2ZE2A

Crystal structure of l100i/k103n mutant hiv-1 reverse transcriptase (rt) in complex with tmc278 (rilpivirine), a non-nucleoside rt inhibitor
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, hydrolase
molecule keywords Reverse transcriptase/ribonuclease H
publication title High-resolution structures of HIV-1 reverse transcriptase/TMC278 complexes: Strategic flexibility explains potency against resistance mutations.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 136
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ze2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ze2A05
1SUQB 1S1WB 1YVFA 3OYKA 3VQSA 5FRMA 4K4SA 1IKXA 1TK0A 4PUOA 3VQ8A 3MF5A 4ECYA 3AVKA 1TL1B 3M8RA 3RB4A 1DLOB 5C25A 3KIOA 2YNFA 4DF8A 2HWHA 4BE2A 1C6VA 4OPKA 5KG5A 4Z0UA 5HP1A 3HPOA 1G15A 4HTUA 3S9HA 4FS1A 4CF1A 5T7BA 2C2RA 4X2BA 5F8LA 3OSPA 5KG2A 4NLVA 3DRSB 4LH5A 4N41A 3LP1B 1D5AA 2R8IA 3NAHA 4AHRA 4IRKA 5KFIA 4WE1A 2BANA 1VSLA 1TQLA 4Z4IA 2FVSA 4N5SA 2VG7B 3RMAA 1N56A 1LWCB 4ED1A 4CJTA 5KFQA 2X6NA 3DLHA 3LP0B 1C0TA 3AVGA 3DLKB 3MEDB 4G1QB 1SKRA 3NGDA 1LWFA 3CJ4A 4IBNA 4ECSA 1L5UA 3M8QA 3TANA 5L1KA 4DU4A 3QEWA 4CIEA 5HBMA 4ID5A 3SPZA 4FJ7A 2W9BB 3KLFA 4FJ8A 3JSMB 4Y1DA 4CJUA 3NH1A 1O1WA 1S1XB 4DQSA 4RUCA 1CZ9A 4JLHA 2F8EX 4NYNA 4G3IA 3AVAA 5C24A 2G8UA 3ZT3A 3Q8RB 3B6PA 1S48A 2FVPA 3PW5A 1RTHA 3WNEA 1UOCA 3HM9A 2V4RA 2B5JA 3LWMA 1JLBA 4MIBA 4J9OA 1JXLA 4DU1A 4O4RA 4F4YA 5I42B 4E3SA 2GIRA 1X9MA 4CESA 2DPJA 2VWKA 4E7KA 3HO1A 5KRTA 4CE9A 3MR3A 5KRSA 4W5NA 1LWEA 3OHBA 3OVNA 3NH0A 1RT2B 1B9DA 4IG3A 4TLRA 4CEFA 3LZJA 4O4GA 4KB1A 2QKBA 1S0OA 2OPPB 1RTDA 3OL8A 4YQWA 1S1UB 3PHEA 1XWLA 2HNZA 2XY6A 3H40A 3HXMA 4K50A 1KVBA 3SQ0A 3ZT1A 1IKXB 4AHVA 4PUOB 3DI6A 4KI6A 5DQIA 4KHSA 5C25B 2DFHA 3DLGA 3AVHA 2Z1JA 4TN2A 4ED2A 1NK0A 4WFXA 2YNFB 1T3NA 4J2BA 2JEGA 4IDKA 3LDSA 4OL8A 4ICLA 5HP1B 2IMWP 2IGIA 4QPXA 1XR7A 1DTTA 3GIKA 4KKOB 2XY5A 3MEEA 4DSJA 4IH5A 1SH0A 3PW7A 1ZETA 3D0PA 3MFIA 1RBUA 4M3XA 2YHBA 4KHRA 5DMRA 1XHZA 1QUVA 4M94A 4FM2A 3CJ2A 2ASJA 2PYJA 4M3WA 2R2RA 3KLEA 1RA7A 1TKXA 1U04A 4CEAA 1UA1A 4IH6A 4KSEB 4YR2A 4DFMA 4BDPA 3V4IA 2BANB 4N76A 4IFVA 5DG7A 3VQAA 3TI0A 3DMJA 1W0HA 1C0UA 1S6PB 4Z4CA 1B92A 5CYQA 1C0TB 4FK0A 3LALA 1LWFB 2ILZA 3KHLA 1KFDA 4LD0A 1DTQA 3C6UA 5CYMB 4B3OA 2YNHA 1X9SA 3DRPA 3M8QB 1TKZA 3M9MB 4Y34A 3OLAA 2QK9A 3SUQA 4C8OA 5JUMA 2ATQA 2D7SA 4KV8B 3HVAA 4NCAA 3KLFB 1RT7A 5J1EB 4HVJA 2VG6B 5T14A 1TK5A 3OL7A 2GUIA 3LZIA 2FBXA 1NK4A 2J6SA 1SV5B 1A5XA 3K58A 3K57A 5C24B 3SJJA 4WXWA 2P1JA 5DK5A 4EBDA 1RTHB 4RW8B 3VQ7A 4DSLA 4CHNA 3RRGA 3NGYA 4OLBA 2C2EA 3OL9A 4MK7A 1RT6A 4M3RA 4CEZA 3MECA 1HYZA 1SKSA 4DL2A 3H2LA 4OPJA 1LWEB 4DF4A 3G86A 4CF8A 4J9PA 4RW4A 1J5OA 4ED3A 3TVKA 1J53A 4CCHA 3VQ6A 3OYHA 2I5JB 1C0MA 1NKCA 5D3GB 3C6TA 4URQU 4QCLA 1QAIA 2HNZB 3G6YA 3TQ1A 2C28A 1TAQA 1EXQA 4B08A 4XO0A 3S3MA 5KG7A 4FLWA 3GV8B 2XHBA 3VQCA 3L2WA 4DSEA 4CJ5A 4FLUA 4O3SA 4CGIA 5J2QA 4J9NA 2BQUA 4R8UA 1N6QA 4LSLA 4DL4A 3UIQA 3KKRA 4NLSA 2O4GA 4O0IA 1XHXA 3MEEB 3NGZA 1VSDA 4FLVA 4ECXA 2F96A 3SFUA 2AJQA 2BDPA 3EPIA 1NK7A 4MFBB 3KLEB 3H08A 3PO4A 5KFBA 4JV2A 4CF9A 3V4IB 4MKAA 4TQRA 4NLUA 4C8NA 4CJRA 1KHVA 4FJGA 1HPZA 4B8CA 3IGNA 2W9CA 5E41A 2RN2A 3QEIA 3IS9A 4J9MA 3OYGA 1WAJA 4DS5A 3TARA 2UVVA 5DQGA 2QE5A 4RNOA 2HNDA 1DTQB 4F2RA 5J2MB 3T5JA 1RTIA 4B3OB 2YNHB 3DRPB 3QGGA 1TKZB 4K4XA 1U47A 3RAQA 4DSFA 5K14A 1HNVB 1RT3A 3PO5A 3KK3A 1RT7B 5F9LA 3LPTA 4FJKA 3V6KA 2OA8A 2OPSA 5KFPA 3AVBA 4EEYA 4DQRA 4KTWA 4PQUA 2WB4A 1JLCA 3H98A 1IH7A 4EP4A 2OZSA 1LAWA 5KI6A 1XI1A 1RBTA 2GIQA 3TAEA 3ZT2A 3QO9A 5EU7A 2A1SA 4PWDA 3MECB 2E9RX 2BR0A 5HRSA 1JIHA 4OKKA 3U3GA 4IRCA 1RDBA 2E4LA 3H59A 1BHLA 2WTFA 3MXJA 4ED6A 2QKKA 4C8KA 1T03A 4EBCA 4KFBA 2R8KA 3OYEA 3C6TB 3WNGA 2G8HA 4DQQA 1QSYA 2V4QA 4FLZA 1R0AA 3QESA 2J6TA 2RDIA 3HPGA 3LP3A 2ETJA 2W9AA 3V6JA 1J9AA 4R5PA 1FK9A 3GIMA 2XCPA 3ZSWA 3CM5A 2G8IA 1HQUA 2HNYA 5J2QB 4R8UB 2GC8A 2JEIA 1S5JA 1IKYB 4LSLB 5KFFA 4DTJA 4KTZA 2E6MA 2P51A 1T05A 4DSKA 3SI8A 2AU0A 3L8BA 3GQCA 4ID1A 1W25A 4NYFA 4HHTA 1VRTB 4DTUA 3ZCMA 4ZMMA 3EYZA 4I2PA 4NLXA 4O3QA 1IO2A 5FDLA 3QINA 1N5YA 1TKTA 4RNMA 4NLRA 3IG1A 2IAJA 3GIJA 3NCIA 2HHQA 3V9WA 1NNDA 3ISND 1HPZB 1QSLA 1GOAA 1U48A 1TGOA 3SI6A 1J54A 4K4VA 3IS9B 3MR2A 2Z1GA 3ALYA 3VQ9A 3O4QA 1QS4A 3KJVA 4E7LA 2G8VA 3FQLA 4DL7A 1BQNA 1ZTTA 3N6NA 3I0SA 3AVFA 3T3FA 1RTIB 4KE5A 2AGOA 3UPFA 1KRPA 3M9OB 2FVRA 1D9DA 3MR5A 5KGWA 4KI4A 4DS4A 4CK3A 3OS1A 1JX4A 2HHWA 1RT3B 3KK3B 3N6MA 1S97A 2GV9A 4DTOA 4NLDA 1WSIA 1JLQA 4NCGA 2OPSB 3HP6A 4RW6B 1JLGA 1ZTWA 1RYRA 4GC7A 3CG7A 2XWYA 4KO0A 3HPHA 4PQUB 4Y3CA 3TAPA 3VA3A 2Y1IA 3PX0A 1K1QA 5F9NA 3HVTA 5KFWA 3F73A 3ZSVA 2GBZA 3UDLA 1D9FA 2W7PA 4J9KA 3QO9B 1NHUA 3L3UA 4KBIA 3VQPA 3UQSA 2HW3A 3BSNA 4U6PA 3DOLA 5F8HA 4CJSA 2YV0X 1SL0A 3EZUA 1WNEA 2ZQBA 4MH8A 4IKAA 4FJJA 3EZ5A 3DLEA 5F8NA 4OGCA 4KFBB 3PUFA 3I0RA 2C2DA 3OYMA 1WSEA 2X78A 4CECA 3EY1A 2ZD1A 4Q0BB 3QYYA 3GV5B 4JUZA 4OKEA 2RF2B 3H5XA 3MAQA 4R5PB 1FK9B 1HQUB 2WRMA 2HVIA 5KT4A 4AHTA 4LQ9A 5HLFA 4XPCA 3NF7A 4O5BA 4WZMA 4B9UA 4KB7A 2JC0A 3VQ5A 4O44B 4ELVA 1S9GA 1NKBA 2YKMA 3D45A 3G6XA 4NLTA 4AH9A 2D5RA 4JS5A 1TP7A 3M9NB 4I2PB 3RB6A 2OYQA 5FDLB 1LV5A 1N5YB 5KFUA 1TKTB 1U4BA 3QEVA 3PY8A 1RILA 3D28A 2IAJB 1HNIB 1WSGA 2ASDA 1RDRA 3GYNA 4HUFA 2XI3A 3HKWA 1CXQA 4OJRA 3CJ3A 3NFAA 3WNHA 4I7FA 1UWBA 4ZP8A 4JRQA 2FJWA 2HHVA 1JXBA 3L2UA 4FLTA 4JV0A 3KJVB 2HMIA 2HWIA 3DYAB 1FXXA 2Y1JA 3I0SB 4K8ZA 4W5TA 1IKVA 1ZBUA 4CHOA 2EC0A 4CERA 1S1TB 2KW4A 3HHKA 5KFDA 4B9TA 3MEGA 3QZ7A 1TKDA 3DRRA 3KK1A 1RT4A 2DFEA 3FDSA 2FC0A 2VA3A 1N4LA 1JLGB 1VSHA 4O3OA 4YMEA 4ZVFA 2J6UA 3GIIA 1BQMB 3M8PA 2G8FA 1L3TA 3PZPA 5F8MA 3H4DA 3CFOA 2RPIA 2E9TA 3HVWA 4CGJA 1JL2A 3O3GA 1S1VA 5KFVA 3DLRA 1Y97A 3BJYA 3L3VA 3QIPA 4ELTA 4H4OA 3QNNA 4AILC 4Y1CA 4NLPA 5CZ2A 1CSJA 4EO6A 4CJLA 4DLEA 1RDDA 3OYIA 3ISNC 4CFAA 3KMQA 4E0DA 2BQ3A 4CGGA 1CLQA 1EETA 1QE1A 3AO1A 2ZD1B 1HYVA 4F4KA 2QV6A 4CJKA 1U09A 5DGBA 3SQ4A 4E89A 2XRIA 3PW0A 4Z4EA 2JLEA 4CGDA 5HLFB 3KNAA 1JL1A 4CJQA 4WE1B 5KFGA 4Z4FA 2RDJA 2FVQA 1REVA 1S9GB 3SV3A 1NOZA 1IG9A 1C1BA 5HROA 2YKMB 4PA1A 3AO2A 2IM1A 3OJSA 2ILYA 3QIDA 3PVXA 1HRHA 4DWIA 3CIZA 4EZ6A 4R0EA 4TYBA 2R2UA 3RAXA 4IR1A 3QNOA 2DY4A 4DTMA 4DU3A 2DTUA 4DFJA 3RR8A 4RNFA 4B9NA 1JLAA 2BGGA 1JKHA 4RW9A 5HBMB 4ID5B 2OZMA 4I7FB 1UWBB 1GX6A 4FVMA 3T5KA 3SUNA 4F4XA 4K4YA 1U49A 3HK2A 2ALZA 4O55A 1JLEA 4E7IA 1X9WA 4F4ZA 2Z1HA 1IKVB 3L2QA 4H4MA 4Q45A 3BGRA 2YHAA 3EPGA 1C1CA 1RTJA 2FLPA 4W5OA 4DSIA 3RBEA 1A5WA 2B5JB 1JLBB 3ZSYA 3SFGA 3DRRB 2FBTA 3KK1B 3V81A 2O5DA 4FS2A 4CHZA 4URSA 1SKWA 1ASUA 4TY9A 4FW2A 4CF0A 1IM4A 3PJXA 4J9LA 2KZZA 1T8EA 1CXUA 4CF2A 1K1SA 3M8PB 4IG3B 2IBKA 1KSPA 4O4GB 1ZBIA 3O3HA 2IM0A 1RTDB 1S1VB 1LW0A 4GMJB 3ITHA 3G0ZA 3QIPB 3SQ1A 1WSHA 4WFYA 3ULDA 4O3PA 4B9LA 2JC1A 5KFNA 3DI6B 5CZ1A 1NJWA 1YTAA 3S3OA 4C8MA 3DLGB 3OLBA 4BACA 1VRUA 3OYFA 2HAIA 1KLNA 3WNFA 1VSFA 1LW2A 4IDKB 1ZBLA 1EETB 1BIZA 1QE1B 4ICLB 2VA2A 4WZQA 3PV8A 1DTTB 4M41A 3BSCA 4AHUA 3SZ2A 4K4UA 1S10A 1TVRA 4QWAA 3CDEA 3BREA 4CEQA 2VG5A 4FK2A 1FKPA 2YKNA 2AGPA 2UVWA 1TKXB 2WCXA 2FJXA 1S0MA 2XGQA 5KFEA 2YNGA 3GV7B 3MXMA 5JS1A 1C1BB 4IFVB 1BCOA 3LAMA 3UR0A 1HJRA 4DQPA 3DMJB 1C0UB 3PX6A 1WLJA 3MR6A 1RDCA 5CYQB 1RCHA 4J9QA 3OS0A 2WK4A 2D0AA 5KFAA 3C6UB 1EP4A 5JS2A 1BGXT 3BSOA 1JLAB 1JKHB 3KD1E 4NLGA 4HCBA 1K6YA 4JS4A 4C8LA 1IKWA 3DDKA 3K5NA 3BQ2A 4QWEA 3AVLA 3OHAA 2IC3A 1BIUA 1JLEB 3SYZA 1NJYA 4H4MB 4RNHA 5KFTA 3BGRB 1KCFA 2C22A 3AVCA 1C1CB 3VA0A 4U7CA 2Q3SA 3V1RA 4FCYA 2PZSA 1YT3A 1MU2A 4QW8A 4KTQA 4DTRA 1X1PA 4H8KA 4FK4A 3HP9A 1TL3A 4ECQA 1KHWA 4YNQA 4IRDA 3V81B 1RT6B 5DGAA 3QZ8A 3LWLA 3C95A 4ZTJA 3E01A 2R8GA 2KZMA 5F8GA 1EKEA 4ED8A 1S9EA 1S4FA 1S9FA 4RW4B 1J5OB 3CQ8A 4Y2CA 3L2RA 4FYDA 4DG1A 3RMBA 4KAZA 4YR3A 1LW0B 3OL6A 1RAJA 3ITHB 3IRXA 4O0JA 4ZHRA 4KHWA 3CJ0A 1S1WA 4WYWA 4ED0A 4CEOA 4CHPA 5KFYA 4AHCA 1C2PA 5KG3A 3CDWA 2BE2A 1GX5A 4DLGA 1DLOA 4RG8A 1WNSA 5KFZA 4HUGA 1F21A 1N6QB 1FKOA 3O4NA 3MTKA 2UVUA 1VSEA 1LW2B 3HYFA 2OPQA 3CWJA 5KFHA 3NBPA 4F3OA 2CKWA 5DG8A 3ZSOA 3NKYA 2IS3A 4ECVA 1YVUA 4ECZA 3LP1A 2VG5B 1FKPB 4K4TA 3M8SA 3GILA 3V6DA 4O3NA 3DM2A 2EHGA 2R8JA 3NF8A 3T5HA 2XY7A 2I1RA 3U6FA 3V1OA 2YNGB 4NZ0A 5KT5A 2VG7A 4IFYA 4N56A 3RBDA 4ZVGA 2D41A 2W9CB 2XY8A 4IOBA 5KFMA 4B9SA 3LP0A 3MXIA 4JRPA 2OPRA 3NDKA 3DLKA 4CJVA 3T19A 4WXOA 3K2PA 1Q8IA 3ZT0A 3I5AA 4RU9A 2HNDB 3OYAA 4CEBA 3CDUA 4E19A 1EP4B 3SPYA 3KD5E 4ECUA 3TR8A 3LANA 4DQIA 5K14B 4FM1A 3JSMA 4FJHA 4CJ3A 1S1XA 3I5CA 4KHQA 5DLFA 3AVMA 5KFRA 2IC3B 5EUHA 3BQ1A 2D0BA 4CGFA 4F4WA 3QEXA 1JLCB 3NGIA 5EWEA 4BDYA 3PR5B 3KHHA 3KLHA 3ZSQA 3KLVA 2PY5A 5HRNA 1MU2B 4FLYA 1TL3B 4I2QA 3T5LA 4NRUA 5EDWA 1TAUA 4E1MA 4PWDB 2WONA 2NUBA 1RNHA 5I3UA 2HHTA 3E01B 3LPUA 1RT2A 4FJMA 4EZ9A 4HYKA 3IAYA 2B6AA 4FXDA 1EX4A 1D1UA 4MQ3A 4OGEA 3SUPA 2WOMA 1T03B 2E6LA 3ZSZA 1BISA 4ZPBA 3QETA 1GOBA 4ZHRB 5KG0A 4CK2A 1R0AB 3KTQA 3P5JA 4NLYA 1UAXA 1JLFA 4FW1A 4CIGA 2BE2B 3CYMA 3OY9A 4KHUA 4NRTA 1SL2A 3BSAA 2HNYB 3BR9A 3I8DA 2JEJA 1FKOB 4EYHB 2AQ4A 3NAEA 4MK8A 3OS2A 3AA3A 3T1AA 2OPQB 2RKIA 3NBPB 2KFNA 4KKOA 3PW2A 2KQ2A 3AO3A 1Z26A 1S49A 4M45A 1T05B 2FVCA 4FBUA 3H4BA 2Z1IA 4FJNA 4LH4A 3A2FA 1ASVA 3OYCA 2W42A 3E51A 3NHGA 1L3SA 1UA0A 3V6DB 2ZE2A 3TAGA 3CFPA 3DM2B 3IG1B 4KB0A 1ASWA 4ZPAA 3QEPA 4F50A 5KT7A 4BWJA 4M95A 4M3TA 3AA5X 4CHQA 4IFYB 4HKQA 1S6PA 3C94A 4W5RA 2AX1A 4NYZA 1BCMA 2OPRB 4CEDA 4FBTA 4BE1A 1SH2A 3PW4A 1BQNB 5CYMA 2XCAA 2HB5A 4QAGA 1WAFA 1L3UA 2FBVA 4RW7A 2YNIA 4F8RA 4KV8A 5KTQA 4XIUA 4NLQA 3TABA 4KPYA 4L8RB 3PX4A 3V9SA 5J1EA 2EX3A 2VG6A 1QHTA 1NK9A 3SCXA 1SV5A 2ASLA 4B9VA 3N6LA 1NKEA 1JLQB 3KOAA 4NCGB 4E7HA 4BDZA 3K5LA 2QXFA 4KO0B 3AA4A 3SQ2A 4AHSA 4RW8A 3QGHA 3P83D 3KLHB 3HVTB 4BWMA 4DMNA 4YFUA 1KVAA 4I2QB 4B9MA 1I6JA 3KLGA 3OSNA 4IH7A 4CK1A 1VSIA 2WONB 2FLLA 4CJ4A 3DOLB 5FROA 1NJXA 5I3UB 2AWZA 1VSKA 4Q5VA 4FZZA 4M3UA 4HCCA 1CZBA 2B6AB 2JEFA 2ITGA 1Z4UA 2I5JA 4QW9A 1RA6A 3DLEB 5D3GA 2WOMB 3CFRA 3I0RB 4ZVEA 3HL8A 3KHRA 3NF9A 4KAIA 2IM3A 3KK2A 4CFCA 4DTNA 3OYDA 4Q8EA 3DLBA 3FQKA 1KTQA 1JLFB 5KG1A 1LAVA 5KGXA 5DQHA 4OLAA 4IG0A 4M3ZA 1B9FA 3ICLA 1NK8A 2VWJA 3PR4A 4ECRA 4CJFA 3IN5A 2O4IA 2D3UA 3NE6A 4GVMA 2CJQA 2RKIB 1NK5A 2FLNA 3AVIA 5KFSA 1T94A 2IJNA 4FJXA 3Q8SB 4MFBA 4TQSA 4TSXA 2ZE2B 3TWHA 3Q8PB 4EYIB 2KTQA 4E1NA 4ECWA 3OYNA 3OYLA 3RR7A 1XR6A 3KLIA 3BQ0A 1QTMA 4QWCA 1A5VA 4KHNA 3V9UA 1VSJA 1BL3A 2F8TA 4ECTA 2UUTA 3VQBA 4ZPDA 3AV9A 5EWFA 3QERA 2D0CA 4B8AB 3NAIA 5KFLA 3QLHA 2HMIB 4ELUA 2V0NA 5J2MA 4K4WA 2AX0A 4W5QA 1ITGA 2B4JA 1Z25A 2OH2A 4OVLA 2ATLA 4RNNA 4FJ9A 3CM6A 4RW7B 4Q43A 2YNIB 1HNVA 2G8WA 4IKFA 5HRRA 1JXEA 4ZTFA 3O3FA 4K4ZA 3NL0A 1NOYA 3MEGB 3VN5A 1RBSA 3THVA 1RT4B 1U45A 4MKBA 2HVHA 5JXSA 5KFXA 1GOCA 2A1RA 2UUWA 3KKSA 4Y2AA 5L1LA 2W8KA 1BI4A 5CY4A 1MMLA 4DL5A 3OYJA 3LP2A 4E7JA 3SUOA 3KLGB 1QSSA 4ZP6A 1OS5A 2F8SA 4H4OB 1ZBFA 3JYTA 1HMVA 4ED7A 3AA2A 1QAJA 2R8HA 4QWDA 3K59A 3RWUA 1TV6A 5F8IA 1N48A 3PJWA 4J2DA 4DTPA 3FSIA 2X6SA 3TAMA 4KREA 3H5YA 4OKJA 1KLMA 2HHUA 4Q44A 4DL6A 3HVRA 2D3ZA 1TK8A 2FBYA 3KK2B 3KMSA 4ZP7A 3OYBA 4RUAA 3NMAA 4CHYA 5J2PA 4CJWA 4I9LA 5C42A 4GC6A 2V9WA 4DEZA 2XGPA 2FJVA 4LSNA 1WN7A 2BRKA 5L1JA 5DLGA 4F3TA 1RBVA 4IG0B 5SZTA 1IKYA 3NH2A 3RRHA 4FJLA 3HT3A 4RZRA 3NF6A 4DL3A 1REVB 4TY8A 3FFIA 3TAFA 1VRTA 5HROB 4MIAA 3ASMA 4HUEA 4EP5A 1VK0A 3H5SA 2W8LA 1I39A 1SH3A 3AVNA 1HQEA 3IGVA 2R2SA 2G8KA 3KLIB 4CJPA 4ZP9A 3QGIA 5HRPA 1NJZA 4F2SA 4KHYA 4RW9B 4K8XA 1ZBHA 2AGQA 1NK6A 2W7OA 1Q9XA 3CVKA 4M3YA 3V1QA 1L3VA 3DOKA 3RMCA 4MK9A 4NLWA 2HHXA 3QLHB 3V9ZA 2DFFA 4Z4GA 3VQDA 3FRZA 5KFCA 1RT1A 1QQCA 1RT5A 3KHGA 1RTJB 4CGHA 4J2AA 4NCBA 3RB3A 1S6QA 5J2NA 3D5MA 3B6OA 4RW6A 4DTSA 4FLXA 4Z4HA 1RDAA 2LSNA 4H54A 5SWMA 4JV1A 1D8YA 1WSFA 5KFKA 3HJFA 3K5OA 1HYSA 4KRFA 2IOCA 2E9ZA 3V6HA 4UQGA 1BI4B 3U3YA 2X74A 3LP2B 1SL1A 1HARA 1SUQA 3JYTB 1HMVB 1XR5A 3HSTB 2KFZA 1TL1A 1TV6B 4FZYA 2R2TA 1ZYQA 4EO8A 4XPEA 5EWGA 4DTXA 3TAMB 1T7PA 3K5MA 5KT2A 1KLMB 5KT6A 1VRUB 2XO7A 5KFOA 4FZXC 1VSMA 4ZPCA 4IQXA 2P5GA 4Q0BA 5FRNA 4WYLA 4DFPA 2RF2A 5J2PB 3ZSRA 3TAQA 5C42B 4FM0A 5KG6A 2ZKUA 2IM2A 1NHVA 1YTUA 1TVRB 3DRSA 4LSNB 4ZVHA 3S3NA 2PYLA 1KFSA 2YKNB 2IJFA 3ZSXA 4O44A 1WSJA 4DFKA 3G6VA 4EBEA 5L1IA 4TY8B 3FFIB 4Q8FA 5KG4A 2XI2A 1LWCA 3V9XA 3RMDA 2JGUA 2P5OA 2UVRA 1Q9YA 1W9HA 3BDPA 4NLOA 3MEDA 4G1QA 4LY7A 1HQEB 3SV4A 1HNIA 4TXSA 1RBRA 3AVJA 3H5UA 4I9QA 3VQ4A 3P1GA 2BRLA 5DG9A 4LQ3A 2BQRA 4WFZA 2W9BA 1IKWB 2DPIA 3AO4A 3QIOA 3DOKB 2WHOA 2IDOA 3DYAA 3F9KA 2HHSA 3RB0A 4CFDA 5L9XA 3LAKA 3L2VA 4YR0A 3RTVA 5F8JA 5KT3A 1S1TA 1RT1B 5C5JA 3G10A 3VQQA 1RT5B 4YP3A 4O3RA 4TYAA 3OJUA 4GW6A 3SNNA 1S6QB 2B43A 5J2NB 3I5BA 3MFHA 4J2EA 2XC9A 1C1AA 1XC9A 5I42A 4FJ5A 5KFJA 4J9RA 2R7YA 4URGA 3VQEA 4J9SA 1BQMA 4KHMA 4CEEA 3CO9A 4CFBA 3AO5A 1D0EA 4QOZB 1I3AA 1KVCA 1HYSB 4CIFA 1RYSA 1S9EB 4BE0A 3Q8QB 4CJEA 2OPPA 1S0NA 4PY5A 4QWBA 1S1UA 4DG1B 4FJIA 3ZT4A 4N47A 4M42A 3CJ5A 2IA6A 4IR9A 3IRXB
chains in the Genus database with same CATH superfamily
2QGFB 1S1WB 3OYKA 2V7YA 3VQSA 3GWCA 2UUBK 4K4SA 3U02A 5AQQA 2CDRB 3PHTA 2HFOA 3MF5A 2E2QA 1U2VB 4LF7K 1GLCG 3M8RA 2NZTA 2B4OA 3W2WA 1DLOB 3EE8A 1MWZA 2VV5A 3UE2A 2WAQD 4BE2A 5HVHA 4NLCA 3B82A 1C6VA 4OPKA 3LL3A 4E2FB 2VKZG 1U02A 2D1CA 1VLYA 1G15A 1X3MA 4FS1A 1S7IA 3M2UB 4X2BA 4CLZA 2ZBQA 2DO0A 1WHVA 3JXOA 1RISA 4I1TA 1VQPN 1HBNB 1EHWA 1HI1A 1QTNB 3NAHA 1W2BM 2I7PA 4WE1A 1FRJA 2BJ7A 3KG4A 3GSIA 3ZX3A 5CHCB 2FVSA 3OVBA 3PFEA 3A5NC 2VG7B 3PDNA 3RMAA 4ED1A 3MD1A 4YOEA 4DV4J 1B99A 3MWBA 1BXNA 2W41A 1EAYC 5CR4A 1C0TA 3DLKB 3MEDB 1AXQA 3NGDA 3CJ4A 1RP5A 1Z2ZA 4USUA 4ECSA 1WC4A 3TANA 3B4MA 4YOTA 4DU4A 2QXLA 3GOIA 2RE2A 3CQYA 1EQ0A 1F3FA 3JSMB 4CJUA 4ETZA 5M2RA 4DQSA 5IT4A 3MPVA 4LFCJ 4I68A 3DCAA 2V69A 2DIUA 1S48A 3ULHA 1F9HA 4DN0A 3HM9A 3LWMA 2M7SA 2MSTA 3C6AA 1SC4B 3CD5A 4ZN1A 3MMCA 4MIBA 2R7WA 4J9OA 1PAEX 4DX5A 4O4RA 4E3SA 1YVNA 3SAHA 4WBFA 4W5NA 1VQNS 1HNZF 3NH0A 1OQ3A 3I82A 2VOOA 4JNEA 1IUJA 3GDQA 3K5PA 1SC3B 2LXFA 5BN9A 2OPPB 1KEKA 2Q3PA 1AFJA 2HNZA 2XY6A 3H40A 4BG8A 3HXMA 2ZJPL 3SQ0A 4FF2A 5DZ6A 1DBDA 1UW9A 4AHVA 3CC2N 1FEHA 2XMJA 1V9OA 4X65F 1HNZK 5C25B 2DFHA 3AVHA 2VQEF 4TN2A 4XDCA 1T3NA 1FWLA 2JEGA 4QPXA 3BGOP 1DTTA 3PW7A 3JSRA 5A2QU 1QD1A 3D0PA 2Z2MA 1RBUA 3NS7B 3LUYA 2ADBA 4CM0A 3GCWP 2CJKA 4M94A 3CJ9A 2R2RA 1UA1A 3KLEA 2W2QP 3QFPA 5T41A 2ZKTA 4X65K 3LO3A 3T1HJ 4A5BA 2VQEK 3QJLA 2HS4A 3V4IA 2BANB 4QR0A 4N76A 2KYXA 3G4SN 5A8WB 4IFVA 1N36J 5DG7A 3TI0A 3FZLA 2RQ4A 4F36A 2WBMA 3SMPA 5I3QA 3J7AP 1KFDA 2ZH4A 2IYGA 2OGUA 4B3MJ 5A8RB 1X9SA 3DRPA 1C4AA 2VWBA 1TKZA 2YHYA 3BBBA 1BY9A 3EICA 5AQPA 2GHVC 2Q43A 3KLFB 4HT7A 3CJAA 2VF3A 1RT7A 1TK5A 4FWOA 2QA4S 3D68A 3KNGA 5ETNA 3J81j 4FPRA 1OIAA 1RTHB 3MDFA 2QWQA 4CHNA 3CPWR 1G7CB 1VQ8N 3T69A 1NM1A 4PR6A 3NGYA 3QWUA 4K41A 3OL9A 1U1RA 4MK7A 2HG4A 3MECA 2F7VA 2XSJA 1SKSA 4OJHA 3MEKA 1LWEB 3JAMO 2XNRA 5EX0A 4DF4A 5DRKA 4J9PA 4RW4A 1J5OA 2FTRA 2DB1A 4QR2A 3VQ6A 3UN3A 2I5JB 1NKCA 5D3GB 4URQU 3O9RA 3G6YA 2Q31A 2EBEA 2H3EB 3TQ1A 5KQDA 4CD3A 5KPTA 3PIOQ 4XO0A 4FLWA 3IR6B 4OYBA 3J7YU 5HJXA 2XHBA 1WC5A 4OZNA 2HVZA 4Z94A 4BLGA 2HS3A 1R8HA 2WVDA 4LSLA 2PDAA 3UIQA 2AMCB 2O8CB 5HVGA 3TJ8A 3UNGC 3NGZA 2R7UA 5HMYA 5AQTA 4C9DA 4ECXA 4PL7A 2BABA 2BJEA 3M1VA 5HO4A 2AHOB 3H08A 2GVDB 1VQON 3TVZA 4WCEL 4M5GA 4I6AA 3PO4A 4YOWA 4DV3J 4JV2A 3JTNA 4CF9A 4H5WA 4USMA 1QQOA 1KHVA 2MYFA 4X4QA 4FJGA 4B8CA 5E41A 2RN2A 3C15A 3US5A 3WDOA 1VQSA 3GPAA 2B7BB 3TARA 3OQ2A 4DV6J 2UVVA 2U1AA 4RNOA 1DTQB 1OH8A 4B3OB 2YNHB 3QGGA 2ZBPA 2NRXA 3G82A 4K4XA 5BREA 2EKYA 1R8CA 3LPTA 1FDNA 2J0SD 3V6KA 2OA8A 4R79A 3EZOA 4OJGA 3AVBA 4QIFA 4PQUA 4DUYJ 3M8YA 2V8HA 1IH7A 3O6QA 4DOZA 1YG0A 5KI6A 2CRLA 3UD3P 5A0YB 3VEZA 3T1YJ 1SJ3P 3ZX0A 1NDKA 3GG1A 4MKVA 2ZJQQ 3HF5A 2YTCA 2A1SA 4PWDA 3EDQB 5AQFA 2E9RX 4ES1A 3U3GA 2MQ8A 1N8RT 2OSRA 4YDUA 1E6VA 2M88A 2QJ3A 3BM7A 2OIHA 4ED6A 1NGHA 4USHA 4JD2B 2G1DA 1IVZA 1T03A 4LR8A 2MKKA 2R8KA 2RHKA 2F40A 2G8HA 5F0XA 1ZS6A 1TYQB 5D6GA 3I55N 1RZMA 2W6KA 2E5GA 2LEBA 2EBGA 1M5HA 2JHEA 2NXCA 2QMUB 2QEXS 1Q7YO 3I4HX 1CEZA 4QZVB 2G8IA 2CQGA 1YI2S 1FWKA 4CT9A 2OJ3A 4DTJA 4J7CA 4X66F 4RCHA 1YGYA 1ITPA 1T05A 2PGCA 4OX9J 2UV8G 2HSEB 2KHCA 4M63A 2DEIA 4KH4A 2ROPA 4K5RA 1R8PA 4NLXA 3ZZRA 4FN5A 5FDLA 3QINA 2R7QA 4Y00A 1Q8BA 3G71S 3DC2A 4ZCKA 2QG9B 2HHQA 2WBNA 1XIQA 3NCRA 1J2VA 1T6CA 4X66K 1KAYA 4DUZF 1ZAVA 1QVGM 4P2XA 1TGOA 2BXJA 3SI6A 1J54A 3OA9A 3AY9A 2Z1GA 3VQ9A 3QFWA 4WK3A 1KVJA 3KJVA 2IFXA 3D4JA 3M30B 2E8AA 3ZNUA 2G13A 2NYIA 2CDQA 3N6NA 3T3FA 2PN6A 1RTIB 1HPMA 2J8SA 3UCZP 3AJDA 1KRPA 4FF1A 2XQCA 4CK3A 3OS1A 3W64A 1JX4A 1RT3B 4A2BA 2BJ3A 4DUZK 3EMTA 3R8YA 2GV9A 1VQ5S 4LF1A 1XMBA 4RW6B 4DPTA 1M1GA 3VEYA 3CG7A 3QQCD 2XWYA 3CGIA 3CD6N 2Y1IA 2Y9HA 1J5EF 3RW6A 1WDDA 3R6MA 3HVTA 5KFWA 4B3SF 2H5IB 2GBZA 4J9KA 3QFUA 2GJIA 1ZXOA 1CJKA 2HW3A 4CYUB 2JX2A 4U6PA 3SEOA 3DOLA 4GMKA 3A13A 1DQAA 6FD1A 3HI9A 3GBTA 4IKAA 2MGZA 1KNZA 5HL7Q 4FJJA 2Q0RA 4JI6F 3DLEA 1ZBSA 5CABA 4KFBB 1PC4A 2C2DA 1ELOA 1XEZA 2RT3A 2X78A 4PWUA 3GV5B 4WWSA 2RF2B 3H5XA 1XC3A 2KH9A 4EUVA 3MAQA 5E0OA 4GRSA 3NMUA 4R5PB 2APOA 1EB0A 2VC1A 5LXYA 2K1RA 3D6HB 4NA2A 2CVEA 5AZIB 3CNQP 3QBCA 4KB7A 3A3PB 4JI6K 3VVUA 2CH6A 3VQ5A 4ELVA 3J81O 5BJRA 5H1SV 3C7NB 2AJ1A 2CQ0A 3EO3A 2YKMA 1TMMA 3D45A 3G6XA 4NLTA 2NXEA 4JS5A 1WF2A 5ETTA 5B08A 2YHXA 3C14A 1MROA 1N5YB 1TKTB 2AJ0A 1U4BA 5BR8J 2W6LA 3D28A 4LF4F 4QJVA 4JV5J 5B7WA 3HKWA 3SCIE 1CXQA 4D3GA 3ZZYA 4V19S 2CUYA 4AFFA 3RGIA 5AXMA 3QT6A 1K73O 1D4XA 2HMIA 1T0TV 1FXXA 3TWZA 3I0SB 4CO3A 1IKVA 3U1NA 1H98A 2E20A 1IQTA 4LF4K 2QL5B 3ZO7A 3MCAB 2X1FA 1TKDA 2ZVIA 4ZCMA 2DFEA 3L6QA 1B0VA 4DR4J 1JLGB 1VSHA 2J6UA 5F8MA 3IFRA 2FF3B 2LDYA 2RPIA 1IBLJ 5CYJA 1V3ZA 4CGJA 1JL2A 4JI4F 2Z2YB 3EKUA 3QIPA 4H4OA 1RI7A 4AILC 2XEXA 4UZCA 1RAFB 4LF5F 1YRXA 5E26A 3VENA 4ZVOB 4DLEA 1RDDA 4JHDA 2LKZA 5GIOA 3KMQA 4ZVTB 5E3CA 3I9ZA 4LRAA 3W7BA 2E2OA 2CPYA 4JI4K 1NO8A 3CJKB 4HEA9 4X4VA 3RBZA 2BOAA 1QY7A 3VV2B 5B0CA 2B4PA 5LMUK 3QBWA 5A6WA 3HD1A 1U09A 3SQ4A 2XRIA 2DGOA 4GVEA 4LF5K 4Z4EA 2JLEA 4CGDA 2SXLA 1JL1A 3DDIA 1KR4A 5AQGA 2RDJA 2FVQA 1FHTA 2RRAA 2WZ1A 1FCAA 5JJBA 1M5SA 4YEAA 3QWPA 3OW2R 4PA1A 5AE1A 4MLEA 5HMZA 4DV7F 1BA1A 3PVXA 3Q8UA 5L39A 3CIZA 4EZ6A 3D0IE 4PYAA 1NZAA 1PO6A 3AOAA 3I4PA 3W60A 3MR7A 1IN0A 3P3DA 2ROEA 1H2UX 4DU3A 4B9NA 2RS8A 1JKHA 5H9FJ 4RW9A 1IBMF 4ID5B 2K7KA 3K8VA 1NGIA 4I7FB 1GX6A 2DH8A 1HKBA 4K4YA 2DNNA 2GMHA 1U49A 3HK2A 5GMDA 4DV7K 5BRHA 2NXJA 4Y28C 1RFQA 3L2QA 4H4MA 1VHFA 1VLOA 3MN6A 1NLKL 3MX2A 1HUXA 4RWXA 3O9UA 1BUXA 3E8OA 3CULA 1IR0A 2W4DA 3QB0A 1UKUA 1IBMK 3ZSYA 3SFGA 3KK1B 4FS2A 2WVCA 4URSA 4S0MA 2CWXA 1VC5A 4TY9A 4F25A 2YQ1A 4DHYA 1N8RO 2KYZA 1B3TA 3A8YA 3GTYX 3ZTPA 2CJXB 1FJGJ 2LECA 2XHWA 2DNOA 1ZBIA 1KAZA 2AT1B 2WW4A 1S1VB 2DGVA 1LW0A 4XH4A 4HI1A 3ISZA 4I6YA 2P9PA 4DI6A 4WFYA 3D2EA 3R6GB 4B9LA 2JC1A 4OLOA 3IRWP 3CCRS 3S3OA 5AQYA 2LQ5A 3OR2A 3TSQA 3J80U 2XMMA 4OMFG 3UDEA 1I94J 4AHUA 5AXKA 1MWMA 3SZ2A 4K4UA 4QWAA 2JRSA 2D4WA 4C11B 4FK2A 2YKNA 4CZHA 1VHIA 2Z56B 1TKXB 1RAAB 2NUHA 4MJKA 1S0MA 3GFYA 3TOQA 2G2OA 5FLXY 4ES3A 4JKGB 1SCJB 5BYSA 3UR0A 3G96A 2G0CA 2GEMA 5K20B 3CCJS 3DMJB 2KLAA 2XYHB 3MR6A 1RDCA 3G9CA 3THTA 2GJ2A 3ZX2A 4AYBD 3OS0A 3Q2TC 5JS2A 1BGXT 4OZ0A 4NXMJ 2GGPA 2YPYA 4HCBA 2A42A 3DDKA 3BQ2A 3OTCA 3CCES 4KBOA 4AL5A 4EWTA 1UMJA 3OHAA 1I3OB 3ENAA 4KGVB 2FHKA 1JLEB 2QLJB 4V1Ak 2PFDA 5KFTA 3BGRB 1KCFA 2X7IA 2LQBA 1UVKA 3TJAA 5DZ7A 4LR7A 2Q3SA 2W7AA 3KG1A 1YT3A 1MU2A 4QW8A 4KTQA 3PNIA 4DTRA 3RU0A 4KIAA 3HP9A 1RT6B 2PAVA 1YIJN 1MWQA 2R4FA 1OVYA 4BR4A 4HH1A 2PT0A 5LL6d 1S9FA 3THXB 4YR3A 4L3QA 1Y4ZB 2IYIA 3IRXA 4O0JA 4KHWA 2V2ZA 4WYWA 4BC9A 4H0XB 3UCGA 1U6FA 3PYEA 4CEOA 4CHPA 1ZM3A 5KG3A 4UQTA 2ZH3A 1KTVA 5KFZA 3L4QA 3W2VB 3MMBA 3MTKA 2ZFHA 2UVUA 3KJNB 4PZVA 3HYFA 4HDGA 3CWJA 4HWIA 3JSBA 2YXLA 4DR6F 5DG8A 2DGUA 3MZIA 3DN9A 4OYMA 3ZLJA 2VG5B 3O44A 3DM2A 4YOVA 1NDLA 2I1RA 3IKMA 5AQUA 2JFDA 5EN1A 1T3VA 3CJRA 3POTA 4DR6K 2W9CB 3AA8A 5M1FA 1KQKA 1ATSA 2LFVA 4RU9A 3OV7A 1W7AA 4ZA1A 5AQOA 3CDUA 4JI7J 2DNYA 5EXWA 4U7BA 3LANA 4DQIA 5K14B 1YJWN 1OO0B 2VCPA 5A2QO 3CMES 3I5CA 4CVNE 3AVMA 2D0BA 2YJFA 2KKHA 4F4WA 3QEXA 4DV1J 1NRKA 1UVNA 5EWEA 1CJUB 4ZITA 4ZVSB 4F3MA 3KLVA 4DPXA 2MY7A 4M5HA 3PEJA 5AJ3J 3SCKE 3BYPA 1YJNN 2DBBA 4MKYA 5I3UA 1WWHA 1RT2A 2IHR1 5JVGQ 3U1MA 1Y11A 3PLAA 3JXUA 3IAYA 4FXDA 5GAEU 2MQNA 1Q8LA 1ICEB 3CJ8A 2E6LA 3ZSZA 4YDUC 2FQQB 1BISA 3QBXA 1GOBA 3CUNA 5B0BA 4NB4A 4NLYA 1QVFM 4OZ3A 1N0VC 1OYDA 4LF6J 4KHUA 2HNYB 2OI2A 2G4BA 2ZEJA 4EYHB 3NAEA 8ATCB 4MK8A 3OS2A 2IVFB 3NNAA 2RKIA 2KFNA 2KQ2A 4DR1J 3AO3A 5HJYA 1S49A 3R5JB 4M45A 1WOQA 3L09A 4FJNA 1YRUA 1ASVA 2W42A 3N4QA 4CZCA 2RE1A 1L3SA 2LCWA 2FC9A 4M63C 3QEPA 3OBWA 3O08A 5KT7A 2J7UA 4M3TA 4CHQA 5IM0B 1S6PA 1T11A 1LKZA 4DV5J 1JJ4A 2AX1A 1BCMA 1LXNA 2LDIA 2HHHJ 4DR7F 3CQXA 1SH2A 1SZ2A 1BQNB 5CYMA 2HB5A 4CBWA 1F1BB 1K47A 3OR1B 2BE9B 2J5AA 4ZLJA 2YNIA 3KWGA 4KV8A 5KTQA 3PX4A 4BRAA 5F2RA 4CI0B 4UOCA 2ASLA 4BGAA 4A62A 3N6LA 3KOAA 4NCGB 5D0HA 3K5LA 4DR7K 4LFAF 3AA4A 3SQ2A 4AHSA 4RW8A 1CS4B 3P83D 3KLHB 3DLLL 1FE4A 2KVIA 1RADB 2YWWA 2Q6CA 4DMNA 3MM8B 4H5NA 1IJEB 4OV6A 4CK1A 2VIHA 4BR0A 2WONB 2FLLA 4ZIWA 4CJ4A 3OD2A 5K8NA 1TZ0A 1UPMB 2HGMA 5RUBA 2FSJA 4DR5J 2NPFA 3MCOA 2E7VA 1XNRJ 2JEFA 4AD6A 1U7LA 1VISA 4NE9C 3CFRA 1S12A 4ZVEA 2V63A 4FZVA 3HL8A 4CFCA 2HQIA 4FKYA 5AE3A 3PM9A 4HHJA 2V34A 2DEJA 1KTQA 3G2XA 4OX8A 5IWAJ 1VOMA 2LP4A 2FZGB 1B9FA 4A57A 3ICLA 1FRMA 3B54A 2EG2A 4GVMA 5ITHA 4KGKA 4LVOP 1NK5A 2FLNA 3AVIA 1GFWB 2YCHA 2N3OA 3GFZA 4MFBA 4PEOA 4UOHA 4TSXA 2RILA 2P9SA 3EXCX 1BMQB 4E1NA 4ECWA 3RR7A 1XR6A 2F5GA 2XYPB 2WW8A 4QWCA 4CBXA 4KHNA 3ILLA 1NSPA 1AUSL 2LXUA 2UUTA 4ECTA 3VQBA 3AV9A 2BKNA 3R5CA 2D0CA 2NZCA 2QYCA 2V0NA 5C2FA 4K4WA 2AX0A 2A2DA 4OX6A 1AZSB 3AJ2A 1Z25A 2ATLA 2HLTA 2V4JA 2Y8WA 5ETKA 1HNVA 2G8WA 3MMAA 1WTFA 1SQKA 3MEGB 3THVA 4IOXA 4IFEA 3R5GA 2JH3A 5ETPA 3DXMB 1WUAA 2UUWA 1Y3KA 3UD5A 2LU1A 5CY4A 3OYJA 2PFFB 3ZTSA 5DDQC 1V4SA 4E7JA 3SUOA 3KLGB 3JAMY 4LF8F 3JYTA 1HMVA 1NGCA 1N32F 3SK3A 2B4UA 4KGMA 2R8HA 1XBWA 1WKJA 1VQPS 3PJWA 3FSIA 4CNYA 3H5YA 3MN7A 4RO0A 2DR7A 3K7RA 2HHUA 4DL6A 1KS2A 2KG0A 1QM9A 3GFHA 1TK8A 1GEHA 3S1TA 3KMSA 2YPZA 1WORA 5C42A 5LMNF 4DEZA 2XGPA 4LF8K 3FJ2A 1UEUA 1N32K 2ITMA 3N9UC 1UPPA 1RBVA 5GADI 2F65A 1IKYA 3W5YA 3BKFA 4CLKA 2AD9A 2OCEA 2C2NA 2KM8B 3PYGA 5M2PA 4USTA 4ZOSA 2P9KA 4TY8A 4DCOB 3PKYA 3FR0A 1VRTA 3MXHP 4MIAA 3VZHA 1VFJA 4HUEA 1VK0A 2RHSB 1VQMN 2M52A 1I39A 3AVNA 2QSWA 1NB7A 3IGVA 3MCPA 1H2TZ 2LEAA 4RBUA 2E1MC 3QGIA 5JICA 4H0OA 3CJ7A 5DDPC 4ILLA 3E9LA 1NK6A 2W7OA 4L3KA 4F3QA 3V1QA 3DOKA 3NWGA 4FYWB 3L95X 3D2FB 3PYFA 3QLHB 4CLLA 1HWKA 1VC0A 3W61A 2DFFA 4C6AA 3VQDA 3FRZA 4TU8A 3MCNA 5C15A 4JB8B 2YQ3A 4AUKA 3VF4A 4CGHA 4NCBA 1RWOB 2VQFF 2KB2A 2ACMA 3IUCA 1SQGA 3M6XA 2QFIA 3RJMB 1FERA 5LJ3Y 1XMOF 4DB3A 1HHQA 4ED5A 1D8YA 3HJFA 2H51B 2E9ZA 4UQGA 2P2CB 1BI4B 3U3YA 2CJ9A 2QLBB 2ASPA 2GO8A 4F0HA 3DXKA 3K0SA 2VQFK 3LP2B 3C8YA 1FI4A 4YS2A 3CC7N 5U47A 3VAFA 1LXJA 2DNZA 3HSTB 3CPWM 2H48B 5IQQA 1U2VA 4G65A 1XMOK 2E29A 2CYYA 2YBVA 2F7TA 4EO8A 5EWGA 3RVCA 5EVZA 3HM8A 4DTXA 3K5MA 1KLMB 1FRKA 2P9LB 4DV0J 3G4SS 2AA4A 3AGKA 3S01A 5FRNA 5J2PB 3M2UA 5KG6A 1YTUA 4ZVHA 2QWLA 2D3O1 4DXLA 4O5FA 2KXNB 2GFFA 1HBNA 3ZSXA 4F9OA 4O44A 2H54B 4TKTA 2RUGA 3FFIB 2DR6A 5KG4A 1EARA 3M2VA 3MAAB 3RMDA 4BC2A 2DK2A 4EIAA 1BE4A 3GFXA 4NLOA 3MEDA 1OYEA 1H0HB 3SV4A 1K9MO 2FDNA 5ADXA 3P1GA 1VQ8S 4OI0A 1IBKF 4H5VA 4WFZA 3PG9A 1IKWB 6AT1B 2BJ9A 2DPIA 5IOLA 3DYAA 2HHSA 2DHGA 5L9XA 4RTFD 3CCZA 2P8IA 1TR0A 4JYAK 5KT3A 2ZH9A 3M05A 2G2ZA 3VQQA 3IM8A 1WACA 5J1NA 1GLFO 4TYAA 1S6QB 2B43A 3TTCA 3FZKA 1RDUA 4Z2XA 1HFEL 1VQ9N 3D2WA 2H3GX 3UKRB 4KHMA 3H8YA 4CIFA 1S9EB 2POKA 4WCEQ 3DGVA 2ZGYA 4ILHA 3N28A 2OPPA 1S0NA 4FJIA 1LOTB 5AQMA 1P8ZA 1SUQB 1UW4A 1YVFA 2R7TA 1TK0A 2W2OP 4IO8A 3GCXP 3AVKA 4ECYA 4P72A 2GQCA 2W25A 1WG5A 5C25A 3BPSP 4FWMA 3KIOA 5D0GA 4FWSA 4DF8A 5KG5A 1SJRA 2BKPA 3H25A 4HTUA 1N5QA 2E2PA 1GT8A 2Q66A 3H42A 1GMWD 3UFCX 3OSPA 2Z0GA 2F1FA 4N41A 3LP1B 1S4EA 2YHWA 4P71A 2KVQE 4AHRA 4IRKA 2DITA 3J81Y 3VGLA 1LQ9A 4DR3J 4OX7A 3PIPQ 2BANA 4Q2LA 1VSLA 3A8IA 2FIUA 4N5SA 3HFKA 1N56A 4CJTA 4L76A 2KRRA 3MAHA 2X6NA 3G6EN 1Q18A 3DLHA 1K8AT 2B9YA 1R31A 4QIVA 1SKRA 4G1QB 3VGSA 5HANA 1V5IB 2YKAA 4IBNA 5A8RA 2JNJA 3J80O 4M1KA 3SPZA 2W9BB 4O8KA 3PIOL 3KLFA 4FJ8A 3NH1A 1XMQF 4ANEA 1O1WA 2CJBA 1S1XB 1F5CA 2F8EX 4NYNA 4G3IA 2GVZA 2F4FA 2FVPA 1Q79A 4M5KA 1RTHA 3WNEA 4M5DA 1MN7A 4HTIA 3I55S 1JXLA 3OXGA 4DU1A 2RDDA 5I42B 2GIRA 1SJ4P 3CCVN 3HO1A 5KRTA 4CE9A 1LWEA 3OHBA 4IG3A 4JK9A 4TLRA 3TUJC 5IQ6A 3LZJA 3M6WA 4KB1A 4ZJOA 1RTDA 3OL8A 1S1UB 4FXWA 1XWLA 1S72N 4JI2F 1FX2A 1EKSA 4K50A 1KVBA 2ZH2A 3ZT1A 3IBWA 1IKXB 4PUOB 5D77A 3UO0A 4KHSA 1K44A 3DLGA 2YKQA 4JOUA 2X51A 3GYGA 2EKNA 4J2BA 3NS5A 3SSSA 3LDSA 2MHEA 3ZXWA 4OL8A 4ICLA 2IGIA 1FRIA 3FK4A 4DV4F 4ZKAA 4JI2K 4DSJA 4IH5A 1SH0A 1ZETA 2RQCA 3MWPA 4Y65A 3M2RA 4DX6A 3MFIA 4M3XA 1RU1A 2X1BA 4ZLPA 1QUVA 4FM2A 1RA7A 1U04A 4CEAA 2GVDA 3DGPB 4KSEB 1U1OA 2ZF5O 1WF0A 4FL9A 2DIVA 2Y0SD 2PEBA 4ZVRB 4OV1A 4BR5A 4F0MA 1JXVA 5ETSA 4DV4K 1TMJA 1W0HA 1C0UA 2QWOA 1B92A 1MW7A 4YOYA 1RBAA 1AYEA 4FK0A 2J9DA 3PXGa 3CD6S 1YI2N 1A0OB 1DTQA 4B3OA 2YNHA 2JSXA 5EX3A 3WXLA 3M8QB 4Y34A 3OLAA 2QK9A 5C2GA 3SUQA 2CFXA 5JUMA 4NCAA 3CCMN 2VG6B 1RAGB 4BQLA 2FBXA 3VAKA 2J6SA 4LFCK 2FHJD 3PKMA 3B8HA 3K57A 5EGYA 3SJJA 3DKDA 4C1NI 5DK5A 1BD6A 2HHPA 3VESA 1X4AA 2Q36A 1OPIA 4O23A 1UWAA 3BUZB 5A0YA 3RRGA 4FKXA 3O1BA 2AYMA 3TO8A 5LSOA 3R2CJ 4YDXA 4M3RA 3ZETB 2XWXA 2GAGC 2LA4A 2IRYA 2YX4A 3HBTA 4CF8A 4ED3A 1J53A 3TVKA 5LJ5Y 4CW7B 4CCHA 2UP1A 2J7WA 3OYHA 4P75A 5GAHP 4QCLA 2XMVA 1NBEB 1CJTB 4XAKA 4CP5A 3WC0A 2C28A 3DNCA 1WI6A 2GV1A 5KG7A 2BV3A 1CC7A 4R0JA 2WTUA 2A0FB 4PAAA 4DSEA 3T1HF 3OTOJ 4O3SA 2GQ2A 2ATCB 1Y5IB 2BJ1A 2QWNA 2MQOA 5EHHA 1WC3A 5AQRA 1N36F 2P9EA 1KDNA 2W4PA 4NLSA 4RPFA 2O4GA 2CZ4A 1XHXA 3O1LA 2CQBA 4JKHA 2AJQA 3NS6A 4A8FA 3VAGA 2BDPA 1HWLA 1NK7A 4DDFA 3T1HK 2O8EA 3BDEA 2QTWA 5IXUA 4UT4A 5KFBA 4KGXB 1S57A 2A18A 5ADXH 4MKAA 4NLUA 1N36K 1A6LA 2CH5A 3S8SA 2QL9B 4X4SA 3IGNA 4DZDA 4GKJJ 4MLHA 3VAMA 4CTAB 1BOTO 2NXUA 4PKGA 3OW2M 2HNDA 2VC0A 5J2MB 5GADP 1RTIA 6FDRA 3RAQA 1RLDA 3QFHA 2ZNZA 1RT3A 1RABB 4X62J 1UCNA 4QU7A 3K2YA 5KFPA 4DQRA 3TX8A 1FF2A 4YY3J 1MG7A 2BW7A 4C3MA 5EOYA 1VGYA 1Y5LB 1LAWA 3VAHA 4GVBB 3W0LA 1XI1A 1RWNB 3RYLA 4HTLA 3TAEA 1NNEA 1Q86T 5AQXA 2H65B 3THYB 5EU7A 4CYUA 4GKKJ 2HBKA 3HSDA 5SUHA 2FF6A 2X3GA 2R7SA 2CPXA 4IRCA 1O6XA 1HBMB 2I38A 2E4LA 1BHLA 4PG7A 3GJTB 4C8KA 3G8SA 3WX8A 3AFGA 4KFBA 1SJFA 3TUIC 3VTIA 5A76A 1QSYA 1ZAWA 4FLZA 1R0AA 4XDDA 1FRXA 2KT2A 3HPGA 4F67A 2QX0A 1VK3A 1LEOA 2W9AA 2FPHX 1J9AA 3CJ1A 1YBAA 4R5PA 2HBMA 2OEJA 2XCPA 3CM5A 4DV3F 3UE5A 5J2QB 3CEDA 2P9NB 2GC8A 1OY8A 1FJ7A 2RH3A 1FTRA 3FKBA 2ZHAA 2FZCB 5KFFA 3BGUA 1NAQA 5G0RB 2P51A 3U9DA 3MM5A 8AT1B 2AU0A 2E1CA 4YN3B 1W25A 4HHTA 2ZWPA 2HZVA 2O01C 4NEZA 5D0RA 2NSCA 4ZMMA 3G8QA 2JOQA 4LIWA 1K8AO 3VERA 1N5YA 1TKTA 2VASA 4RNMA 3IG1A 2F4VF 4DV3K 2GMLA 2HFNA 4A2AA 3HDSA 1GMUA 4ZK7M 3ISND 3DHXA 5LY3A 1GOAA 5CA5A 4EK2A 1FRHA 2WSCC 2MLZA 1YJ9S 1N33J 4DV6K 3FQLA 4OZ5A 3CIMA 3EN9A 1ZTTA 3I0SA 3D6RA 3SSQA 4KE5A 1MN9A 5AQJA 3T1YF 4QPTA 2ZH8A 3BZQA 3WXMB 1WHXA 2HVEA 4QS7A 5A2QY 4KI4A 4PYDA 1TL7A 2HHWA 2KI2A 3KK3B 2EWHA 3N6MA 3PFOA 2E88A 3N79A 4NLDA 3U8XA 2RJZA 3HP6A 4DBQA 1JLGA 2F3JA 2K2PA 4LJMA 4DUYK 4KO0A 2BA9A 4Y3CA 3TAPA 2LU2A 3BZCA 4K5SA 1K1QA 3ZNJ1 4JKDA 3P5BP 1GH8A 3T1YK 3F73A 5I9EB 1U0HA 2C2MB 1U6BA 2W7PA 3QO9B 4BRNA 4A48A 3LF0A 3UQSA 4U8VA 1UZDA 3A3OB 3BSNA 1M90T 1ZAXA 1T9WA 1SL0A 4JI1J 2ZQBA 4MH8A 4OO1J 4LRCA 5F8NA 5DM7Q 3D6MB 3PUFA 1ZA2B 1HKCA 4OX9F 3NGUA 3CJKA 3EY1A 4Q0BB 4BC7A 3QYYA 5C7PA 5B0AA 3UVJA 1FK9B 3OUYB 1KD1T 1HQUB 4XPCA 3NF7A 1F3VA 4B9UA 3AJ1A 2JC0A 4CJ7A 3C6HA 4CLYA 2E1RA 2VQEJ 1RHJB 4JK8A 4OX9K 3SIPB 1HKGA 1NKBA 3D67A 3GL1A 2XS2A 2ASYA 2QWRA 4IQMA 2KL8A 3CCRN 2OYQA 1ZPVA 2RMLA 3JB9k 5D4PA 2HBQB 3PY8A 3GYXB 3S7RA 2BH1A 1HNIB 2IIRA 5B8HA 2EG1A 3GYNA 4HUFA 2FY8A 4E1JA 3CJ3A 1YJTA 3K8WA 2MDAA 4GVLA 3GJSB 3RBXA 3AAQA 1S99A 4WTYA 4UY8O 4I7FA 5HK4A 1UFLA 2MHNA 1YIJS 1PJ7A 2FJWA 2HHVA 5HI7A 3CJCA 3WXJA 1X0FA 1ZBUA 1B7YB 2EI5A 3EUNA 3GU0A 3CD0A 3HHKA 4NA1A 3QZ7A 3LW5C 1KP6A 3CCJN 1YJ7A 3KK1A 2EFPA 2KXHA 3M8ZA 1FA0A 2FC0A 2KHDA 1AA1B 4CH7A 4YMEA 5ETVA 3GIIA 4MMOA 3C65A 1H38A 3PZPA 3H4DA 3CFOA 2E9TA 2J76E 2Q6BA 1S1VA 5KFVA 2A3JA 3L3VA 4BBYA 3CCEN 1KAXA 4NEYA 1M5VC 3L7PA 2KXFA 2B8PA 4Y1CA 4A8WA 1T9UA 3SBGA 4EO6A 4CJLA 2Y3YA 4KY3A 1KKHA 5LSLA 2HF3A 3OYIA 3D66A 2RNEA 1PYTA 4LF9F 1CLQA 4Z7CA 2ZD1B 4BRCA 5AQWA 1YBUA 1E6YA 3WX4A 4IOCQ 4JV5F 5AXNA 3KNAA 2DT9A 4WE1B 5KFGA 4FO0A 4Z4FA 2DHHA 4ETXA 4JKGA 3SV3A 3MDQA 4LF9K 1ZPWX 2NPIA 3AAPA 4Y2IA 5GIPA 2ZWHA 8RUCA 3P6YC 4ZCLA 4DWIA 1HD1A 4TYBA 3O5BA 3RAXA 2DY4A 4JV5K 1SC1B 4DTMA 2R7VA 4ZVPB 1CQMA 2DTUA 4DFJA 3RR8A 4RNFA 2AIRB 2PMWA 1W2IA 4HTJA 1YJNS 3IWLA 4OPHA 5L38A 1JLEA 4F4ZA 1O0PA 2YKOA 1S22A 1P27B 4Q45A 3LDOA 3BGRA 1RTJA 4F0KA 4YHHJ 2CG4A 1FXDA 1S59A 1HL6A 5AQZA 1Q86O 2VD3A 3MMCB 1QAXA 4UZBA 4CHZA 4USKA 3MMVA 3BEGB 3TZYA 1IM4A 2KZZA 2LQJA 3Q89A 1K1SA 1HLUA 3W9IA 3LQVA 1HA1A 2IBKA 1B64A 1N54B 2IM0A 4X4NA 2EVZA 2BKOA 3K89A 3HRGA 1WSRA 4UUXA 3VAJA 2AYEA 3CMEN 4GV6A 1FESA 4A8SA 4BRLA 3EVWA 2Z30B 5CZ1A 5LJVA 3UW1A 1YTAA 3OLBA 4X84A 2BEFA 1NGAA 3W2VA 3TVYA 2CPEA 3JQMA 2L3MA 1PG5B 1QE1B 2VFVA 4LFBJ 3PV8A 1DTTB 1JJ2R 4M41A 3BSCA 3VZIA 1Y9OA 3CDEA 3BREA 2D9PA 4CEQA 2VG5A 4RKUC 1HX1A 2UVWA 3ENBA 2FJXA 1P8GA 5KFEA 4BRQA 3DLLQ 4OYOA 3PACA 3ETMA 5JS1A 1C1BB 4HHHA 4IFVB 4DQPA 4X66J 2JZ5A 3DJCA 2V50A 3QATA 4QYZJ 1WOSA 1GNKA 4C0BA 2BYCA 3OFEA 4AXIA 1HI0P 2QWMA 2D0AA 4B9QA 3BSOA 5H9FK 4NI2A 4C8YA 2AEMA 2ZH5A 4NLGA 1ZOTA 3EE9A 1GMVA 2OMOA 5BRFA 1T3OA 5KOXA 2HBJA 3AVLA 2VHGA 2DNMA 1VQKS 1W7WA 3DOMA 1U1QA 1FJGF 2QSFA 4XTTA 4DMZA 2BJDA 2C22A 1CJUA 1C1CB 3VA0A 1WKLA 3F2KA 3AGRA 1X31C 4B02A 3BN7A 2IA0A 2YH1A 2G9OA 5B0FA 4FK4A 3I9V9 4YNQA 1GLBG 3V81B 5DGAA 4WFNL 4H0TB 2XSJB 2CQCA 3LWLA 1M90O 3MM7A 4ZTJA 3C16A 2R8GA 1H73A 5F8GA 1RE1B 3A8EA 1EKEA 4DR2F 1FJGK 2JVRA 1S4FA 1FEEA 4RW4B 1J5OB 1UEKA 4C7QA 1M1KO 3CQ8A 4DG1A 4JKAA 1J5EJ 1Z1ZA 1I94F 3ITHB 4B3SJ 2JWNA 1G1XA 2WVBA 5T7LA 2J7KA 2XNQA 1Q95G 2GUPA 1FJCA 5KFYA 4DL0C 5BPLA 1C2PA 2ZWOA 4NX9A 3H3NO 1KD1O 2DKOB 4DR2K 1WNSA 4HUGA 2IIHA 4UOFA 3O4NA 3GSDA 1LW2B 5KFHA 1I94K 2ZC3A 2QFJA 3F9MA 1U1MA 1E4GT 2IS3A 2X1GA 1VJQA 2OELA 1PJ6A 2IBOA 4ECZA 3ZZTA 2DXDA 3M1VB 4K4TA 3GILA 4NXMF 2IVPA 2R8JA 3NF8A 4OYZA 5LM7E 5FJ4A 5IFMA 2GNKA 2UXBF 2CAJA 3H7HB 5IM0A 3RBDA 4ZVGA 2DJWA 4CBUA 5KFMA 3LP0A 3C15B 4CJVA 1UJ5A 3EEQA 1VRQC 3IBFB 4L72B 3U4LA 3K2PA 4JI8F 1Q8IA 3I5AA 3NNCA 3OR1A 4NXMK 4WU3A 3H46O 3Q7BA 4XK8C 1NGBA 3KD5E 4ECUA 3TR8A 5DETA 1FRLA 2UXBK 3V5RA 3KWIA 4KHQA 5DLFA 2E66A 3P96A 3BQ1A 2ZITA 4HACA 1WUUA 1F2HA 3CF5L 2RSQA 3KLHA 5AQHA 1Q81T 1SC6A 3VMFB 3MM8A 1UVMA 1NEEA 2VKRA 2UUBF 3I33A 5EDWA 1QZ6A 4PWDB 5FLXU 2WONA 2NUBA 1RNHA 2HHTA 2GA7A 3E01B 2H1YA 4JKBA 5GADU 5F41A 4ISFA 1VK8A 1R6YA 4PXBA 2DYAA 1RSCA 1WSVA 5M1NA 1T03B 2D9OA 2O8BA 4K42A 4JI4J 2DH7A 2AP6A 4B1ZA 1UAXA 1VQMS 4MO5A 2BE2B 1B7FA 1U2FA 1VBZA 3W63A 3I8DA 4H0PA 2D1KA 2JEJA 1FKOB 1DAXA 2OPQB 2QA1A 4KKOA 1S3XA 1T05B 3H4BA 1VCTA 4LH4A 5HOOA 2YKPA 4JP8A 1AFIA 2NQPA 3UN2A 3NHGA 1UA0A 4CLTA 1HHSA 4JI7F 3TAGA 1H74A 2ACYA 3AAWB 4ZPAA 2F9TA 1ATRA 4BWJA 3W1YC 3ILOA 3O4WA 4HKQA 4ZS6A 1YKWA 3CDBA 3O9SA 5DO2A 2OPRB 4CEDA 2DNGA 4ISGA 3J80Y 2XCAA 4QAGA 1L3UA 5E5NA 4JI7K 2FBVA 2Q79A 3ULEB 4F8RA 4IO1A 4NLQA 3TABA 4KPYA 4L8RB 4MT1A 3W8PA 5J1EA 3CC7S 1QHTA 2J4RA 3D0HE 3SCXA 4CDIA 3BKUA 5GAGP 1SV5A 1NDCA 1M5KC 1VC6A 1NKEA 4E7HA 3LDLA 1GMWA 4WFBQ 1Q4RA 4DV1K 3DXMA 1X8DA 3BEXA 1N88A 2A3ZA 1CLFA 3HJVA 1B4SA 3ZZPA 1HIYA 3L4IA 3MOJB 3HVTB 3TTFA 3G87A 4BWMA 4KT0C 4YFUA 4I2QB 1I6JA 3KLGA 4G9ZA 1Q0NA 1VSIA 3E9PA 3ID8A 3DOLB 1NJXA 5FROA 2LMIA 1YITN 4E98A 4Q5VA 4FZZA 3FSYA 4KH1B 2MGZB 2B6AB 1UVLA 2ITGA 5B0GA 4QW9A 3HHNB 3DLEB 2ZJRL 2WOMB 3KZBA 1MA9B 2ASMA 2QA4G 2L41A 5ETMA 4KAIA 2IM3A 4JI3J 3J7ZT 4Q8EA 5E3PA 5K8OA 4DX8H 3QPIA 3DLBA 3KXDA 1JLFB 3QAEA 2FB0A 1JNZB 5DQHA 4FVUA 4OLAA 4M3ZA 3M7VA 4FWLA 4USJC 2VWJA 4CJFA 3NE6A 4DR1K 3KDOA 4AL7A 2ABYA 4Y2KA 2ZC4A 1YX2A 2IJNA 1HBUA 3LGNA 2HHHF 3P49B 5C12A 4FNHA 1D8ZA 1Q82T 4TQSA 1MROB 2ZE2B 3TWHA 3Q8PB 4EYIB 4ILMA 4C4WA 2KTQA 1R59O 3SJHA 4USIA 3CCUN 1NMNA 3G25A 1ZZFA 1BL3A 2F8TA 3MM9A 4ZPWR 4ZPDA 1WC0A 4KYZA 3U1LA 2HHHK 3MPYA 3QERA 4B8AB 1VQ9S 2Z2ZA 4P73A 3D2FA 3NAIA 1IWAA 4W92B 3QLHA 3EM1A 2HMIB 3D6TB 3W66A 4B17A 3VVTA 1SBRA 2QN6B 4W5QA 2GIFA 3PSFA 1ITGA 3J7A1 3CIPA 1Q78A 4FJ9A 2L9WA 4I64A 3Q8YA 3WIUA 2HS0A 3CM6A 4RW7B 1KONA 4WQ4A 2YX7A 1RWWB 4BCAA 1JXEA 4ZTFA 4K4ZA 2QC3A 3LDPA 1WEYA 4F02A 1APSA 4MKBA 4DR5F 1T9VA 4LSZB 2BMBA 1FX4A 5F3ZA 5JXSA 1MMNA 4B1VA 4QR1A 4DV2J 3CJTA 1RHMB 3FC9A 1VQYA 3M4XA 1Q8KA 2W8KA 1BI4A 2V5HG 1MMLA 3ID6A 1SS6A 1R8BA 3LP2A 1FFGB 1QSSA 4H4OB 4DZ6A 4N8NA 3P39A 5ETQA 3AA2A 1QAJA 4DR5K 3K59A 1XNRK 2EFNA 2Z4PA 4J2DA 2CQ3A 3HHLB 4BS2A 3FZMA 5CAAA 2AV5A 5CQGA 1KLMA 2CJYB 2BM0A 1IWGA 2D3ZA 4J9VA 2V94A 2V9KA 4ZP7A 4RUAA 3NMAA 5J2PA 3VF0B 2K7JA 4I9LA 2IRUA 5H9EK 3G6ES 1HWIA 2CPIA 3VOVA 2FJVA 5IWAK 3QSIA 2FHJA 1WN7A 1IXKA 2F8MA 4M5MA 1DQ9A 4IG0B 5SZTA 1B0TA 5JVHL 3NH2A 3FZ2A 3RRHA 1WDTA 5HQMA 3UN5A 3CCSS 3D1OA 5L46A 2RB7A 3MCSA 2V68A 4DL3A 3FFIA 3TAFA 4W4MA 4RBVA 3MAAA 1NMEB 1NWKA 3ASMA 3HX9A 4YB1P 3CC4N 5FPEA 4OPAA 5D8HB 1CJVB 2ZOGA 3AHPA 3WZ0A 5K8PA 4PKHA 4KGZB 3H45C 5IC4B 3QRPA 2AJ2A 5DM6L 3WUHA 3NVKA 5GMEA 1MSWD 1A7GE 4F2SA 4RW9B 3CD7A 3SBMA 3CVKA 3M3ZA 4M3YA 3CCVS 3RMCA 4MK9A 3VTHA 2HHXA 2LXIA 3MN9A 4Z4GA 3H3OB 3FFKB 4CIOA 2K06A 1E3MA 4PKIA 4J2AA 1Q81O 3RB3A 1S72S 3ZZ0A 1S6QA 3D5MA 4QOTA 3JS6A 4FLXA 4C8ZA 2P9UA 1UVIA 5AZJA 5KFKA 3W5ZA 3PIPL 4KRFA 1WOOA 1N34J 1N52B 1QJHA 3IP0A 3S6EA 2VODA 3MUMP 1QZ5A 1SL1A 4K25A 2HFZA 2P9PB 4C98A 1IR2A 1SUQA 1X4DA 4CNZA 1XR5A 2DY1A 4IWVA 2Y1RI 3EZWA 2B3TB 3D2EB 2KFZA 2CZ9A 2R2TA 2MKJA 4BRMA 4CRJA 2HVDA 3OR2B 3R8EA 4CH1A 3MD3A 4V19X 1VSMA 2VH7A 4ZPCA 2HQCA 2YH0A 2IM2A 1NHVA 1FD2A 2NLXA 2CPJA 5I4MA 2ZUGA 2F9JA 3AB2B 1KFSA 2YKNB 3OFFA 1RWUA 2HURA 3EXYA 3HHEA 2IJFA 1LFPA 2MKHA 1WSJA 2C3MA 4DFKA 4EBEA 5L1IA 4BRPA 2OD6A 3CCMS 2V7ZA 4W98A 4OYPA 3V9XA 9ATCB 4FWNA 2H9ZA 1Q9YA 4CZKA 4G1QA 4OYWA 2VOPA 2YWGA 1HQEB 2M8HA 1VQLN 3MGJA 2JL9A 5DG9A 2BQRA 2W9BA 2MQPA 4USVA 2IDOA 3F9KA 3CETA 3MURP 3LAKA 4LMZA 3L2VA 1F5AA 1S1TA 4DR7J 5H1SQ 5C5JA 3UB5A 3DFEA 1RT5B 4HR2A 4JN4A 4J90A 2FYXA 4LF2A 1X5TA 2L9DA 4GW6A 5J2NB 3MFHA 1P6TA 4J2EA 2MTLA 3RZAA 2XC9A 2NRWA 4WFAL 5I42A 4FPBA 3IR7B 2MZJA 2V8VA 4URGA 3VQEA 4J9SA 1BQMA 1S6UA 4BROA 3CO9A 4CFBA 1Q7LB 3OXLA 4QOZB 3TSUA 1RYSA 4DV0F 2HAFA 4CJEA 4L3NA 4LFAJ 4U67L 1S1UA 3OTDA 1VQ4N 3EWGA 3AB4B 4RR5A 2IA6A 4LREA 4IR9A 3IRXB 3AQPA 3J7ZO 1J27A 1IKXA 4PUOA 3VQ8A 3QMLA 4MYUA 1TL1B 3RB4A 3NP5A 1RB0A 1RTZA 4DV0K 3I6PA 2BACA 3MMBB 4Z0UA 4RBTA 4CZIA 3HPOA 1EWRA 3S9HA 3HZ6A 3HI0A 4CF1A 2C2RA 5F8LA 5KG2A 4NLVA 4WP9A 2J0QD 4LH5A 3VPZA 3HSCA 1D5AA 2ADCA 1Q82O 2R8IA 1MNEA 5F1XA 3DGPA 4ZLLA 1WHYA 2P6SA 7AT1B 2HFSA 1FO1A 2BJ8A 1TQLA 2UUAF 3AD9C 2CQDA 3QRRA 4YDDB 1LWCB 2E5LJ 5KFQA 5HSPA 1S77D 3ATVA 3EKSA 2EFVA 2GO9A 3HHLD 1VBXA 5ADZA 1UAWA 5FD1A 1L5UA 1I51B 3M8QA 1TUUA 2DR9A 5HBMA 2OAUA 2UUAK 2OTLN 3A8JA 3GP9A 2BOPA 4Y1DA 3THPA 1O13A 3J7YP 4I56A 1DEJA 2G8UA 3ZT3A 3Q8RB 3TUPA 3B6PA 3PW5A 1WJ9A 4ED4A 2B5JA 3N01A 1JLBA 4ZLNA 1D3WA 2YQ0A 1UETA 3PTWA 2HK3A 3ZETA 4A59A 1X9MA 4E8UA 5IT9O 3FEYB 2VWKA 4E7KA 4NASA 3BGFA 3MWTA 4BVPA 1RT2B 1SKUB 1B9DA 3D54A 5A6PA 4CEFA 4O4GA 2VICA 1S0OA 4BREA 4YQWA 2VBXA 3KG0A 3PHEA 5HATA 2N3LA 4BY9C 1CJTA 5LMUF 3WQTA 4CLFA 4ILRA 4TU9A 3DI6A 1NBWA 4FWRA 2I2YA 1LK5A 3MM6A 3MUTP 3KUEA 1G2EA 2DHXA 4P2FA 2YNFB 2LQ9A 2CNKB 4IDKA 5HP1B 1XR7A 4X4UA 1XJWB 1BG3A 4EFHA 4OIXA 3M1FA 2VFUA 3GG0A 3UNYA 1IV0A 1NXIA 1U6ZA 1XHZA 3CJ2A 2ASJA 2PYJA 3OBIA 5LMNJ 2B9EA 2M70A 3R2DJ 3AT1B 4IH6A 5LSRA 4DFMA 1WG1A 3BS9A 4HT5A 3LH2S 2JDJA 3FZBA 2W40A 3O1WA 1PBAA 3M6GA 1S6PB 2GELA 3EL2A 5CYQA 1BWEA 4J37A 3PRVA 4LT6A 4JI0J 3HSJA 3LALA 1LWFB 3KHLA 4WK1A 3C6UA 1Y5NB 5CYMB 4AQYJ 4P74A 4H0YB 3O8WA 1F5BA 1JJCB 4ALZA 2QI2A 4IO9L 4KV8B 5K8MA 1SIZA 1P90A 4HVJA 3O9QA 3OL7A 3LZIA 3EGVA 1NK4A 4A46A 3R1HA 1A5XA 3B6BA 5C24B 2QMXA 3D1QA 2DVIA 4GVBA 4RW8B 2WVFA 4DSLA 4OLBA 3QT8A 1HWJA 1R6VA 2C2EA 4CD1A 2OP5A 4CEZA 1YJ9N 2VQFJ 1HYZA 1JB0C 4OPJA 1HBMA 3I87A 3KWMA 7FD1A 5CHIA 2DGSA 1AT1B 2XULA 2HQ3A 2HMPA 3FCVA 3E3XA 1QAIA 4ILJA 5BN8A 1S6OA 4IEIA 5A8KA 1TAQA 2RUSA 3EGZA 2B7CB 4B08A 3S3MA 3H20A 3VQCA 3L2WA 5M2UA 5J2QA 4J9NA 2BQUA 5AT1B 1N6QA 3VGUA 3QGPA 5KOWA 1CULB 4DL4A 1YZ7A 1H3DA 3ZEUB 5G0RA 4B3RF 3MEEB 1VSDA 4FLVA 4DKWA 3MMJA 2KM8C 3SDEB 4MFBB 3RSEA 1ACMB 5B09A 1EZZB 3ENHA 3TYTA 2CQHA 4K0KJ 4CJRA 4ZJLA 1X4HA 1HLWA 4AE5A 4B3RK 3QEIA 4J9MA 3AH6A 3E2EA 1G3OA 2UV8A 5E3AA 1KOOA 1WAJA 1ZZNA 2XSFA 3J7Z5 5DM7L 1M5PC 5DQGA 1RACB 2RS2A 2PBDA 2C2ZB 5D15A 4DSFA 3ATUA 1HNVB 2KHOA 3MMAB 3PO5A 3KK3A 1OY9A 5F9LA 1PYSB 2M5YA 1IBKJ 4EEYA 4N8OA 2NS1B 4WQ4C 3BKTA 2A2CA 4KTWA 2UZAA 1JLCA 1YUWA 3H98A 2FJBB 4EP4A 2O8FB 3V4MA 2GIQA 3ZT2A 2CGJA 3QO9A 2HZCA 3EVMA 3CCQN 2MQLA 2YX1A 3ILJA 2BR0A 1Q5YA 2MKCA 1JIHA 3OTOF 4OKKA 4CI6A 1RDBA 1DZ5A 1WELA 1HNWJ 3MXJA 4KHPJ 2QKKA 3ZTOA 1JQGA 4NOHA 4EBCA 2C3YA 3C6TB 2VGMA 3WNGA 4FPAA 1R27B 5IV3A 3QESA 2J6TA 2C2KB 2RDIA 2DNRA 2HIQA 4QQBA 3VEWA 2ETJA 3FGUA 3V6JA 1I1GA 1YJRA 3OTOK 4WTOB 1FK9A 3ZSWA 3CI5A 3OUYA 1HQUA 2RQKA 1VQ7N 2P5VA 4R8UB 2JEIA 1S5JA 5CCMA 1IKYB 4M5JA 2QLXA 4KTZA 4UF4A 3KHYA 1GLAG 4FYYB 2P9KB 4WIQA 3HT0A 3L8BA 2NSBA 2UYTA 1Y00A 4DTUA 1VRTB 4ZCIA 1FDDA 3M5RA 3ZCMA 3N5FA 4HVZA 2V2VA 1IO2A 4O3QA 3NOGA 1JJ2M 3GIJA 3A5LC 3NCIA 1HR0J 4CZJA 3FBFA 4Y2MA 2OLWA 3BF4A 1NNDA 2Y8YA 3V9WA 3QRQA 2A6OA 2PI5A 3R97A 1HPZB 1QSLA 3IS9B 2HPUA 4ES2A 5CZVA 1QS4A 4I6WA 3WC2A 4E7LA 1X7VA 4DL7A 5AQSA 3AVFA 2QIFA 1LK7A 4O0NA 1IR1A 2AGOA 4FYVB 2I6WA 3M9OB 2FVRA 1D9DA 4OZJA 2MXYA 3GIRA 1RUSA 1S97A 4R25A 1WSIA 1JLQA 4LBIA 2OPSB 1T6DA 1RYRA 4IOCL 4GC7A 5F0WA 2AP1A 4CH0S 1XMQJ 1Y10A 2G0JA 5B0DA 5F9NA 4CZEA 3UKUB 1AUDA 3FMBA 2ZHOA 3ZSVA 4NA3A 3UDLA 3CPEA 3BF3A 3HSZA 1NHUA 3OTEA 4KBIA 3L3UA 3CMAS 4HH0A 3DXKB 5M1PA 4OI2A 3THWB 3D0GE 2V51B 5BR9A 1C0FA 2FD2A 3DHWC 1WNEA 3A8KA 2OHDA 4YOXA 3E9OA 3QICA 3EZ5A 4OGCA 1EWQA 4DPUA 2W4CA 3GZ7A 3I0RA 1NU4A 1WSEA 4TLQA 2ZD1A 2MKSA 4WF9L 2G1HA 3ET6B 2H4YB 3A0IX 4OKEA 4X4TA 4JI2J 5L9NA 1DY3A 4NZ7A 4BQZA 1Q7YT 2HVIA 3ZZZA 4O5BA 2FJAB 3CCLN 4O44B 2XMUA 2HGNA 3WBZA 4FNIA 2KKZA 1BQXA 3CSKA 1N33F 2D5RA 3M2VB 5AQKA 3M9NB 1RLCL 1X4GA 3HHDA 4WFNQ 4I2PB 5M1QA 3RB6A 1B70B 2WSEC 3AA9A 4GO7X 5CZXA 1RGVA 1RILA 2IAJB 1RCXB 2ASDA 1RDRA 4WKRA 2XI3A 4OFZA 4OJRA 3VALA 2XS5A 3NFAA 4EGLA 3FBBA 1R7IA 2DTJA 3O5TB 1N33K 1P1LA 1RCOB 4ZP8A 4IUFA 4JRQA 2E1ZA 1JXBA 3L2UA 4JV0A 4KC5A 2HWIA 2VPZB 3DYAB 4FF3A 1S76D 4CHOA 1PC5A 2GMJA 2FHMA 4DPYA 2KW4A 2DGXA 1UJ6A 2MZSA 2NCKL 3KUGA 4B9TA 4PL8A 4P52A 1RT4A 4JI1F 1XERA 2N7CA 3TEGA 4O3OA 4ZVFA 1FKAF 1YJVA 2ZVSA 3HVWA 3DLRA 5HMWA 4ELTA 3QNNA 3WT0A 1VQKN 4JI1K 3TUZC 5CZ2A 4WP8A 3ISNC 4CFAA 3TA2A 1R3NA 4E0DA 1FT8A 1P9YA 5ETRA 2O66A 3J8AA 2CNNB 5IT0A 4B3TJ 1QE1A 1XTZA 3A5OC 4M7XA 5AQNA 1GLLO 3VWSA 4F4KA 2QV6A 3U7JA 3NCPA 3PW0A 1BLUA 3IA0A 4LBPA 2KT5A 5E7OB 5HLFB 2NUUG 3G8TA 4CJQA 3CF5Q 3BZKA 1REVA 1WEZA 1S9GB 1C1BA 5HROA 4PWWA 1TELA 3NOCA 1TU0B 3OJSA 2CXEA 2DNPA 2ILYA 1HRHA 2HBZB 1BUPA 3C2PA 2KJWA 4X64F 5LJWA 4DCJB 3T7ZA 2R2UA 2HLUA 2PD1A 3NXZA 3M8WA 4AM6A 1SPBP 2OZMA 1UWBB 4FVMA 3HTVA 1NGGA 1UJ4A 3OPKA 4F4XA 1K73T 1BHNA 1H6KX 2ALZA 4O55A 3ELHA 3MCMA 2Z1HA 4X64K 2GVZB 5BPNA 1PBUA 1C1CA 4USWA 2LYVA 3VEXA 2HYIB 4W5OA 5GAHI 4DSIA 1F2GA 4M5DB 2V2KA 2UU9J 3MK6A 1K8KB 3DRRB 3V81A 1NPRA 3FEXB 1SKWA 1ASUA 4FW2A 3HOSA 3HKZD 3CJBA 1CXUA 4CF2A 3M8PB 5BYRA 4IG3B 1FW6A 3N4WA 3KKFA 1Z05A 1KSPA 3RW7A 2IPOB 1BC6A 3O3HA 1RGIA 1RTDB 3ITHA 3G0ZA 1XNQJ 1K0TA 3QAUA 3ULDA 5E33A 3FCHA 4F7VA 4DN9A 4P9SA 1NJWA 3R5AA 4P7TA 3BO4A 4C8MA 3DLGB 5AQIA 1OWXA 3MPDA 4A8OA 4BACA 1VRUA 2DR5A 1IM6A 2HAIA 3WNFA 1VSFA 1LW2A 1MLAA 1ZBLA 1EETB 1BIZA 4ICLB 3R5BA 4BC3A 5D4NA 2M9KA 1S10A 1TVRA 1PSDA 3M2RB 4RUHA 5CXTA 2AGPA 2H5JB 1OH6A 2WCXA 1D09B 3UD4P 1A9NB 4BRHA 1BA0A 2CGLA 4BC4A 2XGQA 1HNXJ 1YRTA 3QT7A 2OANA 1BCOA 3LAMA 1AW0A 2JVOA 3NGRA 1OY6A 1WHWA 1C0UB 3PJ9A 1WLJA 2VU5A 4KH6A 3DWLA 1XK8A 2WK4A 2HKEA 4YHHF 2YY3A 5KFAA 3W8GA 2O8DA 2F4VJ 5GAEP 4PXEA 1JLAB 3NG8A 1V5VA 2ZJRQ 1K6YA 4C8LA 1G6BA 1HKAA 1HBOB 3K5NA 3BGLA 4QWEA 4FOEA 2EFGA 3D1HA 4U96A 4HI2A 1BIUA 1YITS 4P6QA 1VAZA 2ZUAA 2MKYA 3SYZA 1U2RA 4XEIA 4FWQA 2IRXA 2DXEA 3AVCA 4YHHK 1M0SA 3V1RA 1VBKA 5KQ8A 4H8KA 1KHWA 2ERRA 1R0BG 2HK2A 3FMWA 1VBYA 3E01A 2B9XA 4K8RA 1EQYA 4ED8A 1NGJA 2PE8A 2PC6A 3L7UA 4X4RA 4Y2CA 3RMBA 5C2DA 2P9GA 3HCXA 4LFBF 1UFKA 3OL6A 1RAJA 2NRVA