2IS3A

Crystal structure of escherichia coli rnase t
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
203
structure length
203
Chain Sequence
LTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease T
publication title Crystal Structure of RNase T, an Exoribonuclease Involved in tRNA Maturation and End Turnover.
pubmed doi rcsb
source organism Escherichia coli k12
total genus 53
structure length 203
sequence length 203
chains with identical sequence B, C, D
ec nomenclature ec 3.1.13.-:
pdb deposition date 2006-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2is3A00
4E7HA 4KFBA 1S9EA 3AVFA 4B9SA 4AHSA 4CJEA 1BQMA 3HYFA 3AVIA 2HHSA 1QTMA 3L8BA 1RCHA 3LP1A 4DTUA 2HVHA 1F21A 3KKSA 5CZ1A 2RKIA 3RMAA 1NJWA 1ITGA 2WONA 4H8KA 4B9NA 4MFBA 4FJXA 1WLJA 1UOCA 4C8MA 4YNQA 2XHBA 4HCBA 4M3WA 2A1SA 3L2VA 4CJ3A 1KVBA 3O3HA 4RW4A 3BDPA 4DTMA 4N5SA 4OLAA 4I7FA 4MQ3A 4PQUA 3L3UA 2EHGA 4CECA 4DSFA 1O1WA 1KFSA 1R0AA 3SUNA 3AVHA 1BQNA 4HUEA 1NK8A 2XY5A 4AHRA 1L3SA 3AVCA 3HT3A 5HRNA 2XY6A 2F96A 1WAJA 1JL2A 1XHXA 2ZD1A 1NOYA 3ZSRA 4CF0A 5FDLA 2JLEA 3VQ9A 4AHCA 4CEFA 4E1NA 2XO7A 4F2RA 2DY4A 3ULDA 3D45A 1L5UA 5HRPA 1LWEA 2GUIA 4CGHA 2KFZA 2Z1IA 4KPYA 3NCIA 2HHQA 1TVRA 2VG7A 5HRSA 3NH0A 4E1MA 3OYEA 2PYJA 4QAGA 2G8IA 3QNNA 3P5JA 3F73A 3SNNA 3DOLA 4KTWA 1C1AA 4DG1A 3E01A 4FJNA 4Z4CA 3LALA 2P1JA 4DU1A 4LSNA 1JLEA 4M3UA 1HRHA 5J2PA 3QERA 4CJSA 3HVTA 3SPZA 1XHZA 4DFPA 4KTQA 4KRFA 1T8EA 1A5XA 1Y97A 4RW9A 1IKXA 4RW6A 4XIUA 3SPYA 4B8CA 3TI0A 1GOBA 1QHTA 3NF6A 4OKJA 4E89A 1WSEA 3AVNA 3CM5A 4I9LA 3QINA 4OPKA 4FLWA 1NKCA 2OPQA 3DYAA 4N56A 2G8UA 4KB0A 3OYNA 3SV4A 4FW1A 5SZTA 3PO4A 1B9FA 3D0PA 5HLFA 4DU4A 1C0UA 3OYMA 3SQ0A 5K14A 3T19A 3OJUA 5I3UA 2D0AA 3U3GA 4FJ7A 3O4NA 3TANA 3C94A 4DLEA 1IG9A 1LW2A 4DSEA 3G0ZA 4M45A 1U45A 1K6YA 3TR8A 3PX4A 2YKMA 3HP9A 2HHWA 3EZ5A 4AHVA 1ASVA 1HJRA 1S1WA 3C6TA 3CQ8A 4F3OA 4M3XA 1JLQA 1ZBLA 4DMNA 4M42A 2OPPA 4N76A 3RMBA 2YHAA 4BDYA 3PY8A 2PZSA 1S1UA 3M8RA 3NF8A 3K5LA 1T05A 3PO5A 1BI4B 1HYZA 3B6OA 2HHXA 3I0RA 4CIFA 4CJLA 1S5JA 3V4IA 4DF4A 2XRIA 4KB1A 2DTUA 1J9AA 3AO4A 2O4GA 3QEWA 2IC3A 4F8RA 2P51A 3SQ4A 1RILA 4M41A 3ZT4A 2YNHA 4CGDA 3T3FA 4E7IA 3QEIA 4L8RB 2E4LA 1NOZA 1G15A 3V1QA 4FJGA 4NCBA 2YNFA 1VSEA 4CK3A 2HHTA 5KI6A 4E19A 1RDAA 4CF1A 3LP3A 1A5WA 3DRSA 1DLOA 3NGIA 3KTQA 4KI4A 5FRMA 2I5JA 2OPRA 4BWMA 3ASMA 4IFVA 2HHUA 4W5RA 5DMRA 1TK0A 4H4MA 4F3TA 4PY5A 3WNHA 3LPUA 1NK5A 3U6FA 1LV5A 2HW3A 1HQEA 1SUQA 4W5QA 3B6PA 3VQEA 4AHUA 3QO9A 2G8FA 3TAMA 4FK0A 3EY1A 2X74A 4OKEA 1J54A 1UA1A 3K2PA 3RWUA 4IDKA 4KREA 3KLEA 4B9UA 3AA3A 4H4OA 3DMJA 1JLCA 1C0MA 3LZJA 4CCHA 4FJKA 3SZ2A 4BACA 4DQPA 3VQCA 3NDKA 1S1TA 3ISNC 2HNYA 3VQBA 4CK2A 4CJQA 4CF2A 1FK9A 1SKWA 2Z1JA 2KQ2A 1HYVA 4Y1DA 3K58A 4CEQA 2VWJA 4CERA 5J2NA 3IAYA 4CJWA 3EYZA 4QOZB 3P83D 4DS5A 1QSLA 1JXEA 1TKTA 3M8PA 2GBZA 4FM1A 4DSLA 1XWLA 4NYNA 4BE1A 3SCXA 4DTPA 1NJZA 3QEVA 4W5OA 3AVMA 4R5PA 1EETA 2YNIA 3ZSOA 2HNDA 3ZSYA 1QQCA 5T7BA 3KK2A 3LZIA 5HRRA 1XI1A 3O3GA 4C8OA 4PUOA 1KLMA 3M8QA 4RG8A 1C1CA 1ZBUA 4CHOA 4M3RA 4FLXA 4CGIA 2X78A 3VQ7A 1TGOA 1KRPA 4DU3A 1RDCA 3MECA 4DTRA 4Z4IA 1W9HA 3OS1A 1BIZA 4FK2A 1SV5A 3PUFA 2Y1JA 4ELVA 2QK9A 4FYDA 3ZSQA 1IO2A 4AHTA 3DI6A 3K59A 5D3GA 1KVCA 3K5NA 4KHQA 4BWJA 3S3MA 4WE1A 4FLYA 3QESA 4FJ5A 1WSGA 4DQSA 2QKKA 4M3YA 3V6DA 3V9UA 3AVGA 4RW7A 4Z0UA 3NGZA 2HMIA 4W5NA 1SL2A 2AJQA 4CFBA 5HROA 1T7PA 4FJ8A 2Z1GA 3SYZA 1YTUA 4DQRA 2G8KA 2BDPA 4B9VA 2ZE2A 3U3YA 2G8HA 3ZT3A 3AA2A 1Q9XA 3L3VA 1TAQA 4CHQA 3K5MA 4KHNA 4FJJA 3L2WA 1WSFA 5KTQA 1HNVA 4DFMA 4OGEA 3UIQA 3RR8A 4C8LA 1DTQA 1NJYA 2KZZA 1C1BA 1C6VA 3JYTA 3OYBA 1RBVA 3KK1A 4CJFA 4FJMA 2FBTA 1ASWA 4Z4GA 4PA1A 1GOAA 5I42A 4LH4A 1RBTA 3KLFA 2FC0A 4FZZA 3O4QA 1YT3A 3OYHA 1L3TA 1KVAA 2WOMA 1D9DA 1CZBA 4FLTA 3WNEA 1LAVA 3TAPA 1HYSA 5FROA 4DQIA 1TKDA 4FVMA 5SWMA 4ZTFA 4NCAA 2EX3A 3AVBA 2OZMA 3C95A 3MXIA 2Z1HA 3WNGA 4CHZA 3VA0A 2F8SA 3AV9A 1QSSA 3JSMA 3AO5A 4KO0A 3K57A 3C6UA 3AO3A 4CJUA 2ETJA 1S6QA 3ZSZA 3DLBA 3ZCMA 4B3OA 3I8DA 1JLAA 2ZQBA 1DTTA 4CHPA 4HCCA 1CZ9A 3HP6A 1QE1A 3QNOA 3BGRA 3TAQA 1U4BA 3KLGA 1RT5A 4CJKA 1RDBA 4HHTA 3LANA 4EZ6A 1XC9A 4J2DA 4O4GA 1U49A 3AA4A 3KD5E 4FJHA 3MXMA 4DLGA 1VSDA 2FBYA 3MEGA 2XY7A 4TSXA 4NYFA 3A2FA 3TAEA 3RRGA 4EP4A 4HUFA 4DTOA 3SI6A 1RDDA 3OYCA 4EP5A 1S9GA 1NK9A 2ATQA 1YVUA 2IAJA 5CZ2A 3ZT0A 2D5RA 1RBSA 3OYGA 4Z4EA 3VN5A 4FLUA 5FRNA 1TKXA 3DLHA 3OY9A 1YTAA 4PWDA 1CXQA 2IS3A 3OS0A 2X6SA 1ZYQA 1VSJA 2JGUA 4CJPA 1L3VA 4K8ZA 5KGWA 1I39A 2A1RA 5J1EA 3VQ6A 4BE2A 3HJFA 4IG0A 1D5AA 4FZYA 4QCLA 1RNHA 3VQAA 2VG5A 3AVAA 5JS1A 5CYQA 4CIGA 4KHSA 3QLHA 4Q0BA 3NAEA 4O0IA 3MAQA 2Y1IA 4IBNA 3V9XA 4FJIA 3TAGA 1A5VA 1EP4A 4CHYA 3SUPA 3V9SA 3KLIA 3MEEA 3OYFA 3QEPA 3VQQA 2VWKA 1X9SA 2QXFA 4B9LA 2B6AA 3NH2A 1KLNA 1ZBFA 3P1GA 3QIPA 5DK5A 3VQ8A 4FM0A 1N5YA 3V1OA 4B9TA 5J2MA 4J2EA 3OYJA 1WNSA 2KW4A 1NKEA 4W5TA 4LSLA 4JRQA 3CYMA 3VA3A 3ALYA 4BDZA 1SL0A 1LWFA 4FW2A 1RTJA 4NCGA 4KHUA 3RR7A 1SKSA 3T1AA 3IS9A 3CM6A 4DFJA 3AVLA 4B9MA 4LH5A 4CFDA 1VSHA 4ZTJA 2HNZA 1B9DA 1BL3A 4F2SA 1BISA 4B08A 3LP2A 2F8TA 3QIOA 1NKBA 4CEEA 4AILC 4KI6A 4ELTA 1WN7A 4OKKA 3KD1E 3OS2A 1EX4A 3QETA 1BGXT 3LAMA 3NFAA 4Z4FA 1VK0A 4ICLA 3DOKA 2P5GA 4N41A 3HPOA 4CGGA 3ZSWA 4CESA 3S9HA 1TK5A 1RTDA 3SQ2A 4DSJA 5CYMA 3SUQA 4CEOA 4HUGA 1IH7A 5KGXA 3HPGA 5KRSA 1NK0A 2OYQA 1VRTA 1UAXA 1UA0A 4BDPA 2DFEA 3M8SA 4FLZA 1RBRA 4JS4A 1S6PA 1X9WA 1IKYA 3V1RA 4RW8A 4CJ4A 1TKZA 2E6LA 1WSHA 3NHGA 1RT2A 3IRXA 1RTIA 4CJVA 4KHYA 3L2QA 3OYDA 4CFAA 2HB5A 4DS4A 2HHVA 1JLFA 2Q3SA 4JS5A 2OA8A 1BCOA 2OPSA 3WNFA 4LD0A 1VSIA 3DLGA 1KFDA 4O5BA 4C8NA 2DFFA 3HK2A 1IKVA 4ZHRA 3DLRA 4CK1A 1I3AA 2VG6A 2G8WA 3LAKA 4DTSA 3AVJA 1L3UA 4FJLA 4CF9A 2X6NA 3MEDA 3G10A 1EKEA 1TK8A 4OLBA 1X9MA 4J2AA 4JLHA 5C42A 1JXBA 1TV6A 2RPIA 2KTQA 4KV8A 1RT3A 4FJ9A 1VRUA 1BI4A 4ELUA 4OPJA 2LSNA 1GOCA 4Y1CA 2XY8A 2RN2A 3KKRA 3SQ1A 4KTZA 3S3NA 1BHLA 4YFUA 1NK6A 2PY5A 4CEBA 4M3TA 4FXDA 3DM2A 1HQUA 4OJRA 1Q8IA 1Z25A 2D0BA 2D0CA 2ITGA 3F9KA 1MU2A 4HTUA 1Q9YA 1KTQA 4HVJA 3L2UA 3NGYA 1RT1A 3ZSXA 2FBVA 2G8VA 4FK4A 1ZBHA 4FZXC 3KLHA 3OJSA 4GVMA 4DTXA 4G1QA 3RTVA 4E7LA 4DFKA 4KAZA 5E41A 1WSJA 4E3SA 1SL1A 2P5OA 4DTJA 3LP0A 2RF2A 1JKHA 1BIUA 1LW0A 3THVA 3ZT2A 4M3ZA 1JL1A 2YHBA 4ID1A 4C8KA 4E0DA 3SV3A 1CLQA 1VSMA 3FFIA 5HBMA 5KRTA 3HSTB 1CXUA 4CEAA 3PX0A 1KCFA 4I2QA 3TABA 3SJJA 3IG1A 2E6MA 3ZSVA 4CHNA 1WSIA 3DRPA 3AA5X 4CEZA 3OYKA 3HXMA 2PYLA 4JRPA 4IKFA 3V81A 3DLEA 3AO2A 2IGIA 3PX6A 4Q5VA 4F4KA 3CFOA 3L2RA 3LDSA 3CFRA 1NK4A 1RBUA 4DTNA 1BCMA 4KHWA 1U04A 5C24A 1C0TA 3RRHA 2KZMA 4N47A 4DF8A 2IOCA 3VQDA 4FLVA 1KSPA 1ZBIA 3PV8A 4EZ9A 3RMCA 2DFHA 4J2BA 1RT7A 2HVIA 1WAFA 4CFCA 1TL1A 3HPHA 3TARA 5EU7A 1HNIA 2OZSA 4Z4HA 1TAUA 4E7KA 3AO1A 1FKOA 1VSKA 2YNGA 3CG7A 2YKNA 3LPTA 1W0HA 2KFNA 1ASUA 2BANA 1HPZA 1RT4A 2BE2A 4CGJA 1D8YA 4O44A 2BGGA 3K5OA 2O4IA 1VSLA 3DRRA 1X1PA 4O55A 2B4JA 1SKRA 1FXXA 4KKOA 1LAWA 4I2PA 5CY4A 3VQPA 4CJRA 4LY7A 2B5JA 4GMJB 1S1XA 3HVRA 4OVLA 4AH9A 3KK3A 1FKPA 4O0JA 1LWCA 4CIEA 3LWMA 3O3FA 5HP1A 1UWBA 3SUOA 1EXQA 3TAFA 2YV0X 3VQ4A 3KJVA 5J2QA 2FBXA 3DLKA 4I9QA 1NK7A 3OYAA 4E7JA 1RTHA 4GW6A 3CFPA 4OGCA 1N6QA 4IG3A 1Z26A 4CJ5A 3HM9A 4CEDA 3OYIA 1IKWA 4ID5A 4BE0A 1REVA 1S1VA 1RT6A 4B8AB 3TWHA 3HL8A 3NBPA 3MXJA 1JLBA 1J53A 3ITHA 4CE9A 3AVKA 1QS4A 4FM2A 3QEXA 3OVNA 4IFYA 3LWLA 1TL3A 3V9WA 1U48A 3ZT1A 1T03A 2NUBA 3HO1A 3RMDA 3S3OA 1HMVA 4CJTA 3H08A 4UQGA 1QSYA 5C25A 4DSIA 2IDOA 4CF8A 1B92A 4K8XA 2GV9A 3I0SA 4CGFA 3OYLA 5JS2A 2QKBA 1J5OA 2W42A 4DSKA 3KIOA 3NF9A 2R7YA 4FCYA 3V9ZA 1NJXA 4DQQA 1D9FA 3NH1A 1U47A 1VSFA 4DWIA 3NE6A 3VQ5A 3NF7A 1JLGA
chains in the Genus database with same CATH superfamily
3KK7A 4B9SA 4AHSA 2HHSA 1BQMA 3L8BA 3LP1A 1F21A 5CZ1A 3RMAA 1ITGA 4H8KA 1GLFO 1WLJA 1UOCA 4A2BA 1YVNA 4YNQA 3HBTA 3IMXA 3CCLN 2UXDK 3VMFB 3GOIA 3MDQA 4DR7K 4MQ3A 5BN9A 2IIRA 3VENA 1NK8A 2XY5A 1L3SA 3HT3A 2YJFA 3KVGA 4BG8A 2FF3B 2ZD1A 1XHXA 3KZBA 3ENBA 3VQ9A 4CEFA 4CF0A 3IUCA 2DY4A 3Q7BA 3D45A 4CGHA 2GUIA 3LDQA 2Z1IA 3NH0A 2PYJA 2O8BB 4E1MA 4BRQA 2G8IA 3QNNA 2RE2A 3EZWA 3DOLA 2O8EB 3E01A 4FJNA 4LSNA 3QERA 1WUAA 3CCUN 3QFUA 4DFPA 1OH8A 5AQXA 3PLAA 4RW9A 4XIUA 4B8CA 3QB0A 1Z05A 3NF6A 4ILHA 4OKJA 4PKIA 5MLCQ 3VGMA 3AVNA 4OPKA 4I9LA 4FLWA 4BGAA 4DR6K 4N56A 2O8DB 3SV4A 2NRHA 3VETA 1B9FA 5HLFA 3OYMA 2IVOA 2KLAA 3L0QA 5K14A 4IOAL 4BC4A 4JKBA 3C94A 3MWTA 4BR2A 1IG9A 1LW2A 1YJNN 3G0ZA 1U45A 3PX4A 2HHWA 4AHVA 1HJRA 4GKJK 5BN8A 1JLQA 5LMNK 4DMNA 2OPPA 4FWOA 3RMBA 2YHAA 3PO5A 1HYZA 3B6OA 3T1HK 3W3DA 5E26A 5DM7L 1HNXK 3MN7A 1XNQK 4F8RA 2IC3A 3K9JA 4YOXA 4B3TK 1NGHA 3ZT4A 3QEIA 4O8KA 2YNFA 4CK3A 5AQZA 4CZHA 5AQKA 2QWPA 1A5WA 5FRMA 2OPRA 4IFVA 4H4MA 3WNHA 3LPUA 4JYAK 2HW3A 1HQEA 1SUQA 2QA4N 2QWRA 3BZCA 1Q7YO 2X74A 4LF6K 2PFUA 4OKEA 1G99A 1UA1A 3RWUA 4JKAA 4H4OA 1JLCA 3SZ2A 3DWLA 3SBTA 4DQPA 4JN4A 1S1TA 2YCHA 2HNYA 3D2FA 2KQ2A 1HYVA 2VWJA 4CERA 3EYZA 1OKJA 1JXEA 1TKTA 5LJWA 3SCXA 3PIOL 3A5MC 3VF2A 1EETA 2YNIA 5T7BA 1OVQA 3ZSYA 4C8OA 4F3TA 1E4GT 4CGIA 3VQ7A 4DU3A 1KAYA 4FPAA 4FK2A 1BUPA 4WFBL 5D3GA 3QESA 1WSGA 4DQSA 4IZ9A 4RW7A 4Z0UA 4BRLA 3HOSA 1SL2A 2AJQA 3HZ6A 1VHXA 4BRFA 2G8KA 4B9VA 3JXUA 3QMLA 3R1XA 5M1QA 4I6MA 3Q7CA 4JAXA 4CHQA 4BRPA 4DFMA 1S72N 1P8ZA 1DTQA 2PAVA 1NJYA 1C1BA 1ILYA 3OYBA 3SAFA 3TSQA 5KQ8A 3CPWM 1ASWA 3ZLJA 3FZLA 4B1UB 5M1PA 5AZJA 4YHHK 3O4QA 4DUYK 3MN6A 2P9PA 4DV5K 3VTIA 4ZTFA 5AQSA 3C95A 2Z1HA 3WNGA 1WB9A 4JV5K 3J80O 2IVPA 4CJUA 5GIPA 4GV3A 2NRWA 3K0SA 1JLAA 1CZ9A 4CJKA 1RDBA 3L6QA 3AA4A 3VF6A 5ADXA 2XY7A 2QWNA 1DGKN 1VQ5N 2P9UB 3TAEA 1EWQA 4EP4A 1ESVA 3BZKA 5FPDA 3ZT0A 4B1YB 4H0VB 4Z4EA 4H5WA 4FLUA 4MDAA 1CXQA 2UUBK 4K8ZA 4CJPA 1NU0A 3OA9A 4IJAA 2A1RA 4BE2A 3NMUA 4KH6A 3VQAA 4F9OA 5JS1A 4CVNE 5CYQA 4CIGA 4Q0BA 3MAQA 3CMEN 4FJIA 3VEXA 1EP4A 3H46O 4CHYA 1WBBA 3QEPA 2QXFA 2B6AA 3VEVA 3P1GA 3VQ8A 1N5YA 5JVHL 3WQTA 1V4TA 3TTDA 4JRQA 3CYMA 4ISFA 1LWFA 1SKSA 5AQYA 4DFJA 4H5VA 4LH5A 4CFDA 4WQ5A 1XNRK 1VSHA 2O8BA 4ZTJA 4F2SA 3BY5A 4B08A 1NKBA 4ELTA 3SJHA 2F9TA 4OKKA 3QETA 5AZIA 3FLCO 2A41A 4JKHA 1RTDA 2BTFA 3S9HA 4DSJA 4XH4A 4HUGA 1IH7A 5KGXA 2DFEA 2D0PA 1XQSC 1IKYA 4RW8A 4ISEA 4JI3K 1MWKA 1WSHA 1RTIA 4NO7A 3L2QA 4RWTA 3DLGA 4O5BA 3O80A 1IBLK 3LAKA 4DTSA 3UB5A 4DHYA 2Q1NA 1TK8A 2KTQA 1RT3A 4JKGB 4OPJA 3S3NA 3KKRA 4OX9K 1VQON 4M3TA 4FXDA 4CEBA 4OPAA 1HQUA 2IVNA 3L4IA 3F9KA 3TTCA 4YOYA 4HTUA 1KTQA 3L2UA 3ZSXA 2FBVA 3OJSA 4GVMA 5JVGL 4KAZA 1EO1A 1KQSM 3JAMO 3K9KA 3LP0A 2RF2A 4PHTX 4V19S 3ZT2A 4M3ZA 1JL1A 2YHBA 4H0XB 4R79A 3SV3A 1CXUA 1KCFA 2A6AA 3T1YK 4CHNA 2E6MA 4CBXA 4CZGA 3HXMA 4DR4K 4U67L 3TPQA 3N4PA 1RBUA 4KHWA 1C0TA 3RRHA 2KZMA 4N47A 3TTFA 3VQDA 1NMDA 2DFHA 4J2BA 3DAWA 1HNIA 4Z4HA 2NRTA 2BE2A 1RT4A 2BGGA 1VSLA 1FXXA 4FL9A 4JKEA 3KK3A 3LM9A 3LWMA 3I55N 3O3FA 2F9WA 3SUOA 2H3GX 1NGFA 1EXQA 2YV0X 3VQ4A 4H5NA 4DR5K 2P9SB 4I9QA 3LDPA 4U7BA 3CFPA 4CZLA 3OYIA 1IKWA 4ID5A 4YOUA 2F8TA 3TWHA 4GNIA 1KFSA 1QS4A 3OVNA 3V9WA 3THWB 4Y0WA 3RMDA 5AR0A 4CJTA 3H08A 4MO5A 4UQGA 5C25A 4RCHA 3DXKB 5KPZA 4K8XA 1YI2N 3NF9A 2R7YA 1QQOA 4DQQA 5AFUA 5F1XA 5FPNA 3NH1A 4BC2A 4DWIA 3VQ5A 1JLGA 1VAZA 2Q2RA 3AVFA 3AVIA 4JD2B 3FR0A 2RKIA 1GLJO 3CCJN 4ISGA 1U6ZA 2WONA 5TKWA 4B9NA 4MFBA 2Q0RA 4C8MA 4HCBA 4M3WA 2A1SA 3KWIA 1NGJA 3SBGA 4MLEA 3O3HA 4RW4A 1GLEG 4DTMA 4N5SA 4WQ5C 4M7YA 5BPNA 4DSFA 1O1WA 2ZWHA 4HUEA 5M1OA 4AHRA 3AVCA 2XY6A 5HRNA 3S41A 1WAJA 4O8UA 3ZSRA 1QHAA 3E9LA 5FDLA 2XO7A 4E1NA 1NM1A 4A5BA 2P9UA 4WYBA 1ZBSA 4KPYA 1RDUA 2VG7A 1XMOK 2NRRA 4QAGA 3MK6A 3P5JA 3U9DA 3SNNA 3QICA 1C1AA 1M1KO 3LALA 3MMVA 4M3UA 1XHZA 4KTQA 3UKUA 5LL6Z 4QS9A 3FE1A 3TI0A 1GOBA 3VOVA 1WSEA 3CM5A 3QINA 2CH6A 2OPQA 2G8UA 3OYNA 4IO8A 2GUPA 5LMUK 4DU4A 3HM8A 5I3UA 2GEMA 1VQ6N 3CJCA 4CBUA 1K6YA 4JI6K 3EZ5A 1YITN 1ASVA 5BRFA 4F3OA 4M3XA 1ZBLA 4M42A 3FGUA 1S1UA 3MX2A 3M8RA 3G6EN 4CIFA 3SMPA 2VWBA 2DTUA 4CD3A 5C15A 5C2DA 3AO4A 3O5BA 4H0TB 4A62A 2VQEK 4KH4A 3T3FA 1NOZA 1G15A 1BA1A 3SK3A 4GV6A 3FZFA 2HHTA 4E19A 3DRSA 1DLOA 3KTQA 4KI4A 1YIJN 1JCFA 4W5RA 3R3LA 2VCPA 1LV5A 1NK5A 3U6FA 1Q81O 4QS7A 4W5QA 1E4FT 3B6PA 3KHYA 4FK0A 3EEQA 3TAMA 1IV0A 3EY1A 4FWLA 1K8KB 2D4WA 1J54A 5C12A 4IDKA 1QVFM 4JKGA 4B9UA 3VEOA 1C0MA 5AQTA 3LZJA 4FJKA 4BACA 3ISNC 4EHTA 4Z94A 2Z1JA 3K58A 3IAYA 4CJWA 2W6KA 4YOVA 3M8PA 2ZJRL 3O9TA 4WCEL 4DTPA 2F4VK 4R5PA 3ZETB 3ZSOA 1RDWX 1XI1A 5CHIA 4PUOA 1KLMA 3A5LC 1C1CA 2YJEA 5AQWA 4FLXA 3CQXA 1RDCA 2GTDA 3ULEB 1BIZA 1NGDA 1SV5A 3PUFA 2Y1JA 3ZSQA 4GV9A 2FSNA 4AHTA 3AGKA 3K5NA 4BWJA 4FJ5A 2QKKA 4M3YA 2E88A 3V9UA 3AVGA 3NGZA 4H5TA 4CW7B 2YX6A 2D0OA 4FJ8A 1X9JA 1YTUA 3AAPA 3BEXA 4B1VA 2G8HA 3ZT3A 3AA2A 1Q9XA 3L3VA 1TAQA 3K5MA 3F2KA 1WSFA 5KTQA 3SAHA 5EX5A 2EWSA 5LJVA 1T6DA 1Y64A 4H5RA 5AZIB 4WQ4A 5AQQA 4Z4GA 3ATUA 4FWQA 3KLFA 2RHKA 1OH7A 1XC3A 1Q86O 4FZZA 3B8AX 4X65K 1L3TA 2WTUA 2YHWA 3P31A 4FLTA 3TAPA 3ENHA 2P9SA 4DQIA 4NCAA 5CE3A 2EX3A 1EQYA 4WF9L 3EE8A 3MXIA 2NNWA 1SS6A 3MCAB 2F8SA 4CHZA 3VA0A 1QSSA 3K57A 3C6UA 4BRCA 1Q82O 4E1JA 1S6QA 3ZSZA 3ZCMA 3THWA 2Q36A 1DTTA 4IXCA 4CHPA 3CMAN 2O8FB 3O9SA 2YI1A 3DXKA 3LANA 1OH6A 1TUUA 4J2DA 4O4GA 4IFEA 4DLGA 2FBYA 4JI5K 4NYFA 5AQOA 4HUFA 1LOTB 3SI6A 1RDDA 5EOYA 1S9GA 1MDUB 5ADXH 2IAJA 2HSTA 4FOIA 4JD2A 3J8AA 3OYGA 3VN5A 1YTAA 1ZYQA 3OS0A 2X6SA 1L3VA 1VSJA 2KKZA 3VQ6A 3CJAA 4IG0A 3VEZA 2QTDA 4CBWA 3CCSN 4IWVA 3CCVN 2Y1IA 1BDGA 3ID6A 1YJWN 1A5VA 2HOEA 4JK7A 3VQQA 2VWKA 3GDQA 1RFQA 5AQJA 3OBYA 5DK5A 1GLCG 4B9TA 5J2MA 1KC8O 4W5TA 3VPZA 4FO0A 3P4IA 4FW2A 1RTJA 4NCGA 3CCMN 4KHUA 2HBKA 4K25A 2ZJPL 4JKDA 3T1AA 3IS9A 4MDBA 2WFBA 3VESA 4JK8A 3J7ZO 1QVGM 5GADP 3FZMA 4JKCA 3LP2A 2V7YA 3BUZB 3KD1E 1M90O 1BGXT 3NFAA 1VK0A 2CGLA 2P5GA 4N41A 3HPOA 3ZSWA 2D1KA 3SQ2A 4FWPA 5KPTA 5CYMA 5BR8K 4CEOA 3SUQA 4LF4K 2V51B 5KRSA 2OYQA 4JHDB 5HL7L 1UA0A 2Q97A 1S6PA 3R8EA 5EXWA 3WEEB 5F0XA 1TKZA 4OPHA 4CJVA 4IO9L 3CD6N 1IG8A 3OYDA 3O1BA 4DS4A 1JLFA 1HLUA 1T6CA 3O6WA 1VSIA 4BVOA 1KFDA 2DFFA 1I3AA 4IOXA 1VQMN 2G8WA 5CR4A 2X6NA 4OLBA 2E2NA 4JLHA 4B3RK 2RPIA 4KV8A 4MLHA 4DV7K 4EHUA 2RN2A 3N4QA 2ITGA 3VGLA 4BC5A 3O9QA 3NGYA 2G8VA 4FK4A 1ZBHA 4DTXA 4G1QA 4E7LA 3QDKA 5E41A 5C0YA 1SL1A 4NB4A 4K0KK 4C1NK 4ID1A 4C8KA 1CLQA 1VSMA 5HBMA 2JWLA 1HUXA 1K9MO 1HKBA 3ZX0A 4I2QA 4LFCK 3SJJA 4BRDA 3ZSVA 5KPRA 3D6RA 2ZGZA 4CEZA 2PYLA 3OYKA 4LF8K 4IKFA 3V81A 5DM6L 1J6ZA 4FWRA 4Q5VA 1K8KA 4F4KA 3CFRA 4X62K 1U04A 5C24A 1C0FA 2VGNA 3F5TA 1KSPA 2HVIA 4CFCA 4GVEA 1IBKK 2OZSA 4PKHA 2ZF5O 1XMQK 3AO1A 3CG7A 2YKNA 1N8RO 2KFNA 4FOEA 1HPZA 2VYPA 2O4IA 4O44A 3K5OA 3DRRA 4LC9B 3UKUB 2B4JA 4X66K 3ZETA 4I2PA 5CY4A 4FVUA 2B5JA 1S1XA 4AH9A 5GAHP 5ELZA 3O1WA 3ULEA 3P39A 5GIOA 4GY2B 5J2QA 1WOQA 1RTHA 2DPNA 3QFPA 4GW6A 4YORA 4ILJA 4CJ5A 2E1YA 2P9LA 1S1VA 4B8AB 3NBPA 3MXJA 1JLBA 1J53A 4CE9A 3QEXA 4IFYA 1U48A 3S3OA 3TSUA 3R6MA 1QSYA 3E9OA 2P9KB 3PSFA 4CF8A 1B92A 2GV9A 3CC2N 3H3NO 2QKBA 4DSKA 2W42A 1NJXA 3PIPL 3U9ZA 1D4XA 2OANA 3NF7A 2E5LK 4KFBA 3J81O 1QTMA 5AFUH 1RCHA 1VQ8N 2HVHA 4FSVA 3KKSA 2YHXA 1W2BM 1I94K 4XH1A 3OTOK 4C23A 4BRGA 1KVBA 3BDPA 3BF3A 4OLAA 4CECA 1NG9A 1R0AA 2HHHK 2O8FA 3AVHA 1BQNA 1JCEA 2F96A 1NOYA 3CCQN 3J7YP 4BGBA 4F2RA 2JLEA 5B8HA 2HBLA 3ULDA 1L5UA 3FZHA 3T7ZA 5HRPA 1E3MA 1LWEA 2KFZA 3NCIA 4BC3A 2HHQA 1TVRA 3OYEA 4DR2K 4BR7A 4Z4CA 3M1FA 1HRHA 3FZKA 3WXJA 5J2PA 3HVTA 3SPZA 1Z6RA 1IJJA 1KAXA 3SPYA 2QXLA 1QHTA 3ZX2A 3W0LA 1NKCA 1MWMA 2QM1A 3DYAA 2GELA 4FWKA 3MN5A 4K43A 5SZTA 3D0PA 5JLFA 3U3GA 2W40A 3O4NA 3TANA 4G9ZA 3GL1A 4CZMA 4YOWA 1GLDG 1K8AO 4DSEA 3UKRB 4M45A 2YKMA 3QBXA 4BRKA 4EIAA 1S1WA 3C6TA 2E2PA 4YDUA 1YHQN 3WXLA 4N76A 5BR9A 4BDYA 3PY8A 2WC9A 2QI2A 3I0RA 4B1XB 4CJLA 1S5JA 3V4IA 4DF4A 2PBDA 4KB1A 1TYQA 1J9AA 2O4GA 4JHDA 1RILA 1IBMK 2YNHA 4CGDA 3D7EO 4NCBA 2E4LA 3WEEA 1VSEA 1YF5L 5KI6A 4JKFA 4CF1A 3LP3A 3NGIA 3H45C 2HHUA 3M3ZA 3CXCM 4PY5A 4KBOA 4OO1J 3VQEA 1NGCA 4AHUA 3QO9A 2E20A 2G8FA 4DV2K 4K41A 2BUPA 3T69A 3DXMB 3J7AP 1VQKN 2FLOA 4KREA 2ITMA 1VQLN 3DMJA 3U8XA 4CCHA 3GG4A 3VQCA 3NDKA 3VQBA 4CJQA 1SKWA 4Y1DA 4CZJA 1N34K 4CEQA 4JI8K 4QOZB 3P83D 4DV0K 4DSLA 4NYNA 3OW2M 1NJZA 4W5OA 3AVMA 3KK2A 3LZIA 3O3GA 3CI5A 2WUSA 4RG8A 2O8CB 3CQYA 3VGKA 3DJCA 2X78A 1V4SA 1NJIO 4DTRA 1W9HA 3L4QA 3I8BA 1J5EK 4B9QA 5JICA 3K59A 4A5AA 4A61A 4WE1A 1EWRA 3V6DA 4BY9C 4IDHA 4W5NA 2QWQA 3SYZA 2ZE2A 3U3YA 4H0OA 4AQYK 2FF6A 5M1KA 4KHNA 4FJJA 3L2WA 2UUAK 4OGEA 3RR8A 5BREA 4C8LA 3JYTA 4LF9K 1RBVA 2A3ZA 4FJMA 2FBTA 5FPEA 2AP1A 5FLXO 3TU5A 5I42A 4LH4A 4B3SK 3IFRA 1SZ2A 3TSPA 3MCPA 2FC0A 3OYHA 1KVAA 2WOMA 1D9DA 1CZBA 4MO4A 1JJ2M 1LAVA 4A2AA 5AJ3K 3AY9A 4FVMA 2OZMA 5BPMA 4J8FA 3JSMA 4KO0A 1BOTO 2ETJA 1SAZA 2JWKA 1NNEA 1BA0A 4B3OA 2A40A 2OTJN 5AQMA 1NWKA 3BGRA 2P9KA 1U4BA 1BWFO 1RT5A 1XC9A 1U49A 1HX1A 4FWMA 3EKSA 4JK9A 4AM7A 3A2FA 2W6LA 2A5XA 3WQUA 3RRGA 4DTOA 3OYCA 2Q31A 4EP5A 3GBTA 2ATQA 1YVUA 3VEWA 5CZ2A 2D5RA 1LCUA 1RBSA 4M63C 1TKXA 3KWGA 2JGUA 4B1ZA 5KGWA 1I39A 3HJFA 4B1WB 4QCLA 1D5AA 4FZYA 1RNHA 2VG5A 4JEPA 3AVAA 3SAGA 3QLHA 4KHSA 3D2EB 4KHPK 4O0IA 1C0GA 4IBNA 3V9XA 1WBDA 2FXUA 3MEEA 3NH2A 1ZBFA 3QIPA 4BR4A 2CGKA 2V52B 4J2EA 3ENOA 3V1OA 4AF1A 3OYJA 1NLVA 1WNSA 2A42A 2BH1A 3VA3A 3ALYA 5AQVA 4BDZA 3CC4N 3NVKA 3THYB 1NBWA 3CM6A 3AVLA 3HRGA 5KQDA 4FPBA 1SQKA 1B9DA 1BL3A 2UUCK 1BISA 1FW6A 3QIOA 4UY8O 2HMPA 4AILC 1X3NA 2E1ZA 1WN7A 3OS2A 2QWMA 4Z4FA 1ATSA 4ICLA 3DOKA 1BG3A 4WFAL 4CGGA 4DV1K 1TK5A 3HPGA 1T44A 1VRTA 4IJNA 4BDPA 5BRHA 2GWKA 4FLZA 1RBRA 3NVMA 2VQFK 1HPMA 2E6LA 3NHGA 4YOTA 5GAEP 4KHYA 2P9LB 3QBWA 2ASPA 4JS5A 1BCOA 4IEIA 3ZX3A 2HHVA 5AQRA 5IWAK 1IKVA 3UKRA 3DLRA 4ZHRA 2WBNA 4CK1A 1TUYA 4ILGB 4L3QA 1L3UA 4FJLA 2UU9K 3MEDA 3G10A 1EKEA 1X9MA 3CJ9A 1JXBA 1TV6A 2KHOA 4FJ9A 3F9MA 1VRUA 5A2QO 3OBWA 4Y1CA 3SQ1A 2YHYA 1ZXOA 3G25A 1NK6A 4BRHA 4JI0K 3DM2A 3CCRN 1RGIA 1Q8IA 2D0CA 1MU2A 3EO3A 3ZEUB 1RT1A 4FZXC 3KLHA 1W7AA 2HF3A 4DTJA 1JKHA 3THVA 3M5RA 1X3MA 3FFIA 4BROA 3AARA 1QZ6A 2ZJQL 1GLBG 3AA5X 4JRPA 3AO2A 2IGIA 3DXMA 4H0PA 4DUZK 3CFOA 1NK4A 3VF4A 4DTNA 1BCMA 5I9EB 1ZBIA 3DLLL 3PV8A 3RMCA 2E2QA 1QQNA 1WAFA 3EN9A 1TL1A 1YXQA 3HPHA 3TARA 4JI7K 1TAUA 3CETA 2P9NB 1JCGA 1VSKA 2YNGA 1W0HA 2BANA 4CZKA 4CGJA 4O55A 1LAWA 3HI0A 4LY7A 1VQ7N 3HVRA 4OVLA 2O8CA 1FKPA 4O0JA 4CIEA 5HP1A 1UWBA 4JI4K 3C0BA 4BRIA 3TAFA 4PKGA 3KJVA 3DLKA 1O13A 4E7JA 1NK7A 1N6QA 4OGCA 4IG3A 3HM9A 4CEDA 4AM6A 1KAZA 1REVA 4DS5A 1RT6A 4RTFD 3HL8A 4EZ9A 4JI2K 4JNEA 3RVCA 1TL3A 3ZT1A 1T03A 2NRZA 1HMVA 3CIPA 1NGBA 3A0IX 5BRDA 1KD1O 1ZC6A 4WFNL 3I56N 4DR1K 3I0SA 4CGFA 2OCEA 5JS2A 1J5OA 4FCYA 3CJ1A 3WXIA 1TYQB 1U47A 1VSFA 1BO5O 1HJOA 1XUPO 4E7HA 1S9EA 4PL8A 4NXNK 5GAGP 4CJEA 3HYFA 4KH5A 4DTUA 3WXKA 1NJWA 4FJXA 3A5NC 2XHBA 3L2VA 1VQ9N 4CJ3A 4DQ8A 4I7FA 4PQUA 3L3UA 2EHGA 2OTLN 4CD1A 4NLCA 3SUNA 3O08A 1JL2A 3G4SN 4AHCA 3E1YA 2V7ZA 4DR3K 4NXMK 4BRNA 3HTVA 4A57A 5JLHA 3LDOA 1VQ4N 5HRSA 4DCHA 3UE5A 4BQLA 3F73A 4KTWA 4DG1A 2P1JA 4DU1A 1JLEA 2QWLA 4CJSA 4KRFA 1T8EA 1A5XA 1Y97A 2QW9A 1IKXA 4RW6A 3D2EA 4JI1K 1QQMA 3RSEB 4E89A 1ATNA 2ZM6K 4KB0A 3HSCA 1DKGD 4HTLA 4FW1A 3AAQA 3PO4A 1C0UA 3SQ0A 4O5FA 3T19A 3OJUA 2D0AA 4FJ7A 4WQ4C 4QS8A 1OH5A 4DLEA 3THYA 4GKKK 3CJBA 3TR8A 3HP9A 5AQLA 4CZEA 3O9UA 3CQ8A 2GWJA 1N36K 1HKGA 3O4WA 5C2FA 4BR5A 2PZSA 3K5LA 3NF8A 1T05A 1YJ9N 1BI4B 3H1VX 2HHXA 2J4RA 1MA9B 3OHRA 2XRIA 1K73O 2NZTA 2VGMA 3QEWA 2P51A 3SQ4A 2ASOA 4M41A 1R59O 3CERA 4E7IA 4L8RB 3V1QA 4FJGA 3BP8A 4DV6K 1U2VB 2AA4A 1RDAA 3PSIA 2I5JA 3WUHA 4BWMA 3ASMA 2I7NA 5DMRA 3THXB 1TK0A 3A5OC 3EL2A 1HKCA 3K2PA 3KLEA 3AA3A 3H6EA 2I7PA 4CK2A 4CF2A 1FK9A 3ZEUA 3AGRA 3EE9A 5J2NA 1QSLA 2O8EA 1S22A 2GBZA 3JS6A 1XWLA 4FM1A 4BE1A 3QEVA 4DKWA 2Q0UA 4B3MK 2HNDA 1QQCA 4LFBK 5HRRA 5C10A 2QEXN 5GINA 3M8QA 2GX9A 1ZBUA 4XH5A 4CHOA 1Q18A 4M3RA 1KRPA 2P9IB 1TGOA 4CI6A 4Z4IA 3MECA 2QK9A 3OS1A 4FYDA 4ELVA 4IOCL 2O8DA 1IO2A 3DI6A 1KVCA 2QWOA 4KHQA 4FLYA 3CJ7A 3C7NB 2ZGYA 3BF1A 4PL7A 2HMIA 5H1SQ 4CFBA 5HROA 1T7PA 2Z1GA 3C6HA 4DQRA 2BDPA 2CH5A 3MWPA 3LM2A 1VQNN 3A8YA 1HNVA 2P9NA 3UIQA 2KZZA 1C6VA 3O8MA 3KK1A 4CJFA 5AQGA 1NGGA 3I33A 3SLCA 4PA1A 1GOAA 4FWSA 4BG9A 1RBTA 5HOOA 1VQPN 1YT3A 3MN9A 4CZIA 1HNZK 3WNEA 1HYSA 5FROA 1TKDA 5SWMA 3AVBA 3CC7N 3AV9A 3AO5A 3GE1A 3AO3A 3WXMB 2NLXA 3I8DA 2ZQBA 4HCCA 1HR0K 3HP6A 3ID8A 1QE1A 4DV4K 3QNOA 3TAQA 1BU6O 3KLGA 5AQUA 4EZ6A 4HHTA 3R9PA 3KD5E 1NGIA 3MXMA 4EAHD 1VSDA 4FJHA 2HBMA 3MEGA 4TSXA 4LFAK 5EVZA 1NK9A 3G71N 5FRNA 3MX5A 2E2OA 1H1VA 1T3VA 3P38A 3OY9A 3DLHA 4PWDA 2IS3A 5J1EA 3HOTA 3ATVA 5AQPA 2UXCK 1HNWK 3H1QA 4K42A 3NAEA 3TAGA 3LDNA 3SUPA 3V9SA 1DT9A 3KLIA 3OYFA 1X9SA 4B9LA 1KLNA 4FM0A 4BRAA 1P90A 2NRVA 3E9PA 2KW4A 1NKEA 4LSLA 2FSJA 3WT0A 5E84A 1SL0A 5AQNA 4BR0A 3RR7A 2HF4A 4XEIA 4B9MA 2HNZA 3CHWA 4LF7K 4A59A 4CEEA 4KI6A 5F2RA 4BQZA 1EX4A 3LAMA 1OVYA 4CESA 2FSKA 1GLAG 3RSEA 3VERA 1NK0A 1UAXA 5JMVA 3M8SA 4CZFA 5LY3A 4JS4A 1X9WA 3V1RA 4CJ4A 1S3XA 1RT2A 3IRXA 2UXBK 1NGAA 4CFAA 2HB5A 3CCEN 1KXPA 2Q3SA 2OA8A 2OPSA 3EKUA 3WNFA 4LD0A 3HK2A 4C8NA 3IKMA 1DEJA 4BRMA 5EY4A 2VG6A 1GLLO 3AVJA 4CF9A 4H0YB 4J2AA 3CF5L 5C42A 2UYTA 1BI4A 4ELUA 2LSNA 1GOCA 2XY8A 4BREA 4KTZA 2PY5A 1BHLA 3CPEA 4YFUA 2NRXA 4OJRA 1N33K 2ASMA 1Z25A 2D0BA 1NMNA 3D2FB 1Q9YA 4HVJA 3C65A 4DFKA 3RTVA 1WSJA 4E3SA 5AQIA 2F7TA 3E66A 2P5OA 5TKYA 1BIUA 1LW0A 3O9RA 5BPLA 1U2VA 4E0DA 3VTHA 5KRTA 3HSTB 4CEAA 3PX0A 1QZ5A 3TABA 1YAGA 3IDHA 3ZYYX 3IG1A 3THXA 1WSIA 3DRPA 4BVPA 1N32K 4HWIA 3VEYA 3LL3A 5IT9O 3DLEA 3PX6A 3L2RA 3LDSA 2CGJA 4LF5K 1NGEA 4EFHA 4DF8A 2IOCA 4FLVA 1RT7A 4I6MB 5AQFA 1W97L 5EU7A 4X64K 3LDLA 4E7KA 1FKOA 3U4LA 3LPTA 4DB3A 1ASUA 4C1NI 5M1NA 1D8YA 1ATRA 1X1PA 1SKRA 4KKOA 4CJRA 3VQPA 4GMJB 3FFKB 1LWCA 2HBJA 5AZJB 2P9IA 3C6AA 4IEEA 4YDUC 5M1FA 2P9PB 4DV3K 2FBXA 3SMSA 1YUWA 3OYAA 1Z26A 3C7NA 2W41A 4BE0A 3DLBA 3S3MA 3ITHA 3AVKA 4FM2A 3LWLA 1FJGK 5AQHA 2NUBA 3HO1A 5FPMA 3H3OB 4M7XA 4DSIA 2IDOA 3M6GA 3OYLA 2E8AA 3KIOA 4FWNA 3V9ZA 1D9FA 4YY3K 4BR9A 1CZAN 4NLBA 4H03B 4CJ7A 3NE6A
chains in the Genus database with same CATH topology
4E7HA 4KFBA 1S9EA 3AVFA 4B9SA 4AHSA 4CJEA 1BQMA 3HYFA 3AVIA 2HHSA 1QTMA 3L8BA 1RCHA 3LP1A 4DTUA 2HVHA 1F21A 3KKSA 5CZ1A 2RKIA 3RMAA 1NJWA 1ITGA 2WONA 4H8KA 4B9NA 4MFBA 4FJXA 1WLJA 1UOCA 4C8MA 4YNQA 2XHBA 4HCBA 4M3WA 2A1SA 3L2VA 4CJ3A 1KVBA 3O3HA 4RW4A 3BDPA 4DTMA 4N5SA 4OLAA 4I7FA 4MQ3A 4PQUA 3L3UA 2EHGA 4CECA 4DSFA 1O1WA 1KFSA 1R0AA 3SUNA 3AVHA 1BQNA 4HUEA 1NK8A 2XY5A 4AHRA 1L3SA 3AVCA 3HT3A 5HRNA 2XY6A 2F96A 1WAJA 1JL2A 1XHXA 2ZD1A 1NOYA 3ZSRA 4CF0A 5FDLA 2JLEA 3VQ9A 4AHCA 4CEFA 4E1NA 2XO7A 4F2RA 2DY4A 3ULDA 3D45A 1L5UA 5HRPA 1LWEA 2GUIA 4CGHA 2KFZA 2Z1IA 4KPYA 3NCIA 2HHQA 1TVRA 2VG7A 5HRSA 3NH0A 4E1MA 3OYEA 2PYJA 4QAGA 2G8IA 3QNNA 3P5JA 3F73A 3SNNA 3DOLA 4KTWA 1C1AA 4DG1A 3E01A 4FJNA 4Z4CA 3LALA 2P1JA 4DU1A 4LSNA 1JLEA 4M3UA 1HRHA 5J2PA 3QERA 4CJSA 3HVTA 3SPZA 1XHZA 4DFPA 4KTQA 4KRFA 1T8EA 1A5XA 1Y97A 4RW9A 1IKXA 4RW6A 4XIUA 3SPYA 4B8CA 3TI0A 1GOBA 1QHTA 3NF6A 4OKJA 4E89A 1WSEA 3AVNA 3CM5A 4I9LA 3QINA 4OPKA 4FLWA 1NKCA 2OPQA 3DYAA 4N56A 2G8UA 4KB0A 3OYNA 3SV4A 4FW1A 5SZTA 3PO4A 1B9FA 3D0PA 5HLFA 4DU4A 1C0UA 3OYMA 3SQ0A 5K14A 3T19A 3OJUA 5I3UA 2D0AA 3U3GA 4FJ7A 3O4NA 3TANA 3C94A 4DLEA 1IG9A 1LW2A 4DSEA 3G0ZA 4M45A 1U45A 1K6YA 3TR8A 3PX4A 2YKMA 3HP9A 2HHWA 3EZ5A 4AHVA 1ASVA 1HJRA 1S1WA 3C6TA 3CQ8A 4F3OA 4M3XA 1JLQA 1ZBLA 4DMNA 4M42A 2OPPA 4N76A 3RMBA 2YHAA 4BDYA 3PY8A 2PZSA 1S1UA 3M8RA 3NF8A 3K5LA 1T05A 3PO5A 1BI4B 1HYZA 3B6OA 2HHXA 3I0RA 4CIFA 4CJLA 1S5JA 3V4IA 4DF4A 2XRIA 4KB1A 2DTUA 1J9AA 3AO4A 2O4GA 3QEWA 2IC3A 4F8RA 2P51A 3SQ4A 1RILA 4M41A 3ZT4A 2YNHA 4CGDA 3T3FA 4E7IA 3QEIA 4L8RB 2E4LA 1NOZA 1G15A 3V1QA 4FJGA 4NCBA 2YNFA 1VSEA 4CK3A 2HHTA 5KI6A 4E19A 1RDAA 4CF1A 3LP3A 1A5WA 3DRSA 1DLOA 3NGIA 3KTQA 4KI4A 5FRMA 2I5JA 2OPRA 4BWMA 3ASMA 4IFVA 2HHUA 4W5RA 5DMRA 1TK0A 4H4MA 4F3TA 4PY5A 3WNHA 3LPUA 1NK5A 3U6FA 1LV5A 2HW3A 1HQEA 1SUQA 4W5QA 3B6PA 3VQEA 4AHUA 3QO9A 2G8FA 3TAMA 4FK0A 3EY1A 2X74A 4OKEA 1J54A 1UA1A 3K2PA 3RWUA 4IDKA 4KREA 3KLEA 4B9UA 3AA3A 4H4OA 3DMJA 1JLCA 1C0MA 3LZJA 4CCHA 4FJKA 3SZ2A 4BACA 4DQPA 3VQCA 3NDKA 1S1TA 3ISNC 2HNYA 3VQBA 4CK2A 4CJQA 4CF2A 1FK9A 1SKWA 2Z1JA 2KQ2A 1HYVA 4Y1DA 3K58A 4CEQA 2VWJA 4CERA 5J2NA 3IAYA 4CJWA 3EYZA 4QOZB 3P83D 4DS5A 1QSLA 1JXEA 1TKTA 3M8PA 2GBZA 4FM1A 4DSLA 1XWLA 4NYNA 4BE1A 3SCXA 4DTPA 1NJZA 3QEVA 4W5OA 3AVMA 4R5PA 1EETA 2YNIA 3ZSOA 2HNDA 3ZSYA 1QQCA 5T7BA 3KK2A 3LZIA 5HRRA 1XI1A 3O3GA 4C8OA 4PUOA 1KLMA 3M8QA 4RG8A 1C1CA 1ZBUA 4CHOA 4M3RA 4FLXA 4CGIA 2X78A 3VQ7A 1TGOA 1KRPA 4DU3A 1RDCA 3MECA 4DTRA 4Z4IA 1W9HA 3OS1A 1BIZA 4FK2A 1SV5A 3PUFA 2Y1JA 4ELVA 2QK9A 4FYDA 3ZSQA 1IO2A 4AHTA 3DI6A 3K59A 5D3GA 1KVCA 3K5NA 4KHQA 4BWJA 3S3MA 4WE1A 4FLYA 3QESA 4FJ5A 1WSGA 4DQSA 2QKKA 4M3YA 3V6DA 3V9UA 3AVGA 4RW7A 4Z0UA 3NGZA 2HMIA 4W5NA 1SL2A 2AJQA 4CFBA 5HROA 1T7PA 4FJ8A 2Z1GA 3SYZA 1YTUA 4DQRA 2G8KA 2BDPA 4B9VA 2ZE2A 3U3YA 2G8HA 3ZT3A 3AA2A 1Q9XA 3L3VA 1TAQA 4CHQA 3K5MA 4KHNA 4FJJA 3L2WA 1WSFA 5KTQA 1HNVA 4DFMA 4OGEA 3UIQA 3RR8A 4C8LA 1DTQA 1NJYA 2KZZA 1C1BA 1C6VA 3JYTA 3OYBA 1RBVA 3KK1A 4CJFA 4FJMA 2FBTA 1ASWA 4Z4GA 4PA1A 1GOAA 5I42A 4LH4A 1RBTA 3KLFA 2FC0A 4FZZA 3O4QA 1YT3A 3OYHA 1L3TA 1KVAA 2WOMA 1D9DA 1CZBA 4FLTA 3WNEA 1LAVA 3TAPA 1HYSA 5FROA 4DQIA 1TKDA 4FVMA 5SWMA 4ZTFA 4NCAA 2EX3A 3AVBA 2OZMA 3C95A 3MXIA 2Z1HA 3WNGA 4CHZA 3VA0A 2F8SA 3AV9A 1QSSA 3JSMA 3AO5A 4KO0A 3K57A 3C6UA 3AO3A 4CJUA 2ETJA 1S6QA 3ZSZA 3DLBA 3ZCMA 4B3OA 3I8DA 1JLAA 2ZQBA 1DTTA 4CHPA 4HCCA 1CZ9A 3HP6A 1QE1A 3QNOA 3BGRA 3TAQA 1U4BA 3KLGA 1RT5A 4CJKA 1RDBA 4HHTA 3LANA 4EZ6A 1XC9A 4J2DA 4O4GA 1U49A 3AA4A 3KD5E 4FJHA 3MXMA 4DLGA 1VSDA 2FBYA 3MEGA 2XY7A 4TSXA 4NYFA 3A2FA 3TAEA 3RRGA 4EP4A 4HUFA 4DTOA 3SI6A 1RDDA 3OYCA 4EP5A 1S9GA 1NK9A 2ATQA 1YVUA 2IAJA 5CZ2A 3ZT0A 2D5RA 1RBSA 3OYGA 4Z4EA 3VN5A 4FLUA 5FRNA 1TKXA 3DLHA 3OY9A 1YTAA 4PWDA 1CXQA 2IS3A 3OS0A 2X6SA 1ZYQA 1VSJA 2JGUA 4CJPA 1L3VA 4K8ZA 5KGWA 1I39A 2A1RA 5J1EA 3VQ6A 4BE2A 3HJFA 4IG0A 1D5AA 4FZYA 4QCLA 1RNHA 3VQAA 2VG5A 3AVAA 5JS1A 5CYQA 4CIGA 4KHSA 3QLHA 4Q0BA 3NAEA 4O0IA 3MAQA 2Y1IA 4IBNA 3V9XA 4FJIA 3TAGA 1A5VA 1EP4A 4CHYA 3SUPA 3V9SA 3KLIA 3MEEA 3OYFA 3QEPA 3VQQA 2VWKA 1X9SA 2QXFA 4B9LA 2B6AA 3NH2A 1KLNA 1ZBFA 3P1GA 3QIPA 5DK5A 3VQ8A 4FM0A 1N5YA 3V1OA 4B9TA 5J2MA 4J2EA 3OYJA 1WNSA 2KW4A 1NKEA 4W5TA 4LSLA 4JRQA 3CYMA 3VA3A 3ALYA 4BDZA 1SL0A 1LWFA 4FW2A 1RTJA 4NCGA 4KHUA 3RR7A 1SKSA 3T1AA 3IS9A 3CM6A 4DFJA 3AVLA 4B9MA 4LH5A 4CFDA 1VSHA 4ZTJA 2HNZA 1B9DA 1BL3A 4F2SA 1BISA 4B08A 3LP2A 2F8TA 3QIOA 1NKBA 4CEEA 4AILC 4KI6A 4ELTA 1WN7A 4OKKA 3KD1E 3OS2A 1EX4A 3QETA 1BGXT 3LAMA 3NFAA 4Z4FA 1VK0A 4ICLA 3DOKA 2P5GA 4N41A 3HPOA 4CGGA 3ZSWA 4CESA 3S9HA 1TK5A 1RTDA 3SQ2A 4DSJA 5CYMA 3SUQA 4CEOA 4HUGA 1IH7A 5KGXA 3HPGA 5KRSA 1NK0A 2OYQA 1VRTA 1UAXA 1UA0A 4BDPA 2DFEA 3M8SA 4FLZA 1RBRA 4JS4A 1S6PA 1X9WA 1IKYA 3V1RA 4RW8A 4CJ4A 1TKZA 2E6LA 1WSHA 3NHGA 1RT2A 3IRXA 1RTIA 4CJVA 4KHYA 3L2QA 3OYDA 4CFAA 2HB5A 4DS4A 2HHVA 1JLFA 2Q3SA 4JS5A 2OA8A 1BCOA 2OPSA 3WNFA 4LD0A 1VSIA 3DLGA 1KFDA 4O5BA 4C8NA 2DFFA 3HK2A 1IKVA 4ZHRA 3DLRA 4CK1A 1I3AA 2VG6A 2G8WA 3LAKA 4DTSA 3AVJA 1L3UA 4FJLA 4CF9A 2X6NA 3MEDA 3G10A 1EKEA 1TK8A 4OLBA 1X9MA 4J2AA 4JLHA 5C42A 1JXBA 1TV6A 2RPIA 2KTQA 4KV8A 1RT3A 4FJ9A 1VRUA 1BI4A 4ELUA 4OPJA 2LSNA 1GOCA 4Y1CA 2XY8A 2RN2A 3KKRA 3SQ1A 4KTZA 3S3NA 1BHLA 4YFUA 1NK6A 2PY5A 4CEBA 4M3TA 4FXDA 3DM2A 1HQUA 4OJRA 1Q8IA 1Z25A 2D0BA 2D0CA 2ITGA 3F9KA 1MU2A 4HTUA 1Q9YA 1KTQA 4HVJA 3L2UA 3NGYA 1RT1A 3ZSXA 2FBVA 2G8VA 4FK4A 1ZBHA 4FZXC 3KLHA 3OJSA 4GVMA 4DTXA 4G1QA 3RTVA 4E7LA 4DFKA 4KAZA 5E41A 1WSJA 4E3SA 1SL1A 2P5OA 4DTJA 3LP0A 2RF2A 1JKHA 1BIUA 1LW0A 3THVA 3ZT2A 4M3ZA 1JL1A 2YHBA 4ID1A 4C8KA 4E0DA 3SV3A 1CLQA 1VSMA 3FFIA 5HBMA 5KRTA 3HSTB 1CXUA 4CEAA 3PX0A 1KCFA 4I2QA 3TABA 3SJJA 3IG1A 2E6MA 3ZSVA 4CHNA 1WSIA 3DRPA 3AA5X 4CEZA 3OYKA 3HXMA 2PYLA 4JRPA 4IKFA 3V81A 3DLEA 3AO2A 2IGIA 3PX6A 4Q5VA 4F4KA 3CFOA 3L2RA 3LDSA 3CFRA 1NK4A 1RBUA 4DTNA 1BCMA 4KHWA 1U04A 5C24A 1C0TA 3RRHA 2KZMA 4N47A 4DF8A 2IOCA 3VQDA 4FLVA 1KSPA 1ZBIA 3PV8A 4EZ9A 3RMCA 2DFHA 4J2BA 1RT7A 2HVIA 1WAFA 4CFCA 1TL1A 3HPHA 3TARA 5EU7A 1HNIA 2OZSA 4Z4HA 1TAUA 4E7KA 3AO1A 1FKOA 1VSKA 2YNGA 3CG7A 2YKNA 3LPTA 1W0HA 2KFNA 1ASUA 2BANA 1HPZA 1RT4A 2BE2A 4CGJA 1D8YA 4O44A 2BGGA 3K5OA 2O4IA 1VSLA 3DRRA 1X1PA 4O55A 2B4JA 1SKRA 1FXXA 4KKOA 1LAWA 4I2PA 5CY4A 3VQPA 4CJRA 4LY7A 2B5JA 4GMJB 1S1XA 3HVRA 4OVLA 4AH9A 3KK3A 1FKPA 4O0JA 1LWCA 4CIEA 3LWMA 3O3FA 5HP1A 1UWBA 3SUOA 1EXQA 3TAFA 2YV0X 3VQ4A 3KJVA 5J2QA 2FBXA 3DLKA 4I9QA 1NK7A 3OYAA 4E7JA 1RTHA 4GW6A 3CFPA 4OGCA 1N6QA 4IG3A 1Z26A 4CJ5A 3HM9A 4CEDA 3OYIA 1IKWA 4ID5A 4BE0A 1REVA 1S1VA 1RT6A 4B8AB 3TWHA 3HL8A 3NBPA 3MXJA 1JLBA 1J53A 3ITHA 4CE9A 3AVKA 1QS4A 4FM2A 3QEXA 3OVNA 4IFYA 3LWLA 1TL3A 3V9WA 1U48A 3ZT1A 1T03A 2NUBA 3HO1A 3RMDA 3S3OA 1HMVA 4CJTA 3H08A 4UQGA 1QSYA 5C25A 4DSIA 2IDOA 4CF8A 1B92A 4K8XA 2GV9A 3I0SA 4CGFA 3OYLA 5JS2A 2QKBA 1J5OA 2W42A 4DSKA 3KIOA 3NF9A 2R7YA 4FCYA 3V9ZA 1NJXA 4DQQA 1D9FA 3NH1A 1U47A 1VSFA 4DWIA 3NE6A 3VQ5A 3NF7A 1JLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E7H A;  4KFB A;  1S9E A;  3AVF A;  4B9S A;  4AHS A;  4CJE A;  1BQM A;  3HYF A;  3AVI A;  2HHS A;  1QTM A;  3L8B A;  1RCH A;  3LP1 A;  4DTU A;  2HVH A;  1F21 A;  3KKS A;  5CZ1 A;  2RKI A;  3RMA A;  1NJW A;  1ITG A;  2WON A;  4H8K A;  4B9N A;  4MFB A;  4FJX A;  1WLJ A;  1UOC A;  4C8M A;  4YNQ A;  2XHB A;  4HCB A;  4M3W A;  2A1S A;  3L2V A;  4CJ3 A;  1KVB A;  3O3H A;  4RW4 A;  3BDP A;  4DTM A;  4N5S A;  4OLA A;  4I7F A;  4MQ3 A;  4PQU A;  3L3U A;  2EHG A;  4CEC A;  4DSF A;  1O1W A;  1KFS A;  1R0A A;  3SUN A;  3AVH A;  1BQN A;  4HUE A;  1NK8 A;  2XY5 A;  4AHR A;  1L3S A;  3AVC A;  3HT3 A;  5HRN A;  2XY6 A;  2F96 A;  1WAJ A;  1JL2 A;  1XHX A;  2ZD1 A;  1NOY A;  3ZSR A;  4CF0 A;  5FDL A;  2JLE A;  3VQ9 A;  4AHC A;  4CEF A;  4E1N A;  2XO7 A;  4F2R A;  2DY4 A;  3ULD A;  3D45 A;  1L5U A;  5HRP A;  1LWE A;  2GUI A;  4CGH A;  2KFZ A;  2Z1I A;  4KPY A;  3NCI A;  2HHQ A;  1TVR A;  2VG7 A;  5HRS A;  3NH0 A;  4E1M A;  3OYE A;  2PYJ A;  4QAG A;  2G8I A;  3QNN A;  3P5J A;  3F73 A;  3SNN A;  3DOL A;  4KTW A;  1C1A A;  4DG1 A;  3E01 A;  4FJN A;  4Z4C A;  3LAL A;  2P1J A;  4DU1 A;  4LSN A;  1JLE A;  4M3U A;  1HRH A;  5J2P A;  3QER A;  4CJS A;  3HVT A;  3SPZ A;  1XHZ A;  4DFP A;  4KTQ A;  4KRF A;  1T8E A;  1A5X A;  1Y97 A;  4RW9 A;  1IKX A;  4RW6 A;  4XIU A;  3SPY A;  4B8C A;  3TI0 A;  1GOB A;  1QHT A;  3NF6 A;  4OKJ A;  4E89 A;  1WSE A;  3AVN A;  3CM5 A;  4I9L A;  3QIN A;  4OPK A;  4FLW A;  1NKC A;  2OPQ A;  3DYA A;  4N56 A;  2G8U A;  4KB0 A;  3OYN A;  3SV4 A;  4FW1 A;  5SZT A;  3PO4 A;  1B9F A;  3D0P A;  5HLF A;  4DU4 A;  1C0U A;  3OYM A;  3SQ0 A;  5K14 A;  3T19 A;  3OJU A;  5I3U A;  2D0A A;  3U3G A;  4FJ7 A;  3O4N A;  3TAN A;  3C94 A;  4DLE A;  1IG9 A;  1LW2 A;  4DSE A;  3G0Z A;  4M45 A;  1U45 A;  1K6Y A;  3TR8 A;  3PX4 A;  2YKM A;  3HP9 A;  2HHW A;  3EZ5 A;  4AHV A;  1ASV A;  1HJR A;  1S1W A;  3C6T A;  3CQ8 A;  4F3O A;  4M3X A;  1JLQ A;  1ZBL A;  4DMN A;  4M42 A;  2OPP A;  4N76 A;  3RMB A;  2YHA A;  4BDY A;  3PY8 A;  2PZS A;  1S1U A;  3M8R A;  3NF8 A;  3K5L A;  1T05 A;  3PO5 A;  1BI4 B;  1HYZ A;  3B6O A;  2HHX A;  3I0R A;  4CIF A;  4CJL A;  1S5J A;  3V4I A;  4DF4 A;  2XRI A;  4KB1 A;  2DTU A;  1J9A A;  3AO4 A;  2O4G A;  3QEW A;  2IC3 A;  4F8R A;  2P51 A;  3SQ4 A;  1RIL A;  4M41 A;  3ZT4 A;  2YNH A;  4CGD A;  3T3F A;  4E7I A;  3QEI A;  4L8R B;  2E4L A;  1NOZ A;  1G15 A;  3V1Q A;  4FJG A;  4NCB A;  2YNF A;  1VSE A;  4CK3 A;  2HHT A;  5KI6 A;  4E19 A;  1RDA A;  4CF1 A;  3LP3 A;  1A5W A;  3DRS A;  1DLO A;  3NGI A;  3KTQ A;  4KI4 A;  5FRM A;  2I5J A;  2OPR A;  4BWM A;  3ASM A;  4IFV A;  2HHU A;  4W5R A;  5DMR A;  1TK0 A;  4H4M A;  4F3T A;  4PY5 A;  3WNH A;  3LPU A;  1NK5 A;  3U6F A;  1LV5 A;  2HW3 A;  1HQE A;  1SUQ A;  4W5Q A;  3B6P A;  3VQE A;  4AHU A;  3QO9 A;  2G8F A;  3TAM A;  4FK0 A;  3EY1 A;  2X74 A;  4OKE A;  1J54 A;  1UA1 A;  3K2P A;  3RWU A;  4IDK A;  4KRE A;  3KLE A;  4B9U A;  3AA3 A;  4H4O A;  3DMJ A;  1JLC A;  1C0M A;  3LZJ A;  4CCH A;  4FJK A;  3SZ2 A;  4BAC A;  4DQP A;  3VQC A;  3NDK A;  1S1T A;  3ISN C;  2HNY A;  3VQB A;  4CK2 A;  4CJQ A;  4CF2 A;  1FK9 A;  1SKW A;  2Z1J A;  2KQ2 A;  1HYV A;  4Y1D A;  3K58 A;  4CEQ A;  2VWJ A;  4CER A;  5J2N A;  3IAY A;  4CJW A;  3EYZ A;  4QOZ B;  3P83 D;  4DS5 A;  1QSL A;  1JXE A;  1TKT A;  3M8P A;  2GBZ A;  4FM1 A;  4DSL A;  1XWL A;  4NYN A;  4BE1 A;  3SCX A;  4DTP A;  1NJZ A;  3QEV A;  4W5O A;  3AVM A;  4R5P A;  1EET A;  2YNI A;  3ZSO A;  2HND A;  3ZSY A;  1QQC A;  5T7B A;  3KK2 A;  3LZI A;  5HRR A;  1XI1 A;  3O3G A;  4C8O A;  4PUO A;  1KLM A;  3M8Q A;  4RG8 A;  1C1C A;  1ZBU A;  4CHO A;  4M3R A;  4FLX A;  4CGI A;  2X78 A;  3VQ7 A;  1TGO A;  1KRP A;  4DU3 A;  1RDC A;  3MEC A;  4DTR A;  4Z4I A;  1W9H A;  3OS1 A;  1BIZ A;  4FK2 A;  1SV5 A;  3PUF A;  2Y1J A;  4ELV A;  2QK9 A;  4FYD A;  3ZSQ A;  1IO2 A;  4AHT A;  3DI6 A;  3K59 A;  5D3G A;  1KVC A;  3K5N A;  4KHQ A;  4BWJ A;  3S3M A;  4WE1 A;  4FLY A;  3QES A;  4FJ5 A;  1WSG A;  4DQS A;  2QKK A;  4M3Y A;  3V6D A;  3V9U A;  3AVG A;  4RW7 A;  4Z0U A;  3NGZ A;  2HMI A;  4W5N A;  1SL2 A;  2AJQ A;  4CFB A;  5HRO A;  1T7P A;  4FJ8 A;  2Z1G A;  3SYZ A;  1YTU A;  4DQR A;  2G8K A;  2BDP A;  4B9V A;  2ZE2 A;  3U3Y A;  2G8H A;  3ZT3 A;  3AA2 A;  1Q9X A;  3L3V A;  1TAQ A;  4CHQ A;  3K5M A;  4KHN A;  4FJJ A;  3L2W A;  1WSF A;  5KTQ A;  1HNV A;  4DFM A;  4OGE A;  3UIQ A;  3RR8 A;  4C8L A;  1DTQ A;  1NJY A;  2KZZ A;  1C1B A;  1C6V A;  3JYT A;  3OYB A;  1RBV A;  3KK1 A;  4CJF A;  4FJM A;  2FBT A;  1ASW A;  4Z4G A;  4PA1 A;  1GOA A;  5I42 A;  4LH4 A;  1RBT A;  3KLF A;  2FC0 A;  4FZZ A;  3O4Q A;  1YT3 A;  3OYH A;  1L3T A;  1KVA A;  2WOM A;  1D9D A;  1CZB A;  4FLT A;  3WNE A;  1LAV A;  3TAP A;  1HYS A;  5FRO A;  4DQI A;  1TKD A;  4FVM A;  5SWM A;  4ZTF A;  4NCA A;  2EX3 A;  3AVB A;  2OZM A;  3C95 A;  3MXI A;  2Z1H A;  3WNG A;  4CHZ A;  3VA0 A;  2F8S A;  3AV9 A;  1QSS A;  3JSM A;  3AO5 A;  4KO0 A;  3K57 A;  3C6U A;  3AO3 A;  4CJU A;  2ETJ A;  1S6Q A;  3ZSZ A;  3DLB A;  3ZCM A;  4B3O A;  3I8D A;  1JLA A;  2ZQB A;  1DTT A;  4CHP A;  4HCC A;  1CZ9 A;  3HP6 A;  1QE1 A;  3QNO A;  3BGR A;  3TAQ A;  1U4B A;  3KLG A;  1RT5 A;  4CJK A;  1RDB A;  4HHT A;  3LAN A;  4EZ6 A;  1XC9 A;  4J2D A;  4O4G A;  1U49 A;  3AA4 A;  3KD5 E;  4FJH A;  3MXM A;  4DLG A;  1VSD A;  2FBY A;  3MEG A;  2XY7 A;  4TSX A;  4NYF A;  3A2F A;  3TAE A;  3RRG A;  4EP4 A;  4HUF A;  4DTO A;  3SI6 A;  1RDD A;  3OYC A;  4EP5 A;  1S9G A;  1NK9 A;  2ATQ A;  1YVU A;  2IAJ A;  5CZ2 A;  3ZT0 A;  2D5R A;  1RBS A;  3OYG A;  4Z4E A;  3VN5 A;  4FLU A;  5FRN A;  1TKX A;  3DLH A;  3OY9 A;  1YTA A;  4PWD A;  1CXQ A;  2IS3 A;  3OS0 A;  2X6S A;  1ZYQ A;  1VSJ A;  2JGU A;  4CJP A;  1L3V A;  4K8Z A;  5KGW A;  1I39 A;  2A1R A;  5J1E A;  3VQ6 A;  4BE2 A;  3HJF A;  4IG0 A;  1D5A A;  4FZY A;  4QCL A;  1RNH A;  3VQA A;  2VG5 A;  3AVA A;  5JS1 A;  5CYQ A;  4CIG A;  4KHS A;  3QLH A;  4Q0B A;  3NAE A;  4O0I A;  3MAQ A;  2Y1I A;  4IBN A;  3V9X A;  4FJI A;  3TAG A;  1A5V A;  1EP4 A;  4CHY A;  3SUP A;  3V9S A;  3KLI A;  3MEE A;  3OYF A;  3QEP A;  3VQQ A;  2VWK A;  1X9S A;  2QXF A;  4B9L A;  2B6A A;  3NH2 A;  1KLN A;  1ZBF A;  3P1G A;  3QIP A;  5DK5 A;  3VQ8 A;  4FM0 A;  1N5Y A;  3V1O A;  4B9T A;  5J2M A;  4J2E A;  3OYJ A;  1WNS A;  2KW4 A;  1NKE A;  4W5T A;  4LSL A;  4JRQ A;  3CYM A;  3VA3 A;  3ALY A;  4BDZ A;  1SL0 A;  1LWF A;  4FW2 A;  1RTJ A;  4NCG A;  4KHU A;  3RR7 A;  1SKS A;  3T1A A;  3IS9 A;  3CM6 A;  4DFJ A;  3AVL A;  4B9M A;  4LH5 A;  4CFD A;  1VSH A;  4ZTJ A;  2HNZ A;  1B9D A;  1BL3 A;  4F2S A;  1BIS A;  4B08 A;  3LP2 A;  2F8T A;  3QIO A;  1NKB A;  4CEE A;  4AIL C;  4KI6 A;  4ELT A;  1WN7 A;  4OKK A;  3KD1 E;  3OS2 A;  1EX4 A;  3QET A;  1BGX T;  3LAM A;  3NFA A;  4Z4F A;  1VK0 A;  4ICL A;  3DOK A;  2P5G A;  4N41 A;  3HPO A;  4CGG A;  3ZSW A;  4CES A;  3S9H A;  1TK5 A;  1RTD A;  3SQ2 A;  4DSJ A;  5CYM A;  3SUQ A;  4CEO A;  4HUG A;  1IH7 A;  5KGX A;  3HPG A;  5KRS A;  1NK0 A;  2OYQ A;  1VRT A;  1UAX A;  1UA0 A;  4BDP A;  2DFE A;  3M8S A;  4FLZ A;  1RBR A;  4JS4 A;  1S6P A;  1X9W A;  1IKY A;  3V1R A;  4RW8 A;  4CJ4 A;  1TKZ A;  2E6L A;  1WSH A;  3NHG A;  1RT2 A;  3IRX A;  1RTI A;  4CJV A;  4KHY A;  3L2Q A;  3OYD A;  4CFA A;  2HB5 A;  4DS4 A;  2HHV A;  1JLF A;  2Q3S A;  4JS5 A;  2OA8 A;  1BCO A;  2OPS A;  3WNF A;  4LD0 A;  1VSI A;  3DLG A;  1KFD A;  4O5B A;  4C8N A;  2DFF A;  3HK2 A;  1IKV A;  4ZHR A;  3DLR A;  4CK1 A;  1I3A A;  2VG6 A;  2G8W A;  3LAK A;  4DTS A;  3AVJ A;  1L3U A;  4FJL A;  4CF9 A;  2X6N A;  3MED A;  3G10 A;  1EKE A;  1TK8 A;  4OLB A;  1X9M A;  4J2A A;  4JLH A;  5C42 A;  1JXB A;  1TV6 A;  2RPI A;  2KTQ A;  4KV8 A;  1RT3 A;  4FJ9 A;  1VRU A;  1BI4 A;  4ELU A;  4OPJ A;  2LSN A;  1GOC A;  4Y1C A;  2XY8 A;  2RN2 A;  3KKR A;  3SQ1 A;  4KTZ A;  3S3N A;  1BHL A;  4YFU A;  1NK6 A;  2PY5 A;  4CEB A;  4M3T A;  4FXD A;  3DM2 A;  1HQU A;  4OJR A;  1Q8I A;  1Z25 A;  2D0B A;  2D0C A;  2ITG A;  3F9K A;  1MU2 A;  4HTU A;  1Q9Y A;  1KTQ A;  4HVJ A;  3L2U A;  3NGY A;  1RT1 A;  3ZSX A;  2FBV A;  2G8V A;  4FK4 A;  1ZBH A;  4FZX C;  3KLH A;  3OJS A;  4GVM A;  4DTX A;  4G1Q A;  3RTV A;  4E7L A;  4DFK A;  4KAZ A;  5E41 A;  1WSJ A;  4E3S A;  1SL1 A;  2P5O A;  4DTJ A;  3LP0 A;  2RF2 A;  1JKH A;  1BIU A;  1LW0 A;  3THV A;  3ZT2 A;  4M3Z A;  1JL1 A;  2YHB A;  4ID1 A;  4C8K A;  4E0D A;  3SV3 A;  1CLQ A;  1VSM A;  3FFI A;  5HBM A;  5KRT A;  3HST B;  1CXU A;  4CEA A;  3PX0 A;  1KCF A;  4I2Q A;  3TAB A;  3SJJ A;  3IG1 A;  2E6M A;  3ZSV A;  4CHN A;  1WSI A;  3DRP A;  3AA5 X;  4CEZ A;  3OYK A;  3HXM A;  2PYL A;  4JRP A;  4IKF A;  3V81 A;  3DLE A;  3AO2 A;  2IGI A;  3PX6 A;  4Q5V A;  4F4K A;  3CFO A;  3L2R A;  3LDS A;  3CFR A;  1NK4 A;  1RBU A;  4DTN A;  1BCM A;  4KHW A;  1U04 A;  5C24 A;  1C0T A;  3RRH A;  2KZM A;  4N47 A;  4DF8 A;  2IOC A;  3VQD A;  4FLV A;  1KSP A;  1ZBI A;  3PV8 A;  4EZ9 A;  3RMC A;  2DFH A;  4J2B A;  1RT7 A;  2HVI A;  1WAF A;  4CFC A;  1TL1 A;  3HPH A;  3TAR A;  5EU7 A;  1HNI A;  2OZS A;  4Z4H A;  1TAU A;  4E7K A;  3AO1 A;  1FKO A;  1VSK A;  2YNG A;  3CG7 A;  2YKN A;  3LPT A;  1W0H A;  2KFN A;  1ASU A;  2BAN A;  1HPZ A;  1RT4 A;  2BE2 A;  4CGJ A;  1D8Y A;  4O44 A;  2BGG A;  3K5O A;  2O4I A;  1VSL A;  3DRR A;  1X1P A;  4O55 A;  2B4J A;  1SKR A;  1FXX A;  4KKO A;  1LAW A;  4I2P A;  5CY4 A;  3VQP A;  4CJR A;  4LY7 A;  2B5J A;  4GMJ B;  1S1X A;  3HVR A;  4OVL A;  4AH9 A;  3KK3 A;  1FKP A;  4O0J A;  1LWC A;  4CIE A;  3LWM A;  3O3F A;  5HP1 A;  1UWB A;  3SUO A;  1EXQ A;  3TAF A;  2YV0 X;  3VQ4 A;  3KJV A;  5J2Q A;  2FBX A;  3DLK A;  4I9Q A;  1NK7 A;  3OYA A;  4E7J A;  1RTH A;  4GW6 A;  3CFP A;  4OGC A;  1N6Q A;  4IG3 A;  1Z26 A;  4CJ5 A;  3HM9 A;  4CED A;  3OYI A;  1IKW A;  4ID5 A;  4BE0 A;  1REV A;  1S1V A;  1RT6 A;  4B8A B;  3TWH A;  3HL8 A;  3NBP A;  3MXJ A;  1JLB A;  1J53 A;  3ITH A;  4CE9 A;  3AVK A;  1QS4 A;  4FM2 A;  3QEX A;  3OVN A;  4IFY A;  3LWL A;  1TL3 A;  3V9W A;  1U48 A;  3ZT1 A;  1T03 A;  2NUB A;  3HO1 A;  3RMD A;  3S3O A;  1HMV A;  4CJT A;  3H08 A;  4UQG A;  1QSY A;  5C25 A;  4DSI A;  2IDO A;  4CF8 A;  1B92 A;  4K8X A;  2GV9 A;  3I0S A;  4CGF A;  3OYL A;  5JS2 A;  2QKB A;  1J5O A;  2W42 A;  4DSK A;  3KIO A;  3NF9 A;  2R7Y A;  4FCY A;  3V9Z A;  1NJX A;  4DQQ A;  1D9F A;  3NH1 A;  1U47 A;  1VSF A;  4DWI A;  3NE6 A;  3VQ5 A;  3NF7 A;  1JLG A; 
#chains in the Genus database with same CATH topology
 3KK7 A;  4B9S A;  4AHS A;  2HHS A;  1BQM A;  3L8B A;  3LP1 A;  1F21 A;  5CZ1 A;  3RMA A;  1ITG A;  4H8K A;  1GLF O;  1WLJ A;  1UOC A;  4A2B A;  1YVN A;  4YNQ A;  3HBT A;  3IMX A;  3CCL N;  2UXD K;  3VMF B;  3GOI A;  3MDQ A;  4DR7 K;  4MQ3 A;  5BN9 A;  2IIR A;  3VEN A;  1NK8 A;  2XY5 A;  1L3S A;  3HT3 A;  2YJF A;  3KVG A;  4BG8 A;  2FF3 B;  2ZD1 A;  1XHX A;  3KZB A;  3ENB A;  3VQ9 A;  4CEF A;  4CF0 A;  3IUC A;  2DY4 A;  3Q7B A;  3D45 A;  4CGH A;  2GUI A;  3LDQ A;  2Z1I A;  3NH0 A;  2PYJ A;  2O8B B;  4E1M A;  4BRQ A;  2G8I A;  3QNN A;  2RE2 A;  3EZW A;  3DOL A;  2O8E B;  3E01 A;  4FJN A;  4LSN A;  3QER A;  1WUA A;  3CCU N;  3QFU A;  4DFP A;  1OH8 A;  5AQX A;  3PLA A;  4RW9 A;  4XIU A;  4B8C A;  3QB0 A;  1Z05 A;  3NF6 A;  4ILH A;  4OKJ A;  4PKI A;  5MLC Q;  3VGM A;  3AVN A;  4OPK A;  4I9L A;  4FLW A;  4BGA A;  4DR6 K;  4N56 A;  2O8D B;  3SV4 A;  2NRH A;  3VET A;  1B9F A;  5HLF A;  3OYM A;  2IVO A;  2KLA A;  3L0Q A;  5K14 A;  4IOA L;  4BC4 A;  4JKB A;  3C94 A;  3MWT A;  4BR2 A;  1IG9 A;  1LW2 A;  1YJN N;  3G0Z A;  1U45 A;  3PX4 A;  2HHW A;  4AHV A;  1HJR A;  4GKJ K;  5BN8 A;  1JLQ A;  5LMN K;  4DMN A;  2OPP A;  4FWO A;  3RMB A;  2YHA A;  3PO5 A;  1HYZ A;  3B6O A;  3T1H K;  3W3D A;  5E26 A;  5DM7 L;  1HNX K;  3MN7 A;  1XNQ K;  4F8R A;  2IC3 A;  3K9J A;  4YOX A;  4B3T K;  1NGH A;  3ZT4 A;  3QEI A;  4O8K A;  2YNF A;  4CK3 A;  5AQZ A;  4CZH A;  5AQK A;  2QWP A;  1A5W A;  5FRM A;  2OPR A;  4IFV A;  4H4M A;  3WNH A;  3LPU A;  4JYA K;  2HW3 A;  1HQE A;  1SUQ A;  2QA4 N;  2QWR A;  3BZC A;  1Q7Y O;  2X74 A;  4LF6 K;  2PFU A;  4OKE A;  1G99 A;  1UA1 A;  3RWU A;  4JKA A;  4H4O A;  1JLC A;  3SZ2 A;  3DWL A;  3SBT A;  4DQP A;  4JN4 A;  1S1T A;  2YCH A;  2HNY A;  3D2F A;  2KQ2 A;  1HYV A;  2VWJ A;  4CER A;  3EYZ A;  1OKJ A;  1JXE A;  1TKT A;  5LJW A;  3SCX A;  3PIO L;  3A5M C;  3VF2 A;  1EET A;  2YNI A;  5T7B A;  1OVQ A;  3ZSY A;  4C8O A;  4F3T A;  1E4G T;  4CGI A;  3VQ7 A;  4DU3 A;  1KAY A;  4FPA A;  4FK2 A;  1BUP A;  4WFB L;  5D3G A;  3QES A;  1WSG A;  4DQS A;  4IZ9 A;  4RW7 A;  4Z0U A;  4BRL A;  3HOS A;  1SL2 A;  2AJQ A;  3HZ6 A;  1VHX A;  4BRF A;  2G8K A;  4B9V A;  3JXU A;  3QML A;  3R1X A;  5M1Q A;  4I6M A;  3Q7C A;  4JAX A;  4CHQ A;  4BRP A;  4DFM A;  1S72 N;  1P8Z A;  1DTQ A;  2PAV A;  1NJY A;  1C1B A;  1ILY A;  3OYB A;  3SAF A;  3TSQ A;  5KQ8 A;  3CPW M;  1ASW A;  3ZLJ A;  3FZL A;  4B1U B;  5M1P A;  5AZJ A;  4YHH K;  3O4Q A;  4DUY K;  3MN6 A;  2P9P A;  4DV5 K;  3VTI A;  4ZTF A;  5AQS A;  3C95 A;  2Z1H A;  3WNG A;  1WB9 A;  4JV5 K;  3J80 O;  2IVP A;  4CJU A;  5GIP A;  4GV3 A;  2NRW A;  3K0S A;  1JLA A;  1CZ9 A;  4CJK A;  1RDB A;  3L6Q A;  3AA4 A;  3VF6 A;  5ADX A;  2XY7 A;  2QWN A;  1DGK N;  1VQ5 N;  2P9U B;  3TAE A;  1EWQ A;  4EP4 A;  1ESV A;  3BZK A;  5FPD A;  3ZT0 A;  4B1Y B;  4H0V B;  4Z4E A;  4H5W A;  4FLU A;  4MDA A;  1CXQ A;  2UUB K;  4K8Z A;  4CJP A;  1NU0 A;  3OA9 A;  4IJA A;  2A1R A;  4BE2 A;  3NMU A;  4KH6 A;  3VQA A;  4F9O A;  5JS1 A;  4CVN E;  5CYQ A;  4CIG A;  4Q0B A;  3MAQ A;  3CME N;  4FJI A;  3VEX A;  1EP4 A;  3H46 O;  4CHY A;  1WBB A;  3QEP A;  2QXF A;  2B6A A;  3VEV A;  3P1G A;  3VQ8 A;  1N5Y A;  5JVH L;  3WQT A;  1V4T A;  3TTD A;  4JRQ A;  3CYM A;  4ISF A;  1LWF A;  1SKS A;  5AQY A;  4DFJ A;  4H5V A;  4LH5 A;  4CFD A;  4WQ5 A;  1XNR K;  1VSH A;  2O8B A;  4ZTJ A;  4F2S A;  3BY5 A;  4B08 A;  1NKB A;  4ELT A;  3SJH A;  2F9T A;  4OKK A;  3QET A;  5AZI A;  3FLC O;  2A41 A;  4JKH A;  1RTD A;  2BTF A;  3S9H A;  4DSJ A;  4XH4 A;  4HUG A;  1IH7 A;  5KGX A;  2DFE A;  2D0P A;  1XQS C;  1IKY A;  4RW8 A;  4ISE A;  4JI3 K;  1MWK A;  1WSH A;  1RTI A;  4NO7 A;  3L2Q A;  4RWT A;  3DLG A;  4O5B A;  3O80 A;  1IBL K;  3LAK A;  4DTS A;  3UB5 A;  4DHY A;  2Q1N A;  1TK8 A;  2KTQ A;  1RT3 A;  4JKG B;  4OPJ A;  3S3N A;  3KKR A;  4OX9 K;  1VQO N;  4M3T A;  4FXD A;  4CEB A;  4OPA A;  1HQU A;  2IVN A;  3L4I A;  3F9K A;  3TTC A;  4YOY A;  4HTU A;  1KTQ A;  3L2U A;  3ZSX A;  2FBV A;  3OJS A;  4GVM A;  5JVG L;  4KAZ A;  1EO1 A;  1KQS M;  3JAM O;  3K9K A;  3LP0 A;  2RF2 A;  4PHT X;  4V19 S;  3ZT2 A;  4M3Z A;  1JL1 A;  2YHB A;  4H0X B;  4R79 A;  3SV3 A;  1CXU A;  1KCF A;  2A6A A;  3T1Y K;  4CHN A;  2E6M A;  4CBX A;  4CZG A;  3HXM A;  4DR4 K;  4U67 L;  3TPQ A;  3N4P A;  1RBU A;  4KHW A;  1C0T A;  3RRH A;  2KZM A;  4N47 A;  3TTF A;  3VQD A;  1NMD A;  2DFH A;  4J2B A;  3DAW A;  1HNI A;  4Z4H A;  2NRT A;  2BE2 A;  1RT4 A;  2BGG A;  1VSL A;  1FXX A;  4FL9 A;  4JKE A;  3KK3 A;  3LM9 A;  3LWM A;  3I55 N;  3O3F A;  2F9W A;  3SUO A;  2H3G X;  1NGF A;  1EXQ A;  2YV0 X;  3VQ4 A;  4H5N A;  4DR5 K;  2P9S B;  4I9Q A;  3LDP A;  4U7B A;  3CFP A;  4CZL A;  3OYI A;  1IKW A;  4ID5 A;  4YOU A;  2F8T A;  3TWH A;  4GNI A;  1KFS A;  1QS4 A;  3OVN A;  3V9W A;  3THW B;  4Y0W A;  3RMD A;  5AR0 A;  4CJT A;  3H08 A;  4MO5 A;  4UQG A;  5C25 A;  4RCH A;  3DXK B;  5KPZ A;  4K8X A;  1YI2 N;  3NF9 A;  2R7Y A;  1QQO A;  4DQQ A;  5AFU A;  5F1X A;  5FPN A;  3NH1 A;  4BC2 A;  4DWI A;  3VQ5 A;  1JLG A;  1VAZ A;  2Q2R A;  3AVF A;  3AVI A;  4JD2 B;  3FR0 A;  2RKI A;  1GLJ O;  3CCJ N;  4ISG A;  1U6Z A;  2WON A;  5TKW A;  4B9N A;  4MFB A;  2Q0R A;  4C8M A;  4HCB A;  4M3W A;  2A1S A;  3KWI A;  1NGJ A;  3SBG A;  4MLE A;  3O3H A;  4RW4 A;  1GLE G;  4DTM A;  4N5S A;  4WQ5 C;  4M7Y A;  5BPN A;  4DSF A;  1O1W A;  2ZWH A;  4HUE A;  5M1O A;  4AHR A;  3AVC A;  2XY6 A;  5HRN A;  3S41 A;  1WAJ A;  4O8U A;  3ZSR A;  1QHA A;  3E9L A;  5FDL A;  2XO7 A;  4E1N A;  1NM1 A;  4A5B A;  2P9U A;  4WYB A;  1ZBS A;  4KPY A;  1RDU A;  2VG7 A;  1XMO K;  2NRR A;  4QAG A;  3MK6 A;  3P5J A;  3U9D A;  3SNN A;  3QIC A;  1C1A A;  1M1K O;  3LAL A;  3MMV A;  4M3U A;  1XHZ A;  4KTQ A;  3UKU A;  5LL6 Z;  4QS9 A;  3FE1 A;  3TI0 A;  1GOB A;  3VOV A;  1WSE A;  3CM5 A;  3QIN A;  2CH6 A;  2OPQ A;  2G8U A;  3OYN A;  4IO8 A;  2GUP A;  5LMU K;  4DU4 A;  3HM8 A;  5I3U A;  2GEM A;  1VQ6 N;  3CJC A;  4CBU A;  1K6Y A;  4JI6 K;  3EZ5 A;  1YIT N;  1ASV A;  5BRF A;  4F3O A;  4M3X A;  1ZBL A;  4M42 A;  3FGU A;  1S1U A;  3MX2 A;  3M8R A;  3G6E N;  4CIF A;  3SMP A;  2VWB A;  2DTU A;  4CD3 A;  5C15 A;  5C2D A;  3AO4 A;  3O5B A;  4H0T B;  4A62 A;  2VQE K;  4KH4 A;  3T3F A;  1NOZ A;  1G15 A;  1BA1 A;  3SK3 A;  4GV6 A;  3FZF A;  2HHT A;  4E19 A;  3DRS A;  1DLO A;  3KTQ A;  4KI4 A;  1YIJ N;  1JCF A;  4W5R A;  3R3L A;  2VCP A;  1LV5 A;  1NK5 A;  3U6F A;  1Q81 O;  4QS7 A;  4W5Q A;  1E4F T;  3B6P A;  3KHY A;  4FK0 A;  3EEQ A;  3TAM A;  1IV0 A;  3EY1 A;  4FWL A;  1K8K B;  2D4W A;  1J54 A;  5C12 A;  4IDK A;  1QVF M;  4JKG A;  4B9U A;  3VEO A;  1C0M A;  5AQT A;  3LZJ A;  4FJK A;  4BAC A;  3ISN C;  4EHT A;  4Z94 A;  2Z1J A;  3K58 A;  3IAY A;  4CJW A;  2W6K A;  4YOV A;  3M8P A;  2ZJR L;  3O9T A;  4WCE L;  4DTP A;  2F4V K;  4R5P A;  3ZET B;  3ZSO A;  1RDW X;  1XI1 A;  5CHI A;  4PUO A;  1KLM A;  3A5L C;  1C1C A;  2YJE A;  5AQW A;  4FLX A;  3CQX A;  1RDC A;  2GTD A;  3ULE B;  1BIZ A;  1NGD A;  1SV5 A;  3PUF A;  2Y1J A;  3ZSQ A;  4GV9 A;  2FSN A;  4AHT A;  3AGK A;  3K5N A;  4BWJ A;  4FJ5 A;  2QKK A;  4M3Y A;  2E88 A;  3V9U A;  3AVG A;  3NGZ A;  4H5T A;  4CW7 B;  2YX6 A;  2D0O A;  4FJ8 A;  1X9J A;  1YTU A;  3AAP A;  3BEX A;  4B1V A;  2G8H A;  3ZT3 A;  3AA2 A;  1Q9X A;  3L3V A;  1TAQ A;  3K5M A;  3F2K A;  1WSF A;  5KTQ A;  3SAH A;  5EX5 A;  2EWS A;  5LJV A;  1T6D A;  1Y64 A;  4H5R A;  5AZI B;  4WQ4 A;  5AQQ A;  4Z4G A;  3ATU A;  4FWQ A;  3KLF A;  2RHK A;  1OH7 A;  1XC3 A;  1Q86 O;  4FZZ A;  3B8A X;  4X65 K;  1L3T A;  2WTU A;  2YHW A;  3P31 A;  4FLT A;  3TAP A;  3ENH A;  2P9S A;  4DQI A;  4NCA A;  5CE3 A;  2EX3 A;  1EQY A;  4WF9 L;  3EE8 A;  3MXI A;  2NNW A;  1SS6 A;  3MCA B;  2F8S A;  4CHZ A;  3VA0 A;  1QSS A;  3K57 A;  3C6U A;  4BRC A;  1Q82 O;  4E1J A;  1S6Q A;  3ZSZ A;  3ZCM A;  3THW A;  2Q36 A;  1DTT A;  4IXC A;  4CHP A;  3CMA N;  2O8F B;  3O9S A;  2YI1 A;  3DXK A;  3LAN A;  1OH6 A;  1TUU A;  4J2D A;  4O4G A;  4IFE A;  4DLG A;  2FBY A;  4JI5 K;  4NYF A;  5AQO A;  4HUF A;  1LOT B;  3SI6 A;  1RDD A;  5EOY A;  1S9G A;  1MDU B;  5ADX H;  2IAJ A;  2HST A;  4FOI A;  4JD2 A;  3J8A A;  3OYG A;  3VN5 A;  1YTA A;  1ZYQ A;  3OS0 A;  2X6S A;  1L3V A;  1VSJ A;  2KKZ A;  3VQ6 A;  3CJA A;  4IG0 A;  3VEZ A;  2QTD A;  4CBW A;  3CCS N;  4IWV A;  3CCV N;  2Y1I A;  1BDG A;  3ID6 A;  1YJW N;  1A5V A;  2HOE A;  4JK7 A;  3VQQ A;  2VWK A;  3GDQ A;  1RFQ A;  5AQJ A;  3OBY A;  5DK5 A;  1GLC G;  4B9T A;  5J2M A;  1KC8 O;  4W5T A;  3VPZ A;  4FO0 A;  3P4I A;  4FW2 A;  1RTJ A;  4NCG A;  3CCM N;  4KHU A;  2HBK A;  4K25 A;  2ZJP L;  4JKD A;  3T1A A;  3IS9 A;  4MDB A;  2WFB A;  3VES A;  4JK8 A;  3J7Z O;  1QVG M;  5GAD P;  3FZM A;  4JKC A;  3LP2 A;  2V7Y A;  3BUZ B;  3KD1 E;  1M90 O;  1BGX T;  3NFA A;  1VK0 A;  2CGL A;  2P5G A;  4N41 A;  3HPO A;  3ZSW A;  2D1K A;  3SQ2 A;  4FWP A;  5KPT A;  5CYM A;  5BR8 K;  4CEO A;  3SUQ A;  4LF4 K;  2V51 B;  5KRS A;  2OYQ A;  4JHD B;  5HL7 L;  1UA0 A;  2Q97 A;  1S6P A;  3R8E A;  5EXW A;  3WEE B;  5F0X A;  1TKZ A;  4OPH A;  4CJV A;  4IO9 L;  3CD6 N;  1IG8 A;  3OYD A;  3O1B A;  4DS4 A;  1JLF A;  1HLU A;  1T6C A;  3O6W A;  1VSI A;  4BVO A;  1KFD A;  2DFF A;  1I3A A;  4IOX A;  1VQM N;  2G8W A;  5CR4 A;  2X6N A;  4OLB A;  2E2N A;  4JLH A;  4B3R K;  2RPI A;  4KV8 A;  4MLH A;  4DV7 K;  4EHU A;  2RN2 A;  3N4Q A;  2ITG A;  3VGL A;  4BC5 A;  3O9Q A;  3NGY A;  2G8V A;  4FK4 A;  1ZBH A;  4DTX A;  4G1Q A;  4E7L A;  3QDK A;  5E41 A;  5C0Y A;  1SL1 A;  4NB4 A;  4K0K K;  4C1N K;  4ID1 A;  4C8K A;  1CLQ A;  1VSM A;  5HBM A;  2JWL A;  1HUX A;  1K9M O;  1HKB A;  3ZX0 A;  4I2Q A;  4LFC K;  3SJJ A;  4BRD A;  3ZSV A;  5KPR A;  3D6R A;  2ZGZ A;  4CEZ A;  2PYL A;  3OYK A;  4LF8 K;  4IKF A;  3V81 A;  5DM6 L;  1J6Z A;  4FWR A;  4Q5V A;  1K8K A;  4F4K A;  3CFR A;  4X62 K;  1U04 A;  5C24 A;  1C0F A;  2VGN A;  3F5T A;  1KSP A;  2HVI A;  4CFC A;  4GVE A;  1IBK K;  2OZS A;  4PKH A;  2ZF5 O;  1XMQ K;  3AO1 A;  3CG7 A;  2YKN A;  1N8R O;  2KFN A;  4FOE A;  1HPZ A;  2VYP A;  2O4I A;  4O44 A;  3K5O A;  3DRR A;  4LC9 B;  3UKU B;  2B4J A;  4X66 K;  3ZET A;  4I2P A;  5CY4 A;  4FVU A;  2B5J A;  1S1X A;  4AH9 A;  5GAH P;  5ELZ A;  3O1W A;  3ULE A;  3P39 A;  5GIO A;  4GY2 B;  5J2Q A;  1WOQ A;  1RTH A;  2DPN A;  3QFP A;  4GW6 A;  4YOR A;  4ILJ A;  4CJ5 A;  2E1Y A;  2P9L A;  1S1V A;  4B8A B;  3NBP A;  3MXJ A;  1JLB A;  1J53 A;  4CE9 A;  3QEX A;  4IFY A;  1U48 A;  3S3O A;  3TSU A;  3R6M A;  1QSY A;  3E9O A;  2P9K B;  3PSF A;  4CF8 A;  1B92 A;  2GV9 A;  3CC2 N;  3H3N O;  2QKB A;  4DSK A;  2W42 A;  1NJX A;  3PIP L;  3U9Z A;  1D4X A;  2OAN A;  3NF7 A;  2E5L K;  4KFB A;  3J81 O;  1QTM A;  5AFU H;  1RCH A;  1VQ8 N;  2HVH A;  4FSV A;  3KKS A;  2YHX A;  1W2B M;  1I94 K;  4XH1 A;  3OTO K;  4C23 A;  4BRG A;  1KVB A;  3BDP A;  3BF3 A;  4OLA A;  4CEC A;  1NG9 A;  1R0A A;  2HHH K;  2O8F A;  3AVH A;  1BQN A;  1JCE A;  2F96 A;  1NOY A;  3CCQ N;  3J7Y P;  4BGB A;  4F2R A;  2JLE A;  5B8H A;  2HBL A;  3ULD A;  1L5U A;  3FZH A;  3T7Z A;  5HRP A;  1E3M A;  1LWE A;  2KFZ A;  3NCI A;  4BC3 A;  2HHQ A;  1TVR A;  3OYE A;  4DR2 K;  4BR7 A;  4Z4C A;  3M1F A;  1HRH A;  3FZK A;  3WXJ A;  5J2P A;  3HVT A;  3SPZ A;  1Z6R A;  1IJJ A;  1KAX A;  3SPY A;  2QXL A;  1QHT A;  3ZX2 A;  3W0L A;  1NKC A;  1MWM A;  2QM1 A;  3DYA A;  2GEL A;  4FWK A;  3MN5 A;  4K43 A;  5SZT A;  3D0P A;  5JLF A;  3U3G A;  2W40 A;  3O4N A;  3TAN A;  4G9Z A;  3GL1 A;  4CZM A;  4YOW A;  1GLD G;  1K8A O;  4DSE A;  3UKR B;  4M45 A;  2YKM A;  3QBX A;  4BRK A;  4EIA A;  1S1W A;  3C6T A;  2E2P A;  4YDU A;  1YHQ N;  3WXL A;  4N76 A;  5BR9 A;  4BDY A;  3PY8 A;  2WC9 A;  2QI2 A;  3I0R A;  4B1X B;  4CJL A;  1S5J A;  3V4I A;  4DF4 A;  2PBD A;  4KB1 A;  1TYQ A;  1J9A A;  2O4G A;  4JHD A;  1RIL A;  1IBM K;  2YNH A;  4CGD A;  3D7E O;  4NCB A;  2E4L A;  3WEE A;  1VSE A;  1YF5 L;  5KI6 A;  4JKF A;  4CF1 A;  3LP3 A;  3NGI A;  3H45 C;  2HHU A;  3M3Z A;  3CXC M;  4PY5 A;  4KBO A;  4OO1 J;  3VQE A;  1NGC A;  4AHU A;  3QO9 A;  2E20 A;  2G8F A;  4DV2 K;  4K41 A;  2BUP A;  3T69 A;  3DXM B;  3J7A P;  1VQK N;  2FLO A;  4KRE A;  2ITM A;  1VQL N;  3DMJ A;  3U8X A;  4CCH A;  3GG4 A;  3VQC A;  3NDK A;  3VQB A;  4CJQ A;  1SKW A;  4Y1D A;  4CZJ A;  1N34 K;  4CEQ A;  4JI8 K;  4QOZ B;  3P83 D;  4DV0 K;  4DSL A;  4NYN A;  3OW2 M;  1NJZ A;  4W5O A;  3AVM A;  3KK2 A;  3LZI A;  3O3G A;  3CI5 A;  2WUS A;  4RG8 A;  2O8C B;  3CQY A;  3VGK A;  3DJC A;  2X78 A;  1V4S A;  1NJI O;  4DTR A;  1W9H A;  3L4Q A;  3I8B A;  1J5E K;  4B9Q A;  5JIC A;  3K59 A;  4A5A A;  4A61 A;  4WE1 A;  1EWR A;  3V6D A;  4BY9 C;  4IDH A;  4W5N A;  2QWQ A;  3SYZ A;  2ZE2 A;  3U3Y A;  4H0O A;  4AQY K;  2FF6 A;  5M1K A;  4KHN A;  4FJJ A;  3L2W A;  2UUA K;  4OGE A;  3RR8 A;  5BRE A;  4C8L A;  3JYT A;  4LF9 K;  1RBV A;  2A3Z A;  4FJM A;  2FBT A;  5FPE A;  2AP1 A;  5FLX O;  3TU5 A;  5I42 A;  4LH4 A;  4B3S K;  3IFR A;  1SZ2 A;  3TSP A;  3MCP A;  2FC0 A;  3OYH A;  1KVA A;  2WOM A;  1D9D A;  1CZB A;  4MO4 A;  1JJ2 M;  1LAV A;  4A2A A;  5AJ3 K;  3AY9 A;  4FVM A;  2OZM A;  5BPM A;  4J8F A;  3JSM A;  4KO0 A;  1BOT O;  2ETJ A;  1SAZ A;  2JWK A;  1NNE A;  1BA0 A;  4B3O A;  2A40 A;  2OTJ N;  5AQM A;  1NWK A;  3BGR A;  2P9K A;  1U4B A;  1BWF O;  1RT5 A;  1XC9 A;  1U49 A;  1HX1 A;  4FWM A;  3EKS A;  4JK9 A;  4AM7 A;  3A2F A;  2W6L A;  2A5X A;  3WQU A;  3RRG A;  4DTO A;  3OYC A;  2Q31 A;  4EP5 A;  3GBT A;  2ATQ A;  1YVU A;  3VEW A;  5CZ2 A;  2D5R A;  1LCU A;  1RBS A;  4M63 C;  1TKX A;  3KWG A;  2JGU A;  4B1Z A;  5KGW A;  1I39 A;  3HJF A;  4B1W B;  4QCL A;  1D5A A;  4FZY A;  1RNH A;  2VG5 A;  4JEP A;  3AVA A;  3SAG A;  3QLH A;  4KHS A;  3D2E B;  4KHP K;  4O0I A;  1C0G A;  4IBN A;  3V9X A;  1WBD A;  2FXU A;  3MEE A;  3NH2 A;  1ZBF A;  3QIP A;  4BR4 A;  2CGK A;  2V52 B;  4J2E A;  3ENO A;  3V1O A;  4AF1 A;  3OYJ A;  1NLV A;  1WNS A;  2A42 A;  2BH1 A;  3VA3 A;  3ALY A;  5AQV A;  4BDZ A;  3CC4 N;  3NVK A;  3THY B;  1NBW A;  3CM6 A;  3AVL A;  3HRG A;  5KQD A;  4FPB A;  1SQK A;  1B9D A;  1BL3 A;  2UUC K;  1BIS A;  1FW6 A;  3QIO A;  4UY8 O;  2HMP A;  4AIL C;  1X3N A;  2E1Z A;  1WN7 A;  3OS2 A;  2QWM A;  4Z4F A;  1ATS A;  4ICL A;  3DOK A;  1BG3 A;  4WFA L;  4CGG A;  4DV1 K;  1TK5 A;  3HPG A;  1T44 A;  1VRT A;  4IJN A;  4BDP A;  5BRH A;  2GWK A;  4FLZ A;  1RBR A;  3NVM A;  2VQF K;  1HPM A;  2E6L A;  3NHG A;  4YOT A;  5GAE P;  4KHY A;  2P9L B;  3QBW A;  2ASP A;  4JS5 A;  1BCO A;  4IEI A;  3ZX3 A;  2HHV A;  5AQR A;  5IWA K;  1IKV A;  3UKR A;  3DLR A;  4ZHR A;  2WBN A;  4CK1 A;  1TUY A;  4ILG B;  4L3Q A;  1L3U A;  4FJL A;  2UU9 K;  3MED A;  3G10 A;  1EKE A;  1X9M A;  3CJ9 A;  1JXB A;  1TV6 A;  2KHO A;  4FJ9 A;  3F9M A;  1VRU A;  5A2Q O;  3OBW A;  4Y1C A;  3SQ1 A;  2YHY A;  1ZXO A;  3G25 A;  1NK6 A;  4BRH A;  4JI0 K;  3DM2 A;  3CCR N;  1RGI A;  1Q8I A;  2D0C A;  1MU2 A;  3EO3 A;  3ZEU B;  1RT1 A;  4FZX C;  3KLH A;  1W7A A;  2HF3 A;  4DTJ A;  1JKH A;  3THV A;  3M5R A;  1X3M A;  3FFI A;  4BRO A;  3AAR A;  1QZ6 A;  2ZJQ L;  1GLB G;  3AA5 X;  4JRP A;  3AO2 A;  2IGI A;  3DXM A;  4H0P A;  4DUZ K;  3CFO A;  1NK4 A;  3VF4 A;  4DTN A;  1BCM A;  5I9E B;  1ZBI A;  3DLL L;  3PV8 A;  3RMC A;  2E2Q A;  1QQN A;  1WAF A;  3EN9 A;  1TL1 A;  1YXQ A;  3HPH A;  3TAR A;  4JI7 K;  1TAU A;  3CET A;  2P9N B;  1JCG A;  1VSK A;  2YNG A;  1W0H A;  2BAN A;  4CZK A;  4CGJ A;  4O55 A;  1LAW A;  3HI0 A;  4LY7 A;  1VQ7 N;  3HVR A;  4OVL A;  2O8C A;  1FKP A;  4O0J A;  4CIE A;  5HP1 A;  1UWB A;  4JI4 K;  3C0B A;  4BRI A;  3TAF A;  4PKG A;  3KJV A;  3DLK A;  1O13 A;  4E7J A;  1NK7 A;  1N6Q A;  4OGC A;  4IG3 A;  3HM9 A;  4CED A;  4AM6 A;  1KAZ A;  1REV A;  4DS5 A;  1RT6 A;  4RTF D;  3HL8 A;  4EZ9 A;  4JI2 K;  4JNE A;  3RVC A;  1TL3 A;  3ZT1 A;  1T03 A;  2NRZ A;  1HMV A;  3CIP A;  1NGB A;  3A0I X;  5BRD A;  1KD1 O;  1ZC6 A;  4WFN L;  3I56 N;  4DR1 K;  3I0S A;  4CGF A;  2OCE A;  5JS2 A;  1J5O A;  4FCY A;  3CJ1 A;  3WXI A;  1TYQ B;  1U47 A;  1VSF A;  1BO5 O;  1HJO A;  1XUP O;  4E7H A;  1S9E A;  4PL8 A;  4NXN K;  5GAG P;  4CJE A;  3HYF A;  4KH5 A;  4DTU A;  3WXK A;  1NJW A;  4FJX A;  3A5N C;  2XHB A;  3L2V A;  1VQ9 N;  4CJ3 A;  4DQ8 A;  4I7F A;  4PQU A;  3L3U A;  2EHG A;  2OTL N;  4CD1 A;  4NLC A;  3SUN A;  3O08 A;  1JL2 A;  3G4S N;  4AHC A;  3E1Y A;  2V7Z A;  4DR3 K;  4NXM K;  4BRN A;  3HTV A;  4A57 A;  5JLH A;  3LDO A;  1VQ4 N;  5HRS A;  4DCH A;  3UE5 A;  4BQL A;  3F73 A;  4KTW A;  4DG1 A;  2P1J A;  4DU1 A;  1JLE A;  2QWL A;  4CJS A;  4KRF A;  1T8E A;  1A5X A;  1Y97 A;  2QW9 A;  1IKX A;  4RW6 A;  3D2E A;  4JI1 K;  1QQM A;  3RSE B;  4E89 A;  1ATN A;  2ZM6 K;  4KB0 A;  3HSC A;  1DKG D;  4HTL A;  4FW1 A;  3AAQ A;  3PO4 A;  1C0U A;  3SQ0 A;  4O5F A;  3T19 A;  3OJU A;  2D0A A;  4FJ7 A;  4WQ4 C;  4QS8 A;  1OH5 A;  4DLE A;  3THY A;  4GKK K;  3CJB A;  3TR8 A;  3HP9 A;  5AQL A;  4CZE A;  3O9U A;  3CQ8 A;  2GWJ A;  1N36 K;  1HKG A;  3O4W A;  5C2F A;  4BR5 A;  2PZS A;  3K5L A;  3NF8 A;  1T05 A;  1YJ9 N;  1BI4 B;  3H1V X;  2HHX A;  2J4R A;  1MA9 B;  3OHR A;  2XRI A;  1K73 O;  2NZT A;  2VGM A;  3QEW A;  2P51 A;  3SQ4 A;  2ASO A;  4M41 A;  1R59 O;  3CER A;  4E7I A;  4L8R B;  3V1Q A;  4FJG A;  3BP8 A;  4DV6 K;  1U2V B;  2AA4 A;  1RDA A;  3PSI A;  2I5J A;  3WUH A;  4BWM A;  3ASM A;  2I7N A;  5DMR A;  3THX B;  1TK0 A;  3A5O C;  3EL2 A;  1HKC A;  3K2P A;  3KLE A;  3AA3 A;  3H6E A;  2I7P A;  4CK2 A;  4CF2 A;  1FK9 A;  3ZEU A;  3AGR A;  3EE9 A;  5J2N A;  1QSL A;  2O8E A;  1S22 A;  2GBZ A;  3JS6 A;  1XWL A;  4FM1 A;  4BE1 A;  3QEV A;  4DKW A;  2Q0U A;  4B3M K;  2HND A;  1QQC A;  4LFB K;  5HRR A;  5C10 A;  2QEX N;  5GIN A;  3M8Q A;  2GX9 A;  1ZBU A;  4XH5 A;  4CHO A;  1Q18 A;  4M3R A;  1KRP A;  2P9I B;  1TGO A;  4CI6 A;  4Z4I A;  3MEC A;  2QK9 A;  3OS1 A;  4FYD A;  4ELV A;  4IOC L;  2O8D A;  1IO2 A;  3DI6 A;  1KVC A;  2QWO A;  4KHQ A;  4FLY A;  3CJ7 A;  3C7N B;  2ZGY A;  3BF1 A;  4PL7 A;  2HMI A;  5H1S Q;  4CFB A;  5HRO A;  1T7P A;  2Z1G A;  3C6H A;  4DQR A;  2BDP A;  2CH5 A;  3MWP A;  3LM2 A;  1VQN N;  3A8Y A;  1HNV A;  2P9N A;  3UIQ A;  2KZZ A;  1C6V A;  3O8M A;  3KK1 A;  4CJF A;  5AQG A;  1NGG A;  3I33 A;  3SLC A;  4PA1 A;  1GOA A;  4FWS A;  4BG9 A;  1RBT A;  5HOO A;  1VQP N;  1YT3 A;  3MN9 A;  4CZI A;  1HNZ K;  3WNE A;  1HYS A;  5FRO A;  1TKD A;  5SWM A;  3AVB A;  3CC7 N;  3AV9 A;  3AO5 A;  3GE1 A;  3AO3 A;  3WXM B;  2NLX A;  3I8D A;  2ZQB A;  4HCC A;  1HR0 K;  3HP6 A;  3ID8 A;  1QE1 A;  4DV4 K;  3QNO A;  3TAQ A;  1BU6 O;  3KLG A;  5AQU A;  4EZ6 A;  4HHT A;  3R9P A;  3KD5 E;  1NGI A;  3MXM A;  4EAH D;  1VSD A;  4FJH A;  2HBM A;  3MEG A;  4TSX A;  4LFA K;  5EVZ A;  1NK9 A;  3G71 N;  5FRN A;  3MX5 A;  2E2O A;  1H1V A;  1T3V A;  3P38 A;  3OY9 A;  3DLH A;  4PWD A;  2IS3 A;  5J1E A;  3HOT A;  3ATV A;  5AQP A;  2UXC K;  1HNW K;  3H1Q A;  4K42 A;  3NAE A;  3TAG A;  3LDN A;  3SUP A;  3V9S A;  1DT9 A;  3KLI A;  3OYF A;  1X9S A;  4B9L A;  1KLN A;  4FM0 A;  4BRA A;  1P90 A;  2NRV A;  3E9P A;  2KW4 A;  1NKE A;  4LSL A;  2FSJ A;  3WT0 A;  5E84 A;  1SL0 A;  5AQN A;  4BR0 A;  3RR7 A;  2HF4 A;  4XEI A;  4B9M A;  2HNZ A;  3CHW A;  4LF7 K;  4A59 A;  4CEE A;  4KI6 A;  5F2R A;  4BQZ A;  1EX4 A;  3LAM A;  1OVY A;  4CES A;  2FSK A;  1GLA G;  3RSE A;  3VER A;  1NK0 A;  1UAX A;  5JMV A;  3M8S A;  4CZF A;  5LY3 A;  4JS4 A;  1X9W A;  3V1R A;  4CJ4 A;  1S3X A;  1RT2 A;  3IRX A;  2UXB K;  1NGA A;  4CFA A;  2HB5 A;  3CCE N;  1KXP A;  2Q3S A;  2OA8 A;  2OPS A;  3EKU A;  3WNF A;  4LD0 A;  3HK2 A;  4C8N A;  3IKM A;  1DEJ A;  4BRM A;  5EY4 A;  2VG6 A;  1GLL O;  3AVJ A;  4CF9 A;  4H0Y B;  4J2A A;  3CF5 L;  5C42 A;  2UYT A;  1BI4 A;  4ELU A;  2LSN A;  1GOC A;  2XY8 A;  4BRE A;  4KTZ A;  2PY5 A;  1BHL A;  3CPE A;  4YFU A;  2NRX A;  4OJR A;  1N33 K;  2ASM A;  1Z25 A;  2D0B A;  1NMN A;  3D2F B;  1Q9Y A;  4HVJ A;  3C65 A;  4DFK A;  3RTV A;  1WSJ A;  4E3S A;  5AQI A;  2F7T A;  3E66 A;  2P5O A;  5TKY A;  1BIU A;  1LW0 A;  3O9R A;  5BPL A;  1U2V A;  4E0D A;  3VTH A;  5KRT A;  3HST B;  4CEA A;  3PX0 A;  1QZ5 A;  3TAB A;  1YAG A;  3IDH A;  3ZYY X;  3IG1 A;  3THX A;  1WSI A;  3DRP A;  4BVP A;  1N32 K;  4HWI A;  3VEY A;  3LL3 A;  5IT9 O;  3DLE A;  3PX6 A;  3L2R A;  3LDS A;  2CGJ A;  4LF5 K;  1NGE A;  4EFH A;  4DF8 A;  2IOC A;  4FLV A;  1RT7 A;  4I6M B;  5AQF A;  1W97 L;  5EU7 A;  4X64 K;  3LDL A;  4E7K A;  1FKO A;  3U4L A;  3LPT A;  4DB3 A;  1ASU A;  4C1N I;  5M1N A;  1D8Y A;  1ATR A;  1X1P A;  1SKR A;  4KKO A;  4CJR A;  3VQP A;  4GMJ B;  3FFK B;  1LWC A;  2HBJ A;  5AZJ B;  2P9I A;  3C6A A;  4IEE A;  4YDU C;  5M1F A;  2P9P B;  4DV3 K;  2FBX A;  3SMS A;  1YUW A;  3OYA A;  1Z26 A;  3C7N A;  2W41 A;  4BE0 A;  3DLB A;  3S3M A;  3ITH A;  3AVK A;  4FM2 A;  3LWL A;  1FJG K;  5AQH A;  2NUB A;  3HO1 A;  5FPM A;  3H3O B;  4M7X A;  4DSI A;  2IDO A;  3M6G A;  3OYL A;  2E8A A;  3KIO A;  4FWN A;  3V9Z A;  1D9F A;  4YY3 K;  4BR9 A;  1CZA N;  4NLB A;  4H03 B;  4CJ7 A;  3NE6 A; 
#chains in the Genus database with same CATH homology
 4E7H A;  4KFB A;  1S9E A;  3AVF A;  4B9S A;  4AHS A;  4CJE A;  1BQM A;  3HYF A;  3AVI A;  2HHS A;  1QTM A;  3L8B A;  1RCH A;  3LP1 A;  4DTU A;  2HVH A;  1F21 A;  3KKS A;  5CZ1 A;  2RKI A;  3RMA A;  1NJW A;  1ITG A;  2WON A;  4H8K A;  4B9N A;  4MFB A;  4FJX A;  1WLJ A;  1UOC A;  4C8M A;  4YNQ A;  2XHB A;  4HCB A;  4M3W A;  2A1S A;  3L2V A;  4CJ3 A;  1KVB A;  3O3H A;  4RW4 A;  3BDP A;  4DTM A;  4N5S A;  4OLA A;  4I7F A;  4MQ3 A;  4PQU A;  3L3U A;  2EHG A;  4CEC A;  4DSF A;  1O1W A;  1KFS A;  1R0A A;  3SUN A;  3AVH A;  1BQN A;  4HUE A;  1NK8 A;  2XY5 A;  4AHR A;  1L3S A;  3AVC A;  3HT3 A;  5HRN A;  2XY6 A;  2F96 A;  1WAJ A;  1JL2 A;  1XHX A;  2ZD1 A;  1NOY A;  3ZSR A;  4CF0 A;  5FDL A;  2JLE A;  3VQ9 A;  4AHC A;  4CEF A;  4E1N A;  2XO7 A;  4F2R A;  2DY4 A;  3ULD A;  3D45 A;  1L5U A;  5HRP A;  1LWE A;  2GUI A;  4CGH A;  2KFZ A;  2Z1I A;  4KPY A;  3NCI A;  2HHQ A;  1TVR A;  2VG7 A;  5HRS A;  3NH0 A;  4E1M A;  3OYE A;  2PYJ A;  4QAG A;  2G8I A;  3QNN A;  3P5J A;  3F73 A;  3SNN A;  3DOL A;  4KTW A;  1C1A A;  4DG1 A;  3E01 A;  4FJN A;  4Z4C A;  3LAL A;  2P1J A;  4DU1 A;  4LSN A;  1JLE A;  4M3U A;  1HRH A;  5J2P A;  3QER A;  4CJS A;  3HVT A;  3SPZ A;  1XHZ A;  4DFP A;  4KTQ A;  4KRF A;  1T8E A;  1A5X A;  1Y97 A;  4RW9 A;  1IKX A;  4RW6 A;  4XIU A;  3SPY A;  4B8C A;  3TI0 A;  1GOB A;  1QHT A;  3NF6 A;  4OKJ A;  4E89 A;  1WSE A;  3AVN A;  3CM5 A;  4I9L A;  3QIN A;  4OPK A;  4FLW A;  1NKC A;  2OPQ A;  3DYA A;  4N56 A;  2G8U A;  4KB0 A;  3OYN A;  3SV4 A;  4FW1 A;  5SZT A;  3PO4 A;  1B9F A;  3D0P A;  5HLF A;  4DU4 A;  1C0U A;  3OYM A;  3SQ0 A;  5K14 A;  3T19 A;  3OJU A;  5I3U A;  2D0A A;  3U3G A;  4FJ7 A;  3O4N A;  3TAN A;  3C94 A;  4DLE A;  1IG9 A;  1LW2 A;  4DSE A;  3G0Z A;  4M45 A;  1U45 A;  1K6Y A;  3TR8 A;  3PX4 A;  2YKM A;  3HP9 A;  2HHW A;  3EZ5 A;  4AHV A;  1ASV A;  1HJR A;  1S1W A;  3C6T A;  3CQ8 A;  4F3O A;  4M3X A;  1JLQ A;  1ZBL A;  4DMN A;  4M42 A;  2OPP A;  4N76 A;  3RMB A;  2YHA A;  4BDY A;  3PY8 A;  2PZS A;  1S1U A;  3M8R A;  3NF8 A;  3K5L A;  1T05 A;  3PO5 A;  1BI4 B;  1HYZ A;  3B6O A;  2HHX A;  3I0R A;  4CIF A;  4CJL A;  1S5J A;  3V4I A;  4DF4 A;  2XRI A;  4KB1 A;  2DTU A;  1J9A A;  3AO4 A;  2O4G A;  3QEW A;  2IC3 A;  4F8R A;  2P51 A;  3SQ4 A;  1RIL A;  4M41 A;  3ZT4 A;  2YNH A;  4CGD A;  3T3F A;  4E7I A;  3QEI A;  4L8R B;  2E4L A;  1NOZ A;  1G15 A;  3V1Q A;  4FJG A;  4NCB A;  2YNF A;  1VSE A;  4CK3 A;  2HHT A;  5KI6 A;  4E19 A;  1RDA A;  4CF1 A;  3LP3 A;  1A5W A;  3DRS A;  1DLO A;  3NGI A;  3KTQ A;  4KI4 A;  5FRM A;  2I5J A;  2OPR A;  4BWM A;  3ASM A;  4IFV A;  2HHU A;  4W5R A;  5DMR A;  1TK0 A;  4H4M A;  4F3T A;  4PY5 A;  3WNH A;  3LPU A;  1NK5 A;  3U6F A;  1LV5 A;  2HW3 A;  1HQE A;  1SUQ A;  4W5Q A;  3B6P A;  3VQE A;  4AHU A;  3QO9 A;  2G8F A;  3TAM A;  4FK0 A;  3EY1 A;  2X74 A;  4OKE A;  1J54 A;  1UA1 A;  3K2P A;  3RWU A;  4IDK A;  4KRE A;  3KLE A;  4B9U A;  3AA3 A;  4H4O A;  3DMJ A;  1JLC A;  1C0M A;  3LZJ A;  4CCH A;  4FJK A;  3SZ2 A;  4BAC A;  4DQP A;  3VQC A;  3NDK A;  1S1T A;  3ISN C;  2HNY A;  3VQB A;  4CK2 A;  4CJQ A;  4CF2 A;  1FK9 A;  1SKW A;  2Z1J A;  2KQ2 A;  1HYV A;  4Y1D A;  3K58 A;  4CEQ A;  2VWJ A;  4CER A;  5J2N A;  3IAY A;  4CJW A;  3EYZ A;  4QOZ B;  3P83 D;  4DS5 A;  1QSL A;  1JXE A;  1TKT A;  3M8P A;  2GBZ A;  4FM1 A;  4DSL A;  1XWL A;  4NYN A;  4BE1 A;  3SCX A;  4DTP A;  1NJZ A;  3QEV A;  4W5O A;  3AVM A;  4R5P A;  1EET A;  2YNI A;  3ZSO A;  2HND A;  3ZSY A;  1QQC A;  5T7B A;  3KK2 A;  3LZI A;  5HRR A;  1XI1 A;  3O3G A;  4C8O A;  4PUO A;  1KLM A;  3M8Q A;  4RG8 A;  1C1C A;  1ZBU A;  4CHO A;  4M3R A;  4FLX A;  4CGI A;  2X78 A;  3VQ7 A;  1TGO A;  1KRP A;  4DU3 A;  1RDC A;  3MEC A;  4DTR A;  4Z4I A;  1W9H A;  3OS1 A;  1BIZ A;  4FK2 A;  1SV5 A;  3PUF A;  2Y1J A;  4ELV A;  2QK9 A;  4FYD A;  3ZSQ A;  1IO2 A;  4AHT A;  3DI6 A;  3K59 A;  5D3G A;  1KVC A;  3K5N A;  4KHQ A;  4BWJ A;  3S3M A;  4WE1 A;  4FLY A;  3QES A;  4FJ5 A;  1WSG A;  4DQS A;  2QKK A;  4M3Y A;  3V6D A;  3V9U A;  3AVG A;  4RW7 A;  4Z0U A;  3NGZ A;  2HMI A;  4W5N A;  1SL2 A;  2AJQ A;  4CFB A;  5HRO A;  1T7P A;  4FJ8 A;  2Z1G A;  3SYZ A;  1YTU A;  4DQR A;  2G8K A;  2BDP A;  4B9V A;  2ZE2 A;  3U3Y A;  2G8H A;  3ZT3 A;  3AA2 A;  1Q9X A;  3L3V A;  1TAQ A;  4CHQ A;  3K5M A;  4KHN A;  4FJJ A;  3L2W A;  1WSF A;  5KTQ A;  1HNV A;  4DFM A;  4OGE A;  3UIQ A;  3RR8 A;  4C8L A;  1DTQ A;  1NJY A;  2KZZ A;  1C1B A;  1C6V A;  3JYT A;  3OYB A;  1RBV A;  3KK1 A;  4CJF A;  4FJM A;  2FBT A;  1ASW A;  4Z4G A;  4PA1 A;  1GOA A;  5I42 A;  4LH4 A;  1RBT A;  3KLF A;  2FC0 A;  4FZZ A;  3O4Q A;  1YT3 A;  3OYH A;  1L3T A;  1KVA A;  2WOM A;  1D9D A;  1CZB A;  4FLT A;  3WNE A;  1LAV A;  3TAP A;  1HYS A;  5FRO A;  4DQI A;  1TKD A;  4FVM A;  5SWM A;  4ZTF A;  4NCA A;  2EX3 A;  3AVB A;  2OZM A;  3C95 A;  3MXI A;  2Z1H A;  3WNG A;  4CHZ A;  3VA0 A;  2F8S A;  3AV9 A;  1QSS A;  3JSM A;  3AO5 A;  4KO0 A;  3K57 A;  3C6U A;  3AO3 A;  4CJU A;  2ETJ A;  1S6Q A;  3ZSZ A;  3DLB A;  3ZCM A;  4B3O A;  3I8D A;  1JLA A;  2ZQB A;  1DTT A;  4CHP A;  4HCC A;  1CZ9 A;  3HP6 A;  1QE1 A;  3QNO A;  3BGR A;  3TAQ A;  1U4B A;  3KLG A;  1RT5 A;  4CJK A;  1RDB A;  4HHT A;  3LAN A;  4EZ6 A;  1XC9 A;  4J2D A;  4O4G A;  1U49 A;  3AA4 A;  3KD5 E;  4FJH A;  3MXM A;  4DLG A;  1VSD A;  2FBY A;  3MEG A;  2XY7 A;  4TSX A;  4NYF A;  3A2F A;  3TAE A;  3RRG A;  4EP4 A;  4HUF A;  4DTO A;  3SI6 A;  1RDD A;  3OYC A;  4EP5 A;  1S9G A;  1NK9 A;  2ATQ A;  1YVU A;  2IAJ A;  5CZ2 A;  3ZT0 A;  2D5R A;  1RBS A;  3OYG A;  4Z4E A;  3VN5 A;  4FLU A;  5FRN A;  1TKX A;  3DLH A;  3OY9 A;  1YTA A;  4PWD A;  1CXQ A;  2IS3 A;  3OS0 A;  2X6S A;  1ZYQ A;  1VSJ A;  2JGU A;  4CJP A;  1L3V A;  4K8Z A;  5KGW A;  1I39 A;  2A1R A;  5J1E A;  3VQ6 A;  4BE2 A;  3HJF A;  4IG0 A;  1D5A A;  4FZY A;  4QCL A;  1RNH A;  3VQA A;  2VG5 A;  3AVA A;  5JS1 A;  5CYQ A;  4CIG A;  4KHS A;  3QLH A;  4Q0B A;  3NAE A;  4O0I A;  3MAQ A;  2Y1I A;  4IBN A;  3V9X A;  4FJI A;  3TAG A;  1A5V A;  1EP4 A;  4CHY A;  3SUP A;  3V9S A;  3KLI A;  3MEE A;  3OYF A;  3QEP A;  3VQQ A;  2VWK A;  1X9S A;  2QXF A;  4B9L A;  2B6A A;  3NH2 A;  1KLN A;  1ZBF A;  3P1G A;  3QIP A;  5DK5 A;  3VQ8 A;  4FM0 A;  1N5Y A;  3V1O A;  4B9T A;  5J2M A;  4J2E A;  3OYJ A;  1WNS A;  2KW4 A;  1NKE A;  4W5T A;  4LSL A;  4JRQ A;  3CYM A;  3VA3 A;  3ALY A;  4BDZ A;  1SL0 A;  1LWF A;  4FW2 A;  1RTJ A;  4NCG A;  4KHU A;  3RR7 A;  1SKS A;  3T1A A;  3IS9 A;  3CM6 A;  4DFJ A;  3AVL A;  4B9M A;  4LH5 A;  4CFD A;  1VSH A;  4ZTJ A;  2HNZ A;  1B9D A;  1BL3 A;  4F2S A;  1BIS A;  4B08 A;  3LP2 A;  2F8T A;  3QIO A;  1NKB A;  4CEE A;  4AIL C;  4KI6 A;  4ELT A;  1WN7 A;  4OKK A;  3KD1 E;  3OS2 A;  1EX4 A;  3QET A;  1BGX T;  3LAM A;  3NFA A;  4Z4F A;  1VK0 A;  4ICL A;  3DOK A;  2P5G A;  4N41 A;  3HPO A;  4CGG A;  3ZSW A;  4CES A;  3S9H A;  1TK5 A;  1RTD A;  3SQ2 A;  4DSJ A;  5CYM A;  3SUQ A;  4CEO A;  4HUG A;  1IH7 A;  5KGX A;  3HPG A;  5KRS A;  1NK0 A;  2OYQ A;  1VRT A;  1UAX A;  1UA0 A;  4BDP A;  2DFE A;  3M8S A;  4FLZ A;  1RBR A;  4JS4 A;  1S6P A;  1X9W A;  1IKY A;  3V1R A;  4RW8 A;  4CJ4 A;  1TKZ A;  2E6L A;  1WSH A;  3NHG A;  1RT2 A;  3IRX A;  1RTI A;  4CJV A;  4KHY A;  3L2Q A;  3OYD A;  4CFA A;  2HB5 A;  4DS4 A;  2HHV A;  1JLF A;  2Q3S A;  4JS5 A;  2OA8 A;  1BCO A;  2OPS A;  3WNF A;  4LD0 A;  1VSI A;  3DLG A;  1KFD A;  4O5B A;  4C8N A;  2DFF A;  3HK2 A;  1IKV A;  4ZHR A;  3DLR A;  4CK1 A;  1I3A A;  2VG6 A;  2G8W A;  3LAK A;  4DTS A;  3AVJ A;  1L3U A;  4FJL A;  4CF9 A;  2X6N A;  3MED A;  3G10 A;  1EKE A;  1TK8 A;  4OLB A;  1X9M A;  4J2A A;  4JLH A;  5C42 A;  1JXB A;  1TV6 A;  2RPI A;  2KTQ A;  4KV8 A;  1RT3 A;  4FJ9 A;  1VRU A;  1BI4 A;  4ELU A;  4OPJ A;  2LSN A;  1GOC A;  4Y1C A;  2XY8 A;  2RN2 A;  3KKR A;  3SQ1 A;  4KTZ A;  3S3N A;  1BHL A;  4YFU A;  1NK6 A;  2PY5 A;  4CEB A;  4M3T A;  4FXD A;  3DM2 A;  1HQU A;  4OJR A;  1Q8I A;  1Z25 A;  2D0B A;  2D0C A;  2ITG A;  3F9K A;  1MU2 A;  4HTU A;  1Q9Y A;  1KTQ A;  4HVJ A;  3L2U A;  3NGY A;  1RT1 A;  3ZSX A;  2FBV A;  2G8V A;  4FK4 A;  1ZBH A;  4FZX C;  3KLH A;  3OJS A;  4GVM A;  4DTX A;  4G1Q A;  3RTV A;  4E7L A;  4DFK A;  4KAZ A;  5E41 A;  1WSJ A;  4E3S A;  1SL1 A;  2P5O A;  4DTJ A;  3LP0 A;  2RF2 A;  1JKH A;  1BIU A;  1LW0 A;  3THV A;  3ZT2 A;  4M3Z A;  1JL1 A;  2YHB A;  4ID1 A;  4C8K A;  4E0D A;  3SV3 A;  1CLQ A;  1VSM A;  3FFI A;  5HBM A;  5KRT A;  3HST B;  1CXU A;  4CEA A;  3PX0 A;  1KCF A;  4I2Q A;  3TAB A;  3SJJ A;  3IG1 A;  2E6M A;  3ZSV A;  4CHN A;  1WSI A;  3DRP A;  3AA5 X;  4CEZ A;  3OYK A;  3HXM A;  2PYL A;  4JRP A;  4IKF A;  3V81 A;  3DLE A;  3AO2 A;  2IGI A;  3PX6 A;  4Q5V A;  4F4K A;  3CFO A;  3L2R A;  3LDS A;  3CFR A;  1NK4 A;  1RBU A;  4DTN A;  1BCM A;  4KHW A;  1U04 A;  5C24 A;  1C0T A;  3RRH A;  2KZM A;  4N47 A;  4DF8 A;  2IOC A;  3VQD A;  4FLV A;  1KSP A;  1ZBI A;  3PV8 A;  4EZ9 A;  3RMC A;  2DFH A;  4J2B A;  1RT7 A;  2HVI A;  1WAF A;  4CFC A;  1TL1 A;  3HPH A;  3TAR A;  5EU7 A;  1HNI A;  2OZS A;  4Z4H A;  1TAU A;  4E7K A;  3AO1 A;  1FKO A;  1VSK A;  2YNG A;  3CG7 A;  2YKN A;  3LPT A;  1W0H A;  2KFN A;  1ASU A;  2BAN A;  1HPZ A;  1RT4 A;  2BE2 A;  4CGJ A;  1D8Y A;  4O44 A;  2BGG A;  3K5O A;  2O4I A;  1VSL A;  3DRR A;  1X1P A;  4O55 A;  2B4J A;  1SKR A;  1FXX A;  4KKO A;  1LAW A;  4I2P A;  5CY4 A;  3VQP A;  4CJR A;  4LY7 A;  2B5J A;  4GMJ B;  1S1X A;  3HVR A;  4OVL A;  4AH9 A;  3KK3 A;  1FKP A;  4O0J A;  1LWC A;  4CIE A;  3LWM A;  3O3F A;  5HP1 A;  1UWB A;  3SUO A;  1EXQ A;  3TAF A;  2YV0 X;  3VQ4 A;  3KJV A;  5J2Q A;  2FBX A;  3DLK A;  4I9Q A;  1NK7 A;  3OYA A;  4E7J A;  1RTH A;  4GW6 A;  3CFP A;  4OGC A;  1N6Q A;  4IG3 A;  1Z26 A;  4CJ5 A;  3HM9 A;  4CED A;  3OYI A;  1IKW A;  4ID5 A;  4BE0 A;  1REV A;  1S1V A;  1RT6 A;  4B8A B;  3TWH A;  3HL8 A;  3NBP A;  3MXJ A;  1JLB A;  1J53 A;  3ITH A;  4CE9 A;  3AVK A;  1QS4 A;  4FM2 A;  3QEX A;  3OVN A;  4IFY A;  3LWL A;  1TL3 A;  3V9W A;  1U48 A;  3ZT1 A;  1T03 A;  2NUB A;  3HO1 A;  3RMD A;  3S3O A;  1HMV A;  4CJT A;  3H08 A;  4UQG A;  1QSY A;  5C25 A;  4DSI A;  2IDO A;  4CF8 A;  1B92 A;  4K8X A;  2GV9 A;  3I0S A;  4CGF A;  3OYL A;  5JS2 A;  2QKB A;  1J5O A;  2W42 A;  4DSK A;  3KIO A;  3NF9 A;  2R7Y A;  4FCY A;  3V9Z A;  1NJX A;  4DQQ A;  1D9F A;  3NH1 A;  1U47 A;  1VSF A;  4DWI A;  3NE6 A;  3VQ5 A;  3NF7 A;  1JLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...