2ZM6K

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
total genus 24
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2zm6K00
4JYAK 4DR3K 4LF9K 4B3SK 4X64K 2UUCK 3J80O 4JI3K 4JI5K 5A2QO 2UUAK 4X62K 2E5LK 4DR4K 3T1HK 4JI0K 2VQFK 4AQYK 1N36K 4GKKK 4DV2K 4DV3K 4DUZK 4X66K 5BR8K 1I94K 4DR2K 4JI4K 3JAMO 4OX9K 3J7YP 4DUYK 1XNQK 4LF4K 2ZM6K 4LFBK 1IBKK 4DV0K 4B3RK 5FLXO 4DV7K 4DV5K 4DR5K 4JI7K 4LF6K 2UXCK 5IT9O 1IBLK 4DR1K 4CW7B 4V19S 1HNZK 4B3MK 3OTOK 4DR7K 4K0KK 4LF8K 1HNWK 4JI6K 4CVNE 4NXMK 1N33K 4JI1K 4DV6K 4LF5K 4LFAK 3T1YK 1XMQK 5IWAK 4JI2K 1J5EK 5LMUK 4JI8K 2F4VK 2UUBK 5AJ3K 1XNRK 4YY3K 1N34K 1N32K 5LMNK 4JV5K 5LL6Z 1HNXK 4X65K 4NXNK 2UU9K 4LFCK 4GKJK 1FJGK 4B3TK 2HHHK 3J7AP 2VQEK 4DV4K 4LF7K 3J81O 1IBMK 1XMOK 2UXDK 2UXBK 4DR6K 4KHPK 4YHHK 4DV1K 1HR0K
chains in the Genus database with same CATH superfamily
4CIGA 2BE2A 4PKGA 4BR9A 2LSNA 3V1OA 4CF1A 3QIOA 3VGMA 4CD3A 4X64K 3AO3A 3L4QA 3SPZA 4CGHA 1I3AA 3MCAB 1JCEA 2I5JA 3AGRA 3EKUA 5C0YA 4JAXA 2WTUA 4AHVA 1VQ9N 3M1FA 1IKYA 4JEPA 4CJ4A 4HHTA 3MEEA 3H46O 3LM9A 4DMNA 2HHQA 5AQSA 1N36K 4GKKK 2ZWHA 5HOOA 4DV2K 4DV3K 3CFOA 1GLEG 3LDLA 5FPDA 2FBTA 3U6FA 4DU1A 4DB3A 1BWFO 2WUSA 3QEIA 2BUPA 4IG3A 1SL2A 4NLCA 3U3GA 4CJWA 3I55N 4O0IA 2Y1JA 4OO1J 3HZ6A 1YTAA 3DYAA 4I2QA 4DSIA 4BR5A 2ZGYA 1SV5A 4CE9A 4FJ7A 4LF6K 3UKUB 5JS2A 3HI0A 1TL3A 1HUXA 1U45A 1IKXA 2ZD1A 1BIZA 4RW4A 1NGAA 3K5NA 4FJXA 3TTCA 4BWJA 3OYEA 4A59A 4CF0A 5E41A 3IAYA 4JHDA 1VK0A 3TAQA 2VWBA 3GOIA 3ZSZA 1KVBA 2FF3B 3G25A 4BGAA 1YI2N 1N32K 3DJCA 4CZHA 4FLVA 1OH7A 1C1AA 2GBZA 1TK5A 3THYB 5AQHA 1C0GA 3A5OC 3HO1A 2ZQBA 1S1VA 4H8KA 3VPZA 3ZT1A 3CM6A 3SAHA 2BH1A 3S9HA 1HPMA 3A0IX 1TKXA 3FZLA 1GLCG 5BN8A 1DTTA 2HBJA 4QAGA 4DV4K 3AA2A 3BUZB 5JVGL 2FSJA 2O4GA 3TI0A 2A40A 2IVNA 3R9PA 1NJIO 2A3ZA 4WE1A 4L3QA 1RDCA 3AVHA 3WT0A 4CF9A 3OYIA 1GLAG 1WAFA 4DTMA 5KQ8A 3JXUA 3LAMA 5GAHP 3VENA 1OVQA 4E3SA 2O8DA 3BEXA 4KREA 4H0TB 4LD0A 3MXIA 2HNZA 2P9PA 2HHVA 3CQ8A 1JLEA 2H3GX 4B1WB 3HXMA 3O1WA 1EO1A 1J54A 4WYBA 2D0PA 3SK3A 3M6GA 3SJJA 3VEWA 3SUNA 5KI6A 4BRIA 4OJRA 1VQ7N 2FBVA 1S9GA 4KB1A 1ZYQA 4M45A 5C10A 4RTFD 2IVPA 1SZ2A 1WBBA 1K8KB 1OKJA 1WOQA 5BN9A 5FLXO 3F9MA 4E7LA 4DR5K 4CJTA 4N76A 3CCSN 2HHXA 1A5VA 4G9ZA 3AV9A 3WNGA 1QHAA 3AO2A 4KH4A 1QSLA 4F9OA 3NAEA 4I7FA 5J2QA 3VN5A 2GV9A 1HNWK 2FC0A 1JXEA 3A5NC 4A2BA 5IWAK 1W97L 1LOTB 3LANA 3VQPA 3SBGA 4DTXA 3WNEA 2E8AA 4KHYA 4KHQA 4MLHA 2XY6A 5KPTA 5CHIA 4JN4A 2QA4N 1GLDG 4GV9A 4F2RA 1O13A 4KPYA 1A5XA 5E84A 1LWEA 2O8CA 4CZMA 3O9UA 3MWPA 4DU4A 4E1MA 3LDOA 2HMIA 1X3NA 2QWRA 3K57A 4UQGA 1S6QA 1DGKN 4CFCA 3VQ5A 3SUQA 2FLOA 1HR0K 2ZJRL 1WB9A 3V9WA 2F8SA 2X78A 4JKGA 3VQ7A 3KLGA 1RGIA 2VWJA 2UUCK 1XI1A 3MDQA 4FK4A 5D3GA 2ASOA 3SV3A 1RT3A 1XHZA 4GVEA 3PX6A 1Q9YA 3QETA 3LPUA 2OZSA 2YCHA 4BC3A 4RW8A 4E7KA 2O8DB 5EX5A 1NM1A 2WONA 3K59A 1VQNN 4DQRA 3KD1E 2YHWA 2P9PB 4DR2K 3O6WA 4KHNA 2OANA 1WN7A 1D8YA 3QEWA 1ZBLA 1NOYA 1LWFA 4MO5A 4BQZA 2IVOA 5GAGP 5JMVA 3ISNC 1M90O 3ZSVA 1VSHA 3AA4A 4HCBA 3VF6A 4OVLA 4CGDA 1RDAA 4JI7K 4BRGA 4OLAA 5C24A 1BGXT 5IT9O 1ATRA 3ENBA 3OJUA 4FW1A 4DFJA 3JYTA 4PQUA 4BC4A 3DLHA 2QKBA 4KI6A 1N33K 3UE5A 4F3TA 1OVYA 2CH5A 2XO7A 1D9DA 3N4QA 3M8PA 5JLFA 3P5JA 3MXMA 2Q1NA 1ASVA 1C1BA 5C42A 3L2VA 4CHQA 2I7NA 2UUBK 1U04A 3HP9A 3AARA 3IKMA 4GW6A 2O8EA 4BG9A 1T44A 1EQYA 1ZBHA 4QS7A 3HOSA 3CETA 2NLXA 3ITHA 2KKZA 4TSXA 4FJ5A 3NF6A 4Z4GA 3CJBA 4CEAA 1IBMK 2O8CB 2HNDA 1EWRA 3DLBA 4DHYA 1HYVA 4RW9A 3RRGA 3V81A 3CXCM 4HVJA 3R8EA 4ZTJA 1DEJA 4JKAA 3P39A 3U3YA 4BE1A 1TAUA 3L2WA 1BISA 3L0QA 4FLWA 2V7YA 2O4IA 3BGRA 4DU3A 3OYBA 4I9QA 5HLFA 2BGGA 3BF1A 4H5NA 3A8YA 1SS6A 1L3SA 1RILA 3TTFA 3LL3A 4AILC 1QS4A 3VEXA 4DQQA 4JD2A 3C6HA 3D2FA 4CJRA 3QEVA 1GLJO 1VQKN 4W5NA 4KHUA 4Q5VA 3NF7A 5AQQA 3OA9A 1HNVA 3KIOA 1Z26A 3LP1A 2PFUA 3U9ZA 3B8AX 3DRSA 3KK3A 4JK9A 3F9KA 4Z4IA 3DWLA 3VQQA 4FLZA 4NLBA 2DPNA 1XWLA 4CZJA 1KCFA 4FOIA 1ATSA 3VEYA 4QOZB 3KKSA 1RT4A 3THWA 3ZT4A 1WSGA 4FOEA 4J2EA 4XEIA 1QVGM 2JWKA 4FJ8A 2QKKA 4KFBA 3DOLA 1NKCA 2G8HA 3BF3A 1HLUA 4E19A 1O1WA 4LY7A 4NXMK 3AA5X 2OA8A 3E1YA 3HYFA 4LFAK 1QSSA 3BY5A 3VETA 1NGCA 3FFIA 1QZ6A 4BY9C 3JS6A 3M8RA 1KAYA 1K73O 3KK7A 3H3NO 1OH8A 3D6RA 3AVIA 3F73A 1U4BA 3OYGA 5GIPA 3RRHA 2O8EB 4FJGA 3C65A 3ULDA 4PHTX 1VQON 3MCPA 5KPRA 3WXKA 3WNHA 2ZGZA 4CHNA 3OYNA 4I6MA 4HUFA 4GV3A 3EE9A 3RMAA 4ISFA 3O8MA 3MEDA 4H4OA 3NH1A 3R1XA 4CEZA 3MN6A 3J80O 4DFMA 1LCUA 2VCPA 3MMVA 1ZBSA 4C8OA 5AQFA 2YHXA 2G8VA 4LSLA 1KAXA 1S72N 1SAZA 1ZBUA 4K8ZA 2YKNA 1UA0A 1R0AA 3ZT0A 2NRTA 3T3FA 1T03A 1VRTA 4KTZA 5BREA 2EX3A 3AVGA 3I8BA 3O9SA 4BRAA 4LC9B 4DTSA 2G8FA 1NLVA 4JD2B 3RMBA 2GTDA 4BR0A 4DUYK 3D2FB 4MO4A 3RMDA 3TSUA 1TK8A 3QICA 3AVFA 1YXQA 5HL7L 3FZMA 4CJUA 4LSNA 2DTUA 5ADXH 4FLUA 1HJOA 3T19A 4WQ4C 4WQ5A 3IUCA 3OYHA 3KZBA 1XC3A 4C8NA 1VQ4N 1RTHA 4FJNA 1BOTO 4DFPA 3P1GA 2WOMA 3PUFA 1CZ9A 3VEOA 3AVAA 5HRRA 3LM2A 4M41A 4CJFA 3QEPA 4M3XA 2F9TA 4GY2B 1VQPN 4FWPA 4O0JA 3VQ4A 3OYCA 3IFRA 1JL2A 2E2PA 2P5GA 5J2PA 2OPPA 1ITGA 4YOTA 4J2DA 3ID6A 3DLGA 4GKJK 4ELVA 1NMDA 4CFBA 3WNFA 3OBYA 4KBOA 1JLQA 2ETJA 3IDHA 3J7AP 1ESVA 2AJQA 4ELUA 3G4SN 1U49A 2WBNA 4LF7K 1HPZA 1MA9B 4YOVA 1WAJA 4YHHK 4AHCA 2ZE2A 4CI6A 1B9FA 4DR3K 3GG4A 4I6MB 3HSTB 1TKTA 4M7YA 4BG8A 4RW6A 4O8KA 4E89A 2A6AA 1VSFA 4DWIA 3SUOA 5BR9A 4DR4K 1DTQA 3K0SA 1SKRA 4FXDA 3MECA 1HRHA 1NJYA 1JXBA 1VQ5N 1WSFA 3VQDA 4GMJB 4FJMA 4J2BA 4OKKA 5I9EB 2G8IA 3K58A 5M1PA 3CMAN 2HVHA 4DQ8A 4BWMA 4NCBA 3ZX2A 4H5VA 4BR7A 4FJJA 3V9XA 4W5TA 3C6TA 5C15A 4L8RB 3R6MA 4JKEA 4JNEA 4JLHA 3ZSRA 1J53A 1W7AA 4E7IA 4B1ZA 1NNEA 3D7EO 3NF9A 4MDBA 3HOTA 1EETA 4OKJA 4DQIA 2B5JA 3DLRA 5CYQA 1KLMA 3HTVA 2F96A 1Z6RA 2HBKA 3DRPA 5AFUH 2VWKA 3DM2A 2O8BA 4U7BA 3NH0A 1IJJA 1R59O 3ZEUB 5CZ2A 4B08A 3VA3A 1YJNN 1CLQA 4CZEA 3KLHA 1JLCA 4O4GA 4A5BA 4NXNK 3EZWA 4HCCA 3FZKA 3H08A 3O3FA 3EEQA 1CXUA 2Z1GA 4IDKA 5GAEP 2Q36A 4B9NA 4B3TK 1T3VA 3DXKA 4OGEA 3CCMN 3NGYA 3OVNA 4B1YB 3V4IA 4AF1A 2W40A 3OY9A 3TWHA 3C6AA 2ZF5O 5DM7L 4M3TA 1C1CA 1BI4A 1C0FA 3A5LC 3LWLA 5AQKA 4GVMA 3LDQA 4CZGA 3SMSA 3AVKA 2UUAK 1RCHA 1TUUA 3BP8A 1QVFM 3JSMA 4CHYA 4N41A 3ZSXA 2G8UA 4IOCL 4JI0K 1WUAA 4IJAA 3D45A 2GX9A 3I8DA 4JKDA 3D2EA 1S1WA 1RBRA 2E2OA 2FXUA 2PYLA 4MFBA 4FWNA 4EHTA 3IMXA 3L4IA 1NU0A 4NYNA 1MU2A 1JLAA 4B8AB 4DKWA 3SUPA 1JKHA 1TVRA 3OYMA 4FWMA 2P9KA 4FJ9A 1N5YA 1VSDA 1QE1A 5AQNA 2GEMA 3CQXA 3LWMA 1WSHA 1MWKA 4MDAA 4C8MA 1Q86O 3CF5L 2ASPA 5CY4A 3DMJA 2W6KA 3DLEA 3SPYA 3OTOK 4B9TA 3CCUN 3SBTA 1NOZA 4M3WA 2PAVA 4IO8A 5EXWA 3U9DA 2KZMA 3QBXA 4DSJA 5K14A 4C1NI 3T1YK 1HKGA 3ZETA 4BRNA 2YNHA 1DLOA 4ILJA 1L5UA 3I0SA 5MLCQ 4E7HA 1WNSA 4B9MA 4M42A 2D0AA 4IFYA 1P90A 3RWUA 3TU5A 1TGOA 4EZ9A 3KKRA 2CGLA 4ISEA 4X65K 5C12A 1RDDA 3W3DA 2UU9K 3HT3A 1UWBA 4E7JA 5EVZA 3VOVA 4YDUA 4NCGA 3BZCA 3HPOA 5I3UA 1GOAA 3I56N 3CIPA 1NG9A 3H6EA 3MX5A 3LP2A 2NNWA 5HP1A 4CEEA 4DR6K 3HP6A 5AQGA 4FJKA 1NGEA 4EIAA 4IXCA 3DLLL 3QMLA 3VQEA 1C0MA 2HB5A 4KTWA 5EY4A 4LF9K 1QQCA 1HYZA 4JHDB 2PY5A 3M8QA 3EKSA 4JI5K 1KSPA 3E9LA 4K25A 4DF4A 4NCAA 2F9WA 4C23A 1BI4B 1W0HA 1K6YA 2VQFK 1H1VA 2B6AA 1S1XA 4JK7A 1F21A 3AGKA 3O08A 3CFRA 4FK0A 3G0ZA 4DG1A 4F4KA 4FWLA 4HUGA 4F3OA 3AVMA 3FGUA 1YHQN 3SQ2A 5BR8K 5AQXA 2EHGA 3D2EB 4KRFA 2O8FA 4FM0A 4KV8A 4Z94A 3C7NA 4CFAA 2P1JA 3QO9A 2V51B 4AH9A 4B1XB 3ZSQA 3LAKA 1K9MO 5M1KA 4DV7K 5J2MA 1LAWA 3KWGA 4DLEA 4OKEA 3C95A 4WF9L 2P9KB 1XC9A 2JGUA 1Z25A 1IBLK 4DR1K 3HPHA 1XUPO 4V19S 1YJWN 3TARA 4W5RA 3OJSA 4EZ6A 1L3UA 5HRNA 4CJQA 3VQBA 2ASMA 3H1QA 2E6MA 4IKFA 2QW9A 1BA0A 3C6UA 4CECA 2VG5A 2Q31A 5FPMA 3ULEA 2ITGA 3ZYYX 4CFDA 5LMUK 4DS4A 4G1QA 1T05A 4DLGA 4H0XB 1OH5A 4KO0A 3ZETB 1E4GT 3OYKA 2GUPA 1RT6A 4M3ZA 3RSEA 1QHTA 2YJEA 3GBTA 4M7XA 3KVGA 4JS4A 1KRPA 2VGNA 4Q0BA 3QERA 2NRHA 3AO4A 1BIUA 4MQ3A 4O5BA 3VQ8A 4WCEL 4FVMA 1VSEA 3FLCO 4IEEA 4CESA 3J81O 1S3XA 2QWNA 1XMOK 3FZHA 4KHPK 4Z4HA 1BL3A 4IZ9A 1L3VA 3SQ0A 2HW3A 2HF3A 4LH4A 2QK9A 5E26A 4B9QA 3DI6A 4CJ7A 2Q0RA 4FWOA 3ZLJA 4FYDA 3ATVA 5AQWA 4BRQA 3FFKB 1S1TA 4KHWA 3QLHA 4IFEA 3CJCA 5M1FA 5A2QO 3O5BA 4KTQA 3CQYA 3U8XA 2D0OA 1FXXA 2OZMA 2CGKA 1WSEA 4KH6A 2P9LA 1KFSA 1RFQA 3S3MA 4M3RA 5FROA 1Q81O 3P83D 2KFNA 4FLXA 4XH4A 1E3MA 5CR4A 3RTVA 1QQMA 2X6SA 3LZJA 2HSTA 1NK9A 1LV5A 2OPQA 1KVAA 3JAMO 3KK1A 4CZFA 4BACA 3VQ9A 2ZM6K 1YVUA 1IBKK 4ZHRA 4JKGB 1NJXA 1JLFA 4FL9A 3C7NB 4B1VA 4DV5K 1BUPA 1FKOA 2RN2A 2P9UA 3SNNA 3SV4A 4CCHA 5FPNA 4B8CA 3M8SA 4FLYA 4CJEA 3CYMA 3SQ1A 3CFPA 1VSIA 1KXPA 5DMRA 4DF8A 3SI6A 1RBUA 3DAWA 2A41A 3TTDA 4ELTA 5CE3A 4LF5K 3O80A 3AY9A 4IFVA 3AAQA 5C2DA 2P9IA 1QZ5A 3OYDA 3KTQA 3VTHA 1SUQA 3CPWM 1C6VA 3ULEB 4XH1A 1TL1A 1Y64A 5LMNK 5AQTA 3B6OA 5LL6Z 5KTQA 1G15A 2YI1A 3ZT3A 4FZXC 4ICLA 3OBWA 3ZX3A 2QI2A 4WFBL 4F8RA 4FWQA 4CGJA 3T69A 4QS8A 3RSEB 4BR2A 3H45C 2DY4A 2I7PA 1J5OA 1UA1A 1RT2A 1C0TA 3FZFA 5BRDA 4HUEA 4DS5A 1D9FA 3PO4A 4FPAA 3HSCA 4PKIA 1T7PA 4CJ3A 4CEQA 4CIFA 3CJ1A 4BDZA 2BANA 4Y1CA 3QNNA 3MN9A 3V6DA 3ZX0A 4YOUA 3CCEN 4DSLA 1KVCA 3CCJN 4ZTFA 2E2QA 1Q18A 2FBXA 2FBYA 3E9OA 3E01A 4FLTA 4ILHA 1BQMA 4BGBA 3UIQA 1VQ8N 1BCMA 5KGXA 4J8FA 3RVCA 3QEXA 4IOAL 4IDHA 1RT5A 5LJVA 3EL2A 2DFHA 2HF4A 5AZIA 3M5RA 4A57A 3CERA 3DXMA 5FDLA 2P9LB 4CF2A 3TR8A 1GOBA 1VRUA 3QFUA 3TAMA 3J7YP 1S22A 4DQSA 5BRFA 2D4WA 2BDPA 2UYTA 3HM9A 4PUOA 1BDGA 1E4FT 4N56A 4FZZA 1X9MA 1NK4A 1NK8A 2HHSA 1NGBA 2QWLA 1RBSA 1K8AO 1RTDA 4KKOA 3PV8A 1NK6A 4EP5A 4K0KK 3MEGA 2P9UB 4LF8K 2ZJQL 4CHPA 4AHRA 1X9SA 1RDBA 3C94A 3ZT2A 4CIEA 2HBMA 2Z1HA 2IIRA 4N5SA 4WQ4A 2IC3A 4JI2K 3V9ZA 1RTIA 1QQOA 3KLIA 3OYJA 2HNYA 2F4VK 2NRRA 1FW6A 4IO9L 3A2FA 3SLCA 3AVLA 4DTNA 1KFDA 3DLKA 3CC2N 2P9IB 5EU7A 2KW4A 2X6NA 3THWB 3M3ZA 1BHLA 1SL1A 5FRNA 3SJHA 5AR0A 1TYQA 2DFFA 4AHUA 2GUIA 4CGIA 4HTUA 1U6ZA 4DTPA 1FJGK 1U48A 3T7ZA 1TKZA 3K9KA 4CJLA 2Q97A 2YNGA 3VF4A 1JLGA 4HWIA 2G8KA 5LJWA 3IRXA 2YNIA 3KLEA 2KQ2A 4ISGA 1WSJA 2NUBA 3THVA 1JL1A 5DK5A 3PSFA 2E6LA 4B3SK 3WQTA 4RG8A 4IEIA 4QS9A 2RE2A 4BRCA 1HJRA 1IG8A 3LALA 4YOYA 3UKUA 4FM2A 3LDPA 5HROA 2HMPA 3CD6N 1C0UA 1V4TA 1VSMA 1IV0A 2CGJA 3HPGA 1YUWA 5HBMA 2B4JA 4H0PA 2RF2A 3EY1A 1Q82O 3VQAA 3CC7N 1S1UA 2D0CA 4FWSA 4Y1DA 3S3OA 5F1XA 1EP4A 3LDNA 2NRVA 3V1QA 4J2AA 3DXMB 4LFBK 4EAHD 2NRWA 1D5AA 4JRQA 4W5QA 2OYQA 4FK2A 3QINA 2YV0X 3LP3A 2XY5A 1Q7YO 3TABA 4DSFA 3THYA 3BZKA 1KD1O 1KTQA 2QM1A 2HOEA 4B3MK 4ID1A 4DR7K 2YJFA 1W9HA 1NMNA 2AA4A 2A1SA 2VYPA 3AO1A 3U4LA 4BRMA 5TKWA 4RWTA 5I42A 4JI6K 4CVNE 1HQUA 1NK0A 4FJHA 3VTIA 3CCQN 4JI1K 4DV6K 4OLBA 1S5JA 3NBPA 1YITN 4JI8K 4C8LA 3L2QA 4CBXA 2OTJN 2QEXN 5AJ3K 4JKFA 3O4WA 1XNRK 4FWRA 5AQLA 1N34K 1VQMN 1J6ZA 4RW7A 1WLJA 2ZJPL 4E1NA 4IBNA 4KI4A 4CHOA 1JLBA 3FR0A 1SKSA 4ILGB 3WUHA 3CJ9A 2YHBA 3SCXA 3ALYA 1TYQB 1EWQA 4FO0A 3CC4N 1TUYA 4BRFA 4DV1K 4B9SA 4CHZA 3K9JA 4PKHA 2BTFA 3NF8A 4JYAK 1NK7A 1KLNA 3I33A 1REVA 3LPTA 3TSPA 1K8KA 1Q8IA 4JI3K 2D1KA 3L2UA 4KB0A 2XY8A 2XRIA 4R79A 5F0XA 3O1BA 3PIPL 4BRDA 2OPSA 2P51A 4AQYK 5DM6L 5AQRA 4NYFA 1U47A 2PZSA 4DSKA 4A5AA 1T6DA 5KQDA 4H0OA 1BCOA 3OS2A 3LP0A 4K8XA 3AO5A 3NE6A 1ASUA 2QWPA 4RCHA 1Y97A 3O4NA 2IGIA 3WXLA 2D5RA 1N6QA 3LDSA 4BE2A 4W5OA 3OYFA 1BQNA 4CJSA 4DV0K 3EYZA 1J9AA 2F7TA 3RMCA 2GELA 1V4SA 1NKBA 1YF5L 2KTQA 2RHKA 3AVCA 3LZIA 3VQCA 1HQEA 4BRPA 4B9UA 4WFNL 1TV6A 2V7ZA 2IOCA 3O3HA 1XQSC 2OTLN 2D0BA 4I9LA 1QQNA 4DTUA 2PBDA 3S41A 1RT1A 2X74A 1MDUB 1QTMA 3NVMA 4CZKA 2F8TA 1YAGA 1J5EK 4E1JA 5GINA 1CZAN 4PWDA 3ZSYA 4FJLA 3L2RA 1NGDA 2QTDA 3VGLA 4BC2A 3SMPA 3IS9A 4AM6A 1HNXK 5AQJA 2P5OA 5M1OA 1JJ2M 5CZ1A 1X1PA 4FJIA 1TK0A 3OS0A 1RBVA 3PY8A 5F2RA 2HHHK 4DCHA 3UB5A 1IG9A 2UXBK 3CMEN 4BRHA 5GADP 3L3UA 4H0VB 3O9QA 4FSVA 3ID8A 1DKGD 4EP4A 5ADXA 4UY8O 3GL1A 2O8BB 3K5OA 1FKPA 3P4IA 3KK2A 1T6CA 4OPHA 4CK1A 5JICA 3ENHA 3L3VA 2E1ZA 1YJ9N 2YNFA 2VG6A 1NGFA 2JWLA 3VESA 4JRPA 4CBUA 2KZZA 3NVKA 1BO5O 4BRKA 1ILYA 3BDPA 4Z0UA 4NB4A 4DTRA 5AQUA 3DXKB 4OPAA 1I94K 3NHGA 4QCLA 3Q7CA 3OYAA 2FSKA 4OX9K 1Z05A 5TKYA 2W42A 4Z4EA 4IWVA 4B3RK 2V52B 4M63C 2QWQA 4YDUC 2DFEA 3IG1A 3UKRA 3Q7BA 3TAGA 4CW7B 1NK5A 3L6QA 1EXQA 3NFAA 3KHYA 2YX6A 5AZJA 5AQVA 4PA1A 2IAJA 4AM7A 3V1RA 4C1NK 5JVHL 4BRLA 1XMQK 3ZSOA 1RDUA 1YVNA 2E4LA 2FF6A 1IKWA 2Z1IA 2OCEA 2NRXA 4U67L 3O9RA 4BREA 2P9NA 3CM5A 4OPJA 5HRSA 1KC8O 3WQUA 4CBWA 1WBDA 3O4QA 5FPEA 3MN7A 2W6LA 1NGGA 1VQLN 4LFCK 1SQKA 2G8WA 3MXJA 2P9SA 3V9SA 1X3MA 1TKDA 3ZCMA 1ZBFA 3A5MC 5KPZA 4YOWA 3I0RA 4YORA 1UAXA 3HL8A 3QFPA 2QWOA 4HTLA 3GE1A 5KRSA 1VSLA 3VQ6A 4BVOA 3QESA 1P8ZA 3NGZA 2VGMA 3VGKA 1HYSA 3K5LA 3NDKA 1WSIA 3F5TA 2QWMA 3C0BA 2PYJA 3KD5E 5AQOA 4CJKA 3RR7A 5AQIA 1OH6A 2E20A 3GDQA 5AFUA 3KWIA 3SAGA 1Q9XA 4FCYA 3S3NA 3G6EN 4DUZK 4PY5A 3W0LA 3CCVN 3CJAA 2A1RA 1DT9A 1ASWA 4JI4K 3WXJA 3TAFA 3CPEA 3ZSWA 3O3GA 3D0PA 2RKIA 4GNIA 4H5WA 5SZTA 4BC5A 2WC9A 2QXLA 3THXA 3OYLA 2ATQA 2Y1IA 2RPIA 4CEOA 1RNHA 2E1YA 2Q0UA 1NJZA 5J2NA 2R7YA 3PIOL 4H4MA 1NKEA 3EO3A 1GLFO 3E66A 3B6PA 4Y0WA 1SL0A 1LW2A 1NWKA 2YKMA 4I2PA 3UKRB 1D4XA 1HNIA 1CZBA 4IJNA 4XIUA 1VQ6N 1ZC6A 5C25A 3P38A 3NCIA 5M1NA 4B9VA 1TAQA 3WEEA 5AZJB 2O8FB 4CERA 1M1KO 3TSQA 5CYMA 1XHXA 3SYZA 1IH7A 1VSJA 4CEBA 4YY3K 4DFKA 1GOCA 3J8AA 3CJ7A 3NMUA 2WFBA 1JCGA 3MAQA 4KHSA 5J1EA 3SAFA 2P9NB 1UOCA 1VSKA 4CJVA 1S9EA 3QBWA 3PX4A 1VAZA 4O55A 1IO2A 1RDWX 3N4PA 2VQEK 4EFHA 3CG7A 1NJWA 2E2NA 2UXDK 3QIPA 2P9SB 2IS3A 4LH5A 2AP1A 4O44A 3AVBA 5KGWA 5FRMA 1BG3A 5GIOA 4DTOA 4C8KA 1ATNA 4FWKA 4BDYA 5BPMA 1NGIA 2GWKA 2NRZA 2Q2RA 3R3LA 1NGHA 1YTUA 4X62K 5KRTA 1HKCA 4CGFA 4EHUA 4WFAL 5JS1A 2J4RA 3HBTA 4A2AA 3HM8A 3VMFB 3H1VX 4B9LA 2ITMA 4ID5A 4X66K 3FE1A 3AA3A 4JS5A 4FPBA 4A62A 3O9TA 4H5RA 3MX2A 4MLEA 5HRPA 4BROA 4E0DA 1IKVA 1XNQK 4FM1A 4LF4K 3MK6A 1RTJA 3DOKA 3E9PA 2IDOA 3AAPA 4CJPA 3K2PA 5EOYA 3HVTA 4NO7A 2NZTA 1KQSM 4O5FA 3SZ2A 1EX4A 4H03B 3F2KA 2HHUA 4PL8A 4OPKA 3THXB 1QSYA 3G71N 4BR4A 1HNZK 1LW0A 1MWMA 3L8BA 1YIJN 4IG0A 3K5MA 3OHRA 3PX0A 3HK2A 1B92A 1FK9A 4AHTA 4CZLA 4R5PA 1X9JA 5M1QA 3VEVA 3HJFA 3DRRA 1CXQA 2YHAA 2A5XA 4OGCA 1GLLO 1ZBIA 1LAVA 1HMVA 3WEEB 4DQPA 1U2VA 4JV5K 2KLAA 4KH5A 4AHSA 1GLBG 3VEZA 1JCFA 4BQLA 3TAPA 4FVUA 4JK8A 3EZ5A 5BRHA 4H5TA 3AVJA 2Z1JA 4CF8A 4YNQA 1RT7A 5JLHA 3NH2A 2CH6A 4O8UA 1S6PA 4A61A 3CCLN 4CEDA 2KHOA 4YFUA 3EN9A 2HHWA 1BU6O 5AQPA 1YT3A 1RBTA 2E5LK 3PLAA 3V9UA 1HKBA 1KAZA 2KFZA 4CK2A 3T1HK 3G10A 4K41A 5H1SQ 3NGIA 2JLEA 5AQMA 4K42A 3H3OB 1X9WA 1B9DA 4CGGA 3CI5A 1EKEA 3TAEA 3P31A 4CK3A 2Q3SA 5LY3A 4JKBA 2QXFA 4M3UA 4IOXA 3J7ZO 4CEFA 2XY7A 4YOXA 3HVRA 4WQ5C 2OPRA 4B1UB 3VF2A 1L3TA 3HRGA 3QNOA 2FSNA 3ZEUA 2EWSA 3TANA 2HBLA 1HX1A 1BA1A 4CD1A 1G99A 4H0YB 3MWTA 1NBWA 2XHBA 4CZIA 3KJVA 3VERA 5BPLA 1A5WA 4GV6A 2UXCK 3ATUA 2A42A 3AVNA 1I39A 2W41A 5AQZA 4BDPA 3TPQA 4K43A 5T7BA 3VA0A 4FZYA 3MN5A 5SWMA 1LWCA 2YHYA 5AQYA 3WXMB 3ASMA 3T1AA 5AZIB 3QDKA 3KLFA 1VHXA 4Z4FA 3WXIA 3PSIA 3EE8A 3CCRN 1W2BM 4JKCA 5C2FA 3OS1A 4B3OA 3RR8A 3PO5A 4M3YA 1SKWA 4DSEA 1ZXOA 2VG7A 3OW2M 5ELZA 2E88A 1NGJA 2HHTA 4JKHA 1N8RO 2HVIA 3CHWA 3SQ4A 4XH5A 4F2SA 2GWJA 1U2VB 4Z4CA 5BPNA 4PL7A 4KAZA 4N47A 3ENOA 4FW2A 4BE0A 3QB0A 1T8EA 4CJ5A 5B8HA 4DTJA 4BVPA
chains in the Genus database with same CATH topology
4JYAK 4DR3K 4LF9K 4B3SK 4X64K 2UUCK 3J80O 4JI3K 4JI5K 5A2QO 2UUAK 4X62K 2E5LK 4DR4K 3T1HK 4JI0K 2VQFK 4AQYK 1N36K 4GKKK 4DV2K 4DV3K 4DUZK 4X66K 5BR8K 1I94K 4DR2K 4JI4K 3JAMO 4OX9K 3J7YP 4DUYK 1XNQK 4LF4K 2ZM6K 4LFBK 1IBKK 4DV0K 4B3RK 5FLXO 4DV7K 4DV5K 4DR5K 4JI7K 4LF6K 2UXCK 5IT9O 1IBLK 4DR1K 4CW7B 4V19S 1HNZK 4B3MK 3OTOK 4DR7K 4K0KK 4LF8K 1HNWK 4JI6K 4CVNE 4NXMK 1N33K 4JI1K 4DV6K 4LF5K 4LFAK 3T1YK 1XMQK 5IWAK 4JI2K 1J5EK 5LMUK 4JI8K 2F4VK 2UUBK 5AJ3K 1XNRK 4YY3K 1N34K 1N32K 5LMNK 4JV5K 5LL6Z 1HNXK 4X65K 4NXNK 2UU9K 4LFCK 4GKJK 1FJGK 4B3TK 2HHHK 3J7AP 2VQEK 4DV4K 4LF7K 3J81O 1IBMK 1XMOK 2UXDK 2UXBK 4DR6K 4KHPK 4YHHK 4DV1K 1HR0K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA K;  4DR3 K;  4LF9 K;  4B3S K;  4X64 K;  2UUC K;  3J80 O;  4JI3 K;  4JI5 K;  5A2Q O;  2UUA K;  4X62 K;  2E5L K;  4DR4 K;  3T1H K;  4JI0 K;  2VQF K;  4AQY K;  1N36 K;  4GKK K;  4DV2 K;  4DV3 K;  4DUZ K;  4X66 K;  5BR8 K;  1I94 K;  4DR2 K;  4JI4 K;  3JAM O;  4OX9 K;  3J7Y P;  4DUY K;  1XNQ K;  4LF4 K;  2ZM6 K;  4LFB K;  1IBK K;  4DV0 K;  4B3R K;  5FLX O;  4DV7 K;  4DV5 K;  4DR5 K;  4JI7 K;  4LF6 K;  2UXC K;  5IT9 O;  1IBL K;  4DR1 K;  4CW7 B;  4V19 S;  1HNZ K;  4B3M K;  3OTO K;  4DR7 K;  4K0K K;  4LF8 K;  1HNW K;  4JI6 K;  4CVN E;  4NXM K;  1N33 K;  4JI1 K;  4DV6 K;  4LF5 K;  4LFA K;  3T1Y K;  1XMQ K;  5IWA K;  4JI2 K;  1J5E K;  5LMU K;  4JI8 K;  2F4V K;  2UUB K;  5AJ3 K;  1XNR K;  4YY3 K;  1N34 K;  1N32 K;  5LMN K;  4JV5 K;  5LL6 Z;  1HNX K;  4X65 K;  4NXN K;  2UU9 K;  4LFC K;  4GKJ K;  1FJG K;  4B3T K;  2HHH K;  3J7A P;  2VQE K;  4DV4 K;  4LF7 K;  3J81 O;  1IBM K;  1XMO K;  2UXD K;  2UXB K;  4DR6 K;  4KHP K;  4YHH K;  4DV1 K;  1HR0 K; 
#chains in the Genus database with same CATH topology
 4CIG A;  2BE2 A;  4PKG A;  4BR9 A;  2LSN A;  3V1O A;  4CF1 A;  3QIO A;  3VGM A;  4CD3 A;  4X64 K;  3AO3 A;  3L4Q A;  3SPZ A;  4CGH A;  1I3A A;  3MCA B;  1JCE A;  2I5J A;  3AGR A;  3EKU A;  5C0Y A;  4JAX A;  2WTU A;  4AHV A;  1VQ9 N;  3M1F A;  1IKY A;  4JEP A;  4CJ4 A;  4HHT A;  3MEE A;  3H46 O;  3LM9 A;  4DMN A;  2HHQ A;  5AQS A;  1N36 K;  4GKK K;  2ZWH A;  5HOO A;  4DV2 K;  4DV3 K;  3CFO A;  1GLE G;  3LDL A;  5FPD A;  2FBT A;  3U6F A;  4DU1 A;  4DB3 A;  1BWF O;  2WUS A;  3QEI A;  2BUP A;  4IG3 A;  1SL2 A;  4NLC A;  3U3G A;  4CJW A;  3I55 N;  4O0I A;  2Y1J A;  4OO1 J;  3HZ6 A;  1YTA A;  3DYA A;  4I2Q A;  4DSI A;  4BR5 A;  2ZGY A;  1SV5 A;  4CE9 A;  4FJ7 A;  4LF6 K;  3UKU B;  5JS2 A;  3HI0 A;  1TL3 A;  1HUX A;  1U45 A;  1IKX A;  2ZD1 A;  1BIZ A;  4RW4 A;  1NGA A;  3K5N A;  4FJX A;  3TTC A;  4BWJ A;  3OYE A;  4A59 A;  4CF0 A;  5E41 A;  3IAY A;  4JHD A;  1VK0 A;  3TAQ A;  2VWB A;  3GOI A;  3ZSZ A;  1KVB A;  2FF3 B;  3G25 A;  4BGA A;  1YI2 N;  1N32 K;  3DJC A;  4CZH A;  4FLV A;  1OH7 A;  1C1A A;  2GBZ A;  1TK5 A;  3THY B;  5AQH A;  1C0G A;  3A5O C;  3HO1 A;  2ZQB A;  1S1V A;  4H8K A;  3VPZ A;  3ZT1 A;  3CM6 A;  3SAH A;  2BH1 A;  3S9H A;  1HPM A;  3A0I X;  1TKX A;  3FZL A;  1GLC G;  5BN8 A;  1DTT A;  2HBJ A;  4QAG A;  4DV4 K;  3AA2 A;  3BUZ B;  5JVG L;  2FSJ A;  2O4G A;  3TI0 A;  2A40 A;  2IVN A;  3R9P A;  1NJI O;  2A3Z A;  4WE1 A;  4L3Q A;  1RDC A;  3AVH A;  3WT0 A;  4CF9 A;  3OYI A;  1GLA G;  1WAF A;  4DTM A;  5KQ8 A;  3JXU A;  3LAM A;  5GAH P;  3VEN A;  1OVQ A;  4E3S A;  2O8D A;  3BEX A;  4KRE A;  4H0T B;  4LD0 A;  3MXI A;  2HNZ A;  2P9P A;  2HHV A;  3CQ8 A;  1JLE A;  2H3G X;  4B1W B;  3HXM A;  3O1W A;  1EO1 A;  1J54 A;  4WYB A;  2D0P A;  3SK3 A;  3M6G A;  3SJJ A;  3VEW A;  3SUN A;  5KI6 A;  4BRI A;  4OJR A;  1VQ7 N;  2FBV A;  1S9G A;  4KB1 A;  1ZYQ A;  4M45 A;  5C10 A;  4RTF D;  2IVP A;  1SZ2 A;  1WBB A;  1K8K B;  1OKJ A;  1WOQ A;  5BN9 A;  5FLX O;  3F9M A;  4E7L A;  4DR5 K;  4CJT A;  4N76 A;  3CCS N;  2HHX A;  1A5V A;  4G9Z A;  3AV9 A;  3WNG A;  1QHA A;  3AO2 A;  4KH4 A;  1QSL A;  4F9O A;  3NAE A;  4I7F A;  5J2Q A;  3VN5 A;  2GV9 A;  1HNW K;  2FC0 A;  1JXE A;  3A5N C;  4A2B A;  5IWA K;  1W97 L;  1LOT B;  3LAN A;  3VQP A;  3SBG A;  4DTX A;  3WNE A;  2E8A A;  4KHY A;  4KHQ A;  4MLH A;  2XY6 A;  5KPT A;  5CHI A;  4JN4 A;  2QA4 N;  1GLD G;  4GV9 A;  4F2R A;  1O13 A;  4KPY A;  1A5X A;  5E84 A;  1LWE A;  2O8C A;  4CZM A;  3O9U A;  3MWP A;  4DU4 A;  4E1M A;  3LDO A;  2HMI A;  1X3N A;  2QWR A;  3K57 A;  4UQG A;  1S6Q A;  1DGK N;  4CFC A;  3VQ5 A;  3SUQ A;  2FLO A;  1HR0 K;  2ZJR L;  1WB9 A;  3V9W A;  2F8S A;  2X78 A;  4JKG A;  3VQ7 A;  3KLG A;  1RGI A;  2VWJ A;  2UUC K;  1XI1 A;  3MDQ A;  4FK4 A;  5D3G A;  2ASO A;  3SV3 A;  1RT3 A;  1XHZ A;  4GVE A;  3PX6 A;  1Q9Y A;  3QET A;  3LPU A;  2OZS A;  2YCH A;  4BC3 A;  4RW8 A;  4E7K A;  2O8D B;  5EX5 A;  1NM1 A;  2WON A;  3K59 A;  1VQN N;  4DQR A;  3KD1 E;  2YHW A;  2P9P B;  4DR2 K;  3O6W A;  4KHN A;  2OAN A;  1WN7 A;  1D8Y A;  3QEW A;  1ZBL A;  1NOY A;  1LWF A;  4MO5 A;  4BQZ A;  2IVO A;  5GAG P;  5JMV A;  3ISN C;  1M90 O;  3ZSV A;  1VSH A;  3AA4 A;  4HCB A;  3VF6 A;  4OVL A;  4CGD A;  1RDA A;  4JI7 K;  4BRG A;  4OLA A;  5C24 A;  1BGX T;  5IT9 O;  1ATR A;  3ENB A;  3OJU A;  4FW1 A;  4DFJ A;  3JYT A;  4PQU A;  4BC4 A;  3DLH A;  2QKB A;  4KI6 A;  1N33 K;  3UE5 A;  4F3T A;  1OVY A;  2CH5 A;  2XO7 A;  1D9D A;  3N4Q A;  3M8P A;  5JLF A;  3P5J A;  3MXM A;  2Q1N A;  1ASV A;  1C1B A;  5C42 A;  3L2V A;  4CHQ A;  2I7N A;  2UUB K;  1U04 A;  3HP9 A;  3AAR A;  3IKM A;  4GW6 A;  2O8E A;  4BG9 A;  1T44 A;  1EQY A;  1ZBH A;  4QS7 A;  3HOS A;  3CET A;  2NLX A;  3ITH A;  2KKZ A;  4TSX A;  4FJ5 A;  3NF6 A;  4Z4G A;  3CJB A;  4CEA A;  1IBM K;  2O8C B;  2HND A;  1EWR A;  3DLB A;  4DHY A;  1HYV A;  4RW9 A;  3RRG A;  3V81 A;  3CXC M;  4HVJ A;  3R8E A;  4ZTJ A;  1DEJ A;  4JKA A;  3P39 A;  3U3Y A;  4BE1 A;  1TAU A;  3L2W A;  1BIS A;  3L0Q A;  4FLW A;  2V7Y A;  2O4I A;  3BGR A;  4DU3 A;  3OYB A;  4I9Q A;  5HLF A;  2BGG A;  3BF1 A;  4H5N A;  3A8Y A;  1SS6 A;  1L3S A;  1RIL A;  3TTF A;  3LL3 A;  4AIL C;  1QS4 A;  3VEX A;  4DQQ A;  4JD2 A;  3C6H A;  3D2F A;  4CJR A;  3QEV A;  1GLJ O;  1VQK N;  4W5N A;  4KHU A;  4Q5V A;  3NF7 A;  5AQQ A;  3OA9 A;  1HNV A;  3KIO A;  1Z26 A;  3LP1 A;  2PFU A;  3U9Z A;  3B8A X;  3DRS A;  3KK3 A;  4JK9 A;  3F9K A;  4Z4I A;  3DWL A;  3VQQ A;  4FLZ A;  4NLB A;  2DPN A;  1XWL A;  4CZJ A;  1KCF A;  4FOI A;  1ATS A;  3VEY A;  4QOZ B;  3KKS A;  1RT4 A;  3THW A;  3ZT4 A;  1WSG A;  4FOE A;  4J2E A;  4XEI A;  1QVG M;  2JWK A;  4FJ8 A;  2QKK A;  4KFB A;  3DOL A;  1NKC A;  2G8H A;  3BF3 A;  1HLU A;  4E19 A;  1O1W A;  4LY7 A;  4NXM K;  3AA5 X;  2OA8 A;  3E1Y A;  3HYF A;  4LFA K;  1QSS A;  3BY5 A;  3VET A;  1NGC A;  3FFI A;  1QZ6 A;  4BY9 C;  3JS6 A;  3M8R A;  1KAY A;  1K73 O;  3KK7 A;  3H3N O;  1OH8 A;  3D6R A;  3AVI A;  3F73 A;  1U4B A;  3OYG A;  5GIP A;  3RRH A;  2O8E B;  4FJG A;  3C65 A;  3ULD A;  4PHT X;  1VQO N;  3MCP A;  5KPR A;  3WXK A;  3WNH A;  2ZGZ A;  4CHN A;  3OYN A;  4I6M A;  4HUF A;  4GV3 A;  3EE9 A;  3RMA A;  4ISF A;  3O8M A;  3MED A;  4H4O A;  3NH1 A;  3R1X A;  4CEZ A;  3MN6 A;  3J80 O;  4DFM A;  1LCU A;  2VCP A;  3MMV A;  1ZBS A;  4C8O A;  5AQF A;  2YHX A;  2G8V A;  4LSL A;  1KAX A;  1S72 N;  1SAZ A;  1ZBU A;  4K8Z A;  2YKN A;  1UA0 A;  1R0A A;  3ZT0 A;  2NRT A;  3T3F A;  1T03 A;  1VRT A;  4KTZ A;  5BRE A;  2EX3 A;  3AVG A;  3I8B A;  3O9S A;  4BRA A;  4LC9 B;  4DTS A;  2G8F A;  1NLV A;  4JD2 B;  3RMB A;  2GTD A;  4BR0 A;  4DUY K;  3D2F B;  4MO4 A;  3RMD A;  3TSU A;  1TK8 A;  3QIC A;  3AVF A;  1YXQ A;  5HL7 L;  3FZM A;  4CJU A;  4LSN A;  2DTU A;  5ADX H;  4FLU A;  1HJO A;  3T19 A;  4WQ4 C;  4WQ5 A;  3IUC A;  3OYH A;  3KZB A;  1XC3 A;  4C8N A;  1VQ4 N;  1RTH A;  4FJN A;  1BOT O;  4DFP A;  3P1G A;  2WOM A;  3PUF A;  1CZ9 A;  3VEO A;  3AVA A;  5HRR A;  3LM2 A;  4M41 A;  4CJF A;  3QEP A;  4M3X A;  2F9T A;  4GY2 B;  1VQP N;  4FWP A;  4O0J A;  3VQ4 A;  3OYC A;  3IFR A;  1JL2 A;  2E2P A;  2P5G A;  5J2P A;  2OPP A;  1ITG A;  4YOT A;  4J2D A;  3ID6 A;  3DLG A;  4GKJ K;  4ELV A;  1NMD A;  4CFB A;  3WNF A;  3OBY A;  4KBO A;  1JLQ A;  2ETJ A;  3IDH A;  3J7A P;  1ESV A;  2AJQ A;  4ELU A;  3G4S N;  1U49 A;  2WBN A;  4LF7 K;  1HPZ A;  1MA9 B;  4YOV A;  1WAJ A;  4YHH K;  4AHC A;  2ZE2 A;  4CI6 A;  1B9F A;  4DR3 K;  3GG4 A;  4I6M B;  3HST B;  1TKT A;  4M7Y A;  4BG8 A;  4RW6 A;  4O8K A;  4E89 A;  2A6A A;  1VSF A;  4DWI A;  3SUO A;  5BR9 A;  4DR4 K;  1DTQ A;  3K0S A;  1SKR A;  4FXD A;  3MEC A;  1HRH A;  1NJY A;  1JXB A;  1VQ5 N;  1WSF A;  3VQD A;  4GMJ B;  4FJM A;  4J2B A;  4OKK A;  5I9E B;  2G8I A;  3K58 A;  5M1P A;  3CMA N;  2HVH A;  4DQ8 A;  4BWM A;  4NCB A;  3ZX2 A;  4H5V A;  4BR7 A;  4FJJ A;  3V9X A;  4W5T A;  3C6T A;  5C15 A;  4L8R B;  3R6M A;  4JKE A;  4JNE A;  4JLH A;  3ZSR A;  1J53 A;  1W7A A;  4E7I A;  4B1Z A;  1NNE A;  3D7E O;  3NF9 A;  4MDB A;  3HOT A;  1EET A;  4OKJ A;  4DQI A;  2B5J A;  3DLR A;  5CYQ A;  1KLM A;  3HTV A;  2F96 A;  1Z6R A;  2HBK A;  3DRP A;  5AFU H;  2VWK A;  3DM2 A;  2O8B A;  4U7B A;  3NH0 A;  1IJJ A;  1R59 O;  3ZEU B;  5CZ2 A;  4B08 A;  3VA3 A;  1YJN N;  1CLQ A;  4CZE A;  3KLH A;  1JLC A;  4O4G A;  4A5B A;  4NXN K;  3EZW A;  4HCC A;  3FZK A;  3H08 A;  3O3F A;  3EEQ A;  1CXU A;  2Z1G A;  4IDK A;  5GAE P;  2Q36 A;  4B9N A;  4B3T K;  1T3V A;  3DXK A;  4OGE A;  3CCM N;  3NGY A;  3OVN A;  4B1Y B;  3V4I A;  4AF1 A;  2W40 A;  3OY9 A;  3TWH A;  3C6A A;  2ZF5 O;  5DM7 L;  4M3T A;  1C1C A;  1BI4 A;  1C0F A;  3A5L C;  3LWL A;  5AQK A;  4GVM A;  3LDQ A;  4CZG A;  3SMS A;  3AVK A;  2UUA K;  1RCH A;  1TUU A;  3BP8 A;  1QVF M;  3JSM A;  4CHY A;  4N41 A;  3ZSX A;  2G8U A;  4IOC L;  4JI0 K;  1WUA A;  4IJA A;  3D45 A;  2GX9 A;  3I8D A;  4JKD A;  3D2E A;  1S1W A;  1RBR A;  2E2O A;  2FXU A;  2PYL A;  4MFB A;  4FWN A;  4EHT A;  3IMX A;  3L4I A;  1NU0 A;  4NYN A;  1MU2 A;  1JLA A;  4B8A B;  4DKW A;  3SUP A;  1JKH A;  1TVR A;  3OYM A;  4FWM A;  2P9K A;  4FJ9 A;  1N5Y A;  1VSD A;  1QE1 A;  5AQN A;  2GEM A;  3CQX A;  3LWM A;  1WSH A;  1MWK A;  4MDA A;  4C8M A;  1Q86 O;  3CF5 L;  2ASP A;  5CY4 A;  3DMJ A;  2W6K A;  3DLE A;  3SPY A;  3OTO K;  4B9T A;  3CCU N;  3SBT A;  1NOZ A;  4M3W A;  2PAV A;  4IO8 A;  5EXW A;  3U9D A;  2KZM A;  3QBX A;  4DSJ A;  5K14 A;  4C1N I;  3T1Y K;  1HKG A;  3ZET A;  4BRN A;  2YNH A;  1DLO A;  4ILJ A;  1L5U A;  3I0S A;  5MLC Q;  4E7H A;  1WNS A;  4B9M A;  4M42 A;  2D0A A;  4IFY A;  1P90 A;  3RWU A;  3TU5 A;  1TGO A;  4EZ9 A;  3KKR A;  2CGL A;  4ISE A;  4X65 K;  5C12 A;  1RDD A;  3W3D A;  2UU9 K;  3HT3 A;  1UWB A;  4E7J A;  5EVZ A;  3VOV A;  4YDU A;  4NCG A;  3BZC A;  3HPO A;  5I3U A;  1GOA A;  3I56 N;  3CIP A;  1NG9 A;  3H6E A;  3MX5 A;  3LP2 A;  2NNW A;  5HP1 A;  4CEE A;  4DR6 K;  3HP6 A;  5AQG A;  4FJK A;  1NGE A;  4EIA A;  4IXC A;  3DLL L;  3QML A;  3VQE A;  1C0M A;  2HB5 A;  4KTW A;  5EY4 A;  4LF9 K;  1QQC A;  1HYZ A;  4JHD B;  2PY5 A;  3M8Q A;  3EKS A;  4JI5 K;  1KSP A;  3E9L A;  4K25 A;  4DF4 A;  4NCA A;  2F9W A;  4C23 A;  1BI4 B;  1W0H A;  1K6Y A;  2VQF K;  1H1V A;  2B6A A;  1S1X A;  4JK7 A;  1F21 A;  3AGK A;  3O08 A;  3CFR A;  4FK0 A;  3G0Z A;  4DG1 A;  4F4K A;  4FWL A;  4HUG A;  4F3O A;  3AVM A;  3FGU A;  1YHQ N;  3SQ2 A;  5BR8 K;  5AQX A;  2EHG A;  3D2E B;  4KRF A;  2O8F A;  4FM0 A;  4KV8 A;  4Z94 A;  3C7N A;  4CFA A;  2P1J A;  3QO9 A;  2V51 B;  4AH9 A;  4B1X B;  3ZSQ A;  3LAK A;  1K9M O;  5M1K A;  4DV7 K;  5J2M A;  1LAW A;  3KWG A;  4DLE A;  4OKE A;  3C95 A;  4WF9 L;  2P9K B;  1XC9 A;  2JGU A;  1Z25 A;  1IBL K;  4DR1 K;  3HPH A;  1XUP O;  4V19 S;  1YJW N;  3TAR A;  4W5R A;  3OJS A;  4EZ6 A;  1L3U A;  5HRN A;  4CJQ A;  3VQB A;  2ASM A;  3H1Q A;  2E6M A;  4IKF A;  2QW9 A;  1BA0 A;  3C6U A;  4CEC A;  2VG5 A;  2Q31 A;  5FPM A;  3ULE A;  2ITG A;  3ZYY X;  4CFD A;  5LMU K;  4DS4 A;  4G1Q A;  1T05 A;  4DLG A;  4H0X B;  1OH5 A;  4KO0 A;  3ZET B;  1E4G T;  3OYK A;  2GUP A;  1RT6 A;  4M3Z A;  3RSE A;  1QHT A;  2YJE A;  3GBT A;  4M7X A;  3KVG A;  4JS4 A;  1KRP A;  2VGN A;  4Q0B A;  3QER A;  2NRH A;  3AO4 A;  1BIU A;  4MQ3 A;  4O5B A;  3VQ8 A;  4WCE L;  4FVM A;  1VSE A;  3FLC O;  4IEE A;  4CES A;  3J81 O;  1S3X A;  2QWN A;  1XMO K;  3FZH A;  4KHP K;  4Z4H A;  1BL3 A;  4IZ9 A;  1L3V A;  3SQ0 A;  2HW3 A;  2HF3 A;  4LH4 A;  2QK9 A;  5E26 A;  4B9Q A;  3DI6 A;  4CJ7 A;  2Q0R A;  4FWO A;  3ZLJ A;  4FYD A;  3ATV A;  5AQW A;  4BRQ A;  3FFK B;  1S1T A;  4KHW A;  3QLH A;  4IFE A;  3CJC A;  5M1F A;  5A2Q O;  3O5B A;  4KTQ A;  3CQY A;  3U8X A;  2D0O A;  1FXX A;  2OZM A;  2CGK A;  1WSE A;  4KH6 A;  2P9L A;  1KFS A;  1RFQ A;  3S3M A;  4M3R A;  5FRO A;  1Q81 O;  3P83 D;  2KFN A;  4FLX A;  4XH4 A;  1E3M A;  5CR4 A;  3RTV A;  1QQM A;  2X6S A;  3LZJ A;  2HST A;  1NK9 A;  1LV5 A;  2OPQ A;  1KVA A;  3JAM O;  3KK1 A;  4CZF A;  4BAC A;  3VQ9 A;  2ZM6 K;  1YVU A;  1IBK K;  4ZHR A;  4JKG B;  1NJX A;  1JLF A;  4FL9 A;  3C7N B;  4B1V A;  4DV5 K;  1BUP A;  1FKO A;  2RN2 A;  2P9U A;  3SNN A;  3SV4 A;  4CCH A;  5FPN A;  4B8C A;  3M8S A;  4FLY A;  4CJE A;  3CYM A;  3SQ1 A;  3CFP A;  1VSI A;  1KXP A;  5DMR A;  4DF8 A;  3SI6 A;  1RBU A;  3DAW A;  2A41 A;  3TTD A;  4ELT A;  5CE3 A;  4LF5 K;  3O80 A;  3AY9 A;  4IFV A;  3AAQ A;  5C2D A;  2P9I A;  1QZ5 A;  3OYD A;  3KTQ A;  3VTH A;  1SUQ A;  3CPW M;  1C6V A;  3ULE B;  4XH1 A;  1TL1 A;  1Y64 A;  5LMN K;  5AQT A;  3B6O A;  5LL6 Z;  5KTQ A;  1G15 A;  2YI1 A;  3ZT3 A;  4FZX C;  4ICL A;  3OBW A;  3ZX3 A;  2QI2 A;  4WFB L;  4F8R A;  4FWQ A;  4CGJ A;  3T69 A;  4QS8 A;  3RSE B;  4BR2 A;  3H45 C;  2DY4 A;  2I7P A;  1J5O A;  1UA1 A;  1RT2 A;  1C0T A;  3FZF A;  5BRD A;  4HUE A;  4DS5 A;  1D9F A;  3PO4 A;  4FPA A;  3HSC A;  4PKI A;  1T7P A;  4CJ3 A;  4CEQ A;  4CIF A;  3CJ1 A;  4BDZ A;  2BAN A;  4Y1C A;  3QNN A;  3MN9 A;  3V6D A;  3ZX0 A;  4YOU A;  3CCE N;  4DSL A;  1KVC A;  3CCJ N;  4ZTF A;  2E2Q A;  1Q18 A;  2FBX A;  2FBY A;  3E9O A;  3E01 A;  4FLT A;  4ILH A;  1BQM A;  4BGB A;  3UIQ A;  1VQ8 N;  1BCM A;  5KGX A;  4J8F A;  3RVC A;  3QEX A;  4IOA L;  4IDH A;  1RT5 A;  5LJV A;  3EL2 A;  2DFH A;  2HF4 A;  5AZI A;  3M5R A;  4A57 A;  3CER A;  3DXM A;  5FDL A;  2P9L B;  4CF2 A;  3TR8 A;  1GOB A;  1VRU A;  3QFU A;  3TAM A;  3J7Y P;  1S22 A;  4DQS A;  5BRF A;  2D4W A;  2BDP A;  2UYT A;  3HM9 A;  4PUO A;  1BDG A;  1E4F T;  4N56 A;  4FZZ A;  1X9M A;  1NK4 A;  1NK8 A;  2HHS A;  1NGB A;  2QWL A;  1RBS A;  1K8A O;  1RTD A;  4KKO A;  3PV8 A;  1NK6 A;  4EP5 A;  4K0K K;  3MEG A;  2P9U B;  4LF8 K;  2ZJQ L;  4CHP A;  4AHR A;  1X9S A;  1RDB A;  3C94 A;  3ZT2 A;  4CIE A;  2HBM A;  2Z1H A;  2IIR A;  4N5S A;  4WQ4 A;  2IC3 A;  4JI2 K;  3V9Z A;  1RTI A;  1QQO A;  3KLI A;  3OYJ A;  2HNY A;  2F4V K;  2NRR A;  1FW6 A;  4IO9 L;  3A2F A;  3SLC A;  3AVL A;  4DTN A;  1KFD A;  3DLK A;  3CC2 N;  2P9I B;  5EU7 A;  2KW4 A;  2X6N A;  3THW B;  3M3Z A;  1BHL A;  1SL1 A;  5FRN A;  3SJH A;  5AR0 A;  1TYQ A;  2DFF A;  4AHU A;  2GUI A;  4CGI A;  4HTU A;  1U6Z A;  4DTP A;  1FJG K;  1U48 A;  3T7Z A;  1TKZ A;  3K9K A;  4CJL A;  2Q97 A;  2YNG A;  3VF4 A;  1JLG A;  4HWI A;  2G8K A;  5LJW A;  3IRX A;  2YNI A;  3KLE A;  2KQ2 A;  4ISG A;  1WSJ A;  2NUB A;  3THV A;  1JL1 A;  5DK5 A;  3PSF A;  2E6L A;  4B3S K;  3WQT A;  4RG8 A;  4IEI A;  4QS9 A;  2RE2 A;  4BRC A;  1HJR A;  1IG8 A;  3LAL A;  4YOY A;  3UKU A;  4FM2 A;  3LDP A;  5HRO A;  2HMP A;  3CD6 N;  1C0U A;  1V4T A;  1VSM A;  1IV0 A;  2CGJ A;  3HPG A;  1YUW A;  5HBM A;  2B4J A;  4H0P A;  2RF2 A;  3EY1 A;  1Q82 O;  3VQA A;  3CC7 N;  1S1U A;  2D0C A;  4FWS A;  4Y1D A;  3S3O A;  5F1X A;  1EP4 A;  3LDN A;  2NRV A;  3V1Q A;  4J2A A;  3DXM B;  4LFB K;  4EAH D;  2NRW A;  1D5A A;  4JRQ A;  4W5Q A;  2OYQ A;  4FK2 A;  3QIN A;  2YV0 X;  3LP3 A;  2XY5 A;  1Q7Y O;  3TAB A;  4DSF A;  3THY A;  3BZK A;  1KD1 O;  1KTQ A;  2QM1 A;  2HOE A;  4B3M K;  4ID1 A;  4DR7 K;  2YJF A;  1W9H A;  1NMN A;  2AA4 A;  2A1S A;  2VYP A;  3AO1 A;  3U4L A;  4BRM A;  5TKW A;  4RWT A;  5I42 A;  4JI6 K;  4CVN E;  1HQU A;  1NK0 A;  4FJH A;  3VTI A;  3CCQ N;  4JI1 K;  4DV6 K;  4OLB A;  1S5J A;  3NBP A;  1YIT N;  4JI8 K;  4C8L A;  3L2Q A;  4CBX A;  2OTJ N;  2QEX N;  5AJ3 K;  4JKF A;  3O4W A;  1XNR K;  4FWR A;  5AQL A;  1N34 K;  1VQM N;  1J6Z A;  4RW7 A;  1WLJ A;  2ZJP L;  4E1N A;  4IBN A;  4KI4 A;  4CHO A;  1JLB A;  3FR0 A;  1SKS A;  4ILG B;  3WUH A;  3CJ9 A;  2YHB A;  3SCX A;  3ALY A;  1TYQ B;  1EWQ A;  4FO0 A;  3CC4 N;  1TUY A;  4BRF A;  4DV1 K;  4B9S A;  4CHZ A;  3K9J A;  4PKH A;  2BTF A;  3NF8 A;  4JYA K;  1NK7 A;  1KLN A;  3I33 A;  1REV A;  3LPT A;  3TSP A;  1K8K A;  1Q8I A;  4JI3 K;  2D1K A;  3L2U A;  4KB0 A;  2XY8 A;  2XRI A;  4R79 A;  5F0X A;  3O1B A;  3PIP L;  4BRD A;  2OPS A;  2P51 A;  4AQY K;  5DM6 L;  5AQR A;  4NYF A;  1U47 A;  2PZS A;  4DSK A;  4A5A A;  1T6D A;  5KQD A;  4H0O A;  1BCO A;  3OS2 A;  3LP0 A;  4K8X A;  3AO5 A;  3NE6 A;  1ASU A;  2QWP A;  4RCH A;  1Y97 A;  3O4N A;  2IGI A;  3WXL A;  2D5R A;  1N6Q A;  3LDS A;  4BE2 A;  4W5O A;  3OYF A;  1BQN A;  4CJS A;  4DV0 K;  3EYZ A;  1J9A A;  2F7T A;  3RMC A;  2GEL A;  1V4S A;  1NKB A;  1YF5 L;  2KTQ A;  2RHK A;  3AVC A;  3LZI A;  3VQC A;  1HQE A;  4BRP A;  4B9U A;  4WFN L;  1TV6 A;  2V7Z A;  2IOC A;  3O3H A;  1XQS C;  2OTL N;  2D0B A;  4I9L A;  1QQN A;  4DTU A;  2PBD A;  3S41 A;  1RT1 A;  2X74 A;  1MDU B;  1QTM A;  3NVM A;  4CZK A;  2F8T A;  1YAG A;  1J5E K;  4E1J A;  5GIN A;  1CZA N;  4PWD A;  3ZSY A;  4FJL A;  3L2R A;  1NGD A;  2QTD A;  3VGL A;  4BC2 A;  3SMP A;  3IS9 A;  4AM6 A;  1HNX K;  5AQJ A;  2P5O A;  5M1O A;  1JJ2 M;  5CZ1 A;  1X1P A;  4FJI A;  1TK0 A;  3OS0 A;  1RBV A;  3PY8 A;  5F2R A;  2HHH K;  4DCH A;  3UB5 A;  1IG9 A;  2UXB K;  3CME N;  4BRH A;  5GAD P;  3L3U A;  4H0V B;  3O9Q A;  4FSV A;  3ID8 A;  1DKG D;  4EP4 A;  5ADX A;  4UY8 O;  3GL1 A;  2O8B B;  3K5O A;  1FKP A;  3P4I A;  3KK2 A;  1T6C A;  4OPH A;  4CK1 A;  5JIC A;  3ENH A;  3L3V A;  2E1Z A;  1YJ9 N;  2YNF A;  2VG6 A;  1NGF A;  2JWL A;  3VES A;  4JRP A;  4CBU A;  2KZZ A;  3NVK A;  1BO5 O;  4BRK A;  1ILY A;  3BDP A;  4Z0U A;  4NB4 A;  4DTR A;  5AQU A;  3DXK B;  4OPA A;  1I94 K;  3NHG A;  4QCL A;  3Q7C A;  3OYA A;  2FSK A;  4OX9 K;  1Z05 A;  5TKY A;  2W42 A;  4Z4E A;  4IWV A;  4B3R K;  2V52 B;  4M63 C;  2QWQ A;  4YDU C;  2DFE A;  3IG1 A;  3UKR A;  3Q7B A;  3TAG A;  4CW7 B;  1NK5 A;  3L6Q A;  1EXQ A;  3NFA A;  3KHY A;  2YX6 A;  5AZJ A;  5AQV A;  4PA1 A;  2IAJ A;  4AM7 A;  3V1R A;  4C1N K;  5JVH L;  4BRL A;  1XMQ K;  3ZSO A;  1RDU A;  1YVN A;  2E4L A;  2FF6 A;  1IKW A;  2Z1I A;  2OCE A;  2NRX A;  4U67 L;  3O9R A;  4BRE A;  2P9N A;  3CM5 A;  4OPJ A;  5HRS A;  1KC8 O;  3WQU A;  4CBW A;  1WBD A;  3O4Q A;  5FPE A;  3MN7 A;  2W6L A;  1NGG A;  1VQL N;  4LFC K;  1SQK A;  2G8W A;  3MXJ A;  2P9S A;  3V9S A;  1X3M A;  1TKD A;  3ZCM A;  1ZBF A;  3A5M C;  5KPZ A;  4YOW A;  3I0R A;  4YOR A;  1UAX A;  3HL8 A;  3QFP A;  2QWO A;  4HTL A;  3GE1 A;  5KRS A;  1VSL A;  3VQ6 A;  4BVO A;  3QES A;  1P8Z A;  3NGZ A;  2VGM A;  3VGK A;  1HYS A;  3K5L A;  3NDK A;  1WSI A;  3F5T A;  2QWM A;  3C0B A;  2PYJ A;  3KD5 E;  5AQO A;  4CJK A;  3RR7 A;  5AQI A;  1OH6 A;  2E20 A;  3GDQ A;  5AFU A;  3KWI A;  3SAG A;  1Q9X A;  4FCY A;  3S3N A;  3G6E N;  4DUZ K;  4PY5 A;  3W0L A;  3CCV N;  3CJA A;  2A1R A;  1DT9 A;  1ASW A;  4JI4 K;  3WXJ A;  3TAF A;  3CPE A;  3ZSW A;  3O3G A;  3D0P A;  2RKI A;  4GNI A;  4H5W A;  5SZT A;  4BC5 A;  2WC9 A;  2QXL A;  3THX A;  3OYL A;  2ATQ A;  2Y1I A;  2RPI A;  4CEO A;  1RNH A;  2E1Y A;  2Q0U A;  1NJZ A;  5J2N A;  2R7Y A;  3PIO L;  4H4M A;  1NKE A;  3EO3 A;  1GLF O;  3E66 A;  3B6P A;  4Y0W A;  1SL0 A;  1LW2 A;  1NWK A;  2YKM A;  4I2P A;  3UKR B;  1D4X A;  1HNI A;  1CZB A;  4IJN A;  4XIU A;  1VQ6 N;  1ZC6 A;  5C25 A;  3P38 A;  3NCI A;  5M1N A;  4B9V A;  1TAQ A;  3WEE A;  5AZJ B;  2O8F B;  4CER A;  1M1K O;  3TSQ A;  5CYM A;  1XHX A;  3SYZ A;  1IH7 A;  1VSJ A;  4CEB A;  4YY3 K;  4DFK A;  1GOC A;  3J8A A;  3CJ7 A;  3NMU A;  2WFB A;  1JCG A;  3MAQ A;  4KHS A;  5J1E A;  3SAF A;  2P9N B;  1UOC A;  1VSK A;  4CJV A;  1S9E A;  3QBW A;  3PX4 A;  1VAZ A;  4O55 A;  1IO2 A;  1RDW X;  3N4P A;  2VQE K;  4EFH A;  3CG7 A;  1NJW A;  2E2N A;  2UXD K;  3QIP A;  2P9S B;  2IS3 A;  4LH5 A;  2AP1 A;  4O44 A;  3AVB A;  5KGW A;  5FRM A;  1BG3 A;  5GIO A;  4DTO A;  4C8K A;  1ATN A;  4FWK A;  4BDY A;  5BPM A;  1NGI A;  2GWK A;  2NRZ A;  2Q2R A;  3R3L A;  1NGH A;  1YTU A;  4X62 K;  5KRT A;  1HKC A;  4CGF A;  4EHU A;  4WFA L;  5JS1 A;  2J4R A;  3HBT A;  4A2A A;  3HM8 A;  3VMF B;  3H1V X;  4B9L A;  2ITM A;  4ID5 A;  4X66 K;  3FE1 A;  3AA3 A;  4JS5 A;  4FPB A;  4A62 A;  3O9T A;  4H5R A;  3MX2 A;  4MLE A;  5HRP A;  4BRO A;  4E0D A;  1IKV A;  1XNQ K;  4FM1 A;  4LF4 K;  3MK6 A;  1RTJ A;  3DOK A;  3E9P A;  2IDO A;  3AAP A;  4CJP A;  3K2P A;  5EOY A;  3HVT A;  4NO7 A;  2NZT A;  1KQS M;  4O5F A;  3SZ2 A;  1EX4 A;  4H03 B;  3F2K A;  2HHU A;  4PL8 A;  4OPK A;  3THX B;  1QSY A;  3G71 N;  4BR4 A;  1HNZ K;  1LW0 A;  1MWM A;  3L8B A;  1YIJ N;  4IG0 A;  3K5M A;  3OHR A;  3PX0 A;  3HK2 A;  1B92 A;  1FK9 A;  4AHT A;  4CZL A;  4R5P A;  1X9J A;  5M1Q A;  3VEV A;  3HJF A;  3DRR A;  1CXQ A;  2YHA A;  2A5X A;  4OGC A;  1GLL O;  1ZBI A;  1LAV A;  1HMV A;  3WEE B;  4DQP A;  1U2V A;  4JV5 K;  2KLA A;  4KH5 A;  4AHS A;  1GLB G;  3VEZ A;  1JCF A;  4BQL A;  3TAP A;  4FVU A;  4JK8 A;  3EZ5 A;  5BRH A;  4H5T A;  3AVJ A;  2Z1J A;  4CF8 A;  4YNQ A;  1RT7 A;  5JLH A;  3NH2 A;  2CH6 A;  4O8U A;  1S6P A;  4A61 A;  3CCL N;  4CED A;  2KHO A;  4YFU A;  3EN9 A;  2HHW A;  1BU6 O;  5AQP A;  1YT3 A;  1RBT A;  2E5L K;  3PLA A;  3V9U A;  1HKB A;  1KAZ A;  2KFZ A;  4CK2 A;  3T1H K;  3G10 A;  4K41 A;  5H1S Q;  3NGI A;  2JLE A;  5AQM A;  4K42 A;  3H3O B;  1X9W A;  1B9D A;  4CGG A;  3CI5 A;  1EKE A;  3TAE A;  3P31 A;  4CK3 A;  2Q3S A;  5LY3 A;  4JKB A;  2QXF A;  4M3U A;  4IOX A;  3J7Z O;  4CEF A;  2XY7 A;  4YOX A;  3HVR A;  4WQ5 C;  2OPR A;  4B1U B;  3VF2 A;  1L3T A;  3HRG A;  3QNO A;  2FSN A;  3ZEU A;  2EWS A;  3TAN A;  2HBL A;  1HX1 A;  1BA1 A;  4CD1 A;  1G99 A;  4H0Y B;  3MWT A;  1NBW A;  2XHB A;  4CZI A;  3KJV A;  3VER A;  5BPL A;  1A5W A;  4GV6 A;  2UXC K;  3ATU A;  2A42 A;  3AVN A;  1I39 A;  2W41 A;  5AQZ A;  4BDP A;  3TPQ A;  4K43 A;  5T7B A;  3VA0 A;  4FZY A;  3MN5 A;  5SWM A;  1LWC A;  2YHY A;  5AQY A;  3WXM B;  3ASM A;  3T1A A;  5AZI B;  3QDK A;  3KLF A;  1VHX A;  4Z4F A;  3WXI A;  3PSI A;  3EE8 A;  3CCR N;  1W2B M;  4JKC A;  5C2F A;  3OS1 A;  4B3O A;  3RR8 A;  3PO5 A;  4M3Y A;  1SKW A;  4DSE A;  1ZXO A;  2VG7 A;  3OW2 M;  5ELZ A;  2E88 A;  1NGJ A;  2HHT A;  4JKH A;  1N8R O;  2HVI A;  3CHW A;  3SQ4 A;  4XH5 A;  4F2S A;  2GWJ A;  1U2V B;  4Z4C A;  5BPN A;  4PL7 A;  4KAZ A;  4N47 A;  3ENO A;  4FW2 A;  4BE0 A;  3QB0 A;  1T8E A;  4CJ5 A;  5B8H A;  4DTJ A;  4BVP A; 
#chains in the Genus database with same CATH homology
 4JYA K;  4DR3 K;  4LF9 K;  4B3S K;  4X64 K;  2UUC K;  3J80 O;  4JI3 K;  4JI5 K;  5A2Q O;  2UUA K;  4X62 K;  2E5L K;  4DR4 K;  3T1H K;  4JI0 K;  2VQF K;  4AQY K;  1N36 K;  4GKK K;  4DV2 K;  4DV3 K;  4DUZ K;  4X66 K;  5BR8 K;  1I94 K;  4DR2 K;  4JI4 K;  3JAM O;  4OX9 K;  3J7Y P;  4DUY K;  1XNQ K;  4LF4 K;  2ZM6 K;  4LFB K;  1IBK K;  4DV0 K;  4B3R K;  5FLX O;  4DV7 K;  4DV5 K;  4DR5 K;  4JI7 K;  4LF6 K;  2UXC K;  5IT9 O;  1IBL K;  4DR1 K;  4CW7 B;  4V19 S;  1HNZ K;  4B3M K;  3OTO K;  4DR7 K;  4K0K K;  4LF8 K;  1HNW K;  4JI6 K;  4CVN E;  4NXM K;  1N33 K;  4JI1 K;  4DV6 K;  4LF5 K;  4LFA K;  3T1Y K;  1XMQ K;  5IWA K;  4JI2 K;  1J5E K;  5LMU K;  4JI8 K;  2F4V K;  2UUB K;  5AJ3 K;  1XNR K;  4YY3 K;  1N34 K;  1N32 K;  5LMN K;  4JV5 K;  5LL6 Z;  1HNX K;  4X65 K;  4NXN K;  2UU9 K;  4LFC K;  4GKJ K;  1FJG K;  4B3T K;  2HHH K;  3J7A P;  2VQE K;  4DV4 K;  4LF7 K;  3J81 O;  1IBM K;  1XMO K;  2UXD K;  2UXB K;  4DR6 K;  4KHP K;  4YHH K;  4DV1 K;  1HR0 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...