1J54A

Structure of the n-terminal exonuclease domain of the epsilon subunit of e.coli dna polymerase iii at ph 5.8
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
174
structure length
174
Chain Sequence
RQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHGALLDAQILAEVYLAMTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase III, epsilon chain
publication title Structural Basis for Proofreading during Replication of the Escherichia coli Chromosome
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 57
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1j54A00
1RBTA 4DTSA 4K8ZA 3G10A 1NOZA 3SJJA 4BWMA 4FK2A 4FK4A 1B9DA 3H08A 2ZE2A 3I8DA 1O1WA 4E7JA 3KD1E 2B6AA 3QO9A 3ZSWA 4FZXC 4KHSA 2G8IA 1QSLA 3ZSYA 4DFJA 1GOCA 3JSMA 4OKKA 4RW4A 1QE1A 3IG1A 4Z4CA 5HROA 5CZ2A 2G8KA 4ELUA 5J2MA 1YT3A 3ZT2A 1J9AA 2PYJA 1U04A 1QTMA 4B8AB 4CJPA 1VRTA 2LSNA 3O3GA 3HK2A 4AILC 4EZ6A 2KW4A 1HNVA 3C6UA 4B3OA 3TABA 1X9MA 1S1UA 4CEDA 3OY9A 4DF4A 3DRPA 4GW6A 4JRPA 3KIOA 5E41A 2IAJA 3LAMA 3RTVA 3V9ZA 1RBVA 1SV5A 4IG0A 1KFSA 2BANA 4E0DA 4FJJA 4KHQA 4M3RA 4CJLA 4FXDA 4E7IA 2A1SA 4E19A 3VQQA 1N5YA 5J1EA 1ZBLA 1SKWA 4CFAA 1KFDA 4CHYA 3SZ2A 4CE9A 4CJSA 4E1NA 4DFPA 3K5MA 1JLEA 1RTJA 3OS2A 3QEPA 4IG3A 1XHZA 1ZYQA 1KSPA 4B9UA 3TAGA 1LWEA 1TAQA 4E7LA 3CFOA 4L8RB 1CZBA 3HXMA 3KLIA 4FW2A 1QSYA 5KRSA 4CK1A 4LD0A 4CGJA 2D5RA 1RT5A 1LAWA 4RW7A 4KFBA 3QEWA 1NK7A 2YHBA 4Q0BA 1TKDA 3L2QA 1IG9A 3HSTB 4FLTA 1BI4B 4O55A 3LDSA 5J2NA 3AO1A 4CEAA 4DWIA 3RMAA 1C6VA 2RN2A 1F21A 3DYAA 1W9HA 5DMRA 3OYNA 2Y1JA 4IKFA 4FZYA 3LP3A 4E89A 3VQ9A 3V81A 3HO1A 4OLAA 4CJEA 3VQBA 2HHTA 4K8XA 1NJWA 3TR8A 2HNYA 1NK5A 1T05A 1ZBFA 5CYMA 3C94A 3PX4A 4ID5A 2XY8A 3NH1A 4FCYA 3P1GA 2QXFA 3V1OA 2G8FA 3VQEA 1D9FA 3CYMA 1T03A 3SQ0A 1VK0A 3P5JA 2IOCA 4B9NA 4E7KA 3NF8A 3C95A 4H8KA 3AV9A 4EZ9A 1S1WA 5FRMA 3LALA 4Z4HA 3NH2A 3NDKA 5FRNA 1L3TA 1KTQA 1SL1A 4DU3A 1VSKA 4M41A 5D3GA 2O4GA 2OPRA 3AVMA 3VQ4A 1L3UA 4JS4A 4HHTA 1JLBA 4CEBA 2HHWA 3MXJA 3CFRA 4QCLA 3LANA 1JKHA 1RBSA 3TARA 3OYBA 4DLGA 4FJIA 4PA1A 4DTNA 4Q5VA 5J2PA 2HHQA 3V9SA 4FJNA 4N76A 4OLBA 4W5TA 3O3HA 3QNNA 1KLNA 1MU2A 4Z4EA 5KI6A 3AVAA 2F8SA 3LWMA 4PUOA 3T1AA 4CGGA 3OYDA 4O4GA 5DK5A 4BDZA 1VSEA 1I39A 4I2PA 1S1XA 3KKRA 3QESA 4J2BA 2QK9A 1XWLA 2X6NA 4DQRA 4CJUA 1ZBHA 3ULDA 4FJGA 2E6MA 2BE2A 2XY6A 4CK3A 2YNIA 1NK8A 4EP5A 1WNSA 4HUEA 3V9WA 5C24A 4ELVA 1HYVA 4FYDA 1BL3A 1SL0A 1J5OA 1HYSA 1QQCA 5T7BA 2P5OA 3MEGA 4FLVA 5J2QA 4MFBA 1EP4A 1LAVA 3F73A 4F3TA 3WNGA 4KHWA 3O4QA 1IH7A 1RDCA 5C25A 2HNDA 5KGWA 5KTQA 1D8YA 3K2PA 4CFDA 3IAYA 4DSKA 1REVA 3HVTA 4CJTA 3L2UA 1Z25A 1ZBUA 3AVLA 2IC3A 3ZT0A 3CFPA 3DLHA 1WSFA 3VA0A 4DTUA 3KLFA 1IO2A 1RDBA 4CEQA 3G0ZA 3PX0A 4GVMA 4CJWA 2VWJA 3OJSA 1VSJA 4CJQA 2PZSA 1HRHA 3RR7A 1RT3A 3EY1A 3PY8A 1NJXA 5HP1A 3VQ6A 1ASUA 2I5JA 4KHNA 1TKTA 3SUQA 3PX6A 2FC0A 4H4MA 4OJRA 4CK2A 3HT3A 3V6DA 2GV9A 1S9EA 1BQNA 3AA4A 4OPKA 3TAPA 4F8RA 1IKXA 2P51A 5SZTA 3LWLA 2OPQA 4DS5A 2GBZA 2XHBA 4I7FA 3AA3A 4Z4IA 1TKXA 3OYJA 2Z1IA 3HM9A 3K5LA 1NK4A 2VG5A 4FM1A 3DLRA 4I2QA 3VN5A 3HPOA 3PO5A 1EKEA 3SNNA 4B8CA 3TAQA 4R5PA 4N56A 1SUQA 1BGXT 2B4JA 3FFIA 4O5BA 4O0JA 3NCIA 3LPTA 5C42A 3NFAA 4DSIA 5JS1A 1WN7A 3RR8A 3V4IA 1KCFA 3AVJA 4OVLA 3VQDA 3ZT1A 3HP6A 4CGDA 2PYLA 1U47A 4FLXA 3U3GA 3BDPA 3MXIA 4FJMA 4M3XA 2QKBA 5FDLA 4CGIA 3S9HA 1WAJA 2Z1GA 4KB1A 3THVA 3LPUA 4DTJA 2X78A 2YV0X 2XO7A 4I9QA 1S5JA 3DRRA 4M45A 2VG6A 2KZMA 1NK6A 1DLOA 3WNFA 4UQGA 4DMNA 2F8TA 4CJ4A 4PQUA 1RCHA 3OS0A 2A1RA 4NCAA 4LSLA 3KTQA 3B6PA 1C1CA 3ASMA 3L3VA 1LWFA 1Z26A 3KD5E 3HJFA 1UOCA 1X9SA 4E3SA 4OKEA 3NAEA 3QINA 3KLHA 4BDYA 4IFYA 2HHUA 5CY4A 1TAUA 3AVNA 2Y1IA 4DU1A 1JL1A 4XIUA 1D9DA 1TKZA 3ZSQA 3DLKA 3OYFA 4FK0A 1JLGA 2G8UA 2YNFA 3QLHA 4RG8A 1QS4A 4BE2A 4CEOA 4CHPA 2XY5A 4AHTA 4FLYA 1SKRA 4C8LA 4FJ7A 3ITHA 1JL2A 2KFNA 2YHAA 3QNOA 1DTQA 2R7YA 1U4BA 2QKKA 2JGUA 1HYZA 2Z1JA 3HPGA 3OS1A 3S3OA 1L3VA 1LW0A 1JLFA 1L5UA 2E6LA 3OYGA 3QEXA 3NH0A 1QHTA 1XHXA 4IDKA 1SKSA 4CF8A 5SWMA 4ZTJA 4M42A 2EHGA 1BIUA 1JLAA 3AVCA 4DTXA 4DF8A 4DSLA 1FXXA 5HRSA 1KLMA 1RBRA 2OPPA 3C6TA 4CF0A 4CHZA 5HRPA 4CJFA 5I42A 1C1BA 4ZTFA 4M3YA 5HRNA 3SPZA 1TVRA 2ITGA 2IS3A 4CEFA 3OYMA 3S3MA 1NJYA 1T7PA 1VSLA 2YNHA 3VA3A 2RPIA 3B6OA 1RNHA 4CGHA 4DTPA 3RRGA 4BDPA 4CJRA 3AVIA 3LP2A 3HP9A 3OYLA 2E4LA 1WSEA 3CM5A 1JXBA 3ZSVA 4N5SA 1WSGA 4Y1DA 4CHNA 4OPJA 4C8OA 1Q9YA 1EETA 3S3NA 3ZSXA 1LW2A 4CGFA 4FJ5A 3TWHA 4QOZB 3OYEA 2ATQA 4J2DA 2IDOA 3AO3A 3D45A 2GUIA 4AH9A 3SV4A 3ZSOA 3ZSZA 3K59A 4DQIA 4KB0A 4CHOA 1S9GA 2FBTA 3AVHA 1RILA 2YKNA 3MECA 4W5QA 4B9MA 2YNGA 1W0HA 3D0PA 1GOAA 3NE6A 1NOYA 3I0SA 3UIQA 3ZSRA 1RT1A 2Q3SA 4KTWA 3TAEA 3TI0A 3QETA 3AO4A 2FBXA 3SUOA 2OA8A 4B9SA 2O4IA 2WOMA 1NJZA 4N47A 1TK0A 1UA0A 1KVCA 2YKMA 2B5JA 3O3FA 3OYHA 5HBMA 1X9WA 5KRTA 4RW6A 3VQCA 4FJ9A 3BGRA 1R0AA 4AHCA 1NKCA 4LY7A 1TK8A 3V1QA 2G8WA 1JXEA 4J2AA 3HVRA 1HQEA 1RT4A 4KV8A 1BI4A 2KQ2A 1U49A 1HPZA 1BCOA 3K57A 3F9KA 5FROA 3NGZA 1WAFA 3OVNA 1YTUA 2HVIA 2OZMA 3SUNA 1IKWA 4AHVA 4F2RA 3OYIA 4LSNA 1TV6A 3A2FA 3L2WA 4JS5A 3KKSA 1A5WA 3NF6A 3RRHA 4CJKA 4FM0A 4FJLA 4OGEA 1RDDA 1UAXA 2BDPA 1BISA 4J2EA 2ZQBA 4MQ3A 2BGGA 4PY5A 4GMJB 3MEDA 4CF1A 1CLQA 3SCXA 3ZT4A 3VQ5A 4O0IA 4M3ZA 1S6QA 5KGXA 4E7HA 3PV8A 4DQPA 3SQ1A 1XC9A 4O44A 3WNEA 2P5GA 2WONA 3ALYA 4AHUA 4HCBA 2KTQA 4WE1A 2IGIA 4CJVA 3U6FA 1TL3A 4YNQA 4DFKA 2F96A 4CCHA 4FJXA 1VSMA 3I0RA 5K14A 2G8HA 4KAZA 2FBYA 3VQ7A 1CXUA 2RF2A 4DSEA 1BIZA 3MEEA 3T3FA 1G15A 3L2RA 3MXMA 2OYQA 3LZIA 4NCBA 2RKIA 1S6PA 4LH5A 1D5AA 5HRRA 2OZSA 4B9LA 4NYNA 1ASWA 3AA5X 1NK0A 1RT7A 3K5NA 3ISNC 3TANA 4F4KA 1ASVA 4M3WA 4BE1A 3TAMA 4DQQA 1C0MA 3AVFA 1NK9A 4FZZA 2XY7A 1X1PA 1XI1A 4C8KA 4FLUA 3NBPA 1S1TA 4KTZA 1WSJA 3HPHA 3ZT3A 4HCCA 3CM6A 1Y97A 4LH4A 4OGCA 4KHUA 3U3YA 4CEZA 1TGOA 3K58A 5HLFA 4DSJA 4FLWA 1YVUA 3CG7A 1NKEA 2HMIA 1EXQA 1FKOA 4FM2A 4CHQA 3EYZA 4KRFA 1VRUA 3OYCA 4IBNA 3KK3A 3AA2A 1WLJA 4W5NA 4KHYA 1U48A 1A5VA 2DFHA 2X6SA 3LP1A 3T19A 3IRXA 4W5RA 1QSSA 2KFZA 1BQMA 2AJQA 4DTMA 2DFFA 2HW3A 4QAGA 1BHLA 3KK1A 1JLQA 2D0CA 1CXQA 3KK2A 4KI6A 1A5XA 1EX4A 3AVGA 4DFMA 3M8SA 2HHXA 3DOLA 1HNIA 4RW9A 4CJ5A 1KVAA 4CFBA 2NUBA 1RTDA 1T8EA 4CESA 4ID1A 4CIEA 3OYKA 3RMDA 4HTUA 1FK9A 4ELTA 4Z4GA 4I9LA 2D0AA 3SV3A 3CQ8A 4FJKA 3SQ4A 1WSIA 4CIGA 4DG1A 3KJVA 3DLBA 2HVHA 4ICLA 4Z4FA 2Z1HA 3ZCMA 5CZ1A 2JLEA 1TK5A 1BCMA 3NF9A 1HQUA 1WSHA 1ITGA 3NGYA 2HB5A 3O4NA 3L3UA 3SYZA 3AVBA 4NCGA 1GOBA 4DQSA 2PY5A 3SPYA 3QEIA 3K5OA 3QERA 1NKBA 5CYQA 3M8RA 4M3UA 3TAFA 4Y1CA 3VQPA 2W42A 3L2VA 1UWBA 3LP0A 4KO0A 1J53A 4E1MA 4B08A 4CEEA 1Q8IA 3L8BA 1KRPA 4IFVA 4OKJA 3DLGA 1RDAA 4Z0UA 4HVJA 3OYAA 1Q9XA 4H4OA 4F3OA 3P83D 1IKVA 4DTRA 1UA1A 1RTIA 4C8NA 3V1RA 3KLGA 1U45A 1VSIA 1SL2A 5JS2A 4BE0A 1N6QA 4JLHA 3VQ8A 4FVMA 3KLEA 1YTAA 3QIOA 4PWDA 4G1QA 3SUPA 1VSDA 4AHSA 3WNHA 3RWUA 4FLZA 1LV5A 1S1VA 3QIPA 5EU7A 3PO4A 2OPSA 3M8PA 1VSHA 3E01A 2DTUA 3SQ2A 3M8QA 3PUFA 1JLCA 1L3SA 4F2SA 3RMCA 1IKYA 1VSFA 4CF2A 3AVKA 3LZJA 4B9VA 2DY4A 2X74A 3DM2A 4AHRA 3DLEA 3QEVA 4CIFA 1C0TA 1RTHA 3JYTA 4BACA 3DI6A 3HL8A 4FJHA 1DTTA 3OJUA 3NHGA 3AO5A 3V9UA 3VQAA 4DLEA 3SI6A 4FW1A 4BWJA 2P1JA 4CF9A 4FJ8A 2ZD1A 3NGIA 1KVBA 1LWCA 4W5OA 1K6YA 2XRIA 4CFCA 1TL1A 4CJ3A 3AO2A 1J54A 2EX3A 3DMJA 1RT6A 1C0UA 4B9TA 2KZZA 3LAKA 2G8VA 4RW8A 1RT2A 4YFUA 4HUFA 4KPYA 5I3UA 3DOKA 3HYFA 3MAQA 4KTQA 4C8MA 1CZ9A 3RMBA 2VWKA 4TSXA 1B9FA 2HNZA 2VG7A 4KKOA 1ZBIA 2DFEA 4N41A 1RBUA 1I3AA 3V9XA 4JRQA 3IS9A 4ZHRA 1B92A 4EP4A 4DS4A 4CERA 4M3TA 4DSFA 1FKPA 2FBVA 3EZ5A 4DTOA 4KI4A 2HHVA 2HHSA 2D0BA 1HJRA 4HUGA 1HMVA 2ETJA 4KREA 1C1AA 4NYFA 4CECA 4DU4A 3NF7A 3DRSA
chains in the Genus database with same CATH superfamily
1RBTA 4O8KA 4BWMA 4FK2A 4FL9A 3KD1E 2B6AA 3ZSWA 4KHSA 4M7YA 1GOCA 4RW4A 4FPBA 5J2MA 1YT3A 1K9MO 3ZT2A 2PYJA 1QTMA 4CJPA 1OH7A 4K25A 3HM8A 3OY9A 1U2VB 4JI1K 4IG0A 4E0DA 2BANA 4FJJA 4M3RA 3VQQA 1ZBLA 2Q1NA 4CFAA 4CHYA 4E1NA 2YJFA 1XHZA 1KSPA 1RTJA 5AFUA 3OS2A 1ZYQA 1E4GT 1LWEA 3KK7A 3CJ1A 3R9PA 4L8RB 1EO1A 1XC3A 1VQ5N 4JKBA 3IUCA 1LAWA 5M1FA 1NK7A 3CIPA 3TPQA 1BI4B 4U7BA 2O8CB 1C6VA 3DYAA 1F21A 3CCLN 1DT9A 2P9UA 5KPZA 4IKFA 4FZYA 3CHWA 3OTOK 4EFHA 3HO1A 3FZHA 1IG8A 2A42A 5KPTA 2QWLA 4FCYA 2QXFA 3VQEA 3KZBA 5AQLA 2YI1A 3O8MA 4CVNE 5GIOA 1BG3A 3MN5A 5LJVA 2UXDK 3LALA 4G9ZA 1L3TA 1VSKA 4H0XB 5AJ3K 2YCHA 4FWSA 4JS4A 4HHTA 3MXJA 2YHYA 3TARA 3OYBA 4XH4A 3TTCA 4BC3A 4DTNA 1T3VA 5J2PA 1VQON 4GY2B 3O3HA 3QNNA 1MU2A 2F8SA 5DM7L 1M90O 1GLFO 3C6HA 5DK5A 2VYPA 4JKFA 3KKRA 4J2BA 5H1SQ 4JNEA 2E6MA 4EP5A 3QFUA 4CZFA 5T7BA 2P5OA 4KHWA 5C25A 1RDCA 2HNDA 4DCHA 3K2PA 1BA0A 3AVLA 4UY8O 2IC3A 3ZT0A 2WBNA 3CFPA 3DLHA 3VA0A 3UKRB 1HLUA 1RDBA 3U9ZA 4JK8A 3P38A 4GVMA 1YIJN 3AY9A 4BRDA 4CJQA 1X3MA 1YAGA 1ASUA 2I5JA 4B1XB 3SUQA 4H4MA 3HT3A 3V6DA 2GV9A 2HF3A 3SLCA 3TAPA 4F8RA 1N36K 3C6AA 2OPQA 1QZ5A 2Z1IA 3VEXA 4LFCK 2VG5A 2QM1A 3OA9A 4I2QA 3VN5A 2JWLA 4CZLA 1BGXT 3NCIA 4R79A 3LPTA 2FXUA 3HTVA 4CGDA 3GL1A 3LL3A 4IWVA 3S41A 4PKIA 4FJMA 2A6AA 3S9HA 1YVNA 5GINA 1WAJA 4BQLA 4RCHA 2Q36A 3WXMB 1NK6A 2F8TA 1RCHA 4ILHA 4IEIA 4LSLA 1MDUB 3PIOL 2HF4A 3K9JA 3O80A 4DV2K 4BDYA 4IFYA 3AVNA 4DU1A 4JKGB 1D9DA 4LF4K 3ZSQA 4DR5K 5BN9A 2G8UA 4RG8A 1SKRA 2RE2A 3ITHA 3Q7BA 4YOYA 2KFNA 3Q7CA 4QS9A 1DTQA 1U4BA 2QKKA 1NGJA 2Z1JA 2HMPA 3WQTA 1JLFA 1L5UA 3E1YA 3D2FB 3NH0A 5SWMA 2NRWA 4BRCA 2IVPA 3GE1A 2EHGA 4ZTJA 1VQ9N 5M1PA 4CF0A 5HRPA 5I42A 1M1KO 1C1BA 3W3DA 2E5LK 1VSLA 4K43A 2UUAK 1YJNN 4ILJA 1RNHA 4CGHA 3DXMB 3OYLA 4DV0K 2D4WA 1WSGA 3CMAN 3O9QA 3S3NA 4BR7A 4PL8A 3JS6A 2IDOA 1W2BM 5AQZA 4FOEA 4WFBL 3ZSOA 1U2VA 3K59A 4DQIA 4FWKA 2ZJQL 2FBTA 3AVHA 1RILA 2YKNA 1KC8O 4DV5K 3D0PA 3NE6A 1N8RO 5C2FA 3SUOA 5BR9A 1NJZA 2ZM6K 3MN7A 1KVCA 3O3FA 2OCEA 2O8DA 1GLEG 3BZKA 3BGRA 1NKCA 3CQXA 1ATSA 3V1QA 2Q0UA 2HBKA 3THYB 1RT4A 4YOWA 1U49A 1BI4A 4A2BA 1HPZA 1BCOA 1HKCA 3F9KA 3NGZA 2HVIA 2O8CA 4ISGA 3SUNA 1NGDA 1QQNA 3VEYA 2ASOA 1A5WA 1UAXA 2BDPA 2BGGA 3EE9A 3MEDA 4O8UA 5GADP 4O0IA 3CI5A 3H1VX 4IOXA 4DQPA 4DR1K 2P5GA 3CCEN 3LDOA 2O8EA 3ALYA 2W40A 4AHUA 2W6KA 5TKYA 1WBBA 4WE1A 3U6FA 4YNQA 4DFKA 1VSMA 3I0RA 2G8HA 1C0FA 3VQ7A 2PFUA 4BR9A 1BIZA 3MEEA 1KXPA 3MXMA 1ZC6A 4BQZA 3LZIA 2RKIA 1S6PA 3WXJA 2E2OA 2OZSA 4F4KA 1NGIA 1OH5A 1ASVA 2OTLN 4DQQA 3TAMA 1NK9A 3AVFA 4BRAA 4FZZA 3LDQA 2WUSA 1XI1A 2CGLA 4OPHA 2V51B 3HPHA 4F9OA 1Y97A 3CQYA 4KHUA 2CH6A 4JK7A 3CG7A 4QS8A 1VQMN 1EXQA 3KHYA 4H5VA 2AP1A 1VRUA 2VGNA 5E84A 5GIPA 1OVQA 3E9LA 4X65K 2ZGYA 4W5NA 5EOYA 1A5VA 2X6SA 3LP1A 1QSSA 3VPZA 2VGMA 2O8BB 3M1FA 5FLXO 4DV1K 2HW3A 2DPNA 3LM9A 3R8EA 4QAGA 3VTHA 1K8KA 4BRQA 4BR5A 3M8SA 4MO4A 4AM6A 4CFBA 1KVAA 1QZ6A 3ZETB 4DV4K 2NRHA 4HTUA 4ELTA 4Z4GA 4BRLA 3SV3A 2HBMA 4CIGA 1ZBSA 4DR2K 4Z4FA 2Z1HA 3EZWA 3FE1A 2ZF5O 1TUYA 5BPNA 4BRPA 3AVBA 2E1YA 4CBXA 1BOTO 1NKBA 2NRZA 3OHRA 1OH6A 2NRVA 1BDGA 1BO5O 1J53A 4YHHK 2QTDA 3DLGA 2QA4N 5LMNK 1Q9XA 2A40A 3V1RA 1U45A 1SL2A 1VQ6N 3AARA 5DM6L 5M1NA 3KLEA 1YTAA 3QIOA 3LDNA 3ZYYX 4AHSA 4FLZA 2E2PA 5EU7A 1VSHA 3EL2A 3E01A 2DTUA 3SQ2A 1L3SA 4KH4A 3DM2A 2VQFK 2E88A 4GV3A 1ATRA 3DI6A 4LFBK 3VQAA 3EKSA 4CF9A 2ZD1A 2XRIA 4BROA 4CJ3A 4JD2A 1NMNA 4B9TA 3M3ZA 2KZZA 4M63C 1J5EK 1HPMA 4B1WB 5BN8A 3HYFA 3MAQA 1CZ9A 3L4QA 4TSXA 2HNZA 2VG7A 1I3AA 4JRQA 3IS9A 2Q31A 1TYQA 4DSFA 4KI4A 2YX6A 1ESVA 2HBJA 1C1AA 4CECA 3NF7A 3CCVN 3G10A 3SJJA 3C7NB 1B9DA 3H08A 3VMFB 4OKKA 1QE1A 5LJWA 4ELUA 2CGKA 1BU6O 4FWOA 1U04A 2P9KB 4B8AB 4AILC 4EZ6A 3C6UA 1NGGA 1S1UA 3DRPA 3KIOA 3LAMA 3RTVA 3V9ZA 2P9IA 1SV5A 3TSPA 4A62A 1KFSA 3CCUN 2HHHK 1YUWA 4E19A 1N5YA 5J1EA 1SKWA 1KFDA 4DSLA 3WQUA 4CE9A 4CJSA 5CHIA 3BY5A 3SAFA 3O9UA 3CFOA 4LF9K 1CZBA 4B9QA 4FW2A 3HXMA 1QSYA 5KRSA 1N32K 4LD0A 5AZIB 3AAQA 5BRFA 3K0SA 1TKDA 3L2QA 1IG9A 3H45C 1JCFA 2EWSA 5J2NA 4EIAA 2VQEK 2RN2A 4YDUA 5DMRA 3LP3A 3MX5A 4E89A 4GV9A 3JAMO 3BP8A 2A5XA 3D2EA 1NJWA 3TR8A 1T05A 5CYMA 3C94A 3PX4A 4DR7K 3P1GA 3V1OA 2G8FA 1X3NA 1D9FA 2E2NA 2E1ZA 3CYMA 3THWB 3QB0A 2A41A 2IOCA 4MLEA 3CC4N 4EAHD 3AV9A 5LY3A 3THXB 4EZ9A 1S1WA 2HSTA 2D1KA 3QBXA 4Z4HA 1IV0A 2O8FB 1Q82O 4DV6K 1SL1A 4M41A 2OPRA 3AVMA 3O4WA 2HBLA 5M1OA 4CEBA 2HHWA 3CFRA 3LANA 1JKHA 1RBSA 4PA1A 1FW6A 3VEZA 2HHQA 4FJNA 5AQNA 3B8AX 4CJ7A 5C10A 3E66A 3T1AA 2P9NA 3BUZB 4H03B 4O4GA 3CJBA 4BDZA 1I39A 1S1XA 2KKZA 3WXIA 2QK9A 5C2DA 1XWLA 2X6NA 1ATNA 3FFKB 3ULDA 2BE2A 2XY6A 1NM1A 4YY3K 4NXNK 3ATUA 1J5OA 4FWLA 1QQCA 3ULEB 1MWKA 1EP4A 3F73A 3O4QA 4FOIA 1D8YA 4DSKA 5KTQA 3IAYA 4CFDA 1REVA 3FZMA 4H0PA 3ZX0A 3L2UA 1WSFA 2GUPA 3J8AA 4H0TB 3WEEA 4JHDB 2IIRA 4CEQA 4X66K 1VSJA 2PZSA 3PY8A 3H6EA 4WQ5A 4B3SK 1NJXA 3DLLL 1K73O 4OJRA 3RSEA 1BQNA 3SMPA 4BVPA 1NU0A 3QMLA 2GBZA 3ATVA 2XHBA 1WOQA 3VEVA 1TKXA 4BC5A 3PIPL 3HM9A 1NK4A 5AQIA 4XH1A 5E26A 4B8CA 3TAQA 4R5PA 4AF1A 4O5BA 3NFAA 1WN7A 1KCFA 3VQDA 1HUXA 4BRGA 3BDPA 1P90A 4M3XA 2Z1GA 4KB1A 3G6EN 4DTJA 2X78A 2YV0X 5KQ8A 2XO7A 3DRRA 2KZMA 2VG6A 4PQUA 4DMNA 3OS0A 4NCAA 3B6PA 3L3VA 3KD5E 1LWFA 4A61A 1UOCA 4CW7B 4E3SA 4OKEA 3NAEA 3KLHA 2Y1IA 1JL1A 4XIUA 3DLKA 3OYFA 4FK0A 1JLGA 2YNFA 4CEOA 4C8LA 4WFNL 5BRDA 2YHAA 1BWFO 2FF6A 1HYZA 1L3VA 4IJAA 3G4SN 1LW0A 2ASPA 2E6LA 3OYGA 1XHXA 5F2RA 4DTXA 1BIUA 1RBRA 4HWIA 2IVNA 4M3YA 5HRNA 3SPZA 2ITGA 2IS3A 4CEFA 3OYMA 3S3MA 1N34K 2YNHA 2RPIA 1YHQN 3J81O 4CJRA 3CCJN 3HP9A 3C7NA 3LDLA 3CM5A 1VAZA 2ITMA 5AQMA 4CGFA 4FJ5A 2P9KA 1QVGM 3TWHA 1EQYA 3J80O 2F9TA 3AO3A 4H0OA 4B3MK 3D45A 2GUIA 3SV4A 2PAVA 5FPNA 1S9GA 4IO9L 3CMEN 2YNGA 5B8HA 3I0SA 3TI0A 1C0GA 3CJ7A 4B9SA 2CH5A 2P9SB 2YKMA 1X9WA 4RW6A 1R0AA 4LY7A 4JAXA 4KH6A 5AZIA 1TK8A 2E8AA 4FSVA 3HVRA 3H46O 4KV8A 2KQ2A 1DGKN 1WAFA 1YTUA 4GVEA 3OYIA 3L4IA 4M7XA 3NF6A 3RRHA 1V4SA 4JI4K 3VF2A 3O1BA 4CF1A 2YJEA 3O9TA 5KGXA 3PV8A 3SQ1A 5JLFA 1XC9A 3THWA 2WONA 4HTLA 4CCHA 2IGIA 4FJXA 1GLBG 4KAZA 2RF2A 4DSEA 3THXA 1G15A 3CJCA 2O8FA 2GWKA 3MK6A 1D5AA 3MCPA 1NK0A 3K5NA 3ISNC 4M3WA 4A5BA 2XY7A 4FLUA 3NBPA 1S1TA 4YORA 1WSJA 1LOTB 3SBTA 1LCUA 4OGCA 3U3YA 4CEZA 4BR2A 4B3RK 4FM2A 3FLCO 3EYZA 1VQNN 4IBNA 3KK3A 3WT0A 3AA2A 1N33K 1YXQA 1WLJA 3CPEA 2DFHA 5AQSA 3IRXA 3T19A 2AJQA 4DTMA 4NLBA 3J7ZO 2UXCK 1BHLA 5AR0A 3KK2A 4KI6A 1A5XA 3AVGA 5C15A 3HOTA 1HNIA 1RTDA 2NUBA 1T8EA 4CESA 3H1QA 4CIEA 3RMDA 1U6ZA 4H5NA 1FK9A 4I9LA 2D0AA 4DG1A 3KJVA 4K42A 5CZ1A 1TK5A 3DWLA 1HQUA 1ITGA 1BUPA 2HB5A 3O4NA 3QICA 4FWPA 4DQSA 5AFUH 1GLJO 3QEIA 4M3UA 3TAFA 4Y1CA 3VQPA 3L2VA 4KO0A 4B08A 1Q8IA 4IFVA 4OKJA 2J4RA 3GBTA 2I7PA 3TSQA 3FZKA 1UA1A 4C8NA 5JVHL 5JS2A 4BG8A 4PHTX 1VQPN 4FVMA 4PWDA 1VSDA 1LV5A 3GG4A 3M8PA 3QDKA 1KQSM 1GLLO 1NWKA 3M8QA 1JLCA 4DR4K 3AVKA 2WFBA 5AQJA 1MWMA 3QEVA 3DLEA 4CIFA 1C0TA 3JYTA 4BACA 2QWNA 4MDAA 3OJUA 2ASMA 3V9UA 5AZJB 3SI6A 4MLHA 3FGUA 2OANA 3NGIA 4W5OA 1T6CA 1TL1A 4DHYA 2EX3A 3LDPA 4A5AA 4YFUA 3O9RA 1SS6A 4KTQA 3RMBA 1R59O 1NBWA 3SAGA 4JI0K 4N41A 3WXKA 5LL6Z 5GAEP 4Z94A 4CERA 4V19S 2FBVA 3EZ5A 2HHSA 1RGIA 3CERA 4MO5A 2D0BA 2ETJA 4DU4A 1IBLK 4DTSA 4K8ZA 1NGFA 2ZE2A 3I8DA 3IMXA 3QO9A 4FZXC 4DFJA 3UKUB 5HROA 2G8KA 1JCEA 1J9AA 1T6DA 2LSNA 2KW4A 4B3OA 3GOIA 1X9MA 1E3MA 4CEDA 4GW6A 2IAJA 4KHQA 1RBVA 4CJLA 1MA9B 2A1SA 2QWMA 4YOVA 5IT9O 1XUPO 4DFPA 4IO8A 2HHXA 1XQSC 4B9UA 4K0KK 3F5TA 1TAQA 2GTDA 2V7YA 3LM2A 3BF3A 4CGJA 4KFBA 2YHBA 5EX5A 4O55A 5C0YA 5BR8K 3LDSA 2VCPA 3AO1A 3A5MC 3RMAA 1W9HA 2Y1JA 2WC9A 4YDUC 5AQRA 3UKRA 4CJEA 3U4LA 2HHTA 5EXWA 3VEWA 2HNYA 3VGKA 3NH1A 5HOOA 3M5RA 4C1NI 3P39A 2D0OA 3NF8A 3R1XA 5AQGA 3PSFA 3NDKA 1SZ2A 3A8YA 3ZEUB 5FRNA 1KTQA 4DU3A 2NLXA 3MCAB 1L3UA 1JLBA 4CZJA 2Q0RA 3O6WA 4BR0A 3ZX2A 4DLGA 4W5TA 4Z4EA 5KI6A 3LWMA 4WF9L 4PUOA 2QEXN 2ZJRL 4CZEA 1IBMK 5JICA 4JI8K 3G25A 4I2PA 5AQTA 3QESA 4FJGA 2YNIA 1WNSA 4HUEA 3V9WA 4ELVA 4FYDA 1BL3A 4BRFA 3BZCA 3D6RA 5BPMA 1HYSA 4FLVA 4JKGA 4MFBA 1HNWK 1LAVA 5FPMA 4CD3A 1IH7A 5KGWA 5F1XA 1J6ZA 5GAHP 2P9UB 4CJTA 1ZBUA 4O5FA 4FWQA 4WQ4C 3AGRA 4DTUA 3KLFA 3VOVA 3D2FA 4CJWA 3WUHA 4DV3K 3RR7A 1RDWX 4ISFA 3FZFA 1WUAA 3VQ6A 4KHNA 3EKUA 2UU9K 2FC0A 4WQ5C 4CK2A 1S9EA 1NLVA 4OPKA 1IKXA 2P51A 3LWLA 3JXUA 3DXMA 3BEXA 4FWNA 4C23A 3SK3A 4FM1A 1W97L 3DLRA 3HPOA 3WXLA 3PO5A 3SNNA 5F0XA 2JWKA 4I6MB 2OTJN 4N56A 1SUQA 2B4JA 3FFIA 1X9JA 3T1YK 5C42A 3I33A 3RR8A 3V4IA 4B1UB 2W41A 5AQOA 3ZT1A 2UYTA 1G99A 1Y64A 1U47A 3U3GA 3K9KA 3THVA 3LPUA 3CCRN 2QW9A 1S5JA 1YJ9N 1E4FT 1DLOA 3BF1A 4LF8K 5A2QO 1Z26A 3THYA 5JMVA 3G71N 2HHUA 5CY4A 4JI6K 3NVKA 1TKZA 3ENOA 4IOCL 3QLHA 4BE2A 4CHPA 1JL2A 2V52B 5BRHA 3S3OA 2NRRA 3QEXA 3VENA 1SKSA 4CF8A 4JI7K 3OBWA 4DF8A 1JLAA 5HL7L 1FXXA 5HRSA 1KLMA 1KD1O 1HKBA 2QWPA 3C6TA 4CHZA 4I9QA 5AQWA 1TVRA 4IDHA 1NJYA 1T7PA 4H5WA 1EWQA 1S22A 1XMQK 3LP2A 5JLHA 2E4LA 1WSEA 4N5SA 4ISEA 2P9LB 3MN6A 4Y1DA 4C8OA 3UKUA 1DEJA 1EETA 3ZSXA 1LW2A 4JKCA 4IXCA 4QOZB 3OYEA 4J2DA 4OO1J 3E9OA 3VTIA 4AH9A 3ZSZA 1HNXK 4KB0A 4AQYK 5MLCQ 4W5QA 4B9MA 1W0HA 4H5TA 4KBOA 1HNZK 3IKMA 4YOTA 3UIQA 5EY4A 3ZSRA 1RT1A 2OA8A 2FBXA 4B3TK 3A5LC 3F2KA 1QHAA 3EO3A 2B5JA 2O8BA 1ILYA 5KRTA 3VQCA 4FJ9A 1KAZA 5FPEA 3C65A 2G8WA 4J2AA 4WQ4A 5ADXH 4PL7A 1I94K 3OW2M 3ZETA 3K57A 5FROA 2A3ZA 1TV6A 4FM0A 4FJLA 4OGEA 1BISA 3TTFA 4MQ3A 3ZT4A 3VQ5A 4M3ZA 4C1NK 4OX9K 4DR3K 4O44A 3WNEA 1Z05A 4CJVA 4BRMA 4CBUA 2F96A 3CXCM 5K14A 1CXUA 2Q2RA 4DUYK 2FSNA 3ZX3A 3L2RA 3MX2A 3ZEUA 4LH5A 5HRRA 4B9LA 1WB9A 1ASWA 3TANA 5KQDA 4BC4A 3I55N 1C0MA 5AQVA 4KTZA 3ZT3A 4HCCA 3CM6A 4CZGA 3MDQA 4LH4A 5BREA 1TGOA 3L0QA 3MMVA 4OPAA 1YVUA 1NKEA 4CHQA 4WCEL 1V4TA 3OYCA 4NXMK 1VQ7N 3I8BA 1U48A 1HR0K 1O13A 2O8DB 1KAYA 4CZHA 2D0CA 2W6LA 4XEIA 1EX4A 5CE3A 2F4VK 4ID1A 4BR4A 2YHXA 1RDUA 3PSIA 3CQ8A 3SQ4A 3DXKB 4NO7A 3DLBA 4ICLA 4H5RA 4JI2K 2JLEA 4JKDA 3NVMA 3NGYA 1GOBA 2PY5A 3SPYA 3K5OA 2O8EB 2E20A 3ENHA 1NGCA 5CYQA 4CZIA 2W42A 4E1MA 3L8BA 3IDHA 1KRPA 4KH5A 3PLAA 1NGAA 4Z0UA 3P83D 1IKVA 3ZLJA 1RTIA 4A57A 3KLGA 4I6MA 4G1QA 3SUPA 4J8FA 1DKGD 1S1VA 4X62K 3PO4A 2OPSA 2NZTA 1JJ2M 3TU5A 3PUFA 4CF2A 1VSFA 4B9VA 3VESA 1JCGA 2X74A 2ZJPL 4JN4A 3NHGA 1VQLN 4FW1A 4BWJA 5BPLA 4FJ8A 2P9PB 1KVBA 3VF4A 4CFCA 1K8KB 3A5OC 3AO2A 1J54A 5I9EB 1Q86O 4RW8A 1RT2A 2QWRA 4HUFA 4KPYA 4C8MA 2VWKA 2DFEA 1RBUA 1T44A 4EP4A 4DS4A 1NG9A 1FKPA 4DTOA 1YF5L 2UXBK 2HHVA 4HUGA 4KREA 4NYFA 3F9MA 3DRSA 3HRGA 3TSUA 3CJAA 2NNWA 1NOZA 4BG9A 4FK4A 4JYAK 1O1WA 3DJCA 4E7JA 3UB5A 2G8IA 3T69A 3H3NO 1QSLA 3ZSYA 3JSMA 4Z4CA 3IG1A 2F7TA 5CZ2A 4U67L 3HK2A 3O3GA 1VRTA 4QS7A 4FVUA 1HNVA 2P9LA 3TABA 3CETA 2E2QA 4LC9B 4DF4A 5TKWA 4JRPA 3NMUA 5E41A 4RTFD 4DB3A 4FXDA 4E7IA 4RWTA 3N4PA 1IJJA 3SZ2A 3QEPA 3K5MA 1JLEA 4IG3A 1VQ8N 3TAGA 4E7LA 3KLIA 5ELZA 4CK1A 3P4IA 2D5RA 1RT5A 3KVGA 4RW7A 3QEWA 3ULEA 4Q0BA 3HSTB 4FLTA 2KLAA 4CEAA 3R3LA 1ZXOA 4DWIA 4IOAL 3OYNA 1GLCG 3J7AP 3TTDA 1KAXA 3VQ9A 3V81A 4JD2B 3HZ6A 4OLAA 3ID8A 4JHDA 3VQBA 4K8XA 3U8XA 1NK5A 5EVZA 1ZBFA 1VQKN 2BH1A 1YITN 4FPAA 4ID5A 2XY8A 1RFQA 3UE5A 1T03A 1TYQB 3SQ0A 1VK0A 1QVFM 3P5JA 4A59A 4B9NA 4E7KA 3MWPA 3C95A 4H8KA 5JVGL 5FRMA 3MN9A 3NH2A 1BA1A 2BUPA 5D3GA 2O4GA 4BREA 3VQ4A 5M1KA 4QCLA 3DAWA 1TUUA 1NGBA 4FJIA 4Q5VA 1XNQK 3V9SA 4N76A 4OLBA 1KLNA 3AVAA 3VGLA 4CGGA 3OYDA 2P9IB 3I56N 2H3GX 3FZLA 1VSEA 3M6GA 2GWJA 3VEOA 4BY9C 4DQRA 4CJUA 4H0YB 1ZBHA 3CCSN 4CK3A 5IWAK 1NK8A 5C24A 1HYVA 1SL0A 2KHOA 4GKKK 2PBDA 3O5BA 3MEGA 2GX9A 1NJIO 5J2QA 4F3TA 3WNGA 4YOXA 4GNIA 2D0PA 2CGJA 3HVTA 1Z25A 3HBTA 4IEEA 1IO2A 3D2EB 3G0ZA 3PX0A 1W7AA 2VWJA 3OJSA 5KPRA 4DQ8A 1HRHA 1RT3A 3EY1A 3DXKA 5HP1A 1TKTA 3PX6A 3R6MA 2FSKA 1YJWN 3VERA 3AA4A 1S3XA 2RHKA 5SZTA 4DS5A 4I7FA 3AA3A 4IZ9A 4Z4IA 3OYJA 3ENBA 1CZAN 4JKEA 3K5LA 3O08A 1D4XA 3KWIA 4DKWA 5M1QA 1EKEA 2QXLA 5AQHA 3CC2N 4O0JA 4DSIA 5JS1A 1FJGK 3A0IX 3AVJA 4OVLA 3HP6A 4DV7K 2PYLA 4FLXA 1OVYA 2P9NB 3MXIA 2QKBA 5FDLA 4CGIA 4WFAL 3FR0A 3O9SA 2P9SA 1H1VA 3GDQA 4M45A 3WNFA 4UQGA 4LF6K 4CJ4A 2A1RA 3AAPA 4DR6K 3KTQA 2GEMA 1C1CA 3ASMA 1NGHA 3HJFA 4BRHA 5AQYA 1X9SA 3L6QA 4A2AA 3QINA 4BRKA 4CZKA 4PKGA 3CF5L 1GLDG 1TAUA 4K41A 2P9PA 4PKHA 4IJNA 4F2RA 3U9DA 2XY5A 1QS4A 4JKAA 4AHTA 3HSCA 4FLYA 2YHWA 4FJ7A 3SMSA 3SJHA 3QNOA 1HJOA 2R7YA 4BC2A 4CD1A 2JGUA 3HPGA 3WEEB 3OS1A 1QQMA 2FSJA 1QHTA 4IDKA 1YI2N 2ZWHA 4M42A 3AVCA 4FO0A 2OPPA 2HOEA 4CJFA 4ZTFA 5CR4A 3RSEB 3VA3A 3B6OA 3E9PA 3RRGA 2Q97A 4DTPA 4BDPA 3AVIA 4YOUA 3ID6A 2WTUA 1WBDA 4JI5K 4B1VA 1JXBA 1Q18A 5AQQA 3ZSVA 4CHNA 2I7NA 3A5NC 4OPJA 1Q9YA 5ADXA 1SQKA 4JI3K 3VETA 3IFRA 4AM7A 2QWOA 2ATQA 2ZGZA 1OKJA 4WYBA 1SAZA 2NRXA 4B1ZA 4CHOA 4DUZK 3MECA 3SBGA 1NOYA 1GOAA 4EHTA 2Q3SA 4KTWA 1QQOA 3TAEA 3QETA 3AO4A 5AQUA 3EEQA 4BVOA 2O4IA 3W0LA 2WOMA 4N47A 1TK0A 1S72N 1UA0A 3QFPA 3OYHA 5LMUK 5HBMA 3J7YP 1XNRK 4AHCA 4H0VB 1JXEA 1HQEA 3OVNA 2OZMA 1IKWA 4AHVA 4LSNA 3L2WA 3A2FA 4JS5A 3KKSA 5C12A 4CJKA 1RDDA 4J2EA 2ZQBA 4PY5A 3VF6A 4GMJB 1IBKK 4BRIA 1CLQA 3SCXA 1Q81O 1S6QA 4E7HA 1NMDA 4X64K 4XH5A 4CBWA 5GAGP 2AA4A 4HCBA 2KTQA 1TL3A 2FBYA 4NLCA 4LFAK 1EWRA 3T3FA 2OYQA 4NCBA 4MDBA 2FLOA 4JK9A 4BGBA 4NYNA 3AA5X 2BTFA 1RT7A 4FWMA 4BE1A 1X1PA 4C8KA 3MWTA 1HKGA 5HLFA 3K58A 4DSJA 4FLWA 3HOSA 5AQPA 2VWBA 2HMIA 1FKOA 3HI0A 4KRFA 3D7EO 4KHYA 5AZJA 4L3QA 4W5RA 2KFZA 1BQMA 1P8ZA 2DFFA 5FPDA 3KK1A 1JLQA 3KWGA 1CXQA 2UUBK 3CPWM 4B1YB 3CC7N 4DFMA 1XMOK 3CCMN 4GKJK 3DOLA 4JKHA 4RW9A 3RVCA 4CJ5A 3OYKA 4FJKA 1WSIA 4IFEA 1VHXA 3H3OB 2HVHA 2UUCK 3AGKA 3ZCMA 1BCMA 3NF9A 1WSHA 3SYZA 2GELA 3L3UA 4NCGA 3T1HK 4Y0WA 3QERA 3N4QA 3T7ZA 4JEPA 3M8RA 1UWBA 3LP0A 3SAHA 4CEEA 4LF5K 1RDAA 4HVJA 3OYAA 4H4OA 4F3OA 3QBWA 4DTRA 2QI2A 1VSIA 4BE0A 4ILGB 5AQXA 1N6QA 4JLHA 3VQ8A 4CI6A 4KHPK 3WNHA 3RWUA 2FF3B 2F9WA 3QIPA 5AQFA 2IVOA 1NGEA 3VGMA 4EHUA 3RMCA 1IKYA 3LZJA 1K8AO 4F2SA 3CJ9A 3CD6N 2DY4A 4AHRA 2QWQA 1RTHA 4FJHA 3HL8A 3CCQN 1DTTA 4LF7K 3AO5A 4DLEA 2P1JA 1NNEA 1LWCA 1K6YA 2V7ZA 4FWRA 4GV6A 3C0BA 3P31A 3EN9A 3DMJA 1RT6A 1C0UA 3LAKA 1Z6RA 2NRTA 2G8VA 4E1JA 1Q7YO 5I3UA 3DOKA 5AQKA 1B9FA 1VQ4N 4KKOA 1ZBIA 1GLAG 3V9XA 4ZHRA 1B92A 3O1WA 3EE8A 4M3TA 3OBYA 4NB4A 4CZMA 4JV5K 4BGAA 4BRNA 1HJRA 1HMVA 1OH8A 1HX1A
chains in the Genus database with same CATH topology
1RBTA 4DTSA 4K8ZA 3G10A 1NOZA 3SJJA 4BWMA 4FK2A 4FK4A 1B9DA 3H08A 2ZE2A 3I8DA 1O1WA 4E7JA 3KD1E 2B6AA 3QO9A 3ZSWA 4FZXC 4KHSA 2G8IA 1QSLA 3ZSYA 4DFJA 1GOCA 3JSMA 4OKKA 4RW4A 1QE1A 3IG1A 4Z4CA 5HROA 5CZ2A 2G8KA 4ELUA 5J2MA 1YT3A 3ZT2A 1J9AA 2PYJA 1U04A 1QTMA 4B8AB 4CJPA 1VRTA 2LSNA 3O3GA 3HK2A 4AILC 4EZ6A 2KW4A 1HNVA 3C6UA 4B3OA 3TABA 1X9MA 1S1UA 4CEDA 3OY9A 4DF4A 3DRPA 4GW6A 4JRPA 3KIOA 5E41A 2IAJA 3LAMA 3RTVA 3V9ZA 1RBVA 1SV5A 4IG0A 1KFSA 2BANA 4E0DA 4FJJA 4KHQA 4M3RA 4CJLA 4FXDA 4E7IA 2A1SA 4E19A 3VQQA 1N5YA 5J1EA 1ZBLA 1SKWA 4CFAA 1KFDA 4CHYA 3SZ2A 4CE9A 4CJSA 4E1NA 4DFPA 3K5MA 1JLEA 1RTJA 3OS2A 3QEPA 4IG3A 1XHZA 1ZYQA 1KSPA 4B9UA 3TAGA 1LWEA 1TAQA 4E7LA 3CFOA 4L8RB 1CZBA 3HXMA 3KLIA 4FW2A 1QSYA 5KRSA 4CK1A 4LD0A 4CGJA 2D5RA 1RT5A 1LAWA 4RW7A 4KFBA 3QEWA 1NK7A 2YHBA 4Q0BA 1TKDA 3L2QA 1IG9A 3HSTB 4FLTA 1BI4B 4O55A 3LDSA 5J2NA 3AO1A 4CEAA 4DWIA 3RMAA 1C6VA 2RN2A 1F21A 3DYAA 1W9HA 5DMRA 3OYNA 2Y1JA 4IKFA 4FZYA 3LP3A 4E89A 3VQ9A 3V81A 3HO1A 4OLAA 4CJEA 3VQBA 2HHTA 4K8XA 1NJWA 3TR8A 2HNYA 1NK5A 1T05A 1ZBFA 5CYMA 3C94A 3PX4A 4ID5A 2XY8A 3NH1A 4FCYA 3P1GA 2QXFA 3V1OA 2G8FA 3VQEA 1D9FA 3CYMA 1T03A 3SQ0A 1VK0A 3P5JA 2IOCA 4B9NA 4E7KA 3NF8A 3C95A 4H8KA 3AV9A 4EZ9A 1S1WA 5FRMA 3LALA 4Z4HA 3NH2A 3NDKA 5FRNA 1L3TA 1KTQA 1SL1A 4DU3A 1VSKA 4M41A 5D3GA 2O4GA 2OPRA 3AVMA 3VQ4A 1L3UA 4JS4A 4HHTA 1JLBA 4CEBA 2HHWA 3MXJA 3CFRA 4QCLA 3LANA 1JKHA 1RBSA 3TARA 3OYBA 4DLGA 4FJIA 4PA1A 4DTNA 4Q5VA 5J2PA 2HHQA 3V9SA 4FJNA 4N76A 4OLBA 4W5TA 3O3HA 3QNNA 1KLNA 1MU2A 4Z4EA 5KI6A 3AVAA 2F8SA 3LWMA 4PUOA 3T1AA 4CGGA 3OYDA 4O4GA 5DK5A 4BDZA 1VSEA 1I39A 4I2PA 1S1XA 3KKRA 3QESA 4J2BA 2QK9A 1XWLA 2X6NA 4DQRA 4CJUA 1ZBHA 3ULDA 4FJGA 2E6MA 2BE2A 2XY6A 4CK3A 2YNIA 1NK8A 4EP5A 1WNSA 4HUEA 3V9WA 5C24A 4ELVA 1HYVA 4FYDA 1BL3A 1SL0A 1J5OA 1HYSA 1QQCA 5T7BA 2P5OA 3MEGA 4FLVA 5J2QA 4MFBA 1EP4A 1LAVA 3F73A 4F3TA 3WNGA 4KHWA 3O4QA 1IH7A 1RDCA 5C25A 2HNDA 5KGWA 5KTQA 1D8YA 3K2PA 4CFDA 3IAYA 4DSKA 1REVA 3HVTA 4CJTA 3L2UA 1Z25A 1ZBUA 3AVLA 2IC3A 3ZT0A 3CFPA 3DLHA 1WSFA 3VA0A 4DTUA 3KLFA 1IO2A 1RDBA 4CEQA 3G0ZA 3PX0A 4GVMA 4CJWA 2VWJA 3OJSA 1VSJA 4CJQA 2PZSA 1HRHA 3RR7A 1RT3A 3EY1A 3PY8A 1NJXA 5HP1A 3VQ6A 1ASUA 2I5JA 4KHNA 1TKTA 3SUQA 3PX6A 2FC0A 4H4MA 4OJRA 4CK2A 3HT3A 3V6DA 2GV9A 1S9EA 1BQNA 3AA4A 4OPKA 3TAPA 4F8RA 1IKXA 2P51A 5SZTA 3LWLA 2OPQA 4DS5A 2GBZA 2XHBA 4I7FA 3AA3A 4Z4IA 1TKXA 3OYJA 2Z1IA 3HM9A 3K5LA 1NK4A 2VG5A 4FM1A 3DLRA 4I2QA 3VN5A 3HPOA 3PO5A 1EKEA 3SNNA 4B8CA 3TAQA 4R5PA 4N56A 1SUQA 1BGXT 2B4JA 3FFIA 4O5BA 4O0JA 3NCIA 3LPTA 5C42A 3NFAA 4DSIA 5JS1A 1WN7A 3RR8A 3V4IA 1KCFA 3AVJA 4OVLA 3VQDA 3ZT1A 3HP6A 4CGDA 2PYLA 1U47A 4FLXA 3U3GA 3BDPA 3MXIA 4FJMA 4M3XA 2QKBA 5FDLA 4CGIA 3S9HA 1WAJA 2Z1GA 4KB1A 3THVA 3LPUA 4DTJA 2X78A 2YV0X 2XO7A 4I9QA 1S5JA 3DRRA 4M45A 2VG6A 2KZMA 1NK6A 1DLOA 3WNFA 4UQGA 4DMNA 2F8TA 4CJ4A 4PQUA 1RCHA 3OS0A 2A1RA 4NCAA 4LSLA 3KTQA 3B6PA 1C1CA 3ASMA 3L3VA 1LWFA 1Z26A 3KD5E 3HJFA 1UOCA 1X9SA 4E3SA 4OKEA 3NAEA 3QINA 3KLHA 4BDYA 4IFYA 2HHUA 5CY4A 1TAUA 3AVNA 2Y1IA 4DU1A 1JL1A 4XIUA 1D9DA 1TKZA 3ZSQA 3DLKA 3OYFA 4FK0A 1JLGA 2G8UA 2YNFA 3QLHA 4RG8A 1QS4A 4BE2A 4CEOA 4CHPA 2XY5A 4AHTA 4FLYA 1SKRA 4C8LA 4FJ7A 3ITHA 1JL2A 2KFNA 2YHAA 3QNOA 1DTQA 2R7YA 1U4BA 2QKKA 2JGUA 1HYZA 2Z1JA 3HPGA 3OS1A 3S3OA 1L3VA 1LW0A 1JLFA 1L5UA 2E6LA 3OYGA 3QEXA 3NH0A 1QHTA 1XHXA 4IDKA 1SKSA 4CF8A 5SWMA 4ZTJA 4M42A 2EHGA 1BIUA 1JLAA 3AVCA 4DTXA 4DF8A 4DSLA 1FXXA 5HRSA 1KLMA 1RBRA 2OPPA 3C6TA 4CF0A 4CHZA 5HRPA 4CJFA 5I42A 1C1BA 4ZTFA 4M3YA 5HRNA 3SPZA 1TVRA 2ITGA 2IS3A 4CEFA 3OYMA 3S3MA 1NJYA 1T7PA 1VSLA 2YNHA 3VA3A 2RPIA 3B6OA 1RNHA 4CGHA 4DTPA 3RRGA 4BDPA 4CJRA 3AVIA 3LP2A 3HP9A 3OYLA 2E4LA 1WSEA 3CM5A 1JXBA 3ZSVA 4N5SA 1WSGA 4Y1DA 4CHNA 4OPJA 4C8OA 1Q9YA 1EETA 3S3NA 3ZSXA 1LW2A 4CGFA 4FJ5A 3TWHA 4QOZB 3OYEA 2ATQA 4J2DA 2IDOA 3AO3A 3D45A 2GUIA 4AH9A 3SV4A 3ZSOA 3ZSZA 3K59A 4DQIA 4KB0A 4CHOA 1S9GA 2FBTA 3AVHA 1RILA 2YKNA 3MECA 4W5QA 4B9MA 2YNGA 1W0HA 3D0PA 1GOAA 3NE6A 1NOYA 3I0SA 3UIQA 3ZSRA 1RT1A 2Q3SA 4KTWA 3TAEA 3TI0A 3QETA 3AO4A 2FBXA 3SUOA 2OA8A 4B9SA 2O4IA 2WOMA 1NJZA 4N47A 1TK0A 1UA0A 1KVCA 2YKMA 2B5JA 3O3FA 3OYHA 5HBMA 1X9WA 5KRTA 4RW6A 3VQCA 4FJ9A 3BGRA 1R0AA 4AHCA 1NKCA 4LY7A 1TK8A 3V1QA 2G8WA 1JXEA 4J2AA 3HVRA 1HQEA 1RT4A 4KV8A 1BI4A 2KQ2A 1U49A 1HPZA 1BCOA 3K57A 3F9KA 5FROA 3NGZA 1WAFA 3OVNA 1YTUA 2HVIA 2OZMA 3SUNA 1IKWA 4AHVA 4F2RA 3OYIA 4LSNA 1TV6A 3A2FA 3L2WA 4JS5A 3KKSA 1A5WA 3NF6A 3RRHA 4CJKA 4FM0A 4FJLA 4OGEA 1RDDA 1UAXA 2BDPA 1BISA 4J2EA 2ZQBA 4MQ3A 2BGGA 4PY5A 4GMJB 3MEDA 4CF1A 1CLQA 3SCXA 3ZT4A 3VQ5A 4O0IA 4M3ZA 1S6QA 5KGXA 4E7HA 3PV8A 4DQPA 3SQ1A 1XC9A 4O44A 3WNEA 2P5GA 2WONA 3ALYA 4AHUA 4HCBA 2KTQA 4WE1A 2IGIA 4CJVA 3U6FA 1TL3A 4YNQA 4DFKA 2F96A 4CCHA 4FJXA 1VSMA 3I0RA 5K14A 2G8HA 4KAZA 2FBYA 3VQ7A 1CXUA 2RF2A 4DSEA 1BIZA 3MEEA 3T3FA 1G15A 3L2RA 3MXMA 2OYQA 3LZIA 4NCBA 2RKIA 1S6PA 4LH5A 1D5AA 5HRRA 2OZSA 4B9LA 4NYNA 1ASWA 3AA5X 1NK0A 1RT7A 3K5NA 3ISNC 3TANA 4F4KA 1ASVA 4M3WA 4BE1A 3TAMA 4DQQA 1C0MA 3AVFA 1NK9A 4FZZA 2XY7A 1X1PA 1XI1A 4C8KA 4FLUA 3NBPA 1S1TA 4KTZA 1WSJA 3HPHA 3ZT3A 4HCCA 3CM6A 1Y97A 4LH4A 4OGCA 4KHUA 3U3YA 4CEZA 1TGOA 3K58A 5HLFA 4DSJA 4FLWA 1YVUA 3CG7A 1NKEA 2HMIA 1EXQA 1FKOA 4FM2A 4CHQA 3EYZA 4KRFA 1VRUA 3OYCA 4IBNA 3KK3A 3AA2A 1WLJA 4W5NA 4KHYA 1U48A 1A5VA 2DFHA 2X6SA 3LP1A 3T19A 3IRXA 4W5RA 1QSSA 2KFZA 1BQMA 2AJQA 4DTMA 2DFFA 2HW3A 4QAGA 1BHLA 3KK1A 1JLQA 2D0CA 1CXQA 3KK2A 4KI6A 1A5XA 1EX4A 3AVGA 4DFMA 3M8SA 2HHXA 3DOLA 1HNIA 4RW9A 4CJ5A 1KVAA 4CFBA 2NUBA 1RTDA 1T8EA 4CESA 4ID1A 4CIEA 3OYKA 3RMDA 4HTUA 1FK9A 4ELTA 4Z4GA 4I9LA 2D0AA 3SV3A 3CQ8A 4FJKA 3SQ4A 1WSIA 4CIGA 4DG1A 3KJVA 3DLBA 2HVHA 4ICLA 4Z4FA 2Z1HA 3ZCMA 5CZ1A 2JLEA 1TK5A 1BCMA 3NF9A 1HQUA 1WSHA 1ITGA 3NGYA 2HB5A 3O4NA 3L3UA 3SYZA 3AVBA 4NCGA 1GOBA 4DQSA 2PY5A 3SPYA 3QEIA 3K5OA 3QERA 1NKBA 5CYQA 3M8RA 4M3UA 3TAFA 4Y1CA 3VQPA 2W42A 3L2VA 1UWBA 3LP0A 4KO0A 1J53A 4E1MA 4B08A 4CEEA 1Q8IA 3L8BA 1KRPA 4IFVA 4OKJA 3DLGA 1RDAA 4Z0UA 4HVJA 3OYAA 1Q9XA 4H4OA 4F3OA 3P83D 1IKVA 4DTRA 1UA1A 1RTIA 4C8NA 3V1RA 3KLGA 1U45A 1VSIA 1SL2A 5JS2A 4BE0A 1N6QA 4JLHA 3VQ8A 4FVMA 3KLEA 1YTAA 3QIOA 4PWDA 4G1QA 3SUPA 1VSDA 4AHSA 3WNHA 3RWUA 4FLZA 1LV5A 1S1VA 3QIPA 5EU7A 3PO4A 2OPSA 3M8PA 1VSHA 3E01A 2DTUA 3SQ2A 3M8QA 3PUFA 1JLCA 1L3SA 4F2SA 3RMCA 1IKYA 1VSFA 4CF2A 3AVKA 3LZJA 4B9VA 2DY4A 2X74A 3DM2A 4AHRA 3DLEA 3QEVA 4CIFA 1C0TA 1RTHA 3JYTA 4BACA 3DI6A 3HL8A 4FJHA 1DTTA 3OJUA 3NHGA 3AO5A 3V9UA 3VQAA 4DLEA 3SI6A 4FW1A 4BWJA 2P1JA 4CF9A 4FJ8A 2ZD1A 3NGIA 1KVBA 1LWCA 4W5OA 1K6YA 2XRIA 4CFCA 1TL1A 4CJ3A 3AO2A 1J54A 2EX3A 3DMJA 1RT6A 1C0UA 4B9TA 2KZZA 3LAKA 2G8VA 4RW8A 1RT2A 4YFUA 4HUFA 4KPYA 5I3UA 3DOKA 3HYFA 3MAQA 4KTQA 4C8MA 1CZ9A 3RMBA 2VWKA 4TSXA 1B9FA 2HNZA 2VG7A 4KKOA 1ZBIA 2DFEA 4N41A 1RBUA 1I3AA 3V9XA 4JRQA 3IS9A 4ZHRA 1B92A 4EP4A 4DS4A 4CERA 4M3TA 4DSFA 1FKPA 2FBVA 3EZ5A 4DTOA 4KI4A 2HHVA 2HHSA 2D0BA 1HJRA 4HUGA 1HMVA 2ETJA 4KREA 1C1AA 4NYFA 4CECA 4DU4A 3NF7A 3DRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RBT A;  4DTS A;  4K8Z A;  3G10 A;  1NOZ A;  3SJJ A;  4BWM A;  4FK2 A;  4FK4 A;  1B9D A;  3H08 A;  2ZE2 A;  3I8D A;  1O1W A;  4E7J A;  3KD1 E;  2B6A A;  3QO9 A;  3ZSW A;  4FZX C;  4KHS A;  2G8I A;  1QSL A;  3ZSY A;  4DFJ A;  1GOC A;  3JSM A;  4OKK A;  4RW4 A;  1QE1 A;  3IG1 A;  4Z4C A;  5HRO A;  5CZ2 A;  2G8K A;  4ELU A;  5J2M A;  1YT3 A;  3ZT2 A;  1J9A A;  2PYJ A;  1U04 A;  1QTM A;  4B8A B;  4CJP A;  1VRT A;  2LSN A;  3O3G A;  3HK2 A;  4AIL C;  4EZ6 A;  2KW4 A;  1HNV A;  3C6U A;  4B3O A;  3TAB A;  1X9M A;  1S1U A;  4CED A;  3OY9 A;  4DF4 A;  3DRP A;  4GW6 A;  4JRP A;  3KIO A;  5E41 A;  2IAJ A;  3LAM A;  3RTV A;  3V9Z A;  1RBV A;  1SV5 A;  4IG0 A;  1KFS A;  2BAN A;  4E0D A;  4FJJ A;  4KHQ A;  4M3R A;  4CJL A;  4FXD A;  4E7I A;  2A1S A;  4E19 A;  3VQQ A;  1N5Y A;  5J1E A;  1ZBL A;  1SKW A;  4CFA A;  1KFD A;  4CHY A;  3SZ2 A;  4CE9 A;  4CJS A;  4E1N A;  4DFP A;  3K5M A;  1JLE A;  1RTJ A;  3OS2 A;  3QEP A;  4IG3 A;  1XHZ A;  1ZYQ A;  1KSP A;  4B9U A;  3TAG A;  1LWE A;  1TAQ A;  4E7L A;  3CFO A;  4L8R B;  1CZB A;  3HXM A;  3KLI A;  4FW2 A;  1QSY A;  5KRS A;  4CK1 A;  4LD0 A;  4CGJ A;  2D5R A;  1RT5 A;  1LAW A;  4RW7 A;  4KFB A;  3QEW A;  1NK7 A;  2YHB A;  4Q0B A;  1TKD A;  3L2Q A;  1IG9 A;  3HST B;  4FLT A;  1BI4 B;  4O55 A;  3LDS A;  5J2N A;  3AO1 A;  4CEA A;  4DWI A;  3RMA A;  1C6V A;  2RN2 A;  1F21 A;  3DYA A;  1W9H A;  5DMR A;  3OYN A;  2Y1J A;  4IKF A;  4FZY A;  3LP3 A;  4E89 A;  3VQ9 A;  3V81 A;  3HO1 A;  4OLA A;  4CJE A;  3VQB A;  2HHT A;  4K8X A;  1NJW A;  3TR8 A;  2HNY A;  1NK5 A;  1T05 A;  1ZBF A;  5CYM A;  3C94 A;  3PX4 A;  4ID5 A;  2XY8 A;  3NH1 A;  4FCY A;  3P1G A;  2QXF A;  3V1O A;  2G8F A;  3VQE A;  1D9F A;  3CYM A;  1T03 A;  3SQ0 A;  1VK0 A;  3P5J A;  2IOC A;  4B9N A;  4E7K A;  3NF8 A;  3C95 A;  4H8K A;  3AV9 A;  4EZ9 A;  1S1W A;  5FRM A;  3LAL A;  4Z4H A;  3NH2 A;  3NDK A;  5FRN A;  1L3T A;  1KTQ A;  1SL1 A;  4DU3 A;  1VSK A;  4M41 A;  5D3G A;  2O4G A;  2OPR A;  3AVM A;  3VQ4 A;  1L3U A;  4JS4 A;  4HHT A;  1JLB A;  4CEB A;  2HHW A;  3MXJ A;  3CFR A;  4QCL A;  3LAN A;  1JKH A;  1RBS A;  3TAR A;  3OYB A;  4DLG A;  4FJI A;  4PA1 A;  4DTN A;  4Q5V A;  5J2P A;  2HHQ A;  3V9S A;  4FJN A;  4N76 A;  4OLB A;  4W5T A;  3O3H A;  3QNN A;  1KLN A;  1MU2 A;  4Z4E A;  5KI6 A;  3AVA A;  2F8S A;  3LWM A;  4PUO A;  3T1A A;  4CGG A;  3OYD A;  4O4G A;  5DK5 A;  4BDZ A;  1VSE A;  1I39 A;  4I2P A;  1S1X A;  3KKR A;  3QES A;  4J2B A;  2QK9 A;  1XWL A;  2X6N A;  4DQR A;  4CJU A;  1ZBH A;  3ULD A;  4FJG A;  2E6M A;  2BE2 A;  2XY6 A;  4CK3 A;  2YNI A;  1NK8 A;  4EP5 A;  1WNS A;  4HUE A;  3V9W A;  5C24 A;  4ELV A;  1HYV A;  4FYD A;  1BL3 A;  1SL0 A;  1J5O A;  1HYS A;  1QQC A;  5T7B A;  2P5O A;  3MEG A;  4FLV A;  5J2Q A;  4MFB A;  1EP4 A;  1LAV A;  3F73 A;  4F3T A;  3WNG A;  4KHW A;  3O4Q A;  1IH7 A;  1RDC A;  5C25 A;  2HND A;  5KGW A;  5KTQ A;  1D8Y A;  3K2P A;  4CFD A;  3IAY A;  4DSK A;  1REV A;  3HVT A;  4CJT A;  3L2U A;  1Z25 A;  1ZBU A;  3AVL A;  2IC3 A;  3ZT0 A;  3CFP A;  3DLH A;  1WSF A;  3VA0 A;  4DTU A;  3KLF A;  1IO2 A;  1RDB A;  4CEQ A;  3G0Z A;  3PX0 A;  4GVM A;  4CJW A;  2VWJ A;  3OJS A;  1VSJ A;  4CJQ A;  2PZS A;  1HRH A;  3RR7 A;  1RT3 A;  3EY1 A;  3PY8 A;  1NJX A;  5HP1 A;  3VQ6 A;  1ASU A;  2I5J A;  4KHN A;  1TKT A;  3SUQ A;  3PX6 A;  2FC0 A;  4H4M A;  4OJR A;  4CK2 A;  3HT3 A;  3V6D A;  2GV9 A;  1S9E A;  1BQN A;  3AA4 A;  4OPK A;  3TAP A;  4F8R A;  1IKX A;  2P51 A;  5SZT A;  3LWL A;  2OPQ A;  4DS5 A;  2GBZ A;  2XHB A;  4I7F A;  3AA3 A;  4Z4I A;  1TKX A;  3OYJ A;  2Z1I A;  3HM9 A;  3K5L A;  1NK4 A;  2VG5 A;  4FM1 A;  3DLR A;  4I2Q A;  3VN5 A;  3HPO A;  3PO5 A;  1EKE A;  3SNN A;  4B8C A;  3TAQ A;  4R5P A;  4N56 A;  1SUQ A;  1BGX T;  2B4J A;  3FFI A;  4O5B A;  4O0J A;  3NCI A;  3LPT A;  5C42 A;  3NFA A;  4DSI A;  5JS1 A;  1WN7 A;  3RR8 A;  3V4I A;  1KCF A;  3AVJ A;  4OVL A;  3VQD A;  3ZT1 A;  3HP6 A;  4CGD A;  2PYL A;  1U47 A;  4FLX A;  3U3G A;  3BDP A;  3MXI A;  4FJM A;  4M3X A;  2QKB A;  5FDL A;  4CGI A;  3S9H A;  1WAJ A;  2Z1G A;  4KB1 A;  3THV A;  3LPU A;  4DTJ A;  2X78 A;  2YV0 X;  2XO7 A;  4I9Q A;  1S5J A;  3DRR A;  4M45 A;  2VG6 A;  2KZM A;  1NK6 A;  1DLO A;  3WNF A;  4UQG A;  4DMN A;  2F8T A;  4CJ4 A;  4PQU A;  1RCH A;  3OS0 A;  2A1R A;  4NCA A;  4LSL A;  3KTQ A;  3B6P A;  1C1C A;  3ASM A;  3L3V A;  1LWF A;  1Z26 A;  3KD5 E;  3HJF A;  1UOC A;  1X9S A;  4E3S A;  4OKE A;  3NAE A;  3QIN A;  3KLH A;  4BDY A;  4IFY A;  2HHU A;  5CY4 A;  1TAU A;  3AVN A;  2Y1I A;  4DU1 A;  1JL1 A;  4XIU A;  1D9D A;  1TKZ A;  3ZSQ A;  3DLK A;  3OYF A;  4FK0 A;  1JLG A;  2G8U A;  2YNF A;  3QLH A;  4RG8 A;  1QS4 A;  4BE2 A;  4CEO A;  4CHP A;  2XY5 A;  4AHT A;  4FLY A;  1SKR A;  4C8L A;  4FJ7 A;  3ITH A;  1JL2 A;  2KFN A;  2YHA A;  3QNO A;  1DTQ A;  2R7Y A;  1U4B A;  2QKK A;  2JGU A;  1HYZ A;  2Z1J A;  3HPG A;  3OS1 A;  3S3O A;  1L3V A;  1LW0 A;  1JLF A;  1L5U A;  2E6L A;  3OYG A;  3QEX A;  3NH0 A;  1QHT A;  1XHX A;  4IDK A;  1SKS A;  4CF8 A;  5SWM A;  4ZTJ A;  4M42 A;  2EHG A;  1BIU A;  1JLA A;  3AVC A;  4DTX A;  4DF8 A;  4DSL A;  1FXX A;  5HRS A;  1KLM A;  1RBR A;  2OPP A;  3C6T A;  4CF0 A;  4CHZ A;  5HRP A;  4CJF A;  5I42 A;  1C1B A;  4ZTF A;  4M3Y A;  5HRN A;  3SPZ A;  1TVR A;  2ITG A;  2IS3 A;  4CEF A;  3OYM A;  3S3M A;  1NJY A;  1T7P A;  1VSL A;  2YNH A;  3VA3 A;  2RPI A;  3B6O A;  1RNH A;  4CGH A;  4DTP A;  3RRG A;  4BDP A;  4CJR A;  3AVI A;  3LP2 A;  3HP9 A;  3OYL A;  2E4L A;  1WSE A;  3CM5 A;  1JXB A;  3ZSV A;  4N5S A;  1WSG A;  4Y1D A;  4CHN A;  4OPJ A;  4C8O A;  1Q9Y A;  1EET A;  3S3N A;  3ZSX A;  1LW2 A;  4CGF A;  4FJ5 A;  3TWH A;  4QOZ B;  3OYE A;  2ATQ A;  4J2D A;  2IDO A;  3AO3 A;  3D45 A;  2GUI A;  4AH9 A;  3SV4 A;  3ZSO A;  3ZSZ A;  3K59 A;  4DQI A;  4KB0 A;  4CHO A;  1S9G A;  2FBT A;  3AVH A;  1RIL A;  2YKN A;  3MEC A;  4W5Q A;  4B9M A;  2YNG A;  1W0H A;  3D0P A;  1GOA A;  3NE6 A;  1NOY A;  3I0S A;  3UIQ A;  3ZSR A;  1RT1 A;  2Q3S A;  4KTW A;  3TAE A;  3TI0 A;  3QET A;  3AO4 A;  2FBX A;  3SUO A;  2OA8 A;  4B9S A;  2O4I A;  2WOM A;  1NJZ A;  4N47 A;  1TK0 A;  1UA0 A;  1KVC A;  2YKM A;  2B5J A;  3O3F A;  3OYH A;  5HBM A;  1X9W A;  5KRT A;  4RW6 A;  3VQC A;  4FJ9 A;  3BGR A;  1R0A A;  4AHC A;  1NKC A;  4LY7 A;  1TK8 A;  3V1Q A;  2G8W A;  1JXE A;  4J2A A;  3HVR A;  1HQE A;  1RT4 A;  4KV8 A;  1BI4 A;  2KQ2 A;  1U49 A;  1HPZ A;  1BCO A;  3K57 A;  3F9K A;  5FRO A;  3NGZ A;  1WAF A;  3OVN A;  1YTU A;  2HVI A;  2OZM A;  3SUN A;  1IKW A;  4AHV A;  4F2R A;  3OYI A;  4LSN A;  1TV6 A;  3A2F A;  3L2W A;  4JS5 A;  3KKS A;  1A5W A;  3NF6 A;  3RRH A;  4CJK A;  4FM0 A;  4FJL A;  4OGE A;  1RDD A;  1UAX A;  2BDP A;  1BIS A;  4J2E A;  2ZQB A;  4MQ3 A;  2BGG A;  4PY5 A;  4GMJ B;  3MED A;  4CF1 A;  1CLQ A;  3SCX A;  3ZT4 A;  3VQ5 A;  4O0I A;  4M3Z A;  1S6Q A;  5KGX A;  4E7H A;  3PV8 A;  4DQP A;  3SQ1 A;  1XC9 A;  4O44 A;  3WNE A;  2P5G A;  2WON A;  3ALY A;  4AHU A;  4HCB A;  2KTQ A;  4WE1 A;  2IGI A;  4CJV A;  3U6F A;  1TL3 A;  4YNQ A;  4DFK A;  2F96 A;  4CCH A;  4FJX A;  1VSM A;  3I0R A;  5K14 A;  2G8H A;  4KAZ A;  2FBY A;  3VQ7 A;  1CXU A;  2RF2 A;  4DSE A;  1BIZ A;  3MEE A;  3T3F A;  1G15 A;  3L2R A;  3MXM A;  2OYQ A;  3LZI A;  4NCB A;  2RKI A;  1S6P A;  4LH5 A;  1D5A A;  5HRR A;  2OZS A;  4B9L A;  4NYN A;  1ASW A;  3AA5 X;  1NK0 A;  1RT7 A;  3K5N A;  3ISN C;  3TAN A;  4F4K A;  1ASV A;  4M3W A;  4BE1 A;  3TAM A;  4DQQ A;  1C0M A;  3AVF A;  1NK9 A;  4FZZ A;  2XY7 A;  1X1P A;  1XI1 A;  4C8K A;  4FLU A;  3NBP A;  1S1T A;  4KTZ A;  1WSJ A;  3HPH A;  3ZT3 A;  4HCC A;  3CM6 A;  1Y97 A;  4LH4 A;  4OGC A;  4KHU A;  3U3Y A;  4CEZ A;  1TGO A;  3K58 A;  5HLF A;  4DSJ A;  4FLW A;  1YVU A;  3CG7 A;  1NKE A;  2HMI A;  1EXQ A;  1FKO A;  4FM2 A;  4CHQ A;  3EYZ A;  4KRF A;  1VRU A;  3OYC A;  4IBN A;  3KK3 A;  3AA2 A;  1WLJ A;  4W5N A;  4KHY A;  1U48 A;  1A5V A;  2DFH A;  2X6S A;  3LP1 A;  3T19 A;  3IRX A;  4W5R A;  1QSS A;  2KFZ A;  1BQM A;  2AJQ A;  4DTM A;  2DFF A;  2HW3 A;  4QAG A;  1BHL A;  3KK1 A;  1JLQ A;  2D0C A;  1CXQ A;  3KK2 A;  4KI6 A;  1A5X A;  1EX4 A;  3AVG A;  4DFM A;  3M8S A;  2HHX A;  3DOL A;  1HNI A;  4RW9 A;  4CJ5 A;  1KVA A;  4CFB A;  2NUB A;  1RTD A;  1T8E A;  4CES A;  4ID1 A;  4CIE A;  3OYK A;  3RMD A;  4HTU A;  1FK9 A;  4ELT A;  4Z4G A;  4I9L A;  2D0A A;  3SV3 A;  3CQ8 A;  4FJK A;  3SQ4 A;  1WSI A;  4CIG A;  4DG1 A;  3KJV A;  3DLB A;  2HVH A;  4ICL A;  4Z4F A;  2Z1H A;  3ZCM A;  5CZ1 A;  2JLE A;  1TK5 A;  1BCM A;  3NF9 A;  1HQU A;  1WSH A;  1ITG A;  3NGY A;  2HB5 A;  3O4N A;  3L3U A;  3SYZ A;  3AVB A;  4NCG A;  1GOB A;  4DQS A;  2PY5 A;  3SPY A;  3QEI A;  3K5O A;  3QER A;  1NKB A;  5CYQ A;  3M8R A;  4M3U A;  3TAF A;  4Y1C A;  3VQP A;  2W42 A;  3L2V A;  1UWB A;  3LP0 A;  4KO0 A;  1J53 A;  4E1M A;  4B08 A;  4CEE A;  1Q8I A;  3L8B A;  1KRP A;  4IFV A;  4OKJ A;  3DLG A;  1RDA A;  4Z0U A;  4HVJ A;  3OYA A;  1Q9X A;  4H4O A;  4F3O A;  3P83 D;  1IKV A;  4DTR A;  1UA1 A;  1RTI A;  4C8N A;  3V1R A;  3KLG A;  1U45 A;  1VSI A;  1SL2 A;  5JS2 A;  4BE0 A;  1N6Q A;  4JLH A;  3VQ8 A;  4FVM A;  3KLE A;  1YTA A;  3QIO A;  4PWD A;  4G1Q A;  3SUP A;  1VSD A;  4AHS A;  3WNH A;  3RWU A;  4FLZ A;  1LV5 A;  1S1V A;  3QIP A;  5EU7 A;  3PO4 A;  2OPS A;  3M8P A;  1VSH A;  3E01 A;  2DTU A;  3SQ2 A;  3M8Q A;  3PUF A;  1JLC A;  1L3S A;  4F2S A;  3RMC A;  1IKY A;  1VSF A;  4CF2 A;  3AVK A;  3LZJ A;  4B9V A;  2DY4 A;  2X74 A;  3DM2 A;  4AHR A;  3DLE A;  3QEV A;  4CIF A;  1C0T A;  1RTH A;  3JYT A;  4BAC A;  3DI6 A;  3HL8 A;  4FJH A;  1DTT A;  3OJU A;  3NHG A;  3AO5 A;  3V9U A;  3VQA A;  4DLE A;  3SI6 A;  4FW1 A;  4BWJ A;  2P1J A;  4CF9 A;  4FJ8 A;  2ZD1 A;  3NGI A;  1KVB A;  1LWC A;  4W5O A;  1K6Y A;  2XRI A;  4CFC A;  1TL1 A;  4CJ3 A;  3AO2 A;  1J54 A;  2EX3 A;  3DMJ A;  1RT6 A;  1C0U A;  4B9T A;  2KZZ A;  3LAK A;  2G8V A;  4RW8 A;  1RT2 A;  4YFU A;  4HUF A;  4KPY A;  5I3U A;  3DOK A;  3HYF A;  3MAQ A;  4KTQ A;  4C8M A;  1CZ9 A;  3RMB A;  2VWK A;  4TSX A;  1B9F A;  2HNZ A;  2VG7 A;  4KKO A;  1ZBI A;  2DFE A;  4N41 A;  1RBU A;  1I3A A;  3V9X A;  4JRQ A;  3IS9 A;  4ZHR A;  1B92 A;  4EP4 A;  4DS4 A;  4CER A;  4M3T A;  4DSF A;  1FKP A;  2FBV A;  3EZ5 A;  4DTO A;  4KI4 A;  2HHV A;  2HHS A;  2D0B A;  1HJR A;  4HUG A;  1HMV A;  2ETJ A;  4KRE A;  1C1A A;  4NYF A;  4CEC A;  4DU4 A;  3NF7 A;  3DRS A; 
#chains in the Genus database with same CATH topology
 1RBT A;  4O8K A;  4BWM A;  4FK2 A;  4FL9 A;  3KD1 E;  2B6A A;  3ZSW A;  4KHS A;  4M7Y A;  1GOC A;  4RW4 A;  4FPB A;  5J2M A;  1YT3 A;  1K9M O;  3ZT2 A;  2PYJ A;  1QTM A;  4CJP A;  1OH7 A;  4K25 A;  3HM8 A;  3OY9 A;  1U2V B;  4JI1 K;  4IG0 A;  4E0D A;  2BAN A;  4FJJ A;  4M3R A;  3VQQ A;  1ZBL A;  2Q1N A;  4CFA A;  4CHY A;  4E1N A;  2YJF A;  1XHZ A;  1KSP A;  1RTJ A;  5AFU A;  3OS2 A;  1ZYQ A;  1E4G T;  1LWE A;  3KK7 A;  3CJ1 A;  3R9P A;  4L8R B;  1EO1 A;  1XC3 A;  1VQ5 N;  4JKB A;  3IUC A;  1LAW A;  5M1F A;  1NK7 A;  3CIP A;  3TPQ A;  1BI4 B;  4U7B A;  2O8C B;  1C6V A;  3DYA A;  1F21 A;  3CCL N;  1DT9 A;  2P9U A;  5KPZ A;  4IKF A;  4FZY A;  3CHW A;  3OTO K;  4EFH A;  3HO1 A;  3FZH A;  1IG8 A;  2A42 A;  5KPT A;  2QWL A;  4FCY A;  2QXF A;  3VQE A;  3KZB A;  5AQL A;  2YI1 A;  3O8M A;  4CVN E;  5GIO A;  1BG3 A;  3MN5 A;  5LJV A;  2UXD K;  3LAL A;  4G9Z A;  1L3T A;  1VSK A;  4H0X B;  5AJ3 K;  2YCH A;  4FWS A;  4JS4 A;  4HHT A;  3MXJ A;  2YHY A;  3TAR A;  3OYB A;  4XH4 A;  3TTC A;  4BC3 A;  4DTN A;  1T3V A;  5J2P A;  1VQO N;  4GY2 B;  3O3H A;  3QNN A;  1MU2 A;  2F8S A;  5DM7 L;  1M90 O;  1GLF O;  3C6H A;  5DK5 A;  2VYP A;  4JKF A;  3KKR A;  4J2B A;  5H1S Q;  4JNE A;  2E6M A;  4EP5 A;  3QFU A;  4CZF A;  5T7B A;  2P5O A;  4KHW A;  5C25 A;  1RDC A;  2HND A;  4DCH A;  3K2P A;  1BA0 A;  3AVL A;  4UY8 O;  2IC3 A;  3ZT0 A;  2WBN A;  3CFP A;  3DLH A;  3VA0 A;  3UKR B;  1HLU A;  1RDB A;  3U9Z A;  4JK8 A;  3P38 A;  4GVM A;  1YIJ N;  3AY9 A;  4BRD A;  4CJQ A;  1X3M A;  1YAG A;  1ASU A;  2I5J A;  4B1X B;  3SUQ A;  4H4M A;  3HT3 A;  3V6D A;  2GV9 A;  2HF3 A;  3SLC A;  3TAP A;  4F8R A;  1N36 K;  3C6A A;  2OPQ A;  1QZ5 A;  2Z1I A;  3VEX A;  4LFC K;  2VG5 A;  2QM1 A;  3OA9 A;  4I2Q A;  3VN5 A;  2JWL A;  4CZL A;  1BGX T;  3NCI A;  4R79 A;  3LPT A;  2FXU A;  3HTV A;  4CGD A;  3GL1 A;  3LL3 A;  4IWV A;  3S41 A;  4PKI A;  4FJM A;  2A6A A;  3S9H A;  1YVN A;  5GIN A;  1WAJ A;  4BQL A;  4RCH A;  2Q36 A;  3WXM B;  1NK6 A;  2F8T A;  1RCH A;  4ILH A;  4IEI A;  4LSL A;  1MDU B;  3PIO L;  2HF4 A;  3K9J A;  3O80 A;  4DV2 K;  4BDY A;  4IFY A;  3AVN A;  4DU1 A;  4JKG B;  1D9D A;  4LF4 K;  3ZSQ A;  4DR5 K;  5BN9 A;  2G8U A;  4RG8 A;  1SKR A;  2RE2 A;  3ITH A;  3Q7B A;  4YOY A;  2KFN A;  3Q7C A;  4QS9 A;  1DTQ A;  1U4B A;  2QKK A;  1NGJ A;  2Z1J A;  2HMP A;  3WQT A;  1JLF A;  1L5U A;  3E1Y A;  3D2F B;  3NH0 A;  5SWM A;  2NRW A;  4BRC A;  2IVP A;  3GE1 A;  2EHG A;  4ZTJ A;  1VQ9 N;  5M1P A;  4CF0 A;  5HRP A;  5I42 A;  1M1K O;  1C1B A;  3W3D A;  2E5L K;  1VSL A;  4K43 A;  2UUA K;  1YJN N;  4ILJ A;  1RNH A;  4CGH A;  3DXM B;  3OYL A;  4DV0 K;  2D4W A;  1WSG A;  3CMA N;  3O9Q A;  3S3N A;  4BR7 A;  4PL8 A;  3JS6 A;  2IDO A;  1W2B M;  5AQZ A;  4FOE A;  4WFB L;  3ZSO A;  1U2V A;  3K59 A;  4DQI A;  4FWK A;  2ZJQ L;  2FBT A;  3AVH A;  1RIL A;  2YKN A;  1KC8 O;  4DV5 K;  3D0P A;  3NE6 A;  1N8R O;  5C2F A;  3SUO A;  5BR9 A;  1NJZ A;  2ZM6 K;  3MN7 A;  1KVC A;  3O3F A;  2OCE A;  2O8D A;  1GLE G;  3BZK A;  3BGR A;  1NKC A;  3CQX A;  1ATS A;  3V1Q A;  2Q0U A;  2HBK A;  3THY B;  1RT4 A;  4YOW A;  1U49 A;  1BI4 A;  4A2B A;  1HPZ A;  1BCO A;  1HKC A;  3F9K A;  3NGZ A;  2HVI A;  2O8C A;  4ISG A;  3SUN A;  1NGD A;  1QQN A;  3VEY A;  2ASO A;  1A5W A;  1UAX A;  2BDP A;  2BGG A;  3EE9 A;  3MED A;  4O8U A;  5GAD P;  4O0I A;  3CI5 A;  3H1V X;  4IOX A;  4DQP A;  4DR1 K;  2P5G A;  3CCE N;  3LDO A;  2O8E A;  3ALY A;  2W40 A;  4AHU A;  2W6K A;  5TKY A;  1WBB A;  4WE1 A;  3U6F A;  4YNQ A;  4DFK A;  1VSM A;  3I0R A;  2G8H A;  1C0F A;  3VQ7 A;  2PFU A;  4BR9 A;  1BIZ A;  3MEE A;  1KXP A;  3MXM A;  1ZC6 A;  4BQZ A;  3LZI A;  2RKI A;  1S6P A;  3WXJ A;  2E2O A;  2OZS A;  4F4K A;  1NGI A;  1OH5 A;  1ASV A;  2OTL N;  4DQQ A;  3TAM A;  1NK9 A;  3AVF A;  4BRA A;  4FZZ A;  3LDQ A;  2WUS A;  1XI1 A;  2CGL A;  4OPH A;  2V51 B;  3HPH A;  4F9O A;  1Y97 A;  3CQY A;  4KHU A;  2CH6 A;  4JK7 A;  3CG7 A;  4QS8 A;  1VQM N;  1EXQ A;  3KHY A;  4H5V A;  2AP1 A;  1VRU A;  2VGN A;  5E84 A;  5GIP A;  1OVQ A;  3E9L A;  4X65 K;  2ZGY A;  4W5N A;  5EOY A;  1A5V A;  2X6S A;  3LP1 A;  1QSS A;  3VPZ A;  2VGM A;  2O8B B;  3M1F A;  5FLX O;  4DV1 K;  2HW3 A;  2DPN A;  3LM9 A;  3R8E A;  4QAG A;  3VTH A;  1K8K A;  4BRQ A;  4BR5 A;  3M8S A;  4MO4 A;  4AM6 A;  4CFB A;  1KVA A;  1QZ6 A;  3ZET B;  4DV4 K;  2NRH A;  4HTU A;  4ELT A;  4Z4G A;  4BRL A;  3SV3 A;  2HBM A;  4CIG A;  1ZBS A;  4DR2 K;  4Z4F A;  2Z1H A;  3EZW A;  3FE1 A;  2ZF5 O;  1TUY A;  5BPN A;  4BRP A;  3AVB A;  2E1Y A;  4CBX A;  1BOT O;  1NKB A;  2NRZ A;  3OHR A;  1OH6 A;  2NRV A;  1BDG A;  1BO5 O;  1J53 A;  4YHH K;  2QTD A;  3DLG A;  2QA4 N;  5LMN K;  1Q9X A;  2A40 A;  3V1R A;  1U45 A;  1SL2 A;  1VQ6 N;  3AAR A;  5DM6 L;  5M1N A;  3KLE A;  1YTA A;  3QIO A;  3LDN A;  3ZYY X;  4AHS A;  4FLZ A;  2E2P A;  5EU7 A;  1VSH A;  3EL2 A;  3E01 A;  2DTU A;  3SQ2 A;  1L3S A;  4KH4 A;  3DM2 A;  2VQF K;  2E88 A;  4GV3 A;  1ATR A;  3DI6 A;  4LFB K;  3VQA A;  3EKS A;  4CF9 A;  2ZD1 A;  2XRI A;  4BRO A;  4CJ3 A;  4JD2 A;  1NMN A;  4B9T A;  3M3Z A;  2KZZ A;  4M63 C;  1J5E K;  1HPM A;  4B1W B;  5BN8 A;  3HYF A;  3MAQ A;  1CZ9 A;  3L4Q A;  4TSX A;  2HNZ A;  2VG7 A;  1I3A A;  4JRQ A;  3IS9 A;  2Q31 A;  1TYQ A;  4DSF A;  4KI4 A;  2YX6 A;  1ESV A;  2HBJ A;  1C1A A;  4CEC A;  3NF7 A;  3CCV N;  3G10 A;  3SJJ A;  3C7N B;  1B9D A;  3H08 A;  3VMF B;  4OKK A;  1QE1 A;  5LJW A;  4ELU A;  2CGK A;  1BU6 O;  4FWO A;  1U04 A;  2P9K B;  4B8A B;  4AIL C;  4EZ6 A;  3C6U A;  1NGG A;  1S1U A;  3DRP A;  3KIO A;  3LAM A;  3RTV A;  3V9Z A;  2P9I A;  1SV5 A;  3TSP A;  4A62 A;  1KFS A;  3CCU N;  2HHH K;  1YUW A;  4E19 A;  1N5Y A;  5J1E A;  1SKW A;  1KFD A;  4DSL A;  3WQU A;  4CE9 A;  4CJS A;  5CHI A;  3BY5 A;  3SAF A;  3O9U A;  3CFO A;  4LF9 K;  1CZB A;  4B9Q A;  4FW2 A;  3HXM A;  1QSY A;  5KRS A;  1N32 K;  4LD0 A;  5AZI B;  3AAQ A;  5BRF A;  3K0S A;  1TKD A;  3L2Q A;  1IG9 A;  3H45 C;  1JCF A;  2EWS A;  5J2N A;  4EIA A;  2VQE K;  2RN2 A;  4YDU A;  5DMR A;  3LP3 A;  3MX5 A;  4E89 A;  4GV9 A;  3JAM O;  3BP8 A;  2A5X A;  3D2E A;  1NJW A;  3TR8 A;  1T05 A;  5CYM A;  3C94 A;  3PX4 A;  4DR7 K;  3P1G A;  3V1O A;  2G8F A;  1X3N A;  1D9F A;  2E2N A;  2E1Z A;  3CYM A;  3THW B;  3QB0 A;  2A41 A;  2IOC A;  4MLE A;  3CC4 N;  4EAH D;  3AV9 A;  5LY3 A;  3THX B;  4EZ9 A;  1S1W A;  2HST A;  2D1K A;  3QBX A;  4Z4H A;  1IV0 A;  2O8F B;  1Q82 O;  4DV6 K;  1SL1 A;  4M41 A;  2OPR A;  3AVM A;  3O4W A;  2HBL A;  5M1O A;  4CEB A;  2HHW A;  3CFR A;  3LAN A;  1JKH A;  1RBS A;  4PA1 A;  1FW6 A;  3VEZ A;  2HHQ A;  4FJN A;  5AQN A;  3B8A X;  4CJ7 A;  5C10 A;  3E66 A;  3T1A A;  2P9N A;  3BUZ B;  4H03 B;  4O4G A;  3CJB A;  4BDZ A;  1I39 A;  1S1X A;  2KKZ A;  3WXI A;  2QK9 A;  5C2D A;  1XWL A;  2X6N A;  1ATN A;  3FFK B;  3ULD A;  2BE2 A;  2XY6 A;  1NM1 A;  4YY3 K;  4NXN K;  3ATU A;  1J5O A;  4FWL A;  1QQC A;  3ULE B;  1MWK A;  1EP4 A;  3F73 A;  3O4Q A;  4FOI A;  1D8Y A;  4DSK A;  5KTQ A;  3IAY A;  4CFD A;  1REV A;  3FZM A;  4H0P A;  3ZX0 A;  3L2U A;  1WSF A;  2GUP A;  3J8A A;  4H0T B;  3WEE A;  4JHD B;  2IIR A;  4CEQ A;  4X66 K;  1VSJ A;  2PZS A;  3PY8 A;  3H6E A;  4WQ5 A;  4B3S K;  1NJX A;  3DLL L;  1K73 O;  4OJR A;  3RSE A;  1BQN A;  3SMP A;  4BVP A;  1NU0 A;  3QML A;  2GBZ A;  3ATV A;  2XHB A;  1WOQ A;  3VEV A;  1TKX A;  4BC5 A;  3PIP L;  3HM9 A;  1NK4 A;  5AQI A;  4XH1 A;  5E26 A;  4B8C A;  3TAQ A;  4R5P A;  4AF1 A;  4O5B A;  3NFA A;  1WN7 A;  1KCF A;  3VQD A;  1HUX A;  4BRG A;  3BDP A;  1P90 A;  4M3X A;  2Z1G A;  4KB1 A;  3G6E N;  4DTJ A;  2X78 A;  2YV0 X;  5KQ8 A;  2XO7 A;  3DRR A;  2KZM A;  2VG6 A;  4PQU A;  4DMN A;  3OS0 A;  4NCA A;  3B6P A;  3L3V A;  3KD5 E;  1LWF A;  4A61 A;  1UOC A;  4CW7 B;  4E3S A;  4OKE A;  3NAE A;  3KLH A;  2Y1I A;  1JL1 A;  4XIU A;  3DLK A;  3OYF A;  4FK0 A;  1JLG A;  2YNF A;  4CEO A;  4C8L A;  4WFN L;  5BRD A;  2YHA A;  1BWF O;  2FF6 A;  1HYZ A;  1L3V A;  4IJA A;  3G4S N;  1LW0 A;  2ASP A;  2E6L A;  3OYG A;  1XHX A;  5F2R A;  4DTX A;  1BIU A;  1RBR A;  4HWI A;  2IVN A;  4M3Y A;  5HRN A;  3SPZ A;  2ITG A;  2IS3 A;  4CEF A;  3OYM A;  3S3M A;  1N34 K;  2YNH A;  2RPI A;  1YHQ N;  3J81 O;  4CJR A;  3CCJ N;  3HP9 A;  3C7N A;  3LDL A;  3CM5 A;  1VAZ A;  2ITM A;  5AQM A;  4CGF A;  4FJ5 A;  2P9K A;  1QVG M;  3TWH A;  1EQY A;  3J80 O;  2F9T A;  3AO3 A;  4H0O A;  4B3M K;  3D45 A;  2GUI A;  3SV4 A;  2PAV A;  5FPN A;  1S9G A;  4IO9 L;  3CME N;  2YNG A;  5B8H A;  3I0S A;  3TI0 A;  1C0G A;  3CJ7 A;  4B9S A;  2CH5 A;  2P9S B;  2YKM A;  1X9W A;  4RW6 A;  1R0A A;  4LY7 A;  4JAX A;  4KH6 A;  5AZI A;  1TK8 A;  2E8A A;  4FSV A;  3HVR A;  3H46 O;  4KV8 A;  2KQ2 A;  1DGK N;  1WAF A;  1YTU A;  4GVE A;  3OYI A;  3L4I A;  4M7X A;  3NF6 A;  3RRH A;  1V4S A;  4JI4 K;  3VF2 A;  3O1B A;  4CF1 A;  2YJE A;  3O9T A;  5KGX A;  3PV8 A;  3SQ1 A;  5JLF A;  1XC9 A;  3THW A;  2WON A;  4HTL A;  4CCH A;  2IGI A;  4FJX A;  1GLB G;  4KAZ A;  2RF2 A;  4DSE A;  3THX A;  1G15 A;  3CJC A;  2O8F A;  2GWK A;  3MK6 A;  1D5A A;  3MCP A;  1NK0 A;  3K5N A;  3ISN C;  4M3W A;  4A5B A;  2XY7 A;  4FLU A;  3NBP A;  1S1T A;  4YOR A;  1WSJ A;  1LOT B;  3SBT A;  1LCU A;  4OGC A;  3U3Y A;  4CEZ A;  4BR2 A;  4B3R K;  4FM2 A;  3FLC O;  3EYZ A;  1VQN N;  4IBN A;  3KK3 A;  3WT0 A;  3AA2 A;  1N33 K;  1YXQ A;  1WLJ A;  3CPE A;  2DFH A;  5AQS A;  3IRX A;  3T19 A;  2AJQ A;  4DTM A;  4NLB A;  3J7Z O;  2UXC K;  1BHL A;  5AR0 A;  3KK2 A;  4KI6 A;  1A5X A;  3AVG A;  5C15 A;  3HOT A;  1HNI A;  1RTD A;  2NUB A;  1T8E A;  4CES A;  3H1Q A;  4CIE A;  3RMD A;  1U6Z A;  4H5N A;  1FK9 A;  4I9L A;  2D0A A;  4DG1 A;  3KJV A;  4K42 A;  5CZ1 A;  1TK5 A;  3DWL A;  1HQU A;  1ITG A;  1BUP A;  2HB5 A;  3O4N A;  3QIC A;  4FWP A;  4DQS A;  5AFU H;  1GLJ O;  3QEI A;  4M3U A;  3TAF A;  4Y1C A;  3VQP A;  3L2V A;  4KO0 A;  4B08 A;  1Q8I A;  4IFV A;  4OKJ A;  2J4R A;  3GBT A;  2I7P A;  3TSQ A;  3FZK A;  1UA1 A;  4C8N A;  5JVH L;  5JS2 A;  4BG8 A;  4PHT X;  1VQP N;  4FVM A;  4PWD A;  1VSD A;  1LV5 A;  3GG4 A;  3M8P A;  3QDK A;  1KQS M;  1GLL O;  1NWK A;  3M8Q A;  1JLC A;  4DR4 K;  3AVK A;  2WFB A;  5AQJ A;  1MWM A;  3QEV A;  3DLE A;  4CIF A;  1C0T A;  3JYT A;  4BAC A;  2QWN A;  4MDA A;  3OJU A;  2ASM A;  3V9U A;  5AZJ B;  3SI6 A;  4MLH A;  3FGU A;  2OAN A;  3NGI A;  4W5O A;  1T6C A;  1TL1 A;  4DHY A;  2EX3 A;  3LDP A;  4A5A A;  4YFU A;  3O9R A;  1SS6 A;  4KTQ A;  3RMB A;  1R59 O;  1NBW A;  3SAG A;  4JI0 K;  4N41 A;  3WXK A;  5LL6 Z;  5GAE P;  4Z94 A;  4CER A;  4V19 S;  2FBV A;  3EZ5 A;  2HHS A;  1RGI A;  3CER A;  4MO5 A;  2D0B A;  2ETJ A;  4DU4 A;  1IBL K;  4DTS A;  4K8Z A;  1NGF A;  2ZE2 A;  3I8D A;  3IMX A;  3QO9 A;  4FZX C;  4DFJ A;  3UKU B;  5HRO A;  2G8K A;  1JCE A;  1J9A A;  1T6D A;  2LSN A;  2KW4 A;  4B3O A;  3GOI A;  1X9M A;  1E3M A;  4CED A;  4GW6 A;  2IAJ A;  4KHQ A;  1RBV A;  4CJL A;  1MA9 B;  2A1S A;  2QWM A;  4YOV A;  5IT9 O;  1XUP O;  4DFP A;  4IO8 A;  2HHX A;  1XQS C;  4B9U A;  4K0K K;  3F5T A;  1TAQ A;  2GTD A;  2V7Y A;  3LM2 A;  3BF3 A;  4CGJ A;  4KFB A;  2YHB A;  5EX5 A;  4O55 A;  5C0Y A;  5BR8 K;  3LDS A;  2VCP A;  3AO1 A;  3A5M C;  3RMA A;  1W9H A;  2Y1J A;  2WC9 A;  4YDU C;  5AQR A;  3UKR A;  4CJE A;  3U4L A;  2HHT A;  5EXW A;  3VEW A;  2HNY A;  3VGK A;  3NH1 A;  5HOO A;  3M5R A;  4C1N I;  3P39 A;  2D0O A;  3NF8 A;  3R1X A;  5AQG A;  3PSF A;  3NDK A;  1SZ2 A;  3A8Y A;  3ZEU B;  5FRN A;  1KTQ A;  4DU3 A;  2NLX A;  3MCA B;  1L3U A;  1JLB A;  4CZJ A;  2Q0R A;  3O6W A;  4BR0 A;  3ZX2 A;  4DLG A;  4W5T A;  4Z4E A;  5KI6 A;  3LWM A;  4WF9 L;  4PUO A;  2QEX N;  2ZJR L;  4CZE A;  1IBM K;  5JIC A;  4JI8 K;  3G25 A;  4I2P A;  5AQT A;  3QES A;  4FJG A;  2YNI A;  1WNS A;  4HUE A;  3V9W A;  4ELV A;  4FYD A;  1BL3 A;  4BRF A;  3BZC A;  3D6R A;  5BPM A;  1HYS A;  4FLV A;  4JKG A;  4MFB A;  1HNW K;  1LAV A;  5FPM A;  4CD3 A;  1IH7 A;  5KGW A;  5F1X A;  1J6Z A;  5GAH P;  2P9U B;  4CJT A;  1ZBU A;  4O5F A;  4FWQ A;  4WQ4 C;  3AGR A;  4DTU A;  3KLF A;  3VOV A;  3D2F A;  4CJW A;  3WUH A;  4DV3 K;  3RR7 A;  1RDW X;  4ISF A;  3FZF A;  1WUA A;  3VQ6 A;  4KHN A;  3EKU A;  2UU9 K;  2FC0 A;  4WQ5 C;  4CK2 A;  1S9E A;  1NLV A;  4OPK A;  1IKX A;  2P51 A;  3LWL A;  3JXU A;  3DXM A;  3BEX A;  4FWN A;  4C23 A;  3SK3 A;  4FM1 A;  1W97 L;  3DLR A;  3HPO A;  3WXL A;  3PO5 A;  3SNN A;  5F0X A;  2JWK A;  4I6M B;  2OTJ N;  4N56 A;  1SUQ A;  2B4J A;  3FFI A;  1X9J A;  3T1Y K;  5C42 A;  3I33 A;  3RR8 A;  3V4I A;  4B1U B;  2W41 A;  5AQO A;  3ZT1 A;  2UYT A;  1G99 A;  1Y64 A;  1U47 A;  3U3G A;  3K9K A;  3THV A;  3LPU A;  3CCR N;  2QW9 A;  1S5J A;  1YJ9 N;  1E4F T;  1DLO A;  3BF1 A;  4LF8 K;  5A2Q O;  1Z26 A;  3THY A;  5JMV A;  3G71 N;  2HHU A;  5CY4 A;  4JI6 K;  3NVK A;  1TKZ A;  3ENO A;  4IOC L;  3QLH A;  4BE2 A;  4CHP A;  1JL2 A;  2V52 B;  5BRH A;  3S3O A;  2NRR A;  3QEX A;  3VEN A;  1SKS A;  4CF8 A;  4JI7 K;  3OBW A;  4DF8 A;  1JLA A;  5HL7 L;  1FXX A;  5HRS A;  1KLM A;  1KD1 O;  1HKB A;  2QWP A;  3C6T A;  4CHZ A;  4I9Q A;  5AQW A;  1TVR A;  4IDH A;  1NJY A;  1T7P A;  4H5W A;  1EWQ A;  1S22 A;  1XMQ K;  3LP2 A;  5JLH A;  2E4L A;  1WSE A;  4N5S A;  4ISE A;  2P9L B;  3MN6 A;  4Y1D A;  4C8O A;  3UKU A;  1DEJ A;  1EET A;  3ZSX A;  1LW2 A;  4JKC A;  4IXC A;  4QOZ B;  3OYE A;  4J2D A;  4OO1 J;  3E9O A;  3VTI A;  4AH9 A;  3ZSZ A;  1HNX K;  4KB0 A;  4AQY K;  5MLC Q;  4W5Q A;  4B9M A;  1W0H A;  4H5T A;  4KBO A;  1HNZ K;  3IKM A;  4YOT A;  3UIQ A;  5EY4 A;  3ZSR A;  1RT1 A;  2OA8 A;  2FBX A;  4B3T K;  3A5L C;  3F2K A;  1QHA A;  3EO3 A;  2B5J A;  2O8B A;  1ILY A;  5KRT A;  3VQC A;  4FJ9 A;  1KAZ A;  5FPE A;  3C65 A;  2G8W A;  4J2A A;  4WQ4 A;  5ADX H;  4PL7 A;  1I94 K;  3OW2 M;  3ZET A;  3K57 A;  5FRO A;  2A3Z A;  1TV6 A;  4FM0 A;  4FJL A;  4OGE A;  1BIS A;  3TTF A;  4MQ3 A;  3ZT4 A;  3VQ5 A;  4M3Z A;  4C1N K;  4OX9 K;  4DR3 K;  4O44 A;  3WNE A;  1Z05 A;  4CJV A;  4BRM A;  4CBU A;  2F96 A;  3CXC M;  5K14 A;  1CXU A;  2Q2R A;  4DUY K;  2FSN A;  3ZX3 A;  3L2R A;  3MX2 A;  3ZEU A;  4LH5 A;  5HRR A;  4B9L A;  1WB9 A;  1ASW A;  3TAN A;  5KQD A;  4BC4 A;  3I55 N;  1C0M A;  5AQV A;  4KTZ A;  3ZT3 A;  4HCC A;  3CM6 A;  4CZG A;  3MDQ A;  4LH4 A;  5BRE A;  1TGO A;  3L0Q A;  3MMV A;  4OPA A;  1YVU A;  1NKE A;  4CHQ A;  4WCE L;  1V4T A;  3OYC A;  4NXM K;  1VQ7 N;  3I8B A;  1U48 A;  1HR0 K;  1O13 A;  2O8D B;  1KAY A;  4CZH A;  2D0C A;  2W6L A;  4XEI A;  1EX4 A;  5CE3 A;  2F4V K;  4ID1 A;  4BR4 A;  2YHX A;  1RDU A;  3PSI A;  3CQ8 A;  3SQ4 A;  3DXK B;  4NO7 A;  3DLB A;  4ICL A;  4H5R A;  4JI2 K;  2JLE A;  4JKD A;  3NVM A;  3NGY A;  1GOB A;  2PY5 A;  3SPY A;  3K5O A;  2O8E B;  2E20 A;  3ENH A;  1NGC A;  5CYQ A;  4CZI A;  2W42 A;  4E1M A;  3L8B A;  3IDH A;  1KRP A;  4KH5 A;  3PLA A;  1NGA A;  4Z0U A;  3P83 D;  1IKV A;  3ZLJ A;  1RTI A;  4A57 A;  3KLG A;  4I6M A;  4G1Q A;  3SUP A;  4J8F A;  1DKG D;  1S1V A;  4X62 K;  3PO4 A;  2OPS A;  2NZT A;  1JJ2 M;  3TU5 A;  3PUF A;  4CF2 A;  1VSF A;  4B9V A;  3VES A;  1JCG A;  2X74 A;  2ZJP L;  4JN4 A;  3NHG A;  1VQL N;  4FW1 A;  4BWJ A;  5BPL A;  4FJ8 A;  2P9P B;  1KVB A;  3VF4 A;  4CFC A;  1K8K B;  3A5O C;  3AO2 A;  1J54 A;  5I9E B;  1Q86 O;  4RW8 A;  1RT2 A;  2QWR A;  4HUF A;  4KPY A;  4C8M A;  2VWK A;  2DFE A;  1RBU A;  1T44 A;  4EP4 A;  4DS4 A;  1NG9 A;  1FKP A;  4DTO A;  1YF5 L;  2UXB K;  2HHV A;  4HUG A;  4KRE A;  4NYF A;  3F9M A;  3DRS A;  3HRG A;  3TSU A;  3CJA A;  2NNW A;  1NOZ A;  4BG9 A;  4FK4 A;  4JYA K;  1O1W A;  3DJC A;  4E7J A;  3UB5 A;  2G8I A;  3T69 A;  3H3N O;  1QSL A;  3ZSY A;  3JSM A;  4Z4C A;  3IG1 A;  2F7T A;  5CZ2 A;  4U67 L;  3HK2 A;  3O3G A;  1VRT A;  4QS7 A;  4FVU A;  1HNV A;  2P9L A;  3TAB A;  3CET A;  2E2Q A;  4LC9 B;  4DF4 A;  5TKW A;  4JRP A;  3NMU A;  5E41 A;  4RTF D;  4DB3 A;  4FXD A;  4E7I A;  4RWT A;  3N4P A;  1IJJ A;  3SZ2 A;  3QEP A;  3K5M A;  1JLE A;  4IG3 A;  1VQ8 N;  3TAG A;  4E7L A;  3KLI A;  5ELZ A;  4CK1 A;  3P4I A;  2D5R A;  1RT5 A;  3KVG A;  4RW7 A;  3QEW A;  3ULE A;  4Q0B A;  3HST B;  4FLT A;  2KLA A;  4CEA A;  3R3L A;  1ZXO A;  4DWI A;  4IOA L;  3OYN A;  1GLC G;  3J7A P;  3TTD A;  1KAX A;  3VQ9 A;  3V81 A;  4JD2 B;  3HZ6 A;  4OLA A;  3ID8 A;  4JHD A;  3VQB A;  4K8X A;  3U8X A;  1NK5 A;  5EVZ A;  1ZBF A;  1VQK N;  2BH1 A;  1YIT N;  4FPA A;  4ID5 A;  2XY8 A;  1RFQ A;  3UE5 A;  1T03 A;  1TYQ B;  3SQ0 A;  1VK0 A;  1QVF M;  3P5J A;  4A59 A;  4B9N A;  4E7K A;  3MWP A;  3C95 A;  4H8K A;  5JVG L;  5FRM A;  3MN9 A;  3NH2 A;  1BA1 A;  2BUP A;  5D3G A;  2O4G A;  4BRE A;  3VQ4 A;  5M1K A;  4QCL A;  3DAW A;  1TUU A;  1NGB A;  4FJI A;  4Q5V A;  1XNQ K;  3V9S A;  4N76 A;  4OLB A;  1KLN A;  3AVA A;  3VGL A;  4CGG A;  3OYD A;  2P9I B;  3I56 N;  2H3G X;  3FZL A;  1VSE A;  3M6G A;  2GWJ A;  3VEO A;  4BY9 C;  4DQR A;  4CJU A;  4H0Y B;  1ZBH A;  3CCS N;  4CK3 A;  5IWA K;  1NK8 A;  5C24 A;  1HYV A;  1SL0 A;  2KHO A;  4GKK K;  2PBD A;  3O5B A;  3MEG A;  2GX9 A;  1NJI O;  5J2Q A;  4F3T A;  3WNG A;  4YOX A;  4GNI A;  2D0P A;  2CGJ A;  3HVT A;  1Z25 A;  3HBT A;  4IEE A;  1IO2 A;  3D2E B;  3G0Z A;  3PX0 A;  1W7A A;  2VWJ A;  3OJS A;  5KPR A;  4DQ8 A;  1HRH A;  1RT3 A;  3EY1 A;  3DXK A;  5HP1 A;  1TKT A;  3PX6 A;  3R6M A;  2FSK A;  1YJW N;  3VER A;  3AA4 A;  1S3X A;  2RHK A;  5SZT A;  4DS5 A;  4I7F A;  3AA3 A;  4IZ9 A;  4Z4I A;  3OYJ A;  3ENB A;  1CZA N;  4JKE A;  3K5L A;  3O08 A;  1D4X A;  3KWI A;  4DKW A;  5M1Q A;  1EKE A;  2QXL A;  5AQH A;  3CC2 N;  4O0J A;  4DSI A;  5JS1 A;  1FJG K;  3A0I X;  3AVJ A;  4OVL A;  3HP6 A;  4DV7 K;  2PYL A;  4FLX A;  1OVY A;  2P9N B;  3MXI A;  2QKB A;  5FDL A;  4CGI A;  4WFA L;  3FR0 A;  3O9S A;  2P9S A;  1H1V A;  3GDQ A;  4M45 A;  3WNF A;  4UQG A;  4LF6 K;  4CJ4 A;  2A1R A;  3AAP A;  4DR6 K;  3KTQ A;  2GEM A;  1C1C A;  3ASM A;  1NGH A;  3HJF A;  4BRH A;  5AQY A;  1X9S A;  3L6Q A;  4A2A A;  3QIN A;  4BRK A;  4CZK A;  4PKG A;  3CF5 L;  1GLD G;  1TAU A;  4K41 A;  2P9P A;  4PKH A;  4IJN A;  4F2R A;  3U9D A;  2XY5 A;  1QS4 A;  4JKA A;  4AHT A;  3HSC A;  4FLY A;  2YHW A;  4FJ7 A;  3SMS A;  3SJH A;  3QNO A;  1HJO A;  2R7Y A;  4BC2 A;  4CD1 A;  2JGU A;  3HPG A;  3WEE B;  3OS1 A;  1QQM A;  2FSJ A;  1QHT A;  4IDK A;  1YI2 N;  2ZWH A;  4M42 A;  3AVC A;  4FO0 A;  2OPP A;  2HOE A;  4CJF A;  4ZTF A;  5CR4 A;  3RSE B;  3VA3 A;  3B6O A;  3E9P A;  3RRG A;  2Q97 A;  4DTP A;  4BDP A;  3AVI A;  4YOU A;  3ID6 A;  2WTU A;  1WBD A;  4JI5 K;  4B1V A;  1JXB A;  1Q18 A;  5AQQ A;  3ZSV A;  4CHN A;  2I7N A;  3A5N C;  4OPJ A;  1Q9Y A;  5ADX A;  1SQK A;  4JI3 K;  3VET A;  3IFR A;  4AM7 A;  2QWO A;  2ATQ A;  2ZGZ A;  1OKJ A;  4WYB A;  1SAZ A;  2NRX A;  4B1Z A;  4CHO A;  4DUZ K;  3MEC A;  3SBG A;  1NOY A;  1GOA A;  4EHT A;  2Q3S A;  4KTW A;  1QQO A;  3TAE A;  3QET A;  3AO4 A;  5AQU A;  3EEQ A;  4BVO A;  2O4I A;  3W0L A;  2WOM A;  4N47 A;  1TK0 A;  1S72 N;  1UA0 A;  3QFP A;  3OYH A;  5LMU K;  5HBM A;  3J7Y P;  1XNR K;  4AHC A;  4H0V B;  1JXE A;  1HQE A;  3OVN A;  2OZM A;  1IKW A;  4AHV A;  4LSN A;  3L2W A;  3A2F A;  4JS5 A;  3KKS A;  5C12 A;  4CJK A;  1RDD A;  4J2E A;  2ZQB A;  4PY5 A;  3VF6 A;  4GMJ B;  1IBK K;  4BRI A;  1CLQ A;  3SCX A;  1Q81 O;  1S6Q A;  4E7H A;  1NMD A;  4X64 K;  4XH5 A;  4CBW A;  5GAG P;  2AA4 A;  4HCB A;  2KTQ A;  1TL3 A;  2FBY A;  4NLC A;  4LFA K;  1EWR A;  3T3F A;  2OYQ A;  4NCB A;  4MDB A;  2FLO A;  4JK9 A;  4BGB A;  4NYN A;  3AA5 X;  2BTF A;  1RT7 A;  4FWM A;  4BE1 A;  1X1P A;  4C8K A;  3MWT A;  1HKG A;  5HLF A;  3K58 A;  4DSJ A;  4FLW A;  3HOS A;  5AQP A;  2VWB A;  2HMI A;  1FKO A;  3HI0 A;  4KRF A;  3D7E O;  4KHY A;  5AZJ A;  4L3Q A;  4W5R A;  2KFZ A;  1BQM A;  1P8Z A;  2DFF A;  5FPD A;  3KK1 A;  1JLQ A;  3KWG A;  1CXQ A;  2UUB K;  3CPW M;  4B1Y B;  3CC7 N;  4DFM A;  1XMO K;  3CCM N;  4GKJ K;  3DOL A;  4JKH A;  4RW9 A;  3RVC A;  4CJ5 A;  3OYK A;  4FJK A;  1WSI A;  4IFE A;  1VHX A;  3H3O B;  2HVH A;  2UUC K;  3AGK A;  3ZCM A;  1BCM A;  3NF9 A;  1WSH A;  3SYZ A;  2GEL A;  3L3U A;  4NCG A;  3T1H K;  4Y0W A;  3QER A;  3N4Q A;  3T7Z A;  4JEP A;  3M8R A;  1UWB A;  3LP0 A;  3SAH A;  4CEE A;  4LF5 K;  1RDA A;  4HVJ A;  3OYA A;  4H4O A;  4F3O A;  3QBW A;  4DTR A;  2QI2 A;  1VSI A;  4BE0 A;  4ILG B;  5AQX A;  1N6Q A;  4JLH A;  3VQ8 A;  4CI6 A;  4KHP K;  3WNH A;  3RWU A;  2FF3 B;  2F9W A;  3QIP A;  5AQF A;  2IVO A;  1NGE A;  3VGM A;  4EHU A;  3RMC A;  1IKY A;  3LZJ A;  1K8A O;  4F2S A;  3CJ9 A;  3CD6 N;  2DY4 A;  4AHR A;  2QWQ A;  1RTH A;  4FJH A;  3HL8 A;  3CCQ N;  1DTT A;  4LF7 K;  3AO5 A;  4DLE A;  2P1J A;  1NNE A;  1LWC A;  1K6Y A;  2V7Z A;  4FWR A;  4GV6 A;  3C0B A;  3P31 A;  3EN9 A;  3DMJ A;  1RT6 A;  1C0U A;  3LAK A;  1Z6R A;  2NRT A;  2G8V A;  4E1J A;  1Q7Y O;  5I3U A;  3DOK A;  5AQK A;  1B9F A;  1VQ4 N;  4KKO A;  1ZBI A;  1GLA G;  3V9X A;  4ZHR A;  1B92 A;  3O1W A;  3EE8 A;  4M3T A;  3OBY A;  4NB4 A;  4CZM A;  4JV5 K;  4BGA A;  4BRN A;  1HJR A;  1HMV A;  1OH8 A;  1HX1 A; 
#chains in the Genus database with same CATH homology
 1RBT A;  4DTS A;  4K8Z A;  3G10 A;  1NOZ A;  3SJJ A;  4BWM A;  4FK2 A;  4FK4 A;  1B9D A;  3H08 A;  2ZE2 A;  3I8D A;  1O1W A;  4E7J A;  3KD1 E;  2B6A A;  3QO9 A;  3ZSW A;  4FZX C;  4KHS A;  2G8I A;  1QSL A;  3ZSY A;  4DFJ A;  1GOC A;  3JSM A;  4OKK A;  4RW4 A;  1QE1 A;  3IG1 A;  4Z4C A;  5HRO A;  5CZ2 A;  2G8K A;  4ELU A;  5J2M A;  1YT3 A;  3ZT2 A;  1J9A A;  2PYJ A;  1U04 A;  1QTM A;  4B8A B;  4CJP A;  1VRT A;  2LSN A;  3O3G A;  3HK2 A;  4AIL C;  4EZ6 A;  2KW4 A;  1HNV A;  3C6U A;  4B3O A;  3TAB A;  1X9M A;  1S1U A;  4CED A;  3OY9 A;  4DF4 A;  3DRP A;  4GW6 A;  4JRP A;  3KIO A;  5E41 A;  2IAJ A;  3LAM A;  3RTV A;  3V9Z A;  1RBV A;  1SV5 A;  4IG0 A;  1KFS A;  2BAN A;  4E0D A;  4FJJ A;  4KHQ A;  4M3R A;  4CJL A;  4FXD A;  4E7I A;  2A1S A;  4E19 A;  3VQQ A;  1N5Y A;  5J1E A;  1ZBL A;  1SKW A;  4CFA A;  1KFD A;  4CHY A;  3SZ2 A;  4CE9 A;  4CJS A;  4E1N A;  4DFP A;  3K5M A;  1JLE A;  1RTJ A;  3OS2 A;  3QEP A;  4IG3 A;  1XHZ A;  1ZYQ A;  1KSP A;  4B9U A;  3TAG A;  1LWE A;  1TAQ A;  4E7L A;  3CFO A;  4L8R B;  1CZB A;  3HXM A;  3KLI A;  4FW2 A;  1QSY A;  5KRS A;  4CK1 A;  4LD0 A;  4CGJ A;  2D5R A;  1RT5 A;  1LAW A;  4RW7 A;  4KFB A;  3QEW A;  1NK7 A;  2YHB A;  4Q0B A;  1TKD A;  3L2Q A;  1IG9 A;  3HST B;  4FLT A;  1BI4 B;  4O55 A;  3LDS A;  5J2N A;  3AO1 A;  4CEA A;  4DWI A;  3RMA A;  1C6V A;  2RN2 A;  1F21 A;  3DYA A;  1W9H A;  5DMR A;  3OYN A;  2Y1J A;  4IKF A;  4FZY A;  3LP3 A;  4E89 A;  3VQ9 A;  3V81 A;  3HO1 A;  4OLA A;  4CJE A;  3VQB A;  2HHT A;  4K8X A;  1NJW A;  3TR8 A;  2HNY A;  1NK5 A;  1T05 A;  1ZBF A;  5CYM A;  3C94 A;  3PX4 A;  4ID5 A;  2XY8 A;  3NH1 A;  4FCY A;  3P1G A;  2QXF A;  3V1O A;  2G8F A;  3VQE A;  1D9F A;  3CYM A;  1T03 A;  3SQ0 A;  1VK0 A;  3P5J A;  2IOC A;  4B9N A;  4E7K A;  3NF8 A;  3C95 A;  4H8K A;  3AV9 A;  4EZ9 A;  1S1W A;  5FRM A;  3LAL A;  4Z4H A;  3NH2 A;  3NDK A;  5FRN A;  1L3T A;  1KTQ A;  1SL1 A;  4DU3 A;  1VSK A;  4M41 A;  5D3G A;  2O4G A;  2OPR A;  3AVM A;  3VQ4 A;  1L3U A;  4JS4 A;  4HHT A;  1JLB A;  4CEB A;  2HHW A;  3MXJ A;  3CFR A;  4QCL A;  3LAN A;  1JKH A;  1RBS A;  3TAR A;  3OYB A;  4DLG A;  4FJI A;  4PA1 A;  4DTN A;  4Q5V A;  5J2P A;  2HHQ A;  3V9S A;  4FJN A;  4N76 A;  4OLB A;  4W5T A;  3O3H A;  3QNN A;  1KLN A;  1MU2 A;  4Z4E A;  5KI6 A;  3AVA A;  2F8S A;  3LWM A;  4PUO A;  3T1A A;  4CGG A;  3OYD A;  4O4G A;  5DK5 A;  4BDZ A;  1VSE A;  1I39 A;  4I2P A;  1S1X A;  3KKR A;  3QES A;  4J2B A;  2QK9 A;  1XWL A;  2X6N A;  4DQR A;  4CJU A;  1ZBH A;  3ULD A;  4FJG A;  2E6M A;  2BE2 A;  2XY6 A;  4CK3 A;  2YNI A;  1NK8 A;  4EP5 A;  1WNS A;  4HUE A;  3V9W A;  5C24 A;  4ELV A;  1HYV A;  4FYD A;  1BL3 A;  1SL0 A;  1J5O A;  1HYS A;  1QQC A;  5T7B A;  2P5O A;  3MEG A;  4FLV A;  5J2Q A;  4MFB A;  1EP4 A;  1LAV A;  3F73 A;  4F3T A;  3WNG A;  4KHW A;  3O4Q A;  1IH7 A;  1RDC A;  5C25 A;  2HND A;  5KGW A;  5KTQ A;  1D8Y A;  3K2P A;  4CFD A;  3IAY A;  4DSK A;  1REV A;  3HVT A;  4CJT A;  3L2U A;  1Z25 A;  1ZBU A;  3AVL A;  2IC3 A;  3ZT0 A;  3CFP A;  3DLH A;  1WSF A;  3VA0 A;  4DTU A;  3KLF A;  1IO2 A;  1RDB A;  4CEQ A;  3G0Z A;  3PX0 A;  4GVM A;  4CJW A;  2VWJ A;  3OJS A;  1VSJ A;  4CJQ A;  2PZS A;  1HRH A;  3RR7 A;  1RT3 A;  3EY1 A;  3PY8 A;  1NJX A;  5HP1 A;  3VQ6 A;  1ASU A;  2I5J A;  4KHN A;  1TKT A;  3SUQ A;  3PX6 A;  2FC0 A;  4H4M A;  4OJR A;  4CK2 A;  3HT3 A;  3V6D A;  2GV9 A;  1S9E A;  1BQN A;  3AA4 A;  4OPK A;  3TAP A;  4F8R A;  1IKX A;  2P51 A;  5SZT A;  3LWL A;  2OPQ A;  4DS5 A;  2GBZ A;  2XHB A;  4I7F A;  3AA3 A;  4Z4I A;  1TKX A;  3OYJ A;  2Z1I A;  3HM9 A;  3K5L A;  1NK4 A;  2VG5 A;  4FM1 A;  3DLR A;  4I2Q A;  3VN5 A;  3HPO A;  3PO5 A;  1EKE A;  3SNN A;  4B8C A;  3TAQ A;  4R5P A;  4N56 A;  1SUQ A;  1BGX T;  2B4J A;  3FFI A;  4O5B A;  4O0J A;  3NCI A;  3LPT A;  5C42 A;  3NFA A;  4DSI A;  5JS1 A;  1WN7 A;  3RR8 A;  3V4I A;  1KCF A;  3AVJ A;  4OVL A;  3VQD A;  3ZT1 A;  3HP6 A;  4CGD A;  2PYL A;  1U47 A;  4FLX A;  3U3G A;  3BDP A;  3MXI A;  4FJM A;  4M3X A;  2QKB A;  5FDL A;  4CGI A;  3S9H A;  1WAJ A;  2Z1G A;  4KB1 A;  3THV A;  3LPU A;  4DTJ A;  2X78 A;  2YV0 X;  2XO7 A;  4I9Q A;  1S5J A;  3DRR A;  4M45 A;  2VG6 A;  2KZM A;  1NK6 A;  1DLO A;  3WNF A;  4UQG A;  4DMN A;  2F8T A;  4CJ4 A;  4PQU A;  1RCH A;  3OS0 A;  2A1R A;  4NCA A;  4LSL A;  3KTQ A;  3B6P A;  1C1C A;  3ASM A;  3L3V A;  1LWF A;  1Z26 A;  3KD5 E;  3HJF A;  1UOC A;  1X9S A;  4E3S A;  4OKE A;  3NAE A;  3QIN A;  3KLH A;  4BDY A;  4IFY A;  2HHU A;  5CY4 A;  1TAU A;  3AVN A;  2Y1I A;  4DU1 A;  1JL1 A;  4XIU A;  1D9D A;  1TKZ A;  3ZSQ A;  3DLK A;  3OYF A;  4FK0 A;  1JLG A;  2G8U A;  2YNF A;  3QLH A;  4RG8 A;  1QS4 A;  4BE2 A;  4CEO A;  4CHP A;  2XY5 A;  4AHT A;  4FLY A;  1SKR A;  4C8L A;  4FJ7 A;  3ITH A;  1JL2 A;  2KFN A;  2YHA A;  3QNO A;  1DTQ A;  2R7Y A;  1U4B A;  2QKK A;  2JGU A;  1HYZ A;  2Z1J A;  3HPG A;  3OS1 A;  3S3O A;  1L3V A;  1LW0 A;  1JLF A;  1L5U A;  2E6L A;  3OYG A;  3QEX A;  3NH0 A;  1QHT A;  1XHX A;  4IDK A;  1SKS A;  4CF8 A;  5SWM A;  4ZTJ A;  4M42 A;  2EHG A;  1BIU A;  1JLA A;  3AVC A;  4DTX A;  4DF8 A;  4DSL A;  1FXX A;  5HRS A;  1KLM A;  1RBR A;  2OPP A;  3C6T A;  4CF0 A;  4CHZ A;  5HRP A;  4CJF A;  5I42 A;  1C1B A;  4ZTF A;  4M3Y A;  5HRN A;  3SPZ A;  1TVR A;  2ITG A;  2IS3 A;  4CEF A;  3OYM A;  3S3M A;  1NJY A;  1T7P A;  1VSL A;  2YNH A;  3VA3 A;  2RPI A;  3B6O A;  1RNH A;  4CGH A;  4DTP A;  3RRG A;  4BDP A;  4CJR A;  3AVI A;  3LP2 A;  3HP9 A;  3OYL A;  2E4L A;  1WSE A;  3CM5 A;  1JXB A;  3ZSV A;  4N5S A;  1WSG A;  4Y1D A;  4CHN A;  4OPJ A;  4C8O A;  1Q9Y A;  1EET A;  3S3N A;  3ZSX A;  1LW2 A;  4CGF A;  4FJ5 A;  3TWH A;  4QOZ B;  3OYE A;  2ATQ A;  4J2D A;  2IDO A;  3AO3 A;  3D45 A;  2GUI A;  4AH9 A;  3SV4 A;  3ZSO A;  3ZSZ A;  3K59 A;  4DQI A;  4KB0 A;  4CHO A;  1S9G A;  2FBT A;  3AVH A;  1RIL A;  2YKN A;  3MEC A;  4W5Q A;  4B9M A;  2YNG A;  1W0H A;  3D0P A;  1GOA A;  3NE6 A;  1NOY A;  3I0S A;  3UIQ A;  3ZSR A;  1RT1 A;  2Q3S A;  4KTW A;  3TAE A;  3TI0 A;  3QET A;  3AO4 A;  2FBX A;  3SUO A;  2OA8 A;  4B9S A;  2O4I A;  2WOM A;  1NJZ A;  4N47 A;  1TK0 A;  1UA0 A;  1KVC A;  2YKM A;  2B5J A;  3O3F A;  3OYH A;  5HBM A;  1X9W A;  5KRT A;  4RW6 A;  3VQC A;  4FJ9 A;  3BGR A;  1R0A A;  4AHC A;  1NKC A;  4LY7 A;  1TK8 A;  3V1Q A;  2G8W A;  1JXE A;  4J2A A;  3HVR A;  1HQE A;  1RT4 A;  4KV8 A;  1BI4 A;  2KQ2 A;  1U49 A;  1HPZ A;  1BCO A;  3K57 A;  3F9K A;  5FRO A;  3NGZ A;  1WAF A;  3OVN A;  1YTU A;  2HVI A;  2OZM A;  3SUN A;  1IKW A;  4AHV A;  4F2R A;  3OYI A;  4LSN A;  1TV6 A;  3A2F A;  3L2W A;  4JS5 A;  3KKS A;  1A5W A;  3NF6 A;  3RRH A;  4CJK A;  4FM0 A;  4FJL A;  4OGE A;  1RDD A;  1UAX A;  2BDP A;  1BIS A;  4J2E A;  2ZQB A;  4MQ3 A;  2BGG A;  4PY5 A;  4GMJ B;  3MED A;  4CF1 A;  1CLQ A;  3SCX A;  3ZT4 A;  3VQ5 A;  4O0I A;  4M3Z A;  1S6Q A;  5KGX A;  4E7H A;  3PV8 A;  4DQP A;  3SQ1 A;  1XC9 A;  4O44 A;  3WNE A;  2P5G A;  2WON A;  3ALY A;  4AHU A;  4HCB A;  2KTQ A;  4WE1 A;  2IGI A;  4CJV A;  3U6F A;  1TL3 A;  4YNQ A;  4DFK A;  2F96 A;  4CCH A;  4FJX A;  1VSM A;  3I0R A;  5K14 A;  2G8H A;  4KAZ A;  2FBY A;  3VQ7 A;  1CXU A;  2RF2 A;  4DSE A;  1BIZ A;  3MEE A;  3T3F A;  1G15 A;  3L2R A;  3MXM A;  2OYQ A;  3LZI A;  4NCB A;  2RKI A;  1S6P A;  4LH5 A;  1D5A A;  5HRR A;  2OZS A;  4B9L A;  4NYN A;  1ASW A;  3AA5 X;  1NK0 A;  1RT7 A;  3K5N A;  3ISN C;  3TAN A;  4F4K A;  1ASV A;  4M3W A;  4BE1 A;  3TAM A;  4DQQ A;  1C0M A;  3AVF A;  1NK9 A;  4FZZ A;  2XY7 A;  1X1P A;  1XI1 A;  4C8K A;  4FLU A;  3NBP A;  1S1T A;  4KTZ A;  1WSJ A;  3HPH A;  3ZT3 A;  4HCC A;  3CM6 A;  1Y97 A;  4LH4 A;  4OGC A;  4KHU A;  3U3Y A;  4CEZ A;  1TGO A;  3K58 A;  5HLF A;  4DSJ A;  4FLW A;  1YVU A;  3CG7 A;  1NKE A;  2HMI A;  1EXQ A;  1FKO A;  4FM2 A;  4CHQ A;  3EYZ A;  4KRF A;  1VRU A;  3OYC A;  4IBN A;  3KK3 A;  3AA2 A;  1WLJ A;  4W5N A;  4KHY A;  1U48 A;  1A5V A;  2DFH A;  2X6S A;  3LP1 A;  3T19 A;  3IRX A;  4W5R A;  1QSS A;  2KFZ A;  1BQM A;  2AJQ A;  4DTM A;  2DFF A;  2HW3 A;  4QAG A;  1BHL A;  3KK1 A;  1JLQ A;  2D0C A;  1CXQ A;  3KK2 A;  4KI6 A;  1A5X A;  1EX4 A;  3AVG A;  4DFM A;  3M8S A;  2HHX A;  3DOL A;  1HNI A;  4RW9 A;  4CJ5 A;  1KVA A;  4CFB A;  2NUB A;  1RTD A;  1T8E A;  4CES A;  4ID1 A;  4CIE A;  3OYK A;  3RMD A;  4HTU A;  1FK9 A;  4ELT A;  4Z4G A;  4I9L A;  2D0A A;  3SV3 A;  3CQ8 A;  4FJK A;  3SQ4 A;  1WSI A;  4CIG A;  4DG1 A;  3KJV A;  3DLB A;  2HVH A;  4ICL A;  4Z4F A;  2Z1H A;  3ZCM A;  5CZ1 A;  2JLE A;  1TK5 A;  1BCM A;  3NF9 A;  1HQU A;  1WSH A;  1ITG A;  3NGY A;  2HB5 A;  3O4N A;  3L3U A;  3SYZ A;  3AVB A;  4NCG A;  1GOB A;  4DQS A;  2PY5 A;  3SPY A;  3QEI A;  3K5O A;  3QER A;  1NKB A;  5CYQ A;  3M8R A;  4M3U A;  3TAF A;  4Y1C A;  3VQP A;  2W42 A;  3L2V A;  1UWB A;  3LP0 A;  4KO0 A;  1J53 A;  4E1M A;  4B08 A;  4CEE A;  1Q8I A;  3L8B A;  1KRP A;  4IFV A;  4OKJ A;  3DLG A;  1RDA A;  4Z0U A;  4HVJ A;  3OYA A;  1Q9X A;  4H4O A;  4F3O A;  3P83 D;  1IKV A;  4DTR A;  1UA1 A;  1RTI A;  4C8N A;  3V1R A;  3KLG A;  1U45 A;  1VSI A;  1SL2 A;  5JS2 A;  4BE0 A;  1N6Q A;  4JLH A;  3VQ8 A;  4FVM A;  3KLE A;  1YTA A;  3QIO A;  4PWD A;  4G1Q A;  3SUP A;  1VSD A;  4AHS A;  3WNH A;  3RWU A;  4FLZ A;  1LV5 A;  1S1V A;  3QIP A;  5EU7 A;  3PO4 A;  2OPS A;  3M8P A;  1VSH A;  3E01 A;  2DTU A;  3SQ2 A;  3M8Q A;  3PUF A;  1JLC A;  1L3S A;  4F2S A;  3RMC A;  1IKY A;  1VSF A;  4CF2 A;  3AVK A;  3LZJ A;  4B9V A;  2DY4 A;  2X74 A;  3DM2 A;  4AHR A;  3DLE A;  3QEV A;  4CIF A;  1C0T A;  1RTH A;  3JYT A;  4BAC A;  3DI6 A;  3HL8 A;  4FJH A;  1DTT A;  3OJU A;  3NHG A;  3AO5 A;  3V9U A;  3VQA A;  4DLE A;  3SI6 A;  4FW1 A;  4BWJ A;  2P1J A;  4CF9 A;  4FJ8 A;  2ZD1 A;  3NGI A;  1KVB A;  1LWC A;  4W5O A;  1K6Y A;  2XRI A;  4CFC A;  1TL1 A;  4CJ3 A;  3AO2 A;  1J54 A;  2EX3 A;  3DMJ A;  1RT6 A;  1C0U A;  4B9T A;  2KZZ A;  3LAK A;  2G8V A;  4RW8 A;  1RT2 A;  4YFU A;  4HUF A;  4KPY A;  5I3U A;  3DOK A;  3HYF A;  3MAQ A;  4KTQ A;  4C8M A;  1CZ9 A;  3RMB A;  2VWK A;  4TSX A;  1B9F A;  2HNZ A;  2VG7 A;  4KKO A;  1ZBI A;  2DFE A;  4N41 A;  1RBU A;  1I3A A;  3V9X A;  4JRQ A;  3IS9 A;  4ZHR A;  1B92 A;  4EP4 A;  4DS4 A;  4CER A;  4M3T A;  4DSF A;  1FKP A;  2FBV A;  3EZ5 A;  4DTO A;  4KI4 A;  2HHV A;  2HHS A;  2D0B A;  1HJR A;  4HUG A;  1HMV A;  2ETJ A;  4KRE A;  1C1A A;  4NYF A;  4CEC A;  4DU4 A;  3NF7 A;  3DRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...