2ZE2A

Crystal structure of l100i/k103n mutant hiv-1 reverse transcriptase (rt) in complex with tmc278 (rilpivirine), a non-nucleoside rt inhibitor
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title High-resolution structures of HIV-1 reverse transcriptase/TMC278 complexes: Strategic flexibility explains potency against resistance mutations.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase, hydrolase
total genus 136
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ze2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ze2A05
1RBRA 5E41A 3OYGA 4YR3A 2OPPB 4K4VA 1VRUA 3NE6A 1VSFA 2D0BA 4F8RA 2AU0A 4UQGA 1IKVB 1CXQA 1NK4A 4CEFA 1RT4B 3F9KA 3DRPB 3SPYA 1IKXA 2YNFA 1RT6A 1S48A 4WXWA 5HROA 4JUZA 2QV6A 1RDDA 4DMNA 2IGIA 4R8UA 3NCIA 1QE1A 1RT1A 1N6QA 4LSLB 4KV8A 3M9OB 3L3UA 4M3TA 4E1MA 1ZBIA 1KTQA 1HQUA 1S9GB 1U04A 2I5JB 1C0UB 1X9WA 2QKBA 2B4JA 4KPYA 3IGNA 4IRKA 5C25B 2OZSA 3CM5A 4TN2A 3TWHA 1IKYB 4IRDA 1S4FA 1G15A 1S1WA 3K58A 3LWLA 1HQEB 3KHHA 4ECQA 2HHQA 4CHNA 4CHYA 1LV5A 2ILYA 1BI4A 4IDKB 1FXXA 2BR0A 3PHEA 3KLEB 4K50A 1ZBFA 2WTFA 1SL0A 3O3FA 2R2SA 3SPZA 1QSLA 2R2UA 2G8KA 4FXDA 4OJRA 4IR9A 2Z1IA 4W5NA 3K57A 2BANA 2IC3A 2Z1GA 4MKAA 3AVAA 5KG0A 1S1XA 4RUAA 4O0JA 2B5JA 4N47A 3IS9B 1JLEB 4NZ0A 1BCMA 4XPCA 3RWUA 1GOCA 3G0ZA 1HNIB 3L2WA 5EU7A 3OS0A 3P1GA 3V1QA 1GOAA 3C6UB 4FW1A 1RT7B 3PW5A 3HO1A 3OY9A 3TAMB 3SUQA 1X1PA 1ZETA 1RYRA 1VK0A 2DY4A 1A5VA 4ZPCA 4AHVA 4ZMMA 2JGUA 2HMIA 1TL3A 1NJWA 1SL1A 3I5CA 3ZT2A 4NLYA 1EX4A 2AGOA 3LALA 2IM1A 3UDLA 4DFPA 3KK1B 2D0AA 4KHSA 2ITGA 4NLDA 4URGA 2RDJA 1S5JA 1CZ9A 4EP5A 4WFZA 4O3QA 2W9BB 3V9UA 4CF8A 2YNHA 2E9ZA 2WONA 3MXMA 2YHBA 5J1EA 3HVWA 3QGIA 4TQSA 3M8SA 3NH1A 3H5SA 3I8DA 3AA4A 4Z4HA 2F8EX 3HPGA 4B9UA 4O55A 3IN5A 1RILA 4O44B 1TVRB 4FZXC 3TVKA 4CHQA 4NLSA 5F8IA 4LSLA 3NGZA 4GMJB 3RTVA 4FZZA 3VQSA 3BJYA 1L3UA 3M8PA 2E9TA 3AO1A 4CGGA 1L3VA 2GIRA 5KTQA 2ILZA 4ELUA 5J2NB 4Z4EA 3T5LA 1C1BB 4IFVA 3S9HA 3OYEA 4CEOA 3PJWA 1IO2A 3ZSXA 3I0RB 4M42A 2ZQBA 4YFUA 2B6AA 3LP2A 3SV4A 5KG2A 1VSMA 4DU3A 4ICLA 3O3HA 1NK8A 4CJWA 4KO0A 4YR0A 3PX0A 4LH4A 2FVQA 5F9NA 2AX1A 1L3TA 1EXQA 4C8OA 2KW4A 4CJ5A 1KVAA 1RTDA 5CY4A 2IJFA 3QGGA 1LW2A 2AGQA 3PUFA 1GOBA 4NLOA 1X9MA 1L3SA 2E9RX 4CFBA 2E6LA 5JS2A 3AA5X 4B08A 3H4BA 2VG6A 5C5JA 4WE1B 3V4IA 3FQLA 4FBTA 3PX4A 1LWCB 1MU2B 1RDAA 1S0MA 3TABA 4IRCA 2O4GA 3QESA 2WCXA 4WZMA 1IH7A 4KE5A 1W9HA 2FVSA 4HUGA 4Q43A 4EBDA 1HNVB 2W42A 3NAIA 5C42A 2DFEA 4EZ6A 2UVRA 4J9MA 2WOMB 4FLUA 4CEZA 5K14B 3CIZA 1FK9B 4F2SA 3H98A 3HXMA 5CZ1A 1TKXB 3HPHA 3K5OA 3VQ6A 4IG3B 2O4IA 4QWCA 4KFBB 2W9BA 4CEEA 1HYZA 2E4LA 2YV0X 4DSKA 1TAUA 2FJVA 3VA3A 3NF8A 1XR7A 1BIUA 1RYSA 4KRFA 2ZE2B 3CFPA 4MK8A 1TV6A 4M3UA 2YHAA 3GIJA 3ASMA 1LWFA 4KTZA 1RDCA 5J2QB 4N76A 3MAQA 1XHXA 4ELVA 3QO9B 3KHGA 4CHPA 1U48A 1NJXA 2OA8A 4E7KA 4I7FA 3KLHB 2BGGA 4Y3CA 2PY5A 1TAQA 2VG7B 4L8RB 1JLAB 3OYBA 4KHUA 2HVHA 4WYLA 1SKRA 2HNDA 1JXBA 1IM4A 3V81A 2R8GA 4O3PA 4ELTA 1KFSA 2VG5A 3OYFA 4RZRA 3OJSA 5J2NA 4MQ3A 4DLEA 5DMRA 3RB3A 1KRPA 1FKOA 1Q8IA 2RF2A 3S3NA 3MR2A 1SUQB 4HCCA 4QAGA 3L8BA 4TLRA 1RT3A 2ASDA 4RW4A 3LZIA 1ZYQA 4N41A 1GX6A 3T1AA 3SUOA 2ZKUA 4BE0A 5SWMA 2XO7A 5KT6A 4U6PA 1JLQB 1TKZB 4RW7B 1T05A 3ZT0A 3PZPA 4ECWA 4MFBA 4LQ9A 1LAVA 4FJJA 4FJXA 2R2TA 4MH8A 2QE5A 3CJ0A 1A5WA 4DTPA 4KKOA 4RW6A 3I5BA 1WSEA 4EYHB 4DF8A 4QWAA 3KIOA 4QW8A 3DRSB 4YP3A 4TSXA 3OL7A 4RNOA 3VQQA 1HRHA 3VQEA 3EZUA 3DYAB 3BSOA 3RR8A 2PYJA 1RCHA 1UWBB 3TAPA 4HCBA 3OS1A 4BACA 2ATQA 4ED2A 3B6OA 5EUHA 3QIPB 1KFDA 2W7PA 5HRNA 4RNMA 3F73A 3M9MB 4EEYA 5HP1B 4RU9A 2OPRB 2RN2A 3V1OA 1VSIA 1DTTB 3AVIA 2RKIB 3OYMA 3JYTA 3E01B 3HL8A 2BQ3A 3FDSA 2R8KA 2ZD1A 5D3GB 1KHVA 1U49A 1S6QA 3PR4A 3RB6A 3IG1A 4CJVA 4TY8A 1BIZA 2IM3A 3AVNA 1NJZA 4BWMA 4FM2A 1SV5B 2YNIB 2C22A 3MTKA 4ECSA 3O3GA 1JX4A 3D0PA 1TK0A 4ECUA 3O4QA 2GV9A 2IDOA 3MR5A 3KNAA 1KVBA 4R5PA 4Q0BA 1Z26A 4DS5A 3MECA 4WZQA 2JEJA 2HAIA 4OPJA 1DTQA 2YKNA 4FJHA 2J6SA 3I0SB 1NNDA 3NFAA 3V6DB 3LPUA 3MEEB 3P5JA 1S0NA 3GIIA 1S1VA 2P1JA 1EETB 3DOLA 4PWDA 1T3NA 3QETA 4B3OA 4OKEA 3KLFA 4M95A 1QUVA 1U4BA 4ZP9A 4B9NA 3KK3A 2WRMA 5DG8A 3BQ1A 4RUCA 3CDEA 4KB7A 5I42A 4GW6A 4KI6A 4DTUA 1ZBUA 3FFIB 3LWMA 3MR6A 3SQ4A 2XY7A 4E7JA 5FDLB 1K1SA 1ITGA 4K8XA 4URSA 4DSFA 5KFVA 4IG0A 1JLQA 3QLHA 3DLEB 2ASJA 3DM2B 2R2RA 4ECVA 4ID5B 1REVA 2FJWA 1RT5B 4NYNA 3C6TA 1S9EB 3RMDA 3SUNA 3H59A 4J9QA 3RBDA 4PUOB 2W7OA 3QNNA 4RW8A 4HVJA 3FQKA 1JKHA 3BREA 4Z4IA 4CFCA 5KG5A 4F4KA 3GV7B 1JLFB 3DRRB 1N48A 1HYSB 4NCGB 1C1AA 4CF9A 4RNHA 3UPFA 2P5GA 3I5AA 3SI6A 4NLXA 1TKTB 3NL0A 5KFJA 3NMAA 2KZMA 2R8JA 2JEGA 3H5YA 3JSMA 2QKKA 4FJKA 4FK0A 5KG3A 4W5QA 4EZ9A 1RA6A 3SQ2A 4K4YA 4CERA 3SFUA 3NAEA 1TL1A 1DTTA 2IJNA 5KFZA 1RBVA 2EHGA 3H2LA 1NK0A 4WFYA 1OS5A 2VWJA 1T94A 2A1SA 4CJFA 1BQNB 3AVLA 5KI6A 4K8ZA 4J2BA 4RW9B 5DQHA 2KZZA 1KVCA 4DFMA 2HNYB 3UIQA 4C8MA 1WAFA 3VN5A 4HKQA 5EDWA 5KFMA 4W5TA 1SV5A 1RTIA 5KFTA 1S6PB 1R0AA 4Y2CA 4E0DA 3V1RA 1JLGA 3O4NA 5F8NA 3SV3A 4NYFA 2YKMA 2FBXA 3V6KA 3BGRB 3AO3A 3QYYA 3VA0A 3RRGA 3H4DA 3Q8SB 3U6FA 1KLMA 2J6TA 3VQ5A 1QHTA 4ZP7A 1U45A 3NH2A 4DG1B 1LW0B 4E7LA 4OGEA 4AH9A 2B43A 3M8QA 3NH0A 1S1UA 3UR0A 4NYZA 4F2RA 3MEDA 1JLBB 2DPIA 2AGPA 3EY1A 3KK2B 4LQ3A 1LWEA 3LP0A 1VRTA 5J2PB 3MF5A 4FK2A 3DLGB 2HWHA 2RDIA 2G8WA 5KGWA 3AVBA 5CYMB 1BQMB 4M41A 3BSCA 1NJYA 4IH7A 3OSPA 1ZBHA 1T03B 3TR8A 3NBPB 2W9CB 3WNEA 4IR1A 4Q5VA 4CECA 3NAHA 4B9SA 4KHWA 2HNZA 3SYZA 4MKBA 1WAJA 4O4GB 5KFYA 4N56A 1SKSA 1CLQA 3CJ3A 4RNNA 5CYQA 4PY5A 1Q9YA 3ZSVA 4FJ7A 3TAEA 1U47A 1I39A 4W5OA 4ZTJA 4FS2A 4ZHRB 5KGXA 2D3UA 2Z1HA 4Y1DA 4IBNA 3HP6A 2OPPA 4KAZA 1LAWA 3SQ1A 3ULDA 1WSJA 4U7CA 2QXFA 3PY8A 2XWYA 4CJ4A 3MEGB 2EX3A 2XY8A 1IKVA 3MR3A 1C0TB 1RT4A 1CZBA 4CEDA 3DRPA 4OL8A 4JV0A 3LP1B 3CG7A 5KG7A 4N5SA 4KHMA 3Q8RB 2OYQA 4KI4A 3HKWA 4QWBA 3V6JA 4JV2A 3KKSA 4C8KA 4O0IA 4AHRA 1J5OB 1FKPB 3KLIB 2FLPA 4YR2A 5FROA 4M3ZA 1S9GA 2I5JA 1RTJB 2ASLA 4ZPDA 1C0UA 4Y1CA 3BQ2A 3K59A 5HRPA 5C25A 4Z0UA 4E7HA 1IKYA 3C95A 1JLCB 5J2MB 1UA1A 1HQEA 3AV9A 2W9AA 4M94A 4DWIA 2JC0A 3G6XA 4IDKA 3RB4A 3KLEA 1RT2B 4J9RA 5C24B 4W5RA 3IGVA 4CJRA 2XCPA 4KHQA 4F3TA 3SCXA 4H4OB 5F8LA 4CK3A 3AVGA 1QQCA 3IS9A 1JLEA 2O5DA 4ZVEA 5KFLA 1WSGA 4IKFA 2BQUA 3KD1E 1T8EA 1HNIA 5CYMA 5KFHA 4I2QB 3C6UA 1RT7A 4KHRA 4DL5A 3TAMA 4ED8A 3CQ8A 1XC9A 3IAYA 1ZTWA 4DLGA 3NBPA 3VQAA 4J9SA 4DL7A 4CK1A 1RA7A 4BE1A 5KFQA 2OZMA 1I6JA 3BDPA 2JEFA 4I2PB 3KK1A 5F8JA 3EPGA 3QIDA 2NUBA 3OYHA 1NKBA 3V9WA 2WB4A 3DMJB 2UVUA 4CEAA 1N56A 3VQBA 1S49A 4XO0A 1ASWA 2F8TA 3HHKA 3RB0A 1IG9A 2AX0A 2FVCA 5KFNA 1YVFA 4PA1A 4OPKA 4LSNB 5HLFB 1BL3A 4JS5A 5DLFA 4IQXA 1GX5A 5I3UB 1KSPA 1HPZB 3MEGA 5KFXA 4EP4A 1C0TA 3OYDA 1D9FA 4B9VA 4J9OA 1SH2A 3CDWA 3OVNA 3PJXA 4O44A 4OLAA 4RNFA 1TVRA 5KFAA 1WSIA 4ECTA 4J9NA 4FLYA 4TXSA 3OS2A 5JUMA 4CF0A 1QS4A 4FJGA 1N4LA 4FM0A 4IH5A 2DFFA 4BDYA 1KLNA 1S1TB 2DFHA 2HHVA 2VA3A 1VSDA 3HM9A 3EYZA 4G1QB 3NKYA 1YVUA 2WHOA 1C1BA 1J54A 3QEXA 1RTHB 1T7PA 4M45A 2XRIA 2J6UA 5F8MA 4C8LA 4LD0A 4ED1A 4F4ZA 1NK9A 3I0RA 5KG4A 4IFYB 3EZ5A 4ED7A 2XI2A 4AHSA 1RT2A 4FJMA 5F9LA 1EP4B 3L2UA 3CYMA 4M3WA 2KQ2A 3T3FA 2BRKA 4YQWA 4ED6A 4WYWA 3KKRA 3ZSZA 3AVCA 3LZJA 1Q9XA 1S97A 2OPQB 3KLGB 1XWLA 3DOKB 2HHUA 3DLRA 2XI3A 3DI6B 5KFWA 5KFCA 3TAGA 3H08A 3HT3A 5DQGA 4X2BA 2KFZA 2D7SA 2LSNA 3TANA 3OHAA 1QAJA 5DG9A 4FM1A 1C1CB 3QEVA 4H4MB 3HVTB 4WE1A 4GC6A 3VQ9A 4XIUA 1MU2A 1LWCA 2IBKA 2Y1JA 4F3OA 2ETJA 3SZ2A 1VSHA 4JLHA 4DL2A 3PO5A 2BE2B 5KFRA 5HBMB 1RDBA 3ZCMA 4DTJA 1HNVA 2YNGB 3THVA 5KFUA 3CO9A 4CGIA 1TKDA 4I2PA 2WOMA 1NHVA 1J53A 3MXJA 5K14A 1FK9A 3OLAA 4AHUA 4C8NA 3ITHB 3IRXB 2OPSB 4J9KA 1TKXA 4J2AA 1VSJA 3A2FA 4IG3A 4FYDA 4RG8A 1C0MA 3CFOA 3U3GA 4PQUB 2UUTA 4KFBA 4K4XA 4AILC 1SH0A 4QPXA 1NHUA 2G8UA 5KFGA 4ZVGA 2XC9A 5DG7A 4ZP8A 2ZE2A 1JXEA 3BSNA 3NHGA 1VRUB 4DL3A 1HPZA 2ATLA 4Z4CA 1MMLA 3K2PA 5J2QA 1HARA 3QZ7A 4CIGA 3QO9A 1IKXB 2YNFB 1RT6B 2XGPA 5HROB 4DSLA 1CXUA 4R8UB 3OYIA 3KLHA 1QE1B 1RT1B 1N6QB 3SQ0A 4QOZB 2VG7A 3BSAA 1JLAA 1HQUB 4CE9A 3AA3A 1S0OA 2IM0A 2IMWP 5SZTA 4R0EA 4LY7A 5DLGA 2A1RA 4ECXA 2FC0A 4ID1A 1Y97A 1SH3A 1S1WB 3SJJA 4KAIA 4DTXA 2R7YA 4NLUA 4IKAA 4ZTFA 5KFPA 4Q45A 4FLWA 4DQPA 1SUQA 2HVIA 4O3OA 4Q44A 4GVMA 2IA6A 4DSIA 1N5YB 4ZVHA 3KTQA 1WNEA 1TKZA 4RW7A 2BANB 2IC3B 3CWJA 4NRUA 4O3NA 4CESA 1S1XB 3D5MA 1BGXT 4IH6A 2B5JB 4BWJA 4M3XA 3DLKB 3D45A 4M3YA 4O4RA 4TY9A 4ZPAA 1WN7A 2XHBA 1K1QA 4Y2AA 3KMSA 1C1CA 3ISND 1BHLA 4Y34A 3DRSA 3N6NA 3N6MA 3KLVA 4MIBA 4KHYA 1HJRA 2D41A 1B9FA 1W0HA 3OL6A 3DYAA 4E1NA 4DSJA 3HP9A 1K6YA 1UWBA 3VQ4A 1HYVA 3V9ZA 2AJQA 1NK5A 4KTQA 2HMIB 1TL3B 3HVRA 3QIPA 2C28A 1U09A 5KT3A 3AA2A 4CFDA 5CZ2A 2F8SA 3IRXA 5HP1A 2I1RA 2C2EA 1WSFA 3MFIA 2OPRA 4MK9A 3RMBA 4FBUA 2RKIA 4CJPA 4CEQA 3HVAA 2W8KA 3E01A 3PW7A 2IM2A 4FLVA 3CJ4A 2OH2A 3NGDA 3OL9A 5D3GA 3V9SA 2PZSA 1ASUA 3G10A 2YNHB 4FJ9A 2WONB 1ZTTA 4FLZA 3HK2A 4DFKA 5J1EB 4YNQA 4CGFA 4CJUA 3T5JA 3PVXA 2D0CA 4LH5A 2G8IA 1SL2A 3TAQA 4XPEA 4JS4A 2YNIA 5T7BA 4OGCA 1BISA 5KT4A 3NF9A 3WNHA 1XR6A 1B92A 3MXIA 3VQPA 1SKWA 4KBIA 3I0SA 5JS1A 3V6DA 4EYIB 4FS1A 3MEEA 3M8PB 3FRZA 2KFNA 2HHTA 4H54A 3OL8A 1EETA 4NLQA 4E7IA 4FVMA 3QEWA 2E6MA 4EO6A 3KJVB 4CJQA 1YTAA 4IFVB 1JIHA 3AVHA 4JRPA 4ECYA 4CHOA 4BE2A 3RMCA 2UUWA 1NKCA 2B6AB 3LP2B 3FFIA 4E89A 4CJLA 4ICLB 2X74A 2GUIA 3MFHA 4KO0B 5FDLA 1NKEA 4ZP6A 4IOBA 3S3MA 4H8KA 1N5YA 1L5UA 3CFRA 3L3VA 4CIEA 3LPTA 4KTWA 3DLEA 3DM2A 3QGHA 4ID5A 4DTOA 1RT5A 3UQSA 4BDZA 4FCYA 1S9EA 4M3RA 3SI8A 1RTDB 1HMVB 3ZSOA 4I9QA 4PUOA 2D3ZA 1LW2B 3QEIA 3DLKA 2P51A 4B9LA 5DQIA 4F50A 3VQCA 3OYKA 1VSEA 4WXOA 3TAFA 1JLFA 3DRRA 2VG6B 1HYSA 4NCGA 3V4IB 4NLWA 2PYLA 1TKTA 1TP7A 2JC1A 4CJ3A 4OLBA 4K4TA 1C2PA 1KCFA 1VSKA 5C42B 3GYNA 4QW9A 3T19A 1ASVA 2R8IA 4CJTA 1BCOA 2QK9A 1NOZA 4CIFA 4O3RA 3WNFA 4QCLA 2FLNA 4DU4A 1NK7A 5F8HA 3K5LA 1RBSA 5KG6A 3RBEA 1F21A 3OYJA 4K4WA 3QERA 2AWZA 4NLPA 5KRSA 1BQNA 5KFDA 4CF2A 4J2DA 4RW9A 4KHNA 4TYAA 1J9AA 4K4UA 1YT3A 2HNYA 1TV6B 1Z25A 3NF7A 1VSLA 1S6PA 4FLTA 1LWFB 5KFIA 3KHLA 3QZ8A 3T5HA 3BGRA 3LAMA 5L1IA 3SUPA 1X9SA 2EC0A 4DEZA 4I7FB 1D8YA 4HUEA 2VA2A 3QNOA 2G8FA 2FBTA 4FZYA 4E19A 4CF1A 4HTUA 2HHWA 4DG1A 2HNDB 1LW0A 4B8CA 3V81B 3KJVA 2VG5B 4EBEA 4B9MA 2WK4A 1WNSA 3H5XA 4KB1A 1JLBA 4FJNA 1FKOB 5HRSA 3CJ2A 3KK2A 2RF2B 3OYLA 3V9XA 3SNNA 3BR9A 1RT3B 4RW4B 3DDKA 1ZBLA 5J2PA 4NLTA 5L1JA 3DLGA 1DLOB 4NLVA 2RPIA 4BDPA 3H5UA 4KSEB 3LP3A 1B9DA 4JRQA 1BQMA 4CJKA 1T05B 2KTQA 2V0NA 4CJEA 3OSNA 3ZT1A 3RRHA 1HMVA 2XGQA 3E51A 2Y1IA 4MFBB 2IAJB 4CFAA 1T03A 1JL1A 2W9CA 4I9LA 4DTRA 3AO5A 4NCAA 4WFXA 2Z1JA 3GV8B 2GC8A 4KKOB 4RW6B 4ECRA 3L2QA 4O4GA 4J2EA 4Q8EA 3L2VA 2BDPA 1RAJA 1I3AA 4DU1A 3VQ7A 4E3SA 4HHTA 3Q8QB 1JL2A 1NK6A 5DGBA 2FVRA 3PV8A 1D1UA 2X78A 3ICLA 4ZHRA 4K4SA 5EWEA 3OJUA 1RDRA 3GILA 3TARA 3GIKA 2IS3A 3M8RA 3T5KA 5L9XA 1WLJA 4HUFA 3GIMA 3NDKA 4FK4A 3PX6A 1C6VA 3JYTB 4O5BA 1JXLA 3LP1A 4DS4A 2ZD1B 1S6QB 3IG1B 1S9FA 5KFEA 3K5NA 1J5OA 4TY8B 1FKPA 3KLIA 1QTMA 3QINA 1D9DA 3C94A 5FRNA 1RNHA 1RTJA 4ZVFA 3S3OA 3RAXA 3Q8PB 4B9TA 4Z4FA 3NF6A 3AVFA 4FLXA 4DQIA 3N6LA 3OHBA 4R5PB 1W25A 4Q0BB 1JLCA 5J2MA 3MECB 3RR7A 4DF4A 2XCAA 1DTQB 2YKNB 2FLLA 2JEIA 2HW3A 2Q3SA 3CVKA 3QIOA 1S1VB 4NCBA 3DOLB 3AO4A 4PWDB 5C24A 4OKKA 4B3OB 4MK7A 3KLFB 2XY6A 4TQRA 4ED3A 5FRMA 4GC7A 4ECZA 4FJIA 4Z4GA 3KK3B 4CJSA 4DTSA 4J9PA 1D0EA 4CGHA 4H4OA 1QSSA 4OVLA 5I42B 2G8VA 2X6SA 4DFJA 2C2RA 4G3IA 3P83D 2F96A 4B8AB 2DTUA 2R8HA 1DLOA 5KFOA 2BQRA 2C2DA 3K5MA 3OYNA 5KRTA 4DSEA 3DLHA 4IG0B 3QLHB 4I2QA 3KHRA 5KT5A 1QAIA 1REVB 2ALZA 3C6TB 5HRRA 3M9NB 3OYAA 4KREA 2IAJA 3PR5B 1O1WA 3WNGA 2AQ4A 4RW8B 2BRLA 3ZT3A 3SFGA 1RBUA 1S10A 3AVKA 3KMQA 1JKHB 2CKWA 5KG1A 3AVMA 4DQRA 5KFSA 3ZT4A 1TK5A 2DPJA 3VQ8A 2HHSA 3KD5E 1UA0A 3KOAA 3HYFA 4CGDA 2X6NA 4ED0A 3PW2A 4OKJA 2V9WA 3DMJA 1IKWB 5KT7A 3ISNC 4DTMA 3TQ1A 2FJXA 3JSMB 4FJLA 5JXSA 3ZSYA 4DL4A 3CM6A 1NOYA 1YTUA 3ZSRA 4LSNA 5HLFA 2GBZA 4FJ8A 1TL1B 5I3UA 4JV1A 3FSIA 4AHCA 3DLBA 3G6VA 1TGOA 3AVJA 1A5XA 3RMAA 2IOCA 3CJ5A 2HB5A 3HPOA 3TI0A 1XHZA 4ZPBA 3RAQA 1UAXA 4KV8B 4HYKA 4NLGA 4NLRA 3NGYA 4KB0A 4FJ5A 4K4ZA 1RTIB 1S1TA 1R0AB 1WSHA 3V6HA 1JLGB 1TK8A 4G1QA 4YMEA 4QWDA 2YKMB 5KFKA 3AO2A 1RTHA 5EWGA 1UOCA 3G86A 5KFFA 4O3SA 2W8LA 1KLMB 3ALYA 4F4YA 3PW4A 4FW2A 4DL6A 2G8HA 2CJQA 3OLBA 3EPIA 1BI4B 4IFYA 4CHZA 3OYCA 1EP4A 3M8QB 3VQDA 1S1UB 5KFBA 4DQSA 3LAKA 3MEDB 4DTNA 4F4WA 2FBVA 3BQ0A 2OPQA 2FVPA 3KLGA 5L1LA 4EBCA 3HSTB 5DK5A 2D5RA 3DOKA 2UVWA 2HWIA 1LWEB 1XI1A 4NRTA 2JLEA 3DI6A 2V4QA 3LANA 4Q8FA 3QEPA 3U3YA 3PW0A 3LP0B 1VRTB 3G6YA 1RBTA 4F4XA 5F8GA 1TQLA 3D28A 5L1KA 2UVVA 4H4MA 3HVTA 1KHWA 3NGIA 4AHTA 5KT2A 1D5AA 2HHXA 3PO4A 2XY5A 3GV5B 5EWFA 1XR5A 4URQU 4CEBA 4J9LA 3B6PA 5DGAA 2BE2A 4CGJA 5HBMA 2HNZB 2VWKA 1EKEA 2YNGA 5T14A 2GIQA 4DQQA 2P5OA 1CSJA 5CYQB 1Z4UA 4QWEA 3ITHA 4TYBA 2OPSA 4CCHA 3CDUA 2FBYA 3GQCA 1IKWA 4EO8A 3LDSA 3HJFA 2V4RA 4PQUA 4MIAA 3ZSQA 3ZSWA 4CK2A 3H40A 1QSYA 3L2RA
chains in the Genus database with same CATH superfamily
1RBRA 5E41A 3OYGA 1YJVA 1VRUA 2Y1RI 1WTBA 3NE6A 2D0BA 3ILLA 1Y7PA 3W65A 2QWLA 1RE1B 4CEFA 1VQ6S 2IY5B 4LF9K 2O8BB 4R8UA 3NCIA 1QE1A 1RT1A 4LSLB 3M9OB 3L3UA 4B1XB 1G3OA 2CQIA 4K42A 1HFEL 1HQUA 1C0UB 3MWBA 2FHMA 4HACA 2QKBA 1ZAWA 4C4WA 2OZSA 1DEJA 3ZEUB 1IKYB 2BKPA 4ATNA 3K58A 2MJUA 4WP3A 3DU6A 4RBTA 1RZMA 3A8IA 2BM1A 5AQWA 4CHNA 4CHYA 1DHMA 2V7YA 2JVRA 4BGAA 3AFGA 1JQGA 1HBOB 3BP8A 2ZH2A 1FXXA 3PHEA 3KLEB 4OI6A 4H0XB 2WTFA 4FYXB 4LF7K 2R2SA 4WFBQ 3SPZA 3DN9A 2OEMA 4IR9A 3MM7A 4W5NA 1I1GA 4QR0A 3MUVP 3ILIA 4O0JA 3AJ1A 4C0OC 3H45C 1KDNA 1WTFA 1FD8A 3SSQA 4BRNA 1NMNA 4UUXA 1X60A 4NZ0A 4XPCA 5IV4A 1HNIB 3L2WA 5EU7A 5HAOA 5LMNF 1A0OB 3P1GA 3G82A 3J7A1 1GNKA 2FPHX 3TAMB 1CJKA 1GXTA 3SUQA 1X1PA 2J9CA 2QL5B 1ZETA 3BO4A 3RZAA 1A5VA 8AT1B 2IIRA 2JGUA 1TL3A 1SL1A 3KHYA 4LBIA 3SBTA 3UDLA 1W2IA 4KHSA 3OR2B 4URGA 5DDOC 1S5JA 3DXKA 2VC1A 1Q82T 4YB1P 2UU9K 2W9BB 2VV5A 4OYPA 2V2ZA 4CF8A 4JYAK 3O1WA 4UOHA 1FTRA 3MXMA 3C2PA 4QIVA 3IBFB 5HJYA 4J37A 3NH1A 3H5SA 4DCPB 3AA4A 4Z4HA 2F8EX 2MKSA 2RUSA 2VYPA 1RILA 4O44B 4FZXC 4CHQA 2QLBB 4WKYA 2N3LA 5F8IA 2YKAA 1U1KA 4GMJB 3NGZA 3HBTA 2Z2ZA 2C2KB 4JI2J 1WUUA 1L3UA 3TOQA 1TUUA 5M1QA 4JI0J 4G1PA 4Z7YA 4L6V3 2GIRA 1BQXA 2Q2RA 4DR5F 4QYZK 2UUCF 1ZM3A 1RHQB 2EKYA 3T5LA 4P2XA 3R2CJ 5EY4A 1XUPO 2RT3A 5LOQA 4UY8T 3PJWA 1IO2A 1U2VA 3I0RB 3O80A 4M42A 2B6AA 3DC2A 1VSMA 4DU3A 1HX1A 3O3HA 1NK8A 2QWMA 5JVHQ 1YITN 1NDCA 3RBXA 3PX0A 1Y11A 3WQTA 2FVQA 4JV5J 2KW4A 1UFLA 3C14B 5AQQA 4CJ5A 1WC1A 1RHUB 1KVIA 2W2MP 5CY4A 4IDHA 2CQDA 2Q1NA 1GOBA 4NLOA 3D1QA 2YVSA 5KPTA 4JI6F 4A5BA 1NU4A 1PJ5A 3E9LA 3SCLE 4WE1B 3FQLA 2BH1A 3I33A 5D0HA 4DZ6A 3EVMA 3PX4A 2V94A 1WHWA 2DNKA 4P9SA 3TABA 4IRCA 2O4GA 1YQHA 1GAOA 2HKEA 1W9HA 2AJ4A 1IM6A 5F3TA 2YXLA 2E20A 3D2FB 2W42A 4EZ6A 1V9OA 4J9MA 2QM1A 3CIZA 3AXMA 1UZHA 2OSQA 1V4SA 4B1YB 2FGCA 3N5FA 2NRZA 1TKXB 2VQFJ 3VQ6A 3K5OA 5ELZA 3ATVA 3GIRA 4KFBB 3TEGA 1PGZA 4O5FA 1OYEA 1VRQC 4P10A 3I8BA 1EWQA 2LDYA 4ANCA 4ZDNA 1RYSA 1APSA 2CNLB 4M3UA 5IOLA 1YDLA 4Y0FA 2P9SB 4IFEA 2UUBK 1LWFA 4KTZA 1X5SA 4N76A 2L41A 1XHXA 4C6AA 1EQYA 3KHGA 4A47A 1HHTP 2M9KA 2ZJQL 4E7KA 2PY5A 1TAQA 1K47A 1P1TA 2H5EA 2BJ3A 2NXJA 2CQHA 4GKKF 4KHUA 5T7LA 1Q5VA 1JK9B 4CZKA 4JKBA 1IM4A 3P96A 3V81A 5L38A 1ATSA 4R25A 2FSNA 4DLEA 3RB3A 4BC4A 3PIPQ 1Q8IA 4M5DA 3MR2A 3VGSA 4OX6A 4HCCA 4QAGA 3UDCA 3L8BA 4FF3A 1RT3A 5LMNK 4OMFG 3N9UC 1BO5O 4KR0B 3CJ9A 1UPPA 2XO7A 5KT6A 3MM8A 2F9WA 1JLQB 1TKZB 4RJVA 2Z58B 2XYPB 4LQ9A 4FWSA 3WZ0A 4FJXA 2QGFB 4OX7A 4BS2A 4MH8A 2VL1A 3VAIA 2P9KA 2NREA 4AYBD 3EX7B 3OTOF 1FEHA 5B0DA 3JAMY 4KYZA 3VQEA 4PXBA 2NSBA 2BV3A 3HKZD 2ROEA 2Q79A 1ZZNA 2CGLA 3DOMA 4HDHA 3WXKA 3VGVA 4ED2A 1YJTA 3QIPB 3A8JA 1KFDA 5F41A 4XK8C 4BR9A 4PXDA 5AQTA 3F73A 5GMDA 2E1YA 4EEYA 2RN2A 1NO8A 1DTTB 3FSXA 3AOBA 3OYMA 1MWYA 1CZAN 5F2RA 1K0TA 3FDSA 2BEFA 3DDNA 1S6QA 1YRUA 1M5PC 5FLXU 3AVNA 3UN3A 1NJZA 3JQMA 2UUCK 4IO8A 2BUNA 1TK0A 1U0SA 3GJTB 2GV9A 1CC7A 4Y0WA 4Q0BA 1RABB 4TU8A 1ITPA 3D3CJ 4WZQA 4OI4A 2YKNA 4OPJA 3LTOA 1Q81T 3B8HA 3I0SB 1YAGA 3NFAA 3V6DB 3LPUA 4UT4A 4ZPWR 3MEEB 5AE1A 1S1VA 2P1JA 1Q0NA 3W7BA 4B3OA 1U4BA 4HT5A 1Y10A 2QLJB 3C0BA 4ZP9A 3KK3A 2WRMA 4RUCA 3CDEA 1XQIA 4DR7F 1HKGA 4UF4A 4GW6A 4XEIA 5AQHA 3EGVA 1ZBUA 3LWMA 3MR7A 3EMTA 5AZIB 4E7JA 1K1SA 3R1XA 2AYGA 4URSA 3WXLA 3M2VA 2ZH4A 3NGUA 3ISZA 1JJ2R 3OPKA 3DM2B 2R2RA 1XMOJ 2FJWA 3H59A 2XHWA 4DOZA 3RBDA 4MLEA 4PUOB 3QNNA 3ILOA 2PDAA 2BJ1A 3BREA 3P38A 3OW2M 1JLFB 2KB2A 4PAAA 3GE9A 1C1AA 4B3RK 3I5AA 3SI6A 3NL0A 3NMAA 1HPMA 4C2MA 3TU5A 1HBUA 1WC4A 1ZZFA 5MLCV 2XNQA 2OO4A 4D3GA 4JI1F 1RA6A 1RKJA 3GJQB 3KJQB 3RU0A 3CJTA 3UDEA 1N34F 2ZWHA 3JQKA 2YHYA 2CQ4A 3E9PA 2XS5A 1TL1A 3UCUP 5KQDA 2ASPA 4K5SA 2E5IA 2EHGA 3A0IX 4CJFA 2CQGA 2ZITA 4GKKK 4RW9B 1Q1KA 3PYFA 1Z2ZA 2M8HA 1GMVA 4DV5K 1CC8A 1R0AA 1F5BA 2H4WB 2H51B 1X4AA 3V1RA 5LM7E 5F8NA 2VJVA 3DDIA 3V6KA 5CA5A 2BJEA 2FIUA 3AO3A 3QYYA 3RRGA 1KLMA 4DUYF 1OIAA 1QHTA 1FXDA 1OY9A 1CJVA 2HBYB 2IVFB 1FDBA 4DG1B 4AH9A 1YTYA 5GINA 1S1UA 3BN4A 1X3NA 1R6YA 3K7RA 3MM9A 2UXBF 3MEDA 4X4QA 1JLBB 2HQFA 2AGPA 3KK2B 3O9QA 5ETOA 1PJ6A 3MF5A 4OHVA 3WC2A 1A7GE 2G8WA 3ET6B 1CVJA 2Q97A 1F3VA 3VETA 4HH0A 4M41A 5A6WA 3JAMO 1NJYA 3VENA 2BE9B 3MOZA 3OSPA 3BZCA 2IFXA 2W9CB 3ZTPA 4IR1A 3WNEA 4LFAJ 4Q5VA 4CECA 1FVQA 4B9SA 3TZXA 1U1MA 2PO4A 2HNZA 4KHWA 2COLA 5AQNA 1SKSA 1NWKA 1FE0A 3CJ3A 5CYQA 4PY5A 1UJ6A 2LQJA 3ZSVA 4OYAA 3FGUA 2OTLS 3EVOA 1I39A 2LXIA 1VQ9N 3OT9A 4ZHRB 2XMWA 3ENVA 1ZM4A 2R7RA 2IVNA 2GWKA 1Y5NB 2HHHJ 3AXKA 3SQ1A 2C3MA 4CJ4A 3RG6A 2C2ZB 2GJIA 1RT4A 4CEDA 3DRPA 3LP1B 2D0OA 5KG7A 3CG7A 2OYQA 3Q8RB 2GNKA 2Y8YA 3A3NB 4C8KA 3MX2A 2DIUA 4P75A 1FKPB 3KLIB 2FLPA 3J7ZT 5FROA 5AZJA 4M3ZA 5HOOA 2I5JA 4ZPDA 2OEKA 5C25A 1S72N 3FR0A 1M0SA 3ENWA 5HMWA 2QFIA 2B8QA 4DR7K 2ACYA 7FD1A 3O8MA 3V4MA 3TTFA 2A6MA 4JI8J 2E7VA 1NH8A 2NLWA 5D8HB 3G87A 4J9UE 1BUXA 2P9CA 3G4SS 2GMHA 3NWGA 3RAMA 4A5AA 4QS7A 1U2RA 2A6OA 2V4JB 4CJRA 2XCPA 2GX9A 3W3DA 3M2UA 3QICA 5F8LA 4CK3A 2I0XA 1PAUB 4MKVA 3J7YI 3W3SA 4U8YA 4EMDA 2NR0A 5KFLA 5GAHI 3KD1E 1NB2A 1FCAA 4I2QB 2EC2A 3GZ7A 1R31A 3C6UA 1PYTA 1RT7A 2MY8A 4KHRA 3THYB 1P90A 3QBCA 3R6MA 2MZRA 1KBRA 4ED8A 2DGQA 4QIGA 3BO3A 3CQ8A 3R5BA 1J27A 3IAYA 2VKZG 3RW6A 4DLGA 3NBPA 2QIFA 1FF2A 3FVYA 2FC8A 2W7AA 4HVZA 2JEFA 2R4FA 5H9FK 1X31C 4JI2F 2WBNA 2NRHA 2ZZNA 4JI0F 4IO9Q 3OYHA 1M1HA 4E2FB 7FDRA 2UVUA 3SJHA 3QWUA 1N56A 1S49A 1Q5YA 3HHKA 3HZGA 1Q82O 3P4UB 4RO0A 4N7TA 3BKTA 1YVFA 3EDQB 4FWNA 3CCMS 3VWSA 4YDUC 4JS5A 2O01C 2P9UB 1UW4A 4IQXA 1HPZB 1K8AT 2AJ2A 4V19J 2XQCA 3R7BB 1RWNB 5KFXA 3BY5A 1C0TA 1D9FA 4B9VA 4BRLA 4BREA 4QOTA 4JV5F 2GUPA 2FJAB 4Z2XA 1IR2A 4TXSA 3W66A 1NBEB 5D77A 1TFWA 4FJGA 2L08A 4FM0A 1S1TB 2D74B 4OZ2A 3FZLA 4G1QB 1RHRB 4O23A 2DYAA 3UWTA 1HBMB 5F8MA 1HNXJ 1SB6A 1NK9A 1FD2A 2DKOB 1KTVA 4UY8O 2DY1A 5DM7Q 2XI2A 2KL8A 4PKGA 4FVUA 3I82A 4JI7J 3CYMA 2BRKA 2JHEA 4NB4A 1G6BA 3ZSZA 3AVCA 1Q9XA 4ZLLA 3R1HA 1XWLA 1ROFA 3G2XA 4Q2MA 3VVUA 1WJ9A 2HBQB 5HQMA 4X2BA 2UXCJ 4BRGA 1QAJA 4FM1A 3HULA 1XBWA 4H4MB 1Q53A 3NCRA 5D78A 3EKUA 3VQ9A 1VQ4S 2EI5A 2IBKA 4LR8A 1RWXB 4OX8A 4DL2A 4P74A 2FJDB 5HBMB 1DY3A 1X5OA 2DNRA 2U1AA 1W7AA 1HNVA 2YNGB 3THVA 4QPTA 2XB2D 4QIEA 2ZHAA 4I2PA 2WOMA 1NHVA 3BH6B 3PRBA 3SCJE 1J53A 5K14A 4PG6A 1FK9A 4O0NA 2H4YB 3OLAA 1EHWA 4FYYB 3IRXB 3W5XA 4D3HA 4J9KA 4YY3K 4IG3A 3N4WA 4RG8A 3U3GA 4K4XA 2ZJPL 4AILC 3NNHA 3W1YC 2G8UA 5C2DA 4PWWA 4ZVGA 1J5EJ 4AXIA 4YEAA 3KDNA 1JXEA 3NHGA 1QHAA 1VRUB 3C6AA 4DL3A 2MZ1A 3DHXA 2A0FB 5J2QA 2OCEA 4GKJJ 2XGPA 4LIRA 1OH8A 2QA4N 1CXUA 2BBEA 4R8UB 1QE1B 1RT1B 5A6PA 4ZVPB 4FN5A 4ENOA 3I55S 2CJ9A 1HQUB 4NYOA 3T1HF 4BRMA 4C23A 4HACB 3AA3A 3EICA 2IMWP 3T1YK 4ZCKA 4MKYA 1D9AA 4LY7A 2FC0A 2P8IA 3D0IE 4DTXA 3ETOA 4H5VA 4LF2A 4AE5A 1V3ZA 2E7XA 1S76D 4A8KA 2YHWA 2KN4A 4FLWA 1XN9A 2HVIA 1YLXA 3O5TB 1PYSB 1Y3JA 4DSIA 2YJFA 2GGPB 5B0AA 5DJBA 1WNEA 3MM7B 3LQVA 4RW7A 5D4LA 3S8SA 4NRUA 2Z0GA 3GCWP 2QT7A 4CESA 5LXRA 1X4DA 1VC6A 4BWJA 3DLKB 3D45A 4ZPAA 4M5NA 2YKQA 1Q7LB 4Y2AA 2EWSA 1C1CA 3M7VA 1BHLA 3UN5A 3N6NA 3D54A 3G82B 1AA1B 1CJKB 3U1MA 3OL6A 2HFOA 4E1NA 4X4NA 4ISGA 1UWBA 1BA1A 3VQ4A 1XEZA 1TL3B 3THPA 2C28A 5KT3A 4M7XA 4CFDA 1VFJA 2F8SA 2MQNA 2C2EA 4DJBA 3H46O 2OPRA 4MAKA 2MZQA 3DXKB 2RKIA 2HWTA 3R5AA 3HVAA 3E01A 2W4CA 2BJ7A 2OH2A 4B3SJ 4QR2A 3NGDA 2HQIA 3V9SA 2PZSA 3AQPA 1ASUA 4FJ9A 1ZTTA 1SJ1A 4CJUA 3UR3C 4CLPA 4LH5A 2RD5C 4H0VB 2KJVA 4JS4A 2VIHA 5T7BA 2B7CB 2RS2A 4RL1A 5KT4A 1C4AA 5CYJA 2MGZA 1B92A 3CIPA 3MXIA 4J7CA 1XMOF 4OHYA 3KZBA 1SKWA 4JKHA 3MMAA 1RI7A 1Q81O 3FRZA 3NCPA 1EETA 4NLQA 3KJVB 2VQFK 1V5VA 2B9WA 3M05A 2WSEC 2VGNA 4YN3B 4BE2A 3LDLA 3RMCA 1U2VB 3A13A 2B6AB 2XZDB 4UZBA 3FFIA 2G4BA 5IWAJ 4CJLA 4DR1K 2X74A 1NKEA 2QA2A 4ZP6A 5IC4B 5DO2A 2F63A 3QRPA 3L3VA 2BA9A 2XMJA 2QRRA 4L73A 3DLEA 3GJSB 3QGHA 4CZFA 1SJQA 1RT5A 3BPDA 4MMOA 4FCYA 1S9EA 3VR1A 4Y2IA 3SI8A 3ZSOA 3J81U 2Y9HA 2A3ZA 2HS4A 3QEIA 2AP6A 3H2UB 2W4PA 3CT9A 1Y3KA 5IT0A 3OD2A 2KJWA 1H0HB 3OVAA 3M8ZA 2E5HA 1HYSA 4NCGA 1ATNA 3GFXA 1PCAA 1TKTA 3S1TA 5GADP 4JI3K 4CJ3A 4CLWA 4OLBA 4Z7CA 2E2OA 4K4TA 1HR0J 1JCEA 4WJBA 1C2PA 2DNZA 4OI3A 3W2WA 4CJTA 1ASVA 1X4FA 1HNWF 4CIFA 3WNFA 3ULHA 4X4OA 2WBMA 4QCLA 4XTTA 1GXLA 5HVFA 4EI2A 3HTVA 1NK7A 5MLCQ 4FXVA 3IO1A 1RBSA 1MDUB 1RWKB 5KG6A 3IMQJ 4P7VA 5HK4A 4CF2A 2GWJA 3D4JA 3IFRA 3P6YC 2O67A 1J9AA 1YT3A 2HNYA 1VDHA 4JHDA 3WIVA 1LWFB 2RE1A 3RYLA 4HH1A 4OX9J 4EGLA 4LFCJ 4FP9A 3QDKA 2AHOB 3LAMA 3D1OA 2VPZB 1N0UA 1BWVA 1FFSB 2ZC3A 2G2ZA 4FZYA 4E19A 5T7LB 2DH9A 4HTUA 4LFAF 2HHWA 1LW0A 2HHPA 3V81B 3TQEA 2G0IA 4CLTA 5BR8J 4EBEA 4YOYA 5THWA 5GIOA 3ENHA 4DV2J 1M90T 4DR4K 1P6TA 3NGSA 1JJ2M 5HL7L 4M5DB 4WFNQ 2A5XA 3QMQA 4C3MA 1RT3B 3S7RA 5C2FA 1ZBLA 2FF3B 1YVNA 4BDPA 3EGWB 1B9DA 3MM8B 2HHHF 2K3IA 1HNZJ 3OSNA 1HMVA 2XGQA 3E51A 2R3VA 3CJKA 1FXLA 4CFAA 2GS8A 3M8YA 4PKDB 2P9KB 1JL1A 3QFWA 1PC4A 4I9LA 4DTRA 2BKOA 2M5YA 4O4GA 5IM0A 1QVFR 1I3AA 2G9OA 4OZ3A 5KPRA 3VMFB 4BR5A 4DZDA 4RWWA 3DOMB 3ICLA 2VODA 1NHKL 1P27B 2R7SA 5L9XA 1WLJA 4IJAA 3GIMA 4CI0B 3NDKA 1DT9A 1N5QA 2PMWA 1RWWB 4HTJA 1XMOK 4O5BA 3U27A 5H1SQ 2QTDA 1JXLA 1VQ5N 4DS4A 1S6QB 1J5OA 4BRIA 5I3QA 3POTA 5DZ7A 4KH4A 3AAPA 2DNQA 1QTMA 5LMUJ 4PL7A 3PYDA 1RTJA 3J7ZO 1Q95G 2LKZA 4FLXA 4K7QA 2VOOA 4Q0BB 4L75A 2JVOA 1IBKF 4B9QA 3RR7A 4ZVRB 5B09A 2XCAA 2YKNB 2FY8A 4WKRA 5B0GA 2HW3A 3CVKA 5D4PA 3MOJB 1S1VB 3AO4A 4OKKA 4B3OB 4ED3A 4TQRA 2F40A 1VQMS 1NB7A 3CJAA 4JKGA 3KK3B 3NCQA 1D0EA 5GAEU 1LCUA 4CGHA 1U1RA 2Y8WA 3H25A 4H4OA 4JAXA 2QC3A 3CXCR 4FXWA 1YBUA 3H2VE 2JNJA 3BBFA 3MK6A 2VPWB 1WOSA 1FERA 2RNEA 1DLOA 4MYUA 4DSEA 2AV5A 2KFYA 3M2VB 3Q7CA 4FZVA 2W4DA 1QAIA 4A4JA 3IP0A 5AQKA 4ALZA 3HZEA 4KREA 2IAJA 4FWLA 5E84A 3CC2N 2A1BA 3SFGA 3AVKA 3KMQA 1NPPA 1NGJA 3SEOA 2WZ1A 2MHEA 3ZT4A 3HZ6A 3VQ8A 2QG9B 2YWEA 1RWOB 2X6NA 3A1YG 3CO0P 2PN6A 3DMJA 1IKWB 1HBUB 2LFVA 4BGBA 4U67Q 3TQ1A 4FL9A 2R7OA 2XZTB 4FJLA 5JXSA 3M6UA 2MY7A 3CM6A 2GAHC 4H5NA 5HLFA 2LQ9A 2QLXA 2F4FA 1TL1B 4EHUA 5I3UA 4JV1A 4TLQA 4ES3A 4JI7F 4AHCA 1RU1A 3ZTQA 1HBNA 1K8AO 4C11A 5AQUA 2VF3A 5U47A 3KJFB 2CDRB 1RQ0A 2FZCB 2OGUA 1C0FA 4KV8B 4JD2A 3NGYA 1FJEB 2CQ3A 2FJBB 4DCOB 4A2AA 3G71S 1R0AB 3MM5A 1W26A 2VUGA 3UNGC 2UXCF 3V6HA 4IOAQ 1ZOTA 5KFKA 4DV6K 3EN9A 2GVDA 3T41A 1UOCA 2DR7A 5KFFA 4C9DA 1R89A 1KLMB 4FW2A 2CJQA 1BI4B 5JLHA 5CCLA 2HHHK 4C0BA 1S1UB 4DR3K 1ZH5A 2VCPA 4NPOA 1UCNA 3MEDB 2CWKA 3X1LB 3GSIA 4ZVUB 3CCSS 4F4WA 1GTHA 2ZEJA 4CTAB 2FBVA 1N33J 2FVPA 3KLGA 2W24A 5L1LA 1ELOA 1HD1A 2JLEA 4Q8FA 3LANA 3QEPA 1YIJN 1DURA 2QEXN 4F4XA 1FXRA 1J5EF 3D28A 3HSZA 4YDUA 3HVTA 4GV3A 2G2YA 1EB0A 1N52B 1WI6A 2PT0A 4P7TA 3TSUA 3H7HB 1VC5A 1RDUA 4PPDA 4DPUA 1HJOA 4GKJF 5EWFA 4JI8K 1XR5A 5D4NA 1VJWA 4CEBA 1WWHA 4OI2A 2B4PA 2HNZB 1HKBA 2VWKA 5T14A 4DQQA 3MN6A 2LMIA 1VHIA 2L9WA 1Y4ZB 1TFYA 4J5OA 5CYQB 3UE5A 4LFBJ 2OPSA 4B3MK 3CDUA 1NJIT 4EO8A 4MIAA 3TA0A 4OYBA 1KQKA 1Q8BA 1FFGB 1RK8A 2HLUA 1JXVA 3D3BJ 4CM2A 4F8RA 2AU0A 2BM0A 2UP1A 1TL4A 1RT4B 3DRPB 2YNFA 1I5OB 4WXWA 4JUZA 1N32K 1RDDA 4DR2K 4ZK7M 2J7KA 3A8EA 4M3TA 4E1MA 5AZJB 1ZBIA 1KTQA 1RCXB 2I5JB 2B4JA 3IGNA 2F3JA 1PBAA 4IRKA 5C25B 2W6LA 3HHLD 5F0XA 4YORA 1PIEA 3D2EB 4DV3K 1Y5LB 1G15A 3KHHA 4ECQA 1VQ6N 2VPXB 2NZ4A 3WEEA 2ILYA 2V8VA 2DHSA 2VFSA 3DHWC 3U7JA 2BR0A 2FY1A 1ZBFA 1SL0A 1RHMB 5HO4A 3O3FA 1QSLA 2R2UA 4A46A 2G8KA 3A3PB 4NLCA 4OJRA 3PACA 4F3MA 5C7PA 2OSRA 3M2UB 2PFDA 4PWUA 1VIXA 4LF8K 3AVAA 3FZFA 4PCQA 4L76A 2GEMA 1RGVA 1U1QA 4B3SF 3QQCD 5EX3A 2ZH9A 2B56A 1BCMA 3BBBA 4NMXA 3G0ZA 4BR0A 2V5HG 2E1AA 1GOAA 3C6UB 1RT7B 3HO1A 1YXQA 3MDQA 4HDGA 1HNXK 2DY4A 1G1XA 4I6MA 1RWPB 2HMIA 3I5CA 2DGWA 1EX4A 2IA0A 3TZZA 4CD3A 4XDDA 3PIPL 2O1PA 2HVZA 2MQMA 2RDJA 4K25A 5J1NA 1CZ9A 4X4PA 2ZWOA 4EP5A 3EGNA 3O1LA 3CCRS 5AQPA 4DL0C 2WONA 4N77A 3BEXA 3FZBA 3GG0A 5ADXA 3HVWA 2ZBCA 1MWKA 4YB7A 4TQSA 1F3FA 3M8SA 3G96A 2NZCA 2YPYA 5IWAF 3I8DA 2RDDA 3HPGA 2QN6B 4O55A 2ZM6K 4ANEA 3TVKA 3CJ7A 4LSLA 3OVBA 1YJUA 3AB4B 4BRKA 1RACB 3VESA 3CCJS 1SXLA 2DH8A 3BJYA 3M8PA 3Q24A 1AUSL 2E9TA 5B8HA 1L3VA 2Z2LA 3THTA 5KTQA 3QJJA 4DPYA 1CJTA 4ELUA 2DD8S 4IFVA 4W98A 3S9HA 3BS9A 1RB0A 2G1DA 3ELHA 5CHIA 2YQ0A 1HL6A 4FPBA 2E1MC 4ICLA 4M5KA 1HR0F 3GCXP 2KU7A 4CJWA 4P6QA 4YR0A 4QIWD 4I6YA 4DBQA 1KN6A 3K0SA 3PJ9A 4LH4A 1L3TA 4GKJK 3CD6S 1X4EA 3K0JA 4L3NA 1RTDA 3JS6A 3AOCA 3HX9A 4L72B 3PUFA 2CPYA 1L3SA 1MN9A 1CEZA 2R7UA 4CFBA 2ZH3A 3C65A 3ENBA 5KAKA 3ETMA 4B08A 1OPZA 2VG6A 3MMCA 2OAUA 1VI7A 1OSDA 1RDAA 3UB5A 2NXEA 1S0MA 1GLLO 3G6ES 3QESA 4FKXA 4OX9F 4LFCF 4LF9J 4WZMA 4I56A 2FVSA 4DPWA 2HZAA 1HNVB 2MEWA 1NMDA 3VF4A 3ZZTA 5C42A 1UJ4A 2WOMB 2XMKA 5K14B 1RHJB 1FK9B 4IEIA 3R3TA 3HXMA 3T6BA 4Y28C 4IG3B 4XH4A 1W2BR 3RGIA 2HZVA 2W9BA 4CEEA 5BR8F 2E4LA 3MCOA 4DV2F 2FJVA 3NF8A 1XR7A 2XS2A 3MN9A 4MK8A 3OBYA 1QQMA 1TV6A 2XULA 4LF7J 3IRWP 5HANA 3DAWA 4FVCA 3TJAA 4ANDA 3ASMA 2GTDA 4EIAA 5FJ4A 5J2QB 1OO0B 3PFOA 3MAQA 2JLGA 5EXWA 4PR6A 4NZ6A 1YBAA 4I7FA 2KT3A 1HNZF 5D6GA 4Y3CA 1GLFO 4L8RB 4USJC 2CQPA 2OKQA 1RDWX 5E2QA 3JTPA 2HVHA 2HNDA 3OQ2A 2MQ8A 4ELTA 4ILMA 1T9TA 2PMZD 3BF4A 2BW2A 3TUJC 1KRPA 2IRXA 1KNZA 5AE2A 4OYIA 2ITMA 3S3NA 1M90O 1FNMA 3VQTA 1G4CA 1EQ0A 2ASDA 5LSOA 4N41A 1GX6A 2PD1A 2ZKUA 4K0KK 5SWMA 4AUKA 4CJ7A 4U6PA 4RW7B 3O8WA 4ECWA 2Q1LA 3C14A 4HI1A 1FNXH 1BWEA 2W01A 3NY0A 4JYAJ 2QE5A 1R8HA 1NGAA 4KBOA 4Z37A 2MQQA 1A5WA 4DTPA 3H1VX 4KKOA 4C48A 2XZWA 2NRWA 2HBMA 3I5BA 1WSEA 4KPCA 4DV4F 5LMUF 4QW8A 2MDAA 4TSXA 3VQQA 2YQ1A 4CW7B 3F9MA 1UPMB 1RLDA 2YH1A 2PYJA 5LXYA 1UWBB 3TAPA 2DHAA 2ATQA 1U1OA 2J0QD 2I8EA 4KT0C 3SCIE 3M9MB 2ZJRQ 1BE4A 2QYCA 2PI5A 4RU9A 2X1AA 2Q0RA 2OPRB 4QYZJ 3V1OA 3WQUA 4KGXB 3AVIA 2RKIB 3JYTA 2DGSA 4CBWA 3E01B 3RRKA 1OQ6A 3HL8A 2BQ3A 3MPYA 2R8KA 5IT4A 4Y00A 2JFDA 1F2HA 2EKNA 4BLGA 3E66A 1BIZA 3LA0A 2P9SA 2F8MA 4FM2A 1SV5B 5AQRA 3MTKA 4ECSA 3D0PA 2N82B 4ECUA 3CTRA 1X7VA 3ZZOA 4R5PA 2MGZB 4C8ZA 2PEHA 2J6SA 1WBDA 3MMAB 3NOGA 2UXDJ 2YKPA 2B0GA 2HRUA 1EETB 4HWIA 3QSYB 1T3NA 3QETA 2D0PA 4M95A 4DV1K 2DGTA 4WF9Q 1SVDA 1OJ4A 3V2UC 4KB7A 3NVMA 4Y6IA 3HHLC 4KI6A 4ZJOA 3FFIB 2XY7A 3CDAA 1MROA 4JKCA 3NRBA 3C8YA 3KYLA 1VK3A 1Z6RA 4IG0A 3D68A 1JLQA 3DLEB 3O5BA 1HIYA 1JJHA 3B6BA 1RT5B 1N36J 1S9EB 3RMDA 1QVFM 3SUNA 2V8GA 2CPJA 2JWKA 4ZLNA 2W7OA 3DLLQ 4RW8A 3FCHA 3MAHA 1OSCA 3EXYA 1FRKA 2KHDA 2OP5A 3FFKB 4Z4IA 2XBPA 4AL6A 1U1PA 3QAEA 3FGVA 3W5ZA 4QS8A 3BGFA 1HYSB 4NCGB 4WYBA 2KXFA 4RNHA 5BR8K 2P5GA 4WK3A 1R59O 3SSSA 1TKTB 3WX8A 4AFFA 4TU9A 2D9OA 2JEGA 2V52B 1WSVA 2EK1A 3MMJA 1XTZA 2M7SA 2LU2A 3JSMA 4USHA 3AT1B 3D0HE 5KG3A 4W5QA 3RBZA 3W2WB 3SQ2A 2BTFA 3SFUA 1E6VA 2IJRA 2QWOA 3NAEA 2QWNA 1DTTA 1RBVA 3O9RA 2D69A 4BRHA 1T9UA 4IOXA 1LKZA 1K9MT 2YQ3A 5IV3A 3J7AN 5KI6A 4J2BA 1N33F 4PQAA 2LXUA 5DQHA 2EPIA 1KVCA 2AP1A 2HNYB 2IMOA 2OFGX 2QW9A 4HKQA 4W5TA 4F04B 5KFMA 2RIJA 2GZOA 4JHDB 2QMUB 4Y2CA 5F0WA 1JLGA 4CLFA 4NYFA 2FBXA 5AQOA 1BDGA 3AJDA 1QQNA 2AMCB 3U6FA 2GO8A 4HLBA 2J6TA 1QLNA 3GFYA 3GR1A 3MD3A 2J9EA 3OTDA 4ZP7A 2UUAK 1LW0B 3CXCM 4E7LA 4OGEA 2B43A 1KVKA 3NH0A 2ADBA 2ROGA 4F2RA 2NYIA 3IR6B 2DPIA 3LDPA 4LFBF 2FHJD 3PCOB 5AR0A 2CFXA 4LJMA 4LMZA 4IZ9A 2DXFA 2ZDOA 2XM3A 4FK2A 2WB1D 2HWHA 1P8GA 1VR6A 3AVBA 1YKWA 2CPFA 1R27B 3BSCA 4ZCLA 4IJNA 4IH7A 1Y9OA 5BN9A 3UKRA 3TR8A 1WC3A 1TR0A 3EE3A 1O6XA 3NAHA 3VPZA 4LRAA 3SYZA 5B0EA 4O4GB 5IM0B 4JK8A 2MKJA 2W25A 9RUBA 3E1YA 4WU3A 1FRXA 4PYAA 4ED5A 1FDDA 4FJ7A 5DM7L 1U47A 1NJIO 4G6VB 2VGMA 5IT9Y 3TSQA 2ZUAA 3H3NO 1U1LA 3WX4A 4BR4A 3HP6A 2OPPA 4PXCA 1N8RT 1DZ5A 1AT1B 3DRXA 4KAZA 1U8WA 2UZAA 3MM6A 3PY8A 2XWYA 4H0OA 3MEGB 1IKVA 5K8MA 4JV0A 3MPVA 4QWBA 3V6JA 2G0JA 2OTLN 4O0IA 1GMWA 4L3KA 1J5OB 3POTB 1SIZA 1KXPA 3QBWA 4YR2A 2UV8A 2BJDA 5K5MA 2HFVA 1S9GA 4ZVSB 1RTJB 4LF5J 3BQ2A 3W5YA 5HRPA 2RE2A 2IDEA 3OFHA 3C95A 2J76E 1HQEA 1Q16B 3AV9A 4M94A 4PEOA 1SJRA 5HQ8A 4IDKA 2QWRA 1RT2B 4J9RA 1XNRJ 1VQ8S 4B3RJ 2DHHA 4JKGB 2BVZA 4F3TA 3L4BC 1H98A 3PEHA 3B8AX 2A6AA 4H4OB 2OIHA 2DGXA 1JMTA 1QQCA 1MLAA 2RH3A 4LF6K 3BF3A 1WSGA 4MYTA 1U6BA 3G4SN 4FYVB 3MPDA 4GV6A 4WQ5A 4AM6A 4CD1A 3J7YU 4ER8A 4DL5A 3CCLN 3SMPA 2CJYB 1VBXA 5GAHU 1YUWA 1VQKN 2CADA 5KPZA 3VQAA 1OKJA 3N01A 1AW0A 4BE1A 4DV5J 2A40A 2OZMA 2NXCA 3GFHA 1VQLS 3S01A 1WSRA 1YHQS 1NKBA 5K8PA 3V9WA 3DMJB 3L7OA 3VAHA 4CEAA 3VQBA 3MN5A 1ASWA 1IG9A 2B51A 5KFNA 2OEJA 4M1KA 5JVGL 5HLFB 3SLCA 2RS8A 1GX5A 5I3UB 4F7VA 1O0PA 5AQSA 3MN7A 2HPUA 2ZBRA 2CZ9A 1R43A 1HBNB 3OYDA 4C11B 2JWNA 2IRUA 3S41A 3PJXA 1TVRA 5KFAA 5TKYA 1T44A 5C2GA 4CO1A 4AM7A 5JUMA 4JD2B 3GMGA 2KXNB 4I6AA 1QS4A 3B78A 1D09B 1KLNA 3ZC4A 3MM5B 3ZYYX 3JXUA 1VHFA 4M5JA 2AA4A 2MSSA 2WHOA 3QEXA 4C8LA 4DR6K 4LD0A 5ETQA 4LF9F 5KG4A 3CDBA 3EZ5A 3U8XA 3OUYA 1GMUA 4AHSA 1CULA 3L2UA 2KQ2A 4AL7A 3T3FA 4YQWA 5AQFA 1LFPA 4ED6A 4WYWA 3KKRA 2MLXA 2DCUB 3KLGB 2BW7A 1WUAA 5CH7B 4J9VA 5KFCA 1RJJA 3H08A 3HT3A 1O51A 2D7SA 3VEVA 4CWBA 4IUFA 3R1LA 3HVTB 4LF7F 5LJ3Y 4RWTA 1MU2A 1LWCA 4F3OA 2ETJA 4NXMK 2HBRB 1VSHA 3P8BB 3PO5A 4ILLA 4DXLA 5IT9O 1R7IA 3ZCMA 4DTJA 2APOA 2C2OB 3CO9A 4CGIA 2XWXA 4NLBA 2CRLA 3JQJA 4C8NA 2O8CA 2A2DA 3D9BA 3IWNC 2OPSB 4J2AA 1VSJA 2YPZA 5LL6d 1SH0A 4QPXA 1TZ0A 1M5OC 1VQ4N 4ZVOB 4ZP8A 3VGUA 4WIIA 3BSNA 1FWLA 2MQOA 2P9UA 1HPZA 2LA6A 2ATLA 1VBZA 1MMLA 2HAFA 2B9XA 4WFAL 5A2QU 3K89A 1URRA 1HUXA 1MWZA 4M63C 2YNFB 1BG3A 2UU9F 3OYIA 3KLHA 3QAUA 4OLOA 2FB0A 4OZ1A 2A42A 3SQ0A 5B0CA 1JLAA 2X7IA 3H1QA 1IWAA 4JYAF 2NPFA 3NMRA 3CCVN 2H5IB 1UEKA 1SS6A 4CE9A 3C15A 4R0EA 4YHHJ 2XMTA 1Y97A 1SH3A 1Y00A 3EE9A 3SJJA 1AUDA 1RGIA 1HBMA 4DUTA 2QLWA 3DJCA 4JI5K 2LLZA 4CO0A 3WEEB 4I64A 3KWGA 5ETLA 4Q44A 5H9FJ 2HQCA 4RBVA 2KI2A 3CJSA 1N5YB 5I3PA 3ZZZA 1P8ZA 3ZTOA 3C7NA 1JNRB 2L9DA 2HIYA 1WEZA 3CMES 2MTLA 4QQBA 2JDJA 2ZJQQ 2HBJA 1VK8A 2DK2A 3DRSA 1X9JA 4MIBA 4H4KC 2AIRB 4CZLA 1NSKL 4M5HA 1HYVA 4I6MB 1W2BM 2AJQA 2MKKA 3CJQA 2HMIB 4E1JA 4NE9C 4Q2LA 4UOCA 2CQCA 1Y64A 2UXDF 4LF1A 5CZ2A 3IRXA 5HP1A 2DNYA 3DFEA 1I51B 2VQEJ 4CJPA 2EEYA 2W8KA 4CEQA 3PW7A 2MKIA 2IM2A 3QSIA 3FCWA 3CJ4A 2GVZA 5D3GA 4FNHA 3F56A 4HHHA 1R6VA 5CE3A 3KG0A 2WONB 4FLZA 4JB8B 4H5RA 3ZETA 1WOQA 4YS2A 1T9YA 2M2BA 5GAEP 4OIXA 2B4VA 3TAQA 2YNIA 4KH5A 4OGCA 4JNEA 1XERA 1OQ3A 2DR9A 3FLCO 2RU9A 1GLCG 4B3TJ 4PYDA 2MJNA 4KBIA 4LR7A 4A62A 5FPDA 4X4VA 4A8SA 2Z8QA 2DXDA 2LEBA 1MG7A 2Z2MA 3M8PB 2KFNA 1KR4A 2XS7A 2VJUA 4E7IA 3QEWA 4BCAA 3T9NA 2JJ4D 1CJTB 2UUBF 2JFKA 4CJQA 1YTAA 4IFVB 4RKUC 4ZITA 4EHTA 1S7IA 1R8CA 4H0YB 2HFZA 4ICLB 3PXGa 3NP5A 3ZX3A 3TP2A 4FO0A 4IOBA 3ZX0A 2GGPA 4KTWA 4YY3J 3IWLA 3K5PA 3R5GA 3UQSA 1WC6A 3THXA 1RTDB 3UI3A 1OH6A 4I9QA 2D3ZA 3R5JB 1X4HA 3DLKA 4RWXA 2E66A 2P51A 5D0GA 5DQIA 4F50A 2B4UA 3VQCA 3CE8A 3ZO7A 3SDEA 4WXOA 3QT6A 3TW0A 2D4WA 3DRRA 2VG6B 1KKHA 3U02A 3MMCB 3EM1A 3KUHA 3AY0A 2KXHA 1PC5A 1RU2A 1RP5A 3KUEA 2E5LK 5C42B 3GYNA 3J80Y 4L3QA 1PKUA 1NOZA 3VERA 4O3RA 3T1YJ 1FJCA 2FLNA 1G7CB 4DU4A 3K5LA 2E8AA 3AH6A 1VLOA 4QS9A 1KS2A 2XTJP 1FJGJ 3RBEA 1SQKA 1F21A 4G9ZA 3W0LA 2AWZA 2L3MA 1BQNA 2PI4A 5KFDA 2O8EA 1K9MO 4J2DA 3HHLA 1TV6B 3W63A 3NF7A 3D6HB 1RAGB 1VSLA 3Q23A 2DVIA 4JKDA 3QZ8A 4P73A 1S59A 2DJWA 2Y0BB 1NGCA 3SUPA 2EC0A 4I7FB 1D8YA 4HUEA 2ZNZA 2YY3A 4LF4J 4DV0K 2FBTA 2P6SA 3KDOA 2HNDB 4B8CA 4U67L 5HI7A 2DR6A 3KJVA 3NVKA 4PG5A 1WNSA 3H5XA 4JN4A 2F7VA 2F1FA 1GEHA 4FJNA 1UEUA 3CJ2A 3SNNA 3R3LA 4CZCA 2PE8A 3O6QA 2DGUA 3DDKA 4X84A 5J2PA 2VHGA 4YDXA 2VFUA 4TVAB 1VAZA 3H5UA 1EARA 2PFFB 2YTCA 2CJXB 1U26A 3DXMB 1N0VC 1B64A 1B0PA 4P71A 4CJEA 3RRHA 1FRIA 2Y1IA 4YB5A 1LXJA 1T03A 4A8XA 2CDQA 2B8PA 2UXDK 1W97L 3O6WA 2L48A 4IOAL 4XDCA 2Q3PA 4KKOB 2ROPA 2B9EA 4ECRA 2PFUA 5LL6Z 1FFWB 4NA3A 1RAJA 1ZBSA 2EXUA 1KQFB 3LUYA 3Q8QB 5DRKA 3JB9k 3VAKA 5BPLA 2WSFC 3PV8A 1D1UA 4BG8A 2RRBA 3EZWA 1RDRA 5BYRA 3TARA 3MCNA 3WBZA 2IS3A 3M8RA 1IVZA 2RRNA 1F5CA 4HUFA 3CJ1A 1Y5IB 1N8RO 1XNRF 3JYTB 3M1VA 4B3RF 1N36K 3CCQS 2XSFA 2D1CA 3CD5A 1NDLA 2DRDA 3R7SB 1NGFA 3CB4A 4OO1J 4DR1J 5FIIA 3QINA 5FRNA 1RNHA 2BJ8A 5K8OA 3FZ2A 3Q8PB 1EX8A 4Z4FA 4A8MP 3NF6A 3O3LA 3OHBA 1JB0C 1NM1A 4R5PB 3DU5A 1W25A 3TX0A 2G0CA 3D7SB 2O8FA 2OELA 4DX8H 4CO5A 3U1NA 1H38A 4K8RA 2N7YA 3CC7N 2GIFA 4ITSA 3QIOA 3BDEA 2CGJA 4NCBA 1UL3A 4CH1A 4V19S 4MK7A 5A8WA 4DV5F 5FRMA 4GC7A 4ECZA 2K1RA 2FXUA 1CQMA 3HHEA 4FJIA 1OH7A 3QFUA 2HBLA 4JI3J 2DR8A 1FEEA 3IR7B 4FKYA 1RKIA 4CBXA 2ZH1A 4DFJA 1HWKA 4G3IA 3P83D 3K17A 4B8AB 1MROB 2BQRA 3R5CA 4IG0B 3KHRA 3NLCA 4FWMA 4DV7J 3ENQA 8ATCB 2H54B 2M70A 1SC1B 1VQMN 5E5NA 1Q86T 4RW8B 2BRLA 3NS5A 2ERRA 3K2YA 2FZKB 1RBUA 2CKWA 3O9SA 5KG1A 5RUBA 3N79A 1TK5A 2AJ0A 2HHSA 3J80O 3KD5E 1UA0A 1S0VA 3KOAA 2EG2A 3HYFA 4CGDA 3FJ2A 4WWSA 4ZJQA 2XLKA 3FBCA 4OHWA 4OKJA 1RWUA 4DX6A 2WFBA 1YWXA 2DISA 1UVLA 4FF2A 1CLFA 4DTMA 4QU6A 3JSMB 3LDNA 5DDPC 1HI8A 3PEJA 3RSEA 3VEWA 2LVWA 1E6VB 2GBZA 2J0SD 5JMVA 3S6EA 3H0PA 1WG1A 1A5XA 3P3DA 4DR4J 1NGGA 1FI4A 3TI0A 1XHZA 4ZPBA 3RAQA 2R7XA 2HG4A 3LW5C 1S6OA 1HWIA 4HYKA 4NLGA 4OHZA 1KD1T 1AFIA 4KB0A 4K4ZA 1QM9A 4P52A 2DH7A 2P6TA 1WSHA 1JLGB 1V6HA 2MKCA 4GNIA 1NGIA 1RAAB 1U2FA 3FEYB 4FPAA 1WOPA 3ZZRA 5EWGA 2GHWA 4YUDA 4DPOA 1RWVB 3ALYA 4F4YA 1OYDA 3PW4A 1HLWA 1X5PA 5CXTA 1W7WA 2ZNYA 4IFYA 1KONA 1RXOB 1TTHB 2M4MA 1AYEA 3VQDA 4DQSA 3G71N 3UE2A 4USVA 3M4XA 5A8KA 2QA1A 3BQ0A 2OPQA 2ZBIA 4F26A 3CW2C 4OYMA 1J2VA 5DK5A 2D5RA 3IBWA 2HWIA 4NRTA 3DI6A 4EU0A 2VOPA 3G6YA 2YWKA 3QPIA 4LF5K 2ATCB 2IHR1 3W2VA 3NGIA 2ZH8A 5KT2A 2LEPA 1D5AA 3VGTA 3NEKA 3UKRB 3GR0A 3GV5B 3B6PA 3QB0A 5DGAA 3OTBA 1IN0A 1EKEA 3PYGA 2FC9A 3W61A 3OBIA 1XNRK 3R5DA 3R7NB 3C16A 4X65K 5E0OA 1S77D 3VAMA 3MEKA 4X66K 2BACA 1IKWA 3LDSA 2F9DA 5E3RA 4YHHF 3CERA 4KH6A 2ZFHA 2V4RA 4FWRA 3ZSQA 3R6LB 3BO2A 4CK2A 1QSYA 4B17A 3L2RA 3DXSX 2K7KA 4YR3A 2OPPB 4K4VA 5AT1B 4C97A 4OYWA 3MM6B 2WW4A 2RVJA 1IKVB 1CXQA 1NK4A 4BC5A 3F9KA 4EAHD 1IKXA 1RT6A 1S48A 2QV6A 2HQGA 2GFFA 4F0MA 3RJMB 4KV8A 2J4RA 1HWUA 1S9GB 2MLZA 1U04A 2OMOA 1X9WA 2LQBA 3P39A 1GLJO 3CM5A 4TN2A 3TWHA 4IRDA 3M6VA 1S1WA 1HQEB 2QMXA 3F2KA 2HHQA 4RCHA 4BROA 2AJ1A 2FYXA 1BI4A 3LM2A 3ILJA 4IDKB 1WKLA 4K50A 2DO0A 3EO3A 2ZJPQ 4NXNJ 2OUGA 2BZ2A 1IJFB 2WBRA 1YGYA 2Z1IA 3IAS9 5GAGP 4CTAA 2IC3A 1H74A 3TUZC 1HHQA 4JKAA 2B5JA 2V69A 5CQGA 5M2PA 5A76A 2ZBPA 3RWUA 1GOCA 4FW1A 3PW5A 2HBKA 1ILYA 5ADZA 1VK0A 4M63A 4B3TF 4RX6A 4CDIA 1ZXOA 2EFQA 3CMQA 1U02A 5HSPA 3ZT2A 1S79A 4DFPA 4CO3A 2D0AA 3L3CA 4NLDA 4DV6J 2P9IA 4YDDB 2ZVSA 4O3QA 3HSJA 1G99A 3V9UA 3OBWA 5LJ5Y 2YNHA 2E9ZA 2E1PA 3A3OB 1ICEB 3VV2B 5H1SV 2YHBA 5J1EA 2KG0A 3QGIA 2KVQE 2CUYA 3EVWA 2IRYA 4DR3J 2DNPA 7AT1B 2CH5A 2YX7A 4FYWB 1FX2A 4B9UA 1I3OB 3AAQA 2XSJB 4YY3F 2F9TA 5HJXA 1TVRB 4NLSA 1IR1A 2XYGB 3RTVA 3BYRA 4FZZA 3TTDA 2BXJA 4PG7A 1UMJA 3D2EA 2FHJA 3SBMA 2LXFA 5J2NB 4Z4EA 2RQMA 2P9PA 2POKA 4UY85 3TX8A 4P2SA 4H4KA 2V6AA 2ZJRL 2V34A 4CEOA 4KQZA 2CJKA 4YFUA 3Q2SC 1NBWA 2P9NA 3OUYB 1CULB 3R97A 4LVNP 2AYBA 1K8KA 2CPIA 3TJ9A 4B3MJ 5F9NA 2AX1A 3T1YF 2PMHA 2QO3A 3QWPA 2WUSA 2HF3A 2IJFA 3NNAA 1CQNA 2QYGA 2MSTA 3QGGA 1LW2A 1FJGF 3B54A 3AJ2A 3AA5X 3HD1A 2R7WA 1KAZA 4BRDA 1SZ2A 1OY8A 4KHPJ 2LCWA 3H4BA 1G2EA 4YHHK 2LEAA 3V4IA 1CG2A 1BUPA 1H1VA 5AQJA 1LWCB 1MU2B 4W90B 4OPHA 1N32J 4IOCQ 4QR1A 4DR2J 3CD6N 1K0VA 4KE5A 4HUGA 5D15A 4EBDA 3UCZP 4JI4K 3M1FA 3NAIA 2DFEA 4LF4F 1F6TA 2UVRA 4WF9L 3MGJA 1UFKA 4CEZA 4CT9A 3H98A 2O8CB 4DV3J 1XMQJ 1H2UX 3HPHA 1LFWA 2FJEB 1HYZA 2XLJA 5DM6L 3A8YA 3AQOA 4X62K 3G6EN 2HSTA 1F60B 5G4DA 4QBUA 3Q8VA 4M8LA 2GA7A 2YHAA 3GTYX 4JKFA 3DLLL 1IXKA 1RDCA 4B02A 3DCAA 5HN0A 4LF8J 1U48A 1UVMA 2YX1A 3KLHB 1DQ9A 5LY3A 2MZJA 1JLAB 3MTJA 5FPNA 3N4QA 2CYYA 5CAAA 1SKRA 1JXBA 3C15B 5L39A 4E8UA 2R8GA 1I94J 3AHPA 2DCLA 1KFSA 2VG5A 3OYFA 4OJ1A 4RZRA 4XAKA 2VQEK 4MQ3A 5DMRA 1WC5A 3ZZUA 3MUMP 5ETPA 3OHRA 3BGLA 1ZC6A 2EFVA 2KH9A 5DS7A 4TLRA 4DUZK 3LZIA 1ZYQA 3T1AA 3SUOA 4BE0A 3PRDA 2DY9A 1T05A 4ILGB 1VOMA 3P4IA 1T6DA 4CLSA 2VQFF 4K41A 4B3TK 1UETA 3C7NB 4ETXA 4P2FA 3A8KA 2V51B 3CF5L 1LAVA 2W2OP 4FWKA 1T0TV 3PKYA 4RW6A 1QVGR 2ZOMA 2NUUG 4DF8A 3TZWA 2G13A 4DR1F 1VQOS 4YOXA 4A8YA 2ZDPA 4QWAA 3KIOA 1NCLA 1TUWA 4KJIA 3P5TL 3FEZA 3DRSB 4YP3A 1QD1A 3OL7A 2ZM6J 1T02A 3EZUA 1U7LA 3CCES 1FNOA 1D3WA 3ZNUA 2CAJA 2NRVA 4HCBA 2KO1A 5FLXY 3OS1A 4JP8A 4F0KA 4BACA 3B6OA 1KOOA 4NX9A 4B1WB 4RNMA 2A10A 4YOEA 3D7EO 5HP1B 1VIOA 5HL7Q 2QWPA 1VSIA 5EGYA 2NRRA 3JAMU 4RR5A 3PM9A 2GJFA 2GVZB 5D3GB 4CZMA 3RB6A 4UW2A 3IG1A 4JI3F 3ZETB 1RLCL 5TKWA 1IBCB 3NGTA 2IM3A 4PG4A 3EWGA 1KQSR 2BOAA 5GADU 2J9DA 2YNIB 3OTCA 4EUVA 2C22A 3O3GA 3FZKA 3LH2S 2IDOA 3GJRB 3K9KA 3KNAA 4BRFA 1P9QC 3BZQA 2E2QA 5LJVA 3SXLA 1Z26A 5AQZA 2JEJA 2HAIA 1DTQA 1YIJS 4J91A 3GIIA 3J7YP 2IIHA 4I68A 4USTA 4WQ4C 5M1PA 2X3GA 2P5VA 3JSRA 4PWDA 5GAHP 4OKEA 3KLFA 5ETSA 4B9NA 1T9WA 1FJGK 1JNZB 1UVJA 1VBKA 4CNYA 2RQ4A 3EZOA 4DTUA 2XLIA 3GE1A 3CPWR 3SQ4A 3TWZA 2E44A 2KKHA 4I4BA 1HW9A 1ITGA 2FSJA 1SQGA 4K8XA 2WC9A 4DSFA 5KFVA 4KGMA 3QLHA 2JZ5A 2WVEA 4OV6A 4ECVA 1REVA 4NYNA 3THXB 5EN1A 1UVNA 5BYSA 4DUYJ 2N4CA 2YWFA 3BV8A 1S4EA 4LF4K 1JKHA 4DR4F 1Q86O 2FZGB 4CFCA 4UQTA 3SDEB 3GV7B 4M5MA 3GONA 2CZVC 3DRRB 1N48A 4CF9A 3HFVA 3UPFA 4N8NA 4AL5A 3T7ZA 1C4CA 5HVHA 1PAEX 2R8JA 3UD4P 5B7WA 3H5YA 4M5LA 3GL1A 2QKKA 4FK0A 3ZNJ1 4Y65A 1NAQA 1EKSA 1S12A 4CERA 3KXDA 1VQPS 2MB0B 1BY9A 5DDRC 3D6FB 2IJNA 5KFZA 3K8VA 3H2LA 4FF4A 1Y0HA 1N54B 3WXMB 2YX4A 1LWXA 2A1SA 5F0UA 1BQNB 3AVLA 4K8ZA 2O8EB 3R2DJ 1QZ6A 3W64A 2KZZA 2LP4A 3HHLB 3UIQA 4C8MA 1WAFA 2GX8A 3VN5A 3QNWB 1SV5A 4K0KJ 5BRDA 1KD1O 3LDQA 4AQYK 5EX5A 2NCKL 3SV3A 4O8KA 2ASYA 2C3OA 2JLFA 3SSRA 1IR0A 1M5SA 3Q0AA 1VQYA 3H4DA 2MYFA 3UN2A 3ZX2A 4HT7A 4ISFA 4OZJA 4CH0S 1U45A 2KLAA 2HOEA 4U7UD 1IJEB 5E3AA 1MW7A 3CC4N 2Y0SD 3UR0A 4IEEA 2KRRA 1FRJA 4KGVB 3I56S 1GQEA 2GHPA 3FBBA 2ZWPA 1HWJA 3GYGA 3KJNB 4PKHA 1LK7A 4W92B 4LQ3A 4OZ5A 2HK2A 5E26A 2BMBA 4A57A 1VRTA 5J2PB 4H0PA 1ZAXA 2IVMA 1N88A 2RDIA 3IA0A 5CYMB 1U0HA 4V1Ak 4OHXA 2N3OA 1TUYA 1T03B 1VGYA 2GJ2A 2V8HA 5FLXO 1WG4A 4MKBA 4F9OA 4N56A 4CBUA 3M2RA 4DI6A 1FTCA 5GIPA 2KDOA 5GMKa 5A0YA 3QJLA 2OTJS 2HQ3A 4ZTJA 4FS2A 2MKYA 1MA9B 2GMJA 1A6LA 4Q7AA 1EIYB 1GFWB 1ZPVA 2D3UA 2NSCA 2Z1HA 4OI1A 4Y1DA 1MN7A 2JSXA 1NSAA 4OQJA 1LAWA 3ULDA 3H42A 1L3KA 2F7TA 4U7CA 1MWMA 3CJRA 4DV1J 1X5TA 1BOTO 4NZ7A 2EX3A 3M1VB 4DV7K 1IBLJ 1RAOA 4NXNF 4BRQA 3UNYA 4OJ3A 2CWXA 3PTWA 4KI4A 3VTHA 2PGCA 1Z05A 4JV2A 3KKSA 3J7Z5 3FRYA 2ASLA 4Y1CA 4E7HA 3LPYA 2ZF5O 5E3PA 5M1OA 5K20B 5H9EK 2Y3YA 5SUHA 3SAGA 2RUGA 4HL9A 2CPXA 3UD3P 3UVJA 2O8FB 1NEEA 1WKJA 2ZC4A 3O1BA 1O8BA 2W9AA 3AD9C 3N28A 4DWIA 2JC0A 3VF0B 4R0JA 3T69A 2YH0A 2E88A 5CD4H 5DZ6A 3N5BA 3RB4A 2FHOB 4CLYA 3VAGA 5G0RA 4W5RA 5A8WB 2AEMA 2K1RB 2OMLA 5HQLA 1AFJA 4KHQA 2EBEA 4CZGA 3OFEA 3N0VA 3MCSA 4H03B 4DV6F 1WHVA 5BPNA 2VKRA 1NLVA 5LSRA 3IS9A 5I9EB 1JLEA 1WORA 3M5RA 2O5DA 4ZVEA 3GB0A 3TJ8A 3DWLA 1VQ8N 4DR3F 2AYEA 2Q31A 2RJZA 1T3VA 3L95X 1ZTWA 3GG4A 3AA8A 3VF6A 4J9SA 2ZZMA 3BYPA 5KFQA 4LREA 1B0TA 3BDPA 1WOOA 4WU2A 3W8PA 1ZM9A 3KK1A 1B4SA 3CD0A 3J8AA 3QIDA 5IFMA 2ZHBA 3F0NA 5IQQA 2WB4A 1QAYA 2I7PA 4XO0A 2GQQA 2F8TA 3ULEB 3RB0A 4U9RA 1CS4A 2QL7B 3ATUA 1E4FT 2FVCA 1YI2N 4JI8F 1NMEB 2UUAJ 3RSEB 4HEA9 2R7TA 3HT0A 1BL3A 2DXEA 5DLFA 3MEGA 1VQLN 2VFVA 4AF1A 2F65A 4J9OA 1YHQN 4BC7A 1UTAA 4B3MF 3OVNA 4RNFA 3R27A 1E4GT 1WSIA 4ECTA 3WHIA 3OS2A 5BXIA 4ILJA 4CF0A 2DNGA 4NL5A 4IH5A 2DFFA 2DFHA 3TZYA 3SAHA 1HA1A 4A2BA 2DNHA 2JH3A 3HM9A 4KHPF 1C1BA 4M45A 2J6UA 1HQ2A 1U2CA 5GMEA 1N32F 4GO5X 4DR2F 1F0XA 4IFYB 1NGHA 4FOIA 4NI2A 1RT2A 4FJMA 1CJUA 5C2CA 1VQ7S 2YHXA 1M5HA 5A8KB 3CCUS 1YJ9S 1S97A 4DV3F 2OPQB 1XMQF 2RHQB 4GVEA 3IUCA 1MNEA 2HHUA 3GPAA 3DLRA 2MLYA 3DI6B 3T1HJ 1RBAA 5DQGA 2EK6A 3TANA 2LSNA 3OHAA 5AE3A 3IR5B 3W2VB 3QEVA 1O5JA 5GAGI 3VEOA 3BGUA 4XIUA 2Y1JA 4ZJLA 1RFQA 2DHGA 1QQOA 3CQXA 4JLHA 5HMZA 4LF8F 2DNMA 4GY2B 1EAYC 1WDDA 5KFRA 1RDBA 2YKOA 3HRGA 2FSKA 3MUTP 2VBZA 3VZHA 3MXJA 3C16B 4HTIA 4OJGA 4NXNK 4AHUA 2H9ZA 2HURA 5C15A 3A2FA 1I94F 3AGRA 3IFEA 4KGKA 1C0MA 3CFOA 1XNQJ 4WFBL 2DTJA 4E98A 4RUBA 3QFPA 4GVBA