3O4QA

Crystal structure of the rous associated virus integrase catalytic domain a182t in citrate buffer ph 6.2
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
145
structure length
136
Chain Sequence
b'LGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSFTSKSTREWLARWGIAHTTQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords integrase
publication title A crystal structure of the catalytic core domain of an avian sarcoma and leukemia virus integrase suggests an alternate dimeric assembly.
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Dna binding protein
total genus 50
structure length 136
sequence length 145
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3o4qA00
4FXDA 3SPZA 2HHWA 4M42A 3V1QA 4HVJA 3L2VA 4M41A 1S9GA 3HJFA 3F73A 4M45A 3C6TA 3HPOA 1NOZA 3AVCA 3M8QA 3ZSWA 1RDDA 3TWHA 3VQEA 3M8RA 1S5JA 1Z25A 3AVFA 3TAFA 1SL0A 1RT4A 2RN2A 3OS0A 4FZZA 4N41A 1IKWA 3PX6A 4GMJB 3V6DA 2XHBA 2YNHA 4W5NA 2X78A 5HLFA 4OKJA 4M3WA 4RW7A 3QINA 2W42A 3K5NA 3DI6A 2R7YA 5KRSA 4FLVA 4DU1A 4CGJA 4DTNA 1D9DA 3AA4A 1JLCA 5D3GA 4B9LA 4CEZA 4MFBA 2FBXA 2RKIA 1BI4A 3AVNA 1RTIA 1QSYA 1KRPA 4ZHRA 3DLBA 2ATQA 3O4QA 4XIUA 3TR8A 2VWJA 3KTQA 1S6QA 3HP6A 2VG6A 2KQ2A 1BIUA 4K8XA 5SWMA 3MXMA 1JLFA 1S1UA 4FJKA 3T3FA 3QO9A 4DTMA 1SUQA 4E0DA 4DSLA 2A1SA 3KKRA 1VSMA 3L2QA 1QE1A 4CF1A 4AHUA 1YVUA 2F96A 4JS5A 3QERA 3OYHA 3SQ0A 1KFDA 5KRTA 3S9HA 1BGXT 4Z4GA 4YNQA 1L3VA 1Q9XA 2KTQA 3KLEA 1TK0A 5EU7A 3QEXA 4LSNA 2IOCA 4AHSA 2HVIA 4AHTA 3V1RA 2I5JA 3I0RA 3A2FA 1A5XA 3QEWA 2OZSA 3ZT0A 4CEDA 4BDPA 1B9FA 1VSLA 1YTUA 1JKHA 1NOYA 3SZ2A 3OYKA 1RBUA 4DQPA 3QETA 4CEFA 5FRMA 4E7JA 3OYDA 3LAMA 1RCHA 4TSXA 2QKKA 1A5WA 2JLEA 3M8SA 1N6QA 2OYQA 3AA5X 4M3UA 4B08A 3OJUA 3TARA 4CJUA 4EZ9A 5HRSA 3BGRA 4FJNA 1KLNA 1VSJA 4C8OA 2D5RA 1BIZA 1QTMA 2B4JA 3IG1A 3VQPA 1NK8A 3PX0A 2HW3A 2P1JA 2KFZA 4Q0BA 5C42A 4F4KA 3V4IA 1SKRA 4E7IA 4OGCA 3ZSYA 1TKZA 5C24A 3ASMA 4AHVA 3VN5A 4DF4A 4FJ8A 4M3YA 1CZ9A 2Z1IA 3M8PA 4FLZA 1HQUA 3KLIA 2XY8A 2AJQA 2HNZA 1KCFA 5CYQA 5J2PA 3OYEA 3T19A 4DTSA 2DFEA 1SL2A 4B9UA 2IC3A 1I39A 1A5VA 2EHGA 3CG7A 2XO7A 1HNIA 4B8AB 1W0HA 4KTQA 4KI6A 4B3OA 4FJGA 2HHSA 4E19A 4PQUA 5K14A 3THVA 4DTUA 4FJXA 3KIOA 1BCMA 3FFIA 3NGIA 1VSEA 4FJ5A 5HRPA 1NJWA 1NK0A 4W5TA 3OYJA 3MAQA 1HJRA 2OPRA 4LH4A 3O3HA 4M3XA 1NKEA 4DSIA 1IH7A 3MEDA 4KO0A 1XC9A 1RTDA 1LWFA 5J2QA 2OPPA 3QNOA 2WOMA 4B9TA 1Z26A 3SUOA 4L8RB 4BWJA 3AVIA 1WSJA 3WNEA 2XY5A 3SUPA 4NYNA 4FM2A 3SPYA 1TAUA 4DQRA 4H4MA 4CGGA 1RT6A 3CM6A 3HVTA 1EP4A 3LP3A 4CECA 1HYVA 4DU3A 3DOKA 3RR8A 3V1OA 1XI1A 4Z4FA 3LAKA 1WSHA 2FBYA 4QAGA 5KI6A 4CFCA 1T8EA 1IO2A 1D9FA 4AILC 4DSJA 1HRHA 1LWCA 3ZSXA 3DLKA 4CF0A 3NDKA 2HVHA 2HB5A 4KI4A 4ID5A 2E4LA 3D45A 4B8CA 1VSDA 2KZMA 3F9KA 5CY4A 4DG1A 1F21A 3RRGA 1RDAA 1LAWA 4CESA 3HM9A 3SI6A 3U3GA 4AHRA 4FM1A 2DFHA 1ZBIA 4JRPA 4JS4A 4HHTA 3P83D 3NH1A 4DTPA 1EETA 5FDLA 3QEVA 1S6PA 4WE1A 4J2AA 4J2DA 4CEAA 2HHTA 3IAYA 1FKPA 4BE2A 3BDPA 1C6VA 1C0MA 4DWIA 3RRHA 3DRRA 5T7BA 1S9EA 4C8KA 5CZ2A 1FXXA 1T03A 3ISNC 4R5PA 4FLYA 4H4OA 3AVJA 3PO5A 2QKBA 5HRRA 2YKMA 1LW2A 4PA1A 3VQ4A 1KVCA 3HP9A 4CEBA 1VSFA 4RW9A 4DF8A 1S1VA 3AVBA 4DMNA 4DQIA 5HROA 4J2EA 2RF2A 1RT2A 4IFVA 3AA3A 4HUEA 1EX4A 3RMAA 2GBZA 1W9HA 4CIEA 4B9MA 1Y97A 5HBMA 1N5YA 4JRQA 4N76A 3K2PA 2ZE2A 4UQGA 4KHYA 2FC0A 4N5SA 4G1QA 3O4NA 4KV8A 1ZBUA 1D8YA 1CXQA 4CGFA 2GUIA 3ITHA 1IG9A 1YTAA 4IFYA 4C8NA 3VQCA 1WSEA 3O3FA 3NE6A 1C0UA 2FBVA 2X6SA 3OYNA 4CFBA 3SYZA 2YNFA 1U48A 4KHSA 3C95A 3MECA 2G8IA 3C94A 4PY5A 4KTZA 4DSKA 1RDBA 3KK1A 3L8BA 3NGZA 2F8TA 3SCXA 5JS1A 4CHYA 3TAQA 3AO2A 4BWMA 1DTQA 3VQBA 3OS1A 3HVRA 1NJXA 4BE0A 1RT5A 2BDPA 3HK2A 4FYDA 3TAEA 4O0IA 4K8ZA 4BDZA 4Q5VA 3ULDA 1WAJA 3NF6A 3L3UA 1NJYA 4OLAA 3LALA 3ZSRA 3ZSOA 4F2RA 1BCOA 1RBTA 3C6UA 4IG0A 5I42A 4FJHA 3ZSQA 1WSFA 2VG7A 4KKOA 4KHUA 3TAPA 2D0CA 1ZBFA 3KKSA 3AVGA 3OJSA 3NF8A 3NF7A 2PYJA 4CHOA 3PUFA 4C8LA 1REVA 4CJVA 1FKOA 1RBRA 3ZSVA 4HCBA 1TKXA 1S1TA 2RPIA 2YHBA 2FBTA 3P1GA 1T05A 3VQ9A 1NK9A 1QSLA 4F3TA 3K59A 1U47A 5DK5A 4OKEA 4CF9A 1SV5A 1JLBA 3ZT3A 3NH0A 1IKXA 1SKWA 5J2MA 2IGIA 2HMIA 4N47A 4I2PA 4Y1DA 1NK7A 3E01A 1BHLA 1EXQA 5SZTA 3SQ4A 1TV6A 3SV4A 1C1AA 1TGOA 2YNGA 3TANA 4B9NA 4ELTA 3KLFA 1ASWA 4FJ9A 1RT7A 1VRUA 2B6AA 4NYFA 4CK1A 4CJ4A 5I3UA 4I7FA 1J53A 1BQNA 1KTQA 2OPSA 3VQ7A 3KLGA 3EZ5A 4ID1A 4DTJA 1RT3A 2HHXA 3G10A 2DFFA 4O0JA 4BDYA 1FK9A 2B5JA 3CYMA 4OPJA 3OYBA 1KLMA 1LV5A 3ALYA 1WAFA 4E7LA 3DLRA 3PO4A 1WLJA 1UOCA 2KFNA 4CGHA 5KGWA 4EP4A 3LWMA 1NJZA 1HPZA 1S1WA 1TKTA 4KHQA 2O4IA 3KK2A 4LD0A 1WSIA 3U6FA 1KFSA 3LP1A 3I0SA 4IG3A 1C1BA 4CJPA 4E89A 1GOAA 2QXFA 1X9SA 1BL3A 1KVAA 2OA8A 3L2RA 3IRXA 4PWDA 3H08A 2PYLA 3ZT4A 2X6NA 2QK9A 1HYSA 4KTWA 3ZCMA 1CZBA 3AV9A 4IDKA 1YT3A 3DLEA 1C0TA 4IKFA 3RR7A 3MXIA 1Q8IA 1U4BA 5C25A 1JXBA 1VSKA 2XRIA 4W5QA 3VA3A 3SQ1A 4Z4EA 4O5BA 4CF8A 2P5GA 2DTUA 1WNSA 1D5AA 3VA0A 3HXMA 3SUNA 4E1NA 3QEPA 1JXEA 2PY5A 4KPYA 4M3ZA 3QNNA 4N56A 1UWBA 3OYGA 4E3SA 4DFJA 1NK5A 1LWEA 2BE2A 3O3GA 1JLQA 1TVRA 3RMDA 4OKKA 4JLHA 4CIFA 4FLXA 4CJTA 5JS2A 3TAGA 1ZBHA 2IAJA 4NCGA 1KVBA 1S1XA 3MEGA 4ELUA 3QEIA 1R0AA 4NCAA 1UAXA 3WNGA 4KHWA 3AVHA 5HP1A 2Z1HA 1HYZA 4CK3A 5E41A 2F8SA 1XHXA 1NK4A 4CCHA 1TAQA 5CYMA 4CK2A 4OLBA 4ELVA 1NKBA 3TAMA 4CEEA 4BE1A 1VRTA 2HHQA 1RBVA 4DSEA 1CXUA 4HUFA 1WN7A 4DS4A 3DMJA 1JL1A 3OY9A 3OYIA 4ICLA 3K58A 1U49A 3KD5E 3LPUA 4I9LA 4RW4A 4GVMA 2PZSA 5KTQA 3I8DA 3SJJA 3HSTB 3T1AA 4CJSA 4AH9A 4Z4IA 3QLHA 4QOZB 4M3TA 4CGDA 2D0AA 1VSIA 4FJJA 3IS9A 3V81A 1HQEA 3TI0A 3S3MA 3NHGA 4CHNA 3SUQA 3QIOA 2G8WA 4KHNA 1GOCA 3NCIA 1ITGA 1CLQA 2G8UA 4FJLA 1ASUA 2BGGA 5FROA 4NCBA 3AO3A 3PX4A 1J9AA 3L2UA 3NH2A 1B92A 4LSLA 2E6LA 4OJRA 4LH5A 3V9ZA 4DFMA 1J5OA 1SL1A 4B9SA 1QSSA 4KB0A 2IS3A 3SNNA 4FZYA 3DRSA 3OYFA 2LSNA 3NF9A 1RT1A 5J2NA 3S3NA 1C1CA 4FW2A 4I2QA 4E7KA 3LANA 3K57A 1B9DA 1X9WA 1G15A 1LW0A 2NUBA 3EY1A 1KSPA 2XY6A 4DFPA 1RNHA 4E1MA 1U45A 1VSHA 4CEOA 4CF2A 1NKCA 3KLHA 1RTJA 4DTXA 2A1RA 4BACA 4O4GA 3V9XA 3NBPA 2GV9A 3L3VA 3LZJA 4HUGA 3UIQA 1LAVA 3OVNA 3DM2A 2Y1IA 1DLOA 1VK0A 2IDOA 4CFAA 2VG5A 2KZZA 3HPGA 4FJ7A 1ASVA 4Z0UA 4CGIA 4DU4A 3HPHA 2X74A 1UA0A 3WNHA 3TABA 1T7PA 2VWKA 3RMCA 2XY7A 1JLEA 3LPTA 4F2SA 4Y1CA 4J2BA 1O1WA 4W5OA 4CHQA 3CQ8A 2G8KA 2G8VA 2DY4A 4F3OA 3JSMA 2OPQA 2ITGA 4KB1A 4HCCA 4KAZA 1QQCA 3VQQA 3RTVA 3V9WA 4E7HA 4DQQA 2HHUA 5CZ1A 4O55A 4RW6A 3NAEA 3QIPA 2D0BA 3AO4A 1TL1A 3LZIA 4DTOA 4CHPA 1SKSA 1ZYQA 2YHAA 4CJKA 1IKVA 3PV8A 4DLEA 3HYFA 1GOBA 4F8RA 3VQ5A 4CJWA 1K6YA 1QHTA 3DRPA 3CFRA 3ZT1A 3SQ2A 2G8FA 3KK3A 3OYLA 4FZXC 2EX3A 2YNIA 4DSFA 4I9QA 3AO5A 2ZD1A 2KW4A 4CERA 4FJMA 4ZTFA 4OGEA 1XHZA 3HL8A 3K5LA 1X1PA 2O4GA 4M3RA 1BQMA 4CJ3A 3VQDA 3CM5A 4MQ3A 3D0PA 4Z4CA 4FJIA 4KRFA 1XWLA 3U3YA 1HNVA 1BISA 3VQ6A 2HNDA 2P5OA 4CE9A 4FK4A 2Z1JA 2ZQBA 2P51A 1UA1A 2Z1GA 4YFUA 3PY8A 4OPKA 1JL2A 4EP5A 1L5UA 2OZMA 4B9VA 3K5OA 2ETJA 1QS4A 3B6OA 4RG8A 3B6PA 1NK6A 3AA2A 4OVLA 3OYCA 4DTRA 1J54A 3CFPA 4FCYA 4C8MA 2E6MA 4ZTJA 4IBNA 4CJ5A 3AVKA 4LY7A 4W5RA 1TKDA 3VQ8A 3QESA 1HMVA 3NFAA 4AHCA 1X9MA 1MU2A 3LP2A 3MEEA 4FM0A 1U04A 4FLUA 1BI4B 2YKNA 1Q9YA 3G0ZA 3V9SA 5DMRA 3ZSZA 3LWLA 4CJRA 5FRNA 3WNFA 3L2WA 1I3AA 4Z4HA 3OS2A 1DTTA 4DQSA 4QCLA 1TK8A 5HRNA 2HNYA 1TL3A 1L3SA 4KREA 3AVMA 3NGYA 4FVMA 1JLAA 3ZT2A 4DFKA 4FK0A 3DLGA 2JGUA 4PUOA 2HHVA 4KFBA 3LP0A 2Q3SA 1JLGA 3AVAA 2Y1JA 5J1EA 4H8KA 4FW1A 3KJVA 3P5JA 4HTUA 3OYAA 3S3OA 4GW6A 3OYMA 1WSGA 3LDSA 4RW8A 4FLTA 1IKYA 5KGXA 4DS5A 3V9UA 4CJEA 1RDCA 2YV0X 4CJQA 4CHZA 3SV3A 2G8HA 3HO1A 4CJFA 3JYTA 3CFOA 1RBSA 4EZ6A 4CEQA 3HT3A 4O44A 4CFDA 3DLHA 2BANA 4DLGA 3MXJA 4FLWA 1RILA 3K5MA 4FK2A 4CIGA 3EYZA 3VQAA 1L3UA 3KD1E 3RWUA 3AO1A 3DYAA 3DOLA 1EKEA 3RMBA 1ZBLA 1L3TA 4CJLA 1RTHA 1TK5A 2WONA 3AVLA
chains in the Genus database with same CATH superfamily
4FXDA 4M42A 3V1QA 3HPOA 4A62A 3D2FA 4QS9A 1W7AA 3VQEA 4B1ZA 3M8RA 3TAFA 2RN2A 3ID6A 4N41A 1IKWA 4NXMK 2O8BA 2X78A 4OKJA 1VQON 3FZMA 5KRSA 2R7YA 1T44A 4JI7K 4CBWA 2RKIA 3AVNA 1VQ4N 1KRPA 3DLBA 3O4QA 3TR8A 1S6QA 2VG6A 4MDBA 4U7BA 4FJKA 3T3FA 4JHDB 3KKRA 3L2QA 1QE1A 2F96A 1VQKN 5GAGP 5AZIB 3S9HA 2CGLA 4YNQA 2EWSA 3C6AA 5FPNA 3KLEA 5EU7A 4LSNA 3THXA 3A2FA 1A5XA 1QHAA 3ZT0A 1N8RO 1VSLA 1OKJA 3AGRA 1FJGK 3CCSN 2UXCK 4DR2K 1RBUA 3QETA 4MLEA 4EAHD 3OYDA 2AA4A 5JVGL 4CBXA 1J5EK 3M8SA 5EOYA 3TARA 3A0IX 1KLNA 1VSJA 4C8OA 2B4JA 3PX0A 2KFZA 4Q0BA 5C42A 1TUUA 1SKRA 5BRHA 3ZSYA 1TKZA 5C24A 4M3YA 1S22A 1OVQA 1KAZA 1M90O 1KCFA 5J2PA 1QQNA 4B9UA 4HTLA 1A5VA 1WUAA 4AF1A 2XO7A 1HNIA 4B3OA 1QVFM 4PQUA 3WXKA 3HOTA 1JJ2M 3P4IA 1NJWA 4FOEA 3UKRA 4W5TA 3OYJA 3VEYA 4A5BA 3O3HA 4DSIA 4KO0A 3FFKB 4AM6A 2P9PB 2F4VK 4PL7A 1Q7YO 5J2QA 2WOMA 3O8MA 4L8RB 2QWRA 3WNEA 3AVIA 2XY5A 3BZKA 3A8YA 3CM6A 3C0BA 4CECA 3KWGA 5IWAK 2IVNA 4CZHA 4DU3A 2GWJA 2NRWA 5AQOA 3RR8A 3V1OA 3J7ZO 1XI1A 5KI6A 3THYB 4YDUC 3VEZA 1IO2A 1D9FA 4CF0A 4CZFA 1GLEG 3IKMA 4JI4K 3EE8A 2KZMA 4DG1A 1HNWK 3RRGA 1LAWA 4CESA 5KQ8A 2D1KA 3C65A 3VEWA 1EETA 4FWKA 2HHTA 3IAYA 3DRRA 1BUPA 5E26A 1FXXA 1T03A 3HM8A 4R5PA 1HR0K 2NLXA 2QKBA 1LW2A 3QMLA 4DF8A 3GOIA 3ZX2A 4DQIA 4XH1A 4J2EA 4LF9K 2QM1A 5LL6Z 3MN5A 1NGJA 1T6DA 3J81O 2FC0A 4N5SA 4DUZK 3E9PA 4CGFA 1OVYA 3VQCA 4DFJA 3NE6A 3W3DA 1SKWA 1Z05A 2X6SA 1XNRK 3MX5A 1RGIA 1U48A 3T1HK 4KHSA 2G8IA 5AQWA 3TSPA 4PY5A 4DSKA 1VQ9N 3F2KA 4BQZA 4C1NI 3AAQA 3O1WA 3OS1A 1NJXA 1RT5A 3SJHA 5LY3A 5JMVA 5KPTA 1WAJA 3L3UA 4ILGB 1HKGA 4OLAA 3ZSRA 3ZSOA 3S41A 1WSFA 4KHUA 3KKSA 1GLDG 2E8AA 4GVEA 5C12A 4H0TB 5EX5A 1S1TA 2RPIA 4CZGA 2FBTA 3K59A 4CI6A 3ZYYX 2IGIA 4I2PA 3MWPA 4Y1DA 5GINA 3E01A 4LF7K 3SQ4A 2QTDA 1RDUA 3KLFA 1BU6O 1RT7A 4CK1A 4JKFA 1J53A 1BQNA 1KTQA 3G4SN 3KLGA 2O8DB 4ID1A 3G10A 2B5JA 3E9LA 2HHHK 3ALYA 3H46O 4EP4A 5HOOA 3WXLA 1TKTA 2NRTA 4BREA 4IG3A 3T1YK 2OA8A 1KVAA 2YJFA 3L2RA 4DV3K 3EEQA 3H08A 2X6NA 1ATSA 3H3OB 4BRAA 3HZ6A 2QWPA 3MXIA 2P9SB 4JHDA 4Z4EA 3J7YP 2P5GA 4V19S 1WNSA 5AZIA 3HXMA 4YORA 2E2PA 4N56A 1UWBA 4EIAA 4EFHA 3O3GA 3L6QA 3KK7A 4CJTA 4FL9A 1XMOK 1ZBHA 3UE5A 4JKCA 3QEIA 2BTFA 4KHWA 5HP1A 2Z1HA 1XHXA 3ZETB 3ZEUB 4I6MB 4CK2A 4OLBA 3VF2A 4ELVA 4CD3A 4CEEA 1NGFA 4YOUA 3MDQA 3G6EN 1WN7A 4DS4A 4GNIA 3OY9A 4ICLA 3OYIA 3K58A 1KC8O 3SJJA 5AQFA 4AH9A 4DCHA 3QLHA 2D0AA 2NNWA 3V81A 4IDHA 1NM1A 3NHGA 3QIOA 4H0OA 4DV6K 3NCIA 4BRDA 5TKYA 5FROA 3PX4A 5CHIA 4LSLA 2E6LA 1QSSA 3TTDA 3SNNA 4FZYA 4DR1K 3OYFA 4FW2A 1RFQA 2P9PA 1B9DA 1G15A 4CJ7A 1N32K 5M1KA 1KSPA 2XY6A 4DFPA 1RNHA 4E1MA 1U45A 4BACA 3LDNA 3NBPA 3LZJA 3ENOA 3OVNA 4X62K 1VK0A 3HPGA 5AQSA 4JAXA 4Z0UA 3THYA 4UY8O 1OH5A 3TABA 4FWLA 2UU9K 4J2BA 4PKHA 4BC5A 2ITMA 4KB1A 3AGKA 4KAZA 3V9WA 3RTVA 2Q0RA 3OHRA 4B1VA 5F0XA 3LZIA 1SKSA 4CJKA 2GWKA 3VQ5A 5JVHL 2PFUA 2EX3A 2YNIA 5GAHP 4DSFA 3AO5A 2KW4A 1J5OA 2O4GA 4CJ3A 4MQ3A 4KRFA 4DR7K 2P5OA 4FK4A 1YUWA 1ATNA 4CZLA 4OPKA 2OZMA 3FGUA 3B6PA 3MN7A 4DTRA 4FCYA 3W0LA 2UUBK 5FPEA 3PSIA 2A41A 3U9DA 3LP2A 3CC2N 4FM0A 4FLUA 2YKNA 3SLCA 3GG4A 5DMRA 3ZSZA 4FVUA 2D0OA 5FRNA 3CETA 3WNFA 4IO9L 3CJAA 4OX9K 4KREA 3NGYA 5AJ3K 5AQUA 3LP0A 2Q3SA 5J1EA 1NGGA 4FW1A 5ADXH 4PL8A 1Z6RA 2CGJA 5LJVA 2O8FB 3OYMA 5AQXA 4RW8A 4FLTA 1IKYA 4DS5A 4JI2K 3V9UA 4R79A 3L4QA 3SV3A 3F9MA 1NNEA 1Q18A 3HO1A 3JYTA 5BPLA 3HT3A 4O44A 3DLHA 3MXJA 2O8DA 1RILA 3RVCA 4FK2A 4CIGA 3RWUA 3AO1A 3VETA 1MDUB 3OYNA 4CD1A 5ADXA 2HHWA 4HVJA 2ASPA 1S9GA 1YXQA 4JN4A 1NOZA 3ZSWA 4FWSA 1Q81O 4BRQA 4FZZA 1P8ZA 4GMJB 4M7XA 3QB0A 2YNHA 4W5NA 3Q7CA 5AQGA 4X65K 4RW7A 4PKIA 3K5NA 4FLVA 2P9SA 4DTNA 4FSVA 2ZGYA 1D9DA 2UXDK 1JLCA 4MFBA 1NGCA 2FBXA 5ELZA 1BI4A 4BC4A 1RTIA 3CMAN 3H1VX 4ZHRA 3H45C 2ATQA 3CCRN 1S1UA 5F2RA 3VGKA 1YJNN 2YJEA 4B9QA 2A3ZA 1HKCA 3O6WA 3QERA 3SQ0A 2YHYA 5KRTA 1N34K 3ZEUA 4BC3A 4I6MA 4AHSA 4AHTA 3I33A 3JS6A 2OZSA 5TKWA 4BDPA 1B9FA 2D0PA 2NRXA 5C15A 2ZJPL 4DQPA 4BR5A 2HBKA 3LAMA 1NMDA 1RCHA 4BRLA 2QKKA 4M3UA 5C0YA 3OJUA 4CJUA 3ZLJA 4L3QA 4EZ9A 1DT9A 1P90A 1BIZA 1QTMA 3VQPA 2P1JA 4LF8K 3WXIA 4E7IA 1BOTO 4AHVA 4GV9A 4FJ8A 1K8AO 4B1WB 1BWFO 1HQUA 4BRHA 2AJQA 1G99A 3OYEA 3T19A 2QI2A 3O80A 3CG7A 3VOVA 5IT9O 4E19A 5K14A 2VWBA 3THVA 4FJXA 3KIOA 3JAMO 2ZGZA 1NK0A 3MAQA 1HJRA 4LH4A 4M3XA 1X3MA 1NKEA 1U6ZA 1RTDA 1LWFA 4WFAL 2OPPA 4B9TA 3SUOA 4GY2B 3SUPA 1TAUA 4CGGA 1ILYA 1EP4A 3LP3A 1W97L 4ISFA 3P31A 2YCHA 4WQ5A 3CCMN 1NU0A 2QEXN 1VQNN 1LWCA 3NDKA 3DLKA 4GKJK 3OBYA 2HB5A 4ID5A 3D45A 1F21A 5AQHA 4PKGA 4NO7A 5M1NA 3HM9A 1YIJN 2DFHA 4JS4A 4HHTA 1BO5O 5E84A 1NWKA 4BR7A 5FDLA 1S6PA 2IVOA 4CEAA 1FKPA 4DWIA 1S9EA 1OH7A 3ISNC 3PO5A 2YKMA 4RW9A 1S1VA 4DMNA 1XMQK 4IFVA 4Z94A 3AA3A 4HUEA 2GBZA 4CIEA 4N76A 4JK8A 3P38A 1ZBUA 1D8YA 1CXQA 3CJBA 2Q36A 3CCVN 1NGEA 1WSEA 3SYZA 1C0UA 2YNFA 3A5MC 1GLJO 3MECA 3VF4A 3VENA 3KK1A 1VQLN 5JS1A 2Q2RA 3TAQA 3VPZA 2BDPA 2O8FA 4K8ZA 4BDZA 4QS7A 2ZWHA 5GIOA 5AQJA 3N4QA 4JI6K 3LALA 2YX6A 3VEVA 2FXUA 3ZSQA 5I42A 3HTVA 4IEEA 3TAPA 3E66A 3OJSA 3NF7A 3P39A 3FE1A 3PUFA 5AQPA 3SAGA 4C8LA 4CJVA 3ZSVA 4HCBA 2W41A 2YHBA 1QSLA 4CF9A 1JLBA 3ZT3A 4DHYA 3JXUA 2GTDA 1ESVA 3VGLA 1KAXA 5BRFA 2P9KB 1NK7A 5I9EB 1BHLA 1EXQA 5SZTA 1TV6A 3FR0A 4ELTA 4CJ4A 4KH5A 2OPSA 4DTJA 1RT3A 4O0JA 1FK9A 1MA9B 3OYBA 4BG8A 2QWQA 4BGAA 4E7LA 2KFNA 3LWMA 3TPQA 2O4IA 4LF4K 3O4WA 3M6GA 1WSIA 2A40A 1C1BA 4CJPA 1GOAA 1BL3A 3OBWA 5AQMA 3ZT4A 3LDPA 4H5WA 4KTWA 3AV9A 3DLEA 4BG9A 1C0TA 4FWNA 4IKFA 1Q8IA 1U4BA 1VSKA 3VA3A 4BRNA 2DTUA 1MWMA 3M5RA 3C7NB 3VA0A 3MMVA 3TSUA 4C1NK 2PY5A 4BRPA 3QNNA 3OYGA 4E3SA 2YI1A 1LWEA 3BEXA 4GV3A 1JLQA 1TVRA 5BN8A 3TAGA 4B3SK 2FF6A 4NCGA 1S1XA 3MEGA 4BVOA 2Q0UA 4ELUA 1SAZA 1T6CA 1UAXA 3WNGA 5E41A 1NK4A 1TAQA 5CYMA 3DLLL 4IJAA 4JI5K 3TAMA 2HHQA 2P9LB 1RBVA 1CXUA 4HUFA 4KH4A 3DMJA 5M1FA 3CF5L 3LPUA 4IOXA 1WBBA 5KTQA 1QQMA 3HBTA 4QOZB 3T1AA 3IS9A 3CJCA 2V52B 3S3MA 2G8WA 4CHNA 4KHNA 2FSJA 4B1UB 3GL1A 1GOCA 3VGMA 1CLQA 3D7EO 4NCBA 1NGAA 4NB4A 1J9AA 3L2UA 1B92A 3NMUA 4IWVA 2IS3A 4FPBA 3NF9A 1RT1A 4I2QA 2UUCK 3LANA 3PSFA 4IXCA 3K57A 3BZCA 1X3NA 3R9PA 3WUHA 5CR4A 3AAPA 1VSHA 4CF2A 2VGMA 4DTXA 2A1RA 3UIQA 2GV9A 4XH4A 1LCUA 3WEEA 1ASVA 4DU4A 3HPHA 2PAVA 1SQKA 3LPTA 3CC7N 4F2SA 4FWMA 1O1WA 3HI0A 4CHQA 3CQ8A 2DY4A 1QZ5A 4F3OA 3JSMA 2VCPA 2OPQA 4BR4A 4HCCA 3ENHA 3O9QA 3VQQA 3EZWA 1E4FT 5AQLA 3FZHA 1ZBSA 4RW6A 3NAEA 4G9ZA 4C23A 4CHPA 4YDUA 4DLEA 1K6YA 2G8FA 3DJCA 4IFEA 3U8XA 4JI3K 4FZXC 1LOTB 1NJIO 4JI8K 2IIRA 4K42A 4I9QA 4CERA 3CC4N 4ZTFA 5FPDA 1XHZA 3HL8A 4WQ4C 3D0PA 4FJIA 2GEMA 3B8AX 1SS6A 1BISA 5BR9A 1UA1A 1OH8A 2YHXA 1OH6A 3QBWA 3TSQA 4EP5A 3DXMB 3K5OA 2ETJA 4RTFD 4JKEA 4YOXA 4LFAK 3WXMB 3IDHA 4ZTJA 1EWRA 4JKBA 3THWB 1HX1A 4AHCA 5GIPA 1YJWN 2CGKA 3MEEA 2BH1A 1Q9YA 1BI4B 3MN9A 4BGBA 3V9SA 5CE3A 2GX9A 4Z4HA 3OS2A 1NMNA 4DQSA 1TK8A 1L3SA 4FVMA 4DFKA 1JLAA 4FK0A 4PUOA 3SAFA 2QWOA 1JLGA 4BRKA 4H8KA 3KJVA 4DV4K 1MWKA 1YVNA 5AQVA 3OYAA 3I8BA 2F9TA 1WSGA 4YOVA 5GAEP 1VAZA 2P9KA 2YV0X 2G8HA 2KKZA 3WT0A 4A61A 2BANA 2QW9A 4FLWA 2JWLA 1IJJA 3KD1E 3DYAA 4DV5K 1EKEA 3RMBA 4CJLA 1RTHA 2HSTA 4OPAA 4CW7B 3L2VA 2QWMA 1YJ9N 3L0QA 3HJFA 1EQYA 4M45A 3C6TA 5AR0A 1S5JA 1Z25A 1HKBA 3QBXA 3PX6A 2V51B 3O1BA 2Q1NA 4WCEL 4M3WA 4OPHA 3QINA 1NGIA 1TYQB 4WQ4A 4IOAL 5D3GA 4B9LA 4WYBA 4XH5A 2ZJRL 4B3RK 3C7NA 3ID8A 1GLLO 4XIUA 3KTQA 3D2EB 1GLAG 1BIUA 4DTMA 4LFCK 1YF5L 1SUQA 4E0DA 4DSLA 2A1SA 3LDQA 1VSMA 4CF1A 4AHUA 1YVUA 1YITN 3CIPA 3WQTA 3OYHA 4EHUA 1KFDA 1HUXA 4Z4GA 1BGXT 1Q9XA 2W6LA 1U2VB 1TK0A 3QEXA 2P9LA 2I5JA 3I0RA 3QEWA 2UYTA 4CEDA 4NLBA 1WB9A 3CCQN 3GE1A 1NOYA 3SZ2A 4DR6K 3OYKA 4CEFA 3QICA 4JKAA 4JI1K 1A5WA 2OYQA 1N6QA 4M63C 3AA5X 3C6HA 4B08A 4DR3K 1S72N 4FJNA 3BGRA 2D5RA 3A5OC 4H0XB 1KXPA 1NK8A 3IUCA 3G25A 5AZJB 3H6EA 3ASMA 4DF4A 1CZ9A 3MCAB 4FLZA 2XY8A 2HNZA 3BP8A 5CYQA 2DFEA 2OTLN 1I39A 4B8AB 1W0HA 4FJGA 2NRRA 4DTUA 1BCMA 3FFIA 4FJ5A 3WQUA 5BREA 2OPRA 5H1SQ 3MEDA 4U67L 2P9NB 1XC9A 2A5XA 1QVGM 1H1VA 5JLFA 1WSJA 4K41A 4NYNA 4FM2A 4LF5K 4H4MA 1RT6A 2HF3A 3ATUA 2ASOA 2UUAK 1HYVA 3MWTA 3DOKA 2E5LK 3VTHA 1WSHA 4QAGA 3AARA 4CBUA 2O8CB 3CPEA 2HVHA 2V7ZA 3CD6N 2E4LA 2BUPA 4DB3A 4FOIA 5BR8K 3SI6A 3U3GA 4AHRA 5M1PA 4FM1A 1Q86O 1BA1A 4JRPA 3P83D 2V7YA 3QEVA 4J2AA 4BE2A 2WFBA 4JKDA 1GLFO 1C6VA 4JNEA 2F7TA 3BDPA 3RRHA 3MX2A 5T7BA 5CZ2A 4FWOA 1IBMK 3DWLA 3DXMA 5BN9A 4FLYA 3AVJA 4X66K 4ILJA 4PA1A 3VQ4A 4DV7K 1KVCA 3HP9A 1VSFA 3AVBA 4JK7A 1T3VA 5AQTA 1RT2A 5KPZA 3THWA 5B8HA 2WBNA 3RMAA 2ZF5O 1W9HA 5HBMA 4JRQA 1BDGA 3K2PA 3J80O 4UQGA 4WFNL 1XQSC 1JCFA 4KV8A 4IJNA 3ITHA 1YTAA 4IFYA 4C8NA 1XUPO 2WC9A 3O3FA 3EKSA 3C95A 3EL2A 1J6ZA 3C94A 3K0SA 1RDBA 3NGZA 3SCXA 3VQBA 5DM6L 3I56N 3HVRA 3HK2A 4FYDA 3CJ7A 3J8AA 4O0IA 4H0YB 3ULDA 3NF6A 1SZ2A 3VMFB 4FJHA 3SMSA 4A57A 2VG7A 4KKOA 1ZBFA 3AVGA 3NF8A 2PYJA 1RBRA 4H0PA 3SBTA 1QZ6A 3P1GA 3VQ9A 1U47A 3CJ1A 3NH0A 1IKXA 5J2MA 1WOQA 2HMIA 4N47A 3SV4A 2UXBK 4FJ9A 2B6AA 4NYFA 5I3UA 4I7FA 3VQ7A 4K0KK 2HHXA 1IBKK 3PLAA 2DFFA 4OPJA 1KAYA 1LV5A 2E20A 3CCJN 3VESA 3PO4A 1WLJA 1TYQA 3ULEB 4CGHA 1NJZA 1HPZA 1S1WA 4A5AA 4KHQA 4LD0A 3CERA 2Q97A 3U6FA 1KFSA 4A2BA 3LP1A 5BRDA 4E89A 3RSEB 4PWDA 4IZ9A 3D2EA 1HYSA 3SAHA 4IDKA 1YT3A 1I94K 2VQFK 1NLVA 2GELA 5C25A 1JXBA 2XRIA 3SQ1A 3Q7BA 1VQ5N 4B1YB 3WEEB 1D5AA 3CQYA 5C2FA 3CPWM 3SUNA 4E1NA 1DKGD 1JXEA 1U2VA 1BA0A 2QXLA 4PHTX 1FW6A 1NK5A 2BE2A 3RMDA 4JLHA 5JS2A 3IFRA 2IAJA 1IV0A 1KVBA 3KWIA 5AQYA 4EHTA 1R0AA 4NCAA 3AVHA 1HYZA 3TTCA 3PIPL 2W40A 2P9IB 3FZFA 5F1XA 3OW2M 1WBDA 3HSCA 1VRTA 4BC2A 2VQEK 3KD5E 4KH6A 3I8DA 4BRIA 4M3TA 4Z4FA 1VSIA 4FJJA 3ZX0A 1HQEA 5AZJA 3TI0A 3SUQA 2PBDA 4M7YA 2G8UA 1ASUA 3R3LA 4BVPA 4FPAA 5DM7L 5M1QA 3O08A 4OJRA 1GLBG 1SL1A 4KB0A 2GUPA 3BUZB 5FLXO 3DRSA 4YOTA 1C1CA 3VF6A 3BF3A 4LF6K 1O13A 4O8KA 2P9NA 1VQMN 2NUBA 2RHKA 2JWKA 4H5TA 4LC9B 3KLHA 1RTJA 1NGDA 3V9XA 4YY3K 3L3VA 3EO3A 4HUGA 1LAVA 2J4RA 3QFPA 2Y1IA 1DLOA 2VG5A 4JKGB 4FJ7A 4CGIA 3R8EA 2O8CA 3LDLA 3WNHA 2VWKA 3RMCA 4BR9A 3QFUA 2OCEA 2ITGA 1EO1A 2E1ZA 2RE2A 4E7HA 3F5TA 4DTOA 3QIPA 2D0BA 3AO4A 2YHAA 3R6MA 1IKVA 1GOBA 3LL3A 4CJWA 3CFRA 3SQ2A 3KK3A 4GKKK 4OGEA 1X1PA 4M3RA 1BQMA 3VQDA 1K9MO 4Z4CA 1XWLA 4J8FA 2HNDA 4JKHA 4CE9A 4JI0K 3EN9A 2E2QA 4YFUA 3HRGA 1L5UA 5MLCQ 3ATVA 4YOYA 1QS4A 1XC3A 2OANA 3R1XA 1J54A 5AQQA 4FWQA 4C8MA 2E6MA 4O5FA 3NVMA 4IBNA 2NZTA 4CJ5A 4LY7A 5HL7L 4H5VA 1TKDA 3J7AP 3VQ8A 1HMVA 3NFAA 4GV6A 1X9MA 1VQPN 1MU2A 4KBOA 4FWRA 3VEOA 4CVNE 2HMPA 3G0ZA 1Q82O 4CJRA 3L2WA 1I3AA 5AFUH 3VTIA 5HRNA 2HNYA 1TL3A 3NVKA 3ZT2A 2ZM6K 5M1OA 3SBGA 2HHVA 4BRCA 3FZLA 5AQZA 3P5JA 4HTUA 5LJWA 4BR0A 3S3OA 4GW6A 4RWTA 1KD1O 4CJQA 4DKWA 4CHZA 4CJFA 5AFUA 3VERA 3CXCM 4MLHA 3DOLA 4JEPA 1ZBLA 5LMNK 4MDAA 2YHWA 1TK5A 2WONA 3SPZA 3A5LC 3ULEA 2O8EB 4M41A 3F73A 4K25A 4DQ8A 3AVCA 3M8QA 1RDDA 3TWHA 3AVFA 1SL0A 1RT4A 3OS0A 3CCLN 4H5NA 3RSEA 3MK6A 3BF1A 4BRGA 4IO8A 3V6DA 2XHBA 5GADP 4DV0K 5HLFA 2W42A 3DI6A 4DU1A 4CGJA 3E1YA 3AA4A 2HBJA 1C0FA 4CEZA 1HLUA 2FSNA 2NRZA 4NLCA 1QSYA 3BY5A 3K9KA 2VWJA 3IMXA 3HP6A 2KQ2A 4K8XA 5SWMA 3MXMA 1JLFA 4CZMA 2I7NA 3QO9A 3TTFA 1ATRA 2VYPA 4JS5A 2I7PA 3CQXA 1L3VA 2P9IA 2KTQA 2IOCA 2HVIA 3V1RA 4DV1K 3SK3A 4H5RA 1C0GA 3LM9A 1YTUA 1JKHA 2NRHA 5FRMA 4E7JA 3L4IA 4TSXA 2JLEA 3KZBA 5HRSA 4AM7A 5C10A 2HW3A 3IG1A 3UKUB 4LFBK 4F4KA 3V4IA 4OGCA 2QWNA 1HPMA 3VN5A 2Z1IA 3M8PA 4YOWA 3KLIA 2A42A 2FLOA 4DTSA 1SL2A 2IC3A 2EHGA 3GBTA 4KTQA 4KI6A 4JV5K 2HHSA 5A2QO 3NGIA 1VSEA 3U4LA 2P9UB 5HRPA 3WXJA 4JKGA 4K43A 1IH7A 4JK9A 1GLCG 1VQ7N 3QNOA 1Z26A 4BWJA 1QQOA 3SPYA 1E4GT 4DQRA 3HVTA 1D4XA 4JYAK 4KHPK 3LAKA 1T8EA 2FBYA 4CFCA 3FZKA 5FPMA 2WUSA 4AILC 4DSJA 1HRHA 3ZSXA 2KLAA 4KI4A 1IBLK 4B8CA 3FLCO 1YAGA 1VSDA 3F9KA 5CY4A 1RDAA 5JICA 1ZBIA 4MO4A 3NH1A 4DTPA 3GDQA 4WE1A 3H3NO 4J2DA 2VGNA 5C2DA 4JD2B 1C0MA 4BQLA 4C8KA 4BR2A 2CH6A 1NG9A 4H4OA 1XNQK 2OTJN 5HRRA 4CEBA 3DXKB 1HNXK 3I55N 5HROA 2RF2A 3T7ZA 1EX4A 4F9OA 2FSKA 4B9MA 1Y97A 1N5YA 2QWLA 2ZE2A 4BY9C 4KHYA 4B3MK 4G1QA 3O4NA 1M1KO 2GUIA 1IG9A 2E1YA 2FBVA 4FO0A 1NGHA 4CFBA 4H03B 4KTZA 3HOSA 3L8BA 2F8TA 4CHYA 5EVZA 3AO2A 4BWMA 1DTQA 4BE0A 3TAEA 4Q5VA 3O9TA 5KQDA 3UB5A 4X64K 1NJYA 4ISGA 4F2RA 1BCOA 1RBTA 3C6UA 4IG0A 2D0CA 4YHHK 4H0VB 4CHOA 1REVA 4E1JA 1FKOA 1EWQA 1TKXA 2F9WA 3EKUA 1T05A 4F3TA 1NK9A 1W2BM 2DPNA 1HNZK 5AQIA 3N4PA 1CZAN 4OKEA 1X9JA 1K8KB 1SV5A 5DK5A 3MCPA 2O8EA 1DGKN 1C1AA 1TGOA 2YNGA 3TANA 4DUYK 1VQ8N 1ASWA 1VRUA 3VEXA 2A6AA 4OO1J 3EZ5A 3AY9A 4BDYA 3CYMA 4XEIA 1KLMA 3CMEN 1WAFA 3DLRA 1UOCA 5KGWA 5BPNA 3KK2A 3A5NC 3D2FB 3KVGA 3CCUN 1YHQN 3I0SA 3U9ZA 1X9SA 2QXFA 3IRXA 4HWIA 2O8BB 3O9SA 2PYLA 3G71N 2QK9A 4NXNK 3ZCMA 1CZBA 2ASMA 4IEIA 3RR7A 1V4TA 4W5QA 5KPRA 2D4WA 3QDKA 5EXWA 4O5BA 4CF8A 3OA9A 4AQYK 3QEPA 4KPYA 4M3ZA 2CH5A 4OKKA 4CIFA 4FLXA 2WTUA 4DV2K 4QS8A 4B1XB 4CK3A 2F8SA 2HOEA 4CCHA 3THXB 1NKBA 4BE1A 2E2OA 4DSEA 1NGBA 1JL1A 1U49A 3UKUA 4I9LA 4RW4A 4GVMA 2PZSA 3HSTB 1RDWX 4CJSA 4Z4IA 4CGDA 4FJLA 4A59A 3PIOL 1KQSM 2HBMA 1ITGA 1V4SA 2BGGA 1ZC6A 3AO3A 3E9OA 2NRVA 3NH2A 4DFMA 4LH5A 3V9ZA 4B9SA 4CZIA 3OTOK 2P9UA 2LSNA 5J2NA 3S3NA 1ZXOA 2HF4A 4E7KA 3T69A 4A2AA 1X9WA 1Y64A 1LW0A 4ISEA 3EY1A 3ZX3A 4BRMA 4WQ5C 4CEOA 1NKCA 3CHWA 5BPMA 4O4GA 5AQKA 1JCEA 3DM2A 3UKRB 4O8UA 2IDOA 2KZZA 1R59O 3O9RA 3M1FA 2X74A 1UA0A 1N33K 1T7PA 2XY7A 1JLEA 1S3XA 4Y1CA 4CZJA 4W5OA 2QA4N 2G8KA 2G8VA 3KHYA 5LMUK 3MN6A 2IVPA 4Y0WA 1QQCA 1N36K 4DQQA 2HHUA 5CZ1A 3ZETA 5AQRA 4O55A 1TL1A 3LM2A 1ZYQA 4JD2A 3PV8A 4CZEA 3HYFA 4F8RA 4BRFA 1QHTA 1VHXA 3DRPA 4ILHA 3ZT1A 3CJ9A 4RCHA 3OYLA 5EY4A 4BROA 2ZD1A 3CCEN 4FJMA 3DXKA 3O5BA 3K5LA 1TUYA 3CM5A 5JLHA 4WF9L 3LDOA 3U3YA 1HNVA 3VQ6A 1JCGA 2Z1JA 2ZQBA 2P51A 4CZKA 2AP1A 2E88A 2Z1GA 3PY8A 1JL2A 3SMPA 4B9VA 2Q31A 3CI5A 3B6OA 4RG8A 1NK6A 3AA2A 4OVLA 3M3ZA 3OYCA 3CFPA 1NBWA 2KHOA 2E2NA 3EE9A 4WFBL 4DR4K 3AVKA 1DEJA 4W5RA 3QESA 4IOCL 1IG8A 1U04A 4MO5A 4DR5K 1VQ6N 3K9JA 3LWLA 1DTTA 4QCLA 3AVMA 5AQNA 3DLGA 2JGUA 2HBLA 4KFBA 3AVAA 2Y1JA 3TU5A 3D6RA 2W6KA 3LDSA 1K8KA 1HJOA 5KGXA 4B3TK 3DAWA 3H1QA 4FWPA 4CJEA 1RDCA 2ZJQL 3CFOA 1RBSA 3O9UA 4EZ6A 4CEQA 4CFDA 4DLGA 1BG3A 1K73O 2H3GX 3ENBA 1YI2N 3K5MA 3EYZA 3VQAA 1L3UA 1E3MA 1L3TA 2FF3B 4B9NA 4CFAA 3AVLA
chains in the Genus database with same CATH topology
4FXDA 3SPZA 2HHWA 4M42A 3V1QA 4HVJA 3L2VA 4M41A 1S9GA 3HJFA 3F73A 4M45A 3C6TA 3HPOA 1NOZA 3AVCA 3M8QA 3ZSWA 1RDDA 3TWHA 3VQEA 3M8RA 1S5JA 1Z25A 3AVFA 3TAFA 1SL0A 1RT4A 2RN2A 3OS0A 4FZZA 4N41A 1IKWA 3PX6A 4GMJB 3V6DA 2XHBA 2YNHA 4W5NA 2X78A 5HLFA 4OKJA 4M3WA 4RW7A 3QINA 2W42A 3K5NA 3DI6A 2R7YA 5KRSA 4FLVA 4DU1A 4CGJA 4DTNA 1D9DA 3AA4A 1JLCA 5D3GA 4B9LA 4CEZA 4MFBA 2FBXA 2RKIA 1BI4A 3AVNA 1RTIA 1QSYA 1KRPA 4ZHRA 3DLBA 2ATQA 3O4QA 4XIUA 3TR8A 2VWJA 3KTQA 1S6QA 3HP6A 2VG6A 2KQ2A 1BIUA 4K8XA 5SWMA 3MXMA 1JLFA 1S1UA 4FJKA 3T3FA 3QO9A 4DTMA 1SUQA 4E0DA 4DSLA 2A1SA 3KKRA 1VSMA 3L2QA 1QE1A 4CF1A 4AHUA 1YVUA 2F96A 4JS5A 3QERA 3OYHA 3SQ0A 1KFDA 5KRTA 3S9HA 1BGXT 4Z4GA 4YNQA 1L3VA 1Q9XA 2KTQA 3KLEA 1TK0A 5EU7A 3QEXA 4LSNA 2IOCA 4AHSA 2HVIA 4AHTA 3V1RA 2I5JA 3I0RA 3A2FA 1A5XA 3QEWA 2OZSA 3ZT0A 4CEDA 4BDPA 1B9FA 1VSLA 1YTUA 1JKHA 1NOYA 3SZ2A 3OYKA 1RBUA 4DQPA 3QETA 4CEFA 5FRMA 4E7JA 3OYDA 3LAMA 1RCHA 4TSXA 2QKKA 1A5WA 2JLEA 3M8SA 1N6QA 2OYQA 3AA5X 4M3UA 4B08A 3OJUA 3TARA 4CJUA 4EZ9A 5HRSA 3BGRA 4FJNA 1KLNA 1VSJA 4C8OA 2D5RA 1BIZA 1QTMA 2B4JA 3IG1A 3VQPA 1NK8A 3PX0A 2HW3A 2P1JA 2KFZA 4Q0BA 5C42A 4F4KA 3V4IA 1SKRA 4E7IA 4OGCA 3ZSYA 1TKZA 5C24A 3ASMA 4AHVA 3VN5A 4DF4A 4FJ8A 4M3YA 1CZ9A 2Z1IA 3M8PA 4FLZA 1HQUA 3KLIA 2XY8A 2AJQA 2HNZA 1KCFA 5CYQA 5J2PA 3OYEA 3T19A 4DTSA 2DFEA 1SL2A 4B9UA 2IC3A 1I39A 1A5VA 2EHGA 3CG7A 2XO7A 1HNIA 4B8AB 1W0HA 4KTQA 4KI6A 4B3OA 4FJGA 2HHSA 4E19A 4PQUA 5K14A 3THVA 4DTUA 4FJXA 3KIOA 1BCMA 3FFIA 3NGIA 1VSEA 4FJ5A 5HRPA 1NJWA 1NK0A 4W5TA 3OYJA 3MAQA 1HJRA 2OPRA 4LH4A 3O3HA 4M3XA 1NKEA 4DSIA 1IH7A 3MEDA 4KO0A 1XC9A 1RTDA 1LWFA 5J2QA 2OPPA 3QNOA 2WOMA 4B9TA 1Z26A 3SUOA 4L8RB 4BWJA 3AVIA 1WSJA 3WNEA 2XY5A 3SUPA 4NYNA 4FM2A 3SPYA 1TAUA 4DQRA 4H4MA 4CGGA 1RT6A 3CM6A 3HVTA 1EP4A 3LP3A 4CECA 1HYVA 4DU3A 3DOKA 3RR8A 3V1OA 1XI1A 4Z4FA 3LAKA 1WSHA 2FBYA 4QAGA 5KI6A 4CFCA 1T8EA 1IO2A 1D9FA 4AILC 4DSJA 1HRHA 1LWCA 3ZSXA 3DLKA 4CF0A 3NDKA 2HVHA 2HB5A 4KI4A 4ID5A 2E4LA 3D45A 4B8CA 1VSDA 2KZMA 3F9KA 5CY4A 4DG1A 1F21A 3RRGA 1RDAA 1LAWA 4CESA 3HM9A 3SI6A 3U3GA 4AHRA 4FM1A 2DFHA 1ZBIA 4JRPA 4JS4A 4HHTA 3P83D 3NH1A 4DTPA 1EETA 5FDLA 3QEVA 1S6PA 4WE1A 4J2AA 4J2DA 4CEAA 2HHTA 3IAYA 1FKPA 4BE2A 3BDPA 1C6VA 1C0MA 4DWIA 3RRHA 3DRRA 5T7BA 1S9EA 4C8KA 5CZ2A 1FXXA 1T03A 3ISNC 4R5PA 4FLYA 4H4OA 3AVJA 3PO5A 2QKBA 5HRRA 2YKMA 1LW2A 4PA1A 3VQ4A 1KVCA 3HP9A 4CEBA 1VSFA 4RW9A 4DF8A 1S1VA 3AVBA 4DMNA 4DQIA 5HROA 4J2EA 2RF2A 1RT2A 4IFVA 3AA3A 4HUEA 1EX4A 3RMAA 2GBZA 1W9HA 4CIEA 4B9MA 1Y97A 5HBMA 1N5YA 4JRQA 4N76A 3K2PA 2ZE2A 4UQGA 4KHYA 2FC0A 4N5SA 4G1QA 3O4NA 4KV8A 1ZBUA 1D8YA 1CXQA 4CGFA 2GUIA 3ITHA 1IG9A 1YTAA 4IFYA 4C8NA 3VQCA 1WSEA 3O3FA 3NE6A 1C0UA 2FBVA 2X6SA 3OYNA 4CFBA 3SYZA 2YNFA 1U48A 4KHSA 3C95A 3MECA 2G8IA 3C94A 4PY5A 4KTZA 4DSKA 1RDBA 3KK1A 3L8BA 3NGZA 2F8TA 3SCXA 5JS1A 4CHYA 3TAQA 3AO2A 4BWMA 1DTQA 3VQBA 3OS1A 3HVRA 1NJXA 4BE0A 1RT5A 2BDPA 3HK2A 4FYDA 3TAEA 4O0IA 4K8ZA 4BDZA 4Q5VA 3ULDA 1WAJA 3NF6A 3L3UA 1NJYA 4OLAA 3LALA 3ZSRA 3ZSOA 4F2RA 1BCOA 1RBTA 3C6UA 4IG0A 5I42A 4FJHA 3ZSQA 1WSFA 2VG7A 4KKOA 4KHUA 3TAPA 2D0CA 1ZBFA 3KKSA 3AVGA 3OJSA 3NF8A 3NF7A 2PYJA 4CHOA 3PUFA 4C8LA 1REVA 4CJVA 1FKOA 1RBRA 3ZSVA 4HCBA 1TKXA 1S1TA 2RPIA 2YHBA 2FBTA 3P1GA 1T05A 3VQ9A 1NK9A 1QSLA 4F3TA 3K59A 1U47A 5DK5A 4OKEA 4CF9A 1SV5A 1JLBA 3ZT3A 3NH0A 1IKXA 1SKWA 5J2MA 2IGIA 2HMIA 4N47A 4I2PA 4Y1DA 1NK7A 3E01A 1BHLA 1EXQA 5SZTA 3SQ4A 1TV6A 3SV4A 1C1AA 1TGOA 2YNGA 3TANA 4B9NA 4ELTA 3KLFA 1ASWA 4FJ9A 1RT7A 1VRUA 2B6AA 4NYFA 4CK1A 4CJ4A 5I3UA 4I7FA 1J53A 1BQNA 1KTQA 2OPSA 3VQ7A 3KLGA 3EZ5A 4ID1A 4DTJA 1RT3A 2HHXA 3G10A 2DFFA 4O0JA 4BDYA 1FK9A 2B5JA 3CYMA 4OPJA 3OYBA 1KLMA 1LV5A 3ALYA 1WAFA 4E7LA 3DLRA 3PO4A 1WLJA 1UOCA 2KFNA 4CGHA 5KGWA 4EP4A 3LWMA 1NJZA 1HPZA 1S1WA 1TKTA 4KHQA 2O4IA 3KK2A 4LD0A 1WSIA 3U6FA 1KFSA 3LP1A 3I0SA 4IG3A 1C1BA 4CJPA 4E89A 1GOAA 2QXFA 1X9SA 1BL3A 1KVAA 2OA8A 3L2RA 3IRXA 4PWDA 3H08A 2PYLA 3ZT4A 2X6NA 2QK9A 1HYSA 4KTWA 3ZCMA 1CZBA 3AV9A 4IDKA 1YT3A 3DLEA 1C0TA 4IKFA 3RR7A 3MXIA 1Q8IA 1U4BA 5C25A 1JXBA 1VSKA 2XRIA 4W5QA 3VA3A 3SQ1A 4Z4EA 4O5BA 4CF8A 2P5GA 2DTUA 1WNSA 1D5AA 3VA0A 3HXMA 3SUNA 4E1NA 3QEPA 1JXEA 2PY5A 4KPYA 4M3ZA 3QNNA 4N56A 1UWBA 3OYGA 4E3SA 4DFJA 1NK5A 1LWEA 2BE2A 3O3GA 1JLQA 1TVRA 3RMDA 4OKKA 4JLHA 4CIFA 4FLXA 4CJTA 5JS2A 3TAGA 1ZBHA 2IAJA 4NCGA 1KVBA 1S1XA 3MEGA 4ELUA 3QEIA 1R0AA 4NCAA 1UAXA 3WNGA 4KHWA 3AVHA 5HP1A 2Z1HA 1HYZA 4CK3A 5E41A 2F8SA 1XHXA 1NK4A 4CCHA 1TAQA 5CYMA 4CK2A 4OLBA 4ELVA 1NKBA 3TAMA 4CEEA 4BE1A 1VRTA 2HHQA 1RBVA 4DSEA 1CXUA 4HUFA 1WN7A 4DS4A 3DMJA 1JL1A 3OY9A 3OYIA 4ICLA 3K58A 1U49A 3KD5E 3LPUA 4I9LA 4RW4A 4GVMA 2PZSA 5KTQA 3I8DA 3SJJA 3HSTB 3T1AA 4CJSA 4AH9A 4Z4IA 3QLHA 4QOZB 4M3TA 4CGDA 2D0AA 1VSIA 4FJJA 3IS9A 3V81A 1HQEA 3TI0A 3S3MA 3NHGA 4CHNA 3SUQA 3QIOA 2G8WA 4KHNA 1GOCA 3NCIA 1ITGA 1CLQA 2G8UA 4FJLA 1ASUA 2BGGA 5FROA 4NCBA 3AO3A 3PX4A 1J9AA 3L2UA 3NH2A 1B92A 4LSLA 2E6LA 4OJRA 4LH5A 3V9ZA 4DFMA 1J5OA 1SL1A 4B9SA 1QSSA 4KB0A 2IS3A 3SNNA 4FZYA 3DRSA 3OYFA 2LSNA 3NF9A 1RT1A 5J2NA 3S3NA 1C1CA 4FW2A 4I2QA 4E7KA 3LANA 3K57A 1B9DA 1X9WA 1G15A 1LW0A 2NUBA 3EY1A 1KSPA 2XY6A 4DFPA 1RNHA 4E1MA 1U45A 1VSHA 4CEOA 4CF2A 1NKCA 3KLHA 1RTJA 4DTXA 2A1RA 4BACA 4O4GA 3V9XA 3NBPA 2GV9A 3L3VA 3LZJA 4HUGA 3UIQA 1LAVA 3OVNA 3DM2A 2Y1IA 1DLOA 1VK0A 2IDOA 4CFAA 2VG5A 2KZZA 3HPGA 4FJ7A 1ASVA 4Z0UA 4CGIA 4DU4A 3HPHA 2X74A 1UA0A 3WNHA 3TABA 1T7PA 2VWKA 3RMCA 2XY7A 1JLEA 3LPTA 4F2SA 4Y1CA 4J2BA 1O1WA 4W5OA 4CHQA 3CQ8A 2G8KA 2G8VA 2DY4A 4F3OA 3JSMA 2OPQA 2ITGA 4KB1A 4HCCA 4KAZA 1QQCA 3VQQA 3RTVA 3V9WA 4E7HA 4DQQA 2HHUA 5CZ1A 4O55A 4RW6A 3NAEA 3QIPA 2D0BA 3AO4A 1TL1A 3LZIA 4DTOA 4CHPA 1SKSA 1ZYQA 2YHAA 4CJKA 1IKVA 3PV8A 4DLEA 3HYFA 1GOBA 4F8RA 3VQ5A 4CJWA 1K6YA 1QHTA 3DRPA 3CFRA 3ZT1A 3SQ2A 2G8FA 3KK3A 3OYLA 4FZXC 2EX3A 2YNIA 4DSFA 4I9QA 3AO5A 2ZD1A 2KW4A 4CERA 4FJMA 4ZTFA 4OGEA 1XHZA 3HL8A 3K5LA 1X1PA 2O4GA 4M3RA 1BQMA 4CJ3A 3VQDA 3CM5A 4MQ3A 3D0PA 4Z4CA 4FJIA 4KRFA 1XWLA 3U3YA 1HNVA 1BISA 3VQ6A 2HNDA 2P5OA 4CE9A 4FK4A 2Z1JA 2ZQBA 2P51A 1UA1A 2Z1GA 4YFUA 3PY8A 4OPKA 1JL2A 4EP5A 1L5UA 2OZMA 4B9VA 3K5OA 2ETJA 1QS4A 3B6OA 4RG8A 3B6PA 1NK6A 3AA2A 4OVLA 3OYCA 4DTRA 1J54A 3CFPA 4FCYA 4C8MA 2E6MA 4ZTJA 4IBNA 4CJ5A 3AVKA 4LY7A 4W5RA 1TKDA 3VQ8A 3QESA 1HMVA 3NFAA 4AHCA 1X9MA 1MU2A 3LP2A 3MEEA 4FM0A 1U04A 4FLUA 1BI4B 2YKNA 1Q9YA 3G0ZA 3V9SA 5DMRA 3ZSZA 3LWLA 4CJRA 5FRNA 3WNFA 3L2WA 1I3AA 4Z4HA 3OS2A 1DTTA 4DQSA 4QCLA 1TK8A 5HRNA 2HNYA 1TL3A 1L3SA 4KREA 3AVMA 3NGYA 4FVMA 1JLAA 3ZT2A 4DFKA 4FK0A 3DLGA 2JGUA 4PUOA 2HHVA 4KFBA 3LP0A 2Q3SA 1JLGA 3AVAA 2Y1JA 5J1EA 4H8KA 4FW1A 3KJVA 3P5JA 4HTUA 3OYAA 3S3OA 4GW6A 3OYMA 1WSGA 3LDSA 4RW8A 4FLTA 1IKYA 5KGXA 4DS5A 3V9UA 4CJEA 1RDCA 2YV0X 4CJQA 4CHZA 3SV3A 2G8HA 3HO1A 4CJFA 3JYTA 3CFOA 1RBSA 4EZ6A 4CEQA 3HT3A 4O44A 4CFDA 3DLHA 2BANA 4DLGA 3MXJA 4FLWA 1RILA 3K5MA 4FK2A 4CIGA 3EYZA 3VQAA 1L3UA 3KD1E 3RWUA 3AO1A 3DYAA 3DOLA 1EKEA 3RMBA 1ZBLA 1L3TA 4CJLA 1RTHA 1TK5A 2WONA 3AVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FXD A;  3SPZ A;  2HHW A;  4M42 A;  3V1Q A;  4HVJ A;  3L2V A;  4M41 A;  1S9G A;  3HJF A;  3F73 A;  4M45 A;  3C6T A;  3HPO A;  1NOZ A;  3AVC A;  3M8Q A;  3ZSW A;  1RDD A;  3TWH A;  3VQE A;  3M8R A;  1S5J A;  1Z25 A;  3AVF A;  3TAF A;  1SL0 A;  1RT4 A;  2RN2 A;  3OS0 A;  4FZZ A;  4N41 A;  1IKW A;  3PX6 A;  4GMJ B;  3V6D A;  2XHB A;  2YNH A;  4W5N A;  2X78 A;  5HLF A;  4OKJ A;  4M3W A;  4RW7 A;  3QIN A;  2W42 A;  3K5N A;  3DI6 A;  2R7Y A;  5KRS A;  4FLV A;  4DU1 A;  4CGJ A;  4DTN A;  1D9D A;  3AA4 A;  1JLC A;  5D3G A;  4B9L A;  4CEZ A;  4MFB A;  2FBX A;  2RKI A;  1BI4 A;  3AVN A;  1RTI A;  1QSY A;  1KRP A;  4ZHR A;  3DLB A;  2ATQ A;  3O4Q A;  4XIU A;  3TR8 A;  2VWJ A;  3KTQ A;  1S6Q A;  3HP6 A;  2VG6 A;  2KQ2 A;  1BIU A;  4K8X A;  5SWM A;  3MXM A;  1JLF A;  1S1U A;  4FJK A;  3T3F A;  3QO9 A;  4DTM A;  1SUQ A;  4E0D A;  4DSL A;  2A1S A;  3KKR A;  1VSM A;  3L2Q A;  1QE1 A;  4CF1 A;  4AHU A;  1YVU A;  2F96 A;  4JS5 A;  3QER A;  3OYH A;  3SQ0 A;  1KFD A;  5KRT A;  3S9H A;  1BGX T;  4Z4G A;  4YNQ A;  1L3V A;  1Q9X A;  2KTQ A;  3KLE A;  1TK0 A;  5EU7 A;  3QEX A;  4LSN A;  2IOC A;  4AHS A;  2HVI A;  4AHT A;  3V1R A;  2I5J A;  3I0R A;  3A2F A;  1A5X A;  3QEW A;  2OZS A;  3ZT0 A;  4CED A;  4BDP A;  1B9F A;  1VSL A;  1YTU A;  1JKH A;  1NOY A;  3SZ2 A;  3OYK A;  1RBU A;  4DQP A;  3QET A;  4CEF A;  5FRM A;  4E7J A;  3OYD A;  3LAM A;  1RCH A;  4TSX A;  2QKK A;  1A5W A;  2JLE A;  3M8S A;  1N6Q A;  2OYQ A;  3AA5 X;  4M3U A;  4B08 A;  3OJU A;  3TAR A;  4CJU A;  4EZ9 A;  5HRS A;  3BGR A;  4FJN A;  1KLN A;  1VSJ A;  4C8O A;  2D5R A;  1BIZ A;  1QTM A;  2B4J A;  3IG1 A;  3VQP A;  1NK8 A;  3PX0 A;  2HW3 A;  2P1J A;  2KFZ A;  4Q0B A;  5C42 A;  4F4K A;  3V4I A;  1SKR A;  4E7I A;  4OGC A;  3ZSY A;  1TKZ A;  5C24 A;  3ASM A;  4AHV A;  3VN5 A;  4DF4 A;  4FJ8 A;  4M3Y A;  1CZ9 A;  2Z1I A;  3M8P A;  4FLZ A;  1HQU A;  3KLI A;  2XY8 A;  2AJQ A;  2HNZ A;  1KCF A;  5CYQ A;  5J2P A;  3OYE A;  3T19 A;  4DTS A;  2DFE A;  1SL2 A;  4B9U A;  2IC3 A;  1I39 A;  1A5V A;  2EHG A;  3CG7 A;  2XO7 A;  1HNI A;  4B8A B;  1W0H A;  4KTQ A;  4KI6 A;  4B3O A;  4FJG A;  2HHS A;  4E19 A;  4PQU A;  5K14 A;  3THV A;  4DTU A;  4FJX A;  3KIO A;  1BCM A;  3FFI A;  3NGI A;  1VSE A;  4FJ5 A;  5HRP A;  1NJW A;  1NK0 A;  4W5T A;  3OYJ A;  3MAQ A;  1HJR A;  2OPR A;  4LH4 A;  3O3H A;  4M3X A;  1NKE A;  4DSI A;  1IH7 A;  3MED A;  4KO0 A;  1XC9 A;  1RTD A;  1LWF A;  5J2Q A;  2OPP A;  3QNO A;  2WOM A;  4B9T A;  1Z26 A;  3SUO A;  4L8R B;  4BWJ A;  3AVI A;  1WSJ A;  3WNE A;  2XY5 A;  3SUP A;  4NYN A;  4FM2 A;  3SPY A;  1TAU A;  4DQR A;  4H4M A;  4CGG A;  1RT6 A;  3CM6 A;  3HVT A;  1EP4 A;  3LP3 A;  4CEC A;  1HYV A;  4DU3 A;  3DOK A;  3RR8 A;  3V1O A;  1XI1 A;  4Z4F A;  3LAK A;  1WSH A;  2FBY A;  4QAG A;  5KI6 A;  4CFC A;  1T8E A;  1IO2 A;  1D9F A;  4AIL C;  4DSJ A;  1HRH A;  1LWC A;  3ZSX A;  3DLK A;  4CF0 A;  3NDK A;  2HVH A;  2HB5 A;  4KI4 A;  4ID5 A;  2E4L A;  3D45 A;  4B8C A;  1VSD A;  2KZM A;  3F9K A;  5CY4 A;  4DG1 A;  1F21 A;  3RRG A;  1RDA A;  1LAW A;  4CES A;  3HM9 A;  3SI6 A;  3U3G A;  4AHR A;  4FM1 A;  2DFH A;  1ZBI A;  4JRP A;  4JS4 A;  4HHT A;  3P83 D;  3NH1 A;  4DTP A;  1EET A;  5FDL A;  3QEV A;  1S6P A;  4WE1 A;  4J2A A;  4J2D A;  4CEA A;  2HHT A;  3IAY A;  1FKP A;  4BE2 A;  3BDP A;  1C6V A;  1C0M A;  4DWI A;  3RRH A;  3DRR A;  5T7B A;  1S9E A;  4C8K A;  5CZ2 A;  1FXX A;  1T03 A;  3ISN C;  4R5P A;  4FLY A;  4H4O A;  3AVJ A;  3PO5 A;  2QKB A;  5HRR A;  2YKM A;  1LW2 A;  4PA1 A;  3VQ4 A;  1KVC A;  3HP9 A;  4CEB A;  1VSF A;  4RW9 A;  4DF8 A;  1S1V A;  3AVB A;  4DMN A;  4DQI A;  5HRO A;  4J2E A;  2RF2 A;  1RT2 A;  4IFV A;  3AA3 A;  4HUE A;  1EX4 A;  3RMA A;  2GBZ A;  1W9H A;  4CIE A;  4B9M A;  1Y97 A;  5HBM A;  1N5Y A;  4JRQ A;  4N76 A;  3K2P A;  2ZE2 A;  4UQG A;  4KHY A;  2FC0 A;  4N5S A;  4G1Q A;  3O4N A;  4KV8 A;  1ZBU A;  1D8Y A;  1CXQ A;  4CGF A;  2GUI A;  3ITH A;  1IG9 A;  1YTA A;  4IFY A;  4C8N A;  3VQC A;  1WSE A;  3O3F A;  3NE6 A;  1C0U A;  2FBV A;  2X6S A;  3OYN A;  4CFB A;  3SYZ A;  2YNF A;  1U48 A;  4KHS A;  3C95 A;  3MEC A;  2G8I A;  3C94 A;  4PY5 A;  4KTZ A;  4DSK A;  1RDB A;  3KK1 A;  3L8B A;  3NGZ A;  2F8T A;  3SCX A;  5JS1 A;  4CHY A;  3TAQ A;  3AO2 A;  4BWM A;  1DTQ A;  3VQB A;  3OS1 A;  3HVR A;  1NJX A;  4BE0 A;  1RT5 A;  2BDP A;  3HK2 A;  4FYD A;  3TAE A;  4O0I A;  4K8Z A;  4BDZ A;  4Q5V A;  3ULD A;  1WAJ A;  3NF6 A;  3L3U A;  1NJY A;  4OLA A;  3LAL A;  3ZSR A;  3ZSO A;  4F2R A;  1BCO A;  1RBT A;  3C6U A;  4IG0 A;  5I42 A;  4FJH A;  3ZSQ A;  1WSF A;  2VG7 A;  4KKO A;  4KHU A;  3TAP A;  2D0C A;  1ZBF A;  3KKS A;  3AVG A;  3OJS A;  3NF8 A;  3NF7 A;  2PYJ A;  4CHO A;  3PUF A;  4C8L A;  1REV A;  4CJV A;  1FKO A;  1RBR A;  3ZSV A;  4HCB A;  1TKX A;  1S1T A;  2RPI A;  2YHB A;  2FBT A;  3P1G A;  1T05 A;  3VQ9 A;  1NK9 A;  1QSL A;  4F3T A;  3K59 A;  1U47 A;  5DK5 A;  4OKE A;  4CF9 A;  1SV5 A;  1JLB A;  3ZT3 A;  3NH0 A;  1IKX A;  1SKW A;  5J2M A;  2IGI A;  2HMI A;  4N47 A;  4I2P A;  4Y1D A;  1NK7 A;  3E01 A;  1BHL A;  1EXQ A;  5SZT A;  3SQ4 A;  1TV6 A;  3SV4 A;  1C1A A;  1TGO A;  2YNG A;  3TAN A;  4B9N A;  4ELT A;  3KLF A;  1ASW A;  4FJ9 A;  1RT7 A;  1VRU A;  2B6A A;  4NYF A;  4CK1 A;  4CJ4 A;  5I3U A;  4I7F A;  1J53 A;  1BQN A;  1KTQ A;  2OPS A;  3VQ7 A;  3KLG A;  3EZ5 A;  4ID1 A;  4DTJ A;  1RT3 A;  2HHX A;  3G10 A;  2DFF A;  4O0J A;  4BDY A;  1FK9 A;  2B5J A;  3CYM A;  4OPJ A;  3OYB A;  1KLM A;  1LV5 A;  3ALY A;  1WAF A;  4E7L A;  3DLR A;  3PO4 A;  1WLJ A;  1UOC A;  2KFN A;  4CGH A;  5KGW A;  4EP4 A;  3LWM A;  1NJZ A;  1HPZ A;  1S1W A;  1TKT A;  4KHQ A;  2O4I A;  3KK2 A;  4LD0 A;  1WSI A;  3U6F A;  1KFS A;  3LP1 A;  3I0S A;  4IG3 A;  1C1B A;  4CJP A;  4E89 A;  1GOA A;  2QXF A;  1X9S A;  1BL3 A;  1KVA A;  2OA8 A;  3L2R A;  3IRX A;  4PWD A;  3H08 A;  2PYL A;  3ZT4 A;  2X6N A;  2QK9 A;  1HYS A;  4KTW A;  3ZCM A;  1CZB A;  3AV9 A;  4IDK A;  1YT3 A;  3DLE A;  1C0T A;  4IKF A;  3RR7 A;  3MXI A;  1Q8I A;  1U4B A;  5C25 A;  1JXB A;  1VSK A;  2XRI A;  4W5Q A;  3VA3 A;  3SQ1 A;  4Z4E A;  4O5B A;  4CF8 A;  2P5G A;  2DTU A;  1WNS A;  1D5A A;  3VA0 A;  3HXM A;  3SUN A;  4E1N A;  3QEP A;  1JXE A;  2PY5 A;  4KPY A;  4M3Z A;  3QNN A;  4N56 A;  1UWB A;  3OYG A;  4E3S A;  4DFJ A;  1NK5 A;  1LWE A;  2BE2 A;  3O3G A;  1JLQ A;  1TVR A;  3RMD A;  4OKK A;  4JLH A;  4CIF A;  4FLX A;  4CJT A;  5JS2 A;  3TAG A;  1ZBH A;  2IAJ A;  4NCG A;  1KVB A;  1S1X A;  3MEG A;  4ELU A;  3QEI A;  1R0A A;  4NCA A;  1UAX A;  3WNG A;  4KHW A;  3AVH A;  5HP1 A;  2Z1H A;  1HYZ A;  4CK3 A;  5E41 A;  2F8S A;  1XHX A;  1NK4 A;  4CCH A;  1TAQ A;  5CYM A;  4CK2 A;  4OLB A;  4ELV A;  1NKB A;  3TAM A;  4CEE A;  4BE1 A;  1VRT A;  2HHQ A;  1RBV A;  4DSE A;  1CXU A;  4HUF A;  1WN7 A;  4DS4 A;  3DMJ A;  1JL1 A;  3OY9 A;  3OYI A;  4ICL A;  3K58 A;  1U49 A;  3KD5 E;  3LPU A;  4I9L A;  4RW4 A;  4GVM A;  2PZS A;  5KTQ A;  3I8D A;  3SJJ A;  3HST B;  3T1A A;  4CJS A;  4AH9 A;  4Z4I A;  3QLH A;  4QOZ B;  4M3T A;  4CGD A;  2D0A A;  1VSI A;  4FJJ A;  3IS9 A;  3V81 A;  1HQE A;  3TI0 A;  3S3M A;  3NHG A;  4CHN A;  3SUQ A;  3QIO A;  2G8W A;  4KHN A;  1GOC A;  3NCI A;  1ITG A;  1CLQ A;  2G8U A;  4FJL A;  1ASU A;  2BGG A;  5FRO A;  4NCB A;  3AO3 A;  3PX4 A;  1J9A A;  3L2U A;  3NH2 A;  1B92 A;  4LSL A;  2E6L A;  4OJR A;  4LH5 A;  3V9Z A;  4DFM A;  1J5O A;  1SL1 A;  4B9S A;  1QSS A;  4KB0 A;  2IS3 A;  3SNN A;  4FZY A;  3DRS A;  3OYF A;  2LSN A;  3NF9 A;  1RT1 A;  5J2N A;  3S3N A;  1C1C A;  4FW2 A;  4I2Q A;  4E7K A;  3LAN A;  3K57 A;  1B9D A;  1X9W A;  1G15 A;  1LW0 A;  2NUB A;  3EY1 A;  1KSP A;  2XY6 A;  4DFP A;  1RNH A;  4E1M A;  1U45 A;  1VSH A;  4CEO A;  4CF2 A;  1NKC A;  3KLH A;  1RTJ A;  4DTX A;  2A1R A;  4BAC A;  4O4G A;  3V9X A;  3NBP A;  2GV9 A;  3L3V A;  3LZJ A;  4HUG A;  3UIQ A;  1LAV A;  3OVN A;  3DM2 A;  2Y1I A;  1DLO A;  1VK0 A;  2IDO A;  4CFA A;  2VG5 A;  2KZZ A;  3HPG A;  4FJ7 A;  1ASV A;  4Z0U A;  4CGI A;  4DU4 A;  3HPH A;  2X74 A;  1UA0 A;  3WNH A;  3TAB A;  1T7P A;  2VWK A;  3RMC A;  2XY7 A;  1JLE A;  3LPT A;  4F2S A;  4Y1C A;  4J2B A;  1O1W A;  4W5O A;  4CHQ A;  3CQ8 A;  2G8K A;  2G8V A;  2DY4 A;  4F3O A;  3JSM A;  2OPQ A;  2ITG A;  4KB1 A;  4HCC A;  4KAZ A;  1QQC A;  3VQQ A;  3RTV A;  3V9W A;  4E7H A;  4DQQ A;  2HHU A;  5CZ1 A;  4O55 A;  4RW6 A;  3NAE A;  3QIP A;  2D0B A;  3AO4 A;  1TL1 A;  3LZI A;  4DTO A;  4CHP A;  1SKS A;  1ZYQ A;  2YHA A;  4CJK A;  1IKV A;  3PV8 A;  4DLE A;  3HYF A;  1GOB A;  4F8R A;  3VQ5 A;  4CJW A;  1K6Y A;  1QHT A;  3DRP A;  3CFR A;  3ZT1 A;  3SQ2 A;  2G8F A;  3KK3 A;  3OYL A;  4FZX C;  2EX3 A;  2YNI A;  4DSF A;  4I9Q A;  3AO5 A;  2ZD1 A;  2KW4 A;  4CER A;  4FJM A;  4ZTF A;  4OGE A;  1XHZ A;  3HL8 A;  3K5L A;  1X1P A;  2O4G A;  4M3R A;  1BQM A;  4CJ3 A;  3VQD A;  3CM5 A;  4MQ3 A;  3D0P A;  4Z4C A;  4FJI A;  4KRF A;  1XWL A;  3U3Y A;  1HNV A;  1BIS A;  3VQ6 A;  2HND A;  2P5O A;  4CE9 A;  4FK4 A;  2Z1J A;  2ZQB A;  2P51 A;  1UA1 A;  2Z1G A;  4YFU A;  3PY8 A;  4OPK A;  1JL2 A;  4EP5 A;  1L5U A;  2OZM A;  4B9V A;  3K5O A;  2ETJ A;  1QS4 A;  3B6O A;  4RG8 A;  3B6P A;  1NK6 A;  3AA2 A;  4OVL A;  3OYC A;  4DTR A;  1J54 A;  3CFP A;  4FCY A;  4C8M A;  2E6M A;  4ZTJ A;  4IBN A;  4CJ5 A;  3AVK A;  4LY7 A;  4W5R A;  1TKD A;  3VQ8 A;  3QES A;  1HMV A;  3NFA A;  4AHC A;  1X9M A;  1MU2 A;  3LP2 A;  3MEE A;  4FM0 A;  1U04 A;  4FLU A;  1BI4 B;  2YKN A;  1Q9Y A;  3G0Z A;  3V9S A;  5DMR A;  3ZSZ A;  3LWL A;  4CJR A;  5FRN A;  3WNF A;  3L2W A;  1I3A A;  4Z4H A;  3OS2 A;  1DTT A;  4DQS A;  4QCL A;  1TK8 A;  5HRN A;  2HNY A;  1TL3 A;  1L3S A;  4KRE A;  3AVM A;  3NGY A;  4FVM A;  1JLA A;  3ZT2 A;  4DFK A;  4FK0 A;  3DLG A;  2JGU A;  4PUO A;  2HHV A;  4KFB A;  3LP0 A;  2Q3S A;  1JLG A;  3AVA A;  2Y1J A;  5J1E A;  4H8K A;  4FW1 A;  3KJV A;  3P5J A;  4HTU A;  3OYA A;  3S3O A;  4GW6 A;  3OYM A;  1WSG A;  3LDS A;  4RW8 A;  4FLT A;  1IKY A;  5KGX A;  4DS5 A;  3V9U A;  4CJE A;  1RDC A;  2YV0 X;  4CJQ A;  4CHZ A;  3SV3 A;  2G8H A;  3HO1 A;  4CJF A;  3JYT A;  3CFO A;  1RBS A;  4EZ6 A;  4CEQ A;  3HT3 A;  4O44 A;  4CFD A;  3DLH A;  2BAN A;  4DLG A;  3MXJ A;  4FLW A;  1RIL A;  3K5M A;  4FK2 A;  4CIG A;  3EYZ A;  3VQA A;  1L3U A;  3KD1 E;  3RWU A;  3AO1 A;  3DYA A;  3DOL A;  1EKE A;  3RMB A;  1ZBL A;  1L3T A;  4CJL A;  1RTH A;  1TK5 A;  2WON A;  3AVL A; 
#chains in the Genus database with same CATH topology
 4FXD A;  4M42 A;  3V1Q A;  3HPO A;  4A62 A;  3D2F A;  4QS9 A;  1W7A A;  3VQE A;  4B1Z A;  3M8R A;  3TAF A;  2RN2 A;  3ID6 A;  4N41 A;  1IKW A;  4NXM K;  2O8B A;  2X78 A;  4OKJ A;  1VQO N;  3FZM A;  5KRS A;  2R7Y A;  1T44 A;  4JI7 K;  4CBW A;  2RKI A;  3AVN A;  1VQ4 N;  1KRP A;  3DLB A;  3O4Q A;  3TR8 A;  1S6Q A;  2VG6 A;  4MDB A;  4U7B A;  4FJK A;  3T3F A;  4JHD B;  3KKR A;  3L2Q A;  1QE1 A;  2F96 A;  1VQK N;  5GAG P;  5AZI B;  3S9H A;  2CGL A;  4YNQ A;  2EWS A;  3C6A A;  5FPN A;  3KLE A;  5EU7 A;  4LSN A;  3THX A;  3A2F A;  1A5X A;  1QHA A;  3ZT0 A;  1N8R O;  1VSL A;  1OKJ A;  3AGR A;  1FJG K;  3CCS N;  2UXC K;  4DR2 K;  1RBU A;  3QET A;  4MLE A;  4EAH D;  3OYD A;  2AA4 A;  5JVG L;  4CBX A;  1J5E K;  3M8S A;  5EOY A;  3TAR A;  3A0I X;  1KLN A;  1VSJ A;  4C8O A;  2B4J A;  3PX0 A;  2KFZ A;  4Q0B A;  5C42 A;  1TUU A;  1SKR A;  5BRH A;  3ZSY A;  1TKZ A;  5C24 A;  4M3Y A;  1S22 A;  1OVQ A;  1KAZ A;  1M90 O;  1KCF A;  5J2P A;  1QQN A;  4B9U A;  4HTL A;  1A5V A;  1WUA A;  4AF1 A;  2XO7 A;  1HNI A;  4B3O A;  1QVF M;  4PQU A;  3WXK A;  3HOT A;  1JJ2 M;  3P4I A;  1NJW A;  4FOE A;  3UKR A;  4W5T A;  3OYJ A;  3VEY A;  4A5B A;  3O3H A;  4DSI A;  4KO0 A;  3FFK B;  4AM6 A;  2P9P B;  2F4V K;  4PL7 A;  1Q7Y O;  5J2Q A;  2WOM A;  3O8M A;  4L8R B;  2QWR A;  3WNE A;  3AVI A;  2XY5 A;  3BZK A;  3A8Y A;  3CM6 A;  3C0B A;  4CEC A;  3KWG A;  5IWA K;  2IVN A;  4CZH A;  4DU3 A;  2GWJ A;  2NRW A;  5AQO A;  3RR8 A;  3V1O A;  3J7Z O;  1XI1 A;  5KI6 A;  3THY B;  4YDU C;  3VEZ A;  1IO2 A;  1D9F A;  4CF0 A;  4CZF A;  1GLE G;  3IKM A;  4JI4 K;  3EE8 A;  2KZM A;  4DG1 A;  1HNW K;  3RRG A;  1LAW A;  4CES A;  5KQ8 A;  2D1K A;  3C65 A;  3VEW A;  1EET A;  4FWK A;  2HHT A;  3IAY A;  3DRR A;  1BUP A;  5E26 A;  1FXX A;  1T03 A;  3HM8 A;  4R5P A;  1HR0 K;  2NLX A;  2QKB A;  1LW2 A;  3QML A;  4DF8 A;  3GOI A;  3ZX2 A;  4DQI A;  4XH1 A;  4J2E A;  4LF9 K;  2QM1 A;  5LL6 Z;  3MN5 A;  1NGJ A;  1T6D A;  3J81 O;  2FC0 A;  4N5S A;  4DUZ K;  3E9P A;  4CGF A;  1OVY A;  3VQC A;  4DFJ A;  3NE6 A;  3W3D A;  1SKW A;  1Z05 A;  2X6S A;  1XNR K;  3MX5 A;  1RGI A;  1U48 A;  3T1H K;  4KHS A;  2G8I A;  5AQW A;  3TSP A;  4PY5 A;  4DSK A;  1VQ9 N;  3F2K A;  4BQZ A;  4C1N I;  3AAQ A;  3O1W A;  3OS1 A;  1NJX A;  1RT5 A;  3SJH A;  5LY3 A;  5JMV A;  5KPT A;  1WAJ A;  3L3U A;  4ILG B;  1HKG A;  4OLA A;  3ZSR A;  3ZSO A;  3S41 A;  1WSF A;  4KHU A;  3KKS A;  1GLD G;  2E8A A;  4GVE A;  5C12 A;  4H0T B;  5EX5 A;  1S1T A;  2RPI A;  4CZG A;  2FBT A;  3K59 A;  4CI6 A;  3ZYY X;  2IGI A;  4I2P A;  3MWP A;  4Y1D A;  5GIN A;  3E01 A;  4LF7 K;  3SQ4 A;  2QTD A;  1RDU A;  3KLF A;  1BU6 O;  1RT7 A;  4CK1 A;  4JKF A;  1J53 A;  1BQN A;  1KTQ A;  3G4S N;  3KLG A;  2O8D B;  4ID1 A;  3G10 A;  2B5J A;  3E9L A;  2HHH K;  3ALY A;  3H46 O;  4EP4 A;  5HOO A;  3WXL A;  1TKT A;  2NRT A;  4BRE A;  4IG3 A;  3T1Y K;  2OA8 A;  1KVA A;  2YJF A;  3L2R A;  4DV3 K;  3EEQ A;  3H08 A;  2X6N A;  1ATS A;  3H3O B;  4BRA A;  3HZ6 A;  2QWP A;  3MXI A;  2P9S B;  4JHD A;  4Z4E A;  3J7Y P;  2P5G A;  4V19 S;  1WNS A;  5AZI A;  3HXM A;  4YOR A;  2E2P A;  4N56 A;  1UWB A;  4EIA A;  4EFH A;  3O3G A;  3L6Q A;  3KK7 A;  4CJT A;  4FL9 A;  1XMO K;  1ZBH A;  3UE5 A;  4JKC A;  3QEI A;  2BTF A;  4KHW A;  5HP1 A;  2Z1H A;  1XHX A;  3ZET B;  3ZEU B;  4I6M B;  4CK2 A;  4OLB A;  3VF2 A;  4ELV A;  4CD3 A;  4CEE A;  1NGF A;  4YOU A;  3MDQ A;  3G6E N;  1WN7 A;  4DS4 A;  4GNI A;  3OY9 A;  4ICL A;  3OYI A;  3K58 A;  1KC8 O;  3SJJ A;  5AQF A;  4AH9 A;  4DCH A;  3QLH A;  2D0A A;  2NNW A;  3V81 A;  4IDH A;  1NM1 A;  3NHG A;  3QIO A;  4H0O A;  4DV6 K;  3NCI A;  4BRD A;  5TKY A;  5FRO A;  3PX4 A;  5CHI A;  4LSL A;  2E6L A;  1QSS A;  3TTD A;  3SNN A;  4FZY A;  4DR1 K;  3OYF A;  4FW2 A;  1RFQ A;  2P9P A;  1B9D A;  1G15 A;  4CJ7 A;  1N32 K;  5M1K A;  1KSP A;  2XY6 A;  4DFP A;  1RNH A;  4E1M A;  1U45 A;  4BAC A;  3LDN A;  3NBP A;  3LZJ A;  3ENO A;  3OVN A;  4X62 K;  1VK0 A;  3HPG A;  5AQS A;  4JAX A;  4Z0U A;  3THY A;  4UY8 O;  1OH5 A;  3TAB A;  4FWL A;  2UU9 K;  4J2B A;  4PKH A;  4BC5 A;  2ITM A;  4KB1 A;  3AGK A;  4KAZ A;  3V9W A;  3RTV A;  2Q0R A;  3OHR A;  4B1V A;  5F0X A;  3LZI A;  1SKS A;  4CJK A;  2GWK A;  3VQ5 A;  5JVH L;  2PFU A;  2EX3 A;  2YNI A;  5GAH P;  4DSF A;  3AO5 A;  2KW4 A;  1J5O A;  2O4G A;  4CJ3 A;  4MQ3 A;  4KRF A;  4DR7 K;  2P5O A;  4FK4 A;  1YUW A;  1ATN A;  4CZL A;  4OPK A;  2OZM A;  3FGU A;  3B6P A;  3MN7 A;  4DTR A;  4FCY A;  3W0L A;  2UUB K;  5FPE A;  3PSI A;  2A41 A;  3U9D A;  3LP2 A;  3CC2 N;  4FM0 A;  4FLU A;  2YKN A;  3SLC A;  3GG4 A;  5DMR A;  3ZSZ A;  4FVU A;  2D0O A;  5FRN A;  3CET A;  3WNF A;  4IO9 L;  3CJA A;  4OX9 K;  4KRE A;  3NGY A;  5AJ3 K;  5AQU A;  3LP0 A;  2Q3S A;  5J1E A;  1NGG A;  4FW1 A;  5ADX H;  4PL8 A;  1Z6R A;  2CGJ A;  5LJV A;  2O8F B;  3OYM A;  5AQX A;  4RW8 A;  4FLT A;  1IKY A;  4DS5 A;  4JI2 K;  3V9U A;  4R79 A;  3L4Q A;  3SV3 A;  3F9M A;  1NNE A;  1Q18 A;  3HO1 A;  3JYT A;  5BPL A;  3HT3 A;  4O44 A;  3DLH A;  3MXJ A;  2O8D A;  1RIL A;  3RVC A;  4FK2 A;  4CIG A;  3RWU A;  3AO1 A;  3VET A;  1MDU B;  3OYN A;  4CD1 A;  5ADX A;  2HHW A;  4HVJ A;  2ASP A;  1S9G A;  1YXQ A;  4JN4 A;  1NOZ A;  3ZSW A;  4FWS A;  1Q81 O;  4BRQ A;  4FZZ A;  1P8Z A;  4GMJ B;  4M7X A;  3QB0 A;  2YNH A;  4W5N A;  3Q7C A;  5AQG A;  4X65 K;  4RW7 A;  4PKI A;  3K5N A;  4FLV A;  2P9S A;  4DTN A;  4FSV A;  2ZGY A;  1D9D A;  2UXD K;  1JLC A;  4MFB A;  1NGC A;  2FBX A;  5ELZ A;  1BI4 A;  4BC4 A;  1RTI A;  3CMA N;  3H1V X;  4ZHR A;  3H45 C;  2ATQ A;  3CCR N;  1S1U A;  5F2R A;  3VGK A;  1YJN N;  2YJE A;  4B9Q A;  2A3Z A;  1HKC A;  3O6W A;  3QER A;  3SQ0 A;  2YHY A;  5KRT A;  1N34 K;  3ZEU A;  4BC3 A;  4I6M A;  4AHS A;  4AHT A;  3I33 A;  3JS6 A;  2OZS A;  5TKW A;  4BDP A;  1B9F A;  2D0P A;  2NRX A;  5C15 A;  2ZJP L;  4DQP A;  4BR5 A;  2HBK A;  3LAM A;  1NMD A;  1RCH A;  4BRL A;  2QKK A;  4M3U A;  5C0Y A;  3OJU A;  4CJU A;  3ZLJ A;  4L3Q A;  4EZ9 A;  1DT9 A;  1P90 A;  1BIZ A;  1QTM A;  3VQP A;  2P1J A;  4LF8 K;  3WXI A;  4E7I A;  1BOT O;  4AHV A;  4GV9 A;  4FJ8 A;  1K8A O;  4B1W B;  1BWF O;  1HQU A;  4BRH A;  2AJQ A;  1G99 A;  3OYE A;  3T19 A;  2QI2 A;  3O80 A;  3CG7 A;  3VOV A;  5IT9 O;  4E19 A;  5K14 A;  2VWB A;  3THV A;  4FJX A;  3KIO A;  3JAM O;  2ZGZ A;  1NK0 A;  3MAQ A;  1HJR A;  4LH4 A;  4M3X A;  1X3M A;  1NKE A;  1U6Z A;  1RTD A;  1LWF A;  4WFA L;  2OPP A;  4B9T A;  3SUO A;  4GY2 B;  3SUP A;  1TAU A;  4CGG A;  1ILY A;  1EP4 A;  3LP3 A;  1W97 L;  4ISF A;  3P31 A;  2YCH A;  4WQ5 A;  3CCM N;  1NU0 A;  2QEX N;  1VQN N;  1LWC A;  3NDK A;  3DLK A;  4GKJ K;  3OBY A;  2HB5 A;  4ID5 A;  3D45 A;  1F21 A;  5AQH A;  4PKG A;  4NO7 A;  5M1N A;  3HM9 A;  1YIJ N;  2DFH A;  4JS4 A;  4HHT A;  1BO5 O;  5E84 A;  1NWK A;  4BR7 A;  5FDL A;  1S6P A;  2IVO A;  4CEA A;  1FKP A;  4DWI A;  1S9E A;  1OH7 A;  3ISN C;  3PO5 A;  2YKM A;  4RW9 A;  1S1V A;  4DMN A;  1XMQ K;  4IFV A;  4Z94 A;  3AA3 A;  4HUE A;  2GBZ A;  4CIE A;  4N76 A;  4JK8 A;  3P38 A;  1ZBU A;  1D8Y A;  1CXQ A;  3CJB A;  2Q36 A;  3CCV N;  1NGE A;  1WSE A;  3SYZ A;  1C0U A;  2YNF A;  3A5M C;  1GLJ O;  3MEC A;  3VF4 A;  3VEN A;  3KK1 A;  1VQL N;  5JS1 A;  2Q2R A;  3TAQ A;  3VPZ A;  2BDP A;  2O8F A;  4K8Z A;  4BDZ A;  4QS7 A;  2ZWH A;  5GIO A;  5AQJ A;  3N4Q A;  4JI6 K;  3LAL A;  2YX6 A;  3VEV A;  2FXU A;  3ZSQ A;  5I42 A;  3HTV A;  4IEE A;  3TAP A;  3E66 A;  3OJS A;  3NF7 A;  3P39 A;  3FE1 A;  3PUF A;  5AQP A;  3SAG A;  4C8L A;  4CJV A;  3ZSV A;  4HCB A;  2W41 A;  2YHB A;  1QSL A;  4CF9 A;  1JLB A;  3ZT3 A;  4DHY A;  3JXU A;  2GTD A;  1ESV A;  3VGL A;  1KAX A;  5BRF A;  2P9K B;  1NK7 A;  5I9E B;  1BHL A;  1EXQ A;  5SZT A;  1TV6 A;  3FR0 A;  4ELT A;  4CJ4 A;  4KH5 A;  2OPS A;  4DTJ A;  1RT3 A;  4O0J A;  1FK9 A;  1MA9 B;  3OYB A;  4BG8 A;  2QWQ A;  4BGA A;  4E7L A;  2KFN A;  3LWM A;  3TPQ A;  2O4I A;  4LF4 K;  3O4W A;  3M6G A;  1WSI A;  2A40 A;  1C1B A;  4CJP A;  1GOA A;  1BL3 A;  3OBW A;  5AQM A;  3ZT4 A;  3LDP A;  4H5W A;  4KTW A;  3AV9 A;  3DLE A;  4BG9 A;  1C0T A;  4FWN A;  4IKF A;  1Q8I A;  1U4B A;  1VSK A;  3VA3 A;  4BRN A;  2DTU A;  1MWM A;  3M5R A;  3C7N B;  3VA0 A;  3MMV A;  3TSU A;  4C1N K;  2PY5 A;  4BRP A;  3QNN A;  3OYG A;  4E3S A;  2YI1 A;  1LWE A;  3BEX A;  4GV3 A;  1JLQ A;  1TVR A;  5BN8 A;  3TAG A;  4B3S K;  2FF6 A;  4NCG A;  1S1X A;  3MEG A;  4BVO A;  2Q0U A;  4ELU A;  1SAZ A;  1T6C A;  1UAX A;  3WNG A;  5E41 A;  1NK4 A;  1TAQ A;  5CYM A;  3DLL L;  4IJA A;  4JI5 K;  3TAM A;  2HHQ A;  2P9L B;  1RBV A;  1CXU A;  4HUF A;  4KH4 A;  3DMJ A;  5M1F A;  3CF5 L;  3LPU A;  4IOX A;  1WBB A;  5KTQ A;  1QQM A;  3HBT A;  4QOZ B;  3T1A A;  3IS9 A;  3CJC A;  2V52 B;  3S3M A;  2G8W A;  4CHN A;  4KHN A;  2FSJ A;  4B1U B;  3GL1 A;  1GOC A;  3VGM A;  1CLQ A;  3D7E O;  4NCB A;  1NGA A;  4NB4 A;  1J9A A;  3L2U A;  1B92 A;  3NMU A;  4IWV A;  2IS3 A;  4FPB A;  3NF9 A;  1RT1 A;  4I2Q A;  2UUC K;  3LAN A;  3PSF A;  4IXC A;  3K57 A;  3BZC A;  1X3N A;  3R9P A;  3WUH A;  5CR4 A;  3AAP A;  1VSH A;  4CF2 A;  2VGM A;  4DTX A;  2A1R A;  3UIQ A;  2GV9 A;  4XH4 A;  1LCU A;  3WEE A;  1ASV A;  4DU4 A;  3HPH A;  2PAV A;  1SQK A;  3LPT A;  3CC7 N;  4F2S A;  4FWM A;  1O1W A;  3HI0 A;  4CHQ A;  3CQ8 A;  2DY4 A;  1QZ5 A;  4F3O A;  3JSM A;  2VCP A;  2OPQ A;  4BR4 A;  4HCC A;  3ENH A;  3O9Q A;  3VQQ A;  3EZW A;  1E4F T;  5AQL A;  3FZH A;  1ZBS A;  4RW6 A;  3NAE A;  4G9Z A;  4C23 A;  4CHP A;  4YDU A;  4DLE A;  1K6Y A;  2G8F A;  3DJC A;  4IFE A;  3U8X A;  4JI3 K;  4FZX C;  1LOT B;  1NJI O;  4JI8 K;  2IIR A;  4K42 A;  4I9Q A;  4CER A;  3CC4 N;  4ZTF A;  5FPD A;  1XHZ A;  3HL8 A;  4WQ4 C;  3D0P A;  4FJI A;  2GEM A;  3B8A X;  1SS6 A;  1BIS A;  5BR9 A;  1UA1 A;  1OH8 A;  2YHX A;  1OH6 A;  3QBW A;  3TSQ A;  4EP5 A;  3DXM B;  3K5O A;  2ETJ A;  4RTF D;  4JKE A;  4YOX A;  4LFA K;  3WXM B;  3IDH A;  4ZTJ A;  1EWR A;  4JKB A;  3THW B;  1HX1 A;  4AHC A;  5GIP A;  1YJW N;  2CGK A;  3MEE A;  2BH1 A;  1Q9Y A;  1BI4 B;  3MN9 A;  4BGB A;  3V9S A;  5CE3 A;  2GX9 A;  4Z4H A;  3OS2 A;  1NMN A;  4DQS A;  1TK8 A;  1L3S A;  4FVM A;  4DFK A;  1JLA A;  4FK0 A;  4PUO A;  3SAF A;  2QWO A;  1JLG A;  4BRK A;  4H8K A;  3KJV A;  4DV4 K;  1MWK A;  1YVN A;  5AQV A;  3OYA A;  3I8B A;  2F9T A;  1WSG A;  4YOV A;  5GAE P;  1VAZ A;  2P9K A;  2YV0 X;  2G8H A;  2KKZ A;  3WT0 A;  4A61 A;  2BAN A;  2QW9 A;  4FLW A;  2JWL A;  1IJJ A;  3KD1 E;  3DYA A;  4DV5 K;  1EKE A;  3RMB A;  4CJL A;  1RTH A;  2HST A;  4OPA A;  4CW7 B;  3L2V A;  2QWM A;  1YJ9 N;  3L0Q A;  3HJF A;  1EQY A;  4M45 A;  3C6T A;  5AR0 A;  1S5J A;  1Z25 A;  1HKB A;  3QBX A;  3PX6 A;  2V51 B;  3O1B A;  2Q1N A;  4WCE L;  4M3W A;  4OPH A;  3QIN A;  1NGI A;  1TYQ B;  4WQ4 A;  4IOA L;  5D3G A;  4B9L A;  4WYB A;  4XH5 A;  2ZJR L;  4B3R K;  3C7N A;  3ID8 A;  1GLL O;  4XIU A;  3KTQ A;  3D2E B;  1GLA G;  1BIU A;  4DTM A;  4LFC K;  1YF5 L;  1SUQ A;  4E0D A;  4DSL A;  2A1S A;  3LDQ A;  1VSM A;  4CF1 A;  4AHU A;  1YVU A;  1YIT N;  3CIP A;  3WQT A;  3OYH A;  4EHU A;  1KFD A;  1HUX A;  4Z4G A;  1BGX T;  1Q9X A;  2W6L A;  1U2V B;  1TK0 A;  3QEX A;  2P9L A;  2I5J A;  3I0R A;  3QEW A;  2UYT A;  4CED A;  4NLB A;  1WB9 A;  3CCQ N;  3GE1 A;  1NOY A;  3SZ2 A;  4DR6 K;  3OYK A;  4CEF A;  3QIC A;  4JKA A;  4JI1 K;  1A5W A;  2OYQ A;  1N6Q A;  4M63 C;  3AA5 X;  3C6H A;  4B08 A;  4DR3 K;  1S72 N;  4FJN A;  3BGR A;  2D5R A;  3A5O C;  4H0X B;  1KXP A;  1NK8 A;  3IUC A;  3G25 A;  5AZJ B;  3H6E A;  3ASM A;  4DF4 A;  1CZ9 A;  3MCA B;  4FLZ A;  2XY8 A;  2HNZ A;  3BP8 A;  5CYQ A;  2DFE A;  2OTL N;  1I39 A;  4B8A B;  1W0H A;  4FJG A;  2NRR A;  4DTU A;  1BCM A;  3FFI A;  4FJ5 A;  3WQU A;  5BRE A;  2OPR A;  5H1S Q;  3MED A;  4U67 L;  2P9N B;  1XC9 A;  2A5X A;  1QVG M;  1H1V A;  5JLF A;  1WSJ A;  4K41 A;  4NYN A;  4FM2 A;  4LF5 K;  4H4M A;  1RT6 A;  2HF3 A;  3ATU A;  2ASO A;  2UUA K;  1HYV A;  3MWT A;  3DOK A;  2E5L K;  3VTH A;  1WSH A;  4QAG A;  3AAR A;  4CBU A;  2O8C B;  3CPE A;  2HVH A;  2V7Z A;  3CD6 N;  2E4L A;  2BUP A;  4DB3 A;  4FOI A;  5BR8 K;  3SI6 A;  3U3G A;  4AHR A;  5M1P A;  4FM1 A;  1Q86 O;  1BA1 A;  4JRP A;  3P83 D;  2V7Y A;  3QEV A;  4J2A A;  4BE2 A;  2WFB A;  4JKD A;  1GLF O;  1C6V A;  4JNE A;  2F7T A;  3BDP A;  3RRH A;  3MX2 A;  5T7B A;  5CZ2 A;  4FWO A;  1IBM K;  3DWL A;  3DXM A;  5BN9 A;  4FLY A;  3AVJ A;  4X66 K;  4ILJ A;  4PA1 A;  3VQ4 A;  4DV7 K;  1KVC A;  3HP9 A;  1VSF A;  3AVB A;  4JK7 A;  1T3V A;  5AQT A;  1RT2 A;  5KPZ A;  3THW A;  5B8H A;  2WBN A;  3RMA A;  2ZF5 O;  1W9H A;  5HBM A;  4JRQ A;  1BDG A;  3K2P A;  3J80 O;  4UQG A;  4WFN L;  1XQS C;  1JCF A;  4KV8 A;  4IJN A;  3ITH A;  1YTA A;  4IFY A;  4C8N A;  1XUP O;  2WC9 A;  3O3F A;  3EKS A;  3C95 A;  3EL2 A;  1J6Z A;  3C94 A;  3K0S A;  1RDB A;  3NGZ A;  3SCX A;  3VQB A;  5DM6 L;  3I56 N;  3HVR A;  3HK2 A;  4FYD A;  3CJ7 A;  3J8A A;  4O0I A;  4H0Y B;  3ULD A;  3NF6 A;  1SZ2 A;  3VMF B;  4FJH A;  3SMS A;  4A57 A;  2VG7 A;  4KKO A;  1ZBF A;  3AVG A;  3NF8 A;  2PYJ A;  1RBR A;  4H0P A;  3SBT A;  1QZ6 A;  3P1G A;  3VQ9 A;  1U47 A;  3CJ1 A;  3NH0 A;  1IKX A;  5J2M A;  1WOQ A;  2HMI A;  4N47 A;  3SV4 A;  2UXB K;  4FJ9 A;  2B6A A;  4NYF A;  5I3U A;  4I7F A;  3VQ7 A;  4K0K K;  2HHX A;  1IBK K;  3PLA A;  2DFF A;  4OPJ A;  1KAY A;  1LV5 A;  2E20 A;  3CCJ N;  3VES A;  3PO4 A;  1WLJ A;  1TYQ A;  3ULE B;  4CGH A;  1NJZ A;  1HPZ A;  1S1W A;  4A5A A;  4KHQ A;  4LD0 A;  3CER A;  2Q97 A;  3U6F A;  1KFS A;  4A2B A;  3LP1 A;  5BRD A;  4E89 A;  3RSE B;  4PWD A;  4IZ9 A;  3D2E A;  1HYS A;  3SAH A;  4IDK A;  1YT3 A;  1I94 K;  2VQF K;  1NLV A;  2GEL A;  5C25 A;  1JXB A;  2XRI A;  3SQ1 A;  3Q7B A;  1VQ5 N;  4B1Y B;  3WEE B;  1D5A A;  3CQY A;  5C2F A;  3CPW M;  3SUN A;  4E1N A;  1DKG D;  1JXE A;  1U2V A;  1BA0 A;  2QXL A;  4PHT X;  1FW6 A;  1NK5 A;  2BE2 A;  3RMD A;  4JLH A;  5JS2 A;  3IFR A;  2IAJ A;  1IV0 A;  1KVB A;  3KWI A;  5AQY A;  4EHT A;  1R0A A;  4NCA A;  3AVH A;  1HYZ A;  3TTC A;  3PIP L;  2W40 A;  2P9I B;  3FZF A;  5F1X A;  3OW2 M;  1WBD A;  3HSC A;  1VRT A;  4BC2 A;  2VQE K;  3KD5 E;  4KH6 A;  3I8D A;  4BRI A;  4M3T A;  4Z4F A;  1VSI A;  4FJJ A;  3ZX0 A;  1HQE A;  5AZJ A;  3TI0 A;  3SUQ A;  2PBD A;  4M7Y A;  2G8U A;  1ASU A;  3R3L A;  4BVP A;  4FPA A;  5DM7 L;  5M1Q A;  3O08 A;  4OJR A;  1GLB G;  1SL1 A;  4KB0 A;  2GUP A;  3BUZ B;  5FLX O;  3DRS A;  4YOT A;  1C1C A;  3VF6 A;  3BF3 A;  4LF6 K;  1O13 A;  4O8K A;  2P9N A;  1VQM N;  2NUB A;  2RHK A;  2JWK A;  4H5T A;  4LC9 B;  3KLH A;  1RTJ A;  1NGD A;  3V9X A;  4YY3 K;  3L3V A;  3EO3 A;  4HUG A;  1LAV A;  2J4R A;  3QFP A;  2Y1I A;  1DLO A;  2VG5 A;  4JKG B;  4FJ7 A;  4CGI A;  3R8E A;  2O8C A;  3LDL A;  3WNH A;  2VWK A;  3RMC A;  4BR9 A;  3QFU A;  2OCE A;  2ITG A;  1EO1 A;  2E1Z A;  2RE2 A;  4E7H A;  3F5T A;  4DTO A;  3QIP A;  2D0B A;  3AO4 A;  2YHA A;  3R6M A;  1IKV A;  1GOB A;  3LL3 A;  4CJW A;  3CFR A;  3SQ2 A;  3KK3 A;  4GKK K;  4OGE A;  1X1P A;  4M3R A;  1BQM A;  3VQD A;  1K9M O;  4Z4C A;  1XWL A;  4J8F A;  2HND A;  4JKH A;  4CE9 A;  4JI0 K;  3EN9 A;  2E2Q A;  4YFU A;  3HRG A;  1L5U A;  5MLC Q;  3ATV A;  4YOY A;  1QS4 A;  1XC3 A;  2OAN A;  3R1X A;  1J54 A;  5AQQ A;  4FWQ A;  4C8M A;  2E6M A;  4O5F A;  3NVM A;  4IBN A;  2NZT A;  4CJ5 A;  4LY7 A;  5HL7 L;  4H5V A;  1TKD A;  3J7A P;  3VQ8 A;  1HMV A;  3NFA A;  4GV6 A;  1X9M A;  1VQP N;  1MU2 A;  4KBO A;  4FWR A;  3VEO A;  4CVN E;  2HMP A;  3G0Z A;  1Q82 O;  4CJR A;  3L2W A;  1I3A A;  5AFU H;  3VTI A;  5HRN A;  2HNY A;  1TL3 A;  3NVK A;  3ZT2 A;  2ZM6 K;  5M1O A;  3SBG A;  2HHV A;  4BRC A;  3FZL A;  5AQZ A;  3P5J A;  4HTU A;  5LJW A;  4BR0 A;  3S3O A;  4GW6 A;  4RWT A;  1KD1 O;  4CJQ A;  4DKW A;  4CHZ A;  4CJF A;  5AFU A;  3VER A;  3CXC M;  4MLH A;  3DOL A;  4JEP A;  1ZBL A;  5LMN K;  4MDA A;  2YHW A;  1TK5 A;  2WON A;  3SPZ A;  3A5L C;  3ULE A;  2O8E B;  4M41 A;  3F73 A;  4K25 A;  4DQ8 A;  3AVC A;  3M8Q A;  1RDD A;  3TWH A;  3AVF A;  1SL0 A;  1RT4 A;  3OS0 A;  3CCL N;  4H5N A;  3RSE A;  3MK6 A;  3BF1 A;  4BRG A;  4IO8 A;  3V6D A;  2XHB A;  5GAD P;  4DV0 K;  5HLF A;  2W42 A;  3DI6 A;  4DU1 A;  4CGJ A;  3E1Y A;  3AA4 A;  2HBJ A;  1C0F A;  4CEZ A;  1HLU A;  2FSN A;  2NRZ A;  4NLC A;  1QSY A;  3BY5 A;  3K9K A;  2VWJ A;  3IMX A;  3HP6 A;  2KQ2 A;  4K8X A;  5SWM A;  3MXM A;  1JLF A;  4CZM A;  2I7N A;  3QO9 A;  3TTF A;  1ATR A;  2VYP A;  4JS5 A;  2I7P A;  3CQX A;  1L3V A;  2P9I A;  2KTQ A;  2IOC A;  2HVI A;  3V1R A;  4DV1 K;  3SK3 A;  4H5R A;  1C0G A;  3LM9 A;  1YTU A;  1JKH A;  2NRH A;  5FRM A;  4E7J A;  3L4I A;  4TSX A;  2JLE A;  3KZB A;  5HRS A;  4AM7 A;  5C10 A;  2HW3 A;  3IG1 A;  3UKU B;  4LFB K;  4F4K A;  3V4I A;  4OGC A;  2QWN A;  1HPM A;  3VN5 A;  2Z1I A;  3M8P A;  4YOW A;  3KLI A;  2A42 A;  2FLO A;  4DTS A;  1SL2 A;  2IC3 A;  2EHG A;  3GBT A;  4KTQ A;  4KI6 A;  4JV5 K;  2HHS A;  5A2Q O;  3NGI A;  1VSE A;  3U4L A;  2P9U B;  5HRP A;  3WXJ A;  4JKG A;  4K43 A;  1IH7 A;  4JK9 A;  1GLC G;  1VQ7 N;  3QNO A;  1Z26 A;  4BWJ A;  1QQO A;  3SPY A;  1E4G T;  4DQR A;  3HVT A;  1D4X A;  4JYA K;  4KHP K;  3LAK A;  1T8E A;  2FBY A;  4CFC A;  3FZK A;  5FPM A;  2WUS A;  4AIL C;  4DSJ A;  1HRH A;  3ZSX A;  2KLA A;  4KI4 A;  1IBL K;  4B8C A;  3FLC O;  1YAG A;  1VSD A;  3F9K A;  5CY4 A;  1RDA A;  5JIC A;  1ZBI A;  4MO4 A;  3NH1 A;  4DTP A;  3GDQ A;  4WE1 A;  3H3N O;  4J2D A;  2VGN A;  5C2D A;  4JD2 B;  1C0M A;  4BQL A;  4C8K A;  4BR2 A;  2CH6 A;  1NG9 A;  4H4O A;  1XNQ K;  2OTJ N;  5HRR A;  4CEB A;  3DXK B;  1HNX K;  3I55 N;  5HRO A;  2RF2 A;  3T7Z A;  1EX4 A;  4F9O A;  2FSK A;  4B9M A;  1Y97 A;  1N5Y A;  2QWL A;  2ZE2 A;  4BY9 C;  4KHY A;  4B3M K;  4G1Q A;  3O4N A;  1M1K O;  2GUI A;  1IG9 A;  2E1Y A;  2FBV A;  4FO0 A;  1NGH A;  4CFB A;  4H03 B;  4KTZ A;  3HOS A;  3L8B A;  2F8T A;  4CHY A;  5EVZ A;  3AO2 A;  4BWM A;  1DTQ A;  4BE0 A;  3TAE A;  4Q5V A;  3O9T A;  5KQD A;  3UB5 A;  4X64 K;  1NJY A;  4ISG A;  4F2R A;  1BCO A;  1RBT A;  3C6U A;  4IG0 A;  2D0C A;  4YHH K;  4H0V B;  4CHO A;  1REV A;  4E1J A;  1FKO A;  1EWQ A;  1TKX A;  2F9W A;  3EKU A;  1T05 A;  4F3T A;  1NK9 A;  1W2B M;  2DPN A;  1HNZ K;  5AQI A;  3N4P A;  1CZA N;  4OKE A;  1X9J A;  1K8K B;  1SV5 A;  5DK5 A;  3MCP A;  2O8E A;  1DGK N;  1C1A A;  1TGO A;  2YNG A;  3TAN A;  4DUY K;  1VQ8 N;  1ASW A;  1VRU A;  3VEX A;  2A6A A;  4OO1 J;  3EZ5 A;  3AY9 A;  4BDY A;  3CYM A;  4XEI A;  1KLM A;  3CME N;  1WAF A;  3DLR A;  1UOC A;  5KGW A;  5BPN A;  3KK2 A;  3A5N C;  3D2F B;  3KVG A;  3CCU N;  1YHQ N;  3I0S A;  3U9Z A;  1X9S A;  2QXF A;  3IRX A;  4HWI A;  2O8B B;  3O9S A;  2PYL A;  3G71 N;  2QK9 A;  4NXN K;  3ZCM A;  1CZB A;  2ASM A;  4IEI A;  3RR7 A;  1V4T A;  4W5Q A;  5KPR A;  2D4W A;  3QDK A;  5EXW A;  4O5B A;  4CF8 A;  3OA9 A;  4AQY K;  3QEP A;  4KPY A;  4M3Z A;  2CH5 A;  4OKK A;  4CIF A;  4FLX A;  2WTU A;  4DV2 K;  4QS8 A;  4B1X B;  4CK3 A;  2F8S A;  2HOE A;  4CCH A;  3THX B;  1NKB A;  4BE1 A;  2E2O A;  4DSE A;  1NGB A;  1JL1 A;  1U49 A;  3UKU A;  4I9L A;  4RW4 A;  4GVM A;  2PZS A;  3HST B;  1RDW X;  4CJS A;  4Z4I A;  4CGD A;  4FJL A;  4A59 A;  3PIO L;  1KQS M;  2HBM A;  1ITG A;  1V4S A;  2BGG A;  1ZC6 A;  3AO3 A;  3E9O A;  2NRV A;  3NH2 A;  4DFM A;  4LH5 A;  3V9Z A;  4B9S A;  4CZI A;  3OTO K;  2P9U A;  2LSN A;  5J2N A;  3S3N A;  1ZXO A;  2HF4 A;  4E7K A;  3T69 A;  4A2A A;  1X9W A;  1Y64 A;  1LW0 A;  4ISE A;  3EY1 A;  3ZX3 A;  4BRM A;  4WQ5 C;  4CEO A;  1NKC A;  3CHW A;  5BPM A;  4O4G A;  5AQK A;  1JCE A;  3DM2 A;  3UKR B;  4O8U A;  2IDO A;  2KZZ A;  1R59 O;  3O9R A;  3M1F A;  2X74 A;  1UA0 A;  1N33 K;  1T7P A;  2XY7 A;  1JLE A;  1S3X A;  4Y1C A;  4CZJ A;  4W5O A;  2QA4 N;  2G8K A;  2G8V A;  3KHY A;  5LMU K;  3MN6 A;  2IVP A;  4Y0W A;  1QQC A;  1N36 K;  4DQQ A;  2HHU A;  5CZ1 A;  3ZET A;  5AQR A;  4O55 A;  1TL1 A;  3LM2 A;  1ZYQ A;  4JD2 A;  3PV8 A;  4CZE A;  3HYF A;  4F8R A;  4BRF A;  1QHT A;  1VHX A;  3DRP A;  4ILH A;  3ZT1 A;  3CJ9 A;  4RCH A;  3OYL A;  5EY4 A;  4BRO A;  2ZD1 A;  3CCE N;  4FJM A;  3DXK A;  3O5B A;  3K5L A;  1TUY A;  3CM5 A;  5JLH A;  4WF9 L;  3LDO A;  3U3Y A;  1HNV A;  3VQ6 A;  1JCG A;  2Z1J A;  2ZQB A;  2P51 A;  4CZK A;  2AP1 A;  2E88 A;  2Z1G A;  3PY8 A;  1JL2 A;  3SMP A;  4B9V A;  2Q31 A;  3CI5 A;  3B6O A;  4RG8 A;  1NK6 A;  3AA2 A;  4OVL A;  3M3Z A;  3OYC A;  3CFP A;  1NBW A;  2KHO A;  2E2N A;  3EE9 A;  4WFB L;  4DR4 K;  3AVK A;  1DEJ A;  4W5R A;  3QES A;  4IOC L;  1IG8 A;  1U04 A;  4MO5 A;  4DR5 K;  1VQ6 N;  3K9J A;  3LWL A;  1DTT A;  4QCL A;  3AVM A;  5AQN A;  3DLG A;  2JGU A;  2HBL A;  4KFB A;  3AVA A;  2Y1J A;  3TU5 A;  3D6R A;  2W6K A;  3LDS A;  1K8K A;  1HJO A;  5KGX A;  4B3T K;  3DAW A;  3H1Q A;  4FWP A;  4CJE A;  1RDC A;  2ZJQ L;  3CFO A;  1RBS A;  3O9U A;  4EZ6 A;  4CEQ A;  4CFD A;  4DLG A;  1BG3 A;  1K73 O;  2H3G X;  3ENB A;  1YI2 N;  3K5M A;  3EYZ A;  3VQA A;  1L3U A;  1E3M A;  1L3T A;  2FF3 B;  4B9N A;  4CFA A;  3AVL A; 
#chains in the Genus database with same CATH homology
 4FXD A;  3SPZ A;  2HHW A;  4M42 A;  3V1Q A;  4HVJ A;  3L2V A;  4M41 A;  1S9G A;  3HJF A;  3F73 A;  4M45 A;  3C6T A;  3HPO A;  1NOZ A;  3AVC A;  3M8Q A;  3ZSW A;  1RDD A;  3TWH A;  3VQE A;  3M8R A;  1S5J A;  1Z25 A;  3AVF A;  3TAF A;  1SL0 A;  1RT4 A;  2RN2 A;  3OS0 A;  4FZZ A;  4N41 A;  1IKW A;  3PX6 A;  4GMJ B;  3V6D A;  2XHB A;  2YNH A;  4W5N A;  2X78 A;  5HLF A;  4OKJ A;  4M3W A;  4RW7 A;  3QIN A;  2W42 A;  3K5N A;  3DI6 A;  2R7Y A;  5KRS A;  4FLV A;  4DU1 A;  4CGJ A;  4DTN A;  1D9D A;  3AA4 A;  1JLC A;  5D3G A;  4B9L A;  4CEZ A;  4MFB A;  2FBX A;  2RKI A;  1BI4 A;  3AVN A;  1RTI A;  1QSY A;  1KRP A;  4ZHR A;  3DLB A;  2ATQ A;  3O4Q A;  4XIU A;  3TR8 A;  2VWJ A;  3KTQ A;  1S6Q A;  3HP6 A;  2VG6 A;  2KQ2 A;  1BIU A;  4K8X A;  5SWM A;  3MXM A;  1JLF A;  1S1U A;  4FJK A;  3T3F A;  3QO9 A;  4DTM A;  1SUQ A;  4E0D A;  4DSL A;  2A1S A;  3KKR A;  1VSM A;  3L2Q A;  1QE1 A;  4CF1 A;  4AHU A;  1YVU A;  2F96 A;  4JS5 A;  3QER A;  3OYH A;  3SQ0 A;  1KFD A;  5KRT A;  3S9H A;  1BGX T;  4Z4G A;  4YNQ A;  1L3V A;  1Q9X A;  2KTQ A;  3KLE A;  1TK0 A;  5EU7 A;  3QEX A;  4LSN A;  2IOC A;  4AHS A;  2HVI A;  4AHT A;  3V1R A;  2I5J A;  3I0R A;  3A2F A;  1A5X A;  3QEW A;  2OZS A;  3ZT0 A;  4CED A;  4BDP A;  1B9F A;  1VSL A;  1YTU A;  1JKH A;  1NOY A;  3SZ2 A;  3OYK A;  1RBU A;  4DQP A;  3QET A;  4CEF A;  5FRM A;  4E7J A;  3OYD A;  3LAM A;  1RCH A;  4TSX A;  2QKK A;  1A5W A;  2JLE A;  3M8S A;  1N6Q A;  2OYQ A;  3AA5 X;  4M3U A;  4B08 A;  3OJU A;  3TAR A;  4CJU A;  4EZ9 A;  5HRS A;  3BGR A;  4FJN A;  1KLN A;  1VSJ A;  4C8O A;  2D5R A;  1BIZ A;  1QTM A;  2B4J A;  3IG1 A;  3VQP A;  1NK8 A;  3PX0 A;  2HW3 A;  2P1J A;  2KFZ A;  4Q0B A;  5C42 A;  4F4K A;  3V4I A;  1SKR A;  4E7I A;  4OGC A;  3ZSY A;  1TKZ A;  5C24 A;  3ASM A;  4AHV A;  3VN5 A;  4DF4 A;  4FJ8 A;  4M3Y A;  1CZ9 A;  2Z1I A;  3M8P A;  4FLZ A;  1HQU A;  3KLI A;  2XY8 A;  2AJQ A;  2HNZ A;  1KCF A;  5CYQ A;  5J2P A;  3OYE A;  3T19 A;  4DTS A;  2DFE A;  1SL2 A;  4B9U A;  2IC3 A;  1I39 A;  1A5V A;  2EHG A;  3CG7 A;  2XO7 A;  1HNI A;  4B8A B;  1W0H A;  4KTQ A;  4KI6 A;  4B3O A;  4FJG A;  2HHS A;  4E19 A;  4PQU A;  5K14 A;  3THV A;  4DTU A;  4FJX A;  3KIO A;  1BCM A;  3FFI A;  3NGI A;  1VSE A;  4FJ5 A;  5HRP A;  1NJW A;  1NK0 A;  4W5T A;  3OYJ A;  3MAQ A;  1HJR A;  2OPR A;  4LH4 A;  3O3H A;  4M3X A;  1NKE A;  4DSI A;  1IH7 A;  3MED A;  4KO0 A;  1XC9 A;  1RTD A;  1LWF A;  5J2Q A;  2OPP A;  3QNO A;  2WOM A;  4B9T A;  1Z26 A;  3SUO A;  4L8R B;  4BWJ A;  3AVI A;  1WSJ A;  3WNE A;  2XY5 A;  3SUP A;  4NYN A;  4FM2 A;  3SPY A;  1TAU A;  4DQR A;  4H4M A;  4CGG A;  1RT6 A;  3CM6 A;  3HVT A;  1EP4 A;  3LP3 A;  4CEC A;  1HYV A;  4DU3 A;  3DOK A;  3RR8 A;  3V1O A;  1XI1 A;  4Z4F A;  3LAK A;  1WSH A;  2FBY A;  4QAG A;  5KI6 A;  4CFC A;  1T8E A;  1IO2 A;  1D9F A;  4AIL C;  4DSJ A;  1HRH A;  1LWC A;  3ZSX A;  3DLK A;  4CF0 A;  3NDK A;  2HVH A;  2HB5 A;  4KI4 A;  4ID5 A;  2E4L A;  3D45 A;  4B8C A;  1VSD A;  2KZM A;  3F9K A;  5CY4 A;  4DG1 A;  1F21 A;  3RRG A;  1RDA A;  1LAW A;  4CES A;  3HM9 A;  3SI6 A;  3U3G A;  4AHR A;  4FM1 A;  2DFH A;  1ZBI A;  4JRP A;  4JS4 A;  4HHT A;  3P83 D;  3NH1 A;  4DTP A;  1EET A;  5FDL A;  3QEV A;  1S6P A;  4WE1 A;  4J2A A;  4J2D A;  4CEA A;  2HHT A;  3IAY A;  1FKP A;  4BE2 A;  3BDP A;  1C6V A;  1C0M A;  4DWI A;  3RRH A;  3DRR A;  5T7B A;  1S9E A;  4C8K A;  5CZ2 A;  1FXX A;  1T03 A;  3ISN C;  4R5P A;  4FLY A;  4H4O A;  3AVJ A;  3PO5 A;  2QKB A;  5HRR A;  2YKM A;  1LW2 A;  4PA1 A;  3VQ4 A;  1KVC A;  3HP9 A;  4CEB A;  1VSF A;  4RW9 A;  4DF8 A;  1S1V A;  3AVB A;  4DMN A;  4DQI A;  5HRO A;  4J2E A;  2RF2 A;  1RT2 A;  4IFV A;  3AA3 A;  4HUE A;  1EX4 A;  3RMA A;  2GBZ A;  1W9H A;  4CIE A;  4B9M A;  1Y97 A;  5HBM A;  1N5Y A;  4JRQ A;  4N76 A;  3K2P A;  2ZE2 A;  4UQG A;  4KHY A;  2FC0 A;  4N5S A;  4G1Q A;  3O4N A;  4KV8 A;  1ZBU A;  1D8Y A;  1CXQ A;  4CGF A;  2GUI A;  3ITH A;  1IG9 A;  1YTA A;  4IFY A;  4C8N A;  3VQC A;  1WSE A;  3O3F A;  3NE6 A;  1C0U A;  2FBV A;  2X6S A;  3OYN A;  4CFB A;  3SYZ A;  2YNF A;  1U48 A;  4KHS A;  3C95 A;  3MEC A;  2G8I A;  3C94 A;  4PY5 A;  4KTZ A;  4DSK A;  1RDB A;  3KK1 A;  3L8B A;  3NGZ A;  2F8T A;  3SCX A;  5JS1 A;  4CHY A;  3TAQ A;  3AO2 A;  4BWM A;  1DTQ A;  3VQB A;  3OS1 A;  3HVR A;  1NJX A;  4BE0 A;  1RT5 A;  2BDP A;  3HK2 A;  4FYD A;  3TAE A;  4O0I A;  4K8Z A;  4BDZ A;  4Q5V A;  3ULD A;  1WAJ A;  3NF6 A;  3L3U A;  1NJY A;  4OLA A;  3LAL A;  3ZSR A;  3ZSO A;  4F2R A;  1BCO A;  1RBT A;  3C6U A;  4IG0 A;  5I42 A;  4FJH A;  3ZSQ A;  1WSF A;  2VG7 A;  4KKO A;  4KHU A;  3TAP A;  2D0C A;  1ZBF A;  3KKS A;  3AVG A;  3OJS A;  3NF8 A;  3NF7 A;  2PYJ A;  4CHO A;  3PUF A;  4C8L A;  1REV A;  4CJV A;  1FKO A;  1RBR A;  3ZSV A;  4HCB A;  1TKX A;  1S1T A;  2RPI A;  2YHB A;  2FBT A;  3P1G A;  1T05 A;  3VQ9 A;  1NK9 A;  1QSL A;  4F3T A;  3K59 A;  1U47 A;  5DK5 A;  4OKE A;  4CF9 A;  1SV5 A;  1JLB A;  3ZT3 A;  3NH0 A;  1IKX A;  1SKW A;  5J2M A;  2IGI A;  2HMI A;  4N47 A;  4I2P A;  4Y1D A;  1NK7 A;  3E01 A;  1BHL A;  1EXQ A;  5SZT A;  3SQ4 A;  1TV6 A;  3SV4 A;  1C1A A;  1TGO A;  2YNG A;  3TAN A;  4B9N A;  4ELT A;  3KLF A;  1ASW A;  4FJ9 A;  1RT7 A;  1VRU A;  2B6A A;  4NYF A;  4CK1 A;  4CJ4 A;  5I3U A;  4I7F A;  1J53 A;  1BQN A;  1KTQ A;  2OPS A;  3VQ7 A;  3KLG A;  3EZ5 A;  4ID1 A;  4DTJ A;  1RT3 A;  2HHX A;  3G10 A;  2DFF A;  4O0J A;  4BDY A;  1FK9 A;  2B5J A;  3CYM A;  4OPJ A;  3OYB A;  1KLM A;  1LV5 A;  3ALY A;  1WAF A;  4E7L A;  3DLR A;  3PO4 A;  1WLJ A;  1UOC A;  2KFN A;  4CGH A;  5KGW A;  4EP4 A;  3LWM A;  1NJZ A;  1HPZ A;  1S1W A;  1TKT A;  4KHQ A;  2O4I A;  3KK2 A;  4LD0 A;  1WSI A;  3U6F A;  1KFS A;  3LP1 A;  3I0S A;  4IG3 A;  1C1B A;  4CJP A;  4E89 A;  1GOA A;  2QXF A;  1X9S A;  1BL3 A;  1KVA A;  2OA8 A;  3L2R A;  3IRX A;  4PWD A;  3H08 A;  2PYL A;  3ZT4 A;  2X6N A;  2QK9 A;  1HYS A;  4KTW A;  3ZCM A;  1CZB A;  3AV9 A;  4IDK A;  1YT3 A;  3DLE A;  1C0T A;  4IKF A;  3RR7 A;  3MXI A;  1Q8I A;  1U4B A;  5C25 A;  1JXB A;  1VSK A;  2XRI A;  4W5Q A;  3VA3 A;  3SQ1 A;  4Z4E A;  4O5B A;  4CF8 A;  2P5G A;  2DTU A;  1WNS A;  1D5A A;  3VA0 A;  3HXM A;  3SUN A;  4E1N A;  3QEP A;  1JXE A;  2PY5 A;  4KPY A;  4M3Z A;  3QNN A;  4N56 A;  1UWB A;  3OYG A;  4E3S A;  4DFJ A;  1NK5 A;  1LWE A;  2BE2 A;  3O3G A;  1JLQ A;  1TVR A;  3RMD A;  4OKK A;  4JLH A;  4CIF A;  4FLX A;  4CJT A;  5JS2 A;  3TAG A;  1ZBH A;  2IAJ A;  4NCG A;  1KVB A;  1S1X A;  3MEG A;  4ELU A;  3QEI A;  1R0A A;  4NCA A;  1UAX A;  3WNG A;  4KHW A;  3AVH A;  5HP1 A;  2Z1H A;  1HYZ A;  4CK3 A;  5E41 A;  2F8S A;  1XHX A;  1NK4 A;  4CCH A;  1TAQ A;  5CYM A;  4CK2 A;  4OLB A;  4ELV A;  1NKB A;  3TAM A;  4CEE A;  4BE1 A;  1VRT A;  2HHQ A;  1RBV A;  4DSE A;  1CXU A;  4HUF A;  1WN7 A;  4DS4 A;  3DMJ A;  1JL1 A;  3OY9 A;  3OYI A;  4ICL A;  3K58 A;  1U49 A;  3KD5 E;  3LPU A;  4I9L A;  4RW4 A;  4GVM A;  2PZS A;  5KTQ A;  3I8D A;  3SJJ A;  3HST B;  3T1A A;  4CJS A;  4AH9 A;  4Z4I A;  3QLH A;  4QOZ B;  4M3T A;  4CGD A;  2D0A A;  1VSI A;  4FJJ A;  3IS9 A;  3V81 A;  1HQE A;  3TI0 A;  3S3M A;  3NHG A;  4CHN A;  3SUQ A;  3QIO A;  2G8W A;  4KHN A;  1GOC A;  3NCI A;  1ITG A;  1CLQ A;  2G8U A;  4FJL A;  1ASU A;  2BGG A;  5FRO A;  4NCB A;  3AO3 A;  3PX4 A;  1J9A A;  3L2U A;  3NH2 A;  1B92 A;  4LSL A;  2E6L A;  4OJR A;  4LH5 A;  3V9Z A;  4DFM A;  1J5O A;  1SL1 A;  4B9S A;  1QSS A;  4KB0 A;  2IS3 A;  3SNN A;  4FZY A;  3DRS A;  3OYF A;  2LSN A;  3NF9 A;  1RT1 A;  5J2N A;  3S3N A;  1C1C A;  4FW2 A;  4I2Q A;  4E7K A;  3LAN A;  3K57 A;  1B9D A;  1X9W A;  1G15 A;  1LW0 A;  2NUB A;  3EY1 A;  1KSP A;  2XY6 A;  4DFP A;  1RNH A;  4E1M A;  1U45 A;  1VSH A;  4CEO A;  4CF2 A;  1NKC A;  3KLH A;  1RTJ A;  4DTX A;  2A1R A;  4BAC A;  4O4G A;  3V9X A;  3NBP A;  2GV9 A;  3L3V A;  3LZJ A;  4HUG A;  3UIQ A;  1LAV A;  3OVN A;  3DM2 A;  2Y1I A;  1DLO A;  1VK0 A;  2IDO A;  4CFA A;  2VG5 A;  2KZZ A;  3HPG A;  4FJ7 A;  1ASV A;  4Z0U A;  4CGI A;  4DU4 A;  3HPH A;  2X74 A;  1UA0 A;  3WNH A;  3TAB A;  1T7P A;  2VWK A;  3RMC A;  2XY7 A;  1JLE A;  3LPT A;  4F2S A;  4Y1C A;  4J2B A;  1O1W A;  4W5O A;  4CHQ A;  3CQ8 A;  2G8K A;  2G8V A;  2DY4 A;  4F3O A;  3JSM A;  2OPQ A;  2ITG A;  4KB1 A;  4HCC A;  4KAZ A;  1QQC A;  3VQQ A;  3RTV A;  3V9W A;  4E7H A;  4DQQ A;  2HHU A;  5CZ1 A;  4O55 A;  4RW6 A;  3NAE A;  3QIP A;  2D0B A;  3AO4 A;  1TL1 A;  3LZI A;  4DTO A;  4CHP A;  1SKS A;  1ZYQ A;  2YHA A;  4CJK A;  1IKV A;  3PV8 A;  4DLE A;  3HYF A;  1GOB A;  4F8R A;  3VQ5 A;  4CJW A;  1K6Y A;  1QHT A;  3DRP A;  3CFR A;  3ZT1 A;  3SQ2 A;  2G8F A;  3KK3 A;  3OYL A;  4FZX C;  2EX3 A;  2YNI A;  4DSF A;  4I9Q A;  3AO5 A;  2ZD1 A;  2KW4 A;  4CER A;  4FJM A;  4ZTF A;  4OGE A;  1XHZ A;  3HL8 A;  3K5L A;  1X1P A;  2O4G A;  4M3R A;  1BQM A;  4CJ3 A;  3VQD A;  3CM5 A;  4MQ3 A;  3D0P A;  4Z4C A;  4FJI A;  4KRF A;  1XWL A;  3U3Y A;  1HNV A;  1BIS A;  3VQ6 A;  2HND A;  2P5O A;  4CE9 A;  4FK4 A;  2Z1J A;  2ZQB A;  2P51 A;  1UA1 A;  2Z1G A;  4YFU A;  3PY8 A;  4OPK A;  1JL2 A;  4EP5 A;  1L5U A;  2OZM A;  4B9V A;  3K5O A;  2ETJ A;  1QS4 A;  3B6O A;  4RG8 A;  3B6P A;  1NK6 A;  3AA2 A;  4OVL A;  3OYC A;  4DTR A;  1J54 A;  3CFP A;  4FCY A;  4C8M A;  2E6M A;  4ZTJ A;  4IBN A;  4CJ5 A;  3AVK A;  4LY7 A;  4W5R A;  1TKD A;  3VQ8 A;  3QES A;  1HMV A;  3NFA A;  4AHC A;  1X9M A;  1MU2 A;  3LP2 A;  3MEE A;  4FM0 A;  1U04 A;  4FLU A;  1BI4 B;  2YKN A;  1Q9Y A;  3G0Z A;  3V9S A;  5DMR A;  3ZSZ A;  3LWL A;  4CJR A;  5FRN A;  3WNF A;  3L2W A;  1I3A A;  4Z4H A;  3OS2 A;  1DTT A;  4DQS A;  4QCL A;  1TK8 A;  5HRN A;  2HNY A;  1TL3 A;  1L3S A;  4KRE A;  3AVM A;  3NGY A;  4FVM A;  1JLA A;  3ZT2 A;  4DFK A;  4FK0 A;  3DLG A;  2JGU A;  4PUO A;  2HHV A;  4KFB A;  3LP0 A;  2Q3S A;  1JLG A;  3AVA A;  2Y1J A;  5J1E A;  4H8K A;  4FW1 A;  3KJV A;  3P5J A;  4HTU A;  3OYA A;  3S3O A;  4GW6 A;  3OYM A;  1WSG A;  3LDS A;  4RW8 A;  4FLT A;  1IKY A;  5KGX A;  4DS5 A;  3V9U A;  4CJE A;  1RDC A;  2YV0 X;  4CJQ A;  4CHZ A;  3SV3 A;  2G8H A;  3HO1 A;  4CJF A;  3JYT A;  3CFO A;  1RBS A;  4EZ6 A;  4CEQ A;  3HT3 A;  4O44 A;  4CFD A;  3DLH A;  2BAN A;  4DLG A;  3MXJ A;  4FLW A;  1RIL A;  3K5M A;  4FK2 A;  4CIG A;  3EYZ A;  3VQA A;  1L3U A;  3KD1 E;  3RWU A;  3AO1 A;  3DYA A;  3DOL A;  1EKE A;  3RMB A;  1ZBL A;  1L3T A;  4CJL A;  1RTH A;  1TK5 A;  2WON A;  3AVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...