2ZM6K

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
total genus 24
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2zm6K00
3J80O 4DR5K 2UXBK 4OX9K 1HNWK 4B3RK 4LF8K 1N32K 4JI4K 3JAMO 4LF9K 4DV4K 1XNRK 4JI8K 4X66K 4B3MK 4DR2K 2VQFK 4DR3K 1XMOK 3J81O 4YHHK 1J5EK 3OTOK 4DR4K 4YY3K 4CVNE 5LMUK 1HNXK 1XNQK 1IBLK 4LFCK 4JI7K 2VQEK 4DV5K 2UUAK 1HR0K 4LFAK 2ZM6K 4DV2K 1XMQK 1N34K 4DUYK 4NXNK 4B3TK 4DV6K 4JV5K 2F4VK 2UXCK 2UXDK 4B3SK 1N36K 3J7YP 1N33K 1IBKK 4DV1K 4KHPK 4JYAK 4X62K 2UUBK 4GKKK 4DV0K 4LF4K 4DUZK 4X65K 5LL6Z 4LF5K 4DV7K 3T1YK 4DR7K 4DR1K 4JI2K 4LF6K 1I94K 4LF7K 2UUCK 4V19S 4DR6K 4NXMK 5IWAK 5A2QO 5LMNK 3J7AP 5BR8K 4X64K 4AQYK 4DV3K 4JI0K 2HHHK 4GKJK 4JI1K 4K0KK 4LFBK 4JI3K 4JI5K 2E5LK 2UU9K 1HNZK 5IT9O 4CW7B 5AJ3K 5FLXO 3T1HK 4JI6K 1FJGK 1IBMK
chains in the Genus database with same CATH superfamily
2QWPA 3SQ4A 4BDYA 4CZEA 4BRDA 1VSHA 3QB0A 1SL1A 4OVLA 3BUZB 4W5OA 4JS4A 2VQFK 4BQLA 2XO7A 2ATQA 4BE0A 3PX6A 5EOYA 1CZ9A 1A5XA 2E2QA 2NRHA 3AVGA 4M45A 3THWA 4ELTA 4CD3A 4GVEA 3D2FA 1NBWA 1RTHA 3A0IX 3P1GA 2KFNA 1VSLA 2Q1NA 3FGUA 3OHRA 3CHWA 5GINA 3S3NA 1SKSA 3TI0A 4B3TK 4AHVA 4MO4A 4Z94A 2A3ZA 4BREA 3TARA 3IRXA 5J2QA 1N6QA 2IGIA 1JXEA 4PL7A 4JKBA 1NG9A 4X62K 3AO3A 4Z4IA 1V4SA 1Q8IA 4OO1J 1HQEA 3A5LC 2D0OA 1RNHA 2PFUA 4GVMA 4ICLA 3VGMA 1QS4A 4HUGA 4LD0A 3QEWA 1J54A 4I9LA 3CCUN 4UY8O 4FZYA 2DY4A 4JKFA 4A57A 3EE9A 1KVCA 4Z4HA 1S6QA 5EU7A 1SL2A 1U4BA 3CC7N 3QESA 3P39A 2W6KA 3DLHA 1NGDA 5BPLA 4O4GA 4E3SA 4AQYK 4GNIA 4Y1DA 1L3UA 4DV3K 3KTQA 3OYEA 2NRVA 3ENOA 3L0QA 4L3QA 4YOYA 3V9WA 3AA3A 4JKCA 4CW7B 2E88A 4BVOA 2X78A 5C0YA 2QK9A 1S1UA 1U2VB 1FJGK 4DSJA 3W0LA 1HPZA 4DFJA 3VOVA 2F9WA 3PV8A 3L6QA 3VEXA 1ATNA 4KHSA 3K9KA 2DTUA 4GV6A 3SV4A 3RRGA 1QQMA 1RT3A 4IFEA 3M5RA 2DFHA 4B3OA 4E0DA 3A2FA 3KJVA 4QS7A 2OYQA 2HBLA 3MXJA 3TPQA 2P9SA 2BTFA 1HJOA 4E7IA 3MEEA 3EEQA 3THYA 4W5TA 3SMSA 1E4FT 1NGGA 3HZ6A 5CZ2A 3M6GA 2I7PA 5C2DA 5BPMA 3PO4A 1RT5A 1RT6A 4WE1A 2CGLA 3ZSZA 4FLTA 4FZXC 4EIAA 3EY1A 4DV5K 3QDKA 3PX0A 2H3GX 1VSMA 4CFBA 4DTRA 3WNHA 3AA4A 4N47A 4FWQA 4DV2K 3RMCA 2HNYA 1N34K 1NK8A 1KLMA 4FPAA 4ZTJA 2AP1A 4OKJA 2HBJA 1N5YA 2DFEA 1DTTA 4AM6A 5M1NA 4CEOA 1N33K 4KHPK 2D0CA 2FF3B 1C0FA 1JLEA 3RMDA 3O5BA 3P83D 4E7KA 2QTDA 2OTLN 4CEFA 4CEQA 2O8BA 1S22A 1T44A 4IJNA 1T6CA 1BGXT 1NK6A 1W0HA 4M3XA 3QEIA 4Q0BA 2OANA 3PO5A 5M1OA 1WBDA 4IFVA 3O6WA 3C0BA 3I55N 3D2FB 4M3YA 3HVTA 5H1SQ 4CHNA 3V1OA 4YOVA 4BR4A 1K8AO 3FFKB 1KTQA 4BRQA 1HNIA 2UU9K 4BR0A 3MXIA 3A8YA 2YHXA 3CMEN 5IT9O 3RSEB 3M8PA 3ENHA 5FLXO 2FF6A 1Z05A 3A5OC 2E6LA 1LWCA 1KQSM 3VENA 5FRMA 1ATSA 1BQNA 4FLWA 2UXBK 2ASPA 4OX9K 1DLOA 3OY9A 3QEVA 4QCLA 4ZHRA 4DB3A 4KREA 3AVMA 3MEGA 4WQ4A 3AO5A 5JLFA 1XNRK 3K5MA 4MLEA 4EP5A 3H1QA 4I2PA 4CBUA 5C10A 2O4IA 4FWSA 3ZSYA 3NH1A 3THXB 1NJYA 3F9KA 2D0BA 1LAVA 3OTOK 3NF7A 4DF4A 3KLEA 3DYAA 4J2EA 3P4IA 3ULDA 4DTJA 4BR2A 4KHUA 3PIOL 3TTFA 3NGIA 1S72N 3G0ZA 2HVIA 3ZT1A 2Y1JA 4JI7K 1HX1A 3LALA 1ZBHA 3FR0A 1MWMA 1B92A 4FK2A 4C8MA 3CQYA 3O9RA 3TAPA 5GAGP 4JK7A 4K8XA 3OW2M 1TKDA 1BIUA 3LDPA 1UA0A 4OJRA 4DS4A 4JV5K 3KIOA 1RCHA 1VQ4N 3UKRB 2WTUA 4FWRA 3OYBA 4H5RA 1N36K 4WQ4C 3O4QA 4CIFA 4CJ3A 4DTXA 3HM9A 2VG6A 5T7BA 1QQNA 5FRNA 5DMRA 1BI4A 1RGIA 3FZMA 3OYIA 1D5AA 4KKOA 4DSIA 1R0AA 2ETJA 2FBXA 1T7PA 5JVHL 4JK8A 3HYFA 4CF9A 4CJWA 2P1JA 5AQKA 1FK9A 3IMXA 5BRDA 1IH7A 4PKGA 1RDWX 3RTVA 4E7LA 4K0KK 4IEIA 3HOSA 4DQIA 4JNEA 1NJXA 1ZBUA 4HTLA 3ATVA 1VQMN 3CCJN 3T1HK 3AA2A 1YJNN 3CJAA 1IBMK 4B1UB 3AARA 2F9TA 2HHXA 1NK9A 3ID8A 5FROA 3F5TA 3LDLA 4NB4A 1HNVA 4EZ6A 4RG8A 4OLBA 1JL1A 3I33A 3CG7A 3KVGA 1QSLA 3ZETA 4JKAA 1BQMA 4DMNA 5E26A 1J9AA 3F9MA 2PBDA 5J2NA 4O55A 3AVCA 3OVNA 4ELVA 2YHYA 4HWIA 2G8HA 4ID1A 5AQMA 2O8CA 1EO1A 1XI1A 3D2EA 3T3FA 3CPEA 3LDQA 1QHAA 1HYSA 4CCHA 5AQQA 1FKPA 3AO4A 3WXJA 2CGKA 3I8BA 1BA1A 2X74A 5AQNA 4F4KA 1YAGA 1KCFA 1JCFA 1EETA 3DLLL 5KPTA 3MDQA 4FJIA 2YNGA 4CHPA 5AZIA 4F2RA 3EN9A 4JKDA 3B8AX 1WSJA 4KTWA 3H3OB 2UXCK 3G4SN 4A5BA 5AQWA 5HOOA 2HVHA 4IJAA 3QBWA 3CCMN 4NCBA 3DWLA 3DXMB 2UUBK 4CF0A 4FJ5A 3VQ9A 2YV0X 4LF5K 3UKUA 1VQ8N 3MWTA 2RN2A 2IOCA 1TKZA 3BY5A 1BISA 2R7YA 2EX3A 4J8FA 2CH6A 2D1KA 3UIQA 5LJVA 4BC2A 3OYLA 3AGKA 1WBBA 2JWKA 4BRMA 1VQ6N 3O3HA 1GLCG 1RT1A 3OYMA 4H03B 4YOWA 5C12A 4FYDA 1K8KA 4KHQA 3U3GA 4JI1K 3WEEB 3OJUA 3SMPA 1TK8A 4JD2B 1SL0A 3LM9A 3KKSA 3C6AA 4DSFA 3QLHA 1HMVA 4BGAA 4DTNA 3C95A 4CHZA 4KHWA 2VGNA 5AQLA 1ZYQA 2QKKA 2ZJRL 1TKTA 4CGGA 4BRAA 1VSJA 4F8RA 1HQUA 3KD5E 1QSSA 1QQOA 3VPZA 2O8DB 2BH1A 4FW1A 3MK6A 4CZGA 3PY8A 3K9JA 4M7XA 2CGJA 5HLFA 1HYZA 4KO0A 5M1QA 4Y0WA 4IZ9A 1E3MA 3AAPA 3E9PA 3O80A 3LPTA 2VG5A 4DTMA 2JGUA 1U45A 3KLHA 4B9SA 2HBMA 4BRPA 1NKCA 2D5RA 4K8ZA 3CC2N 2YKMA 4DR4K 3HRGA 2IAJA 5MLCQ 5J2PA 3QMLA 2IDOA 2FBVA 3IAYA 1HNXK 1WSIA 4ISFA 1XNQK 4YOXA 3H3NO 4H8KA 3AAQA 4RCHA 5ADXA 1Q18A 2Q36A 5AFUA 3AO2A 4EHUA 4FJHA 3D0PA 4XH4A 1Y64A 3E1YA 4FJXA 1V4TA 3CJBA 1VSDA 1X9SA 3ATUA 3VEWA 3WT0A 4DTUA 4CJVA 4FJKA 3NVKA 1MA9B 3S41A 4CZKA 1RT2A 3MXMA 4F3OA 4KB0A 2NRRA 1TK0A 4H4MA 1T8EA 4DV0K 3OS0A 3SNNA 1IKYA 1S9GA 1MDUB 5DM6L 3K0SA 4MO5A 3K59A 5I9EB 3L2WA 4LF7K 1YVUA 3CXCM 3O3GA 3ALYA 2A1SA 4E89A 2YHBA 1HKGA 5BRFA 1WSEA 1GLJO 4X64K 4LC9B 3TTCA 4G1QA 1J53A 3VF2A 1U2VA 5EXWA 4HCCA 1ZBIA 1GLEG 3CJ7A 3Q7BA 3SUOA 3UE5A 2G8UA 4JKEA 5AZIB 3DMJA 1J6ZA 1ESVA 2GUIA 1O13A 4PL8A 2B6AA 2OZSA 1NGAA 2OCEA 3N4QA 3LZIA 1J5OA 5CZ1A 3R8EA 1ZXOA 2E1YA 3VQQA 1YJWN 4DQ8A 3WUHA 4EFHA 1XWLA 3DLBA 1HKBA 4OKKA 4KTQA 3AVNA 2P9IA 4YDUA 3V9UA 1HLUA 4CF8A 2PAVA 4B9LA 3JYTA 1K8KB 3R3LA 5KGXA 1SV5A 1KRPA 4IBNA 2VG7A 2Q2RA 5D3GA 1NGHA 5KRTA 1EP4A 2VWJA 2RHKA 3HK2A 4BACA 2RF2A 4I6MA 1YT3A 3O08A 3SK3A 1KAYA 3EO3A 4DU4A 1Q9XA 3WXLA 4AHCA 2KLAA 2FLOA 2V7ZA 3O4NA 1NMDA 4FJ8A 4H5VA 2KW4A 3LWLA 3H45C 3RR7A 1S1TA 2I5JA 1QZ5A 4M3UA 2X6NA 4OPHA 1P8ZA 5KRSA 4EP4A 3KK1A 5JS1A 3TABA 1BL3A 1X3MA 4CJTA 1ZBSA 4B3SK 4W5RA 1RTDA 2FXUA 3HPGA 4YDUC 1NKBA 4GKKK 4KPYA 1NNEA 2YJFA 4H5WA 4KFBA 3AVIA 3E9LA 3NFAA 1YF5L 5JICA 1RILA 4FOIA 3BEXA 3CERA 3ZEUB 2QI2A 5FPNA 2RKIA 2HOEA 4DR1K 4FXDA 2FSJA 1EQYA 5C24A 3HOTA 4JK9A 3VQ4A 1DEJA 3DRSA 2FSKA 2GV9A 2YNHA 3RSEA 4CZHA 1NJZA 4DFKA 4Y1CA 1YITN 1ATRA 1WOQA 3NMUA 3BP8A 4JI3K 3WXKA 4RWTA 3IDHA 3RMAA 3KKRA 3PX4A 2F8TA 1HYVA 1NOYA 5AJ3K 1REVA 1FXXA 4CEBA 1YVNA 3ZT4A 1G99A 2O4GA 4DR5K 2Z1JA 1VQ5N 4FWPA 1VSFA 1YXQA 2WONA 2QXLA 5M1PA 2QWNA 4JS5A 3THXA 3MECA 4H0TB 3O8MA 1BG3A 3G25A 4CZIA 1D4XA 1C0GA 5J2MA 2OZMA 3DLRA 3FZKA 4B8CA 3FLCO 4DR3K 4O0JA 5HBMA 4YHHK 4B1XB 4CGFA 4B8AB 4BGBA 1KFDA 5K14A 3VTHA 4B1ZA 1IBLK 1DT9A 4PWDA 2W42A 1RDCA 1SAZA 4BG8A 3EYZA 4BWMA 2F96A 4JAXA 3NH0A 2BDPA 3TU5A 3UKRA 4JRQA 1NMNA 5KQDA 2YCHA 4Z0UA 4B9UA 2ZM6K 1ASUA 3DRRA 3T1AA 4JKGB 5HRRA 5AQSA 1NWKA 5GIPA 1VAZA 4DU1A 2KKZA 3EKSA 2A41A 2ITGA 3TSQA 4KI4A 2P9IB 3CM5A 1HKCA 1NGEA 1QHTA 3NF9A 1S1XA 3HXMA 2QWMA 1MWKA 4FWMA 1CZAN 1BUPA 2GEMA 2NRWA 3AVKA 4W5QA 1GOAA 2VWKA 1O1WA 5AQFA 3ZX3A 3L3UA 4OGCA 5FPDA 4DUZK 3LM2A 3ZX0A 3T1YK 4GV3A 3FE1A 5KGWA 3E01A 1GLBG 5HP1A 4CE9A 4V19S 3H1VX 4I6MB 1VSIA 3FZHA 3IFRA 1LV5A 4IOAL 1L3TA 4JRPA 2HHSA 3EZWA 4KH6A 4B1VA 1R59O 5C42A 2Q0UA 4C8LA 4CIGA 2YI1A 2GBZA 4MDBA 1LWEA 5KTQA 2P9NB 4A2BA 4N5SA 4BDPA 4CEDA 4C23A 2YHAA 3M3ZA 4JEPA 4LH4A 3U9ZA 2PY5A 4B9QA 1NGIA 1S3XA 2UYTA 4ILJA 4I7FA 3OYJA 2QEXN 1VRUA 1W7AA 4FOEA 5AQOA 1TL3A 3L8BA 3DLEA 3O9UA 1M90O 2E2NA 3E66A 1XHXA 4WCEL 4NLCA 4X66K 3J8AA 3VA3A 3D6RA 1NK0A 2NNWA 4GMJB 4RW6A 4H0PA 4O5BA 2W40A 1J5EK 4XH1A 4CIEA 1YTUA 2QWLA 4H5TA 3O9SA 4IDHA 1KC8O 1SKRA 3ZT3A 3EKUA 3LDNA 3VEZA 1LCUA 4YFUA 5HRPA 1UA1A 1KLNA 1L3SA 2F8SA 4ILGB 1S1WA 3NVMA 5CE3A 3PUFA 4DU3A 3DXMA 3OYGA 4NXNK 3EZ5A 1IKVA 5GADP 1B9DA 2BGGA 3OYFA 3SQ0A 1X9MA 3IKMA 3SQ2A 2OPSA 3CC4N 1D8YA 2G8IA 1NGJA 4A62A 2O8FB 3ITHA 4I2QA 4X65K 2LSNA 4PKIA 4B9NA 2E8AA 4CGDA 4K43A 5LJWA 3DOKA 5HRSA 3V9XA 3VQDA 4FWNA 1TYQA 3C7NA 2ZJPL 3AVAA 3KLGA 3WEEA 4BQZA 2XRIA 5IWAK 4ISEA 4JD2A 3H08A 1NOZA 4RW4A 1Q86O 4E1JA 1QSYA 2Z1IA 2P5OA 4BC4A 4L8RB 4CJRA 3CMAN 3LAKA 3BF1A 3L3VA 4CJKA 3AGRA 4TSXA 4FPBA 4LFBK 3OYDA 1YIJN 2GUPA 4JI5K 1JXBA 4E7JA 1SKWA 4PHTX 4QS8A 1OH6A 2O8DA 3KWIA 1YUWA 3AO1A 2HHWA 2PYLA 1VQLN 3KWGA 2YHWA 2IVPA 1WLJA 4RW8A 3SUQA 1GLFO 3R6MA 4DHYA 3KZBA 4KH4A 3OA9A 4H4OA 4BDZA 4B3MK 3VEVA 1WB9A 1P90A 4UQGA 4BC3A 3GDQA 4M3RA 3DXKB 1XMOK 1RT7A 3LP1A 1C6VA 2OPRA 3KLFA 2A40A 5LMUK 3V9SA 3HM8A 5DM7L 4DKWA 3OYHA 4M3WA 3TAFA 3L4QA 3NBPA 1NK7A 3CFPA 3C94A 3TSUA 4HTUA 3PIPL 4CZFA 4E7HA 4NLBA 1IKXA 1XMQK 1QE1A 5AR0A 2HNZA 4WYBA 1NKEA 3ZYYX 3FZLA 1RBTA 5HROA 3NE6A 1K6YA 3SCXA 3W3DA 1S6PA 3WQTA 3KK2A 1MU2A 2IVOA 2O8EA 5BN9A 4LF4K 3DLGA 4DV7K 4E19A 4IWVA 4C1NK 1T3VA 3F2KA 2B4JA 5TKWA 3AVHA 2KZMA 3ZSXA 2B5JA 5CY4A 1BIZA 1Q81O 5BR8K 3AVFA 2VCPA 1IG8A 4HUEA 3WNFA 3DAWA 1BDGA 2HHQA 4BRGA 1TVRA 2ZF5O 5KQ8A 5EY4A 5AQUA 3G71N 3SUPA 1HNZK 3ZT0A 3THVA 5C2FA 1TAUA 4BR7A 1OH8A 1HPMA 4IOCL 4A61A 4KI6A 2HBKA 3G6EN 1T05A 2NLXA 4CF1A 3D45A 3HBTA 4CZLA 4K42A 3JS6A 4CK2A 3CJ1A 3CCQN 1NJWA 1VRTA 4YOUA 3QEPA 4FJMA 3JAMO 1TYQB 4FO0A 3C7NB 3VN5A 3CFRA 1WUAA 4BE2A 1X3NA 2XY8A 2G8VA 1RT4A 1QTMA 1RDUA 4EZ9A 3SYZA 3K57A 4C8NA 1BA0A 2KHOA 1X9WA 1F21A 1DGKN 3ZLJA 3QERA 5C25A 3BGRA 4KB1A 1JLFA 1ZBFA 2HHTA 2E4LA 4KRFA 2GELA 3HT3A 4JHDB 3ENBA 1EWRA 4U7BA 4XH5A 3TAEA 3CD6N 1IO2A 2A6AA 4FLYA 5AQVA 3U9DA 2QM1A 2ZWHA 4DV6K 1Y97A 5BREA 3NF8A 3ZEUA 1ILYA 4KH5A 4Z4EA 1JJ2M 4M3ZA 3L2RA 1OKJA 1KFSA 4DQPA 4J2DA 2NRXA 5KI6A 4CFCA 2HB5A 2P5GA 1EWQA 3NH2A 4CEAA 2YJEA 3CJ9A 4B08A 3LWMA 4N76A 2OPPA 3CETA 2QWOA 4ISGA 5A2QO 2GWKA 1KD1O 3VESA 4AILC 4H0YB 4FM1A 3AY9A 1OH5A 2G8WA 4DSLA 2ZGZA 5BRHA 3V1RA 3P38A 1TV6A 4E1NA 4R79A 1VQNN 2QW9A 3ZCMA 4FJGA 3VF6A 5AQZA 1EXQA 1I3AA 1NM1A 2O8EB 3OBYA 4LSLA 4BROA 2NUBA 4CJLA 3JSMA 3G10A 3WNGA 1T03A 3O9QA 5F1XA 4PKHA 4CEZA 1HJRA 2JWLA 5AQXA 3TSPA 4R5PA 3CPWM 3UB5A 4EHTA 5FPMA 4O44A 2IC3A 3ZSWA 1Q9YA 4N41A 1VQ9N 4MFBA 3QIPA 3VQ8A 1JKHA 3J81O 3B6PA 4CJSA 2E2OA 2P9LB 1U49A 3MAQA 4H5NA 3R9PA 1CLQA 3PSIA 3SPYA 4JKGA 1UOCA 4B9TA 3JXUA 4FM2A 2DPNA 1ASVA 1HR0K 3CCRN 3LPUA 4CEEA 3VQBA 3U3YA 2A1RA 1DKGD 1HRHA 2WBNA 3N4PA 1BU6O 2F4VK 1RDDA 5M1FA 3AVJA 3HSTB 3NGZA 4CBWA 4DV1K 4FJ9A 3L2QA 4PUOA 4FW2A 2QWRA 3DJCA 4C8KA 3ZSVA 1QQCA 3PSFA 2QXFA 4J2BA 4PY5A 5HL7L 1OVYA 4IO9L 3OYNA 1LWFA 3R1XA 1D9FA 1C1CA 1A5WA 4OGEA 4CHOA 2P9NA 3MN9A 1M1KO 4IG3A 1BWFO 2KZZA 4RW9A 1JL2A 3M8SA 1NK5A 3O1WA 2RPIA 3VEOA 3VGLA 5C15A 4YOTA 4MLHA 2WC9A 3U8XA 2HMIA 4CHYA 3NF6A 3QICA 3DI6A 3QBXA 3RVCA 3S3OA 4BR5A 4AF1A 4DG1A 2FBTA 2HSTA 4OPAA 5EX5A 3LP3A 4BRKA 3J7ZO 3SJHA 4LF8K 4CZMA 3MMVA 4BRIA 2ZJQL 4FL9A 1CZBA 5I3UA 1RBVA 2XY7A 4CGJA 1RBRA 4AHUA 4BRHA 4PQUA 3MCAB 1UAXA 1JCGA 4H0OA 1LW0A 3VETA 1GOBA 2VGMA 4KV8A 1TUYA 1L3VA 3RWUA 5LY3A 1KVBA 3ISNC 5DK5A 1Z6RA 5AQPA 3NAEA 4FK4A 5AZJB 3KD1E 3AVBA 4QAGA 4XIUA 2QKBA 4BRNA 3QFPA 3LP0A 3LDSA 3T7ZA 2XHBA 3ZSRA 4KHYA 2HNDA 3NHGA 1FKOA 3VEYA 4CJ4A 3K58A 3CJCA 4B9VA 3ULEA 3GG4A 1Q82O 1YHQN 5ELZA 3MN6A 2O8FA 3V1QA 2G8KA 1WAFA 3LANA 1RBSA 2V52B 2GWJA 3H46O 4N56A 4HUFA 3QINA 4JYAK 3SZ2A 4CFDA 1U6ZA 1RBUA 3MN7A 2P51A 1CXUA 4CECA 1W9HA 1Q7YO 3SV3A 3U4LA 3MN5A 4DR7K 1XC3A 4CJPA 1K9MO 1I94K 2UUCK 4DR6K 4NXMK 4NO7A 3CIPA 2JLEA 1E4GT 2J4RA 4CBXA 4BRFA 5CR4A 2YNFA 3AV9A 4IDKA 5HRNA 3KK3A 3J7AP 4WFBL 3TR8A 4NCGA 4AHRA 2E6MA 4CESA 3QO9A 2HHHK 4KAZA 2W6LA 3CI5A 1ZBLA 1JLGA 4FLZA 1LAWA 2E5LK 1GLDG 1S9EA 1SUQA 4DWIA 4FZZA 4H0VB 2NZTA 1DTQA 1JLCA 4WQ5A 5JS2A 3ASMA 3TAMA 4CD1A 1Z25A 1TKXA 3ZT2A 5FPEA 4HVJA 1KSPA 1IG9A 1N32K 2AJQA 1VK0A 1S1VA 3EE8A 3HP9A 3DXKA 5AQYA 1U48A 1BCMA 4LF9K 3IG1A 3MX2A 5EVZA 3VQ7A 5AQRA 1RFQA 1C0MA 3VQEA 2ASMA 1QVGM 3GL1A 2P9UA 3OYCA 3D7EO 2X6SA 3KK7A 3V9ZA 2P9PA 4CK1A 3F73A 1ZC6A 2BANA 1D9DA 3DM2A 4KHNA 3S3MA 4NYNA 2Z1HA 4LFCK 1U47A 5BR9A 1IV0A 2F7TA 4FJNA 3O1BA 2BE2A 5SWMA 2YNIA 4WQ5C 3CCSN 4FM0A 3THWB 1VSEA 4BG9A 5JVGL 5CYQA 1XC9A 3GBTA 4GW6A 3ZX2A 3LAMA 3SQ1A 4GY2B 1EX4A 4BRCA 4O0IA 3L2UA 3BDPA 3RRHA 3ID6A 1ITGA 4BRLA 4WFAL 3BZKA 4DF8A 3WXMB 4CFAA 4A5AA 3C6UA 3NDKA 2FSNA 3CCVN 4JI2K 4LF6K 4M41A 3BF3A 2D0PA 3CQ8A 4FWKA 4FWLA 4M7YA 1BHLA 1SZ2A 4BC5A 5JMVA 1ASWA 5BN8A 2XY6A 1WN7A 2KQ2A 5LMNK 4ZTFA 3K5OA 3I56N 3FFIA 2OA8A 3I0RA 4C1NI 3HPOA 3C65A 3ULEB 2YX6A 3L4IA 1C1BA 4Z4GA 3VTIA 5BPNA 4G9ZA 3SBGA 2WFBA 3TAGA 3IS9A 1LW2A 5AQJA 4Z4FA 5CYMA 2QA4N 1RTIA 1C0UA 3QNOA 5JLHA 5E84A 4CGHA 4CJFA 3J80O 2E2PA 1C1AA 2HMPA 4FWOA 1A5VA 4ID5A 4JI4K 3VQPA 4DSKA 4KTZA 4FLXA 3TTDA 4WFNL 5F2RA 3QIOA 2Q3SA 3PLAA 3I0SA 1Z26A 3RMBA 3VQCA 1IJJA 4BE1A 2Q31A 4RTFD 4QS9A 3VQAA 4B1YB 4IXCA 4DLGA 1YTAA 2BUPA 4JHDA 4AHTA 2YKNA 1W97L 4CVNE 3GOIA 3VA0A 2P9SB 4CHQA 2AA4A 4CZJA 2KFZA 2VQEK 3THYB 2HF3A 2IVNA 4GV9A 4QOZB 2UUAK 2HW3A 4IO8A 3CF5L 4JN4A 2Q97A 1NLVA 4IKFA 1VHXA 4FK0A 4MQ3A 2A42A 4I9QA 4FJLA 4JKHA 4DTSA 1KVAA 3LZJA 1WSFA 2RE2A 3A5NC 4F9OA 1B9FA 4O5FA 1NGFA 3CFOA 2VYPA 2PZSA 3VF4A 5KPRA 4Q5VA 3J7YP 1IBKK 3B6OA 1K73O 4FJ7A 3MEDA 2P9UB 3CYMA 4FLUA 1NJIO 3M8QA 2G8FA 4DQQA 3TAQA 2P9PB 3H6EA 3SPZA 4PA1A 1JLAA 2ITMA 4BWJA 1JLBA 4KBOA 4F3TA 4M42A 3KHYA 4K41A 3OBWA 1VSKA 3SBTA 4CJEA 1VQON 1XUPO 3WXIA 3HTVA 1HUXA 1WSHA 3QEXA 2O8BB 3VQ6A 4OKEA 4JI0K 1QVFM 3O4WA 1NK4A 4EAHD 4OLAA 1TUUA 3WQUA 2CH5A 2D4WA 4RW7A 4IEEA 2OTJN 1I39A 4AM7A 1U04A 1NU0A 3I8DA 2KTQA 3ZSOA 3O9TA 4YNQA 4DSEA 3T19A 3RR8A 4DTPA 2A5XA 3MCPA 1T6DA 1UWBA 3VGKA 3M8RA 1HNWK 2WUSA 1BOTO 3WNEA 3IUCA 1EKEA 1VQKN 3MWPA 3P31A 2P9LA 3V4IA 3P5JA 4CGIA 4DV4K 4JI8K 4WF9L 4H0XB 4FVUA 3HPHA 5GAEP 4C8OA 4FVMA 3VERA 2E20A 4OPKA 1XQSC 5KPZA 1W2BM 1KXPA 3TANA 4M63C 1FW6A 4ELUA 2VWBA 4LH5A 3QETA 3Q7CA 2NRZA 4CF2A 1L5UA 2IS3A 1G15A 3KLIA 3K5NA 3FZFA 4DCHA 4CK3A 4O8KA 5CHIA 2P9KA 5AQHA 4AHSA 1SQKA 3O3FA 1RDBA 2GTDA 2HF4A 3LP2A 5AQTA 3DRPA 3A5MC 3LDOA 4DUYK 4CI6A 5B8HA 3OS2A 4CERA 3QNNA 4OPJA 1SS6A 5J1EA 3EL2A 2UXDK 3SJJA 3CQXA 4U67L 3BZCA 2GX9A 1LOTB 4E1MA 3OJSA 4BR9A 4DQSA 2HHVA 1TGOA 5AQIA 4DFMA 5LL6Z 4O8UA 5I42A 4W5NA 1IKWA 2QWQA 4B1WB 2ZQBA 1CXQA 4HHTA 2W41A 3CM6A 3HSCA 3HP6A 2ZGYA 2WOMA 3AVLA 4IFYA 1BI4B 3S9HA 3DLKA 1BO5O 4FJJA 4NYFA 1GLAG 2XY5A 1S5JA 2PYJA 1GOCA 3AA5X 1JLQA 4MDAA 1TL1A 4Z4CA 3L2VA 3SAHA 3T69A 3HI0A 1XHZA 1WNSA 1X1PA 4B3RK 3OYKA 2NRTA 3V81A 1C0TA 3OS1A 5M1KA 3CCLN 4FLVA 1TK5A 2HHUA 4CJQA 1WAJA 2Z1GA 3DOLA 3CCEN 5FDLA 2FC0A 4DR2K 3NGYA 5AZJA 2ASOA 5TKYA 1RTJA 3HVRA 3ZETB 3V6DA 3E9OA 1RDAA 4DQRA 1KAZA 1WSGA 4YY3K 1X9JA 4AH9A 1GLLO 2I7NA 4CJ5A 3NCIA 5AQGA 1JCEA 4A2AA 1QZ6A 3C6TA 3VQ5A 3C6HA 4LFAK 4YORA 1YI2N 2FBYA 4IOXA 3SI6A 3ZSQA 4M3TA 5ADXH 1KAXA 5AFUH 3OYAA 2O8CB 4DS5A 1OH7A 4DTOA 3M1FA 3D2EB 4A59A 3SAGA 5GAHP 1VQPN 3SAFA 2IIRA 4NCAA 4ILHA 1N8RO 1YJ9N 3SLCA 1BCOA 3LL3A 3VMFB 5GIOA 1NGCA 3MX5A 5SZTA 3TWHA 2V7YA 4F2SA 4K25A 4DLEA 2V51B 4JLHA 1VQ7N 1OVQA 3QFUA 4FSVA 4IG0A 2P9KB 3UKUB 3GE1A 4DFPA 2Y1IA 3HL8A 2ZD1A 4GKJK 2E1ZA 4LSNA 4XEIA 2EHGA 2Q0RA 2D0AA 2ZE2A 3HO1A 1NGBA 4B9MA 3K5LA 2DFFA 4BY9C 4J2AA 3SUNA 1H1VA 1TAQA 2OPQA 4CJUA 4FCYA 5E41A 2EWSA 4JI6K 4HCBA 5F0XA 4BVPA 3U6FA 4CJ7A 4LY7A 3K2PA 3HJFA
chains in the Genus database with same CATH topology
3J80O 4DR5K 2UXBK 4OX9K 1HNWK 4B3RK 4LF8K 1N32K 4JI4K 3JAMO 4LF9K 4DV4K 1XNRK 4JI8K 4X66K 4B3MK 4DR2K 2VQFK 4DR3K 1XMOK 3J81O 4YHHK 1J5EK 3OTOK 4DR4K 4YY3K 4CVNE 5LMUK 1HNXK 1XNQK 1IBLK 4LFCK 4JI7K 2VQEK 4DV5K 2UUAK 1HR0K 4LFAK 2ZM6K 4DV2K 1XMQK 1N34K 4DUYK 4NXNK 4B3TK 4DV6K 4JV5K 2F4VK 2UXCK 2UXDK 4B3SK 1N36K 3J7YP 1N33K 1IBKK 4DV1K 4KHPK 4JYAK 4X62K 2UUBK 4GKKK 4DV0K 4LF4K 4DUZK 4X65K 5LL6Z 4LF5K 4DV7K 3T1YK 4DR7K 4DR1K 4JI2K 4LF6K 1I94K 4LF7K 2UUCK 4V19S 4DR6K 4NXMK 5IWAK 5A2QO 5LMNK 3J7AP 5BR8K 4X64K 4AQYK 4DV3K 4JI0K 2HHHK 4GKJK 4JI1K 4K0KK 4LFBK 4JI3K 4JI5K 2E5LK 2UU9K 1HNZK 5IT9O 4CW7B 5AJ3K 5FLXO 3T1HK 4JI6K 1FJGK 1IBMK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 O;  4DR5 K;  2UXB K;  4OX9 K;  1HNW K;  4B3R K;  4LF8 K;  1N32 K;  4JI4 K;  3JAM O;  4LF9 K;  4DV4 K;  1XNR K;  4JI8 K;  4X66 K;  4B3M K;  4DR2 K;  2VQF K;  4DR3 K;  1XMO K;  3J81 O;  4YHH K;  1J5E K;  3OTO K;  4DR4 K;  4YY3 K;  4CVN E;  5LMU K;  1HNX K;  1XNQ K;  1IBL K;  4LFC K;  4JI7 K;  2VQE K;  4DV5 K;  2UUA K;  1HR0 K;  4LFA K;  2ZM6 K;  4DV2 K;  1XMQ K;  1N34 K;  4DUY K;  4NXN K;  4B3T K;  4DV6 K;  4JV5 K;  2F4V K;  2UXC K;  2UXD K;  4B3S K;  1N36 K;  3J7Y P;  1N33 K;  1IBK K;  4DV1 K;  4KHP K;  4JYA K;  4X62 K;  2UUB K;  4GKK K;  4DV0 K;  4LF4 K;  4DUZ K;  4X65 K;  5LL6 Z;  4LF5 K;  4DV7 K;  3T1Y K;  4DR7 K;  4DR1 K;  4JI2 K;  4LF6 K;  1I94 K;  4LF7 K;  2UUC K;  4V19 S;  4DR6 K;  4NXM K;  5IWA K;  5A2Q O;  5LMN K;  3J7A P;  5BR8 K;  4X64 K;  4AQY K;  4DV3 K;  4JI0 K;  2HHH K;  4GKJ K;  4JI1 K;  4K0K K;  4LFB K;  4JI3 K;  4JI5 K;  2E5L K;  2UU9 K;  1HNZ K;  5IT9 O;  4CW7 B;  5AJ3 K;  5FLX O;  3T1H K;  4JI6 K;  1FJG K;  1IBM K; 
#chains in the Genus database with same CATH topology
 2QWP A;  3SQ4 A;  4BDY A;  4CZE A;  4BRD A;  1VSH A;  3QB0 A;  1SL1 A;  4OVL A;  3BUZ B;  4W5O A;  4JS4 A;  2VQF K;  4BQL A;  2XO7 A;  2ATQ A;  4BE0 A;  3PX6 A;  5EOY A;  1CZ9 A;  1A5X A;  2E2Q A;  2NRH A;  3AVG A;  4M45 A;  3THW A;  4ELT A;  4CD3 A;  4GVE A;  3D2F A;  1NBW A;  1RTH A;  3A0I X;  3P1G A;  2KFN A;  1VSL A;  2Q1N A;  3FGU A;  3OHR A;  3CHW A;  5GIN A;  3S3N A;  1SKS A;  3TI0 A;  4B3T K;  4AHV A;  4MO4 A;  4Z94 A;  2A3Z A;  4BRE A;  3TAR A;  3IRX A;  5J2Q A;  1N6Q A;  2IGI A;  1JXE A;  4PL7 A;  4JKB A;  1NG9 A;  4X62 K;  3AO3 A;  4Z4I A;  1V4S A;  1Q8I A;  4OO1 J;  1HQE A;  3A5L C;  2D0O A;  1RNH A;  2PFU A;  4GVM A;  4ICL A;  3VGM A;  1QS4 A;  4HUG A;  4LD0 A;  3QEW A;  1J54 A;  4I9L A;  3CCU N;  4UY8 O;  4FZY A;  2DY4 A;  4JKF A;  4A57 A;  3EE9 A;  1KVC A;  4Z4H A;  1S6Q A;  5EU7 A;  1SL2 A;  1U4B A;  3CC7 N;  3QES A;  3P39 A;  2W6K A;  3DLH A;  1NGD A;  5BPL A;  4O4G A;  4E3S A;  4AQY K;  4GNI A;  4Y1D A;  1L3U A;  4DV3 K;  3KTQ A;  3OYE A;  2NRV A;  3ENO A;  3L0Q A;  4L3Q A;  4YOY A;  3V9W A;  3AA3 A;  4JKC A;  4CW7 B;  2E88 A;  4BVO A;  2X78 A;  5C0Y A;  2QK9 A;  1S1U A;  1U2V B;  1FJG K;  4DSJ A;  3W0L A;  1HPZ A;  4DFJ A;  3VOV A;  2F9W A;  3PV8 A;  3L6Q A;  3VEX A;  1ATN A;  4KHS A;  3K9K A;  2DTU A;  4GV6 A;  3SV4 A;  3RRG A;  1QQM A;  1RT3 A;  4IFE A;  3M5R A;  2DFH A;  4B3O A;  4E0D A;  3A2F A;  3KJV A;  4QS7 A;  2OYQ A;  2HBL A;  3MXJ A;  3TPQ A;  2P9S A;  2BTF A;  1HJO A;  4E7I A;  3MEE A;  3EEQ A;  3THY A;  4W5T A;  3SMS A;  1E4F T;  1NGG A;  3HZ6 A;  5CZ2 A;  3M6G A;  2I7P A;  5C2D A;  5BPM A;  3PO4 A;  1RT5 A;  1RT6 A;  4WE1 A;  2CGL A;  3ZSZ A;  4FLT A;  4FZX C;  4EIA A;  3EY1 A;  4DV5 K;  3QDK A;  3PX0 A;  2H3G X;  1VSM A;  4CFB A;  4DTR A;  3WNH A;  3AA4 A;  4N47 A;  4FWQ A;  4DV2 K;  3RMC A;  2HNY A;  1N34 K;  1NK8 A;  1KLM A;  4FPA A;  4ZTJ A;  2AP1 A;  4OKJ A;  2HBJ A;  1N5Y A;  2DFE A;  1DTT A;  4AM6 A;  5M1N A;  4CEO A;  1N33 K;  4KHP K;  2D0C A;  2FF3 B;  1C0F A;  1JLE A;  3RMD A;  3O5B A;  3P83 D;  4E7K A;  2QTD A;  2OTL N;  4CEF A;  4CEQ A;  2O8B A;  1S22 A;  1T44 A;  4IJN A;  1T6C A;  1BGX T;  1NK6 A;  1W0H A;  4M3X A;  3QEI A;  4Q0B A;  2OAN A;  3PO5 A;  5M1O A;  1WBD A;  4IFV A;  3O6W A;  3C0B A;  3I55 N;  3D2F B;  4M3Y A;  3HVT A;  5H1S Q;  4CHN A;  3V1O A;  4YOV A;  4BR4 A;  1K8A O;  3FFK B;  1KTQ A;  4BRQ A;  1HNI A;  2UU9 K;  4BR0 A;  3MXI A;  3A8Y A;  2YHX A;  3CME N;  5IT9 O;  3RSE B;  3M8P A;  3ENH A;  5FLX O;  2FF6 A;  1Z05 A;  3A5O C;  2E6L A;  1LWC A;  1KQS M;  3VEN A;  5FRM A;  1ATS A;  1BQN A;  4FLW A;  2UXB K;  2ASP A;  4OX9 K;  1DLO A;  3OY9 A;  3QEV A;  4QCL A;  4ZHR A;  4DB3 A;  4KRE A;  3AVM A;  3MEG A;  4WQ4 A;  3AO5 A;  5JLF A;  1XNR K;  3K5M A;  4MLE A;  4EP5 A;  3H1Q A;  4I2P A;  4CBU A;  5C10 A;  2O4I A;  4FWS A;  3ZSY A;  3NH1 A;  3THX B;  1NJY A;  3F9K A;  2D0B A;  1LAV A;  3OTO K;  3NF7 A;  4DF4 A;  3KLE A;  3DYA A;  4J2E A;  3P4I A;  3ULD A;  4DTJ A;  4BR2 A;  4KHU A;  3PIO L;  3TTF A;  3NGI A;  1S72 N;  3G0Z A;  2HVI A;  3ZT1 A;  2Y1J A;  4JI7 K;  1HX1 A;  3LAL A;  1ZBH A;  3FR0 A;  1MWM A;  1B92 A;  4FK2 A;  4C8M A;  3CQY A;  3O9R A;  3TAP A;  5GAG P;  4JK7 A;  4K8X A;  3OW2 M;  1TKD A;  1BIU A;  3LDP A;  1UA0 A;  4OJR A;  4DS4 A;  4JV5 K;  3KIO A;  1RCH A;  1VQ4 N;  3UKR B;  2WTU A;  4FWR A;  3OYB A;  4H5R A;  1N36 K;  4WQ4 C;  3O4Q A;  4CIF A;  4CJ3 A;  4DTX A;  3HM9 A;  2VG6 A;  5T7B A;  1QQN A;  5FRN A;  5DMR A;  1BI4 A;  1RGI A;  3FZM A;  3OYI A;  1D5A A;  4KKO A;  4DSI A;  1R0A A;  2ETJ A;  2FBX A;  1T7P A;  5JVH L;  4JK8 A;  3HYF A;  4CF9 A;  4CJW A;  2P1J A;  5AQK A;  1FK9 A;  3IMX A;  5BRD A;  1IH7 A;  4PKG A;  1RDW X;  3RTV A;  4E7L A;  4K0K K;  4IEI A;  3HOS A;  4DQI A;  4JNE A;  1NJX A;  1ZBU A;  4HTL A;  3ATV A;  1VQM N;  3CCJ N;  3T1H K;  3AA2 A;  1YJN N;  3CJA A;  1IBM K;  4B1U B;  3AAR A;  2F9T A;  2HHX A;  1NK9 A;  3ID8 A;  5FRO A;  3F5T A;  3LDL A;  4NB4 A;  1HNV A;  4EZ6 A;  4RG8 A;  4OLB A;  1JL1 A;  3I33 A;  3CG7 A;  3KVG A;  1QSL A;  3ZET A;  4JKA A;  1BQM A;  4DMN A;  5E26 A;  1J9A A;  3F9M A;  2PBD A;  5J2N A;  4O55 A;  3AVC A;  3OVN A;  4ELV A;  2YHY A;  4HWI A;  2G8H A;  4ID1 A;  5AQM A;  2O8C A;  1EO1 A;  1XI1 A;  3D2E A;  3T3F A;  3CPE A;  3LDQ A;  1QHA A;  1HYS A;  4CCH A;  5AQQ A;  1FKP A;  3AO4 A;  3WXJ A;  2CGK A;  3I8B A;  1BA1 A;  2X74 A;  5AQN A;  4F4K A;  1YAG A;  1KCF A;  1JCF A;  1EET A;  3DLL L;  5KPT A;  3MDQ A;  4FJI A;  2YNG A;  4CHP A;  5AZI A;  4F2R A;  3EN9 A;  4JKD A;  3B8A X;  1WSJ A;  4KTW A;  3H3O B;  2UXC K;  3G4S N;  4A5B A;  5AQW A;  5HOO A;  2HVH A;  4IJA A;  3QBW A;  3CCM N;  4NCB A;  3DWL A;  3DXM B;  2UUB K;  4CF0 A;  4FJ5 A;  3VQ9 A;  2YV0 X;  4LF5 K;  3UKU A;  1VQ8 N;  3MWT A;  2RN2 A;  2IOC A;  1TKZ A;  3BY5 A;  1BIS A;  2R7Y A;  2EX3 A;  4J8F A;  2CH6 A;  2D1K A;  3UIQ A;  5LJV A;  4BC2 A;  3OYL A;  3AGK A;  1WBB A;  2JWK A;  4BRM A;  1VQ6 N;  3O3H A;  1GLC G;  1RT1 A;  3OYM A;  4H03 B;  4YOW A;  5C12 A;  4FYD A;  1K8K A;  4KHQ A;  3U3G A;  4JI1 K;  3WEE B;  3OJU A;  3SMP A;  1TK8 A;  4JD2 B;  1SL0 A;  3LM9 A;  3KKS A;  3C6A A;  4DSF A;  3QLH A;  1HMV A;  4BGA A;  4DTN A;  3C95 A;  4CHZ A;  4KHW A;  2VGN A;  5AQL A;  1ZYQ A;  2QKK A;  2ZJR L;  1TKT A;  4CGG A;  4BRA A;  1VSJ A;  4F8R A;  1HQU A;  3KD5 E;  1QSS A;  1QQO A;  3VPZ A;  2O8D B;  2BH1 A;  4FW1 A;  3MK6 A;  4CZG A;  3PY8 A;  3K9J A;  4M7X A;  2CGJ A;  5HLF A;  1HYZ A;  4KO0 A;  5M1Q A;  4Y0W A;  4IZ9 A;  1E3M A;  3AAP A;  3E9P A;  3O80 A;  3LPT A;  2VG5 A;  4DTM A;  2JGU A;  1U45 A;  3KLH A;  4B9S A;  2HBM A;  4BRP A;  1NKC A;  2D5R A;  4K8Z A;  3CC2 N;  2YKM A;  4DR4 K;  3HRG A;  2IAJ A;  5MLC Q;  5J2P A;  3QML A;  2IDO A;  2FBV A;  3IAY A;  1HNX K;  1WSI A;  4ISF A;  1XNQ K;  4YOX A;  3H3N O;  4H8K A;  3AAQ A;  4RCH A;  5ADX A;  1Q18 A;  2Q36 A;  5AFU A;  3AO2 A;  4EHU A;  4FJH A;  3D0P A;  4XH4 A;  1Y64 A;  3E1Y A;  4FJX A;  1V4T A;  3CJB A;  1VSD A;  1X9S A;  3ATU A;  3VEW A;  3WT0 A;  4DTU A;  4CJV A;  4FJK A;  3NVK A;  1MA9 B;  3S41 A;  4CZK A;  1RT2 A;  3MXM A;  4F3O A;  4KB0 A;  2NRR A;  1TK0 A;  4H4M A;  1T8E A;  4DV0 K;  3OS0 A;  3SNN A;  1IKY A;  1S9G A;  1MDU B;  5DM6 L;  3K0S A;  4MO5 A;  3K59 A;  5I9E B;  3L2W A;  4LF7 K;  1YVU A;  3CXC M;  3O3G A;  3ALY A;  2A1S A;  4E89 A;  2YHB A;  1HKG A;  5BRF A;  1WSE A;  1GLJ O;  4X64 K;  4LC9 B;  3TTC A;  4G1Q A;  1J53 A;  3VF2 A;  1U2V A;  5EXW A;  4HCC A;  1ZBI A;  1GLE G;  3CJ7 A;  3Q7B A;  3SUO A;  3UE5 A;  2G8U A;  4JKE A;  5AZI B;  3DMJ A;  1J6Z A;  1ESV A;  2GUI A;  1O13 A;  4PL8 A;  2B6A A;  2OZS A;  1NGA A;  2OCE A;  3N4Q A;  3LZI A;  1J5O A;  5CZ1 A;  3R8E A;  1ZXO A;  2E1Y A;  3VQQ A;  1YJW N;  4DQ8 A;  3WUH A;  4EFH A;  1XWL A;  3DLB A;  1HKB A;  4OKK A;  4KTQ A;  3AVN A;  2P9I A;  4YDU A;  3V9U A;  1HLU A;  4CF8 A;  2PAV A;  4B9L A;  3JYT A;  1K8K B;  3R3L A;  5KGX A;  1SV5 A;  1KRP A;  4IBN A;  2VG7 A;  2Q2R A;  5D3G A;  1NGH A;  5KRT A;  1EP4 A;  2VWJ A;  2RHK A;  3HK2 A;  4BAC A;  2RF2 A;  4I6M A;  1YT3 A;  3O08 A;  3SK3 A;  1KAY A;  3EO3 A;  4DU4 A;  1Q9X A;  3WXL A;  4AHC A;  2KLA A;  2FLO A;  2V7Z A;  3O4N A;  1NMD A;  4FJ8 A;  4H5V A;  2KW4 A;  3LWL A;  3H45 C;  3RR7 A;  1S1T A;  2I5J A;  1QZ5 A;  4M3U A;  2X6N A;  4OPH A;  1P8Z A;  5KRS A;  4EP4 A;  3KK1 A;  5JS1 A;  3TAB A;  1BL3 A;  1X3M A;  4CJT A;  1ZBS A;  4B3S K;  4W5R A;  1RTD A;  2FXU A;  3HPG A;  4YDU C;  1NKB A;  4GKK K;  4KPY A;  1NNE A;  2YJF A;  4H5W A;  4KFB A;  3AVI A;  3E9L A;  3NFA A;  1YF5 L;  5JIC A;  1RIL A;  4FOI A;  3BEX A;  3CER A;  3ZEU B;  2QI2 A;  5FPN A;  2RKI A;  2HOE A;  4DR1 K;  4FXD A;  2FSJ A;  1EQY A;  5C24 A;  3HOT A;  4JK9 A;  3VQ4 A;  1DEJ A;  3DRS A;  2FSK A;  2GV9 A;  2YNH A;  3RSE A;  4CZH A;  1NJZ A;  4DFK A;  4Y1C A;  1YIT N;  1ATR A;  1WOQ A;  3NMU A;  3BP8 A;  4JI3 K;  3WXK A;  4RWT A;  3IDH A;  3RMA A;  3KKR A;  3PX4 A;  2F8T A;  1HYV A;  1NOY A;  5AJ3 K;  1REV A;  1FXX A;  4CEB A;  1YVN A;  3ZT4 A;  1G99 A;  2O4G A;  4DR5 K;  2Z1J A;  1VQ5 N;  4FWP A;  1VSF A;  1YXQ A;  2WON A;  2QXL A;  5M1P A;  2QWN A;  4JS5 A;  3THX A;  3MEC A;  4H0T B;  3O8M A;  1BG3 A;  3G25 A;  4CZI A;  1D4X A;  1C0G A;  5J2M A;  2OZM A;  3DLR A;  3FZK A;  4B8C A;  3FLC O;  4DR3 K;  4O0J A;  5HBM A;  4YHH K;  4B1X B;  4CGF A;  4B8A B;  4BGB A;  1KFD A;  5K14 A;  3VTH A;  4B1Z A;  1IBL K;  1DT9 A;  4PWD A;  2W42 A;  1RDC A;  1SAZ A;  4BG8 A;  3EYZ A;  4BWM A;  2F96 A;  4JAX A;  3NH0 A;  2BDP A;  3TU5 A;  3UKR A;  4JRQ A;  1NMN A;  5KQD A;  2YCH A;  4Z0U A;  4B9U A;  2ZM6 K;  1ASU A;  3DRR A;  3T1A A;  4JKG B;  5HRR A;  5AQS A;  1NWK A;  5GIP A;  1VAZ A;  4DU1 A;  2KKZ A;  3EKS A;  2A41 A;  2ITG A;  3TSQ A;  4KI4 A;  2P9I B;  3CM5 A;  1HKC A;  1NGE A;  1QHT A;  3NF9 A;  1S1X A;  3HXM A;  2QWM A;  1MWK A;  4FWM A;  1CZA N;  1BUP A;  2GEM A;  2NRW A;  3AVK A;  4W5Q A;  1GOA A;  2VWK A;  1O1W A;  5AQF A;  3ZX3 A;  3L3U A;  4OGC A;  5FPD A;  4DUZ K;  3LM2 A;  3ZX0 A;  3T1Y K;  4GV3 A;  3FE1 A;  5KGW A;  3E01 A;  1GLB G;  5HP1 A;  4CE9 A;  4V19 S;  3H1V X;  4I6M B;  1VSI A;  3FZH A;  3IFR A;  1LV5 A;  4IOA L;  1L3T A;  4JRP A;  2HHS A;  3EZW A;  4KH6 A;  4B1V A;  1R59 O;  5C42 A;  2Q0U A;  4C8L A;  4CIG A;  2YI1 A;  2GBZ A;  4MDB A;  1LWE A;  5KTQ A;  2P9N B;  4A2B A;  4N5S A;  4BDP A;  4CED A;  4C23 A;  2YHA A;  3M3Z A;  4JEP A;  4LH4 A;  3U9Z A;  2PY5 A;  4B9Q A;  1NGI A;  1S3X A;  2UYT A;  4ILJ A;  4I7F A;  3OYJ A;  2QEX N;  1VRU A;  1W7A A;  4FOE A;  5AQO A;  1TL3 A;  3L8B A;  3DLE A;  3O9U A;  1M90 O;  2E2N A;  3E66 A;  1XHX A;  4WCE L;  4NLC A;  4X66 K;  3J8A A;  3VA3 A;  3D6R A;  1NK0 A;  2NNW A;  4GMJ B;  4RW6 A;  4H0P A;  4O5B A;  2W40 A;  1J5E K;  4XH1 A;  4CIE A;  1YTU A;  2QWL A;  4H5T A;  3O9S A;  4IDH A;  1KC8 O;  1SKR A;  3ZT3 A;  3EKU A;  3LDN A;  3VEZ A;  1LCU A;  4YFU A;  5HRP A;  1UA1 A;  1KLN A;  1L3S A;  2F8S A;  4ILG B;  1S1W A;  3NVM A;  5CE3 A;  3PUF A;  4DU3 A;  3DXM A;  3OYG A;  4NXN K;  3EZ5 A;  1IKV A;  5GAD P;  1B9D A;  2BGG A;  3OYF A;  3SQ0 A;  1X9M A;  3IKM A;  3SQ2 A;  2OPS A;  3CC4 N;  1D8Y A;  2G8I A;  1NGJ A;  4A62 A;  2O8F B;  3ITH A;  4I2Q A;  4X65 K;  2LSN A;  4PKI A;  4B9N A;  2E8A A;  4CGD A;  4K43 A;  5LJW A;  3DOK A;  5HRS A;  3V9X A;  3VQD A;  4FWN A;  1TYQ A;  3C7N A;  2ZJP L;  3AVA A;  3KLG A;  3WEE A;  4BQZ A;  2XRI A;  5IWA K;  4ISE A;  4JD2 A;  3H08 A;  1NOZ A;  4RW4 A;  1Q86 O;  4E1J A;  1QSY A;  2Z1I A;  2P5O A;  4BC4 A;  4L8R B;  4CJR A;  3CMA N;  3LAK A;  3BF1 A;  3L3V A;  4CJK A;  3AGR A;  4TSX A;  4FPB A;  4LFB K;  3OYD A;  1YIJ N;  2GUP A;  4JI5 K;  1JXB A;  4E7J A;  1SKW A;  4PHT X;  4QS8 A;  1OH6 A;  2O8D A;  3KWI A;  1YUW A;  3AO1 A;  2HHW A;  2PYL A;  1VQL N;  3KWG A;  2YHW A;  2IVP A;  1WLJ A;  4RW8 A;  3SUQ A;  1GLF O;  3R6M A;  4DHY A;  3KZB A;  4KH4 A;  3OA9 A;  4H4O A;  4BDZ A;  4B3M K;  3VEV A;  1WB9 A;  1P90 A;  4UQG A;  4BC3 A;  3GDQ A;  4M3R A;  3DXK B;  1XMO K;  1RT7 A;  3LP1 A;  1C6V A;  2OPR A;  3KLF A;  2A40 A;  5LMU K;  3V9S A;  3HM8 A;  5DM7 L;  4DKW A;  3OYH A;  4M3W A;  3TAF A;  3L4Q A;  3NBP A;  1NK7 A;  3CFP A;  3C94 A;  3TSU A;  4HTU A;  3PIP L;  4CZF A;  4E7H A;  4NLB A;  1IKX A;  1XMQ K;  1QE1 A;  5AR0 A;  2HNZ A;  4WYB A;  1NKE A;  3ZYY X;  3FZL A;  1RBT A;  5HRO A;  3NE6 A;  1K6Y A;  3SCX A;  3W3D A;  1S6P A;  3WQT A;  3KK2 A;  1MU2 A;  2IVO A;  2O8E A;  5BN9 A;  4LF4 K;  3DLG A;  4DV7 K;  4E19 A;  4IWV A;  4C1N K;  1T3V A;  3F2K A;  2B4J A;  5TKW A;  3AVH A;  2KZM A;  3ZSX A;  2B5J A;  5CY4 A;  1BIZ A;  1Q81 O;  5BR8 K;  3AVF A;  2VCP A;  1IG8 A;  4HUE A;  3WNF A;  3DAW A;  1BDG A;  2HHQ A;  4BRG A;  1TVR A;  2ZF5 O;  5KQ8 A;  5EY4 A;  5AQU A;  3G71 N;  3SUP A;  1HNZ K;  3ZT0 A;  3THV A;  5C2F A;  1TAU A;  4BR7 A;  1OH8 A;  1HPM A;  4IOC L;  4A61 A;  4KI6 A;  2HBK A;  3G6E N;  1T05 A;  2NLX A;  4CF1 A;  3D45 A;  3HBT A;  4CZL A;  4K42 A;  3JS6 A;  4CK2 A;  3CJ1 A;  3CCQ N;  1NJW A;  1VRT A;  4YOU A;  3QEP A;  4FJM A;  3JAM O;  1TYQ B;  4FO0 A;  3C7N B;  3VN5 A;  3CFR A;  1WUA A;  4BE2 A;  1X3N A;  2XY8 A;  2G8V A;  1RT4 A;  1QTM A;  1RDU A;  4EZ9 A;  3SYZ A;  3K57 A;  4C8N A;  1BA0 A;  2KHO A;  1X9W A;  1F21 A;  1DGK N;  3ZLJ A;  3QER A;  5C25 A;  3BGR A;  4KB1 A;  1JLF A;  1ZBF A;  2HHT A;  2E4L A;  4KRF A;  2GEL A;  3HT3 A;  4JHD B;  3ENB A;  1EWR A;  4U7B A;  4XH5 A;  3TAE A;  3CD6 N;  1IO2 A;  2A6A A;  4FLY A;  5AQV A;  3U9D A;  2QM1 A;  2ZWH A;  4DV6 K;  1Y97 A;  5BRE A;  3NF8 A;  3ZEU A;  1ILY A;  4KH5 A;  4Z4E A;  1JJ2 M;  4M3Z A;  3L2R A;  1OKJ A;  1KFS A;  4DQP A;  4J2D A;  2NRX A;  5KI6 A;  4CFC A;  2HB5 A;  2P5G A;  1EWQ A;  3NH2 A;  4CEA A;  2YJE A;  3CJ9 A;  4B08 A;  3LWM A;  4N76 A;  2OPP A;  3CET A;  2QWO A;  4ISG A;  5A2Q O;  2GWK A;  1KD1 O;  3VES A;  4AIL C;  4H0Y B;  4FM1 A;  3AY9 A;  1OH5 A;  2G8W A;  4DSL A;  2ZGZ A;  5BRH A;  3V1R A;  3P38 A;  1TV6 A;  4E1N A;  4R79 A;  1VQN N;  2QW9 A;  3ZCM A;  4FJG A;  3VF6 A;  5AQZ A;  1EXQ A;  1I3A A;  1NM1 A;  2O8E B;  3OBY A;  4LSL A;  4BRO A;  2NUB A;  4CJL A;  3JSM A;  3G10 A;  3WNG A;  1T03 A;  3O9Q A;  5F1X A;  4PKH A;  4CEZ A;  1HJR A;  2JWL A;  5AQX A;  3TSP A;  4R5P A;  3CPW M;  3UB5 A;  4EHT A;  5FPM A;  4O44 A;  2IC3 A;  3ZSW A;  1Q9Y A;  4N41 A;  1VQ9 N;  4MFB A;  3QIP A;  3VQ8 A;  1JKH A;  3J81 O;  3B6P A;  4CJS A;  2E2O A;  2P9L B;  1U49 A;  3MAQ A;  4H5N A;  3R9P A;  1CLQ A;  3PSI A;  3SPY A;  4JKG A;  1UOC A;  4B9T A;  3JXU A;  4FM2 A;  2DPN A;  1ASV A;  1HR0 K;  3CCR N;  3LPU A;  4CEE A;  3VQB A;  3U3Y A;  2A1R A;  1DKG D;  1HRH A;  2WBN A;  3N4P A;  1BU6 O;  2F4V K;  1RDD A;  5M1F A;  3AVJ A;  3HST B;  3NGZ A;  4CBW A;  4DV1 K;  4FJ9 A;  3L2Q A;  4PUO A;  4FW2 A;  2QWR A;  3DJC A;  4C8K A;  3ZSV A;  1QQC A;  3PSF A;  2QXF A;  4J2B A;  4PY5 A;  5HL7 L;  1OVY A;  4IO9 L;  3OYN A;  1LWF A;  3R1X A;  1D9F A;  1C1C A;  1A5W A;  4OGE A;  4CHO A;  2P9N A;  3MN9 A;  1M1K O;  4IG3 A;  1BWF O;  2KZZ A;  4RW9 A;  1JL2 A;  3M8S A;  1NK5 A;  3O1W A;  2RPI A;  3VEO A;  3VGL A;  5C15 A;  4YOT A;  4MLH A;  2WC9 A;  3U8X A;  2HMI A;  4CHY A;  3NF6 A;  3QIC A;  3DI6 A;  3QBX A;  3RVC A;  3S3O A;  4BR5 A;  4AF1 A;  4DG1 A;  2FBT A;  2HST A;  4OPA A;  5EX5 A;  3LP3 A;  4BRK A;  3J7Z O;  3SJH A;  4LF8 K;  4CZM A;  3MMV A;  4BRI A;  2ZJQ L;  4FL9 A;  1CZB A;  5I3U A;  1RBV A;  2XY7 A;  4CGJ A;  1RBR A;  4AHU A;  4BRH A;  4PQU A;  3MCA B;  1UAX A;  1JCG A;  4H0O A;  1LW0 A;  3VET A;  1GOB A;  2VGM A;  4KV8 A;  1TUY A;  1L3V A;  3RWU A;  5LY3 A;  1KVB A;  3ISN C;  5DK5 A;  1Z6R A;  5AQP A;  3NAE A;  4FK4 A;  5AZJ B;  3KD1 E;  3AVB A;  4QAG A;  4XIU A;  2QKB A;  4BRN A;  3QFP A;  3LP0 A;  3LDS A;  3T7Z A;  2XHB A;  3ZSR A;  4KHY A;  2HND A;  3NHG A;  1FKO A;  3VEY A;  4CJ4 A;  3K58 A;  3CJC A;  4B9V A;  3ULE A;  3GG4 A;  1Q82 O;  1YHQ N;  5ELZ A;  3MN6 A;  2O8F A;  3V1Q A;  2G8K A;  1WAF A;  3LAN A;  1RBS A;  2V52 B;  2GWJ A;  3H46 O;  4N56 A;  4HUF A;  3QIN A;  4JYA K;  3SZ2 A;  4CFD A;  1U6Z A;  1RBU A;  3MN7 A;  2P51 A;  1CXU A;  4CEC A;  1W9H A;  1Q7Y O;  3SV3 A;  3U4L A;  3MN5 A;  4DR7 K;  1XC3 A;  4CJP A;  1K9M O;  1I94 K;  2UUC K;  4DR6 K;  4NXM K;  4NO7 A;  3CIP A;  2JLE A;  1E4G T;  2J4R A;  4CBX A;  4BRF A;  5CR4 A;  2YNF A;  3AV9 A;  4IDK A;  5HRN A;  3KK3 A;  3J7A P;  4WFB L;  3TR8 A;  4NCG A;  4AHR A;  2E6M A;  4CES A;  3QO9 A;  2HHH K;  4KAZ A;  2W6L A;  3CI5 A;  1ZBL A;  1JLG A;  4FLZ A;  1LAW A;  2E5L K;  1GLD G;  1S9E A;  1SUQ A;  4DWI A;  4FZZ A;  4H0V B;  2NZT A;  1DTQ A;  1JLC A;  4WQ5 A;  5JS2 A;  3ASM A;  3TAM A;  4CD1 A;  1Z25 A;  1TKX A;  3ZT2 A;  5FPE A;  4HVJ A;  1KSP A;  1IG9 A;  1N32 K;  2AJQ A;  1VK0 A;  1S1V A;  3EE8 A;  3HP9 A;  3DXK A;  5AQY A;  1U48 A;  1BCM A;  4LF9 K;  3IG1 A;  3MX2 A;  5EVZ A;  3VQ7 A;  5AQR A;  1RFQ A;  1C0M A;  3VQE A;  2ASM A;  1QVG M;  3GL1 A;  2P9U A;  3OYC A;  3D7E O;  2X6S A;  3KK7 A;  3V9Z A;  2P9P A;  4CK1 A;  3F73 A;  1ZC6 A;  2BAN A;  1D9D A;  3DM2 A;  4KHN A;  3S3M A;  4NYN A;  2Z1H A;  4LFC K;  1U47 A;  5BR9 A;  1IV0 A;  2F7T A;  4FJN A;  3O1B A;  2BE2 A;  5SWM A;  2YNI A;  4WQ5 C;  3CCS N;  4FM0 A;  3THW B;  1VSE A;  4BG9 A;  5JVG L;  5CYQ A;  1XC9 A;  3GBT A;  4GW6 A;  3ZX2 A;  3LAM A;  3SQ1 A;  4GY2 B;  1EX4 A;  4BRC A;  4O0I A;  3L2U A;  3BDP A;  3RRH A;  3ID6 A;  1ITG A;  4BRL A;  4WFA L;  3BZK A;  4DF8 A;  3WXM B;  4CFA A;  4A5A A;  3C6U A;  3NDK A;  2FSN A;  3CCV N;  4JI2 K;  4LF6 K;  4M41 A;  3BF3 A;  2D0P A;  3CQ8 A;  4FWK A;  4FWL A;  4M7Y A;  1BHL A;  1SZ2 A;  4BC5 A;  5JMV A;  1ASW A;  5BN8 A;  2XY6 A;  1WN7 A;  2KQ2 A;  5LMN K;  4ZTF A;  3K5O A;  3I56 N;  3FFI A;  2OA8 A;  3I0R A;  4C1N I;  3HPO A;  3C65 A;  3ULE B;  2YX6 A;  3L4I A;  1C1B A;  4Z4G A;  3VTI A;  5BPN A;  4G9Z A;  3SBG A;  2WFB A;  3TAG A;  3IS9 A;  1LW2 A;  5AQJ A;  4Z4F A;  5CYM A;  2QA4 N;  1RTI A;  1C0U A;  3QNO A;  5JLH A;  5E84 A;  4CGH A;  4CJF A;  3J80 O;  2E2P A;  1C1A A;  2HMP A;  4FWO A;  1A5V A;  4ID5 A;  4JI4 K;  3VQP A;  4DSK A;  4KTZ A;  4FLX A;  3TTD A;  4WFN L;  5F2R A;  3QIO A;  2Q3S A;  3PLA A;  3I0S A;  1Z26 A;  3RMB A;  3VQC A;  1IJJ A;  4BE1 A;  2Q31 A;  4RTF D;  4QS9 A;  3VQA A;  4B1Y B;  4IXC A;  4DLG A;  1YTA A;  2BUP A;  4JHD A;  4AHT A;  2YKN A;  1W97 L;  4CVN E;  3GOI A;  3VA0 A;  2P9S B;  4CHQ A;  2AA4 A;  4CZJ A;  2KFZ A;  2VQE K;  3THY B;  2HF3 A;  2IVN A;  4GV9 A;  4QOZ B;  2UUA K;  2HW3 A;  4IO8 A;  3CF5 L;  4JN4 A;  2Q97 A;  1NLV A;  4IKF A;  1VHX A;  4FK0 A;  4MQ3 A;  2A42 A;  4I9Q A;  4FJL A;  4JKH A;  4DTS A;  1KVA A;  3LZJ A;  1WSF A;  2RE2 A;  3A5N C;  4F9O A;  1B9F A;  4O5F A;  1NGF A;  3CFO A;  2VYP A;  2PZS A;  3VF4 A;  5KPR A;  4Q5V A;  3J7Y P;  1IBK K;  3B6O A;  1K73 O;  4FJ7 A;  3MED A;  2P9U B;  3CYM A;  4FLU A;  1NJI O;  3M8Q A;  2G8F A;  4DQQ A;  3TAQ A;  2P9P B;  3H6E A;  3SPZ A;  4PA1 A;  1JLA A;  2ITM A;  4BWJ A;  1JLB A;  4KBO A;  4F3T A;  4M42 A;  3KHY A;  4K41 A;  3OBW A;  1VSK A;  3SBT A;  4CJE A;  1VQO N;  1XUP O;  3WXI A;  3HTV A;  1HUX A;  1WSH A;  3QEX A;  2O8B B;  3VQ6 A;  4OKE A;  4JI0 K;  1QVF M;  3O4W A;  1NK4 A;  4EAH D;  4OLA A;  1TUU A;  3WQU A;  2CH5 A;  2D4W A;  4RW7 A;  4IEE A;  2OTJ N;  1I39 A;  4AM7 A;  1U04 A;  1NU0 A;  3I8D A;  2KTQ A;  3ZSO A;  3O9T A;  4YNQ A;  4DSE A;  3T19 A;  3RR8 A;  4DTP A;  2A5X A;  3MCP A;  1T6D A;  1UWB A;  3VGK A;  3M8R A;  1HNW K;  2WUS A;  1BOT O;  3WNE A;  3IUC A;  1EKE A;  1VQK N;  3MWP A;  3P31 A;  2P9L A;  3V4I A;  3P5J A;  4CGI A;  4DV4 K;  4JI8 K;  4WF9 L;  4H0X B;  4FVU A;  3HPH A;  5GAE P;  4C8O A;  4FVM A;  3VER A;  2E20 A;  4OPK A;  1XQS C;  5KPZ A;  1W2B M;  1KXP A;  3TAN A;  4M63 C;  1FW6 A;  4ELU A;  2VWB A;  4LH5 A;  3QET A;  3Q7C A;  2NRZ A;  4CF2 A;  1L5U A;  2IS3 A;  1G15 A;  3KLI A;  3K5N A;  3FZF A;  4DCH A;  4CK3 A;  4O8K A;  5CHI A;  2P9K A;  5AQH A;  4AHS A;  1SQK A;  3O3F A;  1RDB A;  2GTD A;  2HF4 A;  3LP2 A;  5AQT A;  3DRP A;  3A5M C;  3LDO A;  4DUY K;  4CI6 A;  5B8H A;  3OS2 A;  4CER A;  3QNN A;  4OPJ A;  1SS6 A;  5J1E A;  3EL2 A;  2UXD K;  3SJJ A;  3CQX A;  4U67 L;  3BZC A;  2GX9 A;  1LOT B;  4E1M A;  3OJS A;  4BR9 A;  4DQS A;  2HHV A;  1TGO A;  5AQI A;  4DFM A;  5LL6 Z;  4O8U A;  5I42 A;  4W5N A;  1IKW A;  2QWQ A;  4B1W B;  2ZQB A;  1CXQ A;  4HHT A;  2W41 A;  3CM6 A;  3HSC A;  3HP6 A;  2ZGY A;  2WOM A;  3AVL A;  4IFY A;  1BI4 B;  3S9H A;  3DLK A;  1BO5 O;  4FJJ A;  4NYF A;  1GLA G;  2XY5 A;  1S5J A;  2PYJ A;  1GOC A;  3AA5 X;  1JLQ A;  4MDA A;  1TL1 A;  4Z4C A;  3L2V A;  3SAH A;  3T69 A;  3HI0 A;  1XHZ A;  1WNS A;  1X1P A;  4B3R K;  3OYK A;  2NRT A;  3V81 A;  1C0T A;  3OS1 A;  5M1K A;  3CCL N;  4FLV A;  1TK5 A;  2HHU A;  4CJQ A;  1WAJ A;  2Z1G A;  3DOL A;  3CCE N;  5FDL A;  2FC0 A;  4DR2 K;  3NGY A;  5AZJ A;  2ASO A;  5TKY A;  1RTJ A;  3HVR A;  3ZET B;  3V6D A;  3E9O A;  1RDA A;  4DQR A;  1KAZ A;  1WSG A;  4YY3 K;  1X9J A;  4AH9 A;  1GLL O;  2I7N A;  4CJ5 A;  3NCI A;  5AQG A;  1JCE A;  4A2A A;  1QZ6 A;  3C6T A;  3VQ5 A;  3C6H A;  4LFA K;  4YOR A;  1YI2 N;  2FBY A;  4IOX A;  3SI6 A;  3ZSQ A;  4M3T A;  5ADX H;  1KAX A;  5AFU H;  3OYA A;  2O8C B;  4DS5 A;  1OH7 A;  4DTO A;  3M1F A;  3D2E B;  4A59 A;  3SAG A;  5GAH P;  1VQP N;  3SAF A;  2IIR A;  4NCA A;  4ILH A;  1N8R O;  1YJ9 N;  3SLC A;  1BCO A;  3LL3 A;  3VMF B;  5GIO A;  1NGC A;  3MX5 A;  5SZT A;  3TWH A;  2V7Y A;  4F2S A;  4K25 A;  4DLE A;  2V51 B;  4JLH A;  1VQ7 N;  1OVQ A;  3QFU A;  4FSV A;  4IG0 A;  2P9K B;  3UKU B;  3GE1 A;  4DFP A;  2Y1I A;  3HL8 A;  2ZD1 A;  4GKJ K;  2E1Z A;  4LSN A;  4XEI A;  2EHG A;  2Q0R A;  2D0A A;  2ZE2 A;  3HO1 A;  1NGB A;  4B9M A;  3K5L A;  2DFF A;  4BY9 C;  4J2A A;  3SUN A;  1H1V A;  1TAQ A;  2OPQ A;  4CJU A;  4FCY A;  5E41 A;  2EWS A;  4JI6 K;  4HCB A;  5F0X A;  4BVP A;  3U6F A;  4CJ7 A;  4LY7 A;  3K2P A;  3HJF A; 
#chains in the Genus database with same CATH homology
 3J80 O;  4DR5 K;  2UXB K;  4OX9 K;  1HNW K;  4B3R K;  4LF8 K;  1N32 K;  4JI4 K;  3JAM O;  4LF9 K;  4DV4 K;  1XNR K;  4JI8 K;  4X66 K;  4B3M K;  4DR2 K;  2VQF K;  4DR3 K;  1XMO K;  3J81 O;  4YHH K;  1J5E K;  3OTO K;  4DR4 K;  4YY3 K;  4CVN E;  5LMU K;  1HNX K;  1XNQ K;  1IBL K;  4LFC K;  4JI7 K;  2VQE K;  4DV5 K;  2UUA K;  1HR0 K;  4LFA K;  2ZM6 K;  4DV2 K;  1XMQ K;  1N34 K;  4DUY K;  4NXN K;  4B3T K;  4DV6 K;  4JV5 K;  2F4V K;  2UXC K;  2UXD K;  4B3S K;  1N36 K;  3J7Y P;  1N33 K;  1IBK K;  4DV1 K;  4KHP K;  4JYA K;  4X62 K;  2UUB K;  4GKK K;  4DV0 K;  4LF4 K;  4DUZ K;  4X65 K;  5LL6 Z;  4LF5 K;  4DV7 K;  3T1Y K;  4DR7 K;  4DR1 K;  4JI2 K;  4LF6 K;  1I94 K;  4LF7 K;  2UUC K;  4V19 S;  4DR6 K;  4NXM K;  5IWA K;  5A2Q O;  5LMN K;  3J7A P;  5BR8 K;  4X64 K;  4AQY K;  4DV3 K;  4JI0 K;  2HHH K;  4GKJ K;  4JI1 K;  4K0K K;  4LFB K;  4JI3 K;  4JI5 K;  2E5L K;  2UU9 K;  1HNZ K;  5IT9 O;  4CW7 B;  5AJ3 K;  5FLX O;  3T1H K;  4JI6 K;  1FJG K;  1IBM K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...