3LAMA

Crystal structure of hiv-1 reverse transcriptase in complex with n1-propyl pyrimidinedione non-nucleoside inhibitor
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N1-Alkyl pyrimidinediones as non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords HIV Reverse transcriptase
total genus 149
structure length 553
sequence length 553
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lamA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lamA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lamA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lamA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lamA05
2A1SA 3CFOA 4RNOA 4CE9A 2E4LA 3GV5B 3ZSWA 1FKOA 3SQ2A 1ZTWA 1QUVA 3C6UA 2CJQA 3TVKA 4NLYA 3DLHA 4DG1A 2DFEA 1QSLA 4J9OA 4O3SA 4DTSA 4DSLA 1QQCA 1TP7A 4CFBA 4DL7A 4W5OA 3HVTB 1YT3A 1T03A 3H98A 2D5RA 1S1VA 3G6YA 2D0CA 2IM2A 3ZT4A 5KRSA 3OS0A 3KK2B 4GW6A 3NBPB 4CGIA 4IH5A 1LAWA 4FJ7A 3HO1A 4B9UA 3V4IA 5HRPA 1SKRA 4DU4A 3SPYA 4URSA 3NF9A 1WNEA 4F3TA 2DTUA 4Q8FA 1JLBB 1TKXA 3H4BA 4QWBA 4HUFA 1KHWA 3QETA 2OYQA 1D8YA 1S97A 3LP1B 4C8NA 4LSNA 2W42A 4IFYB 3DOKB 3BQ0A 2PZSA 3PX4A 4ZPAA 3E01B 4RW4A 3KLFB 2E9ZA 4NLWA 2W9CA 3RB4A 1SH3A 1S1UB 3C6UB 4BWMA 3SUQA 4DLEA 3KHHA 3DLGB 4E1NA 1QE1A 4C8MA 4Z4EA 2YNGB 4M95A 2D3UA 4CJ5A 4R8UA 4DFMA 2QKBA 3NL0A 4KE5A 1QAIA 3OL7A 4CF9A 3H59A 1NKBA 4KTWA 1JLFA 1JLEB 3QIOA 3LP0A 3AVBA 2WRMA 3ZSXA 1QE1B 2IAJB 5C5JA 1ASVA 1RCHA 3ISND 1NKCA 2IGIA 3AVJA 4R5PA 1R0AA 2I5JA 3MEEB 4CF2A 5KI6A 1K1QA 5E41A 2HNZB 3AO3A 2X6NA 2V4QA 2ETJA 1C1CA 4KFBA 3TANA 4HYKA 5HRRA 2J6TA 4CJPA 3TAGA 2XHBA 3CO9A 1ZETA 4K4UA 4IRKA 4E3SA 4F2RA 2P51A 1TKTB 4FJ8A 3SQ1A 1RTIA 1SV5B 3G10A 3CVKA 5J2MB 3TABA 4FJKA 3CJ3A 5KFIA 4OGEA 2RN2A 4KHQA 3DYAB 3L8BA 3PVXA 1RA6A 3UIQA 4FK2A 3QERA 1N6QA 4O0IA 4M45A 1Y97A 1L3TA 4CJFA 2W9BB 1N56A 2WONA 1HMVB 3ITHA 1GOAA 4FJ5A 1BQMB 1U47A 4PWDA 1RTJA 4FLZA 4HHTA 4CFAA 3OL9A 3O4QA 1IM4A 4EZ9A 1C0UB 1GX6A 3OYEA 4MK9A 2GBZA 1BQMA 1JLGB 1Q8IA 4DG1B 4ZTJA 4FLXA 4CECA 3MTKA 1QS4A 3EZUA 5J2PB 1S6QA 4IFVB 2HNYB 3PW5A 3IGNA 1A5VA 3AVMA 4DTOA 2UUTA 4C8OA 2ZKUA 2ATLA 5L9XA 5HLFB 4IRCA 4CHYA 2UUWA 1NOYA 4KI4A 4KAZA 4FYDA 3OVNA 1RT6A 3SUPA 1XR5A 1FKPA 1JLCB 2VG5B 3NH1A 4RW7B 5KG3A 1W25A 3RR7A 2WOMB 3DRRA 3LALA 4RW8A 3DRSB 1S1WA 3AA3A 2OA8A 1S49A 3ZSZA 4B9TA 3IS9B 4ZVEA 4ECZA 2B6AB 1BHLA 4KAIA 4G1QA 1TVRA 4O3NA 4I2PA 4IH7A 3CM6A 1C1BA 1S0NA 3NHGA 4J9QA 5DQIA 3SFGA 1RTHB 2XCAA 5CZ1A 1C0TB 3KLIA 1XC9A 3AA2A 4LD0A 4CIEA 1RT2B 2G8IA 3UDLA 2RKIB 3VN5A 1S1TB 3M8PB 3PX0A 4PUOA 3L2UA 2FBYA 1C2PA 2OZSA 4CK1A 2HHXA 3K5MA 3NH2A 4IG3B 4IFVA 1WAJA 4I7FB 2JC1A 5KFHA 1XI1A 2BANB 3NDKA 5FRNA 5C24B 3GYNA 3A2FA 3OYAA 3B6PA 4NCAA 3NF8A 2W9CB 4E7LA 4EYIB 3CJ2A 4CEDA 2FVRA 5KG2A 2ASLA 2QKKA 4DTJA 4CERA 3ASMA 4K8XA 1HNIA 4J9MA 5KG7A 4O44B 1SH2A 3MXJA 4OJRA 3LP3A 2WONB 4MK7A 3ALYA 2JC0A 5SWMA 3HPOA 1HYSA 3KLVA 1SUQB 1RAJA 3G86A 2FBVA 1NK5A 3MECB 2LSNA 2JLEA 4BWJA 2HHSA 3OYIA 4O44A 3K5OA 1DTQB 2HMIB 3QGGA 2KW4A 1Q9XA 5J2QB 3RBEA 2VA3A 4OPKA 2R8JA 1S1VB 3AVIA 4IKAA 1JXLA 4CHZA 4R5PB 1R0AB 4N41A 2FBTA 3ZT2A 5DGAA 3MFHA 4KTZA 5EUHA 4TSXA 3NKYA 4ECRA 1K6YA 1TK0A 2QXFA 3V81B 2B5JA 1LWCB 4E7JA 2KZZA 3GIJA 1N48A 4RW7A 4O55A 1T05B 4H4MB 3MEGB 3V1OA 4YFUA 3WNEA 1TAQA 4QWDA 3DLRA 4Q0BB 2FVQA 2BR0A 1SL0A 4U7CA 3NGDA 2IJFA 4FXDA 4ZPDA 1NHVA 3DLBA 3AVKA 3VQAA 4HTUA 1GX5A 5KFFA 2W8LA 3L3VA 2OPSA 4ID5A 3L2QA 3KNAA 5HBMB 1CLQA 2GIRA 2ILZA 1SL2A 3K58A 5KG0A 2R2RA 4DTXA 4ZP7A 4XPEA 2WOMA 1RBTA 1IKYB 1S0OA 5D3GA 1OS5A 1KTQA 2IM0A 5KGWA 3LPUA 4F4KA 4IR1A 4CEAA 4EO6A 4QW8A 4FJNA 3ZSVA 3PUFA 3SPZA 3T5JA 1L3VA 5KFCA 3HM9A 3QLHB 2C28A 2HNDA 4NYZA 1ZTTA 4M3ZA 4B08A 4FJLA 3PO4A 4CK3A 5J2MA 3OSPA 1X9WA 3DOLA 4GMJB 5J2PA 3D0PA 1HYSB 3T5HA 5F9LA 3KK2A 3VQ6A 1KHVA 2VA2A 1RT7B 4B9LA 1KVAA 1IH7A 4X2BA 3MEDA 4DL5A 1LWFB 4Q45A 1HPZA 3SNNA 3VA0A 2GV9A 3KHGA 1VSDA 3SV4A 2FLPA 3DMJB 4YR3A 3OYBA 3BGRB 4O5BA 4NRTA 3O3FA 1IKVA 2R2UA 3SCXA 1ITGA 3JYTB 3I5BA 1NK6A 4PUOB 1MMLA 2AGOA 3NGZA 3FDSA 3NGYA 3EPGA 2IC3B 5FDLA 4OKEA 3BSCA 2XC9A 5DG8A 5HROB 1RTDB 2KTQA 4YP3A 3G6XA 2B43A 1DLOA 3QEWA 3QGIA 1BQNA 2ZQBA 4J2DA 5JS2A 4FM1A 4E7IA 1TAUA 2EC0A 4DSIA 2BQ3A 3V9WA 4NLUA 1IKWA 1S9FA 3N6NA 3NFAA 4CEBA 3OYGA 1TL3A 2KFNA 3L2RA 3KJVA 3EYZA 5KT4A 4HVJA 1HPZB 4B9NA 5T14A 3V6KA 1HYVA 1BISA 4DQSA 4MK8A 3OY9A 5KFZA 2XY5A 1HYZA 3RWUA 4CJVA 3Q8PB 4DWIA 4TXSA 2G8HA 2V0NA 2E9RX 5KFLA 4DEZA 4FK4A 4FW2A 3CJ4A 1JL2A 4CJUA 5KFYA 1U49A 3BQ1A 4CFCA 2O4GA 3KK3B 3BGRA 4M42A 3SJJA 1REVB 2ALZA 3ISNC 4KHWA 2KZMA 3JYTA 4ED6A 3NAHA 3I5CA 3KIOA 4WYLA 3VQQA 3AO5A 3GQCA 3HVTA 1HRHA 3E51A 3Q8SB 4ECVA 3VQCA 3SUOA 4GVMA 2W8KA 1JIHA 1TL1A 1F21A 3S3OA 3OHAA 3O3GA 5F8LA 3KOAA 4RNHA 1CSJA 3LZJA 3LP2A 3U3GA 4XPCA 2YNHB 1IKXB 3AVLA 1QSSA 3PO5A 1UWBB 1WNSA 4FLYA 4B8AB 1XR6A 3G0ZA 1TKZA 4LQ9A 4DFKA 3GIKA 3VQPA 3SFUA 1N6QB 1L3SA 1TKTA 2XGPA 3OJUA 1KRPA 1LWEB 2JEJA 2AGQA 1X9SA 4ECTA 4RUAA 3C94A 4J9NA 4J2EA 4CIGA 1JLAB 4O3OA 4J9LA 1WSFA 4JRQA 5CZ2A 3PW0A 4AHCA 3FRZA 4WZQA 4JV0A 1VSFA 3IG1A 3ZT1A 4ZMMA 1BGXT 4XIUA 2HHUA 2AWZA 2DPJA 2OPRB 3T3FA 3DRSA 4NLGA 1KCFA 4CJRA 1RDDA 1ZBIA 5CYQB 2BQUA 4AHUA 3IG1B 3AO4A 3SQ4A 5HROA 2ITGA 4EZ6A 4I9QA 2FJXA 1A5WA 4OVLA 4KO0B 5J2QA 3PY8A 2D41A 3D45A 3EZ5A 3N6LA 2YNIB 1Q9YA 4EBEA 1TK5A 1JLFB 4OLAA 3TI0A 4Q0BA 1ZBHA 2YNGA 1J53A 4DU3A 1IKVB 1U04A 2C2EA 4AHTA 2XY6A 4HCBA 4URGA 4BDZA 3IAYA 4FJJA 2AQ4A 4CJ3A 4E7HA 3VQSA 3M9MB 4Z4IA 4ECQA 1S9EA 3MF5A 4Y34A 2HAIA 4TYAA 4WE1B 1XHXA 2HHVA 3TARA 1N5YA 3VQ8A 2FJWA 2C22A 4RW4B 1I39A 4Z4FA 1NOZA 1RT7A 2KFZA 4HUEA 1RT4B 1B92A 3QYYA 3DOKA 3QNOA 3MFIA 4KI6A 1HQEB 3LP1A 1TKZB 3HKWA 3SQ0A 4DSJA 1GOBA 4NZ0A 3SYZA 3KMQA 1EETA 3QLHA 4M3WA 1RTIB 1SV5A 2F96A 3CWJA 3T19A 2JGUA 3TR8A 3TAPA 2ZD1B 3ZT3A 3HT3A 4ED8A 4I9LA 4BDYA 5KFTA 1ASUA 5KTQA 3T1AA 2G8UA 4R0EA 2HB5A 2QE5A 5DQHA 5EWFA 2IOCA 4MKAA 2JEFA 4Z4HA 1UAXA 2XO7A 4Q8EA 4O4GA 4ECWA 4YMEA 2I5JB 1KLNA 1C1CB 2IJNA 4IRDA 2HWHA 4K4XA 5FROA 2BANA 1UA1A 2D0BA 2FVPA 1Z4UA 3LZIA 4G3IA 4OLBA 4ID5B 3QEVA 4LY7A 5J1EA 3UQSA 3PX6A 4FJMA 2G8VA 2IAJA 3FQKA 1Z25A 4M3UA 1NK9A 3BR9A 4Y1CA 4FVMA 4AHSA 4ED0A 3HL8A 1NK0A 3TQ1A 4H4OB 2OPPA 4FLWA 4FS2A 2Q3SA 4W5NA 1WN7A 4FZZA 5JXSA 2HHTA 4K4SA 3D28A 3T5KA 5J1EB 4TY9A 4EYHB 4DSEA 1HQUB 1S9GA 4WXWA 1G15A 2KQ2A 4K4YA 1VSHA 2R8HA 3DM2B 4I2QB 1C0MA 2BDPA 4DL4A 1LW0A 2YKNB 3AVCA 2B6AA 4LSNB 3O3HA 4URQU 4F8RA 5CY4A 4O3QA 3AA4A 4KSEB 4KTQA 4N47A 5F9NA 4TY8B 3AVHA 3N6MA 2AX0A 4Y2AA 4IH6A 4AILC 4KV8B 5DQGA 4CEFA 4KHMA 4PWDB 2R8KA 4Q44A 1S0MA 1FKPB 2YHBA 3H5UA 4O0JA 1SL1A 1HMVA 4LSLB 2VWKA 2D3ZA 1NNDA 3HJFA 2YNHA 3Q8RB 1KFDA 2OPQB 2UVUA 3ULDA 3MR6A 3C6TB 3M8QB 3RB6A 4M3YA 4KV8A 1C0UA 4DQPA 3C95A 1S6PB 5C25A 2UVVA 5HP1B 1IO2A 1D9FA 2PYJA 4J2AA 4Y2CA 1T8EA 2G8FA 4UQGA 2YNFA 1S6PA 2Z1JA 2FLLA 1FKOB 4E7KA 3QO9B 4IDKA 1LAVA 4CFDA 1NKEA 4QOZB 5HBMA 4ZVHA 4QW9A 2X74A 5L1LA 3I0SB 3PR4A 4KHUA 4MKBA 3SZ2A 4J9SA 5KG6A 4EP5A 1KLMA 3BSAA 3H5SA 4RW6A 2R2SA 4K8ZA 3EPIA 2UVWA 2BE2A 4CJ4A 2FLNA 3MR5A 4FM2A 3IGVA 1BI4B 1RT5A 3SUNA 4KBIA 3KD5E 1RTHA 4KFBB 2YKMB 2FBXA 4E1MA 4QCLA 4YQWA 3OYFA 3DM2A 4I2QA 2AU0A 3KD1E 3K5NA 1TK8A 4M3TA 2IM3A 1EXQA 4B9VA 4IBNA 5DMRA 5J2NB 3RMCA 1N4LA 4JS5A 1U09A 3LAKA 2AGPA 4AH9A 1LW2B 4CHNA 3AV9A 5K14A 1LWEA 2EHGA 1FK9B 3G6VA 1BI4A 1DLOB 4CJSA 4DQRA 1BL3A 3K59A 4EEYA 1IG9A 2XI3A 1VK0A 4RW9A 1SUQA 3V6DB 3NGIA 4DMNA 1T05A 4E19A 4W5TA 3T5LA 2W7PA 1RT6B 1NJXA 1RA7A 1IKXA 1J5OA 4ZP8A 1W0HA 2YHAA 5KFGA 4C8KA 3D5MA 1BCOA 3VQ5A 1HNIB 4O3RA 2F8TA 2HNYA 3QO9A 2WCXA 1MU2B 5CYMA 1JKHA 1RDBA 3JSMB 5KT2A 4F4WA 3GV8B 2BQRA 1T03B 2FVSA 3OYMA 1DTQA 2HMIA 4Y1DA 2GC8A 5KFSA 4DF4A 1NHUA 5DG7A 2WK4A 2A1RA 4KB0A 3KHRA 1VSMA 4DF8A 4MH8A 2F8SA 1S4FA 3OHBA 1TV6B 3TAEA 4TQSA 3DOLB 2O5DA 4ECXA 3RAQA 2HVHA 1HNVA 1FK9A 1D9DA 3P1GA 1C0TA 3KLHA 4NYFA 3OS1A 4DTMA 3HVWA 3KKRA 3VQ9A 4CEQA 4IQXA 3AVGA 1L5UA 2X78A 3QNNA 3I5AA 3CQ8A 2VG6A 3LPTA 4RUCA 1EP4A 1BIUA 3DRPB 3DI6A 3PR5B 3KLEB 4FM0A 5KFRA 4BE1A 1S5JA 3HXMA 4L8RB 3QEPA 1CXUA 3OYLA 3VA3A 2AJQA 4EBCA 1HARA 4BACA 2CKWA 4FLTA 2G8KA 1YTUA 3H5XA 5EU7A 4F4YA 2G8WA 2VG5A 2HVIA 1W9HA 2DFFA 4ZPCA 4FLUA 4KO0A 2V4RA 3HP6A 4EP4A 4FBTA 3TWHA 3ZSRA 3B6OA 3PW4A 5KFJA 5KFXA 5EWEA 2J6UA 3KLGB 3GIMA 5CYQA 3GIIA 3ICLA 4J9KA 2ASJA 2OH2A 3OL6A 1S1XA 2W7OA 4RZRA 4CF0A 4FZXC 5I3UA 3DLGA 3IS9A 4DL3A 2XY8A 3E01A 2QK9A 2IBKA 1SKWA 4ELVA 1YVFA 4PQUB 4PY5A 3HPGA 5C25B 4F4ZA 2FVCA 2JEIA 3V9UA 4ED1A 5F8NA 4N5SA 4LH5A 4OPJA 3F73A 3QESA 2PY5A 4NLTA 2OZMA 1XWLA 1JLAA 2OPQA 4NLSA 4H54A 3FSIA 2VWJA 3MAQA 2D7SA 3RB3A 2B4JA 2XWYA 3ITHB 3SI6A 1I3AA 1ZBLA 2WB4A 5F8IA 3HHKA 1U48A 2DY4A 1HQEA 1NK7A 3TAFA 4B9SA 3M8SA 3IRXB 3K2PA 5KG5A 3PZPA 1XR7A 4Q43A 3PJXA 3CJ5A 1C6VA 3KK1A 2RF2B 3ZSOA 5KFOA 3KHLA 2YKNA 1KSPA 1WSEA 3VQ4A 4JRPA 2GUIA 5JS1A 4XO0A 4DL2A 3HPHA 2E6MA 1VSKA 3V6HA 3AO2A 3HVAA 3NF6A 4TN2A 3JSMA 1RBSA 3H40A 1IKWB 1S9EB 2V9WA 3O4NA 4FJXA 4KKOA 1BCMA 5F8MA 5KG1A 3BSOA 4LH4A 1J5OB 3CM5A 4Z4CA 2Y1IA 3CJ0A 1XHZA 3QEXA 1RTDA 4JV2A 4TY8A 2J6SA 1NJWA 1KFSA 4ZPBA 5K14B 1LV5A 3WNGA 2R8GA 2X6SA 1TL3B 4TLRA 4ELUA 3K57A 1J9AA 4M41A 5SZTA 2O4IA 1C1BB 1SKSA 2HNZA 1RDAA 4W5RA 4W5QA 3LAMA 4G1QB 5KFWA 1YVUA 5EWGA 3DLEA 4FLVA 1C1AA 3LWLA 3BSNA 4TYBA 5KFNA 1J54A 3LWMA 4EBDA 1BIZA 3PV8A 3QINA 4FZYA 2VG6B 4OKKA 2RPIA 1TKDA 4RU9A 1JLEA 5KT6A 3QZ8A 3OYDA 1T7PA 2YKMA 1JLQB 2RDJA 1KLMB 3KLHB 4WXOA 2XCPA 4KRFA 4Z0UA 1HNVB 2IM1A 4RNNA 1YTAA 1JLCA 4DTUA 4WYWA 3H4DA 4K4ZA 1D0EA 1GOCA 2XY7A 2P5OA 3LP2B 3HVRA 1UWBA 4KREA 3RMDA 3TAMB 3MR3A 4HKQA 2VG7B 3RMBA 1RT4A 3I0RA 2VG7A 4WFXA 4FJHA 4YR0A 5KFMA 3V9XA 2ZE2B 3VQEA 3V6JA 5I3UB 5KT3A 4DLGA 5D3GB 2Y1JA 5L1JA 1RYRA 2GIQA 3IRXA 3MR2A 2F8EX 3TAMA 3P5JA 3U6FA 4KHRA 4K50A 3GV7B 4CHOA 4CIFA 4OGCA 4JUZA 2HHWA 3MXMA 2PYLA 5KFEA 2RKIA 1X9MA 5FRMA 3KLGA 3DYAA 3RBDA 2OPPB 3H2LA 5KFBA 1WSIA 3KJVB 3DDKA 3AO1A 1JLQA 1ZBUA 4ED7A 5KFDA 4PQUA 1QHTA 1KVCA 4MIBA 1EX4A 3DLEB 1I6JA 3H5YA 1S1XB 3HK2A 1UOCA 2XGQA 2NUBA 2Z1HA 1BQNB 4QAGA 3S3MA 1EP4B 5HRSA 1RNHA 3MXIA 4CESA 4CHQA 3TAQA 4N56A 4HCCA 4NLVA 1RBUA 3L2VA 3QIDA 1FXXA 4H4MA 1TV6A 4K4WA 2FC0A 3OLBA 3CFRA 3U3YA 4J2BA 2ZD1A 1U4BA 4F3OA 3CDWA 3ZCMA 3V81A 4ECUA 3CG7A 4DFPA 1WAFA 3LANA 3QIPA 3RAXA 5T7BA 5I42B 4BDPA 1U45A 3DRPA 4DSFA 1DTTA 4NRUA 5KFAA 3OJSA 1VSLA 3LDSA 1LWCA 1JLGA 4O4GB 4RG8A 4M3RA 4CEZA 4KPYA 4CJLA 4DTRA 3I0RB 3RRGA 5KFKA 4CEEA 4DU1A 4QWCA 4DFJA 2RF2A 4CGJA 1LWFA 4BE2A 4MQ3A 4M94A 1QTMA 4YNQA 5KFVA 4OKJA 2RDIA 2EX3A 1EETB 3M8QA 3CDUA 1B9FA 5C42A 1VSEA 4KHSA 4DS5A 3UPFA 5C42B 5L1KA 3EY1A 1ZYQA 2ILYA 2UVRA 3WNHA 2W9AA 4RNMA 3OS2A 3VQDA 4E89A 4F2SA 4IG0B 3V6DA 1RT3A 4K4VA 4N76A 4MFBA 3RMAA 3BQ2A 2I1RA 1A5XA 1JL1A 3BDPA 4DS4A 1T94A 4O4RA 3CFPA 1TQLA 4J9PA 5DLFA 3NAIA 3PW7A 3CYMA 4MIAA 4WE1A 2QV6A 4PA1A 3CIZA 3KMSA 1QSYA 4LQ3A 3QIPB 2OPRA 1WSGA 3AA5X 3UR0A 4FJGA 1WSHA 1TVRB 3MEEA 1DTTB 5L1IA 1S9GB 4CJEA 4HUGA 4FS1A 4Z4GA 4Y3CA 1O1WA 4CGDA 4DQIA 4DQQA 3OYCA 4IR9A 4IOBA 3DRRB 4RW8B 1T3NA 4QWEA 2C2RA 4CK2A 4CCHA 4ECYA 4ZVFA 2IDOA 2HWIA 1VRTB 1RT5B 5KT5A 4ZVGA 3QGHA 3KKSA 5KFPA 4CHPA 1NJYA 3OYKA 1RT2A 5JUMA 4B3OA 3MEGA 5J2NA 4NYNA 3ZT0A 3RRHA 3KLIB 4I2PB 3M9NB 4KHNA 1ASWA 1VRUA 4E0DA 3KLFA 4NLXA 4ZHRA 3RTVA 1L3UA 4ELTA 3P83D 4FJ9A 3H08A 1VSJA 3HYFA 4NCGB 2ZE2A 1RT3B 3L2WA 3KK1B 3AVAA 2FJVA 4DTPA 3WNFA 3HSTB 1WLJA 2HW3A 4IFYA 1JLBA 1TKXB 4ZTFA 1RTJB 2IS3A 3V1RA 4LSLA 4KB7A 3C6TA 3QZ7A 2HHQA 2BRLA 4TQRA 3M8RA 4NLRA 4CJWA 4U6PA 3RR8A 5KRTA 4B8CA 3S9HA 4WZMA 4AHVA 1D1UA 3NCIA 1WSJA 3V1QA 3ZSQA 1D5AA 1UA0A 2Z1IA 5DGBA 5F8JA 2D0AA 4J9RA 3AVFA 1ZBFA 5F8HA 3V9ZA 4NLDA 3ZSYA 1CZ9A 3OYJA 3NH0A 1REVA 3FQLA 4YR2A 2WTFA 2E6LA 3OYNA 4GC7A 1HQUA 4CEOA 1S10A 5EDWA 3QEIA 3F9KA 2OPSB 4KB1A 1VRTA 2AX1A 4B3OB 3HP9A 3K5LA 1KVBA 3BREA 3L3UA 4BE0A 4CF1A 2R7YA 2BGGA 1HJRA 4K4TA 2YNIA 2ASDA 2XI2A 3OL8A 3KLEA 1RT1A 1S48A 2JEGA 1LW2A 1VRUB 2BRKA 2Z1GA 1RYSA 4JLHA 1VSIA 2B5JB 4NLOA 1EKEA 3FFIA 3SI8A 4CGFA 4F4XA 1RBVA 2IA6A 3I8DA 4NLQA 1SH0A 4CJKA 1S1UA 4ICLB 4MFBB 3CDEA 1NJZA 3NF7A 1JXEA 4ED2A 2YV0X 1JX4A 4JS4A 4CGGA 3KTQA 1Z26A 1RILA 3I0SA 5KGXA 1K1SA 5HLFA 4R8UB 4H8KA 4CJTA 2IC3A 5FDLB 4RW6B 3MECA 3NE6A 4GC6A 1S6QB 4FCYA 3NMAA 4NLPA 4KHYA 2YNFB 4ZP6A 3IN5A 4F50A 2XRIA 4ID1A 4Q5VA 2DPIA 3AVNA 2P1JA 4IDKB 4CJQA 3Q8QB 1CZBA 4EO8A 4QPXA 2ATQA 3DLKB 3DMJA 4ED3A 2DFHA 3DLKA 1MU2A 5CYMB 2WHOA 3S3NA 4RNFA 4IG0A 4CGHA 1TL1B 3MEDB 3BJYA 5HP1A 1RBRA 1X1PA 2IMWP 4FW1A 5C24A 1JKHB 1B9DA 5KG4A 3GILA 4IKFA 3PJWA 4IG3A 4WFYA 4ZP9A 3OSNA 4AHRA 5HRNA 3V9SA 4DTNA 4OL8A 3V4IB 2HNDB 2R2TA 3THVA 2R8IA 1RDRA 3PHEA 5KFUA 2W9BA 4RW9B 3KK3A 1S1TA 3M8PA 4O3PA 3NBPA 4ECSA 4CF8A 2C2DA 1N5YB 2E9TA 4DL6A 4WFZA 1RDCA 1NK4A 5KT7A 4QWAA 3NAEA 3FFIB 4ZHRB 4NCBA 3PW2A 4NCGA 4ICLA 1QAJA 4FK0A 1IKYA 1LW0B 5I42A 4M3XA 4FBUA 4I7FA 1NK8A 4FJIA 5DK5A 3DI6B 5DG9A 1JXBA 1TGOA 5F8GA 3VQBA 3SV3A 4B9MA 1CXQA 2P5GA 1RT1B 3RB0A 1S1WB 4C8LA 2BE2B 3VQ7A 3OYHA 4DSKA 3LP0B 3M9OB 4JV1A 4H4OA 3OLAA 5DLGA 5KFQA 4KKOB
chains in the Genus database with same CATH superfamily
3CFOA 4C48A 5E3QA 1FDAA 3JAMY 3ZSWA 5CA5A 2E5LJ 5B0AA 1QUVA 2CJQA 2IRUA 2DFEA 1QSLA 3T6BA 3JAMU 2B8QA 4ER8A 1FT8A 1QQCA 1TP7A 3TTFA 2GS8A 4W5OA 1W7AA 4DV5F 2D0CA 4B3RK 2CNOB 3CC2N 5BJRA 4CGIA 4OZ5A 4IOCQ 3BUZB 1RUSA 3HO1A 4B9UA 2KG1A 5HRPA 2QA4S 5GADI 3VGMA 1C4CA 5B0CA 1GAOA 3FNNA 5M1PA 4ZLNA 4JI5J 2DTUA 3ZZZA 4Q8FA 4ISGA 2OYQA 1S97A 3DRYA 2MDAA 4IFYB 2LXUA 4G1PA 4X4UA 3PIOL 2UV8G 2FF3B 1YJ9N 3IXQA 3UCZP 2W9CA 1HLWA 3G4SS 1S1UB 1ZPWX 2F9WA 3L7PA 4I6AA 3KHHA 1OH6A 1HBNA 3MR7A 3MD3A 2NR0A 4Z4EA 2YNGB 3D2FB 4EHUA 3KVGA 4DFMA 5B0FA 3J8AA 4CF9A 1Q7YO 4BRLA 2P2CB 4S0MA 2D4WA 2F9TA 1X8DA 2FHOB 5D4OA 2Q1NA 3CCLS 5DZ6A 5C5JA 2NUHA 1RCHA 4HDGA 4QJVA 3GMGA 4QBUA 1XIQA 1S6OA 1I94F 2HNZB 2BKOA 2X6NA 4CIOA 2OUGA 5LMNF 3R27A 2ETJA 1AB8A 1GH8A 4NEZA 1M5VC 3TPQA 4FVCA 4DXLA 3TANA 1XQIA 5M2PA 4H0PA 4Y6IA 1NSAA 3CO9A 1ZETA 4K4UA 4E3SA 4FJ8A 1PSDA 4ILRA 3G10A 2FXUA 4G9ZA 3CJ3A 1U1NA 5KFIA 4OGEA 3MMAA 4KHQA 3DYAB 2HMPA 4O0IA 4M45A 2LDIA 1FKAF 4DV7K 4FKXA 1NPPA 1N56A 4BQZA 4HT7A 4A8QA 2APOA 4ILHA 2F5GA 1U24A 2MY8A 2HBMA 1FHTA 3G6ES 4JEPA 2RQKA 2ZKTA 2JFKA 4HHTA 3G25A 4A46A 4WFBQ 2GBZA 1NGAA 4OMFG 3SLCA 1QS4A 2H4WB 5J2PB 4PPZA 2HNYB 5JLFA 3IGNA 2GWJA 3D6MB 1TL7B 4FYDA 2UUCF 4JI8F 4TVAB 1RT6A 3SUPA 1XR5A 1NSKL 2VHGA 3CC7S 5GAEI 4I56A 3VGKA 3RR7A 3C14B 4RW8A 2JVOA 3R5AA 4FWQA 2G13A 3AA3A 2OA8A 3MM8B 3IS9B 4ECZA 1M1KT 4OV6A 4O3NA 3RBXA 3LDOA 4IH7A 1P9YA 1C1BA 3CM6A 2BJ3A 1RTHB 3BY5A 4HT5A 3LL3A 5CZ1A 1C0TB 1XC9A 1RI7A 4LD0A 1DT9A 3QRQA 1ESVA 1YJRA 1ATNA 3R3TA 3UDLA 2KYXA 2RKIB 3VN5A 4DBQA 3QFPA 2FBYA 2VBXA 1C2PA 5GAHU 1NMDA 2HHXA 4CK1A 2H4YB 4OI4A 1FNOA 1P8ZA 5KFHA 1K0TA 2PA8D 4U8YA 3GYNA 4NCAA 4BG9A 4FN5A 4CLKA 1OY9A 3E1YA 2ZH3A 2FVRA 1RISA 2UXBJ 2QKKA 2LP4A 2NYHA 2YWKA 1SQFA 2DXDA 3HHNB 4LF6F 4DTJA 3BR8A 1S22A 3ASMA 1HNIA 2R7QA 4J9MA 3FGUA 5KG7A 3HM8A 4O44B 3LP3A 2WONB 2CPIA 5IZHA 5HO4A 4U7UK 3ALYA 1C0FA 4PKGA 3MM7B 4I1TA 3EVMA 5SWMA 1HYSA 4ZOSA 4IFEA 3DXBA 5E2QA 1RKJA 2JLEA 2HHSA 3E3XA 1HKGA 2DXEA 4O44A 3D1QA 3VAHA 3K5OA 2KW4A 3QBWA 2VA3A 1E3MA 4DPXA 5AQZA 4P2MA 4AF1A 3D4JA 4IKAA 1JXLA 4W90B 1RDUA 4CHZA 1P1LA 2P6TA 3A4TA 4KGXB 2C2OB 3NKYA 2B5JA 1LWCB 3THYA 2ZUAA 2OI2A 2CQBA 4C4WA 4O55A 3GDQA 3WNEA 4HR2A 2CWXA 4Q0BB 2FVQA 3M32B 3FBCA 3IAM9 1SL0A 5FLXY 3AGKA 2QTWA 2K1RB 3CJAA 4M7XA 2W8LA 4ID5A 2ZWOA 3BN7A 4OO1J 1CLQA 2ILZA 1SL2A 2YH0A 1KC8T 2ZM6K 4DTXA 4A5AA 4DL0C 1ATRA 2M52A 2Y1LB 3GFZA 1IKYB 5LJ3Y 3UDEA 3I82A 1KTQA 1VIXA 2KKHA 1QQMA 5KGWA 1X4HA 4CEAA 3BP8A 3NGKA 4QW8A 4R79A 3PUFA 2XMAA 2O8FB 5LXRA 5MLCV 4NYZA 1ZTTA 1UPMB 4M3ZA 2QL5B 1X9WA 4BRQA 1HYSB 1X31C 3AJ2A 3QT8A 1FVSA 3KK2A 3VQ6A 5B8HA 4P73A 2VA2A 3UKUB 2EG1A 5ETOA 4ATNA 5D6GA 3MEDA 2EK1A 3G8SA 5CQGA 4JI2K 4JV5K 2V7YA 3VA0A 1HHTP 3LPYA 4KYZA 3CCTA 2DNMA 2Q31A 2GHWA 4DCHA 3SCXA 3WXIA 3Q24A 2ZM6J 1N33J 2XNQA 4GKJF 3BB5A 1NK6A 4F0KA 2DTJA 2BKNA 4PUOB 1MMLA 3MCPA 3L4QA 1FD8A 1NM2A 2DBBA 2AGOA 5FDLA 3TJ8A 2P9NA 2ZJPL 2XC9A 4ZVPB 2HFVA 1WG4A 3FZBA 2YX1A 4YP3A 4D3GA 1WJ9A 2CJBA 4YB6A 5IT0A 1IWAA 2QMXA 5JS2A 4FM1A 2HHHF 2X1AA 4DSIA 2BQ3A 3CF5L 4ZCIA 1S9FA 3M6GA 3NFAA 3K5PA 2XS7A 3JTOA 1R6VA 2RE1A 1YTYA 1KAXA 1HPZB 4B9NA 4HVJA 5T14A 3EGNA 2DCUB 3O44A 2DT9A 2H54B 3BEGB 5K5MA 1S12A 1S6UA 4AFFA 2BJ9A 1RWOB 3BGFA 2G8HA 5KFLA 4FK4A 4M5LA 5J1PA 3BQ1A 3KK3B 3CF5Q 2QWMA 3ISNC 2HFSA 1X5TA 3OV7A 3W3SA 4BQLA 3W64A 3VALA 2EBGA 3VQQA 2HFZA 5AQJA 4CZLA 2AYEA 3HI0A 5ETKA 1HR0K 3Q8SB 2ZH7A 3LDLA 2OTJN 1JIHA 4QU6A 1F21A 3OHAA 2CIMA 4LF4F 3LDQA 3KOAA 2ZH8A 1CSJA 3AH6A 4CJ7A 1FJCA 3I56S 2CJ9A 2O8CA 4KR0B 3AB2B 1NPRA 1IKXB 4JK9A 4CBUA 3AVLA 4BR4A 2XBPA 4H5WA 2ASOA 1QSSA 4BRIA 4CYUA 3VQPA 2P6SA 5IWAF 2KH9A 2XMKA 2XGPA 4LRDA 4FZVA 1IBLJ 4RUAA 4J2EA 4O3OA 1KP6A 2Y8WA 2D0OA 4OZJA 4H0XB 4JRQA 5CZ2A 3U7JA 1S76D 4DPTA 2LU2A 4WZQA 2B9YA 2YWHA 3IG1A 5IQ6A 2P9UB 3QT5A 5DM7Q 3T3FA 3B4DA 3DRSA 1KCFA 4CJRA 2ZBQA 1QAXA 1ZAXA 3IG1B 1WB9A 1YRTA 2CZ4A 5K8OA 3SQ4A 3I56N 3EEQA 5J2QA 3DN9A 3R1LA 3IBFB 2LQ8A 4EBEA 3HFKA 3B78A 1HW8A 4LR7A 1U04A 2V9KA 1FRXA 3BBCA 4EK2A 4FJJA 2WZ1A 3M9MB 4ECQA 1S9EA 1GLEG 3NVKA 4Y34A 1WKJA 4TYAA 3QFUA 3TARA 2P8IA 2DRDA 2C22A 1RT7A 4ZVQB 2HIQA 3J7A1 1M5SA 4HUEA 2FD2A 4CRJA 3MFIA 2MJUA 1FWLA 3HD2A 3HKWA 1OY6A 4DSJA 1GOBA 4WTYA 2E2NA 3VF4A 3SYZA 1Y11A 3QT6A 2Z30B 1JXVA 2MQ8A 2ZD1B 4ED8A 3U1NA 3GSIA 2NLXA 3Q8YA 2OD4A 3HFZB 2XQCA 5KTQA 3U4LA 4BRGA 3OR2B 3CCES 2YX4A 3J80Y 2AZ1A 2IOCA 2JEFA 1NH7A 3WIVA 2XO7A 2DEIA 2XNRA 4ECWA 3K17A 1MWMA 5GMKa 4DHYA 1IV0A 1KLNA 3ZZPA 1WDTA 5FROA 5E0OA 2QLJB 1ZH5A 2V8HA 3AJDA 1UA1A 2NXNA 2D0BA 5AXNA 3LZIA 3CJSA 5E7OB 3ENBA 3PX6A 6FDRA 4DI6A 1IBCB 2IAJA 4LVOP 4B1XB 5GINA 1Y5NB 4M3UA 1RJJA 3AAWB 1DEJA 2M70A 4OLOA 2AEFA 2J0XA 1NK0A 3HL8A 4J8FA 4H4OB 2Q2RA 4NXNJ 3LW5C 3R6GB 4W5NA 4K0KF 3T9ZA 2HQ3A 1ZM4A 2VF3A 4M8LA 4DHVA 2HHTA 4K4SA 3T5KA 4EYHB 3N5BA 5HL7Q 5IWAJ 1G15A 5JVHQ 1JJHA 2ZBPA 4WJBA 8AT1B 4I2QB 3EVWA 4CH7A 2BDPA 4DR2F 1U0HB 1BD6A 3AVCA 3DOMB 3MCOA 4L74A 1YJNN 4WK1A 2HAFA 2B7BB 4O3QA 5BRFA 3FSXA 2MKJA 3GCWP 4N47A 5F9NA 4PR6A 3UB5A 2AX0A 4DV1K 1R59O 3TEHB 4OYAA 2FIUA 1TMMA 1S0MA 3VTHA 4ZA1A 2YHBA 3H5UA 5BN8A 1U2RA 3Q8RB 2FDNA 1HI8A 4DU8A 2ZH1A 2OPQB 3M6UA 2UVUA 5CAAA 3BGOP 4E2FB 3FZ2A 1NJIO 1XMBA 4B02A 1S6PB 5C25A 2UVVA 5HP1B 2HFOA 4FO0A 1YZ7A 2HBJA 5I4MA 1CC7A 4UOCA 4Y2CA 4J2AA 5HJYA 4UQGA 2WFBA 1S6PA 1FKOB 3H2VE 1RWUA 2FQQB 2WVBA 4CFDA 2QWQA 2DXFA 4JN4A 4Y0WA 3WC2A 3I55S 3Q23A 1N8RO 2N3OA 4BRDA 5KG6A 4EP5A 1I94K 3BSAA 1UJ4A 2RNEA 5LSRA 2XWXA 4FM2A 3GJSB 4KBIA 3KD5E 2FJEB 4WTOB 5ETTA 2AU0A 3ULEA 5CD4A 3K5NA 1RAEB 1TK8A 5KPRA 3HHLB 2BEFA 1EXQA 5IT9O 3WXKA 5DMRA 1VJQA 3MM8A 4ID8A 1HW9A 1N4LA 2YHXA 1I5OB 3M2VA 3LAKA 4QR0A 4AL6A 2AGPA 4AH9A 4CNZA 1TL5A 1FK9B 1BI4A 1O6XA 5H9FK 5BRDA 1LWXA 3K59A 4O8KA 1IG9A 3CCQS 2XI3A 2YJFA 3V6DB 3EMTA 2W7PA 2QWOA 1NJXA 1RA7A 4H0TB 3G8TA 1RWPB 1URNA 2BM1A 4F36A 1VK3A 5AXLA 4DV2K 4DCOB 4CLTA 2W2OP 4JB8B 3CD6N 3QO9A 2WCXA 5CYMA 4KRWA 3W9IA 4HI1A 3I8BA 4IOCL 4EIAA 3GV8B 2GX9A 2QA1A 2ZDPA 3L0QA 2V2QA 1DTQA 3P8BB 1RAGB 5KFSA 3EDRB 3O80A 2A1RA 3N79A 3KHRA 3L09A 2JLFA 2FZGB 2OSQA 2LEPA 2KLAA 2W6KA 3BBFA 3D6TB 5IT4A 3DOLB 3T1HK 1MWKA 1GMWA 2QXLA 3RAQA 2GX8A 2QSFA 1D9DA 1HR0F 1V5IB 5KOWA 3AT1B 3HVWA 2VIHA 2WVDA 3VQ9A 4CEQA 1L5UA 2X78A 4P2FA 3R6LB 5A8WB 1EP4A 1P90A 3DI6A 1E6VB 4F0MA 4JI0F 2PMWA 4DR6F 1S5JA 3HXMA 4L8RB 1CXUA 3UCUP 4NYOA 2A3JA 3W5ZA 3GR1A 2YQ3A 4EBCA 1HARA 1T02A 2OTLS 1LEOA 3H5XA 3M32A 2G8WA 3Q8VA 1W9HA 2DFFA 2F3JA 2V4JA 2G0IA 2HS4A 3PKMA 1JWWA 5AQGA 1KVKA 2V4RA 1RDWX 4R0JA 3TWHA 3B6OA 5AZIA 4ZIWA 2W25A 5EWEA 2BOPA 3OXLA 2V4JB 5CYQA 2HHHK 1NGFA 3GIIA 4J9KA 1EIYB 3PNIA 2OH2A 4PG5A 3GLJA 5IOLA 4FZXC 3DLGA 1WF1A 3E01A 2VH7A 1HLUA 1YVFA 2V68A 3VAMA 2J8SA 5B0DA 3V9UA 4OYXA 1WORA 4ED1A 3VWSA 2RHKA 4LH5A 4OPJA 2BUNA 4NLTA 4JI8J 2OZMA 2O3DA 1SZ2A 4LF2A 2NXUA 3C19A 1D9AA 5A76A 3ITHB 3GB0A 1I3AA 1ZBLA 2WB4A 1QVGM 1NSQA 1U48A 2RUGA 3HHKA 4ANEA 2DY4A 1QTNB 3IFEA 3M8SA 4BREA 4CYUB 5KG5A 3PZPA 4RBTA 1VIOA 2YY3A 1Q18A 3CJ5A 3KK1A 3H2UB 1PAUB 2XZTB 2B4OA 5KFOA 3K9KA 3KKFA 2FUG9 5D78A 1KSPA 4WQ4A 5JS1A 2MY7A 3U9DA 1IBLK 2CQ3A 2YX7A 2HEKA 3JXOA 1RBSA 2BUPA 4CZHA 3K89A 3CCSN 2GEMA 1UP1A 1F0XA 3QATA 2MKKA 2DY1A 2FC8A 1G6BA 1KEKA 4WFAQ 3TO8A 4LH4A 3D1HA 2QG9B 3QT7A 3CM5A 1QUPA 3CJ0A 1XHZA 2CGLA 4BG8A 4JV2A 3ILJA 4ZPBA 5K14B 1LV5A 3WNGA 2X6SA 2CQ2A 1U8SA 3OR1A 5M2UA 1J9AA 5SZTA 2R3VA 1SKSA 2O8DA 4JI1K 2GJIA 2OGUA 4P7TA 4B3MF 1F9FA 4W5QA 5IC4B 4G1QB 1YVUA 4FWLA 3DLEA 1OYDA 3MDQA 1WI8A 1UFKA 2XMTA 3NWGA 3BSNA 4YN3B 4TYBA 3LWMA 4E1JA 4F02A 4OKKA 3IO1A 1TKDA 3H7HB 3OTEA 2FSKA 4NXNK 5A2QU 3SK3A 4JKAA 4JKHA 1JLQB 2R7WA 4A59A 2XCPA 4M5KA 4KRFA 2F9JA 1HNVB 4Z0UA 4DR6J 1HBOA 3H4DA 2ZC3A 3CQXA 1D0EA 4JI6K 4BGBA 2XSFA 4DV7J 1Z1ZA 1RBLA 4X4SA 1YITS 1UWBA 1VBYA 4EI2A 2VG7B 2RAQA 3GP9A 3ZZOA 2DGOA 4WFXA 3R7SB 2DPNA 3V9XA 2GMHA 2ZE2B 4LJMA 4X4OA 3V6JA 5KT3A 4UY85 5D3GB 2V8DA 5HK4A 3E9OA 2D1CA 2GIQA 1X0PA 3HHLC 3H20A 2PSZA 4RBVA 1E4GT 4ILGB 2NZTA 3P5JA 2NRXA 3O1BA 2H5JB 5JVGQ 1KTVA 1N54B 1FX2A 4JBCA 3MXMA 5BRHA 1WBDA 5KFEA 2RKIA 3DYAA 2HWTA 3RBDA 5KFBA 5L8RC 3DDKA 3AO1A 3CJ9A 4ED7A 1W2BM 1VQMN 4YOUA 5KOXA 4OI0A 3A8YA 3TJ9A 2CNKB 1H7WA 4F9OA 2UUCK 1Q86O 2KJWA 1JJCB 3MI7X 1RWXB 2HQDA 2O8EA 4I6WA 4K42A 3US5A 4FPBA 4FNHA 4P9SA 2C3UA 1CPZA 2MKHA 2Q36A 3SQGB 2M8HA 4IDHA 3GL1A 2E20A 4LF8F 2VYPA 3RZAA 4B3TK 3T69A 4HCCA 4DV0K 4QOTA 1RCOB 3E2EA 1RSCA 3FRYA 4H4MA 4K4WA 2FC0A 3CFRA 4F04B 4JI3K 5A0YB 1U4BA 3A12A 3GE9A 1OVQA 1PJ6A 4LF1A 3QIPA 3P5TL 3UNGC 3QB0A 5T7BA 1CJVA 2J7KA 2ADCA 4NE9C 5SUHA 4DSFA 3L95X 4OJHA 3MX2A 4YDXA 4RG8A 3IM9A 1Y3JA 3VTIA 4CEZA 3ZZ0A 4CJLA 3HZEA 1AZSB 3HZ6A 1LWFA 4WCEQ 4KH1B 4QU7A 4BE2A 4B3TF 3P49B 2YCHA 3O1WA 1ZZFA 1BOTO 4OKJA 2LMIA 2EX3A 2WVFA 5LMNK 3IR5B 1YBAA 2BJ8A 1ZYQA 1KVIA 2DNYA 2HRYA 4E89A 4F2SA 3JQJA 3AQPA 4K4VA 5E33A 2DR5A 4ILMA 4MFBA 2CPZA 2R9LA 1VBZA 3BQ2A 2JZ5A 4ZVOB 3VZHA 5ETVA 3N4PA 2IJRA 1VHFA 3NWRA 4JI4F 3ZEUA 5DLFA 3NAIA 4PG8A 3PW7A 3AOBA 4YDUA 4PA1A 2QV6A 2EBEA 3KMSA 4CBWA 2QJ3A 3NP5A 3AQOA 2QYCA 3UR0A 3B82A 2HGLA 1WSHA 4UF4A 4CJEA 4Z4GA 3W8PA 3CJ7A 1G4CA 4NZ7A 4IR9A 3AGRA 2VQEF 1O13A 4QWEA 2C2RA 3TA0A 1K8AO 2YXLA 1SQKA 3OUYA 2HWIA 3CXCM 4BRFA 3MMCA 4ZVGA 2L48A 1HBMB 2FJDB 5C10A 1X9JA 1YX2A 5J2NA 3HF5A 3KLIB 2AP1A 3UDVA 4I2PB 3VENA 2GGPB 1JNRB 2C1EB 4CH0S 1VRUA 4Y00A 4DUYJ 3KLFA 4KT0C 4NLXA 3PEHA 4WP3A 3P83D 3H08A 1VSJA 4NCGB 1AFIA 1RT3B 2ASYA 2KVIA 2EWHA 4DV5K 5EVZA 3HSTB 1WLJA 4IFYA 2M4MA 1JLBA 4ZTFA 4OYPA 3A8JA 3B6BA 3DU6A 3T41A 4WIQA 2ZH4A 1M5KC 3CETA 3O9RA 1JJ4A 4KPCA 1N5TA 3JAMO 2BRLA 1Y7PA 1G7CB 3AD7C 5KRTA 4LBIA 2MKYA 3HSDA 5JICA 2CQDA 2LFVA 5I3PA 1D5AA 5DGBA 5F8JA 1LNQA 2DR9A 3UD5A 3LTOA 1CVJA 2E7XA 2DJWA 3W2WB 3FZLA 5F8HA 2P5VA 4V1Ak 2Q6CA 4PAAA 4LBHA 2J9CA 2UV8A 1UVKA 1U1QA 4MAKA 3ZETA 2E6LA 2HK3A 4X64K 1HQUA 1S10A 3F9MA 3QEIA 5T41A 1VRTA 2AX1A 4B3OB 2GQQA 1KVBA 1Q82O 3TW0A 4CF1A 1VR6A 2G2OA 2R7YA 3HOSA 2BGGA 1DY3A 2DKOB 1HD1A 1HJRA 3SEOA 2ASDA 3JTNA 2YHWA 2MJNA 2J9DE 3OL8A 2GJ2A 1RT1A 4LFAK 4NXMF 3CD6S 3HFVA 1RBVA 3M30B 3I8DA 4A57A 1SH0A 4CJKA 1S1UA 2B7CB 1NJZA 3BM7A 4ED2A 4LVNP 1JX4A 3VHQA 4JI4J 3NNAA 2HG4A 2FYXA 2DO0A 1N0UA 3FZFA 1Z26A 1RILA 3TSQA 4PPDA 5KGXA 1K1SA 2C3MA 3UVJB 3UR3C 1WTBA 2HRUA 2NQPA 2ZOGA 5FDLB 4LRFA 3MECA 3EL2A 3NE6A 2ZJQQ 3D6FB 4MO4A 3NMAA 2LYVA 4ZP6A 4FOEA 2IVFB 1XJWB 1R8PA 4M5JA 4EFHA 2DPIA 1YJWS 4IDKB 4CJQA 1CZBA 3QFHA 4BVOA 1UPPA 2ABYA 1HHQA 4R25A 1H72C 4CLLA 4W98A 3SBGA 1K8AT 3DLKA 5CYMB 2CNNB 1VDHA 3RYLA 3QBCA 1Y4ZB 1NRKA 3S3NA 4CGHA 1ILYA 3H3NO 1RQ0A 1X1PA 5A8RB 3GILA 4A47A 4IKFA 1PJ5A 4WFYA 1MA9B 3WZ0A 1VQ5S 2HNDB 2R2TA 3THVA 5KFUA 4WU2A 2W9BA 4YY3K 1S1TA 3M8PA 1ZBTA 1VQ7N 1FRIA 1IG8A 4N7TA 2AF6A 3U02A 5C2DA 1N5YB 2G0CA 2E9TA 1HI0P 1NK4A 1LOTB 4ITSA 5KT7A 1NGDA 3DDNA 4HHHA 3PW2A 4EGLA 4DJBA 4ICLA 4QQBA 3T1HF 1RP5A 2QSWA 1LW0B 1Q1KA 2PE8A 4ZDNA 3DI6B 1EHWA 1W2BR 5F8GA 3SV3A 2E5JA 4NA2A 1ZOTA 2J76E 2DHHA 2W2QP 3IC1A 4Y2IA 4ERDA 3LP0B 1F5BA 3DHWC 3OLAA 4ILJA 2H65B 4KKOB 3ET6A 3ILLA 2A1SA 1B0VA 3LH2S 2E4LA 3GV5B 1FKOA 2OAUA 3FFKB 3IUCA 5DRKA 4NLYA 4DX8H 5TKYA 4OQJA 1Q8LA 2CG8A 3PRVA 2DK2A 2BW2A 3C14A 3J7AP 3AD8C 3QMLA 5E3AA 4M5DA 3ZFVA 3DRXA 4OYMA 3H98A 2D5RA 3G6YA 2IM2A 3RW6A 2P9LA 2Q79A 3K8VA 3AY9A 3OS0A 3KK2B 4DX6A 4LF8K 3MMVA 4GW6A 5AQWA 1XNQJ 1LAWA 3H45C 2AKWB 1FCAA 2WSEC 5AQYA 4MLHA 3SPYA 4URSA 4ENOA 3NF9A 1VQON 3VEYA 4P72A 4LF6K 4F3TA 2X3GA 4W4MA 1WHWA 3D3CJ 3GOIA 3QETA 3LP1B 3KYLA 4C8NA 4LSNA 4JV5J 3DOKB 2PZSA 2LU1A 3R1XA 2DGSA 3LDPA 4ZPAA 2ITMA 3CCEN 3R5BA 1SH3A 3C6UB 3VGUA 4UOGA 2J5AA 4MLEA 1N8RT 1QE1A 4C8MA 2ZFHA 4M95A 5K8MA 3M2RA 2P9KB 1SQGA 2DGTA 1IWGA 3H8YA 3KJFB 3OL7A 3CJBA 1FA0A 2VWBA 3H59A 1NKBA 1NPKA 4KTWA 3SCIE 1JLEB 1RHUB 3QIOA 3LP0A 1BHNA 1OQ3A 3BO3A 1DBDA 2WRMA 3ZSXA 1QE1B 2F7VA 3DXSX 2IY5B 2BJ7A 4OX6A 3GJQB 1G3OA 2MZSA 4J91A 2PO4A 4R5PA 1R0AA 1T3VA 3MEEB 4CLFA 5E41A 3DLLQ 3QAUA 3MZIA 4DCJB 3FSYA 3JSYA 4DV0F 4JI8K 4DR4F 1DQ9A 3NRBA 2J6TA 3GZ7A 3TAGA 2XZDB 3TRGA 2DH8A 4IRKA 2P51A 2K3KA 1IM6A 1AW0A 4F0HA 4GMKA 3CVKA 2OEMA 3TABA 4FJKA 1HR0J 4DR2K 3TP2A 3UIQA 4FK2A 1N6QA 1TU0B 3TA1A 3DXMA 2ROGA 2ADBA 2D9PA 4YOYA 2Z57B 3TA2A 1YWXA 1U47A 3ID8A 1MSWD 4FLZA 1HBUB 4CFAA 3OL9A 3M5RA 3O4QA 4K59A 1NEEA 4MK9A 4FXVA 1GK8A 1H3DA 1HBUA 3MTKA 4GVBB 3PW5A 1QQOA 4DTOA 1LQ9A 3VVUA 2ATLA 3UVJA 1PG5B 2AP6A 2V5HG 1VQMS 4KAZA 3OVNA 1FRJA 2RJZA 2VG5B 1JCFA 5L39A 3PIPL 2VDIA 3KG4A 3O9SA 4DMZA 4RW7B 1DAXA 3BZQA 2OTJS 2WOMB 3DRSB 1S1WA 4LRBA 4CZKA 1EAYC 3QJJA 2VQFJ 1TVRA 4MT1A 4I2PA 4X64J 3PKYA 5FIIA 3ATVA 2KT2A 3O8MA 3SFGA 4E8UA 2XCAA 3KLIA 1HNWF 3R2DJ 4CIEA 2A6MA 1RT2B 2G8IA 4AL5A 1S1TB 3M8PB 1X7VA 3O6WA 5B7WA 1IBKF 2QWRA 4LF4K 4PUOA 3HX9A 2VASA 2OZSA 4EAHD 3C16A 2QEXN 3K5MA 4IG3B 1WAJA 2JC1A 2BANB 2W4DA 2UU9J 4L3KA 3B6PA 1F6TA 2MKCA 2IBOA 1F5CA 4C98A 2HGMA 4EYIB 2J0QD 4Z7YA 5BXIA 4RWXA 2JDJA 4YDUC 3OTOK 2DRAA 3W3DA 2GVDB 5EN1A 2DHAA 2CG4A 3FLCO 4CERA 2E2PA 1NLKL 3MXJA 3IWLA 4K2XA 3ZTRA 2VFVA 5HMZA 4GV9A 3HPOA 3KLVA 3TUPA 2XLIA 3G86A 4AYBD 3OXGA 1WUAA 3MM5A 4V19S 3MCSA 2HMIB 2XMWA 4Q7AA 2VU5A 5M1FA 2IMOA 5J2QB 3G71N 2R8JA 2JHEA 3ULHA 4RCHA 2HLUA 1Q81T 2FBTA 2IVPA 3ZT2A 4DOZA 4CO4A 2C42A 5LMUJ 1MDUB 4ECRA 2OCEA 1TK0A 3C8YA 3V81B 4LRAA 4MKYA 4E7JA 3ENOA 4GKJK 1GLJO 3VPZA 2YKOA 1G99A 2KZZA 3GIJA 1N48A 1ZC6A 4H4MB 3MEGB 1GLCG 5AQXA 2A6OA 1TAQA 4QWDA 2VPZB 3CIMA 3O5TB 1HBMA 3A5OC 2BR0A 4U7CA 1SJ4P 1REGX 4BRCA 1B3TA 2IJFA 2PEHA 3VEXA 1B0TA 1LXJA 4CLZA 3DLBA 3HD1A 3J7YI 1GX5A 1CJKA 2OPSA 4UY8T 5GIOA 2O8EB 4JKGA 2AYGA 2GIRA 3K58A 5KG0A 2KHCA 2NSCA 4XPEA 3MOJB 3CULA 2WOMA 1RBTA 1U26A 3DKDA 4DUZJ 3Q22A 3CCMN 1S0OA 2IM0A 4P74A 3LPUA 4IR1A 4CM2A 1IJJA 3BF1A 1KBRA 2LKZA 2ACMA 3ENVA 1RHQB 2H5EA 3SSSA 3QLHB 4IJNA 2N3LA 1VQ7S 3QAEA 1EQMA 3TUIC 4WCEL 3OSPA 3DOLA 2CPEA 3LGMA 1VQ5N 5J2PA 1IJFB 3BBBA 1UW4A 4OZ0A 3D0PA 3T5HA 4GVLA 3HDSA 3P38A 4CQ1A 4B9LA 1B99A 1EB0A 3ETMA 1IH7A 2ZGYA 4X66F 1X0FA 4ZVRB 2XM3A 4DL5A 1UJ6A 1LWFB 1HPZA 2KN4A 2AA4A 2RQCA 1E6YB 1C4AA 2U1AA 5M1QA 5AQPA 3KUHA 2G2ZA 3M30A 3OYBA 1IKVA 4JI0J 3I5BA 1X5OA 4DV4K 2CQCA 1QJHA 3CW2C 3BPSP 5JLHA 5HROB 2LCWA 1RTDB 2KTQA 1HNZK 2FSNA 2B43A 4I67A 4LF6J 1NG9A 2C2ZB 1BQNA 3VR1A 2JJ4D 6AT1B 4J2DA 5F1XA 1A6LA 4ZLJA 1OY8A 2EC0A 2HPUA 3FCHA 3V9WA 2ZZMA 1IKWA 2VICA 4CEBA 2UXDF 2Q0RA 2E7VA 3L2RA 3OFHA 1D4XA 2M7SA 2CWKA 2PC6A 4JK7A 1HYVA 4DQSA 4MK8A 2XY5A 4CJVA 3CMEN 2BABA 4TXSA 4DWIA 4HTLA 2V0NA 4YB1P 1SJ1A 4FW2A 3CJ4A 4CJUA 4C3LA 3TZZA 1FO1A 3CJ1A 4OJGA 1WF2A 4CZJA 1KC8O 4NPOA 2UUAK 3KIOA 2O8FA 3W2WA 3HVTA 1WHXA 2KFYA 3OXFA 2L9WA 3G82B 5A6PA 1HNXJ 1Q53A 3O3GA 4J90A 2L9NA 3MPYA 3BO2A 3LP2A 1V9OA 2A41A 4XPCA 1SJ3P 2MQLA 3W5YA 3OTOJ 4B8AB 4Q2LA 1X4GA 2VFUA 3G0ZA 3IMXA 3HMJG 4LQ9A 2F4FA 2NXCA 2QO3A 3EX7B 2CPFA 3PYEA 3VZIA 4EHTA 1RAIB 1W26A 2ZHOA 4USIA 1UFLA 1X9SA 3LGNA 3C15B 5D4LA 1JLAB 1WSFA 4ZJOA 3PW0A 5U47A 3PDNA 4JV0A 5H9EJ 4XIUA 2BOAA 2OPRB 3VAGA 3BEXA 3M3ZA 5CYQB 3BH7B 2BQUA 4Y28C 2CDRB 2I7PA 5D0GA 2QTDA 1Q95G 2YI1A 4PEOA 3N6LA 3KK7A 1JLFB 1ZA1B 4ES3A 4Q0BA 3I96A 4A8FA 3J80U 2YNGA 1J53A 4OJ3A 2J7WA 4AHTA 1WKKA 1S99A 4URGA 4BDZA 3IAYA 2ZZTA 3C65A 2IA0A 2CH5A 1M5HA 5IFMA 1XHXA 2HZAA 4LFBJ 2MGZA 4YHHF 1WDDA 3X1LB 3OD2A 3UW1A 3FR0A 4CZFA 4K43A 4FWNA 1NOZA 3UKUA 2KFZA 2CVIA 5D4PA 5D4NA 1RT4B 3QYYA 3QNOA 4DV4J 3H0PA 1TKZB 1D09B 1HWLA 3LDNA 4DN0A 1EETA 4RLEA 2HVZA 3WT0A 1RTIB 4X4TA 4B3RJ 1S3XA 1CLFA 2KRBA 1XTZA 4I9LA 4BDYA 5KFTA 1ASUA 3T1AA 2QZ8A 5DQHA 2PIIA 2R7TA 4MKAA 1O51A 2A2DA 1BA0A 1T9UA 3QSIA 2A18A 3S8SA 3P31A 1C1CB 1WSVA 4H03B 4K4XA 2DH9A 1SCJB 1S7IA 2BANA 2EWSA 3POTA 2DB1A 3MXHP 3QEVA 3KZBA 2G8VA 1HNXF 3DXKA 1HWJA 3MCMA 5KPZA 5HL7L 3BR9A 2DIVA 4FVMA 4CP5A 4ED0A 5IQQA 2OPPA 5EX0A 4FLWA 3AAPA 3MPVA 4FZZA 5B09A 4YY3F 1HQUB 3ONQA 1ZPVA 1PBAA 1WEYA 2ZOMA 2R8HA 1P9QC 2VFSA 1YJVA 1OO0B 2W6LA 4PKDB 3IP0A 3O3HA 1BMQB 4URQU 5CY4A 4GO5X 2AJ0A 4DUZF 4LFBF 5CHIA 3AVHA 3N6MA 3KDNA 4IH6A 4AILC 4KH0B 5DQGA 4CEFA 1IBLF 4PWDB 1VQPS 1PCAA 1SQEA 1K8KA 5E5NA 3FBFA 4OHZA 1FKPB 1KS2A 4Y2MA 2X51A 4DX5A 4LSLB 3NGRA 5ETLA 2D3ZA 1NNDA 4QR2A 1KFDA 5T7LA 2N82B 3VVTA 2RE2A 3C6TB 1T11A 4L73A 4NOHA 3H6EA 1FWPA 4M3YA 2VCPA 5AZJB 2NRZA 2PAVA 5LM7E 2BXJA 1IO2A 2PYJA 1D9FA 2KJVA 3SMZA 3W60A 1NGJA 2G8FA 2E5LF 1WOPA 2XMJA 2Z8QA 4IDKA 1LAVA 1NKEA 3DU5A 1YITN 4QOZB 4IOAQ 4QW9A 3CJKA 4XDCA 4X65J 2X74A 5L1LA 4MKBA 4BRHA 1ZM3A 3H5SA 2UVWA 3DFEA 1AYEA 1OSCA 2FLNA 4H0YB 1MMDA 3MR5A 3SUNA 1YZ6A 1K9MT 1WOSA 5LSOA 2FBXA 2VQFF 3OYFA 4IXCA 1K44A 4CDIA 3DM2A 3KD1E 4ED4A 3J81Y 2K7JA 1PYOB 2B4UA 3D2WA 2GGPA 3FZKA 4NLCA 1S79A 1VLOA 3W62A 2BM0A 5LL6Z 3RMCA 4CT9A 1FFGB 2FGCA 1NBEB 1LW2B 4RR5A 2O1PA 2XSJA 1DLOB 4U95A 4DQRA 2HHPA 1UMJA 1WD6A 4BRMA 1SUQA 2GQCA 4DMNA 2CADA 4E19A 1F1BB 5ETMA 3UE2A 3HCXA 1RT6B 2OSRA 2XLKA 4FYVB 4UOFA 3OPKA 2VOOA 3D5MA 1BCOA 2X1BA 3CUNA 4LFAF 1B0PA 3ZZUA 1HQ2A 1OMSA 3I9V9 2F8TA 5GADU 2KI2A 1MU2B 1JKHA 1Q8BA 3JSMB 5KT2A 4ES1A 3H1VX 1HKCA 1HWIA 1VQSA 4DV1J 5HANA 4I0WA 1T03B 4Y1DA 5DG7A 4DUZK 4N77A 4KBOA 4X64F 2HQFA 1VQ8N 2E1ZA 2F8SA 1B4SA 2GZOA 1S4FA 3TAEA 3QJLA 1UAWA 3BKUA 2O5DA 4ECXA 3CCJN 3SMSA 4JHDA 1HBOB 3BPDA 1HNVA 1FK9A 4K5RA 3KLHA 4NYFA 1UJ5A 2FHJD 3OS1A 1BWEA 4DTMA 1UEVA 4IQXA 3MAAB 3QNNA 3CTRA 1GLFO 3FEXB 5E3PA 2VG6A 2VQEK 1FERA 2K7KA 5AE3A 4RUCA 3MEKA 4USTA 4BE1A 3QEPA 3VA3A 3WUHA 3FBEA 3A5LC 4QS8A 3G9CA 4CZMA 2CKWA 3MMCB 2G8KA 5L38A 4OZ3A 4ZLPA 2VG5A 4ZPCA 2BJEA 2DR7A 4EP4A 1GMUA 4FBTA 3ZSRA 5KFJA 3C6HA 4NI2A 2JWLA 1FDBA 3MUMP 2ACYA 2ROEA 2JSXA 2VKRA 2VJUA 1S1XA 2Z58B 1Q7LB 2EC2A 2IBKA 4L3NA 3BGUA 5E26A 1FW6A 4LF7J 5C25B 4F4ZA 9ATCB 3GTYX 4N5SA 5F8NA 2MLYA 5HN0A 1UVLA 1UCNA 2CDQA 3LM2A 1JLAA 4JI2J 4OLPA 2RU3A 3RRKA 3MAQA 2ZVSA 2B4JA 4KC5A 3NMRA 2MQMA 3SI6A 3THWA 4F3MA 5CCMA 1BUXA 4U7UD 3TAFA 1ZAWA 4USMA 4M63C 1XR7A 4CD1A 4KHPF 1WG5A 4WFAL 2RF2B 1N52B 4ZK7M 1RE1B 3VQ4A 4JRPA 2GUIA 3R5CA 1H0HB 2J0WA 3F0NA 1U6BA 3L6QA 4RWTA 4DV6K 4XO0A 5IT9U 3HPHA 2H1YA 3Q7CA 3HVAA 4QIWD 3JSMA 2KO1A 2PEBA 1IKWB 2BZ2A 4I69A 3V5RA 3RSEA 3RG6A 4QPTA 3V4MA 4NMLA 3T1HJ 2PMZD 2J4RA 5KG1A 3BSOA 1QVFR 5CCLA 3WBZA 1MG7A 2I38A 1RTDA 4TY8A 1KFSA 5A8KA 1YJWN 2R8GA 4FYYB 1TL3B 3D2FA 4PQAA 1SPBP 4ELUA 4K0KK 3K57A 5AE2A 1C1BB 4DZ6A 3W5XA 3EJMA 2P9IB 1T44A 4B3MJ 3ZEUB 4AM7A 4EBDA 1WEXA 3GPAA 3QINA 4FZYA 2VG6B 4RU9A 2CPYA 1UEUA 4WK3A 4FPIA 4HLBA 5KT6A 3QZ8A 1U7LA 2MZ1A 2E1AA 5B0BA 2A6AA 1TUVA 3R9LA 3TEGA 4C8YA 3PFOA 4C11A 3MTJA 1YI2S 2LA4A 4DTUA 1JLCA 4WYWA 1NSPA 2B56A 2HBZB 5DM6Q 2V8PA 4WKYA 1T9TA 5DM6L 1GOCA 2O8CB 2O01C 2LQ9A 2P5OA 2M9KA 4EUVA 3HVRA 4KREA 3RMDA 3MR3A 2OJ3A 1M1HA 2AJ4A 2DITA 3SCJE 4FJHA 4QR1A 4YR0A 5GIPA 2IRXA 4DLGA 2BBEA 2E66A 2BJ1A 2MKSA 2DGQA 3IRXA 1FRMA 2G4BA 1I94J 1NUEA 3WX8A 1NHKL 5F41A 2WBRA 5CXTA 1S72N 4PABA 5AQMA 1U6ZA 4TU9A 2EKYA 2GV1A 3KLGA 3M8WA 1XMQJ 3LUYA 2D3OR 2H5IB 3H2LA 1F2GA 5B08A 5AZIB 3C3LA 1JLQA 2MZRA 1ZBUA 5KFDA 2EPIA 4LT6A 2GFFA 1QHTA 4QIGA 4ZVTB 1YJNS 4J9UE 4MIBA 5C2CA 1XQSC 2QGFB 3HK2A 1EQYA 2Z1HA 3S3MA 2DEJA 3PYFA 2RQMA 1WI6A 1SS6A 1EP4B 1Z2ZA 3VESA 5IM0B 4X62K 4JI3J 1HJOA 4CHQA 3TAQA 4N56A 1H38A 2GHPA 4NXNF 2Q6BA 3CERA 2CQPA 1RBUA 1TV6A 3OLBA 3U3YA 2B3TB 1VOMA 3R5JB 3V81A 3CG7A 3QWPA 4DFPA 3MPDA 2OMLA 4WYBA 3JSBA 5KFAA 3OJSA 2EK6A 1VSLA 2H3EB 2RS8A 3D2EB 4O4GB 5AQQA 2VC0A 4M3RA 4KPYA 3UD4P 1DRZA 3I0RB 5DDQC 4FOIA 3VEVA 5EOYA 5KFKA 2M0GB 4BGAA 4ZCKA 2MGZB 3CCJS 1GLDG 1Y9OA 2DNLA 2E5HA 2RDIA 1YSJA 1EETB 4OYZA 1B9FA 5LXYA 4DS5A 5C42B 4NYPA 5L1KA 4WKRA 4XH4A 4A2BA 3EY1A 1TYQB 1HWUA 2OFHX 2ILYA 2D69A 4LSZB 1Y64A 4LF8J 5AXMA 4RNMA 3C16B 4DUYF 3OS2A 3VQDA 3C6AA 4UZBA 4E98A 2CQIA 2V63A 3AA8A 2I1RA 1JL1A 4QYRA 2X3DA 3BDPA 4O4RA 4CZIA 4J9PA 2C2MB 4MIAA 2JRSA 4FWSA 3CIZA 3QIPB 3B4MA 1WSGA 4IOXA 3G4SN 2A42A 1QLNA 4Q2MA 5L1IA 1RXOB 4FS1A 4DQIA 3TZWA 3OYCA 1QZ5A 3DRRB 3Q7BA 1T3NA 2YHYA 4CK2A 3ZO7A 4ECYA 3OFGA 1OH5A 2KB2A 4CLYA 2M2BA 1VRTB 4C8ZA 3MAHA 5KT5A 4QIVA 2KXHA 1NJYA 1PYSB 1TTHB 2NCKL 1N34F 1NDPA 3SDEB 2NXJA 3RRHA 3ZT0A 4BY9C 4KHNA 1ASWA 3UE5A 4PRFA 2CRLA 4OV1A 4E0DA 1IQZA 4ELTA 1B70B 4DV2J 3CC2S 2YH1A 1U1OA 2GO8A 3KWIA 2WSCC 3HYFA 4XEIA 2HSTA 3ENHA 2CA9A 2ZE2A 3L2WA 1WOOA 3AVAA 1GLAG 3WEEB 3BGLA 2M5YA 5LY3A 3CI5A 1TL7A 4LSLA 3V1RA 2MKIA 2RB7A 3M1VB 4A8MP 4TQRA 1DKGD 1K8KB 4NLRA 3D0GE 2MTLA 4OI6A 5BYRA 4B8CA 5B0EA 1A9NB 4WZMA 1M5OC 2DGXA 3MM9A 4AHVA 3THXB 1AXQA 1U1LA 3NCIA 3V1QA 3CCVN 3ZSQA 3OTBA 1Z6RA 2P9EA 2Z1IA 2D0AA 3CMAN 5AR0A 2B8PA 3P5BP 3IR7B 3E66A 4NLDA 4V19J 4XH5A 2YBVA 1H74A 1UVJA 3FQLA 3JS9A 4FKYA 4CO1A 3OYNA 4GC7A 4CEOA 4KH6A 4OHYA 3HP9A 4Z94A 4A8OA 4PXEA 1PO6A 2OO4A 3L3UA 4ZIVA 1YF5L 2FHJA 1APSA 5MLCQ 2I9SA 3MWTA 5AJ3F 2VL1A 4UUXA 3M2RB 3KLEA 1S48A 1J27A 2BRKA 3M4XA 2K8GA 1EKEA 2CAJA 3R8EA 3A8KA 2IA6A 5K8PA 3D0IE 4ICLB 3C15A 4XH1A 4MFBB 3CDEA 1JXEA 2AJ1A 1H2VZ 4LIWA 4F67A 4CGGA 1DZ5A 3KTQA 2DYAA 3V2UC 1QVFM 3RSEB 4H5TA 4FPRA 3NCPA 4J7CA 3HJVA 2POKA 3THWB 2W24A 5BPNA 1PYTA 2W2PP 4FP9A 3Q8QB 3SSRA 2KHOA 4QPXA 2PBDA 3CJRA 1MU2A 4RNFA 3A5NC 3MM5B 3MEDB 1N88A 1RBRA 1IBMK 4IZ9A 3N9UC 5F3TA 3PJWA 4AHRA 5HRNA 4ZCMA 3OW2R 2R8IA 1J2VA 3PHEA 4AQYF 3DCAA 4O3PA 2ZH9A 3NBPA 2FF6A 4K2JA 4C3KA 4Z7CA 2GWKA 4GV6A 3ID6A 1R89A 2EFQA 1YLXA 1TL4A 4X4PA 4Y2KA 1U1MA 2Y3YA 3NAEA 3FFIB 1XNQF 1IKYA 1WC4A 5I42A 1ZM9A 4M3XA 4UT4A 2DNRA 4USVA 1NK8A 1VQ4S 2UXCJ 1TUYA 5DK5A 5DG9A 1U6FA 1UVNA 2LVWA 2X1FA 3GG0A 1CXQA 2P5GA 1RT1B 1S1WB 4DV1F 4JV1A 2DNHA 2V51B 4A8SA 4QYZK 5KAKA 4ISEA 1EKRA 1KD1T 4JI5K 4LF5F 2HZCA 2RQ4A 5AQHA 4RNOA 4PKHA 2ZUGA 2QL9B 3SQ2A 1H2TZ 1D3WA 2E5IA 3PIPQ 4RL1A 3C6UA 3DLHA 5JMNA 3M6WA 3QPIA 1CG2A 4DTSA 1K9MO 2DHSA 3FUYA 4FDFA 4CFBA 4DL7A 3HT0A 3KJQB 4RX6A 1AUDA 1S1VA 1VMBA 4BRNA 5KRSA 2XB2D 3EGVA 2LQBA 3H46O 2P9CA 1AA1B 3PSIA 4DR1K 2YJEA 1BLUA 4V19X 3QMQA 4BR7A 1SKRA 4DU4A 3QJPA 3J7YP 1NB2A 4PKIA 1N36K 4DV3J 1TKXA 3H4BA 4QWBA 7AT1B 2ZBCA 4IO9L 2F40A 1D8YA 2BJDA 2U2FA 2VOPA 2W42A 3BQ0A 4KHPJ 1FI4A 4FPAA 1M90T 2Q66A 3NOGA 2ZGZA 4WQ5C 3E01B 3RB4A 3FK4A 3SUQA 4BWMA 2MLXA 4DLEA 3ILIA 2ASMA 4HWIA 3DLGB 4E1NA 2NNWA 4CJ5A 1O8BA 4LF7F 2QKBA 3NL0A 4KE5A 1TR0A 1QAIA 3S01A 3ELHA 1KD1O 1B7FA 1URRA 2Z2ZA 3MN9A 1F9HA 1JLFA 4GKKF 2KG0A 1YIJS 5LJWA 3AHPA 2QLFB 1VC0A 4RU2A 2IAJB 2OFGX 5ETSA 3MK6A 3CJKB 2IGIA 2WBMA 2GMJA 2QT7A 2I5JA 1K1QA 3PJ9A 2JH3A 2V4QA 1O5JA 1P1TA 2MEWA 4G65A 1HWKA 5KQDA 1C1CA 3CCQN 2JL9A 4ZVSB 3JS6A 4CJPA 4BR9A 2XHBA 2DNNA 2Z2YB 4ZCLA 3E9LA 3SQ1A 1RTIA 3VGVA 5J2MB 2X1GA 2MPUA 3O08A 2RN2A 3HHEA 4LRCA 2N7CA 3L8BA 2ZOFA 3PVXA 2ZH2A 1Y97A 4CJFA 2W9BB 2WONA 4KGVB 2IVMA 4FJ5A 3MGJA 2WW8A 2IDLA 1RTJA 3G96A 5EY4A 2HVDA 1XMOJ 1C0UB 3OYEA 3I4PA 1JLGB 1Q8IA 3I33A 3PRDA 4BRAA 4CECA 2HBQB 2Z56B 3HLUA 4IFVB 3DXMB 3AVMA 2P9PB 4C8OA 2ZKUA 4IRCA 2E2OA 2XMUA 4CHYA 2F4VF 2UUWA 4KI4A 1FRHA 1MROB 1IUJA 5EXWA 4BC4A 3JQKA 1FKPA 4O5FA 4NZ6A 1MLAA 4MKVA 3A3OB 5KG3A 3PACA 4PWUA 3DRRA 3UDCA 1DFDA 2GHVC 2P9KA 4BR5A 1S49A 3ZSZA 4B9TA 1JK9B 4ZVEA 3T1YK 4KAIA 4G1QA 2W2MP 2EW9A 3VAFA 1F3VA 1S0NA 2C2NA 5DQIA 4B1YB 3CGIA 3MAAA 4B3SF 3CCLN 4LF4J 1ZAVA 3PX0A 2OMOA 1S59A 3L2UA 4JI0K 4M63A 4WF9L 4DV3K 1U1RA 4U67Q 4OHXA 4C23A 3NG8A 3A1YG 3NDKA 1GLLO 5FRNA 3SAGA 3OYAA 4PZVA 1SI9A 3NF8A 4DN9A 3CJ2A 1SC4B 4LFCJ 4IO9Q 5EGYA 1IBKK 5ADXA 4JD2A 4K8XA 2EFPA 1SH2A 3MM9B 4C0OC 2V69A 4OJRA 3ZNJ1 3T1YJ 1KQGB 3KJNB 4MK7A 4OIXA 3MURP 2ZJRQ 2JC0A 4ZPVR 5F0XA 4JYAJ 2NREA 1SUQB 4LF9F 1RAJA 2FBVA 2QA4N 3EWGA 1NK5A 4KJIA 3NMUA 3OYIA 4JOUA 3EVOA 1VQYA 3P3DA 2ZH5A 5JVGL 1NDCA 1Q9XA 5C0YA 3BKFA 3RBEA 2YTCA 3GE1A 4C6AA 3MM6A 1S1VB 4BBYA 1W2IA 3I31A 3W0LA 5H1SV 1OVYA 4R5PB 1R0AB 5DGAA 3MFHA 3EN9A 3BN4A 5EUHA 4ZN1A 3ULEB 4GKJJ 1K6YA 2UUBF 2QXFA 5FPMA 2FSJA 4MMOA 2DR6A 4DUTA 5L46A 4JYAK 2E2QA 1U02A 3V1OA 4YFUA 2QRRA 4OHVA 5CZVA 3DLRA 2CJAA 3MPUB 3R6MA 2PFDA 4JI4K 3DNCA 1SB6A 3CO0P 4JI6J 3G87A 1NHVA 3AVKA 4HTUA 1Y10A 5KFFA 2UXBK 3L2QA 3SQOP 3RBZA 1RAAB 3KNAA 5HBMB 4NB4A 4U9RA 5M1NA 4ZP7A 3TVZA 4HVZA 4DQ8A 1VC5A 2AIRB 5D3GA 3ZYYX 1OS5A 3R3LA 3WX4A 2BE7D 1OWXA 4LMZA 1VBXA 4EO6A 3ZSVA 3SPZA 3FEYB 4ZVUB 3HM9A 2XYPB 1Q7YT 3CCUS 2C28A 4HACA 2UU9K 2HF4A 4FJLA 1WOQA 4CK3A 5TKWA 4GMJB 3VERA 2LA6A 4PG6A 2QYGA 2NSBA 1WG1A 1R3NA 2BACA 1DARA 4OX9J 3DGVA 1KHVA 1DQ8A 4EMDA 1KVAA 3PSFA 1IR0A 4JI3F 4WP8A 1S5ZA 3OTDA 4Q45A 4QS7A 1KQSM 1XERA 3SNNA 3G82A 3GFXA 1VSDA 3W2VA 2FLPA 1FJEB 4AXIA 4YR3A 3BGRB 1FXRA 3OBYA 2R2UA 1ITGA 3JYTB 4Z2XA 4OPAA 2WAQD 2H48B 5HVHA 1FF2A 2DY9A 4OZLA 3NGZA 1X4EA 3EPGA 4OKEA 1WC5A 8RUCA 2XLJA 5DG8A 2PD1A 2HURA 1UTAA 5HVGA 2Q97A 1MMNA 2HIYA 1DLOA 3N4QA 1R6YA 3GWCA 4E7IA 2X7IA 1HL6A 4A8YA 5A8WA 2QA2A 2RDDA 3CDBA 3TX0A 4NLUA 2OIHA 3N6NA 3C0BA 1PC4A 3N5FA 3OR2A 3J81j 2XO6A 1RACB 2KFNA 5KT4A 5BR8F 1SBRA 1F5AA 2UXDJ 3V6KA 4FXWA 4WWSA 4CLWA 4RTFD 1BISA 1U0SA 5KFZA 1VK8A 3QRPA 3AY0A 4L76A 4FWRA 2Q1LA 2E9RX 4DEZA 1Y3KA 1WC0A 1GXTA 1RAOA 2HYIB 1BO5O 2O4GA 3SJJA 2RRNA 2ALZA 4KHWA 2NRRA 2VQEJ 1UW9A 4DPYA 4ED6A 3NAHA 3DGPA 1C0GA 3AO5A 4ANCA 4N8NA 1FVQA 2RH3A 3E51A 4ECVA 3VQCA 4DZDA 3Q86A 2LDYA 3SUOA 4CTAB 1S57A 4PL7A 1KN6A 5BREA 5F8LA 1XNRJ 4RNHA 2F8HA 3LZJA 2R42A 5G0RB 4FWPA 2AHOB 2YNHB 4B17A 3D2EA 3PO5A 2F63A 2V8VA 1XR6A 2VZ9A 3MDFA 1TKZA 4DFKA 4B1ZA 4OYOA 4A2AA 1TKTA 2XZWA 3OJUA 1KRPA 5M1KA 4YOXA 3RGIA 2E88A 4BC9A 5IC6B 2JEJA 4ECTA 3C94A 3GYXB 2VFRA 4CIGA 3HSJA 2MQOA 4KIAA 2C2KB 1FTCA 2G9OA 3FRZA 4CNYA 4ZMMA 2Y9HA 2AWZA 1NM1A 2CUYA 2CYYA 2LQJA 2DPJA 5JMVA 1CJKB 4NLGA 1JJ2M 2AEJA 3QDKA 4AHUA 4JYAF 3AO4A 4LF9J 2ITGA 2FJXA 2W1BA 4OVLA 3Q0AA 4KO0B 5B0GA 2O66A 3EZ5A 1N34J 1TK5A 4OLAA 3ADAC 1KNZA 1ZBHA 4KY3A 3LPEA 3CE8A 1IKVB 1VQKN 2XY6A 3M1FA 2GQ2A 2AQ4A 4YOTA 4C1NI 4CJ3A 4E7HA 2RSQA 3VQSA 2J8AA 1DJ0A 2QC3A 2HAIA 3PFEA 3WDOA 3PYDA 1E6VA 4WE1B 2HHVA 2CQ0A 3FC9A 2A40A 1N5YA 2ZBIA 3VQ8A 1I39A 2VGNA 1H73A 5LJVA 1YRUA 3DOKA 1H7XA 4ZPTR 4BR2A 4KI6A 2DO4A 3HZGA 4YEAA 4NZ0A 3TZXA 3KMQA 1H6KX 3QLHA 1SV5A 1P27B 2JGUA 3TR8A 3EE3A 1YBUA 4AXJA 1JB0C 2G8UA 4R0EA 3O9TA 2AYMA 5EWFA 2BYCA 4LF5J 4Q8EA 4O4GA 1FXLA 2LEBA 3EE9A 2JFDA 2FB0A 4YMEA 2I5JB 4A48A 4IRDA 1ACMB 3KXDA 2FJAB 2Y8YA 3R2CJ 1Z4UA 4G3IA 2KM8C 1XBWA 5J1EA 3KUEA 3RW7A 4FJMA 3KNGA 4DR6K 2DNZA 2MHNA 5BYSA 2IHR1 3FQKA 4H5VA 5AFUA 1Z25A 4NASA 4AHSA 4P75A 2B51A 3J7YU 4CM0A 2Q3SA 1GTHA 1ICEB 5HOOA 3GJTB 4MYUA 2VODA 2YKQA 3D28A 5J1EB 1VLYA 2SXLA 1H1VA 2PDAA 1S9GA 2CGKA 3PLAA 2KQ2A 4M7YA 4K4YA 4NA3A 3DM2B 1C0MA 1I3OB 1N5VA 1XNRK 2YKNB 2B6AA 4LSNB 3WXLA 3CT9A 1ULRA 3VAIA 4KHMA 5M2RA 3MMBA 2NRTA 4USUA 1XEZA 5AQKA 1I1GA 1SL1A 3D67A 1WSRA 2PGCA 3CJQA 1TZ0A 3HJFA 5F0UA 3TR5A 3ULDA 3T9NA 2F65A 4A8KA 3CHWA 3M8QB 3WC0A 1NGCA 4W92B 2Y0BB 4MYTA 4F26A 3RB6A 3JSRA 2V2VA 4TU8A 1C0UA 4DQPA 2F9DA 3EUNA 1Q78A 3WQPA 3VETA 4LR8A 1VQLS 1FXDA 5BR8J 1RTZA 1RADB 2QA4G 3DC2A 1T8EA 2GO9A 1N36J 3O9UA 3BF4A 3GFYA 2KKZA 2WVCA 5HBMA 2GJFA 1E4FT 4ZVHA 3K0SA 3I0SB 3ZNUA 4KHUA 5J1NA 1OQ6A 1HUXA 4RW6A 2R2SA 4X65F 5AQTA 1VHIA 2BE2A 4N8OA 3IGVA 5ITHA 4X4VA 5IM0A 4QS9A 1RTHA 4KFBB 2DR8A 2CH6A 1CJUA 4E1MA 4QCLA 4YQWA 1HI1A 4U7BA 1MNEA 2IM3A 4IBNA 1CJTB 5J2NB 3LO3A 4BCAA 4JS5A 3GIRA 1SVDA 4WFNQ 4CHNA 4I6YA 3AV9A 2DIUA 1LWEA 5KPTA 2ZVIA 3OFEA 3L3CA 3P6YC 4CJSA 4YUDA 1BL3A 4HTIA 4EEYA 3AARA 5ETPA 3T6JA 1VK0A 4RW9A 1YRXA 1T05A 1M5PC 3T5LA 4BRKA 3R1HA 1X4DA 1IKXA 9RUBA 3GONA 4ZP8A 5KFGA 3K2YA 2R7XA 4C8KA 5AQSA 4A61A 4C3MA 4P2SA 3IDHA 1HNIB 2LXFA 4O3RA 3QICA 4OZNA 2FJBB 3SMPA 4F4WA 2BQRA 1MWZA 2E1PA 1RBOB 1YXQA 5AFUH 2HMIA 1LCUA 3F44A 2GC8A 2YKAA 2WK4A 4K5SA 2ZZNA 1VQNN 4IUFA 4M5IA 4U8VA 5D15A 3OHBA 4TQSA 4C11B 1NGBA 3BDEA 1UZDA 5C15A 1WC3A 3MMBB 4WFBL 1AZSA 3A3PB 3KDOA 4LF5K 3AOCA 1FRLA 3EE8A 5H9FJ 3I5AA 3CQ8A 3TUJC 3LPTA 1UVIA 1BIUA 3DRPB 4CI0B 4A8XA 2K1RA 2AJQA 2UUBJ 3BH6B 2ALYB 4CVNE 1YTUA 1NDKA 2ZHBA 2KM8B 4FWOA 3U27A 3CCRN 2RIJA 3HP6A 3N28A 4FYXB 3Q89A 4PWWA 2YKPA 3CXCR 3PW4A 2MXYA 3NGSA 2J6UA