDA 1CZ9A 3TAGA 3WUHA 3K58A 4DFPA 2YHYA 4IEEA 4BQLA 1M90O 4FLYA 4RW6A 1KVAA 1Z25A 3D2FA 2BGGA 3NF6A 1JLGA 4B9TA 4CEEA 2HHQA 3O9SA 4FJKA 1OKJA 5BRDA 1ASVA 3E01A 1NGBA 2QW9A 5HL7L 1U45A 1C6VA 4M3ZA 4YOYA 3ULDA 1MDUB 1VSLA 3SUOA 2A42A 3EKUA 4Y0WA 2E6MA 3BUZB 3DI6A 1EETA 4CE9A 3Q7BA 2QWLA 1IH7A 4YOWA 4CEFA 1Q81O 3NF7A 4DV6K 1IKYA 1YITN 3C7NB 1NGGA 3ENHA 1TKZA 2E2PA 4KHYA 5C10A 1VSDA 4JLHA 3PIOL 3NCIA 2OTJN 2VGMA 1F21A 3VF4A 4BRHA 5BREA 3PX4A 3W3DA 1JCFA 2YNHA 1YHQN 3OBYA 2XY8A 1VHXA 2KFZA 1NGAA 4FOIA 2I5JA 1BUPA 4JRPA 2JWLA 4YOUA 2HHTA 5KRSA 2VWKA 3WXKA 2D5RA 4PA1A 3QFPA 4Q0BA 4IJNA 2Q1NA 4PL7A 1LWFA 3IKMA 3IRXA 4Q5VA 3LZJA 2A6AA 4DTJA 2ZE2A 4FPBA 2KZMA 3H3NO 1MWMA 5K14A 4CVNE 4CJLA 4DLGA 2KQ2A 1XMQK 3THWB 1HNVA 3LM2A 1RDAA 3MEGA 3I0SA 3PLAA 2A40A 4FWRA 4LSNA 2ZJRL 4N56A 4EZ9A 4FLTA 2QWRA 4H0VB 5FPNA 1VK0A 3VETA 3L0QA 1S1UA 1YVUA 5AQKA 3LDSA 2QM1A 5GAEP 1K8KA 5CHIA 3QEPA 4DR2K 2H3GX 3DLKA 3VEWA 4B9NA 3THYA 2OCEA 2B6AA 4IO8A 3R8EA 2KLAA 1FXXA 3B8AX 4KTZA 3CCJN 4GKJK 3QINA 4I9QA 2ASMA 2GTDA 2HNZA 5C2FA 3HPGA 4LC9B 4MLHA 1Z26A 1LWCA 1U47A 5JMVA 4A2BA 2GWJA 3V9ZA 4KAZA 2E2QA 2YKMA 4JV5K 1KQSM 3QICA 4IKFA 4KKOA 3VQ5A 1NOZA 3O5BA 1QHTA 4BR2A 1K8AO 2A41A 4HCBA 3DLEA 4B1WB 3SUNA 1LW2A 4GV6A 4CJ5A 4JS5A 4DSIA 3VN5A 2QA4N 1UOCA 1HQEA 3EE9A 3VF6A 1SKWA 4KHNA 1R59O 3DYAA 3S9HA 5M1OA 4CJUA 3V9UA 2DFFA 4NCAA 3DMJA 3QESA 2QWOA 1QS4A 4KO0A 4MQ3A 1JKHA 3AVFA 2UUCK 1NGEA 4B9UA 1J53A 4LY7A 1XHXA 3AO1A 4GV9A 4E1NA 3TI0A 1LCUA 3UE5A 2F8SA 4BACA 4BC2A 1XHZA 1FK9A 1K9MO 1NGIA 3O3HA 4CF9A 3VPZA 3IG1A 2UXBK 3AVGA 4YDUA 3LDPA 1VQ7N 3CQYA 3CD6N 5M1NA 1JXBA 4EIAA 3ZYYX 4WQ5A 4IDHA 3M8RA 2RPIA 4JKEA 3OBWA 1N32K 2D0AA 3L2VA 3MMVA 3QEXA 2QWNA 1XNRK 1S1XA 1IG8A 4FPAA 4DU4A 3IDHA 1QSYA 4XH4A 1Q9XA 4K8ZA 1YAGA 1VQMN 2FBXA 5AQOA 3T1YK 2DY4A 4Z4IA 4BRGA 1VSMA 3AAQA 2P9PA 5CE3A 3R6MA 3OY9A 3QBWA 4DR4K 3V81A 4CFDA 4QAGA 1HKCA 1TK5A 5LL6Z 4J2DA 4FWSA 1S9EA 3FE1A 3CCSN 4ILJA 4ID5A 5AZJB 2Q2RA 1KLMA 3OYGA 1NMDA 5AQNA 4JHDB 3ULEA 4AHRA 1RILA 3ZX3A 2HF3A 4DHYA 3TU5A 2BTFA 4O0IA 4J8FA 4H5RA 2RHKA 1DTQA 3K0SA 2FC0A 3ITHA 3ZX2A 3ATVA 3JSMA 5HLFA 4BG8A 3R3LA 3AVLA 4WCEL 1Q86O 3MWPA 3W0LA 4DTNA 5C2DA 3KJVA 1EO1A 1ASUA 4AHTA 4BDZA 1NNEA 3OS1A 3DXMB 4KI4A 2OZMA 1NGCA 3A5NC 4JN4A 5LMUK 3TAFA 1NGJA 4X66K 3O4WA 1ZBUA 2DPNA 2ATQA 4FM1A 1A5WA 3C0BA 4B3SK 3KWGA 3VQ8A 5AR0A 4AHVA 4E7JA 2O8BB 2VG6A 2UYTA 4FJ5A 4CK2A 4FJMA 2VCPA 4FCYA 1MWKA 2G8HA 3VQCA 3H1VX 2G8FA 1JLFA 1WSFA 1SL2A 3NAEA 5AFUA 4CJPA 3RMBA 4Z4EA 4KFBA 1QSSA 4BDPA 1YJWN 3CQ8A 1TAQA 2GX9A 4IOCL 1SQKA 2Q0RA 1D5AA 4PY5A 4ILGB 4YOTA 3CC4N 3C7NA 1HNIA 1RT5A 2F9WA 4BGAA 3NMUA 4I7FA 3O8MA 3SV3A 4OKEA 4HUGA 4Y1CA 3SAGA 1XWLA 3EZ5A 2ZGZA 2OYQA 1N5YA 5BPNA 3TANA 3MN5A 4LFBK 2PFUA 4CGJA 3WXJA 5BRFA 4KHQA 3TAQA 2D0PA 4JKHA 4HVJA 3FGUA 4CHNA 3LANA 1IJJA 3AO3A 4O5FA 1FW6A 3H46O 5JVGL 2P9NB 3K57A 1NK9A 3K5LA 2RN2A 5AQHA 4BR5A 2QI2A 3L4IA 2X6NA 4L3QA 4CESA 4DUYK 3TABA 4BC5A 3VQAA 1T3VA 3RSEB 3FZFA 2NRRA 3KLIA 3THVA 1QVGM 1T44A 3WT0A 1NK8A 1JCGA 1BDGA 4FZZA 5AQFA 2P9KB 4NYNA 3OS0A 3A5OC 3A5LC 3BDPA 4F4KA 3AVNA 3PO5A 3VF2A 4Z4FA 2ASOA 1ZBSA 5EOYA 1HNWK 1U6ZA 3JYTA 1RCHA 1FKPA 4KH6A 3ZCMA 1DKGD 2YHWA 1ZC6A 1UA0A 3D7EO 1GLFO 1D9FA 4I6MA 4IOAL 3PSIA 4NLCA 1U04A 2UXCK 1VSEA 5BPMA 3OYNA 2HW3A 1BIUA 4WE1A 2A5XA 2UUAK 4W5NA 1TGOA 4CZKA 2OPQA 4KI6A 1UAXA 4Z4HA 2RE2A 5LY3A 1NBWA 3J8AA 1QZ5A 4K8XA 4LFAK 2BDPA 4IOXA 3HRGA 2P9SA 5HRSA 5AQYA 4CF2A 1TK8A 3N4QA 2OPRA 3CFRA 2G8KA 4QS7A 2ZF5O 2HHXA 3HZ6A 2YNFA 4V19S 1ZXOA 3OJSA 4LF9K 4M3YA 3I33A 1IBLK 4W5TA 2O8FB 3CCLN 1T8EA 5BN8A 1L3TA 3MEDA 2VQEK 1NJZA 1Q7YO 3KLFA 2XHBA 1YXQA 4CZMA 4NCGA 4H5VA 2OA8A 1QE1A 1JL2A 4FJLA 4PKGA 5H1SQ 4I2PA 1IKWA 4H4OA 1NK6A 1GLDG 4CK1A 3MX5A 1VSJA 3I8DA 4MO4A 3SQ4A 5HBMA 3SUPA 1LAWA 4CIFA 3S3MA 2DFEA 5GAHP 5M1KA 2IC3A 1BU6O 4JK9A 4A2AA 2E88A 2G8IA 2P51A 1M1KO 3NH0A 2AA4A 1DT9A 1U49A 4KB1A 4B3TK 4E7IA 2FBTA 2XO7A 3VQDA 1SKRA 1LWEA 4DV4K 1BI4A 3J80O 2IAJA 2A1SA 1EP4A 4XH5A 5D3GA 1ATRA 3KK7A 1GLLO 1HYVA 1JLBA 1NU0A 3AARA 1KSPA 3B6OA 1FJGK 3LDLA 1DLOA 2E4LA 3S41A 3VQPA 1VSIA 2F4VK 4BDYA 3FZHA 5T7BA 4FL9A 4B3RK 1DGKN 1T6DA 2UUBK 1A5XA 1VAZA 3CPWM 4ELUA 2VGNA 3ZSRA 4CEBA 4C1NI 5FPDA 3QDKA 4DV7K 3BY5A 3ZETB 3VQ6A 3IUCA 3SMPA 1GLCG 3DM2A 4E7HA 2VYPA 3GG4A 3L3UA 4OGEA 4KHWA 4QS8A 4RW9A 1WSEA 3RTVA 3C6HA 3O9QA 3MXJA 1XMOK 3G4SN 4A5BA 3MCAB 2Q0UA 4WQ4C 5ELZA 1K6YA 3U3YA 1C0FA 3WNGA 4LF8K 5ADXH 3CM6A 1I94K 4M3XA 3CMEN 4CHYA 4NLBA 2YHXA 4DUZK 4FK4A 3TTFA 2GEMA 3CC2N 3L4QA 1BWFO 4CI6A 4HCCA 4CJ7A 5J2MA 1WSGA 5A2QO 1TAUA 3NBPA 2Q97A 4IXCA 4I2QA 1C0UA 4YORA 4HUFA 3V9SA 3ZLJA 2A3ZA 2O4GA 4BRPA 1UA1A 4DV0K 3ZT2A 2IS3A 1RTDA 3HP9A 3LP2A 2KW4A 3K5NA 1A5VA 2FF6A 3QERA 4CERA 1JLAA 2P9IA 3AO2A 4ISEA 5DM7L 2Q3SA 4O8UA 3WXIA 2Y1JA 4DR6K 3OYDA 3WQUA 1XC9A 1X3MA 3J7YP 3CM5A 5FDLA 4PWDA 4XEIA 2RKIA 4IFVA 1OVQA 1VRUA 1Q18A 3AVIA 3WEEB 4BE2A 1HR0K 3J7AP 2P9LA 3CJ7A 3OVNA 3L2UA 3IAYA 4CJEA 2BUPA 4CJKA 2VWJA 4WFBL 4GVEA 4CGFA 3D2EA 3L6QA 4BRAA 4DFJA 4IJAA 3RMAA 5GIPA 1SAZA 2YJFA 3HYFA 3V1QA 3NFAA 3SQ2A 3LPTA 1N8RO 3P1GA 2IOCA 4DV2K 3L3VA 2NRVA 2ZM6K 4BVOA 2HBJA 1NJYA 4B9QA 1D8YA 3ZSOA 1KXPA 1BG3A 1YI2N 4DCHA 3LALA 3ZT0A 2FBVA 4R5PA 1HRHA 3KK1A 1KC8O 1VQ9N 3GE1A 5FLXO 1S1TA 3F9MA 4KREA 4KH5A 4H5WA 4O8KA 3TAPA 2QTDA 4DQIA 1NG9A 2FSKA 1U48A 3I8BA 5AQZA 1RBUA 2HHUA 2AJQA 4U67L 4FWMA 4JEPA 2NRHA 1NJIO 2WUSA 3K9KA 3R9PA 3QMLA 2WFBA 4C8OA 3SBGA 3NGYA 1EWQA 2BANA 2W6LA 3P5JA 5C12A 3IMXA 1HX1A 3T3FA 4CGGA 1NOYA 4B9VA 3QIOA 1JLQA 2E20A 3AVJA 1IKXA 2F96A 3SPZA 3AA5X 2FBYA 3HT3A 5BR8K 1S72N 4CJFA 4JRQA 3HK2A 5J2PA 4CECA 4FVMA 4JI3K 4JI7K 4H0TB 3UKRA 3VEYA 1U2VA 4DR7K 2WC9A 4OX9K 3CI5A 3OYKA 1D4XA 2HF4A 3RSEA 3TTCA 4E3SA 5KPTA 3LP3A 3KKRA 1W2BM 1HPMA 4EFHA 4FJ8A 4NO7A 4DG1A 4DF8A 3TARA 2ITGA 4HWIA 1J5OA 4DLEA 4DV5K 1HMVA 4MLEA 4CW7B 4JI6K 1GLBG 1MU2A 1TL1A 4RWTA 1RBVA 4CHZA 5AQXA 5C25A 1QVFM 3M8QA 4EZ6A 1TUUA 1V4SA 2HBMA 4GV3A 5MLCQ 1BL3A 4JK8A 2ETJA 4BRKA 4F3TA 2CGLA 1ILYA 3RWUA 5FRNA 4CZFA 1YTUA 2JGUA 2G8VA 4C8KA 4BREA 3PY8A 4G1QA 4CGHA 2ZWHA 4X62K 3HM8A 2OPPA 4CD3A 3KK3A 4M41A 4LF7K 3E9OA 1OH8A 5LJVA 4CEAA 4JNEA 1TV6A 4J2BA 3LDQA 5AQUA 4B1YB 2WBNA 1OH7A 4FK2A 4RTFD 4DU3A 4JI5K 4JKGB 5J2NA 2HNDA 3THXB 1RDCA 1GLEG 3VQ7A 3LWMA 4GKKK 4B3MK 1GOBA 1HQUA 3PX0A 4FJJA 2X6SA 2F7TA 1X9MA 1CZBA 4FLUA 1B9DA 1WN7A 1SV5A 4DTPA 4DWIA 1BQNA 4BR0A 2EX3A 1TVRA 1VQKN 3ZEUB 5JLHA 4DTOA 2GUPA 3HM9A 3DJCA 1S6QA 1JCEA 3QB0A 4M3TA 1V4TA 5B8HA 2GBZA 4BVPA 3T7ZA 1DTTA 4DS4A 4H03B 5CYMA 5GADP 3EN9A 3ENBA 4DQPA 2X74A 3DAWA 4H5NA 4H0OA 1RT6A 5CYQA 1VQ8N 4KB0A 3ISNC 4DQRA 3MN6A 3VEVA 1SL0A 1NKBA 4YFUA 2G8WA 3C6AA 2O8DA 4BRLA 2PY5A 4H5TA 3G25A 4AHSA 3VQQA 1XC3A 3MCPA 2E6LA 4Y1DA 4XIUA 1YIJN 3TSQA 5FROA 2GUIA 5KPRA 3K9JA 1VQ6N 3VTIA 4BRFA 4LD0A 5AQGA 1T03A 4HHTA 5I3UA 1KTQA 1RGIA 2VQFK 1N33K 5JS1A 4KHPK 5AJ3K 1X1PA 2P9UB 4FLZA 4M63C 3RMCA 4EP4A 1G99A 2DFHA 3V4IA 1SZ2A 4YHHK 5DMRA 3CCUN 4CCHA 5JVHL 4RCHA 4A57A 5DK5A 1WBDA 2O4IA 3GDQA 4B9MA 4EHTA 2LSNA 3DOLA 5F0XA 1NJWA 4DFMA 5SZTA 3TPQA 3QETA 1ZBFA 3QEVA 4CGIA 4QOZB 4BR7A 5AQTA 3WNEA 3AVMA 2P5GA 2OTLN 4CEOA 1SS6A 1DEJA 1S6PA 3D2FB 1W0HA 3CPEA 4DF4A 2Z1GA 4FXDA 3O9RA 3K5OA 4FJ7A 3CFPA 4BWMA 2FSJA 3T69A 1IO2A 4BRMA 1S1VA 1WNSA 3AVKA 3OYIA 1NK5A 2O8CB 1I3AA 3KZBA 1HLUA 5E26A 5EX5A 1I39A 5SWMA 3M6GA 4LH4A 2A1RA 3AA2A 4JD2B 3KWIA 4JI2K 4ELTA 3K2PA 3O6WA 3EYZA 3CC7N 2ZD1A 4B3OA 2B5JA 4CJRA 2P5OA 3O1BA 3WEEA 1SKSA 1QQCA 2AP1A 3ZSWA 1S9GA 3JS6A 5I9EB 1VQPN 1WSJA 3A0IX 3UKUB 1JJ2M 3J7ZO 2W42A 4F9OA 3TWHA 3VOVA 1C1BA 2YHBA 4IWVA 4JI1K 3TSPA 4N47A 3OYMA 3CCMN 2E5LK 1L3SA 4IBNA 1RFQA 3EY1A 3M8PA 3LPUA 4JKAA 1RDWX 3FZLA 2IVPA 5M1FA 3RVCA 3MXMA 4DSEA 1TKTA 2G8UA 3ATUA 2HVHA 4DQQA 4B1ZA 5DM6L 4CEDA 4TSXA 1X9JA 3SNNA 4B08A 3AO5A 1ATNA 4JKDA 4DR5K 3FFIA 4IG0A 4IFYA 1CZAN 3VESA 4KPYA 1RT4A 3THWA 4H0YB 4CEQA 3PIPL 5TKWA 3SQ1A 3DRRA 1B92A 4FVUA 2Z1JA 1BHLA 3WNFA 5BPLA 1K8KB 1C1CA 3TAMA 4O5BA 4K0KK 4NYFA 1JXEA 3L2QA 3PUFA 4O55A 4DS5A 1QQNA 2HBLA 2Q31A 5F2RA 3JXUA 3E66A 4LF5K 1RDDA 1RDBA 1NMNA 1S3XA 4CZGA 5KTQA 3RMDA 4X64K 3QFUA 2OZSA 4QS9A 1IKVA 2HOEA 1W97L 1WSIA 2D0OA 3ZX0A 4LF6K 4FJ9A 4Z4GA 1RT1A 4FWOA 1YVNA 4OJRA 3KLHA 2ITMA 1YT3A 1HNZK 3LWLA 3V9WA 4A59A 4WQ4A 3ASMA 1RDUA 3M8SA 1IBMK 4BE1A 1NK7A 3VERA 1LAVA 3O4NA 1KVCA 4IEIA 5BR9A 4CHPA 1Y97A 4MO5A 1EWRA 4H0PA 3WXLA 1BGXT 2XRIA 2ZQBA 4K41A 3LAKA 1OH5A 3AVHA 4DQSA 5AQMA 3D45A 4YOVA 3U6FA 4RW4A 2E2OA 4DU1A 5AFUH 4JS4A 1IV0A 2BH1A 4WF9L 4KTWA 4CIEA 3T19A 2Z1IA 2PYJA 4B9LA 4CBXA 2HNYA 3DRPA 4KHSA 2IVNA 4HTUA 3U4LA 3OS2A 4CFAA 3HPHA 3MAQA 3FFKB 4KV8A 3THXA 1HPZA 4W5OA 5HRPA 3MXIA 3C6UA 1WLJA 3CJ1A 3S3NA 3OYLA 4DMNA 1HJOA 3MX2A 4M3WA 3CQXA 3M1FA 1J9AA 3O08A 3F9KA 2GV9A 4DTRA 4E19A 4AM6A 1C0TA 4BRNA 4DR3K 3ZSZA 3ZSQA 1EXQA 1B9FA 4M42A 3LP1A 3ZSVA 3VGKA 1X9SA 4HTLA 4ID1A 1VQON 3FLCO 3KKSA 1VRTA 4UQGA 3OYEA 2F8TA 2KFNA 3SJJA 5F1XA 3CMAN 4JI8K 3O9TA 4OPAA 2P9PB 4Z94A 2CH6A 3LZIA 3LAMA 4CF0A 1VSHA 3RR8A 2JLEA 4FWPA 2W41A 3SAHA 1EKEA 4IDKA 5AQJA 4AF1A 3TSUA 1P8ZA 3F5TA 4C8NA 1X9WA 1GOCA 1GOAA 4YOXA 1HYSA 4BROA 1WBBA 3AY9A 4E7LA 4K43A 5CY4A 3RRHA 3U3GA 1QTMA 4FO0A 3ULEB 4PHTX 2VG5A 2KTQA 4FWLA 1VQNN 2YHAA 1LOTB 4EHUA 3LDOA 5AZJA 4LFCK 3V1RA 3U8XA 1YJNN 3CCVN 4C8LA 4BY9C 1RT3A 4JHDA 3WNHA 1KVBA 1T05A 3CIPA 3NGIA 3SZ2A 4B8AB 3A5MC 4PUOA 3P39A 2D4WA 3N4PA 5M1PA 3VEXA 4NB4A 3O4QA 4ISFA 2I7NA 3WXMB 4B1VA 2V7ZA 2EHGA 4H4MA 3QBXA 1G15A 5KGXA 2I7PA 1BCMA 4LF4K 4J2EA 1IBKK 1CLQA 1LW0A 3DXMA 4J2AA 3DRSA 4BR4A 2B4JA 3J81O 1VQLN 1LV5A 1TKDA 4C8MA 4AILC 5GAGP 3ZT1A 3E9LA 3BF3A 2J4RA 2NLXA 2HHSA 2O8BA 1C0GA 1VSFA 4FJGA 2PAVA 5C24A 1C1AA 2O8CA 4GW6A 3A2FA 3V9XA 2QKKA 5AQWA 4FW1A 1EQYA 3BGRA 3SAFA 1U4BA 4JD2A 1BQMA 4KHUA 3NH2A 1E4GT 5GIOA 4FM0A 4M7YA 1XUPO 1RT2A 2QWQA 3T1HK 4CZIA 5HRRA 3CYMA 4H0XB 3UKUA 1WUAA 2RF2A 3AA4A 3O3GA 3EEQA 3HVTA 5AQQA 1BA1A 3PSFA 3O1WA 3HBTA 3VMFB 4DQ8A 3HJFA 4M45A 3P4IA 1O1WA 3SBTA 4FLWA 5FPEA 2HSTA 4BG9A 1TKXA 4WYBA 1ITGA 4OGCA 2XY7A 5FRMA 4OPHA 3OYBA 4NCBA 1N34K 4M7XA 4XH1A 2YI1A 2FLOA 3H45C 4GVMA 2WTUA 1ZBIA 3UB5A 4DTXA 1HJRA 4RW8A 2O8EB 2D0BA 4R79A 4Z4CA 3NHGA 1ATSA 1ASWA 2DTUA 4YY3K 1RBTA 2P9NA 3C6TA 5E84A 4CFBA 4FJIA 5KPZA 2IVOA 1P90A 2HMPA 4N41A 3U9ZA 1XI1A 3SK3A 4AHCA 3CXCM 1TUYA 3HTVA 3CETA 3BZKA 2FSNA 3S3OA 4WFNL 1BA0A 4PQUA 3AO4A 2ZGYA 2HMIA 2P9KA 5HOOA 1W9HA 2YNIA 3DLLL 5BRHA 1YJ9N 4BRCA 1WSHA 1R0AA 4ICLA 4FJXA 4I6MB 5KGWA 3ZT4A 4CJ3A 3BF1A 3KVGA 4CD1A 4FWNA 3OHRA 4CEZA 2NRTA 4ELVA 3O3FA 4BC4A 3HL8A 4BC3A 4FJNA 3EE8A 4BGBA 4BRQA 2Y1IA 4G9ZA 3CCRN 1KLNA 3HO1A 1KAXA 3MEEA 1MA9B 2NRXA 2PBDA 1E3MA 3DWLA 2P9SB 5E41A 4I9LA 3D0PA 5C42A 1NJXA 4H8KA 2F9TA 4DR1K 3QO9A 1W7AA 3ZSYA 5CZ1A 2BE2A 2IIRA 2V7YA 5GINA 4DV1K 3E9PA 4B9SA 2HB5A 2O8FA 5FPMA 1BIZA 3H6EA 3HSCA 3CHWA 1Q82O 4IG3A 1BCOA 5AZIB 4M3RA 1BISA 3FZMA 1NK4A 3C94A 3F2KA 3HVRA 3NGZA 4FJHA 3RRGA 3ZSXA 1TL3A 3DXKB 2QEXN 3SQ0A 3OYHA 4BWJA 2KKZA 1WOQA 5HP1A 3CJ9A 3KD5E 3VA3A 3SMSA 3I56N 4ILHA 1NGFA 3GBTA 3PO4A 1BI4B 1NKEA 3OA9A 5EY4A 4W5QA 4BQZA 1KCFA 4FOEA 1Z05A 3AGRA 4PL8A 4CZHA 1CXUA 3HP6A 1KFSA 3VQ9A 3ID8A 3V6DA 4CF1A 3OYJA 4ZTJA 2YCHA 2YKNA 3G10A 3OJUA 3T1AA 3ALYA 2E1ZA 4LH5A 4K25A 5CZ2A 2WOMA 2Z1HA 3P83D 4OKJA 4HUEA 1K73O 4B8CA 4ZHRA 4CK3A 4PKIA 1Z6RA 3AGKA 3E1YA 4CHQA 4KTQA 4CJVA 1NM1A 2FF3B 5C0YA 4FK0A 3OYFA 4DTMA 1WAFA 3I55N 3EKSA 2QWPA 4FYDA 3ZETA 4CIGA 4Z0UA 5JICA 1KRPA 4C23A 1XNQK 4JI4K 3VEZA 4FLVA 3KIOA 2HHVA 1ZBLA 5AQRA 1O13A 3V1OA 3DOKA 4C1NK 3OW2M 2V52B 4N5SA 3HOTA 2YNGA 1ZYQA 4DSJA 3CERA 1S22A 3AAPA 3IS9A 3P31A 3EZWA 1J5EK 1TYQB 4BE0A 3PX6A 3SYZA 3CFOA 4DFKA 4DV3K 3M3ZA 5M1QA 3L2WA 3MN7A 5EU7A 3NVMA 1KD1O 3OYCA 2D1KA 1NWKA 3HOSA 3SCXA 4RW7A 3OTOK 3AV9A 4FZYA 2W6KA 3L2RA 2X78A 3AA3A 4K42A 3UIQA 4AQYK 1ESVA 4FLXA 2WONA 1QZ6A 4YNQA 3D6RA 3JAMO 1NGDA 2ASPA 4JKFA 3HPOA 4FM2A 3HSTB 3KK2A 3K59A 4AHUA 2P9IB 1NK0A 4OO1J 1YF5L 4FZXC 5IWAK 3QNNA 2YJEA 4BR9A 4RG8A 1T7PA 4GMJB 4A61A 1E4FT 3FR0A 3G0ZA 1QHAA 5AQSA 3VGMA 4BRIA 1D9DA 4EAHD 2PZSA 4CZJA 3HXMA 1C0MA 2NUBA 3CCEN 2P9LB 2R7YA 3I0RA 2NZTA 4E89A 2VG7A 4X65K 4ISGA 4YDUC 3H08A 3CJBA 3VTHA 4CZLA 3MECA 1N6QA 4CGDA 1HKBA 3D2EB 3BEXA 4LSLA 4WQ5C 5JLFA 3H3OB 4DB3A 3VQBA 3U9DA 3DLHA 1S1WA 4DKWA 3CJCA 5I42A 3C65A 2YX6A 4FWKA 3TTDA 4E1JA 2HHHK 1BO5O 3MK6A 2XY5A 1WAJA 4F8RA 3LP0A 2D0CA 1YTAA 4OKKA 3CJAA 3EO3A 3KLEA 4DSKA 1KFDA 1NGHA 4CJSA 1QQOA 2QXLA 4FSVA 4QCLA 4AH9A 3MWTA 3KHYA 2EWSA 5HROA 2FXUA 1NKCA 2NRWA 1RTJA 2GWKA 3O80A 4KBOA 1S5JA 2QK9A 1OVYA 5J1EA 4CJTA 3G6EN 3KLGA 2ZJPL 3EL2A 4E0DA 3TAEA 4CJ4A 4GNIA 1XQSC 2O8EA 2VWBA 2W40A 4NXMK 1YUWA 3M5RA 1VQ4N 3UKRB 1U2VB 1Q9YA 4WFAL 3SPYA 3TR8A 3LDNA 3SLCA 5AQIA 3KD1E 3QEIA 4CBWA 3THYB 4CF8A 1IG9A 1TK0A 2HBKA 1ZBHA 2PYLA 4OLAA 5ADXA 2HHWA 2E1YA 3DLRA 3MN9A 3G71N 1N36K 4GY2B 3BP8A 1HUXA 1WB9A 1Q8IA 1RTIA 3WQTA 5CR4A 4E7KA 3NDKA 5JS2A 3ID6A 2QWMA 2IGIA 3GOIA 5LJWA 1VSKA 3ENOA 4NXNK 1HNXK 4E1MA 4JYAK 3LL3A 2QKBA 3RR7A 5LMNK 2UXDK 4F2SA 1L3UA 5C15A 4DSLA 4O0JA 3CG7A 2Q36A 2UU9K 3NF9A 5J2QA 4F3OA 1NLVA 1EX4A 4U7BA 1RTHA 1Y64A 4DSFA 3CCQN 4JAXA 1J54A 2KHOA 1HYZA 3NE6A 4IFEA 3AVBA 1JLCA 1KAZA 2NNWA 4JK7A 3DLBA 5IT9O 2CH5A 4OVLA 3DLGA 5KQDA 1X3NA 5KQ8A 3BZCA 1RNHA 5AQPA 4A5AA 1QQMA 4MDAA 3SJHA 1T6CA 3NVKA 4CJQA 3VGLA 4PKHA 1SUQA 4OPJA 1RT7A 5AZIA 3NH1A 1L5UA 4FW2A 2OANA 3L8BA 1HKGA 4JKGA 2NRZA 3MDQA 1REVA 3DXKA 3VEOA 2CGKA 1VQ5N 2P1JA 3LM9A 5KRTA 2XY6A 3KTQA 4KH4A 3A8YA 3VA0A 4M3UA 1UWBA 3C95A 3VENA 2ZJQL 1L3VA 4DTUA 1BOTO 2IDOA 1GLAG 1FKOA 3QLHA 4CBUA 1RBRA 2V51B 3ZEUA 5EXWA 4MFBA 4W5RA 3R1XA 3SV4A 4EP5A 3QIPA 4B1XB 4F2RA 3QNOA 3SUQA 2JWKA 3O9UA 4B1UB 4OPKA 1OH6A 3H1QA 2YV0X 2O8DB 4N76A 4AM7A 4JKCA 3FZKA 5AQLA 3AVAA 4A62A
chains in the Genus database with same CATH topology
3K57A 4AHSA 1NK9A 3VQQA 3K5LA 1ASWA 2RN2A 1CXQA 3VQ4A 2DTUA 3SI6A 2E6LA 1RBTA 2OPSA 2X6NA 3C6TA 4Y1DA 4CESA 4CFBA 5HRNA 1JLEA 3TABA 1QSLA 4FJIA 3VQAA 5FROA 4N41A 1XI1A 2GUIA 3AVCA 3KLIA 3THVA 4CJWA 1NK8A 4AHCA 4DTSA 3VQEA 4CHOA 4FZZA 4KRFA 4LD0A 3S3OA 3ZT3A 1T03A 4NYNA 4HHTA 3OS0A 5I3UA 1KTQA 3AO4A 2HMIA 3BDPA 4PQUA 4F4KA 3AVNA 1W9HA 2YNIA 5JS1A 1X1PA 4O44A 4FLZA 3RMCA 3PO5A 4EP4A 3K5MA 4Z4FA 3V4IA 2DFHA 4L8RB 1WSHA 1R0AA 4ICLA 5DMRA 4CCHA 3JYTA 4FJXA 1RCHA 1FKPA 1SL1A 3ZCMA 5KGWA 3ZT4A 3OYAA 2KZZA 1UA0A 4CJ3A 1D9FA 5DK5A 4CFCA 4CEZA 1U04A 3QEWA 2O4IA 3PV8A 4B9MA 2LSNA 3DOLA 1VSEA 4ELVA 1NJWA 3OYNA 3O3FA 4DFMA 2QXFA 3F73A 5SZTA 4O4GA 1BIUA 2HW3A 3HL8A 3QETA 2HVIA 4FJNA 3B6PA 3NF8A 1ZBFA 3QEVA 4WE1A 4CGIA 2Y1IA 1RBSA 1KLNA 3HO1A 4W5NA 1TGOA 3MEEA 1JL1A 2OPQA 5KI6A 4KI6A 4QOZB 1UAXA 4Z4HA 4ZTFA 5E41A 3WNEA 1CZ9A 4I9LA 3AVMA 3TAGA 4K8XA 2P5GA 2BDPA 4CEOA 3D0PA 5C42A 5HRSA 3K58A 4DFPA 4CF2A 1NJXA 4H8KA 1S6PA 1TK8A 3QO9A 1W0HA 4FLYA 2OPRA 4RW6A 3CFRA 1KVAA 1Z25A 4DF4A 2G8KA 2Z1GA 4FXDA 2HHXA 2BGGA 2YNFA 1JLGA 3NF6A 3OJSA 4B9TA 4M3YA 3ZSYA 3K5OA 5CZ1A 4FJ7A 2BE2A 4CEEA 4W5TA 4BWMA 3CFPA 1T8EA 2HHQA 1L3TA 3MEDA 1NJZA 4FJKA 1IO2A 1ASVA 3E01A 4B9SA 2HB5A 3KLFA 2XHBA 1BIZA 1S1VA 4IG3A 4OLBA 1BCOA 4NCGA 4M3RA 1U45A 1BISA 1WNSA 3AVKA 3OYIA 1C6VA 2OA8A 1QE1A 1JL2A 1NK5A 4FJLA 1I3AA 4M3ZA 1NK4A 4I2PA 1IKWA 3ULDA 3C94A 4H4OA 1VSLA 5SWMA 1I39A 4CK1A 3NGZA 3HVRA 3SUOA 1NK6A 4FJHA 1VSJA 3RRGA 4LH4A 3ZSXA 2A1RA 1TL3A 3AA2A 3I8DA 3SQ0A 3SQ4A 3OYHA 5HBMA 4BWJA 2E6MA 1LAWA 3DI6A 4CIFA 1EETA 2DFEA 3SUPA 3S3MA 4CE9A 4ELTA 3K2PA 2IC3A 3EYZA 5HP1A 2ZD1A 3KD5E 3VA3A 4B3OA 2B5JA 1IH7A 4CJRA 2G8IA 2P5OA 2P51A 4CEFA 3NH0A 3NF7A 1SKSA 1QQCA 3ZSWA 3PO4A 1S9GA 1U49A 1IKYA 4KB1A 1WSJA 4E7IA 2W42A 1TKZA 2FBTA 1BI4B 3VQDA 2XO7A 3TWHA 4KHYA 1NKEA 1SKRA 1VSDA 4JLHA 1LWEA 3NCIA 1F21A 4W5QA 1C1BA 2YHBA 1KCFA 1BI4A 2IAJA 2A1SA 1EP4A 3PX4A 5D3GA 4N47A 3OYMA 1CXUA 1HYVA 3HP6A 2YNHA 1L3SA 4IBNA 1KFSA 3VQ9A 3V6DA 1JLBA 2XY8A 4CF1A 3M8PA 3EY1A 3LPUA 2KFZA 2I5JA 1KSPA 3OYJA 4ZTJA 2YKNA 3G10A 4JRPA 3OJUA 3B6OA 3T1AA 1DLOA 3MXMA 3ALYA 2E4LA 2HHTA 4DSEA 4LH5A 3VQPA 5KRSA 1VSIA 2VWKA 1TKTA 5CZ2A 4BDYA 2WOMA 2G8UA 2D5RA 2Z1HA 4PA1A 5T7BA 4Q0BA 3P83D 2HVHA 4DQQA 1LWFA 3IRXA 4Q5VA 3LZJA 1A5XA 4OKJA 4HUEA 4B8CA 4ZHRA 4CK3A 4ELUA 4CHQA 4DTJA 3ZSRA 2ZE2A 4CEBA 4CJVA 4KTQA 2KZMA 4CEDA 4TSXA 3SNNA 4B08A 3AO5A 4FK0A 3OYFA 5K14A 4DTMA 1WAFA 3VQ6A 4CJLA 4FYDA 4CIGA 4DLGA 3FFIA 4IG0A 4Z0UA 1KRPA 4IFYA 2KQ2A 3DM2A 4FLVA 4E7HA 3KIOA 2HHVA 1HNVA 1RDAA 1ZBLA 3MEGA 3L3UA 3I0SA 1RT4A 4OGEA 4KPYA 4KHWA 4RW9A 1WSEA 3V1OA 3DOKA 4CEQA 4LSNA 3RTVA 3SQ1A 3DRRA 3MXJA 4N5SA 1B92A 4N56A 4EZ9A 2YNGA 1ZYQA 4FLTA 4DSJA 2Z1JA 1BHLA 1VK0A 3IS9A 3WNFA 1S1UA 1K6YA 1YVUA 3LDSA 3U3YA 3TAMA 1C1CA 3WNGA 4BE0A 3PX6A 4O5BA 4NYFA 1JXEA 3CM6A 3L2QA 3PUFA 4O55A 3SYZA 4M3XA 4CHYA 3CFOA 4DS5A 4DFKA 3QEPA 3L2WA 4FK4A 5EU7A 3DLKA 4B9NA 3OYCA 2B6AA 1FXXA 3SCXA 4KTZA 1RDDA 1RDBA 3QINA 4RW7A 4I9QA 4HCCA 2HNZA 3AV9A 5KTQA 3RMDA 5J2MA 4FZYA 2OZSA 1WSGA 3HPGA 1IKVA 3L2RA 1TAUA 1Z26A 3NBPA 2X78A 3AA3A 3UIQA 1LWCA 1WSIA 4FJ9A 4FLXA 1U47A 4I2QA 4Z4GA 1RT1A 2WONA 4KAZA 1C0UA 3V9ZA 4YNQA 2YKMA 4HUFA 3V9SA 4OJRA 1UA1A 2O4GA 3KLHA 1YT3A 2IS3A 3ZT2A 1RTDA 3HPOA 3HP9A 4FM2A 4IKFA 3HSTB 4KKOA 3LP2A 3VQ5A 2KW4A 3KK2A 3LWLA 3K59A 1NOZA 4AHUA 1NK0A 3K5NA 3V9WA 1A5VA 3QERA 4CERA 1JLAA 1QHTA 3ASMA 3M8SA 4FZXC 4BE1A 3AO2A 3QNNA 1NK7A 2Q3SA 4RG8A 1LAVA 3O4NA 1KVCA 2Y1JA 3OYDA 1T7PA 4HCBA 4GMJB 1XC9A 3DLEA 4CHPA 3SUNA 1LW2A 1Y97A 3G0ZA 3CM5A 5FDLA 1D9DA 1BGXT 4CJ5A 2XRIA 4JS5A 3VN5A 2PZSA 4DSIA 2ZQBA 4PWDA 3HXMA 1UOCA 3LAKA 2RKIA 4IFVA 1C0MA 3AVHA 2NUBA 1VRUA 4DQSA 3D45A 1HQEA 2R7YA 3I0RA 3AVIA 3U6FA 4RW4A 4E89A 2VG7A 1SKWA 4BE2A 4KHNA 3H08A 3MECA 1N6QA 3DYAA 3S9HA 4CGDA 4DU1A 4CJUA 3OVNA 4JS4A 3V9UA 2DFFA 4LSLA 3L2UA 3IAYA 4KTWA 4CJEA 3T19A 4CIEA 3DMJA 4NCAA 2Z1IA 4CJKA 3QESA 2PYJA 2VWJA 4CGFA 3VQBA 3DLHA 4B9LA 1QS4A 1S1WA 4DFJA 2HNYA 3DRPA 5I42A 4KO0A 4MQ3A 3RMAA 4KHSA 1JKHA 4HTUA 3HYFA 3V1QA 3NFAA 3SQ2A 3AVFA 3LPTA 3P1GA 2IOCA 3OS2A 4CFAA 3HPHA 3MAQA 4KV8A 3L3VA 4B9UA 1HPZA 2XY5A 1WAJA 1J53A 4W5OA 4LY7A 4F8RA 1NJYA 5HRPA 1XHXA 3AO1A 3MXIA 3LP0A 1D8YA 3ZSOA 2D0CA 1YTAA 3C6UA 1WLJA 4E1NA 3S3NA 3OYLA 3TI0A 4DMNA 3LALA 3ZT0A 2FBVA 4OKKA 4R5PA 1HRHA 3KK1A 2F8SA 4BACA 3KLEA 4DSKA 1XHZA 1FK9A 1KFDA 1S1TA 4CJSA 4CF9A 3O3HA 4KREA 3TAPA 4M3WA 1J9AA 4DQIA 4QCLA 3F9KA 3IG1A 2GV9A 3AVGA 4DTRA 1U48A 4E19A 4AH9A 1RBUA 2HHUA 1JXBA 5HROA 1C0TA 2AJQA 3ZSZA 3ZSQA 1EXQA 1B9FA 1NKCA 4M42A 1RTJA 3LP1A 3ZSVA 1X9SA 3M8RA 2RPIA 4ID1A 2F8TA 1S5JA 2QK9A 4C8OA 3KKSA 2D0AA 1VRTA 3NGYA 5J1EA 4CJTA 2BANA 4UQGA 3OYEA 3KLGA 3L2VA 3QEXA 3SJJA 2KFNA 1S1XA 3P5JA 3T3FA 4DU4A 4CGGA 1NOYA 3TAEA 4E0DA 4CJ4A 1QSYA 4B9VA 3QIOA 1JLQA 3LZIA 3AVJA 1IKXA 2F96A 3LAMA 4CF0A 1VSHA 3SPZA 1Q9XA 4K8ZA 3AA5X 2FBYA 2FBXA 3HT3A 4Z4IA 2DY4A 3RR8A 1VSMA 2JLEA 4CJFA 4JRQA 3OY9A 3HK2A 5J2PA 4CECA 4FVMA 1Q9YA 1EKEA 3SPYA 3TR8A 4IDKA 3V81A 3QEIA 3KD1E 4CFDA 4QAGA 4C8NA 1X9WA 3OYKA 1GOCA 4CF8A 1TK5A 1IG9A 4E3SA 1TK0A 3LP3A 3KKRA 1GOAA 4J2DA 4FJ8A 3TARA 4DG1A 4DF8A 2PYLA 1ZBHA 2ITGA 1HYSA 4E7LA 1J5OA 4OLAA 4DLEA 1S9EA 5CY4A 2HHWA 3DLRA 4XIUA 3RRHA 1HMVA 3U3GA 1QTMA 4ID5A 3OYGA 1KLMA 1Q8IA 1RTIA 2VG5A 2KTQA 2YHAA 1MU2A 4E7KA 1TL1A 3V1RA 1RILA 4AHRA 3NDKA 5JS2A 1RBVA 4C8LA 4CHZA 1RT3A 2IGIA 3WNHA 4O0IA 1KVBA 5C25A 1T05A 1DTQA 1VSKA 2FC0A 3ITHA 3M8QA 4EZ6A 3NGIA 3SZ2A 4B8AB 4E1MA 2QKBA 4PUOA 3JSMA 5HLFA 3RR7A 3AVLA 4F2SA 1BL3A 3O4QA 1L3UA 4DSLA 4O0JA 4DTNA 3CG7A 3NF9A 3KJVA 2ETJA 5J2QA 4F3OA 4F3TA 1EX4A 1ASUA 2EHGA 4H4MA 4AHTA 4BDZA 1RTHA 3RWUA 1G15A 3OS1A 5KGXA 2JGUA 4DSFA 1BCMA 5FRNA 1YTUA 4KI4A 2G8VA 1J54A 4J2EA 1CLQA 1HYZA 1LW0A 4C8KA 2OZMA 3NE6A 3PY8A 4J2AA 4G1QA 4CGHA 3AVBA 3TAFA 1JLCA 3DRSA 3DLBA 1ZBUA 2ATQA 2B4JA 2OPPA 4OVLA 3DLGA 1A5WA 4FM1A 3KK3A 1LV5A 1TKDA 4C8MA 3VQ8A 4M41A 4AHVA 1RNHA 4E7JA 4AILC 2VG6A 3ZT1A 4FJ5A 4CK2A 4CEAA 4FJMA 1TV6A 4FCYA 2HHSA 2G8HA 4CJQA 4J2BA 1SUQA 1VSFA 3VQCA 4OPJA 1RT7A 4FK2A 4DU3A 3NH1A 4FJGA 5C24A 4FW2A 1L5UA 1C1AA 2G8FA 1JLFA 1WSFA 4GW6A 5J2NA 2HNDA 3L8BA 3A2FA 3V9XA 2QKKA 1SL2A 1RDCA 3NAEA 4CJPA 4FW1A 3RMBA 3VQ7A 4Z4EA 3BGRA 4KFBA 1REVA 1QSSA 3LWMA 1U4BA 1GOBA 1HQUA 3PX0A 1BQMA 4FJJA 4BDPA 2X6SA 1X9MA 2P1JA 3NH2A 3CQ8A 5KRTA 4KHUA 1TAQA 1CZBA 4FLUA 2XY6A 3KTQA 1B9DA 4FM0A 1WN7A 3VA0A 1SV5A 4DTPA 4M3UA 4DWIA 1RT2A 1UWBA 1D5AA 1BQNA 3C95A 4PY5A 1L3VA 2EX3A 4DTUA 1TVRA 5HRRA 2IDOA 3CYMA 1HNIA 4DTOA 2RF2A 3AA4A 1RT5A 3O3GA 1FKOA 3HVTA 3QLHA 3HM9A 4I7FA 1RBRA 3SV3A 1S6QA 4OKEA 4M45A 4HUGA 3HJFA 1O1WA 4FLWA 4MFBA 4Y1CA 4W5RA 4M3TA 3SV4A 1XWLA 4EP5A 1TKXA 3QIPA 2GBZA 1ITGA 3EZ5A 4OGCA 2XY7A 5FRMA 1DTTA 2OYQA 4F2RA 4DS4A 3QNOA 3SUQA 5CYMA 4OPKA 1N5YA 3OYBA 3TANA 4CGJA 4DQPA 2X74A 4NCBA 3TAQA 4KHQA 1RT6A 5CYQA 2YV0X 4KB0A 3ISNC 4DQRA 4GVMA 1SL0A 1NKBA 4HVJA 4N76A 4YFUA 4CHNA 4DTXA 1HJRA 3LANA 3AO3A 2G8WA 4RW8A 1ZBIA 2D0BA 2PY5A 3AVAA 3NHGA 4Z4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K57 A;  4AHS A;  1NK9 A;  3VQQ A;  3K5L A;  1ASW A;  2RN2 A;  1CXQ A;  3VQ4 A;  2DTU A;  3SI6 A;  2E6L A;  1RBT A;  2OPS A;  2X6N A;  3C6T A;  4Y1D A;  4CES A;  4CFB A;  5HRN A;  1JLE A;  3TAB A;  1QSL A;  4FJI A;  3VQA A;  5FRO A;  4N41 A;  1XI1 A;  2GUI A;  3AVC A;  3KLI A;  3THV A;  4CJW A;  1NK8 A;  4AHC A;  4DTS A;  3VQE A;  4CHO A;  4FZZ A;  4KRF A;  4LD0 A;  3S3O A;  3ZT3 A;  1T03 A;  4NYN A;  4HHT A;  3OS0 A;  5I3U A;  1KTQ A;  3AO4 A;  2HMI A;  3BDP A;  4PQU A;  4F4K A;  3AVN A;  1W9H A;  2YNI A;  5JS1 A;  1X1P A;  4O44 A;  4FLZ A;  3RMC A;  3PO5 A;  4EP4 A;  3K5M A;  4Z4F A;  3V4I A;  2DFH A;  4L8R B;  1WSH A;  1R0A A;  4ICL A;  5DMR A;  4CCH A;  3JYT A;  4FJX A;  1RCH A;  1FKP A;  1SL1 A;  3ZCM A;  5KGW A;  3ZT4 A;  3OYA A;  2KZZ A;  1UA0 A;  4CJ3 A;  1D9F A;  5DK5 A;  4CFC A;  4CEZ A;  1U04 A;  3QEW A;  2O4I A;  3PV8 A;  4B9M A;  2LSN A;  3DOL A;  1VSE A;  4ELV A;  1NJW A;  3OYN A;  3O3F A;  4DFM A;  2QXF A;  3F73 A;  5SZT A;  4O4G A;  1BIU A;  2HW3 A;  3HL8 A;  3QET A;  2HVI A;  4FJN A;  3B6P A;  3NF8 A;  1ZBF A;  3QEV A;  4WE1 A;  4CGI A;  2Y1I A;  1RBS A;  1KLN A;  3HO1 A;  4W5N A;  1TGO A;  3MEE A;  1JL1 A;  2OPQ A;  5KI6 A;  4KI6 A;  4QOZ B;  1UAX A;  4Z4H A;  4ZTF A;  5E41 A;  3WNE A;  1CZ9 A;  4I9L A;  3AVM A;  3TAG A;  4K8X A;  2P5G A;  2BDP A;  4CEO A;  3D0P A;  5C42 A;  5HRS A;  3K58 A;  4DFP A;  4CF2 A;  1NJX A;  4H8K A;  1S6P A;  1TK8 A;  3QO9 A;  1W0H A;  4FLY A;  2OPR A;  4RW6 A;  3CFR A;  1KVA A;  1Z25 A;  4DF4 A;  2G8K A;  2Z1G A;  4FXD A;  2HHX A;  2BGG A;  2YNF A;  1JLG A;  3NF6 A;  3OJS A;  4B9T A;  4M3Y A;  3ZSY A;  3K5O A;  5CZ1 A;  4FJ7 A;  2BE2 A;  4CEE A;  4W5T A;  4BWM A;  3CFP A;  1T8E A;  2HHQ A;  1L3T A;  3MED A;  1NJZ A;  4FJK A;  1IO2 A;  1ASV A;  3E01 A;  4B9S A;  2HB5 A;  3KLF A;  2XHB A;  1BIZ A;  1S1V A;  4IG3 A;  4OLB A;  1BCO A;  4NCG A;  4M3R A;  1U45 A;  1BIS A;  1WNS A;  3AVK A;  3OYI A;  1C6V A;  2OA8 A;  1QE1 A;  1JL2 A;  1NK5 A;  4FJL A;  1I3A A;  4M3Z A;  1NK4 A;  4I2P A;  1IKW A;  3ULD A;  3C94 A;  4H4O A;  1VSL A;  5SWM A;  1I39 A;  4CK1 A;  3NGZ A;  3HVR A;  3SUO A;  1NK6 A;  4FJH A;  1VSJ A;  3RRG A;  4LH4 A;  3ZSX A;  2A1R A;  1TL3 A;  3AA2 A;  3I8D A;  3SQ0 A;  3SQ4 A;  3OYH A;  5HBM A;  4BWJ A;  2E6M A;  1LAW A;  3DI6 A;  4CIF A;  1EET A;  2DFE A;  3SUP A;  3S3M A;  4CE9 A;  4ELT A;  3K2P A;  2IC3 A;  3EYZ A;  5HP1 A;  2ZD1 A;  3KD5 E;  3VA3 A;  4B3O A;  2B5J A;  1IH7 A;  4CJR A;  2G8I A;  2P5O A;  2P51 A;  4CEF A;  3NH0 A;  3NF7 A;  1SKS A;  1QQC A;  3ZSW A;  3PO4 A;  1S9G A;  1U49 A;  1IKY A;  4KB1 A;  1WSJ A;  4E7I A;  2W42 A;  1TKZ A;  2FBT A;  1BI4 B;  3VQD A;  2XO7 A;  3TWH A;  4KHY A;  1NKE A;  1SKR A;  1VSD A;  4JLH A;  1LWE A;  3NCI A;  1F21 A;  4W5Q A;  1C1B A;  2YHB A;  1KCF A;  1BI4 A;  2IAJ A;  2A1S A;  1EP4 A;  3PX4 A;  5D3G A;  4N47 A;  3OYM A;  1CXU A;  1HYV A;  3HP6 A;  2YNH A;  1L3S A;  4IBN A;  1KFS A;  3VQ9 A;  3V6D A;  1JLB A;  2XY8 A;  4CF1 A;  3M8P A;  3EY1 A;  3LPU A;  2KFZ A;  2I5J A;  1KSP A;  3OYJ A;  4ZTJ A;  2YKN A;  3G10 A;  4JRP A;  3OJU A;  3B6O A;  3T1A A;  1DLO A;  3MXM A;  3ALY A;  2E4L A;  2HHT A;  4DSE A;  4LH5 A;  3VQP A;  5KRS A;  1VSI A;  2VWK A;  1TKT A;  5CZ2 A;  4BDY A;  2WOM A;  2G8U A;  2D5R A;  2Z1H A;  4PA1 A;  5T7B A;  4Q0B A;  3P83 D;  2HVH A;  4DQQ A;  1LWF A;  3IRX A;  4Q5V A;  3LZJ A;  1A5X A;  4OKJ A;  4HUE A;  4B8C A;  4ZHR A;  4CK3 A;  4ELU A;  4CHQ A;  4DTJ A;  3ZSR A;  2ZE2 A;  4CEB A;  4CJV A;  4KTQ A;  2KZM A;  4CED A;  4TSX A;  3SNN A;  4B08 A;  3AO5 A;  4FK0 A;  3OYF A;  5K14 A;  4DTM A;  1WAF A;  3VQ6 A;  4CJL A;  4FYD A;  4CIG A;  4DLG A;  3FFI A;  4IG0 A;  4Z0U A;  1KRP A;  4IFY A;  2KQ2 A;  3DM2 A;  4FLV A;  4E7H A;  3KIO A;  2HHV A;  1HNV A;  1RDA A;  1ZBL A;  3MEG A;  3L3U A;  3I0S A;  1RT4 A;  4OGE A;  4KPY A;  4KHW A;  4RW9 A;  1WSE A;  3V1O A;  3DOK A;  4CEQ A;  4LSN A;  3RTV A;  3SQ1 A;  3DRR A;  3MXJ A;  4N5S A;  1B92 A;  4N56 A;  4EZ9 A;  2YNG A;  1ZYQ A;  4FLT A;  4DSJ A;  2Z1J A;  1BHL A;  1VK0 A;  3IS9 A;  3WNF A;  1S1U A;  1K6Y A;  1YVU A;  3LDS A;  3U3Y A;  3TAM A;  1C1C A;  3WNG A;  4BE0 A;  3PX6 A;  4O5B A;  4NYF A;  1JXE A;  3CM6 A;  3L2Q A;  3PUF A;  4O55 A;  3SYZ A;  4M3X A;  4CHY A;  3CFO A;  4DS5 A;  4DFK A;  3QEP A;  3L2W A;  4FK4 A;  5EU7 A;  3DLK A;  4B9N A;  3OYC A;  2B6A A;  1FXX A;  3SCX A;  4KTZ A;  1RDD A;  1RDB A;  3QIN A;  4RW7 A;  4I9Q A;  4HCC A;  2HNZ A;  3AV9 A;  5KTQ A;  3RMD A;  5J2M A;  4FZY A;  2OZS A;  1WSG A;  3HPG A;  1IKV A;  3L2R A;  1TAU A;  1Z26 A;  3NBP A;  2X78 A;  3AA3 A;  3UIQ A;  1LWC A;  1WSI A;  4FJ9 A;  4FLX A;  1U47 A;  4I2Q A;  4Z4G A;  1RT1 A;  2WON A;  4KAZ A;  1C0U A;  3V9Z A;  4YNQ A;  2YKM A;  4HUF A;  3V9S A;  4OJR A;  1UA1 A;  2O4G A;  3KLH A;  1YT3 A;  2IS3 A;  3ZT2 A;  1RTD A;  3HPO A;  3HP9 A;  4FM2 A;  4IKF A;  3HST B;  4KKO A;  3LP2 A;  3VQ5 A;  2KW4 A;  3KK2 A;  3LWL A;  3K59 A;  1NOZ A;  4AHU A;  1NK0 A;  3K5N A;  3V9W A;  1A5V A;  3QER A;  4CER A;  1JLA A;  1QHT A;  3ASM A;  3M8S A;  4FZX C;  4BE1 A;  3AO2 A;  3QNN A;  1NK7 A;  2Q3S A;  4RG8 A;  1LAV A;  3O4N A;  1KVC A;  2Y1J A;  3OYD A;  1T7P A;  4HCB A;  4GMJ B;  1XC9 A;  3DLE A;  4CHP A;  3SUN A;  1LW2 A;  1Y97 A;  3G0Z A;  3CM5 A;  5FDL A;  1D9D A;  1BGX T;  4CJ5 A;  2XRI A;  4JS5 A;  3VN5 A;  2PZS A;  4DSI A;  2ZQB A;  4PWD A;  3HXM A;  1UOC A;  3LAK A;  2RKI A;  4IFV A;  1C0M A;  3AVH A;  2NUB A;  1VRU A;  4DQS A;  3D45 A;  1HQE A;  2R7Y A;  3I0R A;  3AVI A;  3U6F A;  4RW4 A;  4E89 A;  2VG7 A;  1SKW A;  4BE2 A;  4KHN A;  3H08 A;  3MEC A;  1N6Q A;  3DYA A;  3S9H A;  4CGD A;  4DU1 A;  4CJU A;  3OVN A;  4JS4 A;  3V9U A;  2DFF A;  4LSL A;  3L2U A;  3IAY A;  4KTW A;  4CJE A;  3T19 A;  4CIE A;  3DMJ A;  4NCA A;  2Z1I A;  4CJK A;  3QES A;  2PYJ A;  2VWJ A;  4CGF A;  3VQB A;  3DLH A;  4B9L A;  1QS4 A;  1S1W A;  4DFJ A;  2HNY A;  3DRP A;  5I42 A;  4KO0 A;  4MQ3 A;  3RMA A;  4KHS A;  1JKH A;  4HTU A;  3HYF A;  3V1Q A;  3NFA A;  3SQ2 A;  3AVF A;  3LPT A;  3P1G A;  2IOC A;  3OS2 A;  4CFA A;  3HPH A;  3MAQ A;  4KV8 A;  3L3V A;  4B9U A;  1HPZ A;  2XY5 A;  1WAJ A;  1J53 A;  4W5O A;  4LY7 A;  4F8R A;  1NJY A;  5HRP A;  1XHX A;  3AO1 A;  3MXI A;  3LP0 A;  1D8Y A;  3ZSO A;  2D0C A;  1YTA A;  3C6U A;  1WLJ A;  4E1N A;  3S3N A;  3OYL A;  3TI0 A;  4DMN A;  3LAL A;  3ZT0 A;  2FBV A;  4OKK A;  4R5P A;  1HRH A;  3KK1 A;  2F8S A;  4BAC A;  3KLE A;  4DSK A;  1XHZ A;  1FK9 A;  1KFD A;  1S1T A;  4CJS A;  4CF9 A;  3O3H A;  4KRE A;  3TAP A;  4M3W A;  1J9A A;  4DQI A;  4QCL A;  3F9K A;  3IG1 A;  2GV9 A;  3AVG A;  4DTR A;  1U48 A;  4E19 A;  4AH9 A;  1RBU A;  2HHU A;  1JXB A;  5HRO A;  1C0T A;  2AJQ A;  3ZSZ A;  3ZSQ A;  1EXQ A;  1B9F A;  1NKC A;  4M42 A;  1RTJ A;  3LP1 A;  3ZSV A;  1X9S A;  3M8R A;  2RPI A;  4ID1 A;  2F8T A;  1S5J A;  2QK9 A;  4C8O A;  3KKS A;  2D0A A;  1VRT A;  3NGY A;  5J1E A;  4CJT A;  2BAN A;  4UQG A;  3OYE A;  3KLG A;  3L2V A;  3QEX A;  3SJJ A;  2KFN A;  1S1X A;  3P5J A;  3T3F A;  4DU4 A;  4CGG A;  1NOY A;  3TAE A;  4E0D A;  4CJ4 A;  1QSY A;  4B9V A;  3QIO A;  1JLQ A;  3LZI A;  3AVJ A;  1IKX A;  2F96 A;  3LAM A;  4CF0 A;  1VSH A;  3SPZ A;  1Q9X A;  4K8Z A;  3AA5 X;  2FBY A;  2FBX A;  3HT3 A;  4Z4I A;  2DY4 A;  3RR8 A;  1VSM A;  2JLE A;  4CJF A;  4JRQ A;  3OY9 A;  3HK2 A;  5J2P A;  4CEC A;  4FVM A;  1Q9Y A;  1EKE A;  3SPY A;  3TR8 A;  4IDK A;  3V81 A;  3QEI A;  3KD1 E;  4CFD A;  4QAG A;  4C8N A;  1X9W A;  3OYK A;  1GOC A;  4CF8 A;  1TK5 A;  1IG9 A;  4E3S A;  1TK0 A;  3LP3 A;  3KKR A;  1GOA A;  4J2D A;  4FJ8 A;  3TAR A;  4DG1 A;  4DF8 A;  2PYL A;  1ZBH A;  2ITG A;  1HYS A;  4E7L A;  1J5O A;  4OLA A;  4DLE A;  1S9E A;  5CY4 A;  2HHW A;  3DLR A;  4XIU A;  3RRH A;  1HMV A;  3U3G A;  1QTM A;  4ID5 A;  3OYG A;  1KLM A;  1Q8I A;  1RTI A;  2VG5 A;  2KTQ A;  2YHA A;  1MU2 A;  4E7K A;  1TL1 A;  3V1R A;  1RIL A;  4AHR A;  3NDK A;  5JS2 A;  1RBV A;  4C8L A;  4CHZ A;  1RT3 A;  2IGI A;  3WNH A;  4O0I A;  1KVB A;  5C25 A;  1T05 A;  1DTQ A;  1VSK A;  2FC0 A;  3ITH A;  3M8Q A;  4EZ6 A;  3NGI A;  3SZ2 A;  4B8A B;  4E1M A;  2QKB A;  4PUO A;  3JSM A;  5HLF A;  3RR7 A;  3AVL A;  4F2S A;  1BL3 A;  3O4Q A;  1L3U A;  4DSL A;  4O0J A;  4DTN A;  3CG7 A;  3NF9 A;  3KJV A;  2ETJ A;  5J2Q A;  4F3O A;  4F3T A;  1EX4 A;  1ASU A;  2EHG A;  4H4M A;  4AHT A;  4BDZ A;  1RTH A;  3RWU A;  1G15 A;  3OS1 A;  5KGX A;  2JGU A;  4DSF A;  1BCM A;  5FRN A;  1YTU A;  4KI4 A;  2G8V A;  1J54 A;  4J2E A;  1CLQ A;  1HYZ A;  1LW0 A;  4C8K A;  2OZM A;  3NE6 A;  3PY8 A;  4J2A A;  4G1Q A;  4CGH A;  3AVB A;  3TAF A;  1JLC A;  3DRS A;  3DLB A;  1ZBU A;  2ATQ A;  2B4J A;  2OPP A;  4OVL A;  3DLG A;  1A5W A;  4FM1 A;  3KK3 A;  1LV5 A;  1TKD A;  4C8M A;  3VQ8 A;  4M41 A;  4AHV A;  1RNH A;  4E7J A;  4AIL C;  2VG6 A;  3ZT1 A;  4FJ5 A;  4CK2 A;  4CEA A;  4FJM A;  1TV6 A;  4FCY A;  2HHS A;  2G8H A;  4CJQ A;  4J2B A;  1SUQ A;  1VSF A;  3VQC A;  4OPJ A;  1RT7 A;  4FK2 A;  4DU3 A;  3NH1 A;  4FJG A;  5C24 A;  4FW2 A;  1L5U A;  1C1A A;  2G8F A;  1JLF A;  1WSF A;  4GW6 A;  5J2N A;  2HND A;  3L8B A;  3A2F A;  3V9X A;  2QKK A;  1SL2 A;  1RDC A;  3NAE A;  4CJP A;  4FW1 A;  3RMB A;  3VQ7 A;  4Z4E A;  3BGR A;  4KFB A;  1REV A;  1QSS A;  3LWM A;  1U4B A;  1GOB A;  1HQU A;  3PX0 A;  1BQM A;  4FJJ A;  4BDP A;  2X6S A;  1X9M A;  2P1J A;  3NH2 A;  3CQ8 A;  5KRT A;  4KHU A;  1TAQ A;  1CZB A;  4FLU A;  2XY6 A;  3KTQ A;  1B9D A;  4FM0 A;  1WN7 A;  3VA0 A;  1SV5 A;  4DTP A;  4M3U A;  4DWI A;  1RT2 A;  1UWB A;  1D5A A;  1BQN A;  3C95 A;  4PY5 A;  1L3V A;  2EX3 A;  4DTU A;  1TVR A;  5HRR A;  2IDO A;  3CYM A;  1HNI A;  4DTO A;  2RF2 A;  3AA4 A;  1RT5 A;  3O3G A;  1FKO A;  3HVT A;  3QLH A;  3HM9 A;  4I7F A;  1RBR A;  3SV3 A;  1S6Q A;  4OKE A;  4M45 A;  4HUG A;  3HJF A;  1O1W A;  4FLW A;  4MFB A;  4Y1C A;  4W5R A;  4M3T A;  3SV4 A;  1XWL A;  4EP5 A;  1TKX A;  3QIP A;  2GBZ A;  1ITG A;  3EZ5 A;  4OGC A;  2XY7 A;  5FRM A;  1DTT A;  2OYQ A;  4F2R A;  4DS4 A;  3QNO A;  3SUQ A;  5CYM A;  4OPK A;  1N5Y A;  3OYB A;  3TAN A;  4CGJ A;  4DQP A;  2X74 A;  4NCB A;  3TAQ A;  4KHQ A;  1RT6 A;  5CYQ A;  2YV0 X;  4KB0 A;  3ISN C;  4DQR A;  4GVM A;  1SL0 A;  1NKB A;  4HVJ A;  4N76 A;  4YFU A;  4CHN A;  4DTX A;  1HJR A;  3LAN A;  3AO3 A;  2G8W A;  4RW8 A;  1ZBI A;  2D0B A;  2PY5 A;  3AVA A;  3NHG A;  4Z4C A; 
#chains in the Genus database with same CATH topology
 1KAY A;  1CXQ A;  3HI0 A;  3VQ4 A;  3IFR A;  4CZE A;  2OPS A;  3SI6 A;  4OLB A;  5HRN A;  1QSL A;  1JLE A;  4JKB A;  3AVC A;  4UY8 O;  4CJW A;  3GL1 A;  4IZ9 A;  4DTS A;  3VQE A;  4CHO A;  4KRF A;  3ZT3 A;  4O44 A;  3K5M A;  1H1V A;  1J6Z A;  5AQV A;  5BN9 A;  4L8R B;  2P9U A;  4MDB A;  4FWQ A;  4JI0 K;  1GLJ O;  2CGJ A;  4IO9 L;  1SL1 A;  3P38 A;  2KZZ A;  3OYA A;  4CFC A;  3QEW A;  1TYQ A;  3PV8 A;  2QXF A;  3F73 A;  2HVI A;  4O4G A;  2E8A A;  2GEL A;  3CF5 L;  3B6P A;  2E2N A;  3NF8 A;  5EVZ A;  1RBS A;  3Q7C A;  5TKY A;  1JL1 A;  5KI6 A;  4ZTF A;  4BRD A;  1CZ9 A;  3TAG A;  3WUH A;  3K58 A;  4DFP A;  2YHY A;  4IEE A;  4BQL A;  1M90 O;  4FLY A;  4RW6 A;  1KVA A;  1Z25 A;  3D2F A;  2BGG A;  3NF6 A;  1JLG A;  4B9T A;  4CEE A;  2HHQ A;  3O9S A;  4FJK A;  1OKJ A;  5BRD A;  1ASV A;  3E01 A;  1NGB A;  2QW9 A;  5HL7 L;  1U45 A;  1C6V A;  4M3Z A;  4YOY A;  3ULD A;  1MDU B;  1VSL A;  3SUO A;  2A42 A;  3EKU A;  4Y0W A;  2E6M A;  3BUZ B;  3DI6 A;  1EET A;  4CE9 A;  3Q7B A;  2QWL A;  1IH7 A;  4YOW A;  4CEF A;  1Q81 O;  3NF7 A;  4DV6 K;  1IKY A;  1YIT N;  3C7N B;  1NGG A;  3ENH A;  1TKZ A;  2E2P A;  4KHY A;  5C10 A;  1VSD A;  4JLH A;  3PIO L;  3NCI A;  2OTJ N;  2VGM A;  1F21 A;  3VF4 A;  4BRH A;  5BRE A;  3PX4 A;  3W3D A;  1JCF A;  2YNH A;  1YHQ N;  3OBY A;  2XY8 A;  1VHX A;  2KFZ A;  1NGA A;  4FOI A;  2I5J A;  1BUP A;  4JRP A;  2JWL A;  4YOU A;  2HHT A;  5KRS A;  2VWK A;  3WXK A;  2D5R A;  4PA1 A;  3QFP A;  4Q0B A;  4IJN A;  2Q1N A;  4PL7 A;  1LWF A;  3IKM A;  3IRX A;  4Q5V A;  3LZJ A;  2A6A A;  4DTJ A;  2ZE2 A;  4FPB A;  2KZM A;  3H3N O;  1MWM A;  5K14 A;  4CVN E;  4CJL A;  4DLG A;  2KQ2 A;  1XMQ K;  3THW B;  1HNV A;  3LM2 A;  1RDA A;  3MEG A;  3I0S A;  3PLA A;  2A40 A;  4FWR A;  4LSN A;  2ZJR L;  4N56 A;  4EZ9 A;  4FLT A;  2QWR A;  4H0V B;  5FPN A;  1VK0 A;  3VET A;  3L0Q A;  1S1U A;  1YVU A;  5AQK A;  3LDS A;  2QM1 A;  5GAE P;  1K8K A;  5CHI A;  3QEP A;  4DR2 K;  2H3G X;  3DLK A;  3VEW A;  4B9N A;  3THY A;  2OCE A;  2B6A A;  4IO8 A;  3R8E A;  2KLA A;  1FXX A;  3B8A X;  4KTZ A;  3CCJ N;  4GKJ K;  3QIN A;  4I9Q A;  2ASM A;  2GTD A;  2HNZ A;  5C2F A;  3HPG A;  4LC9 B;  4MLH A;  1Z26 A;  1LWC A;  1U47 A;  5JMV A;  4A2B A;  2GWJ A;  3V9Z A;  4KAZ A;  2E2Q A;  2YKM A;  4JV5 K;  1KQS M;  3QIC A;  4IKF A;  4KKO A;  3VQ5 A;  1NOZ A;  3O5B A;  1QHT A;  4BR2 A;  1K8A O;  2A41 A;  4HCB A;  3DLE A;  4B1W B;  3SUN A;  1LW2 A;  4GV6 A;  4CJ5 A;  4JS5 A;  4DSI A;  3VN5 A;  2QA4 N;  1UOC A;  1HQE A;  3EE9 A;  3VF6 A;  1SKW A;  4KHN A;  1R59 O;  3DYA A;  3S9H A;  5M1O A;  4CJU A;  3V9U A;  2DFF A;  4NCA A;  3DMJ A;  3QES A;  2QWO A;  1QS4 A;  4KO0 A;  4MQ3 A;  1JKH A;  3AVF A;  2UUC K;  1NGE A;  4B9U A;  1J53 A;  4LY7 A;  1XHX A;  3AO1 A;  4GV9 A;  4E1N A;  3TI0 A;  1LCU A;  3UE5 A;  2F8S A;  4BAC A;  4BC2 A;  1XHZ A;  1FK9 A;  1K9M O;  1NGI A;  3O3H A;  4CF9 A;  3VPZ A;  3IG1 A;  2UXB K;  3AVG A;  4YDU A;  3LDP A;  1VQ7 N;  3CQY A;  3CD6 N;  5M1N A;  1JXB A;  4EIA A;  3ZYY X;  4WQ5 A;  4IDH A;  3M8R A;  2RPI A;  4JKE A;  3OBW A;  1N32 K;  2D0A A;  3L2V A;  3MMV A;  3QEX A;  2QWN A;  1XNR K;  1S1X A;  1IG8 A;  4FPA A;  4DU4 A;  3IDH A;  1QSY A;  4XH4 A;  1Q9X A;  4K8Z A;  1YAG A;  1VQM N;  2FBX A;  5AQO A;  3T1Y K;  2DY4 A;  4Z4I A;  4BRG A;  1VSM A;  3AAQ A;  2P9P A;  5CE3 A;  3R6M A;  3OY9 A;  3QBW A;  4DR4 K;  3V81 A;  4CFD A;  4QAG A;  1HKC A;  1TK5 A;  5LL6 Z;  4J2D A;  4FWS A;  1S9E A;  3FE1 A;  3CCS N;  4ILJ A;  4ID5 A;  5AZJ B;  2Q2R A;  1KLM A;  3OYG A;  1NMD A;  5AQN A;  4JHD B;  3ULE A;  4AHR A;  1RIL A;  3ZX3 A;  2HF3 A;  4DHY A;  3TU5 A;  2BTF A;  4O0I A;  4J8F A;  4H5R A;  2RHK A;  1DTQ A;  3K0S A;  2FC0 A;  3ITH A;  3ZX2 A;  3ATV A;  3JSM A;  5HLF A;  4BG8 A;  3R3L A;  3AVL A;  4WCE L;  1Q86 O;  3MWP A;  3W0L A;  4DTN A;  5C2D A;  3KJV A;  1EO1 A;  1ASU A;  4AHT A;  4BDZ A;  1NNE A;  3OS1 A;  3DXM B;  4KI4 A;  2OZM A;  1NGC A;  3A5N C;  4JN4 A;  5LMU K;  3TAF A;  1NGJ A;  4X66 K;  3O4W A;  1ZBU A;  2DPN A;  2ATQ A;  4FM1 A;  1A5W A;  3C0B A;  4B3S K;  3KWG A;  3VQ8 A;  5AR0 A;  4AHV A;  4E7J A;  2O8B B;  2VG6 A;  2UYT A;  4FJ5 A;  4CK2 A;  4FJM A;  2VCP A;  4FCY A;  1MWK A;  2G8H A;  3VQC A;  3H1V X;  2G8F A;  1JLF A;  1WSF A;  1SL2 A;  3NAE A;  5AFU A;  4CJP A;  3RMB A;  4Z4E A;  4KFB A;  1QSS A;  4BDP A;  1YJW N;  3CQ8 A;  1TAQ A;  2GX9 A;  4IOC L;  1SQK A;  2Q0R A;  1D5A A;  4PY5 A;  4ILG B;  4YOT A;  3CC4 N;  3C7N A;  1HNI A;  1RT5 A;  2F9W A;  4BGA A;  3NMU A;  4I7F A;  3O8M A;  3SV3 A;  4OKE A;  4HUG A;  4Y1C A;  3SAG A;  1XWL A;  3EZ5 A;  2ZGZ A;  2OYQ A;  1N5Y A;  5BPN A;  3TAN A;  3MN5 A;  4LFB K;  2PFU A;  4CGJ A;  3WXJ A;  5BRF A;  4KHQ A;  3TAQ A;  2D0P A;  4JKH A;  4HVJ A;  3FGU A;  4CHN A;  3LAN A;  1IJJ A;  3AO3 A;  4O5F A;  1FW6 A;  3H46 O;  5JVG L;  2P9N B;  3K57 A;  1NK9 A;  3K5L A;  2RN2 A;  5AQH A;  4BR5 A;  2QI2 A;  3L4I A;  2X6N A;  4L3Q A;  4CES A;  4DUY K;  3TAB A;  4BC5 A;  3VQA A;  1T3V A;  3RSE B;  3FZF A;  2NRR A;  3KLI A;  3THV A;  1QVG M;  1T44 A;  3WT0 A;  1NK8 A;  1JCG A;  1BDG A;  4FZZ A;  5AQF A;  2P9K B;  4NYN A;  3OS0 A;  3A5O C;  3A5L C;  3BDP A;  4F4K A;  3AVN A;  3PO5 A;  3VF2 A;  4Z4F A;  2ASO A;  1ZBS A;  5EOY A;  1HNW K;  1U6Z A;  3JYT A;  1RCH A;  1FKP A;  4KH6 A;  3ZCM A;  1DKG D;  2YHW A;  1ZC6 A;  1UA0 A;  3D7E O;  1GLF O;  1D9F A;  4I6M A;  4IOA L;  3PSI A;  4NLC A;  1U04 A;  2UXC K;  1VSE A;  5BPM A;  3OYN A;  2HW3 A;  1BIU A;  4WE1 A;  2A5X A;  2UUA K;  4W5N A;  1TGO A;  4CZK A;  2OPQ A;  4KI6 A;  1UAX A;  4Z4H A;  2RE2 A;  5LY3 A;  1NBW A;  3J8A A;  1QZ5 A;  4K8X A;  4LFA K;  2BDP A;  4IOX A;  3HRG A;  2P9S A;  5HRS A;  5AQY A;  4CF2 A;  1TK8 A;  3N4Q A;  2OPR A;  3CFR A;  2G8K A;  4QS7 A;  2ZF5 O;  2HHX A;  3HZ6 A;  2YNF A;  4V19 S;  1ZXO A;  3OJS A;  4LF9 K;  4M3Y A;  3I33 A;  1IBL K;  4W5T A;  2O8F B;  3CCL N;  1T8E A;  5BN8 A;  1L3T A;  3MED A;  2VQE K;  1NJZ A;  1Q7Y O;  3KLF A;  2XHB A;  1YXQ A;  4CZM A;  4NCG A;  4H5V A;  2OA8 A;  1QE1 A;  1JL2 A;  4FJL A;  4PKG A;  5H1S Q;  4I2P A;  1IKW A;  4H4O A;  1NK6 A;  1GLD G;  4CK1 A;  3MX5 A;  1VSJ A;  3I8D A;  4MO4 A;  3SQ4 A;  5HBM A;  3SUP A;  1LAW A;  4CIF A;  3S3M A;  2DFE A;  5GAH P;  5M1K A;  2IC3 A;  1BU6 O;  4JK9 A;  4A2A A;  2E88 A;  2G8I A;  2P51 A;  1M1K O;  3NH0 A;  2AA4 A;  1DT9 A;  1U49 A;  4KB1 A;  4B3T K;  4E7I A;  2FBT A;  2XO7 A;  3VQD A;  1SKR A;  1LWE A;  4DV4 K;  1BI4 A;  3J80 O;  2IAJ A;  2A1S A;  1EP4 A;  4XH5 A;  5D3G A;  1ATR A;  3KK7 A;  1GLL O;  1HYV A;  1JLB A;  1NU0 A;  3AAR A;  1KSP A;  3B6O A;  1FJG K;  3LDL A;  1DLO A;  2E4L A;  3S41 A;  3VQP A;  1VSI A;  2F4V K;  4BDY A;  3FZH A;  5T7B A;  4FL9 A;  4B3R K;  1DGK N;  1T6D A;  2UUB K;  1A5X A;  1VAZ A;  3CPW M;  4ELU A;  2VGN A;  3ZSR A;  4CEB A;  4C1N I;  5FPD A;  3QDK A;  4DV7 K;  3BY5 A;  3ZET B;  3VQ6 A;  3IUC A;  3SMP A;  1GLC G;  3DM2 A;  4E7H A;  2VYP A;  3GG4 A;  3L3U A;  4OGE A;  4KHW A;  4QS8 A;  4RW9 A;  1WSE A;  3RTV A;  3C6H A;  3O9Q A;  3MXJ A;  1XMO K;  3G4S N;  4A5B A;  3MCA B;  2Q0U A;  4WQ4 C;  5ELZ A;  1K6Y A;  3U3Y A;  1C0F A;  3WNG A;  4LF8 K;  5ADX H;  3CM6 A;  1I94 K;  4M3X A;  3CME N;  4CHY A;  4NLB A;  2YHX A;  4DUZ K;  4FK4 A;  3TTF A;  2GEM A;  3CC2 N;  3L4Q A;  1BWF O;  4CI6 A;  4HCC A;  4CJ7 A;  5J2M A;  1WSG A;  5A2Q O;  1TAU A;  3NBP A;  2Q97 A;  4IXC A;  4I2Q A;  1C0U A;  4YOR A;  4HUF A;  3V9S A;  3ZLJ A;  2A3Z A;  2O4G A;  4BRP A;  1UA1 A;  4DV0 K;  3ZT2 A;  2IS3 A;  1RTD A;  3HP9 A;  3LP2 A;  2KW4 A;  3K5N A;  1A5V A;  2FF6 A;  3QER A;  4CER A;  1JLA A;  2P9I A;  3AO2 A;  4ISE A;  5DM7 L;  2Q3S A;  4O8U A;  3WXI A;  2Y1J A;  4DR6 K;  3OYD A;  3WQU A;  1XC9 A;  1X3M A;  3J7Y P;  3CM5 A;  5FDL A;  4PWD A;  4XEI A;  2RKI A;  4IFV A;  1OVQ A;  1VRU A;  1Q18 A;  3AVI A;  3WEE B;  4BE2 A;  1HR0 K;  3J7A P;  2P9L A;  3CJ7 A;  3OVN A;  3L2U A;  3IAY A;  4CJE A;  2BUP A;  4CJK A;  2VWJ A;  4WFB L;  4GVE A;  4CGF A;  3D2E A;  3L6Q A;  4BRA A;  4DFJ A;  4IJA A;  3RMA A;  5GIP A;  1SAZ A;  2YJF A;  3HYF A;  3V1Q A;  3NFA A;  3SQ2 A;  3LPT A;  1N8R O;  3P1G A;  2IOC A;  4DV2 K;  3L3V A;  2NRV A;  2ZM6 K;  4BVO A;  2HBJ A;  1NJY A;  4B9Q A;  1D8Y A;  3ZSO A;  1KXP A;  1BG3 A;  1YI2 N;  4DCH A;  3LAL A;  3ZT0 A;  2FBV A;  4R5P A;  1HRH A;  3KK1 A;  1KC8 O;  1VQ9 N;  3GE1 A;  5FLX O;  1S1T A;  3F9M A;  4KRE A;  4KH5 A;  4H5W A;  4O8K A;  3TAP A;  2QTD A;  4DQI A;  1NG9 A;  2FSK A;  1U48 A;  3I8B A;  5AQZ A;  1RBU A;  2HHU A;  2AJQ A;  4U67 L;  4FWM A;  4JEP A;  2NRH A;  1NJI O;  2WUS A;  3K9K A;  3R9P A;  3QML A;  2WFB A;  4C8O A;  3SBG A;  3NGY A;  1EWQ A;  2BAN A;  2W6L A;  3P5J A;  5C12 A;  3IMX A;  1HX1 A;  3T3F A;  4CGG A;  1NOY A;  4B9V A;  3QIO A;  1JLQ A;  2E20 A;  3AVJ A;  1IKX A;  2F96 A;  3SPZ A;  3AA5 X;  2FBY A;  3HT3 A;  5BR8 K;  1S72 N;  4CJF A;  4JRQ A;  3HK2 A;  5J2P A;  4CEC A;  4FVM A;  4JI3 K;  4JI7 K;  4H0T B;  3UKR A;  3VEY A;  1U2V A;  4DR7 K;  2WC9 A;  4OX9 K;  3CI5 A;  3OYK A;  1D4X A;  2HF4 A;  3RSE A;  3TTC A;  4E3S A;  5KPT A;  3LP3 A;  3KKR A;  1W2B M;  1HPM A;  4EFH A;  4FJ8 A;  4NO7 A;  4DG1 A;  4DF8 A;  3TAR A;  2ITG A;  4HWI A;  1J5O A;  4DLE A;  4DV5 K;  1HMV A;  4MLE A;  4CW7 B;  4JI6 K;  1GLB G;  1MU2 A;  1TL1 A;  4RWT A;  1RBV A;  4CHZ A;  5AQX A;  5C25 A;  1QVF M;  3M8Q A;  4EZ6 A;  1TUU A;  1V4S A;  2HBM A;  4GV3 A;  5MLC Q;  1BL3 A;  4JK8 A;  2ETJ A;  4BRK A;  4F3T A;  2CGL A;  1ILY A;  3RWU A;  5FRN A;  4CZF A;  1YTU A;  2JGU A;  2G8V A;  4C8K A;  4BRE A;  3PY8 A;  4G1Q A;  4CGH A;  2ZWH A;  4X62 K;  3HM8 A;  2OPP A;  4CD3 A;  3KK3 A;  4M41 A;  4LF7 K;  3E9O A;  1OH8 A;  5LJV A;  4CEA A;  4JNE A;  1TV6 A;  4J2B A;  3LDQ A;  5AQU A;  4B1Y B;  2WBN A;  1OH7 A;  4FK2 A;  4RTF D;  4DU3 A;  4JI5 K;  4JKG B;  5J2N A;  2HND A;  3THX B;  1RDC A;  1GLE G;  3VQ7 A;  3LWM A;  4GKK K;  4B3M K;  1GOB A;  1HQU A;  3PX0 A;  4FJJ A;  2X6S A;  2F7T A;  1X9M A;  1CZB A;  4FLU A;  1B9D A;  1WN7 A;  1SV5 A;  4DTP A;  4DWI A;  1BQN A;  4BR0 A;  2EX3 A;  1TVR A;  1VQK N;  3ZEU B;  5JLH A;  4DTO A;  2GUP A;  3HM9 A;  3DJC A;  1S6Q A;  1JCE A;  3QB0 A;  4M3T A;  1V4T A;  5B8H A;  2GBZ A;  4BVP A;  3T7Z A;  1DTT A;  4DS4 A;  4H03 B;  5CYM A;  5GAD P;  3EN9 A;  3ENB A;  4DQP A;  2X74 A;  3DAW A;  4H5N A;  4H0O A;  1RT6 A;  5CYQ A;  1VQ8 N;  4KB0 A;  3ISN C;  4DQR A;  3MN6 A;  3VEV A;  1SL0 A;  1NKB A;  4YFU A;  2G8W A;  3C6A A;  2O8D A;  4BRL A;  2PY5 A;  4H5T A;  3G25 A;  4AHS A;  3VQQ A;  1XC3 A;  3MCP A;  2E6L A;  4Y1D A;  4XIU A;  1YIJ N;  3TSQ A;  5FRO A;  2GUI A;  5KPR A;  3K9J A;  1VQ6 N;  3VTI A;  4BRF A;  4LD0 A;  5AQG A;  1T03 A;  4HHT A;  5I3U A;  1KTQ A;  1RGI A;  2VQF K;  1N33 K;  5JS1 A;  4KHP K;  5AJ3 K;  1X1P A;  2P9U B;  4FLZ A;  4M63 C;  3RMC A;  4EP4 A;  1G99 A;  2DFH A;  3V4I A;  1SZ2 A;  4YHH K;  5DMR A;  3CCU N;  4CCH A;  5JVH L;  4RCH A;  4A57 A;  5DK5 A;  1WBD A;  2O4I A;  3GDQ A;  4B9M A;  4EHT A;  2LSN A;  3DOL A;  5F0X A;  1NJW A;  4DFM A;  5SZT A;  3TPQ A;  3QET A;  1ZBF A;  3QEV A;  4CGI A;  4QOZ B;  4BR7 A;  5AQT A;  3WNE A;  3AVM A;  2P5G A;  2OTL N;  4CEO A;  1SS6 A;  1DEJ A;  1S6P A;  3D2F B;  1W0H A;  3CPE A;  4DF4 A;  2Z1G A;  4FXD A;  3O9R A;  3K5O A;  4FJ7 A;  3CFP A;  4BWM A;  2FSJ A;  3T69 A;  1IO2 A;  4BRM A;  1S1V A;  1WNS A;  3AVK A;  3OYI A;  1NK5 A;  2O8C B;  1I3A A;  3KZB A;  1HLU A;  5E26 A;  5EX5 A;  1I39 A;  5SWM A;  3M6G A;  4LH4 A;  2A1R A;  3AA2 A;  4JD2 B;  3KWI A;  4JI2 K;  4ELT A;  3K2P A;  3O6W A;  3EYZ A;  3CC7 N;  2ZD1 A;  4B3O A;  2B5J A;  4CJR A;  2P5O A;  3O1B A;  3WEE A;  1SKS A;  1QQC A;  2AP1 A;  3ZSW A;  1S9G A;  3JS6 A;  5I9E B;  1VQP N;  1WSJ A;  3A0I X;  3UKU B;  1JJ2 M;  3J7Z O;  2W42 A;  4F9O A;  3TWH A;  3VOV A;  1C1B A;  2YHB A;  4IWV A;  4JI1 K;  3TSP A;  4N47 A;  3OYM A;  3CCM N;  2E5L K;  1L3S A;  4IBN A;  1RFQ A;  3EY1 A;  3M8P A;  3LPU A;  4JKA A;  1RDW X;  3FZL A;  2IVP A;  5M1F A;  3RVC A;  3MXM A;  4DSE A;  1TKT A;  2G8U A;  3ATU A;  2HVH A;  4DQQ A;  4B1Z A;  5DM6 L;  4CED A;  4TSX A;  1X9J A;  3SNN A;  4B08 A;  3AO5 A;  1ATN A;  4JKD A;  4DR5 K;  3FFI A;  4IG0 A;  4IFY A;  1CZA N;  3VES A;  4KPY A;  1RT4 A;  3THW A;  4H0Y B;  4CEQ A;  3PIP L;  5TKW A;  3SQ1 A;  3DRR A;  1B92 A;  4FVU A;  2Z1J A;  1BHL A;  3WNF A;  5BPL A;  1K8K B;  1C1C A;  3TAM A;  4O5B A;  4K0K K;  4NYF A;  1JXE A;  3L2Q A;  3PUF A;  4O55 A;  4DS5 A;  1QQN A;  2HBL A;  2Q31 A;  5F2R A;  3JXU A;  3E66 A;  4LF5 K;  1RDD A;  1RDB A;  1NMN A;  1S3X A;  4CZG A;  5KTQ A;  3RMD A;  4X64 K;  3QFU A;  2OZS A;  4QS9 A;  1IKV A;  2HOE A;  1W97 L;  1WSI A;  2D0O A;  3ZX0 A;  4LF6 K;  4FJ9 A;  4Z4G A;  1RT1 A;  4FWO A;  1YVN A;  4OJR A;  3KLH A;  2ITM A;  1YT3 A;  1HNZ K;  3LWL A;  3V9W A;  4A59 A;  4WQ4 A;  3ASM A;  1RDU A;  3M8S A;  1IBM K;  4BE1 A;  1NK7 A;  3VER A;  1LAV A;  3O4N A;  1KVC A;  4IEI A;  5BR9 A;  4CHP A;  1Y97 A;  4MO5 A;  1EWR A;  4H0P A;  3WXL A;  1BGX T;  2XRI A;  2ZQB A;  4K41 A;  3LAK A;  1OH5 A;  3AVH A;  4DQS A;  5AQM A;  3D45 A;  4YOV A;  3U6F A;  4RW4 A;  2E2O A;  4DU1 A;  5AFU H;  4JS4 A;  1IV0 A;  2BH1 A;  4WF9 L;  4KTW A;  4CIE A;  3T19 A;  2Z1I A;  2PYJ A;  4B9L A;  4CBX A;  2HNY A;  3DRP A;  4KHS A;  2IVN A;  4HTU A;  3U4L A;  3OS2 A;  4CFA A;  3HPH A;  3MAQ A;  3FFK B;  4KV8 A;  3THX A;  1HPZ A;  4W5O A;  5HRP A;  3MXI A;  3C6U A;  1WLJ A;  3CJ1 A;  3S3N A;  3OYL A;  4DMN A;  1HJO A;  3MX2 A;  4M3W A;  3CQX A;  3M1F A;  1J9A A;  3O08 A;  3F9K A;  2GV9 A;  4DTR A;  4E19 A;  4AM6 A;  1C0T A;  4BRN A;  4DR3 K;  3ZSZ A;  3ZSQ A;  1EXQ A;  1B9F A;  4M42 A;  3LP1 A;  3ZSV A;  3VGK A;  1X9S A;  4HTL A;  4ID1 A;  1VQO N;  3FLC O;  3KKS A;  1VRT A;  4UQG A;  3OYE A;  2F8T A;  2KFN A;  3SJJ A;  5F1X A;  3CMA N;  4JI8 K;  3O9T A;  4OPA A;  2P9P B;  4Z94 A;  2CH6 A;  3LZI A;  3LAM A;  4CF0 A;  1VSH A;  3RR8 A;  2JLE A;  4FWP A;  2W41 A;  3SAH A;  1EKE A;  4IDK A;  5AQJ A;  4AF1 A;  3TSU A;  1P8Z A;  3F5T A;  4C8N A;  1X9W A;  1GOC A;  1GOA A;  4YOX A;  1HYS A;  4BRO A;  1WBB A;  3AY9 A;  4E7L A;  4K43 A;  5CY4 A;  3RRH A;  3U3G A;  1QTM A;  4FO0 A;  3ULE B;  4PHT X;  2VG5 A;  2KTQ A;  4FWL A;  1VQN N;  2YHA A;  1LOT B;  4EHU A;  3LDO A;  5AZJ A;  4LFC K;  3V1R A;  3U8X A;  1YJN N;  3CCV N;  4C8L A;  4BY9 C;  1RT3 A;  4JHD A;  3WNH A;  1KVB A;  1T05 A;  3CIP A;  3NGI A;  3SZ2 A;  4B8A B;  3A5M C;  4PUO A;  3P39 A;  2D4W A;  3N4P A;  5M1P A;  3VEX A;  4NB4 A;  3O4Q A;  4ISF A;  2I7N A;  3WXM B;  4B1V A;  2V7Z A;  2EHG A;  4H4M A;  3QBX A;  1G15 A;  5KGX A;  2I7P A;  1BCM A;  4LF4 K;  4J2E A;  1IBK K;  1CLQ A;  1LW0 A;  3DXM A;  4J2A A;  3DRS A;  4BR4 A;  2B4J A;  3J81 O;  1VQL N;  1LV5 A;  1TKD A;  4C8M A;  4AIL C;  5GAG P;  3ZT1 A;  3E9L A;  3BF3 A;  2J4R A;  2NLX A;  2HHS A;  2O8B A;  1C0G A;  1VSF A;  4FJG A;  2PAV A;  5C24 A;  1C1A A;  2O8C A;  4GW6 A;  3A2F A;  3V9X A;  2QKK A;  5AQW A;  4FW1 A;  1EQY A;  3BGR A;  3SAF A;  1U4B A;  4JD2 A;  1BQM A;  4KHU A;  3NH2 A;  1E4G T;  5GIO A;  4FM0 A;  4M7Y A;  1XUP O;  1RT2 A;  2QWQ A;  3T1H K;  4CZI A;  5HRR A;  3CYM A;  4H0X B;  3UKU A;  1WUA A;  2RF2 A;  3AA4 A;  3O3G A;  3EEQ A;  3HVT A;  5AQQ A;  1BA1 A;  3PSF A;  3O1W A;  3HBT A;  3VMF B;  4DQ8 A;  3HJF A;  4M45 A;  3P4I A;  1O1W A;  3SBT A;  4FLW A;  5FPE A;  2HST A;  4BG9 A;  1TKX A;  4WYB A;  1ITG A;  4OGC A;  2XY7 A;  5FRM A;  4OPH A;  3OYB A;  4NCB A;  1N34 K;  4M7X A;  4XH1 A;  2YI1 A;  2FLO A;  3H45 C;  4GVM A;  2WTU A;  1ZBI A;  3UB5 A;  4DTX A;  1HJR A;  4RW8 A;  2O8E B;  2D0B A;  4R79 A;  4Z4C A;  3NHG A;  1ATS A;  1ASW A;  2DTU A;  4YY3 K;  1RBT A;  2P9N A;  3C6T A;  5E84 A;  4CFB A;  4FJI A;  5KPZ A;  2IVO A;  1P90 A;  2HMP A;  4N41 A;  3U9Z A;  1XI1 A;  3SK3 A;  4AHC A;  3CXC M;  1TUY A;  3HTV A;  3CET A;  3BZK A;  2FSN A;  3S3O A;  4WFN L;  1BA0 A;  4PQU A;  3AO4 A;  2ZGY A;  2HMI A;  2P9K A;  5HOO A;  1W9H A;  2YNI A;  3DLL L;  5BRH A;  1YJ9 N;  4BRC A;  1WSH A;  1R0A A;  4ICL A;  4FJX A;  4I6M B;  5KGW A;  3ZT4 A;  4CJ3 A;  3BF1 A;  3KVG A;  4CD1 A;  4FWN A;  3OHR A;  4CEZ A;  2NRT A;  4ELV A;  3O3F A;  4BC4 A;  3HL8 A;  4BC3 A;  4FJN A;  3EE8 A;  4BGB A;  4BRQ A;  2Y1I A;  4G9Z A;  3CCR N;  1KLN A;  3HO1 A;  1KAX A;  3MEE A;  1MA9 B;  2NRX A;  2PBD A;  1E3M A;  3DWL A;  2P9S B;  5E41 A;  4I9L A;  3D0P A;  5C42 A;  1NJX A;  4H8K A;  2F9T A;  4DR1 K;  3QO9 A;  1W7A A;  3ZSY A;  5CZ1 A;  2BE2 A;  2IIR A;  2V7Y A;  5GIN A;  4DV1 K;  3E9P A;  4B9S A;  2HB5 A;  2O8F A;  5FPM A;  1BIZ A;  3H6E A;  3HSC A;  3CHW A;  1Q82 O;  4IG3 A;  1BCO A;  5AZI B;  4M3R A;  1BIS A;  3FZM A;  1NK4 A;  3C94 A;  3F2K A;  3HVR A;  3NGZ A;  4FJH A;  3RRG A;  3ZSX A;  1TL3 A;  3DXK B;  2QEX N;  3SQ0 A;  3OYH A;  4BWJ A;  2KKZ A;  1WOQ A;  5HP1 A;  3CJ9 A;  3KD5 E;  3VA3 A;  3SMS A;  3I56 N;  4ILH A;  1NGF A;  3GBT A;  3PO4 A;  1BI4 B;  1NKE A;  3OA9 A;  5EY4 A;  4W5Q A;  4BQZ A;  1KCF A;  4FOE A;  1Z05 A;  3AGR A;  4PL8 A;  4CZH A;  1CXU A;  3HP6 A;  1KFS A;  3VQ9 A;  3ID8 A;  3V6D A;  4CF1 A;  3OYJ A;  4ZTJ A;  2YCH A;  2YKN A;  3G10 A;  3OJU A;  3T1A A;  3ALY A;  2E1Z A;  4LH5 A;  4K25 A;  5CZ2 A;  2WOM A;  2Z1H A;  3P83 D;  4OKJ A;  4HUE A;  1K73 O;  4B8C A;  4ZHR A;  4CK3 A;  4PKI A;  1Z6R A;  3AGK A;  3E1Y A;  4CHQ A;  4KTQ A;  4CJV A;  1NM1 A;  2FF3 B;  5C0Y A;  4FK0 A;  3OYF A;  4DTM A;  1WAF A;  3I55 N;  3EKS A;  2QWP A;  4FYD A;  3ZET A;  4CIG A;  4Z0U A;  5JIC A;  1KRP A;  4C23 A;  1XNQ K;  4JI4 K;  3VEZ A;  4FLV A;  3KIO A;  2HHV A;  1ZBL A;  5AQR A;  1O13 A;  3V1O A;  3DOK A;  4C1N K;  3OW2 M;  2V52 B;  4N5S A;  3HOT A;  2YNG A;  1ZYQ A;  4DSJ A;  3CER A;  1S22 A;  3AAP A;  3IS9 A;  3P31 A;  3EZW A;  1J5E K;  1TYQ B;  4BE0 A;  3PX6 A;  3SYZ A;  3CFO A;  4DFK A;  4DV3 K;  3M3Z A;  5M1Q A;  3L2W A;  3MN7 A;  5EU7 A;  3NVM A;  1KD1 O;  3OYC A;  2D1K A;  1NWK A;  3HOS A;  3SCX A;  4RW7 A;  3OTO K;  3AV9 A;  4FZY A;  2W6K A;  3L2R A;  2X78 A;  3AA3 A;  4K42 A;  3UIQ A;  4AQY K;  1ESV A;  4FLX A;  2WON A;  1QZ6 A;  4YNQ A;  3D6R A;  3JAM O;  1NGD A;  2ASP A;  4JKF A;  3HPO A;  4FM2 A;  3HST B;  3KK2 A;  3K59 A;  4AHU A;  2P9I B;  1NK0 A;  4OO1 J;  1YF5 L;  4FZX C;  5IWA K;  3QNN A;  2YJE A;  4BR9 A;  4RG8 A;  1T7P A;  4GMJ B;  4A61 A;  1E4F T;  3FR0 A;  3G0Z A;  1QHA A;  5AQS A;  3VGM A;  4BRI A;  1D9D A;  4EAH D;  2PZS A;  4CZJ A;  3HXM A;  1C0M A;  2NUB A;  3CCE N;  2P9L B;  2R7Y A;  3I0R A;  2NZT A;  4E89 A;  2VG7 A;  4X65 K;  4ISG A;  4YDU C;  3H08 A;  3CJB A;  3VTH A;  4CZL A;  3MEC A;  1N6Q A;  4CGD A;  1HKB A;  3D2E B;  3BEX A;  4LSL A;  4WQ5 C;  5JLF A;  3H3O B;  4DB3 A;  3VQB A;  3U9D A;  3DLH A;  1S1W A;  4DKW A;  3CJC A;  5I42 A;  3C65 A;  2YX6 A;  4FWK A;  3TTD A;  4E1J A;  2HHH K;  1BO5 O;  3MK6 A;  2XY5 A;  1WAJ A;  4F8R A;  3LP0 A;  2D0C A;  1YTA A;  4OKK A;  3CJA A;  3EO3 A;  3KLE A;  4DSK A;  1KFD A;  1NGH A;  4CJS A;  1QQO A;  2QXL A;  4FSV A;  4QCL A;  4AH9 A;  3MWT A;  3KHY A;  2EWS A;  5HRO A;  2FXU A;  1NKC A;  2NRW A;  1RTJ A;  2GWK A;  3O80 A;  4KBO A;  1S5J A;  2QK9 A;  1OVY A;  5J1E A;  4CJT A;  3G6E N;  3KLG A;  2ZJP L;  3EL2 A;  4E0D A;  3TAE A;  4CJ4 A;  4GNI A;  1XQS C;  2O8E A;  2VWB A;  2W40 A;  4NXM K;  1YUW A;  3M5R A;  1VQ4 N;  3UKR B;  1U2V B;  1Q9Y A;  4WFA L;  3SPY A;  3TR8 A;  3LDN A;  3SLC A;  5AQI A;  3KD1 E;  3QEI A;  4CBW A;  3THY B;  4CF8 A;  1IG9 A;  1TK0 A;  2HBK A;  1ZBH A;  2PYL A;  4OLA A;  5ADX A;  2HHW A;  2E1Y A;  3DLR A;  3MN9 A;  3G71 N;  1N36 K;  4GY2 B;  3BP8 A;  1HUX A;  1WB9 A;  1Q8I A;  1RTI A;  3WQT A;  5CR4 A;  4E7K A;  3NDK A;  5JS2 A;  3ID6 A;  2QWM A;  2IGI A;  3GOI A;  5LJW A;  1VSK A;  3ENO A;  4NXN K;  1HNX K;  4E1M A;  4JYA K;  3LL3 A;  2QKB A;  3RR7 A;  5LMN K;  2UXD K;  4F2S A;  1L3U A;  5C15 A;  4DSL A;  4O0J A;  3CG7 A;  2Q36 A;  2UU9 K;  3NF9 A;  5J2Q A;  4F3O A;  1NLV A;  1EX4 A;  4U7B A;  1RTH A;  1Y64 A;  4DSF A;  3CCQ N;  4JAX A;  1J54 A;  2KHO A;  1HYZ A;  3NE6 A;  4IFE A;  3AVB A;  1JLC A;  1KAZ A;  2NNW A;  4JK7 A;  3DLB A;  5IT9 O;  2CH5 A;  4OVL A;  3DLG A;  5KQD A;  1X3N A;  5KQ8 A;  3BZC A;  1RNH A;  5AQP A;  4A5A A;  1QQM A;  4MDA A;  3SJH A;  1T6C A;  3NVK A;  4CJQ A;  3VGL A;  4PKH A;  1SUQ A;  4OPJ A;  1RT7 A;  5AZI A;  3NH1 A;  1L5U A;  4FW2 A;  2OAN A;  3L8B A;  1HKG A;  4JKG A;  2NRZ A;  3MDQ A;  1REV A;  3DXK A;  3VEO A;  2CGK A;  1VQ5 N;  2P1J A;  3LM9 A;  5KRT A;  2XY6 A;  3KTQ A;  4KH4 A;  3A8Y A;  3VA0 A;  4M3U A;  1UWB A;  3C95 A;  3VEN A;  2ZJQ L;  1L3V A;  4DTU A;  1BOT O;  2IDO A;  1GLA G;  1FKO A;  3QLH A;  4CBU A;  1RBR A;  2V51 B;  3ZEU A;  5EXW A;  4MFB A;  4W5R A;  3R1X A;  3SV4 A;  4EP5 A;  3QIP A;  4B1X B;  4F2R A;  3QNO A;  3SUQ A;  2JWK A;  3O9U A;  4B1U B;  4OPK A;  1OH6 A;  3H1Q A;  2YV0 X;  2O8D B;  4N76 A;  4AM7 A;  4JKC A;  3FZK A;  5AQL A;  3AVA A;  4A62 A; 
#chains in the Genus database with same CATH homology
 3K57 A;  4AHS A;  1NK9 A;  3VQQ A;  3K5L A;  1ASW A;  2RN2 A;  1CXQ A;  3VQ4 A;  2DTU A;  3SI6 A;  2E6L A;  1RBT A;  2OPS A;  2X6N A;  3C6T A;  4Y1D A;  4CES A;  4CFB A;  5HRN A;  1JLE A;  3TAB A;  1QSL A;  4FJI A;  3VQA A;  5FRO A;  4N41 A;  1XI1 A;  2GUI A;  3AVC A;  3KLI A;  3THV A;  4CJW A;  1NK8 A;  4AHC A;  4DTS A;  3VQE A;  4CHO A;  4FZZ A;  4KRF A;  4LD0 A;  3S3O A;  3ZT3 A;  1T03 A;  4NYN A;  4HHT A;  3OS0 A;  5I3U A;  1KTQ A;  3AO4 A;  2HMI A;  3BDP A;  4PQU A;  4F4K A;  3AVN A;  1W9H A;  2YNI A;  5JS1 A;  1X1P A;  4O44 A;  4FLZ A;  3RMC A;  3PO5 A;  4EP4 A;  3K5M A;  4Z4F A;  3V4I A;  2DFH A;  4L8R B;  1WSH A;  1R0A A;  4ICL A;  5DMR A;  4CCH A;  3JYT A;  4FJX A;  1RCH A;  1FKP A;  1SL1 A;  3ZCM A;  5KGW A;  3ZT4 A;  3OYA A;  2KZZ A;  1UA0 A;  4CJ3 A;  1D9F A;  5DK5 A;  4CFC A;  4CEZ A;  1U04 A;  3QEW A;  2O4I A;  3PV8 A;  4B9M A;  2LSN A;  3DOL A;  1VSE A;  4ELV A;  1NJW A;  3OYN A;  3O3F A;  4DFM A;  2QXF A;  3F73 A;  5SZT A;  4O4G A;  1BIU A;  2HW3 A;  3HL8 A;  3QET A;  2HVI A;  4FJN A;  3B6P A;  3NF8 A;  1ZBF A;  3QEV A;  4WE1 A;  4CGI A;  2Y1I A;  1RBS A;  1KLN A;  3HO1 A;  4W5N A;  1TGO A;  3MEE A;  1JL1 A;  2OPQ A;  5KI6 A;  4KI6 A;  4QOZ B;  1UAX A;  4Z4H A;  4ZTF A;  5E41 A;  3WNE A;  1CZ9 A;  4I9L A;  3AVM A;  3TAG A;  4K8X A;  2P5G A;  2BDP A;  4CEO A;  3D0P A;  5C42 A;  5HRS A;  3K58 A;  4DFP A;  4CF2 A;  1NJX A;  4H8K A;  1S6P A;  1TK8 A;  3QO9 A;  1W0H A;  4FLY A;  2OPR A;  4RW6 A;  3CFR A;  1KVA A;  1Z25 A;  4DF4 A;  2G8K A;  2Z1G A;  4FXD A;  2HHX A;  2BGG A;  2YNF A;  1JLG A;  3NF6 A;  3OJS A;  4B9T A;  4M3Y A;  3ZSY A;  3K5O A;  5CZ1 A;  4FJ7 A;  2BE2 A;  4CEE A;  4W5T A;  4BWM A;  3CFP A;  1T8E A;  2HHQ A;  1L3T A;  3MED A;  1NJZ A;  4FJK A;  1IO2 A;  1ASV A;  3E01 A;  4B9S A;  2HB5 A;  3KLF A;  2XHB A;  1BIZ A;  1S1V A;  4IG3 A;  4OLB A;  1BCO A;  4NCG A;  4M3R A;  1U45 A;  1BIS A;  1WNS A;  3AVK A;  3OYI A;  1C6V A;  2OA8 A;  1QE1 A;  1JL2 A;  1NK5 A;  4FJL A;  1I3A A;  4M3Z A;  1NK4 A;  4I2P A;  1IKW A;  3ULD A;  3C94 A;  4H4O A;  1VSL A;  5SWM A;  1I39 A;  4CK1 A;  3NGZ A;  3HVR A;  3SUO A;  1NK6 A;  4FJH A;  1VSJ A;  3RRG A;  4LH4 A;  3ZSX A;  2A1R A;  1TL3 A;  3AA2 A;  3I8D A;  3SQ0 A;  3SQ4 A;  3OYH A;  5HBM A;  4BWJ A;  2E6M A;  1LAW A;  3DI6 A;  4CIF A;  1EET A;  2DFE A;  3SUP A;  3S3M A;  4CE9 A;  4ELT A;  3K2P A;  2IC3 A;  3EYZ A;  5HP1 A;  2ZD1 A;  3KD5 E;  3VA3 A;  4B3O A;  2B5J A;  1IH7 A;  4CJR A;  2G8I A;  2P5O A;  2P51 A;  4CEF A;  3NH0 A;  3NF7 A;  1SKS A;  1QQC A;  3ZSW A;  3PO4 A;  1S9G A;  1U49 A;  1IKY A;  4KB1 A;  1WSJ A;  4E7I A;  2W42 A;  1TKZ A;  2FBT A;  1BI4 B;  3VQD A;  2XO7 A;  3TWH A;  4KHY A;  1NKE A;  1SKR A;  1VSD A;  4JLH A;  1LWE A;  3NCI A;  1F21 A;  4W5Q A;  1C1B A;  2YHB A;  1KCF A;  1BI4 A;  2IAJ A;  2A1S A;  1EP4 A;  3PX4 A;  5D3G A;  4N47 A;  3OYM A;  1CXU A;  1HYV A;  3HP6 A;  2YNH A;  1L3S A;  4IBN A;  1KFS A;  3VQ9 A;  3V6D A;  1JLB A;  2XY8 A;  4CF1 A;  3M8P A;  3EY1 A;  3LPU A;  2KFZ A;  2I5J A;  1KSP A;  3OYJ A;  4ZTJ A;  2YKN A;  3G10 A;  4JRP A;  3OJU A;  3B6O A;  3T1A A;  1DLO A;  3MXM A;  3ALY A;  2E4L A;  2HHT A;  4DSE A;  4LH5 A;  3VQP A;  5KRS A;  1VSI A;  2VWK A;  1TKT A;  5CZ2 A;  4BDY A;  2WOM A;  2G8U A;  2D5R A;  2Z1H A;  4PA1 A;  5T7B A;  4Q0B A;  3P83 D;  2HVH A;  4DQQ A;  1LWF A;  3IRX A;  4Q5V A;  3LZJ A;  1A5X A;  4OKJ A;  4HUE A;  4B8C A;  4ZHR A;  4CK3 A;  4ELU A;  4CHQ A;  4DTJ A;  3ZSR A;  2ZE2 A;  4CEB A;  4CJV A;  4KTQ A;  2KZM A;  4CED A;  4TSX A;  3SNN A;  4B08 A;  3AO5 A;  4FK0 A;  3OYF A;  5K14 A;  4DTM A;  1WAF A;  3VQ6 A;  4CJL A;  4FYD A;  4CIG A;  4DLG A;  3FFI A;  4IG0 A;  4Z0U A;  1KRP A;  4IFY A;  2KQ2 A;  3DM2 A;  4FLV A;  4E7H A;  3KIO A;  2HHV A;  1HNV A;  1RDA A;  1ZBL A;  3MEG A;  3L3U A;  3I0S A;  1RT4 A;  4OGE A;  4KPY A;  4KHW A;  4RW9 A;  1WSE A;  3V1O A;  3DOK A;  4CEQ A;  4LSN A;  3RTV A;  3SQ1 A;  3DRR A;  3MXJ A;  4N5S A;  1B92 A;  4N56 A;  4EZ9 A;  2YNG A;  1ZYQ A;  4FLT A;  4DSJ A;  2Z1J A;  1BHL A;  1VK0 A;  3IS9 A;  3WNF A;  1S1U A;  1K6Y A;  1YVU A;  3LDS A;  3U3Y A;  3TAM A;  1C1C A;  3WNG A;  4BE0 A;  3PX6 A;  4O5B A;  4NYF A;  1JXE A;  3CM6 A;  3L2Q A;  3PUF A;  4O55 A;  3SYZ A;  4M3X A;  4CHY A;  3CFO A;  4DS5 A;  4DFK A;  3QEP A;  3L2W A;  4FK4 A;  5EU7 A;  3DLK A;  4B9N A;  3OYC A;  2B6A A;  1FXX A;  3SCX A;  4KTZ A;  1RDD A;  1RDB A;  3QIN A;  4RW7 A;  4I9Q A;  4HCC A;  2HNZ A;  3AV9 A;  5KTQ A;  3RMD A;  5J2M A;  4FZY A;  2OZS A;  1WSG A;  3HPG A;  1IKV A;  3L2R A;  1TAU A;  1Z26 A;  3NBP A;  2X78 A;  3AA3 A;  3UIQ A;  1LWC A;  1WSI A;  4FJ9 A;  4FLX A;  1U47 A;  4I2Q A;  4Z4G A;  1RT1 A;  2WON A;  4KAZ A;  1C0U A;  3V9Z A;  4YNQ A;  2YKM A;  4HUF A;  3V9S A;  4OJR A;  1UA1 A;  2O4G A;  3KLH A;  1YT3 A;  2IS3 A;  3ZT2 A;  1RTD A;  3HPO A;  3HP9 A;  4FM2 A;  4IKF A;  3HST B;  4KKO A;  3LP2 A;  3VQ5 A;  2KW4 A;  3KK2 A;  3LWL A;  3K59 A;  1NOZ A;  4AHU A;  1NK0 A;  3K5N A;  3V9W A;  1A5V A;  3QER A;  4CER A;  1JLA A;  1QHT A;  3ASM A;  3M8S A;  4FZX C;  4BE1 A;  3AO2 A;  3QNN A;  1NK7 A;  2Q3S A;  4RG8 A;  1LAV A;  3O4N A;  1KVC A;  2Y1J A;  3OYD A;  1T7P A;  4HCB A;  4GMJ B;  1XC9 A;  3DLE A;  4CHP A;  3SUN A;  1LW2 A;  1Y97 A;  3G0Z A;  3CM5 A;  5FDL A;  1D9D A;  1BGX T;  4CJ5 A;  2XRI A;  4JS5 A;  3VN5 A;  2PZS A;  4DSI A;  2ZQB A;  4PWD A;  3HXM A;  1UOC A;  3LAK A;  2RKI A;  4IFV A;  1C0M A;  3AVH A;  2NUB A;  1VRU A;  4DQS A;  3D45 A;  1HQE A;  2R7Y A;  3I0R A;  3AVI A;  3U6F A;  4RW4 A;  4E89 A;  2VG7 A;  1SKW A;  4BE2 A;  4KHN A;  3H08 A;  3MEC A;  1N6Q A;  3DYA A;  3S9H A;  4CGD A;  4DU1 A;  4CJU A;  3OVN A;  4JS4 A;  3V9U A;  2DFF A;  4LSL A;  3L2U A;  3IAY A;  4KTW A;  4CJE A;  3T19 A;  4CIE A;  3DMJ A;  4NCA A;  2Z1I A;  4CJK A;  3QES A;  2PYJ A;  2VWJ A;  4CGF A;  3VQB A;  3DLH A;  4B9L A;  1QS4 A;  1S1W A;  4DFJ A;  2HNY A;  3DRP A;  5I42 A;  4KO0 A;  4MQ3 A;  3RMA A;  4KHS A;  1JKH A;  4HTU A;  3HYF A;  3V1Q A;  3NFA A;  3SQ2 A;  3AVF A;  3LPT A;  3P1G A;  2IOC A;  3OS2 A;  4CFA A;  3HPH A;  3MAQ A;  4KV8 A;  3L3V A;  4B9U A;  1HPZ A;  2XY5 A;  1WAJ A;  1J53 A;  4W5O A;  4LY7 A;  4F8R A;  1NJY A;  5HRP A;  1XHX A;  3AO1 A;  3MXI A;  3LP0 A;  1D8Y A;  3ZSO A;  2D0C A;  1YTA A;  3C6U A;  1WLJ A;  4E1N A;  3S3N A;  3OYL A;  3TI0 A;  4DMN A;  3LAL A;  3ZT0 A;  2FBV A;  4OKK A;  4R5P A;  1HRH A;  3KK1 A;  2F8S A;  4BAC A;  3KLE A;  4DSK A;  1XHZ A;  1FK9 A;  1KFD A;  1S1T A;  4CJS A;  4CF9 A;  3O3H A;  4KRE A;  3TAP A;  4M3W A;  1J9A A;  4DQI A;  4QCL A;  3F9K A;  3IG1 A;  2GV9 A;  3AVG A;  4DTR A;  1U48 A;  4E19 A;  4AH9 A;  1RBU A;  2HHU A;  1JXB A;  5HRO A;  1C0T A;  2AJQ A;  3ZSZ A;  3ZSQ A;  1EXQ A;  1B9F A;  1NKC A;  4M42 A;  1RTJ A;  3LP1 A;  3ZSV A;  1X9S A;  3M8R A;  2RPI A;  4ID1 A;  2F8T A;  1S5J A;  2QK9 A;  4C8O A;  3KKS A;  2D0A A;  1VRT A;  3NGY A;  5J1E A;  4CJT A;  2BAN A;  4UQG A;  3OYE A;  3KLG A;  3L2V A;  3QEX A;  3SJJ A;  2KFN A;  1S1X A;  3P5J A;  3T3F A;  4DU4 A;  4CGG A;  1NOY A;  3TAE A;  4E0D A;  4CJ4 A;  1QSY A;  4B9V A;  3QIO A;  1JLQ A;  3LZI A;  3AVJ A;  1IKX A;  2F96 A;  3LAM A;  4CF0 A;  1VSH A;  3SPZ A;  1Q9X A;  4K8Z A;  3AA5 X;  2FBY A;  2FBX A;  3HT3 A;  4Z4I A;  2DY4 A;  3RR8 A;  1VSM A;  2JLE A;  4CJF A;  4JRQ A;  3OY9 A;  3HK2 A;  5J2P A;  4CEC A;  4FVM A;  1Q9Y A;  1EKE A;  3SPY A;  3TR8 A;  4IDK A;  3V81 A;  3QEI A;  3KD1 E;  4CFD A;  4QAG A;  4C8N A;  1X9W A;  3OYK A;  1GOC A;  4CF8 A;  1TK5 A;  1IG9 A;  4E3S A;  1TK0 A;  3LP3 A;  3KKR A;  1GOA A;  4J2D A;  4FJ8 A;  3TAR A;  4DG1 A;  4DF8 A;  2PYL A;  1ZBH A;  2ITG A;  1HYS A;  4E7L A;  1J5O A;  4OLA A;  4DLE A;  1S9E A;  5CY4 A;  2HHW A;  3DLR A;  4XIU A;  3RRH A;  1HMV A;  3U3G A;  1QTM A;  4ID5 A;  3OYG A;  1KLM A;  1Q8I A;  1RTI A;  2VG5 A;  2KTQ A;  2YHA A;  1MU2 A;  4E7K A;  1TL1 A;  3V1R A;  1RIL A;  4AHR A;  3NDK A;  5JS2 A;  1RBV A;  4C8L A;  4CHZ A;  1RT3 A;  2IGI A;  3WNH A;  4O0I A;  1KVB A;  5C25 A;  1T05 A;  1DTQ A;  1VSK A;  2FC0 A;  3ITH A;  3M8Q A;  4EZ6 A;  3NGI A;  3SZ2 A;  4B8A B;  4E1M A;  2QKB A;  4PUO A;  3JSM A;  5HLF A;  3RR7 A;  3AVL A;  4F2S A;  1BL3 A;  3O4Q A;  1L3U A;  4DSL A;  4O0J A;  4DTN A;  3CG7 A;  3NF9 A;  3KJV A;  2ETJ A;  5J2Q A;  4F3O A;  4F3T A;  1EX4 A;  1ASU A;  2EHG A;  4H4M A;  4AHT A;  4BDZ A;  1RTH A;  3RWU A;  1G15 A;  3OS1 A;  5KGX A;  2JGU A;  4DSF A;  1BCM A;  5FRN A;  1YTU A;  4KI4 A;  2G8V A;  1J54 A;  4J2E A;  1CLQ A;  1HYZ A;  1LW0 A;  4C8K A;  2OZM A;  3NE6 A;  3PY8 A;  4J2A A;  4G1Q A;  4CGH A;  3AVB A;  3TAF A;  1JLC A;  3DRS A;  3DLB A;  1ZBU A;  2ATQ A;  2B4J A;  2OPP A;  4OVL A;  3DLG A;  1A5W A;  4FM1 A;  3KK3 A;  1LV5 A;  1TKD A;  4C8M A;  3VQ8 A;  4M41 A;  4AHV A;  1RNH A;  4E7J A;  4AIL C;  2VG6 A;  3ZT1 A;  4FJ5 A;  4CK2 A;  4CEA A;  4FJM A;  1TV6 A;  4FCY A;  2HHS A;  2G8H A;  4CJQ A;  4J2B A;  1SUQ A;  1VSF A;  3VQC A;  4OPJ A;  1RT7 A;  4FK2 A;  4DU3 A;  3NH1 A;  4FJG A;  5C24 A;  4FW2 A;  1L5U A;  1C1A A;  2G8F A;  1JLF A;  1WSF A;  4GW6 A;  5J2N A;  2HND A;  3L8B A;  3A2F A;  3V9X A;  2QKK A;  1SL2 A;  1RDC A;  3NAE A;  4CJP A;  4FW1 A;  3RMB A;  3VQ7 A;  4Z4E A;  3BGR A;  4KFB A;  1REV A;  1QSS A;  3LWM A;  1U4B A;  1GOB A;  1HQU A;  3PX0 A;  1BQM A;  4FJJ A;  4BDP A;  2X6S A;  1X9M A;  2P1J A;  3NH2 A;  3CQ8 A;  5KRT A;  4KHU A;  1TAQ A;  1CZB A;  4FLU A;  2XY6 A;  3KTQ A;  1B9D A;  4FM0 A;  1WN7 A;  3VA0 A;  1SV5 A;  4DTP A;  4M3U A;  4DWI A;  1RT2 A;  1UWB A;  1D5A A;  1BQN A;  3C95 A;  4PY5 A;  1L3V A;  2EX3 A;  4DTU A;  1TVR A;  5HRR A;  2IDO A;  3CYM A;  1HNI A;  4DTO A;  2RF2 A;  3AA4 A;  1RT5 A;  3O3G A;  1FKO A;  3HVT A;  3QLH A;  3HM9 A;  4I7F A;  1RBR A;  3SV3 A;  1S6Q A;  4OKE A;  4M45 A;  4HUG A;  3HJF A;  1O1W A;  4FLW A;  4MFB A;  4Y1C A;  4W5R A;  4M3T A;  3SV4 A;  1XWL A;  4EP5 A;  1TKX A;  3QIP A;  2GBZ A;  1ITG A;  3EZ5 A;  4OGC A;  2XY7 A;  5FRM A;  1DTT A;  2OYQ A;  4F2R A;  4DS4 A;  3QNO A;  3SUQ A;  5CYM A;  4OPK A;  1N5Y A;  3OYB A;  3TAN A;  4CGJ A;  4DQP A;  2X74 A;  4NCB A;  3TAQ A;  4KHQ A;  1RT6 A;  5CYQ A;  2YV0 X;  4KB0 A;  3ISN C;  4DQR A;  4GVM A;  1SL0 A;  1NKB A;  4HVJ A;  4N76 A;  4YFU A;  4CHN A;  4DTX A;  1HJR A;  3LAN A;  3AO3 A;  2G8W A;  4RW8 A;  1ZBI A;  2D0B A;  2PY5 A;  3AVA A;  3NHG A;  4Z4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...