3LAMA

Crystal structure of hiv-1 reverse transcriptase in complex with n1-propyl pyrimidinedione non-nucleoside inhibitor
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV Reverse transcriptase
publication title N1-Alkyl pyrimidinediones as non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 149
structure length 553
sequence length 553
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lamA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lamA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lamA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lamA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lamA05
5DGAA 1IKWA 3LAMA 1S48A 4WZQA 2XY8A 4J9LA 5KT7A 1NK4A 2WB4A 4KRFA 1ITGA 1N56A 2W8LA 4FW2A 1KSPA 1D1UA 4RZRA 4I9QA 1RT2A 1L3UA 3ISNC 4NRTA 4C8LA 1DTQB 1XHZA 5KG6A 4XPEA 1TV6A 1N6QA 3AVIA 4F4ZA 4JV1A 3HKWA 5KFSA 3PY8A 4Y1DA 2OZSA 5EWEA 1JLGB 4KAZA 3GIKA 4O44B 2E6MA 1KLNA 2HHTA 4J9PA 4Z4IA 3G6YA 2R8IA 1C1CB 4NLYA 4NRUA 3SZ2A 1DLOA 5JXSA 5DMRA 3CFPA 3L2UA 4KTZA 1JLFA 3HXMA 1REVA 4PWDA 1U4BA 4URQU 2ZE2B 3IRXB 1SH0A 4FBTA 1JLQB 3SQ4A 3MAQA 4TY9A 4YP3A 5KFTA 2YNFB 1JL2A 1J9AA 2HHVA 2X6NA 2XCPA 4CEFA 1IKWB 4ZP8A 1S1UB 4TY8B 5KFWA 1D9DA 4J2DA 1JLEA 1C0UA 4JRPA 2JC0A 5L9XA 2FVQA 1CLQA 3DOKA 3KK2A 2AX1A 2I1RA 1N6QB 1TV6B 3HVRA 3GV5B 4M95A 2G8FA 3SFUA 1WSEA 2IM1A 5FRNA 4C8KA 4CGIA 3EZ5A 4ZTJA 2FVSA 4K4UA 1MU2B 1DLOB 2B4JA 4O3PA 3BSOA 3AVAA 5DQIA 3RB6A 3AVLA 2KFNA 1JLFB 4RNFA 1LW0A 2YNIA 4PWDB 1NJZA 4DSEA 4M3UA 3H4BA 4DQSA 4DFJA 4DWIA 3GQCA 2G8HA 4KV8A 3MR6A 5JUMA 4F4YA 5CZ2A 3ZSYA 4B9UA 4MK8A 2OPPA 3O3HA 3M9MB 4JLHA 4CCHA 1Q9YA 1SKWA 4CK2A 3MECA 3QEIA 3SUNA 4DTRA 3MEGA 3IAYA 2BQUA 3UR0A 3KHHA 4DL5A 3BR9A 4B9TA 2UVRA 2IS3A 3JYTA 3G10A 1JXEA 3DOKB 4IG3A 3KK2B 3TAPA 3NE6A 5KFRA 1ZBIA 3QIPA 4CGDA 4EBCA 3LWMA 1VK0A 3DLRA 1NK5A 5EDWA 4W5QA 3DOLA 3LP2A 4FJ7A 5EWFA 4ED3A 3PZPA 3BSCA 3RR8A 3OVNA 1TK5A 2YKNA 2BE2A 3WNFA 2P1JA 2YNIB 2Z1HA 1LW2A 2V9WA 3QO9A 3MXJA 4KV8B 5K14A 5I42A 4FLVA 4FJJA 3P83D 1RT6A 1EXQA 2HW3A 2OPPB 4FJNA 4Z4EA 4EYIB 3TAMA 1HARA 2OPQA 3FFIB 4MIAA 4WXOA 3PR4A 2G8KA 1KFSA 4MIBA 2YHBA 1LWEB 2YNHA 1SH3A 5KFBA 4ECWA 3MEGB 5KFNA 4W5RA 4FYDA 2OZMA 3JYTB 3ZSWA 3VQ9A 3TAQA 3OYAA 2B6AA 4IG3B 2JGUA 4FCYA 3TAFA 2HAIA 3QIPB 1C0TB 4CHOA 1IG9A 4M3ZA 4TN2A 3C6TA 3TVKA 3FRZA 3PW4A 3LWLA 2W7OA 3E51A 2ALZA 5CYMA 3WNHA 3TWHA 4E1NA 2OYQA 3AVMA 2BE2B 3E01A 1RTDA 5C25A 1I6JA 2W9BA 3NAIA 3QO9B 3DI6A 1HNVA 2FVPA 1QS4A 4DU3A 5K14B 1RTJA 1TL3A 3T5KA 3TANA 4LSLA 1QTMA 1JKHB 4DL7A 4CJ5A 3L2QA 5KT5A 4RNMA 3SUPA 4LSNA 5KRTA 3N6NA 4J2BA 3KHRA 1RT6B 2HMIA 5HRPA 2ZQBA 4H4MA 4N56A 1HJRA 4HYKA 1IO2A 3DLEA 4IR1A 1S97A 5JS2A 2OPQB 2E9TA 4CEZA 3VQBA 4LH5A 2YNHB 2X6SA 2OPSB 3OYFA 4DTUA 3JSMA 1NHUA 4F4XA 2FC0A 4OKJA 4PQUA 1NKBA 4JS4A 2B6AB 4ZVFA 4DF4A 4DL2A 1X1PA 1VSIA 4CJRA 4E1MA 3C6TB 2C2RA 2QK9A 2XWYA 3LAKA 1UA0A 2IJFA 5CYMB 3RB0A 1TKZB 5DG7A 4AILC 4OPJA 4EBEA 1UOCA 3E01B 1RTDB 5C25B 2V4QA 3M8SA 4YFUA 3GIMA 1TAQA 1BI4A 3TQ1A 4E7JA 2BANA 3D45A 3DI6B 4N76A 4MK9A 1HNVB 2XI3A 1VSLA 4O3OA 1RTJB 1TL3B 2IJNA 3VA3A 5J1EA 1RBRA 1NJYA 4LSLB 2W7PA 3LP3A 4DSLA 1CXQA 3BQ2A 4LSNB 3KLGA 1JXLA 4HUFA 1S1TA 2HMIB 2Y1JA 4H4MB 4HTUA 1BCOA 3NF9A 3PJXA 2FJXA 3LP0A 1J53A 4TXSA 3DLEB 5HRRA 1VSDA 3OYGA 1C1BB 3ISND 3RMCA 1TAUA 4ED7A 5KI6A 4I2PA 1RT5A 3RTVA 3HVAA 5FDLA 4UQGA 2Q3SA 4PQUB 4R8UA 3MXMA 1K1QA 4R0EA 3OY9A 3AVCA 2FLLA 3KLHA 5J2QA 4TSXA 3M9OB 4CEOA 1RDDA 1U49A 2WOMA 5KFMA 3UDLA 2XGQA 3A2FA 4E3SA 3ZT1A 4K4VA 3H2LA 2VA2A 3S3MA 4C8MA 3OHBA 3LP1A 5HP1A 1TKDA 1BI4B 2JEFA 1KFDA 2BANB 1JLAA 4Y2AA 1WAFA 4NCBA 5EU7A 5J1EB 5F8IA 1YTUA 2QV6A 5L1KA 3U3YA 2ZD1A 1TK0A 3RBEA 4DTNA 4BE2A 2BDPA 1QAIA 2AJQA 2R2SA 3FQLA 3KLGB 4ECUA 1RDRA 3L3VA 1S1TB 5KFAA 4FJMA 4M3YA 4Z4CA 5KFPA 3P1GA 5L1IA 3HP6A 4IH6A 2FBTA 1TK8A 3H59A 2GIQA 2D0CA 3T5HA 4IQXA 4I2PB 1U45A 4ZVGA 1KRPA 3SI8A 2YNGA 4CHPA 2AX0A 4X2BA 1UWBA 3VQ6A 3HM9A 4MQ3A 4EBDA 3GV7B 5F9LA 4NCAA 3QETA 5J2PA 5DQGA 3L2WA 2QKBA 5J2QB 4M42A 4EP4A 3LDSA 4J9NA 4FJ8A 2WOMB 3HO1A 3HHKA 3OYCA 2RDJA 1K6YA 2I5JA 2G8IA 3M9NB 4M3XA 3GIJA 5KG5A 5KT3A 3K57A 1SL0A 2ETJA 3LP1B 5HP1B 4CGJA 2RPIA 1T3NA 3T19A 1Q9XA 5KG3A 1OS5A 3IGNA 3THVA 1NKEA 2ZD1B 4MH8A 2R8GA 4IH5A 1XHXA 4QPXA 2X78A 4BACA 3T3FA 1BQNA 1J5OA 1RILA 3SQ1A 4WZMA 2RN2A 4ID5A 2CJQA 1Q8IA 3QIDA 5KFCA 2DTUA 4O4RA 1RTIB 2YV0X 4GVMA 1BQMA 2YNGB 3NF7A 4Q0BA 2P51A 4FM0A 3NKYA 4IRDA 2Y1IA 3B6PA 1KLMA 1UWBB 3K2PA 5J2PB 3KLVA 2KW4A 3HPGA 3KD5E 2HHWA 2HNYA 4Q45A 3S9HA 3RMDA 2RF2A 4M45A 3RB4A 3MR3A 2HNZA 2QXFA 2AGOA 2DFFA 4TQSA 1KHWA 4EEYA 4CJLA 4O4GB 4J2EA 2HHXA 3V1OA 1TVRB 4TLRA 5F8NA 3QZ8A 3EYZA 3I5AA 2HHUA 2ILYA 4Y3CA 3SFGA 4FM1A 2QE5A 1RAJA 4GC7A 4E19A 4CGGA 3O4NA 3TARA 3PR5B 2JEIA 4CF8A 2UUWA 3PVXA 4WXWA 1BQNB 1J5OB 2W9CB 3ZSOA 1WSJA 5CYQA 5KG2A 3OYJA 4DTPA 4IFVA 3IS9A 3C94A 2RKIB 4N5SA 4FXDA 2DY4A 4ID1A 4DEZA 3VQSA 1BQMB 3DLBA 1K1SA 2VG7A 1NK7A 4K8XA 4Q0BB 4CHYA 3MFIA 4DTXA 2W9AA 1KLMB 1S6PA 3RB3A 4IG0A 4E7KA 4DTJA 3IG1A 1QSSA 1NK9A 3BJYA 3V6KA 2GV9A 3V9XA 2HNYB 2YKMB 4IR9A 1S4FA 5F8MA 3VQDA 2RF2B 4U7CA 3D0PA 3KMSA 3NH1A 1CZBA 1JXBA 2F8EX 2HNZB 4CJFA 4KKOA 4FJGA 3H5SA 3OYEA 4QCLA 1G15A 4H8KA 4CF2A 1HYSA 5KT6A 3DLGA 1L3SA 3ZSRA 3CDEA 1RT7A 1VSFA 3O4QA 5DGBA 3NBPB 3VN5A 3OL7A 1FKPA 4CFCA 5HLFA 2UVWA 4DG1A 4Z0UA 3NGZA 4NLWA 4ZVHA 5CYQB 1TGOA 4CK1A 4IFVB 3IS9B 3RMAA 3IN5A 3TI0A 4TYAA 4RW9A 2KZZA 2EHGA 5E41A 3DMJA 1EP4A 2VG7B 3V6DA 5KFFA 2CKWA 4F2RA 4F3OA 4IG0B 3UIQA 1CZ9A 3IG1B 3QGIA 4CJTA 4EZ9A 1RT2B 1F21A 4CJSA 3OS0A 4IKAA 3HPHA 4CIEA 4JUZA 4KKOB 1QUVA 3QEWA 1RDBA 3NGYA 4AHCA 1HYSB 5DK5A 3DLGB 2OH2A 4ECYA 3V9ZA 1C0MA 3CJ5A 5KFZA 1RT7B 1LAWA 5KFLA 1REVB 1NNDA 1C2PA 3BQ0A 1RNHA 4NLQA 3QZ7A 1S1WA 1FKPB 1SL1A 5HLFB 1WSFA 3VA0A 1L3TA 4B08A 4RW4A 3L2RA 2WRMA 2Z1GA 3PW0A 3KKSA 1VRUA 4NYFA 1ASWA 2OA8A 4HCCA 1Z26A 4CFDA 4RW9B 4KTWA 4CJUA 1JLCA 4QWCA 3OYBA 3M8RA 1EP4B 4DF8A 4RW8A 4IBNA 3OS1A 3NGDA 4F4KA 4F2SA 1JLEB 5EWGA 1R0AA 2KQ2A 4B9NA 1C0UB 4FBUA 4FJLA 3Q8RB 2UVUA 4O0IA 3VQEA 5SZTA 1C6VA 5C42A 2B43A 4DFKA 4FZZA 3NAHA 4KBIA 3KHLA 1ZBLA 3G6XA 3CFOA 3K5MA 2LSNA 2D7SA 5KGXA 2XC9A 4GC6A 2BRLA 3T5JA 3OYDA 1ZTWA 4CFAA 3T1AA 4EP5A 1FK9A 1LW0B 1BIUA 3EZUA 1S1WB 3QESA 2D41A 3AV9A 1GOCA 1QSYA 3DYAA 4CEDA 1NKCA 4O3QA 4RW4B 4KTQA 3OL8A 2BQ3A 3HVTA 5KGWA 1VRUB 1S9EA 1WNSA 3PW7A 1EX4A 2HVHA 3S3OA 4MFBA 3MEDA 4CGHA 1JLCB 3KKRA 1RYSA 4O3NA 3MECB 4ED2A 4OKKA 3SV4A 4CECA 4JS5A 2KFZA 1RA7A 1HNIA 2V0NA 3HSTB 1MMLA 2XY7A 1FKOA 1RT3A 5C42B 4BDZA 1W9HA 3CJ3A 3H4DA 3CM5A 2GUIA 3F9KA 3M8PA 2D3ZA 3SUOA 5F8HA 3DOLB 4CERA 3LP2B 1KHVA 1Y97A 1RYRA 4WFZA 4OPKA 4ZP9A 2YKNB 4AHTA 1FK9B 3BQ1A 3RBDA 1TP7A 3OHAA 4OJRA 1UA1A 1LW2B 4CJPA 3MEEA 2IM0A 4CJ3A 4N47A 2HHSA 1HRHA 4CK3A 1HMVA 3KOAA 3LPTA 3OYKA 3MTKA 3DYAB 5I42B 4WYLA 4TYBA 1S0NA 2FBVA 3HVTB 4Z4GA 3QIOA 4CHNA 1LWFA 4JV0A 4RW7A 1ZETA 1LAVA 3TAMB 5DG8A 2F8TA 3DDKA 3PX0A 3L8BA 5KT4A 3CG7A 2WONA 2VA3A 3NH0A 2AU0A 5DG9A 2R8JA 2WHOA 1JL1A 3BGRA 2OPRA 1BISA 5HRSA 2FBYA 4ICLA 1SKSA 3LZIA 1HNIB 1I3AA 2GBZA 4CJQA 4ZP7A 1XWLA 1FKOB 1KTQA 4DMNA 3ZT2A 1EKEA 2W8KA 3ZSVA 1ZBUA 3M8PB 3GIIA 3VQ4A 2AQ4A 4FZYA 3V81A 1HQEA 2DPIA 3SQ2A 3P5JA 2HHQA 3NL0A 5KFGA 4DSKA 3I0SA 3QLHA 4KAIA 4OL8A 2C2DA 3K59A 1ZTTA 2W9BB 3K5LA 5HRNA 1J54A 2PYJA 3MEEB 3CYMA 4NYZA 5T14A 2IOCA 1WSHA 4K4XA 4LY7A 2C28A 3KK1A 4NLOA 1C1AA 1CXUA 4FVMA 1QHTA 3EY1A 3V1RA 5JS1A 4CF1A 1LWFB 2J6SA 3SNNA 3OYMA 3HVWA 2XY6A 4Q8FA 3OYLA 4DS5A 4URGA 1IH7A 3PUFA 2HB5A 4FJHA 4I7FA 1S0MA 1QE1A 1RCHA 1RBTA 2WONB 1GOAA 3JSMB 3RRGA 3O3GA 3V9WA 3HT3A 1SKRA 3BGRB 3QEPA 4DTMA 2R8KA 4ICLB 4DFPA 4HKQA 4CIFA 4DQPA 3V1QA 2WTFA 2R8HA 5F8JA 1RA6A 2D3UA 4W5NA 3H08A 1JIHA 4GMJB 4DTOA 2ASJA 1T03A 4HHTA 3CO9A 3V6HA 4ELVA 3V81B 1HQEB 3BSAA 4EYHB 4FLWA 3H5YA 5KFUA 4NZ0A 3QLHB 1GX5A 3PJWA 2FVRA 5KFKA 2O4IA 4YNQA 3SPZA 5EUHA 4DL3A 3NF8A 4K4SA 4FM2A 3KMQA 4NCGA 3H98A 4J2AA 5KFHA 3VQ5A 1X9WA 5CY4A 1N5YA 3D28A 1RDAA 3SCXA 5D3GA 3HK2A 3KLEA 5KFQA 5KT2A 4K4WA 3AO4A 3DLHA 4W5TA 3LP0B 1IKVA 4KI4A 4ZVEA 4RNOA 4AHSA 4E89A 1YVFA 4I7FB 1RT5B 3KD1E 2BR0A 3ZT4A 5FDLB 4DQRA 4FLXA 3KNAA 2XI2A 1RT4A 3H5UA 4R8UB 2C2EA 4YR0A 4J9RA 2J6UA 3ZT3A 3L3UA 3LPUA 3KLHB 2XGPA 1W25A 2IBKA 2ATQA 1ASVA 1T03B 4URSA 2NUBA 1VSJA 5DQHA 3WNGA 1DTTA 1VRTA 3ZSXA 4F3TA 4J9QA 4J9SA 3D5MA 3DRRA 1JLAB 2XO7A 3VQPA 4FJXA 4DL6A 1N5YB 1ASUA 1X9MA 3CQ8A 5D3GB 5J2MA 4Y2CA 1YVUA 3KLEB 3BDPA 2Z1IA 3ZCMA 1QAJA 3OL6A 1IKVB 2B5JA 3NGIA 4AH9A 4QWDA 3EPGA 1D5AA 3I5CA 1NJWA 4Y34A 1KVCA 3OLBA 2AGQA 3PW2A 4CF0A 4FZXC 4RG8A 2RDIA 3OJUA 3AVGA 3CM6A 4CEQA 5KG1A 4BE1A 4ELUA 2DPJA 4M3RA 1YTAA 1IKYA 3NAEA 1B9FA 3FQKA 3CJ2A 3QNNA 1XR6A 5F8GA 1VRTB 2DFHA 1RDCA 2I5JB 3N6MA 1I39A 3VQ8A 4CEBA 2GIRA 1KVAA 1U47A 4AHRA 3DRRB 1CSJA 3OYNA 3KTQA 2WK4A 4ZMMA 4WE1A 4OKEA 1ZBFA 4HUEA 4R5PA 2UVVA 3AVFA 4BWMA 4O44A 5DLGA 5J2MB 5KFOA 1LWCA 2O5DA 4ID5B 2A1SA 3OJSA 3F73A 2B5JB 1GOBA 1WAJA 2JEJA 3ZSZA 1S49A 4OGCA 4NLGA 4KFBA 4FW1A 3VQQA 1TL1A 3KK3A 4CIGA 3MR5A 3Q8PB 3L2VA 4RUAA 1HPZA 1KCFA 2FJVA 2E4LA 3Q8SB 1SL2A 4AHVA 2F96A 3U3GA 1IKXA 2IC3A 1RBVA 3K58A 5I3UA 1S1UA 5KFDA 4TY8A 4QOZB 4L8RB 4H54A 4YMEA 3NF6A 4IDKA 3MF5A 3AO1A 3ITHA 4K4YA 2IGIA 5HBMA 1NK8A 4K4TA 4WE1B 3C95A 1RTHA 4DSFA 4R5PB 4HUGA 4XO0A 4IRKA 3RAXA 5J2NA 4FK4A 4PY5A 5KG4A 1LWCB 2BGGA 1MU2A 1UAXA 2WCXA 3N6LA 3M8QA 5DLFA 2IA6A 3HPOA 3PO5A 4E7LA 4G1QA 4OLAA 3BSNA 4HCBA 4G3IA 3PHEA 4ZHRA 4KFBB 3NFAA 4RUCA 4FJKA 2QKKA 4Q44A 4ECVA 3I0RA 4KE5A 2ILZA 1S6PB 4KB0A 1TL1B 3KK3B 4QWBA 3PX6A 4O3SA 1Z25A 1XC9A 4ECRA 1HPZB 4ED8A 1IKXB 2IC3B 3K5NA 5I3UB 4ECQA 4KHUA 4IRCA 4FJIA 4TQRA 1TKTA 4FLTA 4O0JA 3NH2A 2E9RX 4I2QA 3NHGA 1S0OA 1QQCA 3V9SA 4IDKB 3NCIA 3ITHB 3CIZA 5HBMB 4M3TA 4IFYA 1RTHB 3AO5A 1VSEA 3IGVA 4NLUA 5FROA 5J2NB 1WN7A 4DG1B 4ZP6A 4DQIA 2P5OA 2ATLA 4O5BA 3RR7A 4IOBA 2ASLA 4M3WA 3M8QB 3TR8A 4M94A 3LANA 3HL8A 4G1QB 3AVBA 4KHNA 3WNEA 4NYNA 4FJ9A 4ZHRB 4DLGA 3SV3A 3DMJB 2W42A 4F8RA 3V6DB 3I0RB 3LZJA 1QSLA 3QEXA 3GV8B 2IAJA 4BE0A 3H5XA 3HJFA 3LALA 4CJVA 1T7PA 3AVHA 4B8AB 4KHRA 2GC8A 2F8SA 1BCMA 1TKTB 3FFIA 1U09A 1T8EA 1YT3A 1RT1A 4I2QB 4YR3A 2IM2A 3RRHA 1LWEA 4U6PA 1NOYA 4FS2A 4Z4FA 2XHBA 4LH4A 4B9SA 4CJ4A 4YQWA 4IFYB 4W5OA 4ECZA 1C0TA 2FBXA 1BL3A 2Z1JA 4LQ3A 2VG6A 2BRKA 4H4OA 1GX6A 1S5JA 4NLSA 1JX4A 3O3FA 1NOZA 4XPCA 4CE9A 4MKAA 5KFIA 5KFEA 4LQ9A 4NLDA 2XCAA 3CJ0A 1XR7A 1VSHA 3DM2A 4F4WA 4RW8B 1O1WA 4E7HA 4CEEA 4EZ6A 5KG0A 2FLNA 4KHQA 4E0DA 3PV8A 1JKHA 2ITGA 4CFBA 2IAJB 1R0AB 3OS2A 4KI6A 4K4ZA 2R2UA 4ELTA 2HNDA 4CEAA 4RW6A 4DU4A 4CJWA 4I9LA 3QINA 3SQ0A 4DS4A 1RBSA 2HWIA 3C6UA 3TAGA 1FXXA 4QWAA 1RT1B 1S9GA 1HQUA 2VWJA 4QWEA 2OPSA 4FK2A 4KREA 2G8WA 1NK6A 3I5BA 3CFRA 1WSIA 5KFXA 1D0EA 4KO0A 3AA3A 3V6JA 4CGFA 2VG6B 3BREA 4H4OB 3PX4A 5KRSA 3QGHA 1T05A 1TKZA 4B9LA 1U04A 1S9EB 1SUQA 4CJEA 4KHYA 1BIZA 1NK0A 4FK0A 4OLBA 2JLEA 4MFBB 4QW8A 3MEDB 5KFYA 2IM3A 1S9FA 3DM2B 2ZKUA 4J9MA 4ECTA 4BDPA 5KG7A 3OL9A 1S6QA 4Q5VA 3TABA 2D0BA 4B8CA 3V9UA 2DFEA 1WSGA 3QYYA 2HNDB 4RW6B 4FJ5A 3ASMA 4WFYA 1RT3B 3NDKA 2KZMA 2J6TA 3MFHA 3C6UB 1C1BA 4KSEB 4ECSA 1S9GB 1HQUB 3B6OA 3SI6A 4NLPA 3PO4A 2G8VA 4F50A 2VG5A 4HVJA 4C8NA 4KB1A 2IDOA 1D8YA 4FS1A 2PYLA 4KO0B 1HYZA 3OSPA 3G86A 2XY5A 4JV2A 2KTQA 1HMVB 3VQAA 5SWMA 4DSJA 5HROA 3T5LA 1T05B 1XI1A 1SUQB 4RNNA 5L1JA 1A5XA 4ZPCA 4BDYA 4RW7B 1WLJA 1N48A 3ULDA 4DTSA 3FDSA 4ZPAA 4Q43A 3G6VA 4MK7A 1EETA 1S6QB 4NLVA 4K8ZA 3UPFA 2OPRB 3HP9A 3CJ4A 1U48A 3RWUA 2C22A 1TKXA 2P5GA 1A5VA 3AA4A 4O55A 1BGXT 2VWKA 3OLAA 2BQRA 3TAEA 1VSKA 1IM4A 2VG5B 3I0SB 3AVKA 1S10A 4ZTFA 3SUQA 1L3VA 4KPYA 4C8OA 4DSIA 4NLXA 2AGPA 2EC0A 4ZPBA 4LD0A 2XRIA 2V4RA 1N4LA 4Z4HA 2E6LA 4RNHA 3V4IA 5C24A 4B9MA 4ED6A 2ASDA 4QW9A 5HROB 3KK1B 1VSMA 3QERA 3S3NA 3DRPA 3QEVA 5KFVA 4QAGA 2JEGA 1S1XA 2D5RA 1BHLA 1S1VA 4DL4A 4CHQA 2E9ZA 4KB7A 4BWJA 1EETB 1JLBA 4JRQA 1QE1B 3SPYA 3CDUA 3OSNA 3G0ZA 4PA1A 2PY5A 4IH7A 4M41A 2R7YA 3AVJA 3CVKA 4CESA 1TKXB 3KLIA 2R2TA 2YHAA 4ED0A 4CF9A 2IMWP 2EX3A 3KLFA 1LV5A 5F8LA 3Q8QB 1RTIA 3KJVA 4FLZA 4Q8EA 3GYNA 5KFJA 1KVBA 3HYFA 3FSIA 5F9NA 5FRMA 3KHGA 3RMBA 2FVCA 4YR2A 3VQCA 3CWJA 3AA5X 4Y1CA 3VQ7A 3ZT0A 2FJWA 3V4IB 5C24B 4NCGB 3ALYA 2FLPA 1ZBHA 1SV5A 4PUOA 3DRSA 4FLYA 1XR5A 3EPIA 2UUTA 3SYZA 4ZPDA 4OVLA 3DRPB 4O4GA 4B3OA 1B92A 4CJKA 1L5UA 3PW5A 1TVRA 4NLRA 3OYIA 1S1XB 4ED1A 1S1VB 3DLKA 1ZYQA 4DQQA 1Z4UA 1RBUA 1TQLA 4AHUA 1JLBB 5CZ1A 4RU9A 4B9VA 3QGGA 1RT4B 1X9SA 2W9CA 4WYWA 1A5WA 2JC1A 3KLIB 4OGEA 4WFXA 4KHSA 2D0AA 2AWZA 2RKIA 3RAQA 4DLEA 1SH2A 5T7BA 3KLFB 3U6FA 1W0HA 3AVNA 4J9OA 3KJVB 4XIUA 3H40A 1DTTB 3AO3A 4CHZA 3QNOA 3MXIA 4MKBA 2R2RA 1D9FA 4DU1A 4NLTA 4IKFA 2HVIA 1WNEA 4EO6A 1DTQA 2YKMA 4K50A 1SV5B 4PUOB 5KTQA 3DRSB 3AO2A 4FLUA 1JLGA 2O4GA 3KIOA 4B3OB 3MR2A 3UQSA 3OYHA 4ECXA 1NJXA 3GILA 1C1CA 4O3RA 4J9KA 4GW6A 4KHMA 3ZSQA 2A1RA 3SJJA 3NMAA 4DFMA 3DLKB 1NHVA 4N41A 3I8DA 3NBPA 2ZE2A 3AA2A 1T94A 3IRXA 4EO8A 3CDWA 1JLQA 3ICLA 2G8UA 2HWHA 1B9DA 3K5OA 1HYVA 2YNFA 4E7IA 2PZSA 4KHWA 5L1LA 2X74A 1IKYB 5C5JA
chains in the Genus database with same CATH superfamily
1NM2A 3PHTA 1J6ZA 1G4CA 4MDBA 1IKWA 2B8PA 3QQCD 2ZH8A 1S48A 4WZQA 2MY7A 1UKUA 5AQOA 1YITS 4U67L 2X3DA 3F9MA 1KSPA 3T6JA 4CT9A 4I9QA 4GKJJ 3AT1B 1DTQB 1XHZA 5KG6A 1N6QA 3AVIA 1OH5A 4LFBJ 1WUAA 2ZVIA 2E6MA 1KLNA 5IWAJ 2CQ2A 3G6YA 2R8IA 5AXNA 3W3SA 1DLOA 5JXSA 3CFPA 4GVLA 1RWPB 4KTZA 2RT3A 4ES3A 3HXMA 4V19S 3MURP 2GVZB 1EKSA 4DV6K 3Q8YA 2YQ1A 5AE2A 3IBCB 2PFDA 3SBMA 1YDLA 3SQ4A 3MAQA 4KR0B 2YNFB 4JOUA 4D3GA 4KGZB 2QA1A 2XCPA 4I56A 4P73A 1IXKA 4CH0S 1TUUA 1T95A 3AD8C 3THYB 3T9ZA 4TY8B 1D9DA 4U9RA 1SXLA 3C2PA 2NRZA 1C0UA 4JRPA 2JC0A 4P2SA 1B64A 1YJWS 5CXTA 1CLQA 4DR1J 2I1RA 1GLCG 4JD2A 3VGLA 2KKZA 4CZLA 3EZ5A 2FVSA 1MU2B 4CZIA 3IWXA 2RDDA 1RHJB 5D8HB 4PR6A 3RB6A 2YNIA 3LDPA 3PJ9A 2F65A 4DSEA 3EDQB 4C8YA 2B7BB 4DFJA 4MO4A 2OP5A 2XLIA 1RU2A 3C7NA 3UDVA 3UKUB 4UZCA 3SCLE 2E2PA 3ZSYA 1R7IA 4KGKA 2CVEA 3O3HA 2VQEK 4CCHA 4JLHA 2R7WA 1MWKA 1VBXA 5M1OA 4OI6A 3QEIA 5BPLA 3P3DA 1X5PA 3M6GA 2F9DA 4DR6F 4DL5A 3O1BA 2MZJA 3WXIA 2IS3A 3KG4A 3DOKB 2LFVA 1JCEA 3ETOA 1VRQC 4FZVA 5AQQA 2MKIA 2DXFA 1KD1O 5EDWA 4FYVB 4BRKA 1Q82T 2MHNA 3CCQN 2DNKA 5G0RA 4DV2J 4ANDA 2MHEA 3GCXP 3I4PA 2P1JA 3HSZA 1VBYA 3MXJA 3NEKA 5K14A 3GMGA 1OVQA 4OYZA 4F0MA 4FNHA 4HHHA 2RH3A 2PE8A 2AEMA 2HW3A 4LIWA 1F5AA 4FJNA 4Z4EA 4EYIB 2ZJQL 3I6PA 1YBTA 4UZBA 1CQMA 2UYTA 4IWVA 4MIBA 2YHBA 1RAEB 3MEGB 2OZMA 4LF5K 3D4JA 3ZTRA 2JGUA 4FCYA 3TAFA 4NL5A 3QIPB 1C0TB 4M3ZA 2CNLB 1ATNA 4U96A 1N5SA 3LWLA 1NU4A 3E51A 2ALZA 2ZH9A 2X1GA 2XTJP 2A41A 2EEYA 3AVMA 1HNXJ 2PMWA 3P4UB 1MROB 2NQPA 1XJWB 3QO9B 4ED5A 3DI6A 4CLUA 2FVPA 2QWRA 3DOMB 1TL3A 3BBCA 4FL9A 3PIOL 4CJ5A 3LM9A 3OTOF 2HQCA 5KRTA 4X66F 1RT6B 4PAAA 2ZQBA 4H4MA 4N56A 5D78A 3U02A 5JS2A 2OPQB 4OX8A 1TMMA 2MYFA 4WPAA 1U6FA 4H0XB 2CGJA 2OPSB 4P2MA 3OYFA 2JNJA 4OKJA 3AY0A 1P1LA 5ETOA 4LRDA 4XH1A 4B3SJ 3HOSA 5JMVA 1VSIA 2NRRA 2VFRA 4CJRA 4USIA 5F41A 4WP8A 2O3DA 2XWYA 1OY9A 4LF2A 2CNKB 3OXFA 1HKCA 3DLLL 2IJFA 3RB0A 1EQ0A 3ONQA 1CPZA 3IO1A 5HOOA 5K8OA 4JI7J 4GVBA 1UOCA 3BEGB 3CC7N 4CH1A 3Q2TC 3GB0A 4BBYA 1FFGB 1TAQA 3W62A 1GQEA 3TQ1A 3OR2A 2KKHA 2V2KA 3GFZA 4MK9A 1VISA 3EM1A 1NJYA 3VA3A 5J1EA 2W7PA 4Y0WA 1WJ9A 2NR0A 3BO3A 3CCRN 4PL7A 4LSNB 3KLGA 3GE9A 4PYDA 1VQON 1S1TA 3R8EA 2HMIB 4Y65A 2IJRA 2SXLA 1DURA 1SC3B 3LP0A 3DLEB 1QQOA 1HHSA 1VSDA 1RHKB 2DJWA 3QJLA 2RD5C 3RMCA 1UJ6A 1U8WA 4JYAF 4ZJQA 4DCJB 1Y64A 4FWOA 3E9PA 4DHVA 3RTVA 4WCEQ 1M1GA 3MXMA 1CJTB 3QRRA 2UXDF 4MIWA 2RS2A 1NGBA 3H8YA 3KLHA 1VQSA 3LO3A 1F9HA 1Q78A 4RJVA 5LM7E 1YBUA 2JFKA 4K4VA 3IXQA 4QYRA 1BOTO 2BE7D 1QDUB 5D0EA 1VQMN 5K9FA 2CQ3A 2ZUAA 1TKDA 5A0YA 1KFDA 2BANB 2J0QD 3CCSN 4Y2AA 1GK8A 1N36K 2W2QP 5F8IA 2YX4A 2ZD1A 1TK0A 4DTNA 4NMLA 1Y3JA 2R2SA 1RDRA 2GMLA 1RBOB 2HVZA 4FJMA 4MLHA 1V5IB 2KT5A 3S1TA 3MM9B 4ZLLA 4Q2LA 3T5HA 4ZVGA 1ZXOA 1TYQA 3DDIA 1UWBA 1HBOA 4MQ3A 4EBDA 1WEZA 3M5RA 5F9LA 1Q18A 3QETA 5IC4B 4DV4F 5J2QB 2CJAA 4EP4A 4OLOA 3LDSA 1HD0A 1B99A 2HBJA 2QTWA 4Q2MA 1SPBP 2KVIA 3JB9k 2G8IA 4USTA 5KT3A 4ISGA 4JKGA 1LXNA 5HP1B 1OPZA 2PI5A 4PKGA 4FSVA 2FJAB 4AQYF 3EWGA 4MH8A 3J81j 4IH5A 4QPXA 1RTZA 4EFAC 3ELHA 5L8RC 1BQNA 4Y00A 2Q1NA 1N5VA 2J9CA 2MQLA 2ABYA 1Q8IA 2QLFB 2YV0X 4GVMA 4PWWA 4NXMJ 4DXLA 2DH8A 3ILLA 1F5CA 4FM0A 4IRDA 3LGNA 2F1FA 2O8FB 3O6QA 1M0SA 3H2VE 3HHEA 3CPWR 1UCNA 2IVMA 2UUCK 2RAQA 1XMQJ 5AR0A 1GXTA 2ZITA 2AGOA 2DFFA 3K8VA 4F3MA 3OR1A 4EEYA 1GMWD 3VQTA 3V1OA 2OKQA 2W2OP 2YKQA 3SFGA 3CCJS 2MZSA 2ROPA 1XBWA 4FM1A 3I82A 2W41A 4L3NA 4CF8A 2UUWA 2EXUA 3OUYB 1R8CA 2GGPB 1J5OB 4L76A 2W9CB 3PIPL 1ZA1B 3TA2A 2Z8QA 1PYSB 5KG2A 2ZH6A 4B3RK 4LMZA 3QAEA 4WQ5C 2KM8B 4N5SA 5E3QA 3CIMA 4O8KA 4KH0B 1XMOJ 4DEZA 3TRGA 4WF9L 3DLBA 1NK7A 4JK9A 4CHYA 3TWZA 3MFIA 2W9AA 1KLMB 1MMDA 3PSIA 4E7KA 3AY9A 3OFHA 4UTGA 3BJYA 3V6KA 2PD1A 5H9FJ 1S4FA 1UTAA 2RF2B 2PFUA 3Q86A 4U7CA 3D0PA 2V8GA 4NX9A 2KDOA 3NS6A 4FJGA 4ES1A 1S72N 2JL9A 4KGXB 1BWEA 2A10A 1U0HB 5AZIB 1Z1ZA 3CDEA 2L9WA 3KFWX 1U8SA 3JSBA 2V9KA 5MLCV 5HLFA 4OZJA 3UCUP 1QLNA 5LY3A 4DG1A 3NGZA 3VF2A 3CMES 4DX5A 2HWTA 5CYQB 2H54B 3T1YF 2HBZB 3IS9B 3SDEA 4TYAA 3J7AP 3L7OA 3GFHA 3E1YA 3VAJA 3DMJA 3OVBA 3HI0A 4JI5F 1M90O 4IG0B 2FSJA 3IG1B 1DBDA 3M2RA 3D7EO 1RADB 3OS0A 3P4IA 3SBTA 1ZBTA 3VAFA 4CVNE 4OO1J 3QEWA 4OYBA 1S7IA 3M3ZA 2YWFA 3M2VB 1GLFO 2OH2A 3PACA 2EPIA 2GZOA 1RT7B 1LAWA 5KFLA 1UW4A 2F4VF 2D1KA 3EDRB 2HBRB 3QZ7A 3C65A 2EWHA 1RDWX 3TZXA 3VA0A 4CDIA 1Y5IB 2FPHX 2WRMA 3PW0A 3PDNA 1FVQA 1ASWA 2R4FA 2JOQA 4JI3F 1FJGJ 1Z26A 3UWTA 4CFDA 4ANCA 4PZVA 1RHRB 3M8RA 3OYBA 4RW8A 2Q1LA 3LOUA 1DY3A 3MAAB 1NM1A 2LU1A 1JLEB 4JP8A 2AZ3A 2AA4A 3UI3A 4FBUA 4B3TJ 3VVTA 1PC4A 2FZGB 3Q8RB 4O0IA 3VQEA 3FFKB 4H0TB 1IQTA 5C42A 3U9DA 4FZZA 1VQKN 4KBIA 2N4CA 4MLEA 5B0BA 4QS8A 5TKYA 1R8BA 5B8HA 3FVYA 4JKDA 3T5JA 4CFAA 1FK9A 1LW0B 3EZUA 1RHUB 1S1WB 1F9FA 2U2FA 2IA0A 5AJ3K 2R7QA 1K0TA 1NKCA 4CEDA 3ENAA 3V5RA 2AYBA 2OTLS 3MK6A 2UXDK 1CLFA 1QQMA 1T9UA 3W9IA 1VRUB 2E20A 1S9EA 1HQ2A 1WNSA 2HVHA 3CCLS 2PMZD 2Q31A 5AT1B 3S3OA 4MFBA 1E6YB 3O2IA 3K0SA 1JLCB 3KKRA 3WIUA 3ZTPA 4K0KF 1RYSA 5GADU 3VAHA 4O3NA 4ED2A 1FD2A 1MW7A 5D4PA 4JS5A 4ILHA 3VTIA 4CO5A 1HNIA 3FSXA 2O01C 2UU9F 1HBMB 3CJ3A 3H4DA 2WFBA 2C2NA 3EXCX 4AXJA 4DBQA 1NZ8A 1WI8A 2UUBF 4CERA 3LP2B 2CQCA 1Y97A 1ZC6A 1RYRA 2WW4A 2FHOB 3EGZA 4AHTA 3BQ1A 3RBDA 3TX8A 4B1ZA 4LIRA 3OHAA 2M70A 2Q36A 1H7XA 1K73T 1H98A 1LW2B 3UD3P 6FD1A 4CK3A 3LPTA 2W2PP 5I42B 4P7TA 4TYBA 2CPDA 1IN0A 2QG9B 3HVTB 3QIOA 1LWFA 3M4XA 1ZETA 3TAMB 2BJ1A 3F56A 2VD3A 4B3MJ 2ZH1A 4NA2A 3L8BA 2P9LB 5RUBA 2VA3A 3NH0A 5DG9A 4X4RA 2OPRA 2FTRA 2FBYA 4RTFD 3GFXA 3OW2M 3LZIA 1I3AA 1FNOA 5E7OB 4ZP7A 4CJQA 1EKEA 2W8KA 1ZBUA 3M8PB 2GHPA 2JHEA 3VQ4A 4Y28C 3MM5A 3AHPA 2QRRA 5KFGA 2VC1A 3HT0A 1U7LA 2VICA 2IVNA 3D1OA 1H73A 1T9XA 1A6LA 3ZZZA 4JV5J 1J54A 2PYJA 3O1WA 2W25A 3KK1A 2B4PA 4FVMA 4YB6A 2RJZA 3NVKA 3EY1A 4PPDA 5JS1A 1ZS6A 1H2VZ 2XQCA 4JI1F 3HVWA 3OTBA 3VGTA 4YUDA 2NXUA 4FOIA 3OYLA 2OCEA 4URGA 1GLJO 3EUNA 4Y6IA 1BA0A 2W2NP 4PKHA 5IT9Y 1RCHA 1RBTA 2WONB 1GOAA 3O3GA 2BKNA 3V9WA 1WD6A 4CIFA 2R8HA 4HWIA 1RA6A 4GVEA 2D3UA 3TYTA 4NEZA 3S41A 4GMJB 2ASJA 1KEKA 3CW2C 4ELVA 2D0OA 1HQEB 1GT8A 1M5HA 1VQ5N 5KFUA 2VDHA 4CLPA 2JSXA 3QAUA 3PJWA 1RWVB 1IG8A 4DL0C 5EUHA 1JXVA 3KMQA 5A8KB 4M63C 4LUBA 4J2AA 2DCUB 3DN9A 2AT1B 2N3OA 3VQ5A 1X9WA 1YTYA 2BM1A 1HNZK 3CMAN 2P9PA 5CY4A 1N5YA 1OYDA 3H2UB 1EWRA 1U2VB 4WKRA 5D3GA 2GQCA 3HZ6A 2DT9A 2FGCA 3KLEA 3UB5A 3P5BP 5ETQA 2DEJA 4B17A 4LRAA 4E89A 2QA2A 3GYXB 2ZJPL 1WEXA 1A0OB 3ZNJ1 4CYUB 2CQGA 1KOOA 2BR0A 1BQXA 1Y3KA 5FDLB 3KNAA 2I8EA 2BX6A 1RT4A 2XI2A 1Q95G 3H5UA 2POKA 4R8UB 1X3MA 5AQJA 4QIEA 2KYXA 3ZT3A 3L3UA 4DR5J 4NI2A 4WIQA 2PN6A 3LPUA 2XGPA 1WACA 2HHPA 2ATQA 3GDQA 2IPOB 1T03B 4XDDA 1VHIA 3TJ8A 2F9TA 3CI5A 4J7CA 1NRKA 5AQRA 3OTCA 2AHOB 2HK3A 1FRXA 2YWGA 3DRRA 1GLBG 2CWXA 1JLAB 3KJQB 2XO7A 1PKUA 5K8NA 4H5RA 2B3TB 4X62F 5J2MA 1SVDA 3E3XA 3CJQA 3BDPA 2Z2ZA 1EAYC 2VKZG 3OL6A 4BR0A 3EPGA 5B0FA 4DCHA 2ATCB 1KVCA 2JJ4D 3AOAA 1XNQF 3AVGA 3BR8A 3VAIA 3CM6A 3ZZYA 2D4WA 4CEQA 3I4HX 4ELUA 5GAHU 2Z2LA 1IKYA 2FZKB 4LR8A 3W2WB 3PFOA 2QZ8A 1UW9A 4JI2J 2K1RB 5GAGI 4Y2MA 3RSEA 3Q23A 2GIRA 3BF4A 4LFBF 3MMCB 3KG0A 4ZMMA 3O80A 2X3GA 2O67A 4WE1A 3SQGB 2FLOA 2ZGZA 4R5PA 3WX8A 3DFEA 2NNWA 1LWCA 2MTLA 3OJSA 3IM9A 3JAMY 1PIEA 1Y7PA 1WAJA 5BN9A 3ZSZA 1S49A 3KUGA 3CULA 4DR2F 3W5YA 4LRFA 4USJC 4FW1A 3SMSA 1TL1A 3AFGA 5HMZA 3ENBA 4C3LA 4DV0J 1NO8A 3X3UA 4RUAA 1JQGA 3UNYA 1SL2A 2F96A 4TY8A 4QOZB 4X4VA 4L8RB 4YMEA 4DR1F 3UN5A 2EFGA 5AXLA 2IGIA 1NH7A 3TA1A 3R9PA 4A59A 2BUPA 5EOYA 4BRFA 5HMWA 4R79A 4K0KK 4WQ4C 1OSCA 4DSFA 4IOCL 4XO0A 3TU5A 4IRKA 2MLZA 2PFFB 4FWKA 1MU2A 1UAXA 2HFOA 5E3RA 1PO6A 5DLFA 3HPOA 3LW5C 4OLAA 2ADBA 3PHEA 4ZHRA 5E26A 1N34K 2LQJA 3ZZRA 4ECVA 3BKUA 1H72C 2J4RA 5ADZA 2DO4A 4DUZJ 4I6YA 1HPZB 3SCJE 4ED8A 3CCQS 2GV1A 1IKXB 2J76E 3MAHA 3D2FB 1KBRA 1UJ5A 1Q0NA 3O9TA 1J5EJ 4I2QA 2NUHA 2WVDA 3V9SA 1NDLA 4IDKB 2HQIA 4CQ1A 3NCIA 2BA9A 3CIZA 2M4MA 1UZHA 1RE1B 3B78A 4BC3A 3IGVA 4FPBA 3O9QA 2UZAA 1WN7A 3FZHA 1HBNA 2JLFA 3RR7A 1CBKA 4IOBA 2LU2A 4J9VA 3M8QB 3TR8A 3IRWP 3ZYYX 2V2ZA 4TU7A 1X5OA 2OEJA 5LL6d 4U67Q 4L3QA 4GV3A 2W42A 3LZJA 2YJFA 4BE0A 2MDAA 3H5XA 1CJUA 2AIRB 4DCPB 4CJVA 1UFKA 4PYAA 4Z37A 5GMDA 2F8SA 3KJNB 1U2RA 2QYGA 1TKTB 1CULA 3W2VA 1U09A 2MMYA 4QZVB 1RT1A 4KY3A 4JI6K 2RRNA 1O13A 2XHBA 1WSVA 2IVOA 4EUVA 3WUHA 4W5OA 3CF5L 3OBWA 3TQEA 1C0TA 3W9HA 2FBXA 3CCEN 2HHHK 1GLLO 5D4LA 2XZWA 1FXDA 4HLBA 3EVWA 2CFXA 4ZVOB 2DNYA 3O3FA 2JWNA 1JX4A 4LF8J 2IDEA 3EKSA 1NOZA 4CE9A 1E3MA 2LQ5A 1FE0A 4LFCJ 5DDPC 1XR7A 1GTEA 4F4WA 4E7HA 3GJRB 3DOMA 4E0DA 3UW1A 3PV8A 2CQDA 2ITGA 3HD1A 2IAJB 4EU0A 2D0PA 4CFBA 4JB8B 4K4ZA 5ETRA 1SQEA 3KYLA 1T9VA 2HBKA 4AL5A 2V5HG 1RWKB 3BP8A 2MKKA 3C6UA 3CC7S 1FXXA 2VWJA 4JAXA 2KRBA 3LGMA 2OPSA 3VEWA 2YVSA 5HI7A 2FC9A 3CFRA 4C1NK 3CCRS 1VQOS 4KO0A 5LMNF 3THWB 5C0YA 1X4DA 2VG6B 3BREA 5KRSA 5DDOC 2V51B 2F8MA 4CJEA 3ZZOA 1BIZA 1HKGA 1U1RA 2IM3A 3DM2B 2V7YA 1ESVA 1D09B 3CJKA 4CLWA 5AQMA 4PHTX 1U2CA 3BYPA 5KG7A 3OL9A 3KJFB 2D0BA 3V9UA 3DXKB 3CIPA 4OJGA 3QYYA 2HNDB 4IZ9A 4RW6B 1YRTA 2LA4A 2V6AA 1RT3B 2J6TA 3MFHA 1VQMS 5AQXA 1S9GB 3CCSS 3PO4A 2G8VA 3M1VB 3HSGA 5CHCB 2DXDA 2K3IA 4DV6J 3C16A 1ZBSA 1PBUA 1EWQA 4WKYA 4MO5A 5L9NA 1D8YA 3M30B 2HPUA 4OYIA 2XY5A 2KTQA 1A7GE 5DRKA 1LK5A 5SWMA 2HRUA 4DSJA 1XNQK 1T05B 2GVDA 4FYYB 3ATUA 5L1JA 5HVHA 1RKJA 4BDYA 2MKYA 4M5MA 1WLJA 1GMWA 1FE4A 1N48A 4BG8A 3ULDA 3NNCA 4ZPAA 3TR5A 2LCWA 4DV1F 2N4DA 1Z05A 3NG8A 1IBLJ 1I3OB 3UPFA 4QPTA 3FSYA 1BO5O 4JNEA 1S5ZA 1U48A 4OZLA 2HBQB 3K7RA 5BYRA 3BKTA 4KPCA 2BQRA 4QR2A 5KPTA 4L74A 4P7VA 2IRYA 1UEUA 3SUQA 3CO0P 2EC0A 4NLBA 4LD0A 2V4RA 2B4VA 4RNHA 1M1KO 3PIOQ 1VBKA 3TJ9A 4B9MA 4ED6A 4IFEA 4QW9A 2GO8A 1VYAA 4JI4F 4NB4A 1KQKA 2VQEJ 4GKKF 3DRPA 3VERA 5KFVA 1SS6A 1S1XA 1VDHA 4CLTA 3G71N 2G2OA 4AD6A 3CDUA 4G65A 1NB7A 1HWKA 2BACA 3NS5A 2G0CA 1QZ5A 3KLIA 2R2TA 3DRXA 1W2BR 4KH4A 4CF9A 3DLLQ 2M9KA 1K8KB 5F8LA 3GOIA 1PJ7A 3O4WA 3J7YU 4FLZA 1N33F 4ZJOA 1VMBA 3KHGA 1SI9A 1WWHA 3D0GE 2HBYB 4OI2A 3FBEA 4YR2A 2YWHA 3GONA 5C24B 2FLPA 1SV5A 8ATCB 2W6KA 3MCMA 5AQHA 2UUTA 3FEZA 2HS0A 2NRXA 1KOHA 4OVLA 3H45C 4B3OA 1B92A 3HLUA 2M8HA 2KI2A 1W26A 1PC5A 1S1VB 4LF5J 3AOBA 1Z4UA 5CR4A 2V69A 2C1EB 5H1SQ 1JLBB 3L9ZA 2IY5B 2Y8WA 2RHSB 5IQQA 1SQKA 1T3OA 4M5DB 3BUZB 1X9SA 2R7TA 2W9CA 4WYWA 3D1HA 2JC1A 4OGEA 4WFBL 3RRKA 1S72S 1N8RO 5T7BA 5GMKa 1H6KX 1DTTB 1WSRA 4KQZA 1OVYA 5AFUA 1H2TZ 2ZWPA 2HVIA 3JQMA 4WK1A 1DAXA 4K50A 4PUOB 1KQSM 4LBPA 3K5PA 3DRSB 2GJFA 4G1PA 2VFVA 3AO2A 1JLGA 3UN2A 1U2FA 2HVDA 3MR2A 5F3TA 1C1CA 4LF9K 4O3RA 2C2OB 2P9EA 2A1RA 5AZIA 2PBDA 1ZAVA 1NHVA 4A57A 3I8DA 3ET6A 3N79A 2MQQA 3MMBA 1OH6A 3HI9A 3ICLA 5LT5A 5GAGP 2HWHA 3D0IE 3K5OA 1B9DA 1HYVA 3VTHA 2YHXA 1FO1A 2HS3A 5C5JA 4PCQA 5DGAA 3LAMA 1RACB 1P8GA 4C2MA 1VQ9N 4WFAL 5LXRA 1M5PC 5KT7A 1R59O 2LQBA 3DDNA 1ITGA 2W8LA 4HACB 1L3UA 1LFWA 4XPEA 1TV6A 4PXBA 1SJ1A 3PY8A 5EWEA 3O9SA 3G8SA 3A3NB 2QI2A 4J9PA 3M6XA 4EI2A 4DX6A 4NLYA 1IBKK 2DGXA 3DGPB 3L2UA 1X8DA 3HBTA 3CUNA 2ZE2B 1K8AT 1SH0A 1JLQB 4BC9A 1VQKS 4TY9A 4YP3A 3H1QA 1JL2A 3QFUA 5LMNK 1IKWB 2J9EA 2UXBF 3ZZUA 2QA4N 3ZX3A 2R7SA 3OBYA 1JLEA 1N36J 5L9XA 3NNHA 4LF6K 2CPXA 4BRGA 4YDUC 3KK2A 4UOCA 2QMWA 2IIHA 1N6QB 1S4EA 2V8VA 2LXUA 3UE2A 3R3LA 4BGBA 4M95A 4TU9A 2G8FA 4OPAA 1WSEA 2ZH7A 5AQUA 1WELA 2J7WA 3DCAA 4C8KA 3FBBA 3AVAA 1HX1A 1DLOB 3BSOA 1BE4A 3ATVA 4AL7A 2WVFA 2GAGC 3U27A 3AVLA 5DO2A 1LW0A 4WF9Q 3QB0A 5E3AA 1WBBA 2IBOA 3M32B 4M3UA 2CADA 4DWIA 4A8MP 4OHYA 3ILIA 6FDRA 2G8HA 4KV8A 3O9RA 2WBRA 4F4YA 3RBXA 2VJUA 3N0VA 1IBCB 3MHYA 4IQMA 1T44A 2AEJA 5CD4A 4B9UA 4B9QA 1X4CA 4PXDA 2XHWA 4X4TA 3HSCA 1SKWA 4I64A 4CK2A 2HFUA 1NBEB 1OYEA 5DZ7A 4YDXA 4DTRA 2BQUA 3UR0A 4YY3K 3BR9A 3MN6A 4QYZJ 4IG3A 3EX7B 3CJCA 4ERDA 2FHKA 3O9UA 1HBMA 2OFHX 4JD2B 2DHHA 2XEXA 4EBCA 5KPRA 3LTOA 3LWMA 3DLRA 2E2OA 5IT9O 1ULRA 1ZZNA 3LP2A 3SMPA 2MKHA 4FJ7A 3NCPA 3BSCA 4RBUA 3UN3A 2J9DA 1TK5A 1XNRK 2YNIB 4F04B 2O1PA 1LW2A 4YHHF 1IR1A 3SQOP 1NGIA 2EG2A 2G1HA 5I42A 3JXUA 3C7NB 1RUSA 2J7KA 4FLVA 3CETA 3OFFA 4FJJA 1KONA 4H0OA 3CCMN 3RJMB 5LSLA 1EXQA 3MZIA 2CUYA 3TAMA 2ZJRQ 3FFIB 4JI4K 4WXOA 5IT9U 1KFSA 4GKKK 5KFBA 4ECWA 4W5RA 3EJMA 1YJTA 3IA0A 3H46O 4RCHA 3O08A 3ZSWA 3VQ9A 3OYAA 2B6AA 4DR6J 3NS7B 3FZMA 3C6TA 1Y9OA 2XLJA 4CZHA 4B3RJ 1YG0A 1RWUA 1BWVA 3J7AN 1OH8A 3D6FB 4C11A 3WNHA 1F60B 1HFEL 3OQ2A 3TWHA 5G0RB 1VI7A 3VEYA 1RTDA 1EKRA 5K5MA 1NDPA 4A2AA 3OBIA 1HNVA 1FFSB 5K14B 3T5KA 3TANA 2FF6A 2H3EB 3U1MA 1KNZA 2Z57B 2AKWB 3RGIA 3N6NA 4J2BA 2ZBIA 3US5A 3KHRA 1VQ5S 2A5XA 2DGVA 5HRPA 1FNMA 3MCSA 2X1FA 2E9TA 4HI2A 2DRDA 3AB2B 3UDCA 1NHUA 4F4XA 4PQUA 1NKBA 3CMAS 1SCJB 2CNNB 2ZUGA 3QJPA 3H42A 4DF4A 1X4GA 4DL2A 4E1MA 3BH6B 3H0PA 2F63A 2KT2A 3BDEA 1RISA 1BI4A 3CJ8A 2FHJA 3DI6B 1ATRA 4C0BA 5A8KA 3W66A 4BR7A 3A8EA 1TL3B 1RBRA 3IC1A 4WWSA 4HH1A 2J8AA 1U2VA 4J9UE 3TEGA 3NMRA 4JKCA 3R6MA 9RUBA 4H4MB 4HTUA 3OTOJ 1BCOA 1YZ7A 4X66J 2AJ1A 1NJIT 3F44A 1C1BB 4U7UK 3LDQA 5KI6A 4IO9L 3CGIA 5FDLA 2R7OA 4UQGA 2DNOA 5AQIA 4DR5F 4R8UA 1B0VA 2VJVA 4OX6A 2N7YA 5AE1A 1K1QA 2FLLA 3JAMO 2XS7A 4TSXA 3M9OB 3QWPA 1RDDA 2OI2A 3SXLA 5KFMA 4GRSA 3TA0A 2ACYA 3S3MA 4ZN1A 1NPPA 2Y1RI 3OR2B 1FHTA 1JLAA 4NCBA 1AW0A 2UUAF 5J1EB 3D2WA 5L1KA 3R7SB 2LEAA 3RBEA 2EFOA 3DRYA 2BDPA 4DUYF 2AJQA 3UKRB 3KLGB 3FBFA 3L3VA 1S1TB 5LXYA 2R7RA 3RUBL 1NGHA 2GWKA 2MXYA 3JAMU 3O44A 4IH6A 4L73A 3D6HB 1LWXA 2D0CA 4ZPWR 3MX2A 4W98A 4CHPA 4JYAJ 4USVA 4ES2A 3GV7B 4NCAA 5J2PA 2DNNA 3FCVA 2UXDJ 4O8UA 3EZOA 4M42A 1S22A 4CD1A 5I3QA 4J9NA 5JVHQ 3PFEA 1XN9A 2V4JB 2YHWA 4M3XA 3GIJA 3E8OA 2VKRA 2RRBA 2KB2A 4P72A 2ETJA 3K89A 5A0YB 2BW7A 1PYOB 2RPIA 1Q9XA 2Q79A 4HT5A 3P96A 1G3OA 3Q24A 5LMUK 2ZD1B 4CRJA 1HHQA 2X78A 2ALYB 3D68A 2I0XA 1RILA 4WZMA 2HIYA 1KVIA 4CBWA 2JVRA 3P8BB 1F1BB 2O8BA 3QIDA 2DNMA 2WVCA 5KFCA 3CT9A 1Q86T 3AA8A 1TUGB 4CZJA 1TYQB 4Q0BA 1LFPA 2P51A 2VZ9A 3NKYA 2Y1IA 3HF5A 1UWBB 3L09A 1HBOB 1MG7A 1YJVA 1NGCA 4ILRA 3KLVA 1Y4ZB 3AAQA 3LL3A 2HNYA 3EKUA 3MXHP 4LFAF 4K42A 4PG5A 4CLSA 4M45A 3RB4A 2DYAA 2HNZA 4LSZB 2WSFC 2QXFA 4TQSA 4CJLA 4JKGB 4RBTA 2HHXA 1TVRB 4M63A 2UXCF 2ZJPQ 1UEVA 3QZ8A 1U0SA 4LJMA 1NXIA 3VR1A 2QE5A 4C23A 1RAJA 4E19A 2FDNA 3O4NA 3PR5B 4UQTA 4AQYJ 2DR6A 1TUVA 1BQNB 2VBYA 1AFJA 3O8MA 2AJFE 3CJTA 3ENWA 4KJIA 1WSJA 4DTPA 2BUNA 4IFVA 3TNVA 4F67A 3T7ZA 1N0VC 2R7VA 3C94A 2DY4A 1HI8A 4X64F 2W4DA 2VFUA 3QMQA 1GLEG 1K1SA 3T41A 2O8CA 2CQ1A 2OFGX 4DTXA 2NPIA 4NLCA 1NK9A 3TSPA 3OVAA 1ZPWX 3SIPB 2P9CA 2GV9A 2QWLA 3V9XA 2YKMB 2Y0SD 2A18A 4A46A 4X4SA 1CZBA 2O8EA 2CQHA 3E66A 3OR1B 3OYEA 4QCLA 1G15A 1V3SA 2DHSA 3WHIA 4CF2A 1HYSA 4LVOP 1L3SA 3ZSRA 2CPEA 2VODA 4F02A 3NMUA 5DGBA 3OL7A 1FKPA 4CFCA 4OZ3A 1N52B 2CAJA 1IVZA 3GFYA 1D9AA 3DXSX 4U8VA 5SUHA 2FXUA 1TGOA 3SLCA 2QL7B 1EIYB 3Q8VA 5C15A 1NG9A 2DO0A 1CG2A 4M7YA 4F25A 1YZ6A 4IDHA 4A8SA 2XHCA 4F2RA 1W7AA 3CCES 1HW8A 2W40A 4A5AA 2I7NA 1R3NA 2E44A 4EZ9A 2NXEA 4GMKA 2R3VA 1DT9A 3HPHA 2ZWOA 2ASMA 1UPPA 2DH7A 1GAOA 2ZWHA 1C0MA 5KFZA 1QAYA 2AEFA 1REVB 1NNDA 1RNHA 1I94K 1O5JA 3M7VA 5HLFB 2FSNA 1L3TA 4XK8C 1PAUB 4RW4A 3L2RA 4KH6A 2ZHOA 3SDEB 2OA8A 3WQPA 1WC5A 2CPYA 3IAS9 4KTWA 4CJUA 3T1YJ 4DN0A 3CC4N 5HQ8A 4CTAB 4IBNA 4DU8A 4F4KA 1RBAA 4JN4A 2ZBQA 4DR4K 3M2RB 4JI5J 1Q4RA 2BJ3A 3C14A 4JI8K 4RR5A 3P49B 3A5MC 4F26A 5SZTA 4LBHA 2B43A 3U1LA 3NAHA 1C4AA 2E5LK 1FESA 4A5BA 1ZBLA 4MYUA 2LECA 5BPNA 3ENVA 4GC6A 3QJJA 4WQ4A 2HURA 2BRLA 2ZC3A 3DXBA 2FJBB 1R0CB 4ZVSB 2RE1A 4U95A 3AV9A 2F4VJ 1GOCA 4A8QA 3DHWC 1DGKN 1BG3A 4C98A 4QQBA 4X4PA 2E29A 2A3ZA 5EX0A 1EX4A 3HZEA 5IT0A 1WKLA 4JI3J 3J80Y 3E2EA 2OLWA 2QL9B 2JVOA 3MECB 4OKKA 2ZF5O 4CECA 5AQLA 1RCXB 2KFZA 3DXKA 4OX9K 1FKOA 1RT3A 5C42B 1W9HA 5AQVA 3CM5A 5GADI 4JKFA 3GZ7A 2QO3A 1UEKA 1F6TA 3KHYA 1UAWA 4KHPF 3VHQA 4DB3A 1ZM4A 1FK9B 1UA1A 4ILLA 2IM0A 3CXCM 3KOAA 3MTKA 1OSDA 4WYLA 2XG8A 2FBVA 1UP1A 3FZ2A 4JV0A 3S7RA 1NSPA 3PLAA 1WC3A 3AJDA 1LAVA 2WSEC 2F8TA 3HULA 3O5BA 1SC6A 1XIQA 2P9UB 5KT4A 4K0KJ 1URNA 2AJ0A 1BISA 5HRSA 4ICLA 5FIIA 1HNIB 4OHVA 4DMNA 1TL4A 2Z2MA 3ULEA 1CJKA 4WU3A 2UU9J 2E1RA 3TO8A 3G71S 3V81A 3SQ2A 1QM9A 3R27A 2P9SB 1FRJA 2UUBJ 4OL8A 3K59A 1S6OA 1ZTTA 3MM8A 2Q97A 1SJ4P 1E6VA 3FNNA 4I6MB 5T14A 2VQEF 2J8SA 1EB0A 1C1AA 5AQWA 1QHTA 3V1RA 4OMFG 4CF1A 1LWFB 2J6SA 3SNNA 4B1XB 2QYCA 5IWAK 3PUFA 4FJHA 5D0GA 4I7FA 2JWKA 1SKRA 1WEYA 4DTMA 2R8KA 2H5JB 3V1QA 3NGKA 2OEKA 5DDQC 1QY7A 2IRUA 5ETVA 4RO0A 4W5NA 1X4HA 1K8KA 4YOXA 2XMTA 2E1YA 4HHTA 3V6HA 1DJ0A 3MM5B 3IBFB 4H4KC 2VFSA 4XEIA 2O4IA 4ATNA 1RP5A 4DL3A 1GH8A 4K4SA 3MMAA 2WBMA 3T69A 3HSDA 5KQDA 5C2CA 5KFHA 3D28A 4ID8A 5B0CA 1FJ7A 5HL7L 4O23A 3HK2A 3FE1A 5KFQA 1T6DA 3FCWA 4JI6J 4DX8H 3AO4A 4CM0A 4ZK7M 4W5TA 3MDFA 4JI1J 3U9ZA 4BY9C 4KI4A 4AHSA 3D3CJ 2ZKTA 4TKTA 4H5VA 5B7WA 4FLXA 4M5DA 3BH7B 2HHHJ 2H65B 2HS4A 3WQTA 4J9RA 4W4MA 5FPNA 1W25A 1VR6A 1VSJA 5DQHA 3WNGA 1DTTA 4OZ2A 1V5VA 5IFMA 5A76A 3CJ7A 3CCUN 1VQ8N 2DNHA 4J9SA 4C3KA 2XSFA 2QWQA 1QAXA 1G6BA 2BJEA 4NASA 2RUGA 4DL6A 1F3FA 2P9PB 1N5YB 1X9MA 2N7CA 1BUPA 3CQ8A 5D3GB 3EN9A 3KLEB 2RSQA 3PXGa 1RU1A 1VQ9S 2MZTA 4ANEA 2DISA 3ZCMA 2AV5A 3C66A 1EQMA 1IBMF 3Q83A 3EL2A 4AH9A 3I5CA 5T41A 3OLBA 2AGQA 3PW2A 4CF0A 2B8QA 3R8YA 5BJRA 2VGNA 2RDIA 3OJUA 4UOHA 4YOYA 4BE1A 5KG1A 2V52B 4M3RA 4USHA 4NI2B 3IMXA 4LF1A 5IV3A 3D9BA 3FQKA 3SJHA 5H1SV 1XR6A 3GL1A 3M6WA 2I5JB 3N6MA 3P38A 1I39A 1HLUA 1OKJA 2KHOA 5GAHI 4YB5A 4CEBA 2GMJA 3CDBA 4P52A 1KVAA 1U47A 4AHRA 3DRRB 2WK4A 4JBCA 3R5JB 2E5JA 4I0WA 5J2MB 5FPEA 2P2CB 2QA4S 3GU0A 3TTDA 4X62J 3F73A 3ADAC 4ILGB 2YJEA 1KVKA 2JEJA 4OZNA 1O51A 3H3OB 3PYFA 4KFBA 1YGYA 3HHLC 4C6AA 4AUKA 3MR5A 3Q8PB 3ID6A 3TUPA 2DVIA 1XNQJ 4ZJLA 1NMNA 2FJVA 1KCFA 4NWBA 4H0VB 4AHVA 3K58A 2IC3A 2A6OA 1N36F 3ZZ0A 4H54A 5BXIA 3RSEB 2NPFA 4DV5K 3NF6A 2XNRA 3AO1A 1LCUA 3ITHA 5HBMA 1NK8A 4FN5A 2XMUA 3ZTQA 4WE1B 2FF3B 1RTHA 3TEHB 4R5PB 5AXMA 4C4WA 2CG8A 4FK4A 4LRCA 5KG4A 4B3SK 4WFBQ 1LWCB 1KR4A 1XMBA 4G1QA 3M32A 3BSNA 3W60A 2ZNZA 1U6ZA 4KHPK 3OTEA 3A3OB 4UOFA 3I0RA 2ILZA 3UCZP 4DR2J 1TL1B 4QWBA 2QGFB 5LL6Z 1Z25A 5K20B 1QUPA 5CH7B 4ECRA 1VQLN 3QT6A 1Y10A 4ECQA 4KHUA 2V8DA 1R6VA 3VVUA 4FLTA 3C6HA 4RWXA 1VLYA 3UD5A 3OVSA 1PILA 3MOZA 1V3RA 2ZDOA 1FXLA 4CP5A 2HF3A 2ZH5A 4NLUA 3CCMS 3ZETA 2VBXA 4BS2A 1MMNA 1YJ9S 1N54B 4DPYA 3JTOA 1MSWD 4O5BA 3GSDA 2PAVA 4M94A 2MSTA 4DU7A 4OV6A 2EWSA 4NYNA 4ZHRB 3SV3A 1PG5B 2UUCF 3DXMA 3F5TA 4H0YB 3V6DB 5A6PA 1X0PA 3W0LA 2AMCB 4NXNF 5HVFA 2E88A 2MQOA 1WOPA 4KHRA 3RZAA 5CCMA 3BF1A 2XULA 3G8QA 1DQ8A 2XMMA 3FFIA 3D7SB 1NZAA 1T8EA 1YT3A 5HMYA 4I2QB 1G7CB 4FXVA 4YR3A 2V8PA 1VQ6N 3U1NA 1Q1KA 4LH4A 4B9SA 5KQ8A 3KK7A 4YEAA 4YB7A 3AODA 4IEIA 1Z6RA 4B3RF 3VEVA 4BRCA 2KJWA 1CS4A 1HL6A 3NY0A 2BRKA 3P5TL 1HBNB 4JI0K 3WC2A 3R5DA 2YX7A 4OJHA 4QIFA 3H1VX 5J1PA 2B9YA 5AQGA 4LQ9A 2WB1D 5DM6Q 2XCAA 3CJ0A 2R7XA 2FB0A 2CDQA 1S59A 5T7LA 4KHQA 2HQFA 3CPEA 1R0AB 1CJUB 3JS6A 2Y8YA 2YH1A 2C3PA 2C2KB 4PABA 5F0WA 4DU4A 3QRPA 4UY8T 4QS9A 1NPKA 1CULB 2I38A 3AH6A 3W2VB 2QA4G 2QLJB 1RT1B 3QSIA 3A8IA 1GEHA 4FK2A 4KREA 4YDUA 3A8KA 2B4UA 1RLDA 2CVIA 1MWMA 3SSQA 3CJ9A 1WSIA 4WCEL 5KFXA 4E2FB 2CH6A 3DC2A 2EI5A 5JJBA 4OFZA 1YUWA 3Q89A 1IV0A 2EW9A 1S57A 3HM8A 4CGFA 3P6YC 3MTJA 3QGHA 5BREA 1RAFB 1XMQK 1SUQA 2WW8A 4FK0A 3CCTA 1E4FT 2OAUA 2JLEA 4QW8A 3MEDB 1TMJA 2ZKUA 2EFPA 4J9MA 5AQYA 3VGUA 4YORA 4FYXB 4MMOA 2Q0UA 1VGYA 1NDCA 1T0TV 5AFUH 3CJAA 3PNIA 3S8SA 4KC5A 2XMAA 2MQPA 3C6UB 3M8WA 1C1BA 4NLPA 2XMKA 1NGDA 1H0HB 5IM0A 2VYPA 4JKHA 1IBMK 3WC0A 1WF0A 4KB1A 3ENQA 3W61A 3WX4A 2VIHA 4KO0B 3G86A 5EN1A 3OT9A 2E1MC 1VLOA 2RVJA 3CPWM 5LMNJ 3T5LA 2GWJA 2ZZNA 5B09A 4FNIA 4ZPCA 3HHLD 1KAZA 4RW7B 4OIXA 3BGFA 1N5TA 3CJKB 2KXFA 2HBMA 4ZIVA 5LOQA 3UKRA 3K9JA 3HSJA 1U1PA 3CJ4A 2NUUG 3DKDA 3D67A 2HLUA 2G0JA 2GFFA 3UVJA 4CIOA 4CZCA 3TAEA 3FGVA 2FY8A 3TZWA 5AJ3F 3I0SB 1QTNB 3O1LA 3C16B 1DEJA 4EIAA 1GMVA 1V9OA 4NLXA 2AGPA 4HH0A 5IQ6A 5AQKA 2E6LA 3V4IA 3N5BA 4DUTA 3NNAA 4MKVA 2GVDB 2V4JA 3G82A 1MLAA 4AM6A 2YKOA 4V1Ak 4H03B 1KXPA 2D5RA 2XWXA 4DL4A 3IMQJ 4BWJA 1R43A 3SPYA 1QE1B 3ENHA 3OSNA 3FR0A 3G0ZA 4DV1J 4IH7A 2R7YA 4C3MA 4YOWA 3BGOP 3B4MA 4ETZA 1OQ3A 3CVKA 1NNEA 1S76D 5CYJA 1MWZA 4KBOA 4NMXA 2GHVC 2H1YA 5C12A 2EX3A 3KLFA 5IS2A 4LC9B 3NVMA 2Y0BB 5HQLA 3EEQA 4Q8EA 4C48A 3GYNA 1KVBA 3HYFA 3EZWA 1ATSA 3IUCA 2HVEA 2W1BA 3EE3A 3QFWA 2FVCA 2M8DB 1V3ZA 1RGIA 1U1KA 2FJWA 3ALYA 2JDJA 4B3TK 4U8YA 3J7YI 4FLYA 1XR5A 2A1BA 3MUTP 3SYZA 3DRPB 2BOPA 4CJKA 1X4EA 1L5UA 4JI4J 1KTVA 1TVRA 1S1XB 5CD4H 4GKKJ 3W63A 4ED1A 3ULHA 5M1KA 4HR2A 5LSRA 2MZ1A 5CZ1A 2IHR1 4RU9A 1BWFO 5MAOA 3QGGA 3SCIE 4IJAA 5M1QA 1NWKA 1BLUA 3VEXA 1RWOB 1A5WA 1G1XA 3KLIB 4WFXA 4KHSA 2D0AA 3EVOA 1PJ5A 1SH2A 3LDOA 1WG4A 3UD4P 5BPMA 2WUSA 1UVJA 3AO3A 4CHZA 1YI2N 5M2UA 3N4QA 4MKBA 4C7QA 1N33J 5IC6B 3AARA 4K2XA 2Q6BA 1WNEA 3L3CA 2YKMA 1SV5B 2B9EA 3GBTA 2DK2A 4BREA 3IFEA 4NXNK 4B3OB 1RAHB 4ECXA 4R25A 1NJXA 2XMJA 4J9KA 1BUXA 2H3GX 2M88A 3AA2A 1T94A 4Z7CA 1QD1A 3ZXWA 3IRXA 1IJJA 4BR9A 2MGZB 3MD1A 3SCKE 2G8UA 2PZSA 3GE1A 5L1LA 2X74A 5KPZA 4DR7K 2CNOB 2HG4A 3LUYA 2QTDA 1PBAA 1M1KT 1NEEA 2HRYA 2KHCA 4W92B 5M1PA 3LH2S 1YF5L 1ROFA 4WJBA 2FYXA 4KRFA 1HNZF 1YHQN 1U1LA 5AZJA 1NLVA 4QIWD 4B3MK 1N32F 3BYRA 1CC8A 1R8PA 4UUXA 4AL6A 3AGRA 3ISNC 4NRTA 4C8LA 2P9IA 2V94A 1FX4A 2GQQA 3AQOA 1YK9A 4F4ZA 1P9QC 1VQ7N 3J80O 4M5KA 3W3DA 5KFSA 4Y1DA 4C97A 1JLGB 4KAZA 3GIKA 4O44B 2DPNA 2LDIA 2C3OA 3CC4S 4Z4IA 2AP1A 1C1CB 4NRUA 4K2JA 3BN4A 3SZ2A 1SAZA 5DMRA 4W90B 1IQZA 3GPAA 1JLFA 1REVA 1YWXA 4PWDA 1U4BA 3ET6B 3HRGA 2M2BA 3H3NO 3MMBB 5GINA 4FBTA 4TU8A 3C19A 1GLDG 5KFTA 2ZH2A 1EX8A 2RQKA 1KAXA 1C4CA 3N28A 4ISFA 4CEFA 4ED4A 5DETA 1S1UB 5KFWA 4CTAA 2XYPB 3AJ1A 3AOCA 1VJWA 1DQAA 1UVIA 1Q8KA 3W64A 4J2DA 5M1NA 4OYOA 2NRHA 2FVQA 5M2PA 4A61A 3A5OC 4TLQA 1TV6B 2CG4A 3GV5B 3SFUA 2IM1A 7FDRA 2V7ZA 4Z7YA 4CGIA 1FTRA 2B4JA 2QIFA 1ITPA 1N88A 5CZVA 3CJSA 1N8RT 1NJZA 3T9NA 2A2DA 4BCAA 1Y00A 2EKNA 4B02A 3GQCA 1DHMA 2ACMA 3MR6A 5JUMA 4M5IA 2EFQA 3G87A 3FKBA 1JJ4A 1NCLA 3H20A 2OPPA 2VASA 8RUCA 1Q9YA 3PEJA 1FWPA 3MECA 2UXBJ 4CJ7A 4M5JA 3WZ0A 3KHHA 4B9TA 3W7BA 3JYTA 1JXEA 1FJCA 3KK2B 3TAPA 3ZEUA 5KFRA 6AT1B 1HW9A 1FRLA 1VK0A 2D9PA 5EY4A 3P31A 4DPOA 4ZA1A 1VJQA 5EWFA 4ED3A 3RR8A 2NSBA 3OVNA 4KH5A 1WOQA 2BE2A 2Z1HA 1S99A 3WEEB 3IAM9 1B0TA 4YOUA 2MPUA 4KV8B 3CCZA 5HVGA 4WTOB 4USKA 2E5GA 1R8HA 3P83D 2OIHA 3OHRA 5ETMA 3H7HB 2QW9A 2RNEA 4MIAA 1J27A 4CO4A 2WAQD 3PR4A 1YXQA 4H5TA 2P9UA 5F2RA 1LWEB 2YNHA 3M6VA 2COLA 2P5VA 2KYZA 3HHNB 4OJ3A 5GAEU 4IG3B 4G1IA 2HAIA 4CHOA 1IG9A 4LVNP 4TN2A 3VGMA 1HNWK 4J90A 5CYMA 2I7PA 2BMBA 1N34F 2P9SA 4E1NA 3DGVA 2YY3A 1V4SA 4YOTA 3E01A 4JI2K 1UFLA 4ITSA 5C25A 3SSSA 1I6JA 4EAHD 2L3MA 3NAIA 2E1PA 1N5QA 1T02A 4I6MA 1UVNA 1Q5YA 4P71A 1RTJA 1B4SA 4LSLA 4YHHJ 1JKHB 4DL7A 4IJNA 2N82B 3L2QA 5KT5A 3B6BA 4HDGA 1Y0HA 2YX1A 4FWSA 1HJRA 5D4NA 2GJIA 3FLCO 3TUIC 1IO2A 1S97A 1GXLA 1ILYA 3MD3A 2QWOA 4LH5A 2X6SA 2I2YA 1PYTA 3N4WA 3OXLA 2NXNA 1NGGA 2MKSA 4KYZA 2B6AB 1X3NA 4PWUA 2K2PA 1X1PA 4LREA 2A40A 3C6TB 4DV0K 2XMVA 4C11B 4IYQA 1JJ2R 1RB0A 1XQSC 5ITHA 3DJCA 4DV7F 2DHAA 3QATA 1RTDB 1J2VA 3M8SA 3PRBA 3GIMA 1VQNN 4E7JA 3HCXA 2Q6CA 3GSIA 4N76A 1HNVB 2XI3A 3MI7X 4O3OA 2IJNA 5HK4A 4V19X 4P74A 5ETPA 4DSLA 3LP3A 1CXQA 2Y9HA 1C0GA 4JI6F 3BQ2A 5HJYA 4CBUA 4HUFA 1YJNN 2Y1JA 3CCVN 3CCUS 3PJXA 1VQ8S 4TXSA 5HRRA 3OYGA 3HJVA 2YBVA 3ISND 3RYLA 4I2PA 2OEMA 2VPXB 2HHHF 3HVAA 4PQUB 4OQJA 2CJKA 3ZC4A 2BEFA 3TW0A 4CM2A 2FZCB 2CA9A 2RS8A 4ISEA 2V2VA 1BHNA 2ZBRA 4OHXA 1FF2A 3NOCA 3TVZA 2WOMA 1KDNA 3UDLA 1Q16B 3A2FA 4E3SA 3H2LA 1KC8O 2VA2A 4C8MA 3OHBA 2H4YB 3LP1A 2BKOA 4G6VB 1YIJN 1BI4B 3QBXA 1WAFA 3MCAB 4BC7A 5EU7A 1JWWA 3BZCA 1YTUA 2QV6A 3U3YA 2QX0A 5DM7Q 5ETLA 2U1AA 3AJ2A 3L95X 1N32K 4DI6A 4ECUA 2UP1A 3W1YC 5KFAA 3OD2A 5L1IA 3M6UA 3A4TA 1XQIA 2G0IA 1TK8A 4K5RA 2GIQA 4ZVQB 2ROGA 2M52A 1U45A 2LKZA 2YNGA 3VMFB 2AX0A 4X2BA 3VQ6A 4QU6A 1SZ2A 3OPKA 3L2WA 2KXHA 1CEZA 2FGOA 3BB5A 4FJ8A 5DDRC 1PCAA 3OYCA 2RDJA 1K6YA 4N8OA 2I5JA 2CQBA 3M9NB 2E1AA 5KG5A 1SL0A 3K57A 3BEXA 4CGJA 2X1BA 2KU7A 5JICA 5AE3A 2VC0A 3T19A 4LF7F 1FJEB 3UE5A 1RJJA 5M1FA 2QSFA 2R8GA 1XHXA 1Q81T 3FGUA 2F3JA 2UUAJ 2XBPA 1DZ5A 3SQ1A 3NGUA 4X4UA 2RN2A 4DUYJ 3L4QA 4NA1A 3R9LA 3NCRA 3A3PB 1GTHA 4CI0B 4LF8K 4O4RA 4B1YB 1RTIB 2OANA 1FEHA 2E7VA 1BQMA 4BQLA 3NF7A 3J7YP 3SMZA 4RX6A 4LFCK 3B6PA 1VIXA 3EMTA 2JWLA 3K2PA 5J2PB 1FRHA 3HPGA 2KW4A 3KD5E 2HHWA 3MM6A 4Q45A 4H4KA 2ZOMA 4OYAA 4XTTA 5HL7Q 4HI1A 3M2UA 2Z58B 4OI4A 3C0BA 1SQFA 4J2EA 3GG1A 4TLRA 3TTCA 5F8NA 2YPYA 4HL9A 5L39A 3EYZA 3CD5A 2DBBA 3QDKA 2AYMA 4XDCA 2OGUA 4GC7A 1VQLS 3TARA 3THXA 3PVXA 1FT8A 3ZSOA 2XYHB 1AUSL 3OYJA 4RUBA 2O8BB 2RKIB 2V67A 2APOA 1K9MO 4USMA 2Z56B 3BO2A 2XSJA 3VQSA 2B4OA 2CH5A 2P6SA 2VG7A 4K8XA 4Q0BB 2OTJN 3TUZC 1WTBA 4DTJA 1QVGR 1HBUA 5JLFA 2FJEB 3L4BC 4K25A 2DGQA 2HNYB 4N8NA 3OA9A 4IR9A 2W6LA 5F8MA 3VQDA 1CVJA 4A8XA 3NH1A 4CLZA 1JXBA 2HNZB 4CJFA 4KKOA 1RAOA 4LFAJ 1EZZB 1IR0A 1D4XA 4H8KA 1WC6A 3B54A 1NMEB 2YKPA 3DLGA 1S3XA 2UXCJ 3VF0B 4P9SA 3O4QA 5GIPA 3NBPB 2VQFF 2GW8A 2GQ2A 2UVWA 2YQ0A 4M5GA 3I55N 1WG5A 4FPAA 4CK1A 4IFVB 1VQ6S 4BC5A 3POTA 3IN5A 3TI0A 2CGKA 1SJQA 2XO6A 2VV5A 4FVUA 4RW9A 2KZZA 1I5OB 7AT1B 1Q5VA 5E41A 1EP4A 2ASPA 2O8CB 3V6DA 5KFFA 4X64J 1RAAB 4F3OA 3GTYX 5AQPA 3BF3A 2GIFA 4CJTA 1RT2B 3QBCA 2DHGA 1F21A 1IBLK 4CJSA 1APSA 1KS2A 5AXKA 4IKAA 4CIEA 4J37A 2O8EB 4JUZA 3K2YA 4BRLA 1QUVA 3M1FA 1UPMB 2G4BA 1B7FA 3IFRA 1HYSB 2XYGB 4U7UD 2PEHA 5A6WA 3UCGA 3C8YA 1L3KA 2VGMA 4PG4A 2BJ7A 2LQ9A 1C2PA 3BQ0A 4NLQA 1FKPB 4BRIA 1LNQA 1WSFA 3AAPA 4X65K 4NE9C 4B08A 1T3VA 2Z1GA 4NYFA 4HCCA 4BC2A 3HHLA 2Q3PA 4QWCA 1YSJA 4LR9A 4DF8A 3NGDA 1Y5NB 4DV7K 3M05A 3C6AA 4BRHA 4AYBD 1R0AA 2KQ2A 4B9NA 2P9KB 2CQPA 4LF9F 3IWNC 1C6VA 3R3TA 5D6GA 1NJIO 3MMVA 2QL5B 3G6XA 3CFOA 4YOEA 2LSNA 3VOVA 2PC6A 3A5LC 2XC9A 2FQQB 5JMNA 4MAKA 1ZTWA 2WBNA 5ETTA 2ZGYA 3TSQA 2ZM6F 1NLKL 4EP5A 3MUMP 3AD9C 3WXKA 1X60A 2L9DA 5BRFA 3QESA 3TPQA 1QSYA 2A3JA 3BBBA 3DYAA 4F9OA 4RW4B 3GCWP 4KTQA 3OL8A 2BQ3A 4PRFA 1UZDA 2W4CA 1X7VA 3IWLA 3MEDA 1HWIA 1W2IA 3ZNUA 5BRDA 4FWQA 3B4DA 2VUGA 4YOVA 1VOMA 3C14B 2CQIA 3PCOB 1RA7A 2V0NA 1IBKF 3N01A 3HSTB 4BDZA 2K7JA 1QVFM 4X4OA 4J91A 3DOLB 1KHVA 1W2BM 4OPKA 2ZVSA 4ZP9A 2YKNB 1RBLA 5JVGL 4OJRA 4U7BA 2ASOA 3R6GB 2VDIA 3D0HE 5AQTA 3MEEA 4LF4F 4CJ3A 2HHSA 1HRHA 1ZPVA 4C1NI 1ZOTA 4OYWA 1S0NA 5ELZA 1HD1A 4Z4GA 4OI3A 3VAGA 1WDDA 1NUEA 4RW7A 2DXEA 4LF6F 1VC6A 4ZLNA 4DV5J 4PPZA 3DDKA 1FX2A 3PX0A 5CHIA 3CG7A 4H0PA 1RWXB 2R8JA 1DARA 2ZOFA 2KT3A 3BGRA 1SKSA 3A8JA 2GBZA 4LF7K 1FKOB 1KTQA 3CERA 2D3O1 3GIIA 2AQ4A 1Q86O 2HHQA 3I0SA 2P9NA 3QLHA 2KFYA 4X84A 4ZVRB 3AB4B 2C2DA 2EC2A 1NGEA 1FKAF 4KHPJ 2W9BB 3K5LA 3IKMA 2OUGA 3QICA 3CD7A 5HRNA 1XTZA 4A8WA 5CZXA 4A48A 1GLAG 5A8RA 1WSHA 2IOCA 1OJ4A 4LY7A 2C28A 4NLOA 1CXUA 2GUPA 3HDSA 3TVYA 2ZJQQ 3OYMA 4YY3F 4Q8FA 3DAWA 4DS5A 3G8TA 4JHDB 1KWMA 2CIMA 5E84A 2GA7A 1S0MA 1QE1A 4DR3K 2KM8C 3JSMB 3RRGA 3HT3A 3BPDA 1S7HA 4ICLB 3VAKA 2KHDA 4DQPA 2DIUA 5F8JA 1R89A 3GP9A 3R97A 4C8ZA 2ZHAA 3H08A 1CJKB 2W7AA 2MQNA 1XNRF 3ULEB 4MT1A 3V81B 5CQGA 3BSAA 2L48A 2X51A 4FLWA 4NZ0A 1DFDA 3A0IX 5KFKA 4OYMA 1WB9A 3G25A 2DKOB 3PRVA 3MM8B 3SPZA 3CTRA 3NF8A 3L7UA 5DZ6A 1E6VB 1AZSB 3H98A 2BXJA 2GCFA 1RDAA 3RAMA 1ACMB 4LBIA 1AYEA 1YI2S 3DWLA 2RU3A 5KT2A 3MMJA 4DPXA 3VEZA 1IKVA 3ZTSA 1AA1B 2IYGA 1YVFA 4I7FB 3OV7A 5HANA 2ZOGA 2G2YA 4TVAB 1RT5B 3KD1E 4DQRA 4DV3F 4YDDB 2C2EA 4YN3B 1QVFR 2KLAA 3KWGA 1RSCA 4JI0J 2NRTA 2VQFK 2IBKA 2BM0A 1ASVA 4URSA 2NUBA 1VRTA 4F3TA 3D5MA 3GJTB 1HJOA 3MMAB 4CO2A 4PXEA 3VQPA 2H5EA 4UUWA 2EVZA 2BW2A 4QYZK 3D6MB 2YX6A 4Y2CA 1YVUA 1FDNA 3FEYB 3ZO7A 3AA9A 1QAJA 4CNZA 2OELA 1AB8A 2HZAA 1YHQS 2B5JA 3NGIA 3R6LB 3FRYA 5C2GA 1FRMA 4Y34A 2HLTA 1SIZA 3HFKA 2MGZA 1OY8A 1VQ7S 4UT4A 4WIIA 4IOAL 1UVLA 4I4BA 2FIUA 3NAEA 1B9FA 2OSRA 3CJ2A 3JSYA 1X4BA 4OZ1A 1BXNA 4BVOA 2DFHA 5EX5A