3O4QA

Crystal structure of the rous associated virus integrase catalytic domain a182t in citrate buffer ph 6.2
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
145
structure length
136
Chain Sequence
LGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSFTSKSTREWLARWGIAHTTQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A crystal structure of the catalytic core domain of an avian sarcoma and leukemia virus integrase suggests an alternate dimeric assembly.
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Dna binding protein
molecule keywords integrase
total genus 50
structure length 136
sequence length 145
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3o4qA00
3TARA 3IRXA 3SUOA 3AVMA 4FW2A 4CHYA 1FKOA 4DFMA 1NJZA 3M8PA 4AHVA 4IKFA 4KHYA 4LSLA 3M8SA 1HRHA 4O55A 3L2RA 4HUFA 3HXMA 4BE1A 4E7HA 4W5QA 1NOYA 4JS5A 3WNGA 1RDBA 2ITGA 4CCHA 2G8KA 1C6VA 3OYFA 1VSIA 2D0CA 1EKEA 4E3SA 1SL2A 1T7PA 3U3GA 2HHVA 4F2RA 3OYHA 4BWJA 3NE6A 3LZJA 4CJPA 3C6UA 4FJ7A 4I9LA 1HYSA 2HNZA 3A2FA 1S6QA 1RBTA 1RCHA 3MEGA 4DG1A 2QK9A 3L2UA 4AILC 4FK4A 4FZXC 3AO4A 3O3HA 3KKRA 2G8IA 4CK1A 4M3TA 2HHWA 1WSJA 2YNFA 1HYVA 2VG6A 1WNSA 3JYTA 2XY7A 2G8FA 1IH7A 1TKXA 4DTSA 1RBVA 2DFHA 1REVA 3BGRA 2FC0A 4B8CA 1JLEA 4DTPA 1I39A 1WAJA 3LWLA 4LH4A 4B9UA 2QKBA 4O0JA 4E19A 2HMIA 1CLQA 4OLBA 1TVRA 4FJHA 1EETA 3ZSRA 3MAQA 2IS3A 4DTUA 3VQ5A 1NK9A 1LAVA 3C6TA 3ULDA 4CEEA 4FJ5A 4N76A 4CJUA 3QLHA 2EHGA 4HUGA 3NF8A 4JRPA 2FBYA 4LH5A 1A5WA 5HP1A 3ZSXA 2BDPA 4FK2A 3VQCA 4DTXA 4CFAA 3V9XA 4RW7A 4DSLA 3OJUA 2I5JA 1ZBUA 3NBPA 2VG7A 3WNFA 1VSHA 3KLGA 1X9SA 1LWFA 3D45A 3ZT3A 3OYNA 4HCCA 4QCLA 2A1SA 3QIOA 1TK5A 4FJXA 4F3TA 1BCOA 3L3UA 4DWIA 1JL1A 3NH2A 3VN5A 1HJRA 3ISNC 3V9ZA 3IS9A 5HRSA 1S5JA 4I2QA 3O4QA 4FVMA 3VQAA 3ZSVA 3CQ8A 3QEXA 1ZBLA 3RWUA 3LAMA 1XHXA 3MEEA 4CGHA 3G0ZA 5E41A 1HNIA 1RDCA 2YNIA 1JLGA 1RTJA 1HMVA 1BHLA 1RT5A 3HK2A 3DLHA 3OJSA 2IC3A 3OYLA 4ZTFA 4DQPA 4KTWA 3AVGA 3EY1A 2A1RA 2Z1JA 4CK3A 4RW4A 3CM5A 4FLVA 3SCXA 1DTTA 3L8BA 4RW6A 3NH0A 3PV8A 4KB0A 3KK1A 1YT3A 5CY4A 2PYJA 3B6OA 3BDPA 4FJKA 3AVNA 4JRQA 4CF8A 1LAWA 3QINA 5J2MA 3AVLA 1LWCA 4DF4A 4M3YA 3MECA 3NF7A 4H4MA 3VQ8A 4DU3A 4J2AA 1NKBA 3P5JA 5HRRA 2YNGA 4OVLA 4CJLA 4OKEA 3MXIA 4K8XA 2HHUA 3QESA 2F96A 4BDZA 2VWJA 3CYMA 2OPPA 4HUEA 2QXFA 4Z4CA 3RMAA 2D0BA 1UAXA 4CJTA 1YTAA 5KI6A 5C25A 1RDAA 4CECA 1BL3A 1U04A 3DOLA 4QAGA 1GOAA 1ITGA 5T7BA 3PO5A 1RTIA 2YNHA 4M3UA 5JS1A 1KFSA 4E7LA 4ELTA 3KLIA 2D0AA 4I2PA 4DMNA 3IG1A 1MU2A 1CZ9A 4BACA 2Z1IA 3DLKA 1VRTA 3DRPA 1BIZA 3SPYA 2HNDA 1RNHA 3AO1A 1L5UA 1TK0A 4FJLA 3AA3A 2ZQBA 4KO0A 3NH1A 4B3OA 4CJ4A 4G1QA 3LP1A 2KQ2A 2O4GA 4CJRA 1LV5A 4IBNA 4M3RA 2XO7A 4N56A 1J54A 3NDKA 1U49A 3OYEA 4Z4IA 2YV0X 4KAZA 4Q5VA 3LP2A 4KI4A 3VQ4A 1NK6A 2KFZA 3MXJA 4B9SA 5DMRA 1GOBA 3C95A 1D9DA 4W5TA 3SUQA 3TAMA 3KK2A 1SL0A 1YVUA 2Z1GA 2RPIA 3OY9A 2FBTA 4BE2A 3RMBA 3DLEA 3KK3A 3CFRA 1RTHA 1C0MA 4YNQA 4KB1A 1RT1A 4CEBA 4CESA 4CHNA 1RTDA 4CF9A 1QTMA 5I3UA 3V9UA 4N47A 1TGOA 4GW6A 5DK5A 3F9KA 4CHZA 4FLTA 1J5OA 4CGJA 1KSPA 4J2EA 5FDLA 3VA3A 4B9MA 3TAGA 2YKNA 3AO5A 3SNNA 1RT4A 4XIUA 4ELUA 1BI4B 2PZSA 3KLFA 3KD5E 3LAKA 2IDOA 3CM6A 5SWMA 3AVIA 1U45A 2XRIA 5KTQA 5JS2A 4AH9A 1RBUA 2OYQA 3IAYA 4B9VA 1C1BA 3DMJA 3NF9A 1U47A 1Z25A 2RN2A 1JLBA 3CFPA 4ZTJA 4I7FA 2G8WA 3SQ4A 1NK7A 4M3WA 4M3ZA 2DY4A 2HVIA 1RBSA 4PWDA 3V1OA 3ASMA 3AVJA 2PY5A 4KHQA 1VRUA 2YKMA 4MQ3A 4CE9A 3TAFA 4DSJA 3OS2A 3DM2A 3OYMA 2D5RA 4EP4A 1RILA 3OVNA 3QO9A 4CHPA 4FM2A 2OZSA 3AVHA 2DFFA 3NCIA 1TV6A 4JLHA 3NGYA 4OPJA 4BDYA 4DS4A 3C94A 4KI6A 3KLHA 1CZBA 3I0RA 2FBXA 4EP5A 1UA0A 1T03A 1B92A 4BWMA 3TR8A 2DTUA 3S9HA 1C1AA 1KVBA 1JLFA 1RT3A 1VSMA 4IFVA 4TSXA 4CF1A 3ZT1A 2OPRA 4EZ6A 1FXXA 4FJ8A 2HHSA 3TAPA 1IKWA 1W0HA 4H8KA 4Z4GA 3HO1A 4EZ9A 1L3VA 4FXDA 4CK2A 1ZBIA 4JS4A 1VSDA 4C8OA 1KVAA 2HW3A 1HYZA 4CHOA 3TI0A 3AO3A 4CIEA 1WLJA 2B6AA 3ZSOA 3HJFA 3CFOA 4OLAA 3ZT0A 2G8HA 2ZD1A 4F2SA 4DQQA 1C1CA 4DTNA 3NFAA 1Q8IA 4PA1A 3AVCA 4ZHRA 4FJIA 3AVKA 5CYMA 4O44A 4AHTA 1QSYA 3LANA 4B8AB 4CJKA 2E6LA 3H08A 1RT6A 5KRSA 3K5MA 4DTOA 4CJFA 1Q9YA 3SQ0A 4I9QA 4KRFA 1ASWA 4FZYA 1W9HA 1SV5A 3PX0A 3RR7A 4CEOA 4BE0A 4FLUA 4IG0A 4B08A 1IO2A 3LPTA 2X78A 4CIGA 4N5SA 4DLEA 4DLGA 1S1VA 2KFNA 3QEIA 4BDPA 4OKJA 3EYZA 3O3GA 5J2PA 3G10A 2QKKA 3KKSA 4FYDA 1U48A 1JKHA 3QEVA 4E1NA 1J9AA 2GBZA 3K58A 1G15A 3SZ2A 1BQMA 4DU1A 3DRRA 1RBRA 4AHCA 3THVA 1VSKA 3SUNA 1VSFA 3HT3A 1IKYA 1SKRA 3OYDA 1X1PA 2GUIA 4FJJA 1BGXT 1Y97A 4NYNA 3V6DA 5KGXA 1RDDA 4FLXA 3RRGA 2Z1HA 3T3FA 2EX3A 2E4LA 4F3OA 1YTUA 3DLBA 1QHTA 2Q3SA 4OKKA 3TABA 2KTQA 2G8UA 2BGGA 2IOCA 3DYAA 3K2PA 4NCGA 3OYCA 3D0PA 3V9SA 1NJWA 4L8RB 4CIFA 1KLMA 2XY5A 1VSJA 3VQ6A 4CFBA 2F8TA 3TAEA 1WSGA 1WSIA 4FJNA 2W42A 1NKEA 5I42A 1JLAA 1K6YA 2E6MA 5FROA 4CGGA 3OYAA 1JXBA 4HHTA 3JSMA 3V4IA 2HHXA 1BCMA 4FK0A 4FJ9A 4H4OA 1B9FA 1S1XA 4M45A 4DF8A 1IG9A 1KRPA 4ID1A 1ZBFA 4KHNA 3SQ1A 1D5AA 1S1UA 5FRNA 5FRMA 1XHZA 4FLZA 5J2QA 1T05A 4Z4EA 4PY5A 4CEQA 1EXQA 1RT7A 1NK8A 5KGWA 1FKPA 4DTJA 2X74A 1BIUA 1Z26A 4IG3A 3QEPA 3S3OA 4IFYA 3RTVA 1VSEA 1NOZA 3SYZA 3KLEA 5HRPA 4Z0UA 4DFJA 4WE1A 3LP0A 3ZT4A 2KW4A 1QE1A 1I3AA 3K59A 3M8RA 2R7YA 4KHUA 4N41A 1JL2A 1LWEA 1UOCA 3CG7A 2B5JA 1ASVA 3MEDA 1U4BA 3SI6A 4ELVA 1NK0A 4AHUA 1C0TA 3FFIA 4GVMA 3QNOA 4DS5A 1ZBHA 2P1JA 4CGFA 3DI6A 4DFPA 3LPUA 2XHBA 3HP6A 4HTUA 1QS4A 4R5PA 5HLFA 1S1TA 3WNEA 4J2DA 3RR8A 3V1RA 1J53A 2P51A 3I8DA 1TKZA 4DQIA 3NGIA 3M8QA 2AJQA 4O5BA 5J2NA 3RRHA 2ZE2A 2WONA 4OPKA 3QERA 2OPQA 4LY7A 4ID5A 4M42A 3HVRA 4M41A 4W5RA 3ZSZA 3SPZA 3L2VA 4OJRA 1D8YA 3B6PA 5K14A 3NF6A 1HQEA 3QNNA 1HPZA 4FM1A 1TAUA 2ATQA 1EX4A 4FJGA 2GV9A 1QQCA 4Z4FA 4Q0BA 4GMJB 2RF2A 5J1EA 1WSEA 3LP3A 1SKWA 1BISA 4DQSA 5KRTA 1TK8A 1JXEA 3K5OA 4LSNA 3S3NA 3ZT2A 5HBMA 3ZSYA 3KTQA 4KKOA 1QSLA 4B9TA 1IKXA 4K8ZA 1N6QA 3SJJA 1UWBA 4M3XA 3OYKA 2LSNA 4CJVA 5C42A 1WN7A 4PQUA 4CJEA 1KTQA 4CEDA 4DU4A 1TKDA 4DSKA 3K5LA 2XY8A 4FLWA 4CFDA 3TANA 4E1MA 3KIOA 2P5OA 1NK4A 4QOZB 3V1QA 4UQGA 3OS0A 1SUQA 3ZCMA 3ZSWA 5CZ2A 3OYJA 5C24A 3QETA 1UA1A 3O3FA 3PX4A 1GOCA 1HQUA 2VG5A 4DSFA 3AVAA 5HRNA 1FK9A 1X9WA 2FBVA 4KTQA 1LW0A 4KPYA 2OPSA 1F21A 3PO4A 3VA0A 1B9DA 2X6NA 4RW9A 3HPGA 3VQ9A 1RT2A 3HP9A 3DLGA 3EZ5A 4FCYA 3MXMA 2P5GA 4FZZA 3L3VA 1WAFA 1TKTA 4CJ3A 3U6FA 3AVBA 3HYFA 3P83D 4C8KA 4E0DA 2IAJA 4CF2A 1D9FA 4J2BA 1KVCA 3O4NA 4O4GA 2OZMA 1C0UA 1S1WA 4PUOA 1XI1A 2NUBA 3AO2A 4IDKA 3DOKA 5CZ1A 3V9WA 3QEWA 2ETJA 3OYBA 3F73A 4CGDA 3HSTB 4O0IA 2G8VA 4CEFA 3VQ7A 2YHBA 3QIPA 3P1GA 4LD0A 3LALA 1JLQA 4AHRA 5SZTA 3TWHA 3S3MA 2F8SA 1WSFA 4KREA 3VQDA 1NKCA 3TAQA 1X9MA 2XY6A 4C8NA 4CEZA 4ICLA 3WNHA 1R0AA 4CHQA 4FJMA 1KLNA 4KHSA 4CJWA 3ALYA 3LZIA 4E7IA 1NJXA 4DQRA 3SV3A 1HNVA 3KD1E 3DLRA 4E7KA 3VQEA 3L2QA 2KZMA 3HM9A 3LDSA 3I0SA 4CEAA 4FLYA 1DLOA 3VQQA 2HB5A 4FW1A 4KFBA 2B4JA 3AA5X 3DRSA 1ZYQA 3L2WA 3K5NA 4MFBA 4RW8A 1SKSA 1CXQA 3OYIA 3UIQA 4Z4HA 1L3UA 2X6SA 4KTZA 4Y1DA 5HROA 1S6PA 4CF0A 4DFKA 3HPOA 4CJQA 2JGUA 2KZZA 2RKIA 3V81A 3AA2A 3AV9A 3VQPA 4KHWA 4NCAA 4NCBA 4C8MA 1EP4A 3ITHA 2DFEA 1TL3A 4CERA 1VK0A 1SL1A 3K57A 3VQBA 5D3GA 3T19A 2HVHA 2O4IA 1DTQA 4DTMA 4AHSA 4F4KA 2HHTA 3LWMA 1LW2A 1L3SA 1ASUA 3OYGA 3HVTA 1BQNA 3T1AA 4F8RA 3KJVA 3E01A 1TL1A 1T8EA 5CYQA 4B9NA 2BANA 1JLCA 4OGEA 4FM0A 2HHQA 4C8LA 4E7JA 3OS1A 4E89A 4DSIA 1L3TA 1KFDA 2BE2A 1XWLA 3SUPA 2OA8A 4W5OA 4DSEA 4DTRA 3ZSQA 1O1WA 4HVJA 3U3YA 3NAEA 2Y1IA 3PX6A 4NYFA 1BI4A 1QSSA 3NGZA 1N5YA 1S9GA 2PYLA 1TAQA 1XC9A 1VSLA 1CXUA 3PUFA 3RMCA 2IGIA 1Q9XA 4CJSA 4Y1CA 3HL8A 3AA4A 5EU7A 1A5XA 1KCFA 3AVFA 2WOMA 3HPHA 3SQ2A 4KV8A 1S9EA 4CGIA 2YHAA 4W5NA 4OGCA 2JLEA 1NK5A 4HCBA 1A5VA 2HNYA 3RMDA 3PY8A 1NJYA 3NHGA 3SV4A 2Y1JA 4B9LA 4RG8A 1IKVA 2VWKA 4CFCA 4YFUA 4CJ5A 1WSHA
chains in the Genus database with same CATH superfamily
1TUYA 3IRXA 4A62A 3SUOA 4CHYA 1VQON 3E1YA 4IKFA 4LSLA 3TTDA 3M8SA 4O55A 4HUFA 4JS5A 1C6VA 1EKEA 3O9QA 2F9TA 3CC2N 1HYSA 2HNZA 3A2FA 4YOYA 3MEGA 4DG1A 5HL7L 5CHIA 4AILC 1VQ9N 1XC3A 3AO4A 3G25A 3KKRA 2PFUA 3MN9A 2YNFA 2VG6A 4H5VA 2XY7A 1SS6A 1IH7A 1TKXA 3A5NC 1RBVA 2FC0A 4B8CA 1I94K 1JLEA 1ATSA 4WFBL 4LFAK 4K42A 2QKBA 4O0JA 1NLVA 3ZSRA 3VEYA 1LAVA 2QI2A 4CZEA 2EHGA 4M7XA 2BDPA 3R9PA 4CFAA 4RW7A 5JMVA 5BPLA 3NBPA 2VG7A 4JEPA 3PIOL 3CJ7A 3QMLA 3SJHA 2P9NB 5KQDA 4HCCA 4FJXA 1TK5A 4BR7A 4F3TA 1BCOA 4DWIA 1S5JA 2QTDA 4FVMA 3CQ8A 3QEXA 2D0OA 1HNXK 3UB5A 2ITMA 5M1OA 4DR6K 1RT5A 4FSVA 2YJFA 4KTWA 3CC4N 2A1RA 2HBMA 3HI0A 3SCXA 3L8BA 4RW6A 3NH0A 3PV8A 4KB0A 2P9PA 2PYJA 1YXQA 4FJKA 4JD2A 4H0PA 4CF8A 1LAWA 3O4WA 3QINA 2FF3B 4M3YA 3MECA 4H4MA 3VQ8A 5GAGP 1NKBA 5HRRA 4OVLA 2VYPA 4WFAL 1IBLK 4OKEA 4K8XA 5EY4A 2F96A 4X62K 2VWJA 5AQWA 2OPPA 4HUEA 4RWTA 2QXFA 3RMAA 5AQPA 1UAXA 5FPNA 1RDAA 1U2VA 4CECA 2ZJRL 1BL3A 3ZX2A 4QAGA 3M3ZA 1VHXA 2OANA 3PO5A 4CZFA 3OW2M 4NXNK 1Z6RA 3SMSA 1KFSA 2A6AA 3KLIA 4DMNA 3IG1A 1O13A 1CZ9A 4BACA 3DLKA 4FWSA 4MO5A 2P9KA 5A2QO 5DM7L 4BR9A 1LV5A 1TUUA 3OYEA 4DUYK 4KAZA 2QWQA 1NK6A 3CPWM 2P9PB 3MXJA 3C95A 4JHDB 2QW9A 1D9DA 3SLCA 1X3MA 1YVUA 2Z1GA 3L6QA 2KHOA 3VPZA 4BRQA 4YNQA 1RTDA 4BRKA 4CF9A 5I3UA 4K43A 4X64K 3MN7A 3VA3A 4AF1A 2UUBK 1RT4A 4UY8O 2PZSA 3KLFA 3ZETA 5SWMA 1P8ZA 3AVIA 5EX5A 3DMJA 1JLBA 1NK7A 2A5XA 1QQOA 1VQ7N 1RBSA 1QQNA 4I6MB 1VRUA 1Q18A 5ADXH 3VF6A 3DM2A 4CHPA 2GEMA 4OPJA 5C10A 4GKKK 1EWRA 3TSQA 1UA0A 4EFHA 4WFNL 1T03A 4BVOA 3K9JA 1DGKN 1C1AA 1KVBA 4YOWA 3ZT1A 2OPRA 4EZ6A 4FJ8A 4LFBK 1W0HA 4EZ9A 4FXDA 1TYQB 1KVAA 1HYZA 3D7EO 1WLJA 4IEEA 4WYBA 1XNRK 4YDUA 3ZT0A 4DTNA 3J7AP 4PA1A 4FJIA 4AHTA 4B8AB 3H08A 4KRFA 4I9QA 1ASWA 1W9HA 3FZHA 2JWLA 5IT9O 2X78A 4N5SA 4DLGA 3WEEB 2KFNA 4BDPA 2QKKA 5AQSA 2UXBK 3KKSA 4DU1A 1X3NA 5GAEP 4IJAA 5AR0A 1RBRA 4PL7A 2NRVA 1VSKA 4GV9A 1VSFA 3HT3A 3OYDA 1VQMN 3V6DA 1RDDA 2EX3A 4F3OA 3DLBA 4OKKA 3TABA 5H1SQ 1QZ5A 3FZLA 3D0PA 4L8RB 1HNWK 4CIFA 3TAEA 5I42A 3OYAA 4JI3K 4HHTA 2HHXA 1BCMA 3J7YP 4FJ9A 4DR2K 4GV6A 1IG9A 4DF8A 5AQXA 2ZM6K 3BP8A 3SQ1A 3LL3A 5FRMA 5LJVA 3O1BA 1RT7A 4DTJA 1FKPA 2X74A 1BIUA 1Z26A 2O8DA 1BG3A 2HF3A 3NVMA 1ESVA 1NOZA 3O08A 3SYZA 3KLEA 4Z0UA 3CG7A 3MEDA 4JKCA 2NRZA 2P9IA 4GVMA 2VQEK 2OCEA 4DS5A 3MN5A 3H45C 4G9ZA 3LPUA 2QWNA 4HTUA 4R5PA 4J2DA 3EE9A 3RR8A 4O5BA 3DXMB 3VEVA 2ZE2A 2Q1NA 2WONA 4OPKA 5BPNA 4LY7A 4ID5A 3O9RA 3HVRA 4NB4A 3QNNA 1HQEA 3ATUA 3CD6N 2ATQA 4BR5A 4FJGA 4Q0BA 2GV9A 1QQCA 5KPZA 3CMAN 4GMJB 5J1EA 1SKWA 1BISA 1YVNA 2QA4N 4R79A 1VQ8N 1IKXA 4M3XA 1WN7A 4PQUA 2CH6A 3D2EB 3CQYA 1TKDA 4E1MA 3KIOA 3KWGA 2CGKA 3SBGA 4KH6A 3OYJA 4YOVA 3HTVA 2FLOA 3PX4A 3DXKB 4DV4K 5HRNA 1FK9A 1X9WA 2FBVA 3VMFB 1NMDA 3PO4A 5AFUA 3VA0A 2V51B 4BQZA 3C6AA 3EZ5A 2P5GA 3MXMA 1QVGM 1S3XA 1WAFA 4MDAA 3U6FA 3HYFA 1CZAN 3P83D 4C8KA 4E0DA 2OZMA 4PUOA 4JI4K 2NUBA 4IDKA 3H1QA 5CZ1A 3QEWA 4K0KK 2ETJA 4CD3A 4B1UB 4CBWA 3HSTB 4CGDA 5AQVA 4YORA 3VQ7A 3QIPA 2WFBA 5DM6L 3TTFA 2QM1A 2JWKA 2UXCK 1GLLO 1HUXA 1WSFA 1NKCA 2O8BB 4C8NA 4CEZA 1KLNA 5AQNA 1HKGA 3L4IA 3LZIA 1Z05A 4E7IA 1NJXA 2CH5A 3VQEA 3T7ZA 1K73O 3I0SA 4CEAA 3O9UA 1IJJA 3DRSA 3J80O 1CXQA 4Y1DA 4KTZA 5HROA 1ZC6A 2Q2RA 2KZZA 3VQPA 5LMUK 4NCAA 4NCBA 1EP4A 4BY9C 1SL1A 1QHAA 1DTQA 2YJEA 1WBBA 2FXUA 4AHSA 4F4KA 1XQSC 1ASUA 4OO1J 1YF5L 3T1AA 1WUAA 1TL1A 4CJ7A 5HOOA 2E8AA 2BANA 4OGEA 4FVUA 4BREA 1OH7A 4C8LA 3OS1A 4E89A 1SAZA 2BE2A 2OA8A 3QB0A 4RCHA 3NAEA 2Y1IA 2HSTA 2PYLA 5AQRA 1YIJN 3DXMA 4DV5K 5EU7A 1A5XA 4MLHA 2GELA 1S9EA 3C65A 1A5VA 1NJYA 3O8MA 3NHGA 3M6GA 4B9LA 4CFCA 4NLCA 3ID8A 3OA9A 3AVMA 4FW2A 3T1HK 1NJZA 4DFMA 1QQMA 4AHVA 2GWJA 2Q0UA 3L2RA 4E7HA 2NRRA 3CCJN 1NOYA 3I55N 3WNGA 2G8KA 4PKIA 3ENBA 3D2FA 1T7PA 4F2RA 4JKGB 4BWJA 3LZJA 3C6UA 3BUZB 1S6QA 2NRHA 1T6CA 2QK9A 4FK4A 4FZXC 4BRDA 1S22A 2QXLA 5C2FA 1WSJA 4H0OA 1WNSA 4DR5K 4H5RA 4DTSA 2Q0RA 3ZYYX 2YCHA 1W97L 2W41A 1I39A 5LL6Z 5B8HA 3FR0A 4H03B 5JVGL 1NNEA 1CLQA 4OLBA 1Y64A 2E2PA 3A5OC 3MAQA 4JI2K 2AP1A 4DTUA 4FJ5A 3QFUA 2FBYA 4LH5A 4FWRA 3VQCA 2FF6A 3OJUA 1ZBUA 4IOXA 3GDQA 4FPBA 1VSHA 3KLGA 3D45A 2Q97A 3OYNA 4QCLA 2A1SA 3QIOA 3L3UA 3Q7CA 3ISNC 4M63C 1ZBLA 3RWUA 1XHXA 3G0ZA 1RDCA 3WXMB 1RTJA 4CZHA 3QBXA 3JS6A 1BHLA 4IXCA 3CC7N 1ATRA 2IC3A 4ZTFA 3M5RA 4DQPA 2KKZA 4CK3A 4RW4A 4C23A 5AZJB 4ISFA 1NGCA 3KK1A 3B6OA 4WCEL 4JRQA 2YX6A 3NMUA 3P5JA 1OVYA 4CI6A 5AQZA 4CJLA 1G99A 3AAPA 4PL8A 4Z4CA 3EO3A 2ZJQL 2WUSA 4FWQA 4CJTA 2E2OA 3CCLN 4XH1A 3C7NA 4X66K 4BR4A 1OKJA 1W7AA 4ELTA 4DR7K 1MU2A 2P9UA 2P9NA 2Z1IA 3TSPA 1K8AO 1TK0A 3C6HA 2W40A 3NH1A 4B3OA 2CGLA 3CQXA 4CJ4A 4G1QA 2KQ2A 4IBNA 1NM1A 4M3RA 1U49A 1J54A 3NDKA 4B3RK 5C12A 4Q5VA 4KI4A 3VQ4A 3QDKA 2KFZA 4JI6K 4EHTA 4B9SA 4W5TA 3THXB 4BRAA 1SL0A 4A5BA 1SZ2A 1YUWA 4BE2A 3A8YA 3DLEA 3KK3A 1C0MA 1OH8A 1R59O 1YAGA 3FZMA 4CHZA 3F9KA 3QICA 4CGJA 2GX9A 5AZJA 5FDLA 4B9MA 3CCEN 3MX5A 5AQIA 4XIUA 1BI4B 3FE1A 1NG9A 3LAKA 1BUPA 5KTQA 1RBUA 4ZTJA 4I7FA 1IBKK 2HVIA 2PY5A 1BWFO 4MQ3A 4CE9A 4WQ5A 1RILA 3OVNA 2OZSA 4B1XB 2DFFA 3NCIA 4BDYA 3C94A 5JLHA 1CZBA 4BRMA 3KLHA 2EWSA 1NGGA 3G6EN 3CCRN 1ILYA 3S9HA 1NBWA 4DB3A 1J6ZA 1JLFA 1VSMA 3TAPA 2ASMA 3HO1A 4JS4A 3VOVA 2HW3A 4CHOA 5C2DA 4CIEA 3DWLA 3CFOA 4LF9K 4OLAA 1GLBG 4F2SA 1C1CA 2O8FA 1Q8IA 3AVKA 1FW6A 1K9MO 1BO5O 2E6LA 1RT6A 2NRTA 3P4IA 5KRSA 4CJFA 3K5MA 4DTOA 3SQ0A 2Q31A 1Q9YA 2FSJA 4CEOA 4BE0A 1NGIA 2P9SB 1DKGD 4BC2A 2IIRA 1S1VA 3NVKA 4AM6A 3QEIA 4OKJA 5J2PA 3O3GA 5BN9A 3ENOA 2WTUA 3QEVA 4E1JA 1BQMA 5KPTA 4KH4A 4AHCA 1JCGA 4GNIA 1IKYA 1BGXT 1Y97A 5FPEA 3THWB 4YY3K 4NYNA 2Z1HA 1QHTA 2P9UB 2KTQA 2WBNA 4NCGA 3K2PA 2BGGA 1NJWA 2XY5A 1VSJA 4CFBA 2F8TA 1WSGA 3MWPA 1WSIA 4HTLA 3TPQA 2W42A 1NKEA 2BH1A 5FROA 4M7YA 3V4IA 4H0VB 4KHNA 3I33A 5I9EB 4IFEA 4CEQA 1NK8A 5KGWA 3THXA 5BR8K 4IG3A 3GOIA 3S3OA 3RTVA 1VSEA 1KXPA 3CHWA 4DFJA 4WE1A 3LP0A 3ZT4A 1QE1A 2RE2A 3KHYA 4KHUA 3ULEA 1JL2A 2NRXA 2B5JA 3SI6A 4ELVA 4AHUA 3FFIA 4CGFA 3P39A 1QS4A 5HLFA 4IWVA 4DQIA 3I8DA 1TKZA 4M42A 5AQYA 3SAFA 4M41A 4W5RA 5K14A 1EX4A 3S41A 1YJNN 3G71N 1JXEA 3K5OA 4LSNA 1V4TA 3ZSYA 3KTQA 4KKOA 4K8ZA 3RVCA 1X9JA 2LSNA 3LDNA 4A59A 5C42A 1KTQA 3K5LA 3TSUA 2P5OA 3VEOA 1NK4A 5GIOA 5FPMA 4QOZB 3ZCMA 2VCPA 5ADXA 5GADP 4BG8A 5C24A 3O3FA 3B8AX 2E2QA 2OPSA 3EKSA 3IMXA 4U67L 3HP9A 3ENHA 1EO1A 3EL2A 1N33K 3F2KA 3WXIA 1KVCA 1GLEG 2QWOA 5JVHL 3UKRA 4O0IA 3VGKA 2HHHK 4CEFA 2BUPA 4LD0A 3N4QA 3THYB 2F8SA 4QS9A 4YOXA 3MMVA 1YJ9N 3R6MA 3TAQA 3EE8A 4CJWA 5TKYA 4DQRA 2CGJA 1QVFM 4E7KA 4CZGA 5BR9A 4B3MK 2PBDA 2O8EA 4FW1A 2B4JA 4HWIA 3UIQA 3K5NA 3CJ1A 4MFBA 4RW8A 1L3UA 2X6SA 3UKUA 1S6PA 2ZGZA 1NGFA 4CF0A 4BRCA 3CJ9A 2RKIA 3I56N 3AA2A 3AV9A 4K25A 5FLXO 4NO7A 1TL3A 1RDUA 4V19S 1VK0A 2O4IA 2E1YA 1NJIO 4DR1K 1KC8O 3E9LA 5AQHA 1LW2A 4IOCL 5E84A 3HVTA 1NU0A 1RDWX 3E01A 3SAGA 4ISGA 4EAHD 3A0IX 4DSIA 3EN9A 1JCEA 4EIAA 4CBUA 2VGMA 1KAXA 1HPMA 1Q86O 3U3YA 5AQTA 4NYFA 3W0LA 3QFPA 2QWMA 2W6KA 3CETA 4WQ4C 4JI0K 1CXUA 2E20A 3RMCA 2IGIA 4BC5A 4Y1CA 3HL8A 2P9LB 2HOEA 3HPHA 5CE3A 2JLEA 4A2AA 4RG8A 4YFUA 3TARA 4CZJA 2GWKA 1FKOA 4KHYA 3HZ6A 3HXMA 3T69A 4BE1A 4JI1K 4YOTA 1HKBA 1RDBA 4CCHA 4XH5A 4JI7K 5BRFA 2V7ZA 1VSIA 2D0CA 4E3SA 3DAWA 1SL2A 3OYHA 1KD1O 1D4XA 3K9KA 4CJPA 4I9LA 4I6MA 2E1ZA 1RBTA 1RCHA 3L2UA 2G8IA 4CK1A 4M3TA 3VTIA 3DXKA 4FWNA 4L3QA 3VTHA 1WOQA 1HYVA 3JYTA 2G8FA 4B3TK 3M1FA 1REVA 3CJAA 1MWKA 2O8EB 3LWLA 4LH4A 2ZJPL 3O80A 4E19A 1ATNA 2HMIA 3ATVA 1GLAG 1EETA 3LM2A 1NK9A 3C6TA 5F1XA 3ULDA 4CJUA 4JK8A 3NF8A 5HP1A 4FK2A 4BC4A 3V9XA 2I5JA 1RGIA 1MA9B 3RSEB 2GUPA 1LWFA 3ZT3A 5BPMA 1XUPO 5MLCQ 1JL1A 3V9ZA 3IS9A 4I2QA 3O4QA 3U9DA 3ZSVA 3LAMA 3MEEA 4CGHA 5E41A 2YNIA 1JLGA 1HMVA 4BR0A 3DLHA 3OJSA 5AZIB 3OYLA 3AVGA 2Z1JA 2F9WA 1DTTA 1VQ6N 1LOTB 2YHYA 5CY4A 3C0BA 4NLBA 1T6DA 3J8AA 3HOSA 4B1WB 4BR2A 3NF7A 4H0YB 4J2AA 3MXIA 5LY3A 3PIPL 3QESA 4BDZA 5BRHA 4K41A 2D0BA 1N8RO 1YTAA 5KI6A 1GOAA 1IBMK 5M1QA 1E4FT 1MWMA 2BTFA 4M3UA 4E7LA 3F9MA 1DEJA 4BRFA 1FJGK 3DRPA 1BIZA 3CI5A 3SPYA 4JKBA 1L5UA 4B1VA 3P38A 3AA3A 5CR4A 3LP1A 4CJRA 2UYTA 1VQLN 2YV0X 3IUCA 3UE5A 3BEXA 1YITN 3LP2A 3WXJA 5DMRA 1GOBA 5EOYA 3I8BA 3TAMA 3SUQA 3KK2A 4AQYK 2RPIA 3OY9A 2FBTA 5AZIA 3EZWA 3ZEUB 3JAMO 4KB1A 4CEBA 4CESA 1VQKN 1QTMA 1TGOA 1WBDA 4FLTA 4J2EA 2W6LA 4YDUC 4JKDA 4YOUA 2YKNA 3SNNA 4ELUA 2IDOA 3CERA 3CM6A 4JKEA 3U8XA 5JS2A 2OYQA 3IAYA 3HSCA 1Z25A 3CFPA 4M3ZA 4M3WA 2DY4A 1LCUA 5AQFA 4PWDA 3AVJA 4XEIA 2YKMA 3TAFA 3OS2A 2D5RA 4EP4A 1S72N 1YTUA 1XNQK 4KI6A 3I0RA 3OHRA 4EP5A 2DTUA 4IJNA 3WEEA 1RT3A 4IFVA 1C0FA 2F7TA 1FXXA 1IKWA 4H8KA 1L3VA 2HF4A 4CK2A 4C8OA 3TI0A 4H5WA 2B6AA 3ZSOA 2WC9A 2G8HA 2ZD1A 3VEZA 3VETA 1BOTO 4O44A 3IKMA 1QSYA 4CJKA 3F5TA 4A2BA 3GE1A 4DQ8A 3PX0A 4FLUA 4IG0A 2OTLN 3A5MC 4CD1A 4DLEA 4A61A 4FYDA 3EYZA 4BRLA 1U48A 1JKHA 4E1NA 2GBZA 1G15A 3SZ2A 3N4PA 3THVA 3SUNA 3VGLA 1SKRA 1X1PA 2GUIA 3HRGA 4LC9B 2O8BA 3W3DA 2GTDA 1XMQK 4FLXA 2E4LA 4J8FA 2A3ZA 2Q3SA 4KBOA 4JKFA 3O9TA 2IOCA 3DYAA 3J81O 3VQ6A 4PHTX 1YI2N 3CCUN 4FJNA 3FZKA 1JLAA 4B9QA 4CGGA 4EHUA 3JSMA 2O8CB 1B9FA 1KRPA 4ID1A 4FWKA 1D5AA 4CZIA 1S1UA 1XHZA 4BC3A 4PY5A 1EXQA 2D4WA 4FOIA 4LF8K 4OPAA 3MWTA 3L4QA 2KW4A 1I3AA 3M8RA 4N41A 1UOCA 3KWIA 1GLCG 4BRNA 1NMNA 4LF7K 2P9KB 3U9ZA 5LMNK 1NK0A 1C0TA 2QWRA 4MLEA 2P1JA 1DT9A 3DI6A 4DFPA 4JYAK 4C1NI 2O8CA 4IZ9A 1S1TA 3WNEA 3V1RA 1J53A 2AJQA 3NGIA 3M8QA 3KK7A 1VAZA 3RRHA 5J2NA 4IO9L 4RTFD 3QERA 2OPQA 1H1VA 2A40A 1HNZK 3ZSZA 3SPZA 3L2VA 1D8YA 3B6PA 1U6ZA 1HPZA 1MDUB 4Z4FA 3IFRA 4DQSA 1TK8A 3KZBA 2OTJN 3S3NA 5HBMA 4O5FA 3EEQA 4B9TA 3THYA 1UWBA 1N32K 4FOEA 3OYKA 3LDOA 4CJVA 2UUAK 3UKRB 4CJEA 5AQQA 4DU4A 4CEDA 4O8UA 3TANA 2ASPA 1NGAA 3V1QA 5IWAK 3OS0A 1SUQA 3QETA 2FSNA 1HQUA 2VG5A 2VGNA 5AFUH 1NGBA 1LW0A 4KTQA 4KPYA 1F21A 2X6NA 4RW9A 3HPGA 1RT2A 3DLGA 4FCYA 4FZZA 3L3VA 1YJWN 2KLAA 4BGBA 3AVBA 4J2BA 3O4NA 4WQ4A 1NGEA 1OVQA 3FFKB 1XI1A 3AO2A 3V9WA 2I7PA 1VQ4N 3WQUA 3FZFA 2FSKA 4DV1K 5M1PA 2G8VA 2YHBA 3K0SA 3P1GA 5SZTA 3LALA 3GL1A 4KREA 3VQDA 4DV6K 2IVOA 2UXDK 3HOTA 3WNHA 4KHSA 4KH5A 3PLAA 1HNVA 4LFCK 3KD1E 3DLRA 3OBWA 4FLYA 4KFBA 1ZYQA 1YHQN 3L2WA 1JJ2M 2QWPA 2E2NA 1BU6O 4DFKA 4B3SK 3HPOA 2UUCK 2JGUA 3KVGA 3ZX0A 1XMOK 3BZCA 3C7NB 3R8EA 3ITHA 3CF5L 4A57A 5AQGA 2HVHA 4PKGA 4JKGA 1C0GA 4DTMA 5C0YA 3TTCA 2HHTA 1L3SA 1ZXOA 3OYGA 4F8RA 3KJVA 4YHHK 4Y0WA 5CYQA 4FM0A 2HHQA 4LF5K 1KAYA 1HLUA 1L3TA 1KFDA 1XWLA 2VWBA 4FWLA 4F9OA 4DSEA 1RFQA 2HMPA 3PX6A 1BI4A 1QSSA 4JKAA 3NGZA 1N5YA 1S9GA 1KAZA 1TAQA 1XC9A 1Q9XA 3T1YK 2E88A 3AA4A 3AVFA 3SQ2A 4IOAL 4JI8K 4OGCA 3ZETB 1NK5A 4FWPA 4IO8A 4HCBA 3RMDA 3P31A 4H5TA 2Y1JA 1K8KA 5GAHP 3SV4A 4CJ5A 3MDQA 5JICA 5M1KA 1Q7YO 3M8PA 1N36K 3CCVN 1HRHA 2A41A 4W5QA 1SQKA 2ITGA 4MO4A 4JHDA 5JLFA 3OYFA 3U3GA 5AQUA 2HHVA 3NE6A 3ID6A 3MX2A 4DV3K 4FJ7A 3MCPA 1BDGA 3MN6A 3D6RA 1IV0A 3O3HA 1IG8A 3IDHA 3VF4A 1W2BM 2HHWA 4DR3K 1E3MA 4H5NA 4BRGA 2DFHA 3BGRA 3PSIA 3ZEUA 4DTPA 1WAJA 4B9UA 5AQMA 3D2FB 1TVRA 1U2VB 4FJHA 4LF4K 4JK9A 2IS3A 1VQ5N 3VQ5A 4N76A 4CEEA 3QLHA 1HX1A 4DHYA 4JRPA 4HUGA 4O8KA 1A5WA 3ZSXA 5M1NA 4DTXA 4DSLA 5F0XA 4BRHA 3WNFA 4FO0A 1X9SA 4JI5K 3CIPA 2IVNA 3H3NO 3WXKA 1J5EK 3NH2A 3VN5A 1HJRA 5HRSA 3VQAA 2D0PA 1HNIA 3UKUB 3HK2A 2YI1A 1T44A 1JCFA 4U7BA 3EY1A 3CM5A 4FLVA 2NZTA 1YT3A 3AAQA 5AQLA 5AJ3K 3BDPA 3AVNA 3LDPA 2V52B 1OH6A 5J2MA 3AVLA 5AQKA 1LWCA 2QWLA 4DF4A 4DU3A 3CXCM 2YNGA 3ULEB 1N34K 2HHUA 1NGJA 3CCMN 3CYMA 3CMEN 3FLCO 4FPAA 3OBYA 3VENA 3OTOK 5C15A 2P9LA 3VGMA 5C25A 4OX9K 1U04A 3DOLA 3MCAB 2UU9K 1VQNN 1ITGA 5T7BA 5EXWA 1RTIA 2YNHA 4BQLA 5JS1A 4B1ZA 4JK7A 2D0AA 3O1WA 4I2PA 3MK6A 1VRTA 2HNDA 3VEWA 4CZKA 1RNHA 3AO1A 3CCSN 4FJLA 3BF3A 2ZQBA 4KO0A 3CJBA 1V4SA 2ASOA 2O4GA 2XO7A 4N56A 2J4RA 4ILJA 4Z4IA 2P9IB 1QZ6A 2Q36A 3AARA 4QS8A 3H6EA 3WQTA 3RMBA 3G4SN 3CFRA 1RTHA 1RT1A 5BRDA 4CHNA 3V9UA 4N47A 1WB9A 3E66A 4GW6A 5DK5A 1J5OA 1KSPA 3O6WA 3BY5A 5BN8A 3BF1A 3R1XA 1NWKA 3TAGA 2RHKA 3HBTA 3AO5A 3KD5E 3CPEA 1U45A 2XRIA 5AQJA 4AH9A 4B9VA 1C1BA 3NF9A 4DV2K 1U47A 2RN2A 4BRIA 4B1YB 2G8WA 3H1VX 3SQ4A 3O5BA 3V1OA 2YHXA 3ASMA 4KHQA 3HM8A 4DSJA 5KQ8A 3OYMA 3QO9A 4FM2A 3AVHA 4DS4A 5LJWA 1TV6A 4JLHA 3NGYA 3H46O 2FBXA 4DR4K 1B92A 4BWMA 4JKHA 3TR8A 3CCQN 3DLLL 4CBXA 3E9OA 3AY9A 4TSXA 4CF1A 2HHSA 4ILGB 1HJOA 4Z4GA 2DPNA 3EKUA 1KQSM 1ZBIA 2QEXN 1VSDA 5FPDA 3AO3A 3L0QA 2ZWHA 3HJFA 4BGAA 4DQQA 2ZF5O 3E9PA 3NFAA 3AVCA 4ZHRA 5CYMA 2F4VK 3LANA 3AGKA 3J7ZO 1GLDG 1ZBSA 3WT0A 4FZYA 1BA1A 1SV5A 3RR7A 4B08A 1IO2A 3LPTA 4GVEA 4IDHA 4CIGA 1Q81O 4IEIA 3G10A 1E4GT 3DJCA 1TYQA 1J9AA 3Q7BA 2HBJA 3K58A 5E26A 3DRRA 3VESA 4FJJA 2O8DB 3VF2A 3FGUA 5KGXA 4X65K 3RRGA 3T3FA 2D1KA 2G8UA 3V9SA 3U4LA 3OYCA 3VERA 1KLMA 3WUHA 4DV0K 4QS7A 3AGRA 1NGHA 1K6YA 2E6MA 1JXBA 3ZLJA 4FK0A 1VQPN 4CZMA 4H4OA 4M45A 1S1XA 4BG9A 1ZBFA 4CW7B 3TU5A 3BZKA 4XH4A 5FRNA 1T05A 4WQ5C 3H3OB 4FLZA 5J2QA 4Z4EA 3QEPA 4IFYA 1EWQA 4A5AA 4FL9A 5HRPA 3K59A 2IVPA 2R7YA 1LWEA 3GBTA 1ASVA 1P90A 1U4BA 4FWOA 3QNOA 4DCHA 1Q82O 1ZBHA 2NNWA 2XHBA 3HP6A 5ELZA 4CVNE 2P51A 4OJRA 3NF6A 1TAUA 4FM1A 2RF2A 1GLFO 1WSEA 3LP3A 2ZGYA 5KRTA 3ZX3A 4H0XB 4DUZK 3ZT2A 4MDBA 1QSLA 4H0TB 3SJJA 1N6QA 3O9SA 3SBTA 4ILHA 4DSKA 4FLWA 2NLXA 2XY8A 4CFDA 4UQGA 1M1KO 4JD2B 2YHWA 3VEXA 3ZSWA 5CZ2A 1UA1A 4JAXA 1GOCA 4DSFA 1HKCA 2HBKA 3AVAA 5F2RA 2PAVA 4Z94A 1B9DA 5EVZA 4FWMA 3VQ9A 2O8FB 5TKWA 1GLJO 1TKTA 4CJ3A 2IAJA 4CF2A 1NGDA 2VQFK 1D9FA 2H3GX 4O4GA 4ISEA 1C0UA 1S1WA 4JV5K 3DOKA 3LDLA 3OYBA 3D2EA 3F73A 4JN4A 2NRWA 4AHRA 3PSFA 1JLQA 3SAHA 3TWHA 3S3MA 4GY2B 3CJCA 1M90O 4CZLA 1X9MA 2XY6A 1K8KB 4ICLA 1R0AA 4CHQA 4FJMA 3ALYA 4LF6K 4GKJK 3SV3A 3LDQA 2KZMA 3L2QA 4BRPA 3HM9A 3LDSA 1DLOA 3VQQA 4PKHA 2HB5A 5M1FA 3AA5X 1SKSA 4WF9L 3OYIA 4Z4HA 4OPHA 2AA4A 3LM9A 4C1NK 5GIPA 4CJQA 3RSEA 3SK3A 2HBLA 3V81A 4KHWA 4C8MA 3THWA 2DFEA 3GG4A 4CERA 4DKWA 4NXMK 3K57A 5GINA 3VQBA 1OH5A 3T19A 5D3GA 3WXLA 1T3VA 3QBWA 2V7YA 5AQOA 2I7NA 3LWMA 1BQNA 1T8EA 2P9SA 4B9NA 2A42A 1JLCA 4GV3A 4E7JA 3SUPA 4W5OA 4DTRA 2E5LK 3ZSQA 1O1WA 4HVJA 3JXUA 4JNEA 4BROA 5BREA 1VSLA 3PUFA 1HR0K 4CJSA 5KPRA 1KCFA 2WOMA 4KV8A 4CGIA 2YHAA 4W5NA 4BVPA 4KHPK 3A5LC 1BA0A 2HNYA 4AM7A 3PY8A 1EQYA 3SMPA 4DV7K 1IKVA 2VWKA 1WSHA 3R3LA
chains in the Genus database with same CATH topology
3TARA 3IRXA 3SUOA 3AVMA 4FW2A 4CHYA 1FKOA 4DFMA 1NJZA 3M8PA 4AHVA 4IKFA 4KHYA 4LSLA 3M8SA 1HRHA 4O55A 3L2RA 4HUFA 3HXMA 4BE1A 4E7HA 4W5QA 1NOYA 4JS5A 3WNGA 1RDBA 2ITGA 4CCHA 2G8KA 1C6VA 3OYFA 1VSIA 2D0CA 1EKEA 4E3SA 1SL2A 1T7PA 3U3GA 2HHVA 4F2RA 3OYHA 4BWJA 3NE6A 3LZJA 4CJPA 3C6UA 4FJ7A 4I9LA 1HYSA 2HNZA 3A2FA 1S6QA 1RBTA 1RCHA 3MEGA 4DG1A 2QK9A 3L2UA 4AILC 4FK4A 4FZXC 3AO4A 3O3HA 3KKRA 2G8IA 4CK1A 4M3TA 2HHWA 1WSJA 2YNFA 1HYVA 2VG6A 1WNSA 3JYTA 2XY7A 2G8FA 1IH7A 1TKXA 4DTSA 1RBVA 2DFHA 1REVA 3BGRA 2FC0A 4B8CA 1JLEA 4DTPA 1I39A 1WAJA 3LWLA 4LH4A 4B9UA 2QKBA 4O0JA 4E19A 2HMIA 1CLQA 4OLBA 1TVRA 4FJHA 1EETA 3ZSRA 3MAQA 2IS3A 4DTUA 3VQ5A 1NK9A 1LAVA 3C6TA 3ULDA 4CEEA 4FJ5A 4N76A 4CJUA 3QLHA 2EHGA 4HUGA 3NF8A 4JRPA 2FBYA 4LH5A 1A5WA 5HP1A 3ZSXA 2BDPA 4FK2A 3VQCA 4DTXA 4CFAA 3V9XA 4RW7A 4DSLA 3OJUA 2I5JA 1ZBUA 3NBPA 2VG7A 3WNFA 1VSHA 3KLGA 1X9SA 1LWFA 3D45A 3ZT3A 3OYNA 4HCCA 4QCLA 2A1SA 3QIOA 1TK5A 4FJXA 4F3TA 1BCOA 3L3UA 4DWIA 1JL1A 3NH2A 3VN5A 1HJRA 3ISNC 3V9ZA 3IS9A 5HRSA 1S5JA 4I2QA 3O4QA 4FVMA 3VQAA 3ZSVA 3CQ8A 3QEXA 1ZBLA 3RWUA 3LAMA 1XHXA 3MEEA 4CGHA 3G0ZA 5E41A 1HNIA 1RDCA 2YNIA 1JLGA 1RTJA 1HMVA 1BHLA 1RT5A 3HK2A 3DLHA 3OJSA 2IC3A 3OYLA 4ZTFA 4DQPA 4KTWA 3AVGA 3EY1A 2A1RA 2Z1JA 4CK3A 4RW4A 3CM5A 4FLVA 3SCXA 1DTTA 3L8BA 4RW6A 3NH0A 3PV8A 4KB0A 3KK1A 1YT3A 5CY4A 2PYJA 3B6OA 3BDPA 4FJKA 3AVNA 4JRQA 4CF8A 1LAWA 3QINA 5J2MA 3AVLA 1LWCA 4DF4A 4M3YA 3MECA 3NF7A 4H4MA 3VQ8A 4DU3A 4J2AA 1NKBA 3P5JA 5HRRA 2YNGA 4OVLA 4CJLA 4OKEA 3MXIA 4K8XA 2HHUA 3QESA 2F96A 4BDZA 2VWJA 3CYMA 2OPPA 4HUEA 2QXFA 4Z4CA 3RMAA 2D0BA 1UAXA 4CJTA 1YTAA 5KI6A 5C25A 1RDAA 4CECA 1BL3A 1U04A 3DOLA 4QAGA 1GOAA 1ITGA 5T7BA 3PO5A 1RTIA 2YNHA 4M3UA 5JS1A 1KFSA 4E7LA 4ELTA 3KLIA 2D0AA 4I2PA 4DMNA 3IG1A 1MU2A 1CZ9A 4BACA 2Z1IA 3DLKA 1VRTA 3DRPA 1BIZA 3SPYA 2HNDA 1RNHA 3AO1A 1L5UA 1TK0A 4FJLA 3AA3A 2ZQBA 4KO0A 3NH1A 4B3OA 4CJ4A 4G1QA 3LP1A 2KQ2A 2O4GA 4CJRA 1LV5A 4IBNA 4M3RA 2XO7A 4N56A 1J54A 3NDKA 1U49A 3OYEA 4Z4IA 2YV0X 4KAZA 4Q5VA 3LP2A 4KI4A 3VQ4A 1NK6A 2KFZA 3MXJA 4B9SA 5DMRA 1GOBA 3C95A 1D9DA 4W5TA 3SUQA 3TAMA 3KK2A 1SL0A 1YVUA 2Z1GA 2RPIA 3OY9A 2FBTA 4BE2A 3RMBA 3DLEA 3KK3A 3CFRA 1RTHA 1C0MA 4YNQA 4KB1A 1RT1A 4CEBA 4CESA 4CHNA 1RTDA 4CF9A 1QTMA 5I3UA 3V9UA 4N47A 1TGOA 4GW6A 5DK5A 3F9KA 4CHZA 4FLTA 1J5OA 4CGJA 1KSPA 4J2EA 5FDLA 3VA3A 4B9MA 3TAGA 2YKNA 3AO5A 3SNNA 1RT4A 4XIUA 4ELUA 1BI4B 2PZSA 3KLFA 3KD5E 3LAKA 2IDOA 3CM6A 5SWMA 3AVIA 1U45A 2XRIA 5KTQA 5JS2A 4AH9A 1RBUA 2OYQA 3IAYA 4B9VA 1C1BA 3DMJA 3NF9A 1U47A 1Z25A 2RN2A 1JLBA 3CFPA 4ZTJA 4I7FA 2G8WA 3SQ4A 1NK7A 4M3WA 4M3ZA 2DY4A 2HVIA 1RBSA 4PWDA 3V1OA 3ASMA 3AVJA 2PY5A 4KHQA 1VRUA 2YKMA 4MQ3A 4CE9A 3TAFA 4DSJA 3OS2A 3DM2A 3OYMA 2D5RA 4EP4A 1RILA 3OVNA 3QO9A 4CHPA 4FM2A 2OZSA 3AVHA 2DFFA 3NCIA 1TV6A 4JLHA 3NGYA 4OPJA 4BDYA 4DS4A 3C94A 4KI6A 3KLHA 1CZBA 3I0RA 2FBXA 4EP5A 1UA0A 1T03A 1B92A 4BWMA 3TR8A 2DTUA 3S9HA 1C1AA 1KVBA 1JLFA 1RT3A 1VSMA 4IFVA 4TSXA 4CF1A 3ZT1A 2OPRA 4EZ6A 1FXXA 4FJ8A 2HHSA 3TAPA 1IKWA 1W0HA 4H8KA 4Z4GA 3HO1A 4EZ9A 1L3VA 4FXDA 4CK2A 1ZBIA 4JS4A 1VSDA 4C8OA 1KVAA 2HW3A 1HYZA 4CHOA 3TI0A 3AO3A 4CIEA 1WLJA 2B6AA 3ZSOA 3HJFA 3CFOA 4OLAA 3ZT0A 2G8HA 2ZD1A 4F2SA 4DQQA 1C1CA 4DTNA 3NFAA 1Q8IA 4PA1A 3AVCA 4ZHRA 4FJIA 3AVKA 5CYMA 4O44A 4AHTA 1QSYA 3LANA 4B8AB 4CJKA 2E6LA 3H08A 1RT6A 5KRSA 3K5MA 4DTOA 4CJFA 1Q9YA 3SQ0A 4I9QA 4KRFA 1ASWA 4FZYA 1W9HA 1SV5A 3PX0A 3RR7A 4CEOA 4BE0A 4FLUA 4IG0A 4B08A 1IO2A 3LPTA 2X78A 4CIGA 4N5SA 4DLEA 4DLGA 1S1VA 2KFNA 3QEIA 4BDPA 4OKJA 3EYZA 3O3GA 5J2PA 3G10A 2QKKA 3KKSA 4FYDA 1U48A 1JKHA 3QEVA 4E1NA 1J9AA 2GBZA 3K58A 1G15A 3SZ2A 1BQMA 4DU1A 3DRRA 1RBRA 4AHCA 3THVA 1VSKA 3SUNA 1VSFA 3HT3A 1IKYA 1SKRA 3OYDA 1X1PA 2GUIA 4FJJA 1BGXT 1Y97A 4NYNA 3V6DA 5KGXA 1RDDA 4FLXA 3RRGA 2Z1HA 3T3FA 2EX3A 2E4LA 4F3OA 1YTUA 3DLBA 1QHTA 2Q3SA 4OKKA 3TABA 2KTQA 2G8UA 2BGGA 2IOCA 3DYAA 3K2PA 4NCGA 3OYCA 3D0PA 3V9SA 1NJWA 4L8RB 4CIFA 1KLMA 2XY5A 1VSJA 3VQ6A 4CFBA 2F8TA 3TAEA 1WSGA 1WSIA 4FJNA 2W42A 1NKEA 5I42A 1JLAA 1K6YA 2E6MA 5FROA 4CGGA 3OYAA 1JXBA 4HHTA 3JSMA 3V4IA 2HHXA 1BCMA 4FK0A 4FJ9A 4H4OA 1B9FA 1S1XA 4M45A 4DF8A 1IG9A 1KRPA 4ID1A 1ZBFA 4KHNA 3SQ1A 1D5AA 1S1UA 5FRNA 5FRMA 1XHZA 4FLZA 5J2QA 1T05A 4Z4EA 4PY5A 4CEQA 1EXQA 1RT7A 1NK8A 5KGWA 1FKPA 4DTJA 2X74A 1BIUA 1Z26A 4IG3A 3QEPA 3S3OA 4IFYA 3RTVA 1VSEA 1NOZA 3SYZA 3KLEA 5HRPA 4Z0UA 4DFJA 4WE1A 3LP0A 3ZT4A 2KW4A 1QE1A 1I3AA 3K59A 3M8RA 2R7YA 4KHUA 4N41A 1JL2A 1LWEA 1UOCA 3CG7A 2B5JA 1ASVA 3MEDA 1U4BA 3SI6A 4ELVA 1NK0A 4AHUA 1C0TA 3FFIA 4GVMA 3QNOA 4DS5A 1ZBHA 2P1JA 4CGFA 3DI6A 4DFPA 3LPUA 2XHBA 3HP6A 4HTUA 1QS4A 4R5PA 5HLFA 1S1TA 3WNEA 4J2DA 3RR8A 3V1RA 1J53A 2P51A 3I8DA 1TKZA 4DQIA 3NGIA 3M8QA 2AJQA 4O5BA 5J2NA 3RRHA 2ZE2A 2WONA 4OPKA 3QERA 2OPQA 4LY7A 4ID5A 4M42A 3HVRA 4M41A 4W5RA 3ZSZA 3SPZA 3L2VA 4OJRA 1D8YA 3B6PA 5K14A 3NF6A 1HQEA 3QNNA 1HPZA 4FM1A 1TAUA 2ATQA 1EX4A 4FJGA 2GV9A 1QQCA 4Z4FA 4Q0BA 4GMJB 2RF2A 5J1EA 1WSEA 3LP3A 1SKWA 1BISA 4DQSA 5KRTA 1TK8A 1JXEA 3K5OA 4LSNA 3S3NA 3ZT2A 5HBMA 3ZSYA 3KTQA 4KKOA 1QSLA 4B9TA 1IKXA 4K8ZA 1N6QA 3SJJA 1UWBA 4M3XA 3OYKA 2LSNA 4CJVA 5C42A 1WN7A 4PQUA 4CJEA 1KTQA 4CEDA 4DU4A 1TKDA 4DSKA 3K5LA 2XY8A 4FLWA 4CFDA 3TANA 4E1MA 3KIOA 2P5OA 1NK4A 4QOZB 3V1QA 4UQGA 3OS0A 1SUQA 3ZCMA 3ZSWA 5CZ2A 3OYJA 5C24A 3QETA 1UA1A 3O3FA 3PX4A 1GOCA 1HQUA 2VG5A 4DSFA 3AVAA 5HRNA 1FK9A 1X9WA 2FBVA 4KTQA 1LW0A 4KPYA 2OPSA 1F21A 3PO4A 3VA0A 1B9DA 2X6NA 4RW9A 3HPGA 3VQ9A 1RT2A 3HP9A 3DLGA 3EZ5A 4FCYA 3MXMA 2P5GA 4FZZA 3L3VA 1WAFA 1TKTA 4CJ3A 3U6FA 3AVBA 3HYFA 3P83D 4C8KA 4E0DA 2IAJA 4CF2A 1D9FA 4J2BA 1KVCA 3O4NA 4O4GA 2OZMA 1C0UA 1S1WA 4PUOA 1XI1A 2NUBA 3AO2A 4IDKA 3DOKA 5CZ1A 3V9WA 3QEWA 2ETJA 3OYBA 3F73A 4CGDA 3HSTB 4O0IA 2G8VA 4CEFA 3VQ7A 2YHBA 3QIPA 3P1GA 4LD0A 3LALA 1JLQA 4AHRA 5SZTA 3TWHA 3S3MA 2F8SA 1WSFA 4KREA 3VQDA 1NKCA 3TAQA 1X9MA 2XY6A 4C8NA 4CEZA 4ICLA 3WNHA 1R0AA 4CHQA 4FJMA 1KLNA 4KHSA 4CJWA 3ALYA 3LZIA 4E7IA 1NJXA 4DQRA 3SV3A 1HNVA 3KD1E 3DLRA 4E7KA 3VQEA 3L2QA 2KZMA 3HM9A 3LDSA 3I0SA 4CEAA 4FLYA 1DLOA 3VQQA 2HB5A 4FW1A 4KFBA 2B4JA 3AA5X 3DRSA 1ZYQA 3L2WA 3K5NA 4MFBA 4RW8A 1SKSA 1CXQA 3OYIA 3UIQA 4Z4HA 1L3UA 2X6SA 4KTZA 4Y1DA 5HROA 1S6PA 4CF0A 4DFKA 3HPOA 4CJQA 2JGUA 2KZZA 2RKIA 3V81A 3AA2A 3AV9A 3VQPA 4KHWA 4NCAA 4NCBA 4C8MA 1EP4A 3ITHA 2DFEA 1TL3A 4CERA 1VK0A 1SL1A 3K57A 3VQBA 5D3GA 3T19A 2HVHA 2O4IA 1DTQA 4DTMA 4AHSA 4F4KA 2HHTA 3LWMA 1LW2A 1L3SA 1ASUA 3OYGA 3HVTA 1BQNA 3T1AA 4F8RA 3KJVA 3E01A 1TL1A 1T8EA 5CYQA 4B9NA 2BANA 1JLCA 4OGEA 4FM0A 2HHQA 4C8LA 4E7JA 3OS1A 4E89A 4DSIA 1L3TA 1KFDA 2BE2A 1XWLA 3SUPA 2OA8A 4W5OA 4DSEA 4DTRA 3ZSQA 1O1WA 4HVJA 3U3YA 3NAEA 2Y1IA 3PX6A 4NYFA 1BI4A 1QSSA 3NGZA 1N5YA 1S9GA 2PYLA 1TAQA 1XC9A 1VSLA 1CXUA 3PUFA 3RMCA 2IGIA 1Q9XA 4CJSA 4Y1CA 3HL8A 3AA4A 5EU7A 1A5XA 1KCFA 3AVFA 2WOMA 3HPHA 3SQ2A 4KV8A 1S9EA 4CGIA 2YHAA 4W5NA 4OGCA 2JLEA 1NK5A 4HCBA 1A5VA 2HNYA 3RMDA 3PY8A 1NJYA 3NHGA 3SV4A 2Y1JA 4B9LA 4RG8A 1IKVA 2VWKA 4CFCA 4YFUA 4CJ5A 1WSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAR A;  3IRX A;  3SUO A;  3AVM A;  4FW2 A;  4CHY A;  1FKO A;  4DFM A;  1NJZ A;  3M8P A;  4AHV A;  4IKF A;  4KHY A;  4LSL A;  3M8S A;  1HRH A;  4O55 A;  3L2R A;  4HUF A;  3HXM A;  4BE1 A;  4E7H A;  4W5Q A;  1NOY A;  4JS5 A;  3WNG A;  1RDB A;  2ITG A;  4CCH A;  2G8K A;  1C6V A;  3OYF A;  1VSI A;  2D0C A;  1EKE A;  4E3S A;  1SL2 A;  1T7P A;  3U3G A;  2HHV A;  4F2R A;  3OYH A;  4BWJ A;  3NE6 A;  3LZJ A;  4CJP A;  3C6U A;  4FJ7 A;  4I9L A;  1HYS A;  2HNZ A;  3A2F A;  1S6Q A;  1RBT A;  1RCH A;  3MEG A;  4DG1 A;  2QK9 A;  3L2U A;  4AIL C;  4FK4 A;  4FZX C;  3AO4 A;  3O3H A;  3KKR A;  2G8I A;  4CK1 A;  4M3T A;  2HHW A;  1WSJ A;  2YNF A;  1HYV A;  2VG6 A;  1WNS A;  3JYT A;  2XY7 A;  2G8F A;  1IH7 A;  1TKX A;  4DTS A;  1RBV A;  2DFH A;  1REV A;  3BGR A;  2FC0 A;  4B8C A;  1JLE A;  4DTP A;  1I39 A;  1WAJ A;  3LWL A;  4LH4 A;  4B9U A;  2QKB A;  4O0J A;  4E19 A;  2HMI A;  1CLQ A;  4OLB A;  1TVR A;  4FJH A;  1EET A;  3ZSR A;  3MAQ A;  2IS3 A;  4DTU A;  3VQ5 A;  1NK9 A;  1LAV A;  3C6T A;  3ULD A;  4CEE A;  4FJ5 A;  4N76 A;  4CJU A;  3QLH A;  2EHG A;  4HUG A;  3NF8 A;  4JRP A;  2FBY A;  4LH5 A;  1A5W A;  5HP1 A;  3ZSX A;  2BDP A;  4FK2 A;  3VQC A;  4DTX A;  4CFA A;  3V9X A;  4RW7 A;  4DSL A;  3OJU A;  2I5J A;  1ZBU A;  3NBP A;  2VG7 A;  3WNF A;  1VSH A;  3KLG A;  1X9S A;  1LWF A;  3D45 A;  3ZT3 A;  3OYN A;  4HCC A;  4QCL A;  2A1S A;  3QIO A;  1TK5 A;  4FJX A;  4F3T A;  1BCO A;  3L3U A;  4DWI A;  1JL1 A;  3NH2 A;  3VN5 A;  1HJR A;  3ISN C;  3V9Z A;  3IS9 A;  5HRS A;  1S5J A;  4I2Q A;  3O4Q A;  4FVM A;  3VQA A;  3ZSV A;  3CQ8 A;  3QEX A;  1ZBL A;  3RWU A;  3LAM A;  1XHX A;  3MEE A;  4CGH A;  3G0Z A;  5E41 A;  1HNI A;  1RDC A;  2YNI A;  1JLG A;  1RTJ A;  1HMV A;  1BHL A;  1RT5 A;  3HK2 A;  3DLH A;  3OJS A;  2IC3 A;  3OYL A;  4ZTF A;  4DQP A;  4KTW A;  3AVG A;  3EY1 A;  2A1R A;  2Z1J A;  4CK3 A;  4RW4 A;  3CM5 A;  4FLV A;  3SCX A;  1DTT A;  3L8B A;  4RW6 A;  3NH0 A;  3PV8 A;  4KB0 A;  3KK1 A;  1YT3 A;  5CY4 A;  2PYJ A;  3B6O A;  3BDP A;  4FJK A;  3AVN A;  4JRQ A;  4CF8 A;  1LAW A;  3QIN A;  5J2M A;  3AVL A;  1LWC A;  4DF4 A;  4M3Y A;  3MEC A;  3NF7 A;  4H4M A;  3VQ8 A;  4DU3 A;  4J2A A;  1NKB A;  3P5J A;  5HRR A;  2YNG A;  4OVL A;  4CJL A;  4OKE A;  3MXI A;  4K8X A;  2HHU A;  3QES A;  2F96 A;  4BDZ A;  2VWJ A;  3CYM A;  2OPP A;  4HUE A;  2QXF A;  4Z4C A;  3RMA A;  2D0B A;  1UAX A;  4CJT A;  1YTA A;  5KI6 A;  5C25 A;  1RDA A;  4CEC A;  1BL3 A;  1U04 A;  3DOL A;  4QAG A;  1GOA A;  1ITG A;  5T7B A;  3PO5 A;  1RTI A;  2YNH A;  4M3U A;  5JS1 A;  1KFS A;  4E7L A;  4ELT A;  3KLI A;  2D0A A;  4I2P A;  4DMN A;  3IG1 A;  1MU2 A;  1CZ9 A;  4BAC A;  2Z1I A;  3DLK A;  1VRT A;  3DRP A;  1BIZ A;  3SPY A;  2HND A;  1RNH A;  3AO1 A;  1L5U A;  1TK0 A;  4FJL A;  3AA3 A;  2ZQB A;  4KO0 A;  3NH1 A;  4B3O A;  4CJ4 A;  4G1Q A;  3LP1 A;  2KQ2 A;  2O4G A;  4CJR A;  1LV5 A;  4IBN A;  4M3R A;  2XO7 A;  4N56 A;  1J54 A;  3NDK A;  1U49 A;  3OYE A;  4Z4I A;  2YV0 X;  4KAZ A;  4Q5V A;  3LP2 A;  4KI4 A;  3VQ4 A;  1NK6 A;  2KFZ A;  3MXJ A;  4B9S A;  5DMR A;  1GOB A;  3C95 A;  1D9D A;  4W5T A;  3SUQ A;  3TAM A;  3KK2 A;  1SL0 A;  1YVU A;  2Z1G A;  2RPI A;  3OY9 A;  2FBT A;  4BE2 A;  3RMB A;  3DLE A;  3KK3 A;  3CFR A;  1RTH A;  1C0M A;  4YNQ A;  4KB1 A;  1RT1 A;  4CEB A;  4CES A;  4CHN A;  1RTD A;  4CF9 A;  1QTM A;  5I3U A;  3V9U A;  4N47 A;  1TGO A;  4GW6 A;  5DK5 A;  3F9K A;  4CHZ A;  4FLT A;  1J5O A;  4CGJ A;  1KSP A;  4J2E A;  5FDL A;  3VA3 A;  4B9M A;  3TAG A;  2YKN A;  3AO5 A;  3SNN A;  1RT4 A;  4XIU A;  4ELU A;  1BI4 B;  2PZS A;  3KLF A;  3KD5 E;  3LAK A;  2IDO A;  3CM6 A;  5SWM A;  3AVI A;  1U45 A;  2XRI A;  5KTQ A;  5JS2 A;  4AH9 A;  1RBU A;  2OYQ A;  3IAY A;  4B9V A;  1C1B A;  3DMJ A;  3NF9 A;  1U47 A;  1Z25 A;  2RN2 A;  1JLB A;  3CFP A;  4ZTJ A;  4I7F A;  2G8W A;  3SQ4 A;  1NK7 A;  4M3W A;  4M3Z A;  2DY4 A;  2HVI A;  1RBS A;  4PWD A;  3V1O A;  3ASM A;  3AVJ A;  2PY5 A;  4KHQ A;  1VRU A;  2YKM A;  4MQ3 A;  4CE9 A;  3TAF A;  4DSJ A;  3OS2 A;  3DM2 A;  3OYM A;  2D5R A;  4EP4 A;  1RIL A;  3OVN A;  3QO9 A;  4CHP A;  4FM2 A;  2OZS A;  3AVH A;  2DFF A;  3NCI A;  1TV6 A;  4JLH A;  3NGY A;  4OPJ A;  4BDY A;  4DS4 A;  3C94 A;  4KI6 A;  3KLH A;  1CZB A;  3I0R A;  2FBX A;  4EP5 A;  1UA0 A;  1T03 A;  1B92 A;  4BWM A;  3TR8 A;  2DTU A;  3S9H A;  1C1A A;  1KVB A;  1JLF A;  1RT3 A;  1VSM A;  4IFV A;  4TSX A;  4CF1 A;  3ZT1 A;  2OPR A;  4EZ6 A;  1FXX A;  4FJ8 A;  2HHS A;  3TAP A;  1IKW A;  1W0H A;  4H8K A;  4Z4G A;  3HO1 A;  4EZ9 A;  1L3V A;  4FXD A;  4CK2 A;  1ZBI A;  4JS4 A;  1VSD A;  4C8O A;  1KVA A;  2HW3 A;  1HYZ A;  4CHO A;  3TI0 A;  3AO3 A;  4CIE A;  1WLJ A;  2B6A A;  3ZSO A;  3HJF A;  3CFO A;  4OLA A;  3ZT0 A;  2G8H A;  2ZD1 A;  4F2S A;  4DQQ A;  1C1C A;  4DTN A;  3NFA A;  1Q8I A;  4PA1 A;  3AVC A;  4ZHR A;  4FJI A;  3AVK A;  5CYM A;  4O44 A;  4AHT A;  1QSY A;  3LAN A;  4B8A B;  4CJK A;  2E6L A;  3H08 A;  1RT6 A;  5KRS A;  3K5M A;  4DTO A;  4CJF A;  1Q9Y A;  3SQ0 A;  4I9Q A;  4KRF A;  1ASW A;  4FZY A;  1W9H A;  1SV5 A;  3PX0 A;  3RR7 A;  4CEO A;  4BE0 A;  4FLU A;  4IG0 A;  4B08 A;  1IO2 A;  3LPT A;  2X78 A;  4CIG A;  4N5S A;  4DLE A;  4DLG A;  1S1V A;  2KFN A;  3QEI A;  4BDP A;  4OKJ A;  3EYZ A;  3O3G A;  5J2P A;  3G10 A;  2QKK A;  3KKS A;  4FYD A;  1U48 A;  1JKH A;  3QEV A;  4E1N A;  1J9A A;  2GBZ A;  3K58 A;  1G15 A;  3SZ2 A;  1BQM A;  4DU1 A;  3DRR A;  1RBR A;  4AHC A;  3THV A;  1VSK A;  3SUN A;  1VSF A;  3HT3 A;  1IKY A;  1SKR A;  3OYD A;  1X1P A;  2GUI A;  4FJJ A;  1BGX T;  1Y97 A;  4NYN A;  3V6D A;  5KGX A;  1RDD A;  4FLX A;  3RRG A;  2Z1H A;  3T3F A;  2EX3 A;  2E4L A;  4F3O A;  1YTU A;  3DLB A;  1QHT A;  2Q3S A;  4OKK A;  3TAB A;  2KTQ A;  2G8U A;  2BGG A;  2IOC A;  3DYA A;  3K2P A;  4NCG A;  3OYC A;  3D0P A;  3V9S A;  1NJW A;  4L8R B;  4CIF A;  1KLM A;  2XY5 A;  1VSJ A;  3VQ6 A;  4CFB A;  2F8T A;  3TAE A;  1WSG A;  1WSI A;  4FJN A;  2W42 A;  1NKE A;  5I42 A;  1JLA A;  1K6Y A;  2E6M A;  5FRO A;  4CGG A;  3OYA A;  1JXB A;  4HHT A;  3JSM A;  3V4I A;  2HHX A;  1BCM A;  4FK0 A;  4FJ9 A;  4H4O A;  1B9F A;  1S1X A;  4M45 A;  4DF8 A;  1IG9 A;  1KRP A;  4ID1 A;  1ZBF A;  4KHN A;  3SQ1 A;  1D5A A;  1S1U A;  5FRN A;  5FRM A;  1XHZ A;  4FLZ A;  5J2Q A;  1T05 A;  4Z4E A;  4PY5 A;  4CEQ A;  1EXQ A;  1RT7 A;  1NK8 A;  5KGW A;  1FKP A;  4DTJ A;  2X74 A;  1BIU A;  1Z26 A;  4IG3 A;  3QEP A;  3S3O A;  4IFY A;  3RTV A;  1VSE A;  1NOZ A;  3SYZ A;  3KLE A;  5HRP A;  4Z0U A;  4DFJ A;  4WE1 A;  3LP0 A;  3ZT4 A;  2KW4 A;  1QE1 A;  1I3A A;  3K59 A;  3M8R A;  2R7Y A;  4KHU A;  4N41 A;  1JL2 A;  1LWE A;  1UOC A;  3CG7 A;  2B5J A;  1ASV A;  3MED A;  1U4B A;  3SI6 A;  4ELV A;  1NK0 A;  4AHU A;  1C0T A;  3FFI A;  4GVM A;  3QNO A;  4DS5 A;  1ZBH A;  2P1J A;  4CGF A;  3DI6 A;  4DFP A;  3LPU A;  2XHB A;  3HP6 A;  4HTU A;  1QS4 A;  4R5P A;  5HLF A;  1S1T A;  3WNE A;  4J2D A;  3RR8 A;  3V1R A;  1J53 A;  2P51 A;  3I8D A;  1TKZ A;  4DQI A;  3NGI A;  3M8Q A;  2AJQ A;  4O5B A;  5J2N A;  3RRH A;  2ZE2 A;  2WON A;  4OPK A;  3QER A;  2OPQ A;  4LY7 A;  4ID5 A;  4M42 A;  3HVR A;  4M41 A;  4W5R A;  3ZSZ A;  3SPZ A;  3L2V A;  4OJR A;  1D8Y A;  3B6P A;  5K14 A;  3NF6 A;  1HQE A;  3QNN A;  1HPZ A;  4FM1 A;  1TAU A;  2ATQ A;  1EX4 A;  4FJG A;  2GV9 A;  1QQC A;  4Z4F A;  4Q0B A;  4GMJ B;  2RF2 A;  5J1E A;  1WSE A;  3LP3 A;  1SKW A;  1BIS A;  4DQS A;  5KRT A;  1TK8 A;  1JXE A;  3K5O A;  4LSN A;  3S3N A;  3ZT2 A;  5HBM A;  3ZSY A;  3KTQ A;  4KKO A;  1QSL A;  4B9T A;  1IKX A;  4K8Z A;  1N6Q A;  3SJJ A;  1UWB A;  4M3X A;  3OYK A;  2LSN A;  4CJV A;  5C42 A;  1WN7 A;  4PQU A;  4CJE A;  1KTQ A;  4CED A;  4DU4 A;  1TKD A;  4DSK A;  3K5L A;  2XY8 A;  4FLW A;  4CFD A;  3TAN A;  4E1M A;  3KIO A;  2P5O A;  1NK4 A;  4QOZ B;  3V1Q A;  4UQG A;  3OS0 A;  1SUQ A;  3ZCM A;  3ZSW A;  5CZ2 A;  3OYJ A;  5C24 A;  3QET A;  1UA1 A;  3O3F A;  3PX4 A;  1GOC A;  1HQU A;  2VG5 A;  4DSF A;  3AVA A;  5HRN A;  1FK9 A;  1X9W A;  2FBV A;  4KTQ A;  1LW0 A;  4KPY A;  2OPS A;  1F21 A;  3PO4 A;  3VA0 A;  1B9D A;  2X6N A;  4RW9 A;  3HPG A;  3VQ9 A;  1RT2 A;  3HP9 A;  3DLG A;  3EZ5 A;  4FCY A;  3MXM A;  2P5G A;  4FZZ A;  3L3V A;  1WAF A;  1TKT A;  4CJ3 A;  3U6F A;  3AVB A;  3HYF A;  3P83 D;  4C8K A;  4E0D A;  2IAJ A;  4CF2 A;  1D9F A;  4J2B A;  1KVC A;  3O4N A;  4O4G A;  2OZM A;  1C0U A;  1S1W A;  4PUO A;  1XI1 A;  2NUB A;  3AO2 A;  4IDK A;  3DOK A;  5CZ1 A;  3V9W A;  3QEW A;  2ETJ A;  3OYB A;  3F73 A;  4CGD A;  3HST B;  4O0I A;  2G8V A;  4CEF A;  3VQ7 A;  2YHB A;  3QIP A;  3P1G A;  4LD0 A;  3LAL A;  1JLQ A;  4AHR A;  5SZT A;  3TWH A;  3S3M A;  2F8S A;  1WSF A;  4KRE A;  3VQD A;  1NKC A;  3TAQ A;  1X9M A;  2XY6 A;  4C8N A;  4CEZ A;  4ICL A;  3WNH A;  1R0A A;  4CHQ A;  4FJM A;  1KLN A;  4KHS A;  4CJW A;  3ALY A;  3LZI A;  4E7I A;  1NJX A;  4DQR A;  3SV3 A;  1HNV A;  3KD1 E;  3DLR A;  4E7K A;  3VQE A;  3L2Q A;  2KZM A;  3HM9 A;  3LDS A;  3I0S A;  4CEA A;  4FLY A;  1DLO A;  3VQQ A;  2HB5 A;  4FW1 A;  4KFB A;  2B4J A;  3AA5 X;  3DRS A;  1ZYQ A;  3L2W A;  3K5N A;  4MFB A;  4RW8 A;  1SKS A;  1CXQ A;  3OYI A;  3UIQ A;  4Z4H A;  1L3U A;  2X6S A;  4KTZ A;  4Y1D A;  5HRO A;  1S6P A;  4CF0 A;  4DFK A;  3HPO A;  4CJQ A;  2JGU A;  2KZZ A;  2RKI A;  3V81 A;  3AA2 A;  3AV9 A;  3VQP A;  4KHW A;  4NCA A;  4NCB A;  4C8M A;  1EP4 A;  3ITH A;  2DFE A;  1TL3 A;  4CER A;  1VK0 A;  1SL1 A;  3K57 A;  3VQB A;  5D3G A;  3T19 A;  2HVH A;  2O4I A;  1DTQ A;  4DTM A;  4AHS A;  4F4K A;  2HHT A;  3LWM A;  1LW2 A;  1L3S A;  1ASU A;  3OYG A;  3HVT A;  1BQN A;  3T1A A;  4F8R A;  3KJV A;  3E01 A;  1TL1 A;  1T8E A;  5CYQ A;  4B9N A;  2BAN A;  1JLC A;  4OGE A;  4FM0 A;  2HHQ A;  4C8L A;  4E7J A;  3OS1 A;  4E89 A;  4DSI A;  1L3T A;  1KFD A;  2BE2 A;  1XWL A;  3SUP A;  2OA8 A;  4W5O A;  4DSE A;  4DTR A;  3ZSQ A;  1O1W A;  4HVJ A;  3U3Y A;  3NAE A;  2Y1I A;  3PX6 A;  4NYF A;  1BI4 A;  1QSS A;  3NGZ A;  1N5Y A;  1S9G A;  2PYL A;  1TAQ A;  1XC9 A;  1VSL A;  1CXU A;  3PUF A;  3RMC A;  2IGI A;  1Q9X A;  4CJS A;  4Y1C A;  3HL8 A;  3AA4 A;  5EU7 A;  1A5X A;  1KCF A;  3AVF A;  2WOM A;  3HPH A;  3SQ2 A;  4KV8 A;  1S9E A;  4CGI A;  2YHA A;  4W5N A;  4OGC A;  2JLE A;  1NK5 A;  4HCB A;  1A5V A;  2HNY A;  3RMD A;  3PY8 A;  1NJY A;  3NHG A;  3SV4 A;  2Y1J A;  4B9L A;  4RG8 A;  1IKV A;  2VWK A;  4CFC A;  4YFU A;  4CJ5 A;  1WSH A; 
#chains in the Genus database with same CATH topology
 1TUY A;  3IRX A;  4A62 A;  3SUO A;  4CHY A;  1VQO N;  3E1Y A;  4IKF A;  4LSL A;  3TTD A;  3M8S A;  4O55 A;  4HUF A;  4JS5 A;  1C6V A;  1EKE A;  3O9Q A;  2F9T A;  3CC2 N;  1HYS A;  2HNZ A;  3A2F A;  4YOY A;  3MEG A;  4DG1 A;  5HL7 L;  5CHI A;  4AIL C;  1VQ9 N;  1XC3 A;  3AO4 A;  3G25 A;  3KKR A;  2PFU A;  3MN9 A;  2YNF A;  2VG6 A;  4H5V A;  2XY7 A;  1SS6 A;  1IH7 A;  1TKX A;  3A5N C;  1RBV A;  2FC0 A;  4B8C A;  1I94 K;  1JLE A;  1ATS A;  4WFB L;  4LFA K;  4K42 A;  2QKB A;  4O0J A;  1NLV A;  3ZSR A;  3VEY A;  1LAV A;  2QI2 A;  4CZE A;  2EHG A;  4M7X A;  2BDP A;  3R9P A;  4CFA A;  4RW7 A;  5JMV A;  5BPL A;  3NBP A;  2VG7 A;  4JEP A;  3PIO L;  3CJ7 A;  3QML A;  3SJH A;  2P9N B;  5KQD A;  4HCC A;  4FJX A;  1TK5 A;  4BR7 A;  4F3T A;  1BCO A;  4DWI A;  1S5J A;  2QTD A;  4FVM A;  3CQ8 A;  3QEX A;  2D0O A;  1HNX K;  3UB5 A;  2ITM A;  5M1O A;  4DR6 K;  1RT5 A;  4FSV A;  2YJF A;  4KTW A;  3CC4 N;  2A1R A;  2HBM A;  3HI0 A;  3SCX A;  3L8B A;  4RW6 A;  3NH0 A;  3PV8 A;  4KB0 A;  2P9P A;  2PYJ A;  1YXQ A;  4FJK A;  4JD2 A;  4H0P A;  4CF8 A;  1LAW A;  3O4W A;  3QIN A;  2FF3 B;  4M3Y A;  3MEC A;  4H4M A;  3VQ8 A;  5GAG P;  1NKB A;  5HRR A;  4OVL A;  2VYP A;  4WFA L;  1IBL K;  4OKE A;  4K8X A;  5EY4 A;  2F96 A;  4X62 K;  2VWJ A;  5AQW A;  2OPP A;  4HUE A;  4RWT A;  2QXF A;  3RMA A;  5AQP A;  1UAX A;  5FPN A;  1RDA A;  1U2V A;  4CEC A;  2ZJR L;  1BL3 A;  3ZX2 A;  4QAG A;  3M3Z A;  1VHX A;  2OAN A;  3PO5 A;  4CZF A;  3OW2 M;  4NXN K;  1Z6R A;  3SMS A;  1KFS A;  2A6A A;  3KLI A;  4DMN A;  3IG1 A;  1O13 A;  1CZ9 A;  4BAC A;  3DLK A;  4FWS A;  4MO5 A;  2P9K A;  5A2Q O;  5DM7 L;  4BR9 A;  1LV5 A;  1TUU A;  3OYE A;  4DUY K;  4KAZ A;  2QWQ A;  1NK6 A;  3CPW M;  2P9P B;  3MXJ A;  3C95 A;  4JHD B;  2QW9 A;  1D9D A;  3SLC A;  1X3M A;  1YVU A;  2Z1G A;  3L6Q A;  2KHO A;  3VPZ A;  4BRQ A;  4YNQ A;  1RTD A;  4BRK A;  4CF9 A;  5I3U A;  4K43 A;  4X64 K;  3MN7 A;  3VA3 A;  4AF1 A;  2UUB K;  1RT4 A;  4UY8 O;  2PZS A;  3KLF A;  3ZET A;  5SWM A;  1P8Z A;  3AVI A;  5EX5 A;  3DMJ A;  1JLB A;  1NK7 A;  2A5X A;  1QQO A;  1VQ7 N;  1RBS A;  1QQN A;  4I6M B;  1VRU A;  1Q18 A;  5ADX H;  3VF6 A;  3DM2 A;  4CHP A;  2GEM A;  4OPJ A;  5C10 A;  4GKK K;  1EWR A;  3TSQ A;  1UA0 A;  4EFH A;  4WFN L;  1T03 A;  4BVO A;  3K9J A;  1DGK N;  1C1A A;  1KVB A;  4YOW A;  3ZT1 A;  2OPR A;  4EZ6 A;  4FJ8 A;  4LFB K;  1W0H A;  4EZ9 A;  4FXD A;  1TYQ B;  1KVA A;  1HYZ A;  3D7E O;  1WLJ A;  4IEE A;  4WYB A;  1XNR K;  4YDU A;  3ZT0 A;  4DTN A;  3J7A P;  4PA1 A;  4FJI A;  4AHT A;  4B8A B;  3H08 A;  4KRF A;  4I9Q A;  1ASW A;  1W9H A;  3FZH A;  2JWL A;  5IT9 O;  2X78 A;  4N5S A;  4DLG A;  3WEE B;  2KFN A;  4BDP A;  2QKK A;  5AQS A;  2UXB K;  3KKS A;  4DU1 A;  1X3N A;  5GAE P;  4IJA A;  5AR0 A;  1RBR A;  4PL7 A;  2NRV A;  1VSK A;  4GV9 A;  1VSF A;  3HT3 A;  3OYD A;  1VQM N;  3V6D A;  1RDD A;  2EX3 A;  4F3O A;  3DLB A;  4OKK A;  3TAB A;  5H1S Q;  1QZ5 A;  3FZL A;  3D0P A;  4L8R B;  1HNW K;  4CIF A;  3TAE A;  5I42 A;  3OYA A;  4JI3 K;  4HHT A;  2HHX A;  1BCM A;  3J7Y P;  4FJ9 A;  4DR2 K;  4GV6 A;  1IG9 A;  4DF8 A;  5AQX A;  2ZM6 K;  3BP8 A;  3SQ1 A;  3LL3 A;  5FRM A;  5LJV A;  3O1B A;  1RT7 A;  4DTJ A;  1FKP A;  2X74 A;  1BIU A;  1Z26 A;  2O8D A;  1BG3 A;  2HF3 A;  3NVM A;  1ESV A;  1NOZ A;  3O08 A;  3SYZ A;  3KLE A;  4Z0U A;  3CG7 A;  3MED A;  4JKC A;  2NRZ A;  2P9I A;  4GVM A;  2VQE K;  2OCE A;  4DS5 A;  3MN5 A;  3H45 C;  4G9Z A;  3LPU A;  2QWN A;  4HTU A;  4R5P A;  4J2D A;  3EE9 A;  3RR8 A;  4O5B A;  3DXM B;  3VEV A;  2ZE2 A;  2Q1N A;  2WON A;  4OPK A;  5BPN A;  4LY7 A;  4ID5 A;  3O9R A;  3HVR A;  4NB4 A;  3QNN A;  1HQE A;  3ATU A;  3CD6 N;  2ATQ A;  4BR5 A;  4FJG A;  4Q0B A;  2GV9 A;  1QQC A;  5KPZ A;  3CMA N;  4GMJ B;  5J1E A;  1SKW A;  1BIS A;  1YVN A;  2QA4 N;  4R79 A;  1VQ8 N;  1IKX A;  4M3X A;  1WN7 A;  4PQU A;  2CH6 A;  3D2E B;  3CQY A;  1TKD A;  4E1M A;  3KIO A;  3KWG A;  2CGK A;  3SBG A;  4KH6 A;  3OYJ A;  4YOV A;  3HTV A;  2FLO A;  3PX4 A;  3DXK B;  4DV4 K;  5HRN A;  1FK9 A;  1X9W A;  2FBV A;  3VMF B;  1NMD A;  3PO4 A;  5AFU A;  3VA0 A;  2V51 B;  4BQZ A;  3C6A A;  3EZ5 A;  2P5G A;  3MXM A;  1QVG M;  1S3X A;  1WAF A;  4MDA A;  3U6F A;  3HYF A;  1CZA N;  3P83 D;  4C8K A;  4E0D A;  2OZM A;  4PUO A;  4JI4 K;  2NUB A;  4IDK A;  3H1Q A;  5CZ1 A;  3QEW A;  4K0K K;  2ETJ A;  4CD3 A;  4B1U B;  4CBW A;  3HST B;  4CGD A;  5AQV A;  4YOR A;  3VQ7 A;  3QIP A;  2WFB A;  5DM6 L;  3TTF A;  2QM1 A;  2JWK A;  2UXC K;  1GLL O;  1HUX A;  1WSF A;  1NKC A;  2O8B B;  4C8N A;  4CEZ A;  1KLN A;  5AQN A;  1HKG A;  3L4I A;  3LZI A;  1Z05 A;  4E7I A;  1NJX A;  2CH5 A;  3VQE A;  3T7Z A;  1K73 O;  3I0S A;  4CEA A;  3O9U A;  1IJJ A;  3DRS A;  3J80 O;  1CXQ A;  4Y1D A;  4KTZ A;  5HRO A;  1ZC6 A;  2Q2R A;  2KZZ A;  3VQP A;  5LMU K;  4NCA A;  4NCB A;  1EP4 A;  4BY9 C;  1SL1 A;  1QHA A;  1DTQ A;  2YJE A;  1WBB A;  2FXU A;  4AHS A;  4F4K A;  1XQS C;  1ASU A;  4OO1 J;  1YF5 L;  3T1A A;  1WUA A;  1TL1 A;  4CJ7 A;  5HOO A;  2E8A A;  2BAN A;  4OGE A;  4FVU A;  4BRE A;  1OH7 A;  4C8L A;  3OS1 A;  4E89 A;  1SAZ A;  2BE2 A;  2OA8 A;  3QB0 A;  4RCH A;  3NAE A;  2Y1I A;  2HST A;  2PYL A;  5AQR A;  1YIJ N;  3DXM A;  4DV5 K;  5EU7 A;  1A5X A;  4MLH A;  2GEL A;  1S9E A;  3C65 A;  1A5V A;  1NJY A;  3O8M A;  3NHG A;  3M6G A;  4B9L A;  4CFC A;  4NLC A;  3ID8 A;  3OA9 A;  3AVM A;  4FW2 A;  3T1H K;  1NJZ A;  4DFM A;  1QQM A;  4AHV A;  2GWJ A;  2Q0U A;  3L2R A;  4E7H A;  2NRR A;  3CCJ N;  1NOY A;  3I55 N;  3WNG A;  2G8K A;  4PKI A;  3ENB A;  3D2F A;  1T7P A;  4F2R A;  4JKG B;  4BWJ A;  3LZJ A;  3C6U A;  3BUZ B;  1S6Q A;  2NRH A;  1T6C A;  2QK9 A;  4FK4 A;  4FZX C;  4BRD A;  1S22 A;  2QXL A;  5C2F A;  1WSJ A;  4H0O A;  1WNS A;  4DR5 K;  4H5R A;  4DTS A;  2Q0R A;  3ZYY X;  2YCH A;  1W97 L;  2W41 A;  1I39 A;  5LL6 Z;  5B8H A;  3FR0 A;  4H03 B;  5JVG L;  1NNE A;  1CLQ A;  4OLB A;  1Y64 A;  2E2P A;  3A5O C;  3MAQ A;  4JI2 K;  2AP1 A;  4DTU A;  4FJ5 A;  3QFU A;  2FBY A;  4LH5 A;  4FWR A;  3VQC A;  2FF6 A;  3OJU A;  1ZBU A;  4IOX A;  3GDQ A;  4FPB A;  1VSH A;  3KLG A;  3D45 A;  2Q97 A;  3OYN A;  4QCL A;  2A1S A;  3QIO A;  3L3U A;  3Q7C A;  3ISN C;  4M63 C;  1ZBL A;  3RWU A;  1XHX A;  3G0Z A;  1RDC A;  3WXM B;  1RTJ A;  4CZH A;  3QBX A;  3JS6 A;  1BHL A;  4IXC A;  3CC7 N;  1ATR A;  2IC3 A;  4ZTF A;  3M5R A;  4DQP A;  2KKZ A;  4CK3 A;  4RW4 A;  4C23 A;  5AZJ B;  4ISF A;  1NGC A;  3KK1 A;  3B6O A;  4WCE L;  4JRQ A;  2YX6 A;  3NMU A;  3P5J A;  1OVY A;  4CI6 A;  5AQZ A;  4CJL A;  1G99 A;  3AAP A;  4PL8 A;  4Z4C A;  3EO3 A;  2ZJQ L;  2WUS A;  4FWQ A;  4CJT A;  2E2O A;  3CCL N;  4XH1 A;  3C7N A;  4X66 K;  4BR4 A;  1OKJ A;  1W7A A;  4ELT A;  4DR7 K;  1MU2 A;  2P9U A;  2P9N A;  2Z1I A;  3TSP A;  1K8A O;  1TK0 A;  3C6H A;  2W40 A;  3NH1 A;  4B3O A;  2CGL A;  3CQX A;  4CJ4 A;  4G1Q A;  2KQ2 A;  4IBN A;  1NM1 A;  4M3R A;  1U49 A;  1J54 A;  3NDK A;  4B3R K;  5C12 A;  4Q5V A;  4KI4 A;  3VQ4 A;  3QDK A;  2KFZ A;  4JI6 K;  4EHT A;  4B9S A;  4W5T A;  3THX B;  4BRA A;  1SL0 A;  4A5B A;  1SZ2 A;  1YUW A;  4BE2 A;  3A8Y A;  3DLE A;  3KK3 A;  1C0M A;  1OH8 A;  1R59 O;  1YAG A;  3FZM A;  4CHZ A;  3F9K A;  3QIC A;  4CGJ A;  2GX9 A;  5AZJ A;  5FDL A;  4B9M A;  3CCE N;  3MX5 A;  5AQI A;  4XIU A;  1BI4 B;  3FE1 A;  1NG9 A;  3LAK A;  1BUP A;  5KTQ A;  1RBU A;  4ZTJ A;  4I7F A;  1IBK K;  2HVI A;  2PY5 A;  1BWF O;  4MQ3 A;  4CE9 A;  4WQ5 A;  1RIL A;  3OVN A;  2OZS A;  4B1X B;  2DFF A;  3NCI A;  4BDY A;  3C94 A;  5JLH A;  1CZB A;  4BRM A;  3KLH A;  2EWS A;  1NGG A;  3G6E N;  3CCR N;  1ILY A;  3S9H A;  1NBW A;  4DB3 A;  1J6Z A;  1JLF A;  1VSM A;  3TAP A;  2ASM A;  3HO1 A;  4JS4 A;  3VOV A;  2HW3 A;  4CHO A;  5C2D A;  4CIE A;  3DWL A;  3CFO A;  4LF9 K;  4OLA A;  1GLB G;  4F2S A;  1C1C A;  2O8F A;  1Q8I A;  3AVK A;  1FW6 A;  1K9M O;  1BO5 O;  2E6L A;  1RT6 A;  2NRT A;  3P4I A;  5KRS A;  4CJF A;  3K5M A;  4DTO A;  3SQ0 A;  2Q31 A;  1Q9Y A;  2FSJ A;  4CEO A;  4BE0 A;  1NGI A;  2P9S B;  1DKG D;  4BC2 A;  2IIR A;  1S1V A;  3NVK A;  4AM6 A;  3QEI A;  4OKJ A;  5J2P A;  3O3G A;  5BN9 A;  3ENO A;  2WTU A;  3QEV A;  4E1J A;  1BQM A;  5KPT A;  4KH4 A;  4AHC A;  1JCG A;  4GNI A;  1IKY A;  1BGX T;  1Y97 A;  5FPE A;  3THW B;  4YY3 K;  4NYN A;  2Z1H A;  1QHT A;  2P9U B;  2KTQ A;  2WBN A;  4NCG A;  3K2P A;  2BGG A;  1NJW A;  2XY5 A;  1VSJ A;  4CFB A;  2F8T A;  1WSG A;  3MWP A;  1WSI A;  4HTL A;  3TPQ A;  2W42 A;  1NKE A;  2BH1 A;  5FRO A;  4M7Y A;  3V4I A;  4H0V B;  4KHN A;  3I33 A;  5I9E B;  4IFE A;  4CEQ A;  1NK8 A;  5KGW A;  3THX A;  5BR8 K;  4IG3 A;  3GOI A;  3S3O A;  3RTV A;  1VSE A;  1KXP A;  3CHW A;  4DFJ A;  4WE1 A;  3LP0 A;  3ZT4 A;  1QE1 A;  2RE2 A;  3KHY A;  4KHU A;  3ULE A;  1JL2 A;  2NRX A;  2B5J A;  3SI6 A;  4ELV A;  4AHU A;  3FFI A;  4CGF A;  3P39 A;  1QS4 A;  5HLF A;  4IWV A;  4DQI A;  3I8D A;  1TKZ A;  4M42 A;  5AQY A;  3SAF A;  4M41 A;  4W5R A;  5K14 A;  1EX4 A;  3S41 A;  1YJN N;  3G71 N;  1JXE A;  3K5O A;  4LSN A;  1V4T A;  3ZSY A;  3KTQ A;  4KKO A;  4K8Z A;  3RVC A;  1X9J A;  2LSN A;  3LDN A;  4A59 A;  5C42 A;  1KTQ A;  3K5L A;  3TSU A;  2P5O A;  3VEO A;  1NK4 A;  5GIO A;  5FPM A;  4QOZ B;  3ZCM A;  2VCP A;  5ADX A;  5GAD P;  4BG8 A;  5C24 A;  3O3F A;  3B8A X;  2E2Q A;  2OPS A;  3EKS A;  3IMX A;  4U67 L;  3HP9 A;  3ENH A;  1EO1 A;  3EL2 A;  1N33 K;  3F2K A;  3WXI A;  1KVC A;  1GLE G;  2QWO A;  5JVH L;  3UKR A;  4O0I A;  3VGK A;  2HHH K;  4CEF A;  2BUP A;  4LD0 A;  3N4Q A;  3THY B;  2F8S A;  4QS9 A;  4YOX A;  3MMV A;  1YJ9 N;  3R6M A;  3TAQ A;  3EE8 A;  4CJW A;  5TKY A;  4DQR A;  2CGJ A;  1QVF M;  4E7K A;  4CZG A;  5BR9 A;  4B3M K;  2PBD A;  2O8E A;  4FW1 A;  2B4J A;  4HWI A;  3UIQ A;  3K5N A;  3CJ1 A;  4MFB A;  4RW8 A;  1L3U A;  2X6S A;  3UKU A;  1S6P A;  2ZGZ A;  1NGF A;  4CF0 A;  4BRC A;  3CJ9 A;  2RKI A;  3I56 N;  3AA2 A;  3AV9 A;  4K25 A;  5FLX O;  4NO7 A;  1TL3 A;  1RDU A;  4V19 S;  1VK0 A;  2O4I A;  2E1Y A;  1NJI O;  4DR1 K;  1KC8 O;  3E9L A;  5AQH A;  1LW2 A;  4IOC L;  5E84 A;  3HVT A;  1NU0 A;  1RDW X;  3E01 A;  3SAG A;  4ISG A;  4EAH D;  3A0I X;  4DSI A;  3EN9 A;  1JCE A;  4EIA A;  4CBU A;  2VGM A;  1KAX A;  1HPM A;  1Q86 O;  3U3Y A;  5AQT A;  4NYF A;  3W0L A;  3QFP A;  2QWM A;  2W6K A;  3CET A;  4WQ4 C;  4JI0 K;  1CXU A;  2E20 A;  3RMC A;  2IGI A;  4BC5 A;  4Y1C A;  3HL8 A;  2P9L B;  2HOE A;  3HPH A;  5CE3 A;  2JLE A;  4A2A A;  4RG8 A;  4YFU A;  3TAR A;  4CZJ A;  2GWK A;  1FKO A;  4KHY A;  3HZ6 A;  3HXM A;  3T69 A;  4BE1 A;  4JI1 K;  4YOT A;  1HKB A;  1RDB A;  4CCH A;  4XH5 A;  4JI7 K;  5BRF A;  2V7Z A;  1VSI A;  2D0C A;  4E3S A;  3DAW A;  1SL2 A;  3OYH A;  1KD1 O;  1D4X A;  3K9K A;  4CJP A;  4I9L A;  4I6M A;  2E1Z A;  1RBT A;  1RCH A;  3L2U A;  2G8I A;  4CK1 A;  4M3T A;  3VTI A;  3DXK A;  4FWN A;  4L3Q A;  3VTH A;  1WOQ A;  1HYV A;  3JYT A;  2G8F A;  4B3T K;  3M1F A;  1REV A;  3CJA A;  1MWK A;  2O8E B;  3LWL A;  4LH4 A;  2ZJP L;  3O80 A;  4E19 A;  1ATN A;  2HMI A;  3ATV A;  1GLA G;  1EET A;  3LM2 A;  1NK9 A;  3C6T A;  5F1X A;  3ULD A;  4CJU A;  4JK8 A;  3NF8 A;  5HP1 A;  4FK2 A;  4BC4 A;  3V9X A;  2I5J A;  1RGI A;  1MA9 B;  3RSE B;  2GUP A;  1LWF A;  3ZT3 A;  5BPM A;  1XUP O;  5MLC Q;  1JL1 A;  3V9Z A;  3IS9 A;  4I2Q A;  3O4Q A;  3U9D A;  3ZSV A;  3LAM A;  3MEE A;  4CGH A;  5E41 A;  2YNI A;  1JLG A;  1HMV A;  4BR0 A;  3DLH A;  3OJS A;  5AZI B;  3OYL A;  3AVG A;  2Z1J A;  2F9W A;  1DTT A;  1VQ6 N;  1LOT B;  2YHY A;  5CY4 A;  3C0B A;  4NLB A;  1T6D A;  3J8A A;  3HOS A;  4B1W B;  4BR2 A;  3NF7 A;  4H0Y B;  4J2A A;  3MXI A;  5LY3 A;  3PIP L;  3QES A;  4BDZ A;  5BRH A;  4K41 A;  2D0B A;  1N8R O;  1YTA A;  5KI6 A;  1GOA A;  1IBM K;  5M1Q A;  1E4F T;  1MWM A;  2BTF A;  4M3U A;  4E7L A;  3F9M A;  1DEJ A;  4BRF A;  1FJG K;  3DRP A;  1BIZ A;  3CI5 A;  3SPY A;  4JKB A;  1L5U A;  4B1V A;  3P38 A;  3AA3 A;  5CR4 A;  3LP1 A;  4CJR A;  2UYT A;  1VQL N;  2YV0 X;  3IUC A;  3UE5 A;  3BEX A;  1YIT N;  3LP2 A;  3WXJ A;  5DMR A;  1GOB A;  5EOY A;  3I8B A;  3TAM A;  3SUQ A;  3KK2 A;  4AQY K;  2RPI A;  3OY9 A;  2FBT A;  5AZI A;  3EZW A;  3ZEU B;  3JAM O;  4KB1 A;  4CEB A;  4CES A;  1VQK N;  1QTM A;  1TGO A;  1WBD A;  4FLT A;  4J2E A;  2W6L A;  4YDU C;  4JKD A;  4YOU A;  2YKN A;  3SNN A;  4ELU A;  2IDO A;  3CER A;  3CM6 A;  4JKE A;  3U8X A;  5JS2 A;  2OYQ A;  3IAY A;  3HSC A;  1Z25 A;  3CFP A;  4M3Z A;  4M3W A;  2DY4 A;  1LCU A;  5AQF A;  4PWD A;  3AVJ A;  4XEI A;  2YKM A;  3TAF A;  3OS2 A;  2D5R A;  4EP4 A;  1S72 N;  1YTU A;  1XNQ K;  4KI6 A;  3I0R A;  3OHR A;  4EP5 A;  2DTU A;  4IJN A;  3WEE A;  1RT3 A;  4IFV A;  1C0F A;  2F7T A;  1FXX A;  1IKW A;  4H8K A;  1L3V A;  2HF4 A;  4CK2 A;  4C8O A;  3TI0 A;  4H5W A;  2B6A A;  3ZSO A;  2WC9 A;  2G8H A;  2ZD1 A;  3VEZ A;  3VET A;  1BOT O;  4O44 A;  3IKM A;  1QSY A;  4CJK A;  3F5T A;  4A2B A;  3GE1 A;  4DQ8 A;  3PX0 A;  4FLU A;  4IG0 A;  2OTL N;  3A5M C;  4CD1 A;  4DLE A;  4A61 A;  4FYD A;  3EYZ A;  4BRL A;  1U48 A;  1JKH A;  4E1N A;  2GBZ A;  1G15 A;  3SZ2 A;  3N4P A;  3THV A;  3SUN A;  3VGL A;  1SKR A;  1X1P A;  2GUI A;  3HRG A;  4LC9 B;  2O8B A;  3W3D A;  2GTD A;  1XMQ K;  4FLX A;  2E4L A;  4J8F A;  2A3Z A;  2Q3S A;  4KBO A;  4JKF A;  3O9T A;  2IOC A;  3DYA A;  3J81 O;  3VQ6 A;  4PHT X;  1YI2 N;  3CCU N;  4FJN A;  3FZK A;  1JLA A;  4B9Q A;  4CGG A;  4EHU A;  3JSM A;  2O8C B;  1B9F A;  1KRP A;  4ID1 A;  4FWK A;  1D5A A;  4CZI A;  1S1U A;  1XHZ A;  4BC3 A;  4PY5 A;  1EXQ A;  2D4W A;  4FOI A;  4LF8 K;  4OPA A;  3MWT A;  3L4Q A;  2KW4 A;  1I3A A;  3M8R A;  4N41 A;  1UOC A;  3KWI A;  1GLC G;  4BRN A;  1NMN A;  4LF7 K;  2P9K B;  3U9Z A;  5LMN K;  1NK0 A;  1C0T A;  2QWR A;  4MLE A;  2P1J A;  1DT9 A;  3DI6 A;  4DFP A;  4JYA K;  4C1N I;  2O8C A;  4IZ9 A;  1S1T A;  3WNE A;  3V1R A;  1J53 A;  2AJQ A;  3NGI A;  3M8Q A;  3KK7 A;  1VAZ A;  3RRH A;  5J2N A;  4IO9 L;  4RTF D;  3QER A;  2OPQ A;  1H1V A;  2A40 A;  1HNZ K;  3ZSZ A;  3SPZ A;  3L2V A;  1D8Y A;  3B6P A;  1U6Z A;  1HPZ A;  1MDU B;  4Z4F A;  3IFR A;  4DQS A;  1TK8 A;  3KZB A;  2OTJ N;  3S3N A;  5HBM A;  4O5F A;  3EEQ A;  4B9T A;  3THY A;  1UWB A;  1N32 K;  4FOE A;  3OYK A;  3LDO A;  4CJV A;  2UUA K;  3UKR B;  4CJE A;  5AQQ A;  4DU4 A;  4CED A;  4O8U A;  3TAN A;  2ASP A;  1NGA A;  3V1Q A;  5IWA K;  3OS0 A;  1SUQ A;  3QET A;  2FSN A;  1HQU A;  2VG5 A;  2VGN A;  5AFU H;  1NGB A;  1LW0 A;  4KTQ A;  4KPY A;  1F21 A;  2X6N A;  4RW9 A;  3HPG A;  1RT2 A;  3DLG A;  4FCY A;  4FZZ A;  3L3V A;  1YJW N;  2KLA A;  4BGB A;  3AVB A;  4J2B A;  3O4N A;  4WQ4 A;  1NGE A;  1OVQ A;  3FFK B;  1XI1 A;  3AO2 A;  3V9W A;  2I7P A;  1VQ4 N;  3WQU A;  3FZF A;  2FSK A;  4DV1 K;  5M1P A;  2G8V A;  2YHB A;  3K0S A;  3P1G A;  5SZT A;  3LAL A;  3GL1 A;  4KRE A;  3VQD A;  4DV6 K;  2IVO A;  2UXD K;  3HOT A;  3WNH A;  4KHS A;  4KH5 A;  3PLA A;  1HNV A;  4LFC K;  3KD1 E;  3DLR A;  3OBW A;  4FLY A;  4KFB A;  1ZYQ A;  1YHQ N;  3L2W A;  1JJ2 M;  2QWP A;  2E2N A;  1BU6 O;  4DFK A;  4B3S K;  3HPO A;  2UUC K;  2JGU A;  3KVG A;  3ZX0 A;  1XMO K;  3BZC A;  3C7N B;  3R8E A;  3ITH A;  3CF5 L;  4A57 A;  5AQG A;  2HVH A;  4PKG A;  4JKG A;  1C0G A;  4DTM A;  5C0Y A;  3TTC A;  2HHT A;  1L3S A;  1ZXO A;  3OYG A;  4F8R A;  3KJV A;  4YHH K;  4Y0W A;  5CYQ A;  4FM0 A;  2HHQ A;  4LF5 K;  1KAY A;  1HLU A;  1L3T A;  1KFD A;  1XWL A;  2VWB A;  4FWL A;  4F9O A;  4DSE A;  1RFQ A;  2HMP A;  3PX6 A;  1BI4 A;  1QSS A;  4JKA A;  3NGZ A;  1N5Y A;  1S9G A;  1KAZ A;  1TAQ A;  1XC9 A;  1Q9X A;  3T1Y K;  2E88 A;  3AA4 A;  3AVF A;  3SQ2 A;  4IOA L;  4JI8 K;  4OGC A;  3ZET B;  1NK5 A;  4FWP A;  4IO8 A;  4HCB A;  3RMD A;  3P31 A;  4H5T A;  2Y1J A;  1K8K A;  5GAH P;  3SV4 A;  4CJ5 A;  3MDQ A;  5JIC A;  5M1K A;  1Q7Y O;  3M8P A;  1N36 K;  3CCV N;  1HRH A;  2A41 A;  4W5Q A;  1SQK A;  2ITG A;  4MO4 A;  4JHD A;  5JLF A;  3OYF A;  3U3G A;  5AQU A;  2HHV A;  3NE6 A;  3ID6 A;  3MX2 A;  4DV3 K;  4FJ7 A;  3MCP A;  1BDG A;  3MN6 A;  3D6R A;  1IV0 A;  3O3H A;  1IG8 A;  3IDH A;  3VF4 A;  1W2B M;  2HHW A;  4DR3 K;  1E3M A;  4H5N A;  4BRG A;  2DFH A;  3BGR A;  3PSI A;  3ZEU A;  4DTP A;  1WAJ A;  4B9U A;  5AQM A;  3D2F B;  1TVR A;  1U2V B;  4FJH A;  4LF4 K;  4JK9 A;  2IS3 A;  1VQ5 N;  3VQ5 A;  4N76 A;  4CEE A;  3QLH A;  1HX1 A;  4DHY A;  4JRP A;  4HUG A;  4O8K A;  1A5W A;  3ZSX A;  5M1N A;  4DTX A;  4DSL A;  5F0X A;  4BRH A;  3WNF A;  4FO0 A;  1X9S A;  4JI5 K;  3CIP A;  2IVN A;  3H3N O;  3WXK A;  1J5E K;  3NH2 A;  3VN5 A;  1HJR A;  5HRS A;  3VQA A;  2D0P A;  1HNI A;  3UKU B;  3HK2 A;  2YI1 A;  1T44 A;  1JCF A;  4U7B A;  3EY1 A;  3CM5 A;  4FLV A;  2NZT A;  1YT3 A;  3AAQ A;  5AQL A;  5AJ3 K;  3BDP A;  3AVN A;  3LDP A;  2V52 B;  1OH6 A;  5J2M A;  3AVL A;  5AQK A;  1LWC A;  2QWL A;  4DF4 A;  4DU3 A;  3CXC M;  2YNG A;  3ULE B;  1N34 K;  2HHU A;  1NGJ A;  3CCM N;  3CYM A;  3CME N;  3FLC O;  4FPA A;  3OBY A;  3VEN A;  3OTO K;  5C15 A;  2P9L A;  3VGM A;  5C25 A;  4OX9 K;  1U04 A;  3DOL A;  3MCA B;  2UU9 K;  1VQN N;  1ITG A;  5T7B A;  5EXW A;  1RTI A;  2YNH A;  4BQL A;  5JS1 A;  4B1Z A;  4JK7 A;  2D0A A;  3O1W A;  4I2P A;  3MK6 A;  1VRT A;  2HND A;  3VEW A;  4CZK A;  1RNH A;  3AO1 A;  3CCS N;  4FJL A;  3BF3 A;  2ZQB A;  4KO0 A;  3CJB A;  1V4S A;  2ASO A;  2O4G A;  2XO7 A;  4N56 A;  2J4R A;  4ILJ A;  4Z4I A;  2P9I B;  1QZ6 A;  2Q36 A;  3AAR A;  4QS8 A;  3H6E A;  3WQT A;  3RMB A;  3G4S N;  3CFR A;  1RTH A;  1RT1 A;  5BRD A;  4CHN A;  3V9U A;  4N47 A;  1WB9 A;  3E66 A;  4GW6 A;  5DK5 A;  1J5O A;  1KSP A;  3O6W A;  3BY5 A;  5BN8 A;  3BF1 A;  3R1X A;  1NWK A;  3TAG A;  2RHK A;  3HBT A;  3AO5 A;  3KD5 E;  3CPE A;  1U45 A;  2XRI A;  5AQJ A;  4AH9 A;  4B9V A;  1C1B A;  3NF9 A;  4DV2 K;  1U47 A;  2RN2 A;  4BRI A;  4B1Y B;  2G8W A;  3H1V X;  3SQ4 A;  3O5B A;  3V1O A;  2YHX A;  3ASM A;  4KHQ A;  3HM8 A;  4DSJ A;  5KQ8 A;  3OYM A;  3QO9 A;  4FM2 A;  3AVH A;  4DS4 A;  5LJW A;  1TV6 A;  4JLH A;  3NGY A;  3H46 O;  2FBX A;  4DR4 K;  1B92 A;  4BWM A;  4JKH A;  3TR8 A;  3CCQ N;  3DLL L;  4CBX A;  3E9O A;  3AY9 A;  4TSX A;  4CF1 A;  2HHS A;  4ILG B;  1HJO A;  4Z4G A;  2DPN A;  3EKU A;  1KQS M;  1ZBI A;  2QEX N;  1VSD A;  5FPD A;  3AO3 A;  3L0Q A;  2ZWH A;  3HJF A;  4BGA A;  4DQQ A;  2ZF5 O;  3E9P A;  3NFA A;  3AVC A;  4ZHR A;  5CYM A;  2F4V K;  3LAN A;  3AGK A;  3J7Z O;  1GLD G;  1ZBS A;  3WT0 A;  4FZY A;  1BA1 A;  1SV5 A;  3RR7 A;  4B08 A;  1IO2 A;  3LPT A;  4GVE A;  4IDH A;  4CIG A;  1Q81 O;  4IEI A;  3G10 A;  1E4G T;  3DJC A;  1TYQ A;  1J9A A;  3Q7B A;  2HBJ A;  3K58 A;  5E26 A;  3DRR A;  3VES A;  4FJJ A;  2O8D B;  3VF2 A;  3FGU A;  5KGX A;  4X65 K;  3RRG A;  3T3F A;  2D1K A;  2G8U A;  3V9S A;  3U4L A;  3OYC A;  3VER A;  1KLM A;  3WUH A;  4DV0 K;  4QS7 A;  3AGR A;  1NGH A;  1K6Y A;  2E6M A;  1JXB A;  3ZLJ A;  4FK0 A;  1VQP N;  4CZM A;  4H4O A;  4M45 A;  1S1X A;  4BG9 A;  1ZBF A;  4CW7 B;  3TU5 A;  3BZK A;  4XH4 A;  5FRN A;  1T05 A;  4WQ5 C;  3H3O B;  4FLZ A;  5J2Q A;  4Z4E A;  3QEP A;  4IFY A;  1EWQ A;  4A5A A;  4FL9 A;  5HRP A;  3K59 A;  2IVP A;  2R7Y A;  1LWE A;  3GBT A;  1ASV A;  1P90 A;  1U4B A;  4FWO A;  3QNO A;  4DCH A;  1Q82 O;  1ZBH A;  2NNW A;  2XHB A;  3HP6 A;  5ELZ A;  4CVN E;  2P51 A;  4OJR A;  3NF6 A;  1TAU A;  4FM1 A;  2RF2 A;  1GLF O;  1WSE A;  3LP3 A;  2ZGY A;  5KRT A;  3ZX3 A;  4H0X B;  4DUZ K;  3ZT2 A;  4MDB A;  1QSL A;  4H0T B;  3SJJ A;  1N6Q A;  3O9S A;  3SBT A;  4ILH A;  4DSK A;  4FLW A;  2NLX A;  2XY8 A;  4CFD A;  4UQG A;  1M1K O;  4JD2 B;  2YHW A;  3VEX A;  3ZSW A;  5CZ2 A;  1UA1 A;  4JAX A;  1GOC A;  4DSF A;  1HKC A;  2HBK A;  3AVA A;  5F2R A;  2PAV A;  4Z94 A;  1B9D A;  5EVZ A;  4FWM A;  3VQ9 A;  2O8F B;  5TKW A;  1GLJ O;  1TKT A;  4CJ3 A;  2IAJ A;  4CF2 A;  1NGD A;  2VQF K;  1D9F A;  2H3G X;  4O4G A;  4ISE A;  1C0U A;  1S1W A;  4JV5 K;  3DOK A;  3LDL A;  3OYB A;  3D2E A;  3F73 A;  4JN4 A;  2NRW A;  4AHR A;  3PSF A;  1JLQ A;  3SAH A;  3TWH A;  3S3M A;  4GY2 B;  3CJC A;  1M90 O;  4CZL A;  1X9M A;  2XY6 A;  1K8K B;  4ICL A;  1R0A A;  4CHQ A;  4FJM A;  3ALY A;  4LF6 K;  4GKJ K;  3SV3 A;  3LDQ A;  2KZM A;  3L2Q A;  4BRP A;  3HM9 A;  3LDS A;  1DLO A;  3VQQ A;  4PKH A;  2HB5 A;  5M1F A;  3AA5 X;  1SKS A;  4WF9 L;  3OYI A;  4Z4H A;  4OPH A;  2AA4 A;  3LM9 A;  4C1N K;  5GIP A;  4CJQ A;  3RSE A;  3SK3 A;  2HBL A;  3V81 A;  4KHW A;  4C8M A;  3THW A;  2DFE A;  3GG4 A;  4CER A;  4DKW A;  4NXM K;  3K57 A;  5GIN A;  3VQB A;  1OH5 A;  3T19 A;  5D3G A;  3WXL A;  1T3V A;  3QBW A;  2V7Y A;  5AQO A;  2I7N A;  3LWM A;  1BQN A;  1T8E A;  2P9S A;  4B9N A;  2A42 A;  1JLC A;  4GV3 A;  4E7J A;  3SUP A;  4W5O A;  4DTR A;  2E5L K;  3ZSQ A;  1O1W A;  4HVJ A;  3JXU A;  4JNE A;  4BRO A;  5BRE A;  1VSL A;  3PUF A;  1HR0 K;  4CJS A;  5KPR A;  1KCF A;  2WOM A;  4KV8 A;  4CGI A;  2YHA A;  4W5N A;  4BVP A;  4KHP K;  3A5L C;  1BA0 A;  2HNY A;  4AM7 A;  3PY8 A;  1EQY A;  3SMP A;  4DV7 K;  1IKV A;  2VWK A;  1WSH A;  3R3L A; 
#chains in the Genus database with same CATH homology
 3TAR A;  3IRX A;  3SUO A;  3AVM A;  4FW2 A;  4CHY A;  1FKO A;  4DFM A;  1NJZ A;  3M8P A;  4AHV A;  4IKF A;  4KHY A;  4LSL A;  3M8S A;  1HRH A;  4O55 A;  3L2R A;  4HUF A;  3HXM A;  4BE1 A;  4E7H A;  4W5Q A;  1NOY A;  4JS5 A;  3WNG A;  1RDB A;  2ITG A;  4CCH A;  2G8K A;  1C6V A;  3OYF A;  1VSI A;  2D0C A;  1EKE A;  4E3S A;  1SL2 A;  1T7P A;  3U3G A;  2HHV A;  4F2R A;  3OYH A;  4BWJ A;  3NE6 A;  3LZJ A;  4CJP A;  3C6U A;  4FJ7 A;  4I9L A;  1HYS A;  2HNZ A;  3A2F A;  1S6Q A;  1RBT A;  1RCH A;  3MEG A;  4DG1 A;  2QK9 A;  3L2U A;  4AIL C;  4FK4 A;  4FZX C;  3AO4 A;  3O3H A;  3KKR A;  2G8I A;  4CK1 A;  4M3T A;  2HHW A;  1WSJ A;  2YNF A;  1HYV A;  2VG6 A;  1WNS A;  3JYT A;  2XY7 A;  2G8F A;  1IH7 A;  1TKX A;  4DTS A;  1RBV A;  2DFH A;  1REV A;  3BGR A;  2FC0 A;  4B8C A;  1JLE A;  4DTP A;  1I39 A;  1WAJ A;  3LWL A;  4LH4 A;  4B9U A;  2QKB A;  4O0J A;  4E19 A;  2HMI A;  1CLQ A;  4OLB A;  1TVR A;  4FJH A;  1EET A;  3ZSR A;  3MAQ A;  2IS3 A;  4DTU A;  3VQ5 A;  1NK9 A;  1LAV A;  3C6T A;  3ULD A;  4CEE A;  4FJ5 A;  4N76 A;  4CJU A;  3QLH A;  2EHG A;  4HUG A;  3NF8 A;  4JRP A;  2FBY A;  4LH5 A;  1A5W A;  5HP1 A;  3ZSX A;  2BDP A;  4FK2 A;  3VQC A;  4DTX A;  4CFA A;  3V9X A;  4RW7 A;  4DSL A;  3OJU A;  2I5J A;  1ZBU A;  3NBP A;  2VG7 A;  3WNF A;  1VSH A;  3KLG A;  1X9S A;  1LWF A;  3D45 A;  3ZT3 A;  3OYN A;  4HCC A;  4QCL A;  2A1S A;  3QIO A;  1TK5 A;  4FJX A;  4F3T A;  1BCO A;  3L3U A;  4DWI A;  1JL1 A;  3NH2 A;  3VN5 A;  1HJR A;  3ISN C;  3V9Z A;  3IS9 A;  5HRS A;  1S5J A;  4I2Q A;  3O4Q A;  4FVM A;  3VQA A;  3ZSV A;  3CQ8 A;  3QEX A;  1ZBL A;  3RWU A;  3LAM A;  1XHX A;  3MEE A;  4CGH A;  3G0Z A;  5E41 A;  1HNI A;  1RDC A;  2YNI A;  1JLG A;  1RTJ A;  1HMV A;  1BHL A;  1RT5 A;  3HK2 A;  3DLH A;  3OJS A;  2IC3 A;  3OYL A;  4ZTF A;  4DQP A;  4KTW A;  3AVG A;  3EY1 A;  2A1R A;  2Z1J A;  4CK3 A;  4RW4 A;  3CM5 A;  4FLV A;  3SCX A;  1DTT A;  3L8B A;  4RW6 A;  3NH0 A;  3PV8 A;  4KB0 A;  3KK1 A;  1YT3 A;  5CY4 A;  2PYJ A;  3B6O A;  3BDP A;  4FJK A;  3AVN A;  4JRQ A;  4CF8 A;  1LAW A;  3QIN A;  5J2M A;  3AVL A;  1LWC A;  4DF4 A;  4M3Y A;  3MEC A;  3NF7 A;  4H4M A;  3VQ8 A;  4DU3 A;  4J2A A;  1NKB A;  3P5J A;  5HRR A;  2YNG A;  4OVL A;  4CJL A;  4OKE A;  3MXI A;  4K8X A;  2HHU A;  3QES A;  2F96 A;  4BDZ A;  2VWJ A;  3CYM A;  2OPP A;  4HUE A;  2QXF A;  4Z4C A;  3RMA A;  2D0B A;  1UAX A;  4CJT A;  1YTA A;  5KI6 A;  5C25 A;  1RDA A;  4CEC A;  1BL3 A;  1U04 A;  3DOL A;  4QAG A;  1GOA A;  1ITG A;  5T7B A;  3PO5 A;  1RTI A;  2YNH A;  4M3U A;  5JS1 A;  1KFS A;  4E7L A;  4ELT A;  3KLI A;  2D0A A;  4I2P A;  4DMN A;  3IG1 A;  1MU2 A;  1CZ9 A;  4BAC A;  2Z1I A;  3DLK A;  1VRT A;  3DRP A;  1BIZ A;  3SPY A;  2HND A;  1RNH A;  3AO1 A;  1L5U A;  1TK0 A;  4FJL A;  3AA3 A;  2ZQB A;  4KO0 A;  3NH1 A;  4B3O A;  4CJ4 A;  4G1Q A;  3LP1 A;  2KQ2 A;  2O4G A;  4CJR A;  1LV5 A;  4IBN A;  4M3R A;  2XO7 A;  4N56 A;  1J54 A;  3NDK A;  1U49 A;  3OYE A;  4Z4I A;  2YV0 X;  4KAZ A;  4Q5V A;  3LP2 A;  4KI4 A;  3VQ4 A;  1NK6 A;  2KFZ A;  3MXJ A;  4B9S A;  5DMR A;  1GOB A;  3C95 A;  1D9D A;  4W5T A;  3SUQ A;  3TAM A;  3KK2 A;  1SL0 A;  1YVU A;  2Z1G A;  2RPI A;  3OY9 A;  2FBT A;  4BE2 A;  3RMB A;  3DLE A;  3KK3 A;  3CFR A;  1RTH A;  1C0M A;  4YNQ A;  4KB1 A;  1RT1 A;  4CEB A;  4CES A;  4CHN A;  1RTD A;  4CF9 A;  1QTM A;  5I3U A;  3V9U A;  4N47 A;  1TGO A;  4GW6 A;  5DK5 A;  3F9K A;  4CHZ A;  4FLT A;  1J5O A;  4CGJ A;  1KSP A;  4J2E A;  5FDL A;  3VA3 A;  4B9M A;  3TAG A;  2YKN A;  3AO5 A;  3SNN A;  1RT4 A;  4XIU A;  4ELU A;  1BI4 B;  2PZS A;  3KLF A;  3KD5 E;  3LAK A;  2IDO A;  3CM6 A;  5SWM A;  3AVI A;  1U45 A;  2XRI A;  5KTQ A;  5JS2 A;  4AH9 A;  1RBU A;  2OYQ A;  3IAY A;  4B9V A;  1C1B A;  3DMJ A;  3NF9 A;  1U47 A;  1Z25 A;  2RN2 A;  1JLB A;  3CFP A;  4ZTJ A;  4I7F A;  2G8W A;  3SQ4 A;  1NK7 A;  4M3W A;  4M3Z A;  2DY4 A;  2HVI A;  1RBS A;  4PWD A;  3V1O A;  3ASM A;  3AVJ A;  2PY5 A;  4KHQ A;  1VRU A;  2YKM A;  4MQ3 A;  4CE9 A;  3TAF A;  4DSJ A;  3OS2 A;  3DM2 A;  3OYM A;  2D5R A;  4EP4 A;  1RIL A;  3OVN A;  3QO9 A;  4CHP A;  4FM2 A;  2OZS A;  3AVH A;  2DFF A;  3NCI A;  1TV6 A;  4JLH A;  3NGY A;  4OPJ A;  4BDY A;  4DS4 A;  3C94 A;  4KI6 A;  3KLH A;  1CZB A;  3I0R A;  2FBX A;  4EP5 A;  1UA0 A;  1T03 A;  1B92 A;  4BWM A;  3TR8 A;  2DTU A;  3S9H A;  1C1A A;  1KVB A;  1JLF A;  1RT3 A;  1VSM A;  4IFV A;  4TSX A;  4CF1 A;  3ZT1 A;  2OPR A;  4EZ6 A;  1FXX A;  4FJ8 A;  2HHS A;  3TAP A;  1IKW A;  1W0H A;  4H8K A;  4Z4G A;  3HO1 A;  4EZ9 A;  1L3V A;  4FXD A;  4CK2 A;  1ZBI A;  4JS4 A;  1VSD A;  4C8O A;  1KVA A;  2HW3 A;  1HYZ A;  4CHO A;  3TI0 A;  3AO3 A;  4CIE A;  1WLJ A;  2B6A A;  3ZSO A;  3HJF A;  3CFO A;  4OLA A;  3ZT0 A;  2G8H A;  2ZD1 A;  4F2S A;  4DQQ A;  1C1C A;  4DTN A;  3NFA A;  1Q8I A;  4PA1 A;  3AVC A;  4ZHR A;  4FJI A;  3AVK A;  5CYM A;  4O44 A;  4AHT A;  1QSY A;  3LAN A;  4B8A B;  4CJK A;  2E6L A;  3H08 A;  1RT6 A;  5KRS A;  3K5M A;  4DTO A;  4CJF A;  1Q9Y A;  3SQ0 A;  4I9Q A;  4KRF A;  1ASW A;  4FZY A;  1W9H A;  1SV5 A;  3PX0 A;  3RR7 A;  4CEO A;  4BE0 A;  4FLU A;  4IG0 A;  4B08 A;  1IO2 A;  3LPT A;  2X78 A;  4CIG A;  4N5S A;  4DLE A;  4DLG A;  1S1V A;  2KFN A;  3QEI A;  4BDP A;  4OKJ A;  3EYZ A;  3O3G A;  5J2P A;  3G10 A;  2QKK A;  3KKS A;  4FYD A;  1U48 A;  1JKH A;  3QEV A;  4E1N A;  1J9A A;  2GBZ A;  3K58 A;  1G15 A;  3SZ2 A;  1BQM A;  4DU1 A;  3DRR A;  1RBR A;  4AHC A;  3THV A;  1VSK A;  3SUN A;  1VSF A;  3HT3 A;  1IKY A;  1SKR A;  3OYD A;  1X1P A;  2GUI A;  4FJJ A;  1BGX T;  1Y97 A;  4NYN A;  3V6D A;  5KGX A;  1RDD A;  4FLX A;  3RRG A;  2Z1H A;  3T3F A;  2EX3 A;  2E4L A;  4F3O A;  1YTU A;  3DLB A;  1QHT A;  2Q3S A;  4OKK A;  3TAB A;  2KTQ A;  2G8U A;  2BGG A;  2IOC A;  3DYA A;  3K2P A;  4NCG A;  3OYC A;  3D0P A;  3V9S A;  1NJW A;  4L8R B;  4CIF A;  1KLM A;  2XY5 A;  1VSJ A;  3VQ6 A;  4CFB A;  2F8T A;  3TAE A;  1WSG A;  1WSI A;  4FJN A;  2W42 A;  1NKE A;  5I42 A;  1JLA A;  1K6Y A;  2E6M A;  5FRO A;  4CGG A;  3OYA A;  1JXB A;  4HHT A;  3JSM A;  3V4I A;  2HHX A;  1BCM A;  4FK0 A;  4FJ9 A;  4H4O A;  1B9F A;  1S1X A;  4M45 A;  4DF8 A;  1IG9 A;  1KRP A;  4ID1 A;  1ZBF A;  4KHN A;  3SQ1 A;  1D5A A;  1S1U A;  5FRN A;  5FRM A;  1XHZ A;  4FLZ A;  5J2Q A;  1T05 A;  4Z4E A;  4PY5 A;  4CEQ A;  1EXQ A;  1RT7 A;  1NK8 A;  5KGW A;  1FKP A;  4DTJ A;  2X74 A;  1BIU A;  1Z26 A;  4IG3 A;  3QEP A;  3S3O A;  4IFY A;  3RTV A;  1VSE A;  1NOZ A;  3SYZ A;  3KLE A;  5HRP A;  4Z0U A;  4DFJ A;  4WE1 A;  3LP0 A;  3ZT4 A;  2KW4 A;  1QE1 A;  1I3A A;  3K59 A;  3M8R A;  2R7Y A;  4KHU A;  4N41 A;  1JL2 A;  1LWE A;  1UOC A;  3CG7 A;  2B5J A;  1ASV A;  3MED A;  1U4B A;  3SI6 A;  4ELV A;  1NK0 A;  4AHU A;  1C0T A;  3FFI A;  4GVM A;  3QNO A;  4DS5 A;  1ZBH A;  2P1J A;  4CGF A;  3DI6 A;  4DFP A;  3LPU A;  2XHB A;  3HP6 A;  4HTU A;  1QS4 A;  4R5P A;  5HLF A;  1S1T A;  3WNE A;  4J2D A;  3RR8 A;  3V1R A;  1J53 A;  2P51 A;  3I8D A;  1TKZ A;  4DQI A;  3NGI A;  3M8Q A;  2AJQ A;  4O5B A;  5J2N A;  3RRH A;  2ZE2 A;  2WON A;  4OPK A;  3QER A;  2OPQ A;  4LY7 A;  4ID5 A;  4M42 A;  3HVR A;  4M41 A;  4W5R A;  3ZSZ A;  3SPZ A;  3L2V A;  4OJR A;  1D8Y A;  3B6P A;  5K14 A;  3NF6 A;  1HQE A;  3QNN A;  1HPZ A;  4FM1 A;  1TAU A;  2ATQ A;  1EX4 A;  4FJG A;  2GV9 A;  1QQC A;  4Z4F A;  4Q0B A;  4GMJ B;  2RF2 A;  5J1E A;  1WSE A;  3LP3 A;  1SKW A;  1BIS A;  4DQS A;  5KRT A;  1TK8 A;  1JXE A;  3K5O A;  4LSN A;  3S3N A;  3ZT2 A;  5HBM A;  3ZSY A;  3KTQ A;  4KKO A;  1QSL A;  4B9T A;  1IKX A;  4K8Z A;  1N6Q A;  3SJJ A;  1UWB A;  4M3X A;  3OYK A;  2LSN A;  4CJV A;  5C42 A;  1WN7 A;  4PQU A;  4CJE A;  1KTQ A;  4CED A;  4DU4 A;  1TKD A;  4DSK A;  3K5L A;  2XY8 A;  4FLW A;  4CFD A;  3TAN A;  4E1M A;  3KIO A;  2P5O A;  1NK4 A;  4QOZ B;  3V1Q A;  4UQG A;  3OS0 A;  1SUQ A;  3ZCM A;  3ZSW A;  5CZ2 A;  3OYJ A;  5C24 A;  3QET A;  1UA1 A;  3O3F A;  3PX4 A;  1GOC A;  1HQU A;  2VG5 A;  4DSF A;  3AVA A;  5HRN A;  1FK9 A;  1X9W A;  2FBV A;  4KTQ A;  1LW0 A;  4KPY A;  2OPS A;  1F21 A;  3PO4 A;  3VA0 A;  1B9D A;  2X6N A;  4RW9 A;  3HPG A;  3VQ9 A;  1RT2 A;  3HP9 A;  3DLG A;  3EZ5 A;  4FCY A;  3MXM A;  2P5G A;  4FZZ A;  3L3V A;  1WAF A;  1TKT A;  4CJ3 A;  3U6F A;  3AVB A;  3HYF A;  3P83 D;  4C8K A;  4E0D A;  2IAJ A;  4CF2 A;  1D9F A;  4J2B A;  1KVC A;  3O4N A;  4O4G A;  2OZM A;  1C0U A;  1S1W A;  4PUO A;  1XI1 A;  2NUB A;  3AO2 A;  4IDK A;  3DOK A;  5CZ1 A;  3V9W A;  3QEW A;  2ETJ A;  3OYB A;  3F73 A;  4CGD A;  3HST B;  4O0I A;  2G8V A;  4CEF A;  3VQ7 A;  2YHB A;  3QIP A;  3P1G A;  4LD0 A;  3LAL A;  1JLQ A;  4AHR A;  5SZT A;  3TWH A;  3S3M A;  2F8S A;  1WSF A;  4KRE A;  3VQD A;  1NKC A;  3TAQ A;  1X9M A;  2XY6 A;  4C8N A;  4CEZ A;  4ICL A;  3WNH A;  1R0A A;  4CHQ A;  4FJM A;  1KLN A;  4KHS A;  4CJW A;  3ALY A;  3LZI A;  4E7I A;  1NJX A;  4DQR A;  3SV3 A;  1HNV A;  3KD1 E;  3DLR A;  4E7K A;  3VQE A;  3L2Q A;  2KZM A;  3HM9 A;  3LDS A;  3I0S A;  4CEA A;  4FLY A;  1DLO A;  3VQQ A;  2HB5 A;  4FW1 A;  4KFB A;  2B4J A;  3AA5 X;  3DRS A;  1ZYQ A;  3L2W A;  3K5N A;  4MFB A;  4RW8 A;  1SKS A;  1CXQ A;  3OYI A;  3UIQ A;  4Z4H A;  1L3U A;  2X6S A;  4KTZ A;  4Y1D A;  5HRO A;  1S6P A;  4CF0 A;  4DFK A;  3HPO A;  4CJQ A;  2JGU A;  2KZZ A;  2RKI A;  3V81 A;  3AA2 A;  3AV9 A;  3VQP A;  4KHW A;  4NCA A;  4NCB A;  4C8M A;  1EP4 A;  3ITH A;  2DFE A;  1TL3 A;  4CER A;  1VK0 A;  1SL1 A;  3K57 A;  3VQB A;  5D3G A;  3T19 A;  2HVH A;  2O4I A;  1DTQ A;  4DTM A;  4AHS A;  4F4K A;  2HHT A;  3LWM A;  1LW2 A;  1L3S A;  1ASU A;  3OYG A;  3HVT A;  1BQN A;  3T1A A;  4F8R A;  3KJV A;  3E01 A;  1TL1 A;  1T8E A;  5CYQ A;  4B9N A;  2BAN A;  1JLC A;  4OGE A;  4FM0 A;  2HHQ A;  4C8L A;  4E7J A;  3OS1 A;  4E89 A;  4DSI A;  1L3T A;  1KFD A;  2BE2 A;  1XWL A;  3SUP A;  2OA8 A;  4W5O A;  4DSE A;  4DTR A;  3ZSQ A;  1O1W A;  4HVJ A;  3U3Y A;  3NAE A;  2Y1I A;  3PX6 A;  4NYF A;  1BI4 A;  1QSS A;  3NGZ A;  1N5Y A;  1S9G A;  2PYL A;  1TAQ A;  1XC9 A;  1VSL A;  1CXU A;  3PUF A;  3RMC A;  2IGI A;  1Q9X A;  4CJS A;  4Y1C A;  3HL8 A;  3AA4 A;  5EU7 A;  1A5X A;  1KCF A;  3AVF A;  2WOM A;  3HPH A;  3SQ2 A;  4KV8 A;  1S9E A;  4CGI A;  2YHA A;  4W5N A;  4OGC A;  2JLE A;  1NK5 A;  4HCB A;  1A5V A;  2HNY A;  3RMD A;  3PY8 A;  1NJY A;  3NHG A;  3SV4 A;  2Y1J A;  4B9L A;  4RG8 A;  1IKV A;  2VWK A;  4CFC A;  4YFU A;  4CJ5 A;  1WSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...