3LAMA

Crystal structure of hiv-1 reverse transcriptase in complex with n1-propyl pyrimidinedione non-nucleoside inhibitor
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV Reverse transcriptase
publication title N1-Alkyl pyrimidinediones as non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 149
structure length 553
sequence length 553
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lamA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lamA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lamA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lamA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lamA05
2HHXA 4IH6A 4CECA 3N6MA 3ZSYA 5KGXA 2C2EA 1A5WA 4F4KA 3PW0A 3VQSA 2D41A 2ALZA 1Q8IA 3KK2A 3H2LA 5F8GA 4FZXC 2KTQA 4DTUA 3K58A 4ZHRA 2XY5A 4E7JA 4PWDB 1U45A 3OSNA 3H5SA 3KK1A 2D0BA 5KRTA 4AHUA 4CE9A 4FJMA 3AVMA 1HJRA 3MR5A 4OPKA 4RW6B 5L1IA 4NLDA 4IH5A 2JC1A 3U3YA 1RDAA 4Q8FA 4ZVFA 1I39A 3BJYA 4CESA 1RT5A 4DSIA 3THVA 3TAPA 4N76A 1N5YA 1SUQB 4YMEA 2FVRA 5J1EA 4E0DA 1NK9A 4B3OA 2HB5A 2E9ZA 4KKOB 1MU2A 5F8MA 2C2DA 3SUOA 5KFXA 3KJVB 2UVWA 4CFAA 4EO8A 4F4WA 4ECQA 4E3SA 4ZVGA 4Q44A 5HRRA 3EY1A 4KHUA 3CFPA 4URQU 3ZSXA 1XR6A 1TKTA 3B6PA 2FLLA 1JLEA 2KQ2A 1BQNB 2WONB 4NCAA 2G8VA 1RT2B 1N4LA 4EP5A 4HHTA 4DSJA 1RBRA 4KFBB 1IKVB 2WHOA 1ASUA 3BREA 3RB6A 3AVHA 3DLKA 4DTJA 4DTNA 5K14B 3SV4A 3JYTB 3ULDA 3ASMA 4I7FB 4DQPA 2ZD1B 1KVCA 4CHNA 1N6QB 4H4OA 1UA0A 4FJ5A 4M42A 4DEZA 1LWFB 3QLHB 4TYAA 3QNOA 3NAEA 3M8QA 3I5BA 1JLFA 4CHZA 1HRHA 4B08A 4EYIB 1T05A 2ASJA 3OYHA 2HHSA 2I5JB 3MXJA 4CF0A 1S48A 5KFQA 4F3TA 3V6JA 5HROA 3OJSA 3V6DA 4TQSA 3RTVA 4J9LA 1OS5A 4FJJA 3CFRA 4FM1A 3I0RA 1NK5A 1ZBUA 3VQDA 1QSYA 5KT3A 5KFUA 3NDKA 1W25A 4E7LA 4KHRA 4PY5A 3GV5B 5J2MA 2YKNB 4FJXA 3L3VA 4NZ0A 4RNOA 2W9AA 3VQQA 5EDWA 1LWCA 3V1QA 2ITGA 3KKSA 1XC9A 4FW2A 4KTZA 2RKIA 2XRIA 2D0AA 1EKEA 4IQXA 3OL6A 3KK1B 4HTUA 4DSLA 1KFDA 4IFVA 4I2PB 2V9WA 4U7CA 1SH3A 1YTAA 4Y2AA 2E4LA 3QERA 4O3QA 2ZQBA 5KFPA 1L3TA 2BRLA 4MH8A 3RB4A 1TV6A 3T5HA 3LZJA 3KIOA 3K2PA 2FVCA 1T8EA 4IBNA 4CJRA 4E7HA 2XI2A 1TP7A 4IDKA 3ZT4A 5T7BA 5HP1B 3SPZA 2XHBA 3MFHA 2ATQA 2VG6A 2C2RA 4CHQA 1GOAA 5KFDA 1WSIA 2OYQA 1NK4A 4B3OB 1NHUA 5KFEA 1MU2B 4B8CA 2EX3A 3VQCA 4ELVA 1S4FA 3DM2B 4K4VA 4K4XA 2W42A 3GV7B 5DQHA 3PJWA 3QINA 3KLFB 4DFKA 3EPIA 4MKBA 4YR2A 1K1SA 1SKRA 4MK9A 4FLVA 1TKTB 4URSA 4ED1A 1BI4B 5DQIA 1JLEB 1UWBA 1NJZA 3PUFA 3OJUA 4C8OA 4TY8A 1HPZA 3VA0A 4CJSA 5KFHA 3V6KA 2YNGB 3NCIA 2I1RA 2OPPA 5KG6A 1EP4A 2V4RA 3QGHA 3T19A 4RW7B 4MIAA 1K1QA 4BWMA 4H4OB 4CJ5A 4N47A 3IRXA 1JL2A 3NGIA 4DG1A 5J2PA 3NF7A 1RDBA 2IDOA 3KHHA 4W5RA 3SQ1A 3NHGA 2W9CA 4YR0A 1JLFB 4IKFA 2Q3SA 4J9PA 3E01A 1NJYA 1A5XA 4FJ7A 4ZVEA 1FKOA 3QETA 2HVIA 2LSNA 4OPJA 4FS1A 1S1XA 1IKYB 3FFIB 4XO0A 2XC9A 3KLVA 5HROB 5KTQA 4FK4A 4AHCA 4I2QA 4Y2CA 1KRPA 2HHQA 4N41A 4KO0A 3HHKA 1D9FA 4URGA 4J9NA 4DS5A 1Q9YA 3VQPA 2CKWA 4C8MA 5DGBA 3G0ZA 3VQ4A 2HNDA 2FLPA 1RILA 1YVFA 5D3GA 3PO4A 3OYJA 3CG7A 1IM4A 1WAJA 3MECA 3O4NA 2Y1IA 4C8LA 1LWCB 1RDDA 2P1JA 1WNEA 1KHWA 3DRSA 2AWZA 4IR1A 1HMVA 5KFZA 1ASWA 1KLMA 1C1BA 4RW9A 3QEWA 3LAKA 1JXEA 2WB4A 3LAMA 3FDSA 3C95A 4E89A 3H5XA 1RT7A 1RA7A 4FJLA 2FJVA 4IG0A 4O5BA 3EYZA 4G1QA 4Z4EA 2BGGA 1TKXA 2HNZB 3MR6A 3HL8A 4J9MA 4DQIA 4DSFA 2O4GA 3A2FA 4O44A 5CZ1A 1VRTB 2KW4A 1J5OA 3FSIA 4KBIA 2YHBA 1HNVA 5CY4A 2PY5A 2VG6B 3KOAA 4FLWA 4RUAA 3DYAB 4J9SA 3V1OA 3DRPA 1WLJA 2DFFA 2FBTA 2KZMA 2BQUA 1XHZA 5KG1A 2IM0A 1RT6B 3NE6A 4XPCA 5HRSA 3O3GA 4FK2A 4AHTA 1UWBB 2G8HA 4ED8A 4CF8A 1JLAA 2XY7A 4ELTA 4EZ9A 3OL7A 3ALYA 4XPEA 4WE1A 2W7PA 2YNIA 3C6UB 1ZETA 4CEEA 5CYMA 2C28A 1SV5A 4O0IA 1EP4B 3LP3A 3M8PB 4FJIA 4W5QA 2OZSA 1GX6A 3IRXB 3IG1A 4DG1B 5KG2A 5J2PB 1YVUA 3AA4A 2W7OA 4CJKA 4PA1A 3HVTA 1G15A 4M3RA 3QEPA 1VRUB 1XR7A 1QAJA 1JL1A 5KFFA 3AO5A 3QYYA 2FVQA 4I2QB 1TL1A 4ZVHA 4ZPAA 5KG4A 3HPOA 4Z0UA 3V1RA 4NYNA 1O1WA 3MFIA 5KT6A 1S10A 5D3GB 3CQ8A 1LWEA 4NLYA 4DTSA 4ZPBA 3NBPA 3CWJA 3DRSB 5KG3A 1HMVB 2DFEA 4ECTA 2O5DA 4KSEB 5KFNA 3LP0A 2YV0X 3ZSQA 3HVAA 3DOLA 1NK7A 1RT7B 2JGUA 4IKAA 4DTMA 2IM1A 4LQ9A 1UAXA 3OYIA 4EO6A 1TKXB 3N6LA 4BDPA 3KD1E 3PZPA 1X1PA 1B9FA 4E7IA 4DL5A 1S6PA 4KPYA 4IFYB 1J5OB 4CGHA 3IGVA 1CZBA 1DLOA 1HQEA 1HNVB 2ZE2B 3CO9A 2B4JA 4M3UA 3OYKA 1RTDB 5KFMA 1WNSA 3CYMA 4MFBB 3DRPB 3Q8PB 3KHGA 1BCOA 4B9VA 4PUOA 1NHVA 4CFCA 2X78A 4FZYA 1SL2A 4FJKA 4K4WA 2RDIA 3DRRA 1T7PA 1TL3B 2VG5B 1C2PA 3PR5B 4FLUA 4KE5A 5EUHA 4J9QA 1S9EB 4CGFA 4OKJA 3ZSOA 1JLAB 4RNHA 4R5PA 1X9WA 3F73A 2OPQA 5DGAA 2AJQA 2YNIB 3JSMA 2FLNA 2JC0A 1VSMA 1B9DA 3LANA 4FJNA 1CZ9A 1SV5B 1RDCA 1WSFA 3T5LA 2FC0A 3SUQA 4IOBA 1HYSA 3IG1B 2VG7A 5F9NA 4CF1A 3ITHB 1HNIA 4F4ZA 3AVKA 4E7KA 2IMWP 1U09A 3V9UA 3OYAA 4Q43A 1Q9XA 2JEIA 4GMJB 3MXMA 4QCLA 4ID5A 4ZTJA 4ID1A 3O3FA 1KFSA 5L1KA 3MEEA 3OYMA 4DU1A 5KFAA 4QWEA 4DLEA 3IS9A 3V4IA 4Y3CA 3NH0A 1TAQA 3GILA 3DLBA 3T1AA 3ZT1A 4G3IA 2QV6A 2FJXA 1NKCA 1TKZB 4OKEA 2YHAA 2B6AB 1LWEB 3SQ4A 1QTMA 3OY9A 1J9AA 3CJ5A 2WTFA 1S0NA 4CK1A 3V9ZA 2DFHA 1RBUA 3G6VA 4FBTA 3RWUA 2BANA 3GIIA 1TVRB 3LP0B 3TQ1A 3QGIA 3C94A 3ZSRA 4H8KA 2WOMA 2HHVA 2BR0A 4R8UA 1U4BA 4HUFA 4BE1A 3TABA 3AO1A 2VWJA 4JRPA 3AO2A 5KRSA 4M3XA 3RR7A 4LQ3A 4QPXA 1RBVA 1JKHB 5CZ2A 5FROA 1S6PB 4RW8A 1BQMA 3OHBA 1GOBA 1DLOB 4X2BA 3Q8QB 5KG7A 2DPIA 1RTJA 4M41A 4EP4A 4CGIA 4NCBA 4TY9A 2R8JA 3CM5A 1IKWA 4FJGA 1JX4A 4DWIA 3DRRB 2UUWA 3G6YA 4F4XA 3MAQA 1LW2A 3OHAA 3NF9A 2ATLA 3SQ2A 5I3UA 4E1NA 2W9BA 3FRZA 2VWKA 4QWDA 3CIZA 2B43A 4HVJA 2XY8A 4CFDA 3SJJA 4CJTA 2VA2A 3QESA 1L3UA 3SI8A 2OPQB 4IR9A 4KI6A 3L2VA 3RRGA 3L2RA 3KLIA 1DTTA 3UIQA 2AX1A 1NOYA 5L1JA 1RNHA 1CXUA 4KB7A 2ETJA 3V9XA 4WZMA 2ASDA 3KK2B 5J2NA 4MKAA 4YP3A 4LSNA 3LDSA 2VG7B 4NLGA 3KHRA 3NL0A 4BDZA 4KHSA 3HP6A 4DSKA 4ZHRB 1HNIB 3PX0A 4DFJA 2OPSA 3S3NA 4FLXA 2A1RA 5HLFA 3G86A 1JLCA 5C24A 4Y1DA 4CCHA 4F50A 1IKXA 3MEEB 1UOCA 3IS9B 1SH0A 3V4IB 3AO4A 1N48A 3GIJA 1D5AA 1QSLA 3DLGA 2Z1HA 4MIBA 3IAYA 1F21A 3AVGA 4RU9A 1TQLA 2YNHA 4FXDA 2UVUA 3UR0A 4IRKA 1XWLA 1RT5B 1T3NA 4DTXA 4CJFA 1VSHA 5KFIA 4WYLA 4UQGA 1N5YB 4B9LA 4ECVA 2B5JA 4NLPA 2W8KA 5J1EB 4CJEA 1NK0A 3OL9A 2BE2A 4CHOA 5E41A 1QQCA 3IGNA 4ZP6A 2ILYA 4FW1A 2HWHA 2BANB 1D0EA 2XCPA 1IG9A 3WNEA 3PVXA 3TR8A 4CHPA 3KMSA 3N6NA 3G6XA 5DMRA 1SKSA 4F3OA 4F8RA 4KV8A 4K4UA 3PJXA 2R2TA 4KI4A 4DL2A 5KFSA 3D5MA 3KK3A 2DPJA 4CGJA 4JLHA 5CYQA 4RW8B 3BQ1A 4NYFA 3DLKB 4HYKA 4OGEA 4NCGA 2FBXA 4AHVA 1RTJB 4O0JA 1WSHA 4CF2A 1IKWB 2AX0A 1ASVA 4KHYA 4QW8A 3M8QB 4NLRA 1LW2B 4IH7A 1T05B 3HPHA 5I3UB 1TK5A 3QNNA 2HNYA 4FLZA 4WFYA 4TN2A 4AILC 4EBDA 4HCCA 4FM2A 3V6DB 3AVCA 1KVBA 2DTUA 1L3SA 3I0RB 2JEJA 1VK0A 3F9KA 1QUVA 4CJVA 1TK8A 4H4MA 1LV5A 2V4QA 5J2MB 2KFZA 4TYBA 2G8IA 4M94A 1RCHA 5J2NB 4QAGA 5JS2A 3MR3A 4LSNB 3UQSA 5KT5A 1NJXA 4IRDA 3PW4A 2RKIB 3FQLA 4J9KA 4Q5VA 3E51A 4FJHA 1T03A 4Q45A 2F8SA 2HHTA 3H98A 1NKEA 3TAFA 1JLCB 3LP1A 4RG8A 4IFVB 3NF6A 5C24B 3ZT2A 5KI6A 1D8YA 3LWMA 1REVA 4GVMA 2PZSA 2XY6A 3EZ5A 4CF9A 1RA6A 3OLAA 3BSOA 3VQ6A 4DF4A 3U6FA 2E6LA 3ISND 3S3MA 1TV6B 4MK8A 1JLBA 3P5JA 3TAQA 1Y97A 3P83D 3H5YA 5FRNA 3AVLA 4JV0A 4O4RA 4IDKB 3SFGA 3QO9A 1CSJA 5FDLA 5EWGA 1QHTA 3SQ0A 3QZ8A 3RR8A 1ITGA 3OYCA 3MR2A 4RW4A 1X9MA 4CJ4A 4DU4A 4C8KA 1KHVA 3NGYA 1EETA 4HKQA 1RBSA 5F8NA 2R7YA 4CJUA 4IRCA 1NKBA 4DL6A 3ZSVA 1YT3A 1KVAA 4GW6A 2IM3A 2XO7A 3SCXA 3DMJA 4M3YA 3DLRA 3QIPA 3K5NA 4CEOA 4CEZA 4DFMA 4DQSA 1ZBFA 1IO2A 4DU3A 1RT3A 1WSEA 3L8BA 4W5TA 4TY8B 3KK3B 1HPZB 1FKPA 3TAMA 3HO1A 1S1WA 3HM9A 1GOCA 4Q8EA 4W5NA 3ZT3A 3BR9A 4B9NA 3SFUA 1WN7A 2OPPB 5DG8A 4OJRA 5F9LA 5JUMA 4RNFA 1S5JA 4NLXA 4CGGA 3L2WA 3MEDA 4JS5A 4FVMA 4F2SA 2WRMA 4M45A 2XGQA 3M9OB 4ECZA 1C0TA 2PYJA 1LW0A 3OSPA 3LP2A 3WNGA 2RF2A 4LSLA 3RB3A 2IC3A 4J2AA 3ZCMA 3DI6A 2P5OA 1DTQA 1NK6A 2CJQA 1S49A 2W9CB 4ELUA 3E01B 2JLEA 2R8HA 1HARA 1BGXT 1FKOB 1A5VA 1S1XB 4GC6A 2HNYB 3M9MB 3BSNA 2AQ4A 1S6QA 4KHNA 4KO0B 3SUNA 1HQUA 2C22A 4LH4A 2E9RX 4CHYA 1U04A 5KFYA 3GV8B 2D7SA 2DY4A 4CERA 2Z1JA 4H4MB 2HNDB 1VSIA 2AGPA 1VSFA 4DS4A 4CGDA 3WNHA 5DLGA 3MECB 4KTWA 1QE1A 3KD5E 2IGIA 4DLGA 3KLGA 1RTIA 3CJ2A 3S3OA 1B92A 3RMAA 5KFRA 1S1VA 3PV8A 3AVBA 4CFBA 1KLMB 1C1BB 5F8IA 4RW9B 2F96A 5C25A 3RAQA 1T03B 3LP1B 2D3UA 2J6UA 1REVB 4QWBA 1Z26A 2UVVA 3EZUA 4IG0B 3VQ5A 4G1QB 1W9HA 2JEGA 1JLGA 3BSCA 2QE5A 4QWAA 2HMIA 2R2RA 4KREA 3OS2A 1JLBB 4NLVA 3AA3A 4O44B 1MMLA 1ZBHA 3B6OA 3QO9B 5FDLB 2UUTA 1BISA 3UPFA 1C1CA 2GIQA 3VQ7A 3VQBA 4ECSA 2HW3A 1BQNA 2WONA 1K6YA 1RBTA 3PW7A 1WSJA 3PO5A 1N56A 1EETB 5DG7A 3TARA 4ICLA 3DDKA 3K57A 3BDPA 1SH2A 4OL8A 3GIKA 5HRPA 5K14A 3ISNC 2AGQA 3DMJB 4I7FA 4KHMA 2ZD1A 4XIUA 1RDRA 3QIPB 3HVWA 4OLBA 5JXSA 4K50A 1WAFA 2E9TA 1VSDA 2IM2A 3NH1A 1RT3B 5F8JA 4B9UA 4NLOA 4K4TA 4E1MA 2HVHA 3TAMB 1RYSA 1S1WB 4WE1B 1TKDA 1RAJA 4ED0A 2YNFA 5CYMB 4NYZA 4ZPCA 3RMDA 3HPGA 3PX6A 3AV9A 2HWIA 4B9SA 3TWHA 3QZ7A 4AH9A 1LW0B 3LP2B 4BE0A 4O3NA 3OYLA 4LSLB 1S0OA 3DLHA 2IC3B 3DI6B 2GBZA 1DTQB 2D0CA 5I42A 4ZP7A 2HHUA 1IH7A 3SV3A 3HVTB 1D9DA 3ZT0A 2P5GA 4KTQA 5KFGA 5C42A 2YKNA 4HUGA 1S6QB 3L2UA 3NMAA 1BCMA 4PQUA 1TL1B 3OYFA 1HQUB 4YFUA 1XR5A 4RUCA 4N56A 1C6VA 1JXBA 4I2PA 3CDUA 5HRNA 1T94A 3PHEA 1RYRA 2YKMA 1QE1B 3KLGB 3MF5A 1RTIB 4MQ3A 3QGGA 3NBPB 2IAJA 4JV1A 2OPRA 1S1VB 1LAVA 4DTPA 4GC7A 3QEIA 3QIOA 5C25B 2OA8A 4U6PA 4BWJA 4DL7A 4NRTA 4YNQA 5KFWA 3DOLB 4M3WA 1CLQA 5HP1A 4FLYA 4ECXA 1QSSA 1X9SA 1BHLA 1JLGB 5SZTA 2HMIB 5KT7A 3CDWA 4N5SA 4CEDA 4O3OA 4OVLA 3OL8A 2FBVA 4LH5A 3DM2A 4DL3A 1I3AA 4LY7A 4J9RA 4C8NA 4O3RA 3KLFA 3BQ0A 3PW2A 4KRFA 4BE2A 1C1CB 1HQEB 4TSXA 2BQRA 1JXLA 3HJFA 3DLEA 3QIDA 3V9WA 2R2SA 1BI4A 1HYZA 1R0AA 5KFJA 1NK8A 4ZP8A 1U48A 1ZBIA 1XHXA 3SZ2A 4PUOB 2D5RA 1KLNA 3GIMA 2O4IA 4ICLB 3GYNA 2X6NA 1L3VA 2YNGA 2R8GA 2V0NA 4NLWA 5KT2A 4CIEA 3TANA 4KHQA 5KFVA 3RAXA 1I6JA 4EEYA 4RW7A 3RRHA 1S1TA 2OH2A 1BIUA 4R5PB 3VQ9A 4FK0A 3HXMA 3MEGA 2NUBA 1UA1A 4FCYA 3JSMB 4OKKA 3OYGA 3TAEA 4CEAA 2YNFB 4CJ3A 4J2EA 4M3ZA 3KLHA 4DL4A 2D3ZA 1IKYA 3FFIA 3I5CA 1HYSB 2FVPA 3EPGA 1J53A 3LPUA 4F2RA 4KAZA 4Z4FA 3L2QA 5I42B 5F8LA 4NRUA 4Z4CA 4I9QA 3U3GA 2HAIA 1RT1A 4EZ6A 3V9SA 5KGWA 3SYZA 5C42B 2G8UA 4DSEA 4ID5B 4CK3A 2IBKA 5KFLA 3S9HA 3NH2A 3KLEA 2ZKUA 4B9TA 4Y1CA 1LAWA 4QOZB 2R8IA 4PQUB 4J2BA 3VQAA 1KSPA 1JLQA 4DTRA 2E6MA 4FZZA 4O4GA 1KCFA 1NOZA 3V81A 1C1AA 3I8DA 3RBEA 4Y34A 3SNNA 2GUIA 3K5MA 3KHLA 1NJWA 1EXQA 5C5JA 2YKMB 2R2UA 4CJQA 2HNZA 2IAJB 2OPRB 4ECUA 4NLTA 3AVAA 1VRTA 3T3FA 3AA5X 3WNFA 3NKYA 3DOKA 1TAUA 2WOMB 2BRKA 5T14A 4HUEA 2FVSA 2P51A 4R8UB 3DYAA 4E19A 2QK9A 4TLRA 4B8AB 3HK2A 4CJWA 2QKKA 3OVNA 3AVNA 3O3HA 1S9GA 2JEFA 1BQMB 3OYNA 1RT6A 3C6TA 4DF8A 3Q8RB 4CEQA 3DLEB 5KG0A 5EWEA 1FK9A 3KMQA 1R0AB 3CFOA 3K5LA 4R0EA 1VSEA 2OZMA 2HHWA 4CJLA 4RZRA 3MTKA 2PYLA 4EBCA 4Z4IA 3C6UA 5F8HA 1SL1A 4ED3A 4K8XA 3OLBA 2Y1JA 4Q0BA 5EU7A 3M8PA 1ZYQA 2W9BB 1S1TB 4TXSA 2ASLA 5DK5A 5HBMA 1S0MA 3ICLA 5KFBA 4Z4GA 3TI0A 4NLQA 3QEXA 3TAGA 3MEGB 3HVRA 1SL0A 4ZPDA 3CM6A 3CJ4A 4CEBA 3LZIA 4FJ8A 3KLIB 2KZZA 1DTTB 3HKWA 3I5AA 3BSAA 2QXFA 4K4YA 1U49A 4ED7A 4CIGA 4NLUA 1VRUA 3FQKA 3VQ8A 3KLHB 3HT3A 2XGPA 3BQ2A 4WYWA 4JUZA 3OS0A 4KB0A 4ZTFA 3VQEA 3RB0A 4JS4A 1C0UA 4O3SA 2IJFA 3CJ0A 3UDLA 4AHRA 3T5JA 2OPSB 3NGZA 4W5OA 4ZMMA 1JIHA 4FLTA 4L8RB 5J2QA 4DQRA 5HLFB 1RT1B 1S97A 2RDJA 1FXXA 3KLEB 1BIZA 4DQQA 1IKXB 1QAIA 2R8KA 1KTQA 1JLQB 1Z4UA 2X74A 3DLGB 3OYEA 4B9MA 4KHWA 4WXWA 4TQRA 4O4GB 4QW9A 2YNHB 3O4QA 3V81B 3CJ3A 4CIFA 1SKWA 3RMCA 1ZTTA 1VSKA 2B5JB 3H4BA 4EBEA 4I9LA 4RNNA 2BE2B 3D28A 3OYDA 4FBUA 2IOCA 2IS3A 5KFKA 2QKBA 4QWCA 1S9FA 3SUPA 2UVRA 1TGOA 4BDYA 3AO3A 2GV9A 1J54A 4IFYA 3AVFA 2AGOA 1C0MA 1EX4A 3DOKB 3HP9A 3OS1A 2KFNA 2ZE2A 3K5OA 1RTDA 4DMNA 3PY8A 3CDEA 3NAHA 3MXIA 2X6SA 4F4YA 4MFBA 4HCBA 4OLAA 3I0SA 4KV8B 3AVIA 2IJNA 1RTHA 2G8FA 4IG3A 3VA3A 1S9GB 5CYQB 5KT4A 3NF8A 4ECWA 4CEFA 4FYDA 1S1UA 1HYVA 1TL3A 2VG5A 3C6TB 4H54A 4WFZA 4NCGB 1RT4A 1S9EA 1FK9B 3TVKA 3G10A 3BGRA 2ILZA 4MK7A 3LWLA 2EHGA 1ZTWA 3PR4A 3AA2A 1GX5A 3P1GA 4O55A 1WSGA 1VSLA 4FJ9A 4EYHB 4Q0BB 2Z1IA 3SI6A 3LALA 5HBMB 3HSTB 5KFCA 3HYFA 3ITHA 3VN5A 1L5UA 4K4ZA 1TK0A 5EWFA 4PWDA 5L9XA 4YQWA 2WK4A 4Z4HA 5DQGA 4WFXA 3NGDA 3ZSZA 2WCXA 4K8ZA 2F8EX 1QS4A 4RW6A 3GQCA 2RPIA 3KTQA 3NFAA 4J9OA 1C0UB 2A1SA 4ED6A 1W0HA 3ZSWA 5J2QB 1TKZA 4KAIA 2B6AA 4O3PA 1SUQA 1ZBLA 4FM0A 3V6HA 4J2DA 1CXQA 3QEVA 1VSJA 4CJPA 2XCAA 4KKOA 2G8WA 3M8SA 5FRMA 5JS1A 2J6TA 1YTUA 3M9NB 3KJVA 4ZP9A 2G8KA 1TVRA 4K4SA 5DG9A 4FS2A 1Z25A 5KFTA 3OYBA 2FBYA 4ED2A 2EC0A 4RNMA 3M8RA 2GIRA 4AHSA 3T5KA 3CVKA 3RBDA 4KB1A 4LD0A 4OGCA 2XI3A 1NNDA 4RW4B 4DTOA 2AU0A 1RT2A 1JKHA 4ECYA 5DLFA 4WZQA 3AVJA 3LPTA 4KFBA 1IKVA 2GC8A 4NLSA 3H4DA 1BL3A 1D1UA 2RN2A 5SWMA 3NAIA 3KNAA 3JYTA 4M3TA 3SPYA 1N6QA 5KFOA 2FJWA 4WXOA 1XI1A 4JV2A 3Q8SB 4CK2A 3H59A 3I0SB 3L3UA 1U47A 4JRQA 1RTHB 3KKRA 4M95A 3H08A 4YR3A 4IG3B 1FKPB 1LWFA 3QLHA 2VA3A 2BDPA 1S1UB 4BACA 3RMBA 3D0PA 2Z1GA 5L1LA 5KG5A 2I5JA 2F8TA 3K59A 1RT4B 2W8LA 3MEDB 3BGRB 2XWYA 3IN5A 3PW5A 4DFPA 4ECRA 1C0TB 2IA6A 2BQ3A 2RF2B 2J6SA 3H40A 3PX4A 3D45A 3H5UA
chains in the Genus database with same CATH superfamily
2FSKA 5KGXA 1UJ5A 3ZZ0A 3SCLE 2ADBA 3BS9A 4F4KA 3BF1A 3VQSA 2Z30B 2Z56B 4XH5A 3H2LA 3MPDA 4DTUA 3K58A 1IR0A 2XY5A 4PWDB 4LIRA 3NG8A 4LFBK 2O8EB 3W2WB 4AT1B 3OVBA 3AJDA 2UXDF 4JV5F 2NRTA 5M1OA 4ZVOB 3C15B 4EK2A 4RW6B 2MZQA 4L74A 4NLDA 5HMWA 2DR6A 2P9GA 4UY85 5F0UA 4WTOB 4IZ9A 3MN6A 3I9V9 2QGFB 2JC1A 3U3YA 4ZVFA 4XTTA 2AYMA 1KOHA 2UUCJ 2JLGA 2NYHA 1E6YB 4H0VB 4CESA 1RT5A 4DSIA 5HQMA 3Q8VA 1N5YA 3L9ZA 4YMEA 1FRKA 3GJQB 3OR1A 3BZQA 1PYOB 1EJ7L 4JI8K 4KKOB 1MU2A 4J91A 5DDRC 2NRZA 1YJ7A 3W9JA 2UVWA 1GQEA 4EO8A 4X62K 4ISGA 4N8OA 2XHWA 3MM8B 2WBMA 2CAJA 4F02A 2QA4S 3EY1A 4URQU 4BQZA 2FJDB 4JI0J 2ZJRL 3B6PA 3LDQA 1JLEA 1BQNB 4NPOA 2RIJA 1FJ7A 2G8VA 1N4LA 4EP5A 3VV2B 2KN4A 4U67L 4DSJA 1WSVA 4KFBB 2XS5A 3AVHA 2NUHA 2ZWOA 1PYTA 3SV4A 2HQFA 4DQPA 1SJFA 1KVCA 4PXCA 4H4OA 3OVSA 4DU8A 2XZWA 3A1YG 3CB4A 1WHVA 3QNOA 1JK9B 3I5BA 4CHZA 2DYAA 1Q4RA 1HRHA 3Q22A 1GLDG 1XUPO 3N4QA 5EGYA 2LQBA 4F3TA 2A2DA 2DHAA 1QJHA 4DV7F 3V6DA 4UF4A 3RTVA 1OS5A 2GGPB 2HZCA 2HFZA 5KT3A 5GADI 3NDKA 2MZSA 5L46A 2H1YA 1W25A 1T3OA 2E1MC 4E7LA 2DJWA 1HHQA 4PY5A 1WORA 3GV5B 1KNZA 2FC8A 3HHEA 2MQOA 2HFVA 1AW0A 4KTZA 1TZ0A 2D0AA 3TA1A 4Y2MA 1EKEA 1WG1A 2VPXB 4BGBA 2HZVA 4DSLA 4IFVA 1N5VA 2EFNA 4OX7A 2V9WA 1SH3A 4I1TA 1T6DA 2ZQBA 4Y0FA 2FYXA 3JAMO 2ZDOA 3EJMA 4LF9K 3LZJA 2FVCA 1T8EA 1YHQN 1TP7A 2DXFA 1QAYA 5T7BA 2DO0A 3SPZA 4A8FA 2YTCA 2ATQA 4CZLA 4CHQA 1GOAA 2VONA 1WSIA 3WEEB 4B3OB 4OV6A 1DY3A 3D67A 3IDHA 5JJBA 3TNVA 4ELVA 3VQCA 1QY7A 2P9KB 3CCQS 5DQHA 5IC4B 4KIAA 4DFKA 1K1SA 3FZBA 1SKRA 2V8HA 2ZVSA 4FLVA 1W2BM 4NLCA 1UEUA 1RXOB 5DQIA 1UWBA 5T7LA 1NJZA 3ULEB 3A8JA 3PUFA 3L4QA 4TY8A 2CPJA 2OFHX 2R7XA 2PC6A 1H1VA 3M05A 2OPPA 1EP4A 1S12A 1VQ8N 5IOLA 3HDSA 3W5ZA 1K73T 3T19A 1X8DA 3PKMA 3MM9A 3BPSP 3CJBA 3NGIA 5JMNA 1I94K 3NF7A 2QSFA 2IDOA 3RSEA 1Q82T 1PYSB 3ZYYX 5BN8A 2CA9A 1PSDA 1UEKA 4FJ7A 1A5XA 4ZVEA 3QETA 2HVIA 4IOXA 2UUCF 4OPJA 4FS1A 1ILYA 4LFAF 4Y2CA 2HHQA 4LR7A 1RAHB 2XMTA 4M63A 4URGA 3F5TA 1Q9YA 2EEYA 1NAQA 4A48A 1FX2A 4C8MA 1HD1A 4YOVA 3QJPA 3G0ZA 1RILA 3HTVA 2DRDA 4IUFA 3CG7A 1IM4A 3O4NA 4BRCA 3SXLA 2VIHA 2DNHA 5JVGQ 5DZ6A 1RDDA 4X66J 3O2IA 5CXTA 1HMVA 3CJRA 3C46A 4IFEA 2J9DA 2LA6A 2QX0A 4OJ1A 2M8DB 3LAKA 1R43A 4DN0A 3FDSA 3C95A 1IWGA 2GVZB 2IA0A 4DR6K 2LDYA 3MR6A 2HS3A 4J9MA 5ITHA 3IAM9 3A2FA 1CG2A 3WXLA 2G13A 2YHBA 5A76A 2KT5A 3KOAA 4ZCMA 3E2EA 4JI1K 3V1OA 1WLJA 3QT6A 4EGLA 3QJLA 3UN3A 3HCXA 4CZFA 1BWFO 1NZ8A 5HO4A 1XHZA 5KG1A 1RT6B 4DR7J 3LA0A 4RU2A 1YJWS 4B02A 4C8ZA 1RAGB 5HVHA 2MB0B 1BUPA 2AJFE 1JLAA 4X64K 4LF5K 1CJTB 2IDLA 4WE1A 3OFGA 1Q78A 3DDIA 3HULA 4B1WB 1YZ6A 3LP3A 4DR5K 3M8PB 3JAMU 3MGJA 3THTA 1NG9A 3WXKA 4PEOA 3IBCB 2BW2A 1KQFB 1QAXA 5J2PB 1UVKA 1KQSR 3GONA 2ZBCA 1TU0B 3TWZA 1PKUA 1U1RA 4M3RA 3QEPA 1I51B 1VRUB 2O01C 4PL8A 1QAJA 4K2XA 3VF6A 2HS4A 4GKKJ 3W8GA 3Q86A 1BWEA 4I2QB 3CW2C 1N36F 2HFNA 2QRRA 2QWRA 4CLTA 3MFIA 2ZBRA 3VF4A 2U1AA 5GAGP 2KRBA 4UY8T 1FRIA 2YKOA 4JD2A 5D3GB 3UVJA 4NLYA 5D0HA 3UNGC 3PIOL 3VF0B 4ISFA 1OQ6A 2HQGA 1N32F 1MG7A 3RW7A 1NBWA 3C0BA 2H3GX 2MKSA 5KFNA 1O8BA 2QJ3A 3C19A 2XEXA 2AD9A 4DTMA 2VBWA 3X3UA 3OYIA 3THPA 5AQLA 4BROA 1HPMA 2O8DB 3DCAA 4C11A 4BVOA 4ZPVR 3BPDA 2DNRA 1S6PA 2LKZA 1NZAA 4KPYA 4M63C 3VALA 3CF5Q 1MWZA 2FB0A 1X4AA 1B0TA 3MM7B 1HNZK 5M1KA 1DGKN 2P9LA 2MY7A 4P52A 4CZHA 3CCLN 3KHGA 2PMHA 1BCOA 3VTIA 2X78A 2IMOA 3F9MA 1SL2A 5LJ5Y 4A59A 2XMMA 1TYQB 2RDIA 3DRRA 1T7PA 2VG5B 1C2PA 3PR5B 7FD1A 3DHWC 2F8MA 1NMNA 1GMVA 1RWWB 3SAHA 2MSSA 4LMZA 3WIVA 4J9QA 1S9EB 2BX6A 2KJVA 5JLHA 2A10A 3SLCA 3MWPA 2XMKA 3X1LB 3KHYA 5DGAA 2KXFA 2OEKA 2JC0A 2ZBQA 1VQLS 4DR4K 4X66F 1AROP 5LM7E 1Q95G 3SCIE 3C8YA 3T5LA 3VQTA 5TKWA 5B0AA 2E88A 1HYSA 4RWTA 3IG1B 1HR0F 2YHWA 4F4ZA 4E7KA 1PJ7A 4G6VB 3J7YI 1YTYA 4OZNA 5B0CA 4M5JA 1TUYA 2OHDA 4GVBB 1WB9A 3GSIA 3O3FA 3UFCX 3MEEA 3OYMA 4DU1A 5KFAA 3RBXA 1URNA 2IFXA 2QA4G 2AIRB 3HHLB 2XBPA 4KPCA 1FDDA 1NKCA 5C15A 2DITA 4UTGA 5GAHP 1YZ7A 3A3NB 3B6BA 2HBJA 5IWAF 5BN9A 5D4NA 1IBKK 3V9ZA 5LL6d 4DR7F 5J1NA 4FBTA 2CVEA 3NY0A 2M0GB 3LP0B 3O08A 2QWQA 3V2UC 1IJJA 2IVNA 1X0FA 2HHVA 2LQ5A 1M5VC 3MD3A 4MDAA 5EX5A 1U4BA 2E7WA 1T9VA 3AO1A 2LYVA 5AQGA 4MLEA 5F0WA 1JKHB 1NBEB 2M5YA 3DHXA 3ELHA 4RW8A 1XERA 1DLOB 4X2BA 2I7NA 4EHUA 3HSZA 2PDAA 5F41A 1AB8A 5KG7A 2V8PA 1XTZA 5ETLA 3GPAA 2NREA 4EP4A 4CGIA 3K8VA 4TY9A 2V9KA 1IKWA 4FJGA 2GAGC 4H0TB 4ALZA 2KO1A 2LU2A 4DV0J 1CJKA 1TUUA 1U0HA 3MAQA 4F4XA 3RAMA 3NF9A 3TSPA 1H7XA 2ATLA 1HIYA 4E1NA 2W9BA 4JI3K 2GELA 1T9YA 4KQZA 2XY8A 3EDQB 4CNZA 2W6LA 4USMA 4DR1K 2Q6BA 2V2ZA 3SI8A 2OPQB 4KI6A 3L2RA 1RDWX 1DTTA 2AX1A 1CXUA 1WKJA 4KB7A 2F4VK 2EPIA 4XH4A 3V9XA 4BRHA 3AXKA 5J2NA 4MKAA 2BYCA 4LSNA 3LDSA 3NL0A 1KTVA 1QVFM 4U7UD 2E5HA 1SC1B 5GAGI 2V34A 3MI7X 1Y64A 1GLCG 3H25A 5C24A 4PXBA 1PG5B 3LGMA 4QU7A 1DEJA 3KUHA 3V4IB 1K0VA 1D5AA 2XHCA 4MIBA 3IAYA 3KKFA 1F21A 3CJKB 3Q7BA 1TQLA 2P9PA 4FF4A 3UR0A 2VFSA 1T3NA 1NDLA 5E3PA 2XS7A 4B9LA 4JEPA 3PTWA 9RUBA 2LA4A 5J1EB 2QIFA 4OO1J 4ZP6A 2E1YA 2ZH2A 2ILYA 3JQMA 2CJKA 2H9ZA 1B64A 2HWHA 2BANB 4C0HA 3AD9C 3TR8A 2DT9A 4YHHJ 5AQFA 5GMKa 3IRWP 1FJCA 3N6NA 5DMRA 2KT3A 3D1QA 4F8RA 1VDHA 2R2TA 2FIUA 2KL8A 2BH1A 3D5MA 4JLHA 3DC2A 2HHPA 2ZHAA 3VAMA 1E6VA 5F1XA 3DLKB 1Q81O 4FF3A 3OPKA 3EMTA 2BXJA 3MURP 4DR2J 1NM1A 3MMVA 2YVSA 1WSHA 2VQEJ 5C10A 2AX0A 3TA0A 5TKYA 1MMDA 1U8SA 2VPZB 1BG3A 4QW8A 3O9SA 5BR9A 4NLRA 1YQHA 1OYDA 3D4JA 3HD1A 4FLZA 1SJ3P 3QAEA 4TN2A 1T0TV 1LEOA 1YJTA 2J5AA 4BRNA 3AA9A 4NASA 3I0RB 2JEJA 1FEEA 1IJEB 4MYTA 3D0IE 4H5RA 3UD3P 3EXCX 4H4MA 5EN1A 2KFZA 2QFIA 4TYBA 2G8IA 4M94A 2ZJRQ 3D1HA 5KT5A 3PW4A 3FQLA 1GEHA 4FJHA 3E51A 1WEXA 2M7SA 2HHTA 1VQPS 4RG8A 1FI4A 5DRKA 3LWMA 1REVA 4GVMA 2PZSA 3QT7A 1IXKA 3ID8A 3EZ5A 2CJAA 2WSCC 1IBMJ 3BSOA 3U6FA 3VPZA 1JLBA 3P5JA 2ROGA 1KVJA 2IIRA 5AE2A 4CZKA 5FRNA 3M5RA 2ZH7A 4O4RA 3UO0A 3QO9A 5FDLA 3SQ0A 3W5XA 2E5IA 1MWYA 5CD4H 3RR8A 3HF5A 4I56A 4BRPA 1JNZB 1TELA 3O9RA 1U2VB 2J4RA 1R6VA 4J7CA 5ETPA 4DV0F 4WFAQ 4YB5A 4FYYB 3NGYA 2GQ2A 5CH7B 3ZSVA 1YX2A 4H0PA 3ONQA 2R7TA 2XO7A 2ZJPL 3QIPA 3K5NA 2GAHC 3ILIA 1ZBFA 4DU3A 3EWGA 3AXMA 4W5TA 3M6GA 1HPZB 1OSDA 3TAMA 4CH7A 4W5NA 1CJUB 4B9NA 4YN3B 1I3OB 4RLEA 5AZIA 2B7CB 4NLXA 4CGGA 1VQMS 3L2WA 3HZEA 4JKGA 4GMKA 4JK8A 3KWMA 1HNXJ 4JBCA 4LSLA 3RB3A 4B3TF 3FMWA 3AB4B 4W98A 5HK4A 1CZAN 3AFGA 4LJMA 1R27B 2MY8A 4PPDA 3SIPB 3E01B 4DV5F 1FKOB 1S1XB 2HNYB 1FD8A 3CCMS 2AQ4A 2UXBK 2NSCA 3Q89A 4KO0B 3OUYA 2HOEA 3JTNA 4ZITA 5B0DA 1TMJA 4P2FA 3UKRB 4A8MP 3GV8B 3A5LC 2HNDB 3D2FA 3ENOA 4DS4A 3J81j 4KTWA 2JHEA 2BVZA 3DGPA 3KLGA 1RTIA 1VJQA 4YHHF 3S3OA 1B92A 3CD5A 5KFRA 3UDCA 3PV8A 4YOXA 4I6AA 1SJ4P 1C1BB 4OFZA 2W2MP 5C25A 1T03B 3QFWA 3LP1B 3A5MC 1WF0A 2OMOA 1C0FA 1FXRA 2P2CB 2ZH5A 1VFJA 2DHHA 1FTCA 1WHWA 4G1QB 3ZZUA 1EZZB 2QE5A 3GWCA 2W40A 5HVFA 1YXQA 1YI2N 2R2RA 5K8MA 3KDOA 4NLVA 4DR2F 2DNQA 4O44B 1A7GE 4K59A 4BQLA 1BISA 2HF3A 4CW7B 3GG1A 4NI2A 2R3VA 2WONA 3PCOB 3EZWA 4ES3A 2VQFJ 1WSJA 3G6EN 3PO5A 3ZXWA 3MUTP 1T02A 3O9QA 3BDPA 4CZMA 4FSVA 4OL8A 5K14A 2BW7A 2VODA 1HI1A 4FYXB 4KHMA 2ZD1A 1HI0P 1OPZA 1QVGR 3HOTA 5BR8K 3HVWA 4KY3A 4OLBA 2NZCA 5BJRA 2IM2A 1RT3B 4EFHA 2NCKL 4ED5A 1TKDA 2PSZA 5FJ4A 2KB2A 4I6WA 2BJEA 5CYMB 3CC2N 4ZPCA 3HPGA 1U6FA 2EI5A 5IQ6A 3R3LA 4KH6A 4BG9A 3LP2B 2E5JA 1GFWB 4O3NA 3OYLA 1S0OA 2DNOA 1YUWA 1E3MA 2KRRA 3L7OA 2DKOB 1DTQB 2D0CA 3I4PA 2QLFB 3SV3A 1D9DA 5EXWA 3P6YC 3FZHA 2A42A 2QFJA 2CQ1A 5AXKA 3OVAA 2UZAA 1V9OA 1WI8A 1VRQC 4PQUA 1K9MT 4ZA1A 3M30B 2E66A 1HQUB 1KWMA 3L7UA 1FFWB 2YQ1A 2CQCA 3CDUA 3QB0A 1T94A 1RYRA 5HJYA 3SDEA 3MF5A 4MQ3A 4CBUA 1KN6A 2NRHA 4NYPA 3T6BA 1S1VB 3P45B 3CCJS 1LAVA 4DTPA 2VJUA 2PA3A 1YF5L 2OA8A 5K20B 4BWJA 8ATCB 4Q7AA 5KFWA 3DOLB 4M3WA 1W7AA 5HP1A 2GJIA 2LQJA 4ILMA 3TSUA 2ZVIA 2YPYA 3FBCA 1X9SA 2H4WB 2NQPA 2Y1LB 4CEDA 1OMSA 4O3OA 4LH5A 1I3AA 3BO3A 3OBWA 4O3RA 3KG4A 2BQRA 2F63A 3V9WA 2GW8A 5LMNJ 1BI4A 5B09A 3AQPA 1NK8A 4DPXA 1FNXH 2D3O1 4PUOB 1FA0A 2D5RA 1KLNA 2O4IA 1TFYA 4HDGA 2YNGA 3BKTA 1GK8A 2V0NA 2VFUA 3DLLL 1U25A 1TL7B 1AXQA 1H2UX 4EEYA 2VF3A 3RRHA 2E2PA 3PIOQ 1Y4ZB 2O8CA 3VQ9A 4DUZK 3HXMA 1WJ9A 5EY4A 4B3RJ 2OANA 5CCLA 5IT9Y 5DM7L 4OKKA 3QSYB 3ZETA 3LUYA 4CEAA 2YNFB 2EFPA 3U1LA 5K8PA 4M3ZA 3E9LA 3KLHA 1NGDA 2CNNB 3IA0A 3TYTA 2O8BB 4GO5X 4X4PA 2L08A 1J53A 2CJBA 1V3ZA 1CC7A 4F2RA 4Z4FA 2GMJA 4NRUA 2HAIA 5KGWA 3KG1A 3OA9A 3SYZA 2M9KA 3D7EO 4JK9A 1U1MA 4DV3K 3S9HA 3NH2A 2ZKUA 2BE7D 2QXLA 4BR0A 1XBWA 1Y5IB 4QOZB 4CIOA 2K3KA 2ALYB 5DDOC 2XMUA 3I8DA 4C48A 4Y34A 2VFVA 1FESA 2R7RA 3SNNA 2GUIA 3GP9A 3KHLA 3THXB 3R9LA 5C5JA 4KHPJ 2YKMB 2GCFA 3POTB 1OWXA 2EG2A 3C65A 2CPIA 5MLCV 4ECUA 2MKIA 2HFOA 4LREA 3WNFA 1KVKA 3NKYA 1T44A 3CCQN 2OAUA 3KK7A 1TAUA 2WOMB 5T14A 2XYPB 3DDNA 3CCVS 4R8UB 1S4EA 4WBFA 3CSKA 1RAAB 4WP8A 4TLRA 1ZBTA 4OI4A 1C4AA 2H5JB 4ZVUB 4PKGA 2JEFA 2D9OA 1IM6A 3C6TA 4DF8A 1S79A 3ZC4A 4DKWA 1U8WA 4JKAA 1FDAA 1FK9A 1R0AB 1LXNA 5G0RB 2KFYA 4R0EA 4FZVA 3MPYA 5LMUK 2UUAK 3EL2A 3C6UA 5F8HA 4PWUA 3BB5A 4C2MA 4JI2K 4DUYJ 2VDHA 1IR2A 3MM6A 5HBMA 1VK8A 3NOCA 2PMWA 1S76D 3VESA 1KQSM 3TAGA 5AQKA 3UD4P 3PRDA 1SL0A 2WAQD 1ZAWA 3LPEA 2ZOFA 4ZPDA 3CJ4A 3CM6A 3O6WA 4HHHA 3QMLA 5GIPA 2HSEB 4NLUA 1KQGB 4WYWA 2OSRA 4BHQA 3OS0A 1YIJN 4WWSA 4O3SA 3CJ0A 4OHWA 4OPAA 3NGZA 2HQCA 4W5OA 1U1QA 5HLFB 1RT1B 2FXUA 2WW4A 3EGVA 3FEXB 3U8XA 2ZBIA 1IKXB 1QAIA 2GJ2A 4UOFA 1JLQB 1Z4UA 4U7BA 3DLGB 4TQRA 4LFBJ 5LMNF 2P9EA 3D0GE 1D09B 3O4QA 3CCUN 1W26A 4JYAK 2BKNA 1RABB 2PO4A 3RMCA 1ZTTA 4EBEA 4RNNA 2BE2B 3BYRA 5E33A 4HI1A 2IIHA 2IOCA 4TU8A 2YJFA 1TFWA 3ZZYA 2GV9A 4IFYA 1NNEA 3AVFA 2AGOA 3KWIA 1Q86O 3DOKB 3WX4A 3DWLA 2LECA 3CDEA 2PGCA 3OTDA 3MXIA 1FRHA 4MFBA 4HCBA 4OLAA 1YJWN 3AVIA 3W65A 1RTHA 3WX8A 3MAAA 1S9GB 4ECWA 2CQBA 4FYDA 1FFGB 1CQNA 2VASA 3J80O 4H54A 1BE4A 2DRBA 1U02A 2G1HA 2NLWA 4H0YB 3PR4A 2DNMA 4P73A 1GX5A 3FNNA 1WSGA 3UN5A 2D1CA 4Q0BB 2Z1IA 3SI6A 4DXLA 1HX1A 2BMBA 2QM1A 1KXPA 1FJGJ 4F3QA 5KFCA 3TO8A 1N8RO 2V68A 3ITHA 2OEJA 2F9JA 3VN5A 1L5UA 4K4ZA 4NA1A 4KHPF 5C2FA 5EWFA 4PWDA 3BN7A 2O8EA 1HWLA 3W2WA 1VIOA 3I33A 1TUWA 2LMIA 1F0XA 3L3CA 5K8NA 3C15A 2F8EX 1MNEA 4RW6A 3J81Y 3THWA 3G2XA 3GQCA 1YRUA 3ZNJ1 2RPIA 3T1HK 3NFAA 2DNLA 3CEDA 1MN7A 3J7ZO 3VEYA 1E6YA 1KR4A 1FCAA 1RAIB 2LXFA 3DRXA 5J2QB 1TKZA 1GXUA 3QQCD 2B6AA 2QWPA 3D0HE 4CLKA 3HRGA 3ET6B 3UCGA 3V6HA 3O1WA 4CJPA 2OMLA 1EAYC 3OXGA 4KKOA 5HN0A 5JS1A 5DG9A 1S7IA 2CVIA 3OYBA 2EC0A 3E3XA 2V4JB 2WVBA 3C14A 3H45C 2GIRA 1X4EA 2Q6CA 4JI4F 1VGYA 4KB1A 4ILGB 1CQMA 2X1AA 4DUYF 1SC6A 2K8GA 5D6GA 1R8HA 4F0KA 1X4FA 4H5VA 4ECYA 2VUGA 3AGKA 3AVJA 4KFBA 1D1UA 2Q36A 2C1EB 4G9ZA 4F0HA 4WXOA 3DJCA 4JV2A 3L95X 3I0SB 1YRTA 4G1PA 3U7JA 5K9FA 5HOOA 3H08A 4YR3A 3E9OA 2XS2A 2OO4A 3IP0A 5THWA 2CIMA 4J37A 1S1UB 3VR1A 3BZCA 1OIAA 4GVLA 1CEZA 1VQLN 2LU1A 2F8TA 3K59A 4FPRA 1RT4B 1TUVA 4B1ZA 3J7Z5 1YWXA 3BGRB 5DETA 2J6SA 1UEVA 4FVCA 3PX4A 5HQLA 3C16A 2GGPA 5AZJB 1OQ3A 1MMNA 4ZVPB 5BYQA 4OYIA 2HLUA 1VISA 1DQAA 3MMBB 3N6MA 1B3TA 3TPQA 4FWOA 2C2EA 2XZDB 4P75A 4UT4A 1A5WA 1SPBP 4LFBF 3PW0A 1Q8IA 2ALZA 3KK2A 2PEHA 4DR3K 4I6YA 5F8GA 2KTQA 4FZXC 4G65A 1BHNA 2UUBK 2LXUA 2NXCA 4E7JA 2K1RA 1PAUB 3KJFB 4DI6A 4AHUA 1S0VA 4RPFA 4FJMA 2ZJPQ 2GHVC 1VAZA 5L1IA 4NA3A 3GLJA 1BUXA 3T6JA 1SJ1A 2ZITA 3GOIA 1R8PA 3U1MA 3J80U 3BJYA 4DV6J 4B1VA 1ZM9A 3THVA 4WU2A 3TAPA 3R27A 1CJVB 1SAZA 4DCPB 3M1VA 3AD7C 4I64A 4FWKA 1N34J 4E0DA 4WQ4A 1NJIO 3WEEA 4B3OA 2ZHBA 1AZSB 2C2DA 3SUOA 1VI7A 4NXMK 5IV3A 4CFAA 2Z4PA 4ZIWA 2OUGA 4RX6A 2IPOB 4WCEL 3ZSXA 3AAWB 3IMXA 2QLBB 2KQ2A 4K41A 1J5EJ 3KVGA 3VAKA 4HHTA 2BOAA 2MGZA 3JSYA 1IKVB 1HWKA 2DNKA 2HVZA 2WHOA 2WVEA 3QFUA 3BREA 5AJ3J 4DTNA 3GFXA 2YWGA 3JYTB 3ASMA 3H42A 4I7FB 2P9UB 3MPVA 4P71A 4CHNA 4USWA 5AQHA 1UA0A 4FJ5A 1ESVA 3GJTB 1ZC6A 1P1TA 4OZLA 1D4XA 1FE4A 5CE3A 4ETZA 1U6ZA 1KONA 4B08A 4EYIB 1T05A 2HHSA 3MXJA 4CF0A 2QSWA 4RBVA 3OXLA 2QWLA 3OJSA 4TQSA 2KJWA 4J9LA 4FJJA 4FM1A 2JZ5A 1NK5A 1PJ6A 2W1BA 1DKGD 2G2OA 4DR5J 2B4PA 3FE1A 4YY3J 3CC7S 2P5VA 3JAMY 4NZ0A 2W9AA 1AUDA 5EDWA 1VHXA 4B3SK 1XC9A 3ZX0A 1RISA 1UJ6A 4V19S 4LBHA 2RKIA 3B82A 4NYOA 2QO3A 4QJVA 2BZ2A 2EVZA 3KK1B 3NNCA 4B1UB 2CPHA 1KFDA 4I2PB 4DV2J 2J9EA 4JI7J 2GVZA 1T9TA 1Z05A 2E4LA 4O3QA 2CG4A 1H2VZ 5KFPA 4FWMA 2HQDA 1XNRK 2AF6A 1QM9A 3T5HA 4QYZK 1WC3A 3K2PA 2B51A 3CCEN 2QL7B 1UJ4A 4OHYA 2B4OA 4DBQA 1T9UA 2XHBA 1QDUB 3MFHA 4ANDA 5DS7A 2JVRA 5KFDA 2G9OA 4A57A 4WFBL 3R7SB 1NHUA 4MIWA 2R7UA 3DM2B 4KGMA 3L0QA 4XH1A 2O66A 2W42A 1L3KA 3PJWA 4J90A 3KLFB 4V1Ak 3GFYA 3EPIA 4HDHA 4DCHA 4LF6K 1P1LA 1VQKN 1ZM3A 2ZH4A 3UB5A 1DAXA 1CJTA 4C8OA 1RBAA 4FXWA 4FPBA 1NM2A 1I94F 1DQ8A 3NCIA 1TTHB 2V4RA 1S3XA 5M2RA 1UAWA 3D6HB 4RW7B 2VCPA 4CJ5A 4WQ4C 5AQNA 2E5LK 1HJOA 2V8DA 1WEZA 5J2PA 3TTDA 4FN5A 5ADZA 2VH7A 1JCFA 1VQ8S 2GJFA 4YR0A 2GEMA 3P38A 1NJYA 3W0LA 4ZVSB 5E84A 2FHJA 1V5VA 1IKYB 3FFIB 1SKUB 3W8PA 5HROB 4AHCA 4I2QA 1IBLK 2DNZA 4N41A 5FD1A 1D9FA 4YUDA 3VAFA 2FQQB 3R9PA 2CDRB 2CKWA 4JN4A 5DGBA 1X5SA 1YVFA 1Q86T 3VAGA 3FGVA 5D3GA 2MKHA 3HHDA 4H5WA 3OYJA 1VQPN 3MECA 2DCUB 1ZXOA 1LWCB 3TZYA 5KFZA 3TRGA 2DTJA 1HBMB 3QEWA 2YHXA 3LAMA 1P9QC 3DLLQ 3IR7B 5BXIA 2FJVA 3MN5A 4O5BA 3EYZA 4Z4EA 1CULB 4P7TA 2NXUA 5GAHU 2O8DA 5AJ3F 5ETQA 1VBXA 3DXBA 4F36A 4N8NA 3NMRA 1HLUA 5CZ1A 5DM7Q 1VRTB 1C0GA 4KBIA 3MM7A 7AT1B 4RUAA 3P49B 5C2DA 5K5MA 4J9SA 5JICA 3OTOJ 2FBTA 2JVOA 1UW4A 1X4GA 1IV0A 4RO0A 2OD4A 2O8FB 3W9IA 1M5OC 2W01A 3HT0A 4LF5F 1DHMA 3FJ2A 2IY5B 2E7XA 1QVGM 1M5KC 3AQOA 3VWSA 5KPRA 4FK2A 5A0YB 4OYXA 2G8HA 1W2BR 1F9HA 2XY7A 4CF8A 5DJBA 3R5JB 4ELTA 4DR5F 4YY3F 4FOIA 3HX9A 1MW7A 3TVYA 3E8OA 5A6PA 2JWKA 2QMXA 2RU9A 2C28A 4BR7A 2HRTA 4DU7A 4E2FB 4W5QA 3P4UB 3VZHA 2OZSA 2JFDA 2ZWPA 3IRXB 4DV2F 3IG1A 3HOSA 2QA2A 3CCMN 2UXCK 3AA4A 4QS7A 4PA1A 1FRMA 3HVTA 4CM0A 4GVBA 1RGVA 1U2CA 1RJJA 3OBIA 3AO5A 1E4FT 3QYYA 1NLKL 1TL1A 4ZVHA 4U8VA 3HHLA 1O1WA 5KT6A 2A0FB 2CQHA 3TR5A 1UKUA 2GUPA 4DPWA 5IM0B 3DU6A 2RVJA 4LIWA 4ZPBA 3IR5B 2QL5B 3NBPA 4DV4K 5ADXA 3CWJA 3DRSB 3JXOA 2AYEA 2E1AA 4ZVTB 4NMLA 2DFEA 2B9XA 4KSEB 3LP0A 2JLFA 3FCWA 3KZBA 4Z94A 1OSCA 1NK7A 1RT7B 1V5IB 2JGUA 4IKAA 3LM2A 4LQ9A 4MYUA 4GKJJ 1RLDA 1TKXB 3PZPA 2AEJA 4ZVRB 1RHRB 5H1SQ 1FFSB 1B9FA 4E7IA 2E5GA 4PYDA 5HAOA 3OXFA 4DL5A 2VB6A 3H20A 2CDQA 1CZBA 3DU5A 1DLOA 1HNVB 1U7LA 2ZE2B 2K2PA 3CO9A 2B4JA 4M3UA 3R5BA 4FOEA 2DNGA 4U7UK 3IKMA 2FD2A 4B9VA 1VQ5N 3BYPA 4K4WA 1RWPB 2ZC4A 4HI2A 1TL3B 1S6UA 4FLUA 2Y3YA 3CCLS 4OKJA 4RNHA 3CJQA 3UKUA 1X9WA 1HUXA 4WP3A 3JSBA 2OPQA 5CZXA 6AT1B 2YNIB 2BBEA 3JSMA 4NX9A 2FLNA 3SK3A 1VSMA 4FJNA 2ZM6K 1TL4A 1CZ9A 1WSFA 4ID8A 3SUQA 5AFUH 2PT0A 3LOUA 4ZCKA 1IUJA 1B0PA 4IOBA 3CCWA 1NJIT 1HBOB 4EU0A 2JDJA 4M5DB 1EKRA 4CF1A 3AVKA 3ZTPA 2IMWP 1Y7PA 1U09A 3RBZA 4Q43A 1Q9XA 2JEIA 3NMUA 3MXMA 4ID5A 2VZ9A 3LPYA 3I31A 4QWEA 3P39A 3MR7A 3V4IA 3UDEA 3NH0A 4PXDA 5IT4A 3D66A 4ZLJA 4P72A 3CJKA 3RRKA 1QD1A 1KD1O 4JV5K 2UXDK 3ZT1A 3M6VA 2FJXA 3OTOF 1OY8A 1YK9A 3TEGA 4OKEA 3I8BA 2R4FA 4EI2A 4CJ7A 3N4PA 1B99A 3OY9A 3BBFA 3B54A 1KBRA 1RWVB 5L9NA 2DFHA 1XNQK 2NRWA 2BANA 4H0XB 3MCPA 1TVRB 5CQGA 3HFVA 2LEPA 4ZN3A 4WYBA 3C94A 4K7QA 4H8KA 2KM8B 3ZSRA 4BRKA 1GLBG 2LEAA 3R2CJ 1VQ4N 3M6XA 2PFUA 4PYAA 5DM6L 4ILRA 5KRSA 5BPNA 3RR7A 4GV9A 4LQ3A 4KGVB 1WOQA 3C2PA 1RZMA 1FE0A 1WWHA 4DCOB 3HHLC 3OHBA 4AQYJ 1GOBA 4QS8A 2HFUA 1GLAG 3U9DA 4WIIA 2DPIA 5JVGL 1UFWA 1LXJA 4M41A 2YX4A 2DISA 2V52B 1KAYA 1PIEA 3CM5A 3IBWA 3H7HB 4JI3F 4DWIA 1H73A 3TP2A 2C2MB 2IDEA 2JNJA 2VDIA 2POKA 2KYXA 2Q0UA 2VWKA 3PNIA 4HVJA 1FVSA 4CFDA 3A8EA 5ETSA 2F4VF 2VA2A 4FKYA 4KT0C 3RRGA 3L2VA 5D0EA 3KLIA 4ATNA 3GMGA 5B0EA 2MQPA 4USKA 5L1JA 3TUPA 3SMPA 1RNHA 1RWOB 4DV7K 2ETJA 2MLYA 3NGTA 1W2IA 4CLPA 3VTHA 3WUHA 2VBZA 2QL9B 3QT5A 4RUHA 1RE1B 1XN9A 5M1PA 2VG7B 2ZH9A 1G4CA 3KHRA 2CXEA 4DSKA 3AD8C 2JWLA 1HNIB 1Q8LA 4GKJF 4DFJA 2OPSA 3KDNA 1V4SA 2A1RA 4QQBA 4ERDA 1ICEB 4DCJB 4BC2A 3U9ZA 4CCHA 1SH0A 3IS9B 1E4GT 3AO4A 1N48A 3GIJA 2J0QD 1QSLA 3MUMP 4I6MA 3AVGA 4OZJA 4PCQA 3OW2M 1XWLA 1RT5B 4DTXA 1SS6A 4CJFA 1VSHA 4UQGA 1N5YB 2RUGA 2AEMA 3OR1B 4ZDNA 3OL9A 1U2VA 4I68A 1QQCA 2ZJQQ 3SBTA 3WXJA 2YWFA 1WOPA 3UCUP 4QOTA 4CZGA 5E3QA 5GAEU 1RWXB 2JWNA 1CC8A 3VHQA 4U8YA 1FRXA 1D0EA 2XCPA 2BJDA 1IG9A 1GLEG 3R5DA 3UNYA 3G6XA 1UZHA 1H6KX 6FDRA 1SKSA 5MLCQ 4OX9J 2RSQA 4L3KA 4JKBA 5CYQA 3CJ8A 1JJCB 1CJUA 1T95A 4NCGA 2HRYA 2KKZA 1YVNA 1RSCA 1RTJB 2PFFB 5L39A 3D6MB 1QUPA 4FF2A 2KHDA 4ZLLA 4KHYA 4BRGA 4JI6K 1LW2B 1P8GA 4H5NA 4CD3A 3HPHA 5I3UB 1TK5A 2OLWA 2HNYA 3HSCA 1NGIA 3PYEA 2P9NA 4V19X 1XMOJ 3V6DB 1KVBA 2DTUA 3VGMA 1VK0A 3S6EA 5AQMA 2F4FA 4OYMA 4J9VA 2A6AA 2UUCK 3CF5L 3MAHA 1EHWA 1QUVA 2RU3A 1Z2LA 1S59A 1JJ4A 2QWOA 1Y5LB 4WCEQ 4Y00A 3N79A 2KDOA 1RCHA 4H4KA 2OJ3A 3DFEA 1QVFR 3EDRB 4IRDA 3A3OB 3WQPA 2EC2A 1DURA 1T03A 4Q45A 2F1FA 3H98A 1NKEA 3LP1A 3GTYX 4IFVB 3NF6A 1JJ2M 3ZEUA 1RA6A 3VQ6A 4JI0K 4AQYF 4C3MA 4L72B 4MK8A 1WEYA 1Y97A 3LW5C 4R0JA 1K8KA 4KJIA 4AM7A 1QHTA 1FF2A 3N0VA 4LRDA 2HIQA 1ITGA 3OYCA 1HW8A 4ANEA 4CLYA 4DU4A 1BQXA 1FW6A 4C9DA 2FGOA 2ZUAA 1Q0NA 3BV8A 4DL6A 1RAOA 1KVAA 2IM3A 5CYJA 3Q2TC 2H5IB 2C3YA 3RUBL 3DLRA 5K8OA 4CEOA 5T7LB 1AA1B 2AP6A 4PKHA 2HZAA 1RT3A 5E7OB 3UWTA 3N01A 4TY8B 3KK3B 3JTPA 1FKPA 5H9EK 3HO1A 3HM9A 1T6CA 4CYUA 4Q8EA 3L6QA 4CRJA 5AE1A 3O1LA 2OPPB 5DG8A 4OJRA 5JUMA 4RNFA 3DOMA 3MEDA 3SEOA 2WRMA 4DZDA 3BGFA 2XGQA 1C0TA 4ZS6A 3LP2A 4YB1P 4J2AA 3ZCMA 2P5OA 3Q24A 2RS2A 1DTQA 3NS5A 2QMWA 3RSEB 1S49A 4BC5A 3VMFB 1Q16B 2JLEA 2RUSA 2NPFA 3L09A 4DX5A 3BSNA 2P6SA 4O8UA 1HFEL 4K0KK 3AA8A 4WFBQ 2B8QA 1NGHA 4KHNA 3FK4A 1HQUA 1FTRA 3BH6B 3EVMA 4CHYA 3MZIA 4X4VA 1ZM2A 5KFYA 3CGIA 3OFEA 1K8AO 2AGPA 2DCLA 3WNHA 2AZ1A 1R8AA 3KD5E 2R7SA 3VF2A 2MYFA 2EXUA 5C2GA 1OO0B 3CJ2A 1HKGA 4NL5A 4LRBA 1S1VA 4CFBA 2F96A 2GZOA 5C7PA 4RR5A 4QWBA 1YJNS 2Y1RI 4DMZA 2VWBA 1GTHA 3BSCA 2CNLB 3I4HX 3OS2A 3BKFA 1JCGA 1SC3B 1V6HA 3CIPA 1G7CB 5FLXO 1ZBHA 2NUUG 3CIMA 3VQBA 1EQ0A 4PR6A 4DB3A 3U1NA 3ENAA 4KRWA 5CAAA 3ZZOA 1K6YA 1XQIA 2G0JA 4A8WA 5KPZA 5DG7A 3TARA 4H4KC 5BR8F 4KGZB 3DDKA 3M8ZA 2Y0SD 3GYGA 1TL7A 2RDDA 5B08A 3DMJB 3P8BB 1OH8A 2YCHA 3DNCA 1Q53A 3KUEA 4Z7YA 4K50A 4YS2A 3WT0A 1WAFA 2E9TA 3NH1A 3Q8YA 5F8JA 4IEEA 2CQGA 3KFWX 2HVHA 1BWVA 2CQ3A 3VGTA 1S1WB 4OQJA 4WE1B 1KD1T 1IG8A 3FKBA 1RAJA 2YNFA 4DV1J 2R9LA 5KQDA 1V3RA 3DRYA 3ULHA 1LW0B 1H98A 3MM5A 4JI5K 4A61A 4X66K 2HRUA 3CC2S 4OLPA 4FYWB 1IH7A 3VEWA 1UVLA 3ZT0A 4KTQA 5KFGA 2YKNA 3FGUA 1B0VA 4KH0B 1Y11A 1S6QB 3L2UA 1R59O 1HBNB 2KXHA 3OYFA 1UTAA 3PG9A 4YFUA 2MQMA 1JXBA 4WQ5A 3NOGA 1WBBA 5HRNA 3MWTA 1W7WA 2YKMA 1EB0A 1QE1B 1F5BA 3POTA 3QGGA 4JV1A 2ZNYA 2CPYA 1SB6A 2H54B 4DPYA 2RRBA 4R79A 1FDNA 3S1TA 2MHNA 4LFAJ 2ASPA 4FLYA 5J1PA 3BF4A 3FMBA 3H3OB 3G8TA 4DR7K 2OCEA 3FEYB 3C6HA 2MDAA 3CDWA 2GO8A 4N5SA 4C11B 3OL8A 2FBVA 1CPZA 2Z2ZA 4LY7A 3K9JA 4FVUA 2Q0RA 1MROA 4W92B 1UVIA 4HH1A 3BQ0A 3OD2A 3V4MA 2BJ7A 4TSXA 3HJFA 2HLTA 3QIDA 3GL1A 4MO4A 2RE2A 1H0HB 4O0NA 1R0AA 5KFJA 4RCHA 5G0RA 2HBQB 2ROPA 4MDBA 5B0FA 1U6BA 3GIMA 4ICLB 3O80A 4DUZF 3TANA 3MOJB 3RAXA 4IO9Q 3NCPA 4GO7X 2YHYA 4NWBA 4PQAA 3O3LA 1BIUA 4GKKK 2CH5A 2MQLA 1NWKA 2MLXA 4YOWA 3O4WA 3IC1A 4UUXA 4FCYA 2FC9A 3GR1A 3TAEA 4L6V3 1XC3A 5AQOA 1JXVA 4DL4A 4WFAL 1HYSB 2FVPA 3CC7N 5DO2A 2X1FA 5FLXU 3L2QA 3CJ1A 2UP1A 3S8SA 4I9QA 3U3GA 4Y28C 1RT1A 2MPUA 2G8UA 5KFLA 3S01A 4Y1CA 1LAWA 3VQAA 1KSPA 1JLQA 4DTRA 4KH1B 2EK1A 1X60A 4MKYA 2GHWA 1C1AA 2WW8A 4LT6A 1IN0A 2VKRA 4JNEA 2R2UA 2N4DA 3T1HJ 1UPPA 1NGJA 4CJQA 2HNZA 2IAJB 1D3WA 1WC6A 2OPRB 2DNNA 3H8YA 4NLTA 4XDDA 2IYGA 3T3FA 3TOQA 3AA5X 3ILOA 2Z0GA 3DOKA 1N36J 1NGAA 5A2QO 2BRKA 1SXLA 3A8KA 4BCAA 2HQ3A 3MMCB 3DYAA 4E19A 5FPMA 3OFHA 1OH6A 3M8WA 4DV1F 3H1VX 2QKKA 4BRLA 2D9PA 4F0MA 4WP9A 4YOUA 1S9GA 1J2VA 1N32J 2MJNA 5HVGA 3Q8RB 4N7TA 2GMHA 2C2OB 2OKQA 1P9YA 4WQ5C 2NXEA 3KMQA 4JI2F 1WI6A 4QR2A 3MX2A 4IOAQ 4CJLA 1Q5YA 5GIOA 2CWKA 1WDTA 3FZLA 3OHRA 1CJKB 2Y1JA 4Q0BA 4XDCA 5EVZA 4LFCJ 1ZYQA 2W9BB 4BREA 1GMWA 1S99A 1S0MA 3ICLA 1CVJA 4M7XA 3PYDA 4Z4GA 3TI0A 4C98A 4ZCLA 4AF1A 3K5PA 4FJ8A 4USHA 1WG5A 1DTTB 5E3AA 2ADCA 2QXFA 4K4YA 1FRJA 1U49A 4ED7A 4OZ2A 2Z8QA 2NZ4A 3AAQA 2C2ZB 2JFKA 5DM6Q 4C3LA 4KB0A 2HEKA 4A2BA 4ZTFA 4J8FA 1PJ5A 3UDLA 4BC7A 3QBXA 4AHRA 5KOWA 1LWXA 3MMAB 4P6QA 3T5JA 3DGVA 4B3MJ 2KH9A 1OVYA 4B9QA 1JIHA 4EIAA 4FLTA 4L8RB 5J2QA 4DQRA 3RZAA 2R7OA 3D6RA 4WFNL 2AYBA 1RI7A 3ET6A 1FXXA 1YIJS 2CQIA 3KLEB 4DQQA 1BIZA 2G0IA 2XMWA 1ELOA 5AQQA 2DHGA 2DH9A 3HBTA 2X74A 2MQQA 5JVHQ 4B9MA 3F2KA 2QW9A 2P9SB 3O8MA 3MCMA 2V5HG 3V81B 5HATA 1WUAA 1ITPA 1HR0J 1M0SA 2ZZNA 4DOZA 5LL6Z 1VHIA 4FBUA 4IJAA 2IS3A 2QKBA 3CCUS 4QWCA 2UVRA 4M7YA 2OELA 1O5JA 4LSZB 3J7AP 1ATRA 1J54A 2EWHA 4ZOSA 3J80Y 1EX4A 4C3KA 3HP9A 3T69A 3GSDA 4DV0K 2KFNA 1RTDA 2BACA 4DMNA 2UU9K 2X6SA 3HFKA 3I0SA 4M5MA 2IJNA 4NXMJ 2E44A 3VA3A 2ZOMA 4D3GA 5KT4A 5IWAJ 5LJWA 2FHKA 1S1UA 1BMQB 3GJSB 2HGLA 1K8AT 1RT4A 4BR9A 2R42A 3BGRA 4MK7A 2W41A 2EHGA 2KHOA 5GMDA 4BR2A 4L73A 4CZIA 5AZJA 2U2FA 3EUNA 1NO8A 1VSLA 4FJ9A 3MMBA 3WXIA 4AFFA 1XMQK 2KXNB 3SQOP 4BC9A 4BRIA 1RAEB 2B56A 2LXIA 3H2VE 2NRXA 4BY9C 3IFEA 3M8YA 2RQ4A 2YX6A 3CI5A 3T1HF 3VGLA 1B7YB 5A2QU 4HTLA 2GX8A 4GV6A 2WK4A 5A8KB 5ETVA 3QICA 5DQGA 2N7CA 4K8ZA 2XULA 5AQZA 3CXCM 3SBMA 1RUSA 3TW0A 2LCWA 2L41A 3D3CJ 3DXKA 5IQQA 2J9DE 3ZSWA 2W6KA 4KAIA 4QR1A 2HK2A 1UW9A 4YHHK 4DZ6A 1CXQA 5E3RA 4WTYA 1PO6A 2IYIA 5FRMA 2A1BA 2FZCB 1YTUA 1T3VA 3M9NB 3IM9A 5KFTA 5F3ZA 2FBYA 4ED2A 4RNMA 3M8RA 2ACYA 4AHSA 4J5OA 2XI3A 4DR2K 1NNDA 4I69A 4BLGA 2AU0A 2L48A 3JSRA 2VQEK 4LFCF 3CD7A 3SCJE 1RGIA 2R7WA 2VPYB 1IKVA 2GC8A 1BL3A 2E8AA 3DXSX 1V3SA 2GQCA 3JYTA 1NU4A 2P9UA 3PEJA 3SPYA 4X4NA 5KFOA 3I56N 2ZFHA 3HFZB 4PABA 3GE1A 4IG3B 4OI1A 2VA3A 2D3OR 2YWEA 3QWUA 2HSTA 3D0PA 2Z1GA 5L1LA 5KG5A 2J7KA 4B3MF 4JKGB 1VQYA 2C3UA 2IA6A 2BQ3A 3T1YJ 1F60B 2XLIA 3K2YA 4IH6A 4CECA 5D15A 3NGKA 3QRPA 3ZZRA 1BY9A 4OHZA 3T9NA 1IBMK 5AQWA 4ZHRA 1NSQA 4AXJA 1Z6RA 1APSA 3H5SA 3KK1A 3ZTOA 1UWAA 1WDDA 2CNKB 4CE9A 3AVMA 3KXDA 2KLAA 2CQPA 1IBLJ 4LRFA 1VBYA 1O51A 3CUNA 4QR0A 1I39A 2VU5A 4L3QA 2RRNA 4K2JA 4NXMF 3R6LB 4N76A 2W4CA 4HH0A 1SUQB 1JB0C 3R5AA 2QLXA 2HBZB 3QPIA 1NXIA 2E1PA 2QEXN 2GNKA 2IBOA 2HB5A 3UE5A 1NGFA 3U4LA 5F8MA 2I0XA 2K06A 3OR2A 1LCUA 2K7KA 2DIUA 4F4WA 1JNRB 2HGMA 4ECQA 4ZVGA 1DQ9A 1FXLA 5LSOA 1KOOA 3O9TA 5HRRA 3ZFVA 3QNWB 4KHUA 3G9CA 1RCOB 2CPDA 1XR6A 3VEZA 4BRQA 5AXLA 4NI2B 3W3SA 2WONB 3SJHA 1HNXK 1HWUA 2MTLA 1RBRA 1ASUA 2Q79A 3RB6A 4DTJA 3R97A 5K14B 2OGUA 4W90B 2ZD1B 2O3DA 1GH8A 1GLLO 4PAAA 4M42A 2G2YA 1VQ7S 5LT5A 1WACA 4UOGA 1Q7YO 1LWFB 3QLHB 4TYAA 4TVAB 3M8QA 3V5RA 4UOHA 3B8AX 4C23A 2ASJA 3OYHA 1S48A 2N4CA 5KFQA 3V6JA 5HROA 3HZGA 3IXQA 4NZ6A 5ELZA 3CFRA 4A2AA 1QSYA 3VQDA 4QIVA 3KYLA 3O9UA 2HHHJ 4J9UE 4OYOA 2NNWA 5J2MA 1DARA 4FJXA 3VQQA 2XZTB 4ITSA 2DGOA 1LWCA 3V1QA 4PRFA 2ITGA 4FW2A 4CO4A 1Q8BA 1F2GA 5CR4A 1HBMA 3A5NC 4IQXA 3HI0A 2DGTA 4HTUA 1XNRF 4B3TJ 4A8QA 5FPDA 4Y2AA 2RQCA 2LVWA 3ETMA 4RJVA 3SDEB 1L3TA 1NB2A 3I82A 2UV8G 2HVEA 3RB4A 1TV6A 4ENOA 4DV5J 1M5SA 2VQFK 4CJRA 4E7HA 4IDKA 2XNQA 3NXZA 3ZT4A 2BKOA 5HP1B 3WXMB 4LF4J 2KI2A 4HEA9 4DV4J 5KFEA 2V7YA 1YJUA 2B0GA 3CCES 3M32A 2WSEC 3TU5A 1NDKA 1I1GA 1HKAA 3T1YF 1MN9A 2MHEA 3SSQA 4WKRA 2ATCB 4RKUC 2H48B 1G1XA 3D2EB 4QS9A 1DJ0A 1TKTB 4URSA 5A0YA 1BI4B 3H6EA 1ATSA 2OIHA 2BUNA 1ROFA 3VA0A 5KFHA 3V6KA 2YNGB 1YGYA 1VQKS 2I1RA 1Y9OA 2GWKA 3QGHA 3NNHA 1GT8A 1K1QA 4BWMA 3EE8A 1VCTA 4N47A 4A8XA 3IRXA 2HKEA 3VERA 4CZEA 2D0OA 4ZKAA 1U1KA 5AR0A 3KHHA 2AZ3A 1N5TA 3NHGA 1IBLF 2W9CA 1SIWB 3AT1B 4DDFA 1JLFB 4IKFA 4J9PA 4X4TA 3VZIA 2XC9A 3KLVA 4FK4A 1KRPA 3RW6A 5AQJA 3HHKA 3EVWA 5JLFA 2FHJD 3AOCA 3M2UA 3VQ4A 3W60A 5D4OA 2DH8A 1K73O 1WAJA 4NLBA 4ZIVA 3JS6A 3VGKA 4C8LA 4CTAB 3GYXB 1KHWA 3DRSA 2AWZA 3GZ7A 2MZ1A 1ASWA 1KLMA 1RWNB 5EX3A 4RW9A 2OTLS 2IVMA 1JXEA 3M3ZA 4XK8C 1MWQA 1R0CB 2RE1A 4O23A 5GAHI 4E89A 4GNIA 1RT7A 2KT2A 1RA7A 1ZAXA 4FJLA 1X31C 3TSQA 4IG0A 2BGGA 1TKXA 5LMNK 1QTNB 4E1JA 3LGHA 1U1OA 4DQIA 5M1QA 3LDPA 2DH7A 1RDUA 1HNVA 3CJCA 2VG6B 4MAKA 4FLWA 2L9DA 3JTOA 2DFFA 1X4BA 4CI6A 1HL6A 2FUG9 3CMQA 4B3RK 3RG6A 2IM0A 5ETMA 2WZ1A 3NE6A 4XPCA 1BOTO 1YITN 4ES1A 4X4UA 3HD2A 5AQYA 2QI2A 3D7SB 3A12A 2HHHF 2NPIA 3CQXA 4ED8A 5LSLA 2F5GA 4R25A 2FZGB 3WHIA 4EZ9A 3CD0A 4LF2A 2XSJB 2CQ4A 2QT7A 3AARA 2YNIA 1GTEA 3C6UB 3SAFA 3PSIA 2FGCA 2DHXA 3H46O 4O0IA 2A41A 3LH2S 5CA5A 2ZGZA 5L8RC 4FJIA 1TMMA 1HBOA 1GX6A 4M5DA 2YBVA 4DG1B 3IO1A 3WC0A 1YVUA 1HBUA 3FZFA 4CJKA 1PILA 3UN2A 5GADP 2ZWHA 1N0VC 4USTA 4FWPA 4K5SA 5KFFA 2I6WA 5AQTA 4KHPK 4MLHA 3EN9A 2XB2D 4AE5A 2Y0BB 2J0SD 4ZPAA 3VGSA 5KG4A 1H72C 3HPOA 3ZX3A 4LF4F 1S22A 3AOAA 1S10A 4HVZA 1HLWA 4DV4F 1RAFB 1FWKA 2B9EA 3CQ8A 5HL7Q 2VOOA 3EICA 4DTSA 3HHLD 1YJNN 1K0TA 4QBUA 5KG3A 2HBLA 3QRRA 2O5DA 4DN9A 3HVAA 3VEXA 2IM1A 2BEFA 5LXYA 1UAXA 5GAEP 2WBRA 4EO6A 3N6LA 4BDPA 3KD1E 3FCHA 2L9NA 2ZBPA 5T41A 4P74A 1RHKB 1S6OA 4X84A 2C3PA 4IOCQ 1VQ9N 4EUVA 2F9DA 4IFYB 1J5OB 3IGVA 1RU1A 4OIXA 1HQEA 4DUYK 2V51B 5BPLA 4M1KA 3G25A 1YJVA 3PFOA 1H74A 3FSYA 2A40A 4LF1A 3PKYA 1SI9A 2X51A 1WNSA 2CGLA 4MFBB 3DRPB 2E1ZA 3Q8PB 3TZZA 1Y00A 1NHVA 4CFCA 3D2WA 3JXUA 2V94A 3MAAB 4FZYA 3R1HA 3R1XA 3U27A 4KE5A 5EUHA 3G82B 3CETA 4WFNQ 5LJ3Y 1VQ5S 4Q2LA 4CGFA 1OY9A 3QJJA 4R5PA 2FY1A 3SSSA 2ZC3A 4EHTA 3F73A 4GVEA 3C7NA 3MTJA 1NGEA 2GVDB 5ETOA 3ENQA 1VYAA 1SV5B 1RDCA 1GXTA 2FC0A 3FZKA 3LGNA 2VG7A 5F9NA 3ITHB 3W62A 1HNIA 2VOPA 4JI6J 3V9UA 1YLXA 1UL3A 3OYAA 3BGOP 4RTFD 4ZPTR 4GMJB 3TEHB 4M5KA 4ZTJA 4ID1A 3HZ6A 1RQ0A 4X65J 3THWB 3IS9A 3A5OC 1DZ5A 2B3TB 4WK1A 1TAQA 5IT0A 2AMCB 3GILA 3T1AA 3CT9A 4G3IA 4JK7A 4YEAA 1JCEA 3SCKE 3JB9k 1U1NA 1TKZB 1XNQF 3EVOA 4MT1A 2B6AB 2OTJS 1LWEB 3SQ4A 1J9AA 1GNKA 2VV5A 3PM9A 2YH1A 3JQKA 1S0NA 4CLFA 1GAOA 2NXJA 2M70A 3G6VA 1VMBA 3R6MA 1Q7YT 3AJ2A 3TQ1A 2BKPA 4BC4A 3QGIA 3CNQP 3VGUA 3C14B 4LVOP 2QN6B 2BR0A 4YORA 4HUFA 2VWJA 1N33J 3SSRA 4M3XA 1RBVA 3Q83A 2OEMA 4PG5A 1ZA1B 4USJC 5CZ2A 5FROA 1BQMA 1VQ4S 1VBZA 3A0IX 3VETA 1F2HA 4JOUA 1X9JA 1RTJA 1FJGK 4AYBD 2R8JA 3DAWA 2GFFA 3EXYA 1JX4A 3HSDA 4XEIA 3F41A 3ZZZA 2J9CA 1IR1A 4OX8A 1LW2A 3OHAA 3BZKA 5KPTA 1VJWA 5M1FA 1CS4B 3SQ2A 2KM8C 5I3UA 3J81U 2M4MA 4PKIA 5DDPC 4QWDA 3W7BA 1UVMA 1EQMA 3SJJA 2B8PA 4CJTA 4ILLA 1L3UA 3C16B 5H9EJ 3H3NO 4BC3A 2ZHOA 3QESA 2EWSA 1HNWK 3GG4A 3ZX2A 5HMXA 3ISZA 4CM2A 1CBKA 4WZMA 2ASDA 3KK2B 4OMFG 5H9FJ 4BDZA 3B78A 4C97A 4ETXA 4N77A 2K1RB 2VICA 5A8RA 3S3NA 4FLXA 3TJ8A 4LF8J 2X7IA 3G86A 1VQOS 5GMEA 5IC6B 4LUBA 2DK2A 1WOOA 2DNYA 3ZTRA 1F9FA 4K0KJ 5AQXA 1VQNS 2CQ2A 4AD6A 1D9AA 5D78A 2OSQA 2Z1HA 2NRRA 2YNHA 4FXDA 4USVA 2UVUA 4IRKA 2JX2A 5KFIA 1Q81T 5GAEI 3M1VB 2B5JA 4K8RA 2WBNA 4CJEA 4OYBA 4CHOA 1BLUA 2GO9A 4FW1A 1RB0A 4A5AA 4UW2A 1VHFA 2QG9B 4WU3A 2CNOB 4CHPA 1ZZNA 3KMSA 3VAHA 1OH5A 2M52A 2UYTA 1UZDA 4KV8A 1MSWD 4PKDB 4DL2A 5KFSA 3KK3A 1QZ5A 4FWNA 1LNQA 2MGZB 3PIPL 4NYFA 4HYKA 1ULRA 3PYFA 1G99A 3LQVA 4JI6F 4K42A 4CF2A 2CWXA 5E5NA 1X3NA 2R7QA 4JI4J 1ZS6A 1ASVA 4X65F 4Q2MA 4PG4A 1Y3KA 1T05B 1GLFO 2C2KB 3BP8A 1NEEA 2IJRA 2DR7A 4B1XB 4WFYA 3QRQA 1UP1A 4AILC 1PGZA 4HCCA 4FM2A 3CHWA 3AVCA 1L3SA 3P31A 5F0XA 5LY3A 3RU0A 2HFSA 1FWPA 1LOTB 3J8AA 4DV6K 3F9KA 2F9TA 3J7YP 4CJVA 4FO0A 1TK8A 1LV5A 4DJBA 2HF4A 1N34K 4QAGA 5JS2A 3MR3A 4JI5J 3UQSA 1NJXA 4ZN1A 2N7YA 2RKIB 2RS8A 4O5FA 3EKSA 1YJ9N 4JI0F 1N33F 2KG0A 3TAFA 1JLCB 2QMUB 5KI6A 1D8YA 2R7VA 1ZBSA 2XY6A 3T9ZA 4FWRA 4CF9A 1RBLA 3OLAA 4DF4A 3S3MA 1J5EK 3TAQA 4JHDB 3H5YA 3AVLA 4JV0A 3OW2R 5BPMA 5EWGA 4JKEA 5AJ3K 2CPEA 3WZ0A 1HKBA 3NWGA 3MR2A 4RW4A 1X9MA 2OI2A 4GV3A 4KH5A 5EX0A 3MCNA 1KHVA 4RWXA 2DY1A 3THYA 1NMEB 4CJUA 1RK8A 2M88A 1YT3A 3NGSA 4GW6A 3KG0A 3FCVA 1RHQB 1VS3A 3DMJA 2ZKTA 2DO4A 4JI8J 2XLJA 4CEZA 1LOUA 4DFMA 1IO2A 3L8BA 3CMES 4CI0B 3J7A1 4X62J 1S1WA 4OYPA 1ZOTA 3VAIA 1U24A 4FKXA 1VK3A 2W2NP 3T41A 5F9LA 1S5JA 3BBCA 4FVMA 4YY3K 2Z2LA 3W2VA 4ECZA 4LF8F 2HIYA 1LW0A 2NYIA 2RF2A 3CJ7A 2GMLA 1RHJB 4C1NK 2VYPA 1NK6A 4K0KF