3VQCA

Hiv-1 in core domain in complex with (5-methyl-3-phenyl-1,2-oxazol-4-yl)methanol
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
151
structure length
141
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPSMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 49
structure length 141
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqcA00
4CJKA 1Y97A 5CYMA 3HYFA 3TWHA 4N76A 4KI6A 1GOBA 3NFAA 3V6DA 4F3OA 5JS1A 3RTVA 1ZBHA 1KVAA 4HCBA 5HRSA 1J9AA 1JLAA 4CERA 2WOMA 3TI0A 3ZT1A 3RRGA 1IKYA 4QCLA 4EZ9A 4ICLA 1LWFA 5KTQA 1WAFA 1XHZA 3ULDA 1W9HA 1EXQA 1C1CA 3QLHA 3V4IA 2F96A 5CYQA 4LH4A 4N5SA 1XC9A 5CZ1A 4OGCA 5E41A 3OYCA 4OVLA 2HHQA 2FBVA 3K5MA 3SQ0A 4CECA 5HROA 3AO4A 4F4KA 3LALA 3B6PA 4CEFA 1RT4A 1BIZA 4B8CA 4H4OA 4E7JA 1SKWA 1WSEA 3DLKA 3NCIA 4F8RA 1QQCA 3H08A 1IKVA 3KLHA 4DTSA 4PUOA 5HRNA 3OYKA 1LWEA 3OYFA 2IDOA 2O4IA 1QSLA 2XY7A 2DFHA 1BISA 4OPKA 4BDYA 1TKZA 2FBTA 3EZ5A 2DFFA 3ZCMA 5T7BA 3KLGA 3K5OA 3AO5A 3ZT3A 2E6MA 3VA0A 4O5BA 1X9MA 1JLFA 2B4JA 1SL0A 4FJ8A 3LPUA 5CY4A 4DMNA 3SUNA 3WNEA 1HPZA 2Y1IA 3SYZA 4B9VA 4DTJA 2B6AA 1S6PA 3TARA 4KHUA 4I7FA 2IS3A 3TAGA 2KZZA 4FJGA 2RKIA 4EZ6A 2D0BA 2IC3A 4M3XA 4KHYA 3UIQA 4DSJA 3OY9A 4GMJB 4FLUA 1NJZA 1TVRA 3DLEA 1LAWA 2ATQA 4YFUA 2EX3A 2O4GA 2D0AA 3RR8A 4F3TA 4DTRA 1NKCA 3NE6A 3V1OA 1VSIA 4W5OA 1YTAA 3VQCA 4K8ZA 4CJ3A 4AH9A 4HUFA 3QEIA 3NH0A 2ZQBA 3SUQA 1NK9A 3F9KA 4PWDA 1I39A 3RR7A 4DS4A 4PA1A 3O3FA 3DYAA 4CEDA 3AA3A 4LH5A 4FJHA 3AVKA 3VQ6A 2HVIA 4B9MA 1RT7A 4CIGA 4OJRA 3L2UA 4DLGA 2ITGA 5KGWA 4I9LA 4O0JA 4C8OA 2QKBA 1Q9YA 3SQ1A 3ZSZA 3VQ7A 2YNHA 3C94A 3HPHA 3LAMA 1JLGA 2G8UA 3NF8A 1LW0A 5K14A 1QSYA 1U04A 4CFAA 1QHTA 1B9FA 1NOYA 1GOAA 1U4BA 4FJ9A 3RMAA 2YNGA 3HSTB 4CF8A 2BANA 1RBTA 4HHTA 3SI6A 1NK7A 1YTUA 4CGFA 4Y1DA 4CJTA 3I0RA 3LWMA 4E1MA 4CJWA 3G0ZA 4W5TA 3AVLA 1C0TA 4CK1A 4DG1A 1RBVA 4QAGA 3TAFA 3S9HA 3DLGA 4ZHRA 4DTNA 1ASVA 3E01A 1RT1A 4E1NA 4HCCA 4E19A 3RMCA 5FRNA 2X74A 4CEBA 4KTQA 4C8KA 1BGXT 1UWBA 1FK9A 4LD0A 3CQ8A 4G1QA 5DMRA 3K59A 1TK8A 3JYTA 3HT3A 3ZSVA 4JS5A 3AVFA 4NYFA 2GBZA 3VQEA 3V9XA 2HHXA 4HUGA 1NK8A 3CG7A 1NKBA 2BGGA 4AHUA 4M42A 3ISNC 3IS9A 3OJUA 1D5AA 4DS5A 3SUOA 3QIPA 1R0AA 1SKSA 4AHSA 2GUIA 4CFCA 1U49A 3C6TA 4DTXA 4FLVA 2JGUA 4CGGA 1ZBFA 3DRSA 3WNGA 2XO7A 1S1WA 4J2AA 4CJ4A 4XIUA 3TANA 2OPPA 3NGYA 3O3HA 2NUBA 3D0PA 4KFBA 3OYAA 1EKEA 4CHNA 2X6NA 3OYMA 3V9UA 4M3UA 1FXXA 1VSHA 1TK5A 4B9LA 4J2DA 4FYDA 3PY8A 3KLFA 4JRQA 4FJMA 2P1JA 3M8SA 4FK2A 1RBSA 1C0MA 3VQ8A 1ITGA 1G15A 4CFBA 4O55A 1J54A 1C1BA 2VG6A 2Z1IA 1JLQA 1KFSA 1YVUA 4LSNA 3VN5A 4E7HA 3L2WA 3KLEA 3NH2A 1BI4A 1HRHA 3QESA 3HM9A 1EETA 2KFZA 1KCFA 3VQ4A 3ZSRA 3HP9A 4OPJA 3K58A 4DFPA 4HVJA 2RF2A 1L3VA 2A1SA 4KHQA 3S3NA 4CFDA 2P5OA 2YKMA 1Q9XA 1RTHA 1NJWA 4RW6A 1RT3A 4CEAA 1BQMA 2HHVA 3KJVA 3LZIA 1L3UA 4B9NA 3BDPA 5I42A 4FK0A 3MAQA 1J53A 4FW1A 3VQPA 4W5NA 1KRPA 4FLYA 4I2PA 1KLMA 4AHCA 1I3AA 4M3YA 1L5UA 3QEXA 1VSLA 1VRTA 3U3GA 3AA2A 4YNQA 1NJXA 2HVHA 3SPYA 2HW3A 2OZSA 3NGIA 1L3SA 4Z4IA 1BHLA 2F8TA 2W42A 4DF8A 4FJJA 1CZ9A 5CZ2A 3U6FA 4KAZA 4FJNA 1CLQA 3LP0A 3V9SA 4C8MA 2EHGA 2LSNA 2IAJA 4DSEA 3DLHA 5J2MA 1HNIA 3SV4A 4LSLA 4KHSA 4LY7A 4CGDA 5FROA 1SL2A 1RDAA 2YKNA 5KI6A 2PYJA 4B9UA 4O4GA 1S1VA 2VWKA 4KTZA 2HMIA 5HLFA 4FZYA 1JL1A 3AVIA 4DTPA 4L8RB 1O1WA 4B9SA 1ZYQA 4IFVA 3WNHA 4CHOA 3OYNA 3U3YA 3TAQA 3T19A 3K2PA 2E4LA 1SUQA 4FVMA 4CJSA 4CJPA 2VWJA 4JRPA 5J2QA 2PYLA 4N41A 1S9EA 3LDSA 3QEWA 3CM5A 4DSIA 1RCHA 2RPIA 4CJRA 1TKDA 3MEGA 5SZTA 2RN2A 3LANA 4OLAA 3AO1A 3AO3A 1S9GA 1FKOA 1LW2A 3AVJA 3MECA 4RW8A 4CHYA 4CJLA 2HNZA 4DU4A 1D9DA 5KGXA 1LV5A 2JLEA 2OPRA 3CFOA 4CESA 1Z25A 1LWCA 5KRTA 5EU7A 2PY5A 3QNOA 1F21A 3ZSWA 3TABA 4DTUA 4IKFA 1WSFA 2OPQA 2X78A 3CFRA 3HPGA 3AVCA 1WAJA 2FBXA 4DF4A 4DFKA 3QETA 4Y1CA 3SZ2A 1NK6A 3CYMA 4M3ZA 3V1QA 4BDZA 2XHBA 3K57A 4KI4A 5JS2A 1VSKA 3VQ9A 3OS2A 3MEDA 4M3TA 2IOCA 1A5XA 1B92A 3LAKA 4W5RA 3I8DA 4OKEA 3DMJA 3ZT4A 1TK0A 4Q5VA 2HHUA 1RDBA 1BI4B 2WONA 1VRUA 4M41A 4RW4A 4ID1A 3RRHA 1UA0A 1IH7A 1UOCA 4B08A 4AHRA 3IAYA 2QK9A 2G8FA 1LAVA 1VSEA 3DI6A 3V9ZA 1SL1A 4ZTFA 3T1AA 4KV8A 3OS0A 3OVNA 3RMDA 3KTQA 4FJIA 3THVA 4QOZB 1RTJA 2YHBA 4MQ3A 4CJEA 1QSSA 5HBMA 1D8YA 4E7IA 2D0CA 1TKTA 4ELUA 3M8PA 2OYQA 4FZZA 2G8IA 1C0UA 3PX0A 1N5YA 2DTUA 3NF9A 4UQGA 3TAEA 4Z4CA 4CK3A 2VG7A 4DQIA 1S1TA 3HL8A 3V81A 3KKRA 4FJ7A 4KHWA 3PO5A 4GW6A 3L2VA 1HYVA 1EP4A 3HPOA 1QE1A 3AO2A 4CIFA 4B8AB 4BWJA 1IG9A 3KKSA 3LPTA 3CM6A 4FLWA 1HJRA 5HRPA 3V1RA 3HO1A 4CF1A 3VQ5A 4FJKA 2I5JA 1CZBA 3V9WA 1T05A 4MFBA 4CEQA 2KW4A 3NH1A 1WSGA 1RDDA 3TR8A 4CHPA 4EP5A 3S3OA 4CE9A 3OYIA 4CJUA 3DRRA 1S1XA 2DFEA 3AVNA 4WE1A 3VQDA 2ETJA 4W5QA 4Z4HA 4NYNA 4C8NA 3M8RA 4CGJA 3OYLA 3HP6A 3OYHA 4DSLA 3NDKA 2Q3SA 1D9FA 1WNSA 2BDPA 1JLCA 1UA1A 4Z4GA 2HHSA 4OGEA 4NCGA 1X9SA 5D3GA 2IGIA 2FBYA 2AJQA 1KVBA 4IBNA 5J1EA 2KQ2A 1HYSA 2E6LA 3AVHA 4FLZA 3EY1A 4IDKA 1HMVA 1CXQA 1VSFA 4CCHA 1VSDA 4GVMA 4M45A 1RT2A 1IO2A 5FRMA 4FXDA 4N56A 1KVCA 3AA4A 3O3GA 3AVBA 3OYEA 4DTOA 3DOLA 4CEZA 1K6YA 4B3OA 3ZSQA 2BE2A 3MXIA 2ZE2A 2YNIA 3PX4A 4KO0A 3LWLA 4BE0A 3QNNA 1HQUA 4M3WA 1ASUA 5J2NA 1IKXA 5C42A 1RT5A 1YT3A 3QEPA 4DQPA 2HB5A 3P5JA 1TAQA 3KK3A 1TL3A 3LP3A 4EP4A 3NHGA 1T8EA 3KLIA 1A5VA 3EYZA 2HNYA 4AHVA 3SQ2A 3HVTA 5J2PA 4E7KA 3K5LA 2G8WA 4DSKA 2KFNA 1TGOA 3KIOA 2XY5A 3ITHA 1BIUA 1TKXA 1EX4A 2ZD1A 1WN7A 2KTQA 3O4NA 3SPZA 1Q8IA 4FLXA 3PV8A 2FC0A 1XHXA 1KLNA 1U48A 4I9QA 1HYZA 1RT6A 5DK5A 3WNFA 1C6VA 3OYJA 4FLTA 1QTMA 2G8KA 4DWIA 1JL2A 1J5OA 4CF0A 3AA5X 3NBPA 3B6OA 4F2RA 1S1UA 1QS4A 1VSJA 2X6SA 4BWMA 3MXJA 2HNDA 3OYDA 5I3UA 4J2BA 3SCXA 1NOZA 1A5WA 2PZSA 4E3SA 3QERA 3OS1A 3L2QA 4JLHA 4BE1A 4CHQA 3SJJA 4CHZA 4E89A 4DFJA 3DLBA 4HTUA 1ZBIA 3SNNA 3DLRA 1BL3A 4M3RA 3L3UA 3LP2A 1JKHA 3NF6A 1CXUA 4CJFA 1VK0A 2YHAA 4CGHA 1RNHA 3S3MA 4KTWA 2YNFA 1XWLA 1Z26A 3M8QA 3VA3A 1VSMA 1REVA 3IG1A 4FM2A 3QO9A 2XY6A 2HHTA 1X1PA 1NK0A 4I2QA 3VQBA 1HNVA 4K8XA 3KK1A 4CEEA 4AILC 4ELTA 4O44A 1NKEA 2Z1GA 4DSFA 3TAMA 1DLOA 3NF7A 1RBRA 5KRSA 3SUPA 1RTDA 4OKKA 1WLJA 4CIEA 1W0HA 2DY4A 4NCAA 3DOKA 1KTQA 1UAXA 3ZSXA 2A1RA 4E0DA 1SV5A 2GV9A 5HRRA 4CGIA 4R5PA 4J2EA 4FCYA 4O0IA 2QKKA 4Q0BA 2QXFA 3HXMA 4BACA 3D45A 5HP1A 4RW7A 4H4MA 4KRFA 4Z4EA 1NJYA 3OYGA 3T3FA 1ZBLA 3LZJA 4DQSA 4NCBA 1WSHA 3PUFA 3HJFA 1KFDA 4OKJA 4CJVA 3PX6A 1JLEA 4ZTJA 3K5NA 4FK4A 3ZSOA 3KK2A 1SKRA 2Z1JA 4E7LA 2OPSA 3MXMA 2B5JA 1B9DA 3QEVA 4KREA 5FDLA 3KD1E 4CK2A 1BCOA 2Y1JA 3PO4A 1JXEA 1X9WA 2HHWA 3OYBA 1MU2A 4DFMA 4BDPA 3QIOA 1JXBA 3AVMA 2P51A 1XI1A 4TSXA 4KHNA 2KZMA 4HUEA 1S6QA 2VG5A 2OZMA 3RWUA 1DTQA 3AV9A 4FW2A 4H8KA 5C25A 1ZBUA 4DU3A 3A2FA 4B9TA 3IRXA 2R7YA 4RG8A 2OA8A 1HQEA 3ZT0A 1DTTA 1U47A 4Z4FA 4KB0A 4RW9A 3ASMA 3HVRA 4BE2A 3SV3A 3FFIA 1NK5A 4KKOA 4CF2A 4ID5A 1U45A 4KB1A 3RMBA 1T03A 1GOCA 3P1GA 2Z1HA 1BQNA 4PY5A 4FM0A 3L3VA 3VQQA 1KSPA 1TL1A 4ELVA 3I0SA 1JLBA 1N6QA 3SQ4A 2F8SA 3NGZA 3TAPA 1NK4A 3OJSA 2G8VA 2P5GA 1L3TA 4CJ5A 2XRIA 5C24A 4OLBA 4CEOA 4DQRA 2XY8A 4FJ5A 1ASWA 1FKPA 1RBUA 1WSJA 1RILA 3O4QA 1IKWA 3ZSYA 4C8LA 3AVAA 3DRPA 3MEEA 5SWMA 4IG3A 1RDCA 2D5RA 3C6UA 3ZT2A 3F73A 4FZXC 1T7PA 4N47A 3NAEA 4DQQA 3P83D 4IFYA 4DTMA 4FJLA 3JSMA 4Z0UA 3VQAA 3HK2A 4AHTA 3KD5E 3ALYA 3AVGA 4DU1A 3BGRA 2G8HA 3CFPA 2YV0X 3G10A 4PQUA 3C95A 1WSIA 3QINA 1TAUA 4IG0A 4CJQA 4FJXA 4CF9A 3L2RA 4DLEA 3LP1A 1TV6A 3DM2A 4F2SA 3L8BA 4KPYA 1RTIA 1C1AA 4JS4A 1S5JA 1BCMA 4FM1A
chains in the Genus database with same CATH superfamily
4KI6A 3RTVA 3C7NB 3TI0A 2A40A 3AARA 4EZ9A 4ICLA 4O8KA 5KTQA 3VF4A 1WAFA 5GIOA 3TPQA 1C1CA 3FZMA 2F96A 4AM7A 4LH4A 1N36K 3G4SN 5CZ1A 2UUAK 5E41A 2GTDA 4F4KA 3JAMO 1SKWA 3DLKA 3NCIA 4BVPA 1LOTB 4IO8A 1QQCA 1IKVA 4DTSA 3L6QA 3T1YK 4L3QA 4BRFA 4AM6A 2XY7A 3IFRA 3GE1A 4OPKA 1TKZA 3A8YA 2ZF5O 3KLGA 3K5OA 1Z6RA 3LPUA 2Q2RA 4DMNA 5C0YA 3WNEA 2UXDK 4JHDB 2Y1IA 4DTJA 1YF5L 3TARA 4KHUA 2KZZA 1WBBA 2D0BA 2HSTA 4DSJA 2D1KA 4FLUA 2P9KA 3DLEA 4YFUA 1ESVA 2EX3A 2Q31A 2D0AA 2P9UA 2A42A 4WCEL 3HRGA 4CI6A 1O13A 1XQSC 1VSIA 3CC7N 2AA4A 4AH9A 1S72N 3MN7A 3SAGA 3NH0A 1N34K 2ZQBA 4DS4A 4CEDA 1SAZA 3AA3A 3H1VX 3MCAB 3AVKA 4FPBA 4B9MA 1TYQA 1RT7A 3L2UA 4DLGA 4O0JA 1Q9YA 4JI8K 3FR0A 4JI1K 3HSTB 2HF4A 3VGKA 4CGFA 4CJTA 4K41A 4BRNA 2F9TA 4F9OA 2OCEA 3WEEA 5E26A 4CK1A 1RBVA 3S9HA 1ASVA 4E19A 5KQDA 5DM6L 4Y0WA 3EKSA 4H0PA 4I6MB 1NU0A 3JYTA 1TK8A 4JS5A 3AVFA 2GBZA 2HHXA 1T6DA 3ISNC 4CZJA 1D5AA 4DS5A 1VQPN 1YIJN 4CFCA 3C6TA 2O8EA 4M7XA 2E1YA 2FSNA 2XO7A 4LF9K 1HNWK 4XIUA 4CHNA 4M3UA 4RWTA 5M1FA 4WQ5C 4JRQA 3ZETA 1M90O 2P1JA 1C0MA 4BRPA 4CFBA 1C1BA 2Z1IA 1VQ8N 4R79A 3KLEA 3QMLA 3QESA 3M3ZA 1EETA 2KFZA 4IDHA 3VQ4A 4GY2B 3HP9A 3AGKA 3ZX0A 1Q9XA 4RW6A 2HHVA 5IT9O 3LZIA 4B9NA 5I42A 1EO1A 4FW1A 4FWPA 2O8CB 1KRPA 1Q82O 4WFAL 4M3YA 1VSLA 3AA2A 3SPYA 2OZSA 3WEEB 1GLAG 3BZCA 2W42A 4KAZA 3QICA 4KHSA 1RDAA 2YKNA 5KI6A 2VWKA 3VMFB 2HMIA 3K9KA 1JL1A 5AZIB 4DUYK 3CJ9A 4IFVA 3P31A 4CHOA 3U3YA 3R1XA 3TAQA 4CZKA 4CJPA 2E4LA 4GVEA 4JRPA 2F9WA 3LDSA 3QEWA 4BG9A 2RN2A 1NGDA 3M1FA 3AO3A 3MECA 4RW8A 3AVJA 4CHYA 3D7EO 3C0BA 1FJGK 3WQUA 2JLEA 4K0KK 4CESA 4PKIA 3ZSWA 3QFPA 3EZWA 1WSFA 4DF4A 3AVCA 1WAJA 5AQLA 2ZJQL 3CYMA 3ZETB 4BDZA 3VGLA 1VSKA 3VQ9A 4BRLA 2UXBK 1ATRA 4M3TA 2IOCA 1A5XA 2D0PA 4U67L 4GNIA 3QB0A 2QWRA 4RW4A 4ID1A 1UA0A 1IH7A 4B08A 2GUPA 3IAYA 2UXCK 4X65K 3DI6A 2G8FA 3V9ZA 1VQ9N 3QBXA 3T1AA 3KTQA 3CC4N 4FJIA 1OH7A 3THVA 1RTJA 4CJEA 4ELUA 4FZZA 2G8IA 1C0UA 4LF5K 1N5YA 4B3SK 5AQTA 3NF9A 2QWLA 3LDNA 1C0FA 4DQIA 4GW6A 5AQJA 3L2VA 1W2BM 4BRMA 3KKSA 5C12A 4FLWA 1HJRA 5HRPA 3V1RA 3HO1A 4CF1A 1HKGA 1CZBA 4MFBA 5BRHA 5AZJA 4CE9A 5CHIA 1P90A 1S1XA 2DFEA 4JKBA 3VQDA 2ETJA 4BR7A 4C8NA 4BROA 3HP6A 5BN8A 4DSLA 3NDKA 1D9FA 4GKJK 4BRKA 5D3GA 4BREA 1WUAA 3U8XA 3KZBA 5J1EA 3CCSN 2NNWA 1EWRA 3WXKA 3EY1A 1W97L 1CXQA 4CVNE 3O9UA 3G6EN 1KVCA 3AA4A 4B9QA 1DT9A 1T3VA 3O3GA 1K6YA 3ZSQA 2BE2A 3O1BA 2YX6A 4KO0A 3Q7CA 4BE0A 1KC8O 4M3WA 1ASUA 1RT5A 1TAQA 3TSQA 3LP3A 3NHGA 1X9JA 3KLIA 3EYZA 2HNYA 3K5LA 1KXPA 4DSKA 2NZTA 5FPMA 5LMNK 3ITHA 1BIUA 2KTQA 1U2VB 4ILGB 3VGMA 1WOQA 4FLXA 1U48A 1RT6A 3WNFA 4OPAA 3LM9A 1JL2A 1J5OA 3T7ZA 1SS6A 3CETA 3PLAA 3SCXA 3WXIA 3L2QA 5BR8K 4CHQA 4JI7K 3K0SA 1HPMA 4C23A 1XMQK 2QWOA 3HOSA 1BL3A 4M3RA 3L3UA 3LP2A 5TKWA 1JKHA 5AZJB 4LF4K 4CJFA 5AQIA 2YHXA 4H0VB 4A62A 3S3MA 4KTWA 1VSMA 4FM2A 2XY6A 1NK0A 5KQ8A 3VQBA 4DR3K 4DR4K 4CEEA 3OTOK 4ISEA 1NKEA 3EN9A 4B1YB 2Z1GA 2O8BA 4DSFA 2HOEA 1DLOA 2IVNA 1RBRA 3CJCA 4UY8O 1NGEA 2GV9A 3BP8A 2QXFA 4BACA 4RW7A 3A5LC 1NJYA 2GELA 3HJFA 4A61A 4ZTJA 5IWAK 3SLCA 4A2AA 2Q97A 4CK2A 1BCOA 2Y1JA 4DV5K 1JXEA 2E2PA 4CZIA 3RSEA 4BRGA 2P51A 3SAFA 4TSXA 2KZMA 1S6QA 3RWUA 1DTQA 3VERA 1GLFO 4C1NI 4DU3A 4JD2A 1DTTA 2CH6A 4RW9A 5C2FA 3SV3A 4BE2A 4KKOA 4KB1A 3RMBA 4X62K 4EAHD 3L3VA 4FVUA 1TL1A 1JLBA 2F8SA 3PSIA 3TAPA 4CJ5A 1BWFO 3VEXA 4WYBA 4IEEA 1FKPA 1RILA 4C8LA 3DRPA 2Q0RA 3TU5A 4DQQA 3CCUN 3HBTA 3AVGA 4DU1A 2Q1NA 3O1WA 3L2RA 4DLEA 2A6AA 3LP1A 2ZWHA 1W7AA 1XC3A 1C1AA 3G71N 4IZ9A 3CCLN 1T44A 1Y97A 3HYFA 5CYMA 1GOBA 5JS1A 3V6DA 4F3OA 1GLDG 1ZBHA 4HCBA 5HRSA 1J9AA 1JLAA 1QVFM 2WOMA 3ZT1A 1IKYA 2JWKA 3QLHA 3SK3A 3V4IA 2NRVA 4BGAA 3Q7BA 5MLCQ 4FWKA 3SAHA 4OGCA 3N4QA 4BRCA 2FBVA 3K5MA 3SQ0A 1JCFA 4BC4A 3AO4A 3RSEB 3OW2M 3LALA 1RT4A 1BIZA 2WBNA 5M1PA 3F2KA 1WSEA 1VQNN 3FZKA 2ASMA 4BC3A 1NGJA 4MDAA 3OYFA 2IDOA 4JD2B 4BRDA 2DFHA 1BISA 4NLBA 4BDYA 4B1ZA 4H5WA 5AQXA 3ZLJA 5T7BA 3DLLL 3AO5A 3ZT3A 1X9MA 1SL0A 5AR0A 2B6AA 1S6PA 4I7FA 4FJGA 4M3XA 3GBTA 3UIQA 3J81O 3O6WA 5I9EB 1NJZA 4DV7K 1LAWA 1Y64A 2BTFA 2Q36A 1NLVA 4QS7A 3NE6A 1YTAA 3VQCA 4HUFA 3DWLA 3QEIA 2FSKA 3O08A 1NK9A 4PWDA 4DB3A 3O3FA 4FJHA 2A5XA 3VQ6A 3FZLA 2ITGA 5KGWA 1N32K 3L0QA 2QKBA 4IOCL 4YY3K 2YNHA 3C94A 2G8UA 1LW0A 3C6AA 4HWIA 1QSYA 4CFAA 3A5OC 4PL7A 1YTUA 3SI6A 3I0RA 5KPRA 3LWMA 3G0ZA 3G25A 4O5FA 2ASPA 4QAGA 3DLGA 5HOOA 2VQEK 3E01A 1NG9A 1RT1A 3QDKA 4DUZK 4KTQA 4C8KA 1KAYA 1UWBA 1FK9A 5DMRA 4JKFA 1DKGD 1V4SA 3GDQA 2QEXN 3ATVA 3VQEA 2E20A 2P9PA 3VEYA 1NKBA 3SUOA 4BR5A 5B8HA 1R0AA 1TUYA 1SKSA 2O8DA 3MX5A 4CGGA 3CHWA 1S1WA 5DM7L 5GADP 2OPPA 2I7PA 3OYAA 4IOAL 1FXXA 1HKBA 3FZFA 1RBSA 1ITGA 3E9PA 2VG6A 3VOVA 1YVUA 1HRHA 3SBTA 4DFPA 2FXUA 1XNRK 2CGLA 2RF2A 1L3VA 4KHQA 1RTHA 3IMXA 2HBMA 3BDPA 4FK0A 1J53A 3VQPA 4I6MA 4AHCA 3U3GA 4YNQA 1NJXA 4BR4A 2HW3A 3NGIA 2NRWA 3GL1A 4DV0K 1CZ9A 5CZ2A 4FJJA 3CMEN 1QQOA 4DSEA 1YUWA 4FO0A 1ATNA 3SV4A 4LSLA 4LY7A 1SL2A 5FROA 1IV0A 4LF8K 3AY9A 3DXKA 1S1VA 4FZYA 2GWJA 4JKCA 4BQLA 4OO1J 2P9PB 2VWBA 3OYNA 3NVKA 4CJSA 3K2PA 4FVMA 5J2QA 2PYLA 1BUPA 4B3MK 2FF6A 4DSIA 1RCHA 2RPIA 5LL6Z 4OLAA 3WXLA 5SZTA 3LANA 2O8DB 3CJ1A 4CJLA 2HNZA 3D6RA 4DCHA 3M5RA 3OBYA 2PY5A 3CFOA 1Z25A 4MO4A 3EE9A 3VEZA 4MLEA 1VQON 4M3ZA 3P38A 3MN9A 2XHBA 3A0IX 4H0YB 5JLHA 2O8CA 1TK0A 4Q5VA 2HHUA 1RDBA 4LFAK 3BF1A 2WONA 3H3NO 4YHHK 4FWSA 3RRHA 3SMSA 1HKCA 2AP1A 3CCRN 1SL1A 2YHWA 4IO9L 5HBMA 4E7IA 2D0CA 1TKTA 5EX5A 2W6KA 2FSJA 1TUUA 3CPEA 3O8MA 4UQGA 4CW7B 4CK3A 3H6EA 2FLOA 2CGKA 5AZIA 1EP4A 2HBKA 4JKGA 1QE1A 4B8AB 5FPDA 3IKMA 5AQQA 1QHAA 1K8KA 4FJKA 2I5JA 4PL8A 1T05A 4CEQA 2KW4A 3NH1A 1WSGA 5AFUH 3TR8A 4CHPA 1VQ4N 4CJUA 3DRRA 3AVNA 2YJFA 3DXKB 4W5QA 4Z4HA 4NYNA 3M8RA 4CGJA 3OYLA 3OYHA 2BDPA 1WNSA 1UA1A 4GV6A 3I55N 4IBNA 2KLAA 4B1XB 4FLZA 4FL9A 1VSFA 5EOYA 4CCHA 1VSDA 2E8AA 1IO2A 4DTOA 4B3OA 4EHUA 3MXIA 1NGHA 1VQLN 3WQTA 2ZE2A 3OHRA 3QNNA 3DAWA 4NLCA 5C42A 1MDUB 3E9OA 3CC2N 1TL3A 4NB4A 4CD1A 5ADXA 4BR2A 4K42A 3SQ2A 5J2PA 4E7KA 4ILJA 2G8WA 2KFNA 1TGOA 2ZD1A 1NGBA 3VTIA 4WF9L 3O4NA 3SPZA 1Q8IA 1BOTO 2FC0A 1XHXA 1VQKN 1KLNA 4I9QA 1HYZA 4K25A 3SBGA 4FLTA 2G8KA 1ZC6A 3H46O 3MDQA 2E2NA 5I3UA 4BY9C 4J2BA 1CZAN 1A5WA 4JKGB 3N4PA 3QERA 1VQ6N 2ITMA 5GIPA 4E89A 1K8KB 4DFJA 3DLBA 3FLCO 4CBUA 2EWSA 4DR5K 1XWLA 1Z26A 3VA3A 2W6LA 2FF3B 3DJCA 2HHTA 3KK1A 4ELTA 3SUPA 1RTDA 4OKKA 4DV1K 1WLJA 4NCAA 4E0DA 1JCGA 1SV5A 5HRRA 4J2EA 4FCYA 4XH5A 4H5NA 3D45A 2GWKA 4Z4EA 1U2VA 3OYGA 1ZBLA 1WSHA 2YHYA 3PUFA 4OKJA 4EIAA 3PX6A 1NMNA 1JLEA 4JI3K 4E7LA 2OPSA 3MXMA 3QEVA 3AAQA 5FDLA 3KD1E 4FWRA 4QS9A 1NBWA 3R3LA 1JXBA 4C1NK 1XI1A 5AQRA 4HUEA 2VG5A 4MDBA 4LC9B 2VGMA 3QBWA 4B9TA 1ZBUA 1V4TA 3H3OB 2R7YA 4RG8A 3TSUA 3D2FA 1HQEA 2YI1A 1K73O 1VAZA 4J8FA 4ID5A 4IOXA 5KPTA 1GOCA 3MK6A 1YI2N 3VQQA 3THYB 1KSPA 4YOVA 4B3RK 3K9JA 3SQ4A 1EQYA 1NK4A 2P5GA 1NNEA 3KHYA 4OLBA 4FSVA 1ASWA 1RBUA 3O4QA 2E1ZA 3AVAA 3C6UA 4BQZA 3TTDA 1T7PA 1BG3A 3J7ZO 4IFYA 4FJLA 1EWQA 2P9NB 3KD5E 2QTDA 3BGRA 3CFPA 2YV0X 3KK7A 5EXWA 2QM1A 1GLJO 4CJQA 4DR7K 2IVOA 3L8BA 2QWNA 2WC9A 3VF2A 1S5JA 1BCMA 3VENA 4FM1A 3WXJA 4LF7K 4CJKA 5LJWA 5E84A 3RRGA 1R59O 4CERA 4OPHA 1XHZA 3ULDA 1EXQA 4EFHA 2QW9A 4BVOA 5CYQA 4N5SA 2HHQA 3EL2A 5HROA 3LDQA 4CEFA 4H4OA 4F8RA 1OH5A 2NRRA 3BEXA 5HRNA 4PUOA 3D2FB 5BR9A 1I94K 3A5MC 3E9LA 3EZ5A 2DFFA 1Q81O 3ZCMA 3VA0A 2QXLA 4O5BA 2UYTA 3KVGA 2HBJA 4CZFA 5F1XA 3SYZA 4B9VA 2IS3A 2E88A 4FWOA 2RKIA 4EZ6A 1NGFA 4WQ4A 4KHYA 1VQ7N 1ILYA 1TVRA 2ATQA 4IJNA 3U4LA 4A2BA 2O4GA 3RR8A 4DV3K 4F3TA 5BREA 2V7YA 4CJ3A 4ISGA 4ILHA 2PBDA 3F9KA 3RR7A 4PA1A 3DYAA 3E66A 2V7ZA 4LH5A 4BC2A 5BPLA 4OJRA 2HF3A 3SQ1A 3ZSZA 3U9DA 3LAMA 1JLGA 3VETA 3NF8A 5K14A 5C15A 1U04A 1GOAA 4WFBL 4CF8A 4HHTA 3RMAA 1RBTA 1YITN 1NK7A 4CJWA 4DG1A 3J80O 4YORA 4ZHRA 4B1VA 2KHOA 5FRNA 4CEBA 4YOYA 4LD0A 3W3DA 3K59A 4KH5A 3PIOL 3ZSVA 3HT3A 4NYFA 3CD6N 3IUCA 4HUGA 4RCHA 4M42A 3QIPA 4FLVA 3DRSA 3O4WA 1E3MA 3J7AP 4CJ4A 3NGYA 3O3HA 2NUBA 4JV5K 3D0PA 1ZXOA 4KFBA 1EKEA 3V9UA 1VSHA 1TK5A 4B9LA 4KHPK 4J2DA 4FYDA 1ATSA 3PY8A 4FJMA 4CZMA 2RE2A 3M8SA 4FK2A 1RFQA 4IFEA 1YVNA 4O55A 4YOWA 3FE1A 3ID6A 1KFSA 4LSNA 5FPEA 3L2WA 3EKUA 4KH4A 4BGBA 3ZSRA 4OPJA 3K58A 4HVJA 1NGAA 4PKGA 1VQ5N 2A1SA 1SZ2A 3S3NA 4CFDA 2P5OA 2YKMA 2NRHA 1NJWA 4CEAA 4A59A 5M1OA 3BY5A 3MAQA 2QWMA 4I2PA 1KLMA 4CJ7A 1I3AA 3QEXA 2HVHA 3SJHA 1L3SA 1MA9B 1BHLA 4FWLA 3PIPL 2VYPA 4DF8A 2F8TA 5LJVA 4A5AA 3V9SA 4C8MA 4DV2K 3OA9A 3WT0A 4CGDA 5LY3A 4FOIA 2PYJA 4FWQA 3WXMB 3CCJN 5HLFA 3AVIA 4DTPA 4L8RB 1O1WA 4B9SA 3WNHA 1HJOA 2GX9A 5JMVA 3T19A 1S9EA 3CM5A 4CJRA 1TKDA 3MEGA 4KBOA 3BF3A 2QA4N 4DQ8A 1MWMA 1D9DA 5KGXA 4JK7A 2OPRA 1LWCA 5EU7A 3HM8A 3T69A 3QNOA 1F21A 1WBDA 4IKFA 2OTJN 1QSLA 2X78A 3HPGA 4DFKA 3V1QA 5CR4A 1FW6A 3F5TA 3K57A 3OS2A 3JS6A 3MEDA 3LDLA 2W41A 3LAKA 3I8DA 4W5RA 3DMJA 3ZT4A 4JI5K 3ENHA 5JLFA 4M41A 1UOCA 4AHRA 3THXA 4U7BA 2QK9A 1LAVA 4ZTFA 1D8YA 1QSSA 4ISFA 1Q18A 5CE3A 1IBLK 2OYQA 1BDGA 2Q0UA 2QWQA 4H5TA 3PX0A 3H1QA 4NXNK 3TAEA 2VG7A 4KHWA 1RDWX 1IBMK 3HPOA 5A2QO 2V51B 4EHTA 3LPTA 2QI2A 3L4QA 2ZM6K 3V9WA 5M1KA 4FWMA 1GLBG 4EP5A 3OYIA 4CZGA 1QVGM 4B1UB 3CMAN 4WE1A 3VPZA 2ZJPL 2Q3SA 4Z4GA 2HHSA 4OGEA 3O9RA 4NCGA 1X9SA 3UB5A 2IGIA 1VHXA 2FBYA 2AJQA 1K9MO 4QS8A 1HNZK 4B1WB 1HYSA 2E6LA 3CI5A 4IDKA 1HMVA 1P8ZA 4N56A 4BRIA 3OYEA 3AVBA 3DOLA 2E2OA 1QQMA 1ZBSA 3LWLA 1HQUA 1IKXA 3QEPA 4DQPA 2HB5A 3P5JA 4MLHA 5H1SQ 4EP4A 4AHVA 3THXB 2XY5A 4MO5A 1TKXA 4KH6A 2BUPA 1XMOK 3PV8A 5F2RA 1QTMA 3OYJA 1C6VA 3HSCA 2P9LA 4CF0A 3AA5X 4DR1K 3B6OA 4F2RA 3ENBA 5GAGP 1VSJA 2X6SA 4BWMA 3MXJA 1DEJA 3TTFA 5BPMA 2HNDA 1NOZA 2PZSA 3CF5L 3OS1A 4BE1A 4HTUA 3DLRA 4PKHA 5AQFA 4JKDA 3NF6A 5FPNA 1NJIO 1CXUA 1VQMN 1VK0A 2WUSA 3M8QA 1REVA 4BRQA 1X1PA 1XNQK 1HNVA 4K8XA 4B3TK 4O44A 4WQ4C 4YOUA 3TAMA 3NF7A 4IWVA 3EEQA 4CBXA 1E4GT 1UAXA 3ZSXA 1D4XA 4CGIA 4R5PA 4Q0BA 2P9IB 4JAXA 4DR6K 3U9ZA 4KRFA 3NVMA 2ZJRL 4NCBA 1KFDA 1HLUA 4CJVA 1OVQA 3K5NA 3KK2A 2Z1JA 3EO3A 2B5JA 1B9DA 3ATUA 3C65A 4CBWA 1X9WA 3OYBA 1MU2A 4DFMA 5JVHL 1Q7YO 5EVZA 2DPNA 4KHNA 2CGJA 4Z94A 4KREA 2OZMA 4FW2A 4H8KA 5C25A 4AF1A 3IRXA 5AQZA 4YDUA 4FPAA 2P9LB 3HVRA 3FFIA 1NK5A 5HL7L 4CF2A 1U45A 3CJAA 4DHYA 1T03A 5C10A 4PY5A 3I0SA 1N6QA 3CERA 1OKJA 1L3TA 5AJ3K 3CPWM 2GEMA 1X3NA 1JCEA 3ZSYA 3MEEA 5SWMA 4X66K 1RDCA 3CJ7A 3F73A 3NAEA 5M1NA 3P83D 4H5RA 1BA1A 3JSMA 3MWTA 1YJNN 3CJBA 3TSPA 3VQAA 3HK2A 2HMPA 4PQUA 2I7NA 1NGIA 3C95A 2P9KB 1WSIA 3QINA 4YOTA 1TAUA 4FJXA 2P9UB 3P39A 1TV6A 3DM2A 4H0XB 2IIRA 3CCVN 2D0OA 4JS4A 1G99A 2HBLA 3CQXA 3ENOA 5M1QA 3TWHA 4N76A 3NFAA 2BH1A 3ZYYX 1KVAA 4QCLA 1LWFA 1X3MA 1W9HA 3MWPA 4JNEA 1TYQB 3FFKB 5AQOA 1XC9A 4H03B 5LMUK 3OYCA 4XH4A 4OVLA 4BC5A 4CECA 3GG4A 1K8AO 3B6PA 2E2QA 4B8CA 4E7JA 1OH8A 3THYA 3H08A 3KLHA 3CXCM 3OYKA 1LWEA 1Z05A 2O4IA 5AQMA 1KAZA 3ULEA 2FBTA 3TTCA 4BR9A 2E6MA 1JLFA 2B4JA 4FJ8A 5CY4A 2H3GX 3SUNA 1HPZA 2KKZA 2YCHA 3I8BA 2ZGYA 3J8AA 3TAGA 2P9NA 2IC3A 1SQKA 3DXMA 3OY9A 4GMJB 3H45C 2CH5A 5BN9A 4DTRA 1NKCA 2O8EB 5AQVA 4BR0A 3V1OA 4W5OA 2JWLA 1LCUA 4K8ZA 3ID8A 1JJ2M 1U6ZA 3SUQA 1I39A 4AQYK 2QWPA 3D2EA 3P4IA 3OBWA 2WTUA 2HVIA 4NXMK 3MCPA 4CIGA 5AQUA 4I9LA 4C8OA 3VQ7A 3HPHA 4K43A 3GOIA 3C6HA 1QHTA 1B9FA 1XUPO 1NOYA 1U4BA 4FJ9A 2YNGA 2BANA 4Y1DA 3EE8A 1YHQN 4E1MA 4W5TA 3AVLA 1C0TA 1NGGA 4H0TB 3TAFA 4DTNA 1YAGA 3VF6A 4E1NA 2F4VK 4HCCA 1H1VA 3RMCA 2X74A 1BGXT 4G1QA 3O5BA 5ELZA 3V9XA 1HR0K 3R6MA 1BU6O 1NK8A 3CG7A 2BGGA 2VQFK 4AHUA 4X64K 4BRAA 3IS9A 5AQKA 3ULEB 3UKRA 3OJUA 3THWA 1J5EK 2UUCK 2W40A 5AQPA 4G9ZA 3HTVA 4AHSA 2GUIA 1U49A 4DTXA 2JGUA 1ZBFA 3MN6A 3WNGA 3BZKA 4J2AA 5AQSA 1C0GA 3TANA 4GV9A 3OYMA 2X6NA 4H5VA 3DXMB 3R9PA 3CCEN 3KLFA 5ADXH 3VQ8A 1G15A 3RVCA 1J54A 3PSFA 5KPZA 3ZX2A 3HZ6A 1JLQA 4RTFD 3VN5A 4E7HA 2WFBA 3NH2A 3BUZB 1BI4A 3HM9A 3ZEUA 1KCFA 2NRXA 3D2EB 5AQNA 4IJAA 1RT3A 1BQMA 3KJVA 1L3UA 3HI0A 4W5NA 4FLYA 1RGIA 1L5UA 1VRTA 1N8RO 5JICA 2O8FA 1HX1A 4Z4IA 1DGKN 3U6FA 4A57A 4FJNA 1CLQA 3LP0A 1BA0A 5EY4A 2EHGA 2LSNA 2IAJA 3T1HK 3DLHA 5J2MA 1HNIA 4BG8A 4B9UA 4O4GA 4KTZA 3CIPA 4XEIA 1ZYQA 4WFNL 1Q86O 5AQHA 1SUQA 2VWJA 4N41A 1RDUA 2ASOA 4JKEA 3UKRB 3THWB 4JK9A 2UUBK 2ZGZA 1T6CA 2VCPA 3AO1A 1S9GA 1FKOA 1LW2A 2HHHK 2J4RA 4DU4A 1LV5A 3UKUA 5GAHP 4LF6K 5KRTA 3TABA 4DTUA 3FGUA 3CFRA 2OPQA 1NK6A 2FBXA 4LFBK 3QETA 4Y1CA 3SZ2A 4JKAA 4KI4A 4FOEA 5JS2A 4FWNA 1B92A 1GLLO 4OKEA 1BI4B 3L4IA 1HNXK 1VRUA 3ZEUB 2D4WA 1VSEA 3I56N 3MN5A 2V52B 4KV8A 3OVNA 3I33A 3OS0A 3RMDA 4QOZB 4MQ3A 2YHBA 3M8PA 3O9TA 2DTUA 3WUHA 4A5BA 5GAEP 4Z4CA 2E5LK 1S1TA 3HL8A 3V81A 3KKRA 4FJ7A 4JI4K 3PO5A 2O8FB 5BPNA 4LFCK 1HYVA 3AO2A 4CIFA 1IG9A 4BWJA 1HUXA 3MX2A 4DV4K 3HOTA 3CM6A 4O8UA 3VQ5A 4YDUC 5BRFA 4JYAK 3KWIA 4CZLA 3VTHA 1RDDA 3FZHA 3S3OA 4H0OA 4DV6K 5TKYA 1NM1A 1JLCA 4WQ5A 3W0LA 1YJ9N 3AAPA 1QZ6A 1KVBA 2OTLN 1MWKA 2KQ2A 4JI2K 3AVHA 3LL3A 2RHKA 3UKUB 1GLEG 4GVMA 1NWKA 4M45A 1RT2A 5FRMA 4FXDA 4CEZA 2UU9K 1S22A 3LM2A 4M7YA 3O9QA 2YNIA 3PX4A 3ZX3A 5J2NA 4IXCA 2O8BB 1J6ZA 1YT3A 1IG8A 3VESA 4CZHA 3KK3A 4JEPA 1BO5O 1T8EA 4YOXA 2F7TA 1A5VA 3O80A 1S3XA 2NRTA 2P9SA 3HVTA 3CCMN 2OANA 3KIOA 1EX4A 1WN7A 3O9SA 3F9MA 3QFUA 1IJJA 3LDOA 4V19S 5DK5A 4DWIA 2PAVA 5JVGL 1WB9A 3NBPA 3B8AX 2VGNA 1S1UA 1NGCA 1QS4A 3OYDA 3M6GA 4NO7A 4JI0K 3IDHA 3JXUA 4BRHA 4E3SA 4JLHA 4XH1A 3SJJA 4GV3A 1GLCG 4CHZA 5BRDA 1KQSM 3J7YP 1ZBIA 3SNNA 1OVYA 2YHAA 4CGHA 1RNHA 2A41A 2YNFA 3IG1A 3QO9A 4I2QA 3LDPA 2A3ZA 3CCQN 4DR2K 2IVPA 2PFUA 4AILC 1QQNA 1KD1O 3KWGA 4CD3A 3VEVA 5KRSA 3CQYA 3R8EA 2DY4A 4CIEA 1W0HA 1NMDA 3DOKA 1KTQA 2A1RA 3UE5A 4O0IA 2QKKA 4GKKK 3HXMA 2YJEA 5HP1A 3C7NA 4H4MA 5AQWA 3NMUA 3T3FA 3LZJA 4DQSA 4JK8A 4FK4A 3ZSOA 1SKRA 5GINA 3VEWA 2P9SB 3PO4A 2HHWA 4BDPA 3QIOA 3AVMA 3AV9A 5FLXO 5AQGA 1YJWN 3A2FA 3VEOA 2OA8A 4JI6K 3ZT0A 1U47A 4Z4FA 4PHTX 4KB0A 2NLXA 5F0XA 3ASMA 4DKWA 3SMPA 3MMVA 3P1GA 2Z1HA 1BQNA 4FM0A 4JHDA 4M63C 4ELVA 3NGZA 1IBKK 3OJSA 2G8VA 2XRIA 5C24A 5AQYA 1M1KO 4OX9K 4CEOA 4DQRA 3E1YA 2XY8A 4FJ5A 1WSJA 1QZ5A 1IKWA 4IG3A 4FZXC 2D5RA 3ZT2A 4N47A 5AFUA 4IEIA 4DTMA 4CZEA 2P9IA 1OH6A 1E4FT 4Z0UA 1N33K 3S41A 4AHTA 2NRZA 3ALYA 2G8HA 4E1JA 3G10A 5C2DA 1KAXA 4IG0A 4CF9A 3A5NC 3AGRA 1YXQA 4F2SA 4KPYA 1RTIA 4JKHA 3CQ8A 4JN4A 4HTLA
chains in the Genus database with same CATH topology
4CJKA 1Y97A 5CYMA 3HYFA 3TWHA 4N76A 4KI6A 1GOBA 3NFAA 3V6DA 4F3OA 5JS1A 3RTVA 1ZBHA 1KVAA 4HCBA 5HRSA 1J9AA 1JLAA 4CERA 2WOMA 3TI0A 3ZT1A 3RRGA 1IKYA 4QCLA 4EZ9A 4ICLA 1LWFA 5KTQA 1WAFA 1XHZA 3ULDA 1W9HA 1EXQA 1C1CA 3QLHA 3V4IA 2F96A 5CYQA 4LH4A 4N5SA 1XC9A 5CZ1A 4OGCA 5E41A 3OYCA 4OVLA 2HHQA 2FBVA 3K5MA 3SQ0A 4CECA 5HROA 3AO4A 4F4KA 3LALA 3B6PA 4CEFA 1RT4A 1BIZA 4B8CA 4H4OA 4E7JA 1SKWA 1WSEA 3DLKA 3NCIA 4F8RA 1QQCA 3H08A 1IKVA 3KLHA 4DTSA 4PUOA 5HRNA 3OYKA 1LWEA 3OYFA 2IDOA 2O4IA 1QSLA 2XY7A 2DFHA 1BISA 4OPKA 4BDYA 1TKZA 2FBTA 3EZ5A 2DFFA 3ZCMA 5T7BA 3KLGA 3K5OA 3AO5A 3ZT3A 2E6MA 3VA0A 4O5BA 1X9MA 1JLFA 2B4JA 1SL0A 4FJ8A 3LPUA 5CY4A 4DMNA 3SUNA 3WNEA 1HPZA 2Y1IA 3SYZA 4B9VA 4DTJA 2B6AA 1S6PA 3TARA 4KHUA 4I7FA 2IS3A 3TAGA 2KZZA 4FJGA 2RKIA 4EZ6A 2D0BA 2IC3A 4M3XA 4KHYA 3UIQA 4DSJA 3OY9A 4GMJB 4FLUA 1NJZA 1TVRA 3DLEA 1LAWA 2ATQA 4YFUA 2EX3A 2O4GA 2D0AA 3RR8A 4F3TA 4DTRA 1NKCA 3NE6A 3V1OA 1VSIA 4W5OA 1YTAA 3VQCA 4K8ZA 4CJ3A 4AH9A 4HUFA 3QEIA 3NH0A 2ZQBA 3SUQA 1NK9A 3F9KA 4PWDA 1I39A 3RR7A 4DS4A 4PA1A 3O3FA 3DYAA 4CEDA 3AA3A 4LH5A 4FJHA 3AVKA 3VQ6A 2HVIA 4B9MA 1RT7A 4CIGA 4OJRA 3L2UA 4DLGA 2ITGA 5KGWA 4I9LA 4O0JA 4C8OA 2QKBA 1Q9YA 3SQ1A 3ZSZA 3VQ7A 2YNHA 3C94A 3HPHA 3LAMA 1JLGA 2G8UA 3NF8A 1LW0A 5K14A 1QSYA 1U04A 4CFAA 1QHTA 1B9FA 1NOYA 1GOAA 1U4BA 4FJ9A 3RMAA 2YNGA 3HSTB 4CF8A 2BANA 1RBTA 4HHTA 3SI6A 1NK7A 1YTUA 4CGFA 4Y1DA 4CJTA 3I0RA 3LWMA 4E1MA 4CJWA 3G0ZA 4W5TA 3AVLA 1C0TA 4CK1A 4DG1A 1RBVA 4QAGA 3TAFA 3S9HA 3DLGA 4ZHRA 4DTNA 1ASVA 3E01A 1RT1A 4E1NA 4HCCA 4E19A 3RMCA 5FRNA 2X74A 4CEBA 4KTQA 4C8KA 1BGXT 1UWBA 1FK9A 4LD0A 3CQ8A 4G1QA 5DMRA 3K59A 1TK8A 3JYTA 3HT3A 3ZSVA 4JS5A 3AVFA 4NYFA 2GBZA 3VQEA 3V9XA 2HHXA 4HUGA 1NK8A 3CG7A 1NKBA 2BGGA 4AHUA 4M42A 3ISNC 3IS9A 3OJUA 1D5AA 4DS5A 3SUOA 3QIPA 1R0AA 1SKSA 4AHSA 2GUIA 4CFCA 1U49A 3C6TA 4DTXA 4FLVA 2JGUA 4CGGA 1ZBFA 3DRSA 3WNGA 2XO7A 1S1WA 4J2AA 4CJ4A 4XIUA 3TANA 2OPPA 3NGYA 3O3HA 2NUBA 3D0PA 4KFBA 3OYAA 1EKEA 4CHNA 2X6NA 3OYMA 3V9UA 4M3UA 1FXXA 1VSHA 1TK5A 4B9LA 4J2DA 4FYDA 3PY8A 3KLFA 4JRQA 4FJMA 2P1JA 3M8SA 4FK2A 1RBSA 1C0MA 3VQ8A 1ITGA 1G15A 4CFBA 4O55A 1J54A 1C1BA 2VG6A 2Z1IA 1JLQA 1KFSA 1YVUA 4LSNA 3VN5A 4E7HA 3L2WA 3KLEA 3NH2A 1BI4A 1HRHA 3QESA 3HM9A 1EETA 2KFZA 1KCFA 3VQ4A 3ZSRA 3HP9A 4OPJA 3K58A 4DFPA 4HVJA 2RF2A 1L3VA 2A1SA 4KHQA 3S3NA 4CFDA 2P5OA 2YKMA 1Q9XA 1RTHA 1NJWA 4RW6A 1RT3A 4CEAA 1BQMA 2HHVA 3KJVA 3LZIA 1L3UA 4B9NA 3BDPA 5I42A 4FK0A 3MAQA 1J53A 4FW1A 3VQPA 4W5NA 1KRPA 4FLYA 4I2PA 1KLMA 4AHCA 1I3AA 4M3YA 1L5UA 3QEXA 1VSLA 1VRTA 3U3GA 3AA2A 4YNQA 1NJXA 2HVHA 3SPYA 2HW3A 2OZSA 3NGIA 1L3SA 4Z4IA 1BHLA 2F8TA 2W42A 4DF8A 4FJJA 1CZ9A 5CZ2A 3U6FA 4KAZA 4FJNA 1CLQA 3LP0A 3V9SA 4C8MA 2EHGA 2LSNA 2IAJA 4DSEA 3DLHA 5J2MA 1HNIA 3SV4A 4LSLA 4KHSA 4LY7A 4CGDA 5FROA 1SL2A 1RDAA 2YKNA 5KI6A 2PYJA 4B9UA 4O4GA 1S1VA 2VWKA 4KTZA 2HMIA 5HLFA 4FZYA 1JL1A 3AVIA 4DTPA 4L8RB 1O1WA 4B9SA 1ZYQA 4IFVA 3WNHA 4CHOA 3OYNA 3U3YA 3TAQA 3T19A 3K2PA 2E4LA 1SUQA 4FVMA 4CJSA 4CJPA 2VWJA 4JRPA 5J2QA 2PYLA 4N41A 1S9EA 3LDSA 3QEWA 3CM5A 4DSIA 1RCHA 2RPIA 4CJRA 1TKDA 3MEGA 5SZTA 2RN2A 3LANA 4OLAA 3AO1A 3AO3A 1S9GA 1FKOA 1LW2A 3AVJA 3MECA 4RW8A 4CHYA 4CJLA 2HNZA 4DU4A 1D9DA 5KGXA 1LV5A 2JLEA 2OPRA 3CFOA 4CESA 1Z25A 1LWCA 5KRTA 5EU7A 2PY5A 3QNOA 1F21A 3ZSWA 3TABA 4DTUA 4IKFA 1WSFA 2OPQA 2X78A 3CFRA 3HPGA 3AVCA 1WAJA 2FBXA 4DF4A 4DFKA 3QETA 4Y1CA 3SZ2A 1NK6A 3CYMA 4M3ZA 3V1QA 4BDZA 2XHBA 3K57A 4KI4A 5JS2A 1VSKA 3VQ9A 3OS2A 3MEDA 4M3TA 2IOCA 1A5XA 1B92A 3LAKA 4W5RA 3I8DA 4OKEA 3DMJA 3ZT4A 1TK0A 4Q5VA 2HHUA 1RDBA 1BI4B 2WONA 1VRUA 4M41A 4RW4A 4ID1A 3RRHA 1UA0A 1IH7A 1UOCA 4B08A 4AHRA 3IAYA 2QK9A 2G8FA 1LAVA 1VSEA 3DI6A 3V9ZA 1SL1A 4ZTFA 3T1AA 4KV8A 3OS0A 3OVNA 3RMDA 3KTQA 4FJIA 3THVA 4QOZB 1RTJA 2YHBA 4MQ3A 4CJEA 1QSSA 5HBMA 1D8YA 4E7IA 2D0CA 1TKTA 4ELUA 3M8PA 2OYQA 4FZZA 2G8IA 1C0UA 3PX0A 1N5YA 2DTUA 3NF9A 4UQGA 3TAEA 4Z4CA 4CK3A 2VG7A 4DQIA 1S1TA 3HL8A 3V81A 3KKRA 4FJ7A 4KHWA 3PO5A 4GW6A 3L2VA 1HYVA 1EP4A 3HPOA 1QE1A 3AO2A 4CIFA 4B8AB 4BWJA 1IG9A 3KKSA 3LPTA 3CM6A 4FLWA 1HJRA 5HRPA 3V1RA 3HO1A 4CF1A 3VQ5A 4FJKA 2I5JA 1CZBA 3V9WA 1T05A 4MFBA 4CEQA 2KW4A 3NH1A 1WSGA 1RDDA 3TR8A 4CHPA 4EP5A 3S3OA 4CE9A 3OYIA 4CJUA 3DRRA 1S1XA 2DFEA 3AVNA 4WE1A 3VQDA 2ETJA 4W5QA 4Z4HA 4NYNA 4C8NA 3M8RA 4CGJA 3OYLA 3HP6A 3OYHA 4DSLA 3NDKA 2Q3SA 1D9FA 1WNSA 2BDPA 1JLCA 1UA1A 4Z4GA 2HHSA 4OGEA 4NCGA 1X9SA 5D3GA 2IGIA 2FBYA 2AJQA 1KVBA 4IBNA 5J1EA 2KQ2A 1HYSA 2E6LA 3AVHA 4FLZA 3EY1A 4IDKA 1HMVA 1CXQA 1VSFA 4CCHA 1VSDA 4GVMA 4M45A 1RT2A 1IO2A 5FRMA 4FXDA 4N56A 1KVCA 3AA4A 3O3GA 3AVBA 3OYEA 4DTOA 3DOLA 4CEZA 1K6YA 4B3OA 3ZSQA 2BE2A 3MXIA 2ZE2A 2YNIA 3PX4A 4KO0A 3LWLA 4BE0A 3QNNA 1HQUA 4M3WA 1ASUA 5J2NA 1IKXA 5C42A 1RT5A 1YT3A 3QEPA 4DQPA 2HB5A 3P5JA 1TAQA 3KK3A 1TL3A 3LP3A 4EP4A 3NHGA 1T8EA 3KLIA 1A5VA 3EYZA 2HNYA 4AHVA 3SQ2A 3HVTA 5J2PA 4E7KA 3K5LA 2G8WA 4DSKA 2KFNA 1TGOA 3KIOA 2XY5A 3ITHA 1BIUA 1TKXA 1EX4A 2ZD1A 1WN7A 2KTQA 3O4NA 3SPZA 1Q8IA 4FLXA 3PV8A 2FC0A 1XHXA 1KLNA 1U48A 4I9QA 1HYZA 1RT6A 5DK5A 3WNFA 1C6VA 3OYJA 4FLTA 1QTMA 2G8KA 4DWIA 1JL2A 1J5OA 4CF0A 3AA5X 3NBPA 3B6OA 4F2RA 1S1UA 1QS4A 1VSJA 2X6SA 4BWMA 3MXJA 2HNDA 3OYDA 5I3UA 4J2BA 3SCXA 1NOZA 1A5WA 2PZSA 4E3SA 3QERA 3OS1A 3L2QA 4JLHA 4BE1A 4CHQA 3SJJA 4CHZA 4E89A 4DFJA 3DLBA 4HTUA 1ZBIA 3SNNA 3DLRA 1BL3A 4M3RA 3L3UA 3LP2A 1JKHA 3NF6A 1CXUA 4CJFA 1VK0A 2YHAA 4CGHA 1RNHA 3S3MA 4KTWA 2YNFA 1XWLA 1Z26A 3M8QA 3VA3A 1VSMA 1REVA 3IG1A 4FM2A 3QO9A 2XY6A 2HHTA 1X1PA 1NK0A 4I2QA 3VQBA 1HNVA 4K8XA 3KK1A 4CEEA 4AILC 4ELTA 4O44A 1NKEA 2Z1GA 4DSFA 3TAMA 1DLOA 3NF7A 1RBRA 5KRSA 3SUPA 1RTDA 4OKKA 1WLJA 4CIEA 1W0HA 2DY4A 4NCAA 3DOKA 1KTQA 1UAXA 3ZSXA 2A1RA 4E0DA 1SV5A 2GV9A 5HRRA 4CGIA 4R5PA 4J2EA 4FCYA 4O0IA 2QKKA 4Q0BA 2QXFA 3HXMA 4BACA 3D45A 5HP1A 4RW7A 4H4MA 4KRFA 4Z4EA 1NJYA 3OYGA 3T3FA 1ZBLA 3LZJA 4DQSA 4NCBA 1WSHA 3PUFA 3HJFA 1KFDA 4OKJA 4CJVA 3PX6A 1JLEA 4ZTJA 3K5NA 4FK4A 3ZSOA 3KK2A 1SKRA 2Z1JA 4E7LA 2OPSA 3MXMA 2B5JA 1B9DA 3QEVA 4KREA 5FDLA 3KD1E 4CK2A 1BCOA 2Y1JA 3PO4A 1JXEA 1X9WA 2HHWA 3OYBA 1MU2A 4DFMA 4BDPA 3QIOA 1JXBA 3AVMA 2P51A 1XI1A 4TSXA 4KHNA 2KZMA 4HUEA 1S6QA 2VG5A 2OZMA 3RWUA 1DTQA 3AV9A 4FW2A 4H8KA 5C25A 1ZBUA 4DU3A 3A2FA 4B9TA 3IRXA 2R7YA 4RG8A 2OA8A 1HQEA 3ZT0A 1DTTA 1U47A 4Z4FA 4KB0A 4RW9A 3ASMA 3HVRA 4BE2A 3SV3A 3FFIA 1NK5A 4KKOA 4CF2A 4ID5A 1U45A 4KB1A 3RMBA 1T03A 1GOCA 3P1GA 2Z1HA 1BQNA 4PY5A 4FM0A 3L3VA 3VQQA 1KSPA 1TL1A 4ELVA 3I0SA 1JLBA 1N6QA 3SQ4A 2F8SA 3NGZA 3TAPA 1NK4A 3OJSA 2G8VA 2P5GA 1L3TA 4CJ5A 2XRIA 5C24A 4OLBA 4CEOA 4DQRA 2XY8A 4FJ5A 1ASWA 1FKPA 1RBUA 1WSJA 1RILA 3O4QA 1IKWA 3ZSYA 4C8LA 3AVAA 3DRPA 3MEEA 5SWMA 4IG3A 1RDCA 2D5RA 3C6UA 3ZT2A 3F73A 4FZXC 1T7PA 4N47A 3NAEA 4DQQA 3P83D 4IFYA 4DTMA 4FJLA 3JSMA 4Z0UA 3VQAA 3HK2A 4AHTA 3KD5E 3ALYA 3AVGA 4DU1A 3BGRA 2G8HA 3CFPA 2YV0X 3G10A 4PQUA 3C95A 1WSIA 3QINA 1TAUA 4IG0A 4CJQA 4FJXA 4CF9A 3L2RA 4DLEA 3LP1A 1TV6A 3DM2A 4F2SA 3L8BA 4KPYA 1RTIA 1C1AA 4JS4A 1S5JA 1BCMA 4FM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJK A;  1Y97 A;  5CYM A;  3HYF A;  3TWH A;  4N76 A;  4KI6 A;  1GOB A;  3NFA A;  3V6D A;  4F3O A;  5JS1 A;  3RTV A;  1ZBH A;  1KVA A;  4HCB A;  5HRS A;  1J9A A;  1JLA A;  4CER A;  2WOM A;  3TI0 A;  3ZT1 A;  3RRG A;  1IKY A;  4QCL A;  4EZ9 A;  4ICL A;  1LWF A;  5KTQ A;  1WAF A;  1XHZ A;  3ULD A;  1W9H A;  1EXQ A;  1C1C A;  3QLH A;  3V4I A;  2F96 A;  5CYQ A;  4LH4 A;  4N5S A;  1XC9 A;  5CZ1 A;  4OGC A;  5E41 A;  3OYC A;  4OVL A;  2HHQ A;  2FBV A;  3K5M A;  3SQ0 A;  4CEC A;  5HRO A;  3AO4 A;  4F4K A;  3LAL A;  3B6P A;  4CEF A;  1RT4 A;  1BIZ A;  4B8C A;  4H4O A;  4E7J A;  1SKW A;  1WSE A;  3DLK A;  3NCI A;  4F8R A;  1QQC A;  3H08 A;  1IKV A;  3KLH A;  4DTS A;  4PUO A;  5HRN A;  3OYK A;  1LWE A;  3OYF A;  2IDO A;  2O4I A;  1QSL A;  2XY7 A;  2DFH A;  1BIS A;  4OPK A;  4BDY A;  1TKZ A;  2FBT A;  3EZ5 A;  2DFF A;  3ZCM A;  5T7B A;  3KLG A;  3K5O A;  3AO5 A;  3ZT3 A;  2E6M A;  3VA0 A;  4O5B A;  1X9M A;  1JLF A;  2B4J A;  1SL0 A;  4FJ8 A;  3LPU A;  5CY4 A;  4DMN A;  3SUN A;  3WNE A;  1HPZ A;  2Y1I A;  3SYZ A;  4B9V A;  4DTJ A;  2B6A A;  1S6P A;  3TAR A;  4KHU A;  4I7F A;  2IS3 A;  3TAG A;  2KZZ A;  4FJG A;  2RKI A;  4EZ6 A;  2D0B A;  2IC3 A;  4M3X A;  4KHY A;  3UIQ A;  4DSJ A;  3OY9 A;  4GMJ B;  4FLU A;  1NJZ A;  1TVR A;  3DLE A;  1LAW A;  2ATQ A;  4YFU A;  2EX3 A;  2O4G A;  2D0A A;  3RR8 A;  4F3T A;  4DTR A;  1NKC A;  3NE6 A;  3V1O A;  1VSI A;  4W5O A;  1YTA A;  3VQC A;  4K8Z A;  4CJ3 A;  4AH9 A;  4HUF A;  3QEI A;  3NH0 A;  2ZQB A;  3SUQ A;  1NK9 A;  3F9K A;  4PWD A;  1I39 A;  3RR7 A;  4DS4 A;  4PA1 A;  3O3F A;  3DYA A;  4CED A;  3AA3 A;  4LH5 A;  4FJH A;  3AVK A;  3VQ6 A;  2HVI A;  4B9M A;  1RT7 A;  4CIG A;  4OJR A;  3L2U A;  4DLG A;  2ITG A;  5KGW A;  4I9L A;  4O0J A;  4C8O A;  2QKB A;  1Q9Y A;  3SQ1 A;  3ZSZ A;  3VQ7 A;  2YNH A;  3C94 A;  3HPH A;  3LAM A;  1JLG A;  2G8U A;  3NF8 A;  1LW0 A;  5K14 A;  1QSY A;  1U04 A;  4CFA A;  1QHT A;  1B9F A;  1NOY A;  1GOA A;  1U4B A;  4FJ9 A;  3RMA A;  2YNG A;  3HST B;  4CF8 A;  2BAN A;  1RBT A;  4HHT A;  3SI6 A;  1NK7 A;  1YTU A;  4CGF A;  4Y1D A;  4CJT A;  3I0R A;  3LWM A;  4E1M A;  4CJW A;  3G0Z A;  4W5T A;  3AVL A;  1C0T A;  4CK1 A;  4DG1 A;  1RBV A;  4QAG A;  3TAF A;  3S9H A;  3DLG A;  4ZHR A;  4DTN A;  1ASV A;  3E01 A;  1RT1 A;  4E1N A;  4HCC A;  4E19 A;  3RMC A;  5FRN A;  2X74 A;  4CEB A;  4KTQ A;  4C8K A;  1BGX T;  1UWB A;  1FK9 A;  4LD0 A;  3CQ8 A;  4G1Q A;  5DMR A;  3K59 A;  1TK8 A;  3JYT A;  3HT3 A;  3ZSV A;  4JS5 A;  3AVF A;  4NYF A;  2GBZ A;  3VQE A;  3V9X A;  2HHX A;  4HUG A;  1NK8 A;  3CG7 A;  1NKB A;  2BGG A;  4AHU A;  4M42 A;  3ISN C;  3IS9 A;  3OJU A;  1D5A A;  4DS5 A;  3SUO A;  3QIP A;  1R0A A;  1SKS A;  4AHS A;  2GUI A;  4CFC A;  1U49 A;  3C6T A;  4DTX A;  4FLV A;  2JGU A;  4CGG A;  1ZBF A;  3DRS A;  3WNG A;  2XO7 A;  1S1W A;  4J2A A;  4CJ4 A;  4XIU A;  3TAN A;  2OPP A;  3NGY A;  3O3H A;  2NUB A;  3D0P A;  4KFB A;  3OYA A;  1EKE A;  4CHN A;  2X6N A;  3OYM A;  3V9U A;  4M3U A;  1FXX A;  1VSH A;  1TK5 A;  4B9L A;  4J2D A;  4FYD A;  3PY8 A;  3KLF A;  4JRQ A;  4FJM A;  2P1J A;  3M8S A;  4FK2 A;  1RBS A;  1C0M A;  3VQ8 A;  1ITG A;  1G15 A;  4CFB A;  4O55 A;  1J54 A;  1C1B A;  2VG6 A;  2Z1I A;  1JLQ A;  1KFS A;  1YVU A;  4LSN A;  3VN5 A;  4E7H A;  3L2W A;  3KLE A;  3NH2 A;  1BI4 A;  1HRH A;  3QES A;  3HM9 A;  1EET A;  2KFZ A;  1KCF A;  3VQ4 A;  3ZSR A;  3HP9 A;  4OPJ A;  3K58 A;  4DFP A;  4HVJ A;  2RF2 A;  1L3V A;  2A1S A;  4KHQ A;  3S3N A;  4CFD A;  2P5O A;  2YKM A;  1Q9X A;  1RTH A;  1NJW A;  4RW6 A;  1RT3 A;  4CEA A;  1BQM A;  2HHV A;  3KJV A;  3LZI A;  1L3U A;  4B9N A;  3BDP A;  5I42 A;  4FK0 A;  3MAQ A;  1J53 A;  4FW1 A;  3VQP A;  4W5N A;  1KRP A;  4FLY A;  4I2P A;  1KLM A;  4AHC A;  1I3A A;  4M3Y A;  1L5U A;  3QEX A;  1VSL A;  1VRT A;  3U3G A;  3AA2 A;  4YNQ A;  1NJX A;  2HVH A;  3SPY A;  2HW3 A;  2OZS A;  3NGI A;  1L3S A;  4Z4I A;  1BHL A;  2F8T A;  2W42 A;  4DF8 A;  4FJJ A;  1CZ9 A;  5CZ2 A;  3U6F A;  4KAZ A;  4FJN A;  1CLQ A;  3LP0 A;  3V9S A;  4C8M A;  2EHG A;  2LSN A;  2IAJ A;  4DSE A;  3DLH A;  5J2M A;  1HNI A;  3SV4 A;  4LSL A;  4KHS A;  4LY7 A;  4CGD A;  5FRO A;  1SL2 A;  1RDA A;  2YKN A;  5KI6 A;  2PYJ A;  4B9U A;  4O4G A;  1S1V A;  2VWK A;  4KTZ A;  2HMI A;  5HLF A;  4FZY A;  1JL1 A;  3AVI A;  4DTP A;  4L8R B;  1O1W A;  4B9S A;  1ZYQ A;  4IFV A;  3WNH A;  4CHO A;  3OYN A;  3U3Y A;  3TAQ A;  3T19 A;  3K2P A;  2E4L A;  1SUQ A;  4FVM A;  4CJS A;  4CJP A;  2VWJ A;  4JRP A;  5J2Q A;  2PYL A;  4N41 A;  1S9E A;  3LDS A;  3QEW A;  3CM5 A;  4DSI A;  1RCH A;  2RPI A;  4CJR A;  1TKD A;  3MEG A;  5SZT A;  2RN2 A;  3LAN A;  4OLA A;  3AO1 A;  3AO3 A;  1S9G A;  1FKO A;  1LW2 A;  3AVJ A;  3MEC A;  4RW8 A;  4CHY A;  4CJL A;  2HNZ A;  4DU4 A;  1D9D A;  5KGX A;  1LV5 A;  2JLE A;  2OPR A;  3CFO A;  4CES A;  1Z25 A;  1LWC A;  5KRT A;  5EU7 A;  2PY5 A;  3QNO A;  1F21 A;  3ZSW A;  3TAB A;  4DTU A;  4IKF A;  1WSF A;  2OPQ A;  2X78 A;  3CFR A;  3HPG A;  3AVC A;  1WAJ A;  2FBX A;  4DF4 A;  4DFK A;  3QET A;  4Y1C A;  3SZ2 A;  1NK6 A;  3CYM A;  4M3Z A;  3V1Q A;  4BDZ A;  2XHB A;  3K57 A;  4KI4 A;  5JS2 A;  1VSK A;  3VQ9 A;  3OS2 A;  3MED A;  4M3T A;  2IOC A;  1A5X A;  1B92 A;  3LAK A;  4W5R A;  3I8D A;  4OKE A;  3DMJ A;  3ZT4 A;  1TK0 A;  4Q5V A;  2HHU A;  1RDB A;  1BI4 B;  2WON A;  1VRU A;  4M41 A;  4RW4 A;  4ID1 A;  3RRH A;  1UA0 A;  1IH7 A;  1UOC A;  4B08 A;  4AHR A;  3IAY A;  2QK9 A;  2G8F A;  1LAV A;  1VSE A;  3DI6 A;  3V9Z A;  1SL1 A;  4ZTF A;  3T1A A;  4KV8 A;  3OS0 A;  3OVN A;  3RMD A;  3KTQ A;  4FJI A;  3THV A;  4QOZ B;  1RTJ A;  2YHB A;  4MQ3 A;  4CJE A;  1QSS A;  5HBM A;  1D8Y A;  4E7I A;  2D0C A;  1TKT A;  4ELU A;  3M8P A;  2OYQ A;  4FZZ A;  2G8I A;  1C0U A;  3PX0 A;  1N5Y A;  2DTU A;  3NF9 A;  4UQG A;  3TAE A;  4Z4C A;  4CK3 A;  2VG7 A;  4DQI A;  1S1T A;  3HL8 A;  3V81 A;  3KKR A;  4FJ7 A;  4KHW A;  3PO5 A;  4GW6 A;  3L2V A;  1HYV A;  1EP4 A;  3HPO A;  1QE1 A;  3AO2 A;  4CIF A;  4B8A B;  4BWJ A;  1IG9 A;  3KKS A;  3LPT A;  3CM6 A;  4FLW A;  1HJR A;  5HRP A;  3V1R A;  3HO1 A;  4CF1 A;  3VQ5 A;  4FJK A;  2I5J A;  1CZB A;  3V9W A;  1T05 A;  4MFB A;  4CEQ A;  2KW4 A;  3NH1 A;  1WSG A;  1RDD A;  3TR8 A;  4CHP A;  4EP5 A;  3S3O A;  4CE9 A;  3OYI A;  4CJU A;  3DRR A;  1S1X A;  2DFE A;  3AVN A;  4WE1 A;  3VQD A;  2ETJ A;  4W5Q A;  4Z4H A;  4NYN A;  4C8N A;  3M8R A;  4CGJ A;  3OYL A;  3HP6 A;  3OYH A;  4DSL A;  3NDK A;  2Q3S A;  1D9F A;  1WNS A;  2BDP A;  1JLC A;  1UA1 A;  4Z4G A;  2HHS A;  4OGE A;  4NCG A;  1X9S A;  5D3G A;  2IGI A;  2FBY A;  2AJQ A;  1KVB A;  4IBN A;  5J1E A;  2KQ2 A;  1HYS A;  2E6L A;  3AVH A;  4FLZ A;  3EY1 A;  4IDK A;  1HMV A;  1CXQ A;  1VSF A;  4CCH A;  1VSD A;  4GVM A;  4M45 A;  1RT2 A;  1IO2 A;  5FRM A;  4FXD A;  4N56 A;  1KVC A;  3AA4 A;  3O3G A;  3AVB A;  3OYE A;  4DTO A;  3DOL A;  4CEZ A;  1K6Y A;  4B3O A;  3ZSQ A;  2BE2 A;  3MXI A;  2ZE2 A;  2YNI A;  3PX4 A;  4KO0 A;  3LWL A;  4BE0 A;  3QNN A;  1HQU A;  4M3W A;  1ASU A;  5J2N A;  1IKX A;  5C42 A;  1RT5 A;  1YT3 A;  3QEP A;  4DQP A;  2HB5 A;  3P5J A;  1TAQ A;  3KK3 A;  1TL3 A;  3LP3 A;  4EP4 A;  3NHG A;  1T8E A;  3KLI A;  1A5V A;  3EYZ A;  2HNY A;  4AHV A;  3SQ2 A;  3HVT A;  5J2P A;  4E7K A;  3K5L A;  2G8W A;  4DSK A;  2KFN A;  1TGO A;  3KIO A;  2XY5 A;  3ITH A;  1BIU A;  1TKX A;  1EX4 A;  2ZD1 A;  1WN7 A;  2KTQ A;  3O4N A;  3SPZ A;  1Q8I A;  4FLX A;  3PV8 A;  2FC0 A;  1XHX A;  1KLN A;  1U48 A;  4I9Q A;  1HYZ A;  1RT6 A;  5DK5 A;  3WNF A;  1C6V A;  3OYJ A;  4FLT A;  1QTM A;  2G8K A;  4DWI A;  1JL2 A;  1J5O A;  4CF0 A;  3AA5 X;  3NBP A;  3B6O A;  4F2R A;  1S1U A;  1QS4 A;  1VSJ A;  2X6S A;  4BWM A;  3MXJ A;  2HND A;  3OYD A;  5I3U A;  4J2B A;  3SCX A;  1NOZ A;  1A5W A;  2PZS A;  4E3S A;  3QER A;  3OS1 A;  3L2Q A;  4JLH A;  4BE1 A;  4CHQ A;  3SJJ A;  4CHZ A;  4E89 A;  4DFJ A;  3DLB A;  4HTU A;  1ZBI A;  3SNN A;  3DLR A;  1BL3 A;  4M3R A;  3L3U A;  3LP2 A;  1JKH A;  3NF6 A;  1CXU A;  4CJF A;  1VK0 A;  2YHA A;  4CGH A;  1RNH A;  3S3M A;  4KTW A;  2YNF A;  1XWL A;  1Z26 A;  3M8Q A;  3VA3 A;  1VSM A;  1REV A;  3IG1 A;  4FM2 A;  3QO9 A;  2XY6 A;  2HHT A;  1X1P A;  1NK0 A;  4I2Q A;  3VQB A;  1HNV A;  4K8X A;  3KK1 A;  4CEE A;  4AIL C;  4ELT A;  4O44 A;  1NKE A;  2Z1G A;  4DSF A;  3TAM A;  1DLO A;  3NF7 A;  1RBR A;  5KRS A;  3SUP A;  1RTD A;  4OKK A;  1WLJ A;  4CIE A;  1W0H A;  2DY4 A;  4NCA A;  3DOK A;  1KTQ A;  1UAX A;  3ZSX A;  2A1R A;  4E0D A;  1SV5 A;  2GV9 A;  5HRR A;  4CGI A;  4R5P A;  4J2E A;  4FCY A;  4O0I A;  2QKK A;  4Q0B A;  2QXF A;  3HXM A;  4BAC A;  3D45 A;  5HP1 A;  4RW7 A;  4H4M A;  4KRF A;  4Z4E A;  1NJY A;  3OYG A;  3T3F A;  1ZBL A;  3LZJ A;  4DQS A;  4NCB A;  1WSH A;  3PUF A;  3HJF A;  1KFD A;  4OKJ A;  4CJV A;  3PX6 A;  1JLE A;  4ZTJ A;  3K5N A;  4FK4 A;  3ZSO A;  3KK2 A;  1SKR A;  2Z1J A;  4E7L A;  2OPS A;  3MXM A;  2B5J A;  1B9D A;  3QEV A;  4KRE A;  5FDL A;  3KD1 E;  4CK2 A;  1BCO A;  2Y1J A;  3PO4 A;  1JXE A;  1X9W A;  2HHW A;  3OYB A;  1MU2 A;  4DFM A;  4BDP A;  3QIO A;  1JXB A;  3AVM A;  2P51 A;  1XI1 A;  4TSX A;  4KHN A;  2KZM A;  4HUE A;  1S6Q A;  2VG5 A;  2OZM A;  3RWU A;  1DTQ A;  3AV9 A;  4FW2 A;  4H8K A;  5C25 A;  1ZBU A;  4DU3 A;  3A2F A;  4B9T A;  3IRX A;  2R7Y A;  4RG8 A;  2OA8 A;  1HQE A;  3ZT0 A;  1DTT A;  1U47 A;  4Z4F A;  4KB0 A;  4RW9 A;  3ASM A;  3HVR A;  4BE2 A;  3SV3 A;  3FFI A;  1NK5 A;  4KKO A;  4CF2 A;  4ID5 A;  1U45 A;  4KB1 A;  3RMB A;  1T03 A;  1GOC A;  3P1G A;  2Z1H A;  1BQN A;  4PY5 A;  4FM0 A;  3L3V A;  3VQQ A;  1KSP A;  1TL1 A;  4ELV A;  3I0S A;  1JLB A;  1N6Q A;  3SQ4 A;  2F8S A;  3NGZ A;  3TAP A;  1NK4 A;  3OJS A;  2G8V A;  2P5G A;  1L3T A;  4CJ5 A;  2XRI A;  5C24 A;  4OLB A;  4CEO A;  4DQR A;  2XY8 A;  4FJ5 A;  1ASW A;  1FKP A;  1RBU A;  1WSJ A;  1RIL A;  3O4Q A;  1IKW A;  3ZSY A;  4C8L A;  3AVA A;  3DRP A;  3MEE A;  5SWM A;  4IG3 A;  1RDC A;  2D5R A;  3C6U A;  3ZT2 A;  3F73 A;  4FZX C;  1T7P A;  4N47 A;  3NAE A;  4DQQ A;  3P83 D;  4IFY A;  4DTM A;  4FJL A;  3JSM A;  4Z0U A;  3VQA A;  3HK2 A;  4AHT A;  3KD5 E;  3ALY A;  3AVG A;  4DU1 A;  3BGR A;  2G8H A;  3CFP A;  2YV0 X;  3G10 A;  4PQU A;  3C95 A;  1WSI A;  3QIN A;  1TAU A;  4IG0 A;  4CJQ A;  4FJX A;  4CF9 A;  3L2R A;  4DLE A;  3LP1 A;  1TV6 A;  3DM2 A;  4F2S A;  3L8B A;  4KPY A;  1RTI A;  1C1A A;  4JS4 A;  1S5J A;  1BCM A;  4FM1 A; 
#chains in the Genus database with same CATH topology
 4KI6 A;  3RTV A;  3C7N B;  3TI0 A;  2A40 A;  3AAR A;  4EZ9 A;  4ICL A;  4O8K A;  5KTQ A;  3VF4 A;  1WAF A;  5GIO A;  3TPQ A;  1C1C A;  3FZM A;  2F96 A;  4AM7 A;  4LH4 A;  1N36 K;  3G4S N;  5CZ1 A;  2UUA K;  5E41 A;  2GTD A;  4F4K A;  3JAM O;  1SKW A;  3DLK A;  3NCI A;  4BVP A;  1LOT B;  4IO8 A;  1QQC A;  1IKV A;  4DTS A;  3L6Q A;  3T1Y K;  4L3Q A;  4BRF A;  4AM6 A;  2XY7 A;  3IFR A;  3GE1 A;  4OPK A;  1TKZ A;  3A8Y A;  2ZF5 O;  3KLG A;  3K5O A;  1Z6R A;  3LPU A;  2Q2R A;  4DMN A;  5C0Y A;  3WNE A;  2UXD K;  4JHD B;  2Y1I A;  4DTJ A;  1YF5 L;  3TAR A;  4KHU A;  2KZZ A;  1WBB A;  2D0B A;  2HST A;  4DSJ A;  2D1K A;  4FLU A;  2P9K A;  3DLE A;  4YFU A;  1ESV A;  2EX3 A;  2Q31 A;  2D0A A;  2P9U A;  2A42 A;  4WCE L;  3HRG A;  4CI6 A;  1O13 A;  1XQS C;  1VSI A;  3CC7 N;  2AA4 A;  4AH9 A;  1S72 N;  3MN7 A;  3SAG A;  3NH0 A;  1N34 K;  2ZQB A;  4DS4 A;  4CED A;  1SAZ A;  3AA3 A;  3H1V X;  3MCA B;  3AVK A;  4FPB A;  4B9M A;  1TYQ A;  1RT7 A;  3L2U A;  4DLG A;  4O0J A;  1Q9Y A;  4JI8 K;  3FR0 A;  4JI1 K;  3HST B;  2HF4 A;  3VGK A;  4CGF A;  4CJT A;  4K41 A;  4BRN A;  2F9T A;  4F9O A;  2OCE A;  3WEE A;  5E26 A;  4CK1 A;  1RBV A;  3S9H A;  1ASV A;  4E19 A;  5KQD A;  5DM6 L;  4Y0W A;  3EKS A;  4H0P A;  4I6M B;  1NU0 A;  3JYT A;  1TK8 A;  4JS5 A;  3AVF A;  2GBZ A;  2HHX A;  1T6D A;  3ISN C;  4CZJ A;  1D5A A;  4DS5 A;  1VQP N;  1YIJ N;  4CFC A;  3C6T A;  2O8E A;  4M7X A;  2E1Y A;  2FSN A;  2XO7 A;  4LF9 K;  1HNW K;  4XIU A;  4CHN A;  4M3U A;  4RWT A;  5M1F A;  4WQ5 C;  4JRQ A;  3ZET A;  1M90 O;  2P1J A;  1C0M A;  4BRP A;  4CFB A;  1C1B A;  2Z1I A;  1VQ8 N;  4R79 A;  3KLE A;  3QML A;  3QES A;  3M3Z A;  1EET A;  2KFZ A;  4IDH A;  3VQ4 A;  4GY2 B;  3HP9 A;  3AGK A;  3ZX0 A;  1Q9X A;  4RW6 A;  2HHV A;  5IT9 O;  3LZI A;  4B9N A;  5I42 A;  1EO1 A;  4FW1 A;  4FWP A;  2O8C B;  1KRP A;  1Q82 O;  4WFA L;  4M3Y A;  1VSL A;  3AA2 A;  3SPY A;  2OZS A;  3WEE B;  1GLA G;  3BZC A;  2W42 A;  4KAZ A;  3QIC A;  4KHS A;  1RDA A;  2YKN A;  5KI6 A;  2VWK A;  3VMF B;  2HMI A;  3K9K A;  1JL1 A;  5AZI B;  4DUY K;  3CJ9 A;  4IFV A;  3P31 A;  4CHO A;  3U3Y A;  3R1X A;  3TAQ A;  4CZK A;  4CJP A;  2E4L A;  4GVE A;  4JRP A;  2F9W A;  3LDS A;  3QEW A;  4BG9 A;  2RN2 A;  1NGD A;  3M1F A;  3AO3 A;  3MEC A;  4RW8 A;  3AVJ A;  4CHY A;  3D7E O;  3C0B A;  1FJG K;  3WQU A;  2JLE A;  4K0K K;  4CES A;  4PKI A;  3ZSW A;  3QFP A;  3EZW A;  1WSF A;  4DF4 A;  3AVC A;  1WAJ A;  5AQL A;  2ZJQ L;  3CYM A;  3ZET B;  4BDZ A;  3VGL A;  1VSK A;  3VQ9 A;  4BRL A;  2UXB K;  1ATR A;  4M3T A;  2IOC A;  1A5X A;  2D0P A;  4U67 L;  4GNI A;  3QB0 A;  2QWR A;  4RW4 A;  4ID1 A;  1UA0 A;  1IH7 A;  4B08 A;  2GUP A;  3IAY A;  2UXC K;  4X65 K;  3DI6 A;  2G8F A;  3V9Z A;  1VQ9 N;  3QBX A;  3T1A A;  3KTQ A;  3CC4 N;  4FJI A;  1OH7 A;  3THV A;  1RTJ A;  4CJE A;  4ELU A;  4FZZ A;  2G8I A;  1C0U A;  4LF5 K;  1N5Y A;  4B3S K;  5AQT A;  3NF9 A;  2QWL A;  3LDN A;  1C0F A;  4DQI A;  4GW6 A;  5AQJ A;  3L2V A;  1W2B M;  4BRM A;  3KKS A;  5C12 A;  4FLW A;  1HJR A;  5HRP A;  3V1R A;  3HO1 A;  4CF1 A;  1HKG A;  1CZB A;  4MFB A;  5BRH A;  5AZJ A;  4CE9 A;  5CHI A;  1P90 A;  1S1X A;  2DFE A;  4JKB A;  3VQD A;  2ETJ A;  4BR7 A;  4C8N A;  4BRO A;  3HP6 A;  5BN8 A;  4DSL A;  3NDK A;  1D9F A;  4GKJ K;  4BRK A;  5D3G A;  4BRE A;  1WUA A;  3U8X A;  3KZB A;  5J1E A;  3CCS N;  2NNW A;  1EWR A;  3WXK A;  3EY1 A;  1W97 L;  1CXQ A;  4CVN E;  3O9U A;  3G6E N;  1KVC A;  3AA4 A;  4B9Q A;  1DT9 A;  1T3V A;  3O3G A;  1K6Y A;  3ZSQ A;  2BE2 A;  3O1B A;  2YX6 A;  4KO0 A;  3Q7C A;  4BE0 A;  1KC8 O;  4M3W A;  1ASU A;  1RT5 A;  1TAQ A;  3TSQ A;  3LP3 A;  3NHG A;  1X9J A;  3KLI A;  3EYZ A;  2HNY A;  3K5L A;  1KXP A;  4DSK A;  2NZT A;  5FPM A;  5LMN K;  3ITH A;  1BIU A;  2KTQ A;  1U2V B;  4ILG B;  3VGM A;  1WOQ A;  4FLX A;  1U48 A;  1RT6 A;  3WNF A;  4OPA A;  3LM9 A;  1JL2 A;  1J5O A;  3T7Z A;  1SS6 A;  3CET A;  3PLA A;  3SCX A;  3WXI A;  3L2Q A;  5BR8 K;  4CHQ A;  4JI7 K;  3K0S A;  1HPM A;  4C23 A;  1XMQ K;  2QWO A;  3HOS A;  1BL3 A;  4M3R A;  3L3U A;  3LP2 A;  5TKW A;  1JKH A;  5AZJ B;  4LF4 K;  4CJF A;  5AQI A;  2YHX A;  4H0V B;  4A62 A;  3S3M A;  4KTW A;  1VSM A;  4FM2 A;  2XY6 A;  1NK0 A;  5KQ8 A;  3VQB A;  4DR3 K;  4DR4 K;  4CEE A;  3OTO K;  4ISE A;  1NKE A;  3EN9 A;  4B1Y B;  2Z1G A;  2O8B A;  4DSF A;  2HOE A;  1DLO A;  2IVN A;  1RBR A;  3CJC A;  4UY8 O;  1NGE A;  2GV9 A;  3BP8 A;  2QXF A;  4BAC A;  4RW7 A;  3A5L C;  1NJY A;  2GEL A;  3HJF A;  4A61 A;  4ZTJ A;  5IWA K;  3SLC A;  4A2A A;  2Q97 A;  4CK2 A;  1BCO A;  2Y1J A;  4DV5 K;  1JXE A;  2E2P A;  4CZI A;  3RSE A;  4BRG A;  2P51 A;  3SAF A;  4TSX A;  2KZM A;  1S6Q A;  3RWU A;  1DTQ A;  3VER A;  1GLF O;  4C1N I;  4DU3 A;  4JD2 A;  1DTT A;  2CH6 A;  4RW9 A;  5C2F A;  3SV3 A;  4BE2 A;  4KKO A;  4KB1 A;  3RMB A;  4X62 K;  4EAH D;  3L3V A;  4FVU A;  1TL1 A;  1JLB A;  2F8S A;  3PSI A;  3TAP A;  4CJ5 A;  1BWF O;  3VEX A;  4WYB A;  4IEE A;  1FKP A;  1RIL A;  4C8L A;  3DRP A;  2Q0R A;  3TU5 A;  4DQQ A;  3CCU N;  3HBT A;  3AVG A;  4DU1 A;  2Q1N A;  3O1W A;  3L2R A;  4DLE A;  2A6A A;  3LP1 A;  2ZWH A;  1W7A A;  1XC3 A;  1C1A A;  3G71 N;  4IZ9 A;  3CCL N;  1T44 A;  1Y97 A;  3HYF A;  5CYM A;  1GOB A;  5JS1 A;  3V6D A;  4F3O A;  1GLD G;  1ZBH A;  4HCB A;  5HRS A;  1J9A A;  1JLA A;  1QVF M;  2WOM A;  3ZT1 A;  1IKY A;  2JWK A;  3QLH A;  3SK3 A;  3V4I A;  2NRV A;  4BGA A;  3Q7B A;  5MLC Q;  4FWK A;  3SAH A;  4OGC A;  3N4Q A;  4BRC A;  2FBV A;  3K5M A;  3SQ0 A;  1JCF A;  4BC4 A;  3AO4 A;  3RSE B;  3OW2 M;  3LAL A;  1RT4 A;  1BIZ A;  2WBN A;  5M1P A;  3F2K A;  1WSE A;  1VQN N;  3FZK A;  2ASM A;  4BC3 A;  1NGJ A;  4MDA A;  3OYF A;  2IDO A;  4JD2 B;  4BRD A;  2DFH A;  1BIS A;  4NLB A;  4BDY A;  4B1Z A;  4H5W A;  5AQX A;  3ZLJ A;  5T7B A;  3DLL L;  3AO5 A;  3ZT3 A;  1X9M A;  1SL0 A;  5AR0 A;  2B6A A;  1S6P A;  4I7F A;  4FJG A;  4M3X A;  3GBT A;  3UIQ A;  3J81 O;  3O6W A;  5I9E B;  1NJZ A;  4DV7 K;  1LAW A;  1Y64 A;  2BTF A;  2Q36 A;  1NLV A;  4QS7 A;  3NE6 A;  1YTA A;  3VQC A;  4HUF A;  3DWL A;  3QEI A;  2FSK A;  3O08 A;  1NK9 A;  4PWD A;  4DB3 A;  3O3F A;  4FJH A;  2A5X A;  3VQ6 A;  3FZL A;  2ITG A;  5KGW A;  1N32 K;  3L0Q A;  2QKB A;  4IOC L;  4YY3 K;  2YNH A;  3C94 A;  2G8U A;  1LW0 A;  3C6A A;  4HWI A;  1QSY A;  4CFA A;  3A5O C;  4PL7 A;  1YTU A;  3SI6 A;  3I0R A;  5KPR A;  3LWM A;  3G0Z A;  3G25 A;  4O5F A;  2ASP A;  4QAG A;  3DLG A;  5HOO A;  2VQE K;  3E01 A;  1NG9 A;  1RT1 A;  3QDK A;  4DUZ K;  4KTQ A;  4C8K A;  1KAY A;  1UWB A;  1FK9 A;  5DMR A;  4JKF A;  1DKG D;  1V4S A;  3GDQ A;  2QEX N;  3ATV A;  3VQE A;  2E20 A;  2P9P A;  3VEY A;  1NKB A;  3SUO A;  4BR5 A;  5B8H A;  1R0A A;  1TUY A;  1SKS A;  2O8D A;  3MX5 A;  4CGG A;  3CHW A;  1S1W A;  5DM7 L;  5GAD P;  2OPP A;  2I7P A;  3OYA A;  4IOA L;  1FXX A;  1HKB A;  3FZF A;  1RBS A;  1ITG A;  3E9P A;  2VG6 A;  3VOV A;  1YVU A;  1HRH A;  3SBT A;  4DFP A;  2FXU A;  1XNR K;  2CGL A;  2RF2 A;  1L3V A;  4KHQ A;  1RTH A;  3IMX A;  2HBM A;  3BDP A;  4FK0 A;  1J53 A;  3VQP A;  4I6M A;  4AHC A;  3U3G A;  4YNQ A;  1NJX A;  4BR4 A;  2HW3 A;  3NGI A;  2NRW A;  3GL1 A;  4DV0 K;  1CZ9 A;  5CZ2 A;  4FJJ A;  3CME N;  1QQO A;  4DSE A;  1YUW A;  4FO0 A;  1ATN A;  3SV4 A;  4LSL A;  4LY7 A;  1SL2 A;  5FRO A;  1IV0 A;  4LF8 K;  3AY9 A;  3DXK A;  1S1V A;  4FZY A;  2GWJ A;  4JKC A;  4BQL A;  4OO1 J;  2P9P B;  2VWB A;  3OYN A;  3NVK A;  4CJS A;  3K2P A;  4FVM A;  5J2Q A;  2PYL A;  1BUP A;  4B3M K;  2FF6 A;  4DSI A;  1RCH A;  2RPI A;  5LL6 Z;  4OLA A;  3WXL A;  5SZT A;  3LAN A;  2O8D B;  3CJ1 A;  4CJL A;  2HNZ A;  3D6R A;  4DCH A;  3M5R A;  3OBY A;  2PY5 A;  3CFO A;  1Z25 A;  4MO4 A;  3EE9 A;  3VEZ A;  4MLE A;  1VQO N;  4M3Z A;  3P38 A;  3MN9 A;  2XHB A;  3A0I X;  4H0Y B;  5JLH A;  2O8C A;  1TK0 A;  4Q5V A;  2HHU A;  1RDB A;  4LFA K;  3BF1 A;  2WON A;  3H3N O;  4YHH K;  4FWS A;  3RRH A;  3SMS A;  1HKC A;  2AP1 A;  3CCR N;  1SL1 A;  2YHW A;  4IO9 L;  5HBM A;  4E7I A;  2D0C A;  1TKT A;  5EX5 A;  2W6K A;  2FSJ A;  1TUU A;  3CPE A;  3O8M A;  4UQG A;  4CW7 B;  4CK3 A;  3H6E A;  2FLO A;  2CGK A;  5AZI A;  1EP4 A;  2HBK A;  4JKG A;  1QE1 A;  4B8A B;  5FPD A;  3IKM A;  5AQQ A;  1QHA A;  1K8K A;  4FJK A;  2I5J A;  4PL8 A;  1T05 A;  4CEQ A;  2KW4 A;  3NH1 A;  1WSG A;  5AFU H;  3TR8 A;  4CHP A;  1VQ4 N;  4CJU A;  3DRR A;  3AVN A;  2YJF A;  3DXK B;  4W5Q A;  4Z4H A;  4NYN A;  3M8R A;  4CGJ A;  3OYL A;  3OYH A;  2BDP A;  1WNS A;  1UA1 A;  4GV6 A;  3I55 N;  4IBN A;  2KLA A;  4B1X B;  4FLZ A;  4FL9 A;  1VSF A;  5EOY A;  4CCH A;  1VSD A;  2E8A A;  1IO2 A;  4DTO A;  4B3O A;  4EHU A;  3MXI A;  1NGH A;  1VQL N;  3WQT A;  2ZE2 A;  3OHR A;  3QNN A;  3DAW A;  4NLC A;  5C42 A;  1MDU B;  3E9O A;  3CC2 N;  1TL3 A;  4NB4 A;  4CD1 A;  5ADX A;  4BR2 A;  4K42 A;  3SQ2 A;  5J2P A;  4E7K A;  4ILJ A;  2G8W A;  2KFN A;  1TGO A;  2ZD1 A;  1NGB A;  3VTI A;  4WF9 L;  3O4N A;  3SPZ A;  1Q8I A;  1BOT O;  2FC0 A;  1XHX A;  1VQK N;  1KLN A;  4I9Q A;  1HYZ A;  4K25 A;  3SBG A;  4FLT A;  2G8K A;  1ZC6 A;  3H46 O;  3MDQ A;  2E2N A;  5I3U A;  4BY9 C;  4J2B A;  1CZA N;  1A5W A;  4JKG B;  3N4P A;  3QER A;  1VQ6 N;  2ITM A;  5GIP A;  4E89 A;  1K8K B;  4DFJ A;  3DLB A;  3FLC O;  4CBU A;  2EWS A;  4DR5 K;  1XWL A;  1Z26 A;  3VA3 A;  2W6L A;  2FF3 B;  3DJC A;  2HHT A;  3KK1 A;  4ELT A;  3SUP A;  1RTD A;  4OKK A;  4DV1 K;  1WLJ A;  4NCA A;  4E0D A;  1JCG A;  1SV5 A;  5HRR A;  4J2E A;  4FCY A;  4XH5 A;  4H5N A;  3D45 A;  2GWK A;  4Z4E A;  1U2V A;  3OYG A;  1ZBL A;  1WSH A;  2YHY A;  3PUF A;  4OKJ A;  4EIA A;  3PX6 A;  1NMN A;  1JLE A;  4JI3 K;  4E7L A;  2OPS A;  3MXM A;  3QEV A;  3AAQ A;  5FDL A;  3KD1 E;  4FWR A;  4QS9 A;  1NBW A;  3R3L A;  1JXB A;  4C1N K;  1XI1 A;  5AQR A;  4HUE A;  2VG5 A;  4MDB A;  4LC9 B;  2VGM A;  3QBW A;  4B9T A;  1ZBU A;  1V4T A;  3H3O B;  2R7Y A;  4RG8 A;  3TSU A;  3D2F A;  1HQE A;  2YI1 A;  1K73 O;  1VAZ A;  4J8F A;  4ID5 A;  4IOX A;  5KPT A;  1GOC A;  3MK6 A;  1YI2 N;  3VQQ A;  3THY B;  1KSP A;  4YOV A;  4B3R K;  3K9J A;  3SQ4 A;  1EQY A;  1NK4 A;  2P5G A;  1NNE A;  3KHY A;  4OLB A;  4FSV A;  1ASW A;  1RBU A;  3O4Q A;  2E1Z A;  3AVA A;  3C6U A;  4BQZ A;  3TTD A;  1T7P A;  1BG3 A;  3J7Z O;  4IFY A;  4FJL A;  1EWQ A;  2P9N B;  3KD5 E;  2QTD A;  3BGR A;  3CFP A;  2YV0 X;  3KK7 A;  5EXW A;  2QM1 A;  1GLJ O;  4CJQ A;  4DR7 K;  2IVO A;  3L8B A;  2QWN A;  2WC9 A;  3VF2 A;  1S5J A;  1BCM A;  3VEN A;  4FM1 A;  3WXJ A;  4LF7 K;  4CJK A;  5LJW A;  5E84 A;  3RRG A;  1R59 O;  4CER A;  4OPH A;  1XHZ A;  3ULD A;  1EXQ A;  4EFH A;  2QW9 A;  4BVO A;  5CYQ A;  4N5S A;  2HHQ A;  3EL2 A;  5HRO A;  3LDQ A;  4CEF A;  4H4O A;  4F8R A;  1OH5 A;  2NRR A;  3BEX A;  5HRN A;  4PUO A;  3D2F B;  5BR9 A;  1I94 K;  3A5M C;  3E9L A;  3EZ5 A;  2DFF A;  1Q81 O;  3ZCM A;  3VA0 A;  2QXL A;  4O5B A;  2UYT A;  3KVG A;  2HBJ A;  4CZF A;  5F1X A;  3SYZ A;  4B9V A;  2IS3 A;  2E88 A;  4FWO A;  2RKI A;  4EZ6 A;  1NGF A;  4WQ4 A;  4KHY A;  1VQ7 N;  1ILY A;  1TVR A;  2ATQ A;  4IJN A;  3U4L A;  4A2B A;  2O4G A;  3RR8 A;  4DV3 K;  4F3T A;  5BRE A;  2V7Y A;  4CJ3 A;  4ISG A;  4ILH A;  2PBD A;  3F9K A;  3RR7 A;  4PA1 A;  3DYA A;  3E66 A;  2V7Z A;  4LH5 A;  4BC2 A;  5BPL A;  4OJR A;  2HF3 A;  3SQ1 A;  3ZSZ A;  3U9D A;  3LAM A;  1JLG A;  3VET A;  3NF8 A;  5K14 A;  5C15 A;  1U04 A;  1GOA A;  4WFB L;  4CF8 A;  4HHT A;  3RMA A;  1RBT A;  1YIT N;  1NK7 A;  4CJW A;  4DG1 A;  3J80 O;  4YOR A;  4ZHR A;  4B1V A;  2KHO A;  5FRN A;  4CEB A;  4YOY A;  4LD0 A;  3W3D A;  3K59 A;  4KH5 A;  3PIO L;  3ZSV A;  3HT3 A;  4NYF A;  3CD6 N;  3IUC A;  4HUG A;  4RCH A;  4M42 A;  3QIP A;  4FLV A;  3DRS A;  3O4W A;  1E3M A;  3J7A P;  4CJ4 A;  3NGY A;  3O3H A;  2NUB A;  4JV5 K;  3D0P A;  1ZXO A;  4KFB A;  1EKE A;  3V9U A;  1VSH A;  1TK5 A;  4B9L A;  4KHP K;  4J2D A;  4FYD A;  1ATS A;  3PY8 A;  4FJM A;  4CZM A;  2RE2 A;  3M8S A;  4FK2 A;  1RFQ A;  4IFE A;  1YVN A;  4O55 A;  4YOW A;  3FE1 A;  3ID6 A;  1KFS A;  4LSN A;  5FPE A;  3L2W A;  3EKU A;  4KH4 A;  4BGB A;  3ZSR A;  4OPJ A;  3K58 A;  4HVJ A;  1NGA A;  4PKG A;  1VQ5 N;  2A1S A;  1SZ2 A;  3S3N A;  4CFD A;  2P5O A;  2YKM A;  2NRH A;  1NJW A;  4CEA A;  4A59 A;  5M1O A;  3BY5 A;  3MAQ A;  2QWM A;  4I2P A;  1KLM A;  4CJ7 A;  1I3A A;  3QEX A;  2HVH A;  3SJH A;  1L3S A;  1MA9 B;  1BHL A;  4FWL A;  3PIP L;  2VYP A;  4DF8 A;  2F8T A;  5LJV A;  4A5A A;  3V9S A;  4C8M A;  4DV2 K;  3OA9 A;  3WT0 A;  4CGD A;  5LY3 A;  4FOI A;  2PYJ A;  4FWQ A;  3WXM B;  3CCJ N;  5HLF A;  3AVI A;  4DTP A;  4L8R B;  1O1W A;  4B9S A;  3WNH A;  1HJO A;  2GX9 A;  5JMV A;  3T19 A;  1S9E A;  3CM5 A;  4CJR A;  1TKD A;  3MEG A;  4KBO A;  3BF3 A;  2QA4 N;  4DQ8 A;  1MWM A;  1D9D A;  5KGX A;  4JK7 A;  2OPR A;  1LWC A;  5EU7 A;  3HM8 A;  3T69 A;  3QNO A;  1F21 A;  1WBD A;  4IKF A;  2OTJ N;  1QSL A;  2X78 A;  3HPG A;  4DFK A;  3V1Q A;  5CR4 A;  1FW6 A;  3F5T A;  3K57 A;  3OS2 A;  3JS6 A;  3MED A;  3LDL A;  2W41 A;  3LAK A;  3I8D A;  4W5R A;  3DMJ A;  3ZT4 A;  4JI5 K;  3ENH A;  5JLF A;  4M41 A;  1UOC A;  4AHR A;  3THX A;  4U7B A;  2QK9 A;  1LAV A;  4ZTF A;  1D8Y A;  1QSS A;  4ISF A;  1Q18 A;  5CE3 A;  1IBL K;  2OYQ A;  1BDG A;  2Q0U A;  2QWQ A;  4H5T A;  3PX0 A;  3H1Q A;  4NXN K;  3TAE A;  2VG7 A;  4KHW A;  1RDW X;  1IBM K;  3HPO A;  5A2Q O;  2V51 B;  4EHT A;  3LPT A;  2QI2 A;  3L4Q A;  2ZM6 K;  3V9W A;  5M1K A;  4FWM A;  1GLB G;  4EP5 A;  3OYI A;  4CZG A;  1QVG M;  4B1U B;  3CMA N;  4WE1 A;  3VPZ A;  2ZJP L;  2Q3S A;  4Z4G A;  2HHS A;  4OGE A;  3O9R A;  4NCG A;  1X9S A;  3UB5 A;  2IGI A;  1VHX A;  2FBY A;  2AJQ A;  1K9M O;  4QS8 A;  1HNZ K;  4B1W B;  1HYS A;  2E6L A;  3CI5 A;  4IDK A;  1HMV A;  1P8Z A;  4N56 A;  4BRI A;  3OYE A;  3AVB A;  3DOL A;  2E2O A;  1QQM A;  1ZBS A;  3LWL A;  1HQU A;  1IKX A;  3QEP A;  4DQP A;  2HB5 A;  3P5J A;  4MLH A;  5H1S Q;  4EP4 A;  4AHV A;  3THX B;  2XY5 A;  4MO5 A;  1TKX A;  4KH6 A;  2BUP A;  1XMO K;  3PV8 A;  5F2R A;  1QTM A;  3OYJ A;  1C6V A;  3HSC A;  2P9L A;  4CF0 A;  3AA5 X;  4DR1 K;  3B6O A;  4F2R A;  3ENB A;  5GAG P;  1VSJ A;  2X6S A;  4BWM A;  3MXJ A;  1DEJ A;  3TTF A;  5BPM A;  2HND A;  1NOZ A;  2PZS A;  3CF5 L;  3OS1 A;  4BE1 A;  4HTU A;  3DLR A;  4PKH A;  5AQF A;  4JKD A;  3NF6 A;  5FPN A;  1NJI O;  1CXU A;  1VQM N;  1VK0 A;  2WUS A;  3M8Q A;  1REV A;  4BRQ A;  1X1P A;  1XNQ K;  1HNV A;  4K8X A;  4B3T K;  4O44 A;  4WQ4 C;  4YOU A;  3TAM A;  3NF7 A;  4IWV A;  3EEQ A;  4CBX A;  1E4G T;  1UAX A;  3ZSX A;  1D4X A;  4CGI A;  4R5P A;  4Q0B A;  2P9I B;  4JAX A;  4DR6 K;  3U9Z A;  4KRF A;  3NVM A;  2ZJR L;  4NCB A;  1KFD A;  1HLU A;  4CJV A;  1OVQ A;  3K5N A;  3KK2 A;  2Z1J A;  3EO3 A;  2B5J A;  1B9D A;  3ATU A;  3C65 A;  4CBW A;  1X9W A;  3OYB A;  1MU2 A;  4DFM A;  5JVH L;  1Q7Y O;  5EVZ A;  2DPN A;  4KHN A;  2CGJ A;  4Z94 A;  4KRE A;  2OZM A;  4FW2 A;  4H8K A;  5C25 A;  4AF1 A;  3IRX A;  5AQZ A;  4YDU A;  4FPA A;  2P9L B;  3HVR A;  3FFI A;  1NK5 A;  5HL7 L;  4CF2 A;  1U45 A;  3CJA A;  4DHY A;  1T03 A;  5C10 A;  4PY5 A;  3I0S A;  1N6Q A;  3CER A;  1OKJ A;  1L3T A;  5AJ3 K;  3CPW M;  2GEM A;  1X3N A;  1JCE A;  3ZSY A;  3MEE A;  5SWM A;  4X66 K;  1RDC A;  3CJ7 A;  3F73 A;  3NAE A;  5M1N A;  3P83 D;  4H5R A;  1BA1 A;  3JSM A;  3MWT A;  1YJN N;  3CJB A;  3TSP A;  3VQA A;  3HK2 A;  2HMP A;  4PQU A;  2I7N A;  1NGI A;  3C95 A;  2P9K B;  1WSI A;  3QIN A;  4YOT A;  1TAU A;  4FJX A;  2P9U B;  3P39 A;  1TV6 A;  3DM2 A;  4H0X B;  2IIR A;  3CCV N;  2D0O A;  4JS4 A;  1G99 A;  2HBL A;  3CQX A;  3ENO A;  5M1Q A;  3TWH A;  4N76 A;  3NFA A;  2BH1 A;  3ZYY X;  1KVA A;  4QCL A;  1LWF A;  1X3M A;  1W9H A;  3MWP A;  4JNE A;  1TYQ B;  3FFK B;  5AQO A;  1XC9 A;  4H03 B;  5LMU K;  3OYC A;  4XH4 A;  4OVL A;  4BC5 A;  4CEC A;  3GG4 A;  1K8A O;  3B6P A;  2E2Q A;  4B8C A;  4E7J A;  1OH8 A;  3THY A;  3H08 A;  3KLH A;  3CXC M;  3OYK A;  1LWE A;  1Z05 A;  2O4I A;  5AQM A;  1KAZ A;  3ULE A;  2FBT A;  3TTC A;  4BR9 A;  2E6M A;  1JLF A;  2B4J A;  4FJ8 A;  5CY4 A;  2H3G X;  3SUN A;  1HPZ A;  2KKZ A;  2YCH A;  3I8B A;  2ZGY A;  3J8A A;  3TAG A;  2P9N A;  2IC3 A;  1SQK A;  3DXM A;  3OY9 A;  4GMJ B;  3H45 C;  2CH5 A;  5BN9 A;  4DTR A;  1NKC A;  2O8E B;  5AQV A;  4BR0 A;  3V1O A;  4W5O A;  2JWL A;  1LCU A;  4K8Z A;  3ID8 A;  1JJ2 M;  1U6Z A;  3SUQ A;  1I39 A;  4AQY K;  2QWP A;  3D2E A;  3P4I A;  3OBW A;  2WTU A;  2HVI A;  4NXM K;  3MCP A;  4CIG A;  5AQU A;  4I9L A;  4C8O A;  3VQ7 A;  3HPH A;  4K43 A;  3GOI A;  3C6H A;  1QHT A;  1B9F A;  1XUP O;  1NOY A;  1U4B A;  4FJ9 A;  2YNG A;  2BAN A;  4Y1D A;  3EE8 A;  1YHQ N;  4E1M A;  4W5T A;  3AVL A;  1C0T A;  1NGG A;  4H0T B;  3TAF A;  4DTN A;  1YAG A;  3VF6 A;  4E1N A;  2F4V K;  4HCC A;  1H1V A;  3RMC A;  2X74 A;  1BGX T;  4G1Q A;  3O5B A;  5ELZ A;  3V9X A;  1HR0 K;  3R6M A;  1BU6 O;  1NK8 A;  3CG7 A;  2BGG A;  2VQF K;  4AHU A;  4X64 K;  4BRA A;  3IS9 A;  5AQK A;  3ULE B;  3UKR A;  3OJU A;  3THW A;  1J5E K;  2UUC K;  2W40 A;  5AQP A;  4G9Z A;  3HTV A;  4AHS A;  2GUI A;  1U49 A;  4DTX A;  2JGU A;  1ZBF A;  3MN6 A;  3WNG A;  3BZK A;  4J2A A;  5AQS A;  1C0G A;  3TAN A;  4GV9 A;  3OYM A;  2X6N A;  4H5V A;  3DXM B;  3R9P A;  3CCE N;  3KLF A;  5ADX H;  3VQ8 A;  1G15 A;  3RVC A;  1J54 A;  3PSF A;  5KPZ A;  3ZX2 A;  3HZ6 A;  1JLQ A;  4RTF D;  3VN5 A;  4E7H A;  2WFB A;  3NH2 A;  3BUZ B;  1BI4 A;  3HM9 A;  3ZEU A;  1KCF A;  2NRX A;  3D2E B;  5AQN A;  4IJA A;  1RT3 A;  1BQM A;  3KJV A;  1L3U A;  3HI0 A;  4W5N A;  4FLY A;  1RGI A;  1L5U A;  1VRT A;  1N8R O;  5JIC A;  2O8F A;  1HX1 A;  4Z4I A;  1DGK N;  3U6F A;  4A57 A;  4FJN A;  1CLQ A;  3LP0 A;  1BA0 A;  5EY4 A;  2EHG A;  2LSN A;  2IAJ A;  3T1H K;  3DLH A;  5J2M A;  1HNI A;  4BG8 A;  4B9U A;  4O4G A;  4KTZ A;  3CIP A;  4XEI A;  1ZYQ A;  4WFN L;  1Q86 O;  5AQH A;  1SUQ A;  2VWJ A;  4N41 A;  1RDU A;  2ASO A;  4JKE A;  3UKR B;  3THW B;  4JK9 A;  2UUB K;  2ZGZ A;  1T6C A;  2VCP A;  3AO1 A;  1S9G A;  1FKO A;  1LW2 A;  2HHH K;  2J4R A;  4DU4 A;  1LV5 A;  3UKU A;  5GAH P;  4LF6 K;  5KRT A;  3TAB A;  4DTU A;  3FGU A;  3CFR A;  2OPQ A;  1NK6 A;  2FBX A;  4LFB K;  3QET A;  4Y1C A;  3SZ2 A;  4JKA A;  4KI4 A;  4FOE A;  5JS2 A;  4FWN A;  1B92 A;  1GLL O;  4OKE A;  1BI4 B;  3L4I A;  1HNX K;  1VRU A;  3ZEU B;  2D4W A;  1VSE A;  3I56 N;  3MN5 A;  2V52 B;  4KV8 A;  3OVN A;  3I33 A;  3OS0 A;  3RMD A;  4QOZ B;  4MQ3 A;  2YHB A;  3M8P A;  3O9T A;  2DTU A;  3WUH A;  4A5B A;  5GAE P;  4Z4C A;  2E5L K;  1S1T A;  3HL8 A;  3V81 A;  3KKR A;  4FJ7 A;  4JI4 K;  3PO5 A;  2O8F B;  5BPN A;  4LFC K;  1HYV A;  3AO2 A;  4CIF A;  1IG9 A;  4BWJ A;  1HUX A;  3MX2 A;  4DV4 K;  3HOT A;  3CM6 A;  4O8U A;  3VQ5 A;  4YDU C;  5BRF A;  4JYA K;  3KWI A;  4CZL A;  3VTH A;  1RDD A;  3FZH A;  3S3O A;  4H0O A;  4DV6 K;  5TKY A;  1NM1 A;  1JLC A;  4WQ5 A;  3W0L A;  1YJ9 N;  3AAP A;  1QZ6 A;  1KVB A;  2OTL N;  1MWK A;  2KQ2 A;  4JI2 K;  3AVH A;  3LL3 A;  2RHK A;  3UKU B;  1GLE G;  4GVM A;  1NWK A;  4M45 A;  1RT2 A;  5FRM A;  4FXD A;  4CEZ A;  2UU9 K;  1S22 A;  3LM2 A;  4M7Y A;  3O9Q A;  2YNI A;  3PX4 A;  3ZX3 A;  5J2N A;  4IXC A;  2O8B B;  1J6Z A;  1YT3 A;  1IG8 A;  3VES A;  4CZH A;  3KK3 A;  4JEP A;  1BO5 O;  1T8E A;  4YOX A;  2F7T A;  1A5V A;  3O80 A;  1S3X A;  2NRT A;  2P9S A;  3HVT A;  3CCM N;  2OAN A;  3KIO A;  1EX4 A;  1WN7 A;  3O9S A;  3F9M A;  3QFU A;  1IJJ A;  3LDO A;  4V19 S;  5DK5 A;  4DWI A;  2PAV A;  5JVG L;  1WB9 A;  3NBP A;  3B8A X;  2VGN A;  1S1U A;  1NGC A;  1QS4 A;  3OYD A;  3M6G A;  4NO7 A;  4JI0 K;  3IDH A;  3JXU A;  4BRH A;  4E3S A;  4JLH A;  4XH1 A;  3SJJ A;  4GV3 A;  1GLC G;  4CHZ A;  5BRD A;  1KQS M;  3J7Y P;  1ZBI A;  3SNN A;  1OVY A;  2YHA A;  4CGH A;  1RNH A;  2A41 A;  2YNF A;  3IG1 A;  3QO9 A;  4I2Q A;  3LDP A;  2A3Z A;  3CCQ N;  4DR2 K;  2IVP A;  2PFU A;  4AIL C;  1QQN A;  1KD1 O;  3KWG A;  4CD3 A;  3VEV A;  5KRS A;  3CQY A;  3R8E A;  2DY4 A;  4CIE A;  1W0H A;  1NMD A;  3DOK A;  1KTQ A;  2A1R A;  3UE5 A;  4O0I A;  2QKK A;  4GKK K;  3HXM A;  2YJE A;  5HP1 A;  3C7N A;  4H4M A;  5AQW A;  3NMU A;  3T3F A;  3LZJ A;  4DQS A;  4JK8 A;  4FK4 A;  3ZSO A;  1SKR A;  5GIN A;  3VEW A;  2P9S B;  3PO4 A;  2HHW A;  4BDP A;  3QIO A;  3AVM A;  3AV9 A;  5FLX O;  5AQG A;  1YJW N;  3A2F A;  3VEO A;  2OA8 A;  4JI6 K;  3ZT0 A;  1U47 A;  4Z4F A;  4PHT X;  4KB0 A;  2NLX A;  5F0X A;  3ASM A;  4DKW A;  3SMP A;  3MMV A;  3P1G A;  2Z1H A;  1BQN A;  4FM0 A;  4JHD A;  4M63 C;  4ELV A;  3NGZ A;  1IBK K;  3OJS A;  2G8V A;  2XRI A;  5C24 A;  5AQY A;  1M1K O;  4OX9 K;  4CEO A;  4DQR A;  3E1Y A;  2XY8 A;  4FJ5 A;  1WSJ A;  1QZ5 A;  1IKW A;  4IG3 A;  4FZX C;  2D5R A;  3ZT2 A;  4N47 A;  5AFU A;  4IEI A;  4DTM A;  4CZE A;  2P9I A;  1OH6 A;  1E4F T;  4Z0U A;  1N33 K;  3S41 A;  4AHT A;  2NRZ A;  3ALY A;  2G8H A;  4E1J A;  3G10 A;  5C2D A;  1KAX A;  4IG0 A;  4CF9 A;  3A5N C;  3AGR A;  1YXQ A;  4F2S A;  4KPY A;  1RTI A;  4JKH A;  3CQ8 A;  4JN4 A;  4HTL A; 
#chains in the Genus database with same CATH homology
 4CJK A;  1Y97 A;  5CYM A;  3HYF A;  3TWH A;  4N76 A;  4KI6 A;  1GOB A;  3NFA A;  3V6D A;  4F3O A;  5JS1 A;  3RTV A;  1ZBH A;  1KVA A;  4HCB A;  5HRS A;  1J9A A;  1JLA A;  4CER A;  2WOM A;  3TI0 A;  3ZT1 A;  3RRG A;  1IKY A;  4QCL A;  4EZ9 A;  4ICL A;  1LWF A;  5KTQ A;  1WAF A;  1XHZ A;  3ULD A;  1W9H A;  1EXQ A;  1C1C A;  3QLH A;  3V4I A;  2F96 A;  5CYQ A;  4LH4 A;  4N5S A;  1XC9 A;  5CZ1 A;  4OGC A;  5E41 A;  3OYC A;  4OVL A;  2HHQ A;  2FBV A;  3K5M A;  3SQ0 A;  4CEC A;  5HRO A;  3AO4 A;  4F4K A;  3LAL A;  3B6P A;  4CEF A;  1RT4 A;  1BIZ A;  4B8C A;  4H4O A;  4E7J A;  1SKW A;  1WSE A;  3DLK A;  3NCI A;  4F8R A;  1QQC A;  3H08 A;  1IKV A;  3KLH A;  4DTS A;  4PUO A;  5HRN A;  3OYK A;  1LWE A;  3OYF A;  2IDO A;  2O4I A;  1QSL A;  2XY7 A;  2DFH A;  1BIS A;  4OPK A;  4BDY A;  1TKZ A;  2FBT A;  3EZ5 A;  2DFF A;  3ZCM A;  5T7B A;  3KLG A;  3K5O A;  3AO5 A;  3ZT3 A;  2E6M A;  3VA0 A;  4O5B A;  1X9M A;  1JLF A;  2B4J A;  1SL0 A;  4FJ8 A;  3LPU A;  5CY4 A;  4DMN A;  3SUN A;  3WNE A;  1HPZ A;  2Y1I A;  3SYZ A;  4B9V A;  4DTJ A;  2B6A A;  1S6P A;  3TAR A;  4KHU A;  4I7F A;  2IS3 A;  3TAG A;  2KZZ A;  4FJG A;  2RKI A;  4EZ6 A;  2D0B A;  2IC3 A;  4M3X A;  4KHY A;  3UIQ A;  4DSJ A;  3OY9 A;  4GMJ B;  4FLU A;  1NJZ A;  1TVR A;  3DLE A;  1LAW A;  2ATQ A;  4YFU A;  2EX3 A;  2O4G A;  2D0A A;  3RR8 A;  4F3T A;  4DTR A;  1NKC A;  3NE6 A;  3V1O A;  1VSI A;  4W5O A;  1YTA A;  3VQC A;  4K8Z A;  4CJ3 A;  4AH9 A;  4HUF A;  3QEI A;  3NH0 A;  2ZQB A;  3SUQ A;  1NK9 A;  3F9K A;  4PWD A;  1I39 A;  3RR7 A;  4DS4 A;  4PA1 A;  3O3F A;  3DYA A;  4CED A;  3AA3 A;  4LH5 A;  4FJH A;  3AVK A;  3VQ6 A;  2HVI A;  4B9M A;  1RT7 A;  4CIG A;  4OJR A;  3L2U A;  4DLG A;  2ITG A;  5KGW A;  4I9L A;  4O0J A;  4C8O A;  2QKB A;  1Q9Y A;  3SQ1 A;  3ZSZ A;  3VQ7 A;  2YNH A;  3C94 A;  3HPH A;  3LAM A;  1JLG A;  2G8U A;  3NF8 A;  1LW0 A;  5K14 A;  1QSY A;  1U04 A;  4CFA A;  1QHT A;  1B9F A;  1NOY A;  1GOA A;  1U4B A;  4FJ9 A;  3RMA A;  2YNG A;  3HST B;  4CF8 A;  2BAN A;  1RBT A;  4HHT A;  3SI6 A;  1NK7 A;  1YTU A;  4CGF A;  4Y1D A;  4CJT A;  3I0R A;  3LWM A;  4E1M A;  4CJW A;  3G0Z A;  4W5T A;  3AVL A;  1C0T A;  4CK1 A;  4DG1 A;  1RBV A;  4QAG A;  3TAF A;  3S9H A;  3DLG A;  4ZHR A;  4DTN A;  1ASV A;  3E01 A;  1RT1 A;  4E1N A;  4HCC A;  4E19 A;  3RMC A;  5FRN A;  2X74 A;  4CEB A;  4KTQ A;  4C8K A;  1BGX T;  1UWB A;  1FK9 A;  4LD0 A;  3CQ8 A;  4G1Q A;  5DMR A;  3K59 A;  1TK8 A;  3JYT A;  3HT3 A;  3ZSV A;  4JS5 A;  3AVF A;  4NYF A;  2GBZ A;  3VQE A;  3V9X A;  2HHX A;  4HUG A;  1NK8 A;  3CG7 A;  1NKB A;  2BGG A;  4AHU A;  4M42 A;  3ISN C;  3IS9 A;  3OJU A;  1D5A A;  4DS5 A;  3SUO A;  3QIP A;  1R0A A;  1SKS A;  4AHS A;  2GUI A;  4CFC A;  1U49 A;  3C6T A;  4DTX A;  4FLV A;  2JGU A;  4CGG A;  1ZBF A;  3DRS A;  3WNG A;  2XO7 A;  1S1W A;  4J2A A;  4CJ4 A;  4XIU A;  3TAN A;  2OPP A;  3NGY A;  3O3H A;  2NUB A;  3D0P A;  4KFB A;  3OYA A;  1EKE A;  4CHN A;  2X6N A;  3OYM A;  3V9U A;  4M3U A;  1FXX A;  1VSH A;  1TK5 A;  4B9L A;  4J2D A;  4FYD A;  3PY8 A;  3KLF A;  4JRQ A;  4FJM A;  2P1J A;  3M8S A;  4FK2 A;  1RBS A;  1C0M A;  3VQ8 A;  1ITG A;  1G15 A;  4CFB A;  4O55 A;  1J54 A;  1C1B A;  2VG6 A;  2Z1I A;  1JLQ A;  1KFS A;  1YVU A;  4LSN A;  3VN5 A;  4E7H A;  3L2W A;  3KLE A;  3NH2 A;  1BI4 A;  1HRH A;  3QES A;  3HM9 A;  1EET A;  2KFZ A;  1KCF A;  3VQ4 A;  3ZSR A;  3HP9 A;  4OPJ A;  3K58 A;  4DFP A;  4HVJ A;  2RF2 A;  1L3V A;  2A1S A;  4KHQ A;  3S3N A;  4CFD A;  2P5O A;  2YKM A;  1Q9X A;  1RTH A;  1NJW A;  4RW6 A;  1RT3 A;  4CEA A;  1BQM A;  2HHV A;  3KJV A;  3LZI A;  1L3U A;  4B9N A;  3BDP A;  5I42 A;  4FK0 A;  3MAQ A;  1J53 A;  4FW1 A;  3VQP A;  4W5N A;  1KRP A;  4FLY A;  4I2P A;  1KLM A;  4AHC A;  1I3A A;  4M3Y A;  1L5U A;  3QEX A;  1VSL A;  1VRT A;  3U3G A;  3AA2 A;  4YNQ A;  1NJX A;  2HVH A;  3SPY A;  2HW3 A;  2OZS A;  3NGI A;  1L3S A;  4Z4I A;  1BHL A;  2F8T A;  2W42 A;  4DF8 A;  4FJJ A;  1CZ9 A;  5CZ2 A;  3U6F A;  4KAZ A;  4FJN A;  1CLQ A;  3LP0 A;  3V9S A;  4C8M A;  2EHG A;  2LSN A;  2IAJ A;  4DSE A;  3DLH A;  5J2M A;  1HNI A;  3SV4 A;  4LSL A;  4KHS A;  4LY7 A;  4CGD A;  5FRO A;  1SL2 A;  1RDA A;  2YKN A;  5KI6 A;  2PYJ A;  4B9U A;  4O4G A;  1S1V A;  2VWK A;  4KTZ A;  2HMI A;  5HLF A;  4FZY A;  1JL1 A;  3AVI A;  4DTP A;  4L8R B;  1O1W A;  4B9S A;  1ZYQ A;  4IFV A;  3WNH A;  4CHO A;  3OYN A;  3U3Y A;  3TAQ A;  3T19 A;  3K2P A;  2E4L A;  1SUQ A;  4FVM A;  4CJS A;  4CJP A;  2VWJ A;  4JRP A;  5J2Q A;  2PYL A;  4N41 A;  1S9E A;  3LDS A;  3QEW A;  3CM5 A;  4DSI A;  1RCH A;  2RPI A;  4CJR A;  1TKD A;  3MEG A;  5SZT A;  2RN2 A;  3LAN A;  4OLA A;  3AO1 A;  3AO3 A;  1S9G A;  1FKO A;  1LW2 A;  3AVJ A;  3MEC A;  4RW8 A;  4CHY A;  4CJL A;  2HNZ A;  4DU4 A;  1D9D A;  5KGX A;  1LV5 A;  2JLE A;  2OPR A;  3CFO A;  4CES A;  1Z25 A;  1LWC A;  5KRT A;  5EU7 A;  2PY5 A;  3QNO A;  1F21 A;  3ZSW A;  3TAB A;  4DTU A;  4IKF A;  1WSF A;  2OPQ A;  2X78 A;  3CFR A;  3HPG A;  3AVC A;  1WAJ A;  2FBX A;  4DF4 A;  4DFK A;  3QET A;  4Y1C A;  3SZ2 A;  1NK6 A;  3CYM A;  4M3Z A;  3V1Q A;  4BDZ A;  2XHB A;  3K57 A;  4KI4 A;  5JS2 A;  1VSK A;  3VQ9 A;  3OS2 A;  3MED A;  4M3T A;  2IOC A;  1A5X A;  1B92 A;  3LAK A;  4W5R A;  3I8D A;  4OKE A;  3DMJ A;  3ZT4 A;  1TK0 A;  4Q5V A;  2HHU A;  1RDB A;  1BI4 B;  2WON A;  1VRU A;  4M41 A;  4RW4 A;  4ID1 A;  3RRH A;  1UA0 A;  1IH7 A;  1UOC A;  4B08 A;  4AHR A;  3IAY A;  2QK9 A;  2G8F A;  1LAV A;  1VSE A;  3DI6 A;  3V9Z A;  1SL1 A;  4ZTF A;  3T1A A;  4KV8 A;  3OS0 A;  3OVN A;  3RMD A;  3KTQ A;  4FJI A;  3THV A;  4QOZ B;  1RTJ A;  2YHB A;  4MQ3 A;  4CJE A;  1QSS A;  5HBM A;  1D8Y A;  4E7I A;  2D0C A;  1TKT A;  4ELU A;  3M8P A;  2OYQ A;  4FZZ A;  2G8I A;  1C0U A;  3PX0 A;  1N5Y A;  2DTU A;  3NF9 A;  4UQG A;  3TAE A;  4Z4C A;  4CK3 A;  2VG7 A;  4DQI A;  1S1T A;  3HL8 A;  3V81 A;  3KKR A;  4FJ7 A;  4KHW A;  3PO5 A;  4GW6 A;  3L2V A;  1HYV A;  1EP4 A;  3HPO A;  1QE1 A;  3AO2 A;  4CIF A;  4B8A B;  4BWJ A;  1IG9 A;  3KKS A;  3LPT A;  3CM6 A;  4FLW A;  1HJR A;  5HRP A;  3V1R A;  3HO1 A;  4CF1 A;  3VQ5 A;  4FJK A;  2I5J A;  1CZB A;  3V9W A;  1T05 A;  4MFB A;  4CEQ A;  2KW4 A;  3NH1 A;  1WSG A;  1RDD A;  3TR8 A;  4CHP A;  4EP5 A;  3S3O A;  4CE9 A;  3OYI A;  4CJU A;  3DRR A;  1S1X A;  2DFE A;  3AVN A;  4WE1 A;  3VQD A;  2ETJ A;  4W5Q A;  4Z4H A;  4NYN A;  4C8N A;  3M8R A;  4CGJ A;  3OYL A;  3HP6 A;  3OYH A;  4DSL A;  3NDK A;  2Q3S A;  1D9F A;  1WNS A;  2BDP A;  1JLC A;  1UA1 A;  4Z4G A;  2HHS A;  4OGE A;  4NCG A;  1X9S A;  5D3G A;  2IGI A;  2FBY A;  2AJQ A;  1KVB A;  4IBN A;  5J1E A;  2KQ2 A;  1HYS A;  2E6L A;  3AVH A;  4FLZ A;  3EY1 A;  4IDK A;  1HMV A;  1CXQ A;  1VSF A;  4CCH A;  1VSD A;  4GVM A;  4M45 A;  1RT2 A;  1IO2 A;  5FRM A;  4FXD A;  4N56 A;  1KVC A;  3AA4 A;  3O3G A;  3AVB A;  3OYE A;  4DTO A;  3DOL A;  4CEZ A;  1K6Y A;  4B3O A;  3ZSQ A;  2BE2 A;  3MXI A;  2ZE2 A;  2YNI A;  3PX4 A;  4KO0 A;  3LWL A;  4BE0 A;  3QNN A;  1HQU A;  4M3W A;  1ASU A;  5J2N A;  1IKX A;  5C42 A;  1RT5 A;  1YT3 A;  3QEP A;  4DQP A;  2HB5 A;  3P5J A;  1TAQ A;  3KK3 A;  1TL3 A;  3LP3 A;  4EP4 A;  3NHG A;  1T8E A;  3KLI A;  1A5V A;  3EYZ A;  2HNY A;  4AHV A;  3SQ2 A;  3HVT A;  5J2P A;  4E7K A;  3K5L A;  2G8W A;  4DSK A;  2KFN A;  1TGO A;  3KIO A;  2XY5 A;  3ITH A;  1BIU A;  1TKX A;  1EX4 A;  2ZD1 A;  1WN7 A;  2KTQ A;  3O4N A;  3SPZ A;  1Q8I A;  4FLX A;  3PV8 A;  2FC0 A;  1XHX A;  1KLN A;  1U48 A;  4I9Q A;  1HYZ A;  1RT6 A;  5DK5 A;  3WNF A;  1C6V A;  3OYJ A;  4FLT A;  1QTM A;  2G8K A;  4DWI A;  1JL2 A;  1J5O A;  4CF0 A;  3AA5 X;  3NBP A;  3B6O A;  4F2R A;  1S1U A;  1QS4 A;  1VSJ A;  2X6S A;  4BWM A;  3MXJ A;  2HND A;  3OYD A;  5I3U A;  4J2B A;  3SCX A;  1NOZ A;  1A5W A;  2PZS A;  4E3S A;  3QER A;  3OS1 A;  3L2Q A;  4JLH A;  4BE1 A;  4CHQ A;  3SJJ A;  4CHZ A;  4E89 A;  4DFJ A;  3DLB A;  4HTU A;  1ZBI A;  3SNN A;  3DLR A;  1BL3 A;  4M3R A;  3L3U A;  3LP2 A;  1JKH A;  3NF6 A;  1CXU A;  4CJF A;  1VK0 A;  2YHA A;  4CGH A;  1RNH A;  3S3M A;  4KTW A;  2YNF A;  1XWL A;  1Z26 A;  3M8Q A;  3VA3 A;  1VSM A;  1REV A;  3IG1 A;  4FM2 A;  3QO9 A;  2XY6 A;  2HHT A;  1X1P A;  1NK0 A;  4I2Q A;  3VQB A;  1HNV A;  4K8X A;  3KK1 A;  4CEE A;  4AIL C;  4ELT A;  4O44 A;  1NKE A;  2Z1G A;  4DSF A;  3TAM A;  1DLO A;  3NF7 A;  1RBR A;  5KRS A;  3SUP A;  1RTD A;  4OKK A;  1WLJ A;  4CIE A;  1W0H A;  2DY4 A;  4NCA A;  3DOK A;  1KTQ A;  1UAX A;  3ZSX A;  2A1R A;  4E0D A;  1SV5 A;  2GV9 A;  5HRR A;  4CGI A;  4R5P A;  4J2E A;  4FCY A;  4O0I A;  2QKK A;  4Q0B A;  2QXF A;  3HXM A;  4BAC A;  3D45 A;  5HP1 A;  4RW7 A;  4H4M A;  4KRF A;  4Z4E A;  1NJY A;  3OYG A;  3T3F A;  1ZBL A;  3LZJ A;  4DQS A;  4NCB A;  1WSH A;  3PUF A;  3HJF A;  1KFD A;  4OKJ A;  4CJV A;  3PX6 A;  1JLE A;  4ZTJ A;  3K5N A;  4FK4 A;  3ZSO A;  3KK2 A;  1SKR A;  2Z1J A;  4E7L A;  2OPS A;  3MXM A;  2B5J A;  1B9D A;  3QEV A;  4KRE A;  5FDL A;  3KD1 E;  4CK2 A;  1BCO A;  2Y1J A;  3PO4 A;  1JXE A;  1X9W A;  2HHW A;  3OYB A;  1MU2 A;  4DFM A;  4BDP A;  3QIO A;  1JXB A;  3AVM A;  2P51 A;  1XI1 A;  4TSX A;  4KHN A;  2KZM A;  4HUE A;  1S6Q A;  2VG5 A;  2OZM A;  3RWU A;  1DTQ A;  3AV9 A;  4FW2 A;  4H8K A;  5C25 A;  1ZBU A;  4DU3 A;  3A2F A;  4B9T A;  3IRX A;  2R7Y A;  4RG8 A;  2OA8 A;  1HQE A;  3ZT0 A;  1DTT A;  1U47 A;  4Z4F A;  4KB0 A;  4RW9 A;  3ASM A;  3HVR A;  4BE2 A;  3SV3 A;  3FFI A;  1NK5 A;  4KKO A;  4CF2 A;  4ID5 A;  1U45 A;  4KB1 A;  3RMB A;  1T03 A;  1GOC A;  3P1G A;  2Z1H A;  1BQN A;  4PY5 A;  4FM0 A;  3L3V A;  3VQQ A;  1KSP A;  1TL1 A;  4ELV A;  3I0S A;  1JLB A;  1N6Q A;  3SQ4 A;  2F8S A;  3NGZ A;  3TAP A;  1NK4 A;  3OJS A;  2G8V A;  2P5G A;  1L3T A;  4CJ5 A;  2XRI A;  5C24 A;  4OLB A;  4CEO A;  4DQR A;  2XY8 A;  4FJ5 A;  1ASW A;  1FKP A;  1RBU A;  1WSJ A;  1RIL A;  3O4Q A;  1IKW A;  3ZSY A;  4C8L A;  3AVA A;  3DRP A;  3MEE A;  5SWM A;  4IG3 A;  1RDC A;  2D5R A;  3C6U A;  3ZT2 A;  3F73 A;  4FZX C;  1T7P A;  4N47 A;  3NAE A;  4DQQ A;  3P83 D;  4IFY A;  4DTM A;  4FJL A;  3JSM A;  4Z0U A;  3VQA A;  3HK2 A;  4AHT A;  3KD5 E;  3ALY A;  3AVG A;  4DU1 A;  3BGR A;  2G8H A;  3CFP A;  2YV0 X;  3G10 A;  4PQU A;  3C95 A;  1WSI A;  3QIN A;  1TAU A;  4IG0 A;  4CJQ A;  4FJX A;  4CF9 A;  3L2R A;  4DLE A;  3LP1 A;  1TV6 A;  3DM2 A;  4F2S A;  3L8B A;  4KPY A;  1RTI A;  1C1A A;  4JS4 A;  1S5J A;  1BCM A;  4FM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...