4LD0A

T. thermophilus ruvc in complex with holliday junction substrate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
166
structure length
158
Chain Sequence
MVVAGIDPGITHLGLGVVAVEGALKARLLHGEVVKTSPQEPAKERVGRIHARVLEVLHRFRPEAVAVQEQFFYRQNELAYKVGWALGAVLVAAFEAGVPVYAYGPMQVKQALAKEEVALMVRGILGLKEAPRPSHLADALAIALTHAFYARMGTAKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Crossover junction endodeoxyribonuclease RuvC
publication title Crystal structure of RuvC resolvase in complex with Holliday junction substrate.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 49
structure length 158
sequence length 166
chains with identical sequence B
ec nomenclature ec 3.1.22.4: Crossover junction endodeoxyribonuclease.
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02075 RuvC Crossover junction endodeoxyribonuclease RuvC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ld0A00
2KZMA 4CEAA 4XIUA 3PY8A 2DY4A 4DTRA 2EHGA 4E19A 4FLYA 1U48A 1SL2A 1NK6A 1QSSA 2G8UA 4CK2A 2OZMA 1WSGA 2F8SA 4DS5A 2KFNA 1RTJA 3AVHA 3KLHA 1IG9A 1CLQA 3M8SA 3TWHA 2VG5A 3AO2A 1SKWA 3LP3A 4C8KA 1Y97A 4DQPA 3CYMA 4CF0A 3A2FA 2ZD1A 4DFJA 3MXIA 1U45A 4LH5A 1SL1A 1C0UA 1RBUA 3L3UA 1S1UA 4OJRA 1RBVA 3AA2A 1EKEA 2VWKA 3ZT2A 1RDCA 1ASVA 1GOAA 2A1SA 2B6AA 3ITHA 5E41A 4M3TA 2KW4A 3NCIA 4L8RB 3L3VA 4E89A 4CHYA 3AO3A 3SV3A 3VQ6A 4O4GA 1NJWA 2G8WA 1UOCA 4QAGA 4E7IA 2ITGA 1IH7A 3DYAA 3OY9A 3HPHA 1ZYQA 2G8IA 3DLRA 4ICLA 3K5MA 4OGCA 4O55A 3WNFA 4Z4CA 3RMBA 3OVNA 4BACA 4OLBA 1NK4A 4KTQA 1JLGA 4FJJA 3OYEA 1C6VA 3CG7A 4Z4IA 2YHBA 1FKOA 3DLEA 3TAPA 4HCCA 4DSJA 4KHWA 3V9XA 5FROA 1LV5A 3E01A 1RTHA 3KKRA 3VQ9A 5T7BA 4H4OA 2Z1GA 3AVBA 1D8YA 1ASWA 2RF2A 3K59A 4DTSA 1XI1A 4JRQA 3DRSA 1RDBA 3DLKA 3KKSA 1DTQA 4CGJA 3OYKA 4FJNA 4J2EA 4CGHA 4IDKA 4FLWA 4O44A 3SUOA 4FZYA 3C94A 4CEEA 2XRIA 1CZBA 1Z25A 3K2PA 4FVMA 2JGUA 4BWJA 4BDZA 1BIZA 1NJXA 3B6OA 4AH9A 3NGYA 4CFAA 4MFBA 3RMCA 1JLAA 3B6PA 3TAEA 1EX4A 3AO5A 2Y1JA 1QSYA 3CQ8A 3MXMA 1L3VA 3CFOA 4GVMA 3HYFA 3I0RA 2DFHA 1A5XA 3M8PA 3MECA 1S1VA 1VSKA 4CF2A 2DFFA 3EYZA 1TKZA 3HP6A 1LWFA 4FZXC 1JLQA 1NK8A 2XY8A 3OYIA 1GOCA 2HNDA 2X6SA 3KIOA 4N56A 1C1AA 4CF8A 4F3TA 1XC9A 1S6QA 1IKVA 5KRTA 1IO2A 4RG8A 3VQ4A 2QKKA 3BDPA 2Q3SA 1YT3A 4BE2A 3VQDA 3RMDA 2P5OA 1SV5A 1RT3A 1HQEA 2Z1HA 1C0TA 1ZBFA 3HPGA 4W5RA 3LANA 5HRRA 1HPZA 3VA0A 3DMJA 1C1BA 3KK2A 3AVKA 2HHWA 4E7KA 5KGXA 1S9EA 2VG6A 3V1RA 5JS1A 3IRXA 2EX3A 2HNZA 1NK0A 3MEGA 3ZCMA 3O4NA 1LAWA 1S9GA 3T1AA 4I2QA 1TK0A 4B9UA 1VSFA 2ZQBA 3TAGA 3HJFA 4W5OA 4B9NA 4I9QA 1RBSA 4FJ9A 4RW4A 4CE9A 1ITGA 1WSJA 3SV4A 2XY6A 2IDOA 3NH1A 4CJRA 4HVJA 4O0JA 5DK5A 4FJIA 4OKKA 2BGGA 5JS2A 4KHQA 4C8NA 1A5WA 1X9MA 1KFSA 4G1QA 3L8BA 4PWDA 3HXMA 4DF4A 1CXUA 1TVRA 1KVCA 2ZE2A 3ZSWA 4DG1A 2R7YA 4HTUA 3SJJA 1BCMA 3AA3A 5C25A 5HRPA 1EXQA 4E7LA 4Y1CA 3SQ0A 1LWCA 2F96A 3QIPA 1T7PA 3D45A 3LWMA 4FJXA 2X78A 5SZTA 4CEZA 5HRNA 4KB1A 2VG7A 2D0CA 1L5UA 3QINA 4CJSA 4IFVA 1UA0A 1B92A 4AHTA 1QQCA 3MEDA 3SUNA 1TK8A 2Z1JA 3PX0A 4E7HA 1KFDA 4AHCA 1S5JA 3F9KA 4B8CA 1T05A 3JSMA 3DLGA 1NKCA 1JLBA 1QE1A 3KTQA 4FJGA 3NBPA 4H4MA 4KO0A 3V81A 3LP1A 4LSNA 1KVAA 3ALYA 1NK9A 4DSLA 3LP0A 1RILA 3AVJA 4C8MA 4B3OA 4AHRA 4F3OA 2BANA 4KTZA 4I9LA 4ID5A 4CJPA 3OS1A 1HJRA 3LZJA 2FBVA 4NCBA 2D0AA 3C6TA 4GW6A 4J2AA 4CIGA 1HYSA 4ZHRA 1Q8IA 5I42A 3LP2A 3VQPA 4ID1A 2P51A 3V9ZA 4FK0A 3P1GA 1Q9XA 3U3GA 4Z4FA 3KD1E 4EZ6A 4FLUA 4AHSA 4HUEA 2IOCA 3P83D 3QERA 4AHVA 3KLGA 1RT2A 3V1QA 3RTVA 1WSIA 4CJQA 4M42A 4DQQA 4PQUA 4DTPA 3S3MA 3I8DA 4DLEA 3G0ZA 4B9TA 5KTQA 5FDLA 4F4KA 2Z1IA 1DTTA 3HVRA 3V1OA 2YKNA 5J2PA 3OYNA 2RN2A 1RDDA 4KI6A 4FJLA 3LALA 2WOMA 2ATQA 3ISNC 3K5OA 3NF7A 4CFDA 2OPRA 3OS2A 2OYQA 2YKMA 4FK2A 4M3ZA 3LPUA 1IKXA 3ZT3A 2P5GA 3D0PA 3AVAA 4KTWA 4CHQA 2HMIA 4LD0A 4JS4A 4EP4A 4B9MA 4DMNA 2GBZA 1TKTA 4CIFA 3NHGA 5J2MA 4C8LA 5HLFA 4CJKA 4PUOA 4DSKA 3AVGA 3QEXA 4DF8A 1TGOA 2P1JA 3VQBA 4CFCA 4CJFA 3SPYA 1XHZA 4FJHA 1VSHA 4CK3A 3DI6A 4LY7A 4DFKA 1NOYA 3TAMA 4DSEA 2FBYA 1N6QA 1U49A 4PY5A 1A5VA 4DQRA 1U47A 3OYMA 4CJUA 1VRUA 3MEEA 5DMRA 4B08A 4CF9A 4R5PA 4IKFA 2NUBA 1NKEA 2KFZA 3NF8A 3S9HA 1T8EA 1LW2A 1NJYA 3SQ2A 1TAUA 4ZTJA 4FK4A 2RKIA 4JS5A 4CESA 4CJVA 3L2VA 1B9FA 3NAEA 3LPTA 1FKPA 4UQGA 1YVUA 1SKSA 3L2WA 4K8XA 2IGIA 1BI4A 2WONA 1ZBLA 1BISA 3DM2A 1CZ9A 1EP4A 1UWBA 1QTMA 3SCXA 3CM5A 4O0IA 1YTAA 4MQ3A 4CERA 5CY4A 4N47A 1SKRA 2AJQA 2BDPA 1X9SA 4F2RA 4F8RA 1KTQA 3WNGA 3TR8A 4B9SA 4CJ3A 4Z0UA 1S1XA 3VQ7A 3TAFA 5C42A 3JYTA 4FJMA 4KHYA 4FW1A 3KD5E 1TKXA 5K14A 5KGWA 4E3SA 1JXBA 1WLJA 3AVLA 4RW7A 2HHTA 1VK0A 3HK2A 4CJTA 4W5NA 1D9FA 1KLMA 3CFPA 1B9DA 3QESA 1BIUA 1MU2A 3HVTA 3KK1A 3T19A 3VQ8A 1L3TA 2E6LA 3SUPA 4KB0A 3K5LA 4FM1A 1W9HA 1HNIA 3O3FA 3RRHA 1LAVA 4FW2A 3QEVA 4IG3A 5SWMA 5C24A 4Z4GA 2B4JA 2FBTA 3AV9A 3AA4A 3OYFA 1Z26A 4HUFA 1REVA 2YNGA 5D3GA 2IC3A 1BCOA 2HVHA 1RCHA 3CFRA 4CHNA 1S1WA 1IKWA 3HT3A 1U4BA 1NK7A 4ZTFA 3EY1A 4CJWA 2KTQA 1JXEA 4CJ4A 4KKOA 3PUFA 1SL0A 2IS3A 3ZSYA 2HHQA 3NFAA 3RRGA 4M3RA 1TL1A 1TL3A 3V9UA 3WNEA 1O1WA 4OPJA 4DFPA 4QCLA 4O5BA 4HHTA 3V4IA 3P5JA 2O4IA 4CEOA 4B9LA 1WAFA 3U3YA 1RT7A 4E0DA 1JLFA 2HVIA 2HB5A 3O4QA 3C6UA 3NE6A 1RT1A 3QEPA 1IKYA 1QSLA 3ZT1A 4FLVA 1HMVA 2X74A 3AVFA 4KHNA 1JLCA 3RWUA 1EETA 4E1MA 1BQNA 3O3HA 5CYQA 1RDAA 4W5QA 3NGIA 3HL8A 4FLZA 1Q9YA 3OYJA 2HW3A 1TAQA 3ZSQA 2ETJA 3THVA 3VN5A 3PO5A 1YTUA 4Q0BA 4FM2A 3SUQA 4OLAA 3WNHA 3K58A 4HUGA 4FXDA 1X9WA 1HYZA 4DLGA 4DQSA 3V9WA 2F8TA 2RPIA 4FM0A 2YHAA 3ZSVA 1I3AA 3QLHA 3TI0A 3QEIA 2Y1IA 4HCBA 4KREA 1G15A 3KK3A 1GOBA 3NGZA 3T3FA 1KCFA 1WSFA 3IS9A 1LWEA 3OYCA 4OPKA 3OJSA 4N41A 4CGFA 2FBXA 4KHSA 3HP9A 1C1CA 1WSHA 3ZSXA 3DRPA 4LH4A 3LDSA 1L3SA 4K8ZA 3U6FA 1KSPA 2G8KA 4KRFA 1D5AA 2QXFA 3F73A 1BGXT 4BDYA 4DQIA 2GUIA 3K57A 2OPQA 2YNHA 4JLHA 3OYAA 3EZ5A 4NYNA 3AVNA 4M41A 5I3UA 1VRTA 1VSDA 4FJ8A 1RT4A 2D0BA 3AA5X 2G8HA 1XHXA 4DSFA 1J5OA 4N76A 1VSMA 3QO9A 4Q5VA 2HHXA 3QNOA 3IG1A 2XY7A 4KV8A 2I5JA 1FXXA 2B5JA 4DTXA 1KLNA 4LSLA 3ZSRA 4NYFA 3NF6A 2OA8A 4DU1A 1ZBIA 4KFBA 1RT6A 1TK5A 2X6NA 4C8OA 3AVIA 2G8FA 1NJZA 4CGDA 4TSXA 2YNFA 1LW0A 1TV6A 4YNQA 4AHUA 4FJKA 3MAQA 4AILC 3NDKA 1W0HA 3AO1A 2HHVA 2G8VA 5KI6A 2HHSA 4DSIA 4FJ7A 1K6YA 4RW6A 2PY5A 5FRNA 3G10A 1C0MA 3QIOA 4DTUA 4FLTA 3VA3A 4CHPA 3SPZA 4BDPA 1R0AA 3DRRA 3TABA 1BL3A 4ELVA 3VQ5A 1KVBA 2HNYA 4CJEA 2PYLA 1J53A 4CEQA 4E7JA 4CECA 5HBMA 2KQ2A 3AO4A 1HRHA 4CFBA 4N5SA 1VSIA 1UA1A 3LAMA 1TKDA 3K5NA 4I2PA 1T03A 1QHTA 3AVMA 3SQ4A 3ZSOA 2HHUA 3S3NA 4KPYA 4BE0A 4NCGA 1WSEA 4CEFA 3V6DA 1HNVA 4F2SA 3OYDA 3OYHA 1WAJA 4FLXA 2XHBA 3SNNA 4M45A 2XO7A 4RW9A 4WE1A 3RR7A 1CXQA 2A1RA 5HROA 3M8RA 1D9DA 1XWLA 2O4GA 1ASUA 5FRMA 1S1TA 3KLEA 4M3UA 1JLEA 1RTIA 4CF1A 4KI4A 4DTOA 3RMAA 4BWMA 3QEWA 4JRPA 3HM9A 4CHZA 2OPSA 3SZ2A 1RTDA 3OYLA 3OJUA 4DTJA 1HYVA 3DOKA 3PO4A 3HPOA 5J2QA 2E4LA 3PX6A 3L2QA 3IAYA 2GV9A 2PYJA 4CJLA 1RNHA 1DLOA 1X1PA 4J2BA 4ELTA 1F21A 4B9VA 4E1NA 3SQ1A 3TAQA 4CEBA 4FYDA 3SYZA 2YV0X 4KAZA 1JL2A 3OS0A 4FZZA 2W42A 4DTNA 3AVCA 3ASMA 4GMJB 4OKEA 5CYMA 5HP1A 2YNIA 5KRSA 1VSJA 4YFUA 1L3UA 3KJVA 1I39A 5HRSA 4Y1DA 3VQQA 4FJ5A 3RR8A 4M3XA 1RBTA 3MXJA 1KRPA 3NH2A 2OZSA 3PX4A 4CIEA 4BE1A 1VSEA 5EU7A 2QK9A 2D5RA 4EP5A 1BI4B 3QNNA 3BGRA 4KHUA 1BQMA 1VSLA 2IAJA 4PA1A 4DTMA 4DFMA 3O3GA 4NCAA 4CJ5A 3L2RA 3HO1A 1ZBHA 4DS4A 3CM6A 4W5TA 1J54A 3OYBA 4OKJA 5CZ2A 3S3OA 3I0SA 2PZSA 1N5YA 4CGGA 3KLIA 4M3YA 2QKBA 4IG0A 1NOZA 4CCHA 3TANA 3LAKA 1RT5A 1NK5A 2VWJA 4B8AB 4Z4EA 4H8KA 1ZBUA 4J2DA 3ZT4A 1SUQA 2E6MA 1U04A 4IBNA 5CZ1A 3ULDA 4DWIA 3UIQA 4Z4HA 4M3WA 3ZT0A 5J2NA 1UAXA 3NF9A 3V9SA 1J9AA 1FK9A 4CHOA 2OPPA 3PV8A 3NH0A 3L2UA 1WNSA 4I7FA 3KLFA 4EZ9A 3VQCA 4OVLA 5J1EA 1QS4A 3ZSZA 4DU4A 2DFEA 2FC0A 3QETA 4CK1A 4DU3A 1WN7A 1HQUA 4RW8A 3TARA 1JL1A 3M8QA 1RBRA 3VQAA 3OYGA 2XY5A 3DLBA 4ELUA 3VQEA 3HSTB 3DLHA 3LWLA 2BE2A 2LSNA 4QOZB 3H08A 3SI6A 1S6PA 4FCYA 3FFIA 2DTUA 4CEDA 3C95A 4CGIA 1NKBA 2JLEA 2KZZA 1BHLA 4IFYA 3LZIA 3DOLA 4OGEA 1JKHA
chains in the Genus database with same CATH superfamily
2KZMA 4XIUA 4IOXA 4WFAL 4DTRA 3IUCA 1U48A 2QA4N 1QSSA 1M90O 4CK2A 1WSGA 1RTJA 1IG9A 5C2DA 4I6MB 4BRMA 3AO2A 2ZWHA 4F9OA 4C8KA 5EY4A 4DQPA 4DFJA 2ZD1A 2Q1NA 2Q31A 1SL1A 3SBGA 4DUYK 4YOXA 4XEIA 1ASVA 1GOAA 2AA4A 3ITHA 1GLBG 3NCIA 3KHYA 2QI2A 4DV1K 4DV4K 1NGFA 3DYAA 3OY9A 1ZYQA 5C12A 5ADXA 4BACA 3TTDA 2J4RA 4LFCK 3CPWM 4Z4IA 4DSJA 4KHWA 3V9XA 1RTHA 2P9LA 5T7BA 2Z1GA 2OANA 2RF2A 4DTSA 3DLKA 4K41A 4BR0A 1KC8O 4FZYA 3NVKA 4M7XA 4GVEA 4CEEA 4BDZA 1CZBA 3I33A 3LM9A 2JGUA 3B6OA 4AH9A 3RMCA 1VQPN 3MXMA 3H46O 1A5XA 3CCUN 4CF2A 3IDHA 3EYZA 5AFUH 4BRKA 3OYIA 4BRHA 3L4QA 3CI5A 4F3TA 1S6QA 4RG8A 2FSKA 1RT3A 2Z1HA 1C0TA 1ZBFA 2QM1A 3LANA 1HPZA 1U2VA 3DMJA 3KK2A 3AVKA 3M3ZA 2HNZA 2P9LB 1EQYA 1K8KA 1LAWA 1S9GA 1TK0A 3ATUA 4IZ9A 2NRZA 3TAGA 4CE9A 1WSJA 3P39A 2XY6A 2QXLA 2IDOA 3NH1A 1XMQK 5DK5A 4FJIA 1N32K 4IO9L 2A41A 4B3RK 4DV7K 1RDWX 4PWDA 4DF4A 1GLEG 4MDAA 1KVCA 1YHQN 4X64K 3PIOL 4IOCL 3AA3A 1ATRA 5C25A 4O8UA 5LY3A 2F96A 3D45A 1HUXA 4FJXA 5AQHA 2X78A 1L5UA 1UA0A 5EOYA 3UE5A 1TYQB 3MEDA 1NGDA 3U9ZA 3PX0A 4E7HA 4AHCA 1NKCA 4U7BA 2YI1A 1T05A 4FJGA 1QE1A 4H4MA 2GUPA 1NK9A 3LP1A 4LSNA 2E20A 3T69A 5JICA 3AVJA 4FWRA 4CZIA 4KTZA 1GLAG 3OS1A 1YVNA 3IMXA 2D0AA 2ASMA 1JCFA 4GW6A 4J2AA 4L3QA 3VTHA 3ZX2A 3LP2A 4ID1A 3CCEN 2P51A 2QWRA 3OA9A 4Z4FA 4EZ6A 4BR5A 3G25A 4AHSA 3VGKA 3VEYA 4CJQA 4M42A 3I8DA 4B9TA 2HBJA 5KTQA 4FWPA 4JI7K 2WC9A 2Z1IA 1HKGA 2YKNA 4FJLA 1QVFM 3LALA 2WOMA 4EHUA 3K5OA 3NF7A 4RTFD 3OS2A 2YKMA 2HBMA 5CHIA 3D0PA 3PSFA 4KTWA 2HMIA 4JS4A 4EP4A 4JI2K 3WEEA 5JMVA 3QEXA 4CFCA 1VSHA 4IEEA 4H0PA 4PY5A 4B08A 3T7ZA 4R5PA 3NF8A 4YOTA 3CF5L 3NAEA 3HOTA 5GIPA 2A42A 2CGLA 3THYA 2W6KA 1CZ9A 5HOOA 1UWBA 1YJ9N 3A5LC 3TR8A 4CJ3A 4Z0UA 3TAFA 3JYTA 5KGWA 4E3SA 2DPNA 3ATVA 1XC3A 1OVYA 4Y0WA 3WEEB 3VQ8A 1L3TA 2E6LA 3K5LA 1W9HA 1HNIA 1LAVA 2RHKA 4IG3A 5C10A 4JK7A 3U8XA 3BF1A 4HUFA 4JI5K 2ITMA 4IO8A 5KPZA 5M1FA 1IKWA 3HT3A 3EY1A 2UXCK 1Q86O 4HTLA 3ZSYA 1ZXOA 2EWSA 4DFPA 1V4TA 3C7NA 4BC2A 4O5BA 3V4IA 3P5JA 3WQUA 2O4IA 4B9LA 3O4QA 3C6UA 5FPDA 1RT1A 3QEPA 3O5BA 1HMVA 2X74A 3AVFA 4KHNA 3AGKA 1BQNA 5CYQA 4W5QA 1Q82O 1Q9YA 3CPEA 3K0SA 4K25A 3SUQA 4OLAA 3WNHA 4FXDA 2D0PA 1X9WA 4EAHD 4DLGA 1KD1O 1BUPA 2VWBA 4FM0A 3QEIA 4KREA 2F9TA 1G15A 3O9QA 5A2QO 1WSFA 3OJSA 4CGFA 4FL9A 3GDQA 1C1CA 5AQJA 1K73O 1KSPA 1Z05A 2QXFA 2QEXN 1V4SA 4LF9K 3C65A 2YNHA 4JLHA 4YOUA 3EZ5A 4GKKK 2PAVA 1VSDA 4FJ8A 3WXMB 3C7NB 4DSFA 3IG1A 4KV8A 5GIOA 4B9QA 4WFBL 2OA8A 4UY8O 5AQTA 3AVIA 2FF3B 3E9OA 4YNQA 4AHUA 4FJKA 2V51B 3E9LA 1W0HA 2HHSA 2HHVA 4FJ7A 5FRNA 4DTUA 3SPZA 4YOYA 1BL3A 3TTFA 3VQ5A 2PYLA 3DXMA 4CEQA 4JKBA 2PBDA 5HBMA 4LFBK 1VSIA 2Q36A 5BRHA 5GAEP 4NCGA 1WSEA 4CEFA 1SS6A 4BE0A 1WAJA 3K9JA 3M8RA 2O4GA 1KAXA 3L4IA 1KAZA 1RTIA 4DV2K 1IG8A 1NWKA 3MN7A 1RTDA 4DTJA 1HYVA 3VEWA 3L2QA 3IAYA 4GV6A 4E1NA 2YV0X 4FZZA 1JL2A 3OS0A 4DTNA 3ASMA 5CYMA 3ZX3A 3KJVA 4M3XA 3VQQA 3RR8A 3D2FA 3DXMB 3OBYA 3P4IA 2HBLA 3NH2A 4DR7K 3PX4A 3O9UA 4BE1A 4B1UB 2D5RA 1BI4B 1U6ZA 3VGLA 4BRCA 1WUAA 3O1WA 4JNEA 4FWLA 4WYBA 4IEIA 2YHWA 4BRAA 2HHHK 1N5YA 3I8BA 3KLIA 2QKBA 1NK5A 2HBKA 4H8KA 4MLEA 1RFQA 4J2DA 4FWQA 2YHYA 2D1KA 3VPZA 1U04A 1HX1A 4Z4HA 3ZT0A 4H0TB 1UAXA 5AQNA 3KWGA 4NLCA 3PV8A 4EZ9A 4BY9C 2CGKA 4OVLA 1QS4A 4CK1A 2JWKA 4RW8A 1GLFO 4BRLA 2A3ZA 1EWRA 1RBRA 3VQAA 2D0OA 3DLBA 4DR1K 4WQ4C 3VQEA 3D2FB 4ELUA 4B1ZA 3FGUA 2LSNA 3H08A 3SI6A 3VF2A 1HNXK 1NKBA 1Z6RA 2JLEA 4BG9A 3BY5A 4IFYA 3O9RA 3DOLA 1JKHA 2ASPA 4CEAA 2EHGA 2UYTA 4E19A 3O9TA 4FLYA 4BQLA 2OZMA 2KFNA 2F8SA 1CLQA 3TWHA 5HL7L 3LP3A 1Y97A 5FPMA 3CYMA 1XMOK 3A2FA 1NGAA 4JI4K 1U45A 1VQ8N 1QHAA 1RBVA 2BH1A 2P9NA 1EKEA 3ZT2A 2B6AA 5C2FA 5E41A 4L8RB 4PKHA 4CHYA 4O4GA 5AQSA 1NJWA 4E7IA 4JK8A 3HPHA 5AQXA 4LF6K 5JVGL 4ICLA 3K5MA 4OGCA 3WNFA 4Z4CA 3RMBA 1VQKN 4RWTA 3CCLN 4K0KK 4KTQA 1JLGA 1QZ6A 1MWKA 4YY3K 5AQFA 2YHBA 3DLEA 3TAPA 1OVQA 4BR4A 5BN9A 2F9WA 2O8CA 3E01A 4FO0A 3PLAA 1XI1A 2VGNA 3DRSA 3CMAN 4JRQA 2OTJN 4CGJA 1MA9B 3R9PA 4CGHA 2OCEA 4WFNL 1N33K 2XRIA 1Z25A 4NLBA 1NJXA 1BIZA 2P9NB 1JLAA 3AO5A 3CQ8A 3CFOA 3ZYYX 1NMNA 3HYFA 1E4GT 4LF8K 1TKZA 1NK8A 3KIOA 4CF8A 4JV5K 5IT9O 3E66A 1H1VA 2E5LK 1BWFO 3VQ4A 2QKKA 2Q3SA 3VQDA 4JKHA 1HQEA 3HPGA 3O1BA 4BR9A 2HHWA 2O8CB 2VG6A 5JS1A 4A5AA 3MEGA 3O4NA 4CD3A 4H0VB 4B9UA 4W5OA 1VAZA 4RW4A 3U4LA 2D4WA 3ZETB 4OKKA 4K43A 1W7AA 4G1QA 5AQPA 4BR7A 4JYAK 3FE1A 3P38A 5DM6L 4OPHA 4DG1A 3SJJA 4FPBA 4E7LA 3MCAB 4MO5A 2V7YA 4CEZA 5HRNA 3J81O 2D0CA 3H3OB 3SAFA 2Z1JA 1KFDA 3CJ1A 3J7ZO 3WQTA 3KTQA 1JLBA 3NBPA 1NBWA 4KO0A 4DSLA 1KVAA 1NGGA 4FWSA 1RILA 4JD2A 4BQZA 4C8MA 4B3OA 5AQZA 3H45C 1BU6O 1OH6A 4CIGA 1Q8IA 5I42A 1XNRK 2E2PA 4GNIA 3V9ZA 3P1GA 4X66K 1Q9XA 3F9MA 5ADXH 1M1KO 2IOCA 4LF7K 4AHVA 3RTVA 1WSIA 4DQQA 4PQUA 3CJCA 2NRVA 2FF6A 3G0ZA 1EO1A 5FDLA 3HVRA 1DTTA 4KI6A 1RDDA 4JKEA 2E1YA 1WOQA 2ATQA 1QZ5A 2NRTA 1IKXA 3LPUA 5AQLA 4PKGA 4CHQA 4QS9A 4LD0A 4B9MA 1TKTA 4C8LA 5J2MA 5HLFA 4JD2B 2ASOA 1WBBA 4DF8A 4BRDA 2E2OA 4CJFA 4CK3A 1NOYA 3TAMA 4DSEA 2GELA 4CJUA 1VQ5N 2FSNA 3MEEA 4IKFA 2NUBA 2W40A 4JKGA 3S9HA 1T8EA 3O6WA 3SQ2A 2UXBK 4FK4A 3QICA 3CCVN 4CZJA 3L2VA 3BZCA 5LJWA 1SKSA 4U67L 4K8XA 3BP8A 2IGIA 3H1QA 3CJBA 3TPQA 1Q18A 3MK6A 1QTMA 3SCXA 3CM5A 1YTAA 4H5WA 4F2RA 1KTQA 1KQSM 1DEJA 3DXKA 1S1XA 2Q2RA 1BDGA 5K14A 3Q7CA 5AQMA 1JXBA 2NRRA 3AVLA 2I7PA 2P9UA 1E4FT 1D9FA 1KLMA 5KPRA 1B9DA 3QESA 3HVTA 3SUPA 4FM1A 3O3FA 3RRHA 3QEVA 2P9IA 1VQMN 5C24A 2JWLA 3M6GA 4GV3A 3F2KA 4DR6K 3SJHA 1VQ4N 2YNGA 5D3GA 1ILYA 1BCOA 3CXCM 4JKGB 3CFRA 4CHNA 1S1WA 4H5NA 1NGEA 1NK7A 3AARA 1JXEA 2FXUA 4CZLA 3NFAA 1LCUA 4CZEA 3V9UA 1O1WA 4LC9B 1NGIA 3U3YA 4E0DA 5LMNK 1FW6A 3DXKB 3VEXA 4CD1A 1WBDA 3ZT1A 5IWAK 4NB4A 3RWUA 1EETA 2I7NA 3O3HA 3NGIA 4FLZA 1N34K 4IJAA 3VF4A 1HLUA 3ZSQA 2BTFA 2ETJA 2P9UB 4H0XB 3VN5A 1C0GA 4FM2A 3K58A 1U2VB 2KKZA 2YHAA 2P9IB 1I3AA 3QLHA 3ZSVA 2Y1IA 3TI0A 1K8KB 3KK3A 1GOBA 3T3FA 3OYCA 4A61A 4DR4K 2VYPA 5BREA 3ZSXA 4ISGA 3NMUA 2FLOA 2V52B 3L0QA 5BPMA 2IVNA 1D5AA 4B1XB 3F73A 4KRFA 4DV6K 1IBMK 2OPQA 4NYNA 5I3UA 1VRTA 2G8HA 1XHXA 3CQYA 1DKGD 3TSQA 1VSMA 2XY7A 1C0FA 2ZJPL 1FXXA 2B5JA 1KLNA 1T6CA 3O8MA 5EXWA 3ZSRA 2F4VK 4WQ4A 3NF6A 3BUZB 4KFBA 4EIAA 4BROA 2X6NA 4C8OA 3ZX0A 2G8FA 3AGRA 4A5BA 2RE2A 3D6RA 2WTUA 3MAQA 2G8VA 5KI6A 1K6YA 4RW6A 1EWQA 3G10A 3MWPA 3DRRA 2F7TA 4ELVA 5BPNA 1J53A 5AZIA 5AJ3K 4CZMA 2A6AA 2IIRA 4JI3K 4I2PA 1T03A 1QHTA 3AVMA 2ZJQL 4DQ8A 3OYDA 5CR4A 3OYHA 2XO7A 4RW9A 4WE1A 1CXQA 2A1RA 3KLEA 4CF1A 3RMAA 4BWMA 5JVHL 2OPSA 3SZ2A 1W2BM 3HPOA 2GV9A 4CBXA 3EZWA 4ELTA 4B9VA 2NRWA 4JI8K 4FYDA 1VQNN 1BO5O 2HF3A 3SYZA 4BREA 1W97L 4KAZA 2W42A 3THWA 5FPNA 1VSJA 5M1PA 1I39A 3EL2A 1RBTA 3G71N 5AZIB 1KRPA 5GAHP 3LDNA 2A5XA 5JLHA 1HKBA 1ESVA 3AY9A 3THYB 3CCRN 4DFMA 3O3GA 4CJ5A 3L2RA 2UU9K 3HO1A 4DS4A 3GE1A 1NLVA 4JK9A 1J54A 3OYBA 4JKDA 1S22A 3I0SA 3D2EA 3TANA 3LAKA 4OO1J 4PHTX 2VWJA 1ZBUA 4B3TK 3ULDA 5CZ1A 3OW2M 4DWIA 4M3WA 3F5TA 3J7YP 1J9AA 1FK9A 2OPPA 3A8YA 1NGJA 3THWB 1IV0A 1HQUA 3TARA 2A40A 3OYGA 2XY5A 1P8ZA 4LF5K 3LWLA 4BG8A 3FFIA 2QWNA 3C95A 4CGIA 3QB0A 4BRQA 5GAGP 2KZZA 4OGEA 3T1YK 2DY4A 2E88A 4B3SK 1NK6A 3D2EB 2G8UA 3EN9A 3AVHA 3VERA 3CC2N 3M8SA 2IVPA 2BUPA 1SKWA 3I56N 4CF0A 4LH5A 1ATNA 3DAWA 1RBUA 3L3UA 1S1UA 4M3TA 3EE9A 3L3VA 3KZBA 4JI6K 2GX9A 2QWPA 3O4WA 2G8WA 2Q0RA 2ITGA 1NGCA 3K9KA 3EEQA 1NGHA 3E9PA 5AQVA 3NVMA 4WCEL 2G8IA 3J7AP 4O55A 3OVNA 3HBTA 1C6VA 3CG7A 4BGAA 3QBXA 5FROA 3CJ7A 4H4OA 2QWOA 4PL8A 3K59A 4DV0K 1RDBA 3KKSA 1DTQA 3OYKA 4FJNA 2O8FA 4J2EA 1Q81O 3SUOA 1NMDA 5AQIA 2E2QA 4CFAA 3TSUA 3QBWA 1QSYA 4ISEA 1L3VA 4GVMA 1I94K 2DFHA 3MECA 2YJFA 4FZXC 2DFFA 1LWFA 2O8DA 1R59O 2HMPA 2XY8A 3QDKA 4JKCA 3MCPA 5KRTA 3BDPA 1YT3A 2FSJA 4BE2A 3RMDA 1SV5A 3CMEN 4GKJK 1IJJA 1C1BA 4E7KA 4H5TA 5KGXA 1S9EA 3V1RA 2NZTA 3IRXA 2EX3A 2UUAK 4DV3K 4CZFA 3T1AA 1TUUA 3A0IX 2ZQBA 2VQFK 3HJFA 4B9NA 1ITGA 2O8FB 4KHPK 4HVJA 4O0JA 4CZKA 3A5NC 5AQOA 2BGGA 3CIPA 1A5WA 1CZAN 3SAGA 3L8BA 4B1VA 1RGIA 3CCJN 2E8AA 3RSEA 3HXMA 3THXA 1CXUA 1TVRA 2GWKA 2ZE2A 1VQ9N 2R7YA 4HTUA 4AQYK 1BCMA 5F2RA 4CBWA 1JCEA 5HRPA 1EXQA 3SQ0A 4Y1CA 1LWCA 3QIPA 3LWMA 2O8DB 4KB1A 2VG7A 3QINA 4H0OA 5B8HA 2ZJRL 1QQCA 2Q97A 5M1QA 4DUZK 1Y64A 4B8CA 1NJIO 4H5RA 4H0YB 3ALYA 3LP0A 1YI2N 4AHRA 1QQMA 2BANA 1BA1A 4ID5A 3C0BA 4CJPA 1HJRA 4BRNA 4R79A 2FBVA 3C6TA 1P90A 3AAPA 1HYSA 4FOEA 4ISFA 4KH6A 2CH5A 3CD6N 3ZEUA 3U3GA 4H03B 4MO4A 3KD1E 3VESA 4HUEA 3WXIA 3P83D 3QERA 3RSEB 3VEZA 3FFKB 3EKSA 4DTPA 4DLEA 1YUWA 3SK3A 3V1OA 3CHWA 3PIPL 5J2PA 3OYNA 3WT0A 2RN2A 3ISNC 2OPRA 4M3ZA 4FK2A 3UKUA 3VETA 4A59A 1FJGK 4DMNA 2GBZA 4CIFA 3NHGA 3FZKA 4CJKA 3AVGA 1XHZA 3VQBA 3SPYA 4OX9K 3RVCA 4DFKA 4LY7A 5E84A 4IOAL 2FBYA 1N6QA 1A5VA 4DQRA 4LFAK 3GOIA 4JI1K 4BVPA 1GLLO 3ZEUB 1NJYA 1TAUA 4ZTJA 2RKIA 4CESA 1B9FA 1FKPA 4UQGA 2WONA 3DM2A 4O0IA 1SKRA 2AJQA 5FLXO 1X9SA 5M1NA 4FJMA 4KHYA 5LMUK 4CZHA 3KD5E 1TKXA 3U9DA 3UKUB 1WLJA 3ENBA 1VK0A 3HK2A 4CJTA 4XH5A 3CFPA 4KH4A 1MU2A 1O13A 1OH7A 4FW2A 2B4JA 3OYFA 1Z26A 1REVA 3O9SA 2VQEK 1U4BA 4ZTFA 4CJWA 2KTQA 4CJ4A 2ZGZA 3ENHA 4KKOA 3WXKA 2IS3A 1ZC6A 1YJWN 3FZHA 4O8KA 3RRGA 4QCLA 1QQOA 3WNEA 3MDQA 4OPJA 3M5RA 4HHTA 4CI6A 4CEOA 1RT7A 4ILGB 1JLFA 3NE6A 4MDBA 1IKYA 3LDLA 3SMSA 4C23A 4DV5K 3HL8A 3R1XA 2HW3A 1VQ6N 1TAQA 3THVA 3PO5A 2QTDA 1HYZA 4OPAA 1MDUB 5C15A 3V9WA 2F8TA 4HCBA 4FVUA 3HI0A 3VGMA 1LWEA 4OPKA 2FBXA 5F0XA 5H1SQ 2CGJA 3HP9A 1L3SA 1WSHA 3D7EO 3DRPA 4LH4A 3LDSA 3U6FA 2G8KA 1D4XA 4DQIA 1BGXT 1BOTO 2GUIA 4X62K 3LM2A 3K57A 1S72N 3SLCA 3AVNA 2Q0UA 3H1VX 2D0BA 3AAQA 4LF4K 5BPLA 3QO9A 5GINA 2KHOA 4FSVA 1QQNA 4FWKA 2YJEA 2HSTA 4NO7A 4LSLA 5MLCQ 3MX5A 4BRPA 1BA0A 4NYFA 3CJAA 3CC7N 1GLDG 4H5VA 4WF9L 1ZBIA 1OKJA 5FPEA 5TKYA 2UXDK 2UUCK 1TUYA 1NJZA 4CGDA 4FWNA 1TV6A 4MLHA 3CCMN 4BVOA 4GV9A 3NDKA 1C0MA 4BDPA 1R0AA 1LOTB 2HNYA 4CJ7A 1KXPA 3M1FA 5F1XA 3MMVA 4E7JA 3AO4A 4CFBA 3C6HA 1UA1A 3K5NA 3ZSOA 2OTLN 3S3NA 4F2SA 3HOSA 4FLXA 4O5FA 3RR7A 1KAYA 5FRMA 1S1TA 3I55N 2H3GX 4KI4A 4DTOA 3N4QA 3QMLA 3HM9A 1T3VA 3VEOA 4CJLA 3MN9A 5AQGA 1DLOA 1X1PA 4J2BA 1F21A 3SQ1A 1VQLN 4IWVA 4AM7A 3CCSN 3AVCA 4GMJB 5HP1A 5KRSA 3UKRA 1L3UA 1TYQA 5HRSA 5GADP 3UB5A 3R6MA 3R3LA 2OZSA 2E1ZA 3MN5A 3R8EA 4CIEA 5EU7A 2QK9A 3GBTA 3BGRA 4KHUA 4PA1A 1VSLA 2IAJA 4DTMA 2CH6A 5AQUA 3CM6A 4W5TA 1VHXA 3FLCO 4A2BA 5AFUA 3L6QA 3Q7BA 4IG0A 1NOZA 5M1OA 4CCHA 4JKFA 4YHHK 1Q7YO 3BF3A 4B8AB 4Z94A 5TKWA 4Z4EA 1SUQA 2E6MA 4IBNA 3UIQA 5AR0A 1SZ2A 3CCQN 5J2NA 3NF9A 3V9SA 4BC5A 2WBNA 3NH0A 4I7FA 3QETA 4DU4A 1SAZA 3UKRB 3FZFA 5M1KA 3EE8A 4M63C 2YHXA 3DLHA 3CJ9A 2BE2A 1S6PA 4FCYA 4NXNK 2DTUA 4CEDA 1SQKA 4C1NI 3FZMA 4I2QA 3PY8A 3ID8A 2QW9A 1SL2A 4DS5A 3DWLA 3KLHA 3G6EN 1VQON 1YIJN 2VG5A 3P31A 1VQ7N 1X3MA 3EKUA 3MXIA 1C0UA 2NRXA 4OJRA 4BC4A 1WB9A 3AA2A 2VWKA 2NRHA 1RDCA 4ILJA 2A1SA 2KW4A 4E89A 3H6EA 4B1YB 3AO3A 3SV3A 3VQ6A 3ULEA 5JLFA 1UOCA 4QAGA 1IH7A 4B1WB 1DGKN 2P9SA 4HWIA 3DLRA 5KPTA 4DKWA 4OLBA 1NK4A 1NM1A 1YXQA 2GEMA 4FJJA 3OYEA 1FKOA 4HCCA 3MN6A 3ID6A 1LV5A 4IFEA 3KKRA 3KVGA 3VQ9A 1D8YA 3AVBA 1ASWA 4CVNE 2W41A 1ZBSA 4IDHA 4KH5A 1X9JA 4IDKA 1T6DA 4QS8A 4FLWA 4O44A 1OH5A 3C94A 4FVMA 3SBTA 3K2PA 4BWJA 1QVGM 3NGYA 4MFBA 3QFPA 3B6PA 3VMFB 1EX4A 2Y1JA 3O08A 3TAEA 3I0RA 3ULEB 3M8PA 3OHRA 1S1VA 1VSKA 3HP6A 3O80A 1JLQA 1GOCA 2P9SB 2HNDA 2X6SA 4JAXA 5AQWA 4N56A 1C1AA 1XC9A 1IKVA 1IO2A 1X3NA 2P5OA 4IXCA 4M3UA 4W5RA 3HRGA 5HRRA 3VA0A 3H3NO 4DR5K 1OH8A 4M7YA 5CE3A 4CBUA 1NK0A 1S3XA 3ZCMA 5LJVA 1MWMA 1VSFA 4YOVA 4I9QA 4FJ9A 1RBSA 3BEXA 3SV4A 2W6LA 4CJRA 1N36K 5JS2A 4KHQA 4C8NA 3C6AA 1X9MA 1KFSA 4WQ5C 4GY2B 3ZSWA 2O8EA 1T7PA 5SZTA 3VEVA 4CJSA 4IFVA 1B92A 4AHTA 3SUNA 1TK8A 4DR2K 4BRIA 1S5JA 3T1HK 3F9KA 3JSMA 3DLGA 3W3DA 5BN8A 1J6ZA 3V81A 4AM6A 3HSCA 3GG4A 3IKMA 4F3OA 3WXLA 4I9LA 4YOWA 2VGMA 3LZJA 4NCBA 5BRFA 3JS6A 1ATSA 4A2AA 4ZHRA 1HR0K 3VQPA 2QWMA 3WUHA 1NG9A 4DR3K 3TU5A 4FK0A 2WUSA 4FLUA 4XH1A 4JHDA 3KLGA 1RT2A 3V1QA 3LDOA 4JI0K 3S3MA 1G99A 2O8EB 4F4KA 3A5MC 4YDUA 3IFRA 4G9ZA 3OBWA 4DHYA 2IVOA 2OYQA 4CFDA 3N4PA 4EFHA 3ZT3A 2P5GA 4C1NK 3KK7A 3AVAA 4KBOA 3ZLJA 2WFBA 5BRDA 4PUOA 4DSKA 1TGOA 2P1JA 4FJHA 3DI6A 1U49A 1JJ2M 1U47A 3OYMA 1VRUA 3KWIA 4FPAA 5DMRA 4CF9A 3J80O 1NKEA 2KFZA 1YAGA 2YX6A 1LW2A 3PSIA 4JS5A 4CJVA 1T44A 5KQDA 3LPTA 4JHDB 3VTIA 1E3MA 1YVUA 3L2WA 1BI4A 4FOIA 1ZBLA 1BISA 1EP4A 3J8AA 3JXUA 3ENOA 4MQ3A 1NU0A 5CY4A 4N47A 4CERA 2BDPA 4F8RA 3A5OC 3LZIA 3WNGA 4DB3A 4B9SA 4A62A 2ZM6K 3VQ7A 5C42A 4FW1A 4K42A 1J5EK 4RW7A 4EHTA 5AZJA 2HHTA 1JCGA 4J8FA 4W5NA 1BIUA 4PKIA 3KK1A 3T19A 4KB0A 3BZKA 4X65K 5SWMA 4Z4GA 2FBTA 3DJCA 4E1JA 3AV9A 3AA4A 2IC3A 2HVHA 1RCHA 3HM8A 5KQ8A 2UUBK 5AQKA 3PUFA 1SL0A 3WXJA 3FZLA 2V7ZA 2HHQA 4M3RA 1TL1A 1TL3A 4AF1A 1WAFA 2HVIA 2HB5A 2P9KA 3MX2A 1RDUA 5BR9A 1YITN 1QSLA 1HNWK 4FLVA 1JLCA 4E1MA 1RDAA 5AZJB 3OYJA 5C0YA 1YTUA 4Q0BA 3TTCA 4XH4A 4HUGA 4RCHA 4DQSA 3FR0A 2QWQA 1GLCG 2RPIA 4B3MK 1XQSC 2P9PA 4ILHA 3NGZA 5EVZA 3VENA 1KCFA 3IS9A 4N41A 4KHSA 3LDQA 4K8ZA 3SAHA 4BDYA 5AQRA 2O8BA 3OYAA 4IJNA 3THXB 4M41A 3GL1A 4DCHA 1RT4A 3AA5X 4BRFA 1J5OA 4N76A 4Q5VA 3HZ6A 4CW7B 2HHXA 3QNOA 2PFUA 2P9KB 2GTDA 2I5JA 3LDPA 4DTXA 1N8RO 1HJOA 4DU1A 2GWJA 1RT6A 2KLAA 1TK5A 5EX5A 3CETA 3E1YA 2ZGYA 2VCPA 4TSXA 2YCHA 2YNFA 1LW0A 3VF6A 1IBLK 2P9PB 4PL7A 4AILC 3AO1A 4DSIA 3B8AX 2PY5A 3QIOA 4FLTA 3VA3A 4CHPA 3TABA 2E2NA 1KVBA 4CJEA 3OTOK 4JN4A 4CECA 2O8BB 1DT9A 2KQ2A 2ZF5O 1HRHA 4N5SA 1TKDA 3LAMA 2NNWA 3W0LA 1NGBA 3SQ4A 2HHUA 4KPYA 2NLXA 1IBKK 2AP1A 3DLLL 1HNVA 3V6DA 3SNNA 2XHBA 4M45A 1K8AO 3CQXA 5HROA 5DM7L 1D9DA 1XWLA 1ASUA 1HKCA 1JLEA 3ZETA 3QEWA 4JRPA 4CHZA 3OYLA 3OJUA 4QS7A 3DOKA 3PO4A 5J2QA 2E4LA 4BRGA 3PX6A 4FWMA 2PYJA 1GLJO 1XUPO 1RNHA 5ELZA 1BG3A 3JAMO 4JKAA 3TAQA 4CEBA 4NXMK 2QWLA 5E26A 1YF5L 5I9EB 4OKEA 3TSPA 2YNIA 4YFUA 4FWOA 4Y1DA 5AQQA 4FJ5A 3HTVA 3MXJA 1VSEA 4EP5A 3VOVA 1HNZK 3QNNA 3LL3A 5LL6Z 1BQMA 4NCAA 1ZBHA 4JEPA 4OKJA 5CZ2A 3S3OA 2PZSA 3S41A 5AQYA 4A57A 4CGGA 4M3YA 1K9MO 4CZGA 1RT5A 4YORA 4I6MA 3CC4N 3ZT4A 2HOEA 4BR2A 4CHOA 1YJNN 3CERA 3L2UA 1WNSA 3KLFA 3SMPA 3VQCA 5J1EA 3ZSZA 4BGBA 2DFEA 2FC0A 4DU3A 1WN7A 1JL1A 3M8QA 4YDUC 1NNEA 1XNQK 3G4SN 3HSTB 1HPMA 4QOZB 4WQ5A 2HF4A 3EO3A 3QFUA 5BR8K 4BC3A 1BHLA 3MWTA 4V19S
chains in the Genus database with same CATH topology
2KZMA 4CEAA 4XIUA 3PY8A 2DY4A 4DTRA 2EHGA 4E19A 4FLYA 1U48A 1SL2A 1NK6A 1QSSA 2G8UA 4CK2A 2OZMA 1WSGA 2F8SA 4DS5A 2KFNA 1RTJA 3AVHA 3KLHA 1IG9A 1CLQA 3M8SA 3TWHA 2VG5A 3AO2A 1SKWA 3LP3A 4C8KA 1Y97A 4DQPA 3CYMA 4CF0A 3A2FA 2ZD1A 4DFJA 3MXIA 1U45A 4LH5A 1SL1A 1C0UA 1RBUA 3L3UA 1S1UA 4OJRA 1RBVA 3AA2A 1EKEA 2VWKA 3ZT2A 1RDCA 1ASVA 1GOAA 2A1SA 2B6AA 3ITHA 5E41A 4M3TA 2KW4A 3NCIA 4L8RB 3L3VA 4E89A 4CHYA 3AO3A 3SV3A 3VQ6A 4O4GA 1NJWA 2G8WA 1UOCA 4QAGA 4E7IA 2ITGA 1IH7A 3DYAA 3OY9A 3HPHA 1ZYQA 2G8IA 3DLRA 4ICLA 3K5MA 4OGCA 4O55A 3WNFA 4Z4CA 3RMBA 3OVNA 4BACA 4OLBA 1NK4A 4KTQA 1JLGA 4FJJA 3OYEA 1C6VA 3CG7A 4Z4IA 2YHBA 1FKOA 3DLEA 3TAPA 4HCCA 4DSJA 4KHWA 3V9XA 5FROA 1LV5A 3E01A 1RTHA 3KKRA 3VQ9A 5T7BA 4H4OA 2Z1GA 3AVBA 1D8YA 1ASWA 2RF2A 3K59A 4DTSA 1XI1A 4JRQA 3DRSA 1RDBA 3DLKA 3KKSA 1DTQA 4CGJA 3OYKA 4FJNA 4J2EA 4CGHA 4IDKA 4FLWA 4O44A 3SUOA 4FZYA 3C94A 4CEEA 2XRIA 1CZBA 1Z25A 3K2PA 4FVMA 2JGUA 4BWJA 4BDZA 1BIZA 1NJXA 3B6OA 4AH9A 3NGYA 4CFAA 4MFBA 3RMCA 1JLAA 3B6PA 3TAEA 1EX4A 3AO5A 2Y1JA 1QSYA 3CQ8A 3MXMA 1L3VA 3CFOA 4GVMA 3HYFA 3I0RA 2DFHA 1A5XA 3M8PA 3MECA 1S1VA 1VSKA 4CF2A 2DFFA 3EYZA 1TKZA 3HP6A 1LWFA 4FZXC 1JLQA 1NK8A 2XY8A 3OYIA 1GOCA 2HNDA 2X6SA 3KIOA 4N56A 1C1AA 4CF8A 4F3TA 1XC9A 1S6QA 1IKVA 5KRTA 1IO2A 4RG8A 3VQ4A 2QKKA 3BDPA 2Q3SA 1YT3A 4BE2A 3VQDA 3RMDA 2P5OA 1SV5A 1RT3A 1HQEA 2Z1HA 1C0TA 1ZBFA 3HPGA 4W5RA 3LANA 5HRRA 1HPZA 3VA0A 3DMJA 1C1BA 3KK2A 3AVKA 2HHWA 4E7KA 5KGXA 1S9EA 2VG6A 3V1RA 5JS1A 3IRXA 2EX3A 2HNZA 1NK0A 3MEGA 3ZCMA 3O4NA 1LAWA 1S9GA 3T1AA 4I2QA 1TK0A 4B9UA 1VSFA 2ZQBA 3TAGA 3HJFA 4W5OA 4B9NA 4I9QA 1RBSA 4FJ9A 4RW4A 4CE9A 1ITGA 1WSJA 3SV4A 2XY6A 2IDOA 3NH1A 4CJRA 4HVJA 4O0JA 5DK5A 4FJIA 4OKKA 2BGGA 5JS2A 4KHQA 4C8NA 1A5WA 1X9MA 1KFSA 4G1QA 3L8BA 4PWDA 3HXMA 4DF4A 1CXUA 1TVRA 1KVCA 2ZE2A 3ZSWA 4DG1A 2R7YA 4HTUA 3SJJA 1BCMA 3AA3A 5C25A 5HRPA 1EXQA 4E7LA 4Y1CA 3SQ0A 1LWCA 2F96A 3QIPA 1T7PA 3D45A 3LWMA 4FJXA 2X78A 5SZTA 4CEZA 5HRNA 4KB1A 2VG7A 2D0CA 1L5UA 3QINA 4CJSA 4IFVA 1UA0A 1B92A 4AHTA 1QQCA 3MEDA 3SUNA 1TK8A 2Z1JA 3PX0A 4E7HA 1KFDA 4AHCA 1S5JA 3F9KA 4B8CA 1T05A 3JSMA 3DLGA 1NKCA 1JLBA 1QE1A 3KTQA 4FJGA 3NBPA 4H4MA 4KO0A 3V81A 3LP1A 4LSNA 1KVAA 3ALYA 1NK9A 4DSLA 3LP0A 1RILA 3AVJA 4C8MA 4B3OA 4AHRA 4F3OA 2BANA 4KTZA 4I9LA 4ID5A 4CJPA 3OS1A 1HJRA 3LZJA 2FBVA 4NCBA 2D0AA 3C6TA 4GW6A 4J2AA 4CIGA 1HYSA 4ZHRA 1Q8IA 5I42A 3LP2A 3VQPA 4ID1A 2P51A 3V9ZA 4FK0A 3P1GA 1Q9XA 3U3GA 4Z4FA 3KD1E 4EZ6A 4FLUA 4AHSA 4HUEA 2IOCA 3P83D 3QERA 4AHVA 3KLGA 1RT2A 3V1QA 3RTVA 1WSIA 4CJQA 4M42A 4DQQA 4PQUA 4DTPA 3S3MA 3I8DA 4DLEA 3G0ZA 4B9TA 5KTQA 5FDLA 4F4KA 2Z1IA 1DTTA 3HVRA 3V1OA 2YKNA 5J2PA 3OYNA 2RN2A 1RDDA 4KI6A 4FJLA 3LALA 2WOMA 2ATQA 3ISNC 3K5OA 3NF7A 4CFDA 2OPRA 3OS2A 2OYQA 2YKMA 4FK2A 4M3ZA 3LPUA 1IKXA 3ZT3A 2P5GA 3D0PA 3AVAA 4KTWA 4CHQA 2HMIA 4LD0A 4JS4A 4EP4A 4B9MA 4DMNA 2GBZA 1TKTA 4CIFA 3NHGA 5J2MA 4C8LA 5HLFA 4CJKA 4PUOA 4DSKA 3AVGA 3QEXA 4DF8A 1TGOA 2P1JA 3VQBA 4CFCA 4CJFA 3SPYA 1XHZA 4FJHA 1VSHA 4CK3A 3DI6A 4LY7A 4DFKA 1NOYA 3TAMA 4DSEA 2FBYA 1N6QA 1U49A 4PY5A 1A5VA 4DQRA 1U47A 3OYMA 4CJUA 1VRUA 3MEEA 5DMRA 4B08A 4CF9A 4R5PA 4IKFA 2NUBA 1NKEA 2KFZA 3NF8A 3S9HA 1T8EA 1LW2A 1NJYA 3SQ2A 1TAUA 4ZTJA 4FK4A 2RKIA 4JS5A 4CESA 4CJVA 3L2VA 1B9FA 3NAEA 3LPTA 1FKPA 4UQGA 1YVUA 1SKSA 3L2WA 4K8XA 2IGIA 1BI4A 2WONA 1ZBLA 1BISA 3DM2A 1CZ9A 1EP4A 1UWBA 1QTMA 3SCXA 3CM5A 4O0IA 1YTAA 4MQ3A 4CERA 5CY4A 4N47A 1SKRA 2AJQA 2BDPA 1X9SA 4F2RA 4F8RA 1KTQA 3WNGA 3TR8A 4B9SA 4CJ3A 4Z0UA 1S1XA 3VQ7A 3TAFA 5C42A 3JYTA 4FJMA 4KHYA 4FW1A 3KD5E 1TKXA 5K14A 5KGWA 4E3SA 1JXBA 1WLJA 3AVLA 4RW7A 2HHTA 1VK0A 3HK2A 4CJTA 4W5NA 1D9FA 1KLMA 3CFPA 1B9DA 3QESA 1BIUA 1MU2A 3HVTA 3KK1A 3T19A 3VQ8A 1L3TA 2E6LA 3SUPA 4KB0A 3K5LA 4FM1A 1W9HA 1HNIA 3O3FA 3RRHA 1LAVA 4FW2A 3QEVA 4IG3A 5SWMA 5C24A 4Z4GA 2B4JA 2FBTA 3AV9A 3AA4A 3OYFA 1Z26A 4HUFA 1REVA 2YNGA 5D3GA 2IC3A 1BCOA 2HVHA 1RCHA 3CFRA 4CHNA 1S1WA 1IKWA 3HT3A 1U4BA 1NK7A 4ZTFA 3EY1A 4CJWA 2KTQA 1JXEA 4CJ4A 4KKOA 3PUFA 1SL0A 2IS3A 3ZSYA 2HHQA 3NFAA 3RRGA 4M3RA 1TL1A 1TL3A 3V9UA 3WNEA 1O1WA 4OPJA 4DFPA 4QCLA 4O5BA 4HHTA 3V4IA 3P5JA 2O4IA 4CEOA 4B9LA 1WAFA 3U3YA 1RT7A 4E0DA 1JLFA 2HVIA 2HB5A 3O4QA 3C6UA 3NE6A 1RT1A 3QEPA 1IKYA 1QSLA 3ZT1A 4FLVA 1HMVA 2X74A 3AVFA 4KHNA 1JLCA 3RWUA 1EETA 4E1MA 1BQNA 3O3HA 5CYQA 1RDAA 4W5QA 3NGIA 3HL8A 4FLZA 1Q9YA 3OYJA 2HW3A 1TAQA 3ZSQA 2ETJA 3THVA 3VN5A 3PO5A 1YTUA 4Q0BA 4FM2A 3SUQA 4OLAA 3WNHA 3K58A 4HUGA 4FXDA 1X9WA 1HYZA 4DLGA 4DQSA 3V9WA 2F8TA 2RPIA 4FM0A 2YHAA 3ZSVA 1I3AA 3QLHA 3TI0A 3QEIA 2Y1IA 4HCBA 4KREA 1G15A 3KK3A 1GOBA 3NGZA 3T3FA 1KCFA 1WSFA 3IS9A 1LWEA 3OYCA 4OPKA 3OJSA 4N41A 4CGFA 2FBXA 4KHSA 3HP9A 1C1CA 1WSHA 3ZSXA 3DRPA 4LH4A 3LDSA 1L3SA 4K8ZA 3U6FA 1KSPA 2G8KA 4KRFA 1D5AA 2QXFA 3F73A 1BGXT 4BDYA 4DQIA 2GUIA 3K57A 2OPQA 2YNHA 4JLHA 3OYAA 3EZ5A 4NYNA 3AVNA 4M41A 5I3UA 1VRTA 1VSDA 4FJ8A 1RT4A 2D0BA 3AA5X 2G8HA 1XHXA 4DSFA 1J5OA 4N76A 1VSMA 3QO9A 4Q5VA 2HHXA 3QNOA 3IG1A 2XY7A 4KV8A 2I5JA 1FXXA 2B5JA 4DTXA 1KLNA 4LSLA 3ZSRA 4NYFA 3NF6A 2OA8A 4DU1A 1ZBIA 4KFBA 1RT6A 1TK5A 2X6NA 4C8OA 3AVIA 2G8FA 1NJZA 4CGDA 4TSXA 2YNFA 1LW0A 1TV6A 4YNQA 4AHUA 4FJKA 3MAQA 4AILC 3NDKA 1W0HA 3AO1A 2HHVA 2G8VA 5KI6A 2HHSA 4DSIA 4FJ7A 1K6YA 4RW6A 2PY5A 5FRNA 3G10A 1C0MA 3QIOA 4DTUA 4FLTA 3VA3A 4CHPA 3SPZA 4BDPA 1R0AA 3DRRA 3TABA 1BL3A 4ELVA 3VQ5A 1KVBA 2HNYA 4CJEA 2PYLA 1J53A 4CEQA 4E7JA 4CECA 5HBMA 2KQ2A 3AO4A 1HRHA 4CFBA 4N5SA 1VSIA 1UA1A 3LAMA 1TKDA 3K5NA 4I2PA 1T03A 1QHTA 3AVMA 3SQ4A 3ZSOA 2HHUA 3S3NA 4KPYA 4BE0A 4NCGA 1WSEA 4CEFA 3V6DA 1HNVA 4F2SA 3OYDA 3OYHA 1WAJA 4FLXA 2XHBA 3SNNA 4M45A 2XO7A 4RW9A 4WE1A 3RR7A 1CXQA 2A1RA 5HROA 3M8RA 1D9DA 1XWLA 2O4GA 1ASUA 5FRMA 1S1TA 3KLEA 4M3UA 1JLEA 1RTIA 4CF1A 4KI4A 4DTOA 3RMAA 4BWMA 3QEWA 4JRPA 3HM9A 4CHZA 2OPSA 3SZ2A 1RTDA 3OYLA 3OJUA 4DTJA 1HYVA 3DOKA 3PO4A 3HPOA 5J2QA 2E4LA 3PX6A 3L2QA 3IAYA 2GV9A 2PYJA 4CJLA 1RNHA 1DLOA 1X1PA 4J2BA 4ELTA 1F21A 4B9VA 4E1NA 3SQ1A 3TAQA 4CEBA 4FYDA 3SYZA 2YV0X 4KAZA 1JL2A 3OS0A 4FZZA 2W42A 4DTNA 3AVCA 3ASMA 4GMJB 4OKEA 5CYMA 5HP1A 2YNIA 5KRSA 1VSJA 4YFUA 1L3UA 3KJVA 1I39A 5HRSA 4Y1DA 3VQQA 4FJ5A 3RR8A 4M3XA 1RBTA 3MXJA 1KRPA 3NH2A 2OZSA 3PX4A 4CIEA 4BE1A 1VSEA 5EU7A 2QK9A 2D5RA 4EP5A 1BI4B 3QNNA 3BGRA 4KHUA 1BQMA 1VSLA 2IAJA 4PA1A 4DTMA 4DFMA 3O3GA 4NCAA 4CJ5A 3L2RA 3HO1A 1ZBHA 4DS4A 3CM6A 4W5TA 1J54A 3OYBA 4OKJA 5CZ2A 3S3OA 3I0SA 2PZSA 1N5YA 4CGGA 3KLIA 4M3YA 2QKBA 4IG0A 1NOZA 4CCHA 3TANA 3LAKA 1RT5A 1NK5A 2VWJA 4B8AB 4Z4EA 4H8KA 1ZBUA 4J2DA 3ZT4A 1SUQA 2E6MA 1U04A 4IBNA 5CZ1A 3ULDA 4DWIA 3UIQA 4Z4HA 4M3WA 3ZT0A 5J2NA 1UAXA 3NF9A 3V9SA 1J9AA 1FK9A 4CHOA 2OPPA 3PV8A 3NH0A 3L2UA 1WNSA 4I7FA 3KLFA 4EZ9A 3VQCA 4OVLA 5J1EA 1QS4A 3ZSZA 4DU4A 2DFEA 2FC0A 3QETA 4CK1A 4DU3A 1WN7A 1HQUA 4RW8A 3TARA 1JL1A 3M8QA 1RBRA 3VQAA 3OYGA 2XY5A 3DLBA 4ELUA 3VQEA 3HSTB 3DLHA 3LWLA 2BE2A 2LSNA 4QOZB 3H08A 3SI6A 1S6PA 4FCYA 3FFIA 2DTUA 4CEDA 3C95A 4CGIA 1NKBA 2JLEA 2KZZA 1BHLA 4IFYA 3LZIA 3DOLA 4OGEA 1JKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZM A;  4CEA A;  4XIU A;  3PY8 A;  2DY4 A;  4DTR A;  2EHG A;  4E19 A;  4FLY A;  1U48 A;  1SL2 A;  1NK6 A;  1QSS A;  2G8U A;  4CK2 A;  2OZM A;  1WSG A;  2F8S A;  4DS5 A;  2KFN A;  1RTJ A;  3AVH A;  3KLH A;  1IG9 A;  1CLQ A;  3M8S A;  3TWH A;  2VG5 A;  3AO2 A;  1SKW A;  3LP3 A;  4C8K A;  1Y97 A;  4DQP A;  3CYM A;  4CF0 A;  3A2F A;  2ZD1 A;  4DFJ A;  3MXI A;  1U45 A;  4LH5 A;  1SL1 A;  1C0U A;  1RBU A;  3L3U A;  1S1U A;  4OJR A;  1RBV A;  3AA2 A;  1EKE A;  2VWK A;  3ZT2 A;  1RDC A;  1ASV A;  1GOA A;  2A1S A;  2B6A A;  3ITH A;  5E41 A;  4M3T A;  2KW4 A;  3NCI A;  4L8R B;  3L3V A;  4E89 A;  4CHY A;  3AO3 A;  3SV3 A;  3VQ6 A;  4O4G A;  1NJW A;  2G8W A;  1UOC A;  4QAG A;  4E7I A;  2ITG A;  1IH7 A;  3DYA A;  3OY9 A;  3HPH A;  1ZYQ A;  2G8I A;  3DLR A;  4ICL A;  3K5M A;  4OGC A;  4O55 A;  3WNF A;  4Z4C A;  3RMB A;  3OVN A;  4BAC A;  4OLB A;  1NK4 A;  4KTQ A;  1JLG A;  4FJJ A;  3OYE A;  1C6V A;  3CG7 A;  4Z4I A;  2YHB A;  1FKO A;  3DLE A;  3TAP A;  4HCC A;  4DSJ A;  4KHW A;  3V9X A;  5FRO A;  1LV5 A;  3E01 A;  1RTH A;  3KKR A;  3VQ9 A;  5T7B A;  4H4O A;  2Z1G A;  3AVB A;  1D8Y A;  1ASW A;  2RF2 A;  3K59 A;  4DTS A;  1XI1 A;  4JRQ A;  3DRS A;  1RDB A;  3DLK A;  3KKS A;  1DTQ A;  4CGJ A;  3OYK A;  4FJN A;  4J2E A;  4CGH A;  4IDK A;  4FLW A;  4O44 A;  3SUO A;  4FZY A;  3C94 A;  4CEE A;  2XRI A;  1CZB A;  1Z25 A;  3K2P A;  4FVM A;  2JGU A;  4BWJ A;  4BDZ A;  1BIZ A;  1NJX A;  3B6O A;  4AH9 A;  3NGY A;  4CFA A;  4MFB A;  3RMC A;  1JLA A;  3B6P A;  3TAE A;  1EX4 A;  3AO5 A;  2Y1J A;  1QSY A;  3CQ8 A;  3MXM A;  1L3V A;  3CFO A;  4GVM A;  3HYF A;  3I0R A;  2DFH A;  1A5X A;  3M8P A;  3MEC A;  1S1V A;  1VSK A;  4CF2 A;  2DFF A;  3EYZ A;  1TKZ A;  3HP6 A;  1LWF A;  4FZX C;  1JLQ A;  1NK8 A;  2XY8 A;  3OYI A;  1GOC A;  2HND A;  2X6S A;  3KIO A;  4N56 A;  1C1A A;  4CF8 A;  4F3T A;  1XC9 A;  1S6Q A;  1IKV A;  5KRT A;  1IO2 A;  4RG8 A;  3VQ4 A;  2QKK A;  3BDP A;  2Q3S A;  1YT3 A;  4BE2 A;  3VQD A;  3RMD A;  2P5O A;  1SV5 A;  1RT3 A;  1HQE A;  2Z1H A;  1C0T A;  1ZBF A;  3HPG A;  4W5R A;  3LAN A;  5HRR A;  1HPZ A;  3VA0 A;  3DMJ A;  1C1B A;  3KK2 A;  3AVK A;  2HHW A;  4E7K A;  5KGX A;  1S9E A;  2VG6 A;  3V1R A;  5JS1 A;  3IRX A;  2EX3 A;  2HNZ A;  1NK0 A;  3MEG A;  3ZCM A;  3O4N A;  1LAW A;  1S9G A;  3T1A A;  4I2Q A;  1TK0 A;  4B9U A;  1VSF A;  2ZQB A;  3TAG A;  3HJF A;  4W5O A;  4B9N A;  4I9Q A;  1RBS A;  4FJ9 A;  4RW4 A;  4CE9 A;  1ITG A;  1WSJ A;  3SV4 A;  2XY6 A;  2IDO A;  3NH1 A;  4CJR A;  4HVJ A;  4O0J A;  5DK5 A;  4FJI A;  4OKK A;  2BGG A;  5JS2 A;  4KHQ A;  4C8N A;  1A5W A;  1X9M A;  1KFS A;  4G1Q A;  3L8B A;  4PWD A;  3HXM A;  4DF4 A;  1CXU A;  1TVR A;  1KVC A;  2ZE2 A;  3ZSW A;  4DG1 A;  2R7Y A;  4HTU A;  3SJJ A;  1BCM A;  3AA3 A;  5C25 A;  5HRP A;  1EXQ A;  4E7L A;  4Y1C A;  3SQ0 A;  1LWC A;  2F96 A;  3QIP A;  1T7P A;  3D45 A;  3LWM A;  4FJX A;  2X78 A;  5SZT A;  4CEZ A;  5HRN A;  4KB1 A;  2VG7 A;  2D0C A;  1L5U A;  3QIN A;  4CJS A;  4IFV A;  1UA0 A;  1B92 A;  4AHT A;  1QQC A;  3MED A;  3SUN A;  1TK8 A;  2Z1J A;  3PX0 A;  4E7H A;  1KFD A;  4AHC A;  1S5J A;  3F9K A;  4B8C A;  1T05 A;  3JSM A;  3DLG A;  1NKC A;  1JLB A;  1QE1 A;  3KTQ A;  4FJG A;  3NBP A;  4H4M A;  4KO0 A;  3V81 A;  3LP1 A;  4LSN A;  1KVA A;  3ALY A;  1NK9 A;  4DSL A;  3LP0 A;  1RIL A;  3AVJ A;  4C8M A;  4B3O A;  4AHR A;  4F3O A;  2BAN A;  4KTZ A;  4I9L A;  4ID5 A;  4CJP A;  3OS1 A;  1HJR A;  3LZJ A;  2FBV A;  4NCB A;  2D0A A;  3C6T A;  4GW6 A;  4J2A A;  4CIG A;  1HYS A;  4ZHR A;  1Q8I A;  5I42 A;  3LP2 A;  3VQP A;  4ID1 A;  2P51 A;  3V9Z A;  4FK0 A;  3P1G A;  1Q9X A;  3U3G A;  4Z4F A;  3KD1 E;  4EZ6 A;  4FLU A;  4AHS A;  4HUE A;  2IOC A;  3P83 D;  3QER A;  4AHV A;  3KLG A;  1RT2 A;  3V1Q A;  3RTV A;  1WSI A;  4CJQ A;  4M42 A;  4DQQ A;  4PQU A;  4DTP A;  3S3M A;  3I8D A;  4DLE A;  3G0Z A;  4B9T A;  5KTQ A;  5FDL A;  4F4K A;  2Z1I A;  1DTT A;  3HVR A;  3V1O A;  2YKN A;  5J2P A;  3OYN A;  2RN2 A;  1RDD A;  4KI6 A;  4FJL A;  3LAL A;  2WOM A;  2ATQ A;  3ISN C;  3K5O A;  3NF7 A;  4CFD A;  2OPR A;  3OS2 A;  2OYQ A;  2YKM A;  4FK2 A;  4M3Z A;  3LPU A;  1IKX A;  3ZT3 A;  2P5G A;  3D0P A;  3AVA A;  4KTW A;  4CHQ A;  2HMI A;  4LD0 A;  4JS4 A;  4EP4 A;  4B9M A;  4DMN A;  2GBZ A;  1TKT A;  4CIF A;  3NHG A;  5J2M A;  4C8L A;  5HLF A;  4CJK A;  4PUO A;  4DSK A;  3AVG A;  3QEX A;  4DF8 A;  1TGO A;  2P1J A;  3VQB A;  4CFC A;  4CJF A;  3SPY A;  1XHZ A;  4FJH A;  1VSH A;  4CK3 A;  3DI6 A;  4LY7 A;  4DFK A;  1NOY A;  3TAM A;  4DSE A;  2FBY A;  1N6Q A;  1U49 A;  4PY5 A;  1A5V A;  4DQR A;  1U47 A;  3OYM A;  4CJU A;  1VRU A;  3MEE A;  5DMR A;  4B08 A;  4CF9 A;  4R5P A;  4IKF A;  2NUB A;  1NKE A;  2KFZ A;  3NF8 A;  3S9H A;  1T8E A;  1LW2 A;  1NJY A;  3SQ2 A;  1TAU A;  4ZTJ A;  4FK4 A;  2RKI A;  4JS5 A;  4CES A;  4CJV A;  3L2V A;  1B9F A;  3NAE A;  3LPT A;  1FKP A;  4UQG A;  1YVU A;  1SKS A;  3L2W A;  4K8X A;  2IGI A;  1BI4 A;  2WON A;  1ZBL A;  1BIS A;  3DM2 A;  1CZ9 A;  1EP4 A;  1UWB A;  1QTM A;  3SCX A;  3CM5 A;  4O0I A;  1YTA A;  4MQ3 A;  4CER A;  5CY4 A;  4N47 A;  1SKR A;  2AJQ A;  2BDP A;  1X9S A;  4F2R A;  4F8R A;  1KTQ A;  3WNG A;  3TR8 A;  4B9S A;  4CJ3 A;  4Z0U A;  1S1X A;  3VQ7 A;  3TAF A;  5C42 A;  3JYT A;  4FJM A;  4KHY A;  4FW1 A;  3KD5 E;  1TKX A;  5K14 A;  5KGW A;  4E3S A;  1JXB A;  1WLJ A;  3AVL A;  4RW7 A;  2HHT A;  1VK0 A;  3HK2 A;  4CJT A;  4W5N A;  1D9F A;  1KLM A;  3CFP A;  1B9D A;  3QES A;  1BIU A;  1MU2 A;  3HVT A;  3KK1 A;  3T19 A;  3VQ8 A;  1L3T A;  2E6L A;  3SUP A;  4KB0 A;  3K5L A;  4FM1 A;  1W9H A;  1HNI A;  3O3F A;  3RRH A;  1LAV A;  4FW2 A;  3QEV A;  4IG3 A;  5SWM A;  5C24 A;  4Z4G A;  2B4J A;  2FBT A;  3AV9 A;  3AA4 A;  3OYF A;  1Z26 A;  4HUF A;  1REV A;  2YNG A;  5D3G A;  2IC3 A;  1BCO A;  2HVH A;  1RCH A;  3CFR A;  4CHN A;  1S1W A;  1IKW A;  3HT3 A;  1U4B A;  1NK7 A;  4ZTF A;  3EY1 A;  4CJW A;  2KTQ A;  1JXE A;  4CJ4 A;  4KKO A;  3PUF A;  1SL0 A;  2IS3 A;  3ZSY A;  2HHQ A;  3NFA A;  3RRG A;  4M3R A;  1TL1 A;  1TL3 A;  3V9U A;  3WNE A;  1O1W A;  4OPJ A;  4DFP A;  4QCL A;  4O5B A;  4HHT A;  3V4I A;  3P5J A;  2O4I A;  4CEO A;  4B9L A;  1WAF A;  3U3Y A;  1RT7 A;  4E0D A;  1JLF A;  2HVI A;  2HB5 A;  3O4Q A;  3C6U A;  3NE6 A;  1RT1 A;  3QEP A;  1IKY A;  1QSL A;  3ZT1 A;  4FLV A;  1HMV A;  2X74 A;  3AVF A;  4KHN A;  1JLC A;  3RWU A;  1EET A;  4E1M A;  1BQN A;  3O3H A;  5CYQ A;  1RDA A;  4W5Q A;  3NGI A;  3HL8 A;  4FLZ A;  1Q9Y A;  3OYJ A;  2HW3 A;  1TAQ A;  3ZSQ A;  2ETJ A;  3THV A;  3VN5 A;  3PO5 A;  1YTU A;  4Q0B A;  4FM2 A;  3SUQ A;  4OLA A;  3WNH A;  3K58 A;  4HUG A;  4FXD A;  1X9W A;  1HYZ A;  4DLG A;  4DQS A;  3V9W A;  2F8T A;  2RPI A;  4FM0 A;  2YHA A;  3ZSV A;  1I3A A;  3QLH A;  3TI0 A;  3QEI A;  2Y1I A;  4HCB A;  4KRE A;  1G15 A;  3KK3 A;  1GOB A;  3NGZ A;  3T3F A;  1KCF A;  1WSF A;  3IS9 A;  1LWE A;  3OYC A;  4OPK A;  3OJS A;  4N41 A;  4CGF A;  2FBX A;  4KHS A;  3HP9 A;  1C1C A;  1WSH A;  3ZSX A;  3DRP A;  4LH4 A;  3LDS A;  1L3S A;  4K8Z A;  3U6F A;  1KSP A;  2G8K A;  4KRF A;  1D5A A;  2QXF A;  3F73 A;  1BGX T;  4BDY A;  4DQI A;  2GUI A;  3K57 A;  2OPQ A;  2YNH A;  4JLH A;  3OYA A;  3EZ5 A;  4NYN A;  3AVN A;  4M41 A;  5I3U A;  1VRT A;  1VSD A;  4FJ8 A;  1RT4 A;  2D0B A;  3AA5 X;  2G8H A;  1XHX A;  4DSF A;  1J5O A;  4N76 A;  1VSM A;  3QO9 A;  4Q5V A;  2HHX A;  3QNO A;  3IG1 A;  2XY7 A;  4KV8 A;  2I5J A;  1FXX A;  2B5J A;  4DTX A;  1KLN A;  4LSL A;  3ZSR A;  4NYF A;  3NF6 A;  2OA8 A;  4DU1 A;  1ZBI A;  4KFB A;  1RT6 A;  1TK5 A;  2X6N A;  4C8O A;  3AVI A;  2G8F A;  1NJZ A;  4CGD A;  4TSX A;  2YNF A;  1LW0 A;  1TV6 A;  4YNQ A;  4AHU A;  4FJK A;  3MAQ A;  4AIL C;  3NDK A;  1W0H A;  3AO1 A;  2HHV A;  2G8V A;  5KI6 A;  2HHS A;  4DSI A;  4FJ7 A;  1K6Y A;  4RW6 A;  2PY5 A;  5FRN A;  3G10 A;  1C0M A;  3QIO A;  4DTU A;  4FLT A;  3VA3 A;  4CHP A;  3SPZ A;  4BDP A;  1R0A A;  3DRR A;  3TAB A;  1BL3 A;  4ELV A;  3VQ5 A;  1KVB A;  2HNY A;  4CJE A;  2PYL A;  1J53 A;  4CEQ A;  4E7J A;  4CEC A;  5HBM A;  2KQ2 A;  3AO4 A;  1HRH A;  4CFB A;  4N5S A;  1VSI A;  1UA1 A;  3LAM A;  1TKD A;  3K5N A;  4I2P A;  1T03 A;  1QHT A;  3AVM A;  3SQ4 A;  3ZSO A;  2HHU A;  3S3N A;  4KPY A;  4BE0 A;  4NCG A;  1WSE A;  4CEF A;  3V6D A;  1HNV A;  4F2S A;  3OYD A;  3OYH A;  1WAJ A;  4FLX A;  2XHB A;  3SNN A;  4M45 A;  2XO7 A;  4RW9 A;  4WE1 A;  3RR7 A;  1CXQ A;  2A1R A;  5HRO A;  3M8R A;  1D9D A;  1XWL A;  2O4G A;  1ASU A;  5FRM A;  1S1T A;  3KLE A;  4M3U A;  1JLE A;  1RTI A;  4CF1 A;  4KI4 A;  4DTO A;  3RMA A;  4BWM A;  3QEW A;  4JRP A;  3HM9 A;  4CHZ A;  2OPS A;  3SZ2 A;  1RTD A;  3OYL A;  3OJU A;  4DTJ A;  1HYV A;  3DOK A;  3PO4 A;  3HPO A;  5J2Q A;  2E4L A;  3PX6 A;  3L2Q A;  3IAY A;  2GV9 A;  2PYJ A;  4CJL A;  1RNH A;  1DLO A;  1X1P A;  4J2B A;  4ELT A;  1F21 A;  4B9V A;  4E1N A;  3SQ1 A;  3TAQ A;  4CEB A;  4FYD A;  3SYZ A;  2YV0 X;  4KAZ A;  1JL2 A;  3OS0 A;  4FZZ A;  2W42 A;  4DTN A;  3AVC A;  3ASM A;  4GMJ B;  4OKE A;  5CYM A;  5HP1 A;  2YNI A;  5KRS A;  1VSJ A;  4YFU A;  1L3U A;  3KJV A;  1I39 A;  5HRS A;  4Y1D A;  3VQQ A;  4FJ5 A;  3RR8 A;  4M3X A;  1RBT A;  3MXJ A;  1KRP A;  3NH2 A;  2OZS A;  3PX4 A;  4CIE A;  4BE1 A;  1VSE A;  5EU7 A;  2QK9 A;  2D5R A;  4EP5 A;  1BI4 B;  3QNN A;  3BGR A;  4KHU A;  1BQM A;  1VSL A;  2IAJ A;  4PA1 A;  4DTM A;  4DFM A;  3O3G A;  4NCA A;  4CJ5 A;  3L2R A;  3HO1 A;  1ZBH A;  4DS4 A;  3CM6 A;  4W5T A;  1J54 A;  3OYB A;  4OKJ A;  5CZ2 A;  3S3O A;  3I0S A;  2PZS A;  1N5Y A;  4CGG A;  3KLI A;  4M3Y A;  2QKB A;  4IG0 A;  1NOZ A;  4CCH A;  3TAN A;  3LAK A;  1RT5 A;  1NK5 A;  2VWJ A;  4B8A B;  4Z4E A;  4H8K A;  1ZBU A;  4J2D A;  3ZT4 A;  1SUQ A;  2E6M A;  1U04 A;  4IBN A;  5CZ1 A;  3ULD A;  4DWI A;  3UIQ A;  4Z4H A;  4M3W A;  3ZT0 A;  5J2N A;  1UAX A;  3NF9 A;  3V9S A;  1J9A A;  1FK9 A;  4CHO A;  2OPP A;  3PV8 A;  3NH0 A;  3L2U A;  1WNS A;  4I7F A;  3KLF A;  4EZ9 A;  3VQC A;  4OVL A;  5J1E A;  1QS4 A;  3ZSZ A;  4DU4 A;  2DFE A;  2FC0 A;  3QET A;  4CK1 A;  4DU3 A;  1WN7 A;  1HQU A;  4RW8 A;  3TAR A;  1JL1 A;  3M8Q A;  1RBR A;  3VQA A;  3OYG A;  2XY5 A;  3DLB A;  4ELU A;  3VQE A;  3HST B;  3DLH A;  3LWL A;  2BE2 A;  2LSN A;  4QOZ B;  3H08 A;  3SI6 A;  1S6P A;  4FCY A;  3FFI A;  2DTU A;  4CED A;  3C95 A;  4CGI A;  1NKB A;  2JLE A;  2KZZ A;  1BHL A;  4IFY A;  3LZI A;  3DOL A;  4OGE A;  1JKH A; 
#chains in the Genus database with same CATH topology
 2KZM A;  4XIU A;  4IOX A;  4WFA L;  4DTR A;  3IUC A;  1U48 A;  2QA4 N;  1QSS A;  1M90 O;  4CK2 A;  1WSG A;  1RTJ A;  1IG9 A;  5C2D A;  4I6M B;  4BRM A;  3AO2 A;  2ZWH A;  4F9O A;  4C8K A;  5EY4 A;  4DQP A;  4DFJ A;  2ZD1 A;  2Q1N A;  2Q31 A;  1SL1 A;  3SBG A;  4DUY K;  4YOX A;  4XEI A;  1ASV A;  1GOA A;  2AA4 A;  3ITH A;  1GLB G;  3NCI A;  3KHY A;  2QI2 A;  4DV1 K;  4DV4 K;  1NGF A;  3DYA A;  3OY9 A;  1ZYQ A;  5C12 A;  5ADX A;  4BAC A;  3TTD A;  2J4R A;  4LFC K;  3CPW M;  4Z4I A;  4DSJ A;  4KHW A;  3V9X A;  1RTH A;  2P9L A;  5T7B A;  2Z1G A;  2OAN A;  2RF2 A;  4DTS A;  3DLK A;  4K41 A;  4BR0 A;  1KC8 O;  4FZY A;  3NVK A;  4M7X A;  4GVE A;  4CEE A;  4BDZ A;  1CZB A;  3I33 A;  3LM9 A;  2JGU A;  3B6O A;  4AH9 A;  3RMC A;  1VQP N;  3MXM A;  3H46 O;  1A5X A;  3CCU N;  4CF2 A;  3IDH A;  3EYZ A;  5AFU H;  4BRK A;  3OYI A;  4BRH A;  3L4Q A;  3CI5 A;  4F3T A;  1S6Q A;  4RG8 A;  2FSK A;  1RT3 A;  2Z1H A;  1C0T A;  1ZBF A;  2QM1 A;  3LAN A;  1HPZ A;  1U2V A;  3DMJ A;  3KK2 A;  3AVK A;  3M3Z A;  2HNZ A;  2P9L B;  1EQY A;  1K8K A;  1LAW A;  1S9G A;  1TK0 A;  3ATU A;  4IZ9 A;  2NRZ A;  3TAG A;  4CE9 A;  1WSJ A;  3P39 A;  2XY6 A;  2QXL A;  2IDO A;  3NH1 A;  1XMQ K;  5DK5 A;  4FJI A;  1N32 K;  4IO9 L;  2A41 A;  4B3R K;  4DV7 K;  1RDW X;  4PWD A;  4DF4 A;  1GLE G;  4MDA A;  1KVC A;  1YHQ N;  4X64 K;  3PIO L;  4IOC L;  3AA3 A;  1ATR A;  5C25 A;  4O8U A;  5LY3 A;  2F96 A;  3D45 A;  1HUX A;  4FJX A;  5AQH A;  2X78 A;  1L5U A;  1UA0 A;  5EOY A;  3UE5 A;  1TYQ B;  3MED A;  1NGD A;  3U9Z A;  3PX0 A;  4E7H A;  4AHC A;  1NKC A;  4U7B A;  2YI1 A;  1T05 A;  4FJG A;  1QE1 A;  4H4M A;  2GUP A;  1NK9 A;  3LP1 A;  4LSN A;  2E20 A;  3T69 A;  5JIC A;  3AVJ A;  4FWR A;  4CZI A;  4KTZ A;  1GLA G;  3OS1 A;  1YVN A;  3IMX A;  2D0A A;  2ASM A;  1JCF A;  4GW6 A;  4J2A A;  4L3Q A;  3VTH A;  3ZX2 A;  3LP2 A;  4ID1 A;  3CCE N;  2P51 A;  2QWR A;  3OA9 A;  4Z4F A;  4EZ6 A;  4BR5 A;  3G25 A;  4AHS A;  3VGK A;  3VEY A;  4CJQ A;  4M42 A;  3I8D A;  4B9T A;  2HBJ A;  5KTQ A;  4FWP A;  4JI7 K;  2WC9 A;  2Z1I A;  1HKG A;  2YKN A;  4FJL A;  1QVF M;  3LAL A;  2WOM A;  4EHU A;  3K5O A;  3NF7 A;  4RTF D;  3OS2 A;  2YKM A;  2HBM A;  5CHI A;  3D0P A;  3PSF A;  4KTW A;  2HMI A;  4JS4 A;  4EP4 A;  4JI2 K;  3WEE A;  5JMV A;  3QEX A;  4CFC A;  1VSH A;  4IEE A;  4H0P A;  4PY5 A;  4B08 A;  3T7Z A;  4R5P A;  3NF8 A;  4YOT A;  3CF5 L;  3NAE A;  3HOT A;  5GIP A;  2A42 A;  2CGL A;  3THY A;  2W6K A;  1CZ9 A;  5HOO A;  1UWB A;  1YJ9 N;  3A5L C;  3TR8 A;  4CJ3 A;  4Z0U A;  3TAF A;  3JYT A;  5KGW A;  4E3S A;  2DPN A;  3ATV A;  1XC3 A;  1OVY A;  4Y0W A;  3WEE B;  3VQ8 A;  1L3T A;  2E6L A;  3K5L A;  1W9H A;  1HNI A;  1LAV A;  2RHK A;  4IG3 A;  5C10 A;  4JK7 A;  3U8X A;  3BF1 A;  4HUF A;  4JI5 K;  2ITM A;  4IO8 A;  5KPZ A;  5M1F A;  1IKW A;  3HT3 A;  3EY1 A;  2UXC K;  1Q86 O;  4HTL A;  3ZSY A;  1ZXO A;  2EWS A;  4DFP A;  1V4T A;  3C7N A;  4BC2 A;  4O5B A;  3V4I A;  3P5J A;  3WQU A;  2O4I A;  4B9L A;  3O4Q A;  3C6U A;  5FPD A;  1RT1 A;  3QEP A;  3O5B A;  1HMV A;  2X74 A;  3AVF A;  4KHN A;  3AGK A;  1BQN A;  5CYQ A;  4W5Q A;  1Q82 O;  1Q9Y A;  3CPE A;  3K0S A;  4K25 A;  3SUQ A;  4OLA A;  3WNH A;  4FXD A;  2D0P A;  1X9W A;  4EAH D;  4DLG A;  1KD1 O;  1BUP A;  2VWB A;  4FM0 A;  3QEI A;  4KRE A;  2F9T A;  1G15 A;  3O9Q A;  5A2Q O;  1WSF A;  3OJS A;  4CGF A;  4FL9 A;  3GDQ A;  1C1C A;  5AQJ A;  1K73 O;  1KSP A;  1Z05 A;  2QXF A;  2QEX N;  1V4S A;  4LF9 K;  3C65 A;  2YNH A;  4JLH A;  4YOU A;  3EZ5 A;  4GKK K;  2PAV A;  1VSD A;  4FJ8 A;  3WXM B;  3C7N B;  4DSF A;  3IG1 A;  4KV8 A;  5GIO A;  4B9Q A;  4WFB L;  2OA8 A;  4UY8 O;  5AQT A;  3AVI A;  2FF3 B;  3E9O A;  4YNQ A;  4AHU A;  4FJK A;  2V51 B;  3E9L A;  1W0H A;  2HHS A;  2HHV A;  4FJ7 A;  5FRN A;  4DTU A;  3SPZ A;  4YOY A;  1BL3 A;  3TTF A;  3VQ5 A;  2PYL A;  3DXM A;  4CEQ A;  4JKB A;  2PBD A;  5HBM A;  4LFB K;  1VSI A;  2Q36 A;  5BRH A;  5GAE P;  4NCG A;  1WSE A;  4CEF A;  1SS6 A;  4BE0 A;  1WAJ A;  3K9J A;  3M8R A;  2O4G A;  1KAX A;  3L4I A;  1KAZ A;  1RTI A;  4DV2 K;  1IG8 A;  1NWK A;  3MN7 A;  1RTD A;  4DTJ A;  1HYV A;  3VEW A;  3L2Q A;  3IAY A;  4GV6 A;  4E1N A;  2YV0 X;  4FZZ A;  1JL2 A;  3OS0 A;  4DTN A;  3ASM A;  5CYM A;  3ZX3 A;  3KJV A;  4M3X A;  3VQQ A;  3RR8 A;  3D2F A;  3DXM B;  3OBY A;  3P4I A;  2HBL A;  3NH2 A;  4DR7 K;  3PX4 A;  3O9U A;  4BE1 A;  4B1U B;  2D5R A;  1BI4 B;  1U6Z A;  3VGL A;  4BRC A;  1WUA A;  3O1W A;  4JNE A;  4FWL A;  4WYB A;  4IEI A;  2YHW A;  4BRA A;  2HHH K;  1N5Y A;  3I8B A;  3KLI A;  2QKB A;  1NK5 A;  2HBK A;  4H8K A;  4MLE A;  1RFQ A;  4J2D A;  4FWQ A;  2YHY A;  2D1K A;  3VPZ A;  1U04 A;  1HX1 A;  4Z4H A;  3ZT0 A;  4H0T B;  1UAX A;  5AQN A;  3KWG A;  4NLC A;  3PV8 A;  4EZ9 A;  4BY9 C;  2CGK A;  4OVL A;  1QS4 A;  4CK1 A;  2JWK A;  4RW8 A;  1GLF O;  4BRL A;  2A3Z A;  1EWR A;  1RBR A;  3VQA A;  2D0O A;  3DLB A;  4DR1 K;  4WQ4 C;  3VQE A;  3D2F B;  4ELU A;  4B1Z A;  3FGU A;  2LSN A;  3H08 A;  3SI6 A;  3VF2 A;  1HNX K;  1NKB A;  1Z6R A;  2JLE A;  4BG9 A;  3BY5 A;  4IFY A;  3O9R A;  3DOL A;  1JKH A;  2ASP A;  4CEA A;  2EHG A;  2UYT A;  4E19 A;  3O9T A;  4FLY A;  4BQL A;  2OZM A;  2KFN A;  2F8S A;  1CLQ A;  3TWH A;  5HL7 L;  3LP3 A;  1Y97 A;  5FPM A;  3CYM A;  1XMO K;  3A2F A;  1NGA A;  4JI4 K;  1U45 A;  1VQ8 N;  1QHA A;  1RBV A;  2BH1 A;  2P9N A;  1EKE A;  3ZT2 A;  2B6A A;  5C2F A;  5E41 A;  4L8R B;  4PKH A;  4CHY A;  4O4G A;  5AQS A;  1NJW A;  4E7I A;  4JK8 A;  3HPH A;  5AQX A;  4LF6 K;  5JVG L;  4ICL A;  3K5M A;  4OGC A;  3WNF A;  4Z4C A;  3RMB A;  1VQK N;  4RWT A;  3CCL N;  4K0K K;  4KTQ A;  1JLG A;  1QZ6 A;  1MWK A;  4YY3 K;  5AQF A;  2YHB A;  3DLE A;  3TAP A;  1OVQ A;  4BR4 A;  5BN9 A;  2F9W A;  2O8C A;  3E01 A;  4FO0 A;  3PLA A;  1XI1 A;  2VGN A;  3DRS A;  3CMA N;  4JRQ A;  2OTJ N;  4CGJ A;  1MA9 B;  3R9P A;  4CGH A;  2OCE A;  4WFN L;  1N33 K;  2XRI A;  1Z25 A;  4NLB A;  1NJX A;  1BIZ A;  2P9N B;  1JLA A;  3AO5 A;  3CQ8 A;  3CFO A;  3ZYY X;  1NMN A;  3HYF A;  1E4G T;  4LF8 K;  1TKZ A;  1NK8 A;  3KIO A;  4CF8 A;  4JV5 K;  5IT9 O;  3E66 A;  1H1V A;  2E5L K;  1BWF O;  3VQ4 A;  2QKK A;  2Q3S A;  3VQD A;  4JKH A;  1HQE A;  3HPG A;  3O1B A;  4BR9 A;  2HHW A;  2O8C B;  2VG6 A;  5JS1 A;  4A5A A;  3MEG A;  3O4N A;  4CD3 A;  4H0V B;  4B9U A;  4W5O A;  1VAZ A;  4RW4 A;  3U4L A;  2D4W A;  3ZET B;  4OKK A;  4K43 A;  1W7A A;  4G1Q A;  5AQP A;  4BR7 A;  4JYA K;  3FE1 A;  3P38 A;  5DM6 L;  4OPH A;  4DG1 A;  3SJJ A;  4FPB A;  4E7L A;  3MCA B;  4MO5 A;  2V7Y A;  4CEZ A;  5HRN A;  3J81 O;  2D0C A;  3H3O B;  3SAF A;  2Z1J A;  1KFD A;  3CJ1 A;  3J7Z O;  3WQT A;  3KTQ A;  1JLB A;  3NBP A;  1NBW A;  4KO0 A;  4DSL A;  1KVA A;  1NGG A;  4FWS A;  1RIL A;  4JD2 A;  4BQZ A;  4C8M A;  4B3O A;  5AQZ A;  3H45 C;  1BU6 O;  1OH6 A;  4CIG A;  1Q8I A;  5I42 A;  1XNR K;  2E2P A;  4GNI A;  3V9Z A;  3P1G A;  4X66 K;  1Q9X A;  3F9M A;  5ADX H;  1M1K O;  2IOC A;  4LF7 K;  4AHV A;  3RTV A;  1WSI A;  4DQQ A;  4PQU A;  3CJC A;  2NRV A;  2FF6 A;  3G0Z A;  1EO1 A;  5FDL A;  3HVR A;  1DTT A;  4KI6 A;  1RDD A;  4JKE A;  2E1Y A;  1WOQ A;  2ATQ A;  1QZ5 A;  2NRT A;  1IKX A;  3LPU A;  5AQL A;  4PKG A;  4CHQ A;  4QS9 A;  4LD0 A;  4B9M A;  1TKT A;  4C8L A;  5J2M A;  5HLF A;  4JD2 B;  2ASO A;  1WBB A;  4DF8 A;  4BRD A;  2E2O A;  4CJF A;  4CK3 A;  1NOY A;  3TAM A;  4DSE A;  2GEL A;  4CJU A;  1VQ5 N;  2FSN A;  3MEE A;  4IKF A;  2NUB A;  2W40 A;  4JKG A;  3S9H A;  1T8E A;  3O6W A;  3SQ2 A;  2UXB K;  4FK4 A;  3QIC A;  3CCV N;  4CZJ A;  3L2V A;  3BZC A;  5LJW A;  1SKS A;  4U67 L;  4K8X A;  3BP8 A;  2IGI A;  3H1Q A;  3CJB A;  3TPQ A;  1Q18 A;  3MK6 A;  1QTM A;  3SCX A;  3CM5 A;  1YTA A;  4H5W A;  4F2R A;  1KTQ A;  1KQS M;  1DEJ A;  3DXK A;  1S1X A;  2Q2R A;  1BDG A;  5K14 A;  3Q7C A;  5AQM A;  1JXB A;  2NRR A;  3AVL A;  2I7P A;  2P9U A;  1E4F T;  1D9F A;  1KLM A;  5KPR A;  1B9D A;  3QES A;  3HVT A;  3SUP A;  4FM1 A;  3O3F A;  3RRH A;  3QEV A;  2P9I A;  1VQM N;  5C24 A;  2JWL A;  3M6G A;  4GV3 A;  3F2K A;  4DR6 K;  3SJH A;  1VQ4 N;  2YNG A;  5D3G A;  1ILY A;  1BCO A;  3CXC M;  4JKG B;  3CFR A;  4CHN A;  1S1W A;  4H5N A;  1NGE A;  1NK7 A;  3AAR A;  1JXE A;  2FXU A;  4CZL A;  3NFA A;  1LCU A;  4CZE A;  3V9U A;  1O1W A;  4LC9 B;  1NGI A;  3U3Y A;  4E0D A;  5LMN K;  1FW6 A;  3DXK B;  3VEX A;  4CD1 A;  1WBD A;  3ZT1 A;  5IWA K;  4NB4 A;  3RWU A;  1EET A;  2I7N A;  3O3H A;  3NGI A;  4FLZ A;  1N34 K;  4IJA A;  3VF4 A;  1HLU A;  3ZSQ A;  2BTF A;  2ETJ A;  2P9U B;  4H0X B;  3VN5 A;  1C0G A;  4FM2 A;  3K58 A;  1U2V B;  2KKZ A;  2YHA A;  2P9I B;  1I3A A;  3QLH A;  3ZSV A;  2Y1I A;  3TI0 A;  1K8K B;  3KK3 A;  1GOB A;  3T3F A;  3OYC A;  4A61 A;  4DR4 K;  2VYP A;  5BRE A;  3ZSX A;  4ISG A;  3NMU A;  2FLO A;  2V52 B;  3L0Q A;  5BPM A;  2IVN A;  1D5A A;  4B1X B;  3F73 A;  4KRF A;  4DV6 K;  1IBM K;  2OPQ A;  4NYN A;  5I3U A;  1VRT A;  2G8H A;  1XHX A;  3CQY A;  1DKG D;  3TSQ A;  1VSM A;  2XY7 A;  1C0F A;  2ZJP L;  1FXX A;  2B5J A;  1KLN A;  1T6C A;  3O8M A;  5EXW A;  3ZSR A;  2F4V K;  4WQ4 A;  3NF6 A;  3BUZ B;  4KFB A;  4EIA A;  4BRO A;  2X6N A;  4C8O A;  3ZX0 A;  2G8F A;  3AGR A;  4A5B A;  2RE2 A;  3D6R A;  2WTU A;  3MAQ A;  2G8V A;  5KI6 A;  1K6Y A;  4RW6 A;  1EWQ A;  3G10 A;  3MWP A;  3DRR A;  2F7T A;  4ELV A;  5BPN A;  1J53 A;  5AZI A;  5AJ3 K;  4CZM A;  2A6A A;  2IIR A;  4JI3 K;  4I2P A;  1T03 A;  1QHT A;  3AVM A;  2ZJQ L;  4DQ8 A;  3OYD A;  5CR4 A;  3OYH A;  2XO7 A;  4RW9 A;  4WE1 A;  1CXQ A;  2A1R A;  3KLE A;  4CF1 A;  3RMA A;  4BWM A;  5JVH L;  2OPS A;  3SZ2 A;  1W2B M;  3HPO A;  2GV9 A;  4CBX A;  3EZW A;  4ELT A;  4B9V A;  2NRW A;  4JI8 K;  4FYD A;  1VQN N;  1BO5 O;  2HF3 A;  3SYZ A;  4BRE A;  1W97 L;  4KAZ A;  2W42 A;  3THW A;  5FPN A;  1VSJ A;  5M1P A;  1I39 A;  3EL2 A;  1RBT A;  3G71 N;  5AZI B;  1KRP A;  5GAH P;  3LDN A;  2A5X A;  5JLH A;  1HKB A;  1ESV A;  3AY9 A;  3THY B;  3CCR N;  4DFM A;  3O3G A;  4CJ5 A;  3L2R A;  2UU9 K;  3HO1 A;  4DS4 A;  3GE1 A;  1NLV A;  4JK9 A;  1J54 A;  3OYB A;  4JKD A;  1S22 A;  3I0S A;  3D2E A;  3TAN A;  3LAK A;  4OO1 J;  4PHT X;  2VWJ A;  1ZBU A;  4B3T K;  3ULD A;  5CZ1 A;  3OW2 M;  4DWI A;  4M3W A;  3F5T A;  3J7Y P;  1J9A A;  1FK9 A;  2OPP A;  3A8Y A;  1NGJ A;  3THW B;  1IV0 A;  1HQU A;  3TAR A;  2A40 A;  3OYG A;  2XY5 A;  1P8Z A;  4LF5 K;  3LWL A;  4BG8 A;  3FFI A;  2QWN A;  3C95 A;  4CGI A;  3QB0 A;  4BRQ A;  5GAG P;  2KZZ A;  4OGE A;  3T1Y K;  2DY4 A;  2E88 A;  4B3S K;  1NK6 A;  3D2E B;  2G8U A;  3EN9 A;  3AVH A;  3VER A;  3CC2 N;  3M8S A;  2IVP A;  2BUP A;  1SKW A;  3I56 N;  4CF0 A;  4LH5 A;  1ATN A;  3DAW A;  1RBU A;  3L3U A;  1S1U A;  4M3T A;  3EE9 A;  3L3V A;  3KZB A;  4JI6 K;  2GX9 A;  2QWP A;  3O4W A;  2G8W A;  2Q0R A;  2ITG A;  1NGC A;  3K9K A;  3EEQ A;  1NGH A;  3E9P A;  5AQV A;  3NVM A;  4WCE L;  2G8I A;  3J7A P;  4O55 A;  3OVN A;  3HBT A;  1C6V A;  3CG7 A;  4BGA A;  3QBX A;  5FRO A;  3CJ7 A;  4H4O A;  2QWO A;  4PL8 A;  3K59 A;  4DV0 K;  1RDB A;  3KKS A;  1DTQ A;  3OYK A;  4FJN A;  2O8F A;  4J2E A;  1Q81 O;  3SUO A;  1NMD A;  5AQI A;  2E2Q A;  4CFA A;  3TSU A;  3QBW A;  1QSY A;  4ISE A;  1L3V A;  4GVM A;  1I94 K;  2DFH A;  3MEC A;  2YJF A;  4FZX C;  2DFF A;  1LWF A;  2O8D A;  1R59 O;  2HMP A;  2XY8 A;  3QDK A;  4JKC A;  3MCP A;  5KRT A;  3BDP A;  1YT3 A;  2FSJ A;  4BE2 A;  3RMD A;  1SV5 A;  3CME N;  4GKJ K;  1IJJ A;  1C1B A;  4E7K A;  4H5T A;  5KGX A;  1S9E A;  3V1R A;  2NZT A;  3IRX A;  2EX3 A;  2UUA K;  4DV3 K;  4CZF A;  3T1A A;  1TUU A;  3A0I X;  2ZQB A;  2VQF K;  3HJF A;  4B9N A;  1ITG A;  2O8F B;  4KHP K;  4HVJ A;  4O0J A;  4CZK A;  3A5N C;  5AQO A;  2BGG A;  3CIP A;  1A5W A;  1CZA N;  3SAG A;  3L8B A;  4B1V A;  1RGI A;  3CCJ N;  2E8A A;  3RSE A;  3HXM A;  3THX A;  1CXU A;  1TVR A;  2GWK A;  2ZE2 A;  1VQ9 N;  2R7Y A;  4HTU A;  4AQY K;  1BCM A;  5F2R A;  4CBW A;  1JCE A;  5HRP A;  1EXQ A;  3SQ0 A;  4Y1C A;  1LWC A;  3QIP A;  3LWM A;  2O8D B;  4KB1 A;  2VG7 A;  3QIN A;  4H0O A;  5B8H A;  2ZJR L;  1QQC A;  2Q97 A;  5M1Q A;  4DUZ K;  1Y64 A;  4B8C A;  1NJI O;  4H5R A;  4H0Y B;  3ALY A;  3LP0 A;  1YI2 N;  4AHR A;  1QQM A;  2BAN A;  1BA1 A;  4ID5 A;  3C0B A;  4CJP A;  1HJR A;  4BRN A;  4R79 A;  2FBV A;  3C6T A;  1P90 A;  3AAP A;  1HYS A;  4FOE A;  4ISF A;  4KH6 A;  2CH5 A;  3CD6 N;  3ZEU A;  3U3G A;  4H03 B;  4MO4 A;  3KD1 E;  3VES A;  4HUE A;  3WXI A;  3P83 D;  3QER A;  3RSE B;  3VEZ A;  3FFK B;  3EKS A;  4DTP A;  4DLE A;  1YUW A;  3SK3 A;  3V1O A;  3CHW A;  3PIP L;  5J2P A;  3OYN A;  3WT0 A;  2RN2 A;  3ISN C;  2OPR A;  4M3Z A;  4FK2 A;  3UKU A;  3VET A;  4A59 A;  1FJG K;  4DMN A;  2GBZ A;  4CIF A;  3NHG A;  3FZK A;  4CJK A;  3AVG A;  1XHZ A;  3VQB A;  3SPY A;  4OX9 K;  3RVC A;  4DFK A;  4LY7 A;  5E84 A;  4IOA L;  2FBY A;  1N6Q A;  1A5V A;  4DQR A;  4LFA K;  3GOI A;  4JI1 K;  4BVP A;  1GLL O;  3ZEU B;  1NJY A;  1TAU A;  4ZTJ A;  2RKI A;  4CES A;  1B9F A;  1FKP A;  4UQG A;  2WON A;  3DM2 A;  4O0I A;  1SKR A;  2AJQ A;  5FLX O;  1X9S A;  5M1N A;  4FJM A;  4KHY A;  5LMU K;  4CZH A;  3KD5 E;  1TKX A;  3U9D A;  3UKU B;  1WLJ A;  3ENB A;  1VK0 A;  3HK2 A;  4CJT A;  4XH5 A;  3CFP A;  4KH4 A;  1MU2 A;  1O13 A;  1OH7 A;  4FW2 A;  2B4J A;  3OYF A;  1Z26 A;  1REV A;  3O9S A;  2VQE K;  1U4B A;  4ZTF A;  4CJW A;  2KTQ A;  4CJ4 A;  2ZGZ A;  3ENH A;  4KKO A;  3WXK A;  2IS3 A;  1ZC6 A;  1YJW N;  3FZH A;  4O8K A;  3RRG A;  4QCL A;  1QQO A;  3WNE A;  3MDQ A;  4OPJ A;  3M5R A;  4HHT A;  4CI6 A;  4CEO A;  1RT7 A;  4ILG B;  1JLF A;  3NE6 A;  4MDB A;  1IKY A;  3LDL A;  3SMS A;  4C23 A;  4DV5 K;  3HL8 A;  3R1X A;  2HW3 A;  1VQ6 N;  1TAQ A;  3THV A;  3PO5 A;  2QTD A;  1HYZ A;  4OPA A;  1MDU B;  5C15 A;  3V9W A;  2F8T A;  4HCB A;  4FVU A;  3HI0 A;  3VGM A;  1LWE A;  4OPK A;  2FBX A;  5F0X A;  5H1S Q;  2CGJ A;  3HP9 A;  1L3S A;  1WSH A;  3D7E O;  3DRP A;  4LH4 A;  3LDS A;  3U6F A;  2G8K A;  1D4X A;  4DQI A;  1BGX T;  1BOT O;  2GUI A;  4X62 K;  3LM2 A;  3K57 A;  1S72 N;  3SLC A;  3AVN A;  2Q0U A;  3H1V X;  2D0B A;  3AAQ A;  4LF4 K;  5BPL A;  3QO9 A;  5GIN A;  2KHO A;  4FSV A;  1QQN A;  4FWK A;  2YJE A;  2HST A;  4NO7 A;  4LSL A;  5MLC Q;  3MX5 A;  4BRP A;  1BA0 A;  4NYF A;  3CJA A;  3CC7 N;  1GLD G;  4H5V A;  4WF9 L;  1ZBI A;  1OKJ A;  5FPE A;  5TKY A;  2UXD K;  2UUC K;  1TUY A;  1NJZ A;  4CGD A;  4FWN A;  1TV6 A;  4MLH A;  3CCM N;  4BVO A;  4GV9 A;  3NDK A;  1C0M A;  4BDP A;  1R0A A;  1LOT B;  2HNY A;  4CJ7 A;  1KXP A;  3M1F A;  5F1X A;  3MMV A;  4E7J A;  3AO4 A;  4CFB A;  3C6H A;  1UA1 A;  3K5N A;  3ZSO A;  2OTL N;  3S3N A;  4F2S A;  3HOS A;  4FLX A;  4O5F A;  3RR7 A;  1KAY A;  5FRM A;  1S1T A;  3I55 N;  2H3G X;  4KI4 A;  4DTO A;  3N4Q A;  3QML A;  3HM9 A;  1T3V A;  3VEO A;  4CJL A;  3MN9 A;  5AQG A;  1DLO A;  1X1P A;  4J2B A;  1F21 A;  3SQ1 A;  1VQL N;  4IWV A;  4AM7 A;  3CCS N;  3AVC A;  4GMJ B;  5HP1 A;  5KRS A;  3UKR A;  1L3U A;  1TYQ A;  5HRS A;  5GAD P;  3UB5 A;  3R6M A;  3R3L A;  2OZS A;  2E1Z A;  3MN5 A;  3R8E A;  4CIE A;  5EU7 A;  2QK9 A;  3GBT A;  3BGR A;  4KHU A;  4PA1 A;  1VSL A;  2IAJ A;  4DTM A;  2CH6 A;  5AQU A;  3CM6 A;  4W5T A;  1VHX A;  3FLC O;  4A2B A;  5AFU A;  3L6Q A;  3Q7B A;  4IG0 A;  1NOZ A;  5M1O A;  4CCH A;  4JKF A;  4YHH K;  1Q7Y O;  3BF3 A;  4B8A B;  4Z94 A;  5TKW A;  4Z4E A;  1SUQ A;  2E6M A;  4IBN A;  3UIQ A;  5AR0 A;  1SZ2 A;  3CCQ N;  5J2N A;  3NF9 A;  3V9S A;  4BC5 A;  2WBN A;  3NH0 A;  4I7F A;  3QET A;  4DU4 A;  1SAZ A;  3UKR B;  3FZF A;  5M1K A;  3EE8 A;  4M63 C;  2YHX A;  3DLH A;  3CJ9 A;  2BE2 A;  1S6P A;  4FCY A;  4NXN K;  2DTU A;  4CED A;  1SQK A;  4C1N I;  3FZM A;  4I2Q A;  3PY8 A;  3ID8 A;  2QW9 A;  1SL2 A;  4DS5 A;  3DWL A;  3KLH A;  3G6E N;  1VQO N;  1YIJ N;  2VG5 A;  3P31 A;  1VQ7 N;  1X3M A;  3EKU A;  3MXI A;  1C0U A;  2NRX A;  4OJR A;  4BC4 A;  1WB9 A;  3AA2 A;  2VWK A;  2NRH A;  1RDC A;  4ILJ A;  2A1S A;  2KW4 A;  4E89 A;  3H6E A;  4B1Y B;  3AO3 A;  3SV3 A;  3VQ6 A;  3ULE A;  5JLF A;  1UOC A;  4QAG A;  1IH7 A;  4B1W B;  1DGK N;  2P9S A;  4HWI A;  3DLR A;  5KPT A;  4DKW A;  4OLB A;  1NK4 A;  1NM1 A;  1YXQ A;  2GEM A;  4FJJ A;  3OYE A;  1FKO A;  4HCC A;  3MN6 A;  3ID6 A;  1LV5 A;  4IFE A;  3KKR A;  3KVG A;  3VQ9 A;  1D8Y A;  3AVB A;  1ASW A;  4CVN E;  2W41 A;  1ZBS A;  4IDH A;  4KH5 A;  1X9J A;  4IDK A;  1T6D A;  4QS8 A;  4FLW A;  4O44 A;  1OH5 A;  3C94 A;  4FVM A;  3SBT A;  3K2P A;  4BWJ A;  1QVG M;  3NGY A;  4MFB A;  3QFP A;  3B6P A;  3VMF B;  1EX4 A;  2Y1J A;  3O08 A;  3TAE A;  3I0R A;  3ULE B;  3M8P A;  3OHR A;  1S1V A;  1VSK A;  3HP6 A;  3O80 A;  1JLQ A;  1GOC A;  2P9S B;  2HND A;  2X6S A;  4JAX A;  5AQW A;  4N56 A;  1C1A A;  1XC9 A;  1IKV A;  1IO2 A;  1X3N A;  2P5O A;  4IXC A;  4M3U A;  4W5R A;  3HRG A;  5HRR A;  3VA0 A;  3H3N O;  4DR5 K;  1OH8 A;  4M7Y A;  5CE3 A;  4CBU A;  1NK0 A;  1S3X A;  3ZCM A;  5LJV A;  1MWM A;  1VSF A;  4YOV A;  4I9Q A;  4FJ9 A;  1RBS A;  3BEX A;  3SV4 A;  2W6L A;  4CJR A;  1N36 K;  5JS2 A;  4KHQ A;  4C8N A;  3C6A A;  1X9M A;  1KFS A;  4WQ5 C;  4GY2 B;  3ZSW A;  2O8E A;  1T7P A;  5SZT A;  3VEV A;  4CJS A;  4IFV A;  1B92 A;  4AHT A;  3SUN A;  1TK8 A;  4DR2 K;  4BRI A;  1S5J A;  3T1H K;  3F9K A;  3JSM A;  3DLG A;  3W3D A;  5BN8 A;  1J6Z A;  3V81 A;  4AM6 A;  3HSC A;  3GG4 A;  3IKM A;  4F3O A;  3WXL A;  4I9L A;  4YOW A;  2VGM A;  3LZJ A;  4NCB A;  5BRF A;  3JS6 A;  1ATS A;  4A2A A;  4ZHR A;  1HR0 K;  3VQP A;  2QWM A;  3WUH A;  1NG9 A;  4DR3 K;  3TU5 A;  4FK0 A;  2WUS A;  4FLU A;  4XH1 A;  4JHD A;  3KLG A;  1RT2 A;  3V1Q A;  3LDO A;  4JI0 K;  3S3M A;  1G99 A;  2O8E B;  4F4K A;  3A5M C;  4YDU A;  3IFR A;  4G9Z A;  3OBW A;  4DHY A;  2IVO A;  2OYQ A;  4CFD A;  3N4P A;  4EFH A;  3ZT3 A;  2P5G A;  4C1N K;  3KK7 A;  3AVA A;  4KBO A;  3ZLJ A;  2WFB A;  5BRD A;  4PUO A;  4DSK A;  1TGO A;  2P1J A;  4FJH A;  3DI6 A;  1U49 A;  1JJ2 M;  1U47 A;  3OYM A;  1VRU A;  3KWI A;  4FPA A;  5DMR A;  4CF9 A;  3J80 O;  1NKE A;  2KFZ A;  1YAG A;  2YX6 A;  1LW2 A;  3PSI A;  4JS5 A;  4CJV A;  1T44 A;  5KQD A;  3LPT A;  4JHD B;  3VTI A;  1E3M A;  1YVU A;  3L2W A;  1BI4 A;  4FOI A;  1ZBL A;  1BIS A;  1EP4 A;  3J8A A;  3JXU A;  3ENO A;  4MQ3 A;  1NU0 A;  5CY4 A;  4N47 A;  4CER A;  2BDP A;  4F8R A;  3A5O C;  3LZI A;  3WNG A;  4DB3 A;  4B9S A;  4A62 A;  2ZM6 K;  3VQ7 A;  5C42 A;  4FW1 A;  4K42 A;  1J5E K;  4RW7 A;  4EHT A;  5AZJ A;  2HHT A;  1JCG A;  4J8F A;  4W5N A;  1BIU A;  4PKI A;  3KK1 A;  3T19 A;  4KB0 A;  3BZK A;  4X65 K;  5SWM A;  4Z4G A;  2FBT A;  3DJC A;  4E1J A;  3AV9 A;  3AA4 A;  2IC3 A;  2HVH A;  1RCH A;  3HM8 A;  5KQ8 A;  2UUB K;  5AQK A;  3PUF A;  1SL0 A;  3WXJ A;  3FZL A;  2V7Z A;  2HHQ A;  4M3R A;  1TL1 A;  1TL3 A;  4AF1 A;  1WAF A;  2HVI A;  2HB5 A;  2P9K A;  3MX2 A;  1RDU A;  5BR9 A;  1YIT N;  1QSL A;  1HNW K;  4FLV A;  1JLC A;  4E1M A;  1RDA A;  5AZJ B;  3OYJ A;  5C0Y A;  1YTU A;  4Q0B A;  3TTC A;  4XH4 A;  4HUG A;  4RCH A;  4DQS A;  3FR0 A;  2QWQ A;  1GLC G;  2RPI A;  4B3M K;  1XQS C;  2P9P A;  4ILH A;  3NGZ A;  5EVZ A;  3VEN A;  1KCF A;  3IS9 A;  4N41 A;  4KHS A;  3LDQ A;  4K8Z A;  3SAH A;  4BDY A;  5AQR A;  2O8B A;  3OYA A;  4IJN A;  3THX B;  4M41 A;  3GL1 A;  4DCH A;  1RT4 A;  3AA5 X;  4BRF A;  1J5O A;  4N76 A;  4Q5V A;  3HZ6 A;  4CW7 B;  2HHX A;  3QNO A;  2PFU A;  2P9K B;  2GTD A;  2I5J A;  3LDP A;  4DTX A;  1N8R O;  1HJO A;  4DU1 A;  2GWJ A;  1RT6 A;  2KLA A;  1TK5 A;  5EX5 A;  3CET A;  3E1Y A;  2ZGY A;  2VCP A;  4TSX A;  2YCH A;  2YNF A;  1LW0 A;  3VF6 A;  1IBL K;  2P9P B;  4PL7 A;  4AIL C;  3AO1 A;  4DSI A;  3B8A X;  2PY5 A;  3QIO A;  4FLT A;  3VA3 A;  4CHP A;  3TAB A;  2E2N A;  1KVB A;  4CJE A;  3OTO K;  4JN4 A;  4CEC A;  2O8B B;  1DT9 A;  2KQ2 A;  2ZF5 O;  1HRH A;  4N5S A;  1TKD A;  3LAM A;  2NNW A;  3W0L A;  1NGB A;  3SQ4 A;  2HHU A;  4KPY A;  2NLX A;  1IBK K;  2AP1 A;  3DLL L;  1HNV A;  3V6D A;  3SNN A;  2XHB A;  4M45 A;  1K8A O;  3CQX A;  5HRO A;  5DM7 L;  1D9D A;  1XWL A;  1ASU A;  1HKC A;  1JLE A;  3ZET A;  3QEW A;  4JRP A;  4CHZ A;  3OYL A;  3OJU A;  4QS7 A;  3DOK A;  3PO4 A;  5J2Q A;  2E4L A;  4BRG A;  3PX6 A;  4FWM A;  2PYJ A;  1GLJ O;  1XUP O;  1RNH A;  5ELZ A;  1BG3 A;  3JAM O;  4JKA A;  3TAQ A;  4CEB A;  4NXM K;  2QWL A;  5E26 A;  1YF5 L;  5I9E B;  4OKE A;  3TSP A;  2YNI A;  4YFU A;  4FWO A;  4Y1D A;  5AQQ A;  4FJ5 A;  3HTV A;  3MXJ A;  1VSE A;  4EP5 A;  3VOV A;  1HNZ K;  3QNN A;  3LL3 A;  5LL6 Z;  1BQM A;  4NCA A;  1ZBH A;  4JEP A;  4OKJ A;  5CZ2 A;  3S3O A;  2PZS A;  3S41 A;  5AQY A;  4A57 A;  4CGG A;  4M3Y A;  1K9M O;  4CZG A;  1RT5 A;  4YOR A;  4I6M A;  3CC4 N;  3ZT4 A;  2HOE A;  4BR2 A;  4CHO A;  1YJN N;  3CER A;  3L2U A;  1WNS A;  3KLF A;  3SMP A;  3VQC A;  5J1E A;  3ZSZ A;  4BGB A;  2DFE A;  2FC0 A;  4DU3 A;  1WN7 A;  1JL1 A;  3M8Q A;  4YDU C;  1NNE A;  1XNQ K;  3G4S N;  3HST B;  1HPM A;  4QOZ B;  4WQ5 A;  2HF4 A;  3EO3 A;  3QFU A;  5BR8 K;  4BC3 A;  1BHL A;  3MWT A;  4V19 S; 
#chains in the Genus database with same CATH homology
 2KZM A;  4CEA A;  4XIU A;  3PY8 A;  2DY4 A;  4DTR A;  2EHG A;  4E19 A;  4FLY A;  1U48 A;  1SL2 A;  1NK6 A;  1QSS A;  2G8U A;  4CK2 A;  2OZM A;  1WSG A;  2F8S A;  4DS5 A;  2KFN A;  1RTJ A;  3AVH A;  3KLH A;  1IG9 A;  1CLQ A;  3M8S A;  3TWH A;  2VG5 A;  3AO2 A;  1SKW A;  3LP3 A;  4C8K A;  1Y97 A;  4DQP A;  3CYM A;  4CF0 A;  3A2F A;  2ZD1 A;  4DFJ A;  3MXI A;  1U45 A;  4LH5 A;  1SL1 A;  1C0U A;  1RBU A;  3L3U A;  1S1U A;  4OJR A;  1RBV A;  3AA2 A;  1EKE A;  2VWK A;  3ZT2 A;  1RDC A;  1ASV A;  1GOA A;  2A1S A;  2B6A A;  3ITH A;  5E41 A;  4M3T A;  2KW4 A;  3NCI A;  4L8R B;  3L3V A;  4E89 A;  4CHY A;  3AO3 A;  3SV3 A;  3VQ6 A;  4O4G A;  1NJW A;  2G8W A;  1UOC A;  4QAG A;  4E7I A;  2ITG A;  1IH7 A;  3DYA A;  3OY9 A;  3HPH A;  1ZYQ A;  2G8I A;  3DLR A;  4ICL A;  3K5M A;  4OGC A;  4O55 A;  3WNF A;  4Z4C A;  3RMB A;  3OVN A;  4BAC A;  4OLB A;  1NK4 A;  4KTQ A;  1JLG A;  4FJJ A;  3OYE A;  1C6V A;  3CG7 A;  4Z4I A;  2YHB A;  1FKO A;  3DLE A;  3TAP A;  4HCC A;  4DSJ A;  4KHW A;  3V9X A;  5FRO A;  1LV5 A;  3E01 A;  1RTH A;  3KKR A;  3VQ9 A;  5T7B A;  4H4O A;  2Z1G A;  3AVB A;  1D8Y A;  1ASW A;  2RF2 A;  3K59 A;  4DTS A;  1XI1 A;  4JRQ A;  3DRS A;  1RDB A;  3DLK A;  3KKS A;  1DTQ A;  4CGJ A;  3OYK A;  4FJN A;  4J2E A;  4CGH A;  4IDK A;  4FLW A;  4O44 A;  3SUO A;  4FZY A;  3C94 A;  4CEE A;  2XRI A;  1CZB A;  1Z25 A;  3K2P A;  4FVM A;  2JGU A;  4BWJ A;  4BDZ A;  1BIZ A;  1NJX A;  3B6O A;  4AH9 A;  3NGY A;  4CFA A;  4MFB A;  3RMC A;  1JLA A;  3B6P A;  3TAE A;  1EX4 A;  3AO5 A;  2Y1J A;  1QSY A;  3CQ8 A;  3MXM A;  1L3V A;  3CFO A;  4GVM A;  3HYF A;  3I0R A;  2DFH A;  1A5X A;  3M8P A;  3MEC A;  1S1V A;  1VSK A;  4CF2 A;  2DFF A;  3EYZ A;  1TKZ A;  3HP6 A;  1LWF A;  4FZX C;  1JLQ A;  1NK8 A;  2XY8 A;  3OYI A;  1GOC A;  2HND A;  2X6S A;  3KIO A;  4N56 A;  1C1A A;  4CF8 A;  4F3T A;  1XC9 A;  1S6Q A;  1IKV A;  5KRT A;  1IO2 A;  4RG8 A;  3VQ4 A;  2QKK A;  3BDP A;  2Q3S A;  1YT3 A;  4BE2 A;  3VQD A;  3RMD A;  2P5O A;  1SV5 A;  1RT3 A;  1HQE A;  2Z1H A;  1C0T A;  1ZBF A;  3HPG A;  4W5R A;  3LAN A;  5HRR A;  1HPZ A;  3VA0 A;  3DMJ A;  1C1B A;  3KK2 A;  3AVK A;  2HHW A;  4E7K A;  5KGX A;  1S9E A;  2VG6 A;  3V1R A;  5JS1 A;  3IRX A;  2EX3 A;  2HNZ A;  1NK0 A;  3MEG A;  3ZCM A;  3O4N A;  1LAW A;  1S9G A;  3T1A A;  4I2Q A;  1TK0 A;  4B9U A;  1VSF A;  2ZQB A;  3TAG A;  3HJF A;  4W5O A;  4B9N A;  4I9Q A;  1RBS A;  4FJ9 A;  4RW4 A;  4CE9 A;  1ITG A;  1WSJ A;  3SV4 A;  2XY6 A;  2IDO A;  3NH1 A;  4CJR A;  4HVJ A;  4O0J A;  5DK5 A;  4FJI A;  4OKK A;  2BGG A;  5JS2 A;  4KHQ A;  4C8N A;  1A5W A;  1X9M A;  1KFS A;  4G1Q A;  3L8B A;  4PWD A;  3HXM A;  4DF4 A;  1CXU A;  1TVR A;  1KVC A;  2ZE2 A;  3ZSW A;  4DG1 A;  2R7Y A;  4HTU A;  3SJJ A;  1BCM A;  3AA3 A;  5C25 A;  5HRP A;  1EXQ A;  4E7L A;  4Y1C A;  3SQ0 A;  1LWC A;  2F96 A;  3QIP A;  1T7P A;  3D45 A;  3LWM A;  4FJX A;  2X78 A;  5SZT A;  4CEZ A;  5HRN A;  4KB1 A;  2VG7 A;  2D0C A;  1L5U A;  3QIN A;  4CJS A;  4IFV A;  1UA0 A;  1B92 A;  4AHT A;  1QQC A;  3MED A;  3SUN A;  1TK8 A;  2Z1J A;  3PX0 A;  4E7H A;  1KFD A;  4AHC A;  1S5J A;  3F9K A;  4B8C A;  1T05 A;  3JSM A;  3DLG A;  1NKC A;  1JLB A;  1QE1 A;  3KTQ A;  4FJG A;  3NBP A;  4H4M A;  4KO0 A;  3V81 A;  3LP1 A;  4LSN A;  1KVA A;  3ALY A;  1NK9 A;  4DSL A;  3LP0 A;  1RIL A;  3AVJ A;  4C8M A;  4B3O A;  4AHR A;  4F3O A;  2BAN A;  4KTZ A;  4I9L A;  4ID5 A;  4CJP A;  3OS1 A;  1HJR A;  3LZJ A;  2FBV A;  4NCB A;  2D0A A;  3C6T A;  4GW6 A;  4J2A A;  4CIG A;  1HYS A;  4ZHR A;  1Q8I A;  5I42 A;  3LP2 A;  3VQP A;  4ID1 A;  2P51 A;  3V9Z A;  4FK0 A;  3P1G A;  1Q9X A;  3U3G A;  4Z4F A;  3KD1 E;  4EZ6 A;  4FLU A;  4AHS A;  4HUE A;  2IOC A;  3P83 D;  3QER A;  4AHV A;  3KLG A;  1RT2 A;  3V1Q A;  3RTV A;  1WSI A;  4CJQ A;  4M42 A;  4DQQ A;  4PQU A;  4DTP A;  3S3M A;  3I8D A;  4DLE A;  3G0Z A;  4B9T A;  5KTQ A;  5FDL A;  4F4K A;  2Z1I A;  1DTT A;  3HVR A;  3V1O A;  2YKN A;  5J2P A;  3OYN A;  2RN2 A;  1RDD A;  4KI6 A;  4FJL A;  3LAL A;  2WOM A;  2ATQ A;  3ISN C;  3K5O A;  3NF7 A;  4CFD A;  2OPR A;  3OS2 A;  2OYQ A;  2YKM A;  4FK2 A;  4M3Z A;  3LPU A;  1IKX A;  3ZT3 A;  2P5G A;  3D0P A;  3AVA A;  4KTW A;  4CHQ A;  2HMI A;  4LD0 A;  4JS4 A;  4EP4 A;  4B9M A;  4DMN A;  2GBZ A;  1TKT A;  4CIF A;  3NHG A;  5J2M A;  4C8L A;  5HLF A;  4CJK A;  4PUO A;  4DSK A;  3AVG A;  3QEX A;  4DF8 A;  1TGO A;  2P1J A;  3VQB A;  4CFC A;  4CJF A;  3SPY A;  1XHZ A;  4FJH A;  1VSH A;  4CK3 A;  3DI6 A;  4LY7 A;  4DFK A;  1NOY A;  3TAM A;  4DSE A;  2FBY A;  1N6Q A;  1U49 A;  4PY5 A;  1A5V A;  4DQR A;  1U47 A;  3OYM A;  4CJU A;  1VRU A;  3MEE A;  5DMR A;  4B08 A;  4CF9 A;  4R5P A;  4IKF A;  2NUB A;  1NKE A;  2KFZ A;  3NF8 A;  3S9H A;  1T8E A;  1LW2 A;  1NJY A;  3SQ2 A;  1TAU A;  4ZTJ A;  4FK4 A;  2RKI A;  4JS5 A;  4CES A;  4CJV A;  3L2V A;  1B9F A;  3NAE A;  3LPT A;  1FKP A;  4UQG A;  1YVU A;  1SKS A;  3L2W A;  4K8X A;  2IGI A;  1BI4 A;  2WON A;  1ZBL A;  1BIS A;  3DM2 A;  1CZ9 A;  1EP4 A;  1UWB A;  1QTM A;  3SCX A;  3CM5 A;  4O0I A;  1YTA A;  4MQ3 A;  4CER A;  5CY4 A;  4N47 A;  1SKR A;  2AJQ A;  2BDP A;  1X9S A;  4F2R A;  4F8R A;  1KTQ A;  3WNG A;  3TR8 A;  4B9S A;  4CJ3 A;  4Z0U A;  1S1X A;  3VQ7 A;  3TAF A;  5C42 A;  3JYT A;  4FJM A;  4KHY A;  4FW1 A;  3KD5 E;  1TKX A;  5K14 A;  5KGW A;  4E3S A;  1JXB A;  1WLJ A;  3AVL A;  4RW7 A;  2HHT A;  1VK0 A;  3HK2 A;  4CJT A;  4W5N A;  1D9F A;  1KLM A;  3CFP A;  1B9D A;  3QES A;  1BIU A;  1MU2 A;  3HVT A;  3KK1 A;  3T19 A;  3VQ8 A;  1L3T A;  2E6L A;  3SUP A;  4KB0 A;  3K5L A;  4FM1 A;  1W9H A;  1HNI A;  3O3F A;  3RRH A;  1LAV A;  4FW2 A;  3QEV A;  4IG3 A;  5SWM A;  5C24 A;  4Z4G A;  2B4J A;  2FBT A;  3AV9 A;  3AA4 A;  3OYF A;  1Z26 A;  4HUF A;  1REV A;  2YNG A;  5D3G A;  2IC3 A;  1BCO A;  2HVH A;  1RCH A;  3CFR A;  4CHN A;  1S1W A;  1IKW A;  3HT3 A;  1U4B A;  1NK7 A;  4ZTF A;  3EY1 A;  4CJW A;  2KTQ A;  1JXE A;  4CJ4 A;  4KKO A;  3PUF A;  1SL0 A;  2IS3 A;  3ZSY A;  2HHQ A;  3NFA A;  3RRG A;  4M3R A;  1TL1 A;  1TL3 A;  3V9U A;  3WNE A;  1O1W A;  4OPJ A;  4DFP A;  4QCL A;  4O5B A;  4HHT A;  3V4I A;  3P5J A;  2O4I A;  4CEO A;  4B9L A;  1WAF A;  3U3Y A;  1RT7 A;  4E0D A;  1JLF A;  2HVI A;  2HB5 A;  3O4Q A;  3C6U A;  3NE6 A;  1RT1 A;  3QEP A;  1IKY A;  1QSL A;  3ZT1 A;  4FLV A;  1HMV A;  2X74 A;  3AVF A;  4KHN A;  1JLC A;  3RWU A;  1EET A;  4E1M A;  1BQN A;  3O3H A;  5CYQ A;  1RDA A;  4W5Q A;  3NGI A;  3HL8 A;  4FLZ A;  1Q9Y A;  3OYJ A;  2HW3 A;  1TAQ A;  3ZSQ A;  2ETJ A;  3THV A;  3VN5 A;  3PO5 A;  1YTU A;  4Q0B A;  4FM2 A;  3SUQ A;  4OLA A;  3WNH A;  3K58 A;  4HUG A;  4FXD A;  1X9W A;  1HYZ A;  4DLG A;  4DQS A;  3V9W A;  2F8T A;  2RPI A;  4FM0 A;  2YHA A;  3ZSV A;  1I3A A;  3QLH A;  3TI0 A;  3QEI A;  2Y1I A;  4HCB A;  4KRE A;  1G15 A;  3KK3 A;  1GOB A;  3NGZ A;  3T3F A;  1KCF A;  1WSF A;  3IS9 A;  1LWE A;  3OYC A;  4OPK A;  3OJS A;  4N41 A;  4CGF A;  2FBX A;  4KHS A;  3HP9 A;  1C1C A;  1WSH A;  3ZSX A;  3DRP A;  4LH4 A;  3LDS A;  1L3S A;  4K8Z A;  3U6F A;  1KSP A;  2G8K A;  4KRF A;  1D5A A;  2QXF A;  3F73 A;  1BGX T;  4BDY A;  4DQI A;  2GUI A;  3K57 A;  2OPQ A;  2YNH A;  4JLH A;  3OYA A;  3EZ5 A;  4NYN A;  3AVN A;  4M41 A;  5I3U A;  1VRT A;  1VSD A;  4FJ8 A;  1RT4 A;  2D0B A;  3AA5 X;  2G8H A;  1XHX A;  4DSF A;  1J5O A;  4N76 A;  1VSM A;  3QO9 A;  4Q5V A;  2HHX A;  3QNO A;  3IG1 A;  2XY7 A;  4KV8 A;  2I5J A;  1FXX A;  2B5J A;  4DTX A;  1KLN A;  4LSL A;  3ZSR A;  4NYF A;  3NF6 A;  2OA8 A;  4DU1 A;  1ZBI A;  4KFB A;  1RT6 A;  1TK5 A;  2X6N A;  4C8O A;  3AVI A;  2G8F A;  1NJZ A;  4CGD A;  4TSX A;  2YNF A;  1LW0 A;  1TV6 A;  4YNQ A;  4AHU A;  4FJK A;  3MAQ A;  4AIL C;  3NDK A;  1W0H A;  3AO1 A;  2HHV A;  2G8V A;  5KI6 A;  2HHS A;  4DSI A;  4FJ7 A;  1K6Y A;  4RW6 A;  2PY5 A;  5FRN A;  3G10 A;  1C0M A;  3QIO A;  4DTU A;  4FLT A;  3VA3 A;  4CHP A;  3SPZ A;  4BDP A;  1R0A A;  3DRR A;  3TAB A;  1BL3 A;  4ELV A;  3VQ5 A;  1KVB A;  2HNY A;  4CJE A;  2PYL A;  1J53 A;  4CEQ A;  4E7J A;  4CEC A;  5HBM A;  2KQ2 A;  3AO4 A;  1HRH A;  4CFB A;  4N5S A;  1VSI A;  1UA1 A;  3LAM A;  1TKD A;  3K5N A;  4I2P A;  1T03 A;  1QHT A;  3AVM A;  3SQ4 A;  3ZSO A;  2HHU A;  3S3N A;  4KPY A;  4BE0 A;  4NCG A;  1WSE A;  4CEF A;  3V6D A;  1HNV A;  4F2S A;  3OYD A;  3OYH A;  1WAJ A;  4FLX A;  2XHB A;  3SNN A;  4M45 A;  2XO7 A;  4RW9 A;  4WE1 A;  3RR7 A;  1CXQ A;  2A1R A;  5HRO A;  3M8R A;  1D9D A;  1XWL A;  2O4G A;  1ASU A;  5FRM A;  1S1T A;  3KLE A;  4M3U A;  1JLE A;  1RTI A;  4CF1 A;  4KI4 A;  4DTO A;  3RMA A;  4BWM A;  3QEW A;  4JRP A;  3HM9 A;  4CHZ A;  2OPS A;  3SZ2 A;  1RTD A;  3OYL A;  3OJU A;  4DTJ A;  1HYV A;  3DOK A;  3PO4 A;  3HPO A;  5J2Q A;  2E4L A;  3PX6 A;  3L2Q A;  3IAY A;  2GV9 A;  2PYJ A;  4CJL A;  1RNH A;  1DLO A;  1X1P A;  4J2B A;  4ELT A;  1F21 A;  4B9V A;  4E1N A;  3SQ1 A;  3TAQ A;  4CEB A;  4FYD A;  3SYZ A;  2YV0 X;  4KAZ A;  1JL2 A;  3OS0 A;  4FZZ A;  2W42 A;  4DTN A;  3AVC A;  3ASM A;  4GMJ B;  4OKE A;  5CYM A;  5HP1 A;  2YNI A;  5KRS A;  1VSJ A;  4YFU A;  1L3U A;  3KJV A;  1I39 A;  5HRS A;  4Y1D A;  3VQQ A;  4FJ5 A;  3RR8 A;  4M3X A;  1RBT A;  3MXJ A;  1KRP A;  3NH2 A;  2OZS A;  3PX4 A;  4CIE A;  4BE1 A;  1VSE A;  5EU7 A;  2QK9 A;  2D5R A;  4EP5 A;  1BI4 B;  3QNN A;  3BGR A;  4KHU A;  1BQM A;  1VSL A;  2IAJ A;  4PA1 A;  4DTM A;  4DFM A;  3O3G A;  4NCA A;  4CJ5 A;  3L2R A;  3HO1 A;  1ZBH A;  4DS4 A;  3CM6 A;  4W5T A;  1J54 A;  3OYB A;  4OKJ A;  5CZ2 A;  3S3O A;  3I0S A;  2PZS A;  1N5Y A;  4CGG A;  3KLI A;  4M3Y A;  2QKB A;  4IG0 A;  1NOZ A;  4CCH A;  3TAN A;  3LAK A;  1RT5 A;  1NK5 A;  2VWJ A;  4B8A B;  4Z4E A;  4H8K A;  1ZBU A;  4J2D A;  3ZT4 A;  1SUQ A;  2E6M A;  1U04 A;  4IBN A;  5CZ1 A;  3ULD A;  4DWI A;  3UIQ A;  4Z4H A;  4M3W A;  3ZT0 A;  5J2N A;  1UAX A;  3NF9 A;  3V9S A;  1J9A A;  1FK9 A;  4CHO A;  2OPP A;  3PV8 A;  3NH0 A;  3L2U A;  1WNS A;  4I7F A;  3KLF A;  4EZ9 A;  3VQC A;  4OVL A;  5J1E A;  1QS4 A;  3ZSZ A;  4DU4 A;  2DFE A;  2FC0 A;  3QET A;  4CK1 A;  4DU3 A;  1WN7 A;  1HQU A;  4RW8 A;  3TAR A;  1JL1 A;  3M8Q A;  1RBR A;  3VQA A;  3OYG A;  2XY5 A;  3DLB A;  4ELU A;  3VQE A;  3HST B;  3DLH A;  3LWL A;  2BE2 A;  2LSN A;  4QOZ B;  3H08 A;  3SI6 A;  1S6P A;  4FCY A;  3FFI A;  2DTU A;  4CED A;  3C95 A;  4CGI A;  1NKB A;  2JLE A;  2KZZ A;  1BHL A;  4IFY A;  3LZI A;  3DOL A;  4OGE A;  1JKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...