2IS3A

Crystal structure of escherichia coli rnase t
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
203
structure length
203
Chain Sequence
LTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title Crystal Structure of RNase T, an Exoribonuclease Involved in tRNA Maturation and End Turnover.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
total genus 53
structure length 203
sequence length 203
chains with identical sequence B, C, D
ec nomenclature ec 3.1.13.-:
pdb deposition date 2006-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2is3A00
4KO0A 5KRSA 4N56A 3DOLA 3LP3A 1A5VA 1QE1A 3NGYA 3OJSA 3L2QA 5HROA 1KRPA 4ELUA 1RTDA 4K8ZA 2XRIA 3AVIA 4FJMA 1K6YA 4AHUA 3HJFA 4FLTA 1U48A 5JS2A 3OY9A 4N41A 2JLEA 4RW7A 3NDKA 2OZSA 1CZ9A 1D5AA 4ID1A 4DQPA 4DSLA 3LALA 3KD5E 3DLKA 3KJVA 1LWEA 2Z1IA 4CEFA 3OS0A 3TAQA 2P5GA 3OYNA 1U45A 2KW4A 4F3OA 4QOZB 2IDOA 1GOBA 3AA3A 5HRRA 1JLCA 4KHSA 3C95A 4ZHRA 3V1RA 1QHTA 3HVTA 3VQDA 3T19A 4F2RA 4FM0A 2RKIA 3VQ6A 2ZD1A 3EZ5A 1J54A 1YTAA 4CHPA 1QQCA 3VA0A 3SYZA 4EZ6A 4DSFA 4K8XA 3TAMA 5SZTA 3TARA 4KHWA 3L2UA 3HPOA 3DLBA 4DFJA 1WSJA 4FJXA 5JS1A 1S1TA 4CJEA 2Z1GA 3HP9A 3AO4A 1S1VA 4KV8A 3MAQA 4F8RA 4M42A 3CYMA 3NE6A 5J2MA 1BCMA 4WE1A 4DQQA 4M3RA 3NAEA 1BGXT 2G8FA 2HHQA 3NF6A 1EETA 1UOCA 3V1QA 4PUOA 1VSFA 1TGOA 4O44A 4CGFA 4CCHA 4FLWA 4DS4A 2VWKA 4DTMA 2VG6A 1B92A 3L3VA 3KK1A 4NCBA 4Z4GA 1KLMA 5K14A 1BI4A 1YT3A 5I42A 4B08A 1WAFA 4CF9A 3THVA 4PQUA 4KTWA 1YTUA 4QCLA 1SKWA 1CZBA 1WAJA 3M8QA 4B9LA 1HQEA 3C94A 2KQ2A 3T1AA 1XWLA 4CF0A 1N6QA 4KTZA 4N47A 2HNZA 4YNQA 3PY8A 1X9WA 3OYIA 3AVAA 4CF8A 4E3SA 4HUGA 1XHXA 2HHSA 3PO4A 3VN5A 4OPKA 4FVMA 4IFYA 1QSYA 4KHYA 4CJVA 1WSHA 3G10A 1TKDA 2GV9A 5HLFA 2PY5A 4W5NA 3HT3A 3OYMA 3K59A 1VSIA 2E6LA 4FJKA 4C8MA 2FBXA 4HHTA 4RW4A 4DU4A 4CFCA 2Z1HA 4FCYA 4M3WA 1KVAA 2O4GA 1DLOA 3NGZA 3KLEA 3NGIA 4B9TA 4HCBA 4UQGA 4FZXC 1DTTA 3TAEA 2KZZA 5FDLA 4AHVA 1RNHA 3IS9A 1D9DA 1FKOA 4RW8A 4ZTJA 4F3TA 3D0PA 3TR8A 3S3NA 2OPRA 1I3AA 3WNEA 5SWMA 4W5OA 4FJNA 2GBZA 2OPPA 2BANA 1YVUA 5J2PA 1WLJA 3WNHA 2I5JA 1VK0A 3RMBA 3DYAA 1J53A 1WNSA 4IBNA 3EY1A 3QLHA 1S5JA 4KHNA 4CHOA 1NK0A 5EU7A 3V1OA 3MEEA 3NBPA 1RILA 2X6NA 1TK0A 2D5RA 3DM2A 5HBMA 2IGIA 1C1CA 1Z25A 4Z4CA 3V81A 3KLIA 5CYQA 2GUIA 5HRPA 4MFBA 3NF7A 4LH4A 1S1UA 1VSJA 4RG8A 4FJLA 1RBTA 2KFZA 2Y1JA 3KK2A 2G8KA 2QXFA 1NKBA 3JSMA 4C8NA 4FLVA 4BDYA 1HNIA 3SQ2A 1LWFA 5J1EA 4B9MA 4CECA 4CEDA 1QS4A 4M41A 3ZT3A 3V6DA 2RPIA 3L3UA 3V9XA 4KHUA 2X6SA 3O3HA 1HMVA 2IS3A 4Z0UA 1BQMA 1ZBIA 2XO7A 1L3SA 3AVKA 3VQAA 1SL2A 1G15A 2RF2A 4NCAA 1S1XA 4N5SA 3DLGA 1REVA 3MXJA 2VG5A 4AHCA 3HP6A 4CJSA 4DF4A 4FK4A 4OLAA 4KRFA 3HVRA 4DTRA 2LSNA 1J9AA 2VWJA 3AVGA 1BQNA 1WN7A 3OYGA 4DTJA 3RR7A 1B9FA 4I7FA 1IKXA 2P51A 3P1GA 3VQCA 2AJQA 2PYJA 4DQIA 3IRXA 4H8KA 3T3FA 1RDCA 4CJTA 4HVJA 2WONA 3DI6A 4B8AB 3LZIA 2W42A 1LW0A 3L8BA 3PV8A 1RTJA 3V9ZA 1CXUA 3LAKA 1NKEA 3LWMA 2QKKA 1IG9A 1KLNA 3ZSQA 4AHTA 1S6QA 4I2QA 1TV6A 4FJGA 2YHBA 4RW9A 4OJRA 1KVCA 4G1QA 1BIUA 4NYFA 1S1WA 4M3ZA 1NJXA 1RT2A 2X74A 4OLBA 1ASWA 1Q8IA 4R5PA 3VQ9A 4FZYA 1NJZA 1T7PA 4M3TA 2QKBA 1UA1A 3CM5A 4DSEA 3OYHA 3ALYA 1NK7A 4DSKA 4NCGA 3RMCA 3LZJA 4EP4A 4DTXA 3SPYA 3LP2A 5CY4A 3JYTA 3AO1A 4BE1A 2IC3A 4E7KA 4KB1A 4DLGA 4FXDA 1XI1A 4Z4HA 1I39A 2HW3A 2B6AA 1RT5A 1VSHA 3S9HA 4Q0BA 3VQ5A 3ZT1A 3G0ZA 3IG1A 3KLFA 4FW2A 5KGWA 3QIPA 3OYLA 4E7LA 3DLHA 4FZZA 4Z4EA 1VRUA 4FJHA 1DTQA 3CQ8A 2G8VA 2OZMA 3ASMA 4MQ3A 2YNGA 1ZYQA 3PO5A 4CEAA 1ITGA 1JL2A 1U04A 3L2RA 4FLUA 1ASVA 4DQSA 1ZBLA 3AO5A 3I8DA 4DSJA 1A5WA 1RBRA 3SQ1A 1HRHA 3SUNA 3VQ4A 1BL3A 3ZSRA 4OVLA 3TANA 2ITGA 4IG3A 3RRHA 2PYLA 3EYZA 2YNFA 4O55A 3HXMA 3TAGA 1Q9XA 2DTUA 1T05A 1F21A 4H4OA 1HQUA 3NHGA 4GVMA 4CESA 4DTSA 1BI4B 3WNFA 3SNNA 1JLQA 3MXMA 4CERA 3HK2A 4E7JA 4L8RB 4PWDA 2HHVA 3QIOA 3MXIA 3AVHA 5D3GA 1B9DA 1GOAA 2B4JA 4OKKA 4DG1A 3KLHA 3DMJA 3U3YA 3TAFA 4CGDA 3OVNA 4KREA 4CJKA 3KIOA 1NJYA 3AO2A 1L3UA 3K5OA 1NK5A 3AVFA 3O4QA 2D0CA 3RMDA 4HCCA 2EHGA 4M3YA 1VSLA 4CHZA 4FJIA 1S9GA 2FBVA 2BGGA 1LAWA 3MEGA 4F4KA 2OPSA 4DU1A 2YNIA 4CE9A 3SI6A 4F2SA 4B9VA 1C0UA 1VSDA 1HJRA 3S3MA 1BCOA 2F8TA 4B3OA 4CJRA 4ELVA 3QEPA 5KI6A 3NH1A 3H08A 4PY5A 1D9FA 4CJ3A 3WNGA 4DTUA 3V9WA 5C24A 4XIUA 5J2NA 5E41A 4BDZA 2FBYA 4ID5A 4DS5A 3IAYA 3KKRA 4CEOA 3QEXA 2HMIA 5KTQA 4KI4A 1C6VA 5FRNA 4OKEA 4DWIA 1C1BA 4FLXA 3ZT0A 2RN2A 3TAPA 2QK9A 1ASUA 2R7YA 3AA2A 1T03A 3K57A 4Y1DA 1TL3A 4E89A 1HNVA 1UWBA 1RTIA 1Z26A 3K58A 1IKYA 3V4IA 1C0TA 1NJWA 2G8HA 2P1JA 1Y97A 2DFEA 3QERA 3ZSXA 3D45A 3K5NA 1RBSA 2DY4A 1VRTA 4Z4IA 4J2BA 4KAZA 3C6UA 2ZQBA 2P5OA 3AVNA 2VG7A 3QO9A 4OKJA 3OYFA 2XY7A 4O4GA 4E1NA 5KRTA 1TVRA 4EP5A 1NK8A 3ZCMA 4CHNA 1EX4A 5CYMA 4E19A 4HUFA 3DLRA 3VQQA 4CJ5A 3PX4A 1JL1A 4CFAA 1U49A 1HYSA 4B8CA 3ZSYA 1JLAA 1TKZA 4LD0A 1BISA 3NH2A 4OGCA 4CHQA 4C8OA 4FJ7A 2Y1IA 4FM2A 5CZ1A 3OYKA 4CFBA 1NOZA 4CF1A 5KGXA 3MECA 1HYVA 1KTQA 4JLHA 3L2VA 4BACA 3SV3A 1LWCA 4DQRA 3M8PA 4DSIA 1X9MA 3BGRA 2FBTA 4FW1A 3KLGA 1SV5A 1R0AA 4J2EA 1EKEA 2FC0A 3L2WA 1L3TA 4CJWA 1HPZA 4GW6A 4I2PA 4JS4A 2OA8A 4CEQA 2A1RA 4KFBA 4AH9A 4NYNA 4CJUA 4IFVA 2Z1JA 1RDDA 5C25A 3HPGA 4OPJA 3OYBA 1RBUA 4CGJA 4CK1A 1LV5A 5HRSA 4CIEA 1MU2A 2XY6A 4B9NA 3A2FA 4FLYA 3SUQA 2KFNA 4CJPA 1RCHA 3LDSA 4KPYA 1HYZA 2A1SA 3QINA 3VQEA 1D8YA 1RT6A 2B5JA 4KKOA 3NF8A 4CGIA 3AV9A 3S3OA 4DMNA 4CJ4A 3PX6A 4DFPA 4M3XA 1SL0A 1IO2A 1W0HA 1SKSA 3KTQA 2HHWA 3I0RA 3K5MA 4CK2A 4HUEA 3LP1A 4KHQA 2YV0X 2O4IA 1VSKA 5I3UA 1QSLA 4JRQA 4E0DA 1JLBA 3LP0A 3SCXA 1JKHA 1BIZA 1LAVA 4FLZA 4BE0A 2E4LA 1WSEA 5C42A 4LSNA 1N5YA 4ELTA 4B9SA 2D0AA 3CM6A 4BWJA 3AA4A 4DTNA 3QEWA 1XC9A 1TK8A 3RR8A 2X78A 2OYQA 1SL1A 5HRNA 4YFUA 3AO3A 3TWHA 1JLGA 2HNDA 1ZBFA 1JLFA 3O3FA 4FM1A 4O5BA 3SZ2A 2ATQA 1RT3A 2XY5A 1QSSA 1SKRA 3AVLA 4KB0A 1IH7A 1J5OA 4FJ5A 3OJUA 2F96A 4CHYA 3V9UA 4DLEA 3HL8A 5FRMA 4H4MA 3ZSVA 3AVCA 3SPZA 3AVMA 4CGGA 5FROA 4BWMA 1GOCA 2BDPA 4M45A 1IKWA 3ISNC 1C0MA 4GMJB 1W9HA 4CJLA 1JXEA 1UAXA 3B6PA 1VSEA 5HP1A 3RRGA 4J2DA 2KTQA 1TK5A 3OYAA 3OYEA 3E01A 4DF8A 3HSTB 2XHBA 1L3VA 1JLEA 4CEZA 3P83D 3ZT4A 3VA3A 4CK3A 5J2QA 2ZE2A 4O0JA 5DMRA 3SJJA 1RDBA 1TL1A 3K2PA 4LSLA 3HM9A 3NCIA 5DK5A 1Q9YA 3U3GA 4HTUA 3SV4A 3CFPA 1WSGA 2XY8A 3B6OA 3RTVA 1NK9A 2BE2A 3AA5X 3M8RA 1RT4A 2G8IA 3VQBA 4AILC 3SUPA 1X9SA 4CEBA 4B9UA 4J2AA 1EP4A 2EX3A 2PZSA 2F8SA 1U47A 3ZSOA 1QTMA 3AVBA 4FJ9A 1RBVA 4DTOA 4IG0A 2YHAA 3SQ0A 1O1WA 3O4NA 4LY7A 1S6PA 2YNHA 4RW6A 3ZSZA 1CXQA 4BDPA 4I9QA 4FYDA 4CF2A 3AVJA 5CZ2A 1RT1A 4DU3A 1SUQA 1BHLA 1RTHA 1U4BA 4EZ9A 4E7HA 4KI6A 2G8UA 2HHXA 2ETJA 3OYCA 3OYDA 4BE2A 3QEIA 4KTQA 1KFDA 3I0SA 1L5UA 1A5XA 4Y1CA 3ITHA 3U6FA 3BDPA 1KSPA 4PA1A 1X1PA 3FFIA 3HYFA 1NK4A 1ZBUA 2KZMA 1C1AA 3K5LA 4ICLA 3OS2A 4C8KA 2OPQA 1XHZA 3ZT2A 3C6TA 3NFAA 4IKFA 3KD1E 2IOCA 4CJQA 3OS1A 1NOYA 1VSMA 3PUFA 1JXBA 1CLQA 3DOKA 3F9KA 3LPTA 4TSXA 3NF9A 1TAUA 1TKXA 1LW2A 3QNOA 4DFMA 3HPHA 3SQ4A 4CEEA 3VQ8A 4E7IA 2WOMA 4M3UA 4Z4FA 2YKMA 3HO1A 2HHTA 4AHSA 4Q5VA 3QESA 2HB5A 3M8SA 1FK9A 1FKPA 3VQPA 1IKVA 1KVBA 4FJJA 1RT7A 2HVIA 4W5RA 3LWLA 3LAMA 4C8LA 1NK6A 3QEVA 3QNNA 4CGHA 3TI0A 2Q3SA 4E1MA 3UIQA 4O0IA 4FK0A 3CFOA 3DRRA 2DFFA 2HVHA 1NKCA 3KK3A 1UA0A 2IAJA 3LPUA 2G8WA 1EXQA 4CJFA 3SUOA 3DLEA 2HHUA 2E6MA 3V9SA 3F73A 1ZBHA 3KKSA 4W5TA 1TKTA 3OYJA 3RWUA 4N76A 2YKNA 4IDKA 1FXXA 4AHRA 4CFDA 3TABA 3NH0A 1KFSA 3P5JA 3CG7A 1WSFA 3DRPA 1T8EA 4JS5A 3ULDA 3QETA 1WSIA 1TAQA 3ZSWA 3RMAA 3O3GA 4QAGA 4FK2A 3LANA 4CIFA 2HNYA 4JRPA 3CFRA 2JGUA 4FJ8A 4W5QA 1KCFA 1S9EA 2NUBA 4LH5A 3VQ7A 3DRSA 3MEDA 4CIGA 4DFKA 4ZTFA 2D0BA 1RDAA 2DFHA 5T7BA 4I9LA 4OGEA 3PX0A 4DTPA
chains in the Genus database with same CATH superfamily
1GLCG 1KRPA 4ELUA 1A5VA 1QE1A 5HROA 2XRIA 4AHUA 3HJFA 1U48A 3OY9A 2JLEA 2FF3B 3DLKA 2Z1IA 3UKUB 3OS0A 2P5GA 1U45A 2KW4A 3VGLA 4J8FA 3AA3A 3O9UA 5BRDA 1JLCA 3V1RA 4LFCK 3T19A 4FSVA 3MN5A 3EZ5A 1KC8O 3H1VX 1J54A 3L2UA 3CPEA 3CCUN 3TU5A 4BQZA 3UB5A 1WSJA 1RFQA 4DFJA 3CC2N 4LF6K 3Q7BA 2Z1GA 3O9TA 4IZ9A 3CYMA 4DQQA 4BRKA 4M3RA 3NAEA 1OVQA 1EETA 4K42A 3V1QA 4PUOA 1VSFA 3O1BA 4CCHA 3T1HK 4NB4A 4DTMA 3KK1A 5K14A 2OTLN 4A61A 1WAJA 3H45C 2GWKA 1HQEA 2KQ2A 2GWJA 3T1AA 4CF0A 1T3VA 4KTZA 4N47A 1T6CA 4DCHA 4HUGA 4BR5A 3PO4A 4IFYA 1WSHA 1TKDA 5F1XA 4W5NA 3OYMA 3K59A 4FJKA 1BA0A 4FCYA 3WEEB 1KVAA 1DLOA 4MLEA 1K8KA 4UQGA 3TAEA 4A62A 5FDLA 4EHUA 4HWIA 3AARA 3D2FB 2DPNA 4F3TA 3TR8A 4DR6K 4W5OA 2WFBA 1VQ6N 3RMBA 2I5JA 4H0TB 5AQVA 2QW9A 3ZETA 2IVNA 3AY9A 4IBNA 2UYTA 4KHNA 4CHOA 3MEEA 5LJVA 1C1CA 4Z4CA 2D0OA 1K8AO 2GUIA 5HRPA 4LH4A 4RG8A 2KFZA 4WCEL 3A5MC 2Y1JA 3KK2A 1HX1A 3F9MA 5AFUH 1HNIA 4B9MA 2UXBK 3ULEA 4KHUA 1HMVA 2IS3A 2XO7A 3VQAA 1SL2A 4DR7K 1G15A 4IJNA 4GKKK 1REVA 3MXJA 2W6KA 5B8HA 4OLAA 2Q0RA 3CHWA 5AQIA 1J9AA 2VWJA 3VEXA 1HKCA 1E4FT 1YAGA 4C1NK 4K0KK 2A40A 4I7FA 2P51A 1NGCA 1YVNA 4DQIA 3ATUA 4JI5K 4CJTA 4HVJA 1KAYA 3PV8A 4BRGA 3LWMA 1KLNA 3ZSQA 3CETA 1S6QA 1S22A 4AHTA 1TV6A 1Z6RA 3THXA 1HNZK 1BIUA 4IEEA 2BTFA 4BRLA 1KAXA 1RT2A 2FLOA 4FZYA 1NJZA 4O8KA 4DSEA 3ALYA 4DSKA 4NLCA 3SPYA 1XUPO 3JYTA 4BE1A 2QM1A 2IC3A 4KHPK 1RGIA 3SK3A 4DLGA 4Z4HA 2HW3A 4Q0BA 3G0ZA 3H6EA 4CD3A 4FJHA 1ZYQA 3PO5A 3L2RA 1ITGA 4DQSA 5C0YA 4XH4A 3SQ1A 3J7YP 3SUNA 4IO9L 2FF6A 3TANA 4OVLA 2P9IB 2HBMA 2YNFA 3TAGA 4H4OA 4GVMA 3SNNA 3FZKA 1S72N 2CGJA 4E1JA 4L8RB 4PWDA 5AQWA 2HHVA 4A5AA 4PKGA 3LM2A 3E66A 1HLUA 4BR2A 3AO2A 5EOYA 3K5OA 2D0CA 3MCAB 3BUZB 5A2QO 1LAWA 1VQKN 4DU1A 3R1XA 3QFPA 1BCOA 1OVYA 3R3LA 4ELVA 3LDLA 3U4LA 5KI6A 2P9UA 3NH1A 1D9FA 3BF1A 4CJ3A 4DTUA 3VTHA 5C24A 4XIUA 3CCRN 4ID5A 3KWIA 1FW6A 5FRNA 5KTQA 4KI4A 1C6VA 3J81O 4DWIA 2KLAA 3ZT0A 2QK9A 1ASUA 3AA2A 4RCHA 1T03A 3PSIA 1HNVA 4H5TA 1Z26A 1NJWA 5E84A 2DFEA 2DY4A 2E8AA 4J2BA 4CD1A 2P5OA 5EXWA 3OYFA 2XY7A 1ZXOA 2VQEK 4FPBA 4KH5A 4ILHA 4HUFA 4E19A 3DLRA 3VQQA 3ULEB 1JL1A 4RTFD 1U49A 1HYSA 4LD0A 1BISA 3NH2A 4CHQA 4FJ7A 4DV5K 3D6RA 4FM2A 3IFRA 4FVUA 1W2BM 1NOZA 4CF1A 5KGXA 3CXCM 1HYVA 2VQFK 1LWCA 5KQDA 4DQRA 4IOXA 2CH6A 1X9MA 4FW1A 4J2EA 1ESVA 5C12A 3CC7N 3ENBA 4AQYK 4NYNA 4IFVA 3DAWA 4CGJA 5M1NA 5HRSA 3I33A 4B9NA 3VPZA 3A2FA 3RVCA 1HYZA 2A1SA 3QINA 3VQEA 3H46O 1JJ2M 1RT6A 4WYBA 3NF8A 4GNIA 4DFPA 3CPWM 1IO2A 4EIAA 1SKSA 4F9OA 4JAXA 3K5MA 3THXB 3LP1A 2O4IA 1TYQA 4E0DA 1BIZA 1LAVA 4FLZA 1WSEA 1N5YA 4ELTA 2J4RA 3CM6A 3AA4A 2OYQA 4FOEA 3I56N 3O9QA 3AO3A 4V19S 1JLGA 3P38A 1ZBFA 3SZ2A 3VOVA 2QA4N 4CHYA 2A41A 1YF5L 3AVCA 1QQOA 3AVMA 4A57A 3BP8A 5BN9A 3VERA 1GOCA 3ISNC 4GMJB 4CJLA 3LDQA 5M1QA 3ID6A 1NG9A 5AQTA 3D2EA 3VEOA 1BA1A 3L4IA 4JKEA 5HP1A 3RRGA 3Q7CA 4BC3A 1BUPA 2Q31A 1NGFA 1XMOK 2ZE2A 1TL1A 3NCIA 5DK5A 1KD1O 4HTUA 3KZBA 1NK9A 2D0PA 2BE2A 3AA5X 3VQBA 4AILC 2O8EA 3HOSA 1QQNA 4B9UA 3O8MA 4NXNK 2EX3A 2PZSA 4FJ9A 4IG0A 3O1WA 3AAQA 4FYDA 1CXQA 1BHLA 5BRFA 2V52B 3OYCA 4KTQA 4JKGA 5MLCQ 1L5UA 1HKBA 1NK4A 2P9UB 1C1AA 3OS2A 2P9SA 3ZT2A 3C6TA 4CJQA 1YXQA 3EO3A 4IFEA 5AQJA 1CLQA 3DOKA 2FSJA 4H0VB 5BPNA 3HPHA 3OHRA 3HO1A 4AHSA 3TSQA 4Q5VA 3CI5A 3M8SA 3L4QA 4BRDA 2HVIA 4BRCA 1XNQK 5C2DA 4B1VA 4CGHA 3TI0A 4B3TK 4JKDA 2IAJA 3LPUA 4JYAK 4BR0A 1ZBHA 5C2FA 3GE1A 1SZ2A 1FXXA 1U6ZA 1T8EA 3U9ZA 3ULDA 4ILGB 3RMAA 2I7PA 4FK2A 3LANA 1SQKA 2JGUA 4CZMA 4R79A 4W5QA 1KCFA 2W41A 4LH5A 4CIGA 4ZTFA 3BY5A 1RDAA 1X3NA 4I9LA 3ZX2A 4DTPA 3OJSA 3M3ZA 3DOLA 3L2QA 2FSKA 1RTDA 4K8ZA 3AVIA 1K6YA 4HTLA 4FLTA 4LC9B 4N41A 3NDKA 2OZSA 1D5AA 2F7TA 5AQFA 3LALA 4DHYA 3E9OA 3KJVA 4CEFA 3OYNA 4F3OA 4QOZB 1GOBA 5EVZA 3JS6A 3C95A 2F9WA 1QHTA 4JI4K 4F2RA 3WXIA 3SMSA 4FM0A 2RKIA 4CHPA 4DSFA 3TTCA 5DM7L 5EX5A 3HPOA 5E26A 3DLBA 5JS1A 2GEMA 3HP9A 3C6AA 1BOTO 3NE6A 1NGJA 4WE1A 3D2EB 1BGXT 3VENA 3VGMA 4O44A 1MWKA 2VWKA 4K25A 2JWKA 3WUHA 5M1PA 1OH8A 5I42A 4DR2K 4FWNA 3THVA 1CZAN 3MN9A 4KTWA 1YTUA 3HZ6A 3M8QA 3C94A 1XWLA 4U67L 2HNZA 1X9WA 4E3SA 3ENOA 2QWNA 3VN5A 4FVMA 4CJVA 3CJ7A 5HLFA 2PY5A 4A5BA 2E6LA 5AQNA 4C8MA 3P4IA 4RW4A 4CFCA 3NGIA 4YOYA 1P90A 3KHYA 1D9DA 4FWKA 1I3AA 4X64K 3QFUA 5SWMA 4FJNA 2P9SB 1C0GA 2BANA 1YVUA 1VQON 2O8BA 3MMVA 1VK0A 2BH1A 2QTDA 4X62K 1IJJA 3EY1A 3GOIA 4DV3K 1VQ4N 2X6NA 3O9RA 4JD2B 3NF7A 4UY8O 1RBTA 4LFBK 4FWOA 2G8KA 3JSMA 3WXMB 4FLVA 1LWFA 5J1EA 4M41A 3AGKA 4GV3A 1GLDG 3GG4A 1ZBIA 1BQMA 3U9DA 1GLJO 4NCAA 1S1XA 3DLGA 5AJ3K 4FK4A 4KRFA 4DTRA 3AVGA 1WN7A 1QVFM 2UUBK 3KK7A 5KQ8A 4GV6A 2E20A 3VQCA 3PIPL 4DUZK 3LDNA 3CCVN 3IRXA 4H5WA 4H8KA 3T3FA 3J7AP 4B8AB 3LZIA 2W42A 1LW0A 5BRHA 1RTJA 4FWSA 4FWRA 4QS8A 3G4SN 1IG9A 4FJGA 2UXDK 4OJRA 4NYFA 3QDKA 1S1WA 5LL6Z 3O80A 4OLBA 1DKGD 3VQ9A 1Q18A 1N8RO 3CM5A 3F5TA 2PAVA 2E2NA 4NCGA 3RMCA 4EP4A 4DTXA 4EFHA 1SAZA 1IBLK 3LP2A 5AZJB 2HF3A 1RT5A 3MWPA 3S9HA 5AQHA 3DLHA 4FW2A 4BRNA 4Z4EA 1Q86O 4FZZA 1VRUA 4YOTA 1DTQA 3CQ8A 2OZMA 4MQ3A 1U04A 4O5FA 1NBWA 2QXLA 3AO5A 3I8DA 2P9IA 4FOIA 3QBXA 1RBRA 4DR1K 1BL3A 5ADXA 2O8DB 3ZSRA 4IG3A 3RRHA 1X9JA 1Q7YO 2AP1A 1F21A 4CESA 3CJBA 3MXMA 1GLLO 3A5NC 4GV9A 3HK2A 2A3ZA 1KQSM 2V51B 4YOUA 2E2QA 3AVHA 5D3GA 3MCPA 1GOAA 4CGDA 2P9LA 2P9KA 1E4GT 3KIOA 1NJYA 2NZTA 1L3UA 4Z94A 3RMDA 4HCCA 2EHGA 4M3YA 1VSLA 3PLAA 2BGGA 1S9GA 4M7XA 5AZIA 2OPSA 1I94K 2YNIA 4CE9A 3SI6A 4B9VA 3S3MA 4B3OA 2F8TA 4H0XB 1XQSC 3QEPA 2UUCK 3H08A 1Q81O 1KXPA 4JKFA 3V9WA 4JI3K 2QEXN 3O5BA 5E41A 4CEOA 4CW7B 3QEXA 2O8BB 1C1BA 4FLXA 3H1QA 3FGUA 3AGRA 4I6MA 5AQXA 2D1KA 3K58A 1C0TA 2QWMA 3E1YA 3QERA 3D45A 3K5NA 1VRTA 3C6UA 5KPZA 3AVNA 3QO9A 4OKJA 4E1NA 3C65A 1NK8A 3ZCMA 4CZGA 1EX4A 4CHNA 4NLBA 4CJ5A 1JLAA 1TKZA 5F2RA 3G6EN 2Y1IA 3OYKA 1BG3A 1QHAA 4CFBA 3FZHA 1VQ8N 3MECA 2AA4A 4BACA 3BGRA 2FBTA 3KLGA 1IG8A 3A5LC 3W0LA 4B3RK 4CJWA 2GUPA 3VF2A 4GW6A 4X66K 2OA8A 4MLHA 4CEQA 4KFBA 2A1RA 4CJUA 2Z1JA 2E88A 4MO5A 2F4VK 1RBUA 4CK1A 1MU2A 2FSNA 1YJNN 4CJPA 1RCHA 4KPYA 3NVMA 4KKOA 3S3OA 2W40A 2WTUA 3PX6A 1SL0A 2GELA 2HHWA 2YV0X 1VSKA 1QSLA 1OKJA 1JLBA 4DKWA 1JKHA 4BE0A 4KH6A 2ZWHA 3HOTA 2D0AA 2HHQA 1NGHA 1XC9A 2X78A 1SL1A 5GAHP 4BRFA 2HNDA 4FM1A 2XY5A 4O5BA 2ATQA 3B8AX 1VQ7N 2ZF5O 3AVLA 4JI0K 1IH7A 2HSTA 5LJWA 2ZJQL 4FJ5A 2NNWA 2E1YA 4IEIA 4X65K 3OJUA 3HL8A 5FRMA 4H4MA 3SPZA 1LCUA 2BUPA 5FROA 3WXKA 4BWMA 4DV7K 1WBBA 1C0MA 1W9HA 1GLFO 1TK5A 3OYEA 1WBDA 3E01A 4DF8A 3HSTB 1HKGA 2XHBA 3CF5L 5JVHL 4BC2A 5DMRA 3SJJA 3K2PA 4DV0K 1Q9YA 3SV4A 3RTVA 1DGKN 2P9NA 3MN6A 4QS9A 1RT4A 1MA9B 2Q1NA 4FWLA 4OPAA 4CEBA 4J2AA 2F8SA 4ILJA 3ZSOA 2P9LB 2P9KB 4DTOA 1NGBA 2YHAA 3QBWA 3SQ0A 3HTVA 4LY7A 4IXCA 4I9QA 3AVJA 1RT1A 4DU3A 4JK8A 1E3MA 4E7HA 5ADXH 5AZIB 2OANA 4BE2A 4DR4K 3CCSN 3EL2A 3HBTA 4Y1CA 3U6FA 3W3DA 4PA1A 1ZBUA 1WUAA 4MO4A 1NOYA 2UXCK 3FR0A 5JLFA 4I6MB 4TSXA 3NF9A 4CEEA 4Z4FA 3C7NA 1R59O 1KVBA 4W5RA 3ZEUB 1NK6A 3QEVA 3O6WA 2PFUA 2Q3SA 3PSFA 4E1MA 4C23A 4O0IA 3RSEB 3C6HA 4B1ZA 4CBWA 3CMAN 2HVHA 3VTIA 3KK3A 3CMEN 2A6AA 5FLXO 3SUOA 2HHHK 2E6MA 4JK9A 3K0SA 1TKTA 4BRPA 4N76A 1V4TA 2YKNA 2YHYA 3VF4A 3D7EO 3P5JA 3CG7A 2NRXA 3DRPA 5I9EB 4JS5A 3ZSWA 1TAQA 3O3GA 4QAGA 3MWTA 4WF9L 2HNYA 4FO0A 4FJ8A 1S9EA 4H0YB 5T7BA 2DFHA 1U2VA 3PX0A 4N56A 1NKCA 4KBOA 4JNEA 2Q36A 4EAHD 4CZFA 3LL3A 2NRRA 4GKJK 3I8BA 2HMPA 1ATSA 5AQZA 4JI1K 1QZ6A 3SBTA 3CQYA 5BREA 4DQPA 1LWEA 3TAQA 1DEJA 1JCEA 1P8ZA 4H0PA 4H5VA 3L0QA 2IDOA 5HRRA 4KHSA 4ZHRA 3HVTA 2GX9A 5M1OA 3VQ6A 3KVGA 3MX5A 5KPTA 3J7ZO 1QQCA 4EZ6A 4K8XA 3O4WA 3TAMA 4FJXA 1NNEA 1S1TA 3AO4A 4JK7A 4KV8A 4DQ8A 3ID8A 4BC4A 3MAQA 3C0BA 5J2MA 3THYB 2G8FA 4GVEA 2YX6A 4ISFA 4DS4A 2O8FA 2VG6A 1B92A 4Z4GA 1KLMA 2D4WA 1BI4A 4PQUA 3M1FA 1X3MA 4DV4K 1YJ9N 1CZBA 2P9NB 4JI8K 1N6QA 4YNQA 3PY8A 4B3SK 2QWLA 4CF8A 3JXUA 1XHXA 4DB3A 4OPKA 3G10A 2GV9A 1VSIA 2FBXA 4CVNE 2Z1HA 4H03B 4FZXC 1DTTA 2KZZA 1IBKK 1RNHA 5ELZA 5LMNK 1FKOA 4RW8A 3QMLA 4AF1A 3S3NA 2OPRA 5CE3A 3WNEA 2GBZA 2OPPA 5J2PA 3WNHA 1J53A 1EO1A 4XH1A 1Z05A 3QLHA 4JD2A 1NK0A 5EU7A 3V1OA 1HUXA 1RILA 1TK0A 2D5RA 3DM2A 5HBMA 3C7NB 1BO5O 2OTJN 4MFBA 5AQPA 4LF7K 1V4SA 1NGIA 3EKUA 1QS4A 3ZT3A 3V6DA 2RPIA 4IJAA 4A2AA 1VQ9N 4Y0WA 3IUCA 3WXJA 4FL9A 2VG5A 1NGAA 3HP6A 5BN8A 3OYGA 4BVPA 2AJQA 2PYJA 4CBUA 1U2VB 2WONA 3DI6A 5AQQA 3IMXA 3A0IX 4YOXA 4JI2K 1YHQN 3V9ZA 1CXUA 3LAKA 1BWFO 4NO7A 3OW2M 2Q97A 2YHBA 4RW9A 1W97L 2NRVA 3HSCA 4A2BA 4M3ZA 4JN4A 1NJXA 5M1FA 1HPMA 1T7PA 1JCGA 1UA1A 2QKBA 5AZJA 2PBDA 3BEXA 3ZX3A 1VHXA 3AO1A 3R6MA 3FE1A 5LY3A 4E7KA 4YY3K 3AAPA 1H1VA 4H0OA 2B6AA 3ZT1A 3JAMO 3IG1A 3KLFA 4E7LA 1BDGA 2G8VA 3ASMA 2YNGA 4CEAA 2O8DA 1JL2A 1ASVA 3VEWA 5AQUA 3OA9A 1HRHA 3VQ4A 2IIRA 2HBLA 2YJEA 2FXUA 2O8FB 3HXMA 2DTUA 1YIJN 3NHGA 1BI4B 3VETA 3HRGA 4B1YB 3QIOA 3CIPA 5AQRA 1B9DA 3T69A 2B4JA 3TAFA 2ZGYA 3IDHA 5M1KA 4CJKA 3O4QA 2RHKA 4CZEA 2FBVA 3CJCA 3SMPA 4F4KA 3MEGA 1ZC6A 4F2SA 2E2OA 4BRQA 4YOWA 4PKHA 1VSDA 4IO8A 2YHWA 5KPRA 3WNGA 5C15A 3IAYA 4BDZA 2FBYA 3FLCO 4G9ZA 3KKRA 1S3XA 3TAPA 4BRAA 5JICA 1M1KO 1RTIA 2G8HA 3DLLL 3O08A 4CBXA 2P1JA 2OCEA 5FPMA 4KAZA 2YI1A 4A59A 4IOAL 3G71N 4O4GA 5KRTA 1TVRA 3HM8A 4KH4A 4CZIA 3QICA 5GAEP 1IBMK 1NMNA 1K9MO 4M7YA 5CZ1A 3SAHA 4DR3K 2NRZA 4JLHA 3SV3A 3M8PA 1SV5A 2EWSA 2FC0A 1HPZA 4I2PA 3FZLA 3CERA 4FPAA 4PHTX 3P31A 2VGNA 2P9PA 3OYBA 1LV5A 2XY6A 3SUQA 3E9LA 3LDSA 5TKWA 5AQOA 1D8YA 2B5JA 4DMNA 3EE8A 1W0HA 5AQSA 4JKAA 4LF9K 1RDWX 4AM7A 4JRQA 4M63C 4JKBA 2E4LA 2O8CA 5C42A 4LSNA 4B9SA 1NU0A 4DTNA 1TK8A 4H5NA 3HI0A 4YFUA 3S41A 4JI7K 1RT3A 1ILYA 3CJ9A 1GLBG 2ZGZA 1FJGK 4CGGA 5C10A 4B1XB 2BDPA 4M45A 1IKWA 1JXEA 1YITN 1UAXA 4U7BA 4DR5K 4J2DA 1N32K 5H1SQ 3CCMN 3OYAA 4K43A 2VGMA 3EZWA 4CEZA 2QWOA 3EEQA 4DUYK 3EN9A 1DT9A 3HM9A 1QTMA 3CFPA 3B6OA 3WQUA 3M8RA 2NRTA 2V7YA 2G8IA 3SUPA 3DXMB 4LF4K 1EP4A 1YI2N 1IV0A 1U47A 3AVBA 3O4NA 1S6PA 4RW6A 3VGKA 3LDPA 2KKZA 5CZ2A 1SUQA 4EZ9A 1U4BA 2ETJA 3OYDA 5BPMA 3QEIA 4ISGA 3GL1A 4PL7A 5CR4A 3ENHA 1X1PA 3HYFA 4XH5A 2UUAK 2KZMA 4ICLA 4BROA 1MDUB 3KD1E 3E9PA 3OS1A 3PUFA 1JXBA 3BZKA 3F9KA 3LPTA 5AQKA 3UE5A 5GAGP 3TTDA 1TKXA 3SBGA 3QNOA 3SQ4A 3UKRA 2QWQA 3VQ8A 4M3UA 2HHTA 4QS7A 2YKMA 3ZEUA 2E1ZA 4PL8A 4BY9C 4BGBA 1FK9A 4YORA 3U8XA 3RSEA 3VQPA 1IKVA 1HJOA 4JHDA 3LWLA 4C8LA 3QNNA 3UIQA 3CFOA 2DFFA 3VEZA 1UA0A 2G8WA 2ASPA 1EXQA 4CJFA 4L3QA 4CZLA 3SAFA 3OYJA 3A5OC 3WQTA 3TABA 1WSFA 4K41A 3QETA 3FZFA 2P9PB 4JRPA 3CFRA 3J80O 4DFKA 3ATVA 3VQ7A 3DRSA 4YHHK 4OGEA 3D0PA 2ZM6K 4KO0A 5KRSA 5IWAK 3LP3A 3NGYA 3CCEN 4FJMA 4RWTA 5JS2A 1EWRA 4RW7A 3LM9A 2WC9A 3NMUA 1W7AA 2IVOA 1CZ9A 1XC3A 2ZJRL 4ID1A 2QI2A 4DSLA 2A42A 3KD5E 2O8CB 2IVPA 4PKIA 4YDUA 1N34K 3OBWA 3VQDA 3TSUA 1YJWN 2ZD1A 1YTAA 3VA0A 1BU6O 3SYZA 2H3GX 4GY2B 3VMFB 5SZTA 3TARA 4NXMK 4KHWA 1N33K 4CZHA 3THYA 4CJEA 2WUSA 1VQMN 1S1VA 3THWA 4F8RA 4M42A 3A8YA 1BCMA 3CCJN 5GIPA 3NF6A 1UOCA 4LF8K 1TGOA 4CGFA 5GINA 4FLWA 3L3VA 4NCBA 4DV6K 1YT3A 5AQGA 1WAFA 4B08A 4CF9A 4QCLA 1SKWA 1OH5A 1WB9A 4B9LA 3MN7A 5CHIA 5AQLA 3OYIA 3AVAA 3MDQA 2HHSA 1QSYA 4KHYA 5HOOA 1GLEG 3HT3A 4BG8A 4JV5K 1TUYA 4HHTA 3G25A 4DU4A 3R9PA 4M3WA 1G99A 2O4GA 4B9QA 3NGZA 3KLEA 2YCHA 4B9TA 4HCBA 3M6GA 5BR9A 4AHVA 3IS9A 4ZTJA 1K8KB 3SAGA 3WT0A 4YDUC 2CGKA 4C1NI 1C0FA 3IKMA 5BPLA 1WLJA 3DYAA 1WNSA 3EE9A 4FWPA 3CCQN 3GBTA 1S5JA 3FZMA 3NBPA 3UKRB 3ZETB 4BR7A 2IGIA 1Z25A 3V81A 2JWLA 3KLIA 5CYQA 1S1UA 1VSJA 4FJLA 1J6ZA 4JHDB 2QXFA 1NKBA 4C8NA 3T7ZA 4BDYA 3SQ2A 3VEYA 4CECA 5DM6L 4CEDA 3SJHA 4MDBA 2YJFA 3L3UA 4EHTA 3V9XA 2X6SA 4BQLA 4Z0UA 3O3HA 1L3SA 3AVKA 4FWMA 4BR9A 2RF2A 3SLCA 4N5SA 4AHCA 4DF4A 4CJSA 1D4XA 3HVRA 3BF3A 2LSNA 1BQNA 1NMDA 3QB0A 3P39A 2ASMA 3RR7A 4DTJA 1B9FA 1NWKA 1IKXA 3P1GA 2ASOA 4DV2K 3FFKB 3NVKA 2F9TA 1RDCA 1TUUA 2I7NA 5AQMA 1NGGA 3L8BA 1NKEA 2QKKA 3MK6A 4I2QA 3I55N 1JCFA 2E2PA 1XNRK 1KVCA 4G1QA 4CI6A 3CCLN 4WFNL 2X74A 1ASWA 1Q8IA 1YUWA 3VEVA 4R5PA 4M3TA 1WOQA 4BG9A 3OYHA 4JKHA 1NK7A 1MWMA 3LZJA 5JLHA 4ISEA 5CY4A 2RE2A 3N4PA 2GTDA 4KB1A 4FXDA 2V7ZA 1XI1A 1I39A 1NGEA 1VSHA 3VQ5A 1K73O 3OYLA 5KGWA 3QIPA 3TSPA 3F2KA 4WQ4A 2NLXA 3J8AA 3THWB 1ZBLA 3ZLJA 4FLUA 4DSJA 1A5WA 2W6LA 2ITGA 2PYLA 3EYZA 4O55A 1Q9XA 3M5RA 1T05A 1HQUA 4DTSA 3WNFA 1JLQA 5AR0A 4CERA 4E7JA 2Q0UA 4WQ5A 3MXIA 4DG1A 4OKKA 3KLHA 3DMJA 3U3YA 3OVNA 4KREA 2ITMA 4DV1K 1NK5A 3AVFA 4JKCA 3CC4N 4BGAA 4CHZA 4FJIA 3DXKA 1ZBSA 5AQYA 1LOTB 5JMVA 3VESA 2CH5A 4JI6K 2YHXA 1C0UA 1HJRA 5GADP 3H3NO 4CJRA 4B1UB 2HBJA 4PY5A 5EY4A 2A5XA 3TPQA 1EWQA 3VF6A 3GDQA 5J2NA 4DS5A 4YOVA 2HMIA 2CGLA 4OKEA 4BR4A 5LMUK 2RN2A 2R7YA 3L6QA 4MDAA 3K57A 4Y1DA 1TL3A 4E89A 1UWBA 1IKYA 3WXLA 3V4IA 1Y97A 2ZJPL 4O8UA 3ZSXA 1RBSA 1N36K 4XEIA 4LFAK 4Z4IA 4WQ4C 2ZQBA 2VG7A 2UU9K 3DJCA 4IWVA 4EP5A 2NRWA 5CYMA 1VQNN 1QQMA 2VWBA 3PX4A 4CFAA 3BZCA 4OPHA 3ZX0A 3ZSYA 4B8CA 4C8OA 4OGCA 2VYPA 3L2VA 4DSIA 1KTQA 4BC5A 2HF4A 5FPDA 1R0AA 2E5LK 1EKEA 3L2WA 1L3TA 4WFAL 4WQ5C 2WBNA 4JS4A 4AH9A 4JEPA 1RDDA 5C25A 3HPGA 4OPJA 5FPEA 4CIEA 1M90O 1HR0K 4FLYA 2KFNA 1NLVA 4CGIA 1ATNA 3AV9A 4CJ4A 1J5EK 4M3XA 4B1WB 3KTQA 3I0RA 4CK2A 4HUEA 4KHQA 1Y64A 3CQXA 5I3UA 3LP0A 3SCXA 1QVGM 3UKUA 3QEWA 4BWJA 3RR8A 1TYQB 5HRNA 2VCPA 3TWHA 4KI6A 3O3FA 1QZ5A 1JLFA 1QSSA 1SKRA 4B3MK 4KB0A 1J5OA 5GIOA 1VQ5N 3ZYYX 2F96A 3V9UA 3EKSA 1T6DA 4DLEA 3ZSVA 4IOCL 3CD6N 1OH6A 3DWLA 4FWQA 5HL7L 2KHOA 2QWPA 3B6PA 1VSEA 1NJIO 2KTQA 3R8EA 1L3VA 1JLEA 3P83D 3ZT4A 3VA3A 4CK3A 5J2QA 4O0JA 1RDBA 3DXMA 4LSLA 1GLAG 3U3GA 1WSGA 2XY8A 4BRMA 5BR8K 3N4QA 1OH7A 3TTFA 3K9JA 1X9SA 2Q2RA 1T44A 1RBVA 2O8EB 1O1WA 4CZKA 2YNHA 3ZSZA 4BDPA 1RDUA 1NM1A 4CF2A 3DXKB 4OO1J 1RTHA 1VAZA 3WEEA 2G8UA 2HHXA 1NGDA 4WFBL 1KFDA 4OX9K 3I0SA 5AFUA 3CJ1A 1A5XA 3ITHA 1O13A 1KAZA 3BDPA 3D2FA 1KSPA 3FFIA 4BRHA 4JKGB 2NRHA 3O9SA 4LF5K 3K5LA 3MX2A 4C8KA 2OPQA 1XHZA 1EQYA 3NFAA 4IKFA 2IOCA 1VQLN 3H3OB 5TKYA 1VSMA 3CJAA 1TAUA 3OTOK 4CZJA 1LW2A 4DFMA 1XMQK 4E7IA 2WOMA 4H5RA 3QESA 2HB5A 4BREA 4IDHA 1FKPA 4FJJA 1RT7A 4BVOA 1HNXK 1VQPN 3LAMA 4FK0A 3DRRA 3PIOL 1ATRA 5JVGL 2HOEA 3DLEA 2QWRA 3K9KA 3V9SA 3F73A 2HHUA 3KKSA 3KWGA 4AM6A 2HBKA 4W5TA 3RWUA 3OBYA 5IT9O 1SS6A 4BRIA 4IDKA 1HNWK 4AHRA 4CFDA 4CJ7A 3NH0A 1KFSA 1WSIA 5F0XA 4CIFA 1Q82O 2NUBA 3MEDA 3T1YK 2D0BA 5FPNA 3LDOA
chains in the Genus database with same CATH topology
4KO0A 5KRSA 4N56A 3DOLA 3LP3A 1A5VA 1QE1A 3NGYA 3OJSA 3L2QA 5HROA 1KRPA 4ELUA 1RTDA 4K8ZA 2XRIA 3AVIA 4FJMA 1K6YA 4AHUA 3HJFA 4FLTA 1U48A 5JS2A 3OY9A 4N41A 2JLEA 4RW7A 3NDKA 2OZSA 1CZ9A 1D5AA 4ID1A 4DQPA 4DSLA 3LALA 3KD5E 3DLKA 3KJVA 1LWEA 2Z1IA 4CEFA 3OS0A 3TAQA 2P5GA 3OYNA 1U45A 2KW4A 4F3OA 4QOZB 2IDOA 1GOBA 3AA3A 5HRRA 1JLCA 4KHSA 3C95A 4ZHRA 3V1RA 1QHTA 3HVTA 3VQDA 3T19A 4F2RA 4FM0A 2RKIA 3VQ6A 2ZD1A 3EZ5A 1J54A 1YTAA 4CHPA 1QQCA 3VA0A 3SYZA 4EZ6A 4DSFA 4K8XA 3TAMA 5SZTA 3TARA 4KHWA 3L2UA 3HPOA 3DLBA 4DFJA 1WSJA 4FJXA 5JS1A 1S1TA 4CJEA 2Z1GA 3HP9A 3AO4A 1S1VA 4KV8A 3MAQA 4F8RA 4M42A 3CYMA 3NE6A 5J2MA 1BCMA 4WE1A 4DQQA 4M3RA 3NAEA 1BGXT 2G8FA 2HHQA 3NF6A 1EETA 1UOCA 3V1QA 4PUOA 1VSFA 1TGOA 4O44A 4CGFA 4CCHA 4FLWA 4DS4A 2VWKA 4DTMA 2VG6A 1B92A 3L3VA 3KK1A 4NCBA 4Z4GA 1KLMA 5K14A 1BI4A 1YT3A 5I42A 4B08A 1WAFA 4CF9A 3THVA 4PQUA 4KTWA 1YTUA 4QCLA 1SKWA 1CZBA 1WAJA 3M8QA 4B9LA 1HQEA 3C94A 2KQ2A 3T1AA 1XWLA 4CF0A 1N6QA 4KTZA 4N47A 2HNZA 4YNQA 3PY8A 1X9WA 3OYIA 3AVAA 4CF8A 4E3SA 4HUGA 1XHXA 2HHSA 3PO4A 3VN5A 4OPKA 4FVMA 4IFYA 1QSYA 4KHYA 4CJVA 1WSHA 3G10A 1TKDA 2GV9A 5HLFA 2PY5A 4W5NA 3HT3A 3OYMA 3K59A 1VSIA 2E6LA 4FJKA 4C8MA 2FBXA 4HHTA 4RW4A 4DU4A 4CFCA 2Z1HA 4FCYA 4M3WA 1KVAA 2O4GA 1DLOA 3NGZA 3KLEA 3NGIA 4B9TA 4HCBA 4UQGA 4FZXC 1DTTA 3TAEA 2KZZA 5FDLA 4AHVA 1RNHA 3IS9A 1D9DA 1FKOA 4RW8A 4ZTJA 4F3TA 3D0PA 3TR8A 3S3NA 2OPRA 1I3AA 3WNEA 5SWMA 4W5OA 4FJNA 2GBZA 2OPPA 2BANA 1YVUA 5J2PA 1WLJA 3WNHA 2I5JA 1VK0A 3RMBA 3DYAA 1J53A 1WNSA 4IBNA 3EY1A 3QLHA 1S5JA 4KHNA 4CHOA 1NK0A 5EU7A 3V1OA 3MEEA 3NBPA 1RILA 2X6NA 1TK0A 2D5RA 3DM2A 5HBMA 2IGIA 1C1CA 1Z25A 4Z4CA 3V81A 3KLIA 5CYQA 2GUIA 5HRPA 4MFBA 3NF7A 4LH4A 1S1UA 1VSJA 4RG8A 4FJLA 1RBTA 2KFZA 2Y1JA 3KK2A 2G8KA 2QXFA 1NKBA 3JSMA 4C8NA 4FLVA 4BDYA 1HNIA 3SQ2A 1LWFA 5J1EA 4B9MA 4CECA 4CEDA 1QS4A 4M41A 3ZT3A 3V6DA 2RPIA 3L3UA 3V9XA 4KHUA 2X6SA 3O3HA 1HMVA 2IS3A 4Z0UA 1BQMA 1ZBIA 2XO7A 1L3SA 3AVKA 3VQAA 1SL2A 1G15A 2RF2A 4NCAA 1S1XA 4N5SA 3DLGA 1REVA 3MXJA 2VG5A 4AHCA 3HP6A 4CJSA 4DF4A 4FK4A 4OLAA 4KRFA 3HVRA 4DTRA 2LSNA 1J9AA 2VWJA 3AVGA 1BQNA 1WN7A 3OYGA 4DTJA 3RR7A 1B9FA 4I7FA 1IKXA 2P51A 3P1GA 3VQCA 2AJQA 2PYJA 4DQIA 3IRXA 4H8KA 3T3FA 1RDCA 4CJTA 4HVJA 2WONA 3DI6A 4B8AB 3LZIA 2W42A 1LW0A 3L8BA 3PV8A 1RTJA 3V9ZA 1CXUA 3LAKA 1NKEA 3LWMA 2QKKA 1IG9A 1KLNA 3ZSQA 4AHTA 1S6QA 4I2QA 1TV6A 4FJGA 2YHBA 4RW9A 4OJRA 1KVCA 4G1QA 1BIUA 4NYFA 1S1WA 4M3ZA 1NJXA 1RT2A 2X74A 4OLBA 1ASWA 1Q8IA 4R5PA 3VQ9A 4FZYA 1NJZA 1T7PA 4M3TA 2QKBA 1UA1A 3CM5A 4DSEA 3OYHA 3ALYA 1NK7A 4DSKA 4NCGA 3RMCA 3LZJA 4EP4A 4DTXA 3SPYA 3LP2A 5CY4A 3JYTA 3AO1A 4BE1A 2IC3A 4E7KA 4KB1A 4DLGA 4FXDA 1XI1A 4Z4HA 1I39A 2HW3A 2B6AA 1RT5A 1VSHA 3S9HA 4Q0BA 3VQ5A 3ZT1A 3G0ZA 3IG1A 3KLFA 4FW2A 5KGWA 3QIPA 3OYLA 4E7LA 3DLHA 4FZZA 4Z4EA 1VRUA 4FJHA 1DTQA 3CQ8A 2G8VA 2OZMA 3ASMA 4MQ3A 2YNGA 1ZYQA 3PO5A 4CEAA 1ITGA 1JL2A 1U04A 3L2RA 4FLUA 1ASVA 4DQSA 1ZBLA 3AO5A 3I8DA 4DSJA 1A5WA 1RBRA 3SQ1A 1HRHA 3SUNA 3VQ4A 1BL3A 3ZSRA 4OVLA 3TANA 2ITGA 4IG3A 3RRHA 2PYLA 3EYZA 2YNFA 4O55A 3HXMA 3TAGA 1Q9XA 2DTUA 1T05A 1F21A 4H4OA 1HQUA 3NHGA 4GVMA 4CESA 4DTSA 1BI4B 3WNFA 3SNNA 1JLQA 3MXMA 4CERA 3HK2A 4E7JA 4L8RB 4PWDA 2HHVA 3QIOA 3MXIA 3AVHA 5D3GA 1B9DA 1GOAA 2B4JA 4OKKA 4DG1A 3KLHA 3DMJA 3U3YA 3TAFA 4CGDA 3OVNA 4KREA 4CJKA 3KIOA 1NJYA 3AO2A 1L3UA 3K5OA 1NK5A 3AVFA 3O4QA 2D0CA 3RMDA 4HCCA 2EHGA 4M3YA 1VSLA 4CHZA 4FJIA 1S9GA 2FBVA 2BGGA 1LAWA 3MEGA 4F4KA 2OPSA 4DU1A 2YNIA 4CE9A 3SI6A 4F2SA 4B9VA 1C0UA 1VSDA 1HJRA 3S3MA 1BCOA 2F8TA 4B3OA 4CJRA 4ELVA 3QEPA 5KI6A 3NH1A 3H08A 4PY5A 1D9FA 4CJ3A 3WNGA 4DTUA 3V9WA 5C24A 4XIUA 5J2NA 5E41A 4BDZA 2FBYA 4ID5A 4DS5A 3IAYA 3KKRA 4CEOA 3QEXA 2HMIA 5KTQA 4KI4A 1C6VA 5FRNA 4OKEA 4DWIA 1C1BA 4FLXA 3ZT0A 2RN2A 3TAPA 2QK9A 1ASUA 2R7YA 3AA2A 1T03A 3K57A 4Y1DA 1TL3A 4E89A 1HNVA 1UWBA 1RTIA 1Z26A 3K58A 1IKYA 3V4IA 1C0TA 1NJWA 2G8HA 2P1JA 1Y97A 2DFEA 3QERA 3ZSXA 3D45A 3K5NA 1RBSA 2DY4A 1VRTA 4Z4IA 4J2BA 4KAZA 3C6UA 2ZQBA 2P5OA 3AVNA 2VG7A 3QO9A 4OKJA 3OYFA 2XY7A 4O4GA 4E1NA 5KRTA 1TVRA 4EP5A 1NK8A 3ZCMA 4CHNA 1EX4A 5CYMA 4E19A 4HUFA 3DLRA 3VQQA 4CJ5A 3PX4A 1JL1A 4CFAA 1U49A 1HYSA 4B8CA 3ZSYA 1JLAA 1TKZA 4LD0A 1BISA 3NH2A 4OGCA 4CHQA 4C8OA 4FJ7A 2Y1IA 4FM2A 5CZ1A 3OYKA 4CFBA 1NOZA 4CF1A 5KGXA 3MECA 1HYVA 1KTQA 4JLHA 3L2VA 4BACA 3SV3A 1LWCA 4DQRA 3M8PA 4DSIA 1X9MA 3BGRA 2FBTA 4FW1A 3KLGA 1SV5A 1R0AA 4J2EA 1EKEA 2FC0A 3L2WA 1L3TA 4CJWA 1HPZA 4GW6A 4I2PA 4JS4A 2OA8A 4CEQA 2A1RA 4KFBA 4AH9A 4NYNA 4CJUA 4IFVA 2Z1JA 1RDDA 5C25A 3HPGA 4OPJA 3OYBA 1RBUA 4CGJA 4CK1A 1LV5A 5HRSA 4CIEA 1MU2A 2XY6A 4B9NA 3A2FA 4FLYA 3SUQA 2KFNA 4CJPA 1RCHA 3LDSA 4KPYA 1HYZA 2A1SA 3QINA 3VQEA 1D8YA 1RT6A 2B5JA 4KKOA 3NF8A 4CGIA 3AV9A 3S3OA 4DMNA 4CJ4A 3PX6A 4DFPA 4M3XA 1SL0A 1IO2A 1W0HA 1SKSA 3KTQA 2HHWA 3I0RA 3K5MA 4CK2A 4HUEA 3LP1A 4KHQA 2YV0X 2O4IA 1VSKA 5I3UA 1QSLA 4JRQA 4E0DA 1JLBA 3LP0A 3SCXA 1JKHA 1BIZA 1LAVA 4FLZA 4BE0A 2E4LA 1WSEA 5C42A 4LSNA 1N5YA 4ELTA 4B9SA 2D0AA 3CM6A 4BWJA 3AA4A 4DTNA 3QEWA 1XC9A 1TK8A 3RR8A 2X78A 2OYQA 1SL1A 5HRNA 4YFUA 3AO3A 3TWHA 1JLGA 2HNDA 1ZBFA 1JLFA 3O3FA 4FM1A 4O5BA 3SZ2A 2ATQA 1RT3A 2XY5A 1QSSA 1SKRA 3AVLA 4KB0A 1IH7A 1J5OA 4FJ5A 3OJUA 2F96A 4CHYA 3V9UA 4DLEA 3HL8A 5FRMA 4H4MA 3ZSVA 3AVCA 3SPZA 3AVMA 4CGGA 5FROA 4BWMA 1GOCA 2BDPA 4M45A 1IKWA 3ISNC 1C0MA 4GMJB 1W9HA 4CJLA 1JXEA 1UAXA 3B6PA 1VSEA 5HP1A 3RRGA 4J2DA 2KTQA 1TK5A 3OYAA 3OYEA 3E01A 4DF8A 3HSTB 2XHBA 1L3VA 1JLEA 4CEZA 3P83D 3ZT4A 3VA3A 4CK3A 5J2QA 2ZE2A 4O0JA 5DMRA 3SJJA 1RDBA 1TL1A 3K2PA 4LSLA 3HM9A 3NCIA 5DK5A 1Q9YA 3U3GA 4HTUA 3SV4A 3CFPA 1WSGA 2XY8A 3B6OA 3RTVA 1NK9A 2BE2A 3AA5X 3M8RA 1RT4A 2G8IA 3VQBA 4AILC 3SUPA 1X9SA 4CEBA 4B9UA 4J2AA 1EP4A 2EX3A 2PZSA 2F8SA 1U47A 3ZSOA 1QTMA 3AVBA 4FJ9A 1RBVA 4DTOA 4IG0A 2YHAA 3SQ0A 1O1WA 3O4NA 4LY7A 1S6PA 2YNHA 4RW6A 3ZSZA 1CXQA 4BDPA 4I9QA 4FYDA 4CF2A 3AVJA 5CZ2A 1RT1A 4DU3A 1SUQA 1BHLA 1RTHA 1U4BA 4EZ9A 4E7HA 4KI6A 2G8UA 2HHXA 2ETJA 3OYCA 3OYDA 4BE2A 3QEIA 4KTQA 1KFDA 3I0SA 1L5UA 1A5XA 4Y1CA 3ITHA 3U6FA 3BDPA 1KSPA 4PA1A 1X1PA 3FFIA 3HYFA 1NK4A 1ZBUA 2KZMA 1C1AA 3K5LA 4ICLA 3OS2A 4C8KA 2OPQA 1XHZA 3ZT2A 3C6TA 3NFAA 4IKFA 3KD1E 2IOCA 4CJQA 3OS1A 1NOYA 1VSMA 3PUFA 1JXBA 1CLQA 3DOKA 3F9KA 3LPTA 4TSXA 3NF9A 1TAUA 1TKXA 1LW2A 3QNOA 4DFMA 3HPHA 3SQ4A 4CEEA 3VQ8A 4E7IA 2WOMA 4M3UA 4Z4FA 2YKMA 3HO1A 2HHTA 4AHSA 4Q5VA 3QESA 2HB5A 3M8SA 1FK9A 1FKPA 3VQPA 1IKVA 1KVBA 4FJJA 1RT7A 2HVIA 4W5RA 3LWLA 3LAMA 4C8LA 1NK6A 3QEVA 3QNNA 4CGHA 3TI0A 2Q3SA 4E1MA 3UIQA 4O0IA 4FK0A 3CFOA 3DRRA 2DFFA 2HVHA 1NKCA 3KK3A 1UA0A 2IAJA 3LPUA 2G8WA 1EXQA 4CJFA 3SUOA 3DLEA 2HHUA 2E6MA 3V9SA 3F73A 1ZBHA 3KKSA 4W5TA 1TKTA 3OYJA 3RWUA 4N76A 2YKNA 4IDKA 1FXXA 4AHRA 4CFDA 3TABA 3NH0A 1KFSA 3P5JA 3CG7A 1WSFA 3DRPA 1T8EA 4JS5A 3ULDA 3QETA 1WSIA 1TAQA 3ZSWA 3RMAA 3O3GA 4QAGA 4FK2A 3LANA 4CIFA 2HNYA 4JRPA 3CFRA 2JGUA 4FJ8A 4W5QA 1KCFA 1S9EA 2NUBA 4LH5A 3VQ7A 3DRSA 3MEDA 4CIGA 4DFKA 4ZTFA 2D0BA 1RDAA 2DFHA 5T7BA 4I9LA 4OGEA 3PX0A 4DTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KO0 A;  5KRS A;  4N56 A;  3DOL A;  3LP3 A;  1A5V A;  1QE1 A;  3NGY A;  3OJS A;  3L2Q A;  5HRO A;  1KRP A;  4ELU A;  1RTD A;  4K8Z A;  2XRI A;  3AVI A;  4FJM A;  1K6Y A;  4AHU A;  3HJF A;  4FLT A;  1U48 A;  5JS2 A;  3OY9 A;  4N41 A;  2JLE A;  4RW7 A;  3NDK A;  2OZS A;  1CZ9 A;  1D5A A;  4ID1 A;  4DQP A;  4DSL A;  3LAL A;  3KD5 E;  3DLK A;  3KJV A;  1LWE A;  2Z1I A;  4CEF A;  3OS0 A;  3TAQ A;  2P5G A;  3OYN A;  1U45 A;  2KW4 A;  4F3O A;  4QOZ B;  2IDO A;  1GOB A;  3AA3 A;  5HRR A;  1JLC A;  4KHS A;  3C95 A;  4ZHR A;  3V1R A;  1QHT A;  3HVT A;  3VQD A;  3T19 A;  4F2R A;  4FM0 A;  2RKI A;  3VQ6 A;  2ZD1 A;  3EZ5 A;  1J54 A;  1YTA A;  4CHP A;  1QQC A;  3VA0 A;  3SYZ A;  4EZ6 A;  4DSF A;  4K8X A;  3TAM A;  5SZT A;  3TAR A;  4KHW A;  3L2U A;  3HPO A;  3DLB A;  4DFJ A;  1WSJ A;  4FJX A;  5JS1 A;  1S1T A;  4CJE A;  2Z1G A;  3HP9 A;  3AO4 A;  1S1V A;  4KV8 A;  3MAQ A;  4F8R A;  4M42 A;  3CYM A;  3NE6 A;  5J2M A;  1BCM A;  4WE1 A;  4DQQ A;  4M3R A;  3NAE A;  1BGX T;  2G8F A;  2HHQ A;  3NF6 A;  1EET A;  1UOC A;  3V1Q A;  4PUO A;  1VSF A;  1TGO A;  4O44 A;  4CGF A;  4CCH A;  4FLW A;  4DS4 A;  2VWK A;  4DTM A;  2VG6 A;  1B92 A;  3L3V A;  3KK1 A;  4NCB A;  4Z4G A;  1KLM A;  5K14 A;  1BI4 A;  1YT3 A;  5I42 A;  4B08 A;  1WAF A;  4CF9 A;  3THV A;  4PQU A;  4KTW A;  1YTU A;  4QCL A;  1SKW A;  1CZB A;  1WAJ A;  3M8Q A;  4B9L A;  1HQE A;  3C94 A;  2KQ2 A;  3T1A A;  1XWL A;  4CF0 A;  1N6Q A;  4KTZ A;  4N47 A;  2HNZ A;  4YNQ A;  3PY8 A;  1X9W A;  3OYI A;  3AVA A;  4CF8 A;  4E3S A;  4HUG A;  1XHX A;  2HHS A;  3PO4 A;  3VN5 A;  4OPK A;  4FVM A;  4IFY A;  1QSY A;  4KHY A;  4CJV A;  1WSH A;  3G10 A;  1TKD A;  2GV9 A;  5HLF A;  2PY5 A;  4W5N A;  3HT3 A;  3OYM A;  3K59 A;  1VSI A;  2E6L A;  4FJK A;  4C8M A;  2FBX A;  4HHT A;  4RW4 A;  4DU4 A;  4CFC A;  2Z1H A;  4FCY A;  4M3W A;  1KVA A;  2O4G A;  1DLO A;  3NGZ A;  3KLE A;  3NGI A;  4B9T A;  4HCB A;  4UQG A;  4FZX C;  1DTT A;  3TAE A;  2KZZ A;  5FDL A;  4AHV A;  1RNH A;  3IS9 A;  1D9D A;  1FKO A;  4RW8 A;  4ZTJ A;  4F3T A;  3D0P A;  3TR8 A;  3S3N A;  2OPR A;  1I3A A;  3WNE A;  5SWM A;  4W5O A;  4FJN A;  2GBZ A;  2OPP A;  2BAN A;  1YVU A;  5J2P A;  1WLJ A;  3WNH A;  2I5J A;  1VK0 A;  3RMB A;  3DYA A;  1J53 A;  1WNS A;  4IBN A;  3EY1 A;  3QLH A;  1S5J A;  4KHN A;  4CHO A;  1NK0 A;  5EU7 A;  3V1O A;  3MEE A;  3NBP A;  1RIL A;  2X6N A;  1TK0 A;  2D5R A;  3DM2 A;  5HBM A;  2IGI A;  1C1C A;  1Z25 A;  4Z4C A;  3V81 A;  3KLI A;  5CYQ A;  2GUI A;  5HRP A;  4MFB A;  3NF7 A;  4LH4 A;  1S1U A;  1VSJ A;  4RG8 A;  4FJL A;  1RBT A;  2KFZ A;  2Y1J A;  3KK2 A;  2G8K A;  2QXF A;  1NKB A;  3JSM A;  4C8N A;  4FLV A;  4BDY A;  1HNI A;  3SQ2 A;  1LWF A;  5J1E A;  4B9M A;  4CEC A;  4CED A;  1QS4 A;  4M41 A;  3ZT3 A;  3V6D A;  2RPI A;  3L3U A;  3V9X A;  4KHU A;  2X6S A;  3O3H A;  1HMV A;  2IS3 A;  4Z0U A;  1BQM A;  1ZBI A;  2XO7 A;  1L3S A;  3AVK A;  3VQA A;  1SL2 A;  1G15 A;  2RF2 A;  4NCA A;  1S1X A;  4N5S A;  3DLG A;  1REV A;  3MXJ A;  2VG5 A;  4AHC A;  3HP6 A;  4CJS A;  4DF4 A;  4FK4 A;  4OLA A;  4KRF A;  3HVR A;  4DTR A;  2LSN A;  1J9A A;  2VWJ A;  3AVG A;  1BQN A;  1WN7 A;  3OYG A;  4DTJ A;  3RR7 A;  1B9F A;  4I7F A;  1IKX A;  2P51 A;  3P1G A;  3VQC A;  2AJQ A;  2PYJ A;  4DQI A;  3IRX A;  4H8K A;  3T3F A;  1RDC A;  4CJT A;  4HVJ A;  2WON A;  3DI6 A;  4B8A B;  3LZI A;  2W42 A;  1LW0 A;  3L8B A;  3PV8 A;  1RTJ A;  3V9Z A;  1CXU A;  3LAK A;  1NKE A;  3LWM A;  2QKK A;  1IG9 A;  1KLN A;  3ZSQ A;  4AHT A;  1S6Q A;  4I2Q A;  1TV6 A;  4FJG A;  2YHB A;  4RW9 A;  4OJR A;  1KVC A;  4G1Q A;  1BIU A;  4NYF A;  1S1W A;  4M3Z A;  1NJX A;  1RT2 A;  2X74 A;  4OLB A;  1ASW A;  1Q8I A;  4R5P A;  3VQ9 A;  4FZY A;  1NJZ A;  1T7P A;  4M3T A;  2QKB A;  1UA1 A;  3CM5 A;  4DSE A;  3OYH A;  3ALY A;  1NK7 A;  4DSK A;  4NCG A;  3RMC A;  3LZJ A;  4EP4 A;  4DTX A;  3SPY A;  3LP2 A;  5CY4 A;  3JYT A;  3AO1 A;  4BE1 A;  2IC3 A;  4E7K A;  4KB1 A;  4DLG A;  4FXD A;  1XI1 A;  4Z4H A;  1I39 A;  2HW3 A;  2B6A A;  1RT5 A;  1VSH A;  3S9H A;  4Q0B A;  3VQ5 A;  3ZT1 A;  3G0Z A;  3IG1 A;  3KLF A;  4FW2 A;  5KGW A;  3QIP A;  3OYL A;  4E7L A;  3DLH A;  4FZZ A;  4Z4E A;  1VRU A;  4FJH A;  1DTQ A;  3CQ8 A;  2G8V A;  2OZM A;  3ASM A;  4MQ3 A;  2YNG A;  1ZYQ A;  3PO5 A;  4CEA A;  1ITG A;  1JL2 A;  1U04 A;  3L2R A;  4FLU A;  1ASV A;  4DQS A;  1ZBL A;  3AO5 A;  3I8D A;  4DSJ A;  1A5W A;  1RBR A;  3SQ1 A;  1HRH A;  3SUN A;  3VQ4 A;  1BL3 A;  3ZSR A;  4OVL A;  3TAN A;  2ITG A;  4IG3 A;  3RRH A;  2PYL A;  3EYZ A;  2YNF A;  4O55 A;  3HXM A;  3TAG A;  1Q9X A;  2DTU A;  1T05 A;  1F21 A;  4H4O A;  1HQU A;  3NHG A;  4GVM A;  4CES A;  4DTS A;  1BI4 B;  3WNF A;  3SNN A;  1JLQ A;  3MXM A;  4CER A;  3HK2 A;  4E7J A;  4L8R B;  4PWD A;  2HHV A;  3QIO A;  3MXI A;  3AVH A;  5D3G A;  1B9D A;  1GOA A;  2B4J A;  4OKK A;  4DG1 A;  3KLH A;  3DMJ A;  3U3Y A;  3TAF A;  4CGD A;  3OVN A;  4KRE A;  4CJK A;  3KIO A;  1NJY A;  3AO2 A;  1L3U A;  3K5O A;  1NK5 A;  3AVF A;  3O4Q A;  2D0C A;  3RMD A;  4HCC A;  2EHG A;  4M3Y A;  1VSL A;  4CHZ A;  4FJI A;  1S9G A;  2FBV A;  2BGG A;  1LAW A;  3MEG A;  4F4K A;  2OPS A;  4DU1 A;  2YNI A;  4CE9 A;  3SI6 A;  4F2S A;  4B9V A;  1C0U A;  1VSD A;  1HJR A;  3S3M A;  1BCO A;  2F8T A;  4B3O A;  4CJR A;  4ELV A;  3QEP A;  5KI6 A;  3NH1 A;  3H08 A;  4PY5 A;  1D9F A;  4CJ3 A;  3WNG A;  4DTU A;  3V9W A;  5C24 A;  4XIU A;  5J2N A;  5E41 A;  4BDZ A;  2FBY A;  4ID5 A;  4DS5 A;  3IAY A;  3KKR A;  4CEO A;  3QEX A;  2HMI A;  5KTQ A;  4KI4 A;  1C6V A;  5FRN A;  4OKE A;  4DWI A;  1C1B A;  4FLX A;  3ZT0 A;  2RN2 A;  3TAP A;  2QK9 A;  1ASU A;  2R7Y A;  3AA2 A;  1T03 A;  3K57 A;  4Y1D A;  1TL3 A;  4E89 A;  1HNV A;  1UWB A;  1RTI A;  1Z26 A;  3K58 A;  1IKY A;  3V4I A;  1C0T A;  1NJW A;  2G8H A;  2P1J A;  1Y97 A;  2DFE A;  3QER A;  3ZSX A;  3D45 A;  3K5N A;  1RBS A;  2DY4 A;  1VRT A;  4Z4I A;  4J2B A;  4KAZ A;  3C6U A;  2ZQB A;  2P5O A;  3AVN A;  2VG7 A;  3QO9 A;  4OKJ A;  3OYF A;  2XY7 A;  4O4G A;  4E1N A;  5KRT A;  1TVR A;  4EP5 A;  1NK8 A;  3ZCM A;  4CHN A;  1EX4 A;  5CYM A;  4E19 A;  4HUF A;  3DLR A;  3VQQ A;  4CJ5 A;  3PX4 A;  1JL1 A;  4CFA A;  1U49 A;  1HYS A;  4B8C A;  3ZSY A;  1JLA A;  1TKZ A;  4LD0 A;  1BIS A;  3NH2 A;  4OGC A;  4CHQ A;  4C8O A;  4FJ7 A;  2Y1I A;  4FM2 A;  5CZ1 A;  3OYK A;  4CFB A;  1NOZ A;  4CF1 A;  5KGX A;  3MEC A;  1HYV A;  1KTQ A;  4JLH A;  3L2V A;  4BAC A;  3SV3 A;  1LWC A;  4DQR A;  3M8P A;  4DSI A;  1X9M A;  3BGR A;  2FBT A;  4FW1 A;  3KLG A;  1SV5 A;  1R0A A;  4J2E A;  1EKE A;  2FC0 A;  3L2W A;  1L3T A;  4CJW A;  1HPZ A;  4GW6 A;  4I2P A;  4JS4 A;  2OA8 A;  4CEQ A;  2A1R A;  4KFB A;  4AH9 A;  4NYN A;  4CJU A;  4IFV A;  2Z1J A;  1RDD A;  5C25 A;  3HPG A;  4OPJ A;  3OYB A;  1RBU A;  4CGJ A;  4CK1 A;  1LV5 A;  5HRS A;  4CIE A;  1MU2 A;  2XY6 A;  4B9N A;  3A2F A;  4FLY A;  3SUQ A;  2KFN A;  4CJP A;  1RCH A;  3LDS A;  4KPY A;  1HYZ A;  2A1S A;  3QIN A;  3VQE A;  1D8Y A;  1RT6 A;  2B5J A;  4KKO A;  3NF8 A;  4CGI A;  3AV9 A;  3S3O A;  4DMN A;  4CJ4 A;  3PX6 A;  4DFP A;  4M3X A;  1SL0 A;  1IO2 A;  1W0H A;  1SKS A;  3KTQ A;  2HHW A;  3I0R A;  3K5M A;  4CK2 A;  4HUE A;  3LP1 A;  4KHQ A;  2YV0 X;  2O4I A;  1VSK A;  5I3U A;  1QSL A;  4JRQ A;  4E0D A;  1JLB A;  3LP0 A;  3SCX A;  1JKH A;  1BIZ A;  1LAV A;  4FLZ A;  4BE0 A;  2E4L A;  1WSE A;  5C42 A;  4LSN A;  1N5Y A;  4ELT A;  4B9S A;  2D0A A;  3CM6 A;  4BWJ A;  3AA4 A;  4DTN A;  3QEW A;  1XC9 A;  1TK8 A;  3RR8 A;  2X78 A;  2OYQ A;  1SL1 A;  5HRN A;  4YFU A;  3AO3 A;  3TWH A;  1JLG A;  2HND A;  1ZBF A;  1JLF A;  3O3F A;  4FM1 A;  4O5B A;  3SZ2 A;  2ATQ A;  1RT3 A;  2XY5 A;  1QSS A;  1SKR A;  3AVL A;  4KB0 A;  1IH7 A;  1J5O A;  4FJ5 A;  3OJU A;  2F96 A;  4CHY A;  3V9U A;  4DLE A;  3HL8 A;  5FRM A;  4H4M A;  3ZSV A;  3AVC A;  3SPZ A;  3AVM A;  4CGG A;  5FRO A;  4BWM A;  1GOC A;  2BDP A;  4M45 A;  1IKW A;  3ISN C;  1C0M A;  4GMJ B;  1W9H A;  4CJL A;  1JXE A;  1UAX A;  3B6P A;  1VSE A;  5HP1 A;  3RRG A;  4J2D A;  2KTQ A;  1TK5 A;  3OYA A;  3OYE A;  3E01 A;  4DF8 A;  3HST B;  2XHB A;  1L3V A;  1JLE A;  4CEZ A;  3P83 D;  3ZT4 A;  3VA3 A;  4CK3 A;  5J2Q A;  2ZE2 A;  4O0J A;  5DMR A;  3SJJ A;  1RDB A;  1TL1 A;  3K2P A;  4LSL A;  3HM9 A;  3NCI A;  5DK5 A;  1Q9Y A;  3U3G A;  4HTU A;  3SV4 A;  3CFP A;  1WSG A;  2XY8 A;  3B6O A;  3RTV A;  1NK9 A;  2BE2 A;  3AA5 X;  3M8R A;  1RT4 A;  2G8I A;  3VQB A;  4AIL C;  3SUP A;  1X9S A;  4CEB A;  4B9U A;  4J2A A;  1EP4 A;  2EX3 A;  2PZS A;  2F8S A;  1U47 A;  3ZSO A;  1QTM A;  3AVB A;  4FJ9 A;  1RBV A;  4DTO A;  4IG0 A;  2YHA A;  3SQ0 A;  1O1W A;  3O4N A;  4LY7 A;  1S6P A;  2YNH A;  4RW6 A;  3ZSZ A;  1CXQ A;  4BDP A;  4I9Q A;  4FYD A;  4CF2 A;  3AVJ A;  5CZ2 A;  1RT1 A;  4DU3 A;  1SUQ A;  1BHL A;  1RTH A;  1U4B A;  4EZ9 A;  4E7H A;  4KI6 A;  2G8U A;  2HHX A;  2ETJ A;  3OYC A;  3OYD A;  4BE2 A;  3QEI A;  4KTQ A;  1KFD A;  3I0S A;  1L5U A;  1A5X A;  4Y1C A;  3ITH A;  3U6F A;  3BDP A;  1KSP A;  4PA1 A;  1X1P A;  3FFI A;  3HYF A;  1NK4 A;  1ZBU A;  2KZM A;  1C1A A;  3K5L A;  4ICL A;  3OS2 A;  4C8K A;  2OPQ A;  1XHZ A;  3ZT2 A;  3C6T A;  3NFA A;  4IKF A;  3KD1 E;  2IOC A;  4CJQ A;  3OS1 A;  1NOY A;  1VSM A;  3PUF A;  1JXB A;  1CLQ A;  3DOK A;  3F9K A;  3LPT A;  4TSX A;  3NF9 A;  1TAU A;  1TKX A;  1LW2 A;  3QNO A;  4DFM A;  3HPH A;  3SQ4 A;  4CEE A;  3VQ8 A;  4E7I A;  2WOM A;  4M3U A;  4Z4F A;  2YKM A;  3HO1 A;  2HHT A;  4AHS A;  4Q5V A;  3QES A;  2HB5 A;  3M8S A;  1FK9 A;  1FKP A;  3VQP A;  1IKV A;  1KVB A;  4FJJ A;  1RT7 A;  2HVI A;  4W5R A;  3LWL A;  3LAM A;  4C8L A;  1NK6 A;  3QEV A;  3QNN A;  4CGH A;  3TI0 A;  2Q3S A;  4E1M A;  3UIQ A;  4O0I A;  4FK0 A;  3CFO A;  3DRR A;  2DFF A;  2HVH A;  1NKC A;  3KK3 A;  1UA0 A;  2IAJ A;  3LPU A;  2G8W A;  1EXQ A;  4CJF A;  3SUO A;  3DLE A;  2HHU A;  2E6M A;  3V9S A;  3F73 A;  1ZBH A;  3KKS A;  4W5T A;  1TKT A;  3OYJ A;  3RWU A;  4N76 A;  2YKN A;  4IDK A;  1FXX A;  4AHR A;  4CFD A;  3TAB A;  3NH0 A;  1KFS A;  3P5J A;  3CG7 A;  1WSF A;  3DRP A;  1T8E A;  4JS5 A;  3ULD A;  3QET A;  1WSI A;  1TAQ A;  3ZSW A;  3RMA A;  3O3G A;  4QAG A;  4FK2 A;  3LAN A;  4CIF A;  2HNY A;  4JRP A;  3CFR A;  2JGU A;  4FJ8 A;  4W5Q A;  1KCF A;  1S9E A;  2NUB A;  4LH5 A;  3VQ7 A;  3DRS A;  3MED A;  4CIG A;  4DFK A;  4ZTF A;  2D0B A;  1RDA A;  2DFH A;  5T7B A;  4I9L A;  4OGE A;  3PX0 A;  4DTP A; 
#chains in the Genus database with same CATH topology
 1GLC G;  1KRP A;  4ELU A;  1A5V A;  1QE1 A;  5HRO A;  2XRI A;  4AHU A;  3HJF A;  1U48 A;  3OY9 A;  2JLE A;  2FF3 B;  3DLK A;  2Z1I A;  3UKU B;  3OS0 A;  2P5G A;  1U45 A;  2KW4 A;  3VGL A;  4J8F A;  3AA3 A;  3O9U A;  5BRD A;  1JLC A;  3V1R A;  4LFC K;  3T19 A;  4FSV A;  3MN5 A;  3EZ5 A;  1KC8 O;  3H1V X;  1J54 A;  3L2U A;  3CPE A;  3CCU N;  3TU5 A;  4BQZ A;  3UB5 A;  1WSJ A;  1RFQ A;  4DFJ A;  3CC2 N;  4LF6 K;  3Q7B A;  2Z1G A;  3O9T A;  4IZ9 A;  3CYM A;  4DQQ A;  4BRK A;  4M3R A;  3NAE A;  1OVQ A;  1EET A;  4K42 A;  3V1Q A;  4PUO A;  1VSF A;  3O1B A;  4CCH A;  3T1H K;  4NB4 A;  4DTM A;  3KK1 A;  5K14 A;  2OTL N;  4A61 A;  1WAJ A;  3H45 C;  2GWK A;  1HQE A;  2KQ2 A;  2GWJ A;  3T1A A;  4CF0 A;  1T3V A;  4KTZ A;  4N47 A;  1T6C A;  4DCH A;  4HUG A;  4BR5 A;  3PO4 A;  4IFY A;  1WSH A;  1TKD A;  5F1X A;  4W5N A;  3OYM A;  3K59 A;  4FJK A;  1BA0 A;  4FCY A;  3WEE B;  1KVA A;  1DLO A;  4MLE A;  1K8K A;  4UQG A;  3TAE A;  4A62 A;  5FDL A;  4EHU A;  4HWI A;  3AAR A;  3D2F B;  2DPN A;  4F3T A;  3TR8 A;  4DR6 K;  4W5O A;  2WFB A;  1VQ6 N;  3RMB A;  2I5J A;  4H0T B;  5AQV A;  2QW9 A;  3ZET A;  2IVN A;  3AY9 A;  4IBN A;  2UYT A;  4KHN A;  4CHO A;  3MEE A;  5LJV A;  1C1C A;  4Z4C A;  2D0O A;  1K8A O;  2GUI A;  5HRP A;  4LH4 A;  4RG8 A;  2KFZ A;  4WCE L;  3A5M C;  2Y1J A;  3KK2 A;  1HX1 A;  3F9M A;  5AFU H;  1HNI A;  4B9M A;  2UXB K;  3ULE A;  4KHU A;  1HMV A;  2IS3 A;  2XO7 A;  3VQA A;  1SL2 A;  4DR7 K;  1G15 A;  4IJN A;  4GKK K;  1REV A;  3MXJ A;  2W6K A;  5B8H A;  4OLA A;  2Q0R A;  3CHW A;  5AQI A;  1J9A A;  2VWJ A;  3VEX A;  1HKC A;  1E4F T;  1YAG A;  4C1N K;  4K0K K;  2A40 A;  4I7F A;  2P51 A;  1NGC A;  1YVN A;  4DQI A;  3ATU A;  4JI5 K;  4CJT A;  4HVJ A;  1KAY A;  3PV8 A;  4BRG A;  3LWM A;  1KLN A;  3ZSQ A;  3CET A;  1S6Q A;  1S22 A;  4AHT A;  1TV6 A;  1Z6R A;  3THX A;  1HNZ K;  1BIU A;  4IEE A;  2BTF A;  4BRL A;  1KAX A;  1RT2 A;  2FLO A;  4FZY A;  1NJZ A;  4O8K A;  4DSE A;  3ALY A;  4DSK A;  4NLC A;  3SPY A;  1XUP O;  3JYT A;  4BE1 A;  2QM1 A;  2IC3 A;  4KHP K;  1RGI A;  3SK3 A;  4DLG A;  4Z4H A;  2HW3 A;  4Q0B A;  3G0Z A;  3H6E A;  4CD3 A;  4FJH A;  1ZYQ A;  3PO5 A;  3L2R A;  1ITG A;  4DQS A;  5C0Y A;  4XH4 A;  3SQ1 A;  3J7Y P;  3SUN A;  4IO9 L;  2FF6 A;  3TAN A;  4OVL A;  2P9I B;  2HBM A;  2YNF A;  3TAG A;  4H4O A;  4GVM A;  3SNN A;  3FZK A;  1S72 N;  2CGJ A;  4E1J A;  4L8R B;  4PWD A;  5AQW A;  2HHV A;  4A5A A;  4PKG A;  3LM2 A;  3E66 A;  1HLU A;  4BR2 A;  3AO2 A;  5EOY A;  3K5O A;  2D0C A;  3MCA B;  3BUZ B;  5A2Q O;  1LAW A;  1VQK N;  4DU1 A;  3R1X A;  3QFP A;  1BCO A;  1OVY A;  3R3L A;  4ELV A;  3LDL A;  3U4L A;  5KI6 A;  2P9U A;  3NH1 A;  1D9F A;  3BF1 A;  4CJ3 A;  4DTU A;  3VTH A;  5C24 A;  4XIU A;  3CCR N;  4ID5 A;  3KWI A;  1FW6 A;  5FRN A;  5KTQ A;  4KI4 A;  1C6V A;  3J81 O;  4DWI A;  2KLA A;  3ZT0 A;  2QK9 A;  1ASU A;  3AA2 A;  4RCH A;  1T03 A;  3PSI A;  1HNV A;  4H5T A;  1Z26 A;  1NJW A;  5E84 A;  2DFE A;  2DY4 A;  2E8A A;  4J2B A;  4CD1 A;  2P5O A;  5EXW A;  3OYF A;  2XY7 A;  1ZXO A;  2VQE K;  4FPB A;  4KH5 A;  4ILH A;  4HUF A;  4E19 A;  3DLR A;  3VQQ A;  3ULE B;  1JL1 A;  4RTF D;  1U49 A;  1HYS A;  4LD0 A;  1BIS A;  3NH2 A;  4CHQ A;  4FJ7 A;  4DV5 K;  3D6R A;  4FM2 A;  3IFR A;  4FVU A;  1W2B M;  1NOZ A;  4CF1 A;  5KGX A;  3CXC M;  1HYV A;  2VQF K;  1LWC A;  5KQD A;  4DQR A;  4IOX A;  2CH6 A;  1X9M A;  4FW1 A;  4J2E A;  1ESV A;  5C12 A;  3CC7 N;  3ENB A;  4AQY K;  4NYN A;  4IFV A;  3DAW A;  4CGJ A;  5M1N A;  5HRS A;  3I33 A;  4B9N A;  3VPZ A;  3A2F A;  3RVC A;  1HYZ A;  2A1S A;  3QIN A;  3VQE A;  3H46 O;  1JJ2 M;  1RT6 A;  4WYB A;  3NF8 A;  4GNI A;  4DFP A;  3CPW M;  1IO2 A;  4EIA A;  1SKS A;  4F9O A;  4JAX A;  3K5M A;  3THX B;  3LP1 A;  2O4I A;  1TYQ A;  4E0D A;  1BIZ A;  1LAV A;  4FLZ A;  1WSE A;  1N5Y A;  4ELT A;  2J4R A;  3CM6 A;  3AA4 A;  2OYQ A;  4FOE A;  3I56 N;  3O9Q A;  3AO3 A;  4V19 S;  1JLG A;  3P38 A;  1ZBF A;  3SZ2 A;  3VOV A;  2QA4 N;  4CHY A;  2A41 A;  1YF5 L;  3AVC A;  1QQO A;  3AVM A;  4A57 A;  3BP8 A;  5BN9 A;  3VER A;  1GOC A;  3ISN C;  4GMJ B;  4CJL A;  3LDQ A;  5M1Q A;  3ID6 A;  1NG9 A;  5AQT A;  3D2E A;  3VEO A;  1BA1 A;  3L4I A;  4JKE A;  5HP1 A;  3RRG A;  3Q7C A;  4BC3 A;  1BUP A;  2Q31 A;  1NGF A;  1XMO K;  2ZE2 A;  1TL1 A;  3NCI A;  5DK5 A;  1KD1 O;  4HTU A;  3KZB A;  1NK9 A;  2D0P A;  2BE2 A;  3AA5 X;  3VQB A;  4AIL C;  2O8E A;  3HOS A;  1QQN A;  4B9U A;  3O8M A;  4NXN K;  2EX3 A;  2PZS A;  4FJ9 A;  4IG0 A;  3O1W A;  3AAQ A;  4FYD A;  1CXQ A;  1BHL A;  5BRF A;  2V52 B;  3OYC A;  4KTQ A;  4JKG A;  5MLC Q;  1L5U A;  1HKB A;  1NK4 A;  2P9U B;  1C1A A;  3OS2 A;  2P9S A;  3ZT2 A;  3C6T A;  4CJQ A;  1YXQ A;  3EO3 A;  4IFE A;  5AQJ A;  1CLQ A;  3DOK A;  2FSJ A;  4H0V B;  5BPN A;  3HPH A;  3OHR A;  3HO1 A;  4AHS A;  3TSQ A;  4Q5V A;  3CI5 A;  3M8S A;  3L4Q A;  4BRD A;  2HVI A;  4BRC A;  1XNQ K;  5C2D A;  4B1V A;  4CGH A;  3TI0 A;  4B3T K;  4JKD A;  2IAJ A;  3LPU A;  4JYA K;  4BR0 A;  1ZBH A;  5C2F A;  3GE1 A;  1SZ2 A;  1FXX A;  1U6Z A;  1T8E A;  3U9Z A;  3ULD A;  4ILG B;  3RMA A;  2I7P A;  4FK2 A;  3LAN A;  1SQK A;  2JGU A;  4CZM A;  4R79 A;  4W5Q A;  1KCF A;  2W41 A;  4LH5 A;  4CIG A;  4ZTF A;  3BY5 A;  1RDA A;  1X3N A;  4I9L A;  3ZX2 A;  4DTP A;  3OJS A;  3M3Z A;  3DOL A;  3L2Q A;  2FSK A;  1RTD A;  4K8Z A;  3AVI A;  1K6Y A;  4HTL A;  4FLT A;  4LC9 B;  4N41 A;  3NDK A;  2OZS A;  1D5A A;  2F7T A;  5AQF A;  3LAL A;  4DHY A;  3E9O A;  3KJV A;  4CEF A;  3OYN A;  4F3O A;  4QOZ B;  1GOB A;  5EVZ A;  3JS6 A;  3C95 A;  2F9W A;  1QHT A;  4JI4 K;  4F2R A;  3WXI A;  3SMS A;  4FM0 A;  2RKI A;  4CHP A;  4DSF A;  3TTC A;  5DM7 L;  5EX5 A;  3HPO A;  5E26 A;  3DLB A;  5JS1 A;  2GEM A;  3HP9 A;  3C6A A;  1BOT O;  3NE6 A;  1NGJ A;  4WE1 A;  3D2E B;  1BGX T;  3VEN A;  3VGM A;  4O44 A;  1MWK A;  2VWK A;  4K25 A;  2JWK A;  3WUH A;  5M1P A;  1OH8 A;  5I42 A;  4DR2 K;  4FWN A;  3THV A;  1CZA N;  3MN9 A;  4KTW A;  1YTU A;  3HZ6 A;  3M8Q A;  3C94 A;  1XWL A;  4U67 L;  2HNZ A;  1X9W A;  4E3S A;  3ENO A;  2QWN A;  3VN5 A;  4FVM A;  4CJV A;  3CJ7 A;  5HLF A;  2PY5 A;  4A5B A;  2E6L A;  5AQN A;  4C8M A;  3P4I A;  4RW4 A;  4CFC A;  3NGI A;  4YOY A;  1P90 A;  3KHY A;  1D9D A;  4FWK A;  1I3A A;  4X64 K;  3QFU A;  5SWM A;  4FJN A;  2P9S B;  1C0G A;  2BAN A;  1YVU A;  1VQO N;  2O8B A;  3MMV A;  1VK0 A;  2BH1 A;  2QTD A;  4X62 K;  1IJJ A;  3EY1 A;  3GOI A;  4DV3 K;  1VQ4 N;  2X6N A;  3O9R A;  4JD2 B;  3NF7 A;  4UY8 O;  1RBT A;  4LFB K;  4FWO A;  2G8K A;  3JSM A;  3WXM B;  4FLV A;  1LWF A;  5J1E A;  4M41 A;  3AGK A;  4GV3 A;  1GLD G;  3GG4 A;  1ZBI A;  1BQM A;  3U9D A;  1GLJ O;  4NCA A;  1S1X A;  3DLG A;  5AJ3 K;  4FK4 A;  4KRF A;  4DTR A;  3AVG A;  1WN7 A;  1QVF M;  2UUB K;  3KK7 A;  5KQ8 A;  4GV6 A;  2E20 A;  3VQC A;  3PIP L;  4DUZ K;  3LDN A;  3CCV N;  3IRX A;  4H5W A;  4H8K A;  3T3F A;  3J7A P;  4B8A B;  3LZI A;  2W42 A;  1LW0 A;  5BRH A;  1RTJ A;  4FWS A;  4FWR A;  4QS8 A;  3G4S N;  1IG9 A;  4FJG A;  2UXD K;  4OJR A;  4NYF A;  3QDK A;  1S1W A;  5LL6 Z;  3O80 A;  4OLB A;  1DKG D;  3VQ9 A;  1Q18 A;  1N8R O;  3CM5 A;  3F5T A;  2PAV A;  2E2N A;  4NCG A;  3RMC A;  4EP4 A;  4DTX A;  4EFH A;  1SAZ A;  1IBL K;  3LP2 A;  5AZJ B;  2HF3 A;  1RT5 A;  3MWP A;  3S9H A;  5AQH A;  3DLH A;  4FW2 A;  4BRN A;  4Z4E A;  1Q86 O;  4FZZ A;  1VRU A;  4YOT A;  1DTQ A;  3CQ8 A;  2OZM A;  4MQ3 A;  1U04 A;  4O5F A;  1NBW A;  2QXL A;  3AO5 A;  3I8D A;  2P9I A;  4FOI A;  3QBX A;  1RBR A;  4DR1 K;  1BL3 A;  5ADX A;  2O8D B;  3ZSR A;  4IG3 A;  3RRH A;  1X9J A;  1Q7Y O;  2AP1 A;  1F21 A;  4CES A;  3CJB A;  3MXM A;  1GLL O;  3A5N C;  4GV9 A;  3HK2 A;  2A3Z A;  1KQS M;  2V51 B;  4YOU A;  2E2Q A;  3AVH A;  5D3G A;  3MCP A;  1GOA A;  4CGD A;  2P9L A;  2P9K A;  1E4G T;  3KIO A;  1NJY A;  2NZT A;  1L3U A;  4Z94 A;  3RMD A;  4HCC A;  2EHG A;  4M3Y A;  1VSL A;  3PLA A;  2BGG A;  1S9G A;  4M7X A;  5AZI A;  2OPS A;  1I94 K;  2YNI A;  4CE9 A;  3SI6 A;  4B9V A;  3S3M A;  4B3O A;  2F8T A;  4H0X B;  1XQS C;  3QEP A;  2UUC K;  3H08 A;  1Q81 O;  1KXP A;  4JKF A;  3V9W A;  4JI3 K;  2QEX N;  3O5B A;  5E41 A;  4CEO A;  4CW7 B;  3QEX A;  2O8B B;  1C1B A;  4FLX A;  3H1Q A;  3FGU A;  3AGR A;  4I6M A;  5AQX A;  2D1K A;  3K58 A;  1C0T A;  2QWM A;  3E1Y A;  3QER A;  3D45 A;  3K5N A;  1VRT A;  3C6U A;  5KPZ A;  3AVN A;  3QO9 A;  4OKJ A;  4E1N A;  3C65 A;  1NK8 A;  3ZCM A;  4CZG A;  1EX4 A;  4CHN A;  4NLB A;  4CJ5 A;  1JLA A;  1TKZ A;  5F2R A;  3G6E N;  2Y1I A;  3OYK A;  1BG3 A;  1QHA A;  4CFB A;  3FZH A;  1VQ8 N;  3MEC A;  2AA4 A;  4BAC A;  3BGR A;  2FBT A;  3KLG A;  1IG8 A;  3A5L C;  3W0L A;  4B3R K;  4CJW A;  2GUP A;  3VF2 A;  4GW6 A;  4X66 K;  2OA8 A;  4MLH A;  4CEQ A;  4KFB A;  2A1R A;  4CJU A;  2Z1J A;  2E88 A;  4MO5 A;  2F4V K;  1RBU A;  4CK1 A;  1MU2 A;  2FSN A;  1YJN N;  4CJP A;  1RCH A;  4KPY A;  3NVM A;  4KKO A;  3S3O A;  2W40 A;  2WTU A;  3PX6 A;  1SL0 A;  2GEL A;  2HHW A;  2YV0 X;  1VSK A;  1QSL A;  1OKJ A;  1JLB A;  4DKW A;  1JKH A;  4BE0 A;  4KH6 A;  2ZWH A;  3HOT A;  2D0A A;  2HHQ A;  1NGH A;  1XC9 A;  2X78 A;  1SL1 A;  5GAH P;  4BRF A;  2HND A;  4FM1 A;  2XY5 A;  4O5B A;  2ATQ A;  3B8A X;  1VQ7 N;  2ZF5 O;  3AVL A;  4JI0 K;  1IH7 A;  2HST A;  5LJW A;  2ZJQ L;  4FJ5 A;  2NNW A;  2E1Y A;  4IEI A;  4X65 K;  3OJU A;  3HL8 A;  5FRM A;  4H4M A;  3SPZ A;  1LCU A;  2BUP A;  5FRO A;  3WXK A;  4BWM A;  4DV7 K;  1WBB A;  1C0M A;  1W9H A;  1GLF O;  1TK5 A;  3OYE A;  1WBD A;  3E01 A;  4DF8 A;  3HST B;  1HKG A;  2XHB A;  3CF5 L;  5JVH L;  4BC2 A;  5DMR A;  3SJJ A;  3K2P A;  4DV0 K;  1Q9Y A;  3SV4 A;  3RTV A;  1DGK N;  2P9N A;  3MN6 A;  4QS9 A;  1RT4 A;  1MA9 B;  2Q1N A;  4FWL A;  4OPA A;  4CEB A;  4J2A A;  2F8S A;  4ILJ A;  3ZSO A;  2P9L B;  2P9K B;  4DTO A;  1NGB A;  2YHA A;  3QBW A;  3SQ0 A;  3HTV A;  4LY7 A;  4IXC A;  4I9Q A;  3AVJ A;  1RT1 A;  4DU3 A;  4JK8 A;  1E3M A;  4E7H A;  5ADX H;  5AZI B;  2OAN A;  4BE2 A;  4DR4 K;  3CCS N;  3EL2 A;  3HBT A;  4Y1C A;  3U6F A;  3W3D A;  4PA1 A;  1ZBU A;  1WUA A;  4MO4 A;  1NOY A;  2UXC K;  3FR0 A;  5JLF A;  4I6M B;  4TSX A;  3NF9 A;  4CEE A;  4Z4F A;  3C7N A;  1R59 O;  1KVB A;  4W5R A;  3ZEU B;  1NK6 A;  3QEV A;  3O6W A;  2PFU A;  2Q3S A;  3PSF A;  4E1M A;  4C23 A;  4O0I A;  3RSE B;  3C6H A;  4B1Z A;  4CBW A;  3CMA N;  2HVH A;  3VTI A;  3KK3 A;  3CME N;  2A6A A;  5FLX O;  3SUO A;  2HHH K;  2E6M A;  4JK9 A;  3K0S A;  1TKT A;  4BRP A;  4N76 A;  1V4T A;  2YKN A;  2YHY A;  3VF4 A;  3D7E O;  3P5J A;  3CG7 A;  2NRX A;  3DRP A;  5I9E B;  4JS5 A;  3ZSW A;  1TAQ A;  3O3G A;  4QAG A;  3MWT A;  4WF9 L;  2HNY A;  4FO0 A;  4FJ8 A;  1S9E A;  4H0Y B;  5T7B A;  2DFH A;  1U2V A;  3PX0 A;  4N56 A;  1NKC A;  4KBO A;  4JNE A;  2Q36 A;  4EAH D;  4CZF A;  3LL3 A;  2NRR A;  4GKJ K;  3I8B A;  2HMP A;  1ATS A;  5AQZ A;  4JI1 K;  1QZ6 A;  3SBT A;  3CQY A;  5BRE A;  4DQP A;  1LWE A;  3TAQ A;  1DEJ A;  1JCE A;  1P8Z A;  4H0P A;  4H5V A;  3L0Q A;  2IDO A;  5HRR A;  4KHS A;  4ZHR A;  3HVT A;  2GX9 A;  5M1O A;  3VQ6 A;  3KVG A;  3MX5 A;  5KPT A;  3J7Z O;  1QQC A;  4EZ6 A;  4K8X A;  3O4W A;  3TAM A;  4FJX A;  1NNE A;  1S1T A;  3AO4 A;  4JK7 A;  4KV8 A;  4DQ8 A;  3ID8 A;  4BC4 A;  3MAQ A;  3C0B A;  5J2M A;  3THY B;  2G8F A;  4GVE A;  2YX6 A;  4ISF A;  4DS4 A;  2O8F A;  2VG6 A;  1B92 A;  4Z4G A;  1KLM A;  2D4W A;  1BI4 A;  4PQU A;  3M1F A;  1X3M A;  4DV4 K;  1YJ9 N;  1CZB A;  2P9N B;  4JI8 K;  1N6Q A;  4YNQ A;  3PY8 A;  4B3S K;  2QWL A;  4CF8 A;  3JXU A;  1XHX A;  4DB3 A;  4OPK A;  3G10 A;  2GV9 A;  1VSI A;  2FBX A;  4CVN E;  2Z1H A;  4H03 B;  4FZX C;  1DTT A;  2KZZ A;  1IBK K;  1RNH A;  5ELZ A;  5LMN K;  1FKO A;  4RW8 A;  3QML A;  4AF1 A;  3S3N A;  2OPR A;  5CE3 A;  3WNE A;  2GBZ A;  2OPP A;  5J2P A;  3WNH A;  1J53 A;  1EO1 A;  4XH1 A;  1Z05 A;  3QLH A;  4JD2 A;  1NK0 A;  5EU7 A;  3V1O A;  1HUX A;  1RIL A;  1TK0 A;  2D5R A;  3DM2 A;  5HBM A;  3C7N B;  1BO5 O;  2OTJ N;  4MFB A;  5AQP A;  4LF7 K;  1V4S A;  1NGI A;  3EKU A;  1QS4 A;  3ZT3 A;  3V6D A;  2RPI A;  4IJA A;  4A2A A;  1VQ9 N;  4Y0W A;  3IUC A;  3WXJ A;  4FL9 A;  2VG5 A;  1NGA A;  3HP6 A;  5BN8 A;  3OYG A;  4BVP A;  2AJQ A;  2PYJ A;  4CBU A;  1U2V B;  2WON A;  3DI6 A;  5AQQ A;  3IMX A;  3A0I X;  4YOX A;  4JI2 K;  1YHQ N;  3V9Z A;  1CXU A;  3LAK A;  1BWF O;  4NO7 A;  3OW2 M;  2Q97 A;  2YHB A;  4RW9 A;  1W97 L;  2NRV A;  3HSC A;  4A2B A;  4M3Z A;  4JN4 A;  1NJX A;  5M1F A;  1HPM A;  1T7P A;  1JCG A;  1UA1 A;  2QKB A;  5AZJ A;  2PBD A;  3BEX A;  3ZX3 A;  1VHX A;  3AO1 A;  3R6M A;  3FE1 A;  5LY3 A;  4E7K A;  4YY3 K;  3AAP A;  1H1V A;  4H0O A;  2B6A A;  3ZT1 A;  3JAM O;  3IG1 A;  3KLF A;  4E7L A;  1BDG A;  2G8V A;  3ASM A;  2YNG A;  4CEA A;  2O8D A;  1JL2 A;  1ASV A;  3VEW A;  5AQU A;  3OA9 A;  1HRH A;  3VQ4 A;  2IIR A;  2HBL A;  2YJE A;  2FXU A;  2O8F B;  3HXM A;  2DTU A;  1YIJ N;  3NHG A;  1BI4 B;  3VET A;  3HRG A;  4B1Y B;  3QIO A;  3CIP A;  5AQR A;  1B9D A;  3T69 A;  2B4J A;  3TAF A;  2ZGY A;  3IDH A;  5M1K A;  4CJK A;  3O4Q A;  2RHK A;  4CZE A;  2FBV A;  3CJC A;  3SMP A;  4F4K A;  3MEG A;  1ZC6 A;  4F2S A;  2E2O A;  4BRQ A;  4YOW A;  4PKH A;  1VSD A;  4IO8 A;  2YHW A;  5KPR A;  3WNG A;  5C15 A;  3IAY A;  4BDZ A;  2FBY A;  3FLC O;  4G9Z A;  3KKR A;  1S3X A;  3TAP A;  4BRA A;  5JIC A;  1M1K O;  1RTI A;  2G8H A;  3DLL L;  3O08 A;  4CBX A;  2P1J A;  2OCE A;  5FPM A;  4KAZ A;  2YI1 A;  4A59 A;  4IOA L;  3G71 N;  4O4G A;  5KRT A;  1TVR A;  3HM8 A;  4KH4 A;  4CZI A;  3QIC A;  5GAE P;  1IBM K;  1NMN A;  1K9M O;  4M7Y A;  5CZ1 A;  3SAH A;  4DR3 K;  2NRZ A;  4JLH A;  3SV3 A;  3M8P A;  1SV5 A;  2EWS A;  2FC0 A;  1HPZ A;  4I2P A;  3FZL A;  3CER A;  4FPA A;  4PHT X;  3P31 A;  2VGN A;  2P9P A;  3OYB A;  1LV5 A;  2XY6 A;  3SUQ A;  3E9L A;  3LDS A;  5TKW A;  5AQO A;  1D8Y A;  2B5J A;  4DMN A;  3EE8 A;  1W0H A;  5AQS A;  4JKA A;  4LF9 K;  1RDW X;  4AM7 A;  4JRQ A;  4M63 C;  4JKB A;  2E4L A;  2O8C A;  5C42 A;  4LSN A;  4B9S A;  1NU0 A;  4DTN A;  1TK8 A;  4H5N A;  3HI0 A;  4YFU A;  3S41 A;  4JI7 K;  1RT3 A;  1ILY A;  3CJ9 A;  1GLB G;  2ZGZ A;  1FJG K;  4CGG A;  5C10 A;  4B1X B;  2BDP A;  4M45 A;  1IKW A;  1JXE A;  1YIT N;  1UAX A;  4U7B A;  4DR5 K;  4J2D A;  1N32 K;  5H1S Q;  3CCM N;  3OYA A;  4K43 A;  2VGM A;  3EZW A;  4CEZ A;  2QWO A;  3EEQ A;  4DUY K;  3EN9 A;  1DT9 A;  3HM9 A;  1QTM A;  3CFP A;  3B6O A;  3WQU A;  3M8R A;  2NRT A;  2V7Y A;  2G8I A;  3SUP A;  3DXM B;  4LF4 K;  1EP4 A;  1YI2 N;  1IV0 A;  1U47 A;  3AVB A;  3O4N A;  1S6P A;  4RW6 A;  3VGK A;  3LDP A;  2KKZ A;  5CZ2 A;  1SUQ A;  4EZ9 A;  1U4B A;  2ETJ A;  3OYD A;  5BPM A;  3QEI A;  4ISG A;  3GL1 A;  4PL7 A;  5CR4 A;  3ENH A;  1X1P A;  3HYF A;  4XH5 A;  2UUA K;  2KZM A;  4ICL A;  4BRO A;  1MDU B;  3KD1 E;  3E9P A;  3OS1 A;  3PUF A;  1JXB A;  3BZK A;  3F9K A;  3LPT A;  5AQK A;  3UE5 A;  5GAG P;  3TTD A;  1TKX A;  3SBG A;  3QNO A;  3SQ4 A;  3UKR A;  2QWQ A;  3VQ8 A;  4M3U A;  2HHT A;  4QS7 A;  2YKM A;  3ZEU A;  2E1Z A;  4PL8 A;  4BY9 C;  4BGB A;  1FK9 A;  4YOR A;  3U8X A;  3RSE A;  3VQP A;  1IKV A;  1HJO A;  4JHD A;  3LWL A;  4C8L A;  3QNN A;  3UIQ A;  3CFO A;  2DFF A;  3VEZ A;  1UA0 A;  2G8W A;  2ASP A;  1EXQ A;  4CJF A;  4L3Q A;  4CZL A;  3SAF A;  3OYJ A;  3A5O C;  3WQT A;  3TAB A;  1WSF A;  4K41 A;  3QET A;  3FZF A;  2P9P B;  4JRP A;  3CFR A;  3J80 O;  4DFK A;  3ATV A;  3VQ7 A;  3DRS A;  4YHH K;  4OGE A;  3D0P A;  2ZM6 K;  4KO0 A;  5KRS A;  5IWA K;  3LP3 A;  3NGY A;  3CCE N;  4FJM A;  4RWT A;  5JS2 A;  1EWR A;  4RW7 A;  3LM9 A;  2WC9 A;  3NMU A;  1W7A A;  2IVO A;  1CZ9 A;  1XC3 A;  2ZJR L;  4ID1 A;  2QI2 A;  4DSL A;  2A42 A;  3KD5 E;  2O8C B;  2IVP A;  4PKI A;  4YDU A;  1N34 K;  3OBW A;  3VQD A;  3TSU A;  1YJW N;  2ZD1 A;  1YTA A;  3VA0 A;  1BU6 O;  3SYZ A;  2H3G X;  4GY2 B;  3VMF B;  5SZT A;  3TAR A;  4NXM K;  4KHW A;  1N33 K;  4CZH A;  3THY A;  4CJE A;  2WUS A;  1VQM N;  1S1V A;  3THW A;  4F8R A;  4M42 A;  3A8Y A;  1BCM A;  3CCJ N;  5GIP A;  3NF6 A;  1UOC A;  4LF8 K;  1TGO A;  4CGF A;  5GIN A;  4FLW A;  3L3V A;  4NCB A;  4DV6 K;  1YT3 A;  5AQG A;  1WAF A;  4B08 A;  4CF9 A;  4QCL A;  1SKW A;  1OH5 A;  1WB9 A;  4B9L A;  3MN7 A;  5CHI A;  5AQL A;  3OYI A;  3AVA A;  3MDQ A;  2HHS A;  1QSY A;  4KHY A;  5HOO A;  1GLE G;  3HT3 A;  4BG8 A;  4JV5 K;  1TUY A;  4HHT A;  3G25 A;  4DU4 A;  3R9P A;  4M3W A;  1G99 A;  2O4G A;  4B9Q A;  3NGZ A;  3KLE A;  2YCH A;  4B9T A;  4HCB A;  3M6G A;  5BR9 A;  4AHV A;  3IS9 A;  4ZTJ A;  1K8K B;  3SAG A;  3WT0 A;  4YDU C;  2CGK A;  4C1N I;  1C0F A;  3IKM A;  5BPL A;  1WLJ A;  3DYA A;  1WNS A;  3EE9 A;  4FWP A;  3CCQ N;  3GBT A;  1S5J A;  3FZM A;  3NBP A;  3UKR B;  3ZET B;  4BR7 A;  2IGI A;  1Z25 A;  3V81 A;  2JWL A;  3KLI A;  5CYQ A;  1S1U A;  1VSJ A;  4FJL A;  1J6Z A;  4JHD B;  2QXF A;  1NKB A;  4C8N A;  3T7Z A;  4BDY A;  3SQ2 A;  3VEY A;  4CEC A;  5DM6 L;  4CED A;  3SJH A;  4MDB A;  2YJF A;  3L3U A;  4EHT A;  3V9X A;  2X6S A;  4BQL A;  4Z0U A;  3O3H A;  1L3S A;  3AVK A;  4FWM A;  4BR9 A;  2RF2 A;  3SLC A;  4N5S A;  4AHC A;  4DF4 A;  4CJS A;  1D4X A;  3HVR A;  3BF3 A;  2LSN A;  1BQN A;  1NMD A;  3QB0 A;  3P39 A;  2ASM A;  3RR7 A;  4DTJ A;  1B9F A;  1NWK A;  1IKX A;  3P1G A;  2ASO A;  4DV2 K;  3FFK B;  3NVK A;  2F9T A;  1RDC A;  1TUU A;  2I7N A;  5AQM A;  1NGG A;  3L8B A;  1NKE A;  2QKK A;  3MK6 A;  4I2Q A;  3I55 N;  1JCF A;  2E2P A;  1XNR K;  1KVC A;  4G1Q A;  4CI6 A;  3CCL N;  4WFN L;  2X74 A;  1ASW A;  1Q8I A;  1YUW A;  3VEV A;  4R5P A;  4M3T A;  1WOQ A;  4BG9 A;  3OYH A;  4JKH A;  1NK7 A;  1MWM A;  3LZJ A;  5JLH A;  4ISE A;  5CY4 A;  2RE2 A;  3N4P A;  2GTD A;  4KB1 A;  4FXD A;  2V7Z A;  1XI1 A;  1I39 A;  1NGE A;  1VSH A;  3VQ5 A;  1K73 O;  3OYL A;  5KGW A;  3QIP A;  3TSP A;  3F2K A;  4WQ4 A;  2NLX A;  3J8A A;  3THW B;  1ZBL A;  3ZLJ A;  4FLU A;  4DSJ A;  1A5W A;  2W6L A;  2ITG A;  2PYL A;  3EYZ A;  4O55 A;  1Q9X A;  3M5R A;  1T05 A;  1HQU A;  4DTS A;  3WNF A;  1JLQ A;  5AR0 A;  4CER A;  4E7J A;  2Q0U A;  4WQ5 A;  3MXI A;  4DG1 A;  4OKK A;  3KLH A;  3DMJ A;  3U3Y A;  3OVN A;  4KRE A;  2ITM A;  4DV1 K;  1NK5 A;  3AVF A;  4JKC A;  3CC4 N;  4BGA A;  4CHZ A;  4FJI A;  3DXK A;  1ZBS A;  5AQY A;  1LOT B;  5JMV A;  3VES A;  2CH5 A;  4JI6 K;  2YHX A;  1C0U A;  1HJR A;  5GAD P;  3H3N O;  4CJR A;  4B1U B;  2HBJ A;  4PY5 A;  5EY4 A;  2A5X A;  3TPQ A;  1EWQ A;  3VF6 A;  3GDQ A;  5J2N A;  4DS5 A;  4YOV A;  2HMI A;  2CGL A;  4OKE A;  4BR4 A;  5LMU K;  2RN2 A;  2R7Y A;  3L6Q A;  4MDA A;  3K57 A;  4Y1D A;  1TL3 A;  4E89 A;  1UWB A;  1IKY A;  3WXL A;  3V4I A;  1Y97 A;  2ZJP L;  4O8U A;  3ZSX A;  1RBS A;  1N36 K;  4XEI A;  4LFA K;  4Z4I A;  4WQ4 C;  2ZQB A;  2VG7 A;  2UU9 K;  3DJC A;  4IWV A;  4EP5 A;  2NRW A;  5CYM A;  1VQN N;  1QQM A;  2VWB A;  3PX4 A;  4CFA A;  3BZC A;  4OPH A;  3ZX0 A;  3ZSY A;  4B8C A;  4C8O A;  4OGC A;  2VYP A;  3L2V A;  4DSI A;  1KTQ A;  4BC5 A;  2HF4 A;  5FPD A;  1R0A A;  2E5L K;  1EKE A;  3L2W A;  1L3T A;  4WFA L;  4WQ5 C;  2WBN A;  4JS4 A;  4AH9 A;  4JEP A;  1RDD A;  5C25 A;  3HPG A;  4OPJ A;  5FPE A;  4CIE A;  1M90 O;  1HR0 K;  4FLY A;  2KFN A;  1NLV A;  4CGI A;  1ATN A;  3AV9 A;  4CJ4 A;  1J5E K;  4M3X A;  4B1W B;  3KTQ A;  3I0R A;  4CK2 A;  4HUE A;  4KHQ A;  1Y64 A;  3CQX A;  5I3U A;  3LP0 A;  3SCX A;  1QVG M;  3UKU A;  3QEW A;  4BWJ A;  3RR8 A;  1TYQ B;  5HRN A;  2VCP A;  3TWH A;  4KI6 A;  3O3F A;  1QZ5 A;  1JLF A;  1QSS A;  1SKR A;  4B3M K;  4KB0 A;  1J5O A;  5GIO A;  1VQ5 N;  3ZYY X;  2F96 A;  3V9U A;  3EKS A;  1T6D A;  4DLE A;  3ZSV A;  4IOC L;  3CD6 N;  1OH6 A;  3DWL A;  4FWQ A;  5HL7 L;  2KHO A;  2QWP A;  3B6P A;  1VSE A;  1NJI O;  2KTQ A;  3R8E A;  1L3V A;  1JLE A;  3P83 D;  3ZT4 A;  3VA3 A;  4CK3 A;  5J2Q A;  4O0J A;  1RDB A;  3DXM A;  4LSL A;  1GLA G;  3U3G A;  1WSG A;  2XY8 A;  4BRM A;  5BR8 K;  3N4Q A;  1OH7 A;  3TTF A;  3K9J A;  1X9S A;  2Q2R A;  1T44 A;  1RBV A;  2O8E B;  1O1W A;  4CZK A;  2YNH A;  3ZSZ A;  4BDP A;  1RDU A;  1NM1 A;  4CF2 A;  3DXK B;  4OO1 J;  1RTH A;  1VAZ A;  3WEE A;  2G8U A;  2HHX A;  1NGD A;  4WFB L;  1KFD A;  4OX9 K;  3I0S A;  5AFU A;  3CJ1 A;  1A5X A;  3ITH A;  1O13 A;  1KAZ A;  3BDP A;  3D2F A;  1KSP A;  3FFI A;  4BRH A;  4JKG B;  2NRH A;  3O9S A;  4LF5 K;  3K5L A;  3MX2 A;  4C8K A;  2OPQ A;  1XHZ A;  1EQY A;  3NFA A;  4IKF A;  2IOC A;  1VQL N;  3H3O B;  5TKY A;  1VSM A;  3CJA A;  1TAU A;  3OTO K;  4CZJ A;  1LW2 A;  4DFM A;  1XMQ K;  4E7I A;  2WOM A;  4H5R A;  3QES A;  2HB5 A;  4BRE A;  4IDH A;  1FKP A;  4FJJ A;  1RT7 A;  4BVO A;  1HNX K;  1VQP N;  3LAM A;  4FK0 A;  3DRR A;  3PIO L;  1ATR A;  5JVG L;  2HOE A;  3DLE A;  2QWR A;  3K9K A;  3V9S A;  3F73 A;  2HHU A;  3KKS A;  3KWG A;  4AM6 A;  2HBK A;  4W5T A;  3RWU A;  3OBY A;  5IT9 O;  1SS6 A;  4BRI A;  4IDK A;  1HNW K;  4AHR A;  4CFD A;  4CJ7 A;  3NH0 A;  1KFS A;  1WSI A;  5F0X A;  4CIF A;  1Q82 O;  2NUB A;  3MED A;  3T1Y K;  2D0B A;  5FPN A;  3LDO A; 
#chains in the Genus database with same CATH homology
 4KO0 A;  5KRS A;  4N56 A;  3DOL A;  3LP3 A;  1A5V A;  1QE1 A;  3NGY A;  3OJS A;  3L2Q A;  5HRO A;  1KRP A;  4ELU A;  1RTD A;  4K8Z A;  2XRI A;  3AVI A;  4FJM A;  1K6Y A;  4AHU A;  3HJF A;  4FLT A;  1U48 A;  5JS2 A;  3OY9 A;  4N41 A;  2JLE A;  4RW7 A;  3NDK A;  2OZS A;  1CZ9 A;  1D5A A;  4ID1 A;  4DQP A;  4DSL A;  3LAL A;  3KD5 E;  3DLK A;  3KJV A;  1LWE A;  2Z1I A;  4CEF A;  3OS0 A;  3TAQ A;  2P5G A;  3OYN A;  1U45 A;  2KW4 A;  4F3O A;  4QOZ B;  2IDO A;  1GOB A;  3AA3 A;  5HRR A;  1JLC A;  4KHS A;  3C95 A;  4ZHR A;  3V1R A;  1QHT A;  3HVT A;  3VQD A;  3T19 A;  4F2R A;  4FM0 A;  2RKI A;  3VQ6 A;  2ZD1 A;  3EZ5 A;  1J54 A;  1YTA A;  4CHP A;  1QQC A;  3VA0 A;  3SYZ A;  4EZ6 A;  4DSF A;  4K8X A;  3TAM A;  5SZT A;  3TAR A;  4KHW A;  3L2U A;  3HPO A;  3DLB A;  4DFJ A;  1WSJ A;  4FJX A;  5JS1 A;  1S1T A;  4CJE A;  2Z1G A;  3HP9 A;  3AO4 A;  1S1V A;  4KV8 A;  3MAQ A;  4F8R A;  4M42 A;  3CYM A;  3NE6 A;  5J2M A;  1BCM A;  4WE1 A;  4DQQ A;  4M3R A;  3NAE A;  1BGX T;  2G8F A;  2HHQ A;  3NF6 A;  1EET A;  1UOC A;  3V1Q A;  4PUO A;  1VSF A;  1TGO A;  4O44 A;  4CGF A;  4CCH A;  4FLW A;  4DS4 A;  2VWK A;  4DTM A;  2VG6 A;  1B92 A;  3L3V A;  3KK1 A;  4NCB A;  4Z4G A;  1KLM A;  5K14 A;  1BI4 A;  1YT3 A;  5I42 A;  4B08 A;  1WAF A;  4CF9 A;  3THV A;  4PQU A;  4KTW A;  1YTU A;  4QCL A;  1SKW A;  1CZB A;  1WAJ A;  3M8Q A;  4B9L A;  1HQE A;  3C94 A;  2KQ2 A;  3T1A A;  1XWL A;  4CF0 A;  1N6Q A;  4KTZ A;  4N47 A;  2HNZ A;  4YNQ A;  3PY8 A;  1X9W A;  3OYI A;  3AVA A;  4CF8 A;  4E3S A;  4HUG A;  1XHX A;  2HHS A;  3PO4 A;  3VN5 A;  4OPK A;  4FVM A;  4IFY A;  1QSY A;  4KHY A;  4CJV A;  1WSH A;  3G10 A;  1TKD A;  2GV9 A;  5HLF A;  2PY5 A;  4W5N A;  3HT3 A;  3OYM A;  3K59 A;  1VSI A;  2E6L A;  4FJK A;  4C8M A;  2FBX A;  4HHT A;  4RW4 A;  4DU4 A;  4CFC A;  2Z1H A;  4FCY A;  4M3W A;  1KVA A;  2O4G A;  1DLO A;  3NGZ A;  3KLE A;  3NGI A;  4B9T A;  4HCB A;  4UQG A;  4FZX C;  1DTT A;  3TAE A;  2KZZ A;  5FDL A;  4AHV A;  1RNH A;  3IS9 A;  1D9D A;  1FKO A;  4RW8 A;  4ZTJ A;  4F3T A;  3D0P A;  3TR8 A;  3S3N A;  2OPR A;  1I3A A;  3WNE A;  5SWM A;  4W5O A;  4FJN A;  2GBZ A;  2OPP A;  2BAN A;  1YVU A;  5J2P A;  1WLJ A;  3WNH A;  2I5J A;  1VK0 A;  3RMB A;  3DYA A;  1J53 A;  1WNS A;  4IBN A;  3EY1 A;  3QLH A;  1S5J A;  4KHN A;  4CHO A;  1NK0 A;  5EU7 A;  3V1O A;  3MEE A;  3NBP A;  1RIL A;  2X6N A;  1TK0 A;  2D5R A;  3DM2 A;  5HBM A;  2IGI A;  1C1C A;  1Z25 A;  4Z4C A;  3V81 A;  3KLI A;  5CYQ A;  2GUI A;  5HRP A;  4MFB A;  3NF7 A;  4LH4 A;  1S1U A;  1VSJ A;  4RG8 A;  4FJL A;  1RBT A;  2KFZ A;  2Y1J A;  3KK2 A;  2G8K A;  2QXF A;  1NKB A;  3JSM A;  4C8N A;  4FLV A;  4BDY A;  1HNI A;  3SQ2 A;  1LWF A;  5J1E A;  4B9M A;  4CEC A;  4CED A;  1QS4 A;  4M41 A;  3ZT3 A;  3V6D A;  2RPI A;  3L3U A;  3V9X A;  4KHU A;  2X6S A;  3O3H A;  1HMV A;  2IS3 A;  4Z0U A;  1BQM A;  1ZBI A;  2XO7 A;  1L3S A;  3AVK A;  3VQA A;  1SL2 A;  1G15 A;  2RF2 A;  4NCA A;  1S1X A;  4N5S A;  3DLG A;  1REV A;  3MXJ A;  2VG5 A;  4AHC A;  3HP6 A;  4CJS A;  4DF4 A;  4FK4 A;  4OLA A;  4KRF A;  3HVR A;  4DTR A;  2LSN A;  1J9A A;  2VWJ A;  3AVG A;  1BQN A;  1WN7 A;  3OYG A;  4DTJ A;  3RR7 A;  1B9F A;  4I7F A;  1IKX A;  2P51 A;  3P1G A;  3VQC A;  2AJQ A;  2PYJ A;  4DQI A;  3IRX A;  4H8K A;  3T3F A;  1RDC A;  4CJT A;  4HVJ A;  2WON A;  3DI6 A;  4B8A B;  3LZI A;  2W42 A;  1LW0 A;  3L8B A;  3PV8 A;  1RTJ A;  3V9Z A;  1CXU A;  3LAK A;  1NKE A;  3LWM A;  2QKK A;  1IG9 A;  1KLN A;  3ZSQ A;  4AHT A;  1S6Q A;  4I2Q A;  1TV6 A;  4FJG A;  2YHB A;  4RW9 A;  4OJR A;  1KVC A;  4G1Q A;  1BIU A;  4NYF A;  1S1W A;  4M3Z A;  1NJX A;  1RT2 A;  2X74 A;  4OLB A;  1ASW A;  1Q8I A;  4R5P A;  3VQ9 A;  4FZY A;  1NJZ A;  1T7P A;  4M3T A;  2QKB A;  1UA1 A;  3CM5 A;  4DSE A;  3OYH A;  3ALY A;  1NK7 A;  4DSK A;  4NCG A;  3RMC A;  3LZJ A;  4EP4 A;  4DTX A;  3SPY A;  3LP2 A;  5CY4 A;  3JYT A;  3AO1 A;  4BE1 A;  2IC3 A;  4E7K A;  4KB1 A;  4DLG A;  4FXD A;  1XI1 A;  4Z4H A;  1I39 A;  2HW3 A;  2B6A A;  1RT5 A;  1VSH A;  3S9H A;  4Q0B A;  3VQ5 A;  3ZT1 A;  3G0Z A;  3IG1 A;  3KLF A;  4FW2 A;  5KGW A;  3QIP A;  3OYL A;  4E7L A;  3DLH A;  4FZZ A;  4Z4E A;  1VRU A;  4FJH A;  1DTQ A;  3CQ8 A;  2G8V A;  2OZM A;  3ASM A;  4MQ3 A;  2YNG A;  1ZYQ A;  3PO5 A;  4CEA A;  1ITG A;  1JL2 A;  1U04 A;  3L2R A;  4FLU A;  1ASV A;  4DQS A;  1ZBL A;  3AO5 A;  3I8D A;  4DSJ A;  1A5W A;  1RBR A;  3SQ1 A;  1HRH A;  3SUN A;  3VQ4 A;  1BL3 A;  3ZSR A;  4OVL A;  3TAN A;  2ITG A;  4IG3 A;  3RRH A;  2PYL A;  3EYZ A;  2YNF A;  4O55 A;  3HXM A;  3TAG A;  1Q9X A;  2DTU A;  1T05 A;  1F21 A;  4H4O A;  1HQU A;  3NHG A;  4GVM A;  4CES A;  4DTS A;  1BI4 B;  3WNF A;  3SNN A;  1JLQ A;  3MXM A;  4CER A;  3HK2 A;  4E7J A;  4L8R B;  4PWD A;  2HHV A;  3QIO A;  3MXI A;  3AVH A;  5D3G A;  1B9D A;  1GOA A;  2B4J A;  4OKK A;  4DG1 A;  3KLH A;  3DMJ A;  3U3Y A;  3TAF A;  4CGD A;  3OVN A;  4KRE A;  4CJK A;  3KIO A;  1NJY A;  3AO2 A;  1L3U A;  3K5O A;  1NK5 A;  3AVF A;  3O4Q A;  2D0C A;  3RMD A;  4HCC A;  2EHG A;  4M3Y A;  1VSL A;  4CHZ A;  4FJI A;  1S9G A;  2FBV A;  2BGG A;  1LAW A;  3MEG A;  4F4K A;  2OPS A;  4DU1 A;  2YNI A;  4CE9 A;  3SI6 A;  4F2S A;  4B9V A;  1C0U A;  1VSD A;  1HJR A;  3S3M A;  1BCO A;  2F8T A;  4B3O A;  4CJR A;  4ELV A;  3QEP A;  5KI6 A;  3NH1 A;  3H08 A;  4PY5 A;  1D9F A;  4CJ3 A;  3WNG A;  4DTU A;  3V9W A;  5C24 A;  4XIU A;  5J2N A;  5E41 A;  4BDZ A;  2FBY A;  4ID5 A;  4DS5 A;  3IAY A;  3KKR A;  4CEO A;  3QEX A;  2HMI A;  5KTQ A;  4KI4 A;  1C6V A;  5FRN A;  4OKE A;  4DWI A;  1C1B A;  4FLX A;  3ZT0 A;  2RN2 A;  3TAP A;  2QK9 A;  1ASU A;  2R7Y A;  3AA2 A;  1T03 A;  3K57 A;  4Y1D A;  1TL3 A;  4E89 A;  1HNV A;  1UWB A;  1RTI A;  1Z26 A;  3K58 A;  1IKY A;  3V4I A;  1C0T A;  1NJW A;  2G8H A;  2P1J A;  1Y97 A;  2DFE A;  3QER A;  3ZSX A;  3D45 A;  3K5N A;  1RBS A;  2DY4 A;  1VRT A;  4Z4I A;  4J2B A;  4KAZ A;  3C6U A;  2ZQB A;  2P5O A;  3AVN A;  2VG7 A;  3QO9 A;  4OKJ A;  3OYF A;  2XY7 A;  4O4G A;  4E1N A;  5KRT A;  1TVR A;  4EP5 A;  1NK8 A;  3ZCM A;  4CHN A;  1EX4 A;  5CYM A;  4E19 A;  4HUF A;  3DLR A;  3VQQ A;  4CJ5 A;  3PX4 A;  1JL1 A;  4CFA A;  1U49 A;  1HYS A;  4B8C A;  3ZSY A;  1JLA A;  1TKZ A;  4LD0 A;  1BIS A;  3NH2 A;  4OGC A;  4CHQ A;  4C8O A;  4FJ7 A;  2Y1I A;  4FM2 A;  5CZ1 A;  3OYK A;  4CFB A;  1NOZ A;  4CF1 A;  5KGX A;  3MEC A;  1HYV A;  1KTQ A;  4JLH A;  3L2V A;  4BAC A;  3SV3 A;  1LWC A;  4DQR A;  3M8P A;  4DSI A;  1X9M A;  3BGR A;  2FBT A;  4FW1 A;  3KLG A;  1SV5 A;  1R0A A;  4J2E A;  1EKE A;  2FC0 A;  3L2W A;  1L3T A;  4CJW A;  1HPZ A;  4GW6 A;  4I2P A;  4JS4 A;  2OA8 A;  4CEQ A;  2A1R A;  4KFB A;  4AH9 A;  4NYN A;  4CJU A;  4IFV A;  2Z1J A;  1RDD A;  5C25 A;  3HPG A;  4OPJ A;  3OYB A;  1RBU A;  4CGJ A;  4CK1 A;  1LV5 A;  5HRS A;  4CIE A;  1MU2 A;  2XY6 A;  4B9N A;  3A2F A;  4FLY A;  3SUQ A;  2KFN A;  4CJP A;  1RCH A;  3LDS A;  4KPY A;  1HYZ A;  2A1S A;  3QIN A;  3VQE A;  1D8Y A;  1RT6 A;  2B5J A;  4KKO A;  3NF8 A;  4CGI A;  3AV9 A;  3S3O A;  4DMN A;  4CJ4 A;  3PX6 A;  4DFP A;  4M3X A;  1SL0 A;  1IO2 A;  1W0H A;  1SKS A;  3KTQ A;  2HHW A;  3I0R A;  3K5M A;  4CK2 A;  4HUE A;  3LP1 A;  4KHQ A;  2YV0 X;  2O4I A;  1VSK A;  5I3U A;  1QSL A;  4JRQ A;  4E0D A;  1JLB A;  3LP0 A;  3SCX A;  1JKH A;  1BIZ A;  1LAV A;  4FLZ A;  4BE0 A;  2E4L A;  1WSE A;  5C42 A;  4LSN A;  1N5Y A;  4ELT A;  4B9S A;  2D0A A;  3CM6 A;  4BWJ A;  3AA4 A;  4DTN A;  3QEW A;  1XC9 A;  1TK8 A;  3RR8 A;  2X78 A;  2OYQ A;  1SL1 A;  5HRN A;  4YFU A;  3AO3 A;  3TWH A;  1JLG A;  2HND A;  1ZBF A;  1JLF A;  3O3F A;  4FM1 A;  4O5B A;  3SZ2 A;  2ATQ A;  1RT3 A;  2XY5 A;  1QSS A;  1SKR A;  3AVL A;  4KB0 A;  1IH7 A;  1J5O A;  4FJ5 A;  3OJU A;  2F96 A;  4CHY A;  3V9U A;  4DLE A;  3HL8 A;  5FRM A;  4H4M A;  3ZSV A;  3AVC A;  3SPZ A;  3AVM A;  4CGG A;  5FRO A;  4BWM A;  1GOC A;  2BDP A;  4M45 A;  1IKW A;  3ISN C;  1C0M A;  4GMJ B;  1W9H A;  4CJL A;  1JXE A;  1UAX A;  3B6P A;  1VSE A;  5HP1 A;  3RRG A;  4J2D A;  2KTQ A;  1TK5 A;  3OYA A;  3OYE A;  3E01 A;  4DF8 A;  3HST B;  2XHB A;  1L3V A;  1JLE A;  4CEZ A;  3P83 D;  3ZT4 A;  3VA3 A;  4CK3 A;  5J2Q A;  2ZE2 A;  4O0J A;  5DMR A;  3SJJ A;  1RDB A;  1TL1 A;  3K2P A;  4LSL A;  3HM9 A;  3NCI A;  5DK5 A;  1Q9Y A;  3U3G A;  4HTU A;  3SV4 A;  3CFP A;  1WSG A;  2XY8 A;  3B6O A;  3RTV A;  1NK9 A;  2BE2 A;  3AA5 X;  3M8R A;  1RT4 A;  2G8I A;  3VQB A;  4AIL C;  3SUP A;  1X9S A;  4CEB A;  4B9U A;  4J2A A;  1EP4 A;  2EX3 A;  2PZS A;  2F8S A;  1U47 A;  3ZSO A;  1QTM A;  3AVB A;  4FJ9 A;  1RBV A;  4DTO A;  4IG0 A;  2YHA A;  3SQ0 A;  1O1W A;  3O4N A;  4LY7 A;  1S6P A;  2YNH A;  4RW6 A;  3ZSZ A;  1CXQ A;  4BDP A;  4I9Q A;  4FYD A;  4CF2 A;  3AVJ A;  5CZ2 A;  1RT1 A;  4DU3 A;  1SUQ A;  1BHL A;  1RTH A;  1U4B A;  4EZ9 A;  4E7H A;  4KI6 A;  2G8U A;  2HHX A;  2ETJ A;  3OYC A;  3OYD A;  4BE2 A;  3QEI A;  4KTQ A;  1KFD A;  3I0S A;  1L5U A;  1A5X A;  4Y1C A;  3ITH A;  3U6F A;  3BDP A;  1KSP A;  4PA1 A;  1X1P A;  3FFI A;  3HYF A;  1NK4 A;  1ZBU A;  2KZM A;  1C1A A;  3K5L A;  4ICL A;  3OS2 A;  4C8K A;  2OPQ A;  1XHZ A;  3ZT2 A;  3C6T A;  3NFA A;  4IKF A;  3KD1 E;  2IOC A;  4CJQ A;  3OS1 A;  1NOY A;  1VSM A;  3PUF A;  1JXB A;  1CLQ A;  3DOK A;  3F9K A;  3LPT A;  4TSX A;  3NF9 A;  1TAU A;  1TKX A;  1LW2 A;  3QNO A;  4DFM A;  3HPH A;  3SQ4 A;  4CEE A;  3VQ8 A;  4E7I A;  2WOM A;  4M3U A;  4Z4F A;  2YKM A;  3HO1 A;  2HHT A;  4AHS A;  4Q5V A;  3QES A;  2HB5 A;  3M8S A;  1FK9 A;  1FKP A;  3VQP A;  1IKV A;  1KVB A;  4FJJ A;  1RT7 A;  2HVI A;  4W5R A;  3LWL A;  3LAM A;  4C8L A;  1NK6 A;  3QEV A;  3QNN A;  4CGH A;  3TI0 A;  2Q3S A;  4E1M A;  3UIQ A;  4O0I A;  4FK0 A;  3CFO A;  3DRR A;  2DFF A;  2HVH A;  1NKC A;  3KK3 A;  1UA0 A;  2IAJ A;  3LPU A;  2G8W A;  1EXQ A;  4CJF A;  3SUO A;  3DLE A;  2HHU A;  2E6M A;  3V9S A;  3F73 A;  1ZBH A;  3KKS A;  4W5T A;  1TKT A;  3OYJ A;  3RWU A;  4N76 A;  2YKN A;  4IDK A;  1FXX A;  4AHR A;  4CFD A;  3TAB A;  3NH0 A;  1KFS A;  3P5J A;  3CG7 A;  1WSF A;  3DRP A;  1T8E A;  4JS5 A;  3ULD A;  3QET A;  1WSI A;  1TAQ A;  3ZSW A;  3RMA A;  3O3G A;  4QAG A;  4FK2 A;  3LAN A;  4CIF A;  2HNY A;  4JRP A;  3CFR A;  2JGU A;  4FJ8 A;  4W5Q A;  1KCF A;  1S9E A;  2NUB A;  4LH5 A;  3VQ7 A;  3DRS A;  3MED A;  4CIG A;  4DFK A;  4ZTF A;  2D0B A;  1RDA A;  2DFH A;  5T7B A;  4I9L A;  4OGE A;  3PX0 A;  4DTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...