4LD0A

T. thermophilus ruvc in complex with holliday junction substrate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
166
structure length
158
Chain Sequence
MVVAGIDPGITHLGLGVVAVEGALKARLLHGEVVKTSPQEPAKERVGRIHARVLEVLHRFRPEAVAVQEQFFYRQNELAYKVGWALGAVLVAAFEAGVPVYAYGPMQVKQALAKEEVALMVRGILGLKEAPRPSHLADALAIALTHAFYARMGTAKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Crossover junction endodeoxyribonuclease RuvC
publication title Crystal structure of RuvC resolvase in complex with Holliday junction substrate.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase/dna
total genus 49
structure length 158
sequence length 166
chains with identical sequence B
ec nomenclature ec 3.1.22.4: Crossover junction endodeoxyribonuclease.
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02075 RuvC Crossover junction endodeoxyribonuclease RuvC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ld0A00
3QEXA 3KD1E 4OGEA 1KCFA 2G8IA 1LWCA 4DU4A 1BI4B 3U3YA 3SPZA 2W42A 3AVKA 2HHVA 3OYHA 3L2RA 2HHWA 4CHNA 4ID1A 3TWHA 1B92A 2F8TA 3LP0A 1UA0A 4Z4GA 1KVAA 4Y1CA 3ALYA 1X9MA 3KD5E 4HCBA 4TSXA 4CEEA 3OVNA 4E1MA 4FLXA 4KHWA 3QEIA 5HRRA 3LPTA 1SV5A 3OYDA 3V9SA 4DFMA 3DLEA 3SQ4A 3P83D 1X1PA 5SWMA 2YHAA 1HPZA 2JLEA 3CG7A 1LAVA 3HVTA 4H4OA 1NK7A 1RDCA 1TAQA 4CIFA 4PY5A 2KTQA 1VSEA 1RBUA 1J5OA 4MFBA 3OYEA 4CE9A 3I0SA 3DMJA 1CLQA 3VQBA 2EX3A 3SQ2A 1WNSA 4JRPA 1NJZA 1UWBA 3TARA 5SZTA 3AVJA 5C42A 4F2SA 1LW2A 4N5SA 1D9FA 1ITGA 3JYTA 1ZYQA 5KI6A 5FRMA 4N47A 1BIUA 3AVLA 3V9UA 1VSIA 1L3SA 3AO3A 1RT5A 1DTQA 3AVHA 4DU3A 4OVLA 3RMAA 4C8LA 4PWDA 4CEFA 3VA0A 2FBYA 4CCHA 5FROA 4CK1A 4CJKA 1NK4A 3DLHA 1KTQA 4LSNA 4K8XA 4Q0BA 2HVIA 3VQQA 1BQMA 4CECA 3TAMA 1LV5A 2G8KA 5JS1A 4OPKA 2VG7A 1S1VA 2B4JA 3B6OA 3O4QA 3ZSRA 3L2WA 4E7JA 4KAZA 4CGGA 4FLUA 2WONA 3AVFA 1RT6A 3DRSA 4ELVA 1JLQA 1A5WA 4ID5A 4JRQA 3NE6A 2P51A 1WSHA 5HBMA 3UIQA 1UAXA 3SUPA 4DSIA 1S6PA 3HPOA 3KTQA 3VQ6A 1QTMA 1D5AA 4C8NA 3AA3A 4CGIA 4B9SA 3DLGA 1ASWA 1JXBA 4CJQA 3MEEA 1HYSA 1LW0A 2YNFA 3KLFA 3L2QA 3AVMA 4DFKA 3S3NA 1KLNA 4PA1A 4FJ7A 1RTDA 2DFFA 3AA5X 3ISNC 1WSGA 2D5RA 4KO0A 3ZSVA 1BGXT 1J54A 4DG1A 4DS5A 2OA8A 2HHTA 3IS9A 2D0BA 2IGIA 4KB1A 1R0AA 1IKYA 1U48A 3VQ8A 4B9MA 3KLIA 2Z1IA 1JL2A 1RCHA 4E7HA 1KSPA 2PY5A 1N5YA 1HMVA 4QOZB 4CFCA 3M8RA 1TK8A 4BE1A 5CY4A 1J9AA 4DTPA 4FK0A 4KREA 4N76A 1JLCA 3ZT1A 1BL3A 4DSKA 4DTJA 3RMDA 1RNHA 1YVUA 3U3GA 2G8HA 1FXXA 4CFDA 3HP9A 3DI6A 3CQ8A 4DF8A 3AVAA 4DTOA 2F8SA 4H4MA 5HP1A 4M3UA 4DU1A 2B5JA 1NJYA 4OJRA 1YTAA 3TAFA 3KLHA 4IFYA 3L3UA 3K5MA 4HTUA 1T05A 1WAFA 2E6MA 3AO2A 1GOCA 3QNOA 2BDPA 3C95A 3ZSZA 4CJSA 1NK8A 3DLBA 1I39A 2KFZA 1I3AA 3OJSA 3IG1A 3OS2A 1W0HA 2G8WA 4W5QA 3CFPA 4DQPA 3TAEA 3L3VA 3AO4A 3LAMA 1L3VA 4FW1A 1KLMA 1KVCA 3SI6A 2DFEA 4NCBA 2DY4A 4CF8A 1C0TA 1SKWA 4JS5A 5J2MA 2GV9A 4HVJA 1QSSA 1IKXA 4EP5A 4CJRA 4M42A 3MECA 2VWKA 5KRTA 1WSEA 4F2RA 3S9HA 3PX4A 3MXJA 1TVRA 1VSJA 3ITHA 5CZ1A 1NJWA 3M8SA 5KGWA 3RTVA 2G8VA 2KZZA 1QE1A 3HPGA 3AA4A 2YNGA 3I0RA 4CEQA 4DTRA 4Z4EA 2OPQA 4Q5VA 4Z4FA 3V6DA 3HP6A 2A1SA 1U47A 3DOKA 3KKSA 3KLGA 3RMBA 4ELUA 4FK2A 4FM1A 5C24A 2XY8A 1C0UA 3VQPA 4CEOA 2P1JA 4O5BA 3VQ4A 4LSLA 4XIUA 4W5TA 3KK1A 1SKRA 1JLBA 4RW9A 3TAGA 1L3TA 4J2EA 1TAUA 2DFHA 4OKJA 2WOMA 1XHZA 4DQQA 1VSHA 3VQ9A 3ZCMA 4IBNA 2BE2A 3C6UA 2FBTA 3HL8A 3ZSXA 4W5OA 1SKSA 4FXDA 3DLRA 2EHGA 4HUFA 4CFAA 3O3HA 2HVHA 2YHBA 1KVBA 4CK2A 1RDDA 1N6QA 1RT4A 1FKOA 3K59A 2Q3SA 4KV8A 4OLAA 4M3ZA 4CK3A 2BANA 3IAYA 4N56A 3MEDA 3HYFA 3V9XA 4FLZA 3HVRA 1ZBLA 2Z1JA 4FLTA 3DYAA 2QKKA 4FZYA 3LZIA 1B9FA 4DSFA 4F4KA 2HHQA 3HT3A 4GVMA 2Y1JA 4PQUA 3NH2A 3PY8A 2HMIA 2E6LA 5DMRA 3D45A 3CM6A 2IAJA 4NYFA 1BIZA 1TL3A 4FCYA 4Z4HA 3P5JA 4DMNA 2GBZA 1T7PA 4NYNA 4DSEA 4AILC 4FZXC 3KLEA 3O3FA 1D8YA 4CESA 2XHBA 4KKOA 4BDPA 3VQDA 2HB5A 4M3XA 3QINA 2FBXA 3F9KA 4E19A 1NKBA 4GMJB 4JS4A 4E3SA 4CGHA 2B6AA 4M3RA 1Q9XA 3BDPA 3HK2A 1EP4A 4FW2A 1UA1A 3VA3A 1S5JA 5EU7A 1EXQA 1HRHA 4C8MA 4RG8A 2A1RA 3PO5A 4PUOA 1XI1A 4LH4A 1TKTA 1TL1A 2G8FA 4CEDA 4F8RA 3MEGA 1SL0A 3NH0A 4FJIA 4HHTA 4F3OA 3HO1A 1QQCA 4CJLA 1KRPA 4KI6A 1RDAA 4KFBA 3DRPA 4BDYA 1KFSA 3OYIA 1JKHA 1JLAA 4DWIA 4I9QA 4J2BA 5FDLA 2YNHA 2OPPA 4CJ5A 4BWMA 3LWMA 2QXFA 4IFVA 4HUGA 4DQRA 4KTZA 2VG5A 4O55A 3LWLA 3V1OA 3CFOA 4E1NA 3T3FA 1EX4A 1TK5A 3NH1A 1SL1A 3WNEA 3AVGA 3WNHA 3JSMA 1VSFA 1QSLA 4O0IA 4CHOA 3ZSWA 4KI4A 1C1CA 4QAGA 2VG6A 4CHYA 4FJGA 2KFNA 4O44A 1LWEA 2YNIA 1Q9YA 1KFDA 2HNYA 1RBVA 5JS2A 4RW4A 2NUBA 3QETA 3B6PA 2ZE2A 3VQAA 5HROA 1NJXA 5HLFA 3L2UA 1DLOA 3NGYA 1HNVA 1LAWA 1RTHA 5CYQA 3LP3A 2VWJA 4BE0A 3K58A 5C25A 4B08A 4CJ3A 3K5OA 3ZSYA 4CJ4A 1GOBA 4DS4A 1NK6A 5K14A 4ZHRA 4DTNA 3DOLA 1IKWA 3DRRA 4CF1A 4CHQA 4DQIA 1HNIA 1VRTA 2HHXA 2E4LA 4FJXA 3RRGA 3FFIA 3WNGA 4CF2A 1Z26A 4EZ9A 5I3UA 1J53A 1LWFA 4IG0A 3MAQA 3PX6A 5CYMA 5J2QA 3SJJA 4YFUA 3O3GA 1FKPA 1S1WA 3TAPA 1RTIA 1ASUA 4B8CA 3NDKA 3SUOA 1C1BA 2Z1GA 1DTTA 1HJRA 4DLEA 3EYZA 4DSJA 3ZSOA 4RW7A 3I8DA 3HM9A 4BE2A 1IO2A 5FRNA 3G0ZA 1NK5A 3TR8A 3VQCA 5KRSA 3OS1A 4CEAA 3QLHA 4R5PA 2KQ2A 2O4GA 3V1RA 3S3OA 1YTUA 1HQEA 3NF6A 4KHUA 3HSTB 3PO4A 1U04A 3QEVA 5CZ2A 5KGXA 2DTUA 1WSIA 1WAJA 3RR7A 1S9EA 3V1QA 3CM5A 3NF9A 1QSYA 2HHSA 3VQEA 2ATQA 3QESA 4OKKA 3V4IA 1JLEA 4WE1A 3OS0A 2HNDA 3IRXA 3OY9A 4RW6A 1L3UA 1S1XA 4ZTJA 3M8PA 3TAQA 1JL1A 3RWUA 1VSKA 4L8RB 1YT3A 4CJUA 2QK9A 1QHTA 4BWJA 1JLFA 4CERA 2ZD1A 3NAEA 1TGOA 1WN7A 4CHPA 4KTWA 4GW6A 1EETA 4AHUA 4FJ9A 3OYJA 3VQ7A 1SUQA 4DTUA 4CEZA 1RT1A 1ZBUA 2ZQBA 4CJFA 1Y97A 3K2PA 2XO7A 2X74A 4B9NA 3VN5A 1VSLA 3PUFA 3D0PA 4KHNA 4CJWA 3OYLA 3L8BA 2D0CA 3KKRA 1TKDA 1RBRA 4M45A 3ZSQA 3OYKA 4BDZA 4FVMA 3K5LA 5D3GA 1U49A 4Y1DA 3SUNA 3SPYA 4M3TA 3E01A 1GOAA 4BACA 3DM2A 4AHTA 1VSMA 4KPYA 3LZJA 4AHRA 4E7LA 4DTSA 2AJQA 4CF0A 1BHLA 1X9SA 4E7IA 4OKEA 2IS3A 4CGDA 4CJVA 3S3MA 3AVNA 1NK9A 2QKBA 1A5VA 3OYNA 4HUEA 3SQ1A 2BGGA 4J2AA 4IKFA 1QS4A 4H8KA 3SUQA 1S9GA 3T1AA 1D9DA 3SQ0A 1HQUA 4NCAA 5DK5A 3L2VA 1SL2A 4FJHA 1G15A 3AO5A 1JLGA 2FC0A 3ULDA 3SNNA 1BQNA 4W5RA 2PYLA 3RR8A 3NCIA 1S1UA 1Z25A 4KHSA 3BGRA 2XRIA 3LP2A 3SV3A 2FBVA 4FJNA 2IOCA 1NOZA 5KTQA 4YNQA 3AVCA 4LD0A 2YV0X 4M41A 4DF4A 4E0DA 4CIEA 1F21A 4NCGA 1T03A 2O4IA 3KJVA 4W5NA 3H08A 1TKXA 4OGCA 3LANA 3NGIA 1CZBA 2P5GA 1U4BA 4QCLA 2IDOA 3ZT4A 1NK0A 2OPRA 4EZ6A 4CHZA 3RRHA 1REVA 1ZBIA 1WSFA 4E7KA 4FJ5A 4FJ8A 4KTQA 2XY5A 1RDBA 4K8ZA 3C6TA 1TKZA 3LAKA 2HW3A 3EY1A 1WLJA 4M3YA 2JGUA 4FM0A 2X6NA 5J1EA 2XY6A 3V81A 1NKEA 2G8UA 4DQSA 5J2NA 3M8QA 4N41A 3ASMA 4C8OA 4DLGA 3LDSA 3F73A 3CFRA 4B3OA 3QO9A 4IDKA 3OJUA 4B9VA 3MXIA 1RT7A 4M3WA 3SZ2A 3TANA 3A2FA 1BISA 1RTJA 2Y1IA 3QNNA 4OLBA 1ASVA 3OYCA 3SCXA 4CFBA 5T7BA 4ELTA 4FYDA 1Q8IA 4O0JA 3PX0A 3ZT0A 3NBPA 3V9ZA 4J2DA 2KW4A 1BCMA 5HRSA 3AVBA 4FLYA 3SYZA 3T19A 3RMCA 3HJFA 1K6YA 2IC3A 4I7FA 4B9UA 3KIOA 1NKCA 4CEBA 3QIOA 1IG9A 1A5XA 2RPIA 3P1GA 2D0AA 1CXQA 4I2PA 2YKMA 3MXMA 4FZZA 3KK2A 3C94A 1MU2A 4CJEA 2RN2A 3TABA 2YKNA 3OYAA 2ETJA 2OZMA 3NF7A 3AVIA 3NGZA 4B9TA 3NF8A 1RT3A 2I5JA 2F96A 4CIGA 4CJPA 1TV6A 4E89A 3ZT2A 1S1TA 2OZSA 1U45A 4LY7A 4DTXA 3U6FA 1CZ9A 1XWLA 1VK0A 1FK9A 1WSJA 2X78A 3LP1A 1T8EA 3QERA 1VRUA 3ZT3A 3K5NA 4ZTFA 3THVA 3LPUA 4JLHA 5HRNA 1CXUA 5E41A 1RBTA 4AH9A 4DFPA 4DTMA 2PYJA 2HNZA 1C6VA 2P5OA 1HYZA 4FLWA 3OYFA 4LH5A 4DFJA 3PV8A 1XC9A 4F3TA 4IG3A 4O4GA 4Z4CA 1O1WA 1B9DA 3O4NA 4FJJA 1IH7A 4G1QA 3OYGA 4AHSA 3AV9A 3AA2A 4FLVA 4AHCA 4DSLA 4KRFA 1UOCA 3QIPA 2XY7A 4KB0A 5J2PA 3EZ5A 2X6SA 1W9HA 4B9LA 4FJKA 2HHUA 3QEWA 2OPSA 4I2QA 1VSDA 4ICLA 2LSNA 4UQGA 3DLKA 3OYMA 2OYQA 1BI4A 1S6QA 3VQ5A 3K57A 2R7YA 2GUIA 1NOYA 3OYBA 3CYMA 2KZMA 4AHVA 3AO1A 1EKEA 1TK0A 4Z0UA 1HYVA 1ZBFA 4OPJA 3G10A 4CF9A 3V9WA 4FJMA 4CGFA 4FK4A 4Z4IA 1JXEA 4KHQA 2Z1HA 1C1AA 5HRPA 3NFAA 4I9LA 4HCCA 3TI0A 5I42A 3LALA 4B8AB 1RT2A 4C8KA 4FM2A 2PZSA 3WNFA 3QEPA 1C0MA 1L5UA 1BCOA 2ITGA 4EP4A 3KK3A 3HPHA 1X9WA 3HXMA 4FJLA 1ZBHA 1IKVA 4CJTA 3NHGA 1XHXA 4RW8A 1RILA 4CGJA 4MQ3A 3SV4A 2RF2A 1RBSA 4KHYA 2RKIA
chains in the Genus database with same CATH superfamily
3QEXA 2E88A 2D0PA 3KD1E 4OGEA 4A62A 2QWOA 4DU4A 3H1QA 2HHVA 3OYHA 4BRLA 3D2FA 3C6AA 3RSEA 3VMFB 3H1VX 1DGKN 2HBLA 4ID1A 4CHNA 2CGJA 4NXMK 4CZHA 4HCBA 4CEEA 3OVNA 1XMQK 3R8EA 3R6MA 3V9SA 3DLEA 1X1PA 2JLEA 3HVTA 1FW6A 4CIFA 4ISGA 2CH5A 4IOAL 4MFBA 4CE9A 3I0SA 3DMJA 3PSIA 2ZJRL 3SQ2A 2QEXN 3D2EA 1JCGA 1D9FA 5KI6A 3L0QA 1BIUA 3D2FB 3RSEB 3CJAA 2QWMA 4PWDA 4CEFA 3W3DA 3VGMA 2IVNA 1BQMA 1NM1A 2HF4A 1HNZK 1T6DA 4RWTA 1A5WA 2E2OA 3NMUA 5AQKA 5HBMA 3UIQA 3SUPA 4DSIA 1QZ6A 3VQ6A 4B9SA 4CZLA 1YJWN 1YAGA 4CJQA 4YHHK 2YNFA 1YIJN 3AVMA 4FWLA 3S3NA 2V7YA 4GV3A 4NXNK 4KO0A 2DFFA 3OTOK 1WSGA 1Z6RA 2OA8A 1NGCA 4FWKA 1W7AA 4B9MA 2Z1IA 3H3OB 4DR2K 3KHYA 4QOZB 3M8RA 1TK8A 2UXBK 1J9AA 3O9SA 1BL3A 4DSKA 4WFAL 3RMDA 1RNHA 5LL6Z 4JK8A 4M7XA 3AVAA 3D6RA 1C0GA 4BRNA 1WBDA 1NJYA 4DCHA 1YTAA 2KKZA 3TAFA 3KLHA 2E6MA 3AO2A 3CI5A 3T1HK 5KQ8A 3C95A 3ZSZA 3DLBA 1VQ6N 1QZ5A 3OJSA 1Q81O 1W0HA 4W5QA 5BRDA 4DQPA 3AO4A 3IUCA 1L3VA 1KVCA 2A6AA 2DY4A 3Q7BA 4JS5A 3DXKA 2CGKA 2GV9A 4CJRA 3TSPA 3ITHA 5GADP 2IIRA 2G8VA 4BVPA 4JNEA 1YHQN 4Z4EA 3KWIA 4Q5VA 3FZMA 1KXPA 3KLGA 3RMBA 4ELUA 4LF7K 3VQPA 3HO1A 3FZFA 4XIUA 3DWLA 4JI5K 2JWLA 1VQ5N 1XHZA 4V19S 4IBNA 4W5OA 4JI3K 4HUFA 4CFAA 3DXKB 4GVEA 1KVBA 2Q3SA 4M3ZA 4XH1A 2BANA 1RDWX 3GBTA 4JKAA 4N56A 4DR5K 4BY9C 3IAYA 5C0YA 4DSFA 4F4KA 3HT3A 5JLFA 4DUYK 3E66A 5DMRA 1ZBSA 5BRFA 4NYFA 1TL3A 2UXCK 2D4WA 4KBOA 3ULEB 4BRHA 4AILC 1Q7YO 2OTJN 4KKOA 2HHHK 3QINA 2FBXA 3ZEUA 4JS4A 4E3SA 2B6AA 4M3RA 1NGHA 1Q9XA 3BDPA 3VA3A 5EU7A 1EXQA 1RGIA 4LH4A 3LDPA 5TKWA 4CEDA 1SL0A 3NH0A 4F3OA 3ENBA 1GLBG 4OX9K 1KRPA 1KFSA 4KFBA 3DRPA 1JKHA 4WCEL 1XC3A 4O55A 3V1OA 4B1WB 1VSFA 1QSLA 3CMEN 4WYBA 3ZSWA 4KI4A 4MDAA 3TTCA 2VG6A 4FJGA 1QQNA 5E26A 2YNIA 4ILGB 1M1KO 1NBWA 4RW4A 5EX5A 3B6PA 4A2BA 5HLFA 3AY9A 1DLOA 4YDUA 2VWJA 1IJJA 4CJ3A 3ZSYA 1NK6A 4YOTA 2BH1A 4DS4A 3SLCA 1IKWA 3DRRA 1HNIA 1VRTA 2HHXA 3I8BA 4ISEA 1VQ4N 5I3UA 1LWFA 3PX6A 2HOEA 4CI6A 4YOYA 3LM2A 2E2PA 1FKPA 2FXUA 4B8CA 2A41A 5GIPA 3NDKA 3SUOA 1N32K 1HJRA 3EYZA 1IO2A 1NGJA 2D0OA 3TR8A 1JCEA 5AQNA 4ILHA 3LL3A 4JN4A 1Q82O 2P9NA 4KHUA 5AQZA 3ID8A 3QEVA 5KGXA 2HSTA 3CM5A 3CJ9A 3QESA 2P9PA 2VGNA 3VGLA 1P90A 2NZTA 4WE1A 4RW6A 3M8PA 4L8RB 4CJUA 1VQON 4CERA 3SAHA 1TGOA 4CHPA 5FPEA 1EETA 4DTUA 4DV3K 4PL7A 4CEZA 1ZBUA 4YDUC 1Y97A 2YHYA 4IZ9A 4CJWA 3OYLA 3G71N 1RBRA 2UYTA 4G9ZA 5D3GA 4LF5K 2VQEK 3E01A 4BACA 3J7AP 3E9PA 4CF0A 3U9DA 1BHLA 1X9SA 2IS3A 3EO3A 4CJVA 3AVNA 3OYNA 3CJ1A 2RHKA 3MX5A 4HUEA 4J2AA 3SUQA 4E1JA 1HQUA 5DM6L 2P9IA 2V7ZA 3SNNA 3SMSA 3BGRA 3CC4N 2P9UA 4E0DA 1ATNA 3FZKA 3U4LA 3KJVA 3FZLA 4W5NA 1TKXA 3D7EO 4QCLA 1NK0A 1XNRK 4CHZA 4K41A 1REVA 3CJ7A 1WSFA 2P9LB 4E7KA 4FJ5A 5M1OA 3E9OA 5F1XA 3CC7N 1TKZA 3VF4A 2X6NA 1QQOA 4FM0A 2G8UA 5J2NA 3ASMA 3O9UA 4IDKA 4CZEA 2P9UB 3NVKA 3TANA 1T3VA 1BISA 4A61A 1TYQB 1ASVA 4ELTA 1BA0A 1Q8IA 3SMPA 3CMAN 4J2DA 3TTDA 3V9ZA 4GNIA 5HRSA 3HJFA 4FLYA 3VTHA 3T19A 4GKJK 1NGIA 1NKCA 4BG9A 2NRTA 4RCHA 2YKMA 3MXMA 3KK2A 1FJGK 1LOTB 2RN2A 1EWRA 2YKNA 1V4TA 2ETJA 2OZMA 2O8FA 3NF7A 3NF8A 4FWQA 1NMDA 5AQPA 1RFQA 1FK9A 2A40A 1WSJA 3AGKA 1VRUA 4JKGB 4JI1K 5AZIB 4JLHA 1CXUA 5E41A 1RBTA 4AH9A 4DTMA 1C6VA 2P5OA 1HYZA 4F3TA 2KLAA 1XC9A 4O4GA 3AAPA 3CCQN 2W6KA 4NB4A 1Y64A 3CCVN 4G1QA 2E2NA 3AV9A 3CHWA 4AHCA 3ZETA 2UXDK 2HMPA 3EZ5A 2X6SA 4B9LA 2QI2A 3BZKA 2OPSA 3QEWA 1GLFO 3ID6A 3DLKA 2OYQA 3EE9A 1S6QA 3K57A 4H0XB 4FPAA 4JK7A 4H5VA 3CYMA 3PIPL 1HYVA 3G10A 4CF9A 5I9EB 1OVQA 1JXEA 4KHQA 5BRHA 2Z1HA 3VOVA 1OKJA 3LALA 4LF8K 1TUUA 3CERA 1R59O 2P9SB 4GKKK 1X9WA 3HXMA 5M1KA 2RF2A 4YOVA 1HR0K 2RKIA 2KHOA 4WQ4A 2E8AA 1LWCA 3U3YA 2E1YA 2W42A 4CZKA 2O8CA 1B92A 4QS8A 1X9MA 3RVCA 4TSXA 4FLXA 4E1MA 3THWA 3OYDA 3MK6A 1HNXK 5SWMA 3CCUN 2YHAA 1HPZA 3CG7A 4H4OA 2V51B 1NK7A 1RDCA 1TAQA 1QQMA 4QS7A 1VSEA 1J5OA 1K8AO 3VQBA 3T7ZA 4FWNA 1WNSA 4JK9A 2QWRA 1UWBA 2H3GX 3JYTA 1ZYQA 3V9UA 3AVLA 1L3SA 2O8CB 4DU3A 4OVLA 1GLDG 4CCHA 4OPHA 3DLHA 4CK1A 4CJKA 4U7BA 3THWB 3TAMA 5JS1A 4OPKA 5CHIA 2ASPA 2E5LK 4JKCA 4CGGA 4FLUA 1RT6A 4ELVA 1KAXA 4JRQA 1SAZA 3MX2A 3ATVA 1OH7A 2P51A 4WQ4C 1UAXA 3HPOA 2AP1A 3NVMA 1D5AA 3DLGA 4F9OA 1JXBA 1HUXA 4PA1A 4M7YA 1K8KB 1RTDA 3AA5X 3ISNC 1BGXT 1J54A 3F5TA 3IS9A 1R0AA 3KLIA 1JL2A 5ELZA 4CZJA 3G6EN 5CY4A 4BR2A 4KREA 3HRGA 3ZT1A 1YVUA 1X3NA 3U3GA 4BGAA 3CQ8A 4DTOA 2F8SA 4H4MA 5HP1A 1BO5O 4DU1A 3UKRB 4BGBA 3UE5A 4IFYA 1I39A 3TU5A 4YOXA 3DJCA 1S22A 1ATRA 3IG1A 3KWGA 3OS2A 2G8WA 1WBBA 3UB5A 3TPQA 3LAMA 4H0VB 1XMOK 4NCBA 3TSQA 4CF8A 4ISFA 4EHUA 5J2MA 5GAEP 1IKXA 2NRVA 4M42A 4DV4K 1BDGA 3CCLN 2WC9A 4Y0WA 2QM1A 4CEQA 3OHRA 4Z4FA 3QFUA 3V6DA 4AM7A 3HP6A 4FPBA 1DEJA 4CEOA 4W5TA 4B3SK 3KK1A 4K25A 4FOIA 4OKJA 2F7TA 3VQ9A 1SKSA 4FXDA 3L4IA 3DLRA 1NLVA 1YVNA 2YHBA 2ASMA 4EAHD 3O4WA 4H03B 1RT4A 3K59A 4OLAA 4FL9A 1DKGD 5LJWA 4FLZA 3LZIA 1B9FA 4BRAA 5M1NA 4PQUA 3NH2A 3PY8A 2E6LA 2IAJA 4FCYA 3QFPA 3LDQA 4Z4HA 4DMNA 3KLEA 4DV1K 1JCFA 1D8YA 4CESA 3SAFA 3F9KA 5M1QA 4R79A 3HK2A 2CH6A 1UA1A 1U2VA 3GG4A 3HBTA 1HRHA 3M5RA 4C8MA 4BC4A 4PUOA 1XI1A 3O1WA 4F8RA 1T44A 2OANA 4XEIA 3VPZA 2A3ZA 4HHTA 3WQUA 4KI6A 3OYIA 4BRMA 1VQ8N 3D2EB 3FFKB 5MLCQ 5AQXA 3WXLA 4E1NA 1HPMA 5F0XA 4O0IA 1GLCG 2KFNA 4O44A 1LWEA 1U2VB 1WUAA 3N4PA 2WFBA 4GV6A 2HNYA 5GIOA 2YJEA 2NUBA 4BRFA 1NJXA 1HNVA 5FLXO 3K58A 5JLHA 4CJ4A 2GUPA 5AR0A 1N36K 4ZHRA 2YJFA 2NRHA 3HOSA 2E4LA 4MO4A 4FJXA 3WNGA 2F9TA 4EZ9A 3MAQA 3ZLJA 2NRZA 3TAPA 3FLCO 1NG9A 3UKUA 1C0FA 1HKBA 4DSJA 4BRGA 3IKMA 4BE2A 3Q7CA 1VQKN 1H1VA 2KQ2A 2O4GA 3S3OA 1HQEA 3NF6A 4BR4A 2ATQA 4OKKA 2OTLN 2HBKA 5AQOA 4FSVA 5JVGL 3B8AX 4O8UA 3UKUB 1JL1A 3CC2N 2PAVA 1QHTA 1WN7A 3OW2M 4GW6A 4AHUA 4JD2A 1VQNN 1N34K 3QDKA 2XO7A 1VSLA 4A57A 3J81O 3GDQA 3HTVA 3SUNA 4H0OA 1ATSA 1GOAA 3H3NO 4JI8K 3LZJA 4CGDA 2QKBA 5JVHL 1NK9A 3BUZB 4IJNA 4IKFA 3BF1A 3O1BA 3PLAA 5DK5A 1BOTO 1JLGA 1J5EK 1S1UA 4YOUA 1ZC6A 3LP2A 4JI2K 3SV3A 2IOCA 4YNQA 4LD0A 4M41A 4DF4A 2NRRA 1T03A 4B1VA 2ZGYA 3LANA 4OGCA 5AQUA 1CZBA 1QHAA 5FPNA 3CCJN 3RRHA 1ESVA 1G99A 2BTFA 3O9QA 2ITMA 4K8ZA 3EY1A 2YX6A 4A2AA 4M3YA 5J1EA 3V81A 4DQSA 3M8QA 4DLGA 3LDSA 3F73A 3ZEUB 3MXIA 1Z05A 4M3WA 4PL8A 2AA4A 4FVUA 2Y1IA 4BR7A 3MN5A 3JS6A 4IJAA 3OYCA 4FYDA 3O8MA 2VYPA 3VGKA 1KAZA 1BCMA 3DAWA 3SYZA 4PHTX 1K6YA 3IDHA 4KH6A 3VENA 4WQ5A 3DXMA 1YI2N 3R9PA 1CXQA 3C94A 3TABA 3OYAA 3N4QA 3IFRA 3AVIA 5C12A 1Q86O 2F96A 4CIGA 1VHXA 2OZSA 1U45A 3U6FA 1CZ9A 1VK0A 4LF4K 4BC2A 1M90O 4ZTFA 1V4SA 5LMUK 5HRNA 1HKGA 4CVNE 4DFPA 2HNZA 4LH5A 1NWKA 1O1WA 3O4NA 4FJJA 1IH7A 3BP8A 5BR8K 1BG3A 4AHSA 5AQGA 3AA2A 3MN9A 5IT9O 5HOOA 4KRFA 4KB0A 5J2PA 3R1XA 1W2BM 1VSDA 4UQGA 3OYMA 1BI4A 3VQ5A 3E9LA 2R7YA 1VQ7N 4DR3K 4Z0UA 2Q36A 3V9WA 4FJMA 1C1AA 2P9NB 2VGMA 3TI0A 4BRPA 5I42A 4WQ5C 1RT2A 4FM2A 1L5UA 4JV5K 1SZ2A 2ITGA 1EWQA 5EXWA 4EP4A 3KK3A 3C7NA 4FJLA 2P9PB 3NHGA 1XHXA 1RILA 3CF5L 3EEQA 1RBSA 4KHYA 3BY5A 1BI4B 4LF9K 3AVKA 4MDBA 3L2RA 3TTFA 1BU6O 4BG8A 2HBJA 2F8TA 4Z4GA 4H5WA 3KD5E 4KHWA 3C65A 5HRRA 4DFMA 3A5MC 3P83D 1LAVA 3THYA 2KTQA 4PY5A 3C7NB 3O9RA 3CCMN 3OYEA 2W40A 5AQRA 1CLQA 2EX3A 1NJZA 3TARA 5SZTA 3AVJA 5C42A 4DV7K 2F4VK 4IO8A 1ITGA 5FRMA 3C6HA 4N47A 2HBMA 1VSIA 4JKFA 1NGAA 5KPRA 3AVHA 3RMAA 4C8LA 4Z94A 4BROA 1NGBA 2P9IB 4LSNA 3VQQA 1VQLN 2ZM6K 1LV5A 5AFUH 4CD3A 1DT9A 1S1VA 2VG7A 3B6OA 3H6EA 2BUPA 3L2WA 4E7JA 3THYB 2W41A 2WONA 3AVFA 4JKDA 3DRSA 1OH6A 4ID5A 5AQMA 1IBMK 1WSHA 5F2RA 1S6PA 3IMXA 4GV9A 3F2KA 3QBWA 2JWKA 1QTMA 3AA3A 4CGIA 5AQLA 3L4QA 4AQYK 4FWMA 3KLFA 2NNWA 1KLNA 4FJ7A 2W6LA 4CBUA 5BN8A 2FF3B 3ZSVA 4DS5A 2D5RA 2D0BA 3VQ8A 4AM6A 4E7HA 2VCPA 1KSPA 3L6QA 2PY5A 1HMVA 4CFCA 3O5BA 3I33A 4BE1A 3WXIA 4FK0A 4N76A 1JLCA 4CFDA 2NRXA 3M1FA 1YXQA 4M3UA 2UUAK 4OJRA 3K5MA 1WAFA 4WF9L 1GOCA 2BDPA 4B1XB 1NGFA 4IEIA 4CJSA 1NK8A 1O13A 2O8FB 3ATUA 3TAEA 3L3VA 3MWTA 1KLMA 3SI6A 1HX1A 1C0TA 3PSFA 1GLLO 4BC3A 4EP5A 4A5AA 2VWKA 5KRTA 1WSEA 3S9HA 1NJWA 3M8SA 3RTVA 1KC8O 1QE1A 2YNGA 3I0RA 4DR7K 2OPQA 5FPMA 2EWSA 5AQVA 2ZF5O 1U47A 4EFHA 1X3MA 3KKSA 3ZETB 4FK2A 4FM1A 5C24A 2XY8A 1C0UA 3M6GA 1SKRA 1JLBA 4RW9A 2O8DA 4J2EA 1TAUA 5BN9A 4I6MA 4DQQA 1VAZA 3ZCMA 3E1YA 3HL8A 4DV2K 3LDOA 1RDDA 3GOIA 1FKOA 1NGGA 5AQTA 4CK3A 3ENOA 4NO7A 3MEDA 5AFUA 3V9XA 2P9KA 1ZBLA 2Z1JA 1WB9A 2J4RA 4KH5A 2HHQA 1HKCA 3VTIA 3BEXA 2HMIA 4H0TB 3G25A 4WFNL 2GBZA 4DSEA 4FZXC 1K73O 1J6ZA 2HB5A 3QB0A 4M3XA 3TSUA 4CGHA 3MN6A 1JJ2M 1BWFO 4RG8A 3AAQA 1TKTA 2G8FA 3MEGA 4OPAA 1JLAA 4DWIA 4I9QA 3WXKA 5FDLA 4CJ5A 3ENHA 4BWMA 3LWMA 3OBYA 4HUGA 4DQRA 1HNWK 2VG5A 5EY4A 1BUPA 3LWLA 2I7PA 3CFOA 3T3FA 1SL1A 3JSMA 4B9QA 4CHOA 4K0KK 4QAGA 2QWPA 3K0SA 2ZE2A 3VQAA 3O08A 1RTHA 4JHDA 4BRQA 5C25A 4B08A 5K14A 4DTNA 2VQFK 1T6CA 5KPZA 3FFIA 4CF2A 1Z26A 1IBLK 1J53A 5J2QA 1YJ9N 4XH5A 3O3GA 1RTIA 3M3ZA 5AZJA 4DKWA 1C1BA 4NLBA 3I8DA 5GINA 4DV0K 1NK5A 4FWRA 4B3MK 5KRSA 5GAGP 1W97L 3EKUA 3OA9A 4JHDB 2Q2RA 3HZ6A 1U04A 3PO4A 1MA9B 5CZ2A 3BZCA 1WSIA 3RR7A 3V1QA 3SBTA 2HHSA 3SJHA 4JYAK 4FWPA 4PKHA 1XNQK 3V4IA 2QWQA 1ILYA 3VESA 4CZMA 1NNEA 4WFBL 4YOWA 1L3UA 4RTFD 4BVOA 4LFBK 4JEPA 1YT3A 2QK9A 2WUSA 1JLFA 2ZD1A 3NAEA 4KTWA 3G4SN 4FJ9A 1SUQA 1RT1A 4CJFA 2QW9A 4BRKA 2X74A 4KHNA 3L8BA 2D0CA 1TKDA 3CCSN 3OYKA 4DR4K 4FVMA 1X9JA 3SPYA 4M3TA 3DM2A 1WOQA 4AHRA 2AJQA 4DTSA 2UUBK 4GY2B 3WEEA 3A8YA 4E7IA 4OKEA 3S3MA 4MLEA 3SQ1A 4XH4A 1QS4A 2WBNA 3T1AA 2GELA 3SQ0A 3MWPA 4FJHA 1G15A 3AO5A 2FC0A 3CXCM 1BQNA 4MLHA 4W5RA 3RR8A 4BR0A 3NCIA 4KHSA 3VEVA 4FJNA 4CD1A 3CJCA 3LM9A 3VERA 2YHXA 3H08A 2WTUA 4JKEA 4H5RA 3EE8A 3NGIA 2P5GA 3WEEB 1U4BA 2IDOA 3ZT4A 2OPRA 4EZ6A 1KQSM 4IFEA 3MCAB 5B8HA 1ZBIA 3VF6A 4KTQA 3C6TA 5A2QO 2HW3A 3LAKA 3VEYA 4KHPK 2JGUA 1Q18A 4HWIA 2XY6A 1GLJO 5C10A 4N41A 4C8OA 3CFRA 3OJUA 1N8RO 4DR6K 1RT7A 4H5TA 1RTJA 4OLBA 3SCXA 4CFBA 3VF2A 2Q0RA 3PX0A 3A5LC 3CCRN 3AVBA 2RE2A 2Q1NA 2ZJQL 3VEWA 4K43A 4I7FA 3J7ZO 3KIOA 1E4GT 4CEBA 2RPIA 3P1GA 4FZZA 3ZYYX 4CJEA 1EQYA 3SBGA 1N33K 3SAGA 4JI0K 1TV6A 3O6WA 1S1TA 4B3RK 1XWLA 5FPDA 3CCEN 3LP1A 1T8EA 4M63C 3ZT3A 3K5NA 2YHWA 2PYJA 4BRIA 4FLWA 3OYFA 4DFJA 3PV8A 4X66K 4IG3A 1B9DA 3CETA 3K9JA 4H0PA 3THXA 2GX9A 2XY7A 5AQFA 1W9HA 2CGLA 4A59A 2LSNA 2DPNA 1OH8A 1P8ZA 4EIAA 2GUIA 4PKGA 4CBXA 3OYBA 4OO1J 2KZMA 4AHVA 3AO1A 2ZJPL 1TK0A 4LFCK 1ZBFA 4OPJA 4BR9A 1VQ9N 4FK4A 4CW7B 5AJ3K 5HRPA 3NFAA 4I9LA 5H1SQ 3GL1A 4C8KA 3WNFA 3QEPA 4YY3K 1ZBHA 3THXB 1IKVA 3VETA 3CPEA 2PBDA 4B1YB 4IEEA 1VQPN 4JI7K 2QXFA 1KCFA 2OCEA 2G8IA 3SPZA 3ULEA 2HHWA 3VEOA 3TWHA 4DV6K 3LP0A 4JD2B 1UA0A 1KVAA 4Y1CA 3ALYA 1VQMN 3QEIA 3LPTA 1SV5A 4DB3A 1EO1A 4HTLA 5C2FA 3SQ4A 5BPMA 4IWVA 2QXLA 4FWSA 4O8KA 3EZWA 1RBUA 3VEZA 5CR4A 4JRPA 5AQIA 4BREA 4F2SA 5AQQA 4DV5K 1LW2A 4N5SA 3HOTA 4X65K 3ZX0A 3J80O 3AO3A 1RT5A 1DTQA 1QVGM 3VA0A 3H46O 2FBYA 2QWNA 5FROA 4K8XA 1NK4A 4Q0BA 1KTQA 2HVIA 1YJNN 3DLLL 2G8KA 4CECA 2E20A 2B4JA 3O4QA 3ZSRA 1XUPO 4KAZA 1JLQA 2NLXA 3ZX2A 3NE6A 4BQZA 4YORA 3KTQA 3A5NC 3FZHA 4C8NA 4X64K 1ASWA 1CZAN 3T69A 3MEEA 1HYSA 1SS6A 1LW0A 2O8EA 3L2QA 4DFKA 2Q0UA 4IOCL 1NGDA 4DG1A 3WXMB 2HHTA 2IGIA 1KD1O 4KB1A 1IKYA 4H5NA 1U48A 4BQLA 3P31A 3J8AA 1RCHA 1HLUA 1N5YA 4AF1A 3VEXA 5C2DA 1IBKK 4B1ZA 1D4XA 4DTPA 3LDNA 2IVPA 4DTJA 2G8HA 1FXXA 3QBXA 3HP9A 3DI6A 4DF8A 3F9MA 5TKYA 3FE1A 2B5JA 2O8EB 3DXMB 3L3UA 1T05A 4HTUA 3WUHA 3QNOA 3U9ZA 4BR5A 2KFZA 1I3AA 3KVGA 3EL2A 4BRCA 3O80A 3CFPA 4FO0A 4U67L 1GLAG 4FW1A 1SQKA 4DHYA 2DFEA 2Q97A 1YUWA 1SKWA 3K9KA 4QS9A 1QVFM 4HVJA 1QSSA 2A42A 3MECA 2YCHA 3S41A 4F2RA 1OH5A 3PX4A 3MXJA 1TVRA 1VSJA 5CZ1A 3QMLA 1IG8A 5KGWA 2KZZA 3HPGA 3AA4A 4DTRA 4JAXA 2A1SA 1OVYA 4LF6K 3DOKA 5EVZA 2P1JA 4O5BA 3VQ4A 4LSLA 3TAGA 1L3TA 2DFHA 2WOMA 2FLOA 1VSHA 2BE2A 3C6UA 2FBTA 3ZSXA 1IV0A 2EHGA 5HL7L 3O3HA 2HVHA 4IDHA 5IWAK 4CK2A 1U6ZA 1N6QA 2Q31A 4KV8A 1KAYA 2UUCK 5LJVA 3HYFA 2A5XA 3T1YK 3HVRA 4FLTA 3DYAA 2QKKA 5KPTA 4FZYA 3R3LA 4GVMA 2Y1JA 2P9LA 3LDLA 3P39A 3D45A 3CM6A 1BIZA 3CQYA 3P5JA 4DR1K 5C15A 1T7PA 4NYNA 3O3FA 1XQSC 2XHBA 1YF5L 4BDPA 1MDUB 3VQDA 4E19A 3A0IX 5BREA 1NKBA 1K9MO 4GMJB 3I55N 1TYQA 3MMVA 1EP4A 4FW2A 4CJ7A 1S5JA 2ASOA 3PO5A 2A1RA 2FSKA 5LY3A 1TL1A 5LMNK 4FJIA 1QQCA 4CJLA 1S72N 1NJIO 1RDAA 3AGRA 4BDYA 3PIOL 4J2BA 2YNHA 2OPPA 3QICA 4IFVA 4KTZA 1YITN 1I94K 2V52B 1TK5A 1EX4A 3NH1A 5ADXH 1RDUA 3WNEA 3AVGA 3WNHA 5JICA 3FGUA 4LC9B 1C1CA 4CHYA 1Q9YA 4JKGA 1KFDA 5JS2A 1RBVA 5GAHP 3QETA 5AZIA 5HROA 3L2UA 3HI0A 3NGYA 1LAWA 2E1ZA 5CYQA 3LP3A 4BE0A 4K42A 2FF6A 3CPWM 3K5OA 1GOBA 3MDQA 1HJOA 3DOLA 3GE1A 3P4IA 4CF1A 4CHQA 4DQIA 2D1KA 3RRGA 4IXCA 4IG0A 5CYMA 3KK7A 3SJJA 4YFUA 1GLEG 1S1WA 1ASUA 4ILJA 3AARA 2Z1GA 1DTTA 4DLEA 3CIPA 3ZSOA 4RW7A 3HM9A 5FRNA 5BPLA 2QTDA 3G0ZA 3VQCA 3OS1A 4CEAA 3QLHA 4R5PA 4DUZK 4IO9L 3V1RA 4EHTA 2HF3A 1YTUA 3CD6N 3HSTB 1NGEA 2DTUA 1WAJA 5BR9A 1S9EA 3OBWA 3JAMO 4PKIA 3NF9A 3EKSA 1QSYA 2UU9K 2P9SA 3VQEA 3CJBA 2I7NA 4A5BA 4FOEA 1JLEA 3OS0A 2HNDA 3IRXA 3OY9A 3CQXA 1MWMA 1S1XA 2ZGZA 4ZTJA 4JKBA 3TAQA 3RWUA 1VSKA 2NRWA 5M1PA 4BWJA 4CZGA 3OYJA 3VQ7A 1NU0A 4MO5A 2ZQBA 3K2PA 2VWBA 4B9NA 3VN5A 3PUFA 3D0PA 3KKRA 4M45A 3ZSQA 1S3XA 4BDZA 3K5LA 1U49A 4Y1DA 1E3MA 2YI1A 5AQSA 4AHTA 1VSMA 4KPYA 2ZWHA 4E7LA 3JXUA 3HSCA 4B1UB 4UY8O 3WT0A 1A5VA 2FSNA 5M1FA 2BGGA 3H45C 4H8KA 1E4FT 1S9GA 2O8DB 1D9DA 1LCUA 4NCAA 4I6MB 3L2VA 1SL2A 1BA1A 3ULDA 2PYLA 1Z25A 2XRIA 4C1NK 2FBVA 5CE3A 1NOZA 5KTQA 3AVCA 5ADXA 2YV0X 3HM8A 3U8XA 4CIEA 1F21A 3MN7A 4NCGA 4BC5A 2O4IA 4O5FA 5DM7L 2P9KB 2QA4N 4FJ8A 5AQWA 2XY5A 1RDBA 5AQJA 4C23A 1WLJA 1NKEA 1K8KA 3I56N 3P38A 4B3OA 3QO9A 4B9VA 3SZ2A 4LFAK 3A2FA 5E84A 3QNNA 5T7BA 4O0JA 3ZT0A 3WXJA 3NBPA 2KW4A 2O8BA 3RMCA 2IC3A 3FR0A 2GTDA 4X62K 4B9UA 4J8FA 3UKRA 3QIOA 1IG9A 1A5XA 2D0AA 3KZBA 2IVOA 4I2PA 3SK3A 4CZIA 1MWKA 1MU2A 3MCPA 5EOYA 3NGZA 3O9TA 4B9TA 1RT3A 2I5JA 4CJPA 2GWJA 1NMNA 3A5OC 4E89A 3ZT2A 4LY7A 4DTXA 3ZX3A 2X78A 2E2QA 3QERA 4FWOA 3C0BA 3THVA 3LPUA 2O8BB 5KQDA 3EN9A 5AQHA 3W0LA 2QWLA 4Z4CA 4KH4A 2PFUA 4JI4K 1TUYA 3OYGA 4FLVA 4DSLA 3J7YP 3BF3A 1UOCA 3QIPA 4JI6K 5AQYA 2HHUA 1ZXOA 4FJKA 4I2QA 2GWKA 4ICLA 5AZJB 4IOXA 4DQ8A 4JKHA 5BPNA 1NOYA 4C1NI 1EKEA 3WQTA 4Z4IA 4CGFA 4CZFA 5JMVA 4NLCA 4CBWA 4HCCA 4H0YB 4B3TK 4B8AB 2PZSA 2GEMA 1C0MA 1BCOA 3HPHA 4CJTA 2FSJA 4RW8A 4BRDA 4MQ3A 4L3QA 4CGJA 3SV4A 2F9WA
chains in the Genus database with same CATH topology
3QEXA 3KD1E 4OGEA 1KCFA 2G8IA 1LWCA 4DU4A 1BI4B 3U3YA 3SPZA 2W42A 3AVKA 2HHVA 3OYHA 3L2RA 2HHWA 4CHNA 4ID1A 3TWHA 1B92A 2F8TA 3LP0A 1UA0A 4Z4GA 1KVAA 4Y1CA 3ALYA 1X9MA 3KD5E 4HCBA 4TSXA 4CEEA 3OVNA 4E1MA 4FLXA 4KHWA 3QEIA 5HRRA 3LPTA 1SV5A 3OYDA 3V9SA 4DFMA 3DLEA 3SQ4A 3P83D 1X1PA 5SWMA 2YHAA 1HPZA 2JLEA 3CG7A 1LAVA 3HVTA 4H4OA 1NK7A 1RDCA 1TAQA 4CIFA 4PY5A 2KTQA 1VSEA 1RBUA 1J5OA 4MFBA 3OYEA 4CE9A 3I0SA 3DMJA 1CLQA 3VQBA 2EX3A 3SQ2A 1WNSA 4JRPA 1NJZA 1UWBA 3TARA 5SZTA 3AVJA 5C42A 4F2SA 1LW2A 4N5SA 1D9FA 1ITGA 3JYTA 1ZYQA 5KI6A 5FRMA 4N47A 1BIUA 3AVLA 3V9UA 1VSIA 1L3SA 3AO3A 1RT5A 1DTQA 3AVHA 4DU3A 4OVLA 3RMAA 4C8LA 4PWDA 4CEFA 3VA0A 2FBYA 4CCHA 5FROA 4CK1A 4CJKA 1NK4A 3DLHA 1KTQA 4LSNA 4K8XA 4Q0BA 2HVIA 3VQQA 1BQMA 4CECA 3TAMA 1LV5A 2G8KA 5JS1A 4OPKA 2VG7A 1S1VA 2B4JA 3B6OA 3O4QA 3ZSRA 3L2WA 4E7JA 4KAZA 4CGGA 4FLUA 2WONA 3AVFA 1RT6A 3DRSA 4ELVA 1JLQA 1A5WA 4ID5A 4JRQA 3NE6A 2P51A 1WSHA 5HBMA 3UIQA 1UAXA 3SUPA 4DSIA 1S6PA 3HPOA 3KTQA 3VQ6A 1QTMA 1D5AA 4C8NA 3AA3A 4CGIA 4B9SA 3DLGA 1ASWA 1JXBA 4CJQA 3MEEA 1HYSA 1LW0A 2YNFA 3KLFA 3L2QA 3AVMA 4DFKA 3S3NA 1KLNA 4PA1A 4FJ7A 1RTDA 2DFFA 3AA5X 3ISNC 1WSGA 2D5RA 4KO0A 3ZSVA 1BGXT 1J54A 4DG1A 4DS5A 2OA8A 2HHTA 3IS9A 2D0BA 2IGIA 4KB1A 1R0AA 1IKYA 1U48A 3VQ8A 4B9MA 3KLIA 2Z1IA 1JL2A 1RCHA 4E7HA 1KSPA 2PY5A 1N5YA 1HMVA 4QOZB 4CFCA 3M8RA 1TK8A 4BE1A 5CY4A 1J9AA 4DTPA 4FK0A 4KREA 4N76A 1JLCA 3ZT1A 1BL3A 4DSKA 4DTJA 3RMDA 1RNHA 1YVUA 3U3GA 2G8HA 1FXXA 4CFDA 3HP9A 3DI6A 3CQ8A 4DF8A 3AVAA 4DTOA 2F8SA 4H4MA 5HP1A 4M3UA 4DU1A 2B5JA 1NJYA 4OJRA 1YTAA 3TAFA 3KLHA 4IFYA 3L3UA 3K5MA 4HTUA 1T05A 1WAFA 2E6MA 3AO2A 1GOCA 3QNOA 2BDPA 3C95A 3ZSZA 4CJSA 1NK8A 3DLBA 1I39A 2KFZA 1I3AA 3OJSA 3IG1A 3OS2A 1W0HA 2G8WA 4W5QA 3CFPA 4DQPA 3TAEA 3L3VA 3AO4A 3LAMA 1L3VA 4FW1A 1KLMA 1KVCA 3SI6A 2DFEA 4NCBA 2DY4A 4CF8A 1C0TA 1SKWA 4JS5A 5J2MA 2GV9A 4HVJA 1QSSA 1IKXA 4EP5A 4CJRA 4M42A 3MECA 2VWKA 5KRTA 1WSEA 4F2RA 3S9HA 3PX4A 3MXJA 1TVRA 1VSJA 3ITHA 5CZ1A 1NJWA 3M8SA 5KGWA 3RTVA 2G8VA 2KZZA 1QE1A 3HPGA 3AA4A 2YNGA 3I0RA 4CEQA 4DTRA 4Z4EA 2OPQA 4Q5VA 4Z4FA 3V6DA 3HP6A 2A1SA 1U47A 3DOKA 3KKSA 3KLGA 3RMBA 4ELUA 4FK2A 4FM1A 5C24A 2XY8A 1C0UA 3VQPA 4CEOA 2P1JA 4O5BA 3VQ4A 4LSLA 4XIUA 4W5TA 3KK1A 1SKRA 1JLBA 4RW9A 3TAGA 1L3TA 4J2EA 1TAUA 2DFHA 4OKJA 2WOMA 1XHZA 4DQQA 1VSHA 3VQ9A 3ZCMA 4IBNA 2BE2A 3C6UA 2FBTA 3HL8A 3ZSXA 4W5OA 1SKSA 4FXDA 3DLRA 2EHGA 4HUFA 4CFAA 3O3HA 2HVHA 2YHBA 1KVBA 4CK2A 1RDDA 1N6QA 1RT4A 1FKOA 3K59A 2Q3SA 4KV8A 4OLAA 4M3ZA 4CK3A 2BANA 3IAYA 4N56A 3MEDA 3HYFA 3V9XA 4FLZA 3HVRA 1ZBLA 2Z1JA 4FLTA 3DYAA 2QKKA 4FZYA 3LZIA 1B9FA 4DSFA 4F4KA 2HHQA 3HT3A 4GVMA 2Y1JA 4PQUA 3NH2A 3PY8A 2HMIA 2E6LA 5DMRA 3D45A 3CM6A 2IAJA 4NYFA 1BIZA 1TL3A 4FCYA 4Z4HA 3P5JA 4DMNA 2GBZA 1T7PA 4NYNA 4DSEA 4AILC 4FZXC 3KLEA 3O3FA 1D8YA 4CESA 2XHBA 4KKOA 4BDPA 3VQDA 2HB5A 4M3XA 3QINA 2FBXA 3F9KA 4E19A 1NKBA 4GMJB 4JS4A 4E3SA 4CGHA 2B6AA 4M3RA 1Q9XA 3BDPA 3HK2A 1EP4A 4FW2A 1UA1A 3VA3A 1S5JA 5EU7A 1EXQA 1HRHA 4C8MA 4RG8A 2A1RA 3PO5A 4PUOA 1XI1A 4LH4A 1TKTA 1TL1A 2G8FA 4CEDA 4F8RA 3MEGA 1SL0A 3NH0A 4FJIA 4HHTA 4F3OA 3HO1A 1QQCA 4CJLA 1KRPA 4KI6A 1RDAA 4KFBA 3DRPA 4BDYA 1KFSA 3OYIA 1JKHA 1JLAA 4DWIA 4I9QA 4J2BA 5FDLA 2YNHA 2OPPA 4CJ5A 4BWMA 3LWMA 2QXFA 4IFVA 4HUGA 4DQRA 4KTZA 2VG5A 4O55A 3LWLA 3V1OA 3CFOA 4E1NA 3T3FA 1EX4A 1TK5A 3NH1A 1SL1A 3WNEA 3AVGA 3WNHA 3JSMA 1VSFA 1QSLA 4O0IA 4CHOA 3ZSWA 4KI4A 1C1CA 4QAGA 2VG6A 4CHYA 4FJGA 2KFNA 4O44A 1LWEA 2YNIA 1Q9YA 1KFDA 2HNYA 1RBVA 5JS2A 4RW4A 2NUBA 3QETA 3B6PA 2ZE2A 3VQAA 5HROA 1NJXA 5HLFA 3L2UA 1DLOA 3NGYA 1HNVA 1LAWA 1RTHA 5CYQA 3LP3A 2VWJA 4BE0A 3K58A 5C25A 4B08A 4CJ3A 3K5OA 3ZSYA 4CJ4A 1GOBA 4DS4A 1NK6A 5K14A 4ZHRA 4DTNA 3DOLA 1IKWA 3DRRA 4CF1A 4CHQA 4DQIA 1HNIA 1VRTA 2HHXA 2E4LA 4FJXA 3RRGA 3FFIA 3WNGA 4CF2A 1Z26A 4EZ9A 5I3UA 1J53A 1LWFA 4IG0A 3MAQA 3PX6A 5CYMA 5J2QA 3SJJA 4YFUA 3O3GA 1FKPA 1S1WA 3TAPA 1RTIA 1ASUA 4B8CA 3NDKA 3SUOA 1C1BA 2Z1GA 1DTTA 1HJRA 4DLEA 3EYZA 4DSJA 3ZSOA 4RW7A 3I8DA 3HM9A 4BE2A 1IO2A 5FRNA 3G0ZA 1NK5A 3TR8A 3VQCA 5KRSA 3OS1A 4CEAA 3QLHA 4R5PA 2KQ2A 2O4GA 3V1RA 3S3OA 1YTUA 1HQEA 3NF6A 4KHUA 3HSTB 3PO4A 1U04A 3QEVA 5CZ2A 5KGXA 2DTUA 1WSIA 1WAJA 3RR7A 1S9EA 3V1QA 3CM5A 3NF9A 1QSYA 2HHSA 3VQEA 2ATQA 3QESA 4OKKA 3V4IA 1JLEA 4WE1A 3OS0A 2HNDA 3IRXA 3OY9A 4RW6A 1L3UA 1S1XA 4ZTJA 3M8PA 3TAQA 1JL1A 3RWUA 1VSKA 4L8RB 1YT3A 4CJUA 2QK9A 1QHTA 4BWJA 1JLFA 4CERA 2ZD1A 3NAEA 1TGOA 1WN7A 4CHPA 4KTWA 4GW6A 1EETA 4AHUA 4FJ9A 3OYJA 3VQ7A 1SUQA 4DTUA 4CEZA 1RT1A 1ZBUA 2ZQBA 4CJFA 1Y97A 3K2PA 2XO7A 2X74A 4B9NA 3VN5A 1VSLA 3PUFA 3D0PA 4KHNA 4CJWA 3OYLA 3L8BA 2D0CA 3KKRA 1TKDA 1RBRA 4M45A 3ZSQA 3OYKA 4BDZA 4FVMA 3K5LA 5D3GA 1U49A 4Y1DA 3SUNA 3SPYA 4M3TA 3E01A 1GOAA 4BACA 3DM2A 4AHTA 1VSMA 4KPYA 3LZJA 4AHRA 4E7LA 4DTSA 2AJQA 4CF0A 1BHLA 1X9SA 4E7IA 4OKEA 2IS3A 4CGDA 4CJVA 3S3MA 3AVNA 1NK9A 2QKBA 1A5VA 3OYNA 4HUEA 3SQ1A 2BGGA 4J2AA 4IKFA 1QS4A 4H8KA 3SUQA 1S9GA 3T1AA 1D9DA 3SQ0A 1HQUA 4NCAA 5DK5A 3L2VA 1SL2A 4FJHA 1G15A 3AO5A 1JLGA 2FC0A 3ULDA 3SNNA 1BQNA 4W5RA 2PYLA 3RR8A 3NCIA 1S1UA 1Z25A 4KHSA 3BGRA 2XRIA 3LP2A 3SV3A 2FBVA 4FJNA 2IOCA 1NOZA 5KTQA 4YNQA 3AVCA 4LD0A 2YV0X 4M41A 4DF4A 4E0DA 4CIEA 1F21A 4NCGA 1T03A 2O4IA 3KJVA 4W5NA 3H08A 1TKXA 4OGCA 3LANA 3NGIA 1CZBA 2P5GA 1U4BA 4QCLA 2IDOA 3ZT4A 1NK0A 2OPRA 4EZ6A 4CHZA 3RRHA 1REVA 1ZBIA 1WSFA 4E7KA 4FJ5A 4FJ8A 4KTQA 2XY5A 1RDBA 4K8ZA 3C6TA 1TKZA 3LAKA 2HW3A 3EY1A 1WLJA 4M3YA 2JGUA 4FM0A 2X6NA 5J1EA 2XY6A 3V81A 1NKEA 2G8UA 4DQSA 5J2NA 3M8QA 4N41A 3ASMA 4C8OA 4DLGA 3LDSA 3F73A 3CFRA 4B3OA 3QO9A 4IDKA 3OJUA 4B9VA 3MXIA 1RT7A 4M3WA 3SZ2A 3TANA 3A2FA 1BISA 1RTJA 2Y1IA 3QNNA 4OLBA 1ASVA 3OYCA 3SCXA 4CFBA 5T7BA 4ELTA 4FYDA 1Q8IA 4O0JA 3PX0A 3ZT0A 3NBPA 3V9ZA 4J2DA 2KW4A 1BCMA 5HRSA 3AVBA 4FLYA 3SYZA 3T19A 3RMCA 3HJFA 1K6YA 2IC3A 4I7FA 4B9UA 3KIOA 1NKCA 4CEBA 3QIOA 1IG9A 1A5XA 2RPIA 3P1GA 2D0AA 1CXQA 4I2PA 2YKMA 3MXMA 4FZZA 3KK2A 3C94A 1MU2A 4CJEA 2RN2A 3TABA 2YKNA 3OYAA 2ETJA 2OZMA 3NF7A 3AVIA 3NGZA 4B9TA 3NF8A 1RT3A 2I5JA 2F96A 4CIGA 4CJPA 1TV6A 4E89A 3ZT2A 1S1TA 2OZSA 1U45A 4LY7A 4DTXA 3U6FA 1CZ9A 1XWLA 1VK0A 1FK9A 1WSJA 2X78A 3LP1A 1T8EA 3QERA 1VRUA 3ZT3A 3K5NA 4ZTFA 3THVA 3LPUA 4JLHA 5HRNA 1CXUA 5E41A 1RBTA 4AH9A 4DFPA 4DTMA 2PYJA 2HNZA 1C6VA 2P5OA 1HYZA 4FLWA 3OYFA 4LH5A 4DFJA 3PV8A 1XC9A 4F3TA 4IG3A 4O4GA 4Z4CA 1O1WA 1B9DA 3O4NA 4FJJA 1IH7A 4G1QA 3OYGA 4AHSA 3AV9A 3AA2A 4FLVA 4AHCA 4DSLA 4KRFA 1UOCA 3QIPA 2XY7A 4KB0A 5J2PA 3EZ5A 2X6SA 1W9HA 4B9LA 4FJKA 2HHUA 3QEWA 2OPSA 4I2QA 1VSDA 4ICLA 2LSNA 4UQGA 3DLKA 3OYMA 2OYQA 1BI4A 1S6QA 3VQ5A 3K57A 2R7YA 2GUIA 1NOYA 3OYBA 3CYMA 2KZMA 4AHVA 3AO1A 1EKEA 1TK0A 4Z0UA 1HYVA 1ZBFA 4OPJA 3G10A 4CF9A 3V9WA 4FJMA 4CGFA 4FK4A 4Z4IA 1JXEA 4KHQA 2Z1HA 1C1AA 5HRPA 3NFAA 4I9LA 4HCCA 3TI0A 5I42A 3LALA 4B8AB 1RT2A 4C8KA 4FM2A 2PZSA 3WNFA 3QEPA 1C0MA 1L5UA 1BCOA 2ITGA 4EP4A 3KK3A 3HPHA 1X9WA 3HXMA 4FJLA 1ZBHA 1IKVA 4CJTA 3NHGA 1XHXA 4RW8A 1RILA 4CGJA 4MQ3A 3SV4A 2RF2A 1RBSA 4KHYA 2RKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QEX A;  3KD1 E;  4OGE A;  1KCF A;  2G8I A;  1LWC A;  4DU4 A;  1BI4 B;  3U3Y A;  3SPZ A;  2W42 A;  3AVK A;  2HHV A;  3OYH A;  3L2R A;  2HHW A;  4CHN A;  4ID1 A;  3TWH A;  1B92 A;  2F8T A;  3LP0 A;  1UA0 A;  4Z4G A;  1KVA A;  4Y1C A;  3ALY A;  1X9M A;  3KD5 E;  4HCB A;  4TSX A;  4CEE A;  3OVN A;  4E1M A;  4FLX A;  4KHW A;  3QEI A;  5HRR A;  3LPT A;  1SV5 A;  3OYD A;  3V9S A;  4DFM A;  3DLE A;  3SQ4 A;  3P83 D;  1X1P A;  5SWM A;  2YHA A;  1HPZ A;  2JLE A;  3CG7 A;  1LAV A;  3HVT A;  4H4O A;  1NK7 A;  1RDC A;  1TAQ A;  4CIF A;  4PY5 A;  2KTQ A;  1VSE A;  1RBU A;  1J5O A;  4MFB A;  3OYE A;  4CE9 A;  3I0S A;  3DMJ A;  1CLQ A;  3VQB A;  2EX3 A;  3SQ2 A;  1WNS A;  4JRP A;  1NJZ A;  1UWB A;  3TAR A;  5SZT A;  3AVJ A;  5C42 A;  4F2S A;  1LW2 A;  4N5S A;  1D9F A;  1ITG A;  3JYT A;  1ZYQ A;  5KI6 A;  5FRM A;  4N47 A;  1BIU A;  3AVL A;  3V9U A;  1VSI A;  1L3S A;  3AO3 A;  1RT5 A;  1DTQ A;  3AVH A;  4DU3 A;  4OVL A;  3RMA A;  4C8L A;  4PWD A;  4CEF A;  3VA0 A;  2FBY A;  4CCH A;  5FRO A;  4CK1 A;  4CJK A;  1NK4 A;  3DLH A;  1KTQ A;  4LSN A;  4K8X A;  4Q0B A;  2HVI A;  3VQQ A;  1BQM A;  4CEC A;  3TAM A;  1LV5 A;  2G8K A;  5JS1 A;  4OPK A;  2VG7 A;  1S1V A;  2B4J A;  3B6O A;  3O4Q A;  3ZSR A;  3L2W A;  4E7J A;  4KAZ A;  4CGG A;  4FLU A;  2WON A;  3AVF A;  1RT6 A;  3DRS A;  4ELV A;  1JLQ A;  1A5W A;  4ID5 A;  4JRQ A;  3NE6 A;  2P51 A;  1WSH A;  5HBM A;  3UIQ A;  1UAX A;  3SUP A;  4DSI A;  1S6P A;  3HPO A;  3KTQ A;  3VQ6 A;  1QTM A;  1D5A A;  4C8N A;  3AA3 A;  4CGI A;  4B9S A;  3DLG A;  1ASW A;  1JXB A;  4CJQ A;  3MEE A;  1HYS A;  1LW0 A;  2YNF A;  3KLF A;  3L2Q A;  3AVM A;  4DFK A;  3S3N A;  1KLN A;  4PA1 A;  4FJ7 A;  1RTD A;  2DFF A;  3AA5 X;  3ISN C;  1WSG A;  2D5R A;  4KO0 A;  3ZSV A;  1BGX T;  1J54 A;  4DG1 A;  4DS5 A;  2OA8 A;  2HHT A;  3IS9 A;  2D0B A;  2IGI A;  4KB1 A;  1R0A A;  1IKY A;  1U48 A;  3VQ8 A;  4B9M A;  3KLI A;  2Z1I A;  1JL2 A;  1RCH A;  4E7H A;  1KSP A;  2PY5 A;  1N5Y A;  1HMV A;  4QOZ B;  4CFC A;  3M8R A;  1TK8 A;  4BE1 A;  5CY4 A;  1J9A A;  4DTP A;  4FK0 A;  4KRE A;  4N76 A;  1JLC A;  3ZT1 A;  1BL3 A;  4DSK A;  4DTJ A;  3RMD A;  1RNH A;  1YVU A;  3U3G A;  2G8H A;  1FXX A;  4CFD A;  3HP9 A;  3DI6 A;  3CQ8 A;  4DF8 A;  3AVA A;  4DTO A;  2F8S A;  4H4M A;  5HP1 A;  4M3U A;  4DU1 A;  2B5J A;  1NJY A;  4OJR A;  1YTA A;  3TAF A;  3KLH A;  4IFY A;  3L3U A;  3K5M A;  4HTU A;  1T05 A;  1WAF A;  2E6M A;  3AO2 A;  1GOC A;  3QNO A;  2BDP A;  3C95 A;  3ZSZ A;  4CJS A;  1NK8 A;  3DLB A;  1I39 A;  2KFZ A;  1I3A A;  3OJS A;  3IG1 A;  3OS2 A;  1W0H A;  2G8W A;  4W5Q A;  3CFP A;  4DQP A;  3TAE A;  3L3V A;  3AO4 A;  3LAM A;  1L3V A;  4FW1 A;  1KLM A;  1KVC A;  3SI6 A;  2DFE A;  4NCB A;  2DY4 A;  4CF8 A;  1C0T A;  1SKW A;  4JS5 A;  5J2M A;  2GV9 A;  4HVJ A;  1QSS A;  1IKX A;  4EP5 A;  4CJR A;  4M42 A;  3MEC A;  2VWK A;  5KRT A;  1WSE A;  4F2R A;  3S9H A;  3PX4 A;  3MXJ A;  1TVR A;  1VSJ A;  3ITH A;  5CZ1 A;  1NJW A;  3M8S A;  5KGW A;  3RTV A;  2G8V A;  2KZZ A;  1QE1 A;  3HPG A;  3AA4 A;  2YNG A;  3I0R A;  4CEQ A;  4DTR A;  4Z4E A;  2OPQ A;  4Q5V A;  4Z4F A;  3V6D A;  3HP6 A;  2A1S A;  1U47 A;  3DOK A;  3KKS A;  3KLG A;  3RMB A;  4ELU A;  4FK2 A;  4FM1 A;  5C24 A;  2XY8 A;  1C0U A;  3VQP A;  4CEO A;  2P1J A;  4O5B A;  3VQ4 A;  4LSL A;  4XIU A;  4W5T A;  3KK1 A;  1SKR A;  1JLB A;  4RW9 A;  3TAG A;  1L3T A;  4J2E A;  1TAU A;  2DFH A;  4OKJ A;  2WOM A;  1XHZ A;  4DQQ A;  1VSH A;  3VQ9 A;  3ZCM A;  4IBN A;  2BE2 A;  3C6U A;  2FBT A;  3HL8 A;  3ZSX A;  4W5O A;  1SKS A;  4FXD A;  3DLR A;  2EHG A;  4HUF A;  4CFA A;  3O3H A;  2HVH A;  2YHB A;  1KVB A;  4CK2 A;  1RDD A;  1N6Q A;  1RT4 A;  1FKO A;  3K59 A;  2Q3S A;  4KV8 A;  4OLA A;  4M3Z A;  4CK3 A;  2BAN A;  3IAY A;  4N56 A;  3MED A;  3HYF A;  3V9X A;  4FLZ A;  3HVR A;  1ZBL A;  2Z1J A;  4FLT A;  3DYA A;  2QKK A;  4FZY A;  3LZI A;  1B9F A;  4DSF A;  4F4K A;  2HHQ A;  3HT3 A;  4GVM A;  2Y1J A;  4PQU A;  3NH2 A;  3PY8 A;  2HMI A;  2E6L A;  5DMR A;  3D45 A;  3CM6 A;  2IAJ A;  4NYF A;  1BIZ A;  1TL3 A;  4FCY A;  4Z4H A;  3P5J A;  4DMN A;  2GBZ A;  1T7P A;  4NYN A;  4DSE A;  4AIL C;  4FZX C;  3KLE A;  3O3F A;  1D8Y A;  4CES A;  2XHB A;  4KKO A;  4BDP A;  3VQD A;  2HB5 A;  4M3X A;  3QIN A;  2FBX A;  3F9K A;  4E19 A;  1NKB A;  4GMJ B;  4JS4 A;  4E3S A;  4CGH A;  2B6A A;  4M3R A;  1Q9X A;  3BDP A;  3HK2 A;  1EP4 A;  4FW2 A;  1UA1 A;  3VA3 A;  1S5J A;  5EU7 A;  1EXQ A;  1HRH A;  4C8M A;  4RG8 A;  2A1R A;  3PO5 A;  4PUO A;  1XI1 A;  4LH4 A;  1TKT A;  1TL1 A;  2G8F A;  4CED A;  4F8R A;  3MEG A;  1SL0 A;  3NH0 A;  4FJI A;  4HHT A;  4F3O A;  3HO1 A;  1QQC A;  4CJL A;  1KRP A;  4KI6 A;  1RDA A;  4KFB A;  3DRP A;  4BDY A;  1KFS A;  3OYI A;  1JKH A;  1JLA A;  4DWI A;  4I9Q A;  4J2B A;  5FDL A;  2YNH A;  2OPP A;  4CJ5 A;  4BWM A;  3LWM A;  2QXF A;  4IFV A;  4HUG A;  4DQR A;  4KTZ A;  2VG5 A;  4O55 A;  3LWL A;  3V1O A;  3CFO A;  4E1N A;  3T3F A;  1EX4 A;  1TK5 A;  3NH1 A;  1SL1 A;  3WNE A;  3AVG A;  3WNH A;  3JSM A;  1VSF A;  1QSL A;  4O0I A;  4CHO A;  3ZSW A;  4KI4 A;  1C1C A;  4QAG A;  2VG6 A;  4CHY A;  4FJG A;  2KFN A;  4O44 A;  1LWE A;  2YNI A;  1Q9Y A;  1KFD A;  2HNY A;  1RBV A;  5JS2 A;  4RW4 A;  2NUB A;  3QET A;  3B6P A;  2ZE2 A;  3VQA A;  5HRO A;  1NJX A;  5HLF A;  3L2U A;  1DLO A;  3NGY A;  1HNV A;  1LAW A;  1RTH A;  5CYQ A;  3LP3 A;  2VWJ A;  4BE0 A;  3K58 A;  5C25 A;  4B08 A;  4CJ3 A;  3K5O A;  3ZSY A;  4CJ4 A;  1GOB A;  4DS4 A;  1NK6 A;  5K14 A;  4ZHR A;  4DTN A;  3DOL A;  1IKW A;  3DRR A;  4CF1 A;  4CHQ A;  4DQI A;  1HNI A;  1VRT A;  2HHX A;  2E4L A;  4FJX A;  3RRG A;  3FFI A;  3WNG A;  4CF2 A;  1Z26 A;  4EZ9 A;  5I3U A;  1J53 A;  1LWF A;  4IG0 A;  3MAQ A;  3PX6 A;  5CYM A;  5J2Q A;  3SJJ A;  4YFU A;  3O3G A;  1FKP A;  1S1W A;  3TAP A;  1RTI A;  1ASU A;  4B8C A;  3NDK A;  3SUO A;  1C1B A;  2Z1G A;  1DTT A;  1HJR A;  4DLE A;  3EYZ A;  4DSJ A;  3ZSO A;  4RW7 A;  3I8D A;  3HM9 A;  4BE2 A;  1IO2 A;  5FRN A;  3G0Z A;  1NK5 A;  3TR8 A;  3VQC A;  5KRS A;  3OS1 A;  4CEA A;  3QLH A;  4R5P A;  2KQ2 A;  2O4G A;  3V1R A;  3S3O A;  1YTU A;  1HQE A;  3NF6 A;  4KHU A;  3HST B;  3PO4 A;  1U04 A;  3QEV A;  5CZ2 A;  5KGX A;  2DTU A;  1WSI A;  1WAJ A;  3RR7 A;  1S9E A;  3V1Q A;  3CM5 A;  3NF9 A;  1QSY A;  2HHS A;  3VQE A;  2ATQ A;  3QES A;  4OKK A;  3V4I A;  1JLE A;  4WE1 A;  3OS0 A;  2HND A;  3IRX A;  3OY9 A;  4RW6 A;  1L3U A;  1S1X A;  4ZTJ A;  3M8P A;  3TAQ A;  1JL1 A;  3RWU A;  1VSK A;  4L8R B;  1YT3 A;  4CJU A;  2QK9 A;  1QHT A;  4BWJ A;  1JLF A;  4CER A;  2ZD1 A;  3NAE A;  1TGO A;  1WN7 A;  4CHP A;  4KTW A;  4GW6 A;  1EET A;  4AHU A;  4FJ9 A;  3OYJ A;  3VQ7 A;  1SUQ A;  4DTU A;  4CEZ A;  1RT1 A;  1ZBU A;  2ZQB A;  4CJF A;  1Y97 A;  3K2P A;  2XO7 A;  2X74 A;  4B9N A;  3VN5 A;  1VSL A;  3PUF A;  3D0P A;  4KHN A;  4CJW A;  3OYL A;  3L8B A;  2D0C A;  3KKR A;  1TKD A;  1RBR A;  4M45 A;  3ZSQ A;  3OYK A;  4BDZ A;  4FVM A;  3K5L A;  5D3G A;  1U49 A;  4Y1D A;  3SUN A;  3SPY A;  4M3T A;  3E01 A;  1GOA A;  4BAC A;  3DM2 A;  4AHT A;  1VSM A;  4KPY A;  3LZJ A;  4AHR A;  4E7L A;  4DTS A;  2AJQ A;  4CF0 A;  1BHL A;  1X9S A;  4E7I A;  4OKE A;  2IS3 A;  4CGD A;  4CJV A;  3S3M A;  3AVN A;  1NK9 A;  2QKB A;  1A5V A;  3OYN A;  4HUE A;  3SQ1 A;  2BGG A;  4J2A A;  4IKF A;  1QS4 A;  4H8K A;  3SUQ A;  1S9G A;  3T1A A;  1D9D A;  3SQ0 A;  1HQU A;  4NCA A;  5DK5 A;  3L2V A;  1SL2 A;  4FJH A;  1G15 A;  3AO5 A;  1JLG A;  2FC0 A;  3ULD A;  3SNN A;  1BQN A;  4W5R A;  2PYL A;  3RR8 A;  3NCI A;  1S1U A;  1Z25 A;  4KHS A;  3BGR A;  2XRI A;  3LP2 A;  3SV3 A;  2FBV A;  4FJN A;  2IOC A;  1NOZ A;  5KTQ A;  4YNQ A;  3AVC A;  4LD0 A;  2YV0 X;  4M41 A;  4DF4 A;  4E0D A;  4CIE A;  1F21 A;  4NCG A;  1T03 A;  2O4I A;  3KJV A;  4W5N A;  3H08 A;  1TKX A;  4OGC A;  3LAN A;  3NGI A;  1CZB A;  2P5G A;  1U4B A;  4QCL A;  2IDO A;  3ZT4 A;  1NK0 A;  2OPR A;  4EZ6 A;  4CHZ A;  3RRH A;  1REV A;  1ZBI A;  1WSF A;  4E7K A;  4FJ5 A;  4FJ8 A;  4KTQ A;  2XY5 A;  1RDB A;  4K8Z A;  3C6T A;  1TKZ A;  3LAK A;  2HW3 A;  3EY1 A;  1WLJ A;  4M3Y A;  2JGU A;  4FM0 A;  2X6N A;  5J1E A;  2XY6 A;  3V81 A;  1NKE A;  2G8U A;  4DQS A;  5J2N A;  3M8Q A;  4N41 A;  3ASM A;  4C8O A;  4DLG A;  3LDS A;  3F73 A;  3CFR A;  4B3O A;  3QO9 A;  4IDK A;  3OJU A;  4B9V A;  3MXI A;  1RT7 A;  4M3W A;  3SZ2 A;  3TAN A;  3A2F A;  1BIS A;  1RTJ A;  2Y1I A;  3QNN A;  4OLB A;  1ASV A;  3OYC A;  3SCX A;  4CFB A;  5T7B A;  4ELT A;  4FYD A;  1Q8I A;  4O0J A;  3PX0 A;  3ZT0 A;  3NBP A;  3V9Z A;  4J2D A;  2KW4 A;  1BCM A;  5HRS A;  3AVB A;  4FLY A;  3SYZ A;  3T19 A;  3RMC A;  3HJF A;  1K6Y A;  2IC3 A;  4I7F A;  4B9U A;  3KIO A;  1NKC A;  4CEB A;  3QIO A;  1IG9 A;  1A5X A;  2RPI A;  3P1G A;  2D0A A;  1CXQ A;  4I2P A;  2YKM A;  3MXM A;  4FZZ A;  3KK2 A;  3C94 A;  1MU2 A;  4CJE A;  2RN2 A;  3TAB A;  2YKN A;  3OYA A;  2ETJ A;  2OZM A;  3NF7 A;  3AVI A;  3NGZ A;  4B9T A;  3NF8 A;  1RT3 A;  2I5J A;  2F96 A;  4CIG A;  4CJP A;  1TV6 A;  4E89 A;  3ZT2 A;  1S1T A;  2OZS A;  1U45 A;  4LY7 A;  4DTX A;  3U6F A;  1CZ9 A;  1XWL A;  1VK0 A;  1FK9 A;  1WSJ A;  2X78 A;  3LP1 A;  1T8E A;  3QER A;  1VRU A;  3ZT3 A;  3K5N A;  4ZTF A;  3THV A;  3LPU A;  4JLH A;  5HRN A;  1CXU A;  5E41 A;  1RBT A;  4AH9 A;  4DFP A;  4DTM A;  2PYJ A;  2HNZ A;  1C6V A;  2P5O A;  1HYZ A;  4FLW A;  3OYF A;  4LH5 A;  4DFJ A;  3PV8 A;  1XC9 A;  4F3T A;  4IG3 A;  4O4G A;  4Z4C A;  1O1W A;  1B9D A;  3O4N A;  4FJJ A;  1IH7 A;  4G1Q A;  3OYG A;  4AHS A;  3AV9 A;  3AA2 A;  4FLV A;  4AHC A;  4DSL A;  4KRF A;  1UOC A;  3QIP A;  2XY7 A;  4KB0 A;  5J2P A;  3EZ5 A;  2X6S A;  1W9H A;  4B9L A;  4FJK A;  2HHU A;  3QEW A;  2OPS A;  4I2Q A;  1VSD A;  4ICL A;  2LSN A;  4UQG A;  3DLK A;  3OYM A;  2OYQ A;  1BI4 A;  1S6Q A;  3VQ5 A;  3K57 A;  2R7Y A;  2GUI A;  1NOY A;  3OYB A;  3CYM A;  2KZM A;  4AHV A;  3AO1 A;  1EKE A;  1TK0 A;  4Z0U A;  1HYV A;  1ZBF A;  4OPJ A;  3G10 A;  4CF9 A;  3V9W A;  4FJM A;  4CGF A;  4FK4 A;  4Z4I A;  1JXE A;  4KHQ A;  2Z1H A;  1C1A A;  5HRP A;  3NFA A;  4I9L A;  4HCC A;  3TI0 A;  5I42 A;  3LAL A;  4B8A B;  1RT2 A;  4C8K A;  4FM2 A;  2PZS A;  3WNF A;  3QEP A;  1C0M A;  1L5U A;  1BCO A;  2ITG A;  4EP4 A;  3KK3 A;  3HPH A;  1X9W A;  3HXM A;  4FJL A;  1ZBH A;  1IKV A;  4CJT A;  3NHG A;  1XHX A;  4RW8 A;  1RIL A;  4CGJ A;  4MQ3 A;  3SV4 A;  2RF2 A;  1RBS A;  4KHY A;  2RKI A; 
#chains in the Genus database with same CATH topology
 3QEX A;  2E88 A;  2D0P A;  3KD1 E;  4OGE A;  4A62 A;  2QWO A;  4DU4 A;  3H1Q A;  2HHV A;  3OYH A;  4BRL A;  3D2F A;  3C6A A;  3RSE A;  3VMF B;  3H1V X;  1DGK N;  2HBL A;  4ID1 A;  4CHN A;  2CGJ A;  4NXM K;  4CZH A;  4HCB A;  4CEE A;  3OVN A;  1XMQ K;  3R8E A;  3R6M A;  3V9S A;  3DLE A;  1X1P A;  2JLE A;  3HVT A;  1FW6 A;  4CIF A;  4ISG A;  2CH5 A;  4IOA L;  4MFB A;  4CE9 A;  3I0S A;  3DMJ A;  3PSI A;  2ZJR L;  3SQ2 A;  2QEX N;  3D2E A;  1JCG A;  1D9F A;  5KI6 A;  3L0Q A;  1BIU A;  3D2F B;  3RSE B;  3CJA A;  2QWM A;  4PWD A;  4CEF A;  3W3D A;  3VGM A;  2IVN A;  1BQM A;  1NM1 A;  2HF4 A;  1HNZ K;  1T6D A;  4RWT A;  1A5W A;  2E2O A;  3NMU A;  5AQK A;  5HBM A;  3UIQ A;  3SUP A;  4DSI A;  1QZ6 A;  3VQ6 A;  4B9S A;  4CZL A;  1YJW N;  1YAG A;  4CJQ A;  4YHH K;  2YNF A;  1YIJ N;  3AVM A;  4FWL A;  3S3N A;  2V7Y A;  4GV3 A;  4NXN K;  4KO0 A;  2DFF A;  3OTO K;  1WSG A;  1Z6R A;  2OA8 A;  1NGC A;  4FWK A;  1W7A A;  4B9M A;  2Z1I A;  3H3O B;  4DR2 K;  3KHY A;  4QOZ B;  3M8R A;  1TK8 A;  2UXB K;  1J9A A;  3O9S A;  1BL3 A;  4DSK A;  4WFA L;  3RMD A;  1RNH A;  5LL6 Z;  4JK8 A;  4M7X A;  3AVA A;  3D6R A;  1C0G A;  4BRN A;  1WBD A;  1NJY A;  4DCH A;  1YTA A;  2KKZ A;  3TAF A;  3KLH A;  2E6M A;  3AO2 A;  3CI5 A;  3T1H K;  5KQ8 A;  3C95 A;  3ZSZ A;  3DLB A;  1VQ6 N;  1QZ5 A;  3OJS A;  1Q81 O;  1W0H A;  4W5Q A;  5BRD A;  4DQP A;  3AO4 A;  3IUC A;  1L3V A;  1KVC A;  2A6A A;  2DY4 A;  3Q7B A;  4JS5 A;  3DXK A;  2CGK A;  2GV9 A;  4CJR A;  3TSP A;  3ITH A;  5GAD P;  2IIR A;  2G8V A;  4BVP A;  4JNE A;  1YHQ N;  4Z4E A;  3KWI A;  4Q5V A;  3FZM A;  1KXP A;  3KLG A;  3RMB A;  4ELU A;  4LF7 K;  3VQP A;  3HO1 A;  3FZF A;  4XIU A;  3DWL A;  4JI5 K;  2JWL A;  1VQ5 N;  1XHZ A;  4V19 S;  4IBN A;  4W5O A;  4JI3 K;  4HUF A;  4CFA A;  3DXK B;  4GVE A;  1KVB A;  2Q3S A;  4M3Z A;  4XH1 A;  2BAN A;  1RDW X;  3GBT A;  4JKA A;  4N56 A;  4DR5 K;  4BY9 C;  3IAY A;  5C0Y A;  4DSF A;  4F4K A;  3HT3 A;  5JLF A;  4DUY K;  3E66 A;  5DMR A;  1ZBS A;  5BRF A;  4NYF A;  1TL3 A;  2UXC K;  2D4W A;  4KBO A;  3ULE B;  4BRH A;  4AIL C;  1Q7Y O;  2OTJ N;  4KKO A;  2HHH K;  3QIN A;  2FBX A;  3ZEU A;  4JS4 A;  4E3S A;  2B6A A;  4M3R A;  1NGH A;  1Q9X A;  3BDP A;  3VA3 A;  5EU7 A;  1EXQ A;  1RGI A;  4LH4 A;  3LDP A;  5TKW A;  4CED A;  1SL0 A;  3NH0 A;  4F3O A;  3ENB A;  1GLB G;  4OX9 K;  1KRP A;  1KFS A;  4KFB A;  3DRP A;  1JKH A;  4WCE L;  1XC3 A;  4O55 A;  3V1O A;  4B1W B;  1VSF A;  1QSL A;  3CME N;  4WYB A;  3ZSW A;  4KI4 A;  4MDA A;  3TTC A;  2VG6 A;  4FJG A;  1QQN A;  5E26 A;  2YNI A;  4ILG B;  1M1K O;  1NBW A;  4RW4 A;  5EX5 A;  3B6P A;  4A2B A;  5HLF A;  3AY9 A;  1DLO A;  4YDU A;  2VWJ A;  1IJJ A;  4CJ3 A;  3ZSY A;  1NK6 A;  4YOT A;  2BH1 A;  4DS4 A;  3SLC A;  1IKW A;  3DRR A;  1HNI A;  1VRT A;  2HHX A;  3I8B A;  4ISE A;  1VQ4 N;  5I3U A;  1LWF A;  3PX6 A;  2HOE A;  4CI6 A;  4YOY A;  3LM2 A;  2E2P A;  1FKP A;  2FXU A;  4B8C A;  2A41 A;  5GIP A;  3NDK A;  3SUO A;  1N32 K;  1HJR A;  3EYZ A;  1IO2 A;  1NGJ A;  2D0O A;  3TR8 A;  1JCE A;  5AQN A;  4ILH A;  3LL3 A;  4JN4 A;  1Q82 O;  2P9N A;  4KHU A;  5AQZ A;  3ID8 A;  3QEV A;  5KGX A;  2HST A;  3CM5 A;  3CJ9 A;  3QES A;  2P9P A;  2VGN A;  3VGL A;  1P90 A;  2NZT A;  4WE1 A;  4RW6 A;  3M8P A;  4L8R B;  4CJU A;  1VQO N;  4CER A;  3SAH A;  1TGO A;  4CHP A;  5FPE A;  1EET A;  4DTU A;  4DV3 K;  4PL7 A;  4CEZ A;  1ZBU A;  4YDU C;  1Y97 A;  2YHY A;  4IZ9 A;  4CJW A;  3OYL A;  3G71 N;  1RBR A;  2UYT A;  4G9Z A;  5D3G A;  4LF5 K;  2VQE K;  3E01 A;  4BAC A;  3J7A P;  3E9P A;  4CF0 A;  3U9D A;  1BHL A;  1X9S A;  2IS3 A;  3EO3 A;  4CJV A;  3AVN A;  3OYN A;  3CJ1 A;  2RHK A;  3MX5 A;  4HUE A;  4J2A A;  3SUQ A;  4E1J A;  1HQU A;  5DM6 L;  2P9I A;  2V7Z A;  3SNN A;  3SMS A;  3BGR A;  3CC4 N;  2P9U A;  4E0D A;  1ATN A;  3FZK A;  3U4L A;  3KJV A;  3FZL A;  4W5N A;  1TKX A;  3D7E O;  4QCL A;  1NK0 A;  1XNR K;  4CHZ A;  4K41 A;  1REV A;  3CJ7 A;  1WSF A;  2P9L B;  4E7K A;  4FJ5 A;  5M1O A;  3E9O A;  5F1X A;  3CC7 N;  1TKZ A;  3VF4 A;  2X6N A;  1QQO A;  4FM0 A;  2G8U A;  5J2N A;  3ASM A;  3O9U A;  4IDK A;  4CZE A;  2P9U B;  3NVK A;  3TAN A;  1T3V A;  1BIS A;  4A61 A;  1TYQ B;  1ASV A;  4ELT A;  1BA0 A;  1Q8I A;  3SMP A;  3CMA N;  4J2D A;  3TTD A;  3V9Z A;  4GNI A;  5HRS A;  3HJF A;  4FLY A;  3VTH A;  3T19 A;  4GKJ K;  1NGI A;  1NKC A;  4BG9 A;  2NRT A;  4RCH A;  2YKM A;  3MXM A;  3KK2 A;  1FJG K;  1LOT B;  2RN2 A;  1EWR A;  2YKN A;  1V4T A;  2ETJ A;  2OZM A;  2O8F A;  3NF7 A;  3NF8 A;  4FWQ A;  1NMD A;  5AQP A;  1RFQ A;  1FK9 A;  2A40 A;  1WSJ A;  3AGK A;  1VRU A;  4JKG B;  4JI1 K;  5AZI B;  4JLH A;  1CXU A;  5E41 A;  1RBT A;  4AH9 A;  4DTM A;  1C6V A;  2P5O A;  1HYZ A;  4F3T A;  2KLA A;  1XC9 A;  4O4G A;  3AAP A;  3CCQ N;  2W6K A;  4NB4 A;  1Y64 A;  3CCV N;  4G1Q A;  2E2N A;  3AV9 A;  3CHW A;  4AHC A;  3ZET A;  2UXD K;  2HMP A;  3EZ5 A;  2X6S A;  4B9L A;  2QI2 A;  3BZK A;  2OPS A;  3QEW A;  1GLF O;  3ID6 A;  3DLK A;  2OYQ A;  3EE9 A;  1S6Q A;  3K57 A;  4H0X B;  4FPA A;  4JK7 A;  4H5V A;  3CYM A;  3PIP L;  1HYV A;  3G10 A;  4CF9 A;  5I9E B;  1OVQ A;  1JXE A;  4KHQ A;  5BRH A;  2Z1H A;  3VOV A;  1OKJ A;  3LAL A;  4LF8 K;  1TUU A;  3CER A;  1R59 O;  2P9S B;  4GKK K;  1X9W A;  3HXM A;  5M1K A;  2RF2 A;  4YOV A;  1HR0 K;  2RKI A;  2KHO A;  4WQ4 A;  2E8A A;  1LWC A;  3U3Y A;  2E1Y A;  2W42 A;  4CZK A;  2O8C A;  1B92 A;  4QS8 A;  1X9M A;  3RVC A;  4TSX A;  4FLX A;  4E1M A;  3THW A;  3OYD A;  3MK6 A;  1HNX K;  5SWM A;  3CCU N;  2YHA A;  1HPZ A;  3CG7 A;  4H4O A;  2V51 B;  1NK7 A;  1RDC A;  1TAQ A;  1QQM A;  4QS7 A;  1VSE A;  1J5O A;  1K8A O;  3VQB A;  3T7Z A;  4FWN A;  1WNS A;  4JK9 A;  2QWR A;  1UWB A;  2H3G X;  3JYT A;  1ZYQ A;  3V9U A;  3AVL A;  1L3S A;  2O8C B;  4DU3 A;  4OVL A;  1GLD G;  4CCH A;  4OPH A;  3DLH A;  4CK1 A;  4CJK A;  4U7B A;  3THW B;  3TAM A;  5JS1 A;  4OPK A;  5CHI A;  2ASP A;  2E5L K;  4JKC A;  4CGG A;  4FLU A;  1RT6 A;  4ELV A;  1KAX A;  4JRQ A;  1SAZ A;  3MX2 A;  3ATV A;  1OH7 A;  2P51 A;  4WQ4 C;  1UAX A;  3HPO A;  2AP1 A;  3NVM A;  1D5A A;  3DLG A;  4F9O A;  1JXB A;  1HUX A;  4PA1 A;  4M7Y A;  1K8K B;  1RTD A;  3AA5 X;  3ISN C;  1BGX T;  1J54 A;  3F5T A;  3IS9 A;  1R0A A;  3KLI A;  1JL2 A;  5ELZ A;  4CZJ A;  3G6E N;  5CY4 A;  4BR2 A;  4KRE A;  3HRG A;  3ZT1 A;  1YVU A;  1X3N A;  3U3G A;  4BGA A;  3CQ8 A;  4DTO A;  2F8S A;  4H4M A;  5HP1 A;  1BO5 O;  4DU1 A;  3UKR B;  4BGB A;  3UE5 A;  4IFY A;  1I39 A;  3TU5 A;  4YOX A;  3DJC A;  1S22 A;  1ATR A;  3IG1 A;  3KWG A;  3OS2 A;  2G8W A;  1WBB A;  3UB5 A;  3TPQ A;  3LAM A;  4H0V B;  1XMO K;  4NCB A;  3TSQ A;  4CF8 A;  4ISF A;  4EHU A;  5J2M A;  5GAE P;  1IKX A;  2NRV A;  4M42 A;  4DV4 K;  1BDG A;  3CCL N;  2WC9 A;  4Y0W A;  2QM1 A;  4CEQ A;  3OHR A;  4Z4F A;  3QFU A;  3V6D A;  4AM7 A;  3HP6 A;  4FPB A;  1DEJ A;  4CEO A;  4W5T A;  4B3S K;  3KK1 A;  4K25 A;  4FOI A;  4OKJ A;  2F7T A;  3VQ9 A;  1SKS A;  4FXD A;  3L4I A;  3DLR A;  1NLV A;  1YVN A;  2YHB A;  2ASM A;  4EAH D;  3O4W A;  4H03 B;  1RT4 A;  3K59 A;  4OLA A;  4FL9 A;  1DKG D;  5LJW A;  4FLZ A;  3LZI A;  1B9F A;  4BRA A;  5M1N A;  4PQU A;  3NH2 A;  3PY8 A;  2E6L A;  2IAJ A;  4FCY A;  3QFP A;  3LDQ A;  4Z4H A;  4DMN A;  3KLE A;  4DV1 K;  1JCF A;  1D8Y A;  4CES A;  3SAF A;  3F9K A;  5M1Q A;  4R79 A;  3HK2 A;  2CH6 A;  1UA1 A;  1U2V A;  3GG4 A;  3HBT A;  1HRH A;  3M5R A;  4C8M A;  4BC4 A;  4PUO A;  1XI1 A;  3O1W A;  4F8R A;  1T44 A;  2OAN A;  4XEI A;  3VPZ A;  2A3Z A;  4HHT A;  3WQU A;  4KI6 A;  3OYI A;  4BRM A;  1VQ8 N;  3D2E B;  3FFK B;  5MLC Q;  5AQX A;  3WXL A;  4E1N A;  1HPM A;  5F0X A;  4O0I A;  1GLC G;  2KFN A;  4O44 A;  1LWE A;  1U2V B;  1WUA A;  3N4P A;  2WFB A;  4GV6 A;  2HNY A;  5GIO A;  2YJE A;  2NUB A;  4BRF A;  1NJX A;  1HNV A;  5FLX O;  3K58 A;  5JLH A;  4CJ4 A;  2GUP A;  5AR0 A;  1N36 K;  4ZHR A;  2YJF A;  2NRH A;  3HOS A;  2E4L A;  4MO4 A;  4FJX A;  3WNG A;  2F9T A;  4EZ9 A;  3MAQ A;  3ZLJ A;  2NRZ A;  3TAP A;  3FLC O;  1NG9 A;  3UKU A;  1C0F A;  1HKB A;  4DSJ A;  4BRG A;  3IKM A;  4BE2 A;  3Q7C A;  1VQK N;  1H1V A;  2KQ2 A;  2O4G A;  3S3O A;  1HQE A;  3NF6 A;  4BR4 A;  2ATQ A;  4OKK A;  2OTL N;  2HBK A;  5AQO A;  4FSV A;  5JVG L;  3B8A X;  4O8U A;  3UKU B;  1JL1 A;  3CC2 N;  2PAV A;  1QHT A;  1WN7 A;  3OW2 M;  4GW6 A;  4AHU A;  4JD2 A;  1VQN N;  1N34 K;  3QDK A;  2XO7 A;  1VSL A;  4A57 A;  3J81 O;  3GDQ A;  3HTV A;  3SUN A;  4H0O A;  1ATS A;  1GOA A;  3H3N O;  4JI8 K;  3LZJ A;  4CGD A;  2QKB A;  5JVH L;  1NK9 A;  3BUZ B;  4IJN A;  4IKF A;  3BF1 A;  3O1B A;  3PLA A;  5DK5 A;  1BOT O;  1JLG A;  1J5E K;  1S1U A;  4YOU A;  1ZC6 A;  3LP2 A;  4JI2 K;  3SV3 A;  2IOC A;  4YNQ A;  4LD0 A;  4M41 A;  4DF4 A;  2NRR A;  1T03 A;  4B1V A;  2ZGY A;  3LAN A;  4OGC A;  5AQU A;  1CZB A;  1QHA A;  5FPN A;  3CCJ N;  3RRH A;  1ESV A;  1G99 A;  2BTF A;  3O9Q A;  2ITM A;  4K8Z A;  3EY1 A;  2YX6 A;  4A2A A;  4M3Y A;  5J1E A;  3V81 A;  4DQS A;  3M8Q A;  4DLG A;  3LDS A;  3F73 A;  3ZEU B;  3MXI A;  1Z05 A;  4M3W A;  4PL8 A;  2AA4 A;  4FVU A;  2Y1I A;  4BR7 A;  3MN5 A;  3JS6 A;  4IJA A;  3OYC A;  4FYD A;  3O8M A;  2VYP A;  3VGK A;  1KAZ A;  1BCM A;  3DAW A;  3SYZ A;  4PHT X;  1K6Y A;  3IDH A;  4KH6 A;  3VEN A;  4WQ5 A;  3DXM A;  1YI2 N;  3R9P A;  1CXQ A;  3C94 A;  3TAB A;  3OYA A;  3N4Q A;  3IFR A;  3AVI A;  5C12 A;  1Q86 O;  2F96 A;  4CIG A;  1VHX A;  2OZS A;  1U45 A;  3U6F A;  1CZ9 A;  1VK0 A;  4LF4 K;  4BC2 A;  1M90 O;  4ZTF A;  1V4S A;  5LMU K;  5HRN A;  1HKG A;  4CVN E;  4DFP A;  2HNZ A;  4LH5 A;  1NWK A;  1O1W A;  3O4N A;  4FJJ A;  1IH7 A;  3BP8 A;  5BR8 K;  1BG3 A;  4AHS A;  5AQG A;  3AA2 A;  3MN9 A;  5IT9 O;  5HOO A;  4KRF A;  4KB0 A;  5J2P A;  3R1X A;  1W2B M;  1VSD A;  4UQG A;  3OYM A;  1BI4 A;  3VQ5 A;  3E9L A;  2R7Y A;  1VQ7 N;  4DR3 K;  4Z0U A;  2Q36 A;  3V9W A;  4FJM A;  1C1A A;  2P9N B;  2VGM A;  3TI0 A;  4BRP A;  5I42 A;  4WQ5 C;  1RT2 A;  4FM2 A;  1L5U A;  4JV5 K;  1SZ2 A;  2ITG A;  1EWQ A;  5EXW A;  4EP4 A;  3KK3 A;  3C7N A;  4FJL A;  2P9P B;  3NHG A;  1XHX A;  1RIL A;  3CF5 L;  3EEQ A;  1RBS A;  4KHY A;  3BY5 A;  1BI4 B;  4LF9 K;  3AVK A;  4MDB A;  3L2R A;  3TTF A;  1BU6 O;  4BG8 A;  2HBJ A;  2F8T A;  4Z4G A;  4H5W A;  3KD5 E;  4KHW A;  3C65 A;  5HRR A;  4DFM A;  3A5M C;  3P83 D;  1LAV A;  3THY A;  2KTQ A;  4PY5 A;  3C7N B;  3O9R A;  3CCM N;  3OYE A;  2W40 A;  5AQR A;  1CLQ A;  2EX3 A;  1NJZ A;  3TAR A;  5SZT A;  3AVJ A;  5C42 A;  4DV7 K;  2F4V K;  4IO8 A;  1ITG A;  5FRM A;  3C6H A;  4N47 A;  2HBM A;  1VSI A;  4JKF A;  1NGA A;  5KPR A;  3AVH A;  3RMA A;  4C8L A;  4Z94 A;  4BRO A;  1NGB A;  2P9I B;  4LSN A;  3VQQ A;  1VQL N;  2ZM6 K;  1LV5 A;  5AFU H;  4CD3 A;  1DT9 A;  1S1V A;  2VG7 A;  3B6O A;  3H6E A;  2BUP A;  3L2W A;  4E7J A;  3THY B;  2W41 A;  2WON A;  3AVF A;  4JKD A;  3DRS A;  1OH6 A;  4ID5 A;  5AQM A;  1IBM K;  1WSH A;  5F2R A;  1S6P A;  3IMX A;  4GV9 A;  3F2K A;  3QBW A;  2JWK A;  1QTM A;  3AA3 A;  4CGI A;  5AQL A;  3L4Q A;  4AQY K;  4FWM A;  3KLF A;  2NNW A;  1KLN A;  4FJ7 A;  2W6L A;  4CBU A;  5BN8 A;  2FF3 B;  3ZSV A;  4DS5 A;  2D5R A;  2D0B A;  3VQ8 A;  4AM6 A;  4E7H A;  2VCP A;  1KSP A;  3L6Q A;  2PY5 A;  1HMV A;  4CFC A;  3O5B A;  3I33 A;  4BE1 A;  3WXI A;  4FK0 A;  4N76 A;  1JLC A;  4CFD A;  2NRX A;  3M1F A;  1YXQ A;  4M3U A;  2UUA K;  4OJR A;  3K5M A;  1WAF A;  4WF9 L;  1GOC A;  2BDP A;  4B1X B;  1NGF A;  4IEI A;  4CJS A;  1NK8 A;  1O13 A;  2O8F B;  3ATU A;  3TAE A;  3L3V A;  3MWT A;  1KLM A;  3SI6 A;  1HX1 A;  1C0T A;  3PSF A;  1GLL O;  4BC3 A;  4EP5 A;  4A5A A;  2VWK A;  5KRT A;  1WSE A;  3S9H A;  1NJW A;  3M8S A;  3RTV A;  1KC8 O;  1QE1 A;  2YNG A;  3I0R A;  4DR7 K;  2OPQ A;  5FPM A;  2EWS A;  5AQV A;  2ZF5 O;  1U47 A;  4EFH A;  1X3M A;  3KKS A;  3ZET B;  4FK2 A;  4FM1 A;  5C24 A;  2XY8 A;  1C0U A;  3M6G A;  1SKR A;  1JLB A;  4RW9 A;  2O8D A;  4J2E A;  1TAU A;  5BN9 A;  4I6M A;  4DQQ A;  1VAZ A;  3ZCM A;  3E1Y A;  3HL8 A;  4DV2 K;  3LDO A;  1RDD A;  3GOI A;  1FKO A;  1NGG A;  5AQT A;  4CK3 A;  3ENO A;  4NO7 A;  3MED A;  5AFU A;  3V9X A;  2P9K A;  1ZBL A;  2Z1J A;  1WB9 A;  2J4R A;  4KH5 A;  2HHQ A;  1HKC A;  3VTI A;  3BEX A;  2HMI A;  4H0T B;  3G25 A;  4WFN L;  2GBZ A;  4DSE A;  4FZX C;  1K73 O;  1J6Z A;  2HB5 A;  3QB0 A;  4M3X A;  3TSU A;  4CGH A;  3MN6 A;  1JJ2 M;  1BWF O;  4RG8 A;  3AAQ A;  1TKT A;  2G8F A;  3MEG A;  4OPA A;  1JLA A;  4DWI A;  4I9Q A;  3WXK A;  5FDL A;  4CJ5 A;  3ENH A;  4BWM A;  3LWM A;  3OBY A;  4HUG A;  4DQR A;  1HNW K;  2VG5 A;  5EY4 A;  1BUP A;  3LWL A;  2I7P A;  3CFO A;  3T3F A;  1SL1 A;  3JSM A;  4B9Q A;  4CHO A;  4K0K K;  4QAG A;  2QWP A;  3K0S A;  2ZE2 A;  3VQA A;  3O08 A;  1RTH A;  4JHD A;  4BRQ A;  5C25 A;  4B08 A;  5K14 A;  4DTN A;  2VQF K;  1T6C A;  5KPZ A;  3FFI A;  4CF2 A;  1Z26 A;  1IBL K;  1J53 A;  5J2Q A;  1YJ9 N;  4XH5 A;  3O3G A;  1RTI A;  3M3Z A;  5AZJ A;  4DKW A;  1C1B A;  4NLB A;  3I8D A;  5GIN A;  4DV0 K;  1NK5 A;  4FWR A;  4B3M K;  5KRS A;  5GAG P;  1W97 L;  3EKU A;  3OA9 A;  4JHD B;  2Q2R A;  3HZ6 A;  1U04 A;  3PO4 A;  1MA9 B;  5CZ2 A;  3BZC A;  1WSI A;  3RR7 A;  3V1Q A;  3SBT A;  2HHS A;  3SJH A;  4JYA K;  4FWP A;  4PKH A;  1XNQ K;  3V4I A;  2QWQ A;  1ILY A;  3VES A;  4CZM A;  1NNE A;  4WFB L;  4YOW A;  1L3U A;  4RTF D;  4BVO A;  4LFB K;  4JEP A;  1YT3 A;  2QK9 A;  2WUS A;  1JLF A;  2ZD1 A;  3NAE A;  4KTW A;  3G4S N;  4FJ9 A;  1SUQ A;  1RT1 A;  4CJF A;  2QW9 A;  4BRK A;  2X74 A;  4KHN A;  3L8B A;  2D0C A;  1TKD A;  3CCS N;  3OYK A;  4DR4 K;  4FVM A;  1X9J A;  3SPY A;  4M3T A;  3DM2 A;  1WOQ A;  4AHR A;  2AJQ A;  4DTS A;  2UUB K;  4GY2 B;  3WEE A;  3A8Y A;  4E7I A;  4OKE A;  3S3M A;  4MLE A;  3SQ1 A;  4XH4 A;  1QS4 A;  2WBN A;  3T1A A;  2GEL A;  3SQ0 A;  3MWP A;  4FJH A;  1G15 A;  3AO5 A;  2FC0 A;  3CXC M;  1BQN A;  4MLH A;  4W5R A;  3RR8 A;  4BR0 A;  3NCI A;  4KHS A;  3VEV A;  4FJN A;  4CD1 A;  3CJC A;  3LM9 A;  3VER A;  2YHX A;  3H08 A;  2WTU A;  4JKE A;  4H5R A;  3EE8 A;  3NGI A;  2P5G A;  3WEE B;  1U4B A;  2IDO A;  3ZT4 A;  2OPR A;  4EZ6 A;  1KQS M;  4IFE A;  3MCA B;  5B8H A;  1ZBI A;  3VF6 A;  4KTQ A;  3C6T A;  5A2Q O;  2HW3 A;  3LAK A;  3VEY A;  4KHP K;  2JGU A;  1Q18 A;  4HWI A;  2XY6 A;  1GLJ O;  5C10 A;  4N41 A;  4C8O A;  3CFR A;  3OJU A;  1N8R O;  4DR6 K;  1RT7 A;  4H5T A;  1RTJ A;  4OLB A;  3SCX A;  4CFB A;  3VF2 A;  2Q0R A;  3PX0 A;  3A5L C;  3CCR N;  3AVB A;  2RE2 A;  2Q1N A;  2ZJQ L;  3VEW A;  4K43 A;  4I7F A;  3J7Z O;  3KIO A;  1E4G T;  4CEB A;  2RPI A;  3P1G A;  4FZZ A;  3ZYY X;  4CJE A;  1EQY A;  3SBG A;  1N33 K;  3SAG A;  4JI0 K;  1TV6 A;  3O6W A;  1S1T A;  4B3R K;  1XWL A;  5FPD A;  3CCE N;  3LP1 A;  1T8E A;  4M63 C;  3ZT3 A;  3K5N A;  2YHW A;  2PYJ A;  4BRI A;  4FLW A;  3OYF A;  4DFJ A;  3PV8 A;  4X66 K;  4IG3 A;  1B9D A;  3CET A;  3K9J A;  4H0P A;  3THX A;  2GX9 A;  2XY7 A;  5AQF A;  1W9H A;  2CGL A;  4A59 A;  2LSN A;  2DPN A;  1OH8 A;  1P8Z A;  4EIA A;  2GUI A;  4PKG A;  4CBX A;  3OYB A;  4OO1 J;  2KZM A;  4AHV A;  3AO1 A;  2ZJP L;  1TK0 A;  4LFC K;  1ZBF A;  4OPJ A;  4BR9 A;  1VQ9 N;  4FK4 A;  4CW7 B;  5AJ3 K;  5HRP A;  3NFA A;  4I9L A;  5H1S Q;  3GL1 A;  4C8K A;  3WNF A;  3QEP A;  4YY3 K;  1ZBH A;  3THX B;  1IKV A;  3VET A;  3CPE A;  2PBD A;  4B1Y B;  4IEE A;  1VQP N;  4JI7 K;  2QXF A;  1KCF A;  2OCE A;  2G8I A;  3SPZ A;  3ULE A;  2HHW A;  3VEO A;  3TWH A;  4DV6 K;  3LP0 A;  4JD2 B;  1UA0 A;  1KVA A;  4Y1C A;  3ALY A;  1VQM N;  3QEI A;  3LPT A;  1SV5 A;  4DB3 A;  1EO1 A;  4HTL A;  5C2F A;  3SQ4 A;  5BPM A;  4IWV A;  2QXL A;  4FWS A;  4O8K A;  3EZW A;  1RBU A;  3VEZ A;  5CR4 A;  4JRP A;  5AQI A;  4BRE A;  4F2S A;  5AQQ A;  4DV5 K;  1LW2 A;  4N5S A;  3HOT A;  4X65 K;  3ZX0 A;  3J80 O;  3AO3 A;  1RT5 A;  1DTQ A;  1QVG M;  3VA0 A;  3H46 O;  2FBY A;  2QWN A;  5FRO A;  4K8X A;  1NK4 A;  4Q0B A;  1KTQ A;  2HVI A;  1YJN N;  3DLL L;  2G8K A;  4CEC A;  2E20 A;  2B4J A;  3O4Q A;  3ZSR A;  1XUP O;  4KAZ A;  1JLQ A;  2NLX A;  3ZX2 A;  3NE6 A;  4BQZ A;  4YOR A;  3KTQ A;  3A5N C;  3FZH A;  4C8N A;  4X64 K;  1ASW A;  1CZA N;  3T69 A;  3MEE A;  1HYS A;  1SS6 A;  1LW0 A;  2O8E A;  3L2Q A;  4DFK A;  2Q0U A;  4IOC L;  1NGD A;  4DG1 A;  3WXM B;  2HHT A;  2IGI A;  1KD1 O;  4KB1 A;  1IKY A;  4H5N A;  1U48 A;  4BQL A;  3P31 A;  3J8A A;  1RCH A;  1HLU A;  1N5Y A;  4AF1 A;  3VEX A;  5C2D A;  1IBK K;  4B1Z A;  1D4X A;  4DTP A;  3LDN A;  2IVP A;  4DTJ A;  2G8H A;  1FXX A;  3QBX A;  3HP9 A;  3DI6 A;  4DF8 A;  3F9M A;  5TKY A;  3FE1 A;  2B5J A;  2O8E B;  3DXM B;  3L3U A;  1T05 A;  4HTU A;  3WUH A;  3QNO A;  3U9Z A;  4BR5 A;  2KFZ A;  1I3A A;  3KVG A;  3EL2 A;  4BRC A;  3O80 A;  3CFP A;  4FO0 A;  4U67 L;  1GLA G;  4FW1 A;  1SQK A;  4DHY A;  2DFE A;  2Q97 A;  1YUW A;  1SKW A;  3K9K A;  4QS9 A;  1QVF M;  4HVJ A;  1QSS A;  2A42 A;  3MEC A;  2YCH A;  3S41 A;  4F2R A;  1OH5 A;  3PX4 A;  3MXJ A;  1TVR A;  1VSJ A;  5CZ1 A;  3QML A;  1IG8 A;  5KGW A;  2KZZ A;  3HPG A;  3AA4 A;  4DTR A;  4JAX A;  2A1S A;  1OVY A;  4LF6 K;  3DOK A;  5EVZ A;  2P1J A;  4O5B A;  3VQ4 A;  4LSL A;  3TAG A;  1L3T A;  2DFH A;  2WOM A;  2FLO A;  1VSH A;  2BE2 A;  3C6U A;  2FBT A;  3ZSX A;  1IV0 A;  2EHG A;  5HL7 L;  3O3H A;  2HVH A;  4IDH A;  5IWA K;  4CK2 A;  1U6Z A;  1N6Q A;  2Q31 A;  4KV8 A;  1KAY A;  2UUC K;  5LJV A;  3HYF A;  2A5X A;  3T1Y K;  3HVR A;  4FLT A;  3DYA A;  2QKK A;  5KPT A;  4FZY A;  3R3L A;  4GVM A;  2Y1J A;  2P9L A;  3LDL A;  3P39 A;  3D45 A;  3CM6 A;  1BIZ A;  3CQY A;  3P5J A;  4DR1 K;  5C15 A;  1T7P A;  4NYN A;  3O3F A;  1XQS C;  2XHB A;  1YF5 L;  4BDP A;  1MDU B;  3VQD A;  4E19 A;  3A0I X;  5BRE A;  1NKB A;  1K9M O;  4GMJ B;  3I55 N;  1TYQ A;  3MMV A;  1EP4 A;  4FW2 A;  4CJ7 A;  1S5J A;  2ASO A;  3PO5 A;  2A1R A;  2FSK A;  5LY3 A;  1TL1 A;  5LMN K;  4FJI A;  1QQC A;  4CJL A;  1S72 N;  1NJI O;  1RDA A;  3AGR A;  4BDY A;  3PIO L;  4J2B A;  2YNH A;  2OPP A;  3QIC A;  4IFV A;  4KTZ A;  1YIT N;  1I94 K;  2V52 B;  1TK5 A;  1EX4 A;  3NH1 A;  5ADX H;  1RDU A;  3WNE A;  3AVG A;  3WNH A;  5JIC A;  3FGU A;  4LC9 B;  1C1C A;  4CHY A;  1Q9Y A;  4JKG A;  1KFD A;  5JS2 A;  1RBV A;  5GAH P;  3QET A;  5AZI A;  5HRO A;  3L2U A;  3HI0 A;  3NGY A;  1LAW A;  2E1Z A;  5CYQ A;  3LP3 A;  4BE0 A;  4K42 A;  2FF6 A;  3CPW M;  3K5O A;  1GOB A;  3MDQ A;  1HJO A;  3DOL A;  3GE1 A;  3P4I A;  4CF1 A;  4CHQ A;  4DQI A;  2D1K A;  3RRG A;  4IXC A;  4IG0 A;  5CYM A;  3KK7 A;  3SJJ A;  4YFU A;  1GLE G;  1S1W A;  1ASU A;  4ILJ A;  3AAR A;  2Z1G A;  1DTT A;  4DLE A;  3CIP A;  3ZSO A;  4RW7 A;  3HM9 A;  5FRN A;  5BPL A;  2QTD A;  3G0Z A;  3VQC A;  3OS1 A;  4CEA A;  3QLH A;  4R5P A;  4DUZ K;  4IO9 L;  3V1R A;  4EHT A;  2HF3 A;  1YTU A;  3CD6 N;  3HST B;  1NGE A;  2DTU A;  1WAJ A;  5BR9 A;  1S9E A;  3OBW A;  3JAM O;  4PKI A;  3NF9 A;  3EKS A;  1QSY A;  2UU9 K;  2P9S A;  3VQE A;  3CJB A;  2I7N A;  4A5B A;  4FOE A;  1JLE A;  3OS0 A;  2HND A;  3IRX A;  3OY9 A;  3CQX A;  1MWM A;  1S1X A;  2ZGZ A;  4ZTJ A;  4JKB A;  3TAQ A;  3RWU A;  1VSK A;  2NRW A;  5M1P A;  4BWJ A;  4CZG A;  3OYJ A;  3VQ7 A;  1NU0 A;  4MO5 A;  2ZQB A;  3K2P A;  2VWB A;  4B9N A;  3VN5 A;  3PUF A;  3D0P A;  3KKR A;  4M45 A;  3ZSQ A;  1S3X A;  4BDZ A;  3K5L A;  1U49 A;  4Y1D A;  1E3M A;  2YI1 A;  5AQS A;  4AHT A;  1VSM A;  4KPY A;  2ZWH A;  4E7L A;  3JXU A;  3HSC A;  4B1U B;  4UY8 O;  3WT0 A;  1A5V A;  2FSN A;  5M1F A;  2BGG A;  3H45 C;  4H8K A;  1E4F T;  1S9G A;  2O8D B;  1D9D A;  1LCU A;  4NCA A;  4I6M B;  3L2V A;  1SL2 A;  1BA1 A;  3ULD A;  2PYL A;  1Z25 A;  2XRI A;  4C1N K;  2FBV A;  5CE3 A;  1NOZ A;  5KTQ A;  3AVC A;  5ADX A;  2YV0 X;  3HM8 A;  3U8X A;  4CIE A;  1F21 A;  3MN7 A;  4NCG A;  4BC5 A;  2O4I A;  4O5F A;  5DM7 L;  2P9K B;  2QA4 N;  4FJ8 A;  5AQW A;  2XY5 A;  1RDB A;  5AQJ A;  4C23 A;  1WLJ A;  1NKE A;  1K8K A;  3I56 N;  3P38 A;  4B3O A;  3QO9 A;  4B9V A;  3SZ2 A;  4LFA K;  3A2F A;  5E84 A;  3QNN A;  5T7B A;  4O0J A;  3ZT0 A;  3WXJ A;  3NBP A;  2KW4 A;  2O8B A;  3RMC A;  2IC3 A;  3FR0 A;  2GTD A;  4X62 K;  4B9U A;  4J8F A;  3UKR A;  3QIO A;  1IG9 A;  1A5X A;  2D0A A;  3KZB A;  2IVO A;  4I2P A;  3SK3 A;  4CZI A;  1MWK A;  1MU2 A;  3MCP A;  5EOY A;  3NGZ A;  3O9T A;  4B9T A;  1RT3 A;  2I5J A;  4CJP A;  2GWJ A;  1NMN A;  3A5O C;  4E89 A;  3ZT2 A;  4LY7 A;  4DTX A;  3ZX3 A;  2X78 A;  2E2Q A;  3QER A;  4FWO A;  3C0B A;  3THV A;  3LPU A;  2O8B B;  5KQD A;  3EN9 A;  5AQH A;  3W0L A;  2QWL A;  4Z4C A;  4KH4 A;  2PFU A;  4JI4 K;  1TUY A;  3OYG A;  4FLV A;  4DSL A;  3J7Y P;  3BF3 A;  1UOC A;  3QIP A;  4JI6 K;  5AQY A;  2HHU A;  1ZXO A;  4FJK A;  4I2Q A;  2GWK A;  4ICL A;  5AZJ B;  4IOX A;  4DQ8 A;  4JKH A;  5BPN A;  1NOY A;  4C1N I;  1EKE A;  3WQT A;  4Z4I A;  4CGF A;  4CZF A;  5JMV A;  4NLC A;  4CBW A;  4HCC A;  4H0Y B;  4B3T K;  4B8A B;  2PZS A;  2GEM A;  1C0M A;  1BCO A;  3HPH A;  4CJT A;  2FSJ A;  4RW8 A;  4BRD A;  4MQ3 A;  4L3Q A;  4CGJ A;  3SV4 A;  2F9W A; 
#chains in the Genus database with same CATH homology
 3QEX A;  3KD1 E;  4OGE A;  1KCF A;  2G8I A;  1LWC A;  4DU4 A;  1BI4 B;  3U3Y A;  3SPZ A;  2W42 A;  3AVK A;  2HHV A;  3OYH A;  3L2R A;  2HHW A;  4CHN A;  4ID1 A;  3TWH A;  1B92 A;  2F8T A;  3LP0 A;  1UA0 A;  4Z4G A;  1KVA A;  4Y1C A;  3ALY A;  1X9M A;  3KD5 E;  4HCB A;  4TSX A;  4CEE A;  3OVN A;  4E1M A;  4FLX A;  4KHW A;  3QEI A;  5HRR A;  3LPT A;  1SV5 A;  3OYD A;  3V9S A;  4DFM A;  3DLE A;  3SQ4 A;  3P83 D;  1X1P A;  5SWM A;  2YHA A;  1HPZ A;  2JLE A;  3CG7 A;  1LAV A;  3HVT A;  4H4O A;  1NK7 A;  1RDC A;  1TAQ A;  4CIF A;  4PY5 A;  2KTQ A;  1VSE A;  1RBU A;  1J5O A;  4MFB A;  3OYE A;  4CE9 A;  3I0S A;  3DMJ A;  1CLQ A;  3VQB A;  2EX3 A;  3SQ2 A;  1WNS A;  4JRP A;  1NJZ A;  1UWB A;  3TAR A;  5SZT A;  3AVJ A;  5C42 A;  4F2S A;  1LW2 A;  4N5S A;  1D9F A;  1ITG A;  3JYT A;  1ZYQ A;  5KI6 A;  5FRM A;  4N47 A;  1BIU A;  3AVL A;  3V9U A;  1VSI A;  1L3S A;  3AO3 A;  1RT5 A;  1DTQ A;  3AVH A;  4DU3 A;  4OVL A;  3RMA A;  4C8L A;  4PWD A;  4CEF A;  3VA0 A;  2FBY A;  4CCH A;  5FRO A;  4CK1 A;  4CJK A;  1NK4 A;  3DLH A;  1KTQ A;  4LSN A;  4K8X A;  4Q0B A;  2HVI A;  3VQQ A;  1BQM A;  4CEC A;  3TAM A;  1LV5 A;  2G8K A;  5JS1 A;  4OPK A;  2VG7 A;  1S1V A;  2B4J A;  3B6O A;  3O4Q A;  3ZSR A;  3L2W A;  4E7J A;  4KAZ A;  4CGG A;  4FLU A;  2WON A;  3AVF A;  1RT6 A;  3DRS A;  4ELV A;  1JLQ A;  1A5W A;  4ID5 A;  4JRQ A;  3NE6 A;  2P51 A;  1WSH A;  5HBM A;  3UIQ A;  1UAX A;  3SUP A;  4DSI A;  1S6P A;  3HPO A;  3KTQ A;  3VQ6 A;  1QTM A;  1D5A A;  4C8N A;  3AA3 A;  4CGI A;  4B9S A;  3DLG A;  1ASW A;  1JXB A;  4CJQ A;  3MEE A;  1HYS A;  1LW0 A;  2YNF A;  3KLF A;  3L2Q A;  3AVM A;  4DFK A;  3S3N A;  1KLN A;  4PA1 A;  4FJ7 A;  1RTD A;  2DFF A;  3AA5 X;  3ISN C;  1WSG A;  2D5R A;  4KO0 A;  3ZSV A;  1BGX T;  1J54 A;  4DG1 A;  4DS5 A;  2OA8 A;  2HHT A;  3IS9 A;  2D0B A;  2IGI A;  4KB1 A;  1R0A A;  1IKY A;  1U48 A;  3VQ8 A;  4B9M A;  3KLI A;  2Z1I A;  1JL2 A;  1RCH A;  4E7H A;  1KSP A;  2PY5 A;  1N5Y A;  1HMV A;  4QOZ B;  4CFC A;  3M8R A;  1TK8 A;  4BE1 A;  5CY4 A;  1J9A A;  4DTP A;  4FK0 A;  4KRE A;  4N76 A;  1JLC A;  3ZT1 A;  1BL3 A;  4DSK A;  4DTJ A;  3RMD A;  1RNH A;  1YVU A;  3U3G A;  2G8H A;  1FXX A;  4CFD A;  3HP9 A;  3DI6 A;  3CQ8 A;  4DF8 A;  3AVA A;  4DTO A;  2F8S A;  4H4M A;  5HP1 A;  4M3U A;  4DU1 A;  2B5J A;  1NJY A;  4OJR A;  1YTA A;  3TAF A;  3KLH A;  4IFY A;  3L3U A;  3K5M A;  4HTU A;  1T05 A;  1WAF A;  2E6M A;  3AO2 A;  1GOC A;  3QNO A;  2BDP A;  3C95 A;  3ZSZ A;  4CJS A;  1NK8 A;  3DLB A;  1I39 A;  2KFZ A;  1I3A A;  3OJS A;  3IG1 A;  3OS2 A;  1W0H A;  2G8W A;  4W5Q A;  3CFP A;  4DQP A;  3TAE A;  3L3V A;  3AO4 A;  3LAM A;  1L3V A;  4FW1 A;  1KLM A;  1KVC A;  3SI6 A;  2DFE A;  4NCB A;  2DY4 A;  4CF8 A;  1C0T A;  1SKW A;  4JS5 A;  5J2M A;  2GV9 A;  4HVJ A;  1QSS A;  1IKX A;  4EP5 A;  4CJR A;  4M42 A;  3MEC A;  2VWK A;  5KRT A;  1WSE A;  4F2R A;  3S9H A;  3PX4 A;  3MXJ A;  1TVR A;  1VSJ A;  3ITH A;  5CZ1 A;  1NJW A;  3M8S A;  5KGW A;  3RTV A;  2G8V A;  2KZZ A;  1QE1 A;  3HPG A;  3AA4 A;  2YNG A;  3I0R A;  4CEQ A;  4DTR A;  4Z4E A;  2OPQ A;  4Q5V A;  4Z4F A;  3V6D A;  3HP6 A;  2A1S A;  1U47 A;  3DOK A;  3KKS A;  3KLG A;  3RMB A;  4ELU A;  4FK2 A;  4FM1 A;  5C24 A;  2XY8 A;  1C0U A;  3VQP A;  4CEO A;  2P1J A;  4O5B A;  3VQ4 A;  4LSL A;  4XIU A;  4W5T A;  3KK1 A;  1SKR A;  1JLB A;  4RW9 A;  3TAG A;  1L3T A;  4J2E A;  1TAU A;  2DFH A;  4OKJ A;  2WOM A;  1XHZ A;  4DQQ A;  1VSH A;  3VQ9 A;  3ZCM A;  4IBN A;  2BE2 A;  3C6U A;  2FBT A;  3HL8 A;  3ZSX A;  4W5O A;  1SKS A;  4FXD A;  3DLR A;  2EHG A;  4HUF A;  4CFA A;  3O3H A;  2HVH A;  2YHB A;  1KVB A;  4CK2 A;  1RDD A;  1N6Q A;  1RT4 A;  1FKO A;  3K59 A;  2Q3S A;  4KV8 A;  4OLA A;  4M3Z A;  4CK3 A;  2BAN A;  3IAY A;  4N56 A;  3MED A;  3HYF A;  3V9X A;  4FLZ A;  3HVR A;  1ZBL A;  2Z1J A;  4FLT A;  3DYA A;  2QKK A;  4FZY A;  3LZI A;  1B9F A;  4DSF A;  4F4K A;  2HHQ A;  3HT3 A;  4GVM A;  2Y1J A;  4PQU A;  3NH2 A;  3PY8 A;  2HMI A;  2E6L A;  5DMR A;  3D45 A;  3CM6 A;  2IAJ A;  4NYF A;  1BIZ A;  1TL3 A;  4FCY A;  4Z4H A;  3P5J A;  4DMN A;  2GBZ A;  1T7P A;  4NYN A;  4DSE A;  4AIL C;  4FZX C;  3KLE A;  3O3F A;  1D8Y A;  4CES A;  2XHB A;  4KKO A;  4BDP A;  3VQD A;  2HB5 A;  4M3X A;  3QIN A;  2FBX A;  3F9K A;  4E19 A;  1NKB A;  4GMJ B;  4JS4 A;  4E3S A;  4CGH A;  2B6A A;  4M3R A;  1Q9X A;  3BDP A;  3HK2 A;  1EP4 A;  4FW2 A;  1UA1 A;  3VA3 A;  1S5J A;  5EU7 A;  1EXQ A;  1HRH A;  4C8M A;  4RG8 A;  2A1R A;  3PO5 A;  4PUO A;  1XI1 A;  4LH4 A;  1TKT A;  1TL1 A;  2G8F A;  4CED A;  4F8R A;  3MEG A;  1SL0 A;  3NH0 A;  4FJI A;  4HHT A;  4F3O A;  3HO1 A;  1QQC A;  4CJL A;  1KRP A;  4KI6 A;  1RDA A;  4KFB A;  3DRP A;  4BDY A;  1KFS A;  3OYI A;  1JKH A;  1JLA A;  4DWI A;  4I9Q A;  4J2B A;  5FDL A;  2YNH A;  2OPP A;  4CJ5 A;  4BWM A;  3LWM A;  2QXF A;  4IFV A;  4HUG A;  4DQR A;  4KTZ A;  2VG5 A;  4O55 A;  3LWL A;  3V1O A;  3CFO A;  4E1N A;  3T3F A;  1EX4 A;  1TK5 A;  3NH1 A;  1SL1 A;  3WNE A;  3AVG A;  3WNH A;  3JSM A;  1VSF A;  1QSL A;  4O0I A;  4CHO A;  3ZSW A;  4KI4 A;  1C1C A;  4QAG A;  2VG6 A;  4CHY A;  4FJG A;  2KFN A;  4O44 A;  1LWE A;  2YNI A;  1Q9Y A;  1KFD A;  2HNY A;  1RBV A;  5JS2 A;  4RW4 A;  2NUB A;  3QET A;  3B6P A;  2ZE2 A;  3VQA A;  5HRO A;  1NJX A;  5HLF A;  3L2U A;  1DLO A;  3NGY A;  1HNV A;  1LAW A;  1RTH A;  5CYQ A;  3LP3 A;  2VWJ A;  4BE0 A;  3K58 A;  5C25 A;  4B08 A;  4CJ3 A;  3K5O A;  3ZSY A;  4CJ4 A;  1GOB A;  4DS4 A;  1NK6 A;  5K14 A;  4ZHR A;  4DTN A;  3DOL A;  1IKW A;  3DRR A;  4CF1 A;  4CHQ A;  4DQI A;  1HNI A;  1VRT A;  2HHX A;  2E4L A;  4FJX A;  3RRG A;  3FFI A;  3WNG A;  4CF2 A;  1Z26 A;  4EZ9 A;  5I3U A;  1J53 A;  1LWF A;  4IG0 A;  3MAQ A;  3PX6 A;  5CYM A;  5J2Q A;  3SJJ A;  4YFU A;  3O3G A;  1FKP A;  1S1W A;  3TAP A;  1RTI A;  1ASU A;  4B8C A;  3NDK A;  3SUO A;  1C1B A;  2Z1G A;  1DTT A;  1HJR A;  4DLE A;  3EYZ A;  4DSJ A;  3ZSO A;  4RW7 A;  3I8D A;  3HM9 A;  4BE2 A;  1IO2 A;  5FRN A;  3G0Z A;  1NK5 A;  3TR8 A;  3VQC A;  5KRS A;  3OS1 A;  4CEA A;  3QLH A;  4R5P A;  2KQ2 A;  2O4G A;  3V1R A;  3S3O A;  1YTU A;  1HQE A;  3NF6 A;  4KHU A;  3HST B;  3PO4 A;  1U04 A;  3QEV A;  5CZ2 A;  5KGX A;  2DTU A;  1WSI A;  1WAJ A;  3RR7 A;  1S9E A;  3V1Q A;  3CM5 A;  3NF9 A;  1QSY A;  2HHS A;  3VQE A;  2ATQ A;  3QES A;  4OKK A;  3V4I A;  1JLE A;  4WE1 A;  3OS0 A;  2HND A;  3IRX A;  3OY9 A;  4RW6 A;  1L3U A;  1S1X A;  4ZTJ A;  3M8P A;  3TAQ A;  1JL1 A;  3RWU A;  1VSK A;  4L8R B;  1YT3 A;  4CJU A;  2QK9 A;  1QHT A;  4BWJ A;  1JLF A;  4CER A;  2ZD1 A;  3NAE A;  1TGO A;  1WN7 A;  4CHP A;  4KTW A;  4GW6 A;  1EET A;  4AHU A;  4FJ9 A;  3OYJ A;  3VQ7 A;  1SUQ A;  4DTU A;  4CEZ A;  1RT1 A;  1ZBU A;  2ZQB A;  4CJF A;  1Y97 A;  3K2P A;  2XO7 A;  2X74 A;  4B9N A;  3VN5 A;  1VSL A;  3PUF A;  3D0P A;  4KHN A;  4CJW A;  3OYL A;  3L8B A;  2D0C A;  3KKR A;  1TKD A;  1RBR A;  4M45 A;  3ZSQ A;  3OYK A;  4BDZ A;  4FVM A;  3K5L A;  5D3G A;  1U49 A;  4Y1D A;  3SUN A;  3SPY A;  4M3T A;  3E01 A;  1GOA A;  4BAC A;  3DM2 A;  4AHT A;  1VSM A;  4KPY A;  3LZJ A;  4AHR A;  4E7L A;  4DTS A;  2AJQ A;  4CF0 A;  1BHL A;  1X9S A;  4E7I A;  4OKE A;  2IS3 A;  4CGD A;  4CJV A;  3S3M A;  3AVN A;  1NK9 A;  2QKB A;  1A5V A;  3OYN A;  4HUE A;  3SQ1 A;  2BGG A;  4J2A A;  4IKF A;  1QS4 A;  4H8K A;  3SUQ A;  1S9G A;  3T1A A;  1D9D A;  3SQ0 A;  1HQU A;  4NCA A;  5DK5 A;  3L2V A;  1SL2 A;  4FJH A;  1G15 A;  3AO5 A;  1JLG A;  2FC0 A;  3ULD A;  3SNN A;  1BQN A;  4W5R A;  2PYL A;  3RR8 A;  3NCI A;  1S1U A;  1Z25 A;  4KHS A;  3BGR A;  2XRI A;  3LP2 A;  3SV3 A;  2FBV A;  4FJN A;  2IOC A;  1NOZ A;  5KTQ A;  4YNQ A;  3AVC A;  4LD0 A;  2YV0 X;  4M41 A;  4DF4 A;  4E0D A;  4CIE A;  1F21 A;  4NCG A;  1T03 A;  2O4I A;  3KJV A;  4W5N A;  3H08 A;  1TKX A;  4OGC A;  3LAN A;  3NGI A;  1CZB A;  2P5G A;  1U4B A;  4QCL A;  2IDO A;  3ZT4 A;  1NK0 A;  2OPR A;  4EZ6 A;  4CHZ A;  3RRH A;  1REV A;  1ZBI A;  1WSF A;  4E7K A;  4FJ5 A;  4FJ8 A;  4KTQ A;  2XY5 A;  1RDB A;  4K8Z A;  3C6T A;  1TKZ A;  3LAK A;  2HW3 A;  3EY1 A;  1WLJ A;  4M3Y A;  2JGU A;  4FM0 A;  2X6N A;  5J1E A;  2XY6 A;  3V81 A;  1NKE A;  2G8U A;  4DQS A;  5J2N A;  3M8Q A;  4N41 A;  3ASM A;  4C8O A;  4DLG A;  3LDS A;  3F73 A;  3CFR A;  4B3O A;  3QO9 A;  4IDK A;  3OJU A;  4B9V A;  3MXI A;  1RT7 A;  4M3W A;  3SZ2 A;  3TAN A;  3A2F A;  1BIS A;  1RTJ A;  2Y1I A;  3QNN A;  4OLB A;  1ASV A;  3OYC A;  3SCX A;  4CFB A;  5T7B A;  4ELT A;  4FYD A;  1Q8I A;  4O0J A;  3PX0 A;  3ZT0 A;  3NBP A;  3V9Z A;  4J2D A;  2KW4 A;  1BCM A;  5HRS A;  3AVB A;  4FLY A;  3SYZ A;  3T19 A;  3RMC A;  3HJF A;  1K6Y A;  2IC3 A;  4I7F A;  4B9U A;  3KIO A;  1NKC A;  4CEB A;  3QIO A;  1IG9 A;  1A5X A;  2RPI A;  3P1G A;  2D0A A;  1CXQ A;  4I2P A;  2YKM A;  3MXM A;  4FZZ A;  3KK2 A;  3C94 A;  1MU2 A;  4CJE A;  2RN2 A;  3TAB A;  2YKN A;  3OYA A;  2ETJ A;  2OZM A;  3NF7 A;  3AVI A;  3NGZ A;  4B9T A;  3NF8 A;  1RT3 A;  2I5J A;  2F96 A;  4CIG A;  4CJP A;  1TV6 A;  4E89 A;  3ZT2 A;  1S1T A;  2OZS A;  1U45 A;  4LY7 A;  4DTX A;  3U6F A;  1CZ9 A;  1XWL A;  1VK0 A;  1FK9 A;  1WSJ A;  2X78 A;  3LP1 A;  1T8E A;  3QER A;  1VRU A;  3ZT3 A;  3K5N A;  4ZTF A;  3THV A;  3LPU A;  4JLH A;  5HRN A;  1CXU A;  5E41 A;  1RBT A;  4AH9 A;  4DFP A;  4DTM A;  2PYJ A;  2HNZ A;  1C6V A;  2P5O A;  1HYZ A;  4FLW A;  3OYF A;  4LH5 A;  4DFJ A;  3PV8 A;  1XC9 A;  4F3T A;  4IG3 A;  4O4G A;  4Z4C A;  1O1W A;  1B9D A;  3O4N A;  4FJJ A;  1IH7 A;  4G1Q A;  3OYG A;  4AHS A;  3AV9 A;  3AA2 A;  4FLV A;  4AHC A;  4DSL A;  4KRF A;  1UOC A;  3QIP A;  2XY7 A;  4KB0 A;  5J2P A;  3EZ5 A;  2X6S A;  1W9H A;  4B9L A;  4FJK A;  2HHU A;  3QEW A;  2OPS A;  4I2Q A;  1VSD A;  4ICL A;  2LSN A;  4UQG A;  3DLK A;  3OYM A;  2OYQ A;  1BI4 A;  1S6Q A;  3VQ5 A;  3K57 A;  2R7Y A;  2GUI A;  1NOY A;  3OYB A;  3CYM A;  2KZM A;  4AHV A;  3AO1 A;  1EKE A;  1TK0 A;  4Z0U A;  1HYV A;  1ZBF A;  4OPJ A;  3G10 A;  4CF9 A;  3V9W A;  4FJM A;  4CGF A;  4FK4 A;  4Z4I A;  1JXE A;  4KHQ A;  2Z1H A;  1C1A A;  5HRP A;  3NFA A;  4I9L A;  4HCC A;  3TI0 A;  5I42 A;  3LAL A;  4B8A B;  1RT2 A;  4C8K A;  4FM2 A;  2PZS A;  3WNF A;  3QEP A;  1C0M A;  1L5U A;  1BCO A;  2ITG A;  4EP4 A;  3KK3 A;  3HPH A;  1X9W A;  3HXM A;  4FJL A;  1ZBH A;  1IKV A;  4CJT A;  3NHG A;  1XHX A;  4RW8 A;  1RIL A;  4CGJ A;  4MQ3 A;  3SV4 A;  2RF2 A;  1RBS A;  4KHY A;  2RKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...