4B3RK

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4b3rK00
3JAMO 2F4VK 5IT9O 4YHHK 2UXCK 1XMOK 4LFAK 4DV5K 4LFCK 4LF6K 4DV4K 2ZM6K 4JI6K 4JV5K 4DV3K 5FLXO 4NXMK 4DR2K 4JI1K 5IWAK 1N33K 4DUZK 4DR4K 4DV7K 2UXDK 4OX9K 1N32K 1XMQK 5BR8K 2UU9K 4DV2K 2VQFK 2UUAK 4NXNK 4JI5K 4GKKK 1J5EK 1HNWK 4K0KK 3J7AP 2UXBK 4CW7B 4LF7K 1HNXK 1N36K 4X66K 1N34K 5LMUK 4B3TK 5LL6Z 4JI0K 4V19S 2UUBK 4LF9K 4YY3K 4JI3K 4DR7K 1IBLK 2E5LK 3OTOK 1I94K 4B3MK 1HNZK 2VQEK 1FJGK 4DR5K 4B3RK 1HR0K 4DV1K 4KHPK 3J7YP 3J81O 4X64K 1XNRK 4DUYK 3J80O 3T1YK 4X62K 1IBKK 1IBMK 4DV6K 5LMNK 2HHHK 3T1HK 4JI7K 4JI8K 1XNQK 4DR3K 4X65K 4LF8K 4LFBK 4JYAK 4DR1K 4GKJK 4DR6K 2UUCK 4DV0K 5A2QO 4AQYK 4CVNE 4JI4K 4LF4K 4LF5K 5AJ3K 4JI2K 4B3SK
chains in the Genus database with same CATH superfamily
3E9OA 4J2BA 2FF3B 1JCFA 4KV8A 4CF8A 3R8EA 4J8FA 3AA2A 3BUZB 3E66A 4AHRA 4JK9A 4FXDA 4DTRA 4LF6K 2P9NA 3THYB 4I9QA 1RDWX 1B92A 4QS7A 4AHSA 4HCCA 3S3NA 5TKYA 3ZT3A 3AVNA 4O0JA 1SKRA 3BZKA 4BRGA 4CIGA 3HPHA 1NM1A 3ZYYX 3H6EA 1VRTA 1TL3A 3S3MA 4OX9K 2QWOA 2DFFA 3H08A 1YHQN 5BPMA 4W5QA 1NK4A 1NGEA 4OKKA 4BR5A 2PY5A 4CGDA 1T6CA 2YNFA 4JN4A 3K5OA 1S6QA 3I33A 3LZIA 4DFKA 1TL1A 1LOTB 4RW7A 3HM8A 4CZEA 3O9SA 2WTUA 4KHNA 2EHGA 4FWRA 3WNFA 2VGNA 3ZCMA 5KI6A 4WQ4C 3WNHA 1W2BM 3OTOK 3L2VA 5J2MA 3UKUA 3GE1A 5GIOA 2RHKA 3MEGA 2O8EB 3LL3A 4BDZA 3CPWM 4K43A 2NNWA 3MN7A 1T05A 3AVJA 1VQ4N 3M3ZA 1L5UA 3QDKA 3VF6A 3K57A 3VPZA 4KHQA 3O9UA 3JXUA 4CF9A 3F9MA 1KAYA 5C24A 3U3GA 2JWLA 4FJ5A 3MMVA 4DQQA 3O1BA 1NK0A 1X9SA 3NF9A 4H4OA 4LFBK 4BRKA 3D2EA 2ZF5O 1JLCA 5AQYA 4DV0K 4BDPA 1W97L 4NYFA 3ZSVA 2EWSA 1NWKA 4B08A 3AO5A 3HSCA 2FSKA 1VQ8N 5CY4A 1TKDA 1K9MO 3VGMA 1P8ZA 1NGAA 3ZT4A 1XQSC 4FWPA 4BRAA 1OVYA 1KVCA 3LAKA 3LDPA 4CE9A 4Y1CA 4BRFA 2HF3A 1IKVA 3SBGA 1C0MA 2XY5A 5KGXA 2P9SB 4GMJB 4DSIA 3OYJA 5CR4A 4BRPA 3IKMA 2YJFA 4CJ5A 3THVA 4NLCA 1NJZA 3EE8A 3S9HA 4GNIA 1JKHA 1NGHA 4LF7K 4OPJA 3NBPA 4BG8A 5JVGL 1KSPA 3L4IA 2ZE2A 4ELUA 2B6AA 5LMUK 1JLBA 4ICLA 3CMAN 2A42A 1MWKA 3U3YA 2VGMA 2ZQBA 4DR7K 2YI1A 3PX4A 4ID5A 2E5LK 4BRQA 4DMNA 1DTQA 4DSFA 5AQFA 2CH5A 4O55A 2YJEA 3ZX3A 3QO9A 4DV1K 3UKRA 3VF2A 2F9WA 4X64K 5T7BA 2QWQA 3DXMA 1KLNA 3GOIA 3S3OA 5KRSA 4E1JA 1HYVA 3KVGA 3QBWA 1K8KA 3T1HK 2E2NA 3C7NA 4I6MB 1C1CA 3C7NB 4BDYA 1YVNA 1J53A 5BPLA 4B9TA 4N56A 3BY5A 1YJWN 4JI7K 3M6GA 2QWRA 4FM2A 1NK5A 2W40A 3EKSA 3VGKA 3B8AX 1LV5A 3VF4A 3G10A 3V9ZA 4H5NA 2NRWA 1NGBA 3OYGA 4FZXC 2P9KA 3SUQA 4CJ4A 4AQYK 4JKCA 3R9PA 1HNIA 3SPZA 3CFRA 2YKMA 1YVUA 4WCEL 3E01A 1S72N 1EWQA 3N4PA 3ITHA 1IG8A 3ZT2A 2O8FA 3L6QA 1C0GA 4JHDB 4CJEA 1XI1A 1BWFO 4B9QA 4O0IA 4FK2A 4JKEA 3T3FA 3SJJA 3IDHA 4C8KA 1SS6A 3P83D 3AVLA 3IG1A 4JI6K 1U47A 4B1XB 3DLBA 3LPUA 4Z4IA 4RW4A 1D9DA 3D7EO 1OH6A 3U9DA 2JGUA 4JI1K 1N6QA 4N5SA 1YT3A 2IOCA 3LWLA 1NLVA 3QFUA 5AQIA 4NO7A 3M8SA 2OPPA 4EAHD 1Z25A 4FJLA 4NXNK 4JI5K 3HM9A 4DTUA 2UXBK 4CW7B 1YUWA 4O8KA 2HMPA 1IKXA 3SK3A 2HHXA 2Z1HA 3SNNA 3TI0A 1LW2A 1L3UA 1NNEA 3SI6A 1S5JA 2DTUA 1F21A 2QKKA 3CD6N 2P5OA 1CXUA 1HKBA 3BDPA 1IBLK 4ISGA 4JKGB 3C95A 3MN6A 1KAZA 2PZSA 1J5OA 4BRDA 1JXEA 1FJGK 4ID1A 5J2QA 3SCXA 5C42A 4PWDA 2X6SA 4I2QA 4BRMA 4H0TB 2GV9A 3JSMA 1SL1A 5C12A 2E1YA 4CCHA 2Q3SA 4A2AA 2Q36A 3LAMA 1TK5A 4DTSA 4CJTA 3K58A 4JI8K 4DTMA 2BUPA 2E4LA 2I7PA 3DRPA 5SZTA 2HHQA 2P9PB 4UQGA 4DFPA 3CFPA 4CZHA 5MLCQ 5FPEA 5C15A 5FRMA 4IG3A 5KPZA 4F2RA 4JI2K 4HUEA 3VQ8A 3M8RA 5IT9O 3SUPA 3MEEA 1HYSA 2D0OA 5KTQA 3ZX0A 3TWHA 2V7ZA 3ZSXA 1TK0A 5KRTA 3TARA 1R59O 3ZSRA 1IH7A 4H0YB 1WBDA 4BRIA 5J2NA 2BANA 1WSGA 3PSIA 1C6VA 3CCRN 1VHXA 3HOTA 1RGIA 3O08A 1OVQA 3ZSOA 3W3DA 4A2BA 1UAXA 4KO0A 5IWAK 4K8ZA 4DR4K 1U6ZA 3D0PA 3PLAA 1O1WA 3VEXA 3ZETB 2ZJQL 4DV2K 4C1NI 4EZ6A 4NCGA 3CCLN 1RDCA 3L4QA 4F2SA 1VQON 4DFMA 4M7XA 5E26A 4LSNA 4ELTA 4F3TA 4DB3A 4H0VB 3QESA 5BREA 4Q0BA 4WFAL 4OLBA 3EN9A 3SBTA 4JD2B 4E7JA 2A1SA 1TK8A 4B9MA 2NZTA 4J2AA 2D5RA 1T8EA 2QEXN 1UOCA 4YY3K 1Q9YA 2IDOA 4DSKA 4FJIA 4AHCA 3KJVA 1KVBA 4JLHA 4H0PA 2F8SA 1FKOA 4B3RK 1ITGA 1SV5A 2VWJA 4RW8A 2Z1IA 3MXJA 3RR8A 4CBWA 5CYMA 3DXKB 3VTIA 4CJUA 1IBMK 3NF6A 1W7AA 4JRQA 1S9EA 3ULEA 3VQPA 3G0ZA 3RMDA 4L3QA 3OYMA 1SUQA 4BR9A 1RTDA 3TU5A 2WONA 3THWB 2W41A 3U8XA 1SL0A 3KK2A 2GEMA 3VERA 4FWKA 4IJNA 2B5JA 1NGGA 4BR0A 4DTJA 3LDLA 3QEVA 4H5VA 3H1VX 1KTQA 3QFPA 2IIRA 2QWNA 1YTUA 4GW6A 1RDDA 3CCQN 4BE1A 3HOSA 3K9KA 4ISFA 3KLFA 4B9NA 4JK7A 4M3WA 1QS4A 2GUPA 5BRDA 3SMPA 2ITMA 1XMOK 3PUFA 3CFOA 3B6PA 3V9XA 1I3AA 5AQTA 3SZ2A 1B9FA 1NJYA 4DV4K 3R3LA 3THXA 3TAEA 3TABA 3LP1A 4YOYA 1BHLA 2Z1JA 1DT9A 3PX0A 4CBUA 3ALYA 4OPAA 1QZ5A 2HNDA 1A5VA 1JL2A 2RF2A 3H1QA 4CBXA 4CJKA 4DF4A 4JK8A 4R5PA 5M1QA 3EZWA 1BISA 1ZBLA 4H5RA 1TYQB 1TKTA 2IS3A 1QSYA 4FJ9A 5JS2A 4GV9A 4FOEA 3SJHA 3F9KA 1S1VA 3U9ZA 4K25A 3OS1A 4HWIA 1N36K 4BQLA 4QS9A 4KRFA 3M1FA 2O8DA 3I8BA 2NRZA 2P9IB 2HHSA 2XRIA 3O9RA 3QICA 3AVHA 5C2DA 4M3UA 5BR9A 1BU6O 4CEQA 5KPRA 1RBVA 3AVIA 5GAEP 1BL3A 2HBLA 2E1ZA 4MLHA 3OYKA 1J54A 4FWLA 3F73A 4YFUA 1HNZK 3MX5A 2CGKA 3WQUA 4WQ5C 1BG3A 4IFEA 1HR0K 1JXBA 4E7IA 2G8WA 4CZGA 3V9WA 1WB9A 1JLGA 3KLEA 2HBJA 4G1QA 5EVZA 4DV6K 5LJWA 5LMNK 3VGLA 2X78A 4YDUA 4FK4A 3JS6A 3KK1A 1W0HA 3DYAA 4AHUA 4FJ8A 5AQUA 4BRNA 2GX9A 4GKJK 4BRCA 3WQTA 2FBVA 1X9MA 3ZSYA 5LJVA 2A41A 4W5NA 2PAVA 3OY9A 2QA4N 4FJKA 1IV0A 3IFRA 4OPKA 3E1YA 1D4XA 5C25A 4JKBA 3OA9A 1LCUA 1UA0A 1RT2A 3EKUA 3CC4N 1NK6A 2AA4A 2W42A 4IDHA 1C0TA 3V1OA 1HKGA 2WC9A 4JKFA 1NG9A 1S1XA 3HRGA 5AZJA 3E9PA 2OPSA 3LP0A 3P31A 5DM6L 3ENBA 1EETA 3OYIA 1ZBHA 1TUYA 1WBBA 1U4BA 1KLMA 3ASMA 1ASWA 1JLEA 4DV7K 4XH4A 3PY8A 1VQ7N 1NGDA 1XMQK 3LALA 4FWQA 1NOZA 5HP1A 2DFHA 4DSEA 4ZTFA 1IJJA 2OANA 4CFCA 5AQRA 4GKKK 5BRHA 4LSLA 2EX3A 4B9SA 4FJHA 3RMAA 2KZMA 4H4MA 2IVPA 2HMIA 3CQXA 3CXCM 3THYA 5AQHA 2D1KA 3SQ0A 1A5XA 1KAXA 4BRHA 1Q7YO 4KTQA 3Q7CA 2E2QA 4ILHA 2Q1NA 3LDQA 4DS5A 3HP6A 4Z0UA 2KFZA 1NKBA 3EY1A 4Z4FA 4C8NA 3V9UA 4B3MK 1VSJA 2A3ZA 3KIOA 4RW9A 3P4IA 4CZMA 3P5JA 2A40A 3H45C 3OYCA 1M1KO 4BVPA 1V4SA 3BP8A 4KFBA 2VWBA 4N41A 3VESA 2RPIA 4MO4A 3VEOA 3MX2A 3CCVN 2YNHA 2HBMA 1HMVA 2XY6A 4RCHA 4DFJA 1X3NA 4U67L 4WF9L 2QKBA 3KHYA 4X65K 1S6PA 4DHYA 3CM5A 4L8RB 2CGJA 3QMLA 1CZBA 3GL1A 4AH9A 3NH2A 2NRVA 2D4WA 3NF8A 1FXXA 4CK2A 4DR6K 4CHQA 2O8EA 3KWGA 3BF3A 4C23A 3WNEA 3MEDA 4CZFA 2KHOA 4FJNA 2QWMA 1C1AA 3ATVA 3A5OC 3AV9A 5CZ1A 4CEFA 1KFSA 1O13A 4J2DA 3SUNA 3ZLJA 3F2KA 1TKZA 4FW1A 5DMRA 1WUAA 1YI2N 3PV8A 3HPGA 4DLEA 1S22A 2YHAA 4PL8A 4A61A 5E41A 3U6FA 2ZM6K 1QSLA 4GY2B 3GDQA 4WYBA 1HLUA 2ZGYA 4LH5A 1NK9A 1NJIO 2P9LB 3AO2A 3V9SA 4OGEA 1ZBIA 4IZ9A 5M1NA 4QCLA 1RTIA 3AVCA 3PSFA 3ZSZA 1U2VA 4PA1A 1U2VB 5GAHP 1Q18A 2VQFK 2O4IA 3WT0A 1GLDG 2D0PA 1JJ2M 4DKWA 3HK2A 1Z6RA 1TKXA 1EQYA 4AHTA 1OH5A 1BI4B 1HNXK 1BOTO 1GLJO 1VSMA 5AQKA 3QETA 3WXJA 4M3RA 3CYMA 1E4GT 3K5LA 4Z4HA 1DTTA 2NRRA 4JS5A 3QERA 1FKPA 2P9SA 4NYNA 4PQUA 4JKDA 2P9UA 2P9UB 1IKWA 4AILC 4FLVA 1NJWA 2V51B 2VQEK 3NCIA 2YCHA 3HTVA 4DG1A 1S9GA 1VQKN 3OJSA 3O4QA 3KKRA 4DLGA 4DSLA 1J6ZA 4CHPA 3IMXA 4ZHRA 5K14A 4EP5A 3LANA 2HHHK 2I5JA 4FLXA 1VSIA 1Q86O 4DTPA 3ZSWA 3A8YA 4CERA 5HOOA 3LPTA 4LF8K 1VSLA 4FJ7A 4CEOA 3SPYA 4FPBA 3OBWA 4I7FA 5A2QO 2F96A 4DSJA 3O9TA 2VG7A 1NGFA 1GOBA 4JI4K 4YOVA 1XHZA 4IEIA 2CH6A 2HHVA 3NGYA 4B3SK 1B9DA 3R1XA 1ASVA 3EL2A 4I6MA 3S41A 5B8HA 4FWMA 2WUSA 3DAWA 5E84A 1L3SA 4YORA 4Y0WA 3NMUA 3Q7BA 5HLFA 1MWMA 1X3MA 3VOVA 1QHTA 1BIZA 2OYQA 4FWNA 5HL7L 5JMVA 3AAQA 2PYLA 4I9LA 1NOYA 4PHTX 1VQ6N 2NUBA 1N33K 2D0AA 5GINA 2NLXA 1U45A 1ZYQA 3WEEB 4JHDA 4CFAA 4XIUA 3L0QA 2UYTA 1RDUA 3OS2A 3DOKA 3OVNA 5F0XA 2A5XA 2YHYA 5KQDA 1J5EK 1E4FT 3DJCA 4CGGA 4FZZA 4KAZA 5M1OA 2XO7A 3SQ4A 4KH5A 4F8RA 2QWLA 3CCMN 1RT6A 4A5BA 1IO2A 3AGKA 1TAQA 5AQMA 3TSUA 4FLWA 3IAYA 1QQMA 1X9WA 4YOTA 3TTDA 5TKWA 1BQNA 1ZBSA 1RT4A 3HSTB 3CJ7A 1ESVA 4HCBA 3HVRA 3ENHA 3AVGA 3CJBA 3DLKA 2G8FA 4KREA 4OJRA 4M7YA 4KBOA 4X62K 1WSEA 5H1SQ 1NGCA 3ENOA 2HW3A 5F1XA 1QQOA 4G9ZA 2BH1A 2W6LA 4JKGA 4NCBA 4PKIA 2GUIA 1S1TA 2QXLA 3C65A 3P38A 1NK8A 1KCFA 3OYFA 3T69A 4LF5K 3FZHA 4E7HA 2KZZA 3ZT1A 4O5BA 5EX5A 1SL2A 3I8DA 4IDKA 1SZ2A 3EYZA 4LFAK 4IEEA 1HJRA 4YOXA 2CGLA 2ZGZA 1LW0A 2FSJA 4BY9C 1NMDA 4BE0A 4BREA 1Z05A 3C6AA 4DQSA 3L8BA 4CJQA 2P9PA 3ZX2A 4W5TA 1U04A 3F5TA 2AP1A 2IVNA 3DMJA 2G8VA 4YOWA 1RT1A 4B8AB 2DFEA 2Q0UA 1MU2A 4DUZK 3O5BA 3DLLL 4WQ4A 5HBMA 4PKHA 2XY7A 3CCUN 3WXIA 4ELVA 4E19A 5CHIA 4BC5A 5AQJA 3O6WA 4DTXA 3PX6A 1RBTA 4X66K 2OTLN 3IS9A 3SAGA 2OPQA 2DPNA 2XHBA 1ZXOA 3NF7A 4NLBA 1VQMN 1RBUA 3HZ6A 2E88A 1C1BA 2GBZA 2HNYA 4B3OA 3ZETA 3NE6A 3AO1A 1HYZA 4M45A 1WSJA 3WXMB 3FFKB 2YHWA 4KI4A 4B1YB 4H5WA 1VSKA 4XH1A 4MDAA 3HT3A 3CQ8A 4DUYK 4FL9A 1MA9B 3KK3A 3CJ9A 3HJFA 1CXQA 1OH7A 3E9LA 4JD2A 2J4RA 2WOMA 3FLCO 4UY8O 4PL7A 1VSEA 1SKSA 4F3OA 2E20A 1LAVA 4CD1A 4OKJA 1RDAA 2FBYA 1ZBFA 3ZEUB 4DF8A 4JKHA 3CJAA 1SAZA 3I55N 3ZT0A 3MECA 3V6DA 3M8QA 3AVAA 3MCAB 3CIPA 4F9OA 1QZ6A 3DXKA 4RW6A 3AARA 4GVMA 3AA4A 2HB5A 3H46O 2JLEA 1Q81O 4CECA 2Q97A 1Y97A 4FVUA 2KLAA 1NKEA 5HRSA 3TAGA 5AZIB 3TTFA 2E2OA 5F2RA 1EO1A 4LFCK 3THWA 5M1PA 4BWJA 4CJWA 3RRHA 3IRXA 3L2QA 3TAFA 3LDOA 3CI5A 2QXFA 1YIJN 3AA5X 3RSEB 3OYDA 1T7PA 5AQPA 4FLZA 4B9VA 2H3GX 2VWKA 1WSHA 3DWLA 5GAGP 2G8HA 2IAJA 1EXQA 3FZFA 1D9FA 3NFAA 3CF5L 4FWOA 1YTAA 5I42A 2E8AA 3NH1A 3LDSA 4DS4A 4OO1J 2RN2A 4KHYA 1EWRA 1ILYA 4CJ3A 2YHBA 4BGAA 5J1EA 3MXMA 4CD3A 2P1JA 1TVRA 2KW4A 3L2WA 4Y1DA 5EXWA 2QTDA 1HRHA 4JI3K 1KRPA 3HL8A 1TYQA 2Y1JA 4KB0A 1RTHA 4GVEA 3C94A 5AQZA 1S1UA 4DR5K 1UA1A 5C0YA 1EP4A 4HVJA 4LD0A 4BGBA 3OW2M 1Q9XA 4BR2A 2G8UA 4QS8A 4CEAA 3HXMA 3J80O 3MAQA 5J2PA 3AA3A 2P9IA 2QM1A 3M5RA 4AM6A 1R0AA 4KHUA 3LM2A 1JLQA 4FCYA 4FZYA 1GOAA 2YNIA 3G6EN 4C8OA 5M1KA 1QVFM 1VSFA 2ETJA 3OYBA 5AQNA 3TR8A 3AO4A 3T7ZA 1H1VA 2OZSA 3DRRA 1ATNA 4KKOA 3VQ6A 1BUPA 2Q0RA 1K73O 1N8RO 3L3VA 4YHHK 1NK7A 4CHYA 4KI6A 3VQBA 4E1NA 3D45A 4A62A 4FLTA 1Z26A 4DU1A 2KKZA 1N5YA 4H5TA 5KPTA 1WOQA 1BCOA 5BPNA 2KQ2A 5HRPA 1KQSM 2HNZA 2QI2A 3VQAA 3MN9A 3O4NA 3O3HA 4JS4A 4AM7A 2OCEA 4E7KA 3DLRA 4DV3K 5DK5A 3V81A 4B1UB 2FF6A 4BVOA 3VQCA 3SLCA 4NCAA 1G99A 4BWMA 5KQ8A 5BN8A 1K8AO 2O4GA 1NGIA 4CEEA 3KD5E 4RG8A 4KHSA 2HVHA 3PIPL 1T6DA 3DLHA 3LP3A 4K0KK 1Y64A 4IG0A 2KFNA 4CK1A 4IO9L 3FZMA 5AQXA 1WAJA 2YKNA 1U48A 1VSDA 3SV3A 1BDGA 3OYNA 4QAGA 5CZ2A 3L2RA 3K5MA 2YHXA 4DTNA 4M63C 1TV6A 3MWPA 3O3FA 3KLGA 3CCJN 3QLHA 4CJSA 1M90O 4K8XA 2O8CB 4DWIA 4IFYA 3VEYA 3SV4A 2OZMA 3MXIA 1LAWA 4FM1A 1VQLN 4CFBA 4BR7A 3K59A 4JKAA 3MN5A 5HRRA 4CJ7A 1V4TA 3O3GA 1X1PA 1XNRK 4H03B 1RT5A 3VQEA 2NRHA 5ELZA 2ASOA 4FJJA 4B9LA 3TAQA 2F7TA 4DQ8A 3NGZA 2E6MA 4H0XB 3VQDA 3O80A 4AHVA 3LM9A 1FK9A 4JEPA 4KTZA 3RRGA 4JYAK 1JL1A 5BN9A 5AFUH 2G8IA 2IC3A 2P9NB 5D3GA 2UUCK 2YV0X 1I39A 4M3XA 3EZ5A 5AJ3K 1YITN 4DTOA 1QSSA 2F9TA 3JAMO 1XWLA 2F4VK 3R6MA 3RMBA 4CEDA 1NJXA 1W9HA 4Z4GA 2FSNA 2AJQA 2YNGA 1E3MA 1KXPA 4MQ3A 3O9QA 5AR0A 1QQCA 4HUFA 3JYTA 1L3VA 3VEWA 1D5AA 1T3VA 1ATSA 4DQRA 4NXMK 3DLEA 4H8KA 3VTHA 3H3NO 4FWSA 3HYFA 3AVFA 2X6NA 3RWUA 1EKEA 4N76A 4E1MA 3VEVA 3WXLA 4CZJA 4W5OA 1EX4A 3UKUB 3CM6A 1RILA 2QW9A 3BZCA 4EFHA 3SAFA 1TAUA 3A2FA 3TAPA 3J7AP 5BRFA 4LY7A 3ID8A 2Q2RA 1NGJA 5EU7A 5GIPA 4Z94A 3QEWA 1VAZA 2P9LA 4IOXA 3DM2A 2I7NA 5LL6Z 5FPNA 4V19S 1JCEA 4FSVA 3MK6A 4CJRA 3QEXA 1LWCA 4KTWA 1DGKN 1I94K 1YAGA 3D2EB 5AQWA 1U49A 3CETA 2HF4A 4IWVA 4JAXA 3DOLA 1ATRA 3G4SN 4KHPK 1YXQA 4MDBA 1BI4A 3H3OB 4CF0A 4CJLA 3VQ9A 3CC7N 4U7BA 5AFUA 5I3UA 4IOAL 4EHUA 3I0SA 2W6KA 1RDBA 5HROA 3LWMA 4ILGB 5EOYA 3QINA 1HX1A 3FZKA 2Y1IA 4YNQA 1YJ9N 4ILJA 4GV3A 3OS0A 4CGIA 1RBRA 3A5MC 4CIFA 1RFQA 1HPMA 1QE1A 4HTLA 4CVNE 3FGUA 1BA1A 2P51A 2A6AA 4O4GA 1BQMA 1XUPO 5C2FA 1VK0A 4DV5K 1HKCA 4DU3A 1KD1O 5KGWA 1K6YA 3K2PA 3SUOA 5FPDA 1CZAN 2ZJPL 2E2PA 2OPRA 4B1VA 2VG5A 3G71N 3MCPA 2UXDK 1JLFA 3LZJA 3VA3A 4YOUA 2WBNA 3OBYA 4FOIA 4KB1A 5BR8K 2HVIA 4QOZB 4I2PA 5DM7L 2UUAK 5AQSA 4MLEA 4MO5A 4Z4EA 3C0BA 1P90A 4WQ5A 3I0RA 3QNNA 4IXCA 3UKRB 4FM0A 3J7ZO 3QB0A 5FROA 4O5FA 3DXMB 1RTJA 3O1WA 4FJGA 3AY9A 1K8KB 3MDQA 1HNVA 4CZIA 2R7YA 4WFNL 4E3SA 2FLOA 5JICA 3WEEA 3CCSN 3NDKA 3OHRA 5M1FA 5FDLA 4BC3A 1KC8O 1SKWA 4DQPA 2HHUA 5JS1A 2P9KB 2IVOA 1YJNN 3PO5A 4IFVA 1BGXT 1NBWA 3AGRA 3G25A 3VQ5A 4CHNA 1T44A 1REVA 3KTQA 2O8FB 4EIAA 4WFBL 3CQYA 3PO4A 3KK7A 1DLOA 1XNQK 3CJ1A 3GG4A 3SAHA 4CK3A 3KKSA 1XC3A 4PY5A 1VRUA 2LSNA 3CJCA 4O8UA 4LF4K 1DEJA 1J9AA 1L3TA 3CERA 2PYJA 1TGOA 2UXCK 3V1QA 1WAFA 2VG6A 3ZSQA 4BQZA 3MWTA 2QK9A 2PFUA 3M8PA 3NVKA 3J8AA 3QBXA 4YDUC 2NRXA 3VQ4A 4H0OA 3AVBA 4M42A 1LWEA 2A1RA 3A5NC 4C8LA 3UE5A 1IG9A 1GLFO 3EO3A 4FJXA 1IKYA 3C6HA 4DR2K 4FW2A 1GLLO 4RTFD 2FBXA 1DKGD 5I9EB 1BA0A 3ID6A 4WE1A 3DLGA 4JRPA 3KLIA 1HJOA 3LP2A 3BEXA 4NB4A 3QNOA 1HNWK 3B6OA 1HPZA 4N47A 3VQ7A 4CIEA 5AQOA 2FC0A 1Q82O 1OH8A 4BRLA 1WNSA 4A57A 4DQIA 3VQQA 1C0UA 1XC9A 4B3TK 3VEZA 3HPOA 1TUUA 2X74A 4FK0A 4M3YA 3CMEN 3ATUA 3N4QA 1S3XA 3HBTA 1GOCA 3FE1A 4K41A 3K5NA 3D6RA 4LC9B 1OKJA 1VQ5N 5EY4A 4BC4A 3OYHA 1BIUA 3J81O 1QHAA 3P1GA 1T03A 3UB5A 4RWTA 3T1YK 3P39A 4DCHA 2OA8A 1NKCA 3HVTA 1JLAA 2ZWHA 1CZ9A 4LH4A 3V4IA 1GLCG 3WXKA 4CHOA 3L2UA 4BROA 2HSTA 3CG7A 4C8MA 1QTMA 4CFDA 3O4WA 1JCGA 4DR1K 2IGIA 3TANA 2P5GA 2RKIA 1ZBUA 4OLAA 4O44A 3KLHA 3OYLA 1D8YA 4R79A 3IUCA 4K42A 3K0SA 4FPAA 4OKEA 3SQ2A 2V7YA 3AVMA 1GLAG 4CGJA 3ISNC 3VMFB 3SQ1A 1ZC6A 4J2EA 4BACA 2ASMA 3ZEUA 5CE3A 1GLEG 3VA0A 2ITGA 5AQVA 2ASPA 3QIPA 2ATQA 4FLYA 4F4KA 4JV5K 4OPHA 1RT7A 3QEIA 4BR4A 1CLQA 5FLXO 4A59A 1NMNA 3BGRA 4IO8A 4FVMA 1Q8IA 4OVLA 3BF1A 2HHWA 3VN5A 1VQNN 1N32K 4M3ZA 3NAEA 2UU9K 5AZIA 1GLBG 3T1AA 4CGHA 3C6TA 4EHTA 3NGIA 5AQQA 2B4JA 2Z1GA 3C6UA 3FZLA 4ZTJA 5JVHL 2RE2A 1ASUA 2ZJRL 3RTVA 3K9JA 3RSEA 4IJAA 3TSQA 3OYEA 4CF2A 1RBSA 4HHTA 1LWFA 4B9UA 3W0LA 3PIOL 2OTJN 3ULEB 4CI6A 4LF9K 4BG9A 4CESA 1X9JA 5JLFA 4BE2A 1VQ9N 3KWIA 3NVMA 3HI0A 3TSPA 5ADXH 4XEIA 5CYQA 2WFBA 3LDNA 4CZLA 4KH6A 5SWMA 3A5LC 1UWBA 1IBKK 1YF5L 4CGFA 3SMSA 3EEQA 3WUHA 3CCEN 3RR7A 3KD1E 4FLUA 2VYPA 4IBNA 1MDUB 4A5AA 3DRSA 4HTUA 4CEBA 4CJFA 4Z4CA 4B1WB 5FPMA 3TPQA 3CHWA 3THXB 2FXUA 2JWKA 5JLHA 3DI6A 4C1NK 3CC2N 3NH0A 1XHXA 4Q5VA 2Q31A 2O8BA 2O8BB 1NU0A 4AF1A 4TSXA 2F8TA 3VETA 1RNHA 4KH4A 3FFIA 4W5RA 3RMCA 1QVGM 4CEZA 3QEPA 2PBDA 5LY3A 4HUGA 3QIOA 3GBTA 2HBKA 4CJPA 2BGGA 4FYDA 2NRTA 4PUOA 3FR0A 4EZ9A 2O8DB 3OYAA 1A5WA 1RT3A 2GWJA 2G8KA 4XH5A 1QQNA 4ISEA 4KHWA 1VSHA 1VQPN 2XY8A 5AQLA 2FBTA 3U4LA 4CJVA 2GWKA 4BC2A 4M3TA 4PKGA 4B1ZA 1WLJA 2QWPA 2D0BA 3AVKA 1WSFA 4MFBA 3O8MA 3T19A 4FO0A 3SYZA 4E7LA 2VCPA 2KTQA 4CF1A 2HOEA 3OJUA 5ADXA 1N34K 3V1RA 4IOCL 1S1WA 1HQUA 2GTDA 4CHZA 2BDPA 3TAMA 3WNGA 3UIQA 3HP9A 4GV6A 1RCHA 1BO5O 4JI0K 2UUBK 1FW6A 5FRNA 3NHGA 4M41A 1WSIA 4FJMA 2E6LA 3AO3A 3EE9A 4OGCA 3J7YP 2GELA 2YX6A 3A0IX 3D2FA 4E0DA 3HO1A 3D2FB 2DY4A 1KVAA 2D0CA 1BCMA 1HQEA 3L3UA 3I56N 1SQKA 1HUXA 3ULDA 5AQGA 4IKFA 2V52B 4CZKA 3VENA 2HHTA 1G15A 2BTFA 2O8CA 3RVCA 4B8CA 4E89A 4DR3K 3TTCA 3KZBA 4JNEA 4KPYA 2ZD1A 3CPEA 5AZJB 1C0FA 1KFDA 2BE2A 3AAPA 4EP4A 5HRNA 1WN7A 5C10A 5GADP 4DU4A
chains in the Genus database with same CATH topology
3JAMO 2F4VK 5IT9O 4YHHK 2UXCK 1XMOK 4LFAK 4DV5K 4LFCK 4LF6K 4DV4K 2ZM6K 4JI6K 4JV5K 4DV3K 5FLXO 4NXMK 4DR2K 4JI1K 5IWAK 1N33K 4DUZK 4DR4K 4DV7K 2UXDK 4OX9K 1N32K 1XMQK 5BR8K 2UU9K 4DV2K 2VQFK 2UUAK 4NXNK 4JI5K 4GKKK 1J5EK 1HNWK 4K0KK 3J7AP 2UXBK 4CW7B 4LF7K 1HNXK 1N36K 4X66K 1N34K 5LMUK 4B3TK 5LL6Z 4JI0K 4V19S 2UUBK 4LF9K 4YY3K 4JI3K 4DR7K 1IBLK 2E5LK 3OTOK 1I94K 4B3MK 1HNZK 2VQEK 1FJGK 4DR5K 4B3RK 1HR0K 4DV1K 4KHPK 3J7YP 3J81O 4X64K 1XNRK 4DUYK 3J80O 3T1YK 4X62K 1IBKK 1IBMK 4DV6K 5LMNK 2HHHK 3T1HK 4JI7K 4JI8K 1XNQK 4DR3K 4X65K 4LF8K 4LFBK 4JYAK 4DR1K 4GKJK 4DR6K 2UUCK 4DV0K 5A2QO 4AQYK 4CVNE 4JI4K 4LF4K 4LF5K 5AJ3K 4JI2K 4B3SK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM O;  2F4V K;  5IT9 O;  4YHH K;  2UXC K;  1XMO K;  4LFA K;  4DV5 K;  4LFC K;  4LF6 K;  4DV4 K;  2ZM6 K;  4JI6 K;  4JV5 K;  4DV3 K;  5FLX O;  4NXM K;  4DR2 K;  4JI1 K;  5IWA K;  1N33 K;  4DUZ K;  4DR4 K;  4DV7 K;  2UXD K;  4OX9 K;  1N32 K;  1XMQ K;  5BR8 K;  2UU9 K;  4DV2 K;  2VQF K;  2UUA K;  4NXN K;  4JI5 K;  4GKK K;  1J5E K;  1HNW K;  4K0K K;  3J7A P;  2UXB K;  4CW7 B;  4LF7 K;  1HNX K;  1N36 K;  4X66 K;  1N34 K;  5LMU K;  4B3T K;  5LL6 Z;  4JI0 K;  4V19 S;  2UUB K;  4LF9 K;  4YY3 K;  4JI3 K;  4DR7 K;  1IBL K;  2E5L K;  3OTO K;  1I94 K;  4B3M K;  1HNZ K;  2VQE K;  1FJG K;  4DR5 K;  4B3R K;  1HR0 K;  4DV1 K;  4KHP K;  3J7Y P;  3J81 O;  4X64 K;  1XNR K;  4DUY K;  3J80 O;  3T1Y K;  4X62 K;  1IBK K;  1IBM K;  4DV6 K;  5LMN K;  2HHH K;  3T1H K;  4JI7 K;  4JI8 K;  1XNQ K;  4DR3 K;  4X65 K;  4LF8 K;  4LFB K;  4JYA K;  4DR1 K;  4GKJ K;  4DR6 K;  2UUC K;  4DV0 K;  5A2Q O;  4AQY K;  4CVN E;  4JI4 K;  4LF4 K;  4LF5 K;  5AJ3 K;  4JI2 K;  4B3S K; 
#chains in the Genus database with same CATH topology
 3E9O A;  4J2B A;  2FF3 B;  1JCF A;  4KV8 A;  4CF8 A;  3R8E A;  4J8F A;  3AA2 A;  3BUZ B;  3E66 A;  4AHR A;  4JK9 A;  4FXD A;  4DTR A;  4LF6 K;  2P9N A;  3THY B;  4I9Q A;  1RDW X;  1B92 A;  4QS7 A;  4AHS A;  4HCC A;  3S3N A;  5TKY A;  3ZT3 A;  3AVN A;  4O0J A;  1SKR A;  3BZK A;  4BRG A;  4CIG A;  3HPH A;  1NM1 A;  3ZYY X;  3H6E A;  1VRT A;  1TL3 A;  3S3M A;  4OX9 K;  2QWO A;  2DFF A;  3H08 A;  1YHQ N;  5BPM A;  4W5Q A;  1NK4 A;  1NGE A;  4OKK A;  4BR5 A;  2PY5 A;  4CGD A;  1T6C A;  2YNF A;  4JN4 A;  3K5O A;  1S6Q A;  3I33 A;  3LZI A;  4DFK A;  1TL1 A;  1LOT B;  4RW7 A;  3HM8 A;  4CZE A;  3O9S A;  2WTU A;  4KHN A;  2EHG A;  4FWR A;  3WNF A;  2VGN A;  3ZCM A;  5KI6 A;  4WQ4 C;  3WNH A;  1W2B M;  3OTO K;  3L2V A;  5J2M A;  3UKU A;  3GE1 A;  5GIO A;  2RHK A;  3MEG A;  2O8E B;  3LL3 A;  4BDZ A;  3CPW M;  4K43 A;  2NNW A;  3MN7 A;  1T05 A;  3AVJ A;  1VQ4 N;  3M3Z A;  1L5U A;  3QDK A;  3VF6 A;  3K57 A;  3VPZ A;  4KHQ A;  3O9U A;  3JXU A;  4CF9 A;  3F9M A;  1KAY A;  5C24 A;  3U3G A;  2JWL A;  4FJ5 A;  3MMV A;  4DQQ A;  3O1B A;  1NK0 A;  1X9S A;  3NF9 A;  4H4O A;  4LFB K;  4BRK A;  3D2E A;  2ZF5 O;  1JLC A;  5AQY A;  4DV0 K;  4BDP A;  1W97 L;  4NYF A;  3ZSV A;  2EWS A;  1NWK A;  4B08 A;  3AO5 A;  3HSC A;  2FSK A;  1VQ8 N;  5CY4 A;  1TKD A;  1K9M O;  3VGM A;  1P8Z A;  1NGA A;  3ZT4 A;  1XQS C;  4FWP A;  4BRA A;  1OVY A;  1KVC A;  3LAK A;  3LDP A;  4CE9 A;  4Y1C A;  4BRF A;  2HF3 A;  1IKV A;  3SBG A;  1C0M A;  2XY5 A;  5KGX A;  2P9S B;  4GMJ B;  4DSI A;  3OYJ A;  5CR4 A;  4BRP A;  3IKM A;  2YJF A;  4CJ5 A;  3THV A;  4NLC A;  1NJZ A;  3EE8 A;  3S9H A;  4GNI A;  1JKH A;  1NGH A;  4LF7 K;  4OPJ A;  3NBP A;  4BG8 A;  5JVG L;  1KSP A;  3L4I A;  2ZE2 A;  4ELU A;  2B6A A;  5LMU K;  1JLB A;  4ICL A;  3CMA N;  2A42 A;  1MWK A;  3U3Y A;  2VGM A;  2ZQB A;  4DR7 K;  2YI1 A;  3PX4 A;  4ID5 A;  2E5L K;  4BRQ A;  4DMN A;  1DTQ A;  4DSF A;  5AQF A;  2CH5 A;  4O55 A;  2YJE A;  3ZX3 A;  3QO9 A;  4DV1 K;  3UKR A;  3VF2 A;  2F9W A;  4X64 K;  5T7B A;  2QWQ A;  3DXM A;  1KLN A;  3GOI A;  3S3O A;  5KRS A;  4E1J A;  1HYV A;  3KVG A;  3QBW A;  1K8K A;  3T1H K;  2E2N A;  3C7N A;  4I6M B;  1C1C A;  3C7N B;  4BDY A;  1YVN A;  1J53 A;  5BPL A;  4B9T A;  4N56 A;  3BY5 A;  1YJW N;  4JI7 K;  3M6G A;  2QWR A;  4FM2 A;  1NK5 A;  2W40 A;  3EKS A;  3VGK A;  3B8A X;  1LV5 A;  3VF4 A;  3G10 A;  3V9Z A;  4H5N A;  2NRW A;  1NGB A;  3OYG A;  4FZX C;  2P9K A;  3SUQ A;  4CJ4 A;  4AQY K;  4JKC A;  3R9P A;  1HNI A;  3SPZ A;  3CFR A;  2YKM A;  1YVU A;  4WCE L;  3E01 A;  1S72 N;  1EWQ A;  3N4P A;  3ITH A;  1IG8 A;  3ZT2 A;  2O8F A;  3L6Q A;  1C0G A;  4JHD B;  4CJE A;  1XI1 A;  1BWF O;  4B9Q A;  4O0I A;  4FK2 A;  4JKE A;  3T3F A;  3SJJ A;  3IDH A;  4C8K A;  1SS6 A;  3P83 D;  3AVL A;  3IG1 A;  4JI6 K;  1U47 A;  4B1X B;  3DLB A;  3LPU A;  4Z4I A;  4RW4 A;  1D9D A;  3D7E O;  1OH6 A;  3U9D A;  2JGU A;  4JI1 K;  1N6Q A;  4N5S A;  1YT3 A;  2IOC A;  3LWL A;  1NLV A;  3QFU A;  5AQI A;  4NO7 A;  3M8S A;  2OPP A;  4EAH D;  1Z25 A;  4FJL A;  4NXN K;  4JI5 K;  3HM9 A;  4DTU A;  2UXB K;  4CW7 B;  1YUW A;  4O8K A;  2HMP A;  1IKX A;  3SK3 A;  2HHX A;  2Z1H A;  3SNN A;  3TI0 A;  1LW2 A;  1L3U A;  1NNE A;  3SI6 A;  1S5J A;  2DTU A;  1F21 A;  2QKK A;  3CD6 N;  2P5O A;  1CXU A;  1HKB A;  3BDP A;  1IBL K;  4ISG A;  4JKG B;  3C95 A;  3MN6 A;  1KAZ A;  2PZS A;  1J5O A;  4BRD A;  1JXE A;  1FJG K;  4ID1 A;  5J2Q A;  3SCX A;  5C42 A;  4PWD A;  2X6S A;  4I2Q A;  4BRM A;  4H0T B;  2GV9 A;  3JSM A;  1SL1 A;  5C12 A;  2E1Y A;  4CCH A;  2Q3S A;  4A2A A;  2Q36 A;  3LAM A;  1TK5 A;  4DTS A;  4CJT A;  3K58 A;  4JI8 K;  4DTM A;  2BUP A;  2E4L A;  2I7P A;  3DRP A;  5SZT A;  2HHQ A;  2P9P B;  4UQG A;  4DFP A;  3CFP A;  4CZH A;  5MLC Q;  5FPE A;  5C15 A;  5FRM A;  4IG3 A;  5KPZ A;  4F2R A;  4JI2 K;  4HUE A;  3VQ8 A;  3M8R A;  5IT9 O;  3SUP A;  3MEE A;  1HYS A;  2D0O A;  5KTQ A;  3ZX0 A;  3TWH A;  2V7Z A;  3ZSX A;  1TK0 A;  5KRT A;  3TAR A;  1R59 O;  3ZSR A;  1IH7 A;  4H0Y B;  1WBD A;  4BRI A;  5J2N A;  2BAN A;  1WSG A;  3PSI A;  1C6V A;  3CCR N;  1VHX A;  3HOT A;  1RGI A;  3O08 A;  1OVQ A;  3ZSO A;  3W3D A;  4A2B A;  1UAX A;  4KO0 A;  5IWA K;  4K8Z A;  4DR4 K;  1U6Z A;  3D0P A;  3PLA A;  1O1W A;  3VEX A;  3ZET B;  2ZJQ L;  4DV2 K;  4C1N I;  4EZ6 A;  4NCG A;  3CCL N;  1RDC A;  3L4Q A;  4F2S A;  1VQO N;  4DFM A;  4M7X A;  5E26 A;  4LSN A;  4ELT A;  4F3T A;  4DB3 A;  4H0V B;  3QES A;  5BRE A;  4Q0B A;  4WFA L;  4OLB A;  3EN9 A;  3SBT A;  4JD2 B;  4E7J A;  2A1S A;  1TK8 A;  4B9M A;  2NZT A;  4J2A A;  2D5R A;  1T8E A;  2QEX N;  1UOC A;  4YY3 K;  1Q9Y A;  2IDO A;  4DSK A;  4FJI A;  4AHC A;  3KJV A;  1KVB A;  4JLH A;  4H0P A;  2F8S A;  1FKO A;  4B3R K;  1ITG A;  1SV5 A;  2VWJ A;  4RW8 A;  2Z1I A;  3MXJ A;  3RR8 A;  4CBW A;  5CYM A;  3DXK B;  3VTI A;  4CJU A;  1IBM K;  3NF6 A;  1W7A A;  4JRQ A;  1S9E A;  3ULE A;  3VQP A;  3G0Z A;  3RMD A;  4L3Q A;  3OYM A;  1SUQ A;  4BR9 A;  1RTD A;  3TU5 A;  2WON A;  3THW B;  2W41 A;  3U8X A;  1SL0 A;  3KK2 A;  2GEM A;  3VER A;  4FWK A;  4IJN A;  2B5J A;  1NGG A;  4BR0 A;  4DTJ A;  3LDL A;  3QEV A;  4H5V A;  3H1V X;  1KTQ A;  3QFP A;  2IIR A;  2QWN A;  1YTU A;  4GW6 A;  1RDD A;  3CCQ N;  4BE1 A;  3HOS A;  3K9K A;  4ISF A;  3KLF A;  4B9N A;  4JK7 A;  4M3W A;  1QS4 A;  2GUP A;  5BRD A;  3SMP A;  2ITM A;  1XMO K;  3PUF A;  3CFO A;  3B6P A;  3V9X A;  1I3A A;  5AQT A;  3SZ2 A;  1B9F A;  1NJY A;  4DV4 K;  3R3L A;  3THX A;  3TAE A;  3TAB A;  3LP1 A;  4YOY A;  1BHL A;  2Z1J A;  1DT9 A;  3PX0 A;  4CBU A;  3ALY A;  4OPA A;  1QZ5 A;  2HND A;  1A5V A;  1JL2 A;  2RF2 A;  3H1Q A;  4CBX A;  4CJK A;  4DF4 A;  4JK8 A;  4R5P A;  5M1Q A;  3EZW A;  1BIS A;  1ZBL A;  4H5R A;  1TYQ B;  1TKT A;  2IS3 A;  1QSY A;  4FJ9 A;  5JS2 A;  4GV9 A;  4FOE A;  3SJH A;  3F9K A;  1S1V A;  3U9Z A;  4K25 A;  3OS1 A;  4HWI A;  1N36 K;  4BQL A;  4QS9 A;  4KRF A;  3M1F A;  2O8D A;  3I8B A;  2NRZ A;  2P9I B;  2HHS A;  2XRI A;  3O9R A;  3QIC A;  3AVH A;  5C2D A;  4M3U A;  5BR9 A;  1BU6 O;  4CEQ A;  5KPR A;  1RBV A;  3AVI A;  5GAE P;  1BL3 A;  2HBL A;  2E1Z A;  4MLH A;  3OYK A;  1J54 A;  4FWL A;  3F73 A;  4YFU A;  1HNZ K;  3MX5 A;  2CGK A;  3WQU A;  4WQ5 C;  1BG3 A;  4IFE A;  1HR0 K;  1JXB A;  4E7I A;  2G8W A;  4CZG A;  3V9W A;  1WB9 A;  1JLG A;  3KLE A;  2HBJ A;  4G1Q A;  5EVZ A;  4DV6 K;  5LJW A;  5LMN K;  3VGL A;  2X78 A;  4YDU A;  4FK4 A;  3JS6 A;  3KK1 A;  1W0H A;  3DYA A;  4AHU A;  4FJ8 A;  5AQU A;  4BRN A;  2GX9 A;  4GKJ K;  4BRC A;  3WQT A;  2FBV A;  1X9M A;  3ZSY A;  5LJV A;  2A41 A;  4W5N A;  2PAV A;  3OY9 A;  2QA4 N;  4FJK A;  1IV0 A;  3IFR A;  4OPK A;  3E1Y A;  1D4X A;  5C25 A;  4JKB A;  3OA9 A;  1LCU A;  1UA0 A;  1RT2 A;  3EKU A;  3CC4 N;  1NK6 A;  2AA4 A;  2W42 A;  4IDH A;  1C0T A;  3V1O A;  1HKG A;  2WC9 A;  4JKF A;  1NG9 A;  1S1X A;  3HRG A;  5AZJ A;  3E9P A;  2OPS A;  3LP0 A;  3P31 A;  5DM6 L;  3ENB A;  1EET A;  3OYI A;  1ZBH A;  1TUY A;  1WBB A;  1U4B A;  1KLM A;  3ASM A;  1ASW A;  1JLE A;  4DV7 K;  4XH4 A;  3PY8 A;  1VQ7 N;  1NGD A;  1XMQ K;  3LAL A;  4FWQ A;  1NOZ A;  5HP1 A;  2DFH A;  4DSE A;  4ZTF A;  1IJJ A;  2OAN A;  4CFC A;  5AQR A;  4GKK K;  5BRH A;  4LSL A;  2EX3 A;  4B9S A;  4FJH A;  3RMA A;  2KZM A;  4H4M A;  2IVP A;  2HMI A;  3CQX A;  3CXC M;  3THY A;  5AQH A;  2D1K A;  3SQ0 A;  1A5X A;  1KAX A;  4BRH A;  1Q7Y O;  4KTQ A;  3Q7C A;  2E2Q A;  4ILH A;  2Q1N A;  3LDQ A;  4DS5 A;  3HP6 A;  4Z0U A;  2KFZ A;  1NKB A;  3EY1 A;  4Z4F A;  4C8N A;  3V9U A;  4B3M K;  1VSJ A;  2A3Z A;  3KIO A;  4RW9 A;  3P4I A;  4CZM A;  3P5J A;  2A40 A;  3H45 C;  3OYC A;  1M1K O;  4BVP A;  1V4S A;  3BP8 A;  4KFB A;  2VWB A;  4N41 A;  3VES A;  2RPI A;  4MO4 A;  3VEO A;  3MX2 A;  3CCV N;  2YNH A;  2HBM A;  1HMV A;  2XY6 A;  4RCH A;  4DFJ A;  1X3N A;  4U67 L;  4WF9 L;  2QKB A;  3KHY A;  4X65 K;  1S6P A;  4DHY A;  3CM5 A;  4L8R B;  2CGJ A;  3QML A;  1CZB A;  3GL1 A;  4AH9 A;  3NH2 A;  2NRV A;  2D4W A;  3NF8 A;  1FXX A;  4CK2 A;  4DR6 K;  4CHQ A;  2O8E A;  3KWG A;  3BF3 A;  4C23 A;  3WNE A;  3MED A;  4CZF A;  2KHO A;  4FJN A;  2QWM A;  1C1A A;  3ATV A;  3A5O C;  3AV9 A;  5CZ1 A;  4CEF A;  1KFS A;  1O13 A;  4J2D A;  3SUN A;  3ZLJ A;  3F2K A;  1TKZ A;  4FW1 A;  5DMR A;  1WUA A;  1YI2 N;  3PV8 A;  3HPG A;  4DLE A;  1S22 A;  2YHA A;  4PL8 A;  4A61 A;  5E41 A;  3U6F A;  2ZM6 K;  1QSL A;  4GY2 B;  3GDQ A;  4WYB A;  1HLU A;  2ZGY A;  4LH5 A;  1NK9 A;  1NJI O;  2P9L B;  3AO2 A;  3V9S A;  4OGE A;  1ZBI A;  4IZ9 A;  5M1N A;  4QCL A;  1RTI A;  3AVC A;  3PSF A;  3ZSZ A;  1U2V A;  4PA1 A;  1U2V B;  5GAH P;  1Q18 A;  2VQF K;  2O4I A;  3WT0 A;  1GLD G;  2D0P A;  1JJ2 M;  4DKW A;  3HK2 A;  1Z6R A;  1TKX A;  1EQY A;  4AHT A;  1OH5 A;  1BI4 B;  1HNX K;  1BOT O;  1GLJ O;  1VSM A;  5AQK A;  3QET A;  3WXJ A;  4M3R A;  3CYM A;  1E4G T;  3K5L A;  4Z4H A;  1DTT A;  2NRR A;  4JS5 A;  3QER A;  1FKP A;  2P9S A;  4NYN A;  4PQU A;  4JKD A;  2P9U A;  2P9U B;  1IKW A;  4AIL C;  4FLV A;  1NJW A;  2V51 B;  2VQE K;  3NCI A;  2YCH A;  3HTV A;  4DG1 A;  1S9G A;  1VQK N;  3OJS A;  3O4Q A;  3KKR A;  4DLG A;  4DSL A;  1J6Z A;  4CHP A;  3IMX A;  4ZHR A;  5K14 A;  4EP5 A;  3LAN A;  2HHH K;  2I5J A;  4FLX A;  1VSI A;  1Q86 O;  4DTP A;  3ZSW A;  3A8Y A;  4CER A;  5HOO A;  3LPT A;  4LF8 K;  1VSL A;  4FJ7 A;  4CEO A;  3SPY A;  4FPB A;  3OBW A;  4I7F A;  5A2Q O;  2F96 A;  4DSJ A;  3O9T A;  2VG7 A;  1NGF A;  1GOB A;  4JI4 K;  4YOV A;  1XHZ A;  4IEI A;  2CH6 A;  2HHV A;  3NGY A;  4B3S K;  1B9D A;  3R1X A;  1ASV A;  3EL2 A;  4I6M A;  3S41 A;  5B8H A;  4FWM A;  2WUS A;  3DAW A;  5E84 A;  1L3S A;  4YOR A;  4Y0W A;  3NMU A;  3Q7B A;  5HLF A;  1MWM A;  1X3M A;  3VOV A;  1QHT A;  1BIZ A;  2OYQ A;  4FWN A;  5HL7 L;  5JMV A;  3AAQ A;  2PYL A;  4I9L A;  1NOY A;  4PHT X;  1VQ6 N;  2NUB A;  1N33 K;  2D0A A;  5GIN A;  2NLX A;  1U45 A;  1ZYQ A;  3WEE B;  4JHD A;  4CFA A;  4XIU A;  3L0Q A;  2UYT A;  1RDU A;  3OS2 A;  3DOK A;  3OVN A;  5F0X A;  2A5X A;  2YHY A;  5KQD A;  1J5E K;  1E4F T;  3DJC A;  4CGG A;  4FZZ A;  4KAZ A;  5M1O A;  2XO7 A;  3SQ4 A;  4KH5 A;  4F8R A;  2QWL A;  3CCM N;  1RT6 A;  4A5B A;  1IO2 A;  3AGK A;  1TAQ A;  5AQM A;  3TSU A;  4FLW A;  3IAY A;  1QQM A;  1X9W A;  4YOT A;  3TTD A;  5TKW A;  1BQN A;  1ZBS A;  1RT4 A;  3HST B;  3CJ7 A;  1ESV A;  4HCB A;  3HVR A;  3ENH A;  3AVG A;  3CJB A;  3DLK A;  2G8F A;  4KRE A;  4OJR A;  4M7Y A;  4KBO A;  4X62 K;  1WSE A;  5H1S Q;  1NGC A;  3ENO A;  2HW3 A;  5F1X A;  1QQO A;  4G9Z A;  2BH1 A;  2W6L A;  4JKG A;  4NCB A;  4PKI A;  2GUI A;  1S1T A;  2QXL A;  3C65 A;  3P38 A;  1NK8 A;  1KCF A;  3OYF A;  3T69 A;  4LF5 K;  3FZH A;  4E7H A;  2KZZ A;  3ZT1 A;  4O5B A;  5EX5 A;  1SL2 A;  3I8D A;  4IDK A;  1SZ2 A;  3EYZ A;  4LFA K;  4IEE A;  1HJR A;  4YOX A;  2CGL A;  2ZGZ A;  1LW0 A;  2FSJ A;  4BY9 C;  1NMD A;  4BE0 A;  4BRE A;  1Z05 A;  3C6A A;  4DQS A;  3L8B A;  4CJQ A;  2P9P A;  3ZX2 A;  4W5T A;  1U04 A;  3F5T A;  2AP1 A;  2IVN A;  3DMJ A;  2G8V A;  4YOW A;  1RT1 A;  4B8A B;  2DFE A;  2Q0U A;  1MU2 A;  4DUZ K;  3O5B A;  3DLL L;  4WQ4 A;  5HBM A;  4PKH A;  2XY7 A;  3CCU N;  3WXI A;  4ELV A;  4E19 A;  5CHI A;  4BC5 A;  5AQJ A;  3O6W A;  4DTX A;  3PX6 A;  1RBT A;  4X66 K;  2OTL N;  3IS9 A;  3SAG A;  2OPQ A;  2DPN A;  2XHB A;  1ZXO A;  3NF7 A;  4NLB A;  1VQM N;  1RBU A;  3HZ6 A;  2E88 A;  1C1B A;  2GBZ A;  2HNY A;  4B3O A;  3ZET A;  3NE6 A;  3AO1 A;  1HYZ A;  4M45 A;  1WSJ A;  3WXM B;  3FFK B;  2YHW A;  4KI4 A;  4B1Y B;  4H5W A;  1VSK A;  4XH1 A;  4MDA A;  3HT3 A;  3CQ8 A;  4DUY K;  4FL9 A;  1MA9 B;  3KK3 A;  3CJ9 A;  3HJF A;  1CXQ A;  1OH7 A;  3E9L A;  4JD2 A;  2J4R A;  2WOM A;  3FLC O;  4UY8 O;  4PL7 A;  1VSE A;  1SKS A;  4F3O A;  2E20 A;  1LAV A;  4CD1 A;  4OKJ A;  1RDA A;  2FBY A;  1ZBF A;  3ZEU B;  4DF8 A;  4JKH A;  3CJA A;  1SAZ A;  3I55 N;  3ZT0 A;  3MEC A;  3V6D A;  3M8Q A;  3AVA A;  3MCA B;  3CIP A;  4F9O A;  1QZ6 A;  3DXK A;  4RW6 A;  3AAR A;  4GVM A;  3AA4 A;  2HB5 A;  3H46 O;  2JLE A;  1Q81 O;  4CEC A;  2Q97 A;  1Y97 A;  4FVU A;  2KLA A;  1NKE A;  5HRS A;  3TAG A;  5AZI B;  3TTF A;  2E2O A;  5F2R A;  1EO1 A;  4LFC K;  3THW A;  5M1P A;  4BWJ A;  4CJW A;  3RRH A;  3IRX A;  3L2Q A;  3TAF A;  3LDO A;  3CI5 A;  2QXF A;  1YIJ N;  3AA5 X;  3RSE B;  3OYD A;  1T7P A;  5AQP A;  4FLZ A;  4B9V A;  2H3G X;  2VWK A;  1WSH A;  3DWL A;  5GAG P;  2G8H A;  2IAJ A;  1EXQ A;  3FZF A;  1D9F A;  3NFA A;  3CF5 L;  4FWO A;  1YTA A;  5I42 A;  2E8A A;  3NH1 A;  3LDS A;  4DS4 A;  4OO1 J;  2RN2 A;  4KHY A;  1EWR A;  1ILY A;  4CJ3 A;  2YHB A;  4BGA A;  5J1E A;  3MXM A;  4CD3 A;  2P1J A;  1TVR A;  2KW4 A;  3L2W A;  4Y1D A;  5EXW A;  2QTD A;  1HRH A;  4JI3 K;  1KRP A;  3HL8 A;  1TYQ A;  2Y1J A;  4KB0 A;  1RTH A;  4GVE A;  3C94 A;  5AQZ A;  1S1U A;  4DR5 K;  1UA1 A;  5C0Y A;  1EP4 A;  4HVJ A;  4LD0 A;  4BGB A;  3OW2 M;  1Q9X A;  4BR2 A;  2G8U A;  4QS8 A;  4CEA A;  3HXM A;  3J80 O;  3MAQ A;  5J2P A;  3AA3 A;  2P9I A;  2QM1 A;  3M5R A;  4AM6 A;  1R0A A;  4KHU A;  3LM2 A;  1JLQ A;  4FCY A;  4FZY A;  1GOA A;  2YNI A;  3G6E N;  4C8O A;  5M1K A;  1QVF M;  1VSF A;  2ETJ A;  3OYB A;  5AQN A;  3TR8 A;  3AO4 A;  3T7Z A;  1H1V A;  2OZS A;  3DRR A;  1ATN A;  4KKO A;  3VQ6 A;  1BUP A;  2Q0R A;  1K73 O;  1N8R O;  3L3V A;  4YHH K;  1NK7 A;  4CHY A;  4KI6 A;  3VQB A;  4E1N A;  3D45 A;  4A62 A;  4FLT A;  1Z26 A;  4DU1 A;  2KKZ A;  1N5Y A;  4H5T A;  5KPT A;  1WOQ A;  1BCO A;  5BPN A;  2KQ2 A;  5HRP A;  1KQS M;  2HNZ A;  2QI2 A;  3VQA A;  3MN9 A;  3O4N A;  3O3H A;  4JS4 A;  4AM7 A;  2OCE A;  4E7K A;  3DLR A;  4DV3 K;  5DK5 A;  3V81 A;  4B1U B;  2FF6 A;  4BVO A;  3VQC A;  3SLC A;  4NCA A;  1G99 A;  4BWM A;  5KQ8 A;  5BN8 A;  1K8A O;  2O4G A;  1NGI A;  4CEE A;  3KD5 E;  4RG8 A;  4KHS A;  2HVH A;  3PIP L;  1T6D A;  3DLH A;  3LP3 A;  4K0K K;  1Y64 A;  4IG0 A;  2KFN A;  4CK1 A;  4IO9 L;  3FZM A;  5AQX A;  1WAJ A;  2YKN A;  1U48 A;  1VSD A;  3SV3 A;  1BDG A;  3OYN A;  4QAG A;  5CZ2 A;  3L2R A;  3K5M A;  2YHX A;  4DTN A;  4M63 C;  1TV6 A;  3MWP A;  3O3F A;  3KLG A;  3CCJ N;  3QLH A;  4CJS A;  1M90 O;  4K8X A;  2O8C B;  4DWI A;  4IFY A;  3VEY A;  3SV4 A;  2OZM A;  3MXI A;  1LAW A;  4FM1 A;  1VQL N;  4CFB A;  4BR7 A;  3K59 A;  4JKA A;  3MN5 A;  5HRR A;  4CJ7 A;  1V4T A;  3O3G A;  1X1P A;  1XNR K;  4H03 B;  1RT5 A;  3VQE A;  2NRH A;  5ELZ A;  2ASO A;  4FJJ A;  4B9L A;  3TAQ A;  2F7T A;  4DQ8 A;  3NGZ A;  2E6M A;  4H0X B;  3VQD A;  3O80 A;  4AHV A;  3LM9 A;  1FK9 A;  4JEP A;  4KTZ A;  3RRG A;  4JYA K;  1JL1 A;  5BN9 A;  5AFU H;  2G8I A;  2IC3 A;  2P9N B;  5D3G A;  2UUC K;  2YV0 X;  1I39 A;  4M3X A;  3EZ5 A;  5AJ3 K;  1YIT N;  4DTO A;  1QSS A;  2F9T A;  3JAM O;  1XWL A;  2F4V K;  3R6M A;  3RMB A;  4CED A;  1NJX A;  1W9H A;  4Z4G A;  2FSN A;  2AJQ A;  2YNG A;  1E3M A;  1KXP A;  4MQ3 A;  3O9Q A;  5AR0 A;  1QQC A;  4HUF A;  3JYT A;  1L3V A;  3VEW A;  1D5A A;  1T3V A;  1ATS A;  4DQR A;  4NXM K;  3DLE A;  4H8K A;  3VTH A;  3H3N O;  4FWS A;  3HYF A;  3AVF A;  2X6N A;  3RWU A;  1EKE A;  4N76 A;  4E1M A;  3VEV A;  3WXL A;  4CZJ A;  4W5O A;  1EX4 A;  3UKU B;  3CM6 A;  1RIL A;  2QW9 A;  3BZC A;  4EFH A;  3SAF A;  1TAU A;  3A2F A;  3TAP A;  3J7A P;  5BRF A;  4LY7 A;  3ID8 A;  2Q2R A;  1NGJ A;  5EU7 A;  5GIP A;  4Z94 A;  3QEW A;  1VAZ A;  2P9L A;  4IOX A;  3DM2 A;  2I7N A;  5LL6 Z;  5FPN A;  4V19 S;  1JCE A;  4FSV A;  3MK6 A;  4CJR A;  3QEX A;  1LWC A;  4KTW A;  1DGK N;  1I94 K;  1YAG A;  3D2E B;  5AQW A;  1U49 A;  3CET A;  2HF4 A;  4IWV A;  4JAX A;  3DOL A;  1ATR A;  3G4S N;  4KHP K;  1YXQ A;  4MDB A;  1BI4 A;  3H3O B;  4CF0 A;  4CJL A;  3VQ9 A;  3CC7 N;  4U7B A;  5AFU A;  5I3U A;  4IOA L;  4EHU A;  3I0S A;  2W6K A;  1RDB A;  5HRO A;  3LWM A;  4ILG B;  5EOY A;  3QIN A;  1HX1 A;  3FZK A;  2Y1I A;  4YNQ A;  1YJ9 N;  4ILJ A;  4GV3 A;  3OS0 A;  4CGI A;  1RBR A;  3A5M C;  4CIF A;  1RFQ A;  1HPM A;  1QE1 A;  4HTL A;  4CVN E;  3FGU A;  1BA1 A;  2P51 A;  2A6A A;  4O4G A;  1BQM A;  1XUP O;  5C2F A;  1VK0 A;  4DV5 K;  1HKC A;  4DU3 A;  1KD1 O;  5KGW A;  1K6Y A;  3K2P A;  3SUO A;  5FPD A;  1CZA N;  2ZJP L;  2E2P A;  2OPR A;  4B1V A;  2VG5 A;  3G71 N;  3MCP A;  2UXD K;  1JLF A;  3LZJ A;  3VA3 A;  4YOU A;  2WBN A;  3OBY A;  4FOI A;  4KB1 A;  5BR8 K;  2HVI A;  4QOZ B;  4I2P A;  5DM7 L;  2UUA K;  5AQS A;  4MLE A;  4MO5 A;  4Z4E A;  3C0B A;  1P90 A;  4WQ5 A;  3I0R A;  3QNN A;  4IXC A;  3UKR B;  4FM0 A;  3J7Z O;  3QB0 A;  5FRO A;  4O5F A;  3DXM B;  1RTJ A;  3O1W A;  4FJG A;  3AY9 A;  1K8K B;  3MDQ A;  1HNV A;  4CZI A;  2R7Y A;  4WFN L;  4E3S A;  2FLO A;  5JIC A;  3WEE A;  3CCS N;  3NDK A;  3OHR A;  5M1F A;  5FDL A;  4BC3 A;  1KC8 O;  1SKW A;  4DQP A;  2HHU A;  5JS1 A;  2P9K B;  2IVO A;  1YJN N;  3PO5 A;  4IFV A;  1BGX T;  1NBW A;  3AGR A;  3G25 A;  3VQ5 A;  4CHN A;  1T44 A;  1REV A;  3KTQ A;  2O8F B;  4EIA A;  4WFB L;  3CQY A;  3PO4 A;  3KK7 A;  1DLO A;  1XNQ K;  3CJ1 A;  3GG4 A;  3SAH A;  4CK3 A;  3KKS A;  1XC3 A;  4PY5 A;  1VRU A;  2LSN A;  3CJC A;  4O8U A;  4LF4 K;  1DEJ A;  1J9A A;  1L3T A;  3CER A;  2PYJ A;  1TGO A;  2UXC K;  3V1Q A;  1WAF A;  2VG6 A;  3ZSQ A;  4BQZ A;  3MWT A;  2QK9 A;  2PFU A;  3M8P A;  3NVK A;  3J8A A;  3QBX A;  4YDU C;  2NRX A;  3VQ4 A;  4H0O A;  3AVB A;  4M42 A;  1LWE A;  2A1R A;  3A5N C;  4C8L A;  3UE5 A;  1IG9 A;  1GLF O;  3EO3 A;  4FJX A;  1IKY A;  3C6H A;  4DR2 K;  4FW2 A;  1GLL O;  4RTF D;  2FBX A;  1DKG D;  5I9E B;  1BA0 A;  3ID6 A;  4WE1 A;  3DLG A;  4JRP A;  3KLI A;  1HJO A;  3LP2 A;  3BEX A;  4NB4 A;  3QNO A;  1HNW K;  3B6O A;  1HPZ A;  4N47 A;  3VQ7 A;  4CIE A;  5AQO A;  2FC0 A;  1Q82 O;  1OH8 A;  4BRL A;  1WNS A;  4A57 A;  4DQI A;  3VQQ A;  1C0U A;  1XC9 A;  4B3T K;  3VEZ A;  3HPO A;  1TUU A;  2X74 A;  4FK0 A;  4M3Y A;  3CME N;  3ATU A;  3N4Q A;  1S3X A;  3HBT A;  1GOC A;  3FE1 A;  4K41 A;  3K5N A;  3D6R A;  4LC9 B;  1OKJ A;  1VQ5 N;  5EY4 A;  4BC4 A;  3OYH A;  1BIU A;  3J81 O;  1QHA A;  3P1G A;  1T03 A;  3UB5 A;  4RWT A;  3T1Y K;  3P39 A;  4DCH A;  2OA8 A;  1NKC A;  3HVT A;  1JLA A;  2ZWH A;  1CZ9 A;  4LH4 A;  3V4I A;  1GLC G;  3WXK A;  4CHO A;  3L2U A;  4BRO A;  2HST A;  3CG7 A;  4C8M A;  1QTM A;  4CFD A;  3O4W A;  1JCG A;  4DR1 K;  2IGI A;  3TAN A;  2P5G A;  2RKI A;  1ZBU A;  4OLA A;  4O44 A;  3KLH A;  3OYL A;  1D8Y A;  4R79 A;  3IUC A;  4K42 A;  3K0S A;  4FPA A;  4OKE A;  3SQ2 A;  2V7Y A;  3AVM A;  1GLA G;  4CGJ A;  3ISN C;  3VMF B;  3SQ1 A;  1ZC6 A;  4J2E A;  4BAC A;  2ASM A;  3ZEU A;  5CE3 A;  1GLE G;  3VA0 A;  2ITG A;  5AQV A;  2ASP A;  3QIP A;  2ATQ A;  4FLY A;  4F4K A;  4JV5 K;  4OPH A;  1RT7 A;  3QEI A;  4BR4 A;  1CLQ A;  5FLX O;  4A59 A;  1NMN A;  3BGR A;  4IO8 A;  4FVM A;  1Q8I A;  4OVL A;  3BF1 A;  2HHW A;  3VN5 A;  1VQN N;  1N32 K;  4M3Z A;  3NAE A;  2UU9 K;  5AZI A;  1GLB G;  3T1A A;  4CGH A;  3C6T A;  4EHT A;  3NGI A;  5AQQ A;  2B4J A;  2Z1G A;  3C6U A;  3FZL A;  4ZTJ A;  5JVH L;  2RE2 A;  1ASU A;  2ZJR L;  3RTV A;  3K9J A;  3RSE A;  4IJA A;  3TSQ A;  3OYE A;  4CF2 A;  1RBS A;  4HHT A;  1LWF A;  4B9U A;  3W0L A;  3PIO L;  2OTJ N;  3ULE B;  4CI6 A;  4LF9 K;  4BG9 A;  4CES A;  1X9J A;  5JLF A;  4BE2 A;  1VQ9 N;  3KWI A;  3NVM A;  3HI0 A;  3TSP A;  5ADX H;  4XEI A;  5CYQ A;  2WFB A;  3LDN A;  4CZL A;  4KH6 A;  5SWM A;  3A5L C;  1UWB A;  1IBK K;  1YF5 L;  4CGF A;  3SMS A;  3EEQ A;  3WUH A;  3CCE N;  3RR7 A;  3KD1 E;  4FLU A;  2VYP A;  4IBN A;  1MDU B;  4A5A A;  3DRS A;  4HTU A;  4CEB A;  4CJF A;  4Z4C A;  4B1W B;  5FPM A;  3TPQ A;  3CHW A;  3THX B;  2FXU A;  2JWK A;  5JLH A;  3DI6 A;  4C1N K;  3CC2 N;  3NH0 A;  1XHX A;  4Q5V A;  2Q31 A;  2O8B A;  2O8B B;  1NU0 A;  4AF1 A;  4TSX A;  2F8T A;  3VET A;  1RNH A;  4KH4 A;  3FFI A;  4W5R A;  3RMC A;  1QVG M;  4CEZ A;  3QEP A;  2PBD A;  5LY3 A;  4HUG A;  3QIO A;  3GBT A;  2HBK A;  4CJP A;  2BGG A;  4FYD A;  2NRT A;  4PUO A;  3FR0 A;  4EZ9 A;  2O8D B;  3OYA A;  1A5W A;  1RT3 A;  2GWJ A;  2G8K A;  4XH5 A;  1QQN A;  4ISE A;  4KHW A;  1VSH A;  1VQP N;  2XY8 A;  5AQL A;  2FBT A;  3U4L A;  4CJV A;  2GWK A;  4BC2 A;  4M3T A;  4PKG A;  4B1Z A;  1WLJ A;  2QWP A;  2D0B A;  3AVK A;  1WSF A;  4MFB A;  3O8M A;  3T19 A;  4FO0 A;  3SYZ A;  4E7L A;  2VCP A;  2KTQ A;  4CF1 A;  2HOE A;  3OJU A;  5ADX A;  1N34 K;  3V1R A;  4IOC L;  1S1W A;  1HQU A;  2GTD A;  4CHZ A;  2BDP A;  3TAM A;  3WNG A;  3UIQ A;  3HP9 A;  4GV6 A;  1RCH A;  1BO5 O;  4JI0 K;  2UUB K;  1FW6 A;  5FRN A;  3NHG A;  4M41 A;  1WSI A;  4FJM A;  2E6L A;  3AO3 A;  3EE9 A;  4OGC A;  3J7Y P;  2GEL A;  2YX6 A;  3A0I X;  3D2F A;  4E0D A;  3HO1 A;  3D2F B;  2DY4 A;  1KVA A;  2D0C A;  1BCM A;  1HQE A;  3L3U A;  3I56 N;  1SQK A;  1HUX A;  3ULD A;  5AQG A;  4IKF A;  2V52 B;  4CZK A;  3VEN A;  2HHT A;  1G15 A;  2BTF A;  2O8C A;  3RVC A;  4B8C A;  4E89 A;  4DR3 K;  3TTC A;  3KZB A;  4JNE A;  4KPY A;  2ZD1 A;  3CPE A;  5AZJ B;  1C0F A;  1KFD A;  2BE2 A;  3AAP A;  4EP4 A;  5HRN A;  1WN7 A;  5C10 A;  5GAD P;  4DU4 A; 
#chains in the Genus database with same CATH homology
 3JAM O;  2F4V K;  5IT9 O;  4YHH K;  2UXC K;  1XMO K;  4LFA K;  4DV5 K;  4LFC K;  4LF6 K;  4DV4 K;  2ZM6 K;  4JI6 K;  4JV5 K;  4DV3 K;  5FLX O;  4NXM K;  4DR2 K;  4JI1 K;  5IWA K;  1N33 K;  4DUZ K;  4DR4 K;  4DV7 K;  2UXD K;  4OX9 K;  1N32 K;  1XMQ K;  5BR8 K;  2UU9 K;  4DV2 K;  2VQF K;  2UUA K;  4NXN K;  4JI5 K;  4GKK K;  1J5E K;  1HNW K;  4K0K K;  3J7A P;  2UXB K;  4CW7 B;  4LF7 K;  1HNX K;  1N36 K;  4X66 K;  1N34 K;  5LMU K;  4B3T K;  5LL6 Z;  4JI0 K;  4V19 S;  2UUB K;  4LF9 K;  4YY3 K;  4JI3 K;  4DR7 K;  1IBL K;  2E5L K;  3OTO K;  1I94 K;  4B3M K;  1HNZ K;  2VQE K;  1FJG K;  4DR5 K;  4B3R K;  1HR0 K;  4DV1 K;  4KHP K;  3J7Y P;  3J81 O;  4X64 K;  1XNR K;  4DUY K;  3J80 O;  3T1Y K;  4X62 K;  1IBK K;  1IBM K;  4DV6 K;  5LMN K;  2HHH K;  3T1H K;  4JI7 K;  4JI8 K;  1XNQ K;  4DR3 K;  4X65 K;  4LF8 K;  4LFB K;  4JYA K;  4DR1 K;  4GKJ K;  4DR6 K;  2UUC K;  4DV0 K;  5A2Q O;  4AQY K;  4CVN E;  4JI4 K;  4LF4 K;  4LF5 K;  5AJ3 K;  4JI2 K;  4B3S K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...