2YHBA

Crystal structure of the n. crassa qde-2 ago mid-piwi domains
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
433
structure length
368
Chain Sequence
VKVARPCRKIEKWTYLELKGSKANEGVPQAMTAFAEFLNRTGIPINPRFSPGMSMSVPGSEKEFFAKVKELMSSHQFVVVLLPRKDVAIYNMVKRAADITFGVHTVCCVAEKFLSTKGQLGYFANVGLKVNLKFGGTNHNIKTPIPLLAKGKTMVVGYDVTHPTNLAAGQSPASAPSIVGLVSTIDQHLGQWPAMVWNNPHGQESMTEQFTDKFKTRLELWRSNPANNRSLPENILIFRDGVSEGQFQMVIKDELPLVRAACKLVYPAGKLPRITLIVSVHYTVLVDEIFRADYGNKAADTLEQLTHDMCYLCPPAYYADLVCDRARIHQKELFDALDENDSVKTDDFARWGNSGAVHPNLRNSMYYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POST-TRANSCRIPTIONAL GENE SILENCING PROTEIN QDE-2
publication title Crystal Structure of the Mid-Piwi Lobe of a Eukaryotic Argonaute Protein
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Rna binding protein
total genus 125
structure length 368
sequence length 433
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yhbA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yhbA01
3IAYA 4O0JA 5JNTA 2QKKA 2PKXA 4MS1B 1BIUA 1DCMA 2AYXA 2D0BA 1RT2A 2VG5A 2VG6A 4CEDA 3TABA 4Y1DA 2WY2D 3QX8A 5BQ3A 4GVMA 2BE2A 4JB2A 2ZQBA 3GV0A 3S3NA 3SQ1A 2OPRA 1KVBA 3BRQA 3HT3A 5EWMA 3GBPA 3LUFA 3G10A 3LZIA 1NXTA 4OKJA 3ZSRA 1MIHA 2X7XA 3M8QA 3SG0A 1SXHA 6ABPA 4Z4CA 2ZAYA 2GBZA 3N0WA 4KK3A 3NDKA 4QPJC 3QLHA 2MYTA 2MYPA 4N56A 1VK0A 1YMUA 2RJOA 3HDGA 2G8KA 2PYJA 3O75A 4HNSA 1JXBA 3E3MA 4KZKA 4FJXA 1E6KA 1L3UA 1BL3A 5DLEA 3JSMA 1SUQA 4Z0NA 3OYMA 3RVLA 4DQDA 1KVAA 4PQUA 3ZSQA 1X9WA 3Q9SA 4EVQA 5TQ0A 1Q8IA 1A0OA 1SXGA 4M45A 1UAXA 2CWDA 4I9QA 5HKOA 3O2JA 2L18A 1XHXA 4DWIA 3ZT4A 3EQZA 4XASA 1NK0A 4BE0A 3KLIA 5TQ2B 3E01A 3O3FA 2FQYA 4ZJPA 4CHZA 3L2QA 2B6AA 3V81A 3LUGA 2L19A 4KQCA 2P4UA 1S9GA 2E6LA 3BBLA 4O5BA 2R4QA 4TMYA 3OYBA 3AVNA 1EP4A 3OM0A 3ROFA 5TE9A 4CIFA 1JLEA 2N9UA 3AVHA 4I9LA 4RK5A 3NF6A 3JYTA 4Z4EA 4KV8A 4CK1A 2LBPA 1RBUA 4G0PA 5FBHA 3NNNA 4YO7A 3ZT1A 4CHNA 4C8NA 1BA2A 4KHUA 4RXMA 3C95A 3CG4A 3QELA 5J2NA 5E3JA 5FRNA 1D5AA 4RU1A 3M9XA 1FFSA 3T8YA 1KLMA 4N0PA 2HW3A 4LD0A 4MQFA 3RRGA 4E1MA 1RDBA 4LX8A 4M3RA 3MM4A 4S04A 2L2QA 1DC8A 2JRLA 2HNYA 3GL9A 4DTPA 5E41A 4EYKA 2FTKE 4FB4A 5IUJC 3HV2A 4FLXA 1Z17A 3LUAA 2LSNA 4B8CA 1FFWA 1IIBA 3CS3A 1P8AA 1Q9YA 4M3TA 4E7IA 1IKVA 3WNGA 3K4HA 3QEVA 2OYQA 4JP1A 2ATQA 4YCSA 3F6PA 1QNLA 4G0OA 1W9HA 1D2AA 4DN6A 1JKHA 1L5YA 5EU7A 1QP0A 3OQMA 3K5MA 1AB5A 5HBMA 1S1WA 2HHXA 3OYHA 1UWBA 1RZRD 4E0DA 5HRPA 4JAVC 4PYRA 2FBTA 4UHJA 2PZSA 1X1PA 3BILA 3VQ5A 3LKBA 3MYYA 1HNIA 1KFDA 2KZMA 2P5OA 3FGZA 3H08A 1TM2A 5TPWB 5I3UA 4Z4GA 3HL8A 3OQNA 4N03A 2QSJA 2QVCA 3OYAA 4CJTA 1UA0A 1VKRA 4FZZA 3CFYA 4C8OA 4CEAA 1BCOA 4O0IA 3ALYA 3LPTA 5J2PA 4Q6WA 2MYUA 1LWCA 3WNFA 4P1ZA 2B4JA 1NJYA 2YKMA 1NXPA 1KGSA 4OJRA 3MEDA 4NCBA 1ZDMA 4E1NA 4OTZA 5C5CA 3ROTA 4CJ3A 3PY8A 3VA3A 1FKOA 4DFJA 1DBPA 3FMVA 3OS2A 3DLGA 1BISA 2KYRA 3DLRA 4IDKA 4B9UA 4DQIA 4FK0A 4WWHA 4ID5A 1CYEA 5FRMA 3N0XA 3WNHA 4PE5B 4P98A 5DK5A 3SUNA 3DOKA 4DLEA 4M3YA 1WSFA 2H0AA 3RVJA 1SKSA 2YNFA 3SNKA 2G8WA 3BRSA 1RTIA 2VWKA 3H5TA 2WOMA 3KLEA 4XARA 2KTQA 5FWYA 3VQPA 1JDNA 4CEBA 3K9CA 3N6VA 1LW0A 1WSHA 3DGFC 5HP1A 5HM6A 3QERA 2PUBA 3VQ8A 3QEXA 3RMBA 3KS9A 1RBVA 4J2BA 4DU3A 3OLYA 4F06A 1VRTA 4DSJA 3DLEA 3RR8A 1WSIA 2WMYA 2HSGA 4PA1A 5KC9A 1VSIA 1RILA 4LE2A 4KAZA 1TAUA 4IKFA 3MF4A 4B9TA 1U2PA 3Q15C 3Q7RA 3DZDA 3RRHA 4KKOA 4CJVA 4N47A 2JBAB 1NY5A 4E7JA 3GRCA 4CK3A 1SL1A 4FJLA 3NGYA 4CF2A 2Z1IA 4WZZA 1REVA 2QK9A 3AVMA 3RQIA 4KTQA 1DBWA 3QX9A 1S8NA 3I0SA 1HNVA 2AJQA 1LBHA 3ULDA 3QLVA 1KFSA 4JLHA 1NJWA 1N5YA 4F8JA 3M8PA 3BGRA 3DBIA 3SUQA 5HSGA 3TX6A 2PL9A 1JH9A 4DLGA 4PY5A 1GOCA 4HUEA 1NTRA 3O74A 1KMIY 2IPNA 2E6MA 3U3YA 3I42A 3OLVA 3C3MA 3AA2A 2HHTA 2ID9A 4LE1A 5CNIA 3NGIA 1ITGA 3MEGA 5ABPA 4RK1A 3MXMA 2JLEA 1RNLA 1G15A 1JDPA 4DSLA 3RVQA 2XY8A 5KRTA 1ZBIA 2FN9A 1WAJA 1PUXA 3SY8A 5TQJA 3TAPA 3ZSOA 1JLGA 4CJRA 1L3SA 2M1ZA 2PJUA 5BRJA 1IH7A 2R47A 1SKWA 3L8BA 1IKWA 1U49A 4DG1A 1W25A 4UQGA 4F3TA 4DFKA 4FJGA 1ZN2A 3HZHA 4PZ0A 2QKBA 2WWVD 2PYLA 1RTHA 4OATA 3AO5A 4MS4B 3OLXA 3CG0A 4H60A 1KCFA 4C8LA 2Y1JA 3S3OA 2JK1A 1RNHA 4KTWA 4B9VA 4QCLA 3QEKA 1WSJA 4RW7A 1Z18A 1ABEA 2GI4A 1KVCA 1XI1A 1ZH2A 3W9SA 4D6YA 1I3CA 3I0RA 2E4ZA 1B92A 1RBTA 2PUAA 1WSEA 1C4WA 5EWLB 4HHTA 4FJKA 1XHZA 7ABPA 2PE5A 3O3HA 3LP1A 2QXFA 1ZBUA 5C24A 4FLUA 1JBEA 1DCKA 3ZSXA 3DMJA 3IPAA 4ELVA 1T7PA 3HPOA 2LIVA 3AVLA 4OGCA 3T3FA 5KGWA 3K59A 3O3GA 4E19A 3SI6A 3I45A 4M3UA 3SUOA 3IP5A 4MR9A 4MS3B 2KQ2A 2FLKA 3KCNA 1EHCA 3LTEA 5TQ0B 4H3HB 1X9MA 2P51A 4DS5A 4RW9A 3KK3A 1KLNA 2PLNA 4MPTA 1DLOA 3KHTA 3OQOA 3N75A 4KREA 1M2FA 1Y97A 1Q9XA 3MMNA 4GNRA 3H5IA 5SWMA 1TVMA 4JS4A 3PX0A 1RT7A 5PNTA 2FQXA 4B9SA 2IS3A 2RGYA 4HTUA 3NNDA 4CF0A 3OLWA 5KQGA 2M98A 3OYGA 4Y9TA 4DTMA 3GWGA 4ETNA 3VQ9A 3OYJA 5JNRA 4Z99A 3O2SB 2FLWA 3LZJA 4FM0A 1BVHA 4NCGA 2Q3SA 3VQQA 3P9YA 3TD9A 3PV8A 4OGEA 4TLMB 4W5QA 4MR7B 3LWMA 4EYGA 3RVNA 1DBQA 2MYNA 3QELB 1TK5A 3ILYA 2E4WA 3CHYA 3AVGA 4IF4A 1HYSA 1DG9A 1TLFA 1QPZA 4ZTJA 4W5RA 3EODA 1Z16A 4FJJA 2RDMA 5GQSA 1PEYA 4G0YA 4QAGA 3C3KA 3H1EA 3AVCA 1JL3A 2ZWMA 3O1IC 1RT6A 2Z1HA 1WSGA 4DU1A 3LP3A 1TL1A 5KI6A 1LWFA 4AHUA 2W42A 4MR8A 2WJWA 4HUGA 2EX3A 3H5LA 3KIOA 4CFAA 1GOBA 3CKMA 5CNJA 2A9QA 4O4GA 5IX8A 3AVJA 4TLLB 3SNNA 4KFBA 4OBBA 4RY8A 1U48A 2E4VA 3P83D 1BQNA 4W5TA 2GV9A 3KKSA 3H6GA 1P2FA 2IYNA 3RTVA 3KTOA 3VQCA 4FJNA 3NF7A 1J54A 5HRNA 2JVJA 4DF8A 4BWJA 4YLEA 4LSNA 4G86A 4CGIA 3B6PA 1W0HA 4N41A 9ABPA 4XFKA 1Y1LA 3KLHA 1RT3A 3VQAA 1FFGA 2HB5A 1RDAA 4MFBA 3EJWA 1LW2A 1S5JA 2NT3A 1LAVA 3DRSA 4JS5A 2FMFA 4F3OA 5FWXA 3QLVC 3C6TA 3AA5X 4MYRA 4FM2A 4L4UA 2G8HA 4DTNA 3RVRA 3PUFA 2G8IA 4MAAA 1BDIA 1Z2EA 2V0NA 4G0ZA 1T03A 1TK0A 3SQNA 4Z4FA 3OMWA 3CYMA 4S05A 1GUDA 3CFOA 4KNYA 1EKEA 1R8JA 4FLVA 1RTDA 4N0QA 4KMRA 4DTRA 1ZY2A 4RK4A 3TB6A 2YKNA 5T7BA 3LKVA 2BANA 3MECA 2YNIA 4DSIA 1BGXT 3KTQA 3OO0A 1TK8A 3C6UA 3IG1A 4GW6A 1NKBA 3CNBA 2PY5A 5J1EA 3O1JC 4JA2A 3V1OA 3RVOA 1A5XA 4FW2A 5FWYB 1LJUA 3IPCA 4NQRA 1ZGZA 3OYEA 2B4AA 3D02A 4IRXA 3TWHA 1HMVA 4ZYLA 3A10A 1DTQA 2Q5CA 3IS9A 4ELUA 1U04A 3KSMA 3IRXA 2E4XA 3NNSA 3V6DA 3TAGA 4FJ9A 2YV0X 4MQ3A 2B1JA 1ZH4A 4G0XA 2KFZA 1R0AA 1BI4A 4F4KA 2HQRA 4IMIB 3AV9A 2YHBA 4H4MA 3QEMB 1TJYA 3SUPA 2FSPA 3TO5A 3V9ZA 4MRMA 3A0RB 3NGZA 4DSFA 2IDOA 4RKRA 4YR7A 2XY7A 1EETA 1VSDA 1X9SA 1ABFA 1TKDA 2X6NA 1DTTA 1URPA 2G8UA 2WONA 1JXEA 3LUKA 3N53A 4CHYA 3JPYA 3KYJB 1XC9A 1C0EA 3H75A 5I42A 2ID7A 4CJ5A 4HCBA 4H3KB 1F21A 2QR3A 3HYFA 1DC7A 1FK9A 4E7LA 4YV7A 4KRFA 2LP4Y 1S6PA 4FW1A 3F73A 3O4QA 1CHNA 1P6QA 3I8DA 5CNMA 1NK8A 3U3GA 1USIA 5JNVA 2X6SA 4I2QA 1JL2A 3AO1A 3DRPA 1S6QA 2HHQA 2VUHB 1D1QA 1QQCA 4DQSA 4PWDA 4JRPA 2OZSA 1RBSA 2DY4A 4KVFA 1QSYA 1ZITA 1QKKA 5JNWA 3DLBA 1F4VA 3QESA 1CXUA 2GWRA 3RVPA 1JYFA 2HNDA 1E2BA 3TMYA 4EZ6A 4Z4IA 3EULA 3NBMA 3V9UA 4KHYA 5CHYA 4CGJA 2FBYA 3SV4A 2XRIA 3G1WA 1L3VA 4QICA 5HROA 4Q6BA 1U2QA 1MB3A 3TAFA 4KI6A 2LPMA 5TQ2A 4FJIA 5D2CA 1RT5A 1QS4A 4DSKA 3AO2A 4CFBA 4LZLA 3QK7A 5C5EA 1CXQA 2RKIA 3LALA 3VQ7A 1HQEA 1H9CA 1AB6A 2P9HA 4DS4A 2FBXA 2FMKA 4E7PA 3OJSA 2FEWB 5CYMA 1DCFA 1Z13A 1GOAA 4CJUA 3HJFA 4ML3A 1OXKB 1K68A 1YS6A 3OMXA 4M88A 4XLTA 1QO0D 1DJMA 5JS2A 3HK2A 3RMCA 2F96A 2WJAA 1RXEA 3SPZA 2FMIA 4RK6A 1NJZA 4CGDA 1RTJA 2NT4A 2O4GA 2A1SA 1J5OA 2A9OA 3UKJA 4CEFA 5DTEA 2IPLA 3K5LA 2NZUG 4O44A 1QMPA 3M9WA 3S3MA 2G8VA 1T8EA 1D9FA 2RJNA 4EZ9A 4DTUA 3LUJA 1FQWA 3QEWA 3DYAA 3OYDA 4RY0A 5DCLA 4FK4A 4Y1CA 2XY6A 3AVAA 3QINA 1P6UA 4XIUA 2BGGA 4H8KA 2TMYA 4MR9B 5EWJB 3CQ8A 2Y1IA 4I2PA 1U4BA 1YK1A 1WN7A 1L3TA 2PUDA 4FLWA 4KO0A 3R0JA 3IDOA 4KFCA 4CEOA 5KWSA 1QO0A 4M3XA 4Z9BA 4BACA 1VSEA 2A1RA 1U45A 1JF8A 1JYEA 4D74A 1VSLA 1SKRA 4AHRA 1GUBA 4E89A 3FFXA 4O5AA 4FJ5A 4DF4A 4ID1A 4FM1A 4CF1A 3UK0A 4CE9A 2NZVG 3HSTB 2E4YA 3B2NA 4QOZB 4CJWA 2HMIA 3FFIA 3RVMA 3T38A 3F6CA 3QLUA 1RDCA 4RXUA 2R48A 4RK7A 1PNTA 3EZ5A 4MLCA 5IUKC 1SXIA 1D4ZA 5TPWA 3KLFA 2ITGA 2HHWA 3T95A 3H6HA 3ASMA 1ASVA 4OLAA 1E6MA 1NK4A 3L3VA 4Q7EA 1M5TA 4YFUA 4FVMA 3VQEA 1LV5A 1YS7A 3C3WA 3OJUA 5CY4A 4CEQA 4CEZA 3JTEA 1N6QA 4QYWA 4FJ7A 1NXSA 1SRRA 1D5WA 1DRJA 2PMCA 1Z25A 1PNRA 3AVIA 3M8RA 2YNHA 2I5JA 4DQPA 4MQEA 3KKRA 4ZMSA 3CZCA 1IKXA 1VLZA 3FFTA 5JNSA 2PL1A 3CU5A 4CGHA 1VRVA 2IOCA 1LJLA 3VNAA 1QP4A 1NXOA 4IG3A 1UDRA 1GCAA 2R25B 5EWMB 1YMVA 3NHZA 3OY9A 4C8MA 2FEPA 1BHLA 1A5WA 5B3JC 1J9AA 1HYZA 4YP9A 4WUTA 3OYNA 5HRSA 2HNZA 1SV5A 1B9DA 4Q5VA 4N76A 4ETIA 4TSXA 3MIZA 2IOYA 2FMHA 1YVUA 3CFRA 4EVSA 4CIEA 5FBKA 4LRQA 3RMDA 4TN5A 2RPIA 2JB9A 3I5AA 3ZSVA 2VUIB 4PICA 5JNUA 4F8RA 4L8RB 4FE4A 3DLKA 4AH9A 2HQOA 2GUIA 3O4NA 3IP9A 4KB0A 2IGIA 1M5UA 1JLBA 1K66A 3QO9A 5FWXB 2DTUA 4NCAA 1HEYA 1Z26A 3RR7A 3VQBA 1TVRA 4QYMA 1C1CA 1NK6A 4G0MA 4I7FA 2ZE2A 3AO4A 1MAVA 2X74A 3UIQA 3K57A 4YNQA 2O20A 3A2FA 3AVFA 2HVHA 2HVIA 3TAQA 3ISNC 1RDDA 1ZBFA 2VG7A 1UA1A 3QIOA 1S1XA 4CK2A 1PEAA 2QW1A 4OG2A 4ICLA 4O1IA 3ILHA 4MLDA 5FROA 1FSPA 4DMNA 3LWLA 3FDFA 4KHWA 2Z1JA 3L2RA 1A04A 4OPJA 1XHFA 2OPQA 4AHTA 2A9RA 3SJJA 3TAMA 4CF8A 3PX6A 4DQRA 4AHCA 3V9XA 4RG8A 2KW4A 4RY9A 3S9HA 5HLFA 2LUOA 4O55A 2DRIA 2OZMA 4ZTFA 4FJHA 1KRWA 2PUFA 2XHBA 5J2QA 4MQFB 4J2DA 4CJSA 1L5UA 2KZZA 3L6UA 1TKTA 2A9PA 3SM9A 1BCMA 3ZSZA 4FLYA 1RXIA 3CG7A 3HPHA 1EWKA 3JVIA 2FN8A 2QXYA 3VA0A 2L17A 3M8SA 3OS0A 1S1UA 1JLCA 4AHVA 3NF8A 3U6FA 3HM9A 3EAFA 3L2UA 4G1QA 4ETMA 5BR1A 3DOLA 4XXHA 4OKKA 1PHRA 3MA0A 4GPAA 4RW6A 1XHEA 1JLAA 2OENG 3T6KA 4JRQA 4E3SA 4MS4A 3OYFA 3BDPA 4MRMB 1VSJA 6CHYA 1A5VA 2H3HA 2IPAB 4CJQA 3RH0A 1VSKA 4KK4A 3V4IA 3HVRA 1CEYA 3SYZA 1BIZA 3AVBA 2G8FA 3SPYA 4EVRA 3EGCA 4WXMA 3VQ4A 3G85A 1VPWA 3KLGA 3VN5A 3PO5A 2JVKA 4E7OA 3LMKA 1S1VA 5GOTA 3RMAA 1NK9A 3OS1A 4CESA 3TAEA 3T1AA 1KRXA 1JFTA 3QNNA 3E61A 2KFNA 3LP2A 1I3AA 1JL1A 1M2EA 5EWLA 4CHPA 3ZCMA 3C94A 5SZTA 4DADA 4UHKA 2P1JA 2O4IA 2HJ9A 4BE1A 4NYNA 4RSMA 3RWUA 3JPWA 3CZ5A 4K8ZA 4EYOA 3OYKA 3HXMA 1WETA 3DGEC 1QQAA 2FQWA 4KQ9A 4AILC 3KG2A 5IULC 2PUCA 4RXTA 4MS3A 4NV3A 1YK0A 4NICA 3EDCA 5CYQA 3QETA 3V9WA 3NH2A 1RT4A 1NKCA 4BDPA 2QZJA 4FK2A 5TPZD 2D0AA 1B00A 3DI6A 1LBIA 3H5VA 2CHEA 1J53A 1FKPA 3QLUC 4WE1A 4KI4A 4FE7A 4M42A 1ISSA 3OM1A 5IBQA 1QSSA 4OPKA 1GCGA 1U0SY 5ED4A 4RZSA 4JB0A 1EWVA 1NXVA 3P1GA 3GA5A 4K8XA 5KQPA 1NOYA 1EX4A 3KD1E 1USGA 1Z2DA 4LE0A 5B3JA 4BDYA 4WT7A 1VSMA 3PX4A 3LPUA 3L49A 4MR7A 1DP4A 3Q41A 4M41A 3H5WA 3RVKA 3QNOA 3LANA 4CECA 3KJVA 5TPZA 1JWLA 1JHZA 4MGEA 4KHQA 1HJRA 1K6YA 1C1BA 2HHVA 2RN2A 2CHFA 1NXXA 3DRRA 4KHNA 1S1TA 4CJKA 4RW8A 2R7YA 3AVKA 1D9DA 1RBRA 4MS1A 3ZSYA 3TI0A 4KHSA 3C97A 4DFPA 3K5OA 2VWJA 2JVIA 4GMJB 1D8YA 3NH1A 4FLTA 3C6QA 4RW4A 1HPZA 3HP9A 3V9SA 2YHAA 2OA8A 4HCCA 1ASUA 3O2QB 4PEVA 2OQRA 5I4CA 4ELTA 4ZMRA 3NF9A 5HQJA 2AYZA 4FJ8A 3L2WA 3KLNA 3NE6A 3MXJA 3AO3A 3LUDA 4HNRA 3CLKA 4Q0BA 3VQDA 4YGXB 2P5GA 4B9NA 4IILA 4M3ZA 3VQ6A 4CCHA 1YTAA 1BDJA 3T19A 4CERA 1MVOA 2WB4A 1NK5A 2I6FA 4CHQA 1OXBB 3Q7TA 1SL2A 1QTMA 2VYCA 2IDMA 4CJLA 2ZD1A 4FZYA 2IC3A 4BE2A 1HQUA 3MXIA 3NFAA 2BDPA 3TARA 4B08A 3KD5E 1B9FA 3OYCA 1ZESA 4EY3A 1DRKA 2XY5A 3EQ2A 4G0QA 1VSFA 3KK1A 3HDVA 4JOQA 5KQMA 4N5SA 4W5OA 1NK7A 5C42A 4F11A 1NOZA 4Z9AA 2IKSA 1EWTA 4MQEB 4LDAA 3OYIA 2OPPA 4CIGA 1RZRA 1ZVVA 1WAFA 3L3UA 4IMJB 3THVA 3Q7SA 4F2RA 4B3OA 2PAFA 2E4UA 2FBVA 3OYLA 4IFVA 4LY7A 4HUFA 4CJFA 1O1WA 3ZT3A 4IBNA 3LUHA 1BAPA 3DLHA 5KRSA 4EUKA 1S9EA 4FZXC 1NATA 1APBA 1E6LA 4CF9A 4LH4A 3M6MD 3HS3A 2QU7A 1QSLA 4E7KA 3DM2A 3WNEA 5C25A 4D6XA 5CZ2A 3QEPA 5IEJA 4FLZA 3EY1A 4HYEA 1LWEA 3LAKA 3HP6A 1ZGGA 4HNQA 2FXIA 3HEBA 1C6VA 3SAJA 3SQ0A 3K58A 3LAMA 3KYIB 2FEKA 4XAQA 4NYFA 5IEBA 2HHUA 1TV6A 3SZ2A 4CGFA 2E4LA 4H4OA 2HHSA 4YWHA 3GYBA 4W5NA 2XO7A 3CM6A 3L2VA 3D8UA 3FFWA 1ZBHA 1JFVA 3QEIA 3KLOA 1LAWA 1IO2A 3D0PA 3K5NA 1BQMA 3AA3A 4CJEA 1NJXA 4OVLA 3QEMA 4M3WA 4B8AB 3H1GA 3AA4A 1QHTA 5D3GA 3NAEA 2JGUA 2XDYA 3B6OA 4FCYA 4DSEA 3I09A 4FJMA 1CZ9A 3A3KA 4YRZA 4EYQA 1JLFA 1VSHA 1TKXA 4LDZA 3MEEA 3HUTA 4RK0A 1YT3A 5KC8A 1IG9A 3RVSA 1C0TA 3G0ZA 3CM5A 3LOPA 3ITHA 4C8KA 3KK2A 4IGAA 3UUGA 1C0MA 2GX6A 4WXEA 1IKYA 2NUBA 5J2MA 3SV3A 3VNBA 2QVGA 2D5RA 4KPYA 5IC5A 4E7HA 2FC0A 1RPJA 5DMRA 4Z4HA 1ZHHA 1UOCA 5JS1A 1JLQA 4PUOA 4R5PA 1U8TA 4HVJA 3IP6A 4AHSA 2F8SA 3CTPA 1J56A 1NXWA 3HVTA 1SL0A 4FXDA 1Z15A 5K14A 4Z0UA 3HPGA 1TGOA 2HPHA 4RV5A 1C0UA 3JVDA 1HRHA 2IPMA 4YS6A 1FXXA 4DFMA 3MQ4A 5CNKA 5DKFA 2D0CA 2OPSA 3NH0A 3LP0A 1DZ3A 3KJXA 5T3YA 1ZAYA 2EHGA 2PUEA 3K2PA 1WNSA 1MU2A 3SQ2A 1KRPA 1JX6A 4MR8B 5F64A 2WRZA 5KGXA 3KKEA 3SQ4A 5FDLA 1TL3A 1GLGA 1ZBLA 1ZYQA 1RT1A 2DFHA 3O1HB 5KTQA 2VK2A 4IFYA 3NHMA 1WLJA 3GBVA 1T34A 3ZT0A 3TR8A 3JY6A 4B09A 3F7NA 1EFAA 4CJ4A 4OLBA 2DFEA 4BDZA 4RDCA 3OLZA 3HCWA 4CEEA 3HO1A 1Z12A 2FKAA 1MB0A 2MSKA 1L5ZA 3ZT2A 2CD7A 2PUGA 1I39A 4O1HA 1QP7A 5CZ1A 1D1PA 2Z1GA 3LFTA 2F8TA 4J2EA 4J2AA 3IP7A 3URMA 4LH5A 4LSLA 2GBPA 4EGSA 4RWEA 5BRAA 2DFFA 3N0RA 1QE1A 1RCHA 1F51E 4OKEA 3NHGA 5KQLA 3N8IA 1CZBA 3OO1A 4CBVA 2JBAA 3CRNA 3HSYA 1SD5A 4ZPJA 4F12A 1YTUA 3QLTA 3ZSWA 3CFPA 3NCIA 4F2SA 1EAYA 5EWJA 2B5JA 3EYZA 1ISRA 3O21A 1JLKA 3LUCA 3QIPA 1U47A 3PO4A 1TAQA 1XWLA 3D45A 2FVYA 4B9MA 4RS3A 3LDSA 4KB1A 5IUNC 3H5OA 2FW0A 1JFSA 1BDHA 3MAQA 1XWWA 2JCGA 3GT7A 4FYDA 2YNGA 4B9LA 3NBPA 4KTZA 4DTJA 4IG0A 4RKQA 2MSWA 2X78A 3JS5A 3SCXA 2QV0A 4CHOA 3H1FA 4DQQA 4CFDA 4G97A 5HRRA 2MSLA 4CGGA 1KSPA 4EP4A 2ETJA 1TMYA 4L85A 3OVNA 4CFCA 2J48A 8ABPA 3F9KA 1VRUA 4DTSA 4CJPA 2HQBA 2RF2A 1TKZA 3P5JA 1A2OA 2IAJA 2GKGA 3BREA 4KV7A 1ASWA 1CLQA 1LK0A 3V1RA 1KTQA 4EP5A 3V1QA 1C1AA 1QQBA 4DU4A 4BWMA 1YIOA 1T05A 5DGCA 3HUUA 4JASB 1HYVA 3TANA 3A0UA 4ZHRA 1BI4B 1USKA 4DTXA 1EXQA 4DTOA 3S99A 1NKEA
chains in the Genus database with same CATH superfamily
4XD7A 2ZUFA 2PKXA 4Q7JB 4Z8YA 1MW8X 3P0IA 2VJBA 5ALXA 3ZVLA 5B8HA 4V0LA 3DOOA 3OE5A 4BMDA 5KOJB 4MVJI 4A9AA 2W0SA 4JD2A 3OHMA 1E20A 4EMBA 4HFRA 4OKJA 1MIHA 4PVCA 1N6KA 4D0NA 2OSVA 1S22A 4B48A 4BTLA 3SAHA 3NDKA 2MYPA 1VK0A 1UBEA 2Q3CA 2YINC 4S24A 4YRTA 3K0FA 1O08A 3Q6NA 4Q3AA 5J9FA 4L9WA 3HI4A 4JJIA 1MO6A 1UBCA 2PY6A 3CVOA 3A1DA 4EJSC 1E7SA 2GZRA 2CXOA 1W30A 1XHXA 3QVOA 3GGCA 2EFJA 1ZJ4A 1U28C 1GCOA 4ZJPA 2L19A 1ULZA 5F1YA 3UMRA 2ALJA 4MJ7A 2IHZA 2BMWA 5H3CA 3C24A 4ESVA 2G0TA 2SCUA 3TCNA 3DFMA 3OZCA 3VO9A 5MGNA 3VVCA 3H18A 1SD1A 4CHNA 1USWA 4Y1RA 1QYRA 3AUAA 1XVAA 3RPEA 4QVGA 1KLMA 3K0KA 1ZUWA 4N0PA 1B26A 1V11B 4EZEA 3CZQA 1U7HA 4A61A 3R5XA 4M3RA 1FFHA 3QV2A 5E41A 3ZWBA 1U2GA 4WNCA 2DSNA 3BJEA 1AHHA 2V5UA 2LSNA 5SYNA 4BAGA 2J3MA 5DPMA 4M3TA 3C3EA 3LBIA 5JAUA 2XIQA 4BMCA 2JFFA 5HFAA 3ZE6A 5JADA 4UOZA 1GV0A 5AW9A 1I1NA 2VQEK 1OGJA 4DA8A 1D2AA 3T3MB 1QQMA 1HZJA 4C1NI 2A9KA 4QBFA 4GQBA 1RWXA 2ZUVA 1XLUA 4GQAA 3P26A 3HBAA 1L5RA 4QG7A 2PZSA 4AX8A 4K6MA 5LBTA 2J3IA 5AJ3K 2Q1WA 1AQJA 4KQKA 1N8SA 4B7UA 2EX4A 3HL8A 2Q07A 1VBNA 3MELA 3P0JA 3CUKA 1C4KA 4LOIA 3J81k 4HWGA 2XMQA 4CIYA 1V8OA 3P9ZA 3IBFA 3O4GA 2QQGA 1P2TA 2B6NA 3FDJA 1ZQ9A 1T2NA 4B6OA 3II6X 4TLEA 3STXA 6YASA 4NHEA 5HOOA 4N40A 1SUCA 1JPJA 4BC1A 3N8KA 4B9UA 4G1EB 2FI1A 3SZGA 1DG3A 5FOWA 3PI7A 3TM5A 1HFKA 5J40A 2BEVA 5BSVA 3ZX0A 3IDFA 3RF6A 1NVVR 2X23A 2VNAA 1TJNA 1UM9B 1Y63A 4HDRA 1THMA 1RZUA 3QBVA 3GZ4A 3PHCA 3F7MA 1S1MA 1XDWA 1RPAA 4D4KA 1H23A 3L0YA 3UANA 2PUBA 4KH6A 6GPBA 5FULA 5EKXA 1YTLA 2B98A 4ND7A 5B4TA 9LDBA 1Z74A 1RILA 2ZREA 4O6VA 4IKFA 5G40A 1E7YA 4CODB 3QM1A 4N47A 3CVVA 1GY8A 1JKXA 2IQ5A 4H7IA 4NSNA 2O8DA 4GP7A 5EIHA 2ROQA 2R7AA 4QTZA 3ANXA 4QPDA 4BC0A 4YNBA 1VQMN 1E9FA 1TK3A 2IDKA 2P8JA 4YJFA 4JKIA 3GQBB 3DA8A 3R7NA 4HUEA 1ZOSA 4YR9A 2NPIA 1JQDA 5GIOE 1YB1A 5CK5A 2FEMA 4NOJA 3AR6A 4RLSA 1OZ0A 4EYSA 1MEEA 4IH1A 1JDPA 2ILVA 1NFFA 4D9HA 1CZHA 3TZBA 4RJIA 1RQLA 3ZSOA 3C70A 4PNHA 5I8ZA 1N8RO 4F9OA 3G2MA 2VNSA 4BLPA 5K2OA 2QE6A 2V7BA 4V3CA 4XJVA 5LQDA 2OM2A 3O4FA 3IQWA 3R40A 3TM4A 1WBDA 2FUG1 4QQRA 1L4YA 1FJHA 3CW2A 1NT4A 1TCCA 4NBUA 3KQVA 1WP9A 3DOJA 5JSKA 1S8FA 3TGPA 4B4UA 3IQHX 1ACMA 4QULA 3H8WA 3JVUA 4EK9A 3CH7A 1NGIA 3SQOA 3PGLA 4BR9A 3R7AA 3CNNA 1C1HA 2AJDA 1A96A 2C4VA 1T7PA 3W77A 4MWEA 2DF8A 3GJ8A 1JN0A 2G63A 3D7NA 3OX3A 2UUBK 5BV0A 3U80A 4AMGA 3SD7A 2OZPA 3JQDA 3NOQA 4JBNA 4N5IX 4XA8A 4BNMA 2B1RA 3LD9A 4LDQA 1P7YA 2FZKA 2V6BA 2PFUA 3E66A 2Q3LA 4YJ3F 4CLOB 3HJCA 1MJGA 4WFJA 4TS1A 4PBTA 3PDUA 3A4TA 1VC2A 2B4RO 3VF6A 3KTAA 4O0LA 5JROA 3T5PA 1R6TA 3X2EA 1JB1A 2AI3A 4S1OA 4EFKA 3DLPX 3ZETA 3PXGA 2MDTA 1TK5A 1GUAA 5AI8A 4FUQA 4UJ5A 4HX2A 4TWBA 5I4BA 1K3FA 1JAIA 3EN9A 4NBTA 5DISB 1GLAG 2WJYA 2X0NA 5CW2A 1PEYA 1UPUA 3IDHA 3O1IC 5A5FA 2VHTA 3H2YA 1P1FA 4EFNA 2W42A 1K88A 4AROA 2X0IA 3AR8A 4GSLA 5KUTA 2G4CA 4Q4JB 2VRCA 1RGIA 4M54A 1RP7A 3B8EA 1QC5A 3GLQA 5A9RA 3FKQA 2NMVA 3QKSA 4ZEWA 4O8UA 2ZUUA 5H82A 4U67L 4YLEA 4CETA 3UAWA 3ZIAD 4WBNF 5AK5A 4GOXA 3CRQA 4DCGA 1GVNB 4XFKA 3KLHA 3H9BA 3VQAA 5BRHA 2O48X 2Q99A 3BCHA 2BRUA 1E9DA 4F3OA 4L8LA 1MGPA 3EQ8A 4AZWA 1K97A 1GSHA 3EXHA 3NTUA 4D46A 2ZEJA 1KYQA 1M1YE 4DDMA 1QR2A 1AF7A 4TPKA 4FOSA 3K4PA 1MV5A 4FBMA 2CDRA 1RTDA 3W3DA 4N0QA 2R5NA 4OYLA 4DTRA 1B3BA 3U3MA 3UT5B 5EY4A 1R9MA 2JCXA 5IDQA 1NNEA 2SICE 1MG5A 3IAM1 3C8UA 4OSOA 4U7TB 5DNAA 2D8AA 2B4AA 1BXKA 4OI4A 1DKRA 4RABA 3RTDA 8LDHA 1Y7IA 2C42A 5IT0A 1C4XA 1BI4A 3BK1A 3S0JA 2ZE8A 2W00A 1AS2A 2C3OA 4M86A 4UAVA 1CUJA 3D6JA 3OEWA 1F4PA 1R1DA 5B1YA 1Z37A 1VSDA 3D7LA 1K86A 2XNDA 4BMSA 1CVRA 2RK3A 5TGDA 4M9CA 3IEXA 5E1MA 4X6YA 1NP3A 3V2IA 2JEOA 4H3KB 5C15A 1NNUA 1QIFA 4KRFA 5CBPA 4H3VA 4OO1J 1AM4D 4FW1A 4DLZA 4RQAA 1WABA 3ZY5A 3U3GA 1LLFA 2X6SA 1GTL1 4KLNA 4R7TA 2IP4A 1ULSA 4XUEA 4AJLA 3OCVA 5E0KB 1KH1A 3D0QA 4Q4HA 2Z9DA 1AURA 5CP8A 5JNWA 1C30B 2WP0A 2GWRA 3RVPA 1FJGK 1M0SA 1DT5A 1JYFA 1X86B 2JASA 3FLMA 1WOQA 4QARA 3IUEA 2QTNA 1IJBA 4BVBA 3M5RA 2QIPA 3Q2KA 1Z5OA 3LC1O 1V8FA 3KOXA 4DCPA 1R6VA 2KBEA 3BZKA 2GR9A 4BWYA 3MGKA 1ADYA 4DS4A 1NVEA 2V52B 3FNIA 3GROA 3DMHA 1PGQA 1QH8A 1P77A 4B1UB 1T6BY 2ZSUA 1PJAA 1I80A 4ZZ2A 1TA4A 2VDNB 5HDQA 4IDQA 1RTJA 1J00A 2A1SA 4WQMA 3R7SA 4IIJB 1DAHA 3M9WA 3TCXB 1LPPA 1T8EA 2IZ1A 1D9FA 4EZ9A 2YOGA 3IAEA 3E3NA 3JD0A 1P6UA 1J09A 2H07A 3DV0B 1QFZA 2B9EA 3NBUA 5DCYA 2H11A 3Q3EA 2BR4A 3NWOA 2AX3A 2CUTA 4Z9BA 1JYEA 5SYAA 5CVTA 2CL6X 5CT8A 1I3MA 3VSAA 2GUGA 3BF7A 4HBGA 4QVKA 3S28A 4FOEA 3AGQA 3MUNA 3E5MA 1N4DA 3RK0A 1ATNA 2IWRA 4RXUA 3NM4A 3U7FB 2XRZA 3LZCA 3WLJA 3HB5X 1XD8A 2ZJ7A 4YQYA 4JR2A 4ZFNA 2QMOA 4BJHB 3ESDA 1AKMA 5F9HA 3Q3HA 4IIVA 2XNCA 4CEQA 4DR4K 3CEHA 1V43A 3JTEA 3HN7A 4Y9RA 1IM8A 4HAIA 5HQTA 2XNJA 1OYVA 5K3AA 2NO5A 5JVDB 2QBYA 1QWSA 4DMUB 4RPJA 2XT0A 3NBFA 4EYEA 3PUYA 3C3DA 3FFTA 4E4TA 1XELA 3AG5A 3GNQA 1QP4A 1G2IA 2B36A 3FWHA 3VR4H 1Y9ZA 5ELZA 3LDHA 5HF9A 2IV3A 4IX9A 3LT0A 1NWHA 5HRSA 3BAFA 4FI3C 3SLCA 3FDXA 2XV1A 1EFVA 3ILXA 2WUEA 4J0KA 2IIQA 1E2EA 1LK5A 3H5AA 2JFOA 1KIAA 3GMDA 4RTJA 2PD6A 2C97A 1IBKK 4QYIB 3ZV7A 2VUIB 1IQUA 5KTYA 1DZIA 4M4SA 3FYDA 3IP9A 2IGIA 2YZGA 3E9PA 1O97D 1UFRA 4WACA 2KI5A 1J9ZA 1G5FA 3RR7A 4JBYA 1VCNA 2I4OA 4FC6A 1N7IA 3CRMA 3A8YA 2WT9A 3C8HA 2BIFA 1XXHB 5BNFA 4UBJA 4XW2A 1G9XA 4MLHA 5JJLA 1D9ZA 4ENRA 3JZFA 5FROA 2VKQA 1FSPA 3CTMA 4RIGA 4X8OA 2YJ3A 3DYBA 3PXCX 1Y5LA 4C4ZA 1KETA 3M7IA 2AXQA 2GCGA 2GTPA 3VJLA 4H1UA 4IVRA 4KSYA 4BEBA 4DQRA 3UVEA 2WAMA 4LSGA 5BPHA 3TU5A 3LT2A 5AQ1A 5JFOA 4YRJA 5KKAA 3R76A 1KRWA 4BV9A 4J2DA 1HX7A 3E9LA 3FTFA 2JGDB 4F71A 3RYIA 3HCAA 1KRHA 3DOLA 4EHIA 3DZJA 3RYCB 3PLAE 5THKA 4GKBA 4Y2QA 4I66A 4G01B 6CHYA 3RH0A 1Q15A 3INRA 3VQ4A 4UAJA 2OXEA 5EOVA 4E7OA 1WMAA 2R66A 3QXCA 3HCCA 1Z4PX 1JFTA 1QGDA 5JYCA 1D7OA 5SZTA 4GPD1 4ALJA 4TV9B 3RWUA 2R6HA 5BWLA 5GGYA 3A6JA 4X94A 5FWAA 2W43A 2XGMA 4IGIA 1A97A 2A1IA 2CBGA 1MAUA 3PUKA 4R41A 1KZYC 1YZ3A 4X8MA 2H9YA 1U9ZA 3OOHA 2AZMA 2BLNA 1V41E 2VQEB 1FOEB 3BF1A 2G80A 4P38A 3GRFA 3P9IA 3B9RA 5CLFA 1CP2A 5I5GA 4OA5A 1QSSA 1GCGA 1EB9A 3L7DA 4RD0A 3VZSA 2DKFA 2W6PA 3GFGA 3C1AA 4ZIRA 1H9AA 1O9HA 1Z0UA 1N6IA 3ZDRA 1I5RA 4RMJA 1P91A 1OV6A 3GRPA 1BE1A 2P68A 5EP4A 4MWBA 1X7WA 3SZ3A 4Q3KA 3WNBA 2QE7A 5AWFC 5CVJA 2I67A 1VL2A 1YQ9A 1LGYA 1Q0TA 1OW3B 1KY4A 3C6QA 5CYFA 3V8QA 2BFAA 4HUJA 3KQWA 1ZXXA 5LQNA 2V9CA 4BRPA 1QIKA 3CLSD 3ICPA 5KOJA 3ZKWA 3KL2A 3CBQA 4C78A 1GPNA 2DY0A 1L4NA 3MZ0A 4Q3OA 3TNYA 1M74A 4QOFA 3ZIUA 3CLKA 1T3LA 3HOTA 2PX8A 3ZCPA 3L0PA 3LQ4A 2JFWA 3PXUA 5LQMA 1OH5A 2FNAA 3I04A 2YTZA 4CHQA 1OXBB 2H8KA 4AMUA 4J16C 1AGNA 4MRSA 2G4VA 1LW7A 1HQUA 4C21A 2BDPA 1I2ZA 2CJYA 5EMNA 2VJMB 1WS6A 5MF6A 4FP9A 2RGEA 4M7PA 2CLKB 5I9BA 4L8GA 4JLOA 2AW5A 5IVKA 4Z2YA 2J5QA 1QB8A 2WZDA 2DQYA 3N2YA 1NGHA 3MCAB 2OPPA 4PFKA 4KQFA 2ZJPL 4QNNA 1NGEA 2FBVA 1LBEA 1TYDE 4C6SA 4E2YA 5JSHA 3ROGA 1ZOOA 3QXJA 4WXRA 2Q31A 2B83A 2QM1A 1IEQA 1V11A 3DE1X 3GPLA 3SQ0A 3SXJA 1P7PA 1ZH8A 3ZXSA 1QDUA 5F5LA 1NMYA 4JU8A 5AQGA 1NPYA 2FK7A 4BB9A 3D0PA 3HY4A 1V8PA 2RKWA 4MAFA 3T1YK 2GILA 4M3WA 3IDSA 2FOIA 1QGZA 2RKOA 1VHQA 2VPYA 3OEHD 2P9EA 2ZE6A 1HE5A 1XROA 3A3KA 1Q57A 4YRZA 3ZQ4A 1NW9B 3SQXA 4J1TA 5GAEP 4NBWA 4GL2A 3IR7A 4RA9B 3HFGA 4M53A 1J90A 4C8KA 2V59A 2ZYWX 1P7VA 4J9VA 3WGKA 1ODTC 1NA5A 4R98A 2NUBA 2VOEA 3KHUA 5BXQC 1C0LA 3M5PA 4E15A 3IE2A 1LA2A 2AN3A 3ZWKA 4R5PA 2NSDA 1L7BA 1U8TA 1DX9A 1GZ4A 2QG6A 4BRFA 2HAEA 3FPBA 2HIMA 1QX3A 1NQOA 4EAQA 2PD3A 3M6LA 4Z0UA 3CKLA 1VIMA 3W34A 2O3SA 4GGPA 3WGQA 4YS6A 1FXXA 3QTLA 1SCKA 1E61A 1JZQA 1JT9A 4MV0A 5EI5A 1VL1A 1DFIA 2EHGA 1WXEA 3W5DA 3SHWA 2VJPA 1UPXA 1MU2A 4JLUA 2ISQA 1B23P 2OB1A 3MJEA 4U0JA 4N5DA 1MZVA 1XRMA 1TL3A 1M7HA 1YRLA 2BGWA 4P2GA 5F2RA 4TXNA 1WB6A 3ETHA 1UM9A 4O4LB 5LNK1 1SXJA 2W71A 2WM9B 3QBWA 4CEEA 3B13B 4F2PA 1F2UB 4TKVA 1EA5A 3G8DA 1MOPA 2ZIEA 3IMCA 1QP7A 3BPSA 2EQ5A 5IXYA 1PJRA 2O2SA 1J23A 3A36A 2BAGA 3AJEA 4YT2A 2FVXA 3I05A 3IA7A 4L4XA 3OO1A 4FCWA 4BX3A 2V65A 4E1VA 2VP2A 1H5NA 3ZSWA 4N7RA 4Q1EA 4FDTA 4QGFA 4FFPA 1K4MA 3OIVA 1XL0A 3JD4A 1TOAA 2V5AA 1DHTA 2C5LA 4LMPA 1KI9A 3H5OA 4WIAA 1DJPA 2WUFA 2C29D 3MCTA 4BRKA 1FE8A 4MB0A 1AX9A 2QGNA 3ZYZA 4CEHB 1H2YA 3C8DA 2X78A 3GQBA 1ZI8A 4XYLA 3WGVA 4DQQA 3RT7A 5KWIA 1Q2UA 2ZUDA 2CV1A 2GKSA 1GZVA 2WG2A 3OM9A 4H1TA 2DQ4A 2ETJA 3HYSA 4OQNA 4AU1A 3ZVRA 3F8SA 4B85A 4UAUA 1NHWA 3UPUA 1T43A 1GQ2A 2FUEA 1Y9EA 4GVLA 1CLQA 1JFFB 1YIOA 4CKWA 2NIPA 2BOVA 4WL0A 4YUWA 3KQTA 5B1IA 1QVWA 1FMCA 3IAYA 2EGGA 4O0JA 5HHTA 1RM5A 5JZBA 3EZGA 2NQ8A 3TABA 2ZB7A 3ELYA 1K8YB 2PEZA 3RSHA 2JGAA 2H7YA 3EAQA 1IVSA 1FU4A 1PGJA 3HT3A 1OB5A 4WBNB 4JELA 3ZSRA 6Q21A 4CCWA 4TSFA 1YI1A 3O3OB 3N0WA 4LZZA 1A2QA 2HSEA 4QPJC 1F0PA 5JAQA 3OBIA 5BUCA 2O6HA 4JDUA 4L74A 4CG3A 1SUQA 1G8JA 4JP8A 2FRXA 5BORA 1NKVA 4CM8B 2CHVA 3ZSQA 1P80A 3L1IA 2AFHB 1AV6A 4WN9A 5KDLA 4EVQA 2O3TA 5DNVA 1A0OA 4PZYA 5DBOA 1UPAA 1UAXA 3GLTA 4I9QA 3M34A 3SQWA 1V5WA 3ZT4A 4DJAA 5AFUA 4UM9D 3L2QA 1T9GS 3QFSA 1CRPA 4CLOA 1XUPO 4RCHA 1DI0A 4JK8A 3VX4A 4BX8A 3T1TA 3C1UA 1ZNXA 2OAGA 2FZLA 4CIFA 3S44A 1RSZA 4S1PA 4I9LA 1A50B 4EMTA 2W6ID 2Q0RA 4CTJA 3WRYC 1QU3A 4H5WA 3MK6A 1DV2A 3PJDA 1D5AA 1GTRA 3T8YA 4Q03A 2JDIA 2IBMA 4NJEB 4EL0A 3AVUA 2O14A 2GCOB 1JIUA 3SSMA 4R1NA 2BN4A 1MG0A 4DC0A 1VHLA 3U3RA 4I5FA 4DLVA 1M6VA 4EP1A 4Q4JA 2A5LA 3ETJA 1KHHA 3BMXA 3F6PA 5DM7L 1CJSA 3NBYC 5IW8A 4EB8A 2Z5VA 4GIBA 2AT1A 4ILKA 4DCNA 1SZCA 3QBEA 4PYRA 3GZNB 1RYBA 1VBFA 2JIDA 3Q3CA 4PXAA 1QHXA 2WV7A 4CJTA 3F6EX 4DHYA 5F1PA 2FPUA 1ZMOA 4GS5A 1BCOA 3MMSA 3EBOA 4UHHA 2MYUA 2SKDA 4Y1EA 3ZXUB 2B4JA 3EDOA 3F0TA 4NCJA 1TO2E 4NCBA 2BGTA 3ANYB 1P62B 5AQMA 1IJJA 5CCEA 1ZINA 4FK0A 4WWHA 5GM1A 1WTAA 3SPXA 3RFFA 4TTSA 2XZDA 2WUVA 2WOMA 2FZWA 4XARA 1K3TA 1NM5A 2R8YA 1R9GA 3IELA 3EVEA 4ZVTA 2B99A 1WR8A 2WM3A 3QEXA 4IDPA 4LMRA 2G72A 2BD0A 2O2ZA 5JAMA 4DU3A 5LJIA 4IICA 2OBLA 1QF9A 2EJUA 1CRZA 1RYEA 4N12A 3A4IA 1Q83A 3PFGA 4TM8A 2QRHA 1NF3A 1F5NA 4NY1A 3CLTD 3I4FA 2A3ZA 2O4UX 3ZDCA 4CMCA 3HXQA 4H59A 2XQGA 3OJOA 3VNUA 4JQOA 4M36A 4BIIA 2NSLA 1OC2A 1E96A 1CRLA 1DLIA 1B0PA 5AH0A 3IODA 1M0TA 2ZIWB 3ULDA 2W6CX 3QLVA 3K6RA 5IHPA 1IK4A 3RG8A 3FR0A 1VA5A 2M1XA 4ZZ3A 5IT9O 5ENDA 2RHGB 2JI9A 3KZXA 3IOCA 2KX7A 3LLMA 2FPGB 4KCGA 1LCUA 1ESZA 1N0VC 1ZIXA 5L7WA 4V02A 4H77A 4O2BA 3K09A 3OCZA 3U44B 3G0GA 4HWTA 2WJJA 5IJ9B 1OTHA 1DELA 4UQGA 3IMEA 4C2UA 2JATA 4FJGA 4JXZA 4KFTA 2DCMA 3T4XA 4TVSA 2WHEA 4JT2A 3L4IA 2FGJA 1WDKA 4BRNA 3MJDA 1PT8A 1T2DA 4OATA 4FLFA 4D02A 4UASA 1QKJA 2B8EA 1UPCA 1U7DA 3B7WA 2R96A 1Z18A 4JYAK 5FF9A 5DCUA 1QZZA 3G5UA 3B8AX 4BVKA 4QWWA 1KE1A 2QL5A 3QMVA 3TI9A 3WYGA 1SRQA 3K94A 3RRXA 2Q4EA 2IIBA 3CA8A 5A4KA 4JC5A 2XRYA 4YRBA 1MO2A 4G5QA 1ZBUA 5EUMA 2XTAA 3RV4A 2GCEA 5KGWA 4I19A 3TQTA 3SI6A 3RS9A 3MFYA 3N28A 1G38A 2XX3A 3PRYA 5L3ZA 3DV0A 4OSPA 5TQ0B 2VDLB 5H7XA 2NV2B 4DS5A 4N9QA 1QQTA 3T9AA 3RTAA 4RUKA 3F47A 2BTFA 1QH0A 1LWNA 4M3NA 4X6UA 4UQOA 5K03A 4P7GA 4JKFA 2QTLA 4P81A 4DKXA 1XUOA 3BWBA 3VH3A 1VDZA 2QW8A 2GF0A 4ETNA 1SCBA 5T4FA 4HNVA 4RFSB 4FM0A 4NCGA 1JNXX 3SHQA 4MR7B 1YJAA 2QLBA 3MILA 4RTNA 3FRIA 4ZK2A 2MYNA 1IJEA 3OETA 2ECKA 2OV2A 4FR5A 2C78A 4FWRA 4J2OA 4EW2A 4HAYA 3WNVA 4HTAA 4JEIA 4FWSA 1J6ZA 2ZT5A 1ZXLA 3UA4A 1ZBDA 1VMEA 2O8EA 2HMSA 1PJ4A 3SAFA 3R7LA 2OSBA 1P17A 4RADA 4POAA 3K6SB 3PE6A 4QJ5A 1N1GA 3CN7A 4BWJA 5BR8B 4OO3A 4QYIA 3BWXA 3CZMA 1C50A 1YHZA 2D54A 4MFBA 1MB9A 5BRFA 2WOJA 4GW3A 1LAVA 1Y4UA 5EKDA 2EKZA 2ODQA 4YA6A 3W05A 3S2IA 3FHJA 4NU8X 5AKLA 1PWXA 3SYRA 3VH2A 3D3JA 5FHRA 3RLIA 2V0NA 2X6TA 3MG9A 2H5IA 2GYWA 1E94E 4L4RA 1XXHA 3DVAB 5ESDA 5HMMA 1XFDA 2A58A 2C3MA 4LJ8A 3AHIA 2QZ4A 1YI2N 5BR7A 1UOOA 5T7BA 3KETA 3TBKA 4H9GA 4FDVA 1TK8A 2Q5EA 3FVRA 3ZXXA 4G5FA 2H4YA 3B70A 1NKBA 1ECGA 2HO4A 3SJAA 4LQ4A 3AC0A 4QGHA 4UNQA 4GHWA 2EJVA 3SYTA 4AIRA 4BN5A 1PS0A 5FI5A 5KNLA 2DVMA 4TWIA 4ISGA 3TMKA 4DXDA 3T9BA 4IBOA 3IS9A 3WJ1A 4YK7A 4FJ9A 3FSGD 2Q8QA 1NJ5A 1KKUA 2QORA 1Z75A 3MSCA 1HJOA 3HACA 2PX3A 3RYCA 1NC1A 4HUQB 1N25A 4JB8A 4Y2SA 4JP2A 1LB1B 3V9ZA 2ZI3A 1XTRA 4IIGA 3VO8A 4C4YA 4FKMA 3ZHXA 3KLPX 4Z2AA 2J9FB 3EZ6A 3JPYA 3SJUA 4NCKA 3ZU6A 4CMKA 3OU7A 1YS1X 1PFWA 3WHLA 4E7LA 2QL9A 3HNOA 1Z2OX 4ARIA 3M6XA 3O4QA 1RRMA 4IJ6A 1LOTB 3ZU2A 5BWCA 3PT5A 2Z9BA 4IJMA 3W2TA 3AHDA 4ASUD 4NRDA 2ARKA 2M2IA 4RIFA 2AJBA 2CE2X 4KHPK 1ZITA 4O2LA 4HXGA 1US8B 3G2OA 3OE4A 5K45A 3VGPA 5E1DA 4EPVA 2WVAA 4RESA 3G7NA 3D6MA 4LDNA 4KE8A 5KTMA 1MIOB 4KR0A 3PUVA 3JQPA 1DO8A 4CFBA 5D85A 2WUDA 1IVNA 5JICA 2YYYA 5BW4A 3TPFA 2P9KB 2VGNA 2LCQA 5ALKA 3GT0A 2HF4A 2I5PO 4XLTA 1MEOA 4BTVA 1RW4A 5JT1A 3K70D 5DX0A 4FFBA 4L5YA 1DPFA 4CLDA 4B3MK 2F3PA 2NT4A 4AY5A 5DTEA 1EFTA 3BGOS 3OQIB 2D3TA 1SOMA 3DAPA 1DWQA 1Z0DA 3GW8A 1IWOA 3GZTB 2C4UA 2IYOA 1U7PA 5CXSA 3BCUA 5DV9A 1WKCA 2IYPA 1W97L 1VCMA 2XBUA 1V3UA 3JWGA 4DLRA 1QK5A 2FXUA 1ECPA 1TZKA 5EUCA 1YK1A 3PVSA 4IIJF 6NULA 3PRKE 2I1VB 1IV0A 3VSCA 1RM3A 1YHNA 1AO0A 4K6GA 1SEVA 3WGOA 3T94A 4MVJM 1SKRA 4ARSA 3SDZA 1P72A 2GDZA 1Q1NA 4Z5XA 3OVMA 1W76A 3F96A 3RVMA 4DMMA 3IALA 4RF2A 1ADCA 3BFKA 2FWAA 3NOOA 5ICFA 4I46A 4OFWA 3GI1A 4JUIA 3T1NA 3LUBA 2GPWA 5JCJA 3WTBA 3QUTA 4Y67A 4UBIA 3ASMA 5G3YA 3ISVA 4ZAZA 3L3VA 3A9VA 3P2JA 3C3WA 4F93B 1MHPA 3Q8KA 5IM5A 3X1YA 1ZMXA 1E3MA 4PLFA 5FO1A 1XYGA 3BA1A 4MIYA 1KO1A 1QXSA 4UPDA 1CIPA 1VGRA 1OFIA 1KYXA 4E2XA 4YUZA 4RQBA 3MCAA 3QEBZ 2ZI9A 3N86A 1SK8A 4P3XA 1LJLA 4JODA 2BDUA 3TXXA 3ZCVA 3KB1A 5EWMB 1PL6A 3TOZA 5JVDF 3ZUGA 3UJ6A 3V33A 1B9DA 5EGNA 4K25A 5J4YA 3EXFB 1YVUA 1VRCA 4KBGA 3UJDA 5FBKA 2H5JA 4XIFA 4LRQA 1E4EA 3R74A 4P2BA 5GZ6A 3HWX1 3A9RA 3UYKA 3BQ9A 1B8VA 4C14A 4WN3A 2DBQA 4CR7A 3LGAA 2N47A 1Y3DE 3WXKA 1VJCA 3O3NB 4H7PA 4IG4A 4WZAE 3K6JA 2NM0A 1C1CA 2EEZA 5G0UA 4QBGB 2X3UA 1G2OA 2UYQA 4ISCA 1FUEA 1ZBFA 3I73A 5A5EA 4YX9A 2Y1XA 4G5GA 3S68A 1UA1A 4DRXB 1JMKC 4BQNA 4Y2JA 4DJFC 3FNQA 1VE3A 1KPIA 5H83A 4E46A 1ZEJA 2J08A 3LGXA 1OI7A 4PCUA 4XB2A 1DKNA 3OJCA 4WLOA 3OCCA 1LFAA 2QS9A 4KXQA 4C7OB 2H57A 1TDJA 2ZT7A 1NZFA 4XM1A 1IM2A 3IBGA 2Q2RA 2DR3A 1L5UA 4FLYA 3CG7A 2Y4OA 1D09A 3IOEA 5TF0A 3HVUA 5TGTA 3WWYA 4AWBA 1GM5A 4G8JA 5MN4A 2RE8A 2QD1A 4XXHA 4IL5A 4PTLA 4X7PA 5K2MA 1XHEA 2FPMA 3ENKA 3TTSA 3OZ7A 3OYFA 3OQJA 4YRNA 2ONZA 3PBKA 4XJSA 4CG0A 1R0RE 3LTNC 5ECDA 2X3YA 4II2A 4O4LA 4TRMA 4ZTUB 2XB2A 4GSKA 2CLEB 3GMSA 3LG2A 1MQSA 2HL6A 4A27A 5F4ZA 1U8EA 2H4HA 5F1KA 5C2JB 4QYXA 2ZGVA 4UHKA 3F8WA 1QBGA 3AP1A 3M4NA 4RSMA 4TQUS 3COSA 2O19A 1N33K 2AFVA 4ITVA 2XD9A 3CB2A 3BXFA 4IMPA 4PYJA 2R7KA 2Q2WA 3COPA 4L57A 4URYR 3EG9B 3N5CA 2I4IA 1IUOA 1CQPA 4YJ3A 4XCQA 1YJCA 3FPEA 4TV9F 4D8TA 5ELLA 1NKCA 2YHXA 3LKZA 1KSFX 4E33A 3GAZA 2BELA 3Q8LA 1LBIA 4CEHA 4JVSB 4LHEA 4RTPA 4N7MA 4BKUA 1O6BA 4ECAA 4JI2K 5AVSA 3KFVA 4FS3A 1FTWA 2VUUA 1W52X 3NLLA 2IHVA 2WWIA 2GFIA 1PJ8A 4JLVA 5K3FA 5M1QA 3G17A 3AP2A 3DBRA 4GNIA 3SJBA 3RC2A 1YGPA 2Z56A 4BR7A 1PG2A 3NCTA 4K40A 1SPBS 1LSUA 1N92A 3N2EA 2B34A 2XQIA 2ZE7A 3KVYA 3LDAA 3EO3A 2ZTSA 4PLVA 3NS7A 1XRJA 2J9XB 4P3PA 3RREA 2VWBA 2ZJRL 1YB6A 1L5VA 5HK8A 4YASA 5CVVA 4W9RA 4WBNA 1J0EA 2J6BA 4YGXB 4DTCA 3SEQA 4CCHA 4NVRA 5DYWA 3WGNA 1YQGA 4B35A 3DBHB 2OXTA 4R9SA 4R8LA 2WSYB 5KNCD 4E11A 4UKDA 5A2QA 4TSRA 1HOXA 2YJ4A 2OLJA 1L7QA 1TTPB 4JSYA 1RYZA 4Q3BA 4GKKK 1NOZA 4UTPA 3O91A 2REXB 3DOCA 3BWEA 4O3MA 3OYIA 4JNKA 2QWLA 2Z0MA 3L3UA 2W83A 2R00A 3K9GA 1A4XA 2OFXA 2DKNA 2DBZA 4WE3A 2ZRQA 4IBNA 1S9EA 4GPIB 7GPBA 4RNCA 4RTMA 3RJZA 3AR7A 4RSRA 3CETA 4FCCA 3S2UA 3BWMA 3OOWA 2CNDA 4RVDA 3G7UA 1X15A 4NJEA 1WSAA 5IEJA 4FLZA 2IHKA 3OJXA 5K0SA 1MX1A 5BWBA 9GPBA 5IAGA 2VWPA 4ZD6A 2CMKA 4U2CA 4J0QA 3CM6A 3COZA 1BIFA 5IASA 3WKAA 2LCIA 3LQ2A 4B8AB 1WBBA 2C9DA 1S89A 4FFOA 1NUTA 4N0DA 3WMEA 2CVPA 4B3JA 4JYAB 4BE4A 3GEEA 3DJCA 1UIRA 3KOOA 3UFBA 1MO5A 4CG2A 3D6HA 1KZ4A 5CUQA 1LU9A 1AQYA 5SICE 4JI5B 1PUJA 1IG9A 4LZAA 1QZ5A 4UBNA 1CBUA 4O2RA 3DFKA 1U3DA 3VNBA 2O8BB 3CGWA 1B0ZA 5A71A 1YRWA 1VKZA 3ZZUA 2QWRA 5SV2A 5D7NA 3TH5A 2FZ4A 1ZK3A 4ITUA 1CLEA 1UAYA 2Q3EA 5AKXA 2W40A 3AILA 1H2EA 3FWNA 5JDCC 1NVTA 1WXDA 1C0GA 4RAOA 1K2WA 4BDSA 3I6YA 2J3DA 4BAZA 5FA5A 2CLDX 1DINA 1OX4B 4NR0A 2DMRA 3A28A 2DFHA 3ER6A 2IXTA 4DMKA 4OOFA 1QANA 5B58T 4RHEA 5CXUA 2FX2A 2PUGA 3R5FA 3KVOA 4HO1X 2YX1A 2AMLA 1JYSA 1RYHA 5E9QA 1UMKA 3PIDA 3QKWA 2WWFA 3SZRA 4O4LF 1OXUA 5L4SA 1ORWA 3HCFA 4CBVA 2O0JA 1G291 1J8YF 5ALMA 3R6GA 2VKTA 2B5JA 1G55A 3BJMA 2Q2OA 4DT1B 5JLJA 1GU1A 2R6AA 1BE8A 5AVYA 2YNGA 1GNQA 5LQCA 2V0GA 1A72A 4G4GA 4ER0A 1AOXA 1YS2X 1YZFA 3TBFA 1TT7A 3BKXA 5CT4A 3ZCUA 3RSOA 2XUFA 4EP4A 2B82A 4D4IA 4Z1MD 5TR9A 3EVBA 3U44A 3L7AA 1WG8A 2JAPA 1Z0JA 2GKGA 1QBKC 4RA6B 2IV7A 3ZHYA 1C1AA 5BP7A 2R6CA 1T0IA 4GI3A 1T05A 3OHRA 3CNLA 4QPCA 3H84A 4DTOA 3S99A 1N2EA 3S2FA 1ZK2A 2IKQA 4YUYA 4MS1B 5HS4A 2D0BA 1GLLO 3WK7A 4XTRA 1BEUB 3ZLTA 2AE1A 1X2BA 3LUFA 4G89A 3AX6A 4JI8K 4RFVA 3WJ7A 3IHLA 4U9IS 5ICGA 3HJUA 5C52B 4Z4CA 2ZAYA 1PJSA 3DLLL 4R2IA 4DIFA 4GY2B 1D6SA 4DQXA 5IH7A 4MIOA 3E3MA 4WNAA 3MTJA 4KZKA 1RHKA 2GZ3A 4AL4A 4DLYA 4HYTA 1U90A 3MW8A 2ECFA 4DQDA 2I54A 3SFTA 2Y1GA 4M6WB 2R9VA 2QX9A 5DI3A 5TQ0A 1Q8IA 1L5GB 4MPPA 3VENA 2A30A 5CH5A 4Y6RA 2XEXA 3I1IA 3AKZA 4ZICA 2AXPA 2H4ZA 2WJHA 4AQYK 3JQBC 2G7ZA 4JKCA 5IXSA 4LECA 3C6BA 2JWLA 4A5AA 1YF3A 1W6UA 1LI5A 3QFCA 1J8MF 2H1SA 2IF0A 4DV0K 3FYSA 3ROFA 3MPUA 3QY9A 4LJRA 1QO7A 4FX2A 4ER7A 2E6KA 4RFSA 3L4EA 4NU5A 1IBLB 1X9JA 1KEWA 2FDXA 2VDJA 3EZWA 4IDDA 1CRQA 1NYRA 2EGUA 5HJ5A 1F3LA 1R6BX 4UM8B 2KJQA 4QVIA 3H1QA 2QY9A 2JBHA 1ZL0A 1XZGA 4KIJA 1SVIA 4S04A 1JJVA 1RLOA 4Q1VA 4B0PA 4REQA 1X7DA 2OMEA 4QUKA 4NV0A 4YT5A 4P35A 3IUNA 1YJ5A 2Y1OA 1J1ZA 1P8AA 2YFQA 2A7QA 2XGJA 4XKJA 3TLAA 3UOGA 2F1KA 4Q05A 3TKYA 4JBLA 4WFKA 3VGMA 1TC2A 1S1WA 1X13A 3L1VA 1AU9A 2CXSA 2NX2A 1EDBA 5EFOA 2PZJA 1HNIA 1KFDA 1K5PA 1O58A 4Z4GA 4GT1A 1JHXA 2DY1A 1XRPA 3VR0A 4C8OA 1K0UA 3OQ6A 4MWSA 1TVEA 4R3NA 2D5CA 2WU8A 1EBBA 2P9PA 3V1TC 2AN9A 2BM9A 4CBWA 1H1DA 3HGQA 4AF1A 4E1NA 1R6XA 2XOKA 1YBAA 3RYHB 1FFDA 2A1UB 2O57A 4PPYA 5C5CA 1UK6A 3KKNA 3DVAA 2V8OA 1P5FA 1JDSA 5LB2A 2C1XA 1NYLA 1XKQA 3QF4A 4XQCA 4G4SO 2AC2A 1E6UA 4AVYA 3LWZA 3N87A 1SKSA 2GZSA 4QGAA 5IKEA 4JKBA 3EZFA 3H5TA 3E1SA 5AM3A 5CLLA 2HDNB 4EF5A 3N05A 4K0KK 4QNRA 3NRCA 1RBVA 5LQSA 1ZX1A 2BFPA 4MW9A 4DIKA 3IH5A 4FHZA 5KU1A 2CJXA 1VRTA 4IDHA 3HBJA 2WUSA 5BW5A 1YBHA 5TT1A 1B43A 3PR3A 2P3LA 3KEFA 3OCXA 1TB4A 3PRJA 2E1YA 4K42A 3MF4A 3L46A 5HW0A 5AHRA 3FG9A 2GLUA 3EL2A 4Q4CA 2Z08A 4I2VA 1QFYA 3L92A 1ZN7A 4NARA 3S8EA 1DBWA 1TKCA 3OQHA 1O5TA 5COQA 3KAJA 2I2CA 4D96A 3A14A 3CYFA 1XCLA 3AUSA 4KMOA 3UKRB 2NUTA 3I2IA 3C5HA 5A4MS 2BGMA 1C0IA 3O9MA 4HYYA 1KMIY 4B7CA 1EGAA 4D5EA 3LV8A 3RAEC 4Z6KA 1HT1E 5FX2A 3S2ZA 3T35A 3ELUA 1VE6A 1P75A 5AFUH 4WESA 1KZ9A 4DSLA 1ISPA 2QZZA 3DHYA 1PJCA 2V6FA 4ZAXA 1VHXA 2QMYA 3FUUA 4LXGA 3KWJA 4RY2A 4F6LA 3JYPA 1TQ6A 3CEAA 1BGVA 1PR6A 2ODPA 5IPFA 3ZHUA 3AF4A 2XVYA 3R9KA 5LYYA 1PGPA 1ZL2A 3ZKAA 4C0XA 3FNFA 3AZPA 4NDNE 4PRKA 3VPCA 2W6QA 2P9KA 4KWIA 4XPIA 1F0YA 1TCBA 4QCLA 4BG9A 2C59A 3B20A 2VCYA 3DAHA 3F6RA 1SCNE 2BE9A 3I01A 3GELA 3O3MB 3GQVA 2FPKA 1XHZA 3EUEA 3O3HA 3LP1A 2UVPB 3VPAA 4MGKR 2JJYA 5AQVA 3IPAA 2NNLD 1XRLA 4JHLA 1GGNA 2Z6VA 3KYDA 3R3SA 1Z5WA 4LUCA 5KOHA 2GJ8A 3P9XA 1ULHA 5AHKA 2NRZA 3BDAA 1SVOA 4KBYA 2CFIA 3WWOA 4RW9A 1KS2A 4MXDA 4LMAA 1E1NA 2BGNA 1NR5A 16PKA 2XODA 4F3NA 1P2GA 2Y0DA 4ZGGA 3EF3A 3NT4A 4QQKA 4RDHA 3BRWD 4JS4A 3P0FA 5KTSA 2OG1A 5SZHB 5IH3A 1VQ9N 5D3MB 1V4BA 3C0BA 3A6KA 5E6UA 2DWCA 4ZYXA 4DTMA 2Q0HA 3NTOA 5J43A 3HRHA 4BMPB 2CKDA 4PG5A 4L5AA 4RKFA 3L1KA 2H18A 1ACJA 2P77A 1ISIA 1VSUA 3I9V1 3PV8A 1XI2A 3EXIB 4TLMB 1YFJA 4W5QA 3C7CB 1Z83A 1FRZA 3FVWA 3G5MA 4GOLD 1HSZA 2X1LA 3DE0X 3BXGA 5CITA 2GAFA 1H3FA 3GBSA 4ZTJA 1HYGA 3WMXA 1JU9A 3K1AB 5H9VA 1T6DA 5JBNA 4OP3A 1EXDA 3T54A 1UC4B 2AD5A 2VH2A 1ZXBA 4KAAA 2COKA 2UXBK 1Q3HA 4ZVMA 2ANBA 3R3YA 1Y34E 3GEBA 2GNPA 4DR6K 4CR6A 3HU1A 2ACKA 3SC2B 1F17A 1S6YA 4JI2B 2OE2A 4B1FA 3W4IA 3V55A 2HDOA 2GV9A 4AS3A 3EXFA 1CEQA 1T35A 3GVPA 3RTVA 3KTOA 1UT5A 2V7TA 1NVUQ 3IEUA 1J54A 1HDEA 5HRNA 4WFNL 5AW7A 1KEPA 5EHGA 5KSPA 3EBPA 3ISTA 1EXWA 2WMNB 4N41A 2YS7A 3R3LA 5KQRA 3DUFB 4MGYR 2VPPA 1YVDA 1IHXA 1VYVA 2OP0A 3OWHA 3CRW1 2NT3A 1B6RA 1KPHA 3T1OA 3RC9A 1JVBA 3MINA 1XRSB 1G64A 1HT0A 2N0SA 2ZSAA 3ESZA 4IZIA 3M2PA 2XA2A 3TB4A 4PWZA 3AJ8A 3CJ9A 1JQLB 5DM60 3OZRA 3ZHQA 3U37A 2Q6OA 1EKEA 3JQAA 5EGSA 3ZK8A 2J3HA 5B6IA 2QXLA 3RGGA 1ZY2A 5DBFA 1WWKA 1M2HA 4Y7DA 4HDKA 3HABA 4YJ2F 3PVZA 4GW6A 2PY5A 5MGBA 3WZMA 2QKYA 5H4GA 1JQAA 1V0JA 2GBCA 1QIEA 3KV1A 4BBJA 3MMVA 4BLUA 2HJVA 3AXSA 3V6DA 1PRYA 4CLRB 1V39A 2IXAA 2OD2A 1H69A 4IUCS 2MMGA 1DGQA 4I6JA 3AERB 2ZRLA 3HYNA 4OJQA 1V1JA 1T4GA 2QJRA 5GMOA 1VYTA 2ZSEA 4U2GA 4YR7A 4BWGA 4C3VA 4H7KA 1QNFA 4NAVA 1URPA 4OKSA 3LM9A 3PNMA 3FTQA 3ZTTA 3EWNA 2IYTA 3WLIA 1C7IA 4GGMX 3WZ2A 1OGYA 1Q19A 1P19A 5HOEA 3MTEA 4N3BA 2J8ZA 3Q40A 4WHMA 4ZO8A 5DM2A 4ER5A 1RHMA 4I2QA 1QRRA 2E6UX 3AO1A 3DRPA 3AF3A 2QZSA 2WC9A 4EA7A 3LX8A 4B1VA 1NJ6A 4CQMB 4J4HA 3AVWA 2EGHA 2VJNA 3K9HA 1L3VA 1XU9A 3FOAA 3IKVA 1XCGB 1QJ4A 2E5FA 1A5AB 1RT5A 2H0QA 4I08A 2E85A 4I1YA 5HUQA 5C5EA 3BSFA 2B2NA 4GLLA 1HQEA 1H9CA 2YOFA 1DEOA 2B8NA 5LN1A 4TLDA 4BC2A 2FG7C 1RKQA 3IUYA 4JEUA 4DMGA 2NSHA 4X3CA 1PAUA 4D3YA 1MA9B 2ZVPX 2IT1A 3O82A 1JB9A 1NUQA 1S2DA 1Z9BA 1OSNA 2A9OA 2OBYA 3UKJA 1ZCFA 1AKQA 1DRWA 1W88B 3S27A 2G8VA 1ZD4A 3DWLA 1Z7EA 4UM7A 5ALJA 2R8XA 3VF2A 1F5SA 2UU9K 2HMYB 2Q5HA 3MTGA 1RWNA 4YCBA 2RGAA 4LJSA 4B31A 1Y4DE 3K0HA 3TEFA 2V45A 1LK7A 1K8KB 1P4HA 2XJ4A 4URZR 2CC2A 3V8BA 1IEXA 4I14A 5JECA 5C10A 5C7OO 3HHPA 1ZSYA 1VSLA 4DIBA 4ANFA 1AKVA 4G37A 3IE1A 2V7XA 2JHPA 4E89A 1HLDA 4Q1FA 5JFTA 3ICCA 5GVRA 1KK3A 3K5PA 1E79A 1PVVA 4I5IA 3ICOA 3CRVA 1NUSA 3DBHA 1PNTA 3EZ5A 1OAOA 1COWA 5K6RA 5IXJA 3UCXA 3KLFA 4WFIA 1MFZA 2XZTA 3IBSA 2XDQB 4UVGA 4YFUA 2B25A 4HDAA 2CHUA 2UUBB 3P9CA 1G3UA 3SMVA 1R5JA 3D7EO 1E1DA 4LSZA 3OZWA 2L82A 3ZW7A 1FXSA 4IIEA 4EH1A 4LS3A 2IL1A 1BW9B 5HRAA 1AHNA 3JXEA 1NW7A 3AOGA 1VPLA 3BOSA 3HXPA 5DCWA 2A42A 5C2FA 4QOIA 4TZ0A 1AQIA 5HKKD 2ERXA 2V7PA 2JFXA 2FMHA 2PHZA 4GWGA 5DN6D 2BPOA 4LAFA 2O5VA 1KI6B 4Y9UA 1N2CB 4NEHB 4K0RA 1Y3AA 2A86A 2OTCA 2VSXA 1ZWKA 3M0EA 2YWHA 1YVRA 4I55B 3O2NA 4ACBA 3LW8A 4AJIA 1LEHA 2HQOA 1XQ1A 3OSUA 1T3GA 1U5BB 4Z3OA 3WHIA 3GJ3A 4BMNA 2CL7X 1J2YA 3LDPA 3EOBI 3H19A 5BNIA 3KUDA 3BUZB 4UUNA 5ILQA 3UW1A 2L69A 1EFUA 1TU3A 2WNHA 2RGUA 5DX8A 4LXHA 3ISNC 3ENWA 2Y76A 2QW1A 1DC5A 3BH7A 3FDFA 4BRGA 4EHKA 4UHDA 4QAJA 1Q82O 4JXKA 4QC2A 2BZ1A 1GTMA 4EM6A 3O31A 3QXHA 4RG8A 2BHTA 4TL6A 1UBKS 3VU3A 4FJHA 1XK6A 4J94A 4EG8A 3L6UA 1BCMA 3KQSA 1N2BA 4C04A 2YMMA 4BEJA 2J5KA 2W2PA 2B5WA 1K1EA 3EAFA 2K87A 3FOEC 1JLAA 3DAOA 4NZMA 4JJZA 2ZRIA 1OX4A 5AVTA 3H3JA 1OFGA 2P6PA 1ZH6A 3ITEA 1VSKA 3QI7A 4AFNA 3QZUA 4EVRA 2D3WA 1SFRA 3M1LA 2JKZA 3UHJA 1J7JA 2ADFA 3ZDDA 1P8ZA 3T1AA 2FSNA 1U9IC 2Z8XA 3QNNA 3TBHA 1GD1O 4JB3A 4M49A 1R0SA 5AQQA 1EGHA 3LZDA 3JPWA 3L8DA 1ATSA 3U4DA 3G9QA 4Y6GB 3ML1A 1WRBA 4Y30A 1E3JA 4F2DA 1H1TA 1WP4A 3BJRA 3E05A 1YL6A 1I5OA 3DONA 4IO8A 5CJ2A 1QRDA 4HLNA 2PIAA 3W9UA 3CSUA 3ICQB 4QS9A 4TMTA 2NVOA 2HMAA 1UR5A 4EG3A 1WUJS 4JD5A 2P2SA 2Q3FA 1PGOA 2I99A 1OHHA 1ZONA 1M1ZA 1JQEA 2H4WA 4Z54A 4BASA 3EPRA 5CEEA 2CMDA 4JLDA 3KO8A 4FZVA 4QJBA 2ODWA 2DETA 3JD2A 4K46A 3KFLA 2X2OA 5ED4A 2CUKA 4YOVA 2CXPA 3HVHA 3KJFA 3P1GA 2IOHA 2NO7A 1MDBA 2O0MA 3EEBA 4DLUA 1PR1A 4BCDA 8MHTA 3WSVA 3SAGA 5KVCA 1DP4A 4MX8A 1IBCA 5HGXA 3UE5A 2GEJA 1TD1A 3HWWA 4JGBA 4JP5A 2HHVA 4KDFA 1FJGB 3GVXA 1WF3A 3I1JA 3WV4A 1W1WA 4G9ZA 4KHNA 1Y8QB 4MS1A 1S7GA 2FQQA 1EX1A 2HA7A 5EXWA 3MT9A 3GN1A 2X8LA 1YNOA 4HX9A 4N6GA 2E8AA 3V9SA 4IOJA 4PYKA 2YRXA 5KVAA 3F6SA 5CG1A 3D4NA 1DAFA 4H0NA 1IN4A 2NRVA 2QUBA 1E64A 3AF0A 4XGNA 4BOYA 2HYIC 3D2BA 3WDSA 4FC7A 3FHCB 1YTAA 5EMLA 4CERA 3QBTA 1MU0A 1NK5A 1C7JA 4DWOA 4HGPA 1ODLA 1I0LA 3T3IA 3FYHA 4XVHA 3W5JA 5JO9A 3NFAA 4AX4A 3L8GA 2PPVA 5DEIA 2QVXX 4F1KA 2YCBA 1DRKA 2QV7A 3FCUB 3O84A 1VSFA 3KK1A 2R4UA 2AJTA 4MYHA 5E7MA 2K7ZA 1T26A 1QIMA 3DMTC 2ZBGA 7YASA 3KQNA 2PRSA 4LDAA 4OPAA 5BRNA 4IMJB 1ZIYA 3NHBA 4OHBA 5CDFE 3LDFA 2E3JA 4D4GA 2DG2A 3JVVA 1XKLA 4MICA 1VPVA 5AVVA 5CDGA 3ZVKA 3UT5A 3L40A 3QLEA 1EVKA 1TRKA 4FHDA 3DDNA 2OO3A 1J2TA 3RWOA 1T5BA 4R81A 2WJZB 1DJOA 3LAKA 3AW9A 4JUCA 2OPHA 1ZCBA 4CCAA 2FEKA 2Q9CA 3P38A 2F48A 3EPPA 3I9JA 3JYOA 3SZ2A 5H59A 5ITVA 4H4OA 3FZGA 4DR4B 4GFDA 2WWHA 1AGPA 3W1WA 3AA3A 2OA0A 3H1GA 2X4DA 3BE4A 3AA4A 1T1SA 1U3VA 5EC8A 1QGUB 1MQ9A 4U2DA 3INNA 3T0FA 3C5VA 4G63A 4EPWA 4Z7JA 4C6RA 4WI1A 1YWGO 3D3WB 4ZYTA 1YI8A 4QRDA 1BG6A 4HAWA 1XL1A 4UCFA 4LPSA 1VE7A 4B43A 3U9DA 1IG8A 2Q1XA 4PVDA 4LWQA 3H2SA 3QU7A 3PFHA 1FQKA 1IBKB 1C1DB 1K5HA 2F8SA 3NPAA 4D4HA 5A06A 4AQ7A 3CTPA 3GR6A 1NXWA 2OBNA 3PB3A 1BKYA 5FDFA 1C30A 1Z4OA 4NU0A 2RH8A 2X58A 1ZVKA 2YFYA 3RYHA 2A1UA 1EK6A 1WW3A 1I7NA 2OM6A 3GLGB 4O33A 5AFSA 5DM1A 2QN6A 1C7RA 5D7BA 4G85A 3LM8A 3PC8A 5A1JA 2QMUA 1RMYA 2BFCB 3UKUB 2IUTA 4UDXX 4XGQA 5KTQA 3AUFA 2WAXA 3QH4A 1EQAA 3JY6A 1E5VA 1H65A 3F7NA 4ZJYA 4HDQB 3HCWA 1J22A 2MTBA 1FF9A 1KK2A 3FMIA 5FTMA 2I6XA 4GMDA 2VF7A 1P74A 4MW0A 1G8PA 4LSLA 1Q1GA 4XGIA 3RS4A 1TCVA 1RXVA 4IIJA 4Q4DA 4R83A 2DUWA 2VPZA 4DPMA 4H17A 1UXOA 3OPVA 4YOXA 3IAS1 3P4XA 4OX9Y 1DX4A 4DNOA 4MO5A 2YV2A 1FYDA 5D86A 4YPOA 3E7XA 5FPPA 5IUNC 5HGJA 2FYTA 4RVUA 2I3DA 1JFSA 1KY3A 4MQ6A 2JLUA 2KLBA 2CLIB 5LZ4A 4FYDA 2Z04A 3WB0A 1GQSA 4MW7A 2VPXA 4KTZA 4DTJA 3A5OC 1S2OA 3PIIA 2J32A 4NS1A 2OGWA 3KJGA 4BO4A 3QXGA 1FSFA 4LOKA 5KTRA 3Q85A 1VI6A 3EHDA 1AKWA 1XMOK 5AVZA 1MT0A 2VPQA 4OHUA 3CF0A 2O5EA 3CINA 5DIFA 3MQFA 1LK0A 1QUFA 5E3HA 4OFXA 4ZU1X 4PX9A 3TSUA 3REFA 5ECGC 2IY9A 5JVDA 2PGIA 3NP9A 1J8FA 3QX8A 4RELA 5BPNA 2QRMA 3QKTA 4INAA 2QWNA 4P7KA 1N2XA 3LZIA 5IVDA 5L95A 4IXTA 1XCPA 2Y0CA 3K0SA 1FNBA 3KQYA 5F2NA 3O75A 2RHMA 5H8WA 2JS7A 4IZOA 3E7DA 1R3UA 4DVGA 5KKNB 5M1KA 3UF0A 3ED1A 4OHKA 4FFDA 3C3JA 4UVHA 3I0NA 2ZR8A 4X63A 4R8SA 2UXDK 3H05A 3ETLA 5ER6A 1HYHA 1IPFA 4NESA 4KI0A 5HKOA 3DLCA 1XB2A 3VH1A 3D8BA 2VS1A 4HB3A 3TLBA 4QL3A 3SS7X 5CH3A 4KRYA 3H0EA 4PN7A 3E7FA 4YJ2B 3BBLA 4R7GA 1PS8A 8ATCA 5D3MA 1GAWA 3AVNA 2IEIA 1UEJA 4EL5A 2N42A 4K26A 4NABA 1GYQA 4KQHA 4BNIA 3O4HA 1PZNA 1E4OA 2LBPA 2WD8A 1V2GA 4LWOA 2NZJA 1FYVA 2J0EA 3FOZA 3FNGA 2RHLA 3BGSA 4ZHSA 3H9EO 1VSVA 4RTFD 2MSDB 3QJ5A 2O9JA 5T6BA 2HW3A 4C23A 4F8YA 3KYBA 1ULAA 3K1AA 2JGDA 5LA6B 5JMVA 5AESA 4DTPA 1EU1A 3UWKA 4FB4A 2ZETA 5ALOA 3L7IA 2C95A 3ZTWA 3EFOB 3P2YA 5IN5A 2HHHK 2PSFA 2GEDA 3PQ8A 3VZRA 3LDQA 1Z56C 3WNGA 4XIYA 1LWOA 3G1UA 3D7KA 4QLOA 3GDHA 1A8SA 1M66A 5CDUA 3G2HA 1L6IA 3LE8A 4FXPA 4DN6A 2VP3A 1UOPA 3OZSA 5AI9A 3S29A 1GDDA 4E5YA 1DIAA 2R7NA 2WVJA 4PQGA 4OJMX 2HZ7A 2HGZA 2ZJ5A 1Y1SA 2P6NA 4DCMA 1GLCG 2I03A 1U0LA 2OBFA 4HLUA 3MPOA 1UUFA 2ERCA 4TV9A 5I3UA 3AUTA 2HF7A 2QSJA 2YWEA 4FWKA 3OYAA 3EPHA 4L51A 3LW7A 2OPBA 3ZNQA 3LPTA 5J2PA 3ABSB 3WNQA 1MB4A 2ZRGA 1YZQA 4JKHA 1ZGBA 4AY3A 1U7XA 4C3OB 3T1YB 3I8OA 1NXPA 1MC1A 3OC0A 1VDMA 3NXKA 4TL8A 1DBPA 3RAJA 3H8VA 2IVPA 1TZBA 3ET5A 5DOVA 5LJLA 1JPNA 1V2HE 1FPQA 1YOVB 4V0RA 3K53A 1SBHA 1U2RA 4QEKA 4PLCA 2Q4TA 1Y7TA 2JLBA 3UAVA 3I2KA 4I9GA 1I4OA 1PWHA 1YQUA 2RAFA 4DSJA 3RR8A 4ROTA 2WMYA 1JQBA 3TECE 1GPLA 3AERA 3ANSA 3RBVA 4F38A 2WTAA 3UWMA 5HG0A 3RRHA 2G88A 3PU6A 3EZNA 5BPFA 3SJZA 3BFPA 3GRCA 2I4MA 3M9LA 4WZZA 3VYTB 3ZX5A 3D7SA 2IYRA 5TARA 2ZM6K 4MTLA 1YA6A 3BN3A 3IHTA 5EJ4A 2GPYA 3V3TA 2QROA 5F2OA 1L8QA 2VHYA 2NQ2C 5A9TA 3TW4A 1C9NA 1WVGA 3LBAA 2ZUTA 1PBNA 1XSEA 3N8NA 3C3MA 4XEUA 4OH1A 1DDGA 3WISA 3FY4A 2MSNA 1KAOA 3L7KA 1AGXA 5KRTA 2DWOA 1J9GA 4E4YA 4WOBA 4DS3A 3CX4A 2HRRA 1GEGA 2P2LA 3SY8A 4BO5A 3FR7A 3BMOB 2AUMA 4BQEA 2LKDA 1EXNA 2YFHA 4MKHA 3V1UA 2YICA 2VJMA 1UH5A 4BAUA 1RHJA 2HJGA 5EP2A 1V4NA 4C7KA 5AUNB 3ENHA 4FZ5A 3WGYA 2UZ4A 3FD8A 1JR3D 3QE9Y 3OE7A 4WA8A 1WSJA 1ABEA 1R3DA 5K0FA 5JRDS 1Y6ZA 4KWCA 4WNYA 3E2MA 3V3KA 1XJ5A 4H1VA 2GD0A 1KJJA 3CW8X 4HQOA 5GADl 2QENA