4B3RK

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4b3rK00
2UXCK 4JI2K 1HR0K 4YHHK 5LMNK 4JI0K 4DV5K 1XMQK 1XMOK 1N32K 4CVNE 4B3MK 4DR1K 4B3SK 4JYAK 3T1HK 4V19S 4AQYK 3J80O 5FLXO 1XNRK 4JI7K 4DV4K 4DR2K 1IBLK 4JI8K 4CW7B 2UUBK 5AJ3K 4LF8K 5A2QO 2UU9K 3OTOK 5BR8K 4YY3K 4LF5K 3J7AP 3T1YK 4LFBK 4LF6K 4DV2K 2UXBK 4DV0K 4B3RK 1HNZK 4DV6K 2HHHK 4KHPK 4DR3K 1IBMK 4LF9K 1J5EK 4JI1K 4DUYK 3J81O 1HNWK 1N33K 4JI5K 4JI6K 4DUZK 2E5LK 4GKKK 4X64K 2F4VK 5IWAK 4DR7K 4JI3K 4GKJK 1IBKK 1I94K 3JAMO 4X66K 2ZM6K 4OX9K 4NXNK 4K0KK 1FJGK 1XNQK 2UUCK 5IT9O 4DV3K 4LF4K 4B3TK 4X65K 4DV7K 2UUAK 5LL6Z 2UXDK 2VQEK 4NXMK 4DR6K 1N36K 4JI4K 5LMUK 4DR5K 1N34K 4DV1K 1HNXK 4LFCK 4DR4K 3J7YP 4LF7K 4X62K 2VQFK 4JV5K 4LFAK
chains in the Genus database with same CATH superfamily
3AO3A 1JLQA 1QVGM 1VQPN 2GX9A 4KBOA 3SUOA 3L4IA 4O0IA 1EXQA 1T3VA 4F2SA 3FFKB 1FW6A 4WFNL 1TGOA 1U04A 3RR8A 4KFBA 5I9EB 4H0TB 3IKMA 1C0MA 1GLLO 1TL1A 4IJNA 1RBSA 5FLXO 3TSUA 2PFUA 1SV5A 1IH7A 1SL0A 3HI0A 3VQ6A 3SQ1A 2O8DB 4CW7B 4BG9A 1JLCA 1QE1A 2YJEA 3TWHA 1VK0A 3WQTA 1HKBA 1QZ6A 1BI4A 4B1UB 1BQMA 4H8KA 4FWQA 1JL2A 3ZX0A 3OYHA 3DI6A 3KIOA 2Q1NA 3N4QA 3WXIA 3OYBA 3M1FA 3QO9A 2D4WA 3QERA 4CF8A 3NBPA 4JKHA 4O5FA 3ZT1A 5C10A 4EZ9A 2FSNA 4PKIA 1IBMK 4DS5A 3DXKA 2GBZA 3NH2A 4B9SA 2O8EA 2A3ZA 4LF9K 1GLDG 4JLHA 2XY5A 4OLAA 3UKRB 5BN8A 3GDQA 1RDWX 3KKRA 3EY1A 4B9TA 3NVMA 4BE0A 1WB9A 1U45A 1BCMA 1JCEA 1RTJA 4AHVA 5F1XA 4CF1A 1DEJA 2QWRA 1TK5A 3KLGA 3EZWA 4JNEA 4W5RA 1JXBA 3SYZA 1IJJA 4IBNA 4DG1A 4CJUA 2HNZA 1U48A 3ENBA 3C0BA 1R0AA 3VETA 4H5TA 3L6QA 3MXIA 4B9QA 1BIUA 4G1QA 5HP1A 5HOOA 4DSJA 2Y1JA 4FJHA 5LL6Z 2VQEK 4N56A 1C6VA 4JI4K 4RW9A 1ZYQA 3SQ2A 4M3TA 3GOIA 3FLCO 5JS2A 3KD5E 3NH0A 2I7PA 1NLVA 3DXKB 3LANA 3M8SA 3CQ8A 1S1TA 3ISNC 4PL8A 5DM7L 4RCHA 4CK3A 1B92A 4BR7A 4F9OA 4E7JA 4AHSA 1BO5O 4CEEA 2ZJPL 3AVCA 4CVNE 4N41A 3AGRA 1S1VA 2P51A 3VEYA 4CCHA 1D9FA 1NGIA 3AVIA 3CJBA 3L3VA 3CG7A 1HPZA 2VCPA 5AR0A 5AQSA 4IXCA 3SJHA 1WSFA 2QWPA 4B1YB 4PL7A 2V52B 5JS1A 1RT1A 1SUQA 2A40A 2Q97A 3ZSOA 4BC3A 1LV5A 2G8FA 2KFNA 5C12A 1A5WA 1YXQA 4XEIA 2V7YA 1S22A 1S9GA 3FZKA 4NCGA 4CJFA 4LF5K 3CQYA 5LJVA 2HNDA 3J7AP 1FK9A 3NF7A 3A8YA 1Q82O 4CHQA 3OS0A 4CZHA 1S72N 3NE6A 5SWMA 4CJRA 4BDZA 4YNQA 2XY8A 4BVOA 4BDPA 2EHGA 3DLEA 1HNVA 3HRGA 4M45A 1JJ2M 4OLBA 4E7LA 3E9PA 3KLEA 4KHYA 1TL3A 5ELZA 3AGKA 4YOVA 2ZGYA 2F4VK 4MLEA 3MK6A 1YAGA 1DT9A 3N4PA 3AA4A 4JI3K 1QTMA 4BGBA 4HTUA 4CHPA 1Q9YA 4IOCL 4OX9K 3ZT4A 3U4LA 3WEEA 3ZSRA 5DMRA 3KLHA 1Q18A 5SZTA 3HOTA 4OKJA 4CEBA 3VF2A 2PYJA 1RDUA 4CEQA 1NKCA 4CEAA 1EWQA 4DTUA 2XHBA 5HRRA 1Q7YO 4LFCK 4Z4FA 4DR4K 1WOQA 4B1WB 5KRTA 4KHSA 3T19A 3LAKA 2E6MA 4RW7A 1G15A 5AQRA 1QSSA 1IKWA 3VEZA 3HOSA 1RFQA 1U49A 2D5RA 1MWKA 2IVNA 4DTMA 2YNHA 3T1HK 1TV6A 1DTTA 3IDHA 3C94A 1EWRA 3J80O 5EXWA 3M5RA 3THXA 3UE5A 4IO9L 2HBJA 3AO2A 3MCAB 5GINA 4BRQA 3T3FA 1EKEA 1NGJA 3WEEB 2UUBK 4RW8A 4H5RA 4BRNA 3L2QA 4Z4GA 3ID6A 1ZBLA 5AQVA 4KH6A 2WFBA 4BACA 2IGIA 2P9LA 4Z0UA 4AH9A 4IFYA 3NVKA 2OA8A 3E66A 4FWPA 4O8UA 3CPWM 2HF3A 5J2QA 2HHUA 2P5OA 4BC2A 2P9PA 4E89A 3AA3A 1YVNA 3FR0A 4MLHA 3VF4A 1WLJA 4J2AA 1KQSM 2VWJA 4KAZA 4YOUA 4CZKA 1N5YA 1C1AA 3QETA 4QOZB 4OKKA 3RWUA 4NLCA 1Z05A 1Q9XA 5KGXA 2O8FA 2HBKA 1I39A 4OPHA 3OS1A 4MDBA 3R1XA 4XH4A 2KZZA 1YI2N 5IWAK 3OYIA 2R7YA 1UA1A 3VF6A 3THXB 3AVLA 3V9ZA 2W40A 1Y97A 3OHRA 2W42A 5AQZA 1FJGK 3AVGA 2WBNA 4DMNA 3CC4N 1I3AA 3KHYA 3RTVA 4BR4A 4FJKA 4FVMA 3HSCA 5KPTA 1L3TA 1TK8A 1XWLA 4HWIA 2YJFA 2YV0X 1HYZA 3CCEN 3HM9A 4CF2A 5FPMA 1NGCA 1RNHA 1CZBA 2P9LB 1NGFA 4UQGA 3LAMA 1X9SA 1GOBA 1T44A 5AFUA 1EX4A 1GLEG 4F4KA 4QS9A 3NH1A 3JYTA 3K9JA 4KTZA 2FF3B 4BWJA 2E2PA 4LFAK 3F9KA 1HR0K 2P9PB 2ZJRL 5MLCQ 3VN5A 1RT5A 3U6FA 3M3ZA 4BREA 4FSVA 3LALA 3NAEA 3CMEN 3H6EA 3AO5A 2AA4A 3LPUA 4L8RB 3AVJA 2OPPA 3QEPA 4B9MA 2O8FB 2F8SA 3LP2A 1QZ5A 1ATSA 3GE1A 2P9IB 2FF6A 3TAMA 3DRRA 1S1UA 3DJCA 4YOTA 4B1XB 1NG9A 3L0QA 4WYBA 2OCEA 5EX5A 3CF5L 1QSYA 3PUFA 4JKGB 5GAHP 1KVBA 3WNHA 4LF6K 4DV2K 2P9SA 2Q0UA 3O08A 4I6MA 2HHVA 3OYMA 4ID5A 5JLFA 3AVBA 3TAGA 4IZ9A 4NO7A 1X3NA 4K8XA 4ZTFA 1YIJN 2AJQA 3H46O 2G8WA 3O6WA 5AZJA 2BH1A 3IG1A 3UKUB 2I5JA 5AQTA 4PKHA 1SL2A 4E19A 3K59A 1XHZA 5HBMA 3CJAA 3THWB 2OANA 4JRPA 3CCUN 3SK3A 5D3GA 3D0PA 5H1SQ 2KTQA 2VGMA 3HBTA 4DU3A 1IBKK 5AQLA 2HHXA 1HQEA 1ZBFA 4FVUA 4KH5A 4DTRA 4QS8A 3DLBA 3L2UA 4GNIA 5AQUA 2Q31A 3DAWA 4NCBA 2GTDA 3MWTA 3QLHA 1IKXA 2YI1A 4PHTX 2YKNA 4ZTJA 4X65K 1YF5L 3VGKA 3MN7A 1X9MA 3DMJA 4KHWA 4I6MB 2QKKA 5LMUK 1NWKA 1D9DA 1TUYA 3F73A 2FLOA 4DV1K 1HNXK 2YHBA 3QEWA 4IEEA 4IEIA 4KTQA 4BC4A 5KTQA 4QCLA 3WQUA 5T7BA 5AZJB 3RSEA 2P9UA 2RHKA 5BRDA 1W2BM 3KJVA 4E7IA 3AVMA 4Z4EA 4I2PA 4R79A 2KFZA 5AQGA 5HLFA 3CI5A 1MU2A 2E1ZA 4FWKA 1KTQA 5TKWA 3EYZA 4GW6A 1XQSC 3KLFA 3K5MA 3LDQA 4CFCA 4JI7K 1QS4A 3O4NA 1MA9B 3VEOA 4JI8K 5AJ3K 2D0AA 1YITN 2QXFA 3BZKA 1REVA 2A42A 1QQCA 5AQNA 3TABA 1NGHA 1VSFA 1K73O 2QTDA 4HHTA 1VSKA 3AVHA 3P4IA 1NOZA 3HL8A 3EE9A 2OPSA 4DR3K 3HP9A 1BQNA 1VRTA 4ICLA 3IRXA 4DFJA 4O44A 3CCRN 4DQRA 2F9WA 3BUZB 2YNFA 3RSEB 3AO1A 3NFAA 4GV3A 2DTUA 1P90A 5DK5A 3LM9A 3O4QA 5FROA 2HHWA 4DR7K 3VA3A 3O9RA 4DF4A 4RWTA 4CJSA 3JAMO 5LJWA 4CI6A 1H1VA 1OKJA 4WE1A 4E1MA 4FZZA 3LL3A 1TKTA 2X6NA 4YDUA 3I55N 4ELUA 1WUAA 5AQWA 1QHTA 4BRLA 2P1JA 3TU5A 2UXDK 5AQQA 3OVNA 4DR5K 1ZBUA 4CGDA 4IWVA 2YHXA 3UIQA 2ZD1A 2Q0RA 3RRGA 1L3SA 4LH4A 3AVAA 3VMFB 4Y1CA 1S5JA 4B1ZA 1RBRA 1XMQK 3SJJA 1TKXA 4OVLA 4CEDA 1SKWA 3HO1A 5JICA 5BRHA 4DR1K 3KKSA 3SLCA 3TSQA 1ATNA 2P5GA 4Z94A 1VRUA 4AQYK 1QVFM 3GBTA 4U7BA 3FZFA 2P9NA 3M8RA 4AM6A 3ZETA 3WXLA 4FZYA 4O5BA 4BRAA 3BZCA 2Z1GA 2IS3A 4CGIA 1HJRA 4CIEA 4DSIA 2NRZA 1NK6A 4JKBA 1U47A 3ZSYA 4FJ5A 4FPAA 4KV8A 3S3MA 3IS9A 4FOIA 4KH4A 3NF8A 3VEVA 4CBUA 3O1BA 4JD2A 4B3RK 4H0PA 1SKSA 3DLKA 2E2NA 3DRSA 3HSTB 1NOYA 3DRPA 3EEQA 3ZX2A 1U2VB 1QQNA 2E88A 4H0XB 3PY8A 4DUYK 1TAUA 3B6PA 3I8DA 4HTLA 4DUZK 3K58A 1WSJA 2ASOA 4OO1J 4NLBA 4JEPA 3CQXA 3CJ1A 4JS5A 5J1EA 4OPKA 3CCJN 4W5QA 2ZJQL 3G6EN 2HF4A 4H5WA 2P9NB 1YJWN 4J2EA 1N8RO 4BQZA 2X74A 4O8KA 3DXMB 3P31A 5CHIA 3SCXA 4OPAA 5AQXA 4EP4A 4F3OA 4CERA 2CGKA 4A5BA 2IC3A 4GY2B 4JK7A 2I7NA 4H0VB 3JXUA 2GWJA 4JD2B 1XUPO 4DR6K 3VQCA 2GELA 2O8CA 2HHTA 4PY5A 2V7ZA 3S41A 1HLUA 1JLGA 1LWFA 3ZSVA 4J2DA 4WCEL 2E2QA 1HPMA 2A5XA 2IVOA 4EP5A 4CD3A 3QINA 3C95A 4NYNA 2OZMA 1HYVA 4FYDA 3K5LA 1BI4B 3Q7CA 1VAZA 1KFDA 3WNFA 1T03A 4CJ4A 2KZMA 5FRNA 4CZIA 3QDKA 2Z1IA 3VENA 3TPQA 5KRSA 5K14A 3VQPA 1RBUA 3A0IX 4TSXA 4IKFA 2FSJA 2O8EB 3SQ4A 4I7FA 1LW2A 3EE8A 5C2FA 3G25A 2HOEA 2HSTA 3HP6A 3HT3A 3M6GA 1SL1A 2F8TA 1BOTO 3VEWA 4CJKA 3C6HA 1VQ4N 4CE9A 1C0FA 1NK9A 2O8CB 1HJOA 4K42A 1Z6RA 4DKWA 3OY9A 2QWNA 3CJCA 5M1PA 1O1WA 3V81A 2Z1HA 4ELVA 2VWBA 4BQLA 3VQ4A 4CHYA 1D4XA 4DTNA 4FK2A 3OBWA 2DFFA 1XC9A 2EWSA 2YX6A 3IAYA 5ADXA 3VQ9A 4YDUC 2KQ2A 5GAEP 5M1KA 5GADP 4BR9A 1ZBIA 4A57A 2CH6A 1HNIA 3LDPA 3PV8A 2VG5A 3F9MA 2NUBA 4E7KA 2W6LA 4MDAA 4DQIA 4FJ7A 1SS6A 1I94K 2Q36A 3VQAA 2F9TA 5E41A 4AF1A 3SNNA 4BRCA 4PQUA 2F7TA 3OW2M 1W0HA 3HM8A 3T69A 3LWMA 4FLTA 3OA9A 1XNQK 3QEVA 4K8ZA 5HROA 2PY5A 3HPGA 2QKBA 4KPYA 1WN7A 4FJNA 4IFEA 1NMNA 2QA4N 4I9QA 1N34K 4PUOA 4CEFA 3AO4A 3CM5A 4EIAA 5CY4A 3DWLA 4FW2A 2DPNA 4PKGA 2YHYA 3DLLL 4F8RA 2KLAA 1A5XA 3VQ7A 4DB3A 1RT6A 1VSJA 5LMNK 1XC3A 3OBYA 4JRQA 1NKBA 1T8EA 2JWKA 2E4LA 4YOWA 3U9ZA 2HW3A 1FKOA 3V1RA 1TVRA 1VSEA 4AHCA 1VSMA 5TKYA 4E0DA 2KHOA 2YNIA 4N47A 1W7AA 2HVIA 4FWNA 3VTIA 4RW4A 1C1CA 4MQ3A 2E8AA 3P39A 1NNEA 1VQMN 1X3MA 4FW1A 4BRFA 1HKGA 4BR5A 3EN9A 4FM2A 5AQOA 4LFBK 1D8YA 2UXBK 3PSIA 1BCOA 1HNZK 3AVKA 3SBTA 3PIPL 1LAVA 4YOXA 2XY7A 3CMAN 4FLWA 1RTDA 3DYAA 3KD1E 3OS2A 1ZBSA 4ILGB 1QQOA 1GLBG 3CHWA 3ITHA 4CF9A 2HBLA 1O13A 3CXCM 5FPEA 3HYFA 1TK0A 3VGLA 3CFRA 2QXLA 3FFIA 4GKJK 1IKYA 3HVRA 2B4JA 4FWLA 5CZ1A 1BG3A 1P8ZA 1VQ9N 1YVUA 4W5OA 1ITGA 1K9MO 4KKOA 1YTAA 5AQHA 4ILJA 2QK9A 2NRTA 3J8AA 1NJIO 3QICA 1S1XA 3ENOA 5M1QA 4DU1A 1NGDA 2WC9A 3W3DA 3V9UA 3ZT2A 4E7HA 3DOKA 4DV5K 4OGCA 4AHRA 1XMOK 4B3SK 1HX1A 2JLEA 2QWOA 4DSEA 4A2AA 3MMVA 3G0ZA 4EAHD 4V19S 4LSLA 1BDGA 3ZX3A 3H3OB 1DKGD 1NJXA 4IOXA 1IG8A 2EX3A 3TI0A 3RMBA 4CJPA 4OPJA 1WAJA 5M1FA 3C6AA 3J7ZO 2UU9K 2D0CA 4DSKA 2ATQA 4JKEA 4ISGA 4ILHA 5FPNA 2D0PA 1TKDA 4KTWA 4DV6K 1UAXA 2KKZA 3CCMN 2BE2A 2YHWA 4CZMA 3MXJA 3ATUA 3TAQA 3A5NC 1NGGA 3BGRA 3MX5A 2DFEA 4B8CA 3L8BA 3ULDA 4R5PA 2XRIA 3KWGA 1FXXA 1C0TA 1ILYA 1KLMA 4KHUA 1NGAA 3OYNA 1RGIA 3R6MA 5HRNA 3TAFA 2NRHA 4BRIA 1JCGA 3FGUA 3RR7A 3LDLA 4GKKK 3HPOA 3D2FA 2HHQA 3KZBA 4DTJA 3CD6N 3VEXA 1QSLA 1NK0A 4AHUA 4KREA 3ENHA 4JK8A 2IAJA 4EHTA 5AQKA 3SPZA 1OH5A 1VQNN 2HVHA 2P9KA 4CZGA 4CFDA 4C8NA 3VESA 4BRKA 1KXPA 3MX2A 2YKMA 4CECA 3HXMA 5C25A 1VSLA 3K57A 2UYTA 3TARA 1S3XA 3OYJA 1EP4A 3MEGA 4JHDA 1IO2A 3IFRA 1NJYA 4H0OA 1BISA 4K41A 1QQMA 4CFAA 4ZHRA 1BGXT 3MAQA 3VPZA 4YHHK 3ZLJA 4U67L 3I0RA 4DLEA 4CK2A 3PIOL 5KQDA 2BANA 2HNYA 2PAVA 1VQKN 3D2FB 4H4MA 4BRHA 2E1YA 4F2RA 2P9SB 4M3ZA 1KLNA 1OH7A 4E1JA 1WNSA 4FM0A 1RILA 5AQFA 3QBXA 5KGWA 3ASMA 4CF0A 4Q5VA 4W5TA 5BRFA 3AAQA 1VSDA 4WQ5C 3RVCA 2B5JA 2P9KB 4GMJB 4I9LA 3WUHA 1J54A 3OTOK 1HKCA 2HHSA 4Y0WA 3VQBA 4F3TA 3D2EA 4WQ4C 4DV0K 3PO5A 1U6ZA 3H1VX 5EU7A 5F0XA 1GLFO 3O3HA 3QESA 4JHDB 3C65A 4DSFA 5BPMA 5J2MA 2GUPA 2FBXA 2XY6A 3BP8A 1L5UA 5EY4A 3QEXA 3L2RA 1YT3A 3O1WA 3J81O 3NGYA 4HUFA 3SUNA 1HNWK 4OGEA 1Z26A 2GEMA 3V9SA 4CGGA 5AQJA 3FZMA 3DLGA 1NMDA 3FZLA 1UWBA 3O9SA 3SI6A 3THYA 4I2QA 4CHZA 3SV4A 3QNOA 3OJSA 2H3GX 5EOYA 3SUQA 1IG9A 3LDNA 1KSPA 2OPRA 2D0BA 3LPTA 4FLVA 3M8PA 3AVFA 5KI6A 3SV3A 3I33A 5ADXH 4Q0BA 3ATVA 3EO3A 3JS6A 3LWLA 2QW9A 4BRGA 2P9UB 3KK7A 4XH5A 1X9JA 1TYQA 2G8HA 2FBTA 1GOCA 3MN9A 1KCFA 1LWCA 3ALYA 5AQIA 3TAEA 2E20A 4UY8O 4X62K 2VQFK 3WT0A 4A5AA 4NCAA 3O9UA 4BDYA 3CC2N 3A2FA 1JL1A 3VTHA 1RT4A 4CESA 4M42A 1LWEA 5AZIA 4KI4A 3MECA 3GL1A 3LZJA 3CCLN 3VQQA 3SMPA 4H03B 4RTFD 3CYMA 2FC0A 4CJ7A 2QM1A 2RPIA 2ASMA 1NGBA 1ASVA 3ZSWA 3K5NA 3SAHA 3THYB 1RDDA 3NDKA 5DM6L 4FO0A 3G71N 4DV4K 1NGEA 3V9WA 3FZHA 5CYMA 1QHAA 2NRVA 2CGLA 3L4QA 1MDUB 3T1YK 4K25A 4Z4CA 2ZWHA 4DLGA 1TYQB 2FSKA 4CBXA 2Y1IA 4C23A 4LD0A 3R9PA 1VQLN 3QEIA 3IMXA 3M8QA 5E26A 5KPZA 5I42A 2RE2A 2G8IA 1HYSA 3PX4A 4BE1A 2O8DA 4HCCA 4Z4IA 3U3GA 4FK0A 4JI1K 4FXDA 5AQYA 1KD1O 2FBVA 4GV9A 4H5VA 3VERA 4B1VA 3ZT0A 4JI6K 5AZIB 3ZSZA 1GLJO 1E3MA 3QBWA 5J2NA 3PSFA 4K43A 3RMDA 4DQQA 4C8KA 1FKPA 2ITMA 5GIPA 4KRFA 3HK2A 3GG4A 3QMLA 1LOTB 4C8OA 5JVHL 1Z25A 4EFHA 3UKRA 3NMUA 2HBMA 4B9LA 2A1RA 1Q8IA 1E4FT 3CPEA 3CERA 4OJRA 2BGGA 4DV7K 1IV0A 3VGMA 2QEXN 3F2KA 4NXMK 4CJQA 2GUIA 3VQ8A 2F96A 3ZEUA 3DLRA 4IG3A 3V6DA 1BHLA 1OVYA 2E2OA 4BE2A 3KTQA 3ZETB 1OH8A 1UA0A 2XO7A 1WAFA 3S3OA 3QB0A 5JVGL 1U4BA 1X9WA 4FJJA 4W5NA 2IVPA 4G9ZA 4KB1A 4CJLA 4BGAA 2NNWA 5J2PA 1BUPA 1WBDA 3AARA 2ZGZA 2ASPA 4LC9B 1X1PA 2ZQBA 2NLXA 1B9FA 2VG7A 1KRPA 1XNRK 4CZEA 2HMPA 1VQ5N 4BRDA 2RN2A 1NK5A 2ZF5O 3ZSQA 4KHQA 4Z4HA 3EZ5A 5AQMA 5CYQA 1SKRA 4BROA 1BWFO 1VHXA 1RTHA 3O9QA 4ELTA 3OYLA 1A5VA 1NM1A 3U9DA 3RRHA 5AFUH 2O8BA 1YJ9N 1KFSA 3I0SA 3ZEUB 5C15A 4DFMA 4FZXC 1OVQA 4JKAA 3W0LA 4DQSA 5KQ8A 1RT3A 5BN9A 3CCSN 4FJGA 5CZ2A 3L2VA 1BA1A 4CEOA 4CJ3A 3AA5X 4HVJA 3PX0A 3MXMA 3OYKA 2IOCA 3CCQN 1Q86O 1SZ2A 3E1YA 2FBYA 3LDOA 3OYGA 2ZM6K 4BRMA 4NXNK 5M1OA 4OKEA 4CK1A 4K0KK 3VQ5A 4BR2A 1GLCG 1VQ8N 3OYDA 1RT7A 2Z1JA 3I8BA 1YTUA 2QWLA 2QWMA 4KO0A 1CXQA 3LZIA 1KC8O 1N36K 1W9HA 3FE1A 1WBBA 2O8BB 2A41A 3SBGA 4FJMA 2QI2A 1T7PA 2IDOA 4C1NK 3K0SA 3C7NA 3WXKA 3ID8A 2UXCK 2VG6A 3K2PA 4KI6A 1T6CA 3G4SN 3VA0A 1V4TA 1RDCA 4M41A 1N32K 4B3MK 2NRXA 4FLUA 3THVA 2X78A 5GAGP 1G99A 1JLBA 2NRRA 1HUXA 2KW4A 5E84A 3V9XA 4DTPA 4IOAL 3H45C 4C1NI 4CIGA 3SPYA 3NGIA 4B08A 3D6RA 3CFPA 1VQON 2X6SA 2CH5A 3MEDA 3NF9A 4M3YA 4FWMA 4FOEA 3ZYYX 3P83D 4FL9A 3QFPA 3OYCA 1DLOA 1JLFA 3G10A 2HMIA 1LW0A 1S6PA 5BPNA 4MO5A 2E6LA 1CXUA 4EZ6A 3OYFA 3C7NB 1E4GT 5F2RA 4A61A 4CD1A 2RF2A 2GV9A 5C42A 3NHGA 1J5EK 1HRHA 3BDPA 4WF9L 2ZE2A 4M63C 4H0YB 3NF6A 3VQEA 1N33K 2WONA 4J8FA 4AHTA 3AY9A 3RMAA 1JKHA 3AA2A 1NJZA 3DLHA 1NKEA 4CGHA 2YCHA 4BG8A 3B6OA 4B9NA 1RTIA 3KVGA 2GWKA 4FLYA 3TR8A 4B9UA 5CR4A 2A6AA 2G8KA 2FXUA 4MFBA 1DTQA 4CEZA 3KK3A 3WNGA 4WQ5A 1NBWA 5JLHA 3D45A 3PO4A 1R59O 1YJNN 1M1KO 4JKFA 2BDPA 4CHNA 3SUPA 2V51B 1J5OA 5GIOA 2NZTA 3WXMB 4WQ4A 4AM7A 2JGUA 4XH1A 5CE3A 4YOYA 1V4SA 1MWMA 3T1AA 4KHNA 5FRMA 3OJUA 4LF7K 4CJ5A 4O4GA 4HCBA 3LDSA 4BVPA 1XHXA 4DQPA 2PBDA 3O80A 4MO4A 3MCPA 5LY3A 3KWIA 4CJVA 3D7EO 1K8AO 3OYAA 4M3RA 2BTFA 3O3FA 1B9DA 4JYAK 3U3YA 1KVAA 1TUUA 2OZSA 3QNNA 4IG0A 4M7YA 2G8VA 3O8MA 3HZ6A 3JSMA 4C8MA 3B8AX 4M3XA 5FPDA 2G8UA 3WNEA 4CZFA 1KAZA 4DR2K 1IBLK 1JLAA 1KAYA 4DF8A 3V1QA 3RMCA 4DTOA 3IUCA 3DM2A 4YY3K 4DTXA 1IKVA 1C0UA 3UB5A 4CJEA 5C24A 2ETJA 4YFUA 5C0YA 1NU0A 4H4OA 1TKZA 4DQ8A 3K9KA 4GV6A 1ZXOA 2P9IA 4JKDA 5JMVA 2O4IA 3BEXA 2WOMA 3BF3A 4CGFA 3H08A 2WTUA 2OTLN 1RBVA 1CLQA 4B8AB 5AQPA 4M3WA 2JWLA 4RG8A 3HJFA 5EVZA 4CZJA 3OYEA 4JKGA 3MWPA 4QS7A 4IDHA 4AILC 3MN6A 4DHYA 4JK9A 2RKIA 1DGKN 1L3VA 4DFPA 3ZCMA 4FM1A 4B9VA 4CGJA 1SAZA 4BC5A 4CJTA 4JKCA 1NK4A 3HVTA 4L3QA 1XI1A 5B8HA 3KLIA 4X66K 3HTVA 3EKSA 4N5SA 4JS4A 3A5OC 1L3UA 3UKUA 3O5BA 4FPBA 2UUCK 3LM2A 2OYQA 3THWA 1NK7A 3V4IA 1VSHA 1WSGA 1HQUA 2D0OA 2QWQA 1RDAA 3SMSA 4CBWA 1KVCA 1D5AA 3LP0A 4FWOA 5M1NA 4DTSA 5BPLA 3Q7BA 1UOCA 4JI0K 5BREA 1VQ6N 4CZLA 1T6DA 4LH5A 4E3SA 3VQDA 4BRPA 2J4RA 3BY5A 1W97L 2VGNA 4A2BA 2PZSA 2A1SA 3CJ7A 4GVMA 3PLAA 1J9AA 4M7XA 3EL2A 1ASWA 3O4WA 1J53A 4PWDA 3LP1A 1BU6O 4ID1A 3I56N 4PA1A 3S9HA 1GLAG 4CJWA 3AVNA 5BR8K 3E01A 3K5OA 4A62A 4NB4A 2HHHK 3V1OA 1LAWA 3E9OA 1YHQN 3NCIA 3QFUA 2VWKA 4WFBL 3S3NA 2OPQA 2HB5A 1ASUA 4JI5K 4E1NA 2BUPA 4Y1DA 4DFKA 1YUWA 3HPHA 3MDQA 2E5LK 4M3UA 1C0GA 3A5LC 4CIFA 4J2BA 4DCHA 3TTDA 4FCYA 4WFAL 5FDLA 1S6QA 3MN5A 2OTJN 1CZAN 5KPRA 1RT2A 4EHUA 1CZ9A 3CCVN 1ZC6A 4BR0A 4HUGA 1S9EA 3ZT3A 2O4GA 4FJ8A 1K6YA 3CETA 4B3OA 4FJIA 3CM6A 2DY4A 3TANA 5C2DA 4LSNA 5IT9O 1TAQA 2YNGA 3CJ9A 3CIPA 4DV3K 3EKUA 1ATRA 4FJ9A 3R8EA 4B3TK 3ULEA 1S1WA 1BL3A 2IIRA 3TTFA 1EQYA 1GOAA 4IO8A 2B6AA 4GVEA 1LCUA 3AV9A 1ESVA 3LP3A 1BA0A 4DS4A 1RBTA 3U8XA 3NGZA 4JI2K 1SQKA 3A5MC 1WSEA 1ZBHA 4LY7A 1J6ZA 1RCHA 3L3UA 2PYLA 1OH6A 1WSHA 4DWIA 2D1KA 3C6UA 4FWSA 2Q3SA 3O3GA 1NJWA 3DOLA 2VYPA 3D2EB 3TSPA 4C8LA 4FLZA 4DU4A 1BIZA 2Q2RA 4FLXA 3KK1A 4KB0A 1C1BA 2W6KA 4DSLA 4FJXA 3SAGA 1JLEA 4LF8K 3MEEA 5A2QO 3QIPA 3T7ZA 5HL7L 1Y64A 3P38A 5I3UA 3PX6A 1EO1A 3ULEB 1WSIA 3R3LA 4YORA 2CGJA 3SQ0A 4O0JA 3SAFA 3O9TA 4CHOA 1HMVA 1K8KA 4KHPK 3C6TA 4H5NA 3TTCA 1M90O 4RW6A 4ISFA 1RDBA 1KAXA 1Q81O 1JXEA 1VQ7N 1N6QA 1F21A 3SZ2A 4ISEA 1VSIA 2YHAA 2NRWA 4FJLA 3F5TA 3L2WA 4IDKA 1JCFA 4QAGA 3E9LA 4IJAA 5BR9A 2ITGA 4X64K 4O55A 2DFHA 4NYFA 3TAPA 4IFVA 1U2VA 4FWRA 4JN4A 4BWMA 3P1GA 4JAXA 5HRSA 2W41A 1T05A 3VOVA 3AAPA 3ZSXA 3CFOA 3QIOA 3KK2A 1EETA 2LSNA 3H1QA 4LF4K 2WUSA 5HRPA 3BF1A 2UUAK 4BY9C 3P5JA 4XIUA 4N76A 4HUEA 3H3NO 4FK4A 2AP1A 1NK8A 1K8KB 4A59A 3J7YP 4CFBA 3WXJA 3CC7N 4JV5K 3DXMA
chains in the Genus database with same CATH topology
2UXCK 4JI2K 1HR0K 4YHHK 5LMNK 4JI0K 4DV5K 1XMQK 1XMOK 1N32K 4CVNE 4B3MK 4DR1K 4B3SK 4JYAK 3T1HK 4V19S 4AQYK 3J80O 5FLXO 1XNRK 4JI7K 4DV4K 4DR2K 1IBLK 4JI8K 4CW7B 2UUBK 5AJ3K 4LF8K 5A2QO 2UU9K 3OTOK 5BR8K 4YY3K 4LF5K 3J7AP 3T1YK 4LFBK 4LF6K 4DV2K 2UXBK 4DV0K 4B3RK 1HNZK 4DV6K 2HHHK 4KHPK 4DR3K 1IBMK 4LF9K 1J5EK 4JI1K 4DUYK 3J81O 1HNWK 1N33K 4JI5K 4JI6K 4DUZK 2E5LK 4GKKK 4X64K 2F4VK 5IWAK 4DR7K 4JI3K 4GKJK 1IBKK 1I94K 3JAMO 4X66K 2ZM6K 4OX9K 4NXNK 4K0KK 1FJGK 1XNQK 2UUCK 5IT9O 4DV3K 4LF4K 4B3TK 4X65K 4DV7K 2UUAK 5LL6Z 2UXDK 2VQEK 4NXMK 4DR6K 1N36K 4JI4K 5LMUK 4DR5K 1N34K 4DV1K 1HNXK 4LFCK 4DR4K 3J7YP 4LF7K 4X62K 2VQFK 4JV5K 4LFAK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC K;  4JI2 K;  1HR0 K;  4YHH K;  5LMN K;  4JI0 K;  4DV5 K;  1XMQ K;  1XMO K;  1N32 K;  4CVN E;  4B3M K;  4DR1 K;  4B3S K;  4JYA K;  3T1H K;  4V19 S;  4AQY K;  3J80 O;  5FLX O;  1XNR K;  4JI7 K;  4DV4 K;  4DR2 K;  1IBL K;  4JI8 K;  4CW7 B;  2UUB K;  5AJ3 K;  4LF8 K;  5A2Q O;  2UU9 K;  3OTO K;  5BR8 K;  4YY3 K;  4LF5 K;  3J7A P;  3T1Y K;  4LFB K;  4LF6 K;  4DV2 K;  2UXB K;  4DV0 K;  4B3R K;  1HNZ K;  4DV6 K;  2HHH K;  4KHP K;  4DR3 K;  1IBM K;  4LF9 K;  1J5E K;  4JI1 K;  4DUY K;  3J81 O;  1HNW K;  1N33 K;  4JI5 K;  4JI6 K;  4DUZ K;  2E5L K;  4GKK K;  4X64 K;  2F4V K;  5IWA K;  4DR7 K;  4JI3 K;  4GKJ K;  1IBK K;  1I94 K;  3JAM O;  4X66 K;  2ZM6 K;  4OX9 K;  4NXN K;  4K0K K;  1FJG K;  1XNQ K;  2UUC K;  5IT9 O;  4DV3 K;  4LF4 K;  4B3T K;  4X65 K;  4DV7 K;  2UUA K;  5LL6 Z;  2UXD K;  2VQE K;  4NXM K;  4DR6 K;  1N36 K;  4JI4 K;  5LMU K;  4DR5 K;  1N34 K;  4DV1 K;  1HNX K;  4LFC K;  4DR4 K;  3J7Y P;  4LF7 K;  4X62 K;  2VQF K;  4JV5 K;  4LFA K; 
#chains in the Genus database with same CATH topology
 3AO3 A;  1JLQ A;  1QVG M;  1VQP N;  2GX9 A;  4KBO A;  3SUO A;  3L4I A;  4O0I A;  1EXQ A;  1T3V A;  4F2S A;  3FFK B;  1FW6 A;  4WFN L;  1TGO A;  1U04 A;  3RR8 A;  4KFB A;  5I9E B;  4H0T B;  3IKM A;  1C0M A;  1GLL O;  1TL1 A;  4IJN A;  1RBS A;  5FLX O;  3TSU A;  2PFU A;  1SV5 A;  1IH7 A;  1SL0 A;  3HI0 A;  3VQ6 A;  3SQ1 A;  2O8D B;  4CW7 B;  4BG9 A;  1JLC A;  1QE1 A;  2YJE A;  3TWH A;  1VK0 A;  3WQT A;  1HKB A;  1QZ6 A;  1BI4 A;  4B1U B;  1BQM A;  4H8K A;  4FWQ A;  1JL2 A;  3ZX0 A;  3OYH A;  3DI6 A;  3KIO A;  2Q1N A;  3N4Q A;  3WXI A;  3OYB A;  3M1F A;  3QO9 A;  2D4W A;  3QER A;  4CF8 A;  3NBP A;  4JKH A;  4O5F A;  3ZT1 A;  5C10 A;  4EZ9 A;  2FSN A;  4PKI A;  1IBM K;  4DS5 A;  3DXK A;  2GBZ A;  3NH2 A;  4B9S A;  2O8E A;  2A3Z A;  4LF9 K;  1GLD G;  4JLH A;  2XY5 A;  4OLA A;  3UKR B;  5BN8 A;  3GDQ A;  1RDW X;  3KKR A;  3EY1 A;  4B9T A;  3NVM A;  4BE0 A;  1WB9 A;  1U45 A;  1BCM A;  1JCE A;  1RTJ A;  4AHV A;  5F1X A;  4CF1 A;  1DEJ A;  2QWR A;  1TK5 A;  3KLG A;  3EZW A;  4JNE A;  4W5R A;  1JXB A;  3SYZ A;  1IJJ A;  4IBN A;  4DG1 A;  4CJU A;  2HNZ A;  1U48 A;  3ENB A;  3C0B A;  1R0A A;  3VET A;  4H5T A;  3L6Q A;  3MXI A;  4B9Q A;  1BIU A;  4G1Q A;  5HP1 A;  5HOO A;  4DSJ A;  2Y1J A;  4FJH A;  5LL6 Z;  2VQE K;  4N56 A;  1C6V A;  4JI4 K;  4RW9 A;  1ZYQ A;  3SQ2 A;  4M3T A;  3GOI A;  3FLC O;  5JS2 A;  3KD5 E;  3NH0 A;  2I7P A;  1NLV A;  3DXK B;  3LAN A;  3M8S A;  3CQ8 A;  1S1T A;  3ISN C;  4PL8 A;  5DM7 L;  4RCH A;  4CK3 A;  1B92 A;  4BR7 A;  4F9O A;  4E7J A;  4AHS A;  1BO5 O;  4CEE A;  2ZJP L;  3AVC A;  4CVN E;  4N41 A;  3AGR A;  1S1V A;  2P51 A;  3VEY A;  4CCH A;  1D9F A;  1NGI A;  3AVI A;  3CJB A;  3L3V A;  3CG7 A;  1HPZ A;  2VCP A;  5AR0 A;  5AQS A;  4IXC A;  3SJH A;  1WSF A;  2QWP A;  4B1Y B;  4PL7 A;  2V52 B;  5JS1 A;  1RT1 A;  1SUQ A;  2A40 A;  2Q97 A;  3ZSO A;  4BC3 A;  1LV5 A;  2G8F A;  2KFN A;  5C12 A;  1A5W A;  1YXQ A;  4XEI A;  2V7Y A;  1S22 A;  1S9G A;  3FZK A;  4NCG A;  4CJF A;  4LF5 K;  3CQY A;  5LJV A;  2HND A;  3J7A P;  1FK9 A;  3NF7 A;  3A8Y A;  1Q82 O;  4CHQ A;  3OS0 A;  4CZH A;  1S72 N;  3NE6 A;  5SWM A;  4CJR A;  4BDZ A;  4YNQ A;  2XY8 A;  4BVO A;  4BDP A;  2EHG A;  3DLE A;  1HNV A;  3HRG A;  4M45 A;  1JJ2 M;  4OLB A;  4E7L A;  3E9P A;  3KLE A;  4KHY A;  1TL3 A;  5ELZ A;  3AGK A;  4YOV A;  2ZGY A;  2F4V K;  4MLE A;  3MK6 A;  1YAG A;  1DT9 A;  3N4P A;  3AA4 A;  4JI3 K;  1QTM A;  4BGB A;  4HTU A;  4CHP A;  1Q9Y A;  4IOC L;  4OX9 K;  3ZT4 A;  3U4L A;  3WEE A;  3ZSR A;  5DMR A;  3KLH A;  1Q18 A;  5SZT A;  3HOT A;  4OKJ A;  4CEB A;  3VF2 A;  2PYJ A;  1RDU A;  4CEQ A;  1NKC A;  4CEA A;  1EWQ A;  4DTU A;  2XHB A;  5HRR A;  1Q7Y O;  4LFC K;  4Z4F A;  4DR4 K;  1WOQ A;  4B1W B;  5KRT A;  4KHS A;  3T19 A;  3LAK A;  2E6M A;  4RW7 A;  1G15 A;  5AQR A;  1QSS A;  1IKW A;  3VEZ A;  3HOS A;  1RFQ A;  1U49 A;  2D5R A;  1MWK A;  2IVN A;  4DTM A;  2YNH A;  3T1H K;  1TV6 A;  1DTT A;  3IDH A;  3C94 A;  1EWR A;  3J80 O;  5EXW A;  3M5R A;  3THX A;  3UE5 A;  4IO9 L;  2HBJ A;  3AO2 A;  3MCA B;  5GIN A;  4BRQ A;  3T3F A;  1EKE A;  1NGJ A;  3WEE B;  2UUB K;  4RW8 A;  4H5R A;  4BRN A;  3L2Q A;  4Z4G A;  3ID6 A;  1ZBL A;  5AQV A;  4KH6 A;  2WFB A;  4BAC A;  2IGI A;  2P9L A;  4Z0U A;  4AH9 A;  4IFY A;  3NVK A;  2OA8 A;  3E66 A;  4FWP A;  4O8U A;  3CPW M;  2HF3 A;  5J2Q A;  2HHU A;  2P5O A;  4BC2 A;  2P9P A;  4E89 A;  3AA3 A;  1YVN A;  3FR0 A;  4MLH A;  3VF4 A;  1WLJ A;  4J2A A;  1KQS M;  2VWJ A;  4KAZ A;  4YOU A;  4CZK A;  1N5Y A;  1C1A A;  3QET A;  4QOZ B;  4OKK A;  3RWU A;  4NLC A;  1Z05 A;  1Q9X A;  5KGX A;  2O8F A;  2HBK A;  1I39 A;  4OPH A;  3OS1 A;  4MDB A;  3R1X A;  4XH4 A;  2KZZ A;  1YI2 N;  5IWA K;  3OYI A;  2R7Y A;  1UA1 A;  3VF6 A;  3THX B;  3AVL A;  3V9Z A;  2W40 A;  1Y97 A;  3OHR A;  2W42 A;  5AQZ A;  1FJG K;  3AVG A;  2WBN A;  4DMN A;  3CC4 N;  1I3A A;  3KHY A;  3RTV A;  4BR4 A;  4FJK A;  4FVM A;  3HSC A;  5KPT A;  1L3T A;  1TK8 A;  1XWL A;  4HWI A;  2YJF A;  2YV0 X;  1HYZ A;  3CCE N;  3HM9 A;  4CF2 A;  5FPM A;  1NGC A;  1RNH A;  1CZB A;  2P9L B;  1NGF A;  4UQG A;  3LAM A;  1X9S A;  1GOB A;  1T44 A;  5AFU A;  1EX4 A;  1GLE G;  4F4K A;  4QS9 A;  3NH1 A;  3JYT A;  3K9J A;  4KTZ A;  2FF3 B;  4BWJ A;  2E2P A;  4LFA K;  3F9K A;  1HR0 K;  2P9P B;  2ZJR L;  5MLC Q;  3VN5 A;  1RT5 A;  3U6F A;  3M3Z A;  4BRE A;  4FSV A;  3LAL A;  3NAE A;  3CME N;  3H6E A;  3AO5 A;  2AA4 A;  3LPU A;  4L8R B;  3AVJ A;  2OPP A;  3QEP A;  4B9M A;  2O8F B;  2F8S A;  3LP2 A;  1QZ5 A;  1ATS A;  3GE1 A;  2P9I B;  2FF6 A;  3TAM A;  3DRR A;  1S1U A;  3DJC A;  4YOT A;  4B1X B;  1NG9 A;  3L0Q A;  4WYB A;  2OCE A;  5EX5 A;  3CF5 L;  1QSY A;  3PUF A;  4JKG B;  5GAH P;  1KVB A;  3WNH A;  4LF6 K;  4DV2 K;  2P9S A;  2Q0U A;  3O08 A;  4I6M A;  2HHV A;  3OYM A;  4ID5 A;  5JLF A;  3AVB A;  3TAG A;  4IZ9 A;  4NO7 A;  1X3N A;  4K8X A;  4ZTF A;  1YIJ N;  2AJQ A;  3H46 O;  2G8W A;  3O6W A;  5AZJ A;  2BH1 A;  3IG1 A;  3UKU B;  2I5J A;  5AQT A;  4PKH A;  1SL2 A;  4E19 A;  3K59 A;  1XHZ A;  5HBM A;  3CJA A;  3THW B;  2OAN A;  4JRP A;  3CCU N;  3SK3 A;  5D3G A;  3D0P A;  5H1S Q;  2KTQ A;  2VGM A;  3HBT A;  4DU3 A;  1IBK K;  5AQL A;  2HHX A;  1HQE A;  1ZBF A;  4FVU A;  4KH5 A;  4DTR A;  4QS8 A;  3DLB A;  3L2U A;  4GNI A;  5AQU A;  2Q31 A;  3DAW A;  4NCB A;  2GTD A;  3MWT A;  3QLH A;  1IKX A;  2YI1 A;  4PHT X;  2YKN A;  4ZTJ A;  4X65 K;  1YF5 L;  3VGK A;  3MN7 A;  1X9M A;  3DMJ A;  4KHW A;  4I6M B;  2QKK A;  5LMU K;  1NWK A;  1D9D A;  1TUY A;  3F73 A;  2FLO A;  4DV1 K;  1HNX K;  2YHB A;  3QEW A;  4IEE A;  4IEI A;  4KTQ A;  4BC4 A;  5KTQ A;  4QCL A;  3WQU A;  5T7B A;  5AZJ B;  3RSE A;  2P9U A;  2RHK A;  5BRD A;  1W2B M;  3KJV A;  4E7I A;  3AVM A;  4Z4E A;  4I2P A;  4R79 A;  2KFZ A;  5AQG A;  5HLF A;  3CI5 A;  1MU2 A;  2E1Z A;  4FWK A;  1KTQ A;  5TKW A;  3EYZ A;  4GW6 A;  1XQS C;  3KLF A;  3K5M A;  3LDQ A;  4CFC A;  4JI7 K;  1QS4 A;  3O4N A;  1MA9 B;  3VEO A;  4JI8 K;  5AJ3 K;  2D0A A;  1YIT N;  2QXF A;  3BZK A;  1REV A;  2A42 A;  1QQC A;  5AQN A;  3TAB A;  1NGH A;  1VSF A;  1K73 O;  2QTD A;  4HHT A;  1VSK A;  3AVH A;  3P4I A;  1NOZ A;  3HL8 A;  3EE9 A;  2OPS A;  4DR3 K;  3HP9 A;  1BQN A;  1VRT A;  4ICL A;  3IRX A;  4DFJ A;  4O44 A;  3CCR N;  4DQR A;  2F9W A;  3BUZ B;  2YNF A;  3RSE B;  3AO1 A;  3NFA A;  4GV3 A;  2DTU A;  1P90 A;  5DK5 A;  3LM9 A;  3O4Q A;  5FRO A;  2HHW A;  4DR7 K;  3VA3 A;  3O9R A;  4DF4 A;  4RWT A;  4CJS A;  3JAM O;  5LJW A;  4CI6 A;  1H1V A;  1OKJ A;  4WE1 A;  4E1M A;  4FZZ A;  3LL3 A;  1TKT A;  2X6N A;  4YDU A;  3I55 N;  4ELU A;  1WUA A;  5AQW A;  1QHT A;  4BRL A;  2P1J A;  3TU5 A;  2UXD K;  5AQQ A;  3OVN A;  4DR5 K;  1ZBU A;  4CGD A;  4IWV A;  2YHX A;  3UIQ A;  2ZD1 A;  2Q0R A;  3RRG A;  1L3S A;  4LH4 A;  3AVA A;  3VMF B;  4Y1C A;  1S5J A;  4B1Z A;  1RBR A;  1XMQ K;  3SJJ A;  1TKX A;  4OVL A;  4CED A;  1SKW A;  3HO1 A;  5JIC A;  5BRH A;  4DR1 K;  3KKS A;  3SLC A;  3TSQ A;  1ATN A;  2P5G A;  4Z94 A;  1VRU A;  4AQY K;  1QVF M;  3GBT A;  4U7B A;  3FZF A;  2P9N A;  3M8R A;  4AM6 A;  3ZET A;  3WXL A;  4FZY A;  4O5B A;  4BRA A;  3BZC A;  2Z1G A;  2IS3 A;  4CGI A;  1HJR A;  4CIE A;  4DSI A;  2NRZ A;  1NK6 A;  4JKB A;  1U47 A;  3ZSY A;  4FJ5 A;  4FPA A;  4KV8 A;  3S3M A;  3IS9 A;  4FOI A;  4KH4 A;  3NF8 A;  3VEV A;  4CBU A;  3O1B A;  4JD2 A;  4B3R K;  4H0P A;  1SKS A;  3DLK A;  2E2N A;  3DRS A;  3HST B;  1NOY A;  3DRP A;  3EEQ A;  3ZX2 A;  1U2V B;  1QQN A;  2E88 A;  4H0X B;  3PY8 A;  4DUY K;  1TAU A;  3B6P A;  3I8D A;  4HTL A;  4DUZ K;  3K58 A;  1WSJ A;  2ASO A;  4OO1 J;  4NLB A;  4JEP A;  3CQX A;  3CJ1 A;  4JS5 A;  5J1E A;  4OPK A;  3CCJ N;  4W5Q A;  2ZJQ L;  3G6E N;  2HF4 A;  4H5W A;  2P9N B;  1YJW N;  4J2E A;  1N8R O;  4BQZ A;  2X74 A;  4O8K A;  3DXM B;  3P31 A;  5CHI A;  3SCX A;  4OPA A;  5AQX A;  4EP4 A;  4F3O A;  4CER A;  2CGK A;  4A5B A;  2IC3 A;  4GY2 B;  4JK7 A;  2I7N A;  4H0V B;  3JXU A;  2GWJ A;  4JD2 B;  1XUP O;  4DR6 K;  3VQC A;  2GEL A;  2O8C A;  2HHT A;  4PY5 A;  2V7Z A;  3S41 A;  1HLU A;  1JLG A;  1LWF A;  3ZSV A;  4J2D A;  4WCE L;  2E2Q A;  1HPM A;  2A5X A;  2IVO A;  4EP5 A;  4CD3 A;  3QIN A;  3C95 A;  4NYN A;  2OZM A;  1HYV A;  4FYD A;  3K5L A;  1BI4 B;  3Q7C A;  1VAZ A;  1KFD A;  3WNF A;  1T03 A;  4CJ4 A;  2KZM A;  5FRN A;  4CZI A;  3QDK A;  2Z1I A;  3VEN A;  3TPQ A;  5KRS A;  5K14 A;  3VQP A;  1RBU A;  3A0I X;  4TSX A;  4IKF A;  2FSJ A;  2O8E B;  3SQ4 A;  4I7F A;  1LW2 A;  3EE8 A;  5C2F A;  3G25 A;  2HOE A;  2HST A;  3HP6 A;  3HT3 A;  3M6G A;  1SL1 A;  2F8T A;  1BOT O;  3VEW A;  4CJK A;  3C6H A;  1VQ4 N;  4CE9 A;  1C0F A;  1NK9 A;  2O8C B;  1HJO A;  4K42 A;  1Z6R A;  4DKW A;  3OY9 A;  2QWN A;  3CJC A;  5M1P A;  1O1W A;  3V81 A;  2Z1H A;  4ELV A;  2VWB A;  4BQL A;  3VQ4 A;  4CHY A;  1D4X A;  4DTN A;  4FK2 A;  3OBW A;  2DFF A;  1XC9 A;  2EWS A;  2YX6 A;  3IAY A;  5ADX A;  3VQ9 A;  4YDU C;  2KQ2 A;  5GAE P;  5M1K A;  5GAD P;  4BR9 A;  1ZBI A;  4A57 A;  2CH6 A;  1HNI A;  3LDP A;  3PV8 A;  2VG5 A;  3F9M A;  2NUB A;  4E7K A;  2W6L A;  4MDA A;  4DQI A;  4FJ7 A;  1SS6 A;  1I94 K;  2Q36 A;  3VQA A;  2F9T A;  5E41 A;  4AF1 A;  3SNN A;  4BRC A;  4PQU A;  2F7T A;  3OW2 M;  1W0H A;  3HM8 A;  3T69 A;  3LWM A;  4FLT A;  3OA9 A;  1XNQ K;  3QEV A;  4K8Z A;  5HRO A;  2PY5 A;  3HPG A;  2QKB A;  4KPY A;  1WN7 A;  4FJN A;  4IFE A;  1NMN A;  2QA4 N;  4I9Q A;  1N34 K;  4PUO A;  4CEF A;  3AO4 A;  3CM5 A;  4EIA A;  5CY4 A;  3DWL A;  4FW2 A;  2DPN A;  4PKG A;  2YHY A;  3DLL L;  4F8R A;  2KLA A;  1A5X A;  3VQ7 A;  4DB3 A;  1RT6 A;  1VSJ A;  5LMN K;  1XC3 A;  3OBY A;  4JRQ A;  1NKB A;  1T8E A;  2JWK A;  2E4L A;  4YOW A;  3U9Z A;  2HW3 A;  1FKO A;  3V1R A;  1TVR A;  1VSE A;  4AHC A;  1VSM A;  5TKY A;  4E0D A;  2KHO A;  2YNI A;  4N47 A;  1W7A A;  2HVI A;  4FWN A;  3VTI A;  4RW4 A;  1C1C A;  4MQ3 A;  2E8A A;  3P39 A;  1NNE A;  1VQM N;  1X3M A;  4FW1 A;  4BRF A;  1HKG A;  4BR5 A;  3EN9 A;  4FM2 A;  5AQO A;  4LFB K;  1D8Y A;  2UXB K;  3PSI A;  1BCO A;  1HNZ K;  3AVK A;  3SBT A;  3PIP L;  1LAV A;  4YOX A;  2XY7 A;  3CMA N;  4FLW A;  1RTD A;  3DYA A;  3KD1 E;  3OS2 A;  1ZBS A;  4ILG B;  1QQO A;  1GLB G;  3CHW A;  3ITH A;  4CF9 A;  2HBL A;  1O13 A;  3CXC M;  5FPE A;  3HYF A;  1TK0 A;  3VGL A;  3CFR A;  2QXL A;  3FFI A;  4GKJ K;  1IKY A;  3HVR A;  2B4J A;  4FWL A;  5CZ1 A;  1BG3 A;  1P8Z A;  1VQ9 N;  1YVU A;  4W5O A;  1ITG A;  1K9M O;  4KKO A;  1YTA A;  5AQH A;  4ILJ A;  2QK9 A;  2NRT A;  3J8A A;  1NJI O;  3QIC A;  1S1X A;  3ENO A;  5M1Q A;  4DU1 A;  1NGD A;  2WC9 A;  3W3D A;  3V9U A;  3ZT2 A;  4E7H A;  3DOK A;  4DV5 K;  4OGC A;  4AHR A;  1XMO K;  4B3S K;  1HX1 A;  2JLE A;  2QWO A;  4DSE A;  4A2A A;  3MMV A;  3G0Z A;  4EAH D;  4V19 S;  4LSL A;  1BDG A;  3ZX3 A;  3H3O B;  1DKG D;  1NJX A;  4IOX A;  1IG8 A;  2EX3 A;  3TI0 A;  3RMB A;  4CJP A;  4OPJ A;  1WAJ A;  5M1F A;  3C6A A;  3J7Z O;  2UU9 K;  2D0C A;  4DSK A;  2ATQ A;  4JKE A;  4ISG A;  4ILH A;  5FPN A;  2D0P A;  1TKD A;  4KTW A;  4DV6 K;  1UAX A;  2KKZ A;  3CCM N;  2BE2 A;  2YHW A;  4CZM A;  3MXJ A;  3ATU A;  3TAQ A;  3A5N C;  1NGG A;  3BGR A;  3MX5 A;  2DFE A;  4B8C A;  3L8B A;  3ULD A;  4R5P A;  2XRI A;  3KWG A;  1FXX A;  1C0T A;  1ILY A;  1KLM A;  4KHU A;  1NGA A;  3OYN A;  1RGI A;  3R6M A;  5HRN A;  3TAF A;  2NRH A;  4BRI A;  1JCG A;  3FGU A;  3RR7 A;  3LDL A;  4GKK K;  3HPO A;  3D2F A;  2HHQ A;  3KZB A;  4DTJ A;  3CD6 N;  3VEX A;  1QSL A;  1NK0 A;  4AHU A;  4KRE A;  3ENH A;  4JK8 A;  2IAJ A;  4EHT A;  5AQK A;  3SPZ A;  1OH5 A;  1VQN N;  2HVH A;  2P9K A;  4CZG A;  4CFD A;  4C8N A;  3VES A;  4BRK A;  1KXP A;  3MX2 A;  2YKM A;  4CEC A;  3HXM A;  5C25 A;  1VSL A;  3K57 A;  2UYT A;  3TAR A;  1S3X A;  3OYJ A;  1EP4 A;  3MEG A;  4JHD A;  1IO2 A;  3IFR A;  1NJY A;  4H0O A;  1BIS A;  4K41 A;  1QQM A;  4CFA A;  4ZHR A;  1BGX T;  3MAQ A;  3VPZ A;  4YHH K;  3ZLJ A;  4U67 L;  3I0R A;  4DLE A;  4CK2 A;  3PIO L;  5KQD A;  2BAN A;  2HNY A;  2PAV A;  1VQK N;  3D2F B;  4H4M A;  4BRH A;  2E1Y A;  4F2R A;  2P9S B;  4M3Z A;  1KLN A;  1OH7 A;  4E1J A;  1WNS A;  4FM0 A;  1RIL A;  5AQF A;  3QBX A;  5KGW A;  3ASM A;  4CF0 A;  4Q5V A;  4W5T A;  5BRF A;  3AAQ A;  1VSD A;  4WQ5 C;  3RVC A;  2B5J A;  2P9K B;  4GMJ B;  4I9L A;  3WUH A;  1J54 A;  3OTO K;  1HKC A;  2HHS A;  4Y0W A;  3VQB A;  4F3T A;  3D2E A;  4WQ4 C;  4DV0 K;  3PO5 A;  1U6Z A;  3H1V X;  5EU7 A;  5F0X A;  1GLF O;  3O3H A;  3QES A;  4JHD B;  3C65 A;  4DSF A;  5BPM A;  5J2M A;  2GUP A;  2FBX A;  2XY6 A;  3BP8 A;  1L5U A;  5EY4 A;  3QEX A;  3L2R A;  1YT3 A;  3O1W A;  3J81 O;  3NGY A;  4HUF A;  3SUN A;  1HNW K;  4OGE A;  1Z26 A;  2GEM A;  3V9S A;  4CGG A;  5AQJ A;  3FZM A;  3DLG A;  1NMD A;  3FZL A;  1UWB A;  3O9S A;  3SI6 A;  3THY A;  4I2Q A;  4CHZ A;  3SV4 A;  3QNO A;  3OJS A;  2H3G X;  5EOY A;  3SUQ A;  1IG9 A;  3LDN A;  1KSP A;  2OPR A;  2D0B A;  3LPT A;  4FLV A;  3M8P A;  3AVF A;  5KI6 A;  3SV3 A;  3I33 A;  5ADX H;  4Q0B A;  3ATV A;  3EO3 A;  3JS6 A;  3LWL A;  2QW9 A;  4BRG A;  2P9U B;  3KK7 A;  4XH5 A;  1X9J A;  1TYQ A;  2G8H A;  2FBT A;  1GOC A;  3MN9 A;  1KCF A;  1LWC A;  3ALY A;  5AQI A;  3TAE A;  2E20 A;  4UY8 O;  4X62 K;  2VQF K;  3WT0 A;  4A5A A;  4NCA A;  3O9U A;  4BDY A;  3CC2 N;  3A2F A;  1JL1 A;  3VTH A;  1RT4 A;  4CES A;  4M42 A;  1LWE A;  5AZI A;  4KI4 A;  3MEC A;  3GL1 A;  3LZJ A;  3CCL N;  3VQQ A;  3SMP A;  4H03 B;  4RTF D;  3CYM A;  2FC0 A;  4CJ7 A;  2QM1 A;  2RPI A;  2ASM A;  1NGB A;  1ASV A;  3ZSW A;  3K5N A;  3SAH A;  3THY B;  1RDD A;  3NDK A;  5DM6 L;  4FO0 A;  3G71 N;  4DV4 K;  1NGE A;  3V9W A;  3FZH A;  5CYM A;  1QHA A;  2NRV A;  2CGL A;  3L4Q A;  1MDU B;  3T1Y K;  4K25 A;  4Z4C A;  2ZWH A;  4DLG A;  1TYQ B;  2FSK A;  4CBX A;  2Y1I A;  4C23 A;  4LD0 A;  3R9P A;  1VQL N;  3QEI A;  3IMX A;  3M8Q A;  5E26 A;  5KPZ A;  5I42 A;  2RE2 A;  2G8I A;  1HYS A;  3PX4 A;  4BE1 A;  2O8D A;  4HCC A;  4Z4I A;  3U3G A;  4FK0 A;  4JI1 K;  4FXD A;  5AQY A;  1KD1 O;  2FBV A;  4GV9 A;  4H5V A;  3VER A;  4B1V A;  3ZT0 A;  4JI6 K;  5AZI B;  3ZSZ A;  1GLJ O;  1E3M A;  3QBW A;  5J2N A;  3PSF A;  4K43 A;  3RMD A;  4DQQ A;  4C8K A;  1FKP A;  2ITM A;  5GIP A;  4KRF A;  3HK2 A;  3GG4 A;  3QML A;  1LOT B;  4C8O A;  5JVH L;  1Z25 A;  4EFH A;  3UKR A;  3NMU A;  2HBM A;  4B9L A;  2A1R A;  1Q8I A;  1E4F T;  3CPE A;  3CER A;  4OJR A;  2BGG A;  4DV7 K;  1IV0 A;  3VGM A;  2QEX N;  3F2K A;  4NXM K;  4CJQ A;  2GUI A;  3VQ8 A;  2F96 A;  3ZEU A;  3DLR A;  4IG3 A;  3V6D A;  1BHL A;  1OVY A;  2E2O A;  4BE2 A;  3KTQ A;  3ZET B;  1OH8 A;  1UA0 A;  2XO7 A;  1WAF A;  3S3O A;  3QB0 A;  5JVG L;  1U4B A;  1X9W A;  4FJJ A;  4W5N A;  2IVP A;  4G9Z A;  4KB1 A;  4CJL A;  4BGA A;  2NNW A;  5J2P A;  1BUP A;  1WBD A;  3AAR A;  2ZGZ A;  2ASP A;  4LC9 B;  1X1P A;  2ZQB A;  2NLX A;  1B9F A;  2VG7 A;  1KRP A;  1XNR K;  4CZE A;  2HMP A;  1VQ5 N;  4BRD A;  2RN2 A;  1NK5 A;  2ZF5 O;  3ZSQ A;  4KHQ A;  4Z4H A;  3EZ5 A;  5AQM A;  5CYQ A;  1SKR A;  4BRO A;  1BWF O;  1VHX A;  1RTH A;  3O9Q A;  4ELT A;  3OYL A;  1A5V A;  1NM1 A;  3U9D A;  3RRH A;  5AFU H;  2O8B A;  1YJ9 N;  1KFS A;  3I0S A;  3ZEU B;  5C15 A;  4DFM A;  4FZX C;  1OVQ A;  4JKA A;  3W0L A;  4DQS A;  5KQ8 A;  1RT3 A;  5BN9 A;  3CCS N;  4FJG A;  5CZ2 A;  3L2V A;  1BA1 A;  4CEO A;  4CJ3 A;  3AA5 X;  4HVJ A;  3PX0 A;  3MXM A;  3OYK A;  2IOC A;  3CCQ N;  1Q86 O;  1SZ2 A;  3E1Y A;  2FBY A;  3LDO A;  3OYG A;  2ZM6 K;  4BRM A;  4NXN K;  5M1O A;  4OKE A;  4CK1 A;  4K0K K;  3VQ5 A;  4BR2 A;  1GLC G;  1VQ8 N;  3OYD A;  1RT7 A;  2Z1J A;  3I8B A;  1YTU A;  2QWL A;  2QWM A;  4KO0 A;  1CXQ A;  3LZI A;  1KC8 O;  1N36 K;  1W9H A;  3FE1 A;  1WBB A;  2O8B B;  2A41 A;  3SBG A;  4FJM A;  2QI2 A;  1T7P A;  2IDO A;  4C1N K;  3K0S A;  3C7N A;  3WXK A;  3ID8 A;  2UXC K;  2VG6 A;  3K2P A;  4KI6 A;  1T6C A;  3G4S N;  3VA0 A;  1V4T A;  1RDC A;  4M41 A;  1N32 K;  4B3M K;  2NRX A;  4FLU A;  3THV A;  2X78 A;  5GAG P;  1G99 A;  1JLB A;  2NRR A;  1HUX A;  2KW4 A;  5E84 A;  3V9X A;  4DTP A;  4IOA L;  3H45 C;  4C1N I;  4CIG A;  3SPY A;  3NGI A;  4B08 A;  3D6R A;  3CFP A;  1VQO N;  2X6S A;  2CH5 A;  3MED A;  3NF9 A;  4M3Y A;  4FWM A;  4FOE A;  3ZYY X;  3P83 D;  4FL9 A;  3QFP A;  3OYC A;  1DLO A;  1JLF A;  3G10 A;  2HMI A;  1LW0 A;  1S6P A;  5BPN A;  4MO5 A;  2E6L A;  1CXU A;  4EZ6 A;  3OYF A;  3C7N B;  1E4G T;  5F2R A;  4A61 A;  4CD1 A;  2RF2 A;  2GV9 A;  5C42 A;  3NHG A;  1J5E K;  1HRH A;  3BDP A;  4WF9 L;  2ZE2 A;  4M63 C;  4H0Y B;  3NF6 A;  3VQE A;  1N33 K;  2WON A;  4J8F A;  4AHT A;  3AY9 A;  3RMA A;  1JKH A;  3AA2 A;  1NJZ A;  3DLH A;  1NKE A;  4CGH A;  2YCH A;  4BG8 A;  3B6O A;  4B9N A;  1RTI A;  3KVG A;  2GWK A;  4FLY A;  3TR8 A;  4B9U A;  5CR4 A;  2A6A A;  2G8K A;  2FXU A;  4MFB A;  1DTQ A;  4CEZ A;  3KK3 A;  3WNG A;  4WQ5 A;  1NBW A;  5JLH A;  3D45 A;  3PO4 A;  1R59 O;  1YJN N;  1M1K O;  4JKF A;  2BDP A;  4CHN A;  3SUP A;  2V51 B;  1J5O A;  5GIO A;  2NZT A;  3WXM B;  4WQ4 A;  4AM7 A;  2JGU A;  4XH1 A;  5CE3 A;  4YOY A;  1V4S A;  1MWM A;  3T1A A;  4KHN A;  5FRM A;  3OJU A;  4LF7 K;  4CJ5 A;  4O4G A;  4HCB A;  3LDS A;  4BVP A;  1XHX A;  4DQP A;  2PBD A;  3O80 A;  4MO4 A;  3MCP A;  5LY3 A;  3KWI A;  4CJV A;  3D7E O;  1K8A O;  3OYA A;  4M3R A;  2BTF A;  3O3F A;  1B9D A;  4JYA K;  3U3Y A;  1KVA A;  1TUU A;  2OZS A;  3QNN A;  4IG0 A;  4M7Y A;  2G8V A;  3O8M A;  3HZ6 A;  3JSM A;  4C8M A;  3B8A X;  4M3X A;  5FPD A;  2G8U A;  3WNE A;  4CZF A;  1KAZ A;  4DR2 K;  1IBL K;  1JLA A;  1KAY A;  4DF8 A;  3V1Q A;  3RMC A;  4DTO A;  3IUC A;  3DM2 A;  4YY3 K;  4DTX A;  1IKV A;  1C0U A;  3UB5 A;  4CJE A;  5C24 A;  2ETJ A;  4YFU A;  5C0Y A;  1NU0 A;  4H4O A;  1TKZ A;  4DQ8 A;  3K9K A;  4GV6 A;  1ZXO A;  2P9I A;  4JKD A;  5JMV A;  2O4I A;  3BEX A;  2WOM A;  3BF3 A;  4CGF A;  3H08 A;  2WTU A;  2OTL N;  1RBV A;  1CLQ A;  4B8A B;  5AQP A;  4M3W A;  2JWL A;  4RG8 A;  3HJF A;  5EVZ A;  4CZJ A;  3OYE A;  4JKG A;  3MWP A;  4QS7 A;  4IDH A;  4AIL C;  3MN6 A;  4DHY A;  4JK9 A;  2RKI A;  1DGK N;  1L3V A;  4DFP A;  3ZCM A;  4FM1 A;  4B9V A;  4CGJ A;  1SAZ A;  4BC5 A;  4CJT A;  4JKC A;  1NK4 A;  3HVT A;  4L3Q A;  1XI1 A;  5B8H A;  3KLI A;  4X66 K;  3HTV A;  3EKS A;  4N5S A;  4JS4 A;  3A5O C;  1L3U A;  3UKU A;  3O5B A;  4FPB A;  2UUC K;  3LM2 A;  2OYQ A;  3THW A;  1NK7 A;  3V4I A;  1VSH A;  1WSG A;  1HQU A;  2D0O A;  2QWQ A;  1RDA A;  3SMS A;  4CBW A;  1KVC A;  1D5A A;  3LP0 A;  4FWO A;  5M1N A;  4DTS A;  5BPL A;  3Q7B A;  1UOC A;  4JI0 K;  5BRE A;  1VQ6 N;  4CZL A;  1T6D A;  4LH5 A;  4E3S A;  3VQD A;  4BRP A;  2J4R A;  3BY5 A;  1W97 L;  2VGN A;  4A2B A;  2PZS A;  2A1S A;  3CJ7 A;  4GVM A;  3PLA A;  1J9A A;  4M7X A;  3EL2 A;  1ASW A;  3O4W A;  1J53 A;  4PWD A;  3LP1 A;  1BU6 O;  4ID1 A;  3I56 N;  4PA1 A;  3S9H A;  1GLA G;  4CJW A;  3AVN A;  5BR8 K;  3E01 A;  3K5O A;  4A62 A;  4NB4 A;  2HHH K;  3V1O A;  1LAW A;  3E9O A;  1YHQ N;  3NCI A;  3QFU A;  2VWK A;  4WFB L;  3S3N A;  2OPQ A;  2HB5 A;  1ASU A;  4JI5 K;  4E1N A;  2BUP A;  4Y1D A;  4DFK A;  1YUW A;  3HPH A;  3MDQ A;  2E5L K;  4M3U A;  1C0G A;  3A5L C;  4CIF A;  4J2B A;  4DCH A;  3TTD A;  4FCY A;  4WFA L;  5FDL A;  1S6Q A;  3MN5 A;  2OTJ N;  1CZA N;  5KPR A;  1RT2 A;  4EHU A;  1CZ9 A;  3CCV N;  1ZC6 A;  4BR0 A;  4HUG A;  1S9E A;  3ZT3 A;  2O4G A;  4FJ8 A;  1K6Y A;  3CET A;  4B3O A;  4FJI A;  3CM6 A;  2DY4 A;  3TAN A;  5C2D A;  4LSN A;  5IT9 O;  1TAQ A;  2YNG A;  3CJ9 A;  3CIP A;  4DV3 K;  3EKU A;  1ATR A;  4FJ9 A;  3R8E A;  4B3T K;  3ULE A;  1S1W A;  1BL3 A;  2IIR A;  3TTF A;  1EQY A;  1GOA A;  4IO8 A;  2B6A A;  4GVE A;  1LCU A;  3AV9 A;  1ESV A;  3LP3 A;  1BA0 A;  4DS4 A;  1RBT A;  3U8X A;  3NGZ A;  4JI2 K;  1SQK A;  3A5M C;  1WSE A;  1ZBH A;  4LY7 A;  1J6Z A;  1RCH A;  3L3U A;  2PYL A;  1OH6 A;  1WSH A;  4DWI A;  2D1K A;  3C6U A;  4FWS A;  2Q3S A;  3O3G A;  1NJW A;  3DOL A;  2VYP A;  3D2E B;  3TSP A;  4C8L A;  4FLZ A;  4DU4 A;  1BIZ A;  2Q2R A;  4FLX A;  3KK1 A;  4KB0 A;  1C1B A;  2W6K A;  4DSL A;  4FJX A;  3SAG A;  1JLE A;  4LF8 K;  3MEE A;  5A2Q O;  3QIP A;  3T7Z A;  5HL7 L;  1Y64 A;  3P38 A;  5I3U A;  3PX6 A;  1EO1 A;  3ULE B;  1WSI A;  3R3L A;  4YOR A;  2CGJ A;  3SQ0 A;  4O0J A;  3SAF A;  3O9T A;  4CHO A;  1HMV A;  1K8K A;  4KHP K;  3C6T A;  4H5N A;  3TTC A;  1M90 O;  4RW6 A;  4ISF A;  1RDB A;  1KAX A;  1Q81 O;  1JXE A;  1VQ7 N;  1N6Q A;  1F21 A;  3SZ2 A;  4ISE A;  1VSI A;  2YHA A;  2NRW A;  4FJL A;  3F5T A;  3L2W A;  4IDK A;  1JCF A;  4QAG A;  3E9L A;  4IJA A;  5BR9 A;  2ITG A;  4X64 K;  4O55 A;  2DFH A;  4NYF A;  3TAP A;  4IFV A;  1U2V A;  4FWR A;  4JN4 A;  4BWM A;  3P1G A;  4JAX A;  5HRS A;  2W41 A;  1T05 A;  3VOV A;  3AAP A;  3ZSX A;  3CFO A;  3QIO A;  3KK2 A;  1EET A;  2LSN A;  3H1Q A;  4LF4 K;  2WUS A;  5HRP A;  3BF1 A;  2UUA K;  4BY9 C;  3P5J A;  4XIU A;  4N76 A;  4HUE A;  3H3N O;  4FK4 A;  2AP1 A;  1NK8 A;  1K8K B;  4A59 A;  3J7Y P;  4CFB A;  3WXJ A;  3CC7 N;  4JV5 K;  3DXM A; 
#chains in the Genus database with same CATH homology
 2UXC K;  4JI2 K;  1HR0 K;  4YHH K;  5LMN K;  4JI0 K;  4DV5 K;  1XMQ K;  1XMO K;  1N32 K;  4CVN E;  4B3M K;  4DR1 K;  4B3S K;  4JYA K;  3T1H K;  4V19 S;  4AQY K;  3J80 O;  5FLX O;  1XNR K;  4JI7 K;  4DV4 K;  4DR2 K;  1IBL K;  4JI8 K;  4CW7 B;  2UUB K;  5AJ3 K;  4LF8 K;  5A2Q O;  2UU9 K;  3OTO K;  5BR8 K;  4YY3 K;  4LF5 K;  3J7A P;  3T1Y K;  4LFB K;  4LF6 K;  4DV2 K;  2UXB K;  4DV0 K;  4B3R K;  1HNZ K;  4DV6 K;  2HHH K;  4KHP K;  4DR3 K;  1IBM K;  4LF9 K;  1J5E K;  4JI1 K;  4DUY K;  3J81 O;  1HNW K;  1N33 K;  4JI5 K;  4JI6 K;  4DUZ K;  2E5L K;  4GKK K;  4X64 K;  2F4V K;  5IWA K;  4DR7 K;  4JI3 K;  4GKJ K;  1IBK K;  1I94 K;  3JAM O;  4X66 K;  2ZM6 K;  4OX9 K;  4NXN K;  4K0K K;  1FJG K;  1XNQ K;  2UUC K;  5IT9 O;  4DV3 K;  4LF4 K;  4B3T K;  4X65 K;  4DV7 K;  2UUA K;  5LL6 Z;  2UXD K;  2VQE K;  4NXM K;  4DR6 K;  1N36 K;  4JI4 K;  5LMU K;  4DR5 K;  1N34 K;  4DV1 K;  1HNX K;  4LFC K;  4DR4 K;  3J7Y P;  4LF7 K;  4X62 K;  2VQF K;  4JV5 K;  4LFA K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...