2ZE2A

Crystal structure of l100i/k103n mutant hiv-1 reverse transcriptase (rt) in complex with tmc278 (rilpivirine), a non-nucleoside rt inhibitor
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of HIV-1 reverse transcriptase/TMC278 complexes: Strategic flexibility explains potency against resistance mutations.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase, hydrolase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 136
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ze2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ze2A05
1JKHA 3SQ4A 4O44A 2R8JA 3ZSXA 4FK4A 4J2EA 2YNIB 4M45A 4I7FB 4ZPBA 3DMJB 1F21A 3PJWA 4Z4GA 3I5AA 3H08A 2HVHA 3PR5B 3BSCA 3TR8A 3CG7A 4CHZA 2HHSA 5KGXA 3M9NB 4WE1A 3NAEA 1ZBIA 4RW6A 4Y2AA 3LP0B 2QE5A 2YNHB 4KFBA 4FYDA 1C0MA 3NH0A 5C42B 3KK3B 3V9ZA 3OL9A 4E1MA 4KHRA 4M42A 4J9KA 4ID5B 4ECWA 4BACA 4CJPA 3MTKA 3V9UA 4JV2A 3CVKA 4KFBB 2FJXA 2BQRA 4DTRA 3M8QB 4DL7A 1WSGA 4K8ZA 2XY5A 3DOKA 2JEJA 1J5OA 2QKBA 4KHNA 2FBXA 1JLBA 3KHHA 1CLQA 5I3UA 2XO7A 1FKOA 4PY5A 3WNGA 4KO0B 4DL4A 3NCIA 2FVQA 1S10A 1QAIA 4KHMA 4IQXA 1L3TA 4NCAA 3NKYA 3GQCA 3IGNA 2G8UA 2D0BA 1JL1A 1T7PA 3CQ8A 1ZBLA 2ZE2A 2Y1JA 4Y34A 4IRDA 4EZ6A 1VRUB 3QZ7A 1N5YB 2OPQA 3LP2B 4DSEA 2HNYB 1EETB 4CJKA 5F8LA 3PX6A 1S48A 2UVRA 1D5AA 3KLIB 3SYZA 3S3NA 5KFTA 4NLUA 1C6VA 3NF8A 2HAIA 4IFYA 3Q8PB 5CZ1A 4JUZA 1J9AA 3SFGA 4ZPCA 1RNHA 3KLEB 1BQNA 1C0UB 1N6QA 4WXOA 1S1WB 4ECTA 3V9XA 4Z4HA 1C1BB 4QW8A 2IAJA 4KTWA 2IC3A 4M3ZA 5L1LA 2GBZA 4HUGA 4CJ3A 4IFYB 3TWHA 4B9TA 4ZHRB 4KRFA 3KLEA 1N6QB 3FQLA 3MEGB 2NUBA 3KLVA 3Q8QB 3SPYA 1RA6A 1LW2B 2IC3B 1D0EA 3M9OB 1TKDA 4OGCA 3OYDA 2IA6A 3OHAA 4C8OA 3T5KA 2RPIA 1Q8IA 2WTFA 4FLYA 3RMDA 3FSIA 1MU2B 1S1XA 5DG8A 3V6DA 1T03A 4CHPA 4C8MA 5F8HA 3NBPA 2IDOA 3DDKA 1HPZA 1KVBA 3TAPA 3GYNA 4K4TA 1Z25A 3AVIA 3HVTB 4M3WA 4H4OA 1S1VB 4DQQA 2ZQBA 4FJKA 4H4MB 1A5WA 5KG0A 3VQ4A 4E7JA 2HNDB 3UQSA 4C8LA 3KLFA 4ED0A 4DSFA 3FQKA 3VQ5A 1SKSA 1BI4A 3LP1B 3OSPA 4CFBA 3QINA 1D9FA 4K4XA 3LAKA 1QUVA 1BQMB 1IKWB 3C6TA 2W8KA 2R7YA 2XY7A 3NH2A 1FKPB 3L2QA 4CGJA 4K4SA 2Z1IA 3QIOA 1T94A 1RDBA 2RF2B 1TVRA 2WOMA 4HVJA 1JLGA 3AV9A 1RTIA 4KI6A 3MFHA 2RDIA 4F2RA 3ZSWA 3HVAA 2OPSA 1C1CB 2YHAA 2VG7A 4FM1A 2HB5A 3EZ5A 4O44B 4WYWA 3CFOA 3O3HA 3F73A 3HKWA 5DGAA 3QEWA 4DL3A 1TVRB 3KK1B 1RT1B 1I39A 1JLAA 4I2QB 3V1OA 5HP1B 3V4IA 2FVRA 2FBVA 2A1SA 5J2QB 3T19A 3E01B 3S3MA 2IJNA 3LP0A 3N6LA 2FC0A 3DYAA 2ITGA 3BGRB 2DPJA 3QLHB 1ZYQA 4YNQA 4DTXA 3V6KA 1NK4A 4QPXA 1CZ9A 4CE9A 5C42A 2X6SA 1Z4UA 1UWBA 3KLHB 4TQSA 2AGOA 3CJ4A 2FJVA 3LPTA 4N56A 3ITHB 1UOCA 4DTSA 1X9SA 3KLIA 4YR2A 1TAUA 1WSFA 2W9AA 3PO5A 5K14B 3KLHA 3QEXA 3CM6A 2E6LA 1NK9A 3H2LA 1Q9YA 4Z0UA 3RRGA 2Z1JA 4FLUA 3V1QA 3G6XA 3MECB 2R2SA 4N5SA 1S1WA 3V81B 1QSSA 1C1BA 2RKIA 3PJXA 4ZTFA 1IG9A 4LSNB 3VQ6A 3CDEA 4N47A 4R8UA 1ASVA 5K14A 3IGVA 1HQEA 5D3GA 4DL2A 5KFVA 1NK0A 4WFXA 2KFZA 3L3VA 4ZHRA 2D0AA 1FK9B 3G10A 3M8RA 2FJWA 3O3FA 3QESA 2YNGB 3NDKA 1CSJA 2IOCA 4EBEA 4DQPA 5J2NB 3KJVA 3HM9A 4J9OA 2YKMB 2GIRA 1HQEB 3C6UA 1X9MA 2O4IA 1XR5A 3ICLA 3HPHA 3EYZA 4RG8A 3AVNA 1N56A 3BQ1A 4DF8A 5HBMB 3IG1A 4OPJA 1BQNB 2KTQA 2F8TA 5KG7A 4CGIA 4EP5A 3H40A 4MH8A 3KHRA 4PUOA 5CYMB 2IAJB 1LWEB 1HMVA 4DFPA 3MEEB 4FZZA 4B9SA 1RDAA 3HVTA 4E89A 4H4OB 3ASMA 3LP3A 1B9DA 4JS4A 3TI0A 2V0NA 3O4QA 1T05A 2UUTA 4G3IA 3LANA 3LPUA 4DEZA 1KFDA 1TKTB 3KD5E 2KZMA 3ZT4A 1BIUA 2P51A 3AVMA 3VQBA 4FK0A 3MFIA 5L1JA 4ZPDA 3B6OA 3AVGA 1U45A 3K5OA 3KMSA 2VA2A 3K59A 1D8YA 2HHTA 1S5JA 2I5JA 4ELVA 4KB0A 4IOBA 5KFIA 1JLGB 3OYNA 3RB6A 4CJSA 2UVUA 1IKXA 2JEGA 5KFJA 3C94A 4Z4CA 2XRIA 4F3TA 4E7IA 3CJ3A 4IG3A 1LAVA 1TKXB 4H4MA 2I1RA 4QWCA 3AVLA 2XWYA 1RBRA 2X74A 2FLPA 3RWUA 4NLOA 2J6TA 4FLZA 2JC0A 5KG2A 5C25A 3H5SA 2QXFA 1VSMA 3ISND 1TK5A 4I7FA 3JSMA 4K4WA 4CJQA 3PX0A 4B9UA 3SPZA 2XI2A 2B5JA 2F96A 3PV8A 3NHGA 3NE6A 1IO2A 3HL8A 3GV8B 3I5CA 4EBDA 4ZVEA 2D5RA 4DFMA 3QEPA 1NHVA 4B3OA 4IR1A 5HROB 4CEFA 3HT3A 2BQ3A 3DLKB 4N76A 3KNAA 3L2UA 4FM2A 1ZBUA 1RT7B 3DI6B 1NJZA 1YTUA 1GOBA 5J1EA 1S0NA 2HHXA 1Q9XA 3RB4A 1TL1B 4ED1A 1REVB 4CEOA 1NJXA 4CERA 3V4IB 1A5VA 3LWMA 5KFLA 2YNFB 3PW7A 4NRTA 4Y2CA 2WCXA 1TAQA 4TY9A 3KMQA 3JYTA 3DYAB 1WAFA 3OS1A 3V6JA 2ATLA 5L1IA 1TP7A 1REVA 5F9NA 4ZMMA 3PW2A 2YNFA 4H8KA 4O55A 4NZ0A 4DQRA 2IBKA 1TKZA 3H98A 1FKOB 4CFDA 3NH1A 4F8RA 3NF6A 4ZP6A 4NRUA 3GV5B 2HW3A 1RBUA 2HVIA 1BCMA 4IDKA 3NAIA 4QWBA 3ZCMA 4M95A 5JS2A 4BDPA 3ZT0A 1TL3A 1VRUA 1S1TB 4QWEA 3PX4A 4F2SA 1JXBA 1T8EA 3C95A 1KLMA 4GC7A 4CF8A 4IBNA 2RKIB 4DTPA 4O0IA 2DFFA 4W5NA 3I5BA 1Y97A 4EBCA 4FJ5A 3MXJA 1TL3B 1TGOA 1WNEA 3RTVA 1C0TA 2AQ4A 5HLFA 1T05B 5KFOA 5CYQA 3KK3A 4YQWA 3OYEA 3NMAA 3DOLA 3IRXA 5KGWA 5DGBA 2KQ2A 3ZSZA 4E7LA 3KJVB 1U4BA 1C2PA 4M3XA 4NLYA 4Z4FA 4K4UA 4ZVHA 3MXIA 3SUQA 5I42A 2A1RA 4YFUA 4ICLA 1Z26A 3HJFA 4AILC 2D3UA 1NK8A 3LALA 3NFAA 3K58A 2B6AA 3OSNA 4AHCA 3TVKA 4O3SA 2CKWA 1XI1A 4CEQA 1KVAA 1K6YA 3ZT2A 5KG5A 1HMVB 3QNOA 4EP4A 5KFHA 3NF9A 3KKSA 3UDLA 4BDYA 4DSKA 1NJYA 4ID1A 3TAQA 3TQ1A 4O3RA 4DF4A 1T03B 4FLVA 1WSJA 4KHUA 1TK0A 3RMAA 1RT2B 4M3YA 3NF7A 4RW4A 1JLQB 3LP2A 1YVUA 1D9DA 2XCAA 1SKWA 4OKJA 1QE1B 4XPCA 2HHVA 4W5TA 4Y1CA 3JSMB 3G6YA 4IH6A 3BREA 5KT2A 5KFXA 1RT2A 4RUAA 3ZT3A 4CJUA 1XC9A 2ZD1B 2XCPA 2ASJA 4ECXA 1YTAA 5KFMA 3NL0A 5F8MA 4IG3B 4ZP8A 3SNNA 1CXQA 2B43A 5EWFA 3S9HA 4YR3A 4KHWA 3M8PB 4KHQA 4E0DA 2R8HA 2EC0A 3P1GA 4OPKA 3LP1A 3AA2A 2R2TA 1QHTA 3OYAA 1UAXA 3P5JA 4MK9A 3KK1A 5F9LA 1RCHA 3OHBA 3HYFA 2W9CB 1UA1A 1U48A 1HJRA 3MR5A 4KI4A 1GX5A 2C22A 4ECYA 1QTMA 1RTIB 1SUQA 3THVA 3L2RA 5FRMA 4AHRA 1ASUA 1C1CA 1RILA 3WNEA 4CGHA 1ASWA 3OS2A 1HYVA 5KFYA 3IS9A 1RT7A 3DI6A 1ITGA 4YR0A 4O3QA 2AGQA 3UIQA 1JLFB 2HNDA 5DQGA 2W8LA 1EP4B 3VQ9A 5KI6A 4RW7B 4ECSA 3V9SA 1KLMB 3U3GA 2BANB 4R5PB 5DK5A 3T5JA 1SV5A 4C8KA 3RMBA 2OPPB 4M3UA 4O3OA 5KT5A 4DL5A 3RB0A 4B9LA 5KRSA 5KT6A 3TAGA 4URQU 1C0TB 3CJ0A 5HRSA 5JUMA 2RF2A 2JGUA 3U6FA 2Y1IA 3I0RA 2YKNB 4ECUA 4FBTA 3K2PA 4AH9A 3MAQA 2UUWA 4O4GA 4EO6A 1LAWA 4RW6B 1LV5A 1HYSB 3ZSQA 3AA3A 4B08A 2OPPA 1X9WA 2HMIB 1NK6A 3G86A 3BSAA 4U6PA 3ISNC 5KG1A 2HNZA 4YP3A 1W25A 1FXXA 4NLDA 4LSLA 4Q8EA 4KBIA 4MK8A 4HUEA 2E9RX 3VQ8A 2YNIA 3OJSA 4RW9B 4IKAA 5KFQA 3QETA 1C1AA 4GVMA 3CWJA 2R8GA 4ZP9A 1LW0B 3RAXA 2J6SA 4NYZA 3OYFA 4B9VA 1JLBB 3CFRA 3OYKA 2BRLA 4WE1B 1FK9A 4NCGB 2V9WA 1NKBA 1RT4B 2RDJA 4RW4B 2G8IA 1VSHA 3QNNA 2V4RA 4I2PB 3EZUA 3GILA 3BR9A 4FJLA 5J2NA 3AA5X 1BCOA 4XPEA 4YMEA 3KD1E 3O4NA 1WSEA 1KHWA 3HO1A 4ECRA 4F3OA 4NCBA 3DRSB 4KV8A 3TAMB 3IAYA 4JV0A 4ED3A 4IKFA 2IS3A 2YHBA 4QCLA 4HKQA 2P1JA 1XHZA 3SUOA 2IM2A 4IRKA 3AO2A 4TQRA 3WNFA 3RAQA 5FRNA 1SL2A 5F8NA 1HQUB 4KV8B 2W7OA 4KPYA 1S4FA 4E19A 4DTJA 4DTOA 3TARA 5J2PA 1RTJB 1U04A 4OKEA 3L2VA 2PY5A 2AU0A 4KO0A 4E7HA 1RYSA 3KTQA 3PY8A 1KRPA 2XY8A 4JRPA 4KHSA 3CO9A 1VRTA 3KK2A 5F8JA 4RUCA 3VQQA 5KFDA 3QERA 1RYRA 3CJ5A 1WNSA 2BRKA 2E4LA 2OPQB 3NGZA 5L1KA 3ALYA 3AVKA 4CESA 1SUQB 4Q5VA 4NLGA 5CZ2A 4PUOB 4FLTA 2XY6A 4KB1A 2XC9A 3DRRA 3VQCA 3K5LA 4M3RA 2E6MA 3BJYA 1RT5A 2IGIA 4BWJA 3IS9B 5EU7A 4FZXC 1VK0A 1W9HA 5C5JA 3RB3A 1NKCA 4B9NA 1S1XB 3MF5A 1TQLA 1HARA 4FCYA 3HPGA 1RTHA 5EWGA 3T3FA 3OVNA 4J9SA 2BANA 4R5PA 3FFIB 1S97A 3QEIA 5KTQA 3N6MA 4CHNA 2W9CA 3QEVA 1BGXT 4WXWA 3H5XA 2D7SA 3GIIA 4Z4IA 5F8IA 1NJWA 3ZSOA 3TANA 4BE2A 5KFKA 3SFUA 4F4WA 2DFHA 3OYGA 4ECQA 1IKVA 5EDWA 3C6TB 3V1RA 1U09A 4EZ9A 4O3PA 4IH5A 3OYBA 1S9FA 5KT3A 4CHOA 1BISA 5DQIA 1T3NA 2E9TA 4MFBB 4FLXA 3TAEA 5T14A 3H4DA 4TY8B 2WOMB 4CGDA 4BDZA 5C24A 1RAJA 4CF2A 3CIZA 1RT6B 4FZYA 4ELUA 1MMLA 1JL2A 2BDPA 3PHEA 4LH5A 4KE5A 4Q43A 2C2RA 4RW8A 3KIOA 4ED2A 3M9MB 2WHOA 1R0AB 3T5LA 3SJJA 4URSA 3QIPA 1LW0A 4JS5A 1JLAB 4QWAA 2OZMA 4EYHB 1D1UA 4PWDB 2F8SA 1KFSA 1DTTA 3BQ2A 4J9QA 4O4RA 2ZE2B 4CEDA 1RT6A 1TKZB 1I6JA 4CEEA 1HYSA 4DTUA 1ZTWA 4URGA 1I3AA 1R0AA 3VQ7A 2E9ZA 3OYLA 4ED6A 2DY4A 2IM1A 4FJHA 5J1EB 3QO9A 2XHBA 1RT3B 3NGIA 1ZBHA 3LZIA 1LWCA 2BGGA 1DTTB 3FRZA 2O5DA 3SQ2A 4IG0A 1X1PA 3TABA 4W5QA 2FLLA 3CDUA 4FVMA 4TN2A 5KFUA 4XO0A 2QKKA 5I42B 2FVSA 4ICLB 4KB7A 4Y1DA 1U47A 2PYLA 3OYHA 4DQIA 1S0MA 4IRCA 1S6QA 3L8BA 4I2QA 1HQUA 2LSNA 1QSLA 1HNIA 3MEDB 4JV1A 4K4ZA 4J9NA 3GV7B 4C8NA 4E7KA 5J2PB 3VN5A 2IJFA 2IM3A 3BDPA 2FVPA 1S49A 5KFRA 3MR3A 2FVCA 4K8XA 1KLNA 4MIBA 1EETA 5KFBA 4I2PA 4HCCA 4KAIA 4ZTJA 3EPGA 2XGPA 3SCXA 3KK2B 3MXMA 3MEDA 4IDKB 4ELTA 3SI6A 4MKBA 2GV9A 1J54A 4CEBA 3MR6A 4UQGA 2WRMA 2YNGA 2HWIA 4ZP7A 5KFFA 4DSJA 3RR7A 1RTDB 4QW9A 2C2DA 3I0SB 2G8KA 3NGYA 1RT5B 2D0CA 4RNHA 4CF0A 4GMJB 1IKYA 4KSEB 3IG1B 5HLFB 1JXLA 1RTJA 1JX4A 3MEGA 4FW1A 4F4ZA 3VA0A 3V81A 3KOAA 4QOZB 2ILYA 4DQSA 4R8UB 2BE2A 5EUHA 1LWFA 3SUNA 3QGHA 2PYJA 5HRNA 4FJNA 1YVFA 1RDRA 3TAFA 4FJXA 3AO1A 4TSXA 3NAHA 3V6DB 4W5OA 1WSHA 1HPZB 3AO5A 1QSYA 4J2DA 4WZMA 3NGDA 1LWFB 3AVHA 4CGGA 4KAZA 3AA4A 3HPOA 2P5GA 4NLSA 4HHTA 4W5RA 1L3SA 3DRPA 2OPRA 4NLWA 1BIZA 4DSLA 1SL1A 4RU9A 4J2BA 3PW4A 5HP1A 4MIAA 1BI4B 4GW6A 4HCBA 2OYQA 4FM0A 3QIDA 1JKHB 2WONB 4Q0BB 1IM4A 3BSOA 3RMCA 4KHYA 2QK9A 3LDSA 3FFIA 1WLJA 4CHYA 4RW8B 2P5OA 2DFEA 3DRPB 4ZVFA 1CZBA 3QLHA 3OS0A 2OPRB 3H5UA 2KZZA 3VQSA 1EP4A 3LWLA 3SUPA 3H59A 4DSIA 4FK2A 4PWDA 1UWBB 4CJ4A 4JRQA 3UPFA 4CJRA 4KREA 2B4JA 2Q3SA 5JXSA 3ITHA 4G1QB 1RDCA 1GOAA 1JLEA 4FJJA 3D5MA 3O3GA 2YKNA 4I9LA 1QQCA 1XWLA 3KHLA 4O4GB 5J2QA 2AX0A 1IKXB 3LZJA 3E01A 3A2FA 5KFNA 4EO8A 2HMIA 1S1UB 3BGRA 4G1QA 3QZ8A 4CJEA 3IN5A 3ZSVA 4CK3A 4LQ3A 5T7BA 1SKRA 3DOKB 2OA8A 4CCHA 2HNZB 4RNOA 1KHVA 1S6QB 3OYJA 4O3NA 4FJIA 3QGGA 3U3YA 3VQDA 3SQ1A 5I3UB 1HNVB 2O4GA 3HP9A 3BQ0A 4OJRA 4OLAA 5CY4A 4DS4A 1NHUA 2YNHA 1TK8A 3PVXA 2UVWA 4KTZA 4DTMA 5KG3A 3QO9B 3C6UB 4PQUB 3SV3A 3SV4A 4CK1A 3OLAA 1HNVA 3AO4A 4ID5A 1QS4A 4IG0B 4CIEA 4CEAA 1N5YA 4LY7A 5KFPA 3MECA 4K50A 4NLQA 4DMNA 3M8QA 1ZETA 3M8SA 1RBVA 2AJQA 3V6HA 1SV5B 3EY1A 4OL8A 3E51A 2ASDA 2JC1A 1CXUA 2VG6B 1IKYB 4HYKA 1S1TA 1L3VA 3FDSA 4IFVB 4BE0A 1C0UA 5KFZA 1B9FA 2WK4A 5DG7A 3ZSRA 1OS5A 4B8CA 3KLGB 3ULDA 2ATQA 3JYTB 5KFAA 1SL0A 1RT4A 3DLRA 1DTQA 4J2AA 1HRHA 2G8WA 3KKRA 3DLBA 3AO3A 2BE2B 1VSLA 2AX1A 2BQUA 3HVWA 4LD0A 2PZSA 2W9BB 5DLGA 3UR0A 5KFEA 4LH4A 2G8HA 4O5BA 1ZBFA 2FBTA 4CJFA 2BR0A 3HSTB 2X6NA 4DL6A 4RNNA 2XGQA 1KCFA 5JS1A 3B6PA 3DM2A 4KKOB 2IM0A 1DLOB 4NLRA 1L3UA 2YV0X 2KFNA 2AWZA 2Z1HA 3AVAA 3OYIA 2EHGA 1S9EA 4RNMA 3SQ0A 4DU3A 3GIKA 3K5MA 1VSDA 4I9QA 3PZPA 2IMWP 4NCGA 3PW5A 2GUIA 3CFPA 4CHQA 3D0PA 4B9MA 4KKOA 4OLBA 3S3OA 2HNYA 2WONA 2Z1GA 4KTQA 2D3ZA 2WB4A 1S9EB 5J2MA 2J6UA 5KG4A 4K4YA 4Q8FA 4AHVA 1A5XA 1VSKA 4FLWA 3CM5A 3DRSA 3L3UA 3DOLB 3IRXB 4QAGA 1NOYA 3DLEA 2G8FA 4J9RA 2JEIA 2R2RA 4XIUA 1SH0A 4CIGA 5HROA 3HXMA 1S0OA 4CGFA 4FXDA 1S9GB 2EX3A 3DLKA 5KG6A 4DS5A 5DMRA 4CK2A 4PA1A 4CFCA 4R0EA 3H4BA 3F9KA 1WN7A 2RN2A 5EWEA 4FJGA 3OYCA 4IR9A 1IKVB 3OL6A 3ZSYA 2X78A 5L9XA 1RTHB 2AGPA 5C25B 1W0HA 4Q0BA 5SZTA 4MQ3A 3GIMA 2JLEA 4MFBA 4CJVA 3H5YA 1EX4A 5KRTA 4ZVGA 4Z4EA 4FS2A 1RT1A 3PW0A 5SWMA 1JLCA 1JLQA 4HUFA 3KHGA 1SH3A 5F8GA 1BQMA 1K1SA 3HP6A 4F4KA 1UA0A 1GOCA 2F8EX 4HTUA 3QYYA 3AVFA 2VA3A 1NKEA 1S1VA 3P83D 4PQUA 3HK2A 4ECZA 1TL1A 4DLEA 1VSIA 4NLTA 2UVVA 4X2BA 1KVCA 4DFJA 4DG1B 2OPSB 2GC8A 3OLBA 2VG7B 4WZQA 3KLFB 4CIFA 4Y3CA 4H54A 1NNDA 3QGIA 2JEFA 1IKWA 2R8IA 4ECVA 2HHQA 4AHUA 2W7PA 1FKPA 4Q44A 1LWCB 1KSPA 3DMJA 4TYBA 1XR6A 4DG1A 3QIPB 2ASLA 3G6VA 3DLHA 5KFSA 3RBDA 2CJQA 3OY9A 3CDWA 5FDLA 1DTQB 4EYIB 4LSNA 4NLXA 2R2UA 4J9PA 4Q45A 1VSFA 4E3SA 3T1AA 2OZSA 4NLPA 1O1WA 2W9BA 1VSJA 1JXEA 4TY8A 1RT3A 1YT3A 4M41A 4DU1A 5C24B 4CF1A 4MK7A 3RBEA 4CECA 5KFGA 1QAJA 5KT4A 3DM2B 4ZPAA 4K4VA 1DLOA 4IH7A 5HRPA 4DLGA 3K57A 2VG5B 3T5HA 1S6PA 2VG6A 4OVLA 1XHXA 4TXSA 3AVBA 4FW2A 5CYQB 4IFVA 2V4QA 2DTUA 3D45A 4WFZA 4RW7A 1HYZA 2FLNA 1JIHA 4N41A 3OL7A 4FJMA 3KLGA 3CYMA 1RDDA 3PUFA 3MR2A 4WFYA 2HHUA 1WAJA 4RZRA 4E1NA 3I0SA 4M3TA 5HRRA 3MEEA 4TLRA 4NYNA 4CEZA 4RW9A 2VG5A 1S6PB 4J9LA 1QE1A 1TV6B 4FJ9A 5J2MB 2G8VA 4F4XA 4CFAA 4LQ9A 2C28A 3GIJA 3AVCA 3AVJA 4NLVA 1TKTA 1EKEA 3RR8A 2B6AB 3I8DA 4J9MA 2QV6A 2ZD1A 4DTNA 5KT7A 4RNFA 1B92A 1TV6A 4EEYA 3LAMA 1S9GA 3VQPA 2ILZA 3K5NA 4NYFA 5DG9A 1J5OB 1K1QA 1VSEA 5DLFA 5D3GB 4M94A 2XI3A 3G0ZA 1IH7A 1HNIB 2FBYA 4LSLB 1NK7A 3M8PA 2HWHA 4CF9A 1LWEA 3OJUA 5DQHA 4FBUA 3VA3A 5KFCA 2GIQA 2VWKA 4CJWA 4BE1A 2C2EA 2YKMA 4MKAA 1ZTTA 2W42A 1WSIA 3V9WA 3DLEB 5HBMA 1GX6A 3EPIA 3PO4A 2ALZA 1RTDA 3L2WA 5CYMA 3PR4A 1VRTB 1J53A 4O0JA 3N6NA 4GC6A 5KFWA 1N48A 2ETJA 4AHSA 4JLHA 3TAMA 4CJ5A 3ZT1A 4DFKA 1JLFA 4ED7A 3SZ2A 2DPIA 5E41A 3NBPB 1RBSA 1NK5A 1L5UA 3DRRB 1U49A 1N4LA 3Q8SB 4U7CA 4AHTA 3DLGA 4QWDA 1JLEB 1XR7A 3RRHA 4F4YA 3VQAA 4F50A 1BL3A 4CJTA 4FJ7A 1JLCB 4TYAA 2I5JB 2ZKUA 4CJLA 1KTQA 3WNHA 5FROA 2KW4A 1NOZA 1LW2A 3I0RB 3D28A 3OYMA 3BSNA 3OL8A 2OH2A 4OGEA 1RA7A 3DLGB 1S1UA 4L8RB 4OKKA 5FDLB 2B5JB 4WYLA 3VQEA 2HHWA 1G15A 1EXQA 1RBTA 4FS1A 3SI8A 4BWMA 1MU2A 1TKXA 4ED8A 4FJ8A 2D41A 3CJ2A 3Q8RB 2R8KA 4B3OB 4B8AB 4DWIA 3HVRA 4DU4A 1SH2A 1BHLA 2VWJA 3HHKA
chains in the Genus database with same CATH superfamily
1JKHA 1IN0A 1WTBA 1JCGA 3GR1A 2CJKA 4LF5F 3ZZOA 1BA1A 1F21A 3I56N 4KRWA 3TJ9A 1F5CA 3PR5B 2F3JA 3EL2A 4WE1A 1SQGA 4PPZA 4AYBD 3LP0B 2UUCK 2FYXA 4ZS6A 4QU6A 2HQIA 2G9OA 5MLCQ 3A1YG 4V19S 3H8YA 1C0MA 3KXDA 1S99A 5EX5A 3ULEB 4E1MA 4KHRA 1X8DA 3MTKA 3PSIA 3V9UA 2OAUA 4A8FA 3CVKA 5LSRA 2FJXA 2BQRA 1CLFA 3CC7N 4DL7A 5H9FK 2OANA 1J5OA 1RHKB 2UUBK 1JLBA 2DGQA 1W2BM 3H1QA 4U9RA 1IM6A 2EC2A 2ZM6K 2XO7A 4A57A 2DNYA 4NI2B 1SJ4P 3IR7B 4PY5A 2DISA 5DDPC 4JI5F 4H0VB 2MMYA 2HBLA 1I3OB 2B3TB 2FVQA 2BUPA 1H72C 2XMKA 1WEXA 4YOVA 4NCAA 5LL6d 3NKYA 2BE9B 3DKDA 2G8UA 4DR3F 1T7PA 3TTDA 1ZM3A 2DEIA 3AQPA 2NZCA 4IRDA 4EZ6A 4WPAA 1IJFB 2D1CA 2AV5A 3ULHA 3O08A 3LP2B 7FD1A 1M5KC 3FMBA 2DIVA 3OFFA 1YWXA 4PG6A 3SYZA 4XTTA 1WOQA 3S3NA 5KFTA 1YJ9S 3KZBA 1OSDA 4USHA 5HL7Q 3NF8A 2D3O1 2ZUAA 5EX0A 3Q8PB 3C19A 4ZPCA 1RABB 3MUMP 4B1YB 1C0UB 1IBLK 1T95A 1RB0A 3OA9A 3DGPA 2IVNA 4ECTA 3V9XA 3HFVA 2IC3A 3LO3A 2IVOA 4NE9C 3F41A 3TWHA 5GADP 1BXNA 4FOIA 3EE3A 4UUWA 3R7SB 1T9VA 2P9KA 3MEGB 3CJKB 2NUBA 3SSRA 4LREA 1D8ZA 3P31A 1FNXH 4NASA 1JCFA 1XMBA 2GCFA 1AZSB 3OYDA 2IA6A 3OHAA 2RPIA 3CPWM 3FCWA 2DGVA 1ATRA 3ID8A 4DR6F 1MU2B 4YB1P 4MIWA 5DG8A 3SAFA 3JS6A 4CHPA 3VEYA 3SCIE 2IDOA 4PG5A 2FC9A 3DDKA 4CW7B 1KVBA 3TAPA 1L3KA 4QU7A 3AVIA 2QRRA 2W4DA 1U26A 1PSDA 1FXRA 2RHQB 2A40A 3QRQA 1A5WA 3VQ4A 1VQLN 1TUUA 3E1YA 2JFDA 1MWQA 4WP8A 2C3MA 4A48A 1IKWB 4I67A 1Z1ZA 2R7YA 4OZ5A 3NH2A 4ZLNA 1FKPB 2MZRA 3L2QA 1N8RO 1YSJA 2ZKTA 5D77A 3HHDA 2Z1IA 3A5LC 5EY4A 2HS3A 5E3PA 1VCTA 3D7SB 4Z7CA 2WOMA 3AV9A 2RDIA 4K2JA 4F2RA 3HVAA 1HW9A 4AUKA 2OPSA 4FM1A 4NEZA 3UWTA 5B0CA 2F4VF 4O44B 2QYCA 3AD9C 1PBAA 3NNHA 4JD2A 2JHEA 2KG0A 2JDJA 4DL3A 1WELA 1NMEB 4DPTA 4CZGA 3V4IA 1MDUB 2FBVA 1HWLA 1VQ8S 3BGUA 1H2TZ 2X1AA 2Q1NA 3TNVA 2J0SD 3S3MA 1GAOA 4RU2A 3HOTA 2FHOB 2D0OA 2FC0A 5GAHP 3WQPA 3OD2A 4DV0J 4YNQA 2FLOA 3V6KA 4GVEA 5I3QA 3MPVA 3VMFB 1E4GT 3ULEA 2BH1A 4RTFD 5HO4A 2FJVA 4DUZJ 4F0MA 2PC6A 3BBBA 1UOCA 1GLAG 3KLIA 3GP9A 4ZN1A 3KLHA 3QEXA 4U7UK 2E6LA 1YUWA 4GKKK 1Q9YA 2YPZA 2MLZA 4FLUA 2KVQE 4JV5K 3MECB 2R2SA 4IOAL 1FDNA 3D0IE 1QVGM 2Q0RA 1QSSA 1C1BA 4LR9A 1N36K 4DV6K 3VF6A 4R8UA 1BO5O 3MM7A 3PYDA 3QJPA 4DL2A 2YXLA 5KFVA 3L3VA 3L09A 4X65J 2EG2A 2IDLA 3CC4N 4DN0A 5GADU 3QESA 3NDKA 1RWMB 4W92B 4CZLA 3BGLA 3L6QA 4EBEA 4DQPA 2MKHA 2UXBJ 3S1TA 4L74A 2Q3PA 3THXB 1HQEB 2W2PP 2O4IA 4JI6K 4RG8A 3BB5A 2PMWA 3R97A 1Y4ZB 5HBMB 4C8ZA 1RSCA 5KOXA 2F8TA 2ASYA 2DHSA 5KG7A 2CPFA 2HRTA 5K9FA 3MCSA 2W2QP 4PUOA 5CYMB 3D6HB 4E89A 2OSRA 1KOOA 3TI0A 2IVYA 2V0NA 1BD6A 3O4QA 2BJ8A 2FZKB 2HQ3A 1VC5A 2UUTA 2A3ZA 1FESA 4DEZA 3KD5E 3ZT4A 3MFIA 5L1JA 3B6OA 1YBAA 1PYOB 3K5OA 4X4RA 2VA2A 4MJKA 3NG8A 3ET6A 2QWNA 3TX8A 2X1FA 3UN5A 2ZGZA 4CZFA 4OYAA 2RS2A 2PN6A 4ZVPB 1X4AA 4NMLA 3OYNA 3RB6A 1KBRA 1VHFA 3TA1A 1VIOA 4GO7X 1IKXA 2JEGA 3C94A 1GMWA 3M8ZA 4HT5A 3CJ3A 4IG3A 3O8WA 4H4MA 3CMAN 1PC4A 1RBRA 4J37A 1IBLJ 2FLPA 4NLCA 2Y0BB 1S6UA 5DJBA 3D66A 5EVZA 4CZIA 2EPIA 5IT9Y 2QXFA 1VSMA 5IT9O 3ISND 1Y3KA 3JSMA 4Z7YA 4CJQA 2C3OA 4NMXA 2F96A 2ACMA 3NHGA 2PFDA 4M5GA 4ZCIA 3H3OB 3VGSA 4EBDA 3QEPA 4J5OA 5HROB 3VERA 1NDPA 3CJBA 4DV1J 2H5JB 4DCOB 4N76A 4BQLA 5LXYA 2YX7A 4FM2A 5BYRA 1NJZA 1DQAA 2QLFB 5J1EA 3CJSA 4ZJOA 3BKUA 3GJQB 3MOZA 1Q9XA 2A6OA 4KJIA 2HQGA 4CERA 3V4IB 1HKCA 3HLUA 4NRTA 1BQXA 1SC6A 5M1KA 2QMWA 2VONA 1X4CA 4BGAA 3V6JA 4PHTX 1RAIB 5L1IA 2E1CA 4LFCF 4DB3A 2D1KA 3CETA 4I56A 1IQTA 3CC2S 4H0PA 1QD1A 2AIRB 2YNFA 3P5TL 3HI9A 2IBKA 1TKZA 3H98A 2QA4S 3MEKA 4CBUA 3BKFA 4C9DA 4F8RA 2BX6A 2KM8B 4ZP6A 2MQMA 1CG2A 2H3GX 1Q5VA 2CQBA 4IDKA 2YBVA 1AYEA 2FSJA 3NAIA 1Q18A 2JH3A 4UOFA 2N3OA 5JS2A 5A8WA 3QDKA 4QWEA 3PX4A 5AJ3J 3C95A 2ZVSA 4C0BA 3MCPA 4CF8A 4DPUA 2RKIB 2BV3A 2RQMA 2PD1A 2V8PA 3MXJA 5J1PA 3CDAA 4PXCA 1TL3B 1WNEA 2RB7A 3HD2A 2KL8A 4X66K 4X4UA 2M7SA 3M4XA 1WEZA 3O9RA 5EOYA 1HBNB 4E7LA 3ZSZA 3KJVB 2QL5B 1U4BA 4NLYA 3VGLA 3FZMA 4F0HA 2MZSA 4YFUA 4ICLA 3CC4S 4F26A 3HBTA 5AQUA 3LALA 2R7TA 3NFAA 1B7FA 2ZDOA 2B6AA 1ZOTA 2ZITA 1GMVA 1XI1A 5HQMA 5KG5A 1HJOA 3QNOA 4EP4A 5KFHA 5GMEA 4FPAA 1XMOF 2M8DB 4PG7A 2VOPA 3A12A 4JKEA 1LOTB 1NJYA 4ID1A 4RJVA 2DXEA 3TQ1A 4O3RA 1TFWA 1YJTA 2XS5A 1Q8KA 3O6QA 1OJ4A 2XULA 5I9EB 4RW4A 3J7A1 1O0PA 2VBYA 4GNIA 1E6YB 3LP2A 1YVUA 2VKRA 2DGTA 5MAOA 3P38A 4W5TA 3JAMO 4ILGB 2E1YA 3FSYA 2NXJA 2PO4A 1GTEA 4NXMF 2B9EA 4X4TA 4X62F 2YX1A 4C4WA 4RUAA 2FB0A 3OTOJ 2ASJA 1RKIA 4TKTA 4KYZA 2LEAA 2B9XA 3TUJC 4J91A 2GHPA 2GO8A 3A5OC 1M5OC 5G0RA 3NL0A 1FRHA 4I6MB 2IIRA 1Q53A 3KUHA 1U2RA 4ZPWR 2QLWA 3VAKA 2B43A 3SQGB 4WP3A 4YR3A 3M8PB 1K47A 2EC0A 1EO1A 4IO1A 1QHTA 1MG7A 2GEMA 3UCZP 4FYYB 3QFWA 4MK9A 2R7UA 2RUSA 3OHBA 3HYFA 3MR5A 3EEQA 1M1GA 2OP5A 1HNZK 4QJVA 3PIPL 5LSOA 1RTIB 4DR4F 2X3GA 3Q8UA 2CQ0A 3J80U 4AHRA 3SSQA 2O67A 3OS2A 1HYVA 5T7LB 2ZC3A 1RGVA 5KFYA 1ITGA 5AXNA 4AQYK 2AEFA 4O3QA 1P8ZA 1O13A 3W3DA 5B0FA 4LBPA 5JLFA 1S7IA 2W8LA 2CPJA 5BRDA 2Z56B 5KI6A 3ZETB 4GVLA 3N01A 1S72S 4RW7B 4WFAL 3LGMA 2MYFA 4ISEA 2BANB 3T5JA 2DNHA 2QC3A 2OPPB 2KXNB 1C0TB 3PRDA 5AQYA 5JUMA 3I0RA 4ILRA 4ECUA 4DR6J 2JVRA 2ZOFA 1MWZA 3H0PA 2XSJB 4P9SA 2VD3A 4DN9A 1LAWA 2YX6A 5AFUH 3GG4A 1HYSB 1B7YB 3AA3A 1F6TA 1WHYA 3I87A 3TJ8A 1NLKL 2CQ2A 5CABA 3N4QA 1YLXA 2HNZA 3QFUA 1VOMA 5AQTA 1OYEA 1KWMA 1S7HA 4OO1J 3VENA 4DV0K 5E3RA 5D0HA 3CMES 4HUEA 2E9RX 3VQ8A 2YNIA 1FRJA 2VBWA 4RW9B 2HVDA 3DNCA 1KKHA 3CWJA 2R8GA 2AZ1A 4ZP9A 3RAXA 4LF7K 2LLZA 2J6SA 4YEAA 3FEXB 2VDHA 5M1QA 4JI0J 2BRLA 1R0BG 1FK9A 2V9WA 3JTNA 4NO7A 3UKRA 1VSHA 1RADB 3RW7A 3VCDA 3MPWA 3BR9A 2BXJA 2XWXA 5HJYA 1BCOA 3L4QA 3O4NA 2DNGA 4F3OA 4KV8A 1BUXA 2GVZA 4FF2A 1GMUA 2P9LB 4IKFA 2YHBA 2P1JA 3P5BP 4JK9A 2WC9A 1XNRK 5GAEI 4TQRA 2CUYA 3WNFA 1ZM2A 3CMEN 4YY3K 3MCNA 1UEKA 5FRNA 1HQUB 1CBKA 3TARA 1SQKA 3K9KA 5HK4A 4OIXA 1IXKA 1RTJB 2Z58B 1U04A 2PY5A 4KO0A 2HBQB 1X4GA 4M1KA 3FZLA 4JRPA 3CO9A 2YH1A 3KK2A 2G0CA 5F8JA 3H1VX 3EE9A 3QERA 3CJ5A 4A47A 3M1VB 2CPDA 2EKNA 2DNOA 4Q5VA 2XC9A 1VDHA 3VQCA 3UVJB 3K5LA 2H5IB 3I9ZA 1RT5A 4FZXC 1X4BA 1XBWA 1W9HA 2C3UA 3RG6A 5HVFA 1LNQA 3MF5A 4YORA 1TQLA 3MPDA 1HARA 3PCOB 1URRA 3C15A 1R6VA 3B8HA 5EWGA 3HOSA 3BO4A 3MM8A 2WVBA 2DNQA 2XMMA 1VBXA 4LF6J 3N6MA 4LIRA 2EWSA 3DAWA 1XMQF 3QEVA 3ZTRA 5I4MA 1U7LA 1BGXT 1UW9A 1XEZA 4WXWA 4IEIA 3H5XA 2D7SA 3AA8A 3AJ1A 1NJWA 2FC8A 2VZ9A 4B1WB 4JHDA 2IRXA 5EDWA 2KB2A 3C6TB 2ASPA 3RSEB 3C3LA 5AQHA 4OJHA 1NGHA 1ZXOA 3F0NA 5DQIA 4MFBB 5BRFA 1Q82T 3KWIA 1RHMB 1N32F 1CJKA 2WOMB 4IYQA 4CGDA 3G96A 3AJ2A 5IS2A 1U0SA 4BDZA 4A5BA 3LPYA 1WC5A 3NGSA 4AE5A 2NSBA 4FZYA 1GXTA 3VALA 2ROPA 3JSBA 3OR2B 4FXVA 4Q43A 2C2RA 1IG8A 1LXJA 2WHOA 3MDQA 2AKWB 4CZMA 4CO1A 2NZTA 2OZMA 1D1UA 4J9QA 3VVUA 3TVYA 1I6JA 2V69A 2HHHK 3TO8A 3JSRA 4M8LA 2A6AA 4DTUA 2HLTA 1N0UA 4DUZF 3P8BB 2E9ZA 4B3RF 4ED6A 1J6ZA 1IWAA 2IM1A 2ZWPA 5K8NA 4FJHA 3NGIA 2L9WA 1ZBHA 1HNZJ 1LWCA 3LZIA 1PAUB 3FRZA 2QA4N 4DX8H 2O5DA 4UOHA 3ELHA 1G1XA 3T1YJ 3EXYA 1XNRF 5I42B 2P5VA 4ICLB 5CYJA 4C3MA 2M88A 3OYHA 4IRCA 1S6QA 3HJVA 3MEDB 2NXNA 3CC2N 1ZAXA 4C8NA 5E3QA 4QZVB 4E8UA 2R7SA 2XYGB 3BDPA 4FPBA 2FVPA 2CADA 3MR3A 5D4LA 3G4SS 2A2CA 5GAHU 3B54A 1Q7YT 4I2PA 2OEMA 1UZHA 2HOEA 2FF3B 3O1WA 2B8PA 4PR6A 1HR0F 3D1HA 4ELTA 2QWRA 3SI6A 1V3SA 2Q1LA 4MKBA 2UUBJ 1HWKA 4DUYJ 1XNQF 4ZP7A 4P7VA 1WHVA 1X5SA 4L3NA 5KFFA 4ZVTB 1NSKL 5IOLA 4QW9A 4R79A 3BBCA 4NOHA 5CR4A 2GHVC 2RE1A 1MMNA 5CZXA 2RNEA 2YWFA 4F67A 3IG1B 3SEOA 2CPIA 5D8HB 2LXIA 8ATCB 1CPZA 4FW1A 4F4ZA 3KOAA 4QOZB 3OR1A 3P4UB 1GLBG 3BZKA 1F0XA 2HFZA 4ETZA 4WQ5A 1S22A 2GJIA 1N0VC 3SUNA 1R8PA 1VR6A 1UJ6A 2MY7A 1K0VA 3H45C 4FJNA 3M30A 5C2CA 3AO1A 4TSXA 4CO2A 3NAHA 2XYHB 3BGOP 5F3TA 1I94J 1WSHA 4OYPA 1HPZB 2AJ0A 4HDGA 3AO5A 1EKRA 4WZMA 1LWFB 3CCJN 2KRRA 2MKCA 3OFGA 4W5RA 3L7OA 4LMZA 2G4BA 1N52B 1BIZA 1MROB 5M2UA 2ZOGA 3PW4A 1KAZA 4HCBA 4N8NA 4GRSA 2F9DA 3A8IA 1IM4A 4IO8A 4DR4K 2HPUA 3BSOA 2V7ZA 3EE8A 2GA7A 2HG4A 3QLHA 3EMTA 2KZZA 2AJ2A 3HHNB 2GFFA 1T0TV 5G4DA 3Q2TC 3UPFA 4WKYA 4ZVSB 5M1OA 4JK7A 1R89A 1VQMN 4QR2A 2NS1B 1YIJS 3VTIA 1ZM4A 1RDCA 4FJJA 1TUVA 3TSQA 2DRDA 3UB5A 3R5CA 1FWKA 4ZLLA 4MKYA 1WUAA 5ETLA 1R8BA 2VFVA 2V4JA 4G1QA 2F4VK 3IN5A 3ZSVA 3KWGA 3R6LB 5T7BA 3DOKB 2OA8A 4CCHA 1HBMA 3QGGA 3VQDA 4TVAB 1J5EK 3MK6A 5E3AA 5AE1A 2O4GA 2GVDA 3HSDA 3HP9A 3OBIA 2QI2A 2CQ1A 5HQLA 1O51A 2VICA 2WSFC 4KTZA 3FSXA 4KBOA 5KG3A 3QO9B 3ENVA 2DK2A 3EX7B 2PT0A 4PQUB 3SV3A 3KJQB 4OZ1A 5FPNA 1HNVA 4ID5A 1RAFB 1N34F 3QT8A 4DMNA 3CCEN 1RBVA 3J80Y 3TW0A 1SV5B 4OL8A 2E1MC 3G87A 3DXKB 2V8DA 2P9GA 2KXFA 4QS7A 1L3VA 1I1GA 4IFVB 2WK4A 3N79A 3UDVA 2V2QA 1RT4A 1HRHA 2G8WA 3CCLS 2BE2B 5GVQA 1HA1A 4LD0A 2XB2D 1NPKA 2O66A 2PZSA 2WVFA 1YJVA 1TTHB 2QJ3A 2AP1A 2FBTA 2L48A 4CJFA 2BR0A 2B9WA 2DEJA 4H5VA 4DV2K 2XGQA 1ITPA 2PAVA 2FJDB 4DV6J 3B6PA 4ATNA 1NGAA 4KKOB 5HATA 2IM0A 1B64A 4NLRA 2YV0X 2Z1HA 2EHGA 1S9EA 4OHYA 5BPLA 1ATSA 4B3MF 3GIKA 4I9QA 3PW5A 1QLNA 1GFWB 4OLBA 1HQ2A 2WONA 3V5RA 2LQ9A 2N3LA 4KTQA 2D3ZA 2WB4A 3G8QA 3K5PA 5K5MA 3NLCA 3CJTA 1VSKA 4FLWA 2F9TA 1RISA 4OX8A 2DBBA 5ETVA 4YY3J 3QBCA 3EVMA 4CIGA 3HXMA 3L7PA 2CNOB 3D1OA 4DHVA 2CPHA 4CTAB 1TR0A 2UU9F 5DDQC 4DKWA 5DMRA 4CK2A 3RRKA 2ZM6F 4DV4F 2F65A 2LMIA 1APSA 1DQ9A 2RN2A 4FJGA 3AGKA 4B3RJ 3CD0A 1UWAA 3OL6A 5BR8J 1RTHB 3SIPB 1SVDA 1UVMA 2E5JA 4MQ3A 3VPZA 3TEGA 4Q2MA 5C2DA 3T6JA 2DNZA 3R5BA 2QYGA 4ZVGA 4Z4EA 4A8XA 5H9EJ 1R8AA 4HDHA 2J4RA 3CTRA 1JLQA 3O1BA 3CCQN 3OW2R 1K1SA 1FWPA 3TZXA 1X5PA 1UA0A 3SXLA 1GOCA 2QA1A 2AEMA 3MX2A 4X65F 3AB4B 1MWMA 2VA3A 1HHQA 3QRRA 3IKMA 3ZTOA 2P9IA 1S1VA 2KG1A 1JJ4A 2CRLA 3ISZA 4X2BA 2BBEA 4DG1B 4WZQA 2NRTA 3KLFB 2CQ3A 2GZOA 4Y3CA 1S3XA 1KOHA 4ETXA 4ECVA 2VL1A 3TUPA 2UP1A 1LWCB 3DMJA 1WF1A 5HQ8A 4TYBA 1XR6A 2UUCJ 3QIPB 2M0GB 4HH0A 4EAHD 2ZC4A 2MTLA 4NLBA 3DLHA 5AQGA 2CJQA 4X65K 4D3HA 5FDLA 4PXDA 3GSDA 4K2XA 2EW9A 2Z2ZA 4IEEA 1RAGB 2ZH7A 1VSFA 2ZH9A 4E3SA 4JI2K 2DNNA 2OZSA 3M8YA 4UZCA 1J5EF 4BG9A 1OH5A 1YT3A 3WIVA 3KDNA 4M41A 4ZOSA 1VQ9S 1S77D 2W4PA 1SJFA 1W2BR 4FF1A 4CECA 2NRWA 4CH1A 2WVCA 2G0JA 3WZ0A 1DLOA 2QIFA 2BKPA 2VG6A 3MN9A 2HHHJ 3BH7B 4IQMA 4WFNQ 4M5KA 1HYZA 3BM7A 4FJMA 1HNZF 5BRHA 3PUFA 4WFYA 1WAJA 4OZJA 4RZRA 4WF9Q 3MEEA 1RCOB 3HULA 4TLRA 4CEZA 5B0EA 1X60A 1OIAA 1S6PB 4J9LA 5J2MB 3A8KA 2G8VA 2LEBA 3J81j 1RACB 4LF2A 2C28A 3PACA 3GIJA 1RHUB 4JYAK 1WHXA 3GTYX 4I69A 3SBGA 3OR1B 3I8DA 4J9MA 2QV6A 3N4PA 3ZC4A 1GQEA 4ZLPA 3GPAA 2V8HA 2EFVA 1TV6A 4AM7A 2N4CA 1BWFO 4BRCA 2AYMA 2ZEJA 4UY8T 3DHWC 4P72A 5D3GB 1IH7A 4CLLA 1T6CA 2H54B 3WXJA 1PO6A 4LSLB 4MTPA 2GTDA 2QLJB 4FN5A 2H1YA 3MTJA 4BE1A 5JLHA 2R42A 1ZTTA 1FEEA 4DPOA 4OYMA 3PYGA 1WSIA 3G71N 4BGBA 4B3TK 4KGXB 1DRZA 1DZ5A 3FFKB 1RK8A 3PR4A 1VRTB 1J53A 5CH7B 4O0JA 4GC6A 5KFWA 5FPEA 2C42A 4JLHA 2IPOB 4CJ5A 2YQ3A 4YDXA 4DFKA 3T7ZA 3SZ2A 3HHLB 2DPIA 3KDOA 2ROEA 2E5LK 3THWB 4WYBA 1WBBA 3DRRB 4NL5A 3AOBA 2HBZB 1XR7A 2EFPA 3HKZD 5B7WA 3VQAA 2HWTA 3M30B 3K9JA 1NM1A 4CJLA 5FROA 1NOZA 3I0RB 4KHPF 3TZWA 3OYMA 4OGEA 4L8RB 1QJHA 3MMAB 4OKKA 1FW6A 2O8FA 4WYLA 3VQEA 3VEVA 4RPFA 3OXGA 1SJQA 2V2ZA 1UETA 2AMCB 2P9EA 2VFTA 4FS1A 3SI8A 1MU2A 4ED8A 3SMSA 4FJ8A 4HVZA 1GLDG 4DU4A 3MDFA 3I8BA 3RYLA 4XDCA 2Y1RI 1I51B 3CCSS 2R8JA 3W5YA 1Q86O 3B4DA 1KS2A 3FGVA 5KPRA 4DI6A 4FK4A 4NXMJ 4M45A 3ZZRA 2YQ1A 3O9QA 4I7FB 2EWHA 3CJ1A 1VQPN 3DMJB 1OPZA 5IT0A 3QBWA 4Z4GA 4AXJA 2ZGYA 4DR6K 4JN4A 1T9WA 3NGRA 3TR8A 5F41A 3PJ9A 3ZZZA 1U0HB 4CH7A 1Y64A 1ZBIA 2H4WB 4JKBA 1SKUB 4LFCK 3O9UA 2B9YA 2XLIA 1NB2A 3EGWB 1UEVA 3W62A 3R5AA 2HHHF 2YNHB 1QVFR 2LA4A 1DARA 4FYDA 4ZIWA 4XEIA 4MO4A 5D4NA 1NGIA 1H0HB 1Q82O 4ECWA 1AFJA 4BACA 3GONA 4PKHA 4KHPK 1J5EJ 3M8QB 1WSGA 2DCLA 2XY5A 2NRHA 4FXWA 5L39A 5M2PA 1KTVA 3TSUA 1VQPS 4ILHA 3MD3A 3MUVP 3M2VA 1LWXA 1FDDA 2BACA 1WC0A 2BJ1A 2FPHX 2XZDB 4KT0C 2HBJA 1J2VA 3WNGA 4KO0B 4DL4A 3NCIA 2OEJA 1QUPA 1ZZNA 4HHHA 4FPIA 1S10A 3AY0A 1QAIA 4KHMA 4IQXA 1KXPA 3GQCA 3CJQA 3IGNA 1JL1A 3CQ8A 2ZE2A 1LK7A 4IOCQ 2B8QA 1VRUB 4WU3A 1UKUA 5L9NA 1RBLA 3W9JA 3L4BC 3CD5A 5F8LA 3C14A 3MD1A 4HHJA 2UVRA 4WKRA 2ZBCA 4JI2J 3OTOK 3ZZPA 2ZFHA 4I1TA 4NLUA 3SCLE 1NAQA 1C6VA 3THYB 2HAIA 4JI0K 2VQFJ 3KWMA 1BY9A 2JL9A 1RNHA 3W2WB 2KO1A 2RJZA 5DETA 1S1WB 5H1SQ 2HRUA 4G65A 2X51A 5DM6L 5AQSA 2IAJA 1HD0A 5L1LA 2GBZA 3P4IA 4HUGA 2GX8A 4CJ3A 1YHQN 1S72N 1Q4RA 3MM7B 2LQ8A 4B9TA 2Z0GA 3KLEA 3GFZA 1N6QB 3I4HX 5CA5A 1YJWS 3CPEA 1H2UX 3G6ES 4FWOA 3Q8QB 2UUAJ 2IC3B 2QA4G 1NRKA 5IV4A 4QIWD 4C8OA 1BWVA 1H2VZ 1Q8IA 4UZBA 3RMDA 2A0FB 4B3SF 1CZAN 4FF4A 3TSPA 1OH7A 3FSIA 4CZJA 3OVAA 5LMUK 2JRSA 4NWBA 1T03A 4LF4F 5F8HA 4OJ1A 1DEJA 4YY3F 1Z25A 4JI6F 2CQIA 3Q24A 4JI7K 1S1VB 3BZQA 5KG0A 2HNDB 1CC8A 3G71S 2QL7B 3FC9A 3FQKA 1FJCA 3VQ5A 4F3MA 1HI0P 4CFBA 4K4XA 3LAKA 1BQMB 3R3LA 3SSSA 2QZ8A 2VU5A 1MW7A 4DV6F 4JI8J 4K4SA 3QIOA 2GGPA 2N7CA 2XMVA 4HVJA 1JLGA 4KI6A 3F56A 1VQKS 3ZSWA 1ZS6A 1IR0A 2J9DE 2YHAA 1KNZA 5KQ8A 3FUYA 3N4WA 2K3IA 3O3HA 2IRYA 2YWHA 4DV5F 4NZ7A 1OVQA 3QEWA 2WBMA 3DLLQ 1TVRB 3KK1B 5I3PA 2BMBA 5GAHI 2DNKA 4X62J 2VIHA 4CO3A 1AUDA 1JJCB 2ITGA 3BGRB 2HFOA 3CW2C 2VODA 1QDUB 1FTRA 2LA6A 3HMJG 4OX7A 4P2XA 4QPXA 1CZ9A 1HBUA 3P45B 4CE9A 2QL9B 3W9IA 1Z4UA 1UWBA 3KLHB 2E7VA 5A8RB 4RBTA 3CJ4A 2QG9B 3TOQA 1BLUA 3D2EB 2MQOA 2GV1A 3IXQA 3NMRA 4KGZB 1Y11A 1Q0NA 2WFBA 1NK9A 4W90B 4FWRA 3G6XA 1VC0A 2K1RB 4N5SA 1WKJA 3PJXA 1IG9A 4EHUA 1X4DA 4N47A 1ASVA 1HQEA 1NK0A 5K20B 3HX9A 3D0HE 2UU9K 4ZJQA 1PGZA 3O3FA 2YNGB 4CI6A 4MLEA 2XQCA 3QMLA 2WSCC 1OPIA 4JI1J 1TL7A 4ZCMA 2GIRA 4DMZA 1RQ0A 3QT7A 1VQNN 3CJ8A 4C8YA 4OJGA 3B78A 3MMJA 5D6GA 4DR1K 5JVHL 1BQNB 2C2MB 2GIFA 4CLSA 4MH8A 3KHRA 3LTOA 5ADXH 1YG0A 2H3EB 2PBDA 3UD5A 4DFPA 3MEEB 4B9SA 4BROA 4BHQA 4H4OB 2R7VA 3LP3A 1B9DA 4RR5A 1T05A 3ET6B 4FF3A 2RS8A 4V19X 1TKTB 2P51A 3KNGA 3P49B 2CPEA 2N7YA 1NH8A 2YKOA 3AVGA 1BC6A 4FPRA 2UXDF 2E88A 1U45A 2V68A 3JTOA 3KMSA 3IBWA 1MN7A 1D8YA 3GG0A 2BOAA 4DU8A 1B0PA 4ELVA 3LF0A 2GQ2A 2VASA 5HANA 5KFIA 3T1HF 2DRBA 3ZNJ1 3K2YA 2HIYA 4CJSA 2ADBA 2EBGA 2XRIA 2N82B 4F3TA 3CJ9A 5GAEU 1LAVA 3R5GA 4HWIA 2K7JA 1Q7YO 2L3MA 1VQYA 1VQ7N 4FNIA 2J6TA 1U1RA 4FLZA 5KG2A 2HSTA 5C25A 3SDEA 1PBUA 4I7FA 5D0EA 3SPZA 1H7XA 2FZGB 4X4VA 1FJGJ 4PKIA 4CBXA 4ZVEA 4DFMA 5LY3A 2CZVC 2E2QA 4WQ4C 3LOUA 4OI0A 3N5FA 3KNAA 1RCXB 5IQQA 4U67Q 1HI1A 5L8RC 4AXIA 1N36F 1GOBA 5LJVA 3SK3A 1K9MO 2ERRA 3ZXWA 4CEOA 2D69A 3IDHA 4ITSA 4QOTA 4TY9A 4QIFA 3KMQA 3JYTA 1WAFA 4JI7J 4PKDB 3A8JA 3KHYA 2ZUGA 1REVA 2HFSA 4ZMMA 3WEEB 4H8KA 4NZ0A 2LEPA 1VRQC 4CFDA 3NH1A 4JYAF 1QZ6A 4L3KA 2DNPA 1FFWB 1KVIA 3NF6A 2LFVA 4WIQA 1S12A 2OI2A 3KJFB 4QWBA 3EN9A 2B4UA 4EIAA 1VRUA 2OTJS 1P1LA 3UW1A 2MSTA 1HKBA 1RDUA 5HMWA 1U0HA 4GC7A 2E1AA 2PE8A 2HRYA 2O3DA 4DTPA 2ZWHA 2MZQA 1VISA 2DFFA 2Q2RA 5JMNA 4W5NA 4EBCA 2OEKA 3AD7C 4H0TB 3CIMA 3U1MA 1C0TA 5HLFA 2A18A 3D2FA 4OZLA 3RVCA 4X62K 3IRXA 2VC0A 3FZ2A 2ZZMA 5AXMA 5DGBA 4OHXA 4QIEA 1C2PA 1VFJA 2QT7A 1RHJB 4Z4FA 3MXIA 3SUQA 2YQ0A 2MGZB 1Z26A 4DV3J 2BKOA 4QBUA 4GVBB 2F8MA 3D4JA 3LGHA 2J5AA 5CXTA 3I31A 2X1BA 3VF2A 2CKWA 2P6TA 1K6YA 1XMOK 5F0WA 1XNQJ 4MAKA 3UE5A 4WP9A 1IBMK 3UDLA 3J81U 3A8YA 5HVGA 3TAQA 2M4MA 3MCOA 4DF4A 2FHMA 2XLKA 3O4WA 4ENOA 1E4FT 4ZCLA 2HQFA 2JNJA 3UDCA 3ZFVA 5A8KB 1QE1B 2NQPA 2P9PB 4XPCA 2HHVA 3MMBB 3JSMB 4IH6A 3U9DA 3GSIA 2RU3A 3LUYA 3ZT3A 4G1PA 3I56S 1HW8A 3EWGA 3UR3C 2O8BA 2ZD1B 2XCPA 1GLLO 3R7NB 1YTAA 1U8SA 3CCES 2WW8A 3W9HA 1AB8A 1HNWJ 5AQKA 1ATNA 4ZP8A 3M05A 5CHCB 1KONA 4ANDA 4OYBA 4KHWA 2OCEA 1RWOB 4GKKJ 2LDYA 4E0DA 4JI0F 1TUWA 2IY5B 1U8WA 3AD8C 4CLUA 1K8AO 2CGKA 4B1XB 3O1LA 4JBCA 1RCHA 1GLEG 2A41A 1K8AT 2KHOA 3R7BB 3VGUA 4B3RK 1GX5A 1OO0B 1SIWB 3VGKA 3KG4A 1NPPA 1RILA 4LVNP 1SXLA 1G6BA 4BR5A 1FJGF 1WG4A 2EFOA 4YR0A 4PL7A 1JLFB 4IOAQ 4AQYF 1RE1B 3K7RA 4ANEA 3OPKA 3MGJA 1EP4B 2H48B 2QN6B 4FYXB 2KFYA 4FWNA 4ECSA 3UCUP 2UUBF 5B8HA 2Q66A 2V4JB 2KHDA 5T7LA 1PJ6A 3CIPA 4B1UB 2HZCA 2O8EB 1AUSL 3E66A 2OFGX 4C8KA 3RMBA 4M3UA 4DL5A 3T41A 3CCZA 4URQU 5HRSA 2RF2A 2JGUA 3U6FA 5IFMA 5ETTA 1JJHA 4E2FB 3K2PA 2CH6A 4AH9A 2UUWA 2B4PA 1Q5YA 3RUBL 1PAEX 2OPPA 2HMIB 1H7WA 1NK6A 5M1NA 3KJNB 3X3UA 4X64K 4YP3A 2J9CA 1SZ2A 1VJQA 2GMLA 1FXXA 4NLDA 3CCJS 3PIOQ 2QEXN 1RAHB 4LSLA 4U67L 2P9UB 1TL7B 2V9KA 4KBIA 3H7HB 5AE3A 2WBRA 1N5QA 4IKAA 3AGRA 4DV3F 5KFQA 3QETA 1C1AA 2JWNA 5CD4H 3HZEA 3TUIC 4NXMK 3CFRA 4ED5A 4BRAA 4WE1B 1N34K 4NCGB 1CULA 5B08A 3BS9A 2G8IA 4JKGB 4PABA 5AZIA 3C0BA 3FKBA 4LJMA 4FJLA 3AA5X 4DR5J 4XPEA 5HMXA 1WSEA 1KQGB 2J0XA 4ECRA 3M8WA 3IAYA 4JV0A 2R7WA 1GXLA 2K2PA 2GUPA 2NRXA 5GIPA 3NS5A 1XHZA 1YJ7A 1OWXA 3SUOA 2RH3A 1UVJA 4ILJA 2ASMA 4IRKA 3CSKA 4OHZA 4NZ6A 3W2VB 3RAQA 3AAQA 5F8NA 4KV8B 4K7QA 2A3JA 4JYAJ 4E19A 4CM0A 2PFUA 5EGYA 5ETNA 3L2VA 1X7VA 1IBKK 1RYSA 1I94K 3KTQA 3R2CJ 1KRPA 3CEDA 2XY8A 1REGX 2BUNA 2BOPA 1N33K 1BHNA 1LEOA 4LF4K 2HURA 2BABA 5L1KA 3ALYA 4CESA 3IR5B 5BXIA 1SUQB 4NLGA 5CZ2A 2F4FA 2XBPA 2XYPB 3DLJA 4M3RA 5AZJA 2ZJRL 2C3YA 3BPDA 4CNZA 3VEXA 2FDNA 3RB3A 1S1XB 2GX9A 5M1FA 4JKCA 4LF9K 3VAGA 3OVSA 2CJXB 4B3TJ 3HPGA 1RTHA 3F2KA 3SMPA 2VV5A 1G4CA 2ABYA 3R5JB 4E98A 2V2VA 3OVNA 4OYXA 2BJEA 4ALZA 4P71A 4EFHA 2UV8G 2BANA 3RSEA 4CH0S 2LVWA 4JI3J 2A42A 1GNKA 3RJMB 3KKFA 3D3CJ 4CHNA 4CYUB 1CVJA 4Z4IA 1CJKB 3ZSOA 3TANA 1FRKA 2HYIB 3SFUA 1SC1B 4F4WA 2DFHA 4ECQA 1F5AA 1AZSA 1U09A 4EZ9A 4O3PA 3ILOA 1S9FA 4YDDB 5KT3A 3AXMA 2LQBA 4M63A 4FLXA 5T14A 1RAEB 4TY8B 1SC3B 3MAAB 2VGNA 2J8AA 5L38A 4OX6A 3WC2A 4H4KC 1RT6B 1DY3A 3PHEA 4AL6A 4KE5A 4ED2A 2UXDJ 3BO2A 3T5LA 2C1EB 4URSA 3QIPA 1LW0A 1JLAB 4WJBA 4BC7A 4PWDB 3HSCA 2F8SA 3TVZA 1KFSA 1DTTA 2DD8S 2IVPA 2UUCF 4UF4A 1I3AA 4N8OA 4YOYA 4UQTA 3M6WA 4CWBA 2DR9A 4B3SJ 4IOCL 2DY4A 2I0XA 4M7YA 1C4AA 1RT3B 2BGGA 4HLBA 2E2PA 1HHTP 3WXMB 2J76E 3OFEA 4IG0A 3DLLL 2AEJA 4Y0WA 4W5QA 2FLLA 4FVMA 2AYGA 4XO0A 2GNKA 2Z2LA 1UTAA 1YRXA 2XMJA 3DCAA 2LSNA 1QSLA 2E5GA 3W60A 3H20A 4JV1A 4UOGA 4J9NA 3GYXB 4H5WA 4E7KA 4U7BA 4NXNK 2L9DA 3EUNA 4NYOA 4MIBA 2G2ZA 1HBNA 3A4TA 4HCCA 2DIUA 2IIHA 2A2DA 4PXBA 4C11B 3MEDA 2GJ2A 2MKSA 3PFEA 3GBTA 2PI5A 3BF3A 1ZM9A 3IWLA 2KRBA 4OPAA 2EEYA 1WC3A 3K8WA 4P2MA 4RO0A 2LU2A 1VQMS 1KP6A 3G9CA 1RI7A 1Y9OA 2G8KA 3NVMA 3NGYA 4K41A 2D0CA 4RNHA 4CF0A 5JJBA 3ILLA 4OI6A 1RAAB 5HLFB 2O8BB 4RX6A 1JXVA 1NU4A 3VA0A 5KPZA 2RU9A 2ILYA 2ZH8A 3MM8B 2BE2A 2HIQA 3POTB 5EUHA 1LWFA 2DR6A 5GIOA 3QGHA 5HRNA 1MWYA 2FZCB 4DV7K 1VK8A 3V6DB 1B0VA 2HQCA 4KH1B 2J7KA 1C0GA 4K0KJ 3O5TB 4RBUA 3IBFB 3CF5Q 4CGGA 4KAZA 4GKKF 4UT4A 1L3SA 3DRPA 2VPYB 3W8GA 2DHXA 2O8CA 3J7ZT 3EM1A 1E6VB 1JKHB 4EGLA 2WONB 1T9UA 4KH0B 4MKVA 3RMCA 1IJJA 2ZVIA 2QK9A 1ZA1B 4RW8B 4LBHA 4CHYA 2DFEA 3GFXA 2P5OA 3H5UA 1V4TA 3VQSA 3SLCA 4GKJJ 3SUPA 3H59A 1NGGA 2DY9A 1UWBB 2LU1A 4CJRA 3S01A 4PG8A 2O8EA 4KREA 4C2MA 2QFJA 5B0AA 2I6WA 4IJNA 3W5ZA 4G1QB 3QSYB 1JLEA 2CYYA 4DU7A 5HN0A 3OTBA 2VC1A 1XWLA 2FUG9 4ZVRB 4O4GB 2AX0A 4UUXA 3M32A 2GWJA 4ZIVA 1YVNA 5C2GA 4EO8A 1S1UB 5BPNA 1YITN 4CJEA 1SKRA 3F44A 2ZJQL 3W0LA 4RNOA 1H73A 1KHVA 3OYJA 4LF1A 2K3KA 2RDDA 1HNVB 3PM9A 3BQ0A 4BC2A 2Z8QA 5CY4A 4OLAA 5MLCV 3CC7S 1NHUA 1V5VA 3ZYYX 2UVWA 4L72B 2R7XA 4CK1A 3WQTA 2KH9A 4B1ZA 4LY7A 5KFPA 3D1QA 3M8SA 2LKZA 3V6HA 4G6VB 3S6EA 2JC1A 4HYKA 3FDSA 1UVNA 4BE0A 5A0YA 1OS5A 4B8CA 3WQUA 5KFAA 1S79A 3H6EA 1U1OA 1KN6A 4PWUA 3RU0A 1Y5NB 3LM2A 3A3OB 2QWLA 2AX1A 2BQUA 3HVWA 2W25A 2MKJA 2ASOA 5FD1A 2X3DA 1VQKN 5KFEA 3CJKA 1ZBFA 2DGXA 4A8QA 3HSTB 2X6NA 4RNNA 3IMQJ 2PEBA 2MKYA 2RD5C 4BBYA 1NZAA 3QB0A 3SQ0A 4B3MJ 3GCWP 4I6YA 3WBZA 4CZHA 1VSDA 4DX7A 3FE1A 4YOXA 3AHPA 3PZPA 3UKUB 1WSRA 4KKOA 4DV5J 4Q7AA 2HNYA 4USWA 5BR9A 4YOUA 1ZPWX 5KG4A 2Z30B 4HR2A 4NA3A 3IO1A 4WTOB 4Q8FA 2JOQA 1TFYA 2XSFA 4ZVUB 3L3UA 3DOLB 3M5RA 1NOYA 4BQZA 3DLEA 2VCPA 2VPXB 3IAS9 4DV4K 2JEIA 2WTUA 2R2RA 4XIUA 1SH0A 1J27A 3DLKA 3G4SN 2C2ZB 1QHAA 2FIUA 4PA1A 3MI7X 3H4BA 1WN7A 3J7YI 3CGIA 3AODA 4CLYA 2JLFA 4LFAJ 2Q36A 2X78A 5L9XA 2AGPA 4Q0BA 3O44A 1S5ZA 3HM8A 3GJSB 4WCEQ 2HBYB 1EX4A 3W66A 5KRTA 4FS2A 1XNQK 1HBMB 3PW0A 4LF9F 1XNRJ 2FXUA 4S0MA 3JXUA 1PG5B 2DNRA 3M2RA 1JLCA 2P8IA 3KHGA 1KAYA 5F8GA 2YWWA 2GVDB 2YH0A 3LDQA 4F4KA 4KC5A 9RUBA 4ES1A 4HTUA 1RZMA 1ZBTA 3QFHA 3QYYA 2WW4A 4ERDA 2ROGA 1NKEA 1UVLA 3P83D 5BPMA 3CJAA 2GGPB 4DR2J 4PQUA 1EHWA 1X4EA 1VSIA 4DFJA 1EWRA 3HSGA 5DDRC 3OLBA 2VG7B 3Q7CA 4CIFA 3R3TA 2BM1A 1NNDA 5JVGL 4FWSA 3S7RA 1RU2A 6FDRA 2YI1A 3QGIA 1IKWA 1NWKA 2B56A 1FKPA 1KSPA 4X4QA 5DM6Q 4XAKA 3HF5A 2J0WA 3UD3P 4LFBJ 4DG1A 3MMCB 2LXFA 2ASLA 5IT4A 2KYZA 3U4LA 2VQFF 5LM7E 2J8SA 5KFSA 3RBDA 3CDWA 1MSWD 3WX4A 1DTQB 4EYIB 4GMKA 3KK7A 4NLXA 1SJ1A 3TP2A 3BO3A 1O1WA 2HF3A 5BYQA 1KQSR 4TY8A 1OY8A 1P6TA 3IAM9 3M6GA 3ZO7A 4CF1A 4TLQA 3CB4A 2WZ1A 1DQ8A 1QAJA 5KT4A 3DM2B 1B3TA 4USIA 1YJNN 2V50A 4IH7A 3T5HA 1S6PA 3TQEA 1U2VB 1NJIT 3P96A 4CLTA 4YUDA 4FW2A 1JK9B 2DTUA 3ZETA 3D45A 4WFZA 4RW7A 2FLNA 2K1RA 3OL7A 3KLGA 4OV6A 4FWLA 2CNLB 3MR2A 1FNOA 4E1NA 5EX3A 3UFCX 4M3TA 3VWSA 5HRRA 4DZDA 4BRMA 2VG5A 3UO0A 4BR7A 1TMMA 3CCSN 5AQQA 1TV6B 4FJ9A 2OELA 4CFAA 3D0GE 2XMWA 2D4WA 1WJ9A 2Q31A 3Q86A 4NLVA 2NR0A 1EKEA 5DM7L 1ESVA 2B6AB 2VGMA 2ZD1A 4DJBA 3R6MA 4DTNA 5KT7A 4JKAA 3GJRB 1S9GA 1U02A 2ILZA 4H5RA 4NYFA 5DG9A 4KR0B 3FEYB 2P9NB 3CCQS 1VSEA 2YJEA 5DLFA 3G0ZA 3VETA 1HNIB 1OMSA 3WT0A 3TX0A 1XUPO 2CIMA 3UN2A 1NK7A 4RUHA 4CF9A 3UDEA 3X1LB 1LWEA 2VWKA 1RBAA 4CJWA 1WB9A 5A2QU 2C2EA 2YKMA 3OUYB 4I64A 4C11A 3M6VA 5AQRA 3ZZ0A 1XN9A 1ZPVA 4M63C 3DLEB 5HBMA 3OV7A 5AJ3K 3UCGA 4NPOA 3EPIA 1RTDA 1FJGK 3L2WA 2VPWB 1KQKA 4ZKAA 1P9YA 2OLWA 3AAWB 3MHYA 2W2OP 5TKYA 2GVZB 3B4MA 4DR3K 1JQGA 1JLFA 4BR4A 4GY2B 3NBPB 1RBSA 5C15A 1U49A 3W3SA 5C7PA 3RGIA 3DLGA 3ENAA 3ATVA 2FF6A 3HHLD 1JLEB 4B3MK 3FBCA 3J7YU 4F4YA 4CJTA 2P9CA 5IT9U 5CZVA 3TTCA 3J7AN 2H51B 2I5JB 1KTQA 3WNHA 2KW4A 2CDRB 3BSNA 3OL8A 3A3NB 4Y2KA 3WHIA 2XZWA 2RQ4A 1S1UA 5FDLB 2B5JB 9ATCB 1G15A 1RBTA 2W40A 1RXOB 2IHR1 2WSEC 1T9YA 4BWMA 2E5IA 4OZ0A 3EJMA 1Z6RA 2D41A 3CJ2A 3Q8RB 5IC4B 4AF1A 3HVRA 1N32J 1SH2A 4BS2A 2EK6A 4WQ5C 2V8GA 4MYUA 3FR0A 3HHKA 1LFPA 4BVOA 4O44A 2CQCA 3CCLN 1PJ5A 3ZSXA 3MWPA 4J2EA 4C1NK 4PYDA 3LDOA 4CNYA 4ZPBA 4Y2MA 3PJWA 3H08A 2CDQA 3C7NA 3BSCA 3CG7A 4LF5K 4G9ZA 1DJ0A 4RW6A 4UY85 3IM8A 4R0JA 3JTPA 5AZIB 2YWGA 1B4SA 3PG9A 5C42B 3KK3B 4USKA 3EVOA 3V9ZA 2GW8A 2HEKA 4KGKA 4XH5A 4NEYA 3CUNA 4M42A 3ILJA 4J9KA 4ID5B 3U8XA 1JMTA 2VBXA 3FK4A 3CE8A 4CJPA 4O5FA 2PSZA 4KFBB 1U1NA 5GAGI 3VV2B 2QKBA 2XS2A 4KHNA 2CJAA 4JV5F 1HNXK 3KHHA 2UU9J 4Y00A 4RWWA 3CT9A 3CCUN 1K73O 1FKOA 4DX6A 4BCAA 3AARA 1HL6A 1R27B 3NCPA 2J7WA 3LW5C 1L3TA 2BJDA 4IO9L 3Q7BA 2D0BA 2E20A 4X64J 3MN5A 3EGNA 4Y34A 4LF8J 1EKSA 1R8HA 4ZVQB 2HNYB 1BU6O 4CJKA 1R6YA 4I4BA 4CLKA 1S48A 2MPUA 4FYWB 1D5AA 4J7CA 1QZ5A 1PCAA 4JI4K 1WOSA 1A0OB 1X3NA 4IFYA 1NGBA 4FWPA 5CZ1A 2MB0B 4JUZA 1J9AA 1PYTA 3KLEB 4CI0B 2VQEF 5A0YB 5THWA 1N6QA 3BY5A 3J7YP 3BF4A 1O5JA 4M3ZA 4HACB 4F25A 1YGYA 4K5SA 4X4OA 3M6XA 3JB9k 3CJ7A 3I6PA 3KLVA 3SPYA 1RA6A 5AQOA 3M9OB 3MMAA 1TKDA 1ZH5A 5ADXA 4OGCA 1KR4A 3BYPA 1Q81O 3T5KA 4Y0FA 2WTFA 4FLYA 4KPCA 4LC9B 1X5OA 2L08A 2GHWA 2NNWA 3V6DA 2I7PA 3K8VA 1Q7LB 3NBPA 3GYNA 4MT1A 1GLCG 3QNWB 2R4FA 3DU6A 2O8DA 3HVTB 4H4OA 1FRIA 2ZQBA 4H4MB 3W61A 4FKYA 4E7JA 1FX4A 3TTFA 3UQSA 2HK2A 4C8LA 2ZBRA 4ED0A 3VTHA 3LA0A 4DSFA 3G82B 2O8CB 1HKGA 4JI5J 2FJBB 1BI4A 4GV6A 2CZ9A 3OSPA 4J90A 2PA8D 4G1IA 1LKZA 1D9FA 3QINA 3C6TA 2XM3A 2W8KA 4CGJA 3D68A 2ZBPA 2O01C 1T94A 1TVRA 1IR2A 4M5DA 1C1CB 4CBWA 4FVUA 2ZH3A 1ZAWA 2QGFB 3EZ5A 5BREA 4WYWA 5E7OB 2H4YB 2MQ8A 2UXDK 3HKWA 1VQ6S 4K0KK 4M7XA 2MQQA 2W6KA 3BUZB 3HRGA 1RT1B 1I39A 1R43A 4I2QB 3GE1A 3V1OA 1VK3A 2A1SA 1HBOB 2B51A 3A3PB 3E01B 4RL1A 3LP0A 1SQEA 3N6LA 4ES3A 2JFKA 4USVA 3BBFA 2DPJA 2HHPA 4QYRA 3QLHB 2OUGA 3EGVA 1ZYQA 4DTXA 2A5XA 4DV0F 5C42A 4OHWA 1VLYA 3O80A 5K8MA 4TQSA 4DUZK 3J8AA 1BMQB 4N56A 4J9UE 3ITHB 2FGOA 2V67A 1YXQA 1X9SA 1G3OA 5U47A 2XMAA 1TAUA 2VJVA 4BC9A 2WB1D 2W9AA 5LJ3Y 2UXCK 1NBEB 2AZ3A 5AQPA 2F1FA 1RWPB 4A4JA 3CM6A 3H2LA 3UE2A 3ILIA 3ETOA 5AQLA 4XH4A 3RRGA 4UY8O 3L4IA 2Z1JA 3V1QA 3RBZA 1S1WA 3LL3A 3V81B 5AQJA 2RKIA 4ZTFA 1VQON 2HFUA 1NPRA 4LSNB 3UD4P 2DT9A 3CDEA 4JP8A 5K14A 4WFXA 2KFZA 4ZHRA 3MM6B 2D0AA 3G10A 4MMOA 1SI9A 2CG8A 3NRBA 2NCKL 1GLFO 2BZ2A 1VQ5S 1K8KA 1N33J 1PYSB 4JKDA 1N5TA 3M2UB 3FLCO 4HTLA 1NM2A 3KJVA 2YKMB 3OUYA 4ZJLA 1WACA 3EDRB 3H3NO 3B6BA 3EYZA 4F36A 1N56A 1FFSB 4DF8A 3IG1A 1XMQK 1HPMA 1FX2A 5IM0A 4EP5A 3H40A 1XJWB 4P2FA 2YJFA 4C98A 1YJ9N 4K59A 3ONQA 4FZZA 1U1PA 5EHHA 4O8UA 1VQ5N 4JS4A 2XMTA 6AT1B 4BRHA 4G3IA 1UVIA 4Q2LA 3LPUA 1U6BA 3C15B 1KFDA 2KZMA 7FDRA 2CWXA 4ZPDA 1M5VC 3IA0A 3OBYA 4OYWA 4OYIA 1V9OA 2MGZA 4QS9A 2HHTA 1S5JA 1YI2N 2I5JA 5EXWA 2MXYA 2DGWA 2GQCA 2Q97A 1JLGB 5BN8A 5FPMA 2UVUA 4C3LA 3HHLC 3OXFA 3M32B 5KFJA 3PIOL 1X0PA 5AR0A 4KHPJ 4USTA 4E7IA 3CCVS 4I6MA 1WG1A 3BR8A 1TKXB 2D9OA 2I1RA 4QWCA 1VQ9N 2HSEB 2UYTA 3QSIA 3AVLA 5JVGQ 2CPXA 2V7YA 3G82A 4DCJB 4NLOA 2JC0A 4CD3A 4CRJA 1BE4A 3NWGA 3R1LA 3OHRA 2RRNA 3H5SA 3DXSX 4B9UA 3PX0A 2XI2A 1N5SA 2XHCA 3PV8A 1NUEA 1EAYC 1NGDA 3NE6A 3HL8A 3GV8B 2CPYA 4OI3A 3G25A 5E2QA 1WC1A 1YI2S 2MLXA 1EQYA 3WC0A 2PIIA 1S76D 2DO0A 4B3SK 5SUHA 3EKUA 1Y7PA 5C12A 2BQ3A 2J0QD 3L2UA 3U9ZA 1VGYA 2GAHC 1ZBUA 1RT7B 3DI6B 1KC8T 1YTUA 1IQZA 1Z2ZA 2HHXA 4P52A 4ED1A 2F7VA 1VQ4S 4X66F 1REVB 1A5VA 1JNZB 4Y2CA 2WCXA 2I2YA 2EFNA 1TAQA 4JHDB 4ID8A 1NEEA 2HF4A 3OS1A 2ZJPL 3OTEA 4JKHA 2ATLA 3LDLA 4M5LA 2HLUA 4DQRA 3NGTA 2DO4A 1FKOB 1BOTO 3NS6A 3OTOF 1UVKA 2IYIA 2ZF5O 2HW3A 2HVIA 4IJAA 3ETMA 4LRAA 2R7RA 2DHHA 4M95A 3ZT0A 4F2SA 2BJ9A 1JXBA 3T1YK 5D4OA 1T8EA 2QWPA 1KLMA 3GG1A 4OI4A 4LVOP 3W63A 4O0IA 4OX9K 5BR8K 1TGOA 3RTVA 1SBRA 4M5NA 2AQ4A 1T05B 3ZZTA 3KK3A 4YQWA 3OYEA 3EDQB 3NMAA 3KG1A 3DOLA 1YRUA 2G1HA 5TKWA 2CG4A 4M3XA 3D54A 4ZVHA 5I42A 3EKSA 2A1RA 4JI8K 3HJFA 4P10A 2D3UA 1F9EB 4CQ1A 1NK8A 1VAZA 2FTRA 4ZVOB 4ZDNA 1FFGB 3K58A 4JI8F 3OSNA 4IUFA 2WUSA 3TVKA 4A8WA 1UFLA 1KVAA 3ZT2A 4Z94A 2KHCA 3FBBA 2GWKA 3NF9A 2P9PA 3TPQA 4DSKA 2W7AA 3I9V9 2KM8C 2PFFB 4FLVA 4M3YA 1RT2B 3NF7A 2KKHA 5BR8F 4JKGA 5LL6Z 3A0IX 5K8OA 2XCAA 3I55S 3CCMS 4OKJA 5AQMA 5FLXO 4Y1CA 1EWQA 3G6YA 5CE3A 3QWPA 5KT2A 4CLPA 2E1ZA 3T1YF 2DYAA 2IJRA 3FVYA 5KFXA 4BR2A 1NLVA 1XC9A 4ECXA 2PGCA 1M5HA 2BW7A 1ZC6A 3DGPB 2W41A 1AXQA 4PKGA 1HHSA 2ZHAA 1ZBSA 4IG3B 2RE2A 4ISFA 1BDGA 2MKIA 3SNNA 4ER8A 3T1HJ 2HVEA 1B99A 3ENHA 3S9HA 3QWUA 3MM9B 5HI7A 2Y0SD 4WTYA 3AY9A 3FNNA 3LP1A 2R2TA 2DXFA 5LSLA 3OYAA 1UAXA 3O6WA 3I55N 5ETOA 4FP9A 4ZK7M 1EIYB 2W9CB 2AA4A 1FJEB 1HJRA 4KI4A 5HVHA 2HMPA 1WF2A 2C22A 4ECYA 1SUQA 5FRMA 4BRNA 2G13A 3QMQA 4UW2A 2R7QA 1ASWA 4JI1K 3DU5A 3IS9A 1RT7A 3DI6A 3SJHA 4JI5K 4AQYJ 4IFEA 4OLOA 3VR1A 5DQGA 3OTDA 2ADCA 2LP4A 4JNEA 1JCEA 2HK3A 4R5PB 5DK5A 1SV5A 2F40A 1FHTA 1WDTA 1I94F 4DPYA 1FJ7A 4KGMA 4B9LA 5KT6A 3CJ0A 2ZBQA 1SAZA 3CI5A 4L75A 4LFAF 1NZ8A 4GO5X 3LM9A 3FZFA 3MAQA 4RW6B 4TNOA 1LV5A 5A76A 1TL5A 5FJ4A 1TMJA 4B08A 4U6PA 3PRBA 2MZ1A 1YJWN 3C46A 1CJTA 1AA1B 2VF3A 2XS7A 1W25A 1RHRB 2F8HA 1U1QA 3VEZA 4Q8EA 1CULB 2DVIA 5LMNF 2HBKA 2HS4A 2VDIA 4GVMA 1LW0B 2BJ3A 3TA2A 2PMZD 4C23A 4NYZA 1JJ2M 4B9VA 1JLBB 2V2KA 3OYKA 3IUCA 1R0CB 2NLWA 2MEWA 1EARA 2P9UA 2UXCJ 4A8OA 4DV3K 4V1Ak 5A8KA 2V4RA 4I2PB 3EZUA 2FQQB 3GILA 5DM7Q 1ZZFA 5J2NA 4LRCA 4M5IA 2VOOA 4UOCA 1KHWA 4DR5F 3D7EO 3DXKA 4NCBA 4A5AA 3DRSB 1HWJA 1W26A 4HKQA 3AXKA 4ED4A 3AO2A 5D0GA 3S41A 3IR6B 3FRYA 5JVHQ 4DV1F 2PI4A 1JB0C 3AB2B 1NSAA 4WIIA 2NXCA 2XZTB 1YKWA 2DGSA 1S6OA 3AOAA 1E6YA 4WK3A 2AU0A 4E7HA 3PY8A 3R1HA 2OGUA 2ZDPA 1VRTA 3MR7A 5F2RA 1LOUA 4RUCA 3GL1A 5AQFA 4AM6A 5M2RA 4RWXA 1WNSA 1QTNB 2BRKA 2E4LA 2OPQB 2UXCF 6FD1A 1M0SA 2FSNA 3C14B 4PUOB 1G2EA 1JNRB 3DRRA 2F5GA 4NYPA 3F5TA 3VESA 3BJYA 1QM9A 3FCHA 4ILLA 4BWJA 5C5JA 3J7ZO 2P9SB 4LUBA 4DR7J 3E3XA 4FCYA 1FRXA 3BN7A 3VAFA 1S4EA 4JI3F 2O8FB 3QEIA 5KTQA 2W9CA 2JWLA 4BR9A 4P74A 2MZTA 1LCUA 5CHIA 3CQXA 5F8IA 2XLJA 5KFKA 1BUPA 3OYGA 1IKVA 1N36J 3D6RA 3C66A 3VAJA 3BDEA 3WXKA 3Q22A 2RAQA 4CP5A 2FY1A 4IH5A 3UNGC 4CHOA 2QO3A 1BISA 2E9TA 3TAEA 3NGKA 1VS3A 1NH7A 3BP8A