2ZE2A

Crystal structure of l100i/k103n mutant hiv-1 reverse transcriptase (rt) in complex with tmc278 (rilpivirine), a non-nucleoside rt inhibitor
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of HIV-1 reverse transcriptase/TMC278 complexes: Strategic flexibility explains potency against resistance mutations.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase, hydrolase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 136
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ze2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ze2A05
4NLDA 3RR8A 5JUMA 1S0MA 2DFFA 3KLGA 4FJ7A 2E9ZA 1S6PA 4H4OA 5KFXA 3RB3A 2R8JA 1Z26A 1ZBLA 4DTNA 4WE1A 2KZZA 4NLSA 4FK4A 3KLEB 1NKEA 3ULDA 4IR1A 5DMRA 4O44B 1VSFA 1BCMA 2YKNB 2ITGA 2FJXA 1LWFA 4CGFA 3RMCA 5FRNA 4IDKA 4DU1A 3KMSA 4JS5A 4KV8A 2O4IA 4CJ5A 1EP4A 4Q44A 4CEFA 2PYJA 4IFYA 3KLVA 1TK0A 3BDPA 4DSLA 4EBDA 5KFVA 1XWLA 3EY1A 4ECWA 3TAEA 3BSCA 4ZPBA 1BQMB 3ZSVA 3E01B 1JLGB 3HJFA 2W9CA 1T3NA 1NOZA 3T3FA 2VG7A 2FVQA 2ASJA 1REVA 5F8HA 4NLGA 1RTIA 3M8QA 2OPQB 4LSNB 5DQGA 3CWJA 2XGQA 5F9NA 3K5MA 1LWCA 3CDEA 5KFMA 1QE1A 3HP6A 2IC3A 4MFBB 3ZT4A 4KKOB 4JV2A 1L3SA 5HROA 3MEGB 3KK2A 1JXLA 1VSJA 4FK0A 5HRRA 2B6AA 5J2NB 1C1BA 5DLFA 2J6UA 1RTIB 3LP0A 1RTHA 5DGAA 4UQGA 3V6HA 1WSEA 4OGCA 1N48A 1GOAA 3AVBA 2I5JA 1TV6B 3VQQA 3IS9A 1SL2A 3VQ7A 4M94A 3LAKA 3I0SB 1KVCA 1RDAA 5K14B 2FJWA 3RB6A 4J9SA 4FM1A 3ITHA 4PQUB 1RBVA 4HYKA 5KG0A 3BSAA 4M3UA 4FJIA 3TANA 1KHVA 1IO2A 3QLHA 4ZP7A 4CK1A 3NCIA 1U04A 3KLFB 4M3WA 1NK6A 2IAJA 4J9OA 2PY5A 3PW5A 2RDIA 1L3TA 2W9AA 4FM2A 3BQ2A 1XR5A 2FJVA 1JXBA 1TAUA 4C8OA 5CYQB 2GUIA 3U3GA 5J1EA 3HVWA 4K8ZA 1S10A 3KJVB 2HHTA 4JV0A 1BI4B 4WFXA 1JLQA 3SFUA 5HP1A 4ECSA 4M95A 4I7FA 1S0OA 3PHEA 5DG7A 3KLIA 2Y1IA 1UAXA 4OJRA 3V6JA 4CJQA 4DSJA 1EXQA 2XO7A 4QW9A 3OL9A 4KHWA 3UQSA 3OL7A 2VA3A 4ECYA 3F73A 1NHUA 4URQU 4OPJA 3GIJA 4C8MA 3M8QB 4LSNA 3TI0A 2NUBA 5J2MA 1RTHB 4J9LA 3OYIA 5CYMA 2ILZA 2GIRA 3LP1A 4DL6A 4CJTA 3S3NA 3I8DA 4IBNA 4AHSA 4GW6A 1NKBA 3HSTB 1TKTA 2R8KA 4ID1A 2F8TA 3KLHA 4E3SA 3DLGB 4Z4CA 1RT5A 3HHKA 2YNIA 2JGUA 3G86A 2V4RA 3I5AA 5HLFA 4U6PA 4RNMA 4FZYA 2GBZA 1B92A 3EZUA 5EU7A 3V1RA 1LW0A 1RILA 3CM6A 2EX3A 3A2FA 1RCHA 3NH2A 3CYMA 1S9FA 1NNDA 4ED0A 3KKSA 3I5BA 4CESA 5KT6A 1KVAA 4ECUA 1RT7B 1D9DA 2PZSA 3H40A 1MMLA 5C42A 5I3UA 2C2RA 4CF8A 1LAWA 1IKVB 4LQ3A 4Q8EA 2IM1A 3H2LA 1LAVA 3AVKA 3K5NA 1ZBHA 1C0MA 1HQEA 1C2PA 2Y1JA 1YVUA 4DEZA 1S1VB 1XHZA 4TQRA 1NJZA 4I9LA 4CF0A 4ZTJA 3HL8A 4YNQA 3MEDB 4EZ9A 1SV5B 1HNVB 4KB7A 1I3AA 1K6YA 3E01A 3DLBA 1J5OA 1JLGA 1JKHA 1IKVA 4I2QB 1S1UA 4FLUA 3M8SA 4NYFA 1L3UA 4ECRA 4EYHB 4ELUA 3NAHA 4RNOA 3H4BA 4HUGA 4Y3CA 3K57A 3QIPB 4I7FB 5HRSA 4F2RA 4KE5A 3NBPA 1IKXA 5HROB 1SH0A 3V9WA 4KAZA 2RKIA 2GV9A 1FKPB 3HVTB 3O4NA 4LD0A 3THVA 2J6SA 2WOMA 3HK2A 2RF2B 4I2QA 1RT5B 3S3MA 1XR6A 3OJUA 4DLGA 5CYMB 3PW2A 4CEZA 4FJMA 3OL6A 3BSOA 1GOBA 3V6KA 4MH8A 3OLBA 1LW0B 4F4WA 1SUQB 2HWHA 2E4LA 2FBVA 3D0PA 1N5YA 4MK8A 4J2BA 4ED7A 1FKPA 1S6PB 2W9BB 2OPRB 3KK1A 4WE1B 1S4FA 4JS4A 3MF5A 3RWUA 4NLPA 5JS2A 5KFNA 3KHLA 4NLVA 1TVRB 4CFBA 4DU4A 3PY8A 3GQCA 4LH5A 2KTQA 4FJXA 4XPCA 5KFSA 4KV8B 3O3HA 3NF6A 1YVFA 2CJQA 2VG5B 3N6NA 2YHBA 4W5OA 4J2DA 1U48A 3QEIA 3RMDA 4B9SA 4Z4IA 1T05A 4BDZA 4O3NA 3HT3A 1NJXA 3EPIA 5HRNA 1UOCA 2VG5A 2XC9A 3QIPA 4WZQA 3GYNA 3NF9A 3CJ3A 1SH3A 4IG0B 4ED3A 4RNNA 3ZSRA 3AA5X 3MEEA 1KLNA 4C8LA 1TL3A 3L2QA 1VSEA 4RW4B 3M8RA 4Z4FA 4JRQA 5C25A 1HQUB 3OYNA 3FSIA 4E1MA 2XI3A 3LZJA 4FJNA 4CJUA 3MFHA 5KFWA 3DDKA 4PWDA 4TYAA 3E51A 1RT4B 1I39A 2W8LA 1JIHA 3H5SA 3OYGA 3MAQA 3SUQA 4JV1A 1ZBIA 3AO2A 2UUWA 3G6XA 3ALYA 1JLEB 2HNYA 3N6MA 1TGOA 4QW8A 4LSLB 3TWHA 2D3ZA 4N41A 5K14A 4HCCA 4ICLA 2D41A 4FZXC 3KK1B 2HHWA 4IFVB 2ETJA 1U09A 3BR9A 1YTAA 3NH0A 2E6LA 4RW9B 4KB1A 3DRPB 4E7JA 2Z1IA 4M3TA 4OKKA 2HB5A 4CHOA 1JLFA 2HHQA 4CK2A 2QKBA 1FXXA 5KGWA 4ID5B 2V0NA 3GV7B 2VWJA 4ZP8A 4IFVA 1WSIA 2Z1HA 2UUTA 3HXMA 4KREA 3MECB 4FLXA 1RA7A 3ZSZA 4Z4HA 2VG6A 4O5BA 1W9HA 2XCPA 3T19A 3L8BA 5HBMB 1VRTB 3SNNA 1RT6A 3PW4A 2R8GA 1BI4A 1CXQA 1EKEA 1JLQB 3L2WA 1DTTA 5I42B 3QGHA 4OLBA 4M3ZA 1EP4B 3SQ4A 4RG8A 1JLCA 3V9SA 4FLWA 5KRSA 1SKSA 5KTQA 1QSYA 4DL3A 3MR6A 4PY5A 2QV6A 1DTQB 3V81B 1KLMB 1T94A 1JLAB 3KJVA 5DQHA 3G6VA 5FDLA 4U7CA 5KFIA 5I42A 1HQEB 3KD1E 4OGEA 4G3IA 3QGGA 4CHQA 2YNGA 3AVMA 2OZMA 1S1WA 3C6TA 5EDWA 3SJJA 2LSNA 2W8KA 1QAJA 4KI6A 5KT3A 4ICLB 4O55A 2VG7B 2YKMB 3TAGA 3V81A 4DMNA 4YR0A 4BDPA 3DYAB 3AVHA 3OS0A 4CJSA 5DK5A 4I9QA 1LW2A 1RT2A 5KFKA 2F8SA 1U47A 2A1RA 4ECQA 1VK0A 3B6PA 2X74A 1TL1A 4FJLA 2IM3A 1N5YB 4HTUA 3UPFA 2JEJA 3AVIA 4L8RB 4NYZA 3HP9A 3NAEA 5KFTA 5KFPA 2FVPA 3G6YA 1VSLA 3RR7A 4N5SA 2DY4A 3SQ0A 3LWLA 3MECA 4QWAA 1S1TA 1JLBA 3RB0A 2OPPA 4RZRA 3H08A 1ZYQA 4DSKA 4R5PB 1X9SA 4EO6A 4E7IA 3OYHA 1HPZB 2R2TA 3DM2B 5F8LA 3MTKA 4K4UA 3O3GA 1W0HA 2P5GA 4I2PA 5L1KA 3M9MB 3Q8SB 2HVHA 3QYYA 1HARA 2OPPB 5EWEA 5HLFB 1T7PA 2R2UA 4DTPA 3HO1A 3QESA 3QZ8A 2JLEA 4WYWA 2ATLA 4Q0BB 5KFFA 5HP1B 4KFBB 1IKYA 3RMBA 3IRXA 3PW0A 4CJ4A 4CHNA 4IKAA 3VQ4A 5KFZA 2JEFA 3FQLA 5DG9A 3QZ7A 3DLEB 4KRFA 5KFHA 1SL0A 5DLGA 4CEDA 4M42A 1RBSA 1RTDB 3QEWA 1SH2A 3KIOA 3V4IA 2QKKA 1Q8IA 5EWFA 4ECXA 1QAIA 2F8EX 3BSNA 4CIEA 3VQPA 3EPGA 5FDLB 3AV9A 3HM9A 2PYLA 2HWIA 4J9MA 4CGDA 3B6OA 2DFHA 1VRUA 4RW8A 4KHRA 4KTWA 1TQLA 4NYNA 5L9XA 2IS3A 1Y97A 1ZETA 1N56A 4FJGA 4CHPA 3MXJA 5KT5A 4NLWA 1SV5A 1IKXB 4K4YA 3MEGA 3QO9A 3MEEB 2HNYB 3OLAA 5EUHA 4K4WA 3I0RA 2OPRA 2EC0A 3CJ2A 4CEQA 3NKYA 1C1BB 3SFGA 2XI2A 3LP0B 4TY8B 3OSPA 3NAIA 4K4SA 4BE1A 1ASVA 4RW7A 3RBEA 1T8EA 3Q8RB 1EETB 4ZP6A 1KTQA 4ZPCA 4ZP9A 3DMJB 4DS5A 1T03A 2IGIA 3OSNA 3T5HA 3H59A 2WCXA 4DG1A 5KRTA 4B9VA 4BWJA 2IM0A 4MK7A 3HVRA 1A5WA 1Z4UA 3CFRA 3ZSXA 4O3PA 3SI8A 4MIBA 4FW1A 3IAYA 4FJJA 1ASUA 4ZVFA 3JYTB 3NGYA 3C94A 1Q9YA 3P83D 4DFKA 4ECZA 4ELVA 2IM2A 2WB4A 4G1QB 2UVWA 4CGJA 3ZCMA 1NOYA 4J2AA 5L1IA 2XCAA 3CJ0A 1NHVA 2W9BA 3KHHA 1G15A 1CZ9A 4C8NA 4KHUA 4DG1B 1BHLA 2DTUA 2G8UA 1ITGA 3RMAA 3C6UA 3PR4A 3DI6B 1RT1B 4Q43A 2D0CA 4DQPA 3V6DA 2FBTA 1S1XB 3AVAA 4O3SA 2YNFB 2ZKUA 5KG3A 4WFZA 1IKYB 4K50A 2FVSA 4ED1A 3ZSWA 2YNGB 1X9MA 1D0EA 1S48A 1VSMA 4CJFA 1WLJA 4DLEA 1ASWA 4DTOA 4K4ZA 3KLEA 3ZT2A 4KBIA 3ZT3A 1RYSA 2OYQA 3D45A 2XY7A 2G8FA 5J2MB 2X6SA 1J9AA 3DYAA 3NDKA 1VSIA 2D0AA 2D0BA 1S1WB 1RNHA 1ZBFA 3PV8A 5FRMA 2FC0A 3DMJA 1UA0A 3PO5A 3FFIA 4CJVA 4F50A 1J5OB 3TAFA 3KLHB 4XPEA 4B9TA 5C25B 4DF8A 1J54A 3BGRB 3H5XA 2QK9A 1RA6A 3IG1A 3MFIA 3CJ4A 4K4TA 3QETA 1TVRA 2G8WA 1OS5A 3FRZA 1SUQA 4O4GB 2C2DA 1QQCA 2FLLA 3IGVA 3SYZA 3KTQA 4PA1A 1DLOB 2B5JB 2ASLA 4QOZB 4WYLA 2KW4A 4CJ3A 3VQEA 4URSA 3CFOA 3VQAA 1RAJA 3L2UA 1LV5A 1QSLA 3P1GA 4Z0UA 4B8CA 4AHTA 4O3QA 3VQCA 4AHUA 3IS9B 4KHQA 4IQXA 2HNZB 4W5RA 1Q9XA 4TSXA 3KLFA 1S0NA 1S1VA 4DQSA 1TKZA 4JRPA 1RBUA 4E7HA 3DRSA 4NCBA 4R8UB 2WTFA 3V9XA 2HHSA 3ZSYA 4DTRA 3C6UB 4DL5A 2JEIA 1C1AA 1RT3A 4ZTFA 3UIQA 3VQ6A 4CK3A 2YKMA 3K5LA 1RYRA 1KLMA 1FKOA 1U45A 1NK4A 4Y34A 2OZSA 4PWDB 3NHGA 1BCOA 1K1SA 3LPTA 2EHGA 4J9QA 1JX4A 1JLCB 3FDSA 3ZT1A 3OS1A 3DLHA 3T5JA 2W42A 3TR8A 3HPGA 4ZVHA 1MU2A 4BDYA 4B9LA 4FS1A 1S1UB 5DGBA 3KOAA 3SV3A 1S9GA 1BISA 4NCGB 3SUPA 3GILA 4YR2A 4F8RA 3TAMB 4GC6A 4J9KA 1QUVA 3S3OA 4OL8A 2OA8A 4AHCA 1TAQA 4RW7B 4M45A 1RDRA 4YP3A 4WXWA 4FLZA 3C6TB 3NMAA 3V9ZA 3I0SA 4CEOA 4DTMA 1CXUA 1MU2B 4ID5A 2AGPA 4DL2A 4DL4A 4ZVEA 2P5OA 1IKWA 2I1RA 4ED6A 3WNEA 1S9GB 3H5UA 1FK9B 4PQUA 1JL1A 3DLKA 5J2PA 4YR3A 3V1OA 4DFMA 1IG9A 3KMQA 3AA3A 3NF7A 4NLQA 1XHXA 1RTJA 2RPIA 3QLHB 1EETA 5KFJA 3JYTA 3HPOA 5KFCA 2B43A 4FJHA 1JLEA 3KK2B 3T5LA 4DS4A 3SPZA 1WN7A 5JXSA 1WAFA 5KFLA 4Q8FA 4OKEA 1RBRA 4ELTA 4DSFA 4ZPAA 3TVKA 5C42B 5I3UB 2BRKA 3QNOA 3DI6A 2IMWP 4DF4A 2FLNA 1JL2A 1RT6B 3PZPA 1DTQA 2ASDA 4FLTA 4WXOA 3HKWA 5F8NA 1BGXT 4JUZA 2VA2A 3KK3A 4IRCA 2Z1JA 3IRXB 5EWGA 2RDJA 4FJ8A 4IH5A 4OLAA 3BJYA 5KG5A 4DTXA 2AGOA 2HW3A 1C6VA 2WONB 4IRDA 3C95A 3RRGA 2UVUA 4CERA 4TXSA 3TAQA 3MXMA 1LWEB 2C2EA 2W9CB 2QE5A 1VRTA 5KFYA 3QGIA 4LQ9A 4LY7A 2DPJA 3VQ9A 4DTSA 3JSMA 4QPXA 1WSFA 1VRUB 4EBCA 4N47A 5KG6A 3H98A 3CDUA 1HMVA 4ZVGA 5KI6A 4TY9A 3RAXA 3DRRB 4LSLA 1IH7A 4NLTA 3CIZA 2R2RA 3SUOA 1C0TB 4RW9A 1LWCB 1FK9A 3MXIA 3AO3A 4OKJA 3SQ2A 4W5TA 4R5PA 3TQ1A 2CKWA 3JSMB 1BQNB 1CLQA 3KHRA 3K5OA 1RT2B 2IOCA 5KT2A 2R2SA 1KCFA 4KHSA 1VSDA 2BGGA 2ZE2A 3DOKB 3EYZA 4IKFA 1KVBA 3PX4A 2XHBA 5KG7A 4W5QA 4WFYA 5KG1A 5J2QB 4O0IA 3SQ1A 4E19A 4RW6A 2KFNA 3ITHB 3OYCA 4RNHA 4TN2A 3DOLA 4CHZA 1HNIB 3P5JA 4FLVA 4KTZA 3AA4A 4RUAA 2ZE2B 3DOKA 1CSJA 4Z4EA 2FBYA 4I2PB 4DL7A 4KB0A 1C0UB 3RB4A 3SV4A 4CGHA 4R8UA 3AVCA 4CGIA 5KFEA 5J1EB 3S9HA 3QINA 3NE6A 4DQIA 4H8KA 4EP5A 5L1LA 1S1XA 1JLAA 3PX0A 3SZ2A 3Q8PB 3HPHA 2IDOA 1DTTB 1GX5A 3QEVA 1WSJA 4HKQA 5F8IA 2IBKA 4E1NA 1F21A 4IG3A 4ZHRB 4RU9A 2YHAA 2W7OA 2WK4A 4IG0A 1ZTWA 1JXEA 3TARA 4Q5VA 3HVTA 3GIKA 3KNAA 4IH7A 4BWMA 2G8KA 3CDWA 5F9LA 2WHOA 5KG4A 3L3UA 4NCGA 1ZTTA 5KG2A 4TLRA 4Y2CA 2IA6A 4JLHA 4MKAA 3NGZA 1NKCA 4NCAA 3RRHA 4F4KA 3OYKA 1T03B 2JC0A 4N76A 3M8PA 2BE2A 4E89A 3L2RA 1D1UA 3PX6A 5KFQA 4DFJA 4RW6B 2YNHA 3GIIA 3AVLA 4KAIA 5KFGA 1LW2B 2FLPA 1S6QB 3AVNA 4J9NA 3BQ0A 1VSHA 4MQ3A 2V9WA 5CZ2A 4B9MA 4M3YA 4CE9A 1NK7A 3OJSA 1S5JA 5KT4A 4G1QA 3D5MA 4O3OA 2BE2B 2AU0A 4M3XA 4F2SA 1A5VA 2ZQBA 4O44A 1B9DA 1S1TB 3AVGA 3SI6A 1S9EB 3CG7A 3L3VA 5KFBA 4F4ZA 1TK5A 3Q8QB 2AWZA 4B3OA 4QWCA 4CCHA 4XO0A 3ISNC 3LANA 1O1WA 4CJLA 1KSPA 4YMEA 4ECVA 2HMIA 3O3FA 3MR3A 2JEGA 4RNFA 5KFRA 3K2PA 3DLEA 1DLOA 2B5JA 3LZIA 4W5NA 4H4MA 4Y2AA 4AILC 3OHBA 4K4XA 4E0DA 2KZMA 3LDSA 2VG6B 4RW4A 3VA3A 4NLXA 1Z25A 5SWMA 4GVMA 2D7SA 4TYBA 2R8IA 3AO5A 3OS2A 1I6JA 4MKBA 1KFSA 4PUOA 2YKNA 2WOMB 3PO4A 3V6DB 4BE2A 2G8IA 2YNHB 5J2PB 1X9WA 3CJ5A 4ED2A 1UWBA 3LP1B 3H4DA 4DQQA 2I5JB 3TABA 1KFDA 3T1AA 3N6LA 4J2EA 3MR5A 1XI1A 2AX1A 4KTQA 5KFAA 4K4VA 3NH1A 3OYDA 3DLGA 1IKWB 1REVB 4J9RA 2BQUA 5J2QA 3VA0A 1TKDA 1S9EA 3G10A 4BE0A 1BQNA 1S6QA 4EYIB 3KKRA 3LP3A 4MFBA 2F96A 2XY6A 2G8VA 3BREA 2G8HA 4FBUA 2OPSA 2A1SA 4CIFA 3AO1A 2HNZA 2V4QA 1D5AA 4NRUA 4CJEA 3FQKA 2HMIB 4DTUA 2UVRA 3NL0A 1N4LA 3RBDA 3OYLA 4H4OB 1C0UA 4CFCA 1X1PA 3K59A 4AHVA 4GC7A 2KQ2A 4DWIA 2GIQA 3O4QA 4KO0A 2W7PA 3VQDA 3L2VA 4M41A 3I5CA 3OYFA 1C1CA 2P1JA 5CY4A 4O4GA 4CEAA 4CF1A 1WNSA 1QSSA 3KLGB 2UVVA 4ZMMA 4IG3B 4ZHRA 3IGNA 2C28A 1HMVB 4Y1DA 4AHRA 5C5JA 1RBTA 3VQBA 3MEDA 1NK0A 4N56A 2OH2A 2R8HA 4AH9A 4QWDA 5CYQA 3BQ1A 4IOBA 5KFUA 4ED8A 4HUEA 3CVKA 2AX0A 3LAMA 5HBMA 4MK9A 3CQ8A 4FJ5A 3OL8A 4F4YA 4NLYA 1D9FA 3V1QA 2HNDB 1QS4A 3KK3B 2BQ3A 3QIOA 2P51A 1QE1B 1WNEA 3OVNA 3QERA 2D3UA 3NF8A 3TAPA 1S49A 1WAJA 3DRRA 1RTDA 2DPIA 3ZT0A 4KPYA 1RT3B 4E7KA 4DQRA 3QEXA 1XC9A 1HQUA 5DG8A 2AQ4A 3UDLA 4TQSA 4TY8A 5F8GA 1HYVA 4FYDA 3VQ8A 2YV0X 3ZSOA 1UA1A 1RT4A 4B8AB 4YQWA 3OYBA 4F4XA 3DOLB 4H54A 1TV6A 3LALA 2IJFA 4B9NA 3NBPB 4X2BA 5F8JA 4YFUA 4KHNA 1TKTB 5C24B 4FW2A 1KHWA 1BIUA 5J2NA 3CM5A 2X6NA 4HHTA 2RF2A 1J53A 2YNIB 2ZD1B 3IG1B 2R7YA 3GV5B 3OYJA 3CFPA 4CHYA 4KI4A 4ECTA 1D8YA 2XRIA 1W25A 1VSKA 1XR7A 4NLRA 2HHXA 3PUFA 4CJKA 1HJRA 1CZBA 4O3RA 1HRHA 2B6AB 4NLOA 4Z4GA 4DSEA 4EEYA 3SPYA 2KFZA 1U4BA 4EZ6A 1JKHB 2D5RA 2AGQA 4KSEB 1WSGA 5FROA 4FCYA 3UR0A 4IRKA 4DU3A 1FKOB 4HVJA 4CFDA 1RDDA 4CEBA 1BIZA 3U3YA 3NGIA 3DRSB 1K1QA 4NRTA 4WZMA 1WSHA 3WNFA 2Q3SA 4DFPA 3GV8B 3M8PB 1EX4A 4C8KA 3U6FA 3I0RB 4CECA 2Z1GA 3NFAA 2HHUA 3OYEA 2OPQA 2HNDA 4Q0BA 4IDKB 4EBEA 1R0AA 4CF9A 3TAMA 2HVIA 4URGA 5KFOA 4KKOA 1YTUA 3OYMA 3M9NB 5L1JA 5KGXA 2ALZA 3NGDA 4GMJB 4XIUA 1TL1B 3QNNA 2WONA 2RKIB 2ATQA 5C24A 3AVFA 1NK8A 3RTVA 4KHYA 1SL1A 3KHGA 3AO4A 3ASMA 3LPUA 3PJXA 4NLUA 4CJRA 1TK8A 3ZSQA 3GIMA 4CF2A 3EZ5A 4FM0A 1R0AB 2E9RX 3HYFA 4HCBA 4FS2A 3RAQA 2OPSB 3KLIB 2B4JA 1KRPA 2JC1A 1HYZA 4LH4A 4QCLA 3QO9B 1ZBUA 5T14A 1L5UA 5D3GB 1U49A 4BACA 2HHVA 1SKWA 2XY5A 2ZD1A 4H4MB 3BGRA 3F9KA 2VWKA 3DRPA 3DLKB 2BRLA 4CEEA 4CIGA 4DTJA 2AJQA 3IN5A 3LP2A 1HYSB 4KO0B 5JS1A 2BANB 3QIDA 5CZ1A 4ZPDA 3OYAA 1HNIA 3LWMA 1JLFB 2FVRA 4KFBA 2GC8A 3MR2A 1B9FA 4FJKA 4O0JA 2RN2A 1TKZB 2DFEA 1N6QB 4OPKA 2O4GA 1BL3A 3G0ZA 4FLYA 3V9UA 4FJ9A 3V4IB 5SZTA 1NK5A 3ICLA 2BANA 1T05B 4E7LA 1LWFB 1L3VA 1C1CB 3CO9A 3D28A 3ISND 3DLRA 3PW7A 2E6MA 5E41A 1S97A 4M3RA 3H5YA 2IAJB 3T5KA 4RW8B 4NZ0A 5DQIA 4OVLA 1N6QA 4CJWA 4O4RA 2IJNA 3OHAA 4F3TA 4DSIA 1RT7A 4FVMA 4B9UA 3FFIB 1LWEA 1TL3B 4F3OA 2FVCA 2XWYA 2BR0A 3WNGA 1NK9A 2YNFA 1C0TA 4B08A 1QTMA 3VQSA 4EP4A 2XY8A 4Y1CA 4IR9A 3KD5E 3PVXA 1A5XA 1YT3A 1UWBB 4IFYB 3SUNA 5HRPA 3HVAA 1TP7A 3QEPA 4QWBA 1RDCA 3PJWA 4QWEA 4FBTA 4FXDA 1HNVA 1BQMA 1TKXA 4CJPA 3SCXA 1NJYA 4K8XA 2ILYA 2E9TA 4EO8A 2FBXA 4PUOB 4FZZA 2BQRA 3VN5A 4R0EA 2X78A 5KFDA 5F8MA 1JLBB 3M9OB 4B3OB 2IC3B 1HPZA 4RUCA 4FK2A 1RTJB 2XGPA 3DM2A 3WNHA 1NJWA 2C22A 1GOCA 2O5DA 2BDPA 1TKXB 4CFAA 1RDBA 4IH6A 5D3GA 3AA2A 4KHMA 3PR5B 3K58A 1IM4A 3OY9A 4Q45A 2HAIA 5T7BA 4HUFA 3AVJA 4J9PA 4MIAA 2J6TA 2WRMA 3LP2B 1HYSA 1RT1A 1GX6A 1QHTA 2QXFA 4CGGA 1SKRA 3VQ5A 4QAGA 5KT7A
chains in the Genus database with same CATH superfamily
2CQGA 4NLDA 1X5TA 4DR7K 2DFFA 1S0MA 2DHGA 3SCJE 2Z2YB 4RR5A 2CJKA 2F9DA 5KFXA 2W2QP 3HBTA 1OWXA 1PSDA 3QRQA 3LGMA 1HKGA 1VSFA 5T7LB 1N52B 1BCMA 2DGXA 4IDKA 1DQ8A 3VQTA 2VPXB 3KMSA 2O4IA 4CEFA 4OI6A 4IFYA 3BDPA 2IVPA 4CZMA 1RTZA 4EBDA 3EY1A 2YX6A 4ECWA 3P39A 2AYMA 3BSCA 2Q0RA 2R7XA 4N77A 3PJ9A 3HULA 3E01B 4I64A 1NOZA 3T3FA 4JI6F 2FVQA 1UZHA 2MZQA 4DOZA 5F8HA 4NLGA 3M8QA 5DQGA 4OMFG 4DR2J 1LWCA 1V5VA 4A46A 1Z1ZA 2IVFB 3CTRA 3HP6A 3BH6B 3ZT4A 4KKOB 2H51B 4C2MA 3H0PA 2ZZNA 5ETKA 1DAXA 3NGSA 5EX5A 4WPAA 4YOEA 3LDQA 4DX8H 2DXDA 1RTIB 3LP0A 4OYMA 5HMYA 2CQPA 4UQGA 4WU2A 2UUCJ 2BE9B 4BHQA 4K5RA 4XEIA 1YZ6A 2I5JA 4TLQA 1TV6B 2LYVA 3TVYA 3MD3A 1FERA 1SQFA 3H3OB 3VQ7A 3LAKA 4ZK7M 3K7RA 4HHHA 3TX0A 5B0AA 4P74A 1RDAA 1FXLA 3T1YF 4M7XA 4RX6A 2P9NB 3FZFA 2O8DA 1RGIA 1B7FA 5E3AA 4PQUB 2ZOGA 1HW8A 1RBVA 3GZ7A 2L9DA 3N0VA 4HYKA 5KG0A 5CXTA 4M3UA 3BR8A 4FJIA 3TANA 3MMAA 3ZZPA 4EGLA 2UYTA 3DXBA 1IO2A 4ES2A 1U04A 2J8AA 3ZZUA 5K8MA 3EGVA 5TKWA 2D0OA 1S79A 2W9AA 4D3HA 1XR5A 1JXBA 1TAUA 1R7IA 3AQPA 4H5VA 1XQIA 5EHHA 4B3SF 3TTFA 3AOAA 4IQMA 3H2VE 3CD5A 5D0GA 1JLQA 1ZM9A 4ECSA 4M95A 3K8WA 4BREA 4RCHA 4WK3A 7FD1A 4LFAF 2MZSA 3KLIA 2C2OB 1FX2A 2LP4A 4QYRA 4LF4F 1EXQA 2XO7A 1FEEA 1Q18A 4KHWA 4F7VA 3UQSA 1ULRA 5EX3A 5AQJA 4OPJA 5ETQA 4C8MA 4YDUA 3OYIA 3G82A 2QM1A 3LP1A 3QBCA 4DL6A 2Y3YA 4FOIA 3IM9A 2QL5B 4LF9J 2ASPA 1NKBA 3PRBA 3HSTB 4BGAA 3IR6B 3CCSS 4BRPA 2F5GA 5LMUK 2F63A 2EBEA 5ETLA 1RLCL 1CJKA 2V4RA 4U6PA 1RLDA 1JMTA 4YY3J 5DS7A 2ROPA 2JSXA 5EU7A 1LW0A 1BA1A 2FQQB 2OTLN 2FJEB 4USKA 3A2FA 1VAZA 4CESA 4LR7A 2RT3A 3FSYA 5HN0A 2N7YA 4JI2K 3M32A 1LAWA 5BN8A 4ER8A 4OYOA 2VKRA 2HSEB 2YH0A 4DX7A 2FC9A 1LAVA 2C2KB 4FO0A 2BABA 1E6VA 1C2PA 1R43A 1S1VB 4W92B 2WBRA 1NJZA 4I9LA 2QMWA 3N28A 1HKBA 1FTCA 2VIHA 2PEHA 3MEDB 1H1VA 1WEZA 4OJ3A 2WSFC 4YS2A 1RI7A 3A1YG 1IJEB 1JLGA 3T9ZA 4I2QB 4JI3J 4ZJOA 1L3UA 4ELUA 4RNOA 2LXFA 3H4BA 4HUGA 3JTPA 3QIPB 2GO8A 4MAKA 1WBBA 4JV5F 1IKXA 5HROB 8ATCB 1JNRB 3Q23A 2GV9A 2FF3B 1UFWA 4LC9B 3W3SA 5JICA 2WOMA 1H6KX 2C3UA 4I2QA 4JI4K 2DH7A 1FRKA 3VEOA 1YJRA 1XR6A 3OJUA 3PW2A 3FNNA 4FJMA 2E7WA 3OL6A 3BSOA 1SVDA 1EJ7L 3V6KA 1AROP 1LW0B 2FBVA 2ZH9A 1N5YA 3QBWA 4J2BA 4ED7A 5CCLA 1S6PB 2PT0A 2V2KA 2W9BB 3K9KA 1S4FA 2E7VA 4P75A 1F5BA 3VVTA 3KHLA 4NLVA 1K9MT 4DU4A 1NBEB 4J9VA 3PY8A 4NZ6A 1FEHA 4DV4K 1WHXA 2V8PA 3RBXA 4K0KF 4KV8B 3VEXA 3O3HA 3OUYA 4LREA 2XWXA 1NEEA 1BE4A 3WBZA 4P7TA 3DHWC 3NWRA 3PEJA 2MQMA 3RAMA 3QEIA 3BZCA 1S57A 3TNVA 4YOTA 3O44A 2KI2A 3N4QA 1UEVA 2B8QA 4TU7A 5M1QA 3ZZZA 1VLOA 1B99A 3MCAB 3JQJA 3OXLA 4DU7A 4ISEA 2D69A 2XC9A 5HVGA 2KRBA 1FJ7A 4IG0B 4RNNA 4K0KJ 3ZSRA 2J5AA 1KLNA 4DI6A 4RW4B 2DO4A 5K8NA 5DETA 3OYNA 3BV8A 2E5LJ 1FWLA 4TU8A 2CRLA 4E1MA 5GIOA 2XI3A 1SJRA 4R79A 4FNHA 4FJNA 4CJUA 3EM1A 5F1XA 1DJ0A 3MUVP 2ZOMA 3DDKA 1HI1A 2GQQA 2W8LA 1A9NB 5ETNA 4AQYJ 3OYGA 2O67A 1K8AT 3RW7A 2KHDA 3F2KA 1HNZF 1HL6A 1M5HA 1FNMA 1JLEB 4L75A 3N6MA 4LSLB 4PG5A 2D3ZA 3S01A 5AQWA 4FZXC 3A8EA 4IFVB 3D1QA 3HHLC 1VYAA 2E20A 4E7JA 2Z1IA 1G1XA 3I87A 5A2QU 2HB5A 1JLFA 1J5EF 2H54B 3MUTP 3CPWR 4ID5B 1H0HB 2V0NA 3NVKA 2NUHA 4IFVA 2Z1HA 1WSIA 2YKQA 4OX9K 2FLOA 4FLXA 1EO1A 1RHQB 4Z4HA 1F9FA 1EWQA 3L8BA 3ZC4A 3CPWM 4DV6K 4DV2F 4LUBA 2R8GA 4CO0A 1EKEA 4DV0K 4PG7A 3L2WA 4YHHK 5I42B 3QGHA 4ANEA 2PA8D 4P10A 2UUAF 5H1SQ 3CULA 2ZEJA 3ZO7A 3D9BA 3KJNB 4WKRA 2HS3A 4ID8A 5KTQA 3IFRA 4C3LA 2N4DA 3QJPA 4H0XB 2VONA 3V81B 2G13A 3RRKA 2H9ZA 2V8HA 4YDDB 3FLCO 5FPMA 4LF1A 4U7CA 4BR9A 3KD1E 4OGEA 4G3IA 1SBRA 1X5SA 4CHQA 2BKOA 2WW4A 3D2EB 2OZMA 3TOQA 3FZBA 4LRFA 1WTFA 4LBHA 1WG1A 2HS4A 5T7LA 3Q7CA 4ICLB 2CWXA 1VQYA 2RILA 4DMNA 3GG4A 2CJAA 1VHXA 3DYAB 3ZZTA 3OS0A 4CJSA 2G2OA 2OAUA 3UR3C 4OYXA 2AZ1A 2IM3A 2OFGX 1T3OA 2B56A 3AVIA 5LMUF 4HT7A 5KFPA 1VSLA 3RR7A 1O13A 2NRWA 2RB7A 1LK5A 1YLXA 3GJQB 1PYTA 4QWAA 1S1TA 3G8QA 3RB0A 2OPPA 4EWTA 4DSKA 3H08A 4CZKA 1VS3A 3F9MA 3DM2B 5F8LA 1RWXB 4K4UA 4JI7F 3D4JA 2DJWA 1W0HA 2CH5A 5L1KA 5GAGI 4DR6K 2HF4A 2OPPB 3QFUA 4X65F 3W66A 2R2UA 2JLEA 4K2JA 5C7PA 2ZM6K 4CJ4A 4IKAA 5A76A 2LQJA 5KFZA 3FQLA 1OVQA 1FWKA 2QWLA 2RRNA 1RU2A 2XULA 3W63A 3MAHA 4CEDA 4RO0A 4NA1A 1SH2A 4IOCL 4BRAA 2RD5C 3CERA 4RKUC 1QAIA 2F8EX 3MM5B 4GO5X 3M8YA 3AV9A 3HM9A 1RHMB 3QMLA 3B6OA 4USUA 3RBZA 4NYNA 1Y97A 1V3ZA 4OZ3A 3ETMA 4CHPA 5AQKA 1KTVA 5M2UA 1SV5A 2I8EA 3KKFA 3MEGA 2HNYB 5GVQA 3DXKA 3I0RA 4V1Ak 1NGAA 3T9NA 3OSPA 1WF2A 1ASVA 3Q8RB 2KXHA 3I56N 4DV7K 2GCFA 2RDDA 4DS5A 4GNIA 4C97A 2JVOA 1XQSC 1WKJA 3CJBA 4FYWB 2IGIA 4BRMA 4DG1A 5KRTA 4DMZA 5C2GA 2IM0A 4FN5A 3HVRA 3IKMA 4NYOA 4NA3A 1DQAA 4MIBA 3SI8A 1ROFA 3JYTB 1Q9YA 4IO1A 2DHSA 2ZF5O 4ELVA 2WB4A 5BR8J 2UVWA 4CGJA 3ZCMA 3DXMB 4ISFA 4J2AA 1NHVA 1V3SA 2W9BA 2QEXN 1Y10A 4C8NA 4DG1B 2DTUA 1ITGA 3NS6A 3VWSA 3C15B 3MD1A 4Q43A 3I9ZA 4M63C 3D2WA 4DQPA 5HL7L 2FBTA 4WFNL 2ZKUA 1NGGA 5D6GA 4WFZA 1IKYB 4K50A 3R7BB 4CO5A 4LF5J 3MPWA 3OUYB 2YNGB 1S48A 4KPCA 5EVZA 4CJFA 4DLEA 1GT8A 4DTOA 3G25A 3ZT2A 3BBFA 2IMOA 1WSRA 2Z0GA 4MKYA 2F40A 2G8FA 2MQNA 4LBPA 4IO9L 1ATNA 1J9AA 3PIOQ 3W8GA 4TU9A 5FLXO 3NDKA 1LWXA 3HF5A 4X4TA 3FZHA 1VSIA 1KBRA 2D0AA 1MDUB 1S1WB 4HR2A 1RNHA 4BY9C 4M5HA 2FC0A 3V4MA 1IWAA 4F50A 2M70A 4BLGA 3KLHB 1FVQA 4G1IA 1N0VC 2JLGA 2I9SA 1HLWA 4CZIA 4YOWA 3MFIA 2CQBA 2J9CA 3CJ4A 4JI5K 4NXMF 1J5EK 2RHKA 1SUQA 1V9OA 2W6LA 5CQGA 1RHJB 3ULHA 3GE9A 3C16A 3CCRN 3U1LA 3GYGA 3R2CJ 2OHDA 2P9UA 4CJ3A 3VQEA 5LY3A 3CFOA 1DGKN 4PWUA 5FLXY 4WCEQ 1LV5A 1MROA 4AHUA 3MI7X 2BYCA 4OFZA 3WXIA 2QL9B 2UUAK 1FTRA 1Q9XA 3KLFA 3OXFA 1S1VA 5IOLA 3FR0A 1K47A 3GDQA 1KXPA 4E7HA 5HQLA 3MCPA 3FCHA 2WTFA 3EMTA 3ZSYA 1SQEA 2VFVA 2VICA 1GLAG 4IWVA 3M5RA 3K5LA 4NXMK 2O8FA 2FHOB 3QDKA 1FKOA 2AW0A 4Y34A 2K2PA 3TU5A 2HBRB 2WSEC 3NHGA 4PCQA 1K1SA 4RBVA 2EHGA 3R5DA 3N9UC 1GTEA 4OI1A 4M5KA 2W6KA 3OS1A 3IWXA 4ZVHA 2R7QA 3AGKA 4FF1A 3JSRA 2A42A 4MO5A 2VZ9A 4JI7J 4K5SA 3GOIA 1BISA 3OBIA 4NCGB 1IBLK 2VQFK 3GILA 1U2RA 3CB4A 1HBOB 1RDRA 2ZGYA 4M45A 3WC0A 1V6HA 3GONA 2E5JA 1NRKA 3B82A 1NLVA 4DCHA 2HF3A 2DGSA 2MJNA 1CXUA 2HOEA 4ID5A 4KGKA 1M1GA 2E1RA 3MM8B 1IKWA 2I1RA 4ED6A 3IXQA 3PHTA 3SSRA 1JL1A 4DR3F 3DDNA 5J2PA 3V1OA 1RWVB 4IXCA 1IG9A 2ZUAA 4NI2B 1XHXA 5KFJA 3HPOA 1OPIA 4CP5A 1BWVA 1M90T 2IBOA 3N5FA 2V8DA 4KGXB 2IVOA 1JLEA 2FHMA 3VESA 1WN7A 5JXSA 1WAFA 3EKSA 1WOOA 4Q8FA 4OKEA 4ELTA 4DSFA 3TVKA 3T1HJ 5I3UB 1K8KA 2LMIA 1SPBP 3O9TA 2QA1A 4WCEL 1RT6B 1DTQA 3MCSA 4NZ7A 4GKKJ 1XIQA 1BGXT 2ZH7A 1R0BG 1TL4A 1UW4A 3SAHA 2EG1A 2RDJA 4OLAA 2CFXA 5KG5A 5JVHQ 2K06A 3VEWA 2V50A 6FDRA 1NGBA 4WK1A 5KFYA 1QQOA 4LQ9A 4JI0K 3HM8A 3AA8A 3J7AN 2CGLA 2SXLA 1WSFA 4EBCA 5KG6A 2WUSA 1HMVA 3CMQA 3KJQB 3VF4A 3M6XA 3B8HA 4TY9A 3DRRB 1H3DA 2P9KA 4LSLA 1YDLA 3JS6A 3CIZA 2R2RA 2DXFA 2MTLA 3VERA 1N88A 3UVJA 2CKWA 1CLQA 3K8VA 3K5OA 3E9LA 2IOCA 4USJC 2R2SA 3X1LB 3A5NC 2ZE2A 4IKFA 2HFNA 3EWGA 1T9UA 4W5QA 4WFYA 3CMAS 1NM2A 5KG1A 1RISA 4P7VA 3HSZA 1SC4B 4RNHA 2ZJQL 2W41A 4K25A 2DEIA 1J2VA 2AYGA 1UPMB 1KOOA 1KQSM 4Z4EA 1CSJA 4KB0A 3O08A 3MN9A 3J7ZO 4CGIA 2MMYA 1MA9B 3NMRA 2HQGA 3S9HA 3B54A 1LQ9A 4DQIA 3NE6A 3CCWA 4EP5A 2PEBA 1YJ9S 4A57A 3ADAC 4OQJA 3HPHA 4BC3A 2F8MA 2G0JA 1KEKA 2IBKA 4E1NA 1Z05A 4UY85 3T1HF 4RU9A 4CQ1A 2BW7A 3W5YA 5E5NA 2WK4A 2GJ2A 1Q53A 3TYTA 3AH6A 3QATA 4Q5VA 4QIVA 4IH7A 2WHOA 1N36F 2N7CA 3BO4A 1RWUA 4C1NI 3VPZA 5HMZA 1ZTTA 1Q8BA 2XO6A 4N8OA 4TLRA 1YKWA 2IA6A 1WOQA 3NGZA 2MPUA 2YTCA 4B3RJ 1QVFM 2D3OR 5CZXA 3TO8A 1T03B 4OYZA 4N76A 2BE2A 4OI2A 2A6MA 3CF5L 3L2RA 3KVGA 3PX6A 2WVEA 4C48A 1C4CA 4DPXA 4DFJA 4LIRA 3VOVA 2BJ1A 1S4EA 3NY0A 2GWJA 1KONA 1B3TA 3EZWA 4Q2LA 3BQ0A 1VSHA 5CZ2A 5IC6B 2FDNA 3QWPA 3HCXA 1YJ7A 4ANCA 1T9VA 1S5JA 4ENOA 3D5MA 2ZUGA 2BE2B 1NDLA 3O8WA 2DRBA 1VBZA 3AOCA 4OYBA 1S22A 2OEKA 4RUHA 1Q5YA 2OTJS 1A6LA 3L95X 3Q8QB 2A41A 2EFVA 4XO0A 3TX8A 2AJ4A 1U2CA 1XNQK 5C0YA 1KSPA 2CGJA 2HMIA 1RADB 3MR3A 2HQFA 5KFRA 2HHHJ 5GINA 4A8FA 1DLOA 1S7IA 5HSPA 3LZIA 4W5NA 4E0DA 4AILC 4K4XA 2ZJRL 4OJHA 4PKGA 3ELHA 3HD2A 4BBYA 3TEHB 4IOAL 4LSZB 3GFZA 3LPYA 4HACB 1APSA 2HBJA 5BXIA 1GEHA 3CD0A 3R5GA 2OIHA 2BKPA 3M1FA 1VIOA 3MURP 1TUUA 1VQ4N 3JB9k 1OQ3A 4RWWA 1WJ9A 2IPOB 3CJ5A 4ED2A 3LP1B 3W64A 4AYBD 4DV2J 4X65J 1KFDA 3LOUA 3GSIA 4J2EA 2VCPA 3MR5A 3MXHP 1WELA 4KTQA 1HHSA 1WB9A 4LRDA 1Q5VA 1C0FA 5J2QA 3VA0A 2KG1A 1TKDA 1ZM4A 1S9EA 2ZH2A 1NGCA 4KIAA 4EYIB 5IT4A 2G8VA 1XMOK 3BREA 1WOPA 4ZKAA 1OQ6A 1U1RA 3UKRB 4DZDA 4L3QA 4UOGA 4DTUA 2UVRA 2EFQA 1N4LA 1VQPS 3F0NA 3TWZA 3UD5A 2LLZA 1AA1B 1C0UA 1BUPA 4CFCA 2M9KA 1X1PA 4HHUA 1S3XA 3THWA 2QO3A 1ZBTA 1S0VA 5BR9A 2BJ3A 2KQ2A 5LJVA 2W7PA 4NXMJ 3VQDA 2ZJPL 1P1LA 3I5CA 1C1CA 5CY4A 1ACMB 5LT5A 3A0IX 4CF1A 1XC3A 1Q7LB 1WNSA 1QSSA 3FMWA 4IG3B 1YXQA 2A40A 2C28A 3AY9A 4ZHRA 2E5HA 2ZWOA 3IGNA 3M1VB 2HQCA 2VJUA 4Y1DA 4AHRA 4OV1A 3GFXA 3MEDA 1WF1A 4RJVA 2R8HA 5I4MA 1V4TA 1HBUA 2AX0A 4LRBA 4FPIA 3UW1A 3AOBA 3OTDA 4Y6IA 1W2BR 4BC5A 1NDKA 2E1AA 3P45B 1XEZA 2H3EB 2DPIA 2V51B 3QEXA 1XC9A 1HQUA 4HLBA 3UDLA 4BROA 5B0GA 1RT4A 4B8AB 1CPZA 1S5ZA 4WFNQ 3A3OB 1G7CB 5F8JA 4E1JA 4KHNA 4IOXA 2GAGC 1VQLS 1BIUA 5J2NA 5A0YA 1J53A 2YNIB 3CCLS 3OYJA 3ZFVA 1Y3JA 5L46A 4WFAL 1XR7A 2W25A 2X1FA 1HHQA 4MDAA 5HVHA 3PUFA 4C9DA 2FJDB 1WI6A 4JEPA 4O3RA 3RUBL 4DV5K 4WKYA 2C3OA 4BR4A 2MQLA 1BOTO 1WC3A 1T6CA 4IO8A 5M2RA 4QR1A 2YPZA 1HNXF 1RAHB 2Z56B 4QBUA 3D3BJ 1M0SA 3E9PA 1TZ0A 1VGYA 4CO1A 4MLEA 3OW2R 2DGOA 1WSHA 4DPOA 3GR0A 2Q3SA 4ILGB 2IIRA 2NXNA 2V8VA 4CECA 2Z1GA 2AJ0A 2HHUA 2HNDA 4EBEA 1R0AA 3NCPA 3E9OA 5KFOA 3OYMA 3M9NB 3R3LA 3NGDA 4OYAA 1F9HA 1PBUA 4O8UA 2EFPA 2GEMA 3QNNA 3HFZB 1FW6A 3A13A 2FHJA 2RKIB 2I0XA 5C24A 3CCUN 2PO4A 3CEDA 2HKEA 3CJCA 3BN7A 3PJXA 4NLUA 3ZSQA 4LF7J 4CF2A 1R0AB 2D74B 3HYFA 5AZIA 4N7TA 5GAEI 1XTZA 4HCBA 5A8RB 1FVSA 3EXYA 4ZITA 2B0GA 2OPSB 3KLIB 1B0TA 2F8HA 2B4JA 2JC1A 4DCJB 4PKHA 4LH4A 5E3RA 3O4WA 2QIFA 1ZBUA 5T14A 1VISA 3AJ1A 1SKWA 2MEWA 2ZD1A 2XY5A 3BGRA 2LEBA 2BRLA 2P9EA 4CIGA 1NO8A 4XDDA 2AJQA 3OHRA 4DTJA 1HYSB 2BANB 5CZ1A 3K0SA 1XNQF 3C7NA 3LWMA 1JLFB 2GX9A 1U0HB 3L9ZA 3EXCX 3MR2A 3FKBA 4ERDA 4FJKA 2O8EA 1NMEB 2CUYA 2J7UA 5C10A 2O4GA 1BL3A 1HWUA 3M4XA 3OXGA 1Y9OA 1K8KB 2PSZA 1M90O 4USHA 1U25A 1YJVA 2WAQD 3PYGA 4DV1J 2XMJA 3C14B 3ICLA 4FYVB 2BANA 1T05B 3MM7A 1LWFB 4E7LA 2XZWA 4C4WA 4I56A 3CO9A 3D28A 3CJRA 3PW7A 2E6MA 1S97A 3WXKA 3S8SA 2IAJB 3T5KA 3DGPA 1UJ6A 3WHIA 1RT7A 3JAMY 3JSYA 4QIWD 3FFIB 4KGZB 4JN4A 4S0MA 1LWEA 1TL3B 1CS4A 3IC1A 1UCNA 3IWLA 4JI2J 3ENAA 2YNFA 3CQXA 4B08A 5K20B 4LT6A 3GB0A 3MAAB 3H45C 4MDBA 1XNQJ 2A3JA 4IFYB 4QR0A 3CMAN 4C3KA 1T9WA 1UEKA 1O51A 3PJWA 2VHGA 1TL7A 4UY8O 4FBTA 4YY3K 5B09A 4CJPA 3SCXA 1NJYA 4K8XA 2IYGA 4DV3J 3TUIC 3ET6A 3VN5A 2D0PA 5KFDA 3M9OB 2UXBJ 3HSJA 4YOYA 5LJ3Y 1SJQA 5E84A 2NXJA 4RUCA 1RTJB 5JJBA 3BYPA 1R0CB 2O5DA 4QIGA 1VCTA 3VAJA 3DWLA 3PR5B 2KM8C 3K58A 2JZ5A 3OY9A 1J5EJ 2P9GA 2DHXA 2J6TA 4P2XA 4LRAA 3LP2B 1GX6A 4B3RK 3ONQA 1A0OB 4CI0B 3O6WA 3MMAB 2Q6BA 1WDTA 3RR8A 1ZBLA 4LF4J 3VZHA 2J0WA 4WE1A 2P9NA 1FI4A 4IR1A 4X4PA 2UUBK 3IBWA 4BRHA 1LWFA 5AQOA 4CGFA 4B3TF 2ZBQA 3FCWA 3G71S 4YOUA 3RMCA 4DU1A 4WIQA 5DJBA 4Q44A 3KLVA 4DSLA 5KFVA 2M52A 1XWLA 3PG9A 4RWTA 3M3ZA 1FFSB 4ZPBA 3CCTA 3PSIA 1T3NA 1YIJS 4YDUC 2VG7A 1RTIA 2HEKA 3CWJA 3VVUA 5F9NA 3K5MA 1MG7A 3UCUP 1WBDA 2IJRA 1QE1A 4DR7F 2DRDA 3SEOA 4LF6K 2EWSA 2H4YB 1SJFA 2UUCK 3MEGB 5A8KA 3SQOP 4LFBK 3KK2A 1X4FA 3OR2B 4CLYA 1SXLA 5J2NB 5A0YB 2OTLS 1C1BA 2VFUA 1M5KC 4FL9A 4LR9A 5DGAA 4U7UD 3QSYB 4M5GA 2E5LK 2I38A 5FPNA 3CSKA 4QS8A 3IS9A 4C3MA 3VQQA 4M5MA 4M94A 3W65A 3M6GA 5D15A 2NSCA 2LQBA 5K14B 4HDGA 4DR1K 1NGFA 3R1XA 4PYDA 3RB6A 2LU1A 4FM1A 1HKCA 1K9MO 4JI1J 1S72S 3EVOA 1RKIA 4B3MF 3PIPQ 3QLHA 1R8BA 4Y00A 4M3WA 1NK6A 4H0TB 4J9OA 4CZCA 4K2XA 2PY5A 2AP6A 1J6ZA 4PXEA 1YRUA 1L3TA 1XJWB 5AXMA 4X4SA 2FJVA 3LH2S 4JKHA 3THXA 2PIIA 2GUIA 2P9CA 5ITHA 1S10A 4DL0C 2HHTA 1BI4B 4WFXA 3SFUA 3KDOA 4WFAQ 3TUJC 5U47A 3W5ZA 2Y1IA 4DV1F 4Y2IA 1UAXA 3SBMA 1IM6A 2CPXA 3DFEA 3DLLL 5M1KA 2FF6A 5GIPA 3DHXA 3OL7A 3MX2A 1MWKA 3F73A 2RQMA 4LSNA 2NUBA 1FJGK 2MLXA 2ILZA 4HI1A 2GIRA 4OX9F 4CJTA 4XAKA 4IBNA 4AHSA 5D0EA 5JMVA 3P96A 2R8KA 2Z58B 4MO4A 2OMLA 3KLHA 4EFHA 4GRSA 1IBLJ 4XDCA 2P9UB 3G86A 4X84A 2HGNA 2Y8YA 1T9YA 5HLFA 1ZPWX 4JI3K 3VEZA 2C3YA 2GBZA 1B92A 2QWNA 5E3PA 5BPMA 2L41A 3G87A 4ZCMA 3O9UA 2V2VA 3CYMA 1S9FA 3HZ6A 4AL7A 1KVAA 1HHTP 3H40A 1MMLA 3EEQA 1KVIA 2WFBA 1AT1B 5ADXA 4DR5J 4LQ3A 3RZAA 4Q8EA 2IM1A 1ZAXA 3K5NA 1ATRA 4DPTA 1C0MA 1HQEA 4DEZA 3SIPB 2F65A 2ZHOA 4TQRA 4CF0A 5G4DA 4YNQA 2E2PA 1PILA 2UUAJ 2QMXA 4EZ9A 4FP9A 2V8GA 3FGUA 1J5OA 1F3FA 1JKHA 1IKVA 1WC0A 1S1UA 5AQRA 1N33F 4FLUA 3TW0A 1Y0HA 2EEYA 5AQYA 2RRAA 4Y3CA 3K57A 2KJWA 1SB6A 1NMDA 4F2RA 1JNZB 2RJZA 1SH0A 4PR6A 3LPEA 4JK8A 1FD2A 3THVA 2J6SA 3HK2A 2ZBPA 2QA4N 1CLFA 1BA0A 1X4EA 4DLGA 1QZ5A 1DURA 4LF8K 2UXDJ 4B9QA 2HRUA 1QVFR 3OLBA 4F4WA 2HWHA 3AXKA 4DV5J 4LF6J 4A5BA 1QZ6A 1FKPA 4DV6J 2E2NA 5GMEA 1R89A 2MKKA 3MF5A 5JS2A 1X4GA 4B3TJ 2UUCF 5A8RA 3FZKA 2ZKTA 1LOTB 1P6TA 1R8CA 2VC0A 2KTQA 3QSIA 2ZDOA 5CD4H 3JTOA 2VG5B 4CLZA 3HDSA 4J2DA 4UY8T 3M8ZA 1U48A 4H5RA 2QFJA 3CJKB 3RMDA 2KKZA 2OSRA 3L7PA 2PFUA 4J8FA 4BDZA 5LSRA 3A5MC 1NJXA 2GVZB 3FK4A 2KRRA 1UL3A 4A8KA 5HRNA 2RH3A 3D0IE 5AE2A 1XUPO 2P9PB 2VG5A 1GMVA 3GYNA 1PJ7A 4RBUA 3PXGa 3CIMA 4K42A 2RU3A 4JI8F 3VETA 3L2QA 2CPZA 1MN9A 1QVGM 3VAFA 3M8RA 4Z4FA 4JRQA 5B0EA 4UT4A 3P6YC 3FSIA 4ZVTB 1Q8KA 4QR2A 3MFHA 3T41A 4PWDA 5AQUA 4NI2A 1JIHA 2FZCB 3SUQA 2CJ9A 4JV1A 4DV3F 1ZBIA 2UUWA 2CA9A 5A8KB 2XNRA 1KS2A 4DKWA 4G1PA 4ICLA 3BR9A 3EUNA 4IJNA 1UETA 1YTAA 2VFTA 3NH0A 3BGUA 4GY2B 2KHOA 4OKKA 3G8SA 3G8TA 1XERA 5D77A 3W61A 1OH5A 5HOOA 2QKBA 4OHXA 1FXXA 5KGWA 1ZBSA 1VIXA 3W2WA 3SSSA 3ET6B 1N36K 3HXMA 4DUTA 1XMOJ 3A8YA 4BR2A 2Y1LB 4O5BA 2KLAA 4X4OA 3CCQN 2UXBF 1CXQA 2GVZA 4ATNA 2XLJA 3OW2M 1PAEX 2W4PA 1KOHA 4OLBA 1H2UX 2J7WA 2K8GA 1QUPA 1X31C 3SQ4A 2DY9A 3DKDA 1JLCA 4J5OA 2BJ9A 1L3KA 5KRSA 1SKSA 2BACA 1M5OC 2ZOFA 4B3SK 1QSYA 2M88A 2QV6A 1GLLO 4OHYA 1KLMB 1XMQF 1MW7A 1UMJA 5KFIA 1BC6A 4HDHA 1VBKA 2QXLA 4USTA 3AVMA 3CCSN 2FGOA 5KPRA 2VQFJ 3H90A 4JKBA 3C6TA 3SJJA 4L76A 5GAHP 1HBUB 2LDIA 2XSJA 2V4JB 1QAJA 1HD1A 1X7VA 5KT3A 1WOSA 3P8BB 3TAGA 3P3DA 1VQ9N 4YR0A 2V67A 4JKGB 3AVHA 2HVZA 5DK5A 3SQGA 3NGRA 3W8PA 3P5TL 5AFUH 1RT2A 3N4PA 2F8SA 2HS0A 3B6PA 4TNOA 3CCEN 1TL1A 1N5YB 3UPFA 4L8RB 4NYZA 1TFYA 3MK6A 3NAEA 5KFTA 2ZC4A 3G6YA 3QRPA 2F9WA 3GWCA 2DY4A 3LWLA 3MECA 2YWWA 1VQ6S 1PJ6A 3AD8C 3BEGB 1B4SA 1X9SA 4EO6A 3LO3A 2AEMA 3OYHA 2R2TA 5CYJA 2KKHA 1GXLA 1IQZA 1M5VC 1K73T 1REGX 3LTOA 1UAWA 3O3GA 2V9KA 3A3PB 1XMBA 3AODA 1QM9A 2OD6A 4CBUA 2VBXA 4LMZA 5H9EK 6FD1A 1HARA 4M63A 5HLFB 2DNGA 4OLPA 3QESA 1FRXA 2CQ1A 2IY5B 3O9SA 3FJ2A 4ZPVR 2YHYA 3O1BA 1IKYA 3IRXA 2F4FA 2X3GA 2JEFA 3DU5A 1Q82O 4YHHJ 4KRFA 1Q79A 2BVZA 5KFHA 4JKCA 1SL0A 1IJFB 4C0OC 2OELA 2AEFA 4NXNF 2EBGA 2QKKA 1NHKL 4YORA 4BG8A 3EKUA 3BSNA 1UVNA 3A8IA 1BUXA 4JKFA 5FDLB 2DH8A 1EKSA 2PYLA 4JI5J 3SAFA 1NH7A 3Q8VA 4RW8A 3CDBA 4A8OA 1TQLA 4KTWA 1FDBA 2XMKA 1N56A 4PKDB 2Q43A 5I3PA 3MXJA 4KQZA 1IKXB 4BRQA 3NCQA 2L9WA 3QO9A 3MEEB 5E3QA 5EUHA 1Q16B 2OPRA 2EC0A 2ZC3A 3H3NO 3CCMS 1CJVA 1C1BB 3SFGA 4CW7B 4TY8B 1ZC6A 2EW9A 3JSBA 3NAIA 5IWAJ 2AJFE 4BE1A 3DRYA 1D4XA 1NM1A 4LF5K 1EETB 3UKUB 2DGQA 4ZPCA 3MPVA 3PYDA 4FXWA 1FRJA 3T5HA 3AGRA 1I5OB 2WCXA 3TRGA 3R1HA 4B9VA 1VMBA 5IM0B 4MK7A 4CH1A 5J1NA 3Q2TC 1A5WA 2GUPA 3ZSXA 3IAYA 1SZ2A 3OV7A 1ASUA 4ZVFA 2UU9F 1SI9A 3NGYA 1TYQB 3BYRA 4K41A 4DR4K 2EFGA 3L3CA 5L1IA 2XCAA 4XK8C 1G15A 2W2MP 1CZ9A 5GAHU 1EWRA 3PR4A 2WBNA 3DI6B 3CJKA 1H7WA 3AVAA 4O3SA 1RE1B 5KG3A 4ED1A 1FD8A 1N36J 4B1VA 3KHYA 3TPQA 1X9MA 1D0EA 2PAVA 4EAHD 2YWFA 2U1AA 1URRA 5A2QY 5AE3A 3D6RA 4HH1A 2XYPB 5LXYA 2VUGA 4KJIA 4KBIA 3WXMB 1RYSA 5BJRA 1GH8A 3HHLB 2OYQA 3D45A 5LL6d 2XY7A 4F3MA 5J2MB 1Z6RA 4DPUA 3DYAA 3EX7B 3W3DA 1WC5A 1U2FA 2QRRA 4WQ4C 2WVBA 1KQFB 1UA0A 5A6PA 2AD9A 2YHWA 3PKMA 3K5PA 3FFIA 4ZN1A 3IR7B 1J5OB 2ASYA 1VFJA 4DF8A 1HNWK 3ZEUB 1RA6A 2KT2A 2HRTA 5MLCQ 3EICA 3NGUA 1UTAA 3QT5A 1OS5A 1YZ7A 2CNOB 2ZZTA 4OHZA 2HMPA 2QJ3A 5IS2A 1WTBA 4KGMA 1AW0A 4X66K 2B5JB 2IYIA 5G0RA 3W2WB 2ASLA 3NNHA 2ITMA 4QOZB 2KW4A 1X4BA 2K3KA 4URSA 5D4LA 4NB4A 3WEEA 3L2UA 2NYIA 1QSLA 3DXSX 4B8CA 2HG4A 4XH1A 4O3QA 2H1YA 1KAZA 2EK6A 4CRJA 1FCAA 2ZBRA 2YKAA 2HZCA 4NCBA 3BGLA 3H25A 1UP1A 3C6UB 2JEIA 1BU6O 1QAYA 3PNIA 2YKMA 3MPYA 1RYRA 1KLMA 3ZZRA 1NK4A 1RWOB 1A7GE 4PWDB 2E7XA 3CCMN 1LXJA 2R3VA 4FVUA 3K2YA 2KDOA 2Q36A 3RSEA 3D2EA 4ZLLA 1JLCB 3S7RA 4WFBQ 3DLHA 2PDAA 1E4GT 3TR8A 1FESA 2B4OA 3MOZA 4U67L 4KH4A 2J0QD 1URNA 3DC2A 1S1UB 5DGBA 4UUWA 1U7LA 4LFAK 3AARA 4F8RA 4J9KA 2F4VK 2C42A 2FGCA 3MN6A 3S3OA 1N8RO 1I94K 1TAQA 5BYQA 4ALZA 5E7OB 2VBZA 3I0SA 3QFHA 1U2VA 4CEOA 3AFGA 2V4JA 2AGPA 4DL2A 4G65A 4DL4A 4ZVEA 4DPYA 4IOAQ 5LMUJ 3NNAA 2QSWA 3A12A 3H5UA 3IP0A 2P5VA 2QZ8A 4YR3A 5HJYA 2M2BA 2Q6CA 4ZIVA 5AT1B 2VBWA 4ZPTR 2RPIA 3W5XA 3A5LC 3FBBA 4FJHA 2P8IA 5GAGU 3KK2B 2NRXA 3T5LA 1NNEA 1M1HA 5KFLA 1RBRA 3VGMA 1IBMJ 4ZPAA 4A2BA 5KQ8A 2GGPB 3D3CJ 3LF0A 3QNOA 1BMQB 1W2IA 2VQFF 3PZPA 3PCOB 4ZCKA 2EI5A 1R6YA 5EWGA 1N33K 4HACA 4IH5A 3QPIA 1N5SA 2HHHF 1UW9A 3OBWA 3BO3A 1DEJA 3US5A 1RQ0A 2HBKA 3C6HA 3NOCA 3C95A 2HK2A 4CERA 1NB2A 1LWEB 2CQ3A 2C2EA 4ZVQB 4Q2MA 1KNZA 5DM6Q 4AL6A 4A62A 2FSKA 3QGIA 2VOOA 1RZMA 2YY3A 2D4WA 4QPXA 1OY9A 3H98A 3M1VA 1YRTA 1RDWX 3Q24A 2HPUA 4OZNA 1T44A 2Z8QA 2FJAB 1GMWD 1FDAA 1LWCB 1WDDA 3MXIA 1TU0B 3SXLA 3V2UC 3JSMB 2AJ2A 1BQNB 2Y0BB 3KHRA 2RU9A 4PWWA 3UWTA 1GXTA 4OYPA 3TP2A 2KVQE 4K8RA 1UKUA 2BGGA 3W62A 1ZOTA 3DOKB 3CCQS 3FMBA 4FZVA 3S6EA 3K89A 1KVBA 4D3GA 3PX4A 1AUSL 2X51A 3HI0A 3SQ1A 4E19A 4RW6A 3K17A 4CNYA 3OYCA 4NMLA 3KUEA 1MMNA 1VI7A 2XMUA 4M5IA 2DNZA 2LDYA 1TYQA 3D68A 5K9FA 4RUAA 1SCJB 3DOKA 1AZSB 2QLXA 2YHXA 2VGNA 3CHWA 5AQFA 2I2YA 4DL7A 2LXUA 3EGZA 3RB4A 3SV4A 2JWKA 4CGHA 2CIMA 4R8UA 1C0GA 2W4CA 4MKVA 2B51A 2JFKA 3GCXP 4JI8K 4CLWA 5L1LA 3P38A 4C23A 3PX0A 1WSJA 2W2PP 1F21A 1CJUA 4DR1J 4LFBF 1Q82T 1UFKA 2W7OA 1PJ5A 1VQMS 2XYHB 4NXNJ 4IG0A 3T6BA 2M8DB 2J76E 4I67A 2MYFA 3HVTA 3GIKA 3EVWA 2M3DA 2KJVA 3AXMA 2IDLA 4FOEA 4KC5A 1GMWA 3L3UA 2R7SA 4NCGA 2QI2A 3WQTA 2ZITA 1NH8A 5KG2A 3J81U 5DO2A 4FF4A 4JK9A 1NKCA 4W90B 3CE8A 3RRHA 2JC0A 3O9RA 3CCZA 3M7VA 1CC8A 1FHTA 1RWKB 1VJWA 4A8XA 2XEXA 4GV6A 4DV5F 4RW6B 2YNHA 1JCEA 2VQEK 2XTJP 3D2FB 2MZTA 2GX8A 2FLPA 5EX0A 4J9NA 4MQ3A 2V9WA 2OJ3A 4CE9A 2HSTA 5KT4A 1YI2S 4YHHF 1LNQA 2ABYA 4F2SA 1A5VA 3HLUA 2ZQBA 1RU1A 4O44A 2W24A 1CJKB 3SI6A 3AA9A 4WWSA 1S9EB 1Q95G 2Q66A 4F4ZA 5H9FJ 4B3OA 5IWAF 2LXIA 4CLTA 3H1QA 1O1WA 3DAWA 4RL1A 1B7YB 4RBTA 2R4FA 4LF4K 4RNFA 2GW8A 3VV2B 3DLEA 1FRMA 2CNKB 3CF5Q 1IUJA 2ZHBA 3LDSA 4BCAA 2VG6B 4GKKF 2QLFB 3HKZD 1BY9A 1YHQS 1BG3A 1PC4A 2JLFA 1Y5LB 2ZNZA 4GVMA 3WZ0A 1MLAA 1YBUA 1YG0A 2MKIA 2KVIA 1OPZA 2XLKA 1HLUA 1J27A 3BS9A 3LQVA 4QOTA 4JHDB 3AO5A 3OS2A 2R7VA 1VOMA 1BWFO 4ZLJA 3GJSB 1V5IB 3Q89A 2YKNA 2OGUA 2WOMB 3BP8A 1NDPA 2MKCA 4ED5A 4BE2A 4DR3J 3G2XA 2XQCA 1E4FT 2YNHB 3Q86A 2QWRA 3R8YA 3TABA 1SJ4P 4BVOA 3N6LA 4PPZA 1XI1A 5KFAA 5C15A 1UVKA 3NH1A 4A61A 1IKWB 3U9ZA 1REVB 2H5IB 4J9RA 2BQUA 3J80U 2QWQA 4BE0A 1WKLA 3KKRA 3LP3A 4MFBA 4JI6K 1QVGR 1OJ4A 1Q7YT 2G8HA 2A1SA 3AO1A 2V4QA 4NRUA 3FQKA 3CMES 1FRLA 3HFKA 2VKZG 3IAS9 4H4OB 3BKTA 1N32J 4QU7A 1NJIO 2CJXB 3MWPA 5JMNA 1ITPA 2OEJA 1TMMA 4KO0A 5ETRA 3L2VA 3ILOA 2DPNA 1RBAA 4CEAA 2Q1NA 4EMDA 2P9PA 3KLGB 2UVVA 4ZMMA 3FC9A 2DH9A 3UCZP 4BRKA 5C5JA 1UVMA 2QA4G 1I1GA 4BGBA 1SC6A 2CNLB 4AH9A 5CYQA 4HUEA 4IOBA 5KFUA 1SC3B 3CVKA 2X3DA 5TKYA 3CQ8A 3OL8A 2E5GA 1P9QC 2ATCB 1D9FA 3UB5A 2HNDB 3CCVN 1QS4A 3I56S 3ENBA 4BS2A 1O0PA 2P51A 3OVNA 1OO0B 5BR8K 2YX7A 5CHCB 3NF8A 3EGWB 3TAPA 4I4BA 2DHHA 1KDNA 1S49A 1WAJA 1N34J 5H1SV 3DRRA 4KPYA 4P52A 1V4SA 3ZT0A 3KZBA 3A4TA 1ZAWA 3G6ES 3PACA 3VQ8A 2VL1A 2NRHA 3DOLB 1PG5B 2JWLA 1RFQA 1YJWS 1X3MA 1O6XA 1WHYA 2BKNA 1TKTB 5C24B 4AL5A 4P2SA 4FW2A 4FWRA 3I33A 5CA5A 3CM5A 3MEKA 1PCAA 3UDVA 3ZEUA 1K8AO 2ZD1B 4DHYA 3TTCA 2R7YA 4CHYA 4KI4A 3SQGB 1N34K 4ECTA 4DR7J 3ZTQA 1W25A 4B02A 3BDEA 5A8WA 5BRFA 2HHXA 2B4VA 1F5AA 4CJKA 2O8EB 3HJVA 5HMXA 1HRHA 2DNLA 1YJ9N 2Q31A 1KN6A 2A2DA 1K0VA 4Z4GA 1EIYB 3SPYA 1E6YA 2KN4A 5HI7A 3M32B 1JKHB 4KSEB 1ZXOA 4ZCLA 4J37A 1NB7A 1WSGA 1GLBG 1YITN 4U67Q 5DDQC 3WXLA 3R5BA 5A8WB 1Q86T 1E6VB 4CFDA 1RDDA 1HJOA 4CEBA 1U1OA 3CCUS 3U3YA 3NLCA 2LVWA 3DRSB 4NRTA 1CG2A 5CR4A 2UU9J 3GV8B 3M8PB 5D4OA 3U6FA 3B4MA 2A18A 2HVEA 3OYEA 2FXUA 4IDKB 3I8BA 4JYAK 4J90A 2FD2A 1T11A 4F04B 4KKOA 3M2VA 2ALZA 1N0UA 5AQNA 4CT9A 1TL1B 4LFCJ 1WD6A 2L9NA 1X4HA 2P9KB 4FKXA 4OZ0A 3ASMA 1UZDA 1VQNS 4F4AA 2CZ4A 3O1WA 1TK8A 1BQXA 3EZ5A 5D0HA 2GHWA 3OTOF 2V69A 3T1YK 2VF3A 3TUZC 3EE9A 1KRPA 4OZLA 2XMVA 1HYZA 4I69A 4JP8A 3U02A 1UVIA 1L5UA 1GLJO 4OI4A 3IBCB 3HHNB 3O80A 7FDRA 4BACA 2HHVA 5M1PA 2XHWA 1Q0NA 4H4MB 4DR3K 3FFKB 2VWKA 3DRPA 3DLKB 1WC6A 4Z2XA 3LP2A 5DZ6A 4BRDA 3JXOA 2UXDF 4ZPDA 3OYAA 2E5IA 4YEAA 1NBWA 2D1KA 2HQIA 1TKZB 2DFEA 1N6QB 3CD7A 4K7QA 1VBXA 4OI3A 5HO4A 1PC5A 1AFIA 3G0ZA 4UOHA 1X0FA 1GLCG 3JAMO 1N54B 3V9UA 1UVJA 4FJ9A 2HBZB 2NQPA 3CJAA 2JVRA 3NVMA 1NK5A 2GQCA 3NGKA 2N4CA 1RJJA 3ETOA 4DR6F 2FY8A 2ZWHA 1PIEA 4CLSA 2EWHA 2VJVA 4M3RA 4RW8B 1HBMA 4UOFA 4OVLA 1N6QA 2GHPA 4O4RA 4CJWA 1NPKA 2IJNA 3OHAA 4TKTA 1P27B 4QZVB 1JQGA 2OP5A 3C46A 3D0HE 2XWYA 3NG8A 4P6QA 1RAFB 2RE1A 5AE1A 3VQSA 2XY8A 4IR9A 3KD5E 3PVXA 1WWHA 1A5XA 4B1UB 2GJIA 1CJUB 2GJFA 3SUNA 2ZH5A 4QWBA 3CC2S 2PMHA 1EQYA 2FBXA 1BWEA 1OMSA 2DNKA 2BQRA 1QQMA 4EUVA 2FPHX 1VQPN 2B4UA 3BZKA 3HTVA 3O1LA 3VENA 4B3OB 2FJBB 1HPZA 3KWMA 4FK2A 3J7A1 2XGPA 3WNHA 1NJWA 3UKRA 2FHJD 2PI5A 1JXVA 1FKAF 1RDBA 2CQDA 5HK4A 4KHMA 3OBYA 2HWTA 2VU5A 1WACA 3P31A 4DX6A 1IM4A 4X64J 1KQGB 2HAIA 3CGIA 3AVJA 1SKRA 3F5TA 1VQSA 4CGGA 3VQ5A 2F4VF 2NR0A 4QAGA 3CJTA 1FDNA 1IR2A 1SS6A 1LOUA 2JHEA 5JUMA 4FJ7A 2E9ZA 5B0BA 1S6PA 4H4OA 2IVNA 3MMBA 2A10A 4ZN3A 2KZZA 4NLSA 4FK4A 3ULDA 5DMRA 4O44B 4OX7A 3OTBA 2FJXA 2Q79A 3TTDA 1CQMA 1YX2A 3POTA 2CQ0A 3NGTA 4NL5A 4JKGA 5FRNA 1UPPA 3W60A 2P9IB 1PBAA 2K1RB 3GJRB 4KV8A 2DNYA 4CJ5A 4M7YA 1F2GA 2V63A 4DV4F 3QFPA 3SBGA 5C2FA 2DTJA 4USVA 5I9EB 2JNJA 3FSXA 4OHVA 5IC4B 2W9CA 4UZCA 4UZBA 3UE5A 2M7SA 4LSNB 5GAGP 1FF2A 2LCWA 5BRHA 5KFMA 1RHUB 1T9XA 4B1ZA 2OMOA 4MFBB 4JV2A 4BRCA 2ASOA 3CCLN 1L3SA 3U27A 4I6AA 4BC9A 1HWIA 4C8ZA 1JXLA 4I68A 4HTIA 2B6AA 1K44A 4HH0A 5DLFA 1B64A 3C19A 3VF2A 4Z7YA 3V6HA 1WSEA 4OGCA 1N48A 1GOAA 3AVBA 2KHCA 1QD1A 4Y2KA 1RSCA 4DR4J 1U0HA 1TFWA 1SL2A 2GA7A 1KVCA 1VC0A 2WC9A 2AT1B 3THWB 1QJHA 3MN7A 4OHWA 1FFGB 2WBMA 2MQQA 2GMLA 4PG8A 3C14A 3T69A 2EXUA 4ZP7A 3NCIA 2EPIA 2NYHA 3KLFB 1VHFA 2HFSA 1W26A 4JI6J 2IAJA 3AB4B 3WIVA 3PW5A 1ZM3A 3I96A 5AQTA 2APOA 3MM9A 4FM2A 3BQ2A 1HR0K 5L8RC 1E6YB 2W7AA 4C8OA 3U3GA 2QG9B 5J1EA 3D7EO 3MDQA 4K8ZA 3S1TA 2ZH8A 2ZJRQ 4CTAA 2QEXS 3SMPA 5HP1A 3CCJN 4MMOA 3VZIA 4RPFA 4I7FA 1IBLF 3EDQB 2G2YA 4P73A 3PHEA 3V6JA 2WW8A 4CJQA 4DSJA 2E2QA 4JB8B 2VPYB 3OL9A 3U4LA 1HX1A 3SDEB 4A8WA 3R6GB 1R27B 4KY3A 2E1YA 5J2MA 2EVZA 5CYMA 2MHEA 1GMUA 3WT0A 3S3NA 3P5BP 3I8DA 4JV5K 3I4HX 4GW6A 2MZ1A 5D0RA 2I7NA 2FY1A 4JV5J 2P2CB 4ZS6A 3UN5A 4ID1A 2F8TA 2MLZA 5AJ3F 4E3SA 4Z4CA 1RT5A 3PTWA 2YNIA 2E44A 1JWWA 4LIWA 3LGNA 3I5AA 2AV5A 4A8SA 1YK9A 4JBCA 3V1RA 1RILA 2BOPA 4IUFA 3ULEB 2XZDB 1RCHA 3KKSA 1NNDA 4ED0A 4CWBA 1OVYA 3I5BA 3R97A 5KT6A 1DQ9A 3LM2A 4ECUA 3H20A 1D9DA 5C42A 1NWKA 1VQ5N 3QT6A 4JAXA 2Z2MA 4LF9F 3QFWA 1IKVB 2CPJA 1MWZA 3H2LA 2E66A 1ZBHA 2Y9HA 2VV5A 2Y1JA 3OR1A 3HL8A 3BKUA 3UE2A 2GAHC 4KB7A 1UVLA 1I3AA 3L0QA 4XH4A 1K6YA 4OYIA 3E01A 2RAQA 2ZH1A 3P4UB 4BRIA 1Q86O 2R9LA 1F9EB 5HANA 4ECRA 4EYHB 5DDRC 1NSKL 5LMNF 3UN2A 2HIYA 3I55S 3OR1B 4I7FB 5HRSA 3NBPA 3ZTRA 3UN3A 4NX9A 3B4DA 4WTOB 3V9WA 4KAZA 2P9LB 2HFZA 1FKPB 4LD0A 2E8AA 2E1PA 4I6MB 3CXCM 1RT5B 3CUNA 3R27A 1BHNA 3TR5A 5CYMB 1NAQA 4CEZA 3RJMB 2ZVSA 3MR7A 1SUQB 2E4LA 1QLNA 3CCJS 3JXUA 1QAXA 4MLHA 3SMSA 4MK8A 4WBFA 2HBYB 2OPRB 1EKRA 1BO5O 4JS4A 2DGWA 4HL9A 4NLPA 4IDHA 5KFNA 2XLIA 2O8DB 2X7IA 4B3RF 2HHPA 3TQEA 3H46O 3RVCA 3U1NA 4CFBA 1HBNA 3E8OA 4ES1A 2MLYA 3W0LA 4FJXA 4JI8J 4XPCA 2O8BA 4F26A 3SLCA 4JK7A 3MX5A 3NF6A 4FVCA 3N6NA 3KG4A 1RAIB 3W1YC 4FWQA 2B8PA 2PE8A 1KVJA 4B9SA 3GSDA 2ZH3A 3LM9A 4DR2F 4LF2A 3W9JA 1AB8A 3R7NB 2K1RA 1MMDA 3F44A 2NRZA 1YIJN 3A5OC 4WZQA 3L4QA 3NF9A 1CJTA 4AUKA 2POKA 2V52B 1SH3A 2X1GA 3AA5X 4C8LA 2P9LA 1VSEA 2P9SA 3HT0A 3PYEA 5C25A 3J7YP 4FPAA 4DZ6A 1E3MA 3ZZYA 4QQBA 2VD3A 2J7KA 5KFWA 4TYAA 4Y0WA 1RT4B 3FEXB 1I39A 2A5XA 2BOAA 1U8WA 3H5SA 5AQXA 3GTYX 3VAKA 3AO2A 3G6XA 3PYFA 3Q0AA 2HNYA 1NSPA 1TGOA 4N41A 1N32F 4HCCA 2ETJA 1U09A 1X60A 2E6LA 2VPWB 4KB1A 3DRPB 2ZH4A 3ENHA 5BRDA 3VAIA 5IV3A 1XN9A 4YOVA 8AT1B 2A6AA 3J7AP 3KJFB 2LA6A 4V19J 4W98A 3GV7B 1SAZA 1H72C 2QLBB 1TUVA 4ZP8A 5B08A 5LMNJ 3N5BA 2UUTA 3MECB 4DBQA 4PEOA 1N33J 3T19A 2MKYA 5HBMB 3I32A 5E2QA 1RCXB 3R1LA 3GJTB 4E8UA 5MLCV 1DTTA 2QYGA 3PLAA 3BPSP 4WQ4A 1FNXH 1VQKS 4RG8A 3SCLE 4QYZK 3L7OA 1KWMA 5AQIA 2AHOB 5D8HB 5AXKA 3MR6A 1JLAB 4CO4A 2FYXA 5DQHA 3R9PA 2ASMA 5FDLA 2LECA 1HNWF 1HQ2A 4NYPA 3QGGA 1RWMB 2YNGA 3LUYA 1S1WA 3HSDA 4F0KA 4F02A 3MM9B 4YB1P 4F0HA 1KAXA 2GMJA 2WB1D 2LSNA 4U9RA 2B9YA 2W8KA 4KI6A 4O55A 2YKMB 3KDNA 2UZAA 2O8FB 2UXBK 1D8ZA 3M2RA 1QHAA 4RLEA 2BX6A 3ZETB 2WSCC 4PL8A 3UD4P 2JEJA 3C16B 1D09B 2FVPA 3LA0A 1G2EA 2FUG9 3SQ0A 4CLFA 1BXNA 3HZGA 1VBYA 1JLBA 4WIIA 2RRBA 1ZYQA 2CPEA 4R5PB 2DCLA 4NEYA 4E7IA 2MKSA 1HPZB 1WUUA 1MSWD 4DV7F 3M05A 4WJBA 3K0JA 4X65K 4Y28C 3MTKA 2J4RA 1TR0A 2P5GA 1VQ7S 4I2PA 4X62K 2H3GX 1HIYA 3Q8SB 2ZM6J 4DUYJ 4HT5A 2JRSA 4IYQA 3GG1A 4DTPA 4B3SJ 2H5JB 4XTTA 1FJGJ 4WYWA 4L73A 1P90A 2F7TA 3PW0A 2O3DA 2O8CB 3HHEA 2UXCF 1IJJA 4PYAA 1RXOB 5ETSA 4H0OA 4USWA 3VQ4A 3EGNA 2NXCA 4CH0S 3QZ7A 2MB0B 3DLEB 4AF1A 3MMBB 2XSFA 1WORA 3THXB 4K0KK 1B0VA 1U8SA 1RBSA 3MCMA 4OX8A 3KIOA 3HX9A 5AR0A 4PG4A 1Q8IA 4ECXA 4JI1F 4CIEA 3BB5A 1H2VZ 4XH5A 4CGDA 2DFHA 4A48A 2NXEA 2C3PA 4KHRA 2DNHA 5L9XA 4FJGA 3R6MA 2QLWA 3AY0A 5KT5A 4NLWA 1HWJA 4K4YA 3ZZ0A 1IR1A 2CQIA 4LRCA 4K4WA 3NKYA 4I6MA 3DCAA 1RACB 3OA9A 3F56A 2XI2A 1NZAA 3FZ2A 1VQ8N 3HFVA 3EE8A 5IT9O 4CDIA 4UW2A 4RW7A 5B0FA 3MMCA 3RBEA 1T8EA 3MN5A 2QTWA 2V2ZA 3CJSA 2JOQA 4EFAC 1QTNB 3IO1A 4F25A 3OSNA 2AF6A 1O5JA 1PO6A 4BWJA 4AM7A 2C1EB 5LSOA 2G0CA 1KC8O 3IRWP 1PAUB 2DY1A 2QYCA 1OKJA 3CFRA 1DZ5A 4O3PA 1ESVA 2CH6A 3P83D 3CC7N 4ECZA 3QJLA 2IM2A 2IRXA 4G1QB 2ZWPA 2C2ZB 2G0IA 5F0WA 2Z2LA 4NOHA 2HBQB 4KHUA 5E0OA 2MJUA 4OPHA 2QC3A 3C6UA 3RMAA 5IT9Y 3FBFA 2D0CA 1VQLN 1S1XB 3G4SN 4IOCQ 4LF5F 3TZWA 3D6HB 3N4WA 2FVSA 1N5QA 4EIAA 2IRYA 1AZSA 2MXYA 1OIAA 1T02A 3R8EA 3KUGA 2P6SA 4K4ZA 3EN9A 3KLEA 3KG1A 3BF1A 4ANDA 3ZT3A 1HWLA 2MQ8A 3EL2A 1NUEA 3D0GE 1YJNS 2YVSA 4U7UK 4FXVA 4M8LA 4KH6A 3DGPB 1FXDA 1F3VA 2Q3PA 3PV8A 3DMJA 4F67A 3BBCA 1FRIA 1G99A 3ZTPA 4CJVA 3TAFA 5K5MA 4XPEA 5DZ7A 3VTIA 4KT0C 4DB3A 2C3MA 5SUHA 3BGRB 2QK9A 1DY3A 1NPPA 3BY5A 2ROGA 2FZKB 2G8WA 3QT8A 4HWIA 1RWPB 3UI3A 1S6UA 2MKHA 2HGMA 2C2DA 1JJHA 1LXNA 3NWGA 1QQCA 2ZZMA 5LXRA 2FLLA 3IGVA 2CWKA 3GE1A 4PA1A 4WYLA 4IEEA 1S77D 3ZYYX 3GYXB 3VQAA 1RAJA 4CZHA 2DEJA 3P1GA 4AHTA 3ENOA 2EK1A 4KH5A 3RGIA 2HNZB 2GIFA 4W5RA 1S0NA 4J9UE 4JRPA 2DR6A 3ENWA 1AYEA 3H7HB 4CM0A 5KPTA 4OJGA 4YN3B 3DRSA 1GFWB 4DTRA 1C1AA 2ZJQQ 3UIQA 3VQ6A 4CK3A 4AE5A 1U45A 2HLUA 1F1BB 1OYDA 5ADXH 1P9YA 5AQZA 1BCOA 2HZAA 2U2FA 4J9QA 3H2UB 1GLFO 3PM9A 2D3O1 9ATCB 3VGUA 3T5JA 1OY6A 2W42A 3HPGA 1U2VB 2ZM6F 5CHIA 1MU2A 5M1OA 2PI4A 4DDFA 2A1BA 3THTA 4FS1A 2LQ9A 2UXCK 1S9GA 3SUPA 2AZ3A 2J9DE 2RS2A 1S6OA 1Z2LA 3G82B 2YKPA 1YUWA 1RP5A 4H4KC 2VFSA 4YP3A 4WXWA 2YX1A 3H1VX 3C6TB 4FLZA 2CQ2A 4BQLA 1MU2B 3TA0A 4FWOA 1HI0P 2P5OA 1RDUA 2Q2RA 3L4IA 4NO7A 3WNEA 1S9GB 3TZZA 5BYRA 3DLKA 1WG5A 3LDLA 3KMQA 3AA3A 1SQGA 3NF7A 2RUSA 4NLQA 3JYTA 2YQ1A 2B43A 5F0UA 4DS4A 5D4PA 4YUDA 2B7CB 3J81O 2HHHK 2GQ2A 2BRKA 4DPWA 3VAGA 2DIVA 4DF4A 2FLNA 1JL2A 4UQTA 2ASDA 2V7ZA 3WQPA 3RG6A