4X65K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4x65K00
1HNWK 4DUZK 2UXBK 4JI1K 4LFBK 4LF4K 4CW7B 4B3SK 4JYAK 4K0KK 5LMNK 1HNZK 4DR1K 1FJGK 4NXMK 3J7YP 4DV4K 2UU9K 1XNRK 4DV2K 1HR0K 2HHHK 1N36K 3JAMO 4NXNK 4DV7K 4JI0K 4X64K 5FLXO 4OX9K 2UXDK 3J7AP 2F4VK 4JI3K 4B3MK 3J81O 4YY3K 5BR8K 4GKJK 4DV3K 4LF5K 1J5EK 4DR3K 5AJ3K 5IWAK 5LL6Z 1N32K 2UXCK 3T1YK 1XMOK 1HNXK 4V19S 4X65K 4JI7K 3OTOK 2E5LK 4DV6K 2UUCK 4DR4K 1N34K 4KHPK 4JI8K 4DUYK 4LF6K 1XMQK 4JI5K 4JV5K 1XNQK 3J80O 4LFCK 1N33K 2UUBK 4DV5K 4JI2K 5A2QO 4LF7K 4JI4K 4B3TK 5IT9O 4DV0K 4DV1K 2VQFK 2VQEK 2ZM6K 1IBKK 2UUAK 4CVNE 4YHHK 4X66K 4LF8K 4LFAK 4X62K 1I94K 4DR2K 4B3RK 4LF9K 4DR5K 4JI6K 4AQYK 3T1HK 4DR7K 1IBMK 4GKKK 1IBLK 4DR6K 5LMUK
chains in the Genus database with same CATH superfamily
1EWRA 3NF8A 4N76A 2PYJA 3CFRA 4IEIA 4F8RA 3LPUA 4LF4K 3LL3A 4DTSA 5I9EB 1Z26A 4N41A 1FK9A 4AHTA 2NRHA 3F9KA 1IKVA 4DQQA 3K9KA 1VQ5N 3C6TA 4FW1A 1FJGK 1W9HA 3IG1A 2B5JA 1U45A 3TR8A 3VERA 3ZEUA 4UY8O 2D0OA 3OS0A 2DFHA 5GADP 2O8EB 5JS1A 1MWKA 1KVAA 4XH1A 4CE9A 4CF1A 4WYBA 2AJQA 4CJEA 2FBXA 4GVEA 3JSMA 4ICLA 1ZBLA 3MCAB 4JI3K 3D2FB 2A40A 4HWIA 2HW3A 1X1PA 1JLQA 2WC9A 3QEWA 3QFPA 5MLCQ 4M3ZA 3QICA 3EE8A 3LP0A 3TAGA 3MWTA 1NGFA 3QETA 1RFQA 4L8RB 1Y64A 2HHSA 5KI6A 3S3NA 1XHXA 1GOCA 1WN7A 2Q3SA 5HRSA 1N6QA 4Y0WA 5KQDA 3MK6A 5F0XA 3A5MC 5C25A 3I33A 3HYFA 4A5BA 3VF6A 1TUUA 3VA0A 3AA3A 4Y1DA 1E3MA 4YOXA 3V9UA 4AF1A 3SK3A 5CYMA 1XNQK 3P5JA 5BN8A 3CXCM 3VQEA 1Q8IA 2ZGZA 3OVNA 2UUBK 3VEXA 5GAHP 3H45C 4LF7K 2GELA 1G15A 4TSXA 4YOYA 4CFBA 5GIPA 3U6FA 1RTDA 4DU1A 4B9MA 5EOYA 2D0AA 4O8UA 3HOSA 3DRPA 2O8FA 1YJNN 5C24A 4JAXA 1NNEA 2HMPA 4DR5K 4HUFA 4DR7K 2ZJPL 3QMLA 4CBXA 3DOLA 1KVBA 4IDKA 3QERA 3D0PA 3D6RA 3SQ0A 4B9QA 3VMFB 4CBWA 1HNZK 1WB9A 3EEQA 3CJ1A 4B1UB 1SZ2A 2ZWHA 1GLCG 1U04A 1T03A 1HUXA 4M3WA 1YTAA 2YHWA 4I6MA 1NGGA 1QQNA 4CZJA 2UXDK 2QWMA 3T69A 2YKNA 5AQUA 4B3MK 4BDPA 1J5EK 1U6ZA 1BI4B 4MO4A 4RG8A 1B9DA 4KB1A 3TABA 4BR4A 3OYNA 3M5RA 1QVFM 1WSJA 3NF7A 4FK2A 4C8KA 1DEJA 1Q82O 3DLHA 1JLBA 4BWMA 5TKYA 3A5LC 1RT7A 1T44A 3FFKB 1ITGA 3HBTA 4DR4K 3LP3A 1RDAA 1B9FA 1CLQA 4FWNA 4EZ9A 1Z05A 3DAWA 4B3OA 2QW9A 5EU7A 4JEPA 5DM6L 4M63C 4JI5K 4LFCK 3TSUA 2VYPA 4IXCA 3NCIA 1RT1A 3H3OB 1JCGA 4CZKA 4BRDA 4M42A 4BR9A 4J2AA 4CZGA 2VQEK 3AAPA 4CJRA 2QWRA 3CQXA 2GX9A 1NGDA 3CJBA 3HP9A 4KKOA 3NDKA 4QAGA 4B9NA 4LFAK 4PWDA 3E9LA 3SJHA 4JS5A 3OS1A 3NGYA 3WXJA 3ULEB 4CJ7A 1GLBG 4M7XA 4C8OA 2YNIA 3PLAA 4JK9A 1ZBHA 3SUPA 1TVRA 1D9DA 5J2NA 1IG8A 4H0PA 1JKHA 3KKSA 4DTPA 2VG6A 4BRLA 4FJXA 2HBLA 3NGZA 3TANA 4FPBA 3TAEA 1X3MA 4WF9L 4K41A 3J7YP 1LWEA 3QBWA 2Z1JA 3O1WA 4YOUA 1HPMA 3THWB 2YKMA 4Z4FA 4EZ6A 3K5NA 5AZJB 4C8LA 1VK0A 5DK5A 1ZBSA 4WQ4C 4GMJB 1BDGA 1I3AA 2WONA 3BGRA 2ETJA 4CF2A 3K9JA 3VQ9A 2LSNA 1W7AA 2I7PA 4B9TA 1U2VA 2BANA 5M1FA 3ZX0A 1R0AA 4FOEA 3WT0A 4RW9A 1SKWA 4JK7A 4OKKA 3FZMA 4OJRA 3TSPA 4DV3K 3VQ8A 2O8CA 1UWBA 4DCHA 1OH5A 3L3VA 2RE2A 3MX2A 3UIQA 1O13A 2QWNA 5ADXH 3AO4A 4CEZA 4LH4A 3C7NB 3RMCA 2EX3A 4C1NK 4Z4HA 4JKGB 1HNXK 4F3OA 3TTDA 2X78A 3AA2A 3SQ4A 2YNFA 4F2SA 4IOCL 4FZYA 2W40A 3V9WA 1Q9XA 3CCUN 4CHOA 1QS4A 4DSJA 1B92A 2FBYA 3FLCO 5F1XA 3LDNA 2GUIA 4A61A 1X9SA 2E1ZA 4K8XA 4ID5A 4BRIA 1FKOA 1JL2A 3EY1A 4BQZA 3N4QA 1C0UA 4JKAA 3B6PA 3ITHA 3AVCA 4YDUA 3ZT1A 5AQLA 3I0SA 4EHTA 3RWUA 3L4QA 3SAGA 5AQSA 3QEXA 4ISEA 2BTFA 1VQ8N 4F4KA 1OVYA 1VQMN 5H1SQ 1T6CA 2ZJRL 5J2PA 3FGUA 1YVNA 4CVNE 4B1ZA 3LM2A 5JICA 3V6DA 4NYFA 3O3HA 5F2RA 3ZSWA 1ESVA 4FK0A 1CXUA 4JLHA 4JKDA 4JI6K 2QTDA 4WFAL 1SL0A 2E6MA 1NGEA 3O9RA 1JCEA 1DKGD 1HNWK 1UAXA 4DUZK 4FLTA 3AVMA 3SMSA 4IJNA 4L3QA 1KVCA 3OYAA 4B3SK 4WFNL 3ALYA 4DR1K 2FBVA 4BR2A 4CZMA 1X9WA 4R79A 3AVGA 4IG3A 1HKGA 4DV2K 3C0BA 3UKRB 3RSEB 3H6EA 3SPYA 3SI6A 3U9DA 1KRPA 4BVPA 5SZTA 5SWMA 2F8TA 4H0YB 1M90O 3U4LA 2HMIA 4X64K 3JYTA 4FPAA 2E2PA 3RRGA 3LWLA 1MDUB 5BPNA 1NKEA 3P1GA 1BUPA 4CJ3A 4IOAL 1IV0A 4HTLA 3C6UA 3O9SA 4FLUA 3EE9A 1NM1A 1R59O 3KVGA 3KWGA 5AJ3K 5IWAK 2Q1NA 3ENHA 4F2RA 3QEIA 3MCPA 4MDAA 3OYGA 1NU0A 1NJWA 3DLGA 4LSLA 3OTOK 1KC8O 3OYBA 2DFEA 3HM9A 1WBDA 3VGMA 4PL7A 4K42A 4FYDA 5C0YA 5AQYA 2E4LA 3LALA 4JI8K 1XMQK 3CJAA 2B6AA 5AZIA 2D5RA 2ZGYA 2V52B 3KLIA 3KK1A 4CIEA 3SBTA 4M3XA 3RMBA 3KK7A 1ZXOA 4JRQA 2NRTA 3P83D 2HVIA 1J5OA 4I9QA 4DV1K 1S72N 4BRGA 2NRRA 1NGCA 4M45A 4Z0UA 4JD2A 2YCHA 4BDYA 3VEOA 4H03B 4DR2K 1KCFA 1YUWA 5GAGP 4BDZA 1VRUA 1JLGA 2PAVA 3WXKA 3P31A 2VWBA 5B8HA 1JLAA 4HUGA 1NMDA 2NUBA 3C95A 3ISNC 4JI1K 3NE6A 3O1BA 2W6LA 4DSLA 2F96A 3AO5A 5M1KA 4CGFA 1HQEA 3TARA 3NBPA 1HYVA 2QXLA 1F21A 3HPOA 3L2QA 4G9ZA 3CFOA 1DTTA 3K5MA 1HR0K 5AQQA 4H0XB 1A5VA 1KTQA 4WQ5A 3K59A 5CYQA 4XH4A 3WEEA 4E3SA 3BY5A 3OYMA 5AQMA 3VQ5A 3AVBA 1T3VA 2QWPA 1FKPA 3OYEA 4A2BA 3ZETA 3DXKB 3UE5A 4DTUA 5ELZA 2DTUA 4O5BA 2BGGA 1NK6A 1T8EA 1K73O 4FJKA 4CHPA 2A1RA 3HL8A 4M7YA 2XRIA 5JS2A 1KQSM 4PKIA 3DXMA 2E5LK 1WSIA 4BGAA 4KO0A 1RTHA 1ILYA 4ZTFA 2HNZA 2P9KA 4J2BA 3QNOA 2Q0RA 5HP1A 2YHAA 4ELUA 5FPDA 4O55A 4CF0A 4LF6K 3OJSA 1GOBA 4ILGB 5GIOA 3ENOA 4FLVA 2HHWA 4MO5A 3ZEUB 3DMJA 3O3GA 4EP4A 2FSNA 4DTNA 4CHQA 3K57A 4CJUA 3MEGA 4DV0K 4HHTA 1XC3A 3MX5A 2I5JA 3THXA 1VRTA 4O0IA 3G6EN 3NGIA 3MXJA 1D4XA 5HRRA 3RRHA 3CG7A 2YNHA 4E1JA 3HRGA 4OGEA 1LWCA 3JS6A 1SAZA 1IKWA 2DFFA 2P1JA 1Q81O 4DLGA 4W5OA 4LFBK 1VSFA 2GUPA 5M1PA 1QTMA 2IAJA 2W6KA 3VTIA 1ZYQA 3VTHA 1A5WA 3CC7N 4CJKA 2OZMA 1VSMA 3MXIA 4BRKA 3A8YA 1BGXT 2JWLA 2VWKA 1EKEA 3O3FA 4FWQA 4LC9B 3K5OA 4KI6A 2XHBA 1M1KO 3DRSA 4NXNK 1RDDA 3CQYA 1SL1A 1IO2A 2RKIA 5M1NA 4KHSA 3CIPA 5KPZA 3J81O 1ATNA 3ATVA 3V9ZA 3BDPA 4KI4A 4CGIA 3ZSOA 3O4NA 1C1AA 1HJRA 4M3RA 2HBJA 4PUOA 3QIOA 3SAFA 3T1YK 2O8FB 1Q9YA 4BG9A 2ZE2A 1NKCA 5AQWA 4CJ4A 4CD3A 4OPKA 3IUCA 4KTZA 4JI7K 3O4WA 3UKUA 1HRHA 1ATRA 2YHXA 4FJIA 4FOIA 3MN5A 5C15A 2CGKA 4H5WA 2E2NA 1SL2A 4ILJA 1N34K 4YDUC 3Q7BA 3PY8A 3QB0A 3LWMA 1K8KA 1TL3A 3WXIA 4JV5K 1YITN 4BC5A 1C6VA 4J8FA 1W2BM 3DWLA 2Y1JA 4CJFA 1HJOA 1S1WA 3A5OC 1TK8A 1U47A 4I6MB 2OTLN 2VQFK 4FWKA 1IBKK 3EZ5A 1S6PA 3O9TA 3GE1A 4YHHK 3D2EA 3ZSQA 2FC0A 2VG7A 3LDLA 4CEBA 4FZXC 3I8BA 3VQ4A 4YORA 2HSTA 3CFPA 3S3OA 3FZHA 1K9MO 3KJVA 1C1BA 1KFSA 4LY7A 1XUPO 3TAQA 4NB4A 3THYA 3DI6A 1BG3A 4RW7A 5KTQA 4KHNA 3LZJA 4PHTX 3J8AA 3PO5A 3LDOA 4FJ8A 1SV5A 3IMXA 1DGKN 4DTJA 4CI6A 4CZLA 3SPZA 1HYSA 4B9VA 3CI5A 3WXMB 4XEIA 2V51B 4AHUA 3R8EA 2HOEA 1FW6A 3AA4A 3HO1A 2XY6A 1EP4A 2NRVA 4H5VA 1ATSA 3J7AP 5BRFA 2WUSA 1UA1A 4U67L 3A0IX 3O08A 1LCUA 3SJJA 4I7FA 5BRHA 3OYHA 2X74A 3HOTA 4GW6A 2ZD1A 3LAKA 3I56N 1XMOK 2P5OA 2RHKA 4CFDA 3CCEN 5GINA 1WUAA 1RT2A 3D2FA 5CZ2A 4FJMA 1NWKA 4CJTA 1HNVA 3RMDA 3FFIA 3SMPA 3WNGA 5FRMA 4KBOA 2HHQA 3RMAA 4BGBA 5BREA 1JLEA 2QK9A 4UQGA 2OPPA 4M3TA 1A5XA 3R3LA 2FBTA 3KLHA 2HVHA 5I42A 4DU4A 3T1AA 5D3GA 4CERA 3V1OA 3MAQA 1EETA 1GOAA 3F5TA 1K8AO 1BWFO 1NJYA 4FJLA 4J2EA 3OJUA 2I7NA 3VETA 3KK2A 3VGLA 4K8ZA 1P8ZA 3V4IA 1VQLN 2P9NB 2WOMA 1U2VB 2ITMA 4E89A 4AILC 1V4TA 1C0FA 4BROA 1WLJA 2O8CB 3LDSA 1YTUA 4IDHA 5AQKA 1NKBA 4NCAA 5C42A 1OKJA 2GWKA 5HOOA 2DPNA 3AVIA 4WQ5C 2Z1HA 5LMNK 3QEVA 3AVJA 4DV4K 3SUOA 5DMRA 1HX1A 4HUEA 4H0OA 1NGHA 3OBYA 4BWJA 5CY4A 4CZEA 1S6QA 2GWJA 3G4SN 5FPMA 2Q36A 3ZYYX 3PIPL 3IAYA 5FLXO 4N5SA 1QHTA 1S3XA 1NK8A 3EKUA 3CCVN 5KPTA 3L3UA 3G10A 2FF3B 4MFBA 2A5XA 4PKGA 1K6YA 3CYMA 4H5RA 1RT5A 1HKBA 4H0TB 1LWFA 4JRPA 3E9PA 3V9XA 2HHVA 1JCFA 4DTOA 3ATUA 1HLUA 4BR7A 4CK3A 3R9PA 3M8QA 3PV8A 3VN5A 3CCRN 5C12A 1WSEA 2VCPA 3AAQA 1XI1A 2YV0X 5GAEP 2VG5A 2GTDA 3LP2A 2P9PA 3AGKA 2HB5A 1KD1O 4A59A 1RTJA 4DF8A 4CK1A 3MECA 1LOTB 3RR7A 1VQKN 1NJIO 4B3RK 3U3YA 2KZZA 1BISA 3EZWA 5JVGL 1IBLK 1JJ2M 3O8MA 4BC2A 4JNEA 3NHGA 4KHWA 4KRFA 1O1WA 2OCEA 1S1VA 4OKJA 3WQUA 2G8HA 1JXEA 3DLLL 4CEQA 2P9UA 3CCJN 4DSIA 2KW4A 3ZSZA 4M3YA 4JKBA 3DLRA 3KK3A 2O8DA 2EWSA 2FXUA 1VSJA 1XNRK 4CEAA 2HBKA 2ZF5O 2E88A 5M1OA 1VSLA 5HRNA 3S3MA 4NLCA 1BIZA 2A41A 3NF9A 3AARA 1U48A 5AZIB 1L5UA 3SCXA 2YJFA 5JLFA 3I0RA 4KHQA 2KFNA 1X9MA 4QS8A 4AH9A 1EWQA 2QKBA 3HP6A 4MLEA 4I9LA 3EYZA 3DOKA 1DLOA 3R6MA 2A1SA 4H5TA 2IDOA 5AZJA 3KD5E 1UOCA 1SUQA 1Z6RA 3H3NO 4DR3K 4JD2B 1RDBA 2YJEA 4DQIA 3E1YA 1IKYA 4DS4A 4KHYA 1SS6A 4O4GA 2QM1A 5AQNA 2O4GA 4KREA 3TSQA 3L0QA 3HPGA 4DB3A 4HCBA 4CGGA 4QCLA 1TL1A 1RGIA 4FVUA 3TPQA 4IJAA 2O8BA 1EQYA 5M1QA 1RBVA 2P9SA 1H1VA 3H1VX 3G25A 1BA0A 1NGBA 1L3UA 1RDCA 3WEEB 3TAFA 3F9MA 1KAZA 2VWJA 4CF9A 3HZ6A 1VSDA 3PSIA 4FWLA 1TYQA 4LF8K 2QWOA 3SV3A 4FWPA 3LM9A 1JLFA 3VOVA 3M1FA 1G99A 3ZETB 3PUFA 3QIPA 3F73A 4E7LA 5EY4A 3LPTA 4NO7A 1DTQA 4CD1A 4CHNA 1RBSA 4MDBA 4E0DA 4FSVA 3CPEA 4CIGA 5AQOA 4CW7B 4FJHA 1CXQA 4DSFA 2QI2A 2HHUA 4JYAK 3OS2A 1S1UA 1QSLA 4DS5A 1TK0A 3DXMB 2CGLA 1BU6O 1J9AA 3QESA 1L3TA 4DQSA 3BF3A 2IIRA 4HCCA 3LP1A 4C1NI 4AHVA 4MQ3A 1UA0A 3C6HA 2NZTA 4FJGA 2D0BA 2Q31A 3ENBA 1N5YA 2Z1GA 3OHRA 3VENA 4CJWA 1RTIA 2KKZA 1WSFA 4CZFA 2NRZA 3PX6A 2YHYA 2ASMA 2H3GX 3VEVA 1N8RO 3QFUA 3OYKA 3OW2M 3THXB 3PX4A 1NGAA 3ZX3A 4Q0BA 1NGJA 3NMUA 3DLKA 3NVKA 1KLNA 4W5QA 2Y1IA 1QZ6A 4KH5A 3HVRA 3V81A 3VQBA 3KD1E 2QEXN 3WNHA 4E19A 4FWRA 2XY7A 1TKZA 1VQ4N 3ZLJA 3DYAA 2E8AA 2PBDA 1OH7A 4KHUA 4O0JA 3MWPA 5J2QA 1QHAA 1VQ6N 5KGXA 4CEOA 2YI1A 1VSKA 3CM6A 3IKMA 4K43A 3H1QA 1TK5A 5J2MA 1QVGM 4KPYA 4WCEL 3G0ZA 5A2QO 4DSKA 3CCQN 4A62A 3WQTA 3EKSA 2HHTA 3SNNA 5AQXA 2IVNA 4EAHD 3T7ZA 1X3NA 3H08A 3AV9A 4KAZA 1RBTA 4RW4A 4BRPA 2G8VA 4JHDA 2QXFA 4G1QA 2Q2RA 3T1HK 2Q0UA 4DFPA 2G8FA 5LMUK 1NJZA 4FLWA 4KH6A 3ZT0A 2IOCA 4JKFA 1TKXA 3ZSVA 3ID8A 4JK8A 3G71N 3UKUB 4PA1A 5CE3A 1C0MA 3KKRA 1BL3A 1RILA 3HT3A 4FLZA 4IO9L 2P51A 4QS7A 1LW0A 5KRSA 3M8RA 1C0TA 2XY5A 1YI2N 5BPLA 2HF3A 3T19A 3CMEN 5KGWA 5AQJA 1GLJO 3WXLA 1K8KB 4CJLA 3LDQA 1IH7A 1NOZA 3BP8A 3LANA 2OPRA 3SLCA 1WOQA 1W97L 2P9IA 4OX9K 3QBXA 4FLYA 3FZFA 4YY3K 1WBBA 4O8KA 4CF8A 4GY2B 3TTCA 2BE2A 3GL1A 1BQNA 4BC3A 4DTXA 3PSFA 3VPZA 1U49A 5LL6Z 3D2EB 3SQ1A 5E84A 1TKDA 4H0VB 1BHLA 1NK5A 3LZIA 3AVFA 3DLEA 1SKRA 4RW8A 4X65K 4B08A 2E6LA 4NYNA 4FVMA 2B4JA 4DV6K 3HPHA 3THYB 3P38A 4FO0A 1LAWA 1X9JA 3WNEA 3KWIA 3EL2A 4E7HA 4LH5A 4FJ9A 2KTQA 4BG8A 3SAHA 1CZBA 3QINA 1RBRA 2ASPA 4ELTA 2CH5A 1N33K 3Q7CA 4JI2K 3MMVA 4DQPA 5C10A 3O4QA 4FWSA 4XH5A 5BN9A 2KZMA 3MN9A 4AM7A 1YT3A 4CJSA 5KQ8A 3CMAN 4X66K 1T05A 2UYTA 3QDKA 2WTUA 3L2RA 4LF9K 3N4PA 3VEWA 3CM5A 1BQMA 4KH4A 3OY9A 4GKKK 1EX4A 3HM8A 3BF1A 1QQCA 4DG1A 4DMNA 4JS4A 4GV6A 3K5LA 3AO3A 3HVTA 4CEFA 1ASVA 4KFBA 2D1KA 4B1VA 2FSKA 4CZIA 4K0KK 3KTQA 3O9UA 1TGOA 4BRFA 2P9LA 2X6SA 1XHZA 2UU9K 3TI0A 2QWLA 4DQ8A 2KQ2A 4KTWA 5JVHL 3CERA 3VQ6A 1RT4A 1S5JA 1RCHA 1XWLA 1YAGA 4OPAA 4W5RA 4DFMA 4B9LA 3VEZA 5AR0A 1KAXA 3BEXA 1Q18A 3TU5A 1E4GT 1GLAG 3OYJA 3AVAA 4LF5K 4CECA 5AQIA 3VGKA 4EIAA 1Y97A 1YVUA 2BH1A 4OVLA 3VESA 1BO5O 5FDLA 1S1XA 3VEYA 1IKXA 1MA9B 2G8UA 4V19S 4FWMA 2F9WA 3BZKA 4Z4IA 3CF5L 2XO7A 2D0CA 3SYZA 4AHSA 1YHQN 1J54A 4JKHA 3NAEA 4CGDA 4ILHA 2V7YA 3RR8A 4K25A 4KHPK 2A42A 3BZCA 4E7KA 1VQ7N 2NRWA 2O8EA 4DSEA 2HNDA 1OH8A 4DUYK 1T7PA 4CCHA 5HBMA 1VSEA 5C2DA 3CETA 3P4IA 4ZHRA 2PZSA 3J7ZO 2BDPA 3QEPA 2YNGA 1KAYA 1VQON 3TWHA 4W5TA 1JXBA 2J4RA 4YNQA 1CZAN 1RDUA 2FLOA 3TAPA 5CHIA 3ZSRA 4Z4EA 4AM6A 4QOZB 1HMVA 3K0SA 4OPJA 1IBMK 4JKEA 4IFEA 4DR6K 2ATQA 4LD0A 4CFCA 1E4FT 1SQKA 1ZBIA 2OPSA 5TKWA 1IG9A 2EHGA 4H4OA 5HL7L 3SUQA 2VGMA 4GVMA 4C23A 4C8NA 1RBUA 5FPNA 5HRPA 4NXMK 3VQPA 3GBTA 3FZKA 3I8DA 3AGRA 5JLHA 3NH1A 5AFUA 1QZ5A 1BOTO 3LDPA 4EP5A 2AA4A 1Q7YO 3C94A 4DU3A 4B1WB 3HSCA 4DV7K 4EFHA 4IBNA 1W0HA 1VQNN 4OKEA 3AVLA 1MWMA 1NK0A 1NK7A 5BR8K 4GKJK 2P9PB 4BREA 1TKTA 4CJQA 3O6WA 3ZT4A 1VHXA 1YXQA 4MLHA 4CJ5A 4KV8A 4BC4A 1LAVA 3VQCA 3NH2A 2F9TA 4IFYA 4IKFA 2HHXA 4BRQA 4JN4A 4DFJA 3GDQA 4YOWA 3SUNA 3HJFA 4DWIA 4BACA 2P9UB 5E41A 2A6AA 1REVA 1LW2A 2OANA 3P39A 3VQ7A 4BRHA 4CIFA 4O5FA 2O8DB 3J80O 3GOIA 3M6GA 5AQPA 1S9GA 1JLCA 3NH0A 1V4SA 4BRAA 3ZCMA 2ZJQL 4Z94A 1GLFO 4DKWA 3C6AA 1BI4A 4IO8A 3A2FA 1BA1A 3AA5X 3M3ZA 2OPQA 1TUYA 4B8CA 5AQTA 2G8KA 4A57A 4X62K 3O5BA 4E1NA 4JKCA 4ISFA 5AQGA 3CC2N 1D5AA 5C2FA 1QE1A 4FJNA 2IGIA 2RF2A 1KSPA 4DQRA 2E2OA 2P9NA 4CZHA 4OGCA 1WAJA 4C8MA 4N47A 3HI0A 1YIJN 3CJ7A 2HBMA 2JGUA 3R1XA 3B6OA 4BQLA 2QKKA 1L3SA 2JWKA 2ITGA 3KHYA 1GLLO 4GV9A 2KLAA 4ZTJA 4A5AA 3SZ2A 2V7ZA 1ZC6A 5FROA 4CHYA 3HXMA 3QO9A 4BR5A 1KLMA 4B9SA 3M8SA 1IJJA 1I39A 2O8BB 4H4MA 3CHWA 3ID6A 4CHZA 4ISGA 4E7JA 5EX5A 2Z1IA 4O44A 2GEMA 3VQQA 4FJJA 2NRXA 2P9SB 3OYDA 5AQVA 2G8WA 1TAQA 2CGJA 3S9HA 3ULEA 5AQRA 2FSJA 2OA8A 3ZT2A 4M3UA 3NF6A 3HTVA 4QS9A 4CBUA 5DM7L 4CESA 4NLBA 3WUHA 1VQPN 1N32K 1TYQB 2UXCK 1J6ZA 2OZSA 4BR0A 3OYIA 3CCMN 4PKHA 2ZQBA 2NLXA 5EVZA 3AVKA 2HNYA 2GV9A 3V1RA 3RTVA 1D8YA 4F3TA 3OYFA 4CJPA 4YOTA 1YF5L 4NCBA 4FL9A 1EXQA 4IWVA 4RCHA 4BE2A 1NOYA 3THWA 4NCGA 2OYQA 3MXMA 4E1MA 4LSNA 2XY8A 1T6DA 2FF6A 4IZ9A 1HNIA 3D7EO 4FWOA 3NFAA 3LAMA 3VF4A 4PY5A 4HVJA 4WFBL 3D45A 2F7TA 5AQHA 3V1QA 4W5NA 2YHBA 5K14A 3NVMA 4CEDA 4OPHA 4JI4K 1YJWN 2IS3A 4B3TK 3O9QA 2ZM6K 2IVOA 3KLEA 3IRXA 4A2AA 3C7NA 3DLBA 3IFRA 3DJCA 1I94K 4JKGA 1HKCA 3AY9A 4M41A 4RWTA 2VGNA 4AQYK 5HROA 2PYLA 1XQSC 4IFVA 3CD6N 4FW2A 4IOXA 3KLGA 2W41A 4BVOA 3CCSN 4FJ7A 4IG0A 1QQOA 1BIUA 2P5GA 2UXBK 1P90A 1OH6A 1NBWA 4YOVA 4CGJA 4U7BA 2W42A 3A5NC 1DT9A 3CJ9A 1MU2A 4CEEA 1WNSA 2O4IA 1WSGA 4PL8A 2ASOA 4Z4GA 3HSTB 4ELVA 1Z25A 3ASMA 2JLEA 2PFUA 1ASUA 2DY4A 1RT6A 1HPZA 1RT3A 2OTJN 4FCYA 2QA4N 1ASWA 1N36K 1OVQA 1S1TA 4CGHA 4Y1CA 3JAMO 1C1CA 3OA9A 3L4IA 3U3GA 3ZT3A 2BUPA 4BRMA 4JI0K 5J1EA 3C65A 4I2PA 3H46O 3CCLN 3L2VA 3VA3A 3SBGA 1JL1A 2RN2A 3PO4A 4FXDA 5AQFA 4B1YB 3E01A 2IVPA 5T7BA 3QNNA 4BRNA 3L8BA 2P9KB 4FM2A 4DF4A 3I55N 2E2QA 3CJCA 3EN9A 3KLFA 4KTQA 4CJVA 1HYZA 4RTFD 3AVHA 2F8SA 4Z4CA 3FR0A 4JHDB 1BCMA 1HQUA 2QWQA 2X6NA 3K2PA 4OLBA 1RNHA 3AO1A 4J2DA 4H5NA 3ZSXA 4H8KA 3JXUA 4B1XB 3IDHA 1GLDG 5FPEA 1CZ9A 4BRCA 4BE1A 2NNWA 1TAUA 1GLEG 1NG9A 5JMVA 3UKRA 3RSEA 4DTMA 3THVA 3T3FA 4BY9C 2D4WA 2WFBA 3FZLA 4BE0A 4B9UA 2WBNA 1D9FA 4RW6A 1U4BA 3KZBA 4CFAA 3B8AX 1KFDA 3SV4A 3FE1A 3OYLA 5CR4A 5AQZA 5IT9O 3DRRA 4ID1A 4OO1J 2E1YA 2UUAK 1S9EA 3BUZB 3U8XA 5ADXA 2P9IB 2RPIA 5LJWA 3CQ8A 3S41A 3OBWA 5BR9A 3MEEA 2HF4A 3L2WA 4EHUA 5E26A 4FM0A 3U9ZA 3MEDA 2AP1A 1QSYA 3W3DA 4GNIA 2CH6A 3KIOA 1EO1A 1KXPA 3F2KA 3RVCA 1XC9A 5CZ1A 3GG4A 1S22A 4GV3A 2KFZA 2GBZA 3O80A 4FLXA 4FZZA 3M8PA 3PX0A 3DM2A 1QQMA 5LY3A 4IEEA 3OYCA 2HHHK 3L2UA 2R7YA 4DHYA 5KRTA 2IC3A 1NK9A 1RDWX 3ULDA 4XIUA 3V9SA 3K58A 1VQ9N 3CPWM 4FK4A 1NGIA 3L6QA 4YFUA 3IS9A 2YX6A 5KPRA 3TAMA 2F4VK 4KB0A 5EXWA 4FM1A 4WQ4A 4DTRA 3HK2A 3ZX2A 3MN7A 3E9OA 1VSHA 1QSSA 3QLHA 1FXXA 1Q86O 3WNFA 1TV6A 5BPMA 3AVNA 2PY5A 1VSIA 1LV5A 1WAFA 3VQDA 2Q97A 5FRNA 2E20A 4DFKA 2KHOA 1NJXA 3SQ2A 3AO2A 3VQAA 1C0GA 3ZSYA 2UUCK 4FJ5A 5LJVA 1J53A 3CC4N 5HLFA 3PIOL 3MDQA 1VAZA 1YJ9N 2P9LB 4HTUA 1BCOA 3E66A 3VF2A 3MN6A 3W0LA 4DV5K 1NMNA 5AFUH 4CK2A 4Q5VA 4I2QA 4DLEA 3DXKA 3UB5A 1NLVA 4AHCA 4E7IA 4OLAA 4F9OA 4B8AB 2D0PA 1WSHA 4R5PA 5BRDA 1SKSA 4WE1A 1ZBFA 4PQUA 1NK4A 1L3VA 2A3ZA 3EO3A 1ZBUA 4N56A 2G8IA 5I3UA 3TTFA 4AHRA
chains in the Genus database with same CATH topology
1HNWK 4DUZK 2UXBK 4JI1K 4LFBK 4LF4K 4CW7B 4B3SK 4JYAK 4K0KK 5LMNK 1HNZK 4DR1K 1FJGK 4NXMK 3J7YP 4DV4K 2UU9K 1XNRK 4DV2K 1HR0K 2HHHK 1N36K 3JAMO 4NXNK 4DV7K 4JI0K 4X64K 5FLXO 4OX9K 2UXDK 3J7AP 2F4VK 4JI3K 4B3MK 3J81O 4YY3K 5BR8K 4GKJK 4DV3K 4LF5K 1J5EK 4DR3K 5AJ3K 5IWAK 5LL6Z 1N32K 2UXCK 3T1YK 1XMOK 1HNXK 4V19S 4X65K 4JI7K 3OTOK 2E5LK 4DV6K 2UUCK 4DR4K 1N34K 4KHPK 4JI8K 4DUYK 4LF6K 1XMQK 4JI5K 4JV5K 1XNQK 3J80O 4LFCK 1N33K 2UUBK 4DV5K 4JI2K 5A2QO 4LF7K 4JI4K 4B3TK 5IT9O 4DV0K 4DV1K 2VQFK 2VQEK 2ZM6K 1IBKK 2UUAK 4CVNE 4YHHK 4X66K 4LF8K 4LFAK 4X62K 1I94K 4DR2K 4B3RK 4LF9K 4DR5K 4JI6K 4AQYK 3T1HK 4DR7K 1IBMK 4GKKK 1IBLK 4DR6K 5LMUK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNW K;  4DUZ K;  2UXB K;  4JI1 K;  4LFB K;  4LF4 K;  4CW7 B;  4B3S K;  4JYA K;  4K0K K;  5LMN K;  1HNZ K;  4DR1 K;  1FJG K;  4NXM K;  3J7Y P;  4DV4 K;  2UU9 K;  1XNR K;  4DV2 K;  1HR0 K;  2HHH K;  1N36 K;  3JAM O;  4NXN K;  4DV7 K;  4JI0 K;  4X64 K;  5FLX O;  4OX9 K;  2UXD K;  3J7A P;  2F4V K;  4JI3 K;  4B3M K;  3J81 O;  4YY3 K;  5BR8 K;  4GKJ K;  4DV3 K;  4LF5 K;  1J5E K;  4DR3 K;  5AJ3 K;  5IWA K;  5LL6 Z;  1N32 K;  2UXC K;  3T1Y K;  1XMO K;  1HNX K;  4V19 S;  4X65 K;  4JI7 K;  3OTO K;  2E5L K;  4DV6 K;  2UUC K;  4DR4 K;  1N34 K;  4KHP K;  4JI8 K;  4DUY K;  4LF6 K;  1XMQ K;  4JI5 K;  4JV5 K;  1XNQ K;  3J80 O;  4LFC K;  1N33 K;  2UUB K;  4DV5 K;  4JI2 K;  5A2Q O;  4LF7 K;  4JI4 K;  4B3T K;  5IT9 O;  4DV0 K;  4DV1 K;  2VQF K;  2VQE K;  2ZM6 K;  1IBK K;  2UUA K;  4CVN E;  4YHH K;  4X66 K;  4LF8 K;  4LFA K;  4X62 K;  1I94 K;  4DR2 K;  4B3R K;  4LF9 K;  4DR5 K;  4JI6 K;  4AQY K;  3T1H K;  4DR7 K;  1IBM K;  4GKK K;  1IBL K;  4DR6 K;  5LMU K; 
#chains in the Genus database with same CATH topology
 1EWR A;  3NF8 A;  4N76 A;  2PYJ A;  3CFR A;  4IEI A;  4F8R A;  3LPU A;  4LF4 K;  3LL3 A;  4DTS A;  5I9E B;  1Z26 A;  4N41 A;  1FK9 A;  4AHT A;  2NRH A;  3F9K A;  1IKV A;  4DQQ A;  3K9K A;  1VQ5 N;  3C6T A;  4FW1 A;  1FJG K;  1W9H A;  3IG1 A;  2B5J A;  1U45 A;  3TR8 A;  3VER A;  3ZEU A;  4UY8 O;  2D0O A;  3OS0 A;  2DFH A;  5GAD P;  2O8E B;  5JS1 A;  1MWK A;  1KVA A;  4XH1 A;  4CE9 A;  4CF1 A;  4WYB A;  2AJQ A;  4CJE A;  2FBX A;  4GVE A;  3JSM A;  4ICL A;  1ZBL A;  3MCA B;  4JI3 K;  3D2F B;  2A40 A;  4HWI A;  2HW3 A;  1X1P A;  1JLQ A;  2WC9 A;  3QEW A;  3QFP A;  5MLC Q;  4M3Z A;  3QIC A;  3EE8 A;  3LP0 A;  3TAG A;  3MWT A;  1NGF A;  3QET A;  1RFQ A;  4L8R B;  1Y64 A;  2HHS A;  5KI6 A;  3S3N A;  1XHX A;  1GOC A;  1WN7 A;  2Q3S A;  5HRS A;  1N6Q A;  4Y0W A;  5KQD A;  3MK6 A;  5F0X A;  3A5M C;  5C25 A;  3I33 A;  3HYF A;  4A5B A;  3VF6 A;  1TUU A;  3VA0 A;  3AA3 A;  4Y1D A;  1E3M A;  4YOX A;  3V9U A;  4AF1 A;  3SK3 A;  5CYM A;  1XNQ K;  3P5J A;  5BN8 A;  3CXC M;  3VQE A;  1Q8I A;  2ZGZ A;  3OVN A;  2UUB K;  3VEX A;  5GAH P;  3H45 C;  4LF7 K;  2GEL A;  1G15 A;  4TSX A;  4YOY A;  4CFB A;  5GIP A;  3U6F A;  1RTD A;  4DU1 A;  4B9M A;  5EOY A;  2D0A A;  4O8U A;  3HOS A;  3DRP A;  2O8F A;  1YJN N;  5C24 A;  4JAX A;  1NNE A;  2HMP A;  4DR5 K;  4HUF A;  4DR7 K;  2ZJP L;  3QML A;  4CBX A;  3DOL A;  1KVB A;  4IDK A;  3QER A;  3D0P A;  3D6R A;  3SQ0 A;  4B9Q A;  3VMF B;  4CBW A;  1HNZ K;  1WB9 A;  3EEQ A;  3CJ1 A;  4B1U B;  1SZ2 A;  2ZWH A;  1GLC G;  1U04 A;  1T03 A;  1HUX A;  4M3W A;  1YTA A;  2YHW A;  4I6M A;  1NGG A;  1QQN A;  4CZJ A;  2UXD K;  2QWM A;  3T69 A;  2YKN A;  5AQU A;  4B3M K;  4BDP A;  1J5E K;  1U6Z A;  1BI4 B;  4MO4 A;  4RG8 A;  1B9D A;  4KB1 A;  3TAB A;  4BR4 A;  3OYN A;  3M5R A;  1QVF M;  1WSJ A;  3NF7 A;  4FK2 A;  4C8K A;  1DEJ A;  1Q82 O;  3DLH A;  1JLB A;  4BWM A;  5TKY A;  3A5L C;  1RT7 A;  1T44 A;  3FFK B;  1ITG A;  3HBT A;  4DR4 K;  3LP3 A;  1RDA A;  1B9F A;  1CLQ A;  4FWN A;  4EZ9 A;  1Z05 A;  3DAW A;  4B3O A;  2QW9 A;  5EU7 A;  4JEP A;  5DM6 L;  4M63 C;  4JI5 K;  4LFC K;  3TSU A;  2VYP A;  4IXC A;  3NCI A;  1RT1 A;  3H3O B;  1JCG A;  4CZK A;  4BRD A;  4M42 A;  4BR9 A;  4J2A A;  4CZG A;  2VQE K;  3AAP A;  4CJR A;  2QWR A;  3CQX A;  2GX9 A;  1NGD A;  3CJB A;  3HP9 A;  4KKO A;  3NDK A;  4QAG A;  4B9N A;  4LFA K;  4PWD A;  3E9L A;  3SJH A;  4JS5 A;  3OS1 A;  3NGY A;  3WXJ A;  3ULE B;  4CJ7 A;  1GLB G;  4M7X A;  4C8O A;  2YNI A;  3PLA A;  4JK9 A;  1ZBH A;  3SUP A;  1TVR A;  1D9D A;  5J2N A;  1IG8 A;  4H0P A;  1JKH A;  3KKS A;  4DTP A;  2VG6 A;  4BRL A;  4FJX A;  2HBL A;  3NGZ A;  3TAN A;  4FPB A;  3TAE A;  1X3M A;  4WF9 L;  4K41 A;  3J7Y P;  1LWE A;  3QBW A;  2Z1J A;  3O1W A;  4YOU A;  1HPM A;  3THW B;  2YKM A;  4Z4F A;  4EZ6 A;  3K5N A;  5AZJ B;  4C8L A;  1VK0 A;  5DK5 A;  1ZBS A;  4WQ4 C;  4GMJ B;  1BDG A;  1I3A A;  2WON A;  3BGR A;  2ETJ A;  4CF2 A;  3K9J A;  3VQ9 A;  2LSN A;  1W7A A;  2I7P A;  4B9T A;  1U2V A;  2BAN A;  5M1F A;  3ZX0 A;  1R0A A;  4FOE A;  3WT0 A;  4RW9 A;  1SKW A;  4JK7 A;  4OKK A;  3FZM A;  4OJR A;  3TSP A;  4DV3 K;  3VQ8 A;  2O8C A;  1UWB A;  4DCH A;  1OH5 A;  3L3V A;  2RE2 A;  3MX2 A;  3UIQ A;  1O13 A;  2QWN A;  5ADX H;  3AO4 A;  4CEZ A;  4LH4 A;  3C7N B;  3RMC A;  2EX3 A;  4C1N K;  4Z4H A;  4JKG B;  1HNX K;  4F3O A;  3TTD A;  2X78 A;  3AA2 A;  3SQ4 A;  2YNF A;  4F2S A;  4IOC L;  4FZY A;  2W40 A;  3V9W A;  1Q9X A;  3CCU N;  4CHO A;  1QS4 A;  4DSJ A;  1B92 A;  2FBY A;  3FLC O;  5F1X A;  3LDN A;  2GUI A;  4A61 A;  1X9S A;  2E1Z A;  4K8X A;  4ID5 A;  4BRI A;  1FKO A;  1JL2 A;  3EY1 A;  4BQZ A;  3N4Q A;  1C0U A;  4JKA A;  3B6P A;  3ITH A;  3AVC A;  4YDU A;  3ZT1 A;  5AQL A;  3I0S A;  4EHT A;  3RWU A;  3L4Q A;  3SAG A;  5AQS A;  3QEX A;  4ISE A;  2BTF A;  1VQ8 N;  4F4K A;  1OVY A;  1VQM N;  5H1S Q;  1T6C A;  2ZJR L;  5J2P A;  3FGU A;  1YVN A;  4CVN E;  4B1Z A;  3LM2 A;  5JIC A;  3V6D A;  4NYF A;  3O3H A;  5F2R A;  3ZSW A;  1ESV A;  4FK0 A;  1CXU A;  4JLH A;  4JKD A;  4JI6 K;  2QTD A;  4WFA L;  1SL0 A;  2E6M A;  1NGE A;  3O9R A;  1JCE A;  1DKG D;  1HNW K;  1UAX A;  4DUZ K;  4FLT A;  3AVM A;  3SMS A;  4IJN A;  4L3Q A;  1KVC A;  3OYA A;  4B3S K;  4WFN L;  3ALY A;  4DR1 K;  2FBV A;  4BR2 A;  4CZM A;  1X9W A;  4R79 A;  3AVG A;  4IG3 A;  1HKG A;  4DV2 K;  3C0B A;  3UKR B;  3RSE B;  3H6E A;  3SPY A;  3SI6 A;  3U9D A;  1KRP A;  4BVP A;  5SZT A;  5SWM A;  2F8T A;  4H0Y B;  1M90 O;  3U4L A;  2HMI A;  4X64 K;  3JYT A;  4FPA A;  2E2P A;  3RRG A;  3LWL A;  1MDU B;  5BPN A;  1NKE A;  3P1G A;  1BUP A;  4CJ3 A;  4IOA L;  1IV0 A;  4HTL A;  3C6U A;  3O9S A;  4FLU A;  3EE9 A;  1NM1 A;  1R59 O;  3KVG A;  3KWG A;  5AJ3 K;  5IWA K;  2Q1N A;  3ENH A;  4F2R A;  3QEI A;  3MCP A;  4MDA A;  3OYG A;  1NU0 A;  1NJW A;  3DLG A;  4LSL A;  3OTO K;  1KC8 O;  3OYB A;  2DFE A;  3HM9 A;  1WBD A;  3VGM A;  4PL7 A;  4K42 A;  4FYD A;  5C0Y A;  5AQY A;  2E4L A;  3LAL A;  4JI8 K;  1XMQ K;  3CJA A;  2B6A A;  5AZI A;  2D5R A;  2ZGY A;  2V52 B;  3KLI A;  3KK1 A;  4CIE A;  3SBT A;  4M3X A;  3RMB A;  3KK7 A;  1ZXO A;  4JRQ A;  2NRT A;  3P83 D;  2HVI A;  1J5O A;  4I9Q A;  4DV1 K;  1S72 N;  4BRG A;  2NRR A;  1NGC A;  4M45 A;  4Z0U A;  4JD2 A;  2YCH A;  4BDY A;  3VEO A;  4H03 B;  4DR2 K;  1KCF A;  1YUW A;  5GAG P;  4BDZ A;  1VRU A;  1JLG A;  2PAV A;  3WXK A;  3P31 A;  2VWB A;  5B8H A;  1JLA A;  4HUG A;  1NMD A;  2NUB A;  3C95 A;  3ISN C;  4JI1 K;  3NE6 A;  3O1B A;  2W6L A;  4DSL A;  2F96 A;  3AO5 A;  5M1K A;  4CGF A;  1HQE A;  3TAR A;  3NBP A;  1HYV A;  2QXL A;  1F21 A;  3HPO A;  3L2Q A;  4G9Z A;  3CFO A;  1DTT A;  3K5M A;  1HR0 K;  5AQQ A;  4H0X B;  1A5V A;  1KTQ A;  4WQ5 A;  3K59 A;  5CYQ A;  4XH4 A;  3WEE A;  4E3S A;  3BY5 A;  3OYM A;  5AQM A;  3VQ5 A;  3AVB A;  1T3V A;  2QWP A;  1FKP A;  3OYE A;  4A2B A;  3ZET A;  3DXK B;  3UE5 A;  4DTU A;  5ELZ A;  2DTU A;  4O5B A;  2BGG A;  1NK6 A;  1T8E A;  1K73 O;  4FJK A;  4CHP A;  2A1R A;  3HL8 A;  4M7Y A;  2XRI A;  5JS2 A;  1KQS M;  4PKI A;  3DXM A;  2E5L K;  1WSI A;  4BGA A;  4KO0 A;  1RTH A;  1ILY A;  4ZTF A;  2HNZ A;  2P9K A;  4J2B A;  3QNO A;  2Q0R A;  5HP1 A;  2YHA A;  4ELU A;  5FPD A;  4O55 A;  4CF0 A;  4LF6 K;  3OJS A;  1GOB A;  4ILG B;  5GIO A;  3ENO A;  4FLV A;  2HHW A;  4MO5 A;  3ZEU B;  3DMJ A;  3O3G A;  4EP4 A;  2FSN A;  4DTN A;  4CHQ A;  3K57 A;  4CJU A;  3MEG A;  4DV0 K;  4HHT A;  1XC3 A;  3MX5 A;  2I5J A;  3THX A;  1VRT A;  4O0I A;  3G6E N;  3NGI A;  3MXJ A;  1D4X A;  5HRR A;  3RRH A;  3CG7 A;  2YNH A;  4E1J A;  3HRG A;  4OGE A;  1LWC A;  3JS6 A;  1SAZ A;  1IKW A;  2DFF A;  2P1J A;  1Q81 O;  4DLG A;  4W5O A;  4LFB K;  1VSF A;  2GUP A;  5M1P A;  1QTM A;  2IAJ A;  2W6K A;  3VTI A;  1ZYQ A;  3VTH A;  1A5W A;  3CC7 N;  4CJK A;  2OZM A;  1VSM A;  3MXI A;  4BRK A;  3A8Y A;  1BGX T;  2JWL A;  2VWK A;  1EKE A;  3O3F A;  4FWQ A;  4LC9 B;  3K5O A;  4KI6 A;  2XHB A;  1M1K O;  3DRS A;  4NXN K;  1RDD A;  3CQY A;  1SL1 A;  1IO2 A;  2RKI A;  5M1N A;  4KHS A;  3CIP A;  5KPZ A;  3J81 O;  1ATN A;  3ATV A;  3V9Z A;  3BDP A;  4KI4 A;  4CGI A;  3ZSO A;  3O4N A;  1C1A A;  1HJR A;  4M3R A;  2HBJ A;  4PUO A;  3QIO A;  3SAF A;  3T1Y K;  2O8F B;  1Q9Y A;  4BG9 A;  2ZE2 A;  1NKC A;  5AQW A;  4CJ4 A;  4CD3 A;  4OPK A;  3IUC A;  4KTZ A;  4JI7 K;  3O4W A;  3UKU A;  1HRH A;  1ATR A;  2YHX A;  4FJI A;  4FOI A;  3MN5 A;  5C15 A;  2CGK A;  4H5W A;  2E2N A;  1SL2 A;  4ILJ A;  1N34 K;  4YDU C;  3Q7B A;  3PY8 A;  3QB0 A;  3LWM A;  1K8K A;  1TL3 A;  3WXI A;  4JV5 K;  1YIT N;  4BC5 A;  1C6V A;  4J8F A;  1W2B M;  3DWL A;  2Y1J A;  4CJF A;  1HJO A;  1S1W A;  3A5O C;  1TK8 A;  1U47 A;  4I6M B;  2OTL N;  2VQF K;  4FWK A;  1IBK K;  3EZ5 A;  1S6P A;  3O9T A;  3GE1 A;  4YHH K;  3D2E A;  3ZSQ A;  2FC0 A;  2VG7 A;  3LDL A;  4CEB A;  4FZX C;  3I8B A;  3VQ4 A;  4YOR A;  2HST A;  3CFP A;  3S3O A;  3FZH A;  1K9M O;  3KJV A;  1C1B A;  1KFS A;  4LY7 A;  1XUP O;  3TAQ A;  4NB4 A;  3THY A;  3DI6 A;  1BG3 A;  4RW7 A;  5KTQ A;  4KHN A;  3LZJ A;  4PHT X;  3J8A A;  3PO5 A;  3LDO A;  4FJ8 A;  1SV5 A;  3IMX A;  1DGK N;  4DTJ A;  4CI6 A;  4CZL A;  3SPZ A;  1HYS A;  4B9V A;  3CI5 A;  3WXM B;  4XEI A;  2V51 B;  4AHU A;  3R8E A;  2HOE A;  1FW6 A;  3AA4 A;  3HO1 A;  2XY6 A;  1EP4 A;  2NRV A;  4H5V A;  1ATS A;  3J7A P;  5BRF A;  2WUS A;  1UA1 A;  4U67 L;  3A0I X;  3O08 A;  1LCU A;  3SJJ A;  4I7F A;  5BRH A;  3OYH A;  2X74 A;  3HOT A;  4GW6 A;  2ZD1 A;  3LAK A;  3I56 N;  1XMO K;  2P5O A;  2RHK A;  4CFD A;  3CCE N;  5GIN A;  1WUA A;  1RT2 A;  3D2F A;  5CZ2 A;  4FJM A;  1NWK A;  4CJT A;  1HNV A;  3RMD A;  3FFI A;  3SMP A;  3WNG A;  5FRM A;  4KBO A;  2HHQ A;  3RMA A;  4BGB A;  5BRE A;  1JLE A;  2QK9 A;  4UQG A;  2OPP A;  4M3T A;  1A5X A;  3R3L A;  2FBT A;  3KLH A;  2HVH A;  5I42 A;  4DU4 A;  3T1A A;  5D3G A;  4CER A;  3V1O A;  3MAQ A;  1EET A;  1GOA A;  3F5T A;  1K8A O;  1BWF O;  1NJY A;  4FJL A;  4J2E A;  3OJU A;  2I7N A;  3VET A;  3KK2 A;  3VGL A;  4K8Z A;  1P8Z A;  3V4I A;  1VQL N;  2P9N B;  2WOM A;  1U2V B;  2ITM A;  4E89 A;  4AIL C;  1V4T A;  1C0F A;  4BRO A;  1WLJ A;  2O8C B;  3LDS A;  1YTU A;  4IDH A;  5AQK A;  1NKB A;  4NCA A;  5C42 A;  1OKJ A;  2GWK A;  5HOO A;  2DPN A;  3AVI A;  4WQ5 C;  2Z1H A;  5LMN K;  3QEV A;  3AVJ A;  4DV4 K;  3SUO A;  5DMR A;  1HX1 A;  4HUE A;  4H0O A;  1NGH A;  3OBY A;  4BWJ A;  5CY4 A;  4CZE A;  1S6Q A;  2GWJ A;  3G4S N;  5FPM A;  2Q36 A;  3ZYY X;  3PIP L;  3IAY A;  5FLX O;  4N5S A;  1QHT A;  1S3X A;  1NK8 A;  3EKU A;  3CCV N;  5KPT A;  3L3U A;  3G10 A;  2FF3 B;  4MFB A;  2A5X A;  4PKG A;  1K6Y A;  3CYM A;  4H5R A;  1RT5 A;  1HKB A;  4H0T B;  1LWF A;  4JRP A;  3E9P A;  3V9X A;  2HHV A;  1JCF A;  4DTO A;  3ATU A;  1HLU A;  4BR7 A;  4CK3 A;  3R9P A;  3M8Q A;  3PV8 A;  3VN5 A;  3CCR N;  5C12 A;  1WSE A;  2VCP A;  3AAQ A;  1XI1 A;  2YV0 X;  5GAE P;  2VG5 A;  2GTD A;  3LP2 A;  2P9P A;  3AGK A;  2HB5 A;  1KD1 O;  4A59 A;  1RTJ A;  4DF8 A;  4CK1 A;  3MEC A;  1LOT B;  3RR7 A;  1VQK N;  1NJI O;  4B3R K;  3U3Y A;  2KZZ A;  1BIS A;  3EZW A;  5JVG L;  1IBL K;  1JJ2 M;  3O8M A;  4BC2 A;  4JNE A;  3NHG A;  4KHW A;  4KRF A;  1O1W A;  2OCE A;  1S1V A;  4OKJ A;  3WQU A;  2G8H A;  1JXE A;  3DLL L;  4CEQ A;  2P9U A;  3CCJ N;  4DSI A;  2KW4 A;  3ZSZ A;  4M3Y A;  4JKB A;  3DLR A;  3KK3 A;  2O8D A;  2EWS A;  2FXU A;  1VSJ A;  1XNR K;  4CEA A;  2HBK A;  2ZF5 O;  2E88 A;  5M1O A;  1VSL A;  5HRN A;  3S3M A;  4NLC A;  1BIZ A;  2A41 A;  3NF9 A;  3AAR A;  1U48 A;  5AZI B;  1L5U A;  3SCX A;  2YJF A;  5JLF A;  3I0R A;  4KHQ A;  2KFN A;  1X9M A;  4QS8 A;  4AH9 A;  1EWQ A;  2QKB A;  3HP6 A;  4MLE A;  4I9L A;  3EYZ A;  3DOK A;  1DLO A;  3R6M A;  2A1S A;  4H5T A;  2IDO A;  5AZJ A;  3KD5 E;  1UOC A;  1SUQ A;  1Z6R A;  3H3N O;  4DR3 K;  4JD2 B;  1RDB A;  2YJE A;  4DQI A;  3E1Y A;  1IKY A;  4DS4 A;  4KHY A;  1SS6 A;  4O4G A;  2QM1 A;  5AQN A;  2O4G A;  4KRE A;  3TSQ A;  3L0Q A;  3HPG A;  4DB3 A;  4HCB A;  4CGG A;  4QCL A;  1TL1 A;  1RGI A;  4FVU A;  3TPQ A;  4IJA A;  2O8B A;  1EQY A;  5M1Q A;  1RBV A;  2P9S A;  1H1V A;  3H1V X;  3G25 A;  1BA0 A;  1NGB A;  1L3U A;  1RDC A;  3WEE B;  3TAF A;  3F9M A;  1KAZ A;  2VWJ A;  4CF9 A;  3HZ6 A;  1VSD A;  3PSI A;  4FWL A;  1TYQ A;  4LF8 K;  2QWO A;  3SV3 A;  4FWP A;  3LM9 A;  1JLF A;  3VOV A;  3M1F A;  1G99 A;  3ZET B;  3PUF A;  3QIP A;  3F73 A;  4E7L A;  5EY4 A;  3LPT A;  4NO7 A;  1DTQ A;  4CD1 A;  4CHN A;  1RBS A;  4MDB A;  4E0D A;  4FSV A;  3CPE A;  4CIG A;  5AQO A;  4CW7 B;  4FJH A;  1CXQ A;  4DSF A;  2QI2 A;  2HHU A;  4JYA K;  3OS2 A;  1S1U A;  1QSL A;  4DS5 A;  1TK0 A;  3DXM B;  2CGL A;  1BU6 O;  1J9A A;  3QES A;  1L3T A;  4DQS A;  3BF3 A;  2IIR A;  4HCC A;  3LP1 A;  4C1N I;  4AHV A;  4MQ3 A;  1UA0 A;  3C6H A;  2NZT A;  4FJG A;  2D0B A;  2Q31 A;  3ENB A;  1N5Y A;  2Z1G A;  3OHR A;  3VEN A;  4CJW A;  1RTI A;  2KKZ A;  1WSF A;  4CZF A;  2NRZ A;  3PX6 A;  2YHY A;  2ASM A;  2H3G X;  3VEV A;  1N8R O;  3QFU A;  3OYK A;  3OW2 M;  3THX B;  3PX4 A;  1NGA A;  3ZX3 A;  4Q0B A;  1NGJ A;  3NMU A;  3DLK A;  3NVK A;  1KLN A;  4W5Q A;  2Y1I A;  1QZ6 A;  4KH5 A;  3HVR A;  3V81 A;  3VQB A;  3KD1 E;  2QEX N;  3WNH A;  4E19 A;  4FWR A;  2XY7 A;  1TKZ A;  1VQ4 N;  3ZLJ A;  3DYA A;  2E8A A;  2PBD A;  1OH7 A;  4KHU A;  4O0J A;  3MWP A;  5J2Q A;  1QHA A;  1VQ6 N;  5KGX A;  4CEO A;  2YI1 A;  1VSK A;  3CM6 A;  3IKM A;  4K43 A;  3H1Q A;  1TK5 A;  5J2M A;  1QVG M;  4KPY A;  4WCE L;  3G0Z A;  5A2Q O;  4DSK A;  3CCQ N;  4A62 A;  3WQT A;  3EKS A;  2HHT A;  3SNN A;  5AQX A;  2IVN A;  4EAH D;  3T7Z A;  1X3N A;  3H08 A;  3AV9 A;  4KAZ A;  1RBT A;  4RW4 A;  4BRP A;  2G8V A;  4JHD A;  2QXF A;  4G1Q A;  2Q2R A;  3T1H K;  2Q0U A;  4DFP A;  2G8F A;  5LMU K;  1NJZ A;  4FLW A;  4KH6 A;  3ZT0 A;  2IOC A;  4JKF A;  1TKX A;  3ZSV A;  3ID8 A;  4JK8 A;  3G71 N;  3UKU B;  4PA1 A;  5CE3 A;  1C0M A;  3KKR A;  1BL3 A;  1RIL A;  3HT3 A;  4FLZ A;  4IO9 L;  2P51 A;  4QS7 A;  1LW0 A;  5KRS A;  3M8R A;  1C0T A;  2XY5 A;  1YI2 N;  5BPL A;  2HF3 A;  3T19 A;  3CME N;  5KGW A;  5AQJ A;  1GLJ O;  3WXL A;  1K8K B;  4CJL A;  3LDQ A;  1IH7 A;  1NOZ A;  3BP8 A;  3LAN A;  2OPR A;  3SLC A;  1WOQ A;  1W97 L;  2P9I A;  4OX9 K;  3QBX A;  4FLY A;  3FZF A;  4YY3 K;  1WBB A;  4O8K A;  4CF8 A;  4GY2 B;  3TTC A;  2BE2 A;  3GL1 A;  1BQN A;  4BC3 A;  4DTX A;  3PSF A;  3VPZ A;  1U49 A;  5LL6 Z;  3D2E B;  3SQ1 A;  5E84 A;  1TKD A;  4H0V B;  1BHL A;  1NK5 A;  3LZI A;  3AVF A;  3DLE A;  1SKR A;  4RW8 A;  4X65 K;  4B08 A;  2E6L A;  4NYN A;  4FVM A;  2B4J A;  4DV6 K;  3HPH A;  3THY B;  3P38 A;  4FO0 A;  1LAW A;  1X9J A;  3WNE A;  3KWI A;  3EL2 A;  4E7H A;  4LH5 A;  4FJ9 A;  2KTQ A;  4BG8 A;  3SAH A;  1CZB A;  3QIN A;  1RBR A;  2ASP A;  4ELT A;  2CH5 A;  1N33 K;  3Q7C A;  4JI2 K;  3MMV A;  4DQP A;  5C10 A;  3O4Q A;  4FWS A;  4XH5 A;  5BN9 A;  2KZM A;  3MN9 A;  4AM7 A;  1YT3 A;  4CJS A;  5KQ8 A;  3CMA N;  4X66 K;  1T05 A;  2UYT A;  3QDK A;  2WTU A;  3L2R A;  4LF9 K;  3N4P A;  3VEW A;  3CM5 A;  1BQM A;  4KH4 A;  3OY9 A;  4GKK K;  1EX4 A;  3HM8 A;  3BF1 A;  1QQC A;  4DG1 A;  4DMN A;  4JS4 A;  4GV6 A;  3K5L A;  3AO3 A;  3HVT A;  4CEF A;  1ASV A;  4KFB A;  2D1K A;  4B1V A;  2FSK A;  4CZI A;  4K0K K;  3KTQ A;  3O9U A;  1TGO A;  4BRF A;  2P9L A;  2X6S A;  1XHZ A;  2UU9 K;  3TI0 A;  2QWL A;  4DQ8 A;  2KQ2 A;  4KTW A;  5JVH L;  3CER A;  3VQ6 A;  1RT4 A;  1S5J A;  1RCH A;  1XWL A;  1YAG A;  4OPA A;  4W5R A;  4DFM A;  4B9L A;  3VEZ A;  5AR0 A;  1KAX A;  3BEX A;  1Q18 A;  3TU5 A;  1E4G T;  1GLA G;  3OYJ A;  3AVA A;  4LF5 K;  4CEC A;  5AQI A;  3VGK A;  4EIA A;  1Y97 A;  1YVU A;  2BH1 A;  4OVL A;  3VES A;  1BO5 O;  5FDL A;  1S1X A;  3VEY A;  1IKX A;  1MA9 B;  2G8U A;  4V19 S;  4FWM A;  2F9W A;  3BZK A;  4Z4I A;  3CF5 L;  2XO7 A;  2D0C A;  3SYZ A;  4AHS A;  1YHQ N;  1J54 A;  4JKH A;  3NAE A;  4CGD A;  4ILH A;  2V7Y A;  3RR8 A;  4K25 A;  4KHP K;  2A42 A;  3BZC A;  4E7K A;  1VQ7 N;  2NRW A;  2O8E A;  4DSE A;  2HND A;  1OH8 A;  4DUY K;  1T7P A;  4CCH A;  5HBM A;  1VSE A;  5C2D A;  3CET A;  3P4I A;  4ZHR A;  2PZS A;  3J7Z O;  2BDP A;  3QEP A;  2YNG A;  1KAY A;  1VQO N;  3TWH A;  4W5T A;  1JXB A;  2J4R A;  4YNQ A;  1CZA N;  1RDU A;  2FLO A;  3TAP A;  5CHI A;  3ZSR A;  4Z4E A;  4AM6 A;  4QOZ B;  1HMV A;  3K0S A;  4OPJ A;  1IBM K;  4JKE A;  4IFE A;  4DR6 K;  2ATQ A;  4LD0 A;  4CFC A;  1E4F T;  1SQK A;  1ZBI A;  2OPS A;  5TKW A;  1IG9 A;  2EHG A;  4H4O A;  5HL7 L;  3SUQ A;  2VGM A;  4GVM A;  4C23 A;  4C8N A;  1RBU A;  5FPN A;  5HRP A;  4NXM K;  3VQP A;  3GBT A;  3FZK A;  3I8D A;  3AGR A;  5JLH A;  3NH1 A;  5AFU A;  1QZ5 A;  1BOT O;  3LDP A;  4EP5 A;  2AA4 A;  1Q7Y O;  3C94 A;  4DU3 A;  4B1W B;  3HSC A;  4DV7 K;  4EFH A;  4IBN A;  1W0H A;  1VQN N;  4OKE A;  3AVL A;  1MWM A;  1NK0 A;  1NK7 A;  5BR8 K;  4GKJ K;  2P9P B;  4BRE A;  1TKT A;  4CJQ A;  3O6W A;  3ZT4 A;  1VHX A;  1YXQ A;  4MLH A;  4CJ5 A;  4KV8 A;  4BC4 A;  1LAV A;  3VQC A;  3NH2 A;  2F9T A;  4IFY A;  4IKF A;  2HHX A;  4BRQ A;  4JN4 A;  4DFJ A;  3GDQ A;  4YOW A;  3SUN A;  3HJF A;  4DWI A;  4BAC A;  2P9U B;  5E41 A;  2A6A A;  1REV A;  1LW2 A;  2OAN A;  3P39 A;  3VQ7 A;  4BRH A;  4CIF A;  4O5F A;  2O8D B;  3J80 O;  3GOI A;  3M6G A;  5AQP A;  1S9G A;  1JLC A;  3NH0 A;  1V4S A;  4BRA A;  3ZCM A;  2ZJQ L;  4Z94 A;  1GLF O;  4DKW A;  3C6A A;  1BI4 A;  4IO8 A;  3A2F A;  1BA1 A;  3AA5 X;  3M3Z A;  2OPQ A;  1TUY A;  4B8C A;  5AQT A;  2G8K A;  4A57 A;  4X62 K;  3O5B A;  4E1N A;  4JKC A;  4ISF A;  5AQG A;  3CC2 N;  1D5A A;  5C2F A;  1QE1 A;  4FJN A;  2IGI A;  2RF2 A;  1KSP A;  4DQR A;  2E2O A;  2P9N A;  4CZH A;  4OGC A;  1WAJ A;  4C8M A;  4N47 A;  3HI0 A;  1YIJ N;  3CJ7 A;  2HBM A;  2JGU A;  3R1X A;  3B6O A;  4BQL A;  2QKK A;  1L3S A;  2JWK A;  2ITG A;  3KHY A;  1GLL O;  4GV9 A;  2KLA A;  4ZTJ A;  4A5A A;  3SZ2 A;  2V7Z A;  1ZC6 A;  5FRO A;  4CHY A;  3HXM A;  3QO9 A;  4BR5 A;  1KLM A;  4B9S A;  3M8S A;  1IJJ A;  1I39 A;  2O8B B;  4H4M A;  3CHW A;  3ID6 A;  4CHZ A;  4ISG A;  4E7J A;  5EX5 A;  2Z1I A;  4O44 A;  2GEM A;  3VQQ A;  4FJJ A;  2NRX A;  2P9S B;  3OYD A;  5AQV A;  2G8W A;  1TAQ A;  2CGJ A;  3S9H A;  3ULE A;  5AQR A;  2FSJ A;  2OA8 A;  3ZT2 A;  4M3U A;  3NF6 A;  3HTV A;  4QS9 A;  4CBU A;  5DM7 L;  4CES A;  4NLB A;  3WUH A;  1VQP N;  1N32 K;  1TYQ B;  2UXC K;  1J6Z A;  2OZS A;  4BR0 A;  3OYI A;  3CCM N;  4PKH A;  2ZQB A;  2NLX A;  5EVZ A;  3AVK A;  2HNY A;  2GV9 A;  3V1R A;  3RTV A;  1D8Y A;  4F3T A;  3OYF A;  4CJP A;  4YOT A;  1YF5 L;  4NCB A;  4FL9 A;  1EXQ A;  4IWV A;  4RCH A;  4BE2 A;  1NOY A;  3THW A;  4NCG A;  2OYQ A;  3MXM A;  4E1M A;  4LSN A;  2XY8 A;  1T6D A;  2FF6 A;  4IZ9 A;  1HNI A;  3D7E O;  4FWO A;  3NFA A;  3LAM A;  3VF4 A;  4PY5 A;  4HVJ A;  4WFB L;  3D45 A;  2F7T A;  5AQH A;  3V1Q A;  4W5N A;  2YHB A;  5K14 A;  3NVM A;  4CED A;  4OPH A;  4JI4 K;  1YJW N;  2IS3 A;  4B3T K;  3O9Q A;  2ZM6 K;  2IVO A;  3KLE A;  3IRX A;  4A2A A;  3C7N A;  3DLB A;  3IFR A;  3DJC A;  1I94 K;  4JKG A;  1HKC A;  3AY9 A;  4M41 A;  4RWT A;  2VGN A;  4AQY K;  5HRO A;  2PYL A;  1XQS C;  4IFV A;  3CD6 N;  4FW2 A;  4IOX A;  3KLG A;  2W41 A;  4BVO A;  3CCS N;  4FJ7 A;  4IG0 A;  1QQO A;  1BIU A;  2P5G A;  2UXB K;  1P90 A;  1OH6 A;  1NBW A;  4YOV A;  4CGJ A;  4U7B A;  2W42 A;  3A5N C;  1DT9 A;  3CJ9 A;  1MU2 A;  4CEE A;  1WNS A;  2O4I A;  1WSG A;  4PL8 A;  2ASO A;  4Z4G A;  3HST B;  4ELV A;  1Z25 A;  3ASM A;  2JLE A;  2PFU A;  1ASU A;  2DY4 A;  1RT6 A;  1HPZ A;  1RT3 A;  2OTJ N;  4FCY A;  2QA4 N;  1ASW A;  1N36 K;  1OVQ A;  1S1T A;  4CGH A;  4Y1C A;  3JAM O;  1C1C A;  3OA9 A;  3L4I A;  3U3G A;  3ZT3 A;  2BUP A;  4BRM A;  4JI0 K;  5J1E A;  3C65 A;  4I2P A;  3H46 O;  3CCL N;  3L2V A;  3VA3 A;  3SBG A;  1JL1 A;  2RN2 A;  3PO4 A;  4FXD A;  5AQF A;  4B1Y B;  3E01 A;  2IVP A;  5T7B A;  3QNN A;  4BRN A;  3L8B A;  2P9K B;  4FM2 A;  4DF4 A;  3I55 N;  2E2Q A;  3CJC A;  3EN9 A;  3KLF A;  4KTQ A;  4CJV A;  1HYZ A;  4RTF D;  3AVH A;  2F8S A;  4Z4C A;  3FR0 A;  4JHD B;  1BCM A;  1HQU A;  2QWQ A;  2X6N A;  3K2P A;  4OLB A;  1RNH A;  3AO1 A;  4J2D A;  4H5N A;  3ZSX A;  4H8K A;  3JXU A;  4B1X B;  3IDH A;  1GLD G;  5FPE A;  1CZ9 A;  4BRC A;  4BE1 A;  2NNW A;  1TAU A;  1GLE G;  1NG9 A;  5JMV A;  3UKR A;  3RSE A;  4DTM A;  3THV A;  3T3F A;  4BY9 C;  2D4W A;  2WFB A;  3FZL A;  4BE0 A;  4B9U A;  2WBN A;  1D9F A;  4RW6 A;  1U4B A;  3KZB A;  4CFA A;  3B8A X;  1KFD A;  3SV4 A;  3FE1 A;  3OYL A;  5CR4 A;  5AQZ A;  5IT9 O;  3DRR A;  4ID1 A;  4OO1 J;  2E1Y A;  2UUA K;  1S9E A;  3BUZ B;  3U8X A;  5ADX A;  2P9I B;  2RPI A;  5LJW A;  3CQ8 A;  3S41 A;  3OBW A;  5BR9 A;  3MEE A;  2HF4 A;  3L2W A;  4EHU A;  5E26 A;  4FM0 A;  3U9Z A;  3MED A;  2AP1 A;  1QSY A;  3W3D A;  4GNI A;  2CH6 A;  3KIO A;  1EO1 A;  1KXP A;  3F2K A;  3RVC A;  1XC9 A;  5CZ1 A;  3GG4 A;  1S22 A;  4GV3 A;  2KFZ A;  2GBZ A;  3O80 A;  4FLX A;  4FZZ A;  3M8P A;  3PX0 A;  3DM2 A;  1QQM A;  5LY3 A;  4IEE A;  3OYC A;  2HHH K;  3L2U A;  2R7Y A;  4DHY A;  5KRT A;  2IC3 A;  1NK9 A;  1RDW X;  3ULD A;  4XIU A;  3V9S A;  3K58 A;  1VQ9 N;  3CPW M;  4FK4 A;  1NGI A;  3L6Q A;  4YFU A;  3IS9 A;  2YX6 A;  5KPR A;  3TAM A;  2F4V K;  4KB0 A;  5EXW A;  4FM1 A;  4WQ4 A;  4DTR A;  3HK2 A;  3ZX2 A;  3MN7 A;  3E9O A;  1VSH A;  1QSS A;  3QLH A;  1FXX A;  1Q86 O;  3WNF A;  1TV6 A;  5BPM A;  3AVN A;  2PY5 A;  1VSI A;  1LV5 A;  1WAF A;  3VQD A;  2Q97 A;  5FRN A;  2E20 A;  4DFK A;  2KHO A;  1NJX A;  3SQ2 A;  3AO2 A;  3VQA A;  1C0G A;  3ZSY A;  2UUC K;  4FJ5 A;  5LJV A;  1J53 A;  3CC4 N;  5HLF A;  3PIO L;  3MDQ A;  1VAZ A;  1YJ9 N;  2P9L B;  4HTU A;  1BCO A;  3E66 A;  3VF2 A;  3MN6 A;  3W0L A;  4DV5 K;  1NMN A;  5AFU H;  4CK2 A;  4Q5V A;  4I2Q A;  4DLE A;  3DXK A;  3UB5 A;  1NLV A;  4AHC A;  4E7I A;  4OLA A;  4F9O A;  4B8A B;  2D0P A;  1WSH A;  4R5P A;  5BRD A;  1SKS A;  4WE1 A;  1ZBF A;  4PQU A;  1NK4 A;  1L3V A;  2A3Z A;  3EO3 A;  1ZBU A;  4N56 A;  2G8I A;  5I3U A;  3TTF A;  4AHR A; 
#chains in the Genus database with same CATH homology
 1HNW K;  4DUZ K;  2UXB K;  4JI1 K;  4LFB K;  4LF4 K;  4CW7 B;  4B3S K;  4JYA K;  4K0K K;  5LMN K;  1HNZ K;  4DR1 K;  1FJG K;  4NXM K;  3J7Y P;  4DV4 K;  2UU9 K;  1XNR K;  4DV2 K;  1HR0 K;  2HHH K;  1N36 K;  3JAM O;  4NXN K;  4DV7 K;  4JI0 K;  4X64 K;  5FLX O;  4OX9 K;  2UXD K;  3J7A P;  2F4V K;  4JI3 K;  4B3M K;  3J81 O;  4YY3 K;  5BR8 K;  4GKJ K;  4DV3 K;  4LF5 K;  1J5E K;  4DR3 K;  5AJ3 K;  5IWA K;  5LL6 Z;  1N32 K;  2UXC K;  3T1Y K;  1XMO K;  1HNX K;  4V19 S;  4X65 K;  4JI7 K;  3OTO K;  2E5L K;  4DV6 K;  2UUC K;  4DR4 K;  1N34 K;  4KHP K;  4JI8 K;  4DUY K;  4LF6 K;  1XMQ K;  4JI5 K;  4JV5 K;  1XNQ K;  3J80 O;  4LFC K;  1N33 K;  2UUB K;  4DV5 K;  4JI2 K;  5A2Q O;  4LF7 K;  4JI4 K;  4B3T K;  5IT9 O;  4DV0 K;  4DV1 K;  2VQF K;  2VQE K;  2ZM6 K;  1IBK K;  2UUA K;  4CVN E;  4YHH K;  4X66 K;  4LF8 K;  4LFA K;  4X62 K;  1I94 K;  4DR2 K;  4B3R K;  4LF9 K;  4DR5 K;  4JI6 K;  4AQY K;  3T1H K;  4DR7 K;  1IBM K;  4GKK K;  1IBL K;  4DR6 K;  5LMU K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...