4LD0A

T. thermophilus ruvc in complex with holliday junction substrate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
166
structure length
158
Chain Sequence
MVVAGIDPGITHLGLGVVAVEGALKARLLHGEVVKTSPQEPAKERVGRIHARVLEVLHRFRPEAVAVQEQFFYRQNELAYKVGWALGAVLVAAFEAGVPVYAYGPMQVKQALAKEEVALMVRGILGLKEAPRPSHLADALAIALTHAFYARMGTAKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Crossover junction endodeoxyribonuclease RuvC
publication title Crystal structure of RuvC resolvase in complex with Holliday junction substrate.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase/dna
total genus 49
structure length 158
sequence length 166
chains with identical sequence B
ec nomenclature ec 3.1.22.4: Crossover junction endodeoxyribonuclease.
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02075 RuvC Crossover junction endodeoxyribonuclease RuvC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ld0A00
3F9KA 4CF8A 3LP0A 3KD5E 2GBZA 5EU7A 3IAYA 3RRGA 3NHGA 4CHPA 1JLCA 3DLRA 1EETA 3WNGA 4HUFA 5HROA 1DTQA 4ID5A 3SUNA 4KV8A 1Q8IA 4LD0A 4FLZA 3QEXA 5C24A 3KTQA 4O0IA 2HNZA 5CY4A 4CIEA 1EKEA 3ZSYA 2G8VA 1IKYA 1RDAA 4CF0A 1WAFA 3NF7A 4CJWA 1NK4A 3CM5A 3V1OA 3L8BA 1IG9A 4DTMA 4EP5A 4KHYA 3SV3A 3V9ZA 3MXMA 4KHUA 3CG7A 4CHQA 4BE0A 4PUOA 3AVFA 3TR8A 4KB0A 3V1RA 3C94A 4W5QA 1J5OA 1S1VA 2YV0X 2OYQA 1NOYA 1L3SA 2OA8A 4E7HA 2O4IA 1SV5A 3JSMA 4CJRA 1XC9A 3TAGA 2IGIA 3LWMA 2EX3A 3S9HA 2VG7A 4CEQA 3NE6A 2X74A 3SQ1A 3CFPA 1HYVA 4FJGA 1CLQA 1YVUA 3QEPA 2DY4A 4JS4A 1GOAA 2ITGA 2W42A 1SL1A 2P5GA 1Q9YA 4GVMA 3P1GA 3AVCA 3DYAA 3HO1A 1JL1A 4CEOA 1S9EA 5FRNA 3AO5A 5HRPA 4RW4A 5KGWA 2B6AA 3THVA 1Z26A 5KTQA 4KO0A 1A5WA 3L3VA 5FRMA 3HYFA 3AA3A 3C6UA 4FM0A 4DF4A 3VQ5A 1J9AA 1WSHA 4E7KA 4IG3A 4CFBA 3V9UA 3VA3A 3SJJA 2FBYA 1TKDA 4DSKA 1NK5A 2Z1IA 3OYNA 1FXXA 1KVAA 4CHYA 1L3TA 4YFUA 4QOZB 1TKXA 4CEDA 1C0MA 1XHZA 4Z4FA 4RW9A 1ZBIA 2Z1GA 1U47A 3VN5A 3HP6A 3L3UA 2KW4A 4BWJA 3OYJA 4KHNA 1NOZA 2FC0A 1ZBUA 2OPPA 3EY1A 1X9WA 4FLVA 1NKEA 3TAPA 4Z4IA 1XWLA 2P51A 3TAFA 4DWIA 3K2PA 3RRHA 3ZSOA 4JLHA 4CJLA 2KTQA 4DSLA 5HRRA 4CK1A 4EP4A 4KB1A 2KFNA 1KFDA 3O3GA 4HCBA 3ZCMA 3RR7A 4CCHA 1SUQA 1U4BA 4B9SA 2F8SA 2KQ2A 1LAWA 4B9TA 4M3ZA 3AA5X 4DFJA 3PO5A 1CXUA 1LV5A 4FLYA 2Z1HA 3DLGA 4CJEA 3NGIA 1QSLA 4B9MA 3P83D 4MFBA 1FKPA 3PX4A 3KK1A 4C8OA 2DFFA 1BIUA 4E1NA 3HK2A 2YNIA 1S1UA 1G15A 3RMBA 3HPHA 4FLXA 3AV9A 4OKJA 1TKZA 2GUIA 2D0BA 4PWDA 2QXFA 4OKKA 1JLEA 4ZHRA 4C8KA 4B9LA 3AVGA 4CJUA 4I7FA 5J2NA 3CFOA 1TAQA 3NF6A 4DU4A 1JL2A 1ASUA 4DQIA 2IC3A 2ZD1A 4FZYA 1LAVA 1RILA 4BACA 5K14A 3ALYA 4O5BA 1KSPA 3WNEA 1A5VA 3B6OA 3ZSWA 1JXEA 4M3RA 3HP9A 3SQ4A 4EZ9A 2HHXA 4LY7A 4KI6A 3HXMA 3VQQA 1A5XA 5HBMA 3OYMA 3I8DA 3SV4A 4DSJA 3OYDA 3AO3A 3VQ8A 4OPJA 4BE1A 4KTZA 2YNHA 4W5OA 3TABA 3SNNA 5FDLA 4F8RA 3AVJA 1QSYA 4DS4A 2FBTA 3K59A 3QETA 4B9NA 1RDDA 4CJ5A 2HVHA 3VQ6A 3NH2A 3K57A 1WLJA 2YHAA 3S3MA 4CK2A 4DSFA 4CJQA 4FJJA 4Z4GA 4BWMA 1RDBA 1VSHA 4F2RA 3ZT3A 2G8UA 4AHVA 2OPQA 3KLGA 1TK8A 4M3YA 4IG0A 5SWMA 4B9UA 1C1CA 4KKOA 2QKBA 1IKVA 1IO2A 2E6LA 3LDSA 4N76A 3VQ9A 2HW3A 1S1TA 5T7BA 3PO4A 1QQCA 3MXJA 5D3GA 4DTNA 2G8IA 1TGOA 3DMJA 2X78A 4CEFA 3K58A 1U48A 4C8MA 2HNDA 4CESA 3OYKA 3KJVA 1VSKA 2HMIA 4M42A 1Y97A 3NCIA 3ZT1A 2RN2A 1UAXA 4CGJA 4HVJA 3IG1A 3AVIA 3K5OA 3RWUA 2P5OA 4OVLA 3VQBA 1L3VA 4C8LA 4DF8A 4DS5A 1UWBA 4CE9A 3NGZA 3VQAA 1BHLA 3TARA 1TV6A 1S1XA 2B5JA 5C42A 3O3FA 2HB5A 3L2WA 4FJNA 3QEVA 1NJYA 4DQQA 1U45A 3S3OA 1U04A 3MEEA 1HJRA 4KFBA 5C25A 4DTSA 3QNOA 1F21A 1K6YA 1HMVA 3AVKA 4AHSA 3V4IA 4F3OA 4M3UA 4Q0BA 2HHTA 4ZTJA 1RBTA 1JLQA 4DLEA 3OJUA 4HUEA 1JLGA 4LSLA 5DMRA 3ZSVA 1VRUA 2IS3A 4E7IA 4FJ7A 1GOBA 4FK2A 1L5UA 5J2PA 4KHSA 1HQUA 4CJ4A 2Q3SA 4N5SA 4DTXA 2X6SA 3DLHA 4W5NA 4DTRA 3QNNA 3LWLA 3ITHA 4XIUA 3LP3A 3SI6A 3S3NA 4CJ3A 4FW1A 4CJTA 1RT4A 3MECA 3OS1A 2WONA 1W9HA 3OS0A 1RT6A 3M8SA 1ZBLA 1N5YA 1HQEA 5KRSA 3NH0A 2OPSA 1QS4A 3DLKA 3DRRA 1RTIA 3PX0A 1NJXA 2FBXA 2YKMA 4DFPA 3OYLA 1JXBA 3AVAA 1JLFA 2XY6A 1T7PA 4M3TA 1U49A 4H8KA 4UQGA 4HHTA 1RCHA 1S9GA 4O44A 3DOKA 4CIGA 4FVMA 1ASWA 1D9FA 4M45A 3KKRA 1UOCA 3HM9A 4AILC 1Q9XA 3QIPA 4LSNA 3KK3A 4FZZA 2BGGA 2YNGA 4NYFA 4Z0UA 4OPKA 4BE2A 1I39A 3F73A 1RT2A 2ZQBA 1BIZA 2ATQA 4FJ8A 3ZT0A 1TVRA 1NKBA 3HVTA 5CYMA 4CJKA 1VSMA 4FLTA 4HTUA 3PUFA 1ITGA 4ELTA 1VRTA 3QEWA 1YT3A 4FJMA 1RBRA 3OYAA 2XY7A 5FROA 3D45A 1S1WA 3KLFA 1S6QA 3ULDA 1XI1A 2F8TA 1C0TA 3PX6A 3AVBA 3ZT2A 4DLGA 2KFZA 1X9SA 2HHVA 3HL8A 4B8AB 4CF1A 3DRSA 2D5RA 1FKOA 4CF9A 3AVNA 1SL2A 2R7YA 1RBSA 1EX4A 4GW6A 3CYMA 3QO9A 2XY8A 3LZJA 3VA0A 4IDKA 3RMCA 1WN7A 1ZBHA 4L8RB 1RT5A 2HHWA 1JKHA 4CGFA 4IBNA 4B08A 2YNFA 2IDOA 1WSIA 3BDPA 1DTTA 3ISNC 4M3WA 4KAZA 4OJRA 4FJLA 1ZBFA 1TL1A 3AVMA 4QAGA 3P5JA 1R0AA 1VSFA 3DI6A 2ZE2A 3NF9A 4JS5A 5SZTA 4W5TA 1TK0A 2OZMA 5CZ2A 3SUPA 3M8RA 5HP1A 1XHXA 1KRPA 4OLAA 2IAJA 1IKWA 4I9LA 2FBVA 1J53A 4DTOA 1ZYQA 5HRNA 1BI4A 4KPYA 1VSEA 3V81A 4BDPA 4Z4EA 2DTUA 1KFSA 3TAEA 4ICLA 3SQ2A 1FK9A 3WNFA 1T05A 4RW8A 4PQUA 1X1PA 1NKCA 4MQ3A 4O0JA 1BCOA 4FCYA 2PYJA 2VWKA 4JRQA 4I2PA 2KZZA 1VK0A 2E6MA 2E4LA 4Z4CA 3U6FA 4CGHA 3RTVA 5CYQA 1RT3A 2G8HA 4CHOA 1NK8A 3ZSZA 1D8YA 5KRTA 2AJQA 1VSJA 3RMDA 3AA2A 3OS2A 4F2SA 1B92A 4NYNA 3FFIA 2DFEA 3KIOA 4DQRA 3K5LA 4IFYA 4DTUA 1NJWA 2EHGA 3DLBA 1X9MA 4JRPA 4DSEA 3OYBA 2XO7A 4DG1A 3HPOA 4CHNA 4RW6A 4R5PA 4KI4A 1ASVA 1CZ9A 3T3FA 1HRHA 1NK7A 3BGRA 3VQPA 4Q5VA 1RBUA 3HVRA 3OYGA 2ETJA 4LH5A 2RPIA 2JGUA 3EZ5A 3QERA 1QE1A 4CHZA 1T8EA 2Y1JA 3PV8A 3SUQA 2BDPA 3OY9A 3UIQA 2G8WA 2PY5A 4BDZA 1QSSA 4OGEA 2Y1IA 2O4GA 3O3HA 1BISA 4CEAA 3V9WA 2G8FA 1NJZA 4CEZA 4J2BA 3NF8A 4AHRA 1KCFA 3IRXA 1D9DA 3SQ0A 3LANA 4H4OA 4CFAA 1WSJA 1WAJA 3L2QA 1LW0A 3VQEA 2D0AA 3O4NA 4DSIA 3ZT4A 1VSLA 3U3YA 4KRFA 1IH7A 2DFHA 5HLFA 4EZ6A 4CECA 4CEEA 2RKIA 1BQMA 2HHQA 1JLBA 3NDKA 2YHBA 3SYZA 4KTQA 4RG8A 3LP2A 4FYDA 3SPZA 3OVNA 3V1QA 1RBVA 4RW7A 3KLEA 4M3XA 2LSNA 1SKRA 3U3GA 3A2FA 3ZSQA 1BI4B 3D0PA 4K8ZA 5J2QA 4PA1A 3KLHA 4N56A 1B9FA 1C1AA 1C0UA 2XHBA 4DTJA 5I3UA 4B9VA 4FJXA 2JLEA 4CGDA 3OYHA 3MXIA 4WE1A 3DRPA 5DK5A 3QINA 4KREA 3M8PA 4DU1A 1LWEA 1VSIA 3L2RA 1HYZA 2HHUA 4FM1A 4B8CA 4OLBA 4AHCA 3OYFA 4GMJB 3RR8A 5E41A 4Y1CA 1L3UA 2B4JA 2HVIA 3ZSXA 1TL3A 4E3SA 1TKTA 2NUBA 1REVA 4E19A 1S5JA 2XRIA 3V9XA 1B9DA 4CEBA 3V9SA 2QKKA 2QK9A 1MU2A 4J2DA 4NCAA 4CGGA 2VG5A 4E7LA 3E01A 1BGXT 1HPZA 3AO4A 5HRSA 4CGIA 3RMAA 2PZSA 4E89A 1SKSA 4HCCA 4ID1A 1HYSA 5CZ1A 2GV9A 4N47A 4ELVA 2G8KA 3H08A 4FJIA 1YTUA 5I42A 1J54A 3LAMA 5JS2A 3K5NA 3OYIA 4J2EA 2P1JA 4FM2A 5KGXA 4FJKA 4FXDA 3SCXA 1QHTA 3NBPA 3TI0A 1Z25A 1CXQA 3L2UA 3G0ZA 3AO1A 1WSGA 3O4QA 3SPYA 4K8XA 1RT1A 1N6QA 4FJHA 1LW2A 2A1SA 3KKSA 3NH1A 4OKEA 4NCBA 4CIFA 3C95A 5KI6A 3TAMA 3SUOA 4J2AA 2OPRA 3LPTA 4CJPA 1W0HA 3QESA 2XY5A 3T19A 3VQ4A 3WNHA 1RDCA 3OYEA 4FLUA 1RNHA 4O55A 4CJSA 4FJ5A 3LPUA 4C8NA 4YNQA 3TANA 1NK9A 2HNYA 3LALA 3HT3A 3SZ2A 4KHQA 3T1AA 2HHSA 3TAQA 1HNVA 5J2MA 4FW2A 3LP1A 4Z4HA 1TAUA 2KZMA 1KLMA 2BE2A 1KVBA 4CJFA 3ZSRA 4LH4A 3DOLA 4FZXC 2D0CA 4F3TA 3CQ8A 5JS1A 4CERA 3KK2A 1RT7A 3AVHA 4DMNA 4CFCA 3HJFA 2VG6A 3IS9A 1HNIA 1RTJA 2F96A 3OYCA 1C1BA 4E7JA 3PY8A 3NFAA 1QTMA 2X6NA 4PY5A 3I0RA 2OZSA 3MAQA 3M8QA 2IOCA 1BL3A 1KVCA 4M41A 4ELUA 4IKFA 4CK3A 3VQCA 4O4GA 4QCLA 4OGCA 3V6DA 1NK0A 1BQNA 4KTWA 2VWJA 3DM2A 3OJSA 4HUGA 1WSFA 3MEGA 3AA4A 4F4KA 4FK4A 2I5JA 1LWCA 2YKNA 4AH9A 3I0SA 3QIOA 4DFMA 3ASMA 4FK0A 3VQ7A 1TK5A 1UA1A 2Z1JA 1BCMA 4B3OA 3DLEA 3L2VA 1S6PA 4ZTFA 3QEIA 5J1EA 1NK6A 4FLWA 1JLAA 4NCGA 4KHWA 4I2QA 4H4MA 3VQDA 4DFKA 4DQSA 3LZIA 2A1RA 3HPGA 1CZBA 4TSXA 3JYTA 3K5MA 1LWFA 1WNSA 1UA0A 4CJVA 1GOCA 1C6VA 1EXQA 3AVLA 3KLIA 1I3AA 1WSEA 4CFDA 4AHTA 1T03A 4W5RA 1KLNA 3B6PA 3LAKA 4CF2A 3HSTB 4DQPA 4AHUA 1EP4A 4E1MA 1YTAA 1IKXA 3NGYA 1RTDA 1SL0A 4G1QA 3EYZA 3KD1E 3CM6A 3C6TA 4DU3A 4E0DA 3AO2A 1SKWA 1DLOA 2PYLA 4IFVA 4Y1DA 2WOMA 2RF2A 3CFRA 3QLHA 1O1WA 3TWHA 1D5AA 3MEDA 2BANA 4BDYA 1RTHA 4DTPA 4FJ9A 3G10A 4N41A 4I9QA 3NAEA 1KTQA 1VSDA
chains in the Genus database with same CATH superfamily
3LP0A 5EU7A 3QFUA 3P31A 1EETA 5HROA 2E5LK 3SUNA 2VGNA 4LD0A 4FLZA 5C24A 2NNWA 1IKYA 1NK4A 3WXKA 3L8BA 1IG9A 4DTMA 3VGLA 3CG7A 4BE0A 3TR8A 2IIRA 4KB0A 3C94A 1J5OA 2YHXA 4FWOA 1L3SA 4E7HA 5AQOA 1SV5A 3CIPA 2X74A 3SQ1A 2DY4A 1BA0A 2W42A 3EN9A 1Q9YA 2UU9K 3AVCA 3VGKA 3HO1A 4DV6K 5FRNA 4B1ZA 3SBGA 3THVA 1Z26A 1N33K 1A5WA 5FRMA 3C6UA 4DF4A 4WFBL 1J9AA 4IG3A 4BRKA 4DSKA 4FL9A 3D6RA 3VA3A 2NRTA 2Z1IA 3Q7CA 5GAGP 1FXXA 1KVAA 5GADP 4QOZB 1TKXA 1ZBIA 3ZEUB 2KHOA 4CW7B 4BWJA 2FC0A 2OPPA 1ZBUA 1X9WA 4FLVA 5AQGA 2P51A 3K2PA 2P9IB 3GDQA 3SLCA 5HRRA 3CJ7A 4KB1A 1KFDA 1GLAG 4HCBA 2ZJRL 1SUQA 2KQ2A 3UKRB 3ZYYX 4M3ZA 1DT9A 1LV5A 1YITN 3BP8A 3MX5A 1ILYA 3P83D 3PX4A 5BPLA 2QA4N 3A0IX 3HK2A 1IBKK 1S1UA 4BRDA 3RMBA 1EWRA 4OO1J 2GUIA 4PWDA 1JLEA 1TYQA 3QMLA 3G71N 3CFOA 4AF1A 4DU4A 1JL2A 2P9SA 1BWFO 1ATSA 3UE5A 4B1UB 1KSPA 1A5VA 3B6OA 3ZX0A 1JXEA 4M3RA 5CHIA 4LY7A 1SZ2A 3E9OA 3OYDA 3AO3A 5AQHA 3VQ8A 4BE1A 4KTZA 4UY8O 3MDQA 4X66K 3O6WA 3K59A 5BREA 1RDDA 3VQ6A 3AY9A 1T6CA 3KHYA 2E2QA 1RDBA 4F2RA 1NGAA 4AHVA 4IG0A 1IO2A 3HSCA 5FLXO 2G8IA 4DTNA 1U48A 2OTJN 4A5AA 3SBTA 1VSKA 2HMIA 4M42A 2RN2A 1LCUA 4PL7A 4CGJA 1OVYA 4OVLA 1E4GT 2QI2A 4FWLA 2PAVA 1UWBA 4GV6A 1TV6A 1S1XA 3O3FA 2DPNA 3L2WA 4NXNK 1NJYA 1U04A 2ZGYA 4DTSA 3VEVA 4CD1A 2UUCK 3AVKA 4JEPA 4M3UA 3D2EA 1JLQA 3OJUA 5DMRA 3KVGA 4E7IA 5J2PA 1HQUA 3C6AA 2ZF5O 1NM1A 2HBLA 3ITHA 3ULEA 4BC4A 4CJTA 1RT4A 3OS1A 3OS0A 3M8SA 1RT6A 3FR0A 1HQEA 3O1BA 4CZMA 3DLKA 3E9LA 3DRRA 1NJXA 2YKMA 1JXBA 3AVAA 3ID6A 1JLFA 4X64K 1T7PA 2VYPA 1RCHA 4O44A 3DOKA 1ASWA 2BGGA 3HM9A 3KK3A 1I39A 4JK8A 4FJ8A 1V4SA 1TVRA 3HVTA 4XH1A 5AQKA 4FJMA 2XY7A 2P9LB 3K9KA 5FROA 5C10A 2F8TA 3ULDA 1XI1A 4DLGA 5IWAK 1G99A 2HHVA 3IKMA 3DRSA 4CF9A 2R7YA 3VESA 4H0YB 3RMCA 4H03B 5MLCQ 1ZBHA 4L8RB 4CGFA 4B08A 1C0FA 4JI7K 4KAZA 1XMOK 1ZBFA 3DI6A 5SZTA 3SUPA 5HP1A 1XHXA 4IOCL 4I9LA 1IKWA 3CCJN 1KC8O 3TSPA 5HRNA 4BDPA 3MCPA 3SQ2A 1T05A 1K8AO 4PQUA 1NGJA 4IFEA 5LJVA 4AQYK 5HOOA 4O0JA 4K41A 4JRQA 4I2PA 1S72N 3U6FA 1RT3A 2G8HA 1VSJA 3OS2A 4U7BA 2NZTA 3VERA 4DQRA 2CGKA 4DTUA 3NVMA 1X9MA 4DSEA 3OYBA 3HPOA 3MMVA 2FSKA 1WB9A 4R5PA 5LL6Z 4JYAK 4JI8K 2E8AA 3BGRA 5AZJB 4Q5VA 4LH5A 3EZ5A 2JGUA 1QE1A 3QBXA 2PY5A 4BDZA 1FW6A 3SMPA 3O3HA 4JI2K 4J2BA 4JN4A 1WBBA 3L2QA 5BR9A 3VQEA 2D0AA 3O4NA 3ZT4A 1QQOA 5JVHL 5HLFA 4EZ6A 4PKIA 4IOAL 3DXMB 3JXUA 4KTQA 1FJGK 3VEYA 3O4WA 4RW7A 4JKEA 2P9IA 5M1FA 4I6MB 1SKRA 3ZSQA 1BI4B 3UKRA 4PA1A 3KLHA 4N56A 4FJXA 4LFBK 2XHBA 4DTJA 5JLFA 5F2RA 3DRPA 5DK5A 1XMQK 3TSUA 1LWEA 4FM1A 5E41A 4H0XB 1L3UA 2B4JA 2Q0UA 3A5MC 4CEBA 3V9SA 1GLCG 4CGGA 2VG5A 1BGXT 3AO4A 3RMAA 1VQMN 2PZSA 4ID1A 4N47A 2OTLN 1VQ9N 2G8KA 4A2BA 1YTUA 4O5FA 1J54A 3OYIA 4FM2A 4FXDA 4Y0WA 3SCXA 1E4FT 1YXQA 1N8RO 3TI0A 1CXQA 2KLAA 1RT1A 3BF3A 4FJHA 3KKSA 4B1VA 3WQTA 4NCBA 4CIFA 5KI6A 3TAMA 3CQYA 3HOSA 2QEXN 3QESA 4WFAL 3CMEN 3OYEA 4FLUA 1RNHA 5AQQA 4E1JA 4BROA 4BVPA 4JHDB 4YNQA 1HNZK 3CC4N 1GLDG 1NGEA 2HNYA 3HT3A 4YOUA 3TAQA 3O1WA 1YJNN 5BR8K 3I8BA 1TAUA 1OH8A 5GIPA 3ZSRA 2QWRA 3CQ8A 5JS1A 3KK2A 1HNIA 5GAEP 2A40A 1NG9A 3I0RA 3UKUB 2GTDA 3HOTA 3M1FA 3EKSA 1BQNA 2VWJA 3GL1A 3OJSA 2I5JA 4DV0K 3ENOA 1YIJN 4MO4A 4IWVA 4B1WB 4H5NA 2F4VK 1TK5A 1UA1A 2YHYA 2Z1JA 2VGMA 3T1HK 3QEIA 1NK6A 4FLWA 2O8DB 3LZIA 2A1RA 1UA0A 1CZBA 4H5VA 4JK7A 4TSXA 2CH6A 2VQEK 3CHWA 4DR7K 4KH5A 4CZFA 1KLNA 3VGMA 4WQ5A 4H0OA 2H3GX 4E1MA 4BGBA 1IKXA 1S3XA 3EYZA 3VEWA 3KD1E 4BY9C 2CGLA 1SS6A 4DKWA 2RF2A 1RTHA 1NGFA 2VQFK 4FJ9A 3G10A 3FLCO 3NAEA 4I9QA 4AM6A 2P9LA 4H5TA 2ZM6K 3KD5E 3IAYA 2F9WA 5CE3A 2D0PA 1DTQA 4ID5A 3KTQA 2HNZA 5CY4A 3ZSYA 4CZEA 1RDAA 2PFUA 4BRMA 1JJ2M 4EP5A 1VQ6N 4KHYA 1K9MO 2O8EB 1S1VA 1NOYA 4DUYK 2OA8A 2O4IA 1YJWN 2FF3B 1OVQA 3TPQA 2IGIA 2PBDA 2EX3A 3S9HA 3NE6A 4MDBA 3VETA 1YVUA 4DV5K 4JS4A 1GOAA 3I56N 3LM2A 1J5EK 1JL1A 3CJAA 4A59A 2F7TA 4LF8K 4JI6K 3HM8A 3HYFA 4YOVA 4JK9A 3V9UA 2FBYA 4CHYA 1QQMA 4CI6A 4RW9A 1GLLO 3VN5A 3L3UA 3DAWA 3CCRN 1NOZA 3SJHA 5AZJA 1XWLA 3TAFA 4DWIA 5ADXA 3ZSOA 4CJ7A 1BG3A 4CK1A 1YI2N 3ZCMA 1Q82O 1U4BA 4B9SA 2F8SA 4BG9A 3AA5X 1TUYA 4FLYA 3D7EO 3NGIA 1QSLA 1OH5A 3GG4A 4NXMK 2ASPA 4BRIA 4DR2K 4B3TK 1DKGD 3HPHA 3AV9A 4H0TB 4K43A 3K9JA 2D0BA 3M5RA 4B9LA 1X3NA 3CCVN 2QM1A 4DQIA 2IC3A 5EY4A 4FZYA 4I6MA 1JCFA 3ALYA 3WNEA 4FSVA 3F9MA 4LFCK 4M63C 3OYMA 3I8DA 4OPJA 3ZLJA 3CMAN 4BC3A 2A42A 5FDLA 3AAQA 1QSYA 4DS4A 3A5NC 4IJAA 3K57A 4A2AA 2A3ZA 4FJJA 4CK2A 4Z4GA 3ZT3A 4M3YA 3KLGA 1TK8A 4BG8A 2Q97A 3VQ9A 3THWA 3AGKA 2HW3A 5T7BA 3MXJA 1TGOA 5DM7L 4G9ZA 3CPEA 2FLOA 4CEFA 2IVOA 3O9UA 4JD2B 3KJVA 3CPWM 2NRWA 4HVJA 5KPZA 1L3VA 4C8LA 4WQ4C 5C0YA 5AQWA 3LDQA 4DS5A 4DF8A 2GX9A 3VQAA 4XH5A 2B5JA 1XQSC 4FJNA 3QEVA 4BRQA 1U45A 4WYBA 1HJRA 3QNOA 1NGHA 1NMNA 5AZIA 3VENA 4F3OA 2O8BB 4ZTJA 2I7PA 3JS6A 4DLEA 4LSLA 2WC9A 4FJ7A 1S22A 1GOBA 1TUUA 2YI1A 5IT9O 2P9UA 3FGUA 3EE8A 4N5SA 4DR3K 4W5NA 4B3SK 3SI6A 4XIUA 1U2VA 4CJ3A 4FW1A 3UKUA 2WONA 5KRSA 3NH0A 1RTIA 3PIPL 3PX0A 4DFPA 3OYLA 1IBLK 4UQGA 3LDLA 4GVEA 3A5OC 1Q9XA 3QIPA 2YNGA 4FWRA 4NYFA 4PHTX 4R79A 3PLAA 2JWKA 4K25A 3O9RA 3WUHA 4CVNE 1VSMA 4QS8A 4C1NK 2O8DA 1VRTA 2W6LA 1VQKN 1S6QA 2KFZA 5TKWA 5FPEA 1NBWA 5AQXA 1YF5L 2D5RA 1FKOA 1EX4A 3CYMA 3E1YA 4B1XB 3VA0A 1JKHA 1NMDA 1NU0A 5AQLA 3ISNC 4QAGA 2NLXA 2ZE2A 3NF9A 4K42A 1XNRK 5C15A 3M8RA 1KRPA 4OLAA 3H1QA 3LDNA 4BC5A 5AQIA 4DTOA 3VEOA 4KPYA 1VSEA 3V81A 4MO5A 5AFUH 3O9SA 1FK9A 4CZGA 4RW8A 3N4PA 4MQ3A 3DLLL 5JVGL 4FCYA 3DXKB 2Q1NA 2VWKA 4OX9K 1VK0A 2E6MA 1K8KB 4CGHA 1Y64A 5CYQA 1YVNA 3TTCA 1NK8A 3WXIA 3RMDA 1MDUB 3AA2A 2F9TA 4NO7A 4LF6K 2O8EA 4NYNA 3KIOA 3K5LA 1NJWA 3SAGA 2EHGA 2XO7A 3QB0A 4DQ8A 4NLBA 1HRHA 1V4TA 3OYGA 2RPIA 3QERA 4H0VB 4CHZA 1K73O 3PV8A 3PSFA 5AQFA 2OCEA 4GY2B 4M7XA 2A6AA 1NJZA 3CI5A 4AHRA 3IRXA 5I9EB 3THYA 3NVKA 3SQ0A 4BRCA 3LANA 4H4OA 4YHHK 1WSJA 1WAJA 3ZETB 1Z6RA 3VF4A 1IH7A 2P9PB 2FF6A 4JI5K 4LFAK 5KQ8A 4CEEA 1BQMA 3NDKA 3SYZA 4ISFA 5E26A 2KKZA 4RG8A 3LP2A 4WQ5C 3T7ZA 3SPZA 4M3XA 1QVGM 3U3GA 2YJEA 3D0PA 4K8ZA 1X9JA 3VMFB 1C0UA 5I3UA 3ATUA 3MXIA 5BPNA 5A2QO 3L2RA 1HYZA 2AA4A 4OLBA 4AHCA 3OYFA 2NRHA 4GMJB 2HVIA 3ZSXA 1TL3A 4E3SA 1REVA 2XRIA 2QKKA 2QK9A 4J2DA 1BDGA 3E01A 3MN5A 4RWTA 4CGIA 1HJOA 5M1QA 4HCCA 2YHWA 4JNEA 5AFUA 1HR0K 4HTLA 2E2NA 4J2EA 2P1JA 2BTFA 3BUZB 1Z25A 3L2UA 2E20A 3R1XA 3G0ZA 3O4QA 3SPYA 1YHQN 2UXDK 3DJCA 4IOXA 1LW2A 2E2OA 3SUOA 3LPTA 1GLEG 3VQ4A 2XY5A 3DWLA 3SMSA 4DR6K 3CCMN 4O55A 4C8NA 1KQSM 4FPAA 2HHSA 1HNVA 4FW2A 3MN9A 4IEIA 1QVFM 3KK7A 1KLMA 3ENHA 1KVBA 3KZBA 4CJFA 5AQTA 4FZXC 1GLBG 2D0CA 1ESVA 5M1PA 3WEEB 4CERA 4DMNA 3HJFA 2VG6A 2F96A 3CC2N 3PY8A 1KVCA 4M41A 4IKFA 4CK3A 3H3NO 4YY3K 1X3MA 3V6DA 1NK0A 4KTWA 3BZKA 4HUGA 3MEGA 4IXCA 4F4KA 2O8BA 1LWCA 2YKNA 3I0SA 4DFMA 2HBMA 1KAZA 3L2VA 3BEXA 4LF5K 2CGJA 4XEIA 5J1EA 3N4QA 2OANA 1IG8A 4NCGA 4FOEA 3VQDA 3VTIA 4NB4A 1C6VA 2E88A 3AVLA 4PL8A 3KLIA 5JLHA 3FZFA 1SAZA 2JWLA 4LC9B 3LAKA 4AHUA 1EP4A 1YTAA 3NGYA 1NGCA 2V7YA 1SL0A 3EL2A 1U6ZA 3CM6A 3C6TA 4FPBA 4O8KA 3A8YA 4E0DA 3AO2A 1SKWA 4IFVA 3ZEUA 3RSEB 1VHXA 1D5AA 3MEDA 2BANA 4BDYA 2YX6A 3PSIA 3F9KA 1VSDA 5BRHA 1HLUA 2YCHA 3OA9A 4EAHD 3NHGA 1N34K 4O0IA 4BR9A 4CIEA 2G8VA 1EKEA 3VOVA 3MCAB 3QICA 1WAFA 3NF7A 4CJWA 4YOWA 2WFBA 2ASOA 2FSJA 3R9PA 4CHQA 3FZMA 5AQYA 2YV0X 3CC7N 4DB3A 3J80O 5E84A 4CJRA 3JSMA 1XC9A 5AQMA 4U67L 3TAGA 2VG7A 5KQDA 1HYVA 4FJGA 1CLQA 3QEPA 4DUZK 3ATVA 1EWQA 1SL1A 2P5GA 4GVMA 3P1GA 3DYAA 4CEOA 1S9EA 3DXKA 5HRPA 4RW4A 5KGWA 1K8KA 2B6AA 2E1YA 4QS9A 4HWIA 5KTQA 4KO0A 3AA3A 2GWJA 3VQ5A 5DM6L 2E2PA 3SJJA 4E7KA 4CFBA 1TKDA 4WFNL 1NK5A 3BY5A 1L3TA 4YFUA 4CEDA 1XHZA 4Z4FA 1ZC6A 3GBTA 3WXJA 1U47A 3OYJA 4KHNA 4BRFA 4Z4IA 4CJLA 2KTQA 4MDAA 4DSLA 4H5RA 1MWMA 4ILJA 4DV3K 1LAWA 3PO5A 3U9DA 4B9MA 4FWKA 4MFBA 1FKPA 3KK1A 5BN9A 5HL7L 3ZETA 3C0BA 4E1NA 1G15A 3T1YK 2P9PA 4IZ9A 4FLXA 1OH7A 1T3VA 2QXFA 4OKKA 4C8KA 4ZHRA 3RVCA 3AVGA 4GNIA 4I7FA 4CJUA 5J2NA 2HMPA 2RE2A 1VQON 3R3LA 4ILGB 5GIOA 3CD6N 5F0XA 2O8CB 5C2DA 1LAVA 4BACA 4O5BA 3CETA 3G6EN 3ZSWA 2QWLA 3O9QA 4BR7A 3HXMA 3VQQA 1A5XA 4IEEA 4BR2A 4DSJA 3SV4A 2YNHA 1R59O 3TABA 4F8RA 3HZ6A 3J7YP 1DGKN 4DV1K 4CJ5A 4O8UA 4DSFA 4CJQA 1VSHA 4DV4K 2G8UA 2OPQA 4B9UA 4KKOA 2QKBA 2ZWHA 1IKVA 4N76A 1S1TA 4KBOA 2P9NB 1KAYA 4IO8A 2X78A 4YDUA 3K58A 4C8MA 2HNDA 2W6KA 3J81O 3OYKA 1BA1A 2ASMA 1Y97A 3W3DA 4NLCA 1UAXA 4V19S 3IUCA 3AVIA 3CF5L 2P5OA 1XNQK 3FE1A 1YJ9N 3H3OB 4CE9A 1BHLA 3C7NB 3MN6A 1RDUA 2HB5A 4DQQA 3QBWA 1F21A 1K6YA 1HMVA 1TYQB 1RBTA 1VQPN 4CBWA 4HUEA 2P9SB 1JLGA 3ZSVA 4FK2A 2IS3A 4KHSA 1L5UA 3MN7A 4BREA 4IDHA 3WEEA 4CJ4A 2Q3SA 4DTXA 2X6SA 5EXWA 3LWLA 3LP3A 1VQ7N 1D9FA 1W9HA 1ZBLA 2OPSA 3CQXA 1QS4A 2QWQA 2A41A 5BN8A 4M3TA 4HHTA 1W7AA 5C2FA 1XC3A 4M45A 4AILC 4FZZA 4LSNA 4H0PA 4Z0UA 3LL3A 4J8FA 4OPKA 5CR4A 3F73A 2GWKA 4B3MK 1T6DA 5CYMA 1C0GA 4CJKA 4FLTA 3G4SN 4ELTA 1ITGA 1YAGA 3QEWA 1RBRA 3OYAA 4CBUA 1NNEA 3D45A 4BRPA 3KLFA 1C0TA 1GLFO 3PX6A 3AVBA 2BUPA 4JV5K 1X9SA 4DV2K 4B8AB 1RBSA 4X65K 3ZX2A 2WBNA 4EFHA 4GW6A 3TU5A 1WN7A 4H5WA 1YUWA 3R8EA 3DXMA 3RSEA 1WSIA 3BDPA 1DTTA 3H46O 4OJRA 3P5JA 3M3ZA 1R0AA 1J6ZA 2OZMA 1QHAA 5AQPA 3ULEB 2IAJA 1BI4A 4Z4EA 3TAEA 4ICLA 3WNFA 3CCLN 1X1PA 2PYJA 4EHUA 2KZZA 4Z4CA 2E4LA 3RTVA 1Q86O 4K0KK 5KRTA 4CD3A 5AQRA 4F2SA 3FZHA 2DFEA 1QQNA 4IFYA 1HPMA 5LJWA 3DLBA 5AJ3K 4JRPA 4JKDA 4JKAA 4RW6A 4KI4A 3T3FA 1CZ9A 4GKJK 4KHPK 2QW9A 2ETJA 4YOTA 5KPTA 3CJ9A 1T8EA 2BDPA 2Y1JA 3OY9A 3UIQA 1QSSA 4OGEA 2I7NA 5BRDA 1BISA 4CEZA 3NF8A 1KCFA 4CFAA 1LW0A 4JKHA 1VSLA 3U3YA 4KRFA 2DFHA 5AQVA 4CECA 2IVPA 4JHDA 3TSQA 3VF2A 2HHQA 1JLBA 4FYDA 2Q2RA 1RBVA 3KLEA 3O80A 1HKGA 2LSNA 2QTDA 3FFKB 5J2QA 4PKGA 1B9FA 1Q81O 1C1AA 2HHHK 2JLEA 4CGDA 3OYHA 5H1SQ 1VSIA 3J8AA 3MX2A 4B8CA 3RR8A 4Y1CA 1RFQA 1TKTA 4E19A 1S5JA 3V9XA 1MU2A 4NCAA 1HPZA 1HNXK 2O8CA 4E89A 1SKSA 1HYSA 3CJ1A 2GV9A 3IDHA 3CCSN 3H08A 4FJIA 5I42A 3LAMA 4FJKA 4A61A 1QHTA 1P90A 1D4XA 3AO1A 1WSGA 4GV9A 4DV7K 1N6QA 4CBXA 3NH1A 2A1SA 4EHTA 1Z05A 2QXLA 3C95A 4J2AA 1W0HA 1NJIO 3T19A 3WNHA 4A62A 4CJSA 4FJ5A 5LY3A 3LPUA 4B1YB 3TANA 4KHQA 2P9NA 3T1AA 1N36K 3KWIA 3LP1A 3HRGA 4LH4A 3I33A 3DOLA 5EVZA 4IO9L 5BPMA 1H1VA 2D1KA 3IS9A 4E7JA 1C1BA 1QTMA 4PY5A 2X6NA 3MAQA 4PKHA 2IOCA 1BL3A 4ELUA 3OBWA 2V52B 3VQCA 3C7NA 4FWMA 4OGCA 3DM2A 1WSFA 3AA4A 4FWPA 3H45C 4AH9A 3QIOA 3ASMA 4FK0A 1ATNA 3VQ7A 4RCHA 4B3OA 2UYTA 1WUAA 3EZWA 1NGIA 4ZTFA 4LF4K 3CERA 1JLAA 3ID8A 4IJNA 4KHWA 1GLJO 4FWSA 3HPGA 3K5MA 1LWFA 1HNWK 2AP1A 1RGIA 3SK3A 4DR4K 1I3AA 3CCUN 1BOTO 1T03A 2QWOA 2ITMA 4W5RA 1MWKA 5KPRA 3B6PA 1M90O 4F9OA 1ATRA 3HSTB 4DQPA 1RTDA 4G1QA 3SAFA 1WBDA 4JKBA 2PYLA 4Y1DA 3TWHA 1EO1A 4DTPA 1HX1A 5LMNK 4N41A 3W0LA 3FFIA 4CF8A 2GBZA 3RRGA 3HI0A 4CHPA 1JLCA 3DLRA 3WNGA 4HUFA 3FZKA 3H1VX 4KV8A 1Q8IA 3QEXA 4XH4A 4CF0A 4YDUC 3CM5A 3V1OA 3LM9A 1NLVA 4MLEA 2W40A 3SV3A 3V9ZA 4JI4K 3MXMA 4FO0A 4KHUA 4PUOA 1SQKA 3AVFA 3V1RA 2ZJQL 4W5QA 2OYQA 3CCEN 1DEJA 4BQLA 5AR0A 4BRGA 4WCEL 2IVNA 3LWMA 3GE1A 3E9PA 3WXMB 4CEQA 2FXUA 3CFPA 3BF1A 2HSTA 1HKCA 2ITGA 3I55N 5FPMA 2HBKA 3THXB 3KWGA 4JI3K 3AO5A 5FPDA 3L3VA 4FM0A 4JKCA 3T69A 4JKFA 3B8AX 1WSHA 3C6HA 1IJJA 3OYNA 4LF9K 2D0OA 1E3MA 5F1XA 1C0MA 3FZLA 2Z1GA 2QWNA 5AQNA 1W97L 4C1NI 3TTDA 2KW4A 4A57A 3HP6A 1OH6A 3EY1A 3L0QA 1NKEA 3TAPA 3OTOK 4BRNA 3RRHA 4JLHA 4JD2A 3K0SA 2KFNA 2HF4A 4EP4A 4BQZA 3O3GA 3RR7A 4CCHA 4B9TA 4DFJA 1CXUA 4FWNA 2Z1HA 1JCGA 3DLGA 4CJEA 1I94K 4BRHA 2HBJA 5B8HA 4C8OA 2DFFA 1EQYA 1BIUA 5BRFA 1Q18A 1NGGA 2YNIA 4DR5K 5AQUA 2J4RA 3M6GA 4OKJA 3WQUA 1TKZA 5M1NA 3NF6A 1TAQA 4DCHA 1CZAN 3D2FB 1ASUA 2ZD1A 1RILA 5K14A 4BR0A 4CZIA 2HHXA 3SQ4A 3HP9A 4EZ9A 4KI6A 3Q7BA 5HBMA 4W5OA 3SNNA 3AVJA 2RHKA 2FBTA 3QETA 4B9NA 4YOYA 2HVHA 3NH2A 1WLJA 2YHAA 3S3MA 3TTFA 3J7AP 4BWMA 3U4LA 1ZXOA 3O5BA 1NWKA 5AQSA 4YORA 5SWMA 1C1CA 3ZX3A 4WQ4A 3R6MA 2E6LA 3LDSA 4BRAA 3PO4A 1QQCA 5D3GA 3DMJA 4RTFD 3C65A 3CJBA 3HTVA 4CZKA 1VQLN 2GEMA 4CESA 3MK6A 3OW2M 4LF7K 3NCIA 3ZT1A 3RWUA 3P39A 3IG1A 3K5OA 5M1OA 5TKYA 3VQBA 5AQZA 2BH1A 3NGZA 2UUBK 3TARA 5C42A 3S3OA 4KFBA 3MEEA 4FOIA 3IMXA 5C25A 4X62K 4AHSA 3V4IA 4Q0BA 2HHTA 2Q31A 4L3QA 2NRZA 4YOXA 3ENBA 3L6QA 1VRUA 4KH4A 3HBTA 3VPZA 4CZHA 3NMUA 2O8FB 3F2KA 3DLHA 4DTRA 2P9KB 1LOTB 3QNNA 3S3NA 1T44A 2GUPA 2HF3A 3MECA 1N5YA 1WOQA 5LMUK 3E66A 1JCEA 2FBXA 2V51B 2XY6A 1U49A 2E1ZA 4H8KA 3AAPA 1NGBA 4DR1K 1S9GA 1VQ8N 5ELZA 4JKGB 1M1KO 2FSNA 4CIGA 1ZBSA 4FVMA 3KKRA 1UOCA 4DHYA 4Z94A 4ISGA 3THWB 4BE2A 3OHRA 1BUPA 1RT2A 2ZQBA 1BIZA 2ATQA 3ZT0A 1NKBA 3WXLA 3QDKA 3LDPA 3PUFA 4HTUA 3P4IA 4M7YA 1YT3A 3L4QA 5FPNA 3UB5A 1S1WA 1HUXA 3VEZA 4BC2A 3ZT2A 4BRLA 2W41A 2V7ZA 1OKJA 3HL8A 4CF1A 1VQNN 4JAXA 1SL2A 3AVNA 5AZIB 3QO9A 2XY8A 3LZJA 4IDKA 1RT5A 2HHWA 5JICA 4IBNA 2YNFA 3MWTA 2IDOA 4M3WA 1KXPA 2VCPA 4FJLA 4WF9L 2YJFA 1TL1A 3AVMA 1VSFA 2P9UB 4OPAA 4JS5A 2UXBK 4W5TA 1TK0A 5CZ2A 3O9TA 2UUAK 1U2VB 2FBVA 1J53A 1ZYQA 5M1KA 2NRXA 4GKKK 5C12A 1Q7YO 1KFSA 2DTUA 2Q36A 5JMVA 1NKCA 2Q0RA 2ZJPL 1HKBA 1BCOA 3QFPA 2ZGZA 4EIAA 3EKUA 4CHOA 3ZSZA 1D8YA 3EE9A 2AJQA 4JI1K 1B92A 4OPHA 3SAHA 3JAMO 3LDOA 4DG1A 3WT0A 1BU6O 4CHNA 4FVUA 4B3RK 4MLHA 3PIOL 1ASVA 4BVOA 1NK7A 3VQPA 2QWMA 1RBUA 3HVRA 1MA9B 3MWPA 3THXA 3SUQA 2G8WA 2EWSA 5ADXH 2Y1IA 2O4GA 4CEAA 3V9WA 2G8FA 1D9DA 4DSIA 3IFRA 3G25A 3VF6A 3CCQN 2RKIA 2D4WA 1VQ5N 2YHBA 3L4IA 3OVNA 3V1QA 3AARA 3A2FA 2WUSA 3AGRA 1KD1O 1QZ5A 1XUPO 3EO3A 3J7ZO 4B9VA 2NRVA 3A5LC 2GELA 4WE1A 1RDWX 1IBMK 3QINA 4KREA 3M8PA 4DU1A 1NGDA 4GV3A 2HHUA 3O8MA 2NUBA 1B9DA 2HOEA 4E7LA 3D2FA 3OBYA 5EX5A 5HRSA 5CZ1A 4ELVA 4AM7A 5JS2A 3K5NA 4JI0K 3VTHA 5KGXA 3NBPA 4K8XA 3VEXA 3THYB 4OKEA 1W2BM 2QWPA 4B9QA 2OPRA 4CJPA 1VAZA 3U9ZA 1RDCA 3BZCA 2UXCK 1NK9A 4ISEA 3LALA 3D2EB 3SZ2A 5J2MA 4Z4HA 2KZMA 2BE2A 4F3TA 3U8XA 1BO5O 1RT7A 3AVHA 1O13A 4CFCA 1RTJA 3GOIA 3OYCA 3NFAA 2OZSA 3M8QA 5EOYA 4QS7A 4O4GA 3EEQA 4QCLA 3P38A 5GAHP 4FK4A 1IV0A 4BR5A 5AQJA 1VQ4N 1BCMA 3DLEA 1S6PA 2O8FA 3F5TA 2A5XA 4BR4A 2P9KA 4I2QA 4H4MA 4DFKA 2CH5A 4C23A 4CZJA 4DQSA 3JYTA 3CXCM 1WNSA 4CJVA 1GOCA 1EXQA 1QZ6A 2NRRA 4A5BA 4BGAA 2VWBA 1WSEA 4CFDA 4AHTA 3S41A 4CF2A 2WTUA 5GINA 3O08A 4CZLA 1N32K 4JKGA 1KAXA 3CJCA 4KH6A 4DU3A 1DLOA 4ILHA 3H6EA 2WOMA 3CFRA 3QLHA 1O1WA 1P8ZA 4FWQA 1KTQA
chains in the Genus database with same CATH topology
3F9KA 4CF8A 3LP0A 3KD5E 2GBZA 5EU7A 3IAYA 3RRGA 3NHGA 4CHPA 1JLCA 3DLRA 1EETA 3WNGA 4HUFA 5HROA 1DTQA 4ID5A 3SUNA 4KV8A 1Q8IA 4LD0A 4FLZA 3QEXA 5C24A 3KTQA 4O0IA 2HNZA 5CY4A 4CIEA 1EKEA 3ZSYA 2G8VA 1IKYA 1RDAA 4CF0A 1WAFA 3NF7A 4CJWA 1NK4A 3CM5A 3V1OA 3L8BA 1IG9A 4DTMA 4EP5A 4KHYA 3SV3A 3V9ZA 3MXMA 4KHUA 3CG7A 4CHQA 4BE0A 4PUOA 3AVFA 3TR8A 4KB0A 3V1RA 3C94A 4W5QA 1J5OA 1S1VA 2YV0X 2OYQA 1NOYA 1L3SA 2OA8A 4E7HA 2O4IA 1SV5A 3JSMA 4CJRA 1XC9A 3TAGA 2IGIA 3LWMA 2EX3A 3S9HA 2VG7A 4CEQA 3NE6A 2X74A 3SQ1A 3CFPA 1HYVA 4FJGA 1CLQA 1YVUA 3QEPA 2DY4A 4JS4A 1GOAA 2ITGA 2W42A 1SL1A 2P5GA 1Q9YA 4GVMA 3P1GA 3AVCA 3DYAA 3HO1A 1JL1A 4CEOA 1S9EA 5FRNA 3AO5A 5HRPA 4RW4A 5KGWA 2B6AA 3THVA 1Z26A 5KTQA 4KO0A 1A5WA 3L3VA 5FRMA 3HYFA 3AA3A 3C6UA 4FM0A 4DF4A 3VQ5A 1J9AA 1WSHA 4E7KA 4IG3A 4CFBA 3V9UA 3VA3A 3SJJA 2FBYA 1TKDA 4DSKA 1NK5A 2Z1IA 3OYNA 1FXXA 1KVAA 4CHYA 1L3TA 4YFUA 4QOZB 1TKXA 4CEDA 1C0MA 1XHZA 4Z4FA 4RW9A 1ZBIA 2Z1GA 1U47A 3VN5A 3HP6A 3L3UA 2KW4A 4BWJA 3OYJA 4KHNA 1NOZA 2FC0A 1ZBUA 2OPPA 3EY1A 1X9WA 4FLVA 1NKEA 3TAPA 4Z4IA 1XWLA 2P51A 3TAFA 4DWIA 3K2PA 3RRHA 3ZSOA 4JLHA 4CJLA 2KTQA 4DSLA 5HRRA 4CK1A 4EP4A 4KB1A 2KFNA 1KFDA 3O3GA 4HCBA 3ZCMA 3RR7A 4CCHA 1SUQA 1U4BA 4B9SA 2F8SA 2KQ2A 1LAWA 4B9TA 4M3ZA 3AA5X 4DFJA 3PO5A 1CXUA 1LV5A 4FLYA 2Z1HA 3DLGA 4CJEA 3NGIA 1QSLA 4B9MA 3P83D 4MFBA 1FKPA 3PX4A 3KK1A 4C8OA 2DFFA 1BIUA 4E1NA 3HK2A 2YNIA 1S1UA 1G15A 3RMBA 3HPHA 4FLXA 3AV9A 4OKJA 1TKZA 2GUIA 2D0BA 4PWDA 2QXFA 4OKKA 1JLEA 4ZHRA 4C8KA 4B9LA 3AVGA 4CJUA 4I7FA 5J2NA 3CFOA 1TAQA 3NF6A 4DU4A 1JL2A 1ASUA 4DQIA 2IC3A 2ZD1A 4FZYA 1LAVA 1RILA 4BACA 5K14A 3ALYA 4O5BA 1KSPA 3WNEA 1A5VA 3B6OA 3ZSWA 1JXEA 4M3RA 3HP9A 3SQ4A 4EZ9A 2HHXA 4LY7A 4KI6A 3HXMA 3VQQA 1A5XA 5HBMA 3OYMA 3I8DA 3SV4A 4DSJA 3OYDA 3AO3A 3VQ8A 4OPJA 4BE1A 4KTZA 2YNHA 4W5OA 3TABA 3SNNA 5FDLA 4F8RA 3AVJA 1QSYA 4DS4A 2FBTA 3K59A 3QETA 4B9NA 1RDDA 4CJ5A 2HVHA 3VQ6A 3NH2A 3K57A 1WLJA 2YHAA 3S3MA 4CK2A 4DSFA 4CJQA 4FJJA 4Z4GA 4BWMA 1RDBA 1VSHA 4F2RA 3ZT3A 2G8UA 4AHVA 2OPQA 3KLGA 1TK8A 4M3YA 4IG0A 5SWMA 4B9UA 1C1CA 4KKOA 2QKBA 1IKVA 1IO2A 2E6LA 3LDSA 4N76A 3VQ9A 2HW3A 1S1TA 5T7BA 3PO4A 1QQCA 3MXJA 5D3GA 4DTNA 2G8IA 1TGOA 3DMJA 2X78A 4CEFA 3K58A 1U48A 4C8MA 2HNDA 4CESA 3OYKA 3KJVA 1VSKA 2HMIA 4M42A 1Y97A 3NCIA 3ZT1A 2RN2A 1UAXA 4CGJA 4HVJA 3IG1A 3AVIA 3K5OA 3RWUA 2P5OA 4OVLA 3VQBA 1L3VA 4C8LA 4DF8A 4DS5A 1UWBA 4CE9A 3NGZA 3VQAA 1BHLA 3TARA 1TV6A 1S1XA 2B5JA 5C42A 3O3FA 2HB5A 3L2WA 4FJNA 3QEVA 1NJYA 4DQQA 1U45A 3S3OA 1U04A 3MEEA 1HJRA 4KFBA 5C25A 4DTSA 3QNOA 1F21A 1K6YA 1HMVA 3AVKA 4AHSA 3V4IA 4F3OA 4M3UA 4Q0BA 2HHTA 4ZTJA 1RBTA 1JLQA 4DLEA 3OJUA 4HUEA 1JLGA 4LSLA 5DMRA 3ZSVA 1VRUA 2IS3A 4E7IA 4FJ7A 1GOBA 4FK2A 1L5UA 5J2PA 4KHSA 1HQUA 4CJ4A 2Q3SA 4N5SA 4DTXA 2X6SA 3DLHA 4W5NA 4DTRA 3QNNA 3LWLA 3ITHA 4XIUA 3LP3A 3SI6A 3S3NA 4CJ3A 4FW1A 4CJTA 1RT4A 3MECA 3OS1A 2WONA 1W9HA 3OS0A 1RT6A 3M8SA 1ZBLA 1N5YA 1HQEA 5KRSA 3NH0A 2OPSA 1QS4A 3DLKA 3DRRA 1RTIA 3PX0A 1NJXA 2FBXA 2YKMA 4DFPA 3OYLA 1JXBA 3AVAA 1JLFA 2XY6A 1T7PA 4M3TA 1U49A 4H8KA 4UQGA 4HHTA 1RCHA 1S9GA 4O44A 3DOKA 4CIGA 4FVMA 1ASWA 1D9FA 4M45A 3KKRA 1UOCA 3HM9A 4AILC 1Q9XA 3QIPA 4LSNA 3KK3A 4FZZA 2BGGA 2YNGA 4NYFA 4Z0UA 4OPKA 4BE2A 1I39A 3F73A 1RT2A 2ZQBA 1BIZA 2ATQA 4FJ8A 3ZT0A 1TVRA 1NKBA 3HVTA 5CYMA 4CJKA 1VSMA 4FLTA 4HTUA 3PUFA 1ITGA 4ELTA 1VRTA 3QEWA 1YT3A 4FJMA 1RBRA 3OYAA 2XY7A 5FROA 3D45A 1S1WA 3KLFA 1S6QA 3ULDA 1XI1A 2F8TA 1C0TA 3PX6A 3AVBA 3ZT2A 4DLGA 2KFZA 1X9SA 2HHVA 3HL8A 4B8AB 4CF1A 3DRSA 2D5RA 1FKOA 4CF9A 3AVNA 1SL2A 2R7YA 1RBSA 1EX4A 4GW6A 3CYMA 3QO9A 2XY8A 3LZJA 3VA0A 4IDKA 3RMCA 1WN7A 1ZBHA 4L8RB 1RT5A 2HHWA 1JKHA 4CGFA 4IBNA 4B08A 2YNFA 2IDOA 1WSIA 3BDPA 1DTTA 3ISNC 4M3WA 4KAZA 4OJRA 4FJLA 1ZBFA 1TL1A 3AVMA 4QAGA 3P5JA 1R0AA 1VSFA 3DI6A 2ZE2A 3NF9A 4JS5A 5SZTA 4W5TA 1TK0A 2OZMA 5CZ2A 3SUPA 3M8RA 5HP1A 1XHXA 1KRPA 4OLAA 2IAJA 1IKWA 4I9LA 2FBVA 1J53A 4DTOA 1ZYQA 5HRNA 1BI4A 4KPYA 1VSEA 3V81A 4BDPA 4Z4EA 2DTUA 1KFSA 3TAEA 4ICLA 3SQ2A 1FK9A 3WNFA 1T05A 4RW8A 4PQUA 1X1PA 1NKCA 4MQ3A 4O0JA 1BCOA 4FCYA 2PYJA 2VWKA 4JRQA 4I2PA 2KZZA 1VK0A 2E6MA 2E4LA 4Z4CA 3U6FA 4CGHA 3RTVA 5CYQA 1RT3A 2G8HA 4CHOA 1NK8A 3ZSZA 1D8YA 5KRTA 2AJQA 1VSJA 3RMDA 3AA2A 3OS2A 4F2SA 1B92A 4NYNA 3FFIA 2DFEA 3KIOA 4DQRA 3K5LA 4IFYA 4DTUA 1NJWA 2EHGA 3DLBA 1X9MA 4JRPA 4DSEA 3OYBA 2XO7A 4DG1A 3HPOA 4CHNA 4RW6A 4R5PA 4KI4A 1ASVA 1CZ9A 3T3FA 1HRHA 1NK7A 3BGRA 3VQPA 4Q5VA 1RBUA 3HVRA 3OYGA 2ETJA 4LH5A 2RPIA 2JGUA 3EZ5A 3QERA 1QE1A 4CHZA 1T8EA 2Y1JA 3PV8A 3SUQA 2BDPA 3OY9A 3UIQA 2G8WA 2PY5A 4BDZA 1QSSA 4OGEA 2Y1IA 2O4GA 3O3HA 1BISA 4CEAA 3V9WA 2G8FA 1NJZA 4CEZA 4J2BA 3NF8A 4AHRA 1KCFA 3IRXA 1D9DA 3SQ0A 3LANA 4H4OA 4CFAA 1WSJA 1WAJA 3L2QA 1LW0A 3VQEA 2D0AA 3O4NA 4DSIA 3ZT4A 1VSLA 3U3YA 4KRFA 1IH7A 2DFHA 5HLFA 4EZ6A 4CECA 4CEEA 2RKIA 1BQMA 2HHQA 1JLBA 3NDKA 2YHBA 3SYZA 4KTQA 4RG8A 3LP2A 4FYDA 3SPZA 3OVNA 3V1QA 1RBVA 4RW7A 3KLEA 4M3XA 2LSNA 1SKRA 3U3GA 3A2FA 3ZSQA 1BI4B 3D0PA 4K8ZA 5J2QA 4PA1A 3KLHA 4N56A 1B9FA 1C1AA 1C0UA 2XHBA 4DTJA 5I3UA 4B9VA 4FJXA 2JLEA 4CGDA 3OYHA 3MXIA 4WE1A 3DRPA 5DK5A 3QINA 4KREA 3M8PA 4DU1A 1LWEA 1VSIA 3L2RA 1HYZA 2HHUA 4FM1A 4B8CA 4OLBA 4AHCA 3OYFA 4GMJB 3RR8A 5E41A 4Y1CA 1L3UA 2B4JA 2HVIA 3ZSXA 1TL3A 4E3SA 1TKTA 2NUBA 1REVA 4E19A 1S5JA 2XRIA 3V9XA 1B9DA 4CEBA 3V9SA 2QKKA 2QK9A 1MU2A 4J2DA 4NCAA 4CGGA 2VG5A 4E7LA 3E01A 1BGXT 1HPZA 3AO4A 5HRSA 4CGIA 3RMAA 2PZSA 4E89A 1SKSA 4HCCA 4ID1A 1HYSA 5CZ1A 2GV9A 4N47A 4ELVA 2G8KA 3H08A 4FJIA 1YTUA 5I42A 1J54A 3LAMA 5JS2A 3K5NA 3OYIA 4J2EA 2P1JA 4FM2A 5KGXA 4FJKA 4FXDA 3SCXA 1QHTA 3NBPA 3TI0A 1Z25A 1CXQA 3L2UA 3G0ZA 3AO1A 1WSGA 3O4QA 3SPYA 4K8XA 1RT1A 1N6QA 4FJHA 1LW2A 2A1SA 3KKSA 3NH1A 4OKEA 4NCBA 4CIFA 3C95A 5KI6A 3TAMA 3SUOA 4J2AA 2OPRA 3LPTA 4CJPA 1W0HA 3QESA 2XY5A 3T19A 3VQ4A 3WNHA 1RDCA 3OYEA 4FLUA 1RNHA 4O55A 4CJSA 4FJ5A 3LPUA 4C8NA 4YNQA 3TANA 1NK9A 2HNYA 3LALA 3HT3A 3SZ2A 4KHQA 3T1AA 2HHSA 3TAQA 1HNVA 5J2MA 4FW2A 3LP1A 4Z4HA 1TAUA 2KZMA 1KLMA 2BE2A 1KVBA 4CJFA 3ZSRA 4LH4A 3DOLA 4FZXC 2D0CA 4F3TA 3CQ8A 5JS1A 4CERA 3KK2A 1RT7A 3AVHA 4DMNA 4CFCA 3HJFA 2VG6A 3IS9A 1HNIA 1RTJA 2F96A 3OYCA 1C1BA 4E7JA 3PY8A 3NFAA 1QTMA 2X6NA 4PY5A 3I0RA 2OZSA 3MAQA 3M8QA 2IOCA 1BL3A 1KVCA 4M41A 4ELUA 4IKFA 4CK3A 3VQCA 4O4GA 4QCLA 4OGCA 3V6DA 1NK0A 1BQNA 4KTWA 2VWJA 3DM2A 3OJSA 4HUGA 1WSFA 3MEGA 3AA4A 4F4KA 4FK4A 2I5JA 1LWCA 2YKNA 4AH9A 3I0SA 3QIOA 4DFMA 3ASMA 4FK0A 3VQ7A 1TK5A 1UA1A 2Z1JA 1BCMA 4B3OA 3DLEA 3L2VA 1S6PA 4ZTFA 3QEIA 5J1EA 1NK6A 4FLWA 1JLAA 4NCGA 4KHWA 4I2QA 4H4MA 3VQDA 4DFKA 4DQSA 3LZIA 2A1RA 3HPGA 1CZBA 4TSXA 3JYTA 3K5MA 1LWFA 1WNSA 1UA0A 4CJVA 1GOCA 1C6VA 1EXQA 3AVLA 3KLIA 1I3AA 1WSEA 4CFDA 4AHTA 1T03A 4W5RA 1KLNA 3B6PA 3LAKA 4CF2A 3HSTB 4DQPA 4AHUA 1EP4A 4E1MA 1YTAA 1IKXA 3NGYA 1RTDA 1SL0A 4G1QA 3EYZA 3KD1E 3CM6A 3C6TA 4DU3A 4E0DA 3AO2A 1SKWA 1DLOA 2PYLA 4IFVA 4Y1DA 2WOMA 2RF2A 3CFRA 3QLHA 1O1WA 3TWHA 1D5AA 3MEDA 2BANA 4BDYA 1RTHA 4DTPA 4FJ9A 3G10A 4N41A 4I9QA 3NAEA 1KTQA 1VSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F9K A;  4CF8 A;  3LP0 A;  3KD5 E;  2GBZ A;  5EU7 A;  3IAY A;  3RRG A;  3NHG A;  4CHP A;  1JLC A;  3DLR A;  1EET A;  3WNG A;  4HUF A;  5HRO A;  1DTQ A;  4ID5 A;  3SUN A;  4KV8 A;  1Q8I A;  4LD0 A;  4FLZ A;  3QEX A;  5C24 A;  3KTQ A;  4O0I A;  2HNZ A;  5CY4 A;  4CIE A;  1EKE A;  3ZSY A;  2G8V A;  1IKY A;  1RDA A;  4CF0 A;  1WAF A;  3NF7 A;  4CJW A;  1NK4 A;  3CM5 A;  3V1O A;  3L8B A;  1IG9 A;  4DTM A;  4EP5 A;  4KHY A;  3SV3 A;  3V9Z A;  3MXM A;  4KHU A;  3CG7 A;  4CHQ A;  4BE0 A;  4PUO A;  3AVF A;  3TR8 A;  4KB0 A;  3V1R A;  3C94 A;  4W5Q A;  1J5O A;  1S1V A;  2YV0 X;  2OYQ A;  1NOY A;  1L3S A;  2OA8 A;  4E7H A;  2O4I A;  1SV5 A;  3JSM A;  4CJR A;  1XC9 A;  3TAG A;  2IGI A;  3LWM A;  2EX3 A;  3S9H A;  2VG7 A;  4CEQ A;  3NE6 A;  2X74 A;  3SQ1 A;  3CFP A;  1HYV A;  4FJG A;  1CLQ A;  1YVU A;  3QEP A;  2DY4 A;  4JS4 A;  1GOA A;  2ITG A;  2W42 A;  1SL1 A;  2P5G A;  1Q9Y A;  4GVM A;  3P1G A;  3AVC A;  3DYA A;  3HO1 A;  1JL1 A;  4CEO A;  1S9E A;  5FRN A;  3AO5 A;  5HRP A;  4RW4 A;  5KGW A;  2B6A A;  3THV A;  1Z26 A;  5KTQ A;  4KO0 A;  1A5W A;  3L3V A;  5FRM A;  3HYF A;  3AA3 A;  3C6U A;  4FM0 A;  4DF4 A;  3VQ5 A;  1J9A A;  1WSH A;  4E7K A;  4IG3 A;  4CFB A;  3V9U A;  3VA3 A;  3SJJ A;  2FBY A;  1TKD A;  4DSK A;  1NK5 A;  2Z1I A;  3OYN A;  1FXX A;  1KVA A;  4CHY A;  1L3T A;  4YFU A;  4QOZ B;  1TKX A;  4CED A;  1C0M A;  1XHZ A;  4Z4F A;  4RW9 A;  1ZBI A;  2Z1G A;  1U47 A;  3VN5 A;  3HP6 A;  3L3U A;  2KW4 A;  4BWJ A;  3OYJ A;  4KHN A;  1NOZ A;  2FC0 A;  1ZBU A;  2OPP A;  3EY1 A;  1X9W A;  4FLV A;  1NKE A;  3TAP A;  4Z4I A;  1XWL A;  2P51 A;  3TAF A;  4DWI A;  3K2P A;  3RRH A;  3ZSO A;  4JLH A;  4CJL A;  2KTQ A;  4DSL A;  5HRR A;  4CK1 A;  4EP4 A;  4KB1 A;  2KFN A;  1KFD A;  3O3G A;  4HCB A;  3ZCM A;  3RR7 A;  4CCH A;  1SUQ A;  1U4B A;  4B9S A;  2F8S A;  2KQ2 A;  1LAW A;  4B9T A;  4M3Z A;  3AA5 X;  4DFJ A;  3PO5 A;  1CXU A;  1LV5 A;  4FLY A;  2Z1H A;  3DLG A;  4CJE A;  3NGI A;  1QSL A;  4B9M A;  3P83 D;  4MFB A;  1FKP A;  3PX4 A;  3KK1 A;  4C8O A;  2DFF A;  1BIU A;  4E1N A;  3HK2 A;  2YNI A;  1S1U A;  1G15 A;  3RMB A;  3HPH A;  4FLX A;  3AV9 A;  4OKJ A;  1TKZ A;  2GUI A;  2D0B A;  4PWD A;  2QXF A;  4OKK A;  1JLE A;  4ZHR A;  4C8K A;  4B9L A;  3AVG A;  4CJU A;  4I7F A;  5J2N A;  3CFO A;  1TAQ A;  3NF6 A;  4DU4 A;  1JL2 A;  1ASU A;  4DQI A;  2IC3 A;  2ZD1 A;  4FZY A;  1LAV A;  1RIL A;  4BAC A;  5K14 A;  3ALY A;  4O5B A;  1KSP A;  3WNE A;  1A5V A;  3B6O A;  3ZSW A;  1JXE A;  4M3R A;  3HP9 A;  3SQ4 A;  4EZ9 A;  2HHX A;  4LY7 A;  4KI6 A;  3HXM A;  3VQQ A;  1A5X A;  5HBM A;  3OYM A;  3I8D A;  3SV4 A;  4DSJ A;  3OYD A;  3AO3 A;  3VQ8 A;  4OPJ A;  4BE1 A;  4KTZ A;  2YNH A;  4W5O A;  3TAB A;  3SNN A;  5FDL A;  4F8R A;  3AVJ A;  1QSY A;  4DS4 A;  2FBT A;  3K59 A;  3QET A;  4B9N A;  1RDD A;  4CJ5 A;  2HVH A;  3VQ6 A;  3NH2 A;  3K57 A;  1WLJ A;  2YHA A;  3S3M A;  4CK2 A;  4DSF A;  4CJQ A;  4FJJ A;  4Z4G A;  4BWM A;  1RDB A;  1VSH A;  4F2R A;  3ZT3 A;  2G8U A;  4AHV A;  2OPQ A;  3KLG A;  1TK8 A;  4M3Y A;  4IG0 A;  5SWM A;  4B9U A;  1C1C A;  4KKO A;  2QKB A;  1IKV A;  1IO2 A;  2E6L A;  3LDS A;  4N76 A;  3VQ9 A;  2HW3 A;  1S1T A;  5T7B A;  3PO4 A;  1QQC A;  3MXJ A;  5D3G A;  4DTN A;  2G8I A;  1TGO A;  3DMJ A;  2X78 A;  4CEF A;  3K58 A;  1U48 A;  4C8M A;  2HND A;  4CES A;  3OYK A;  3KJV A;  1VSK A;  2HMI A;  4M42 A;  1Y97 A;  3NCI A;  3ZT1 A;  2RN2 A;  1UAX A;  4CGJ A;  4HVJ A;  3IG1 A;  3AVI A;  3K5O A;  3RWU A;  2P5O A;  4OVL A;  3VQB A;  1L3V A;  4C8L A;  4DF8 A;  4DS5 A;  1UWB A;  4CE9 A;  3NGZ A;  3VQA A;  1BHL A;  3TAR A;  1TV6 A;  1S1X A;  2B5J A;  5C42 A;  3O3F A;  2HB5 A;  3L2W A;  4FJN A;  3QEV A;  1NJY A;  4DQQ A;  1U45 A;  3S3O A;  1U04 A;  3MEE A;  1HJR A;  4KFB A;  5C25 A;  4DTS A;  3QNO A;  1F21 A;  1K6Y A;  1HMV A;  3AVK A;  4AHS A;  3V4I A;  4F3O A;  4M3U A;  4Q0B A;  2HHT A;  4ZTJ A;  1RBT A;  1JLQ A;  4DLE A;  3OJU A;  4HUE A;  1JLG A;  4LSL A;  5DMR A;  3ZSV A;  1VRU A;  2IS3 A;  4E7I A;  4FJ7 A;  1GOB A;  4FK2 A;  1L5U A;  5J2P A;  4KHS A;  1HQU A;  4CJ4 A;  2Q3S A;  4N5S A;  4DTX A;  2X6S A;  3DLH A;  4W5N A;  4DTR A;  3QNN A;  3LWL A;  3ITH A;  4XIU A;  3LP3 A;  3SI6 A;  3S3N A;  4CJ3 A;  4FW1 A;  4CJT A;  1RT4 A;  3MEC A;  3OS1 A;  2WON A;  1W9H A;  3OS0 A;  1RT6 A;  3M8S A;  1ZBL A;  1N5Y A;  1HQE A;  5KRS A;  3NH0 A;  2OPS A;  1QS4 A;  3DLK A;  3DRR A;  1RTI A;  3PX0 A;  1NJX A;  2FBX A;  2YKM A;  4DFP A;  3OYL A;  1JXB A;  3AVA A;  1JLF A;  2XY6 A;  1T7P A;  4M3T A;  1U49 A;  4H8K A;  4UQG A;  4HHT A;  1RCH A;  1S9G A;  4O44 A;  3DOK A;  4CIG A;  4FVM A;  1ASW A;  1D9F A;  4M45 A;  3KKR A;  1UOC A;  3HM9 A;  4AIL C;  1Q9X A;  3QIP A;  4LSN A;  3KK3 A;  4FZZ A;  2BGG A;  2YNG A;  4NYF A;  4Z0U A;  4OPK A;  4BE2 A;  1I39 A;  3F73 A;  1RT2 A;  2ZQB A;  1BIZ A;  2ATQ A;  4FJ8 A;  3ZT0 A;  1TVR A;  1NKB A;  3HVT A;  5CYM A;  4CJK A;  1VSM A;  4FLT A;  4HTU A;  3PUF A;  1ITG A;  4ELT A;  1VRT A;  3QEW A;  1YT3 A;  4FJM A;  1RBR A;  3OYA A;  2XY7 A;  5FRO A;  3D45 A;  1S1W A;  3KLF A;  1S6Q A;  3ULD A;  1XI1 A;  2F8T A;  1C0T A;  3PX6 A;  3AVB A;  3ZT2 A;  4DLG A;  2KFZ A;  1X9S A;  2HHV A;  3HL8 A;  4B8A B;  4CF1 A;  3DRS A;  2D5R A;  1FKO A;  4CF9 A;  3AVN A;  1SL2 A;  2R7Y A;  1RBS A;  1EX4 A;  4GW6 A;  3CYM A;  3QO9 A;  2XY8 A;  3LZJ A;  3VA0 A;  4IDK A;  3RMC A;  1WN7 A;  1ZBH A;  4L8R B;  1RT5 A;  2HHW A;  1JKH A;  4CGF A;  4IBN A;  4B08 A;  2YNF A;  2IDO A;  1WSI A;  3BDP A;  1DTT A;  3ISN C;  4M3W A;  4KAZ A;  4OJR A;  4FJL A;  1ZBF A;  1TL1 A;  3AVM A;  4QAG A;  3P5J A;  1R0A A;  1VSF A;  3DI6 A;  2ZE2 A;  3NF9 A;  4JS5 A;  5SZT A;  4W5T A;  1TK0 A;  2OZM A;  5CZ2 A;  3SUP A;  3M8R A;  5HP1 A;  1XHX A;  1KRP A;  4OLA A;  2IAJ A;  1IKW A;  4I9L A;  2FBV A;  1J53 A;  4DTO A;  1ZYQ A;  5HRN A;  1BI4 A;  4KPY A;  1VSE A;  3V81 A;  4BDP A;  4Z4E A;  2DTU A;  1KFS A;  3TAE A;  4ICL A;  3SQ2 A;  1FK9 A;  3WNF A;  1T05 A;  4RW8 A;  4PQU A;  1X1P A;  1NKC A;  4MQ3 A;  4O0J A;  1BCO A;  4FCY A;  2PYJ A;  2VWK A;  4JRQ A;  4I2P A;  2KZZ A;  1VK0 A;  2E6M A;  2E4L A;  4Z4C A;  3U6F A;  4CGH A;  3RTV A;  5CYQ A;  1RT3 A;  2G8H A;  4CHO A;  1NK8 A;  3ZSZ A;  1D8Y A;  5KRT A;  2AJQ A;  1VSJ A;  3RMD A;  3AA2 A;  3OS2 A;  4F2S A;  1B92 A;  4NYN A;  3FFI A;  2DFE A;  3KIO A;  4DQR A;  3K5L A;  4IFY A;  4DTU A;  1NJW A;  2EHG A;  3DLB A;  1X9M A;  4JRP A;  4DSE A;  3OYB A;  2XO7 A;  4DG1 A;  3HPO A;  4CHN A;  4RW6 A;  4R5P A;  4KI4 A;  1ASV A;  1CZ9 A;  3T3F A;  1HRH A;  1NK7 A;  3BGR A;  3VQP A;  4Q5V A;  1RBU A;  3HVR A;  3OYG A;  2ETJ A;  4LH5 A;  2RPI A;  2JGU A;  3EZ5 A;  3QER A;  1QE1 A;  4CHZ A;  1T8E A;  2Y1J A;  3PV8 A;  3SUQ A;  2BDP A;  3OY9 A;  3UIQ A;  2G8W A;  2PY5 A;  4BDZ A;  1QSS A;  4OGE A;  2Y1I A;  2O4G A;  3O3H A;  1BIS A;  4CEA A;  3V9W A;  2G8F A;  1NJZ A;  4CEZ A;  4J2B A;  3NF8 A;  4AHR A;  1KCF A;  3IRX A;  1D9D A;  3SQ0 A;  3LAN A;  4H4O A;  4CFA A;  1WSJ A;  1WAJ A;  3L2Q A;  1LW0 A;  3VQE A;  2D0A A;  3O4N A;  4DSI A;  3ZT4 A;  1VSL A;  3U3Y A;  4KRF A;  1IH7 A;  2DFH A;  5HLF A;  4EZ6 A;  4CEC A;  4CEE A;  2RKI A;  1BQM A;  2HHQ A;  1JLB A;  3NDK A;  2YHB A;  3SYZ A;  4KTQ A;  4RG8 A;  3LP2 A;  4FYD A;  3SPZ A;  3OVN A;  3V1Q A;  1RBV A;  4RW7 A;  3KLE A;  4M3X A;  2LSN A;  1SKR A;  3U3G A;  3A2F A;  3ZSQ A;  1BI4 B;  3D0P A;  4K8Z A;  5J2Q A;  4PA1 A;  3KLH A;  4N56 A;  1B9F A;  1C1A A;  1C0U A;  2XHB A;  4DTJ A;  5I3U A;  4B9V A;  4FJX A;  2JLE A;  4CGD A;  3OYH A;  3MXI A;  4WE1 A;  3DRP A;  5DK5 A;  3QIN A;  4KRE A;  3M8P A;  4DU1 A;  1LWE A;  1VSI A;  3L2R A;  1HYZ A;  2HHU A;  4FM1 A;  4B8C A;  4OLB A;  4AHC A;  3OYF A;  4GMJ B;  3RR8 A;  5E41 A;  4Y1C A;  1L3U A;  2B4J A;  2HVI A;  3ZSX A;  1TL3 A;  4E3S A;  1TKT A;  2NUB A;  1REV A;  4E19 A;  1S5J A;  2XRI A;  3V9X A;  1B9D A;  4CEB A;  3V9S A;  2QKK A;  2QK9 A;  1MU2 A;  4J2D A;  4NCA A;  4CGG A;  2VG5 A;  4E7L A;  3E01 A;  1BGX T;  1HPZ A;  3AO4 A;  5HRS A;  4CGI A;  3RMA A;  2PZS A;  4E89 A;  1SKS A;  4HCC A;  4ID1 A;  1HYS A;  5CZ1 A;  2GV9 A;  4N47 A;  4ELV A;  2G8K A;  3H08 A;  4FJI A;  1YTU A;  5I42 A;  1J54 A;  3LAM A;  5JS2 A;  3K5N A;  3OYI A;  4J2E A;  2P1J A;  4FM2 A;  5KGX A;  4FJK A;  4FXD A;  3SCX A;  1QHT A;  3NBP A;  3TI0 A;  1Z25 A;  1CXQ A;  3L2U A;  3G0Z A;  3AO1 A;  1WSG A;  3O4Q A;  3SPY A;  4K8X A;  1RT1 A;  1N6Q A;  4FJH A;  1LW2 A;  2A1S A;  3KKS A;  3NH1 A;  4OKE A;  4NCB A;  4CIF A;  3C95 A;  5KI6 A;  3TAM A;  3SUO A;  4J2A A;  2OPR A;  3LPT A;  4CJP A;  1W0H A;  3QES A;  2XY5 A;  3T19 A;  3VQ4 A;  3WNH A;  1RDC A;  3OYE A;  4FLU A;  1RNH A;  4O55 A;  4CJS A;  4FJ5 A;  3LPU A;  4C8N A;  4YNQ A;  3TAN A;  1NK9 A;  2HNY A;  3LAL A;  3HT3 A;  3SZ2 A;  4KHQ A;  3T1A A;  2HHS A;  3TAQ A;  1HNV A;  5J2M A;  4FW2 A;  3LP1 A;  4Z4H A;  1TAU A;  2KZM A;  1KLM A;  2BE2 A;  1KVB A;  4CJF A;  3ZSR A;  4LH4 A;  3DOL A;  4FZX C;  2D0C A;  4F3T A;  3CQ8 A;  5JS1 A;  4CER A;  3KK2 A;  1RT7 A;  3AVH A;  4DMN A;  4CFC A;  3HJF A;  2VG6 A;  3IS9 A;  1HNI A;  1RTJ A;  2F96 A;  3OYC A;  1C1B A;  4E7J A;  3PY8 A;  3NFA A;  1QTM A;  2X6N A;  4PY5 A;  3I0R A;  2OZS A;  3MAQ A;  3M8Q A;  2IOC A;  1BL3 A;  1KVC A;  4M41 A;  4ELU A;  4IKF A;  4CK3 A;  3VQC A;  4O4G A;  4QCL A;  4OGC A;  3V6D A;  1NK0 A;  1BQN A;  4KTW A;  2VWJ A;  3DM2 A;  3OJS A;  4HUG A;  1WSF A;  3MEG A;  3AA4 A;  4F4K A;  4FK4 A;  2I5J A;  1LWC A;  2YKN A;  4AH9 A;  3I0S A;  3QIO A;  4DFM A;  3ASM A;  4FK0 A;  3VQ7 A;  1TK5 A;  1UA1 A;  2Z1J A;  1BCM A;  4B3O A;  3DLE A;  3L2V A;  1S6P A;  4ZTF A;  3QEI A;  5J1E A;  1NK6 A;  4FLW A;  1JLA A;  4NCG A;  4KHW A;  4I2Q A;  4H4M A;  3VQD A;  4DFK A;  4DQS A;  3LZI A;  2A1R A;  3HPG A;  1CZB A;  4TSX A;  3JYT A;  3K5M A;  1LWF A;  1WNS A;  1UA0 A;  4CJV A;  1GOC A;  1C6V A;  1EXQ A;  3AVL A;  3KLI A;  1I3A A;  1WSE A;  4CFD A;  4AHT A;  1T03 A;  4W5R A;  1KLN A;  3B6P A;  3LAK A;  4CF2 A;  3HST B;  4DQP A;  4AHU A;  1EP4 A;  4E1M A;  1YTA A;  1IKX A;  3NGY A;  1RTD A;  1SL0 A;  4G1Q A;  3EYZ A;  3KD1 E;  3CM6 A;  3C6T A;  4DU3 A;  4E0D A;  3AO2 A;  1SKW A;  1DLO A;  2PYL A;  4IFV A;  4Y1D A;  2WOM A;  2RF2 A;  3CFR A;  3QLH A;  1O1W A;  3TWH A;  1D5A A;  3MED A;  2BAN A;  4BDY A;  1RTH A;  4DTP A;  4FJ9 A;  3G10 A;  4N41 A;  4I9Q A;  3NAE A;  1KTQ A;  1VSD A; 
#chains in the Genus database with same CATH topology
 3LP0 A;  5EU7 A;  3QFU A;  3P31 A;  1EET A;  5HRO A;  2E5L K;  3SUN A;  2VGN A;  4LD0 A;  4FLZ A;  5C24 A;  2NNW A;  1IKY A;  1NK4 A;  3WXK A;  3L8B A;  1IG9 A;  4DTM A;  3VGL A;  3CG7 A;  4BE0 A;  3TR8 A;  2IIR A;  4KB0 A;  3C94 A;  1J5O A;  2YHX A;  4FWO A;  1L3S A;  4E7H A;  5AQO A;  1SV5 A;  3CIP A;  2X74 A;  3SQ1 A;  2DY4 A;  1BA0 A;  2W42 A;  3EN9 A;  1Q9Y A;  2UU9 K;  3AVC A;  3VGK A;  3HO1 A;  4DV6 K;  5FRN A;  4B1Z A;  3SBG A;  3THV A;  1Z26 A;  1N33 K;  1A5W A;  5FRM A;  3C6U A;  4DF4 A;  4WFB L;  1J9A A;  4IG3 A;  4BRK A;  4DSK A;  4FL9 A;  3D6R A;  3VA3 A;  2NRT A;  2Z1I A;  3Q7C A;  5GAG P;  1FXX A;  1KVA A;  5GAD P;  4QOZ B;  1TKX A;  1ZBI A;  3ZEU B;  2KHO A;  4CW7 B;  4BWJ A;  2FC0 A;  2OPP A;  1ZBU A;  1X9W A;  4FLV A;  5AQG A;  2P51 A;  3K2P A;  2P9I B;  3GDQ A;  3SLC A;  5HRR A;  3CJ7 A;  4KB1 A;  1KFD A;  1GLA G;  4HCB A;  2ZJR L;  1SUQ A;  2KQ2 A;  3UKR B;  3ZYY X;  4M3Z A;  1DT9 A;  1LV5 A;  1YIT N;  3BP8 A;  3MX5 A;  1ILY A;  3P83 D;  3PX4 A;  5BPL A;  2QA4 N;  3A0I X;  3HK2 A;  1IBK K;  1S1U A;  4BRD A;  3RMB A;  1EWR A;  4OO1 J;  2GUI A;  4PWD A;  1JLE A;  1TYQ A;  3QML A;  3G71 N;  3CFO A;  4AF1 A;  4DU4 A;  1JL2 A;  2P9S A;  1BWF O;  1ATS A;  3UE5 A;  4B1U B;  1KSP A;  1A5V A;  3B6O A;  3ZX0 A;  1JXE A;  4M3R A;  5CHI A;  4LY7 A;  1SZ2 A;  3E9O A;  3OYD A;  3AO3 A;  5AQH A;  3VQ8 A;  4BE1 A;  4KTZ A;  4UY8 O;  3MDQ A;  4X66 K;  3O6W A;  3K59 A;  5BRE A;  1RDD A;  3VQ6 A;  3AY9 A;  1T6C A;  3KHY A;  2E2Q A;  1RDB A;  4F2R A;  1NGA A;  4AHV A;  4IG0 A;  1IO2 A;  3HSC A;  5FLX O;  2G8I A;  4DTN A;  1U48 A;  2OTJ N;  4A5A A;  3SBT A;  1VSK A;  2HMI A;  4M42 A;  2RN2 A;  1LCU A;  4PL7 A;  4CGJ A;  1OVY A;  4OVL A;  1E4G T;  2QI2 A;  4FWL A;  2PAV A;  1UWB A;  4GV6 A;  1TV6 A;  1S1X A;  3O3F A;  2DPN A;  3L2W A;  4NXN K;  1NJY A;  1U04 A;  2ZGY A;  4DTS A;  3VEV A;  4CD1 A;  2UUC K;  3AVK A;  4JEP A;  4M3U A;  3D2E A;  1JLQ A;  3OJU A;  5DMR A;  3KVG A;  4E7I A;  5J2P A;  1HQU A;  3C6A A;  2ZF5 O;  1NM1 A;  2HBL A;  3ITH A;  3ULE A;  4BC4 A;  4CJT A;  1RT4 A;  3OS1 A;  3OS0 A;  3M8S A;  1RT6 A;  3FR0 A;  1HQE A;  3O1B A;  4CZM A;  3DLK A;  3E9L A;  3DRR A;  1NJX A;  2YKM A;  1JXB A;  3AVA A;  3ID6 A;  1JLF A;  4X64 K;  1T7P A;  2VYP A;  1RCH A;  4O44 A;  3DOK A;  1ASW A;  2BGG A;  3HM9 A;  3KK3 A;  1I39 A;  4JK8 A;  4FJ8 A;  1V4S A;  1TVR A;  3HVT A;  4XH1 A;  5AQK A;  4FJM A;  2XY7 A;  2P9L B;  3K9K A;  5FRO A;  5C10 A;  2F8T A;  3ULD A;  1XI1 A;  4DLG A;  5IWA K;  1G99 A;  2HHV A;  3IKM A;  3DRS A;  4CF9 A;  2R7Y A;  3VES A;  4H0Y B;  3RMC A;  4H03 B;  5MLC Q;  1ZBH A;  4L8R B;  4CGF A;  4B08 A;  1C0F A;  4JI7 K;  4KAZ A;  1XMO K;  1ZBF A;  3DI6 A;  5SZT A;  3SUP A;  5HP1 A;  1XHX A;  4IOC L;  4I9L A;  1IKW A;  3CCJ N;  1KC8 O;  3TSP A;  5HRN A;  4BDP A;  3MCP A;  3SQ2 A;  1T05 A;  1K8A O;  4PQU A;  1NGJ A;  4IFE A;  5LJV A;  4AQY K;  5HOO A;  4O0J A;  4K41 A;  4JRQ A;  4I2P A;  1S72 N;  3U6F A;  1RT3 A;  2G8H A;  1VSJ A;  3OS2 A;  4U7B A;  2NZT A;  3VER A;  4DQR A;  2CGK A;  4DTU A;  3NVM A;  1X9M A;  4DSE A;  3OYB A;  3HPO A;  3MMV A;  2FSK A;  1WB9 A;  4R5P A;  5LL6 Z;  4JYA K;  4JI8 K;  2E8A A;  3BGR A;  5AZJ B;  4Q5V A;  4LH5 A;  3EZ5 A;  2JGU A;  1QE1 A;  3QBX A;  2PY5 A;  4BDZ A;  1FW6 A;  3SMP A;  3O3H A;  4JI2 K;  4J2B A;  4JN4 A;  1WBB A;  3L2Q A;  5BR9 A;  3VQE A;  2D0A A;  3O4N A;  3ZT4 A;  1QQO A;  5JVH L;  5HLF A;  4EZ6 A;  4PKI A;  4IOA L;  3DXM B;  3JXU A;  4KTQ A;  1FJG K;  3VEY A;  3O4W A;  4RW7 A;  4JKE A;  2P9I A;  5M1F A;  4I6M B;  1SKR A;  3ZSQ A;  1BI4 B;  3UKR A;  4PA1 A;  3KLH A;  4N56 A;  4FJX A;  4LFB K;  2XHB A;  4DTJ A;  5JLF A;  5F2R A;  3DRP A;  5DK5 A;  1XMQ K;  3TSU A;  1LWE A;  4FM1 A;  5E41 A;  4H0X B;  1L3U A;  2B4J A;  2Q0U A;  3A5M C;  4CEB A;  3V9S A;  1GLC G;  4CGG A;  2VG5 A;  1BGX T;  3AO4 A;  3RMA A;  1VQM N;  2PZS A;  4ID1 A;  4N47 A;  2OTL N;  1VQ9 N;  2G8K A;  4A2B A;  1YTU A;  4O5F A;  1J54 A;  3OYI A;  4FM2 A;  4FXD A;  4Y0W A;  3SCX A;  1E4F T;  1YXQ A;  1N8R O;  3TI0 A;  1CXQ A;  2KLA A;  1RT1 A;  3BF3 A;  4FJH A;  3KKS A;  4B1V A;  3WQT A;  4NCB A;  4CIF A;  5KI6 A;  3TAM A;  3CQY A;  3HOS A;  2QEX N;  3QES A;  4WFA L;  3CME N;  3OYE A;  4FLU A;  1RNH A;  5AQQ A;  4E1J A;  4BRO A;  4BVP A;  4JHD B;  4YNQ A;  1HNZ K;  3CC4 N;  1GLD G;  1NGE A;  2HNY A;  3HT3 A;  4YOU A;  3TAQ A;  3O1W A;  1YJN N;  5BR8 K;  3I8B A;  1TAU A;  1OH8 A;  5GIP A;  3ZSR A;  2QWR A;  3CQ8 A;  5JS1 A;  3KK2 A;  1HNI A;  5GAE P;  2A40 A;  1NG9 A;  3I0R A;  3UKU B;  2GTD A;  3HOT A;  3M1F A;  3EKS A;  1BQN A;  2VWJ A;  3GL1 A;  3OJS A;  2I5J A;  4DV0 K;  3ENO A;  1YIJ N;  4MO4 A;  4IWV A;  4B1W B;  4H5N A;  2F4V K;  1TK5 A;  1UA1 A;  2YHY A;  2Z1J A;  2VGM A;  3T1H K;  3QEI A;  1NK6 A;  4FLW A;  2O8D B;  3LZI A;  2A1R A;  1UA0 A;  1CZB A;  4H5V A;  4JK7 A;  4TSX A;  2CH6 A;  2VQE K;  3CHW A;  4DR7 K;  4KH5 A;  4CZF A;  1KLN A;  3VGM A;  4WQ5 A;  4H0O A;  2H3G X;  4E1M A;  4BGB A;  1IKX A;  1S3X A;  3EYZ A;  3VEW A;  3KD1 E;  4BY9 C;  2CGL A;  1SS6 A;  4DKW A;  2RF2 A;  1RTH A;  1NGF A;  2VQF K;  4FJ9 A;  3G10 A;  3FLC O;  3NAE A;  4I9Q A;  4AM6 A;  2P9L A;  4H5T A;  2ZM6 K;  3KD5 E;  3IAY A;  2F9W A;  5CE3 A;  2D0P A;  1DTQ A;  4ID5 A;  3KTQ A;  2HNZ A;  5CY4 A;  3ZSY A;  4CZE A;  1RDA A;  2PFU A;  4BRM A;  1JJ2 M;  4EP5 A;  1VQ6 N;  4KHY A;  1K9M O;  2O8E B;  1S1V A;  1NOY A;  4DUY K;  2OA8 A;  2O4I A;  1YJW N;  2FF3 B;  1OVQ A;  3TPQ A;  2IGI A;  2PBD A;  2EX3 A;  3S9H A;  3NE6 A;  4MDB A;  3VET A;  1YVU A;  4DV5 K;  4JS4 A;  1GOA A;  3I56 N;  3LM2 A;  1J5E K;  1JL1 A;  3CJA A;  4A59 A;  2F7T A;  4LF8 K;  4JI6 K;  3HM8 A;  3HYF A;  4YOV A;  4JK9 A;  3V9U A;  2FBY A;  4CHY A;  1QQM A;  4CI6 A;  4RW9 A;  1GLL O;  3VN5 A;  3L3U A;  3DAW A;  3CCR N;  1NOZ A;  3SJH A;  5AZJ A;  1XWL A;  3TAF A;  4DWI A;  5ADX A;  3ZSO A;  4CJ7 A;  1BG3 A;  4CK1 A;  1YI2 N;  3ZCM A;  1Q82 O;  1U4B A;  4B9S A;  2F8S A;  4BG9 A;  3AA5 X;  1TUY A;  4FLY A;  3D7E O;  3NGI A;  1QSL A;  1OH5 A;  3GG4 A;  4NXM K;  2ASP A;  4BRI A;  4DR2 K;  4B3T K;  1DKG D;  3HPH A;  3AV9 A;  4H0T B;  4K43 A;  3K9J A;  2D0B A;  3M5R A;  4B9L A;  1X3N A;  3CCV N;  2QM1 A;  4DQI A;  2IC3 A;  5EY4 A;  4FZY A;  4I6M A;  1JCF A;  3ALY A;  3WNE A;  4FSV A;  3F9M A;  4LFC K;  4M63 C;  3OYM A;  3I8D A;  4OPJ A;  3ZLJ A;  3CMA N;  4BC3 A;  2A42 A;  5FDL A;  3AAQ A;  1QSY A;  4DS4 A;  3A5N C;  4IJA A;  3K57 A;  4A2A A;  2A3Z A;  4FJJ A;  4CK2 A;  4Z4G A;  3ZT3 A;  4M3Y A;  3KLG A;  1TK8 A;  4BG8 A;  2Q97 A;  3VQ9 A;  3THW A;  3AGK A;  2HW3 A;  5T7B A;  3MXJ A;  1TGO A;  5DM7 L;  4G9Z A;  3CPE A;  2FLO A;  4CEF A;  2IVO A;  3O9U A;  4JD2 B;  3KJV A;  3CPW M;  2NRW A;  4HVJ A;  5KPZ A;  1L3V A;  4C8L A;  4WQ4 C;  5C0Y A;  5AQW A;  3LDQ A;  4DS5 A;  4DF8 A;  2GX9 A;  3VQA A;  4XH5 A;  2B5J A;  1XQS C;  4FJN A;  3QEV A;  4BRQ A;  1U45 A;  4WYB A;  1HJR A;  3QNO A;  1NGH A;  1NMN A;  5AZI A;  3VEN A;  4F3O A;  2O8B B;  4ZTJ A;  2I7P A;  3JS6 A;  4DLE A;  4LSL A;  2WC9 A;  4FJ7 A;  1S22 A;  1GOB A;  1TUU A;  2YI1 A;  5IT9 O;  2P9U A;  3FGU A;  3EE8 A;  4N5S A;  4DR3 K;  4W5N A;  4B3S K;  3SI6 A;  4XIU A;  1U2V A;  4CJ3 A;  4FW1 A;  3UKU A;  2WON A;  5KRS A;  3NH0 A;  1RTI A;  3PIP L;  3PX0 A;  4DFP A;  3OYL A;  1IBL K;  4UQG A;  3LDL A;  4GVE A;  3A5O C;  1Q9X A;  3QIP A;  2YNG A;  4FWR A;  4NYF A;  4PHT X;  4R79 A;  3PLA A;  2JWK A;  4K25 A;  3O9R A;  3WUH A;  4CVN E;  1VSM A;  4QS8 A;  4C1N K;  2O8D A;  1VRT A;  2W6L A;  1VQK N;  1S6Q A;  2KFZ A;  5TKW A;  5FPE A;  1NBW A;  5AQX A;  1YF5 L;  2D5R A;  1FKO A;  1EX4 A;  3CYM A;  3E1Y A;  4B1X B;  3VA0 A;  1JKH A;  1NMD A;  1NU0 A;  5AQL A;  3ISN C;  4QAG A;  2NLX A;  2ZE2 A;  3NF9 A;  4K42 A;  1XNR K;  5C15 A;  3M8R A;  1KRP A;  4OLA A;  3H1Q A;  3LDN A;  4BC5 A;  5AQI A;  4DTO A;  3VEO A;  4KPY A;  1VSE A;  3V81 A;  4MO5 A;  5AFU H;  3O9S A;  1FK9 A;  4CZG A;  4RW8 A;  3N4P A;  4MQ3 A;  3DLL L;  5JVG L;  4FCY A;  3DXK B;  2Q1N A;  2VWK A;  4OX9 K;  1VK0 A;  2E6M A;  1K8K B;  4CGH A;  1Y64 A;  5CYQ A;  1YVN A;  3TTC A;  1NK8 A;  3WXI A;  3RMD A;  1MDU B;  3AA2 A;  2F9T A;  4NO7 A;  4LF6 K;  2O8E A;  4NYN A;  3KIO A;  3K5L A;  1NJW A;  3SAG A;  2EHG A;  2XO7 A;  3QB0 A;  4DQ8 A;  4NLB A;  1HRH A;  1V4T A;  3OYG A;  2RPI A;  3QER A;  4H0V B;  4CHZ A;  1K73 O;  3PV8 A;  3PSF A;  5AQF A;  2OCE A;  4GY2 B;  4M7X A;  2A6A A;  1NJZ A;  3CI5 A;  4AHR A;  3IRX A;  5I9E B;  3THY A;  3NVK A;  3SQ0 A;  4BRC A;  3LAN A;  4H4O A;  4YHH K;  1WSJ A;  1WAJ A;  3ZET B;  1Z6R A;  3VF4 A;  1IH7 A;  2P9P B;  2FF6 A;  4JI5 K;  4LFA K;  5KQ8 A;  4CEE A;  1BQM A;  3NDK A;  3SYZ A;  4ISF A;  5E26 A;  2KKZ A;  4RG8 A;  3LP2 A;  4WQ5 C;  3T7Z A;  3SPZ A;  4M3X A;  1QVG M;  3U3G A;  2YJE A;  3D0P A;  4K8Z A;  1X9J A;  3VMF B;  1C0U A;  5I3U A;  3ATU A;  3MXI A;  5BPN A;  5A2Q O;  3L2R A;  1HYZ A;  2AA4 A;  4OLB A;  4AHC A;  3OYF A;  2NRH A;  4GMJ B;  2HVI A;  3ZSX A;  1TL3 A;  4E3S A;  1REV A;  2XRI A;  2QKK A;  2QK9 A;  4J2D A;  1BDG A;  3E01 A;  3MN5 A;  4RWT A;  4CGI A;  1HJO A;  5M1Q A;  4HCC A;  2YHW A;  4JNE A;  5AFU A;  1HR0 K;  4HTL A;  2E2N A;  4J2E A;  2P1J A;  2BTF A;  3BUZ B;  1Z25 A;  3L2U A;  2E20 A;  3R1X A;  3G0Z A;  3O4Q A;  3SPY A;  1YHQ N;  2UXD K;  3DJC A;  4IOX A;  1LW2 A;  2E2O A;  3SUO A;  3LPT A;  1GLE G;  3VQ4 A;  2XY5 A;  3DWL A;  3SMS A;  4DR6 K;  3CCM N;  4O55 A;  4C8N A;  1KQS M;  4FPA A;  2HHS A;  1HNV A;  4FW2 A;  3MN9 A;  4IEI A;  1QVF M;  3KK7 A;  1KLM A;  3ENH A;  1KVB A;  3KZB A;  4CJF A;  5AQT A;  4FZX C;  1GLB G;  2D0C A;  1ESV A;  5M1P A;  3WEE B;  4CER A;  4DMN A;  3HJF A;  2VG6 A;  2F96 A;  3CC2 N;  3PY8 A;  1KVC A;  4M41 A;  4IKF A;  4CK3 A;  3H3N O;  4YY3 K;  1X3M A;  3V6D A;  1NK0 A;  4KTW A;  3BZK A;  4HUG A;  3MEG A;  4IXC A;  4F4K A;  2O8B A;  1LWC A;  2YKN A;  3I0S A;  4DFM A;  2HBM A;  1KAZ A;  3L2V A;  3BEX A;  4LF5 K;  2CGJ A;  4XEI A;  5J1E A;  3N4Q A;  2OAN A;  1IG8 A;  4NCG A;  4FOE A;  3VQD A;  3VTI A;  4NB4 A;  1C6V A;  2E88 A;  3AVL A;  4PL8 A;  3KLI A;  5JLH A;  3FZF A;  1SAZ A;  2JWL A;  4LC9 B;  3LAK A;  4AHU A;  1EP4 A;  1YTA A;  3NGY A;  1NGC A;  2V7Y A;  1SL0 A;  3EL2 A;  1U6Z A;  3CM6 A;  3C6T A;  4FPB A;  4O8K A;  3A8Y A;  4E0D A;  3AO2 A;  1SKW A;  4IFV A;  3ZEU A;  3RSE B;  1VHX A;  1D5A A;  3MED A;  2BAN A;  4BDY A;  2YX6 A;  3PSI A;  3F9K A;  1VSD A;  5BRH A;  1HLU A;  2YCH A;  3OA9 A;  4EAH D;  3NHG A;  1N34 K;  4O0I A;  4BR9 A;  4CIE A;  2G8V A;  1EKE A;  3VOV A;  3MCA B;  3QIC A;  1WAF A;  3NF7 A;  4CJW A;  4YOW A;  2WFB A;  2ASO A;  2FSJ A;  3R9P A;  4CHQ A;  3FZM A;  5AQY A;  2YV0 X;  3CC7 N;  4DB3 A;  3J80 O;  5E84 A;  4CJR A;  3JSM A;  1XC9 A;  5AQM A;  4U67 L;  3TAG A;  2VG7 A;  5KQD A;  1HYV A;  4FJG A;  1CLQ A;  3QEP A;  4DUZ K;  3ATV A;  1EWQ A;  1SL1 A;  2P5G A;  4GVM A;  3P1G A;  3DYA A;  4CEO A;  1S9E A;  3DXK A;  5HRP A;  4RW4 A;  5KGW A;  1K8K A;  2B6A A;  2E1Y A;  4QS9 A;  4HWI A;  5KTQ A;  4KO0 A;  3AA3 A;  2GWJ A;  3VQ5 A;  5DM6 L;  2E2P A;  3SJJ A;  4E7K A;  4CFB A;  1TKD A;  4WFN L;  1NK5 A;  3BY5 A;  1L3T A;  4YFU A;  4CED A;  1XHZ A;  4Z4F A;  1ZC6 A;  3GBT A;  3WXJ A;  1U47 A;  3OYJ A;  4KHN A;  4BRF A;  4Z4I A;  4CJL A;  2KTQ A;  4MDA A;  4DSL A;  4H5R A;  1MWM A;  4ILJ A;  4DV3 K;  1LAW A;  3PO5 A;  3U9D A;  4B9M A;  4FWK A;  4MFB A;  1FKP A;  3KK1 A;  5BN9 A;  5HL7 L;  3ZET A;  3C0B A;  4E1N A;  1G15 A;  3T1Y K;  2P9P A;  4IZ9 A;  4FLX A;  1OH7 A;  1T3V A;  2QXF A;  4OKK A;  4C8K A;  4ZHR A;  3RVC A;  3AVG A;  4GNI A;  4I7F A;  4CJU A;  5J2N A;  2HMP A;  2RE2 A;  1VQO N;  3R3L A;  4ILG B;  5GIO A;  3CD6 N;  5F0X A;  2O8C B;  5C2D A;  1LAV A;  4BAC A;  4O5B A;  3CET A;  3G6E N;  3ZSW A;  2QWL A;  3O9Q A;  4BR7 A;  3HXM A;  3VQQ A;  1A5X A;  4IEE A;  4BR2 A;  4DSJ A;  3SV4 A;  2YNH A;  1R59 O;  3TAB A;  4F8R A;  3HZ6 A;  3J7Y P;  1DGK N;  4DV1 K;  4CJ5 A;  4O8U A;  4DSF A;  4CJQ A;  1VSH A;  4DV4 K;  2G8U A;  2OPQ A;  4B9U A;  4KKO A;  2QKB A;  2ZWH A;  1IKV A;  4N76 A;  1S1T A;  4KBO A;  2P9N B;  1KAY A;  4IO8 A;  2X78 A;  4YDU A;  3K58 A;  4C8M A;  2HND A;  2W6K A;  3J81 O;  3OYK A;  1BA1 A;  2ASM A;  1Y97 A;  3W3D A;  4NLC A;  1UAX A;  4V19 S;  3IUC A;  3AVI A;  3CF5 L;  2P5O A;  1XNQ K;  3FE1 A;  1YJ9 N;  3H3O B;  4CE9 A;  1BHL A;  3C7N B;  3MN6 A;  1RDU A;  2HB5 A;  4DQQ A;  3QBW A;  1F21 A;  1K6Y A;  1HMV A;  1TYQ B;  1RBT A;  1VQP N;  4CBW A;  4HUE A;  2P9S B;  1JLG A;  3ZSV A;  4FK2 A;  2IS3 A;  4KHS A;  1L5U A;  3MN7 A;  4BRE A;  4IDH A;  3WEE A;  4CJ4 A;  2Q3S A;  4DTX A;  2X6S A;  5EXW A;  3LWL A;  3LP3 A;  1VQ7 N;  1D9F A;  1W9H A;  1ZBL A;  2OPS A;  3CQX A;  1QS4 A;  2QWQ A;  2A41 A;  5BN8 A;  4M3T A;  4HHT A;  1W7A A;  5C2F A;  1XC3 A;  4M45 A;  4AIL C;  4FZZ A;  4LSN A;  4H0P A;  4Z0U A;  3LL3 A;  4J8F A;  4OPK A;  5CR4 A;  3F73 A;  2GWK A;  4B3M K;  1T6D A;  5CYM A;  1C0G A;  4CJK A;  4FLT A;  3G4S N;  4ELT A;  1ITG A;  1YAG A;  3QEW A;  1RBR A;  3OYA A;  4CBU A;  1NNE A;  3D45 A;  4BRP A;  3KLF A;  1C0T A;  1GLF O;  3PX6 A;  3AVB A;  2BUP A;  4JV5 K;  1X9S A;  4DV2 K;  4B8A B;  1RBS A;  4X65 K;  3ZX2 A;  2WBN A;  4EFH A;  4GW6 A;  3TU5 A;  1WN7 A;  4H5W A;  1YUW A;  3R8E A;  3DXM A;  3RSE A;  1WSI A;  3BDP A;  1DTT A;  3H46 O;  4OJR A;  3P5J A;  3M3Z A;  1R0A A;  1J6Z A;  2OZM A;  1QHA A;  5AQP A;  3ULE B;  2IAJ A;  1BI4 A;  4Z4E A;  3TAE A;  4ICL A;  3WNF A;  3CCL N;  1X1P A;  2PYJ A;  4EHU A;  2KZZ A;  4Z4C A;  2E4L A;  3RTV A;  1Q86 O;  4K0K K;  5KRT A;  4CD3 A;  5AQR A;  4F2S A;  3FZH A;  2DFE A;  1QQN A;  4IFY A;  1HPM A;  5LJW A;  3DLB A;  5AJ3 K;  4JRP A;  4JKD A;  4JKA A;  4RW6 A;  4KI4 A;  3T3F A;  1CZ9 A;  4GKJ K;  4KHP K;  2QW9 A;  2ETJ A;  4YOT A;  5KPT A;  3CJ9 A;  1T8E A;  2BDP A;  2Y1J A;  3OY9 A;  3UIQ A;  1QSS A;  4OGE A;  2I7N A;  5BRD A;  1BIS A;  4CEZ A;  3NF8 A;  1KCF A;  4CFA A;  1LW0 A;  4JKH A;  1VSL A;  3U3Y A;  4KRF A;  2DFH A;  5AQV A;  4CEC A;  2IVP A;  4JHD A;  3TSQ A;  3VF2 A;  2HHQ A;  1JLB A;  4FYD A;  2Q2R A;  1RBV A;  3KLE A;  3O80 A;  1HKG A;  2LSN A;  2QTD A;  3FFK B;  5J2Q A;  4PKG A;  1B9F A;  1Q81 O;  1C1A A;  2HHH K;  2JLE A;  4CGD A;  3OYH A;  5H1S Q;  1VSI A;  3J8A A;  3MX2 A;  4B8C A;  3RR8 A;  4Y1C A;  1RFQ A;  1TKT A;  4E19 A;  1S5J A;  3V9X A;  1MU2 A;  4NCA A;  1HPZ A;  1HNX K;  2O8C A;  4E89 A;  1SKS A;  1HYS A;  3CJ1 A;  2GV9 A;  3IDH A;  3CCS N;  3H08 A;  4FJI A;  5I42 A;  3LAM A;  4FJK A;  4A61 A;  1QHT A;  1P90 A;  1D4X A;  3AO1 A;  1WSG A;  4GV9 A;  4DV7 K;  1N6Q A;  4CBX A;  3NH1 A;  2A1S A;  4EHT A;  1Z05 A;  2QXL A;  3C95 A;  4J2A A;  1W0H A;  1NJI O;  3T19 A;  3WNH A;  4A62 A;  4CJS A;  4FJ5 A;  5LY3 A;  3LPU A;  4B1Y B;  3TAN A;  4KHQ A;  2P9N A;  3T1A A;  1N36 K;  3KWI A;  3LP1 A;  3HRG A;  4LH4 A;  3I33 A;  3DOL A;  5EVZ A;  4IO9 L;  5BPM A;  1H1V A;  2D1K A;  3IS9 A;  4E7J A;  1C1B A;  1QTM A;  4PY5 A;  2X6N A;  3MAQ A;  4PKH A;  2IOC A;  1BL3 A;  4ELU A;  3OBW A;  2V52 B;  3VQC A;  3C7N A;  4FWM A;  4OGC A;  3DM2 A;  1WSF A;  3AA4 A;  4FWP A;  3H45 C;  4AH9 A;  3QIO A;  3ASM A;  4FK0 A;  1ATN A;  3VQ7 A;  4RCH A;  4B3O A;  2UYT A;  1WUA A;  3EZW A;  1NGI A;  4ZTF A;  4LF4 K;  3CER A;  1JLA A;  3ID8 A;  4IJN A;  4KHW A;  1GLJ O;  4FWS A;  3HPG A;  3K5M A;  1LWF A;  1HNW K;  2AP1 A;  1RGI A;  3SK3 A;  4DR4 K;  1I3A A;  3CCU N;  1BOT O;  1T03 A;  2QWO A;  2ITM A;  4W5R A;  1MWK A;  5KPR A;  3B6P A;  1M90 O;  4F9O A;  1ATR A;  3HST B;  4DQP A;  1RTD A;  4G1Q A;  3SAF A;  1WBD A;  4JKB A;  2PYL A;  4Y1D A;  3TWH A;  1EO1 A;  4DTP A;  1HX1 A;  5LMN K;  4N41 A;  3W0L A;  3FFI A;  4CF8 A;  2GBZ A;  3RRG A;  3HI0 A;  4CHP A;  1JLC A;  3DLR A;  3WNG A;  4HUF A;  3FZK A;  3H1V X;  4KV8 A;  1Q8I A;  3QEX A;  4XH4 A;  4CF0 A;  4YDU C;  3CM5 A;  3V1O A;  3LM9 A;  1NLV A;  4MLE A;  2W40 A;  3SV3 A;  3V9Z A;  4JI4 K;  3MXM A;  4FO0 A;  4KHU A;  4PUO A;  1SQK A;  3AVF A;  3V1R A;  2ZJQ L;  4W5Q A;  2OYQ A;  3CCE N;  1DEJ A;  4BQL A;  5AR0 A;  4BRG A;  4WCE L;  2IVN A;  3LWM A;  3GE1 A;  3E9P A;  3WXM B;  4CEQ A;  2FXU A;  3CFP A;  3BF1 A;  2HST A;  1HKC A;  2ITG A;  3I55 N;  5FPM A;  2HBK A;  3THX B;  3KWG A;  4JI3 K;  3AO5 A;  5FPD A;  3L3V A;  4FM0 A;  4JKC A;  3T69 A;  4JKF A;  3B8A X;  1WSH A;  3C6H A;  1IJJ A;  3OYN A;  4LF9 K;  2D0O A;  1E3M A;  5F1X A;  1C0M A;  3FZL A;  2Z1G A;  2QWN A;  5AQN A;  1W97 L;  4C1N I;  3TTD A;  2KW4 A;  4A57 A;  3HP6 A;  1OH6 A;  3EY1 A;  3L0Q A;  1NKE A;  3TAP A;  3OTO K;  4BRN A;  3RRH A;  4JLH A;  4JD2 A;  3K0S A;  2KFN A;  2HF4 A;  4EP4 A;  4BQZ A;  3O3G A;  3RR7 A;  4CCH A;  4B9T A;  4DFJ A;  1CXU A;  4FWN A;  2Z1H A;  1JCG A;  3DLG A;  4CJE A;  1I94 K;  4BRH A;  2HBJ A;  5B8H A;  4C8O A;  2DFF A;  1EQY A;  1BIU A;  5BRF A;  1Q18 A;  1NGG A;  2YNI A;  4DR5 K;  5AQU A;  2J4R A;  3M6G A;  4OKJ A;  3WQU A;  1TKZ A;  5M1N A;  3NF6 A;  1TAQ A;  4DCH A;  1CZA N;  3D2F B;  1ASU A;  2ZD1 A;  1RIL A;  5K14 A;  4BR0 A;  4CZI A;  2HHX A;  3SQ4 A;  3HP9 A;  4EZ9 A;  4KI6 A;  3Q7B A;  5HBM A;  4W5O A;  3SNN A;  3AVJ A;  2RHK A;  2FBT A;  3QET A;  4B9N A;  4YOY A;  2HVH A;  3NH2 A;  1WLJ A;  2YHA A;  3S3M A;  3TTF A;  3J7A P;  4BWM A;  3U4L A;  1ZXO A;  3O5B A;  1NWK A;  5AQS A;  4YOR A;  5SWM A;  1C1C A;  3ZX3 A;  4WQ4 A;  3R6M A;  2E6L A;  3LDS A;  4BRA A;  3PO4 A;  1QQC A;  5D3G A;  3DMJ A;  4RTF D;  3C65 A;  3CJB A;  3HTV A;  4CZK A;  1VQL N;  2GEM A;  4CES A;  3MK6 A;  3OW2 M;  4LF7 K;  3NCI A;  3ZT1 A;  3RWU A;  3P39 A;  3IG1 A;  3K5O A;  5M1O A;  5TKY A;  3VQB A;  5AQZ A;  2BH1 A;  3NGZ A;  2UUB K;  3TAR A;  5C42 A;  3S3O A;  4KFB A;  3MEE A;  4FOI A;  3IMX A;  5C25 A;  4X62 K;  4AHS A;  3V4I A;  4Q0B A;  2HHT A;  2Q31 A;  4L3Q A;  2NRZ A;  4YOX A;  3ENB A;  3L6Q A;  1VRU A;  4KH4 A;  3HBT A;  3VPZ A;  4CZH A;  3NMU A;  2O8F B;  3F2K A;  3DLH A;  4DTR A;  2P9K B;  1LOT B;  3QNN A;  3S3N A;  1T44 A;  2GUP A;  2HF3 A;  3MEC A;  1N5Y A;  1WOQ A;  5LMU K;  3E66 A;  1JCE A;  2FBX A;  2V51 B;  2XY6 A;  1U49 A;  2E1Z A;  4H8K A;  3AAP A;  1NGB A;  4DR1 K;  1S9G A;  1VQ8 N;  5ELZ A;  4JKG B;  1M1K O;  2FSN A;  4CIG A;  1ZBS A;  4FVM A;  3KKR A;  1UOC A;  4DHY A;  4Z94 A;  4ISG A;  3THW B;  4BE2 A;  3OHR A;  1BUP A;  1RT2 A;  2ZQB A;  1BIZ A;  2ATQ A;  3ZT0 A;  1NKB A;  3WXL A;  3QDK A;  3LDP A;  3PUF A;  4HTU A;  3P4I A;  4M7Y A;  1YT3 A;  3L4Q A;  5FPN A;  3UB5 A;  1S1W A;  1HUX A;  3VEZ A;  4BC2 A;  3ZT2 A;  4BRL A;  2W41 A;  2V7Z A;  1OKJ A;  3HL8 A;  4CF1 A;  1VQN N;  4JAX A;  1SL2 A;  3AVN A;  5AZI B;  3QO9 A;  2XY8 A;  3LZJ A;  4IDK A;  1RT5 A;  2HHW A;  5JIC A;  4IBN A;  2YNF A;  3MWT A;  2IDO A;  4M3W A;  1KXP A;  2VCP A;  4FJL A;  4WF9 L;  2YJF A;  1TL1 A;  3AVM A;  1VSF A;  2P9U B;  4OPA A;  4JS5 A;  2UXB K;  4W5T A;  1TK0 A;  5CZ2 A;  3O9T A;  2UUA K;  1U2V B;  2FBV A;  1J53 A;  1ZYQ A;  5M1K A;  2NRX A;  4GKK K;  5C12 A;  1Q7Y O;  1KFS A;  2DTU A;  2Q36 A;  5JMV A;  1NKC A;  2Q0R A;  2ZJP L;  1HKB A;  1BCO A;  3QFP A;  2ZGZ A;  4EIA A;  3EKU A;  4CHO A;  3ZSZ A;  1D8Y A;  3EE9 A;  2AJQ A;  4JI1 K;  1B92 A;  4OPH A;  3SAH A;  3JAM O;  3LDO A;  4DG1 A;  3WT0 A;  1BU6 O;  4CHN A;  4FVU A;  4B3R K;  4MLH A;  3PIO L;  1ASV A;  4BVO A;  1NK7 A;  3VQP A;  2QWM A;  1RBU A;  3HVR A;  1MA9 B;  3MWP A;  3THX A;  3SUQ A;  2G8W A;  2EWS A;  5ADX H;  2Y1I A;  2O4G A;  4CEA A;  3V9W A;  2G8F A;  1D9D A;  4DSI A;  3IFR A;  3G25 A;  3VF6 A;  3CCQ N;  2RKI A;  2D4W A;  1VQ5 N;  2YHB A;  3L4I A;  3OVN A;  3V1Q A;  3AAR A;  3A2F A;  2WUS A;  3AGR A;  1KD1 O;  1QZ5 A;  1XUP O;  3EO3 A;  3J7Z O;  4B9V A;  2NRV A;  3A5L C;  2GEL A;  4WE1 A;  1RDW X;  1IBM K;  3QIN A;  4KRE A;  3M8P A;  4DU1 A;  1NGD A;  4GV3 A;  2HHU A;  3O8M A;  2NUB A;  1B9D A;  2HOE A;  4E7L A;  3D2F A;  3OBY A;  5EX5 A;  5HRS A;  5CZ1 A;  4ELV A;  4AM7 A;  5JS2 A;  3K5N A;  4JI0 K;  3VTH A;  5KGX A;  3NBP A;  4K8X A;  3VEX A;  3THY B;  4OKE A;  1W2B M;  2QWP A;  4B9Q A;  2OPR A;  4CJP A;  1VAZ A;  3U9Z A;  1RDC A;  3BZC A;  2UXC K;  1NK9 A;  4ISE A;  3LAL A;  3D2E B;  3SZ2 A;  5J2M A;  4Z4H A;  2KZM A;  2BE2 A;  4F3T A;  3U8X A;  1BO5 O;  1RT7 A;  3AVH A;  1O13 A;  4CFC A;  1RTJ A;  3GOI A;  3OYC A;  3NFA A;  2OZS A;  3M8Q A;  5EOY A;  4QS7 A;  4O4G A;  3EEQ A;  4QCL A;  3P38 A;  5GAH P;  4FK4 A;  1IV0 A;  4BR5 A;  5AQJ A;  1VQ4 N;  1BCM A;  3DLE A;  1S6P A;  2O8F A;  3F5T A;  2A5X A;  4BR4 A;  2P9K A;  4I2Q A;  4H4M A;  4DFK A;  2CH5 A;  4C23 A;  4CZJ A;  4DQS A;  3JYT A;  3CXC M;  1WNS A;  4CJV A;  1GOC A;  1EXQ A;  1QZ6 A;  2NRR A;  4A5B A;  4BGA A;  2VWB A;  1WSE A;  4CFD A;  4AHT A;  3S41 A;  4CF2 A;  2WTU A;  5GIN A;  3O08 A;  4CZL A;  1N32 K;  4JKG A;  1KAX A;  3CJC A;  4KH6 A;  4DU3 A;  1DLO A;  4ILH A;  3H6E A;  2WOM A;  3CFR A;  3QLH A;  1O1W A;  1P8Z A;  4FWQ A;  1KTQ A; 
#chains in the Genus database with same CATH homology
 3F9K A;  4CF8 A;  3LP0 A;  3KD5 E;  2GBZ A;  5EU7 A;  3IAY A;  3RRG A;  3NHG A;  4CHP A;  1JLC A;  3DLR A;  1EET A;  3WNG A;  4HUF A;  5HRO A;  1DTQ A;  4ID5 A;  3SUN A;  4KV8 A;  1Q8I A;  4LD0 A;  4FLZ A;  3QEX A;  5C24 A;  3KTQ A;  4O0I A;  2HNZ A;  5CY4 A;  4CIE A;  1EKE A;  3ZSY A;  2G8V A;  1IKY A;  1RDA A;  4CF0 A;  1WAF A;  3NF7 A;  4CJW A;  1NK4 A;  3CM5 A;  3V1O A;  3L8B A;  1IG9 A;  4DTM A;  4EP5 A;  4KHY A;  3SV3 A;  3V9Z A;  3MXM A;  4KHU A;  3CG7 A;  4CHQ A;  4BE0 A;  4PUO A;  3AVF A;  3TR8 A;  4KB0 A;  3V1R A;  3C94 A;  4W5Q A;  1J5O A;  1S1V A;  2YV0 X;  2OYQ A;  1NOY A;  1L3S A;  2OA8 A;  4E7H A;  2O4I A;  1SV5 A;  3JSM A;  4CJR A;  1XC9 A;  3TAG A;  2IGI A;  3LWM A;  2EX3 A;  3S9H A;  2VG7 A;  4CEQ A;  3NE6 A;  2X74 A;  3SQ1 A;  3CFP A;  1HYV A;  4FJG A;  1CLQ A;  1YVU A;  3QEP A;  2DY4 A;  4JS4 A;  1GOA A;  2ITG A;  2W42 A;  1SL1 A;  2P5G A;  1Q9Y A;  4GVM A;  3P1G A;  3AVC A;  3DYA A;  3HO1 A;  1JL1 A;  4CEO A;  1S9E A;  5FRN A;  3AO5 A;  5HRP A;  4RW4 A;  5KGW A;  2B6A A;  3THV A;  1Z26 A;  5KTQ A;  4KO0 A;  1A5W A;  3L3V A;  5FRM A;  3HYF A;  3AA3 A;  3C6U A;  4FM0 A;  4DF4 A;  3VQ5 A;  1J9A A;  1WSH A;  4E7K A;  4IG3 A;  4CFB A;  3V9U A;  3VA3 A;  3SJJ A;  2FBY A;  1TKD A;  4DSK A;  1NK5 A;  2Z1I A;  3OYN A;  1FXX A;  1KVA A;  4CHY A;  1L3T A;  4YFU A;  4QOZ B;  1TKX A;  4CED A;  1C0M A;  1XHZ A;  4Z4F A;  4RW9 A;  1ZBI A;  2Z1G A;  1U47 A;  3VN5 A;  3HP6 A;  3L3U A;  2KW4 A;  4BWJ A;  3OYJ A;  4KHN A;  1NOZ A;  2FC0 A;  1ZBU A;  2OPP A;  3EY1 A;  1X9W A;  4FLV A;  1NKE A;  3TAP A;  4Z4I A;  1XWL A;  2P51 A;  3TAF A;  4DWI A;  3K2P A;  3RRH A;  3ZSO A;  4JLH A;  4CJL A;  2KTQ A;  4DSL A;  5HRR A;  4CK1 A;  4EP4 A;  4KB1 A;  2KFN A;  1KFD A;  3O3G A;  4HCB A;  3ZCM A;  3RR7 A;  4CCH A;  1SUQ A;  1U4B A;  4B9S A;  2F8S A;  2KQ2 A;  1LAW A;  4B9T A;  4M3Z A;  3AA5 X;  4DFJ A;  3PO5 A;  1CXU A;  1LV5 A;  4FLY A;  2Z1H A;  3DLG A;  4CJE A;  3NGI A;  1QSL A;  4B9M A;  3P83 D;  4MFB A;  1FKP A;  3PX4 A;  3KK1 A;  4C8O A;  2DFF A;  1BIU A;  4E1N A;  3HK2 A;  2YNI A;  1S1U A;  1G15 A;  3RMB A;  3HPH A;  4FLX A;  3AV9 A;  4OKJ A;  1TKZ A;  2GUI A;  2D0B A;  4PWD A;  2QXF A;  4OKK A;  1JLE A;  4ZHR A;  4C8K A;  4B9L A;  3AVG A;  4CJU A;  4I7F A;  5J2N A;  3CFO A;  1TAQ A;  3NF6 A;  4DU4 A;  1JL2 A;  1ASU A;  4DQI A;  2IC3 A;  2ZD1 A;  4FZY A;  1LAV A;  1RIL A;  4BAC A;  5K14 A;  3ALY A;  4O5B A;  1KSP A;  3WNE A;  1A5V A;  3B6O A;  3ZSW A;  1JXE A;  4M3R A;  3HP9 A;  3SQ4 A;  4EZ9 A;  2HHX A;  4LY7 A;  4KI6 A;  3HXM A;  3VQQ A;  1A5X A;  5HBM A;  3OYM A;  3I8D A;  3SV4 A;  4DSJ A;  3OYD A;  3AO3 A;  3VQ8 A;  4OPJ A;  4BE1 A;  4KTZ A;  2YNH A;  4W5O A;  3TAB A;  3SNN A;  5FDL A;  4F8R A;  3AVJ A;  1QSY A;  4DS4 A;  2FBT A;  3K59 A;  3QET A;  4B9N A;  1RDD A;  4CJ5 A;  2HVH A;  3VQ6 A;  3NH2 A;  3K57 A;  1WLJ A;  2YHA A;  3S3M A;  4CK2 A;  4DSF A;  4CJQ A;  4FJJ A;  4Z4G A;  4BWM A;  1RDB A;  1VSH A;  4F2R A;  3ZT3 A;  2G8U A;  4AHV A;  2OPQ A;  3KLG A;  1TK8 A;  4M3Y A;  4IG0 A;  5SWM A;  4B9U A;  1C1C A;  4KKO A;  2QKB A;  1IKV A;  1IO2 A;  2E6L A;  3LDS A;  4N76 A;  3VQ9 A;  2HW3 A;  1S1T A;  5T7B A;  3PO4 A;  1QQC A;  3MXJ A;  5D3G A;  4DTN A;  2G8I A;  1TGO A;  3DMJ A;  2X78 A;  4CEF A;  3K58 A;  1U48 A;  4C8M A;  2HND A;  4CES A;  3OYK A;  3KJV A;  1VSK A;  2HMI A;  4M42 A;  1Y97 A;  3NCI A;  3ZT1 A;  2RN2 A;  1UAX A;  4CGJ A;  4HVJ A;  3IG1 A;  3AVI A;  3K5O A;  3RWU A;  2P5O A;  4OVL A;  3VQB A;  1L3V A;  4C8L A;  4DF8 A;  4DS5 A;  1UWB A;  4CE9 A;  3NGZ A;  3VQA A;  1BHL A;  3TAR A;  1TV6 A;  1S1X A;  2B5J A;  5C42 A;  3O3F A;  2HB5 A;  3L2W A;  4FJN A;  3QEV A;  1NJY A;  4DQQ A;  1U45 A;  3S3O A;  1U04 A;  3MEE A;  1HJR A;  4KFB A;  5C25 A;  4DTS A;  3QNO A;  1F21 A;  1K6Y A;  1HMV A;  3AVK A;  4AHS A;  3V4I A;  4F3O A;  4M3U A;  4Q0B A;  2HHT A;  4ZTJ A;  1RBT A;  1JLQ A;  4DLE A;  3OJU A;  4HUE A;  1JLG A;  4LSL A;  5DMR A;  3ZSV A;  1VRU A;  2IS3 A;  4E7I A;  4FJ7 A;  1GOB A;  4FK2 A;  1L5U A;  5J2P A;  4KHS A;  1HQU A;  4CJ4 A;  2Q3S A;  4N5S A;  4DTX A;  2X6S A;  3DLH A;  4W5N A;  4DTR A;  3QNN A;  3LWL A;  3ITH A;  4XIU A;  3LP3 A;  3SI6 A;  3S3N A;  4CJ3 A;  4FW1 A;  4CJT A;  1RT4 A;  3MEC A;  3OS1 A;  2WON A;  1W9H A;  3OS0 A;  1RT6 A;  3M8S A;  1ZBL A;  1N5Y A;  1HQE A;  5KRS A;  3NH0 A;  2OPS A;  1QS4 A;  3DLK A;  3DRR A;  1RTI A;  3PX0 A;  1NJX A;  2FBX A;  2YKM A;  4DFP A;  3OYL A;  1JXB A;  3AVA A;  1JLF A;  2XY6 A;  1T7P A;  4M3T A;  1U49 A;  4H8K A;  4UQG A;  4HHT A;  1RCH A;  1S9G A;  4O44 A;  3DOK A;  4CIG A;  4FVM A;  1ASW A;  1D9F A;  4M45 A;  3KKR A;  1UOC A;  3HM9 A;  4AIL C;  1Q9X A;  3QIP A;  4LSN A;  3KK3 A;  4FZZ A;  2BGG A;  2YNG A;  4NYF A;  4Z0U A;  4OPK A;  4BE2 A;  1I39 A;  3F73 A;  1RT2 A;  2ZQB A;  1BIZ A;  2ATQ A;  4FJ8 A;  3ZT0 A;  1TVR A;  1NKB A;  3HVT A;  5CYM A;  4CJK A;  1VSM A;  4FLT A;  4HTU A;  3PUF A;  1ITG A;  4ELT A;  1VRT A;  3QEW A;  1YT3 A;  4FJM A;  1RBR A;  3OYA A;  2XY7 A;  5FRO A;  3D45 A;  1S1W A;  3KLF A;  1S6Q A;  3ULD A;  1XI1 A;  2F8T A;  1C0T A;  3PX6 A;  3AVB A;  3ZT2 A;  4DLG A;  2KFZ A;  1X9S A;  2HHV A;  3HL8 A;  4B8A B;  4CF1 A;  3DRS A;  2D5R A;  1FKO A;  4CF9 A;  3AVN A;  1SL2 A;  2R7Y A;  1RBS A;  1EX4 A;  4GW6 A;  3CYM A;  3QO9 A;  2XY8 A;  3LZJ A;  3VA0 A;  4IDK A;  3RMC A;  1WN7 A;  1ZBH A;  4L8R B;  1RT5 A;  2HHW A;  1JKH A;  4CGF A;  4IBN A;  4B08 A;  2YNF A;  2IDO A;  1WSI A;  3BDP A;  1DTT A;  3ISN C;  4M3W A;  4KAZ A;  4OJR A;  4FJL A;  1ZBF A;  1TL1 A;  3AVM A;  4QAG A;  3P5J A;  1R0A A;  1VSF A;  3DI6 A;  2ZE2 A;  3NF9 A;  4JS5 A;  5SZT A;  4W5T A;  1TK0 A;  2OZM A;  5CZ2 A;  3SUP A;  3M8R A;  5HP1 A;  1XHX A;  1KRP A;  4OLA A;  2IAJ A;  1IKW A;  4I9L A;  2FBV A;  1J53 A;  4DTO A;  1ZYQ A;  5HRN A;  1BI4 A;  4KPY A;  1VSE A;  3V81 A;  4BDP A;  4Z4E A;  2DTU A;  1KFS A;  3TAE A;  4ICL A;  3SQ2 A;  1FK9 A;  3WNF A;  1T05 A;  4RW8 A;  4PQU A;  1X1P A;  1NKC A;  4MQ3 A;  4O0J A;  1BCO A;  4FCY A;  2PYJ A;  2VWK A;  4JRQ A;  4I2P A;  2KZZ A;  1VK0 A;  2E6M A;  2E4L A;  4Z4C A;  3U6F A;  4CGH A;  3RTV A;  5CYQ A;  1RT3 A;  2G8H A;  4CHO A;  1NK8 A;  3ZSZ A;  1D8Y A;  5KRT A;  2AJQ A;  1VSJ A;  3RMD A;  3AA2 A;  3OS2 A;  4F2S A;  1B92 A;  4NYN A;  3FFI A;  2DFE A;  3KIO A;  4DQR A;  3K5L A;  4IFY A;  4DTU A;  1NJW A;  2EHG A;  3DLB A;  1X9M A;  4JRP A;  4DSE A;  3OYB A;  2XO7 A;  4DG1 A;  3HPO A;  4CHN A;  4RW6 A;  4R5P A;  4KI4 A;  1ASV A;  1CZ9 A;  3T3F A;  1HRH A;  1NK7 A;  3BGR A;  3VQP A;  4Q5V A;  1RBU A;  3HVR A;  3OYG A;  2ETJ A;  4LH5 A;  2RPI A;  2JGU A;  3EZ5 A;  3QER A;  1QE1 A;  4CHZ A;  1T8E A;  2Y1J A;  3PV8 A;  3SUQ A;  2BDP A;  3OY9 A;  3UIQ A;  2G8W A;  2PY5 A;  4BDZ A;  1QSS A;  4OGE A;  2Y1I A;  2O4G A;  3O3H A;  1BIS A;  4CEA A;  3V9W A;  2G8F A;  1NJZ A;  4CEZ A;  4J2B A;  3NF8 A;  4AHR A;  1KCF A;  3IRX A;  1D9D A;  3SQ0 A;  3LAN A;  4H4O A;  4CFA A;  1WSJ A;  1WAJ A;  3L2Q A;  1LW0 A;  3VQE A;  2D0A A;  3O4N A;  4DSI A;  3ZT4 A;  1VSL A;  3U3Y A;  4KRF A;  1IH7 A;  2DFH A;  5HLF A;  4EZ6 A;  4CEC A;  4CEE A;  2RKI A;  1BQM A;  2HHQ A;  1JLB A;  3NDK A;  2YHB A;  3SYZ A;  4KTQ A;  4RG8 A;  3LP2 A;  4FYD A;  3SPZ A;  3OVN A;  3V1Q A;  1RBV A;  4RW7 A;  3KLE A;  4M3X A;  2LSN A;  1SKR A;  3U3G A;  3A2F A;  3ZSQ A;  1BI4 B;  3D0P A;  4K8Z A;  5J2Q A;  4PA1 A;  3KLH A;  4N56 A;  1B9F A;  1C1A A;  1C0U A;  2XHB A;  4DTJ A;  5I3U A;  4B9V A;  4FJX A;  2JLE A;  4CGD A;  3OYH A;  3MXI A;  4WE1 A;  3DRP A;  5DK5 A;  3QIN A;  4KRE A;  3M8P A;  4DU1 A;  1LWE A;  1VSI A;  3L2R A;  1HYZ A;  2HHU A;  4FM1 A;  4B8C A;  4OLB A;  4AHC A;  3OYF A;  4GMJ B;  3RR8 A;  5E41 A;  4Y1C A;  1L3U A;  2B4J A;  2HVI A;  3ZSX A;  1TL3 A;  4E3S A;  1TKT A;  2NUB A;  1REV A;  4E19 A;  1S5J A;  2XRI A;  3V9X A;  1B9D A;  4CEB A;  3V9S A;  2QKK A;  2QK9 A;  1MU2 A;  4J2D A;  4NCA A;  4CGG A;  2VG5 A;  4E7L A;  3E01 A;  1BGX T;  1HPZ A;  3AO4 A;  5HRS A;  4CGI A;  3RMA A;  2PZS A;  4E89 A;  1SKS A;  4HCC A;  4ID1 A;  1HYS A;  5CZ1 A;  2GV9 A;  4N47 A;  4ELV A;  2G8K A;  3H08 A;  4FJI A;  1YTU A;  5I42 A;  1J54 A;  3LAM A;  5JS2 A;  3K5N A;  3OYI A;  4J2E A;  2P1J A;  4FM2 A;  5KGX A;  4FJK A;  4FXD A;  3SCX A;  1QHT A;  3NBP A;  3TI0 A;  1Z25 A;  1CXQ A;  3L2U A;  3G0Z A;  3AO1 A;  1WSG A;  3O4Q A;  3SPY A;  4K8X A;  1RT1 A;  1N6Q A;  4FJH A;  1LW2 A;  2A1S A;  3KKS A;  3NH1 A;  4OKE A;  4NCB A;  4CIF A;  3C95 A;  5KI6 A;  3TAM A;  3SUO A;  4J2A A;  2OPR A;  3LPT A;  4CJP A;  1W0H A;  3QES A;  2XY5 A;  3T19 A;  3VQ4 A;  3WNH A;  1RDC A;  3OYE A;  4FLU A;  1RNH A;  4O55 A;  4CJS A;  4FJ5 A;  3LPU A;  4C8N A;  4YNQ A;  3TAN A;  1NK9 A;  2HNY A;  3LAL A;  3HT3 A;  3SZ2 A;  4KHQ A;  3T1A A;  2HHS A;  3TAQ A;  1HNV A;  5J2M A;  4FW2 A;  3LP1 A;  4Z4H A;  1TAU A;  2KZM A;  1KLM A;  2BE2 A;  1KVB A;  4CJF A;  3ZSR A;  4LH4 A;  3DOL A;  4FZX C;  2D0C A;  4F3T A;  3CQ8 A;  5JS1 A;  4CER A;  3KK2 A;  1RT7 A;  3AVH A;  4DMN A;  4CFC A;  3HJF A;  2VG6 A;  3IS9 A;  1HNI A;  1RTJ A;  2F96 A;  3OYC A;  1C1B A;  4E7J A;  3PY8 A;  3NFA A;  1QTM A;  2X6N A;  4PY5 A;  3I0R A;  2OZS A;  3MAQ A;  3M8Q A;  2IOC A;  1BL3 A;  1KVC A;  4M41 A;  4ELU A;  4IKF A;  4CK3 A;  3VQC A;  4O4G A;  4QCL A;  4OGC A;  3V6D A;  1NK0 A;  1BQN A;  4KTW A;  2VWJ A;  3DM2 A;  3OJS A;  4HUG A;  1WSF A;  3MEG A;  3AA4 A;  4F4K A;  4FK4 A;  2I5J A;  1LWC A;  2YKN A;  4AH9 A;  3I0S A;  3QIO A;  4DFM A;  3ASM A;  4FK0 A;  3VQ7 A;  1TK5 A;  1UA1 A;  2Z1J A;  1BCM A;  4B3O A;  3DLE A;  3L2V A;  1S6P A;  4ZTF A;  3QEI A;  5J1E A;  1NK6 A;  4FLW A;  1JLA A;  4NCG A;  4KHW A;  4I2Q A;  4H4M A;  3VQD A;  4DFK A;  4DQS A;  3LZI A;  2A1R A;  3HPG A;  1CZB A;  4TSX A;  3JYT A;  3K5M A;  1LWF A;  1WNS A;  1UA0 A;  4CJV A;  1GOC A;  1C6V A;  1EXQ A;  3AVL A;  3KLI A;  1I3A A;  1WSE A;  4CFD A;  4AHT A;  1T03 A;  4W5R A;  1KLN A;  3B6P A;  3LAK A;  4CF2 A;  3HST B;  4DQP A;  4AHU A;  1EP4 A;  4E1M A;  1YTA A;  1IKX A;  3NGY A;  1RTD A;  1SL0 A;  4G1Q A;  3EYZ A;  3KD1 E;  3CM6 A;  3C6T A;  4DU3 A;  4E0D A;  3AO2 A;  1SKW A;  1DLO A;  2PYL A;  4IFV A;  4Y1D A;  2WOM A;  2RF2 A;  3CFR A;  3QLH A;  1O1W A;  3TWH A;  1D5A A;  3MED A;  2BAN A;  4BDY A;  1RTH A;  4DTP A;  4FJ9 A;  3G10 A;  4N41 A;  4I9Q A;  3NAE A;  1KTQ A;  1VSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...