4B3RK

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4b3rK00
4LFAK 4X65K 3T1HK 4DV3K 4LF5K 1IBKK 4LFBK 5BR8K 4LF8K 4DR2K 2HHHK 1N34K 2VQFK 2UUAK 1N33K 4LF4K 4JYAK 5LL6Z 5A2QO 4DUZK 4JI8K 4DR3K 4JI3K 4DR5K 4B3MK 4JI2K 4K0KK 5FLXO 4YY3K 4B3TK 3OTOK 1HNWK 1IBMK 2UXDK 3J7YP 4DV5K 4OX9K 4JI1K 4DUYK 4DV4K 3JAMO 1N36K 4JI4K 3J81O 4DV0K 4X66K 5IT9O 1J5EK 2ZM6K 1XMQK 4NXMK 2UUBK 4CW7B 2VQEK 4DV7K 4LF9K 4GKJK 4NXNK 5AJ3K 1HNZK 4DR7K 4AQYK 4LFCK 4DR1K 2UUCK 3J7AP 4DV2K 4KHPK 1XNRK 1XNQK 4JV5K 2UU9K 4LF6K 4YHHK 1N32K 3J80O 4V19S 1I94K 2UXCK 4DR4K 4X62K 4DV1K 2UXBK 4X64K 5LMUK 4B3SK 4DR6K 3T1YK 1FJGK 1IBLK 4JI0K 5LMNK 4JI5K 4LF7K 4GKKK 1XMOK 2F4VK 5IWAK 4DV6K 1HR0K 4JI7K 4JI6K 4CVNE 4B3RK 1HNXK 2E5LK
chains in the Genus database with same CATH superfamily
2W6LA 2P9LB 1G15A 5EY4A 4AHCA 1ESVA 4DU1A 1L3SA 3QESA 1WLJA 1O13A 3FGUA 4DSEA 1JXEA 3KD5E 4M7XA 4YOWA 3FE1A 3VQ8A 3P1GA 2NRRA 4F3OA 3D0PA 4PWDA 5C25A 1T8EA 4LF8K 3H1QA 1BIUA 2P9IA 3CJCA 4F4KA 4CJ4A 1QSLA 4CZIA 1K8KA 2VGMA 1MA9B 5A2QO 2YJEA 3V9XA 3DOKA 3VQ7A 2FBYA 4DR5K 1QQOA 2OPPA 5AQKA 3S3NA 5EU7A 4FZYA 5EVZA 2OANA 4FWLA 4CIGA 2GTDA 4DSLA 3RSEA 2UXDK 1TYQB 1TK0A 4ILHA 2YV0X 1JCGA 4JI1K 3HPOA 4KHWA 1GLDG 3LDQA 1RTDA 4IFVA 1GLAG 4Y0WA 2PY5A 4IEIA 3DLRA 4CJFA 1BOTO 1NK5A 4DQRA 1TV6A 3NFAA 4NXMK 3MEEA 1VK0A 3SBTA 5DK5A 3P83D 4NXNK 4B1UB 2P9LA 1WUAA 4RW8A 3QMLA 5HRRA 2ATQA 4FOEA 2W6KA 4PKHA 5HP1A 2P5GA 3O9TA 1JLGA 4FWOA 1WB9A 2ITGA 5I42A 4B9UA 1E3MA 3LPUA 3EKSA 1IKYA 1HPZA 5FPDA 5GIOA 2YHAA 5KTQA 3IRXA 2FF3B 1DTQA 5JS2A 2KQ2A 3OYIA 3M8QA 4LSLA 1TAQA 4BC5A 1GLFO 5ADXA 3FZLA 3CM6A 3F9KA 4KFBA 2XRIA 3A2FA 4BGBA 1ZBIA 2E1YA 3PY8A 3HT3A 3HOSA 2PFUA 4FK0A 3L0QA 4W5NA 1TYQA 1MWMA 2YNIA 4M3UA 2DY4A 3RMBA 5E26A 2IDOA 3EL2A 4DU4A 3SQ2A 4KHYA 3GG4A 1WAJA 4N56A 4G1QA 2OA8A 3I8BA 1ITGA 4M3XA 1MDUB 3AA3A 5AZIB 1D4XA 1VQKN 4OKKA 4CK1A 4CF1A 4EHUA 4A62A 1U45A 3KVGA 1IKXA 4AHVA 4ZHRA 3CHWA 4NCGA 3WQTA 2D0BA 4CGFA 4BRHA 1SZ2A 3CETA 3NH0A 1SL2A 3THVA 3SK3A 1DGKN 4LH4A 3VQPA 4BRLA 3MWPA 3K58A 5BREA 2Z1IA 4H03B 5AQIA 3N4QA 3CCMN 3K5NA 3SUOA 3CC2N 3F5TA 1YUWA 4KREA 3G0ZA 4X66K 1RFQA 3VQ9A 1T6CA 4KBOA 3WUHA 3VEYA 4RW7A 1YI2N 3UKUB 3DXKB 5J2PA 4ZTJA 1TAUA 2I7PA 4LFCK 4CJWA 5F0XA 3GL1A 3NGIA 1WSJA 4J2BA 3E9LA 1QE1A 5AZIA 3RMCA 4IZ9A 4FLWA 3ENOA 1H1VA 3QDKA 4C23A 4DTNA 4M3RA 3FFKB 4O0IA 1HYSA 4DFKA 3HXMA 1ZYQA 4JEPA 1YT3A 2D0AA 4DR4K 3EE9A 4X62K 4DV1K 4M3WA 3V4IA 5LMUK 3K5OA 3O9RA 4GNIA 4M63C 4BRNA 4M41A 2YKMA 2W41A 1S1VA 4B9NA 4GKKK 1RBVA 3L2WA 1IG9A 3I0RA 2G8HA 1A5VA 3VQAA 5C10A 4BE0A 1W2BM 1QQCA 4FLXA 1SKRA 2VG5A 3EEQA 4FJNA 1UWBA 2NUBA 3V9SA 4CZHA 4OO1J 4IDKA 3AARA 5AQWA 2YHBA 1DT9A 1DKGD 3CQXA 3UKUA 2WC9A 3ZT3A 1VSDA 1QSYA 5HRPA 4J8FA 1SUQA 1RT4A 5ADXH 1D8YA 4BRAA 1Y64A 4EAHD 5KPRA 4CHNA 3U6FA 3AO1A 4BWJA 4H8KA 4HTLA 4FSVA 3QEWA 1Z25A 1NOYA 2P9SB 4FVUA 2QWPA 3WXKA 3BP8A 4A5BA 2JGUA 1BA0A 2DTUA 4BRDA 5HL7L 1HLUA 2O8BB 4CZLA 2E2NA 3L8BA 1N36K 4O5BA 3O8MA 4JI4K 5M1PA 4FLUA 1WOQA 2X74A 4WFAL 4IXCA 2IIRA 2QXLA 3ZSXA 3D2FB 4BE2A 1B9FA 4J2EA 4CZKA 3SUPA 1Q82O 5AQYA 4BR0A 4IG3A 1WSFA 4IOCL 4Q5VA 3QNOA 3KD1E 4WE1A 3KK3A 4PY5A 2GWKA 3T69A 3VF6A 3OS0A 3GE1A 3J7AP 2BH1A 1RCHA 3IFRA 3MXJA 3WNFA 3H46O 2F9WA 1S9GA 2A40A 3R9PA 3U3YA 4JV5K 4CJVA 3G10A 2CH6A 3IG1A 3TAFA 3BGRA 4N5SA 1QS4A 2P9SA 4W5RA 4DHYA 1A5WA 4FK2A 1LWFA 1QHAA 2NRZA 2QA4N 3M6GA 3AO5A 3OW2M 3RVCA 2HNYA 4H5TA 2Y1JA 2O8BA 1YJWN 5KI6A 3OJSA 3OYFA 5J2QA 4E7IA 3PX0A 2P5OA 4FWNA 4LSNA 4E7LA 2HF3A 3D2FA 3VQEA 2NRVA 5BPNA 4LFAK 3TPQA 4DTPA 2X6SA 2HBLA 3PIOL 5I3UA 1QZ6A 3DJCA 1Z6RA 4B8CA 5AFUH 4A2BA 3AVGA 3WXJA 3NGZA 1NOZA 2WBNA 4OGEA 1BO5O 4FLTA 3BDPA 4CESA 3V9ZA 5AQGA 2E2PA 2VWKA 1VSFA 5BRDA 3CCLN 4JYAK 3EY1A 1U48A 4CJPA 3ALYA 4MDAA 3R6MA 3MX5A 1TL3A 4CZJA 4HUGA 3H1VX 1RDUA 4CHZA 1X3MA 2FXUA 1X9SA 5C42A 4RG8A 2A1RA 1YJNN 3JAMO 2ETJA 1KCFA 5HRNA 3OYMA 4F3TA 2KLAA 3LALA 1NK4A 2O4IA 5EX5A 1YHQN 4PA1A 4JAXA 3DXMB 4MO5A 3O9UA 3I0SA 4B9QA 2HHXA 1S5JA 2EHGA 4QAGA 2NZTA 4Z94A 1QZ5A 3C6TA 3CCUN 4KTWA 4E19A 4HCCA 5AQUA 4CEFA 2HSTA 4CEZA 1Q81O 2R7YA 3M8PA 5JMVA 1ATNA 5AQMA 3VEXA 4IG0A 1QSSA 1VSEA 2BANA 2F96A 1I39A 4YDUC 5F1XA 3HVTA 3NH2A 4LH5A 4F2RA 3I8DA 1D9DA 1GOBA 1ZBHA 3VA0A 1I94K 3A5MC 3OHRA 4OKEA 4FWKA 4Z0UA 1YIJN 5T7BA 3MX2A 4IO8A 3VEZA 2BTFA 4QS9A 5GAHP 4KHQA 2D0CA 3M3ZA 1HR0K 4R5PA 1NGCA 5AQXA 2HVIA 3O6WA 2YHWA 4WF9L 1NGJA 3DXMA 1YAGA 3T1HK 3SMPA 2PBDA 1S22A 4BGAA 3ZT1A 4FPAA 1DLOA 4GV6A 4FW1A 3LAMA 4IKFA 4OGCA 2ZE2A 3LM2A 5AQTA 3ATVA 4BACA 1BISA 3SI6A 2O8EB 4CEEA 4DS4A 4ID1A 3ID8A 1NGBA 2RF2A 5M1FA 2KFNA 3P38A 5AQNA 3SPYA 3JXUA 4EZ9A 1HNVA 3H3NO 5B8HA 3O08A 3O3GA 1J5OA 3WXLA 4CHPA 1RT5A 4KH4A 4JI3K 1KSPA 2LSNA 1VQPN 1W0HA 4JI2K 4DSJA 1XC9A 4KO0A 1IBMK 1M1KO 4GVEA 3E01A 3DLGA 2ZJPL 4M42A 2FSKA 3BZCA 3J7YP 3NVMA 2HVHA 3OYHA 1JXBA 5EOYA 1C0MA 3CQYA 4BR5A 1U04A 5C2DA 4CHYA 3THWB 4BREA 3PLAA 2A3ZA 4CEDA 4KB0A 4M3YA 3DI6A 3C7NB 3ISNC 4O44A 3RRHA 1ASWA 3OS2A 4CJUA 2V7YA 3L2QA 5F2RA 2E2QA 1T03A 3WNEA 3AO4A 4AF1A 2P1JA 3TABA 1T7PA 2YNHA 2IGIA 2P9PB 2O8EA 4DFPA 5KGWA 1KAXA 1VRUA 1I3AA 4IEEA 1BG3A 1KVCA 1NGFA 4BVOA 3KLGA 1RNHA 1JL1A 1XNRK 3LDSA 4BY9C 3ZX3A 4CZEA 3DRSA 4ISFA 2GUPA 1HNIA 1YVNA 3Q7CA 4R79A 4M3ZA 4A59A 4W5QA 4BDPA 5AQPA 1TKXA 4X64K 1OH6A 4MFBA 4H0YB 3T1YK 4RWTA 4CK3A 1NBWA 1OH7A 4FJKA 3T19A 4NLCA 3VQDA 4B08A 1Q9YA 3KTQA 2PAVA 3ASMA 1LOTB 1S3XA 1KAZA 1NGIA 3VESA 2Q0UA 3THWA 4GV3A 1RBUA 5KGXA 3K0SA 4LY7A 4CFAA 1WAFA 5HBMA 1C1CA 3C7NA 5KPTA 3WXMB 2OPSA 4M45A 1KXPA 1UA0A 3PSIA 3LP3A 2D5RA 2YHXA 3M8SA 3CCSN 3KLIA 4ID5A 4CBXA 3D6RA 1KTQA 4IOXA 2P9PA 4CZMA 2KKZA 2NRHA 3OYDA 2KZZA 1J9AA 1WSEA 3R3LA 4OJRA 4BR7A 5AQVA 3FR0A 1T3VA 4CGJA 3ZYYX 4B3MK 4KKOA 3LDLA 3P39A 4JS5A 3MAQA 5JS1A 3AAPA 3PSFA 2W42A 2HMIA 3ZT0A 1D5AA 3VGMA 2QTDA 4EFHA 4CGDA 4YOVA 3OYLA 4DV0K 1NJIO 3LDNA 1FKOA 3B8AX 3EZ5A 3ZSYA 4BRPA 4CZGA 1BCMA 1TUYA 1YF5L 4PUOA 1QQNA 5FPMA 4B1ZA 4E1MA 4DF8A 3AAQA 1NGDA 4ELUA 3L3VA 4FWRA 1RDAA 1HJOA 2E6LA 1V4TA 3M1FA 3VQBA 4FJXA 4OPJA 1RDWX 2HHVA 1W9HA 4JRPA 1HMVA 1VQMN 4C8OA 1CXUA 4IOAL 3NF7A 5LJVA 1LCUA 1BQMA 4OPAA 4BR4A 3E1YA 1IBLK 4FJGA 1Y97A 2CGKA 3ZX2A 5CYMA 1G99A 4O5FA 3CCJN 4CEAA 4M3TA 5BPLA 1M90O 3HSTB 1NWKA 3P31A 4JI7K 4DSFA 3A0IX 1NU0A 3E9OA 1VQ4N 3TSQA 5GIPA 4DV3K 2BGGA 2WUSA 3P4IA 1VQ5N 4CZFA 3LWLA 5FDLA 5E41A 1N5YA 3JS6A 3HBTA 4IFEA 4FLVA 3A5OC 3CMAN 2HHSA 2OZSA 3K5MA 3W0LA 2YI1A 3VGLA 1VQLN 4KI6A 3AVKA 4DUZK 2FF6A 1S6QA 4JI8K 4Z4FA 2YCHA 3HSCA 4FXDA 2P9NB 1U6ZA 3NGYA 3TAEA 4JKGA 3NHGA 3OYBA 1NK8A 3HTVA 3EE8A 1HNWK 4OLAA 2ASPA 4DG1A 4A5AA 1RT6A 2PYJA 3SNNA 2GBZA 4E1JA 1NMNA 3J81O 4FM2A 4FJ5A 4GY2B 2DFFA 1BUPA 5IT9O 1JJ2M 2NRXA 1RT1A 3HM8A 4H5VA 2YNFA 1TL1A 4CW7B 4WQ5C 3AVHA 2FSNA 4DV7K 5AR0A 2Y1IA 1NJYA 3W3DA 5AJ3K 3QEXA 3H45C 3LP2A 3OYNA 3OBYA 4WQ4C 4H5WA 2YKNA 3VQQA 4DR1K 4FO0A 3SZ2A 4CEQA 4YOYA 3VERA 1EETA 3TTDA 4KHPK 4CHOA 1LAWA 2XY8A 1X3NA 3KJVA 4CF2A 2DPNA 3WNHA 4ELTA 2P9NA 4K41A 1GOCA 1RT3A 4C8MA 3BZKA 3KWIA 2IS3A 1EO1A 1C0FA 2QWRA 3T1AA 3LDOA 4C8NA 1ASVA 4WCEL 3TTCA 5LMNK 3CFOA 3PIPL 3AA2A 3AA4A 3QEIA 4OPHA 4CEOA 4BC4A 4FJLA 1IO2A 3ITHA 4C8KA 1R59O 1CZAN 1T6DA 4JKAA 1RILA 3OYCA 2XO7A 4AHRA 3WQUA 5AQFA 5AQZA 1VSLA 3F2KA 1OKJA 2X6NA 3LPTA 4JRQA 2ZJQL 3WXIA 4CJ7A 2RN2A 3RRGA 4BC3A 1S1XA 4CJKA 2VQFK 2IAJA 3OYGA 3DLHA 4RW6A 4JD2B 4AHTA 1C0GA 5BPMA 3NF8A 1LWEA 3S9HA 2PYLA 3L2RA 4RW4A 3HP6A 2F8SA 3HOTA 2GWJA 1FXXA 1JKHA 4E7JA 3PX4A 3CERA 4KTZA 3DRRA 4Z4CA 3DYAA 3WT0A 4DMNA 3L4QA 2V52B 2ASMA 2ZGYA 1VQ7N 1JLFA 3O5BA 1EP4A 3AO2A 3TSUA 4FOIA 3OA9A 3ZCMA 3G4SN 3G71N 2B5JA 5JVHL 3CFRA 3IDHA 3WNGA 4B1VA 4DR7K 4AQYK 3H3OB 2X78A 1Q9XA 1QTMA 3KWGA 4NLBA 4CJ3A 1S1WA 4DWIA 3RR7A 2UYTA 2UUCK 3NDKA 1VSHA 1P8ZA 1OVQA 3VQ6A 3MEDA 3RTVA 3KKSA 2P9UB 1LV5A 4CFCA 4CF8A 4JD2A 3VTHA 3GDQA 4Y1CA 5AQQA 3SJHA 4H4MA 4XH4A 3DMJA 3ZSZA 4I2PA 3QIPA 2VG7A 2ITMA 3OVNA 1HX1A 1S72N 4N76A 4JI0K 4DCHA 4JI5K 4C1NK 1TKZA 3CCEN 5IWAK 3VF4A 4FJJA 4WYBA 2HBMA 3R8EA 3CJ1A 4JI6K 4N47A 3DRPA 1HQEA 4JS4A 3HRGA 1GLEG 4YOXA 2O8DB 5BR8K 2CGJA 4BQLA 3O9SA 2I5JA 1Z26A 3HL8A 3CM5A 3MCAB 4BE1A 4CE9A 3CCRN 2ZWHA 4DTMA 3VPZA 1RBRA 1YITN 2P9UA 4DR3K 4BROA 4JN4A 3NH1A 1L3VA 4QOZB 3ZT4A 3DOLA 2YHYA 4FCYA 4FWQA 3QINA 3SPZA 1JCFA 4FM1A 3MXIA 1VRTA 3NF9A 3V6DA 5C0YA 4QCLA 2BE2A 4DUYK 4JK8A 5M1QA 1O1WA 3CCQN 1CZ9A 3NF6A 5GINA 3QETA 3ZSOA 4XH5A 4B3OA 1KVBA 3QICA 2O8CB 3HVRA 5H1SQ 3FZKA 1L3TA 3MWTA 4XIUA 4CIFA 2QXFA 3K5LA 2VQEK 4DS5A 3HPGA 4CI6A 3K2PA 3P5JA 3VTIA 1WNSA 5HOOA 4HUFA 3IKMA 4F2SA 2YX6A 4A2AA 1ZC6A 3C6HA 4ZTFA 2ZF5O 1YJ9N 3AY9A 3MN5A 4WQ5A 2O8DA 5EXWA 1GOAA 3AVAA 2QI2A 2A41A 4O8KA 4K8ZA 4NB4A 2RPIA 3ZSQA 3RMAA 4DTOA 5JLHA 4WQ4A 3UKRB 5BN9A 4CF0A 1SKSA 5C2FA 1N32K 3GBTA 3CC7N 3AVCA 4BRKA 1X9MA 5BRFA 3A5LC 5CZ1A 5C24A 5KQDA 3LZIA 4FJ9A 4K42A 4KHUA 3WEEB 4F9OA 4Y1DA 4YORA 1P90A 2OCEA 5KRSA 1RTJA 2GV9A 2NNWA 4IO9L 4DV6K 4DFMA 2FBTA 4MLEA 1XI1A 5TKYA 4CJSA 2O8CA 1C0UA 1ZBFA 2ZJRL 4B3RK 4A57A 2E5LK 4FPBA 3TI0A 3SAFA 3CXCM 2YJFA 1HKGA 4E0DA 5LJWA 4CGIA 3KLFA 1V4SA 1DEJA 5CYQA 5J2MA 1B92A 3LANA 4IJAA 4KI4A 2NRTA 1XUPO 1NJWA 3V1QA 4DQPA 2HHHK 1NGEA 4JHDB 3BUZB 4Z4HA 2QKBA 1CXQA 1S9EA 4O0JA 3U9DA 3MDQA 3U8XA 4CHQA 5LY3A 2A1SA 4HTUA 3UKRA 2A6AA 4KH5A 4FW2A 3C0BA 1HKCA 4HVJA 1SS6A 2FBXA 5KQ8A 3E66A 2NLXA 4FJMA 4CFBA 2V7ZA 4FLZA 4KRFA 3WEEA 2Q3SA 2QWNA 4ISEA 5D3GA 4J2DA 2QK9A 4MQ3A 4DQSA 2HNZA 3GOIA 4FL9A 3VEVA 2VGNA 4BDZA 1JLQA 4Z4IA 1XMQK 4ILJA 3SYZA 1SQKA 2G8UA 2ZGZA 2JLEA 1IH7A 5DMRA 4K8XA 4FZXC 2G8FA 3VEWA 4FJHA 4BWMA 4FYDA 4JKFA 4JKDA 1TK5A 3O3HA 1BWFO 5CE3A 3SV3A 4YFUA 2Z1JA 3FZFA 3A5NC 3HO1A 4BDYA 4JHDA 3ATUA 4DV2K 4H0TB 4H0PA 3NMUA 3C65A 1EWQA 1NK9A 2Q97A 2OPRA 4HWIA 4ISGA 5CR4A 2KFZA 1WN7A 4YOTA 2OTLN 3QB0A 4ICLA 1REVA 1RDCA 5BN8A 3AGKA 1NGHA 3MMVA 1HYZA 4DB3A 2FBVA 4CBUA 2J4RA 2CGLA 2F4VK 3VQ4A 2CH5A 3LDPA 1IKWA 4IJNA 1OVYA 2VG6A 2Q0RA 3D7EO 3G6EN 3K59A 4MDBA 4RCHA 5AQJA 5AQSA 3VEOA 3AGRA 4FWSA 3TWHA 3S41A 4FM0A 5FPEA 1IBKK 2IOCA 2D0OA 1HRHA 3VENA 3N4PA 3ZSRA 1EXQA 1NNEA 3QNNA 3KK7A 5C15A 1QQMA 4DR2K 1HJRA 2QWOA 3MCPA 2OPQA 4CFDA 3MK6A 1XQSC 2RE2A 1A5XA 3TANA 4LF4K 1RT2A 4JKBA 3NAEA 4IDHA 1VQ6N 3L4IA 3PO5A 4Z4EA 3VMFB 3S3OA 3ZEUB 2PZSA 3SAHA 3HYFA 5DM6L 1Q8IA 4CJTA 4WFNL 4CJEA 4JKCA 1S1UA 3LAKA 4CEBA 5MLCQ 2VCPA 5BRHA 4DSIA 2WFBA 4UY8O 5ELZA 4ELVA 1TUUA 4H0VB 4B9MA 3ENBA 2UUBK 3HM9A 3AVJA 3RWUA 1RBSA 5CHIA 3AVNA 2QM1A 5TKWA 4AHUA 1TGOA 4FJIA 3L2VA 1C1BA 1TVRA 1HUXA 3K57A 3RMDA 1Z05A 3QBWA 2D1KA 2HNDA 4CJ5A 1BL3A 1EQYA 1KFDA 1NM1A 3TAGA 3SLCA 1S1TA 5AQOA 2JWLA 5GAEP 2GEMA 3ZETB 2FSJA 4CK2A 4B9VA 4FLYA 3ULEB 4CD1A 1IV0A 3CMEN 3D45A 4RTFD 4CIEA 2Z1HA 3LZJA 3ZSVA 1EWRA 3ZEUA 3H6EA 1JLCA 1BQNA 3AA5X 3THXB 1W7AA 4XEIA 1OH5A 3VQCA 5JICA 4XH1A 4FJ8A 1K9MO 4HHTA 1HYVA 1X1PA 4K43A 1LAVA 3G25A 4EIAA 4JKGB 3CJ7A 2EX3A 5CY4A 3PV8A 3J8AA 1WSIA 4AILC 4PHTX 4YDUA 5HRSA 1K8AO 1VQ8N 4DLGA 3UIQA 2HHTA 1NG9A 1BGXT 3K9KA 1KC8O 3CQ8A 3TAPA 1IKVA 4CJRA 2XY5A 3VETA 4KPYA 3DM2A 5DM7L 1XWLA 2AJQA 4H0OA 3ZETA 3ZT2A 1SKWA 3AV9A 3FZHA 1GLJO 3ULEA 3SQ4A 3O4WA 1MWKA 3O3FA 1NKCA 4NCAA 3HPHA 2P9KB 1KVAA 2QW9A 4B1WB 1QVGM 4C8LA 1ILYA 3THXA 1NK6A 1QHTA 1U2VB 3PX6A 3CPEA 3VOVA 4DTSA 3HP9A 2OTJN 1RT7A 3AO3A 1NMDA 3EZWA 3F73A 1NJZA 1QVFM 3Q7BA 4I6MB 1ATRA 2G8IA 3H08A 3E9PA 2BUPA 3QO9A 3TARA 4BRIA 3QFPA 3KHYA 1UA1A 2HHQA 3ENHA 3CJAA 4IWVA 4JNEA 2QWQA 3O1BA 2JWKA 3HK2A 3CC4N 1SAZA 2B6AA 4LF6K 3MEGA 4JLHA 4YHHK 4BG8A 2IVOA 3JSMA 4KHNA 2RHKA 3FZMA 4O8UA 3KLEA 4CD3A 5HROA 2WONA 1KLNA 2G8WA 3HJFA 2XY7A 4KB1A 3QIOA 1Q18A 1KD1O 2P9KA 3OYJA 1VQ9N 4CF9A 1YTAA 3U3GA 4C1NI 4B1XB 4PKGA 2HBJA 1U2VA 1SL1A 2KW4A 5I9EB 1KRPA 5AQLA 4I2QA 5J1EA 5AZJB 4B9TA 2XHBA 1XC3A 4F8RA 4LF5K 1NK0A 2Q36A 3F9MA 2QWMA 4BG9A 1VQON 3QEVA 3CD6N 2E1ZA 4LFBK 4GMJB 2E2OA 4U7BA 4I6MA 2VWBA 3JYTA 2FLOA 3V1RA 5AQHA 4AM6A 3IAYA 3HI0A 4E1NA 3SBGA 4M7YA 1N33K 1JLAA 3B6PA 2FC0A 2VYPA 2IVPA 3OYEA 3PUFA 4YY3K 3QEPA 3OTOK 3SJJA 4LC9B 4BRCA 1LW0A 4CERA 1VHXA 4OX9K 4DV4K 1T05A 1S6PA 2AP1A 4CGGA 5AFUA 1BDGA 3CPWM 2A42A 2Q31A 4DQIA 3O1WA 2HOEA 4EP4A 4DU3A 4BRQA 3SUQA 1LW2A 1K73O 4DTUA 3V1OA 5JVGL 1RTIA 1YVUA 1BA1A 4GW6A 1WSGA 5AZJA 1NGAA 5JLFA 1X9JA 3O9QA 3C94A 4DQQA 1JLBA 4AHSA 3J7ZO 1GLCG 5HLFA 1XHXA 3A8YA 3BF3A 3KKRA 4EZ6A 2G8VA 4OVLA 2Q2RA 5J2NA 3O4QA 4CCHA 2VWJA 3DXKA 4FWMA 1BI4B 4PQUA 4B3SK 4EP5A 4KH6A 1ATSA 3VF2A 3LL3A 3I33A 3BEXA 1XMOK 3CG7A 1HQUA 5CZ2A 4HUEA 4I9QA 1SV5A 1NKEA 4UQGA 4CECA 3DLLL 1HNXK 4BVPA 2OYQA 5FRNA 1FK9A 4QS8A 5FRMA 3QLHA 3TR8A 4LD0A 1VSKA 3CIPA 4G9ZA 4J2AA 2ZD1A 3AVBA 2F9TA 4BC2A 3TTFA 2HF4A 4ILGB 5LL6Z 4DTJA 2ZQBA 1RBTA 4BRMA 1BU6O 2Q1NA 4DLEA 3SMSA 1J54A 3DLKA 1U4BA 4K0KK 3LM9A 3L2UA 3ULDA 4O4GA 1UOCA 3V9WA 1BI4A 3VA3A 4WFBL 3THYB 1VQNN 1E4FT 1JCEA 3TAMA 3OY9A 3SAGA 2QKKA 4E7HA 2QWLA 5E84A 2ZM6K 3CFPA 5FPNA 1D9FA 4DFJA 2DFHA 3BF1A 2BDPA 3SUNA 2WTUA 4LF9K 1C1AA 4E7KA 4GKJK 1TKDA 5SZTA 4NYNA 4CJQA 1HNZK 4GV9A 4L3QA 3EYZA 1EKEA 3DAWA 1RGIA 2F8TA 3RR8A 3SQ1A 1VSMA 3EO3A 3U9ZA 3FLCO 3KZBA 3QBXA 4Q0BA 2W40A 3DLEA 5M1NA 3SCXA 1XNQK 3MN7A 2D0PA 1WBDA 2H3GX 2NRWA 5GADP 2A5XA 1F21A 4DQ8A 2EWSA 1IG8A 4PKIA 1JL2A 4CGHA 3KK1A 3LP0A 4BR2A 1FJGK 3SV4A 4PL8A 1VAZA 3THYA 3ZSWA 3M8RA 5BR9A 4NCBA 2E6MA 4H5NA 4CVNE 3KLHA 1U47A 2E20A 3AVIA 3CJBA 3VGKA 4OPKA 3T3FA 1CLQA 4X65K 1NGGA 5KPZA 3C6AA 4EHTA 3AVFA 4E89A 4YOUA 1VSJA 4B1YB 1VSIA 4PL7A 3VN5A 4I7FA 4IFYA 3MXMA 1N34K 1KLMA 4BRGA 3IS9A 2KHOA 1TKTA 4DTXA 4H5RA 4W5TA 3S3MA 1KQSM 4N41A 4KAZA 1SL0A 4BR9A 5FLXO 2GX9A 4GVMA 4NO7A 1R0AA 4JKEA 3KIOA 4RW9A 4DSKA 4DV5K 1B9DA 4NYFA 3OYAA 5AQRA 1U49A 1X9WA 3K9JA 1UAXA 1IJJA 5M1KA 4FWPA 3VQ5A 3QFUA 3O80A 3BY5A 3OBWA 1FW6A 3DLBA 2I7NA 2O4GA 3C95A 5SWMA 4B9SA 3LWMA 1WBBA 4FK4A 4E3SA 4W5OA 2HHUA 1LWCA 2G8KA 4FZZA 3CF5L 1FKPA 3KK2A 4OLBA 3MECA 4L8RB 1GLBG 4AH9A 3SQ0A 4JKHA 2HB5A 3I55N 4OKJA 2OZMA 4CJLA 1CZBA 3C6UA 3PO4A 3AVLA 4V19S 1ZXOA 3LP1A 2UXCK 3OS1A 2P51A 5C12A 3NBPA 4BQZA 1NK7A 5M1OA 1XHZA 2DFEA 1W97L 1RDDA 3B6OA 1EX4A 4LF7K 5FROA 3CCVN 4I9LA 4KHSA 3NCIA 4HCBA 3IUCA 4A61A 1HKBA 4FJ7A 3I56N 4H4OA 1RDBA 1BHLA 4U67L 2KZMA 3QERA 4Z4GA 1YXQA 2E88A 5GAGP 1NJXA 1K6YA 1ZBSA 1N8RO 3CI5A 1NLVA 3ID6A 2D4WA 3D2EB 1N6QA 3R1XA 2O8FB 3EKUA 2UUAK 5K14A 4QS7A 4B8AB 3ZX0A 2HBKA 3MN6A 1BIZA 2V51B 4DF4A 3L6QA 3NE6A 4B3TK 2B4JA 2KTQA 1JLEA 3TSPA 4H0XB 1TK8A 4TSXA 3TAQA 1ZBLA 1T44A 4CBWA 3UE5A 3OYKA 3UB5A 1E4GT 1J5EK 3MN9A 1YTUA 3O4NA 3NVKA 1RTHA 1Q86O 4DTRA 3V81A 2F7TA 4JK7A 1C6VA 1GLLO 2QEXN 3CJ9A 3DWLA 3IMXA 2ASOA 1J6ZA 2E4LA 4BRFA 4YNQA 1ZBUA 3U4LA 1KFSA 1C0TA 3FFIA 2P9IB 4K25A 3T7ZA 4O55A 1Q7YO 4MLHA 1K8KB 2Z1GA 3D2EA 4AM7A 2O8FA 4B9LA 3AVMA 3TU5A 1DTTA 1HPMA 2AA4A 1KAYA 2UU9K 4IBNA 4KTQA 1L5UA 2HHWA 3J80O 1BCOA 3M5RA 2IC3A 1J53A 2XY6A 2UXBK 4KV8A 3OJUA 2HW3A 1OH8A 1L3UA 3RSEB 4MO4A 1WSHA 4DR6K 2RKIA 4DKWA 2E8AA 3V9UA 2WOMA 3EN9A 3CYMA 3HZ6A 2HMPA 1NKBA 3L3UA 4JK9A 1ASUA 2GUIA 2IVNA 5KRTA 2YNGA 4FVMA 3ZLJA 1MU2A 2GELA
chains in the Genus database with same CATH topology
4LFAK 4X65K 3T1HK 4DV3K 4LF5K 1IBKK 4LFBK 5BR8K 4LF8K 4DR2K 2HHHK 1N34K 2VQFK 2UUAK 1N33K 4LF4K 4JYAK 5LL6Z 5A2QO 4DUZK 4JI8K 4DR3K 4JI3K 4DR5K 4B3MK 4JI2K 4K0KK 5FLXO 4YY3K 4B3TK 3OTOK 1HNWK 1IBMK 2UXDK 3J7YP 4DV5K 4OX9K 4JI1K 4DUYK 4DV4K 3JAMO 1N36K 4JI4K 3J81O 4DV0K 4X66K 5IT9O 1J5EK 2ZM6K 1XMQK 4NXMK 2UUBK 4CW7B 2VQEK 4DV7K 4LF9K 4GKJK 4NXNK 5AJ3K 1HNZK 4DR7K 4AQYK 4LFCK 4DR1K 2UUCK 3J7AP 4DV2K 4KHPK 1XNRK 1XNQK 4JV5K 2UU9K 4LF6K 4YHHK 1N32K 3J80O 4V19S 1I94K 2UXCK 4DR4K 4X62K 4DV1K 2UXBK 4X64K 5LMUK 4B3SK 4DR6K 3T1YK 1FJGK 1IBLK 4JI0K 5LMNK 4JI5K 4LF7K 4GKKK 1XMOK 2F4VK 5IWAK 4DV6K 1HR0K 4JI7K 4JI6K 4CVNE 4B3RK 1HNXK 2E5LK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA K;  4X65 K;  3T1H K;  4DV3 K;  4LF5 K;  1IBK K;  4LFB K;  5BR8 K;  4LF8 K;  4DR2 K;  2HHH K;  1N34 K;  2VQF K;  2UUA K;  1N33 K;  4LF4 K;  4JYA K;  5LL6 Z;  5A2Q O;  4DUZ K;  4JI8 K;  4DR3 K;  4JI3 K;  4DR5 K;  4B3M K;  4JI2 K;  4K0K K;  5FLX O;  4YY3 K;  4B3T K;  3OTO K;  1HNW K;  1IBM K;  2UXD K;  3J7Y P;  4DV5 K;  4OX9 K;  4JI1 K;  4DUY K;  4DV4 K;  3JAM O;  1N36 K;  4JI4 K;  3J81 O;  4DV0 K;  4X66 K;  5IT9 O;  1J5E K;  2ZM6 K;  1XMQ K;  4NXM K;  2UUB K;  4CW7 B;  2VQE K;  4DV7 K;  4LF9 K;  4GKJ K;  4NXN K;  5AJ3 K;  1HNZ K;  4DR7 K;  4AQY K;  4LFC K;  4DR1 K;  2UUC K;  3J7A P;  4DV2 K;  4KHP K;  1XNR K;  1XNQ K;  4JV5 K;  2UU9 K;  4LF6 K;  4YHH K;  1N32 K;  3J80 O;  4V19 S;  1I94 K;  2UXC K;  4DR4 K;  4X62 K;  4DV1 K;  2UXB K;  4X64 K;  5LMU K;  4B3S K;  4DR6 K;  3T1Y K;  1FJG K;  1IBL K;  4JI0 K;  5LMN K;  4JI5 K;  4LF7 K;  4GKK K;  1XMO K;  2F4V K;  5IWA K;  4DV6 K;  1HR0 K;  4JI7 K;  4JI6 K;  4CVN E;  4B3R K;  1HNX K;  2E5L K; 
#chains in the Genus database with same CATH topology
 2W6L A;  2P9L B;  1G15 A;  5EY4 A;  4AHC A;  1ESV A;  4DU1 A;  1L3S A;  3QES A;  1WLJ A;  1O13 A;  3FGU A;  4DSE A;  1JXE A;  3KD5 E;  4M7X A;  4YOW A;  3FE1 A;  3VQ8 A;  3P1G A;  2NRR A;  4F3O A;  3D0P A;  4PWD A;  5C25 A;  1T8E A;  4LF8 K;  3H1Q A;  1BIU A;  2P9I A;  3CJC A;  4F4K A;  4CJ4 A;  1QSL A;  4CZI A;  1K8K A;  2VGM A;  1MA9 B;  5A2Q O;  2YJE A;  3V9X A;  3DOK A;  3VQ7 A;  2FBY A;  4DR5 K;  1QQO A;  2OPP A;  5AQK A;  3S3N A;  5EU7 A;  4FZY A;  5EVZ A;  2OAN A;  4FWL A;  4CIG A;  2GTD A;  4DSL A;  3RSE A;  2UXD K;  1TYQ B;  1TK0 A;  4ILH A;  2YV0 X;  1JCG A;  4JI1 K;  3HPO A;  4KHW A;  1GLD G;  3LDQ A;  1RTD A;  4IFV A;  1GLA G;  4Y0W A;  2PY5 A;  4IEI A;  3DLR A;  4CJF A;  1BOT O;  1NK5 A;  4DQR A;  1TV6 A;  3NFA A;  4NXM K;  3MEE A;  1VK0 A;  3SBT A;  5DK5 A;  3P83 D;  4NXN K;  4B1U B;  2P9L A;  1WUA A;  4RW8 A;  3QML A;  5HRR A;  2ATQ A;  4FOE A;  2W6K A;  4PKH A;  5HP1 A;  2P5G A;  3O9T A;  1JLG A;  4FWO A;  1WB9 A;  2ITG A;  5I42 A;  4B9U A;  1E3M A;  3LPU A;  3EKS A;  1IKY A;  1HPZ A;  5FPD A;  5GIO A;  2YHA A;  5KTQ A;  3IRX A;  2FF3 B;  1DTQ A;  5JS2 A;  2KQ2 A;  3OYI A;  3M8Q A;  4LSL A;  1TAQ A;  4BC5 A;  1GLF O;  5ADX A;  3FZL A;  3CM6 A;  3F9K A;  4KFB A;  2XRI A;  3A2F A;  4BGB A;  1ZBI A;  2E1Y A;  3PY8 A;  3HT3 A;  3HOS A;  2PFU A;  4FK0 A;  3L0Q A;  4W5N A;  1TYQ A;  1MWM A;  2YNI A;  4M3U A;  2DY4 A;  3RMB A;  5E26 A;  2IDO A;  3EL2 A;  4DU4 A;  3SQ2 A;  4KHY A;  3GG4 A;  1WAJ A;  4N56 A;  4G1Q A;  2OA8 A;  3I8B A;  1ITG A;  4M3X A;  1MDU B;  3AA3 A;  5AZI B;  1D4X A;  1VQK N;  4OKK A;  4CK1 A;  4CF1 A;  4EHU A;  4A62 A;  1U45 A;  3KVG A;  1IKX A;  4AHV A;  4ZHR A;  3CHW A;  4NCG A;  3WQT A;  2D0B A;  4CGF A;  4BRH A;  1SZ2 A;  3CET A;  3NH0 A;  1SL2 A;  3THV A;  3SK3 A;  1DGK N;  4LH4 A;  3VQP A;  4BRL A;  3MWP A;  3K58 A;  5BRE A;  2Z1I A;  4H03 B;  5AQI A;  3N4Q A;  3CCM N;  3K5N A;  3SUO A;  3CC2 N;  3F5T A;  1YUW A;  4KRE A;  3G0Z A;  4X66 K;  1RFQ A;  3VQ9 A;  1T6C A;  4KBO A;  3WUH A;  3VEY A;  4RW7 A;  1YI2 N;  3UKU B;  3DXK B;  5J2P A;  4ZTJ A;  1TAU A;  2I7P A;  4LFC K;  4CJW A;  5F0X A;  3GL1 A;  3NGI A;  1WSJ A;  4J2B A;  3E9L A;  1QE1 A;  5AZI A;  3RMC A;  4IZ9 A;  4FLW A;  3ENO A;  1H1V A;  3QDK A;  4C23 A;  4DTN A;  4M3R A;  3FFK B;  4O0I A;  1HYS A;  4DFK A;  3HXM A;  1ZYQ A;  4JEP A;  1YT3 A;  2D0A A;  4DR4 K;  3EE9 A;  4X62 K;  4DV1 K;  4M3W A;  3V4I A;  5LMU K;  3K5O A;  3O9R A;  4GNI A;  4M63 C;  4BRN A;  4M41 A;  2YKM A;  2W41 A;  1S1V A;  4B9N A;  4GKK K;  1RBV A;  3L2W A;  1IG9 A;  3I0R A;  2G8H A;  1A5V A;  3VQA A;  5C10 A;  4BE0 A;  1W2B M;  1QQC A;  4FLX A;  1SKR A;  2VG5 A;  3EEQ A;  4FJN A;  1UWB A;  2NUB A;  3V9S A;  4CZH A;  4OO1 J;  4IDK A;  3AAR A;  5AQW A;  2YHB A;  1DT9 A;  1DKG D;  3CQX A;  3UKU A;  2WC9 A;  3ZT3 A;  1VSD A;  1QSY A;  5HRP A;  4J8F A;  1SUQ A;  1RT4 A;  5ADX H;  1D8Y A;  4BRA A;  1Y64 A;  4EAH D;  5KPR A;  4CHN A;  3U6F A;  3AO1 A;  4BWJ A;  4H8K A;  4HTL A;  4FSV A;  3QEW A;  1Z25 A;  1NOY A;  2P9S B;  4FVU A;  2QWP A;  3WXK A;  3BP8 A;  4A5B A;  2JGU A;  1BA0 A;  2DTU A;  4BRD A;  5HL7 L;  1HLU A;  2O8B B;  4CZL A;  2E2N A;  3L8B A;  1N36 K;  4O5B A;  3O8M A;  4JI4 K;  5M1P A;  4FLU A;  1WOQ A;  2X74 A;  4WFA L;  4IXC A;  2IIR A;  2QXL A;  3ZSX A;  3D2F B;  4BE2 A;  1B9F A;  4J2E A;  4CZK A;  3SUP A;  1Q82 O;  5AQY A;  4BR0 A;  4IG3 A;  1WSF A;  4IOC L;  4Q5V A;  3QNO A;  3KD1 E;  4WE1 A;  3KK3 A;  4PY5 A;  2GWK A;  3T69 A;  3VF6 A;  3OS0 A;  3GE1 A;  3J7A P;  2BH1 A;  1RCH A;  3IFR A;  3MXJ A;  3WNF A;  3H46 O;  2F9W A;  1S9G A;  2A40 A;  3R9P A;  3U3Y A;  4JV5 K;  4CJV A;  3G10 A;  2CH6 A;  3IG1 A;  3TAF A;  3BGR A;  4N5S A;  1QS4 A;  2P9S A;  4W5R A;  4DHY A;  1A5W A;  4FK2 A;  1LWF A;  1QHA A;  2NRZ A;  2QA4 N;  3M6G A;  3AO5 A;  3OW2 M;  3RVC A;  2HNY A;  4H5T A;  2Y1J A;  2O8B A;  1YJW N;  5KI6 A;  3OJS A;  3OYF A;  5J2Q A;  4E7I A;  3PX0 A;  2P5O A;  4FWN A;  4LSN A;  4E7L A;  2HF3 A;  3D2F A;  3VQE A;  2NRV A;  5BPN A;  4LFA K;  3TPQ A;  4DTP A;  2X6S A;  2HBL A;  3PIO L;  5I3U A;  1QZ6 A;  3DJC A;  1Z6R A;  4B8C A;  5AFU H;  4A2B A;  3AVG A;  3WXJ A;  3NGZ A;  1NOZ A;  2WBN A;  4OGE A;  1BO5 O;  4FLT A;  3BDP A;  4CES A;  3V9Z A;  5AQG A;  2E2P A;  2VWK A;  1VSF A;  5BRD A;  3CCL N;  4JYA K;  3EY1 A;  1U48 A;  4CJP A;  3ALY A;  4MDA A;  3R6M A;  3MX5 A;  1TL3 A;  4CZJ A;  4HUG A;  3H1V X;  1RDU A;  4CHZ A;  1X3M A;  2FXU A;  1X9S A;  5C42 A;  4RG8 A;  2A1R A;  1YJN N;  3JAM O;  2ETJ A;  1KCF A;  5HRN A;  3OYM A;  4F3T A;  2KLA A;  3LAL A;  1NK4 A;  2O4I A;  5EX5 A;  1YHQ N;  4PA1 A;  4JAX A;  3DXM B;  4MO5 A;  3O9U A;  3I0S A;  4B9Q A;  2HHX A;  1S5J A;  2EHG A;  4QAG A;  2NZT A;  4Z94 A;  1QZ5 A;  3C6T A;  3CCU N;  4KTW A;  4E19 A;  4HCC A;  5AQU A;  4CEF A;  2HST A;  4CEZ A;  1Q81 O;  2R7Y A;  3M8P A;  5JMV A;  1ATN A;  5AQM A;  3VEX A;  4IG0 A;  1QSS A;  1VSE A;  2BAN A;  2F96 A;  1I39 A;  4YDU C;  5F1X A;  3HVT A;  3NH2 A;  4LH5 A;  4F2R A;  3I8D A;  1D9D A;  1GOB A;  1ZBH A;  3VA0 A;  1I94 K;  3A5M C;  3OHR A;  4OKE A;  4FWK A;  4Z0U A;  1YIJ N;  5T7B A;  3MX2 A;  4IO8 A;  3VEZ A;  2BTF A;  4QS9 A;  5GAH P;  4KHQ A;  2D0C A;  3M3Z A;  1HR0 K;  4R5P A;  1NGC A;  5AQX A;  2HVI A;  3O6W A;  2YHW A;  4WF9 L;  1NGJ A;  3DXM A;  1YAG A;  3T1H K;  3SMP A;  2PBD A;  1S22 A;  4BGA A;  3ZT1 A;  4FPA A;  1DLO A;  4GV6 A;  4FW1 A;  3LAM A;  4IKF A;  4OGC A;  2ZE2 A;  3LM2 A;  5AQT A;  3ATV A;  4BAC A;  1BIS A;  3SI6 A;  2O8E B;  4CEE A;  4DS4 A;  4ID1 A;  3ID8 A;  1NGB A;  2RF2 A;  5M1F A;  2KFN A;  3P38 A;  5AQN A;  3SPY A;  3JXU A;  4EZ9 A;  1HNV A;  3H3N O;  5B8H A;  3O08 A;  3O3G A;  1J5O A;  3WXL A;  4CHP A;  1RT5 A;  4KH4 A;  4JI3 K;  1KSP A;  2LSN A;  1VQP N;  1W0H A;  4JI2 K;  4DSJ A;  1XC9 A;  4KO0 A;  1IBM K;  1M1K O;  4GVE A;  3E01 A;  3DLG A;  2ZJP L;  4M42 A;  2FSK A;  3BZC A;  3J7Y P;  3NVM A;  2HVH A;  3OYH A;  1JXB A;  5EOY A;  1C0M A;  3CQY A;  4BR5 A;  1U04 A;  5C2D A;  4CHY A;  3THW B;  4BRE A;  3PLA A;  2A3Z A;  4CED A;  4KB0 A;  4M3Y A;  3DI6 A;  3C7N B;  3ISN C;  4O44 A;  3RRH A;  1ASW A;  3OS2 A;  4CJU A;  2V7Y A;  3L2Q A;  5F2R A;  2E2Q A;  1T03 A;  3WNE A;  3AO4 A;  4AF1 A;  2P1J A;  3TAB A;  1T7P A;  2YNH A;  2IGI A;  2P9P B;  2O8E A;  4DFP A;  5KGW A;  1KAX A;  1VRU A;  1I3A A;  4IEE A;  1BG3 A;  1KVC A;  1NGF A;  4BVO A;  3KLG A;  1RNH A;  1JL1 A;  1XNR K;  3LDS A;  4BY9 C;  3ZX3 A;  4CZE A;  3DRS A;  4ISF A;  2GUP A;  1HNI A;  1YVN A;  3Q7C A;  4R79 A;  4M3Z A;  4A59 A;  4W5Q A;  4BDP A;  5AQP A;  1TKX A;  4X64 K;  1OH6 A;  4MFB A;  4H0Y B;  3T1Y K;  4RWT A;  4CK3 A;  1NBW A;  1OH7 A;  4FJK A;  3T19 A;  4NLC A;  3VQD A;  4B08 A;  1Q9Y A;  3KTQ A;  2PAV A;  3ASM A;  1LOT B;  1S3X A;  1KAZ A;  1NGI A;  3VES A;  2Q0U A;  3THW A;  4GV3 A;  1RBU A;  5KGX A;  3K0S A;  4LY7 A;  4CFA A;  1WAF A;  5HBM A;  1C1C A;  3C7N A;  5KPT A;  3WXM B;  2OPS A;  4M45 A;  1KXP A;  1UA0 A;  3PSI A;  3LP3 A;  2D5R A;  2YHX A;  3M8S A;  3CCS N;  3KLI A;  4ID5 A;  4CBX A;  3D6R A;  1KTQ A;  4IOX A;  2P9P A;  4CZM A;  2KKZ A;  2NRH A;  3OYD A;  2KZZ A;  1J9A A;  1WSE A;  3R3L A;  4OJR A;  4BR7 A;  5AQV A;  3FR0 A;  1T3V A;  4CGJ A;  3ZYY X;  4B3M K;  4KKO A;  3LDL A;  3P39 A;  4JS5 A;  3MAQ A;  5JS1 A;  3AAP A;  3PSF A;  2W42 A;  2HMI A;  3ZT0 A;  1D5A A;  3VGM A;  2QTD A;  4EFH A;  4CGD A;  4YOV A;  3OYL A;  4DV0 K;  1NJI O;  3LDN A;  1FKO A;  3B8A X;  3EZ5 A;  3ZSY A;  4BRP A;  4CZG A;  1BCM A;  1TUY A;  1YF5 L;  4PUO A;  1QQN A;  5FPM A;  4B1Z A;  4E1M A;  4DF8 A;  3AAQ A;  1NGD A;  4ELU A;  3L3V A;  4FWR A;  1RDA A;  1HJO A;  2E6L A;  1V4T A;  3M1F A;  3VQB A;  4FJX A;  4OPJ A;  1RDW X;  2HHV A;  1W9H A;  4JRP A;  1HMV A;  1VQM N;  4C8O A;  1CXU A;  4IOA L;  3NF7 A;  5LJV A;  1LCU A;  1BQM A;  4OPA A;  4BR4 A;  3E1Y A;  1IBL K;  4FJG A;  1Y97 A;  2CGK A;  3ZX2 A;  5CYM A;  1G99 A;  4O5F A;  3CCJ N;  4CEA A;  4M3T A;  5BPL A;  1M90 O;  3HST B;  1NWK A;  3P31 A;  4JI7 K;  4DSF A;  3A0I X;  1NU0 A;  3E9O A;  1VQ4 N;  3TSQ A;  5GIP A;  4DV3 K;  2BGG A;  2WUS A;  3P4I A;  1VQ5 N;  4CZF A;  3LWL A;  5FDL A;  5E41 A;  1N5Y A;  3JS6 A;  3HBT A;  4IFE A;  4FLV A;  3A5O C;  3CMA N;  2HHS A;  2OZS A;  3K5M A;  3W0L A;  2YI1 A;  3VGL A;  1VQL N;  4KI6 A;  3AVK A;  4DUZ K;  2FF6 A;  1S6Q A;  4JI8 K;  4Z4F A;  2YCH A;  3HSC A;  4FXD A;  2P9N B;  1U6Z A;  3NGY A;  3TAE A;  4JKG A;  3NHG A;  3OYB A;  1NK8 A;  3HTV A;  3EE8 A;  1HNW K;  4OLA A;  2ASP A;  4DG1 A;  4A5A A;  1RT6 A;  2PYJ A;  3SNN A;  2GBZ A;  4E1J A;  1NMN A;  3J81 O;  4FM2 A;  4FJ5 A;  4GY2 B;  2DFF A;  1BUP A;  5IT9 O;  1JJ2 M;  2NRX A;  1RT1 A;  3HM8 A;  4H5V A;  2YNF A;  1TL1 A;  4CW7 B;  4WQ5 C;  3AVH A;  2FSN A;  4DV7 K;  5AR0 A;  2Y1I A;  1NJY A;  3W3D A;  5AJ3 K;  3QEX A;  3H45 C;  3LP2 A;  3OYN A;  3OBY A;  4WQ4 C;  4H5W A;  2YKN A;  3VQQ A;  4DR1 K;  4FO0 A;  3SZ2 A;  4CEQ A;  4YOY A;  3VER A;  1EET A;  3TTD A;  4KHP K;  4CHO A;  1LAW A;  2XY8 A;  1X3N A;  3KJV A;  4CF2 A;  2DPN A;  3WNH A;  4ELT A;  2P9N A;  4K41 A;  1GOC A;  1RT3 A;  4C8M A;  3BZK A;  3KWI A;  2IS3 A;  1EO1 A;  1C0F A;  2QWR A;  3T1A A;  3LDO A;  4C8N A;  1ASV A;  4WCE L;  3TTC A;  5LMN K;  3CFO A;  3PIP L;  3AA2 A;  3AA4 A;  3QEI A;  4OPH A;  4CEO A;  4BC4 A;  4FJL A;  1IO2 A;  3ITH A;  4C8K A;  1R59 O;  1CZA N;  1T6D A;  4JKA A;  1RIL A;  3OYC A;  2XO7 A;  4AHR A;  3WQU A;  5AQF A;  5AQZ A;  1VSL A;  3F2K A;  1OKJ A;  2X6N A;  3LPT A;  4JRQ A;  2ZJQ L;  3WXI A;  4CJ7 A;  2RN2 A;  3RRG A;  4BC3 A;  1S1X A;  4CJK A;  2VQF K;  2IAJ A;  3OYG A;  3DLH A;  4RW6 A;  4JD2 B;  4AHT A;  1C0G A;  5BPM A;  3NF8 A;  1LWE A;  3S9H A;  2PYL A;  3L2R A;  4RW4 A;  3HP6 A;  2F8S A;  3HOT A;  2GWJ A;  1FXX A;  1JKH A;  4E7J A;  3PX4 A;  3CER A;  4KTZ A;  3DRR A;  4Z4C A;  3DYA A;  3WT0 A;  4DMN A;  3L4Q A;  2V52 B;  2ASM A;  2ZGY A;  1VQ7 N;  1JLF A;  3O5B A;  1EP4 A;  3AO2 A;  3TSU A;  4FOI A;  3OA9 A;  3ZCM A;  3G4S N;  3G71 N;  2B5J A;  5JVH L;  3CFR A;  3IDH A;  3WNG A;  4B1V A;  4DR7 K;  4AQY K;  3H3O B;  2X78 A;  1Q9X A;  1QTM A;  3KWG A;  4NLB A;  4CJ3 A;  1S1W A;  4DWI A;  3RR7 A;  2UYT A;  2UUC K;  3NDK A;  1VSH A;  1P8Z A;  1OVQ A;  3VQ6 A;  3MED A;  3RTV A;  3KKS A;  2P9U B;  1LV5 A;  4CFC A;  4CF8 A;  4JD2 A;  3VTH A;  3GDQ A;  4Y1C A;  5AQQ A;  3SJH A;  4H4M A;  4XH4 A;  3DMJ A;  3ZSZ A;  4I2P A;  3QIP A;  2VG7 A;  2ITM A;  3OVN A;  1HX1 A;  1S72 N;  4N76 A;  4JI0 K;  4DCH A;  4JI5 K;  4C1N K;  1TKZ A;  3CCE N;  5IWA K;  3VF4 A;  4FJJ A;  4WYB A;  2HBM A;  3R8E A;  3CJ1 A;  4JI6 K;  4N47 A;  3DRP A;  1HQE A;  4JS4 A;  3HRG A;  1GLE G;  4YOX A;  2O8D B;  5BR8 K;  2CGJ A;  4BQL A;  3O9S A;  2I5J A;  1Z26 A;  3HL8 A;  3CM5 A;  3MCA B;  4BE1 A;  4CE9 A;  3CCR N;  2ZWH A;  4DTM A;  3VPZ A;  1RBR A;  1YIT N;  2P9U A;  4DR3 K;  4BRO A;  4JN4 A;  3NH1 A;  1L3V A;  4QOZ B;  3ZT4 A;  3DOL A;  2YHY A;  4FCY A;  4FWQ A;  3QIN A;  3SPZ A;  1JCF A;  4FM1 A;  3MXI A;  1VRT A;  3NF9 A;  3V6D A;  5C0Y A;  4QCL A;  2BE2 A;  4DUY K;  4JK8 A;  5M1Q A;  1O1W A;  3CCQ N;  1CZ9 A;  3NF6 A;  5GIN A;  3QET A;  3ZSO A;  4XH5 A;  4B3O A;  1KVB A;  3QIC A;  2O8C B;  3HVR A;  5H1S Q;  3FZK A;  1L3T A;  3MWT A;  4XIU A;  4CIF A;  2QXF A;  3K5L A;  2VQE K;  4DS5 A;  3HPG A;  4CI6 A;  3K2P A;  3P5J A;  3VTI A;  1WNS A;  5HOO A;  4HUF A;  3IKM A;  4F2S A;  2YX6 A;  4A2A A;  1ZC6 A;  3C6H A;  4ZTF A;  2ZF5 O;  1YJ9 N;  3AY9 A;  3MN5 A;  4WQ5 A;  2O8D A;  5EXW A;  1GOA A;  3AVA A;  2QI2 A;  2A41 A;  4O8K A;  4K8Z A;  4NB4 A;  2RPI A;  3ZSQ A;  3RMA A;  4DTO A;  5JLH A;  4WQ4 A;  3UKR B;  5BN9 A;  4CF0 A;  1SKS A;  5C2F A;  1N32 K;  3GBT A;  3CC7 N;  3AVC A;  4BRK A;  1X9M A;  5BRF A;  3A5L C;  5CZ1 A;  5C24 A;  5KQD A;  3LZI A;  4FJ9 A;  4K42 A;  4KHU A;  3WEE B;  4F9O A;  4Y1D A;  4YOR A;  1P90 A;  2OCE A;  5KRS A;  1RTJ A;  2GV9 A;  2NNW A;  4IO9 L;  4DV6 K;  4DFM A;  2FBT A;  4MLE A;  1XI1 A;  5TKY A;  4CJS A;  2O8C A;  1C0U A;  1ZBF A;  2ZJR L;  4B3R K;  4A57 A;  2E5L K;  4FPB A;  3TI0 A;  3SAF A;  3CXC M;  2YJF A;  1HKG A;  4E0D A;  5LJW A;  4CGI A;  3KLF A;  1V4S A;  1DEJ A;  5CYQ A;  5J2M A;  1B92 A;  3LAN A;  4IJA A;  4KI4 A;  2NRT A;  1XUP O;  1NJW A;  3V1Q A;  4DQP A;  2HHH K;  1NGE A;  4JHD B;  3BUZ B;  4Z4H A;  2QKB A;  1CXQ A;  1S9E A;  4O0J A;  3U9D A;  3MDQ A;  3U8X A;  4CHQ A;  5LY3 A;  2A1S A;  4HTU A;  3UKR A;  2A6A A;  4KH5 A;  4FW2 A;  3C0B A;  1HKC A;  4HVJ A;  1SS6 A;  2FBX A;  5KQ8 A;  3E66 A;  2NLX A;  4FJM A;  4CFB A;  2V7Z A;  4FLZ A;  4KRF A;  3WEE A;  2Q3S A;  2QWN A;  4ISE A;  5D3G A;  4J2D A;  2QK9 A;  4MQ3 A;  4DQS A;  2HNZ A;  3GOI A;  4FL9 A;  3VEV A;  2VGN A;  4BDZ A;  1JLQ A;  4Z4I A;  1XMQ K;  4ILJ A;  3SYZ A;  1SQK A;  2G8U A;  2ZGZ A;  2JLE A;  1IH7 A;  5DMR A;  4K8X A;  4FZX C;  2G8F A;  3VEW A;  4FJH A;  4BWM A;  4FYD A;  4JKF A;  4JKD A;  1TK5 A;  3O3H A;  1BWF O;  5CE3 A;  3SV3 A;  4YFU A;  2Z1J A;  3FZF A;  3A5N C;  3HO1 A;  4BDY A;  4JHD A;  3ATU A;  4DV2 K;  4H0T B;  4H0P A;  3NMU A;  3C65 A;  1EWQ A;  1NK9 A;  2Q97 A;  2OPR A;  4HWI A;  4ISG A;  5CR4 A;  2KFZ A;  1WN7 A;  4YOT A;  2OTL N;  3QB0 A;  4ICL A;  1REV A;  1RDC A;  5BN8 A;  3AGK A;  1NGH A;  3MMV A;  1HYZ A;  4DB3 A;  2FBV A;  4CBU A;  2J4R A;  2CGL A;  2F4V K;  3VQ4 A;  2CH5 A;  3LDP A;  1IKW A;  4IJN A;  1OVY A;  2VG6 A;  2Q0R A;  3D7E O;  3G6E N;  3K59 A;  4MDB A;  4RCH A;  5AQJ A;  5AQS A;  3VEO A;  3AGR A;  4FWS A;  3TWH A;  3S41 A;  4FM0 A;  5FPE A;  1IBK K;  2IOC A;  2D0O A;  1HRH A;  3VEN A;  3N4P A;  3ZSR A;  1EXQ A;  1NNE A;  3QNN A;  3KK7 A;  5C15 A;  1QQM A;  4DR2 K;  1HJR A;  2QWO A;  3MCP A;  2OPQ A;  4CFD A;  3MK6 A;  1XQS C;  2RE2 A;  1A5X A;  3TAN A;  4LF4 K;  1RT2 A;  4JKB A;  3NAE A;  4IDH A;  1VQ6 N;  3L4I A;  3PO5 A;  4Z4E A;  3VMF B;  3S3O A;  3ZEU B;  2PZS A;  3SAH A;  3HYF A;  5DM6 L;  1Q8I A;  4CJT A;  4WFN L;  4CJE A;  4JKC A;  1S1U A;  3LAK A;  4CEB A;  5MLC Q;  2VCP A;  5BRH A;  4DSI A;  2WFB A;  4UY8 O;  5ELZ A;  4ELV A;  1TUU A;  4H0V B;  4B9M A;  3ENB A;  2UUB K;  3HM9 A;  3AVJ A;  3RWU A;  1RBS A;  5CHI A;  3AVN A;  2QM1 A;  5TKW A;  4AHU A;  1TGO A;  4FJI A;  3L2V A;  1C1B A;  1TVR A;  1HUX A;  3K57 A;  3RMD A;  1Z05 A;  3QBW A;  2D1K A;  2HND A;  4CJ5 A;  1BL3 A;  1EQY A;  1KFD A;  1NM1 A;  3TAG A;  3SLC A;  1S1T A;  5AQO A;  2JWL A;  5GAE P;  2GEM A;  3ZET B;  2FSJ A;  4CK2 A;  4B9V A;  4FLY A;  3ULE B;  4CD1 A;  1IV0 A;  3CME N;  3D45 A;  4RTF D;  4CIE A;  2Z1H A;  3LZJ A;  3ZSV A;  1EWR A;  3ZEU A;  3H6E A;  1JLC A;  1BQN A;  3AA5 X;  3THX B;  1W7A A;  4XEI A;  1OH5 A;  3VQC A;  5JIC A;  4XH1 A;  4FJ8 A;  1K9M O;  4HHT A;  1HYV A;  1X1P A;  4K43 A;  1LAV A;  3G25 A;  4EIA A;  4JKG B;  3CJ7 A;  2EX3 A;  5CY4 A;  3PV8 A;  3J8A A;  1WSI A;  4AIL C;  4PHT X;  4YDU A;  5HRS A;  1K8A O;  1VQ8 N;  4DLG A;  3UIQ A;  2HHT A;  1NG9 A;  1BGX T;  3K9K A;  1KC8 O;  3CQ8 A;  3TAP A;  1IKV A;  4CJR A;  2XY5 A;  3VET A;  4KPY A;  3DM2 A;  5DM7 L;  1XWL A;  2AJQ A;  4H0O A;  3ZET A;  3ZT2 A;  1SKW A;  3AV9 A;  3FZH A;  1GLJ O;  3ULE A;  3SQ4 A;  3O4W A;  1MWK A;  3O3F A;  1NKC A;  4NCA A;  3HPH A;  2P9K B;  1KVA A;  2QW9 A;  4B1W B;  1QVG M;  4C8L A;  1ILY A;  3THX A;  1NK6 A;  1QHT A;  1U2V B;  3PX6 A;  3CPE A;  3VOV A;  4DTS A;  3HP9 A;  2OTJ N;  1RT7 A;  3AO3 A;  1NMD A;  3EZW A;  3F73 A;  1NJZ A;  1QVF M;  3Q7B A;  4I6M B;  1ATR A;  2G8I A;  3H08 A;  3E9P A;  2BUP A;  3QO9 A;  3TAR A;  4BRI A;  3QFP A;  3KHY A;  1UA1 A;  2HHQ A;  3ENH A;  3CJA A;  4IWV A;  4JNE A;  2QWQ A;  3O1B A;  2JWK A;  3HK2 A;  3CC4 N;  1SAZ A;  2B6A A;  4LF6 K;  3MEG A;  4JLH A;  4YHH K;  4BG8 A;  2IVO A;  3JSM A;  4KHN A;  2RHK A;  3FZM A;  4O8U A;  3KLE A;  4CD3 A;  5HRO A;  2WON A;  1KLN A;  2G8W A;  3HJF A;  2XY7 A;  4KB1 A;  3QIO A;  1Q18 A;  1KD1 O;  2P9K A;  3OYJ A;  1VQ9 N;  4CF9 A;  1YTA A;  3U3G A;  4C1N I;  4B1X B;  4PKG A;  2HBJ A;  1U2V A;  1SL1 A;  2KW4 A;  5I9E B;  1KRP A;  5AQL A;  4I2Q A;  5J1E A;  5AZJ B;  4B9T A;  2XHB A;  1XC3 A;  4F8R A;  4LF5 K;  1NK0 A;  2Q36 A;  3F9M A;  2QWM A;  4BG9 A;  1VQO N;  3QEV A;  3CD6 N;  2E1Z A;  4LFB K;  4GMJ B;  2E2O A;  4U7B A;  4I6M A;  2VWB A;  3JYT A;  2FLO A;  3V1R A;  5AQH A;  4AM6 A;  3IAY A;  3HI0 A;  4E1N A;  3SBG A;  4M7Y A;  1N33 K;  1JLA A;  3B6P A;  2FC0 A;  2VYP A;  2IVP A;  3OYE A;  3PUF A;  4YY3 K;  3QEP A;  3OTO K;  3SJJ A;  4LC9 B;  4BRC A;  1LW0 A;  4CER A;  1VHX A;  4OX9 K;  4DV4 K;  1T05 A;  1S6P A;  2AP1 A;  4CGG A;  5AFU A;  1BDG A;  3CPW M;  2A42 A;  2Q31 A;  4DQI A;  3O1W A;  2HOE A;  4EP4 A;  4DU3 A;  4BRQ A;  3SUQ A;  1LW2 A;  1K73 O;  4DTU A;  3V1O A;  5JVG L;  1RTI A;  1YVU A;  1BA1 A;  4GW6 A;  1WSG A;  5AZJ A;  1NGA A;  5JLF A;  1X9J A;  3O9Q A;  3C94 A;  4DQQ A;  1JLB A;  4AHS A;  3J7Z O;  1GLC G;  5HLF A;  1XHX A;  3A8Y A;  3BF3 A;  3KKR A;  4EZ6 A;  2G8V A;  4OVL A;  2Q2R A;  5J2N A;  3O4Q A;  4CCH A;  2VWJ A;  3DXK A;  4FWM A;  1BI4 B;  4PQU A;  4B3S K;  4EP5 A;  4KH6 A;  1ATS A;  3VF2 A;  3LL3 A;  3I33 A;  3BEX A;  1XMO K;  3CG7 A;  1HQU A;  5CZ2 A;  4HUE A;  4I9Q A;  1SV5 A;  1NKE A;  4UQG A;  4CEC A;  3DLL L;  1HNX K;  4BVP A;  2OYQ A;  5FRN A;  1FK9 A;  4QS8 A;  5FRM A;  3QLH A;  3TR8 A;  4LD0 A;  1VSK A;  3CIP A;  4G9Z A;  4J2A A;  2ZD1 A;  3AVB A;  2F9T A;  4BC2 A;  3TTF A;  2HF4 A;  4ILG B;  5LL6 Z;  4DTJ A;  2ZQB A;  1RBT A;  4BRM A;  1BU6 O;  2Q1N A;  4DLE A;  3SMS A;  1J54 A;  3DLK A;  1U4B A;  4K0K K;  3LM9 A;  3L2U A;  3ULD A;  4O4G A;  1UOC A;  3V9W A;  1BI4 A;  3VA3 A;  4WFB L;  3THY B;  1VQN N;  1E4F T;  1JCE A;  3TAM A;  3OY9 A;  3SAG A;  2QKK A;  4E7H A;  2QWL A;  5E84 A;  2ZM6 K;  3CFP A;  5FPN A;  1D9F A;  4DFJ A;  2DFH A;  3BF1 A;  2BDP A;  3SUN A;  2WTU A;  4LF9 K;  1C1A A;  4E7K A;  4GKJ K;  1TKD A;  5SZT A;  4NYN A;  4CJQ A;  1HNZ K;  4GV9 A;  4L3Q A;  3EYZ A;  1EKE A;  3DAW A;  1RGI A;  2F8T A;  3RR8 A;  3SQ1 A;  1VSM A;  3EO3 A;  3U9Z A;  3FLC O;  3KZB A;  3QBX A;  4Q0B A;  2W40 A;  3DLE A;  5M1N A;  3SCX A;  1XNQ K;  3MN7 A;  2D0P A;  1WBD A;  2H3G X;  2NRW A;  5GAD P;  2A5X A;  1F21 A;  4DQ8 A;  2EWS A;  1IG8 A;  4PKI A;  1JL2 A;  4CGH A;  3KK1 A;  3LP0 A;  4BR2 A;  1FJG K;  3SV4 A;  4PL8 A;  1VAZ A;  3THY A;  3ZSW A;  3M8R A;  5BR9 A;  4NCB A;  2E6M A;  4H5N A;  4CVN E;  3KLH A;  1U47 A;  2E20 A;  3AVI A;  3CJB A;  3VGK A;  4OPK A;  3T3F A;  1CLQ A;  4X65 K;  1NGG A;  5KPZ A;  3C6A A;  4EHT A;  3AVF A;  4E89 A;  4YOU A;  1VSJ A;  4B1Y B;  1VSI A;  4PL7 A;  3VN5 A;  4I7F A;  4IFY A;  3MXM A;  1N34 K;  1KLM A;  4BRG A;  3IS9 A;  2KHO A;  1TKT A;  4DTX A;  4H5R A;  4W5T A;  3S3M A;  1KQS M;  4N41 A;  4KAZ A;  1SL0 A;  4BR9 A;  5FLX O;  2GX9 A;  4GVM A;  4NO7 A;  1R0A A;  4JKE A;  3KIO A;  4RW9 A;  4DSK A;  4DV5 K;  1B9D A;  4NYF A;  3OYA A;  5AQR A;  1U49 A;  1X9W A;  3K9J A;  1UAX A;  1IJJ A;  5M1K A;  4FWP A;  3VQ5 A;  3QFU A;  3O80 A;  3BY5 A;  3OBW A;  1FW6 A;  3DLB A;  2I7N A;  2O4G A;  3C95 A;  5SWM A;  4B9S A;  3LWM A;  1WBB A;  4FK4 A;  4E3S A;  4W5O A;  2HHU A;  1LWC A;  2G8K A;  4FZZ A;  3CF5 L;  1FKP A;  3KK2 A;  4OLB A;  3MEC A;  4L8R B;  1GLB G;  4AH9 A;  3SQ0 A;  4JKH A;  2HB5 A;  3I55 N;  4OKJ A;  2OZM A;  4CJL A;  1CZB A;  3C6U A;  3PO4 A;  3AVL A;  4V19 S;  1ZXO A;  3LP1 A;  2UXC K;  3OS1 A;  2P51 A;  5C12 A;  3NBP A;  4BQZ A;  1NK7 A;  5M1O A;  1XHZ A;  2DFE A;  1W97 L;  1RDD A;  3B6O A;  1EX4 A;  4LF7 K;  5FRO A;  3CCV N;  4I9L A;  4KHS A;  3NCI A;  4HCB A;  3IUC A;  4A61 A;  1HKB A;  4FJ7 A;  3I56 N;  4H4O A;  1RDB A;  1BHL A;  4U67 L;  2KZM A;  3QER A;  4Z4G A;  1YXQ A;  2E88 A;  5GAG P;  1NJX A;  1K6Y A;  1ZBS A;  1N8R O;  3CI5 A;  1NLV A;  3ID6 A;  2D4W A;  3D2E B;  1N6Q A;  3R1X A;  2O8F B;  3EKU A;  2UUA K;  5K14 A;  4QS7 A;  4B8A B;  3ZX0 A;  2HBK A;  3MN6 A;  1BIZ A;  2V51 B;  4DF4 A;  3L6Q A;  3NE6 A;  4B3T K;  2B4J A;  2KTQ A;  1JLE A;  3TSP A;  4H0X B;  1TK8 A;  4TSX A;  3TAQ A;  1ZBL A;  1T44 A;  4CBW A;  3UE5 A;  3OYK A;  3UB5 A;  1E4G T;  1J5E K;  3MN9 A;  1YTU A;  3O4N A;  3NVK A;  1RTH A;  1Q86 O;  4DTR A;  3V81 A;  2F7T A;  4JK7 A;  1C6V A;  1GLL O;  2QEX N;  3CJ9 A;  3DWL A;  3IMX A;  2ASO A;  1J6Z A;  2E4L A;  4BRF A;  4YNQ A;  1ZBU A;  3U4L A;  1KFS A;  1C0T A;  3FFI A;  2P9I B;  4K25 A;  3T7Z A;  4O55 A;  1Q7Y O;  4MLH A;  1K8K B;  2Z1G A;  3D2E A;  4AM7 A;  2O8F A;  4B9L A;  3AVM A;  3TU5 A;  1DTT A;  1HPM A;  2AA4 A;  1KAY A;  2UU9 K;  4IBN A;  4KTQ A;  1L5U A;  2HHW A;  3J80 O;  1BCO A;  3M5R A;  2IC3 A;  1J53 A;  2XY6 A;  2UXB K;  4KV8 A;  3OJU A;  2HW3 A;  1OH8 A;  1L3U A;  3RSE B;  4MO4 A;  1WSH A;  4DR6 K;  2RKI A;  4DKW A;  2E8A A;  3V9U A;  2WOM A;  3EN9 A;  3CYM A;  3HZ6 A;  2HMP A;  1NKB A;  3L3U A;  4JK9 A;  1ASU A;  2GUI A;  2IVN A;  5KRT A;  2YNG A;  4FVM A;  3ZLJ A;  1MU2 A;  2GEL A; 
#chains in the Genus database with same CATH homology
 4LFA K;  4X65 K;  3T1H K;  4DV3 K;  4LF5 K;  1IBK K;  4LFB K;  5BR8 K;  4LF8 K;  4DR2 K;  2HHH K;  1N34 K;  2VQF K;  2UUA K;  1N33 K;  4LF4 K;  4JYA K;  5LL6 Z;  5A2Q O;  4DUZ K;  4JI8 K;  4DR3 K;  4JI3 K;  4DR5 K;  4B3M K;  4JI2 K;  4K0K K;  5FLX O;  4YY3 K;  4B3T K;  3OTO K;  1HNW K;  1IBM K;  2UXD K;  3J7Y P;  4DV5 K;  4OX9 K;  4JI1 K;  4DUY K;  4DV4 K;  3JAM O;  1N36 K;  4JI4 K;  3J81 O;  4DV0 K;  4X66 K;  5IT9 O;  1J5E K;  2ZM6 K;  1XMQ K;  4NXM K;  2UUB K;  4CW7 B;  2VQE K;  4DV7 K;  4LF9 K;  4GKJ K;  4NXN K;  5AJ3 K;  1HNZ K;  4DR7 K;  4AQY K;  4LFC K;  4DR1 K;  2UUC K;  3J7A P;  4DV2 K;  4KHP K;  1XNR K;  1XNQ K;  4JV5 K;  2UU9 K;  4LF6 K;  4YHH K;  1N32 K;  3J80 O;  4V19 S;  1I94 K;  2UXC K;  4DR4 K;  4X62 K;  4DV1 K;  2UXB K;  4X64 K;  5LMU K;  4B3S K;  4DR6 K;  3T1Y K;  1FJG K;  1IBL K;  4JI0 K;  5LMN K;  4JI5 K;  4LF7 K;  4GKK K;  1XMO K;  2F4V K;  5IWA K;  4DV6 K;  1HR0 K;  4JI7 K;  4JI6 K;  4CVN E;  4B3R K;  1HNX K;  2E5L K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...