3O4QA

Crystal structure of the rous associated virus integrase catalytic domain a182t in citrate buffer ph 6.2
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
145
structure length
136
Chain Sequence
LGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSFTSKSTREWLARWGIAHTTQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords integrase
publication title A crystal structure of the catalytic core domain of an avian sarcoma and leukemia virus integrase suggests an alternate dimeric assembly.
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Dna binding protein
total genus 50
structure length 136
sequence length 145
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3o4qA00
3VQ9A 4N5SA 4B9VA 1BQNA 3NF7A 4LSNA 4CE9A 1TAQA 4RW4A 4Y1CA 1IO2A 4C8LA 5HRNA 4JRPA 4HHTA 1CZBA 4BE1A 3AVCA 3DYAA 1DTTA 1HRHA 5HBMA 3OYEA 3SUPA 4F2SA 2HNZA 4FM2A 4LY7A 3IRXA 3LPTA 4O0JA 1IKYA 3ZT0A 4Q0BA 1JKHA 5E41A 1YT3A 4CF8A 5SWMA 4ID5A 2IGIA 4O44A 3KIOA 1JLCA 3V4IA 1L3TA 4BACA 4ELTA 2RF2A 1I39A 3QEIA 4CGFA 3TANA 3VQ7A 4NYNA 3RMDA 1ZBLA 4KRFA 1S9GA 1KVBA 3SPZA 2E6LA 5KRSA 4FCYA 2HHUA 1KVCA 4CJEA 3SV3A 4B9LA 1EXQA 3DLKA 3K5MA 2OPPA 4DFMA 4OVLA 4E7LA 1REVA 1RT4A 4FLZA 1T8EA 4BWMA 1JLAA 2FBXA 3LP3A 1NOZA 2IC3A 4CEDA 1VSEA 3HYFA 1LV5A 3K57A 2P5GA 4CFDA 5JS2A 2HW3A 3KLEA 4PQUA 4K8ZA 1JXBA 1I3AA 5KGXA 1B9FA 3VQ8A 1BIUA 3ZSQA 4KV8A 3KLFA 4Z4CA 3HVRA 2DFEA 2WONA 1CXQA 5I3UA 1HMVA 2F8SA 1RTJA 3PUFA 3AA5X 3AVFA 2OZMA 4FJMA 4M3TA 2HMIA 1O1WA 1RT7A 4DQIA 3K2PA 3LP2A 2Y1JA 1G15A 4FW2A 3O4QA 4I7FA 1IKVA 4EP5A 3SQ0A 1Y97A 2X78A 1NJWA 3OS2A 2G8WA 2G8UA 4FXDA 5KI6A 1NK0A 1N5YA 3AVKA 3SQ2A 4FJ9A 2AJQA 3VQ6A 3IS9A 3AVJA 4CIEA 1ASUA 5J2PA 2BDPA 2KZMA 4YNQA 3QERA 2WOMA 4KB1A 3SUOA 3S9HA 1B9DA 3OYFA 2EHGA 4CJUA 4J2BA 3LP0A 1JL2A 2DFHA 2YHBA 1Q8IA 3PV8A 1ASWA 1JLEA 4RW7A 5J2NA 3QEPA 3NBPA 5CYMA 1WSJA 4QAGA 3JYTA 4KHWA 1VSMA 2KQ2A 5T7BA 4CFCA 2LSNA 2GV9A 4CJTA 1RBSA 1TAUA 4FM1A 3ISNC 3DMJA 5EU7A 3RR7A 1X9WA 1RDBA 1LWCA 3P83D 3RRGA 3HVTA 3VQCA 4CHYA 3M8RA 1NKCA 3HPHA 3OYGA 5FROA 3CYMA 1S6PA 3AVGA 3I0SA 3O3HA 3NGZA 4M3RA 3JSMA 1SKWA 1ZBIA 2QK9A 1GOBA 3MECA 3L2VA 1KSPA 4FJJA 3ZT4A 1NJYA 4CHNA 4LSLA 1S1VA 4CCHA 2YNFA 1CLQA 1EETA 3OYHA 4DU4A 3V6DA 4FJ8A 2BGGA 1GOCA 3AVMA 1HPZA 4OPJA 3QIOA 3OYCA 3V9UA 3TAQA 4CEOA 1FK9A 1YVUA 3L3VA 1U49A 4CFAA 3V9ZA 3CQ8A 4KI6A 3C94A 4DTXA 4ID1A 3V9XA 4FJ5A 3L8BA 4DFKA 1BI4A 1UAXA 3B6PA 4AHRA 4DQQA 3SCXA 1BCMA 2YHAA 3I0RA 4CGDA 1D9FA 2R7YA 3SUNA 2JLEA 4DS5A 1RT2A 5I42A 1RBRA 2D5RA 4KHSA 3PX4A 2RN2A 3SQ1A 1LWFA 3AVIA 3AVHA 4RW6A 3KKRA 5C25A 4BE2A 1C0MA 4NCBA 4H4OA 4KI4A 2DFFA 1S1TA 4AHCA 2XY8A 4KB0A 2GBZA 3AA2A 4Z4FA 4CEBA 1NOYA 4CHZA 1VSHA 3VQPA 4FZYA 4DQRA 1RDAA 4C8MA 4W5OA 1D8YA 4FK2A 4E7KA 1C6VA 4GW6A 3DM2A 3ZSYA 4IDKA 4HTUA 3F9KA 2G8FA 3RTVA 3DLGA 4XIUA 1QTMA 4O5BA 3H08A 3LDSA 3HK2A 3AO5A 3ASMA 2HB5A 5J1EA 5J2MA 4FJKA 2QKKA 3LAMA 4CEQA 2GUIA 5K14A 1GOAA 3MAQA 1Q9YA 3K5OA 4CGJA 5HRSA 4M3UA 2Y1IA 1KTQA 4M41A 1LWEA 3QEVA 3KJVA 4BWJA 1J5OA 3NE6A 4N76A 5C24A 4F3OA 1YTAA 3DRPA 4M3ZA 1S9EA 2HHQA 4JLHA 4Q5VA 2YNGA 4I2QA 1JL1A 3ZSRA 1UA0A 3CFRA 3HPOA 4EZ9A 2KZZA 2D0CA 4AHUA 2IOCA 3MEEA 2Z1IA 2HVHA 1J54A 3OS1A 4CEFA 1TKTA 3OY9A 4AHTA 5HLFA 1B92A 4FVMA 3THVA 4DMNA 3AA4A 1RCHA 2P51A 4DTJA 4B9UA 1KLMA 4FYDA 3V9SA 1TL1A 4CECA 4CGGA 3K58A 3QIPA 4F2RA 4CIGA 3QEWA 4CHPA 4ELUA 2HHTA 3VQEA 4DTSA 2KFZA 4B8CA 1HYSA 2B5JA 2Q3SA 1L3SA 1IKXA 4H4MA 5HRRA 3PX0A 3ZT2A 3VQDA 3PX6A 4J2EA 2A1SA 2Z1JA 4QOZB 1S1UA 2BE2A 3MXMA 2HVIA 3G0ZA 4YFUA 1KRPA 2FBVA 1JLGA 3KLGA 4C8NA 3AO4A 4W5NA 1U45A 4FJGA 1C0UA 2ITGA 1X1PA 3ULDA 1S6QA 4N41A 4RW8A 3DLHA 4FLTA 2HHXA 2VG6A 4WE1A 4OPKA 1Q9XA 4FJHA 2IAJA 1YTUA 3ZSWA 2XY6A 2QKBA 1NK8A 4KTQA 4E89A 2PYLA 4NCGA 2FC0A 4CJ3A 1VK0A 1EX4A 5SZTA 4JRQA 1XHZA 1IKWA 3LZIA 1L5UA 2PZSA 3V9WA 3LP1A 4CERA 4B3OA 4BDPA 1EKEA 2YV0X 1JXEA 3KD1E 4CJKA 3OYAA 3LWMA 2G8KA 4HVJA 3MEDA 3TI0A 1JLFA 2KW4A 4B08A 1HYZA 4G1QA 5HRPA 4E7IA 4KHYA 1RBVA 3LWLA 1TK8A 1KVAA 1A5WA 3IAYA 2HNYA 4JS4A 1RTDA 3C6TA 2O4GA 1WNSA 2D0BA 3SQ4A 4I9LA 2B4JA 2OPRA 1BI4B 1RBTA 4CJFA 1T03A 3RWUA 4CGHA 3HJFA 3QNNA 3OYDA 1X9MA 3I8DA 4B8AB 2PY5A 3AO3A 4CIFA 1BCOA 3F73A 3S3OA 1R0AA 2XY5A 2YKMA 3NH2A 1SKSA 3SV4A 1SKRA 3DLBA 2G8IA 4H8KA 4LH5A 1TKXA 4Z4HA 2IS3A 3LAKA 3SZ2A 4K8XA 4ICLA 3P1GA 5CZ2A 4W5RA 3EYZA 3K5LA 4J2AA 4E19A 1RTHA 4DLEA 4I9QA 4FJ7A 4BE0A 3C95A 3HP9A 2P1JA 4FLVA 3OJUA 1FKOA 4O0IA 4UQGA 1U4BA 1C0TA 1TK0A 3ITHA 1U48A 4HCCA 4DSKA 4RG8A 3M8PA 1TV6A 4OJRA 3U3GA 3DOKA 1DTQA 4CF9A 5KTQA 1U47A 1D9DA 5FRMA 3LPUA 1ZYQA 3DOLA 4DQSA 4CK3A 4LD0A 1ZBFA 4CEZA 4DTNA 4CEEA 3U3YA 3O3FA 3CM6A 1HQUA 3K5NA 4B9TA 1QSLA 3KD5E 3G10A 4OKJA 4AHSA 4KO0A 1LW0A 1DLOA 3OS0A 3V81A 1HYVA 2YKNA 4M45A 4FZXC 3L3UA 1SL1A 1HJRA 3CM5A 1TKDA 3PO5A 2QXFA 2O4IA 2BANA 2YNIA 3OYJA 1W9HA 1HNIA 1LW2A 4FJLA 3P5JA 4NCAA 1N6QA 3WNHA 3HO1A 3DRRA 3RMAA 2XY7A 1FKPA 3TARA 4Z4IA 3A2FA 3SNNA 5D3GA 2RKIA 4GVMA 2HNDA 3AVBA 2X6SA 1UOCA 1RDDA 3L2WA 1NJXA 3LANA 4W5TA 4DTPA 2D0AA 3B6OA 2XRIA 1FXXA 4FZZA 1Z26A 4RW9A 4IFYA 4IG3A 4HUEA 1BISA 1SUQA 3ZSZA 2Z1GA 4PA1A 4CF0A 2OA8A 3ALYA 1NK4A 4B9MA 4DSJA 1QSYA 3CFPA 4E1NA 3KK2A 3SJJA 1JLQA 1Z25A 4F3TA 2KTQA 1WSEA 1RILA 2IDOA 4DSEA 1BHLA 2I5JA 4N47A 3SUQA 4OKEA 3S3MA 1BL3A 4HCBA 4DQPA 5DK5A 1ASVA 4MFBA 4DU1A 1L3VA 2HHSA 3D45A 4IBNA 3EZ5A 4KTWA 2A1RA 4CJPA 4KREA 3T19A 1XHXA 1TKZA 4M3WA 1X9SA 1CZ9A 2G8VA 3DI6A 1WLJA 1BGXT 3NFAA 3OVNA 3K59A 2DY4A 5HP1A 4B9NA 3NHGA 5C42A 4LH4A 2VWKA 2W42A 5FRNA 4PWDA 5HROA 3S3NA 2OPSA 2YNHA 1A5VA 4FJXA 2DTUA 4ELVA 3KLIA 4OKKA 3M8QA 4CJ4A 4DF8A 1WAJA 2X6NA 4DWIA 1S5JA 3NGIA 1TK5A 1KLNA 1KFDA 3VN5A 3BDPA 4EZ6A 2F8TA 2FBTA 4TSXA 3LALA 1VRUA 3NGYA 3T1AA 4DSFA 1WSFA 2Z1HA 4DFJA 1RTIA 2JGUA 3DRSA 1VSLA 3FFIA 4FLYA 3KTQA 3V1QA 3TAEA 1S1WA 3AA3A 1J9AA 3MXJA 1VSDA 4DLGA 1TGOA 4DTUA 2G8HA 4PUOA 2ZQBA 1SL2A 3HSTB 1RNHA 1VSFA 2OZSA 3NAEA 4O55A 3RRHA 1W0HA 4FK4A 4CJQA 1T05A 4L8RB 4CJVA 3AVNA 3VQQA 3UIQA 3OJSA 1UWBA 1RBUA 3VQAA 4CJ5A 1T7PA 3RMBA 3NF8A 4HUGA 2XHBA 4FJNA 3SI6A 1NK9A 1C1CA 3C6UA 1ITGA 4BDYA 3SYZA 1KFSA 1C1AA 3V1OA 2F96A 1NK5A 3VQ4A 3HP6A 5DMRA 2OYQA 3M8SA 2HHVA 3AV9A 3MEGA 1IG9A 1VRTA 3O3GA 3ZSXA 3QETA 2XO7A 2B6AA 4DTRA 2ETJA 1WAFA 4Z4EA 1L3UA 5KRTA 4IG0A 4F4KA 4KHUA 3HPGA 3HM9A 4QCLA 1ZBUA 1F21A 1NKBA 4C8KA 3VA0A 4ZTJA 4C8OA 4Z4GA 5FDLA 3HXMA 3NH0A 4N56A 5J2QA 4GMJB 4DSIA 4KPYA 3QINA 4KTZA 1HQEA 3HL8A 4AH9A 1NK6A 3U6FA 4KKOA 1EP4A 3TAFA 4EP4A 4KHQA 1WSHA 1K6YA 3DLRA 4CJLA 4CK1A 4KAZA 4KHNA 3NDKA 3KLHA 4M3YA 3ZT1A 3TABA 4AILC 3ZCMA 1RDCA 4KFBA 4CHOA 4CF1A 3OYLA 1UA1A 4OGEA 3HT3A 4E7HA 3L2UA 3ZSVA 1VSJA 1IH7A 2ATQA 1WSGA 1RT3A 4Z0UA 4DS4A 4OGCA 3VQ5A 3MXIA 2ZD1A 4B9SA 4M3XA 3QLHA 4DFPA 1SV5A 2VG5A 3PY8A 5JS1A 2EX3A 3BGRA 4DG1A 1QS4A 1D5AA 1LAWA 2RPIA 3O4NA 3LZJA 4HUFA 3QNOA 3DLEA 3TAGA 1VSKA 4BDZA 3OYIA 3QEXA 3WNFA 4M42A 3AO2A 1J53A 3NF6A 3V1RA 4CF2A 3NCIA 3VA3A 3QO9A 4CHQA 1SL0A 2HHWA 4DF4A 3ZT3A 3VQBA 1QSSA 2E4LA 1QQCA 4E7JA 4ZHRA 3IG1A 1LAVA 3OYMA 4CK2A 2P5OA 3ZSOA 4IFVA 1NKEA 4FJIA 5KGWA 3OYKA 4FK0A 1RT5A 1CXUA 4DU3A 1RT6A 4FLUA 4AHVA 4FW1A 1XI1A 2E6MA 3SPYA 3T3FA 3QESA 1MU2A 1WSIA 5CY4A 2FBYA 1U04A 4J2DA 4OLAA 1HNVA 3TR8A 3KK3A 3AVAA 3TAPA 3PO4A 4PY5A 3NH1A 4DTMA 3RR8A 1ZBHA 4CFBA 5CZ1A 3OYBA 3NF9A 4CEAA 3TWHA 4E0DA 3AVLA 2KFNA 3E01A 1A5XA 3EY1A 3RMCA 1BQMA 4R5PA 4O4GA 4NYFA 3OYNA 4CJSA 1XC9A 5CYQA 1NK7A 4F8RA 4E3SA 1RT1A 4OLBA 4DSLA 2PYJA 3KK1A 1BIZA 4CGIA 4E1MA 1KCFA 4CJRA 4DTOA 3D0PA 4FLWA 1S1XA 1WN7A 4MQ3A 3WNGA 1NJZA 3L2RA 2NUBA 3WNEA 1JLBA 3TAMA 4FLXA 2X74A 1QE1A 1XWLA 2VG7A 4IKFA 4ZTFA 3CFOA 3L2QA 2OPQA 2ZE2A 3CG7A 3KKSA 4I2PA 2VWJA 4Y1DA 3AO1A 1TVRA 4CESA 4W5QA 1TL3A 4JS5A 4FM0A 4CJWA 1C1BA 1QHTA 1VSIA
chains in the Genus database with same CATH superfamily
4IDHA 4B9VA 4GV9A 4Y1CA 1YXQA 4C8LA 4JRPA 4CD3A 2O8CB 4BE1A 4IO8A 3CCJN 3IRXA 3LPTA 4O0JA 3EO3A 3ZT0A 2ASOA 3FZLA 3QFPA 3R3LA 3M3ZA 2VGNA 2I7PA 4O44A 2YHWA 3I33A 1JLCA 1I39A 3VENA 3WXJA 1KAZA 3VQ7A 4CGFA 3I56N 3RMDA 5C10A 2HMPA 4KRFA 5KRSA 4FCYA 4DUZK 2RHKA 3K9KA 4DFMA 4OVLA 4CW7B 4E7LA 1N33K 4V19S 1NOZA 1VSEA 4K42A 3HYFA 2HW3A 5ELZA 1VQ7N 3CXCM 1U2VB 5KGXA 3VQ8A 3HVRA 2Q97A 4KV8A 2WONA 5I3UA 1HMVA 3PUFA 3AA5X 4FJMA 4BR4A 2KKZA 2HMIA 4DQIA 4NLCA 3VF6A 3LP2A 3K0SA 2Y1JA 3CQYA 1VQNN 5I9EB 2UUBK 4FW2A 1Y97A 2QWNA 1YIJN 2QWMA 1OH6A 4JKHA 3SAGA 5J2PA 2BDPA 2KZMA 2E2OA 4J2BA 2F9TA 2YHBA 3EKUA 3PV8A 1JLEA 3EZWA 3QEPA 3IFRA 4QAGA 4KHWA 1VSMA 3HM8A 4CFCA 4CJTA 1VHXA 3ISNC 3DMJA 2A41A 3RRGA 3HVTA 1MWKA 4H5WA 4J8FA 3I8BA 3MN6A 1S6PA 3NGZA 2QK9A 1KSPA 2V52B 4JHDA 3LDQA 3CJBA 4OPHA 4CCHA 5AZJB 3OYHA 4DU4A 4FJ8A 1K9MO 3OYCA 3EN9A 4CEOA 5M1PA 5H1SQ 2A42A 5GADP 1T6DA 3J7ZO 3L8BA 1BI4A 3FZHA 4IEEA 4JAXA 4CGDA 2ZM6K 5I42A 1RBRA 2GELA 4FWQA 4OPAA 3DAWA 4BROA 3PX4A 5GAGP 3O80A 1S1TA 4AHCA 4LF5K 2GBZA 4DR7K 3AA2A 4CEBA 1VSHA 5EVZA 2D0PA 3VQPA 2CGJA 4FZYA 2NRXA 3EEQA 1C6VA 4IDKA 2G8FA 3RTVA 3DLGA 4XIUA 3N4QA 3HSCA 2QI2A 5J2MA 5TKWA 3J8AA 3UKRA 4CEQA 3MAQA 4M3UA 3RSEB 1OVQA 1LWEA 4M41A 5ADXH 2JWKA 3O4WA 4BWJA 3HTVA 4N76A 4F3OA 2GWJA 3MWPA 1S9EA 4M3ZA 4CZKA 4Q5VA 4YDUC 1NLVA 2KZZA 4EZ9A 3IKMA 4BRHA 1ZXOA 1J54A 3OS1A 3OY9A 3WEEA 1BU6O 1B92A 3THVA 4BC2A 4DTJA 3UE5A 4FYDA 3V9SA 1TL1A 3QIPA 3QEWA 4CHPA 2FF3B 2HF4A 2KFZA 2ZF5O 3ZT2A 4B1XB 3N4PA 3QDKA 3GBTA 4QOZB 1S1UA 3G71N 4IOXA 3KLGA 4C8NA 4W5NA 4BC5A 4FJGA 1C0UA 2ITGA 1YVNA 3DLLL 3O9RA 3ULDA 5JVGL 4FPAA 2HHXA 4FLTA 3ZEUA 1U6ZA 1W97L 4FJHA 2IAJA 3ZSWA 3H3NO 4E89A 2NRVA 4LF8K 4NCGA 3GDQA 3CC4N 4CZGA 3LZIA 2W6LA 4BDPA 4ILGB 5HRPA 2KW4A 5AZIB 3OBYA 2J4RA 1RBVA 3B8AX 1TK8A 3LDNA 2D0BA 1T03A 4CJFA 1RBTA 1YJWN 1GLBG 4BRQA 3THYB 1K8AO 4DV3K 3AO3A 5EY4A 3S3OA 3F73A 3VERA 4DR5K 1SKRA 4H8KA 3LAKA 3P1GA 3K5LA 4E19A 4DB3A 4I9QA 4FJ7A 2P1JA 1SQKA 3KK7A 4O0IA 3C6AA 1C0TA 1HR0K 1TUYA 3MK6A 3M8PA 1U47A 4CF9A 1D9DA 1ZYQA 3QBXA 5AZIA 3P31A 3SLCA 4LD0A 5EXWA 1EWRA 3CM6A 3CCLN 3U8XA 3G10A 1LW0A 1DLOA 1WB9A 2YKNA 1HNWK 2P9SA 5KPRA 2QXFA 3AAQA 2O4IA 2BANA 3ZX3A 4BGAA 1HNIA 1LW2A 4FJLA 4NCAA 1G99A 3DRRA 3RMAA 2XY7A 4YOXA 3SNNA 4RTFD 3BUZB 1UOCA 3L2WA 3J7YP 4W5TA 4FZZA 4IG3A 4HUEA 1VQLN 2H3GX 5BRDA 1BISA 2P9IB 3AAPA 4LF4K 4PA1A 4B9MA 4WF9L 5C0YA 1JLQA 3CPWM 1BHLA 4BVPA 3SJHA 4IO9L 1L3VA 3EZ5A 2F7TA 1XMQK 1TKZA 1Z05A 1X9SA 2G8VA 3DI6A 3SBTA 3OVNA 3LM2A 3K59A 2DY4A 2IVPA 5C42A 4L3QA 4LH4A 4QS9A 2YNHA 3PIOL 1A5VA 4FJXA 4CJ4A 3D7EO 1S5JA 3QFUA 3NGIA 1TK5A 3NGYA 1WSFA 2Z1HA 5LMUK 1RTIA 2JGUA 4JKBA 5F1XA 1QVFM 4FLYA 1YJNN 3A8YA 3JS6A 3AA3A 4YOWA 1VSDA 4DLGA 3WT0A 2HOEA 2PFUA 1TGOA 4DTUA 4AM6A 2V7ZA 1N34K 1VSFA 4O55A 1W0HA 5HOOA 3MWTA 4CJVA 3AVNA 3VQQA 3UIQA 1UWBA 3VQAA 3NF8A 4FJNA 1NMDA 4JK9A 2GUPA 1C1CA 3ZETB 1KFSA 1C1AA 1NK5A 1E4GT 2UUCK 2OYQA 1E3MA 3VGLA 3O3GA 2ETJA 1WAFA 5KRTA 1VAZA 1NKBA 3VA0A 4C8OA 3QMLA 4FOIA 1HNZK 2D0OA 4KTZA 4BRMA 3CMEN 4PHTX 1EP4A 4KHQA 1BDGA 1WSHA 1N36K 4CJLA 4KHNA 3KLHA 1GLCG 2YJEA 5CE3A 3ZCMA 4FWMA 4CHOA 1UA1A 2FF6A 3HT3A 3TSPA 1VQ5N 2ATQA 1RT3A 1K73O 4DS4A 4OGCA 3MXIA 2ZD1A 3F9MA 3QLHA 1ZBSA 3O9UA 2EX3A 1QS4A 5AQIA 3LZJA 4HUFA 1NGJA 3QNOA 1VSKA 4BDZA 3AO2A 2HHWA 3NCIA 3QO9A 4CHQA 3THWA 1QQCA 4ZHRA 1LAVA 3CF5L 2P5OA 5AQVA 2F4VK 3HBTA 4DU3A 4GV3A 4YOVA 3T3FA 3QESA 1MU2A 5CY4A 4MDBA 1HNVA 3KK3A 1XQSC 3SMSA 4CFBA 4CEAA 2KFNA 3E01A 5CHIA 4NYFA 3OYNA 2YCHA 4H0TB 4E3SA 1RT1A 2PYJA 5M1KA 4CGIA 2Q2RA 1KCFA 3CCEN 4FLWA 3BEXA 4JYAK 3D6RA 1VQ6N 1QE1A 2NRHA 4IKFA 3CFOA 3J80O 4QS8A 2NRTA 4W5QA 4JS5A 1KXPA 1C1BA 1SAZA 1NGAA 1TAQA 1ZC6A 5HRNA 3DYAA 1DTTA 4BG8A 4CZIA 4F2SA 2HNZA 4LY7A 3EE9A 1IKYA 3L4QA 4Q0BA 3I55N 3T1HK 3CI5A 5SWMA 4FWPA 2QW9A 3H45C 4BACA 2RF2A 3QEIA 3TANA 4BRCA 1S9GA 4BRAA 4JD2A 2HHUA 4JKGA 1KVCA 4CZJA 3DLKA 3UKUA 5AQYA 4F9OA 4O8KA 1RT4A 5AQKA 4BWMA 3LP3A 4CBXA 1LCUA 3CJAA 3MN7A 1QHAA 5F0XA 3K57A 1LV5A 2P5GA 5GAHP 3SMPA 4DR2K 1I3AA 2V7YA 3S41A 4DTXA 4Z4CA 4WYBA 5AQGA 3MCAB 1NBWA 3R9PA 4CD1A 5DM6L 1IKVA 4EP5A 2X78A 4HTLA 3OS2A 5KI6A 1NK0A 1N5YA 2FSJA 3AVKA 4FJ9A 4PL8A 2QEXN 4LF7K 2WOMA 4KB1A 2EHGA 1JL2A 4BGBA 2QM1A 4FWNA 4RW7A 3NBPA 3JYTA 3A5LC 1IBLK 1TAUA 4FM1A 3E9PA 2FLOA 5EU7A 1X9WA 1RDBA 3R8EA 1LWCA 3P83D 3VQCA 1NKCA 4JI3K 3AVGA 4JNEA 3MECA 3GG4A 4EIAA 1EETA 1YAGA 3U9ZA 3OW2M 1QZ6A 4JK7A 5AQRA 5A2QO 3C94A 4ID1A 3V9XA 3B6PA 3SCXA 4JKDA 3CHWA 3I0RA 1D9FA 1EQYA 2R7YA 3J81O 1RT2A 3WXIA 4LF9K 4KHSA 3MN5A 1LWFA 2Q0UA 3AVHA 5C25A 4YY3K 1HNXK 1C0MA 4NCBA 2DFFA 4KB0A 2NRWA 1NOYA 2YX6A 1RDAA 4C8MA 4GW6A 4BRDA 3F2KA 2KLAA 4HTUA 1HJOA 3H08A 3LDSA 3ASMA 2HB5A 1VQKN 4FJKA 3TSQA 2GUIA 1Q9YA 1GOAA 3K5OA 4CGJA 1KTQA 3CJCA 1N8RO 3NE6A 5AQJA 1YTAA 4WFBL 1P8ZA 3ZSRA 2D0CA 5BN9A 4AHUA 2VCPA 3MEEA 2E88A 4CEFA 2RE2A 4FVMA 5AFUH 2YHYA 3QICA 1KLMA 2NZTA 1MDUB 4DV5K 4CECA 5BPLA 5DM7L 4RWTA 3K58A 2HHTA 3CJ7A 3VQEA 5BPMA 5JVHL 3CETA 1HYSA 4FO0A 5AQTA 2Q3SA 4LF6K 3OBWA 5JLHA 2QTDA 2QWQA 3PX6A 2A1SA 3LM9A 3G0ZA 4YFUA 2FBVA 3AO4A 3ZX2A 4CBWA 4N41A 1P90A 2ZGYA 4WE1A 1S72N 2CH6A 4JHDB 1YTUA 1ILYA 1NK8A 4KTQA 1HKGA 2FSNA 2PYLA 2FC0A 4CJ3A 1VK0A 4JRQA 1KC8O 3V9WA 4CERA 1EKEA 4PKHA 4HVJA 3MEDA 5LY3A 3HZ6A 1HYZA 4G1QA 3E9OA 4FPBA 1KVAA 2HNYA 3CCMN 1RTDA 3KTQA 2OPRA 1BI4B 4GV6A 4CGHA 3PSIA 3OYDA 3I8DA 4B8AB 2PY5A 1BCOA 1V4SA 3T1YK 2QWLA 5LJWA 4LH5A 1TKXA 3WXKA 2UXBK 5AQZA 4ICLA 5CZ2A 2ITMA 4W5RA 1RTHA 1Q7YO 4BE0A 3HP9A 4DV1K 4K25A 3PLAA 4CJ7A 3VTIA 2A5XA 4EAHD 4ILHA 4HCCA 5KTQA 2HBLA 3O8MA 5FRMA 1YHQN 3UKRB 3LPUA 4CK3A 4FSVA 4IEIA 4CZLA 1V4TA 1Z6RA 3O3FA 1TYQB 4OKJA 4AHSA 4X65K 1HYVA 2IIRA 3CM5A 1TKDA 1OH5A 3OYJA 2YNIA 2A3ZA 4DV4K 3P5JA 3HO1A 1N6QA 3WNHA 3WEEB 2UXCK 4MLEA 1T44A 1FKPA 1IG8A 1Q81O 3KZBA 5IT9O 2BH1A 1BA0A 4I6MA 5AQHA 2D0AA 3B6OA 2XRIA 1XNQK 4RW9A 4IFYA 2Z1GA 2OA8A 1NK4A 3L0QA 4HCBA 4OKEA 1BL3A 5DK5A 4DU1A 1I94K 1TYQA 4KREA 3MX2A 4JKFA 3T19A 4M3WA 1WLJA 1BGXT 3EKSA 3ZEUB 1T3VA 2VWKA 2W42A 4PWDA 4DUYK 4DCHA 2O8DA 1JJ2M 2DTUA 5KPTA 4OKKA 2FXUA 2YJFA 1QQNA 1KFDA 3VN5A 3BDPA 4ISFA 3T1AA 1VSLA 2UU9K 3FZMA 1S1WA 2Q36A 5M1QA 4B1UB 5LL6Z 2P9PB 1SL2A 3HSTB 2NRRA 4FK4A 3AGRA 3OJSA 2DPNA 2XHBA 1C0FA 4CI6A 1NK9A 4DR4K 4DV2K 2F96A 1NJIO 4GY2B 3M8SA 3AV9A 3MEGA 3QETA 2ZGZA 4X64K 2WFBA 4F4KA 2O8BA 1ZBUA 3QB0A 4ZTJA 4DSIA 4XH5A 4KPYA 1RFQA 4AH9A 1HQEA 3HL8A 4KKOA 4EP4A 2P9SB 2P9PA 4WFAL 4M3YA 3ZT1A 3ZLJA 4NB4A 5AR0A 4BREA 3ZSVA 5B8HA 3FR0A 4Z0UA 3AGKA 4B9SA 4JI7K 3O4NA 2WUSA 3TAGA 3QEXA 2P9KA 4DQ8A 3V1RA 5JICA 4A2AA 4DF4A 3ZT3A 1QSSA 1WOQA 3IG1A 4DV0K 4CK2A 4Z94A 4IFVA 3OYKA 3R6MA 1NGFA 4GVEA 1RT6A 4PKGA 4FLUA 4FW1A 2E6MA 1YJ9N 1WSIA 3GL1A 4OLAA 3PO4A 3AVAA 3NH1A 3PSFA 3E1YA 3RR8A 1ZBHA 4AM7A 3NF9A 4JKEA 3AVLA 5IWAK 3EY1A 4R5PA 1NGIA 4CJSA 1NWKA 3IUCA 4OLBA 2E8AA 1BIZA 2OCEA 4NLBA 3TTCA 5BR9A 4FL9A 1N32K 3ZX0A 1WN7A 2NUBA 3WNEA 5LMNK 1XWLA 5BRHA 3L2QA 4I2PA 2ZE2A 4Y1DA 3AO1A 1TVRA 1IBKK 4X62K 1QHTA 3VQ9A 4N5SA 3VOVA 1KQSM 1BQNA 4H0VB 1IO2A 2ZWHA 3VESA 3VMFB 4HHTA 1CZBA 3WXLA 1HRHA 1GLAG 4B9QA 4XEIA 3O9TA 1JKHA 1YT3A 2QA4N 1VQ9N 4BRLA 5FPMA 4JI1K 3KIOA 3V4IA 3T7ZA 3QBWA 4NYNA 2O8FB 3SK3A 3FFKB 3SPZA 2E6LA 3SV3A 4B9LA 5AFUA 1RGIA 4JN4A 2OPPA 2EWSA 3ULEB 4FLZA 1T8EA 4YOTA 4BR7A 2FBXA 2IC3A 1CZAN 4O8UA 3JXUA 3KLEA 4A2BA 4BRIA 3ZYYX 4PQUA 4K8ZA 3WUHA 1JXBA 3THWB 1B9FA 3ZSQA 2F8SA 1CXQA 1RTJA 2OZMA 2F9WA 2ZJQL 1GLJO 2IVNA 3SQ0A 4I7FA 1NJWA 2G8WA 4FWRA 2G8UA 4FXDA 2AJQA 1E4FT 1Q86O 3SQ2A 2O8FA 4BRFA 3VQ6A 3AVJA 3TSUA 1ASUA 4CIEA 3SUOA 3S9HA 3OYFA 3LP0A 1Q8IA 2HSTA 1ASWA 3ULEA 4UY8O 1WSJA 2KQ2A 4IWVA 5T7BA 1GLDG 4H0PA 1RBSA 1OVYA 4CHYA 3M8RA 3WQUA 5FROA 3CYMA 3I0SA 3O3HA 2UUAK 2NLXA 1SKWA 3MDQA 1GOBA 3L2VA 1K8KA 4ILJA 3ZT4A 1NJYA 1S1VA 2YNFA 2WTUA 3V6DA 3MX5A 3AVMA 1HPZA 4OPJA 3QIOA 3CCRN 3VETA 3R1XA 5BR8K 1FK9A 3EE8A 3L3VA 4CFAA 5KPZA 2IVOA 3V9ZA 3CQ8A 4M7XA 5AQSA 4FJ5A 1IBMK 4DFKA 4ISGA 4DQQA 4AHRA 2D1KA 3ENBA 3SUNA 2JLEA 3CC2N 2W40A 4DS5A 3O9SA 1NGCA 2RN2A 3SQ1A 3KKRA 4K41A 4BE2A 4KI4A 3LDLA 2XY8A 4PKIA 4CHZA 1WUAA 1DT9A 3CCQN 3G25A 4E7KA 3ZSYA 1W2BM 3F9KA 4JD2B 4JKGB 1QTMA 4O5BA 3AO5A 3UKUB 5J1EA 2QKKA 3LAMA 3O6WA 2Y1IA 3QEVA 4GNIA 5E84A 1J5OA 5C24A 1NG9A 3DRPA 2HHQA 3Q7CA 2YNGA 4O5FA 4I2QA 5F2RA 4H5RA 5ADXA 3HPOA 1NM1A 1MA9B 5GIOA 3WXMB 5HLFA 3VEZA 1VQON 5AQNA 3AA4A 4BVOA 2P51A 4B9UA 3H3OB 3LL3A 4LC9B 4CGGA 4E1JA 4ELUA 4B8CA 3HOTA 1L3SA 3E66A 1YI2N 4GKKK 3PX0A 4B1WB 1DKGD 4J2EA 2Z1JA 2HVIA 2BE2A 5BN8A 1KRPA 3TTDA 5AQQA 1X1PA 2CH5A 4YORA 3H1VX 3DLHA 1YUWA 4OPKA 4FWKA 2HHHK 2O8EA 1GLEG 2QKBA 1Q18A 3AY9A 1XHZA 3ENOA 5SZTA 1QZ5A 1IKWA 4JK8A 4B3OA 3HI0A 3VF4A 2YV0X 1JXEA 1VQPN 4OO1J 2CGLA 4CJKA 3LWMA 2G8KA 1JLFA 4KHYA 3LWLA 3IAYA 4LFAK 3CJ1A 3VEOA 4JS4A 3C6TA 3CERA 1WNSA 3OA9A 4I9LA 3WQTA 3O08A 3QNNA 3CCUN 4CIFA 1R0AA 3P4IA 3BF3A 3NH2A 1SKSA 3SV4A 3DLBA 2PAVA 2IS3A 3SZ2A 4K8XA 3EYZA 1FW6A 2E1YA 4FLVA 1SS6A 3OJUA 1FKOA 4UQGA 1TK0A 3ITHA 4MLHA 4DSKA 1TV6A 3DOKA 1VQMN 1XNRK 3H46O 4DQSA 4MO5A 1ZBFA 3FZKA 4CEZA 4B3MK 4DR1K 3U3YA 4B9TA 2GEMA 1QSLA 3O5BA 3V81A 4GKJK 4KO0A 2V51B 3ENHA 2OTLN 3THXA 4M45A 4FZXC 3L3UA 1SL1A 1NGDA 3CCVN 2P9NA 3P38A 3KVGA 3GE1A 5M1NA 3CPEA 3CJ9A 4MDAA 4Z4IA 5D3GA 1J6ZA 2RKIA 4GVMA 4IJNA 3W0LA 3AVBA 5C15A 1NJXA 3LANA 1FXXA 2QWRA 4M63C 1BG3A 1SUQA 3ZSZA 4A59A 3ALYA 1QSYA 3CFPA 3KK2A 3SJJA 1Z25A 2KTQA 4F3TA 4CZMA 3A5MC 1RILA 4DSEA 4N47A 5E26A 4KBOA 4DQPA 2HHSA 4IBNA 3A5OC 4KTWA 4BC4A 4CJPA 1XHXA 4YDUA 1CZ9A 5HP1A 3LDOA 3NHGA 3VTHA 5FRNA 1SZ2A 5JMVA 4CZFA 3KLIA 1IJJA 1OH7A 4DF8A 1WAJA 4DWIA 5AQMA 4XH4A 4YHHK 1YITN 2F8TA 4B3SK 4DSFA 4A5AA 3DRSA 3FFIA 3TAEA 4G9ZA 3IDHA 3MMVA 4JI8K 4KHPK 2NRZA 2NNWA 4QS7A 2G8HA 3CIPA 2BTFA 4BR5A 2OZSA 1M1KO 1VQ8N 4H5VA 1J5EK 4K43A 1D4XA 3L4IA 4LFBK 2PBDA 2KHOA 4YOUA 1RBUA 1T7PA 4CJ5A 4HUGA 2A6AA 3SI6A 3SYZA 4BDYA 4A57A 3ID8A 3VQ4A 3HP6A 2HHVA 1VRTA 3ZSXA 2XO7A 2B6AA 4DTRA 1L3UA 4H0YB 4IG0A 2YHXA 3HPGA 3HM9A 3FE1A 3NMUA 3C0BA 1R59O 2O8CA 3HXMA 3NH0A 3QINA 1W7AA 3JAMO 2OANA 3HOSA 4BR0A 3DLRA 4KAZA 4CK1A 3TABA 1WBBA 1RDCA 4FWLA 2VYPA 5KQDA 4CF1A 3OYLA 2ASPA 4FWOA 4E7HA 3L2UA 1IH7A 1WSGA 1NGHA 4X66K 4FVUA 3G6EN 4I6MB 3VQ5A 4DFPA 1SV5A 2AP1A 1XUPO 1Q82O 1D5AA 2RPIA 2E5LK 3SAFA 2D4WA 4CVNE 4M42A 3WNFA 3D2EB 1J53A 3NF6A 4CF2A 4CZHA 2ZJRL 1SL0A 3T69A 1U2VA 3VQBA 1BA1A 4E7JA 3O1BA 5MLCQ 3C65A 1NKEA 1XC3A 5KGWA 2P9UB 1CXUA 4AHVA 2O8DB 2HBKA 5C12A 2FBYA 1U04A 1KD1O 4PY5A 4H5NA 2VWBA 4K0KK 3A0IX 3BY5A 3OYBA 4IXCA 3Q7BA 5FPNA 5AQWA 5FLXO 2WBNA 1XC9A 5CYQA 1NK7A 3D2EA 4C1NI 3KK1A 4CJRA 4DTOA 3D0PA 1S1XA 4MQ3A 1NJZA 1RDUA 3HRGA 1JLBA 3DJCA 1TUUA 3SAHA 2P9UA 4H0XB 4FLXA 4ZTFA 3KKSA 3CG7A 1HLUA 2VWJA 3C7NB 5AZJA 4FM0A 3H1QA 4CJWA 2GX9A 1VSIA 1BO5O 2Q31A 4LSNA 3NF7A 3PIPL 4CE9A 5GAEP 4RW4A 2O8BB 3CD6N 4NXMK 4FWSA 3AVCA 4EFHA 5HBMA 3SUPA 3OYEA 2AA4A 3RVCA 4FM2A 4B1YB 4JI2K 4U7BA 5E41A 4PL7A 4CF8A 4ID5A 2IGIA 4BQLA 1L3TA 4ELTA 1BUPA 1ZBLA 4IFEA 2VQEK 3UB5A 5C2FA 1KVBA 3C7NA 4CJEA 3O9QA 1EXQA 1ATSA 3K5MA 1JCEA 4BG9A 1REVA 3KWGA 5GINA 4CEDA 1JLAA 1HX1A 3RSEA 5AJ3K 1EWQA 5M1FA 4CFDA 5JS2A 2P9KB 3DWLA 3M1FA 3SBGA 3KWIA 3KLFA 1BIUA 2DFEA 3EL2A 3AVFA 4M3TA 1O1WA 1RT7A 3K2PA 3M5RA 2E2NA 1G15A 3DXMB 3O4QA 4DR6K 3CCSN 1GLFO 1QVGM 3IS9A 1X3MA 2E2PA 2YI1A 1ESVA 4YNQA 3QERA 1B9DA 4CJUA 2DFHA 5J2NA 5CYMA 4AF1A 3FLCO 2A40A 2GV9A 2LSNA 5TKYA 3RR7A 3HPHA 3OYGA 2HF3A 5FPDA 4M3RA 3JSMA 1ZBIA 4FJJA 4WQ4A 4IZ9A 4CHNA 4LSLA 3DXMA 1CLQA 3BF1A 2BGGA 4BR2A 1GOCA 3V9UA 3TAQA 2GTDA 1YVUA 3BZCA 3OTOK 4EHUA 2VQFK 1U49A 4KI6A 1NU0A 1EO1A 1UAXA 1KAXA 1BCMA 2YHAA 3THYA 4H03B 4BRPA 3L6QA 2D5RA 1O13A 1Y64A 4BRKA 3AVIA 4RW6A 4H4OA 4DHYA 3A5NC 4Z4FA 4H0OA 4DQRA 4W5OA 1D8YA 4FK2A 3G4SN 3DM2A 1JCGA 4MO4A 5FPEA 3HK2A 1DEJA 1ATNA 5K14A 5HRSA 2HBMA 3KJVA 1FJGK 4NXNK 4JLHA 4JKCA 1JL1A 4WQ5A 5CR4A 1UA0A 1BOTO 3CFRA 2IOCA 3FGUA 2Z1IA 2HVHA 4BRGA 1TKTA 4AHTA 1OKJA 1NGGA 4DMNA 3TPQA 2GWKA 1RCHA 2P9LB 3VGMA 4C23A 1VQ4N 4DV7K 4CIGA 4F2RA 4B1ZA 4DTSA 3ATUA 2B5JA 2P9IA 1IKXA 4H4MA 5HRRA 4JI4K 3VEVA 1NGBA 2E1ZA 3VQDA 3W3DA 3MXMA 1JLGA 4DR3K 1U45A 1LOTB 1S6QA 4RW8A 2VG6A 1HPMA 1Q9XA 1K8KB 3VF2A 2XY6A 1L5UA 1EX4A 2PZSA 4M7YA 2ZJPL 3LP1A 1C0GA 3F5TA 3KD1E 2P9LA 3OYAA 5AQPA 4B08A 3TI0A 4FOEA 4E7IA 1A5WA 2O4GA 3SQ4A 3RWUA 2B4JA 1T6CA 3HJFA 5AQUA 3GOIA 4DV6K 4WFNL 3CMAN 1X9MA 3U9DA 3MCPA 3J7AP 2XY5A 2YKMA 4JKAA 4BRNA 1HKCA 5LJVA 2G8IA 4Z4HA 4JI6K 5BREA 4J2AA 1M90O 3ZETA 1NMNA 4DLEA 4IJAA 3C95A 3P39A 5KQ8A 5AQLA 1U4BA 1U48A 4RG8A 3U3GA 4OJRA 1DTQA 3VEYA 3DOLA 3IMXA 2E20A 3VEXA 4EHTA 1QQMA 3NVKA 1JCFA 4DTNA 4JV5K 4CEEA 5C2DA 1HQUA 3K5NA 2Q1NA 3KD5E 3OS0A 2CGKA 3BZKA 3H6EA 1NGEA 1HJRA 4WCEL 3PO5A 4WQ4C 3DXKB 1W9HA 4DKWA 1DGKN 3TARA 4BC3A 3A2FA 2QXLA 2HNDA 2X6SA 1RDDA 3VGKA 2OTJN 4DTPA 3MN9A 2QWOA 1Z26A 3VPZA 4U67L 4H5TA 2JWLA 4KH4A 5BRFA 4CF0A 2Q0RA 4DSJA 4E1NA 1RDWX 1WSEA 2IDOA 3SUQA 2I5JA 2FSKA 3D2FB 3S3MA 1H1VA 1ASVA 4MFBA 3ID6A 3D45A 2A1RA 3M6GA 5EOYA 1OH8A 2WC9A 4Y0WA 4OX9K 3NFAA 2QWPA 4B9NA 1KAYA 2O8EB 3DXKA 1XMOK 3OHRA 5HROA 3S3NA 4BY9C 2OPSA 3BP8A 4ELVA 3M8QA 5EX5A 2X6NA 4BQZA 1KLNA 4EZ6A 4A61A 2VGMA 2FBTA 4XH1A 4TSXA 3LALA 1VRUA 4DFJA 3TU5A 3V1QA 1J9AA 3MXJA 5AQOA 4JI5K 3O1WA 4WQ5C 1HKBA 4B1VA 4PUOA 3FZFA 2ZQBA 3D2FA 1RNHA 3NAEA 3RRHA 4CJQA 1T05A 2I7NA 4L8RB 4LFCK 3LDPA 3RMBA 3C6HA 4CBUA 3C6UA 1ITGA 3V1OA 4ISEA 1X3NA 5DMRA 4BR9A 1IG9A 3NVMA 4A62A 4Z4EA 2UXDK 4JI0K 1YF5L 4KHUA 4QCLA 1F21A 4C8KA 4Z4GA 5FDLA 5J2QA 2BUPA 4N56A 4GMJB 4JEPA 1NK6A 5BPNA 3U6FA 3AARA 3TAFA 3THXB 4IOAL 5HL7L 1K6YA 4A5BA 3NDKA 2ASMA 2E2QA 4AILC 2P9NB 4KFBA 3VEWA 1HUXA 4OGEA 5M1OA 1VSJA 3CQXA 1WBDA 4M3XA 2VG5A 3PY8A 5JS1A 3BGRA 4DG1A 1S22A 3E9LA 1LAWA 1ATRA 3DLEA 4R79A 3OYIA 4CZEA 4NO7A 3VA3A 2E4LA 1MWMA 3KHYA 3OYMA 3ZSOA 4HWIA 4FJIA 1QQOA 2W6KA 4RCHA 4FK0A 1RT5A 4C1NK 5AQXA 1XI1A 3SPYA 1GLLO 4KH6A 4J2DA 3TR8A 3TTFA 3TAPA 1NNEA 1X9JA 4DTMA 2HBJA 5JLFA 5CZ1A 3TWHA 4E0DA 1A5XA 3RMCA 1BQMA 4O4GA 5AQFA 4F8RA 4YOYA 3U4LA 2W41A 4DSLA 5GIPA 1BWFO 4E1MA 3K9JA 4B3TK 1S3XA 2UYTA 3ATVA 3WNGA 3L2RA 3TAMA 4KH5A 2X74A 2VG7A 1IV0A 2OPQA 4B3RK 4CESA 4AQYK 1TL3A 3CC7N 4IOCL
chains in the Genus database with same CATH topology
3VQ9A 4N5SA 4B9VA 1BQNA 3NF7A 4LSNA 4CE9A 1TAQA 4RW4A 4Y1CA 1IO2A 4C8LA 5HRNA 4JRPA 4HHTA 1CZBA 4BE1A 3AVCA 3DYAA 1DTTA 1HRHA 5HBMA 3OYEA 3SUPA 4F2SA 2HNZA 4FM2A 4LY7A 3IRXA 3LPTA 4O0JA 1IKYA 3ZT0A 4Q0BA 1JKHA 5E41A 1YT3A 4CF8A 5SWMA 4ID5A 2IGIA 4O44A 3KIOA 1JLCA 3V4IA 1L3TA 4BACA 4ELTA 2RF2A 1I39A 3QEIA 4CGFA 3TANA 3VQ7A 4NYNA 3RMDA 1ZBLA 4KRFA 1S9GA 1KVBA 3SPZA 2E6LA 5KRSA 4FCYA 2HHUA 1KVCA 4CJEA 3SV3A 4B9LA 1EXQA 3DLKA 3K5MA 2OPPA 4DFMA 4OVLA 4E7LA 1REVA 1RT4A 4FLZA 1T8EA 4BWMA 1JLAA 2FBXA 3LP3A 1NOZA 2IC3A 4CEDA 1VSEA 3HYFA 1LV5A 3K57A 2P5GA 4CFDA 5JS2A 2HW3A 3KLEA 4PQUA 4K8ZA 1JXBA 1I3AA 5KGXA 1B9FA 3VQ8A 1BIUA 3ZSQA 4KV8A 3KLFA 4Z4CA 3HVRA 2DFEA 2WONA 1CXQA 5I3UA 1HMVA 2F8SA 1RTJA 3PUFA 3AA5X 3AVFA 2OZMA 4FJMA 4M3TA 2HMIA 1O1WA 1RT7A 4DQIA 3K2PA 3LP2A 2Y1JA 1G15A 4FW2A 3O4QA 4I7FA 1IKVA 4EP5A 3SQ0A 1Y97A 2X78A 1NJWA 3OS2A 2G8WA 2G8UA 4FXDA 5KI6A 1NK0A 1N5YA 3AVKA 3SQ2A 4FJ9A 2AJQA 3VQ6A 3IS9A 3AVJA 4CIEA 1ASUA 5J2PA 2BDPA 2KZMA 4YNQA 3QERA 2WOMA 4KB1A 3SUOA 3S9HA 1B9DA 3OYFA 2EHGA 4CJUA 4J2BA 3LP0A 1JL2A 2DFHA 2YHBA 1Q8IA 3PV8A 1ASWA 1JLEA 4RW7A 5J2NA 3QEPA 3NBPA 5CYMA 1WSJA 4QAGA 3JYTA 4KHWA 1VSMA 2KQ2A 5T7BA 4CFCA 2LSNA 2GV9A 4CJTA 1RBSA 1TAUA 4FM1A 3ISNC 3DMJA 5EU7A 3RR7A 1X9WA 1RDBA 1LWCA 3P83D 3RRGA 3HVTA 3VQCA 4CHYA 3M8RA 1NKCA 3HPHA 3OYGA 5FROA 3CYMA 1S6PA 3AVGA 3I0SA 3O3HA 3NGZA 4M3RA 3JSMA 1SKWA 1ZBIA 2QK9A 1GOBA 3MECA 3L2VA 1KSPA 4FJJA 3ZT4A 1NJYA 4CHNA 4LSLA 1S1VA 4CCHA 2YNFA 1CLQA 1EETA 3OYHA 4DU4A 3V6DA 4FJ8A 2BGGA 1GOCA 3AVMA 1HPZA 4OPJA 3QIOA 3OYCA 3V9UA 3TAQA 4CEOA 1FK9A 1YVUA 3L3VA 1U49A 4CFAA 3V9ZA 3CQ8A 4KI6A 3C94A 4DTXA 4ID1A 3V9XA 4FJ5A 3L8BA 4DFKA 1BI4A 1UAXA 3B6PA 4AHRA 4DQQA 3SCXA 1BCMA 2YHAA 3I0RA 4CGDA 1D9FA 2R7YA 3SUNA 2JLEA 4DS5A 1RT2A 5I42A 1RBRA 2D5RA 4KHSA 3PX4A 2RN2A 3SQ1A 1LWFA 3AVIA 3AVHA 4RW6A 3KKRA 5C25A 4BE2A 1C0MA 4NCBA 4H4OA 4KI4A 2DFFA 1S1TA 4AHCA 2XY8A 4KB0A 2GBZA 3AA2A 4Z4FA 4CEBA 1NOYA 4CHZA 1VSHA 3VQPA 4FZYA 4DQRA 1RDAA 4C8MA 4W5OA 1D8YA 4FK2A 4E7KA 1C6VA 4GW6A 3DM2A 3ZSYA 4IDKA 4HTUA 3F9KA 2G8FA 3RTVA 3DLGA 4XIUA 1QTMA 4O5BA 3H08A 3LDSA 3HK2A 3AO5A 3ASMA 2HB5A 5J1EA 5J2MA 4FJKA 2QKKA 3LAMA 4CEQA 2GUIA 5K14A 1GOAA 3MAQA 1Q9YA 3K5OA 4CGJA 5HRSA 4M3UA 2Y1IA 1KTQA 4M41A 1LWEA 3QEVA 3KJVA 4BWJA 1J5OA 3NE6A 4N76A 5C24A 4F3OA 1YTAA 3DRPA 4M3ZA 1S9EA 2HHQA 4JLHA 4Q5VA 2YNGA 4I2QA 1JL1A 3ZSRA 1UA0A 3CFRA 3HPOA 4EZ9A 2KZZA 2D0CA 4AHUA 2IOCA 3MEEA 2Z1IA 2HVHA 1J54A 3OS1A 4CEFA 1TKTA 3OY9A 4AHTA 5HLFA 1B92A 4FVMA 3THVA 4DMNA 3AA4A 1RCHA 2P51A 4DTJA 4B9UA 1KLMA 4FYDA 3V9SA 1TL1A 4CECA 4CGGA 3K58A 3QIPA 4F2RA 4CIGA 3QEWA 4CHPA 4ELUA 2HHTA 3VQEA 4DTSA 2KFZA 4B8CA 1HYSA 2B5JA 2Q3SA 1L3SA 1IKXA 4H4MA 5HRRA 3PX0A 3ZT2A 3VQDA 3PX6A 4J2EA 2A1SA 2Z1JA 4QOZB 1S1UA 2BE2A 3MXMA 2HVIA 3G0ZA 4YFUA 1KRPA 2FBVA 1JLGA 3KLGA 4C8NA 3AO4A 4W5NA 1U45A 4FJGA 1C0UA 2ITGA 1X1PA 3ULDA 1S6QA 4N41A 4RW8A 3DLHA 4FLTA 2HHXA 2VG6A 4WE1A 4OPKA 1Q9XA 4FJHA 2IAJA 1YTUA 3ZSWA 2XY6A 2QKBA 1NK8A 4KTQA 4E89A 2PYLA 4NCGA 2FC0A 4CJ3A 1VK0A 1EX4A 5SZTA 4JRQA 1XHZA 1IKWA 3LZIA 1L5UA 2PZSA 3V9WA 3LP1A 4CERA 4B3OA 4BDPA 1EKEA 2YV0X 1JXEA 3KD1E 4CJKA 3OYAA 3LWMA 2G8KA 4HVJA 3MEDA 3TI0A 1JLFA 2KW4A 4B08A 1HYZA 4G1QA 5HRPA 4E7IA 4KHYA 1RBVA 3LWLA 1TK8A 1KVAA 1A5WA 3IAYA 2HNYA 4JS4A 1RTDA 3C6TA 2O4GA 1WNSA 2D0BA 3SQ4A 4I9LA 2B4JA 2OPRA 1BI4B 1RBTA 4CJFA 1T03A 3RWUA 4CGHA 3HJFA 3QNNA 3OYDA 1X9MA 3I8DA 4B8AB 2PY5A 3AO3A 4CIFA 1BCOA 3F73A 3S3OA 1R0AA 2XY5A 2YKMA 3NH2A 1SKSA 3SV4A 1SKRA 3DLBA 2G8IA 4H8KA 4LH5A 1TKXA 4Z4HA 2IS3A 3LAKA 3SZ2A 4K8XA 4ICLA 3P1GA 5CZ2A 4W5RA 3EYZA 3K5LA 4J2AA 4E19A 1RTHA 4DLEA 4I9QA 4FJ7A 4BE0A 3C95A 3HP9A 2P1JA 4FLVA 3OJUA 1FKOA 4O0IA 4UQGA 1U4BA 1C0TA 1TK0A 3ITHA 1U48A 4HCCA 4DSKA 4RG8A 3M8PA 1TV6A 4OJRA 3U3GA 3DOKA 1DTQA 4CF9A 5KTQA 1U47A 1D9DA 5FRMA 3LPUA 1ZYQA 3DOLA 4DQSA 4CK3A 4LD0A 1ZBFA 4CEZA 4DTNA 4CEEA 3U3YA 3O3FA 3CM6A 1HQUA 3K5NA 4B9TA 1QSLA 3KD5E 3G10A 4OKJA 4AHSA 4KO0A 1LW0A 1DLOA 3OS0A 3V81A 1HYVA 2YKNA 4M45A 4FZXC 3L3UA 1SL1A 1HJRA 3CM5A 1TKDA 3PO5A 2QXFA 2O4IA 2BANA 2YNIA 3OYJA 1W9HA 1HNIA 1LW2A 4FJLA 3P5JA 4NCAA 1N6QA 3WNHA 3HO1A 3DRRA 3RMAA 2XY7A 1FKPA 3TARA 4Z4IA 3A2FA 3SNNA 5D3GA 2RKIA 4GVMA 2HNDA 3AVBA 2X6SA 1UOCA 1RDDA 3L2WA 1NJXA 3LANA 4W5TA 4DTPA 2D0AA 3B6OA 2XRIA 1FXXA 4FZZA 1Z26A 4RW9A 4IFYA 4IG3A 4HUEA 1BISA 1SUQA 3ZSZA 2Z1GA 4PA1A 4CF0A 2OA8A 3ALYA 1NK4A 4B9MA 4DSJA 1QSYA 3CFPA 4E1NA 3KK2A 3SJJA 1JLQA 1Z25A 4F3TA 2KTQA 1WSEA 1RILA 2IDOA 4DSEA 1BHLA 2I5JA 4N47A 3SUQA 4OKEA 3S3MA 1BL3A 4HCBA 4DQPA 5DK5A 1ASVA 4MFBA 4DU1A 1L3VA 2HHSA 3D45A 4IBNA 3EZ5A 4KTWA 2A1RA 4CJPA 4KREA 3T19A 1XHXA 1TKZA 4M3WA 1X9SA 1CZ9A 2G8VA 3DI6A 1WLJA 1BGXT 3NFAA 3OVNA 3K59A 2DY4A 5HP1A 4B9NA 3NHGA 5C42A 4LH4A 2VWKA 2W42A 5FRNA 4PWDA 5HROA 3S3NA 2OPSA 2YNHA 1A5VA 4FJXA 2DTUA 4ELVA 3KLIA 4OKKA 3M8QA 4CJ4A 4DF8A 1WAJA 2X6NA 4DWIA 1S5JA 3NGIA 1TK5A 1KLNA 1KFDA 3VN5A 3BDPA 4EZ6A 2F8TA 2FBTA 4TSXA 3LALA 1VRUA 3NGYA 3T1AA 4DSFA 1WSFA 2Z1HA 4DFJA 1RTIA 2JGUA 3DRSA 1VSLA 3FFIA 4FLYA 3KTQA 3V1QA 3TAEA 1S1WA 3AA3A 1J9AA 3MXJA 1VSDA 4DLGA 1TGOA 4DTUA 2G8HA 4PUOA 2ZQBA 1SL2A 3HSTB 1RNHA 1VSFA 2OZSA 3NAEA 4O55A 3RRHA 1W0HA 4FK4A 4CJQA 1T05A 4L8RB 4CJVA 3AVNA 3VQQA 3UIQA 3OJSA 1UWBA 1RBUA 3VQAA 4CJ5A 1T7PA 3RMBA 3NF8A 4HUGA 2XHBA 4FJNA 3SI6A 1NK9A 1C1CA 3C6UA 1ITGA 4BDYA 3SYZA 1KFSA 1C1AA 3V1OA 2F96A 1NK5A 3VQ4A 3HP6A 5DMRA 2OYQA 3M8SA 2HHVA 3AV9A 3MEGA 1IG9A 1VRTA 3O3GA 3ZSXA 3QETA 2XO7A 2B6AA 4DTRA 2ETJA 1WAFA 4Z4EA 1L3UA 5KRTA 4IG0A 4F4KA 4KHUA 3HPGA 3HM9A 4QCLA 1ZBUA 1F21A 1NKBA 4C8KA 3VA0A 4ZTJA 4C8OA 4Z4GA 5FDLA 3HXMA 3NH0A 4N56A 5J2QA 4GMJB 4DSIA 4KPYA 3QINA 4KTZA 1HQEA 3HL8A 4AH9A 1NK6A 3U6FA 4KKOA 1EP4A 3TAFA 4EP4A 4KHQA 1WSHA 1K6YA 3DLRA 4CJLA 4CK1A 4KAZA 4KHNA 3NDKA 3KLHA 4M3YA 3ZT1A 3TABA 4AILC 3ZCMA 1RDCA 4KFBA 4CHOA 4CF1A 3OYLA 1UA1A 4OGEA 3HT3A 4E7HA 3L2UA 3ZSVA 1VSJA 1IH7A 2ATQA 1WSGA 1RT3A 4Z0UA 4DS4A 4OGCA 3VQ5A 3MXIA 2ZD1A 4B9SA 4M3XA 3QLHA 4DFPA 1SV5A 2VG5A 3PY8A 5JS1A 2EX3A 3BGRA 4DG1A 1QS4A 1D5AA 1LAWA 2RPIA 3O4NA 3LZJA 4HUFA 3QNOA 3DLEA 3TAGA 1VSKA 4BDZA 3OYIA 3QEXA 3WNFA 4M42A 3AO2A 1J53A 3NF6A 3V1RA 4CF2A 3NCIA 3VA3A 3QO9A 4CHQA 1SL0A 2HHWA 4DF4A 3ZT3A 3VQBA 1QSSA 2E4LA 1QQCA 4E7JA 4ZHRA 3IG1A 1LAVA 3OYMA 4CK2A 2P5OA 3ZSOA 4IFVA 1NKEA 4FJIA 5KGWA 3OYKA 4FK0A 1RT5A 1CXUA 4DU3A 1RT6A 4FLUA 4AHVA 4FW1A 1XI1A 2E6MA 3SPYA 3T3FA 3QESA 1MU2A 1WSIA 5CY4A 2FBYA 1U04A 4J2DA 4OLAA 1HNVA 3TR8A 3KK3A 3AVAA 3TAPA 3PO4A 4PY5A 3NH1A 4DTMA 3RR8A 1ZBHA 4CFBA 5CZ1A 3OYBA 3NF9A 4CEAA 3TWHA 4E0DA 3AVLA 2KFNA 3E01A 1A5XA 3EY1A 3RMCA 1BQMA 4R5PA 4O4GA 4NYFA 3OYNA 4CJSA 1XC9A 5CYQA 1NK7A 4F8RA 4E3SA 1RT1A 4OLBA 4DSLA 2PYJA 3KK1A 1BIZA 4CGIA 4E1MA 1KCFA 4CJRA 4DTOA 3D0PA 4FLWA 1S1XA 1WN7A 4MQ3A 3WNGA 1NJZA 3L2RA 2NUBA 3WNEA 1JLBA 3TAMA 4FLXA 2X74A 1QE1A 1XWLA 2VG7A 4IKFA 4ZTFA 3CFOA 3L2QA 2OPQA 2ZE2A 3CG7A 3KKSA 4I2PA 2VWJA 4Y1DA 3AO1A 1TVRA 4CESA 4W5QA 1TL3A 4JS5A 4FM0A 4CJWA 1C1BA 1QHTA 1VSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VQ9 A;  4N5S A;  4B9V A;  1BQN A;  3NF7 A;  4LSN A;  4CE9 A;  1TAQ A;  4RW4 A;  4Y1C A;  1IO2 A;  4C8L A;  5HRN A;  4JRP A;  4HHT A;  1CZB A;  4BE1 A;  3AVC A;  3DYA A;  1DTT A;  1HRH A;  5HBM A;  3OYE A;  3SUP A;  4F2S A;  2HNZ A;  4FM2 A;  4LY7 A;  3IRX A;  3LPT A;  4O0J A;  1IKY A;  3ZT0 A;  4Q0B A;  1JKH A;  5E41 A;  1YT3 A;  4CF8 A;  5SWM A;  4ID5 A;  2IGI A;  4O44 A;  3KIO A;  1JLC A;  3V4I A;  1L3T A;  4BAC A;  4ELT A;  2RF2 A;  1I39 A;  3QEI A;  4CGF A;  3TAN A;  3VQ7 A;  4NYN A;  3RMD A;  1ZBL A;  4KRF A;  1S9G A;  1KVB A;  3SPZ A;  2E6L A;  5KRS A;  4FCY A;  2HHU A;  1KVC A;  4CJE A;  3SV3 A;  4B9L A;  1EXQ A;  3DLK A;  3K5M A;  2OPP A;  4DFM A;  4OVL A;  4E7L A;  1REV A;  1RT4 A;  4FLZ A;  1T8E A;  4BWM A;  1JLA A;  2FBX A;  3LP3 A;  1NOZ A;  2IC3 A;  4CED A;  1VSE A;  3HYF A;  1LV5 A;  3K57 A;  2P5G A;  4CFD A;  5JS2 A;  2HW3 A;  3KLE A;  4PQU A;  4K8Z A;  1JXB A;  1I3A A;  5KGX A;  1B9F A;  3VQ8 A;  1BIU A;  3ZSQ A;  4KV8 A;  3KLF A;  4Z4C A;  3HVR A;  2DFE A;  2WON A;  1CXQ A;  5I3U A;  1HMV A;  2F8S A;  1RTJ A;  3PUF A;  3AA5 X;  3AVF A;  2OZM A;  4FJM A;  4M3T A;  2HMI A;  1O1W A;  1RT7 A;  4DQI A;  3K2P A;  3LP2 A;  2Y1J A;  1G15 A;  4FW2 A;  3O4Q A;  4I7F A;  1IKV A;  4EP5 A;  3SQ0 A;  1Y97 A;  2X78 A;  1NJW A;  3OS2 A;  2G8W A;  2G8U A;  4FXD A;  5KI6 A;  1NK0 A;  1N5Y A;  3AVK A;  3SQ2 A;  4FJ9 A;  2AJQ A;  3VQ6 A;  3IS9 A;  3AVJ A;  4CIE A;  1ASU A;  5J2P A;  2BDP A;  2KZM A;  4YNQ A;  3QER A;  2WOM A;  4KB1 A;  3SUO A;  3S9H A;  1B9D A;  3OYF A;  2EHG A;  4CJU A;  4J2B A;  3LP0 A;  1JL2 A;  2DFH A;  2YHB A;  1Q8I A;  3PV8 A;  1ASW A;  1JLE A;  4RW7 A;  5J2N A;  3QEP A;  3NBP A;  5CYM A;  1WSJ A;  4QAG A;  3JYT A;  4KHW A;  1VSM A;  2KQ2 A;  5T7B A;  4CFC A;  2LSN A;  2GV9 A;  4CJT A;  1RBS A;  1TAU A;  4FM1 A;  3ISN C;  3DMJ A;  5EU7 A;  3RR7 A;  1X9W A;  1RDB A;  1LWC A;  3P83 D;  3RRG A;  3HVT A;  3VQC A;  4CHY A;  3M8R A;  1NKC A;  3HPH A;  3OYG A;  5FRO A;  3CYM A;  1S6P A;  3AVG A;  3I0S A;  3O3H A;  3NGZ A;  4M3R A;  3JSM A;  1SKW A;  1ZBI A;  2QK9 A;  1GOB A;  3MEC A;  3L2V A;  1KSP A;  4FJJ A;  3ZT4 A;  1NJY A;  4CHN A;  4LSL A;  1S1V A;  4CCH A;  2YNF A;  1CLQ A;  1EET A;  3OYH A;  4DU4 A;  3V6D A;  4FJ8 A;  2BGG A;  1GOC A;  3AVM A;  1HPZ A;  4OPJ A;  3QIO A;  3OYC A;  3V9U A;  3TAQ A;  4CEO A;  1FK9 A;  1YVU A;  3L3V A;  1U49 A;  4CFA A;  3V9Z A;  3CQ8 A;  4KI6 A;  3C94 A;  4DTX A;  4ID1 A;  3V9X A;  4FJ5 A;  3L8B A;  4DFK A;  1BI4 A;  1UAX A;  3B6P A;  4AHR A;  4DQQ A;  3SCX A;  1BCM A;  2YHA A;  3I0R A;  4CGD A;  1D9F A;  2R7Y A;  3SUN A;  2JLE A;  4DS5 A;  1RT2 A;  5I42 A;  1RBR A;  2D5R A;  4KHS A;  3PX4 A;  2RN2 A;  3SQ1 A;  1LWF A;  3AVI A;  3AVH A;  4RW6 A;  3KKR A;  5C25 A;  4BE2 A;  1C0M A;  4NCB A;  4H4O A;  4KI4 A;  2DFF A;  1S1T A;  4AHC A;  2XY8 A;  4KB0 A;  2GBZ A;  3AA2 A;  4Z4F A;  4CEB A;  1NOY A;  4CHZ A;  1VSH A;  3VQP A;  4FZY A;  4DQR A;  1RDA A;  4C8M A;  4W5O A;  1D8Y A;  4FK2 A;  4E7K A;  1C6V A;  4GW6 A;  3DM2 A;  3ZSY A;  4IDK A;  4HTU A;  3F9K A;  2G8F A;  3RTV A;  3DLG A;  4XIU A;  1QTM A;  4O5B A;  3H08 A;  3LDS A;  3HK2 A;  3AO5 A;  3ASM A;  2HB5 A;  5J1E A;  5J2M A;  4FJK A;  2QKK A;  3LAM A;  4CEQ A;  2GUI A;  5K14 A;  1GOA A;  3MAQ A;  1Q9Y A;  3K5O A;  4CGJ A;  5HRS A;  4M3U A;  2Y1I A;  1KTQ A;  4M41 A;  1LWE A;  3QEV A;  3KJV A;  4BWJ A;  1J5O A;  3NE6 A;  4N76 A;  5C24 A;  4F3O A;  1YTA A;  3DRP A;  4M3Z A;  1S9E A;  2HHQ A;  4JLH A;  4Q5V A;  2YNG A;  4I2Q A;  1JL1 A;  3ZSR A;  1UA0 A;  3CFR A;  3HPO A;  4EZ9 A;  2KZZ A;  2D0C A;  4AHU A;  2IOC A;  3MEE A;  2Z1I A;  2HVH A;  1J54 A;  3OS1 A;  4CEF A;  1TKT A;  3OY9 A;  4AHT A;  5HLF A;  1B92 A;  4FVM A;  3THV A;  4DMN A;  3AA4 A;  1RCH A;  2P51 A;  4DTJ A;  4B9U A;  1KLM A;  4FYD A;  3V9S A;  1TL1 A;  4CEC A;  4CGG A;  3K58 A;  3QIP A;  4F2R A;  4CIG A;  3QEW A;  4CHP A;  4ELU A;  2HHT A;  3VQE A;  4DTS A;  2KFZ A;  4B8C A;  1HYS A;  2B5J A;  2Q3S A;  1L3S A;  1IKX A;  4H4M A;  5HRR A;  3PX0 A;  3ZT2 A;  3VQD A;  3PX6 A;  4J2E A;  2A1S A;  2Z1J A;  4QOZ B;  1S1U A;  2BE2 A;  3MXM A;  2HVI A;  3G0Z A;  4YFU A;  1KRP A;  2FBV A;  1JLG A;  3KLG A;  4C8N A;  3AO4 A;  4W5N A;  1U45 A;  4FJG A;  1C0U A;  2ITG A;  1X1P A;  3ULD A;  1S6Q A;  4N41 A;  4RW8 A;  3DLH A;  4FLT A;  2HHX A;  2VG6 A;  4WE1 A;  4OPK A;  1Q9X A;  4FJH A;  2IAJ A;  1YTU A;  3ZSW A;  2XY6 A;  2QKB A;  1NK8 A;  4KTQ A;  4E89 A;  2PYL A;  4NCG A;  2FC0 A;  4CJ3 A;  1VK0 A;  1EX4 A;  5SZT A;  4JRQ A;  1XHZ A;  1IKW A;  3LZI A;  1L5U A;  2PZS A;  3V9W A;  3LP1 A;  4CER A;  4B3O A;  4BDP A;  1EKE A;  2YV0 X;  1JXE A;  3KD1 E;  4CJK A;  3OYA A;  3LWM A;  2G8K A;  4HVJ A;  3MED A;  3TI0 A;  1JLF A;  2KW4 A;  4B08 A;  1HYZ A;  4G1Q A;  5HRP A;  4E7I A;  4KHY A;  1RBV A;  3LWL A;  1TK8 A;  1KVA A;  1A5W A;  3IAY A;  2HNY A;  4JS4 A;  1RTD A;  3C6T A;  2O4G A;  1WNS A;  2D0B A;  3SQ4 A;  4I9L A;  2B4J A;  2OPR A;  1BI4 B;  1RBT A;  4CJF A;  1T03 A;  3RWU A;  4CGH A;  3HJF A;  3QNN A;  3OYD A;  1X9M A;  3I8D A;  4B8A B;  2PY5 A;  3AO3 A;  4CIF A;  1BCO A;  3F73 A;  3S3O A;  1R0A A;  2XY5 A;  2YKM A;  3NH2 A;  1SKS A;  3SV4 A;  1SKR A;  3DLB A;  2G8I A;  4H8K A;  4LH5 A;  1TKX A;  4Z4H A;  2IS3 A;  3LAK A;  3SZ2 A;  4K8X A;  4ICL A;  3P1G A;  5CZ2 A;  4W5R A;  3EYZ A;  3K5L A;  4J2A A;  4E19 A;  1RTH A;  4DLE A;  4I9Q A;  4FJ7 A;  4BE0 A;  3C95 A;  3HP9 A;  2P1J A;  4FLV A;  3OJU A;  1FKO A;  4O0I A;  4UQG A;  1U4B A;  1C0T A;  1TK0 A;  3ITH A;  1U48 A;  4HCC A;  4DSK A;  4RG8 A;  3M8P A;  1TV6 A;  4OJR A;  3U3G A;  3DOK A;  1DTQ A;  4CF9 A;  5KTQ A;  1U47 A;  1D9D A;  5FRM A;  3LPU A;  1ZYQ A;  3DOL A;  4DQS A;  4CK3 A;  4LD0 A;  1ZBF A;  4CEZ A;  4DTN A;  4CEE A;  3U3Y A;  3O3F A;  3CM6 A;  1HQU A;  3K5N A;  4B9T A;  1QSL A;  3KD5 E;  3G10 A;  4OKJ A;  4AHS A;  4KO0 A;  1LW0 A;  1DLO A;  3OS0 A;  3V81 A;  1HYV A;  2YKN A;  4M45 A;  4FZX C;  3L3U A;  1SL1 A;  1HJR A;  3CM5 A;  1TKD A;  3PO5 A;  2QXF A;  2O4I A;  2BAN A;  2YNI A;  3OYJ A;  1W9H A;  1HNI A;  1LW2 A;  4FJL A;  3P5J A;  4NCA A;  1N6Q A;  3WNH A;  3HO1 A;  3DRR A;  3RMA A;  2XY7 A;  1FKP A;  3TAR A;  4Z4I A;  3A2F A;  3SNN A;  5D3G A;  2RKI A;  4GVM A;  2HND A;  3AVB A;  2X6S A;  1UOC A;  1RDD A;  3L2W A;  1NJX A;  3LAN A;  4W5T A;  4DTP A;  2D0A A;  3B6O A;  2XRI A;  1FXX A;  4FZZ A;  1Z26 A;  4RW9 A;  4IFY A;  4IG3 A;  4HUE A;  1BIS A;  1SUQ A;  3ZSZ A;  2Z1G A;  4PA1 A;  4CF0 A;  2OA8 A;  3ALY A;  1NK4 A;  4B9M A;  4DSJ A;  1QSY A;  3CFP A;  4E1N A;  3KK2 A;  3SJJ A;  1JLQ A;  1Z25 A;  4F3T A;  2KTQ A;  1WSE A;  1RIL A;  2IDO A;  4DSE A;  1BHL A;  2I5J A;  4N47 A;  3SUQ A;  4OKE A;  3S3M A;  1BL3 A;  4HCB A;  4DQP A;  5DK5 A;  1ASV A;  4MFB A;  4DU1 A;  1L3V A;  2HHS A;  3D45 A;  4IBN A;  3EZ5 A;  4KTW A;  2A1R A;  4CJP A;  4KRE A;  3T19 A;  1XHX A;  1TKZ A;  4M3W A;  1X9S A;  1CZ9 A;  2G8V A;  3DI6 A;  1WLJ A;  1BGX T;  3NFA A;  3OVN A;  3K59 A;  2DY4 A;  5HP1 A;  4B9N A;  3NHG A;  5C42 A;  4LH4 A;  2VWK A;  2W42 A;  5FRN A;  4PWD A;  5HRO A;  3S3N A;  2OPS A;  2YNH A;  1A5V A;  4FJX A;  2DTU A;  4ELV A;  3KLI A;  4OKK A;  3M8Q A;  4CJ4 A;  4DF8 A;  1WAJ A;  2X6N A;  4DWI A;  1S5J A;  3NGI A;  1TK5 A;  1KLN A;  1KFD A;  3VN5 A;  3BDP A;  4EZ6 A;  2F8T A;  2FBT A;  4TSX A;  3LAL A;  1VRU A;  3NGY A;  3T1A A;  4DSF A;  1WSF A;  2Z1H A;  4DFJ A;  1RTI A;  2JGU A;  3DRS A;  1VSL A;  3FFI A;  4FLY A;  3KTQ A;  3V1Q A;  3TAE A;  1S1W A;  3AA3 A;  1J9A A;  3MXJ A;  1VSD A;  4DLG A;  1TGO A;  4DTU A;  2G8H A;  4PUO A;  2ZQB A;  1SL2 A;  3HST B;  1RNH A;  1VSF A;  2OZS A;  3NAE A;  4O55 A;  3RRH A;  1W0H A;  4FK4 A;  4CJQ A;  1T05 A;  4L8R B;  4CJV A;  3AVN A;  3VQQ A;  3UIQ A;  3OJS A;  1UWB A;  1RBU A;  3VQA A;  4CJ5 A;  1T7P A;  3RMB A;  3NF8 A;  4HUG A;  2XHB A;  4FJN A;  3SI6 A;  1NK9 A;  1C1C A;  3C6U A;  1ITG A;  4BDY A;  3SYZ A;  1KFS A;  1C1A A;  3V1O A;  2F96 A;  1NK5 A;  3VQ4 A;  3HP6 A;  5DMR A;  2OYQ A;  3M8S A;  2HHV A;  3AV9 A;  3MEG A;  1IG9 A;  1VRT A;  3O3G A;  3ZSX A;  3QET A;  2XO7 A;  2B6A A;  4DTR A;  2ETJ A;  1WAF A;  4Z4E A;  1L3U A;  5KRT A;  4IG0 A;  4F4K A;  4KHU A;  3HPG A;  3HM9 A;  4QCL A;  1ZBU A;  1F21 A;  1NKB A;  4C8K A;  3VA0 A;  4ZTJ A;  4C8O A;  4Z4G A;  5FDL A;  3HXM A;  3NH0 A;  4N56 A;  5J2Q A;  4GMJ B;  4DSI A;  4KPY A;  3QIN A;  4KTZ A;  1HQE A;  3HL8 A;  4AH9 A;  1NK6 A;  3U6F A;  4KKO A;  1EP4 A;  3TAF A;  4EP4 A;  4KHQ A;  1WSH A;  1K6Y A;  3DLR A;  4CJL A;  4CK1 A;  4KAZ A;  4KHN A;  3NDK A;  3KLH A;  4M3Y A;  3ZT1 A;  3TAB A;  4AIL C;  3ZCM A;  1RDC A;  4KFB A;  4CHO A;  4CF1 A;  3OYL A;  1UA1 A;  4OGE A;  3HT3 A;  4E7H A;  3L2U A;  3ZSV A;  1VSJ A;  1IH7 A;  2ATQ A;  1WSG A;  1RT3 A;  4Z0U A;  4DS4 A;  4OGC A;  3VQ5 A;  3MXI A;  2ZD1 A;  4B9S A;  4M3X A;  3QLH A;  4DFP A;  1SV5 A;  2VG5 A;  3PY8 A;  5JS1 A;  2EX3 A;  3BGR A;  4DG1 A;  1QS4 A;  1D5A A;  1LAW A;  2RPI A;  3O4N A;  3LZJ A;  4HUF A;  3QNO A;  3DLE A;  3TAG A;  1VSK A;  4BDZ A;  3OYI A;  3QEX A;  3WNF A;  4M42 A;  3AO2 A;  1J53 A;  3NF6 A;  3V1R A;  4CF2 A;  3NCI A;  3VA3 A;  3QO9 A;  4CHQ A;  1SL0 A;  2HHW A;  4DF4 A;  3ZT3 A;  3VQB A;  1QSS A;  2E4L A;  1QQC A;  4E7J A;  4ZHR A;  3IG1 A;  1LAV A;  3OYM A;  4CK2 A;  2P5O A;  3ZSO A;  4IFV A;  1NKE A;  4FJI A;  5KGW A;  3OYK A;  4FK0 A;  1RT5 A;  1CXU A;  4DU3 A;  1RT6 A;  4FLU A;  4AHV A;  4FW1 A;  1XI1 A;  2E6M A;  3SPY A;  3T3F A;  3QES A;  1MU2 A;  1WSI A;  5CY4 A;  2FBY A;  1U04 A;  4J2D A;  4OLA A;  1HNV A;  3TR8 A;  3KK3 A;  3AVA A;  3TAP A;  3PO4 A;  4PY5 A;  3NH1 A;  4DTM A;  3RR8 A;  1ZBH A;  4CFB A;  5CZ1 A;  3OYB A;  3NF9 A;  4CEA A;  3TWH A;  4E0D A;  3AVL A;  2KFN A;  3E01 A;  1A5X A;  3EY1 A;  3RMC A;  1BQM A;  4R5P A;  4O4G A;  4NYF A;  3OYN A;  4CJS A;  1XC9 A;  5CYQ A;  1NK7 A;  4F8R A;  4E3S A;  1RT1 A;  4OLB A;  4DSL A;  2PYJ A;  3KK1 A;  1BIZ A;  4CGI A;  4E1M A;  1KCF A;  4CJR A;  4DTO A;  3D0P A;  4FLW A;  1S1X A;  1WN7 A;  4MQ3 A;  3WNG A;  1NJZ A;  3L2R A;  2NUB A;  3WNE A;  1JLB A;  3TAM A;  4FLX A;  2X74 A;  1QE1 A;  1XWL A;  2VG7 A;  4IKF A;  4ZTF A;  3CFO A;  3L2Q A;  2OPQ A;  2ZE2 A;  3CG7 A;  3KKS A;  4I2P A;  2VWJ A;  4Y1D A;  3AO1 A;  1TVR A;  4CES A;  4W5Q A;  1TL3 A;  4JS5 A;  4FM0 A;  4CJW A;  1C1B A;  1QHT A;  1VSI A; 
#chains in the Genus database with same CATH topology
 4IDH A;  4B9V A;  4GV9 A;  4Y1C A;  1YXQ A;  4C8L A;  4JRP A;  4CD3 A;  2O8C B;  4BE1 A;  4IO8 A;  3CCJ N;  3IRX A;  3LPT A;  4O0J A;  3EO3 A;  3ZT0 A;  2ASO A;  3FZL A;  3QFP A;  3R3L A;  3M3Z A;  2VGN A;  2I7P A;  4O44 A;  2YHW A;  3I33 A;  1JLC A;  1I39 A;  3VEN A;  3WXJ A;  1KAZ A;  3VQ7 A;  4CGF A;  3I56 N;  3RMD A;  5C10 A;  2HMP A;  4KRF A;  5KRS A;  4FCY A;  4DUZ K;  2RHK A;  3K9K A;  4DFM A;  4OVL A;  4CW7 B;  4E7L A;  1N33 K;  4V19 S;  1NOZ A;  1VSE A;  4K42 A;  3HYF A;  2HW3 A;  5ELZ A;  1VQ7 N;  3CXC M;  1U2V B;  5KGX A;  3VQ8 A;  3HVR A;  2Q97 A;  4KV8 A;  2WON A;  5I3U A;  1HMV A;  3PUF A;  3AA5 X;  4FJM A;  4BR4 A;  2KKZ A;  2HMI A;  4DQI A;  4NLC A;  3VF6 A;  3LP2 A;  3K0S A;  2Y1J A;  3CQY A;  1VQN N;  5I9E B;  2UUB K;  4FW2 A;  1Y97 A;  2QWN A;  1YIJ N;  2QWM A;  1OH6 A;  4JKH A;  3SAG A;  5J2P A;  2BDP A;  2KZM A;  2E2O A;  4J2B A;  2F9T A;  2YHB A;  3EKU A;  3PV8 A;  1JLE A;  3EZW A;  3QEP A;  3IFR A;  4QAG A;  4KHW A;  1VSM A;  3HM8 A;  4CFC A;  4CJT A;  1VHX A;  3ISN C;  3DMJ A;  2A41 A;  3RRG A;  3HVT A;  1MWK A;  4H5W A;  4J8F A;  3I8B A;  3MN6 A;  1S6P A;  3NGZ A;  2QK9 A;  1KSP A;  2V52 B;  4JHD A;  3LDQ A;  3CJB A;  4OPH A;  4CCH A;  5AZJ B;  3OYH A;  4DU4 A;  4FJ8 A;  1K9M O;  3OYC A;  3EN9 A;  4CEO A;  5M1P A;  5H1S Q;  2A42 A;  5GAD P;  1T6D A;  3J7Z O;  3L8B A;  1BI4 A;  3FZH A;  4IEE A;  4JAX A;  4CGD A;  2ZM6 K;  5I42 A;  1RBR A;  2GEL A;  4FWQ A;  4OPA A;  3DAW A;  4BRO A;  3PX4 A;  5GAG P;  3O80 A;  1S1T A;  4AHC A;  4LF5 K;  2GBZ A;  4DR7 K;  3AA2 A;  4CEB A;  1VSH A;  5EVZ A;  2D0P A;  3VQP A;  2CGJ A;  4FZY A;  2NRX A;  3EEQ A;  1C6V A;  4IDK A;  2G8F A;  3RTV A;  3DLG A;  4XIU A;  3N4Q A;  3HSC A;  2QI2 A;  5J2M A;  5TKW A;  3J8A A;  3UKR A;  4CEQ A;  3MAQ A;  4M3U A;  3RSE B;  1OVQ A;  1LWE A;  4M41 A;  5ADX H;  2JWK A;  3O4W A;  4BWJ A;  3HTV A;  4N76 A;  4F3O A;  2GWJ A;  3MWP A;  1S9E A;  4M3Z A;  4CZK A;  4Q5V A;  4YDU C;  1NLV A;  2KZZ A;  4EZ9 A;  3IKM A;  4BRH A;  1ZXO A;  1J54 A;  3OS1 A;  3OY9 A;  3WEE A;  1BU6 O;  1B92 A;  3THV A;  4BC2 A;  4DTJ A;  3UE5 A;  4FYD A;  3V9S A;  1TL1 A;  3QIP A;  3QEW A;  4CHP A;  2FF3 B;  2HF4 A;  2KFZ A;  2ZF5 O;  3ZT2 A;  4B1X B;  3N4P A;  3QDK A;  3GBT A;  4QOZ B;  1S1U A;  3G71 N;  4IOX A;  3KLG A;  4C8N A;  4W5N A;  4BC5 A;  4FJG A;  1C0U A;  2ITG A;  1YVN A;  3DLL L;  3O9R A;  3ULD A;  5JVG L;  4FPA A;  2HHX A;  4FLT A;  3ZEU A;  1U6Z A;  1W97 L;  4FJH A;  2IAJ A;  3ZSW A;  3H3N O;  4E89 A;  2NRV A;  4LF8 K;  4NCG A;  3GDQ A;  3CC4 N;  4CZG A;  3LZI A;  2W6L A;  4BDP A;  4ILG B;  5HRP A;  2KW4 A;  5AZI B;  3OBY A;  2J4R A;  1RBV A;  3B8A X;  1TK8 A;  3LDN A;  2D0B A;  1T03 A;  4CJF A;  1RBT A;  1YJW N;  1GLB G;  4BRQ A;  3THY B;  1K8A O;  4DV3 K;  3AO3 A;  5EY4 A;  3S3O A;  3F73 A;  3VER A;  4DR5 K;  1SKR A;  4H8K A;  3LAK A;  3P1G A;  3K5L A;  4E19 A;  4DB3 A;  4I9Q A;  4FJ7 A;  2P1J A;  1SQK A;  3KK7 A;  4O0I A;  3C6A A;  1C0T A;  1HR0 K;  1TUY A;  3MK6 A;  3M8P A;  1U47 A;  4CF9 A;  1D9D A;  1ZYQ A;  3QBX A;  5AZI A;  3P31 A;  3SLC A;  4LD0 A;  5EXW A;  1EWR A;  3CM6 A;  3CCL N;  3U8X A;  3G10 A;  1LW0 A;  1DLO A;  1WB9 A;  2YKN A;  1HNW K;  2P9S A;  5KPR A;  2QXF A;  3AAQ A;  2O4I A;  2BAN A;  3ZX3 A;  4BGA A;  1HNI A;  1LW2 A;  4FJL A;  4NCA A;  1G99 A;  3DRR A;  3RMA A;  2XY7 A;  4YOX A;  3SNN A;  4RTF D;  3BUZ B;  1UOC A;  3L2W A;  3J7Y P;  4W5T A;  4FZZ A;  4IG3 A;  4HUE A;  1VQL N;  2H3G X;  5BRD A;  1BIS A;  2P9I B;  3AAP A;  4LF4 K;  4PA1 A;  4B9M A;  4WF9 L;  5C0Y A;  1JLQ A;  3CPW M;  1BHL A;  4BVP A;  3SJH A;  4IO9 L;  1L3V A;  3EZ5 A;  2F7T A;  1XMQ K;  1TKZ A;  1Z05 A;  1X9S A;  2G8V A;  3DI6 A;  3SBT A;  3OVN A;  3LM2 A;  3K59 A;  2DY4 A;  2IVP A;  5C42 A;  4L3Q A;  4LH4 A;  4QS9 A;  2YNH A;  3PIO L;  1A5V A;  4FJX A;  4CJ4 A;  3D7E O;  1S5J A;  3QFU A;  3NGI A;  1TK5 A;  3NGY A;  1WSF A;  2Z1H A;  5LMU K;  1RTI A;  2JGU A;  4JKB A;  5F1X A;  1QVF M;  4FLY A;  1YJN N;  3A8Y A;  3JS6 A;  3AA3 A;  4YOW A;  1VSD A;  4DLG A;  3WT0 A;  2HOE A;  2PFU A;  1TGO A;  4DTU A;  4AM6 A;  2V7Z A;  1N34 K;  1VSF A;  4O55 A;  1W0H A;  5HOO A;  3MWT A;  4CJV A;  3AVN A;  3VQQ A;  3UIQ A;  1UWB A;  3VQA A;  3NF8 A;  4FJN A;  1NMD A;  4JK9 A;  2GUP A;  1C1C A;  3ZET B;  1KFS A;  1C1A A;  1NK5 A;  1E4G T;  2UUC K;  2OYQ A;  1E3M A;  3VGL A;  3O3G A;  2ETJ A;  1WAF A;  5KRT A;  1VAZ A;  1NKB A;  3VA0 A;  4C8O A;  3QML A;  4FOI A;  1HNZ K;  2D0O A;  4KTZ A;  4BRM A;  3CME N;  4PHT X;  1EP4 A;  4KHQ A;  1BDG A;  1WSH A;  1N36 K;  4CJL A;  4KHN A;  3KLH A;  1GLC G;  2YJE A;  5CE3 A;  3ZCM A;  4FWM A;  4CHO A;  1UA1 A;  2FF6 A;  3HT3 A;  3TSP A;  1VQ5 N;  2ATQ A;  1RT3 A;  1K73 O;  4DS4 A;  4OGC A;  3MXI A;  2ZD1 A;  3F9M A;  3QLH A;  1ZBS A;  3O9U A;  2EX3 A;  1QS4 A;  5AQI A;  3LZJ A;  4HUF A;  1NGJ A;  3QNO A;  1VSK A;  4BDZ A;  3AO2 A;  2HHW A;  3NCI A;  3QO9 A;  4CHQ A;  3THW A;  1QQC A;  4ZHR A;  1LAV A;  3CF5 L;  2P5O A;  5AQV A;  2F4V K;  3HBT A;  4DU3 A;  4GV3 A;  4YOV A;  3T3F A;  3QES A;  1MU2 A;  5CY4 A;  4MDB A;  1HNV A;  3KK3 A;  1XQS C;  3SMS A;  4CFB A;  4CEA A;  2KFN A;  3E01 A;  5CHI A;  4NYF A;  3OYN A;  2YCH A;  4H0T B;  4E3S A;  1RT1 A;  2PYJ A;  5M1K A;  4CGI A;  2Q2R A;  1KCF A;  3CCE N;  4FLW A;  3BEX A;  4JYA K;  3D6R A;  1VQ6 N;  1QE1 A;  2NRH A;  4IKF A;  3CFO A;  3J80 O;  4QS8 A;  2NRT A;  4W5Q A;  4JS5 A;  1KXP A;  1C1B A;  1SAZ A;  1NGA A;  1TAQ A;  1ZC6 A;  5HRN A;  3DYA A;  1DTT A;  4BG8 A;  4CZI A;  4F2S A;  2HNZ A;  4LY7 A;  3EE9 A;  1IKY A;  3L4Q A;  4Q0B A;  3I55 N;  3T1H K;  3CI5 A;  5SWM A;  4FWP A;  2QW9 A;  3H45 C;  4BAC A;  2RF2 A;  3QEI A;  3TAN A;  4BRC A;  1S9G A;  4BRA A;  4JD2 A;  2HHU A;  4JKG A;  1KVC A;  4CZJ A;  3DLK A;  3UKU A;  5AQY A;  4F9O A;  4O8K A;  1RT4 A;  5AQK A;  4BWM A;  3LP3 A;  4CBX A;  1LCU A;  3CJA A;  3MN7 A;  1QHA A;  5F0X A;  3K57 A;  1LV5 A;  2P5G A;  5GAH P;  3SMP A;  4DR2 K;  1I3A A;  2V7Y A;  3S41 A;  4DTX A;  4Z4C A;  4WYB A;  5AQG A;  3MCA B;  1NBW A;  3R9P A;  4CD1 A;  5DM6 L;  1IKV A;  4EP5 A;  2X78 A;  4HTL A;  3OS2 A;  5KI6 A;  1NK0 A;  1N5Y A;  2FSJ A;  3AVK A;  4FJ9 A;  4PL8 A;  2QEX N;  4LF7 K;  2WOM A;  4KB1 A;  2EHG A;  1JL2 A;  4BGB A;  2QM1 A;  4FWN A;  4RW7 A;  3NBP A;  3JYT A;  3A5L C;  1IBL K;  1TAU A;  4FM1 A;  3E9P A;  2FLO A;  5EU7 A;  1X9W A;  1RDB A;  3R8E A;  1LWC A;  3P83 D;  3VQC A;  1NKC A;  4JI3 K;  3AVG A;  4JNE A;  3MEC A;  3GG4 A;  4EIA A;  1EET A;  1YAG A;  3U9Z A;  3OW2 M;  1QZ6 A;  4JK7 A;  5AQR A;  5A2Q O;  3C94 A;  4ID1 A;  3V9X A;  3B6P A;  3SCX A;  4JKD A;  3CHW A;  3I0R A;  1D9F A;  1EQY A;  2R7Y A;  3J81 O;  1RT2 A;  3WXI A;  4LF9 K;  4KHS A;  3MN5 A;  1LWF A;  2Q0U A;  3AVH A;  5C25 A;  4YY3 K;  1HNX K;  1C0M A;  4NCB A;  2DFF A;  4KB0 A;  2NRW A;  1NOY A;  2YX6 A;  1RDA A;  4C8M A;  4GW6 A;  4BRD A;  3F2K A;  2KLA A;  4HTU A;  1HJO A;  3H08 A;  3LDS A;  3ASM A;  2HB5 A;  1VQK N;  4FJK A;  3TSQ A;  2GUI A;  1Q9Y A;  1GOA A;  3K5O A;  4CGJ A;  1KTQ A;  3CJC A;  1N8R O;  3NE6 A;  5AQJ A;  1YTA A;  4WFB L;  1P8Z A;  3ZSR A;  2D0C A;  5BN9 A;  4AHU A;  2VCP A;  3MEE A;  2E88 A;  4CEF A;  2RE2 A;  4FVM A;  5AFU H;  2YHY A;  3QIC A;  1KLM A;  2NZT A;  1MDU B;  4DV5 K;  4CEC A;  5BPL A;  5DM7 L;  4RWT A;  3K58 A;  2HHT A;  3CJ7 A;  3VQE A;  5BPM A;  5JVH L;  3CET A;  1HYS A;  4FO0 A;  5AQT A;  2Q3S A;  4LF6 K;  3OBW A;  5JLH A;  2QTD A;  2QWQ A;  3PX6 A;  2A1S A;  3LM9 A;  3G0Z A;  4YFU A;  2FBV A;  3AO4 A;  3ZX2 A;  4CBW A;  4N41 A;  1P90 A;  2ZGY A;  4WE1 A;  1S72 N;  2CH6 A;  4JHD B;  1YTU A;  1ILY A;  1NK8 A;  4KTQ A;  1HKG A;  2FSN A;  2PYL A;  2FC0 A;  4CJ3 A;  1VK0 A;  4JRQ A;  1KC8 O;  3V9W A;  4CER A;  1EKE A;  4PKH A;  4HVJ A;  3MED A;  5LY3 A;  3HZ6 A;  1HYZ A;  4G1Q A;  3E9O A;  4FPB A;  1KVA A;  2HNY A;  3CCM N;  1RTD A;  3KTQ A;  2OPR A;  1BI4 B;  4GV6 A;  4CGH A;  3PSI A;  3OYD A;  3I8D A;  4B8A B;  2PY5 A;  1BCO A;  1V4S A;  3T1Y K;  2QWL A;  5LJW A;  4LH5 A;  1TKX A;  3WXK A;  2UXB K;  5AQZ A;  4ICL A;  5CZ2 A;  2ITM A;  4W5R A;  1RTH A;  1Q7Y O;  4BE0 A;  3HP9 A;  4DV1 K;  4K25 A;  3PLA A;  4CJ7 A;  3VTI A;  2A5X A;  4EAH D;  4ILH A;  4HCC A;  5KTQ A;  2HBL A;  3O8M A;  5FRM A;  1YHQ N;  3UKR B;  3LPU A;  4CK3 A;  4FSV A;  4IEI A;  4CZL A;  1V4T A;  1Z6R A;  3O3F A;  1TYQ B;  4OKJ A;  4AHS A;  4X65 K;  1HYV A;  2IIR A;  3CM5 A;  1TKD A;  1OH5 A;  3OYJ A;  2YNI A;  2A3Z A;  4DV4 K;  3P5J A;  3HO1 A;  1N6Q A;  3WNH A;  3WEE B;  2UXC K;  4MLE A;  1T44 A;  1FKP A;  1IG8 A;  1Q81 O;  3KZB A;  5IT9 O;  2BH1 A;  1BA0 A;  4I6M A;  5AQH A;  2D0A A;  3B6O A;  2XRI A;  1XNQ K;  4RW9 A;  4IFY A;  2Z1G A;  2OA8 A;  1NK4 A;  3L0Q A;  4HCB A;  4OKE A;  1BL3 A;  5DK5 A;  4DU1 A;  1I94 K;  1TYQ A;  4KRE A;  3MX2 A;  4JKF A;  3T19 A;  4M3W A;  1WLJ A;  1BGX T;  3EKS A;  3ZEU B;  1T3V A;  2VWK A;  2W42 A;  4PWD A;  4DUY K;  4DCH A;  2O8D A;  1JJ2 M;  2DTU A;  5KPT A;  4OKK A;  2FXU A;  2YJF A;  1QQN A;  1KFD A;  3VN5 A;  3BDP A;  4ISF A;  3T1A A;  1VSL A;  2UU9 K;  3FZM A;  1S1W A;  2Q36 A;  5M1Q A;  4B1U B;  5LL6 Z;  2P9P B;  1SL2 A;  3HST B;  2NRR A;  4FK4 A;  3AGR A;  3OJS A;  2DPN A;  2XHB A;  1C0F A;  4CI6 A;  1NK9 A;  4DR4 K;  4DV2 K;  2F96 A;  1NJI O;  4GY2 B;  3M8S A;  3AV9 A;  3MEG A;  3QET A;  2ZGZ A;  4X64 K;  2WFB A;  4F4K A;  2O8B A;  1ZBU A;  3QB0 A;  4ZTJ A;  4DSI A;  4XH5 A;  4KPY A;  1RFQ A;  4AH9 A;  1HQE A;  3HL8 A;  4KKO A;  4EP4 A;  2P9S B;  2P9P A;  4WFA L;  4M3Y A;  3ZT1 A;  3ZLJ A;  4NB4 A;  5AR0 A;  4BRE A;  3ZSV A;  5B8H A;  3FR0 A;  4Z0U A;  3AGK A;  4B9S A;  4JI7 K;  3O4N A;  2WUS A;  3TAG A;  3QEX A;  2P9K A;  4DQ8 A;  3V1R A;  5JIC A;  4A2A A;  4DF4 A;  3ZT3 A;  1QSS A;  1WOQ A;  3IG1 A;  4DV0 K;  4CK2 A;  4Z94 A;  4IFV A;  3OYK A;  3R6M A;  1NGF A;  4GVE A;  1RT6 A;  4PKG A;  4FLU A;  4FW1 A;  2E6M A;  1YJ9 N;  1WSI A;  3GL1 A;  4OLA A;  3PO4 A;  3AVA A;  3NH1 A;  3PSF A;  3E1Y A;  3RR8 A;  1ZBH A;  4AM7 A;  3NF9 A;  4JKE A;  3AVL A;  5IWA K;  3EY1 A;  4R5P A;  1NGI A;  4CJS A;  1NWK A;  3IUC A;  4OLB A;  2E8A A;  1BIZ A;  2OCE A;  4NLB A;  3TTC A;  5BR9 A;  4FL9 A;  1N32 K;  3ZX0 A;  1WN7 A;  2NUB A;  3WNE A;  5LMN K;  1XWL A;  5BRH A;  3L2Q A;  4I2P A;  2ZE2 A;  4Y1D A;  3AO1 A;  1TVR A;  1IBK K;  4X62 K;  1QHT A;  3VQ9 A;  4N5S A;  3VOV A;  1KQS M;  1BQN A;  4H0V B;  1IO2 A;  2ZWH A;  3VES A;  3VMF B;  4HHT A;  1CZB A;  3WXL A;  1HRH A;  1GLA G;  4B9Q A;  4XEI A;  3O9T A;  1JKH A;  1YT3 A;  2QA4 N;  1VQ9 N;  4BRL A;  5FPM A;  4JI1 K;  3KIO A;  3V4I A;  3T7Z A;  3QBW A;  4NYN A;  2O8F B;  3SK3 A;  3FFK B;  3SPZ A;  2E6L A;  3SV3 A;  4B9L A;  5AFU A;  1RGI A;  4JN4 A;  2OPP A;  2EWS A;  3ULE B;  4FLZ A;  1T8E A;  4YOT A;  4BR7 A;  2FBX A;  2IC3 A;  1CZA N;  4O8U A;  3JXU A;  3KLE A;  4A2B A;  4BRI A;  3ZYY X;  4PQU A;  4K8Z A;  3WUH A;  1JXB A;  3THW B;  1B9F A;  3ZSQ A;  2F8S A;  1CXQ A;  1RTJ A;  2OZM A;  2F9W A;  2ZJQ L;  1GLJ O;  2IVN A;  3SQ0 A;  4I7F A;  1NJW A;  2G8W A;  4FWR A;  2G8U A;  4FXD A;  2AJQ A;  1E4F T;  1Q86 O;  3SQ2 A;  2O8F A;  4BRF A;  3VQ6 A;  3AVJ A;  3TSU A;  1ASU A;  4CIE A;  3SUO A;  3S9H A;  3OYF A;  3LP0 A;  1Q8I A;  2HST A;  1ASW A;  3ULE A;  4UY8 O;  1WSJ A;  2KQ2 A;  4IWV A;  5T7B A;  1GLD G;  4H0P A;  1RBS A;  1OVY A;  4CHY A;  3M8R A;  3WQU A;  5FRO A;  3CYM A;  3I0S A;  3O3H A;  2UUA K;  2NLX A;  1SKW A;  3MDQ A;  1GOB A;  3L2V A;  1K8K A;  4ILJ A;  3ZT4 A;  1NJY A;  1S1V A;  2YNF A;  2WTU A;  3V6D A;  3MX5 A;  3AVM A;  1HPZ A;  4OPJ A;  3QIO A;  3CCR N;  3VET A;  3R1X A;  5BR8 K;  1FK9 A;  3EE8 A;  3L3V A;  4CFA A;  5KPZ A;  2IVO A;  3V9Z A;  3CQ8 A;  4M7X A;  5AQS A;  4FJ5 A;  1IBM K;  4DFK A;  4ISG A;  4DQQ A;  4AHR A;  2D1K A;  3ENB A;  3SUN A;  2JLE A;  3CC2 N;  2W40 A;  4DS5 A;  3O9S A;  1NGC A;  2RN2 A;  3SQ1 A;  3KKR A;  4K41 A;  4BE2 A;  4KI4 A;  3LDL A;  2XY8 A;  4PKI A;  4CHZ A;  1WUA A;  1DT9 A;  3CCQ N;  3G25 A;  4E7K A;  3ZSY A;  1W2B M;  3F9K A;  4JD2 B;  4JKG B;  1QTM A;  4O5B A;  3AO5 A;  3UKU B;  5J1E A;  2QKK A;  3LAM A;  3O6W A;  2Y1I A;  3QEV A;  4GNI A;  5E84 A;  1J5O A;  5C24 A;  1NG9 A;  3DRP A;  2HHQ A;  3Q7C A;  2YNG A;  4O5F A;  4I2Q A;  5F2R A;  4H5R A;  5ADX A;  3HPO A;  1NM1 A;  1MA9 B;  5GIO A;  3WXM B;  5HLF A;  3VEZ A;  1VQO N;  5AQN A;  3AA4 A;  4BVO A;  2P51 A;  4B9U A;  3H3O B;  3LL3 A;  4LC9 B;  4CGG A;  4E1J A;  4ELU A;  4B8C A;  3HOT A;  1L3S A;  3E66 A;  1YI2 N;  4GKK K;  3PX0 A;  4B1W B;  1DKG D;  4J2E A;  2Z1J A;  2HVI A;  2BE2 A;  5BN8 A;  1KRP A;  3TTD A;  5AQQ A;  1X1P A;  2CH5 A;  4YOR A;  3H1V X;  3DLH A;  1YUW A;  4OPK A;  4FWK A;  2HHH K;  2O8E A;  1GLE G;  2QKB A;  1Q18 A;  3AY9 A;  1XHZ A;  3ENO A;  5SZT A;  1QZ5 A;  1IKW A;  4JK8 A;  4B3O A;  3HI0 A;  3VF4 A;  2YV0 X;  1JXE A;  1VQP N;  4OO1 J;  2CGL A;  4CJK A;  3LWM A;  2G8K A;  1JLF A;  4KHY A;  3LWL A;  3IAY A;  4LFA K;  3CJ1 A;  3VEO A;  4JS4 A;  3C6T A;  3CER A;  1WNS A;  3OA9 A;  4I9L A;  3WQT A;  3O08 A;  3QNN A;  3CCU N;  4CIF A;  1R0A A;  3P4I A;  3BF3 A;  3NH2 A;  1SKS A;  3SV4 A;  3DLB A;  2PAV A;  2IS3 A;  3SZ2 A;  4K8X A;  3EYZ A;  1FW6 A;  2E1Y A;  4FLV A;  1SS6 A;  3OJU A;  1FKO A;  4UQG A;  1TK0 A;  3ITH A;  4MLH A;  4DSK A;  1TV6 A;  3DOK A;  1VQM N;  1XNR K;  3H46 O;  4DQS A;  4MO5 A;  1ZBF A;  3FZK A;  4CEZ A;  4B3M K;  4DR1 K;  3U3Y A;  4B9T A;  2GEM A;  1QSL A;  3O5B A;  3V81 A;  4GKJ K;  4KO0 A;  2V51 B;  3ENH A;  2OTL N;  3THX A;  4M45 A;  4FZX C;  3L3U A;  1SL1 A;  1NGD A;  3CCV N;  2P9N A;  3P38 A;  3KVG A;  3GE1 A;  5M1N A;  3CPE A;  3CJ9 A;  4MDA A;  4Z4I A;  5D3G A;  1J6Z A;  2RKI A;  4GVM A;  4IJN A;  3W0L A;  3AVB A;  5C15 A;  1NJX A;  3LAN A;  1FXX A;  2QWR A;  4M63 C;  1BG3 A;  1SUQ A;  3ZSZ A;  4A59 A;  3ALY A;  1QSY A;  3CFP A;  3KK2 A;  3SJJ A;  1Z25 A;  2KTQ A;  4F3T A;  4CZM A;  3A5M C;  1RIL A;  4DSE A;  4N47 A;  5E26 A;  4KBO A;  4DQP A;  2HHS A;  4IBN A;  3A5O C;  4KTW A;  4BC4 A;  4CJP A;  1XHX A;  4YDU A;  1CZ9 A;  5HP1 A;  3LDO A;  3NHG A;  3VTH A;  5FRN A;  1SZ2 A;  5JMV A;  4CZF A;  3KLI A;  1IJJ A;  1OH7 A;  4DF8 A;  1WAJ A;  4DWI A;  5AQM A;  4XH4 A;  4YHH K;  1YIT N;  2F8T A;  4B3S K;  4DSF A;  4A5A A;  3DRS A;  3FFI A;  3TAE A;  4G9Z A;  3IDH A;  3MMV A;  4JI8 K;  4KHP K;  2NRZ A;  2NNW A;  4QS7 A;  2G8H A;  3CIP A;  2BTF A;  4BR5 A;  2OZS A;  1M1K O;  1VQ8 N;  4H5V A;  1J5E K;  4K43 A;  1D4X A;  3L4I A;  4LFB K;  2PBD A;  2KHO A;  4YOU A;  1RBU A;  1T7P A;  4CJ5 A;  4HUG A;  2A6A A;  3SI6 A;  3SYZ A;  4BDY A;  4A57 A;  3ID8 A;  3VQ4 A;  3HP6 A;  2HHV A;  1VRT A;  3ZSX A;  2XO7 A;  2B6A A;  4DTR A;  1L3U A;  4H0Y B;  4IG0 A;  2YHX A;  3HPG A;  3HM9 A;  3FE1 A;  3NMU A;  3C0B A;  1R59 O;  2O8C A;  3HXM A;  3NH0 A;  3QIN A;  1W7A A;  3JAM O;  2OAN A;  3HOS A;  4BR0 A;  3DLR A;  4KAZ A;  4CK1 A;  3TAB A;  1WBB A;  1RDC A;  4FWL A;  2VYP A;  5KQD A;  4CF1 A;  3OYL A;  2ASP A;  4FWO A;  4E7H A;  3L2U A;  1IH7 A;  1WSG A;  1NGH A;  4X66 K;  4FVU A;  3G6E N;  4I6M B;  3VQ5 A;  4DFP A;  1SV5 A;  2AP1 A;  1XUP O;  1Q82 O;  1D5A A;  2RPI A;  2E5L K;  3SAF A;  2D4W A;  4CVN E;  4M42 A;  3WNF A;  3D2E B;  1J53 A;  3NF6 A;  4CF2 A;  4CZH A;  2ZJR L;  1SL0 A;  3T69 A;  1U2V A;  3VQB A;  1BA1 A;  4E7J A;  3O1B A;  5MLC Q;  3C65 A;  1NKE A;  1XC3 A;  5KGW A;  2P9U B;  1CXU A;  4AHV A;  2O8D B;  2HBK A;  5C12 A;  2FBY A;  1U04 A;  1KD1 O;  4PY5 A;  4H5N A;  2VWB A;  4K0K K;  3A0I X;  3BY5 A;  3OYB A;  4IXC A;  3Q7B A;  5FPN A;  5AQW A;  5FLX O;  2WBN A;  1XC9 A;  5CYQ A;  1NK7 A;  3D2E A;  4C1N I;  3KK1 A;  4CJR A;  4DTO A;  3D0P A;  1S1X A;  4MQ3 A;  1NJZ A;  1RDU A;  3HRG A;  1JLB A;  3DJC A;  1TUU A;  3SAH A;  2P9U A;  4H0X B;  4FLX A;  4ZTF A;  3KKS A;  3CG7 A;  1HLU A;  2VWJ A;  3C7N B;  5AZJ A;  4FM0 A;  3H1Q A;  4CJW A;  2GX9 A;  1VSI A;  1BO5 O;  2Q31 A;  4LSN A;  3NF7 A;  3PIP L;  4CE9 A;  5GAE P;  4RW4 A;  2O8B B;  3CD6 N;  4NXM K;  4FWS A;  3AVC A;  4EFH A;  5HBM A;  3SUP A;  3OYE A;  2AA4 A;  3RVC A;  4FM2 A;  4B1Y B;  4JI2 K;  4U7B A;  5E41 A;  4PL7 A;  4CF8 A;  4ID5 A;  2IGI A;  4BQL A;  1L3T A;  4ELT A;  1BUP A;  1ZBL A;  4IFE A;  2VQE K;  3UB5 A;  5C2F A;  1KVB A;  3C7N A;  4CJE A;  3O9Q A;  1EXQ A;  1ATS A;  3K5M A;  1JCE A;  4BG9 A;  1REV A;  3KWG A;  5GIN A;  4CED A;  1JLA A;  1HX1 A;  3RSE A;  5AJ3 K;  1EWQ A;  5M1F A;  4CFD A;  5JS2 A;  2P9K B;  3DWL A;  3M1F A;  3SBG A;  3KWI A;  3KLF A;  1BIU A;  2DFE A;  3EL2 A;  3AVF A;  4M3T A;  1O1W A;  1RT7 A;  3K2P A;  3M5R A;  2E2N A;  1G15 A;  3DXM B;  3O4Q A;  4DR6 K;  3CCS N;  1GLF O;  1QVG M;  3IS9 A;  1X3M A;  2E2P A;  2YI1 A;  1ESV A;  4YNQ A;  3QER A;  1B9D A;  4CJU A;  2DFH A;  5J2N A;  5CYM A;  4AF1 A;  3FLC O;  2A40 A;  2GV9 A;  2LSN A;  5TKY A;  3RR7 A;  3HPH A;  3OYG A;  2HF3 A;  5FPD A;  4M3R A;  3JSM A;  1ZBI A;  4FJJ A;  4WQ4 A;  4IZ9 A;  4CHN A;  4LSL A;  3DXM A;  1CLQ A;  3BF1 A;  2BGG A;  4BR2 A;  1GOC A;  3V9U A;  3TAQ A;  2GTD A;  1YVU A;  3BZC A;  3OTO K;  4EHU A;  2VQF K;  1U49 A;  4KI6 A;  1NU0 A;  1EO1 A;  1UAX A;  1KAX A;  1BCM A;  2YHA A;  3THY A;  4H03 B;  4BRP A;  3L6Q A;  2D5R A;  1O13 A;  1Y64 A;  4BRK A;  3AVI A;  4RW6 A;  4H4O A;  4DHY A;  3A5N C;  4Z4F A;  4H0O A;  4DQR A;  4W5O A;  1D8Y A;  4FK2 A;  3G4S N;  3DM2 A;  1JCG A;  4MO4 A;  5FPE A;  3HK2 A;  1DEJ A;  1ATN A;  5K14 A;  5HRS A;  2HBM A;  3KJV A;  1FJG K;  4NXN K;  4JLH A;  4JKC A;  1JL1 A;  4WQ5 A;  5CR4 A;  1UA0 A;  1BOT O;  3CFR A;  2IOC A;  3FGU A;  2Z1I A;  2HVH A;  4BRG A;  1TKT A;  4AHT A;  1OKJ A;  1NGG A;  4DMN A;  3TPQ A;  2GWK A;  1RCH A;  2P9L B;  3VGM A;  4C23 A;  1VQ4 N;  4DV7 K;  4CIG A;  4F2R A;  4B1Z A;  4DTS A;  3ATU A;  2B5J A;  2P9I A;  1IKX A;  4H4M A;  5HRR A;  4JI4 K;  3VEV A;  1NGB A;  2E1Z A;  3VQD A;  3W3D A;  3MXM A;  1JLG A;  4DR3 K;  1U45 A;  1LOT B;  1S6Q A;  4RW8 A;  2VG6 A;  1HPM A;  1Q9X A;  1K8K B;  3VF2 A;  2XY6 A;  1L5U A;  1EX4 A;  2PZS A;  4M7Y A;  2ZJP L;  3LP1 A;  1C0G A;  3F5T A;  3KD1 E;  2P9L A;  3OYA A;  5AQP A;  4B08 A;  3TI0 A;  4FOE A;  4E7I A;  1A5W A;  2O4G A;  3SQ4 A;  3RWU A;  2B4J A;  1T6C A;  3HJF A;  5AQU A;  3GOI A;  4DV6 K;  4WFN L;  3CMA N;  1X9M A;  3U9D A;  3MCP A;  3J7A P;  2XY5 A;  2YKM A;  4JKA A;  4BRN A;  1HKC A;  5LJV A;  2G8I A;  4Z4H A;  4JI6 K;  5BRE A;  4J2A A;  1M90 O;  3ZET A;  1NMN A;  4DLE A;  4IJA A;  3C95 A;  3P39 A;  5KQ8 A;  5AQL A;  1U4B A;  1U48 A;  4RG8 A;  3U3G A;  4OJR A;  1DTQ A;  3VEY A;  3DOL A;  3IMX A;  2E20 A;  3VEX A;  4EHT A;  1QQM A;  3NVK A;  1JCF A;  4DTN A;  4JV5 K;  4CEE A;  5C2D A;  1HQU A;  3K5N A;  2Q1N A;  3KD5 E;  3OS0 A;  2CGK A;  3BZK A;  3H6E A;  1NGE A;  1HJR A;  4WCE L;  3PO5 A;  4WQ4 C;  3DXK B;  1W9H A;  4DKW A;  1DGK N;  3TAR A;  4BC3 A;  3A2F A;  2QXL A;  2HND A;  2X6S A;  1RDD A;  3VGK A;  2OTJ N;  4DTP A;  3MN9 A;  2QWO A;  1Z26 A;  3VPZ A;  4U67 L;  4H5T A;  2JWL A;  4KH4 A;  5BRF A;  4CF0 A;  2Q0R A;  4DSJ A;  4E1N A;  1RDW X;  1WSE A;  2IDO A;  3SUQ A;  2I5J A;  2FSK A;  3D2F B;  3S3M A;  1H1V A;  1ASV A;  4MFB A;  3ID6 A;  3D45 A;  2A1R A;  3M6G A;  5EOY A;  1OH8 A;  2WC9 A;  4Y0W A;  4OX9 K;  3NFA A;  2QWP A;  4B9N A;  1KAY A;  2O8E B;  3DXK A;  1XMO K;  3OHR A;  5HRO A;  3S3N A;  4BY9 C;  2OPS A;  3BP8 A;  4ELV A;  3M8Q A;  5EX5 A;  2X6N A;  4BQZ A;  1KLN A;  4EZ6 A;  4A61 A;  2VGM A;  2FBT A;  4XH1 A;  4TSX A;  3LAL A;  1VRU A;  4DFJ A;  3TU5 A;  3V1Q A;  1J9A A;  3MXJ A;  5AQO A;  4JI5 K;  3O1W A;  4WQ5 C;  1HKB A;  4B1V A;  4PUO A;  3FZF A;  2ZQB A;  3D2F A;  1RNH A;  3NAE A;  3RRH A;  4CJQ A;  1T05 A;  2I7N A;  4L8R B;  4LFC K;  3LDP A;  3RMB A;  3C6H A;  4CBU A;  3C6U A;  1ITG A;  3V1O A;  4ISE A;  1X3N A;  5DMR A;  4BR9 A;  1IG9 A;  3NVM A;  4A62 A;  4Z4E A;  2UXD K;  4JI0 K;  1YF5 L;  4KHU A;  4QCL A;  1F21 A;  4C8K A;  4Z4G A;  5FDL A;  5J2Q A;  2BUP A;  4N56 A;  4GMJ B;  4JEP A;  1NK6 A;  5BPN A;  3U6F A;  3AAR A;  3TAF A;  3THX B;  4IOA L;  5HL7 L;  1K6Y A;  4A5B A;  3NDK A;  2ASM A;  2E2Q A;  4AIL C;  2P9N B;  4KFB A;  3VEW A;  1HUX A;  4OGE A;  5M1O A;  1VSJ A;  3CQX A;  1WBD A;  4M3X A;  2VG5 A;  3PY8 A;  5JS1 A;  3BGR A;  4DG1 A;  1S22 A;  3E9L A;  1LAW A;  1ATR A;  3DLE A;  4R79 A;  3OYI A;  4CZE A;  4NO7 A;  3VA3 A;  2E4L A;  1MWM A;  3KHY A;  3OYM A;  3ZSO A;  4HWI A;  4FJI A;  1QQO A;  2W6K A;  4RCH A;  4FK0 A;  1RT5 A;  4C1N K;  5AQX A;  1XI1 A;  3SPY A;  1GLL O;  4KH6 A;  4J2D A;  3TR8 A;  3TTF A;  3TAP A;  1NNE A;  1X9J A;  4DTM A;  2HBJ A;  5JLF A;  5CZ1 A;  3TWH A;  4E0D A;  1A5X A;  3RMC A;  1BQM A;  4O4G A;  5AQF A;  4F8R A;  4YOY A;  3U4L A;  2W41 A;  4DSL A;  5GIP A;  1BWF O;  4E1M A;  3K9J A;  4B3T K;  1S3X A;  2UYT A;  3ATV A;  3WNG A;  3L2R A;  3TAM A;  4KH5 A;  2X74 A;  2VG7 A;  1IV0 A;  2OPQ A;  4B3R K;  4CES A;  4AQY K;  1TL3 A;  3CC7 N;  4IOC L; 
#chains in the Genus database with same CATH homology
 3VQ9 A;  4N5S A;  4B9V A;  1BQN A;  3NF7 A;  4LSN A;  4CE9 A;  1TAQ A;  4RW4 A;  4Y1C A;  1IO2 A;  4C8L A;  5HRN A;  4JRP A;  4HHT A;  1CZB A;  4BE1 A;  3AVC A;  3DYA A;  1DTT A;  1HRH A;  5HBM A;  3OYE A;  3SUP A;  4F2S A;  2HNZ A;  4FM2 A;  4LY7 A;  3IRX A;  3LPT A;  4O0J A;  1IKY A;  3ZT0 A;  4Q0B A;  1JKH A;  5E41 A;  1YT3 A;  4CF8 A;  5SWM A;  4ID5 A;  2IGI A;  4O44 A;  3KIO A;  1JLC A;  3V4I A;  1L3T A;  4BAC A;  4ELT A;  2RF2 A;  1I39 A;  3QEI A;  4CGF A;  3TAN A;  3VQ7 A;  4NYN A;  3RMD A;  1ZBL A;  4KRF A;  1S9G A;  1KVB A;  3SPZ A;  2E6L A;  5KRS A;  4FCY A;  2HHU A;  1KVC A;  4CJE A;  3SV3 A;  4B9L A;  1EXQ A;  3DLK A;  3K5M A;  2OPP A;  4DFM A;  4OVL A;  4E7L A;  1REV A;  1RT4 A;  4FLZ A;  1T8E A;  4BWM A;  1JLA A;  2FBX A;  3LP3 A;  1NOZ A;  2IC3 A;  4CED A;  1VSE A;  3HYF A;  1LV5 A;  3K57 A;  2P5G A;  4CFD A;  5JS2 A;  2HW3 A;  3KLE A;  4PQU A;  4K8Z A;  1JXB A;  1I3A A;  5KGX A;  1B9F A;  3VQ8 A;  1BIU A;  3ZSQ A;  4KV8 A;  3KLF A;  4Z4C A;  3HVR A;  2DFE A;  2WON A;  1CXQ A;  5I3U A;  1HMV A;  2F8S A;  1RTJ A;  3PUF A;  3AA5 X;  3AVF A;  2OZM A;  4FJM A;  4M3T A;  2HMI A;  1O1W A;  1RT7 A;  4DQI A;  3K2P A;  3LP2 A;  2Y1J A;  1G15 A;  4FW2 A;  3O4Q A;  4I7F A;  1IKV A;  4EP5 A;  3SQ0 A;  1Y97 A;  2X78 A;  1NJW A;  3OS2 A;  2G8W A;  2G8U A;  4FXD A;  5KI6 A;  1NK0 A;  1N5Y A;  3AVK A;  3SQ2 A;  4FJ9 A;  2AJQ A;  3VQ6 A;  3IS9 A;  3AVJ A;  4CIE A;  1ASU A;  5J2P A;  2BDP A;  2KZM A;  4YNQ A;  3QER A;  2WOM A;  4KB1 A;  3SUO A;  3S9H A;  1B9D A;  3OYF A;  2EHG A;  4CJU A;  4J2B A;  3LP0 A;  1JL2 A;  2DFH A;  2YHB A;  1Q8I A;  3PV8 A;  1ASW A;  1JLE A;  4RW7 A;  5J2N A;  3QEP A;  3NBP A;  5CYM A;  1WSJ A;  4QAG A;  3JYT A;  4KHW A;  1VSM A;  2KQ2 A;  5T7B A;  4CFC A;  2LSN A;  2GV9 A;  4CJT A;  1RBS A;  1TAU A;  4FM1 A;  3ISN C;  3DMJ A;  5EU7 A;  3RR7 A;  1X9W A;  1RDB A;  1LWC A;  3P83 D;  3RRG A;  3HVT A;  3VQC A;  4CHY A;  3M8R A;  1NKC A;  3HPH A;  3OYG A;  5FRO A;  3CYM A;  1S6P A;  3AVG A;  3I0S A;  3O3H A;  3NGZ A;  4M3R A;  3JSM A;  1SKW A;  1ZBI A;  2QK9 A;  1GOB A;  3MEC A;  3L2V A;  1KSP A;  4FJJ A;  3ZT4 A;  1NJY A;  4CHN A;  4LSL A;  1S1V A;  4CCH A;  2YNF A;  1CLQ A;  1EET A;  3OYH A;  4DU4 A;  3V6D A;  4FJ8 A;  2BGG A;  1GOC A;  3AVM A;  1HPZ A;  4OPJ A;  3QIO A;  3OYC A;  3V9U A;  3TAQ A;  4CEO A;  1FK9 A;  1YVU A;  3L3V A;  1U49 A;  4CFA A;  3V9Z A;  3CQ8 A;  4KI6 A;  3C94 A;  4DTX A;  4ID1 A;  3V9X A;  4FJ5 A;  3L8B A;  4DFK A;  1BI4 A;  1UAX A;  3B6P A;  4AHR A;  4DQQ A;  3SCX A;  1BCM A;  2YHA A;  3I0R A;  4CGD A;  1D9F A;  2R7Y A;  3SUN A;  2JLE A;  4DS5 A;  1RT2 A;  5I42 A;  1RBR A;  2D5R A;  4KHS A;  3PX4 A;  2RN2 A;  3SQ1 A;  1LWF A;  3AVI A;  3AVH A;  4RW6 A;  3KKR A;  5C25 A;  4BE2 A;  1C0M A;  4NCB A;  4H4O A;  4KI4 A;  2DFF A;  1S1T A;  4AHC A;  2XY8 A;  4KB0 A;  2GBZ A;  3AA2 A;  4Z4F A;  4CEB A;  1NOY A;  4CHZ A;  1VSH A;  3VQP A;  4FZY A;  4DQR A;  1RDA A;  4C8M A;  4W5O A;  1D8Y A;  4FK2 A;  4E7K A;  1C6V A;  4GW6 A;  3DM2 A;  3ZSY A;  4IDK A;  4HTU A;  3F9K A;  2G8F A;  3RTV A;  3DLG A;  4XIU A;  1QTM A;  4O5B A;  3H08 A;  3LDS A;  3HK2 A;  3AO5 A;  3ASM A;  2HB5 A;  5J1E A;  5J2M A;  4FJK A;  2QKK A;  3LAM A;  4CEQ A;  2GUI A;  5K14 A;  1GOA A;  3MAQ A;  1Q9Y A;  3K5O A;  4CGJ A;  5HRS A;  4M3U A;  2Y1I A;  1KTQ A;  4M41 A;  1LWE A;  3QEV A;  3KJV A;  4BWJ A;  1J5O A;  3NE6 A;  4N76 A;  5C24 A;  4F3O A;  1YTA A;  3DRP A;  4M3Z A;  1S9E A;  2HHQ A;  4JLH A;  4Q5V A;  2YNG A;  4I2Q A;  1JL1 A;  3ZSR A;  1UA0 A;  3CFR A;  3HPO A;  4EZ9 A;  2KZZ A;  2D0C A;  4AHU A;  2IOC A;  3MEE A;  2Z1I A;  2HVH A;  1J54 A;  3OS1 A;  4CEF A;  1TKT A;  3OY9 A;  4AHT A;  5HLF A;  1B92 A;  4FVM A;  3THV A;  4DMN A;  3AA4 A;  1RCH A;  2P51 A;  4DTJ A;  4B9U A;  1KLM A;  4FYD A;  3V9S A;  1TL1 A;  4CEC A;  4CGG A;  3K58 A;  3QIP A;  4F2R A;  4CIG A;  3QEW A;  4CHP A;  4ELU A;  2HHT A;  3VQE A;  4DTS A;  2KFZ A;  4B8C A;  1HYS A;  2B5J A;  2Q3S A;  1L3S A;  1IKX A;  4H4M A;  5HRR A;  3PX0 A;  3ZT2 A;  3VQD A;  3PX6 A;  4J2E A;  2A1S A;  2Z1J A;  4QOZ B;  1S1U A;  2BE2 A;  3MXM A;  2HVI A;  3G0Z A;  4YFU A;  1KRP A;  2FBV A;  1JLG A;  3KLG A;  4C8N A;  3AO4 A;  4W5N A;  1U45 A;  4FJG A;  1C0U A;  2ITG A;  1X1P A;  3ULD A;  1S6Q A;  4N41 A;  4RW8 A;  3DLH A;  4FLT A;  2HHX A;  2VG6 A;  4WE1 A;  4OPK A;  1Q9X A;  4FJH A;  2IAJ A;  1YTU A;  3ZSW A;  2XY6 A;  2QKB A;  1NK8 A;  4KTQ A;  4E89 A;  2PYL A;  4NCG A;  2FC0 A;  4CJ3 A;  1VK0 A;  1EX4 A;  5SZT A;  4JRQ A;  1XHZ A;  1IKW A;  3LZI A;  1L5U A;  2PZS A;  3V9W A;  3LP1 A;  4CER A;  4B3O A;  4BDP A;  1EKE A;  2YV0 X;  1JXE A;  3KD1 E;  4CJK A;  3OYA A;  3LWM A;  2G8K A;  4HVJ A;  3MED A;  3TI0 A;  1JLF A;  2KW4 A;  4B08 A;  1HYZ A;  4G1Q A;  5HRP A;  4E7I A;  4KHY A;  1RBV A;  3LWL A;  1TK8 A;  1KVA A;  1A5W A;  3IAY A;  2HNY A;  4JS4 A;  1RTD A;  3C6T A;  2O4G A;  1WNS A;  2D0B A;  3SQ4 A;  4I9L A;  2B4J A;  2OPR A;  1BI4 B;  1RBT A;  4CJF A;  1T03 A;  3RWU A;  4CGH A;  3HJF A;  3QNN A;  3OYD A;  1X9M A;  3I8D A;  4B8A B;  2PY5 A;  3AO3 A;  4CIF A;  1BCO A;  3F73 A;  3S3O A;  1R0A A;  2XY5 A;  2YKM A;  3NH2 A;  1SKS A;  3SV4 A;  1SKR A;  3DLB A;  2G8I A;  4H8K A;  4LH5 A;  1TKX A;  4Z4H A;  2IS3 A;  3LAK A;  3SZ2 A;  4K8X A;  4ICL A;  3P1G A;  5CZ2 A;  4W5R A;  3EYZ A;  3K5L A;  4J2A A;  4E19 A;  1RTH A;  4DLE A;  4I9Q A;  4FJ7 A;  4BE0 A;  3C95 A;  3HP9 A;  2P1J A;  4FLV A;  3OJU A;  1FKO A;  4O0I A;  4UQG A;  1U4B A;  1C0T A;  1TK0 A;  3ITH A;  1U48 A;  4HCC A;  4DSK A;  4RG8 A;  3M8P A;  1TV6 A;  4OJR A;  3U3G A;  3DOK A;  1DTQ A;  4CF9 A;  5KTQ A;  1U47 A;  1D9D A;  5FRM A;  3LPU A;  1ZYQ A;  3DOL A;  4DQS A;  4CK3 A;  4LD0 A;  1ZBF A;  4CEZ A;  4DTN A;  4CEE A;  3U3Y A;  3O3F A;  3CM6 A;  1HQU A;  3K5N A;  4B9T A;  1QSL A;  3KD5 E;  3G10 A;  4OKJ A;  4AHS A;  4KO0 A;  1LW0 A;  1DLO A;  3OS0 A;  3V81 A;  1HYV A;  2YKN A;  4M45 A;  4FZX C;  3L3U A;  1SL1 A;  1HJR A;  3CM5 A;  1TKD A;  3PO5 A;  2QXF A;  2O4I A;  2BAN A;  2YNI A;  3OYJ A;  1W9H A;  1HNI A;  1LW2 A;  4FJL A;  3P5J A;  4NCA A;  1N6Q A;  3WNH A;  3HO1 A;  3DRR A;  3RMA A;  2XY7 A;  1FKP A;  3TAR A;  4Z4I A;  3A2F A;  3SNN A;  5D3G A;  2RKI A;  4GVM A;  2HND A;  3AVB A;  2X6S A;  1UOC A;  1RDD A;  3L2W A;  1NJX A;  3LAN A;  4W5T A;  4DTP A;  2D0A A;  3B6O A;  2XRI A;  1FXX A;  4FZZ A;  1Z26 A;  4RW9 A;  4IFY A;  4IG3 A;  4HUE A;  1BIS A;  1SUQ A;  3ZSZ A;  2Z1G A;  4PA1 A;  4CF0 A;  2OA8 A;  3ALY A;  1NK4 A;  4B9M A;  4DSJ A;  1QSY A;  3CFP A;  4E1N A;  3KK2 A;  3SJJ A;  1JLQ A;  1Z25 A;  4F3T A;  2KTQ A;  1WSE A;  1RIL A;  2IDO A;  4DSE A;  1BHL A;  2I5J A;  4N47 A;  3SUQ A;  4OKE A;  3S3M A;  1BL3 A;  4HCB A;  4DQP A;  5DK5 A;  1ASV A;  4MFB A;  4DU1 A;  1L3V A;  2HHS A;  3D45 A;  4IBN A;  3EZ5 A;  4KTW A;  2A1R A;  4CJP A;  4KRE A;  3T19 A;  1XHX A;  1TKZ A;  4M3W A;  1X9S A;  1CZ9 A;  2G8V A;  3DI6 A;  1WLJ A;  1BGX T;  3NFA A;  3OVN A;  3K59 A;  2DY4 A;  5HP1 A;  4B9N A;  3NHG A;  5C42 A;  4LH4 A;  2VWK A;  2W42 A;  5FRN A;  4PWD A;  5HRO A;  3S3N A;  2OPS A;  2YNH A;  1A5V A;  4FJX A;  2DTU A;  4ELV A;  3KLI A;  4OKK A;  3M8Q A;  4CJ4 A;  4DF8 A;  1WAJ A;  2X6N A;  4DWI A;  1S5J A;  3NGI A;  1TK5 A;  1KLN A;  1KFD A;  3VN5 A;  3BDP A;  4EZ6 A;  2F8T A;  2FBT A;  4TSX A;  3LAL A;  1VRU A;  3NGY A;  3T1A A;  4DSF A;  1WSF A;  2Z1H A;  4DFJ A;  1RTI A;  2JGU A;  3DRS A;  1VSL A;  3FFI A;  4FLY A;  3KTQ A;  3V1Q A;  3TAE A;  1S1W A;  3AA3 A;  1J9A A;  3MXJ A;  1VSD A;  4DLG A;  1TGO A;  4DTU A;  2G8H A;  4PUO A;  2ZQB A;  1SL2 A;  3HST B;  1RNH A;  1VSF A;  2OZS A;  3NAE A;  4O55 A;  3RRH A;  1W0H A;  4FK4 A;  4CJQ A;  1T05 A;  4L8R B;  4CJV A;  3AVN A;  3VQQ A;  3UIQ A;  3OJS A;  1UWB A;  1RBU A;  3VQA A;  4CJ5 A;  1T7P A;  3RMB A;  3NF8 A;  4HUG A;  2XHB A;  4FJN A;  3SI6 A;  1NK9 A;  1C1C A;  3C6U A;  1ITG A;  4BDY A;  3SYZ A;  1KFS A;  1C1A A;  3V1O A;  2F96 A;  1NK5 A;  3VQ4 A;  3HP6 A;  5DMR A;  2OYQ A;  3M8S A;  2HHV A;  3AV9 A;  3MEG A;  1IG9 A;  1VRT A;  3O3G A;  3ZSX A;  3QET A;  2XO7 A;  2B6A A;  4DTR A;  2ETJ A;  1WAF A;  4Z4E A;  1L3U A;  5KRT A;  4IG0 A;  4F4K A;  4KHU A;  3HPG A;  3HM9 A;  4QCL A;  1ZBU A;  1F21 A;  1NKB A;  4C8K A;  3VA0 A;  4ZTJ A;  4C8O A;  4Z4G A;  5FDL A;  3HXM A;  3NH0 A;  4N56 A;  5J2Q A;  4GMJ B;  4DSI A;  4KPY A;  3QIN A;  4KTZ A;  1HQE A;  3HL8 A;  4AH9 A;  1NK6 A;  3U6F A;  4KKO A;  1EP4 A;  3TAF A;  4EP4 A;  4KHQ A;  1WSH A;  1K6Y A;  3DLR A;  4CJL A;  4CK1 A;  4KAZ A;  4KHN A;  3NDK A;  3KLH A;  4M3Y A;  3ZT1 A;  3TAB A;  4AIL C;  3ZCM A;  1RDC A;  4KFB A;  4CHO A;  4CF1 A;  3OYL A;  1UA1 A;  4OGE A;  3HT3 A;  4E7H A;  3L2U A;  3ZSV A;  1VSJ A;  1IH7 A;  2ATQ A;  1WSG A;  1RT3 A;  4Z0U A;  4DS4 A;  4OGC A;  3VQ5 A;  3MXI A;  2ZD1 A;  4B9S A;  4M3X A;  3QLH A;  4DFP A;  1SV5 A;  2VG5 A;  3PY8 A;  5JS1 A;  2EX3 A;  3BGR A;  4DG1 A;  1QS4 A;  1D5A A;  1LAW A;  2RPI A;  3O4N A;  3LZJ A;  4HUF A;  3QNO A;  3DLE A;  3TAG A;  1VSK A;  4BDZ A;  3OYI A;  3QEX A;  3WNF A;  4M42 A;  3AO2 A;  1J53 A;  3NF6 A;  3V1R A;  4CF2 A;  3NCI A;  3VA3 A;  3QO9 A;  4CHQ A;  1SL0 A;  2HHW A;  4DF4 A;  3ZT3 A;  3VQB A;  1QSS A;  2E4L A;  1QQC A;  4E7J A;  4ZHR A;  3IG1 A;  1LAV A;  3OYM A;  4CK2 A;  2P5O A;  3ZSO A;  4IFV A;  1NKE A;  4FJI A;  5KGW A;  3OYK A;  4FK0 A;  1RT5 A;  1CXU A;  4DU3 A;  1RT6 A;  4FLU A;  4AHV A;  4FW1 A;  1XI1 A;  2E6M A;  3SPY A;  3T3F A;  3QES A;  1MU2 A;  1WSI A;  5CY4 A;  2FBY A;  1U04 A;  4J2D A;  4OLA A;  1HNV A;  3TR8 A;  3KK3 A;  3AVA A;  3TAP A;  3PO4 A;  4PY5 A;  3NH1 A;  4DTM A;  3RR8 A;  1ZBH A;  4CFB A;  5CZ1 A;  3OYB A;  3NF9 A;  4CEA A;  3TWH A;  4E0D A;  3AVL A;  2KFN A;  3E01 A;  1A5X A;  3EY1 A;  3RMC A;  1BQM A;  4R5P A;  4O4G A;  4NYF A;  3OYN A;  4CJS A;  1XC9 A;  5CYQ A;  1NK7 A;  4F8R A;  4E3S A;  1RT1 A;  4OLB A;  4DSL A;  2PYJ A;  3KK1 A;  1BIZ A;  4CGI A;  4E1M A;  1KCF A;  4CJR A;  4DTO A;  3D0P A;  4FLW A;  1S1X A;  1WN7 A;  4MQ3 A;  3WNG A;  1NJZ A;  3L2R A;  2NUB A;  3WNE A;  1JLB A;  3TAM A;  4FLX A;  2X74 A;  1QE1 A;  1XWL A;  2VG7 A;  4IKF A;  4ZTF A;  3CFO A;  3L2Q A;  2OPQ A;  2ZE2 A;  3CG7 A;  3KKS A;  4I2P A;  2VWJ A;  4Y1D A;  3AO1 A;  1TVR A;  4CES A;  4W5Q A;  1TL3 A;  4JS5 A;  4FM0 A;  4CJW A;  1C1B A;  1QHT A;  1VSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...