2ZE2A

Crystal structure of l100i/k103n mutant hiv-1 reverse transcriptase (rt) in complex with tmc278 (rilpivirine), a non-nucleoside rt inhibitor
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title High-resolution structures of HIV-1 reverse transcriptase/TMC278 complexes: Strategic flexibility explains potency against resistance mutations.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase, hydrolase
total genus 136
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ze2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ze2A05
3DLBA 2ATQA 1WSJA 4ELUA 1N6QB 1JLBB 5JS2A 1S0MA 3H59A 4DTSA 5HBMB 5HBMA 3WNEA 4E19A 5KG6A 4TQSA 4QWCA 3SUOA 4FJ9A 2YNGB 2YNGA 3SFGA 3MR6A 1WSHA 2OPQA 3UDLA 4NYFA 3WNFA 1Z4UA 4CGGA 5FROA 3AA2A 2V4RA 2YV0X 2YHAA 2F8SA 2EX3A 4ECTA 4IR1A 2HAIA 4JLHA 4FJKA 4WE1A 5KFAA 1T03B 2IM2A 2OPRB 2OPRA 3I5BA 2JEIA 3ZSRA 4CF0A 4Y2CA 3E01A 3CO9A 4URGA 1X1PA 4R0EA 4M95A 2A1SA 5F8GA 5KFKA 1TL1B 5F8JA 1TL1A 4N56A 2XRIA 1EKEA 3M8RA 3OYNA 1XR5A 3WNGA 1S1WB 1ZBUA 1ASUA 4IFVA 3PJWA 2IAJB 2IAJA 1UA0A 3RB6A 4CGHA 4OLBA 3CG7A 3S3OA 2OH2A 4ECQA 4BDZA 1ZBIA 1NK9A 1MU2B 1MU2A 2ITGA 1T05B 4KKOA 4RZRA 2HNYB 3KLHB 4FM1A 1JLGA 3PY8A 4O44B 1TK8A 4O44A 3CDUA 4ID1A 2C22A 1T3NA 1RT1B 1XWLA 3T5LA 3QESA 3BSCA 4CK3A 2G8VA 2UVRA 3V9ZA 4ID5B 4N41A 4ID5A 4CEDA 5DLFA 3HVWA 3LAMA 1UAXA 3RMAA 1XHXA 4M3XA 1WNSA 5CZ1A 2AGQA 3V9WA 1WSIA 1DTQB 1DTQA 1N4LA 4KE5A 3UR0A 3MXMA 3EPIA 3KK3A 1DTTB 4RNHA 1DTTA 2KFZA 2G8KA 1LWEB 1Y97A 1IM4A 3QNOA 5J2QB 3K5OA 4WZQA 3ASMA 4FK0A 4CF8A 1U45A 2IC3B 2IC3A 3AO4A 1BISA 3AA5X 4NLYA 3EZ5A 1L3SA 3IRXA 1LV5A 3KD1E 3QEVA 4J9LA 3H5XA 3L2RA 3KLFB 5FRNA 2D3UA 5KFOA 1I6JA 1IH7A 4CHQA 2I1RA 3AVJA 2HVIA 2BDPA 2D41A 1NK0A 3LWLA 1TKTB 1TKTA 2JGUA 3KHRA 5EUHA 4FLUA 3LWMA 3BDPA 4MK7A 3CJ3A 1T7PA 4KO0A 5KG0A 5DQHA 2E9TA 1TK0A 1HQUB 4JV0A 4NLWA 4XO0A 3CDWA 5HLFB 4RNMA 2VWJA 3TVKA 1QQCA 4FYDA 4PUOB 3QLHB 4PUOA 2HWHA 5KFYA 2W9AA 5KFTA 4ED3A 4DSLA 1S97A 4NLUA 2AU0A 4ECWA 4ECRA 3OS1A 1VRTB 4LSLA 1HQEB 1HQEA 3PO4A 2ASLA 1TVRB 4ZPDA 4KSEB 4DL4A 5I42A 1W9HA 4MK9A 2IBKA 4CEQA 5KFLA 4AHCA 1HPZA 4IDKB 4OKEA 4IG3A 4FW1A 1C1BA 4HCCA 3AV9A 3SQ0A 2D3ZA 3P5JA 3DRRB 4DS4A 2P51A 5KI6A 2JEGA 3DYAB 4DTXA 2FC0A 1NK8A 4KV8B 3N6MA 3DOKB 5C24A 1J5OA 5D3GB 1IKYB 3GIJA 3OL7A 4HTUA 3CDEA 3N6NA 4DMNA 4HVJA 3M9OB 3ZT2A 5CYQA 4IRKA 4FJMA 4JUZA 1QTMA 3GIIA 4FW2A 2W8KA 4X2BA 3LP3A 4KTZA 4CE9A 1WLJA 3LP0B 4RW8A 4WFXA 4DQRA 4MKAA 3BQ2A 3I5AA 1X9SA 4EZ9A 3I0SB 1A5WA 1RT6B 1O1WA 4IRDA 3MECB 1B92A 4L8RB 3OL8A 3KOAA 3G6XA 1JLAA 2J6SA 5L1LA 3KLEA 4ZHRB 4ZHRA 2XO7A 4WXWA 1LWFB 3LDSA 3VQBA 3RR7A 1I3AA 4DS5A 5EU7A 4LQ3A 3NF9A 1BIUA 1RBVA 4AHSA 2DY4A 4KB1A 3VQ6A 4CJLA 2O5DA 4Y3CA 3Q8SB 4Q43A 3AVNA 3AVHA 5J2NB 4NYNA 4W5RA 5J2NA 2BRKA 2ETJA 3IN5A 4ED2A 1VSFA 2JC1A 4O3PA 1A5XA 3DLKB 2Z1HA 1ZBFA 4F3TA 3HKWA 1BI4A 4MKBA 5KFIA 3LANA 2ZKUA 5I3UB 4EO8A 1KHWA 4FZZA 3AA3A 3NAIA 2OA8A 1N5YB 1RDDA 4YR0A 3PJXA 3Q8QB 4DFJA 1NJWA 4CHOA 1X9MA 1RT5B 4ECSA 4OKKA 1JLCA 1RT5A 4QPXA 3G86A 3AVAA 1VSIA 3HM9A 2B6AB 2G8HA 4KREA 4K4ZA 3DLEB 1QUVA 3BSOA 2RPIA 4ELTA 1RT4B 4Y2AA 1REVA 3B6PA 1ZTTA 4Z4EA 3UPFA 5L9XA 2HW3A 4Y1CA 2G8WA 4NLRA 4FLTA 3SYZA 1SV5A 2XI3A 5HRPA 2YKNB 3MFHA 5KG4A 3TWHA 1KLNA 4M3WA 3GIKA 2O4IA 1DLOA 1S6QA 4DQSA 2DFHA 3NFAA 1RNHA 3HPGA 3QGHA 2WTFA 1K1SA 1LW2A 4KAZA 1IO2A 1NK7A 4TY9A 5F8NA 4DLEA 1BIZA 1WSEA 4YFUA 3FDSA 3DLGB 4EP5A 1XC9A 3O3FA 4FJNA 4QOZB 4ZVEA 1S9EB 4CERA 1S9EA 1VSKA 1BQMB 3NGDA 4B8AB 1BQMA 1TAUA 4EZ6A 4NZ0A 3T5HA 1L3VA 3NBPB 3NBPA 2AWZA 2KTQA 3OS2A 2JEJA 4CCHA 4RNFA 3LALA 4DTOA 5KFFA 2J6TA 3RB0A 3RBDA 2D0CA 3TABA 2R8IA 2YNFB 4NCGB 2YNFA 4NCGA 3KJVB 3KJVA 4HHTA 3NH2A 3DM2B 2FVCA 1BL3A 3DM2A 4H4MA 1JLQB 2PZSA 1JLQA 3CJ4A 3PZPA 4CEBA 5KT7A 3AVGA 1UWBB 4CHZA 4DTUA 1RTJB 1KVBA 1OS5A 4KHSA 1C0TB 1CXUA 4G3IA 2ILZA 1TV6B 4BE1A 3DOLB 2AGOA 1IKWB 3ZSWA 3KMQA 1IKWA 4FXDA 4E0DA 4K4VA 3PX4A 2UUTA 4J9RA 4CEFA 5KG1A 1NOYA 4CJWA 4CFAA 3H4DA 3VQ9A 4OPJA 1NJZA 2RF2A 2AX0A 3V6JA 2F8TA 4KHNA 3KK1B 3KK1A 4RUAA 4EBDA 3HSTB 4G1QA 4H4OA 3ZSZA 2BR0A 4IG0B 1RTIA 3AO3A 3M9NB 1KRPA 2RDJA 2P5GA 2BQUA 4CEOA 2VG5B 2VG5A 2Y1JA 4J9MA 2KW4A 3KK2B 3M8PA 4RNOA 3H98A 3IS9B 4BE2A 3IS9A 2W9CB 3QZ8A 2W9CA 4B9UA 2HNZA 3S3NA 3ZT4A 4RG8A 4OLAA 3QIDA 3NL0A 4OGCA 2YNIB 3SPZA 2YNIA 3KHGA 4FK4A 4CFDA 4J2AA 1RT3B 1RT3A 2IMWP 2BGGA 1JXEA 4CIFA 3VQ7A 4KBIA 5KFBA 2X78A 4RW7A 3O3HA 4DL3A 2RKIB 4PWDB 5J2MA 4PWDA 1JKHB 1C0UA 1JKHA 1NJYA 4J2BA 4XIUA 3KLIB 4ECUA 3M9MB 3ZSVA 1C1CA 1TKZB 1TKZA 2XY6A 1D9DA 4M3TA 4DLGA 4EBCA 2VA3A 3MEDA 3RB3A 1SH3A 3CQ8A 1GOCA 3ZCMA 1UOCA 4DFPA 5EWFA 4O3RA 2W9BA 1VRUB 2R8JA 3NF7A 2UVUA 4LSNB 4I2QB 4I2PB 4I2PA 2GIRA 3OJSA 4BDYA 1D1UA 3ZSQA 4ZP7A 1N6QA 1JLBA 1RBRA 1RCHA 2HNDB 3PW0A 3MR3A 4CJEA 2IA6A 1QSYA 4MH8A 4YR2A 3ZT0A 3FFIB 3M8QB 3M8QA 1YT3A 1GOAA 2KQ2A 1A5VA 4K4XA 4KTWA 3SV3A 2DFEA 2VG7B 3MXJA 5F9LA 2VG7A 3U3GA 3OYDA 2ATLA 2YKMB 5JXSA 1ITGA 3CM5A 1JL2A 2GIQA 5C25B 3G6VA 5C25A 3NGZA 3CWJA 4ECYA 2ZQBA 3TAEA 4B9LA 3T1AA 2QKBA 1T03A 4DU1A 3H2LA 3OHAA 5J2PB 4CJ3A 1VSEA 3L2VA 5KFWA 4H8KA 4DL2A 2OYQA 2QKKA 4CK1A 5KFNA 1HNVB 4FBTA 4F2RA 4F4XA 3BREA 4FJ5A 1QSLA 3NHGA 2BRLA 2F8EX 3H5UA 1TK5A 4J2EA 1S1WA 2DPIA 4ICLB 3ZSXA 4Q8EA 3VA0A 2XCAA 4AH9A 2XGQA 1ASWA 5FDLB 3QNNA 4M3RA 5FDLA 2X6SA 1C0MA 4TLRA 4BDPA 2RDIA 1T05A 2YNHB 3AVCA 2YNHA 5L1IA 2XI2A 2O4GA 4CJUA 2HNYA 3C6UB 3KLHA 2R8KA 3FQKA 3L2QA 3V9SA 4ZP9A 4AHUA 3QGIA 2D0AA 3I8DA 1RT1A 3KHLA 1HRHA 4QCLA 4BE0A 2E4LA 1WAFA 3HPHA 1LW0B 1HYSB 3SQ4A 5CYMB 4ZP8A 5CYMA 3OYMA 4CHNA 3TAGA 1Z26A 2E9ZA 1Z25A 5C5JA 1QHTA 1RBTA 3SUNA 2FBVA 2WCXA 2IJFA 3SUPA 3K57A 5KFHA 1LWEA 2J6UA 3G6YA 5J2QA 4DEZA 4C8MA 4CK2A 4CJPA 4M94A 2QV6A 3QIPB 1NOZA 3QIPA 3HVRA 4LH5A 4NLXA 3T5KA 1EXQA 4BWMA 1QSSA 1FKPB 1D9FA 4BWJA 3Q8PB 2QE5A 3CFPA 4O3QA 4DSEA 1WSFA 4UQGA 3KLFA 4AHRA 4BACA 1VSLA 3KMSA 4CEEA 4Z4CA 1KTQA 3PHEA 4AHTA 4DTMA 3RAXA 4CGIA 1TKDA 1T94A 4MIAA 1N48A 4JS5A 2FJXA 4NCAA 3IGVA 2R7YA 2IS3A 3LPUA 4E7KA 1HQUA 2GV9A 3P1GA 3RWUA 4ED8A 5HLFA 5EDWA 1KHVA 3VQAA 4HKQA 2QK9A 2I5JB 4LH4A 5JUMA 4FJ7A 3QLHA 2R2TA 1W0HA 4Q8FA 1S1TB 3V6KA 3HVTB 5DQGA 5E41A 3ISND 3FSIA 4K8ZA 1JX4A 4K50A 4TQRA 1C6VA 1Q9YA 1TP7A 3THVA 3KHHA 1L3UA 2B43A 4O3NA 1VRTA 1WN7A 3NF6A 3V4IB 3CFOA 1TVRA 3NH1A 1UA1A 4DG1B 3V1QA 4DG1A 3I5CA 4PQUB 3TQ1A 4E7HA 3P83D 1ZYQA 4ZVFA 4IDKA 4Z4HA 4DQPA 2ZE2B 1KCFA 2ZE2A 4ELVA 3QEPA 4DFKA 3TARA 1HYZA 4DL5A 2OPSB 3OYFA 3MEGB 3MEGA 4EYIB 4OKJA 3OYBA 3DRPB 3DRRA 3DRPA 3VQPA 3HK2A 3OYLA 3DYAA 4CGDA 5DQIA 4KV8A 3G0ZA 3DOKA 3GYNA 1CZ9A 5D3GA 4NLPA 1IKYA 4IKAA 4IQXA 3DLHA 3AVBA 4CIEA 4CHPA 4M42A 1U4BA 3DRSB 4DTJA 3DRSA 4MK8A 4DQQA 3LP0A 4FLWA 4B9SA 3AA4A 1IKVB 2XY5A 1IKVA 4NLSA 2GBZA 4NCBA 3I0SA 3H5YA 1RT6A 4DTRA 3MECA 2HWIA 2E6LA 1GOBA 1S10A 4DSFA 2ILYA 3KD5E 3K59A 3NAHA 3HP6A 1WNEA 3BQ0A 1BCMA 5K14B 5K14A 5KFZA 5L1KA 4ED0A 4HYKA 1LWFA 4R8UB 3OJUA 4R8UA 1Q8IA 3ISNC 4I9QA 3VA3A 1D8YA 2BQRA 5KG7A 1GX6A 3V6DB 5DMRA 3KLGB 3KLGA 2AQ4A 2C2RA 3B6OA 2AGPA 1XR6A 2FVSA 1I39A 2QXFA 3RRGA 4ZVGA 1LWCB 1HYVA 2FLPA 3QIOA 4EBEA 2HHTA 1RDAA 3DLKA 1RBUA 4WYWA 3OL9A 1FXXA 3NKYA 4RW4B 4QWEA 3MEEB 4N76A 4C8LA 2GC8A 4LD0A 2Q3SA 4Z4GA 3PR4A 4KAIA 1ZETA 3SZ2A 5I3UA 4M41A 2FVRA 4M3UA 4XPCA 3C95A 4GW6A 1ASVA 1N5YA 3SUQA 3GV8B 4KHRA 4ECVA 3LP2B 5HP1B 3CIZA 5HP1A 3RAQA 5JS1A 2Z1IA 5L1JA 4IH7A 2UVWA 2B6AA 2G8UA 5KFMA 3DMJB 4R5PB 5KG2A 3D45A 4DF4A 3DLEA 1IG9A 3IAYA 4DSKA 1RT4A 1IKXB 1IKXA 4Q44A 1FKOB 4QWBA 4IH6A 4F4WA 2HB5A 3NGIA 2YKNA 1EETB 1HJRA 5F9NA 4KHUA 5SWMA 3SI8A 4FJ8A 3U3YA 1NKEA 1KFDA 3K5MA 5KFCA 5KGWA 4FJGA 4O4GB 5F8HA 3C94A 1TKXB 1TKXA 3NF8A 3K5LA 3VQSA 4RW9B 1RT7B 3TANA 4NLGA 3DLGA 4K4TA 4F4YA 4FJHA 3AO2A 5DLGA 3PO5A 3L3VA 4ED7A 5F8IA 4CHYA 2W8LA 5T7BA 3EZUA 3MR5A 4NLTA 4K4WA 1XI1A 3VQDA 3EYZA 3RRHA 2D7SA 3H40A 3M8SA 3K5NA 3IGNA 1EP4B 1CZBA 3AO1A 4CIGA 2ASJA 4ZP6A 3BGRB 2ASDA 3L3UA 1G15A 3OHBA 4TN2A 3LP1B 1YVUA 5KT6A 2KZZA 1S48A 3FQLA 1UWBA 3KLVA 3RMDA 3N6LA 1RTJA 4CECA 4E3SA 4U7CA 2UVVA 3VQ8A 4RW6B 3CFRA 2WOMB 1C0TA 4RW6A 4Z4FA 2GUIA 2IJNA 1RA6A 1RTDB 3AVKA 2XY8A 3CVKA 1CLQA 1J53A 1TV6A 3MTKA 2OZMA 3I0RB 3I0RA 3DOLA 2YHBA 2P5OA 2FBTA 2BANB 2BANA 2R2SA 3HVAA 4FJXA 4QAGA 1SL1A 4B3OB 4B3OA 3IG1B 4HUGA 1R0AB 3KIOA 1R0AA 1F21A 4ZPAA 3CJ5A 2WB4A 2OPPB 3JYTB 3JYTA 4IBNA 3PW2A 2FBYA 2HVHA 4CESA 3HL8A 4FJIA 5KT5A 4K8XA 4IRCA 2KFNA 4Z0UA 4KI4A 3ALYA 4B9MA 3S9HA 2G8IA 5KGXA 2WK4A 3NE6A 4IG0A 1S1UB 3V1RA 1HARA 1EX4A 4B9NA 1KLMB 1XR7A 1KLMA 3KK2A 3PX6A 1VSMA 3VQCA 2E9RX 3RMBA 4ZTFA 4WYLA 1BQNB 1BQNA 3H08A 2C28A 4WXOA 5DG8A 4YR3A 4PA1A 3PV8A 4M3ZA 1SH2A 2RN2A 4RUCA 3OVNA 4QWDA 4KTQA 5HROB 2IM0A 4O3OA 1U48A 3OYHA 1VSJA 3TR8A 1JLFB 2ALZA 1WSGA 2Z1JA 3AVMA 3ITHB 3H4BA 4FLZA 3SFUA 1YTAA 4W5QA 3E51A 4OGEA 2RKIA 2Z1GA 1W25A 3SPYA 4B9VA 2B5JB 3QO9B 2WONB 3KLIA 1CSJA 3S3MA 3H5SA 5KFUA 5KT2A 4E7IA 3SQ2A 3GV5B 1JXLA 4NRTA 3DI6B 5KT3A 1S9GB 1KVAA 1VRUA 4LSNA 3CYMA 4I2QA 4DSJA 4IFYB 5EWEA 1S0OA 1BGXT 4W5NA 2R8GA 3ZSOA 2HNDA 1SL2A 2CJQA 3BSNA 4E7LA 2W7PA 3FFIA 2FVQA 4JS4A 2LSNA 1JIHA 3G10A 1SL0A 4MIBA 3OLAA 4E7JA 4E89A 1S49A 4FJLA 2YKMA 1S9FA 2F96A 3QETA 1KSPA 3ZT3A 4Z4IA 4TYBA 1D5AA 2XY7A 4IKFA 4KB0A 3GV7B 5KRSA 1U04A 2UUWA 3SV4A 1TL3B 1TL3A 1FK9B 2OPQB 3WNHA 1FK9A 3GIMA 4M45A 4FS1A 4N5SA 3NCIA 1S5JA 5J2PA 1N56A 3NDKA 4Q0BB 1YTUA 4Q0BA 1D0EA 4URSA 1J9AA 4J9NA 1S0NA 4YP3A 2ZD1B 5DG9A 1RBSA 2ZD1A 3OYEA 4WE1B 3OY9A 1HNVA 3NAEA 4F4KA 3TAPA 2HHVA 4F2SA 3VN5A 3AVLA 3RBEA 3E01B 4ICLA 1RYSA 3OSPA 2IGIA 5KTQA 4LQ9A 1RTHB 1RTHA 4E1MA 2VA2A 3VQEA 2PYLA 4KHMA 4DTNA 4DWIA 5HRNA 3QINA 3C6UA 2HHQA 4IFVB 3HP9A 4CJRA 2X6NA 4NYZA 4FS2A 4KPYA 4K4YA 3PX0A 2NUBA 3RR8A 4CEZA 3BQ1A 4FM0A 3L2WA 4GVMA 4NLDA 4J9OA 2EHGA 4HCBA 1BHLA 3TI0A 4KKOB 1LW0A 1HYSA 1T8EA 4MFBB 4MFBA 3UIQA 1JLGB 4O3SA 3QEXA 4MQ3A 2PY5A 3RB4A 3TAQA 1XHZA 2A1RA 1QE1B 2AX1A 1QE1A 2W7OA 3DLRA 1JLEB 3GILA 1JLEA 3PUFA 4TSXA 3KKSA 4NLVA 3O4QA 1RYRA 4JRPA 5HRSA 1RDCA 5C42B 5C42A 4F50A 4DFMA 4ECZA 4ED1A 3KK3B 1TGOA 1SKWA 4K4UA 4XPEA 5CZ2A 1FKPA 2HHXA 4TXSA 4CJFA 1KVCA 3D5MA 4YMEA 4AHVA 3OYGA 4WFZA 5KFSA 4TYAA 3AVIA 5F8MA 1SKRA 3IRXB 3UQSA 2R2RA 2WRMA 3ICLA 3PR5B 2VG6B 4CGFA 2VG6A 5KRTA 4N47A 2P1JA 4Y1DA 3TAFA 4IOBA 2I5JA 3NMAA 2B4JA 2IM3A 4DQIA 1S1XB 4F8RA 1S1XA 1S1TA 2Y1IA 4KO0B 1RDBA 4Q5VA 2XC9A 4CJSA 3HVTA 5KFEA 3KNAA 4OPKA 3QEIA 4CF1A 1RDRA 2DTUA 3T19A 3HPOA 4CFCA 3V4IA 1C2PA 1NKCA 5KT4A 4C8KA 4PQUA 4B8CA 3VQQA 3D0PA 3SQ1A 3O4NA 1NK4A 1TQLA 2FLNA 5KFGA 4CFBA 4LSLB 3EPGA 2FJWA 2OPSA 1QAIA 4QW9A 4DF8A 3F73A 5I42B 4URQU 5KFRA 2HHWA 1HPZB 3QZ7A 5KG3A 4DU4A 3KTQA 4IG3B 1C1BB 1SKSA 4OJRA 3ZT1A 1X9WA 4U6PA 2IDOA 4B9TA 4I9LA 4YQWA 1NKBA 2HMIB 2HMIA 4CF2A 3RTVA 1ZBHA 1L3TA 5C24B 1GX5A 1RAJA 1J5OB 4CJQA 1SUQB 3VQ5A 3SCXA 1SUQA 2JEFA 2V4QA 3CM6A 1S6PB 5KG5A 1S6PA 4B08A 4NRUA 1J54A 5CYQB 3QYYA 4KHQA 1NK5A 3KKRA 4DSIA 4O0IA 3O3GA 4RW8B 3HJFA 3BR9A 4OL8A 4IR9A 3PW7A 5DG7A 4FLVA 4EP4A 4O5BA 4CJ4A 1QAJA 3HYFA 3BSAA 1QS4A 1U49A 4M3YA 5SZTA 4EO6A 4EEYA 3V6DA 2XWYA 2R2UA 1JLAB 4HUEA 3KLEB 4C8OA 3LZIA 3OYIA 3K58A 1LWCA 4WZMA 4W5TA 4RW4A 3CJ2A 4EYHB 3QGGA 3MEEA 2DFFA 4CJKA 2PYJA 2BE2B 4IH5A 3OYKA 2BE2A 4JV2A 4GC6A 1C1AA 4KHWA 1L5UA 4I7FB 3V1OA 4I7FA 4ZVHA 1RA7A 3HO1A 1CXQA 4J9PA 1VSHA 3VQ4A 4CEAA 4W5OA 3LP2A 1BI4B 3DMJA 4R5PA 3CJ0A 3PW5A 3RMCA 2WHOA 3D28A 3OYJA 4ZMMA 1BCOA 1ZTWA 1VSDA 4K4SA 4NLQA 1K6YA 5HRRA 1FKOA 4HUFA 4QWAA 4KHYA 1WAJA 4Q45A 1JLCB 3OYAA 1EETA 5KFQA 4CJ5A 4DTPA 4J9QA 4CF9A 1TAQA 4QW8A 1REVB 2IM1A 3PVXA 4FVMA 4J2DA 2C2DA 3L8BA 3SJJA 1NHVA 3V9UA 4O0JA 3LZJA 5F8LA 3FRZA 1U09A 1SV5B 2VWKA 4KB7A 1NHUA 3OL6A 4O4GA 4DU3A 4RW9A 1RT7A 5T14A 3C6TB 1DLOB 1S6QB 3C6TA 4ECXA 4OVLA 4CGJA 4CJVA 4YNQA 3MXIA 3SI6A 4TY8B 1LW2B 1Q9XA 4TY8A 1RT2B 2D0BA 1RT2A 1HMVB 1HMVA 2XCPA 4FCYA 2XGPA 2OZSA 3T5JA 1EP4A 2XHBA 3OSNA 4ZPBA 3NGYA 3V9XA 1KFSA 3BGRA 3V81B 4FLXA 3V81A 3MAQA 3LP1A 4FBUA 2FVPA 5FRMA 3HHKA 4WFYA 2W42A 3SNNA 1S1VB 2AJQA 1S1VA 5KFJA 3DDKA 4F4ZA 3MFIA 3QERA 3MR2A 1JL1A 1RILA 2BQ3A 2WOMA 3V6HA 4RNNA 1MMLA 2FBXA 1RTDA 4F3OA 4H4MB 3ZSYA 3F9KA 4FM2A 4FZYA 2EC0A 3HXMA 3IG1A 4GMJB 3OYCA 2FLLA 5KFXA 2OPPA 2G8FA 1S4FA 4DL7A 3AO5A 1LAWA 5DGAA 2KZMA 4FJJA 3TAMB 3TAMA 4PY5A 1JXBA 1S1UA 4RU9A 1LAVA 3L2UA 2RF2B 1B9FA 5DGBA 4FK2A 5DK5A 4JRQA 1HNIB 3NH0A 1HNIA 3QEWA 4G1QB 4H4OB 2HHSA 5EWGA 1RTIB 5J1EB 1ZBLA 5J1EA 5CY4A 3OS0A 3HT3A 3GQCA 4J9KA 2X74A 5KFPA 3T3FA 3OLBA 3M8PB 1B9DA 3ULDA 3MF5A 4FZXC 5HROA 2IOCA 1K1QA 1JLFA 5KFVA 4ED6A 2HNZB 3ITHA 4AILC 3EY1A 3A2FA 4ZTJA 2E6MA 2R8HA 4ZPCA 4C8NA 2JC0A 4O4RA 4JV1A 4FLYA 2B5JA 3QO9A 4KFBB 2WONA 4KFBA 3Q8RB 1NNDA 3LPTA 4RW7B 2V0NA 4KRFA 4H54A 1NJXA 3DI6A 3PW4A 4CJTA 4J9SA 2JLEA 1S9GA 5J2MB 1U47A 4NLOA 1C0UB 2DPJA 3LAKA 4IFYA 1NK6A 2CKWA 2D5RA 2V9WA 4LY7A 1C1CB 1YVFA 4Y34A 4E1NA 5KFDA 3BJYA 2HHUA 4KI6A 3MEDB 3JSMB 3U6FA 3JSMA 3AVFA 2C2EA 2FJVA 4GC7A 1VK0A 3K2PA 2W9BB 4O55A 1SH0A 4DL6A
chains in the Genus database with same CATH superfamily
2ATQA 3VF0B 3M2UB 4DV3K 2NZCA 1NBWA 2V67A 3BN4A 1JLBB 3A5OC 1MWZA 3LO3A 3ZYYX 2RT3A 4FJ9A 5D8HB 5LT5A 5LL6Z 2C3UA 2AD9A 1EQMA 4NYFA 3WNFA 5FPDA 3D0IE 1BUXA 3R6LB 5AJ3K 3L7UA 3CUNA 2ZITA 2F8SA 4ANEA 2EX3A 4ECTA 5BPMA 5CABA 4OYXA 4PG8A 4A61A 3CCLS 3TSPA 3F0NA 1QAYA 4URGA 3MN9A 4EGLA 4WFNL 2A1SA 4RX6A 3DC2A 1UJ5A 2EWSA 2WBMA 4HACB 3LA0A 6FDRA 1TL1A 3ILOA 3C2PA 2ACMA 5D4LA 3FBEA 1Q7YO 4IFVA 2LA4A 2GA7A 3VERA 1P1LA 2L41A 3MPDA 3CG7A 2GAGC 4BDZA 1ZBIA 1MU2A 2ITGA 1WORA 3CT9A 4H0YB 1IXKA 2XG8A 4E98A 2HNYB 2DEIA 2MB0B 4OX9J 2AHOB 1IR1A 1J27A 1BOTO 3H7HB 3JQJA 3GYGA 3V9ZA 3VEVA 2QT7A 4IUFA 3HVWA 3LAMA 1Y3KA 1FD8A 2GHVC 2RS8A 4BRHA 4YOXA 4QIFA 1F5BA 1Y10A 2C42A 4M5DA 2AGQA 1WSIA 4KE5A 3KK3A 1DTTB 4RNHA 4YEAA 1IJEB 2G8KA 1LWEB 1TZ0A 4DR7J 3NVKA 3H0PA 3W0LA 2CG4A 3O1LA 2M4MA 2RDDA 3J7ZO 3R2DJ 2H9ZA 4CF8A 1KXPA 2IC3B 5C2CA 1U8WA 2PFDA 4QR1A 3GIRA 4DU8A 3IRXA 1LV5A 2XS5A 4I6WA 2P9PB 2Z0GA 5GINA 2D3UA 3TUJC 2HVIA 1NK0A 1TKTA 2QEXS 4MK7A 1T7PA 4B9QA 4KO0A 5EGYA 4DR7F 4JV0A 5D4PA 4NLWA 1X4GA 4XO0A 5DJBA 3CDWA 4QZVB 1K8KA 3LQVA 1FNXH 3D4JA 2Z30B 4PUOB 1UJ6A 1S72N 3SMSA 3NGUA 5KFTA 2FJBB 3VAFA 4BR0A 1IBLK 4CLPA 5A0YB 2KRBA 1U1RA 4HTLA 3CCQN 3L6QA 2QLBB 4IOCL 2CPDA 2GGPB 1DRZA 3OS1A 1VRTB 4LSLA 2ASLA 4C0OC 3B82A 3L4IA 1RAHB 3N79A 5ETPA 3CD6N 5I42A 3MXHP 4Z94A 4MK9A 2IBKA 1WC3A 4AD6A 4AHCA 1DZ5A 1RJJA 4I69A 5DM7Q 3CDBA 4HCCA 4CLFA 3O4WA 4YDDB 1TR0A 5DRKA 4USMA 1WG1A 5FLXO 3CJKB 3SBMA 3HI0A 2P51A 5KI6A 2JEGA 2F65A 4KV8B 3W2WB 4F3MA 3T9NA 1UCNA 3AA8A 2FGOA 1OQ3A 1IKYB 2Z57B 3AA9A 3OL7A 4DMNA 3N6NA 1W2BR 5CYQA 4IDHA 3IM9A 1FJGJ 2W8KA 4CE9A 2E1PA 3O8MA 1ZOTA 4WFXA 1VQNS 2Y1RI 1WKKA 4MKAA 2D3OR 1RHJB 3R5CA 3VWSA 4BRMA 1RT6B 2ZH5A 4WWSA 3EKSA 4H5RA 1O1WA 1EARA 2ZJPL 2OEKA 4M63A 5AQZA 3G6XA 2DR8A 5L1LA 3MPVA 1X4BA 4ZHRA 3QFUA 4WXWA 1NPRA 3RR7A 3VQBA 4CZMA 3LDSA 5EU7A 2IYIA 2NXCA 1X4DA 3PIOQ 3GFHA 4KB1A 2XULA 4DCPB 5K8PA 3CJRA 3OR1B 2BZ2A 1ZBTA 4Q43A 5M1FA 1MLAA 5GAHI 3BH7B 2Z2ZA 3DXMB 2AIRB 3OV7A 1M90T 1VSFA 3GCXP 2B7BB 2BTFA 3AB2B 1ZBFA 4A5BA 3LANA 1KQKA 4WFBL 4OHYA 2IVYA 3ZETB 1KHWA 3AA3A 4AQYJ 3C65A 3EGZA 1WHXA 1HNZJ 2OA8A 4LR7A 3BEXA 1DKGD 1WEYA 4X84A 4A2AA 4YR0A 1X9MA 4L76A 2DNGA 2B9XA 4ECSA 2O66A 3CCRN 2HHHF 1VSIA 2XYHB 2G8HA 3B8AX 2Z8QA 2ZBIA 4KREA 2RPIA 5GVQA 1YX2A 3Q2TC 3HFKA 1KQFB 3S01A 3UPFA 1KOHA 2W41A 4I6YA 1Q1KA 4FLTA 1W7AA 5HRPA 2VCPA 4RPFA 5KG4A 3M05A 1BA0A 1HI1A 2QO3A 1SAZA 1HNZF 3C7NA 3SAGA 3HFVA 2DGQA 4DQSA 4WQ4C 3H3NO 1NM1A 3GTYX 1RNHA 1VC0A 3VETA 1IR0A 1IO2A 4DLEA 4L73A 2J8AA 1WSEA 1WDTA 2RSQA 1OQ6A 3AD7C 3IWXA 4KPCA 4FWMA 1TAUA 1YRUA 4EZ6A 3CJQA 2KFYA 4BS2A 1L3VA 3NBPB 3E66A 4A8FA 2AWZA 2KTQA 3OS2A 4I64A 2CNOB 3FJ2A 2VUGA 1F0XA 4DR7K 4AUKA 3HLUA 1VHIA 1VQYA 4NCGB 3KUEA 3NH2A 3DM2B 3EO3A 1JLQB 3CJ4A 3MCOA 3MGJA 2CQBA 2IBOA 1KVBA 1Q79A 4QIVA 3I33A 1KQSM 1XEZA 3MMCA 1OH6A 2CQIA 1CXUA 3U8XA 5F3ZA 1RAIB 5LSRA 4FXDA 2VPYB 1NOYA 3D1OA 3H4DA 1VBZA 3TTFA 4FPBA 3CCJS 4OPJA 4KGMA 5IM0A 1OPZA 4I0WA 3U1NA 3T1YF 2AX0A 5E33A 2E1RA 2FGCA 3KK1A 4RUAA 1YIJN 2CQ3A 3HSTB 5AXLA 3SCIE 3O5BA 1RTIA 1JK9B 3AO3A 2RDJA 2Q97A 2P5GA 1VLOA 2BQUA 1QD1A 2VG5A 3MAHA 2KW4A 1FDAA 2W9CB 5DDPC 2H54B 2HNZA 1ROFA 2DD8S 5K8MA 4Z7CA 2H4YB 1G3OA 4WP8A 2YNIA 3FMWA 2K2PA 4X4UA 3A8JA 3WQUA 2X78A 5KFBA 4RW7A 2ZBPA 4DL3A 4QS8A 4ANCA 3ENVA 2JZ5A 1YJNN 3PNIA 1ZPVA 4XIUA 4ECUA 1H1VA 5EX5A 3ZSVA 5ETTA 2RMLA 4M3TA 2XY6A 1D9DA 2OSRA 2QFJA 5EY4A 3ILJA 4CNZA 1HHQA 5B0DA 1RZMA 3RB3A 1RHUB 1MN9A 4AYBD 4O3RA 1VGYA 4I2QB 3S6EA 2GIRA 1VIOA 4BDYA 1D1UA 3IWNC 4M5JA 4DJBA 2V4JA 2IA6A 1R27B 4MH8A 4NMXA 3FFIB 3HULA 4DR6F 2ZKTA 2ZJQQ 5HO4A 2IVMA 2LDYA 2VG7B 2Q43A 4QS9A 5AQXA 5AE1A 2UV8A 1JL2A 2GIQA 5C25B 3G6VA 1AFJA 4GVBA 3UVJB 3NGZA 2ZQBA 3TAEA 4B9LA 3T1AA 2P9KA 5K20B 4DU1A 3FZBA 3N28A 2HHHK 4NWBA 4QYRA 3TSUA 4BVPA 2XWXA 5HMXA 3THWB 1IBMJ 4F2RA 2XS2A 2F8EX 3VOVA 5D0RA 2P9LA 1S1WA 2MMYA 4ICLB 3ZXWA 3SSSA 1FWPA 3IBFB 1X4FA 2XGQA 1HNZK 1M1KO 1F9EB 1C0MA 1UKUA 4KH5A 1RXOB 2YNHA 3C3LA 3ENOA 4BC9A 1HUXA 4CJUA 4IFEA 1WEXA 2LVWA 4QU6A 3FQKA 2GO8A 1M0SA 4A47A 3QGIA 4G6VB 1ZXOA 1F3VA 4OYZA 3KHLA 1HRHA 4X65F 1S3XA 4BE0A 4U7UK 3TZXA 4RKUC 1FTCA 3TAGA 2L3MA 2E9ZA 1EX8A 4OYOA 1Z25A 4NLBA 3SUNA 2J7UA 2IJFA 2HQ3A 3K57A 2R7XA 2J6UA 5HL7L 3UD5A 4P52A 3S1TA 4DEZA 2F5GA 2N4CA 4X4SA 2A0FB 2ZH7A 3U9DA 4DUTA 1Z05A 4NLXA 2NLXA 3M2VA 4BRNA 3CFPA 3DXKB 3CCUS 1RAGB 3KMSA 3GJSB 4Z4CA 1KTQA 2Z58B 4PEOA 4AHTA 3RAXA 3TEHB 4MIAA 3JS6A 4WP9A 4NCAA 4DR4J 2CG8A 4HDHA 2OAUA 2CPJA 4JI1J 3RWUA 1U6ZA 2BUNA 3L9ZA 3HMJG 1KHVA 2F9WA 3EVWA 4QIGA 3VQAA 3QLHA 3T1YK 1W0HA 4F0HA 1S1TB 1YWXA 3QAEA 3V6KA 1RGIA 4C8YA 4CZHA 3ISND 2K1RA 3W1YC 3FC9A 4TQRA 2QA4G 1SQKA 4USHA 4J9UE 3THVA 4JI3J 1ZPWX 4O3NA 1AB8A 4A2BA 4MO5A 3T9ZA 3AARA 2YQ0A 2DCUB 3I5CA 1CJTA 4E7HA 3QJPA 1ZYQA 3SAFA 4IDKA 3MI7X 4DQPA 2ZE2B 2WVFA 2ZH6A 3FSYA 4DUZK 1W7WA 4LF8F 3QT5A 4DL5A 1OWXA 2JDJA 1QQMA 2LKZA 3HK2A 5DQIA 1VMBA 2QMUB 4HL9A 3G0ZA 4JI3F 3GYNA 4Y2IA 1VQ8S 4IQXA 3R8YA 4CHPA 3D68A 1BD6A 2R7QA 3H1QA 4DQQA 3PDNA 3D2FB 4U7BA 1IKVB 2YHXA 1HL6A 3AAWB 2RRAA 4DSFA 4PXDA 2ILYA 3K59A 3NAHA 4DV6F 4DR6K 3BQ0A 1D3WA 2DIUA 1F9HA 1BCMA 5K14B 4K2JA 4P2SA 2EFGA 4NA2A 3R5GA 1LWFA 1AA1B 3ISNC 2B0GA 4K7QA 1U1PA 2FJAB 4B3RK 1EAYC 3V6DB 5DMRA 3CCEN 2AQ4A 3B6OA 2AGPA 1HBNB 2CQ0A 4FWPA 2G2ZA 2JRSA 2VV5A 4UOCA 1XNQJ 1RBOB 3PYGA 5AT1B 1Q95G 2NYHA 2FVSA 1I39A 4ZIWA 4LF2A 2E88A 2FLPA 1RBUA 2KB2A 1FXXA 1FDBA 2VU5A 2GTDA 3OBWA 3AGRA 1X5PA 1X31C 2DKOB 3O44A 1HR0J 3C95A 4CLSA 1XNQF 3SUQA 3P5BP 4N7TA 5HP1B 4X64F 3CIZA 3RAQA 3M2RA 5L1JA 4IH7A 2B6AA 5KG2A 1IG9A 3IAYA 1ZBSA 4I4BA 2VFSA 1IKXB 2B51A 4FF3A 2BW2A 2F9DA 4Q44A 4IEEA 4QWBA 4X65K 1VQ7N 4IH6A 4CTAB 3VF2A 1M5VC 3R5DA 2FHJA 4EFAC 4IOXA 1EETB 2AW0A 3FNNA 1NJIO 3PRDA 2ZC3A 3AAQA 5SWMA 4FJ8A 1Q86T 4X62J 4ZPVR 5DM6Q 2FD2A 2EFQA 3J81Y 2HF3A 1SIZA 4AE5A 2P9NA 4TVAB 4CO4A 1TKXA 2JFDA 3K5LA 1H6KX 1RT7B 1TUYA 3DLGA 4USJC 1WG5A 1NMNA 4FJHA 3L3VA 4CHYA 1N52B 2DIVA 3MR5A 3D2EA 4ZKAA 2QWNA 2D7SA 5JJBA 4PAAA 3U27A 3I4HX 2D9OA 1QLNA 4X62F 1CZBA 1A9NB 3N5BA 1B64A 1OY9A 4AF1A 4OI1A 1SQEA 2ASDA 2OGUA 3A8YA 1Q8BA 3Q83A 1WG4A 1JJ2R 3OFHA 2QEXN 4JHDB 4DR3J 3KLVA 2E29A 2E2OA 1UVIA 1OSDA 3WHIA 4I67A 4DU7A 4CECA 2UVVA 2UU9F 3TR5A 3CF5Q 3VQ8A 4Z4FA 2GUIA 2QLFB 5M2UA 4WF9L 1RADB 3A4TA 1M1HA 3NEKA 1TV6A 2OZMA 2RUGA 3I0RA 3HKZD 3DOLA 4CO3A 2H65B 2BANB 3AJDA 4LRCA 3CJCA 2HFZA 4QAGA 1X3NA 3IG1B 3KIOA 1F21A 4PCQA 2V52B 4IJNA 4ZPAA 2XSJB 3SCKE 2F8HA 2OPPB 4EMDA 3JYTA 4RBVA 3D9BA 1JCFA 2CFXA 3EUNA 5L8RC 3HL8A 4CESA 4FF4A 5KT5A 1YVNA 4LF8K 3BPDA 1KKHA 1TL4A 2CNNB 4IG0A 4K43A 3KWMA 4KGZB 3QSIA 3IUCA 3FMBA 4M5HA 2DNPA 3VQCA 3VQTA 2ROGA 2MSSA 3HHDA 6AT1B 1ZM9A 1UVMA 3LOUA 2UUCF 2P9SA 2DHXA 1VQ4N 4QWDA 1U48A 4PPDA 2GO9A 3THPA 5HSPA 1ZA1B 3AVMA 3SFUA 3OXLA 5BXIA 4MJKA 1SC6A 1YQHA 3HHLD 4DV6K 3LGNA 1MROB 4RWTA 3KLIA 3MX2A 1VR6A 1NU0A 2Y0BB 3SQ2A 4M5IA 4H5WA 1QQNA 2ABYA 3I4PA 1S9GB 4I6MA 3CMES 1CLFA 4Y0WA 1Z2ZA 3QGPA 4ITSA 3CGIA 2WW8A 4I1TA 3OVBA 2HNDA 1FDDA 1MNEA 1GLBG 1SL2A 1FESA 1P1TA 4LR9A 5BRFA 4DX8H 4E7LA 3IC1A 3THYA 2FVQA 4JS4A 4OYBA 2LP4A 2EC2A 3G10A 2E66A 4E7JA 2GNKA 3W60A 1NPPA 1NGCA 3GG0A 2F96A 3ZT3A 4OJGA 1D5AA 4F7VA 3AJ1A 1RHMB 2MLZA 1GH8A 1XNQK 1VC5A 1FK9B 3WNHA 4X64K 3OXFA 2XEXA 4N5SA 3MCAB 3NDKA 5J2PA 1P8ZA 3JQMA 3VV2B 1VBXA 4OQJA 3CC4S 3OYEA 3GONA 4NYPA 2VDHA 5AFUA 2OEJA 1K47A 2M70A 1RYSA 1DFDA 3OSPA 3WT0A 2VDIA 4M5NA 2J9DE 4LQ9A 2GHPA 1RTHB 3K0JA 2VYPA 2DR6A 5HJXA 2QIFA 2PYLA 3NG8A 3CTRA 4DWIA 2IDLA 4IFVB 3HP9A 2EKNA 3TUZC 4CJRA 2LECA 5AXMA 1NPKA 3PX0A 4FP9A 3BV8A 1RDWX 3CNQP 3L2WA 4NLDA 2EHGA 4KH6A 4W98A 1HYSA 1T8EA 4MFBA 4V19X 3TAQA 3WIVA 1XHZA 3VVUA 1N0UA 3T69A 4IOAQ 1JLEA 4TSXA 1RYRA 4LFAF 3BKFA 2PIIA 4M5DB 1JQGA 4F50A 1Q7YT 4QU7A 3KK3B 2PSZA 1SKWA 3NGSA 4K4UA 1GMUA 3WXKA 4C98A 4OJHA 1D09B 1KVCA 3D5MA 2NRWA 2CAJA 5C2FA 1SB6A 3GR1A 4AHVA 1RU2A 2UU9K 1LQ9A 5GAGI 1BE4A 4HTIA 2G0CA 2H3EB 2GVDA 1BWFO 3MM6B 3IRXB 1BWEA 2R2RA 2WRMA 1RAAB 4PPZA 1S0VA 5KRTA 2A2CA 1YSJA 4USKA 2I5JA 2B4JA 2IM3A 4KO0B 1V4SA 2XC9A 3QEIA 5AZIA 3ENAA 4CF1A 3J80Y 3U1MA 2DGTA 3BF4A 1K8KB 2V34A 1NDKA 3CCJN 3J7ZT 1UJ4A 1Y5LB 2FZCB 2RD5C 4CM2A 5KT4A 4PQUA 3MWTA 3KUHA 2UUCK 1T9XA 3VQQA 2JSXA 3O4NA 1VQLS 2CUYA 2YI1A 2FZKB 4LSLB 3EPGA 4JOUA 2BJ9A 5I42B 1AW0A 5KFRA 5M1NA 5RUBA 1SCJB 4PKDB 2ZWPA 3HD2A 1BHNA 1R8AA 4CH0S 4U6PA 2IDOA 3UNYA 4YQWA 1NKBA 3O9QA 5GIPA 2KXHA 3VR1A 3TA2A 2VOOA 1GX5A 2ASMA 3N9UC 2IHR1 1V5IB 1Y5IB 3I55S 2V4QA 2GQCA 1N32J 5CYQB 3M1FA 2QSWA 2LQJA 1RWVB 4O0IA 2ZJRQ 3T7ZA 3FZLA 2RUSA 1KR4A 3RG6A 3PIOL 4B02A 3CSKA 2PA3A 4O5BA 1VQ5S 1OJ4A 2KJVA 1QAJA 4YB1P 2MYFA 3BO2A 1QS4A 3MAAA 1U49A 5SZTA 2FHOB 2OFHX 2R2UA 3T41A 1CC8A 5E84A 1JNZB 2HVDA 4P72A 2QWPA 1N32F 3WDOA 3IKMA 4BRQA 4WZMA 3Q7CA 3HHNB 4USTA 3QBCA 3CJ2A 4YOWA 2CH5A 4CNYA 3MEEA 4PWWA 1W97L 3MN6A 2BE2A 3CIPA 5T41A 3QWUA 1GXUA 1L5UA 1T11A 3Q86A 3CC7N 5D0HA 2JVRA 1X7VA 3EL2A 2F63A 2NZTA 4CEAA 3B54A 5IV4A 3DMJA 4R5PA 3CETA 3IA0A 3CHWA 1H0HB 1VSDA 3GP9A 4K4SA 1QHAA 1K6YA 1W26A 3J81U 5LM7E 4Q45A 4IXCA 1TAQA 2NREA 2IM1A 2E2NA 1NRKA 5L46A 4O0JA 3LZJA 3V9UA 2DO0A 4Q7AA 4CZCA 2R7TA 4LFAK 3OL6A 4H0XB 3IFEA 4DU3A 2G13A 2Z4PA 4KHPJ 3QQCD 4LF4J 1X4AA 1NG9A 4OYAA 3PHTA 3TEGA 1NO8A 5CE3A 4ECXA 4OVLA 3Q2SC 5M2RA 3ZZTA 4HEA9 3MXIA 2HZVA 4TY8A 2A6AA 3TPQA 1XQSC 3W61A 4QOTA 1YJTA 2J7WA 3CULA 1MW7A 1V4TA 2P8IA 4CBWA 1KFSA 3BGRA 4QBUA 3P5TL 3MM8A 4FYXB 5L9NA 3LP1A 3NY0A 4FBUA 1U24A 5FRMA 5HN0A 4KHPF 4WFYA 4LF4F 4C4WA 3ETMA 1VDHA 1V9OA 2VJVA 2E7VA 2RQCA 2G9OA 3DDKA 2DR9A 3FGVA 2HRYA 2AF6A 4IQMA 4F4ZA 3X1LB 4LIRA 2DK2A 4B1YB 1U25A 3MR2A 1LNQA 2CNLB 1RILA 1RWOB 2A10A 4F3OA 2VWBA 1WOOA 3H2UB 4Y00A 3HXMA 1NSQA 1OPIA 3MMCB 6FD1A 2OIHA 5KFXA 2KRRA 3LGHA 3B4MA 4OO1J 5MLCV 3AO5A 1LAWA 1BUPA 1T9TA 4JI2J 3VF4A 4NB4A 2MZ1A 4ILGB 1HI0P 3GE1A 1UEKA 1HBOB 4U67Q 5B09A 4B17A 1RBLA 4KJIA 1JXBA 2QJ3A 5AQTA 1S1UA 3AFGA 1CJVA 1WKJA 1Q53A 2QLXA 2BEFA 2DVIA 1QVGR 3LDPA 3G96A 5EOYA 5FPMA 1RTIB 2OLWA 4K5RA 4J9KA 5KFPA 1I51B 2H5EA 1VQ8N 3OLBA 1A0OB 5JMVA 4FZXC 5JICA 3UDCA 2LLZA 3RW6A 1JLFA 2FC9A 4ED6A 2HNZB 4DPUA 3JB9k 3ITHA 4AILC 1S12A 4MYUA 1NCLA 2R8HA 2EEYA 2POKA 2HZAA 3HT0A 1ZZNA 2JC0A 4FLYA 4KFBB 3BDEA 1WSRA 1NNDA 2RQKA 1HBUB 4RW7B 4KRFA 1YI2S 1HD0A 4J9SA 2MHEA 4U7UD 2CGKA 3VALA 2CKWA 2RNEA 3AH6A 1N32K 1Q8KA 4G1IA 5KFDA 4ZA1A 1NU4A 1GEHA 4BR4A 3A8IA 2VJUA 2Y0SD 3U6FA 3JSMA 2C2EA 3GFYA 4O55A 4OJ3A 3S41A 3ZTSA 4DR2F 4J9VA 3L3CA 2V8DA 3N5FA 3M2UA 2HHPA 2E1YA 2L9DA 3C16B 1NNEA 3ENQA 5HBMB 3B4DA 3WNEA 2YNGB 4DV7J 1SJ4P 1WJ9A 3VEWA 5GADI 2F1FA 3AA2A 2ZM6J 2V4RA 3AGKA 2DNKA 2MQQA 4GVBB 4FJKA 1TL7A 5KFAA 2MDAA 3AODA 1JMTA 5CYJA 3E01A 3CO9A 3W8PA 4K42A 1RWXB 3D6FB 3DKDA 3VEOA 5M1KA 4HACA 5F8JA 2GAHC 3JXOA 4QR2A 3NXZA 3M8RA 4ILMA 1S1WB 3TA1A 1SC4B 1ZBUA 4BR7A 4LBPA 4CGHA 4DR5J 2OH2A 5A76A 1ZAVA 5ETMA 1AZSA 1NK9A 5AQQA 1H2VZ 1VQKS 4WFNQ 5AQVA 5LMUF 2ZBQA 5BPLA 1BC6A 4KKOA 4RZRA 2ZUAA 1FE0A 4FM1A 1JLGA 3TP2A 3PSFA 1UVKA 2C22A 1T3NA 4HHJA 3VZHA 2HGNA 2Q1NA 4B1XB 2HFOA 4RUHA 2G8VA 2UVRA 3H20A 3LH2S 3QT7A 3U9ZA 3H8YA 2V2KA 3TYTA 3A12A 4G9ZA 1WNSA 1TMMA 2VH7A 4IYQA 4KHPK 2IRUA 4LF4K 1N4LA 2HYIB 3FE1A 3UR0A 1DTTA 2DNNA 1Y97A 1IM4A 4U96A 2J0WA 3QNOA 1YBTA 4WZQA 1M1KT 2D0OA 1U45A 1DEJA 1QVFR 2IC3A 4CLLA 1BISA 1L3SA 4NLYA 1NDCA 1QM9A 2W4PA 3QEVA 4K59A 2W4CA 4J9LA 4JKFA 1FXLA 1P9YA 3J80U 5FLXY 4YY3J 3LWLA 3WUHA 5EUHA 1EQYA 4FLUA 3LWMA 3PSIA 3CJ3A 3M6UA 2M7SA 2PFFB 4H0VB 5DQHA 2PI4A 3WIUA 1E6YB 2R7UA 3ZNJ1 5L39A 3QDKA 3NVMA 4ZPWR 4UZCA 3VGKA 2F7TA 1N34J 3WX8A 1B7FA 3P4IA 1QQCA 3A0IX 4QYZJ 3QLHB 4PUOA 2HWHA 4LF7J 4A8YA 4WBFA 2VQFJ 3M6VA 5A0YA 2VD3A 4NLUA 2QWRA 4YY3F 5LSLA 3M5RA 2K1RB 3J8AA 2GGPA 4ECWA 4X4RA 2EG1A 2BYCA 1HQEB 3JTNA 1VQPN 2D4WA 1CJUB 1GMWD 4ZPDA 4DL4A 1UMJA 1X8DA 1W9HA 4OV1A 1CJTB 2CJKA 1DQ9A 4CEQA 5KFLA 4IDKB 4YHHJ 4WQ5A 4FW1A 1DHMA 5GMEA 4IOCQ 5E3RA 5ETKA 3P5JA 3EGWB 4L3QA 4DS4A 3W7BA 1XNRJ 2NRHA 4A8QA 2DNMA 1V3SA 4NASA 2FC0A 3N6MA 2MLYA 3W2WA 3ZNUA 1J5OA 1GMVA 1BDGA 3CDEA 7FD1A 3M9OB 4FJMA 4IRKA 4JUZA 2WVCA 5CD4A 2ASYA 4MDAA 3ZZ0A 2O8EA 4KTZA 1WLJA 4J37A 3CMEN 2B4UA 1YJWS 4DR2K 3J7Z5 3ELHA 4EZ9A 2W2PP 5DO2A 2M8HA 1U1QA 1XNRF 3NGRA 2J9EA 2Q6CA 1FRXA 1P9QC 3G8QA 2XO7A 1DURA 1LWFB 4U9RA 4DS5A 4PXCA 3NF9A 3OUYB 1RBVA 3D0GE 2GMLA 2DGWA 4AHSA 2DY4A 4CJLA 2NCKL 4Y3CA 2VKZG 4QPTA 4JKEA 2ZJPQ 3AVNA 1H2UX 1UZDA 5J2NB 2BRKA 4GO5X 1JCEA 1FD2A 4GMKA 2Z1HA 2NXNA 4K0KJ 1QVFM 1F9FA 1PC4A 2HEKA 1BI4A 2C1EB 1D9AA 1FEEA 5KFIA 4FNIA 5J1PA 2U1AA 2XSFA 5H9FK 4JI5J 2OMLA 3GSIA 4PXBA 4A46A 2IPOB 4DFJA 5LMUK 2LA6A 1MMNA 1RT5B 4OKKA 3CMAS 3OA9A 3G86A 3HSGA 2B6AB 2BJ3A 3MMJA 1OIAA 4Y2AA 1REVA 2KH9A 2R7OA 4IEIA 1ZTTA 1FRKA 4CRJA 2NSCA 3ZFVA 4WFBQ 2UUAJ 4NLRA 4WJBA 3SYZA 1SC3B 1WC4A 2CPEA 4PYDA 4JI5F 3TWHA 4L74A 5FIIA 2ZH1A 1C0FA 2DGSA 2O4IA 4JKDA 1DLOA 2XLIA 3BBFA 1S7HA 3HPGA 3EGNA 1LCUA 3HJVA 1LW2A 4BG8A 4A5AA 4USIA 2QL7B 2O8CB 3DLGB 2ASPA 2HK3A 4DV0F 3UB5A 3HOTA 2OO4A 2H51B 1HNWK 2D1CA 1VSKA 1BQMB 2UXBJ 2NUHA 4B1VA 3NBPA 3NP5A 3GU0A 1NJIT 4Q2LA 4RNFA 2Y1LB 3PEJA 5KFFA 2J6TA 3FFKB 3TABA 2CDRB 2R8IA 4NCGA 3KJVB 2O8BA 4CLKA 3K2YA 3DM2A 2PZSA 1JLQA 1U26A 3Q23A 5KT7A 3AVGA 3C15B 5AE3A 3SXLA 4CP5A 2DRBA 4YY3K 3B6BA 5M1PA 4OLOA 1WWHA 2ILZA 1TV6B 3DOLB 1IKWB 3ZSWA 3KMQA 4BRFA 4K4VA 3VEXA 1UW4A 4J9RA 4CFAA 2KM8B 5F3TA 3TJAA 1ZC6A 5HANA 2FJEB 4HH0A 4M5KA 1VQLN 1KVKA 1RWPB 1RACB 2EBGA 5LSOA 1NJZA 2GWKA 3VGMA 4LF5J 3V6JA 2F8TA 4ES1A 4KHNA 2FIUA 2E2PA 3RYLA 2FF3B 4G1QA 4I68A 5ADZA 2EBEA 2BR0A 4IG0B 4HHUA 1KRPA 2XNQA 1P90A 2GHWA 4WKYA 4P75A 1J5EJ 3M8PA 2VC1A 3QSYB 3H98A 1XMQJ 4ETXA 1PJ6A 3QZ8A 2W9CA 3S3NA 1QUPA 2P9SB 4OGCA 3DWLA 3K8VA 1FA0A 3Q8UA 1DAXA 3I55N 4CFDA 1RT3B 3IAM9 1JXEA 1Q81T 2ZBCA 1XNRK 5HOOA 3W65A 2OTJS 3GL1A 1J5EF 1C0UA 1NJYA 4OYIA 3S8SA 1FRIA 1XMQF 3KLIB 3MCSA 1WEZA 2YWWA 2R7RA 3TRGA 1C1CA 2HSTA 2W25A 2QGFB 4F3QA 2A3ZA 4DV5F 1VQ5N 3QBWA 5ETOA 2KT3A 3D1QA 4EBCA 2VA3A 1NDPA 3MEDA 5EWFA 2XM3A 4I6MB 2R4FA 3ATVA 3NF7A 2UVUA 2HGMA 3TTCA 1RISA 1T02A 4FPIA 1R0BG 1FRJA 1KC8T 4JKAA 1OH8A 4CLZA 4ZDNA 5ELZA 1RBRA 1RCHA 2HNDB 3PW0A 2DT9A 4YR2A 3ZT0A 3Q22A 3M8QB 3D6RA 2BMBA 1TU0B 3HD1A 2JX2A 5BREA 3SV3A 4CLWA 2VG7A 2MZSA 2UXCF 2ATLA 2F7VA 4LFBJ 2GQ2A 2LMIA 5C25A 3CWJA 2CIMA 2QKBA 4QJVA 1T03A 3GMGA 2W40A 1G1XA 3GG1A 5J2PB 1VQSA 2ZHBA 1M5PC 3L2VA 3E8OA 2DGUA 1RB0A 5KFWA 2C3OA 4H8KA 2OYQA 2QKKA 3DN9A 1W2IA 4CK1A 3GJTB 2KJWA 4FBTA 3THWA 4C3LA 4FJ5A 4NZ6A 1GLLO 1TK5A 2DPIA 3T1HJ 2XCAA 1TUGB 2I6WA 4B1ZA 5FDLB 1FNOA 3PRBA 2PO4A 4TLRA 5HK4A 3G4SS 1T05A 2A3JA 4IOAL 3KLHA 5A8KB 3P96A 4F36A 4CWBA 2D0AA 3ENWA 3I8DA 1RT1A 3MM7A 2PAVA 4EHUA 4XH1A 2L9WA 3BKTA 2R7VA 2EK1A 4DV0K 1CBKA 2C3MA 3HPHA 2HS3A 1HYSB 3OYMA 3T1HF 4CHNA 4LVOP 2VFRA 4HHHA 2ROEA 3K9JA 5KFHA 1Z1ZA 1RTZA 2NRZA 1NHKL 1HLWA 5C12A 4OJ1A 1WDDA 3QIPB 2H4WB 4DUYJ 1NOZA 3PG9A 3T5KA 3WEEB 4XK8C 1QSSA 4JYAJ 5H1SV 2LEBA 2E1CA 3KLFA 4AHRA 5I9EB 3DDNA 1X9JA 5HL7Q 4JI8J 5D0GA 4CGIA 4JS5A 3IBCB 1CPZA 2R7YA 4E7KA 3P1GA 4JV5F 4LIWA 4ED8A 4DUYF 4K5SA 2I5JB 1S6OA 4U95A 2GUPA 4FJ7A 2CZ9A 3WQPA 2MGZB 2DXFA 3MD3A 1YKWA 4BR5A 1PJ5A 1VBYA 2YX7A 4CJ7A 4H0TB 3J7AP 1EQ0A 1RU1A 1JX4A 4K50A 4JI8F 5BR8J 2XZDB 4C3KA 3V5RA 4CBXA 3KHHA 3FEXB 4YOUA 3NF6A 1FWLA 1TVRA 1T6DA 4DG1B 5CZXA 5GAEI 4PQUB 2QYCA 2GWJA 4OLPA 3P83D 4ZVFA 2ZE2A 3QEPA 3TARA 4BRPA 2PBDA 2XLJA 3OYFA 3T6BA 4OKJA 1ATNA 3DRRA 5IT4A 1HW9A 1NEEA 3PRVA 4KH0B 3C14A 3DYAA 4CGDA 1J5EK 1CZ9A 5D3GA 4OZLA 3DLHA 4CD3A 4CIEA 1XMQK 1VFJA 5A8WA 3GR0A 1U4BA 4DV5K 3DRSB 5EX3A 1N33F 2QZ8A 1QY7A 3LP0A 4C6AA 2D3O1 2HMPA 2XY5A 1IKVA 4NLSA 4QIEA 5C7PA 3MECA 5ETNA 2HWIA 2B4PA 2O3DA 1S10A 3KD5E 4Y2MA 4IWVA 1U1OA 1TFWA 3QRQA 4ZN1A 2P9CA 4TLQA 5K14A 1R3NA 5KFZA 2VODA 4R8UB 3OJUA 1Q8IA 4MLEA 2UXCK 1HWIA 5KG7A 1GX6A 3KLGB 1M5SA 3TUPA 3FEZA 8RUCA 5C0YA 1G7CB 2W6KA 1RK8A 3HFZB 4LF9J 1HYVA 4FWQA 5AJ3J 3FUYA 4H4KA 1FXRA 1KD1T 3DLKA 2Y8YA 1NUEA 2QWOA 3MEEB 5H9EK 1KDNA 1H7XA 4DN0A 1SJ3P 5B0FA 5DZ6A 1G2EA 2Q3SA 3ZZRA 1YUWA 4LRDA 2ZVSA 2LEAA 1RSCA 5IQQA 3GV8B 5HP1A 4K2XA 3U1LA 2WBRA 3DLLQ 2Z1IA 4LF9F 1VI7A 5LJWA 3WXJA 3R7NB 5AJ3F 3DMJB 4R5PB 1KNZA 2QI2A 3DLEA 4DSKA 1FJCA 1JJCB 4CD1A 3MMAB 1IKXA 3E3XA 1HLUA 3A8KA 2X51A 3ZZUA 4UOGA 1YITN 4B1WB 4KC5A 3T1HK 1R8PA 3MWBA 4KHUA 3U3YA 1NKEA 4FXWA 5E3AA 3H46O 1KFDA 3K5MA 1O51A 3R9LA 3DJCA 2H5JB 5KFCA 1B99A 2HAFA 1HWUA 4NLGA 4K4TA 3RGIA 2E5JA 5I4MA 2AJFE 3ZZZA 1DBDA 5F8IA 3MWPA 2FLOA 4LVNP 5BRHA 4NLTA 2XO6A 4U8VA 1R31A 5D6GA 3L4BC 1U2CA 3M8SA 4ZN3A 1RWNB 4CLYA 3IGNA 5D77A 4CIGA 2ASJA 4DPYA 3BGRB 1G15A 2B8PA 3ILIA 4NL5A 4JV5K 3LP1B 4JI6F 2R7SA 3RU0A 2KZZA 2HBQB 1S48A 3FQLA 4YOTA 3HBTA 3A1YG 1RTJA 1F6TA 3AJ2A 5EN1A 4NA1A 1YJ7A 4RW6B 4MT1A 3CFRA 1C0TA 3CJTA 3UD4P 1RA6A 2GFFA 4JI8K 4X66F 3VAIA 3QBXA 3CVKA 3W5ZA 1CLQA 2MZTA 3HSZA 3MTKA 3WC0A 2P5OA 1HWJA 2BANA 1FDNA 3P8BB 1SL1A 4HUGA 1R0AB 3G71S 2C2ZB 3CJ5A 3O8WA 2WB4A 5IT9U 2AYBA 3Q8YA 4UOHA 4IRCA 2KFNA 4KI4A 2OTLS 2AKWB 4WF9Q 2J5AA 4R79A 5IC6B 2J0QD 3I82A 1NM2A 3JSBA 1S1UB 1CJVB 1X4CA 2FJDB 2PT0A 4B9NA 1KLMB 3KK2A 4ZTFA 2E9RX 2LFVA 3OFEA 1BQNB 1N33K 4DV2F 4ZCIA 3HSCA 5DG8A 3WXMB 3P6YC 4PA1A 2G4BA 3I56N 4M3ZA 2HG4A 2FZGB 3FLCO 2C3YA 3OVNA 1RCOB 4KTQA 3TZYA 2DH9A 2IM0A 4O3OA 3OYHA 3TR8A 1JLFB 1WSGA 2Z1JA 3ITHB 3H4BA 4FLZA 1YTAA 4OGEA 2RKIA 3FZMA 1YJWN 1W25A 2CDQA 5IFMA 3TZZA 1MROA 2ZF5O 1CSJA 3H5SA 5IXUA 4O23A 4PL8A 2YWGA 3IDHA 4NRTA 3AY0A 5KOWA 4BC7A 5EWEA 2B3TB 2CJYB 4EWTA 1BGXT 1X5SA 4W5NA 2R8GA 2RH3A 1SBRA 2CJQA 4ZCLA 2RB7A 5B0CA 5GIOA 5THWA 3D3BJ 2J0SD 3KG0A 1JIHA 1SL0A 2DCLA 4MIBA 3OLAA 4A4JA 4FJLA 1PSDA 4GVEA 2P9GA 3KUGA 1VQOS 2KDOA 3W66A 4PRFA 4IKFA 5KRSA 1U04A 3SV4A 2CJBA 1FK9A 1XIQA 1S7IA 4UOFA 1M5OC 4LF9K 4URSA 2XMVA 3V2UC 1S0NA 1ZS6A 2XMKA 1KN6A 5DG9A 1RBSA 4Q2MA 3W2VB 1TL7B 1RHRB 1HNVA 3NAEA 4F4KA 3TAPA 2M0GB 2DNYA 4F2SA 2HHVA 3HDSA 5FPEA 1VLYA 3E01B 4DX5A 1IBKF 2P5VA 3KJFB 3VESA 1RTHA 3WX4A 3NLCA 3OTCA 3PYEA 4E1MA 2VA2A 4KHMA 5A6PA 1WTFA 4Y6IA 3CJBA 3TWZA 3QINA 3M6XA 2Q6BA 2X6NA 2K06A 3PFOA 4NYZA 3RRKA 2A18A 2Z2LA 1RWUA 5CAAA 1WBBA 4C2MA 1AZSB 4CEZA 3LTOA 3VTIA 1N8RO 2CVIA 3PCOB 4X4NA 4KKOB 2XYGB 1LW0A 1JLGB 3R27A 3RB4A 1EWRA 3THTA 1YBUA 2AX1A 3GSDA 1MA9B 5AQPA 4OPHA 4EIAA 5AQNA 3DLRA 4FSVA 4ZVPB 2HPUA 1FT8A 3PUFA 5HRSA 2CH6A 1RDCA 5BJRA 1B0TA 3EMTA 5C42B 4JI6K 4DFMA 3HCXA 2KG0A 2N7YA 4ED1A 2RILA 1KOOA 4NMLA 4NYOA 4V19S 1FKPA 2W2QP 3CCVS 5IS2A 3GWCA 3I9ZA 4YMEA 3VAKA 1MWKA 3OYGA 5E26A 3DU5A 4X66K 3MM6A 3N4WA 1KAYA 3UQSA 3PR5B 2VG6B 4CGFA 1RGVA 2DXEA 1ICEB 3TAFA 5ETQA 3C8YA 3NMAA 4F8RA 3CXCM 1WF1A 2HK2A 4Q5VA 5HMYA 4CJSA 3HVTA 4OX6A 5KFEA 3KNAA 4PWUA 4ZVRB 3JAMU 3M32A 1RDRA 3D7SB 4EFHA 2DTUA 2FC8A 1QTNB 2YVSA 5G0RB 3UN2A 2JWKA 2CJAA 4DMZA 4YDXA 4CFCA 1FJ7A 2DYAA 2EWHA 3V4IA 2DY9A 4FKYA 1C2PA 1VC6A 1NKCA 3O9SA 3POTA 2WC9A 1WBDA 1UTAA 3KKFA 1EO1A 4P74A 3NS7B 4GO7X 2ZEJA 2FB0A 4DV2K 3FBBA 1KVJA 4CFBA 1FF2A 4WK3A 2FJWA 3E2EA 1WTBA 2NPIA 1J2VA 2OUGA 1WI6A 2FF6A 3QZ7A 4BVOA 1AROP 3J7YU 3FRYA 2QWMA 2V8VA 4KT0C 2RQ4A 4WFAL 4OJRA 3ZT1A 3JSYA 1RKJA 2RU9A 4I9LA 5IT0A 3CJSA 2OTJN 2V50A 2HMIB 3IR6B 3F5TA 4CF2A 2M88A 3QMQA 3MN7A 1J5OB 1YJ9S 4CJQA 1M90O 2JEFA 2R7WA 3GE9A 4NRUA 2O8DA 3PIPL 2X1FA 4F0KA 2CWKA 2CPYA 2YKPA 4KHQA 3M6WA 2O8EB 2HBRB 2NXUA 2HBZB 5HJYA 2Q66A 3O3GA 3W9HA 4OL8A 3F2KA 5DG7A 4DKWA 2VPZB 3MCNA 4GV3A 4P6QA 2P9UA 3HHLB 1YBAA 3CJ9A 4RWXA 1NLKL 1RLDA 4KRWA 2Q2RA 4EO6A 2QSFA 2CADA 2XWYA 4FOEA 5KPTA 1HFEL 3V4MA 1SQGA 4FPAA 4C8OA 5AQIA 4E8UA 4JI0J 3K58A 4HDGA 1NZ8A 3R5JB 4NEYA 1HNXJ 5IV3A 1ATSA 1Q5YA 4RW4A 4JD2A 4EYHB 4X4VA 3QGGA 1WOQA 5ADXA 2DFFA 4CJKA 2PYJA 3KNGA 3MUTP 2HHHJ 2Q31A 1IBKK 2E5LJ 1V6HA 3ID8A 4EK2A 3UCUP 4ZVHA 4CQ1A 4J9PA 1YRTA 1BI4B 2LU2A 1GLJO 2ZUGA 4NE9C 4JI0F 5JVHL 2ZDOA 3CCSS 2WHOA 3MR7A 1HNXF 3BF3A 4B3TJ 2LU1A 3HX9A 3JS9A 4P2MA 4NLQA 3G4SN 1FKOA 2PMWA 4Y65A 4QWAA 4DV1K 2MQ8A 4JKCA 4RCHA 3BPSP 1NSPA 1FVSA 2DNQA 1I1GA 3EXYA 4DTPA 4J9QA 2E5LF 4CF9A 1QJHA 1S6UA 4QW8A 1REVB 2HIQA 2JNJA 5B8HA 4ZK7M 4F4AA 3PVXA 4J2DA 2C2DA 3SJJA 2V63A 1NHVA 3CCMS 1ELOA 2N82B 5F8LA 2QTDA 5LXRA 3IWLA 1FTRA 1VK3A 3PJ9A 1MG7A 3MMVA 4KB7A 1H98A 3SBTA 4O4GA 3BH6B 4B3TF 3HRGA 5T14A 1SI9A 4PYAA 1DLOB 1R59O 2BOAA 4CGJA 4CJVA 1AUSL 1NAQA 4YNQA 3SI6A 3M3ZA 1LW2B 1H3DA 1RT2B 3SBGA 1HMVB 2WVDA 2XGPA 1UWAA 3KG1A 4CZFA 1GK8A 1EP4A 2OI2A 2XZWA 3MDFA 2U2FA 4GKJF 4ZPBA 4JAXA 3G9CA 3E9LA 1REGX 3GOIA 4X4QA 1NSAA 3HHKA 1KAZA 4J5OA 4BLGA 3TU5A 4C1NK 3SNNA 2AJQA 5KFJA 1YK9A 3IR5B 4ZVTB 2V5HG 2G2YA 3ZTPA 4NXMK 5KQDA 2COLA 2BQ3A 2MTLA 5C10A 2LQ5A 4RNNA 1W2BM 2O8BB 3EDQB 1RTDA 4BRGA 4PQAA 3D2WA 3T1YJ 2MKHA 1NMDA 5BYSA 1VRQC 2OEMA 2IY5B 3OYCA 2FLLA 4Z37A 2G8FA 1S4FA 4DL7A 1Q82O 2FHKA 1WHVA 4FJJA 4JKBA 1HBOA 2A2DA 3MN5A 1BG3A 3MPWA 4RU9A 3TVYA 1LAVA 1C0GA 2LDIA 3L2UA 1XMOJ 1JCGA 2DHHA 4DUZJ 5DK5A 4ED4A 3N01A 3P38A 1HNIB 5HQMA 3NH0A 4G1QB 3TQEA 2HHSA 5EWGA 2JOQA 5J1EB 5CY4A 5G4DA 2HRUA 3GQCA 4LREA 2YPZA 2AJ2A 3M8PB 1R89A 4C0HA 2IOCA 1ZZFA 1CG2A 1K1QA 2GVZA 1EJ7L 5KFVA 2VFVA 1RHKB 3BYPA 4ZOSA 3PTWA 2V8PA 1UPMB 2JWLA 4ZPCA 1XMOF 4F67A 2VBYA 4DUZF 3UDEA 2WONA 4KFBA 3Q8RB 5IQ6A 2O8FB 4OI2A 1HBUA 2QWLA 4H54A 3DI6A 4CJTA 2J9DA 1U47A 2KT5A 4FDFA 1C0UB 2QMWA 4DR6J 1Z2LA 2V2VA 2OELA 1C1CB 3CD5A 1PBUA 4DL0C 3MEDB 2ZNZA 1R8CA 3HF5A 4B3RJ 3AVFA 2FJVA 1FX2A 4GC7A 1VK0A 3DGPA 4DL6A 1XERA 3SIPB 3DLBA 1WSJA 5IWAJ 2W7AA 3C16A 5JS2A 1S0MA 1LXJA 2HQDA 5AR0A 5HBMA 4JK7A 4RO0A 3OPKA 5KG6A 3PFEA 3B78A 3SUOA 2YNGA 3MR6A 1HQ2A 1YJUA 3UDLA 1Z4UA 4CGGA 2F40A 4GRSA 1SJQA 5FROA 4RBUA 4JI0K 2GW8A 2YV0X 2YHAA 3AXKA 4CO5A 1HNXK 4B3RF 1K9MO 4IR1A 4JLHA 4WE1A 1VK8A 1T03B 4CVNE 3THXA 2OPRB 3I5BA 2JEIA 1U1NA 4Y2CA 5IWAF 2VFTA 1VQ6N 1S59A 1WELA 1X1PA 3SSRA 4R0EA 5T7LB 3FCWA 2K3IA 2E5LK 2Q3PA 4DV4J 2IRYA 4TNOA 4M63C 2XRIA 4NPOA 4X65J 3OYNA 3R3TA 4FVCA 3ATUA 4JK9A 5AQOA 3PJWA 2IAJB 4ID8A 4FF2A 3RB6A 1O0PA 4B3TK 4O0NA 3FCHA 1T05B 1R8HA 1MSWD 1YHQN 2O1PA 1FJEB 4HTJA 1DY3A 2K3KA 2OCEA 3KLHB 4UY85 3PY8A 4O44B 3CDUA 5E3CA 2MY8A 4DV4F 4ID1A 2HIYA 1RT1B 3MM7B 2HBJA 3BSCA 4CK3A 2KKZA 4C23A 4FPRA 3GG4A 4GKJK 4ID5B 4YDUA 3EE8A 1YLXA 4KGXB 5LY3A 3RMAA 1XHXA 4M3XA 2HZCA 4TU8A 4NI2A 1DTQB 1DQAA 3MXMA 2DNOA 4PHTX 3O9TA 2ZZMA 4YB5A 3ULEB 2KFZA 3RJMB 1RUSA 2Q79A 3FGUA 1U2VB 3MPUB 2HFNA 2RRBA 3W3DA 4FK0A 4JP8A 3LDQA 1GLCG 3KD1E 3H5XA 2DJWA 3L2RA 5BYQA 3KLFB 4WIIA 1ILYA 3MMBB 3AOAA 1QAXA 2M8DB 1I6JA 1IH7A 4CHQA 2I1RA 3AVJA 3GBTA 2D41A 4Y0FA 2GX8A 3BDPA 4F26A 3O1BA 5KG0A 1BO5O 1E6YA 1TK0A 3UE5A 4FNHA 1AT1B 5LMNF 4DPOA 5MAOA 4DZDA 1QQOA 2VWJA 4FYDA 1S22A 3KDNA 4MMOA 5KFYA 2W9AA 4DSLA 4LF8J 2HQFA 2OTLN 1GLEG 3LM9A 2AU0A 2V51B 4BQZA 1TUVA 5K8OA 3QRPA 4ECRA 3GCWP 1VQMN 2HQIA 1RAOA 1HQEA 4CH1A 3PO4A 1YIJS 1TVRB 2GX9A 3KWIA 4KSEB 1CJUA 4S0MA 1N36K 1KAXA 3GB0A 4CBUA 5CR4A 2KT2A 5EXWA 3E1YA 2ZGZA 1K0TA 1XMOK 4HLBA 1V5VA 4OKEA 1DJ0A 4ZVUB 2N3OA 1C1BA 2HFUA 2GEMA 3AV9A 3C46A 3DRRB 2BUPA 3C14B 2M9KA 2QL9B 3DYAB 1NK8A 4BREA 3JTOA 3UDVA 4DV6J 5D3GB 4HTUA 7AT1B 4HVJA 5A8WB 1LFPA 1YJVA 3ZT2A 4JK8A 1QTMA 3GIIA 3OTBA 5D4OA 4X2BA 3LP0B 3KDOA 3LM2A 2Q0RA 1OY6A 2QTWA 2RAQA 3MECB 1B92A 2LQBA 2X1GA 2R9LA 4L8RB 4C3MA 1I94F 2F3JA 3SQGB 4CDIA 2ADBA 2MKCA 3KLEA 1H74A 4RBTA 2V7ZA 2BABA 1U0HB 3R8EA 3LPEA 1I3AA 4BRAA 1BIUA 3OUYA 4TKTA 4OZ2A 1VQON 3I8BA 3Q24A 2GQQA 3OQ2A 3O08A 2FY1A 4X64J 3AVHA 4W5RA 5J2NA 4MKVA 5IWAK 2ETJA 4ZLNA 3IN5A 2GJ2A 2ZWOA 4ED2A 4J8FA 2RIJA 2YBVA 2JC1A 2YH0A 3DLLL 4O3PA 1A5XA 3DLKB 2E7WA 2D1KA 1JWWA 3CCLN 2IVOA 2ZKUA 1GTHA 4EO8A 2OANA 4FZZA 2PDAA 3NAIA 4FWSA 4WTOB 3MM9B 4A8SA 1RDDA 2VZ9A 3SCJE 3PJXA 1NJWA 4RU2A 3A5LC 2BM1A 2G0JA 3G25A 1RT5A 1SJRA 4QPXA 3BBCA 4U8YA 3DLEB 3BSOA 4ELTA 1FX4A 2L48A 3B6PA 2O67A 4DV4K 4Z4EA 2HW3A 5L9XA 2VGMA 4Y1CA 2DNRA 2G8WA 2HS0A 4E1JA 1SV5A 1I3OB 3MFHA 2YPYA 1KLNA 1U02A 1YTYA 4ANDA 2ZC4A 3GFZA 5A2QO 2DFHA 3SAHA 5K5MA 3UD3P 2WSFC 1EZZB 4KAZA 4ZJQA 3US5A 1NK7A 5F8NA 1BIZA 2O8CA 3D66A 4EP5A 3ZZYA 3O3FA 2EKYA 4HWIA 4ZVEA 3NS5A 1S9EB 4CERA 4UT4A 5KPRA 2YWEA 2UU9J 4B8AB 3NGDA 1BQMA 4NZ0A 3UFCX 4LR8A 4DPXA 3FCVA 2K7KA 2JJ4D 4JKGA 4GVLA 2E20A 5ADXH 2DGXA 5HI7A 1V3ZA 2MKYA 2D0CA 5LMNK 4OZ1A 2YNFB 3O3LA 3KJVA 2HLUA 2NLWA 3K89A 4G1PA 4LF1A 3MUMP 2FVCA 4ZIVA 3L7OA 4CHZA 4DTUA 3C15A 1RTJB 1WOPA 3BP8A 2GJIA 1OS5A 2BJDA 2C2MB 1CQNA 2V6AA 4P7TA 1QZ6A 4KHSA 1C0TB 2XMTA 1I5OB 4JI4F 5HQ8A 3DGVA 3IMQJ 4BE1A 1IKWA 4IJAA 2KG1A 4CEFA 2UUCJ 3VQ9A 2RF2A 2HVEA 4OZNA 1UFLA 1NSKL 4H4OA 1EHWA 3ZSZA 4V19J 3D3CJ 3M9NB 5CHCB 5DETA 1U2RA 1Y7PA 2Y1JA 4J9MA 4PG4A 3KK2B 2PE8A 2X3DA 3IS9B 2QC3A 1MWMA 2CQHA 4B9UA 2ADCA 2FSKA 5HATA 3ZT4A 4RG8A 4OLAA 3QIDA 3NL0A 2BA9A 3SPZA 1YJ9N 3KHGA 2ZOMA 4FK4A 1KWMA 4B3MF 1RT3A 2CQ2A 2ZH8A 4KBIA 3O3HA 1I94K 2C2OB 4Z2XA 2RKIB 4FVUA 4PWDB 5J2MA 1VQNN 1JKHB 1FI4A 2KYXA 4J2BA 1IUJA 2XHWA 1XUPO 3M9MB 1TKZB 2G1DA 1YDLA 3JQKA 3I87A 1FWKA 1ZM4A 2AJ1A 4EI2A 1SH3A 1GOCA 1UOCA 4WCEL 1T9VA 4DFPA 2W9BA 2VGNA 5D0EA 3BGFA 4WIQA 3EE3A 4I2PB 3OW2R 2QA4S 3NS6A 3OJSA 2W6LA 3ZSQA 2E2QA 4ZP7A 3HZEA 1N6QA 3RSEB 1YZ7A 3MURP 1N5VA 3H25A 3MR3A 4CJEA 1QSYA 3I6PA 3CCES 4A48A 3M8QA 2DTJA 1YT3A 1GOAA 2KQ2A 4XH4A 1CS4A 3NWGA 1A5VA 3J7YP 2DFEA 1E4FT 5EVZA 1XMBA 3U3GA 3OYDA 4ILLA 5JXSA 1ITGA 3ET6B 4WQ4A 4ECYA 2DHSA 4FXVA 2ZHOA 3H2LA 4FWNA 3E9OA 5BYRA 4CJ3A 1VSEA 3CCSN 1LEOA 2AEJA 2AJ0A 4BC5A 4BC4A 4DL2A 2FHJD 1HNVB 1JJ2M 1HPMA 4F4XA 4QQBA 2N4DA 3GLJA 2BRLA 3H5UA 5C2DA 4J2EA 3ZSXA 4Q8EA 2CQPA 1GXLA 3VA0A 4M3RA 5FDLA 3CCMN 2KL8A 3MCMA 4OFZA 3AVCA 1VQ7S 2NXJA 2P6SA 2I0XA 4C11B 2RHQB 4LFAJ 1SC1B 5A8KA 4HI2A 3V9SA 2BKPA 4ZP9A 1Q7LB 2HS4A 4QCLA 1T9WA 2E4LA 1F3FA 1LW0B 5CYMB 4ZP8A 4GKKJ 1Z26A 3DU6A 2JFKA 3JXUA 3L4QA 1QHTA 1RBTA 2FBVA 5JLHA 3SUPA 2VBXA 1VJQA 3G6YA 1VOMA 5J2QA 1NMEB 4Y2KA 2IYGA 1YG0A 1U6BA 4C8MA 1UFWA 2OHDA 4OX9F 3QIPA 3HVRA 1EXQA 3WEEA 2B8QA 3NNAA 3BBBA 3O2IA 3BN7A 1FKPB 1D9FA 2QE5A 5F0XA 2HF4A 3FBCA 2J7KA 4DSEA 1WSFA 4UQGA 1DARA 1N8RT 1VSLA 4GKKF 2BACA 2H48B 4RJVA 2MPUA 4DTMA 4JI4K 5ETRA 1N48A 3ENHA 2DH8A 3IGVA 1K44A 4M7YA 1HQUA 3DLJA 3EVMA 5HLFA 3SEOA 3PYDA 2RS2A 2Y8WA 2QK9A 4FL9A 2MGZA 5J1NA 2JH3A 3QT8A 3HVTB 3I32A 3M32B 3OW2M 1JXVA 4K8ZA 5BRDA 1VISA 1DGKN 1TP7A 4O5FA 4A8MP 1L3UA 2B43A 3V4IB 4AM6A 9RUBA 4F02A 3POTB 1UA1A 4KGKA 4DG1A 1S99A 2A5XA 4CYUA 3NGTA 1R6VA 4Z4HA 1LK5A 1CULA 2XS7A 4F04B 2RQMA 3RBZA 1HYZA 3AOBA 2BX6A 3K8WA 4A62A 3MEGB 2APOA 4X4PA 3P31A 4EYIB 4B3MK 3DRPB 3NRBA 3OYLA 3HTVA 2BOPA 4WYBA 4KH4A 3ILLA 3DOKA 1VQ4S 4IKAA 2YH1A 1GLAG 4M7XA 2RVJA 1PKUA 1BU6O 1VAZA 1E6VB 5AQYA 3OTOK 4DTJA 3DRSA 4MK8A 1UPPA 2HFVA 3O9UA 3N4QA 4FLWA 4B9SA 1S79A 2KM8C 3AA4A 3QWPA 1U8SA 5M1OA 1KQSR 5D4NA 4NCBA 2GBZA 4LBHA 3I0SA 3H5YA 3OFGA 1RFQA 3GJRB 4DTRA 1WF2A 1WC6A 2O8DB 4CZLA 1CZAN 1X3MA 3IAS9 2EFPA 2XB2D 1WNEA 4DZ6A 2WZ1A 3CMQA 2DO4A 5L1KA 2P9UB 1T3OA 4R8UA 1BXNA 5E2QA 2VC0A 1HIYA 4NX9A 1D8YA 4FYYB 2BQRA 1U7LA 1FJGF 4H5TA 4CIOA 4QS7A 5I3QA 3KLGA 2YX1A 3DOMA 4PABA 1XR6A 1AFIA 1HHTP 1HKBA 1Y3JA 4KY3A 2R42A 3RRGA 3P39A 3QIOA 4EBEA 1CJKB 1B70B 2HHTA 4ZPTR 2QFIA 1RDAA 4AXIA 4ILHA 4WYWA 3OL9A 4RW4B 4PL7A 3OD2A 4JD2B 2DY1A 3OT9A 4N76A 2FY8A 2GC8A 4Z4GA 3PR4A 2V8HA 4KAIA 5I3UA 1PJ7A 4M41A 3C0BA 4M3UA 2DNLA 2NS1B 3CPEA 4GW6A 1ASVA 1N5YA 1B4SA 3BR8A 4OZ3A 4KHRA 5M2PA 4Y28C 2G8UA 5KFMA 2C2KB 4HH1A 1RT4A 1Z6RA 2UYTA 5GAHU 2YTCA 3MEKA 3MMAA 1FKOB 1X4HA 4F4WA 2YKNA 2CQCA 4F9OA 3M8WA 4K41A 1U1MA 3SSQA 2PMZD 4MYTA 2MKSA 4AQYF 5F9NA 4LRFA 1A6LA 1WSVA 3SI8A 3OTEA 2KHCA 3BM7A 1CVJA 2L08A 4N77A 2QRRA 3KHYA 3RVCA 4WPAA 3GJQB 4O4GB 3C94A 4D3HA 3MPYA 4OX9K 5U47A 3NF8A 4UW2A 1FERA 2AP6A 3NMUA 1HKAA 2C3PA 1BLUA 4MO4A 5L38A 3TANA 4H0PA 3AO2A 3PO5A 1PYOB 4ED7A 3L0QA 5T7BA 3EZUA 1NBEB 3R1HA 4K4WA 1XI1A 4GKKK 2CQ4A 2ATCB 3FZHA 5F0WA 4CW7B 2WVBA 1GFWB 2YWKA 5FD1A 2ACYA 2E1AA 3AO1A 1EP4B 4FWKA 1FRLA 3PXGa 4DX6A 1S76D 3VCDA 4NEZA 4ZP6A 3L3UA 3CCUN 3OHBA