3LAMA

Crystal structure of hiv-1 reverse transcriptase in complex with n1-propyl pyrimidinedione non-nucleoside inhibitor
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV Reverse transcriptase
publication title N1-Alkyl pyrimidinediones as non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 149
structure length 553
sequence length 553
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lamA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lamA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lamA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lamA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lamA05
1J54A 4RW9B 3V6KA 3PHEA 4Y1CA 4N41A 3TANA 1KTQA 5KG5A 1T8EA 1TK0A 4FLYA 4IBNA 4C8MA 3NGZA 2I5JB 4M45A 4NLPA 1L3UA 1S1XB 1UA1A 3FQLA 3DMJB 4CGDA 4I2QB 4M3UA 2IOCA 2D3UA 1NKBA 5DGAA 3F9KA 5J2PB 2AGOA 3KLFB 2JGUA 3M9NB 3LAKA 4YR3A 4IDKA 3AO1A 3KK1A 4DL6A 3DRSB 3KK2B 1RBUA 1J53A 2Y1IA 1Z26A 3RB3A 4K4SA 4DU1A 2O4IA 3WNGA 3OYBA 3MXJA 5HLFB 2XI3A 1JLGA 3QLHA 3SUQA 4CF8A 3V6JA 2UVVA 4CGJA 4NCBA 4DL5A 1IO2A 5DQHA 1HYSB 2E6MA 4DL4A 3ZT4A 4M3WA 1RT5B 1TV6B 2QK9A 3DLKB 4PUOB 1EP4B 1ZTTA 1XHXA 3NH1A 3MECB 1S0NA 3DLEB 2R8HA 3TWHA 2HHQA 4B08A 4DTXA 1IKVA 2R2UA 3OS1A 4FJ7A 4CF9A 5CYMB 3CQ8A 5KT7A 3DOLB 2XI2A 3HVTA 2P5GA 4CEFA 5KG2A 3TAGA 3LP1A 1TK8A 1L5UA 1S4FA 4CGHA 3RMCA 4CFAA 3DRRB 4TYBA 1QUVA 3CJ4A 4O44A 4OKKA 4TY9A 4NLGA 2BDPA 3MR2A 1RT4A 4TXSA 3TVKA 4IR1A 3KHLA 2KFZA 3VQBA 3WNFA 1WAFA 2IM0A 2WCXA 2R8KA 3ZSYA 4TY8B 2EHGA 2ZD1A 3NF6A 1RT3A 4QWDA 2W9BA 2OH2A 4OGCA 5KGWA 3LDSA 2D5RA 4WFZA 3T19A 2ASDA 1F21A 3HT3A 4KB0A 4EYHB 3QNNA 3SCXA 3DLHA 4DL2A 2B6AB 4RZRA 4IFYB 2GBZA 3O3HA 2XY5A 5CYQA 1S5JA 3SYZA 2E6LA 3QYYA 4N56A 3KKSA 4FJMA 1MU2B 5KFDA 4Z4HA 1YT3A 3OHAA 3M9MB 2F8EX 3K5OA 2V4RA 1SL1A 3CJ5A 3MR3A 3ZT1A 1BCOA 2P5OA 4H4MB 1RT7B 4E89A 1RDDA 4H54A 2VG6A 4FXDA 1A5XA 2DPJA 1NK6A 1IM4A 1NJWA 5DG8A 4E7KA 3CVKA 2C28A 3CJ3A 2F8SA 1TAUA 4NYFA 4Q8FA 1RT6A 2JEFA 4I2PA 3AA3A 1JLEA 4OVLA 1U45A 1NJZA 1RTIB 3BREA 3KNAA 4J9SA 3DI6A 4YR2A 4X2BA 4LH5A 1KFDA 3ZSWA 4NLYA 2UVUA 3SQ1A 1SUQA 4RNMA 3KK3A 2PYLA 5L1KA 3LP3A 2R8IA 2FC0A 3OYNA 4IRKA 3DRPA 1TVRA 4B9SA 1QSSA 5DG9A 3OSNA 5C24B 5KRTA 1TKTB 5KFLA 5C5JA 1UOCA 5F8HA 4I9LA 3PJXA 4RW6B 3BGRB 4IG0A 4HCCA 1A5WA 5KFGA 4KI6A 4EO6A 3K59A 4FLTA 1LW0B 2HVHA 3DOKB 3DLBA 4BE1A 5EDWA 4FBTA 3AO5A 2YNFA 2F96A 3V6DA 3ALYA 3K58A 4E7JA 4O0JA 1C1CA 1T94A 3HJFA 3PW2A 1RILA 3MR5A 3QIPB 1S6QB 4KI4A 2HHTA 4M3ZA 1W25A 2IGIA 3C94A 2A1SA 4O3RA 2G8IA 1HMVA 5SWMA 5HROA 3MTKA 3WNEA 3RRHA 4O3OA 5KG7A 2YNIA 3QEPA 5DQGA 2HNZA 3NBPB 5F8GA 3SUPA 4ID5B 5J2QB 3EZUA 3BR9A 2AU0A 3S3NA 2RF2B 4ZP9A 3KLIB 2WRMA 3VQ7A 3N6MA 4CIGA 3Q8PB 3SFGA 1JLAA 4QWCA 3CM5A 4AHUA 1S10A 4NYNA 1WSIA 4E1MA 2OPQA 1LWFB 4CEAA 1S0MA 1UWBB 1T03A 1RBSA 2FBTA 4L8RB 1TL3B 3UPFA 4CHOA 4Y3CA 2D0BA 2IS3A 4BWMA 4OJRA 1S1TB 1WSFA 3DLGA 3NE6A 4KRFA 4U7CA 3VQ8A 2E9TA 2G8HA 5L9XA 1CXUA 2BRKA 3QO9A 3AVHA 1BI4A 1TKDA 4MK9A 3OLBA 1SH0A 3PVXA 1S49A 2OA8A 2I1RA 2HNYB 3SPYA 1U4BA 1RTDA 2C2EA 1R0AA 4J9RA 3O4NA 3BQ2A 4AH9A 3CDEA 2HWHA 2XWYA 3I5BA 2IAJA 3DYAA 4KPYA 4CJ4A 3THVA 4BE2A 4NLOA 4FW1A 4MK7A 2KZMA 4RW7B 5L1IA 4QW8A 3K5NA 4ZMMA 4KFBB 1HRHA 1IKWA 4Q44A 3V1QA 3BSAA 2XCPA 1JXEA 4KHMA 1C0MA 5KFEA 2YHAA 3LP0B 4K4UA 4B9UA 1SV5A 2ETJA 2GIQA 4Z4IA 1TKXB 4CJVA 4W5OA 4J2EA 4B8CA 4ZVHA 2YKNA 4CHZA 1S1WA 3UDLA 3OLAA 1HARA 1K1SA 4FK4A 1KVCA 3ZT3A 1QE1B 1XHZA 1CSJA 3MEEA 4FJ8A 1SKWA 4PWDB 1KHWA 4KO0A 1VRTB 3NL0A 4Q0BB 3G6XA 3VN5A 4C8OA 1T3NA 1DTQB 3HPGA 2R7YA 2BGGA 3SUNA 3I0SB 2Z1GA 2R2SA 1IKXB 2DPIA 4Z4CA 1LAWA 3LP2B 4KB7A 2LSNA 5F9NA 4KKOB 1L3VA 1C0TA 4ICLA 3PJWA 2BR0A 1ASUA 3NHGA 3IG1B 4ZVGA 3VQQA 3UIQA 5L1JA 5KFRA 3CO9A 2YHBA 4FJ5A 3N6NA 1JKHB 4CJQA 3MF5A 3VQ9A 4KV8A 3OYHA 3KD5E 5DLGA 4DFJA 4ZTFA 1LWEA 1HPZA 3KLEA 4CEEA 4ZP6A 1FK9B 4DTMA 4R8UA 3HL8A 4O3NA 2ILYA 4ECYA 4PY5A 2JEIA 3DDKA 3WNHA 3IGNA 4TLRA 2ZQBA 4ECZA 1K1QA 1U09A 2RPIA 3PX0A 4M3YA 1KVBA 4IQXA 1VK0A 3ITHB 3C6UA 4RW8B 5KFYA 2X6SA 1HYZA 3KKRA 3AVFA 3V4IA 5HP1B 2HNDB 4J9NA 3T5HA 4O55A 4CF0A 3HKWA 4Z0UA 2YKMA 3PW7A 3RAQA 3ISNC 4O3SA 2RDIA 3V81B 5KFVA 4W5RA 3HP9A 2IBKA 2WHOA 2F8TA 1CLQA 4ECWA 3P1GA 1RBRA 4IDKB 3C6TA 3M8QB 1Q9YA 2W8LA 5KT4A 3GV8B 3QEWA 1VSDA 3RWUA 1BQNA 3OYLA 3CDUA 1IKYA 2G8WA 4GC7A 1VSHA 4LH4A 1GOBA 2FBYA 2IJNA 5CZ2A 1UA0A 1SKSA 1DTTA 3AVMA 3T3FA 3A2FA 2R2TA 5KFQA 1ZBUA 3P83D 4E1NA 1C1BB 4DTUA 3BDPA 2W9AA 5FDLB 3HYFA 4CJTA 5K14A 2BQUA 3OL6A 3SPZA 1IKVB 3HK2A 3OHBA 4K4YA 1VSMA 3HVTB 4DMNA 3P5JA 2XHBA 3OY9A 1BQMB 2XGPA 1ASVA 3AVNA 2FVQA 1WSJA 3I8DA 3MAQA 4FM1A 2HMIB 3LP1B 4JV1A 3QIOA 4B3OA 3SQ4A 1NKEA 3AVAA 2BANA 3JYTB 1DLOB 3LAMA 1JLBA 3HPOA 4J9QA 3SZ2A 3NF7A 5KFFA 4NLRA 2Y1JA 4B9VA 3KLGA 4CE9A 3SJJA 3TARA 4G1QB 2UVWA 1S9GB 5KFIA 1RT3B 1HNVA 4CECA 4HKQA 3M9OB 4EBCA 4HHTA 2C22A 2WB4A 4ECUA 4K4WA 5CYQB 4CHQA 1RCHA 3L2WA 2WONA 3N6LA 4BACA 2RKIB 3FFIA 2OZSA 2WTFA 2ZE2B 3BQ0A 4CERA 4Z4EA 5KFAA 3HO1A 2OPPA 4KSEB 4R5PB 4IOBA 4CGFA 2XGQA 4TQSA 3C95A 3DM2A 2V4QA 3MXIA 1U49A 1N6QB 2VG6B 3OYGA 2BQ3A 5C42A 3NMAA 4FYDA 4Y1DA 4FJNA 2IDOA 4IG3B 4MQ3A 3RBEA 2OPSA 2W8KA 3DI6B 4FJKA 2FVSA 4MIAA 4J9OA 1KRPA 3S3OA 2G8VA 4K4TA 4YP3A 1J5OA 4K4XA 4J9LA 4IR9A 3PW5A 4DSEA 4O4GA 3H4DA 4F4ZA 4WZQA 3SI6A 3L3VA 4DSJA 4NCGA 4RNFA 5KI6A 3CM6A 2IA6A 2W9CA 5HRSA 1NOYA 4CJRA 3DRPB 3V6HA 5F8JA 1TVRB 3OL7A 1O1WA 2D3ZA 3H08A 5JUMA 3V9XA 4DU4A 1JLCA 2RN2A 4CK1A 2C2DA 1HQEB 5C25B 3QERA 2UUWA 3KLHB 3GIMA 1WN7A 4ZPBA 2O5DA 4EP4A 3OYFA 1FKPB 4IKAA 5DGBA 3DMJA 2BQRA 1C1AA 4DLGA 1C1CB 2E9ZA 4B9LA 4LQ3A 3H40A 1LV5A 1ASWA 5J2PA 3G6VA 4GMJB 1NK4A 3OJUA 4DSFA 1HMVB 4K8XA 3KOAA 4B8AB 1RT2B 1RYSA 2YNIB 1RBVA 2AQ4A 2JC1A 4C8NA 4M94A 1GX6A 1NNDA 3OYCA 4W5QA 3KIOA 3NFAA 4DF4A 4E7HA 4Q43A 4BWJA 3O3GA 5FROA 2FJXA 4DTOA 1FXXA 4M41A 2X74A 1EXQA 1NHVA 4OGEA 3VQPA 1VRUA 4Q5VA 2R8JA 3ICLA 1HYSA 1RT5A 3IAYA 1JLAB 1NK7A 3L2UA 4PUOA 1EP4A 3HVAA 2R2RA 3ULDA 2OPQB 5T14A 3M8PB 2B5JA 4KB1A 4XIUA 3MECA 4M42A 3M8SA 4DFKA 4JUZA 2Z1HA 3HVWA 4NLWA 4EBDA 1TKZA 4Y2AA 1JXLA 1QSYA 2J6SA 1LW2B 5CYMA 4FW2A 2PYJA 3DOLA 3RR7A 5KFWA 4CFDA 4MFBA 3TAQA 5L1LA 5J2NB 1N48A 3QEXA 5D3GA 4JV0A 4OKEA 3OYKA 4KHQA 3QO9B 4F4YA 5T7BA 1BI4B 4ELUA 2XY8A 4DFPA 1XI1A 2WOMB 1S97A 5KFXA 3IS9A 1S1VA 1RTDB 1EKEA 4TY8A 2YNGB 4FZYA 1JL2A 3V9ZA 3TAMB 4JS4A 2VG5B 3OYDA 3EYZA 2BE2A 1RBTA 2Z1JA 4HYKA 4URGA 3QGGA 1IKWB 4ED0A 3NKYA 3MFHA 1X1PA 2W42A 1NJXA 1RTJA 1TL1B 1SH3A 4ZPCA 2B6AA 4CFCA 1NHUA 1EETA 3U6FA 5KFTA 4U6PA 4CESA 2DFHA 3CFOA 5KT5A 2IM2A 1HQUB 3CJ2A 1Q8IA 3SQ0A 3L2QA 3I0RB 4TYAA 3NGIA 3K5MA 2YKNB 4ZHRA 4E19A 4F4XA 1TAQA 2P1JA 2XCAA 5HRNA 4DG1B 1JLQA 3OS2A 1QSLA 2B43A 3MEEB 3T5KA 3VQSA 1B9DA 1N5YB 3KMQA 2GUIA 5DK5A 3V1OA 3ZCMA 2ASLA 3RBDA 4B9NA 1GOCA 5KFJA 5KG4A 4HTUA 4NLVA 4LY7A 3SV4A 3BJYA 1K6YA 1RTIA 1KLNA 5HBMB 1TGOA 4DTSA 4ICLB 3JSMB 1WSHA 1N56A 1OS5A 3G0ZA 2IM3A 4M3RA 1WAJA 1JLFA 4NRTA 3CFRA 1WNSA 2B4JA 1XR6A 1L3SA 5F8LA 1JXBA 4CHNA 4RW4B 1HPZB 1KSPA 3IRXB 1TKTA 3EPIA 4ZVEA 1HNIA 2VA3A 3BGRA 4NCAA 2KFNA 3ZT2A 4J2BA 4IFVB 5I3UB 1HJRA 3S9HA 1RAJA 1JX4A 4WYWA 1W9HA 1I6JA 4KHRA 1RYRA 4XO0A 3QESA 4FLVA 4WFYA 4LQ9A 4CK2A 4W5TA 3PW0A 4DQSA 2A1RA 4QW9A 4O4RA 1S9EB 2D7SA 1SH2A 3GV7B 2E9RX 4LSNA 3D0PA 3V4IB 4FLWA 1X9WA 3ZSOA 2YKMB 3KJVB 4KAZA 3ISND 4QCLA 3K57A 3IGVA 3NBPA 2HAIA 4JS5A 4ID5A 5J2QA 3TAPA 3NGYA 2OZMA 3H5UA 2CJQA 3ASMA 3M8RA 4OPJA 4ED2A 1D8YA 2RDJA 4F4WA 1U04A 3AVCA 3L2RA 4RUCA 5DG7A 4J9PA 3C6TB 1ZBHA 1S1UB 1QQCA 3SUOA 4DF8A 2WK4A 3D28A 3CG7A 4DQQA 3FRZA 4AHTA 3GV5B 2FJVA 1RT1A 1VSEA 4DTNA 3EY1A 1S6PB 4Q8EA 4HUEA 4R0EA 4FM2A 3H59A 4C8LA 4CGIA 3K2PA 4G3IA 1S1TA 4MIBA 4YR0A 3AVBA 3NGDA 1LWCB 5KFSA 4N5SA 4ZVFA 4ED1A 2JLEA 4W5NA 4M95A 4ED7A 3OSPA 4NRUA 3OS0A 4CCHA 4FM0A 4NLSA 4FLZA 4FLXA 4TSXA 4FK0A 4BDYA 4TQRA 3HXMA 2VG7B 4BE0A 2ASJA 4DLEA 1ZYQA 3U3GA 2GIRA 3LZIA 4LSLB 2HNYA 1C0UB 4H4OA 5JS1A 1Y97A 4ID1A 4N76A 1YVUA 3E01A 4FS2A 1CZBA 3OYAA 5KFKA 3T1AA 4OL8A 3LWLA 3HP6A 2HB5A 1S48A 5FRMA 4FLUA 4OKJA 2YNHA 3KTQA 4GW6A 4DEZA 2IMWP 1JLBB 3UR0A 3NAEA 4IH7A 4CJKA 4FJHA 4ZPAA 2JC0A 1TKXA 3OL9A 3KLGB 3GIKA 1EX4A 2AGPA 3MEGA 3AO4A 1N4LA 3EPGA 2FLPA 1NJYA 1HNVB 4FJXA 4I7FA 4NLTA 3O4QA 2FVRA 2UVRA 1QE1A 3D5MA 3BQ1A 1BIZA 4F3TA 3U3YA 4EP5A 3KK1B 3MEDA 1VRTA 4Q0BA 1RTHA 2WONB 1DTQA 3V9SA 3RMDA 4WZMA 4QOZB 3FFIB 4KTQA 3TAFA 4ZP8A 3I0SA 1JLGB 3QLHB 1GX5A 4BDZA 2HHSA 1IKXA 4PQUA 2W7OA 4XPEA 3LP2A 4KKOA 3DM2B 2VA2A 4LD0A 4J2AA 4WE1A 1Z4UA 3IG1A 2QV6A 3PX6A 4H8KA 4CHYA 3VQCA 3UQSA 3HVRA 1VSJA 3NCIA 1JKHA 3V1RA 4RNNA 4BDPA 3L8BA 3AVIA 4J9MA 2EX3A 4J2DA 4URSA 2OPSB 5JS2A 1TK5A 2V9WA 4FBUA 5F8MA 4EO8A 2FLLA 4ECRA 2HVIA 2AJQA 3RAXA 4KTWA 3MXMA 5KG3A 2V0NA 4O44B 3RMAA 2P51A 1RNHA 1CZ9A 4O5BA 4NCGB 1REVA 1BGXT 5SZTA 4CFBA 1RT4B 4CK3A 1QS4A 4Y2CA 5J2MA 4YMEA 3KLVA 4DTRA 4CIFA 5F9LA 2ZD1B 4EYIB 3OJSA 3AA4A 5J1EA 2W9BB 3QGIA 3AVKA 2DTUA 2FVPA 2HW3A 5KFUA 1C6VA 5CZ1A 5HP1A 3PR4A 2HNDA 4CJEA 2J6UA 3NDKA 2FJWA 2OPRA 4KAIA 4CHPA 1XC9A 4OPKA 3V81A 4CJSA 4YQWA 3NF8A 2OYQA 2XC9A 4F2SA 4CJ5A 4OLBA 1D5AA 2GV9A 4RNOA 3H5XA 3I5CA 3M8QA 4CJPA 4FJ9A 4WFXA 2ILZA 1X9SA 1QTMA 4F8RA 3LWMA 5I42A 1XR7A 3PV8A 4JLHA 3OVNA 1FKOA 4URQU 3Q8RB 2ITGA 3CWJA 4KREA 2IM1A 1RT6B 4I2PB 1JLEB 1VRUB 3GILA 4FZZA 4FZXC 3NF9A 4IH5A 4Y34A 2QKBA 2PZSA 4CJ3A 2IC3A 4IRDA 1SL0A 1C1BA 3SFUA 2B5JB 4QWEA 2ALZA 5KT3A 5FDLA 1SUQB 4ECQA 3AVGA 3LALA 3KK3B 4FJIA 1TKZB 4CEOA 4KHWA 4K4VA 1VSIA 1NOZA 2VWKA 3PO4A 1Q9XA 1L3TA 4CIEA 1BQMA 3KHHA 4MFBB 3H98A 4CGGA 2QE5A 4XPCA 1KLMA 1S0OA 5D3GB 2HMIA 3HPHA 3I5AA 1T05A 3VQ4A 1ZBIA 4HUGA 3Q8SB 4IG0B 4RW9A 1A5VA 4JRPA 3JYTA 1DLOA 1YVFA 4IKFA 3PX4A 3FDSA 3IS9B 2I5JA 1S1VB 4CEZA 1S1XA 2YNFB 3V6DB 4G1QA 2FLNA 4KHYA 1S9GA 4I2QA 2ZKUA 2BE2B 4B9TA 1RA6A 2HHXA 2CKWA 3MFIA 3PO5A 2R8GA 3ZSQA 4FJGA 3B6OA 3KLFA 4O3QA 4FJLA 1RTJB 2FVCA 1I3AA 4B9MA 3DRSA 3KK2A 5HROB 1EETB 4KHSA 4KHUA 4FVMA 4CEDA 3TI0A 3HM9A 2HNZB 1RDRA 2RKIA 3LANA 5HLFA 4QWAA 1YTAA 3NAHA 2ZE2A 4CJUA 3NAIA 3QEIA 4ZHRB 3Q8QB 1KHVA 4R5PA 1JLQB 4Z4GA 1BISA 3AO2A 3OYJA 4J9KA 1N6QA 1TV6A 4AHVA 4KTZA 2JEJA 3DLKA 3D45A 2KW4A 4WXOA 4DU3A 3QINA 1Z25A 1T03B 3BSNA 4FJJA 3DLEA 3O3FA 3GYNA 4IG3A 2FBVA 5KT6A 1D9FA 3DLGB 1ZTWA 1BIUA 3ZSVA 1GOAA 3TQ1A 3RMBA 4DTJA 2QKKA 3T5LA 1KVAA 3VQ6A 4RNHA 3DRRA 4NLDA 1JIHA 4RU9A 1JLFB 1TQLA 3QEVA 4ECSA 3QNOA 3OL8A 2AX0A 3MR6A 3AA5X 2VWJA 1R0AB 1HYVA 2AGQA 2IAJB 3EZ5A 3DYAB 3AVJA 3H5YA 1HNIB 1HQEA 5C25A 3QIDA 1I39A 3PUFA 2XO7A 3TAEA 2D41A 3KLHA 4PA1A 3ZT0A 2KZZA 4IFYA 4CF2A 2GC8A 4HCBA 1CXQA 1FKPA 1ZBFA 4F2RA 4CF1A 1MU2A 1SV5B 4K50A 1WLJA 4QAGA 1S1WB 2AWZA 3QETA 4FCYA 3E51A 4NYZA 4F50A 1VSFA 4F4KA 1RDCA 3S3MA 4LSNB 3H2LA 4DSKA 1RT2A 4H4MA 1RT7A 3CDWA 5KFMA 4DQPA 1SKRA 4QWBA 4DWIA 1WNEA 3V9UA 4KO0B 2FBXA 2Q3SA 4CJWA 1IH7A 4RG8A 3VA0A 3K5LA 3QGHA 4KHNA 4UQGA 5KFHA 4CEQA 2G8FA 3G6YA 2ATQA 3H4BA 4HVJA 3HSTB 5HRRA 4E7LA 5F8NA 1KCFA 5KGXA 3AV9A 1C0TB 3M8PA 4GC6A 2NUBA 4DTPA 5HRPA 2D0CA 4WXWA 2W7PA 1RT1B 3VA3A 4DS5A 4K8ZA 3G10A 4CEBA 2HHWA 3ZSXA 1LW2A 1QAJA 3RB0A 2DFEA 4M3XA 4AHRA 1WSGA 3SNNA 2HHUA 4KV8B 5J2NA 1QAIA 5C24A 1LWEB 3HHKA 3KLEB 1NK0A 1RDBA 4DFMA 3KD1E 5CY4A 4EEYA 4R8UB 4EZ6A 5DMRA 3VQAA 4RW6A 4EBEA 3ZSZA 1U47A 4E7IA 1XR5A 3L2VA 3NH2A 2WOMA 1LW0A 4ED8A 1T7PA 3DOKA 3B6PA 4ELTA 1NK5A 4H4OB 5KG1A 4MKBA 2YNGA 3E01B 3TAMA 2VG5A 3RB6A 1VSLA 1BL3A 3QIPA 1S6QA 3C6UB 3ZSRA 4ECTA 2YV0X 4M3TA 2G8KA 4Q45A 1TL1A 3H5SA 4MKAA 4RUAA 4AHSA 2YNHB 2XY6A 1J9AA 3GQCA 3RTVA 5EUHA 1SL2A 4FS1A 2QXFA 1HQUA 1ITGA 3I0RA 1UAXA 4DS4A 3MEGB 4QPXA 3KHRA 5KFOA 3QZ8A 1G15A 4E3SA 4Z4FA 3LPTA 1BCMA 4DG1A 2RF2A 4I7FB 1XWLA 3KLIA 1U48A 4JV2A 1D9DA 1D1UA 4ED3A 1N5YA 3MEDB 5KFZA 1LWFA 1RTHB 1BQNB 5KFCA 1UWBA 4YFUA 3NH0A 4K4ZA 3AA2A 1IKYB 1TL3A 4PQUB 4NLXA 1LAVA 4O3PA 2HWIA 3KMSA 1BHLA 4F3OA 4DL7A 2IJFA 2HHVA 5HBMA 4DSIA 1IG9A 2ATLA 1DTTB 4CJLA 1NKCA 4IH6A 4NLQA 3JSMA 4WE1B 1KFSA 4DL3A 3PZPA 3AO3A 1NK9A 1W0HA 3VQ5A 3CIZA 4IRCA 5EWGA 2BRLA 2JEGA 4GVMA 5K14B 3CYMA 3GIJA 3SQ2A 2X6NA 4RW4A 3V9WA 4DQIA 3IN5A 1TP7A 5FRNA 3IRXA 3GIIA 2KQ2A 3CJ0A 5KFNA 4NZ0A 3LZJA 5F8IA 1X9MA 2C2RA 1B92A 4C8KA 4ED6A 4RW7A 4KFBA 1D0EA 4ZP7A 4B3OB 3OYEA 4IFVA 5I3UA 5EWEA 4AILC 1REVB 2BANB 4E0DA 5J2MB 2E4LA 3RB4A 4AHCA 3LP0A 2XRIA 4YNQA 3DLRA 1S9FA 2J6TA 5KG6A 4OLAA 1S9EA 5J1EB 1NK8A 5JXSA 5EWFA 3BSOA 4TN2A 2EC0A 4ZTJA 4CJFA 2G8UA 4FK2A 3KJVA 4PWDA 2OPRB 3G86A 4HUFA 3L3UA 1WSEA 1C2PA 2KTQA 4DSLA 3PR5B 4NLUA 3PY8A 4MH8A 1MMLA 4ZPDA 3SI8A 3FSIA 1RDAA 2XY7A 2OPPB 3VQDA 4WYLA 3BSCA 1VSKA 3F73A 1S1UA 4JRQA 3PW4A 4I9QA 3TR8A 3AVLA 3VQEA 3RRGA 5I42B 5KRSA 3KHGA 5DQIA 4KE5A 5KFPA 5C42B 1S6PA 5KFBA 4KBIA 5KG0A 1FKOB 2UUTA 2O4GA 3RR8A 4EZ9A 5KT2A 2DFFA 1LWCA 4ECXA 3TABA 4ECVA 4DQRA 1FK9A 2Z1IA 2IC3B 1B9FA 4MK8A 5E41A 2X78A 1J5OB 2VG7A 2D0AA 3CFPA 3OYMA 4O4GB 5EU7A 3FQKA 4LSLA 4N47A 3SV3A 1C0UA 4ELVA 1YTUA 2W9CB 2PY5A 3QZ7A 1ZETA 1JL1A 4O0IA 1KLMB 2AX1A 5KTQA 3OYIA 1RA7A 5DLFA 1T05B 2DY4A 3ITHA 3T5JA 1QHTA 1JLCB 4RW8A 1ZBLA 3LPUA
chains in the Genus database with same CATH superfamily
4K59A 2KU7A 1WEXA 2NR0A 4M45A 1UA1A 4OV6A 3CB4A 3DMJB 1AFIA 2J9CA 2YHXA 2D3UA 1NKBA 2MQLA 5DGAA 3LDNA 3HOTA 2EVZA 2AGOA 3KLFB 2N4CA 3M9NB 1YIJN 3BKTA 3KK1A 3DRSB 1YQHA 1TYQB 4FKYA 3O80A 1AUDA 3OYBA 3MCPA 3QLHA 3VEOA 2IMOA 3SUQA 4O0NA 1I1GA 2UVVA 3OW2R 4KH6A 1OH5A 4JK7A 4C97A 3C65A 1PGZA 4C8YA 5RUBA 4DL5A 3UE5A 1GMWD 2QK9A 3DLKB 1NMEB 2W25A 5AZIA 4PUOB 1EP4B 1O8BA 3IP0A 2CJAA 2MKYA 2V52B 4A5BA 3NH1A 3MM8B 3D54A 2HHQA 3KDNA 5CYMB 3DOLB 2P5GA 3HD1A 4CEFA 4K0KF 5KG2A 4WCEQ 4CI0B 4G1IA 4DV3K 1YJNN 4NLCA 3G6EN 1TK8A 1L5UA 3ZZYA 1NH7A 1IBMJ 2IHR1 4DV2J 4TY9A 3C16B 1Y3JA 1RWNB 2C42A 3MR2A 1RT4A 3B4DA 3TVKA 4IR1A 2J7UA 3WNFA 4PXCA 2IM0A 2WCXA 1YZ6A 4TY8B 2MQNA 4QYZK 1KR4A 3E8OA 4YOWA 4YOYA 2W9BA 2OH2A 3DGPB 4OGCA 1VQ9S 1B4SA 4LC9B 2D5RA 4NB4A 2ASDA 1F21A 3D2WA 4RZRA 3MCAB 2XY5A 3PNIA 3O3HA 4BRNA 2E6LA 4CP5A 3ENOA 4FJMA 2B7BB 1YT3A 1IWAA 2DGUA 1SL1A 1Z05A 1YF5L 1RHMB 4B3MJ 2P5OA 4FDFA 5IZHA 4FWLA 4KQZA 3R5AA 1VQNS 3TUIC 2IBOA 5KPRA 1S3XA 1RSCA 3BGLA 2GMHA 4JI4J 1TAUA 4HWIA 2JNJA 3AA3A 1NJZA 5D4PA 1RTIB 2WBMA 2OMLA 4J9SA 5L38A 3DI6A 4YR2A 1CC7A 3G87A 1K73T 2ZWOA 3RBZA 4NLYA 3SQ1A 4DR7K 2CPZA 3J81O 3PJ9A 2MB0B 3KK3A 3KG0A 2PYLA 1FHTA 5I9EB 5L1KA 3LP3A 1PAEX 4F67A 3OYNA 1R7IA 3O5TB 4XH4A 1TVRA 3HLUA 3MCMA 1QSSA 5IQQA 3OSNA 5C24B 1UFLA 3D7EO 2UP1A 4A46A 4Q7AA 1A9NB 3LGMA 5E3CA 1UOCA 4IG0A 1A5WA 2DXEA 4TVAB 5KFGA 3K59A 1XMOK 1LW0B 3DOKB 4EFHA 3DLBA 3TWZA 2JHEA 4B1YB 2YNFA 2LCWA 3ALYA 3NXZA 1IBMF 4DV2F 4E7JA 1C1CA 2QRRA 3PW2A 3QIPB 4KI4A 2B8PA 1X4HA 4M3ZA 2IJRA 1W25A 3ET6B 2JRSA 4O3RA 4UY8O 3RRHA 2YNIA 5DQGA 1UEKA 4ID5B 3ID6A 2LA6A 2RF2B 2FHJD 3BF1A 1U1QA 3TQEA 3KLIB 5CH7B 2WRMA 1WOQA 4WFAQ 3N6MA 3CM5A 4V1Ak 1WDDA 3I87A 1S10A 3L6QA 4NLBA 3R6LB 4CZHA 1LWFB 2MTLA 1B7FA 3AJ2A 4B3MF 1WTBA 1RKJA 1N8RT 2ZH4A 2HOEA 1EHWA 4Y3CA 3M2UA 3CO0P 4F04B 4OJRA 5A0YA 3DLGA 4CO5A 5AQLA 1AT1B 3TZYA 4JI4F 1RWXB 5E7OB 2Z56B 4LRAA 5C12A 2XO6A 1BI4A 3CGIA 4FWSA 3R8EA 2X3GA 5LM7E 1FD2A 1NDLA 3I5BA 3ULHA 1MMDA 4CJ4A 4BE2A 4NLOA 1HKBA 4I6AA 4MK7A 4QW8A 3K5NA 1J5EJ 4B3SK 3V1QA 2BKOA 1WF1A 2XCPA 3GE9A 1JXEA 4KHMA 4C3LA 2YHAA 3LP0B 3G96A 2VGNA 2O01C 2ETJA 2XSJA 2D3OR 4J2EA 4B8CA 4ZVHA 4PKIA 3BR8A 1K1SA 4LR9A 1YI2S 3MEEA 4FJ8A 1SKWA 4PWDB 2ACMA 5ETTA 4QR2A 3WX4A 1N36K 2R7YA 1NU4A 3I0SB 3MAAB 2R2SA 3G4SN 1S6OA 1IKXB 1ZA2B 2HAFA 4UQTA 5GAGU 3POTA 3DLJA 4Z4CA 1LAWA 3LP2B 2ADBA 4X4OA 2LSNA 1ULRA 2CG8A 3CCVS 3NHGA 4ZVGA 2AA4A 1WKJA 5CXTA 4LFAJ 4AUKA 1JKHB 2DNOA 3F56A 3I96A 2P9NA 1WC6A 1I5OB 3OYHA 3T1HK 2Q0RA 4M7XA 4DFJA 4CT8A 3KLEA 5LMUJ 3TA0A 2ATCB 1FK9B 2E2QA 4DTMA 1WUUA 4ZLLA 3AY9A 4R8UA 3G8TA 2E2PA 4QU6A 5AFUH 3AQPA 2KB2A 3JS9A 1WHVA 3P39A 2W4PA 4NE9C 3EJMA 5HVHA 4A2BA 4EUVA 3PX0A 3BY5A 3HULA 1O51A 4M3YA 1FJGJ 1Q5VA 4IQXA 3ITHB 2PAVA 3KKRA 1YWXA 3NOCA 4K43A 2H9ZA 1FRIA 1MWYA 4AYBD 3T5HA 1SKUB 2YKMA 3CCRN 3OVSA 5D78A 2MLXA 1JJ2M 4C0OC 2RDIA 3B54A 5H9EJ 4LF8J 1H7WA 4UTGA 3HP9A 1P9QC 5JMVA 1NSQA 4DZ6A 1CLQA 1GMUA 2ZF5O 2OD6A 1MN7A 5H1SQ 1IUJA 2C3OA 3NCQA 3M8QB 1MROB 4C0HA 3TZZA 3UB5A 4C7QA 5AXLA 3J8AA 2GGPA 3CDUA 4MIWA 1VSHA 2BOAA 1SKSA 3WQPA 4KH5A 3BUZB 2CQDA 8RUCA 3A2FA 2R2TA 4E1NA 5FDLB 2CQHA 4LJMA 3HYFA 5K14A 1VJQA 2ZC4A 3SPZA 3VVUA 3RBXA 1BUPA 4K4YA 2C3YA 1MA9B 5FLXO 1GMVA 3OY9A 2XGPA 2DHAA 2FVQA 4DBQA 3EZOA 1E6VB 1QQNA 4H0XB 5C10A 1UP1A 1XC3A 2QLWA 1S0VA 3Q2TC 2E2NA 2ZC3A 4B3OA 3LF0A 4JKDA 3JYTB 2IYIA 5LMUF 5HOOA 3DXBA 3H8YA 1JLBA 4USTA 5G4DA 2NYHA 1WC1A 1NO8A 5KFFA 2DHXA 3W5ZA 4OYPA 3KLGA 1KQGB 2I7PA 3PSIA 1U2VA 1RQ0A 4ZPVR 4FF4A 2O8BB 5AXNA 4YN3B 4M5NA 2IY5B 3QT7A 3BH6B 2HBMA 1NUEA 3R8YA 3GIRA 3VAFA 1FJGF 3EXCX 4UY8T 1IBKF 4CHQA 2DH7A 2L08A 5K9FA 3FFIA 4QS7A 3ZX2A 2K8GA 5KFAA 2VFVA 1BUXA 4DOZA 1O0PA 5K8NA 1DURA 4CGFA 1YZ7A 1W97L 5HJYA 1SIZA 4DPOA 4LF8F 4BC3A 2Q97A 1V4SA 2BQ3A 3DDNA 3TEGA 1WG5A 3W66A 5E5NA 1M5PC 4Y1DA 1NGGA 4C23A 5HMYA 3W62A 3EGVA 2DHGA 2B0GA 4B9QA 1QDUB 4BVOA 1T9XA 3DI6B 4MIAA 2HMPA 2G8VA 2IDLA 2ZEJA 3CD7A 4NXMJ 2PEBA 4J9LA 2QL7B 4F4ZA 4WZQA 2XG8A 2GZOA 4G9ZA 5KI6A 3ENHA 3CM6A 1XUPO 4CJRA 2CDQA 2ZH7A 4IJNA 1N33K 2V8DA 1TVRB 3OL7A 4RCHA 1HL6A 5C2GA 5M2RA 3HZ6A 4BRPA 3RW6A 1VLOA 3FBBA 1VOMA 1H1VA 4HACA 4LF4J 3VGMA 3UR3C 1BC6A 5JICA 3JAMY 2J0XA 2UUAK 4DLGA 3FZHA 2NS1B 1C1CB 1P8GA 1NB2A 2NRZA 5J2PA 3QRRA 5I4MA 3G6VA 4WU3A 4KC5A 3L9ZA 3ENQA 3KOAA 4B8AB 2OEJA 3A3PB 2EK1A 2ZHAA 2DNNA 2YNIB 5C2DA 4DV4J 2Z2ZA 1IQZA 4C8NA 3KJQB 3MPYA 2J0SD 3NFAA 4DF4A 5HQ8A 2V6AA 2FJXA 1T02A 4M41A 2QLXA 1EXQA 4OGEA 3VQPA 1KEKA 2HFZA 1RWMB 2RHSB 1XERA 1RT5A 2AD9A 2DK2A 5T14A 4ZVRB 3MM7A 2ZH9A 3MM6A 3CCQN 2B5JA 3JXOA 2EFQA 4NMXA 3HVWA 4Y2MA 1WC5A 2J6SA 4Y6IA 5B0GA 1LW2B 2PYJA 3RR7A 3UDCA 3SSSA 3J7A1 4MFBA 5A0YB 5J2NB 1N48A 2XM3A 3AGKA 2KO1A 4P2FA 4ZCMA 1VFJA 2K3IA 3NGUA 2EKYA 1BI4B 2YWFA 2NYIA 4DFPA 3WEEA 2N7CA 2WOMB 3GSIA 3CCMN 3GSDA 5IV4A 2AF6A 2HK3A 1Z2LA 1T44A 4NXMF 3EWGA 2QT7A 3O6WA 1JL2A 4M5MA 2BE2A 4LF7K 2M9KA 1RBTA 2Z1JA 4HYKA 3QGGA 2W42A 4MKYA 1RTJA 4ZPCA 4CRJA 2B6AA 1F9EB 1NHUA 2QM1A 4FWPA 2OELA 2F9DA 3A5OC 3BS9A 2DFHA 2JOQA 5KT5A 4FVUA 2XSJB 2Z58B 1HQUB 3I0RB 1VQ4S 4OQJA 5ADXH 3OVBA 1TAQA 3MAHA 4LF4F 4BVPA 1JLQA 5JVHQ 3H6EA 1QSLA 3EE8A 4YB1P 3VAHA 3MEEB 3T5KA 2MLYA 4GVBA 3UNYA 1H73A 1C4AA 4F4AA 3S01A 2IVNA 2NLWA 1GFWB 2BZ2A 5KFJA 2V8HA 1SQKA 2ZOGA 3BJYA 4DV4F 4NOHA 3FZKA 3POTB 3CD6N 3K9JA 2F9TA 1SQGA 3OFGA 1XMBA 4IXCA 1UJ4A 3ZXWA 1WAJA 1JLFA 3CFRA 3CQYA 2BJ8A 2E8AA 3OA9A 2M3DA 2EI5A 3TO8A 4LRBA 4CZCA 5EVZA 4FWKA 3BGRA 1OWXA 4L3KA 1UW4A 5AQTA 4J91A 3ZT2A 4J2BA 1QVGR 2AYBA 1HJRA 3IAS9 1W9HA 4HVZA 3N01A 4WFYA 4BHQA 3TTCA 3Q8YA 2E9RX 1K9MO 4U7UD 1HI8A 3OT9A 4PKHA 2OSQA 4LF9K 3BEXA 2YKMB 4QCLA 2VPZB 2M5YA 2W01A 3QAEA 3K57A 3IGVA 3NBPA 4CIOA 5J2QA 1SC6A 3M30B 3OQ2A 2CJQA 3PM9A 3M8RA 3UKRB 3FUYA 3A5MC 3Q23A 1GAOA 4F4WA 1U04A 3PYFA 1U6BA 3L2RA 4J9PA 3TR5A 2F4VK 5BR8K 2HBKA 2GGPB 1TELA 5D0RA 3EY1A 2X51A 2OGUA 2FLOA 4FM2A 2KT3A 4G3IA 4YR0A 7FDRA 4M95A 3OTEA 4NRUA 4X84A 4DLEA 2QTDA 2GIRA 4LSLB 1U1RA 2QLBB 2AJ4A 2ZH3A 2H54B 1YVUA 3FSXA 3HF5A 4FS2A 2MPUA 4JKGA 3OYAA 4OI4A 4JI3J 1WOPA 1NGEA 4BS2A 4OJGA 3L3CA 4WFNQ 4OKJA 3HOSA 3IBFB 2MKSA 2IMWP 1BD6A 1JLBB 2PMHA 2YVSA 4ED4A 3NAEA 2G1HA 3IAM9 1B0VA 2ZH8A 3KLGB 2AGPA 1N4LA 5E3AA 2FLPA 4DHVA 1X0PA 4JI5K 3MN9A 4KRWA 4FJXA 4ATNA 4PXBA 3O4QA 2UVRA 3D5MA 4RWTA 4B3TK 4UOFA 3JAMU 4DPWA 2R7WA 1DTQA 1RAOA 5DM7Q 3CHWA 3V9SA 4QOZB 3FFIB 1DQ8A 4ZP8A 6FD1A 2RHQB 3S41A 4BDZA 2YPYA 3GBTA 4LF6J 2CQGA 1NDCA 4M5GA 4MAKA 2GWKA 2AYGA 2DISA 1W2IA 4RWXA 2QV6A 5AQIA 2UXDJ 3VQCA 4JYAJ 3HRGA 3NCIA 4RNNA 4CJ7A 1M5HA 5E2QA 3R5BA 4HT5A 4URSA 3UE2A 1TK5A 3EXYA 4OYZA 5F8MA 1Y0HA 5F0WA 4EO8A 1G1XA 3VF4A 3Q2SC 2ZH2A 5LSRA 4ECRA 4JI0K 3DRXA 4KTWA 1PO6A 3H90A 3U1NA 1SB6A 4ED5A 5IXUA 1FRJA 1KAYA 2P51A 1REVA 3W2VB 1TL4A 2R7UA 3CCMS 4DTRA 4CIFA 2B51A 2I6WA 1YGYA 3AA4A 4V19X 2FVPA 1NGHA 2A10A 1C6VA 3HMJG 3PR4A 4LRDA 3ATUA 2CQ2A 3LPYA 3MCNA 4A61A 2DNZA 1Q4RA 2OPRA 1MWZA 2GTDA 3N4WA 4JI3F 1FNXH 4CJSA 3CD5A 4YQWA 3JTOA 2YH1A 1T95A 1HNWF 1N5TA 4F2SA 2RILA 3MMJA 3TUJC 4RNOA 2D74B 3H5XA 2V2KA 1HKGA 3O4WA 3TUZC 2ILZA 2GVDA 4EMDA 2RRAA 4WF9Q 3CC2N 4CW7B 4C8ZA 3PV8A 4JLHA 3RVCA 2IRYA 3Q8RB 5LXRA 1JJ2R 3TTFA 1AXQA 2P9KA 4LRFA 4FZXC 2IC3A 4OYXA 5LSOA 3MM7B 1C1BA 3MM6B 2B5JB 4QWEA 4ECQA 2ALZA 3LALA 4LF6F 4FNIA 4X4NA 4CEOA 3DLLL 1VSIA 3PO4A 2VWKA 3HT0A 2MLZA 4MFBB 3H98A 2UXDF 4CGGA 4CZKA 1R8BA 3Q24A 4JYAF 2QA4S 5EX5A 4LR8A 1T05A 1ZBIA 2DPNA 2F65A 5ETLA 2K7JA 3QBWA 1A5VA 4RW9A 4JRPA 1U0HA 1DLOA 2YWKA 3PX4A 1DQ9A 4BRHA 3MK6A 1FFGB 2DXFA 2OMOA 1S1XA 1CQMA 2AT1B 4CLKA 4G1QA 2FLNA 4FPAA 3VGKA 1G4CA 3DCAA 2BE2B 4JKFA 2KHOA 1RA6A 4LVOP 2CKWA 3MFIA 4JI6K 1KC8O 1WOSA 2J7WA 4JAXA 3UI3A 1RTJB 1AUSL 1K9MT 3KK2A 3VAMA 4KHUA 5AE3A 1K8KB 4W90B 3LANA 3B6BA 4HT7A 3NAHA 3D6TB 2W2OP 3PACA 2DGWA 2Q6BA 1KHVA 4LFBJ 4R5PA 2M2BA 1JLQB 1RUSA 3IM9A 1GNKA 2PIIA 4J9KA 4AHVA 2I38A 2JEJA 2IVFB 2KW4A 4WXOA 4LF5J 1T03B 3ADAC 2GCFA 3O1LA 3VERA 3NNCA 2LQ8A 4M5DA 1VHXA 3J7AN 2WBRA 2UXBF 2X1AA 1KOOA 1KVAA 3PEJA 3PFOA 2R3VA 3MMCA 1JLFB 1VI7A 4A62A 1Y9OA 5GAGP 3MN6A 5BPMA 3OL8A 3C46A 1MG7A 4GKJK 4M5JA 1N5QA 1N5VA 2AGQA 2IAJB 3DYAB 1W2BM 3O44A 3QIDA 1FDBA 2XO7A 5LJ5Y 4ILHA 2DR5A 5B0EA 2B9EA 3VGVA 2FSJA 4JHDA 3IBWA 2CJKA 5KOXA 1NU0A 4HCBA 3C3LA 4CF1A 1MU2A 3C8YA 3FMBA 4K50A 2NPFA 1YJWN 5CZVA 4YOVA 3EVWA 3FCWA 1S1WB 4DB3A 2AWZA 3B8AX 1VSFA 1RDCA 3H2LA 3MUMP 5KFMA 4WQ5C 3GE1A 4WQ4C 4KO0B 2FBXA 4CLLA 4OZ3A 5BXIA 3QGHA 5L39A 4UQGA 5KFHA 5C2CA 1RCOB 3X3UA 2DEJA 2G8FA 3G6YA 3SCLE 2GQCA 4HVJA 3CMAS 1YHQN 4PABA 1KCFA 3H45C 3AV9A 1NRKA 2GQQA 1C0TB 3M8PA 4GC6A 3ZFVA 3K17A 4DTPA 3CJ9A 2LQBA 4LFBF 4IUFA 5DZ7A 3G10A 1T6CA 3W9HA 3ZSXA 4QIGA 4DPYA 2YQ0A 2HHUA 1QAIA 4LF5F 1VCTA 3OR2A 1CULA 1RDBA 4DFMA 3OR1B 5GADP 3CE8A 5AXKA 3HHEA 5DMRA 2MYFA 4EBEA 5HJXA 1NDPA 1T7PA 1RHRB 2CQCA 3WHIA 1X3MA 3TAMA 2VG5A 4JKGB 2H5EA 2YV0X 4M3TA 4TLQA 2HZAA 4MKAA 2P9PB 2XY6A 4KYZA 3DAWA 5CHIA 3SQOP 2DHHA 1BE4A 5EUHA 1SL2A 1U2RA 5HSPA 1JWWA 4BR5A 1UAXA 2GO9A 4DS4A 3KHRA 3KWIA 1M1GA 5KFOA 4P6QA 4Z4FA 3LPTA 1S76D 1ZBTA 2NXEA 4BR7A 1T9YA 1CJUA 4EWTA 5D8HB 3R3TA 1U48A 3LGHA 2Q66A 1D1UA 3QJPA 1KOHA 4YFUA 1H38A 4DV3J 4CZEA 1TL3A 3VEVA 4GV3A 4O3PA 1S77D 2IRXA 2QWLA 1OH7A 1BHLA 2CGLA 2GVZA 1DTTB 3TTDA 3LPEA 5AT1B 3ULEB 1KFSA 1CJTA 2DT9A 3PZPA 1NK9A 4KH4A 1W0HA 4IRCA 4A5AA 3A3NB 4BRKA 5A8WB 5HVGA 2JEGA 4QYZJ 4DR6F 2CNNB 3FLCO 3GIJA 3W60A 3HSJA 4UT4A 3IN5A 3W7BA 1U1MA 3CJ0A 5KFNA 3LZJA 2A6AA 2C2RA 1B92A 2MKCA 3EE9A 3GCXP 4ED6A 1HD0A 4KFBA 5HQLA 2MQMA 4IFVA 1RADB 2HHPA 5I3UA 2XLKA 4AILC 1REVB 2BANB 4E0DA 1FT8A 3VF6A 5EN1A 3FR0A 3DLRA 3GDQA 1NPRA 3QATA 1S9FA 4JKCA 1S9EA 1NK8A 5EWFA 2YTCA 1KC8T 1RE1B 1DEJA 2EC0A 3QJLA 2VCPA 3PYDA 1S22A 4CJFA 3CMES 2OPRB 4HUFA 4RWWA 2JH3A 3L3UA 2RRNA 3U7JA 1C0GA 1WSEA 3THWA 2J5AA 3BN4A 4P7TA 4DSLA 1QD1A 2GW8A 1HX1A 3OTBA 1HI1A 1S12A 2OPPB 2QLFB 2FTRA 1D4XA 1FDNA 1VSKA 3F73A 1S1UA 2AZ1A 1RACB 3AVLA 1EQYA 2V8GA 3J7YP 2V2QA 5DDQC 5ETOA 2Q1NA 5KFPA 5C42B 4HDHA 2C3PA 2OIHA 3O08A 4RPFA 1VQLN 5KT2A 4ECXA 2XEXA 4F36A 2YQ1A 3MWBA 2A2DA 4DQRA 1XMOJ 2DNQA 4DV3F 2IC3B 1B9FA 1NBWA 4MK8A 1J5OB 2VQEK 2D0AA 4CO2A 3OYMA 4O4GB 5M1KA 4WU2A 2BUNA 2LU2A 4ELVA 1LNQA 2W9CB 2PY5A 3I4HX 2E7VA 4C2MA 3HSZA 1JL1A 1U1PA 3AOBA 4MDBA 2O8FA 3OYIA 3H2UB 5DLFA 1T05B 2DY4A 4X65K 1QHTA 2CXEA 3LPUA 3F41A 4WKRA 1FRMA 3TYTA 1WELA 1J54A 2CPEA 4EHTA 3ZETA 1BU6O 4RW9B 4C6AA 4N41A 3NGZA 1GMWA 4MMOA 2RVJA 1L3UA 1S1XB 2VFRA 4QR1A 4DR5K 1YJWS 4M3UA 4XTTA 1ESVA 2XMVA 2XZTB 1U1KA 4ZLPA 3KWMA 3A3OB 4YR3A 4YB5A 1DY3A 3AO1A 2FY1A 2JWLA 3DC2A 3KK2B 2DTJA 2YJEA 1WC4A 5CD4A 1Z26A 4ZN3A 1ZS6A 5F1XA 1J5EK 3MXJA 3PG9A 2XI3A 2IVPA 2CZ4A 4CF8A 2NZCA 2XMKA 1FVSA 4NCBA 4PKDB 2ZH5A 1IO2A 2AP1A 3P4IA 1GK8A 1HYSB 4M3WA 2MKJA 3MX2A 3ZZOA 3HHLD 4NEZA 4DR7F 1RB0A 3CUNA 1XHXA 1S0NA 2VBXA 3PXGa 3OS1A 2MZJA 2RQKA 3HVTA 3HHDA 4EI2A 1FXLA 3MI7X 3JXUA 1OH6A 3AB4B 3EZWA 1VBYA 1NGBA 3LP1A 3O9QA 3D66A 4UUXA 3CJ4A 4NLGA 2BDPA 2R42A 1XMOF 2CH6A 4TXSA 3KHLA 4USWA 1WAFA 2JDJA 2EHGA 4FZVA 4LFAK 2ZD1A 3NF6A 4CD1A 2OTJN 4ZK7M 1Y5NB 4QWDA 1UVMA 4BRDA 4NPOA 1FJ7A 1N36J 2R7TA 3BN7A 3QBCA 5GMKa 2V9KA 4WFZA 3T19A 4KB0A 4AM7A 3QNNA 3DLHA 4DU8A 4RU2A 4ISFA 4JHDB 5T41A 4USHA 3QYYA 4N56A 3KKSA 4I4BA 1MU2B 4NWBA 3CCUS 3OHAA 2F3JA 5AQGA 2FSNA 4PKGA 1VBKA 4OI0A 3MR3A 4P7VA 3BKUA 2XYHB 2FSKA 5GIPA 3S1TA 1BY9A 2VG6A 2VJVA 4FXDA 3T1HJ 4ETXA 5AJ3J 1NJWA 5DG8A 4E7KA 5BRFA 2C28A 3CJ3A 3GR1A 2E5LK 4CLYA 1AW0A 1WDTA 1RGIA 1CS4B 1JLEA 4OVLA 3MUVP 4A8KA 3BREA 3UCGA 3KNAA 2LQ5A 2EW9A 4P75A 5MAOA 4X2BA 4LF8K 2NQPA 2PT0A 1KFDA 2CUYA 1W26A 4IQMA 2ZZNA 1F3FA 9RUBA 3CTRA 1WSVA 2XMTA 3CETA 2VH7A 3SAFA 2O8CA 3GFXA 4IRKA 3DRPA 4UW2A 5DG9A 4OZ5A 2DRAA 2R7OA 2KG0A 2A40A 1TKTB 5KFLA 5F8HA 2ABYA 3PJXA 2CQBA 1I3OB 4CO3A 4B3SF 4M1KA 4O8UA 2FHJA 2KXNB 3GYGA 4BE1A 5EDWA 4DV5J 2P9SB 3V6DA 3WX8A 2KXHA 3M6GA 3P49B 1T94A 3HJFA 4IWVA 3U02A 1Y00A 3E1YA 3CJKB 4NI2A 2HHTA 2IGIA 4HHHA 3C94A 3C0BA 3I82A 3SMPA 3MURP 2D3O1 5SWMA 2RNEA 5HROA 1S72S 5KG7A 2VASA 4B3RK 3GLJA 2HNZA 4A8XA 2ACYA 1N36F 5F8GA 2HIQA 1YJ9S 3EZUA 3BR9A 4USIA 3OVAA 3U1MA 4ZP9A 3CJ1A 3VQ7A 1CJUB 2QC3A 3Q8PB 2MSSA 1XJWB 2A42A 1FO1A 5AXMA 4E1MA 1TFWA 4CEAA 1RDUA 3M8ZA 4LIWA 1YJUA 4KJIA 2A6OA 4L8RB 3NS5A 5DM6L 1TL3B 4K25A 3UPFA 3UN2A 2D1CA 4CHOA 1VQLS 2D0BA 2IS3A 4BWMA 4H0PA 1HWIA 1GQEA 3T1HF 4DCJB 2GVZB 5AJ3F 3CW2C 4QIEA 4R79A 2W41A 3UCUP 1HD1A 4KRFA 1ROFA 2OJ3A 2FF6A 2RUGA 2Y8WA 4F0KA 5D0HA 4MK9A 1SH0A 2OA8A 3GJQB 2HNYB 3SPYA 1PJ5A 4X62J 2MJUA 1RTDA 3FRYA 2C2EA 1R0AA 4J9RA 3O4NA 4U7BA 3BQ2A 2YJFA 4AH9A 2ZBPA 4OIXA 3FBCA 2Y9HA 2LXUA 3THVA 2ZVSA 4N77A 4ZMMA 4KFBB 1HRHA 1PSDA 1F5CA 2FY8A 4Q44A 1JK9B 2YPZA 5IV3A 7AT1B 3W61A 3D6HB 4CTAB 1WJ9A 5JVGL 5C7PA 1C0MA 1SI9A 3QICA 4K4UA 4B9UA 2GIQA 1TKXB 4W5OA 2YKNA 4CHZA 1VQ7N 3QB0A 3TEHB 3FZMA 1HARA 1VQKS 3A13A 1VIOA 1QAYA 1W2BR 1QE1B 1MLAA 1CSJA 1T0TV 3GJTB 1NLVA 4BC5A 2DGQA 3NL0A 4H5NA 4C8OA 3MMBB 3THXA 4H4KC 2BGGA 1YX2A 2R9LA 4P74A 2HGNA 2P8IA 4TU7A 3WXMB 3IMXA 3BYRA 2M7SA 4KKOB 3ZZUA 1FD8A 4GV9A 3A8YA 2BJEA 1KTVA 3UIQA 4BLGA 2Q36A 5IWAK 1VBXA 4CJQA 2YWWA 3R6MA 3MF5A 3IR7B 4KV8A 5DLGA 1VISA 3Q22A 4CYUA 1XQIA 1FFSB 1E4FT 2A5XA 4JKEA 2AJ0A 1LFPA 1YBUA 2KFYA 3JS6A 3HFZB 4K5SA 3OUYA 1QTNB 3J80O 2XMWA 5LY3A 1RAIB 3DKDA 2WFBA 1DRZA 1KVBA 3C6UA 5KFYA 4RKUC 3DXMA 1DAXA 1WSRA 5HP1B 2HNDB 3KYLA 3HKWA 2C1EB 3PW7A 2RHKA 3ISNC 1FCAA 2AEJA 3V81B 5KFVA 4KR0B 4EK2A 1ZM3A 2IBKA 1MDUB 3D2FA 3QRQA 1F5BA 3P1GA 1O13A 1RBRA 1UVLA 1Q9YA 2W8LA 4QQBA 4XDDA 1UEUA 1VSDA 1R31A 2CG4A 3I56S 1OY6A 2BACA 2H65B 1IKYA 5CD4H 4GC7A 2AW0A 5T7LB 2DO0A 2EBGA 2J8AA 1GOBA 4FXVA 3P31A 3TZWA 1RU2A 2IJNA 2VJUA 3NCPA 5E33A 3OXGA 3AVMA 5ITHA 5KFQA 1NSKL 2FHKA 4P10A 4FPRA 3MWPA 1ZOTA 1W7AA 1X4CA 4CJTA 3N5FA 4RO0A 4FP9A 2BQUA 1URRA 4LF7J 4A8WA 3IXQA 4FYXB 3M2RA 4MLHA 1E6YB 1VSMA 3HVTB 4DMNA 3CIPA 1N33F 3K0JA 2IRUA 1WSJA 2QMXA 3M6WA 4YY3J 1MWMA 2HMIB 3DGVA 3LP1B 4U8VA 5JMNA 1XNRK 1KXPA 1NKEA 3ETMA 4OYIA 3PIPL 3AVAA 4NA1A 4CI6A 2DVIA 2UUAF 3TARA 3SJJA 1RHUB 4OHWA 1RBAA 3HTVA 2UVWA 5KFIA 3CCSN 4ID8A 1HNVA 5J1PA 3M9OB 4YORA 1HBOA 2KL8A 2WB4A 4X4VA 3MZIA 4ECUA 4K4WA 2WB1D 1K47A 3GWCA 4LBHA 2RKIB 2WTFA 2ZE2B 8AT1B 2OI2A 3HO1A 2QWQA 2COLA 4CZMA 2HGMA 4IEIA 2V51B 4ZIWA 3DM2A 3P4UB 2LU1A 3OV7A 2QWPA 1N6QB 2VG6B 4IOAL 1NSPA 1U2CA 2MMYA 3WXLA 2C3UA 5HVFA 3BYPA 1IJFB 4CVNE 4FJNA 4DCPB 2IDOA 4IG3B 4MQ3A 2OPSA 1AFJA 1OVQA 1QVFM 4J9OA 1KRPA 5D0GA 1BWFO 5ADZA 4K4TA 1EO1A 3FKBA 4BROA 3L0QA 2W6KA 3PW5A 2JSXA 4BRMA 3L3VA 2APOA 5AQSA 1NOYA 3ENBA 3OBYA 1RABB 3DRPB 1WEZA 2CQIA 2D3ZA 3H08A 1I51B 4LF9J 5JUMA 3V9XA 2NRRA 1JLCA 4P2SA 4DU4A 2RN2A 4LF7F 1WD6A 2EXUA 1XQSC 4EFAC 4MYUA 2QSWA 4LRCA 2XWXA 2RIJA 4ZPBA 4W4MA 4YY3F 4EP4A 5A8RB 2NXUA 5DGBA 4XEIA 3DMJA 2Y1RI 2F4VJ 3QSIA 5BR8J 4BR2A 2HIYA 4FYVB 3ETOA 4ALZA 1ASWA 2ZWHA 4I6YA 3QNWB 4KH1B 4X4RA 4MDAA 4DSFA 3TP2A 4K8XA 1RT2B 1X0FA 1R43A 2VFUA 1VC5A 1GX6A 3SEOA 4W5QA 1G99A 2YX4A 4K8RA 5FROA 3UW1A 2H4YB 1NHVA 3MMVA 1X5PA 4Q5VA 2CVEA 2RE1A 3FE1A 3IAYA 2VPWB 3CC4S 1R8AA 2WVDA 4PUOA 1EP4A 3HVAA 5HL7L 5ETMA 3U4LA 4BRFA 4PPZA 2FD2A 5M2PA 4XIUA 3R3LA 3M8SA 1QSYA 5CYMA 3DOLA 2K3KA 4CFDA 3N79A 4Z7YA 3FVYA 3NEKA 3QEXA 1OY8A 4JV0A 5K20B 2GIFA 2J9DA 3O1BA 4KHQA 2WVBA 4ELUA 2LVWA 1DBDA 1FDDA 1S97A 4JI5J 2H5JB 3IS9A 3DLLQ 3DWLA 1RTDB 3DOMA 4TY8A 4B3TJ 1FNMA 3W5XA 4ANCA 3OYDA 3DGPA 2PA3A 4URGA 3MPUB 4FPBA 1ATRA 1X1PA 4ITSA 1TL1B 4CFCA 1OKJA 4LF9F 3Q86A 4IDHA 2WSCC 5M1QA 2GMLA 1ITPA 5IOLA 2NZ4A 2IM2A 3SQ0A 3CJ2A 3L2QA 3QFUA 2YKNB 4ZHRA 3AD9C 4E19A 3ENWA 4F4XA 3T6JA 3M3ZA 2XCAA 2G0JA 5HRNA 4WPAA 3PIOL 4M5HA 2F4VF 1UVJA 5BR8F 3CXCM 1HWUA 2Z4PA 2GUIA 2GX8A 5IM0A 2L9NA 3ZCMA 4CBXA 3THXB 2ASLA 3RBDA 4B9NA 2CQ4A 2KVQE 1GOCA 4HTUA 4NLVA 3MM5B 4JI0J 3SV4A 3TJ8A 1K6YA 1RTIA 4ZIVA 1KLNA 1KQSM 3C6HA 5HBMB 5M1FA 4DTSA 3JSMB 3P96A 1WTFA 1WSHA 1NGDA 2IM3A 4DX8H 1XR6A 2O8DB 3D68A 3R7NB 3ATVA 4ZITA 3L7UA 1JXBA 5AQPA 4RL1A 3GMGA 1VQSA 1X4FA 4FF2A 4FVCA 4RW4B 1Z2ZA 4IYQA 3T69A 1UJ6A 1HNIA 1JXVA 2VA3A 4K5RA 4KIAA 2ZH1A 3W65A 1RZMA 2KFNA 5KPZA 1NLKL 3HZEA 1NPPA 4CZFA 4XO0A 1YBTA 1GLLO 4FWOA 4LQ9A 4DQSA 4CLUA 4QW9A 2DR8A 3FJ2A 1VQ9N 4JI5F 4A57A 1N32J 1B99A 5K8OA 2GJFA 4LSNA 1X5OA 2NSCA 1X9WA 1WHWA 4B3TF 1YSJA 5J1NA 2M70A 3ZSOA 3KJVB 2Q43A 1RAGB 1IN0A 2HAIA 3VPZA 4JS5A 5LMNJ 4ID5A 3D0IE 2DH8A 4A4JA 3NGYA 2CPYA 3H5UA 2OLWA 3F44A 4CH0S 3ASMA 2B56A 4OPJA 3P38A 2RDJA 3LA0A 4OI6A 3AVCA 3NGTA 2WW4A 2PSZA 5KPTA 2UU9J 2Z2MA 3AAPA 1VQNN 1ZBHA 3SUOA 4DF8A 3CG7A 4OZNA 3FRZA 4AHTA 2FJVA 2J9EA 4WP8A 1RT1A 1UAWA 3H46O 4P71A 1S6PB 1W7WA 4Q8EA 2HFNA 4R0EA 4NA2A 3H59A 4CGIA 1ZZNA 3NGDA 4N5SA 4N7TA 3JQMA 3OSPA 2ZJRL 2X1GA 1HR0K 4FM0A 4NLSA 4TSXA 1WI8A 2KM8C 4JI0F 4FK0A 2PFFB 2FZGB 3T1YJ 2NLXA 4H0VB 4DR2J 2ZFHA 1ZYQA 1NJIO 2ZOMA 3LZIA 2AEMA 1RU1A 1BDGA 4DU7A 4ID1A 4DV6K 2IIRA 4CLWA 5EX3A 3WIUA 3E01A 3W2WA 3GP9A 5KFKA 3T1AA 4OL8A 3HP6A 4FF1A 4P2XA 2HB5A 1S48A 5FRMA 4HTLA 2W2QP 4FLUA 5CCMA 5C2FA 2HYIB 1J2VA 3J7ZO 3UR0A 2HFVA 3TA2A 1NM2A 4U67L 2JC0A 4CLTA 4WIIA 3OL9A 1KWMA 3W8GA 3AO4A 3EPGA 4QJVA 1NJYA 1FKAF 3K0SA 4WIQA 1HNVB 3RSEA 2JFDA 4I7FA 2OFGX 1HBOB 2CYYA 2M4MA 4CDIA 1BIZA 3TSUA 4LF2A 4EP5A 3MEDA 4OZLA 4OI2A 1N32F 2AJFE 4WZMA 3TA1A 3I0SA 1JLGB 1GX5A 3R6GB 2HHSA 1IKXA 4PQUA 2A3JA 1GLAG 2GWJA 1UETA 3K8WA 3LP2A 1T6DA 3DM2B 1LFWA 3FCHA 2OEKA 2OP5A 3M6VA 1OPZA 1TU0B 3PX6A 4H8KA 1EZZB 3PFEA 1ZAXA 3UQSA 1VSJA 1JKHA 3V1RA 1H0HB 2UU9F 3L8BA 1V5VA 3AVIA 3V2UC 4J2DA 2AKWB 2OPSB 5JS2A 3R27A 3VF0B 4FBUA 1DFDA 1FRXA 1SPBP 4Y0FA 4X4QA 2AJQA 2HEKA 3DXKB 3MXMA 2V0NA 4O44B 3RMAA 1RNHA 1CZ9A 1BGXT 4Y2CA 5J2MA 4USJC 4YMEA 2XMAA 3NGKA 3T1YF 4OJHA 4DR2F 3TSQA 2V68A 1N88A 3OJSA 3PSFA 3UWTA 5AQKA 3QGIA 5CR4A 4JI6F 2HW3A 5KFUA 2H4WB 5HK4A 1LCUA 2E5HA 2J6UA 4OZ0A 3NDKA 2MKKA 4KAIA 2K1RB 1XC9A 3IUCA 2R7RA 1TMJA 5MLCV 2L9DA 5FPDA 1FWKA 2NXCA 2U1AA 2OYQA 1WHYA 5M2UA 1IVZA 4CJ5A 3EDQB 1YI2N 3R5CA 3O3LA 3M8QA 1MROA 4WFXA 1SZ2A 4F25A 1X9SA 3DDIA 1IWGA 4F8RA 3LWMA 3LW5C 1F2GA 1KAZA 1FJCA 4QR0A 1V9OA 4YDUA 3OVNA 1FKOA 4URQU 2ITGA 1GLBG 3CDBA 1RT6B 3OPKA 4I2PB 5GMEA 4AQYJ 3CJ7A 3NF9A 4IH5A 2PZSA 1Q82O 1CBKA 2ROEA 4QS9A 3CCVN 4KGXB 3ZTQA 4IRDA 5FDLA 1SUQB 2P9LB 3AVGA 3NMUA 4DUZJ 3UVJB 4FJIA 3KHYA 4KHWA 4K4VA 4X4SA 4L75A 4GKJF 3KHHA 4MJKA 1Y7PA 4ILJA 1E6VA 4J5OA 1S0OA 2LQJA 2A3ZA 2DITA 3HPHA 3O8MA 4BGBA 3AH6A 2YX7A 1RCXB 1DZ5A 4OZ2A 2CDRB 3JYTA 3KJFB 4IKFA 3A8JA 6FDRA 3CSKA 3IS9B 3DOMB 4CEZA 2IVOA 4OHVA 4NZ7A 2OKQA 1KONA 2HFUA 4KHYA 2ZKUA 4I2QA 3NMRA 4DHYA 2ZM6K 2O8BA 4B9TA 3PO5A 1JJHA 2R8GA 1NCLA 4FJGA 2DHSA 3AHPA 1VS3A 1Q0NA 2FVCA 2BYCA 4B9MA 2N3LA 3IRWP 3K2YA 1RDRA 5HLFA 1YTAA 2ZUGA 4CJUA 3BDEA 3NAIA 1RXOB 4ZHRB 3EGZA 2NNWA 3J81j 1TV6A 4Z94A 2WVFA 1ICEB 1YRXA 3D45A 4ES1A 5IM0B 5KOWA 4BC4A 4CM2A 4FJJA 3NY0A 4M63A 3LQVA 2EG1A 1WI6A 5HI7A 1IJJA 3CPEA 1XTZA 1D9FA 4BRQA 4H5VA 3ZSVA 4DTJA 2QKKA 3GFYA 3U9DA 4RNHA 3DRRA 4NLDA 4V19S 1TQLA 3QEVA 3QNOA 1SIWB 1NJIT 2VWJA 4FKXA 2C2NA 1HYVA 2OFHX 1X4GA 2DB1A 4DUZF 3VMFB 3R7BB 4H4KA 1HNIB 3TJ9A 1QVFR 3SCKE 3TAEA 4NZ6A 4C11B 2DY1A 3ZT0A 4PXEA 1IXKA 3VVTA 1FRKA 3M2VA 1HKAA 2KHCA 4BC2A 1CXQA 2C3MA 3J7ZT 4JEPA 2F8HA 4U8YA 1SV5B 3CJSA 3E51A 4F50A 4F0HA 1BA0A 4LSNB 4DSKA 1DT9A 4H4MA 1RT7A 3SK3A 4QWBA 1NNEA 4FXWA 5ETSA 3LM9A 2HVZA 2QW9A 4CJWA 1IH7A 4RG8A 2MHEA 2Q6CA 1U8SA 2HFSA 4UZCA 2O66A 4ILGB 4QPTA 3H4BA 2VQEJ 3KFWX 5HRRA 3T7ZA 1D9AA 3H42A 2GJIA 1TMMA 1IV0A 5KGXA 1QZ5A 2BE9B 4BCAA 2NUBA 4ERDA 4WXWA 2ZGYA 3EEQA 1RT1B 3ZX3A 4HR2A 2EWHA 4CEBA 3FEYB 2HHWA 1LW2A 4X65J 1MN9A 3ENAA 4ANDA 4QOTA 5J2NA 4B1VA 1LWEB 3HHKA 4EEYA 5B0DA 4EZ6A 4ZOSA 4RW6A 3DNCA 3ZSZA 4DR5J 2VBWA 2BTFA 4E98A 4W92B 4CZGA 2WOMA 1OSCA 2RRBA 3C14A 1UL3A 4MKBA 3DN9A 3VALA 3E01B 3W2WB 4K42A 1VHFA 1S6QA 2HBLA 3ONQA 4HI1A 3ZSRA 3MX5A 3D2EA 2KJVA 3H5SA 3UKUB 4UOGA 4WFBL 3BF4A 5D15A 4QIVA 3AQOA 3GQCA 5LSLA 4FS1A 1Q95G 1HQUA 1ITGA 3I0RA 4QPXA 1F9FA 3N28A 3MN5A 1HW8A 1U8WA 2EKNA 4P52A 3UFCX 3RSEB 2MQ8A 4KBOA 3PKYA 4I7FB 2YH0A 3QT6A 3O6QA 4JV2A 1Q7YO 1D9DA 3RGIA 1JB0C 1FTRA 4ED3A 2NUUG 3MEDB 2VQFK 2UYTA 5H9FK 3BM7A 1BQNB 5KFCA 4LSZB 1YVNA 3NH0A 2LA4A 4K4ZA 2P9GA 3EL2A 4PHTX 4JN4A 1N34K 4PQUB 3ILOA 1GLCG 1NMDA 2QZ8A 1VR6A 2K7KA 4DSIA 4I67A 3IR5B 2J0QD 1IG9A 3ZZ0A 1NKCA 4DR1K 1RISA 1Q82T 5E3PA 2CIMA 4GV6A 3M1FA 4HI2A 3CXCR 2VQEF 3UNGC 3JAMO 2BRLA 4GVMA 1EAYC 5DM6Q 2AYEA 1V6HA 1VJWA 2LFVA 2X6NA 5AJ3K 2RJZA 1TP7A 4NZ0A 5LL6Z 1X9MA 2VYPA 4U9RA 4X65F 4RW7A 1KQSR 2DXDA 1VQ6S 2O3DA 3DU6A 3FNNA 4ZP7A 3QPIA 3OYEA 1M5OC 4B1UB 3WC0A 1SC3B 1YAGA 5EWEA 2KRBA 4HDGA 5J2MB 2VONA 5BYSA 4DV7K 4YNQA 3IDHA 4DR5F 2Q79A 5KG6A 4OLAA 3SCIE 3K89A 1YRUA 3S7RA 1YJTA 5JXSA 3CCES 3BSOA 2VFTA 2E5LJ 2QO3A 1PC4A 5A2QU 4OHXA 1WKKA 4ZTJA 2G8UA 4FK2A 4OI3A 3NVMA 2JJ4D 4ZVOB 5JVGQ 2VIHA 4WP9A 1J5EF 1M90O 2KTQA 3VCDA 5AQYA 3MXHP 2BM1A 1LQ9A 3AA9A 1VQ4N 1J27A 3M30A 3H7HB 3CCJS 3PY8A 4PXDA 2ZZMA 4NEYA 4ZPDA 1RDAA 2EK6A 3UKRA 1HWLA 4JKAA 4DV5K 4KGVB 4P9SA 1HUXA 2V50A 3PW4A 3VQEA 2CJ9A 5DQIA 4GVLA 1KP6A 1Z1ZA 2RUSA 1FKOB 4EZ9A 1URNA 5A6WA 4ZS6A 2GELA 1VK8A 1SQFA 2W6LA 2YKPA 5EXWA 1F1BB 4MTPA 3H3NO 2CQ0A 5E41A 1N0VC 4BY9C 2E5JA 4PG5A 2HQCA 3DRYA 3ISZA 1X9JA 4LSLA 1M5KC 4OX6A 5ETVA 4KY3A 4JKBA 4OLOA 1ZETA 4O0IA 3QGPA 4JB8B 4D3HA 4LFAF 5D4NA 4CNZA 3Q8UA 3P5BP 3T5JA 4B3RJ 2GMJA 2KG1A 3H2VE 1RLCL 3V6KA 2D69A 5KG5A 3CNQP 4FLYA 4C8MA 4FYYB 3LUYA 2YBVA 4NLPA 3HHLA 3FQLA 1WUAA 2B4OA 2YX1A 3OTCA 1CLFA 3G9CA 4CGDA 4I2QB 2IOCA 3SAHA 4EHUA 3AJDA 4X62K 1KS2A 3F9KA 1WWHA 2G4BA 2JGUA 4L3NA 1NGAA 3LAKA 3WQUA 2A18A 4DV1K 1J53A 4K4SA 2O4IA 3WNGA 3AODA 5EOYA 2GS8A 5HLFB 2E5LF 1VQOS 1PYTA 1BMQB 1RAAB 2N3OA 1HNZK 1QM9A 2A0FB 3WZ0A 2W2MP 4CGJA 2QYCA 1F0XA 1BXNA 2E6MA 4DL4A 1TV6B 2YQ3A 1H72C 1SS6A 5M1PA 3MECB 3QJJA 4FWRA 1IKVA 4JP8A 4FJ7A 5KT7A 4DDFA 2XI2A 2DNHA 4HH1A 3OBWA 1JJ4A 1TL7A 1FTCA 2FJBB 3TAGA 1S4FA 4CFAA 3DRRB 4TYBA 4ZCKA 5ETNA 3GJRB 1CEZA 3W2VA 3KJNB 4UOHA 1FESA 3QDKA 2SXLA 1R89A 2R8KA 3ZSYA 3CC7S 2ZBRA 4BC7A 1RT3A 1DKGD 3LDSA 2LECA 1H2TZ 3IBCB 2KJWA 1B0PA 4OMFG 4EYHB 3SCXA 2OO4A 3PIPQ 3M2VB 2GBZA 1Y4ZB 5CYQA 3VGTA 4B3RF 1S5JA 2I0XA 3QFPA 2M88A 3VGSA 5KFDA 2F7VA 2Z2LA 1HPMA 1VMBA 5K8MA 3M9MB 1QLNA 2DD8S 4A8YA 4BQLA 2F8EX 4KGKA 2V4RA 1P9YA 3ZT1A 3AD7C 1HNXK 4H4MB 1RT7B 5IWAJ 4ZVQB 2Z57B 4E89A 4JI1K 4H54A 1Q7YT 4AL6A 2HBJA 3GPAA 5AR0A 1OYEA 4CLSA 3AA8A 3X1LB 4NYFA 2JEFA 2PMWA 2V8VA 1U45A 1RWKB 2GQ2A 3GONA 1V3SA 5MLCQ 2E1MC 3EO3A 1X4BA 5HATA 2DGOA 3CPWM 3NS6A 1S79A 2QEXS 4IOAQ 2BE7D 4KT0C 1YJVA 3V5RA 3IC1A 2CWKA 2FC0A 3MPVA 4QS8A 3TNVA 4B9SA 5E3RA 1Q18A 3CJBA 4RW6B 4HCCA 4MT1A 4EO6A 5IT9Y 4JK8A 4M8LA 3ZNJ1 5DZ6A 5LXYA 4FLTA 4RTFD 2HVHA 4OX7A 3C14B 2N7YA 2ZGZA 2E1YA 4TU8A 3IWNC 1NB7A 1RILA 1S6QB 4HH0A 1FX2A 3D2EB 2LYVA 3CULA 2G8IA 3C15B 2VBZA 4YY3K 1GXTA 3MTKA 1VHIA 3WNEA 4O3OA 4PL8A 1VQ5N 1K8KA 1T9UA 3W3SA 3L7PA 1M90T 3MOJB 2CNOB 1HHSA 3S3NA 3E2EA 2K2PA 4CIGA 3BBFA 3PEHA 4AHUA 2AP6A 1RAHB 3EKSA 2OPQA 3O9RA 2V2ZA 4FSVA 1S0MA 1T03A 2FBTA 4QZVB 1CJKB 3BKFA 1Y3KA 2QFJA 5IWAF 1XNRJ 3IWXA 1S1TB 8ATCB 1WSFA 2J9DE 4USMA 1SC1B 3AXKA 2LP4A 3ZTOA 2XMMA 3NS7B 4U7CA 4LREA 2NRWA 3VQ8A 2G8HA 5HL7Q 2NZTA 3EE3A 4RBTA 1CXUA 4L6V3 3RAMA 4UY85 3AVHA 3QQCD 1TKDA 2D0PA 5L46A 2ASMA 1X8DA 5ELZA 3CCZA 3MM9B 3VQTA 1S49A 5GMDA 2CZ9A 2I1RA 3PVXA 2CQ3A 3MHYA 1U4BA 1ZZFA 3BBBA 1XEZA 2QA4N 2IAJA 3DYAA 4KPYA 1VC6A 3I55S 4FW1A 3BPDA 4RW7B 3HJVA 4I64A 4CO4A 2PMZD 4J90A 1IKWA 1V3ZA 2BUPA 3HFVA 1TZ0A 3VR1A 3BSAA 2VKRA 1Y64A 5G0RB 2UXCK 2FQQB 3BZQA 4LFCK 2Q1LA 4ZJQA 1P90A 3EGWB 3KDOA 1S1WA 4IO1A 1FRHA 2OD4A 3UN5A 3OLAA 5DETA 3THPA 4FK4A 2QMUB 1XHZA 2OAUA 2BKPA 1KHWA 5EY4A 4KO0A 1VRTB 2DGVA 4Q0BB 2VV5A 3G6XA 3VN5A 1T3NA 5LJ3Y 3VEZA 2G9OA 1P27B 3SUNA 2QL9B 2Z1GA 4CZJA 2RT3A 2OTLS 3KZBA 1JCEA 4ER8A 4YEAA 2X1BA 4MYTA 2DPIA 2ERRA 3A0IX 3N0VA 3Q89A 2GNKA 4KB7A 2A6MA 3PIOQ 5F9NA 1CZAN 1C0TA 4ICLA 4JOUA 2BR0A 5F0XA 3IG1B 1HIYA 3D9BA 4R25A 1K0TA 5KFRA 4PCQA 3CO9A 4FJ5A 3R5JB 2W4CA 4C3KA 3TVYA 1E4GT 5AQFA 4JV5K 3HCXA 3VQ9A 1SCJB 2EG2A 1HPZA 1AZSB 3QRPA 4CEEA 4ZP6A 3TSPA 2ZDPA 3OR1A 2YKOA 2MZ1A 1XNRF 3HL8A 1FE4A 2ZNZA 3T9NA 1BO5O 4OJ3A 2ILYA 4ECYA 2B7CB 2R7XA 3C66A 3DDKA 3WNHA 1SBRA 1SJRA 3IGNA 3D7SB 4TLRA 1ZC6A 4ECZA 1K1QA 4PQAA 2HZCA 3Q8VA 1U09A 2QJ3A 2RQMA 2RPIA 1FE0A 1VK0A 1TUUA 2NRTA 3KUHA 1ZXOA 3AVFA 3F0NA 2P9PA 3G82A 3V4IA 1SVDA 4J9NA 3IA0A 5C0YA 4P73A 2WZ1A 4AFFA 3HHLB 4O3SA 2FF3B 3JB9k 4W5RA 2B9XA 5JLHA 2NRXA 4LIRA 4DX6A 1X4DA 5IC4B 4ECWA 3C6TA 5KT4A 3GV8B 2D4WA 1Y10A 3OYLA 3A5LC 1YDLA 2G8WA 2XBPA 4LH4A 2FBYA 4F26A 5A8KB 1UA0A 3CMAN 2W2PP 1FNOA 3SDEB 1DTTA 3M6XA 2JFKA 3T3FA 5CQGA 4JI8K 3ULEA 5IFMA 2Q3PA 2DGXA 1LOUA 4KGZB 5A8WA 3F9MA 3EUNA 1IKVB 3HK2A 3OHBA 3GU0A 2XHBA 3ILLA 1BQMB 1TL7B 3AVNA 5F2RA 4QIWD 3FK4A 4M5IA 3I8DA 4FM1A 5GVQA 3MCSA 2ZJRQ 3LDQA 2G2OA 3NGRA 1F5AA 3OFFA 3L4BC 4BRCA 4C1NI 2BANA 1VQPN 4DX5A 3CD0A 5L8RC 5F0UA 1X5TA 2LXFA 4LBIA 3SZ2A 1Q8KA 1ZA1B 4E1JA 1M5VC 2Y1JA 3M8WA 3GR0A 3CI5A 1S9GB 1RT3B 1BHNA 1TUVA 4DKWA 4CECA 1UZDA 4EBCA 5IT9U 3F2KA 1HKCA 3W63A 4HHTA 1P8ZA 4EAHD 2KYXA 3FC9A 2P9CA 3RU0A 1VQ5S 5CYQB 1JMTA 3EKUA 3QBXA 2WONA 3N6LA 3OXLA 2K06A 5GADI 4RUHA 4BRGA 2RDDA 4RR5A 5CCLA 4U67Q 4HL9A 1HHQA 1WC0A 4HLBA 3KKFA 3BQ0A 2OPPA 3BBCA 2XGQA 3UO0A 2V4QA 2PI4A 2BABA 3R1XA 1U49A 1N32K 3OYGA 4FF3A 5C42A 4FYDA 4IO9L 1EWQA 4RLEA 2BH1A 1SQEA 3RBEA 2QX0A 2E20A 2E1AA 2HS0A 5GAHI 5LMNK 1FVQA 2FVSA 2V4JA 1KAXA 1GT8A 2DGTA 3Q83A 4YP3A 1J5OA 2ZHOA 4K4XA 3CCLS 4O4GA 2Z0GA 4DMZA 2B4VA 2UU9K 2MZQA 3QFWA 4GRSA 3I32A 2IA6A 2W9CA 4CBWA 5IS2A 2KT5A 3HKZD 1ZM2A 1IQTA 5IC6B 3C7NA 5ETQA 3UDVA 3ILIA 3NOGA 3QT8A 4CK1A 2NXNA 1HQEB 5C25B 2Q0UA 2DGSA 3KLHB 2VFSA 3GIMA 1WN7A 3LDLA 2O5DA 1GH8A 3M8YA 1FKPB 3T1YK 4BGAA 4DR2K 5HN0A 2BQRA 2QA2A 4B9LA 4LQ3A 3H40A 1LV5A 3RRKA 2RQCA 4H0TB 4L72B 4QBUA 4OZJA 4QU7A 3OJUA 2OCEA 3CMEN 1FF2A 1RYSA 4L3QA 2YHWA 2UUBJ 2JC1A 1NNDA 3KIOA 2KM8B 4Q43A 2JLGA 1AYEA 4BWJA 4DTOA 3FMWA 2B9YA 1HR0J 2E1CA 1UTAA 1U1NA 3R97A 1OMSA 1EARA 2BA9A 2Y0BB 3QWUA 3UDEA 3ICLA 3UD3P 1HYSA 1F60B 1NG9A 4OO1J 2NCKL 1X7VA 2MQPA 4XH1A 1Q8BA 1VC0A 2OPQB 1QVGM 3BH7B 1VQ8S 4DV6J 4KB1A 4M42A 4DFKA 4JUZA 2Z1HA 4NLWA 4EBDA 2HHHK 4DR4K 2HF3A 4USKA 4FOEA 5B7WA 1EB0A 2AMCB 5L1LA 3PYEA 5D3GA 1XNQK 4P72A 2Y1LB 4A48A 5T7BA 3SMSA 2XY8A 2EWSA 5KFXA 3ZLJA 4IJAA 1S1VA 2GV1A 2F40A 1WBDA 3J7YI 4A2AA 2YNGB 5AQNA 3V9ZA 3ZZPA 1JJCB 3QT5A 5LJVA 3EYZA 3SBTA 4ZLJA 1PCAA 2IPOB 1VQMS 3ENVA 1IKWB 3MFHA 2AHOB 4OHZA 4MO4A 3QWPA 1SH3A 1A7GE 1G7CB 5B09A 2Z8QA 3J7AP 4C9DA 2MQQA 5KFTA 3U9ZA 3DJCA 2NXJA 1X3NA 3RZAA 3P3DA 4OV1A 3NGIA 3K5MA 4FYWB 1HWJA 3K9KA 4DG1B 4PG8A 1YJ7A 1B70B 2KKZA 1A6LA 5DJBA 3GZ7A 2BM0A 4D3GA 1N5YB 6AT1B 3KMQA 3D1HA 2P6SA 3M4XA 4I6MA 1LXJA 1NXIA 2DH9A 1CS4A 1NZAA 1RHJB 4LY7A 1QUPA 2E5IA 3EVOA 2CJBA 2HBZB 2UUBF 2QTWA 2XHWA 3EGNA 5ETPA 1NGFA 4ICLB 1F3VA 1HR0F 5EX0A 2PD1A 4EU0A 3MN7A 1N56A 4M3RA 4OHYA 1KBRA 2FB0A 2B4JA 2BJ1A 2VPYB 4B02A 1L3SA 4ILLA 2L9WA 2MZRA 5AQRA 5BYRA 4CHNA 5GINA 4DV6F 1HPZB 2Y8YA 1KSPA 3IRXB 1TKTA 2IA0A 1FX4A 4ZVEA 2MKIA 2CVIA 3HSCA 4AQYK 3CPWR 3Q7BA 2YKAA 3D6MB 1EX8A 1GXUA 1VQPS 1RAJA 1JX4A 4WYWA 1I6JA 2XULA 4KHRA 1TR0A 2P9SA 4FLVA 2KYZA 3O8WA 5ADXA 1E3MA 2ZJPQ 3AARA 3M32B 4DUZK 3PW0A 4JI2K 1OQ6A 3T9ZA 3CJKA 2DO4A 2GHWA 2E44A 5JJBA 4O4RA 1IR0A 2D7SA 2GEMA 2FUG9 3G82B 3D0PA 3V4IB 2MY7A 1YIJS 3CERA 3ISND 2HSEB 2R4FA 4M7YA 3CCUN 3GFHA 2HPUA 3TAPA 1FFWB 5B0AA 2NSBA 3ZZTA 2OZMA 3QSYB 1OVYA 3L95X 1D8YA 2C2KB 2H1YA 4BR9A 3C6TB 2DCLA 2F9JA 2HBRB 3D28A 2RQ4A 1Q79A 1U02A 4JNEA 3L7OA 3GV5B 4OX9K 3OD2A 5BPNA 2CPIA 4DTNA 1WACA 2AIRB 1WORA 1ZPVA 4HUEA 1TUGB 2CA9A 2YWGA 1T3OA 4C8LA 4WP3A 4AXJA 1LWCB 5KFSA 4JKHA 4ZVFA 1OY9A 1SJ1A 2XYPB 4ED7A 1V4TA 2DEIA 4CCHA 2RD5C 1YJNS 3G6ES 2V94A 4A8OA 3GFZA 4M5LA 1IR1A 3EN9A 3HXMA 2VG7B