2ZE2A

Crystal structure of l100i/k103n mutant hiv-1 reverse transcriptase (rt) in complex with tmc278 (rilpivirine), a non-nucleoside rt inhibitor
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of HIV-1 reverse transcriptase/TMC278 complexes: Strategic flexibility explains potency against resistance mutations.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase, hydrolase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 136
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ze2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ze2A05
4CJRA 4N5SA 3H08A 5KFYA 2BANB 3OL9A 4LQ9A 3GV7B 1NHVA 2OPSA 2XO7A 3TAMB 2BGGA 2KFNA 1DLOA 2J6SA 4ZVHA 3OL6A 5KFOA 4OPJA 2Z1IA 1SV5A 4M45A 2V4QA 3HVTB 2UUTA 2R8KA 5DQHA 3ITHA 2IOCA 4PWDA 3MEDA 1RT3B 1TKTB 5HRNA 2BE2B 4ELVA 5KGXA 4W5RA 3BSAA 2YNGA 3SQ0A 2I5JA 5KFFA 3OJUA 4FM1A 4YP3A 3P83D 1YVFA 1J5OA 5KFAA 5HLFB 4FZXC 4MFBA 4TQSA 4BDZA 3C95A 1D0EA 4KPYA 4W5QA 3NGIA 4J9RA 2IA6A 3OYFA 1TV6B 3QO9A 2AGOA 4K4UA 4B08A 4ECQA 4CF1A 3G10A 2IC3B 5HP1A 3VQ6A 1B9FA 3AO5A 4JS4A 5HRSA 3IRXB 1RT1A 2B6AB 5FROA 3M9MB 3EPGA 4NLGA 4I2PA 5DQGA 4O55A 1QS4A 1RDAA 1XR6A 3AV9A 5KG3A 1JKHB 4LSLB 3NH0A 1HPZB 4QWAA 1S10A 4NLSA 4MIAA 3KLIB 4OGEA 1CXQA 1QQCA 2WK4A 4KO0B 4IRCA 3CDEA 3PJXA 4K4VA 1WSFA 3L2QA 3AA2A 2R8JA 3AVBA 3WNEA 3ZSVA 2JC0A 4B9LA 4B3OA 1HQEA 4LSNA 4J9LA 3NAEA 2ALZA 1S1UB 1WNEA 1JXBA 4DQPA 4J9SA 3DOLA 1T05B 2IM2A 5F8NA 1BI4B 1XWLA 1T94A 3FDSA 4DSIA 3IGNA 4C8OA 3C6UB 4B9SA 1RTJB 1GOBA 4FCYA 1C0UA 2HWIA 3AVLA 2I1RA 3VQDA 1VSHA 4IR9A 2ZQBA 5KI6A 4KREA 4GMJB 3NKYA 3QGGA 4RUCA 4KV8A 1UOCA 5EWFA 1KLMA 3K5NA 4Z4FA 5J1EB 4CCHA 2YKMB 2C22A 3H98A 1EETB 4E7IA 1RDCA 2G8KA 3NAIA 4IDKB 4FBUA 3IGVA 3QEIA 2B5JB 3KHGA 2UUWA 3VN5A 4BE2A 2VWKA 1LW2A 4TXSA 2P5GA 1RNHA 4DS4A 4O44B 3QGHA 3LP1B 1B9DA 1Z4UA 2V4RA 4M42A 3OSNA 4EYHB 1MU2A 1YVUA 3OL8A 5KRSA 1RILA 3RWUA 3E01A 3NE6A 1EP4A 3BQ1A 2GUIA 2R7YA 2V9WA 4M3ZA 3GIKA 5KG6A 4ID1A 3RMAA 4OVLA 3HPHA 1BQNA 1RA7A 4IFYA 3T19A 1HQUB 3RAQA 4RW9B 3GQCA 3I5AA 4NLPA 4TQRA 3PX6A 2YNIB 4QW9A 4DSLA 4CJKA 4F4ZA 2F8TA 4RNNA 5DQIA 1RT4A 2WONB 2Y1IA 5L1LA 2A1SA 5KT7A 4H4MB 1N4LA 3RB0A 3KKSA 1IKWA 4UQGA 4Y2CA 2RF2B 3HT3A 4DTSA 5HBMA 1BISA 4KHQA 4DL7A 2GV9A 2BRKA 4FLXA 1TAUA 3RMDA 3KLGA 1ZBIA 2DY4A 1RBUA 4FJKA 3M8SA 2C2DA 3SPZA 1BCOA 4YNQA 1JLGB 1NOZA 5F8IA 1VSEA 3KHRA 3NGZA 5J1EA 4B3OB 5EUHA 1JLBA 1QUVA 4U7CA 2QKBA 4DMNA 4MFBB 4N41A 5F9NA 4KHUA 3KLEB 4IH5A 2X78A 3NF9A 3P1GA 2HNYB 4DQQA 4M3XA 2JEFA 4PQUA 3OLAA 3C6UA 5EDWA 3L2WA 2DPJA 4C8LA 1JLEB 3HVTA 3NFAA 2EC0A 2D5RA 5K14A 2AX0A 4CJPA 3AVAA 4ZP7A 3VQ5A 4LSLA 1RTDA 2AX1A 3RBEA 3PX4A 5HLFA 2OZSA 5KFDA 5I3UA 1WSGA 4C8NA 4CJVA 1FKPB 2YNIA 1HNVA 3QETA 4R5PB 4CE9A 3CVKA 2ZD1B 3NH2A 1B92A 3JSMA 1RCHA 4FBTA 5HRPA 1TVRA 3UR0A 2FC0A 3L3UA 2I5JB 1IKVB 4OLBA 3LWLA 5KFEA 4FLWA 1U4BA 4Y34A 2C28A 4ECSA 4CJ5A 1RT7B 3BGRA 2ATLA 3ZCMA 4FJXA 5FDLA 1HMVB 2C2RA 3M9NB 1C0UB 2HHTA 1TV6A 3EZUA 1RT5A 3M8PB 3IG1A 2QKKA 1L3UA 2WHOA 4MK7A 3SUOA 4DSFA 1HYZA 4Z0UA 3OYCA 3UDLA 3MTKA 2J6TA 4CF2A 2VWJA 3ZSWA 4CERA 3CQ8A 3MXMA 5CYMA 3ZSZA 3KD1E 2D0AA 3Q8SB 4IDKA 1FK9A 3KK2B 4NLXA 1NK9A 3QZ7A 3MR2A 3IN5A 3MFIA 4CFCA 5C24A 2IBKA 2FBXA 3H5XA 4F4WA 5KG4A 4CHPA 1HJRA 3SUQA 1UWBB 4FYDA 4ID5B 3KHLA 3E51A 4FXDA 2IM0A 4KBIA 1NNDA 4XIUA 4RW6A 5KFZA 5C24B 4KI6A 2JEJA 2HW3A 1S9EA 5KG7A 3SI8A 3DM2A 3KJVB 4KKOB 4J9NA 3SFUA 4FLVA 1L3VA 4RW4B 1IKXA 2O4GA 4GC7A 1RTJA 1R0AB 3FQKA 4KFBB 4MIBA 3LZJA 5KFQA 5KFMA 5F8MA 1S9GA 4NLDA 1TQLA 2B6AA 2OYQA 4Y1CA 4I9LA 2D3ZA 2UVWA 1VSDA 4KAZA 4ED2A 3DLGB 1IKYA 1CLQA 1GX6A 5KFNA 2HVIA 1R0AA 4CJ3A 4RW8B 3Q8RB 4H8KA 3QIDA 2HNDA 2KQ2A 3V9WA 1TGOA 4N76A 4URQU 3I0RB 1XC9A 3LALA 3LDSA 1J54A 4IFYB 1SL0A 4O44A 4URGA 5KT5A 4KTWA 3M8RA 2IJFA 4NLYA 1ZBUA 3VQ8A 4N47A 1RDBA 3HJFA 3VQEA 4J2DA 3L3VA 2OPQB 3KK1A 5CZ1A 3CM6A 1KSPA 1NJWA 3PUFA 4CGJA 4F8RA 2UVVA 4DTNA 1EP4B 3FRZA 4IG3A 3NCIA 4FLUA 4E1NA 1NKCA 1C1BB 3IS9B 4DS5A 2ZD1A 2FVQA 1U47A 2PYLA 2F96A 4Q45A 3ASMA 1W9HA 1EX4A 3SQ4A 1YTUA 1JXEA 1L5UA 4TY8B 3H4BA 1XR5A 3HPGA 1RDRA 3NF8A 4CHYA 1HYVA 4K50A 3TI0A 5C42A 1RTHA 5L9XA 3DI6B 4M3WA 2OA8A 3DYAA 5J2PB 4QAGA 5I42B 4J9MA 2IAJA 1JLQA 2GIRA 5J2MB 4NLTA 4J9QA 1S9EB 2P1JA 5C42B 1JLBB 1WNSA 4O3SA 5HBMB 1S1TB 4IKAA 4DTMA 1TL1B 3GYNA 1RBRA 2FVCA 3OYMA 2E4LA 4W5NA 4K4YA 2GC8A 1TK8A 4AHUA 3DYAB 5J2PA 4HUEA 4M3TA 1C1CA 2BANA 3CM5A 3T5JA 1S9FA 3LP2B 2VG6B 2FVRA 5EWGA 4HCCA 3BR9A 4FJJA 1JLGA 3HP9A 4AHSA 4DF8A 4NCBA 1QTMA 3CWJA 4RG8A 4CGFA 1FXXA 4CHZA 1VRTB 3PW7A 4OKEA 4FJ8A 3QEVA 1L3TA 2FLPA 3V9SA 2AWZA 1S6PB 5J2NA 3V6DA 1C2PA 2E6LA 4PWDB 5KFHA 4CIGA 3KLFB 1TAQA 3V6JA 5F8JA 4QWDA 4YR0A 1JLFA 3IG1B 3N6NA 5KFCA 2YKNA 2D3UA 3OL7A 3EY1A 4F3OA 2PZSA 1QSLA 2HVHA 4H4MA 3H2LA 4R5PA 4NYNA 4F2RA 3HP6A 4FJMA 4J9PA 2W7PA 4NRUA 1UA1A 1Y97A 4J2BA 4C8MA 3ZSQA 2YNHA 4K4WA 4DL5A 4OKJA 2W9CB 3TARA 1RT6A 1S4FA 5F8HA 3BGRB 3H40A 2VG5A 1DTQA 4DTPA 3GV5B 3OYAA 4GVMA 4YMEA 4Z4IA 2RKIA 3I5BA 4ED0A 1S1XB 3KLHB 4ECXA 1W0HA 3AVJA 4LH5A 3VQ9A 3AVKA 4KE5A 3BDPA 3SNNA 1BIZA 1QE1A 4R0EA 4HTUA 4BE0A 3V9ZA 2XCPA 4CK1A 3KTQA 5CY4A 4EYIB 1WSHA 1S9GB 1L3SA 3MAQA 4OKKA 4ZHRB 3TAQA 2HHSA 3UQSA 1UWBA 1RYSA 2XRIA 3CJ0A 4ZPBA 3I5CA 2DPIA 4IR1A 4RW6B 5KFBA 3T5HA 4EP5A 1C1AA 4NCAA 4RNFA 1JLAA 1T03A 4I2PB 3C6TA 3CFRA 1K1QA 4IRDA 4B9MA 4Y3CA 3MEGA 5I42A 3OYJA 4KKOA 4J9OA 2X6SA 1C0TB 4JV2A 1JIHA 2QE5A 4ED7A 1S0NA 4FM2A 3VQAA 3QESA 2R8GA 3TQ1A 1IKVA 4CGHA 4ICLB 3IRXA 1WLJA 1RBVA 3GIIA 3PX0A 1RT3A 1TKTA 1KVAA 5KFXA 1JXLA 2X6NA 5CYQB 2XI2A 3AO2A 4QPXA 3TAPA 1NK0A 5KTQA 4ZVFA 3O3FA 3H5UA 4DL3A 4CGIA 2JGUA 4CHOA 1DTQB 4ECYA 2HB5A 3U6FA 4RW9A 1SL2A 4WYWA 4CFBA 2WOMA 4IH6A 4M41A 3JYTB 4ZPCA 2HNDB 4IFVB 1S48A 3TAMA 3TR8A 1ZBFA 3LZIA 2HHWA 3LP0A 4N56A 1LWCB 4O3NA 4K8XA 4OLAA 1ZBHA 4WE1A 3PR5B 1LWFA 2ETJA 5KT2A 4NLQA 2ITGA 1KVCA 4QWEA 3LP1A 2W42A 2BDPA 2HHVA 3PJWA 5C25B 1KLNA 2HNZA 5KFWA 3ZSOA 3PV8A 3RB3A 4JUZA 3FSIA 1NK7A 3ALYA 1LAWA 1KFSA 4O3PA 4Y1DA 5C25A 3QNNA 3DLHA 4MQ3A 4DFMA 4M3RA 4IOBA 4B9NA 2RN2A 4ID5A 3DLGA 4MK9A 2ILZA 1JX4A 2BQ3A 3OYKA 2ASDA 3DI6A 3Q8PB 4PUOB 4CECA 3RR7A 2QXFA 3DRRB 4X2BA 3LP2A 4M3YA 4O3OA 2VG6A 1SH2A 3RB4A 3OYGA 3QEPA 4E7JA 2XWYA 3CDWA 4ZP9A 3QIPA 4TYAA 2CKWA 3G86A 4AHTA 3C6TB 4ECZA 3K58A 4DSKA 4F4YA 2OH2A 5HRRA 4KHYA 4URSA 1HYSA 1ZYQA 4NCGA 3GV8B 2YHAA 2G8UA 5I3UB 1K1SA 3WNFA 3DLBA 3RMCA 5KG5A 2RPIA 1NJXA 2IM1A 1TKZB 3TVKA 2RF2A 3SCXA 1Q9XA 1BQNB 4JRQA 3JSMB 1F21A 3EZ5A 1NKEA 3DLEA 4NCGB 2VG5B 3KMQA 3NGDA 4F3TA 5HROB 3QYYA 3DRSA 4DTRA 2Z1JA 4FJGA 2BRLA 4Z4CA 4XO0A 2AU0A 2OPRB 4FLTA 2EX3A 4RZRA 3M9OB 1KFDA 3RBDA 2W9BA 2JEGA 3DLEB 4ED8A 5EU7A 5SWMA 3DRPB 3OJSA 3D5MA 1NK5A 3M8QB 3CG7A 4H54A 3KOAA 1IH7A 3B6PA 4ZP8A 1SL1A 2EHGA 4RW4A 4EO8A 4CEAA 4KV8B 4FJLA 4AHCA 2PY5A 3VQ7A 4M95A 4HUFA 5CZ2A 3G0ZA 3S3NA 2YKMA 1YTAA 1REVB 2AQ4A 3MR5A 1JLAB 4G3IA 1ASWA 3AA3A 3MXIA 2OPPB 3VQQA 3QLHB 3F73A 3NMAA 1D9FA 5J2QA 3DLKB 1U48A 1S49A 3ICLA 2DFEA 1VSKA 3OHBA 2R2SA 4CF0A 1WSJA 5KFTA 2IDOA 2Z1HA 2WTFA 3CO9A 3LAKA 2OPQA 4KO0A 4DU4A 3I0SA 4YFUA 2AJQA 1LW0B 5KFRA 3ULDA 3VQSA 3NF6A 1NJYA 3QINA 4TYBA 1S1XA 5DG8A 1KTQA 3L2VA 1LWFB 3FFIB 2W7OA 2R8HA 1S1UA 4JV1A 4DTXA 1S6QA 1ASVA 1GOAA 3NAHA 3VA0A 1RDDA 3DOKA 3LAMA 1YT3A 3RMBA 3SPYA 2A1RA 3G6XA 3VA3A 4RW7B 3DDKA 2WOMB 2HMIB 4CJWA 3CJ5A 2HHQA 4DTOA 4B9VA 2G8IA 5DLFA 4KSEB 4CJUA 3OYNA 2R2UA 1C1BA 2W9AA 1VRUA 2C2EA 1FKOA 4ELTA 4FLZA 5JXSA 3ZT1A 2HMIA 5SZTA 1T03B 1D8YA 2GBZA 1DLOB 4WFYA 1DTTB 3HM9A 4EZ9A 2QV6A 5K14B 3K5OA 1JLCA 4B8CA 1C0TA 4ECVA 4Q0BB 4KRFA 4O3QA 3AVMA 3PVXA 3S9HA 4FZZA 1NK8A 4AILC 3V9XA 1RT2B 1XHXA 3I0RA 3RRHA 3SQ2A 1N5YA 1ITGA 2D7SA 2XY6A 4O4GA 5KFGA 3OYIA 2HHUA 4XPEA 4CJEA 2OPSB 1ZTTA 3CJ4A 5KFIA 4IBNA 1JLFB 3KD5E 3KNAA 3BSCA 3H5YA 2O5DA 4JS5A 4RNOA 4HUGA 3PW2A 1N5YB 4CEFA 4ZPDA 3PW5A 4IG0A 3AO1A 1HNIA 1NOYA 3ZT2A 4IRKA 3CJ2A 3I0SB 3V1RA 5FRMA 1N56A 3CFOA 2YHBA 1HMVA 3KJVA 5D3GB 2WONA 1JKHA 3GIJA 3NL0A 3OLBA 4QW8A 2IGIA 4HYKA 4TY9A 3K5LA 4GW6A 1N6QA 4WZQA 3LPUA 4FJ7A 2X74A 3UIQA 5DK5A 2W9BB 4QWCA 3B6OA 4DLEA 4FJHA 1RA6A 3BQ2A 4FLYA 2HWHA 4DWIA 1IKYB 3V4IA 1T3NA 2RDIA 2VG7A 3EPIA 3K59A 3SQ1A 3PR4A 1T05A 1RT1B 4DSJA 4EBDA 3OYEA 1QE1B 1BHLA 4BWMA 4DFJA 5KFKA 1EKEA 1NKBA 2RDJA 1J9AA 1TKDA 4M3UA 4BDYA 4MH8A 2YNHB 3ZT4A 4HVJA 1WN7A 1RTIA 2KFZA 2E6MA 5F8LA 4KHWA 4DL6A 1KCFA 3T3FA 2G8FA 3WNGA 1U45A 1FK9B 3LP0B 4PQUB 1UAXA 4KHRA 5KG0A 2YNFB 5KFPA 4WYLA 4OL8A 2NUBA 1IM4A 1X9SA 5KT4A 3AO4A 1CXUA 1S0MA 1RBSA 4CEZA 4M94A 4CHQA 3OYBA 3PO4A 3K2PA 5F8GA 4QWBA 1VSJA 2IC3A 3SI6A 3PY8A 3MXJA 2ATQA 3F9KA 5DGBA 1HARA 3RRGA 4NYFA 3RR8A 1O1WA 4F2SA 4I7FA 1S97A 4DU1A 4ZPAA 1S1WA 1A5XA 1W25A 4ICLA 1A5WA 3O4NA 4IG0B 2FJXA 2BR0A 2YNGB 4EBCA 1T7PA 4KFBA 3TAGA 4YR3A 3DLKA 3OYLA 4EO6A 1I3AA 5KT3A 5KFLA 4FW1A 4O4GB 4LQ3A 4K4TA 1RAJA 2OZMA 4I2QB 3KLHA 4YR2A 4AHVA 5KGWA 2KTQA 1RT5B 3AA4A 4CJQA 1BIUA 1VK0A 4B8AB 4NLRA 2XY7A 4K8ZA 3T5LA 4O0IA 1LV5A 1FKPA 1RT6B 3DMJB 5F9LA 4C8KA 1RTHB 3K5MA 3CYMA 3HKWA 1LWCA 3KK1B 2UVUA 4O4RA 4ZHRA 3OSPA 3L2RA 1QSYA 4KB1A 1JLCB 4MKBA 3MR6A 4DL2A 3RB6A 2XI3A 4E1MA 4IG3B 2FLNA 4DFKA 1TKZA 2G8WA 1T8EA 2BQUA 4HHTA 4RW7A 1G15A 3S3OA 4DQIA 4CEOA 1TKXA 1I39A 2CJQA 4Z4EA 5DMRA 1LAVA 4KI4A 3HL8A 4KB0A 1Q8IA 2DFHA 2FJWA 3G6YA 2W9CA 4BWJA 3V81B 1S5JA 4KTQA 3U3YA 1TL3B 3QERA 3JYTA 4FS1A 3ITHB 4ECUA 1CZ9A 4KHMA 4B9UA 2Q3SA 2OPRA 1MU2B 1J53A 3SFGA 4CEQA 3G6VA 4MKAA 4ZVGA 3E01B 3OS2A 3DRPA 3AO3A 4G1QA 5DG9A 3HSTB 4BACA 4RNHA 2DFFA 3GILA 1NK4A 1EETA 3PO5A 4ELUA 3MEGB 2R2TA 3TABA 2FLLA 3SUPA 3ISNC 3VQBA 1JL1A 2P5OA 3C94A 4RW8A 5EWEA 1LW2B 3ZSRA 3QEWA 3QZ8A 3EYZA 1X1PA 4FK2A 2D0BA 1U09A 3DM2B 4JV0A 4CIFA 3PW4A 4FK0A 3QEXA 3V6KA 1KLMB 3PZPA 4IH7A 3V6HA 4JRPA 4EZ6A 1N48A 2VG7B 3HK2A 4MK8A 1LWEA 4KAIA 1Q9YA 4DG1A 3LANA 4Q8FA 4WXWA 2D0CA 3BSOA 1QAJA 3SUNA 4NYZA 1XI1A 4K4XA 1HQEB 3OHAA 3HO1A 2B43A 3RAXA 1JL2A 2R2RA 4K4SA 3AVNA 3THVA 4E89A 4Q8EA 3DOLB 5KFUA 3D0PA 5KFSA 3P5JA 3TANA 3CIZA 2BQRA 4TN2A 2FBVA 4O5BA 3UPFA 5T7BA 2HAIA 3L2UA 2FBYA 1EXQA 4NLUA 4ECWA 4ED6A 2VA2A 4DTUA 4IKFA 5JS1A 2ZE2B 1WSIA 4KB7A 1TKXB 1SH3A 4CHNA 3KLIA 4I9QA 3NGYA 1TVRB 2V0NA 2IS3A 3AVCA 2JLEA 4E7HA 1Z25A 4CFDA 3M8QA 1K6YA 2WRMA 4Q0BA 2UVRA 4R8UB 3O3HA 5JS2A 4DSEA 3A2FA 1BGXT 4EBEA 4CJSA 1D1UA 1RT4B 1OS5A 1XR7A 3TWHA 4XPCA 4Q43A 3SV4A 2XC9A 4G1QB 1ZTWA 2IMWP 3NF7A 2P51A 4OPKA 4R8UA 2YNFA 2AGPA 4JLHA 3MEDB 3HPOA 3MF5A 4CIEA 3TAEA 3HYFA 2FVSA 1SKWA 3NBPB 2PYJA 3MECA 2JC1A 4CEDA 3D28A 1S6PA 5J2NB 3V6DB 1TL3A 4FW2A 4FS2A 3SJJA 1VSMA 1VSFA 4B9TA 3SYZA 4W5OA 1C6VA 3NDKA 2YKNB 4NRTA 1X9WA 1BL3A 3LP3A 1LWEB 1N6QB 3DMJA 1MMLA 4CGGA 4E0DA 4CEEA 3WNHA 3U3GA 1RTDB 3V9UA 4NLWA 3LWMA 4FZYA 1KRPA 2XHBA 4QCLA 5DG7A 2FBTA 4F50A 3MFHA 3OS1A 3SZ2A 1UA0A 2OPPA 4TSXA 3FFIA 4WXOA 3T5KA 4EEYA 4ED1A 1HNIB 2B4JA 3DRRA 3KK3A 1S1WB 3DOKB 1RBTA 1QSSA 4TLRA 2R8IA 2J6UA 2DTUA 4Y2AA 3OY9A 4L8RB 4DL4A 5HP1B 3CJ3A 3KLGB 4DU3A 3H59A 1NK6A 4DG1B 2W8LA 5KT6A 4LH4A 3RTVA 2XGPA 3MEEA 3HXMA 2Y1JA 1XHZA 4TY8A 3QNOA 4FJNA 1U04A 2KZZA 3KMSA 3DRSB 2IM3A 2ASJA 1ZBLA 5KRTA 4RUAA 4F4KA 2GIQA 5L1IA 4RU9A 1RYRA 1CZBA 4IFVA 4CGDA 1DTTA 2KW4A 4DLGA 1SH0A 4NZ0A 4AH9A 5J2MA 3KK2A 4DQRA 4LD0A 1RT7A 1NHUA 2ILYA 1WAFA 4CEBA 1SUQB 4PY5A 4DQSA 4BDPA 2G8VA 4H4OA 3ISND 4CESA 3VQPA 3K57A 1HRHA 3S3MA 3MECB 3I8DA 1S1VB 2E9ZA 5HROA 3CFPA 1BQMA 3HVWA 4W5TA 2WB4A 4CF8A 1TK5A 5KG2A 2W8KA 3KIOA 1SUQA 3QIPB 2BE2A 1ASUA 1LW0A 4CFAA 4HCBA 2E9RX 3T1AA 1X9MA 4FJ5A 1J5OB 1S1VA 2HHXA 4E3SA 4I2QA 5DLGA 4DF4A 2YV0X 3L8BA 4Z4GA 3HHKA 4YQWA 4CJTA 4PUOA 4FK4A 5D3GA 4Z4HA 4CJLA 3DLRA 3BREA 1SV5B 3AVHA 4ZTJA 1VSIA 4OGCA 4FM0A 4O3RA 3KHHA 4ZP6A 2ZKUA 3O3GA 4Q5VA 3H4DA 2FJVA 1IKXB 4HKQA 3PW0A 2G8HA 3QLHA 5J2QB 3AVGA 2D41A 5FRNA 1S6QB 4ZMMA 1IG9A 4FJ9A 4J2EA 2VA3A 3OYHA 4CJ4A 1GX5A 3OVNA 3KLFA 2RKIB 4KHNA 1NJZA 3NHGA 3MR3A 4LSNB 1JLQB 1QAIA 5KFVA 1KHVA 1S0OA 1BCMA 4CJFA 4KHSA 3ZT0A 1A5VA 3IS9A 3KK3B 4CK3A 1BI4A 3NH1A 2ZE2A 4NLOA 4WFZA 1RT2A 4O0JA 3V1OA 3V1QA 3M8PA 4EP4A 3NBPA 2Z1GA 1VRUB 4DFPA 1FKOB 1C1CB 3HVAA 3Q8QB 4DTJA 5E41A 2KZMA 2F8EX 4WFXA 2F8SA 3HVRA 1QHTA 4E19A 1U49A 1REVA 1TK0A 3PHEA 3QGIA 4DEZA 5KG1A 5C5JA 4WE1B 3OYDA 3N6MA 1RTIB 1IO2A 3V81A 3AVIA 3QO9B 3TAFA 4U6PA 4AHRA 1HQUA 1WSEA 4RNMA 4GC6A 3CDUA 3ZSXA 4K4ZA 3ZT3A 4ECTA 4H4OB 3KKRA 4E7LA 4FJIA 4ED3A 2HNYA 4IQXA 1BQMB 3KLVA 2WCXA 2ASLA 5L1KA 4J9KA 1JLEA 5CYQA 3QIOA 2B5JA 2JEIA 3D45A 5JUMA 4Q44A 1I6JA 1SKSA 1KHWA 4BE1A 2XY5A 2AGQA 1SKRA 3SV3A 3VQCA 3H5SA 4ECRA 4J2AA 4WZMA 1CSJA 4QOZB 5T14A 3ZSYA 5DGAA 4CK2A 2QK9A 3V4IB 4PA1A 2E9TA 2XY8A 3LPTA 1D5AA 1GOCA 3N6LA 1VRTA 1HNVB 3IAYA 4KTZA 1IKWB 2IJNA 5CYMB 1VSLA 3FQLA 3AA5X 1HPZA 4NLVA 1HYSB 3AVFA 4F4XA 3KLEA 2O4IA 4OJRA 1WAJA 1TP7A 3VQ4A 4E7KA 3MEEB 4ZTFA 5L1JA 2IAJB 3BJYA 2XCAA 2XGQA 4FVMA 4LY7A 4ZVEA 3BQ0A 1ZETA 3BSNA 3GIMA 1KVBA 5KFJA 2LSNA 4CF9A 5FDLB 1S1TA 4I7FB 1C0MA 2HNZB 1TL1A 2FVPA 1Z26A 3OS0A 3O4QA 1D9DA
chains in the Genus database with same CATH superfamily
2GS8A 1BWFO 2Z0GA 1JMTA 2BANB 3CD5A 5HMYA 3TX8A 3VAFA 2XO7A 2MKIA 4BRIA 3UO0A 4QPTA 3IXQA 2RE2A 3QJPA 1VJWA 4C6AA 5KFOA 2X1AA 1SV5A 3R2DJ 3ITHA 2D69A 6FD1A 2IOCA 2DH7A 3QFHA 3CD7A 2VPXB 4CT9A 4W5RA 4AQYJ 3BSAA 2I5JA 2KJWA 4NOHA 2DR8A 4YP3A 3UCZP 2RB7A 4U7UD 1GEHA 3P45B 4FZXC 3AB4B 1ESVA 1JJHA 4U7UK 4CO3A 4J9RA 1F1BB 3OYFA 3UVJA 1TV6B 3QO9A 2AGOA 4A57A 3HKZD 4CF1A 3QFUA 1SPBP 4JNEA 4OYMA 5HP1A 1BA1A 2YJFA 1T95A 3AO5A 3D67A 1VQNS 3IP0A 4H0VB 2YQ1A 2LKZA 2O8EA 1X8DA 3M9MB 2LQ9A 1FWKA 4O55A 3RW7A 4AM6A 1RDAA 3FZBA 3PM9A 3TTCA 2DRDA 4GVEA 3NH0A 3RRKA 1S72S 4MIAA 3T7ZA 4CLPA 4EAHD 4FVCA 3ZSVA 1VQ7S 2OI2A 2EFPA 4RUHA 1FKAF 4IUFA 1WC4A 4JYAJ 1S1UB 2YH1A 5B0CA 4J9SA 1AROP 3AD7C 1BI4B 3OHRA 1NHKL 3BEXA 4DSIA 3DGPB 3L4IA 2VASA 4C8OA 3A8EA 4B9SA 2OCEA 3OVAA 1HNZK 3AVLA 2I1RA 3FBBA 2I7NA 3VQDA 1VSHA 5KI6A 2GGPB 3QGGA 4RUCA 4X4VA 5EWFA 4ZJLA 2J8SA 2O01C 3PRBA 3OXFA 5D4LA 3DXKA 1EETB 1SAZA 1JNZB 1RDCA 2G8KA 3NAIA 4WP9A 3B82A 2LYVA 3AXMA 3VN5A 2RUGA 4ZPWR 2EFVA 4A8XA 2VFUA 4NXMF 2QLJB 4O44B 2G9OA 3QGHA 2J7KA 2GWJA 1U1MA 2HHHF 1KN6A 4NZ7A 2HOEA 1YZ6A 3Q2SC 1SJ4P 4OZ2A 4TKTA 1FRKA 3KJQB 3E01A 1ATSA 1NDKA 3NE6A 2RDDA 4K41A 1HR0J 2R7YA 5KG6A 1F2GA 2W2PP 2HIYA 4IFYA 1Q82T 4DV3F 3T19A 1HQUB 4TQRA 1XNQJ 3CDAA 2ZH4A 5KOWA 5IQ6A 4C11B 3PX6A 4QW9A 3EVMA 3DC2A 4ZIVA 4DKWA 3TX0A 1WBBA 4RNNA 4U8YA 3P6YC 4CBWA 1GTHA 5F3ZA 3VF2A 2NZ4A 4OMFG 4ZVQB 1RCOB 4H4MB 4FF1A 3SBTA 2E44A 4LF2A 1VIOA 4JI5K 4Y2CA 3AGKA 3HT3A 1BISA 4PYAA 1HR0K 2GV9A 2E88A 2ZNZA 1WACA 5LJ3Y 3HLUA 4QJVA 1RDWX 1RBUA 4V19X 4I4BA 2C2DA 1CLFA 3ZYYX 5M2RA 1T11A 1S5ZA 4C0BA 1WELA 1R8CA 2E7XA 3D0GE 2WBNA 3VESA 3NGZA 4H4KA 5J1EA 3F5TA 2FUG9 5CZVA 1JLBA 4P74A 5K5MA 1UW9A 3L9ZA 4IH5A 4BC3A 1NDLA 4K5RA 1XJWB 3OFFA 3O6WA 5IT9U 3FZHA 2YX1A 4LF6K 2DPJA 1DRZA 2E1MC 3I9ZA 2B7BB 2Z58B 1WSVA 1XNRF 2F9WA 1E3MA 3ZC4A 2AX0A 1ATNA 4ZP7A 2C3MA 1RTDA 2AYEA 2AX1A 3OTBA 4M63C 2XSJB 2Q6CA 3NWGA 5HLFA 1Y7PA 3DXBA 4YB6A 1U02A 3DRYA 4CZMA 4LIRA 4XAKA 1ROFA 2PI4A 4KPCA 4Y0FA 1B92A 3JSMA 1HNXF 4FO0A 2MSSA 4NI2B 4H0OA 1YJTA 2AT1B 3UR0A 1IKVB 2L9DA 4FLWA 2NRWA 1PCAA 1G7CB 4YB7A 4Y34A 2P9IB 4ECSA 1OY6A 3T1HF 4CJ5A 3JB9k 1H2VZ 3ZCMA 2YX4A 3PIOQ 4LC9B 1C0UB 4DOZA 3EZUA 3VZHA 3M8PB 1IV0A 1I94K 5BPNA 2OFGX 3G82A 3VGVA 4DSFA 4Z0UA 4KGZB 3UDLA 3IBFB 1R27B 3BKUA 4CERA 3CQ8A 3MXMA 3CERA 3MAAB 5CYMA 2DNKA 3MM7A 2CQ3A 4EWTA 2FHJD 5IWAJ 4IDKA 5ADZA 2EBEA 3KK2B 4LFCJ 2JWLA 1URRA 1YBTA 4NLXA 3MMCB 3MR2A 4QR1A 2IBKA 5LMNJ 2FC9A 2DEIA 3H5XA 4LREA 3OTCA 4CHPA 4D3GA 2J4RA 1X0FA 2V2ZA 1WKLA 1RACB 1KQGB 2GVDA 3E51A 3I56S 4KBIA 4XIUA 4RW6A 3ET6A 2MQQA 4MT1A 5JVGQ 2KT5A 4JI3F 3DM2A 4LF5K 4FLVA 5D78A 3M1FA 1IKXA 4BVOA 4GC7A 1RTJA 3UN5A 5ELZA 3TO8A 4KFBB 4MIBA 4USVA 3H45C 5KFMA 4CVNE 1TQLA 2OYQA 4Y1CA 5GADI 1S3XA 4I9LA 3FKBA 1VSDA 4FKXA 2RU9A 1N32J 1IKYA 2NXCA 3MUTP 2HGMA 4P71A 4H8KA 3TRGA 1KBRA 3NP5A 4JI4J 2J5AA 3QT6A 3QIDA 4N76A 3P96A 4URQU 4JI8K 3UN2A 2X51A 5H1SQ 4AUKA 4CO4A 5FPEA 1RDBA 3VQEA 3ZO7A 3CF5L 3L3VA 4ZDNA 1HHQA 4YY3F 4ISEA 4BREA 4DTNA 3FRZA 3NCIA 4CT8A 1NKCA 2ABYA 1U47A 2LQ5A 1M90T 3IA0A 2FYXA 2C3PA 1HYVA 4AM7A 3BGOP 5C42A 1RTHA 1YJRA 2BABA 2BJ7A 3RSEA 4JI0F 3CJAA 3DYAA 4QAGA 4DV2K 5I42B 4LVNP 5J2MB 4HHUA 2BACA 2EG2A 2CJXB 1FESA 1J6ZA 2F8HA 1HBUB 5HBMB 4IKAA 1PBUA 2RILA 3RGIA 3GYNA 5LL6d 4A5BA 1LOTB 4M3TA 4HUEA 4WQ5C 1S9FA 4DUZK 3NOCA 4A4JA 1ZM9A 3LGNA 4FJJA 1FDNA 3HP9A 1MLAA 3UD4P 3IBCB 2ZNYA 1A7GE 1P6TA 3IDHA 4B1WB 1DBDA 1L3TA 4LFBF 2Q0RA 1PYOB 1T9TA 1FNOA 4LRCA 3KLFB 1TAQA 3ZTRA 2BUNA 3EO3A 5F8JA 3QBWA 3UNYA 1N8RT 1JLFA 3IG1B 5E3PA 4DR5K 4A2BA 2HG4A 1OKJA 2XTJP 2PZSA 4H4MA 1K44A 3Q8YA 4F2RA 4NXNF 2D74B 1I51B 3VOVA 3ZLJA 2W7PA 3FJ2A 4NRUA 1UA1A 2XM3A 1YJNN 4PABA 3SJHA 2QRRA 4QYRA 2FSJA 4K4WA 4C7QA 1RT6A 1HNWF 3VZIA 1S7HA 5C2CA 3H40A 2VG5A 1TYQB 1DTQA 2E5LF 1TL4A 4Z4IA 2RKIA 3I5BA 3KLHB 1YAGA 5DJBA 4K0KK 3AVJA 4LH5A 2LQBA 2NXJA 1B64A 2OD6A 5B0EA 1BIZA 3VERA 2EXUA 2YX6A 3E66A 3E3XA 5CY4A 1VBZA 5GAEU 3MAQA 3HZEA 2HHSA 3VEVA 4AL6A 4WP8A 1UWBA 2YKPA 2ZHAA 2EKYA 3A3PB 1O5JA 2B3TB 3OR1A 3R7NB 3GU0A 1VQSA 5GAGP 1H0HB 2B56A 3T5HA 1C1AA 1HWKA 2YY3A 4I2PB 3QBXA 3CFRA 2OEJA 2C42A 4X64K 2GO9A 3MEGA 5I42A 2X6SA 1XUPO 1C0TB 2NRTA 3QESA 2R8GA 4L73A 2ZJQQ 5K8OA 3CHWA 2HFZA 1IKVA 2WBMA 4FP9A 1K8KA 1K8AO 3IRXA 2YVSA 3H1VX 2CQHA 4A8OA 2NXUA 1IBCB 2HBLA 4DR1J 1YXQA 1KVAA 2X6NA 1N54B 2XEXA 4P75A 2OGUA 4DV6J 5CABA 3DDIA 3FC9A 2OLWA 2NXNA 5KTQA 3BV8A 1O8BA 4ZVFA 3GCXP 2MKCA 3TJAA 1NDCA 4DZ6A 3UVJB 1B3TA 1QZ6A 4JI4F 5BR8K 3JS9A 4DHVA 4L74A 4ES1A 1KVJA 4IH6A 2DISA 2XZTB 4ZPCA 2HNDB 3ENQA 4C0OC 1OJ4A 4E1JA 1S48A 5HQMA 1Y64A 3EDRB 4YORA 4WE1A 2ETJA 4NLQA 3TA0A 1DQ8A 3H3OB 3M05A 1UVNA 1TUVA 2UU9F 1U6FA 5C25B 2DGUA 4HI1A 2HS4A 3VEZA 4ILGB 3IR5B 3FSIA 1RLDA 2AYGA 2KH9A 4Y1DA 3MM6B 4LR9A 3HMJG 1BA0A 1HKAA 1E4FT 3ZX2A 4ID5A 5JMVA 3EDQB 4NA2A 5M1PA 1VQ8S 3MCSA 2ZZNA 2CDRB 3LGMA 2OTLS 3WDOA 3QBCA 2MB0B 3LP2A 4M3YA 4O3OA 2A18A 2VG6A 2DH9A 5CD4H 4B3RJ 3RB4A 4FXWA 1U1OA 2RVJA 4UOFA 1NZ8A 1RP5A 4ZP9A 3ZTQA 1KVIA 4F9OA 3IAM9 1F6TA 2CKWA 3NEKA 4KIAA 4X64J 3K58A 2M9KA 4JKDA 4DV0K 4ETZA 3H20A 2CNOB 2XNRA 2ZDOA 1NPPA 1ICEB 4UUWA 1C4CA 4NCGA 4YUDA 2FF6A 3BH6B 1K1SA 3J7YP 2CADA 5KG5A 2RPIA 4KGXB 2M2BA 1DAXA 4JRQA 3RSEB 2LU1A 1N5QA 1Q8LA 3FZKA 4F3TA 3PSIA 3QYYA 3O4WA 5M1QA 5LJ5Y 2BRLA 4Z4CA 2OPRB 1QLNA 2EX3A 2CPEA 2FHOB 4USTA 2J0SD 3OBWA 3RBDA 2W9BA 4F04B 2P9NB 3P49B 3DRPB 3N4QA 2PSZA 1KP6A 1RI7A 1NK5A 3SCLE 3M8QB 1IR1A 1NB7A 2WSCC 4C0HA 1IH7A 1QAXA 4ZP8A 2OMOA 4LR8A 2DHXA 4CEAA 4YS2A 4KV8B 2R7XA 4D3HA 3KKFA 2PY5A 1BD6A 4NA1A 2K1RB 3S3NA 1M5KC 4FF3A 2B7CB 2WW8A 5IT9O 3MXIA 2XSFA 3M7VA 3NMAA 1D9FA 3DLKB 7AT1B 1U48A 1S49A 8RUCA 3R97A 3OR2A 4PG8A 2Q79A 1WSJA 3U1LA 5B08A 2IDOA 3CO9A 2LMIA 3OXGA 2DH8A 4XDCA 1G3OA 1QY7A 3LDPA 3H3NO 4JK8A 1TYQA 3NF6A 1SC4B 1NJYA 3QINA 1UVIA 2EWHA 3PKYA 3O80A 3VENA 3JTOA 1AFJA 1S1UA 4JV1A 1GOAA 5CCMA 3CXCR 1SS6A 3NMUA 3DOKA 1NM2A 3RMBA 3SPYA 3T41A 2DRBA 3UDCA 3DDKA 4DJBA 4LF9K 2W2QP 4N77A 4CJWA 2HHQA 4P7VA 3CB4A 2CQ2A 4CJUA 1P8GA 3QNWB 1NUEA 2Z2MA 2HMIA 3BR8A 1HX1A 2KXNB 3KXDA 1VQ5S 3GSDA 4F26A 1DTTB 2QV6A 1Q0NA 4B8CA 1C0TA 4O3QA 3AVMA 2A6AA 1RT2B 2LEAA 4M5LA 3I0RA 2W4PA 4J9VA 3SQ2A 2EEYA 1N5YA 3CCUN 2D7SA 2XY6A 2DNPA 4ILJA 4XPEA 1IBMJ 3ZTSA 4EFAC 3CCES 4FWQA 2MQ8A 2IVMA 4CM0A 3R8EA 3KHYA 2VFRA 2DCLA 3KD5E 3BSCA 3H5YA 2FD2A 4JS5A 3PW2A 4CEFA 1KVKA 3ENWA 1UEKA 2N4DA 3GJRB 3NGRA 4CIOA 3V1RA 5AE3A 1HMVA 5IQQA 2Y1LB 3D2EB 2UUBK 1Q7YO 3L95X 1FVSA 5I3QA 4ZLPA 4OI3A 4GW6A 2IPOB 3TP2A 3LPUA 2M70A 5L46A 1WC6A 2X74A 4MYUA 5F0XA 2KVQE 4FLYA 5D6GA 2M0GB 5HATA 4DWIA 1IKYB 5H9EK 3V4IA 4C48A 2KHCA 1HI1A 1OSCA 5GADP 1BDGA 1KNZA 3SEOA 2ZBRA 1NLVA 4M3UA 3CCJS 4HTIA 4IWVA 1WN7A 1RTIA 4KRWA 5F8LA 1FWLA 2U2FA 1VIXA 2C2OB 3KFWX 1IBLK 1KCFA 3T3FA 2BH1A 2G8FA 1FRLA 2JHEA 3WNGA 2L48A 2DNMA 1FK9B 3C16B 1TUGB 2HLUA 2O8FA 3HHNB 2VFVA 3QGPA 4DR3F 3K9KA 4LF9J 3I32A 5KT4A 4DQ8A 5CAAA 3OYBA 3PO4A 3FGVA 4ZPTR 1RAFB 3SI6A 4PAAA 2ATQA 3F9KA 4ZJQA 2ZM6J 3QB0A 1S97A 1TELA 4DU1A 3OBIA 1UVMA 2DNQA 2V7YA 3M6VA 2P5VA 1W25A 4CO0A 4ICLA 4DX7A 3D2FA 2WVFA 4WK3A 5AXKA 4RWWA 2BR0A 3K7RA 2DXFA 1U2VA 2UXDK 1LCUA 3TPQA 3M6GA 4BC2A 2Y8YA 5H1SV 3AARA 1GK8A 2CJKA 4OJHA 5KT3A 5KFLA 5F2RA 1HJOA 2OZMA 4I2QB 2EFNA 3PYGA 5FIIA 5KGWA 5BREA 3AA4A 1MROA 1GLEG 3G71N 4OPAA 4ER8A 1VBXA 1NNEA 1F5AA 1FHTA 3WQTA 5F9LA 2W6LA 1OY9A 1VBYA 4WCEL 4DV1J 3DXMB 1LWCA 4C8ZA 4IEIA 3GSIA 3L2RA 3VAGA 1QSYA 4KB1A 1HNXJ 3RB6A 2XYGB 1H2UX 1BOTO 3MM9A 1TKZA 1T8EA 1IBKJ 3VF4A 3FMBA 4DQIA 5BRHA 2G0JA 3E9PA 1I39A 4EGLA 2C2MB 4XTTA 3TSUA 4KI4A 5KQ8A 2NREA 3QERA 3JYTA 4FS1A 4KHMA 5AE2A 2WW4A 4B9UA 1MU2B 1MDUB 4DUYF 3CSKA 3O2IA 2IFXA 4E98A 2M7SA 2C2NA 4CEQA 3G6VA 2DT9A 4MKAA 3OS2A 3LTOA 3AO3A 2FHJA 4JI1J 4DR7J 2BTFA 2QLBB 4RNHA 3OUYB 4ELUA 3PO5A 5F1XA 3ATUA 2R2TA 3QFWA 3TABA 3WEEA 3DGPA 2FLLA 1DGKN 1P1LA 3ISNC 2P5OA 4M1KA 4DUZF 2BM1A 5KAKA 3QZ8A 3MHYA 3EYZA 4FK2A 1M1GA 4DCHA 4USIA 3QEXA 1CZAN 3V6HA 5D8HB 3H2UB 3R6MA 1WC1A 4AF1A 4MK8A 1LWEA 4BRNA 1Q9YA 4DG1A 4Q8FA 4X4OA 2CXEA 2XS7A 1ZPVA 4LF7F 3BSOA 2VQEF 4JBCA 3SUNA 1SJFA 4NYZA 2QA4G 2VKZG 3OHAA 4Q2MA 2FHMA 1U2VB 2N7CA 4K4SA 3HULA 1C4AA 4Q8EA 5KFUA 2CPJA 1YBAA 2M5YA 2PA3A 2MPUA 2FBVA 2ZBQA 3AJ1A 5T7BA 3L2UA 5IXUA 4ED6A 3QT5A 1J2VA 3WC2A 2ZE2B 1RABB 1WSIA 1H2TZ 2MHEA 3AQPA 1SH3A 3NGYA 2IS3A 2JLEA 2JLFA 3TJ8A 3OTDA 3HSGA 5IWAK 4CFDA 4R8UB 4QIWD 2OP5A 5JS2A 4PL7A 1AFIA 1IJJA 4EBEA 4CJSA 1FRMA 4XPCA 2GJIA 3SV4A 2IMWP 3J7YI 2E5IA 2AGPA 4JLHA 3HPOA 1FD8A 2E29A 3W9JA 3HYFA 1U6ZA 1J5EK 4JK9A 1VMBA 1L3KA 2RU3A 3S01A 3HZGA 4JN4A 3CQYA 4LF4F 1OPZA 1C6VA 2DHSA 1QHAA 3LDNA 4FPAA 3ZTOA 4QR0A 2KRBA 3BN4A 2P9SB 1FRHA 3LGHA 4NLWA 3EICA 2NPFA 3R5GA 3T1YF 4QCLA 2PC6A 1ITPA 4HT5A 4RL1A 3FFIA 4I6WA 2RD5C 5JICA 3D6MB 5D4OA 3CC4S 3KK3A 1S1WB 2PI5A 3PYFA 3G8TA 2J6UA 3ZETA 2DY9A 4Y2AA 4L8RB 3MEKA 4DL4A 3BPDA 2N82B 4B9QA 2V8HA 4DG1B 2BJ3A 3RTVA 2HPUA 4ZLNA 3SDEB 1T9XA 4UTGA 1U04A 2KZZA 4AL7A 3KMSA 2IM3A 4TU9A 4RUAA 3Q7BA 1HNZJ 1CJKB 3HCXA 4CI6A 1EKSA 2GIQA 2PMWA 1RGVA 2XLJA 4IFVA 1G2EA 5AQJA 1VJQA 1RGIA 4NZ0A 4AH9A 2P9LB 3A3NB 4M5GA 1NHUA 1SUQB 4ZVSB 4YB1P 4BDPA 2G8VA 4H4OA 3L7OA 1UZDA 3G82B 3MECB 2V4JB 5CHIA 1HWLA 2WB4A 1ZAWA 2UXBJ 3MCNA 2DNNA 1TK5A 4PKGA 3ZZOA 3QIPB 2BE2A 1ASUA 2K7KA 2QMWA 3M2UB 4FWPA 3MM8A 2E9RX 4FJ5A 4OIXA 1J5OB 2HHXA 1YIJS 5EGYA 4I2QA 1SBRA 2ZC3A 5DZ7A 4DX8H 3L8BA 3GG1A 5L9NA 5C2GA 3EGNA 5D3GA 1CJTB 3VCDA 4FPIA 2K06A 2F7TA 1E6YA 1FT8A 2Y9HA 4WTYA 1E4GT 2V50A 1JJ4A 4KHPK 2QA4S 3OTOJ 4B3TK 3TR5A 1MMDA 4OGCA 5KOXA 4O3RA 1AW0A 3VMFB 4ZP6A 1NMNA 3O3GA 2C3OA 5HSPA 5GAHU 2HVZA 3P3DA 1IKXB 1QVFR 2G8HA 5DS7A 1S6QB 4ZMMA 4Z2XA 5B0BA 2LVWA 3UR3C 3OYHA 1DKGD 4CJ4A 3E8OA 4LSNB 5E3RA 2ZJPQ 5KFVA 1KHVA 1W7AA 1OYDA 1S0OA 2QI2A 3LPEA 4CJFA 2BE9B 1U1NA 2ZM6K 4KHSA 3IMQJ 2A0FB 1IBMF 1GXLA 4CZEA 3KK3B 4NLOA 3VWSA 4WFZA 3V1OA 3V1QA 2DNYA 3TWZA 3NBPA 3ETOA 3AOBA 3HFZB 4QIFA 3MDQA 1QHTA 4E19A 3VAHA 1QQNA 2BM0A 1VQKS 1YUWA 5KG1A 2DIUA 3VGTA 1F5CA 3K9JA 3LDOA 4F25A 4DDFA 3V81A 4OHWA 3TAFA 2RHQB 1HQUA 5GAHI 3B54A 5DM6L 4MMOA 2AIRB 4K4ZA 4YDDB 2YHXA 4H4OB 4TNOA 3KKRA 4E7LA 2QX0A 2PEHA 2ZOGA 2M88A 2P9GA 3G87A 3H90A 2HNYA 4IQXA 3CC2S 2V4JA 2WCXA 3AA9A 2JVOA 4Y2IA 5L1KA 4J9KA 5AJ3F 1JLEA 2VBWA 5CYQA 3ENBA 5BN9A 2JEIA 1HWUA 1ZS6A 1Q16B 2RHSB 2XY5A 3SBMA 1HD1A 3SV3A 1QVGR 1VQLN 1LFPA 2MJNA 2QIFA 3J81O 2QYGA 1MWMA 3MTJA 5T14A 3ZSYA 2YKQA 1P1TA 3ENOA 1I94J 5L38A 1TFYA 2E9TA 2XY8A 2WVBA 4OZNA 1NGCA 3IWXA 1HNVB 3IAYA 4KGMA 3PYEA 4KTZA 4UY8O 4WTOB 5CYMB 1VSLA 3MM7B 1HPZA 2OANA 4DPYA 1KKHA 4BC9A 2O4IA 4CTAB 5LMUF 1XMOJ 3VQ4A 2O66A 1I5OB 2BJ8A 5GMKa 3BJYA 2XGQA 3NGKA 2HGNA 4HI2A 1R8AA 3I8BA 2DGSA 3GIMA 1KVBA 2QWPA 5FDLB 1C0MA 2HNZB 2FVPA 3D3BJ 3LUYA 1K73O 4CJRA 2IBOA 3D1OA 3H08A 4LQ9A 3PCOB 5G0RB 2K1RA 1NHVA 2OPSA 2DHAA 3TSQA 3TAMB 5LMNF 5E26A 2KL8A 3TEGA 2BGGA 4PR6A 3E2EA 2KFNA 1DLOA 4WCEQ 2J6SA 2N3OA 2E2NA 1CULA 1N33F 4NLBA 3HVTB 2R8KA 4OJGA 2FJAB 1XMOK 4PWDA 3HBTA 2H5JB 4IZ9A 2YWFA 1CEZA 5HRNA 4C8YA 2HBRB 2IVNA 4C1NK 2YNGA 4QBUA 5KFAA 4MFBA 4TQSA 4X4RA 1VQ4S 3CMEN 3C95A 4KPYA 4W5QA 1U1RA 2VKRA 2QL7B 1JCFA 1IBKF 2IRUA 4L3QA 3G10A 5HL7L 1IR2A 3CE8A 3VQ6A 2QFJA 3P39A 5HRSA 2H5EA 4ANEA 5FROA 3EPGA 4I2PA 3VTHA 3CMAN 1FO1A 5HANA 1GT8A 4K42A 1M5HA 2EI5A 1S10A 4IEEA 1PYTA 5F0WA 4OGEA 1QQCA 2WK4A 4WU2A 4GV9A 3CDEA 3PJXA 1T9UA 3VEWA 1EWRA 5DM7L 1UJ5A 2W1BA 3WNEA 4JB8B 2JC0A 3KJNB 4B1ZA 4B3OA 5J1PA 1HQEA 1NXIA 4FWKA 2M8DB 2CUYA 2EK6A 3NAEA 3WXIA 4DQPA 3BP8A 3DOLA 2IM2A 2B51A 4ZIWA 5F8NA 1XWLA 3FDSA 3BGFA 3VEYA 1RTJB 1GOBA 5EOYA 2VPYB 3W66A 4ZLJA 1GLBG 4IR9A 4GMJB 3NKYA 2V9KA 1UOCA 3QWPA 2V2QA 5GAGI 2NZTA 2ZOMA 4CCHA 4GKJF 3BZKA 2YKMB 2ZKTA 2DO0A 1UP1A 2B5JB 1HQ2A 2UUWA 1VQLS 4HDHA 2VWKA 4BRMA 1LW2A 2P5GA 1RNHA 3H8YA 4C3LA 1Z4UA 1TMMA 3HOSA 1CS4B 4EYHB 1H73A 1AUSL 1MU2A 4OJ1A 1RE1B 4DV7K 4V19J 3CJKB 1RILA 2ROPA 2UYTA 3R7BB 2CZ9A 2GUIA 3BQ1A 2UXDF 4MJKA 4HVZA 2V9WA 2DR5A 4M3ZA 1HIYA 1DURA 3GIKA 3OXLA 1N0VC 4NPOA 3DHWC 4RW9B 2E5GA 3I5AA 4NLPA 5CZXA 2YNIB 2MY8A 2QLWA 5IT4A 4F4ZA 2F8TA 4JD2A 2G2YA 3BBBA 3WIVA 5L1LA 2RRBA 4DHYA 3ILLA 2MKYA 5JMNA 5KT7A 2G0IA 1WG5A 4LF8J 2QLXA 3RB0A 3KKSA 2UXBK 1RHQB 1MWQA 4DTSA 1WWHA 5HBMA 2HLTA 5LM7E 3WXLA 2CZ4A 1TAUA 3FNNA 2F8MA 3RMDA 3EKSA 2DY4A 2XWXA 3L4BC 4FJKA 1MG7A 5D0RA 1SQKA 3M8SA 1VQON 2GGPA 3A8KA 4GKJJ 1BCOA 1VQ9N 5JVHQ 5F8IA 1VSEA 3KHRA 3BB5A 4B3OB 5EUHA 4B3MF 5M1NA 3C6HA 2QKBA 2MKJA 3KLEB 2K2PA 2X78A 4BQLA 4LRBA 3NF9A 2WBRA 4PXEA 2HNYB 3R5DA 4WPAA 4DQQA 2WC9A 4M3XA 4R25A 1DQAA 1M0SA 4PQUA 2JEFA 3OLAA 5F0UA 4WFNQ 4Z7CA 5HVFA 3L2WA 2ZBPA 1JLEB 3G2XA 5CCLA 3DRXA 2EC0A 4ITSA 4YHHF 5K14A 4CJPA 3AVAA 4K25A 3RBEA 2OFHX 3PX4A 4W90B 4DV6K 4Z37A 2W41A 5I3UA 1KAXA 4C11A 2R7OA 1HNVA 2ALYB 1B0PA 2IRYA 3QETA 4R5PB 2R42A 4CE9A 2ZD1B 4ETXA 3FBEA 1WHYA 2YWKA 3DXMA 4LF7K 2OO4A 3W2VA 2MLYA 3L3UA 4OLBA 3LWLA 2HHHJ 3ZX0A 1U4BA 1RAIB 3L7UA 1K8AT 1OIAA 3SLCA 1YX2A 3FZFA 4O23A 2MLXA 4DXLA 5FDLA 4V1Ak 1JQGA 1HYZA 2RSQA 4NMLA 4NLCA 2YJEA 4U67Q 2FDNA 3MTKA 4NYPA 2D0AA 4HTLA 4RBVA 5AXLA 1N33J 3LH2S 5GMDA 3QZ7A 4ISGA 3IN5A 1CG2A 1R6YA 3W61A 4X62J 5EVZA 5C24A 3D6FB 1NMEB 3J7AP 5A0YB 4F4WA 4CLTA 1N36J 2QXLA 1HJRA 3SUQA 1VQ7N 4FYDA 4ID5B 2BXJA 3KHLA 4DR4K 4Y0WA 4M5MA 2ZUGA 2JEJA 1KQKA 1S9EA 1PJ6A 5KG7A 4JI2K 3TU5A 3SI8A 4KKOB 4J9NA 1L3VA 4RW4B 5T7LB 1R0AB 1KQSM 4X62F 5KFQA 2UUCJ 5F8MA 1S9GA 3MMAA 2E2PA 3MM5B 4ED2A 3DLGB 1I94F 2EG1A 1CLQA 1N36K 4OHZA 2HNDA 4LMZA 3V9WA 1WF0A 1XC9A 3I0RB 3LALA 4IFYB 1HHTP 3FRYA 2FJEB 1FJ7A 3KYLA 4H0TB 2JJ4D 2KHOA 1HNWJ 3T6BA 4CZGA 3HJFA 2DXDA 2OPQB 3HI9A 1Q78A 4F7VA 1Y11A 1NJWA 4ID8A 2VZ9A 4CGJA 3EMTA 3UDVA 4KBOA 1V5IB 2J9CA 5HMZA 1GMVA 2ZD1A 3EM1A 4OO1J 1YSJA 2FJDB 2F96A 2F4VJ 3O1LA 3ASMA 1YTUA 1JXEA 4TY8B 3ADAC 5AQWA 2HHHK 3H4BA 1XR5A 5B8HA 4CHYA 1Q86O 1N88A 3ENAA 3GBTA 1NB2A 3FBFA 3VEOA 1VQMS 2OA8A 5J2PB 3UW1A 2IAJA 3O3LA 4V19S 3BH7B 4NLTA 1S6OA 2EVZA 1JLBB 2A3ZA 3M8YA 1TL1B 3OYMA 2I38A 3HHEA 4W5NA 2GC8A 3BZQA 4AHUA 5EN1A 3I56N 2IVPA 1TL7A 1HBNA 3CM5A 1V4TA 3HHDA 5A0YA 2FVRA 3D0HE 5EWGA 3BR9A 2HFUA 4NCBA 3HI0A 2GQQA 1QTMA 4JYAF 3CWJA 2FC8A 2F65A 1NGJA 4DBQA 2ACMA 4H4KC 3QEVA 5J2NA 4CD3A 2E6LA 5KFHA 2PFDA 1YTYA 2J76E 2ZH8A 4QWDA 4YR0A 5AQPA 1ZBTA 2J0XA 3J7YU 5KFCA 1FVQA 1HPMA 3BO4A 4GVLA 4XH4A 2YKNA 2I8EA 3J8AA 4NYNA 4FJMA 3D1QA 4DV4K 4C8MA 3D6HB 4DL5A 3GFZA 3QT7A 1Y5NB 2B9XA 1GLJO 4F36A 2KVIA 3R5CA 3GV5B 2GVZA 4YMEA 3TTDA 4OX9K 2BKPA 3ET6B 1AXQA 2CYYA 3SNNA 2VC1A 1SQGA 1QE1A 4HTUA 2XCPA 4CK1A 4OPHA 3VVUA 3KTQA 2LCWA 2R4FA 2EC2A 2W2OP 4OZLA 5BRFA 4UOCA 3A0IX 4E2FB 3GR1A 5J1NA 3TAQA 3CCJN 4M5JA 1FX2A 3BM7A 4RBTA 5CA5A 4ZPBA 3NG8A 3T9ZA 1R8HA 3FCWA 2LDIA 4RW6B 5KFBA 3R1HA 4PPDA 1JLAA 1VQKN 3EE3A 3RAMA 3BYPA 2DB1A 4K8RA 2QWLA 4JV2A 2QE5A 4ED7A 4UF4A 1FJEB 4CLLA 3VQAA 4UW2A 4RU2A 3DU5A 4CZHA 3W2VB 3O08A 1NU4A 4DR6F 2CQ0A 1WOPA 2AW0A 2GO8A 3PX0A 1S22A 5KFXA 1OH5A 3AB2B 3AO2A 3HD1A 1XNQF 2OEKA 4FZVA 4QPXA 4X4QA 4NYOA 3TAPA 3IBWA 1HA1A 1NK0A 2PFUA 1RBAA 1YRTA 4NEZA 3O3FA 4RR5A 2QA2A 1DTQB 2YWWA 4UY8T 3S8SA 4ECYA 3U6FA 2O8DA 4RO0A 2H3GX 1Q7YT 3GJQB 1XMQJ 3WXMB 2WOMA 2A41A 3KWIA 3KDOA 1YJNS 3TR8A 4ZPVR 1ZBFA 3LZIA 2HHWA 2AHOB 2B4VA 4K8XA 5IM0A 4QR2A 1LWFA 3DOMA 5KT2A 3AOAA 4QWEA 1TMJA 3LP1A 1VFJA 4ZVOB 5G4DA 4ZJOA 4JV5F 5T7LA 4P9SA 1Q81O 3PRDA 4P2MA 3DXKB 2AZ1A 3WX8A 3OFEA 2CRLA 1ZZFA 3B4MA 2O8BB 1D9AA 4DUYK 4M3RA 3D2FB 2RN2A 2AYMA 1B0TA 4X65F 2VYPA 3DLGA 4JKHA 3B78A 2AP1A 5K8PA 3DI6A 4PUOB 3RR7A 2Q0UA 2QXFA 3DRRB 1VR6A 2KHDA 5GAHP 1SC1B 2HYIB 1F9FA 3FEYB 3VHQA 4WFNL 4DCPB 1H3DA 1QD1A 3OYGA 4QYZJ 2ZITA 3CDWA 1D09B 4PYDA 2EKNA 2NR0A 1NGBA 3CD6S 2ZOFA 4ECZA 4BC4A 3JAMO 1QAYA 4WQ4A 3ZNJ1 5HRRA 3I4HX 2LXFA 4URSA 3EXCX 5M1KA 4FWRA 3C65A 1VOMA 2LA6A 4U8VA 5BR8J 3BN7A 2XULA 3GV8B 3U1MA 2G8UA 3C16A 4QIVA 4CLSA 1U1KA 3RMCA 1NWKA 1NJXA 4WWSA 2OSQA 1TKZB 2XZDB 5ADXA 2H65B 2DR7A 1F21A 3G96A 2I6WA 2VG5B 3JQJA 5JJBA 5B09A 2KKZA 2YKAA 4HHJA 3R9LA 4QYZK 1YKWA 3DRSA 4CZCA 4WK1A 4XO0A 2AU0A 2B8PA 5AZIA 1KFDA 3MURP 2JEGA 3DLEB 5EU7A 3KK7A 1W2BM 2P9CA 4FOEA 4AL5A 4H54A 4ZCKA 3B6PA 1CQMA 3ONQA 2AF6A 4EO8A 4GVBA 3MN6A 3M6WA 4FF4A 5K8MA 2J9DA 2X1BA 3NMRA 4DV5F 4CH0S 4B3RK 4ILHA 2CQCA 1REVB 1RWXB 1ASWA 4GKKF 2OPPB 3VQQA 3F73A 3O9QA 4OI2A 2BMBA 5ETTA 4CLUA 2DFEA 2DGWA 3B4DA 4YN3B 5HQLA 2HQIA 5BRDA 3Q8VA 3TQEA 5KFTA 3MPYA 2Y0BB 5M2PA 2Z1HA 4UUXA 3RJMB 4NI2A 1DQ9A 1YWXA 2MQMA 3I0SA 2R7UA 3OT9A 3ULDA 3VQSA 3DFEA 2CH5A 2P9IA 3M6UA 3RW6A 4DTXA 1KR4A 2V63A 4DPUA 4P7TA 4XK8C 1ASVA 2VFSA 4LR7A 4EHTA 4YOTA 2QO3A 1HWIA 5AFUA 2AEFA 1V5VA 3VA3A 4C3MA 4H5VA 3ZZTA 3DKDA 1FD2A 2UU9J 4KYZA 2MMYA 5AR0A 3ILJA 3POTA 5FPMA 3UCUP 2R2UA 1C1BA 2W9AA 1VRUA 4LF9F 2CWKA 2D1KA 2OEMA 5JXSA 4CO1A 1YF5L 1D8YA 2GBZA 1IWAA 4MO4A 1GLAG 2XS2A 2CVEA 1T02A 4XDDA 2HS3A 3THWB 4OHVA 4ECVA 3PVXA 3S9HA 1NK8A 2HBQB 1UEUA 4QZVB 2CPHA 3K89A 1ITGA 4PG5A 4UOGA 1JJ2M 4O4GA 5HQ8A 1NG9A 3R3TA 5KFGA 2QA1A 4BC7A 1IJEB 2CQBA 3CJ4A 5KPRA 5KFIA 3KZBA 3KNAA 5K9FA 5ETKA 3I31A 2CGKA 1HHSA 4HUGA 3PW5A 1WB9A 4IG0A 3AO1A 4IXCA 1NOYA 1WC0A 2VQFJ 5FRMA 2Z4PA 3F56A 3W62A 3ZETB 2PT0A 1JKHA 3NL0A 3OLBA 4TY9A 4FJ7A 4LFCF 2DGVA 2Z8QA 2PE8A 3TUZC 2XLIA 5DK5A 4X4SA 2W9BB 4QWCA 2HWHA 4FSVA 1VQPN 5LXYA 3MI7X 1X0PA 1ZA2B 3SQ1A 3PR4A 1SZ2A 1T05A 1RT1B 4FKYA 2V8DA 2IY5B 2RS2A 1BHLA 4BWMA 4QOTA 4DFJA 5KFKA 4E8UA 3GP9A 2LXUA 5CH7B 1HNWK 3QFPA 2YNHB 3ZT4A 4HVJA 5AQSA 2NYIA 3PIPL 3JSYA 2BOPA 2RUSA 5C10A 2O67A 3CJSA 5IFMA 2RRAA 3O9SA 1R0BG 2O8CA 1AZSB 1Q18A 3LP0B 4PQUB 3EVWA 4YDUA 4LFAK 5KQDA 4WYLA 1OH6A 1PGZA 1KDNA 4TVAB 1GMWD 1UZHA 1ZAXA 3AO4A 5IOLA 3IM8A 1CXUA 1HWJA 4CHQA 3K2PA 2IYIA 4QWBA 1RHKB 4I56A 2IC3A 1VSJA 1RWNB 3MXJA 5DGBA 1HARA 4BR0A 1SIZA 1O1WA 1AB8A 3D6RA 1UETA 1U2FA 3F44A 1PC4A 1H98A 1X5TA 4ZPAA 3KVGA 3NS7B 4Z94A 3FK4A 1S1WA 4JI8J 3CCVN 1OH7A 4ZLLA 4EBCA 1UKUA 4KFBA 5LSRA 3DLKA 3OYLA 2YX7A 4EO6A 1UTAA 1PG5B 5FPNA 4O5FA 1S59A 2G2OA 1I3AA 1YIJN 4O4GB 4USHA 1RAJA 2VQFF 1RDUA 4JKGA 3CIPA 1CJKA 5HK4A 4Y2KA 4CJQA 1BIUA 1HKBA 1FX4A 4NLRA 3N01A 4K8ZA 1LV5A 1FKPA 1RT6B 3R8YA 3DMJB 2CGLA 4C4WA 1GAOA 4EI2A 2WVEA 1RTHB 3C3LA 2Q66A 1M5OC 1CJVA 1FFGB 3CYMA 3PEJA 5AJ3J 2CJBA 3QATA 4ZHRA 4CZJA 2YCHA 4JI7K 4M63A 3MR6A 4KH5A 1R7IA 1RWPB 2FLNA 3FZMA 4DFKA 3ENVA 3S3OA 4CEOA 1TKXA 4GV3A 3G4SS 3V5RA 3HSJA 2CPIA 4H5RA 2B9WA 1NEEA 2DFHA 3V81B 2NCKL 2KT3A 5A8KA 3ETMA 3ITHB 1HLUA 4HACB 1NGHA 3BKFA 4ECUA 1CZ9A 1RCXB 3G8SA 1YJWS 1J53A 2P6TA 3SFGA 4BLGA 2PFFB 4IO8A 4ZVGA 1REGX 5A76A 3LL3A 1W2BR 4F02A 3HSTB 1RSCA 2OELA 3OD2A 3CD0A 2DCUB 5FLXU 2GAHC 3MEGB 2QWRA 2HURA 2Z56B 5JVHL 2FQQB 3MM5A 4H03B 3OBYA 1KD1O 4JI6K 4K2XA 3VQBA 2K3KA 1FRIA 5EWEA 1PAEX 4B3MJ 4PKHA 3D6TB 2BW2A 2RE1A 1U09A 3W65A 4JV0A 3AQOA 1TU0B 3BO2A 3PZPA 4EZ6A 4JRPA 1N48A 1PJ5A 2W4DA 2V7ZA 4GRSA 4KAIA 2V51B 3LANA 5LMUJ 4WXWA 2MQPA 2UUAF 2V94A 5M2UA 5AQNA 1XI1A 1FJGK 4LF7J 2B43A 4F0HA 3Q86A 5AQHA 3M2RB 4RCHA 2A5XA 4JI0J 5HMXA 4XEIA 3TANA 1KAZA 4TN2A 1WF2A 4O5BA 3NOGA 2HAIA 2E5LJ 2GTDA 4NLUA 2VBZA 2VA2A 2V6AA 3AD8C 4Y00A 4IKFA 4I6MB 2IYGA 1T3OA 1CVJA 4A8KA 4CHNA 1TVRB 5E3QA 5BN8A 1JB0C 1Y3KA 1EX8A 2FTRA 2VGMA 1F0XA 3BS9A 2BVZA 3DLJA 3M1VA 4K0KJ 1BGXT 5BPLA 2NYHA 1OS5A 1XR7A 4LF6F 4MLHA 5IWAF 5AQVA 1CULB 1QZ5A 4KY3A 1DFDA 1XERA 2VJUA 2A2DA 3GFYA 2XC9A 5DETA 3C7NA 1ZXOA 4RUBA 4CZLA 3MF5A 3TAEA 4OX8A 2Z30B 1K73T 2PYJA 4LBIA 1UWAA 2Q97A 5DDOC 2IRXA 4AQYK 5J2NB 2WVCA 5A6WA 1RAAB 4FW2A 2ZWOA 4FS2A 1SJ3P 3SJJA 1VSMA 1VSFA 4H5WA 3SYZA 5CYJA 3NDKA 2YKNB 2PD1A 4NRTA 5HN0A 1X9WA 1LWEB 2HRTA 1MMLA 4E0DA 3D68A 4MIWA 2J9DE 2QFIA 2YWGA 3V9UA 2OUGA 1FNMA 4ZN1A 3LWMA 1RAEB 4QU6A 4FZYA 1KRPA 1GFWB 2AD9A 2AJ4A 5A2QY 3TVZA 1K8KB 1W26A 1HNIB 4NA3A 1SKUB 2B4JA 3CCTA 2NRZA 3DRRA 5GMEA 3EVOA 4KC5A 5AQZA 2Y3YA 5JLHA 2GVZB 2R8IA 2DTUA 3NGSA 1FE0A 2CPDA 4LF8F 3H59A 1NK6A 3QT8A 4X4NA 1CQNA 2QSFA 3MEEA 2JFKA 3HXMA 2Y1JA 2EFQA 2PAVA 1T44A 3QNOA 1QQMA 2FB0A 3SAGA 4ZCIA 5KRTA 5D15A 2BYCA 2YPZA 2LQ8A 5L1IA 3VTIA 1RYRA 5ETRA 3GFHA 1F3VA 4LD0A 1WAFA 2HFVA 1Q81T 4DQSA 5E2QA 2MZTA 4IOAL 4CESA 2ZZMA 3VQPA 3L4QA 1U0HA 3C66A 3S3MA 1XN9A 1EAYC 2E9ZA 1BQMA 3GONA 2YHYA 1WC3A 2WAQD 1TUWA 2Y1RI 4I1TA 5KG2A 3PSFA 5AXMA 1LW0A 3CJKA 1I3OB 3T1AA 1X9MA 4X66K 4CNZA 1LXNA 4RLEA 1S1VA 3HHLC 4IOCQ 3BPSP 2YV0X 2UZAA 2VOOA 2EBGA 3MGJA 3QMLA 3ATVA 3M8WA 4Z4HA 3ZNUA 4CJLA 3DLRA 4FPBA 2MKHA 4USUA 1HR0F 1IQZA 1VSIA 4FM0A 5M1FA 3TA1A 2J7UA 2CAJA 4Q5VA 1VK3A 4KH0B 2VU5A 3VGKA 2FJVA 4FDFA 4HKQA 3PW0A 4PWWA 2D9PA 3EXYA 3MPWA 1B99A 4PWUA 2VD3A 3SDEA 3MN9A 4FVUA 4KHNA 2IHR1 1RISA 2VDIA 4DPTA 4KR0B 1JLQB 3AODA 4NX9A 3W1YC 1QAIA 1BCMA 5EXWA 2AA4A 3IS9A 2ZE2A 5HJXA 4O0JA 3A3OB 2EWSA 4BRLA 3M8PA 2QMXA 2Z1GA 1MMNA 4USKA 2MZSA 1C1CB 2HBYB 1SB6A 5GIOA 5E41A 2B4PA 3MAAA 3MXHP 3ID8A 4JKAA 1TK0A 1NJIT 3MMCA 2NQPA 2AEJA 3FSYA 4DEZA 4H0YB 5I3PA 4YOXA 2KLAA 3Q0AA 3N6MA 1VQ9S 4LUBA 3ZEUA 1EWQA 2JDJA 1ACMB 2HWTA 2UUBF 4U6PA 2AJ2A 4DR5F 1X4AA 3OW2M 3MMJA 5CR4A 2LEBA 3MUMP 3ZT3A 4ECTA 2J9EA 4EHUA 5LOQA 4DL0C 4FJIA 4DMZA 3OFHA 9RUBA 1P9QC 2CA9A 3MMBB 2ZH7A 1BQMB 3KLVA 2A42A 3SAFA 2QYCA 2ASLA 1ILYA 1XMBA 3M2RA 1HW8A 2ATCB 3M32A 3ENHA 1S77D 2R7QA 1C0GA 2BE7D 4Q44A 1SKSA 1N32K 3VQCA 5GAEP 3CCRN 4QOZB 5DGAA 3ZFVA 4DR1F 3V4IB 1TUUA 1S72N 1D5AA 4CH1A 3N6LA 3HSDA 1RWWB 4BR2A 1IKWB 2IJNA 3AA5X 4NLVA 1HYSB 3AVFA 2UUCF 3KLEA 1PSDA 2VC0A 2UUAJ 4OJRA 1TP7A 3PYDA 2VPWB 4E7KA 3U7JA 3CCEN 5L1JA 2BEFA 3SQGA 4JI3K 2OAUA 3AT1B 1RB0A 2ZH5A 4WQ4C 3AAPA 3H25A 4LY7A 4ZVEA 2IDLA 4G1IA 2LSNA 2VHGA 1XQSC 1S0VA 4DV0J 4LBHA 3RU0A 2O8FB 3OS0A 4GVBB 3GE9A 3O4QA 2VGNA 3HDSA 4N5SA 5KFYA 4AT1B 3FZLA 2DGQA 1PYSB 4OV1A 2HZVA 3LQVA 4ZVHA 4MDAA 4M5KA 2AJFE 2Z1IA 2VIHA 3E9OA 4A8MP 4LSZB 1UVLA 2VDHA 2IJRA 3W3SA 2UUBJ 2BE2B 4ELVA 2GIFA 3I55N 5KFFA 1DARA 3P83D 1F2HA 1J5OA 1F5BA 4BDZA 2O8EB 1HBMB 1YRXA 1D0EA 2F3JA 3HHLB 3SXLA 4F3MA 1MSWD 4JI4K 4K4UA 3MOJB 4ECQA 5LMUK 1VGYA 2IC3B 1B9FA 5BR8F 2FGOA 1XQIA 4O8KA 1QS4A 1N52B 4HH0A 1XR6A 3AV9A 5KG3A 4LSLB 2QN6B 2J8AA 1HPZB 5C2DA 1SXLA 4W98A 2MZQA 4NLSA 3KLIB 5LJVA 2H48B 4ALZA 3R27A 1RKIA 2ZHBA 2VQEK 2DITA 1UCNA 2HK2A 3K2YA 2DY1A 1XNRJ 4G6VB 2RIJA 4ANCA 4BBYA 3VPZA 2JL9A 3N4PA 4LSNA 4HEA9 4P73A 2ALZA 1WNEA 1JXBA 1LKZA 1XMOF 3ILIA 2P2CB 3C14B 4P2FA 2KM8B 1S79A 3GFXA 3C6UB 4LBPA 1N34K 3OTOF 2W25A 1G4CA 3R2CJ 4KREA 2ZQBA 1WBDA 3KNGA 3HOTA 3NXZA 2JSXA 1IBLJ 1EQMA 2VUGA 4JI7J 3WBZA 2Y0SD 4P2SA 2IVYA 5LT5A 3MDFA 3O44A 1AYEA 2BV3A 3CCQS 5JLFA 4E7IA 2E1YA 3SQOP 3QRPA 2W24A 4DUZJ 1UFLA 3RVCA 4BE2A 3PTWA 1RADB 2Z2YB 5I9EB 2RT3A 3LP1B 3CQXA 1B9DA 2V4RA 4M42A 3OSNA 2I0XA 1P9YA 1YVUA 1QJHA 5KRSA 1N5SA 1SJ1A 4CLKA 4DR5J 5C2FA 4ID1A 4OVLA 3HPHA 2FF3B 4DV7F 2MDAA 2JVRA 4OYXA 2VBYA 2NNWA 1AT1B 4CJKA 2HIQA 4BC5A 2ZFHA 3J81j 2DBBA 2ACYA 3NNCA 2M4MA 2XBPA 3J7AN 1BE4A 3W64A 2DD8S 1N4LA 2RF2B 1GLFO 3A5MC 1BU6O 3UE2A 4RBUA 1M5SA 1URNA 1GMUA 2NUHA 3KLGA 1HNXK 1TL7B 3VF6A 3W9HA 2P9PA 3W0LA 4YNQA 3CTRA 4FWLA 2GEMA 1YBUA 2N3LA 3FVYA 3F2KA 1QUVA 4U7CA 3OQ2A 4DMNA 4FF2A 4MFBB 2QL9B 5SUHA 3R1LA 1NPKA 5HO4A 2NZCA 1M5PC 1CC8A 4KH1B 3P1GA 3AD9C 2KT2A 2B9EA 2AMCB 3C6UA 2F9DA 1BHNA 4OLPA 4WFAQ 3D1HA 1U1PA 1YJ9N 3HVTA 5FJ4A 1K9MO 4A48A 1WDDA 2HQDA 2LEPA 1AA1B 3NNAA 5E0OA 5ETMA 3C7NB 3Q7CA 3S41A 4A2AA 2Z2ZA 4A47A 5KFDA 4IO9Q 1FNXH 4IOAQ 2FXUA 3A5NC 1FKPB 2YNIA 1ULRA 4F3QA 1RWUA 3CJCA 3TTFA 3CVKA 3DLLQ 2FIUA 1UPMB 3DDNA 2XMMA 4ANDA 3HRGA 4FBTA 4YOEA 2RS8A 5HRPA 4USJC 1YHQS 2ZJRL 2CQGA 3BGRA 4FJXA 1RBLA 7FDRA 2C2RA 4CZIA 2HHTA 3GE1A 3CC4N 2QKKA 2HSTA 3SUOA 2ZJRQ 5IT0A 3R6GB 1S6UA 3OYCA 2MSTA 3VQTA 2ZVSA 3MCMA 1M5VC 5E33A 3ZSZA 1EQ0A 3DLLL 3Q8SB 4BRAA 4R0JA 1NK9A 5C0YA 4CFCA 5BR9A 2O8BA 4GNIA 4DV2J 5B0FA 5AZJA 3QRQA 4G1PA 4IDHA 4FXDA 4O0NA 2XQCA 3FEXB 2QEXS 2C2KB 3OVSA 4KI6A 4KHPF 2HW3A 3OR2B 1WTFA 2W2NP 3D9BA 4CZKA 3CW2C 3ILOA 1KQSR 4JKEA 3PHTA 3SFUA 3LM9A 1VQ6N 3FQKA 1VDHA 4NLDA 1SC3B 1FI4A 3R6LB 3WZ0A 4G9ZA 4DI6A 1E6YB 2D3ZA 1UVJA 3A8JA 3N4WA 1HI8A 1R6VA 2F1FA 3O8WA 3EGZA 3AJDA 3Q8RB 3N9UC 4ZITA 3LOUA 3EGWB 1TGOA 4USMA 2LA4A 3LDSA 3EZWA 1IJFB 1YJ7A 1Z2ZA 5IM0B 4URGA 5KT5A 3M8RA 3H1QA 3CCMN 1Q8BA 4N47A 3KK1A 1TTHB 5DRKA 4CLZA 3CCZA 2G2ZA 3PUFA 4F8RA 1EP4B 4IG3A 1RWKB 2CQDA 2KFYA 4MO5A 2FVQA 3CGIA 5GINA 1VQNN 4Q45A 2XMJA 5HI7A 3I4PA 2V8VA 1W9HA 1EX4A 3SQ4A 4CO5A 5ETVA 4PQAA 1RDRA 4LF4K 4K50A 2R7RA 2E1AA 3T1HK 5L9XA 4CLYA 3DI6B 3UD5A 3GG4A 1APSA 1U1QA 2MQNA 4J9MA 4J8FA 1JLQA 5DM7Q 3BBFA 4X65J 5AQQA 4J9QA 1S9EB 4R79A 3JTNA 2P1JA 5C42B 4L72B 2DRAA 1WNSA 1S1TB 2HK3A 3PIOL 2FVCA 2E4LA 4FOIA 5LJWA 3MN7A 3GJSB 1TK8A 1RAOA 3DYAB 1X5PA 2XG8A 1C1CA 4RX6A 2QSWA 2BANA 2UV8A 3B8AX 3GPAA 3VVTA 5ETOA 3S7RA 2KXFA 3X3UA 1BQXA 1M1HA 4ZKAA 4HCCA 3JXUA 4DZDA 3EEQA 1JLGA 2DNZA 1X5OA 3T69A 4ISFA 3M8ZA 3M2UA 2CVIA 4CGFA 1FXXA 4CHZA 1VRTB 4OKEA 3O6QA 2FLPA 3V9SA 1YITS 2AWZA 4RKUC 1S6PB 3TZZA 3THYB 5AQRA 2AJ1A 3V6JA 5HJYA 1Z1ZA 3N6NA 4MTPA 3KG0A 2AYBA 3OL7A 4CW7B 4ZCMA 2HVHA 4R5PA 3HP6A 4ED4A 2X3DA 4DN0A 1J5EJ 1W97L 1Y97A 3D3CJ 4OYZA 3SIPB 4JI0K 1ZC6A 2HEKA 3BEGB 1GLLO 1S4FA 1ZM2A 1YJ9S 1R59O 1U25A 3OYAA 4GVMA 2X1GA 2JX2A 4NXNJ 1T9YA 1S1XB 4ECXA 1NH7A 4OI0A 3L3CA 3LDLA 3AVKA 4KE5A 4TLQA 3BDPA 3G6EN 3A13A 1NU0A 4BE0A 3V9ZA 4EUVA 2OTLN 2PMHA 3CC7S 2X7IA 1NJIO 2DXEA 1WSHA 1UJ6A 1S9GB 2QTWA 4B17A 4WU3A 4ZHRB 2H3EB 2E5HA 2P9UB 5DZ6A 4LFAF 1GLCG 1RYSA 4ZA1A 1X4FA 2XRIA 3CJ0A 3I5CA 2JZ5A 2FZGB 3GJTB 3F9MA 2PBDA 4RNFA 1T03A 3C6TA 2H51B 2GA7A 4NXNK 3NWRA 1K1QA 1Q5YA 4B9MA 3ULEA 5ETLA 4DV2F 3OYJA 1K0VA 4KKOA 4J9OA 5AQOA 5DDRC 2Z2LA 4FM2A 4WQ5A 2VPZB 1X3NA 3TQ1A 1MROB 4CGHA 4ICLB 1VHFA 3B6BA 4JV5J 1WLJA 1T0TV 3MPVA 3GIIA 3LDQA 3HTVA 3GLJA 1WI8A 1JXLA 5CYQB 2L9NA 1SVDA 4DR3J 3OA9A 3H5UA 5CHCB 2JGUA 3POTB 2NUUG 5IT9Y 1PKUA 1VLOA 2QW9A 1G99A 1F60B 4DR4F 3LW5C 3HM8A 1V9OA 3N5FA 3I9V9 2HSEB 3VR1A 4JK7A 2CQPA 3JYTB 1KS2A 1GTEA 3TAMA 4UOHA 4ZCLA 3LP0A 5THWA 2COLA 1LWCB 4O3NA 1YLXA 1ZBHA 3PR5B 4J90A 4LT6A 2W42A 2HHVA 3PJWA 3OUYA 1RK8A 5AT1B 2HNZA 1Y9OA 4K59A 4TU7A 3ZSOA 4LF5F 1X9JA 3RB3A 4JUZA 1NK7A 4K0KF 3ALYA 1LAWA 4KT0C 5C25A 3QNNA 3DLHA 4MQ3A 4IOBA 1DY3A 3AA8A 2YQ3A 3FBCA 2RRNA 2ILZA 1ZH5A 3T9NA 4OLOA 2BQ3A 3OYKA 2ASDA 4LF5J 5AQGA 4JI1K 3Q8PB 4DR7K 1JCEA 4X2BA 3MM6A 1WG4A 2FY1A 1SH2A 3O9TA 2U1AA 1Q86T 2RQCA 3UWTA 2CZVC 1HLWA 1QM9A 4E7JA 5MLCV 1OVQA 1NAQA 5TKYA 4TYAA 3G86A 1T9VA 4QIEA 3C6TB 3HFKA 3CJ7A 2OH2A 4IOCL 4KHYA 4B3SK 3HHLD 4JD2B 1HYSA 1RFQA 1ZYQA 3T6JA 3MD1A 2Q6BA 3CC7N 5DM6Q 2YHAA 4DV5J 3BGUA 2O8CB 2UV8G 2VFTA 4DV1K 1OMSA 4F0MA 1VC6A 3A5LC 2ZUAA 3FCHA 3JSMB 1QUPA 4DX6A 3OPKA 1NKEA 4NCGB 1TL5A 2HRUA 4K2JA 4GO7X 3KMQA 3IWNC 5HROB 3NY0A 1LOUA 1YITN 4FJGA 3C2PA 3SCJE 3MMVA 2MEWA 1XBWA 2WB1D 4IYQA 4RZRA 3M9OB 4C1NI 2GNKA 2W40A 5L39A 5SWMA 4JI5F 3J80Y 3CG7A 3O5BA 1YGYA 4YY3K 1FWPA 2DHGA 4M5HA 4PG7A 4PRFA 2EHGA 4FWSA 2F7VA 3UNGC 2Q1LA 4AHCA 3VALA 4DV0F 3VQ7A 2FHKA 2F4VK 3G0ZA 4JKGB 3HX9A 2WUSA 2YKMA 1YTAA 1YJVA 1YVNA 2BJDA 3KG1A 1WHXA 3MR5A 1JLAB 2SXLA 3AA3A 3QLHB 3CULA 3NRBA 1MN7A 3ICLA 1VSKA 1CJVB 4WFBQ 2YWEA 3P5BP 1NBEB 2MKSA 1NGDA 2F40A 1YJWN 3D4JA 4L3KA 2FZCB 1KD1T 2ZH1A 1XMQK 3NLCA 3LAKA 5T41A 5BXIA 3IO1A 2AJQA 1LW0B 1VISA 2HHPA 2EK1A 2F9TA 1RUSA 2GHVC 4ILLA 3TJ9A 4TYBA 1S1XA 1KTQA 5DG8A 3L2VA 3WXKA 2GJ2A 1LWFB 1NSPA 3DOMB 4OYBA 3FFIB 4DV3J 2R8HA 1OO0B 2K7JA 2GAGC 2IVFB 3J7A1 4C23A 3SBGA 1WUUA 2B0GA 1Y5LB 2IIRA 1WF1A 3HSZA 4LFBK 2A1RA 5H9FK 1CJUB 4BS2A 3US5A 4RW7B 2R7SA 2WOMB 1I1GA 2HMIB 1B7YB 4LF4J 1IVZA 3C19A 1LNQA 4S0MA 4ZK7M 3WQUA 3M2VA 3MCPA 3OYNA 1NSQA 2C2EA 1FKOA 1N0UA 2A3JA 3FEZA 4ELTA 2OHDA 4PG6A 3UKRA 2CPYA 1T03B 3R9PA 3D7SB 3VETA 4WFYA 2DYAA 3PXGa 1FTCA 5K14B 1JLCA 3T1YK 4Q0BB 1YZ7A 1PO6A 4KRFA 1XNQK 3J7ZT 3P38A 1NBWA 2FSKA 3JXOA 1GNKA 5A8RA 1WDTA 3A1YG 5ITHA 1MWZA 3V9XA 3THXB 2MZ1A 1RXOB 5E3AA 1VC5A 4WIIA 5A8WB 4WKYA 1O13A 3ISZA 3OYIA 4CJEA 1RKJA