3LAMA

Crystal structure of hiv-1 reverse transcriptase in complex with n1-propyl pyrimidinedione non-nucleoside inhibitor
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N1-Alkyl pyrimidinediones as non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords HIV Reverse transcriptase
total genus 149
structure length 553
sequence length 553
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lamA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lamA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lamA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lamA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lamA05
4ZVHA 1UA1A 4O3SA 1B9FA 1F21A 4F4WA 5FDLA 4BDZA 3VQQA 3MEEB 2BE2B 3F9KA 1T03B 2WONA 4NYZA 4QWBA 4CHYA 5KT6A 2HHQA 3PX0A 4EO8A 1RAJA 3OYBA 5K14B 3PO5A 2QK9A 2JEFA 3LWLA 5CZ2A 4EYIB 4IOBA 3TQ1A 4OKKA 3S9HA 4BDPA 1S1XB 1QTMA 4CF0A 2UVWA 5EUHA 3KIOA 4MFBA 5C42B 3OL7A 2OPQA 2VA3A 4N47A 1JLGA 5I42A 3LP0B 3LP1A 2P51A 3NAEA 1VSMA 4J9RA 1C1BA 3L8BA 4NLGA 4K50A 2IM2A 2YNFB 4IKAA 3DDKA 3RMAA 4FJGA 3L2WA 3BGRB 5L1IA 4TYBA 3BSOA 2QXFA 1FXXA 3OYFA 2E6MA 1BQMA 2E4LA 1UWBA 2YNHB 4DTJA 3DRRB 3LAMA 4U7CA 3KJVB 2NUBA 2GIRA 4FW1A 3ZSZA 1JLEA 3EZUA 5KFPA 4CF2A 1RILA 2G8IA 2W9CA 4X2BA 3QIOA 5C25B 1D9DA 1HQUB 4ZTJA 2HWIA 3O3GA 2V9WA 3OYGA 1XR7A 3SI8A 2XCPA 4HUFA 4DQRA 2DFEA 3NGYA 4EO6A 2R8HA 2F8EX 3U3GA 4KV8A 3HL8A 4WYWA 1S6PB 3KLFA 3ISND 3KLVA 3V6JA 3VQSA 1FKPB 2YKNB 2G8KA 3NAIA 1YTAA 3NF6A 4Z0UA 4B9UA 2X6SA 4J9MA 4CHQA 2A1RA 2WOMA 5KFFA 3RTVA 3KHHA 3PO4A 2VWKA 3V6DA 3NF9A 4PY5A 3H5YA 1J54A 1W9HA 4OLAA 3SPYA 3CDUA 5KFKA 3OS2A 3MR6A 4GVMA 1RT4B 2AJQA 1TK5A 2E6LA 2PZSA 1ZBIA 1RTIB 4Q0BB 5KFXA 3V6DB 4DLEA 1RTJA 1IKXA 4OL8A 3B6OA 3U6FA 2BR0A 3V1OA 4M45A 1NKEA 4NLVA 4U6PA 3DOKA 3AVJA 1IH7A 4IKFA 1N6QB 4PA1A 1S10A 4BACA 3TAPA 1TGOA 4DEZA 2EHGA 1X9MA 3K2PA 2V4RA 3LP2B 5F8LA 3AVLA 2W9BA 1CXQA 3V9WA 1D5AA 4FXDA 4DU3A 4QWDA 3QZ7A 1SKWA 1KCFA 3PUFA 2PYLA 1TQLA 5DG7A 3T5LA 3MEGA 4Y1DA 4M41A 4C8LA 4M3RA 5KRSA 4HCBA 3RAXA 1VSKA 3CIZA 1TKZA 4Q8EA 5KGWA 3PY8A 4H8KA 3DLEB 2BRKA 1NOZA 4Q5VA 3LPTA 2BGGA 2HAIA 4CF8A 4CHPA 3SV4A 2XY7A 3DLRA 2R8IA 3GIMA 1XWLA 3NBPB 4BWMA 4FJ5A 3M8RA 4JV1A 2IGIA 2X74A 4AILC 4IRKA 5DMRA 1DTTA 2XY5A 1TP7A 4G1QA 3NDKA 5F8NA 4EZ6A 3KLGB 4DTPA 4WFYA 1RA7A 5F9LA 4RW4A 1HYVA 4R0EA 2GUIA 3I5AA 5T14A 4JRQA 4M94A 4AHVA 1T05A 2F96A 2WRMA 3E01A 3ULDA 5KG6A 4QAGA 4MK9A 4CFCA 1S0OA 2ILZA 3EYZA 1GOBA 3SQ0A 4DFKA 4GW6A 1J5OB 3AVIA 1K1SA 5C25A 4BE2A 3OLAA 3U3YA 3IGNA 1NK4A 2XI3A 3WNEA 4ZP8A 1SH2A 4CHZA 1BI4A 4CJ5A 3K5MA 2C28A 3H5XA 2DFHA 4FM0A 3LPUA 4YR3A 3IN5A 4CJPA 4XIUA 1LAVA 4YMEA 2V4QA 1TKXB 1HQEB 4TLRA 5I3UB 4KRFA 3CDEA 1S0MA 4DTMA 4O0JA 4KHQA 1JLBA 3DMJB 1HYSA 2GIQA 3MAQA 3PX6A 2C2RA 2HNYB 4B9VA 5L1KA 1JLFA 2ZD1B 4B8CA 4LH4A 4XPEA 4TY8A 2YHBA 2OZSA 3VQ6A 1XHZA 4B3OA 3AO1A 3OYKA 3K58A 3HP6A 1RTHB 1U47A 4ECTA 1XR5A 1FK9A 4CIFA 4LSLA 3HHKA 4DF8A 5KFBA 3ZT2A 1GOCA 3HSTB 4IH7A 1JLQA 4RNHA 4EBEA 2R2RA 3C94A 4NLRA 2R2SA 2HW3A 5KTQA 3E01B 1Z4UA 3G6VA 2RN2A 3ZSVA 2OYQA 2Z1HA 4FS2A 1VRTB 4PQUA 1VSFA 5FDLB 2OPQB 2YKMB 1WN7A 1HNIB 1J9AA 4BWJA 1T3NA 4FLTA 5KFQA 4MKAA 1RYSA 4R5PB 4RW7B 4CF9A 1WAJA 2IM3A 4ZPAA 1I6JA 5KFYA 3I5CA 2XY6A 1RT2B 2IAJB 3QIPA 1CZ9A 5J1EB 4IG3A 4ECZA 5KFCA 1LV5A 3ITHA 1D1UA 3KD1E 3D28A 4NYFA 4KHMA 4DTNA 3TI0A 4DQPA 4TXSA 2C2DA 2KQ2A 1CZBA 4IFVA 4QWCA 1C0TB 3SUPA 2IJFA 5KFUA 1TK0A 1BCOA 1VSEA 4R5PA 4Y1CA 4FJJA 2FVSA 2D0BA 4FLYA 2YNGA 4M3UA 1VRUB 3OHAA 4B9NA 4E7HA 5DLGA 1WSHA 1R0AB 2XGPA 3PZPA 3DOKB 3SI6A 3OLBA 4CJQA 5KI6A 2QKKA 1IKVB 4KAZA 4CEDA 1XI1A 3RR8A 5KG3A 1JLCB 2KFZA 4N76A 4NLDA 3G0ZA 3MFIA 5KFOA 1YVFA 2HNDB 5F8IA 2Y1IA 1ZBUA 3N6MA 1RT7A 2P5OA 1EXQA 1NK9A 1BISA 3CJ4A 1X1PA 4OGEA 3KLIB 5JUMA 4LQ3A 1VSIA 2XY8A 4YNQA 1JLAB 5HRSA 4CF1A 4RUAA 5KRTA 4WYLA 4NLWA 3IG1B 4CEQA 3LZIA 4KTZA 2FVRA 3AVCA 4Z4FA 4I2PB 3TAEA 4F50A 4FBUA 1EP4B 4K4XA 3V81A 4FJXA 3LAKA 1RNHA 2DPJA 4ZVFA 4CESA 1MU2A 2RPIA 2O4GA 4E1MA 3PW7A 4JLHA 2JLEA 3HPOA 1S1WA 3BJYA 3Q8QB 1N56A 3IRXA 4RNNA 4ICLA 2RKIA 1C0MA 3TWHA 1JKHB 4HCCA 3JYTB 3G6XA 3AA5X 4IH6A 4CGGA 3OYHA 3NAHA 2WK4A 3MTKA 1GX5A 4FJMA 2HNZB 1ZBLA 3SYZA 4Z4CA 3K59A 3T3FA 4B9MA 1HPZB 4DMNA 3Q8PB 1XR6A 1BCMA 3PW4A 4K4TA 1WNSA 4CFAA 3KJVA 2FVQA 3BQ0A 3TARA 1ZBHA 1ZTWA 3H59A 3H08A 3V9XA 2FLPA 3RRGA 1WSEA 1VRTA 4PQUB 5DQIA 3KHGA 4FBTA 3VQEA 1L5UA 1S1XA 3DRSA 2ILYA 5HP1B 2PY5A 2JEGA 4KB0A 3RRHA 4RW8A 4J9PA 2A1SA 4RW9B 4KAIA 3BDPA 2R8JA 3QIPB 5J1EA 3MXJA 2AQ4A 3QEVA 3V6KA 4B08A 4NZ0A 4B3OB 2VA2A 2IOCA 4Y34A 1MU2B 1SL2A 4E7KA 2YKNA 1WNEA 1JXBA 1S1UB 2I5JB 4E0DA 3SUOA 2DFFA 5J2NA 2YNGB 3OY9A 4CJRA 1KTQA 3OL8A 2X78A 4B9LA 4L8RB 4DS5A 4KI6A 4FLVA 3KNAA 2D0CA 4NLYA 3T19A 4H4OA 3AA2A 1WSFA 1I3AA 1RBSA 3CFPA 2E9TA 4LQ9A 1HYZA 3NCIA 4I7FB 4FJ9A 4WFXA 3SQ4A 4NLXA 4FJLA 3JSMA 3QLHA 1N48A 4ZMMA 3OL9A 5SZTA 4C8OA 3N6LA 1JLCA 4RW4B 2BRLA 1BL3A 4E19A 5KFWA 1S97A 4ED2A 3SFUA 4QCLA 2VG7A 4IQXA 5CYQB 3HYFA 1HQEA 1IG9A 3T5HA 4KTQA 4XPCA 5HLFB 1U45A 2CKWA 3HPGA 2Q3SA 3I8DA 4O0IA 1JLBB 3PW2A 4RU9A 1X9SA 1NNDA 1B9DA 4FS1A 4YFUA 3RBDA 2JC1A 1RBUA 3FSIA 2WOMB 3AVFA 3VQCA 5CYMA 4RG8A 5J2QA 2XHBA 2DPIA 4J2AA 4FJKA 2YNFA 3QINA 4F4YA 4TSXA 4CCHA 5HRRA 2AWZA 4KKOA 3BSAA 5JS1A 1HMVB 2F8SA 1BQNB 2B43A 5CZ1A 3DLGB 3DRRA 2B6AA 3HM9A 5EWFA 1QUVA 1TKZB 3V9SA 1RT1A 2XO7A 4DSKA 4DTSA 5L1JA 5K14A 1NK0A 4DFMA 2OPRB 4FLWA 4KI4A 4CEZA 4FVMA 4RNMA 5DLFA 2IM0A 1N6QA 4ZVEA 5E41A 2R2TA 1LWEA 3GILA 1LW2A 1LWCB 4MIAA 1EETB 3LP0A 3QLHB 5SWMA 1NJXA 1ITGA 4ZP6A 1SV5A 2VG6B 2WCXA 1NK6A 1VK0A 3V1RA 3CQ8A 1KLNA 4IRDA 1VRUA 5JXSA 2WHOA 3CFOA 3L2RA 1S6QA 2FC0A 3H2LA 4M42A 3BGRA 2JGUA 3QERA 3RMDA 3GIIA 3QGIA 3VQ8A 3SQ1A 4EZ9A 1KFDA 4TY9A 4FJNA 1I39A 2HHUA 1S4FA 4ZHRB 4WE1B 2HB5A 1RCHA 2PYJA 3UDLA 3QEIA 4FZXC 1S1TA 3NHGA 4KB1A 5J2QB 3T1AA 2IAJA 2G8WA 2HHVA 1CXUA 1TV6A 4JV2A 3JYTA 3MECA 5KFLA 3BQ2A 4DFJA 4DL6A 4HTUA 1RTIA 3QNOA 1TAQA 3KHLA 1RT5A 2GC8A 3O4QA 3HVTA 2Z1IA 4B9TA 4W5RA 4CJTA 3CJ0A 3TANA 3KKSA 4QW8A 2W8KA 3D45A 1RT6A 3NL0A 3CWJA 4GC6A 2BANA 3ZSYA 3H40A 3AVBA 3E51A 2XC9A 2QKBA 1VSHA 3QO9A 4W5OA 1Q8IA 4I2QA 1RTDA 4ZP9A 2D3ZA 4KFBB 2D5RA 4ECWA 2JC0A 1Z26A 1D9FA 4CGDA 3QYYA 3HVRA 5KFVA 3ASMA 1DLOA 3VQ5A 3K5LA 1A5XA 4Q0BA 5HRPA 2D0AA 4YR0A 3OYIA 4CJVA 4DF4A 1JX4A 3MXMA 4J2DA 3BSCA 3SFGA 4ECSA 3ICLA 3TABA 2BANB 1HJRA 2HHTA 5EDWA 2C2EA 1NK8A 4W5QA 1S9EB 2XI2A 3UR0A 4Q43A 4Z4EA 4FLUA 4WZMA 1S1WB 5KGXA 3I0SB 5KFRA 3QEWA 4LSNB 4O4GB 4PWDA 4CJWA 4KSEB 3KLHA 5KFSA 3GV8B 3PR5B 2HNYA 4WXOA 2OZMA 5C5JA 3MXIA 1KVBA 4NRTA 2HNZA 3QEPA 4RNOA 4FJ7A 4F8RA 3KK3B 1SKRA 2AX0A 4DL2A 3VQBA 3ITHB 3MR5A 1FKOB 3TAMA 3M8PB 4FZZA 4DS4A 1S9EA 4H4OB 4J9OA 3O3HA 3LALA 1BGXT 4KKOB 5EU7A 2VG5A 1N5YB 4DSLA 4KO0B 1S0NA 3HXMA 5J2PB 3H98A 1T05B 2FJXA 1U04A 4TQSA 3NF8A 4OPJA 3Q8SB 4IDKA 4GMJB 1S9GB 4R8UA 3TAMB 3CYMA 4E1NA 4FZYA 2FLNA 1WSGA 5FRMA 1UOCA 3K5NA 3KTQA 3FDSA 3Q8RB 2W9CB 4CJ4A 4DTOA 1EETA 3ZSRA 3IS9B 2FLLA 1C2PA 1SL0A 3THVA 3FFIB 1SV5B 3MR3A 1EX4A 3RB6A 4KHSA 1JIHA 3VQ9A 4O3OA 5KT3A 4JS4A 4KHYA 3ALYA 2RDJA 4RZRA 4RW6A 2D41A 3QEXA 2I1RA 3LDSA 3HVAA 4CJFA 3DM2B 3HPHA 4MFBB 5C42A 4JUZA 5CY4A 4AHCA 4WZQA 1JLFB 2ZD1A 1NJZA 2BE2A 4DSJA 3DLGA 2AGPA 1BQMB 2R2UA 1KVCA 2CJQA 2GBZA 4N56A 3DLKB 4KB7A 4ED8A 4C8NA 3DI6B 4NCBA 4EEYA 2IJNA 3BQ1A 4CJKA 4LH5A 4RW6B 5KG5A 3ZT4A 1RBVA 3NE6A 4DLGA 3TAGA 4FK0A 1EP4A 4CECA 3L2QA 2UVRA 4CEOA 1HNVB 4ID1A 3OYNA 2UVVA 3C6UB 1HARA 3QZ8A 1NJYA 2IM1A 2G8HA 2OPSA 4Q45A 3ZT3A 3ZSOA 4O5BA 4O3NA 5EWGA 5KG7A 3SUNA 3TAFA 4ZTFA 2ASLA 4F4XA 3OYDA 3M9OB 4OKEA 3AA4A 4CE9A 4I2QB 1RTDB 3PR4A 1VSJA 2RDIA 1KLMA 1RTHA 1Z25A 2HVIA 1IKWB 4M95A 1WSIA 3AVHA 3NFAA 4CIGA 1WAFA 1T8EA 2OH2A 5L9XA 3VQDA 3S3NA 4CK2A 2YNIB 4FLZA 4DFPA 1T03A 4K4WA 2JEJA 4AH9A 4M3XA 4CJEA 2OA8A 3BREA 1NOYA 2BQUA 4O3PA 3KLHB 4URQU 2O5DA 4JRPA 5F8JA 4I9LA 2R7YA 4Y2CA 2G8UA 4DL4A 3I5BA 3P83D 5D3GA 3M8PA 2YNIA 1HNIA 3AVAA 4GC7A 4KV8B 3P1GA 4NLUA 3L3VA 1SKSA 1O1WA 1N5YA 4G3IA 2UUWA 4CEEA 1HNVA 3M8QB 4IFVB 4ED0A 4JV0A 5HBMA 3KLEB 4IRCA 3AO4A 4E7LA 2V0NA 2RF2B 3L2UA 3MFHA 4MK7A 1LAWA 5J2MA 4IG0B 3HVWA 2W42A 2ZE2B 2OPRA 1SH3A 1U4BA 3DLHA 1IKYA 3KD5E 3PHEA 3I0SA 4TN2A 3KK2A 3SCXA 4FLXA 1RT5B 3MF5A 3AVKA 1LWCA 3RB4A 3OJSA 1QE1A 3SZ2A 4ED6A 1ZTTA 4EP5A 3BR9A 4RW8B 3V9ZA 4FK2A 2ATLA 4CJSA 1Y97A 1RDDA 3OYAA 3HT3A 4CK3A 1QHTA 2C22A 4CEAA 4ECRA 4ECQA 1TKXA 3DOLB 3CDWA 5KT5A 1Q9YA 4FJHA 1JLAA 3NGIA 3DLBA 2HMIB 1RBTA 3C6TB 1TL3A 3AO5A 2ZKUA 4OLBA 5J2NB 4F2SA 1ZETA 3QESA 3PW5A 4IDKB 3KMQA 3F73A 1TVRA 4IFYB 1B92A 2Z1JA 1YVUA 1C0UA 1T7PA 1DTTB 3IAYA 1S1VA 4KHNA 4CJ3A 4ZPDA 3OYLA 3MEDA 1BQNA 4DSEA 5KG0A 2W9BB 5HROA 3CM6A 3IG1A 4J9SA 1S49A 1TL3B 1NK5A 1RT6B 4FW2A 4O4RA 2BQRA 4CGHA 1RDCA 5DG8A 4Q8FA 1LWFB 4OPKA 4DTXA 3CJ5A 2WONB 1L3UA 2AGQA 3KOAA 1C1CB 3EY1A 1SH0A 1TAUA 5F9NA 2VG5B 4HKQA 4JS5A 5I3UA 5KFTA 4YP3A 2IC3A 4ED7A 2HWHA 2ETJA 1C6VA 4ZVGA 3LWMA 1BIUA 4ELTA 3H5SA 4NLPA 5KFEA 4F3OA 1VSDA 1S9GA 1K6YA 3I0RA 4KHWA 2IDOA 5EWEA 4KTWA 4CK1A 3CVKA 3ZT1A 2WTFA 3QGGA 3M9MB 5J2PA 4DTRA 1JLGB 3RBEA 3K57A 3VA3A 2O4IA 3HKWA 3IS9A 4ZP7A 4IBNA 3P5JA 2GV9A 1L3SA 3C6TA 1GOAA 4MK8A 3GIJA 4CHOA 4URGA 4ECVA 2E9RX 4ECUA 4NCGA 3FQLA 4XO0A 4HUGA 3MEGB 3OYJA 1S1VB 1HRHA 4DSFA 2P5GA 4IH5A 4FM2A 1J5OA 4DQSA 3DM2A 4CFBA 4ZPBA 4CGJA 3QIDA 3OSNA 1VSLA 1KFSA 1A5VA 1BI4B 3AVMA 2QV6A 3GQCA 1KRPA 4C8KA 2DTUA 3AA3A 1X9WA 3ZSXA 1JLEB 2G8VA 4MH8A 3OYMA 5KFZA 4OJRA 4ZPCA 5KFHA 1ASUA 4IG0A 4URSA 4DSIA 4KHRA 4LY7A 3VN5A 1U49A 4AHRA 2UVUA 4G1QB 4O55A 1TL1B 1NHUA 5KFJA 1Q9XA 3DLKA 1KHWA 2J6UA 3V9UA 4BE0A 1LW0A 5KFGA 2HHWA 4CHNA 3N6NA 4ED3A 1OS5A 2XGQA 3H5UA 2AU0A 4M3TA 1HMVA 4NLOA 3KK1A 4I7FA 3C6UA 1JXLA 4NLTA 2YKMA 3M8QA 2FBVA 1QSLA 2YNHA 3AVGA 4QOZB 1TKDA 1IM4A 4F4ZA 3CJ2A 2RKIB 1RT2A 3G10A 2F8TA 4K4ZA 3KK1B 3H4BA 1IKVA 3L3UA 2AGOA 2XRIA 1IKWA 3RB3A 4CEFA 5KG4A 4ELUA 5I42B 4ZHRA 5KFNA 3NGDA 4HHTA 1S6QB 1KSPA 1KVAA 4QWEA 1RT7B 2BDPA 5F8GA 5T7BA 1T94A 3KLFB 1NKBA 3MECB 4E7JA 4K4YA 2D3UA 5KT4A 1UAXA 4LSLB 4YR2A 2R8GA 4HUEA 3OHBA 1ASWA 3WNFA 4DU1A 3OYEA 4NLSA 1DTQA 1WLJA 4QWAA 3EZ5A 5KFIA 2HVHA 4AHSA 3HJFA 3AO2A 3RB0A 5F8HA 1R0AA 4ICLB 4FJ8A 4KPYA 1KHVA 3UPFA 1RT4A 3V81B 4DL3A 3NBPA 3ZT0A 4FK4A 1SUQB 1TK8A 4DL7A 4N41A 2RF2A 2E9ZA 3MEDB 3D0PA 2VG6A 2X6NA 2XCAA 2LSNA 3DLEA 1TKTA 3ISNC 4KO0A 1JKHA 3KHRA 3HO1A 3BSNA 4QPXA 2HNDA 4K4UA 1C1BB 3PV8A 3QNNA 2IBKA 2UUTA 5FROA 4C8MA 1S6PA 4Z4GA 4NCGB 2J6SA 1LWFA 4I2PA 5JS2A 4MIBA 1FKPA 2KZMA 2WB4A 3LP2A 4PUOA 4H4MB 4B8AB 4ECYA 3SNNA 4DQQA 3DRSB 2W7PA 1UWBB 1L3VA 4LSNA 1RT3B 4RNFA 4EBDA 3VA0A 1NKCA 3V6HA 3FFIA 3GIKA 1S5JA 4E89A 4DG1B 1UA0A 1JL2A 3ZSWA 1QSYA 2ALZA 2ASJA 4HYKA 2FBYA 1N4LA 2KW4A 3GV7B 3AV9A 4BDYA 2VG7B 3HK2A 1C0UB 1YT3A 4ID5B 3D5MA 4CIEA 3SV3A 3B6PA 4PUOB 4Q44A 4J9LA 5DG9A 2ATQA 5KFMA 5DQGA 4OKJA 4CJUA 1A5WA 1TVRB 4IFYA 1FKOA 4WFZA 3CJ3A 1D0EA 2HHSA 3QO9B 4Y2AA 4OVLA 2FVPA 1RBRA 4Z4HA 4EP4A 3V4IA 1RDRA 1IO2A 5FRNA 4KFBA 3G86A 5DGAA 1QAJA 3M9NB 4K8ZA 2IS3A 1DLOB 3OSPA 4KE5A 2QE5A 2XWYA 3MEEA 4F4KA 2B4JA 4F3TA 2YV0X 2OPPA 4F2RA 4O44A 4QW9A 4TYAA 3QGHA 5KFDA 3RWUA 4N5SA 1XHXA 4AHTA 4O3RA 1QS4A 3UIQA 3AVNA 1RDBA 4J9QA 4PWDB 2ASDA 1TL1A 4FM1A 4J2BA 4WXWA 1BHLA 1JLQB 3SQ2A 3DRPA 3SUQA 3S3OA 5DQHA 4DQIA 2EC0A 5DK5A 4M3WA 3DMJA 1HYSB 1CLQA 1CSJA 4O44B 4EYHB 1BIZA 1JL1A 3O3FA 4DG1A 3NGZA 4CJLA 3G6YA 1ZBFA 5HRNA 4R8UB 1IKYB 4TY8B 3C95A 3O4NA 4M3ZA 2VWJA 3KLGA 3DYAB 3LP3A 4RUCA 3RAQA 1C0TA 1QE1B 1J53A 3OYCA 3VQPA 2IC3B 5C24A 1NK7A 1S1TB 4ELVA 2W9AA 4I9QA 4NCAA 3HP9A 1NJWA 5L1LA 4K8XA 3I0RB 1RA6A 2W8LA 1FK9B 4NRUA 3RMCA 1C1AA 3KKRA 1SUQA 4ED1A 5KFAA 1KLMB 3CO9A 3NH2A 3HVTB 2W7OA 3RMBA 1RYRA 1TKTB 4M3YA 3GYNA 1LW0B 1HQUA 3ZCMA 3NH1A 2B5JB 4B9SA 5CYMB 3TR8A 3DI6A 1U09A 4KBIA 3A2FA 4K4VA 3NKYA 3UQSA 5KG2A 3LZJA 3LANA 1D8YA 3FQKA 5DGBA 4CEBA 4H4MA 4H54A 1NHVA 4HVJA 1U48A 4O3QA 1MMLA 1RTJB 1G15A 1K1QA 3SPZA 3OVNA 4NYNA 3AO3A 3OS0A 3PJWA 1SL1A 4DL5A 2Z1GA 4LD0A 4MKBA 2AX1A 1YTUA 3TAQA 1C1CA 2B6AB 3WNHA 4Y3CA 2OPSB 1LWEB 3PJXA 2YHAA 2HHXA 3H4DA 3ZSQA 1W0HA 1QAIA 2G8FA 4J9KA 3IRXB 3PW0A 3PVXA 5HLFA 4K4SA 4AHUA 1IKXB 1ZYQA 3V4IB 5F8MA 4ECXA 4J2EA 2KTQA 3NF7A 2DY4A 4RW7A 3CM5A 5J2MB 2ITGA 3VQAA 4IG3B 3OS1A 5KT7A 2B5JA 3M8SA 2KFNA 3IGVA 1JXEA 3NMAA 1TV6B 2FBXA 5D3GB 3KLIA 4CFDA 3VQ7A 1HPZA 4IR1A 1DTQB 4CGIA 4FCYA 3GV5B 1RT1B 1ASVA 1GX6A 5HP1A 4KHUA 5HBMB 3KLEA 1QQCA 1L3TA 3OL6A 2ZE2A 1REVA 4UQGA 5KT2A 3RR7A 1LW2B 2P1JA 2J6TA 3K5OA 4E7IA 1WSJA 2R8KA 3DYAA 4DTUA 4YQWA 3T5JA 2Y1JA 2OPPB 3SJJA 2IMWP 3KK3A 1S1UA 2I5JA 3TVKA 2FJWA 4OGCA 2JEIA 1RDAA 3PX4A 4BE1A 3L2VA 2FVCA 4IR9A 2ZQBA 3KK2B 1REVB 1S48A 3FRZA 3WNGA 5HROB 2D7SA 3EPGA 1S9FA 1RT3A 4WE1A 2KZZA 3OJUA 3DOLA 2BQ3A 3DRPB 3LP1B 4O4GA 3JSMB 4FJIA 4Z4IA 2HMIA 4FYDA 4TQRA 4EBCA 4DU4A 3QETA 1EKEA 5KG1A 4CGFA 4ID5A 4W5NA 3CFRA 3KMSA 5CYQA 3S3MA 4CERA 4DWIA 2FBTA 4E3SA 3EPIA 4W5TA 3MR2A 4KREA 4J9NA 4RW9A 3T5KA 1XC9A 3V1QA 4NLQA 1W25A 1QSSA 2FJVA 4MQ3A 2IA6A 3CG7A 3NH0A 5C24B 3VQ4A 2EX3A
chains in the Genus database with same CATH superfamily
4ZVHA 1EKSA 3KK7A 3J7YU 2PA3A 1F21A 4F4WA 4B1VA 1SC6A 2W2QP 4DCPB 4DR5K 1MWQA 2RHQB 1Y5IB 4DV1J 3MZIA 4OHZA 5KT6A 2HHQA 5IXUA 4OZ3A 1RP5A 2ZUAA 2AIRB 5IFMA 2QK9A 2RRAA 3NVMA 3S9HA 4CF0A 2UVWA 3OL7A 3CCMS 2AYEA 2CPFA 3SDEA 3R6GB 1WOPA 4CW7B 4B17A 3TJ8A 5C0YA 1C1BA 4K50A 4X4OA 1X5TA 3KJQB 3Q8YA 5M1NA 3DXMA 1NBWA 5K20B 3G8TA 4FJGA 3BSOA 2O66A 1CS4B 5FLXU 1TTHB 3T1HK 3VERA 3OYFA 1BQMA 2VF3A 2E4LA 1UWBA 5K8PA 4DTJA 2GJ2A 3KJVB 4MKYA 4MJKA 5KFPA 3SEOA 1P8GA 2HHHF 4F36A 3HHLD 2G8IA 5CA5A 4OYOA 3JS9A 4DHVA 3QIOA 4LF4K 4ZTJA 2HWIA 2V9WA 3OYGA 3TTCA 1RXOB 1GTHA 2XCPA 3SI8A 4JI6F 2M7SA 3GLJA 4LF7F 3TX8A 2EKNA 1R27B 4EO6A 4ANCA 1VGYA 1GMWD 1MNEA 4GVBA 3OTEA 2YWFA 3KLFA 3SCLE 2BJDA 3EM1A 1FKPB 2DY1A 2YKNB 1GXTA 3NAIA 4C8YA 3NF6A 1CEZA 1XMQK 4CHQA 3KHHA 3ZZOA 5DM6L 4PY5A 3LM9A 4IFEA 1W9HA 2AMCB 3CDUA 5AQPA 2LP4A 3L4BC 5KFKA 5EX5A 1GTEA 2CQ2A 1RT4B 2ZWHA 3HF5A 2HSTA 3WHIA 2E6LA 2PZSA 3CCVS 1KC8O 4CH1A 1VHXA 2MLZA 4PWUA 1U2VB 3O80A 2D4WA 4DLEA 2FHMA 4EIAA 4E2FB 4OL8A 3B6OA 4PQAA 3U6FA 3GU0A 5K8NA 3AVJA 1P90A 3FCVA 1N6QB 4OYAA 1S10A 1X9MA 3K2PA 1Y0HA 3LP2B 5F8LA 1VQPS 2NQPA 1VLOA 3V9WA 4FSVA 4FXDA 1T9WA 3IWLA 3QZ7A 1PJ7A 2QL7B 2EFNA 2PT0A 1RAOA 4CLFA 4FVUA 4FWSA 2YJEA 4CNYA 4FOIA 1WTBA 5KRSA 5LMNF 3CIZA 1TKZA 3R5CA 5B0FA 1UP1A 4NL5A 3HMJG 5CHCB 4CHPA 3DLRA 4NX9A 3GIMA 1HKBA 3H46O 1QQMA 4BWMA 4JI6K 1YJ7A 2HG4A 3QAUA 4NXNJ 2X74A 1NBEB 1NG9A 3QRPA 5DMRA 1RHQB 4G1QA 4BREA 4F9OA 1Y7PA 1S79A 1X4FA 1VQON 4NE9C 2VJVA 1HHTP 5EXWA 1JJHA 3DGPA 1S99A 3GG4A 5T14A 3THWA 1VIOA 2F96A 4PR6A 3ULDA 3AB4B 2G1DA 4MK9A 4LRCA 1NJIT 1S0OA 1AZSA 4M63A 3PYEA 1CPZA 4GW6A 3FR0A 1J5OB 3J81U 2V34A 2BKPA 4OLPA 3ZZPA 5C2FA 4FYYB 2YKAA 1VS3A 3MN9A 3WNEA 1VFJA 4CJ5A 3H5XA 1OPIA 9ATCB 3LPUA 4YUDA 1KD1T 4LF6J 4YOEA 2GA7A 2MJUA 4CJPA 2FB0A 4BGAA 2RILA 1YVNA 5HQ8A 4YMEA 5BXIA 2P6SA 4TLRA 3I33A 3CDEA 3P96A 1WORA 1JLBA 4BCAA 5TKYA 3HLUA 4ES2A 2K7KA 1F2HA 1NNEA 4LH4A 1H73A 1DKGD 2DNMA 4TY8A 2YHBA 1XHZA 4B3OA 2IIHA 3T7ZA 3AO1A 4YOXA 2XMUA 2VV5A 3K58A 1FJCA 3MUTP 1MSWD 1FFWB 4LSLA 4DF8A 1E6VA 3RVCA 3J7AN 4FWQA 3J8AA 4G1PA 3MPWA 4M5GA 4NLRA 4HEA9 1YQHA 3E01B 3BBBA 3N28A 4USKA 2FJBB 2OYQA 4P73A 2Z1HA 2RAQA 4FS2A 4PQUA 2ALYB 4OZ1A 1VSFA 2QTDA 3WC0A 2L9DA 1FDBA 1J9AA 4FLTA 4KH6A 2EWHA 2MQPA 1HNWJ 4DUYF 3D3CJ 3US5A 3CCJS 4CF9A 4ZPAA 3D66A 5KFYA 3HD1A 2CPHA 2UUAJ 5KFCA 1H0HB 2GO9A 2AA4A 4KHMA 2PD1A 3TI0A 4DTNA 2QA4N 2HSEB 4QWCA 3C65A 4G9ZA 4L73A 3LOUA 3UW1A 1UFKA 4YHHK 2C2MB 1HNZF 1W7AA 4Y1CA 2KVQE 4JI2J 2FVSA 2Y1RI 2XMWA 2MMYA 3VOVA 5GAHP 4BHQA 1QQOA 4B9NA 4LF8J 1R0AB 4N77A 3DOKB 3HHLC 1RWPB 4FYVB 2P9UA 4DV7J 4CJQA 1AUDA 1IKVB 4DV5J 2P9LA 3K8WA 1H7WA 3RR8A 1XI1A 3DAWA 2B4VA 2MPUA 2KFZA 4F4AA 1GH8A 3R3TA 2AYGA 1E4FT 4IJNA 2Q6BA 5F8IA 2O8EA 2P5OA 2LQJA 4WQ5A 1HBMB 3KLIB 3ZTQA 4ZLNA 4YNQA 1JLAB 3BKUA 3GR0A 3EXYA 4CF1A 1K44A 2IVFB 5T7LB 1VQ6S 4BG9A 2HVDA 3WQPA 3IG1B 4NXMJ 1F5CA 3LZIA 2HBKA 3MM7A 2FVRA 1HIYA 4CRJA 4Z4FA 3I55N 4F50A 3RW6A 4FJXA 2DPJA 4ZVFA 2O4GA 4HL9A 2ZJQL 2JLEA 2R3VA 3HPOA 1Q5YA 4A57A 1RWMB 2JH3A 3N4WA 2MZSA 3TWHA 4HCCA 3NAHA 3A8KA 1KS2A 1ZBLA 2VKRA 3SYZA 2LEBA 1B7YB 3TUJC 4FWRA 2NRHA 4B9MA 2FJDB 3H90A 1TMMA 1QDUB 1BCMA 1VK3A 3KJVA 3TARA 4FZVA 2QLXA 1ZTWA 3H59A 3H08A 3GG0A 1R6YA 3U1MA 3R1LA 4CP5A 1WSEA 3MOJB 2C2OB 1L5UA 3VQEA 1E6YA 2D1CA 3EO3A 2M9KA 4H0TB 1U24A 3M5RA 2KI2A 4K5SA 1RWNB 4GKKK 5A6PA 3R1HA 4RW8A 4J9PA 2A1SA 4DV0J 3BDPA 2RDDA 3U9ZA 3MXHP 2R7UA 5LJ5Y 3SCKE 2AQ4A 3SK3A 2E20A 1UW4A 3MCAB 1R3NA 2CPJA 2VA2A 2IOCA 2BJEA 4OYPA 1BDGA 4PG4A 5L8RC 4Y34A 3Q7BA 1JXBA 2I5JB 3SUOA 2DFFA 5J2NA 2XWXA 3OL8A 2X78A 5IT9O 4DS5A 3R8YA 1BC6A 3UN3A 3HBTA 1RLCL 4X4PA 2ZJRL 3PYFA 2W4CA 4B1YB 2E9TA 4LQ9A 3NCIA 4FJ9A 3CIPA 3AHPA 4FJLA 3KUHA 4FL9A 4C8OA 3N6LA 4JKEA 4E19A 1CLFA 4JKBA 4ED2A 2JVRA 2B4PA 4QCLA 5G4DA 1B70B 5D0EA 1IG9A 3L4QA 2PSZA 4XPCA 1ZPVA 3R7BB 1JLBB 1XNRJ 5AQFA 2MLYA 3BGLA 1B9DA 3H1VX 4FS1A 3RBDA 3LA0A 3PRBA 3CD0A 3FSIA 3AVFA 4RG8A 5J2QA 2XHBA 2DPIA 4TSXA 2MY7A 3PYGA 4B3TK 1NMEB 4EK2A 4ETZA 1VQOS 5HRRA 1OMSA 4WPAA 3H42A 4KKOA 2V4JA 3BSAA 4DV5F 3NNCA 2F8SA 3BYPA 3J7AP 3DRRA 3N5FA 1MWKA 3KJNB 2ZNYA 1QUVA 3V9SA 2XO7A 2OKQA 3RW7A 3MEKA 2B0GA 1IBLK 1KOOA 3S8SA 4FLWA 5GAHU 4A8MP 5AR0A 2IM0A 3UKRA 5E41A 2C3YA 5HQLA 1LWEA 1KNZA 2OANA 5DDRC 1YITN 3NMRA 3LP0A 1D09B 2V6AA 2WCXA 3IP0A 4RTFD 4LT6A 3ETMA 3HHLA 3SAGA 1VK0A 4IRDA 4DR6J 1FWLA 4GVBB 4HI1A 3AA9A 1XMOK 2FC0A 3U1NA 3BGRA 2JGUA 3RU0A 3QERA 3QGIA 3SQ1A 3IR5B 4RUBA 4M5KA 1U2FA 3JXOA 3GZ7A 2VCPA 4A5BA 4C3MA 1SVDA 4PXCA 2HHUA 3G25A 1WG1A 1HI0P 1C4CA 1EZZB 2LA4A 2HB5A 4JI5J 2PYJA 1HWKA 1H98A 1S1TA 3O9SA 4JEPA 1D9AA 3O1LA 2HHVA 4JV2A 3O4WA 3JYTA 2YX6A 2E1MC 4DFJA 1VR6A 2QIFA 4AYBD 3QNOA 1TAQA 1GLFO 1HNWK 3CJ8A 4B9TA 4W5RA 3AB2B 1G4CA 4FPRA 3AARA 3CJ0A 3I82A 3LW5C 4CBWA 1FE4A 1RT6A 3NL0A 3D2FB 4ERDA 4GC6A 2VWBA 2BANA 3H40A 1EKRA 4GKJF 3QO9A 2Z2ZA 3MMBB 2XZWA 3FEYB 3RSEB 2D3ZA 3VAKA 4KFBB 3D1HA 2VPWB 3ASMA 4CO2A 5K9FA 1JX4A 2B56A 3SFGA 3GE9A 3TABA 1HJRA 1AXQA 4W5QA 1TFWA 3UR0A 4DV6F 4WF9Q 3HFKA 4QQBA 1S1WB 2G4BA 4MYUA 5KGXA 4BRDA 3I56N 2VU5A 3GYXB 1Q79A 2UXBJ 3Q23A 4CJWA 4KSEB 3KLHA 2FC9A 2E7XA 1KVBA 2CZVC 3LO3A 3NLCA 1SKRA 3GCXP 4RU2A 3VQBA 3OHRA 4FZZA 4DS4A 4PRFA 3ENBA 1OPZA 1OH7A 3O3HA 1V3ZA 5EU7A 2VG5A 1PAUB 4QZVB 2K1RB 3JSYA 1UKUA 4U95A 4JB8B 2V52B 3ZLJA 3CC7N 3O1BA 3HXMA 1PBUA 1WC5A 1NZ8A 4EUVA 4GMJB 4IOCQ 2VYPA 2NCKL 1U6FA 3CPWR 1HW9A 1VQ7S 1WELA 4M5HA 3A8YA 3Q8RB 2ZWOA 4CJ4A 5IQ6A 4UOHA 1TL4A 2P9KB 3G2XA 2YH0A 3ZSRA 3IS9B 2YBVA 3JTPA 3THVA 1SV5B 1M5KC 4KHSA 2VOPA 3GPAA 2WAQD 3VQ9A 5KT3A 2RDJA 1JJ2M 2J7WA 4OI4A 1URRA 4RW6A 4DN0A 3M6WA 4JV5J 2EFGA 3HVAA 1QLNA 3DM2B 3HPHA 5C42A 4EFHA 4JUZA 1RAAB 3M8WA 2X3GA 4UT4A 4WFNQ 4J9VA 5GMEA 3TJ9A 5AQTA 2O01C 2R2UA 2GBZA 3FBEA 1KD1O 3NCQA 4NCBA 2UUBK 1KWMA 4LH5A 3AAQA 4PPDA 4NXMF 1VBYA 2FPHX 2B51A 1RBVA 1NH8A 4DLGA 3JAMO 4CQ1A 3DLLL 1S7HA 3L2QA 5EGYA 4CEOA 1WUUA 4ID1A 2UVVA 3MX2A 1HARA 3MM8A 1NJYA 3NWGA 2OPSA 2W25A 3ZT3A 4O3NA 2CQ1A 3EUNA 1UAWA 1N5SA 1T9XA 3WDOA 4ZTFA 3J7ZT 4F4XA 4O8KA 3M9OB 4OKEA 3OYDA 3AA4A 1ZM3A 2LA6A 2HPUA 1VSJA 2BJ1A 1ZOTA 3M7VA 1WKLA 4DR1J 1MG7A 1IKWB 2PGCA 4LIRA 2KFYA 4HT7A 4M95A 1WSIA 1T8EA 3I4HX 2DNOA 4BS2A 4F0KA 3CERA 3VQDA 1HWUA 2ZJRQ 1YLXA 2G9OA 4CK2A 4FLZA 4AH9A 3FZFA 2H48B 4UUWA 3BREA 2GZOA 2GHVC 4LFCF 4DKWA 3PEHA 3CJQA 4URQU 2ZBCA 5F8JA 4I9LA 3EN9A 2G8UA 1VYAA 1F3VA 1UVLA 2NLXA 4YORA 2GHPA 2LMIA 3G87A 4CH7A 3AVAA 2CJYB 5AQVA 4MO4A 4NLUA 1SKSA 1FE0A 4X66J 1HBMA 4WFBL 1NO8A 3S1TA 3KLEB 4E7LA 2Q97A 4XAKA 5J2MA 5B8HA 3HVWA 2WB1D 1SH3A 3M8YA 3O9UA 2CAJA 3FEZA 3J7A1 3RBZA 3LPYA 3I0SA 4FWOA 3MF5A 3T1HJ 3BZCA 3DKDA 4CM0A 4EP5A 1RWXB 4LF7K 1DJ0A 1U0HB 3V9ZA 4PG8A 2LDIA 4L6V3 4F26A 1RDDA 3OYAA 4I56A 3W5ZA 1HBOA 4C3LA 1M1KO 3ZTPA 2BXJA 3IFRA 4CEAA 4ECRA 1TKXA 4GO7X 1Q9YA 1RDWX 3VEYA 2B8PA 1RAGB 3NGIA 2Z2MA 5F0UA 3C46A 3OUYA 2MKYA 2NRTA 2RHSB 4IUFA 3AO5A 2NRRA 4I68A 3KMQA 5LMUJ 3I31A 1XNRK 2J8SA 3IA0A 3SIPB 1DTTB 4MAKA 5H9FJ 1KAYA 4DR5J 3QRRA 3MEDA 5HANA 1UJ5A 2AZ1A 4DSEA 2Q66A 5KG0A 1H38A 4DV0F 1HW8A 2OHDA 2CVIA 3HSDA 1UVNA 1NK5A 1JK9B 3QFHA 1HWLA 2XMTA 2QC3A 4BC4A 3W5YA 4XH5A 4CVNE 2Q6CA 3MAAB 3IM9A 3EY1A 1SH0A 2W7AA 2VG5B 2CQ3A 4YP3A 3WEEB 1FW6A 2QA1A 4ZVGA 1O6XA 4S0MA 1F3FA 3DXBA 1MDUB 5CAAA 1S9GA 1IJFB 4KHWA 3W65A 4P7TA 1JJCB 1NGEA 1UFLA 3DDNA 3CVKA 2WTFA 5FPEA 3O6QA 1OSCA 4DTRA 3RBEA 2KHDA 3CD6S 3IS9A 4ZP7A 4IBNA 2GV9A 1GOAA 3UB5A 3OT9A 3GIJA 3T41A 2F8MA 2UUBF 3W60A 4JKCA 1N32F 3AQOA 3MM5B 3MUVP 1J5OA 1U25A 3QSIA 4DQSA 3R97A 2IRXA 5BRFA 1VSLA 1KFSA 3W8PA 5FLXY 1WSVA 2QV6A 3NXZA 3GQCA 2PC6A 4LF9F 2DTUA 3B4DA 3IDHA 3EGWB 4HHUA 1JLEB 2XSJB 2MZ1A 5KFZA 5KFHA 4OJRA 3W0LA 1QD1A 2V94A 4KHRA 1WKJA 3FE1A 3VN5A 2HGLA 4G1QB 4XTTA 3RUBL 1NGBA 1BA0A 1KHWA 4YDUC 1EHWA 1H3DA 2IPOB 2A6MA 3UKUB 3GBTA 4ED3A 1OS5A 3OQ2A 3GL1A 3OFHA 1HMVA 4NLOA 2A2CA 3C6UA 4PAAA 1BWFO 1A6LA 2H54B 4NLTA 5HI7A 3LDLA 1QSLA 2FBVA 1WD6A 3G4SS 3AVGA 2DGOA 2VPXB 2Q31A 1X4AA 2P9NA 1KTVA 1XERA 2P9UB 2D9OA 4W90B 3H7HB 4LF7J 4DUYJ 1XQIA 3CCJN 1WEZA 2NZ4A 4PABA 2ASYA 4LFAJ 1YKWA 4ELUA 2H5IB 5I42B 2ZVIA 2L48A 4ZHRA 1WC1A 4HHTA 4MLEA 1S6QB 2HFVA 2UUCK 3J81Y 5F8GA 4B3MK 5T7BA 3F2KA 3HI0A 1NKBA 5AT1B 2HLTA 1VBXA 3MN7A 3R2DJ 2DHSA 4YR2A 2VGMA 3T1YJ 1TUVA 2OFGX 5M2UA 2R7RA 1Q78A 4H5WA 5EY4A 1WLJA 1NEEA 4QWAA 4AHSA 2QFJA 3AO2A 1BLUA 3RB0A 2KB2A 1YJ9N 3B4MA 4QS8A 3UD4P 2RUSA 3EKSA 3NBPA 3CCZA 2RF2A 2E9ZA 3MEDB 2LSNA 2E1CA 3DLEA 1TKTA 3ISNC 2RB7A 1JKHA 3KWIA 1N8RO 1NJIO 4DMZA 3PDNA 3FSXA 3WZ0A 1C1BB 4DR6K 4CWBA 4I67A 2UUTA 2QWOA 1EX8A 3TUZC 4Z4GA 1DQ8A 4WU3A 1LWFA 2J6SA 4I2PA 4D3GA 5JS2A 2GFFA 4DUZJ 3CCRN 3BEXA 2GQ2A 2WB4A 3UFCX 4LSZB 3ZX3A 4B8AB 3SNNA 3S6EA 3V6HA 1RSCA 1XMOF 4CNZA 3R9LA 2C3UA 2KW4A 3ETOA 3GV7B 3AV9A 4OX6A 4AQYF 3QT5A 2DD8S 1O8BA 3D6HB 6FDRA 3D5MA 3ZNJ1 3W2VA 3OTBA 3SBMA 3A3PB 4JI1F 4TLQA 2ATQA 5D15A 2KDOA 4CJUA 1P1LA 3O6WA 5HSPA 1HI8A 1TVRB 2LEPA 2ZHOA 1FKOA 4WFZA 3FRYA 4A61A 3QO9B 1KAXA 2BM1A 3V4IA 1IO2A 2SXLA 2VQEJ 3VEVA 3LUYA 3CJKB 3H1QA 3ZZTA 2XWYA 3LGHA 4FOEA 4WQ5C 2B4JA 1PSDA 3CCQN 2HZAA 4F3TA 4QW9A 4TYAA 5AQJA 3ADAC 2IFXA 2RU3A 4N5SA 2QWMA 2CQGA 1QS4A 2KM8C 3AVNA 1R43A 2IIRA 4OMFG 4J9QA 4FNIA 4JYAK 5FD1A 1TL1A 1SJFA 1DT9A 1VQ8S 1BHLA 1ACMB 3FZ2A 3O2IA 4LBPA 1UPPA 3WIUA 2W4PA 1K8AT 4DQIA 4LF9J 5DK5A 4M3WA 1HYSB 3G82A 2H4WB 4ZIWA 1JL1A 4DG1A 2Q3PA 1OQ6A 3P3DA 2OEMA 3G6YA 2IDEA 2V2QA 5JJBA 1BG3A 2FZKB 4A47A 4WK3A 1DARA 3C95A 1M5OC 4M3ZA 4AUKA 1FO1A 1CG2A 1KQSM 3D4JA 1WB9A 2W9AA 2IVMA 3KUEA 1PYTA 3HP9A 2HMPA 5M2RA 4HTIA 1VDHA 5L1LA 4K8XA 3I0RB 2YXLA 4OJGA 4X4RA 2CGKA 1KLMB 3CO9A 3NH2A 4USHA 2ZWPA 3JB9k 4MMOA 2PO4A 4DPXA 5LXYA 4HTJA 3TA0A 1PBAA 2B5JB 5CYMB 3TR8A 2NRXA 4QR2A 2WVDA 5KG2A 2CZ4A 2RE1A 4U96A 4GKKF 4KH4A 4HI2A 4V19X 4H4MA 1D8ZA 4UY8T 3W3DA 1VQYA 4HVJA 4O3QA 1MMLA 4CLSA 1RTJB 3ZTOA 5LJ3Y 4YB1P 4Z7CA 4OJHA 4NYNA 4NA2A 1FRJA 3AO3A 4CTAB 4BR4A 1KKHA 3P4IA 4DL5A 1U1PA 3LH2S 4A8OA 3T1YF 3WNHA 4Y3CA 4BC3A 3VAIA 3MPUB 2OPSB 1LWEB 2YJFA 1VQNS 2YHAA 4JI4F 2HHXA 1YBUA 3H8YA 1AUSL 3ENAA 3MMCB 2ZH3A 4YHHJ 2HOEA 1AFIA 4OQJA 1C4AA 4DPUA 3V4IB 4JI5K 4J2EA 1Y00A 1HBNB 3FFKB 3M2RA 3R3LA 2KTQA 3A5LC 2RUGA 4R0JA 3VWSA 4CH0S 1CVJA 4RKUC 1CJUB 3OS1A 4I6YA 1Q1KA 1RK8A 2KFNA 1N88A 3IGVA 2ITMA 1JXEA 3NMAA 3JS6A 3L7OA 2MDAA 4NLCA 3VQ7A 3IAS9 1JCEA 1O51A 4P7VA 4IR1A 1RWVB 3E9PA 4CGIA 1RT1B 3GP9A 5F41A 3LDQA 1QQCA 1Q81T 3OTCA 3PKMA 1N54B 3R2CJ 2ZH2A 2B9YA 1WSJA 2JJ4D 1WHXA 1X0FA 2E66A 1ZS6A 3QJPA 2Y1JA 3IAM9 3HFVA 2JEIA 5CXTA 2ZJPL 2CGLA 4BE1A 2FVCA 3DGPB 4I64A 2ZQBA 3Q8VA 4CZLA 2NXCA 3DU5A 2EC2A 1S48A 1FWPA 3E2EA 4JI3K 4JHDA 3WNGA 2D7SA 2Z4PA 2HBZB 3ENQA 3H2VE 2OTLN 2JFDA 2F4VF 1T44A 5IOLA 2HQIA 4YS2A 4FJIA 2HMIA 4DR4F 4DR2J 1HBOB 4ZS6A 2DNPA 4ISGA 2QG9B 4CD1A 5KG1A 3CMQA 4W5NA 4ID5A 1MMNA 3KMSA 1WOOA 3U7JA 3DU6A 3E1YA 5AQSA 1R6VA 2AW0A 4CERA 2GNKA 4E3SA 4HH1A 4CBXA 5MAOA 2QLWA 3MR2A 4UZBA 5I9EB 4KREA 4J9NA 1YRXA 4RW9A 2CUYA 1QSSA 3NH0A 5C24B 1O5JA 3EGNA 3VQ4A 3TNVA 4PKHA 2DISA 1UA1A 5B0BA 1FXRA 4O3SA 5GADP 3ENVA 3MEEB 4CO5A 2BE2B 2WONA 1WC3A 4WTYA 1VQMN 1VRQC 3CHWA 4OX9F 4Z7YA 3M2UA 2DRBA 1NDKA 3RBXA 4CHYA 2FIUA 4C98A 2FZGB 3EMTA 5I3QA 3CCQS 4ILMA 1XMBA 3PX0A 4EO8A 4NO7A 3OYBA 1ZM2A 5CZ2A 1BHNA 3TQ1A 2OTJN 4OKKA 4G65A 1U7LA 3CC2N 1WDDA 5A6WA 3CMES 5EUHA 3KIOA 4MFBA 4N47A 2VA3A 1VJQA 5I42A 1GLBG 1MWMA 2P51A 3ELHA 1VSMA 5E3PA 1SQKA 4IKAA 5HMZA 1GEHA 3D3BJ 3WXIA 3BGRB 1GAOA 2W4DA 5L1IA 4YDXA 2O8FB 4KBOA 3I8BA 1R89A 1TUWA 3HULA 3P31A 3HHLB 3AXMA 4EAHD 4FW1A 2GV1A 4A8KA 5HN0A 3L3CA 3OTOF 3KXDA 2ASOA 2XLIA 2QA4G 2AD9A 3CJCA 1BD6A 3CQYA 4GV3A 2GAHC 1G99A 3O3GA 4BBYA 4X66K 2DHGA 2M70A 5A2QY 4HUFA 2WSCC 3HOSA 4DQRA 2DFEA 4CLTA 1NLKL 2F8EX 4IEIA 3HL8A 3W9IA 1X5OA 1R8BA 4ZN1A 3OTOK 1F9FA 2RVJA 3B8AX 3VQSA 3JTNA 4B9UA 4J9MA 1V6HA 5KFFA 4DU7A 5AQRA 3SCIE 1HNXF 1FF2A 1GXUA 3F9MA 1G6BA 3SPYA 1YSJA 2DYAA 1X8DA 3MR6A 4F25A 4GVMA 1YJRA 5BR8K 4PXEA 3CI5A 3QFUA 2AJQA 3CT9A 2Z56B 5EHHA 2VJUA 5KPRA 4KGVB 1RTIB 4Y2IA 4Y00A 5KFXA 3VALA 3D68A 2A18A 2ZM6K 3PCOB 5ETKA 3V1OA 3D0GE 3CCTA 1IH7A 3A13A 2RSQA 4C1NK 1I94J 3QMLA 2W2OP 1DGKN 4DEZA 5CCMA 4LRAA 2HQGA 2V4RA 4A62A 1KOHA 2B4UA 2C3PA 2DGSA 2CJAA 2E1YA 4RJVA 4GVEA 3DJCA 1SKWA 2IVPA 4UOFA 2V50A 1F9EB 3OTDA 1HD0A 3BKFA 3MEGA 4WQ4C 3AGKA 4M41A 2MGZB 4C8LA 4M3RA 1RHUB 4L75A 2XMMA 4C11A 3EZOA 3CD7A 5KGWA 2M8HA 3S01A 2BRKA 2L41A 3M6GA 2GWJA 4QIWD 2DHAA 2R8IA 1XWLA 1WBBA 1K73T 1VQMS 1K9MO 4FPIA 4AILC 2DXEA 2EFQA 4IRKA 2XY5A 4FWLA 1TZ0A 4BVPA 1N36F 4EZ6A 1SKUB 4WFYA 4JV5F 2P9GA 5F9LA 3ZEUA 3VGUA 2BVZA 4R0EA 2GUIA 5C12A 1MW7A 2OI2A 4JRQA 4M94A 4OZ2A 4AHVA 5ADXH 3MPVA 5KG6A 1T6DA 4QAGA 1Y3JA 4CFCA 2OELA 5DS7A 2GJIA 1GOBA 1WG5A 4BR9A 3FVYA 1K1SA 2GCFA 4BE2A 4RL1A 2P2CB 1NK4A 3IGNA 2B9EA 4ZP8A 4CHZA 3ZEUB 1BI4A 3KUGA 2C28A 4NMLA 4K2JA 4KIAA 5AQLA 4YR3A 5H1SQ 4XIUA 2FYXA 1LAVA 1WHWA 5LOQA 3P6YC 3BO4A 4KRFA 3H6EA 1E4GT 4DTMA 2VUGA 4KHQA 3WEEA 1HYSA 1QHAA 2GIQA 4B9VA 1H2TZ 5L1KA 5C15A 1JLFA 1S3XA 2NRZA 4NI2B 3WXMB 1YJVA 4A8QA 4BR2A 1VQ5N 4ZCLA 2QJ3A 3L6QA 1RTHB 2I38A 4ECTA 1XR5A 1FK9A 4CIFA 1HWJA 3PG9A 5AQQA 1N8RT 2AYBA 3J80O 1JLQA 2F40A 1Q16B 2R2RA 2P5VA 2B8QA 1GT8A 5KTQA 4USVA 3P49B 1NHKL 3N0VA 1VRTB 4NPOA 3EGVA 2OPQB 1HNIB 2LVWA 2V7ZA 4DR3J 1T3NA 4WTOB 1RYSA 3WIVA 4OHXA 4RW7B 3GB0A 4OYBA 3I5CA 2IAJB 1MROA 4MLHA 1PGZA 4IG3A 1IN0A 1IWAA 4FWPA 3D28A 1UCNA 2KO1A 4NXMK 4DR3F 1TMJA 2VL1A 4TXSA 2C2DA 4FNHA 4Y0WA 1KP6A 1CZBA 1NGJA 1C0TB 3SUPA 5KFUA 4DQ8A 5A8WB 2F65A 3EWGA 1PILA 1BCOA 3CF5Q 4IQMA 2D0BA 4FLYA 2CPEA 5G0RA 5DLGA 3QT6A 2HF3A 1YX2A 2NS1B 1SQGA 3SI6A 3OLBA 3R1XA 5KI6A 4C48A 1GLDG 1R8HA 2WSFC 3OBYA 4CEDA 3QRQA 5GAGI 3SAHA 2KN4A 4DR7F 3N5BA 2ZH4A 1N34K 2Q36A 2PI5A 2PN6A 1U26A 4NLDA 3G0ZA 1M5HA 3MFIA 5KFOA 1YVFA 2HNDB 3HSJA 1ZBUA 2ZBIA 1EXQA 2COLA 3JSRA 4W98A 3I87A 4ANEA 4LQ3A 1VSIA 2XY8A 1TL5A 1M1GA 3W1YC 2CH6A 5GAEP 4XK8C 1CJUA 4ZIVA 4CLLA 4WYLA 4CEQA 3EZWA 1ULRA 3GYGA 1KVKA 3AVCA 4I2PB 1FJGK 3R7NB 2VFUA 3GTYX 4AXIA 2QWLA 1EP4B 1RCOB 2AJ4A 1RNHA 2V8VA 2V2ZA 3E9LA 3VEOA 3BJYA 2MB0B 1EO1A 3HZGA 1KONA 2L9NA 3W9HA 2Y8YA 4RNNA 1LWXA 2RKIA 1C0MA 5IT4A 3G6XA 4LBHA 5DM7Q 4DV6K 4CGGA 1GX5A 2AEFA 4FJMA 1W7WA 1FA0A 2OSQA 4Z4CA 2UXCF 1HUXA 3PIOQ 4I6WA 2CWXA 3T3FA 1HPZB 2V9KA 1L3KA 3Q89A 3K8VA 2K1RA 3W61A 2C2KB 1WNSA 1M5VC 1RCXB 1FX2A 2FVQA 4PL8A 3VVUA 5DM7L 2FLPA 4GKJK 2A0FB 3RRGA 1ATRA 1VRTA 3OR2B 3C2PA 4PKDB 4ZJQA 5HO4A 5GADI 2CPYA 3W2WA 2NPIA 4X4NA 3RRHA 1RACB 2LU1A 2XYGB 4RW9B 4HWIA 4K8RA 4KAIA 1HNWF 1M1KT 5B7WA 2CQDA 3OPKA 4OHYA 5J1EA 2WFBA 3MXJA 2DHXA 2MZQA 2VKZG 1HFEL 1RJJA 2YHWA 4NZ0A 4B3OB 1GMVA 1SL2A 4CZEA 3D7EO 2YKNA 2E5HA 4BROA 4YDDB 4L72B 2YNGB 4CJRA 1YJWS 4I69A 1KTQA 4GY2B 3FEXB 1I3AA 3CFPA 2ZKTA 2FHJD 1FEEA 1HYZA 4I7FB 3G71N 4WFXA 4ZPWR 5GMDA 4JYAJ 1HNZK 4G6VB 1N48A 3C8YA 3QATA 2CQBA 4DX7A 2H51B 2LLZA 5AQYA 1LK5A 3CJ9A 1JLCA 2BRLA 1BL3A 4BG8A 3MX5A 1OIAA 1S97A 1IR1A 3P45B 3T5HA 3VAGA 4KTQA 1SBRA 1U45A 5AJ3J 1BY9A 3PW2A 4RU9A 1X9SA 1UZHA 2LQBA 4AL7A 1IBLF 4YFUA 5FPMA 2JC1A 2CNOB 2GGPB 3WBZA 1RBUA 3O9TA 3AAPA 1S72N 3QINA 4ZLLA 4F4YA 1RHRB 3HD2A 1EQ0A 2FHJA 3QT8A 3QFPA 3ZZYA 4LF5F 2HBYB 1ELOA 4B3MF 5E7OB 5LY3A 5JS1A 4DCHA 1BQNB 3DLGB 1SJ1A 3VVTA 2HQ3A 1TKZB 2WTUA 2UU9F 4DTSA 3TQEA 2KYXA 3MR7A 4DFMA 2BJ3A 1DFDA 4N8OA 2OO4A 3OW2R 4CEZA 4FVMA 4CI0B 4RNMA 5LJWA 1UVMA 5KOXA 4R79A 3K0JA 5AQKA 3GILA 1LW2A 3OVSA 4MIAA 1EETB 1VK8A 5GAEI 1NJXA 4ANDA 1PO6A 1NK6A 1KVJA 1UL3A 1U2CA 1KLNA 1Q5VA 1VRUA 3L2RA 1T9TA 1P1TA 3GIIA 3VQ8A 3M8ZA 3M3ZA 4JI2K 4X62J 1LK7A 2NLWA 1S4FA 3SQGA 4ZHRB 1A9NB 1G1XA 2MKHA 3TEHB 4FZXC 2C42A 3NHGA 4K7QA 2DHHA 1SC4B 1CXUA 1IR0A 1WF2A 3BQ2A 2VICA 2W41A 1RT5A 2GC8A 3MCSA 4YB5A 3HVTA 2QX0A 4DR3K 4YY3K 5LSRA 4CZGA 2CNNB 1NRKA 4IOXA 3R6MA 3IRWP 3E51A 2UYTA 8AT1B 1VQSA 3H25A 4I2QA 1RTDA 4ZP9A 4ECWA 2O8BA 4BRIA 3QBCA 1D9FA 2M3DA 3K5PA 5F1XA 2YWHA 3PACA 3R8EA 3VQ5A 4DF4A 5HRPA 2D0AA 4CJVA 5D78A 3PM9A 3BSCA 1T9VA 3KWGA 3CCES 1NH7A 5RUBA 4LJMA 2LQ5A 3BH7B 3CDBA 1S9EB 2XI2A 4FLUA 5KFRA 3QEWA 3LPEA 3H45C 5KQ8A 1RWKB 2R4FA 4LSNB 4RCHA 4O4GB 2YPZA 1I5OB 2ZH7A 3GV8B 2HNYA 4TU7A 4GMKA 4WXOA 2VH7A 3ZZUA 3KK3B 2AX0A 3ITHB 3TAMA 2WBNA 4RBUA 4TKTA 4J9OA 4OHWA 2D69A 4KO0B 3AODA 1YZ7A 2EFPA 1T05B 2FJXA 3CNQP 3HCXA 3NF8A 2DNQA 3Q8SB 4HVZA 1WJ9A 5B08A 4CO0A 4OX7A 1S9GB 4E1NA 2IHR1 3D1QA 1WSGA 2JWNA 1HR0F 3UCZP 4CZIA 3KTQA 3FDSA 4DTOA 4WYBA 2DH7A 1XBWA 3WUHA 1C2PA 5IT0A 3FFIB 2NXJA 1EX4A 5C2CA 2YX1A 1JIHA 4O3OA 4KHYA 4ILGB 1IQZA 4ES1A 2GELA 3UR3C 2QA2A 2O8EB 5CZVA 4C0HA 3I9ZA 1XJWB 3GJRB 4CJFA 5CY4A 4AHCA 6AT1B 4WZQA 2ZD1A 1FJ7A 2XO6A 5KOWA 4DSJA 5CH7B 1Y5NB 2QT7A 4RLEA 2QLFB 4YHHF 4N56A 2FSNA 4O8UA 2DITA 4WP8A 4GKKJ 2A5XA 1N33J 4C8NA 4QU6A 2IJNA 3DN9A 3LF0A 3BQ1A 4CJKA 3ZX0A 2UXBF 3SMPA 4RW6B 5KG5A 5AE2A 4FK0A 5EVZA 4P72A 3NE6A 1EP4A 1YI2S 2UVRA 5ETQA 3OYNA 2IVNA 3QZ8A 3IM8A 5GADU 3ZSOA 1SS6A 4O5BA 5EWGA 2ZZNA 4OYWA 4CE9A 2ZM6J 4I2QB 1RTDB 4QS9A 3SDEB 2ATCB 2HVIA 1YIJS 4CIGA 1WAFA 3C6HA 2OH2A 1SIWB 4JI7K 4BVOA 3TZXA 1U1KA 3DXMB 1YJNS 2ZM6F 4P52A 4WJBA 2YNIB 3NS6A 3CJAA 1T03A 4K4WA 4JKGA 3O9QA 1Y64A 2XB2D 3VETA 5E33A 1XMQJ 3DFEA 4K0KJ 3RAMA 3TVZA 4U7UD 4WF9L 2AEJA 1QY7A 2R7YA 5BPNA 2RQCA 2J9DE 1RFQA 5D3GA 2YNIA 1HNIA 1K8KA 1N5YA 4CEEA 1HNVA 4ZITA 4IFVB 4PG6A 2KJVA 4FDFA 4IRCA 3AO4A 2V0NA 2RF2B 2XMJA 1PCAA 4MK7A 2GVDB 4JI8J 2A3JA 4IG0B 2D74B 4LR9A 2ZE2B 2OPRA 2VHGA 3PHEA 2P9EA 4Y2KA 4TN2A 3KK2A 4FLXA 4WU2A 1OH8A 1LWCA 1V9OA 4TU8A 3RB4A 3OJSA 3FCHA 3G96A 3LGMA 1ZTTA 3EVWA 3NGKA 3BR9A 1RBLA 1PJ5A 2GWKA 1N36K 2QXLA 3UE2A 4RW8B 1U1OA 2VODA 5A2QU 1Y97A 2YKQA 4L3QA 2ZZMA 3TUIC 3I32A 2RRNA 2CQIA 2YI1A 1QHTA 1FFSB 2MTLA 3E8OA 3DOLB 3VF0B 4MIWA 2FUG9 1JLAA 5MLCQ 2IYGA 1RBTA 4FN5A 2O1PA 2A3ZA 4E98A 4FVCA 1TL3A 3MMAA 3CCMN 2DEIA 1ZETA 1ZM9A 1HLWA 3PW5A 4IDKB 3UO0A 5F0WA 1C0UA 1HR0K 1W97L 1S1VA 5AJ3K 3OYLA 2ZHBA 4AQYJ 5HROA 1NSPA 4C4WA 3JTOA 1S49A 3HHEA 1TL3B 3U27A 4FW2A 2VDIA 4O4RA 2BQRA 4WFAL 3B54A 3U4LA 2H3GX 3K9KA 4OX9K 4O5FA 4OPKA 1Q8BA 3T9NA 1L3UA 3KOAA 3AOBA 3EL2A 1C1CB 5AQXA 1FVQA 2FJEB 5I3UA 1U2VA 4PWWA 5LMUF 2DGUA 1WF0A 4ED7A 4DBQA 2ETJA 3T6JA 4LF2A 4ID8A 1BIUA 2V8PA 5KFEA 4PCQA 4KH5A 3THXA 5D0HA 1RADB 3I0RA 2VC0A 2QI2A 2R7XA 3MUMP 1N0VC 4CK1A 4NOHA 2DNZA 4LF6K 3QGGA 2CA9A 3LTOA 1JLGB 4BR5A 3K57A 3KYLA 1KXPA 4MK8A 2MJNA 4URGA 1FNOA 4GRSA 1SAZA 3FQLA 4XO0A 4K5RA 2Z2LA 3MEGB 1S1VB 4IH5A 3DM2A 4CFBA 4ZPBA 4CGJA 1E6VB 4NWBA 1WKKA 1A5VA 1BI4B 3AVMA 4C8KA 3ZZZA 2GVDA 2B4OA 3ZSXA 4LFBJ 3OYMA 2B3TB 2PFUA 3VZIA 2XMAA 3BN7A 2P9CA 2GTDA 4AHRA 2ZBPA 2UVUA 2FTRA 2MHNA 4MTPA 1NHUA 5K8OA 3DLKA 3ZXWA 4AD6A 2W40A 2LYVA 3V9UA 1LW0A 4LF8F 2APOA 4CHNA 3N6NA 4ZN3A 4JI2F 1WBDA 3KK1A 3CPWM 4BC5A 4I7FA 1ROFA 1UW9A 1FRLA 2PDAA 1JXLA 1FJGJ 4CDIA 5THWA 3POTA 3BBCA 4LBIA 1XK8A 3ONQA 3CCLN 4QOZB 4A8SA 1TKDA 1IM4A 1VQPN 4F4ZA 4B1WB 1RT2A 2UV8G 4ZKAA 3VEWA 3C66A 3MPDA 3H4BA 5DZ7A 2AGOA 3RB3A 3GMGA 3ILLA 4USTA 1HD1A 2IDLA 1XMOJ 2UXCK 4XH4A 4ATNA 3ENWA 3L7PA 2X7IA 1KSPA 1NGFA 3WXLA 1Y3KA 1OVYA 1RT7B 2EI5A 4OYIA 4JI8K 2I0XA 2DCUB 4DV5K 3MURP 2MQLA 4E7JA 5C2GA 5BR8J 5A8RA 2P9SB 3PSFA 4HUEA 1ESVA 1Q82T 3CJBA 4LFAK 1ASWA 2MQOA 2GJFA 4NLSA 1DTQA 3BZKA 2U1AA 4ICLB 4F3MA 2BMBA 2H3EB 3OTOJ 3LDPA 3KKFA 2FC8A 4KRWA 3ZT0A 4FK4A 1TK8A 5HVFA 3D0PA 3H3NO 2BKOA 3BUZB 5HJYA 3HO1A 2YX7A 2FD2A 4K4UA 3PV8A 4NMXA 2IBKA 1T11A 2DNLA 2J9CA 1S4EA 2J0WA 5M1KA 4DR7K 2LEAA 3ID6A 3QGPA 2XMVA 5IS2A 2B7CB 4H4MB 4RR5A 5L39A 1VQLN 2YHXA 1UWBB 2X1FA 1ZM4A 2BA9A 1IBCB 4RNFA 4EBDA 2ERRA 3VA0A 3FFIA 3QBXA 4NYOA 2ALZA 1N4LA 5LSLA 4CZJA 4J7CA 1C0UB 4BRAA 1YT3A 4ID5B 4CIEA 3B6PA 4PUOB 4Q44A 4DV3J 2QL5B 2DRAA 2OEKA 5KFMA 5DQGA 4OKJA 2HHPA 2DVIA 1D0EA 3NOCA 3GWCA 2ZBRA 3U8XA 1RBRA 1WWHA 3VAFA 2W6LA 4EP4A 2WVFA 3AJ2A 5HL7Q 3G86A 4H5VA 3M9NB 4K8ZA 1DLOB 3OSPA 1JB0C 4FWMA 4F4KA 2O67A 4F2RA 4DV4J 2GVZA 2FSKA 3RWUA 4RO0A 1XHXA 4O3RA 1RI7A 2W6KA 1VC6A 1OWXA 5TKWA 2CZ9A 2M2BA 3OXGA 3MM9B 4PWDB 5K8MA 4J2BA 4WXWA 1FJEB 4DPYA 4OYXA 3M2UB 1JLQB 4J90A 5DQHA 2EC0A 1CSJA 3MMVA 4EYHB 2W2NP 4RWTA 1ZBFA 5IM0A 1APSA 1IKYB 4TY8B 3Q22A 3M1VB 1FJGF 3EE9A 3BF4A 3KLGA 1YJWN 3DYAB 4AQYK 4DR1F 3GFHA 1X0PA 1J53A 4KGMA 2WZ1A 5M1OA 1VQ6N 1ZBTA 1TELA 3UNYA 3DXKA 4DPOA 3EXCX 4NRUA 1AA1B 2R7TA 3RMCA 3KKRA 1SUQA 4X62F 2Q1LA 3IO1A 1RYRA 4M3YA 3UDCA 4GKJJ 1JMTA 4DR6F 1LW0B 4V19S 2A2DA 1NGHA 3MN6A 2ZEJA 3ZCMA 4BRLA 3OVAA 3A2FA 4K4VA 2CFXA 3NKYA 4LC9B 3F0NA 2CG8A 1VQLS 4JD2A 3FQKA 5JVHL 2N7YA 4U8YA 3HI9A 4YN3B 1EQMA 4GO5X 4Z94A 4IWVA 1JQGA 1J27A 4X65K 1SB6A 3SSSA 3G4SN 3SPZA 2JL9A 5HVGA 3M32B 2ZC4A 4JBCA 2VZ9A 3OS0A 1PIEA 1SL1A 1YDLA 4MKBA 3D2EA 3SBTA 2B6AB 1ZPWX 2OTJS 2FLOA 3IWNC 3PJXA 2YWWA 4JKFA 3FBBA 1W0HA 4DUYK 4QYZK 2UU9K 3G8QA 2ROEA 1QJHA 3PW0A 5HLFA 3WC2A 2QEXN 4DCOB 4NA3A 1IKXB 5EX3A 4DI6A 4EI2A 4UY8O 2A6AA 1K9MT 5M2PA 1RU1A 4LF5K 4FYXB 3DHXA 4O23A 1LKZA 4RW7A 5J2MB 3BZQA 3TTDA 4C1NI 2H4YB 2HS0A 4IG3B 2VD3A 1FI4A 2DEJA 3M8SA 2FY1A 2IA0A 3KLIA 2O8FA 3ZO7A 4DCJB 4FCYA 5FPDA 3GV5B 1FVSA 5JICA 1SQEA 1GX6A 5HP1A 1URNA 3KLEA 4DV1F 4LF8K 4V19J 2X3DA 3AA8A 3IR6B 5EOYA 2E44A 1REVA 5KT2A 2OTLS 4ZLPA 4E7IA 1S7IA 2JOQA 2R8KA 4DTUA 2UV8A 1RWOB 3WQUA 2VC1A 3UN5A 7AT1B 3CCSS 3SJJA 3O8WA 2VIHA 3KK3A 4LFCJ 2FJWA 1FHTA 3L2VA 1CJKB 4K59A 2RQMA 2NYHA 4OLOA 2HQCA 1DAXA 2OEJA 5LSOA 2ZJQQ 3KK2B 4EMDA 4HH0A 4IO9Q 1WEYA 1AW0A 1BE4A 1RT3A 2KZZA 4LVOP 3CJ1A 3F44A 5A8KA 2BQ3A 4BC2A 3CC4S 4JV5K 2MKKA 4Z4IA 4FYDA 5FPNA 4TQRA 4EBCA 5EX0A 1EKEA 3TP2A 2LXUA 4X4SA 2EXUA 1EWRA 1N32J 4DWIA 4KHPK 3MHYA 1FRXA 2ASMA 2VFRA 4NLQA 5IC6B 4MQ3A 4QIVA 1R8CA 3DXSX 2EX3A 2UP1A 4X84A 1EARA 7FD1A 2CIMA 3HZEA 5AQOA 2EVZA 2BTFA 4BDZA 1C0GA 3VQQA 3K89A 1H1VA 2A10A 3F9KA 1T03B 1RE1B 3MTJA 4CM2A 3FK4A 3P8BB 3GFXA 4NYZA 4QWBA 4CLKA 3B8HA 4EGLA 2CNKB 4IYQA 1OH5A 2HAFA 2RQKA 1IJEB 1CJVB 2AF6A 2CJXB 5LMUK 3PO5A 2DNKA 4DV0K 3LWLA 2JEFA 2Q0UA 4EYIB 4IOBA 2HBRB 5CD4A 2N3LA 1LFPA 5DRKA 1S1XB 2Q43A 1Q81O 1KQKA 4KY3A 3DDIA 4B9QA 1QVGM 5HK4A 2CJBA 5BN9A 1RB0A 2ZDPA 2DO4A 3NAEA 1ZAWA 3P39A 4NLGA 2IM2A 2YNFB 3RMAA 3ULEA 3L2WA 4OX9J 2WC9A 1N36J 4TYBA 5A8RB 2QXFA 2AT1B 2O3DA 2E6MA 1HNXK 3PJ9A 2YNHB 2ACMA 2VB6A 5D4PA 3A5MC 4U7CA 2NUBA 2GIRA 4UF4A 2V2KA 3HKZD 4CF2A 2YQ3A 1HL6A 3BN4A 2W9CA 2JFKA 1A0OB 4USUA 1D9DA 5C25B 1HQUB 4MYTA 1UEKA 2VOOA 1OY9A 2XEXA 1XR7A 1NDLA 3OUYB 2MQQA 2DR7A 3NGYA 4DR2F 2BOPA 4DV4F 3U3GA 4KV8A 3MM6A 1TYQB 2BE9B 4FF1A 3TSUA 4HDHA 4BRFA 3KLVA 1G2EA 4JI4J 3TA1A 4YOUA 2X6SA 1W26A 2A1RA 2KH9A 3PO4A 2GQQA 2VWKA 2F4FA 3NEKA 3V6DA 4NI2A 4P2XA 1EB0A 2I6WA 2F9JA 3CDAA 4OLAA 1JCFA 1KQFB 3TSQA 3BYRA 3OS2A 3W3SA 5AQGA 3VMFB 2HK3A 2DNNA 1Z1ZA 1XUPO 2D3O1 1UTAA 3D7SB 1ZBIA 4UW2A 2KG1A 3NS7B 3VZHA 2HEKA 2YWEA 2KYZA 2H9ZA 4A8WA 3V6DB 1H74A 1RTJA 5JVGQ 4WK1A 2BR0A 1VCTA 1HNXJ 3O44A 3PRVA 5AQWA 4PPZA 4NLVA 3C7NA 5F0XA 3DOKA 1FRMA 3JAMY 1YZ6A 1FNXH 1WI8A 3CEDA 4PA1A 3TAPA 4BACA 3NVKA 1TGOA 2QA4S 3AVLA 4Y6IA 1RLDA 2BJ9A 2JNJA 3ATUA 1FD8A 2N4DA 3GJSB 1BUPA 4QWDA 4CZFA 2QLJB 4IOAQ 2OAUA 4ED4A 1LXNA 2LXFA 2VFTA 4CLUA 2AJ1A 4Y1DA 4BRNA 3AY9A 4A59A 4HCBA 3RAXA 2AZ3A 2F8HA 4Q8EA 4WFBQ 2FJAB 3QMQA 4H8KA 4ZVSB 4Q5VA 3LPTA 2BGGA 1VIXA 2VBXA 3MOZA 2XY7A 2OMOA 4Y65A 2E2PA 5GIOA 3MI7X 1Q82O 2GX8A 3PTWA 5ADZA 1DTTA 2J5AA 2AHOB 3NDKA 2MZRA 3KLGB 3UCUP 2RS2A 3A3NB 2DGTA 1RA7A 4ZVPB 3I5AA 2HK2A 4NA1A 4A8XA 1QAYA 1M1HA 2BEFA 2OP5A 3E01A 3CD5A 3VHQA 3TOQA 2YWKA 5E2QA 1NDPA 3SQ0A 4DFKA 3CE8A 3AVIA 5C25A 2XI3A 2Q1NA 1SH2A 3K5MA 4F0HA 3TPQA 2DFHA 4DL0C 2CADA 3BV8A 2DKOB 3DLLQ 2HRYA 1B99A 4BRKA 2V4QA 1KQSR 2G1HA 3NMUA 1FWKA 5J1NA 1P27B 3DMJB 2C2RA 4LFCK 2HF4A 1V5VA 1KVIA 4X64J 3QWPA 2XS5A 4HACB 4B8CA 5AQZA 2GVZB 4OPHA 2ZH1A 1WI6A 2OZSA 1BMQB 2K3IA 3VQ6A 4WQ4A 3VF2A 4LRDA 1YITS 3OBWA 1U47A 2MQ8A 4JKGB 4DU8A 2ZDOA 3HHKA 3HSTB 4RNHA 2ACYA 3C94A 2R2SA 2HW3A 3O3LA 1R0CB 3N79A 2YKMB 4K42A 2OD6A 3AD9C 3MDFA 1O0PA 5DZ6A 3HHNB 3KJFB 4DZ6A 5D6GA 5KFQA 2EEYA 2E1PA 1DY3A 2MEWA 2ZFHA 4R5PB 3A1YG 2IM3A 2V8DA 1I6JA 1RT2B 2I7NA 3QIPA 3U9DA 4ECZA 4A48A 1LV5A 4U67Q 4PEOA 3CCUN 1CJKA 1R0BG 4DQPA 4IOCL 3FZLA 1S12A 2KQ2A 2A41A 3ZX2A 1IQTA 2I8EA 2W24A 4JI0J 3M30B 1TK0A 2HFSA 2DBBA 4FJJA 2YNGA 5FLXO 4JP8A 4M3UA 2J4RA 3NGTA 5DDPC 3H0PA 1RHJB 2KHOA 4E7HA 2XGPA 1VQ4S 3PZPA 3GSIA 3VAMA 2B9WA 1K47A 4L3KA 4KAZA 4M5NA 3GE1A 3M30A 2QFIA 1FDNA 5KG3A 2VQFJ 4D3HA 2P9NB 1JLCB 2AV5A 3QJLA 2OSRA 3V5RA 4N76A 3GCWP 3HSGA 3UVJA 4AE5A 2Y1IA 1RT7A 3AXKA 1BISA 3ZZ0A 1X1PA 4OGEA 2E5GA 5IT9U 3H20A 2E2OA 2UZAA 1KBRA 4B3RK 4BRHA 3TZWA 3MMAB 2WBMA 3FKBA 3EE3A 2KL8A 3FJ2A 2Z0GA 2G0CA 2I2YA 3CD6N 4CYUB 1FDAA 4I6AA 4LRBA 2QZ8A 3MD1A 3TAEA 3D2EB 4FBUA 4FXWA 4UY85 1MU2A 2DR6A 4WFAQ 4AT1B 1XTZA 4ICLA 3CXCR 3EX7B 1JKHB 2UUCF 4BRMA 4OZ0A 1IVZA 4IH6A 2HBJA 3OYHA 4XEIA 3MTKA 1F0XA 2HNZB 4ZPVR 4WCEQ 3PXGa 1Z05A 2NUUG 3DGVA 5E0OA 3T6BA 3Q8PB 1FD2A 3CXCM 1JCGA 5HOOA 3RJMB 3PW4A 1Z2LA 3KG0A 4CFAA 3BQ0A 1UVJA 3C16A 2BJ7A 2PA8D 4PQUB 5DQIA 4C11B 3KHGA 2VBYA 5CZXA 1S1XA 2ILYA 4W92B 1Q86T 2E7WA 3RZAA 5CYJA 2JDJA 5M1QA 1MROB 2JZ5A 2R8JA 3QIPB 2X51A 3WT0A 3QEVA 2C1EB 2DT9A 4B08A 5GAEU 2AJ0A 5BPLA 3W63A 3GDQA 1QVFM 5AFUH 2DNYA 1MU2B 2HQDA 4E7KA 3L95X 1CQMA 5BPMA 1XIQA 4E0DA 1OYEA 3A0IX 4B9LA 2CDQA 4KI6A 1FERA 5HATA 3KNAA 5JLHA 4LF9K 3T19A 2QMXA 3AA2A 1RBSA 1SIZA 4U7UK 3PYDA 3NGRA 1KEKA 4F7VA 5A76A 3QLHA 5SZTA 2P9PA 2MHEA 3Q2TC 3CCUS 3LGNA 4LF1A 2XTJP 3SFUA 2VG7A 5CYQB 1Q7LB 3HYFA 2CXEA 1YAGA 2FGOA 2XBPA 3MAAA 3HPGA 2P6TA 2OGUA 5BRHA 3J7YP 3FZBA 2I7PA 3IKMA 1NNDA 3SJHA 4B1XB 1NGAA 4LF6F 4A8YA 3CCSN 3DNCA 4C2MA 4LR8A 1S6UA 2DTJA 1TL7A 2WOMB 1IBKF 3VQCA 4WCEL 5CYMA 2J0XA 4FJKA 1NPRA 3A5OC 5HAOA 4CCHA 3MCNA 4BC7A 2AWZA 2XS7A 4OZJA 1DHMA 2GAGC 1HMVB 2B43A 5CZ1A 3EJMA 1JNRB 2B6AA 2VQFF 2PIIA 3CCWA 3HM9A 3HT0A 5H9EK 5EWFA 3L4IA 1RT1A 4DSKA 4FO0A 5K14A 2DGWA 4E8UA 4HHJA 1ILYA 2CJ9A 1LEOA 5DLFA 1R31A 1N6QA 5LXRA 2R2TA 2J0QD 2WW4A 2OJ3A 1LWCB 1S22A 2JWLA 4ILJA 2DGXA 5AJ3F 3ULHA 4LMZA 4ZP6A 2VG6B 4F04B 1XC3A 2LECA 3V1RA 2ZBQA 2A6OA 5JXSA 1UEVA 2WHOA 4WKYA 3CFOA 3ZTRA 1S6QA 3H2LA 3TVYA 2VPZB 1NGDA 4EZ9A 1QAXA 4X4VA 1FRKA 4FJNA 1I39A 4DX5A 4WE1B 1RCHA 3QEIA 4C97A 1VLYA 4KB1A 5L38A 3KDOA 2O8DA 2B7BB 3T1AA 1RAHB 2IYIA 2G8WA 2K2PA 1TV6A 1VBKA 3MECA 2HZVA 1QM9A 2ZH8A 4X62K 1ZA1B 4DL6A 1RTZA 4HTUA 3N01A 3GG1A 2Z1IA 2E1AA 1Q7YT 2ROGA 3TANA 3KKSA 4QW8A 4PKGA 4OFZA 4DR1K 4X64F 2M5YA 3ZSYA 2NREA 3AVBA 4OI0A 1VSHA 1YJNN 4JD2B 5AXLA 2D5RA 2JC0A 1Z26A 3QYYA 3HVRA 3O5TB 4HLBA 5BR9A 2WVBA 3K5LA 1A5XA 4Q0BA 4DR4J 4YR0A 5BYQA 3O08A 3OYIA 4J2DA 1QQNA 4ECSA 3IBCB 2ZHAA 3CGIA 3ICLA 2F4VJ 1VBZA 2C2EA 1NK8A 3P5TL 3P38A 4USIA 3CJKA 1X4EA 2UUAK 3J7ZO 2DO0A 2ZF5O 3POTB 1YJUA 2UUBJ 4NZ7A 4NLBA 3PR5B 1U1NA 4FPAA 3I9V9 2NR0A 3EICA 1Y9OA 2CPXA 5C5JA 3MXIA 1W2BR 4NRTA 2HNZA 4RNOA 4DXLA 4F8RA 2WBRA 2MYFA 4DL2A 4ZVOB 1V4TA 3LALA 1M5PC 2RRBA 3OR2A 3P5BP 1N5YB 3PFOA 4DSLA 4M8LA 3PHTA 1T9YA 1WHYA 3V2UC 2MLXA 2J8AA 3M2VB 1U1LA 3H98A 1T3VA 2PAVA 4TQSA 1CZAN 4YB7A 2BACA 4C6AA 4R8UA 4FZYA 2FLNA 2D0OA 1UOCA 3K5NA 1XNRF 2W9CB 1EETA 1I94F 2FLLA 4P75A 1SL0A 3MR3A 3RB6A 4JI6J 3D6FB 4A4JA 5BYSA 1IWGA 5CCLA 4DR2K 1QTNB 2I1RA 2HKEA 4MFBB 3OD2A 1YWXA 2OLWA 1RISA 1NJZA 4KGZB 3DLGA 2OIHA 2HBQB 1BQMB 1KVCA 2CJQA 1M5SA 2VASA 4ED8A 3DI6B 4JAXA 4EEYA 2DR5A 4OI6A 4DDFA 3Q7CA 1YXQA 3TAGA 3ZFVA 4CECA 1J5EJ 4Y0FA 1OQ3A 2CYYA 2NYIA 3AFGA 1RKIA 2PMZD 3C6UB 3VEZA 3C19A 4RBTA 2K7JA 1HHQA 2G8HA 2KLAA 4PXDA 4Q45A 3UKUA 1KC8T 3AJ1A 2QWQA 3SUNA 3UVJB 2ASLA 1RGVA 3KHYA 3BY5A 2FQQB 4FP9A 3M6XA 2P8IA 3PR4A 1KLMA 2IVYA 4K41A 1RTHA 1SJ4P 1S0VA 4JI8F 1H72C 1CULA 3VGSA 3OXFA 1Z25A 3AVHA 3NFAA 2AKWB 3S3NA 2NXEA 4DV2J 1SI9A 4DFPA 1RAEB 1IV0A 4P9SA 2CWKA 2ZH9A 2R7WA 3NS5A 4FWNA 3LM2A 2OA8A 4A5AA 1NOYA 2ZH5A 2P9SA 2BQUA 4O3PA 3KLHB 3L09A 3TRGA 1NPKA 2RHKA 1H6KX 4DZDA 3IC1A 4Y2CA 4USMA 4DL4A