2YHBA

Crystal structure of the n. crassa qde-2 ago mid-piwi domains
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
433
structure length
368
Chain Sequence
VKVARPCRKIEKWTYLELKGSKANEGVPQAMTAFAEFLNRTGIPINPRFSPGMSMSVPGSEKEFFAKVKELMSSHQFVVVLLPRKDVAIYNMVKRAADITFGVHTVCCVAEKFLSTKGQLGYFANVGLKVNLKFGGTNHNIKTPIPLLAKGKTMVVGYDVTHPTNLAAGQSPASAPSIVGLVSTIDQHLGQWPAMVWNNPHGQESMTEQFTDKFKTRLELWRSNPANNRSLPENILIFRDGVSEGQFQMVIKDELPLVRAACKLVYPAGKLPRITLIVSVHYTVLVDEIFRADYGNKAADTLEQLTHDMCYLCPPAYYADLVCDRARIHQKELFDALDENDSVKTDDFARWGNSGAVHPNLRNSMYYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords POST-TRANSCRIPTIONAL GENE SILENCING PROTEIN QDE-2
publication title Crystal Structure of the Mid-Piwi Lobe of a Eukaryotic Argonaute Protein
pubmed doi rcsb
source organism Neurospora crassa
total genus 125
structure length 368
sequence length 433
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yhbA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yhbA01
1VSFA 5JNWA 4CJUA 5SZTA 1NJZA 3K58A 2HMIA 4MQEA 4Z4GA 1HMVA 4HHTA 1LAVA 4FJ9A 4HNSA 3K5MA 2KTQA 1LJUA 2WB4A 5E3JA 4AHRA 3P83D 1VSEA 4Q6WA 2XHBA 2KZZA 2JCGA 3ZSVA 1ZBFA 1RTDA 4CFCA 2IGIA 2PYJA 2PZSA 4PICA 2B6AA 4O1IA 5I3UA 1SL1A 1QMPA 7ABPA 2JK1A 1GOAA 1IKVA 2VK2A 3CFOA 4HCCA 3IRXA 1RXEA 4ZPJA 3HVTA 3NBPA 1J5OA 4E19A 3N0XA 1LAWA 5C24A 1KVCA 3K5OA 1QSYA 3SUOA 1QKKA 2PUFA 2QW1A 4OTZA 2YHAA 3V9SA 2HVHA 2PKXA 3NE6A 4KFBA 3VQ9A 3LWLA 3FFWA 3MM4A 3DLBA 3QELA 1QS4A 5IUJC 3HUTA 3OS2A 5CZ1A 1ASVA 2ITGA 4E7PA 4FLWA 2JB9A 3NH0A 4RXTA 3ULDA 4F06A 3PO4A 4CJTA 5HKOA 2MSKA 3AA2A 1QSSA 3KKEA 4MGEA 1Z18A 4IBNA 4B08A 5DLEA 1WSEA 2VYCA 2FTKE 4G97A 3QINA 1USGA 2IPLA 1TK0A 1BIUA 1LW2A 4QYMA 4MR9B 2GWRA 3IG1A 3UK0A 4FJGA 2EX3A 4ZMSA 2HQOA 4N0QA 1NJWA 1GOCA 4YLEA 1VSHA 3EZ5A 1X9WA 2JVJA 4GVMA 3SUNA 2HNDA 4CJVA 1SD5A 4LH5A 5C42A 1DBWA 4EZ6A 4RXUA 3NH2A 4HYEA 5TPZD 3VQBA 3KJVA 4CHNA 1S9GA 4JLHA 4DTSA 3L6UA 2YNGA 2YHBA 3WNGA 2KFZA 3NF8A 3KYIB 1NOZA 1FFSA 1WLJA 3V9UA 4F3TA 2GV9A 4F12A 2HHQA 1SXIA 1X9MA 2NUBA 4FW2A 4DWIA 4NICA 4XAQA 1SL2A 3H5WA 3QLVC 1U04A 1JFVA 3E3MA 3IPCA 4TLMB 3U3GA 5ED4A 2X6NA 4KHWA 3D8UA 2Z1HA 3EQ2A 4ELTA 4S04A 3ZSYA 1ZY2A 4G0YA 4IGAA 5CNMA 1C6VA 4PEVA 3T95A 1HYZA 4ID5A 2ID7A 1CZBA 3S3NA 5HRPA 3OYGA 4RV5A 3DRRA 4RZSA 1EX4A 3HCWA 3VQDA 3DZDA 4N47A 1BCOA 3O1IC 3TI0A 3NDKA 4CJPA 3CFYA 2RJOA 4H60A 4ZYLA 3C94A 1C4WA 4LZLA 4M3YA 2QKBA 2H3HA 4EYOA 4KHSA 3V1OA 5EWJB 4N0PA 4TMYA 4EZ9A 4FVMA 4LDAA 4J2EA 3GV0A 3MMNA 3RVLA 2R25B 4MRMA 1DP4A 4LRQA 4N41A 4FJKA 3ALYA 4O0IA 3FDFA 1T34A 3TAEA 3H6HA 1DC7A 4FJNA 4CEBA 1PNTA 2FSPA 1GCGA 3H5OA 2PAFA 4CJEA 4KAZA 4EYQA 1JYEA 5FBHA 2GBPA 3HO1A 1PEYA 3O4QA 1U2QA 3RR8A 5HQJA 4KRFA 3HUUA 3C6UA 1BDIA 3NHZA 3O2QB 1JLFA 3QK7A 2ZD1A 2PLNA 3DM2A 4G0ZA 3KHTA 1VKRA 3LP2A 2PUCA 2IDOA 3R0JA 3OQOA 3OS1A 3VQ7A 3F9KA 1KVBA 3AVHA 4KQCA 4YRZA 3HXMA 1JLBA 2LSNA 1ZGGA 3PO5A 1KMIY 4OLAA 1LWEA 2HNYA 1L3VA 3ILYA 1NATA 2E4WA 5TQ0A 2L18A 4CFBA 1B9DA 5TE9A 4CEFA 1RZRD 4ML3A 4E7IA 4FJHA 3M9XA 3D0PA 5JNRA 2AYZA 1HJRA 3OM1A 3P5JA 4D74A 3A2FA 3MXIA 1URPA 1SKWA 3SAJA 3C6QA 3ITHA 1EHCA 2HSGA 4ZMRA 3DRPA 4FE7A 4FLTA 3BRQA 1NXOA 5FBKA 2WWVD 3FMVA 1EFAA 4CGJA 4KNYA 1IKXA 4DQRA 2KYRA 3QO9A 4EGSA 4HUEA 4PWDA 2IAJA 3V81A 4CGIA 4Z0UA 4YNQA 1FQWA 5FRMA 3LUAA 3JYTA 1CYEA 1NXSA 1KRXA 2FVYA 3VQEA 3QETA 4FK0A 2ZQBA 3MEGA 4MLCA 4MS3A 3F7NA 2D0AA 4RDCA 1RDDA 4W5QA 1HPZA 3M8PA 3PX0A 4MPTA 2CHFA 5KRSA 5DCLA 2FEKA 1VSDA 4QOZB 5KQMA 3IP7A 2E4UA 5TPWB 4DTXA 4CFDA 2O4GA 3BDPA 2KZMA 3I5AA 4EVRA 1QPZA 2JGUA 1EWVA 4AH9A 3H5VA 1LJLA 4FCYA 3LUJA 2VG6A 5HP1A 2PYLA 4DQIA 4G0OA 4CCHA 3EAFA 1YK0A 3C3WA 4TN5A 3OQMA 4HCBA 4F3OA 2BGGA 3VQQA 3KLEA 1TK5A 3S9HA 3LMKA 3AVLA 4Z4HA 4AILC 1CLQA 4MR7B 3O75A 4B3OA 3SY8A 1I3AA 4DTPA 1C0UA 4KB1A 2H0AA 4FB4A 4DU3A 1TKZA 3LP0A 4LH4A 4E1MA 2RDMA 1QP7A 1K66A 2PUBA 2GUIA 3TABA 4HTUA 1TJYA 3O2JA 1NOYA 4YR7A 5HSGA 2A9OA 1R0AA 4DU4A 1OXKB 1B9FA 3HDGA 4LD0A 3NGZA 3OJUA 3HV2A 1ZGZA 1ISRA 2G8HA 4CJ5A 1WAJA 3EQZA 4AHVA 2YNIA 3LPUA 1RT6A 1QP0A 3Q7TA 3HPGA 3KLHA 3ROTA 4C8NA 3PV8A 1ZBUA 4JRQA 3DRSA 5FRNA 3VA0A 1N6QA 3RRGA 4PUOA 5J2QA 2R47A 1RBSA 2P9HA 2IPAB 1S1XA 5IEBA 1TVMA 3TR8A 1Z16A 3I0SA 2OA8A 2FMHA 4FJ7A 3K2PA 3K9CA 4M45A 2LP4Y 5CNKA 3CQ8A 3RVNA 1YT3A 1LK0A 4IMJB 2JBAB 3IS9A 4HNQA 4DS5A 4DFJA 4I7FA 1DCMA 3CG7A 1S6PA 1L3SA 3RVRA 3ZSXA 3OLZA 3WNFA 2NT3A 2LUOA 4DTNA 3DLKA 3MEDA 2J48A 3AVMA 3BREA 3NGIA 2B1JA 2IKSA 2HQBA 4DG1A 3DLGA 4N56A 1RTJA 3GWGA 4OVLA 4KMRA 3C95A 3OS0A 3CRNA 3V9ZA 2XY7A 3S3OA 5D2CA 3AA5X 1TVRA 3HT3A 3MIZA 2RGYA 3MAQA 3QLUC 6ABPA 3OYMA 1Z13A 4KFCA 3VNAA 3O3GA 4FLZA 4DSLA 2P5OA 3DBIA 3MQ4A 4DSJA 4DTJA 3KSMA 2I6FA 2X6SA 1BISA 4PQUA 1YMVA 4DLEA 1BHLA 1SXHA 1BIZA 1BDJA 5CYMA 1JLQA 3EY1A 2IYNA 3H1GA 1JLAA 4B8AB 4RK7A 4LSNA 1DRKA 1NK6A 3QLVA 1P2FA 2PL1A 4K8XA 3UKJA 4DF4A 2QVGA 1LV5A 3CHYA 4M88A 3OLWA 3NHMA 3H5TA 4B09A 1DG9A 1UWBA 4G0MA 1SUQA 1RBRA 2JLEA 4ZHRA 1ZBLA 3GYBA 4MFBA 3JTEA 1S5JA 5IEJA 4BWMA 1TKTA 1M2EA 2E4YA 4DFMA 2ZWMA 1S1VA 2QR3A 2WONA 2FBTA 1CHNA 1U4BA 1KRPA 4NV3A 4GNRA 2ID9A 3NAEA 3A0UA 5EU7A 3LKVA 4DFPA 6CHYA 4H3HB 1I3CA 1NXPA 1QO0A 2GI4A 5IBQA 4EYKA 2M1ZA 1BVHA 4R5PA 3HK2A 1B00A 1DBPA 4RW9A 1MVOA 3LAMA 1P6QA 1C0TA 1JL1A 3GT7A 3N8IA 3AVGA 3OVNA 3TAMA 1C0MA 1WSJA 4DLGA 5J2MA 4CGFA 2GKGA 3L2UA 2PUDA 3E61A 4CJFA 1XI1A 1YMUA 3OLVA 5TQ2A 1EKEA 1L5UA 4DSIA 3L3UA 4IFVA 2B4JA 1JL3A 1XHXA 4MR9A 4FE4A 1QQAA 3RR7A 3PUFA 2D0CA 3ROFA 3LUFA 1D2AA 4Q6BA 2QVCA 5FWYB 3O3HA 2VWJA 4L4UA 2BE2A 1VK0A 4CIFA 4MLDA 5BRJA 5KQPA 5IC5A 1ZVVA 3RVPA 3DOLA 4RK4A 3H75A 4CF0A 4KO0A 5CZ2A 5JS1A 3ILHA 3OJSA 1JDNA 3QIOA 3TB6A 4Z9AA 1REVA 1VRVA 1ASUA 1P6UA 2Q3SA 4ZTFA 3NNNA 2Z1GA 3OLYA 4CF8A 1JLCA 2Y1IA 5TQ2B 2A9PA 3HSYA 3N75A 4DADA 1S1WA 1GCAA 1P8AA 4RW8A 1WNSA 4OGCA 3LFTA 3VQ5A 3TWHA 2PUAA 4MQ3A 1A5WA 3KD5E 4XXHA 4BDYA 3DGFC 2FEWB 4Z99A 3HP9A 4G0XA 4IG0A 3B6OA 3AVJA 4PZ0A 3K59A 3LALA 3IPAA 4OPJA 3VQ4A 2E6LA 4K8ZA 1R8JA 4CHYA 4BE1A 2XDYA 5KI6A 1BQMA 3RTVA 3JVDA 1A2OA 5ABPA 5C5EA 4Z4FA 4QICA 1JFTA 4FJ5A 3OYIA 4O55A 3T19A 5I4CA 3KLFA 4MR8A 3RQIA 2B5JA 3CZCA 2A9QA 4RWEA 3JY6A 1TV6A 2E4LA 5EWJA 1DTTA 1JYFA 1FXXA 1WSHA 3PX6A 2MSLA 4I9QA 1ZHHA 1C1BA 4KK3A 1FFGA 1C0EA 5K14A 4KV8A 4B8CA 5GOTA 4B9UA 3AVCA 3B2NA 3I0RA 3H08A 1DTQA 1Z2EA 3RMAA 3QX9A 2G8VA 1DCFA 1NTRA 3N53A 3OM0A 1TKXA 1J54A 2IS3A 4HNRA 3K57A 3RVOA 9ABPA 1VRTA 1YS7A 1TM2A 2ZE2A 3T3FA 4DN6A 4FK4A 2QZJA 1VPWA 1MU2A 5I42A 4Z9BA 1APBA 1SKRA 3SQ0A 3G1WA 1WETA 4MR8B 2HW3A 8ABPA 4F2RA 4F8JA 3QEPA 4ZJPA 2A9RA 4OKKA 2BANA 1VSMA 2XY5A 1DBQA 1QQBA 4KTWA 3QESA 3P9YA 1MB0A 3GL9A 1T05A 3AO4A 4FM2A 4OKJA 5JS2A 2QXFA 4KHYA 4CE9A 3TANA 5FWXB 3U3YA 1W9HA 2KW4A 3LTEA 1C1AA 3RH0A 4IFYA 1BCMA 4RY0A 4QPJC 5DMRA 4MS1A 1JFSA 2JRLA 3GRCA 4DU1A 3QEXA 4QAGA 3ZSRA 4CEZA 2VWKA 4PY5A 3AV9A 1Z17A 3L2VA 3RMCA 1D8YA 2E4ZA 1KCFA 4JS5A 2V0NA 1ZH2A 2AJQA 2PL9A 1E6MA 1EWKA 3AVBA 3PX4A 3K4HA 1RT3A 3SNNA 2E4XA 1NXTA 1DRJA 2OPQA 3BILA 5KGXA 3OLXA 1JLKA 3MYYA 3JSMA 4C8OA 5FDLA 2HHSA 4CIGA 2FBVA 4Z4IA 1D5WA 4N03A 2ETJA 5GQSA 5CYQA 1ZBHA 4P98A 4KTZA 3MF4A 5TPZA 4CHZA 3OYJA 3KLNA 1KFDA 3QLUA 1GOBA 3LKBA 5TPWA 3VNBA 1IKYA 3OYHA 3VQ6A 2NZVG 3SUPA 1FKOA 4MS1B 5BQ3A 2ATQA 2MYTA 4CEDA 1FK9A 4OATA 2WJWA 4Z4EA 4G1QA 4H8KA 3ZT2A 1JLGA 3ZT4A 4D6XA 3OYEA 4ICLA 4E7OA 4YWHA 3F6PA 1RDBA 4KI4A 1ABEA 2KQ2A 4I2QA 3CG4A 4O0JA 2MYUA 5JNVA 5CNIA 4MR7A 2JVIA 1A5VA 3CM6A 4CF1A 3Q7RA 1XHFA 4AHSA 3H5IA 3V6DA 1BAPA 4M3RA 3GA5A 2WJAA 3MEEA 4CEAA 1C1CA 1SRRA 3LZJA 1D1PA 3L3VA 3SV4A 4IRXA 1TL1A 3L8BA 2D5RA 3OYNA 4D6YA 2QKKA 3N0RA 1WSIA 4H3KB 1ISSA 2HHTA 4OGEA 4EVQA 1IH7A 1XWLA 3SM9A 5HRNA 5DK5A 1NXXA 1BGXT 3LUCA 4GW6A 4RKQA 4JB0A 1S8NA 3QEMB 2JVKA 1HEYA 3GBPA 4DQSA 2P5GA 3M8RA 2LPMA 4FZZA 2I5JA 3CG0A 5J2PA 5CY4A 1A04A 1AB6A 3SNKA 3M8QA 4C8MA 4F4KA 3QX8A 2QU7A 4DS4A 2JBAA 4KZKA 3G10A 3C6TA 4JS4A 1NK4A 4C8LA 2HB5A 3ZT3A 3HSTB 3L2WA 4RW6A 4RU1A 3KKSA 1RNLA 2A1SA 2VUIB 5B3JC 4QCLA 4YS6A 2HQRA 1IKWA 1NK5A 3LUKA 3OYBA 5KQGA 4C8KA 1NY5A 3VN5A 2D0BA 1Q9YA 4Q7EA 4FLUA 2RJNA 4FZYA 3HDVA 3LUDA 3TO5A 2HJ9A 3ZT1A 1XWWA 1BQNA 4E7KA 3QNOA 4YO7A 3V4IA 1SV5A 3RVJA 2P51A 3OYAA 4MQFB 4KHNA 3AVKA 1NK0A 2F8TA 3H5LA 4DTOA 4FJ8A 4P1ZA 4G86A 4ETMA 1JBEA 3SUQA 2MSWA 3LUGA 2Q5CA 2DFHA 3WNEA 3SQ2A 5J1EA 2XRIA 5JNUA 4EY3A 1RZRA 1RDAA 1MAVA 1K6YA 1E6LA 2A1RA 4RW4A 2GX6A 4NCGA 3OYDA 1RTIA 1NK8A 4NCBA 2DFFA 4CEOA 4DQDA 2Z1IA 4IG3A 4RY9A 4WXMA 1RT5A 4YFUA 3U6FA 3DMJA 1TLFA 2GBZA 2FQWA 3A3KA 1H9CA 3AVNA 1RNHA 3LWMA 4CF9A 3KJXA 1PNRA 5T3YA 3SV3A 1L3TA 4CBVA 1EAYA 4CJ3A 3KLOA 5J2NA 1LWCA 1VSJA 4OKEA 2HHWA 1UAXA 1JDPA 4I2PA 1USKA 3KLIA 5HM6A 3N6VA 4ELVA 1NKCA 4PE5B 3HP6A 3CYMA 2X7XA 1D9FA 3RVKA 4RXMA 1LWFA 4W5NA 1RTHA 1WN7A 1EP4A 1Q9XA 4FJIA 1J9AA 5EWLB 1TL3A 5DTEA 3DOKA 3AVIA 3QEIA 3V1RA 4NCAA 1IO2A 4KHQA 1KLMA 4ELUA 4E89A 4EVSA 3TAGA 1UA0A 3K5LA 4OBBA 2M98A 3UUGA 4EUKA 5BR1A 2OPPA 3QLHA 4KHUA 4W5RA 1QQCA 3KK2A 3FFXA 2E6MA 4DFKA 4RS3A 4Y9TA 1NJXA 1RXIA 3SQ4A 1Z15A 4KVFA 4B9MA 3NNDA 4QYWA 1G15A 2DRIA 1Z12A 3QLTA 4ETNA 5JNSA 1LBIA 1A0OA 4OG2A 3DLHA 4F8RA 2G8WA 1HYSA 3QNNA 4NQRA 5FWYA 1TGOA 3SPZA 3S3MA 4IILA 2HHUA 1VSIA 4TSXA 3H1EA 1PEAA 2F8SA 3I42A 1XHEA 1L5YA 3KS9A 3KKRA 3Q9SA 1QSLA 1O1WA 1NK7A 3QEKA 1HYVA 3RMBA 4RSMA 3V9WA 3QEVA 4MAAA 2WY2D 2WOMA 1F4VA 4F11A 3OO0A 2EHGA 3EGCA 3IDOA 3KD1E 3IP6A 2XO7A 4L8RB 3SG0A 1XHZA 3EODA 1SXGA 3O74A 2VG5A 4LE0A 1BL3A 3T6KA 4BE2A 4M3WA 2FMFA 2IOYA 4JA2A 2YNFA 4O4GA 3T8YA 3H1FA 4EYGA 1K68A 3BGRA 1OXBB 4DTUA 2PJUA 1JL2A 3ISNC 3ZSOA 2BDPA 5FROA 2CHEA 4AHTA 3CTPA 1UOCA 4HUFA 4J2DA 1AB5A 3O1HB 3OMXA 1X9SA 2PUGA 2YKNA 3CS3A 2IPNA 4CJKA 3OO1A 4KV7A 4FXDA 1JF8A 4HVJA 4JRPA 1UA1A 1DCKA 5IUNC 1NXWA 3LOPA 3M9WA 5CHYA 1VLZA 1YVUA 5IX8A 2OQRA 5SWMA 3M6MD 1GUDA 3HEBA 2R4QA 3OYKA 3L2RA 3SPYA 1QHTA 4JP1A 2HHXA 3TAQA 2N9UA 1ZESA 1E2BA 4O44A 3I09A 4CEEA 3OY9A 4MQEB 4DSFA 2L19A 4FK2A 2L17A 3OQNA 2O20A 3KYJB 1JLEA 4IMIB 3O2SB 1ZH4A 1IIBA 4E3SA 1VRUA 4FYDA 4O1HA 4RW7A 4TLLB 4BWJA 1CZ9A 3LZIA 1HNVA 4CIEA 2F96A 4RG8A 4H4OA 2Y1JA 4FM1A 4IF4A 4LX8A 1BDHA 1W0HA 1T8EA 2P4UA 3AO5A 2DY4A 3FFTA 4M41A 1M5TA 4FZXC 4EP5A 3T1AA 3RRHA 4LSLA 3Q15C 4E1NA 1QNLA 3D02A 4LDZA 2NT4A 4CESA 3VQAA 2FC0A 1M5UA 1A5XA 3THVA 3UIQA 3SQNA 1NK9A 3DGEC 2PUEA 4N5SA 3QELB 5T7BA 4O5BA 3CLKA 2G8FA 1RCHA 1D4ZA 1L3UA 4KK4A 1PUXA 4F2SA 1M2FA 4NYFA 2OZSA 4UQGA 2VG7A 3D45A 5FWXA 4AHCA 3TX6A 5C25A 3LDSA 1RT1A 2FMKA 3HS3A 1DJMA 1FKPA 1RPJA 2DTUA 3LP3A 2W42A 3T38A 2IOCA 2PE5A 4CJRA 1F51E 4ZTJA 1HQEA 4CF2A 1D9DA 2PY5A 2FN8A 5B3JA 3FFIA 4I9LA 1L5ZA 4CGGA 5HROA 4KTQA 4CJLA 1NXVA 1W25A 2IDMA 2YNHA 1YK1A 3NNSA 4FM0A 1BI4A 3RVSA 3HJFA 4G0QA 5KRTA 3AVAA 4MYRA 1S9EA 3ASMA 3E01A 4G0PA 1JXEA 4OJRA 3OYCA 2XY8A 2RKIA 2HNZA 2FMIA 4WE1A 3ZSQA 4GPAA 4J2BA 1TKDA 3NHGA 4Q5VA 2P1JA 3C3MA 3A10A 1PHRA 2FQXA 3AO1A 3TD9A 1YS6A 1CXQA 4JB2A 3ZT0A 3URMA 4ID1A 3A0RB 5E41A 4B9SA 2R48A 1I39A 1U8TA 2L2QA 2KFNA 3CFPA 1XC9A 3O1JC 5DGCA 2TMYA 1TAUA 1X1PA 5IUKC 3LUHA 4Y1DA 2OZMA 1ZDMA 1DC8A 1U48A 3AO3A 1RT7A 2G8IA 3G0ZA 4WZZA 2IC3A 2G8UA 4PA1A 2HPHA 1CXUA 1BI4B 4YGXB 2FEPA 3KCNA 3RMDA 4Q0BA 5KGWA 4FLXA 4XLTA 4M3ZA 4E7LA 1JX6A 3NCIA 3NF9A 1Y97A 4CHPA 3HPOA 3MXJA 3IP9A 1YTAA 5HBMA 1JXBA 1GLGA 1HRHA 4KI6A 4WWHA 4CK1A 5IULC 2FKAA 1QTMA 3VQCA 4B9LA 5KTQA 3VQPA 2QK9A 4DTMA 3VQ8A 3WNHA 3NFAA 1WSFA 3DLEA 3HYFA 3JPWA 3QEMA 5HRRA 4MRMB 4LE1A 3NF6A 4Y1CA 2YV0X 4E7JA 5CNJA 1RBVA 1ZAYA 4WT7A 3KIOA 5BRAA 4XASA 3F73A 1RT2A 3C3KA 4B9NA 1JWLA 4FW1A 4RK1A 4UHKA 3LANA 1E6KA 1RILA 4FJXA 4LY7A 1BA2A 1QE1A 3VA3A 3O3FA 3CU5A 2LBPA 1ASWA 3M8SA 3TARA 3NH1A 4RY8A 1YTUA 4FJJA 1TMYA 3DYAA 3QEWA 3V9XA 4M3UA 1D5AA 4PYRA 2FLKA 3KLGA 3SJJA 2WMYA 3H6GA 3IAYA 4CECA 3B6PA 3HM9A 3MECA 3MA0A 5TQ0B 3ZSWA 1T7PA 1Y1LA 1ZN2A 1ZYQA 4Z0NA 3TAPA 2FQYA 4MQFA 4BE0A 1CEYA 4M3XA 3AVFA 3OYLA 4CGDA 4CEQA 1MIHA 4H4MA 2MYNA 3AA4A 1NKBA 1U0SY 3JPYA 3NBMA 1J56A 1U49A 1LBHA 2FBYA 4MS4A 1KGSA 2DFEA 3SQ1A 4NYNA 2RF2A 3BBLA 4CHOA 2OPSA 4IKFA 4CK3A 1ITGA 1S6QA 4CJSA 3HPHA 2QXYA 3HVRA 2RPIA 4RK5A 5HRSA 3O4NA 2OENG 2FLWA 1KVAA 5KWSA 1SKSA 4KKOA 1F21A 3AO2A 4FLVA 2HVIA 2WRZA 3L49A 2VUHB 3KK1A 4DQQA 1HNIA 1EETA 3G85A 3V1QA 4KPYA 4MS3B 4XARA 1QP4A 1WAFA 2G8KA 1SL0A 1RT4A 1USIA 2X74A 4JAVC 2IPMA 4FLYA 2CWDA 1EXQA 4GMJB 4CJQA 1FFWA 4YP9A 1RBTA 5F64A 1QO0D 4CK2A 3DLRA 5JNTA 3F6CA 5EWLA 4CJWA 4MS4B 1NKEA 2OPRA 4YV7A 4HUGA 4B9TA 1D1QA 1DZ3A 5EWMA 1NJYA 3RVQA 3AA3A 3TMYA 2MYPA 3IP5A 3JVIA 3FGZA 3SI6A 1JH9A 1U47A 5TQJA 4CFAA 3HZHA 3KK3A 4M42A 2QSJA 4DTRA 2OYQA 1JKHA 1RDCA 3NGYA 1JHZA 2E4VA 1KSPA 1ABFA 2PMCA 2LIVA 3CM5A 1S1UA 3PY8A 4DSKA 3EYZA 4FJMA 3KTOA 4XFKA 3LP1A 5KC9A 4CJ4A 3LAKA 1IG9A 3S99A 3TAFA 4B9VA 1U2PA 2RN2A 3QIPA 5D3GA 4BACA 4KREA 1YIOA 3W9SA 2HHVA 1EWTA 3OYFA 3RVMA 3ZCMA 1ZBIA 4JASB 4YCSA 4S05A 1KTQA 3OMWA 4M3TA 3Q41A 3I8DA 4ETIA 2FN9A 2FW0A 3CKMA 3DI6A 4E0DA 4DF8A 2NZUG 3EDCA 4Z4CA 4N76A 1Q8IA 5EWMB 1Z26A 3CNBA 1U45A 4KQ9A 4RKRA 2B4AA 4KB0A 3NF7A 3CZ5A 1RBUA 3I45A 1LW0A 3SCXA 3N0WA 2O4IA 3Q7SA 1Z2DA 4WXEA 3RWUA 1N5YA 4DSEA 2X78A 4W5OA 4UHJA 2QV0A 1B92A 4J2AA 1FSPA 5DKFA 3P1GA 1Z25A 4BDPA 1GUBA 3EJWA 4OLBA 1KLNA 4BDZA 3KG2A 4L85A 4FJLA 4IDKA 3SZ2A 1MB3A 2FXIA 1TAQA 3SYZA 4E7HA 4WUTA 4EP4A 4CERA 4AHUA 1S1TA 2FBXA 1UDRA 1TK8A 2ZAYA 1VSKA 3LPTA 3QERA 3BRSA 4O5AA 3JS5A 3GBVA 2YKMA 2AYXA 1VSLA 4LE2A 3KTQA 3L2QA 5KC8A 4JOQA 4XIUA 3MXMA 2R7YA 3C97A 4CGHA 4RK0A 4OPKA 1KFSA 5PNTA 4DQPA 1J53A 1HQUA 2XY6A 1T03A 2CD7A 2Z1JA 1DLOA 4DMNA 3EULA 3O21A 5HLFA 4CHQA 3HL8A 1WSGA 3CFRA 3ZSZA 5KQLA 1KRWA 1ZITA 3K5NA 4W5TA 5C5CA 4RK6A
chains in the Genus database with same CATH superfamily
1LPPA 5BN3A 3NW9A 1NBIA 4E07A 2UDPA 3K58A 5JOQA 3MWJA 4R2MA 1LJUA 1E1YA 2OR3A 5E3JA 4B81A 1Z8FA 2PSEA 1ENOA 5EY4A 1HE2A 4WZBA 2C3YA 2JK1A 3WRWA 2Q3BA 2NZXA 4Q0MA 3QFPA 1J2YA 4L73A 4BMSA 3G8BA 4MRNA 3T0FA 2FSIA 4BYGA 1CQWA 1OPXA 3GIDA 4OTZA 4YQEA 3TFOA 5H81A 2AKEA 2V9PA 3GG4A 4FZ3A 5JICA 2QUKA 1KVTA 4UPDA 1E3JA 3C2QA 1KMHA 1N4AA 4E7PA 3NH0A 3B8EA 3KO8A 2Y1EA 4H3VA 3CMMA 3LNCA 5BQPA 1U3WA 3ENKA 1Q0PA 3UPTA 3G2QA 2Y9MB 3LQ1A 3ICCA 1WSEA 2C2ZA 4G97A 1TDJA 4MQMA 5LM3A 3KL4A 4O4LA 2BIFA 3BJIC 2IF2A 2OTJN 1X42A 2RH4A 3RS8A 4E09A 4J1TC 4URVR 5JMWA 4JU8A 5F9FA 3W2EA 2HUPA 1NP6A 1WKCA 2DFVA 1S3IA 4ISGA 2V9ZA 3E81A 4G84A 4WN3A 3PGKA 4DTSA 2J4CA 2QR2A 4UY8O 3HI6A 1NOZA 3T5DA 2XE6A 4JI1B 3RUIA 4F3TA 4GBGA 4M7WA 4EEXA 2GV9A 2J7KA 3Q40A 4AM7A 2XUDA 4P5DA 3EIOA 4AP6A 3KJZA 4NZMA 1PFWA 5JH7F 3IV7A 3IEPA 4D9HA 2AMFA 1V96A 1K4YA 2JG3A 2Q28A 4TSFD 5LLSA 3O4GA 1IQRA 1SC4A 1IY9A 2AFRA 4ID5A 2ID7A 2ZBRA 7AT1A 3VQDA 1K8RA 3IEKA 1T1JA 2AJTA 1P1HA 4H0TB 3WKCA 4UUPA 1PR1A 3ZDXB 1BMDA 4Y0NA 4GKKB 3A58B 4BRKA 3W0LA 3ND6A 4XIJA 1QF9A 1TIPA 5ANRB 4O0IA 1HR0K 1TQ8A 4JUFA 4XH9B 1J22A 1A98A 1DDGA 4FWKA 4UREA 5CVVA 3LDQA 2Q9CA 1AU9A 4AG6A 4EYQA 1Q6YA 1JYEA 5M2QA 2XXBA 3TIXB 3EZ2A 3C6UA 4NU8X 3C3JA 1MNQA 1Q7EA 2W98A 3DM2A 1EWYA 2Z57A 3SZLA 3T7TA 1P60A 4JVSB 3S7TA 2LSNA 1EFTA 1WUIS 5LBUA 3K6SB 1RMTA 3LC1O 4OLAA 1MC4A 4CFBA 4NCJA 3K1YA 4EW3A 1B6TA 2RI0A 4XUGB 3VR6A 1AVTA 2PT9A 2N46A 3D0PA 1HJRA 2PZMA 2YFKA 2YX1A 4LWZA 4UULA 1GQYA 4RJLA 2QD4A 4EPTA 3A1TA 3NEYA 1PQPA 5L4NA 1E20A 2VT2A 4ISFA 3U44A 4KPUB 1IKXA 2PNFA 3DKKA 2PSDA 2NXWA 4D0NA 1VKZA 1FQWA 3ROEA 2SECE 1OBCA 1ZO8A 4WK4B 5J59A 3RUEA 1R5OA 3WQHA 4OHZA 3V4SA 3OM9A 1RP1A 1JLRA 4NBUA 3EVDA 3M7IA 2FEKA 3JD4A 5JJLA 1DC3A 3NTVA 3H2ZA 3QE4A 4NLCA 4YAOA 3H5VA 3KOXA 3CZ9A 2AXPA 2GLTA 4LWOA 3IOCA 1PUIA 3MN5A 2JBHA 3QNUA 3SAHA 5EE0A 3VOBA 3O83A 5BN1A 3A1DA 1YNSA 2ZK7A 2ORVA 2LZ0A 1TCAA 2PTHA 3L9WA 3O8QA 5TGTA 1NGBA 1BG6A 4UU0A 2G8HA 2Z5GA 1QJCA 2P9SA 2YFHA 3WK9A 3Q7TA 2WFLB 4PL8A 3S0JA 3ND9A 1O7JA 2VDNB 5J2QA 2R47A 4KRYA 2B4KA 4RAOA 4Q3BA 1OX5A 4LOHA 3I0SA 1CE8A 1B0UA 1DDOA 1FFEA 4XLZA 2X76A 2BEUB 3COPA 4D8WA 1YONA 3O91A 1B15A 1T2DA 4IIGA 3X2SA 4XPZA 1QIFA 4GVXA 1KI9A 2UUBB 4FSXA 1KK0A 4TL6A 1DQPA 3MEDA 4G0NA 3K0FB 4C06A 1RQ7A 1TAHA 3BMNA 2E1PA 4TKVB 1LDNA 2A0FA 3LKZA 4MJ7A 4BNVA 2C2OA 2VDWB 5FFNA 3ETHA 4CM8A 1LPNA 1JS1X 1LRLA 5LR6A 5DULA 5H59A 3KZOA 3N5KA 4DSLA 1GKYA 3ZGOA 5CCDA 1YCGA 5IK2D 3EF0A 3PE6A 4PZCA 3QE3A 4U63A 2WWWA 4DLEA 1BFUA 2IYNA 3QLVA 1P2FA 4DF4A 1RBYA 4B09A 2FFAA 2W48A 3CVVA 3LD9A 3HKBA 1SBYA 1XMQK 2NU6B 3LM9A 2EDCA 2XTJA 4FMPA 3KSRA 4W82A 3HFGA 3MPOA 3S8EA 1XZDA 4PS1A 4RKYA 3CRRA 2D1YA 4H3HB 3DOEA 4IDCA 3P4YA 3L8FA 2P67A 3RC7A 5C4IA 1T9HA 5BOSA 1XXHA 3L84A 3SKVA 4RD6A 4YP1A 2P9NB 1DWOA 4PRYA 3UKUA 2JF0A 4ZAZA 1YE5A 1K98A 4ANFA 4PINA 2VJCA 3MHTA 1D2AA 3VC3A 4OGGA 4Q6BA 2J3JA 4HDRA 3B9RA 4CIFA 4B79A 5IC5A 2DCMA 3IEMA 3EGDA 2BF7A 1VSVA 4FYVA 3GWZA 1PKXA 4X85A 4CEHA 1O9BA 4DEYA 3QIOA 1REVA 2OHXA 3OLYA 2O2DA 2QWXA 2N1BA 3PX7A 1GCAA 1N5JA 4MQ3A 5AOCA 1OTHA 4G0XA 1E1RA 5DEIA 5F1KA 3ZGYA 3OEHD 5DGXA 2WDPA 5FOSA 1A2OA 1NONA 3UGJA 2ZSAA 2IHTA 3ZDZB 4O55A 3MCZA 4WKBA 5B1DA 1NULA 4HX5A 4YUZA 4UZSA 1TCUA 4Q4LA 4JLNA 3E9EA 2DECA 1PVDA 3CUYA 4DCVA 4UQPA 1B8NA 3JWEA 4KK3A 5DT2A 5FHQA 1G8AA 5F2OA 2W71A 4YALA 4QSMA 4B9UA 4ZD6A 1MO2A 3H08A 4KQWA 3WLIA 4RLQA 4PYOA 3QX9A 3HVUA 4NCHA 3JAKA 5CVDA 2CW5A 3ZKWB 1SB8A 3AKDA 4BDSA 5TMPA 4MQUA 1SHZA 3KJIA 4IXWA 1YHNA 3RO7A 5FB3A 3K9KA 3PR2B 4D57A 2GOYA 4A36A 3UXHA 1ISMA 1PG2A 5LD2C 3E0QA 1DBQA 3QWBA 5THKA 1E2GA 1RYBA 3N0TA 5ALKA 2OORA 4OYLA 1VLJA 4WX2B 1NM1A 1IVYA 2CFTA 2FWNA 2JRLA 3QEXA 4TKUB 3ZGNA 1IXSB 3AV9A 5E6SA 2E4ZA 2HJVA 4JEIA 2C58A 5KTMA 4HZUB 2FPGA 3ILVA 1I7QB 1ZOIA 1EI9A 2QMEA 5IJ0A 3VTAA 3T7AA 3N7UA 1R6AA 2EGGA 5FDLA 1TM7E 3K0BA 3CW2A 4I81A 4OQFA 3EGXA 3B36A 4MKFA 3ICQB 3BSYA 1WE2A 1Y8RA 2ZITA 1ONPA 5K3DA 3VQ6A 4XJVA 1YR2A 2EXXA 3QKWA 4CEDA 1OXMA 4Z4EA 3M6AA 2D5CA 2JRCA 2ZP1A 1ZICA 4C0WA 2A9JA 4MR7A 3KOMA 3KEGA 2BFNA 4LSMA 4L28A 2ZM5A 5FLXO 3GA5A 4LI3X 2QRQA 4PYQA 1XROA 4UXHA 3TRKA 1PLLA 1US8A 1PF7E 4EVQA 2WIAA 3TS1A 3FMIA 3BE5A 2JHGA 1JN0A 5TNXA 4KNWA 2YOFA 3SMPA 5JZBA 1QC5A 4WRRA 3EXHA 4L8GA 4Y2GA 2HOEA 4C8MA 1HL7A 3RANA 2CKDA 4CLRA 1G98A 2SCUB 5AESA 3KKSA 1DEOA 2ZBVA 3G5UA 4BTEA 4EJFA 4B0OA 3OYBA 3B2QA 2ZM6B 1NBHA 1WB6A 3H4VA 4FLUA 4UJ5A 3TW8B 3QNOA 2V7ZA 3UKRB 1A69A 2DHCA 1M83A 3SX4A 4C4SA 3AVKA 4IIFA 3P9IA 2F8TA 4X8MA 1X77A 2Z9CA 2TMDA 2I2BA 3IPYA 3FPAA 3ZQ6A 4B7AA 2BCEA 3O26A 2RAPA 5JD6A 2NGRA 2O8DA 4IG3A 1XK7A 3M2TA 4NCNA 3D6JA 3FCOA 2AN9A 3SV3A 3QBXA 3FNIA 1BMQA 1S2IA 2IIVA 1QH8A 1SCBA 5JAUA 1USKA 4FYMA 1F7VA 3K92A 2XNHA 2EWWA 2YRWA 3T3OA 4FWMA 1H8EA 3FZQA 4N3GA 1MTOA 3JVUA 1ONBA 4BNIA 16PKA 2AUTA 2Q6KA 4ND8B 3K30A 4ZI7A 2OYSA 3I05A 4HNGA 3UQYS 2IOFA 3ABIA 2B0CA 3QEBZ 3N76A 2P6RA 4HPWA 4YJKA 4R51A 3C7CB 1Z15A 2R60A 5DSXA 2OQVA 3D6TB 4YP0A 2YCLA 4XIFA 1Z2OX 2H59A 3MB5A 2GH1A 4PCAA 4YRAA 3RW9A 4ZHQB 4NULA 3JQ7B 5D01A 3E2MA 1I3KA 2E2PA 2G5CA 3QPVA 1T6XA 2JKVA 5AKGA 4MUYA 4QNMA 2D13A 1AURA 4EHTA 3HN7A 2WY2D 3BN3A 2QW9A 1GGNA 1RLTA 5D6OA 1YJNN 2X19A 4MB6A 1QFMA 2ZUBA 4KAFA 3WRXA 2P2LA 4LHWA 1GZ4A 4O4GA 4AJKA 2D00A 2XKKA 1NLVA 2Q7XA 3TWOA 1M66A 2ZJ8A 2F1HA 1W5AA 3HUEA 3KQOA 1X7GA 5TB5A 1XCOA 4MO5A 4L0MA 4L4ZA 4YOVA 1YT5A 2EFYA 1AGXA 4EPWA 3TSWA 2UXDB 5J2TF 4JC5A 1IG3A 2O2JA 3RSHA 3UKDA 3AHDA 1QQMA 1QHTA 4JEMA 4RS4A 3AF6A 3L6DA 3HBJA 3P2OA 3K72B 2K87A 5FADA 2XHEA 4FYDA 4HFJA 3I52A 2XAAA 3TOZA 1N9KA 1E77A 2F96A 4RG8A 1G21B 2OM2A 1JAHA 3A9WA 3O3NB 1XAGA 3BMQB 3DXZA 1WVMA 3KZXA 4FDTA 4UD6A 3WLPA 4DIDA 2C78A 2QRPA 4YJ2F 4YA6A 1KH2A 3R6WA 1FE8A 1V1RB 1NVVR 1DQRA 1DJPA 2QVZX 3COVA 3EEYA 3NYQA 1U0TA 3ABSB 4DXDA 1ZNXA 4F2SA 3SMQA 2G67A 4EITA 1FDSA 1HNZK 4EW1A 5FR1A 5C25A 2O0JA 5HCUA 3LCMA 2YMPA 3N2GB 2LD4A 3WB0A 3PEWA 4XH5A 3V32A 4H0XB 3OZTA 1AOXA 1KO8A 4WKNA 1IQ0A 1OIWA 4R9VA 4J0CA 4BMYA 4F46A 4X71A 2ZWHA 2VPZA 4CGGA 3K94A 4KQMA 3DLAA 5HS6A 3EOBI 3AVAA 4MMZB 1DFGA 1ES9A 3HCCA 3VO8A 4LMPA 1ZG3A 4D3SA 4G56A 1EHIA 3UV6A 1N6LA 3BWVA 3W6PA 3BA6A 5AH0A 1XTVA 3R3WA 1WCIB 1FVOA 4C0HA 1U8TA 1T1EA 1Z5PA 3O1JC 3TOXA 3GBTA 1TAUA 4NNOA 3G9ZA 1ZDMA 4NH4A 2C8KA 1WY5A 1L7EA 1SKYE 1GKLA 1BI4B 2ZJ7A 1XRJA 3DJYA 4Q0BA 5KGWA 1UPCA 4BRWA 1K9VF 1PR5A 2BTFA 1Q3KA 4F84A 5KAMA 3OC0A 1N8TA 3ROPA 1UPTA 1MG0A 4ZRMA 3QKRB 4P82A 1VIMA 1HNWK 5KTQA 5FFMA 1E6CA 1SS6A 2JIMA 2JGLA 4XR9A 4Y1CA 1M8PA 3ZDQA 4KQXA 4LF9B 4WT7A 3W4KA 3TSAA 3KVYA 4PANA 1E6KA 2YJTD 5IRCD 2HA5A 3K70B 3KX2A 5ECWA 1Z68A 2DFDA 3L2OB 2JGIA 3VYRB 4E3ZA 5EIXA 3DEKA 5TQVA 3ZQUA 4JKHA 4ZYVA 1YVPA 3P9KA 9LDBA 2WYIA 2G09A 2BFBB 3NIWA 3JX9A 4Z0NA 4JI4K 3USCS 5M1FA 3NALA 2SKEA 4Q93A 4L4RA 2QMOA 2FEOA 2E5FA 2F90A 3C4VA 4UM9B 3AA4A 4HLDA 1HG1A 2XMDA 4EG1A 3IB6A 5F4BA 4IKFA 3FZNA 4TYQA 2ETXA 8GPBA 1VI6A 4TSKA 4DJEC 5FH9A 1ILYA 4K9QA 3UJ9A 4K6FA 4FDMA 3PITA 4BATA 5EQJB 4K6MA 1ODSA 2VYVA 4MRSA 2YWHA 3IVXA 4DQQA 3L92A 4W9NA 4PVDA 3WMRA 1RT4A 2IPMA 4C21A 3C0KA 3IKLA 1RBTA 4L1KA 4WKOA 1L3IA 1F12A 4IICA 4HUGA 1NUHA 1D1QA 1M90O 1YQUA 2GCPA 2IVNA 3EEQA 4DTRA 1JFFB 1DO2A 4X8HA 1JHZA 2XTZA 3AK4A 3PFNA 3LP1A 3PPYA 3LWDA 4XVHA 2D6FA 3MDQA 1ZU4A 3KAJA 1RU3A 1HDIA 1NC3A 3HOTA 5CA1A 5A9TA 3G2IA 2R87A 4IKPA 3KHYA 3WO1A 5KTPA 1LPBB 4WUVA 4ZOQI 3G8CA 1QCCA 4ZIRB 4LCBA 3P9SA 3G8YA 1D07A 2PY6A 1A3CA 5E95A 3M4NA 4UM5A 2XVXA 5LA6F 3C1AA 4HF7A 1SQ0A 2V4MA 1R9NA 5DIFA 5IBCA 3NF7A 1HLUA 1DEKA 3I45A 3MTEA 2I6XA 3U7QA 3BXPA 2FRVA 1I3MA 4Q34A 3QW4B 4BLVA 4CCAA 1TCCA 3KSAC 1PQWA 3LO8A 3I1YA 5DPMA 3B5JA 2BUBA 3IC5A 2FBXA 4RIFA 3UC9A 3WI7A 2Q9BA 3BRSA 4IDEA 4PR0A 1RRGA 3O9TA 1KFSA 4BNMA 2IYUA 1V5GA 4HK4A 3QYJA 5AZIB 3SC2B 3WISA 1WMAA 5HLFA 2IJGX 1JQEA 2J9RA 2IUYA 4LC1A 5HF9A 3WGNA 3BY5A 4R2HA 2A58A 2CF6A 3P9PA 5K99A 1K8YB 4I4IA 4MARA 3E7PA 5KTRA 1AGYA 4MQEA 3K20A 5LU8A 1THZA 5TT0A 3ATUA 4AHRA 1FP2A 3VGMA 4QXMA 1MC8A 1PWHA 4Q6WA 1W9MA 1UDXA 2OP1A 1J5PA 2WWTA 5AFUA 3IURA 2Z2XA 7ABPA 3EXEA 1ADCA 2D5IA 1XAIA 2D3WA 3AP2A 4UUOA 1K1EA 5BPLA 2QM1A 3K1AB 1N2CB 3HXKA 3JQEA 2PFSA 1Z37A 4J43A 1Z6RA 4EMUA 2QWRA 3H42B 2IH2A 4I0WB 5AQYA 4IUBS 3RUFA 2DQKA 3QELA 1KVRA 5CZ1A 5LC1A 5B4TA 1G3IA 5JYBA 5HDBB 1QB8A 3AKCA 1QK5A 4P22A 5AZJB 4G85A 4D46A 3MSXA 4Q1CA 3VO2A 4MVCA 2FF6A 3DR3A 2PRIA 3DDNA 4YRKA 1RC8A 2H00A 2P78A 4OUDB 4MA5A 1VIDA 2R44A 4US1R 5TC4A 1M72A 4D4LA 4OV6B 1SKMA 2OHJA 1XQVA 3S8YA 3TIVA 4YLEA 2GHIA 3PIDA 1QP8A 2QAGB 2VPQA 4UM7A 3FOFC 3ID8A 3U9DA 2H1CA 2JFBA 3SUNA 5DP2A 4CJVA 3MTJA 5FA8A 2ZCJA 4G37A 4KSBA 3UHFA 4DA6A 6NULA 3DV9A 3F71A 3E9RA 2UZ3A 2AG1A 3ETGA 4HR7A 5I9SA 1E4EA 3BB4A 4F12A 1GD1O 3UMBA 3D0KA 2YFYA 4FW2A 3AM1A 3H5WA 3E3MA 3N74A 5JLJA 1I2BA 3IPCA 5ED4A 2DHEA 1QQ5A 1GLNA 1WXIA 2F48A 4GYKA 3G0CA 3A9VA 3F5MA 1N0VC 2O4UX 1JEEA 2UZ0A 3OQPA 1NVVQ 5CFNA 1CQIB 4HDNB 3O9QA 5IU6A 3HI0A 3KYDA 5JAMA 1ZJ6A 4CKZA 1L4GA 1UZUA 4YYEA 3CN7A 1PE0A 3A6GA 2II6A 3I3OA 1EFPB 2P75A 4LCJA 2RHHA 3MTBA 4WDQA 2AEMA 1YI0A 2BFFA 1FP4A 3WK8A 5KKAA 1R10A 5IT0A 5ALGA 2ZCVA 1C3XA 2VJKA 3O9ZA 2J08A 1MZPA 2JJ1A 1QHHB 1GCGA 3WNBA 3UZUA 5F51A 5AVTA 4X1IA 4EHKA 2ZRKA 4DLNA 4B73A 4RLFA 4UE2A 2AD5A 4CKWB 3AEZA 4GPBA 2O3UA 2ZQZA 1Y64A 3E82A 3VPDA 4JC4A 2DLDA 4MWEA 1HR0B 4Q82A 5EP4A 3T3EA 4KH4A 5CFMA 1KEEA 3AF4A 3E35A 2FSVC 4PFQA 1BWFO 5DLQC 3MUOA 2D1FA 3FJ1A 2DM6A 1FSSA 1RYMA 2RARA 5AUNB 1GU0A 2XUFA 3JR3A 3G2OA 4DF3A 1MWKA 3C6QA 1M8KA 1OWPA 1KJZA 2V58A 4FLTA 3BRQA 1W52X 2G80A 1JW9B 1ISIA 4NYMR 4IZIA 2QJRA 4OB8A 4R9RA 2Y3IA 4PWDA 1HEUA 3NOQA 4I1OA 4R9UC 4YNQA 1IK4A 2QWNA 2NSYA 5BUQA 2C82A 1ZN7A 3NOVA 1SG9A 1YJAA 1Q12A 2NYVA 1AMUA 1ZOLA 3HR8A 3GFGA 3JRXA 3LYAA 4YYZA 3M8PA 3MTAA 1EXDA 2NNWA 2W8BB 3DFFA 3THOA 3A1CA 1EZ4A 1HDRA 4R6WA 3BDPA 4MKHA 1CUSA 1B8OA 1PR3A 1KAMA 4DY6A 5A9RA 4TN5A 4UNQA 5AOAA 4YMUA 3HWSA 1PKEA 1M2VB 1F4LA 4Y9RA 1OLSA 2DOKA 3O75A 3PFCA 4GZ5A 2PEZA 3Q8KA 4DY4A 1GADO 1L7MA 3R3SA 2YS6A 4HAZA 5FNVB 5AM4A 3GU3A 3WGJA 2H3GX 2GZHA 3HDGA 3FGPA 1JZSA 4WKGA 3T3IA 5BV0A 1YFKA 4E1BA 3ZI7A 1UT6A 3V34A 1MNAA 3J81k 1ZBUA 5H68A 4CHGA 1HZJA 3D3NA 2OV3A 3QF4B 3RK1A 4IJAA 2XPCA 5G0WA 3PIRA 1Q7TA 5AXDA 1ZEJA 2QN3A 2PXHA 3GQBB 3EEOA 3GUYA 3A1SA 5JXHA 1AZWA 1PFUA 3OTIA 5JJBA 1H2AS 5B6PA 1VIAA 2XSZA 3BK7A 3ZHRA 2P11A 2HIMA 4C9BA 2AOVA 5AQPA 4Q1FA 3G2KA 4KXWA 1UP7A 1K6MA 1FPQA 2GELA 5E1OA 5KNCH 1FLNA 3OS0A 2QTFA 1KC8O 3W2FA 4OI1A 4C4OA 2I7NA 2CXNA 2CMGA 2B8JA 5TEWA 1AQLA 1CR4A 1I1OA 3VNAA 2ZE5A 5IW8A 1BJKA 1M2NA 2R96A 3EAGA 2C29D 4Q47A 2I6FA 4PQUA 2TYSB 4D4GA 5CYMA 3PHLA 3AV3A 2VJDA 3L4JA 5HUHA 2ECFA 2CC2A 3LLCA 3ETJA 1NC1A 2ZJ5A 1PGQA 1DG9A 3EDOA 1S2NA 3MCUA 5I7WA 4RDIA 1PIWA 5T4HA 2CHUA 1X80B 1Z0UA 4ND2A 1FVHA 3LDNA 1AGPA 3BHIA 2F9LA 3QXCA 4XDGA 5LNK6 3A0UA 1K7CA 3QJ5A 3EQ9A 2CVQA 1OJ7A 4PQYA 3H45C 3NU1A 3EIEA 3PENA 2M1ZA 3MW8A 3N7TA 3QPUA 4HBZA 1BMTA 4JODA 2I78A 1XMQB 3C15C 2C9MA 2DETA 4LIPD 4LKOA 3LUPA 4WQ5A 1KHTA 3NX4A 3VSBA 4OK6A 3TBFA 4HTFA 3LPLA 5CPBA 1TZJA 4IFVA 1K8KA 4YDUA 3PQDA 1PEKE 1RXCA 2GBLC 1D4XA 3H65A 1IZ8A 1ECBA 4LFAK 3UATA 1Y3HA 2GTPA 1OLUA 3K8YA 5B58T 2BZ1A 1TUBB 5ICFA 3BGWA 1N5LA 3UYLA 3DZKA 4CEJB 4KO0A 4UDNA 4A9AA 1T2EA 3ZHTA 1V37A 5F3WB 4KPGA 1EXVA 3FPHA 4ZI3A 5U4QA 1ASUA 2XKAA 4HAUA 4WCFC 4YOUA 2OG1A 1TK2A 4IO0A 4EUFA 2ZR0A 2XBUA 3H11B 1T9GR 4IOXA 4JK9A 3I9MA 1SD2A 3P0HA 2ZWIA 4ZOEA 1U4OA 3F47A 2OB2A 4RW8A 4DGQA 3LKDA 1YS2X 4YTEA 3STHA 4BQOA 1A5WA 4QOIA 4JX8A 4PHHA 3K15A 3NORA 1LDGA 3QF7A 6PFKA 2WIGA 4MJ3A 3RV3A 4DG8A 4OHXA 2CLCX 1QCZA 3IXLA 4DUPA 1UKEA 4QICA 5FEUA 4TTPA 5I4CA 4ETWA 4ZOCA 3JY6A 4IWYA 3V2HA 2E4LA 2ATVA 1N5RA 3CCLN 3PQ5A 2Q3HA 4JK8A 2FUCA 2MSLA 3PNPA 2HXSA 2WD7B 3T9BA 4IDOA 4AUMA 3E9CA 1Q44A 2R751 2Q6OA 2AJLI 3AVCA 2EQAA 2Q7DA 4FZRA 3TW0A 3SF8B 2XTMA 2AR9A 4A6XA 3AJAA 2DAPA 3F3YA 4C7VA 3EL2A 1IL0A 4HDSB 1PX0A 2HW3A 1MDUB 1JHPA 1R3UA 2P9PA 2JCSA 1XNRK 1VSBA 1EVLA 4EHUA 2EGHA 3AZQA 2EWVA 4F93B 5F1XA 3HMKA 4KODA 3JZIA 4S1PA 3T1TA 3GLGE 2DHRA 3L06A 4I9UA 2YXNA 2EX4A 2F9FA 2OVFA 2GERA 4CL0A 3WNQA 2ZJOA 2V55B 3Q7CA 3T7IA 2PX0A 5CCXA 2XJ9A 2MSNA 3CC4N 3K0EA 1TFUA 2X1VA 2JLZA 3TD2A 1CF2O 1CEQA 2Q5QA 2IYFA 6REQB 1W4ZA 5AKYA 2RAFA 4K86A 4V19S 2VUSA 3A14A 2QQGA 1ZCFA 4Z4IA 1RWMA 4LG1A 4WTOA 2VJMA 1NU6A 3HCPA 2ZSEA 2NW6A 3E70C 5H4GA 1P0MA 1Q0TA 1QU2A 4I46A 2HCFA 3SUPA 3OW2M 1FKOA 1C7JA 4H8KA 4OSOA 3AX6A 3V00A 3TRIA 4FKZA 2W6QA 4KI4A 2KQ2A 3SAGA 1ONOA 3HCAA 5AKXA 1FDOA 4G4SP 2Y99A 3GARA 1GU1A 5ADUS 1FNDA 3O8OA 3RRZA 2XA2A 4L4SA 3ES9A 1W1IA 2HHTA 3SM9A 1QIHA 2DJ5A 4UNNA 4PCLA 4GW6A 4II3A 1RI4A 3LVQE 3RTGA 1F0NA 3Q9UA 4AY5A 4DQSA 1NM5C 2VA9A 3DF7A 4DV1K 1Y8QB 2HF9A 1VL0A 3V7NA 3VH1A 4F5EA 5KYNA 3DQZA 1A04A 3CT6A 3ZN2A 1CRLA 4G1FA 4QDTA 2B5OA 3FRJA 4MDYA 5ALMA 3MILA 2IGTA 5L3SB 1QRUA 4JI7K 1MUUA 1NK5A 3VN5A 3SLRA 1D09A 1S4QA 3FTQA 3H83A 5UKDA 3TNFA 3ZT1A 1DAMA 1ZWLA 1XWWA 1SUEA 5CVUA 1B3BA 5IJAA 2W4MA 4YO7A 7MDHA 2AXEA 2ZRHA 4MQFB 4DTOA 4D80A 4LRTB 4QOJA 2PXCA 5CDFA 1ORHA 4IGEA 2H1SA 3I2HA 2ZYHA 4PCVA 1P1CA 1SCQA 1OA1A 4FYPA 4JP8A 2QOEA 1BKYA 1RNHA 1E60A 3DDCA 1P7PA 4BAUA 4F6RA 5HX7A 2JLRA 4HQNA 5LYJA 1A9XA 3U6KA 4HTLA 4FWSA 3KLOA 1OT5A 4OKEA 3Q2KA 4X6YA 3F8TA 1NVGA 3TINA 2Q3DA 3DBVO 3QI7A 3SBTA 4ARUA 1GSOA 4XX1A 4ZQGA 3JWPA 4KB5A 2TSYB 3CNEA 4C7OA 2BVNA 4FJIA 5EWLB 3DOKA 5AK6A 1JHXA 3P9ZA 3V1RA 3ESBA 3U3OA 2FG5A 3EQ6A 3G9QA 2HK6A 4YDRA 2E6UX 3NTLA 4I36A 4YQZA 1OW3B 5LIRA 2WP0A 1E2MA 4E13A 1NY6A 3JQ8A 1HZZA 3T3HA 3OCJA 4LVUA 1SEVA 1TRKA 2WYWA 3MJEA 1UFVA 2OO5A 3E5HA 3U9LA 2Y0CA 5T5QA 4H1HA 5CH8A 2J0EA 2EL7A 2HF2A 3KZCA 1U3FA 3NDBB 2BRUA 3SEZA 5EHIA 1IEQA 5DN6A 3SPZA 4HT3B 3JYNA 3SC3A 2G28A 1XHEA 3CKYA 3G0BA 1MJGA 1XRPA 4FYKA 1QBKC 2VT3A 3RMBA 1NQWA 1H3EA 3G9XA 1VJGA 4W99A 1F20A 1Z8NA 2HCRA 5FPPA 3T54A 2DBRA 1NI4A 3IIEA 5K8LA 3VSDA 4YAFA 2PMBA 1EVEA 1UJNA 4TT8A 4UBNA 4OUKX 4WIAA 3HR7A 4EP1A 3N8HA 3BE4A 1W4LA 2PJUA 1HK7A 5I45A 4MRAA 4KH6A 4K46A 4LEIA 2IVOA 3A6LA 1MO6A 1IULA 4WY8A 3R6GA 4CJKA 4LXUA 2XUKA 4L9SA 4KXFB 4BVFA 2NRRA 4HVJA 4BVKA 3N3BC 3BFJA 1NXWA 2V6IA 1XZKA 4PLWA 4EWLA 2R4QA 4NMHA 2KPOA 1TA9A 1DBIA 3V1NA 3LC7O 3E5RA 4BFUA 3I09A 4AF1A 1YHYA 1J2RA 4LHEA 2GWHA 2L17A 3M6WA 4IMIB 3RHSA 1P7VA 3I83A 1XCJA 1U1GA 1FFXB 1Q0RA 2BN4A 2N42A 4BMPB 1N7HA 4HY3A 3BQ9A 3PU6A 5GV8A 2C9YA 4FOLA 1Y9JA 1YBVA 5D1NA 1G41A 2E5LK 3FMGA 1UDCA 4J4TA 1MFZA 2NTNA 2IHKA 2VGNA 1XEWY 1OSNA 3D02A 1QNLA 1WNFA 3AKYA 2E2WA 3RYIA 3UIQA 5J4VA 1Z4MA 4ZO7A 3W6NA 4KACA 1FP1D 2ET6A 2WU3A 4I2NA 2NRTA 2O1EA 3N2NA 4F4JA 4RD0A 4DOMA 4UQGA 1PX2A 1V11A 4PSKA 1XDSA 4WECA 2VK4A 3T52A 4QPPA 3ZJUA 1Q92A 1RT1A 2FMKA 2FF3B 5IJXA 2EKQA 1GTSA 3EHDA 5G40A 3KUXA 4FSVA 1NZFA 1YFJA 3OLQA 3GEGA 2ZJFA 1EGVB 4FGKA 3LK7A 1HNZB 3CSUA 3H16A 1NG1A 4OJRA 3QOXA 1ISPA 3WSVA 3NHSA 3TLYA 1ESMA 1T25A 2JS7A 2RAUA 2E1YA 2FQXA 4EY8A 2HMVA 3ZK8A 4IHJA 4WNYA 3URMA 5B36A 3D6VA 4ZC1A 4KIGA 5AYVA 3AERA 1QWSA 5ITVA 4XGNA 1T10A 4V02A 4UVIA 4P38A 1DWQA 2IC3A 1DC6A 2HPHA 4N8DA 4GPIB 3MN1A 2FEPA 4DR7K 3BUSA 2LNDA 2EX0A 2H3EA 4IOCL 3F6RA 2HRDA 2XCLA 2AGVA 3RSEB 3MERA 4YRDA 1QTMA 1T5BA 4B9LA 3HDYA 1Z7EA 3OPYB 3IT3A 1JJAA 3BSWA 4DLWA 1OXSC 3IIKA 4ZVKA 4CIWA 5LLTA 5ADXA 3DLEA 1EDOA 1D4OA 4UBKA 3QEMA 1YTLA 3QA3E 5DM70 1MOZA 1P4HA 4G01B 5BRAA 4B3RK 4MH0R 1COWD 3VC1A 3F4KA 3UAZA 5F76A 1SQ5A 1QRDA 4F3KA 4RK1A 4I4TF 3IP8A 1HNWB 4HEJA 2GQ0A 3U13A 2F4VK 2QBYB 5JS8A 4KAAA 3TARA 2X9QA 1E1CA 1LPMA 4MKZA 5G53C 4A62A 4CHTA 2Q1NA 3SJUA 3AAPA 2WMYA 4JBXA 3H6GA 2H4FA 2YCBA 1JXMA 4BASA 1YU6A 3IYLW 2O9JA 3N2KA 2NACA 2C8LA 2Q99A 4ZOAA 4JUBA 1SKAA 4PPFA 4BZZA 4OPAA 5BOVA 4M3XA 2GPYA 5BWNA 3DZJA 1A9RA 3LBAA 2QENA 1KKUA 3DXFA 5HGXA 2R5FA 1NMEA 1X1EA 4CHOA 1BQ4A 4C0SA 3JSXA 4GO1A 2WD9A 2FPPA 3FOBA 4JI4B 4IOAL 3NJ8A 2OENG 1RT9A 4EH1A 1JVNA 4ENTA 3LP8A 2VNAA 1F21A 1BA3A 3CISA 4Y1FA 1IFXA 4LFBK 3VX4A 1UC5B 2YIJA 2FSJA 4FOIA 1E7WA 1ZL2A 5FUWA 2J5RA 2OV1A 3DAPA 1YRHA 1U7TA 1WB9A 5JZSA 5FTNA 5JSHA 1GFWA 4TLAA 3HXOA 3OBIA 1S1CA 3SSMA 4HEHA 1ZM3A 2ZAIA 1P5HA 1PWXA 4O2AA 4PX5A 3WEEB 1ZKMA 3CPJB 3SK0A 3U5ZB 3CV3A 5C4GB 5HFAA 3CM5A 5ES3A 4EHJA 3G2MA 4YP7A 4DCSA 2GN4A 5IKEA 4NK4A 2A1TS 3OZFA 5D3GA 3FHOA 1Y3IA 3I6YA 1LBEA 5IJ9B 3AFNA 3W5VA 3TZLA 3IGFA 3WKDA 3ZCMA 4A0HA 1RMQA 2P41A 1ZRNA 1TVEA 1Z75A 5T57A 5KX5A 3U9SA 4FGUA 1TFRA 2RK3A 1KAOA 3KOOA 3AARA 3TLBA 4G24A 4V1CB 4MUGA 1BXZA 1N1DA 4Y18A 1PJAA 2CMFA 5KYTA 1PFKA 1VB3A 1XL0A 1O6ZA 4RA9A 2JEZA 4BRZA 3RJ9A 3R5KA 4MVJG 3N0WA 4I6MA 4WXEA 3RWUA 2Y1XA 4W5OA 3EZ6A 4KE9A 4KYVA 1M2HA 3RYCB 4OLBA 2OGWA 4M0CA 3HRGA 4JCCA 1YA8A 1G55A 3SYZA 2ACVA 4BWFB 2QK4A 2AOTB 1XIVA 1E0AA 1VSKA 3LPTA 3QERA 4CBUA 2RHWA 4BU1A 3UUWA 5SYAA 1U3UA 1H0RA 1Z88A 4XRGA 2BBOA 1MO4A 3VISA 4GPEA 2CD7A 1I1QB 4YAUA 1SIWA 4DFDA 3ETDA 1KH3A 3PC6A 1NW7A 1OU0A 1EVZA 1S8OA 4MUIA 3TLGA 3F6SA 1B14A 5A6SA 3GJ7A 4Q21A 1Y8ZA 2W0SA 2WHEA 2P0AA 1Y4SA 1NAHA 3DZ8A 3GLIE 4HHTA 2EFEB 1V8OA 5GGXA 3ZE9A 2Q3JA 1PI3A 1VSEA 3GFSA 1BD3A 4R0VA 1IJEA 4O5FA 3A2MA 2ITMA 2HYIC 1O4VA 3NOOA 4L3OA 3CW9A 4PNPA 1W5TA 2Z98A 1SC1A 1UKBA 5LBIA 3P96A 4DPLA 1YAJA 2XUIA 3FTDA 2O06A 3B3FA 1H0KA 3M1AA 1RLOA 4DMHA 2HHHK 1KWGA 1ASVA 2OCBA 4QWMA 5DP1A 4RXTA 3B6IA 4F6CA 4CJTA 2JJ8A 2MSKA 3ADPA 4OHKA 5C1PA 4JV5K 2FTKE 1U0BB 3NJRA 2QYTA 2G82A 4WN9A 3MCAA 4JQOA 4B5KA 1XLVA 4GXTA 5AKEA 4H0YB 421PA 3P2IA 4I9FA 3UB5A 1CNMA 2PKEA 3LC2O 4MJXA 3R3JA 2HNDA 2CXOA 3ZXXA 1W5EA 4D3XA 3D8HA 1K08A 1E32A 2UVPB 4B1UB 4YR9A 2CSXA 4C2TA 1VYVA 1UFQA 3LIPA 4PLFA 5HBRA 3TLXA 1PQYA 2CFIA 1XMXA 3T61A 1SVLA 1IY2A 1NVEA 3ELWA 1DOAA 2Z3ZA 2HIHA 2KX7A 3GVCA 3SAFA 5ICEA 3EQ2A 4XM2A 1SBHA 5JYDA 4DM4A 2EATA 2WMDA 3B3QA 1UPXA 3R7BA 5AKJA 4I3FA 3DRRA 4S35A 2BM0A 4H0NA 2JI4A 3CZPA 2J9FA 3O7WA 1MRSA 3GOQA 3IKMB 2G7MC 4OQMA 1PN3A 1OH5A 2QKBA 4RF4A 2ZUTA 4G25A 4OB7A 4WXPA 5AW7A 1B6GA 3IX7A 2GEKA 1UIRA 1DP4A 1SKYB 2EVWX 3CE9A 4KRGA 1JEQB 1J5XA 2HSJA 4ZN6A 3KFVA 2JWKA 1RAFA 3BWDD 1ZM2A 3O2QB 3UWSA 1KS2A 5HKAA 1VKHA 3QK7A 2CBXA 1UMDB 2HJWA 3QOFA 3OS1A 1J0XO 1SKBA 3OUZA 5EMLA 3D7SA 2J6BA 1CX9B 2L18A 1KC3A 1NBWB 3IPXA 3LOUA 3LAWA 4GP6A 5E7JA 1ZZEA 4CEFA 4TWJA 3P5JA 1F8UA 4NOKA 3PFIA 2Q5OA 3D8SA 1PWYE 1OBOA 3RSSA 5CVJA 3OEYA 4Z7JA 2BJVA 1GEGA 3EUEA 3WNCA 2PS0A 3RPEA 3EXFB 2P3SA 1ZA1A 5DHRA 2BEVB 4QPCA 4YJHA 1NPTO 4EO9A 5DI3B 4D6PA 2DKNA 2D0AA 3MMXA 4W5QA 3BCRA 3ZOZA 5DCLA 1W4RA 1JLSA 3L18A 4D9FA 1WZIA 1W73A 4DTXA 1Q6ZA 3C6ZA 5I7EA 1LSJA 2FLOA 2K6GA 1QPZA 4U7WA 4FCYA 3C3WA 3GJSA 3HJUA 4AURA 4IJMA 5BSGA 2H2DA 4RACA 3UJ3X 4AJOA 3IEVA 2VF7A 4YMLA 3AEYA 2DYKA 1L1QA 3SY8A 1I3AA 3QBVA 4D44A 3CC8A 4MSUA 3TW6A 1H0HA 3G8AA 5EC8A 2R7MA 2OCXA 1UZNA 4HTUA 1CZOA 1E58A 1PR0A 2QG4A 2IUEA 1IUNA 3LPUA 3PRJA 2FLVA 3T15A 1WVGA 4PONA 3V8QA 5JTUA 4A73A 4XWWA 3NP9A 5I9NA 4ARIA 1JAIA 3V6MA 1KIAA 2C94A 2E48A 5ENDA 1YZQA 4RZHA 2JBAB 3T5MA 1P29A 5FLXA 2IBSA 4I7FA 3S5JA 3DWGA 2WF9A 3TLKA 2JGKA 3PRHA 1XQ9A 3MBKA 4DG1A 1WCWA 3GXBA 2F64A 4I6EA 2EOAA 2RGYA 1I10A 1TW3A 2R6AA 1E98A 4COOA 1U80A 4AKIA 4DSJA 2HL6A 4KMOA 2HHCA 1BISA 3MRVA 3L6OO 3SOZA 4EF5A 1ADBA 5CR9A 1ANKA 2WC9A 5EKTA 4RHXA 1DRKA 2PL1A 4U8GA 2PXXA 3PNYA 2DBYA 3OLWA 1UWBA 1YZNA 1SUQA 1RBRA 1XTJA 3WBFA 2ZIUB 5CFOA 3AHFA 3LBYA 5JMVA 2CNNA 3D7EO 5HBGA 1J5EK 3EYAA 3KXDA 2AR0A 1S1VA 1I3NA 5BRHA 2FFBA 2DWQA 1YE8A 2YVAA 3SU8A 1V1JA 5IXJA 3KU1A 2YL2A 1NXPA 1QV7A 4X20A 1KMNA 1N5DA 3J80O 3H1PA 3RWBA 1CEEA 3TF5A 5ALNA 5A5GA 3N05A 3WKAA 3EIFA 4WACA 2QRZA 1NA5A 2C03A 4L9RA 2BR4A 4U9HS 5KKCA 2PMWB 1XI1A 1CS4C 4AK9A 3AQIA 5JRJA 4JD5A 4CV2A 3IO3A 4FFVA 4GWLA 1XR3A 1SUPA 4HKTA 1B7GO 1QZ6A 4QJ5A 4OLHA 4NBRA 5K3EA 4LDJA 1GL3A 1FRVA 3N58A 4W4TA 1N33K 1EP2B 3S2IA 1R7RA 4C1NA 2XGJA 1A95A 3H75A 5JS1A 4GGPA 3LW7A 3MJHA 4WAUA 2ZTMA 2FAXA 4U4AA 1EWQA 4P5PA 3FGOA 2IUTA 5F4ZA 4L8FA 4EGFA 3CQYA 4JJ8A 4ZTFA 1Z45A 2DKFA 2J4DA 3OQVA 1GTRA 1JYSA 4LFAB 1XNGA 2C7OA 1R4MB 4DG9A 1JKFA 3VVCA 1XDZA 2PLRA 3OCXA 4LRUA 4EA6A 4EG5A 3L1KA 4JZYA 1IBCA 4DNQA 3LFTA 2QVYX 4J29A 1ZK2A 1BCSA 1B26A 3TQRA 2HQ1A 1E18A 2ZBFA 3NRJA 4MVJD 4TYNA 1U3CA 3VQ4A 1DARA 4WMLA 3DXMA 2D5AA 4ZYUA 2O2XA 5K0LA 3IUQA 5E38A 4D97A 2FZCA 1JFTA 3OC6A 1EWRA 5J4YA 3KLFA 1FXWA 5HZKA 2CMKA 1NVXQ 2LDBA 4H0CA 1JUDA 3QPWA 3QXXA 1VSQA 2CGKA 2ZLBA 4HZGA 1FFGA 1C0EA 5C7YA 1RABA 3S2ZA 2GZMA 3DULA 4BRPA 1FC0A 4L78A 1YS9A 1U2VA 5IKXA 3C5CA 3W90A 3RMAA 3OT5A 2IS3A 1Z36A 1R6DA 1H85A 4G5YA 3K4PA 5LXTA 1QF7A 3QUTA 1L7PA 4AZ0A 4OGKA 4TLDA 5IVKA 4C88A 2MHCA 4ZJPA 1IYZA 1JKMA 4CD3A 3WLTA 2ODNA 3ZZTA 4HN9A 3ELDA 3M4YA 4DA4A 1P39A 1U6JA 3R5FA 5JS2A 1N6IA 2ILVA 4KHYA 4CE9A 2GDZA 4CIDA 2YJ5A 3A6HA 5C8XA 1RXUA 2Q49A 1JFLA 4KVAA 5I48A 1XNRB 2HLDD 3PFGA 4IIBA 4OREX 4PY5A 3VC2A 2AV6A 1R0SA 4OP2A 3S2UA 4B83A 4MKGA 1U0LA 3H2YA 3GCZA 1EFVB 3H3FA 3W2HA 4OMFG 1NXTA 1X87A 1JWAB 3UXMA 2OECA 3I34X 4FI3F 4M36A 1WHSA 5K0SA 3UUFA 1T8UA 1BFDA 3DQQA 1C7IA 1VQ5N 3HFSA 4P98A 1KZ4A 3HYCA 2VNSA 4YCMA 4IH4A 3GJ5A 3RS9A 4B9EA 3A04A 5K0ZA 3VR1A 3U4QB 1JLGA 1KI2A 2I2FA 1NBMD 4YWHA 2D06A 5L7YA 4ERXA 4XGRA 1I7LA 1EFRD 1TEVA 5JNVA 1C9NA 1JVBA 1KE1A 2JVIA 2VK1A 3OIWA 1N9GA 3KTDA 3P4UA 1VC2A 4JH0A 2E89A 1NW8A 1SRRA 3CH6A 5I51A 1VHDA 3WXMB 2W6IA 2J0UA 4DYHA 4FEEA 5K6TA 4C5BA 4DWOA 4U7DA 1TRHA 3SS9X 3ORSA 5FBLB 1RBQA 2HW8A 1S8NA 2C5BA 4WQ4A 5EOYA 4WPGA 3GBPA 3BF3A 4JYAK 4BJHB 5K8TA 2JI8A 4GU5A 3A25A 1UC9A 4JR1A 3VNVA 2P2GA 1GN8A 4OLFA 1VFNA 4KDCA 3GEDA 2EDAA 3A1UA 4C8LA 4JR0A 1TW2A 4RW6A 2B4YA 5B7NA 3X1WA 4C0XA 1SUBA 2X5OA 1I51A 3B52X 1F0PA 4DV1B 3PICA 1E9AA 3RIMA 5KOYA 3OKFA 2WAOA 4IDFA 1H5UA 1F17A 3GK3A 3L40A 3THWA 4B33A 2OORC 4K2HA 1IBLK 5CB4B 1G99A 4PXAA 1J2UA 2P9ZA 4JI7B 1H2RS 1G3QA 5L6LB 1QPBA 4B3XA 5LQDA 1OASA 2J30A 3OYDA 4GX2A 3UJPA 4AT1A 1DSSG 3D3QA 4DLAA 4YFUA 3FPKA 2IYSA 3A3KA 1H9CA 1SUDA 4CF9A 4DHWA 4Q3DA 1L3TA 4CBVA 1KTVA 2JLYA 4PZPA 2VCHA 4IXTA 2OXCA 3KWLA 4ZT4A 1MTZA 2BR3A 4KI0A 2W5UA 4I2PA 3CSDA 2QIOA 1L8OA 2IYXA 4XCVA 3DBLB 1PFQA 4RXMA 1O5IA 1LWFA 3WK6A 1P2VA 2C1ZA 1UFOA 1V4NA 3AVIA 3NQ41 1ISHA 3A5OC 5FBRB 3SLCA 2I2AA 4BY9E 4FILA 4EFMA 1E5DA 1IN4A 1ISGA 3TTXA 2H2AA 1P19A 5AKKA 2V5UA 1O94D 2I65A 1WP9A 1KJWA 2Q1XA 5F1YA 1XUOA 1T2CA 3KK2A 2X3UA 1U0EA 2OFWA 3NXKA 4HVTA 2WKWA 1L5LA 5FLKA 4GKAA 4FT4A 4ETNA 1Z4PX 2IWHA 1ZD3A 1G6KA 3D6RA 2J3EA 4M8LA 2HFKA 3I8SA 2OKCA 2Q27A 1PP4A 1WR8A 3UYKA 2JW5A 1QSLA 2OO7A 2OCLA 4OXKA 5HVNA 1NK7A 4JLOA 3JQFA 5JY1A 3EZFA 3W8EA 3I9V6 3QVKA 1T5LA 4BWGA 2A30A 1Y4UA 4O4IF 3H4MA 5EZYA 4DIOA 5TDHA 2PV7A 1U7PA 3O4FA 3UXYA 2CLSA 3KZVA 5JVDA 4EYGA 1T2VA 8MHTA 5SYNA 2EBUA 1HMYA 2JGRA 3FXAA 3MUEA 5BSMA 4LYDA 3CTPA 3L7BA 4ALKA 3EZGA 4H08A 4YRCA 3AM3A 1VG9B 5AW0A 1KXPA 2HH9A 5IUNC 3OFND 4FXPA 1TVKA 1XG5A 2R85A 2OQRA 1BNCA 4GC9A 3CLTD 4YQFA 4MLZA 5JWOA 3CEMA 3R40A 4BGDA 2ETVA 4TYWA 1ZVKA 5I3CA 3OKCA 4B8WA 4A8JC 4FK2A 1HL3A 2X0RA 1L8QA 2CXTA 3OQNA 2I3GA 4KV9A 1R0XA 2AFHA 4RW7A 4BL5A 1RHJA 2VK8A 4EQ6B 2YNMD 4HAXA 3V3KA 1CLEA 3LM2A 4REOA 1BFKA 3AETA 3IL2A 4V2IA 3NDRA 1M10A 4CQLA 1S72N 4OIFA 4DR2K 3G79A 4U2CA 2JKZA 1IEWA 4L6AA 1M7HA 3BDAA 4OO1J 1VHJA 1KOFA 3I2JA 3RIHA 3VQAA 5ALEA 1SVOA 4GZMA 1AIPA 1RDWX 3ECSA 3HA2A 4ZQEA 3CNOA 4NDZA 4KK4A 3WLAA 2E5LB 1E9CA 1LV7A 3I30X 1BJRE 1J06A 2COUA 4AHCA 2JEOA 2GYUA 3ADBA 4O4LF 1Q22A 2DX7A 4LK2A 3LDSA 4K26A 4KO2S 1OPRA 1RPJA 1SC6A 5JARA 1ZN9A 3HVJA 5GAJA 1BH6A 4CL8A 2BLNA 3LO5A 2P9YA 2ENWA 2FN8A 3HGMA 4KCGA 1Y1RA 4CJLA 2HLHA 4MYRA 4HGRA 1YVDA 2DBVO 3FCUB 1S02A 1T1IA 2H54A 3GNTA 1PD0A 1RAIA 2RONA 4Y0AA 4OSEA 4UW9A 4XDZA 3GDQA 2R7NA 3RUHA 3CFPA 1XC9A 3FLAA 1C14A 3ZQ4A 4LJYA 5G0SA 5IVIA 4OHWA 1JR3D 4R7GA 5HNKA 4DLKA 5KO2A 3HADA 3HZRA 1WXXA 1WAMA 5E2IA 3MWYW 3LH5A 3PC4A 1QHSA 2VTVA 1H1TA 3DT8A 2GZ1A 1BXKA 3K1JA 2Q21A 3CVJA 4EFKA 1ZMTA 4EFNA 1L4FA 4WBNB 5B57C 4IIEA 3CC2N 1Z38A 1ZUNA 3FFBA 1TCVA 1WXEA 1L3CA 4XVQA 4DR7B 1H2BA 4JGGA 2AF4C 4CM3A 1PJ8A 3O4JA 1SXJB 4FMBB 2XCUA 1RT2A 2V7GA 1E69A 4M55A 1OFIA 1PRYA 1YCHA 1MH9A 1W85B 1XVIA 2BH9A 3GG2A 5EXSA 1CDEA 1GUAA 1BO5O 3A5MC 5PGMA 1ASWA 3QUBA 2BYTA 1FFCA 3DYAA 1MEOA 2H8KA 2QYOA 1QVAA 1GA1A 4BLSA 1JHVA 4B3RB 3QKUA 3B6PA 3HM9A 1V16A 1I13A 1TU4A 3GEPA 5H3LA 3RSOA 2B0JA 3PPIA 2O5RA 1RPAA 1ESCA 4BQIA 4H6XA 3I9LA 1MIHA 4R8KA 5HE8A 3LQRA 3SHOA 4CNBA 4DG5A 4BMZA 4JL5A 1U49A 3OM8A 1QVFM 3HC7A 1ZYUA 1ECPA 4ZT3A 1P7YA 1XMJA 2R8ZA 3DXKA 1E2LA 1NMZA 1W59A 1YZVA 4XUEA 4DCUA 4B6RA 2WI8A 3URKA 2VUHB 1SHUX 3QMPA 1G8FA 1YXQA 1CW2B 3VEVA 1XLUA 4AJNA 5LQJA 3D5QA 2XDQB 2GCEA 5E4FA 1UEJA 4QO7A 1NR7A 3CUEF 2V7UA 3HO6A 1N78A 2OA0A 3ZNNA 3OHMA 4AROA 5F7OA 5K45A 4LFBB 3R8EA 4YRNA 5KAPA 2RHJA 4PHGA 4W1PA 4PC1A 4ZXPA 3Q7PA 2OYQA 1MX5A 3T7SA 4UVDA 1ZMBA 5FL7D 4LYEA 3TVDA 5IT5A 1ZX1A 5I8WA 3EYZA 1FJ2A 1CUZA 3NCTA 1ZJ4A 1KWKA 3FYSA 2QXTA 4BACA 3E9YA 3V7FA 1K6IA 4FOSA 2X5JO 2HHVA 1EWTA 3RVMA 3MT8A 1GLCG 3NBYC 4I1IA 2KW5A 2QMZA 3ZDRA 4X60A 2UYHA 4IOLA 4LPSA 4JBYA 2ADFA 2B4AA 4HG2A 1SUAA 3WIBA 1R4NA 1N5YA 3UAWA 2WTBA 4ZK6A 4EMSA 2KLAA 4PWZA 1AUXA 1Z25A 5D86A 1YA6A 1CNFA 1GUBA 3V1LA 4L51A 3AR8A 2PBDA 2JAUA 4AULA 3B9BA 4CERA 3EW7A 5AJUA 4DVJA 3H86A 3G4SN 4FGSA 1UDRA 4YPOA 4O5AA 1T4BA 4UU1A 4H03B 3QWAA 1W96A 4E4TA 2H16A 1OD6A 3V4LA 1U2DA 5AT1A 4MPJA 1SZPA 1YR9A 1TMKA 1ZVJA 3KTAA 5DCUA 2C0QA 1SBCA 2RB5A 3OOHA 3KYCB 4HJRA 4CUKA 2P4QA 4D41A 3RYHB 1SR8A 2I1WA 4ZT7A 1ZBSA 1D2GA 3KEMA 2FR8C 4FMCF 1XDUA 3OFKA 3F9RA 1OAKA 1YUWA 4G1EB 2LTAA 1VHTA 2KTQA 1QZTA 5B2ZA 4FCTA 4B43A 3QQPA 1WMBA 5EZQA 1XTSA 3PIIA 5I3UA 1T0JB 3BAFA 4AG5A 3KD2A 4V0MA 3KE9A 2PYZA 3WGMA 5BR9A 1VCMA 4DV6K 3RABA 2I1QA 3ZCVA 4U5QA 2SBTA 2QLTA 1VCHA 4RYDA 1NJIO 4LJKA 4URWR 3LDHA 2PKXA 4Q9IA 1X1BA 3ISTA 3VM6A 5DO9A 4FFDA 3PGLA 1Z6ZA 4BKOA 4JI2K 3KFLA 3QPCA 5AHRA 1NNUA 3E3NA 2WC1A 1YS1X 3T3MB 4KDEA 1QSSA 1JG1A 2Q2OA 3SZGA 4LXHA 2AB0A 2Y1LA 2FSKA 3ICEA 4QYMA 3C6XA 2HHHB 2ZYUX 5A1TA 1YFZA 5IZCC 2HQOA 3DB2A 2ZDGA 2C59A 4BRUA 2WAAA 4E12A 4YRPA 3KPJA 4EPVA 1V3VA 4U02A 4X94A 1X9WA 2XRZA 4JV5B 5FUMA 5KHOC 4NBLA 3ZQJA 2XCRB 2NRWA 2QLBA 5H5JA 3L6UA 3M49A 4Q3NA 3NGLA 3WXIA 3V9UA 4FMDF 4NICA 4C04A 2QTBA 3B48A 2JLQA 4TLMB 3CZQA 4NZOA 1FU4A 4ACBA 1T3ZA 1OYVA 3TJRA 3A4IA 1LZKA 1AV6A 4MUNA 4RTOA 2AOUB 1T15A 3IBFA 5FBWB 2EW1A 2KE5A 5KNDD 1Q74A 1KIFA 4ZZIA 2IP4A 1QZZA 4OP1A 3W7BA 5L40A 4ER0A 1GHTA 4MP3A 3M6LA 4CKYA 1TQ4A 4L07A 4FYWA 3O5AA 3MSCA 2OPHA 3FHJA 1L5FA 4ZOLB 4IDQA 3A06A 4A8HA 4FQ7A 1PNTA 2FSPA 1WXQA 5KNBD 3PT5A 2R1ZA 3K16A 3L8HA 5FBHA 4XM1A 4OY3A 1HQDA 1UUFA 4FFBA 3D4LA 5F3DA 3FNEA 4B3SK 1T8WA 5FI3A 1DG1G 4HUJA 2YZMA 3K9FC 3L8CA 1PT5A 1Q19A 1WG8A 2WJIA 2IUUA 1HSOA 4WLOA 5GPBA 3PGXA 4C6TA 4F5ZA 4MIKA 3EVBA 4ZKEA 5HHTA 4FJHA 4WZAA 2QTVA 3BMOA 3CX6A 3UG6A 1TNDA 4UMDA 4LOIA 2D2FA 4IHAA 4DQRA 3KZ1E 5EZ6B 4ZVSA 2GJKA 3KYBA 4AS3A 4EGSA 3QBEA 4WY5A 5LB2A 4GE0A 3THYA 2IAJA 3V81A 1GPBA 5ALIA 1XI2A 3O92A 2X8JB 1ODLA 4BZXA 4LDNA 4YMTA 1NXSA 1O08A 3TZBA 2ZQBA 3LPCA 1RDDA 1KY3A 1YDEA 1A9QA 1O6FA 4BX0A 4EJSB 4GC5A 3IVMA 4GT1A 5IANA 1EP3B 4BFTA 2JC3A 1P0PA 3TBKA 2W2OA 1UJ4A 3OTHA 3TSOA 4G0OA 3I1JA 2QD1A 5CITA 5AQGA 1FBNA 1BCRA 4PZLA 2GPTA 5DW0A 1OZ0A 4FGWA 3ZIAD 2DR3A 3KLEA 3CF0A 4J6EA 3VPFA 4URXR 1N9ZA 3BA1A 4QLBA 1GPAA 5J58A 3L1UA 3KSZO 4CZKA 2ROQA 3UPUA 4UOQA 3ZJ4A 2GUIA 4KN8A 1OXKB 1LF0A 3KAQA 3HV2A 3AVTA 4YFVA 2I3AA 4OH1A 3VJKA 1F60A 3T4EA 1G5RA 3IKJA 1DXQA 4K9SA 2GASA 3RE1A 1DFHA 2XZPA 1RXSA 1AKNA 4KLCA 4E08A 4AS1A 1LK0A 2CVOA 3U7JA 3EH1A 1U1FA 3WQUA 2VDVE 5EJEA 4Q18A 1UJ6A 1XZJA 2HD4A 1ENPA 1TC1A 4BNLA 3MXTA 3Q7IA 1EESA 4YQYA 4F91B 1TKBA 2GEJA 1J23A 2R6JA 2OY0A 3QXJA 1ZI6A 1DE0A 4TS9A 4DDTA 2GBFA 1QIDA 3O3GA 1L5HB 2DT8A 3S28A 3T1OA 3AUYA 2OP0A 1S2DA 4ILGB 3OE7D 5D87A 2WMNB 3DS8A 1X3NA 1BHLA 1Z2CA 4YOYA 1J1IA 3WXLA 1L5OA 1EGAA 3A9CA 4BRDA 3DMHA 1OROA 2PBRA 1RVV1 2K2QB 4JVLA 5GINA 1RLJA 4EYSA 4RZQA 3PF9A 3D64A 3H7IA 4NFHA 3ZHBA 2CDCA 4DQKA 3ORFA 2ZWMA 4MWTA 5AXBA 2QR3A 2HF4A 3OHSX 2HKIA 2ZBQA 3DTNA 1RZUA 3GLIB