3VQCA

Hiv-1 in core domain in complex with (5-methyl-3-phenyl-1,2-oxazol-4-yl)methanol
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
151
structure length
141
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPSMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
total genus 49
structure length 141
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqcA00
3QEXA 1BISA 3OYIA 5C24A 4CJ3A 3DRSA 1RNHA 3U6FA 5J2QA 4B9TA 2F8TA 4CEDA 3QESA 3RMCA 1NK6A 2Y1IA 1ZBHA 4FJ9A 3AVNA 3OS0A 3NFAA 4FVMA 4IDKA 5JS2A 5FROA 4BDZA 3V9ZA 3MXJA 1LWEA 4CCHA 3KKRA 3AA4A 2HHTA 1A5WA 1I39A 4KI6A 4AH9A 3VA3A 4PY5A 5EU7A 5E41A 1LW2A 4DFMA 1NKCA 2BDPA 4E1NA 4ID5A 4F3TA 1RTHA 2FBYA 1CXQA 4BWMA 3NDKA 3V9UA 3V81A 3SQ0A 3SI6A 3KLHA 1RDDA 2G8KA 1S1UA 3V6DA 4CFCA 1RTIA 1BGXT 4CHPA 1RDBA 4CFBA 3SYZA 4B9VA 4EP5A 1BL3A 4H8KA 4KKOA 4F8RA 4DSLA 3CG7A 1NOZA 3L3UA 1DTTA 4IFVA 5K14A 1WSIA 3LZJA 4O5BA 4N76A 3LP0A 3NH2A 3QO9A 4B8AB 1C1CA 4E7HA 2FBXA 3EY1A 4J2EA 4KPYA 3O4QA 3IS9A 4CIFA 4Z4IA 2G8UA 1TV6A 2I5JA 1IH7A 3SNNA 1NK8A 1UWBA 1CXUA 2IOCA 2QK9A 1KLMA 3E01A 2VG7A 1FKPA 3LALA 5HRPA 3VA0A 4FJHA 1TKTA 3S3MA 2ZE2A 3K5LA 1HYSA 4CJVA 1NOYA 2B5JA 4CGIA 3KTQA 3HL8A 4JS5A 2IS3A 1NJWA 3KJVA 1XC9A 2RKIA 4FK0A 4I9QA 1VRUA 4BE2A 2P5GA 1HNIA 4FJ7A 4DTJA 4KTQA 1C6VA 3PO4A 2YHAA 4K8XA 2YKMA 1J9AA 3QETA 3LWMA 3OYKA 4M3XA 5SZTA 1UAXA 1XWLA 1S1XA 3QEIA 4FLWA 4ELVA 3OYAA 1S6QA 4DQQA 1F21A 3L2QA 1VSMA 3PV8A 2O4IA 3NAEA 1S5JA 4JLHA 3L8BA 4B9MA 1J53A 1NK7A 4CFAA 3K5MA 3H08A 2Z1HA 4E7LA 3AVJA 4B9SA 1B9FA 3VQ8A 3DMJA 3TAEA 4DWIA 2Z1JA 3LANA 1QSYA 2ETJA 1LAVA 4DG1A 4KRFA 4N56A 3OYEA 4DTRA 1L3SA 1RT1A 1QS4A 4AHCA 2IAJA 3ZT2A 4CHYA 1KFSA 1RBTA 3V9XA 1XHXA 4YNQA 1IO2A 4CGGA 3QERA 4HCCA 5FRNA 3PO5A 1JLAA 2YV0X 3CYMA 3T1AA 3VQCA 3I0RA 3OVNA 3WNGA 1WN7A 3DLHA 1WSHA 4CJSA 1TAQA 4CF2A 4J2AA 3K5OA 4F4KA 1TVRA 2D0BA 4KHQA 1N5YA 4CK2A 3SPYA 2IDOA 3AVAA 1RTJA 4H4OA 4AHVA 3AVGA 1WLJA 4LD0A 1C0TA 1GOBA 4CEOA 4KV8A 1VSLA 3MAQA 3T3FA 5D3GA 3SZ2A 3CQ8A 4GVMA 2IC3A 2BANA 2VWJA 2YNHA 3KLFA 1RT7A 4DSJA 3V1QA 2QKKA 1SUQA 2G8HA 1HRHA 1SL0A 4OLAA 4EZ9A 1TK0A 3VQPA 1ASWA 2G8WA 1SL1A 1JL1A 3LDSA 3DOKA 3HM9A 4M45A 3HPGA 3NF8A 4KTWA 4DTNA 1HPZA 3OYCA 1T8EA 2OYQA 1HJRA 4N5SA 5CZ2A 4DF4A 1N6QA 4OPJA 4B9UA 2EX3A 3HO1A 2YKNA 4CEEA 4CJFA 3OYJA 3VQDA 4DSFA 4DU3A 3ISNC 1NKBA 4C8KA 3TAMA 3RRGA 1YTUA 4KHNA 1NJZA 3VQQA 5KTQA 3DM2A 2OPQA 1IKYA 4Z0UA 4FK4A 3VQ9A 3VQEA 4ZHRA 1XHZA 5JS1A 1WSFA 4KREA 4ICLA 3SV3A 4DS5A 4JRQA 3TAFA 4CHZA 1D8YA 2IGIA 4OKJA 4RW8A 4B08A 4CJLA 5C42A 3OS1A 5I3UA 4C8LA 1ZYQA 3P1GA 4M3WA 5CYQA 4GW6A 3ZSQA 4Z4FA 2GV9A 4B9NA 3KLIA 1ASVA 4FLVA 5J1EA 1S1VA 2KQ2A 4O0IA 1JLEA 1SV5A 1Y97A 4I9LA 3THVA 1ITGA 2G8FA 3D0PA 2OPRA 3KIOA 4HUGA 1CLQA 2O4GA 3AVBA 3AA5X 4CESA 2LSNA 4NCGA 4W5OA 2QKBA 2KZMA 4CEBA 4L8RB 3OS2A 4F3OA 3I8DA 4FZYA 3QNOA 3AVHA 4QOZB 4CK3A 1BIZA 1L3TA 3NBPA 1JL2A 1TKZA 4I2QA 4CHQA 3TI0A 2HNYA 2F8SA 2DY4A 5DK5A 1KVCA 2D5RA 1EP4A 3LAKA 4OJRA 3ZSWA 3NHGA 1RBSA 3SQ1A 1RBUA 4M3RA 4M3YA 2KFZA 1RT2A 3DYAA 1RBVA 5HRSA 3S3OA 3MEGA 3U3GA 3WNHA 1RILA 4B9LA 3CM5A 3O3GA 4DQIA 3M8QA 4CIGA 3K59A 5HBMA 4M3TA 4CJEA 4DSKA 4O44A 1W9HA 2WONA 2Y1JA 1C0MA 3FFIA 1HMVA 1S9EA 1TGOA 4E0DA 1JXEA 1X9MA 2HB5A 2B6AA 4XIUA 2PZSA 3QLHA 4PWDA 4GMJB 1WSJA 1X9WA 2B4JA 4CJWA 1UOCA 1NJYA 4CF0A 3ZT0A 1JLGA 3OY9A 3AV9A 1J54A 4HUEA 4R5PA 2G8VA 2JLEA 4LH5A 2XRIA 4EP4A 3EZ5A 3PX6A 3NCIA 4CK1A 1FKOA 2GBZA 3B6OA 1LWCA 3TAGA 1C1BA 4Y1CA 2PY5A 4OGCA 3KK1A 1QTMA 4FZXC 1WAJA 3HPHA 1S9GA 4FJGA 1T05A 2VG6A 4O55A 4KHWA 4E89A 3LPUA 1NJXA 4BDYA 2X6NA 4O0JA 3VQAA 2JGUA 4LH4A 3WNFA 4DFPA 1U47A 1TAUA 1QE1A 1T03A 1VSDA 2XY8A 3RR8A 2OZSA 2HHSA 3QINA 3CM6A 1DLOA 4C8MA 3L3VA 3SUOA 3PX4A 3KD1E 1U4BA 4Q0BA 4CF1A 4LSLA 3MEDA 1GOCA 4Q5VA 1ASUA 5J2PA 5HRNA 4BACA 1JXBA 4KB1A 1J5OA 3OYFA 3LZIA 1Z25A 3RMDA 3DRPA 3O4NA 4CGJA 4CEFA 3OYHA 2YNGA 4CEZA 3ALYA 4IFYA 1IG9A 4CIEA 3MXMA 3HJFA 2HMIA 4KHSA 3LP1A 1CZBA 4CGFA 3KK2A 1X1PA 3SQ4A 4FJLA 1RDAA 4FLUA 5FRMA 1SKRA 1S1TA 3MEEA 1HQEA 1YT3A 4DTXA 1HQUA 2VG5A 3QEPA 4IG3A 3DI6A 4FJNA 1SL2A 2HHWA 3DLKA 3ULDA 4J2DA 1WAFA 4MQ3A 1NKEA 3RRHA 3AVKA 4DTOA 4RW4A 4ZTJA 5KRSA 4FJ8A 1BCOA 1BI4A 2OA8A 1LWFA 4YFUA 2D0AA 1L5UA 2FBVA 3PY8A 4KI4A 3DOLA 3M8PA 3ASMA 1QSSA 3B6PA 2BE2A 1B9DA 2A1RA 1FXXA 3NF9A 4DU4A 2P5OA 2DTUA 4DMNA 2F96A 2X78A 3HVTA 2P51A 4RW9A 3ZT1A 3ZT4A 3SV4A 3C94A 4OKKA 1R0AA 1U48A 1X9SA 2PYJA 1U45A 3C6UA 2DFHA 1O1WA 4CJUA 2FC0A 4E7IA 1VRTA 3AO2A 1YVUA 1UA0A 5KI6A 4CJRA 1C1AA 1W0HA 2X74A 3P83D 4E1MA 3MXIA 3OYLA 3HK2A 3AO5A 1NK0A 3V9SA 4CJQA 3QEWA 2HVHA 1NK9A 3IG1A 3NGYA 4KO0A 3ZSZA 4CJKA 3A2FA 4W5NA 5DMRA 3UIQA 1UA1A 1ZBIA 3DLBA 4DSIA 1DTQA 4IG0A 1YTAA 1L3VA 3LP2A 3AVLA 1D9FA 4QCLA 3AVMA 2KFNA 2HHXA 4H4MA 4O4GA 4LSNA 1HYVA 4CGHA 4FM0A 3CFPA 3LAMA 4RW7A 3K58A 3SUNA 3LWLA 4ELUA 3SJJA 5FDLA 4HVJA 3SPZA 4JS4A 1BHLA 4W5RA 2ZD1A 3K57A 3SCXA 1RBRA 2D0CA 3F73A 1RT4A 2XHBA 3IRXA 3VQBA 3I0SA 4DLEA 3HPOA 1KVAA 4DS4A 3SUQA 3L2UA 2W42A 1Q9XA 4EZ6A 3LP3A 3CFRA 4CGDA 4M3UA 3HYFA 2HW3A 3NH1A 3QIOA 1RT5A 4M3ZA 2WOMA 1KVBA 4DTUA 4PUOA 1TK5A 4AHUA 4KAZA 3DLEA 4E7KA 1MU2A 4OLBA 1JLBA 1VSIA 1T7PA 2RF2A 4CERA 4FJMA 4JRPA 4CEQA 1SKSA 1TKDA 1LW0A 5C25A 3OYGA 4IBNA 4FLZA 3ZSYA 3HT3A 2HVIA 2PYLA 3KK3A 3L2RA 1WSGA 1REVA 4RG8A 2ITGA 5J2MA 5KGWA 4W5QA 3NH0A 1KTQA 2YHBA 1IKWA 4C8OA 4AHRA 1EKEA 4CHNA 2X6SA 1D5AA 3JSMA 3ZCMA 1C0UA 4CE9A 2VWKA 1BIUA 4PQUA 4Z4CA 3O3FA 3L2VA 3S9HA 4FK2A 2HHQA 5SWMA 3EYZA 1TK8A 3HP6A 1RDCA 2OPSA 1JKHA 3S3NA 4NCBA 3G0ZA 4CEAA 1WSEA 4DTSA 1D9DA 1TL1A 4QAGA 3KD5E 4FXDA 1TL3A 4NYNA 1LAWA 4MFBA 1ZBUA 2HHUA 3RMBA 1NK5A 4ELTA 3DLGA 1RT3A 4BE1A 3LPTA 4G1QA 3PX0A 4FYDA 4I2PA 1JLCA 3M8RA 4K8ZA 4I7FA 1U49A 1EXQA 4NCAA 3TAPA 1GOAA 5CYMA 3JYTA 4DFJA 4CFDA 3DLRA 1VK0A 3QIPA 3M8SA 1VSJA 3RTVA 1BQMA 1Q8IA 4FM1A 4FLXA 2XY7A 2KTQA 1JLFA 1IKVA 5HROA 3ITHA 1QHTA 1ZBFA 4LY7A 4PA1A 3RR7A 3P5JA 4CF9A 4AILC 1RTDA 4FLTA 2P1JA 4M42A 1QQCA 3AVCA 4C8NA 3D45A 4BE0A 3ZSRA 4NYFA 4DSEA 4F2SA 2KZZA 4OPKA 3NE6A 3MECA 4J2BA 2NUBA 4UQGA 5J2NA 1LV5A 3NGIA 4OGEA 4IKFA 3TR8A 4RW6A 4Y1DA 4CJPA 2Q3SA 1Q9YA 4DLGA 2AJQA 4KHYA 3V4IA 2OZMA 1HYZA 3ZSOA 4HCBA 1VSKA 4Z4HA 4FJIA 4KB0A 1BCMA 3NF6A 2QXFA 2YNFA 2E6LA 3QNNA 4FZZA 1WNSA 4CJ5A 4M41A 4HTUA 4FW2A 4B3OA 4DF8A 4BWJA 3OYBA 3KLEA 1Z26A 3CFOA 4N47A 5HP1A 2Z1GA 3PUFA 4WE1A 3SQ2A 3TANA 3AVIA 4DQPA 1KLNA 2XY6A 4FJJA 3ZT3A 3DRRA 4FW1A 4FM2A 4Z4EA 3C95A 3IAYA 1G15A 1KSPA 3AO1A 3VQ5A 4Z4GA 3C6TA 3HVRA 4HHTA 4DU1A 3BDPA 1HNVA 1EETA 1K6YA 4F2RA 4KTZA 2KW4A 3K2PA 4TSXA 3VN5A 5KGXA 3AO3A 5T7BA 1VSEA 3KKSA 4OKEA 3L2WA 3BGRA 3AVFA 4KFBA 4W5TA 4AHSA 3U3YA 1RT6A 4BDPA 4AHTA 4DQSA 4OVLA 1FK9A 2FBTA 3TARA 2E4LA 5I42A 4E19A 2DFFA 4CJ4A 1XI1A 3ZSXA 4ZTFA 4KHUA 2E6MA 2GUIA 2HNZA 4CECA 2OPPA 3V9WA 3TABA 3OYMA 2XY5A 1EX4A 3OJUA 5CZ1A 1SKWA 1IKXA 1NK4A 2RPIA 2ATQA 3AO4A 5HRRA 2HNDA 3HSTB 1ZBLA 1QSLA 1CZ9A 2HHVA 3TAQA 4FCYA 3V1OA 4DTMA 2A1SA 5HLFA 1VSFA 4CF8A 4HUFA 2ZQBA 3QEVA 4N41A 2XO7A 3AA3A 1VSHA 3OJSA 2DFEA 1JLQA 3VQ7A 3V1RA 2BGGA 3TWHA 3OYDA 3RWUA 3AA2A 3HXMA 2G8IA 3ZSVA 1KCFA 1TKXA 1U04A 3VQ6A 3T19A 2EHGA 4B8CA 1BQNA 3VQ4A 5KRTA 1RCHA 3HP9A 3WNEA 3F9KA 2R7YA 4E3SA 1A5XA 3RMAA 3NF7A 4FJXA 4CJTA 1KFDA 3SUPA 1KRPA 1I3AA 4ID1A 4FLYA 4CHOA 4DQRA 1A5VA 4FJ5A 3NGZA 3K5NA 5CY4A 1B92A 2YNIA 3O3HA 1L3UA 4FJKA 4E7JA 4DFKA 2RN2A 4DTPA 1BI4B 3G10A 3OYNA 1S1WA 1S6PA 3KLGA 2Z1IA
chains in the Genus database with same CATH superfamily
4BY9C 2F7TA 2FLOA 5BRFA 3AA4A 3HI0A 3S41A 4KI6A 3UE5A 3VA3A 5GINA 1NKCA 2A40A 4F3TA 2UU9K 5CHIA 1IBLK 3SQ0A 1RDDA 3AAPA 3T7ZA 2G8KA 2O8EB 1KAYA 3QDKA 1BGXT 4CHPA 5JMVA 1RDBA 3MMVA 3D2FA 4F8RA 3L3UA 1VQNN 4O5BA 4BRCA 1NJIO 2FBXA 3EY1A 4KPYA 3O4QA 4CIFA 1J5EK 2GWJA 3SNNA 3IMXA 4IOAL 5ADXA 1KLMA 3LALA 3VA0A 4FJHA 1TKTA 4FWRA 4CJVA 3TSPA 4V19S 2B5JA 4IXCA 4CGIA 3HL8A 4JS5A 2YJEA 2IS3A 1NJWA 3KJVA 1QHAA 4CZFA 1XC9A 2GTDA 4A2BA 5LMUK 4I9QA 2P5GA 3A5OC 4PKHA 4KTQA 1C6VA 3VGLA 2PAVA 5SZTA 4M63C 1QZ6A 2E5LK 3M5RA 3THYB 4DV7K 3OYAA 3TU5A 4DQQA 4BVPA 1VQON 4DR6K 1BOTO 3L8BA 4B9MA 1J53A 3AVJA 4B9SA 3EN9A 4X62K 2WFBA 1HKBA 1QS4A 2IAJA 3CCUN 3V9XA 1XHXA 3QERA 4HCCA 2YV0X 3O08A 3T1AA 1YJ9N 1T44A 3K5OA 1K73O 1TVRA 2P9KA 2E2PA 3L4IA 3SPYA 1N5YA 4KHQA 3AVAA 1RTJA 4AHVA 2D0OA 4LD0A 4CBUA 1C0TA 4KV8A 2BANA 1S72N 2YNHA 3KLFA 1RT7A 5DM6L 4EZ9A 3BY5A 1JL1A 3LDSA 3DOKA 4M45A 3HPGA 1OH7A 1ZC6A 5HL7L 1NMNA 4DTNA 3OYCA 1T8EA 4AQYK 4JK8A 4OPJA 3CCMN 4DU3A 2I7NA 3ISNC 1YUWA 5M1QA 1HKGA 1NJZA 3VQQA 1IKYA 4Z0UA 4FK4A 3EE8A 4ZHRA 3O9SA 1VQ5N 4JRQA 2PBDA 1VHXA 4MDAA 3GG4A 4OKJA 5C42A 4M3WA 3DWLA 2BTFA 3KLIA 5J1EA 1S1VA 1IV0A 4HUGA 1CLQA 2O4GA 4MLEA 3CPEA 3R3LA 4CESA 3FLCO 3EL2A 4JKHA 4CK3A 4I2QA 4DV1K 1TKZA 1KVCA 3OBYA 3LAKA 3MWPA 4OJRA 1XQSC 4JN4A 4FWPA 1RBUA 5AZJA 1C0GA 4M3YA 4H03B 1NMDA 3LM9A 3S3OA 4B9LA 3CM5A 4M3TA 3M8QA 2WONA 3QBWA 4WQ4C 2KLAA 1NLVA 2B6AA 3QLHA 1GLCG 1WSJA 3LDPA 4CJWA 3IDHA 5M1OA 3ZT0A 2JLEA 2XRIA 4EP4A 4BR5A 4CK1A 2HBKA 4WQ5C 4BGBA 3G4SN 4FZXC 3HPHA 4Y0WA 4FJGA 2VG6A 4KHWA 3RSEA 1OVQA 1SZ2A 4E89A 2A6AA 3BEXA 4B9QA 1QE1A 2H3GX 3PSFA 2HHSA 3CM6A 1DLOA 3SUOA 5F1XA 3PX4A 4WYBA 3C6HA 4Q5VA 4BACA 4KB1A 1J5OA 3LZIA 1XMQK 1IG9A 3MXMA 1X3NA 4H0OA 3LP1A 2QWOA 3D2FB 1RDAA 1VQ8N 3O9RA 4FLUA 3MEEA 4IOCL 5AZIB 2VG5A 5AQZA 3MX5A 2HHWA 4CZLA 3L6QA 3FR0A 4MQ3A 3RRHA 4DTOA 3FGUA 4F9OA 4IEEA 1LWFA 5AQHA 4YFUA 2D0AA 3NVKA 4LF4K 4A2AA 3M8PA 3ASMA 1FXXA 3NF9A 4DMNA 2X78A 4RW9A 3C94A 3MN7A 1U48A 2PYJA 1U45A 2CGLA 1U2VA 4YORA 1NGCA 5TKYA 3D7EO 1O1WA 5BREA 4CZMA 2FC0A 1UA0A 3O6WA 4E1MA 3MXIA 1NK0A 3V9SA 4CZIA 3QEWA 4H5RA 3A2FA 3W3DA 5KPZA 5DMRA 3UIQA 4BRQA 4B3RK 3AVLA 5GIOA 4O4GA 4LSNA 1W2BM 1ESVA 1HYVA 2QM1A 3LAMA 3SUNA 2HSTA 4ELUA 3LWLA 1ZXOA 1BHLA 3K57A 4BRKA 1RBRA 2D0CA 1RT4A 1Q9XA 3O9QA 3SUQA 4IO9L 2W42A 1E4FT 3HYFA 3CD6N 3SJHA 2P9KB 3O9UA 5AJ3K 4KAZA 5EX5A 4OLBA 2E88A 1TKDA 4FLZA 3IKMA 2W6KA 3SAGA 4W5QA 5E84A 1KTQA 3NH0A 4C8OA 3LL3A 4AM6A 4CHNA 2WBNA 4JYAK 2VWKA 3L2VA 4FK2A 1LCUA 4RTFD 2OPSA 1JKHA 3H46O 4NCBA 3G0ZA 4ISGA 4BGAA 4WQ4A 2UUBK 1TL3A 4MFBA 1NK5A 1G99A 3TTCA 4FYDA 4C23A 4JI2K 4QS8A 1EXQA 3FZMA 3MCAB 1OH6A 3WEEA 2KKZA 1QQNA 1VSJA 3CCQN 4DV2K 1IKVA 4CZHA 2O8BA 1QHTA 1ZBFA 4LY7A 4B1WB 4BG8A 2NRRA 2P1JA 4WFBL 4C8NA 3D45A 4NYFA 4DSEA 2HOEA 3NE6A 4J2BA 4IKFA 3O8MA 2AJQA 3V4IA 4O8UA 4FJIA 4M7XA 1BCMA 3NF6A 2QXFA 3EO3A 1WNSA 3JS6A 4FW2A 4B3OA 4DF8A 3OYBA 5HP1A 3VEOA 1YAGA 5C10A 1V4TA 3SQ2A 3AVIA 4DQPA 4JI0K 1U6ZA 4NLCA 4FJJA 3SMSA 1VQ6N 4FM2A 1ATNA 1G15A 3VQ5A 4Z4GA 5BN8A 1HNVA 1EETA 4F2RA 4KTZA 3VN5A 5KGXA 4CZEA 5T7BA 4CZJA 3U3YA 4CZKA 1VQMN 4AHTA 4DQSA 4GV3A 1FK9A 4IEIA 5I42A 4E19A 3ZSXA 2QWMA 4CECA 2HNZA 3OYMA 2ATQA 4A5AA 4I6MA 4CD1A 3AO4A 3HSTB 1QSLA 2HHVA 4FWNA 4PL7A 2A1SA 5HLFA 1VSFA 2NRVA 2ZQBA 3QEVA 4N41A 3H45C 3CF5L 1JLQA 2UXCK 3TWHA 3R9PA 4L3QA 1TKXA 1U04A 4JHDB 3VQ4A 3WNEA 3F9KA 2R7YA 4JKDA 1A5XA 3K0SA 3FZLA 5ELZA 3K5NA 2P9IB 2YNIA 5CY4A 1MA9B 4IDHA 3O3HA 1L3UA 4DFKA 4FJKA 2RN2A 2FSJA 1V4SA 3SPZA 3KLGA 2Z1IA 2ASMA 5C24A 3OYIA 3U6FA 4B9TA 3RMCA 1ZBHA 4FJ9A 1BWFO 4JI4K 4FVMA 4IJNA 4IDKA 3V9ZA 1LWEA 4AH9A 5E41A 1LW2A 3H1VX 1U2VB 4DFMA 2BDPA 5H1SQ 4LC9B 4E1NA 1OH8A 4ID5A 4LF7K 2OCEA 3V9UA 3V81A 3SI6A 1S1UA 5TKWA 4CFCA 3VF2A 1RTIA 3UKRB 4CFBA 4BVOA 1HPMA 4EP5A 1BL3A 3BP8A 3JXUA 3NH2A 4B8AB 1J6ZA 2G8UA 1HX1A 1NGAA 1TV6A 4DUZK 2IOCA 1YF5L 1N33K 2ZE2A 1KD1O 3WUHA 3GE1A 1NOYA 3BZCA 3C7NA 3KTQA 2RE2A 1E4GT 1X9JA 4FK0A 2JWLA 3A5LC 2YHAA 1J9AA 3QETA 3OYKA 4OX9K 1UAXA 1NNEA 4PKGA 3QEIA 3VEWA 4EHUA 4ELVA 1S6QA 3WT0A 3L2QA 2VQFK 1VSMA 1Q81O 4CFAA 3K5MA 4DWIA 3LANA 4YOWA 1QSYA 1YI2N 4N56A 4DTRA 2JWKA 1IO2A 4CGGA 5GADP 1K8KA 3PO5A 2J4RA 4J2AA 4F4KA 3ID8A 3VEYA 4CK2A 2IDOA 2IVPA 3AVGA 3JAMO 1GOBA 3WEEB 3CXCM 3T3FA 3CQ8A 1CZAN 4DSJA 4B3MK 4OLAA 2GWKA 3VQPA 1TK0A 1ASWA 2G8WA 1SL1A 5C12A 3LM2A 1Z05A 2A5XA 3HM9A 2P9LA 5FPEA 3CC4N 1NGEA 4KTWA 3CCJN 3J7ZO 2OYQA 2YI1A 4N5SA 4B9UA 4CEEA 3TAMA 5CE3A 2HF3A 4KHNA 4FL9A 4JD2A 3WXLA 4DR1K 3VGKA 3FFKB 4BC3A 3TSQA 1WSFA 4KREA 3SV3A 4DR7K 3VESA 3OS1A 4CJLA 1NU0A 2WUSA 4C8LA 4Z4FA 3ZSQA 1TUYA 4B9NA 1YIJN 4OO1J 1FJGK 2Q0RA 3THVA 2Q97A 2G8FA 4DB3A 3AVBA 4DV4K 2ASPA 2LSNA 4NCGA 5C0YA 4BQLA 2QKBA 5C2FA 4L8RB 5AQYA 2GEMA 4CHQA 2F8SA 2HNYA 3KK7A 2ZM6K 3NHGA 3HBTA 4M3RA 1JCGA 5HRSA 3WNHA 1RILA 4IJAA 3K59A 4H0XB 1N8RO 4CJEA 4DSKA 4O44A 4FWQA 4KH4A 4MO5A 4DV0K 1HMVA 1JXEA 4IWVA 1X9MA 2HB5A 2PZSA 4BC5A 4JEPA 5AQGA 5IT9O 4JKAA 1UOCA 5M1NA 3MCPA 4YOYA 1J54A 2G8VA 2F9WA 3B6OA 5AR0A 1C1BA 4Y1CA 4OGCA 3VEXA 1FW6A 3WQTA 1T05A 4O55A 3LPUA 4BC4A 2X6NA 1U47A 4ILJA 3CCVN 1TAUA 1T03A 1VSDA 4C8MA 1OH5A 1YVNA 4Q0BA 1HNZK 5J2PA 3ZETA 3OYFA 1Z25A 4CGJA 4K0KK 4CEFA 2YNGA 4A61A 3F9MA 3KK2A 3SQ4A 1O13A 3A8YA 1SKRA 1S1TA 3O1BA 2NZTA 4DTXA 1HQUA 5F0XA 3E9OA 1T6CA 4J2DA 1WAFA 1NKEA 4NB4A 4B1UB 4RW4A 3ZEUA 4ZTJA 1BCOA 2UYTA 2OTJN 3PY8A 3DOLA 2P5OA 2BE2A 5AQSA 3FZFA 3R6MA 4BR4A 4DUYK 4DU4A 1N34K 3C7NB 3ZT1A 1T3VA 4BC2A 1R0AA 4JI3K 3AGRA 3AO2A 4JKGA 3CJ9A 1YVUA 3ULEA 2VCPA 3L0QA 4FWSA 1SQKA 5AQLA 1W0HA 3HK2A 4BR2A 4CJQA 1NK9A 2QWRA 3ZSZA 4CJKA 4BROA 3DLBA 4DSIA 1L3VA 4QCLA 2QW9A 1IG8A 1SAZA 4FM0A 4NXMK 3CCLN 3K58A 4QS9A 1VQ7N 1NGIA 3F73A 3RVCA 3O4WA 1HUXA 1K8AO 4N76A 3HPOA 3L2UA 3THWA 4M3UA 3NMUA 3QIOA 1RT5A 4M3ZA 2O8DA 4DTUA 3GBTA 1JCFA 2D1KA 3D2EB 2O8CA 1JLBA 5AQXA 1T7PA 2RF2A 4GKJK 2W41A 4CERA 1SKSA 2CGKA 1LW0A 2HVIA 4IBNA 1XNQK 3ZSYA 3HT3A 3KK3A 2Q31A 1WSGA 1SS6A 3P39A 5KGWA 3J80O 2RHKA 2P9LB 4FWLA 4GV6A 3JSMA 2HBLA 1BIUA 3LDNA 3O3FA 3S9HA 1GLDG 3S3NA 3E66A 4DTSA 4FXDA 1TL1A 4QAGA 1LAWA 2HHUA 3RMBA 5M1FA 4BRGA 4ELTA 2FSNA 1VQ9N 3LPTA 3VETA 4K8ZA 2UXBK 1GOAA 2ZWHA 3CQXA 3JYTA 4DFJA 1VAZA 2E1YA 3M8SA 2KTQA 2XY7A 1BQMA 1Q8IA 4FM1A 3KHYA 3MK6A 3CCSN 5HROA 3WXKA 3RR7A 3Q7BA 3P5JA 3ZX3A 1QQCA 2E20A 3H6EA 4LFAK 3ZSRA 2KZZA 4OPKA 3MECA 4FWKA 4BRDA 2GX9A 4UQGA 5J2NA 1LV5A 4OGEA 4RW6A 4DV3K 2OZMA 2W6LA 4HCBA 5BN9A 3QNNA 4CJ5A 4M41A 1Q86O 4H5NA 4HTUA 4K42A 3AY9A 3KLEA 1Z26A 3CFOA 1KLNA 2XY6A 1RGIA 5LMNK 3C95A 3AO1A 4HHTA 3BDPA 1EQYA 2KW4A 4TSXA 3CC7N 5AFUH 4OKEA 3BGRA 2AA4A 4AHSA 3G71N 4BDPA 1KAXA 4ISEA 5FPMA 1OKJA 1IBKK 2E4LA 3GDQA 4JI5K 3AAQA 4ZTFA 4JI6K 3V9WA 3TABA 5CZ1A 1IKXA 2HBMA 4DR5K 2NLXA 5HRRA 3LDQA 3V1OA 4BR9A 4DTMA 3SAFA 3AGKA 4DKWA 1DT9A 2XO7A 1VSHA 3ZETB 2D4WA 2DFEA 2BGGA 3IUCA 2YX6A 3HXMA 1KCFA 3T19A 1BQNA 1R59O 2E2OA 4CJTA 1A5VA 3DJCA 3NGZA 4E7JA 4DTPA 5AQPA 3G10A 1KAZA 1S1WA 1S6PA 3OYNA 1BISA 3DRSA 1RNHA 4GV9A 2NRXA 2F8TA 4CEDA 1ATSA 3T1HK 1NK6A 3A5NC 2Y1IA 3OS0A 3NFAA 5JS2A 2KHOA 4FO0A 5FROA 3MXJA 4CCHA 2HHTA 1I39A 3QMLA 4PL8A 4GVEA 3T1YK 1RTHA 4ILGB 5JVHL 2NRTA 2FBYA 4JKGB 4BWMA 3ULEB 5M1PA 3VEVA 2QXLA 1VQKN 3VOVA 1YJWN 1Q82O 4DSLA 4YDUC 1DTTA 4IFVA 1WSIA 3EEQA 4U67L 3LP0A 3CJCA 3QO9A 4E7HA 4Z4IA 4LFBK 1BA1A 2P9UA 2I5JA 3Q7CA 1UWBA 2QK9A 4JI1K 4MO4A 3E01A 5HRPA 1FKPA 4FOEA 3S3MA 3CMEN 1HYSA 3KWIA 2QI2A 4WQ5A 1TYQA 1S22A 2RKIA 3M6GA 1VRUA 3I33A 4FJ7A 3IFRA 2O8DB 1GLLO 4K8XA 4BRFA 3ZX2A 3G6EN 4XH5A 1XWLA 5AZJB 4FLWA 2YHXA 4H0VB 3E9LA 2O4IA 1S5JA 3H3NO 4JLHA 2ZJPL 1NK7A 3BZKA 2QEXN 3H08A 4MDBA 3VQ8A 3DMJA 2ETJA 2QWPA 4DG1A 3D6RA 1L3SA 2ZGYA 3O9TA 1X3MA 4AHCA 3CIPA 3A0IX 3ZT2A 1KFSA 4YNQA 4BRLA 3CYMA 3VQCA 3DLHA 3I0RA 3OVNA 3WNGA 1WN7A 1BG3A 1WSHA 3CETA 4CJSA 2O8FA 1GLFO 5BPMA 4CF2A 2IIRA 4JKFA 1WLJA 3CI5A 4CEOA 4E1JA 1VSLA 3I8BA 3RSEB 3C65A 1NWKA 2IC3A 2VWJA 5HOOA 4A59A 2QKKA 1HRHA 3CJAA 5JVGL 4ILHA 3ID6A 2Q0UA 3NF8A 2WC9A 4BG9A 1HJRA 5AQJA 5CZ2A 3WQUA 1N6QA 3HO1A 2EX3A 1WOQA 4CJFA 3OYJA 3VQDA 3B8AX 4NO7A 3ENBA 1BUPA 2E8AA 4UY8O 3DM2A 4KH5A 1NGHA 3VQ9A 5JS1A 4J8FA 4ICLA 3HOTA 4CHZA 4H5VA 4B08A 4RW8A 4XH4A 4ISFA 3P1GA 5CYQA 4JNEA 2HHHK 2GV9A 3EKUA 4FLVA 2KQ2A 1SV5A 4FOIA 3CHWA 1XNRK 2OPRA 3KIOA 5BPLA 3DXKA 3BF3A 3OS2A 3MWTA 3I8DA 3THXA 4QOZB 3QNOA 3NBPA 1JL2A 4YHHK 2DY4A 2CGJA 5DK5A 1EP4A 1EWRA 4JKCA 4YOUA 2GUPA 1JJ2M 3PSIA 4C1NI 1RT2A 1RBVA 3MEGA 3U3GA 4O5FA 3O3GA 4DQIA 4CIGA 4KHPK 5HBMA 3VTIA 4EHTA 1S9EA 2UUAK 4E0DA 4XIUA 4PWDA 1I94K 1KC8O 1H1VA 1X9WA 4FVUA 3AV9A 4HUEA 5AQRA 4R5PA 2F4VK 3EZ5A 3PX6A 3NCIA 2GBZA 3TAGA 2PY5A 3KK1A 2NNWA 1Q18A 4H0TB 3WNFA 4DFPA 4LFCK 2XY8A 2OZSA 5C15A 2P9NA 3QINA 4FSVA 5EY4A 3L3VA 1IJJA 4YY3K 3QBXA 3CJ7A 4LSLA 4DHYA 1GOCA 1ASUA 4HWIA 5HRNA 5DM7L 5EVZA 1WBBA 3DRPA 3OYHA 1QQOA 3ALYA 3QFUA 1RFQA 4CIEA 4KHSA 1CZBA 2P9SA 3R8EA 1X1PA 5M1KA 4XH1A 1N32K 5FRMA 1YT3A 1E3MA 1GLJO 2W40A 3DI6A 4IG3A 1SL2A 3ULDA 3I56N 4WFNL 1ATRA 5KRSA 1BI4A 2OA8A 3M3ZA 1RDUA 4KI4A 2HF4A 1QSSA 2DTUA 2A1RA 5BR9A 1TYQB 2O8BB 5FPDA 3BF1A 3SV4A 2OTLN 3HTVA 2DFHA 2A3ZA 2HMPA 3CJBA 3SLCA 3SBTA 4JK9A 3P83D 1GLAG 3OYLA 3AO5A 3FZHA 4KO0A 4EAHD 5JLFA 1YTAA 1QVGM 1OVYA 1D9FA 2HHXA 5EOYA 3U9DA 4PKIA 1VQPN 3KZBA 3VMFB 1K9MO 2YHYA 4RW7A 4WFAL 3SJJA 4JS4A 2ZD1A 3SCXA 4K43A 3IRXA 4DS4A 3HM8A 4EZ6A 3E9PA 4CGDA 2O8FB 2HW3A 1RDWX 3NH1A 4JAXA 3M1FA 5AQIA 5KQDA 1TK5A 3GOIA 4AHUA 4E7KA 1MU2A 4AM7A 4RCHA 2ZGZA 3CC2N 4FJMA 4I6MB 2PYLA 3L2RA 1REVA 4RG8A 5LJVA 4BQZA 1S3XA 5J2MA 1P8ZA 4Z94A 4JK7A 3EKSA 4EIAA 3F5TA 4AHRA 1XMOK 4NXNK 1EKEA 2V52B 4CE9A 4PQUA 4Z4CA 5A2QO 5KQ8A 4BR0A 5SWMA 3HOSA 3EYZA 1TK8A 4K41A 1RDCA 1WSEA 5GAGP 2A41A 4NYNA 1ZBUA 5AZIA 3W0LA 1RT3A 4C1NK 2FSKA 4BE1A 2ZJQL 4I2PA 4BRPA 2BH1A 1JLCA 3M8RA 2A42A 4I7FA 1U49A 3TAPA 3PIPL 4LF5K 1EO1A 3DLRA 1VK0A 3QIPA 3RTVA 3KD1E 2VWBA 3N4QA 3DXKB 4CF9A 1VQLN 4FLTA 3THXB 3AVCA 4BE0A 4F2SA 2NUBA 3U4LA 4X64K 2WTUA 3NGIA 4CJPA 4YOVA 2P9PA 2Q3SA 1Q9YA 3ZSOA 4Z4HA 2E6LA 2AP1A 3VERA 3PLAA 3FE1A 4N47A 1QZ5A 1MDUB 4WE1A 3T69A 4DV6K 4FW1A 4O8KA 4AF1A 4Z4EA 4DR4K 1KSPA 4A57A 2D0PA 1K6YA 3K2PA 4B1ZA 3KKSA 4YOXA 1Y64A 1D4XA 1RT6A 4KBOA 4OVLA 1ZBSA 2FBTA 3TARA 2DFFA 3C0BA 3VPZA 5BPNA 1YXQA 2GUIA 4X65K 4CI6A 1EX4A 1MWKA 1W97L 1SKWA 1WBDA 4CJ7A 2HNDA 2P9NB 3CQYA 3FZKA 4CF8A 4HUFA 5LL6Z 3CPWM 3VQ7A 3V1RA 3SBGA 3OYDA 2G8IA 5AFUA 3VQ6A 2P9SB 3MDQA 2NRZA 1JCEA 1K8KB 5KRTA 4E3SA 3OW2M 5F2RA 3O1WA 2V51B 3RMAA 3NF7A 5GAHP 1KFDA 5FPNA 4DQRA 1B92A 1C0FA 3WXMB 1BI4B 3ENHA 1ITGA 3QEXA 4CJ3A 5J2QA 3QESA 5ADXH 3AVNA 3R1XA 1NGJA 4H0PA 1KQSM 4BDZA 3KKRA 1A5WA 1NM1A 3QICA 4WF9L 3MN5A 4PY5A 5EU7A 4IO8A 1YHQN 1QQMA 3UKUA 3NVMA 5MLCQ 1TUUA 1CXQA 4A5BA 2CH6A 3NDKA 1W7AA 5C2DA 3KLHA 2DPNA 3V6DA 3SYZA 4B9VA 1NGBA 4H8KA 4JD2B 4KKOA 3CG7A 2ZF5O 1NOZA 4YOTA 3LZJA 5K14A 2E1ZA 4M7YA 3E1YA 1C1CA 3VTHA 5AQUA 3CCEN 4J2EA 3IS9A 1IH7A 5GIPA 1NK8A 1CXUA 5IWAK 2VG7A 2UXDK 4X66K 3VEZA 3K5LA 1NGDA 3WXJA 1T6DA 1BDGA 4B1VA 4BREA 3ZYYX 2IVNA 2VGNA 1HNIA 4JKBA 4DR2K 4BE2A 4DTJA 5AQMA 3WXIA 3PO4A 2YKMA 3J7AP 1WB9A 3LWMA 4M3XA 1HKCA 3VENA 4B1XB 3DAWA 1NGFA 1F21A 4U7BA 3PV8A 3NAEA 1P90A 2Q36A 4GNIA 3QB0A 4H5TA 3MN9A 2Z1HA 4HTLA 4E7LA 1B9FA 3TAEA 2Z1JA 1LAVA 4KRFA 3OYEA 1HR0K 1RT1A 4CW7B 4CHYA 1RBTA 1BU6O 4JHDA 1NGGA 3KWGA 5FRNA 1JLAA 3CJ1A 1TAQA 4IZ9A 2D0BA 1DEJA 2P9IA 4H4OA 3N4PA 4LF6K 3MAQA 3U9ZA 5D3GA 3SZ2A 4GVMA 3V1QA 1SUQA 2G8HA 1SL0A 4LF9K 2QA4N 5FLXO 1IBMK 1HPZA 1YJNN 4RWTA 2QWLA 2GELA 2P9PB 4DF4A 3ZLJA 2YKNA 4DSFA 1NKBA 3UKRA 4C8KA 3H1QA 3RRGA 1YTUA 5I9EB 5KTQA 2OPQA 2QWQA 4OPHA 2OANA 4QS7A 3TSUA 2Q1NA 3DXMA 4JKEA 3VQEA 1XHZA 4DS5A 3TAFA 4GY2B 3ZEUB 1D8YA 1WUAA 2IGIA 4CD3A 5I3UA 4JI8K 1ZYQA 4KH6A 2FF6A 4GW6A 1ASVA 4O0IA 1JLEA 1Y97A 4I9LA 3D0PA 3AA5X 4DCHA 3BUZB 4W5OA 2KZMA 4CEBA 2UUCK 4F3OA 5KPRA 4DQ8A 4FZYA 3AVHA 1BIZA 1L3TA 1HNXK 3TI0A 2D5RA 2VQEK 1DKGD 5AQOA 3ZSWA 1RBSA 3SQ1A 1VQ4N 2EWSA 2KFZA 3OBWA 3DYAA 5AQQA 5AQKA 4IFEA 1W9HA 2Y1JA 1C0MA 3FFIA 1TGOA 4GMJB 2B4JA 4JV5K 1NJYA 3L4QA 4FWOA 4CF0A 1JLGA 4BRMA 3OY9A 3THWB 4LH5A 1FKOA 1LWCA 3U8XA 2PFUA 3J8AA 1QTMA 1WAJA 4H5WA 4B3SK 1S9GA 1XUPO 3AARA 2O8CB 2QWNA 3G25A 1NJXA 4BDYA 4O0JA 3VQAA 3MX2A 2JGUA 3K9JA 4LH4A 3RR8A 1U4BA 4CF1A 5BR8K 2YCHA 3MEDA 3UKUB 1JXBA 3SMPA 3RMDA 5CR4A 5LY3A 3O4NA 3ATVA 4CEZA 4IFYA 3HJFA 4CBXA 5B8HA 2HMIA 4NLBA 4CGFA 1NG9A 1QVFM 4FJLA 1HQEA 3CCRN 4BRNA 3QEPA 1NBWA 4FJNA 5JLHA 3DLKA 1HNWK 3ENOA 3AVKA 3EZWA 4FJ8A 2BUPA 1L5UA 2FBVA 3HRGA 3B6PA 1B9DA 2Q2RA 2F96A 3HVTA 2P51A 3ZT4A 4OKKA 1X9SA 5AQFA 3VGMA 3C6UA 3UB5A 4CJUA 4CVNE 4E7IA 2CH5A 1VRTA 1M90O 5KI6A 4CJRA 2QTDA 1C1AA 2X74A 2VGMA 3OA9A 4A62A 2O8EA 2ZJRL 2HVHA 3IG1A 3NGYA 4BRIA 4W5NA 5EXWA 1ZBIA 1UA1A 1DTQA 4IG0A 5AQNA 3K9KA 3LP2A 2KFNA 3AVMA 4EFHA 4K25A 4H4MA 4CGHA 3CFPA 2FXUA 5FDLA 4HVJA 1MWMA 3HSCA 4W5RA 2XHBA 3VQBA 2E2NA 3I0SA 2NRHA 1KVAA 3LDOA 5KPTA 4DLEA 3LP3A 3CFRA 1Z6RA 4CBWA 2VYPA 3CERA 2WOMA 1KVBA 4PUOA 3DLEA 1VSIA 4JRPA 5E26A 4CEQA 3THYA 1LOTB 5C25A 3OYGA 2ITGA 4MLHA 2YHWA 1HLUA 2F9TA 2V7ZA 1IKWA 2YHBA 3LDLA 2X6SA 1D5AA 4OPAA 3ZCMA 1C0UA 2ASOA 4YDUA 3O80A 3P38A 3P4IA 2HHQA 3C6AA 3HP6A 3EE9A 3QFPA 4CEAA 5BRHA 3HZ6A 3DLLL 1D9DA 3KD5E 4DV5K 1ILYA 5LJWA 3DXMB 4FPBA 4DR3K 3DLGA 5GAEP 3TTFA 3PIOL 4G1QA 3PX0A 4JI7K 3ZX0A 3SAHA 4NCAA 5CYMA 2FF3B 4CFDA 4BR7A 3H3OB 4FLXA 3O5BA 1JLFA 3ITHA 4FPAA 4PA1A 3SK3A 4AILC 1RTDA 1XC3A 4M42A 5AQVA 4IOXA 3OHRA 3MN6A 3I55N 1N36K 3TR8A 4Y1DA 4DLGA 4KHYA 1KXPA 1HYZA 1VSKA 1GLBG 4KB0A 1DGKN 2YNFA 4FZZA 2HBJA 4BWJA 2P9UB 2Z1GA 3PUFA 3TANA 3KVGA 3A5MC 3ZT3A 3DRRA 3IAYA 4H0YB 4LF8K 3C6TA 3HVRA 4DU1A 4R79A 5AQWA 3AO3A 4BRAA 1M1KO 4B1YB 3L2WA 1VSEA 4PHTX 3AVFA 4KFBA 4W5TA 4BRHA 1BO5O 2NRWA 3P31A 1YITN 4XEIA 4CJ4A 1BA0A 1XI1A 4KHUA 2E6MA 3D2EA 2IVOA 2OPPA 3TTDA 2XY5A 3OJUA 4FWMA 1NK4A 2RPIA 2E2QA 1Q7YO 3OTOK 1ZBLA 1CZ9A 2V7YA 3J81O 3TAQA 4FCYA 4GKKK 1EWQA 3AA3A 2ITMA 5JICA 5BRDA 3OJSA 4WCEL 1GLEG 3VF4A 3F2KA 3ATUA 3AA2A 3RWUA 3ZSVA 2I7PA 2EHGA 3TPQA 4B8CA 1RCHA 3HP9A 4B3TK 4FJXA 3CMAN 3SUPA 1KRPA 1I3AA 4ID1A 4FLYA 4CHOA 2YJFA 4FJ5A 3J7YP 1HJOA 4G9ZA 3GL1A 3VF6A 4CZGA 5AQTA 1S1XA
chains in the Genus database with same CATH topology
3QEXA 1BISA 3OYIA 5C24A 4CJ3A 3DRSA 1RNHA 3U6FA 5J2QA 4B9TA 2F8TA 4CEDA 3QESA 3RMCA 1NK6A 2Y1IA 1ZBHA 4FJ9A 3AVNA 3OS0A 3NFAA 4FVMA 4IDKA 5JS2A 5FROA 4BDZA 3V9ZA 3MXJA 1LWEA 4CCHA 3KKRA 3AA4A 2HHTA 1A5WA 1I39A 4KI6A 4AH9A 3VA3A 4PY5A 5EU7A 5E41A 1LW2A 4DFMA 1NKCA 2BDPA 4E1NA 4ID5A 4F3TA 1RTHA 2FBYA 1CXQA 4BWMA 3NDKA 3V9UA 3V81A 3SQ0A 3SI6A 3KLHA 1RDDA 2G8KA 1S1UA 3V6DA 4CFCA 1RTIA 1BGXT 4CHPA 1RDBA 4CFBA 3SYZA 4B9VA 4EP5A 1BL3A 4H8KA 4KKOA 4F8RA 4DSLA 3CG7A 1NOZA 3L3UA 1DTTA 4IFVA 5K14A 1WSIA 3LZJA 4O5BA 4N76A 3LP0A 3NH2A 3QO9A 4B8AB 1C1CA 4E7HA 2FBXA 3EY1A 4J2EA 4KPYA 3O4QA 3IS9A 4CIFA 4Z4IA 2G8UA 1TV6A 2I5JA 1IH7A 3SNNA 1NK8A 1UWBA 1CXUA 2IOCA 2QK9A 1KLMA 3E01A 2VG7A 1FKPA 3LALA 5HRPA 3VA0A 4FJHA 1TKTA 3S3MA 2ZE2A 3K5LA 1HYSA 4CJVA 1NOYA 2B5JA 4CGIA 3KTQA 3HL8A 4JS5A 2IS3A 1NJWA 3KJVA 1XC9A 2RKIA 4FK0A 4I9QA 1VRUA 4BE2A 2P5GA 1HNIA 4FJ7A 4DTJA 4KTQA 1C6VA 3PO4A 2YHAA 4K8XA 2YKMA 1J9AA 3QETA 3LWMA 3OYKA 4M3XA 5SZTA 1UAXA 1XWLA 1S1XA 3QEIA 4FLWA 4ELVA 3OYAA 1S6QA 4DQQA 1F21A 3L2QA 1VSMA 3PV8A 2O4IA 3NAEA 1S5JA 4JLHA 3L8BA 4B9MA 1J53A 1NK7A 4CFAA 3K5MA 3H08A 2Z1HA 4E7LA 3AVJA 4B9SA 1B9FA 3VQ8A 3DMJA 3TAEA 4DWIA 2Z1JA 3LANA 1QSYA 2ETJA 1LAVA 4DG1A 4KRFA 4N56A 3OYEA 4DTRA 1L3SA 1RT1A 1QS4A 4AHCA 2IAJA 3ZT2A 4CHYA 1KFSA 1RBTA 3V9XA 1XHXA 4YNQA 1IO2A 4CGGA 3QERA 4HCCA 5FRNA 3PO5A 1JLAA 2YV0X 3CYMA 3T1AA 3VQCA 3I0RA 3OVNA 3WNGA 1WN7A 3DLHA 1WSHA 4CJSA 1TAQA 4CF2A 4J2AA 3K5OA 4F4KA 1TVRA 2D0BA 4KHQA 1N5YA 4CK2A 3SPYA 2IDOA 3AVAA 1RTJA 4H4OA 4AHVA 3AVGA 1WLJA 4LD0A 1C0TA 1GOBA 4CEOA 4KV8A 1VSLA 3MAQA 3T3FA 5D3GA 3SZ2A 3CQ8A 4GVMA 2IC3A 2BANA 2VWJA 2YNHA 3KLFA 1RT7A 4DSJA 3V1QA 2QKKA 1SUQA 2G8HA 1HRHA 1SL0A 4OLAA 4EZ9A 1TK0A 3VQPA 1ASWA 2G8WA 1SL1A 1JL1A 3LDSA 3DOKA 3HM9A 4M45A 3HPGA 3NF8A 4KTWA 4DTNA 1HPZA 3OYCA 1T8EA 2OYQA 1HJRA 4N5SA 5CZ2A 4DF4A 1N6QA 4OPJA 4B9UA 2EX3A 3HO1A 2YKNA 4CEEA 4CJFA 3OYJA 3VQDA 4DSFA 4DU3A 3ISNC 1NKBA 4C8KA 3TAMA 3RRGA 1YTUA 4KHNA 1NJZA 3VQQA 5KTQA 3DM2A 2OPQA 1IKYA 4Z0UA 4FK4A 3VQ9A 3VQEA 4ZHRA 1XHZA 5JS1A 1WSFA 4KREA 4ICLA 3SV3A 4DS5A 4JRQA 3TAFA 4CHZA 1D8YA 2IGIA 4OKJA 4RW8A 4B08A 4CJLA 5C42A 3OS1A 5I3UA 4C8LA 1ZYQA 3P1GA 4M3WA 5CYQA 4GW6A 3ZSQA 4Z4FA 2GV9A 4B9NA 3KLIA 1ASVA 4FLVA 5J1EA 1S1VA 2KQ2A 4O0IA 1JLEA 1SV5A 1Y97A 4I9LA 3THVA 1ITGA 2G8FA 3D0PA 2OPRA 3KIOA 4HUGA 1CLQA 2O4GA 3AVBA 3AA5X 4CESA 2LSNA 4NCGA 4W5OA 2QKBA 2KZMA 4CEBA 4L8RB 3OS2A 4F3OA 3I8DA 4FZYA 3QNOA 3AVHA 4QOZB 4CK3A 1BIZA 1L3TA 3NBPA 1JL2A 1TKZA 4I2QA 4CHQA 3TI0A 2HNYA 2F8SA 2DY4A 5DK5A 1KVCA 2D5RA 1EP4A 3LAKA 4OJRA 3ZSWA 3NHGA 1RBSA 3SQ1A 1RBUA 4M3RA 4M3YA 2KFZA 1RT2A 3DYAA 1RBVA 5HRSA 3S3OA 3MEGA 3U3GA 3WNHA 1RILA 4B9LA 3CM5A 3O3GA 4DQIA 3M8QA 4CIGA 3K59A 5HBMA 4M3TA 4CJEA 4DSKA 4O44A 1W9HA 2WONA 2Y1JA 1C0MA 3FFIA 1HMVA 1S9EA 1TGOA 4E0DA 1JXEA 1X9MA 2HB5A 2B6AA 4XIUA 2PZSA 3QLHA 4PWDA 4GMJB 1WSJA 1X9WA 2B4JA 4CJWA 1UOCA 1NJYA 4CF0A 3ZT0A 1JLGA 3OY9A 3AV9A 1J54A 4HUEA 4R5PA 2G8VA 2JLEA 4LH5A 2XRIA 4EP4A 3EZ5A 3PX6A 3NCIA 4CK1A 1FKOA 2GBZA 3B6OA 1LWCA 3TAGA 1C1BA 4Y1CA 2PY5A 4OGCA 3KK1A 1QTMA 4FZXC 1WAJA 3HPHA 1S9GA 4FJGA 1T05A 2VG6A 4O55A 4KHWA 4E89A 3LPUA 1NJXA 4BDYA 2X6NA 4O0JA 3VQAA 2JGUA 4LH4A 3WNFA 4DFPA 1U47A 1TAUA 1QE1A 1T03A 1VSDA 2XY8A 3RR8A 2OZSA 2HHSA 3QINA 3CM6A 1DLOA 4C8MA 3L3VA 3SUOA 3PX4A 3KD1E 1U4BA 4Q0BA 4CF1A 4LSLA 3MEDA 1GOCA 4Q5VA 1ASUA 5J2PA 5HRNA 4BACA 1JXBA 4KB1A 1J5OA 3OYFA 3LZIA 1Z25A 3RMDA 3DRPA 3O4NA 4CGJA 4CEFA 3OYHA 2YNGA 4CEZA 3ALYA 4IFYA 1IG9A 4CIEA 3MXMA 3HJFA 2HMIA 4KHSA 3LP1A 1CZBA 4CGFA 3KK2A 1X1PA 3SQ4A 4FJLA 1RDAA 4FLUA 5FRMA 1SKRA 1S1TA 3MEEA 1HQEA 1YT3A 4DTXA 1HQUA 2VG5A 3QEPA 4IG3A 3DI6A 4FJNA 1SL2A 2HHWA 3DLKA 3ULDA 4J2DA 1WAFA 4MQ3A 1NKEA 3RRHA 3AVKA 4DTOA 4RW4A 4ZTJA 5KRSA 4FJ8A 1BCOA 1BI4A 2OA8A 1LWFA 4YFUA 2D0AA 1L5UA 2FBVA 3PY8A 4KI4A 3DOLA 3M8PA 3ASMA 1QSSA 3B6PA 2BE2A 1B9DA 2A1RA 1FXXA 3NF9A 4DU4A 2P5OA 2DTUA 4DMNA 2F96A 2X78A 3HVTA 2P51A 4RW9A 3ZT1A 3ZT4A 3SV4A 3C94A 4OKKA 1R0AA 1U48A 1X9SA 2PYJA 1U45A 3C6UA 2DFHA 1O1WA 4CJUA 2FC0A 4E7IA 1VRTA 3AO2A 1YVUA 1UA0A 5KI6A 4CJRA 1C1AA 1W0HA 2X74A 3P83D 4E1MA 3MXIA 3OYLA 3HK2A 3AO5A 1NK0A 3V9SA 4CJQA 3QEWA 2HVHA 1NK9A 3IG1A 3NGYA 4KO0A 3ZSZA 4CJKA 3A2FA 4W5NA 5DMRA 3UIQA 1UA1A 1ZBIA 3DLBA 4DSIA 1DTQA 4IG0A 1YTAA 1L3VA 3LP2A 3AVLA 1D9FA 4QCLA 3AVMA 2KFNA 2HHXA 4H4MA 4O4GA 4LSNA 1HYVA 4CGHA 4FM0A 3CFPA 3LAMA 4RW7A 3K58A 3SUNA 3LWLA 4ELUA 3SJJA 5FDLA 4HVJA 3SPZA 4JS4A 1BHLA 4W5RA 2ZD1A 3K57A 3SCXA 1RBRA 2D0CA 3F73A 1RT4A 2XHBA 3IRXA 3VQBA 3I0SA 4DLEA 3HPOA 1KVAA 4DS4A 3SUQA 3L2UA 2W42A 1Q9XA 4EZ6A 3LP3A 3CFRA 4CGDA 4M3UA 3HYFA 2HW3A 3NH1A 3QIOA 1RT5A 4M3ZA 2WOMA 1KVBA 4DTUA 4PUOA 1TK5A 4AHUA 4KAZA 3DLEA 4E7KA 1MU2A 4OLBA 1JLBA 1VSIA 1T7PA 2RF2A 4CERA 4FJMA 4JRPA 4CEQA 1SKSA 1TKDA 1LW0A 5C25A 3OYGA 4IBNA 4FLZA 3ZSYA 3HT3A 2HVIA 2PYLA 3KK3A 3L2RA 1WSGA 1REVA 4RG8A 2ITGA 5J2MA 5KGWA 4W5QA 3NH0A 1KTQA 2YHBA 1IKWA 4C8OA 4AHRA 1EKEA 4CHNA 2X6SA 1D5AA 3JSMA 3ZCMA 1C0UA 4CE9A 2VWKA 1BIUA 4PQUA 4Z4CA 3O3FA 3L2VA 3S9HA 4FK2A 2HHQA 5SWMA 3EYZA 1TK8A 3HP6A 1RDCA 2OPSA 1JKHA 3S3NA 4NCBA 3G0ZA 4CEAA 1WSEA 4DTSA 1D9DA 1TL1A 4QAGA 3KD5E 4FXDA 1TL3A 4NYNA 1LAWA 4MFBA 1ZBUA 2HHUA 3RMBA 1NK5A 4ELTA 3DLGA 1RT3A 4BE1A 3LPTA 4G1QA 3PX0A 4FYDA 4I2PA 1JLCA 3M8RA 4K8ZA 4I7FA 1U49A 1EXQA 4NCAA 3TAPA 1GOAA 5CYMA 3JYTA 4DFJA 4CFDA 3DLRA 1VK0A 3QIPA 3M8SA 1VSJA 3RTVA 1BQMA 1Q8IA 4FM1A 4FLXA 2XY7A 2KTQA 1JLFA 1IKVA 5HROA 3ITHA 1QHTA 1ZBFA 4LY7A 4PA1A 3RR7A 3P5JA 4CF9A 4AILC 1RTDA 4FLTA 2P1JA 4M42A 1QQCA 3AVCA 4C8NA 3D45A 4BE0A 3ZSRA 4NYFA 4DSEA 4F2SA 2KZZA 4OPKA 3NE6A 3MECA 4J2BA 2NUBA 4UQGA 5J2NA 1LV5A 3NGIA 4OGEA 4IKFA 3TR8A 4RW6A 4Y1DA 4CJPA 2Q3SA 1Q9YA 4DLGA 2AJQA 4KHYA 3V4IA 2OZMA 1HYZA 3ZSOA 4HCBA 1VSKA 4Z4HA 4FJIA 4KB0A 1BCMA 3NF6A 2QXFA 2YNFA 2E6LA 3QNNA 4FZZA 1WNSA 4CJ5A 4M41A 4HTUA 4FW2A 4B3OA 4DF8A 4BWJA 3OYBA 3KLEA 1Z26A 3CFOA 4N47A 5HP1A 2Z1GA 3PUFA 4WE1A 3SQ2A 3TANA 3AVIA 4DQPA 1KLNA 2XY6A 4FJJA 3ZT3A 3DRRA 4FW1A 4FM2A 4Z4EA 3C95A 3IAYA 1G15A 1KSPA 3AO1A 3VQ5A 4Z4GA 3C6TA 3HVRA 4HHTA 4DU1A 3BDPA 1HNVA 1EETA 1K6YA 4F2RA 4KTZA 2KW4A 3K2PA 4TSXA 3VN5A 5KGXA 3AO3A 5T7BA 1VSEA 3KKSA 4OKEA 3L2WA 3BGRA 3AVFA 4KFBA 4W5TA 4AHSA 3U3YA 1RT6A 4BDPA 4AHTA 4DQSA 4OVLA 1FK9A 2FBTA 3TARA 2E4LA 5I42A 4E19A 2DFFA 4CJ4A 1XI1A 3ZSXA 4ZTFA 4KHUA 2E6MA 2GUIA 2HNZA 4CECA 2OPPA 3V9WA 3TABA 3OYMA 2XY5A 1EX4A 3OJUA 5CZ1A 1SKWA 1IKXA 1NK4A 2RPIA 2ATQA 3AO4A 5HRRA 2HNDA 3HSTB 1ZBLA 1QSLA 1CZ9A 2HHVA 3TAQA 4FCYA 3V1OA 4DTMA 2A1SA 5HLFA 1VSFA 4CF8A 4HUFA 2ZQBA 3QEVA 4N41A 2XO7A 3AA3A 1VSHA 3OJSA 2DFEA 1JLQA 3VQ7A 3V1RA 2BGGA 3TWHA 3OYDA 3RWUA 3AA2A 3HXMA 2G8IA 3ZSVA 1KCFA 1TKXA 1U04A 3VQ6A 3T19A 2EHGA 4B8CA 1BQNA 3VQ4A 5KRTA 1RCHA 3HP9A 3WNEA 3F9KA 2R7YA 4E3SA 1A5XA 3RMAA 3NF7A 4FJXA 4CJTA 1KFDA 3SUPA 1KRPA 1I3AA 4ID1A 4FLYA 4CHOA 4DQRA 1A5VA 4FJ5A 3NGZA 3K5NA 5CY4A 1B92A 2YNIA 3O3HA 1L3UA 4FJKA 4E7JA 4DFKA 2RN2A 4DTPA 1BI4B 3G10A 3OYNA 1S1WA 1S6PA 3KLGA 2Z1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QEX A;  1BIS A;  3OYI A;  5C24 A;  4CJ3 A;  3DRS A;  1RNH A;  3U6F A;  5J2Q A;  4B9T A;  2F8T A;  4CED A;  3QES A;  3RMC A;  1NK6 A;  2Y1I A;  1ZBH A;  4FJ9 A;  3AVN A;  3OS0 A;  3NFA A;  4FVM A;  4IDK A;  5JS2 A;  5FRO A;  4BDZ A;  3V9Z A;  3MXJ A;  1LWE A;  4CCH A;  3KKR A;  3AA4 A;  2HHT A;  1A5W A;  1I39 A;  4KI6 A;  4AH9 A;  3VA3 A;  4PY5 A;  5EU7 A;  5E41 A;  1LW2 A;  4DFM A;  1NKC A;  2BDP A;  4E1N A;  4ID5 A;  4F3T A;  1RTH A;  2FBY A;  1CXQ A;  4BWM A;  3NDK A;  3V9U A;  3V81 A;  3SQ0 A;  3SI6 A;  3KLH A;  1RDD A;  2G8K A;  1S1U A;  3V6D A;  4CFC A;  1RTI A;  1BGX T;  4CHP A;  1RDB A;  4CFB A;  3SYZ A;  4B9V A;  4EP5 A;  1BL3 A;  4H8K A;  4KKO A;  4F8R A;  4DSL A;  3CG7 A;  1NOZ A;  3L3U A;  1DTT A;  4IFV A;  5K14 A;  1WSI A;  3LZJ A;  4O5B A;  4N76 A;  3LP0 A;  3NH2 A;  3QO9 A;  4B8A B;  1C1C A;  4E7H A;  2FBX A;  3EY1 A;  4J2E A;  4KPY A;  3O4Q A;  3IS9 A;  4CIF A;  4Z4I A;  2G8U A;  1TV6 A;  2I5J A;  1IH7 A;  3SNN A;  1NK8 A;  1UWB A;  1CXU A;  2IOC A;  2QK9 A;  1KLM A;  3E01 A;  2VG7 A;  1FKP A;  3LAL A;  5HRP A;  3VA0 A;  4FJH A;  1TKT A;  3S3M A;  2ZE2 A;  3K5L A;  1HYS A;  4CJV A;  1NOY A;  2B5J A;  4CGI A;  3KTQ A;  3HL8 A;  4JS5 A;  2IS3 A;  1NJW A;  3KJV A;  1XC9 A;  2RKI A;  4FK0 A;  4I9Q A;  1VRU A;  4BE2 A;  2P5G A;  1HNI A;  4FJ7 A;  4DTJ A;  4KTQ A;  1C6V A;  3PO4 A;  2YHA A;  4K8X A;  2YKM A;  1J9A A;  3QET A;  3LWM A;  3OYK A;  4M3X A;  5SZT A;  1UAX A;  1XWL A;  1S1X A;  3QEI A;  4FLW A;  4ELV A;  3OYA A;  1S6Q A;  4DQQ A;  1F21 A;  3L2Q A;  1VSM A;  3PV8 A;  2O4I A;  3NAE A;  1S5J A;  4JLH A;  3L8B A;  4B9M A;  1J53 A;  1NK7 A;  4CFA A;  3K5M A;  3H08 A;  2Z1H A;  4E7L A;  3AVJ A;  4B9S A;  1B9F A;  3VQ8 A;  3DMJ A;  3TAE A;  4DWI A;  2Z1J A;  3LAN A;  1QSY A;  2ETJ A;  1LAV A;  4DG1 A;  4KRF A;  4N56 A;  3OYE A;  4DTR A;  1L3S A;  1RT1 A;  1QS4 A;  4AHC A;  2IAJ A;  3ZT2 A;  4CHY A;  1KFS A;  1RBT A;  3V9X A;  1XHX A;  4YNQ A;  1IO2 A;  4CGG A;  3QER A;  4HCC A;  5FRN A;  3PO5 A;  1JLA A;  2YV0 X;  3CYM A;  3T1A A;  3VQC A;  3I0R A;  3OVN A;  3WNG A;  1WN7 A;  3DLH A;  1WSH A;  4CJS A;  1TAQ A;  4CF2 A;  4J2A A;  3K5O A;  4F4K A;  1TVR A;  2D0B A;  4KHQ A;  1N5Y A;  4CK2 A;  3SPY A;  2IDO A;  3AVA A;  1RTJ A;  4H4O A;  4AHV A;  3AVG A;  1WLJ A;  4LD0 A;  1C0T A;  1GOB A;  4CEO A;  4KV8 A;  1VSL A;  3MAQ A;  3T3F A;  5D3G A;  3SZ2 A;  3CQ8 A;  4GVM A;  2IC3 A;  2BAN A;  2VWJ A;  2YNH A;  3KLF A;  1RT7 A;  4DSJ A;  3V1Q A;  2QKK A;  1SUQ A;  2G8H A;  1HRH A;  1SL0 A;  4OLA A;  4EZ9 A;  1TK0 A;  3VQP A;  1ASW A;  2G8W A;  1SL1 A;  1JL1 A;  3LDS A;  3DOK A;  3HM9 A;  4M45 A;  3HPG A;  3NF8 A;  4KTW A;  4DTN A;  1HPZ A;  3OYC A;  1T8E A;  2OYQ A;  1HJR A;  4N5S A;  5CZ2 A;  4DF4 A;  1N6Q A;  4OPJ A;  4B9U A;  2EX3 A;  3HO1 A;  2YKN A;  4CEE A;  4CJF A;  3OYJ A;  3VQD A;  4DSF A;  4DU3 A;  3ISN C;  1NKB A;  4C8K A;  3TAM A;  3RRG A;  1YTU A;  4KHN A;  1NJZ A;  3VQQ A;  5KTQ A;  3DM2 A;  2OPQ A;  1IKY A;  4Z0U A;  4FK4 A;  3VQ9 A;  3VQE A;  4ZHR A;  1XHZ A;  5JS1 A;  1WSF A;  4KRE A;  4ICL A;  3SV3 A;  4DS5 A;  4JRQ A;  3TAF A;  4CHZ A;  1D8Y A;  2IGI A;  4OKJ A;  4RW8 A;  4B08 A;  4CJL A;  5C42 A;  3OS1 A;  5I3U A;  4C8L A;  1ZYQ A;  3P1G A;  4M3W A;  5CYQ A;  4GW6 A;  3ZSQ A;  4Z4F A;  2GV9 A;  4B9N A;  3KLI A;  1ASV A;  4FLV A;  5J1E A;  1S1V A;  2KQ2 A;  4O0I A;  1JLE A;  1SV5 A;  1Y97 A;  4I9L A;  3THV A;  1ITG A;  2G8F A;  3D0P A;  2OPR A;  3KIO A;  4HUG A;  1CLQ A;  2O4G A;  3AVB A;  3AA5 X;  4CES A;  2LSN A;  4NCG A;  4W5O A;  2QKB A;  2KZM A;  4CEB A;  4L8R B;  3OS2 A;  4F3O A;  3I8D A;  4FZY A;  3QNO A;  3AVH A;  4QOZ B;  4CK3 A;  1BIZ A;  1L3T A;  3NBP A;  1JL2 A;  1TKZ A;  4I2Q A;  4CHQ A;  3TI0 A;  2HNY A;  2F8S A;  2DY4 A;  5DK5 A;  1KVC A;  2D5R A;  1EP4 A;  3LAK A;  4OJR A;  3ZSW A;  3NHG A;  1RBS A;  3SQ1 A;  1RBU A;  4M3R A;  4M3Y A;  2KFZ A;  1RT2 A;  3DYA A;  1RBV A;  5HRS A;  3S3O A;  3MEG A;  3U3G A;  3WNH A;  1RIL A;  4B9L A;  3CM5 A;  3O3G A;  4DQI A;  3M8Q A;  4CIG A;  3K59 A;  5HBM A;  4M3T A;  4CJE A;  4DSK A;  4O44 A;  1W9H A;  2WON A;  2Y1J A;  1C0M A;  3FFI A;  1HMV A;  1S9E A;  1TGO A;  4E0D A;  1JXE A;  1X9M A;  2HB5 A;  2B6A A;  4XIU A;  2PZS A;  3QLH A;  4PWD A;  4GMJ B;  1WSJ A;  1X9W A;  2B4J A;  4CJW A;  1UOC A;  1NJY A;  4CF0 A;  3ZT0 A;  1JLG A;  3OY9 A;  3AV9 A;  1J54 A;  4HUE A;  4R5P A;  2G8V A;  2JLE A;  4LH5 A;  2XRI A;  4EP4 A;  3EZ5 A;  3PX6 A;  3NCI A;  4CK1 A;  1FKO A;  2GBZ A;  3B6O A;  1LWC A;  3TAG A;  1C1B A;  4Y1C A;  2PY5 A;  4OGC A;  3KK1 A;  1QTM A;  4FZX C;  1WAJ A;  3HPH A;  1S9G A;  4FJG A;  1T05 A;  2VG6 A;  4O55 A;  4KHW A;  4E89 A;  3LPU A;  1NJX A;  4BDY A;  2X6N A;  4O0J A;  3VQA A;  2JGU A;  4LH4 A;  3WNF A;  4DFP A;  1U47 A;  1TAU A;  1QE1 A;  1T03 A;  1VSD A;  2XY8 A;  3RR8 A;  2OZS A;  2HHS A;  3QIN A;  3CM6 A;  1DLO A;  4C8M A;  3L3V A;  3SUO A;  3PX4 A;  3KD1 E;  1U4B A;  4Q0B A;  4CF1 A;  4LSL A;  3MED A;  1GOC A;  4Q5V A;  1ASU A;  5J2P A;  5HRN A;  4BAC A;  1JXB A;  4KB1 A;  1J5O A;  3OYF A;  3LZI A;  1Z25 A;  3RMD A;  3DRP A;  3O4N A;  4CGJ A;  4CEF A;  3OYH A;  2YNG A;  4CEZ A;  3ALY A;  4IFY A;  1IG9 A;  4CIE A;  3MXM A;  3HJF A;  2HMI A;  4KHS A;  3LP1 A;  1CZB A;  4CGF A;  3KK2 A;  1X1P A;  3SQ4 A;  4FJL A;  1RDA A;  4FLU A;  5FRM A;  1SKR A;  1S1T A;  3MEE A;  1HQE A;  1YT3 A;  4DTX A;  1HQU A;  2VG5 A;  3QEP A;  4IG3 A;  3DI6 A;  4FJN A;  1SL2 A;  2HHW A;  3DLK A;  3ULD A;  4J2D A;  1WAF A;  4MQ3 A;  1NKE A;  3RRH A;  3AVK A;  4DTO A;  4RW4 A;  4ZTJ A;  5KRS A;  4FJ8 A;  1BCO A;  1BI4 A;  2OA8 A;  1LWF A;  4YFU A;  2D0A A;  1L5U A;  2FBV A;  3PY8 A;  4KI4 A;  3DOL A;  3M8P A;  3ASM A;  1QSS A;  3B6P A;  2BE2 A;  1B9D A;  2A1R A;  1FXX A;  3NF9 A;  4DU4 A;  2P5O A;  2DTU A;  4DMN A;  2F96 A;  2X78 A;  3HVT A;  2P51 A;  4RW9 A;  3ZT1 A;  3ZT4 A;  3SV4 A;  3C94 A;  4OKK A;  1R0A A;  1U48 A;  1X9S A;  2PYJ A;  1U45 A;  3C6U A;  2DFH A;  1O1W A;  4CJU A;  2FC0 A;  4E7I A;  1VRT A;  3AO2 A;  1YVU A;  1UA0 A;  5KI6 A;  4CJR A;  1C1A A;  1W0H A;  2X74 A;  3P83 D;  4E1M A;  3MXI A;  3OYL A;  3HK2 A;  3AO5 A;  1NK0 A;  3V9S A;  4CJQ A;  3QEW A;  2HVH A;  1NK9 A;  3IG1 A;  3NGY A;  4KO0 A;  3ZSZ A;  4CJK A;  3A2F A;  4W5N A;  5DMR A;  3UIQ A;  1UA1 A;  1ZBI A;  3DLB A;  4DSI A;  1DTQ A;  4IG0 A;  1YTA A;  1L3V A;  3LP2 A;  3AVL A;  1D9F A;  4QCL A;  3AVM A;  2KFN A;  2HHX A;  4H4M A;  4O4G A;  4LSN A;  1HYV A;  4CGH A;  4FM0 A;  3CFP A;  3LAM A;  4RW7 A;  3K58 A;  3SUN A;  3LWL A;  4ELU A;  3SJJ A;  5FDL A;  4HVJ A;  3SPZ A;  4JS4 A;  1BHL A;  4W5R A;  2ZD1 A;  3K57 A;  3SCX A;  1RBR A;  2D0C A;  3F73 A;  1RT4 A;  2XHB A;  3IRX A;  3VQB A;  3I0S A;  4DLE A;  3HPO A;  1KVA A;  4DS4 A;  3SUQ A;  3L2U A;  2W42 A;  1Q9X A;  4EZ6 A;  3LP3 A;  3CFR A;  4CGD A;  4M3U A;  3HYF A;  2HW3 A;  3NH1 A;  3QIO A;  1RT5 A;  4M3Z A;  2WOM A;  1KVB A;  4DTU A;  4PUO A;  1TK5 A;  4AHU A;  4KAZ A;  3DLE A;  4E7K A;  1MU2 A;  4OLB A;  1JLB A;  1VSI A;  1T7P A;  2RF2 A;  4CER A;  4FJM A;  4JRP A;  4CEQ A;  1SKS A;  1TKD A;  1LW0 A;  5C25 A;  3OYG A;  4IBN A;  4FLZ A;  3ZSY A;  3HT3 A;  2HVI A;  2PYL A;  3KK3 A;  3L2R A;  1WSG A;  1REV A;  4RG8 A;  2ITG A;  5J2M A;  5KGW A;  4W5Q A;  3NH0 A;  1KTQ A;  2YHB A;  1IKW A;  4C8O A;  4AHR A;  1EKE A;  4CHN A;  2X6S A;  1D5A A;  3JSM A;  3ZCM A;  1C0U A;  4CE9 A;  2VWK A;  1BIU A;  4PQU A;  4Z4C A;  3O3F A;  3L2V A;  3S9H A;  4FK2 A;  2HHQ A;  5SWM A;  3EYZ A;  1TK8 A;  3HP6 A;  1RDC A;  2OPS A;  1JKH A;  3S3N A;  4NCB A;  3G0Z A;  4CEA A;  1WSE A;  4DTS A;  1D9D A;  1TL1 A;  4QAG A;  3KD5 E;  4FXD A;  1TL3 A;  4NYN A;  1LAW A;  4MFB A;  1ZBU A;  2HHU A;  3RMB A;  1NK5 A;  4ELT A;  3DLG A;  1RT3 A;  4BE1 A;  3LPT A;  4G1Q A;  3PX0 A;  4FYD A;  4I2P A;  1JLC A;  3M8R A;  4K8Z A;  4I7F A;  1U49 A;  1EXQ A;  4NCA A;  3TAP A;  1GOA A;  5CYM A;  3JYT A;  4DFJ A;  4CFD A;  3DLR A;  1VK0 A;  3QIP A;  3M8S A;  1VSJ A;  3RTV A;  1BQM A;  1Q8I A;  4FM1 A;  4FLX A;  2XY7 A;  2KTQ A;  1JLF A;  1IKV A;  5HRO A;  3ITH A;  1QHT A;  1ZBF A;  4LY7 A;  4PA1 A;  3RR7 A;  3P5J A;  4CF9 A;  4AIL C;  1RTD A;  4FLT A;  2P1J A;  4M42 A;  1QQC A;  3AVC A;  4C8N A;  3D45 A;  4BE0 A;  3ZSR A;  4NYF A;  4DSE A;  4F2S A;  2KZZ A;  4OPK A;  3NE6 A;  3MEC A;  4J2B A;  2NUB A;  4UQG A;  5J2N A;  1LV5 A;  3NGI A;  4OGE A;  4IKF A;  3TR8 A;  4RW6 A;  4Y1D A;  4CJP A;  2Q3S A;  1Q9Y A;  4DLG A;  2AJQ A;  4KHY A;  3V4I A;  2OZM A;  1HYZ A;  3ZSO A;  4HCB A;  1VSK A;  4Z4H A;  4FJI A;  4KB0 A;  1BCM A;  3NF6 A;  2QXF A;  2YNF A;  2E6L A;  3QNN A;  4FZZ A;  1WNS A;  4CJ5 A;  4M41 A;  4HTU A;  4FW2 A;  4B3O A;  4DF8 A;  4BWJ A;  3OYB A;  3KLE A;  1Z26 A;  3CFO A;  4N47 A;  5HP1 A;  2Z1G A;  3PUF A;  4WE1 A;  3SQ2 A;  3TAN A;  3AVI A;  4DQP A;  1KLN A;  2XY6 A;  4FJJ A;  3ZT3 A;  3DRR A;  4FW1 A;  4FM2 A;  4Z4E A;  3C95 A;  3IAY A;  1G15 A;  1KSP A;  3AO1 A;  3VQ5 A;  4Z4G A;  3C6T A;  3HVR A;  4HHT A;  4DU1 A;  3BDP A;  1HNV A;  1EET A;  1K6Y A;  4F2R A;  4KTZ A;  2KW4 A;  3K2P A;  4TSX A;  3VN5 A;  5KGX A;  3AO3 A;  5T7B A;  1VSE A;  3KKS A;  4OKE A;  3L2W A;  3BGR A;  3AVF A;  4KFB A;  4W5T A;  4AHS A;  3U3Y A;  1RT6 A;  4BDP A;  4AHT A;  4DQS A;  4OVL A;  1FK9 A;  2FBT A;  3TAR A;  2E4L A;  5I42 A;  4E19 A;  2DFF A;  4CJ4 A;  1XI1 A;  3ZSX A;  4ZTF A;  4KHU A;  2E6M A;  2GUI A;  2HNZ A;  4CEC A;  2OPP A;  3V9W A;  3TAB A;  3OYM A;  2XY5 A;  1EX4 A;  3OJU A;  5CZ1 A;  1SKW A;  1IKX A;  1NK4 A;  2RPI A;  2ATQ A;  3AO4 A;  5HRR A;  2HND A;  3HST B;  1ZBL A;  1QSL A;  1CZ9 A;  2HHV A;  3TAQ A;  4FCY A;  3V1O A;  4DTM A;  2A1S A;  5HLF A;  1VSF A;  4CF8 A;  4HUF A;  2ZQB A;  3QEV A;  4N41 A;  2XO7 A;  3AA3 A;  1VSH A;  3OJS A;  2DFE A;  1JLQ A;  3VQ7 A;  3V1R A;  2BGG A;  3TWH A;  3OYD A;  3RWU A;  3AA2 A;  3HXM A;  2G8I A;  3ZSV A;  1KCF A;  1TKX A;  1U04 A;  3VQ6 A;  3T19 A;  2EHG A;  4B8C A;  1BQN A;  3VQ4 A;  5KRT A;  1RCH A;  3HP9 A;  3WNE A;  3F9K A;  2R7Y A;  4E3S A;  1A5X A;  3RMA A;  3NF7 A;  4FJX A;  4CJT A;  1KFD A;  3SUP A;  1KRP A;  1I3A A;  4ID1 A;  4FLY A;  4CHO A;  4DQR A;  1A5V A;  4FJ5 A;  3NGZ A;  3K5N A;  5CY4 A;  1B92 A;  2YNI A;  3O3H A;  1L3U A;  4FJK A;  4E7J A;  4DFK A;  2RN2 A;  4DTP A;  1BI4 B;  3G10 A;  3OYN A;  1S1W A;  1S6P A;  3KLG A;  2Z1I A; 
#chains in the Genus database with same CATH topology
 4BY9 C;  2F7T A;  2FLO A;  5BRF A;  3AA4 A;  3HI0 A;  3S41 A;  4KI6 A;  3UE5 A;  3VA3 A;  5GIN A;  1NKC A;  2A40 A;  4F3T A;  2UU9 K;  5CHI A;  1IBL K;  3SQ0 A;  1RDD A;  3AAP A;  3T7Z A;  2G8K A;  2O8E B;  1KAY A;  3QDK A;  1BGX T;  4CHP A;  5JMV A;  1RDB A;  3MMV A;  3D2F A;  4F8R A;  3L3U A;  1VQN N;  4O5B A;  4BRC A;  1NJI O;  2FBX A;  3EY1 A;  4KPY A;  3O4Q A;  4CIF A;  1J5E K;  2GWJ A;  3SNN A;  3IMX A;  4IOA L;  5ADX A;  1KLM A;  3LAL A;  3VA0 A;  4FJH A;  1TKT A;  4FWR A;  4CJV A;  3TSP A;  4V19 S;  2B5J A;  4IXC A;  4CGI A;  3HL8 A;  4JS5 A;  2YJE A;  2IS3 A;  1NJW A;  3KJV A;  1QHA A;  4CZF A;  1XC9 A;  2GTD A;  4A2B A;  5LMU K;  4I9Q A;  2P5G A;  3A5O C;  4PKH A;  4KTQ A;  1C6V A;  3VGL A;  2PAV A;  5SZT A;  4M63 C;  1QZ6 A;  2E5L K;  3M5R A;  3THY B;  4DV7 K;  3OYA A;  3TU5 A;  4DQQ A;  4BVP A;  1VQO N;  4DR6 K;  1BOT O;  3L8B A;  4B9M A;  1J53 A;  3AVJ A;  4B9S A;  3EN9 A;  4X62 K;  2WFB A;  1HKB A;  1QS4 A;  2IAJ A;  3CCU N;  3V9X A;  1XHX A;  3QER A;  4HCC A;  2YV0 X;  3O08 A;  3T1A A;  1YJ9 N;  1T44 A;  3K5O A;  1K73 O;  1TVR A;  2P9K A;  2E2P A;  3L4I A;  3SPY A;  1N5Y A;  4KHQ A;  3AVA A;  1RTJ A;  4AHV A;  2D0O A;  4LD0 A;  4CBU A;  1C0T A;  4KV8 A;  2BAN A;  1S72 N;  2YNH A;  3KLF A;  1RT7 A;  5DM6 L;  4EZ9 A;  3BY5 A;  1JL1 A;  3LDS A;  3DOK A;  4M45 A;  3HPG A;  1OH7 A;  1ZC6 A;  5HL7 L;  1NMN A;  4DTN A;  3OYC A;  1T8E A;  4AQY K;  4JK8 A;  4OPJ A;  3CCM N;  4DU3 A;  2I7N A;  3ISN C;  1YUW A;  5M1Q A;  1HKG A;  1NJZ A;  3VQQ A;  1IKY A;  4Z0U A;  4FK4 A;  3EE8 A;  4ZHR A;  3O9S A;  1VQ5 N;  4JRQ A;  2PBD A;  1VHX A;  4MDA A;  3GG4 A;  4OKJ A;  5C42 A;  4M3W A;  3DWL A;  2BTF A;  3KLI A;  5J1E A;  1S1V A;  1IV0 A;  4HUG A;  1CLQ A;  2O4G A;  4MLE A;  3CPE A;  3R3L A;  4CES A;  3FLC O;  3EL2 A;  4JKH A;  4CK3 A;  4I2Q A;  4DV1 K;  1TKZ A;  1KVC A;  3OBY A;  3LAK A;  3MWP A;  4OJR A;  1XQS C;  4JN4 A;  4FWP A;  1RBU A;  5AZJ A;  1C0G A;  4M3Y A;  4H03 B;  1NMD A;  3LM9 A;  3S3O A;  4B9L A;  3CM5 A;  4M3T A;  3M8Q A;  2WON A;  3QBW A;  4WQ4 C;  2KLA A;  1NLV A;  2B6A A;  3QLH A;  1GLC G;  1WSJ A;  3LDP A;  4CJW A;  3IDH A;  5M1O A;  3ZT0 A;  2JLE A;  2XRI A;  4EP4 A;  4BR5 A;  4CK1 A;  2HBK A;  4WQ5 C;  4BGB A;  3G4S N;  4FZX C;  3HPH A;  4Y0W A;  4FJG A;  2VG6 A;  4KHW A;  3RSE A;  1OVQ A;  1SZ2 A;  4E89 A;  2A6A A;  3BEX A;  4B9Q A;  1QE1 A;  2H3G X;  3PSF A;  2HHS A;  3CM6 A;  1DLO A;  3SUO A;  5F1X A;  3PX4 A;  4WYB A;  3C6H A;  4Q5V A;  4BAC A;  4KB1 A;  1J5O A;  3LZI A;  1XMQ K;  1IG9 A;  3MXM A;  1X3N A;  4H0O A;  3LP1 A;  2QWO A;  3D2F B;  1RDA A;  1VQ8 N;  3O9R A;  4FLU A;  3MEE A;  4IOC L;  5AZI B;  2VG5 A;  5AQZ A;  3MX5 A;  2HHW A;  4CZL A;  3L6Q A;  3FR0 A;  4MQ3 A;  3RRH A;  4DTO A;  3FGU A;  4F9O A;  4IEE A;  1LWF A;  5AQH A;  4YFU A;  2D0A A;  3NVK A;  4LF4 K;  4A2A A;  3M8P A;  3ASM A;  1FXX A;  3NF9 A;  4DMN A;  2X78 A;  4RW9 A;  3C94 A;  3MN7 A;  1U48 A;  2PYJ A;  1U45 A;  2CGL A;  1U2V A;  4YOR A;  1NGC A;  5TKY A;  3D7E O;  1O1W A;  5BRE A;  4CZM A;  2FC0 A;  1UA0 A;  3O6W A;  4E1M A;  3MXI A;  1NK0 A;  3V9S A;  4CZI A;  3QEW A;  4H5R A;  3A2F A;  3W3D A;  5KPZ A;  5DMR A;  3UIQ A;  4BRQ A;  4B3R K;  3AVL A;  5GIO A;  4O4G A;  4LSN A;  1W2B M;  1ESV A;  1HYV A;  2QM1 A;  3LAM A;  3SUN A;  2HST A;  4ELU A;  3LWL A;  1ZXO A;  1BHL A;  3K57 A;  4BRK A;  1RBR A;  2D0C A;  1RT4 A;  1Q9X A;  3O9Q A;  3SUQ A;  4IO9 L;  2W42 A;  1E4F T;  3HYF A;  3CD6 N;  3SJH A;  2P9K B;  3O9U A;  5AJ3 K;  4KAZ A;  5EX5 A;  4OLB A;  2E88 A;  1TKD A;  4FLZ A;  3IKM A;  2W6K A;  3SAG A;  4W5Q A;  5E84 A;  1KTQ A;  3NH0 A;  4C8O A;  3LL3 A;  4AM6 A;  4CHN A;  2WBN A;  4JYA K;  2VWK A;  3L2V A;  4FK2 A;  1LCU A;  4RTF D;  2OPS A;  1JKH A;  3H46 O;  4NCB A;  3G0Z A;  4ISG A;  4BGA A;  4WQ4 A;  2UUB K;  1TL3 A;  4MFB A;  1NK5 A;  1G99 A;  3TTC A;  4FYD A;  4C23 A;  4JI2 K;  4QS8 A;  1EXQ A;  3FZM A;  3MCA B;  1OH6 A;  3WEE A;  2KKZ A;  1QQN A;  1VSJ A;  3CCQ N;  4DV2 K;  1IKV A;  4CZH A;  2O8B A;  1QHT A;  1ZBF A;  4LY7 A;  4B1W B;  4BG8 A;  2NRR A;  2P1J A;  4WFB L;  4C8N A;  3D45 A;  4NYF A;  4DSE A;  2HOE A;  3NE6 A;  4J2B A;  4IKF A;  3O8M A;  2AJQ A;  3V4I A;  4O8U A;  4FJI A;  4M7X A;  1BCM A;  3NF6 A;  2QXF A;  3EO3 A;  1WNS A;  3JS6 A;  4FW2 A;  4B3O A;  4DF8 A;  3OYB A;  5HP1 A;  3VEO A;  1YAG A;  5C10 A;  1V4T A;  3SQ2 A;  3AVI A;  4DQP A;  4JI0 K;  1U6Z A;  4NLC A;  4FJJ A;  3SMS A;  1VQ6 N;  4FM2 A;  1ATN A;  1G15 A;  3VQ5 A;  4Z4G A;  5BN8 A;  1HNV A;  1EET A;  4F2R A;  4KTZ A;  3VN5 A;  5KGX A;  4CZE A;  5T7B A;  4CZJ A;  3U3Y A;  4CZK A;  1VQM N;  4AHT A;  4DQS A;  4GV3 A;  1FK9 A;  4IEI A;  5I42 A;  4E19 A;  3ZSX A;  2QWM A;  4CEC A;  2HNZ A;  3OYM A;  2ATQ A;  4A5A A;  4I6M A;  4CD1 A;  3AO4 A;  3HST B;  1QSL A;  2HHV A;  4FWN A;  4PL7 A;  2A1S A;  5HLF A;  1VSF A;  2NRV A;  2ZQB A;  3QEV A;  4N41 A;  3H45 C;  3CF5 L;  1JLQ A;  2UXC K;  3TWH A;  3R9P A;  4L3Q A;  1TKX A;  1U04 A;  4JHD B;  3VQ4 A;  3WNE A;  3F9K A;  2R7Y A;  4JKD A;  1A5X A;  3K0S A;  3FZL A;  5ELZ A;  3K5N A;  2P9I B;  2YNI A;  5CY4 A;  1MA9 B;  4IDH A;  3O3H A;  1L3U A;  4DFK A;  4FJK A;  2RN2 A;  2FSJ A;  1V4S A;  3SPZ A;  3KLG A;  2Z1I A;  2ASM A;  5C24 A;  3OYI A;  3U6F A;  4B9T A;  3RMC A;  1ZBH A;  4FJ9 A;  1BWF O;  4JI4 K;  4FVM A;  4IJN A;  4IDK A;  3V9Z A;  1LWE A;  4AH9 A;  5E41 A;  1LW2 A;  3H1V X;  1U2V B;  4DFM A;  2BDP A;  5H1S Q;  4LC9 B;  4E1N A;  1OH8 A;  4ID5 A;  4LF7 K;  2OCE A;  3V9U A;  3V81 A;  3SI6 A;  1S1U A;  5TKW A;  4CFC A;  3VF2 A;  1RTI A;  3UKR B;  4CFB A;  4BVO A;  1HPM A;  4EP5 A;  1BL3 A;  3BP8 A;  3JXU A;  3NH2 A;  4B8A B;  1J6Z A;  2G8U A;  1HX1 A;  1NGA A;  1TV6 A;  4DUZ K;  2IOC A;  1YF5 L;  1N33 K;  2ZE2 A;  1KD1 O;  3WUH A;  3GE1 A;  1NOY A;  3BZC A;  3C7N A;  3KTQ A;  2RE2 A;  1E4G T;  1X9J A;  4FK0 A;  2JWL A;  3A5L C;  2YHA A;  1J9A A;  3QET A;  3OYK A;  4OX9 K;  1UAX A;  1NNE A;  4PKG A;  3QEI A;  3VEW A;  4EHU A;  4ELV A;  1S6Q A;  3WT0 A;  3L2Q A;  2VQF K;  1VSM A;  1Q81 O;  4CFA A;  3K5M A;  4DWI A;  3LAN A;  4YOW A;  1QSY A;  1YI2 N;  4N56 A;  4DTR A;  2JWK A;  1IO2 A;  4CGG A;  5GAD P;  1K8K A;  3PO5 A;  2J4R A;  4J2A A;  4F4K A;  3ID8 A;  3VEY A;  4CK2 A;  2IDO A;  2IVP A;  3AVG A;  3JAM O;  1GOB A;  3WEE B;  3CXC M;  3T3F A;  3CQ8 A;  1CZA N;  4DSJ A;  4B3M K;  4OLA A;  2GWK A;  3VQP A;  1TK0 A;  1ASW A;  2G8W A;  1SL1 A;  5C12 A;  3LM2 A;  1Z05 A;  2A5X A;  3HM9 A;  2P9L A;  5FPE A;  3CC4 N;  1NGE A;  4KTW A;  3CCJ N;  3J7Z O;  2OYQ A;  2YI1 A;  4N5S A;  4B9U A;  4CEE A;  3TAM A;  5CE3 A;  2HF3 A;  4KHN A;  4FL9 A;  4JD2 A;  3WXL A;  4DR1 K;  3VGK A;  3FFK B;  4BC3 A;  3TSQ A;  1WSF A;  4KRE A;  3SV3 A;  4DR7 K;  3VES A;  3OS1 A;  4CJL A;  1NU0 A;  2WUS A;  4C8L A;  4Z4F A;  3ZSQ A;  1TUY A;  4B9N A;  1YIJ N;  4OO1 J;  1FJG K;  2Q0R A;  3THV A;  2Q97 A;  2G8F A;  4DB3 A;  3AVB A;  4DV4 K;  2ASP A;  2LSN A;  4NCG A;  5C0Y A;  4BQL A;  2QKB A;  5C2F A;  4L8R B;  5AQY A;  2GEM A;  4CHQ A;  2F8S A;  2HNY A;  3KK7 A;  2ZM6 K;  3NHG A;  3HBT A;  4M3R A;  1JCG A;  5HRS A;  3WNH A;  1RIL A;  4IJA A;  3K59 A;  4H0X B;  1N8R O;  4CJE A;  4DSK A;  4O44 A;  4FWQ A;  4KH4 A;  4MO5 A;  4DV0 K;  1HMV A;  1JXE A;  4IWV A;  1X9M A;  2HB5 A;  2PZS A;  4BC5 A;  4JEP A;  5AQG A;  5IT9 O;  4JKA A;  1UOC A;  5M1N A;  3MCP A;  4YOY A;  1J54 A;  2G8V A;  2F9W A;  3B6O A;  5AR0 A;  1C1B A;  4Y1C A;  4OGC A;  3VEX A;  1FW6 A;  3WQT A;  1T05 A;  4O55 A;  3LPU A;  4BC4 A;  2X6N A;  1U47 A;  4ILJ A;  3CCV N;  1TAU A;  1T03 A;  1VSD A;  4C8M A;  1OH5 A;  1YVN A;  4Q0B A;  1HNZ K;  5J2P A;  3ZET A;  3OYF A;  1Z25 A;  4CGJ A;  4K0K K;  4CEF A;  2YNG A;  4A61 A;  3F9M A;  3KK2 A;  3SQ4 A;  1O13 A;  3A8Y A;  1SKR A;  1S1T A;  3O1B A;  2NZT A;  4DTX A;  1HQU A;  5F0X A;  3E9O A;  1T6C A;  4J2D A;  1WAF A;  1NKE A;  4NB4 A;  4B1U B;  4RW4 A;  3ZEU A;  4ZTJ A;  1BCO A;  2UYT A;  2OTJ N;  3PY8 A;  3DOL A;  2P5O A;  2BE2 A;  5AQS A;  3FZF A;  3R6M A;  4BR4 A;  4DUY K;  4DU4 A;  1N34 K;  3C7N B;  3ZT1 A;  1T3V A;  4BC2 A;  1R0A A;  4JI3 K;  3AGR A;  3AO2 A;  4JKG A;  3CJ9 A;  1YVU A;  3ULE A;  2VCP A;  3L0Q A;  4FWS A;  1SQK A;  5AQL A;  1W0H A;  3HK2 A;  4BR2 A;  4CJQ A;  1NK9 A;  2QWR A;  3ZSZ A;  4CJK A;  4BRO A;  3DLB A;  4DSI A;  1L3V A;  4QCL A;  2QW9 A;  1IG8 A;  1SAZ A;  4FM0 A;  4NXM K;  3CCL N;  3K58 A;  4QS9 A;  1VQ7 N;  1NGI A;  3F73 A;  3RVC A;  3O4W A;  1HUX A;  1K8A O;  4N76 A;  3HPO A;  3L2U A;  3THW A;  4M3U A;  3NMU A;  3QIO A;  1RT5 A;  4M3Z A;  2O8D A;  4DTU A;  3GBT A;  1JCF A;  2D1K A;  3D2E B;  2O8C A;  1JLB A;  5AQX A;  1T7P A;  2RF2 A;  4GKJ K;  2W41 A;  4CER A;  1SKS A;  2CGK A;  1LW0 A;  2HVI A;  4IBN A;  1XNQ K;  3ZSY A;  3HT3 A;  3KK3 A;  2Q31 A;  1WSG A;  1SS6 A;  3P39 A;  5KGW A;  3J80 O;  2RHK A;  2P9L B;  4FWL A;  4GV6 A;  3JSM A;  2HBL A;  1BIU A;  3LDN A;  3O3F A;  3S9H A;  1GLD G;  3S3N A;  3E66 A;  4DTS A;  4FXD A;  1TL1 A;  4QAG A;  1LAW A;  2HHU A;  3RMB A;  5M1F A;  4BRG A;  4ELT A;  2FSN A;  1VQ9 N;  3LPT A;  3VET A;  4K8Z A;  2UXB K;  1GOA A;  2ZWH A;  3CQX A;  3JYT A;  4DFJ A;  1VAZ A;  2E1Y A;  3M8S A;  2KTQ A;  2XY7 A;  1BQM A;  1Q8I A;  4FM1 A;  3KHY A;  3MK6 A;  3CCS N;  5HRO A;  3WXK A;  3RR7 A;  3Q7B A;  3P5J A;  3ZX3 A;  1QQC A;  2E20 A;  3H6E A;  4LFA K;  3ZSR A;  2KZZ A;  4OPK A;  3MEC A;  4FWK A;  4BRD A;  2GX9 A;  4UQG A;  5J2N A;  1LV5 A;  4OGE A;  4RW6 A;  4DV3 K;  2OZM A;  2W6L A;  4HCB A;  5BN9 A;  3QNN A;  4CJ5 A;  4M41 A;  1Q86 O;  4H5N A;  4HTU A;  4K42 A;  3AY9 A;  3KLE A;  1Z26 A;  3CFO A;  1KLN A;  2XY6 A;  1RGI A;  5LMN K;  3C95 A;  3AO1 A;  4HHT A;  3BDP A;  1EQY A;  2KW4 A;  4TSX A;  3CC7 N;  5AFU H;  4OKE A;  3BGR A;  2AA4 A;  4AHS A;  3G71 N;  4BDP A;  1KAX A;  4ISE A;  5FPM A;  1OKJ A;  1IBK K;  2E4L A;  3GDQ A;  4JI5 K;  3AAQ A;  4ZTF A;  4JI6 K;  3V9W A;  3TAB A;  5CZ1 A;  1IKX A;  2HBM A;  4DR5 K;  2NLX A;  5HRR A;  3LDQ A;  3V1O A;  4BR9 A;  4DTM A;  3SAF A;  3AGK A;  4DKW A;  1DT9 A;  2XO7 A;  1VSH A;  3ZET B;  2D4W A;  2DFE A;  2BGG A;  3IUC A;  2YX6 A;  3HXM A;  1KCF A;  3T19 A;  1BQN A;  1R59 O;  2E2O A;  4CJT A;  1A5V A;  3DJC A;  3NGZ A;  4E7J A;  4DTP A;  5AQP A;  3G10 A;  1KAZ A;  1S1W A;  1S6P A;  3OYN A;  1BIS A;  3DRS A;  1RNH A;  4GV9 A;  2NRX A;  2F8T A;  4CED A;  1ATS A;  3T1H K;  1NK6 A;  3A5N C;  2Y1I A;  3OS0 A;  3NFA A;  5JS2 A;  2KHO A;  4FO0 A;  5FRO A;  3MXJ A;  4CCH A;  2HHT A;  1I39 A;  3QML A;  4PL8 A;  4GVE A;  3T1Y K;  1RTH A;  4ILG B;  5JVH L;  2NRT A;  2FBY A;  4JKG B;  4BWM A;  3ULE B;  5M1P A;  3VEV A;  2QXL A;  1VQK N;  3VOV A;  1YJW N;  1Q82 O;  4DSL A;  4YDU C;  1DTT A;  4IFV A;  1WSI A;  3EEQ A;  4U67 L;  3LP0 A;  3CJC A;  3QO9 A;  4E7H A;  4Z4I A;  4LFB K;  1BA1 A;  2P9U A;  2I5J A;  3Q7C A;  1UWB A;  2QK9 A;  4JI1 K;  4MO4 A;  3E01 A;  5HRP A;  1FKP A;  4FOE A;  3S3M A;  3CME N;  1HYS A;  3KWI A;  2QI2 A;  4WQ5 A;  1TYQ A;  1S22 A;  2RKI A;  3M6G A;  1VRU A;  3I33 A;  4FJ7 A;  3IFR A;  2O8D B;  1GLL O;  4K8X A;  4BRF A;  3ZX2 A;  3G6E N;  4XH5 A;  1XWL A;  5AZJ B;  4FLW A;  2YHX A;  4H0V B;  3E9L A;  2O4I A;  1S5J A;  3H3N O;  4JLH A;  2ZJP L;  1NK7 A;  3BZK A;  2QEX N;  3H08 A;  4MDB A;  3VQ8 A;  3DMJ A;  2ETJ A;  2QWP A;  4DG1 A;  3D6R A;  1L3S A;  2ZGY A;  3O9T A;  1X3M A;  4AHC A;  3CIP A;  3A0I X;  3ZT2 A;  1KFS A;  4YNQ A;  4BRL A;  3CYM A;  3VQC A;  3DLH A;  3I0R A;  3OVN A;  3WNG A;  1WN7 A;  1BG3 A;  1WSH A;  3CET A;  4CJS A;  2O8F A;  1GLF O;  5BPM A;  4CF2 A;  2IIR A;  4JKF A;  1WLJ A;  3CI5 A;  4CEO A;  4E1J A;  1VSL A;  3I8B A;  3RSE B;  3C65 A;  1NWK A;  2IC3 A;  2VWJ A;  5HOO A;  4A59 A;  2QKK A;  1HRH A;  3CJA A;  5JVG L;  4ILH A;  3ID6 A;  2Q0U A;  3NF8 A;  2WC9 A;  4BG9 A;  1HJR A;  5AQJ A;  5CZ2 A;  3WQU A;  1N6Q A;  3HO1 A;  2EX3 A;  1WOQ A;  4CJF A;  3OYJ A;  3VQD A;  3B8A X;  4NO7 A;  3ENB A;  1BUP A;  2E8A A;  4UY8 O;  3DM2 A;  4KH5 A;  1NGH A;  3VQ9 A;  5JS1 A;  4J8F A;  4ICL A;  3HOT A;  4CHZ A;  4H5V A;  4B08 A;  4RW8 A;  4XH4 A;  4ISF A;  3P1G A;  5CYQ A;  4JNE A;  2HHH K;  2GV9 A;  3EKU A;  4FLV A;  2KQ2 A;  1SV5 A;  4FOI A;  3CHW A;  1XNR K;  2OPR A;  3KIO A;  5BPL A;  3DXK A;  3BF3 A;  3OS2 A;  3MWT A;  3I8D A;  3THX A;  4QOZ B;  3QNO A;  3NBP A;  1JL2 A;  4YHH K;  2DY4 A;  2CGJ A;  5DK5 A;  1EP4 A;  1EWR A;  4JKC A;  4YOU A;  2GUP A;  1JJ2 M;  3PSI A;  4C1N I;  1RT2 A;  1RBV A;  3MEG A;  3U3G A;  4O5F A;  3O3G A;  4DQI A;  4CIG A;  4KHP K;  5HBM A;  3VTI A;  4EHT A;  1S9E A;  2UUA K;  4E0D A;  4XIU A;  4PWD A;  1I94 K;  1KC8 O;  1H1V A;  1X9W A;  4FVU A;  3AV9 A;  4HUE A;  5AQR A;  4R5P A;  2F4V K;  3EZ5 A;  3PX6 A;  3NCI A;  2GBZ A;  3TAG A;  2PY5 A;  3KK1 A;  2NNW A;  1Q18 A;  4H0T B;  3WNF A;  4DFP A;  4LFC K;  2XY8 A;  2OZS A;  5C15 A;  2P9N A;  3QIN A;  4FSV A;  5EY4 A;  3L3V A;  1IJJ A;  4YY3 K;  3QBX A;  3CJ7 A;  4LSL A;  4DHY A;  1GOC A;  1ASU A;  4HWI A;  5HRN A;  5DM7 L;  5EVZ A;  1WBB A;  3DRP A;  3OYH A;  1QQO A;  3ALY A;  3QFU A;  1RFQ A;  4CIE A;  4KHS A;  1CZB A;  2P9S A;  3R8E A;  1X1P A;  5M1K A;  4XH1 A;  1N32 K;  5FRM A;  1YT3 A;  1E3M A;  1GLJ O;  2W40 A;  3DI6 A;  4IG3 A;  1SL2 A;  3ULD A;  3I56 N;  4WFN L;  1ATR A;  5KRS A;  1BI4 A;  2OA8 A;  3M3Z A;  1RDU A;  4KI4 A;  2HF4 A;  1QSS A;  2DTU A;  2A1R A;  5BR9 A;  1TYQ B;  2O8B B;  5FPD A;  3BF1 A;  3SV4 A;  2OTL N;  3HTV A;  2DFH A;  2A3Z A;  2HMP A;  3CJB A;  3SLC A;  3SBT A;  4JK9 A;  3P83 D;  1GLA G;  3OYL A;  3AO5 A;  3FZH A;  4KO0 A;  4EAH D;  5JLF A;  1YTA A;  1QVG M;  1OVY A;  1D9F A;  2HHX A;  5EOY A;  3U9D A;  4PKI A;  1VQP N;  3KZB A;  3VMF B;  1K9M O;  2YHY A;  4RW7 A;  4WFA L;  3SJJ A;  4JS4 A;  2ZD1 A;  3SCX A;  4K43 A;  3IRX A;  4DS4 A;  3HM8 A;  4EZ6 A;  3E9P A;  4CGD A;  2O8F B;  2HW3 A;  1RDW X;  3NH1 A;  4JAX A;  3M1F A;  5AQI A;  5KQD A;  1TK5 A;  3GOI A;  4AHU A;  4E7K A;  1MU2 A;  4AM7 A;  4RCH A;  2ZGZ A;  3CC2 N;  4FJM A;  4I6M B;  2PYL A;  3L2R A;  1REV A;  4RG8 A;  5LJV A;  4BQZ A;  1S3X A;  5J2M A;  1P8Z A;  4Z94 A;  4JK7 A;  3EKS A;  4EIA A;  3F5T A;  4AHR A;  1XMO K;  4NXN K;  1EKE A;  2V52 B;  4CE9 A;  4PQU A;  4Z4C A;  5A2Q O;  5KQ8 A;  4BR0 A;  5SWM A;  3HOS A;  3EYZ A;  1TK8 A;  4K41 A;  1RDC A;  1WSE A;  5GAG P;  2A41 A;  4NYN A;  1ZBU A;  5AZI A;  3W0L A;  1RT3 A;  4C1N K;  2FSK A;  4BE1 A;  2ZJQ L;  4I2P A;  4BRP A;  2BH1 A;  1JLC A;  3M8R A;  2A42 A;  4I7F A;  1U49 A;  3TAP A;  3PIP L;  4LF5 K;  1EO1 A;  3DLR A;  1VK0 A;  3QIP A;  3RTV A;  3KD1 E;  2VWB A;  3N4Q A;  3DXK B;  4CF9 A;  1VQL N;  4FLT A;  3THX B;  3AVC A;  4BE0 A;  4F2S A;  2NUB A;  3U4L A;  4X64 K;  2WTU A;  3NGI A;  4CJP A;  4YOV A;  2P9P A;  2Q3S A;  1Q9Y A;  3ZSO A;  4Z4H A;  2E6L A;  2AP1 A;  3VER A;  3PLA A;  3FE1 A;  4N47 A;  1QZ5 A;  1MDU B;  4WE1 A;  3T69 A;  4DV6 K;  4FW1 A;  4O8K A;  4AF1 A;  4Z4E A;  4DR4 K;  1KSP A;  4A57 A;  2D0P A;  1K6Y A;  3K2P A;  4B1Z A;  3KKS A;  4YOX A;  1Y64 A;  1D4X A;  1RT6 A;  4KBO A;  4OVL A;  1ZBS A;  2FBT A;  3TAR A;  2DFF A;  3C0B A;  3VPZ A;  5BPN A;  1YXQ A;  2GUI A;  4X65 K;  4CI6 A;  1EX4 A;  1MWK A;  1W97 L;  1SKW A;  1WBD A;  4CJ7 A;  2HND A;  2P9N B;  3CQY A;  3FZK A;  4CF8 A;  4HUF A;  5LL6 Z;  3CPW M;  3VQ7 A;  3V1R A;  3SBG A;  3OYD A;  2G8I A;  5AFU A;  3VQ6 A;  2P9S B;  3MDQ A;  2NRZ A;  1JCE A;  1K8K B;  5KRT A;  4E3S A;  3OW2 M;  5F2R A;  3O1W A;  2V51 B;  3RMA A;  3NF7 A;  5GAH P;  1KFD A;  5FPN A;  4DQR A;  1B92 A;  1C0F A;  3WXM B;  1BI4 B;  3ENH A;  1ITG A;  3QEX A;  4CJ3 A;  5J2Q A;  3QES A;  5ADX H;  3AVN A;  3R1X A;  1NGJ A;  4H0P A;  1KQS M;  4BDZ A;  3KKR A;  1A5W A;  1NM1 A;  3QIC A;  4WF9 L;  3MN5 A;  4PY5 A;  5EU7 A;  4IO8 A;  1YHQ N;  1QQM A;  3UKU A;  3NVM A;  5MLC Q;  1TUU A;  1CXQ A;  4A5B A;  2CH6 A;  3NDK A;  1W7A A;  5C2D A;  3KLH A;  2DPN A;  3V6D A;  3SYZ A;  4B9V A;  1NGB A;  4H8K A;  4JD2 B;  4KKO A;  3CG7 A;  2ZF5 O;  1NOZ A;  4YOT A;  3LZJ A;  5K14 A;  2E1Z A;  4M7Y A;  3E1Y A;  1C1C A;  3VTH A;  5AQU A;  3CCE N;  4J2E A;  3IS9 A;  1IH7 A;  5GIP A;  1NK8 A;  1CXU A;  5IWA K;  2VG7 A;  2UXD K;  4X66 K;  3VEZ A;  3K5L A;  1NGD A;  3WXJ A;  1T6D A;  1BDG A;  4B1V A;  4BRE A;  3ZYY X;  2IVN A;  2VGN A;  1HNI A;  4JKB A;  4DR2 K;  4BE2 A;  4DTJ A;  5AQM A;  3WXI A;  3PO4 A;  2YKM A;  3J7A P;  1WB9 A;  3LWM A;  4M3X A;  1HKC A;  3VEN A;  4B1X B;  3DAW A;  1NGF A;  1F21 A;  4U7B A;  3PV8 A;  3NAE A;  1P90 A;  2Q36 A;  4GNI A;  3QB0 A;  4H5T A;  3MN9 A;  2Z1H A;  4HTL A;  4E7L A;  1B9F A;  3TAE A;  2Z1J A;  1LAV A;  4KRF A;  3OYE A;  1HR0 K;  1RT1 A;  4CW7 B;  4CHY A;  1RBT A;  1BU6 O;  4JHD A;  1NGG A;  3KWG A;  5FRN A;  1JLA A;  3CJ1 A;  1TAQ A;  4IZ9 A;  2D0B A;  1DEJ A;  2P9I A;  4H4O A;  3N4P A;  4LF6 K;  3MAQ A;  3U9Z A;  5D3G A;  3SZ2 A;  4GVM A;  3V1Q A;  1SUQ A;  2G8H A;  1SL0 A;  4LF9 K;  2QA4 N;  5FLX O;  1IBM K;  1HPZ A;  1YJN N;  4RWT A;  2QWL A;  2GEL A;  2P9P B;  4DF4 A;  3ZLJ A;  2YKN A;  4DSF A;  1NKB A;  3UKR A;  4C8K A;  3H1Q A;  3RRG A;  1YTU A;  5I9E B;  5KTQ A;  2OPQ A;  2QWQ A;  4OPH A;  2OAN A;  4QS7 A;  3TSU A;  2Q1N A;  3DXM A;  4JKE A;  3VQE A;  1XHZ A;  4DS5 A;  3TAF A;  4GY2 B;  3ZEU B;  1D8Y A;  1WUA A;  2IGI A;  4CD3 A;  5I3U A;  4JI8 K;  1ZYQ A;  4KH6 A;  2FF6 A;  4GW6 A;  1ASV A;  4O0I A;  1JLE A;  1Y97 A;  4I9L A;  3D0P A;  3AA5 X;  4DCH A;  3BUZ B;  4W5O A;  2KZM A;  4CEB A;  2UUC K;  4F3O A;  5KPR A;  4DQ8 A;  4FZY A;  3AVH A;  1BIZ A;  1L3T A;  1HNX K;  3TI0 A;  2D5R A;  2VQE K;  1DKG D;  5AQO A;  3ZSW A;  1RBS A;  3SQ1 A;  1VQ4 N;  2EWS A;  2KFZ A;  3OBW A;  3DYA A;  5AQQ A;  5AQK A;  4IFE A;  1W9H A;  2Y1J A;  1C0M A;  3FFI A;  1TGO A;  4GMJ B;  2B4J A;  4JV5 K;  1NJY A;  3L4Q A;  4FWO A;  4CF0 A;  1JLG A;  4BRM A;  3OY9 A;  3THW B;  4LH5 A;  1FKO A;  1LWC A;  3U8X A;  2PFU A;  3J8A A;  1QTM A;  1WAJ A;  4H5W A;  4B3S K;  1S9G A;  1XUP O;  3AAR A;  2O8C B;  2QWN A;  3G25 A;  1NJX A;  4BDY A;  4O0J A;  3VQA A;  3MX2 A;  2JGU A;  3K9J A;  4LH4 A;  3RR8 A;  1U4B A;  4CF1 A;  5BR8 K;  2YCH A;  3MED A;  3UKU B;  1JXB A;  3SMP A;  3RMD A;  5CR4 A;  5LY3 A;  3O4N A;  3ATV A;  4CEZ A;  4IFY A;  3HJF A;  4CBX A;  5B8H A;  2HMI A;  4NLB A;  4CGF A;  1NG9 A;  1QVF M;  4FJL A;  1HQE A;  3CCR N;  4BRN A;  3QEP A;  1NBW A;  4FJN A;  5JLH A;  3DLK A;  1HNW K;  3ENO A;  3AVK A;  3EZW A;  4FJ8 A;  2BUP A;  1L5U A;  2FBV A;  3HRG A;  3B6P A;  1B9D A;  2Q2R A;  2F96 A;  3HVT A;  2P51 A;  3ZT4 A;  4OKK A;  1X9S A;  5AQF A;  3VGM A;  3C6U A;  3UB5 A;  4CJU A;  4CVN E;  4E7I A;  2CH5 A;  1VRT A;  1M90 O;  5KI6 A;  4CJR A;  2QTD A;  1C1A A;  2X74 A;  2VGM A;  3OA9 A;  4A62 A;  2O8E A;  2ZJR L;  2HVH A;  3IG1 A;  3NGY A;  4BRI A;  4W5N A;  5EXW A;  1ZBI A;  1UA1 A;  1DTQ A;  4IG0 A;  5AQN A;  3K9K A;  3LP2 A;  2KFN A;  3AVM A;  4EFH A;  4K25 A;  4H4M A;  4CGH A;  3CFP A;  2FXU A;  5FDL A;  4HVJ A;  1MWM A;  3HSC A;  4W5R A;  2XHB A;  3VQB A;  2E2N A;  3I0S A;  2NRH A;  1KVA A;  3LDO A;  5KPT A;  4DLE A;  3LP3 A;  3CFR A;  1Z6R A;  4CBW A;  2VYP A;  3CER A;  2WOM A;  1KVB A;  4PUO A;  3DLE A;  1VSI A;  4JRP A;  5E26 A;  4CEQ A;  3THY A;  1LOT B;  5C25 A;  3OYG A;  2ITG A;  4MLH A;  2YHW A;  1HLU A;  2F9T A;  2V7Z A;  1IKW A;  2YHB A;  3LDL A;  2X6S A;  1D5A A;  4OPA A;  3ZCM A;  1C0U A;  2ASO A;  4YDU A;  3O80 A;  3P38 A;  3P4I A;  2HHQ A;  3C6A A;  3HP6 A;  3EE9 A;  3QFP A;  4CEA A;  5BRH A;  3HZ6 A;  3DLL L;  1D9D A;  3KD5 E;  4DV5 K;  1ILY A;  5LJW A;  3DXM B;  4FPB A;  4DR3 K;  3DLG A;  5GAE P;  3TTF A;  3PIO L;  4G1Q A;  3PX0 A;  4JI7 K;  3ZX0 A;  3SAH A;  4NCA A;  5CYM A;  2FF3 B;  4CFD A;  4BR7 A;  3H3O B;  4FLX A;  3O5B A;  1JLF A;  3ITH A;  4FPA A;  4PA1 A;  3SK3 A;  4AIL C;  1RTD A;  1XC3 A;  4M42 A;  5AQV A;  4IOX A;  3OHR A;  3MN6 A;  3I55 N;  1N36 K;  3TR8 A;  4Y1D A;  4DLG A;  4KHY A;  1KXP A;  1HYZ A;  1VSK A;  1GLB G;  4KB0 A;  1DGK N;  2YNF A;  4FZZ A;  2HBJ A;  4BWJ A;  2P9U B;  2Z1G A;  3PUF A;  3TAN A;  3KVG A;  3A5M C;  3ZT3 A;  3DRR A;  3IAY A;  4H0Y B;  4LF8 K;  3C6T A;  3HVR A;  4DU1 A;  4R79 A;  5AQW A;  3AO3 A;  4BRA A;  1M1K O;  4B1Y B;  3L2W A;  1VSE A;  4PHT X;  3AVF A;  4KFB A;  4W5T A;  4BRH A;  1BO5 O;  2NRW A;  3P31 A;  1YIT N;  4XEI A;  4CJ4 A;  1BA0 A;  1XI1 A;  4KHU A;  2E6M A;  3D2E A;  2IVO A;  2OPP A;  3TTD A;  2XY5 A;  3OJU A;  4FWM A;  1NK4 A;  2RPI A;  2E2Q A;  1Q7Y O;  3OTO K;  1ZBL A;  1CZ9 A;  2V7Y A;  3J81 O;  3TAQ A;  4FCY A;  4GKK K;  1EWQ A;  3AA3 A;  2ITM A;  5JIC A;  5BRD A;  3OJS A;  4WCE L;  1GLE G;  3VF4 A;  3F2K A;  3ATU A;  3AA2 A;  3RWU A;  3ZSV A;  2I7P A;  2EHG A;  3TPQ A;  4B8C A;  1RCH A;  3HP9 A;  4B3T K;  4FJX A;  3CMA N;  3SUP A;  1KRP A;  1I3A A;  4ID1 A;  4FLY A;  4CHO A;  2YJF A;  4FJ5 A;  3J7Y P;  1HJO A;  4G9Z A;  3GL1 A;  3VF6 A;  4CZG A;  5AQT A;  1S1X A; 
#chains in the Genus database with same CATH homology
 3QEX A;  1BIS A;  3OYI A;  5C24 A;  4CJ3 A;  3DRS A;  1RNH A;  3U6F A;  5J2Q A;  4B9T A;  2F8T A;  4CED A;  3QES A;  3RMC A;  1NK6 A;  2Y1I A;  1ZBH A;  4FJ9 A;  3AVN A;  3OS0 A;  3NFA A;  4FVM A;  4IDK A;  5JS2 A;  5FRO A;  4BDZ A;  3V9Z A;  3MXJ A;  1LWE A;  4CCH A;  3KKR A;  3AA4 A;  2HHT A;  1A5W A;  1I39 A;  4KI6 A;  4AH9 A;  3VA3 A;  4PY5 A;  5EU7 A;  5E41 A;  1LW2 A;  4DFM A;  1NKC A;  2BDP A;  4E1N A;  4ID5 A;  4F3T A;  1RTH A;  2FBY A;  1CXQ A;  4BWM A;  3NDK A;  3V9U A;  3V81 A;  3SQ0 A;  3SI6 A;  3KLH A;  1RDD A;  2G8K A;  1S1U A;  3V6D A;  4CFC A;  1RTI A;  1BGX T;  4CHP A;  1RDB A;  4CFB A;  3SYZ A;  4B9V A;  4EP5 A;  1BL3 A;  4H8K A;  4KKO A;  4F8R A;  4DSL A;  3CG7 A;  1NOZ A;  3L3U A;  1DTT A;  4IFV A;  5K14 A;  1WSI A;  3LZJ A;  4O5B A;  4N76 A;  3LP0 A;  3NH2 A;  3QO9 A;  4B8A B;  1C1C A;  4E7H A;  2FBX A;  3EY1 A;  4J2E A;  4KPY A;  3O4Q A;  3IS9 A;  4CIF A;  4Z4I A;  2G8U A;  1TV6 A;  2I5J A;  1IH7 A;  3SNN A;  1NK8 A;  1UWB A;  1CXU A;  2IOC A;  2QK9 A;  1KLM A;  3E01 A;  2VG7 A;  1FKP A;  3LAL A;  5HRP A;  3VA0 A;  4FJH A;  1TKT A;  3S3M A;  2ZE2 A;  3K5L A;  1HYS A;  4CJV A;  1NOY A;  2B5J A;  4CGI A;  3KTQ A;  3HL8 A;  4JS5 A;  2IS3 A;  1NJW A;  3KJV A;  1XC9 A;  2RKI A;  4FK0 A;  4I9Q A;  1VRU A;  4BE2 A;  2P5G A;  1HNI A;  4FJ7 A;  4DTJ A;  4KTQ A;  1C6V A;  3PO4 A;  2YHA A;  4K8X A;  2YKM A;  1J9A A;  3QET A;  3LWM A;  3OYK A;  4M3X A;  5SZT A;  1UAX A;  1XWL A;  1S1X A;  3QEI A;  4FLW A;  4ELV A;  3OYA A;  1S6Q A;  4DQQ A;  1F21 A;  3L2Q A;  1VSM A;  3PV8 A;  2O4I A;  3NAE A;  1S5J A;  4JLH A;  3L8B A;  4B9M A;  1J53 A;  1NK7 A;  4CFA A;  3K5M A;  3H08 A;  2Z1H A;  4E7L A;  3AVJ A;  4B9S A;  1B9F A;  3VQ8 A;  3DMJ A;  3TAE A;  4DWI A;  2Z1J A;  3LAN A;  1QSY A;  2ETJ A;  1LAV A;  4DG1 A;  4KRF A;  4N56 A;  3OYE A;  4DTR A;  1L3S A;  1RT1 A;  1QS4 A;  4AHC A;  2IAJ A;  3ZT2 A;  4CHY A;  1KFS A;  1RBT A;  3V9X A;  1XHX A;  4YNQ A;  1IO2 A;  4CGG A;  3QER A;  4HCC A;  5FRN A;  3PO5 A;  1JLA A;  2YV0 X;  3CYM A;  3T1A A;  3VQC A;  3I0R A;  3OVN A;  3WNG A;  1WN7 A;  3DLH A;  1WSH A;  4CJS A;  1TAQ A;  4CF2 A;  4J2A A;  3K5O A;  4F4K A;  1TVR A;  2D0B A;  4KHQ A;  1N5Y A;  4CK2 A;  3SPY A;  2IDO A;  3AVA A;  1RTJ A;  4H4O A;  4AHV A;  3AVG A;  1WLJ A;  4LD0 A;  1C0T A;  1GOB A;  4CEO A;  4KV8 A;  1VSL A;  3MAQ A;  3T3F A;  5D3G A;  3SZ2 A;  3CQ8 A;  4GVM A;  2IC3 A;  2BAN A;  2VWJ A;  2YNH A;  3KLF A;  1RT7 A;  4DSJ A;  3V1Q A;  2QKK A;  1SUQ A;  2G8H A;  1HRH A;  1SL0 A;  4OLA A;  4EZ9 A;  1TK0 A;  3VQP A;  1ASW A;  2G8W A;  1SL1 A;  1JL1 A;  3LDS A;  3DOK A;  3HM9 A;  4M45 A;  3HPG A;  3NF8 A;  4KTW A;  4DTN A;  1HPZ A;  3OYC A;  1T8E A;  2OYQ A;  1HJR A;  4N5S A;  5CZ2 A;  4DF4 A;  1N6Q A;  4OPJ A;  4B9U A;  2EX3 A;  3HO1 A;  2YKN A;  4CEE A;  4CJF A;  3OYJ A;  3VQD A;  4DSF A;  4DU3 A;  3ISN C;  1NKB A;  4C8K A;  3TAM A;  3RRG A;  1YTU A;  4KHN A;  1NJZ A;  3VQQ A;  5KTQ A;  3DM2 A;  2OPQ A;  1IKY A;  4Z0U A;  4FK4 A;  3VQ9 A;  3VQE A;  4ZHR A;  1XHZ A;  5JS1 A;  1WSF A;  4KRE A;  4ICL A;  3SV3 A;  4DS5 A;  4JRQ A;  3TAF A;  4CHZ A;  1D8Y A;  2IGI A;  4OKJ A;  4RW8 A;  4B08 A;  4CJL A;  5C42 A;  3OS1 A;  5I3U A;  4C8L A;  1ZYQ A;  3P1G A;  4M3W A;  5CYQ A;  4GW6 A;  3ZSQ A;  4Z4F A;  2GV9 A;  4B9N A;  3KLI A;  1ASV A;  4FLV A;  5J1E A;  1S1V A;  2KQ2 A;  4O0I A;  1JLE A;  1SV5 A;  1Y97 A;  4I9L A;  3THV A;  1ITG A;  2G8F A;  3D0P A;  2OPR A;  3KIO A;  4HUG A;  1CLQ A;  2O4G A;  3AVB A;  3AA5 X;  4CES A;  2LSN A;  4NCG A;  4W5O A;  2QKB A;  2KZM A;  4CEB A;  4L8R B;  3OS2 A;  4F3O A;  3I8D A;  4FZY A;  3QNO A;  3AVH A;  4QOZ B;  4CK3 A;  1BIZ A;  1L3T A;  3NBP A;  1JL2 A;  1TKZ A;  4I2Q A;  4CHQ A;  3TI0 A;  2HNY A;  2F8S A;  2DY4 A;  5DK5 A;  1KVC A;  2D5R A;  1EP4 A;  3LAK A;  4OJR A;  3ZSW A;  3NHG A;  1RBS A;  3SQ1 A;  1RBU A;  4M3R A;  4M3Y A;  2KFZ A;  1RT2 A;  3DYA A;  1RBV A;  5HRS A;  3S3O A;  3MEG A;  3U3G A;  3WNH A;  1RIL A;  4B9L A;  3CM5 A;  3O3G A;  4DQI A;  3M8Q A;  4CIG A;  3K59 A;  5HBM A;  4M3T A;  4CJE A;  4DSK A;  4O44 A;  1W9H A;  2WON A;  2Y1J A;  1C0M A;  3FFI A;  1HMV A;  1S9E A;  1TGO A;  4E0D A;  1JXE A;  1X9M A;  2HB5 A;  2B6A A;  4XIU A;  2PZS A;  3QLH A;  4PWD A;  4GMJ B;  1WSJ A;  1X9W A;  2B4J A;  4CJW A;  1UOC A;  1NJY A;  4CF0 A;  3ZT0 A;  1JLG A;  3OY9 A;  3AV9 A;  1J54 A;  4HUE A;  4R5P A;  2G8V A;  2JLE A;  4LH5 A;  2XRI A;  4EP4 A;  3EZ5 A;  3PX6 A;  3NCI A;  4CK1 A;  1FKO A;  2GBZ A;  3B6O A;  1LWC A;  3TAG A;  1C1B A;  4Y1C A;  2PY5 A;  4OGC A;  3KK1 A;  1QTM A;  4FZX C;  1WAJ A;  3HPH A;  1S9G A;  4FJG A;  1T05 A;  2VG6 A;  4O55 A;  4KHW A;  4E89 A;  3LPU A;  1NJX A;  4BDY A;  2X6N A;  4O0J A;  3VQA A;  2JGU A;  4LH4 A;  3WNF A;  4DFP A;  1U47 A;  1TAU A;  1QE1 A;  1T03 A;  1VSD A;  2XY8 A;  3RR8 A;  2OZS A;  2HHS A;  3QIN A;  3CM6 A;  1DLO A;  4C8M A;  3L3V A;  3SUO A;  3PX4 A;  3KD1 E;  1U4B A;  4Q0B A;  4CF1 A;  4LSL A;  3MED A;  1GOC A;  4Q5V A;  1ASU A;  5J2P A;  5HRN A;  4BAC A;  1JXB A;  4KB1 A;  1J5O A;  3OYF A;  3LZI A;  1Z25 A;  3RMD A;  3DRP A;  3O4N A;  4CGJ A;  4CEF A;  3OYH A;  2YNG A;  4CEZ A;  3ALY A;  4IFY A;  1IG9 A;  4CIE A;  3MXM A;  3HJF A;  2HMI A;  4KHS A;  3LP1 A;  1CZB A;  4CGF A;  3KK2 A;  1X1P A;  3SQ4 A;  4FJL A;  1RDA A;  4FLU A;  5FRM A;  1SKR A;  1S1T A;  3MEE A;  1HQE A;  1YT3 A;  4DTX A;  1HQU A;  2VG5 A;  3QEP A;  4IG3 A;  3DI6 A;  4FJN A;  1SL2 A;  2HHW A;  3DLK A;  3ULD A;  4J2D A;  1WAF A;  4MQ3 A;  1NKE A;  3RRH A;  3AVK A;  4DTO A;  4RW4 A;  4ZTJ A;  5KRS A;  4FJ8 A;  1BCO A;  1BI4 A;  2OA8 A;  1LWF A;  4YFU A;  2D0A A;  1L5U A;  2FBV A;  3PY8 A;  4KI4 A;  3DOL A;  3M8P A;  3ASM A;  1QSS A;  3B6P A;  2BE2 A;  1B9D A;  2A1R A;  1FXX A;  3NF9 A;  4DU4 A;  2P5O A;  2DTU A;  4DMN A;  2F96 A;  2X78 A;  3HVT A;  2P51 A;  4RW9 A;  3ZT1 A;  3ZT4 A;  3SV4 A;  3C94 A;  4OKK A;  1R0A A;  1U48 A;  1X9S A;  2PYJ A;  1U45 A;  3C6U A;  2DFH A;  1O1W A;  4CJU A;  2FC0 A;  4E7I A;  1VRT A;  3AO2 A;  1YVU A;  1UA0 A;  5KI6 A;  4CJR A;  1C1A A;  1W0H A;  2X74 A;  3P83 D;  4E1M A;  3MXI A;  3OYL A;  3HK2 A;  3AO5 A;  1NK0 A;  3V9S A;  4CJQ A;  3QEW A;  2HVH A;  1NK9 A;  3IG1 A;  3NGY A;  4KO0 A;  3ZSZ A;  4CJK A;  3A2F A;  4W5N A;  5DMR A;  3UIQ A;  1UA1 A;  1ZBI A;  3DLB A;  4DSI A;  1DTQ A;  4IG0 A;  1YTA A;  1L3V A;  3LP2 A;  3AVL A;  1D9F A;  4QCL A;  3AVM A;  2KFN A;  2HHX A;  4H4M A;  4O4G A;  4LSN A;  1HYV A;  4CGH A;  4FM0 A;  3CFP A;  3LAM A;  4RW7 A;  3K58 A;  3SUN A;  3LWL A;  4ELU A;  3SJJ A;  5FDL A;  4HVJ A;  3SPZ A;  4JS4 A;  1BHL A;  4W5R A;  2ZD1 A;  3K57 A;  3SCX A;  1RBR A;  2D0C A;  3F73 A;  1RT4 A;  2XHB A;  3IRX A;  3VQB A;  3I0S A;  4DLE A;  3HPO A;  1KVA A;  4DS4 A;  3SUQ A;  3L2U A;  2W42 A;  1Q9X A;  4EZ6 A;  3LP3 A;  3CFR A;  4CGD A;  4M3U A;  3HYF A;  2HW3 A;  3NH1 A;  3QIO A;  1RT5 A;  4M3Z A;  2WOM A;  1KVB A;  4DTU A;  4PUO A;  1TK5 A;  4AHU A;  4KAZ A;  3DLE A;  4E7K A;  1MU2 A;  4OLB A;  1JLB A;  1VSI A;  1T7P A;  2RF2 A;  4CER A;  4FJM A;  4JRP A;  4CEQ A;  1SKS A;  1TKD A;  1LW0 A;  5C25 A;  3OYG A;  4IBN A;  4FLZ A;  3ZSY A;  3HT3 A;  2HVI A;  2PYL A;  3KK3 A;  3L2R A;  1WSG A;  1REV A;  4RG8 A;  2ITG A;  5J2M A;  5KGW A;  4W5Q A;  3NH0 A;  1KTQ A;  2YHB A;  1IKW A;  4C8O A;  4AHR A;  1EKE A;  4CHN A;  2X6S A;  1D5A A;  3JSM A;  3ZCM A;  1C0U A;  4CE9 A;  2VWK A;  1BIU A;  4PQU A;  4Z4C A;  3O3F A;  3L2V A;  3S9H A;  4FK2 A;  2HHQ A;  5SWM A;  3EYZ A;  1TK8 A;  3HP6 A;  1RDC A;  2OPS A;  1JKH A;  3S3N A;  4NCB A;  3G0Z A;  4CEA A;  1WSE A;  4DTS A;  1D9D A;  1TL1 A;  4QAG A;  3KD5 E;  4FXD A;  1TL3 A;  4NYN A;  1LAW A;  4MFB A;  1ZBU A;  2HHU A;  3RMB A;  1NK5 A;  4ELT A;  3DLG A;  1RT3 A;  4BE1 A;  3LPT A;  4G1Q A;  3PX0 A;  4FYD A;  4I2P A;  1JLC A;  3M8R A;  4K8Z A;  4I7F A;  1U49 A;  1EXQ A;  4NCA A;  3TAP A;  1GOA A;  5CYM A;  3JYT A;  4DFJ A;  4CFD A;  3DLR A;  1VK0 A;  3QIP A;  3M8S A;  1VSJ A;  3RTV A;  1BQM A;  1Q8I A;  4FM1 A;  4FLX A;  2XY7 A;  2KTQ A;  1JLF A;  1IKV A;  5HRO A;  3ITH A;  1QHT A;  1ZBF A;  4LY7 A;  4PA1 A;  3RR7 A;  3P5J A;  4CF9 A;  4AIL C;  1RTD A;  4FLT A;  2P1J A;  4M42 A;  1QQC A;  3AVC A;  4C8N A;  3D45 A;  4BE0 A;  3ZSR A;  4NYF A;  4DSE A;  4F2S A;  2KZZ A;  4OPK A;  3NE6 A;  3MEC A;  4J2B A;  2NUB A;  4UQG A;  5J2N A;  1LV5 A;  3NGI A;  4OGE A;  4IKF A;  3TR8 A;  4RW6 A;  4Y1D A;  4CJP A;  2Q3S A;  1Q9Y A;  4DLG A;  2AJQ A;  4KHY A;  3V4I A;  2OZM A;  1HYZ A;  3ZSO A;  4HCB A;  1VSK A;  4Z4H A;  4FJI A;  4KB0 A;  1BCM A;  3NF6 A;  2QXF A;  2YNF A;  2E6L A;  3QNN A;  4FZZ A;  1WNS A;  4CJ5 A;  4M41 A;  4HTU A;  4FW2 A;  4B3O A;  4DF8 A;  4BWJ A;  3OYB A;  3KLE A;  1Z26 A;  3CFO A;  4N47 A;  5HP1 A;  2Z1G A;  3PUF A;  4WE1 A;  3SQ2 A;  3TAN A;  3AVI A;  4DQP A;  1KLN A;  2XY6 A;  4FJJ A;  3ZT3 A;  3DRR A;  4FW1 A;  4FM2 A;  4Z4E A;  3C95 A;  3IAY A;  1G15 A;  1KSP A;  3AO1 A;  3VQ5 A;  4Z4G A;  3C6T A;  3HVR A;  4HHT A;  4DU1 A;  3BDP A;  1HNV A;  1EET A;  1K6Y A;  4F2R A;  4KTZ A;  2KW4 A;  3K2P A;  4TSX A;  3VN5 A;  5KGX A;  3AO3 A;  5T7B A;  1VSE A;  3KKS A;  4OKE A;  3L2W A;  3BGR A;  3AVF A;  4KFB A;  4W5T A;  4AHS A;  3U3Y A;  1RT6 A;  4BDP A;  4AHT A;  4DQS A;  4OVL A;  1FK9 A;  2FBT A;  3TAR A;  2E4L A;  5I42 A;  4E19 A;  2DFF A;  4CJ4 A;  1XI1 A;  3ZSX A;  4ZTF A;  4KHU A;  2E6M A;  2GUI A;  2HNZ A;  4CEC A;  2OPP A;  3V9W A;  3TAB A;  3OYM A;  2XY5 A;  1EX4 A;  3OJU A;  5CZ1 A;  1SKW A;  1IKX A;  1NK4 A;  2RPI A;  2ATQ A;  3AO4 A;  5HRR A;  2HND A;  3HST B;  1ZBL A;  1QSL A;  1CZ9 A;  2HHV A;  3TAQ A;  4FCY A;  3V1O A;  4DTM A;  2A1S A;  5HLF A;  1VSF A;  4CF8 A;  4HUF A;  2ZQB A;  3QEV A;  4N41 A;  2XO7 A;  3AA3 A;  1VSH A;  3OJS A;  2DFE A;  1JLQ A;  3VQ7 A;  3V1R A;  2BGG A;  3TWH A;  3OYD A;  3RWU A;  3AA2 A;  3HXM A;  2G8I A;  3ZSV A;  1KCF A;  1TKX A;  1U04 A;  3VQ6 A;  3T19 A;  2EHG A;  4B8C A;  1BQN A;  3VQ4 A;  5KRT A;  1RCH A;  3HP9 A;  3WNE A;  3F9K A;  2R7Y A;  4E3S A;  1A5X A;  3RMA A;  3NF7 A;  4FJX A;  4CJT A;  1KFD A;  3SUP A;  1KRP A;  1I3A A;  4ID1 A;  4FLY A;  4CHO A;  4DQR A;  1A5V A;  4FJ5 A;  3NGZ A;  3K5N A;  5CY4 A;  1B92 A;  2YNI A;  3O3H A;  1L3U A;  4FJK A;  4E7J A;  4DFK A;  2RN2 A;  4DTP A;  1BI4 B;  3G10 A;  3OYN A;  1S1W A;  1S6P A;  3KLG A;  2Z1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...