1HNXK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1hnxK00
4DR1K 4YHHK 4JI8K 1IBMK 1HNXK 4B3MK 4DR3K 4JYAK 2VQEK 5LMUK 4JI6K 4DR5K 5A2QO 4X66K 4DV3K 5FLXO 4DUYK 1XMOK 2E5LK 4X65K 4NXNK 1N33K 3J7YP 1IBLK 5IT9O 4JI1K 3T1YK 4DR7K 4DR4K 4LF8K 4LF4K 5BR8K 2UUAK 2UXBK 3OTOK 4LF5K 1HNWK 4OX9K 4DV5K 4GKKK 4LF7K 5AJ3K 4LF9K 4DV6K 4JV5K 1I94K 1XMQK 4JI4K 3J81O 4DUZK 4YY3K 4AQYK 4JI3K 4GKJK 4LFAK 1N36K 4JI5K 1N34K 5LMNK 1IBKK 4DV4K 3JAMO 2UU9K 4B3TK 4DR2K 4B3SK 4NXMK 1FJGK 4X62K 2F4VK 4DV7K 4JI2K 4DR6K 3J80O 1XNQK 3J7AP 4CW7B 4V19S 2UXDK 5LL6Z 4DV0K 2UUCK 4LF6K 1XNRK 5IWAK 3T1HK 4K0KK 4B3RK 4KHPK 4DV1K 1HR0K 2HHHK 4CVNE 2UUBK 2VQFK 4JI7K 4DV2K 1HNZK 2UXCK 4LFBK 4LFCK 1N32K 2ZM6K 4JI0K 4X64K 1J5EK
chains in the Genus database with same CATH superfamily
4DQIA 3O3GA 3E01A 4O0IA 2ZJQL 5C24A 2O8FB 4IFYA 4JYAK 3THXA 3LP0A 1HJRA 3LM9A 3QMLA 3D0PA 3V81A 2NUBA 3TU5A 1N8RO 3LPUA 3U9DA 2B4JA 1RBRA 2RHKA 4OO1J 2P9LB 2F8SA 5KTQA 3CC7N 4C1NK 4RCHA 4CGJA 2QA4N 4DSIA 3J7YP 1IBLK 1TK8A 4C23A 4CF0A 3VQ9A 3M8SA 4DS4A 1A5WA 3JSMA 2YNFA 1JXEA 3V9ZA 2O4IA 3AA5X 2HMPA 5M1OA 1O1WA 3HI0A 1QE1A 1RILA 1RTIA 2V51B 1YIJN 3OVNA 1S1VA 1U6ZA 4IEIA 3VEOA 5GIPA 4FO0A 4Z4GA 3VTHA 4YOTA 3J81O 1TYQA 1DKGD 3SNNA 2Q36A 4CEDA 1C0TA 4FPBA 1WSEA 2QWPA 4H5VA 4FJ9A 1G15A 1BO5O 3T3FA 1GLFO 1VQNN 1HKCA 2D0BA 3PO4A 2KFNA 2W40A 1QSSA 2RKIA 3MXJA 3DLEA 1GOCA 1LAVA 4BG8A 4OJRA 3HSTB 4BE1A 3PIPL 3DLBA 1TAQA 1CLQA 4E7IA 5BR9A 1V4SA 4FVMA 3THVA 3C65A 3VETA 3AO3A 4OKKA 4PKHA 3CCUN 2QEXN 1IJJA 3QFUA 2XY8A 3CETA 4Z4HA 4EP4A 3KK3A 4RTFD 2UXDK 3ZX3A 4ISGA 3M8PA 4CGIA 5LL6Z 2UUCK 1VSFA 1NOYA 4B3RK 1XC9A 1BI4A 4HCBA 3CCQN 2YCHA 2XY6A 4IO8A 3AVBA 4M3YA 1DTQA 1K73O 3LDPA 2ZGZA 4AHTA 3LPTA 1UOCA 1NNEA 1ATSA 1UA1A 4BC4A 3V1OA 3Q7BA 2H3GX 5CYMA 1U45A 2E2OA 4CFBA 4BG9A 1REVA 2ASOA 3HRGA 1NGIA 3HZ6A 4I6MB 3T69A 3AY9A 3NGYA 2OTJN 3S3OA 1WBBA 2HHQA 4FYDA 1D9FA 1NJIO 5AFUH 1LWCA 3MN6A 3H08A 4BGBA 3K57A 4CJVA 1YHQN 4F3TA 2W42A 4QAGA 1VHXA 2E8AA 4F2SA 3CQXA 3OYNA 3R1XA 3VEXA 4PA1A 1SKWA 4FM0A 1U04A 3VESA 4R79A 3JS6A 4W5TA 2ETJA 4AHRA 3O9SA 4FWSA 1JLEA 2ZWHA 2P9NA 3PUFA 4BRGA 3KLFA 1RT5A 4C8KA 4E1MA 3ZX2A 4FLXA 1T6CA 2VWKA 4YOWA 1NGBA 3U3GA 3EO3A 4M3WA 2Q2RA 4B8CA 4CK3A 3M6GA 4ID1A 2IOCA 3GE1A 4BR0A 3OY9A 4FK4A 2F9TA 4U7BA 3L4IA 5DM6L 1NK5A 3E1YA 2HBKA 1VQON 1GLDG 3MXIA 4GVEA 3G10A 4IDKA 4KH6A 4FW2A 3IMXA 5DMRA 3PV8A 4IDHA 5AQFA 2FF3B 4YFUA 1HYSA 2NNWA 1HR0K 5F2RA 4DKWA 4DMNA 4CF8A 1JLCA 4BROA 2Z1GA 2O8DA 1MDUB 3ID6A 3CFOA 3SYZA 1TAUA 3CYMA 3H45C 4CHOA 4L3QA 1YTAA 3V6DA 4M3UA 4JHDB 2ITMA 1IH7A 4KTQA 2QWOA 1D9DA 3CJAA 3FZMA 2D0AA 2ITGA 2BDPA 3ZT0A 3ULDA 4MFBA 1OH7A 4H4MA 3TPQA 1RTHA 4FJGA 4FK0A 3THXB 3QETA 1SL2A 2B6AA 1GOBA 4FLVA 3RRGA 1LOTB 3I0RA 1SL1A 3FGUA 3SUNA 1YT3A 1J53A 2GWJA 3U8XA 4CCHA 4J2DA 2BE2A 2DFEA 2YNGA 4CECA 3VEVA 2NRVA 3NH1A 3THWA 2HNZA 3PLAA 1DGKN 2QWQA 2OZMA 4DFMA 3RMDA 3H6EA 3MN9A 1ZBFA 4H5NA 2HBLA 4JI4K 4FZZA 4CJSA 4KAZA 1C0FA 3GBTA 5AQQA 2WTUA 4DUZK 3N4QA 1TYQB 4GKJK 1CXUA 1NU0A 1NK4A 4DB3A 4H0XB 1J54A 4XEIA 1XUPO 3F2KA 5E26A 4DQQA 4BR5A 4KPYA 4JKAA 3A8YA 4NXMK 4CZHA 1IG9A 3P1GA 3OYCA 3LDNA 3QFPA 3VQAA 2YHBA 3S9HA 2HVHA 3QESA 4BDYA 3H46O 4AF1A 3WT0A 3WXKA 3RMBA 1YITN 2IGIA 4Q0BA 4CF2A 3LM2A 2HB5A 3LWLA 1JL1A 4LF6K 3VEYA 2OA8A 1EO1A 3VGMA 4JD2A 3TSUA 3ZT2A 2XHBA 3KJVA 4JAXA 1BI4B 1ZC6A 3FFIA 4Z4CA 1TKDA 3NBPA 4K41A 3L2WA 2HHTA 3DXMA 1TL3A 4NB4A 4M41A 4NLCA 2P51A 4YDUC 4A62A 4FLYA 4LC9B 2GTDA 4HVJA 5HLFA 5AQZA 3C6UA 3DOLA 4DR1K 4CJRA 3HPOA 1WN7A 3B8AX 4CK1A 5HOOA 4CEZA 4DF4A 3PX4A 3K5LA 1T44A 4B08A 1Q9XA 3CI5A 3O9QA 1YVNA 1KQSM 3QICA 3DLGA 4KO0A 1ZBIA 4DLEA 1VAZA 1X9SA 1T8EA 2E5LK 3W3DA 1WNSA 4JI1K 2Q0RA 3DOKA 5FPDA 4Z0UA 1F21A 2I7NA 1YJWN 5BR8K 2Q3SA 2QXFA 4K25A 4BRNA 3IG1A 3AVNA 3VQ5A 1LAWA 1RDBA 3AA3A 3J7ZO 2BTFA 3TARA 4JV5K 3THYA 4FJIA 4CZEA 2P9NB 4L8RB 2YKNA 3CJ7A 4DU1A 1NGJA 4DFKA 2HHSA 5JS1A 4H8KA 1EP4A 1C1BA 4JI5K 3M3ZA 1M90O 1KAZA 2IS3A 1HNVA 3LZJA 2FSJA 3CCJN 3HVTA 4W5QA 3P4IA 4RW7A 1JLBA 4BC3A 4FJNA 3MDQA 3U6FA 3NGZA 1TL1A 4DS5A 3QNOA 5FPMA 3QEWA 1Q18A 1ZBUA 3CJCA 3OW2M 1XNQK 3VA0A 2Q0UA 1T6DA 3QB0A 1OH8A 5CHIA 3GL1A 3KZBA 4H0OA 3S41A 1WUAA 3VENA 3HPGA 3MEDA 1XNRK 1ASUA 4FJ5A 2FF6A 3ZX0A 2B5JA 4CJ4A 4CEOA 4ID5A 2PZSA 3ULEA 2VQFK 4DV2K 2O8DB 1S1TA 2X78A 3ITHA 2YJFA 5J2NA 3KLIA 2OPSA 3KKSA 4Z94A 1IBMK 1B9DA 4PY5A 3EE8A 1D4XA 3W0LA 2E2QA 3AVMA 4KFBA 3D2FA 4PUOA 5A2QO 3JYTA 4ILJA 4CBXA 3F73A 4CGDA 4W5OA 1BGXT 3VF6A 1UWBA 4N56A 4HWIA 3AAPA 4LSNA 4OGCA 4WQ5C 4M45A 3P38A 2G8VA 1W7AA 4CHYA 2PAVA 2WONA 4JKCA 2UUAK 4Y1CA 5AR0A 4CFDA 4WFAL 3SAGA 1HNWK 4XH4A 1ILYA 3NFAA 3THWB 3T1AA 4A5AA 5J2QA 3NMUA 3VMFB 5K14A 3H1QA 4K8ZA 4BRDA 1X3MA 4NO7A 1ATRA 3SV3A 5EXWA 2F9WA 4JI3K 3SAHA 4B1WB 4LFAK 3EZ5A 2NRHA 3OYIA 1ZBSA 3AV9A 3ZSXA 2KTQA 2NRTA 4AHUA 3L3UA 1RT1A 3G71N 3QBXA 5M1QA 4PWDA 5GAHP 4CERA 3DLRA 5AZJA 4GV9A 2O4GA 3HBTA 3PIOL 3CG7A 3DRPA 4KHYA 4E1JA 2HHWA 4G9ZA 1RTDA 3VQDA 3PX0A 1ASWA 4MLEA 4Y0WA 4IEEA 4JD2B 4KB1A 1MU2A 1Z05A 3TAMA 4I9QA 4OKEA 5F1XA 1ZXOA 2J4RA 3LP1A 1KAXA 3DXMB 1VRTA 3ZT4A 3DI6A 4LFBK 2WC9A 2UYTA 2X74A 2Y1IA 1YJ9N 4IFVA 3K5NA 3OYEA 3HL8A 3H1VX 2AA4A 3S3NA 2VCPA 3CQYA 4B3MK 4CF1A 4E19A 5HBMA 3MECA 3DYAA 5F0XA 3OYHA 3SUQA 5KGXA 4Q5VA 4CHNA 4DUYK 3UKUA 4FM1A 3CCEN 1VQLN 4FWPA 1OVYA 1RT6A 3LAMA 3V9WA 2D1KA 3A5MC 4DR7K 3KKRA 4M3RA 1GLJO 3UIQA 4DU4A 5E41A 3I56N 5AQWA 2KQ2A 3BP8A 3O9TA 5J1EA 4YNQA 4GKKK 3KWGA 4NCAA 3O8MA 4IFEA 3THYB 4M63C 4LH5A 5I3UA 1UA0A 3TTFA 4GMJB 4JKHA 4H5TA 3K2PA 4DTXA 4DSFA 3KLEA 2FSKA 3SAFA 1G99A 3VQ6A 3SCXA 2OANA 4OPJA 1BCOA 4E7JA 2GELA 3WXIA 4BACA 1SS6A 1NK9A 4R5PA 3RR8A 2KLAA 4EZ6A 5AQIA 5AQUA 2HF4A 2XRIA 2PYLA 4X62K 4DSJA 4FVUA 2V7YA 2HF3A 2F4VK 4CEBA 3QBWA 2D0CA 2PY5A 1U49A 4RW9A 4FJ8A 1I3AA 4CFCA 1L3UA 4WFNL 3EKSA 2FBYA 4V19S 1R59O 2D4WA 3ZSQA 3HM8A 4DV0K 3AVFA 5AZIA 5MLCQ 4FWLA 3OYDA 2QTDA 3AAQA 4JEPA 3MXMA 1J6ZA 4E1NA 3ENOA 2CGJA 1L5UA 3VPZA 4CVNE 4PKGA 3KD1E 5AQMA 3IUCA 3ULEB 1OVQA 1IKXA 1A5VA 5FDLA 1J9AA 2KW4A 4C8OA 4KTZA 2ZM6K 3I8BA 4BRAA 1BQMA 2IC3A 5CZ2A 1JKHA 2QXLA 4CEQA 3DXKA 2VG6A 1NK7A 3E9LA 1W9HA 4YDUA 1FW6A 3F9MA 3AGKA 1QHTA 4GV3A 3TSQA 1B92A 4BRHA 3D2FB 1NJXA 1Z25A 1IO2A 3QNNA 1QSYA 3MWPA 3O80A 2QW9A 3CCSN 4CBWA 4NYFA 4NXNK 4A2BA 5IT9O 4CEAA 3L4QA 2YHAA 1TV6A 4N76A 2F96A 3NH0A 1HPMA 1X3NA 3K5OA 1XQSC 3KTQA 5JVGL 5C2DA 1YXQA 4OPAA 5AJ3K 4DQ8A 5SWMA 1QQNA 4WE1A 2EHGA 1GLBG 4HUGA 1E4FT 4FWOA 5JVHL 4BRKA 4GVMA 5JS2A 2VG7A 3C94A 1VQ7N 3EEQA 3B6PA 3AO1A 1N34K 3SJJA 4DV4K 3JAMO 4YOYA 1NMDA 4H0VB 4CJFA 4NCBA 1KAYA 4DQRA 4DQSA 3EL2A 4AILC 5BREA 4JI2K 1BHLA 4BWMA 5KRSA 4AHSA 3TSPA 4LH4A 5AZJB 4F3OA 3TTCA 4WQ4C 3BDPA 4CHQA 1BISA 4H0PA 4KH4A 1FKPA 4W5RA 5ELZA 3ZLJA 3ZEUA 3T1HK 4WFBL 3IS9A 3SUPA 4PKIA 1XI1A 4CGHA 3OYAA 4CJ7A 4M3ZA 3AO4A 3SI6A 4NYNA 3SUOA 2HHHK 4W5NA 1HYVA 3RMCA 4I7FA 4BGAA 1KRPA 4A59A 4E7LA 1Q8IA 5EVZA 1L3SA 2F8TA 2D5RA 3RMAA 4LFCK 4Z4FA 2YNHA 5KGWA 3TI0A 2WBNA 3A5LC 1S6QA 2OPRA 2P9UA 4CZJA 4OKJA 4FXDA 4JNEA 1VQPN 5AQXA 4BQZA 3OYLA 4I2QA 1D8YA 4FLTA 2HW3A 4FJLA 1QS4A 3UB5A 2ZE2A 5I9EB 4HCCA 3MK6A 3VN5A 4KTWA 3OHRA 5JLFA 3AO2A 3UKUB 3NAEA 3WXJA 5AQYA 4X65K 4HUFA 3HJFA 4CGFA 1HRHA 3DMJA 2OYQA 4UQGA 1QTMA 3T1YK 1RT7A 2GEMA 3VERA 5C10A 3TAQA 4LF8K 4I9LA 4KHNA 2UXBK 4MQ3A 3P83D 2HHUA 4DV5K 2YV0X 1SV5A 4WQ5A 2I5JA 3C7NA 3HP6A 4M3XA 5AQNA 2JWLA 3P31A 1MA9B 2G8WA 4OPKA 2DPNA 4B8AB 4IOCL 1WB9A 3F9KA 3WNEA 3AVKA 3VA3A 1GLEG 3IAYA 1KVAA 2E4LA 2IVPA 5HP1A 3TANA 5C15A 2OPPA 5GADP 4DCHA 5JMVA 2FLOA 3NDKA 1WSJA 4DR6K 1DTTA 3J7AP 2CH6A 5AFUA 2A41A 1BL3A 3E9OA 4FOIA 1VSJA 5DK5A 5IWAK 3R8EA 3ATVA 5AZIB 4BC5A 3OYFA 3ZT1A 1C0GA 1VSHA 3G6EN 1JLAA 3RWUA 2FSNA 2P9IA 4K43A 1W0HA 1JLGA 2P9PA 3L2RA 4DSEA 3WXMB 3O1WA 1VQ8N 2P1JA 5C42A 2ZJPL 1HNZK 1LCUA 4CZLA 4JRQA 1HPZA 4BR4A 3R3LA 4IZ9A 4X64K 1Q81O 2I7PA 1VSMA 2JWKA 2Q1NA 1KFSA 2G8HA 1NMNA 3DXKB 2A40A 1ASVA 3AVHA 4M7XA 2HOEA 3I8DA 1VQ6N 5C25A 2GUIA 5AQGA 4B9LA 1VRUA 4J2EA 2Z1JA 2VYPA 3WNFA 1WLJA 4BRQA 1SAZA 3V9SA 3O6WA 5M1PA 3NHGA 5D3GA 5ADXH 4B1ZA 3NF8A 3EY1A 2KKZA 4EHUA 3WUHA 2KHOA 3ATUA 1HKBA 4BVPA 2VGMA 3PSFA 1RDDA 2NZTA 5E84A 5JLHA 3DLKA 1BCMA 1CXQA 2DTUA 3SQ1A 3DWLA 1N5YA 3O3HA 2E2NA 3K0SA 3OYKA 3KD5E 4KRFA 3CPWM 5HRNA 1KVCA 3B6OA 3L6QA 1NBWA 1S3XA 2W41A 4RW6A 3AVGA 5LMNK 2UU9K 1NM1A 2D0OA 4DFJA 4B9NA 5SZTA 1NLVA 1BWFO 1IKVA 4FJHA 3WEEA 3LDSA 4H5WA 5CE3A 3AVIA 4B1UB 1HQUA 4YOVA 4C1NI 1SL0A 1KD1O 1NGCA 2A5XA 3ZSWA 4RWTA 2A6AA 4ELTA 4IG3A 1S9EA 3NCIA 4QCLA 5CZ1A 4LSLA 4BR9A 4AHCA 3VQQA 3QEIA 4WYBA 4K42A 2OPQA 3BEXA 4QOZB 1X1PA 4BRPA 2OZSA 3ZEUB 1S72N 3ISNC 1JCEA 1S1XA 2E88A 3HP9A 3RVCA 3VOVA 1VQMN 4MDAA 3CCMN 4NLBA 3CJBA 2ASMA 3KVGA 3FE1A 4KREA 4HTUA 1HNXK 3K9JA 2P9UB 3SPYA 4E7HA 2YJEA 1H1VA 4CJPA 4PHTX 4DR5K 4O44A 2QWMA 4CESA 3D45A 1C1CA 4DSKA 4ISFA 1RT2A 3ENBA 4FJJA 3HYFA 1K6YA 3TTDA 3D2EA 3VQ8A 1QZ6A 4FLWA 4CJUA 4DTOA 1YAGA 1S6PA 3VGLA 4U67L 2HMIA 4J8FA 5M1KA 4O4GA 3SQ0A 3P5JA 1NG9A 5FPNA 3CERA 1KXPA 4LF7K 4CHPA 2X6SA 4H0TB 1I94K 3C7NB 3AGRA 2YHXA 3OJUA 1TKXA 4JKDA 2IIRA 1KLNA 1WSFA 4FLUA 3D7EO 4M3TA 5J2MA 3HOTA 1N36K 3RR7A 4HTLA 5CY4A 5BRFA 3BF3A 3M8QA 3O5BA 3NVMA 2P9KA 4CEFA 4DTSA 1BUPA 3ZSZA 1NGFA 5HRRA 3GOIA 4O5BA 4DTPA 1FJGK 3U3YA 4BRFA 4CIFA 2QM1A 1U4BA 3TWHA 4FJXA 4IWVA 5TKWA 2GV9A 4HUEA 3CM6A 3VQEA 1S1WA 3AO5A 2KFZA 3SJHA 4YOUA 3SK3A 4FW1A 2ZD1A 3TAFA 4DU3A 3VF4A 4FWNA 1S5JA 3VEZA 2YX6A 3ZETA 2F7TA 3SBTA 1YF5L 3LL3A 3RRHA 2PBDA 4CFAA 2EX3A 4MO5A 2A3ZA 2RN2A 3PX6A 3OS1A 4FWMA 4WQ4A 4JKEA 4MDBA 2P9IB 4H5RA 2RPIA 2OCEA 1QHAA 2P9PB 2ZJRL 1GLCG 4H4OA 4DQPA 4IOXA 4N41A 5BPNA 4O5FA 5FRNA 3UKRA 3TAGA 3C6TA 1Q82O 4FOEA 1N32K 4GNIA 5GAEP 3ALYA 4CZGA 5KPTA 4JK7A 5KI6A 1U2VA 4CJ5A 4DTUA 2PYJA 4XH1A 4N47A 4YHHK 1VSKA 4ZHRA 1WAFA 1NJYA 4ZTFA 3LALA 2EWSA 2VQEK 5LMUK 2QK9A 2ATQA 1DLOA 3O9RA 1RDAA 4Z4EA 5C0YA 4CBUA 1X9MA 1VK0A 2NRRA 3RSEA 1IKWA 3AA4A 4TSXA 1XHXA 2JGUA 4O55A 4BDZA 2R7YA 2VWBA 3CHWA 1TKZA 1K8AO 2Z1HA 4YORA 3C6AA 5BN9A 3OYGA 4LY7A 1VQ4N 5BRDA 5AQVA 2IVOA 3FZLA 1SZ2A 1XC3A 2E6MA 4AM7A 3LDQA 2P9SB 1MWKA 1RBVA 4AQYK 3CCVN 2YI1A 4KHQA 1C6VA 1D5AA 4B9SA 3CFPA 4B9UA 4DR2K 4B3SK 4CZIA 1TKTA 3CC2N 4FSVA 3I33A 5AQSA 3L8BA 3EZWA 3WEEB 1YVUA 3SMSA 1Q86O 1T3VA 4DV7K 4AH9A 3L2QA 1HQEA 1KCFA 2LSNA 3AA2A 3I0SA 4CW7B 2VG5A 1E3MA 3LDLA 4CD1A 4CI6A 1BA0A 4BRIA 1LW2A 4CJTA 4KI6A 4NCGA 1SKRA 3CMAN 1U48A 4DV1K 1YUWA 2DY4A 3WQTA 1U47A 1K9MO 3BZKA 3SLCA 5BPLA 3A2FA 3FFKB 4CZKA 2OTLN 1RFQA 2FBTA 1BA1A 1NGGA 4FCYA 3MX2A 3DRSA 2X6NA 4CJ3A 4JI0K 3A5NC 3V1RA 1R0AA 5FRMA 3H3OB 4KI4A 4C8MA 4H03B 3V9UA 1HYZA 1M1KO 4RW4A 2AP1A 1VSLA 3QERA 2QKKA 2FC0A 1VQ9N 3K59A 5M1FA 2DFHA 5FROA 4DV3K 1JLFA 4JK8A 1EWQA 3BGRA 1XMOK 1NGEA 2FXUA 5LJVA 2O8CA 4JS4A 1K8KA 1LWFA 3CM5A 3CD6N 3CF5L 2RE2A 1TK0A 3D2EB 1WAJA 3O4QA 1RNHA 1JLQA 4ICLA 1ZBHA 3DRRA 3MX5A 4OX9K 4F9OA 2JLEA 2V52B 4LF9K 3OYBA 1NK8A 4CD3A 4I2PA 4M42A 3KHYA 3AVJA 2XY5A 3DLLL 4PQUA 2GX9A 5BRHA 4F4KA 3EE9A 1GLLO 3NGIA 4CHZA 3K9KA 3VQ4A 1NKCA 3MMVA 2O8EA 3V9XA 4DTJA 4WF9L 3R6MA 1QVGM 2P9KB 2IAJA 1NKEA 2Q97A 3V4IA 2PFUA 3P39A 3BY5A 3KK2A 3RTVA 1CZ9A 5T7BA 3WNGA 3MCAB 4M7YA 3G25A 3O3FA 4BE0A 3J8AA 3CC4N 4GY2B 4ZTJA 3MCPA 3ZYYX 2P5OA 4Y1DA 4FJKA 3SV4A 1NGHA 4FWRA 3K58A 1FKOA 3ZETB 4BRMA 3KK1A 1NJZA 2NRWA 2XY7A 4IJAA 3V1QA 1WSGA 2YKMA 1WOQA 1P90A 3AVAA 3SPZA 4B9MA 2G8KA 1OH5A 2UXCK 1NGDA 2HNYA 1X9WA 3LDOA 3VF2A 1BG3A 4EHTA 3ENHA 3UKRB 1KC8O 1RTJA 3MN5A 1C1AA 3IDHA 4J2AA 4QS7A 4JI8K 1C0MA 1U2VB 4RW8A 4BQLA 3K5MA 3L0QA 4MO4A 4A57A 4FLZA 4CJEA 3EYZA 4DR3K 3OBYA 3CXCM 1NJWA 2NLXA 4JI6K 4IXCA 5EOYA 1GLAG 3L2VA 3CMEN 3QIPA 1KLMA 1UAXA 5DM7L 1Q9YA 3EKUA 1N33K 3HTVA 2WOMA 4DHYA 4F8RA 1T05A 3RSEB 2FBXA 3QEXA 4CZFA 5KPZA 4FL9A 3SBGA 5BPMA 5EY4A 2VWJA 1FK9A 3WNHA 3O9UA 1S1UA 2Q31A 2GWKA 1RCHA 3QIOA 1HKGA 3CCLN 4DWIA 3OA9A 1BIZA 3DLHA 4IOAL 1RDWX 1O13A 1WBDA 3QDKA 1KVBA 2DFFA 3HM9A 4JKGA 1EQYA 4MLHA 2O8BA 2E2PA 3WQUA 1ITGA 1RT4A 2W6LA 3KK7A 4BVOA 5B8HA 4ELUA 1SQKA 2V7ZA 3NVKA 1BOTO 4B3TK 3O4WA 2AJQA 1V4TA 1WSHA 4Z4IA 4B9QA 3ZSRA 4OGEA 3VTIA 4CIEA 1BIUA 4EZ9A 1T03A 4BC2A 2BANA 5HROA 5KPRA 4IO9L 4K0KK 1P8ZA 4E89A 3GG4A 4EIAA 1TK5A 3E66A 1WSIA 3OS0A 1S22A 4G1QA 3PY8A 1A5XA 2G8IA 3ZSYA 2G8UA 4FPAA 2NRZA 4B3OA 4DLGA 4FZXC 4JKBA 2BUPA 3LANA 3CPEA 5AQRA 4CJKA 1ZBLA 4FJMA 1RDCA 5KRTA 1NWKA 2Z1IA 4KHUA 1OKJA 2E6LA 4BE2A 1IG8A 4QS9A 4OVLA 4JRPA 3LP2A 3IRXA 5TKYA 1HX1A 1XWLA 3ZSVA 4J2BA 3C6HA 1RT3A 1E4GT 5KQ8A 2O8CB 1K8KB 3CJ1A 3T19A 2E1ZA 2YHWA 4B1VA 5CYQA 1CZBA 3TR8A 3NH2A 4PL8A 2A1SA 3OTOK 4O0JA 3PO5A 4XH5A 1VSDA 4PL7A 1NGAA 3HSCA 4AM6A 4QS8A 1EWRA 1HMVA 1EETA 2QWLA 3HK2A 3VQ7A 4C8LA 4KKOA 1VQ5N 3EN9A 4JKFA 3O08A 5HRSA 4CJQA 1KSPA 1BDGA 2HHXA 1LWEA 4JN4A 3MN7A 3OBWA 4AHVA 1Y97A 3ZSOA 4YY3K 1NKBA 3CJ9A 3HT3A 3VEWA 2HSTA 1YJNN 3NE6A 1IBKK 3FZFA 1W2BM 2O8EB 2HHVA 1I39A 4CE9A 2FBVA 5EX5A 3C95A 5GAGP 1RDUA 4IKFA 2D0PA 4IJNA 4O8UA 5AQJA 2ASPA 3A0IX 3QLHA 4EAHD 5CR4A 2Y1JA 2P5GA 1HNIA 2P9SA 3J80O 1JL2A 4B1YB 1GOAA 3VQPA 4F2RA 3T7ZA 4BRLA 3AVLA 3ZT3A 4ISEA 3OYJA 3F5TA 4LD0A 3S3MA 2IDOA 3GDQA 4GW6A 4CGGA 1QQCA 3D6RA 4EFHA 2UUBK 3JXUA 3CIPA 4JI7K 1OH6A 1SUQA 1YTUA 2QWRA 4N5SA 3HVRA 3G4SN 4A2AA 1RBSA 4FZYA 3CQ8A 3M5RA 1XMQK 3O1BA 3C0BA 2O8FA 2ZF5O 5KQDA 4FK2A 2E20A 3KLHA 3M1FA 1CZAN 3OJSA 1ZYQA 4YOXA 2CGLA 4K8XA 4CJWA 3DJCA 4X66K 2CH5A 3TAEA 2P9LA 5AQTA 4B1XB 5GIOA 2GUPA 4ILGB 4B9VA 1QQOA 3FLCO 4DTNA 2BH1A 2XO7A 3LWMA 4A61A 4FJ7A 1RBTA 2BGGA 4CK2A 3MAQA 1Z6RA 2IVNA 4LF5K 1ATNA 1HJOA 5C12A 2RF2A 1BU6O 3FZKA 4DV6K 4KV8A 3BF1A 5GINA 4ELVA 1HUXA 3SZ2A 4C8NA 5I42A 1DT9A 4KHSA 3TAPA 5EU7A 4DF8A 4BWJA 3LZIA 1Y64A 4E7KA 4KB0A 3DAWA 3O4NA 4JS5A 1RGIA 5C2FA 4KH5A 4JKGB 5LY3A 2WUSA 2O8BB 2GBZA 3HO1A 2W6KA 1X9JA 3Q7CA 1TVRA 1KFDA 4RG8A 4CJLA 3BZCA 2HNDA 2HVIA 3VGKA 1HLUA 1SKSA 3CFRA 2ZQBA 1BQNA 3IFRA 4ILHA 1VSEA 3G0ZA 3SQ4A 5ADXA 2A1RA 1JXBA 3H3NO 3KWIA 3NF7A 3OYMA 5AQLA 4CEEA 1W97L 4FM2A 1JCFA 4OPHA 3IKMA 1NK0A 5LJWA 1Q7YO 3L3VA 2G8FA 3MEGA 1TUYA 3HOSA 2QI2A 4H0YB 1QSLA 4JLHA 3AVCA 1L3VA 4CZMA 1IV0A 4FWKA 1Z26A 3QINA 5M1NA 3A5OC 3OS2A 1QZ5A 1J5EK 2YNIA 1KTQA 4WCEL 4BR7A 5AQOA 1ESVA 1TGOA 3NF9A 4I6MA 4DTMA 1MWMA 3KIOA 4CIGA 4KBOA 1VQKN 2E1YA 5FLXO 5HL7L 3QEPA 5HRPA 2QKBA 3M8RA 1IKYA 1XHZA 3MWTA 4E0DA 3L2UA 3LP3A 4DFPA 3ID8A 1B9FA 1JCGA 5JICA 4DR4K 3VQCA 4DSLA 3QO9A 4LF4K 3U4LA 1NOZA 4E3SA 1VSIA 1FXXA 4IG0A 1N6QA 1EKEA 3FR0A 4EP5A 3I55N 2NRXA 5AQHA 2WFBA 3SQ2A 1EX4A 1L3TA 1EXQA 3QEVA 3R9PA 3KLGA 3HXMA 2YHYA 2KZZA 2QWNA 3TABA 3U9ZA 4JK9A 3DM2A 1LV5A 3ASMA 4O8KA 4DTRA 2CGKA 4A5BA 4IBNA 3MEEA 5AQPA 5BN8A 3BUZB 4BR2A 1JJ2M 4BDPA 3N4PA 4DG1A 3UE5A 1T7PA 1QVFM 1YI2N 1QQMA 3VQBA 4BRCA 5H1SQ 3HPHA 4OLBA 2HBJA 1NK6A 1S9GA 1TUUA 5J2PA 2A42A 2HBMA 5FPEA 3ZCMA 3LAKA 4GV6A 4BY9C 4KHPK 2KZMA 3FZHA 4XIUA 2VGNA 4UY8O 1C0UA 5AQKA 3E9PA 1RBUA 4B9TA 1LW0A 3PSIA 4OLAA 4CF9A 1J5OA 4JHDA 4KHWA 2ZGYA 4HHTA 3WXLA 3AARA 3SMPA 3NF6A 3CCRN 4BREA 4FWQA 1DEJA
chains in the Genus database with same CATH topology
4DR1K 4YHHK 4JI8K 1IBMK 1HNXK 4B3MK 4DR3K 4JYAK 2VQEK 5LMUK 4JI6K 4DR5K 5A2QO 4X66K 4DV3K 5FLXO 4DUYK 1XMOK 2E5LK 4X65K 4NXNK 1N33K 3J7YP 1IBLK 5IT9O 4JI1K 3T1YK 4DR7K 4DR4K 4LF8K 4LF4K 5BR8K 2UUAK 2UXBK 3OTOK 4LF5K 1HNWK 4OX9K 4DV5K 4GKKK 4LF7K 5AJ3K 4LF9K 4DV6K 4JV5K 1I94K 1XMQK 4JI4K 3J81O 4DUZK 4YY3K 4AQYK 4JI3K 4GKJK 4LFAK 1N36K 4JI5K 1N34K 5LMNK 1IBKK 4DV4K 3JAMO 2UU9K 4B3TK 4DR2K 4B3SK 4NXMK 1FJGK 4X62K 2F4VK 4DV7K 4JI2K 4DR6K 3J80O 1XNQK 3J7AP 4CW7B 4V19S 2UXDK 5LL6Z 4DV0K 2UUCK 4LF6K 1XNRK 5IWAK 3T1HK 4K0KK 4B3RK 4KHPK 4DV1K 1HR0K 2HHHK 4CVNE 2UUBK 2VQFK 4JI7K 4DV2K 1HNZK 2UXCK 4LFBK 4LFCK 1N32K 2ZM6K 4JI0K 4X64K 1J5EK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR1 K;  4YHH K;  4JI8 K;  1IBM K;  1HNX K;  4B3M K;  4DR3 K;  4JYA K;  2VQE K;  5LMU K;  4JI6 K;  4DR5 K;  5A2Q O;  4X66 K;  4DV3 K;  5FLX O;  4DUY K;  1XMO K;  2E5L K;  4X65 K;  4NXN K;  1N33 K;  3J7Y P;  1IBL K;  5IT9 O;  4JI1 K;  3T1Y K;  4DR7 K;  4DR4 K;  4LF8 K;  4LF4 K;  5BR8 K;  2UUA K;  2UXB K;  3OTO K;  4LF5 K;  1HNW K;  4OX9 K;  4DV5 K;  4GKK K;  4LF7 K;  5AJ3 K;  4LF9 K;  4DV6 K;  4JV5 K;  1I94 K;  1XMQ K;  4JI4 K;  3J81 O;  4DUZ K;  4YY3 K;  4AQY K;  4JI3 K;  4GKJ K;  4LFA K;  1N36 K;  4JI5 K;  1N34 K;  5LMN K;  1IBK K;  4DV4 K;  3JAM O;  2UU9 K;  4B3T K;  4DR2 K;  4B3S K;  4NXM K;  1FJG K;  4X62 K;  2F4V K;  4DV7 K;  4JI2 K;  4DR6 K;  3J80 O;  1XNQ K;  3J7A P;  4CW7 B;  4V19 S;  2UXD K;  5LL6 Z;  4DV0 K;  2UUC K;  4LF6 K;  1XNR K;  5IWA K;  3T1H K;  4K0K K;  4B3R K;  4KHP K;  4DV1 K;  1HR0 K;  2HHH K;  4CVN E;  2UUB K;  2VQF K;  4JI7 K;  4DV2 K;  1HNZ K;  2UXC K;  4LFB K;  4LFC K;  1N32 K;  2ZM6 K;  4JI0 K;  4X64 K;  1J5E K; 
#chains in the Genus database with same CATH topology
 4DQI A;  3O3G A;  3E01 A;  4O0I A;  2ZJQ L;  5C24 A;  2O8F B;  4IFY A;  4JYA K;  3THX A;  3LP0 A;  1HJR A;  3LM9 A;  3QML A;  3D0P A;  3V81 A;  2NUB A;  3TU5 A;  1N8R O;  3LPU A;  3U9D A;  2B4J A;  1RBR A;  2RHK A;  4OO1 J;  2P9L B;  2F8S A;  5KTQ A;  3CC7 N;  4C1N K;  4RCH A;  4CGJ A;  2QA4 N;  4DSI A;  3J7Y P;  1IBL K;  1TK8 A;  4C23 A;  4CF0 A;  3VQ9 A;  3M8S A;  4DS4 A;  1A5W A;  3JSM A;  2YNF A;  1JXE A;  3V9Z A;  2O4I A;  3AA5 X;  2HMP A;  5M1O A;  1O1W A;  3HI0 A;  1QE1 A;  1RIL A;  1RTI A;  2V51 B;  1YIJ N;  3OVN A;  1S1V A;  1U6Z A;  4IEI A;  3VEO A;  5GIP A;  4FO0 A;  4Z4G A;  3VTH A;  4YOT A;  3J81 O;  1TYQ A;  1DKG D;  3SNN A;  2Q36 A;  4CED A;  1C0T A;  4FPB A;  1WSE A;  2QWP A;  4H5V A;  4FJ9 A;  1G15 A;  1BO5 O;  3T3F A;  1GLF O;  1VQN N;  1HKC A;  2D0B A;  3PO4 A;  2KFN A;  2W40 A;  1QSS A;  2RKI A;  3MXJ A;  3DLE A;  1GOC A;  1LAV A;  4BG8 A;  4OJR A;  3HST B;  4BE1 A;  3PIP L;  3DLB A;  1TAQ A;  1CLQ A;  4E7I A;  5BR9 A;  1V4S A;  4FVM A;  3THV A;  3C65 A;  3VET A;  3AO3 A;  4OKK A;  4PKH A;  3CCU N;  2QEX N;  1IJJ A;  3QFU A;  2XY8 A;  3CET A;  4Z4H A;  4EP4 A;  3KK3 A;  4RTF D;  2UXD K;  3ZX3 A;  4ISG A;  3M8P A;  4CGI A;  5LL6 Z;  2UUC K;  1VSF A;  1NOY A;  4B3R K;  1XC9 A;  1BI4 A;  4HCB A;  3CCQ N;  2YCH A;  2XY6 A;  4IO8 A;  3AVB A;  4M3Y A;  1DTQ A;  1K73 O;  3LDP A;  2ZGZ A;  4AHT A;  3LPT A;  1UOC A;  1NNE A;  1ATS A;  1UA1 A;  4BC4 A;  3V1O A;  3Q7B A;  2H3G X;  5CYM A;  1U45 A;  2E2O A;  4CFB A;  4BG9 A;  1REV A;  2ASO A;  3HRG A;  1NGI A;  3HZ6 A;  4I6M B;  3T69 A;  3AY9 A;  3NGY A;  2OTJ N;  3S3O A;  1WBB A;  2HHQ A;  4FYD A;  1D9F A;  1NJI O;  5AFU H;  1LWC A;  3MN6 A;  3H08 A;  4BGB A;  3K57 A;  4CJV A;  1YHQ N;  4F3T A;  2W42 A;  4QAG A;  1VHX A;  2E8A A;  4F2S A;  3CQX A;  3OYN A;  3R1X A;  3VEX A;  4PA1 A;  1SKW A;  4FM0 A;  1U04 A;  3VES A;  4R79 A;  3JS6 A;  4W5T A;  2ETJ A;  4AHR A;  3O9S A;  4FWS A;  1JLE A;  2ZWH A;  2P9N A;  3PUF A;  4BRG A;  3KLF A;  1RT5 A;  4C8K A;  4E1M A;  3ZX2 A;  4FLX A;  1T6C A;  2VWK A;  4YOW A;  1NGB A;  3U3G A;  3EO3 A;  4M3W A;  2Q2R A;  4B8C A;  4CK3 A;  3M6G A;  4ID1 A;  2IOC A;  3GE1 A;  4BR0 A;  3OY9 A;  4FK4 A;  2F9T A;  4U7B A;  3L4I A;  5DM6 L;  1NK5 A;  3E1Y A;  2HBK A;  1VQO N;  1GLD G;  3MXI A;  4GVE A;  3G10 A;  4IDK A;  4KH6 A;  4FW2 A;  3IMX A;  5DMR A;  3PV8 A;  4IDH A;  5AQF A;  2FF3 B;  4YFU A;  1HYS A;  2NNW A;  1HR0 K;  5F2R A;  4DKW A;  4DMN A;  4CF8 A;  1JLC A;  4BRO A;  2Z1G A;  2O8D A;  1MDU B;  3ID6 A;  3CFO A;  3SYZ A;  1TAU A;  3CYM A;  3H45 C;  4CHO A;  4L3Q A;  1YTA A;  3V6D A;  4M3U A;  4JHD B;  2ITM A;  1IH7 A;  4KTQ A;  2QWO A;  1D9D A;  3CJA A;  3FZM A;  2D0A A;  2ITG A;  2BDP A;  3ZT0 A;  3ULD A;  4MFB A;  1OH7 A;  4H4M A;  3TPQ A;  1RTH A;  4FJG A;  4FK0 A;  3THX B;  3QET A;  1SL2 A;  2B6A A;  1GOB A;  4FLV A;  3RRG A;  1LOT B;  3I0R A;  1SL1 A;  3FGU A;  3SUN A;  1YT3 A;  1J53 A;  2GWJ A;  3U8X A;  4CCH A;  4J2D A;  2BE2 A;  2DFE A;  2YNG A;  4CEC A;  3VEV A;  2NRV A;  3NH1 A;  3THW A;  2HNZ A;  3PLA A;  1DGK N;  2QWQ A;  2OZM A;  4DFM A;  3RMD A;  3H6E A;  3MN9 A;  1ZBF A;  4H5N A;  2HBL A;  4JI4 K;  4FZZ A;  4CJS A;  4KAZ A;  1C0F A;  3GBT A;  5AQQ A;  2WTU A;  4DUZ K;  3N4Q A;  1TYQ B;  4GKJ K;  1CXU A;  1NU0 A;  1NK4 A;  4DB3 A;  4H0X B;  1J54 A;  4XEI A;  1XUP O;  3F2K A;  5E26 A;  4DQQ A;  4BR5 A;  4KPY A;  4JKA A;  3A8Y A;  4NXM K;  4CZH A;  1IG9 A;  3P1G A;  3OYC A;  3LDN A;  3QFP A;  3VQA A;  2YHB A;  3S9H A;  2HVH A;  3QES A;  4BDY A;  3H46 O;  4AF1 A;  3WT0 A;  3WXK A;  3RMB A;  1YIT N;  2IGI A;  4Q0B A;  4CF2 A;  3LM2 A;  2HB5 A;  3LWL A;  1JL1 A;  4LF6 K;  3VEY A;  2OA8 A;  1EO1 A;  3VGM A;  4JD2 A;  3TSU A;  3ZT2 A;  2XHB A;  3KJV A;  4JAX A;  1BI4 B;  1ZC6 A;  3FFI A;  4Z4C A;  1TKD A;  3NBP A;  4K41 A;  3L2W A;  2HHT A;  3DXM A;  1TL3 A;  4NB4 A;  4M41 A;  4NLC A;  2P51 A;  4YDU C;  4A62 A;  4FLY A;  4LC9 B;  2GTD A;  4HVJ A;  5HLF A;  5AQZ A;  3C6U A;  3DOL A;  4DR1 K;  4CJR A;  3HPO A;  1WN7 A;  3B8A X;  4CK1 A;  5HOO A;  4CEZ A;  4DF4 A;  3PX4 A;  3K5L A;  1T44 A;  4B08 A;  1Q9X A;  3CI5 A;  3O9Q A;  1YVN A;  1KQS M;  3QIC A;  3DLG A;  4KO0 A;  1ZBI A;  4DLE A;  1VAZ A;  1X9S A;  1T8E A;  2E5L K;  3W3D A;  1WNS A;  4JI1 K;  2Q0R A;  3DOK A;  5FPD A;  4Z0U A;  1F21 A;  2I7N A;  1YJW N;  5BR8 K;  2Q3S A;  2QXF A;  4K25 A;  4BRN A;  3IG1 A;  3AVN A;  3VQ5 A;  1LAW A;  1RDB A;  3AA3 A;  3J7Z O;  2BTF A;  3TAR A;  4JV5 K;  3THY A;  4FJI A;  4CZE A;  2P9N B;  4L8R B;  2YKN A;  3CJ7 A;  4DU1 A;  1NGJ A;  4DFK A;  2HHS A;  5JS1 A;  4H8K A;  1EP4 A;  1C1B A;  4JI5 K;  3M3Z A;  1M90 O;  1KAZ A;  2IS3 A;  1HNV A;  3LZJ A;  2FSJ A;  3CCJ N;  3HVT A;  4W5Q A;  3P4I A;  4RW7 A;  1JLB A;  4BC3 A;  4FJN A;  3MDQ A;  3U6F A;  3NGZ A;  1TL1 A;  4DS5 A;  3QNO A;  5FPM A;  3QEW A;  1Q18 A;  1ZBU A;  3CJC A;  3OW2 M;  1XNQ K;  3VA0 A;  2Q0U A;  1T6D A;  3QB0 A;  1OH8 A;  5CHI A;  3GL1 A;  3KZB A;  4H0O A;  3S41 A;  1WUA A;  3VEN A;  3HPG A;  3MED A;  1XNR K;  1ASU A;  4FJ5 A;  2FF6 A;  3ZX0 A;  2B5J A;  4CJ4 A;  4CEO A;  4ID5 A;  2PZS A;  3ULE A;  2VQF K;  4DV2 K;  2O8D B;  1S1T A;  2X78 A;  3ITH A;  2YJF A;  5J2N A;  3KLI A;  2OPS A;  3KKS A;  4Z94 A;  1IBM K;  1B9D A;  4PY5 A;  3EE8 A;  1D4X A;  3W0L A;  2E2Q A;  3AVM A;  4KFB A;  3D2F A;  4PUO A;  5A2Q O;  3JYT A;  4ILJ A;  4CBX A;  3F73 A;  4CGD A;  4W5O A;  1BGX T;  3VF6 A;  1UWB A;  4N56 A;  4HWI A;  3AAP A;  4LSN A;  4OGC A;  4WQ5 C;  4M45 A;  3P38 A;  2G8V A;  1W7A A;  4CHY A;  2PAV A;  2WON A;  4JKC A;  2UUA K;  4Y1C A;  5AR0 A;  4CFD A;  4WFA L;  3SAG A;  1HNW K;  4XH4 A;  1ILY A;  3NFA A;  3THW B;  3T1A A;  4A5A A;  5J2Q A;  3NMU A;  3VMF B;  5K14 A;  3H1Q A;  4K8Z A;  4BRD A;  1X3M A;  4NO7 A;  1ATR A;  3SV3 A;  5EXW A;  2F9W A;  4JI3 K;  3SAH A;  4B1W B;  4LFA K;  3EZ5 A;  2NRH A;  3OYI A;  1ZBS A;  3AV9 A;  3ZSX A;  2KTQ A;  2NRT A;  4AHU A;  3L3U A;  1RT1 A;  3G71 N;  3QBX A;  5M1Q A;  4PWD A;  5GAH P;  4CER A;  3DLR A;  5AZJ A;  4GV9 A;  2O4G A;  3HBT A;  3PIO L;  3CG7 A;  3DRP A;  4KHY A;  4E1J A;  2HHW A;  4G9Z A;  1RTD A;  3VQD A;  3PX0 A;  1ASW A;  4MLE A;  4Y0W A;  4IEE A;  4JD2 B;  4KB1 A;  1MU2 A;  1Z05 A;  3TAM A;  4I9Q A;  4OKE A;  5F1X A;  1ZXO A;  2J4R A;  3LP1 A;  1KAX A;  3DXM B;  1VRT A;  3ZT4 A;  3DI6 A;  4LFB K;  2WC9 A;  2UYT A;  2X74 A;  2Y1I A;  1YJ9 N;  4IFV A;  3K5N A;  3OYE A;  3HL8 A;  3H1V X;  2AA4 A;  3S3N A;  2VCP A;  3CQY A;  4B3M K;  4CF1 A;  4E19 A;  5HBM A;  3MEC A;  3DYA A;  5F0X A;  3OYH A;  3SUQ A;  5KGX A;  4Q5V A;  4CHN A;  4DUY K;  3UKU A;  4FM1 A;  3CCE N;  1VQL N;  4FWP A;  1OVY A;  1RT6 A;  3LAM A;  3V9W A;  2D1K A;  3A5M C;  4DR7 K;  3KKR A;  4M3R A;  1GLJ O;  3UIQ A;  4DU4 A;  5E41 A;  3I56 N;  5AQW A;  2KQ2 A;  3BP8 A;  3O9T A;  5J1E A;  4YNQ A;  4GKK K;  3KWG A;  4NCA A;  3O8M A;  4IFE A;  3THY B;  4M63 C;  4LH5 A;  5I3U A;  1UA0 A;  3TTF A;  4GMJ B;  4JKH A;  4H5T A;  3K2P A;  4DTX A;  4DSF A;  3KLE A;  2FSK A;  3SAF A;  1G99 A;  3VQ6 A;  3SCX A;  2OAN A;  4OPJ A;  1BCO A;  4E7J A;  2GEL A;  3WXI A;  4BAC A;  1SS6 A;  1NK9 A;  4R5P A;  3RR8 A;  2KLA A;  4EZ6 A;  5AQI A;  5AQU A;  2HF4 A;  2XRI A;  2PYL A;  4X62 K;  4DSJ A;  4FVU A;  2V7Y A;  2HF3 A;  2F4V K;  4CEB A;  3QBW A;  2D0C A;  2PY5 A;  1U49 A;  4RW9 A;  4FJ8 A;  1I3A A;  4CFC A;  1L3U A;  4WFN L;  3EKS A;  2FBY A;  4V19 S;  1R59 O;  2D4W A;  3ZSQ A;  3HM8 A;  4DV0 K;  3AVF A;  5AZI A;  5MLC Q;  4FWL A;  3OYD A;  2QTD A;  3AAQ A;  4JEP A;  3MXM A;  1J6Z A;  4E1N A;  3ENO A;  2CGJ A;  1L5U A;  3VPZ A;  4CVN E;  4PKG A;  3KD1 E;  5AQM A;  3IUC A;  3ULE B;  1OVQ A;  1IKX A;  1A5V A;  5FDL A;  1J9A A;  2KW4 A;  4C8O A;  4KTZ A;  2ZM6 K;  3I8B A;  4BRA A;  1BQM A;  2IC3 A;  5CZ2 A;  1JKH A;  2QXL A;  4CEQ A;  3DXK A;  2VG6 A;  1NK7 A;  3E9L A;  1W9H A;  4YDU A;  1FW6 A;  3F9M A;  3AGK A;  1QHT A;  4GV3 A;  3TSQ A;  1B92 A;  4BRH A;  3D2F B;  1NJX A;  1Z25 A;  1IO2 A;  3QNN A;  1QSY A;  3MWP A;  3O80 A;  2QW9 A;  3CCS N;  4CBW A;  4NYF A;  4NXN K;  4A2B A;  5IT9 O;  4CEA A;  3L4Q A;  2YHA A;  1TV6 A;  4N76 A;  2F96 A;  3NH0 A;  1HPM A;  1X3N A;  3K5O A;  1XQS C;  3KTQ A;  5JVG L;  5C2D A;  1YXQ A;  4OPA A;  5AJ3 K;  4DQ8 A;  5SWM A;  1QQN A;  4WE1 A;  2EHG A;  1GLB G;  4HUG A;  1E4F T;  4FWO A;  5JVH L;  4BRK A;  4GVM A;  5JS2 A;  2VG7 A;  3C94 A;  1VQ7 N;  3EEQ A;  3B6P A;  3AO1 A;  1N34 K;  3SJJ A;  4DV4 K;  3JAM O;  4YOY A;  1NMD A;  4H0V B;  4CJF A;  4NCB A;  1KAY A;  4DQR A;  4DQS A;  3EL2 A;  4AIL C;  5BRE A;  4JI2 K;  1BHL A;  4BWM A;  5KRS A;  4AHS A;  3TSP A;  4LH4 A;  5AZJ B;  4F3O A;  3TTC A;  4WQ4 C;  3BDP A;  4CHQ A;  1BIS A;  4H0P A;  4KH4 A;  1FKP A;  4W5R A;  5ELZ A;  3ZLJ A;  3ZEU A;  3T1H K;  4WFB L;  3IS9 A;  3SUP A;  4PKI A;  1XI1 A;  4CGH A;  3OYA A;  4CJ7 A;  4M3Z A;  3AO4 A;  3SI6 A;  4NYN A;  3SUO A;  2HHH K;  4W5N A;  1HYV A;  3RMC A;  4I7F A;  4BGA A;  1KRP A;  4A59 A;  4E7L A;  1Q8I A;  5EVZ A;  1L3S A;  2F8T A;  2D5R A;  3RMA A;  4LFC K;  4Z4F A;  2YNH A;  5KGW A;  3TI0 A;  2WBN A;  3A5L C;  1S6Q A;  2OPR A;  2P9U A;  4CZJ A;  4OKJ A;  4FXD A;  4JNE A;  1VQP N;  5AQX A;  4BQZ A;  3OYL A;  4I2Q A;  1D8Y A;  4FLT A;  2HW3 A;  4FJL A;  1QS4 A;  3UB5 A;  2ZE2 A;  5I9E B;  4HCC A;  3MK6 A;  3VN5 A;  4KTW A;  3OHR A;  5JLF A;  3AO2 A;  3UKU B;  3NAE A;  3WXJ A;  5AQY A;  4X65 K;  4HUF A;  3HJF A;  4CGF A;  1HRH A;  3DMJ A;  2OYQ A;  4UQG A;  1QTM A;  3T1Y K;  1RT7 A;  2GEM A;  3VER A;  5C10 A;  3TAQ A;  4LF8 K;  4I9L A;  4KHN A;  2UXB K;  4MQ3 A;  3P83 D;  2HHU A;  4DV5 K;  2YV0 X;  1SV5 A;  4WQ5 A;  2I5J A;  3C7N A;  3HP6 A;  4M3X A;  5AQN A;  2JWL A;  3P31 A;  1MA9 B;  2G8W A;  4OPK A;  2DPN A;  4B8A B;  4IOC L;  1WB9 A;  3F9K A;  3WNE A;  3AVK A;  3VA3 A;  1GLE G;  3IAY A;  1KVA A;  2E4L A;  2IVP A;  5HP1 A;  3TAN A;  5C15 A;  2OPP A;  5GAD P;  4DCH A;  5JMV A;  2FLO A;  3NDK A;  1WSJ A;  4DR6 K;  1DTT A;  3J7A P;  2CH6 A;  5AFU A;  2A41 A;  1BL3 A;  3E9O A;  4FOI A;  1VSJ A;  5DK5 A;  5IWA K;  3R8E A;  3ATV A;  5AZI B;  4BC5 A;  3OYF A;  3ZT1 A;  1C0G A;  1VSH A;  3G6E N;  1JLA A;  3RWU A;  2FSN A;  2P9I A;  4K43 A;  1W0H A;  1JLG A;  2P9P A;  3L2R A;  4DSE A;  3WXM B;  3O1W A;  1VQ8 N;  2P1J A;  5C42 A;  2ZJP L;  1HNZ K;  1LCU A;  4CZL A;  4JRQ A;  1HPZ A;  4BR4 A;  3R3L A;  4IZ9 A;  4X64 K;  1Q81 O;  2I7P A;  1VSM A;  2JWK A;  2Q1N A;  1KFS A;  2G8H A;  1NMN A;  3DXK B;  2A40 A;  1ASV A;  3AVH A;  4M7X A;  2HOE A;  3I8D A;  1VQ6 N;  5C25 A;  2GUI A;  5AQG A;  4B9L A;  1VRU A;  4J2E A;  2Z1J A;  2VYP A;  3WNF A;  1WLJ A;  4BRQ A;  1SAZ A;  3V9S A;  3O6W A;  5M1P A;  3NHG A;  5D3G A;  5ADX H;  4B1Z A;  3NF8 A;  3EY1 A;  2KKZ A;  4EHU A;  3WUH A;  2KHO A;  3ATU A;  1HKB A;  4BVP A;  2VGM A;  3PSF A;  1RDD A;  2NZT A;  5E84 A;  5JLH A;  3DLK A;  1BCM A;  1CXQ A;  2DTU A;  3SQ1 A;  3DWL A;  1N5Y A;  3O3H A;  2E2N A;  3K0S A;  3OYK A;  3KD5 E;  4KRF A;  3CPW M;  5HRN A;  1KVC A;  3B6O A;  3L6Q A;  1NBW A;  1S3X A;  2W41 A;  4RW6 A;  3AVG A;  5LMN K;  2UU9 K;  1NM1 A;  2D0O A;  4DFJ A;  4B9N A;  5SZT A;  1NLV A;  1BWF O;  1IKV A;  4FJH A;  3WEE A;  3LDS A;  4H5W A;  5CE3 A;  3AVI A;  4B1U B;  1HQU A;  4YOV A;  4C1N I;  1SL0 A;  1KD1 O;  1NGC A;  2A5X A;  3ZSW A;  4RWT A;  2A6A A;  4ELT A;  4IG3 A;  1S9E A;  3NCI A;  4QCL A;  5CZ1 A;  4LSL A;  4BR9 A;  4AHC A;  3VQQ A;  3QEI A;  4WYB A;  4K42 A;  2OPQ A;  3BEX A;  4QOZ B;  1X1P A;  4BRP A;  2OZS A;  3ZEU B;  1S72 N;  3ISN C;  1JCE A;  1S1X A;  2E88 A;  3HP9 A;  3RVC A;  3VOV A;  1VQM N;  4MDA A;  3CCM N;  4NLB A;  3CJB A;  2ASM A;  3KVG A;  3FE1 A;  4KRE A;  4HTU A;  1HNX K;  3K9J A;  2P9U B;  3SPY A;  4E7H A;  2YJE A;  1H1V A;  4CJP A;  4PHT X;  4DR5 K;  4O44 A;  2QWM A;  4CES A;  3D45 A;  1C1C A;  4DSK A;  4ISF A;  1RT2 A;  3ENB A;  4FJJ A;  3HYF A;  1K6Y A;  3TTD A;  3D2E A;  3VQ8 A;  1QZ6 A;  4FLW A;  4CJU A;  4DTO A;  1YAG A;  1S6P A;  3VGL A;  4U67 L;  2HMI A;  4J8F A;  5M1K A;  4O4G A;  3SQ0 A;  3P5J A;  1NG9 A;  5FPN A;  3CER A;  1KXP A;  4LF7 K;  4CHP A;  2X6S A;  4H0T B;  1I94 K;  3C7N B;  3AGR A;  2YHX A;  3OJU A;  1TKX A;  4JKD A;  2IIR A;  1KLN A;  1WSF A;  4FLU A;  3D7E O;  4M3T A;  5J2M A;  3HOT A;  1N36 K;  3RR7 A;  4HTL A;  5CY4 A;  5BRF A;  3BF3 A;  3M8Q A;  3O5B A;  3NVM A;  2P9K A;  4CEF A;  4DTS A;  1BUP A;  3ZSZ A;  1NGF A;  5HRR A;  3GOI A;  4O5B A;  4DTP A;  1FJG K;  3U3Y A;  4BRF A;  4CIF A;  2QM1 A;  1U4B A;  3TWH A;  4FJX A;  4IWV A;  5TKW A;  2GV9 A;  4HUE A;  3CM6 A;  3VQE A;  1S1W A;  3AO5 A;  2KFZ A;  3SJH A;  4YOU A;  3SK3 A;  4FW1 A;  2ZD1 A;  3TAF A;  4DU3 A;  3VF4 A;  4FWN A;  1S5J A;  3VEZ A;  2YX6 A;  3ZET A;  2F7T A;  3SBT A;  1YF5 L;  3LL3 A;  3RRH A;  2PBD A;  4CFA A;  2EX3 A;  4MO5 A;  2A3Z A;  2RN2 A;  3PX6 A;  3OS1 A;  4FWM A;  4WQ4 A;  4JKE A;  4MDB A;  2P9I B;  4H5R A;  2RPI A;  2OCE A;  1QHA A;  2P9P B;  2ZJR L;  1GLC G;  4H4O A;  4DQP A;  4IOX A;  4N41 A;  5BPN A;  4O5F A;  5FRN A;  3UKR A;  3TAG A;  3C6T A;  1Q82 O;  4FOE A;  1N32 K;  4GNI A;  5GAE P;  3ALY A;  4CZG A;  5KPT A;  4JK7 A;  5KI6 A;  1U2V A;  4CJ5 A;  4DTU A;  2PYJ A;  4XH1 A;  4N47 A;  4YHH K;  1VSK A;  4ZHR A;  1WAF A;  1NJY A;  4ZTF A;  3LAL A;  2EWS A;  2VQE K;  5LMU K;  2QK9 A;  2ATQ A;  1DLO A;  3O9R A;  1RDA A;  4Z4E A;  5C0Y A;  4CBU A;  1X9M A;  1VK0 A;  2NRR A;  3RSE A;  1IKW A;  3AA4 A;  4TSX A;  1XHX A;  2JGU A;  4O55 A;  4BDZ A;  2R7Y A;  2VWB A;  3CHW A;  1TKZ A;  1K8A O;  2Z1H A;  4YOR A;  3C6A A;  5BN9 A;  3OYG A;  4LY7 A;  1VQ4 N;  5BRD A;  5AQV A;  2IVO A;  3FZL A;  1SZ2 A;  1XC3 A;  2E6M A;  4AM7 A;  3LDQ A;  2P9S B;  1MWK A;  1RBV A;  4AQY K;  3CCV N;  2YI1 A;  4KHQ A;  1C6V A;  1D5A A;  4B9S A;  3CFP A;  4B9U A;  4DR2 K;  4B3S K;  4CZI A;  1TKT A;  3CC2 N;  4FSV A;  3I33 A;  5AQS A;  3L8B A;  3EZW A;  3WEE B;  1YVU A;  3SMS A;  1Q86 O;  1T3V A;  4DV7 K;  4AH9 A;  3L2Q A;  1HQE A;  1KCF A;  2LSN A;  3AA2 A;  3I0S A;  4CW7 B;  2VG5 A;  1E3M A;  3LDL A;  4CD1 A;  4CI6 A;  1BA0 A;  4BRI A;  1LW2 A;  4CJT A;  4KI6 A;  4NCG A;  1SKR A;  3CMA N;  1U48 A;  4DV1 K;  1YUW A;  2DY4 A;  3WQT A;  1U47 A;  1K9M O;  3BZK A;  3SLC A;  5BPL A;  3A2F A;  3FFK B;  4CZK A;  2OTL N;  1RFQ A;  2FBT A;  1BA1 A;  1NGG A;  4FCY A;  3MX2 A;  3DRS A;  2X6N A;  4CJ3 A;  4JI0 K;  3A5N C;  3V1R A;  1R0A A;  5FRM A;  3H3O B;  4KI4 A;  4C8M A;  4H03 B;  3V9U A;  1HYZ A;  1M1K O;  4RW4 A;  2AP1 A;  1VSL A;  3QER A;  2QKK A;  2FC0 A;  1VQ9 N;  3K59 A;  5M1F A;  2DFH A;  5FRO A;  4DV3 K;  1JLF A;  4JK8 A;  1EWQ A;  3BGR A;  1XMO K;  1NGE A;  2FXU A;  5LJV A;  2O8C A;  4JS4 A;  1K8K A;  1LWF A;  3CM5 A;  3CD6 N;  3CF5 L;  2RE2 A;  1TK0 A;  3D2E B;  1WAJ A;  3O4Q A;  1RNH A;  1JLQ A;  4ICL A;  1ZBH A;  3DRR A;  3MX5 A;  4OX9 K;  4F9O A;  2JLE A;  2V52 B;  4LF9 K;  3OYB A;  1NK8 A;  4CD3 A;  4I2P A;  4M42 A;  3KHY A;  3AVJ A;  2XY5 A;  3DLL L;  4PQU A;  2GX9 A;  5BRH A;  4F4K A;  3EE9 A;  1GLL O;  3NGI A;  4CHZ A;  3K9K A;  3VQ4 A;  1NKC A;  3MMV A;  2O8E A;  3V9X A;  4DTJ A;  4WF9 L;  3R6M A;  1QVG M;  2P9K B;  2IAJ A;  1NKE A;  2Q97 A;  3V4I A;  2PFU A;  3P39 A;  3BY5 A;  3KK2 A;  3RTV A;  1CZ9 A;  5T7B A;  3WNG A;  3MCA B;  4M7Y A;  3G25 A;  3O3F A;  4BE0 A;  3J8A A;  3CC4 N;  4GY2 B;  4ZTJ A;  3MCP A;  3ZYY X;  2P5O A;  4Y1D A;  4FJK A;  3SV4 A;  1NGH A;  4FWR A;  3K58 A;  1FKO A;  3ZET B;  4BRM A;  3KK1 A;  1NJZ A;  2NRW A;  2XY7 A;  4IJA A;  3V1Q A;  1WSG A;  2YKM A;  1WOQ A;  1P90 A;  3AVA A;  3SPZ A;  4B9M A;  2G8K A;  1OH5 A;  2UXC K;  1NGD A;  2HNY A;  1X9W A;  3LDO A;  3VF2 A;  1BG3 A;  4EHT A;  3ENH A;  3UKR B;  1KC8 O;  1RTJ A;  3MN5 A;  1C1A A;  3IDH A;  4J2A A;  4QS7 A;  4JI8 K;  1C0M A;  1U2V B;  4RW8 A;  4BQL A;  3K5M A;  3L0Q A;  4MO4 A;  4A57 A;  4FLZ A;  4CJE A;  3EYZ A;  4DR3 K;  3OBY A;  3CXC M;  1NJW A;  2NLX A;  4JI6 K;  4IXC A;  5EOY A;  1GLA G;  3L2V A;  3CME N;  3QIP A;  1KLM A;  1UAX A;  5DM7 L;  1Q9Y A;  3EKU A;  1N33 K;  3HTV A;  2WOM A;  4DHY A;  4F8R A;  1T05 A;  3RSE B;  2FBX A;  3QEX A;  4CZF A;  5KPZ A;  4FL9 A;  3SBG A;  5BPM A;  5EY4 A;  2VWJ A;  1FK9 A;  3WNH A;  3O9U A;  1S1U A;  2Q31 A;  2GWK A;  1RCH A;  3QIO A;  1HKG A;  3CCL N;  4DWI A;  3OA9 A;  1BIZ A;  3DLH A;  4IOA L;  1RDW X;  1O13 A;  1WBD A;  3QDK A;  1KVB A;  2DFF A;  3HM9 A;  4JKG A;  1EQY A;  4MLH A;  2O8B A;  2E2P A;  3WQU A;  1ITG A;  1RT4 A;  2W6L A;  3KK7 A;  4BVO A;  5B8H A;  4ELU A;  1SQK A;  2V7Z A;  3NVK A;  1BOT O;  4B3T K;  3O4W A;  2AJQ A;  1V4T A;  1WSH A;  4Z4I A;  4B9Q A;  3ZSR A;  4OGE A;  3VTI A;  4CIE A;  1BIU A;  4EZ9 A;  1T03 A;  4BC2 A;  2BAN A;  5HRO A;  5KPR A;  4IO9 L;  4K0K K;  1P8Z A;  4E89 A;  3GG4 A;  4EIA A;  1TK5 A;  3E66 A;  1WSI A;  3OS0 A;  1S22 A;  4G1Q A;  3PY8 A;  1A5X A;  2G8I A;  3ZSY A;  2G8U A;  4FPA A;  2NRZ A;  4B3O A;  4DLG A;  4FZX C;  4JKB A;  2BUP A;  3LAN A;  3CPE A;  5AQR A;  4CJK A;  1ZBL A;  4FJM A;  1RDC A;  5KRT A;  1NWK A;  2Z1I A;  4KHU A;  1OKJ A;  2E6L A;  4BE2 A;  1IG8 A;  4QS9 A;  4OVL A;  4JRP A;  3LP2 A;  3IRX A;  5TKY A;  1HX1 A;  1XWL A;  3ZSV A;  4J2B A;  3C6H A;  1RT3 A;  1E4G T;  5KQ8 A;  2O8C B;  1K8K B;  3CJ1 A;  3T19 A;  2E1Z A;  2YHW A;  4B1V A;  5CYQ A;  1CZB A;  3TR8 A;  3NH2 A;  4PL8 A;  2A1S A;  3OTO K;  4O0J A;  3PO5 A;  4XH5 A;  1VSD A;  4PL7 A;  1NGA A;  3HSC A;  4AM6 A;  4QS8 A;  1EWR A;  1HMV A;  1EET A;  2QWL A;  3HK2 A;  3VQ7 A;  4C8L A;  4KKO A;  1VQ5 N;  3EN9 A;  4JKF A;  3O08 A;  5HRS A;  4CJQ A;  1KSP A;  1BDG A;  2HHX A;  1LWE A;  4JN4 A;  3MN7 A;  3OBW A;  4AHV A;  1Y97 A;  3ZSO A;  4YY3 K;  1NKB A;  3CJ9 A;  3HT3 A;  3VEW A;  2HST A;  1YJN N;  3NE6 A;  1IBK K;  3FZF A;  1W2B M;  2O8E B;  2HHV A;  1I39 A;  4CE9 A;  2FBV A;  5EX5 A;  3C95 A;  5GAG P;  1RDU A;  4IKF A;  2D0P A;  4IJN A;  4O8U A;  5AQJ A;  2ASP A;  3A0I X;  3QLH A;  4EAH D;  5CR4 A;  2Y1J A;  2P5G A;  1HNI A;  2P9S A;  3J80 O;  1JL2 A;  4B1Y B;  1GOA A;  3VQP A;  4F2R A;  3T7Z A;  4BRL A;  3AVL A;  3ZT3 A;  4ISE A;  3OYJ A;  3F5T A;  4LD0 A;  3S3M A;  2IDO A;  3GDQ A;  4GW6 A;  4CGG A;  1QQC A;  3D6R A;  4EFH A;  2UUB K;  3JXU A;  3CIP A;  4JI7 K;  1OH6 A;  1SUQ A;  1YTU A;  2QWR A;  4N5S A;  3HVR A;  3G4S N;  4A2A A;  1RBS A;  4FZY A;  3CQ8 A;  3M5R A;  1XMQ K;  3O1B A;  3C0B A;  2O8F A;  2ZF5 O;  5KQD A;  4FK2 A;  2E20 A;  3KLH A;  3M1F A;  1CZA N;  3OJS A;  1ZYQ A;  4YOX A;  2CGL A;  4K8X A;  4CJW A;  3DJC A;  4X66 K;  2CH5 A;  3TAE A;  2P9L A;  5AQT A;  4B1X B;  5GIO A;  2GUP A;  4ILG B;  4B9V A;  1QQO A;  3FLC O;  4DTN A;  2BH1 A;  2XO7 A;  3LWM A;  4A61 A;  4FJ7 A;  1RBT A;  2BGG A;  4CK2 A;  3MAQ A;  1Z6R A;  2IVN A;  4LF5 K;  1ATN A;  1HJO A;  5C12 A;  2RF2 A;  1BU6 O;  3FZK A;  4DV6 K;  4KV8 A;  3BF1 A;  5GIN A;  4ELV A;  1HUX A;  3SZ2 A;  4C8N A;  5I42 A;  1DT9 A;  4KHS A;  3TAP A;  5EU7 A;  4DF8 A;  4BWJ A;  3LZI A;  1Y64 A;  4E7K A;  4KB0 A;  3DAW A;  3O4N A;  4JS5 A;  1RGI A;  5C2F A;  4KH5 A;  4JKG B;  5LY3 A;  2WUS A;  2O8B B;  2GBZ A;  3HO1 A;  2W6K A;  1X9J A;  3Q7C A;  1TVR A;  1KFD A;  4RG8 A;  4CJL A;  3BZC A;  2HND A;  2HVI A;  3VGK A;  1HLU A;  1SKS A;  3CFR A;  2ZQB A;  1BQN A;  3IFR A;  4ILH A;  1VSE A;  3G0Z A;  3SQ4 A;  5ADX A;  2A1R A;  1JXB A;  3H3N O;  3KWI A;  3NF7 A;  3OYM A;  5AQL A;  4CEE A;  1W97 L;  4FM2 A;  1JCF A;  4OPH A;  3IKM A;  1NK0 A;  5LJW A;  1Q7Y O;  3L3V A;  2G8F A;  3MEG A;  1TUY A;  3HOS A;  2QI2 A;  4H0Y B;  1QSL A;  4JLH A;  3AVC A;  1L3V A;  4CZM A;  1IV0 A;  4FWK A;  1Z26 A;  3QIN A;  5M1N A;  3A5O C;  3OS2 A;  1QZ5 A;  1J5E K;  2YNI A;  1KTQ A;  4WCE L;  4BR7 A;  5AQO A;  1ESV A;  1TGO A;  3NF9 A;  4I6M A;  4DTM A;  1MWM A;  3KIO A;  4CIG A;  4KBO A;  1VQK N;  2E1Y A;  5FLX O;  5HL7 L;  3QEP A;  5HRP A;  2QKB A;  3M8R A;  1IKY A;  1XHZ A;  3MWT A;  4E0D A;  3L2U A;  3LP3 A;  4DFP A;  3ID8 A;  1B9F A;  1JCG A;  5JIC A;  4DR4 K;  3VQC A;  4DSL A;  3QO9 A;  4LF4 K;  3U4L A;  1NOZ A;  4E3S A;  1VSI A;  1FXX A;  4IG0 A;  1N6Q A;  1EKE A;  3FR0 A;  4EP5 A;  3I55 N;  2NRX A;  5AQH A;  2WFB A;  3SQ2 A;  1EX4 A;  1L3T A;  1EXQ A;  3QEV A;  3R9P A;  3KLG A;  3HXM A;  2YHY A;  2KZZ A;  2QWN A;  3TAB A;  3U9Z A;  4JK9 A;  3DM2 A;  1LV5 A;  3ASM A;  4O8K A;  4DTR A;  2CGK A;  4A5B A;  4IBN A;  3MEE A;  5AQP A;  5BN8 A;  3BUZ B;  4BR2 A;  1JJ2 M;  4BDP A;  3N4P A;  4DG1 A;  3UE5 A;  1T7P A;  1QVF M;  1YI2 N;  1QQM A;  3VQB A;  4BRC A;  5H1S Q;  3HPH A;  4OLB A;  2HBJ A;  1NK6 A;  1S9G A;  1TUU A;  5J2P A;  2A42 A;  2HBM A;  5FPE A;  3ZCM A;  3LAK A;  4GV6 A;  4BY9 C;  4KHP K;  2KZM A;  3FZH A;  4XIU A;  2VGN A;  4UY8 O;  1C0U A;  5AQK A;  3E9P A;  1RBU A;  4B9T A;  1LW0 A;  3PSI A;  4OLA A;  4CF9 A;  1J5O A;  4JHD A;  4KHW A;  2ZGY A;  4HHT A;  3WXL A;  3AAR A;  3SMP A;  3NF6 A;  3CCR N;  4BRE A;  4FWQ A;  1DEJ A; 
#chains in the Genus database with same CATH homology
 4DR1 K;  4YHH K;  4JI8 K;  1IBM K;  1HNX K;  4B3M K;  4DR3 K;  4JYA K;  2VQE K;  5LMU K;  4JI6 K;  4DR5 K;  5A2Q O;  4X66 K;  4DV3 K;  5FLX O;  4DUY K;  1XMO K;  2E5L K;  4X65 K;  4NXN K;  1N33 K;  3J7Y P;  1IBL K;  5IT9 O;  4JI1 K;  3T1Y K;  4DR7 K;  4DR4 K;  4LF8 K;  4LF4 K;  5BR8 K;  2UUA K;  2UXB K;  3OTO K;  4LF5 K;  1HNW K;  4OX9 K;  4DV5 K;  4GKK K;  4LF7 K;  5AJ3 K;  4LF9 K;  4DV6 K;  4JV5 K;  1I94 K;  1XMQ K;  4JI4 K;  3J81 O;  4DUZ K;  4YY3 K;  4AQY K;  4JI3 K;  4GKJ K;  4LFA K;  1N36 K;  4JI5 K;  1N34 K;  5LMN K;  1IBK K;  4DV4 K;  3JAM O;  2UU9 K;  4B3T K;  4DR2 K;  4B3S K;  4NXM K;  1FJG K;  4X62 K;  2F4V K;  4DV7 K;  4JI2 K;  4DR6 K;  3J80 O;  1XNQ K;  3J7A P;  4CW7 B;  4V19 S;  2UXD K;  5LL6 Z;  4DV0 K;  2UUC K;  4LF6 K;  1XNR K;  5IWA K;  3T1H K;  4K0K K;  4B3R K;  4KHP K;  4DV1 K;  1HR0 K;  2HHH K;  4CVN E;  2UUB K;  2VQF K;  4JI7 K;  4DV2 K;  1HNZ K;  2UXC K;  4LFB K;  4LFC K;  1N32 K;  2ZM6 K;  4JI0 K;  4X64 K;  1J5E K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...