1J54A

Structure of the n-terminal exonuclease domain of the epsilon subunit of e.coli dna polymerase iii at ph 5.8
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
174
structure length
174
Chain Sequence
RQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHGALLDAQILAEVYLAMTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA polymerase III, epsilon chain
publication title Structural Basis for Proofreading during Replication of the Escherichia coli Chromosome
pubmed doi rcsb
source organism Escherichia coli
total genus 57
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1j54A00
1YVUA 3NE6A 1S6QA 2OA8A 3L2UA 3SQ2A 4JRPA 5C42A 4IFYA 1S1XA 1ZBIA 4HCCA 4CEZA 2EHGA 2OPRA 4OGEA 4DSJA 3VA0A 4DTOA 1HMVA 2B6AA 5KI6A 2Y1IA 4AHVA 4CEOA 2I5JA 4BE0A 3SV3A 1WNSA 4QAGA 3KLFA 3ISNC 4FJ9A 1ZBFA 3K2PA 3KK3A 1TAUA 4I2PA 3SJJA 4FLXA 2RF2A 3VQ5A 3KD5E 3BGRA 4WE1A 4RW8A 3ZSRA 2A1RA 3S9HA 4OJRA 1JL1A 4FJXA 4RW9A 4TSXA 1ASWA 3LP1A 3AVGA 4KKOA 2RPIA 5K14A 3AVHA 3DLRA 1IH7A 4O5BA 3NCIA 3L8BA 3HVTA 4O0JA 1T8EA 4HUFA 4OKKA 3VQEA 1W0HA 3AVNA 3KKRA 1FKPA 4CECA 1T05A 5C24A 3NF7A 3AV9A 3L2QA 4KREA 5FRNA 4Z4EA 1JLGA 2HNYA 3L2VA 3NF6A 3LP3A 3OYMA 4BACA 3V1RA 2DTUA 3S3OA 3AA3A 1Y97A 3AA4A 2ZQBA 2YNIA 1RT2A 4MQ3A 4OGCA 4CJEA 4CF2A 3ZT0A 4CJLA 3U3GA 2Z1IA 4Z0UA 3NF8A 5I3UA 3NHGA 3P1GA 1RT6A 1VSIA 3AVIA 1RBVA 1NJXA 1BGXT 4OPKA 3HL8A 1C6VA 4IBNA 2D0BA 1IKVA 4DS4A 3QNOA 1KVBA 1GOCA 3MEDA 4OVLA 3C95A 1GOAA 4I7FA 4CEDA 3NH1A 3OYHA 1UA1A 3RR8A 4DWIA 4F2RA 4M42A 4CGHA 4JLHA 4E1MA 2G8FA 3T1AA 2E6MA 1U49A 1IKYA 2IGIA 2YHAA 4HTUA 1TK8A 1LAVA 4BWJA 4K8XA 2HHWA 1NJZA 4CJFA 2P51A 2Z1JA 4C8MA 4EP5A 3S3MA 1R0AA 1N5YA 4FLVA 4QCLA 3DI6A 4Z4CA 4FJMA 4CJUA 4C8OA 3C6TA 4ELUA 4CK1A 4O55A 3AVJA 4CJTA 1EKEA 3KLIA 1XWLA 4RW7A 3HP6A 4DFJA 4E7KA 1T03A 4KI4A 1S9EA 4OLBA 4B3OA 1C0MA 5HROA 3DM2A 3NGIA 2PY5A 1RT4A 1WSGA 2JLEA 3O3HA 3V1QA 1S5JA 4E7IA 5D3GA 3QETA 5CYMA 5C25A 1RTHA 1QSSA 2KFZA 4FCYA 4I2QA 4DLGA 4CFBA 1JLFA 4J2AA 2B4JA 3O4QA 3HPOA 5J2PA 4OLAA 3WNHA 4E19A 4CHOA 1L3SA 4FJ8A 1LWEA 2YNFA 5T7BA 1YT3A 3O4NA 3SQ4A 1FKOA 2QKBA 5HP1A 1L3TA 1S1TA 5HRRA 3OYJA 2RKIA 1RTJA 4DTPA 3M8SA 1HQUA 3RTVA 4DFPA 4HCBA 3TANA 4EP4A 3LALA 1IG9A 1CXQA 2KFNA 3ZT3A 1X1PA 3OYLA 2VG6A 4E7HA 1J54A 1JLAA 1BIZA 2X6SA 3TAEA 1WAFA 3HPGA 1NKEA 1RDDA 4CF9A 3O3FA 1J53A 4LH5A 3SUOA 1VK0A 3RWUA 2KTQA 3L3UA 1NK9A 1ITGA 1HJRA 1A5XA 4Y1CA 4CEQA 4DS5A 4PUOA 3AO3A 3MECA 4CK2A 4AH9A 1BCOA 1RDBA 3V9XA 2YHBA 3LP0A 3CFRA 2VG5A 3CQ8A 3T19A 2DY4A 1K6YA 4PA1A 5SZTA 1RT7A 3KLGA 2G8HA 4M3RA 3TWHA 3DLEA 3LZJA 1X9SA 1XHXA 4C8KA 4QOZB 3DOKA 4N41A 4IKFA 2D0CA 1RBTA 4UQGA 4FYDA 4CE9A 3RMDA 4C8LA 1B9DA 3I0SA 2BGGA 1J9AA 4DSLA 4DTMA 4DTRA 3LP2A 3ZSQA 4AHRA 4FM0A 3DOLA 3OS1A 1SKWA 1NK5A 2QKKA 4B9MA 4BDPA 4O4GA 1SV5A 3QEIA 1EX4A 1BHLA 3OYGA 4BE2A 4DU4A 2KQ2A 2XO7A 1HNIA 4KTZA 3V81A 3KD1E 4DQIA 4ZTFA 4Z4FA 3QEWA 1UOCA 1C1AA 1D9FA 4DSIA 1YTAA 2HHVA 3MXMA 3IS9A 1Q9XA 1RDCA 3VQ4A 1LW0A 1TGOA 2ATQA 2D5RA 1HNVA 3OYDA 4OKEA 3WNEA 5HRPA 4NYNA 1RBSA 1VSJA 4FW2A 5KGXA 2QK9A 2A1SA 4M3XA 3KJVA 4DFKA 3QEVA 4ID5A 4NYFA 4JS5A 1WSEA 1KCFA 2VWKA 2WOMA 1CLQA 1KTQA 1W9HA 4KFBA 1L5UA 1CZBA 1X9MA 4FLTA 3NF9A 3T3FA 1TKTA 1T7PA 3HO1A 1TAQA 3F9KA 3K58A 1NOYA 3WNFA 2W42A 3I8DA 3AVLA 2XHBA 4DQPA 4F4KA 4FK0A 4FZXC 4ICLA 1U47A 1U48A 4HUGA 4CFAA 2OZMA 3VQ9A 4FZYA 4PQUA 3D0PA 3AO5A 4B08A 3HT3A 3PV8A 1CXUA 3MXJA 2X74A 1LWCA 1VSMA 3DLKA 4Z4HA 4OPJA 4K8ZA 1RBRA 4F3OA 3QO9A 1CZ9A 3AA5X 4FJ5A 1TKZA 1JL2A 4ID1A 4Y1DA 4DG1A 3OYAA 3SQ0A 2P5OA 1UA0A 2BE2A 3THVA 1NJWA 3SCXA 2XY5A 3PX6A 4CIEA 5J2MA 1C0UA 3JSMA 2FBTA 3DMJA 1KFDA 2HHUA 3KIOA 3QNNA 4LH4A 4LSNA 3OYFA 1KVAA 1QQCA 3SPYA 2HHQA 1JKHA 4LY7A 4KHQA 3OYIA 3AVBA 4RW4A 3U6FA 3SUPA 1WSHA 3V9WA 5JS1A 4M41A 4FJJA 1RT3A 2PYLA 1TVRA 2HNDA 3VQ8A 1WSIA 4FVMA 3KK2A 3SNNA 4DU3A 4F2SA 1XHZA 3EY1A 1WSJA 1KFSA 3OYCA 1BISA 5HBMA 3HSTB 4CGJA 1A5VA 4M3TA 3AA2A 5CZ1A 4FJNA 4IDKA 3AVFA 3M8PA 1VSKA 5CYQA 1EETA 3ZCMA 1TKDA 2Z1GA 1ASVA 3LANA 1UWBA 3VQDA 3OYEA 1ZBLA 1FXXA 2DFHA 5E41A 4E7LA 3KK1A 5FROA 3ASMA 4FLWA 1NK8A 3ZSZA 3AVCA 4NCBA 3VQCA 3V4IA 2OPQA 3SUNA 4AHSA 3NBPA 3KLEA 2KW4A 3PX4A 4B9NA 4W5RA 4YFUA 3RRGA 2ITGA 3LDSA 4CEBA 1DTTA 3IG1A 4LD0A 2XY7A 3PY8A 4W5OA 3OS0A 1XC9A 5KGWA 4DFMA 5FRMA 1BQNA 4J2DA 4I9LA 5HRNA 1B92A 4KO0A 4F3TA 4HHTA 3TI0A 4CK3A 4ZHRA 4PY5A 1A5WA 4CGIA 1NJYA 3M8RA 4Z4IA 3IAYA 2AJQA 2Z1HA 4CF1A 3AVMA 3TAMA 1VRUA 4E1NA 3C6UA 4KRFA 3U3YA 1BQMA 3HXMA 2F96A 2IC3A 3DYAA 4MFBA 2G8VA 3TR8A 3NGZA 4JRQA 2HVIA 5J1EA 2GV9A 2WONA 2OPPA 3RMCA 4KHNA 3V9UA 1D9DA 3K5LA 3SQ1A 2G8IA 2PYJA 3L3VA 3SYZA 1F21A 2G8KA 2X6NA 4Z4GA 2YNHA 1XI1A 3K59A 5KRTA 4PWDA 1DTQA 3VA3A 4FJKA 2ZD1A 3HM9A 4CJ4A 3QESA 5CY4A 3AO2A 3RRHA 1SL0A 4I9QA 3HP9A 3VQ7A 3AVAA 1BI4A 1NK4A 1RTDA 2XRIA 1D8YA 4H4MA 3ZSYA 3P83D 1G15A 3K5NA 4E89A 4FLZA 2F8TA 4Q0BA 4E3SA 1HYVA 3LWLA 2HB5A 4H4OA 2HMIA 4RW6A 5EU7A 1QTMA 4ZTJA 5KRSA 1KSPA 2EX3A 3VQBA 3KKSA 4DTXA 1RT1A 1S9GA 1ZBUA 3AVKA 4R5PA 1I39A 4FM2A 3QIOA 2Y1JA 3I0RA 3KTQA 4FW1A 3EZ5A 2FBYA 4KTWA 4W5NA 1VSHA 4KB0A 1RDAA 4CJ5A 1S1VA 4CFCA 3QEPA 3OVNA 4L8RB 3NAEA 3ZSWA 4CIFA 4DTJA 3HK2A 1DLOA 1LWFA 3G10A 1HRHA 4AHTA 1U45A 4DTUA 1X9WA 4B9TA 1GOBA 1HYSA 2OYQA 1RILA 4W5TA 5DMRA 3ZT1A 2ZE2A 3SZ2A 3ZSOA 1B9FA 2YNGA 1L3VA 3DLBA 4FXDA 3ZT2A 4LSLA 3JYTA 2BANA 1QSYA 4EZ6A 4M3WA 4CGDA 2YKMA 4DQSA 4KI6A 3LPTA 4KHUA 2HHXA 3ZSVA 4DQQA 4CEFA 3H08A 1C1CA 4CHQA 1JXEA 4CEAA 3RMBA 4Q5VA 2G8WA 3NH0A 3NFAA 4M45A 5HRSA 3DLHA 2Q3SA 1U04A 3K5OA 4IG3A 3PUFA 3NDKA 1RTIA 3G0ZA 3LPUA 3CG7A 3V6DA 3KLHA 3SI6A 4FZZA 3DRPA 1KVCA 3AO1A 2OPSA 2O4IA 4M3YA 1JXBA 4FLYA 1SL2A 1RT5A 3MEEA 3MAQA 4DSEA 1U4BA 3B6OA 4J2EA 4N76A 1S6PA 2FC0A 2KZMA 4W5QA 5J2NA 1BI4B 1NOZA 1TV6A 3CFPA 4F8RA 4CJQA 4O44A 4J2BA 1YTUA 4GW6A 4O0IA 3VQ6A 1TKXA 1N6QA 2YV0X 3ZT4A 4B8CA 4CJKA 3TAGA 1QS4A 1IO2A 3F73A 1VRTA 4NCAA 4H8KA 1WLJA 2NUBA 1HQEA 2E4LA 3K5MA 5CZ2A 4E0DA 3L2WA 3SPZA 3VQQA 4CF8A 4HVJA 3L2RA 1WN7A 1RCHA 4OKJA 1O1WA 3ZSXA 4FLUA 3RR7A 4CF0A 3P5JA 3QLHA 4BDZA 2GUIA 4G1QA 3ALYA 4CGGA 2PZSA 3RMAA 1ASUA 3NGYA 4GVMA 4CJVA 4B9SA 3DRRA 3FFIA 4CHYA 1TK0A 3LWMA 4N5SA 4DTNA 4IFVA 4CHPA 4ELTA 3D45A 4DF8A 3V9ZA 1REVA 2P1JA 3OYKA 1JLQA 2B5JA 2YKNA 5JS2A 5J2QA 3B6PA 1HYZA 4CJRA 2KZZA 3PO4A 4HUEA 2DFFA 4CERA 3HPHA 3TABA 1J5OA 4FJ7A 3HVRA 4AHCA 4FK4A 2HHTA 3OJSA 2FBXA 3C94A 4CFDA 3TAFA 4FK2A 4CCHA 1RNHA 1WAJA 3DRSA 4BE1A 3QEXA 1TL3A 4B9UA 4C8NA 1EXQA 4M3UA 2HW3A 4DMNA 4CEEA 4ELVA 3WNGA 3BDPA 1NK0A 3AO4A 1JLEA 1LAWA 4AHUA 2IS3A 4EZ9A 3CM6A 1JLCA 3CFOA 4CESA 1NK6A 1S1UA 3HYFA 1JLBA 4KV8A 1C1BA 4KB1A 1I3AA 4N47A 1LV5A 2P5GA 1SKRA 4DQRA 3V9SA 3OYNA 1VSLA 4KTQA 1L3UA 4M3ZA 3UIQA 4FJIA 2IDOA 4KHWA 1RBUA 1UAXA 2ETJA 2JGUA 4CGFA 4CJ3A 4YNQA 1HPZA 3TAPA 3MXIA 3K57A 1BIUA 4DSKA 2HVHA 5KTQA 4JS4A 3LAKA 4XIUA 4BDYA 3M8QA 1D5AA 2FBVA 3OS2A 4B8AB 5HLFA 4B9VA 2O4GA 3CM5A 2OZSA 3PO5A 3PX0A 4E7JA 1QHTA 2VWJA 1ZBHA 4KPYA 1VSFA 3EYZA 3VQPA 1MU2A 2VG7A 1Q8IA 5FDLA 3QIPA 5SWMA 3LAMA 3MEGA 4IG0A 2IAJA 4CJWA 1KLNA 3SV4A 2G8UA 2BDPA 4FJLA 4DU1A 4NCGA 1WSFA 3QERA 3SUQA 3VQAA 3TARA 4DF4A 3NH2A 4CJSA 1BL3A 2R7YA 4B9LA 1FK9A 1KLMA 1SUQA 4KHYA 4CJPA 4BWMA 3OYBA 5DK5A 1NKBA 2QXFA 5I42A 4DSFA 4RG8A 1KRPA 2XY8A 1NK7A 3DLGA 2HNZA 2DFEA 1S1WA 1Z25A 3ITHA 4CHNA 4DLEA 3LZIA 3HJFA 4AILC 3ULDA 2E6LA 4FJHA 4KHSA 3VN5A 2X78A 1IKXA 3S3NA 3O3GA 1EP4A 1IKWA 1C0TA 2RN2A 4CHZA 4KAZA 1LW2A 1VSEA 4GMJB 1SL1A 2D0AA 3OY9A 3CYMA 1ZYQA 1Z26A 1VSDA 3E01A 1BCMA 3TAQA 1Q9YA 4FJGA 1TL1A 1QE1A 3V1OA 4CIGA 4FM1A 1TK5A 3A2FA 3OJUA 1SKSA 1NKCA 1QSLA 2F8SA 4N56A 2HHSA 3IRXA 4DTSA 2XY6A 3QINA 2IOCA 2LSNA 2GBZA
chains in the Genus database with same CATH superfamily
1YVUA 1S6QA 4K41A 1C0FA 1DEJA 3Q7CA 5C42A 4H0XB 4IFYA 1NGCA 3VENA 2O8BB 2VGNA 1ZBIA 4YOVA 4CEZA 2EHGA 4OGEA 4L3QA 1NM1A 1HMVA 2B6AA 2Y1IA 2P9SA 4BE0A 1WNSA 5AQYA 4K0KK 1ZBFA 1TAUA 4I2PA 2P9UA 3BGRA 1W2BM 5KQ8A 3S9HA 1BUPA 3H3OB 3AVGA 4BROA 4O0JA 1T8EA 2UXDK 5LJWA 3KKRA 1T05A 2P9PA 1W97L 2FF6A 5FRNA 4NB4A 2HNYA 4IOCL 3J81O 3LP3A 3V1RA 4MQ3A 4LF6K 3K9JA 4MDAA 2KLAA 3NF8A 5I3UA 3NHGA 1KC8O 3R6MA 1KAZA 1OKJA 2A41A 3FZKA 1NJXA 1C6VA 4HWIA 3T1HK 2D0BA 5JVHL 1R59O 4CEDA 2FSJA 1ATRA 4M42A 3MX2A 1IKYA 2YHAA 1TK8A 1LAVA 1NJZA 3O1BA 2Z1JA 4XEIA 4IOAL 4QCLA 4FLVA 3W3DA 4BR2A 4WQ4A 3AVJA 2P9LB 4JHDA 4DFJA 3CPWM 4OLBA 4B3OA 1C0MA 3DM2A 2PY5A 1WSGA 3UB5A 4H5VA 1OVYA 5EX5A 4EHTA 3QETA 4LF9K 2YHYA 3MN5A 5C15A 5AQMA 4OLAA 5ELZA 3HPOA 5J2PA 3T69A 4YOXA 2DPNA 2YNFA 5BRFA 1FKOA 1BWFO 5E84A 3WXJA 4DTPA 3M8SA 1HQUA 3TANA 4EP4A 3LALA 1CXQA 3H45C 5A2QO 1K73O 2X6SA 3TAEA 3C7NB 3PIOL 4LH5A 2FLOA 4LF5K 1QZ5A 4QS8A 3QICA 1NK9A 1EQYA 1VQMN 4Y1CA 3J7AP 4CK2A 1RDBA 3FLCO 2YHBA 3LP0A 4YOWA 2DY4A 5GAEP 3NVMA 1RT7A 4B9QA 2G8HA 3TWHA 3DLEA 3K9KA 1X9SA 2QWMA 4N41A 1NMDA 1QQMA 1RBTA 2D0CA 4IOXA 3WXMB 1VAZA 3CF5L 1J9AA 1HLUA 4M63C 2EWSA 4AHRA 3M6GA 1SKWA 4B9MA 2QKKA 3QEIA 1EX4A 4JEPA 3OYGA 3H46O 2KQ2A 4IEEA 3KD1E 2CGLA 3VESA 3WT0A 1UOCA 1C1AA 1YTAA 3IS9A 1Q9XA 2YHXA 1T6DA 1TGOA 4Z94A 3HI0A 1OH5A 3ID6A 4H0PA 4FW2A 5GIOA 1XNRK 5MLCQ 1KCFA 2KHOA 1KTQA 1L5UA 1X9MA 4FLTA 3NF9A 3T3FA 3A5OC 1WBBA 4YY3K 1NOYA 2QWRA 4CZFA 1U48A 1RDWX 4IXCA 3AO5A 1CXUA 3MXJA 4Z4HA 4K8ZA 4F3OA 1O13A 3AA5X 4ILGB 1YF5L 4BREA 2V51B 1JL2A 4ID1A 4Y1DA 4GKKK 1XMOK 2Q31A 3O80A 2O8DB 4CIEA 1C0UA 2FBTA 2HHUA 3KIOA 2HBLA 4IDHA 3OYFA 2Q0UA 1QVFM 2IIRA 3OYIA 3AVBA 5AQRA 5TKWA 1NGFA 4FJJA 4OO1J 3A0IX 3CCLN 4DU3A 1WSJA 4JKCA 3HSTB 1NU0A 3E66A 4IDKA 1TKDA 5CYQA 3VEVA 2Z1GA 1UWBA 5C12A 4NXMK 1ZBLA 2DFHA 1N36K 5AQXA 2E2PA 4NCBA 3THYB 3SLCA 4IJAA 2Q1NA 1XUPO 3A5NC 3SUNA 4AHSA 3PX4A 4B9NA 4W5RA 1OVQA 3RRGA 4LD0A 2XY7A 3PY8A 4CBUA 5KGWA 1V4TA 4I9LA 5HRNA 4KO0A 3G6EN 4HHTA 3TI0A 4PY5A 1A5WA 3F2KA 5TKYA 4CGIA 1NJYA 4Z4IA 1OH6A 4YORA 5F0XA 1BQMA 2F96A 2IC3A 4BRHA 2HHHK 2O8BA 4JRQA 3P38A 3V9UA 2PYJA 4FWQA 3SYZA 2X6NA 1KXPA 1XI1A 3M1FA 3K59A 1DTQA 2PFUA 4BG9A 3VA3A 4JI6K 3HM9A 4FO0A 5BPLA 1BU6O 3DJCA 1ATSA 1NK4A 3GDQA 3K5NA 3CI5A 4FLZA 3MWTA 2HB5A 4H4OA 2A40A 4RW6A 5EU7A 5KRSA 2EX3A 1N34K 3AGRA 3VQBA 4DTXA 1S9GA 2NRTA 4R5PA 1VSHA 4KB0A 5AQOA 4L8RB 1N8RO 3HK2A 1LWFA 4H0OA 1X9WA 1GOBA 4W5TA 1I94K 5DMRA 3ZT1A 3DLLL 1B9FA 1HX1A 4FXDA 4NLBA 5BPNA 2NZTA 3FZHA 4EZ6A 4CGDA 4KI6A 4H5RA 4WYBA 2P9LA 5JVGL 1JXEA 1IV0A 5HRSA 2Q3SA 3PUFA 3ZEUB 2O4IA 1SL2A 4MDBA 3C6HA 4W5QA 1BI4B 5AJ3K 5EOYA 4A2AA 1IO2A 4H8KA 4X64K 5M1QA 5CZ2A 3UKUB 4CF8A 1RCHA 2UUAK 1O1WA 4CF0A 3P5JA 4BDZA 4G1QA 3ALYA 4CJVA 4FPBA 4ELTA 4K43A 1MWKA 2YKNA 5JS2A 5M1KA 2KZZA 1HYZA 4CJRA 1BO5O 5AQQA 4FJ7A 3TABA 4M7XA 4AHCA 4IWVA 2O8FB 2HHTA 1JCEA 2FBXA 4CFDA 4NXNK 1WAJA 3QEXA 2HW3A 1EXQA 2HBMA 3WNGA 1NK0A 1JLEA 4AHUA 4PKIA 3MWPA 1JLCA 4LFCK 4CESA 1S1UA 2NRWA 1C1BA 1I3AA 1SKRA 4DQRA 1VSLA 4EFHA 1L3UA 4FJIA 2ETJA 4CJ3A 2F9WA 3K57A 2IVPA 1BIUA 3C65A 2HVHA 5KTQA 2YHWA 3MN6A 3WUHA 2V7ZA 1D5AA 4KHPK 3SJHA 4B8AB 5IT9O 2O4GA 3PO5A 4E7JA 3EYZA 2HOEA 4FPAA 3QIPA 3JAMO 4CZEA 3LAMA 4IG0A 1KLNA 4BRDA 4JI5K 4FJLA 4HTLA 4NCGA 3F9MA 4DB3A 3CCVN 3CC2N 2ZGYA 4GNIA 5HL7L 1FK9A 1KLMA 4CJPA 4BWMA 2BTFA 4WQ5C 2QXFA 5I42A 5BN9A 1NK7A 4DLEA 4BRQA 2O8DA 3HJFA 4AILC 4KHSA 4FJHA 1EP4A 2O8EB 1Q7YO 3C6AA 3OY9A 1VSDA 3VGMA 3EKUA 3TAQA 3O9SA 2D4WA 1TK5A 1NKCA 4O5FA 1M1KO 3IRXA 4LC9B 3IFRA 1IJJA 2OA8A 3L2UA 2RHKA 4KH4A 3KVGA 4EHUA 2ZF5O 1V4SA 3VGLA 4B1ZA 1XNQK 5AQPA 1BG3A 4B3SK 4CEOA 3THYA 3OW2M 4FJ9A 3AGKA 3ISNC 2ASPA 3KK3A 3DXKB 2A1RA 3ZSRA 3G4SN 4FWMA 4FJXA 2UYTA 1ASWA 3LP1A 1YITN 3NCIA 4OKKA 3CC4N 1P8ZA 1W0HA 2QI2A 2BUPA 3LDNA 3L2QA 1JLGA 2VQFK 4QS9A 4A61A 4BR5A 4BVOA 1EO1A 4FM2A 2YNIA 1RT2A 4CJEA 1HJOA 2A3ZA 3VF4A 1VQNN 3M3ZA 3O6WA 1RBVA 3OA9A 4OPKA 3J7YP 2FSNA 4DS4A 3NH1A 1UA1A 3RR8A 3BP8A 2G8FA 4E1MA 2IGIA 1U2VB 1H1VA 4K8XA 3U9ZA 4K25A 4CJFA 2P51A 3ULEB 1N5YA 3S3MA 4K42A 3H3NO 4C8OA 4A57A 5BREA 1EKEA 3I33A 3KLIA 3GL1A 3HP6A 1T03A 4E7KA 5BR8K 3NGIA 1RT4A 2JLEA 3QBXA 3V1QA 5C25A 1VQ9N 1GLLO 3P4IA 3VEOA 1RTHA 4BGAA 1QSSA 4I2QA 4J2AA 2B4JA 3O4QA 3CCMN 4E19A 3EL2A 4FJ8A 2GEMA 1SS6A 1YT3A 3SQ4A 2QKBA 1DKGD 3OYJA 1NBWA 2O8CA 4DFPA 3RTVA 3HRGA 1IG9A 2KFNA 3ZT3A 1BIZA 1WAFA 3OBYA 3HPGA 3EE9A 1RDDA 1Z05A 3RWUA 2KTQA 5ADXH 2NRXA 4DS5A 1SQKA 4PUOA 3AO3A 3MECA 4AH9A 3CFRA 2VG5A 3T19A 3KLGA 3O9TA 1XHXA 3DOKA 5LMNK 4R79A 1B9DA 3I0SA 3IDHA 4M7YA 3P39A 3LP2A 1U6ZA 3ZSQA 3BZKA 2NRRA 5KQDA 1NK5A 5AQTA 4O4GA 2XO7A 1HNIA 3E9PA 4YDUC 3V81A 4DQIA 4Z4FA 3QEWA 5FPNA 5E26A 2HHVA 2ZJPL 1RDCA 1LW0A 2VCPA 4NYNA 1RBSA 1J5EK 3BF3A 3QEVA 4ID5A 3KHYA 4JS5A 1W9HA 3VEWA 1JJ2M 1TKTA 3HO1A 1TAQA 4YOYA 1VQ6N 3WNFA 2XHBA 1K8KB 5LL6Z 3EKSA 5AFUA 4HUGA 4PHTX 4PQUA 1NGJA 4B08A 2BH1A 1LWCA 1VSMA 4OPJA 1HKGA 3JXUA 2QEXN 4DG1A 1NJWA 4DR3K 3JSMA 4XH1A 3FE1A 1ATNA 2HHQA 4KHQA 4CZHA 4LFAK 2HNDA 1WSIA 4QS7A 4CVNE 2FXUA 2F9TA 3EY1A 3DXMB 3MX5A 3OYCA 5HBMA 3AARA 3LM2A 4BRFA 3H1VX 1HNZK 3FGUA 3TPQA 1NGGA 4FWKA 1GLJO 2HBJA 3VQDA 3OYEA 1FXXA 1FJGK 5FPMA 3ASMA 1NK8A 3ZSZA 3AVCA 2CGKA 4ILJA 4BRLA 4G9ZA 3KLEA 2O8EA 4YFUA 5AQZA 3WQTA 3SAHA 4W5OA 4DFMA 2YX6A 1B92A 2OCEA 3UE5A 3MDQA 3M8RA 5AQLA 3IAYA 2AJQA 5M1OA 3BEXA 1VRUA 4LF7K 3C6UA 2OANA 3HOSA 4GV9A 4J8FA 2A5XA 3DYAA 3W0LA 3RMCA 3THXA 3K5LA 3SQ1A 2G8KA 4Z4GA 4DUYK 4YOTA 3ZX0A 3QB0A 4FJKA 2ZD1A 2E2NA 4MO5A 3TTFA 3E9OA 4I9QA 4BRCA 3R3LA 4GKJK 1IG8A 4PL8A 2F7TA 4JI0K 4JI8K 3ZSYA 1G15A 2A6AA 1S22A 5AZJB 4E3SA 1HYVA 2FSKA 4FSVA 5C10A 4ZTJA 2P9KB 2D1KA 2ZWHA 4DR2K 1NGAA 3KKSA 4CZKA 1RT1A 2ZJRL 2Y1JA 1I39A 1J6ZA 1NGBA 3I0RA 1Z6RA 1GLAG 3KTQA 2FBYA 5BRDA 5GADP 3M5RA 1BA1A 3ENOA 4AHTA 1U45A 3CMEN 4B9TA 5AQNA 1HYSA 4B3TK 2OYQA 1RILA 1T44A 3ZX2A 2YNGA 3JYTA 1U2VA 2BANA 3WEEB 2YKMA 4DQSA 4KHUA 2HHXA 3OTOK 4DR4K 3H08A 1C1CA 4CHQA 2G8WA 5AQUA 3O8MA 3DLHA 1U04A 3K5OA 3G0ZA 4DQ8A 3SI6A 3FZLA 4FZZA 1KVCA 3AO1A 2OPSA 4M3YA 4JI1K 3B6OA 1NMNA 4N76A 2FC0A 4B1VA 2KZMA 5J2NA 3A5MC 3RSEB 3CFPA 2QW9A 2YJFA 1YTUA 1N6QA 2YV0X 1E3MA 3J80O 3CCEN 1HQEA 2E4LA 4BC5A 3K5MA 3L2WA 3SPZA 3A5LC 4DR6K 3ZSXA 3RR7A 2GUIA 3EN9A 2PZSA 3RMAA 1ASUA 4GVMA 4C23A 5IWAK 4DCHA 4B9SA 3DRRA 5I9EB 3FFIA 4N5SA 4CHPA 4DF8A 3V9ZA 5JMVA 1NGIA 2DFFA 4CERA 5GAGP 3K0SA 2I7NA 3MN7A 3C94A 5FPDA 4BE1A 4BRNA 4B9UA 4C8NA 4DMNA 4CEEA 4ELVA 3BDPA 3AO4A 4H5TA 4EZ9A 1OH7A 3CFOA 1ZXOA 4KH6A 4IO8A 2P9IB 4N47A 1M90O 4M3ZA 2IDOA 4YNQA 3MXIA 4AM7A 4B1XB 4CW7B 3TAPA 4DSKA 4JS4A 4IO9L 3M8QA 1QHAA 4B1YB 3E1YA 3CM5A 3G71N 2VWJA 1G99A 1YUWA 2W6LA 4CJWA 3SV4A 4WQ5A 4JN4A 1TYQB 2Q0RA 3SUQA 1BL3A 4DKWA 3O9UA 4JI2K 4BRKA 5DK5A 4DSFA 2V7YA 2XY8A 3U8XA 4FOEA 3LZIA 3EO3A 4I6MB 4JKHA 1SZ2A 3S3NA 4CHZA 2RN2A 4JK8A 3LDOA 1VSEA 4GMJB 2D0AA 1X3NA 3KZBA 5LMUK 4FJGA 3VTIA 2QWPA 1YVNA 1QE1A 3V1OA 4CIGA 5H1SQ 4BRAA 3OJUA 1QSLA 2IOCA 3DXMA 2LSNA 1HKBA 4DV5K 3NE6A 1HUXA 3SQ2A 4JRPA 4DR1K 1S1XA 1QZ6A 5JLHA 3VA0A 4DSJA 3J7ZO 2YJEA 4DUZK 3CJ1A 1Q82O 3KLFA 3K2PA 1S3XA 1GLCG 3KD5E 4FLXA 2RF2A 1JL1A 4X66K 4RW9A 5M1NA 4FOIA 4KKOA 2RPIA 3AVHA 3DLRA 1IH7A 4O5BA 1WBDA 3HVTA 3ZLJA 4HUFA 3FZMA 3G25A 1VQLN 3AVNA 4CECA 1FKPA 4KREA 3AV9A 3C7NA 3L2VA 3NF6A 4BC4A 1W7AA 3NVKA 4V19S 1ILYA 3VOVA 2DTUA 1Y97A 2E8AA 3VF2A 4BY9C 2Z1IA 5C0YA 4BRMA 1RT6A 3AVIA 3ENBA 1BGXT 5AZIB 3H6EA 2ZM6K 4IBNA 1IKVA 3QNOA 4OVLA 3C95A 1GOAA 4I7FA 4DWIA 4CGHA 4JLHA 2E6MA 4HTUA 2E1ZA 4BWJA 2HHWA 4EP5A 1R0AA 3DI6A 4Z4CA 5AZJA 1BA0A 4CJUA 4O55A 4CJTA 3RVCA 4RW7A 1XWLA 2FF3B 2P9KA 1MWMA 4A2BA 2H3GX 4E7IA 5D3GA 3VEXA 3D2EB 2KFZA 1JLFA 1KQSM 3EEQA 4CHOA 4OPHA 3FFKB 1NWKA 5T7BA 3KWGA 2GTDA 1L3TA 1S1TA 5HRRA 1RTJA 3O9QA 3R8EA 1JLAA 5AQWA 2VYPA 5CE3A 4CF9A 1S72N 3GG4A 1KAYA 4BGBA 4JI4K 3CERA 4CEQA 3ID8A 1T6CA 4O8UA 2W40A 2GWJA 3CQ8A 2UUBK 2ZJQL 1K6YA 3CQYA 3MCAB 1QQNA 2UU9K 3QFUA 1GLBG 4ILHA 4QOZB 1E4FT 4ISEA 5JLFA 4IKFA 4YDUA 4UQGA 4DR7K 3RMDA 3CPEA 2BGGA 4DSLA 4DV6K 4DTMA 4DTRA 2JWKA 3OS1A 1SV5A 4BR7A 2WBNA 1BHLA 3TTCA 5AQKA 1IBLK 3T7ZA 4GV6A 1D9FA 1ESVA 2CGJA 3VQ4A 2D5RA 2GUPA 3OYDA 4OKEA 1N32K 3L6QA 5KGXA 2QK9A 4M3XA 3KJVA 1VQON 1WSEA 2WOMA 1CLQA 4WCEL 3D7EO 3O08A 4H0YB 4H5WA 3F9KA 4U7BA 5AQFA 4F4KA 1BDGA 3AVLA 4ICLA 1U47A 3CHWA 3BY5A 2OZMA 3CJ7A 4GVEA 2P9IA 3D0PA 3DLKA 1CZAN 1YHQN 4CZGA 3QO9A 4FJ5A 1TKZA 3OYAA 2P5OA 3LM9A 1UA0A 4GY2B 3ATVA 3SCXA 5AR0A 2XY5A 3PX6A 5BPMA 3L4IA 3H1QA 1HPMA 4LH4A 3UKRB 1QQCA 3SPYA 1DT9A 1JKHA 4LY7A 4U67L 4C1NI 3U6FA 3R9PA 1WSHA 3MN9A 2PYLA 1TVRA 3VF6A 2QXLA 4FVMA 3KK2A 1TYQA 1XHZA 4M3TA 1K8AO 1WUAA 5CZ1A 3AVFA 5E41A 4E7LA 3KK1A 1Y64A 5FROA 4YHHK 2RE2A 4I6MA 3V4IA 2OPQA 1D4XA 2KW4A 4JKBA 2ITGA 4CBWA 4CEBA 1NGHA 2Q97A 1XC9A 4F3TA 1BQNA 3CC7N 2QWLA 4ZHRA 1TUYA 2Z1HA 3QBWA 4CF1A 1C0GA 3QDKA 3QFPA 3PIPL 3ZETB 3CIPA 3U3YA 3N4QA 3HXMA 4MFBA 1P90A 3S41A 3NGZA 3A8YA 2GV9A 5J1EA 2OPPA 2G8IA 3TSUA 5AQSA 3CCUN 3ZEUA 5KRTA 3SAGA 3B8AX 4PWDA 5GINA 3AO2A 3U9DA 2E88A 3HP9A 3VQ7A 4CI6A 2Q2RA 5F2RA 1BI4A 3JS6A 2PAVA 4PKGA 1VQ8N 1RTDA 1D8YA 3WXIA 4C1NK 4H5NA 3FZFA 3P83D 4E89A 4B1WB 4BR0A 3LWLA 3CJCA 2QWQA 3UKUA 1QTMA 1KSPA 3SMPA 5M1FA 3ATUA 1ZBUA 3AVKA 4W5NA 3EZ5A 5AQGA 4BQZA 1RDAA 4CJ5A 1XMQK 4IZ9A 1EWRA 3OVNA 3NAEA 3OBWA 3ZSWA 1DLOA 2E2QA 4BR4A 2O8FA 5BR9A 3SZ2A 1L3VA 1GLFO 5B8HA 2VQEK 3ZSVA 4DQQA 4A5AA 4CEFA 4CEAA 4Q5VA 1X9JA 3NH0A 2WTUA 3GBTA 3NFAA 4M45A 4CZJA 4LF8K 4IG3A 3NDKA 3CG7A 3KLHA 3GE1A 2WFBA 1JXBA 3D2EA 1RT5A 3MEEA 4KH5A 3ZX3A 4J2EA 1K9MO 1S6PA 1NOZA 4FWPA 4CJQA 4O44A 4F8RA 4DV1K 3VQ6A 1TKXA 1T3VA 3ZT4A 3IKMA 4B8CA 3TAGA 4NCAA 1WLJA 3VQQA 4HVJA 1WN7A 4AF1A 4FLUA 3QLHA 4CGGA 3WXKA 3QMLA 4CHYA 1TK0A 3LWMA 4DTNA 4IFVA 3HM8A 4A59A 3I56N 1KAXA 2E2OA 1REVA 2P1JA 1JLQA 2B5JA 5J2QA 4HUEA 5HOOA 4OX9K 1J5OA 5KPZA 5F1XA 1XC3A 3AAQA 4JKGB 3TAFA 4FK2A 1RNHA 3DRSA 4H0TB 4M3UA 3IMXA 3T1YK 3U4LA 1LAWA 1VQ5N 1JCFA 3CM6A 3R1XA 5KPRA 1NK6A 3HYFA 1JLBA 4KV8A 4KB1A 2QWNA 1LV5A 5CHIA 3V9SA 3OYNA 1VQKN 4KTQA 3UIQA 1UAXA 3IUCA 3SK3A 1EWQA 4WFAL 4FWLA 3VEZA 3LAKA 4BDYA 4B3RK 5EVZA 2FBVA 3OS2A 1ZBHA 1VSFA 3VQPA 1MU2A 2YCHA 2WUSA 2IVNA 5FDLA 3VEYA 2BDPA 3DXKA 4AQYK 4DU1A 1NJIO 2QWOA 4CZLA 1WSFA 3QERA 3HSCA 5AQJA 3TARA 3NH2A 5GAHP 3C0BA 3CCJN 1SUQA 4FWOA 4KHYA 3MMVA 1KRPA 2QA4N 2HNZA 1S1WA 3ITHA 3ULDA 4EIAA 2X78A 1IKWA 2GWKA 1LW2A 4H03B 3BZCA 3VGKA 1NNEA 1OH8A 1SL1A 2UUCK 1TUUA 1ZYQA 3UKRA 1Z26A 5ADXA 3THWB 1BCMA 2Q36A 4EAHD 3KWIA 4FM1A 3A2FA 2P9NB 2HBKA 4N56A 1YXQA 3AAPA 2XY6A 1Q81O 2HF3A 2GBZA 3ULEA 4WFNL 4JI7K 5JICA 4HCCA 2OPRA 1NGEA 3D2FB 3CCSN 4DTOA 5KI6A 1X3MA 4AHVA 5GIPA 2I5JA 4MLEA 3SV3A 4QAGA 1VQPN 4LF4K 4B1UB 3SJJA 3VQ5A 4WE1A 4RW8A 4JK9A 4OJRA 4CJ7A 4TSXA 4X65K 4NLCA 5K14A 5C2DA 3L8BA 3VQEA 3HOTA 5C24A 3FR0A 3NF7A 1YJWN 4Z4EA 3VETA 1HNWK 3ZETA 4BACA 3OYMA 1ZC6A 1VQ7N 4CBXA 4XH5A 3S3OA 3AA3A 2ZQBA 3AA4A 4CF2A 4DV4K 4OGCA 3ZT0A 4CJLA 3U3GA 4Z0UA 4AM6A 4E1JA 3P1GA 1VSIA 2NLXA 3HL8A 1KVBA 1GOCA 3MEDA 3OYHA 4F2RA 3T1AA 1U49A 3I55N 4C8MA 4KBOA 4FJMA 4ELUA 3C6TA 4CK1A 4KI4A 3KK7A 1S9EA 5HROA 3CCRN 3TTDA 3O3HA 1S5JA 5CYMA 4WQ4C 2ZGZA 4FCYA 1YAGA 4DLGA 4CFBA 2OTJN 1BOTO 2ASOA 3WNHA 1L3SA 1LWEA 3O4NA 1ZBSA 3VERA 5HP1A 2RKIA 2KKZA 4HCBA 4PKHA 2E5LK 1FW6A 1X1PA 3LDPA 3OYLA 2VG6A 4E7HA 1J54A 1Q86O 4X62K 3VMFB 1IBKK 5BRHA 1NKEA 1K8KA 4GV3A 1RDUA 1JCGA 3O3FA 1J53A 3SUOA 1VK0A 3L3UA 4H0VB 3L0QA 1ITGA 3PSFA 1HJRA 1A5XA 1NG9A 2CH6A 1BCOA 3V9XA 4OPAA 4RCHA 4MLHA 3SBTA 4PA1A 5SZTA 4M3RA 2A42A 1MA9B 3LZJA 4DV3K 4BR9A 4C8KA 4FYDA 1Q18A 4CE9A 4C8LA 4FWRA 4FM0A 2HSTA 3DOLA 3SAFA 4BDPA 4BVPA 2NRHA 4BE2A 4DU4A 5M1PA 4KTZA 4ZTFA 2E20A 4DSIA 1NGDA 4JNEA 1GLEG 3MXMA 2AA4A 2ATQA 1GLDG 1HNVA 3WNEA 5HRPA 4WFBL 4JV5K 5KPTA 4DV0K 4DV2K 1VSJA 3EZWA 3D6RA 2A1SA 4JK7A 4DFKA 2O8CB 4FWNA 4NYFA 2VWKA 4JKGA 4KFBA 3CMAN 1CZBA 1QQOA 4F9OA 3DWLA 2VWBA 1T7PA 3K58A 4JD2B 4DQPA 4JKEA 3I8DA 4RTFD 2AP1A 2W42A 4FK0A 4FZXC 2I7PA 3J8AA 2VGMA 4JKDA 4CFAA 3VQ9A 4FZYA 3PV8A 3HT3A 2X74A 3PSIA 2F4VK 3LDLA 1RBRA 4XH4A 1CZ9A 4LFBK 3SQ0A 2YI1A 2BE2A 3THVA 4CZMA 3MK6A 5J2MA 3DMJA 1KFDA 3AY9A 4CD3A 3QNNA 1HKCA 1YJ9N 4LSNA 1KVAA 5EY4A 3WQUA 3CJAA 4RW4A 3SUPA 5BN8A 3V9WA 5JS1A 4M41A 1DGKN 1RT3A 4DV7K 3VQ8A 3CXCM 1YI2N 3SNNA 4DHYA 4F2SA 2ASMA 1KFSA 1BISA 4CGJA 1A5VA 3AA2A 4FJNA 3M8PA 1VSKA 1EETA 3ZCMA 4PL7A 1ASVA 3LANA 1YJNN 4CD1A 2W41A 4FLWA 2P9SB 3CQXA 3VQCA 3NBPA 2P9UB 1YIJN 3LDSA 3ENHA 1DTTA 1RFQA 3IG1A 3CJ9A 4O8KA 1KD1O 5FRMA 5CR4A 3OS0A 3THWA 4J2DA 4A5BA 3HBTA 4CZIA 1N33K 2P9NA 4CK3A 3O5BA 2P9PB 3AVMA 3TAMA 4E1NA 4BRIA 3WEEA 1E4GT 4KRFA 3ZYYX 3Q7BA 2G8VA 3CCQN 3TR8A 2HVIA 2WONA 4JKFA 4KHNA 1D9DA 3D2FA 3L3VA 1F21A 2GX9A 2YNHA 1WB9A 2JWLA 3SBGA 4WF9L 3TSQA 4CJ4A 3QESA 5CY4A 3RRHA 1SL0A 3AVAA 3RSEA 2NRZA 2XRIA 4H4MA 4Q0BA 2F8TA 3VPZA 5LJVA 2IVOA 4DR5K 2HMIA 2PBDA 4JHDB 3DAWA 2WC9A 4FL9A 3QIOA 1LOTB 4FW1A 4KTWA 2UXBK 1S1VA 4CFCA 3QEPA 4CIFA 4DTJA 2W6KA 5AFUH 3G10A 1HRHA 5C2FA 1HNXK 4DTUA 3F5TA 3I8BA 4B3MK 2ZE2A 3HZ6A 3ZSOA 3DLBA 3ZT2A 4LSLA 3BF1A 1QSYA 4M3WA 4FVUA 3LPTA 4Y0WA 2QTDA 3RMBA 3THXB 3LDQA 1WOQA 1MDUB 4ISFA 2J4RA 4BC2A 1RTIA 3LPUA 5FLXO 3E9LA 3V6DA 3CJBA 4JKAA 5AQIA 3DRPA 5EXWA 4FLYA 3MAQA 4DSEA 1U4BA 3L4QA 4ISGA 2QM1A 3PLAA 2D0OA 1TV6A 4J2BA 1VQ4N 4GW6A 4O0IA 4CJKA 1QS4A 3F73A 1VRTA 2D0PA 4BRGA 4IFEA 2NUBA 3CETA 4E0DA 2HMPA 3L2RA 3OHRA 1IBMK 4OKJA 2NRVA 3LL3A 2V52B 3NGYA 3TU5A 4BG8A 3O4WA 4UY8O 3D45A 4BQLA 3OYKA 3B6PA 3PO4A 1HR0K 4JYAK 3HPHA 3HVRA 4FK4A 2E1YA 2GELA 3OJSA 3EE8A 1SAZA 3HTVA 4CCHA 4RWTA 2OTLN 2ITMA 1TL3A 3P31A 3VTHA 2IS3A 4NO7A 3BUZB 4BC3A 1VHXA 5LY3A 2P5GA 2UXCK 3O1WA 2NNWA 4A62A 4KHWA 1RBUA 2JGUA 4CGFA 1XQSC 1HPZA 4XIUA 5HLFA 4B9VA 2OZSA 3PX0A 1QHTA 3N4PA 4KPYA 2HF4A 3SMSA 2VG7A 1Q8IA 5SWMA 3MEGA 2G8UA 4JAXA 2IAJA 5DM7L 4JD2A 3VQAA 1RGIA 4DF4A 3NMUA 1LCUA 4CJSA 2R7YA 4YOUA 4B9LA 3GOIA 4IEIA 2CH5A 5AQHA 1QVGM 4MO4A 3O9RA 3OYBA 5AQVA 1NKBA 3MCPA 4RG8A 3DLGA 2HHSA 2DFEA 1Z25A 4CHNA 3TSPA 2E6LA 4FWSA 3VN5A 1IKXA 3O3GA 4KAZA 1C0TA 5FPEA 1NLVA 4IJNA 4JI3K 3CYMA 1Q9YA 3E01A 1TL1A 5AZIA 1SKSA 2F8SA 3WXLA 5DM6L 4BRPA 4DTSA 3QINA 3CD6N
chains in the Genus database with same CATH topology
1YVUA 3NE6A 1S6QA 2OA8A 3L2UA 3SQ2A 4JRPA 5C42A 4IFYA 1S1XA 1ZBIA 4HCCA 4CEZA 2EHGA 2OPRA 4OGEA 4DSJA 3VA0A 4DTOA 1HMVA 2B6AA 5KI6A 2Y1IA 4AHVA 4CEOA 2I5JA 4BE0A 3SV3A 1WNSA 4QAGA 3KLFA 3ISNC 4FJ9A 1ZBFA 3K2PA 3KK3A 1TAUA 4I2PA 3SJJA 4FLXA 2RF2A 3VQ5A 3KD5E 3BGRA 4WE1A 4RW8A 3ZSRA 2A1RA 3S9HA 4OJRA 1JL1A 4FJXA 4RW9A 4TSXA 1ASWA 3LP1A 3AVGA 4KKOA 2RPIA 5K14A 3AVHA 3DLRA 1IH7A 4O5BA 3NCIA 3L8BA 3HVTA 4O0JA 1T8EA 4HUFA 4OKKA 3VQEA 1W0HA 3AVNA 3KKRA 1FKPA 4CECA 1T05A 5C24A 3NF7A 3AV9A 3L2QA 4KREA 5FRNA 4Z4EA 1JLGA 2HNYA 3L2VA 3NF6A 3LP3A 3OYMA 4BACA 3V1RA 2DTUA 3S3OA 3AA3A 1Y97A 3AA4A 2ZQBA 2YNIA 1RT2A 4MQ3A 4OGCA 4CJEA 4CF2A 3ZT0A 4CJLA 3U3GA 2Z1IA 4Z0UA 3NF8A 5I3UA 3NHGA 3P1GA 1RT6A 1VSIA 3AVIA 1RBVA 1NJXA 1BGXT 4OPKA 3HL8A 1C6VA 4IBNA 2D0BA 1IKVA 4DS4A 3QNOA 1KVBA 1GOCA 3MEDA 4OVLA 3C95A 1GOAA 4I7FA 4CEDA 3NH1A 3OYHA 1UA1A 3RR8A 4DWIA 4F2RA 4M42A 4CGHA 4JLHA 4E1MA 2G8FA 3T1AA 2E6MA 1U49A 1IKYA 2IGIA 2YHAA 4HTUA 1TK8A 1LAVA 4BWJA 4K8XA 2HHWA 1NJZA 4CJFA 2P51A 2Z1JA 4C8MA 4EP5A 3S3MA 1R0AA 1N5YA 4FLVA 4QCLA 3DI6A 4Z4CA 4FJMA 4CJUA 4C8OA 3C6TA 4ELUA 4CK1A 4O55A 3AVJA 4CJTA 1EKEA 3KLIA 1XWLA 4RW7A 3HP6A 4DFJA 4E7KA 1T03A 4KI4A 1S9EA 4OLBA 4B3OA 1C0MA 5HROA 3DM2A 3NGIA 2PY5A 1RT4A 1WSGA 2JLEA 3O3HA 3V1QA 1S5JA 4E7IA 5D3GA 3QETA 5CYMA 5C25A 1RTHA 1QSSA 2KFZA 4FCYA 4I2QA 4DLGA 4CFBA 1JLFA 4J2AA 2B4JA 3O4QA 3HPOA 5J2PA 4OLAA 3WNHA 4E19A 4CHOA 1L3SA 4FJ8A 1LWEA 2YNFA 5T7BA 1YT3A 3O4NA 3SQ4A 1FKOA 2QKBA 5HP1A 1L3TA 1S1TA 5HRRA 3OYJA 2RKIA 1RTJA 4DTPA 3M8SA 1HQUA 3RTVA 4DFPA 4HCBA 3TANA 4EP4A 3LALA 1IG9A 1CXQA 2KFNA 3ZT3A 1X1PA 3OYLA 2VG6A 4E7HA 1J54A 1JLAA 1BIZA 2X6SA 3TAEA 1WAFA 3HPGA 1NKEA 1RDDA 4CF9A 3O3FA 1J53A 4LH5A 3SUOA 1VK0A 3RWUA 2KTQA 3L3UA 1NK9A 1ITGA 1HJRA 1A5XA 4Y1CA 4CEQA 4DS5A 4PUOA 3AO3A 3MECA 4CK2A 4AH9A 1BCOA 1RDBA 3V9XA 2YHBA 3LP0A 3CFRA 2VG5A 3CQ8A 3T19A 2DY4A 1K6YA 4PA1A 5SZTA 1RT7A 3KLGA 2G8HA 4M3RA 3TWHA 3DLEA 3LZJA 1X9SA 1XHXA 4C8KA 4QOZB 3DOKA 4N41A 4IKFA 2D0CA 1RBTA 4UQGA 4FYDA 4CE9A 3RMDA 4C8LA 1B9DA 3I0SA 2BGGA 1J9AA 4DSLA 4DTMA 4DTRA 3LP2A 3ZSQA 4AHRA 4FM0A 3DOLA 3OS1A 1SKWA 1NK5A 2QKKA 4B9MA 4BDPA 4O4GA 1SV5A 3QEIA 1EX4A 1BHLA 3OYGA 4BE2A 4DU4A 2KQ2A 2XO7A 1HNIA 4KTZA 3V81A 3KD1E 4DQIA 4ZTFA 4Z4FA 3QEWA 1UOCA 1C1AA 1D9FA 4DSIA 1YTAA 2HHVA 3MXMA 3IS9A 1Q9XA 1RDCA 3VQ4A 1LW0A 1TGOA 2ATQA 2D5RA 1HNVA 3OYDA 4OKEA 3WNEA 5HRPA 4NYNA 1RBSA 1VSJA 4FW2A 5KGXA 2QK9A 2A1SA 4M3XA 3KJVA 4DFKA 3QEVA 4ID5A 4NYFA 4JS5A 1WSEA 1KCFA 2VWKA 2WOMA 1CLQA 1KTQA 1W9HA 4KFBA 1L5UA 1CZBA 1X9MA 4FLTA 3NF9A 3T3FA 1TKTA 1T7PA 3HO1A 1TAQA 3F9KA 3K58A 1NOYA 3WNFA 2W42A 3I8DA 3AVLA 2XHBA 4DQPA 4F4KA 4FK0A 4FZXC 4ICLA 1U47A 1U48A 4HUGA 4CFAA 2OZMA 3VQ9A 4FZYA 4PQUA 3D0PA 3AO5A 4B08A 3HT3A 3PV8A 1CXUA 3MXJA 2X74A 1LWCA 1VSMA 3DLKA 4Z4HA 4OPJA 4K8ZA 1RBRA 4F3OA 3QO9A 1CZ9A 3AA5X 4FJ5A 1TKZA 1JL2A 4ID1A 4Y1DA 4DG1A 3OYAA 3SQ0A 2P5OA 1UA0A 2BE2A 3THVA 1NJWA 3SCXA 2XY5A 3PX6A 4CIEA 5J2MA 1C0UA 3JSMA 2FBTA 3DMJA 1KFDA 2HHUA 3KIOA 3QNNA 4LH4A 4LSNA 3OYFA 1KVAA 1QQCA 3SPYA 2HHQA 1JKHA 4LY7A 4KHQA 3OYIA 3AVBA 4RW4A 3U6FA 3SUPA 1WSHA 3V9WA 5JS1A 4M41A 4FJJA 1RT3A 2PYLA 1TVRA 2HNDA 3VQ8A 1WSIA 4FVMA 3KK2A 3SNNA 4DU3A 4F2SA 1XHZA 3EY1A 1WSJA 1KFSA 3OYCA 1BISA 5HBMA 3HSTB 4CGJA 1A5VA 4M3TA 3AA2A 5CZ1A 4FJNA 4IDKA 3AVFA 3M8PA 1VSKA 5CYQA 1EETA 3ZCMA 1TKDA 2Z1GA 1ASVA 3LANA 1UWBA 3VQDA 3OYEA 1ZBLA 1FXXA 2DFHA 5E41A 4E7LA 3KK1A 5FROA 3ASMA 4FLWA 1NK8A 3ZSZA 3AVCA 4NCBA 3VQCA 3V4IA 2OPQA 3SUNA 4AHSA 3NBPA 3KLEA 2KW4A 3PX4A 4B9NA 4W5RA 4YFUA 3RRGA 2ITGA 3LDSA 4CEBA 1DTTA 3IG1A 4LD0A 2XY7A 3PY8A 4W5OA 3OS0A 1XC9A 5KGWA 4DFMA 5FRMA 1BQNA 4J2DA 4I9LA 5HRNA 1B92A 4KO0A 4F3TA 4HHTA 3TI0A 4CK3A 4ZHRA 4PY5A 1A5WA 4CGIA 1NJYA 3M8RA 4Z4IA 3IAYA 2AJQA 2Z1HA 4CF1A 3AVMA 3TAMA 1VRUA 4E1NA 3C6UA 4KRFA 3U3YA 1BQMA 3HXMA 2F96A 2IC3A 3DYAA 4MFBA 2G8VA 3TR8A 3NGZA 4JRQA 2HVIA 5J1EA 2GV9A 2WONA 2OPPA 3RMCA 4KHNA 3V9UA 1D9DA 3K5LA 3SQ1A 2G8IA 2PYJA 3L3VA 3SYZA 1F21A 2G8KA 2X6NA 4Z4GA 2YNHA 1XI1A 3K59A 5KRTA 4PWDA 1DTQA 3VA3A 4FJKA 2ZD1A 3HM9A 4CJ4A 3QESA 5CY4A 3AO2A 3RRHA 1SL0A 4I9QA 3HP9A 3VQ7A 3AVAA 1BI4A 1NK4A 1RTDA 2XRIA 1D8YA 4H4MA 3ZSYA 3P83D 1G15A 3K5NA 4E89A 4FLZA 2F8TA 4Q0BA 4E3SA 1HYVA 3LWLA 2HB5A 4H4OA 2HMIA 4RW6A 5EU7A 1QTMA 4ZTJA 5KRSA 1KSPA 2EX3A 3VQBA 3KKSA 4DTXA 1RT1A 1S9GA 1ZBUA 3AVKA 4R5PA 1I39A 4FM2A 3QIOA 2Y1JA 3I0RA 3KTQA 4FW1A 3EZ5A 2FBYA 4KTWA 4W5NA 1VSHA 4KB0A 1RDAA 4CJ5A 1S1VA 4CFCA 3QEPA 3OVNA 4L8RB 3NAEA 3ZSWA 4CIFA 4DTJA 3HK2A 1DLOA 1LWFA 3G10A 1HRHA 4AHTA 1U45A 4DTUA 1X9WA 4B9TA 1GOBA 1HYSA 2OYQA 1RILA 4W5TA 5DMRA 3ZT1A 2ZE2A 3SZ2A 3ZSOA 1B9FA 2YNGA 1L3VA 3DLBA 4FXDA 3ZT2A 4LSLA 3JYTA 2BANA 1QSYA 4EZ6A 4M3WA 4CGDA 2YKMA 4DQSA 4KI6A 3LPTA 4KHUA 2HHXA 3ZSVA 4DQQA 4CEFA 3H08A 1C1CA 4CHQA 1JXEA 4CEAA 3RMBA 4Q5VA 2G8WA 3NH0A 3NFAA 4M45A 5HRSA 3DLHA 2Q3SA 1U04A 3K5OA 4IG3A 3PUFA 3NDKA 1RTIA 3G0ZA 3LPUA 3CG7A 3V6DA 3KLHA 3SI6A 4FZZA 3DRPA 1KVCA 3AO1A 2OPSA 2O4IA 4M3YA 1JXBA 4FLYA 1SL2A 1RT5A 3MEEA 3MAQA 4DSEA 1U4BA 3B6OA 4J2EA 4N76A 1S6PA 2FC0A 2KZMA 4W5QA 5J2NA 1BI4B 1NOZA 1TV6A 3CFPA 4F8RA 4CJQA 4O44A 4J2BA 1YTUA 4GW6A 4O0IA 3VQ6A 1TKXA 1N6QA 2YV0X 3ZT4A 4B8CA 4CJKA 3TAGA 1QS4A 1IO2A 3F73A 1VRTA 4NCAA 4H8KA 1WLJA 2NUBA 1HQEA 2E4LA 3K5MA 5CZ2A 4E0DA 3L2WA 3SPZA 3VQQA 4CF8A 4HVJA 3L2RA 1WN7A 1RCHA 4OKJA 1O1WA 3ZSXA 4FLUA 3RR7A 4CF0A 3P5JA 3QLHA 4BDZA 2GUIA 4G1QA 3ALYA 4CGGA 2PZSA 3RMAA 1ASUA 3NGYA 4GVMA 4CJVA 4B9SA 3DRRA 3FFIA 4CHYA 1TK0A 3LWMA 4N5SA 4DTNA 4IFVA 4CHPA 4ELTA 3D45A 4DF8A 3V9ZA 1REVA 2P1JA 3OYKA 1JLQA 2B5JA 2YKNA 5JS2A 5J2QA 3B6PA 1HYZA 4CJRA 2KZZA 3PO4A 4HUEA 2DFFA 4CERA 3HPHA 3TABA 1J5OA 4FJ7A 3HVRA 4AHCA 4FK4A 2HHTA 3OJSA 2FBXA 3C94A 4CFDA 3TAFA 4FK2A 4CCHA 1RNHA 1WAJA 3DRSA 4BE1A 3QEXA 1TL3A 4B9UA 4C8NA 1EXQA 4M3UA 2HW3A 4DMNA 4CEEA 4ELVA 3WNGA 3BDPA 1NK0A 3AO4A 1JLEA 1LAWA 4AHUA 2IS3A 4EZ9A 3CM6A 1JLCA 3CFOA 4CESA 1NK6A 1S1UA 3HYFA 1JLBA 4KV8A 1C1BA 4KB1A 1I3AA 4N47A 1LV5A 2P5GA 1SKRA 4DQRA 3V9SA 3OYNA 1VSLA 4KTQA 1L3UA 4M3ZA 3UIQA 4FJIA 2IDOA 4KHWA 1RBUA 1UAXA 2ETJA 2JGUA 4CGFA 4CJ3A 4YNQA 1HPZA 3TAPA 3MXIA 3K57A 1BIUA 4DSKA 2HVHA 5KTQA 4JS4A 3LAKA 4XIUA 4BDYA 3M8QA 1D5AA 2FBVA 3OS2A 4B8AB 5HLFA 4B9VA 2O4GA 3CM5A 2OZSA 3PO5A 3PX0A 4E7JA 1QHTA 2VWJA 1ZBHA 4KPYA 1VSFA 3EYZA 3VQPA 1MU2A 2VG7A 1Q8IA 5FDLA 3QIPA 5SWMA 3LAMA 3MEGA 4IG0A 2IAJA 4CJWA 1KLNA 3SV4A 2G8UA 2BDPA 4FJLA 4DU1A 4NCGA 1WSFA 3QERA 3SUQA 3VQAA 3TARA 4DF4A 3NH2A 4CJSA 1BL3A 2R7YA 4B9LA 1FK9A 1KLMA 1SUQA 4KHYA 4CJPA 4BWMA 3OYBA 5DK5A 1NKBA 2QXFA 5I42A 4DSFA 4RG8A 1KRPA 2XY8A 1NK7A 3DLGA 2HNZA 2DFEA 1S1WA 1Z25A 3ITHA 4CHNA 4DLEA 3LZIA 3HJFA 4AILC 3ULDA 2E6LA 4FJHA 4KHSA 3VN5A 2X78A 1IKXA 3S3NA 3O3GA 1EP4A 1IKWA 1C0TA 2RN2A 4CHZA 4KAZA 1LW2A 1VSEA 4GMJB 1SL1A 2D0AA 3OY9A 3CYMA 1ZYQA 1Z26A 1VSDA 3E01A 1BCMA 3TAQA 1Q9YA 4FJGA 1TL1A 1QE1A 3V1OA 4CIGA 4FM1A 1TK5A 3A2FA 3OJUA 1SKSA 1NKCA 1QSLA 2F8SA 4N56A 2HHSA 3IRXA 4DTSA 2XY6A 3QINA 2IOCA 2LSNA 2GBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVU A;  3NE6 A;  1S6Q A;  2OA8 A;  3L2U A;  3SQ2 A;  4JRP A;  5C42 A;  4IFY A;  1S1X A;  1ZBI A;  4HCC A;  4CEZ A;  2EHG A;  2OPR A;  4OGE A;  4DSJ A;  3VA0 A;  4DTO A;  1HMV A;  2B6A A;  5KI6 A;  2Y1I A;  4AHV A;  4CEO A;  2I5J A;  4BE0 A;  3SV3 A;  1WNS A;  4QAG A;  3KLF A;  3ISN C;  4FJ9 A;  1ZBF A;  3K2P A;  3KK3 A;  1TAU A;  4I2P A;  3SJJ A;  4FLX A;  2RF2 A;  3VQ5 A;  3KD5 E;  3BGR A;  4WE1 A;  4RW8 A;  3ZSR A;  2A1R A;  3S9H A;  4OJR A;  1JL1 A;  4FJX A;  4RW9 A;  4TSX A;  1ASW A;  3LP1 A;  3AVG A;  4KKO A;  2RPI A;  5K14 A;  3AVH A;  3DLR A;  1IH7 A;  4O5B A;  3NCI A;  3L8B A;  3HVT A;  4O0J A;  1T8E A;  4HUF A;  4OKK A;  3VQE A;  1W0H A;  3AVN A;  3KKR A;  1FKP A;  4CEC A;  1T05 A;  5C24 A;  3NF7 A;  3AV9 A;  3L2Q A;  4KRE A;  5FRN A;  4Z4E A;  1JLG A;  2HNY A;  3L2V A;  3NF6 A;  3LP3 A;  3OYM A;  4BAC A;  3V1R A;  2DTU A;  3S3O A;  3AA3 A;  1Y97 A;  3AA4 A;  2ZQB A;  2YNI A;  1RT2 A;  4MQ3 A;  4OGC A;  4CJE A;  4CF2 A;  3ZT0 A;  4CJL A;  3U3G A;  2Z1I A;  4Z0U A;  3NF8 A;  5I3U A;  3NHG A;  3P1G A;  1RT6 A;  1VSI A;  3AVI A;  1RBV A;  1NJX A;  1BGX T;  4OPK A;  3HL8 A;  1C6V A;  4IBN A;  2D0B A;  1IKV A;  4DS4 A;  3QNO A;  1KVB A;  1GOC A;  3MED A;  4OVL A;  3C95 A;  1GOA A;  4I7F A;  4CED A;  3NH1 A;  3OYH A;  1UA1 A;  3RR8 A;  4DWI A;  4F2R A;  4M42 A;  4CGH A;  4JLH A;  4E1M A;  2G8F A;  3T1A A;  2E6M A;  1U49 A;  1IKY A;  2IGI A;  2YHA A;  4HTU A;  1TK8 A;  1LAV A;  4BWJ A;  4K8X A;  2HHW A;  1NJZ A;  4CJF A;  2P51 A;  2Z1J A;  4C8M A;  4EP5 A;  3S3M A;  1R0A A;  1N5Y A;  4FLV A;  4QCL A;  3DI6 A;  4Z4C A;  4FJM A;  4CJU A;  4C8O A;  3C6T A;  4ELU A;  4CK1 A;  4O55 A;  3AVJ A;  4CJT A;  1EKE A;  3KLI A;  1XWL A;  4RW7 A;  3HP6 A;  4DFJ A;  4E7K A;  1T03 A;  4KI4 A;  1S9E A;  4OLB A;  4B3O A;  1C0M A;  5HRO A;  3DM2 A;  3NGI A;  2PY5 A;  1RT4 A;  1WSG A;  2JLE A;  3O3H A;  3V1Q A;  1S5J A;  4E7I A;  5D3G A;  3QET A;  5CYM A;  5C25 A;  1RTH A;  1QSS A;  2KFZ A;  4FCY A;  4I2Q A;  4DLG A;  4CFB A;  1JLF A;  4J2A A;  2B4J A;  3O4Q A;  3HPO A;  5J2P A;  4OLA A;  3WNH A;  4E19 A;  4CHO A;  1L3S A;  4FJ8 A;  1LWE A;  2YNF A;  5T7B A;  1YT3 A;  3O4N A;  3SQ4 A;  1FKO A;  2QKB A;  5HP1 A;  1L3T A;  1S1T A;  5HRR A;  3OYJ A;  2RKI A;  1RTJ A;  4DTP A;  3M8S A;  1HQU A;  3RTV A;  4DFP A;  4HCB A;  3TAN A;  4EP4 A;  3LAL A;  1IG9 A;  1CXQ A;  2KFN A;  3ZT3 A;  1X1P A;  3OYL A;  2VG6 A;  4E7H A;  1J54 A;  1JLA A;  1BIZ A;  2X6S A;  3TAE A;  1WAF A;  3HPG A;  1NKE A;  1RDD A;  4CF9 A;  3O3F A;  1J53 A;  4LH5 A;  3SUO A;  1VK0 A;  3RWU A;  2KTQ A;  3L3U A;  1NK9 A;  1ITG A;  1HJR A;  1A5X A;  4Y1C A;  4CEQ A;  4DS5 A;  4PUO A;  3AO3 A;  3MEC A;  4CK2 A;  4AH9 A;  1BCO A;  1RDB A;  3V9X A;  2YHB A;  3LP0 A;  3CFR A;  2VG5 A;  3CQ8 A;  3T19 A;  2DY4 A;  1K6Y A;  4PA1 A;  5SZT A;  1RT7 A;  3KLG A;  2G8H A;  4M3R A;  3TWH A;  3DLE A;  3LZJ A;  1X9S A;  1XHX A;  4C8K A;  4QOZ B;  3DOK A;  4N41 A;  4IKF A;  2D0C A;  1RBT A;  4UQG A;  4FYD A;  4CE9 A;  3RMD A;  4C8L A;  1B9D A;  3I0S A;  2BGG A;  1J9A A;  4DSL A;  4DTM A;  4DTR A;  3LP2 A;  3ZSQ A;  4AHR A;  4FM0 A;  3DOL A;  3OS1 A;  1SKW A;  1NK5 A;  2QKK A;  4B9M A;  4BDP A;  4O4G A;  1SV5 A;  3QEI A;  1EX4 A;  1BHL A;  3OYG A;  4BE2 A;  4DU4 A;  2KQ2 A;  2XO7 A;  1HNI A;  4KTZ A;  3V81 A;  3KD1 E;  4DQI A;  4ZTF A;  4Z4F A;  3QEW A;  1UOC A;  1C1A A;  1D9F A;  4DSI A;  1YTA A;  2HHV A;  3MXM A;  3IS9 A;  1Q9X A;  1RDC A;  3VQ4 A;  1LW0 A;  1TGO A;  2ATQ A;  2D5R A;  1HNV A;  3OYD A;  4OKE A;  3WNE A;  5HRP A;  4NYN A;  1RBS A;  1VSJ A;  4FW2 A;  5KGX A;  2QK9 A;  2A1S A;  4M3X A;  3KJV A;  4DFK A;  3QEV A;  4ID5 A;  4NYF A;  4JS5 A;  1WSE A;  1KCF A;  2VWK A;  2WOM A;  1CLQ A;  1KTQ A;  1W9H A;  4KFB A;  1L5U A;  1CZB A;  1X9M A;  4FLT A;  3NF9 A;  3T3F A;  1TKT A;  1T7P A;  3HO1 A;  1TAQ A;  3F9K A;  3K58 A;  1NOY A;  3WNF A;  2W42 A;  3I8D A;  3AVL A;  2XHB A;  4DQP A;  4F4K A;  4FK0 A;  4FZX C;  4ICL A;  1U47 A;  1U48 A;  4HUG A;  4CFA A;  2OZM A;  3VQ9 A;  4FZY A;  4PQU A;  3D0P A;  3AO5 A;  4B08 A;  3HT3 A;  3PV8 A;  1CXU A;  3MXJ A;  2X74 A;  1LWC A;  1VSM A;  3DLK A;  4Z4H A;  4OPJ A;  4K8Z A;  1RBR A;  4F3O A;  3QO9 A;  1CZ9 A;  3AA5 X;  4FJ5 A;  1TKZ A;  1JL2 A;  4ID1 A;  4Y1D A;  4DG1 A;  3OYA A;  3SQ0 A;  2P5O A;  1UA0 A;  2BE2 A;  3THV A;  1NJW A;  3SCX A;  2XY5 A;  3PX6 A;  4CIE A;  5J2M A;  1C0U A;  3JSM A;  2FBT A;  3DMJ A;  1KFD A;  2HHU A;  3KIO A;  3QNN A;  4LH4 A;  4LSN A;  3OYF A;  1KVA A;  1QQC A;  3SPY A;  2HHQ A;  1JKH A;  4LY7 A;  4KHQ A;  3OYI A;  3AVB A;  4RW4 A;  3U6F A;  3SUP A;  1WSH A;  3V9W A;  5JS1 A;  4M41 A;  4FJJ A;  1RT3 A;  2PYL A;  1TVR A;  2HND A;  3VQ8 A;  1WSI A;  4FVM A;  3KK2 A;  3SNN A;  4DU3 A;  4F2S A;  1XHZ A;  3EY1 A;  1WSJ A;  1KFS A;  3OYC A;  1BIS A;  5HBM A;  3HST B;  4CGJ A;  1A5V A;  4M3T A;  3AA2 A;  5CZ1 A;  4FJN A;  4IDK A;  3AVF A;  3M8P A;  1VSK A;  5CYQ A;  1EET A;  3ZCM A;  1TKD A;  2Z1G A;  1ASV A;  3LAN A;  1UWB A;  3VQD A;  3OYE A;  1ZBL A;  1FXX A;  2DFH A;  5E41 A;  4E7L A;  3KK1 A;  5FRO A;  3ASM A;  4FLW A;  1NK8 A;  3ZSZ A;  3AVC A;  4NCB A;  3VQC A;  3V4I A;  2OPQ A;  3SUN A;  4AHS A;  3NBP A;  3KLE A;  2KW4 A;  3PX4 A;  4B9N A;  4W5R A;  4YFU A;  3RRG A;  2ITG A;  3LDS A;  4CEB A;  1DTT A;  3IG1 A;  4LD0 A;  2XY7 A;  3PY8 A;  4W5O A;  3OS0 A;  1XC9 A;  5KGW A;  4DFM A;  5FRM A;  1BQN A;  4J2D A;  4I9L A;  5HRN A;  1B92 A;  4KO0 A;  4F3T A;  4HHT A;  3TI0 A;  4CK3 A;  4ZHR A;  4PY5 A;  1A5W A;  4CGI A;  1NJY A;  3M8R A;  4Z4I A;  3IAY A;  2AJQ A;  2Z1H A;  4CF1 A;  3AVM A;  3TAM A;  1VRU A;  4E1N A;  3C6U A;  4KRF A;  3U3Y A;  1BQM A;  3HXM A;  2F96 A;  2IC3 A;  3DYA A;  4MFB A;  2G8V A;  3TR8 A;  3NGZ A;  4JRQ A;  2HVI A;  5J1E A;  2GV9 A;  2WON A;  2OPP A;  3RMC A;  4KHN A;  3V9U A;  1D9D A;  3K5L A;  3SQ1 A;  2G8I A;  2PYJ A;  3L3V A;  3SYZ A;  1F21 A;  2G8K A;  2X6N A;  4Z4G A;  2YNH A;  1XI1 A;  3K59 A;  5KRT A;  4PWD A;  1DTQ A;  3VA3 A;  4FJK A;  2ZD1 A;  3HM9 A;  4CJ4 A;  3QES A;  5CY4 A;  3AO2 A;  3RRH A;  1SL0 A;  4I9Q A;  3HP9 A;  3VQ7 A;  3AVA A;  1BI4 A;  1NK4 A;  1RTD A;  2XRI A;  1D8Y A;  4H4M A;  3ZSY A;  3P83 D;  1G15 A;  3K5N A;  4E89 A;  4FLZ A;  2F8T A;  4Q0B A;  4E3S A;  1HYV A;  3LWL A;  2HB5 A;  4H4O A;  2HMI A;  4RW6 A;  5EU7 A;  1QTM A;  4ZTJ A;  5KRS A;  1KSP A;  2EX3 A;  3VQB A;  3KKS A;  4DTX A;  1RT1 A;  1S9G A;  1ZBU A;  3AVK A;  4R5P A;  1I39 A;  4FM2 A;  3QIO A;  2Y1J A;  3I0R A;  3KTQ A;  4FW1 A;  3EZ5 A;  2FBY A;  4KTW A;  4W5N A;  1VSH A;  4KB0 A;  1RDA A;  4CJ5 A;  1S1V A;  4CFC A;  3QEP A;  3OVN A;  4L8R B;  3NAE A;  3ZSW A;  4CIF A;  4DTJ A;  3HK2 A;  1DLO A;  1LWF A;  3G10 A;  1HRH A;  4AHT A;  1U45 A;  4DTU A;  1X9W A;  4B9T A;  1GOB A;  1HYS A;  2OYQ A;  1RIL A;  4W5T A;  5DMR A;  3ZT1 A;  2ZE2 A;  3SZ2 A;  3ZSO A;  1B9F A;  2YNG A;  1L3V A;  3DLB A;  4FXD A;  3ZT2 A;  4LSL A;  3JYT A;  2BAN A;  1QSY A;  4EZ6 A;  4M3W A;  4CGD A;  2YKM A;  4DQS A;  4KI6 A;  3LPT A;  4KHU A;  2HHX A;  3ZSV A;  4DQQ A;  4CEF A;  3H08 A;  1C1C A;  4CHQ A;  1JXE A;  4CEA A;  3RMB A;  4Q5V A;  2G8W A;  3NH0 A;  3NFA A;  4M45 A;  5HRS A;  3DLH A;  2Q3S A;  1U04 A;  3K5O A;  4IG3 A;  3PUF A;  3NDK A;  1RTI A;  3G0Z A;  3LPU A;  3CG7 A;  3V6D A;  3KLH A;  3SI6 A;  4FZZ A;  3DRP A;  1KVC A;  3AO1 A;  2OPS A;  2O4I A;  4M3Y A;  1JXB A;  4FLY A;  1SL2 A;  1RT5 A;  3MEE A;  3MAQ A;  4DSE A;  1U4B A;  3B6O A;  4J2E A;  4N76 A;  1S6P A;  2FC0 A;  2KZM A;  4W5Q A;  5J2N A;  1BI4 B;  1NOZ A;  1TV6 A;  3CFP A;  4F8R A;  4CJQ A;  4O44 A;  4J2B A;  1YTU A;  4GW6 A;  4O0I A;  3VQ6 A;  1TKX A;  1N6Q A;  2YV0 X;  3ZT4 A;  4B8C A;  4CJK A;  3TAG A;  1QS4 A;  1IO2 A;  3F73 A;  1VRT A;  4NCA A;  4H8K A;  1WLJ A;  2NUB A;  1HQE A;  2E4L A;  3K5M A;  5CZ2 A;  4E0D A;  3L2W A;  3SPZ A;  3VQQ A;  4CF8 A;  4HVJ A;  3L2R A;  1WN7 A;  1RCH A;  4OKJ A;  1O1W A;  3ZSX A;  4FLU A;  3RR7 A;  4CF0 A;  3P5J A;  3QLH A;  4BDZ A;  2GUI A;  4G1Q A;  3ALY A;  4CGG A;  2PZS A;  3RMA A;  1ASU A;  3NGY A;  4GVM A;  4CJV A;  4B9S A;  3DRR A;  3FFI A;  4CHY A;  1TK0 A;  3LWM A;  4N5S A;  4DTN A;  4IFV A;  4CHP A;  4ELT A;  3D45 A;  4DF8 A;  3V9Z A;  1REV A;  2P1J A;  3OYK A;  1JLQ A;  2B5J A;  2YKN A;  5JS2 A;  5J2Q A;  3B6P A;  1HYZ A;  4CJR A;  2KZZ A;  3PO4 A;  4HUE A;  2DFF A;  4CER A;  3HPH A;  3TAB A;  1J5O A;  4FJ7 A;  3HVR A;  4AHC A;  4FK4 A;  2HHT A;  3OJS A;  2FBX A;  3C94 A;  4CFD A;  3TAF A;  4FK2 A;  4CCH A;  1RNH A;  1WAJ A;  3DRS A;  4BE1 A;  3QEX A;  1TL3 A;  4B9U A;  4C8N A;  1EXQ A;  4M3U A;  2HW3 A;  4DMN A;  4CEE A;  4ELV A;  3WNG A;  3BDP A;  1NK0 A;  3AO4 A;  1JLE A;  1LAW A;  4AHU A;  2IS3 A;  4EZ9 A;  3CM6 A;  1JLC A;  3CFO A;  4CES A;  1NK6 A;  1S1U A;  3HYF A;  1JLB A;  4KV8 A;  1C1B A;  4KB1 A;  1I3A A;  4N47 A;  1LV5 A;  2P5G A;  1SKR A;  4DQR A;  3V9S A;  3OYN A;  1VSL A;  4KTQ A;  1L3U A;  4M3Z A;  3UIQ A;  4FJI A;  2IDO A;  4KHW A;  1RBU A;  1UAX A;  2ETJ A;  2JGU A;  4CGF A;  4CJ3 A;  4YNQ A;  1HPZ A;  3TAP A;  3MXI A;  3K57 A;  1BIU A;  4DSK A;  2HVH A;  5KTQ A;  4JS4 A;  3LAK A;  4XIU A;  4BDY A;  3M8Q A;  1D5A A;  2FBV A;  3OS2 A;  4B8A B;  5HLF A;  4B9V A;  2O4G A;  3CM5 A;  2OZS A;  3PO5 A;  3PX0 A;  4E7J A;  1QHT A;  2VWJ A;  1ZBH A;  4KPY A;  1VSF A;  3EYZ A;  3VQP A;  1MU2 A;  2VG7 A;  1Q8I A;  5FDL A;  3QIP A;  5SWM A;  3LAM A;  3MEG A;  4IG0 A;  2IAJ A;  4CJW A;  1KLN A;  3SV4 A;  2G8U A;  2BDP A;  4FJL A;  4DU1 A;  4NCG A;  1WSF A;  3QER A;  3SUQ A;  3VQA A;  3TAR A;  4DF4 A;  3NH2 A;  4CJS A;  1BL3 A;  2R7Y A;  4B9L A;  1FK9 A;  1KLM A;  1SUQ A;  4KHY A;  4CJP A;  4BWM A;  3OYB A;  5DK5 A;  1NKB A;  2QXF A;  5I42 A;  4DSF A;  4RG8 A;  1KRP A;  2XY8 A;  1NK7 A;  3DLG A;  2HNZ A;  2DFE A;  1S1W A;  1Z25 A;  3ITH A;  4CHN A;  4DLE A;  3LZI A;  3HJF A;  4AIL C;  3ULD A;  2E6L A;  4FJH A;  4KHS A;  3VN5 A;  2X78 A;  1IKX A;  3S3N A;  3O3G A;  1EP4 A;  1IKW A;  1C0T A;  2RN2 A;  4CHZ A;  4KAZ A;  1LW2 A;  1VSE A;  4GMJ B;  1SL1 A;  2D0A A;  3OY9 A;  3CYM A;  1ZYQ A;  1Z26 A;  1VSD A;  3E01 A;  1BCM A;  3TAQ A;  1Q9Y A;  4FJG A;  1TL1 A;  1QE1 A;  3V1O A;  4CIG A;  4FM1 A;  1TK5 A;  3A2F A;  3OJU A;  1SKS A;  1NKC A;  1QSL A;  2F8S A;  4N56 A;  2HHS A;  3IRX A;  4DTS A;  2XY6 A;  3QIN A;  2IOC A;  2LSN A;  2GBZ A; 
#chains in the Genus database with same CATH topology
 1YVU A;  1S6Q A;  4K41 A;  1C0F A;  1DEJ A;  3Q7C A;  5C42 A;  4H0X B;  4IFY A;  1NGC A;  3VEN A;  2O8B B;  2VGN A;  1ZBI A;  4YOV A;  4CEZ A;  2EHG A;  4OGE A;  4L3Q A;  1NM1 A;  1HMV A;  2B6A A;  2Y1I A;  2P9S A;  4BE0 A;  1WNS A;  5AQY A;  4K0K K;  1ZBF A;  1TAU A;  4I2P A;  2P9U A;  3BGR A;  1W2B M;  5KQ8 A;  3S9H A;  1BUP A;  3H3O B;  3AVG A;  4BRO A;  4O0J A;  1T8E A;  2UXD K;  5LJW A;  3KKR A;  1T05 A;  2P9P A;  1W97 L;  2FF6 A;  5FRN A;  4NB4 A;  2HNY A;  4IOC L;  3J81 O;  3LP3 A;  3V1R A;  4MQ3 A;  4LF6 K;  3K9J A;  4MDA A;  2KLA A;  3NF8 A;  5I3U A;  3NHG A;  1KC8 O;  3R6M A;  1KAZ A;  1OKJ A;  2A41 A;  3FZK A;  1NJX A;  1C6V A;  4HWI A;  3T1H K;  2D0B A;  5JVH L;  1R59 O;  4CED A;  2FSJ A;  1ATR A;  4M42 A;  3MX2 A;  1IKY A;  2YHA A;  1TK8 A;  1LAV A;  1NJZ A;  3O1B A;  2Z1J A;  4XEI A;  4IOA L;  4QCL A;  4FLV A;  3W3D A;  4BR2 A;  4WQ4 A;  3AVJ A;  2P9L B;  4JHD A;  4DFJ A;  3CPW M;  4OLB A;  4B3O A;  1C0M A;  3DM2 A;  2PY5 A;  1WSG A;  3UB5 A;  4H5V A;  1OVY A;  5EX5 A;  4EHT A;  3QET A;  4LF9 K;  2YHY A;  3MN5 A;  5C15 A;  5AQM A;  4OLA A;  5ELZ A;  3HPO A;  5J2P A;  3T69 A;  4YOX A;  2DPN A;  2YNF A;  5BRF A;  1FKO A;  1BWF O;  5E84 A;  3WXJ A;  4DTP A;  3M8S A;  1HQU A;  3TAN A;  4EP4 A;  3LAL A;  1CXQ A;  3H45 C;  5A2Q O;  1K73 O;  2X6S A;  3TAE A;  3C7N B;  3PIO L;  4LH5 A;  2FLO A;  4LF5 K;  1QZ5 A;  4QS8 A;  3QIC A;  1NK9 A;  1EQY A;  1VQM N;  4Y1C A;  3J7A P;  4CK2 A;  1RDB A;  3FLC O;  2YHB A;  3LP0 A;  4YOW A;  2DY4 A;  5GAE P;  3NVM A;  1RT7 A;  4B9Q A;  2G8H A;  3TWH A;  3DLE A;  3K9K A;  1X9S A;  2QWM A;  4N41 A;  1NMD A;  1QQM A;  1RBT A;  2D0C A;  4IOX A;  3WXM B;  1VAZ A;  3CF5 L;  1J9A A;  1HLU A;  4M63 C;  2EWS A;  4AHR A;  3M6G A;  1SKW A;  4B9M A;  2QKK A;  3QEI A;  1EX4 A;  4JEP A;  3OYG A;  3H46 O;  2KQ2 A;  4IEE A;  3KD1 E;  2CGL A;  3VES A;  3WT0 A;  1UOC A;  1C1A A;  1YTA A;  3IS9 A;  1Q9X A;  2YHX A;  1T6D A;  1TGO A;  4Z94 A;  3HI0 A;  1OH5 A;  3ID6 A;  4H0P A;  4FW2 A;  5GIO A;  1XNR K;  5MLC Q;  1KCF A;  2KHO A;  1KTQ A;  1L5U A;  1X9M A;  4FLT A;  3NF9 A;  3T3F A;  3A5O C;  1WBB A;  4YY3 K;  1NOY A;  2QWR A;  4CZF A;  1U48 A;  1RDW X;  4IXC A;  3AO5 A;  1CXU A;  3MXJ A;  4Z4H A;  4K8Z A;  4F3O A;  1O13 A;  3AA5 X;  4ILG B;  1YF5 L;  4BRE A;  2V51 B;  1JL2 A;  4ID1 A;  4Y1D A;  4GKK K;  1XMO K;  2Q31 A;  3O80 A;  2O8D B;  4CIE A;  1C0U A;  2FBT A;  2HHU A;  3KIO A;  2HBL A;  4IDH A;  3OYF A;  2Q0U A;  1QVF M;  2IIR A;  3OYI A;  3AVB A;  5AQR A;  5TKW A;  1NGF A;  4FJJ A;  4OO1 J;  3A0I X;  3CCL N;  4DU3 A;  1WSJ A;  4JKC A;  3HST B;  1NU0 A;  3E66 A;  4IDK A;  1TKD A;  5CYQ A;  3VEV A;  2Z1G A;  1UWB A;  5C12 A;  4NXM K;  1ZBL A;  2DFH A;  1N36 K;  5AQX A;  2E2P A;  4NCB A;  3THY B;  3SLC A;  4IJA A;  2Q1N A;  1XUP O;  3A5N C;  3SUN A;  4AHS A;  3PX4 A;  4B9N A;  4W5R A;  1OVQ A;  3RRG A;  4LD0 A;  2XY7 A;  3PY8 A;  4CBU A;  5KGW A;  1V4T A;  4I9L A;  5HRN A;  4KO0 A;  3G6E N;  4HHT A;  3TI0 A;  4PY5 A;  1A5W A;  3F2K A;  5TKY A;  4CGI A;  1NJY A;  4Z4I A;  1OH6 A;  4YOR A;  5F0X A;  1BQM A;  2F96 A;  2IC3 A;  4BRH A;  2HHH K;  2O8B A;  4JRQ A;  3P38 A;  3V9U A;  2PYJ A;  4FWQ A;  3SYZ A;  2X6N A;  1KXP A;  1XI1 A;  3M1F A;  3K59 A;  1DTQ A;  2PFU A;  4BG9 A;  3VA3 A;  4JI6 K;  3HM9 A;  4FO0 A;  5BPL A;  1BU6 O;  3DJC A;  1ATS A;  1NK4 A;  3GDQ A;  3K5N A;  3CI5 A;  4FLZ A;  3MWT A;  2HB5 A;  4H4O A;  2A40 A;  4RW6 A;  5EU7 A;  5KRS A;  2EX3 A;  1N34 K;  3AGR A;  3VQB A;  4DTX A;  1S9G A;  2NRT A;  4R5P A;  1VSH A;  4KB0 A;  5AQO A;  4L8R B;  1N8R O;  3HK2 A;  1LWF A;  4H0O A;  1X9W A;  1GOB A;  4W5T A;  1I94 K;  5DMR A;  3ZT1 A;  3DLL L;  1B9F A;  1HX1 A;  4FXD A;  4NLB A;  5BPN A;  2NZT A;  3FZH A;  4EZ6 A;  4CGD A;  4KI6 A;  4H5R A;  4WYB A;  2P9L A;  5JVG L;  1JXE A;  1IV0 A;  5HRS A;  2Q3S A;  3PUF A;  3ZEU B;  2O4I A;  1SL2 A;  4MDB A;  3C6H A;  4W5Q A;  1BI4 B;  5AJ3 K;  5EOY A;  4A2A A;  1IO2 A;  4H8K A;  4X64 K;  5M1Q A;  5CZ2 A;  3UKU B;  4CF8 A;  1RCH A;  2UUA K;  1O1W A;  4CF0 A;  3P5J A;  4BDZ A;  4G1Q A;  3ALY A;  4CJV A;  4FPB A;  4ELT A;  4K43 A;  1MWK A;  2YKN A;  5JS2 A;  5M1K A;  2KZZ A;  1HYZ A;  4CJR A;  1BO5 O;  5AQQ A;  4FJ7 A;  3TAB A;  4M7X A;  4AHC A;  4IWV A;  2O8F B;  2HHT A;  1JCE A;  2FBX A;  4CFD A;  4NXN K;  1WAJ A;  3QEX A;  2HW3 A;  1EXQ A;  2HBM A;  3WNG A;  1NK0 A;  1JLE A;  4AHU A;  4PKI A;  3MWP A;  1JLC A;  4LFC K;  4CES A;  1S1U A;  2NRW A;  1C1B A;  1I3A A;  1SKR A;  4DQR A;  1VSL A;  4EFH A;  1L3U A;  4FJI A;  2ETJ A;  4CJ3 A;  2F9W A;  3K57 A;  2IVP A;  1BIU A;  3C65 A;  2HVH A;  5KTQ A;  2YHW A;  3MN6 A;  3WUH A;  2V7Z A;  1D5A A;  4KHP K;  3SJH A;  4B8A B;  5IT9 O;  2O4G A;  3PO5 A;  4E7J A;  3EYZ A;  2HOE A;  4FPA A;  3QIP A;  3JAM O;  4CZE A;  3LAM A;  4IG0 A;  1KLN A;  4BRD A;  4JI5 K;  4FJL A;  4HTL A;  4NCG A;  3F9M A;  4DB3 A;  3CCV N;  3CC2 N;  2ZGY A;  4GNI A;  5HL7 L;  1FK9 A;  1KLM A;  4CJP A;  4BWM A;  2BTF A;  4WQ5 C;  2QXF A;  5I42 A;  5BN9 A;  1NK7 A;  4DLE A;  4BRQ A;  2O8D A;  3HJF A;  4AIL C;  4KHS A;  4FJH A;  1EP4 A;  2O8E B;  1Q7Y O;  3C6A A;  3OY9 A;  1VSD A;  3VGM A;  3EKU A;  3TAQ A;  3O9S A;  2D4W A;  1TK5 A;  1NKC A;  4O5F A;  1M1K O;  3IRX A;  4LC9 B;  3IFR A;  1IJJ A;  2OA8 A;  3L2U A;  2RHK A;  4KH4 A;  3KVG A;  4EHU A;  2ZF5 O;  1V4S A;  3VGL A;  4B1Z A;  1XNQ K;  5AQP A;  1BG3 A;  4B3S K;  4CEO A;  3THY A;  3OW2 M;  4FJ9 A;  3AGK A;  3ISN C;  2ASP A;  3KK3 A;  3DXK B;  2A1R A;  3ZSR A;  3G4S N;  4FWM A;  4FJX A;  2UYT A;  1ASW A;  3LP1 A;  1YIT N;  3NCI A;  4OKK A;  3CC4 N;  1P8Z A;  1W0H A;  2QI2 A;  2BUP A;  3LDN A;  3L2Q A;  1JLG A;  2VQF K;  4QS9 A;  4A61 A;  4BR5 A;  4BVO A;  1EO1 A;  4FM2 A;  2YNI A;  1RT2 A;  4CJE A;  1HJO A;  2A3Z A;  3VF4 A;  1VQN N;  3M3Z A;  3O6W A;  1RBV A;  3OA9 A;  4OPK A;  3J7Y P;  2FSN A;  4DS4 A;  3NH1 A;  1UA1 A;  3RR8 A;  3BP8 A;  2G8F A;  4E1M A;  2IGI A;  1U2V B;  1H1V A;  4K8X A;  3U9Z A;  4K25 A;  4CJF A;  2P51 A;  3ULE B;  1N5Y A;  3S3M A;  4K42 A;  3H3N O;  4C8O A;  4A57 A;  5BRE A;  1EKE A;  3I33 A;  3KLI A;  3GL1 A;  3HP6 A;  1T03 A;  4E7K A;  5BR8 K;  3NGI A;  1RT4 A;  2JLE A;  3QBX A;  3V1Q A;  5C25 A;  1VQ9 N;  1GLL O;  3P4I A;  3VEO A;  1RTH A;  4BGA A;  1QSS A;  4I2Q A;  4J2A A;  2B4J A;  3O4Q A;  3CCM N;  4E19 A;  3EL2 A;  4FJ8 A;  2GEM A;  1SS6 A;  1YT3 A;  3SQ4 A;  2QKB A;  1DKG D;  3OYJ A;  1NBW A;  2O8C A;  4DFP A;  3RTV A;  3HRG A;  1IG9 A;  2KFN A;  3ZT3 A;  1BIZ A;  1WAF A;  3OBY A;  3HPG A;  3EE9 A;  1RDD A;  1Z05 A;  3RWU A;  2KTQ A;  5ADX H;  2NRX A;  4DS5 A;  1SQK A;  4PUO A;  3AO3 A;  3MEC A;  4AH9 A;  3CFR A;  2VG5 A;  3T19 A;  3KLG A;  3O9T A;  1XHX A;  3DOK A;  5LMN K;  4R79 A;  1B9D A;  3I0S A;  3IDH A;  4M7Y A;  3P39 A;  3LP2 A;  1U6Z A;  3ZSQ A;  3BZK A;  2NRR A;  5KQD A;  1NK5 A;  5AQT A;  4O4G A;  2XO7 A;  1HNI A;  3E9P A;  4YDU C;  3V81 A;  4DQI A;  4Z4F A;  3QEW A;  5FPN A;  5E26 A;  2HHV A;  2ZJP L;  1RDC A;  1LW0 A;  2VCP A;  4NYN A;  1RBS A;  1J5E K;  3BF3 A;  3QEV A;  4ID5 A;  3KHY A;  4JS5 A;  1W9H A;  3VEW A;  1JJ2 M;  1TKT A;  3HO1 A;  1TAQ A;  4YOY A;  1VQ6 N;  3WNF A;  2XHB A;  1K8K B;  5LL6 Z;  3EKS A;  5AFU A;  4HUG A;  4PHT X;  4PQU A;  1NGJ A;  4B08 A;  2BH1 A;  1LWC A;  1VSM A;  4OPJ A;  1HKG A;  3JXU A;  2QEX N;  4DG1 A;  1NJW A;  4DR3 K;  3JSM A;  4XH1 A;  3FE1 A;  1ATN A;  2HHQ A;  4KHQ A;  4CZH A;  4LFA K;  2HND A;  1WSI A;  4QS7 A;  4CVN E;  2FXU A;  2F9T A;  3EY1 A;  3DXM B;  3MX5 A;  3OYC A;  5HBM A;  3AAR A;  3LM2 A;  4BRF A;  3H1V X;  1HNZ K;  3FGU A;  3TPQ A;  1NGG A;  4FWK A;  1GLJ O;  2HBJ A;  3VQD A;  3OYE A;  1FXX A;  1FJG K;  5FPM A;  3ASM A;  1NK8 A;  3ZSZ A;  3AVC A;  2CGK A;  4ILJ A;  4BRL A;  4G9Z A;  3KLE A;  2O8E A;  4YFU A;  5AQZ A;  3WQT A;  3SAH A;  4W5O A;  4DFM A;  2YX6 A;  1B92 A;  2OCE A;  3UE5 A;  3MDQ A;  3M8R A;  5AQL A;  3IAY A;  2AJQ A;  5M1O A;  3BEX A;  1VRU A;  4LF7 K;  3C6U A;  2OAN A;  3HOS A;  4GV9 A;  4J8F A;  2A5X A;  3DYA A;  3W0L A;  3RMC A;  3THX A;  3K5L A;  3SQ1 A;  2G8K A;  4Z4G A;  4DUY K;  4YOT A;  3ZX0 A;  3QB0 A;  4FJK A;  2ZD1 A;  2E2N A;  4MO5 A;  3TTF A;  3E9O A;  4I9Q A;  4BRC A;  3R3L A;  4GKJ K;  1IG8 A;  4PL8 A;  2F7T A;  4JI0 K;  4JI8 K;  3ZSY A;  1G15 A;  2A6A A;  1S22 A;  5AZJ B;  4E3S A;  1HYV A;  2FSK A;  4FSV A;  5C10 A;  4ZTJ A;  2P9K B;  2D1K A;  2ZWH A;  4DR2 K;  1NGA A;  3KKS A;  4CZK A;  1RT1 A;  2ZJR L;  2Y1J A;  1I39 A;  1J6Z A;  1NGB A;  3I0R A;  1Z6R A;  1GLA G;  3KTQ A;  2FBY A;  5BRD A;  5GAD P;  3M5R A;  1BA1 A;  3ENO A;  4AHT A;  1U45 A;  3CME N;  4B9T A;  5AQN A;  1HYS A;  4B3T K;  2OYQ A;  1RIL A;  1T44 A;  3ZX2 A;  2YNG A;  3JYT A;  1U2V A;  2BAN A;  3WEE B;  2YKM A;  4DQS A;  4KHU A;  2HHX A;  3OTO K;  4DR4 K;  3H08 A;  1C1C A;  4CHQ A;  2G8W A;  5AQU A;  3O8M A;  3DLH A;  1U04 A;  3K5O A;  3G0Z A;  4DQ8 A;  3SI6 A;  3FZL A;  4FZZ A;  1KVC A;  3AO1 A;  2OPS A;  4M3Y A;  4JI1 K;  3B6O A;  1NMN A;  4N76 A;  2FC0 A;  4B1V A;  2KZM A;  5J2N A;  3A5M C;  3RSE B;  3CFP A;  2QW9 A;  2YJF A;  1YTU A;  1N6Q A;  2YV0 X;  1E3M A;  3J80 O;  3CCE N;  1HQE A;  2E4L A;  4BC5 A;  3K5M A;  3L2W A;  3SPZ A;  3A5L C;  4DR6 K;  3ZSX A;  3RR7 A;  2GUI A;  3EN9 A;  2PZS A;  3RMA A;  1ASU A;  4GVM A;  4C23 A;  5IWA K;  4DCH A;  4B9S A;  3DRR A;  5I9E B;  3FFI A;  4N5S A;  4CHP A;  4DF8 A;  3V9Z A;  5JMV A;  1NGI A;  2DFF A;  4CER A;  5GAG P;  3K0S A;  2I7N A;  3MN7 A;  3C94 A;  5FPD A;  4BE1 A;  4BRN A;  4B9U A;  4C8N A;  4DMN A;  4CEE A;  4ELV A;  3BDP A;  3AO4 A;  4H5T A;  4EZ9 A;  1OH7 A;  3CFO A;  1ZXO A;  4KH6 A;  4IO8 A;  2P9I B;  4N47 A;  1M90 O;  4M3Z A;  2IDO A;  4YNQ A;  3MXI A;  4AM7 A;  4B1X B;  4CW7 B;  3TAP A;  4DSK A;  4JS4 A;  4IO9 L;  3M8Q A;  1QHA A;  4B1Y B;  3E1Y A;  3CM5 A;  3G71 N;  2VWJ A;  1G99 A;  1YUW A;  2W6L A;  4CJW A;  3SV4 A;  4WQ5 A;  4JN4 A;  1TYQ B;  2Q0R A;  3SUQ A;  1BL3 A;  4DKW A;  3O9U A;  4JI2 K;  4BRK A;  5DK5 A;  4DSF A;  2V7Y A;  2XY8 A;  3U8X A;  4FOE A;  3LZI A;  3EO3 A;  4I6M B;  4JKH A;  1SZ2 A;  3S3N A;  4CHZ A;  2RN2 A;  4JK8 A;  3LDO A;  1VSE A;  4GMJ B;  2D0A A;  1X3N A;  3KZB A;  5LMU K;  4FJG A;  3VTI A;  2QWP A;  1YVN A;  1QE1 A;  3V1O A;  4CIG A;  5H1S Q;  4BRA A;  3OJU A;  1QSL A;  2IOC A;  3DXM A;  2LSN A;  1HKB A;  4DV5 K;  3NE6 A;  1HUX A;  3SQ2 A;  4JRP A;  4DR1 K;  1S1X A;  1QZ6 A;  5JLH A;  3VA0 A;  4DSJ A;  3J7Z O;  2YJE A;  4DUZ K;  3CJ1 A;  1Q82 O;  3KLF A;  3K2P A;  1S3X A;  1GLC G;  3KD5 E;  4FLX A;  2RF2 A;  1JL1 A;  4X66 K;  4RW9 A;  5M1N A;  4FOI A;  4KKO A;  2RPI A;  3AVH A;  3DLR A;  1IH7 A;  4O5B A;  1WBD A;  3HVT A;  3ZLJ A;  4HUF A;  3FZM A;  3G25 A;  1VQL N;  3AVN A;  4CEC A;  1FKP A;  4KRE A;  3AV9 A;  3C7N A;  3L2V A;  3NF6 A;  4BC4 A;  1W7A A;  3NVK A;  4V19 S;  1ILY A;  3VOV A;  2DTU A;  1Y97 A;  2E8A A;  3VF2 A;  4BY9 C;  2Z1I A;  5C0Y A;  4BRM A;  1RT6 A;  3AVI A;  3ENB A;  1BGX T;  5AZI B;  3H6E A;  2ZM6 K;  4IBN A;  1IKV A;  3QNO A;  4OVL A;  3C95 A;  1GOA A;  4I7F A;  4DWI A;  4CGH A;  4JLH A;  2E6M A;  4HTU A;  2E1Z A;  4BWJ A;  2HHW A;  4EP5 A;  1R0A A;  3DI6 A;  4Z4C A;  5AZJ A;  1BA0 A;  4CJU A;  4O55 A;  4CJT A;  3RVC A;  4RW7 A;  1XWL A;  2FF3 B;  2P9K A;  1MWM A;  4A2B A;  2H3G X;  4E7I A;  5D3G A;  3VEX A;  3D2E B;  2KFZ A;  1JLF A;  1KQS M;  3EEQ A;  4CHO A;  4OPH A;  3FFK B;  1NWK A;  5T7B A;  3KWG A;  2GTD A;  1L3T A;  1S1T A;  5HRR A;  1RTJ A;  3O9Q A;  3R8E A;  1JLA A;  5AQW A;  2VYP A;  5CE3 A;  4CF9 A;  1S72 N;  3GG4 A;  1KAY A;  4BGB A;  4JI4 K;  3CER A;  4CEQ A;  3ID8 A;  1T6C A;  4O8U A;  2W40 A;  2GWJ A;  3CQ8 A;  2UUB K;  2ZJQ L;  1K6Y A;  3CQY A;  3MCA B;  1QQN A;  2UU9 K;  3QFU A;  1GLB G;  4ILH A;  4QOZ B;  1E4F T;  4ISE A;  5JLF A;  4IKF A;  4YDU A;  4UQG A;  4DR7 K;  3RMD A;  3CPE A;  2BGG A;  4DSL A;  4DV6 K;  4DTM A;  4DTR A;  2JWK A;  3OS1 A;  1SV5 A;  4BR7 A;  2WBN A;  1BHL A;  3TTC A;  5AQK A;  1IBL K;  3T7Z A;  4GV6 A;  1D9F A;  1ESV A;  2CGJ A;  3VQ4 A;  2D5R A;  2GUP A;  3OYD A;  4OKE A;  1N32 K;  3L6Q A;  5KGX A;  2QK9 A;  4M3X A;  3KJV A;  1VQO N;  1WSE A;  2WOM A;  1CLQ A;  4WCE L;  3D7E O;  3O08 A;  4H0Y B;  4H5W A;  3F9K A;  4U7B A;  5AQF A;  4F4K A;  1BDG A;  3AVL A;  4ICL A;  1U47 A;  3CHW A;  3BY5 A;  2OZM A;  3CJ7 A;  4GVE A;  2P9I A;  3D0P A;  3DLK A;  1CZA N;  1YHQ N;  4CZG A;  3QO9 A;  4FJ5 A;  1TKZ A;  3OYA A;  2P5O A;  3LM9 A;  1UA0 A;  4GY2 B;  3ATV A;  3SCX A;  5AR0 A;  2XY5 A;  3PX6 A;  5BPM A;  3L4I A;  3H1Q A;  1HPM A;  4LH4 A;  3UKR B;  1QQC A;  3SPY A;  1DT9 A;  1JKH A;  4LY7 A;  4U67 L;  4C1N I;  3U6F A;  3R9P A;  1WSH A;  3MN9 A;  2PYL A;  1TVR A;  3VF6 A;  2QXL A;  4FVM A;  3KK2 A;  1TYQ A;  1XHZ A;  4M3T A;  1K8A O;  1WUA A;  5CZ1 A;  3AVF A;  5E41 A;  4E7L A;  3KK1 A;  1Y64 A;  5FRO A;  4YHH K;  2RE2 A;  4I6M A;  3V4I A;  2OPQ A;  1D4X A;  2KW4 A;  4JKB A;  2ITG A;  4CBW A;  4CEB A;  1NGH A;  2Q97 A;  1XC9 A;  4F3T A;  1BQN A;  3CC7 N;  2QWL A;  4ZHR A;  1TUY A;  2Z1H A;  3QBW A;  4CF1 A;  1C0G A;  3QDK A;  3QFP A;  3PIP L;  3ZET B;  3CIP A;  3U3Y A;  3N4Q A;  3HXM A;  4MFB A;  1P90 A;  3S41 A;  3NGZ A;  3A8Y A;  2GV9 A;  5J1E A;  2OPP A;  2G8I A;  3TSU A;  5AQS A;  3CCU N;  3ZEU A;  5KRT A;  3SAG A;  3B8A X;  4PWD A;  5GIN A;  3AO2 A;  3U9D A;  2E88 A;  3HP9 A;  3VQ7 A;  4CI6 A;  2Q2R A;  5F2R A;  1BI4 A;  3JS6 A;  2PAV A;  4PKG A;  1VQ8 N;  1RTD A;  1D8Y A;  3WXI A;  4C1N K;  4H5N A;  3FZF A;  3P83 D;  4E89 A;  4B1W B;  4BR0 A;  3LWL A;  3CJC A;  2QWQ A;  3UKU A;  1QTM A;  1KSP A;  3SMP A;  5M1F A;  3ATU A;  1ZBU A;  3AVK A;  4W5N A;  3EZ5 A;  5AQG A;  4BQZ A;  1RDA A;  4CJ5 A;  1XMQ K;  4IZ9 A;  1EWR A;  3OVN A;  3NAE A;  3OBW A;  3ZSW A;  1DLO A;  2E2Q A;  4BR4 A;  2O8F A;  5BR9 A;  3SZ2 A;  1L3V A;  1GLF O;  5B8H A;  2VQE K;  3ZSV A;  4DQQ A;  4A5A A;  4CEF A;  4CEA A;  4Q5V A;  1X9J A;  3NH0 A;  2WTU A;  3GBT A;  3NFA A;  4M45 A;  4CZJ A;  4LF8 K;  4IG3 A;  3NDK A;  3CG7 A;  3KLH A;  3GE1 A;  2WFB A;  1JXB A;  3D2E A;  1RT5 A;  3MEE A;  4KH5 A;  3ZX3 A;  4J2E A;  1K9M O;  1S6P A;  1NOZ A;  4FWP A;  4CJQ A;  4O44 A;  4F8R A;  4DV1 K;  3VQ6 A;  1TKX A;  1T3V A;  3ZT4 A;  3IKM A;  4B8C A;  3TAG A;  4NCA A;  1WLJ A;  3VQQ A;  4HVJ A;  1WN7 A;  4AF1 A;  4FLU A;  3QLH A;  4CGG A;  3WXK A;  3QML A;  4CHY A;  1TK0 A;  3LWM A;  4DTN A;  4IFV A;  3HM8 A;  4A59 A;  3I56 N;  1KAX A;  2E2O A;  1REV A;  2P1J A;  1JLQ A;  2B5J A;  5J2Q A;  4HUE A;  5HOO A;  4OX9 K;  1J5O A;  5KPZ A;  5F1X A;  1XC3 A;  3AAQ A;  4JKG B;  3TAF A;  4FK2 A;  1RNH A;  3DRS A;  4H0T B;  4M3U A;  3IMX A;  3T1Y K;  3U4L A;  1LAW A;  1VQ5 N;  1JCF A;  3CM6 A;  3R1X A;  5KPR A;  1NK6 A;  3HYF A;  1JLB A;  4KV8 A;  4KB1 A;  2QWN A;  1LV5 A;  5CHI A;  3V9S A;  3OYN A;  1VQK N;  4KTQ A;  3UIQ A;  1UAX A;  3IUC A;  3SK3 A;  1EWQ A;  4WFA L;  4FWL A;  3VEZ A;  3LAK A;  4BDY A;  4B3R K;  5EVZ A;  2FBV A;  3OS2 A;  1ZBH A;  1VSF A;  3VQP A;  1MU2 A;  2YCH A;  2WUS A;  2IVN A;  5FDL A;  3VEY A;  2BDP A;  3DXK A;  4AQY K;  4DU1 A;  1NJI O;  2QWO A;  4CZL A;  1WSF A;  3QER A;  3HSC A;  5AQJ A;  3TAR A;  3NH2 A;  5GAH P;  3C0B A;  3CCJ N;  1SUQ A;  4FWO A;  4KHY A;  3MMV A;  1KRP A;  2QA4 N;  2HNZ A;  1S1W A;  3ITH A;  3ULD A;  4EIA A;  2X78 A;  1IKW A;  2GWK A;  1LW2 A;  4H03 B;  3BZC A;  3VGK A;  1NNE A;  1OH8 A;  1SL1 A;  2UUC K;  1TUU A;  1ZYQ A;  3UKR A;  1Z26 A;  5ADX A;  3THW B;  1BCM A;  2Q36 A;  4EAH D;  3KWI A;  4FM1 A;  3A2F A;  2P9N B;  2HBK A;  4N56 A;  1YXQ A;  3AAP A;  2XY6 A;  1Q81 O;  2HF3 A;  2GBZ A;  3ULE A;  4WFN L;  4JI7 K;  5JIC A;  4HCC A;  2OPR A;  1NGE A;  3D2F B;  3CCS N;  4DTO A;  5KI6 A;  1X3M A;  4AHV A;  5GIP A;  2I5J A;  4MLE A;  3SV3 A;  4QAG A;  1VQP N;  4LF4 K;  4B1U B;  3SJJ A;  3VQ5 A;  4WE1 A;  4RW8 A;  4JK9 A;  4OJR A;  4CJ7 A;  4TSX A;  4X65 K;  4NLC A;  5K14 A;  5C2D A;  3L8B A;  3VQE A;  3HOT A;  5C24 A;  3FR0 A;  3NF7 A;  1YJW N;  4Z4E A;  3VET A;  1HNW K;  3ZET A;  4BAC A;  3OYM A;  1ZC6 A;  1VQ7 N;  4CBX A;  4XH5 A;  3S3O A;  3AA3 A;  2ZQB A;  3AA4 A;  4CF2 A;  4DV4 K;  4OGC A;  3ZT0 A;  4CJL A;  3U3G A;  4Z0U A;  4AM6 A;  4E1J A;  3P1G A;  1VSI A;  2NLX A;  3HL8 A;  1KVB A;  1GOC A;  3MED A;  3OYH A;  4F2R A;  3T1A A;  1U49 A;  3I55 N;  4C8M A;  4KBO A;  4FJM A;  4ELU A;  3C6T A;  4CK1 A;  4KI4 A;  3KK7 A;  1S9E A;  5HRO A;  3CCR N;  3TTD A;  3O3H A;  1S5J A;  5CYM A;  4WQ4 C;  2ZGZ A;  4FCY A;  1YAG A;  4DLG A;  4CFB A;  2OTJ N;  1BOT O;  2ASO A;  3WNH A;  1L3S A;  1LWE A;  3O4N A;  1ZBS A;  3VER A;  5HP1 A;  2RKI A;  2KKZ A;  4HCB A;  4PKH A;  2E5L K;  1FW6 A;  1X1P A;  3LDP A;  3OYL A;  2VG6 A;  4E7H A;  1J54 A;  1Q86 O;  4X62 K;  3VMF B;  1IBK K;  5BRH A;  1NKE A;  1K8K A;  4GV3 A;  1RDU A;  1JCG A;  3O3F A;  1J53 A;  3SUO A;  1VK0 A;  3L3U A;  4H0V B;  3L0Q A;  1ITG A;  3PSF A;  1HJR A;  1A5X A;  1NG9 A;  2CH6 A;  1BCO A;  3V9X A;  4OPA A;  4RCH A;  4MLH A;  3SBT A;  4PA1 A;  5SZT A;  4M3R A;  2A42 A;  1MA9 B;  3LZJ A;  4DV3 K;  4BR9 A;  4C8K A;  4FYD A;  1Q18 A;  4CE9 A;  4C8L A;  4FWR A;  4FM0 A;  2HST A;  3DOL A;  3SAF A;  4BDP A;  4BVP A;  2NRH A;  4BE2 A;  4DU4 A;  5M1P A;  4KTZ A;  4ZTF A;  2E20 A;  4DSI A;  1NGD A;  4JNE A;  1GLE G;  3MXM A;  2AA4 A;  2ATQ A;  1GLD G;  1HNV A;  3WNE A;  5HRP A;  4WFB L;  4JV5 K;  5KPT A;  4DV0 K;  4DV2 K;  1VSJ A;  3EZW A;  3D6R A;  2A1S A;  4JK7 A;  4DFK A;  2O8C B;  4FWN A;  4NYF A;  2VWK A;  4JKG A;  4KFB A;  3CMA N;  1CZB A;  1QQO A;  4F9O A;  3DWL A;  2VWB A;  1T7P A;  3K58 A;  4JD2 B;  4DQP A;  4JKE A;  3I8D A;  4RTF D;  2AP1 A;  2W42 A;  4FK0 A;  4FZX C;  2I7P A;  3J8A A;  2VGM A;  4JKD A;  4CFA A;  3VQ9 A;  4FZY A;  3PV8 A;  3HT3 A;  2X74 A;  3PSI A;  2F4V K;  3LDL A;  1RBR A;  4XH4 A;  1CZ9 A;  4LFB K;  3SQ0 A;  2YI1 A;  2BE2 A;  3THV A;  4CZM A;  3MK6 A;  5J2M A;  3DMJ A;  1KFD A;  3AY9 A;  4CD3 A;  3QNN A;  1HKC A;  1YJ9 N;  4LSN A;  1KVA A;  5EY4 A;  3WQU A;  3CJA A;  4RW4 A;  3SUP A;  5BN8 A;  3V9W A;  5JS1 A;  4M41 A;  1DGK N;  1RT3 A;  4DV7 K;  3VQ8 A;  3CXC M;  1YI2 N;  3SNN A;  4DHY A;  4F2S A;  2ASM A;  1KFS A;  1BIS A;  4CGJ A;  1A5V A;  3AA2 A;  4FJN A;  3M8P A;  1VSK A;  1EET A;  3ZCM A;  4PL7 A;  1ASV A;  3LAN A;  1YJN N;  4CD1 A;  2W41 A;  4FLW A;  2P9S B;  3CQX A;  3VQC A;  3NBP A;  2P9U B;  1YIJ N;  3LDS A;  3ENH A;  1DTT A;  1RFQ A;  3IG1 A;  3CJ9 A;  4O8K A;  1KD1 O;  5FRM A;  5CR4 A;  3OS0 A;  3THW A;  4J2D A;  4A5B A;  3HBT A;  4CZI A;  1N33 K;  2P9N A;  4CK3 A;  3O5B A;  2P9P B;  3AVM A;  3TAM A;  4E1N A;  4BRI A;  3WEE A;  1E4G T;  4KRF A;  3ZYY X;  3Q7B A;  2G8V A;  3CCQ N;  3TR8 A;  2HVI A;  2WON A;  4JKF A;  4KHN A;  1D9D A;  3D2F A;  3L3V A;  1F21 A;  2GX9 A;  2YNH A;  1WB9 A;  2JWL A;  3SBG A;  4WF9 L;  3TSQ A;  4CJ4 A;  3QES A;  5CY4 A;  3RRH A;  1SL0 A;  3AVA A;  3RSE A;  2NRZ A;  2XRI A;  4H4M A;  4Q0B A;  2F8T A;  3VPZ A;  5LJV A;  2IVO A;  4DR5 K;  2HMI A;  2PBD A;  4JHD B;  3DAW A;  2WC9 A;  4FL9 A;  3QIO A;  1LOT B;  4FW1 A;  4KTW A;  2UXB K;  1S1V A;  4CFC A;  3QEP A;  4CIF A;  4DTJ A;  2W6K A;  5AFU H;  3G10 A;  1HRH A;  5C2F A;  1HNX K;  4DTU A;  3F5T A;  3I8B A;  4B3M K;  2ZE2 A;  3HZ6 A;  3ZSO A;  3DLB A;  3ZT2 A;  4LSL A;  3BF1 A;  1QSY A;  4M3W A;  4FVU A;  3LPT A;  4Y0W A;  2QTD A;  3RMB A;  3THX B;  3LDQ A;  1WOQ A;  1MDU B;  4ISF A;  2J4R A;  4BC2 A;  1RTI A;  3LPU A;  5FLX O;  3E9L A;  3V6D A;  3CJB A;  4JKA A;  5AQI A;  3DRP A;  5EXW A;  4FLY A;  3MAQ A;  4DSE A;  1U4B A;  3L4Q A;  4ISG A;  2QM1 A;  3PLA A;  2D0O A;  1TV6 A;  4J2B A;  1VQ4 N;  4GW6 A;  4O0I A;  4CJK A;  1QS4 A;  3F73 A;  1VRT A;  2D0P A;  4BRG A;  4IFE A;  2NUB A;  3CET A;  4E0D A;  2HMP A;  3L2R A;  3OHR A;  1IBM K;  4OKJ A;  2NRV A;  3LL3 A;  2V52 B;  3NGY A;  3TU5 A;  4BG8 A;  3O4W A;  4UY8 O;  3D45 A;  4BQL A;  3OYK A;  3B6P A;  3PO4 A;  1HR0 K;  4JYA K;  3HPH A;  3HVR A;  4FK4 A;  2E1Y A;  2GEL A;  3OJS A;  3EE8 A;  1SAZ A;  3HTV A;  4CCH A;  4RWT A;  2OTL N;  2ITM A;  1TL3 A;  3P31 A;  3VTH A;  2IS3 A;  4NO7 A;  3BUZ B;  4BC3 A;  1VHX A;  5LY3 A;  2P5G A;  2UXC K;  3O1W A;  2NNW A;  4A62 A;  4KHW A;  1RBU A;  2JGU A;  4CGF A;  1XQS C;  1HPZ A;  4XIU A;  5HLF A;  4B9V A;  2OZS A;  3PX0 A;  1QHT A;  3N4P A;  4KPY A;  2HF4 A;  3SMS A;  2VG7 A;  1Q8I A;  5SWM A;  3MEG A;  2G8U A;  4JAX A;  2IAJ A;  5DM7 L;  4JD2 A;  3VQA A;  1RGI A;  4DF4 A;  3NMU A;  1LCU A;  4CJS A;  2R7Y A;  4YOU A;  4B9L A;  3GOI A;  4IEI A;  2CH5 A;  5AQH A;  1QVG M;  4MO4 A;  3O9R A;  3OYB A;  5AQV A;  1NKB A;  3MCP A;  4RG8 A;  3DLG A;  2HHS A;  2DFE A;  1Z25 A;  4CHN A;  3TSP A;  2E6L A;  4FWS A;  3VN5 A;  1IKX A;  3O3G A;  4KAZ A;  1C0T A;  5FPE A;  1NLV A;  4IJN A;  4JI3 K;  3CYM A;  1Q9Y A;  3E01 A;  1TL1 A;  5AZI A;  1SKS A;  2F8S A;  3WXL A;  5DM6 L;  4BRP A;  4DTS A;  3QIN A;  3CD6 N; 
#chains in the Genus database with same CATH homology
 1YVU A;  3NE6 A;  1S6Q A;  2OA8 A;  3L2U A;  3SQ2 A;  4JRP A;  5C42 A;  4IFY A;  1S1X A;  1ZBI A;  4HCC A;  4CEZ A;  2EHG A;  2OPR A;  4OGE A;  4DSJ A;  3VA0 A;  4DTO A;  1HMV A;  2B6A A;  5KI6 A;  2Y1I A;  4AHV A;  4CEO A;  2I5J A;  4BE0 A;  3SV3 A;  1WNS A;  4QAG A;  3KLF A;  3ISN C;  4FJ9 A;  1ZBF A;  3K2P A;  3KK3 A;  1TAU A;  4I2P A;  3SJJ A;  4FLX A;  2RF2 A;  3VQ5 A;  3KD5 E;  3BGR A;  4WE1 A;  4RW8 A;  3ZSR A;  2A1R A;  3S9H A;  4OJR A;  1JL1 A;  4FJX A;  4RW9 A;  4TSX A;  1ASW A;  3LP1 A;  3AVG A;  4KKO A;  2RPI A;  5K14 A;  3AVH A;  3DLR A;  1IH7 A;  4O5B A;  3NCI A;  3L8B A;  3HVT A;  4O0J A;  1T8E A;  4HUF A;  4OKK A;  3VQE A;  1W0H A;  3AVN A;  3KKR A;  1FKP A;  4CEC A;  1T05 A;  5C24 A;  3NF7 A;  3AV9 A;  3L2Q A;  4KRE A;  5FRN A;  4Z4E A;  1JLG A;  2HNY A;  3L2V A;  3NF6 A;  3LP3 A;  3OYM A;  4BAC A;  3V1R A;  2DTU A;  3S3O A;  3AA3 A;  1Y97 A;  3AA4 A;  2ZQB A;  2YNI A;  1RT2 A;  4MQ3 A;  4OGC A;  4CJE A;  4CF2 A;  3ZT0 A;  4CJL A;  3U3G A;  2Z1I A;  4Z0U A;  3NF8 A;  5I3U A;  3NHG A;  3P1G A;  1RT6 A;  1VSI A;  3AVI A;  1RBV A;  1NJX A;  1BGX T;  4OPK A;  3HL8 A;  1C6V A;  4IBN A;  2D0B A;  1IKV A;  4DS4 A;  3QNO A;  1KVB A;  1GOC A;  3MED A;  4OVL A;  3C95 A;  1GOA A;  4I7F A;  4CED A;  3NH1 A;  3OYH A;  1UA1 A;  3RR8 A;  4DWI A;  4F2R A;  4M42 A;  4CGH A;  4JLH A;  4E1M A;  2G8F A;  3T1A A;  2E6M A;  1U49 A;  1IKY A;  2IGI A;  2YHA A;  4HTU A;  1TK8 A;  1LAV A;  4BWJ A;  4K8X A;  2HHW A;  1NJZ A;  4CJF A;  2P51 A;  2Z1J A;  4C8M A;  4EP5 A;  3S3M A;  1R0A A;  1N5Y A;  4FLV A;  4QCL A;  3DI6 A;  4Z4C A;  4FJM A;  4CJU A;  4C8O A;  3C6T A;  4ELU A;  4CK1 A;  4O55 A;  3AVJ A;  4CJT A;  1EKE A;  3KLI A;  1XWL A;  4RW7 A;  3HP6 A;  4DFJ A;  4E7K A;  1T03 A;  4KI4 A;  1S9E A;  4OLB A;  4B3O A;  1C0M A;  5HRO A;  3DM2 A;  3NGI A;  2PY5 A;  1RT4 A;  1WSG A;  2JLE A;  3O3H A;  3V1Q A;  1S5J A;  4E7I A;  5D3G A;  3QET A;  5CYM A;  5C25 A;  1RTH A;  1QSS A;  2KFZ A;  4FCY A;  4I2Q A;  4DLG A;  4CFB A;  1JLF A;  4J2A A;  2B4J A;  3O4Q A;  3HPO A;  5J2P A;  4OLA A;  3WNH A;  4E19 A;  4CHO A;  1L3S A;  4FJ8 A;  1LWE A;  2YNF A;  5T7B A;  1YT3 A;  3O4N A;  3SQ4 A;  1FKO A;  2QKB A;  5HP1 A;  1L3T A;  1S1T A;  5HRR A;  3OYJ A;  2RKI A;  1RTJ A;  4DTP A;  3M8S A;  1HQU A;  3RTV A;  4DFP A;  4HCB A;  3TAN A;  4EP4 A;  3LAL A;  1IG9 A;  1CXQ A;  2KFN A;  3ZT3 A;  1X1P A;  3OYL A;  2VG6 A;  4E7H A;  1J54 A;  1JLA A;  1BIZ A;  2X6S A;  3TAE A;  1WAF A;  3HPG A;  1NKE A;  1RDD A;  4CF9 A;  3O3F A;  1J53 A;  4LH5 A;  3SUO A;  1VK0 A;  3RWU A;  2KTQ A;  3L3U A;  1NK9 A;  1ITG A;  1HJR A;  1A5X A;  4Y1C A;  4CEQ A;  4DS5 A;  4PUO A;  3AO3 A;  3MEC A;  4CK2 A;  4AH9 A;  1BCO A;  1RDB A;  3V9X A;  2YHB A;  3LP0 A;  3CFR A;  2VG5 A;  3CQ8 A;  3T19 A;  2DY4 A;  1K6Y A;  4PA1 A;  5SZT A;  1RT7 A;  3KLG A;  2G8H A;  4M3R A;  3TWH A;  3DLE A;  3LZJ A;  1X9S A;  1XHX A;  4C8K A;  4QOZ B;  3DOK A;  4N41 A;  4IKF A;  2D0C A;  1RBT A;  4UQG A;  4FYD A;  4CE9 A;  3RMD A;  4C8L A;  1B9D A;  3I0S A;  2BGG A;  1J9A A;  4DSL A;  4DTM A;  4DTR A;  3LP2 A;  3ZSQ A;  4AHR A;  4FM0 A;  3DOL A;  3OS1 A;  1SKW A;  1NK5 A;  2QKK A;  4B9M A;  4BDP A;  4O4G A;  1SV5 A;  3QEI A;  1EX4 A;  1BHL A;  3OYG A;  4BE2 A;  4DU4 A;  2KQ2 A;  2XO7 A;  1HNI A;  4KTZ A;  3V81 A;  3KD1 E;  4DQI A;  4ZTF A;  4Z4F A;  3QEW A;  1UOC A;  1C1A A;  1D9F A;  4DSI A;  1YTA A;  2HHV A;  3MXM A;  3IS9 A;  1Q9X A;  1RDC A;  3VQ4 A;  1LW0 A;  1TGO A;  2ATQ A;  2D5R A;  1HNV A;  3OYD A;  4OKE A;  3WNE A;  5HRP A;  4NYN A;  1RBS A;  1VSJ A;  4FW2 A;  5KGX A;  2QK9 A;  2A1S A;  4M3X A;  3KJV A;  4DFK A;  3QEV A;  4ID5 A;  4NYF A;  4JS5 A;  1WSE A;  1KCF A;  2VWK A;  2WOM A;  1CLQ A;  1KTQ A;  1W9H A;  4KFB A;  1L5U A;  1CZB A;  1X9M A;  4FLT A;  3NF9 A;  3T3F A;  1TKT A;  1T7P A;  3HO1 A;  1TAQ A;  3F9K A;  3K58 A;  1NOY A;  3WNF A;  2W42 A;  3I8D A;  3AVL A;  2XHB A;  4DQP A;  4F4K A;  4FK0 A;  4FZX C;  4ICL A;  1U47 A;  1U48 A;  4HUG A;  4CFA A;  2OZM A;  3VQ9 A;  4FZY A;  4PQU A;  3D0P A;  3AO5 A;  4B08 A;  3HT3 A;  3PV8 A;  1CXU A;  3MXJ A;  2X74 A;  1LWC A;  1VSM A;  3DLK A;  4Z4H A;  4OPJ A;  4K8Z A;  1RBR A;  4F3O A;  3QO9 A;  1CZ9 A;  3AA5 X;  4FJ5 A;  1TKZ A;  1JL2 A;  4ID1 A;  4Y1D A;  4DG1 A;  3OYA A;  3SQ0 A;  2P5O A;  1UA0 A;  2BE2 A;  3THV A;  1NJW A;  3SCX A;  2XY5 A;  3PX6 A;  4CIE A;  5J2M A;  1C0U A;  3JSM A;  2FBT A;  3DMJ A;  1KFD A;  2HHU A;  3KIO A;  3QNN A;  4LH4 A;  4LSN A;  3OYF A;  1KVA A;  1QQC A;  3SPY A;  2HHQ A;  1JKH A;  4LY7 A;  4KHQ A;  3OYI A;  3AVB A;  4RW4 A;  3U6F A;  3SUP A;  1WSH A;  3V9W A;  5JS1 A;  4M41 A;  4FJJ A;  1RT3 A;  2PYL A;  1TVR A;  2HND A;  3VQ8 A;  1WSI A;  4FVM A;  3KK2 A;  3SNN A;  4DU3 A;  4F2S A;  1XHZ A;  3EY1 A;  1WSJ A;  1KFS A;  3OYC A;  1BIS A;  5HBM A;  3HST B;  4CGJ A;  1A5V A;  4M3T A;  3AA2 A;  5CZ1 A;  4FJN A;  4IDK A;  3AVF A;  3M8P A;  1VSK A;  5CYQ A;  1EET A;  3ZCM A;  1TKD A;  2Z1G A;  1ASV A;  3LAN A;  1UWB A;  3VQD A;  3OYE A;  1ZBL A;  1FXX A;  2DFH A;  5E41 A;  4E7L A;  3KK1 A;  5FRO A;  3ASM A;  4FLW A;  1NK8 A;  3ZSZ A;  3AVC A;  4NCB A;  3VQC A;  3V4I A;  2OPQ A;  3SUN A;  4AHS A;  3NBP A;  3KLE A;  2KW4 A;  3PX4 A;  4B9N A;  4W5R A;  4YFU A;  3RRG A;  2ITG A;  3LDS A;  4CEB A;  1DTT A;  3IG1 A;  4LD0 A;  2XY7 A;  3PY8 A;  4W5O A;  3OS0 A;  1XC9 A;  5KGW A;  4DFM A;  5FRM A;  1BQN A;  4J2D A;  4I9L A;  5HRN A;  1B92 A;  4KO0 A;  4F3T A;  4HHT A;  3TI0 A;  4CK3 A;  4ZHR A;  4PY5 A;  1A5W A;  4CGI A;  1NJY A;  3M8R A;  4Z4I A;  3IAY A;  2AJQ A;  2Z1H A;  4CF1 A;  3AVM A;  3TAM A;  1VRU A;  4E1N A;  3C6U A;  4KRF A;  3U3Y A;  1BQM A;  3HXM A;  2F96 A;  2IC3 A;  3DYA A;  4MFB A;  2G8V A;  3TR8 A;  3NGZ A;  4JRQ A;  2HVI A;  5J1E A;  2GV9 A;  2WON A;  2OPP A;  3RMC A;  4KHN A;  3V9U A;  1D9D A;  3K5L A;  3SQ1 A;  2G8I A;  2PYJ A;  3L3V A;  3SYZ A;  1F21 A;  2G8K A;  2X6N A;  4Z4G A;  2YNH A;  1XI1 A;  3K59 A;  5KRT A;  4PWD A;  1DTQ A;  3VA3 A;  4FJK A;  2ZD1 A;  3HM9 A;  4CJ4 A;  3QES A;  5CY4 A;  3AO2 A;  3RRH A;  1SL0 A;  4I9Q A;  3HP9 A;  3VQ7 A;  3AVA A;  1BI4 A;  1NK4 A;  1RTD A;  2XRI A;  1D8Y A;  4H4M A;  3ZSY A;  3P83 D;  1G15 A;  3K5N A;  4E89 A;  4FLZ A;  2F8T A;  4Q0B A;  4E3S A;  1HYV A;  3LWL A;  2HB5 A;  4H4O A;  2HMI A;  4RW6 A;  5EU7 A;  1QTM A;  4ZTJ A;  5KRS A;  1KSP A;  2EX3 A;  3VQB A;  3KKS A;  4DTX A;  1RT1 A;  1S9G A;  1ZBU A;  3AVK A;  4R5P A;  1I39 A;  4FM2 A;  3QIO A;  2Y1J A;  3I0R A;  3KTQ A;  4FW1 A;  3EZ5 A;  2FBY A;  4KTW A;  4W5N A;  1VSH A;  4KB0 A;  1RDA A;  4CJ5 A;  1S1V A;  4CFC A;  3QEP A;  3OVN A;  4L8R B;  3NAE A;  3ZSW A;  4CIF A;  4DTJ A;  3HK2 A;  1DLO A;  1LWF A;  3G10 A;  1HRH A;  4AHT A;  1U45 A;  4DTU A;  1X9W A;  4B9T A;  1GOB A;  1HYS A;  2OYQ A;  1RIL A;  4W5T A;  5DMR A;  3ZT1 A;  2ZE2 A;  3SZ2 A;  3ZSO A;  1B9F A;  2YNG A;  1L3V A;  3DLB A;  4FXD A;  3ZT2 A;  4LSL A;  3JYT A;  2BAN A;  1QSY A;  4EZ6 A;  4M3W A;  4CGD A;  2YKM A;  4DQS A;  4KI6 A;  3LPT A;  4KHU A;  2HHX A;  3ZSV A;  4DQQ A;  4CEF A;  3H08 A;  1C1C A;  4CHQ A;  1JXE A;  4CEA A;  3RMB A;  4Q5V A;  2G8W A;  3NH0 A;  3NFA A;  4M45 A;  5HRS A;  3DLH A;  2Q3S A;  1U04 A;  3K5O A;  4IG3 A;  3PUF A;  3NDK A;  1RTI A;  3G0Z A;  3LPU A;  3CG7 A;  3V6D A;  3KLH A;  3SI6 A;  4FZZ A;  3DRP A;  1KVC A;  3AO1 A;  2OPS A;  2O4I A;  4M3Y A;  1JXB A;  4FLY A;  1SL2 A;  1RT5 A;  3MEE A;  3MAQ A;  4DSE A;  1U4B A;  3B6O A;  4J2E A;  4N76 A;  1S6P A;  2FC0 A;  2KZM A;  4W5Q A;  5J2N A;  1BI4 B;  1NOZ A;  1TV6 A;  3CFP A;  4F8R A;  4CJQ A;  4O44 A;  4J2B A;  1YTU A;  4GW6 A;  4O0I A;  3VQ6 A;  1TKX A;  1N6Q A;  2YV0 X;  3ZT4 A;  4B8C A;  4CJK A;  3TAG A;  1QS4 A;  1IO2 A;  3F73 A;  1VRT A;  4NCA A;  4H8K A;  1WLJ A;  2NUB A;  1HQE A;  2E4L A;  3K5M A;  5CZ2 A;  4E0D A;  3L2W A;  3SPZ A;  3VQQ A;  4CF8 A;  4HVJ A;  3L2R A;  1WN7 A;  1RCH A;  4OKJ A;  1O1W A;  3ZSX A;  4FLU A;  3RR7 A;  4CF0 A;  3P5J A;  3QLH A;  4BDZ A;  2GUI A;  4G1Q A;  3ALY A;  4CGG A;  2PZS A;  3RMA A;  1ASU A;  3NGY A;  4GVM A;  4CJV A;  4B9S A;  3DRR A;  3FFI A;  4CHY A;  1TK0 A;  3LWM A;  4N5S A;  4DTN A;  4IFV A;  4CHP A;  4ELT A;  3D45 A;  4DF8 A;  3V9Z A;  1REV A;  2P1J A;  3OYK A;  1JLQ A;  2B5J A;  2YKN A;  5JS2 A;  5J2Q A;  3B6P A;  1HYZ A;  4CJR A;  2KZZ A;  3PO4 A;  4HUE A;  2DFF A;  4CER A;  3HPH A;  3TAB A;  1J5O A;  4FJ7 A;  3HVR A;  4AHC A;  4FK4 A;  2HHT A;  3OJS A;  2FBX A;  3C94 A;  4CFD A;  3TAF A;  4FK2 A;  4CCH A;  1RNH A;  1WAJ A;  3DRS A;  4BE1 A;  3QEX A;  1TL3 A;  4B9U A;  4C8N A;  1EXQ A;  4M3U A;  2HW3 A;  4DMN A;  4CEE A;  4ELV A;  3WNG A;  3BDP A;  1NK0 A;  3AO4 A;  1JLE A;  1LAW A;  4AHU A;  2IS3 A;  4EZ9 A;  3CM6 A;  1JLC A;  3CFO A;  4CES A;  1NK6 A;  1S1U A;  3HYF A;  1JLB A;  4KV8 A;  1C1B A;  4KB1 A;  1I3A A;  4N47 A;  1LV5 A;  2P5G A;  1SKR A;  4DQR A;  3V9S A;  3OYN A;  1VSL A;  4KTQ A;  1L3U A;  4M3Z A;  3UIQ A;  4FJI A;  2IDO A;  4KHW A;  1RBU A;  1UAX A;  2ETJ A;  2JGU A;  4CGF A;  4CJ3 A;  4YNQ A;  1HPZ A;  3TAP A;  3MXI A;  3K57 A;  1BIU A;  4DSK A;  2HVH A;  5KTQ A;  4JS4 A;  3LAK A;  4XIU A;  4BDY A;  3M8Q A;  1D5A A;  2FBV A;  3OS2 A;  4B8A B;  5HLF A;  4B9V A;  2O4G A;  3CM5 A;  2OZS A;  3PO5 A;  3PX0 A;  4E7J A;  1QHT A;  2VWJ A;  1ZBH A;  4KPY A;  1VSF A;  3EYZ A;  3VQP A;  1MU2 A;  2VG7 A;  1Q8I A;  5FDL A;  3QIP A;  5SWM A;  3LAM A;  3MEG A;  4IG0 A;  2IAJ A;  4CJW A;  1KLN A;  3SV4 A;  2G8U A;  2BDP A;  4FJL A;  4DU1 A;  4NCG A;  1WSF A;  3QER A;  3SUQ A;  3VQA A;  3TAR A;  4DF4 A;  3NH2 A;  4CJS A;  1BL3 A;  2R7Y A;  4B9L A;  1FK9 A;  1KLM A;  1SUQ A;  4KHY A;  4CJP A;  4BWM A;  3OYB A;  5DK5 A;  1NKB A;  2QXF A;  5I42 A;  4DSF A;  4RG8 A;  1KRP A;  2XY8 A;  1NK7 A;  3DLG A;  2HNZ A;  2DFE A;  1S1W A;  1Z25 A;  3ITH A;  4CHN A;  4DLE A;  3LZI A;  3HJF A;  4AIL C;  3ULD A;  2E6L A;  4FJH A;  4KHS A;  3VN5 A;  2X78 A;  1IKX A;  3S3N A;  3O3G A;  1EP4 A;  1IKW A;  1C0T A;  2RN2 A;  4CHZ A;  4KAZ A;  1LW2 A;  1VSE A;  4GMJ B;  1SL1 A;  2D0A A;  3OY9 A;  3CYM A;  1ZYQ A;  1Z26 A;  1VSD A;  3E01 A;  1BCM A;  3TAQ A;  1Q9Y A;  4FJG A;  1TL1 A;  1QE1 A;  3V1O A;  4CIG A;  4FM1 A;  1TK5 A;  3A2F A;  3OJU A;  1SKS A;  1NKC A;  1QSL A;  2F8S A;  4N56 A;  2HHS A;  3IRX A;  4DTS A;  2XY6 A;  3QIN A;  2IOC A;  2LSN A;  2GBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...