4X65K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4x65K00
4DV0K 5LL6Z 1IBLK 1IBKK 2UXCK 5IWAK 4JI2K 4JI0K 5LMNK 5LMUK 2UUCK 2UUAK 2VQEK 4DR6K 1XNRK 4DUYK 1HNZK 4DV6K 4LF4K 4JI1K 4B3MK 3T1YK 4LF5K 1N32K 2ZM6K 4JI5K 4LFCK 5AJ3K 4DR4K 2UXBK 4DR3K 4LFBK 4YHHK 2F4VK 4X64K 3J81O 2UU9K 3J7YP 4JI3K 1XNQK 4DV2K 3OTOK 4LFAK 4JYAK 4DV1K 1IBMK 1N33K 5FLXO 1XMQK 5BR8K 1HNXK 4B3TK 4JI7K 4YY3K 3J7AP 4DUZK 2UXDK 4DV5K 4DR2K 4LF7K 4DV4K 1I94K 4CW7B 4CVNE 1FJGK 4KHPK 3J80O 3JAMO 4X65K 4JI6K 5IT9O 4LF9K 4OX9K 3T1HK 2UUBK 4NXNK 1N36K 1J5EK 1HNWK 4B3SK 2E5LK 4DV3K 1HR0K 4K0KK 4LF6K 4GKKK 1N34K 4JV5K 4LF8K 4NXMK 4DR1K 4B3RK 4GKJK 4V19S 5A2QO 2HHHK 4DV7K 4AQYK 4JI4K 2VQFK 1XMOK 4DR5K 4X62K 4JI8K 4DR7K 4X66K
chains in the Genus database with same CATH superfamily
4JKEA 5LL6Z 4LY7A 5J2PA 4CESA 1UOCA 3SUOA 2NRVA 3KLGA 4J8FA 3KWIA 3RMBA 3O1BA 3I56N 2Z1HA 3CMAN 3GDQA 3VQ9A 1LWCA 4H5VA 1BOTO 4LF5K 4HCBA 3SQ1A 3PIPL 4M3WA 4IZ9A 4BRKA 4CJPA 4OGCA 3CCJN 3DMJA 3VQ8A 3J8AA 4BE0A 3HP6A 4BR4A 3MK6A 4DMNA 4WF9L 3LAKA 3OYJA 4DTUA 4I2QA 4E7JA 2GUPA 1C0TA 2FBXA 3OTOK 4DSIA 2F9WA 4PA1A 1ZBSA 1BA1A 3VOVA 4OKEA 4FJ9A 2O8CA 2OZMA 1GLFO 4GY2B 2DFFA 1FKPA 3WNFA 4FM1A 2E2NA 4CJ5A 3ID6A 4CHOA 4BROA 2PYLA 3MEEA 3HO1A 4BVPA 3L2WA 1IG8A 3O08A 3EO3A 4JRQA 4FK0A 3RMCA 4KH6A 4AHCA 4XH4A 1WUAA 2Q1NA 4F8RA 3K58A 5AQNA 4Y1CA 5KPTA 5H1SQ 3C6HA 5IT9O 4M3ZA 4JK9A 3AVBA 4HWIA 4BR9A 3T1HK 5AQIA 2YV0X 3SPYA 4H4OA 4ISFA 4K25A 3OY9A 3P31A 1U2VB 5GIOA 4BGBA 4DFJA 3ZETB 3RVCA 2F8TA 3KLFA 4I2PA 3H3OB 5T7BA 4LF6K 4CD1A 1T3VA 4CGDA 3QFPA 3AAQA 3MEGA 4O0JA 3ZSVA 4OKJA 4EP5A 2OA8A 5KRTA 3NH0A 3O9UA 4DSJA 3SLCA 4DTNA 4RCHA 3LZIA 4AHSA 5CHIA 2NRZA 1WB9A 4QCLA 4CFBA 3H46O 4RW6A 3DAWA 3A5LC 1HYZA 3K5MA 5BPMA 1RGIA 1VSJA 1YHQN 4M42A 1EWRA 3O9RA 1BGXT 3THXB 3S3MA 4H0VB 4IOXA 5ADXA 1HNZK 1RDDA 3CCUN 3IMXA 2HBLA 4Z0UA 3NGYA 3CXCM 4JI1K 4CEDA 2I7PA 3KZBA 1KAYA 4BG9A 4W5RA 4CK3A 5AQYA 3ZSWA 3F2KA 1GOCA 4AHTA 5LJWA 3DXMA 1L3UA 1L3SA 4A2BA 2ZGYA 4IEEA 3RRHA 3TANA 2HHUA 1HKGA 4PL7A 2PBDA 5BRDA 1YI2N 3K5OA 3T69A 4NCGA 2HF3A 5F0XA 3RR8A 3VERA 1CZAN 3HT3A 3OYEA 1TK8A 1EXQA 3TABA 1XI1A 4RW9A 1XMQK 4NO7A 2P9LA 2W40A 3T1AA 1HKBA 2RHKA 4G9ZA 3PX4A 3UKRB 4ISEA 1NK7A 1Q81O 1U47A 2QWPA 1BL3A 3LANA 1K73O 4FWLA 1TYQA 1FXXA 2A42A 2FBTA 3ZT3A 3CC4N 4B1VA 1KSPA 1MU2A 3O3GA 1H1VA 2ETJA 3H3NO 4KFBA 4JI6K 2ZJPL 1ASWA 3QERA 4B08A 4YNQA 1Z05A 4CEAA 4FWRA 4I9LA 4CIEA 1T05A 2Q97A 2FBVA 5KQ8A 4CJSA 3NH1A 3L0QA 3VEXA 2OZSA 2Y1JA 3HOSA 4BG8A 1CZBA 3M1FA 4A5BA 5GADP 3BUZB 2O8EB 2IIRA 1TK0A 1GLDG 1HYSA 4M7YA 3AVLA 2D0AA 5C2DA 1FKOA 4B3OA 2DTUA 1C6VA 1S1VA 3TARA 3CMEN 2F7TA 3RR7A 4I6MA 4IXCA 2NZTA 1SKWA 2QWRA 4FLWA 1N8RO 1WBBA 2UXCK 2V7YA 1T8EA 2B5JA 3AVAA 4CZGA 2RN2A 3KKRA 1RNHA 1C1AA 3W0LA 1ATNA 2HHSA 4DSEA 5KGXA 1HPZA 1JLGA 1XNRK 1DT9A 1UA1A 4DU4A 3AAPA 4MLEA 3AVMA 1B9FA 4CCHA 4QAGA 3MDQA 3QEXA 2P9KB 1LW2A 2P9UA 4AF1A 1RTJA 2UXBK 3CJ9A 4BDYA 3AO5A 4IBNA 2R7YA 3ZLJA 3O3HA 1U04A 2YJFA 5J2MA 3OYDA 3GL1A 1BQMA 3CCRN 4LFAK 3AA2A 4CEOA 4FK4A 4HVJA 3KD1E 4CEEA 3OS2A 3N4QA 3DI6A 2QXFA 3HVRA 3V1QA 2D4WA 5AQOA 3OYBA 3CFRA 2HVHA 3MX2A 4HCCA 4NCAA 3A0IX 4NCBA 1N33K 4FJNA 3KK7A 5DMRA 5FPDA 3K0SA 3BZKA 3VF4A 3A5MC 4IWVA 1VQ6N 3OW2M 2YNHA 1JL1A 4DTOA 4B9VA 1RDWX 4DR2K 3KIOA 3OS0A 1RTIA 1HQEA 1LCUA 3HBTA 4NB4A 1HYVA 4CF0A 3VGKA 3SMPA 2W42A 5AZJA 2YI1A 3RSEB 3ZT1A 2J4RA 3DYAA 4F3OA 2BDPA 4BDZA 4B9MA 5TKYA 1P90A 2E5LK 2O8DA 3RMDA 3RRGA 3QLHA 2O8FB 1VQ8N 3DWLA 1IJJA 2VWKA 4KHYA 5BR9A 3WNGA 4E1NA 3JSMA 1Q86O 3H6EA 5GINA 4YOWA 3M5RA 2WOMA 4DV0K 2KZMA 5AZIB 3FFIA 1SL2A 2FSJA 3AGKA 4U7BA 1BISA 2Q36A 1IBKK 1C0GA 2OANA 2VG5A 4GV6A 2AJQA 4CJ3A 4CEQA 2A1SA 4NYFA 2VQEK 1NGJA 3V9ZA 1XC9A 3SUPA 1V4TA 1VSKA 3S41A 4CEZA 2Z1GA 2D0PA 4YDUA 2QEXN 4FZXC 2VG6A 2QK9A 3SBGA 5M1FA 3THVA 3S3OA 2DFHA 3CCSN 3VTIA 2WTUA 3U6FA 4DLEA 1R0AA 1TV6A 3TTDA 3P4IA 2V52B 4F2RA 3TSQA 3AARA 1YTUA 3U9ZA 2XY7A 3IDHA 3OYFA 4JK7A 2D1KA 4FJGA 3NFAA 4H0XB 4B9UA 4JKHA 4O5FA 1N5YA 2XO7A 3BF3A 5AR0A 5BN8A 3TAQA 1HNIA 4FJKA 4CIGA 1JLQA 4XH1A 1T6CA 3HOTA 4IOCL 4DV5K 4DQQA 1YVUA 4PHTX 1VSDA 1Z6RA 3OVNA 4E7HA 5M1KA 1U2VA 2A6AA 3FZFA 3ZETA 4KHPK 1J54A 4ICLA 2W41A 4CJKA 3HVTA 4M3RA 4OX9K 2O4GA 1VSEA 2DY4A 3HTVA 3BY5A 2FC0A 2ASOA 4IOAL 3VQCA 1OH5A 5SWMA 3ZSXA 4C1NI 2GV9A 3QMLA 5TKWA 2BTFA 1ZBUA 4BR7A 4C1NK 1EX4A 4L8RB 1ZBLA 1HRHA 2B4JA 4H5WA 1LWEA 3SNNA 2HMIA 1IKXA 3LPUA 4JKFA 3THXA 3I0SA 4FWQA 4Y1DA 5K14A 2OCEA 3DLGA 4IKFA 4BR5A 1WSHA 2ZF5O 3ZX3A 3I8DA 3BF1A 4X66K 3V81A 4AHUA 1NJZA 4HTUA 3WT0A 1UA0A 3QICA 4BGAA 3VEVA 4DKWA 3OJSA 5C2FA 3E66A 1VQ7N 5EU7A 3MWTA 1IKWA 3SYZA 4JHDB 3FZHA 3MEDA 4CJQA 4K8ZA 3KWGA 4FWOA 1C1BA 4NLBA 3SV3A 3SI6A 1WSGA 5AQHA 2NNWA 4KREA 4H0YB 1S1TA 3V9WA 5M1QA 1DKGD 5AQKA 3SUNA 1TKXA 5HRNA 4CZHA 3UKRA 2P9IB 1R59O 4LSNA 4EZ6A 1MDUB 3OYHA 2ZJQL 3ZT4A 4KTZA 3EEQA 1BIZA 4KTWA 3EZ5A 4F4KA 2NRHA 3R1XA 3FE1A 3CM5A 1XC3A 5CY4A 3AVJA 1D5AA 2ZJRL 1X3MA 4MO4A 4FLXA 3SZ2A 2P51A 3IFRA 4DV4K 3PUFA 2P9SB 3CQXA 1KAXA 2VYPA 3BZCA 4AM6A 4B1UB 4E1MA 1J53A 1TL3A 2O4IA 2O8EA 5AQWA 3VN5A 3B6PA 4DTRA 1D9FA 4DHYA 2P1JA 3SPZA 1NGAA 4O44A 1WAJA 3OBWA 3V1RA 3VQBA 5BRHA 4B9QA 3TAEA 1NGEA 4BDPA 3SMSA 1N34K 4IG3A 3AVKA 3LDLA 4E0DA 3OYMA 4BWJA 4GVEA 4JKGB 1IKYA 2HHQA 3HXMA 4CD3A 4M3TA 2NRXA 4KTQA 1E3MA 4BC4A 4N47A 4CBWA 4ELVA 3AVIA 1S6QA 5AQQA 2QTDA 3V9XA 2P9KA 2DFEA 3TR8A 4B9LA 2FBYA 3FZKA 4Z4CA 1REVA 3ZX2A 1GOAA 1S1XA 3NVKA 3KJVA 3HI0A 4IJNA 4Y0WA 2E20A 2FF6A 3SJJA 1NOYA 4GMJB 3VQ7A 2IOCA 5EXWA 3A8YA 1U49A 4CGIA 1E4FT 3QEWA 2ZM6K 3NF9A 1BIUA 3SCXA 2VCPA 1KD1O 3WXLA 4OLBA 4WE1A 4BRIA 2F96A 5FROA 3P5JA 1XNQK 1NM1A 4RTFD 2YHXA 3LWLA 1WSFA 3H1QA 1HLUA 3ZCMA 4EFHA 1DEJA 5EOYA 3OYIA 1T44A 4Z4GA 4CERA 1Z26A 4CHZA 2E4LA 3RSEA 4DSKA 3WXJA 4CJLA 1NG9A 4B3TK 1OH8A 1VSFA 4ID5A 4ELUA 4YY3K 2PFUA 4CGHA 3AVNA 2D0OA 2UXDK 4OPJA 3EN9A 4YOTA 2O8FA 1WSEA 2ASPA 1FJGK 3NBPA 1ITGA 3IAYA 3HZ6A 2HBKA 3M8RA 2OTLN 5AQGA 4QOZB 4FWMA 3WEEA 3VMFB 1J5EK 4CGFA 2IVPA 2KLAA 3SK3A 3MN6A 1KFSA 3CF5L 4CJ7A 4DS5A 4QS8A 4FLVA 5AZIA 3UB5A 1HKCA 2GWJA 3VGMA 4DR1K 1B92A 1S9EA 3PX0A 3WXIA 4JNEA 2YHAA 3L4QA 3OS1A 3NMUA 4NYNA 1CLQA 1ZC6A 1EQYA 3WNHA 5AQSA 3O80A 2E2PA 4CJFA 4C23A 1K8KB 3CQYA 1VRTA 4ISGA 5AQTA 3PIOL 3TSUA 5I42A 1BCMA 4JI2K 3ZT0A 1DGKN 4CZFA 2I7NA 4BRQA 1A5VA 4R5PA 3KK3A 1JKHA 1OKJA 4WFNL 2PZSA 3FZLA 2A41A 3DJCA 3HP9A 5M1NA 3C7NB 4BRGA 5CR4A 2AP1A 3VPZA 1Q9XA 4H5NA 1XHXA 4LFCK 4OGEA 4FLZA 3DRPA 4FSVA 5LY3A 1HJRA 4LD0A 4IFYA 3CCMN 3HPGA 4KAZA 3J7YP 2YJEA 2ZGZA 1NMNA 3IG1A 2PYJA 3DLRA 3KHYA 4JK8A 5KPRA 2RPIA 1EKEA 3WQUA 1DTQA 2HBJA 3O5BA 3LZJA 3ZEUB 2QWNA 3KLHA 1TKDA 3F73A 3V1OA 1JLEA 1WAFA 3ZSOA 1RFQA 4WQ5A 4BC5A 4CBUA 3HM8A 1RBTA 5CZ2A 1FW6A 2QKKA 3M8SA 2V7ZA 1ASUA 3FR0A 1C0UA 3OYCA 2JGUA 4PWDA 1UAXA 3CCLN 3CPEA 1YJ9N 4DSFA 1EO1A 3J80O 3V6DA 1RILA 3VF2A 4FZZA 2BGGA 4W5QA 2UUBK 4KBOA 3THYB 3HSTB 2HHVA 3FGUA 1NK9A 2RF2A 4FCYA 1D9DA 2QWMA 3ZSYA 1EP4A 3IUCA 4IG0A 2QXLA 2KZZA 4LF8K 4CJUA 3QEVA 4B3RK 4CZMA 3A5OC 3VQQA 4U67L 1ZYQA 4FJHA 2IGIA 3DRRA 3DRSA 4QS7A 4AQYK 1YJNN 1XMOK 4JHDA 4F3TA 3O3FA 4K8XA 4CK1A 1TL1A 4FOIA 3AA4A 5CYQA 3THWB 4N76A 1SAZA 3QBWA 3BDPA 4YOYA 1RT3A 4JI0K 1GLLO 3VF6A 2UUCK 4CHYA 3K9KA 2KKZA 4YFUA 1NGHA 2JWKA 3LDOA 4DV6K 4HUEA 4BE2A 2G8FA 2P9IA 1A5WA 4DR4K 4LFBK 4XIUA 2EHGA 2JWLA 2QM1A 1WSJA 3KVGA 2G8WA 1BG3A 5AQMA 3L2RA 2NRWA 3DOKA 3MWPA 4WQ4C 4JS5A 3TTFA 3BGRA 4M3UA 1X9SA 2P9SA 4FJ5A 2WONA 5C42A 1GLJO 4B8CA 5CYMA 3Q7BA 1RTHA 3AO4A 5HRPA 3OYAA 4JRPA 4DTXA 4JN4A 3DLHA 3VEYA 4K42A 4GV3A 1QSSA 3QO9A 1IH7A 2IDOA 2VGNA 4B8AB 2IAJA 2LSNA 2HOEA 2XY8A 2YX6A 3L3VA 3AV9A 3CM6A 1YIJN 2HF4A 4LF9K 3CCVN 3TU5A 4IJAA 4JKGA 2VWJA 1SL0A 4CJVA 4MDAA 1S1WA 3EZWA 4CHPA 2GELA 2NUBA 1Z25A 1IKVA 4B1XB 2HNYA 1O1WA 1J5OA 4V19S 3L2VA 3D6RA 3E9LA 3TSPA 4PKHA 3V4IA 1KAZA 1KVCA 2V51B 3HYFA 5B8HA 1RT1A 4RW4A 1YUWA 1NK0A 2EWSA 2OPQA 2NRTA 4JAXA 5AQFA 3CJCA 1RT6A 2Z1IA 4LH5A 3M8PA 3NF7A 4FJLA 1NJIO 1BI4B 1IBLK 1JXEA 1X9MA 4J2DA 3KKSA 1NKBA 1XQSC 3O6WA 5FDLA 2XY6A 1L3VA 4WFBL 3TTCA 2KFZA 3MMVA 4I9QA 1XWLA 3A2FA 3T1YK 1FK9A 4FM2A 1W9HA 2G8UA 2W6KA 4H4MA 4CEBA 2GWKA 4ZTJA 3QIOA 4YHHK 1I3AA 3J81O 1ASVA 3Q7CA 4IFVA 4ILHA 3LDQA 5BPLA 4AHRA 4BRAA 5EVZA 1RCHA 2BE2A 4OKKA 1QZ6A 2E6MA 5EY4A 4A61A 1YF5L 1NGGA 2FSNA 3AVHA 2OYQA 1MWKA 4CJTA 3T19A 4W5OA 1BU6O 2UYTA 3T3FA 3ENHA 3I0RA 1LV5A 2G8VA 1TKZA 2H3GX 5FLXO 3K9JA 2EX3A 4Z4HA 1HUXA 3K5LA 3H08A 4ID1A 5I9EB 3CERA 4IO9L 3V9SA 3AA3A 1NOZA 2QA4N 3VGLA 5J2NA 1NKCA 1VQNN 4IO8A 2JLEA 3QNOA 4FWPA 4FPBA 1ESVA 4CVNE 5ADXH 2XY5A 2KHOA 2Q2RA 1WBDA 3CFOA 4JKDA 3OYNA 3E01A 1D4XA 2XRIA 3MXMA 2ZD1A 3MAQA 4LH4A 5F1XA 4DF8A 1T03A 3NVMA 3W3DA 1ZBHA 3R8EA 3QFUA 3PX6A 1K6YA 1K8KA 1U6ZA 2IVNA 3MCPA 3VQ4A 4JV5K 4MFBA 1JLFA 3WXKA 3AA5X 4FOEA 1QHTA 2CH6A 3LDNA 3VTHA 5FPEA 3U3GA 4AM7A 2YKMA 4IDHA 2VQFK 4DU1A 4DTMA 5JICA 4X62K 4BR2A 5KGWA 2OPRA 4J2EA 1YAGA 1TGOA 4KB1A 4CBXA 3C7NA 5FRMA 4LC9B 3KLIA 1LWFA 4HTLA 4OJRA 1QQOA 4WYBA 3P38A 3EE9A 5E41A 4CZIA 2KW4A 3ITHA 3ENOA 3GOIA 4E7KA 4B3MK 1VQKN 4JS4A 1HQUA 3ZEUA 2OPPA 3SV4A 4FVUA 4L3QA 2YHYA 1WN7A 4H5RA 1OH7A 4E7IA 4JI3K 1KVAA 3LL3A 3SAHA 4CZJA 3C6UA 3OYGA 4KHNA 4FJMA 4C8OA 4IEIA 2IVOA 4B1ZA 1Q82O 4C8KA 1RDCA 3EKSA 2Q3SA 1IBMK 3UKUB 5J1EA 4XH5A 4KHSA 1F21A 3G25A 3MECA 1JLAA 2PY5A 4J2AA 4PL8A 3J7AP 1NK4A 2HVIA 4M3YA 3THYA 1NGIA 3NDKA 1A5XA 3SUQA 3VEZA 2ITMA 2ATQA 1VQPN 3VA0A 3JAMO 1JL2A 2YHBA 3VETA 4CHNA 1KRPA 1NNEA 1U48A 1QE1A 3AO2A 4O8UA 3E1YA 4GKKK 3QB0A 3THWA 5GAGP 1M90O 3CJBA 4KH4A 3CQ8A 3LPTA 2A3ZA 3BEXA 4GW6A 4OVLA 3VQ5A 5A2QO 4CF8A 1VQMN 4PY5A 2QI2A 3O8MA 3I55N 3L8BA 4JI8K 1S1UA 1W7AA 3EL2A 5JS1A 4DQPA 1S72N 4FK2A 1U4BA 4FJJA 2NLXA 1K9MO 4CHQA 1M1KO 5LMNK 3K57A 3D2EB 1VQ5N 2UUAK 1OVQA 4TSXA 3OHRA 3P83D 3PY8A 4M41A 1T7PA 4LF4K 3HRGA 4B9TA 1HNVA 3NGZA 4FM0A 4JI5K 4MLHA 5AQXA 5AJ3K 4JD2B 3C6AA 4E7LA 3PV8A 2HMPA 4BRHA 3HM9A 1O13A 3UE5A 2ZWHA 3SAFA 2G8IA 3LWMA 1KLNA 5AQVA 1YXQA 1BA0A 1NLVA 1GLEG 4DTJA 3U9DA 1MWMA 1BCOA 4DLGA 5JS2A 3VA3A 4DV1K 3ZSQA 4A59A 4CJ4A 3KK2A 4GV9A 4CFAA 5BR8K 3F9MA 4H8KA 5KTQA 3OYLA 1YTAA 2FSKA 3K2PA 4CE9A 4DUZK 4ZHRA 1VSMA 1TVRA 1YVNA 3DLKA 3VEWA 3F5TA 4BRNA 3LDPA 4JKBA 4C8NA 1KCFA 1XHZA 1YJWN 4EP4A 2IC3A 2BUPA 2KFNA 5JLFA 1NU0A 1U45A 4E1JA 4DSLA 2WC9A 3U8XA 4B3SK 2KQ2A 1Q18A 2PAVA 1QVGM 5KQDA 4O0IA 2D0CA 2E88A 1SKSA 3MCAB 3C6TA 1BI4A 3TWHA 1RT5A 4CJWA 3CPWM 3L2QA 3E9OA 3FZMA 1RDBA 4BR0A 1QTMA 2W6LA 1NKEA 3GE1A 4M3XA 3VENA 4DR5K 4KPYA 4OO1J 4O4GA 3CI5A 1SQKA 1TAQA 4BRMA 1C1CA 4CGJA 4JLHA 3T7ZA 1S6PA 4KHUA 3NE6A 1VSLA 5JMVA 4MQ3A 3HJFA 5KPZA 1RBVA 3CCQN 3ULEB 3O1WA 3ZX0A 4DTSA 4N5SA 3L2UA 3ISNC 4O55A 4DUYK 3O4WA 5AQUA 4ILGB 2O8BB 4FWNA 1P8ZA 1G99A 2P9PB 1B9DA 4BREA 1BUPA 1NGFA 1CZ9A 3SAGA 4N41A 4YDUC 3D0PA 1WOQA 2CGLA 4YOVA 3QEPA 3ZSZA 4BVOA 4CGGA 5BN9A 3HL8A 4AHVA 3VQAA 5SZTA 4FWKA 4M45A 5HP1A 3BP8A 1ZXOA 1QQMA 1SZ2A 1ZBFA 3D2FB 2Z1JA 4EZ9A 5ELZA 1E4GT 4CFCA 4HUFA 5MLCQ 4KB0A 4FVMA 4E19A 5AQLA 1JCEA 4FL9A 4I7FA 4Z4EA 3CJ7A 1L3TA 5KRSA 3PLAA 3CCEN 1TUUA 4CW7B 4KHQA 4QS9A 5AQPA 4DQ8A 4LSLA 4H03B 2QWLA 1QSLA 3QETA 4KV8A 3K59A 1JCGA 2WFBA 4BRCA 5LJVA 4F9OA 3EYZA 2RKIA 4B1YB 4OPAA 3MN7A 5FRNA 3LDSA 1HR0K 4A62A 3EE8A 5E26A 2CGJA 3NF8A 5GAEP 3MN9A 3AVFA 5DM7L 4B9NA 4CF9A 4GKJK 3I8BA 1ZBIA 3VEOA 3CYMA 3L6QA 1J6ZA 3ULDA 1SUQA 5AFUA 1L5UA 5CZ1A 2HHTA 1RT4A 4DFKA 3S3NA 3R3LA 4WCEL 2P5GA 4DR7K 3MN5A 5M1PA 1BHLA 2Q0UA 3RWUA 1NBWA 4BWMA 2QKBA 4FLUA 2B6AA 1QSYA 4KRFA 2OPSA 2X6SA 4F2SA 3K5NA 2QWOA 4FLYA 3L3UA 4DWIA 1GLBG 1HPMA 3PO5A 5HBMA 4FPAA 3C95A 4B1WB 4GVMA 3QESA 4BRDA 3GBTA 3FFKB 4DQIA 3I33A 4FO0A 2VG7A 2XHBA 3DOLA 2F4VK 4OPHA 4X64K 3LM9A 1NGCA 1LAWA 3UKUA 3A5NC 2YNFA 4CEFA 5JVHL 4DV2K 1KQSM 5FPMA 1S5JA 4BC2A 4FJ7A 4E89A 1CXQA 3SQ4A 1BWFO 2KTQA 3KTQA 2GUIA 3AVCA 4RWTA 1BDGA 3C0BA 2GTDA 4H0OA 1DLOA 2YNGA 1LAVA 1S9GA 1X9WA 2ASMA 5C25A 1HNXK 3RTVA 1Q9YA 4CJRA 4JI7K 3AO1A 4C8MA 5J2QA 1G15A 1QVFM 3ATUA 3AVGA 4CF2A 1GLCG 4BC3A 4C8LA 3OJUA 4BRLA 3WNEA 2VWBA 2HW3A 1N36K 1RDAA 1SL1A 4BQLA 4PKGA 3KK1A 1X1PA 3D7EO 3TPQA 4FJXA 4AH9A 1KXPA 4CZLA 1JLCA 3HPHA 1N6QA 2AA4A 5I3UA 3ID8A 2GBZA 4DTPA 3CD6N 5BRFA 3ALYA 3R9PA 2G8KA 4OLAA 1BO5O 3JS6A 3QDKA 1ATSA 4DV7K 2P9NB 3D2EA 1Q8IA 3DXKB 4Q5VA 1RT7A 3B6OA 3HPOA 1MA9B 2YCHA 3P1GA 4IFEA 5F2RA 2WUSA 1KFDA 1CXUA 4O8KA 1QHAA 3VQDA 3AO3A 4JD2A 3O9TA 3WXMB 2Q0RA 5C10A 4DR6K 4CIFA 1K8AO 3CC7N 2QWQA 4DQRA 1NWKA 1IG9A 2HB5A 4CFDA 1KC8O 3PSFA 1X9JA 3G71N 3MX5A 1QQCA 3JYTA 1IV0A 5E84A 4RW7A 4BY9C 3SBTA 1TKTA 5HL7L 3LALA 2CGKA 1JJ2M 3E9PA 3MXJA 1J9AA 5CE3A 1NGBA 3SQ0A 3DLBA 3HSCA 5AQRA 2E6LA 3O9QA 4N56A 3CETA 4FZYA 4HHTA 3NH2A 1RBRA 1SS6A 3DLLL 3EY1A 1VK0A 2F8SA 4R79A 3M8QA 4W5NA 2D5RA 2E8AA 3LM2A 3NF6A 4A5AA 3ASMA 5JVGL 2O8CB 5HROA 1GLAG 3V9UA 4LF7K 2GEMA 3WUHA 1I94K 3O9SA 4K41A 5C15A 3WEEB 3TAPA 3WQTA 2G8HA 4DFPA 5M1OA 2Q31A 3QIPA 3SJHA 3OYKA 2HBMA 1NMDA 1RDUA 3U3YA 4DFMA 4NXNK 2X74A 3LP1A 1VQ4N 4PQUA 3ZYYX 2Y1IA 1ILYA 1VQON 1GOBA 1JLBA 4FLTA 3OBYA 1NK6A 5AQJA 3F9KA 4O5BA 3H1VX 4K0KK 5C12A 3LAMA 2FF3B 2YKNA 2FXUA 4NXMK 3U4LA 5JLHA 3NAEA 1S22A 1VQLN 2RE2A 2X78A 1HMVA 4BRFA 2IS3A 1Q7YO 3ULEA 2HHHK 4DS4A 3DM2A 3D45A 4XEIA 3G10A 4JI4K 4UY8O 4CECA 2HSTA 4AILC 3G0ZA 3LP0A 3OA9A 4FW2A 4RW8A 1ATRA 2VGMA 2OTJN 2O8BA 1X3NA 1NK5A 3UIQA 3LP3A 2P9PA 1YITN 3CG7A 2I5JA 4DB3A 2E1ZA 3ATVA 2FLOA 5BREA 1EWQA 5LMUK 4H0PA 1TUYA 1KLMA 4K43A 1NJWA 5HOOA 3SQ2A 2A1RA 4M63C 3HK2A 5AFUH 1QZ5A 3D2FA 1TAUA 4WFAL 1LOTB 4EIAA 3J7ZO 3M6GA 2ZQBA 4DR3K 1T6DA 1HX1A 3PO4A 3TAGA 3GG4A 2ITGA 3VQPA 2UU9K 4KO0A 4Z4IA 4KH5A 5C0YA 1V4SA 1OVYA 3IRXA 2X6NA 5HRRA 4DCHA 4BQZA 2A40A 3CJ1A 1RTDA 4HUGA 3DXMB 2NRRA 1IO2A 5KI6A 3G4SN 4YOXA 4G1QA 2WBNA 4EHTA 1BQNA 2HHXA 3B8AX 3AGRA 4RG8A 3P39A 4WQ5C 3NHGA 4CI6A 1YT3A 4NLCA 3JXUA 4JKAA 1KVBA 4MO5A 3FLCO 1I39A 2QW9A 5DK5A 4YOUA 2P9LB 4IDKA 5FPNA 4JKCA 4ELTA 1DTTA 1SV5A 4KI6A 4PUOA 3QINA 1VSHA 4FW1A 3G6EN 2E1YA 4UQGA 3LP2A 3CFPA 1TYQB 4FJIA 4B9SA 3AY9A 2P5OA 3CC2N 4H0TB 1RBSA 3PSIA 4CZEA 4CJEA 2D0BA 2ZE2A 4FJ8A 4KKOA 1Y64A 4FXDA 1JXBA 4KHWA 1WLJA 3VESA 1EETA 1NJXA 3CJAA 4Q0BA 4ILJA 5EX5A 5HLFA 5IWAK 5HRSA 3NGIA 3ENBA 2A5XA 5GAHP 3EKUA 1VAZA 1JCFA 4I6MB 4BRPA 4CZKA 1N32K 1W0HA 4PKIA 1QQNA 4DU3A 4E3SA 4MDBA 1C0FA 5AQZA 4CK2A 4DG1A 2HNDA 3TAMA 1LW0A 4WQ4A 2BANA 2GX9A 1NK8A 4A57A 4OPKA 4ZTFA 4JYAK 1TK5A 3H45C 5D3GA 4FWSA 2P9UB 4BE1A 2E2QA 3O4QA 4Z4FA 1NJYA 1RBUA 3S9HA 5BPNA 1OH6A 2E2OA 3KLEA 1WNSA 4DF4A 5C24A 4W5TA 5DM6L 3KD5E 4JEPA 2HNZA 1QS4A 1WSIA 3IKMA 4Z94A 1S3XA 3TI0A 4CF1A 1W2BM 3RMAA 1Y97A 4GNIA 3QNNA 4M7XA 1VSIA 1HJOA 1RT2A 3C65A 3TAFA 4X65K 1C0MA 3NCIA 2CH5A 4H5TA 3CHWA 5GIPA 3DLEA 3R6MA 3L4IA 1HNWK 2P9NA 3M3ZA 2F9TA 1KTQA 4DV3K 4BACA 1W97L 1VQ9N 1UWBA 4A2AA 2YHWA 3QEIA 3DXKA 2BH1A 1VRUA 3ZSRA 4EAHD 5AZJB 4FYDA 4KI4A 2HHWA 2DPNA 3QBXA 3VQ6A 3O4NA 1NGDA 4YORA 1XUPO 4J2BA 1SKRA 3IS9A 2YNIA 3CIPA 3ZT2A 1D8YA 1VHXA 3MXIA 3C94A 2O8DB 3VQEA 4DQSA 4EHUA 3N4PA
chains in the Genus database with same CATH topology
4DV0K 5LL6Z 1IBLK 1IBKK 2UXCK 5IWAK 4JI2K 4JI0K 5LMNK 5LMUK 2UUCK 2UUAK 2VQEK 4DR6K 1XNRK 4DUYK 1HNZK 4DV6K 4LF4K 4JI1K 4B3MK 3T1YK 4LF5K 1N32K 2ZM6K 4JI5K 4LFCK 5AJ3K 4DR4K 2UXBK 4DR3K 4LFBK 4YHHK 2F4VK 4X64K 3J81O 2UU9K 3J7YP 4JI3K 1XNQK 4DV2K 3OTOK 4LFAK 4JYAK 4DV1K 1IBMK 1N33K 5FLXO 1XMQK 5BR8K 1HNXK 4B3TK 4JI7K 4YY3K 3J7AP 4DUZK 2UXDK 4DV5K 4DR2K 4LF7K 4DV4K 1I94K 4CW7B 4CVNE 1FJGK 4KHPK 3J80O 3JAMO 4X65K 4JI6K 5IT9O 4LF9K 4OX9K 3T1HK 2UUBK 4NXNK 1N36K 1J5EK 1HNWK 4B3SK 2E5LK 4DV3K 1HR0K 4K0KK 4LF6K 4GKKK 1N34K 4JV5K 4LF8K 4NXMK 4DR1K 4B3RK 4GKJK 4V19S 5A2QO 2HHHK 4DV7K 4AQYK 4JI4K 2VQFK 1XMOK 4DR5K 4X62K 4JI8K 4DR7K 4X66K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 K;  5LL6 Z;  1IBL K;  1IBK K;  2UXC K;  5IWA K;  4JI2 K;  4JI0 K;  5LMN K;  5LMU K;  2UUC K;  2UUA K;  2VQE K;  4DR6 K;  1XNR K;  4DUY K;  1HNZ K;  4DV6 K;  4LF4 K;  4JI1 K;  4B3M K;  3T1Y K;  4LF5 K;  1N32 K;  2ZM6 K;  4JI5 K;  4LFC K;  5AJ3 K;  4DR4 K;  2UXB K;  4DR3 K;  4LFB K;  4YHH K;  2F4V K;  4X64 K;  3J81 O;  2UU9 K;  3J7Y P;  4JI3 K;  1XNQ K;  4DV2 K;  3OTO K;  4LFA K;  4JYA K;  4DV1 K;  1IBM K;  1N33 K;  5FLX O;  1XMQ K;  5BR8 K;  1HNX K;  4B3T K;  4JI7 K;  4YY3 K;  3J7A P;  4DUZ K;  2UXD K;  4DV5 K;  4DR2 K;  4LF7 K;  4DV4 K;  1I94 K;  4CW7 B;  4CVN E;  1FJG K;  4KHP K;  3J80 O;  3JAM O;  4X65 K;  4JI6 K;  5IT9 O;  4LF9 K;  4OX9 K;  3T1H K;  2UUB K;  4NXN K;  1N36 K;  1J5E K;  1HNW K;  4B3S K;  2E5L K;  4DV3 K;  1HR0 K;  4K0K K;  4LF6 K;  4GKK K;  1N34 K;  4JV5 K;  4LF8 K;  4NXM K;  4DR1 K;  4B3R K;  4GKJ K;  4V19 S;  5A2Q O;  2HHH K;  4DV7 K;  4AQY K;  4JI4 K;  2VQF K;  1XMO K;  4DR5 K;  4X62 K;  4JI8 K;  4DR7 K;  4X66 K; 
#chains in the Genus database with same CATH topology
 4JKE A;  5LL6 Z;  4LY7 A;  5J2P A;  4CES A;  1UOC A;  3SUO A;  2NRV A;  3KLG A;  4J8F A;  3KWI A;  3RMB A;  3O1B A;  3I56 N;  2Z1H A;  3CMA N;  3GDQ A;  3VQ9 A;  1LWC A;  4H5V A;  1BOT O;  4LF5 K;  4HCB A;  3SQ1 A;  3PIP L;  4M3W A;  4IZ9 A;  4BRK A;  4CJP A;  4OGC A;  3CCJ N;  3DMJ A;  3VQ8 A;  3J8A A;  4BE0 A;  3HP6 A;  4BR4 A;  3MK6 A;  4DMN A;  4WF9 L;  3LAK A;  3OYJ A;  4DTU A;  4I2Q A;  4E7J A;  2GUP A;  1C0T A;  2FBX A;  3OTO K;  4DSI A;  2F9W A;  4PA1 A;  1ZBS A;  1BA1 A;  3VOV A;  4OKE A;  4FJ9 A;  2O8C A;  2OZM A;  1GLF O;  4GY2 B;  2DFF A;  1FKP A;  3WNF A;  4FM1 A;  2E2N A;  4CJ5 A;  3ID6 A;  4CHO A;  4BRO A;  2PYL A;  3MEE A;  3HO1 A;  4BVP A;  3L2W A;  1IG8 A;  3O08 A;  3EO3 A;  4JRQ A;  4FK0 A;  3RMC A;  4KH6 A;  4AHC A;  4XH4 A;  1WUA A;  2Q1N A;  4F8R A;  3K58 A;  5AQN A;  4Y1C A;  5KPT A;  5H1S Q;  3C6H A;  5IT9 O;  4M3Z A;  4JK9 A;  3AVB A;  4HWI A;  4BR9 A;  3T1H K;  5AQI A;  2YV0 X;  3SPY A;  4H4O A;  4ISF A;  4K25 A;  3OY9 A;  3P31 A;  1U2V B;  5GIO A;  4BGB A;  4DFJ A;  3ZET B;  3RVC A;  2F8T A;  3KLF A;  4I2P A;  3H3O B;  5T7B A;  4LF6 K;  4CD1 A;  1T3V A;  4CGD A;  3QFP A;  3AAQ A;  3MEG A;  4O0J A;  3ZSV A;  4OKJ A;  4EP5 A;  2OA8 A;  5KRT A;  3NH0 A;  3O9U A;  4DSJ A;  3SLC A;  4DTN A;  4RCH A;  3LZI A;  4AHS A;  5CHI A;  2NRZ A;  1WB9 A;  4QCL A;  4CFB A;  3H46 O;  4RW6 A;  3DAW A;  3A5L C;  1HYZ A;  3K5M A;  5BPM A;  1RGI A;  1VSJ A;  1YHQ N;  4M42 A;  1EWR A;  3O9R A;  1BGX T;  3THX B;  3S3M A;  4H0V B;  4IOX A;  5ADX A;  1HNZ K;  1RDD A;  3CCU N;  3IMX A;  2HBL A;  4Z0U A;  3NGY A;  3CXC M;  4JI1 K;  4CED A;  2I7P A;  3KZB A;  1KAY A;  4BG9 A;  4W5R A;  4CK3 A;  5AQY A;  3ZSW A;  3F2K A;  1GOC A;  4AHT A;  5LJW A;  3DXM A;  1L3U A;  1L3S A;  4A2B A;  2ZGY A;  4IEE A;  3RRH A;  3TAN A;  2HHU A;  1HKG A;  4PL7 A;  2PBD A;  5BRD A;  1YI2 N;  3K5O A;  3T69 A;  4NCG A;  2HF3 A;  5F0X A;  3RR8 A;  3VER A;  1CZA N;  3HT3 A;  3OYE A;  1TK8 A;  1EXQ A;  3TAB A;  1XI1 A;  4RW9 A;  1XMQ K;  4NO7 A;  2P9L A;  2W40 A;  3T1A A;  1HKB A;  2RHK A;  4G9Z A;  3PX4 A;  3UKR B;  4ISE A;  1NK7 A;  1Q81 O;  1U47 A;  2QWP A;  1BL3 A;  3LAN A;  1K73 O;  4FWL A;  1TYQ A;  1FXX A;  2A42 A;  2FBT A;  3ZT3 A;  3CC4 N;  4B1V A;  1KSP A;  1MU2 A;  3O3G A;  1H1V A;  2ETJ A;  3H3N O;  4KFB A;  4JI6 K;  2ZJP L;  1ASW A;  3QER A;  4B08 A;  4YNQ A;  1Z05 A;  4CEA A;  4FWR A;  4I9L A;  4CIE A;  1T05 A;  2Q97 A;  2FBV A;  5KQ8 A;  4CJS A;  3NH1 A;  3L0Q A;  3VEX A;  2OZS A;  2Y1J A;  3HOS A;  4BG8 A;  1CZB A;  3M1F A;  4A5B A;  5GAD P;  3BUZ B;  2O8E B;  2IIR A;  1TK0 A;  1GLD G;  1HYS A;  4M7Y A;  3AVL A;  2D0A A;  5C2D A;  1FKO A;  4B3O A;  2DTU A;  1C6V A;  1S1V A;  3TAR A;  3CME N;  2F7T A;  3RR7 A;  4I6M A;  4IXC A;  2NZT A;  1SKW A;  2QWR A;  4FLW A;  1N8R O;  1WBB A;  2UXC K;  2V7Y A;  1T8E A;  2B5J A;  3AVA A;  4CZG A;  2RN2 A;  3KKR A;  1RNH A;  1C1A A;  3W0L A;  1ATN A;  2HHS A;  4DSE A;  5KGX A;  1HPZ A;  1JLG A;  1XNR K;  1DT9 A;  1UA1 A;  4DU4 A;  3AAP A;  4MLE A;  3AVM A;  1B9F A;  4CCH A;  4QAG A;  3MDQ A;  3QEX A;  2P9K B;  1LW2 A;  2P9U A;  4AF1 A;  1RTJ A;  2UXB K;  3CJ9 A;  4BDY A;  3AO5 A;  4IBN A;  2R7Y A;  3ZLJ A;  3O3H A;  1U04 A;  2YJF A;  5J2M A;  3OYD A;  3GL1 A;  1BQM A;  3CCR N;  4LFA K;  3AA2 A;  4CEO A;  4FK4 A;  4HVJ A;  3KD1 E;  4CEE A;  3OS2 A;  3N4Q A;  3DI6 A;  2QXF A;  3HVR A;  3V1Q A;  2D4W A;  5AQO A;  3OYB A;  3CFR A;  2HVH A;  3MX2 A;  4HCC A;  4NCA A;  3A0I X;  4NCB A;  1N33 K;  4FJN A;  3KK7 A;  5DMR A;  5FPD A;  3K0S A;  3BZK A;  3VF4 A;  3A5M C;  4IWV A;  1VQ6 N;  3OW2 M;  2YNH A;  1JL1 A;  4DTO A;  4B9V A;  1RDW X;  4DR2 K;  3KIO A;  3OS0 A;  1RTI A;  1HQE A;  1LCU A;  3HBT A;  4NB4 A;  1HYV A;  4CF0 A;  3VGK A;  3SMP A;  2W42 A;  5AZJ A;  2YI1 A;  3RSE B;  3ZT1 A;  2J4R A;  3DYA A;  4F3O A;  2BDP A;  4BDZ A;  4B9M A;  5TKY A;  1P90 A;  2E5L K;  2O8D A;  3RMD A;  3RRG A;  3QLH A;  2O8F B;  1VQ8 N;  3DWL A;  1IJJ A;  2VWK A;  4KHY A;  5BR9 A;  3WNG A;  4E1N A;  3JSM A;  1Q86 O;  3H6E A;  5GIN A;  4YOW A;  3M5R A;  2WOM A;  4DV0 K;  2KZM A;  5AZI B;  3FFI A;  1SL2 A;  2FSJ A;  3AGK A;  4U7B A;  1BIS A;  2Q36 A;  1IBK K;  1C0G A;  2OAN A;  2VG5 A;  4GV6 A;  2AJQ A;  4CJ3 A;  4CEQ A;  2A1S A;  4NYF A;  2VQE K;  1NGJ A;  3V9Z A;  1XC9 A;  3SUP A;  1V4T A;  1VSK A;  3S41 A;  4CEZ A;  2Z1G A;  2D0P A;  4YDU A;  2QEX N;  4FZX C;  2VG6 A;  2QK9 A;  3SBG A;  5M1F A;  3THV A;  3S3O A;  2DFH A;  3CCS N;  3VTI A;  2WTU A;  3U6F A;  4DLE A;  1R0A A;  1TV6 A;  3TTD A;  3P4I A;  2V52 B;  4F2R A;  3TSQ A;  3AAR A;  1YTU A;  3U9Z A;  2XY7 A;  3IDH A;  3OYF A;  4JK7 A;  2D1K A;  4FJG A;  3NFA A;  4H0X B;  4B9U A;  4JKH A;  4O5F A;  1N5Y A;  2XO7 A;  3BF3 A;  5AR0 A;  5BN8 A;  3TAQ A;  1HNI A;  4FJK A;  4CIG A;  1JLQ A;  4XH1 A;  1T6C A;  3HOT A;  4IOC L;  4DV5 K;  4DQQ A;  1YVU A;  4PHT X;  1VSD A;  1Z6R A;  3OVN A;  4E7H A;  5M1K A;  1U2V A;  2A6A A;  3FZF A;  3ZET A;  4KHP K;  1J54 A;  4ICL A;  2W41 A;  4CJK A;  3HVT A;  4M3R A;  4OX9 K;  2O4G A;  1VSE A;  2DY4 A;  3HTV A;  3BY5 A;  2FC0 A;  2ASO A;  4IOA L;  3VQC A;  1OH5 A;  5SWM A;  3ZSX A;  4C1N I;  2GV9 A;  3QML A;  5TKW A;  2BTF A;  1ZBU A;  4BR7 A;  4C1N K;  1EX4 A;  4L8R B;  1ZBL A;  1HRH A;  2B4J A;  4H5W A;  1LWE A;  3SNN A;  2HMI A;  1IKX A;  3LPU A;  4JKF A;  3THX A;  3I0S A;  4FWQ A;  4Y1D A;  5K14 A;  2OCE A;  3DLG A;  4IKF A;  4BR5 A;  1WSH A;  2ZF5 O;  3ZX3 A;  3I8D A;  3BF1 A;  4X66 K;  3V81 A;  4AHU A;  1NJZ A;  4HTU A;  3WT0 A;  1UA0 A;  3QIC A;  4BGA A;  3VEV A;  4DKW A;  3OJS A;  5C2F A;  3E66 A;  1VQ7 N;  5EU7 A;  3MWT A;  1IKW A;  3SYZ A;  4JHD B;  3FZH A;  3MED A;  4CJQ A;  4K8Z A;  3KWG A;  4FWO A;  1C1B A;  4NLB A;  3SV3 A;  3SI6 A;  1WSG A;  5AQH A;  2NNW A;  4KRE A;  4H0Y B;  1S1T A;  3V9W A;  5M1Q A;  1DKG D;  5AQK A;  3SUN A;  1TKX A;  5HRN A;  4CZH A;  3UKR A;  2P9I B;  1R59 O;  4LSN A;  4EZ6 A;  1MDU B;  3OYH A;  2ZJQ L;  3ZT4 A;  4KTZ A;  3EEQ A;  1BIZ A;  4KTW A;  3EZ5 A;  4F4K A;  2NRH A;  3R1X A;  3FE1 A;  3CM5 A;  1XC3 A;  5CY4 A;  3AVJ A;  1D5A A;  2ZJR L;  1X3M A;  4MO4 A;  4FLX A;  3SZ2 A;  2P51 A;  3IFR A;  4DV4 K;  3PUF A;  2P9S B;  3CQX A;  1KAX A;  2VYP A;  3BZC A;  4AM6 A;  4B1U B;  4E1M A;  1J53 A;  1TL3 A;  2O4I A;  2O8E A;  5AQW A;  3VN5 A;  3B6P A;  4DTR A;  1D9F A;  4DHY A;  2P1J A;  3SPZ A;  1NGA A;  4O44 A;  1WAJ A;  3OBW A;  3V1R A;  3VQB A;  5BRH A;  4B9Q A;  3TAE A;  1NGE A;  4BDP A;  3SMS A;  1N34 K;  4IG3 A;  3AVK A;  3LDL A;  4E0D A;  3OYM A;  4BWJ A;  4GVE A;  4JKG B;  1IKY A;  2HHQ A;  3HXM A;  4CD3 A;  4M3T A;  2NRX A;  4KTQ A;  1E3M A;  4BC4 A;  4N47 A;  4CBW A;  4ELV A;  3AVI A;  1S6Q A;  5AQQ A;  2QTD A;  3V9X A;  2P9K A;  2DFE A;  3TR8 A;  4B9L A;  2FBY A;  3FZK A;  4Z4C A;  1REV A;  3ZX2 A;  1GOA A;  1S1X A;  3NVK A;  3KJV A;  3HI0 A;  4IJN A;  4Y0W A;  2E20 A;  2FF6 A;  3SJJ A;  1NOY A;  4GMJ B;  3VQ7 A;  2IOC A;  5EXW A;  3A8Y A;  1U49 A;  4CGI A;  1E4F T;  3QEW A;  2ZM6 K;  3NF9 A;  1BIU A;  3SCX A;  2VCP A;  1KD1 O;  3WXL A;  4OLB A;  4WE1 A;  4BRI A;  2F96 A;  5FRO A;  3P5J A;  1XNQ K;  1NM1 A;  4RTF D;  2YHX A;  3LWL A;  1WSF A;  3H1Q A;  1HLU A;  3ZCM A;  4EFH A;  1DEJ A;  5EOY A;  3OYI A;  1T44 A;  4Z4G A;  4CER A;  1Z26 A;  4CHZ A;  2E4L A;  3RSE A;  4DSK A;  3WXJ A;  4CJL A;  1NG9 A;  4B3T K;  1OH8 A;  1VSF A;  4ID5 A;  4ELU A;  4YY3 K;  2PFU A;  4CGH A;  3AVN A;  2D0O A;  2UXD K;  4OPJ A;  3EN9 A;  4YOT A;  2O8F A;  1WSE A;  2ASP A;  1FJG K;  3NBP A;  1ITG A;  3IAY A;  3HZ6 A;  2HBK A;  3M8R A;  2OTL N;  5AQG A;  4QOZ B;  4FWM A;  3WEE A;  3VMF B;  1J5E K;  4CGF A;  2IVP A;  2KLA A;  3SK3 A;  3MN6 A;  1KFS A;  3CF5 L;  4CJ7 A;  4DS5 A;  4QS8 A;  4FLV A;  5AZI A;  3UB5 A;  1HKC A;  2GWJ A;  3VGM A;  4DR1 K;  1B92 A;  1S9E A;  3PX0 A;  3WXI A;  4JNE A;  2YHA A;  3L4Q A;  3OS1 A;  3NMU A;  4NYN A;  1CLQ A;  1ZC6 A;  1EQY A;  3WNH A;  5AQS A;  3O80 A;  2E2P A;  4CJF A;  4C23 A;  1K8K B;  3CQY A;  1VRT A;  4ISG A;  5AQT A;  3PIO L;  3TSU A;  5I42 A;  1BCM A;  4JI2 K;  3ZT0 A;  1DGK N;  4CZF A;  2I7N A;  4BRQ A;  1A5V A;  4R5P A;  3KK3 A;  1JKH A;  1OKJ A;  4WFN L;  2PZS A;  3FZL A;  2A41 A;  3DJC A;  3HP9 A;  5M1N A;  3C7N B;  4BRG A;  5CR4 A;  2AP1 A;  3VPZ A;  1Q9X A;  4H5N A;  1XHX A;  4LFC K;  4OGE A;  4FLZ A;  3DRP A;  4FSV A;  5LY3 A;  1HJR A;  4LD0 A;  4IFY A;  3CCM N;  3HPG A;  4KAZ A;  3J7Y P;  2YJE A;  2ZGZ A;  1NMN A;  3IG1 A;  2PYJ A;  3DLR A;  3KHY A;  4JK8 A;  5KPR A;  2RPI A;  1EKE A;  3WQU A;  1DTQ A;  2HBJ A;  3O5B A;  3LZJ A;  3ZEU B;  2QWN A;  3KLH A;  1TKD A;  3F73 A;  3V1O A;  1JLE A;  1WAF A;  3ZSO A;  1RFQ A;  4WQ5 A;  4BC5 A;  4CBU A;  3HM8 A;  1RBT A;  5CZ2 A;  1FW6 A;  2QKK A;  3M8S A;  2V7Z A;  1ASU A;  3FR0 A;  1C0U A;  3OYC A;  2JGU A;  4PWD A;  1UAX A;  3CCL N;  3CPE A;  1YJ9 N;  4DSF A;  1EO1 A;  3J80 O;  3V6D A;  1RIL A;  3VF2 A;  4FZZ A;  2BGG A;  4W5Q A;  2UUB K;  4KBO A;  3THY B;  3HST B;  2HHV A;  3FGU A;  1NK9 A;  2RF2 A;  4FCY A;  1D9D A;  2QWM A;  3ZSY A;  1EP4 A;  3IUC A;  4IG0 A;  2QXL A;  2KZZ A;  4LF8 K;  4CJU A;  3QEV A;  4B3R K;  4CZM A;  3A5O C;  3VQQ A;  4U67 L;  1ZYQ A;  4FJH A;  2IGI A;  3DRR A;  3DRS A;  4QS7 A;  4AQY K;  1YJN N;  1XMO K;  4JHD A;  4F3T A;  3O3F A;  4K8X A;  4CK1 A;  1TL1 A;  4FOI A;  3AA4 A;  5CYQ A;  3THW B;  4N76 A;  1SAZ A;  3QBW A;  3BDP A;  4YOY A;  1RT3 A;  4JI0 K;  1GLL O;  3VF6 A;  2UUC K;  4CHY A;  3K9K A;  2KKZ A;  4YFU A;  1NGH A;  2JWK A;  3LDO A;  4DV6 K;  4HUE A;  4BE2 A;  2G8F A;  2P9I A;  1A5W A;  4DR4 K;  4LFB K;  4XIU A;  2EHG A;  2JWL A;  2QM1 A;  1WSJ A;  3KVG A;  2G8W A;  1BG3 A;  5AQM A;  3L2R A;  2NRW A;  3DOK A;  3MWP A;  4WQ4 C;  4JS5 A;  3TTF A;  3BGR A;  4M3U A;  1X9S A;  2P9S A;  4FJ5 A;  2WON A;  5C42 A;  1GLJ O;  4B8C A;  5CYM A;  3Q7B A;  1RTH A;  3AO4 A;  5HRP A;  3OYA A;  4JRP A;  4DTX A;  4JN4 A;  3DLH A;  3VEY A;  4K42 A;  4GV3 A;  1QSS A;  3QO9 A;  1IH7 A;  2IDO A;  2VGN A;  4B8A B;  2IAJ A;  2LSN A;  2HOE A;  2XY8 A;  2YX6 A;  3L3V A;  3AV9 A;  3CM6 A;  1YIJ N;  2HF4 A;  4LF9 K;  3CCV N;  3TU5 A;  4IJA A;  4JKG A;  2VWJ A;  1SL0 A;  4CJV A;  4MDA A;  1S1W A;  3EZW A;  4CHP A;  2GEL A;  2NUB A;  1Z25 A;  1IKV A;  4B1X B;  2HNY A;  1O1W A;  1J5O A;  4V19 S;  3L2V A;  3D6R A;  3E9L A;  3TSP A;  4PKH A;  3V4I A;  1KAZ A;  1KVC A;  2V51 B;  3HYF A;  5B8H A;  1RT1 A;  4RW4 A;  1YUW A;  1NK0 A;  2EWS A;  2OPQ A;  2NRT A;  4JAX A;  5AQF A;  3CJC A;  1RT6 A;  2Z1I A;  4LH5 A;  3M8P A;  3NF7 A;  4FJL A;  1NJI O;  1BI4 B;  1IBL K;  1JXE A;  1X9M A;  4J2D A;  3KKS A;  1NKB A;  1XQS C;  3O6W A;  5FDL A;  2XY6 A;  1L3V A;  4WFB L;  3TTC A;  2KFZ A;  3MMV A;  4I9Q A;  1XWL A;  3A2F A;  3T1Y K;  1FK9 A;  4FM2 A;  1W9H A;  2G8U A;  2W6K A;  4H4M A;  4CEB A;  2GWK A;  4ZTJ A;  3QIO A;  4YHH K;  1I3A A;  3J81 O;  1ASV A;  3Q7C A;  4IFV A;  4ILH A;  3LDQ A;  5BPL A;  4AHR A;  4BRA A;  5EVZ A;  1RCH A;  2BE2 A;  4OKK A;  1QZ6 A;  2E6M A;  5EY4 A;  4A61 A;  1YF5 L;  1NGG A;  2FSN A;  3AVH A;  2OYQ A;  1MWK A;  4CJT A;  3T19 A;  4W5O A;  1BU6 O;  2UYT A;  3T3F A;  3ENH A;  3I0R A;  1LV5 A;  2G8V A;  1TKZ A;  2H3G X;  5FLX O;  3K9J A;  2EX3 A;  4Z4H A;  1HUX A;  3K5L A;  3H08 A;  4ID1 A;  5I9E B;  3CER A;  4IO9 L;  3V9S A;  3AA3 A;  1NOZ A;  2QA4 N;  3VGL A;  5J2N A;  1NKC A;  1VQN N;  4IO8 A;  2JLE A;  3QNO A;  4FWP A;  4FPB A;  1ESV A;  4CVN E;  5ADX H;  2XY5 A;  2KHO A;  2Q2R A;  1WBD A;  3CFO A;  4JKD A;  3OYN A;  3E01 A;  1D4X A;  2XRI A;  3MXM A;  2ZD1 A;  3MAQ A;  4LH4 A;  5F1X A;  4DF8 A;  1T03 A;  3NVM A;  3W3D A;  1ZBH A;  3R8E A;  3QFU A;  3PX6 A;  1K6Y A;  1K8K A;  1U6Z A;  2IVN A;  3MCP A;  3VQ4 A;  4JV5 K;  4MFB A;  1JLF A;  3WXK A;  3AA5 X;  4FOE A;  1QHT A;  2CH6 A;  3LDN A;  3VTH A;  5FPE A;  3U3G A;  4AM7 A;  2YKM A;  4IDH A;  2VQF K;  4DU1 A;  4DTM A;  5JIC A;  4X62 K;  4BR2 A;  5KGW A;  2OPR A;  4J2E A;  1YAG A;  1TGO A;  4KB1 A;  4CBX A;  3C7N A;  5FRM A;  4LC9 B;  3KLI A;  1LWF A;  4HTL A;  4OJR A;  1QQO A;  4WYB A;  3P38 A;  3EE9 A;  5E41 A;  4CZI A;  2KW4 A;  3ITH A;  3ENO A;  3GOI A;  4E7K A;  4B3M K;  1VQK N;  4JS4 A;  1HQU A;  3ZEU A;  2OPP A;  3SV4 A;  4FVU A;  4L3Q A;  2YHY A;  1WN7 A;  4H5R A;  1OH7 A;  4E7I A;  4JI3 K;  1KVA A;  3LL3 A;  3SAH A;  4CZJ A;  3C6U A;  3OYG A;  4KHN A;  4FJM A;  4C8O A;  4IEI A;  2IVO A;  4B1Z A;  1Q82 O;  4C8K A;  1RDC A;  3EKS A;  2Q3S A;  1IBM K;  3UKU B;  5J1E A;  4XH5 A;  4KHS A;  1F21 A;  3G25 A;  3MEC A;  1JLA A;  2PY5 A;  4J2A A;  4PL8 A;  3J7A P;  1NK4 A;  2HVI A;  4M3Y A;  3THY A;  1NGI A;  3NDK A;  1A5X A;  3SUQ A;  3VEZ A;  2ITM A;  2ATQ A;  1VQP N;  3VA0 A;  3JAM O;  1JL2 A;  2YHB A;  3VET A;  4CHN A;  1KRP A;  1NNE A;  1U48 A;  1QE1 A;  3AO2 A;  4O8U A;  3E1Y A;  4GKK K;  3QB0 A;  3THW A;  5GAG P;  1M90 O;  3CJB A;  4KH4 A;  3CQ8 A;  3LPT A;  2A3Z A;  3BEX A;  4GW6 A;  4OVL A;  3VQ5 A;  5A2Q O;  4CF8 A;  1VQM N;  4PY5 A;  2QI2 A;  3O8M A;  3I55 N;  3L8B A;  4JI8 K;  1S1U A;  1W7A A;  3EL2 A;  5JS1 A;  4DQP A;  1S72 N;  4FK2 A;  1U4B A;  4FJJ A;  2NLX A;  1K9M O;  4CHQ A;  1M1K O;  5LMN K;  3K57 A;  3D2E B;  1VQ5 N;  2UUA K;  1OVQ A;  4TSX A;  3OHR A;  3P83 D;  3PY8 A;  4M41 A;  1T7P A;  4LF4 K;  3HRG A;  4B9T A;  1HNV A;  3NGZ A;  4FM0 A;  4JI5 K;  4MLH A;  5AQX A;  5AJ3 K;  4JD2 B;  3C6A A;  4E7L A;  3PV8 A;  2HMP A;  4BRH A;  3HM9 A;  1O13 A;  3UE5 A;  2ZWH A;  3SAF A;  2G8I A;  3LWM A;  1KLN A;  5AQV A;  1YXQ A;  1BA0 A;  1NLV A;  1GLE G;  4DTJ A;  3U9D A;  1MWM A;  1BCO A;  4DLG A;  5JS2 A;  3VA3 A;  4DV1 K;  3ZSQ A;  4A59 A;  4CJ4 A;  3KK2 A;  4GV9 A;  4CFA A;  5BR8 K;  3F9M A;  4H8K A;  5KTQ A;  3OYL A;  1YTA A;  2FSK A;  3K2P A;  4CE9 A;  4DUZ K;  4ZHR A;  1VSM A;  1TVR A;  1YVN A;  3DLK A;  3VEW A;  3F5T A;  4BRN A;  3LDP A;  4JKB A;  4C8N A;  1KCF A;  1XHZ A;  1YJW N;  4EP4 A;  2IC3 A;  2BUP A;  2KFN A;  5JLF A;  1NU0 A;  1U45 A;  4E1J A;  4DSL A;  2WC9 A;  3U8X A;  4B3S K;  2KQ2 A;  1Q18 A;  2PAV A;  1QVG M;  5KQD A;  4O0I A;  2D0C A;  2E88 A;  1SKS A;  3MCA B;  3C6T A;  1BI4 A;  3TWH A;  1RT5 A;  4CJW A;  3CPW M;  3L2Q A;  3E9O A;  3FZM A;  1RDB A;  4BR0 A;  1QTM A;  2W6L A;  1NKE A;  3GE1 A;  4M3X A;  3VEN A;  4DR5 K;  4KPY A;  4OO1 J;  4O4G A;  3CI5 A;  1SQK A;  1TAQ A;  4BRM A;  1C1C A;  4CGJ A;  4JLH A;  3T7Z A;  1S6P A;  4KHU A;  3NE6 A;  1VSL A;  5JMV A;  4MQ3 A;  3HJF A;  5KPZ A;  1RBV A;  3CCQ N;  3ULE B;  3O1W A;  3ZX0 A;  4DTS A;  4N5S A;  3L2U A;  3ISN C;  4O55 A;  4DUY K;  3O4W A;  5AQU A;  4ILG B;  2O8B B;  4FWN A;  1P8Z A;  1G99 A;  2P9P B;  1B9D A;  4BRE A;  1BUP A;  1NGF A;  1CZ9 A;  3SAG A;  4N41 A;  4YDU C;  3D0P A;  1WOQ A;  2CGL A;  4YOV A;  3QEP A;  3ZSZ A;  4BVO A;  4CGG A;  5BN9 A;  3HL8 A;  4AHV A;  3VQA A;  5SZT A;  4FWK A;  4M45 A;  5HP1 A;  3BP8 A;  1ZXO A;  1QQM A;  1SZ2 A;  1ZBF A;  3D2F B;  2Z1J A;  4EZ9 A;  5ELZ A;  1E4G T;  4CFC A;  4HUF A;  5MLC Q;  4KB0 A;  4FVM A;  4E19 A;  5AQL A;  1JCE A;  4FL9 A;  4I7F A;  4Z4E A;  3CJ7 A;  1L3T A;  5KRS A;  3PLA A;  3CCE N;  1TUU A;  4CW7 B;  4KHQ A;  4QS9 A;  5AQP A;  4DQ8 A;  4LSL A;  4H03 B;  2QWL A;  1QSL A;  3QET A;  4KV8 A;  3K59 A;  1JCG A;  2WFB A;  4BRC A;  5LJV A;  4F9O A;  3EYZ A;  2RKI A;  4B1Y B;  4OPA A;  3MN7 A;  5FRN A;  3LDS A;  1HR0 K;  4A62 A;  3EE8 A;  5E26 A;  2CGJ A;  3NF8 A;  5GAE P;  3MN9 A;  3AVF A;  5DM7 L;  4B9N A;  4CF9 A;  4GKJ K;  3I8B A;  1ZBI A;  3VEO A;  3CYM A;  3L6Q A;  1J6Z A;  3ULD A;  1SUQ A;  5AFU A;  1L5U A;  5CZ1 A;  2HHT A;  1RT4 A;  4DFK A;  3S3N A;  3R3L A;  4WCE L;  2P5G A;  4DR7 K;  3MN5 A;  5M1P A;  1BHL A;  2Q0U A;  3RWU A;  1NBW A;  4BWM A;  2QKB A;  4FLU A;  2B6A A;  1QSY A;  4KRF A;  2OPS A;  2X6S A;  4F2S A;  3K5N A;  2QWO A;  4FLY A;  3L3U A;  4DWI A;  1GLB G;  1HPM A;  3PO5 A;  5HBM A;  4FPA A;  3C95 A;  4B1W B;  4GVM A;  3QES A;  4BRD A;  3GBT A;  3FFK B;  4DQI A;  3I33 A;  4FO0 A;  2VG7 A;  2XHB A;  3DOL A;  2F4V K;  4OPH A;  4X64 K;  3LM9 A;  1NGC A;  1LAW A;  3UKU A;  3A5N C;  2YNF A;  4CEF A;  5JVH L;  4DV2 K;  1KQS M;  5FPM A;  1S5J A;  4BC2 A;  4FJ7 A;  4E89 A;  1CXQ A;  3SQ4 A;  1BWF O;  2KTQ A;  3KTQ A;  2GUI A;  3AVC A;  4RWT A;  1BDG A;  3C0B A;  2GTD A;  4H0O A;  1DLO A;  2YNG A;  1LAV A;  1S9G A;  1X9W A;  2ASM A;  5C25 A;  1HNX K;  3RTV A;  1Q9Y A;  4CJR A;  4JI7 K;  3AO1 A;  4C8M A;  5J2Q A;  1G15 A;  1QVF M;  3ATU A;  3AVG A;  4CF2 A;  1GLC G;  4BC3 A;  4C8L A;  3OJU A;  4BRL A;  3WNE A;  2VWB A;  2HW3 A;  1N36 K;  1RDA A;  1SL1 A;  4BQL A;  4PKG A;  3KK1 A;  1X1P A;  3D7E O;  3TPQ A;  4FJX A;  4AH9 A;  1KXP A;  4CZL A;  1JLC A;  3HPH A;  1N6Q A;  2AA4 A;  5I3U A;  3ID8 A;  2GBZ A;  4DTP A;  3CD6 N;  5BRF A;  3ALY A;  3R9P A;  2G8K A;  4OLA A;  1BO5 O;  3JS6 A;  3QDK A;  1ATS A;  4DV7 K;  2P9N B;  3D2E A;  1Q8I A;  3DXK B;  4Q5V A;  1RT7 A;  3B6O A;  3HPO A;  1MA9 B;  2YCH A;  3P1G A;  4IFE A;  5F2R A;  2WUS A;  1KFD A;  1CXU A;  4O8K A;  1QHA A;  3VQD A;  3AO3 A;  4JD2 A;  3O9T A;  3WXM B;  2Q0R A;  5C10 A;  4DR6 K;  4CIF A;  1K8A O;  3CC7 N;  2QWQ A;  4DQR A;  1NWK A;  1IG9 A;  2HB5 A;  4CFD A;  1KC8 O;  3PSF A;  1X9J A;  3G71 N;  3MX5 A;  1QQC A;  3JYT A;  1IV0 A;  5E84 A;  4RW7 A;  4BY9 C;  3SBT A;  1TKT A;  5HL7 L;  3LAL A;  2CGK A;  1JJ2 M;  3E9P A;  3MXJ A;  1J9A A;  5CE3 A;  1NGB A;  3SQ0 A;  3DLB A;  3HSC A;  5AQR A;  2E6L A;  3O9Q A;  4N56 A;  3CET A;  4FZY A;  4HHT A;  3NH2 A;  1RBR A;  1SS6 A;  3DLL L;  3EY1 A;  1VK0 A;  2F8S A;  4R79 A;  3M8Q A;  4W5N A;  2D5R A;  2E8A A;  3LM2 A;  3NF6 A;  4A5A A;  3ASM A;  5JVG L;  2O8C B;  5HRO A;  1GLA G;  3V9U A;  4LF7 K;  2GEM A;  3WUH A;  1I94 K;  3O9S A;  4K41 A;  5C15 A;  3WEE B;  3TAP A;  3WQT A;  2G8H A;  4DFP A;  5M1O A;  2Q31 A;  3QIP A;  3SJH A;  3OYK A;  2HBM A;  1NMD A;  1RDU A;  3U3Y A;  4DFM A;  4NXN K;  2X74 A;  3LP1 A;  1VQ4 N;  4PQU A;  3ZYY X;  2Y1I A;  1ILY A;  1VQO N;  1GOB A;  1JLB A;  4FLT A;  3OBY A;  1NK6 A;  5AQJ A;  3F9K A;  4O5B A;  3H1V X;  4K0K K;  5C12 A;  3LAM A;  2FF3 B;  2YKN A;  2FXU A;  4NXM K;  3U4L A;  5JLH A;  3NAE A;  1S22 A;  1VQL N;  2RE2 A;  2X78 A;  1HMV A;  4BRF A;  2IS3 A;  1Q7Y O;  3ULE A;  2HHH K;  4DS4 A;  3DM2 A;  3D45 A;  4XEI A;  3G10 A;  4JI4 K;  4UY8 O;  4CEC A;  2HST A;  4AIL C;  3G0Z A;  3LP0 A;  3OA9 A;  4FW2 A;  4RW8 A;  1ATR A;  2VGM A;  2OTJ N;  2O8B A;  1X3N A;  1NK5 A;  3UIQ A;  3LP3 A;  2P9P A;  1YIT N;  3CG7 A;  2I5J A;  4DB3 A;  2E1Z A;  3ATV A;  2FLO A;  5BRE A;  1EWQ A;  5LMU K;  4H0P A;  1TUY A;  1KLM A;  4K43 A;  1NJW A;  5HOO A;  3SQ2 A;  2A1R A;  4M63 C;  3HK2 A;  5AFU H;  1QZ5 A;  3D2F A;  1TAU A;  4WFA L;  1LOT B;  4EIA A;  3J7Z O;  3M6G A;  2ZQB A;  4DR3 K;  1T6D A;  1HX1 A;  3PO4 A;  3TAG A;  3GG4 A;  2ITG A;  3VQP A;  2UU9 K;  4KO0 A;  4Z4I A;  4KH5 A;  5C0Y A;  1V4S A;  1OVY A;  3IRX A;  2X6N A;  5HRR A;  4DCH A;  4BQZ A;  2A40 A;  3CJ1 A;  1RTD A;  4HUG A;  3DXM B;  2NRR A;  1IO2 A;  5KI6 A;  3G4S N;  4YOX A;  4G1Q A;  2WBN A;  4EHT A;  1BQN A;  2HHX A;  3B8A X;  3AGR A;  4RG8 A;  3P39 A;  4WQ5 C;  3NHG A;  4CI6 A;  1YT3 A;  4NLC A;  3JXU A;  4JKA A;  1KVB A;  4MO5 A;  3FLC O;  1I39 A;  2QW9 A;  5DK5 A;  4YOU A;  2P9L B;  4IDK A;  5FPN A;  4JKC A;  4ELT A;  1DTT A;  1SV5 A;  4KI6 A;  4PUO A;  3QIN A;  1VSH A;  4FW1 A;  3G6E N;  2E1Y A;  4UQG A;  3LP2 A;  3CFP A;  1TYQ B;  4FJI A;  4B9S A;  3AY9 A;  2P5O A;  3CC2 N;  4H0T B;  1RBS A;  3PSI A;  4CZE A;  4CJE A;  2D0B A;  2ZE2 A;  4FJ8 A;  4KKO A;  1Y64 A;  4FXD A;  1JXB A;  4KHW A;  1WLJ A;  3VES A;  1EET A;  1NJX A;  3CJA A;  4Q0B A;  4ILJ A;  5EX5 A;  5HLF A;  5IWA K;  5HRS A;  3NGI A;  3ENB A;  2A5X A;  5GAH P;  3EKU A;  1VAZ A;  1JCF A;  4I6M B;  4BRP A;  4CZK A;  1N32 K;  1W0H A;  4PKI A;  1QQN A;  4DU3 A;  4E3S A;  4MDB A;  1C0F A;  5AQZ A;  4CK2 A;  4DG1 A;  2HND A;  3TAM A;  1LW0 A;  4WQ4 A;  2BAN A;  2GX9 A;  1NK8 A;  4A57 A;  4OPK A;  4ZTF A;  4JYA K;  1TK5 A;  3H45 C;  5D3G A;  4FWS A;  2P9U B;  4BE1 A;  2E2Q A;  3O4Q A;  4Z4F A;  1NJY A;  1RBU A;  3S9H A;  5BPN A;  1OH6 A;  2E2O A;  3KLE A;  1WNS A;  4DF4 A;  5C24 A;  4W5T A;  5DM6 L;  3KD5 E;  4JEP A;  2HNZ A;  1QS4 A;  1WSI A;  3IKM A;  4Z94 A;  1S3X A;  3TI0 A;  4CF1 A;  1W2B M;  3RMA A;  1Y97 A;  4GNI A;  3QNN A;  4M7X A;  1VSI A;  1HJO A;  1RT2 A;  3C65 A;  3TAF A;  4X65 K;  1C0M A;  3NCI A;  2CH5 A;  4H5T A;  3CHW A;  5GIP A;  3DLE A;  3R6M A;  3L4I A;  1HNW K;  2P9N A;  3M3Z A;  2F9T A;  1KTQ A;  4DV3 K;  4BAC A;  1W97 L;  1VQ9 N;  1UWB A;  4A2A A;  2YHW A;  3QEI A;  3DXK A;  2BH1 A;  1VRU A;  3ZSR A;  4EAH D;  5AZJ B;  4FYD A;  4KI4 A;  2HHW A;  2DPN A;  3QBX A;  3VQ6 A;  3O4N A;  1NGD A;  4YOR A;  1XUP O;  4J2B A;  1SKR A;  3IS9 A;  2YNI A;  3CIP A;  3ZT2 A;  1D8Y A;  1VHX A;  3MXI A;  3C94 A;  2O8D B;  3VQE A;  4DQS A;  4EHU A;  3N4P A; 
#chains in the Genus database with same CATH homology
 4DV0 K;  5LL6 Z;  1IBL K;  1IBK K;  2UXC K;  5IWA K;  4JI2 K;  4JI0 K;  5LMN K;  5LMU K;  2UUC K;  2UUA K;  2VQE K;  4DR6 K;  1XNR K;  4DUY K;  1HNZ K;  4DV6 K;  4LF4 K;  4JI1 K;  4B3M K;  3T1Y K;  4LF5 K;  1N32 K;  2ZM6 K;  4JI5 K;  4LFC K;  5AJ3 K;  4DR4 K;  2UXB K;  4DR3 K;  4LFB K;  4YHH K;  2F4V K;  4X64 K;  3J81 O;  2UU9 K;  3J7Y P;  4JI3 K;  1XNQ K;  4DV2 K;  3OTO K;  4LFA K;  4JYA K;  4DV1 K;  1IBM K;  1N33 K;  5FLX O;  1XMQ K;  5BR8 K;  1HNX K;  4B3T K;  4JI7 K;  4YY3 K;  3J7A P;  4DUZ K;  2UXD K;  4DV5 K;  4DR2 K;  4LF7 K;  4DV4 K;  1I94 K;  4CW7 B;  4CVN E;  1FJG K;  4KHP K;  3J80 O;  3JAM O;  4X65 K;  4JI6 K;  5IT9 O;  4LF9 K;  4OX9 K;  3T1H K;  2UUB K;  4NXN K;  1N36 K;  1J5E K;  1HNW K;  4B3S K;  2E5L K;  4DV3 K;  1HR0 K;  4K0K K;  4LF6 K;  4GKK K;  1N34 K;  4JV5 K;  4LF8 K;  4NXM K;  4DR1 K;  4B3R K;  4GKJ K;  4V19 S;  5A2Q O;  2HHH K;  4DV7 K;  4AQY K;  4JI4 K;  2VQF K;  1XMO K;  4DR5 K;  4X62 K;  4JI8 K;  4DR7 K;  4X66 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...