2YHBA

Crystal structure of the n. crassa qde-2 ago mid-piwi domains
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
433
structure length
368
Chain Sequence
VKVARPCRKIEKWTYLELKGSKANEGVPQAMTAFAEFLNRTGIPINPRFSPGMSMSVPGSEKEFFAKVKELMSSHQFVVVLLPRKDVAIYNMVKRAADITFGVHTVCCVAEKFLSTKGQLGYFANVGLKVNLKFGGTNHNIKTPIPLLAKGKTMVVGYDVTHPTNLAAGQSPASAPSIVGLVSTIDQHLGQWPAMVWNNPHGQESMTEQFTDKFKTRLELWRSNPANNRSLPENILIFRDGVSEGQFQMVIKDELPLVRAACKLVYPAGKLPRITLIVSVHYTVLVDEIFRADYGNKAADTLEQLTHDMCYLCPPAYYADLVCDRARIHQKELFDALDENDSVKTDDFARWGNSGAVHPNLRNSMYYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Mid-Piwi Lobe of a Eukaryotic Argonaute Protein
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Rna binding protein
molecule keywords POST-TRANSCRIPTIONAL GENE SILENCING PROTEIN QDE-2
total genus 125
structure length 368
sequence length 433
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yhbA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yhbA01
2MSKA 3LKBA 3ALYA 2NZUG 1KFSA 2J48A 3VQ8A 3K59A 4ELUA 1KVCA 2VG5A 1BVHA 1DZ3A 1U4BA 2JRLA 1PHRA 2E4UA 2IPAB 3AVNA 1ABEA 2GUIA 3T8YA 1K68A 1PEYA 3B2NA 3SJJA 3DI6A 3TARA 4BWMA 3DRPA 4MLDA 1Q8IA 4DWIA 5HQJA 4YO7A 3HDGA 3EDCA 1BDJA 3HV2A 2F96A 1N5YA 1RPJA 4RK6A 1EXQA 3ZSWA 5BRAA 3KKEA 1JWLA 5DKFA 1RTDA 3GBVA 3M8RA 5JNRA 3TAMA 1L5YA 3C3MA 5B3JC 3KTQA 3L3VA 3HSYA 2PZSA 2AJQA 4MS4B 4LZLA 1JBEA 3RMDA 3HEBA 1DBQA 3DZDA 3RVKA 3AO1A 2R4QA 5T3YA 3RVOA 4LDAA 4PY5A 4E19A 4EYOA 4KTWA 4HTUA 1S9EA 4E89A 2KZMA 4M3YA 3NNNA 4JB2A 3A3KA 4MS1A 1E6LA 3GA5A 3L2VA 1SD5A 3Q7RA 3N0RA 5EWMA 1A0OA 2ID7A 5HP1A 3TAEA 1LK0A 1UDRA 4N0QA 4NCGA 5KC8A 2LUOA 4RW6A 4BE1A 1Q9YA 3VQQA 1I39A 3RMCA 1L3SA 5KWSA 3OLXA 1XHFA 3MM4A 4F3TA 1S1XA 3O21A 3I8DA 3SI6A 4JS5A 4FE4A 3OS0A 4CERA 4FLYA 3TO5A 1ZHHA 3VA0A 1WSEA 1XWWA 2WB4A 4YLEA 4FZYA 2WJAA 2RGYA 4MQFB 3HK2A 3HVRA 3LUCA 3QELA 3THVA 3QELB 5DTEA 1S9GA 1JLKA 4DTSA 3VA3A 1NK6A 4MS4A 4LSLA 3P83D 1RT6A 3RVNA 4FJMA 4RS3A 2FBXA 4Z4FA 3T95A 1QO0D 3A10A 3WNFA 1MVOA 1TKDA 3H5OA 5JS2A 3OQOA 2L17A 3O2JA 5JNTA 4HHTA 3DLEA 3D0PA 5DCLA 3KD1E 3KLHA 2JVIA 5C5EA 3BREA 4YV7A 4H3KB 1TM2A 3VQ6A 2G8IA 2NT3A 4DTPA 2E4XA 4CJLA 4G97A 4B9UA 4I9QA 4PE5B 4MAAA 3M9WA 2PAFA 2JLEA 3RQIA 1RTJA 3IDOA 1REVA 4ZTJA 2MYPA 4PUOA 3NNSA 1NOYA 4WWHA 4N76A 4DLGA 4RU1A 3VQAA 1TKXA 1SKSA 3L49A 4FJKA 5J2NA 5B3JA 5J1EA 3LP0A 3LTEA 1NK0A 4MS3B 3RVRA 1JXBA 1DC8A 1S6PA 4Q5VA 4IGAA 1LAWA 5IBQA 4E7KA 3ZCMA 1BCMA 1KSPA 4S05A 1KVAA 2HQBA 4HUFA 2GWRA 4M42A 4CHQA 1SXIA 3A0RB 3QO9A 3LP2A 3OM1A 5I42A 1WNSA 2FMIA 4C8NA 4MFBA 1NKBA 4DN6A 3KLOA 4XLTA 1VSLA 4YFUA 1VSMA 4MR7B 4QYWA 3O1JC 4N5SA 3RMAA 5EWLB 1EWKA 3LP1A 4DQIA 3OY9A 5J2MA 4CEZA 3SNKA 4OJRA 1HQEA 4DFPA 3DOKA 4QICA 3LANA 4I7FA 4Z0NA 1BAPA 4Z9AA 3IP5A 2IGIA 2R47A 1LWCA 1Z25A 1WETA 2WOMA 5CNIA 2IPLA 5BRJA 1YT3A 2XO7A 3BRSA 2YKMA 2FBYA 5IUKC 1BGXT 1A5XA 1SV5A 3D45A 1JLEA 4B9TA 4G0OA 3QNNA 3AA2A 1M5TA 4FJJA 4IG0A 4BACA 4CK2A 1BIZA 3NH1A 2PE5A 1ZBFA 4KNYA 3IPAA 4TSXA 1QP0A 3SPYA 3AVFA 4CGJA 2ZAYA 1J5OA 1E6MA 4DLEA 1DCMA 2M1ZA 2BGGA 3O1IC 3LUFA 1D1QA 2HHSA 1ZBLA 3MXJA 2XY6A 4GW6A 4CHNA 2D0CA 3GV0A 2LBPA 1KVBA 1HRHA 2HVHA 2PL9A 1KLMA 1C1AA 3K57A 4CGDA 1Z12A 3UUGA 3OYHA 3TAQA 1TAUA 4FJLA 2KZZA 2ZQBA 1D1PA 4CEAA 4G0QA 1TAQA 1NK8A 3DBIA 3ASMA 1HYZA 3KK3A 3IS9A 2I5JA 4IF4A 4ID1A 5FWYA 4Z9BA 4ZYLA 4RZSA 3HO1A 4CJRA 4KRFA 5CNJA 4LE0A 4CJTA 2HHQA 3OVNA 5FWXB 1DBWA 1A5WA 1BQNA 4YP9A 1ZY2A 1QTMA 3V1OA 4KB0A 4KV7A 4O1HA 3FDFA 3SZ2A 1Y1LA 2KYRA 4FM2A 1NK5A 5HRRA 1NKEA 3M9XA 4CEQA 4YNQA 3BILA 1S1TA 4MR9A 5IC5A 3TAFA 1JFTA 1O1WA 3P5JA 1NKCA 1DCFA 2EX3A 1M5UA 5HROA 1ZH2A 2PUBA 4CK1A 3AVLA 4KTZA 5TPZA 4DQQA 2DTUA 2JVJA 3KLGA 4CFCA 4FJHA 4B9SA 2WMYA 3PX6A 5CZ2A 4G0MA 4LSNA 1LBHA 4LRQA 1VK0A 1JKHA 5FRMA 3LMKA 5TQ0B 3LZIA 4PZ0A 4E0DA 2VWJA 3FFTA 1NK9A 4EVSA 2G8KA 4EY3A 3JSMA 2WONA 1BDHA 3CHYA 3T1AA 4IFYA 2Q5CA 1HNVA 1FFGA 1RNHA 2VWKA 1Z15A 4CJ3A 2QR3A 1OXKB 3P1GA 5FWYB 2DY4A 3QEIA 3SQ4A 1EP4A 4XARA 1LJUA 1YTUA 4Z4HA 4DTOA 4DSKA 3E01A 4KVFA 4IBNA 1ZGZA 2JK1A 4DQRA 4NYNA 4Z4CA 1CZ9A 2YNGA 1WSJA 1B9DA 4M41A 3AVKA 2JGUA 1ZAYA 3LAMA 1S1VA 3Q15C 5IUJC 1GLGA 3EAFA 3AA5X 3H1EA 2JBAA 4B09A 1NJYA 3AO4A 1GOCA 1G15A 3LZJA 4MPTA 2OA8A 4FZZA 2E4VA 6ABPA 2FKAA 1XC9A 3ZT3A 2XY8A 3NBPA 1LW0A 5BQ3A 2X6SA 4WXMA 4F3OA 1LWEA 4E7JA 1WAFA 3SV4A 7ABPA 4GMJB 3KYIB 4M45A 4NV3A 4C8MA 1UA0A 4YRZA 1TJYA 1VPWA 3RVMA 3MEEA 3B6PA 1QPZA 3KLEA 3IPCA 2X7XA 2RJOA 3PO5A 5FROA 1BI4B 2HNZA 1VLZA 3LOPA 3HZHA 1SXHA 1TK0A 2ITGA 4YS6A 2DFEA 4RG8A 2I6FA 3OYCA 2Y1JA 4RSMA 1C6VA 5C42A 4OGCA 3EZ5A 4HUGA 4G0ZA 4EYGA 4AH9A 1ZVVA 3MQ4A 1IKVA 4RXTA 4LH5A 2QK9A 3RVQA 2CHFA 3HVTA 1I3CA 1C0EA 1RCHA 5TQ0A 1JL3A 2MYTA 3NHZA 2RN2A 3VQPA 1C0MA 4DTMA 1ASUA 4MR8A 4CBVA 1F4VA 1VSEA 3ZSVA 1JLQA 3DRRA 3C94A 4PA1A 1MB0A 3L8BA 4G86A 3CM5A 4KK4A 4TLLB 3U3GA 5DK5A 2NZVG 2O20A 1PUXA 4FK2A 1VSDA 3MEGA 4CF2A 1B00A 3OYDA 1KMIY 2AYXA 5HKOA 3H5IA 1CYEA 3MF4A 5FWXA 1ZGGA 3QERA 4AHTA 3LP3A 1ITGA 5ABPA 3OYJA 2VUHB 4FW1A 1FKPA 1VSHA 1VKRA 4L4UA 5CNKA 3KIOA 3FFWA 5E3JA 3AVHA 4MQEB 4S04A 1CEYA 3IAYA 1GUDA 5K14A 2Z1JA 1TK8A 4CEEA 1UA1A 3DRSA 3NF7A 4RXUA 1JDNA 3OJUA 1ISRA 3O74A 4I2QA 3KLFA 4RWEA 2L19A 1P6UA 5KRSA 3OYNA 1ABFA 3RWUA 3LUGA 5EU7A 1RDAA 4DFJA 4J2DA 4CHYA 2XY5A 1USIA 3G1WA 1BHLA 2E6MA 4H60A 2YV0X 2W42A 3KYJB 1LV5A 3DM2A 4IG3A 4OBBA 4NQRA 4XIUA 4CJ5A 4QYMA 5TPZD 3S3MA 4G0YA 1SKRA 3OLZA 2HNDA 3K58A 3NHMA 1HPZA 1KRWA 2YHAA 2YNHA 1BDIA 4CGFA 4C8KA 4DTJA 3NNDA 4N56A 4Z99A 1U8TA 3H1FA 4KK3A 4DU1A 3FFIA 3I5AA 2F8TA 3H5TA 4OKEA 3AVCA 1B9FA 1IKYA 4M3TA 4RW9A 1USGA 5FRNA 3P9YA 5J2PA 2HMIA 3PUFA 2ZWMA 4JRQA 4CF1A 2BE2A 1QKKA 4G1QA 3JTEA 3S3NA 2B5JA 2X78A 3CM6A 3SCXA 4HVJA 4N03A 1VRVA 1Z16A 2HNYA 1U0SY 3OS2A 1NXPA 1TVMA 2IKSA 3A2FA 4AHSA 1ZBIA 3F73A 1MB3A 4FM1A 4DQDA 3QEWA 4JA2A 4Q7EA 4QOZB 4E7LA 1NOZA 2MSLA 2RPIA 3OQNA 4DSEA 3S9HA 2PLNA 1NJZA 3OMXA 3LALA 4DFKA 1NXTA 2A9RA 5IEJA 3EY1A 1Z13A 4LE2A 4OVLA 4FLTA 3B6OA 3O3FA 4JAVC 4KTQA 1NTRA 3EULA 3OM0A 1R0AA 4KV8A 4I2PA 3KJVA 3QLTA 3DMJA 5TPWA 3S3OA 4M3XA 2IPMA 3CFYA 3L6UA 3FFXA 1XI1A 1KLNA 4DSLA 3V6DA 3GWGA 4OATA 3T3FA 1U2PA 3TAPA 4EYQA 4DSFA 1D4ZA 3RR8A 1X9MA 4AHUA 1JFVA 4HNSA 1JFSA 3H6HA 2PUFA 4JP1A 4LD0A 3CLKA 4Z4IA 1FFSA 3NGIA 3JYTA 1NATA 2B6AA 1NXXA 3CKMA 4WUTA 2GV9A 3T38A 3OYFA 1T8EA 5CYQA 4E3SA 3ZSOA 2XY7A 1JL1A 2B1JA 2QSJA 3QX8A 4MLCA 2OPQA 3H5LA 4J2EA 4D6YA 1K6YA 5FBKA 3H5WA 3JVDA 4DU4A 3HSTB 2G8WA 1IKXA 4Z4EA 3CFOA 1E2BA 2VG6A 5DLEA 4IMJB 1YMVA 3VNAA 3SUNA 3WNEA 5TQJA 3M8QA 3AVBA 3SAJA 2GI4A 1XWLA 3L2WA 4KI4A 3OO1A 1L3VA 2QVCA 1SRRA 5CHYA 4IKFA 3ITHA 5SWMA 1EKEA 4RK0A 1YK1A 3HJFA 4EVRA 8ABPA 3ZT1A 3TB6A 4DG1A 3HM9A 2ETJA 3OYBA 4ZHRA 4FB4A 4DS4A 4P1ZA 4CJKA 3DOLA 3D8UA 4QAGA 1QSYA 2HHXA 3PX4A 1KCFA 3CZ5A 3EQZA 3PO4A 1H9CA 4H8KA 2PUEA 4HYEA 1K66A 1NXVA 2Q3SA 2JVKA 4Y1DA 3DGFC 1RT1A 2OYQA 2RKIA 1RBTA 1TMYA 3DLRA 1X1PA 4YGXB 3MIZA 4CJUA 2FQWA 4F8RA 2OQRA 1RTHA 1JL2A 1CXUA 2FN8A 4KO0A 1ZBUA 3OYLA 4LE1A 4F06A 3SNNA 4DTUA 3O4NA 1RBSA 3KS9A 3HCWA 4OKKA 3KG2A 1AB6A 1PNTA 3S99A 4EP5A 3ILYA 4OPJA 3HP9A 1DCKA 2L2QA 4CFDA 2NUBA 4FM0A 4EZ6A 1Z18A 1LJLA 1RDCA 2E4WA 4DU3A 1RTIA 4W5RA 4H4MA 5EWJB 4ETIA 3ZSQA 4LDZA 2JB9A 3JY6A 4GVMA 1RILA 3KCNA 4RW7A 4HNRA 3K5MA 3V4IA 4K8XA 3SM9A 3RMBA 2FLWA 1URPA 4DS5A 3H1GA 1J53A 2PY5A 1QS4A 4ZPJA 1J9AA 5DMRA 4W5NA 3H5VA 3OQMA 2KW4A 3NF6A 2LIVA 1HNIA 3SQNA 4M3RA 3V9XA 1S6QA 3QETA 3V9SA 1KRPA 3I0RA 2HQOA 3ZSYA 4WT7A 3KKRA 4NCAA 1RT4A 2P9HA 1U47A 3N8IA 2Z1IA 4ELVA 2Y1IA 2PKXA 1TKZA 2IS3A 3O3GA 1W0HA 3I45A 4C8LA 5KRTA 2FSPA 2FEPA 1OXBB 1NXWA 2P1JA 4BDZA 4RK7A 3TD9A 2PUAA 3OS1A 3CS3A 4L8RB 2A9PA 5EWMB 4CIFA 2IAJA 3LUHA 4IFVA 2QW1A 2VK2A 2PMCA 1A2OA 2H0AA 6CHYA 1ZYQA 2IDMA 3LUAA 4FYDA 2CHEA 1ZN2A 1T05A 5JNSA 1C0TA 4CK3A 3OYMA 1F21A 3ROTA 3RRHA 4E7OA 5E41A 4E7IA 1MIHA 3D02A 2HHUA 2ZE2A 3DLGA 2DFHA 5HSGA 3L2UA 1DRJA 4RY8A 1QMPA 1QQCA 4PICA 4WZZA 5KI6A 3NGYA 1QQBA 1ASWA 2V0NA 4KAZA 2YNFA 4YCSA 4FJIA 4EVQA 2N9UA 1HYVA 4RW4A 4DF4A 3DLBA 1ZITA 3CU5A 2VYCA 2AYZA 3RRGA 4IDKA 3LWLA 4CE9A 3HYFA 3HDVA 4Y1CA 3ZT2A 2QKKA 2FVYA 4B9LA 3VQDA 3JPYA 4CGHA 3KJXA 3GL9A 2FC0A 4MQ3A 4CHOA 1ZDMA 3K2PA 5C25A 2G8VA 4MGEA 4OGEA 4JRPA 4DF8A 3LAKA 3QIOA 2G8FA 4JASB 2IYNA 1F51E 4LX8A 1T03A 3CG7A 3SQ0A 4HCBA 4EP4A 5C24A 5FBHA 3I09A 2MSWA 3MAQA 4CIGA 2FXIA 4CGGA 2JCGA 3TWHA 2FQYA 3A0UA 3ROFA 3V9ZA 1U04A 4TMYA 3NCIA 1KFDA 2RJNA 1JHZA 1NXOA 4B08A 1U48A 4OPKA 3G10A 4OTZA 1FFWA 4E1NA 2HVIA 4OKJA 3OJSA 2HB5A 1Z2EA 5T7BA 3AVGA 4FW2A 5FDLA 4CFBA 3VQ9A 1A5VA 4KZKA 3TANA 1IKWA 4O55A 3IP6A 3BBLA 1U49A 4FE7A 4BE2A 2Z1HA 2IOCA 2O4IA 4L85A 3V9UA 4CECA 5CNMA 3TMYA 3QESA 4MS3A 3ULDA 3QLUA 4MS1B 1PEAA 3MEDA 3JPWA 3KTOA 4KB1A 1RDDA 4J2BA 5CZ1A 5EWJA 1WLJA 4YWHA 3F9KA 1JLAA 4NCBA 3KLIA 4FJ8A 4JOQA 3N6VA 3LKVA 1TL3A 1AB5A 5IEBA 4ZJPA 2IPNA 3JS5A 3T6KA 1QSLA 2B4AA 2PUGA 2JBAB 3VQBA 2TMYA 4FVMA 3PV8A 3RVSA 5KQPA 4HNQA 2KFZA 2R25B 5EWLA 4FLUA 5IULC 4TLMB 1BQMA 3VQ7A 1SKWA 3MXIA 4UHKA 2RDMA 4LH4A 4B9MA 2LP4Y 3V9WA 1HQUA 1RT3A 1FXXA 4G0XA 3AO5A 4B9VA 4CJWA 4Q6BA 3QEKA 4UQGA 5DGCA 3K4HA 1L5UA 1D9FA 5CY4A 3NF9A 3M8SA 3AA3A 4KPYA 3OLWA 4KKOA 4QPJC 5JS1A 3K5OA 1TKTA 3QLHA 1L3TA 1S1UA 4J2AA 3F6CA 3QK7A 4PQUA 1APBA 3NFAA 1DJMA 4CJQA 3O3HA 1M2EA 1DLOA 3SYZA 3LDSA 1ASVA 4ZMSA 5IUNC 3OYEA 4IMIB 4RKRA 1CXQA 3SG0A 4WXEA 3C6UA 3CQ8A 2A1RA 1GOBA 3OYIA 3MXMA 4XAQA 4F4KA 1VSKA 4KHSA 1LBIA 3MYYA 3HPHA 1EWVA 3LWMA 3I42A 2PJUA 3O1HB 1TK5A 4FXDA 1YIOA 1WSHA 1D2AA 3OO0A 3AO3A 3ZT4A 3CG4A 4BWJA 3HPOA 4CIEA 4DMNA 1JLFA 1X9SA 4C8OA 2FMHA 1P2FA 3NF8A 4I9LA 4CEOA 3VQCA 4E7HA 2FEWB 4HCCA 4KMRA 1BIUA 3F6PA 5ED4A 1RBVA 3SV3A 4CEFA 4XFKA 2L18A 3GT7A 2LPMA 4O1IA 3OYGA 4FJ7A 1QP4A 3CZCA 2DFFA 4KHNA 2PYLA 3VN5A 1CLQA 4EZ9A 4DQSA 3SPZA 2FTKE 2G8HA 2E4YA 4Z0UA 4CJSA 2G8UA 3LUJA 4EGSA 4CESA 3QINA 2KTQA 1BI4A 2KFNA 1NXSA 3TX6A 1U45A 1WN7A 5PNTA 4CHZA 5KQGA 2QV0A 1A04A 3HT3A 3I0SA 2XHBA 4AHRA 4Q0BA 2CD7A 1JLGA 2D5RA 1Z17A 1TVRA 3BDPA 5I4CA 4EUKA 1BA2A 3ILHA 3KSMA 2P5OA 1FQWA 1UAXA 2WY2D 2IDOA 5JNUA 5GOTA 1P6QA 3CG0A 3KK1A 3LFTA 4OLBA 2MYUA 5IX8A 4RY0A 2CWDA 2Z1GA 3O2SB 1JXEA 5KQMA 1EFAA 3ZSZA 1TLFA 3VQ4A 3V81A 2EHGA 3KK2A 2F8SA 4Y9TA 4DQPA 2HHVA 3QLVA 4NICA 4AHCA 4DTRA 1VSFA 3UKJA 2ZD1A 4D74A 1YS6A 3WNGA 3DYAA 3URMA 2YKNA 1TV6A 4WE1A 4RW8A 5HRPA 1FSPA 3HXMA 3H08A 5TE9A 3HUTA 1BL3A 5TQ2A 3L2QA 3E61A 2QZJA 4CEBA 3SQ2A 4M3UA 1XHEA 3QX9A 3PX0A 3C6QA 5KGXA 3AVAA 4E7PA 3RVJA 1WAJA 4MR9B 3SY8A 4ETNA 4KHUA 4DSIA 3JVIA 4MR7A 4D6XA 2XRIA 1EWTA 1SL0A 3AA4A 2O4GA 2GX6A 3SUPA 3TI0A 4BE0A 3NH0A 2FBTA 1J54A 2FBVA 2M98A 5C5CA 3R0JA 3N75A 3AVJA 3QLVC 3IP7A 4FJNA 1QQAA 3DLHA 4O0JA 3VQ5A 2FW0A 5HRNA 4RXMA 3NDKA 1C0UA 1VSIA 5GQSA 1GCGA 1MAVA 3ZT0A 4DTNA 1I3AA 1EX4A 1BCOA 3U6FA 1GUBA 5SZTA 4BDPA 4KHQA 2RF2A 3CFRA 3C3WA 4ML3A 1SL2A 5I3UA 1QHTA 4OLAA 4CF0A 3CYMA 2FMFA 1Z2DA 5TQ2B 3LPUA 4FJ5A 3U3YA 1IH7A 4M88A 3KLNA 2GKGA 3H6GA 1RZRA 2A9OA 1DP4A 1R8JA 1WSGA 3O4QA 4ZMRA 4ZTFA 4G0PA 3L2RA 2OPPA 4F2SA 3AVIA 1EHCA 4YR7A 4RV5A 3HP6A 3G85A 3ZSXA 1NJWA 1M2FA 1RXEA 1GCAA 2FMKA 3RR7A 4KREA 4H3HB 1W25A 1DBPA 4H4OA 1QP7A 4DSJA 2WWVD 1JDPA 1WSFA 4O5AA 1IO2A 4TN5A 2E4LA 3IP9A 5HRSA 1RXIA 3K5LA 2A9QA 1JYFA 1DC7A 1LAVA 3BGRA 3TR8A 2R7YA 3CTPA 1IIBA 5KQLA 2FN9A 4JLHA 3OLYA 2XDYA 3O2QB 1HYSA 3K5NA 5KGWA 3Q41A 4M3WA 5KTQA 3SQ1A 2HW3A 3IRXA 2HQRA 1N6QA 4QCLA 2VUIB 1NK7A 1RT2A 4RDCA 2A1SA 4N0PA 3UK0A 1T34A 1JH9A 3KHTA 3MA0A 4B8AB 4ID5A 2PUDA 4PYRA 3N0XA 1LW2A 4CF9A 1BISA 3SUQA 3GBPA 3UIQA 1D5WA 3Q9SA 2HHTA 1KRXA 2QXYA 1QNLA 3KD5E 1S8NA 1RT5A 4PWDA 1Y97A 2OPSA 2X74A 1W9HA 4EYKA 3NAEA 2DRIA 1HEYA 4RY9A 2GBPA 1RZRD 4R5PA 1P8AA 3OMWA 1U2QA 2ID9A 1GOAA 2P4UA 1RDBA 4W5QA 3ISNC 4CJ4A 2IC3A 4FLVA 1IG9A 3NBMA 1DTQA 4KFBA 1DRKA 4M3ZA 2ATQA 2PL1A 1SXGA 2GBZA 2VG7A 3Q7TA 1ZESA 1LWFA 3K9CA 1RBRA 4PEVA 1JF8A 3QEXA 4FK4A 3CFPA 4RK5A 4ETMA 4NYFA 1SUQA 1TGOA 1JYEA 4KHWA 4CJVA 1L5ZA 1UWBA 3C97A 3N53A 5CYMA 2P5GA 2B4JA 2D0AA 3RTVA 5BR1A 2QKBA 3QEPA 3OYKA 4FLXA 1YMUA 3RVPA 2MYNA 4JS4A 1E6KA 2PUCA 1XHZA 1DG9A 1HMVA 3SUOA 4F11A 1S5JA 3KKSA 1RNLA 3W9SA 3O75A 2FEKA 4Z4GA 3OLVA 2HSGA 1T7PA 3LPTA 4MRMB 2E6LA 4IILA 3OYAA 4MRMA 4CJPA 3VQEA 3EQ2A 3TAGA 4XASA 4FK0A 2BDPA 3GRCA 5D2CA 4F12A 4IRXA 1FK9A 1Z26A 5J2QA 4XXHA 9ABPA 1S1WA 2WRZA 4FCYA 2HJ9A 3H75A 4F2RA 3ZSRA 3V1QA 1FKOA 3AV9A 1D5AA 4RKQA 4KQ9A 4JB0A 3C95A 4AHVA 4KQCA 3T19A 4RK1A 3PY8A 2FLKA 4MYRA 4W5OA 2H3HA 3QLUC 1ISSA 4ICLA 3F7NA 1SL1A 2NT4A 1USKA 5TPWB 4FJXA 4KHYA 5D3GA 4FZXC 1VSJA 5HBMA 4LY7A 1EETA 4O5BA 1NK4A 4FJ9A 5JNVA 5JNWA 2OPRA 4OG2A 1Q9XA 1JLCA 2QVGA 3HS3A 3TABA 4DADA 3G0ZA 1QE1A 4GNRA 2BANA 3EJWA 1NY5A 1KGSA 4E1MA 3AVMA 3HL8A 5F64A 1DTTA 4CFAA 3C3KA 5HLFA 1JLBA 2P51A 3QEMB 4FJGA 3GYBA 1MU2A 3QEMA 2LSNA 1CZBA 3RH0A 1PNRA 4CCHA 3QEVA 3NH2A 3N0WA 5KC9A 1QSSA 4ELTA 4CJEA 4MR8B 3Q7SA 4GPAA 1RT7A 2OZSA 4N47A 1TL1A 3VNBA 1QO0A 2QXFA 4CEDA 3EYZA 3M8PA 3NHGA 4B9NA 4MQFA 4CGIA 4BDYA 4DFMA 4P98A 4UHJA 1B92A 3C6TA 3L3UA 1CHNA 3LUKA 1C1CA 2OENG 1WSIA 3MECA 2X6NA 2E4ZA 2D0BA 3RVLA 3BRQA 3AO2A 4B8CA 1J56A 4B3OA 3DGEC 1YTAA 4CF8A 1VRUA 2QU7A 4RK4A 4DTXA 3MMNA 2KQ2A 1D9DA 3CNBA 4CHPA 1YVUA 4AILC 1VRTA 4HUEA 3E3MA 3EGCA 3HUUA 4MQEA 4O44A 3DLKA 4FLWA 4W5TA 3QIPA 4N41A 1RBUA 4O0IA 2IOYA 1HJRA 5HM6A 4KI6A 2WJWA 3CRNA 2YHBA 3QNOA 2FQXA 4KFCA 1NJXA 3HPGA 1C4WA 3FGZA 1YK0A 1X9WA 1KTQA 3EODA 2R48A 4K8ZA 2HHWA 4O4GA 4F8JA 3IG1A 3WNHA 2PYJA 4Q6WA 3V1RA 3M6MD 1UOCA 1ZH4A 1C1BA 3NGZA 1EAYA 1XHXA 3NE6A 1ZBHA 1YS7A 2YNIA 4FLZA 1JX6A 1L3UA 2OZMA 2HPHA 1D8YA 3FMVA 3LUDA 4CJFA
chains in the Genus database with same CATH superfamily
3H3JA 4LRSB 5CT9A 1DB3A 1E9FA 3DV0B 4BNGA 5IAOA 2QN8A 1TA9A 3Q0TA 2C4HA 4FOPA 4IH4A 3D6RA 3A28A 3LNTA 4IYRA 4ILHA 1KFSA 2Z56A 3HJCA 3E18A 2JCBA 4WBXC 4X7RA 3W8NA 3A8YA 3VQ8A 4B6SA 1YI8A 3JYPA 4KDEA 1G3QA 4ELUA 4O8KA 2GNPA 3PCXA 5JQGF 1XMQK 3CNEA 2QLBA 1PWZA 5DCYA 3F96A 5K0EA 5LU8A 1DZ3A 3IS3A 1SELA 1VLJA 4A8JC 1GLVA 3UE5A 1YJNN 1M8KA 3HCAA 1Q3KA 1UP4A 4JKIA 4V2IA 4AY6A 5D8DA 1SB9A 2HUPA 4BRKA 3LLSA 1S3GA 4OI4A 1U2SA 4B3CA 3MGCA 4R98A 3O8BA 1K68A 3W4JA 4BYGA 4Q19A 1D9ZA 4KO1S 5GOZA 3LDOA 3UC5A 4O2AB 1NYRA 1R6XA 5A3VA 2GNAA 2NUPA 2NTJA 2P2YA 4M1EA 2PX8A 3BSSA 3DRPA 2VDOB 3FGOA 4D57A 4DWIA 3DE5X 4EY5A 3QMLA 2X0FA 4QYXA 4ZXPA 4OX9B 4IBOA 4YLYA 5IHPA 4W5WA 4N7JA 1VBKA 5BR4A 2PK3A 2UVDA 3RUAA 3G88A 2J5KA 3DTNA 3HDGA 4GV9A 1PJ2A 3UQYS 3ZTYA 4AULA 4ZGBA 2MT9A 1N5YA 1ZBDA 1P39A 4R2MA 3RKSA 1RPJA 5BSHA 3OZVA 4Y2SA 3Q2OA 1QQOA 4PLFA 5FWAA 5CUQA 5JCOC 1LA2A 2W6ZA 3TLCA 1R5JA 2NIPA 3SQWA 3DV9A 2VK1A 4UDYX 5LSAA 5BRAA 4RVNA 4C0AC 3KKEA 5I7AA 4S1PA 5DKFA 1PJBA 3WQBA 4CCSA 3GBVA 4LCBA 2NO7A 2BY4A 3LPCA 2O7QA 1ESMA 4J91A 2P0EA 2WP0A 1PV1A 2D7CA 3L8CA 1KVTA 1Y3AA 3GGCA 4B1XB 1L5YA 2XTNA 3U31A 1U2TA 1XJQA 3C3MA 2DHCA 3IKVA 4XX1A 3KTQA 1WMEA 5IK2A 1UEIA 3AEUA 1A5BB 3D6TB 4IGKA 3T1TA 2BM9A 3HSYA 3R8XA 2AJQA 3SJBA 4B7AA 2A1TS 3L82B 1ZK0A 4BTVA 4GGOA 3KWGA 4LZLA 1B93A 1LNQA 1JHUA 2TRSB 5EZYB 4LFBK 2J59A 1EGVB 3EG9B 2GYUA 5F2RA 2FRDC 2WK1A 4R1LA 3A4VA 4MUEA 2ONKA 4ESVA 4KTVE 5GGXA 3RVOA 4E12A 3E9PA 2NLXA 1MA0A 5BR8K 1NVFA 4PY5A 4MCHA 3V6MA 4GH5A 3PJFA 1RKBA 2BZ1A 1XZQA 3I2GA 4B31A 1N2CE 1QIMA 1J21A 5CA0A 4KTWA 3QX7A 1S9EA 1D2CA 5ARCA 4C3UA 2I2CA 1WKVA 5KOHB 3E2PA 3LYUA 3L2VA 4RHUA 5ADWA 5AVOA 2YFYA 1R7RA 1VE6A 3HKBA 3HYTA 4MHOA 1DKLA 2PD6A 2XQGA 3EY9A 1OI4A 2OZLB 4WY2A 3ZGZA 2RG1A 1Z62A 3PUIA 2AZXA 4D96A 1L5SA 3FM9A 3GA7A 1L8XA 1I3LA 4N0QA 1D2MA 1I1QB 2CXXA 4WZBA 3UUFA 2KBFA 1YQXA 3L6DA 4EKYA 1RADA 3QTTA 3GJXC 4YAOA 4BHTA 5EJAA 2VZ0A 4B34A 3C6HA 5K3FA 3D4PA 4I5IA 1KL7A 4LOHA 3VQQA 3HP7A 3RMCA 2P6NA 4V0MA 1M3SA 2BR3A 2HY7A 2AK2A 3NI2A 4JMPA 4LCEA 1RJ9A 2P78A 1L3SA 1W73A 2YC4C 4D4IA 3I6BA 4MRNA 5D5QA 1TK9A 1OLUA 1RQPA 1S1XA 1K0UA 1YMQA 2DR0A 4KQHA 4O4LA 4UDXX 2WC1A 4ZT7A 4WFNL 1GLJO 3SI6A 1KORA 1VCMA 1IG8A 1YS1X 2QQFA 3DDHA 3K32A 1G6Q1 1N75A 3BWMA 4N7MA 1WY5A 4FLFA 5CX1B 1NGIA 2LIPA 3AR7A 4RMGA 1I7PA 3EPKA 1K92A 2D74A 2DT8A 3Q40A 5WRFA 4OUDA 4NZPA 1XLTC 4NDZA 5ALJA 1X7ZB 4FYYA 4DNQA 4OX9Y 4E51A 4R0VA 3WGIA 2FSKA 1BVRA 4PGGA 3VJKA 2JI4A 4FZYA 2PLRA 4MUNA 5F7JA 3U1BA 3CVWA 1UM8A 3O9MA 1C4KA 1SQSA 3HVRA 4K43A 2EW1A 2F3TA 3LY8A 4Y2VA 3SYLA 2V7UA 2IIRA 4L22A 1J99A 1YASA 3L0SA 1MO6A 3GQBA 4MCIA 3WWDA 2W2OA 1JLKA 2JGDB 4ZREA 2PO5A 5KWJA 4Q3EA 3KXIA 2CLHB 2ZB7A 1BX0A 3U4LA 4BRZA 1GPDG 1Y7HA 4BWVA 3PRKE 2J3JA 3GP8A 2I8CA 2JGIA 1HT2E 3EE6A 3FUWA 1KYVA 4LJ8A 3HP4A 4BGIA 1HURA 4RHYA 4KN6A 5LLTA 5UKDA 2VJCA 3LUPA 1IIRA 4NBRA 4Y1FA 1BCRB 3AVYA 3WYNA 4GX0A 4EFHA 1DQSA 1GP2A 4IDCA 4HSGA 3WL8A 3WNFA 3SSOA 1TUEA 1MVOA 1IXKA 1QHHA 1ZGCA 1Z82A 3GT3A 3H5OA 3IDHA 2CLOB 3I5XA 4QSMA 5K0SA 5IYZF 3ESBA 9LDBA 3GUYA 2CDAA 4MP3A 4PBTA 1B7GO 1Z0FA 2Y0CA 3T7ZA 1VIYA 1XLUA 4G4SO 3O6WA 1AIPA 1IQRA 3A2MA 4YRCA 4PIVA 3DLEA 3UM9A 3WLHA 5DCLA 4BLOA 3WRYC 4DE5A 1K9SA 4J7CA 4WQ4C 3KLHA 1T1RA 2FR0A 2J4CA 4S0ZA 3V80A 1Z5PA 4H3KB 1KYTA 4NE9A 4MO2A 2ATEA 1KWGA 2G8IA 3PT9A 1E9RA 1T4DA 2VEDA 4C29A 1RU3A 4REQA 5EX5A 5HCUA 5LXTB 1STOA 3GDQA 2V6BA 3HVHA 1YJCA 4G97A 4YCJA 1IM2A 2F7SA 2PQ0A 2X23A 4X0EA 1NL3A 4AM8A 4C5AA 4COKA 1PT6A 4JUCA 1RYBA 3HJHA 4FYKA 3VV3A 5TF4A 1UZNA 2Q5IA 3PZRA 5BN3B 1CVRA 1ZMTA 3ZE0B 3TSYA 5G1NA 5KTMA 2YJTD 2RE2A 2O8NA 2QT1A 3EH1A 3RQIA 2MCFA 2IX9A 1T29A 1OFVA 1XTKA 4KIGA 2Q8QA 3UXYA 3IDOA 5JJ5A 3R4CA 3OCJA 4I9UA 4MJLA 2IS4A 2JWKA 2FSSA 4ZTJA 2MYPA 4Q12A 5F9MA 2DFPA 3ZCTA 5K2OA 2FVXA 2G08A 4PAWA 4R01A 1NOYA 4JUAA 1Y6FA 1ZJ6A 4CMAA 4FFSA 4WWHA 3QHAA 4GHWA 3WLAA 4PKHA 3HN2A 2QUIA 1C7IA 1Y9DA 5CEFA 2P9TA 4TT3D 4D9IA 5U9CA 3GMDA 2OZKA 2IEAA 2GLXA 1ULSA 3F46A 4DR4K 2X4DA 4CIWA 4CF4A 2IXTA 1TCBA 4ALIA 1KJQA 2RHWA 3L49A 3TCKA 5J2NA 4R69A 5IAAA 3TXAA 3RUFA 3OVMA 3UKRA 1OU0A 3LTEA 2DLCX 1TQDA 3H65A 1L3IA 5EVZA 2AFRA 1IXZA 4KKVA 4MS3B 3TL6A 1JXBA 1S6PA 4E3ZA 3W3DA 4B17A 1PG5A 5TMPA 1BWPA 3RVDA 4RTLA 4E7KA 2I6SA 2ZREA 4D8WA 4S05A 2AE2A 2Q4OA 5HPYB 3JWPA 3HTVA 3HN6A 3TLBA 3QXSA 1GZSA 2QZZA 3TU5A 4G1VA 1CHDA 5MN6A 2IVZA 4CHQA 4ZI3A 1DUSA 2H00A 1ID1A 1JPJA 2GBLC 1GAEO 1P72A 2O05A 3DFMA 3PPVA 1WNSA 1FJGK 2FMIA 5DSZA 1UDBA 2YVAA 4MFBA 4CMKA 2EX1A 5K0BA 3I56N 2CLCX 1TVKB 1NR5A 1ZP6A 5SZJA 1KEPA 1SXJE 3WOHA 3ELUA 4OHPA 1XD8A 5ADXA 3GRVA 3KLOA 3F1LA 4OBEA 1MLDA 4XLTA 1NMSA 3SVZA 1VTKA 4F4IA 4PYIA 3HL4A 3TZLA 1U3GA 5FEUA 1ZD5A 2JZOA 4KWEA 1UDCA 4R83A 4N5SA 3OZXA 3Q6IA 1JA9A 2HLNA 1R4NB 4NCJA 4BXOB 4L95C 4QUJA 4CL0A 1V8FA 3J7AP 2XB2A 5EJ2A 1V11B 4K41A 4K28A 4C6SA 3CF5L 4OLFA 4GX2A 3SNKA 1QANA 1QK5A 1HQEA 3M4YA 3PF8A 4REMA 3H99A 3BY5A 2ZRAA 4GKKB 4R51A 1JRLA 3A70A 3L4JA 4GPBA 4K46A 4J3NA 1FMFA 1QVFM 1NC3A 3IP5A 5FKJA 2AMLA 4HUTA 2IGIA 2OHJA 2VJLA 4NU6A 1LWCA 2BSXA 5KSOA 1WETA 2IPLA 3DOCA 5KBYA 1OLOA 1LTHR 2QX9A 1YT3A 1TDJA 4X6LA 1K5DA 2F1JA 3ICVA 2PX5A 5CR4A 3VZCA 2IS2A 1RZ3A 1XXLA 4CKWB 1W4RA 3BRSA 4HDMB 1J2JA 1D4OA 1HETA 3TZKA 4OBWA 5T4BA 1R6UA 2W7TA 2NPOA 3LBFA 1LK7A 2FN7A 3OETA 1XOIA 3GVIA 4BVJA 5ELMA 4TTRA 4C7KA 4B9TA 1JBKA 3HY3A 4BWFB 4R2JA 1KDTA 4KMMA 2RHDA 1O0SA 1CY1A 4HRAA 2AF3C 5ANRB 4OM7A 1M5TA 4KR9A 1KARA 3R0XA 3KKPA 1XQWA 2H2DA 4PNHA 3GJ0A 4UJ3A 4CK2A 1BIZA 4POAA 1Y33E 1E18A 3MWTA 3U44B 1H5QA 3F9CA 3D2EB 4K9PA 2JH3A 4BC1A 1XBTA 1KY3A 2WWGA 4G5YA 4BL5A 1QIDA 3TLZA 1NE7A 3SYTA 3ZD7A 2ZJQL 4EFNA 2DY0A 1SVKA 1QP0A 3AEXA 2CXNA 2P4QA 2YZNA 4MVJF 4HDCA 4NBWA 3SX4A 4II7A 2H0QA 2XMPA 4UE2A 4OYYA 4A82A 4EJFA 3SPXA 1YULA 2PPLA 4RPGA 5EMNA 2CXRA 4ZV4A 4I3HA 4LI0A 2PCJA 3PPXA 1J5OA 2FA9A 2JAOA 4BB6A 4HLNA 1MPTA 2BTQA 3W04A 2G0TA 4BU1A 1DWOA 4ER5A 2XE7A 1QUFA 1ZK4A 2A1IA 2DYKA 1G55A 3E23A 4KBYA 2BGGA 3AETB 1D1QA 5GAEP 3Q9LA 2HHSA 3KHYA 3MXJA 4LZAA 4H77A 2OGSA 2WNHA 1BXGB 3HKCA 2JGLA 4HGYA 4TLCA 3NV9A 4XGKA 2X0NA 3KQMA 4V0RA 5T4FA 4AJJA 1M6EX 1U4OA 1EK5A 4JBNA 1O5TA 3NAMA 5BPFA 2D0CA 2QSUA 1POXA 1WD7A 2VH5R 1PQPA 5HF5A 1ULAA 2AJLI 3GQVA 5J2TA 2EJVA 2VO1A 2WINI 5IABA 5HOEA 2J7PD 3ID6C 4G63A 2XECA 1VCOA 1YZ3A 1TOAA 1NPDA 1JG4A 4Q15A 3GMSA 4FZ3A 4EJ6A 4UD6A 1E7YA 2KZZA 1CY7A 4UARA 4WCDA 3U7QB 3OTOK 4BRPA 3WG9A 2D54A 2AN1A 3ASMA 1OIXA 2ODTX 2P0AA 1SO8A 3OIFA 2PGLA 3IS9A 2JHPA 2PY6A 4CQLB 4FB5A 5KNBH 3K0SA 4IF4A 1T36A 1KQGA 5FRDA 3VHQA 3AHFA 3U9DA 1DI0A 5LDDC 1E2QA 4ZYLA 1KEEB 2J5RA 4R8SA 1WSWA 2B34A 4RZSA 1IXYA 4OQMA 1TKAA 1YUMA 4JI6K 2QUKA 3RK1A 1ZNQO 5IKPA 1M6VA 4O4IB 4DABA 5JH7B 1RHKA 4LE0A 3SBTA 3IAFA 5GONB 4HSEA 4CJTA 1CJKC 2QWXA 3CH7A 4RTPA 3ZCQA 4DSNA 4IYJA 3T1OA 4B3MB 5TSDA 1BXRB 2XXAB 2FOLA 4L5CA 1P18A 2BCGY 1BUPA 4HXFB 3DFKA 2M6RA 5EYPB 5I4BA 4J1SA 1F5NA 4NE2A 4WN9B 1BMFD 4L3VA 2XJ4A 4KB0A 4KV7A 1IJEA 4O1HA 3LF2A 3GVCA 5LMNK 3FDFA 3UJNA 2JAUA 4DR4B 5JI3E 3LKDA 4FM2A 1P1BA 4DSTA 2NVOA 3AB8A 3HYSA 4EF5A 3ZEUB 1KEWA 4YNQA 1FS4A 2FPGA 2PO7A 1JXOA 2XB6A 3BILA 4UNNA 2W71A 1ZS9A 4RFLA 1G2QA 1X0VA 1Z47A 4BO4A 3L4BC 1O1WA 1SOWA 2G6BA 3MRTA 1NKCA 3OHMA 1HE3A 4HWSA 3DMRA 1A71A 2A1TR 4W1SA 1GTL1 4IIEA 1ZH2A 3K6RA 3W5UA 4DYVA 4OJTA 2F43B 5G3ZA 4CL2A 5TDHA 4B5KA 2BFMA 4DQQA 4AG6A 4BCDA 2Q4BA 5IEJA 3KLGA 3CIOA 2IEZA 3HDYA 2ZEJA 3OQVA 3T5DA 1EESA 2Q9AA 4KXUA 1NUUA 2NYRA 4B9SA 2R5NA 4YPVA 4G0MA 1KTIA 2IH5A 1ELOA 4LYFA 1LBHA 4CRWB 4BO3A 1E2NA 4DLTA 1CIVA 4EKGA 4IFTA 2NO5A 4ZYZA 5LQMA 2B8EA 3NIGB 3PFIA 4L3QA 2BBSA 3WS7A 3LZIA 4FOIA 2FUG1 2NOAA 1U8CB 1YRBA 2J9FA 3M70A 2OAQ1 1IZ7A 2IUSA 2D5LA 4BQFA 3PD1A 2QTNA 1QGOA 5IT0A 4QM6A 4TKZA 4LBZA 4EVSA 3P7MA 4P2GA 3A2LA 4FFRA 4IDFA 1XZ8A 3D8HA 4O0LA 3CKYA 4JI3B 5BW4A 5H02A 5KSPA 4B85A 1BDHA 1AQIA 3HWSA 4FFOA 4F2GA 2P2ZA 4BBJA 2O2IA 5JBQA 4A0QA 4IFYA 2VRWA 4RX1A 1E8NA 1RM4A 3STHA 1G7TA 5DLPA 2Q5CA 1GNLA 2YZ2A 1IHOA 3PDIB 1TEHA 3N2LA 5FUXA 3MK6A 3GDWA 2VWKA 1NJ1A 1J2EA 2A88A 4NEHB 3GCZA 2C92A 4BP9A 2QR3A 1R6DA 1SZDA 1FOEB 2A92A 2KLHA 1EJ2A 2WFZA 1CW2B 1ZCJA 3K0CC 2NADA 4TMTA 3P97A 2A4KA 1OW3B 1N5MA 1Z74A 2GPAA 1FRFS 2O2DA 3H7IA 3QV1A 3D0QA 1XNRK 2HBRA 2RHOA 1PZEA 3I0MA 4XARA 3A05A 1B6GA 1YTUA 1UEXC 2ONYA 4I1UA 4DTOA 1V47A 3ESCA 1XZJA 3GP3A 4LZJA 4Q66C 5AKEA 5HP4A 1NNEA 4YJ2F 5H4GA 4NYNA 3EQ8A 5AKLA 1ZVKA 3SEZA 4DC9A 1ULUA 2VCPA 1NW8A 2OOKA 4F84A 1IEWA 1R59O 1Q12A 5HMLA 3P2YA 4IQ8A 2YNGA 2Z4RA 3ZCVA 1BQ3A 4OOFA 5D01A 1R0SA 2ZWIA 1CUDA 3I12A 4D9CA 3KV1A 3SVTA 2JGUA 2GVDC 1S1VA 4WQ5A 3VKWA 1MGOA 4BS9A 3ZEUA 2FPGB 2VT3A 1NBME 1GLGA 1RAGA 1X19A 1P9OA 2Q1TA 5ICGA 3AA5X 2O3UA 4BDSA 2XLCA 3H1EA 4N0DA 3PWZA 3IT3A 4PAGA 5EY4A 5GADP 1CJMA 1Y5MA 2XQJA 4K9DA 3ZDZB 1HO3A 1X8LA 2EP8A 3IPXA 5EOYA 5FV4A 2HJRA 4MPTA 2GDZA 4IG4A 2X0EA 2WFBA 2E4VA 1L5MA 3BVPA 3BFJA 5IJ0B 1JPNA 2C3OA 1XC9A 3GRFA 3PXEA 3NBPA 3FHJA 4G5RA 4FYIA 1IB0A 5E4YA 4AKTA 4D5GA 2IHUA 3WDSA 4L2IA 4C43A 5LOVA 1QG6A 2VSYA 2Y68A 3IQZA 4WCFB 3PC4A 4B6RA 2HSZA 4I1RA 5HCIA 2HJHA 3RYHA 4DLXA 2XUOA 2FPRA 2IW3A 2QDKA 3DUFA 3F4KA 3KVNA 1SVLA 2CXSA 2WYIA 3R3SA 4GZLA 4QPNA 1UPUA 1WAFA 2JJ1A 1T1JA 3CR3C 3O03A 3O4IA 3Q98A 4QO7A 5LJWA 5ILQA 3V1UA 1P9WA 4H5NA 1ZJZA 2WWIA 4JV5K 1OTYA 3NM5A 5DLQC 4J94A 4DZZA 3NX4A 1C1XA 5EUMA 3KAJA 2I2WA 4RPKA 1PG2A 3KFXA 5EKSA 1A8IA 3DVQX 1F14A 1YRAA 2B9VA 2FG5A 4OHWA 3B6PA 2GD1O 3T35A 5CIWA 3G9QA 4HKTA 5CGQB 3REFA 2C94A 4MUAA 4NG5A 4XRGA 4TZ0A 1ESCA 3EXG1 4KFUA 4DR2B 4C7OA 5KO2A 3KQHA 4M1OA 4HWOA 4YC7A 4U67L 3PUZA 5KQ8A 1GXSB 2HBKA 1T6NA 2OE2A 1X2EA 3LOPA 2W2VA 3EVDA 4FJ0A 1R88A 4ZO4A 1QOZA 1UBTS 4QFMA 2J4RA 1OFIA 1L1RA 2PU5A 3VZBA 4DFDA 1TK0A 1WXXA 1EVEA 2AYYA 3L1HA 3L7IA 5FX2A 2J9GA 1A8UA 4DCMA 1P3DA 4TL6A 3MS4A 4V1CA 3KJFA 3OYCA 1J9GA 1T8TA 2CHQA 1O57A 1O1YA 1C14A 2EFCB 4EKEA 3D3KA 3IUYA 1DV1A 1UJCA 5SV2A 1C6VA 1U6JA 1FB5A 1RKQA 4GIBA 3V4FA 2YYYA 3VR4A 4G5OA 4G0ZA 1U0BB 3KXDA 3WBBA 4IXTA 1IKVA 4QJIA 5JLJA 4RXTA 4LH5A 3SMPA 1V95A 4Q5IA 2CHFA 4CGZA 3HVTA 1JQDA 2P7HA 1I3CA 1A98A 3G49A 2OT3B 1Q86O 2VP6A 4JC0A 2C5HA 4QNNA 5CU7A 5AWFC 5JAOA 2CF6A 5AQQA 3T3HA 1JL3A 2XUKA 2QE7A 4LGMA 3W6NA 5I7SA 3VPXA 5CA1B 3WGVA 1KPIA 4TLEA 4QOGA 4ER7A 2JF0A 2I7XA 2XRMA 1XTJA 2HHHB 3VQPA 121PA 1JPUA 1SOUA 1ASUA 1U7HA 1P2DA 1YJBA 4MR8A 1RWNA 5GMOA 1F4VA 3CEMA 3MOSA 4BVAA 1D2NA 2PMEA 3ZSVA 5M7EA 4AKGA 2BHNA 5FT9A 4F6RB 5BWNA 5JY6A 3MJEA 4C2BA 3OECA 1JEOA 3ORSA 1K4KA 4C01A 3E5HA 5C8XA 1RCTE 3PNBA 2VPIA 2AOTB 4AZTA 2QYHA 5A0TA 4UAJA 3GRPA 4BR9A 2IA5A 4KK4A 1P8JA 4G41A 1XWFA 2VPZA 4OP2A 2Q2WA 3QKUA 1WBDA 2AE1A 3U3GA 5DK5A 2TS1A 2VDMB 4MKHA 4KE8A 4QRHA 4F4JA 3RSSA 3SLKA 4M3NA 3M5DA 4FK2A 1SS6A 3FLCO 3D6HA 4FI3C 3QVUA 4I4TF 4OXKA 4U9UA 4WNCA 4G5XA 5TEVA 4QFCA 2VYND 1M33A 2X9GA 1R74A 5HKOA 1KYQA 2P2GA 2QP9X 2V59A 4DTCA 4IIUA 3QPWA 2XCSB 4JKFA 1GUFA 4UDOA 2IDZA 2VPYA 1AXRA 1RFQA 3PTZA 4UUPA 5A05A 1UDAA 3C16C 1LV8A 3CLUD 4FWMA 1QX3A 2DY1A 2AEJA 5JLAA 4D44A 4FW1A 1PLJA 2YIMA 4HUJA 2V4MA 3WJ7A 3NWEA 1VSHA 2D2IA 3CF4A 3LT4A 4KO8A 4L4UA 4A2PA 3DC2A 3EUFA 1RM0A 2Z2KA 3BCSA 4KXFB 1YS4A 3W0LA 4KGVA 1BHJA 1RWWA 1TQ8A 2MIIA 4HHEA 4MQEB 2DKFA 3NDIA 3IAYA 2FF6A 2DULA 2PZAA 5K14A 1WXDA 3PL1A 4G4JA 4Q24A 3VPBA 1MP0A 3EGWA 2VPWA 4IHKA 2YFHA 4AS3A 4AWBA 5HUJA 1PDOA 5BQOA 4J9UE 1UA1A 1I5RA 3W4KA 3DW3X 3WJ2A 1SD2A 1ZXOA 3CX4A 3NYRA 2PMDA 3SBEA 2X77A 3H19A 1WLYA 1W2HA 5BXQC 1V45E 3IEKA 1V1RB 3TTCA 1FFDA 4AZ0A 1YC5A 3IDSA 3RJ5A 1PLKA 4AX4A 5C7LO 4AQ7A 5HIJA 1H8HA 3O74A 2VDRB 3C74A 3G79A 2H1RA 1PK8A 4EO4A 2AXNA 4BLQA 2O2ZA 2QX6A 5D85A 4Q9AA 4JLSA 5HNKA 3QEOA 4NV1A 4C3OB 3K5PA 1SUFA 2PS0A 3SJZA 1W7AA 1RDAA 4DFJA 3KQWA 3S7TA 1HT1E 2H11A 1CUWA 2PUWA 3C0KA 4KQXA 2GM3A 1USIA 4WY5A 3TJMA 2Y0EA 3DBVO 1JLLA 1M9NA 3DXYA 1EYZA 4H60A 3ZPXA 3TNYA 2C7PA 4U7TB 2ZROA 2Z57A 4U6NA 4WOPA 4IXNA 1IDOA 2FN3A 3GFQA 4OBBA 4GQIA 3G13A 4NX2A 1ZLXA 5JARA 5TKWA 4G84A 4O1MA 4PINA 3WQHA 4D4JA 3ZX0A 1PZXA 3WRVA 4EA6A 4CJ5A 1AD2A 2APJA 4AJ9A 1Y6JA 3EQ6A 2JIZD 1V16B 3SJHA 3GZNA 3FHTA 1F8XA 4A92A 4C4RA 1R6BX 3K58A 3ZK7A 1SM4A 1X1EA 1KRWA 3UIEA 4YMSA 1RE1A 4CV3A 4Q3LA 5KEIA 4DVJA 1MFZA 2HBJA 4C8KA 3K3PA 3NNDA 2JATA 4JNKA 3ZV5A 3M1LA 1A7JA 1N6HA 3CCFA 4HAXA 3GLRA 5FA5A 4C0LA 4Z1MD 1QIGA 4DRYA 4KK3A 4DU1A 3KB1A 2F8TA 3H5TA 4QUEA 2EGUA 2Q3DA 3GJTA 1P1RA 1JDBC 1KSHA 4C0QC 1XJ0A 2Y76A 3WSVA 821PA 3LK6A 3Q8LA 4ZHSA 4BKRA 1R0CA 1EI9A 1HM5A 5G0UA 4KSYA 2ZWMA 1L4UA 2OCDA 2BUPA 1Q83A 3D3WB 4LKRA 4MW7A 2OXIA 1GTSA 3QUTA 3TL2A 3ZDYB 4DCHA 5BR9A 4JRQA 2V7XA 3NIBA 2UXCB 1OI7A 4YMVA 1SKQA 2XAUA 3NU1A 2W6KA 1LW6E 3LPAA 2O8DA 3ORYA 4D9MA 4ZIRB 3BIOA 4OI0A 3S41A 4PL8A 4OSEA 3WP1B 4R6WA 3S3NA 3AVPA 1TUYA 2B5JA 2X78A 1N0UA 1YBMA 1IMJA 2Q4RA 2Q6KA 3BAZA 3OFVA 4QOHA 2D59A 2NXEA 1SUWA 4V0QA 1U1EA 1WU8A 4COOA 1L7PA 4IHJA 5K05A 2HNYA 3P32A 3UJ8A 2REOA 3IMKA 4EO7A 1MPXA 1O2DA 5ALPA 3KYCB 1N6RA 1EFRD 1WHTB 4LNHA 4XKJA 1NXPA 4EHFA 2IKSA 1GAJA 2QWOA 1SBQA 3KE8A 2P68A 4X00A 1FLDA 2YUIA 3L5OA 2Q3CA 3F73A 4C05A 4EKDA 4FM1A 3E9ZA 4ZZ0A 5JBNA 4BB0A 3QEWA 1IUPA 2B6HA 1KIAA 1Z0UA 2WWYA 3NYWA 3IQHX 3GR6A 4ZK2A 3OIVA 1IN8A 4MWSA 2QJTA 1H8HD 1ZK1A 3F6RA 3NEJA 4IHQA 1NJZA 2LZ0A 2YV1A 5A4FS 1UAAA 3UJCA 2Z6QA 4NABA 4BZXA 1HQYE 2GK3A 4HPWA 5DVZA 3I73A 4GI7A 3ST7A 3IQIX 4X93A 3ZQUA 4DFKA 1TQ6A 1XNGA 4PWZA 3VR2A 2V74B 3ML1A 4XQ9A 4C4OA 4WIAA 3BORA 4Z7NB 1XTBA 2OL4A 4LE2A 2ACVA 3K9LA 4BAUA 1J97A 2AKEA 2JFQA 5CIQA 2H57A 2DTEA 1T9KA 3KFLA 5B1SA 2HCBA 3S7ZA 2X8WA 2NV0A 4R8KA 1EO1A 1PYDA 3Q2KA 3QKIA 1W0JA 1Z0ZA 1ZNWA 5AM4A 4DMHA 1NV9A 3RWOA 1ATNA 4XVCA 4PHTA 4MGYR 4FFDA 2HO4A 4OFXA 1GAWA 2YRXA 3S3OA 3M49A 4A6EA 4M3XA 4QBFA 3ND5A 4ALKA 1MB2A 3L6UA 1QRDA 3FFXA 2JFVA 3WLFA 2GARA 3FAZA 1Q16A 4TL7A 3RT9A 4DWVA 4ZI7F 1F8YA 2KBEA 4URVR 3G2JA 4GY2B 3GWGA 5KYWB 1U2PA 2CZGA 5EI5A 4CW7B 3BEOA 2H7CA 4DQUA 2SBTA 4DSFA 3J7YP 5IT4A 2XPCA 1PO7A 4N12A 4DV3K 1DX6A 1VLQA 2HSDA 3TLAA 4RTNA 3CN7A 2PUFA 5FOWA 4H18A 1EQYA 3PBKA 1ZRSA 1OH7A 2GA8A 4OIMA 4Z3KA 5EIEA 1NBIA 3DEKA 3AV0B 3NGIA 1TAHA 1PJTA 4UUOA 5FXMA 4F5EA 4LPKA 4K6HA 3DZGA 4UBNA 1E3WA 1NXXA 2OHGA 2Q07A 4WFJA 3FNFA 4LTDA 4ZJYA 2V51B 1FDIA 1T8EA 1HEUA 1RWXA 1RI2A 2C03A 4F9EA 4DV6K 5BPHA 2X1HA 3SZLA 3UK2A 5KWVA 3KQQA 4MITA 3IMEA 2WB2A 3ZSOA 3IPRA 2QSJA 3FOAA 4E21A 1MWKA 2OPQA 3H5LA 4J2EA 2GHQA 4ZZ2A 1FXSA 1II9A 4D6YA 4NYIQ 5F4BA 3UHJA 3B1ZA 1DJOA 5FBKA 3SSNA 3ZK8A 4DIOA 1BMDA 3ISVA 5BRDA 1NZFA 3KL2A 1QQ6A 4MW5A 4P7BA 1PI3A 1T9BA 4FFMA 1WRBA 4RJLA 1ORVA 4YFVA 4E1VA 2ZBEA 2HPVA 1JJIA 2B0JA 2PBRA 3OURA 5HF6A 5KMGB 2FSVC 1W76A 4C1NK 1SBYA 1PWEA 4WGFA 4NBNA 4WHMA 2OCAA 3STVA 1FQKA 5KCMA 3ZVKA 3EDQA 3O5BA 2EX4A 1IKXA 1E3EA 2XMQA 4GLBA 1WV0A 4R4JA 5ALHA 4C0BA 3PNKA 1E2BA 4IMJB 2GJ9A 1AZSC 1XDWA 3HJNA 1U7OA 4DSOA 1QFMA 1H3EA 4PZEA 1CXZA 4D45A 3AP1A 2QRVB 3WNEA 1I9CA 2BEVA 2HLDA 5E6UA 5TQJA 1EGHA 3KEFA 4HR7A 5A0VA 3K70D 3I5YA 2ENWA 1XWLA 3L2WA 4DCUA 1N4AA 3OO1A 3W9YA 5EKUA 2BP7A 4KR7A 5ADXH 2EQBA 4W9RA 5CHYA 2ZBUA 2VSQA 4JKYA 1EKEA 2MINA 1B0PA 1VKJA 2DHDA 1L7MA 3SFTA 4NMXB 4RK0A 1YK1A 2WUSA 5CW1A 2ZZNA 4EVRA 3NBUA 3L6BA 1U28A 3H0EA 8ABPA 4Z7QB 5LBIA 3RRJA 4LJRA 3EGIA 1QU3A 3ZDAA 5LJVA 4DG1A 1IXSB 2ETJA 3ZHRA 2P6PA 3FKSA 5BV0A 4TTSA 4OJQA 4CM7A 5I7UA 4U39A 1K5GA 2BEKA 3HR4A 1P7WA 2BKUA 4GWKA 3KYBA 3M5RA 5AZIB 1WXWA 4QU9A 2A4MA 4CJKA 4J0GA 4BNWA 5CB8A 2Z8XA 1QG4A 5EVJA 5KYWA 1OIWA 5T64A 3CZ5A 1SAZA 1JUDA 3EQZA 4QRIA 4UUNA 1G8KA 2RKBA 4K86A 1E5LA 2JIDA 1EK1A 1AHIA 2IYUA 3CISA 3K2IA 4NLLA 3ZI0A 3FR8A 5FBRB 3A58B 2FK7A 2HJSA 2B4KA 4M7RA 3PR1A 3QE0A 4B3XA 2PUEA 4AKHA 1NXVA 1OTXA 4MVXA 1V4TA 3IIJA 2JVKA 3D7RA 4CM9D 2C8JA 1DC4A 1RT1A 1E3JA 3CLRC 4IV0A 2OYQA 3PNQA 4LA4A 2JGMA 4YACA 5FPPA 3NWOA 5LBUA 4WACA 5JMTA 4FGJA 5GIPE 4F5WA 3AAPA 1SEVA 2IEBA 1RBTA 1GQRA 1TMYA 3DLRA 1WSAA 1Y48E 2G04A 3GDFA 5DU2A 3E9EA 3OG9A 4JI7B 2DWPA 3DP9A 5K0NA 1NBHA 2XDQB 3HABA 5ECWA 4CFYA 1FRZA 1BDBA 1SIOA 4D99A 4O0MA 2O0KA 2UUAB 1I80A 2O52A 5TNXA 3T94A 1YRYE 2IGTA 2OO7A 3QXHA 3OE5A 5I5GA 3ZDXB 1DPFA 2UUBK 2YXLA 2PXXA 2I5PO 5AM3A 1K8KA 2J41A 2VDUE 2WUWE 3AC0A 3CR8A 3ZE2B 2B78A 2JD0A 5KNCA 1OVGA 1RKXA 1ADGA 2EJUA 1ZJ4A 1VE3A 4J0DA 1G8FA 4MWZA 5COAA 4BQSA 4HDQB 5EHGA 3VMFB 3OLCX 5H3CA 4PO1A 4Q9KA 4MUBA 4C1NI 3LHDA 1RE0A 4UAUA 5DTRA 3WKAA 3O4NA 3GMTA 3KKQA 1X7ZA 5CDFA 1IHDA 5JQWA 3SBGA 1JLHA 1GPNA 3C41J 3FTPA 3VSEA 5KYNA 3FLBA 3KPWA 4L28A 4OKKA 1FLNA 5JG7A 4ARAA 2X2EA 4R2XA 3RC1A 1SCAA 3EEYA 2EW8A 5E7JA 3UMRA 4QTUB 3V48A 3THWA 2OFXA 3T06B 4U5XA 4UBJA 5KYUB 1Q82O 1CR2A 3L79A 4QFDA 1TFRA 3S8YA 1SXJC 3U7FB 3OBBA 1R12A 3HCCA 5B36A 1U9ZA 1RDCA 1LH0A 1RBQA 2X41A 4DU3A 3JYLA 4UUQA 3EXHB 1BFDA 1FDTA 2DBVO 3FHOA 2V7YA 4GKAA 1M90O 3DNFA 3G5LA 3HBTA 4M9ZA 2QY9A 2A0FA 4QUIA 2SCUB 5EWJB 3SEAA 4F91B 2JCVA 1CNFA 1LCUA 5JAQA 4KPEC 3DDWA 1VSVA 1MO3A 2YCLA 1KI6B 1B8NA 1RYNA 2DUUA 1REQA 1DWQA 5FJIA 4BMOB 2DOKA 3D4OA 4HNRA 4M76B 2ZBDA 2ZULA 4HTAA 3VBCA 4LOKA 3V4IA 4FUTA 1ZOOA 2ZIGA 4M0UA 4BFYA 1KMCA 5B1IA 1G8SA 2CV1A 1AGXA 1JS1X 1GLLO 2C1XA 1JWLA 2VXCA 1WULS 2ZRIA 3QI7A 1P4SA 3BRWD 4Y9RA 1ZYUA 1BW9A 3LHSA 1UBMS 2O2CA 4HG2A 2O1XA 4PR0A 3OX3A 4LYYA 4DS5A 4QLOA 1L5WA 1USWA 1OVMA 2C4WA 3UAOA 2C58A 2AC2A 4HADA 1VLLA 2DBRA 1LK5A 2ZJ7A 4G24A 4IPTA 4K1LA 2H7YA 2VRCA 3IX7A 2CK3A 2QZ4A 2VDNB 1JKIA 3WX0A 4M2LA 4ACAA 4E03A 1HLGA 1NJ8A 3N8KA 3QPVA 4AXXA 5I47A 3I61A 1S6QA 2DPGA 3IKLA 4YAFA 4GLLA 2OGTA 3QETA 3ENQA 2VP0A 5IDWA 1TKBA 3QXGA 2ZTMA 3VYRB 3I0RA 2E0IA 2XMGA 1G3RA 2OO3A 2PV0A 3LL4A 4CV2A 3KKRA 1HDEA 2ZFUA 3AW9A 1VRWA 3C7CB 2QVXX 2RB5A 2K7ZA 1P1KA 2C96A 1EVJA 4AG5A 2HEGA 1A8QA 1UQTA 4PX5A 3WICA 1SBCA 1GARA 2JZNA 1GL9B 1E7SA 2XHEA 1C3XA 4OD0A 1BH2A 4ANFA 4KH6A 2RI6A 1T2FA 2WR8A 4DUZB 2E48A 2FFBA 5JVGL 2Z1IA 1O0BA 1VAZA 2EL7A 5KNCD 2YJEA 2Y1IA 1ZC3A 2YNMA 1LI5A 2WI8A 3CPJB 6REQB 2WFLB 4P4GA 1YNOA 1OC2A 2Z2XA 3TPCA 3O3GA 1W0HA 2RGBA 5J40A 3FLMA 4C8LA 1I1HA 2HPAA 2ABWA 1NMXA 2I80A 2QGNA 2WD9A 2PWAA 4M54A 1SCDA 1CU1A 3ESXA 4NRDA 3A3YA 4C5BA 4DY6A 2FSPA 1YZVA 3ORHA 5TB5A 1E2KA 2LWIA 3D2LA 3SOZA 3KIPA 4BDZA 4HLUA 1YF3A 3VVCA 3GARA 4GL2A 3CGGA 1XUOA 1Z3CA 1F1JA 4JWTA 2OFFA 2PKYX 2PWBA 3FE2A 2P1ZA 4L8RB 1G21B 5EWMB 5E3HA 4CIFA 2QRMA 1HC7A 2IAJA 4EUNA 4IFVA 1N9GA 2BTFA 4PHHA 4QPDA 4CM4B 2XWPA 5LKAA 2CN1A 4Q03A 5TF0A 4ZN6A 4D0SA 2E1ZA 6CHYA 3H3OB 2IDMA 2QJWA 1YHQN 2JI6A 1W5TA 3ZNOA 3EEOA 5MFZA 2VJBA 1ICIA 2ISQA 4CETA 1DBSA 2OORA 4NVRA 2FX5A 3ZBUA 4BLPA 1XT6A 1T05A 1ZN2A 3I0ZA 1FX1A 1KP2A 2WM2A 4LY6A 4BLWA 3AVUA 4LF6K 1S9HA 5JSKA 1HDXA 1F21A 2VHJA 2JH9A 5EEHA 4E7OA 1N2OA 3V8VA 1PVOA 5E41A 4E7IA 4X65K 4LI3X 2YYAA 4WBNA 4OB7A 1WOYA 3O4RA 5CVEA 1XNRB 2WJPA 4H4DA 1E7QA 2AH5A 1DKPA 3WNVA 4BMYA 1DRJA 5HSGA 4KHPB 1QMPA 2ODEA 1QQCA 3L84A 2ZJ4A 2H2IA 5JVDA 5FPNA 2QTRA 5T41A 1YNSA 4DJTA 4RF5A 1ASWA 3A6HA 2A33A 4IFEA 2H85A 2AFHE 2V0NA 2X6QA 4P08A 3T7KA 4DANA 3PKZA 2YS7A 3GPLA 5BW8A 1YZFA 2QA4N 2O4UX 4P2BA 1HYGA 4E5UA 1A4UA 4NENA 5AFSA 1TZ2A 3DOHA 4M38A 3LWLA 2CLFB 1J00A 3FSEA 4QS7A 4FWKA 2WF8A 4Q9LA 5BOSA 4CE9A 2XWBF 4L07A 3QFFA 1W48A 2FVYA 4HZGA 3UEOA 1L8AA 2H9YA 1MW9X 1P9LA 3T99A 3TBHA 3HCNA 3RFXA 1VXRA 3AIIA 2YNMC 3K9QO 1QHFA 3MFQA 1ISMA 1LS1A 2QXLA 3PKJA 3U80A 4AN4A 5CB6A 3KJXA 3VPCA 3FZFA 2YH2A 5HZKA 2EP7A 5E3IA 3E66A 1F20A 4HWRA 1AUOA 3SQDA 2FC0A 4AM6A 1Q15A 3LGXA 3VKFA 2O50A 2W9XA 2NXCA 4FQ8A 1UC9A 4PFJA 2Y6UA 4MGEA 3WNZA 4P80A 1IWOA 4FFPA 4DF8A 3LNCA 4XUCA 4YO8A 3QKRB 1ZUIA 3QFUA 3AP3A 4QOIA 1GDHA 2EQAA 4WK0B 3TOCA 5CFPA 2XYVA 3AVVA 4O4HB 4GMFA 4LX8A 4MYUA 3CG7A 3SQLA 4DXAA 3K70C 4HCBA 3TLGA 1VIVA 4FBMA 4EP4A 2PX6A 4YXWA 1MF7A 3U4DA 5J2UF 3IVXA 4XH1A 1T3ZA 2MSWA 4QU8A 2PMKA 4JEUA 4Q4AB 2ZUTA 5AO9A 3QE2A 5IVPA 1Y1PA 2G5TA 3GFTA 5E1DA 4EHLA 1N2ZA 2I7VA 2J0UA 4QPZA 3R8CA 1QVRA 2FWNA 5AQIA 3IERA 1D8TA 3TWHA 1RLMA 2VR1A 3NWPA 3O92A 3A0UA 4WDQA 4JVLA 1KVSA 1OJ7A 3I4LA 1C3LA 2GR9A 3ROFA 2QI9F 3SP1A 3UG6A 1NVBA 5G02A 1U04A 3K15A 2BFEB 2A5XA 2R5FA 1E2PA 2F9FA 3I8SA 1XCGB 2C78A 2NO0A 5LQUA 1W1WA 1NHWA 1I13A 2YQ5A 3EZXA 5EE0A 1FFWA 3OEEA 1XZKA 4B3JA 2HVIA 2ZJ5A 3R6DA 2MHCA 1ONPA 1CUGA 4G9EA 3HCBA 1Y64A 3QU9A 4JJFA 4W9NA 4XFJA 1P9RA 5KOYA 3O4GA 4FEGA 2DTDA 4B73A 1XHLA 5E2BA 2ZXUA 2V7ZA 5FOSA 4OKNA 4EJ0A 3AVGA 1RAIA 4NL4H 1TQ2A 1UFRA 2CXTA 5DGIA 5AKYA 5JDIA 3VQ9A 1F8FA 3A04A 4ZARA 3Q8KA 2BIFA 3TANA 3AIKA 1IKWA 3G7UA 3GFRA 4MULA 4N8EA 4HQKA 4KH4A 4ZQGA 4DV4B 2DQKA 4EUSA 16PKA 4DMLA 5HKKA 3RWBA 3NC0C 2NRWA 5KPZA 4L85A 3VO8A 1NDUA 1IZ9A 1YJ5A 4X41A 1UEJA 4U2EA 2I3AA 3P0FA 4RMNA 3TE7A 3M6IA 3G8BA 3NQ41 1LDBA 5IXSA 2I8AA 3K0FB 3OJEA 4BZWA 2ZDGA 4MS1B 2WZDA 4K9NA 1Q6YA 2RAFA 4R9SA 4RFVA 4J0IA 2X4IA 4AQYB 4Z9XA 2WF7A 5HUHA 2WMOB 2VQFB 1SOAA 4F3YA 1FDOA 1TUBB 3HOTA 3JWEA 4WADA 3VF2A 4FEEA 4MTLA 5FCDA 3KVVA 4JB3A 1K3UB 5CP8A 4YDRA 5I8PA 1PT8A 3DM9B 5H59A 4IWXA 4CG0A 5K45A 4TL9A 4QHSA 2LRHA 1ISGA 1S96A 3UTDA 1KXPA 3NEAA 3OC6A 3H45C 4D42A 7MDHA 5KPRA 4CMCA 3SS8A 5BMOA 2IPNA 3AUUA 1R8YA 4IAOA 2OTLN 2Z2IA 1ZD2P 2HX1A 3GHYA 3CVYA 3PFCA 3T6KA 4IL5A 1GUYA 3F74A 1E9EA 5AOCA 2C61A 1ZISA 4DLSA 1PSZA 3VQBA 1ZOSA 3ZN2A 1VMDA 5L40A 2OVBA 2CMFA 5AVSA 1PUJA 3QVLA 3PV8A 1BJTA 2GVZC 2EWVA 3KOXA 4D79A 5KQPA 1DMRA 3BWVA 2XWQA 4HNQA 4JELA 2KFZA 3T5BA 4FLUA 4EG8A 3VR2D 2W37A 4KWHA 3UMMA 2V7QA 2WTXA 2PH7A 1Q1EA 2VXBA 1SKWA 3VTZA 2Q1SA 4Y2JA 4H0VB 3MXIA 4UOZA 4IOAL 1GPLA 1DRUA 3NM4A 4MX8A 3GLIB 3FWHA 4G8CA 4W9NC 1FW8A 5KDLA 2BKLA 1OUMA 3WXKA 4RL6A 3LCRA 4BWGA 5LFAA 3AGPA 4OVKA 3PYMA 4RMHA 3AVOA 1FXXA 5EUBA 5LLSA 3WBJA 5CVTA 2GMWA 6Q21A 5AH0A 3RYIB 3HTXA 3ZXSA 3AO5A 3ZX3A 3ENNA 3TSAA 3RS0A 4B0OA 5JNRA 4BRMA 1AGRA 2I7PA 2J45A 3AR9A 4MVJM 2VCEA 1J0AA 1WPQA 2YWXA 4NOLA 3QBXA 5CLGA 3U39A 3TG2A 1H05A 2OGUA 2WJ6A 3OF5A 4P32A 1IHYA 2ZIXB 2XB9A 4CMBA 3DEAA 4I55A 5MHTA 3A6JA 3F71A 3KZNA 2A7QA 4KKOA 4ZVMA 5DYYA 2P2CA 3O0DA 3UQZA 4MQ5A 3N2KA 4ZYWA 5CEJA 5JCZA 1BKYA 5AHRA 1CT9A 1CQWA 1XKTA 4PXAA 1UINA 2VNKA 4ZQFA 1UXHA 2QTVA 3WGUA 4JUFA 3K5OA 3ZJTA 4TV9F 3VM6A 1C1HA 1Y7LA 2H1WA 3BOSA 1S1UA 3D6NB 2QTGA 2C20A 2DJIA 4LJYA 5EJIA 5KYVA 4LXGA 3VISA 3F6CA 1UR5A 2WIBA 1ZSVA 2H2GA 1WB6A 3O3HA 4GNIA 4J7AA 1M2EA 1MOZA 3LDFA 1KP9A 4X95A 2WKWA 4OH1A 2D0PB 4WX2B 5YASA 1H65A 3K96A 3WLQA 3ZBQA 3ZHVA 4INOA 4EPVA 1N32B 3H17A 1UUFA 1WTCA 3P9CA 1SHLA 4RKRA 1L7VC 2ECOA 4GO1A 1DEKA 3SG0A 4IQGA 4EGFA 3IJRA 3EA4A 3G5UA 2IYSA 2HU7A 4JLJA 2IVNA 2A1RA 4XPIB 1GOBA 1L4LA 1BVUA 2XLBA 2GEBA 4ZVLA 5FTKA 1JFFB 2YMLA 5JD5A 2X9VA 2Z2JA 4RZ2A 3B9RA 2DKOA 2Y1EA 3ED1A 3UV3A 4P3XA 1QB7A 3W34A 5AQPA 2WF9A 3MYYA 5IDXA 4DCOA 5L7TA 1EWVA 3S2UA 5KYTA 3LWMA 1OTHA 3R3LA 1SXQA 3CKKA 4FXDA 3AEZA 3K4QA 1IZ8A 4ECAA 2E4AA 2HR1A 2ZUFA 2HOEA 2HHHK 3C3XA 1B3RA 1KFEB 4Z2YA 1KH2A 1FSFA 3FNRA 2B9EA 2DM6A 3HGQA 5JDCA 1F6DA 4EHAA 1GLNA 1AMNA 1RAFA 4DMNA 1S3IA 1GPBA 4YLGA 4UMFA 1ST2A 3VU1A 7REQB 2CMHA 3SQOA 3KK7A 4UXIA 1M2WA 3RREA 3CNOA 3CW2A 3HACA 4LWZA 4QBHA 3RUPA 2ATXA 2FFJA 2ZOSA 2ZSUA 4EL0A 4HVAA 4E7HA 4M36A 1N3LA 2IYXA 3LCJA 3A3OA 3AU8A 2W2MA 3QWFA 4KMRA 4RTSA 1BIUA 3SJAA 1JE0A 5KTPA 1NQOA 5B53A 4X71A 3R5HA 1A9PA 4LNUB 2W6IA 1P7CA 4MHSA 5CJ2A 1R37A 3T4EA 3W6PA 4NAUA 4OMUA 4S3MA 3OC0A 1J8QA 2EKLA 3V55A 4BBZA 2YHIA 3GJ6A 4J90A 4P38A 1U7XA 4LVOA 2E20A 1L7BA 1QP4A 3V4SA 2PRKA 3WXJA 4S1TA 3WEEA 1ECPA 2PYLA 1EP9A 3ANMA 3RSOA 3W5CA 3IAS6 1U8YA 3VN5A 5GINA 3PYXA 4EZ9A 5FOXA 4ZOLB 1ULZA 2FPOA 3N86A 1XPOA 3VNVA 4TKMA 2BFPA 4OHFA 3ZNPA 1I2DA 4CZIA 4Z0UA 1QKIA 2EU8A 2JDID 2Q46A 4FK8A 1MQ8B 1X7YB 2G8UA 5MGBA 1K8QA 4UU8A 4AS2A 3JTMA 1M7HA 4CNQA 2WEKA 1ACLA 1VHWA 3O1WA 2JI8A 4KKXB 4QGBA 1I0IA 1CZLA 4P4SA 5EKDA 5KQGA 4LYDA 2VBFA 1XZBA 4JFAA 4Q0BA 1G7SA 2D5RA 2CD7A 4WAUA 3GEMA 2UXDB 2BH1A 1Z17A 3L8DA 4CM9A 3BDPA 2V54A 2Q0UA 1KSGA 3C8DA 2VK8A 4PZPA 4L9RA 4XGRA 3L04A 3TTYA 5CDUA 1Y6GA 1FE8A 2IC5A 2P9PA 2OD9A 3GFFA 3ILHA 3PQ8A 2OGZA 2NSLA 4JR1A 4RELA 1UAXA 5B64A 3LT1A 1BN6A 3BJIC 5DM4A 2IDOA 1J1UA 1P6QA 2YFKA 3BUZB 2RHMA 3CG0A 2VH1A 2QRKA 3ONFA 4MVJH 4RO0A 3ZYZA 2VQEK 1NQUA 4XPIA 2IV2X 3AETA 3HEAA 4KACA 3VKHA 3EE8A 4RY0A 3ZVMA 1JXAA 1Z2PX 1BXGA 1JXQA 4WZAA 4IJKA 1YXQA 1EFAA 1VQON 3EPHA 3PQ3A 3QNUA 1KI9A 3NBKA 1OI3A 3OKFA 1TLFA 4NF2A 4U7FA 2HWUA 3C3AA 10MHA 4GMXA 3CN9A 2C4NA 1J6ZA 2FRVA 1M2VA 3G9ZA 3O8CA 3RSCA 2HMVA 1C9JA 4M0KA 3SK3A 4OH7A 4UZFA 2SHKA 5F3DA 4K9LA 1QH9A 2F8SA 3V1TC 1WUIS 1M0EA 2FF5A 3GUHA 1EFPA 1KXJA 4EYEA 2FR8A 2VPXA 4H3SA 4NICA 3EEIA 2ZYGA 4B1WB 3PU6A 5CM9C 5AJWA 4C0SA 3E9YA 4GICA 1LF5A 1VSFA 1M1KO 4JOBA 3UKJA 3W5SA 2J3DA 1I51A 1ND6A 3BTUA 1JIXA 3IUBA 1H42A 4S35A 2GGSA 2OYCA 4BMZA 3RAEC 1Z37A 4D74A 4HK4A 4DEYA 4RACA 3GVHA 1YS6A 5J4YA 4DPKA 1TD9A 1YR8A 4KXNA 4TV8B 2BFNA 2YY7A 2H5LA 4H7HA 5IP5A 3L7YA 2HD4A 3N05A 4KR3A 4LNUA 5ELLA 3ZIAA 1TV6A 1R4ZA 1UT5A 2W00A 4ARZA 3FPEA 3FROA 4KIFA 4M4SA 3KQUA 2EFGA 1OAOA 4N3GA 1QRAA 4QXQA 5HQ3B 1NAHA 4FCVA 1JU4A 3BFVA 2AG8A 1U11A 1NR1A 1PL8A 1EFHA 5TE9A 1ONNA 2W8BA 2YYZA 1B73A 3HUTA 2YHUA 4MMZB 1LPOA 5HTOA 1RDUA 1WSBA 2C1ZA 1QQTA 4U7GA 5TQ2A 2D3WA 3L2QA 3F49S 1NGCA 4NO7A 3LLMA 3E61A 3ZLUA 1QB8A 2QZJA 1FX0B 1F1BA 4CEBA 3PI6A 5IAJA 1L5KA 2NU7A 5DCUA 3DFZA 4EA8A 4AWXA 3R5TA 5JJIA 3RFFA 1T6CA 5A9SA 1Q74A 1Q0HA 2IU4A 2O5RA 2OKCA 3TQQA 5AVYA 3O4HA 2QYSA 3AVAA 3CCUN 1NI3A 4IIHA 3BD7A 2HWKA 2I6UA 2YWJA 4NAVA 3RVJA 3VDMA 4F1JA 3SY8A 4DHWA 2WBLC 1XA0A 4LHSA 1PR9A 2VYVD 1FFCA 3B70A 5AYVA 3N1UA 1AUXA 5C4GB 3ILVA 2RGNC 1AKWA 3WI7A 3OA2A 5IN5A 3NUQA 2W90A 2PAVA 3ZDEA 4IIJA 1OWLA 1SL0A 3OQIB 5EIBD 4ZVOA 1J49A 5JO9A 3CSDA 3MMSA 2O4GA 1R5NA 3SUPA 2V7BA 2V3CC 1IK4A 4Q82A 1VHJA 5JE8A 4KQKA 1V26A 3D0RA 1K7EB 2FBTA 3FE1A 2HO5A 3J81O 1BXKA 4FS8A 4LPSA 5K4GA 1J5EK 1DQNA 1DFIA 1F38A 5TT1A 5LOVF 2UVQA 4INZA 5C5CA 2P5TB 4ZO6A 3P2EA 3EPPA 4WBSA 1DC6A 8MHTA 1E60A 4P3NA 5AHOA 1FNCA 1YVDA 3VH4A 4TMXA 2DUMA 3ZCXA 1V35A 1HNXK 3QFPA 2R8BA 5B3AA 3TNDA 1MQ9A 1AKUA 2A0UA 3H2ZA 1L5FA 5EE9A 1K4YA 3L93A 2O7VA 1J06A 1L4GA 3QLVC 2K2QB 1WMDA 3DVAA 3QOWA 1QHNA 4L6AA 1QVVA 2QY6A 4O3FA 4YECA 5ENVA 1QBKC 5LJLA 2WIKA 1QQAA 1EVYA 1II0A 3ONDA 1NOJA 2BMFA 2FW0A 2JK0A 3NKVA 4H16A 5D6NA 3SZOA 3UOAB 4BO9A 2J6BA 2IH4A 3NDKA 4MVJA 1NPYA 4JBLA 3KB2A 5BNZA 1X1DA 2RIRA 4N9WA 4PTLA 4ZVKA 4D97A 2G83A 1C1YA 2VT2A 3WSTA 3ZT0A 1O77A 4EY6A 4U7DA 2R6GA 4DTNA 5EUCA 5U4QA 2BMJA 1EX4A 3ABRB 4DIDA 3BK7A 4DWJA 3MT0A 3QVVA 1E1KA 4YAIA 4Z2AA 4FWQA 3SHOA 1C7EA 2R2GA 1GUBA 5E6RA 5LMNB 4LYHA 4R68A 4D82A 5LUAA 1NR7A 1YBHA 1AQYA 2ZJZA 3C4JA 3N7AA 3ROQA 3O38A 4U2CA 2VUUA 4UHDA 4KHQA 4U02A 3WGNA 3ZHTA 2RF2A 1ESDA 4OEHA 1TA0A 1QHTA 2AZMA 2MSNA 1ECBA 1JEAA 2PBDA 1A5TA 1IUKA 3H2BA 3K9NA 1PFWA 3N87A 3HFGA 2CF5A 3N8GA 2NYUA 3QWBA 3VSDA 4HDRA 4XWAA 4DWOA 3OEHD 5B2ZA 5C37A 3WMXA 4XDZA 1Q7TA 4QLAA 2WLSA 5DCWA 3CYMA 1ODCA 4CKXA 3WJAA 2B8NA 1Z2DA 3TLJA 3E0QA 1PJSA 3LPUA 1X7HA 5TQ2B 4QTYA 5JEDA 3NDPA 4RHXA 4PFSA 3VR0A 4NBTA 1FX0A 1VHDA 4FJ5A 4RNDB 2PUVA 3P2IA 2AV6A 3U3YA 3REOA 2Q0RA 1XP5A 2M2IA 2IUFA 2QA5A 1J0DA 3KLNA 3IFSA 1UJBA 3G9TA 2QRPA 3T7RA 3O3OB 4IDEA 3ZHXA 4F60A 4ARCA 1FC0A 1IONA 1P6XA 2A9OA 4OHVA 4F71A 1RZRA 3GNSA 1ENOA 2O4CA 2OXCA 3QPCA 3UOWA 1ZWLA 1Z8DA 5I7FA 1KFKB 3TZBA 3GUCA 2P4SA 3C5VA 3QWAA 4JL5A 3NFRA 4ZMRA 4G0PA 2G0NA 2GAOA 1VL6A 5FADA 2OPPA 3SFVA 2NU9A 1ZVMA 3EAQA 5DW3A 3EN9A 5AFUH 2HJGA 3FCUB 5HFAA 4YR7A 1SPXA 4CF7A 3T1YB 3HP6A 2WU1A 2YZGA 3QITA 3OPMA 1MAAA 2KM1A 3KOOA 3TW6A 2YHWA 3ZSXA 3GL1A 2NYAA 4ZODA 4PHCA 1M2FA 2J9YB 2P6OA 5K20A 2X2OA 5GVSA 4WCFA 2REXB 2OCPA 3GBSA 3R40A 3PGJA 3EEFA 4OHKA 4E15A 4HN9A 3OQBA 1YBFA 2A5JA 2E88A 1JTFA 2P9IA 2CGLA 3OHRA 1XQ6A 5IARA 5JRZA 1OE0A 1TW3A 1N6IA 4RSHA 4BJ3A 3MN9A 1AXGA 1DBPA 1RI1A 1U5AA 3QNWA 4H4OA 3EHDA 2WE7A 1QP7A 4D4MA 3TR0A 3KUKA 4DSJA 3EVNA 4CF5A 1FTNA 3H1PA 3VOVA 3ZBTA 2H54A 4O5AA 1IO2A 1HKBA 3K30A 4QPCA 2E4LA 4DBLE 4EGCB 2XZLA 2QRGA 1DBRA 1NI4B 2G4VA 4MUKA 1IAVA 4N65A 3WK6A 4RD0A 3I6MA 3L0QA 1DC7A 2A0KA 2QB5A 4BMDA 1OLSA