2YHBA

Crystal structure of the n. crassa qde-2 ago mid-piwi domains
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
433
structure length
368
Chain Sequence
VKVARPCRKIEKWTYLELKGSKANEGVPQAMTAFAEFLNRTGIPINPRFSPGMSMSVPGSEKEFFAKVKELMSSHQFVVVLLPRKDVAIYNMVKRAADITFGVHTVCCVAEKFLSTKGQLGYFANVGLKVNLKFGGTNHNIKTPIPLLAKGKTMVVGYDVTHPTNLAAGQSPASAPSIVGLVSTIDQHLGQWPAMVWNNPHGQESMTEQFTDKFKTRLELWRSNPANNRSLPENILIFRDGVSEGQFQMVIKDELPLVRAACKLVYPAGKLPRITLIVSVHYTVLVDEIFRADYGNKAADTLEQLTHDMCYLCPPAYYADLVCDRARIHQKELFDALDENDSVKTDDFARWGNSGAVHPNLRNSMYYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POST-TRANSCRIPTIONAL GENE SILENCING PROTEIN QDE-2
publication title Crystal Structure of the Mid-Piwi Lobe of a Eukaryotic Argonaute Protein
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Rna binding protein
total genus 125
structure length 368
sequence length 433
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yhbA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yhbA01
3O21A 3LUCA 1NKEA 4KB1A 1HJRA 4ETIA 4BDZA 2PUFA 3CG4A 2IDOA 1NK0A 5T3YA 3UUGA 3EY1A 4PUOA 2FSPA 5EU7A 1JWLA 1YMUA 4CGGA 5PNTA 2FMIA 4EVSA 3EULA 3LTEA 1NATA 3LP3A 4YS6A 4HUGA 1MIHA 3KLFA 1S5JA 3KK2A 5EWMA 1L3TA 5TPWA 3IPAA 1C0TA 2FN8A 2IC3A 2NZUG 3DRSA 2FEPA 4F11A 3WNEA 1LW0A 1RZRD 1X9MA 4KHQA 1TM2A 4DQDA 1LW2A 1S1VA 3AVLA 2IOYA 1C6VA 1KVBA 2FN9A 4ZJPA 2PY5A 3RVQA 5CNJA 2D5RA 3OJUA 1WSEA 3AVNA 1S9GA 2D0AA 3S3OA 3HP6A 2CHFA 3EGCA 4PY5A 3NF6A 3ILYA 3VNAA 1VSLA 2DFEA 4FZXC 4CJ5A 2W42A 3GT7A 4PZ0A 3A2FA 4JB0A 5KGWA 1QO0A 3KHTA 1NXSA 3NH0A 4QYMA 1RXIA 1AB6A 4PWDA 4DTRA 5CNIA 3L3VA 5TPZD 4RWEA 1ISRA 1CHNA 3G1WA 3NNDA 4CJTA 1XWLA 4MR7B 1B9DA 3IS9A 1BDJA 3JSMA 4RW4A 2CD7A 4KHUA 4TSXA 2G8FA 5J2NA 4FJHA 1DC7A 2QVGA 3H1EA 3OS2A 4CK1A 1TKDA 3SZ2A 3IAYA 1IIBA 4ELUA 1U49A 4N0QA 5B3JA 4IBNA 4KKOA 3E01A 4KO0A 3TMYA 4KTWA 3BDPA 2HPHA 4P1ZA 1JLKA 5DKFA 4CIEA 4DF4A 1ZDMA 4XASA 4RXUA 2JLEA 3EQZA 2G8VA 3EYZA 1NJWA 4FLTA 3AA2A 2FBTA 4XAQA 1RTDA 1WAJA 3EDCA 4IG0A 3RH0A 4MRMA 1WSIA 4MR9B 3L6UA 3RTVA 4IGAA 2R7YA 4Q6WA 4J2AA 1SUQA 3JTEA 1TL1A 4HVJA 4DSFA 4UHKA 3Q9SA 3L2UA 1VPWA 2HHWA 3F73A 1U8TA 1XHEA 3AA5X 4M3WA 2ATQA 3AO3A 4GPAA 3CYMA 2WJAA 4CF8A 1WN7A 1MU2A 2QW1A 4RK1A 3P83D 4OG2A 4N76A 3HPHA 3M8SA 4DFPA 4MR8B 4M3UA 2JGUA 4ZHRA 2PL1A 5I3UA 4CFAA 2DRIA 1W25A 3K57A 4CK2A 1K66A 3EAFA 1GUDA 2XY6A 3F6PA 4BDPA 1NOYA 4JS4A 4CHPA 1YVUA 3KJVA 2ID7A 4CESA 3N8IA 1T34A 4LDAA 2JB9A 5F64A 3T95A 3Q7SA 2DY4A 2L17A 3QEIA 3NF7A 4ICLA 1JLBA 4KV7A 3AVFA 1QSSA 1QQBA 3H5IA 1ASWA 4LH5A 4DFKA 4LSLA 1FFWA 4YR7A 2F8TA 1FKOA 3SPZA 1SV5A 5HROA 1VSIA 3SJJA 3SY8A 5I4CA 3H5OA 2G8UA 4FM0A 3N75A 1MVOA 1PEYA 1JKHA 3LP1A 3OYGA 4H60A 1PHRA 2TMYA 2IS3A 4CJRA 1RTHA 1NK4A 3BILA 3TAQA 3KLOA 3V1RA 3M8QA 2VUIB 1YK1A 4K8ZA 2Y1JA 3RMBA 4PE5B 1L3VA 1EWKA 3B2NA 2E6MA 3H08A 4JA2A 4ZTJA 1ZVVA 3OYHA 9ABPA 1IKYA 3H5VA 3C3WA 4ML3A 3AVCA 3DLHA 2CHEA 3AVKA 4B8AB 1JDPA 4PA1A 1ZYQA 2HHSA 1C0UA 1QS4A 1JLEA 4G0ZA 1F51E 1RZRA 1Z2DA 4N41A 5I42A 2FVYA 3ZSQA 2OPQA 1HQEA 1VLZA 1QQCA 3RWUA 3IP9A 3ZT4A 1XHZA 3OM0A 5EWJA 1D1PA 4ZPJA 1KVAA 4DS4A 3SPYA 3RRGA 4CF1A 3SUPA 5J1EA 2L19A 4DADA 3I45A 3MF4A 1IH7A 2YNGA 2VWKA 1RBRA 3AO2A 4CF9A 1UAXA 3ZCMA 4IMJB 4C8OA 3U3YA 4AHSA 1B00A 3K5NA 3QLUC 4NCGA 3SV3A 1Y97A 3NBMA 4YP9A 3KIOA 2IPLA 3Q7TA 1RT5A 1NK9A 3DRPA 5KRSA 3V9XA 5TPZA 1DCMA 4LD0A 1SXIA 4W5NA 2FLKA 5EWLA 4S05A 3RVJA 1C0EA 4D6YA 3LAMA 4M3TA 3VQ9A 1GOAA 2XO7A 1KCFA 1M2EA 3ALYA 1D5WA 5T7BA 4G1QA 4RZSA 5TQ2B 3NF8A 4OPKA 3DLBA 3CS3A 4RK6A 4AHTA 1CXQA 5IBQA 5BRJA 3AVHA 3KYJB 2VWJA 4PEVA 4J2BA 1BVHA 1RBUA 1RT2A 1D2AA 4FJ8A 2IYNA 1A5WA 1JFSA 1L5UA 3AA3A 1DZ3A 3NHGA 3AVBA 2X6NA 2Q3SA 1J9AA 5CZ1A 1Z2EA 4PICA 3JVIA 3VQ4A 3FFTA 3GBVA 4OGEA 1HMVA 2ITGA 2I6FA 3NGZA 4JRQA 1CYEA 4FW1A 4FK0A 3OYIA 2EX3A 3MA0A 4IMIB 2FQXA 4DSEA 2OA8A 4E7PA 1EKEA 4B9TA 3NAEA 1CXUA 1EAYA 2VG6A 3RVPA 4EZ6A 3RVNA 3N0WA 1NKBA 2M98A 4YO7A 1JLCA 5HRPA 3DLKA 1D9DA 1VSJA 3KKRA 3QETA 4OJRA 3B6PA 4RSMA 1ZGGA 1BL3A 4FJ7A 3RVLA 2PYJA 4HHTA 4Q7EA 4DMNA 3ASMA 1L3UA 4IKFA 4FJGA 4IFVA 2OPSA 3ZT0A 3VQ6A 1BI4B 3IP5A 3LKBA 4C8NA 4E7IA 5ED4A 1BISA 3VQDA 4RW9A 4KREA 1A2OA 1RDCA 4JS5A 3KK3A 1TVMA 1M5TA 5IX8A 3RQIA 1M2FA 3QIOA 3HV2A 4N47A 2P5OA 4HCCA 5KQPA 3D8UA 3G85A 2PAFA 3PX4A 1ASVA 3OLYA 3N0RA 3UKJA 4G0MA 4EVQA 3AO1A 2RN2A 3KLNA 4FJ5A 3ZT3A 3O1HB 4N5SA 4Q0BA 3KG2A 1LWCA 3DOKA 4QAGA 2PUAA 4CEFA 1J53A 4TMYA 4CGIA 3AVGA 2Z1HA 4W5QA 2DFFA 3LALA 2QR3A 2LSNA 4HNRA 1LBIA 4KTQA 4JP1A 3LMKA 1EWTA 1U45A 5IUJC 1BCOA 4FJXA 1MB3A 3TAPA 2XDYA 5TQ0B 1P2FA 1APBA 1Z26A 5FRNA 3TO5A 4MS1B 2Z1JA 4OLAA 3LUAA 1SL2A 3KTQA 5IULC 1DJMA 4MR7A 3O4NA 3ZT1A 4F3OA 3IP7A 7ABPA 1I3AA 1GCGA 4FJNA 5SZTA 1RTJA 3OM1A 4MS4A 3W9SA 3LPUA 3IG1A 3S9HA 4OKKA 3DLRA 4DTXA 4OVLA 1EX4A 4YCSA 1A5VA 4FZZA 1RT4A 4DTMA 1JHZA 2FKAA 1P6QA 2R25B 4AHCA 2A1SA 4MR9A 2H3HA 2ETJA 1X9SA 3KKEA 4JASB 3OQOA 2PUCA 4RKQA 1D4ZA 2O20A 3JYTA 4IRXA 2ZWMA 2AJQA 2HNDA 1DLOA 1ITGA 2E4ZA 4K8XA 4NQRA 4KFBA 3JY6A 1H9CA 2Z1IA 5JNWA 1SKRA 2E6LA 1MB0A 2PUBA 4DSJA 3QINA 3OYKA 4OATA 2QKBA 1NJYA 3RVSA 4IF4A 3VN5A 4F8JA 3GA5A 4UQGA 1NXPA 3TD9A 3VA0A 1GOCA 3MXMA 4G0PA 1JXBA 1NXTA 1DTQA 4DTUA 1NXVA 2RDMA 3SQ1A 2YNHA 2DFHA 3EJWA 4CJQA 3HJFA 1NK7A 2L2QA 4RK5A 2CWDA 3U6FA 2D0CA 1RPJA 2WWVD 1DBWA 5C5CA 2E4XA 4RKRA 2PE5A 3OYCA 2FMFA 3BRQA 4I7FA 3IDOA 4GMJB 1S1UA 4PYRA 1Z25A 4C8KA 2HHVA 1JL1A 1QMPA 2EHGA 2WOMA 2ZD1A 3QEPA 1HYSA 2MYNA 4RXTA 3OQMA 1M5UA 3JVDA 1VSKA 4KNYA 1KVCA 5JNTA 1IKXA 3V81A 1PNTA 3CM5A 3SNKA 4YV7A 2M1ZA 1KGSA 4DQPA 5KC8A 3C6UA 1RCHA 3L3UA 4FB4A 1SRRA 4ZYLA 4CFDA 5GOTA 1ISSA 2YHAA 4CHZA 1XWWA 5IC5A 1RDBA 3NF9A 1Q9YA 3DGFC 1SL0A 3KCNA 4FLXA 4R5PA 1WSFA 3F7NA 4KI6A 2FEKA 3O1JC 4E19A 4FXDA 3V9WA 3NHZA 4EP5A 4KB0A 1JX6A 3PX6A 1BIZA 3KD5E 4CIGA 3T8YA 1S6PA 1SXGA 3NBPA 4OPJA 5FROA 4M3ZA 4BDYA 3C97A 4QCLA 3OLZA 1XC9A 1TLFA 4ELTA 1HYVA 2RPIA 5CNMA 3U3GA 3HP9A 3QX9A 3VNBA 1JBEA 3K5OA 3QK7A 3OS0A 3HUUA 1XHFA 1BHLA 1HNIA 5C5EA 3QLVC 1REVA 1JYEA 4MYRA 1QP0A 4RW7A 4Z4IA 3QNOA 1GCAA 1A04A 4EUKA 4CECA 3SQ2A 1GOBA 2A9RA 5J2PA 3FGZA 1LWEA 3QERA 2OPRA 1DG9A 4M42A 4DQRA 3N6VA 4E1NA 4B9MA 3H5LA 3ROTA 4DFMA 3ZSWA 3OYBA 4BWMA 3TARA 4DQQA 2B6AA 1YIOA 3F6CA 3D0PA 4KRFA 4ETMA 5TQ2A 4CGHA 3SNNA 2VYCA 4AH9A 3PO4A 3FMVA 1YK0A 3DM2A 3CRNA 4G0OA 2X7XA 5DGCA 3H1FA 4NYFA 2KZZA 3DGEC 1J54A 4LSNA 4DSLA 3AVIA 3ZSXA 3Q41A 4Z9AA 3VQ8A 1A0OA 3SQ0A 1D8YA 2XRIA 1Z13A 1S6QA 2B5JA 4YFUA 3EQ2A 2J48A 2E4YA 5HRRA 2XHBA 2GI4A 2F8SA 1NXXA 2AYZA 2QXYA 3GYBA 1RTIA 1LAVA 4B8CA 4CCHA 3AO4A 2B4JA 3QEMA 1VRTA 1CZ9A 2PYLA 1HQUA 1JLGA 2O4GA 1ABEA 2RJOA 1GUBA 4AILC 3JPYA 1FXXA 3KLHA 2Y1IA 2PUGA 2OZSA 4FZYA 1VSDA 5HRNA 1KFDA 4RK7A 2A9OA 4HNSA 2HQOA 1DRKA 1TKTA 3O4QA 3QEKA 5CY4A 5HP1A 4FYDA 4HYEA 3NGYA 3LUFA 3H6HA 1ABFA 1U0SY 3T3FA 5DK5A 3NE6A 4O5BA 2KTQA 4M88A 4FJJA 3LANA 5D3GA 4O0IA 1JH9A 3EODA 2XY8A 3AO5A 4CEZA 2BGGA 3DBIA 3Q7RA 4DFJA 4YGXB 1L5ZA 4CJUA 1KSPA 3HDVA 3CNBA 1BIUA 5FBHA 3KK1A 3FFWA 4FM2A 1WSGA 3TAMA 3H75A 2XY5A 1XHXA 1FK9A 4CJSA 4OBBA 4MPTA 3TAFA 3QEVA 3HDGA 1TK5A 2LIVA 1TL3A 5HRSA 4KI4A 4RY9A 4LE1A 3PV8A 5GQSA 5E41A 4XFKA 4NCAA 3H5WA 2G8KA 4F06A 3E61A 4KQCA 2HQBA 4LRQA 3RVKA 1C1CA 4FLZA 1WAFA 1DCKA 3LFTA 5TE9A 3CG7A 4XIUA 4CF0A 3HSTB 3K5LA 1EFAA 2KQ2A 2HVHA 3ZSRA 1JFTA 1YT3A 1TAQA 4KHWA 4FLWA 3C3KA 3MIZA 1Z17A 3LUGA 3HEBA 5TQ0A 1C1AA 1TGOA 3C6QA 2N9UA 3QELB 2YNFA 2E4UA 3OMWA 3K59A 5K14A 5IEBA 2OYQA 3VQCA 2PL9A 2HNYA 4MS1A 1TV6A 4W5TA 3CLKA 2ZQBA 4XLTA 4FK4A 3L2WA 4CIFA 2ZAYA 1NY5A 2WJWA 2O4IA 4CF2A 2PJUA 1NK8A 3T38A 5JNRA 1UA0A 1KFSA 3O3GA 2G8WA 1PUXA 1SKSA 2FMKA 2FEWB 4LY7A 3TWHA 4TLLB 3K5MA 2R47A 4F12A 2G8HA 3OYLA 2FMHA 1EP4A 3OQNA 1R0AA 3OVNA 3QLTA 3URMA 1BQMA 1E6KA 3ULDA 4LE0A 4DSKA 3LUJA 4RW8A 4EY3A 4H3KB 1HEYA 4GNRA 4OLBA 5HM6A 5FWYB 3QNNA 3MEDA 3LWMA 2KFZA 5JS2A 2PZSA 3A3KA 3GL9A 1DBPA 4Q5VA 3OYJA 1X9WA 1L3SA 4CJEA 4B3OA 4TLMB 3SAJA 3S3MA 1LAWA 2PKXA 1LK0A 4M3RA 4O0JA 1SKWA 2WRZA 3KYIB 1VSFA 1UWBA 4CE9A 3H6GA 3CZCA 1CLQA 1QSYA 4IG3A 1EHCA 4BACA 3P1GA 4WWHA 3SQNA 4CHYA 5ABPA 5KQLA 2NT4A 3QLUA 3S99A 4CEQA 2R4QA 3CKMA 4O1IA 1YMVA 4FLVA 3P5JA 1NK6A 4OKEA 3O1IC 3RMAA 3V6DA 3KLIA 3O75A 1E6LA 4WZZA 2A9PA 2VG7A 3PX0A 3DYAA 2LPMA 4GVMA 1C0MA 3HSYA 1UA1A 2MYTA 4WE1A 3NNSA 2AYXA 5KTQA 3BRSA 4MS3B 3LKVA 2OPPA 1E6MA 4RG8A 2P9HA 1YS6A 3KTOA 1HYZA 4B09A 4EYGA 1JLAA 1TK8A 4CGFA 3LZJA 3OLWA 4EGSA 3JPWA 3LP2A 3CFRA 4RY0A 3PUFA 3EZ5A 3MECA 1ZH4A 2MYPA 2ZE2A 1C4WA 1S9EA 2JVIA 4EYQA 2QVCA 4DQIA 1IKVA 2WONA 2FTKE 4CEAA 1SL1A 4LDZA 1RT3A 2P1JA 3I09A 1JDNA 2IPAB 3N0XA 1USIA 5DLEA 4DS5A 2MSKA 5CNKA 4CHNA 5C42A 4ID5A 3SYZA 1JL3A 4EVRA 1E2BA 4BE0A 4FM1A 3ZSOA 4F8RA 3SUNA 5JNVA 4DLGA 2G8IA 4CFCA 2OENG 4CERA 1OXKB 4F4KA 1TAUA 3OS1A 3SUQA 1BDIA 3L2RA 5FWXB 1O1WA 3NFAA 4EP4A 2A1RA 1VK0A 2KW4A 2RJNA 3FFXA 3H5TA 1JXEA 4HUEA 4DF8A 3RVMA 4E7JA 1YS7A 1RNHA 3IRXA 2FW0A 5DCLA 2HNZA 3LDSA 4DTOA 2BDPA 4FJKA 1OXBB 1DRJA 3ILHA 3HK2A 1KLMA 4DTSA 3O2SB 5J2MA 1D5AA 4L4UA 3NNNA 3M9WA 4CHOA 4W5RA 1ZBLA 5EWLB 1DC8A 1VKRA 3LWLA 4KVFA 1K68A 3C95A 4CHQA 2P4UA 8ABPA 3QIPA 1URPA 2IGIA 2X78A 1MAVA 3WNHA 4UHJA 1QE1A 3V9UA 1QP7A 2QZJA 2B1JA 1QNLA 4CGJA 1QQAA 4E7KA 4FJMA 4TN5A 3HO1A 3QO9A 3O3HA 1N6QA 3K4HA 2YV0X 1DP4A 4QYWA 4CJ4A 1FFSA 1RBVA 1QSLA 3NH2A 4CJLA 1NJZA 1W0HA 4CEDA 2JBAB 4E7LA 1VSEA 4MR8A 3OO0A 2JRLA 3NGIA 2WB4A 2GBZA 3SI6A 3DOLA 3MQ4A 1S1WA 1U04A 3ZSVA 1QP4A 1LJUA 1K6YA 3WNFA 2FQYA 4MQFB 3F9KA 2FC0A 4FJIA 3I5AA 3ZSYA 3GRCA 1PNRA 3L8BA 1RILA 2FQWA 1ZBHA 4DWIA 4CK3A 5KRTA 3TB6A 4Z4HA 3WNGA 4MQEB 2DTUA 2B4AA 3RR8A 2H0AA 4EZ9A 4FLYA 4W5OA 4EYOA 2FXIA 3I0SA 1TJYA 1ZH2A 3NHMA 3CHYA 4MAAA 3A10A 4H8KA 5HLFA 4KZKA 2NZVG 4JLHA 4BE1A 1U48A 3RMCA 4XXHA 3AVMA 3D02A 3HXMA 1NXWA 3I42A 1GLGA 4M3YA 3QESA 2RGYA 1I39A 1J56A 3FDFA 2HHXA 2OQRA 2PUDA 3KLGA 3SM9A 1ZESA 4KMRA 1U47A 5B3JC 3LPTA 3AVJA 4YNQA 4EYKA 3TR8A 3KKSA 4G86A 1USGA 4RK0A 4FCYA 2VUHB 3KS9A 1ZBUA 1USKA 3T19A 2GV9A 1JYFA 5TQJA 4B9VA 4RS3A 1EETA 1Z16A 2JVJA 1QHTA 3DRRA 3TABA 1EXQA 4CBVA 5KC9A 2BE2A 4QICA 5E3JA 4I9QA 4Z0UA 4G0QA 2YKMA 2HQRA 4LZLA 3AA4A 2MSLA 4H4OA 4HUFA 4DTJA 1TKZA 4XARA 1T05A 1B92A 3KD1E 4KQ9A 2QV0A 4MGEA 4YRZA 4J2DA 3RVOA 2Q5CA 3LUKA 3M6MD 3VQ5A 3CFOA 1FKPA 1L5YA 1JLFA 3MYYA 3LP0A 5CHYA 1WSJA 2YHBA 3T1AA 2JVKA 4M45A 1YTAA 4ID1A 4B9SA 3QELA 3IPCA 4LE2A 2MSWA 2PMCA 4RXMA 5FBKA 3VQ7A 3L2VA 4F2SA 2R48A 3HPGA 2QK9A 1YTUA 4RW6A 1TVRA 4M3XA 1ZBIA 4MS4B 2GBPA 1HPZA 3S3NA 3MXJA 5KWSA 4S04A 1T03A 4FE7A 4C8LA 2HW3A 1FSPA 1KRWA 2LP4Y 3C6TA 2QU7A 1U2QA 4DG1A 2QSJA 2VG5A 1VSHA 4LH4A 4DU4A 4RU1A 1UOCA 1ASUA 4IFYA 2NT3A 2WMYA 3M8PA 3PY8A 3AV9A 1S1XA 4F2RA 3K2PA 3BBLA 2MYUA 5FWYA 3I0RA 3RRHA 3BGRA 4DU3A 4YLEA 4CJFA 3K9CA 3NDKA 3DZDA 5JNSA 1IKWA 5BQ3A 3GWGA 4CJPA 1HNVA 2E4LA 3ROFA 3L2QA 1VSMA 3DMJA 3CU5A 3SQ4A 5IUKC 3UIQA 5D2CA 3AVAA 1DBQA 3QLVA 5HKOA 1R8JA 3VQEA 4FJLA 4O1HA 1ZAYA 3VA3A 5IEJA 3ISNC 1LV5A 2GWRA 4C8MA 3FFIA 4F3TA 4NYNA 3VQPA 3SV4A 2GUIA 4LX8A 1QKKA 4H4MA 4MLDA 1D1QA 2PUEA 4CGDA 2HMIA 1UDRA 1U4BA 2Z1GA 3ITHA 1BDHA 1AB5A 3B6OA 4D74A 1BQNA 3G0ZA 5EWMB 3GV0A 3HCWA 5TPWB 4KFCA 1TMYA 3TX6A 5C24A 4I9LA 1NKCA 1BI4A 1ZN2A 3M9XA 4MS3A 2FBXA 1SD5A 4N03A 3RVRA 1JL2A 4DU1A 4OTZA 2YNIA 4HNQA 3HS3A 2E4VA 4OKJA 4DN6A 4CEOA 3O3FA 1QPZA 4IDKA 1I3CA 4DTNA 3P9YA 2GX6A 4H3HB 1KRXA 2L18A 1DCFA 3TAEA 4I2PA 1FQWA 4FW2A 1JF8A 2RF2A 3NH1A 2RKIA 1Z12A 4J2EA 1EWVA 3UK0A 4CJKA 1T7PA 5FDLA 3L49A 3GBPA 5SWMA 5HBMA 3SUOA 4HTUA 3TI0A 4DQSA 2F96A 2HHTA 4B9UA 3PO5A 1Z18A 4BE2A 5CYQA 1ZY2A 2FBVA 5JNUA 4HCBA 4KPYA 2IPNA 4CJ3A 3LAKA 1G15A 3DLGA 3HVRA 5BRAA 4KHYA 1F4VA 4KK3A 4Z4GA 1LBHA 3V1QA 4WXEA 2E4WA 2A9QA 1RDAA 4AHVA 4N56A 3QEWA 3OLVA 3V9SA 3K58A 4WUTA 2OZMA 3QEXA 1N5YA 5FWXA 5FRMA 1ZGZA 1KLNA 4JAVC 3LOPA 3CM6A 3THVA 1VRUA 2BANA 4AHRA 3VQQA 3HT3A 3ZSZA 3VQBA 2X6SA 1CEYA 3OLXA 4ELVA 1J5OA 4MRMB 2ID9A 1JLQA 1WETA 4L8RB 4QPJC 3OYEA 2KYRA 1RBSA 1W9HA 1Y1LA 4KHSA 4RDCA 4MFBA 3MAQA 4Z4EA 3CQ8A 2HVIA 3G10A 4KV8A 5DMRA 2LUOA 4Z9BA 4E3SA 2FLWA 2HSGA 4JOQA 4NCBA 3HPOA 4FLUA 4D6XA 3MEEA 4M41A 1IO2A 3CTPA 4KAZA 4ETNA 1B9FA 4GW6A 2JBAA 3RR7A 2HHUA 4JRPA 2I5JA 4KHNA 4ZMSA 4CJVA 4ZTFA 4MQFA 1RT6A 3R0JA 3BREA 1S8NA 3HL8A 4Y1DA 3QEMB 3CFPA 3VQAA 3HM9A 5J2QA 3OJSA 3CG0A 3O2JA 3NCIA 4AHUA 4NV3A 4MQEA 3OYFA 4O55A 4YWHA 3A0RB 4MLCA 4CEBA 3LZIA 4FK2A 5IUNC 3OYAA 1RNLA 1KTQA 2X74A 4E1MA 4QOZB 2IDMA 4N0PA 2GKGA 3OO1A 1NJXA 3DLEA 4ZMRA 1Q9XA 2YKNA 1TKXA 3OYNA 4CJWA 5DTEA 3I8DA 1KRPA 1RXEA 3OY9A 2NUBA 3MM4A 4CFBA 3ZT2A 4B08A 1FFGA 4E0DA 4WT7A 1C1BA 4NICA 4RV5A 2P5GA 5CZ2A 4Z4CA 2VK2A 2FBYA 1QO0D 2XY7A 3OYDA 4DSIA 1X1PA 3Q15C 6CHYA 1JFVA 5KGXA 1F21A 4Z99A 1LWFA 1VRVA 3OYMA 2QXFA 1P6UA 1P8AA 4G0YA 1Z15A 3OMXA 1WLJA 4Z0NA 4B9NA 1ZITA 3KSMA 2QKKA 1WSHA 1NXOA 1S1TA 4RY8A 5KI6A 4G0XA 3QX8A 1DTTA 5EWJB 4Y9TA 3C94A 3D45A 2HB5A 3SG0A 4CEEA 4BWJA 1NOZA 3E3MA 2HHQA 2IOCA 3LUHA 1BCMA 3N53A 4E89A 1CZBA 4P98A 3A0UA 3MMNA 3HVTA 1NTRA 4FE4A 2IKSA 3HYFA 2D0BA 1SXHA 3TANA 3KLEA 1NK5A 2P51A 3CFYA 1A5XA 3QLHA 3KJXA 4O5AA 5HQJA 1RBTA 4FJ9A 4I2QA 2WY2D 3IP6A 1BA2A 1D9FA 3O2QB 3SCXA 2PLNA 6ABPA 3V1OA 3V4IA 4FVMA 4KTZA 4KK4A 2LBPA 5BR1A 1TK0A 4L85A 4RK4A 4MQ3A 1XI1A 3JS5A 4Y1CA 2KZMA 3MXIA 4B9LA 2V0NA 1WNSA 5HSGA 1PEAA 1RT7A 2HJ9A 2KFNA 5KQMA 4E7HA 1BGXT 1ZBFA 4OGCA 3HZHA 3TAGA 1Q8IA 4O44A 1U2PA 1RDDA 4Z4FA 5KQGA 1QTMA 2IAJA 3DI6A 5JS1A 1RT1A 4O4GA 4DLEA 3H1GA 3LUDA 3C3MA 5C25A 3HUTA 2JK1A 3T6KA 4E7OA 4G97A 1ZHHA 1IG9A 4IILA 5CYMA 1LJLA 3RMDA 2JCGA 3V9ZA 4Q6BA 3CZ5A 4DTPA 4PQUA 4WXMA 1KMIY 1HRHA 4JB2A 3MEGA 3O74A 1T8EA 2IPMA 3M8RA 1BAPA
chains in the Genus database with same CATH superfamily
3FGUA 2F00A 1EBFA 3UK6A 4X63A 5GGXA 2EFCB 1QZXA 5HCUA 3EY1A 1P1HA 5BQ5A 3PENA 4XVQA 4XRRA 1KO7A 3VEZA 3LTEA 1R5JA 3LP3A 3ZVRA 3DJFA 4H03B 2CVOA 1JQEA 2Q7XA 3I0MA 5I47A 5IK2D 3GEMA 4MUEA 5CA0B 4C6SA 4UOQA 3FETA 4G1UC 1LW0A 4ITRC 3NB0A 5E4TA 3ZIUA 4MUYA 3BMOB 1IXSB 3MX2A 2ZI7A 3GXOA 1Z62A 5F23A 2OFFA 1H6DA 5DTJA 3OBBA 3Q3VA 3I28A 1Y4UA 4R5MA 1MRSA 3RD5A 5E6UB 1Y8QA 3U7HB 4FXOA 4BIIA 3N28A 5KGWA 4G8BA 1AB6A 2YDXA 2AMJA 2VHWA 3IIIA 4X91A 4IXCA 3DHNA 3BK2A 3KB2A 1XWLA 1YRQA 3O8CA 2CD7A 3Q3IA 3F3YA 5J2TA 1SU7A 5J2NA 4TRJA 3R6LA 2IYSA 3FSRA 1OVYA 3USCS 4AM8A 4HB4A 3IAYA 2RC6A 3CCFA 3NAQA 1TEHA 1CEQA 1CY1A 1RWXA 2MHCA 4YCAA 4X8HA 4G5SA 4E08A 3AW8A 1QCYA 1X42A 3JQ7B 3W9YA 4ATNA 2IEZA 3CWQA 3ITDA 1RTDA 1MQ8B 3R7FA 1G98A 3JAWB 4BRMA 5TT1A 3WB0A 2V7XA 2C4MA 4MB2A 1FP7A 3EPPA 4A27A 2CK3A 3TTVA 3JTEA 5LQMA 1CLEA 3L7CA 4JSRA 2BFMA 1LNQA 4BFWA 1UT6A 5AQXA 2REBA 3ADPA 4O3MA 1Y9JA 1I7DA 1I4OA 1ZYUA 3W2GA 1VSBA 1PVOA 1IXYA 2FCAA 5I3UA 3TLCA 4TM8A 2GVDC 4FWMA 1AOXA 3F6PA 3SZMA 4BDPA 4XTCS 2FUG6 3MT8A 3KJVA 3NVDA 1T8WA 3BTSA 2HMSA 1R0ZA 1IJJA 4YRKA 1DADA 2OA0A 4XVRA 1SEPA 2AFIB 4PR0A 1KMQA 3AVFA 5BNTA 1QSSA 4ZYUA 9GPBA 1D3AA 2EQ5A 3ETJA 1FQJA 2ZBDA 1JEDA 2GWJA 2I8CA 3FZMA 1ZEMA 5B4TA 2NNLD 3VETA 5JQWA 3K31A 2Q0QA 1DWQA 5JLAA 5I9NA 3MSXA 2BGUA 1RTHA 1U6IA 3TAQA 3UJ6A 8ATCA 4A5OA 2QRVB 4BB5A 4NB4A 2CL6X 4L8VA 2EEPA 4NXNK 2QB5A 3G0DA 4R2WA 2HBMA 4JA2A 1O8CA 4NHOA 3VZDA 3R3LA 1Y89A 5AQRA 3TZEA 3AUKA 4JD5A 4UUMA 1X7WA 2WF5A 4QPCA 3R9PA 5F2EA 1UEXC 3DLCA 4BLSA 2DY0A 1E2PA 2HBJA 4C03A 4BYGA 5IMSA 1IHXA 4GXNA 5H4GA 4PKGA 3FWZA 4PQFA 1C81A 1UJNA 3UMFA 1S1CA 1KVAA 3QFTA 4GR9A 5AOCA 2BISA 5IWCA 4OJKA 2EW1A 2Z6AA 2LCIA 2D2IA 1PJSA 3ZCMA 3MCWA 3EIQA 3ZBPA 6Q21A 4MVYA 1JEJA 1M76A 1Y97A 3M1AA 1RT5A 3NT4A 1AZSC 2PMEA 4X66B 1PWYE 1X1RA 3VBEA 5C80A 3G9QA 1WMEA 1L7XA 2OORA 1F14A 2YZ7A 3NHKA 2GN6A 1FMLA 2HCJB 2YW9A 4TYWA 4KXMA 5FPNA 1T24A 4Q00A 521PA 3W5CA 2GM3A 3VTHA 3DMRA 1F9AA 1QBKC 4J2BA 3BTVA 3D2LA 3O91A 1RHKA 4B7UA 4FONA 2YXNA 1HXHA 1J5XA 1NRWA 2O2EA 4OQPA 1CEXA 4KBFA 4IWNA 5A9TA 3PUXA 1U3VA 1VQ1A 5LMNB 4JCOA 4OX9K 4KWTA 4QUBA 1MB2A 4E7PA 5A02A 3EZNA 3JU3A 3AL3A 3IR5A 2M98A 3E1KA 5HRPA 3LP8A 3U8XA 4ZAVA 3FPHA 1D9DA 3KKRA 1FK8A 5HIKA 3S41A 5ALXA 4K40A 4TL7A 4YI3A 2E48A 2PYJA 5LMZA 4QS7A 3LHDA 4UM7A 3RWMB 1OBCA 4W7HA 4JVNA 4MP3A 1KYWA 1A2OA 2OFOA 3A6FA 2IHUA 1FFHA 2X4DA 3HV2A 1RFQA 3V00A 2BFFA 2RGAA 3KKPA 2JJ2A 2PAFA 1VA5A 4C7VA 2W11A 5CLIA 4TZ0A 3BSFA 5A0VA 5AXAA 3D3JA 1OROA 3A31A 1TEVA 2PZLA 4W4TA 1M90O 2BFNA 2OCKA 3QFCA 3RVBA 4XD2A 1U3WA 4E0BA 2OBXA 4W1SA 2Q27A 2AX3A 4I0WB 1RCUA 2P9NB 4F3OA 2P6OA 2P41A 1NI3A 2VJMB 4Q39A 5CH5A 4B33A 1FYEA 1N5DA 4D26A 2WM8A 3GPBA 3KQWA 4TPKA 3S9HA 1N92A 2UYCA 2NZ8A 3T1YB 1NFRA 1DTWB 3O8RA 2JAOA 2FKAA 2F90A 1X9HA 4NATA 4JCCA 1NLFA 5IJ9A 1SXJB 2R97A 2BFCB 4ECEA 1XU9A 3OQOA 5J58A 3BE8A 3N7TA 5AZIA 3NKFA 3ZZ0A 4CZMA 2REXB 1QUEA 3CKKA 4OATA 2B0CA 5HOQA 5DGXA 1TFRA 4F84A 3TSPA 5DNYB 5HF8A 2X76A 2OYCA 1PR4A 2VPWA 3NRCA 3OHMA 5GY7A 5LD2B 4N8SA 1XROA 2F62A 4DSNA 4MJ3A 4RVDA 1UOOA 1ADGA 2Y05A 3G8AA 2BUBA 1GM5A 1JAIA 1RPJA 2WHQA 1V8DA 1G16A 1Z0DA 3FUXA 4G5OA 1ZMXA 3KUCA 4PN3A 3RSEB 1SC9A 1WUAA 2GWKA 4F5YA 1YRHA 3OQMA 4R9UC 4KNYA 4JXJA 5EKDA 2CMGA 3E5MA 2QM0A 3OE1A 4OHOA 1GLEG 1VAZA 1FU8A 1IATA 4ZYLA 5FPYA 3CLTC 3A3PA 5LJIA 1SHKA 4G8DA 5K9ZA 4YMIA 3ENOA 4GQBA 2R85A 3P5SA 4E22A 1XDSA 3SJAA 4J6EA 3KC2A 1R7RA 5KYXA 3L9XA 5AQ1A 1V7QA 2GK4A 2I34A 3RAJA 4AMYA 4EI7A 5FROA 4E5DA 2ZSJA 3GFGA 1TLFA 3K2BA 3RT1A 3HGMA 3PCTA 3NORA 5HYVA 2UKDA 1JEQB 1VPEA 2QRNA 3PQDA 3UZUA 1UBGA 2IZ1A 5FYQA 4OP1A 2PZBA 4CZFA 3NGLA 1LWEA 2A1TS 3ZDZB 2XYGA 1J5EK 5EOVA 2VDOB 1DMRA 3O3OB 1ADJA 3DSRA 4CT5A 2F64A 3SNNA 3JATB 1ZCJA 3FMVA 4JUDX 5EI5A 2QTZA 4Y2GA 2OCYC 2FW1A 3BT7A 1Z8DA 3CH6A 3VQ8A 3EQ2A 2A5GA 3MYRA 1GGKA 3A6EA 2O5EA 1JH8A 3OG9A 2FZEA 3N76A 3J7ZO 3B8HA 4L16A 1QQMA 3EY4A 5CG2A 1CZ9A 5T67A 3C3XA 4IIDA 2CNNA 1ECFA 5I3CA 3KQLA 2OANA 1YI8A 1GADO 4GT1A 4UOZA 3CEPB 2K2QB 1MV8A 1KFDA 4HNSA 1U6ZA 1YJWN 2IEDA 3ZQ4A 1ZWKA 4BQEA 3H6HA 3EZGA 4HX5A 2XY8A 4BRWA 4CEZA 2YS6A 5KCZA 3SHOA 1IXKA 4JN4A 4J2OA 3V6LA 4YJDA 2OMKA 5KYUB 3CURA 1M0EA 3TUZC 4KOAA 5GP1A 1HDXA 2CW5A 1UK7A 2H1VA 5E41A 3UB3A 3HPRA 2QT9A 1B3RA 2QAGC 5LKRA 3LFTA 4FSDA 4CF0A 1O54A 3TSYA 4IZHA 1F2TB 1GOTA 2HJWA 3NEAA 1IEVA 1Z17A 1T8TA 1JVSA 1TGOA 3GMSA 5IEBA 1R66A 3UXYA 5JMTA 1E6EA 1M66A 2PL9A 2VP4A 4Y2HA 1ODLA 3BS4A 1YBMA 4IHJF 4GPD1 2PMBA 2IYEA 3ABOB 4BNKA 1LNSA 5JNRA 1KFSA 2XWBF 3WDSA 3O3GA 3P0JA 1AE1A 3ZHVA 4JKEA 4MV8A 4WLVA 3AB3A 3ESRA 1T5IA 3C41J 4FIDA 3E9EA 4M0EA 4X62B 4JKGB 1T2DA 4I1YA 4ZOLA 3H1VX 1XT6A 2QR5A 3E9OA 5CFZA 2IVNA 4EEZA 3C6YA 1YB2A 4GXQA 2JDIA 1DC3A 3CERA 1R9GA 2ZB3A 1IJKA 4MINA 5E9JA 5I7HA 2ZBUA 3OEYA 2RCYA 3THXB 2AYYA 4W8OA 3O4GA 1AZLA 1ZMBA 5LLTA 1D2CA 2VDMB 4OI1A 3F2KA 3LBHA 2Q6IA 3NLLA 3UMBA 4EB3A 5AR0A 1RYNA 3AR2A 2Y4NA 1DPFA 3CW8X 2AYXA 3ROKA 3OTIA 3F78A 4O29A 5KPTA 3F4KA 2G8NA 4B09A 2BP7B 4ZJYA 1J1UA 4HH1A 5JRDS 3A0IX 1OB2A 5DNVA 4BZPA 4EYQA 4C4SA 1UBCA 3FYTA 4MEAA 4LVCA 1GKIA 2GJKA 5DLEA 5A4FS 2E20A 4P3NA 4QODA 4CHNA 3SEQA 4CM4B 2Z6QA 4BWFB 1I2MA 2B2XA 4LISA 1P2TA 4OAQA 5BW5A 3ZSOA 2I22A 1M1NA 3DVAB 3CNNA 2HADA 3KKKA 3ZUGA 2QVZX 2FWBA 5IKOA 1Y63A 3KVYA 1M2OB 2BSXA 1E2FA 2ZSAA 1R6UA 3OCJA 1KAHA 4KO1S 2M6RA 1PD0A 3LDSA 1CG6A 3RHSA 4MVJP 2I2DA 3LPCA 1T3ZA 4TUYA 2CXXA 4LXUA 4RTFD 3FPSA 3ZDCA 4L4UA 4DILA 4YRIA 1QVZA 4TS4A 4IL5A 5B1DA 4O63O 3LWLA 4KVFA 3RYCA 4Y6PA 2G1JA 2NV6A 1CUUA 1Y0BA 2ZSHA 4B87A 1MAVA 1DKMA 4PXAA 3K35A 3LZCA 3ZBQA 1LCIA 2VBFA 3PUZA 3OQVA 1RIFA 2ARKA 2PUJA 3OUUA 2FN7A 1WSAA 2HU7A 3K4HA 2YRXA 3MB5A 4WKNA 1DP4A 5KOHA 3SXUA 1ZO8A 4PV7A 3U7EB 1ODCA 1W29A 4WOBA 4YI5A 1JJIA 4K28A 3KQQA 4C23A 2I7DA 1QIGA 3MQ4A 1RRCA 1KVQA 3AFNA 1L4KA 4Z4HA 1V39A 3ZK8A 1KFJB 2XMRA 4QC2A 2BE9A 2QMUA 1WQ3A 2V65A 1CQIB 4R83A 4PCAA 5LP6C 3EK2A 4PZCA 1KARA 1X74A 3HSCA 2R7MA 3AVMA 3HUEA 4O6VA 2FNAA 4Q4LA 3GHHA 1Y3BE 1W59A 5ADUS 4RTPA 3BAFA 3STWA 4ZEMA 2PD3A 5K0BA 1TAGA 1T1SA 5FLYA 1FJ2A 3PUIA 5K03A 4MWDA 3DMNA 2GV9A 2OZVA 1AKNA 2P9PB 1W581 3W1EA 2R0QC 4LN1A 4LJ9A 4L8WB 2V7QA 1C4KA 5D01A 3IP3A 4HUFA 1JFFB 4KNVA 3IAUA 4K6GA 1RI1A 3Q5GA 1B92A 3SPXA 1E1DA 2I7NA 1X7ZA 2MWMA 3PU6A 3WLAA 4Q7MB 5KAMA 1P5RA 4BNVA 5TV2A 4BLUA 2D1TA 4FGSA 2Q9CA 5TNXA 4LE2A 3M6UA 5B7NA 5IKPA 3M3HA 4M99A 2HDNB 1XR3A 1BCRA 4F97A 5CEFA 1BG6A 3TTXA 2BKUA 4CM9A 5TS2A 2R1UA 4YA6A 2QWLA 2H5EA 4DUZB 2XUKA 5EMLA 2FA9A 3AY7A 4L6IA 1Y8ZA 1KZYC 4IOJA 5D3KA 1Q1NA 1PK8A 3RYTC 3RUCA 4TTQA 3K2PA 2QL6A 3N8DA 5BN3A 2A9KA 2Y0EA 4KXNA 1O94C 2H11A 1IH8A 5BQ3A 3EKSA 1OX6A 4ZVOA 4B5LA 1QB8A 3D4PA 5BSRA 3IODA 3KE9A 2R96A 1ZLXA 3OF5A 4UVIA 5IUKC 3UIQA 3OCZA 3IAM6 1B76A 3KQSA 2XSZA 4E03A 2QL9A 3T15A 1FP6A 1GGEA 3VA3A 2JJ1A 1OZAA 5SYNA 5IYZB 3IMEA 4FI3C 4CF5A 4ZAXA 2HMIA 1HQYE 1BDHA 5EMMA 1ZWLA 2OLEA 3AYZB 3PB3A 1V8BA 1E2IA 5C5IA 3IMCA 4JV5K 1W5SA 4MA0A 3UQYS 2BMVA 2YWHA 5AQYA 2I9PA 3EASA 4JYAB 1QPZA 1FUUA 4IDKA 4D2IA 4O25A 3LGAA 1RJGA 4JX8A 1JF8A 3BA6A 3Q5EA 1CQPA 4K5QA 1VQ8N 1NVVQ 5SZKB 1Y80A 3DFFA 2XMGA 4BE2A 1VJRA 4FFLA 4E1AA 4GZ3A 1RT9A 4CLOA 2XGMA 3UAYA 5A4DA 1VDMA 4Y0VA 3AILA 3GDWA 1JR3D 4OHFA 5DI3A 2A9QA 3C45A 4HNTA 1LQUA 5AW9A 1KLNA 5K3BA 4JHXA 3W5UA 4HRVA 5EMKA 2N1MA 4NZOA 2VPTA 1J2EA 1T6ZA 4OHCA 1NW9B 4B7AA 5DO9A 1U4OA 1ZHFA 1MAHA 2JBWA 2V6MA 2GAIA 3CHWA 2CYBA 3Q8XB 3VPAA 2ASPA 2X8LA 5AESA 2G4VA 5JZMA 4KV8A 3CNEA 3CA8A 4KUHA 1XTQA 3DKRA 3MBIA 1XCMA 2B61A 5AQEA 3ZH2A 3JQBC 1G4UR 1P1CA 4JLBA 1IO2A 2ST1A 5LA6B 1GKKA 1OPXA 2XITA 1T2FA 4I2VA 1F06A 2HU5A 4KLAA 1E9VA 2JBAA 4PBTA 1GG8A 1WG8A 2XKJE 4H0VB 2C9OA 4MWTA 5AUPB 1XZMA 3ESCA 2ECPA 3DXFA 2O2XA 3OYFA 2FK8A 5FQOA 1AKEA 1BVRA 3KZOA 5FH9A 3GLIA 1YASA 1QQTA 2GD1O 1XF1A 2IH5A 4ZDIA 3U9SA 4MZXA 1Q9XA 1K88A 3SBEA 4JI4B 3ZDBA 3FMOB 4LRYA 2OV1A 4TLAA 1W85B 4QBIA 4JITA 1B74A 1FZQA 3JYPA 1U1CA 4UASA 1EX9A 1X7YB 1QO0D 3BCRA 3OCYA 5IVIA 5KGXA 1F21A 3EEBA 2QIPA 2OM6A 1MXFA 4OPMA 2FW6A 2GPSA 3I1FA 4Q12A 1Z15A 1JIJA 1XO1A 3ECCA 4WPGA 4C21A 1KDOA 1A9RA 1Z28A 4HUQA 4RY8A 2GKOA 4KODA 5ALQA 4ILKA 4GX2A 3W8RA 4KLZA 3AY0A 3L6EA 2JGKA 3OCVA 1QAQA 3MB8A 4JA0A 3RRBA 4KMMA 4BWYA 1K6XA 5E3HA 5ITSA 3O2QB 2CC2A 2HRZA 2DPNA 5DF1A 1BU6O 3BY5A 1V1MB 4MKXA 4RTQA 4RTMA 2N1BA 1C1XB 1G8GA 1ZBFA 2YIVX 1E8MA 2EZ9A 3MGKA 3MUFA 4UDNA 3R09A 3WIBA 2I2FA 1FNNA 2ZATA 3OA2A 3CZ5A 3LSYA 4DTPA 3ILXA 3WBFA 1GTL1 4HYYA 4JKOA 5HGJA 4YJ2F 1KAYA 4LWZA 2FGKA 4D97A 4PNEA 2AZDA 4UVDA 5K3SA 1WXHA 4ZMBA 2D0PA 2X1VA 1IN8A 5FPPA 1I6KA 1TQ8A 2BGKA 1WVIA 4ZVNA 4ZCRA 2FWRA 2V3VA 1F7UA 3F90A 1QIEA 4J1SA 3UT5A 4QLOA 1QKJA 1HFEL 3JQFC 3H3JA 2PNJA 1DV2A 1YF5L 2QRZA 2F48A 4YQFA 1LK5A 3I01M 2BKVA 4JEPA 5AI0A 3JX9A 2JLUA 2XX3A 2I76A 2RJ3A 3BRWD 3L4KA 1J21A 2RB4A 3JZAA 4FFRA 1YF3A 2NTYC 1SZPA 2B5OA 3AVNA 2HWYA 1CZUA 5A3SA 3S3OA 5M1PA 2VFAA 4FNGA 2A9FA 3LZ6A 4NVRA 3VJRA 4EPVA 4YNBA 2VK8A 4XSVA 3VEWA 5DHAA 4YAEA 5BVGB 1U80A 2NUPA 4HXGA 3ZUPA 1BDJA 3TLEA 2XW6A 4DV4B 3BL8A 1I51A 5CEEA 4ELUA 4QTYA 1HFJA 2H51A 4IJNA 5HX7A 3LXUX 5KSWB 4BR0A 3RUIA 4CIEA 4INOA 4N1AA 3AA2A 3O3CA 1GL7A 1GGFA 3MW8A 3THWB 3M83A 1QTRA 5BMVF 2WUFA 4HGQA 3DT9A 1F1JA 1U2ZA 4OXKA 3L6UA 3RTVA 5A62A 2W6OA 3TI7A 1I0LA 4UHKA 4DLKA 1U8TA 3C70A 3QQPA 2EJTA 4H6XA 1XHEA 4ND1A 2DECA 3ZH9B 3RT7A 1MU2A 3H9JA 4DFPA 5DYGA 1V96A 4ZHRA 3Q7CA 1ZS9A 3BSYA 7YASA 5AVZA 3O31A 1E58A 4M8IA 1R0LA 4LY0A 4B3FX 3RREA 3SEAA 3FZKA 4YOVA 3EZ6A 2LD4A 1EEHA 2RFLA 4X3PA 1EWRA 4BE7B 3ENZA 1GPUA 3EARA 2ZWHA 1OF1A 3T06B 4K43A 3GL1A 4O4JB 4JKAA 3EF0A 3IFSA 4LSLA 4Q01A 1FFWA 2F8TA 4IX9A 5I45A 2DHQA 4BWVA 3LC2O 2OSVA 3RRXA 1BDMA 2GCOB 2BBTA 4C2AA 2WR8A 3AF6A 1PDVA 3C6KA 1PHRA 3GG4A 3PQ5A 2IXDA 2GSWA 1ENZA 3NTRA 3ZETA 1RAEA 3SS8A 3M8QA 3PF9A 1PX0A 1E77A 1P18A 5FADA 3IXQA 3VGMA 1WP9A 1DKRA 3TZQA 1IBSA 5CLQA 5AQQA 3TGLA 1H2ZA 5B1SA 3PZBA 5LXTF 4L15A 1N9GB 1UQRA 1HA3A 4ML3A 2IEGA 1XMPA 2VF7A 4PA1A 4XGIA 1QR6A 3DNFA 4C04A 3VR4D 4XW2A 1P3DA 2XH8A 3VO1A 4G63A 3N9IA 1RGIA 5GINE 4H1VA 4S2UA 2YNGA 2RBEA 4P4GA 2H1SA 1N3LA 1SRQA 3KQTA 2FMXA 1HR0K 4LGVA 1ONOA 1P31A 3R0XA 3KIOA 1SMKA 2DR3A 4QT0A 3UB5A 2UDPA 2Z8YA 4NP6A 2GR9A 1C0EA 2AW3A 1BJRE 4QQFA 3ROMA 3RSHA 3BHJA 1GAJA 1NQXA 4AVYA 1O57A 5BXQC 1EE2A 3ALYA 3O3MB 3FOEC 3F47A 1N2HA 4LGYA 5LU8A 1K1EA 4AHTA 5IBQA 2C7PA 4YAUA 1QG2A 2IKQA 1D2AA 1ZL2A 4BNYA 1J9AA 3I76A 1H0SA 1FNCA 1RXSA 4GI5A 3FOZA 4E09A 1E3QA 1JXOA 1KL7A 4GOXA 3LIPA 1PR6A 2ODPA 5ICCA 5HPYB 4OF4A 3DEJA 2VF4X 4D7AA 4QM7A 2VG6A 2FG5A 1CETA 4G9BA 4JLSA 1W0JA 5DDIP 4Y0WA 1L6IA 1CUIA 4KAFA 1ZGGA 1BL3A 3KT8A 1NGSA 4KWCA 3IBYA 1BMFA 4B48A 4KAXA 4AJ2A 1BISA 4QUKA 5JPDA 3AG5A 2HA0A 1PFVA 3V1TC 1E1YA 2DFPA 2P4EA 3ERCA 2PCLA 2VJKA 2XKAA 2HWUA 4CIVA 1CZOA 2P6RA 2O3SA 4N5SA 5KQDA 1PL7A 1ZHOA 2AE2A 2A41A 3VU1A 3AVGA 3GRKA 3LMKA 4BUJA 3CBQA 1Z26A 1MA0A 1OIWA 4BECA 3D0RA 2DETA 3NR2A 2O0LA 2R3SA 4LYEA 3CLSC 4N8EA 8AT1A 4HT3B 4PG8A 3VQTA 4BRUA 1H6CA 4WCDA 1FS6A 3NWEA 1K89A 4KLRA 1DL5A 4UM8B 2P3QA 5LKAA 5J4HA 1YQEA 3ZV4A 4EMUA 3KHUA 4Z5XA 2O8DB 2E1YA 2WTAA 4MHOA 3W05A 2I2AA 2XE6A 4YOWA 3RR2A 3MWLA 1VHLA 5FPTA 2OO5A 2ZWMA 3WISA 2JS7A 1XF9A 1VBNA 1I5RA 2HA6A 1HE8B 4MITA 4CBXA 3TAUA 1SPBS 4DMCA 4G56A 1XYYA 2UUAB 5ALTA 4DMUB 1SUDA 4RVHA 3ZD6A 1SVKA 5FNVA 3N8GA 4DJJA 1XXLA 1CQXA 1RC1A 4HNAB 1TM4E 1DTQA 3AGRA 2RAUA 3EHDA 4D0NA 4QSHA 1QHNA 5CA0F 2OGWA 4JWTA 2RGWA 4GBJA 4IDAA 1JEAA 3BQNB 1NK7A 1A4RA 3U81A 2HZBA 4BPRA 4L0QA 3OECA 1JIUA 1OE0A 2YNMC 4TVKA 3TRFA 1T6CA 1Z08A 2LGJA 3BORA 1QMPA 3WQRA 4EHUA 1HYSA 3RUAA 4CEJA 4YJ3B 1Z63A 2WUSA 4O33A 3Q1KA 3ESZA 5BW4A 1PNTA 4YV7A 1TL7C 1KGSA 3WGHA 1UKVY 3C6UA 5J2UB 3KQHA 4G3XA 1JKJA 1ATZA 3IULA 1E2KA 2H1RA 4TTTS 3KCNA 4YMTA 1PEDA 3F3MA 5IJ0A 4KW7A 3REOA 2ZK7A 4BG9A 5BSFA 4TSRA 3NBPA 3MWGA 2F4VB 1K4KA 4EKIA 3IBGA 4M3ZA 3LT5A 2GCEA 1I6LA 4P34A 2NU9B 3ISJA 2O59A 3DMFA 1NULA 3RLFA 4MW0A 4NR0A 4NIMA 3ZEAA 1W2HA 2D4AA 4LKRA 2EX1A 3IT2A 3EE9A 1JDUA 3AETA 4UHEA 1NVGA 3NOXA 1Q95A 1YQTA 2QRUA 3THRA 4CGHA 2I6UA 5KJ1A 3DXZA 2X7XA 3K2QA 1X38A 1SU4A 3G8YA 3VHXA 5E9AA 1NNLA 2R44A 2PIDA 3ZDQA 3T1QA 4ANFA 1CJTC 2G1KA 4JBLA 1XLUA 4AO6A 2QR2A 1LAVA 1ZW1A 4XWYA 5TSDA 3AO4A 4RQTA 3HJRA 4HHEA 4LJ4A 1G0OA 4XYEA 1HQUA 3ZGYA 5I9SA 2R62A 1FXXA 4D42A 2Y1IA 9ATCA 4BKUA 1YB1A 3LLCA 5DOVA 1JG6A 5BV1A 4JJKA 3ZW7A 1TKTA 5M1QA 3QE2A 3LGXA 4HYEA 2WV9A 3LUFA 5M04A 1SUCA 4C0QC 4DDWA 3FFKB 1FLDA 3OPNA 4KQWA 4FM9A 2HNKA 1IWBB 3ZJTA 3WL6A 5FPKA 2Z4RA 1PZNA 2B78A 1T3TA 2C3OA 1ZXXA 2JGIA 1E1RA 3UB4A 3UENA 2F9FA 8OHMA 2ZUBA 2VTBB 4E14A 3Q8KA 3SQMA 2QTHA 2XMDA 3BXOA 4PZDA 1A98A 4LE1A 2CVZA 3CCRN 5BREA 4EO9A 3WJ2A 1KJZA 3RVKA 3I39X 4DQLA 2IYPA 3S1SA 4OQMA 3P5BA 3CUWA 1JRLA 3WGZA 3TL3A 1JFTA 2WHYA 3MIZA 1FDOA 3LA8A 3X1KA 1LRJA 4LZAA 4A0FA 5ULLA 1BFKA 1YR6A 2YV3A 3L8CA 1UWKA 3A9VA 1AUOA 4XLTA 5LQNA 1FA9A 4OB7A 3AG6A 2G9RA 1AF7A 4GECA 5IJWA 4C05A 4FYIA 3HA3A 4OD0A 2C2ZA 3FYDA 3D0KA 2JIZA 2E7ZA 4BPBA 2HXYA 3H8SA 4PGAA 3I1YA 1GYQA 1R0AA 4WY8A 3DDHA 3L8FA 3ULDA 4JGIA 4HDMB 3LYUA 3OVMA 1YC2A 3M6VA 4ENQA 2P5SA 2CZGA 1XCPA 1NYRA 3IDAA 4YIHA 3L7BA 2OD2A 2AXPA 2JFPA 4EJMA 2JD2A 2G80A 4MKHA 2GVNA 3KB6A 2ORWA 1CCWA 3FWKA 4IIBA 1GRCA 3P1GA 1Z0JA 4YRDA 3HACA 2XT9A 2ZYHA 3R40A 5KQLA 2NT4A 2Z9DA 1KSGA 1WWKA 3D8HA 4BO2A 4TS3A 3ER9A 1LSSA 4EPYA 4O1MA 1WDTA 2AWOA 4DQVA 2OPPA 4ARVA 1TK8A 3UWOA 1T3HA 4KOEC 1SZ2A 4IO0A 1Z4MA 2PUTA 1ZH4A 2FZLA 3BIOA 3E2IA 3JVVA 4Q1CA 1B4DA 4DQIA 4L8FA 3DMGA 2WIFA 5DW3A 5CX4A 4R8SA 1V35A 4HAIA 4INPA 4IH1A 5IRCD 1R6XA 4HDAA 4DSOA 1O8BA 2A94A 4KACA 1VIVA 2OENG 1VPVA 3ZPXA 2BGLA 2VZLA 4FYHA 4WY5A 2ASEA 1BDIA 2A42A 1IZ9A 3SC2A 1C2YA 1JSCA 1FU4A 3DT6A 1QGAA 1LPOA 2NV2B 2ZUFA 3BEXA 4N8DA 5AW2A 3UXHA 4AKSA 3BEDA 4UTPA 5J2MA 1T6BY 2V7ZA 3UKUB 1A1SA 1K7CA 3JW8A 2IVZA 8ABPA 4L75A 3V9UA 3BX1A 4JMPA 1GG2A 4TN5A 2JG3A 5CH3A 3TZHA 2B4TO 1DQSA 1T43A 4HLUA 4DS3A 4E4YA 3NH2A 1EDEA 4MVCA 3SHVA 4E30A 3QVOA 1XVUA 3O1LA 1TIBA 4QLBA 2XNHA 1Z33A 3CZAA 4ZVRA 1DT3A 2FC0A 2VA9A 4ZQIA 4YV2A 4QARA 2FQWA 4U00A 1ARZA 3AJRA 5BW8A 2FPXA 1QE3A 1E2MA 5TEWA 2YN4A 4D80A 2HLDD 1LTQA 4YX9A 1Y4ZA 4KQIA 4OQZA 4H7EA 4M7RA 1QX4A 3KLPX 4IIXA 1YNOA 2WAAA 4WZBA 2RKBA 3EGXA 5DX8A 4V0SA 2K5UA 3QESA 3DMDA 5IAOA 3IIEA 4D9BA 4NWIA 2HHXA 3ZY4A 1DCTA 3NYIA 3P2JA 2XB9A 5B3JC 2Y1OA 3TR8A 1OWNA 2PKQO 1BH2A 3QJGA 4LXIA 2VUHB 1UAAA 2HXGA 4B9VA 4NBNA 1VE6A 1QHTA 2XOKA 3T5GA 2XTMA 4EITA 1H66A 4EUNA 4H18A 2PH5A 5AJYA 2XCQA 3MWEA 3SZUA 5ERYA 3PC6A 3RKRA 1LRLA 2Y67A 1FDVA 1T05A 3TTDA 2QV0A 2PX6A 1D8TA 2VYVA 1XMQK 4D4HA 1JAYA 4XJXA 3K4PA 1JLFA 1R4ZA 3P45A 4QGSA 4TXHA 1WO8A 4MI1A 1JXAA 2IU4A 4CDMA 2PD6A 1YE8A 4BEJA 2W2LD 3N8NA 3WAJA 1NLVA 4RW6A 4IIJB 4S04A 4YRRA 2UVPA 5HK8A 3E3NA 5JRJA 4E94A 1SUSA 3SAGA 3PFNA 5FI0B 1ADBA 5CUQA 1QCZA 2J87A 4Q9DA 4IH4A 3EJ6A 2Z09A 1HLPA 1JEYB 4I46A 4DU4A 3G8CA 3M8PA 3PY8A 1WLYA 3A5LC 4B7CA 1J9GA 1T1JA 3WLPA 3BBLA 4LCJA 4MW1A 1VBFA 4CCWA 1JQ3A 2VATA 1M7BA 1YACA 3GFBA 4YLEA 1SUFA 4WZAA 4XKJA 4DQUA 4YFYA 3AM1A 4XR9A 3QLVA 4F56A 3FYHA 1H6BA 2BV3A 2Z8YM 1T4MA 4ENTA 4BO8A 3FFIA 2J0VA 1P29A 2PUEA 1N2CA 1U4BA 3ITHA 3G59A 3T5TA 2O7NA 5A5GA 3CNLA 1Z6XA 1R4MA 3N87A 1L5RA 3VAYA 3AARA 3CW9A 2OFXA 2Z2IA 1XTPA 5TPWB 3ZCXA 4I99A 4LGCA 3MJRA 3K9HA 3ZWCA 4IV5A 4DN6A 1YS9A 5JCJA 4L76A 2GFHA 1ZJJA 2EHDA 2VYFA 2A2ZA 2GX6A 2VNHA 3UV7A 4QNRA 3TAEA 2W2NA 1JMKC 1I1NA 1FFCA 1W47A 4P0TA 2F96A 3CPEA 1RWWA 1CKEA 2QP3A 1T36A 1QCDA 1XEXA 5AO9A 3HVRA 4CD3A 3I3SR 5JPIA 4E5UA 1KH3A 1JPJA 3J80O 2E4WA 3DL7A 2Q3MA 1VYTA 3FUVA 3FMPB 4DIFA 2GLXA 1JE1A 3THVA 4WUVA 1X7GA 4B32A 5BYBA 3IUPA 1QZ5A 4CMIB 5LMUB 2D4WA 4JJGA 4AXBA 4BB9A 3FZEA 1XRNA 1W5BA 3KAQA 3AERA 5E2BA 3EWNA 4MV3A 3WYNA 2QORA 3B1JA 3A37A 1ZPDA 4V2IA 3B7PA 2JEZA 2HSGA 2O6HA 1QNFA 4K2AA 1KDPA 3UOGA 4HQNA 1MO6A 3MEEA 4MPJA 1RWMA 1I2AA 3NYRA 1GPBA 5EGSA 2QMOA 5C8XA 2R86A 2WMNB 2NGRA 1OX5A 1L5OA 5H4HA 4H17A 5WRFA 1HDGO 1XZDA 3ON5A 5CX1B 2LR0A 1ZM3A 3ELDA 4P3OA 4DEYA 2OAQ1 5JVDB 4ZTFA 1RT6A 3C3EA 4DDTA 1NRXA 4K2HA 3DEHA 2WIJA 2CXNA 4M98A 3KB8A 5C5DA 4EF5A 1BRMA 5BPNA 3H9GA 4JELA 1WNTA 3LKZA 4U2FA 1J2UA 3U9DA 2OYRA 3FPFA 4CR7A 5DSXA 3OY9A 4ZZ1A 1P2BA 3UF0A 1M9NA 5CXXA 2GEUA 3EGIA 3GEPA 3HVJA 3OYDA 1X1PA 2WD9A 2BEVA 2XOEA 3AWIA 4WQMA 3W0LA 1P8AA 5L4SA 3FRJA 2V55B 4B9NA 4H31A 4B3TK 2NZTA 1M6YA 1TUBA 4KQFA 3TDMA 1SBZA 2V6FA 3BM5A 4ZT4A 4OQDA 1RWBA 4P98A 4E89A 1CZBA 1YA8A 3FNBA 1LY1A 4HSEA 2ZR8A 2VQFK 1PJCA 4TT8A 2VZEA 4PTLA 1A5XA 3K53A 1F2UA 3L06A 4G0UA 1MENA 1HNZK 2PKQP 2JJQA 3P96A 1UJBA 2LBPA 2GEBA 1IJBA 1TK0A 2ZIGA 4G09A 1H0RA 3AXTA 1UM9B 1UOEA 2BW0A 1P7VA 1CY8A 4FSVA 5BNFA 2IHVA 2OQVA 3BWCA 4NK4A 3EVNA 3GUVA 3KXIA 1MHPA 4HEQA 1JTEA 2HJSA 3VYSB 2CLSA 2B1QA 3VM6A 2DT8A 1U7TA 3ZXYA 2CE2X 2XCOA 3QYAA 1RDDA 3GBSA 1Z8FA 2QQFA 2NOAA 4EGCB 3HUTA 4E7OA 4EB0A 5H59A 2DVMA 5CYMA 4D3SA 2WKQA 3KPYA 3R9XB 4DLYA 1SZJG 3FOCA 3RTGA 3JSAA 1KMIY 1YVDA 2Y6VA 3NAMA 1JHYA 1QVFM 5T8KC 5BXYA 4ZAGA 4R68A 4JI2K 1RJEA 2C2YA 3C7NA 4ZT5A 4WKGA 3JWHA 2VBCA 2IDOA 5E8RA 3LPAA 4LXTA 2FMIA 4CKWB 1FPMA 3UMSA 5ES3A 2HBKA 5HQ3A 5EWMA 3LDFA 5ARBA 2SBTA 1U9YA 2VZ0A 2FN8A 1ONNA 5AM3A 3EC2A 5FKJA 3PQ2A 3KP1A 4KHQA 4CEHA 3KYDB 4M1OA 3CONA 1IUPA 3NAGA 1Y3FE 2VNAA 1EK1A 4DB4A 4BS9A 2GK3A 1O77A 2G17A 4ER7A 1D9XA 1JHOA 1OREA 1DXQA 4PWDA 4MLHA 3FKSA 5JSYA 3QSGA 5J40A 1U6KA 1HI9A 2GZSA 1YE3A 3QYFA 2NXJA 3WSTA 3H1EA 2AVDA 2IIVA 2ZM6K 1XZCA 2PMKA 1Y6ZA 1BXGB 1CYDA 3KD2A 3M33A 5K45A 4WBXC 1NJWA 2FBTA 3EDCA 4FHDA 1RQNA 2C5BA 3JXEA 3LX6A 2JIMA 2G8LA 4Q6WA 3UKDA 2G06A 3DDCA 2COEA 4F9TA 4B3SK 1HBJA 2QTTA 2HV9A 3DZJA 3WLHA 3DZFA 3D81A 1E4YA 1KJWA 3TR0A 3OEWA 1KO8A 2P2GA 1W25A 3I01A 4DNQA 3MBKA 5CVTA 3ZWBA 2V9PA 1GGMA 4YFVA 2YWJA 2WM2A 5AVVA 4GUAA 2PV7A 4LDAA 1T8RA 5KYKA 2WSBA 3QHQA 3IALA 2RK3A 2QE7A 2P7HA 1ZOIA 4EQ6A 4KPFC 3LBAA 2PL3A 2CVPA 1CR1A 2CUTA 2GPYA 3DMTC 1GQOA 2POCA 3N8HA 5ALNA 2G8UA 4DR2B 3OPYA 3V34A 4FCCA 1MVOA 4NSNA 4BLTA 2CZQA 3L05A 4E5MA 3ATVA 3VTFA 3OA0A 1L4EA 3C5WP 2GEVA 3WGGA 2UXBK 2VHCA 5I6DA 1QZTA 3PTLA 4X84A 3KT0A 1I0IA 3H2IA 3PFCA 5ESRA 1AQNA 4F2GA 3K94A 3P31A 4TV9B 4EHBA 5JVHL 2V7EA 4GPTA 3WMFA 1G5QA 1EH5A 3JALA 3IP9A 3OJWA 2Q29A 1WXXA 4UMEA 2FPGA 4NOLA 1CUYA 1XPRA 2C5FA 3WRYA 4L2IB 3A9WA 3I9JA 3HR4A 3H1TA 2O8FB 1ZNXA 3S2UA 4C8OA 4I8XA 5EXWA 4AHSA 3K5NA 4NCGA 2QRLA 3RK4A 1T6NA 4MUFA 3C43A 4XR4A 1HZZA 3K9FC 2NZJA 1NN1A 1EGHA 4M8NE 2I7PA 3TSQA 4JQZA 4ZJUA 5GAHP 4X7RA 2HTEA 3ZU3A 3QKRB 1DIAA 4TZKA 2C9MA 1D5WA 1KAXA 3ZIAA 4G65A 1QHYA 4K8RB 3JTMA 4OQXA 3HEMA 1CXQA 1ADCA 4QL3A 3CC8A 3QU5A 3EPRA 4U6NA 1XMIA 3CJ9A 1BSVA 4GSYA 1VE3A 3WIUA 2VUUA 1ILYA 3RYIA 2DUUA 2ZJ8A 3R41A 4Y67A 4IVRA 2XUZA 4NEQA 5JAQA 3PGVA 4GRAA 5B2ZA 1GQQA 3OYIA 5FT9A 2OA8A 3D5TA 3IDFA 2UZ4A 4QXOA 2MSDB 4H9GA 1F5NA 3W5HA 3V1YA 5IABA 1SFRA 2YWXA 1JLLA 3QMWA 4CM8B 3NBYC 4DR7K 4GEKA 1T8SA 1SXQA 3FLBA 4AULA 3FLMA 2R9VA 1LC0A 3FDJA 2YJ6A 2QTBA 1HPLA 4BNFA 2PZKA 4KREA 1JAXA 4X6XA 1UBRS 2QUIA 2ZIUB 4UZEA 5C46F 4Y2JA 3G85A 1R4NB 1K92A 4HWTA 3ZZMA 1ITZA 3EEFA 5A1TA 4F4CA 4BN4A 1SUIA 4RY2A 1U2GC 4TMYA 4ZV9A 1A4XA 1OAOC 2AFHB 5HE8A 2G72A 2HX1A 1VQ5N 3T7RA 1BCOA 3EC7A 4BV3A 1NMSA 1BFDA 3DONA 1JV2B 1DHRA 1MB4A 4OIFA 5KYYA 5FRNA 1FSGA 4PQEA 3IXLA 2WHPB 3E1YA 1N57A 3IL2A 1L7PA 2QUAA 1I3AA 1ISJA 1TC1A 2PLFA 4DEXA 4M6WB 3OU6A 2Q3HA 4Z54A 1V8ZA 3QU2A 2JGAA 2E5FA 2YY6A 2BM9A 4FZZA 2JHFA 3HB0A 1NV8A 4JLAA 2EP5A 1DAKA 1EQUA 4DIOA 4E6EA 5F33A 4MXDA 3I9MA 3L7LA 4K8XA 2WWGA 4ZVPA 5BQFA 4RABA 3HJHA 2H7CA 4REQA 3TTUA 1C3XA 1D04A 4U7TB 3ABSB 2ZEJA 4FCVA 3RROA 2HF9A 4TKVA 4I3GA 2NZXA 1Q50A 5LQDA 4DV2B 5J23A 2PLRA 1PLJA 1DFHA 3WQSB 3LRPA 3FDIA 3RUPA 4B4DA 4TXJA 4L8YA 2OGSA 3HJFA 5HFJA 2NQ2C 4FFNA 4ZRNA 1WCIB 4RCYA 3MWTA 5IBRA 2WKWA 1XNQK 3DH0A 3L6CA 5DT9A 5BOVA 1O0BA 3GHYA 2E5LB 3PC8C 4WLNA 1L5HA 1YBVA 2FX5A 3N2KB 5C35A 3IUEA 1QQ6A 3KFLA 1IBKK 1BOFA 3UHFA 3OM9A 1V71A 3KNZA 4ZAWA 1Q0LA 2QU8A 1J8MF 2D1YA 3NOOA 3AFMA 1VJCA 4NEHB 3BERA 1ULAA 1S3IA 1KY3A 1Z34A 3R5TA 1SO8A 1OVMA 5L6LB 3F7NA 1GIAA 5ERXA 1IWOA 5DNUA 4CQMA 3JYNA 3MLBA 4HDSB 1U5CA 3K6RA 1UBOS 1T2VA 2FPPB 5TX7A 2QSZA 1BN7A 3NVMA 4LOJA 4ZARA 2PWYA 4B1WB 4BRGA 3GVXA 2FWNA 4UM9B 3U3GA 1JFLA 3FX2A 3L02A 3EZ9A 2H92A 3RADC 1WBJB 2WAMA 3L7YA 5BOSB 4MYRA 1M6NA 3GAFA 1J49A 4PYMA 4WRRA 3DZHA 2QUJA 4R6XA 1OIXA 3PDIB 5J2PA 4JKCA 2DQZA 2HA7A 1QYCA 2OPRA 4PLHA 4EB6A 4E1NA 4YRNA 3UJHA 3HZOA 2JPDA 4HWOA 4R1QA 2DAPA 2C1ZA 4LKOA 3L82B 3RRYA 1BYUA 3FNRA 2E21A 3QE4A 3OESA 2EQBA 1FXSA 1X3NA 5KJFA 2V6GA 1OKKD 3UHOA 4KDRA 3U4DA 1GPKA 5DSZA 1Z6RA 4I14A 1ZXBA 2BVNA 2O4GA 4EL0A 3JPYA 3OOSA 2PG3A 7MDHA 4A0SA 4J0KA 2OWEA 2WUWE 5ITVA 1IQPA 4P2GA 4NBWA 5NLLA 3O4QA 2WJHA 3EVZA 2GTDA 1MW9X 1XLVA 3AQ4A 1CC1S 2VA8A 1U0SY 4ZGWA 4TLDA 4AWBA 1V47A 1VPLA 4EY7A 4F3YA 4DCNA 4DPLA 4NV0A 2HQSA 3CNBA 2ZE6A 4KYIB 3EKUA 3I33A 3IDHA 4MQ5A 2WG1A 1LB1B 2XY5A 2YJTD 2ZIEA 4MPTA 3QWAA 4HX9A 1SR8A 1GZHB 4RAQA 2CNWD 2BEUA 5HGXA 4PINA 1S3XA 2ODQA 4O4LA 1Q19A 4TTJA 1C7IA 1C1CA 1EUDB 4MKIA 4K6KA 3U48A 4A8JA 5D3QA 5ICEA 3LBIA 5AOVA 4DC0A 3AR9A 2HU8A 2FPLA 3LCJA 3GMDA 3UANA 6GPBA 3WLNA 3GQBB 2EJUA 2R79A 3F0TA 4PW0A 3K59A 2VS1A 2Q0XA 1Y3AA 5CLGA 4EJSC 3GC6A 2PUHA 5DHTA 5LSAA 1NW8A 3CUKA 3ZKWA 4PYNA 3ID6A 1Y9AA 3BD7A 3IOEA 4BCDA 1ZGAA 1SKSA 3OW2M 3SYNA 3P2OA 1TUEA 1MAWA 2NN3C 1QRRA 3OYLA 1M2JA 1NVFA 1T9ZA 3AR3A 3PXEA 5JZBA 4I55A 4NOMA 3HB1A 5SZHB 3A3KA 2P1ZA 5CU7A 1PT7A 4JH0A 3AY9A 3VGPA 4QO8A 5EUQB 8LDHA 1ZA2A 5DNWA 2JGDA 5LJWA 1I3MA 3FJOA 3SQNA 3S27A 4WLEA 5BN4B 1XC3A 1VCHA 3DULA 1HC7A 4YJGA 3OFSA 2XMBA 3I55N 3RMAA 1T9HA 1YVRA 3QF4B 5IF9A 1BX0A 3G23A 3W3ZB 3JYHA 5LYJB 4WHMA 3QUSA 3HSYA 2BZ1A 1L4FA 3O8DA 9LDTA 1GRQA 3DT8A 2WU4A 2PY6A 5IAAA 1I24A 2IYUA 3DFZA 3IIJA 3STUA 1MT0A 3A7DA 2VT2A 2FF7A 4INAA 3VSEA 3WADA 4HL6A 1ODFA 1EA7A 2HA4A 3VU0A 2Q5IA 2ORYA 3D8BA 5IZCA 1N77A 4IF6A 3EUEA 2WONA 1UBNA 1UJCA 5KTKA 3V9AA 2SHKA 3EVCA 2IPAB 3N0XA 4E2FA 1SQSA 1UDAA 1VKHA 5DT2A 2J3MA 3V7YA 5JNVA 5LZ5A 2H9YA 1J6UA 3EXHC 2R1ZA 4UFOA 3NFAA 3ICQB 5D3ZA 4X61A 5LUBA 1YS7A 3CLTD 3WKAA 4DR1B 3MGCA 5K0JA 2EATA 3EPHA 4AJKA 5HZMA 1F48A 3RJZA 4RA9B 5FBRB 3CRVA 2KI5A 3BWDD 2IZ5A 2XE4A 1P60A 5BQPA 1J97A 3V4RA 3N05A 1KK0A 1RQ7A 4XDHA 4ZYXA 1J2JA 3M34A 1R9NA 2XTZA 4YXWD 3JRNA 4RNDB 3RO7A 4P22A 3ELWA 4NPAA 3L4BA 3C1AA 1HE4A 2VZ8A 1QP4A 1LJUA 3WGJA 1OYVA 1TFUA 4LHSA 1RILA 2X2PA 5MF6A 2LWIA 4MEBA 4NZMA 5BSHA 5ALVA 4GU5A 3TLAA 3RR8A 2H0AA 3M4YA 4E21A 3KRTA 4DHEA 1TQ2A 3D7MA 2L82A 4M0UA 3OF3A 3GRZA 1NRJB 4JR0A 1DBRA 3BGSA 2X8JA 1DBIA 2P90A 1I39A 1PT6A 2P6NA 2NU7B 1FDIA 1U7PA 1Z6PA 4I4TF 3FDFA 3GRYA 4KPUA 5FDFA 3EGEA 3SM9A 5K0EA 5DULA 2XDWA 1V1RB 1SBHA 2AMYA 4UREA 5AVQA 1SB8A 1RIIA 3DV0B 2FX3A 4D79A 2Y68A 2R8XA 1UZLA 2MMCA 2C7RA 4U6QA 3Q8LA 3AA4A 3WWZA 2QM3A 2GA8A 4X1OA 5LXTA 3WXJA 5CFQA 4RGYA 4MGEA 1F8FA 4V3BA 3LW8A 2VDKB 1L5YA 3TCNA 1WSJA 1KZ6A 2P9QA 2PRYA 3BSSA 4DLLA 1VTKA 2AC2A 4L22A 3FHOA 5KWVA 4BFSA 3A70A 2R48A 1YTUA 4GWKA 3NC1C 2ZT8A 4ZVSA 3D0OA 3HUDA 3QVMA 1M75A 1R6BX 3F3SA 3KQPA 4OJQA 5A71A 3PYLA 1DIHA 1I7NA 2ZI9A 3PEFA 2XBMA 2JASA 1UT8A 2D5CA 3KEMA 4KO8A 5REQA 2VL7A 5FWYA 4DMHA 1O6ZA 4G8JA 3BGRA 2FPIA 1YHNA 5JNSA 3LPDA 1TJ4A 5HBGA 3RHZA 3P9NA 2WU8A 3MJDA 4EA8A 2E4LA 5AJWA 1WXEA 2IYYA 3O9RA 1WY7A 4DAEA 3M5RA 1ZVQA 4F60A 3AFGA 1UR5A 3DFMA 5JCZA 3X0DA 1E94E 4BNHA 4MTLA 4Q3EA 4C7KA 1QPGA 3LW7A 1VE7A 4FJLA 3LBNA 3V1LA 2EC5A 4BMXA 3PGMA 3FDZB 4F3TA 4WX2B 3EVGA 3PHCA 4E11A 2Z43A 2NVBA 1YCFA 3GF4A 2R60A 3MAJA 3TGPA 1TMYA 3TX6A 1JQLB 3DG9A 1BI4A 2IUTA 1DFGA 1W36B 1X7XA 2ESRA 4OLJA 1WDMA 3ND9A 4N6OA 2NTEA 3IMKA 4QXPA 4RHYA 2QN7A 2G9UA 3ANSA 1T0BA 5I01A 5KJEA 3IR7A 1CLUA 2WBNA 4ARZA 4TYMA 1HE2A 3V7WA 3TI0A 4HDOB 1QVAA 1YCDA 2H2AA 4J8FA 2EKDA 4LF9K 4KPYA 2BR4A 2EKBA 3G68A 3ZVLA 1C30A 2JIPA 4WCVA 3DLGA 5BRAA 3G02A 4Z4GA 1LBHA 4J94A 1RU3A 2F8LA 3GJ4A 1E79A 3PXDA 4MWBA 1V8OA 4PGFA 1SAZA 3QPBA 3VV2A 4NZNA 1GR1A 3B7GA 1GEEA 1VRUA 3VQQA 3U4GA 1D9ZA 4IP0A 1QHAA 1RI3A 3TRDA 1K97A 1SKYB 1CDEA 3PVZA 1PEKE 1Z7BA 2NQTA 1UH5A 1RWKA 5A7GA 3ZGZA 4I5IA 3G10A 2ILTA 5ISMA 2LUOA 4FKBA 1C8KA 3A4YA 2XNJA 2R00A 4Q66C 1N3YA 3HPOA 1EIZA 4UNRA 3SC3A 5TLSA 1CIVA 1CFZA 3WRXC 3IA2A 3QPVA 1M8FA 5FXMA 4R7GA 1G8YA 4FMDF 1DQNA 4CV1A 1GLVA 4C6HA 1BKDR 2F1RA 1UZMA 3VQAA 3FTDA 3O1WA 3NCIA 4OHKA 4AMZA 4RBNA 3U3OA 3VR6H 4E1MA 1Y7IA 2NZ2A 3S0JA 1EU1A 3PIRA 5HKBA 1GL3A 1KYIA 3KOUA 1TKXA 3TLZA 2FEXA 3K5IA 3P9CA 1RJ9A 3QICA 4WT7A 3X1MA 3ZVMA 1J90A 4HG2A 4YCLA 4GX5A 3WNBA 4BO5A 4FQ7A 2HN9A 5EJEA 2J4FA 2O2SA 3PJRA 4F45A 4PCLA 2C4TA 3S2GA 2VPIA 2ZRMA 4QOHA 3ZZTA 1EXVA 4PSUA 4Y9TA 1ESCA 4O8UA 3N53A 3RYFB 3ENVA 1XUOA 4NYJQ 2PSFA 4C4PA 5C1DA 1YR2A 4PSCA 2E2PA 1OQAA 1HE1C 1JBKA 3AF5A 3GLQA 4WBNF 4LBZA 2B5VA 3SCXA 4FOPA 3UMYA 4K6OA 1U8XX 2FK7A 2QJFA 4UFNA 2BELA 3GEDA 4EA9A 3K70B 2KZMA 4GM0A 1QQNA 4O4HF 2R84A 3MD0A 1N2EA 4CF3A 1C2TA 3BF3A 3MBOA 1DKLA 4IDCA 2GBLC 4HS9A 3VJMA 4X6LA 3M0EA 4Y6GB 5B1IA 3FKJA 5E3IA 3ASYA 4KSBA 2P5YA 3LUDA 3C3MA 3C65A 1NW5A 4B3MB 3GFSA 1Z2OX 1ZHHA 4LS3A 1WHSA 4BROA 3DTYA 1WX1A 5EP3A 3P0IA 1T6DA 3N7AA 4BVJA 4BAZA 1MH1A 1RAGA 4TSKA 3THOA 3MEGA 1E6CA 1SC6A 1BAPA 4IVPA 5FRDA 1AA9A 4CKBB 3GLGB 4KB1A 2C94A 1HJRA 2DWQA 2Q2WA 4BDZA 4N6GA 5DGIA 2QROA 1O94D 2XDAA 1FX0B 1YMUA 2MSCB 1CQWA 1DOHA 1WUHS 1G7CA 4HADA 4AZTA 4HEA1 1MIHA 4YPOA 1OFTA 3UTCA 1L3TA 4TRMA 3IGFA 4YRSA 1O9HA 1S2NA 4NBTA 5ADWA 1Y7LA 2OZLA 5BYJA 1S22A 1GKYA 2IOYA 3PL5A 2EBWA 5LZ2A 4G0WA 2Q2OA 2FPSA 1ZRNA 1WSEA 4JI8K 1GZ7A 3ZY2A 1AS3A 2WT4A 2CLMB 2O14A 2I3AA 3T4UA 1TKAA 3UCEA 3VZRA 2W2OA 3SZ3A 3WWCA 3F5TA 2C31A 4Z7NB 2FDCA 3D2EB 1YGPA 2BRUC 1E5XA 2QTCA 1RXIA 5GADl 4IIJF 1QJCA 4QUDA 5T6MA 1DC6A 3NNDA 1YQQA 4QWWA 2VP2A 4DKXA 1FSZA 3K2IA 3KHSA 5IS2A 1E3TA 2HF7A 1ZFNA 1XLTC 1U49A 4JJ6A 3TMYA 1PR0A 1XQ9A 1JLKA 4KR7A 4HFNA 1I80A 2O2YA 5EC8A 3BVPA 4QOFA 4FKZA 1E8NA 4IG0A 3DOIA 3RH0A 1JHMA 4A1FA 1WSIA 2R7YA 1LBSA 3OTGA 4AY3A 3GLHB 3U7FB 3V8MA 2X4LA 3H97A 5DWQA 3AA5X 5CG1A 3RTCA 3EQ9A 3HG7A 4BHTA 3SS7X 4C78A 3W3AH 4LVOA 1K86A 2DRIA 1RZUA 3LQFA 1WW2A 2AG6A 5I7FA 4FWPA 3BE5A 2W6CX 3PIIA 3I2FA 1CQJA 1NURA 3MT0A 2YBDA 2RC5A 4B0OA 4ICLA 1CF4A 3L7DA 3D3WB 1V6SA 1OLSA 3ZHBA 3INNA 1XAHA 4DR6B 2VR1A 1J7KA 2H65A 4HWIA 4M9XA 5JADA 1ACMA 3IEKA 3H5OA 3IHTA 4BGVA 2ONKA 2IVFA 4MW2A 3LP1A 4BV2A 1ZH6A 3CN9A 3C5VA 1EYZA 5JDIA 4JI6B 4TMVA 1IBLB 3ABRB 3K0FA 5HJ2A 4R6WA 3SVTA 4YALA 4WLUA 2M2IA 3R0ZA 3OYHA 1WUIS 3UKRA 2G9ZA 3PPVA 1KPGA 1EPUA 2QGZA 1U8ZA 1XZGA 1S4MA 5EKSA 4HN2A 2AOTB 4G0ZA 4X65K 4G81A 1MWMA 3V2IA 4TWBA 1QQCA 5M34A 3OM0A 3EDMA 4N0DA 1MX5A 4DHWA 4CFYA 1W34A 1PG2A 1F8GA 5MN4A 1K08A 4IUBS 2ZBRA 1C5KA 2VP5A 3L8HA 5A5VA 2XMPA 2IY8A 1Q0QA 4JR1A 2F6RA 3A1DA 4ZCTA 5K2MA 4YP9A 1TIKA 2HRQA 3SSOA 1KY2A 1U6JA 3DRPA 3VOAA 4L4RA 2BZ0A 1MFPA 1R5OA 4BE4A 1E99A 5K4GA 4EW2A 4J8PA 4AY2A 1OFUA 4ZTBA 1L1FA 1Z37A 2P9UA 6NULA 1I13A 4MRSA 4ZO4A 5ALMA 5A7FA 3LT1A 2NYUA 4ISGA 2YUTA 4GPEA 4CMBA 3HRGA 1UPFA 3NOVA 2ZJQL 3QNUA 3P27A 2GN4A 4OSOA 1EAMA 2NM0A 4KH4A 3FFTA 2BSQA 1H2RS 5GMOA 4A2QA 3VKVA 2I6FA 3WGMA 4UBKA 4NS1A 5CD1A 3NFYA 3A4VA 3MK6A 4IV0A 2PEZA 1REQA 1SKUA 1TT7A 3RVPA 5JD3A 1P80A 1OYYA 2GAJA 2C9YA 3PIPL 1ZUNA 2RGUA 3B78A 4JB8A 3BF7A 1P0FA 4KVAA 1RHJA 2QK4A 5DYWA 1ULHA 2RHWA 4EF6A 1Q6YA 3JVEA 4Q18A 3ZT0A 3HCOA 1L5LA 5ED4A 4KG7A 2DHCA 4FFWA 5KYTA 1UEJA 3P32A 5IX8A 2Z8ZA 1QTIA 2II6A 4IH9A 3BMXA 5LY3A 1L8AA 3N2GA 4JEIA 3L41A 1B0UA 1CB0A 4BNIA 4BZXA 2CJWB 4Q7KA 2QW8A 4M46A 1M34B 5JLJA 2VWPA 1JHPA 3CJRA 4OLAA 2NAFA 4IJMA 1NW7A 2XUHA 1U2RA 5HM8A 3LLMA 4UMFA 3CF5L 1XZFA 3ME5A 3N07A 1Z9BA 1KJ9A 3A58B 2OP0A 3L0BA 1H5UA 5ECYA 3FPGA 3X3HA 4KQ6A 4YACA 1RT4A 4DG5A 3RV3A 3D3QA 3S55A 1P6QA 4D9JA 4DIEA 4TKLA 4DIDA 3AKYA 5ALSA 3STTA 4QXRA 4YK7A 4G0VA 3RU9A 3GD5A 3KU1A 4OPHA 2IWRA 1RVV1 3D3KA 3T1HK 2QTVB 3OIFA 4MGZR 2ODWA 3WGLA 3CKYA 1HYGA 5D5PA 2H5IA 1XQWA 3KQUA 2Z1IA