2YHBA

Crystal structure of the n. crassa qde-2 ago mid-piwi domains
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
433
structure length
368
Chain Sequence
VKVARPCRKIEKWTYLELKGSKANEGVPQAMTAFAEFLNRTGIPINPRFSPGMSMSVPGSEKEFFAKVKELMSSHQFVVVLLPRKDVAIYNMVKRAADITFGVHTVCCVAEKFLSTKGQLGYFANVGLKVNLKFGGTNHNIKTPIPLLAKGKTMVVGYDVTHPTNLAAGQSPASAPSIVGLVSTIDQHLGQWPAMVWNNPHGQESMTEQFTDKFKTRLELWRSNPANNRSLPENILIFRDGVSEGQFQMVIKDELPLVRAACKLVYPAGKLPRITLIVSVHYTVLVDEIFRADYGNKAADTLEQLTHDMCYLCPPAYYADLVCDRARIHQKELFDALDENDSVKTDDFARWGNSGAVHPNLRNSMYYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Mid-Piwi Lobe of a Eukaryotic Argonaute Protein
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Rna binding protein
molecule keywords POST-TRANSCRIPTIONAL GENE SILENCING PROTEIN QDE-2
total genus 125
structure length 368
sequence length 433
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yhbA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yhbA01
2HHXA 4JA2A 3AVLA 1W0HA 3QEVA 4OKJA 3OYAA 2FN9A 4PA1A 4CJKA 4L8RB 3HXMA 3QELB 4G97A 4EVRA 3HDVA 2FN8A 1QMPA 3DOLA 3NF9A 4RK4A 1RDDA 1RILA 1PEAA 1JKHA 4KB0A 2Z1IA 1E6LA 1QKKA 3TAPA 4M3ZA 1T34A 1Z2EA 1UA1A 1SL2A 1I39A 5TPWA 4FCYA 5J2MA 3QESA 2PUDA 3I0RA 4J2DA 2QSJA 2ETJA 4FM2A 1JHZA 3VQCA 1NKBA 3QLVC 3EDCA 3RVLA 2HHWA 4CFBA 1CZ9A 2R47A 2A9QA 3H5VA 1WN7A 3L2WA 1DCKA 4KREA 2ZQBA 4C8MA 4MS4B 3EAFA 1YMUA 2R4QA 3U3YA 3M9WA 3QEWA 1NJZA 3KLEA 3M8PA 3HP9A 1JLQA 3NNSA 3AA3A 3L6UA 3OYFA 4RXUA 3VQAA 5TPWB 4DQQA 4M3YA 2LPMA 3L8BA 3K57A 2B4AA 4Z4FA 1QQBA 3DGFC 3FFIA 1K6YA 4CK3A 3AVCA 4YRZA 3I45A 2FLWA 5TQ2A 3KK1A 1IKWA 4LDAA 4CJUA 3RVKA 3DRSA 3NAEA 1LJLA 4MR8B 4IFYA 5EWJB 1U2QA 3CZCA 4CHOA 2RKIA 4MR7B 4IF4A 5HKOA 4M3RA 3OJSA 4CJSA 2HQRA 5JNUA 4DG1A 3V81A 1CXQA 5KQGA 2HQBA 5TQ0B 1E6KA 1TAQA 3NNNA 3KTOA 3LUKA 4CGFA 2D0CA 4W5TA 3JPYA 1DRJA 1DC8A 3AVGA 3LTEA 3AVBA 2RJNA 4KZKA 4Q6BA 1JFVA 4MR9A 4RG8A 4XARA 1Z25A 5EWLB 4FVMA 1GCAA 4C8KA 4RSMA 3A2FA 2E4VA 2E4UA 3KLNA 4ML3A 3TD9A 3KKRA 3E01A 1ITGA 3AO1A 3HPGA 1OXKB 4EP5A 3B6PA 3E3MA 1B9DA 1U04A 2WONA 3ISNC 3CM6A 1BQNA 3FFXA 3AO5A 3EYZA 4MQEB 4DTSA 6ABPA 3N0WA 3SG0A 2IDMA 2HW3A 1LV5A 3SM9A 2XDYA 1HYSA 2IPMA 4EY3A 5E41A 4FJJA 1VSDA 4O5BA 4Z4GA 3UKJA 1VRUA 3S9HA 1KRPA 3AV9A 3SZ2A 4HUGA 4CJTA 3CFYA 2QK9A 4B09A 4YS6A 4F8RA 4FB4A 1NXTA 2RDMA 1AB5A 5FWXA 7ABPA 3CU5A 4KHQA 3OM0A 4KB1A 3JVDA 3QEMB 4Q5VA 3LKBA 1WSFA 1RBSA 3D0PA 2FLKA 4FK2A 2VUHB 4AHUA 1RDBA 3GT7A 3H5WA 5IBQA 4MS4A 4AHCA 4FM1A 1TJYA 4DFPA 4DS5A 1S9EA 4KTZA 2FEPA 2IPAB 1VSHA 1XHZA 2QZJA 4YWHA 5T7BA 1WSJA 4QCLA 2PUBA 1VSEA 3W9SA 4CJ5A 2W42A 2HSGA 4PY5A 1QO0D 1U47A 3LPTA 2KFNA 1VSJA 3HVTA 3WNFA 3AA4A 4CESA 3VQ9A 2FBTA 4DSEA 4HNQA 1FKOA 1L3SA 1YTAA 3ZSOA 1D1PA 4MLDA 1RT3A 5DGCA 2Q3SA 4LRQA 4ELVA 3JVIA 1SKRA 1FFGA 1S1WA 4ID5A 4W5RA 1XWLA 1S8NA 1TK0A 1GUBA 3HP6A 4KV7A 1TL3A 3VQ8A 3PV8A 1WETA 2OZSA 3OS1A 4I2QA 4RY8A 3T6KA 2E6MA 4FJHA 4CJRA 2X6SA 3NH1A 1X9WA 1JFSA 5GOTA 2I6FA 3IP9A 2G8HA 2HNYA 1KCFA 3HM9A 4DADA 3P9YA 2NT3A 2BANA 3ZT0A 5HSGA 2E4ZA 3CG7A 3HL8A 3RMDA 2MYNA 3L49A 3HO1A 4RV5A 4OTZA 5DTEA 1U49A 4RZSA 3MM4A 2RN2A 1ZBFA 3L2UA 3K59A 5BRJA 4B9NA 3LUAA 3MQ4A 1NATA 2ZE2A 1DBWA 1BDJA 3JSMA 4OATA 5HRSA 5FRNA 1DG9A 1SXIA 4CGGA 4JS4A 3H5TA 3KLFA 1HYZA 4EUKA 4RU1A 3F9KA 2VG5A 3O74A 3KLHA 3RVOA 4DSKA 4MQEA 2WJWA 4DF4A 3K58A 1GOAA 5BQ3A 3ZSVA 3O1IC 4IFVA 1B00A 2AYXA 1TKXA 4LSNA 5SWMA 3OYLA 3M8QA 1TKDA 3LUCA 1VSKA 4ELUA 4D6YA 4B9UA 2HHUA 1WAFA 1EWTA 4MQFB 1NK8A 2X78A 4O1IA 4RW7A 4KHUA 2P51A 4MR9B 1YS7A 3QX8A 4FJIA 4G0PA 1LBIA 4YGXB 5CYQA 4KO0A 3OYGA 3F6PA 3VA0A 3TANA 4RXTA 4XFKA 1ASUA 3OM1A 1C0UA 1F21A 3RQIA 5TQ0A 3RVQA 4PICA 1JXEA 2A1RA 1SL1A 3CTPA 5FBHA 1VK0A 2B4JA 3I5AA 4ZTJA 4E89A 3NH2A 2G8IA 1SL0A 3AVHA 1YT3A 4CCHA 3T38A 3AA2A 1NY5A 2QW1A 4ID1A 1KLMA 4G0ZA 4M42A 1ASVA 1M5TA 1KMIY 4DTMA 1DBQA 2YV0X 2E4XA 3DLRA 4DFJA 4Z0NA 4FLWA 4DFMA 5HROA 2XRIA 4EVSA 3QEIA 4CFAA 2A9PA 4AHSA 3BBLA 3ZSRA 3NGIA 4O5AA 1ISRA 5KQMA 4J2BA 4RK7A 4NYNA 1MU2A 3V9XA 2HQOA 4DU3A 1X9MA 3ZSYA 3DOKA 3MECA 1DBPA 1L5YA 2FEWB 4E1MA 4K8ZA 4OLAA 1L5ZA 1TAUA 2IAJA 4RS3A 2FBXA 3VQ4A 2JVJA 2KZZA 1IKYA 2E6LA 3C6UA 3OYMA 4P98A 3C3MA 5B3JC 3L2QA 3LP1A 3RVPA 1NK5A 1TKZA 1CHNA 4O0IA 5KGXA 4QYMA 1TK8A 2HHVA 1NTRA 1D1QA 3TAQA 4JASB 1C4WA 1L3VA 2XY6A 3H6HA 5KWSA 4CIEA 4C8LA 5JS1A 2N9UA 1YK1A 2OQRA 4KFCA 3QELA 1JWLA 3PX6A 4I2PA 2DFHA 1ZBLA 4KK4A 1UAXA 2IC3A 2FMHA 3V9WA 1TMYA 3EQ2A 3Q15C 1QHTA 1JLCA 1FQWA 2F96A 1XHXA 4F2SA 4YP9A 1WSEA 3OYEA 1BAPA 3QIPA 5DKFA 3CNBA 3NE6A 4RY0A 2O4GA 3EGCA 1TVMA 3CQ8A 3MIZA 5JNWA 1A0OA 2GV9A 2HVHA 2XY5A 4NCAA 2CD7A 4Y9TA 2IOCA 3L3UA 3HPOA 4TLMB 4FLZA 2IOYA 3JPWA 1P6QA 3NNDA 4HCCA 4S05A 3C6QA 1LAVA 2O20A 5I3UA 4B3OA 1TM2A 2GUIA 1PEYA 3RVNA 5GQSA 4MQFA 2JBAB 3A0RB 3IS9A 4XASA 4K8XA 4FLVA 5FRMA 3H5LA 3IP6A 3ASMA 1S6QA 4LE2A 1EKEA 2G8FA 3KJXA 1BIZA 1BI4B 1QO0A 4RWEA 4DTXA 4MS1A 4CFCA 1ZAYA 3LWLA 1HQEA 3QLVA 3O3HA 3WNHA 3A0UA 3I8DA 4CJPA 3SQ0A 1C1CA 3T1AA 5KI6A 4CHNA 2YNFA 1NKCA 1RTIA 3IP5A 3TARA 2JVIA 1BL3A 2JGUA 1F4VA 1TLFA 1ZBIA 3O3GA 3VN5A 2YKNA 4CJEA 4CF2A 3K5NA 3M8RA 4HHTA 1QPZA 2O4IA 4FZZA 3OQMA 1RT7A 4FLTA 3KG2A 4FXDA 1CXUA 1RZRD 5IX8A 3ZT3A 3I0SA 1U4BA 4RW8A 1R0AA 4CIGA 4FJ8A 1YMVA 3CRNA 5CNIA 2KQ2A 2VUIB 3C95A 2QVGA 2F8SA 4LE0A 1EETA 2OYQA 3LZIA 1MB0A 1VSMA 1USGA 1WNSA 1J9AA 3NGZA 1RT4A 2RJOA 3VQ6A 3OLZA 3D45A 4XAQA 4MGEA 1DC7A 4FW1A 1JLGA 2H0AA 5EWJA 4L85A 5CYMA 3A10A 3PX0A 4RW6A 5KC8A 4XXHA 4DF8A 3GWGA 1VRTA 1JBEA 2R7YA 5DLEA 3ZCMA 1ISSA 3O75A 3DI6A 1QS4A 2FSPA 1QSYA 4F2RA 1BI4A 4DTPA 4G1QA 2X74A 2PMCA 1NK6A 3FFTA 1CEYA 1VSLA 1SV5A 4H3HB 3CZ5A 3NBPA 3Q7RA 4Q6WA 3CFPA 4NCBA 2DFEA 3VQQA 3KJVA 3DGEC 4QICA 3V4IA 4B8AB 3EQZA 3LUJA 2I5JA 3LP2A 2HPHA 1WSHA 2FBVA 1CZBA 2LP4Y 1A2OA 3URMA 4CGIA 4CFDA 3SAJA 1QQAA 3O4QA 3M8SA 1VSIA 3SV4A 1KSPA 4DTRA 1I3CA 3QLUA 1Y97A 1FSPA 1U48A 1U0SY 1A04A 4E7HA 4E19A 4HTUA 4DU4A 1UWBA 2QKBA 1QQCA 3MEDA 1Z15A 2FEKA 3QEKA 1JLEA 2RGYA 4TMYA 2KTQA 3KS9A 3NBMA 2VG7A 3HEBA 3OQOA 3B6OA 1MVOA 1ZESA 2FTKE 1T7PA 5C24A 3JYTA 3N0RA 3ILHA 5KRSA 4YO7A 4CF1A 4JB2A 4D74A 4CJFA 1NK9A 3DLGA 1XI1A 5BR1A 3TMYA 4XIUA 3QO9A 1IG9A 3TAMA 4FLYA 3SUQA 1D2AA 1GCGA 2XO7A 4CJWA 5D2CA 5FWYB 5HQJA 1RNLA 2JLEA 1DLOA 1JXBA 4DSIA 3OMWA 1YTUA 4DS4A 1KVAA 3S3NA 1JL3A 1RNHA 4IKFA 4TLLB 5EWLA 4CGJA 4KNYA 3DMJA 1C6VA 4DU1A 2GWRA 3VA3A 2NUBA 1JX6A 3DLEA 4EYQA 3VQBA 3H1EA 5JNTA 5JNVA 4FK0A 3HK2A 2PL9A 1PNTA 3LZJA 3LOPA 1O1WA 3TABA 2Z1JA 1JDNA 2WB4A 3FDFA 3HDGA 1HNIA 5K14A 4KVFA 3RRHA 2HHQA 4RK5A 5T3YA 1ABEA 3LMKA 1BDIA 1REVA 1LWEA 3IPAA 3QLHA 1HPZA 4OLBA 3B2NA 2KZMA 1EP4A 2OPRA 4O44A 3QLTA 1YIOA 4DTNA 3TB6A 1NXWA 1QSSA 1DP4A 4OGCA 4P1ZA 3N53A 3NHZA 1Z2DA 4N47A 1B92A 2BDPA 4E7KA 4KQ9A 1LW0A 3SPYA 3I42A 3WNGA 4TN5A 5TQJA 4FLUA 1U8TA 3S3MA 4H4OA 3VQPA 2JBAA 1KRWA 1D9FA 3QNOA 1QTMA 4O0JA 4OPJA 4KHYA 4XLTA 1EX4A 3DBIA 3QIOA 3RR8A 1HQUA 1ZITA 3CLKA 3HSYA 1J5OA 3MXMA 4FE4A 3CHYA 1J56A 1LWFA 5J1EA 2JB9A 2AYZA 4FJ7A 2L19A 1HJRA 2E4YA 2PAFA 5HRNA 1KRXA 2X6NA 1P8AA 5HRPA 3OYDA 3MEGA 3NF7A 1URPA 2QU7A 2EX3A 4DTJA 3GRCA 3GBVA 2G8VA 2B1JA 1A5WA 1QP0A 3KIOA 4IDKA 2P4UA 1KVCA 1P6UA 4CEZA 2CHFA 3DLHA 4E3SA 4H8KA 1NXPA 1ZH2A 2D0AA 3BGRA 1L3TA 1ABFA 5CHYA 3DLBA 1ZBHA 1C0EA 2ZD1A 1TL1A 3IDOA 1NKEA 1IO2A 2G8KA 4DMNA 4RW4A 4FJ5A 3RR7A 3HS3A 3NHGA 1XHFA 1BGXT 1BA2A 3O2QB 1H9CA 1Q8IA 1KTQA 2OPPA 2MYUA 1EFAA 3N75A 1LW2A 1USKA 1SXGA 1RT6A 2FMKA 3SYZA 4C8NA 1SD5A 4RK6A 2TMYA 3OYBA 3AVFA 4KK3A 4PZ0A 3DRPA 4AHVA 4MPTA 5F64A 3S3OA 4OVLA 3Q41A 1JH9A 4MLCA 1NOYA 4OJRA 4CEEA 4G0QA 4DQSA 2IS3A 4DQIA 4O4GA 4QYWA 3IP7A 2E4WA 4DLGA 3L2RA 3KTQA 3MXJA 1YVUA 1RT2A 2WY2D 4DLEA 3SQ2A 1ZYQA 3SI6A 3CG0A 3D02A 2V0NA 4WWHA 3OY9A 3QINA 3LP0A 3GL9A 1ZGGA 5C25A 4MRMB 4GPAA 1L3UA 2IPLA 2PE5A 3NCIA 1U2PA 4BWMA 3BILA 3AVNA 1CYEA 1TK5A 1A5VA 2HMIA 2GKGA 2B5JA 4ZJPA 2LBPA 2VYCA 3RRGA 2JRLA 4RY9A 3NF8A 4EP4A 3TWHA 4YLEA 2KW4A 3RMBA 4LH4A 3H08A 3WNEA 3QLUC 3L2VA 2WMYA 3LPUA 3IRXA 1DJMA 3JY6A 1B9FA 1KLNA 1PNRA 3SNKA 1WSGA 4KMRA 3GV0A 4IILA 1GOCA 3SJJA 3JTEA 3DRRA 1SRRA 4KTQA 2VWJA 3TAGA 2E4LA 4IMJB 4DWIA 4LZLA 1EHCA 1ASWA 4FLXA 2Y1IA 1Z12A 4OKKA 3OQNA 4C8OA 4EYOA 4N5SA 4MQ3A 4DQPA 3V1OA 1QE1A 3T19A 4F4KA 3VNBA 4M3TA 1JF8A 3AVIA 3RMAA 2ITGA 3ALYA 1M2EA 3RVSA 4AHRA 4YNQA 1KFSA 4I7FA 4ICLA 3QX9A 3ROTA 5HLFA 4DSJA 1RTJA 1NJWA 4UQGA 1P2FA 4ETIA 3AO3A 3LUHA 3TO5A 4ZYLA 3OLXA 1SUQA 2P5OA 3BRSA 1JYEA 3KYIB 1BDHA 4KRFA 5IC5A 5I42A 4IRXA 4BE1A 3KK2A 1BHLA 1X9SA 3LALA 4I9LA 2R48A 5ABPA 3U6FA 1Z17A 1NXSA 4EYGA 2GX6A 2QVCA 1JDPA 5CNJA 2ZAYA 1HMVA 1UOCA 2DY4A 1PHRA 2HNDA 3GA5A 3OS2A 3SQ1A 4E0DA 1QP7A 1IIBA 3NGYA 2PUCA 3UIQA 4FYDA 4CERA 1F51E 3DYAA 3G10A 2QXFA 1S9GA 3MYYA 4H60A 2QKKA 2QV0A 2GI4A 3NFAA 4CF9A 1Q9YA 3Q9SA 2P1JA 4HUEA 1D9DA 3N0XA 3NF6A 3HVRA 5C42A 5IUJC 4FJMA 3OLVA 1G15A 1S6PA 3RMCA 4PUOA 1JLAA 5D3GA 2RF2A 3AA5X 3P83D 1JLFA 1EXQA 2WJAA 1TKTA 1KFDA 1HNVA 1T8EA 5FWYA 4WE1A 3G85A 3GBPA 2WWVD 4BDYA 2A9RA 4EGSA 1S5JA 4GNRA 3V6DA 5HM6A 3TAFA 1X1PA 3K5OA 4Y1DA 2J48A 3UK0A 4PWDA 4QPJC 1M2FA 1WAJA 1NOZA 2PYJA 4GW6A 3P5JA 2KYRA 5IEBA 1W9HA 2Z1GA 2D0BA 5FBKA 1LWCA 3OS0A 3G1WA 2FBYA 2YHAA 2JK1A 4Z4EA 1RTHA 3QEMA 4M88A 3IAYA 1LK0A 2PYLA 1JL2A 1E6MA 1D5WA 4KV8A 4J2EA 1ZBUA 1NK7A 4DN6A 4E7IA 3OO0A 3FFWA 2MSKA 4F12A 1QSLA 3F7NA 1K66A 3KKEA 4CJVA 1RT5A 4HNRA 1XC9A 3D8UA 3KCNA 4CEAA 3SQ4A 3CG4A 3HV2A 3LP3A 3LUFA 2FKAA 3PO4A 4ZMRA 1MB3A 1LAWA 4L4UA 3EULA 3AVJA 3SY8A 2R25B 2IKSA 3R0JA 3ULDA 1U45A 2PZSA 3ROFA 2P9HA 3EZ5A 3T8YA 1VLZA 3HCWA 3SV3A 5TPZD 4Q0BA 4N41A 4BDPA 4FJGA 3C6TA 3SPZA 5KQLA 3OMXA 4WXEA 4F8JA 1SKWA 3O21A 2OA8A 5KC9A 3LUDA 3OYNA 4ELTA 3ZT2A 3RVRA 2M98A 4N0QA 4DTUA 4I9QA 2FC0A 1R8JA 1TVRA 3N8IA 4TSXA 5JNRA 4O1HA 3LFTA 3MMNA 5J2QA 2RPIA 5EU7A 4H4MA 5DK5A 3O3FA 1T03A 1HRHA 1Q9XA 3KHTA 4MR7A 4E7LA 4RK0A 3KK3A 1RBUA 1RZRA 1TV6A 3H5OA 3MEEA 4DSLA 4G0MA 2HHSA 1UDRA 5TQ2B 3AO4A 4AH9A 1BIUA 4B9VA 3MAQA 3Q7TA 2YNHA 2LUOA 2LSNA 4MYRA 5DMRA 1GOBA 5IUNC 1FXXA 1AB6A 1RDAA 5CNKA 2OENG 1ZH4A 5HRRA 4PQUA 2ZWMA 3JS5A 2PUAA 3S99A 4CHQA 4OPKA 4PYRA 4LDZA 4HYEA 3SUNA 1SXHA 4CEDA 4W5OA 4CE9A 4OBBA 4FM0A 5CNMA 4S04A 4NYFA 4FW2A 1RBRA 3VNAA 4HNSA 4CK2A 4FJXA 3ZSWA 3RVMA 4RXMA 4DTOA 2HB5A 4CHYA 4G86A 1GLGA 4HCBA 3MA0A 1RBVA 3KLOA 4JRQA 4WXMA 4KAZA 4Z4HA 4YFUA 2ID7A 1A5XA 2HNZA 5J2PA 1VPWA 4JLHA 1KVBA 2G8WA 2A1SA 4IBNA 1NJXA 1N5YA 4DQDA 1DTQA 3ZT4A 2B6AA 4LY7A 1NJYA 4M3XA 2IYNA 3Q7SA 1JFTA 3OLWA 4Z0UA 2WOMA 4ETNA 5KGWA 2Y1JA 1NXVA 4FK4A 4CGDA 3OYKA 1DRKA 4KHNA 3VQ7A 3EJWA 3O2SB 4OG2A 3UUGA 3V1QA 3ZSXA 1D5AA 5JNSA 3LKVA 1C0TA 2YNGA 2X7XA 4JOQA 1OXBB 4KKOA 4LX8A 4BDZA 1C1BA 4UHJA 2FVYA 3H75A 2H3HA 1USIA 4WZZA 2F8TA 3KYJB 1E2BA 4CHPA 3H6GA 4RKRA 2Q5CA 5FROA 3PY8A 1NK4A 4IMIB 3V9ZA 3KLIA 2L2QA 2CHEA 4RK1A 4E7PA 4CECA 3HZHA 1S1TA 4QAGA 4M45A 4B8CA 1D8YA 1M5UA 3F6CA 4EZ6A 3QNNA 2ATQA 1J53A 3LANA 3SCXA 4MFBA 3KD1E 3OJUA 2MSWA 5PNTA 1C0MA 4G0YA 3IPCA 3OYCA 1T05A 4IG3A 3H5IA 4PE5B 4CBVA 4DSFA 3OYIA 2IGIA 1RCHA 3L3VA 4Z4IA 3H1GA 2BGGA 1UA0A 2FQYA 3QK7A 3GYBA 1ZDMA 3H1FA 1BQMA 3F73A 3EY1A 3RTVA 5CZ2A 1BVHA 3VQEA 3V9SA 5HBMA 2PJUA 2PL1A 4DFKA 4E7OA 1FK9A 2FQWA 4B9MA 2P5GA 2LIVA 4FJ9A 2YNIA 3SQNA 4NQRA 3I09A 3PX4A 4Z9BA 1APBA 4AILC 3VQDA 4LD0A 1YS6A 2WRZA 2D5RA 2QR3A 3O1JC 5IUKC 3PO5A 3IG1A 4OGEA 4CJLA 3C97A 3KLGA 3LWMA 5C5EA 4CJ3A 4MS1B 1DCFA 2DFFA 5J2NA 1N6QA 5BRAA 4YCSA 4LSLA 3C3KA 3NHMA 5KTQA 4N56A 4W5NA 4M3WA 1S1VA 4IG0A 1Z16A 4N0PA 1VKRA 1ZGZA 1FFSA 4NCGA 2NZUG 2JVKA 4F3OA 2MYTA 4M3UA 5HP1A 3T95A 2HJ9A 4IGAA 2OPSA 4MAAA 3O4NA 2IDOA 5TE9A 4B08A 3CYMA 3TAEA 4JP1A 4Z99A 4BE0A 2YHBA 4MRMA 3ZT1A 1VRVA 2L17A 1RBTA 4KI4A 4J2AA 3BDPA 2CWDA 3MXIA 3V9UA 3HJFA 5B3JA 1WSIA 2MSLA 5SZTA 3QETA 4CF8A 2PY5A 4GMJB 1NXOA 2FMIA 2PUGA 3NH0A 1RXIA 3CFRA 5CY4A 1DTTA 2OZMA 3N6VA 3KD5E 4E7JA 2Z1HA 1RTDA 4JS5A 1JYFA 1C1AA 4Y1CA 1Z18A 4FJLA 1FKPA 3O2JA 1FFWA 2IPNA 2AJQA 3LAKA 1ZVVA 3LDSA 1VSFA 4F11A 5DCLA 2DRIA 3HYFA 4CIFA 4CHZA 3MF4A 3C94A 1TGOA 4MS3B 4W5QA 4E1NA 2MYPA 3CKMA 5ED4A 1JLKA 4G0XA 3TX6A 2GBPA 1RPJA 1IKVA 4O55A 3VQ5A 1RT1A 3ZSZA 4CEFA 4EVQA 4EZ9A 5IULC 5I4CA 3PUFA 3AO2A 2JCGA 3K4HA 4OKEA 4RDCA 1Z13A 4YR7A 3NDKA 1LBHA 1KGSA 3HT3A 1I3AA 2QXYA 1DZ3A 3BREA 4R5PA 2PKXA 1ZY2A 4N76A 1WLJA 4HUFA 2FQXA 3HPHA 3RVJA 1Y1LA 3DZDA 9ABPA 3LAMA 4NV3A 3OYJA 3E61A 4YV7A 2FW0A 4KI6A 3CFOA 4KFBA 4H3KB 3CM5A 4LE1A 3OLYA 2VK2A 3HUUA 1JLBA 4WUTA 4FJNA 2YKMA 4KHWA 1MAVA 1SKSA 3ZSQA 1GUDA 3LUGA 4Z4CA 1K68A 3OYHA 3RH0A 4M41A 4FZXC 3TI0A 3T3FA 1JL1A 5IEJA 2OPQA 4NICA 4GVMA 2NT4A 2PUFA 5JS2A 4KPYA 2FXIA 4UHKA 1HEYA 4CF0A 3A3KA 4ZMSA 3BRQA 2DTUA 4Z9AA 2PUEA 3K5MA 3O1HB 3AVAA 4F06A 4DQRA 4FE7A 4EYKA 1BISA 3SNNA 4CGHA 3K2PA 4CEBA 4FJKA 2XY8A 1LJUA 3QEXA 4BWJA 1S1XA 4MR8A 1BCOA 1S1UA 3SUPA 3ITHA 3KKSA 3M6MD 4F3TA 3CS3A 1EAYA 1BCMA 4MS3A 3HSTB 5TPZA 1W25A 5CZ1A 2KFZA 2PLNA 4B9SA 2BE2A 3OO1A 1D4ZA 4JAVC 5EWMB 4FZYA 3K5LA 2HHTA 2M1ZA 5C5CA 5FWXB 1ZHHA 4ZTFA 4CK1A 1ZN2A 4ZHRA 2FMFA 4LH5A 1DCMA 5E3JA 3ILYA 3M9XA 5KRTA 1EWVA 1YK0A 2XHBA 1QP4A 3RWUA 1IH7A 4B9TA 1RXEA 2ID9A 4QOZB 4AHTA 4CJQA 1XWWA 4PEVA 3K9CA 4Q7EA 3DM2A 4ETMA 3HUTA 4RKQA 4KTWA 3THVA 2A9OA 2VG6A 4B9LA 4CEOA 3V1RA 1XHEA 4ZPJA 3TR8A 4CEQA 2EHGA 3FGZA 5EWMA 2XY7A 4JRPA 1CLQA 3QERA 5FDLA 1EWKA 5KQPA 1PUXA 4KHSA 2G8UA 3QEPA 3AVMA 3EODA 3G0ZA 4CJ4A 1NXXA 4BACA 1HYVA 2NZVG 1MIHA 4JB0A 1IKXA 3U3GA 6CHYA 8ABPA 1J54A 3P1GA 4RW9A 1Z26A 3OVNA 4D6XA 3DLKA 1QNLA 4N03A 2L18A 3FMVA 4G0OA 2VWKA 1NK0A 3C3WA 2HVIA 4KQCA 1L5UA 1RDCA 4HVJA 4WT7A 3AVKA 4BE2A 3KSMA 2GBZA 3SUOA
chains in the Genus database with same CATH superfamily
3TTDA 3CJBA 2WR8A 1MA0A 1AKQA 3T9DA 5I9TA 3AVLA 2QXTA 2YNMA 3PDIB 3QEVA 4RZ2A 4GL2A 4FS8A 3OYAA 2CFOA 4PTLA 1NJSA 4PA1A 4CJKA 3F9IA 4L6AA 5K2OA 3HXMA 5F12A 3HDVA 1IL0A 4EM6A 5JO0A 3DPIA 5AKLA 3ENNA 3ZDFA 2IS6A 3I76A 5FUVA 3SIPA 1X70A 1BKYA 2TYSB 1MVLA 3UJBA 2UUCK 1SBNE 4OSOA 3EVAA 3OTOB 2RHRA 5CFPA 3NF9A 1JHQA 3L8DA 3CJAA 4DCPA 2GNOA 4DA0A 2GM4A 3LCCA 2GLTA 2OFPA 2OHHA 1RILA 3CBQA 3HC7A 4B6JA 2Z1IA 1QKKA 3AUFA 4M3ZA 2E89A 3QE3A 4WFIA 2ROQA 4TWRA 2B35A 3FZKA 4B6GA 1UA1A 1SL2A 1G7SA 3L7NA 2O5VA 4OHKA 4I6MA 4ZV7A 5KSYA 2HRCA 3TLJA 3ZBTA 4MVCA 1UBLS 3M4XA 3LPDA 3SS7X 3UG6A 5KYGA 3GAFA 2IP2A 3VDXA 5IVKA 3GC6A 3V2HA 1E0AA 4ZGBA 1W0JD 5L53A 4QRDA 2GEJA 2G7MC 2ETJA 1JHZA 2VA9A 3EA0A 1AHHA 4TTPA 2VBIA 1ND6A 5JMOA 1JDTA 1RQXA 3KWFA 1U1FA 4IFIA 2QNRA 4IF6A 1GTL1 4FP9A 3RIGA 3RVLA 2VJMB 4KLZA 3TGWA 2V7VA 1HYHA 4HUQB 4OFXA 4J16A 2RHHA 5LA6F 3TTSA 2ZJ6A 3FZMA 2CVQA 3ZY5A 5F5LA 2Q36A 1QDLB 4K05A 5EP2A 4IVNA 4HDRA 3A7DA 3H5VA 1DIRA 1EP3B 1QFYA 2VSXA 3C98A 5EN4A 3V2UA 3L2WA 2E88A 3OZ7A 4I0WB 1TPZA 2GEUA 5EJIA 4ZAGA 3V42A 4DQUA 2ZQBA 4IDCA 3U9LA 2I7TA 1Y1PA 2XGMA 1NGFA 2HHJA 2R4QA 2WWTA 2XQJA 2ZT5A 1R8SA 3JQ8B 3QXJA 3QVSA 1FUEA 1U81A 4MWOA 2KM1A 5F98A 8MHTA 5EYPB 4U6NA 1K8KB 2RK3A 3WGNA 2ZEJA 4BBJA 4RTOA 4L0MA 3NNSA 3QLJA 2HCRA 121PA 3FLEA 4U7FA 3AA3A 4GWLA 3ZU3A 3NYQA 4B46A 4YI5A 1KI9A 1XXHA 1EE2A 3Q0EA 2WFBA 3QHAA 4LECA 2GETA 3F9CA 4RMNA 4G4SO 1U3DA 1G7CA 1D4FA 2ID4A 4NFLA 4WPGA 5DHPA 2N1MA 3TTUA 2VZLA 4FFRA 1DZIA 5ALHA 4CKYA 4QSMA 4DQQA 4M3YA 4WKCA 1PQPA 4Z4FA 2FUG1 2NTJA 3NG1A 4KQJA 1QQBA 3S7TA 1HPMA 1Q7RA 3A4IA 1J8FA 2IX3A 4YPOA 1PF7E 3IGFA 5KJEA 4URWR 3MRSA 3PZBA 4JVMA 4M1TA 4DRXB 3TW6A 4G1UC 2ZIVB 1L7PA 2A0UA 2B8NA 2R5FA 4EHAA 3QKSA 1KYWA 1IC6A 2Y1KA 3B9PA 5BNIA 3H0KA 2FB9A 3AEQB 5IXSA 1IKWA 4FR5A 3CEJA 5IT0A 4K81B 4LDAA 1I6WA 4Y6LA 2I55A 5FQNA 4CJUA 1SQKA 5D5QA 3C3JA 3NWJA 3VTZA 1LJLA 1IBSA 3WL5A 2QNBA 3HDQA 5A02A 1GLAG 4YMTA 3SQDA 3E8SA 4MR7B 2E85A 1FMFA 1IUOA 3B3QA 1XX6A 4ENVA 2JKZA 3F78A 2BPOA 4AXXA 4M3RA 3OJSA 1QQ5A 3R5FA 2AFHA 2TMDA 3COPA 3Q2OA 4BGEA 4GP7A 2OP0A 3HR7A 5DO9A 4DG1A 2FSIA 2QROA 2Q6IA 5HIJA 4OB7A 2JPDA 2SKDA 5H4HA 4GMDA 2EDCA 4ITUA 3ZC3A 2RC6A 1CNMA 1P2BA 3NHFA 1YI0A 1TAQA 3VUFA 3C45A 3L41A 3K2IA 3KTOA 5LP6A 1K6IA 1VQ4N 3C43A 3Q7CA 4DM3A 3CA8A 4R8KA 2MSDB 1Z6TA 3ICWA 4WQ4C 1BSVA 5IJXA 1TT5A 5A9SA 3AVGA 1C50A 3GRPA 3OH8A 4W6ZA 5P21A 1MB2A 3SLCA 1VCOA 1ZA1A 4MGYR 4QU0A 4X65B 1KVQA 3LFHA 2IIRA 2QSYA 1XA0A 4LYGA 2G63A 1D2RA 3R7WA 4C8KA 1BDBA 3F71A 2HXYA 4DNFA 821PA 5KYXB 2HU7A 5AKIA 3BSYA 3MK31 3N4QA 3A2FA 2E4VA 1DJLA 2Y1DA 2HWXA 3HR8A 4EG4A 1ACMA 4FILA 4LDJA 3GN1A 4ZOLB 1ITGA 4YCNA 1KVSA 2DMRA 1B0AA 2ISQA 4GH5A 1SULA 1ABBA 5ILOA 5CIYA 4LY6A 3B6PA 2HIHA 3E3MA 5D85A 2VTBA 1LDEA 1SMKA 4WLUA 4PN3A 2QLJA 5JPCA 5IDQA 2WONA 3ISNC 4LF5K 2PYIA 5FOXA 3RW9A 3TINA 1H8ED 1JXAA 5TDHA 4KUHA 3U4CA 4ARCA 1E4VA 2FF6A 1Z6GA 4OA8A 2FPPB 2OY0A 4BRSA 5DHQA 3E18A 3P2YA 4MQEB 4OY3A 2XCRB 2FF3B 3HZ6A 1U7UA 4JXJA 3KQPA 4RMGA 5L9AA 1X74A 5JFGA 2B5VA 2BGJA 5AI6A 3N0WA 1CQZA 4KR7A 2G1UA 1KMHB 2FPGB 2VC2B 1SN7A 1PGOA 3D2AA 3SG0A 1FVOA 2YXBA 1LV5A 1R4ZA 3EKUA 2FX5A 2BP7B 3SM9A 4Z3KA 5JMTA 1N3IA 2Y1CA 3BXFA 5K3DA 3USCS 4Q37A 4F84A 4J0JA 3PPVA 2IPMA 4H1TA 4MSUA 1QHSA 3AEUA 3CLTD 4FJJA 2Q9CA 4RAQA 5CXXA 1PZXA 3RU2A 3JQFA 3SQLA 4B80A 4Z4GA 1GPKA 3K5HA 1V3VA 3AO0B 3HDHA 4IG9A 4MIOA 3A1CA 2AC2A 4BZZA 4ES6A 5LYJB 2VOJA 2YJ4A 4FDUA 3EXFA 3N8KA 5K6AA 3WWCA 5HJ7A 4QVKA 2GSWA 1FX1A 4IH9A 3WRXA 4HWOA 5IAEA 1F8FA 2YMQA 5TKWA 2UVQA 2ASPA 1MX3A 2ZTVA 3CCSN 2W40A 5DNYB 3PQ3A 1C0LA 5FWXA 4EZIA 4M9SA 1NNSA 3TZLA 2FK8A 2GDZA 3P5BA 5LBUA 2ONYA 3OIWA 3GZ4A 3E9ZA 4HLUC 5AVZA 3H0EA 4OXXA 4CU5A 2HWYA 1SOWA 2P1ZA 2YR0A 3IB6A 3QEMB 4RKFA 4ZICA 4I55F 4UVDA 1WSFA 1T8PA 4LNAA 5AKZA 4I5FA 3ZY2A 3ZCUA 4DPMA 1AGYA 1TJ3A 1RBSA 4UY8O 1A9OA 1MIOB 2P2CA 4H15A 5EKXA 4DT1B 1XEWX 2SBTA 1CR6A 5FOWA 5K8TA 2D74A 1E18A 2Q5LA 2XNCA 2G28A 4LYFA 2CHUA 1K0UA 4IDBA 4B3MB 5BMOA 3Q40A 4Q1CA 1VL5A 2JLCA 3H5WA 1T4CB 1CU1A 5I7SA 1KOJA 2DLNA 3GEPA 4H0PA 4FM1A 4CZJA 1DT3A 1YR9A 4NR0A 3TX2A 3U9TA 2FRDC 4AZVA 3DXXA 3HCAA 1FYWA 3VR4A 1G8PA 1KC8O 2HPZA 4E3WA 1X1QA 4PSUA 3WRYC 1S9EA 4B1YB 2QMOA 3TUJC 3EPJA 3K9HA 3LPMA 1J0CA 4KTZA 1K6XA 3PFNA 4HMQA 1V11A 2RHLA 3DXKB 3AY0A 2WDZA 4K6GA 3HVUA 4TLCA 3GFQA 4QT4A 4DV2B 4BV2A 3K15A 3JV7A 4IQFA 3SYMA 2Q1XA 1F20A 2QZJA 1XMXA 1F2TB 1KKMA 1U0TA 1TU4A 3TW0A 1YULA 3Q8KA 4ONEA 4Z3OA 4QCLA 2I6SA 1SU8A 3FI0A 1GAXA 4GLLA 2HSGA 2X4GA 5EY4A 4U4AA 3MCWA 1Z4MA 3UAZA 4N82A 1G0NA 3K1YA 4N7RA 4OGWA 3L6DA 1EJ6A 4O63O 5F76A 2XWPA 2RHDA 4L57A 4TWAA 5I9LA 4LFBB 4CCYB 1YI2N 4CESA 3Q0TA 5BSUA 2IUEA 2FBTA 3L6EA 4QO7A 4G9ZA 1QP8A 2GZ1A 3B9BA 1VQLN 1YTAA 1EFDN 4A5AA 3E6AA 4HNQA 4XCXA 1T9GS 2NUTB 5KOYA 3EEFA 3PXGA 4EFMA 1B4DA 2CN1A 2ZTSA 3UB2A 3LWNA 3LX4A 4O8KA 4YOXA 3UUWA 1VI5A 4P4NA 2ORIA 2Q3SA 3GLFE 5E2AA 1WMFA 4O3MA 4EB6B 1H3EA 3ZJYA 1M1YA 2JWKA 3KHUA 2WDPA 1SKRA 5C2FA 3A7EA 3R9XA 2VQSA 3QHPA 2CDAA 1ATRA 4Q34A 1CB7A 2YWGA 5F35A 3MWEB 5AVSA 2WBLC 4X20A 3C6MA 2IHJA 1S8NA 3D8NA 1TK0A 1VM6A 2NMVA 2HY7A 4KV7A 5CM9C 4BMYA 2HT1A 3VQ8A 3LF2A 3PGMA 3QQPA 4TV8F 3Q1KA 1RXSA 1U7XA 1EIZA 4UXHA 4EGFA 5JCOC 3A6KA 1M34A 3BCSA 3U09A 3ZE7A 3GPLA 5JAZA 2JDID 4PONA 3U4QA 3MG9A 2PSFA 4V0MA 1W2GA 1UXOA 1J0XO 4FGJA 4K1XA 5GOTA 2PCLA 3J81k 721PA 4H0XB 2CFTA 3DS8A 3COSA 4JVNA 4G0UA 4RELA 3RC3A 3ZHYA 3H9EO 4HWSA 9MHTA 4NHEA 3W6OA 3IIEA 1QIJA 5IJWA 4MHOA 2HDHA 2WNIA 4DV5B 4UCWA 3HM9A 3AKDA 5AWFC 3O9ZA 2PU5A 2AXPA 1P1FA 4JI6B 1P0PA 2DP4E 2J3JA 3U7HB 3PENA 4WX2B 3RMDA 5JRZA 1SELA 2I9KA 1XMQK 1ULZA 4CMCA 4RV5A 4JKOA 2C59A 3CJQA 1PR5A 2PEZA 4LYJA 5ALZA 1H8HA 3CJ9A 1BHJA 2Y68A 2H2IA 3NGLA 3S44A 3VNBA 4RZSA 3RSEB 3AWDA 4K86A 5E0OA 3EQ9A 2NAFA 2WU1A 4ZT3A 5KQDA 1D1TA 1X15A 2RN2A 3L2UA 1CS0A 4FTWA 2WPNA 3CLUC 3LSTA 1Z5NA 3MAJA 3NBQA 4ZAFA 4PG7A 3KQLA 1TTQB 5LPNA 2E82A 3B3AA 1Z63A 1NATA 1VTKA 2VXBA 2JJ1D 1AQIA 2D4AA 1E66A 5AJ3K 5B1SA 2H9IA 2P9KA 4PPFA 3TSZA 3MJHA 4N3NA 1DXHA 1RYMA 4GLJA 3UHFA 4JS4A 1RKBA 5LZ5A 2IQ5A 1X8XA 2VPPA 4EUKA 3CTMA 1IOZA 4PKIA 4DWOA 1AV7A 5BN8A 1M2JA 1GUAA 1OLXB 1U0HC 1WMEA 3JAKA 3O74A 3TRKA 3U4HA 4DSKA 5KINB 1EUCA 4Y1EA 2FCAA 4PCUA 2YWHA 3IDSA 3L8FA 2ZI4A 2Z6VA 2HU8A 6YASA 1BDMA 2WU8A 4UMFA 4A73A 4RENA 5HK8A 3KKNA 3TBHA 3TNFA 1Y4SA 1N5LA 5K8IA 4N5DA 1XALA 4IFVA 1SUCA 4HV4A 3QV2A 1OMOA 5SWMA 4FFLA 4JMLA 1OXTA 3SU8A 2GCEA 1PWYE 4XSVA 4YMHA 3LUCA 2X9QA 4GPTA 1RJFA 3WR5A 2ZETA 2VZEA 3P0RA 1UPCA 4FD3A 4B9UA 4XX0B 3WAKA 3BN3A 3ZXSA 4YQFA 4B1VA 1YAHA 2E2WA 1XEXB 2BEVA 3K5WA 1BA3A 1NGBA 4KIUA 1KIFA 1F1BA 2Q3LA 3D4IA 3K72B 1K7XB 3DH0A 2MCFA 5B64A 3SLRA 4F6LA 2AN5A 3H4MA 2X78A 3OM9A 1BVRA 4I50A 1PQUA 1ESZA 4O1IA 4R5HA 4KHUA 3QH4A 3WO0A 2WUDA 3IAXA 1FLDA 2QJOA 3R3SA 5DYGA 2GEFA 1QGYA 3K8QA 3LGXA 1GAJA 2GYYA 4RGBA 3RTAA 1QMGA 2QS9A 1LX7A 3CUYA 5LXTA 1A9YA 5FAXA 4WLFA 1RWOA 3FAZA 5DLDA 1ORIA 1X8LA 4GYYA 2B21A 4DGSA 3F6PA 5JSHA 1J00A 3H3NO 1C0UA 3OQ1A 2JIRA 4R31A 3THYB 2DHEA 2XMQA 3IUEA 4KBYA 5LDHA 5CGZA 3ZS9A 4FPBA 2A78A 4YONB 3WGVA 1JXEA 2A1RA 1SL1A 1VE6A 2GZRA 1JLSA 4ID3A 3LLUA 2C83A 1PGNA 1DKPA 1BXGA 2QLNA 2XDAA 1MO5A 3JTMA 5FBHA 3X1ZA 1PLKA 2ZPUA 3A5MC 4CMKA 4B76A 2FY8A 5DSTA 3N2YA 5BV7A 3QM1A 4ZT7A 1J0BA 3PIOL 1WSDA 1B8UA 3RRNA 1J2JA 1RBMA 4ZOBA 4CW7B 4HY3A 4RHEA 1DVRA 1REQB 4CF7A 1X1RA 5EZ6B 1Y1TA 4N8DA 3L9WA 2R3SA 1OH6A 4CCHA 1FS6A 3CR7A 1VQ9N 3K09A 3FZFA 1SKAA 3DFUA 1NY5A 3VPAA 2QW1A 2V4MA 2EQBA 5KYYB 1Z0FA 1LVGA 4DJEC 3RWBA 1HA3A 4MH0R 3O90A 4G0ZA 4M42A 2C2BA 1YR2A 4GOJA 4ODIA 4U7JA 1J33A 3C24A 3E0QA 5IK2A 4F5ZA 1O96A 2RGUA 1DBQA 5D84A 1ZEMA 3G0DA 3NUZA 5JYCA 5G40A 2DPLA 3LFUA 5HROA 1LBSA 2F1RA 2X42A 3KLBA 4EVSA 1BRTA 5KVVA 4YECA 3QEIA 2FZ4A 4CFAA 2YFKA 4IJQA 1YWGO 3NVMB 4M0PA 1KPHA 5FBVB 2WD7B 2I8LA 4O5AA 4Z7JA 3GT3A 1ISRA 1KPIA 3A9VA 2HBMA 1BROA 2ZE5A 4J2BA 1J7KA 2H9AA 1PR0A 5EQJB 1ONBA 2EERA 3AXTA 1WB6A 4A62A 4RIIA 4TV9B 1ZK1A 1EVKA 2IEAA 4W6QA 4QLAA 4X1YB 4YRRA 3WL6A 1PS0A 1FBTA 3W8EA 3KR1A 2OBFA 3P4XA 4URZR 5F0XA 4DU3A 1CUUA 4ZZ1A 1X9MA 1WXHA 5MGNA 3ZSYA 2OCEA 3ZDQA 2ATCA 1XPUA 1ZGBA 4XCVA 2G06A 5EGNA 4E1MA 5K0EA 2QT9A 3CX7A 1L5ZA 5CDSA 2JIMA 2IAJA 4EJSB 4RS3A 3L7JA 4F4UA 3ECSA 2B61A 4Q05A 5ED0A 3OICA 4JD5A 3HWX1 3WGJA 2FBXA 1B2LA 1QH8A 1D0VA 3WHKA 2WFLA 3AKYA 1SK8A 1XLVA 1N25A 2BUAA 2JAUA 4D81A 3CLRD 5I51A 5ES3A 5FBWB 1HKUA 1QC5A 1IDOA 1WMBA 5BR8K 4QREA 1C0PA 4M9ZA 4CF4A 4H1WA 3U4DA 1YH3A 1C2YA 4NLLA 3HYNA 2Q1UA 4HYYA 4XWKA 1KKLA 3LP1A 1ITZA 1YF5L 1TKZA 3VERA 4Q1DA 4YAIA 3FRHA 1EZ1A 2HHVA 2O4CA 4ECEA 1IWBB 4Q9AA 1MBZA 1NN0A 1ULAA 1KBOA 4FJ0A 2QZ9A 4JLUA 1QYXA 5FUXA 2C2GA 1LPNA 1RBYA 1ISJA 3OAAD 4I7EA 2XUKA 4CIDA 4YRNA 3KOZA 4FYVA 2Q49A 4MGHA 3HSCA 4FGLA 2HI0A 1ENZA 3LOQA 3A06A 2A40A 2QYHA 3O82A 4YFYA 3JQ7B 1IWOA 5ALDA 1IY2A 4ZYVA 1PT5A 4GBED 1IBKB 1QRSA 1LA2A 3VZSA 3BVPA 4W7IA 3DXMB 1L3VA 4URVR 1XWFA 2OVFA 2YZ2A 2XY6A 3CIFA 4TTVA 3LQ4A 3QB0A 2ZU6A 1EWRA 2DUMA 3FUWA 3O94A 3SDBA 3L7YA 1G1AA 2O9JA 3DB1A 4E0BA 2V6IA 3K71B 1MPTA 1NVFA 2XCTB 1OQAA 2A9JA 1YRHA 4PGGA 4I9HA 1XP8A 2PX2A 2I76A 5H68A 1YE8A 3B7PA 4DDKA 5K8UA 1C3OB 1UBMS 4XEHA 1XRRA 1OT3A 4CKBB 3PX6A 4WZAA 4YAGA 4GECA 4I2PA 1ZBLA 3G5TA 3CUKA 3ZLBA 3CX3A 2QUIA 4D1YA 2IC3A 5CDFA 4GDFA 2QR5A 3GJ4A 4KN9S 4RZXA 4YQEA 4BE7B 3PNYA 3V9WA 5ALNA 1IY1A 1D2NA 3QVJA 1WIWA 4OA5A 1L5KA 4JT9A 5I7FA 2V5AA 3QEOA 4M53A 4PVCA 3PX2A 2MR6A 4I2VA 4LVNA 4QBFA 3T7IA 3DW1X 3LGSA 1NN3A 4UMEA 3CRVA 4J90A 3A6EA 5DKFA 1U80A 4CKXA 5I7RA 2FEXA 4GM1A 2O4GA 4BR9A 2R6FA 5IYZA 4ZU6X 1OB2A 2QEXN 1G3QA 1KOGA 2GN2A 3M6AA 4HN2A 3CQ8A 4TKZA 1DG3A 2QK4A 4C0JA 3O8NA 2GV9A 2H4YA 3LQ1A 2CYCA 2FDCA 1EQAA 2Z57A 1X19A 3EUAA 2HVHA 3H3XA 3RRZA 4RA6A 2WV9A 3JX9A 3VU9A 4TVOA 3IVRA 1JSZA 3KIPA 2IH2A 2IWRA 5A2GA 3MN9A 2AI2A 1NT4A 2P0AA 3VETA 2VUUA 2CH6A 3O3OB 3Q9NA 1M90O 1ZN8A 2QTHA 5FTWA 4UUOA 5I7OA 3WNBA 1JKMA 1U8EA 4L4SA 1BHO1 1XXHB 4JJKA 4QZVA 3G2PA 5G3YA 3H6KA 1P6QA 2XUQA 4MWBA 4PZ9A 3TQHA 2HN9A 1QHFA 3ZI4A 3D9QX 1LAVA 3WT0A 1Z6AA 1N1GA 2HGZA 1X1SA 4HX5A 4RZHA 3DXKA 3A8YA 4B3OA 2NO7A 3ENZA 4DOMA 1PYOA 1XKTA 3IAEA 5CU7A 1TM2A 5KNDA 2HLNA 2GUIA 1L5VA 4RTPA 2AMFA 4F46A 4MQFA 1YE5A 2JI4A 5CK5A 5BNTA 3MLBA 3ZWMA 1JHPA 1NE2A 3KPJA 4C7OA 1UT8A 1XI2A 4M9CA 1NYTA 3BB1A 2ALJA 4E5DA 2HO5A 4RULA 4QEDA 4FLVA 2R6AA 3EFEA 2AB0A 4MGIR 2JHCA 2Z8YA 4WASA 3S2GA 1HE3A 3DOCA 1YCHA 3ND9A 1S6QA 3KWGA 2EBFX 5DOVA 1RQGA 1Y8RA 2BUCA 2YI1A 1NKVA 2G8FA 1F17A 4LFCB 4C4ZA 2COEA 1BIZA 4RWEA 2YWDA 1F0YA 4F4JA 3ZX5A 4XPIB 4DTXA 4N9QA 3COJA 4KR3A 3LPAA 4L5BA 2C0QA 3KVYA 3EVFA 1J70A 2OHOA 3GXOA 5EHGA 5CDHA 3SE0A 1KWGA 1BS1A 5AM1A 1HQEA 4P86A 2DECA 3VTFA 4AAYA 3DHEA 5K3SA 4NXNK 4JIMA 1DWOA 2PSJA 4TWIA 3VDRA 1ZK0A 3TTXA 5JHGB 1ZS9A 3GCZA 1EGQA 1OX4B 2I54A 4C4TA 2OV8A 2P30A 5KI6A 1JIIA 4FNMA 3STHA 1L9XA 1YFJA 4X85A 3OEED 5IHXA 5DE3A 1KDOA 1N9GA 2VA8A 3UBTA 1X3SA 4MO2A 3R6MA 5B37A 3TARA 3OQBA 1MV8A 2G25A 4S1NA 1XF1A 5ICGA 3O3GA 3OOSA 1FXUA 4Y67A 1VJCA 2AQ8A 4ISGA 4M22A 4BRGA 2ZE6A 3FTCA 4B79A 3IAM1 5C8YB 2WHQA 2PGAA 3D59A 4EL0A 6ADHA 2VAXA 2ACWA 1QVZA 2J4DA 2FOXA 3OQMA 3H1PA 1BW9B 4G0WA 1GG9A 1R5NA 4FXDA 3AF3A 3HVHA 1MO2A 3TCXB 4BE4A 4NBNA 4CIBA 1NNEA 4CKZA 3TTYA 2E1RA 3ZT3A 1IMJA 3I0SA 1RFLA 1UPTA 4CZGA 4RW8A 1FCJA 2AN4A 3HA2A 2C82A 1Q0QA 1D2GA 2OPBA 3PHCA 4RMJA 4YI3A 1T3TA 1JAIA 2B30A 1M7HA 5BN3A 1LNSA 3GZNB 3HRIA 4HNHA 1JHYA 1SVUA 2QVGA 3WQRA 2F8SA 1VKZA 3NBYC 4M60A 5IJ9A 3FJOA 4GBJA 4K9PA 2CUZA 4BRMA 3H8SA 3AZOA 4ZC8A 3WYBA 1FP4B 1VSMA 3LT0A 4AMUA 4ND3A 3T7JA 4RZIA 1MAWA 3NGZA 3ZWQA 4KSYA 2RJOA 2D1YA 4AFNA 3R24A 4NI5A 1EBBA 1JR3E 4GC9A 3OLZA 3D45A 6REQA 1EFUA 4BGUA 2RHGB 2F3UA 5LQKA 3AIIA 3NBZC 5I9IA 1JVNA 1AGPA 1NA5A 4FW1A 2BFPA 1VCMA 5EHQA 2IWHA 2H0AA 2ZGVA 3Q3IA 4PGFA 1U7DA 4S35A 5AKYA 5EWJA 5B55A 3BRWD 1JG1A 1MWMA 3I37X 4L85A 4B44A 5CYMA 3ZZNA 3J80O 3HN2A 2GHTA 4M8IA 5DBOA 3V2GA 1ID8A 2BM8A 3ADDA 4RW6A 5L7WA 2JLUA 5LYJF 5MDHA 3ZI0A 5F3DA 2D5AA 1I3LA 2FKNA 3VOVA 3C3XA 3K9WA 3TIGA 3FUXA 1AVTA 2VJAA 4I1OA 1LX6A 3I8XA 4KXWA 4XXHA 5KC8A 5CCXA 2XA1A 3K8ZA 1N9KA 2WV7A 3T7SA 3U16A 3NEJA 1ZJ6A 4XWOA 4BQQA 4WLOA 1VL0A 1P7YA 3BY5A 4HR7A 1LLDA 4PRLA 3UMYA 3INYA 1NG1A 2A33A 1KC3A 4QDUA 1EWYA 3WWOA 4DYDA 1DRWA 1EO1A 4U8GA 1ZKMA 1ISSA 3PXCX 3KUKA 4ON9A 3ZKWA 1M2NA 3I2JA 5BN4A 1U1EA 3BWCA 4G09A 4MMYB 4KAAA 1A4IA 1A69A 3T1QA 3NR2A 1VQ8N 3GEHA 3O3MB 4GEGA 5FQOA 2Y8EA 5TS2A 4IINA 2V74B 2VPWA 3OP4A 2XZDA 3QNMA 1M54A 1YBVA 2QUHA 1WZNA 3CKKA 1M1UA 3DKPA 3H4VA 3NRJA 5SICE 1FDOA 4GRDA 5BWNA 4B6FA 2WC1A 2IS1A 4XIIA 5DULA 1K89A 2A5XA 2J5QA 1SHZA 2B4RO 3GGOA 4J94A 1AGNA 4JEHA 4EHJA 2E6KA 1II9A 1FUYB 4NXMK 3FFTA 4ZVQA 3ZHXA 4LRYA 4V0ME 5B7QA 1CRLA 2WPDD 2UYQA 4RJTA 2QBYA 1ST2A 4FO0A 2JFOA 2M2IA 3CZ5A 2GR9A 4HFNA 1PR2A 4Q6WA 4YOVA 3ENQA 2AQKA 5FPSA 3ANMA 3KETA 2RGCA 1R6XA 1YL7A 4YT4A 1S5PA 2BBSA 2HJSA 2XJ9A 3LDOA 3DGEC 4H5RA 2B4KA 3OMLA 1A9XB 2BEWB 3GDHA 3V6MA 1UFKA 4JBLA 1JXOA 2I71A 2OD2A 4PCLA 4ZT2A 2DFDA 2G40A 4F9EA 1NBHA 1DX6A 1Q84A 3D43A 4QVGA 1R6DA 3O26A 4RJ2A 3IAS6 2O7VA 3GJ3A 2QQFA 2YWEA 3WHLA 1E9CA 3PGA1 8ADHA 1A2OA 3L82B 1DIBA 4TMKA 3HYTA 4WNCA 3IESA 3URMA 3X2SA 3SAJA 4TL9A 1MB9A 1VSIA 1YZTA 1UJ4A 5I4BA 4O8UA 2J0EA 1I3CA 3SZOA 1K97A 2O0MA 4C3UA 4DUZB 4EX7A 2EGGA 4RANA 2OT3B 4P4TA 1TZMA 2VT7A 1FSPA 4U63A 4NDZA 1TM4E 4DZRA 1DV1A 5IM5A 3H46O 2OHIA 1JEQA 2CHQA 1WDTA 3F3MA 3GPDG 3CC7N 3HB9A 3O4FA 4QNMA 3UGQA 4BC1A 3SXJA 3NHJA 3HKEA 2IA5A 3P94A 3DCIA 4DU4A 2X1VA 3UOAB 1UWBA 5JS7A 3OE7D 1UOOA 3LP6A 3AUJB 1QQCA 3MEDA 4R1TA 1P9LA 2PL3A 3AUUA 3DOOA 3UATA 1W1WA 1BOFA 4RGYA 3ZE1B 2H8KA 3NBMA 3FCYA 4GT1A 3UCFA 4ZEXA 5J1SB 1J1UA 3ZE9A 1GKKA 1ZNQO 3O8DA 2JCSA 2FTKE 2EDAA 2XOEA 1T7PA 4XJVA 2FZGA 1G2IA 1KMHA 2FPGA 3B1JA 3VC7A 2C99A 2C58A 3KKKA 3VR6A 1MJGA 4DR2B 1NW6A 4CF1A 4A23A 4KRGA 4DCOA 5HKKD 4TPKA 4P81A 5JW6A 4AP9A 3L93A 1ESDA 2FPPA 2BHRA 1ZXXA 3I1YA 4FYMA 4MRSA 1P1HA 3UUEA 1XRLA 2Q0SA 5BR1A 1FDSA 2DQSA 1IG9A 3TAMA 4JSYA 4MV1A 3SUQA 2DR3A 3BTOA 3D8HA 4KO8A 2OO5C 3NP7A 4B85A 2ZM6B 1ATZA 2XGOA 4I19A 4IGEA 3VPXA 4DMGA 3RSHA 1R4MB 5D2CA 2P2DA 1B3RA 2F3QA 1KZ7B 3CVVA 2PANA 1HRDA 4RLFA 1IZ0A 1TCBA 1ULBA 3EFOA 4MLEA 2EKPA 4BPRA 2HTFA 1U0JA 3I6BA 5C8VA 3FHOA 4TTQA 1I7QB 2XZOA 2C7PA 5TX7A 5IK2D 2XF8A 3MN6A 1O03A 3GELA 3DXFA 3F5MA 2WKQA 1Y3FE 3ETNA 4XE5A 1TMGE 2KW5A 3O3CA 2A67A 3W9UA 3TJMA 1TUBB 1RNHA 3GDOA 1PJ4A 2ZIAA 3H2ZA 4TLLB 1NKTA 3BIXA 3E9RA 4GOND 5IMSA 4PG5A 2VPTA 4QG7A 4KNYA 1N33K 4GVEA 2IXDA 5A4DA 1IUPA 4UNPA 2XWJI 3L0OA 1YGPA 5D6NA 4AS3A 3ESQA 3K0AB 2Y6UA 3G2IA 3IC5A 4GZ6A 4Y2YA 3GG4A 3VA3A 3EA5A 2XKBA 5ELLA 3UGTA 1LEHA 1G18A 2D3WA 4MV7A 3RSSA 3VQBA 3AF0A 3GLRA 2F17A 4JH0A 4RHUA 4RFSA 3HNOA 3H1EA 4FMDF 2WIFA 2ZBDA 5ENDA 5HDQA 4P32A 5AIBA 3JZMA 5JVDF 5KNLA 4I66A 2PL9A 1WM1A 2EWWA 2J32A 2Q3JA 2YCBA 5IT4A 4EARA 2G3YA 5HCUA 1E96A 2FJUA 2FHSA 2PFKA 1O1WA 2H59A 2Z1JA 4EIAA 3G8AA 1JDNA 2GZ3A 3I3SR 5F3WB 1UK9A 1RVV1 4F1WA 1A7KA 3ZXYA 2OPHA 3CVWA 4R2XA 4NLBA 4Y2HA 4KVFA 2RHWA 3H11B 3KZVA 3WP1B 1XRMA 3AZPA 4ZCLA 1DLJA 4NZOA 1E7SA 3FWPA 4M54A 3BIOA 1ZI9A 1N5DA 2EG5A 4IDPA 5CD9A 3R1IA 5AK5A 3OLCX 3KFXA 1O0SA 3PWSA 1TLTA 1I7LA 3IVMA 1S72N 1HFEL 4DM7A 1R74A 1TA0A 4WHMA 3E23A 3K1ZA 2IVOA 4U7TB 5BWMA 3PFCA 2OPRA 3VGKA 3PRJA 4MUEA 1JNXX 4B2PA 1YIOA 2P67A 3TD6A 1HUQA 2DC1A 1M2OA 4FKBA 3I2HA 3ZS8A 2O2YA 1UIRA 1GARA 2BFMA 3LVBA 5AKXA 1HEIA 1RJGA 3S29A 1MPXA 3LL3A 3DKKA 4XD7A 1O4WA 4D4HA 3EGIA 1JQDA 4U2DA 4ZWNA 2OM6A 1QH1B 2BD0A 3NHZA 1Z2DA 1JIUA 5FO1A 2EQAA 3DMHA 1B92A 2BDPA 1BN7A 2MU1A 3DE0X 3W4KA 4CPDA 4HJRA 1B42A 3R7DA 1LW0A 1JIXA 2IHNA 2ECFA 3JAWA 2PUCA 4AURA 1IHOA 3D2BA 1CX9B 3S3MA 5ARDA 3AEZA 3LO8A 4C05A 3C1OA 2FF5A 1N5JA 2HCBA 3VQPA 2IIBA 3W0LB 2BL4A 3P97A 3PF8A 1JA9A 1QBGA 1GQFA 2H52A 4O2RA 1WMSA 1D9FA 4BNKA 1I5RA 4IJ6A 2O19A 1KDRA 4O0JA 2FZKA 2OHGA 2C9CA 3N2EA 4OQMA 4TRNA 2B34A 2Q5QA 5GONF 1GR0A 3UJ3X 3ZY3A 4XLTA 4DABA 1CRPA 2YRXA 1NAHA 1E3QA 2DHDA 3L8EA 4H7FA 1ZGCA 2F4NA 4IS2A 5JDCC 1HQUA 2H00A 2Q0XA 4EHTA 4HL6A 4NMHA 4JA0A 2QRJA 1HNZB 3ROZA 5I3CA 2YCLA 1GNLA 3MXMA 3Q10A 3C7CB 4JYAK 2FSHA 3L0SA 4KHPK 4IDOA 5K6RA 3VA7A 4QDJA 2DFVA 1GLNA 2C7GA 1K8AO 4EPVA 1UWCA 1SQ0A 1J56A 4FW9A 1IZZA 1D3AA 5BO5A 4RQTA 4DFDA 1WB4A 1LWFA 3RBXA 5J1EA 4IOKA 4FJ7A 2K4MA 1GG2A 1SCJA 3NDIA 4IZIA 2I66A 3ZCXA 2E4YA 3E22B 1VB3A 3FLAA 2QM7A 1UFOA 1DB3A 1CERA 3R6GA 4LJAA 4DXDA 1W5TA 2R6DA 3TDKA 1YRQA 3IHWA 2X6NA 2IV2X 3H1BA 1P8AA 4JI0B 2QTMA 4EPTA 1FF9A 4LK2A 5AQZA 3RNOA 1V4VA 5J1TB 1VQMN 2DG2A 2ZQ5A 3AY3A 3PS9A 5KYWB 4QVIA 5GIOA 1PGPA 3QVWA 5G1NA 2Z8XA 3DAPA 4HNVA 3H2GA 5CYGA 3NF7A 4FX5A 4IWXA 3IDHA 2A8YA 1BDGA 2H7CA 1URPA 3A32A 4R1QA 4TGLA 4DV3B 2EX3A 1GDDA 1JXQA 2WWHA 2Y3IA 3ADPA 4MW2A 3ZUGA 4AIRA 5P8WA 4UHCA 3GBVA 1ILWA 1LPAB 2G9NA 1BMFD 3TIIA 3CH7A 3ULKA 1G6KA 2WJVA 2G8VA 3NKVA 1X7ZA 2B1JA 1A5WA 3E35A 1QP0A 1VZ2A 4KO2S 1GPUA 4URXR 1EIWA 1J49A 1XNHA 1BWQA 3PR3A 4ZIRB 3U3OA 4QHYA 3OCXA 4XUCA 1G8GA 2ZWAA 3DBOB 1GLVA 1TCUA 1FJ2A 1NI4B 5LJIA 2WWRA 2YCHA 1VQ7N 2BMWA 1LFDB 2HV8A 2NSLA 5JCXA 2M9MA 3I1JA 3FHJA 1U4OA 3U49A 3V97A 4HNAB 1HBJA 1OR8A 3DM5A 4MV4A 5K4GA 4K88A 1QDEA 2JLBA 4V1CI 3AR6A 4WGGA 4H8KA 3QFSA 1VSUA 2UXDK 2X7HA 2Y2VA 3FVTA 5ITWA 3CVXA 3KOOA 3ISJA 1NZFA 4L9SA 5HQTA 1HG1A 2VDJA 3OLQA 2VNAA 4IRMA 1ABFA 1JDVA 2WE7A 3I01M 1H6BA 2WJ3A 4BFSA 4EF5A 1C0EA 3AB3A 3AI7A 4EQ6B 2AWOA 3F2VA 3AGQA 4G0NA 3NTLA 4RW4A 1SHTX 1A5ZA 2J31A 3EOBI 3HS3A 1OGIA 1ZW1A 3Q9LA 1PEDA 5CVDA 3W6NA 2OO7A 3NHGA 5JIBA 4HD8A 4LBWA 1SUDA 1Q8IA 2HF8A 1KTQA 1SCKA 3IEUA 1UC5B 2GPJA 4DCJA 4KI7A 1L5MA 1DC4A 1G60A 5AM3A 4PSDA 3N75A 4CMAA 3Q85A 3WC4A 2O59A 2QYOA 1CD5A 1SXGA 3AB8A 4F91B 4ENQA 1EUDB 2ZYWX 5C8XA 3N86A 1S7CA 1Z88A 2XE4A 4CR8A 4RNCA 5F33A 3EQ6A 2FN7A 1ZWLA 3DBRB 3NASA 2NU8A 5YASA 1YKFA 2UU9K 5AK0A 4RF4A 4KK3A 2D2EA 4ROSA 3KYDB 3CCEN 3C3PA 3E2IA 4L8FA 2X14A 2H17A 4M7YA 2JFPA 4PAQA 2MJLA 4MPTA 3NHUA 2YMLA 2Q3EA 3TL2A 1NGSA 4DV4K 3VPCA 4BMPB 4Z7QB 4L78A 4ZI7A 8AT1A 1JH9A 2OYCA 5LU9A 4Q9HA 1ONOA 1H2WA 5F23A 1E5DA 2LE0A 4LQDA 4CEEA 3I55N 2QTNA 3BXGA 3KQWA 4KDCA 4B48A 4KQ1A 4L4YA 4OOFA 4R68A 3W5UA 1QR6A 3Q3HA 2ACVA 4IIFA 4NY1A 4QPPA 3I05A 3WFIA 1Z05A 4QYWA 3BGSA 3C1AA 3GVPA 2UUOA 2YJEA 2E4WA 1NUUA 3BXPA 3IRVA 2X23A 2Y66A 3L4EA 3WYNA 1PQWA 2YX1A 2RHCA 1XZAA 1G1MA 2RHOA 2ZBVA 4HB4A 1RT2A 1LLCA 2WIGA 1ZYQA 3H4TA 3I23A 3P9RA 4OKNA 4XWGA 2NLXA 5H3CA 1ZH8A 3WHPA 2E2OA 4HYQA 5KJFA 1WAMA 3D02A 5KOIA 3OY9A 2C4WA 2F48A 4B8YA 3SFTA 3QINA 2PZKA 1RFGE 1QK4A 2XR1A 3LP0A 3KTAA 4LGVA 1WXXA 3DZCA 4JLBA 4G4JA 1CR1A 3K2EA 5F5NA 3ZDRA 4GPAA 2QP4A 4KODA 4EUHA 1OZ0A 2CBXA 3DZKA 1K06A 2P9BA 2C4VA 1L3UA 1A8PA 1XDWA 1F6BA 2AMJA 2IPLA 2XT6A 1KMQA 2P9PA 3NCIA 3CH5A 3NBFA 4O3FA 1QZXA 2C31A 4FGSA 3D5QA 1A5VA 1AZSC 1QGDA 2PMKA 4JYCA 4UU0A 2WVJA 3X1DA 5AW8A 1FX0B 4LF9B 3PIPL 4GBMA 3U7FB 3FTQA 1DOAA 1RLJA 4M0DA 4DLVA 2HKIA 2VYCA 3QFRA 4N8EA 3ASZA 2EIHA 4IUDS 4NZNA 4F3CA 2XXAB 1W29A 1VHJA 2ZKIA 4H7PA 3RAJA 5JT1A 2GO7A 3ZYZA 4JEMA 5UKDA 2VNIA 2ZI3A 4UBMA 3A6FA 2AC7A 3KKLA 2KW4A 3RMBA 1AUPA 4DR2K 2CXRA 2H1VA 1ZK4A 3ZBPA 5EUMA 1XAGA 5ALPA 1TAGA 5E1DA 5C7YA 1SCUB 3H08A 2GZHA 3SHTA 3WSWA 2J3QA 2V58A 5TR9A 4EA6A 2AEEA 4DLNA 2PXXA 4B3MK 3LC2O 3Q7BA 2Q27A 4WDQA 4R7GA 3BAFA 5HBRA 1P4HA 4A5SA 1KETA 2HB6A 3PK0A 4G1EB 1A9SA 1W36B 3OD1A 2NNLD 3SMQA 4OXNA 2N0SA 5AKJA 1B9FA 4YRBA 1KLNA 4GWKA 4AYWA 1NVXQ 1RXVA 1Q16A 1UWKA 3SNKA 1N5KA 5G1PA 3KT6A 2E6UX 1U02A 1WY5A 1KQNA 4IILA 1YR1A 1WPRA 3DEZA 2Q3BA 1YZNA 3F8WA 1KI8A 1YZUA 1JN0A 1PZNA 3DPUA 4TMFA 4C4OA 3R5JA 4IMJB 2A42A 4DWIA 5EFZA 1V9CA 2V7QA 2VRCD 5DN6A 5EJFA 1R3DA 2FXVA 3PV0A 3D1VA 3AKZA 4RUKA 1RPAA 3L0YA 4N49A 4WKBA 2PH7A 1ASWA 2OZEA 3W5HA 2I4LA 5BW8A 6NULA 2WUEA 3KBOA 5ADHA 3CX6A 1UF9A 1FQJA 3Q2KA 4C8OA 2R5WA 1DXOA 1XNGA 4H4DA 4XH1A 1I7NA 4LW8A 5CDYA 1EYZA 4Q24A 5M3BA 3ZHCA 3ADOA 1U2GC 2W6PA 4J9UE 2Z5GA 2QA5A 1J21A 2B98A 2VF2A 2XTZA 4ZC1A 3OUUA 4E5YA 1FXSA 1MR3F 1UJ2A 2MWMA 4A8JA 2VKTA 4QATA 1XF9A 4FHZA 4BRKA 3EGXB 1MOPA 4AB1A 3VR5H 2J8ZA 3BGIA 4R1PA 6GPBA 4XPIA 2NACA 1GG8A 4YIKA 4I7FA 2PCJA 2J5KA 4YRPA 3DT9A 1CF9A 1LPBB 4ICLA 2P75A 3LIIA 3W5JA 1NMYA 3RHSA 3GNTA 3NJ8A 4Q4AA 3OPYI 4X91A 1RTJA 2VN8A 4NBSA 3G2HA 4BGAA 1MORA 1QOZA 3WDSA 3HJRA 3LDHA 3AO3A 2QW0X 4KH0A 1BX1A 3F4BA 3MGBA 2CXOA 5TVKA 3WRVA 4FKZA 1SAZA 2BFCB 1SKUA 4Y2PA 3RSEA 5AQLA 3QENA 1P5FA 1YVNA 1JQAA 1NUHA 2CLFB 4MLZA 4NV1A 1M8GA 1RCTE 3UB3A 1SU7A 2X8WA 4HBGA 2OUKA 1I51A 1WKBA 4PV7A 5EE5B 4DYHA 3BRSA 1JYEA 2QTVA 3D54D 8ABPA 4ARVA 2Z3VA 2FPIB 3ROPA 3PUHA 3S2FA 2QI9C 1IN6A 4J0DA 1EB9A 1QDUA 4GPZA 2JS7A 1TT5B 5A9SB 4I9LA 1RP1A 1WUTA 4PIPA 1P4GA 1RAHA 2HWWA 4WXHA 5F5XA 1UODA 1C7QA 2C4KA 4KAJA 4V2UA 1DKRA 1NF2A 1WXFA 3PTZA 5JSUA 2Q1WA 3CV3A 4WOKA 1QAOA 1MFPA 1UBFA 2D2XA 2QVCA 4U9HS 2W41A 4JJ7A 2GO1A 5CXQA 3AGKA 3UKRB 4N1AA 3T54A 1I4OA 1HMVA 3OTIA 3ZIAA 1T3LA 2JFFA 2QP9X 1TK3A 3H19A 4FU0A 1LTQA 3PNBA 1N36B 1YJNN 2ORVA 2JH9A 2PFGA 2D1TA 1RRPA 1SCDA 4JLJA 1VKNA 3H2KA 2X4DA 3SNHA 4YRMA 5LZ7A 2DETA 1NIPA 3ZDXB 2FMXA 5AQEA 1W5BA 5E7QA 5L3QB 2GPAA 5K3AA 5CDGA 3FGOA 4CERA 1C1XA 4N6OA 3DYAA 4AMGA 2R11A 4BDTA 1KJZA 4FDVA 1EU1A 4UTXA 3ZWOA 5AQ1A 4HAXA 4CIWA 1ENPA 2TMKA 1IK4A 3A04A 3U8XA 2PKWA 1S22A 1L3IA 5B1DA 1N75A 2P1JA 3IPLA 3Q9SA 1GU0A 2I7XA 4C04A 1GQRA 2J6HA 3SXUA 3VEYA 3OTWA 3NF6A 2ST1A 2PIAA 2PVCA 3DE4X 3VISA 4EB6A 4YJHB 4L1KA 1HNXK 4K9LA 4Q3CA 3HVRA 2FPXA 3OOEA 4IHJF 4FJMA 3Q7PA 4BNNA 3C3EA 3OLVA 1H5QA 2JIOA 1S1CA 2AKYA 1JLAA 5D3GA 2P9YA 5H7XA 1YDGA 5A5FA 1H0HA 1UQRA 2IEZA 5F51A 1I3OA 1R37A 2CNNA 1SG9A 1NQAO 3LDPA 3N2NA 3K20A 3K53A 3DCJA 4GMHA 4QXOA 1ICEA 4JLDA 1PQ4A 1OZHA 1Y48E 3NKFA 3U62A 1I4LD 1YQXA 1ZRSA 2DHQA 3GUYA 1ZD2P 3OCWA 3PWZA 4RPIA 1T5OA 3WXBA 3NYWA 4AJJA 2VDOB 3QF4B 4ND2A 2ZYAA 3DE5X 2C5HA 4P4SB 4KQMA 4QPNA 1QGAA 3TSOA 2O3UA 4Q03A 1T8EA 4BWYA 4Z51A 2W22A 1U9JA 2BDEA 2WWVD 1QE0A 2R9VA 3IS3A 4Q9JA 2OO3A 5DNCA 2OESA 2QTWB 2YMPA 5FADA 3V8NA 3B3FA 1ZA2A 4GXQA 4UCXA 2CLHB 3MN7A 2OTJN 3EPKA 1BEUB 2BFFB 3HGQA 2IZ0A 3V6DA 2FUEA 2QTFA 4CNQA 1O5IA 2GHRA 1I7PA 2HMTA 1Y6RA 2BCJQ 1QYCA 1ZJYA 1ZJJA 1OWPA 3D3NA 1Y3HA 4IIGA 1X1PA 2LTAA 2Q5EA 3KT3A 1P17A 2J48A 5DRTA 4E03A 1Q7TA 1P0MA 4TV8A 4EGAA 4PWDA 1GNVA 2NRXA 5DHFA 4QPJC 4ZYTA 1M2FA 2QOEA 2FGKA 1B6SA 2OXCA 3QVKA 4PZPA 3RC7A 3U4QB 3CJCA 2PYJA 2FV8A 1YZKA 2XZTA 3NBAA 5KTPA 3ETEA 1PIWA 2D0PA 3W7AA 5BXQC 1YVEI 5CVTA 2WQ6A 3H8WA 1RZVA 1NMQA 2D0BA 4WN3A 4KQ2A 5F2EA 3MPOA 1M2VB 3KUCA 3ORRA 4WN9A 4MJLA 4ZU3A 2BRUA 2QL9A 3G1WA 4MPRA 2OFWA 3DHVA 3ZJ5A 5JSQA 3U7JA 5BQXA 1P9WA 4EFKA 2H4WA 1MO3A 3IAYA 2ASEA 2R8YA 2PYLA 2O8DB 2ES4A 2PT5A 2ZSIA 4MVWA 4XB1A 1D5WA 3EVCA 4MV9A 1DKQA 1EK5A 2C20A 2A5LA 4LZOA 4TQUS 1OAOC 1QO9A 3E7FA 1MF7A 3V3KA 4G07A 2G1PA 2IZOA 1XO1A 1G6HA 5DSXA 4JEPA 1HTWA 3T7RA 5GVSA 4B34A 5H5JA 3ID6A 5CAEA 4F12A 5JQGF 1TT7A 4KX5A 4OLJA 4XVHA 4W1SA 1WP4A 5AHXA 4C78A 1IEQA 1G9TA 3FR0A 4JYZA 1OBFO 3RC1A 1K66A 4KLRA 1EE1A 1EB8A 3OD5A 3QPVA 4O59O 4D97A 3GAMA 1BHQ1 2JFZA 4PCVA 2X5JO 2Z4TA 4LNUB 1RT5A 1G8FA 3AEUB 1X3LA 3KCNA 4HNRA 3PYMA 4P84A 2HWUA 2HA6A 5ALIA 3VHLB 4CCYA 1VYHA 1O1YA 4GPEA 3UAOA 5HS4A 1Q1AA 3VZDA 3PJEA 1JVSA 1T2AA 2I1LA 3VC3A 3LP3A 3MX2A 1C30A 1Y34E 3RVBA 4YN3A 2CNWD 1YHQN 3W7VA 4A8TA 4ZMBA 4RVOA 1MNAA 2IYSA 2QX8A 1RBZA 4TLAA 2X4IA 1RADA 2P8SA 4L4UA 3PYLA 4JSRA 3ABSB 2R7KA 5FYDA 3AVJA 4IFTA 1YGYA 3A37A 2HHHB 4BIIA 3PUVA 3GXBA 1UPAA 2CDRA 4MLDA 1YITN 3K6KA 5AJXA 3WK5A 1BXRB 1OGJA 1MABB 1ORWA 3VKFA 5B58T 3VU0A 3WLJA 3STTA 4P58A 3FOBA 3OFND 5ITZA 2BYTA 1GU1A 3MFQA 3G1UA 1XMOB 4JEUA 1UBRS 3ZEIA 5LB2A 2P78A 3GJXC 4JL8A 4YV1A 1EVIA 3BXHA 1UXIA 4NPAA 4PLHA 3HCWA 5BY2A 2P4EA 5TPZD 3JW8A 3L05A 5B4UA 5CYFA 4C08A 5CCBA 2JCBA 4RPCA 3MWFA 2QN6A 2PH1A 4FJGA 1NBWB 3SPZA 1J97A 1U5CA 2UZ0A 3C39A 1SCQA 3B8EA 4OHPA 4LV5B 3OCYA 2C2XA 3BSSA 3QMPA 4AF8A 1SKWA 4BO0A 5ICCA 2B5OA 1F2TA 5LXTF 2YXPX 5KC9A 3NHYA 1R0RE 3FZYA 2D1RA 3LUDA 5AI5A 1B2RA 3D2FB 3ZT2A 3VH3A 5IMBA 4CQMD 5KYYA 4PU0A 4TL6A 2XOXA 1W4LA 4IQ4A 4I9QA 3IBYA 2ZJQL 1NULA 5LOVB 5JC8A 1ZKDA 2IF2A 4B9AA 1M83A 3HNRA 3QWAA 3UWDA 4O1HA 4J6EA 1VSTA 2JGLA 4XJTA 3IR6A 3ORSA 4QL3A 4CJ7A 1VLLA 1KF0A 3BMNA 5DN9A 1SXPA 3U3XA 2W58A 2WHEA 4X93A 1T0BA 5CJ2A 2XCUA 3G23A 3L8HA 1O95D 2F1JA 2QN1A 1YKGA 1Y8ZA 2P2GA 3HKDB 1JHDA 4KN8A 2AC4A 3O3FA 1EK0A 2HDNB 1MJFA 1HRHA 1MH1A 2HHLA 2X1LA 3LQRA 3ILSA 2V6MA 4MR7A 1IHDA 3M6VA 4X97A 1U0NA 4RK0A 3D6RA 1EE9A 2GZMA 2WUSA 4XYEA 3SOPA 1ZIYA 1TV6A 3OZTA 4BR7A 3MXTA 4ZVKA 4JROA 4UUNA 4UEQA 2ZXEA 3OT4A 4RWZA 2J4RA 4W9MC 2PRYA 3FMFA 3WB2A 2WAMA 1W19A 3P27A 5ELXA 3UH1A 2GD0A 3ZQUA 2HHSA 4ZO4A 3PSFA 2Z04A 3ZX3A 2XD4A 3CW2A 3EG5A 3BHMA 3NMUF 1JMKC 1BIUA 1KK2A 1US8A 3GJ5A 4R8LA 3S7ZA 2LUOA 4KKXB 2IITA 2ENWA 4IWYA 1XTBA 3PDHA 5DMRA 2XW6A 3AI1A 2R1VB 1DPFA 1K5DA 4I6JA 4MYRA 4RA9A 5EXDA 3L43A 1FXXA 5A4JA 1ISFA 5CNKA 4D6PA 1VRWA 3I30X 4RTSA 1I2MA 4BZXA 3AF6A 3NIDB 1KYVA 2SCUB 2OENG 2XV1A 3MWLA 4QBHA 3MERA 4IZOA 3TNYA 3UYKA 5JMWA 4GE3A 4NESA 1S8AA 1JPJA 2J9FB 3AY6A 4A7PA 5KYTA 4PKHA 3S99A 4CHQA 1L5HA 4JU9A 3D4PA 3GG9A 1AUXA 4LDZA 2ZI5A 3IKLA 4GSKA 3WLEA 2H08A 4KR6A 3ED1A 1SXHA 4W5OA 5LYYA 3OIFA 1OGYA 1L5WA 5ECDA 5CNMA 3ROMA 3WWDA 3X44A 2H11A 1NFQA 4BRIA 1XD2A 3VNAA 2RGBA 3A9TA 3AFNA 1OFVA 3TPQA 3EZ7A 3LRPA 1VIVA 3KR0A 5KB3A 2EX0A 1CF2O 3AHCA 3VU3A 2CT8A 1LPMA 2WUGA 4FFBA 4KH5A 3RR2A 1MQSA 1VLMA 3PD0A 1F4LA 4AM8A 3SZGA 1AUOA 1N4DA 1ZSYA 4DLKA 1YVPA 3B5EA 1GLGA 1K6JA 4HDRB 4QBIA 2ZSFA 1GTJ1 1IBMB 2VP3A 1Y4AE 3MA0A 4KGXA 3KLOA 4NKRA 5CLLA 3HHEA 5AXCA 3ZXUB 3ZYCA 4JRQA 1NLMA 1P2DA 4I46A 1U2RA 1YCGA 4LRUA 4YT5A 5G0SA 4KAZA 1ZH6A 1ZK2A 1ZNXA 4HS9A 4ARZB 2D0PB 2BKXA 1A77A 1G99A 2NAPA 1VPWA 3F49S 1H5NA 3CXUA 1XTSA 4C0LA 1H22A 2ZS8A 2GZ2A 2WF9A 4UXIA 4UD2A 3O6WA 4QA9A 3B6ZA 4CVNE 2AKAB 1ECFA 4YMWA 2Q9UA 4ZCSA 3V55A 1M1NA 3I62A 2X9LA 2QWRA 4IBNA 4NEGA 2JD1A 1ID1A 4UARA 1NJXA 3EIQA 3W05A 1N5YA 4UTOA 4ZVMA 2B2XA 2Q2WA 3GJ0A 3FYUC 2XF2A 3GJZA 4O4JF 4ZHQB 2V5VA 3S2IA 4DC0A 3EFOB 4NE2A 1NJYA 2J3HA 4NQZA 5BUZA 4TZ0A 2VVTA 1VDMA 1ZQ1A 2GPTA 3GO4A 2RB4A 3TOCA 4BJ5A 3SS8A 3R23A 1H4QA 1Z6ZA 5GINA 2RH4A 4E6PA 1VHLA 2PGNA 4BBZA 1CJSA 4YMVA 1K6MA 3QPBA 2E8AA 1L8AA 4L0CA 4M38A 4DMKA 2ZE8A 3E7DA 1ZN9A 1DKOA 5L40A 4YBRA 3VM6A 2C5EA 5JBNA 1DRKA 2PWYA 2Q3CA 3GVIA 2XBUA 5C4GB 4ME6A 3VQ7A 3O2SB 4GLOA 3RS5A 1EK1A 5TT1A 4D41A 1XE3A 5H82A 1AK2A 3LXUX 4BP3A 4DB2A 4W5WA 1DKGD 1OX5A 5HQ3B 4D4KA 3TTCA 2YNGA 1JQJC 1YS2X 2HA0A 2J08A 2X7XA 1V7PC 1OXBB 2VBFA 3GGCA 2IBMA 1E8MA 4KWIA 1K1EA 4MW6A 1G20A 1CQJA 2WC9A 4DCMA 2ERYA 4BDZA 1PT7A 4CZMA 4IOCL 1WMAA 2VCYA 2IDZA 3PLRA 4J0GA 1Q21A 4N5MA 2JI6A 4V39A 1NW3A 2HCFA 1E3WB 2PR2A 4MA4A 3CF2A 4BLTA 5KWJA 3MCAB 1YBHA 1E2BA 1ISPA 5ITVA 1OFTA 4QC2A 3SSMA 2OXTA 1XPJA 3H6GA 3HGTA 5FP0A 1RYBA 5KCMA 3LPCA 2R8ZA 3GGGA 2WM8A 2ZTMA 5JVGL 1VHTA 3BC1A 1RRMA 3PUKA 1PWXA 3G7NA 1S6YA 3G17A 4IMIB 2ZE7A 4BNTA 4FFOA 3LDAA 1K2VN 4ZYZA 2CFIA 2J9YB 2CVPA 4BGDA 5AQSA 1PZGA 2QP3A 1E2JA 4MRNA 3L4KA 1M5RA 5G41A 1FFYA 1DMRA 4OJNA 5JXGA 5FPNA 2PLFA 3DAOA 2XHEA 4XQEA 4NC9A 3R40A 4RK1A 4E7PA 3KCQA 2C8JA 1FRZA 4RFLA 3U5ZB 1QVVA 1TJ4A 1AQYA 4M87A 2HBJA 4PSAA 4P7KA 4D9JA 1S1TA 5A06A 3T3OA 3CN7A 2HX1A 2Q62A 4B8CA 3RCBA 1IBKK 1M5UA 1BGWA 2HSJA 4IQ8A 3FMGA 1NQVA 2VH5R 1VSQA 1J53A 2JLAA 1YB6A 3MGCA 3LANA 2ADOA 2QU8A 2VPXA 3ADCA 2XMCA 3TG8A 3SCXA 4QS8A 1N8TA 1JUDA 2WJJA 3DXYA 3JWGA 3Q12A 4FHFA 5FI3A 3S70A 4MFBA 1GGMA 3KD1E 3QUTA 3BGWA 2HRRA 2ZB7A 2MSWA 5EPOA 5PNTA 3VSBA 4C01A 2BUBA 1T9ZA 4PAOA 1KNQA 1SU6A 5CGQB 1G5TA 2WF5A 3ROGA 2DHCA 1MAUA 3K3PA 1AQUA 5J4YA 3P2MA 4U5QA 1GTRA 5BR8B 1U65A 3BX1A 2IGIA 3K6SB 4JBYA 4M49A 4R1UA 5JANA 3CURA 1CQIB 3HUEA 1YQTA 2BGGA 1K5HA 4US0R 5FBQB 4QICA 1NGHA 4CQJA 2V3CC 3EVNA 1ZDMA 1U0OC 1BQMA 1CUEA 1WPGA 3CPWM 4OX9Y 4OHFA 4KR0A 1Z5ZA 2BCGY 2P6NA 5CZ2A 4PXAA 5EIWA 5ILGA 4D98A 4ZYYA 2EEPA 2HBRA