3VQCA

Hiv-1 in core domain in complex with (5-methyl-3-phenyl-1,2-oxazol-4-yl)methanol
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
151
structure length
141
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPSMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
molecule keywords POL polyprotein
total genus 49
structure length 141
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqcA00
4KB0A 3OJSA 4FM1A 5C24A 4Z4EA 3CM6A 3DRSA 4BWMA 5HRRA 2PYLA 1RT3A 3OYLA 3KLHA 1RTIA 4CGDA 2BGGA 2DFEA 4RW9A 3VQ9A 3HPHA 1MU2A 4CJRA 1J9AA 3KKRA 1C0TA 2W42A 3NF8A 5KRTA 1L3VA 5D3GA 3QEPA 3M8PA 4FVMA 2G8VA 1ZBHA 4BDPA 3UIQA 3V9SA 4CEAA 1S1UA 4FK4A 3AVJA 4LSLA 2HNDA 1DLOA 3L3VA 4O44A 1UWBA 5SWMA 3EZ5A 4LY7A 1X9MA 1SL2A 1L5UA 3OS0A 3AA3A 4M3ZA 3U3YA 2FC0A 4CHZA 5CZ2A 4J2DA 4FJHA 4CGGA 2A1RA 4XIUA 4E7IA 1RILA 2B6AA 3ZSZA 3TANA 4FLTA 1S6PA 3TI0A 1W0HA 3RWUA 4KHNA 4FJNA 4PY5A 3TAFA 1BCOA 2VG6A 1HMVA 4HCBA 4FJJA 4M42A 2RPIA 1QE1A 1B9DA 3SUQA 1X9WA 3PO4A 3KD5E 4CF2A 1KVCA 1NK0A 4FJMA 1FKPA 3OY9A 4QOZB 4I2QA 3IG1A 5E41A 4B9LA 3RTVA 3L2QA 1CXQA 1SV5A 4FM2A 4E1MA 3QEIA 3S3NA 1XHXA 3U6FA 3V6DA 1QTMA 2HHQA 1RT1A 4GMJB 3AA2A 4W5RA 3SV3A 4E3SA 4Z4IA 2EX3A 3LZJA 4YNQA 4FJ5A 2QK9A 1NK7A 4WE1A 1JLGA 4K8XA 4J2AA 1JLAA 4GW6A 1SUQA 1S1TA 1WSFA 2OPRA 3I0SA 4CEFA 3HVRA 2ZQBA 2PY5A 4I7FA 1DTQA 4DF4A 5HRSA 2HMIA 1JXBA 1KSPA 1L3SA 3V9WA 4ZHRA 4CK1A 1KRPA 4L8RB 4FLYA 1TK8A 1D9FA 3AVAA 3SUPA 5HRNA 4NCBA 2FBVA 3AVFA 4DTMA 4ID5A 1RT7A 3AVBA 3ZSRA 3D0PA 4UQGA 4LSNA 2OA8A 4IBNA 1KLMA 3P1GA 2O4GA 4Y1DA 3V1QA 3K57A 2HB5A 3F9KA 4F4KA 4CHPA 3AVKA 4DFJA 4ID1A 4OLBA 3HPOA 1VRTA 4LH4A 3QERA 4AHTA 3O3FA 3L8BA 4B9TA 3MEEA 4H8KA 4DTOA 1NJXA 4Z4GA 4KREA 2YKMA 4LH5A 4CGHA 3PX4A 4FJLA 3NF7A 1WN7A 1FXXA 1GOAA 3MXMA 3QLHA 4DLGA 1G15A 1JLQA 4KPYA 4RW4A 4OKEA 4CERA 3KK1A 3ISNC 3M8RA 4B3OA 1VSMA 2HHWA 3VQ4A 4N47A 1IKYA 4B9SA 1REVA 3TWHA 5KGWA 3L2RA 3VA0A 4NCGA 2P5OA 3F73A 1UA0A 4J2EA 3K59A 4HHTA 4KKOA 1RBUA 4MQ3A 3PX0A 2HVHA 1S1VA 2LSNA 3QIOA 3HXMA 3LDSA 1NKBA 1VSKA 1O1WA 1SL1A 4OLAA 1I3AA 2D0BA 3PX6A 3AA4A 3SPZA 4CEOA 2XY7A 2X78A 3U3GA 3SQ2A 2G8IA 1U48A 1BQNA 3AO2A 3ITHA 3TAPA 4IKFA 1Q8IA 4KFBA 2HW3A 5JS2A 1RT4A 1ASVA 3IAYA 3HYFA 1SKWA 1J53A 5K14A 4CF0A 3HP9A 4FZXC 2OPSA 4GVMA 1J5OA 2GBZA 1XC9A 4I9QA 1EX4A 4O55A 4YFUA 4CJWA 3WNFA 3VQ8A 3S3MA 1J54A 4E0DA 1HQUA 1XI1A 3LP0A 2HHTA 3VQDA 2YHAA 3BGRA 1VSFA 2WONA 4Y1CA 3SQ1A 2QKKA 4DSIA 3VQ6A 3AO5A 5KGXA 3HSTB 2Q3SA 1TGOA 3CFRA 2DTUA 1TL3A 1WLJA 4KTWA 2GV9A 3NF6A 5FRMA 1CLQA 4E7JA 3SJJA 2FBTA 3ZT3A 2HHVA 4B9NA 1C0MA 3B6OA 3LWLA 3JYTA 4CJLA 3QEVA 1A5VA 3C6TA 3A2FA 3ZSYA 4CJ4A 4DTXA 1GOBA 4DU1A 1TKZA 4AILC 2ETJA 3P5JA 3V1OA 5EU7A 2RKIA 3AO1A 4CF1A 3QEWA 1QSYA 2IGIA 1BGXT 3SZ2A 1NOYA 3MEDA 1JL2A 1JXEA 4Q5VA 4C8NA 4DS4A 5I42A 4DWIA 4FM0A 1S9GA 1WSJA 1BCMA 1S1WA 4H4MA 3PO5A 4FXDA 1HYSA 4H4OA 4CFCA 4DQPA 3OYNA 3K5MA 4CJKA 3TAQA 3DRPA 3OYFA 3E01A 1VSHA 4FZYA 4O5BA 3JSMA 3NF9A 4E7HA 4DTUA 1BHLA 3VQ5A 3MXJA 1A5WA 1ASWA 3QIPA 4W5OA 2E6LA 1GOCA 3OYJA 4CJUA 2B4JA 1HNIA 4AHUA 1ZBIA 1TL1A 5J2PA 1RBSA 4ZTFA 3AO3A 2PYJA 4FZZA 3QESA 2OYQA 3NGZA 3VQ7A 1W9HA 5C25A 4DFMA 1NK4A 3ULDA 4OGCA 5J2NA 2XY5A 4Z0UA 4HUGA 5DMRA 1VSIA 1WSEA 1JLBA 1I39A 1TV6A 1S9EA 3KIOA 1BL3A 3IRXA 3MXIA 4M45A 4N5SA 4CIGA 4PUOA 1U49A 3DLHA 1CZ9A 2KZZA 3KLGA 4ELUA 1LW0A 3K5LA 2X6SA 3QO9A 5CYQA 1XHZA 1U45A 1KFDA 3K2PA 4DF8A 3ZT1A 4CEQA 1JLEA 4O0IA 4CHYA 1ZBLA 1Z26A 4IG3A 4CF9A 1SKSA 1JKHA 3WNEA 3CQ8A 2YHBA 4CJQA 3ZT0A 4J2BA 3ZSVA 3QNNA 2G8KA 2KTQA 4W5NA 4OPKA 3VN5A 3PV8A 3S9HA 4KI6A 4Q0BA 3ZSXA 3BDPA 4OKKA 4FCYA 2QKBA 2BDPA 3D45A 1TKXA 3S3OA 1Q9YA 2X6NA 4KRFA 3AVCA 4CEBA 3LAKA 5DK5A 4BE2A 4KI4A 5HRPA 3NE6A 2FBXA 5HLFA 3M8SA 3LPUA 4E89A 4TSXA 4DSKA 4HUEA 1UOCA 4CHQA 1NK8A 1RTHA 2HHUA 2BANA 2DY4A 1NOZA 3DLKA 1C1CA 3WNGA 2AJQA 1T7PA 2YKNA 1KVBA 1BIUA 1JL1A 3IS9A 2VWKA 3AVLA 2F96A 2P1JA 4KTZA 4DTSA 2ZD1A 1D9DA 1NK6A 1IKWA 2OPPA 1RDDA 1IO2A 5KTQA 4FLXA 3RRHA 5HP1A 4C8LA 1T8EA 4FJ8A 2KFZA 4DTPA 3TAMA 3SQ0A 1X9SA 5HBMA 4CEEA 2VWJA 1YVUA 1TVRA 3KD1E 4W5QA 1IKXA 2IAJA 4DS5A 2OZSA 4FW1A 3SI6A 2KFNA 1R0AA 2ITGA 1RT6A 3CFPA 1HYZA 4KB1A 4FJ9A 4PWDA 3OYBA 3HM9A 2IDOA 2IOCA 4IFVA 4EZ9A 4HTUA 2XHBA 1NJWA 1HRHA 4KTQA 3CG7A 4KHSA 1BI4A 1YTUA 3RRGA 1L3UA 3RMBA 4B8AB 1JLFA 3I0RA 2X74A 1RNHA 3NH0A 1U04A 5CY4A 4DQSA 4EP4A 4KV8A 3G10A 3VQCA 1ASUA 5KI6A 5T7BA 1VK0A 1IH7A 1QHTA 1U47A 1EP4A 4DQIA 4DU3A 2KZMA 1VRUA 3HVTA 4E7KA 1WSHA 2PZSA 4KO0A 1BQMA 4OJRA 4FJXA 3SUOA 3O3GA 4FW2A 3MEGA 1LWFA 4ICLA 3NHGA 1IKVA 4BACA 4FLZA 3SV4A 1QSSA 4FLVA 4KHQA 1WSIA 2YNIA 4DG1A 3HJFA 3KK2A 1NJYA 1FKOA 1QQCA 3MECA 3FFIA 3OJUA 4FYDA 3LZIA 1FK9A 4CJSA 3OYAA 4LD0A 3K5OA 3DLBA 3MAQA 4K8ZA 3LP2A 1CZBA 1B9FA 3WNHA 3OYCA 3KK3A 2YV0X 1VSLA 1Y97A 3LPTA 3SNNA 1DTTA 4RG8A 1S6QA 3KKSA 1KVAA 4IDKA 5J1EA 4E7LA 3LANA 3NH1A 1EKEA 3V81A 4E1NA 3QINA 4FK0A 4CJFA 1SKRA 1ZYQA 2G8FA 3EYZA 3NAEA 3OS2A 2ZE2A 4CEZA 3AVHA 3DOLA 4AHVA 1Z25A 3I8DA 1U4BA 2P5GA 5FRNA 3HT3A 1X1PA 1S1XA 3CFOA 3VQAA 1RBVA 1UA1A 1WAJA 4CK3A 3O3HA 4AH9A 3M8QA 4IG0A 4FLUA 3NH2A 2I5JA 1NKEA 3LP1A 4JS5A 4E19A 3TAEA 3NGIA 3ZSQA 4DLEA 3SUNA 1VSJA 1C1BA 4DTRA 4B9VA 3DLGA 4CJ3A 1WAFA 1C0UA 2G8UA 3O4NA 3VQPA 3T3FA 4M3XA 3DI6A 4M3WA 4HVJA 1BI4B 4BE1A 1QSLA 2ATQA 3RMAA 4DSLA 4N56A 4CF8A 3O4QA 2Z1HA 3ALYA 4CGFA 1IG9A 2WOMA 5C42A 5FROA 3RR7A 3NFAA 3VQQA 1T03A 3KLFA 3SQ4A 4ELVA 4NYNA 4ELTA 2RF2A 3PUFA 4DMNA 3VQEA 4DFPA 1NK9A 4CFDA 4NYFA 1D8YA 4KHUA 1LV5A 4DU4A 4PA1A 3CYMA 4OPJA 3L2WA 3NCIA 3V9UA 3PY8A 3RMDA 4CHNA 4OVLA 4CJTA 5HROA 4CJEA 4OKJA 3ZT4A 1RT5A 2G8WA 1RTJA 2XRIA 3H08A 3AVIA 4QAGA 1BIZA 5SZTA 4M3RA 2OPQA 3AV9A 4MFBA 3ZCMA 4DSFA 4FK2A 2HVIA 4CJPA 2Y1JA 5JS1A 4CIEA 4PQUA 3V1RA 2P51A 4M41A 2HNZA 1WSGA 3V9ZA 4ZTJA 1T05A 4N41A 3DM2A 1BISA 1TAQA 4DQRA 4JS4A 4JRPA 3ZSOA 1ITGA 4F8RA 3HL8A 3VQBA 3TAGA 2B5JA 1YTAA 1CXUA 1TAUA 1S5JA 2F8SA 2G8HA 1VSDA 4QCLA 4F3TA 4CESA 1RDCA 4C8MA 2KW4A 2HNYA 4R5PA 3L2UA 3V9XA 4KAZA 4Z4FA 3TR8A 4JLHA 3T19A 3G0ZA 3ASMA 3C94A 5FDLA 4AHCA 4HUFA 1ZBUA 3TABA 1LAWA 2KQ2A 3KLIA 1HYVA 2EHGA 5KRSA 1UAXA 4DSJA 4B9UA 3ZSWA 3NGYA 3KJVA 3L3UA 4FJIA 4CECA 4C8OA 2A1SA 4AHSA 4KHYA 4BDYA 3OYEA 4CGJA 3AO4A 3NBPA 1SL0A 2OZMA 4NCAA 2YNGA 4CJVA 1HQEA 3OYMA 1ZBFA 4DTJA 4FLWA 4CJ5A 2XO7A 1NKCA 2IS3A 2D0CA 4I9LA 1RCHA 3OYDA 4DQQA 3T1AA 2Z1IA 1LW2A 4I2PA 3RMCA 3SPYA 1TKDA 3AVNA 4HCCA 4B9MA 1C1AA 3CM5A 4FJ7A 4CEDA 1HNVA 3DOKA 3DYAA 5CYMA 1KTQA 3ZT2A 2XY6A 2BE2A 1RBTA 4G1QA 1LAVA 4OGEA 1RDAA 1VSEA 3HP6A 5I3UA 4O0JA 1HJRA 2NUBA 4EP5A 4FJKA 4KHWA 4BWJA 4IFYA 1YT3A 1TK5A 3KLEA 4DFKA 3HK2A 2XY8A 4DTNA 2YNHA 3TARA 4B8CA 3HO1A 3LALA 1K6YA 3SYZA 1EETA 3OVNA 4N76A 4Z4CA 1LWCA 2Z1GA 3OYGA 3K5NA 3C95A 3DLRA 1RBRA 3LP3A 1EXQA 1NK5A 4EZ6A 3HPGA 4BDZA 5CZ1A 3DRRA 4CE9A 4DSEA 1XWLA 2E4LA 3P83D 1N6QA 1N5YA 1LWEA 4O4GA 4RW6A 3QEXA 3KTQA 3VA3A 1WNSA 2IC3A 1B92A 2Z1JA 5J2MA 3AVMA 2Y1IA 4CCHA 4F2SA 4FJGA 1RTDA 3EY1A 3QETA 2FBYA 3L2VA 3AA5X 3OS1A 4M3TA 4M3YA 4CGIA 4CFBA 2E6MA 4RW8A 2RN2A 3B6PA 3SCXA 4M3UA 3NDKA 3K58A 1KFSA 4W5TA 2DFFA 4B08A 2R7YA 4JRQA 2YNFA 1NJZA 3C6UA 2GUIA 4F2RA 1HPZA 2VG5A 4AHRA 1RT2A 2DFHA 3V4IA 2QXFA 1TK0A 1C6VA 3QNOA 1TKTA 3OYIA 1A5XA 2D5RA 1KLNA 3DLEA 1RDBA 3THVA 3OYKA 5J2QA 1JLCA 4F3OA 3DMJA 2O4IA 4CIFA 2JLEA 4Z4HA 3LWMA 1L3TA 2HHSA 4CK2A 1Q9XA 2VG7A 2HHXA 1KCFA 1QS4A 3LAMA 4BE0A 1F21A 2JGUA 4CHOA 3AVGA 4CFAA 4RW7A 2F8TA 1D5AA 3OYHA 2D0AA 3RR8A 4C8KA
chains in the Genus database with same CATH superfamily
3DRSA 4BWMA 4I6MA 5HRRA 2PYLA 5LL6Z 1RTIA 4RW9A 4U67L 3VQ9A 5C0YA 4BROA 4DV7K 3QEPA 2F9TA 1ZBHA 4BDPA 1S1UA 3AVJA 1QQNA 2HNDA 4BRQA 4O44A 1UWBA 1L5UA 2WFBA 4Y0WA 3OS0A 1V4TA 2FC0A 2W41A 4FJHA 2B6AA 3ZSZA 4CZMA 4CZIA 3TANA 3A5MC 2OANA 3TAFA 3PSIA 4M42A 1HMVA 4FJJA 2RPIA 3RVCA 1QE1A 3SUQA 1K9MO 3KD5E 4FJMA 4CF2A 1KVCA 4B9LA 3K9KA 1VQKN 1XHXA 3V6DA 4JKGA 2P9IB 3CQXA 4CZFA 4IO9L 4RCHA 1WBDA 3THXB 1Z05A 3CC2N 5LMNK 2WUSA 3I56N 3A8YA 2O8CA 4CEFA 1SUQA 1GLFO 1S1TA 3HVRA 5A2QO 2PY5A 3T1YK 3WXKA 2FBVA 4DTMA 4DV6K 3AVBA 2A41A 4UQGA 2O4GA 3LDLA 3OW2M 4U7BA 1SZ2A 2HB5A 1QQOA 3AVKA 4BRDA 3QERA 4AHTA 3L8BA 4FWMA 2PBDA 3R1XA 3A5NC 3E1YA 5JVGL 1NJXA 2ASPA 1W7AA 1VQLN 4BG8A 4FJLA 3L4IA 1GOAA 2KKZA 4V19S 4OKEA 4M7YA 4JI2K 1VSMA 2ZJRL 4N47A 1KD1O 5KGWA 3L2RA 2P5OA 1XMOK 1UA0A 4IJAA 4HHTA 4MQ3A 4WQ4C 4BR0A 3CCQN 4A5AA 3RSEB 1VSKA 2ZWHA 3SPZA 3SLCA 3SQ2A 2FLOA 4H5NA 3TAPA 3MX2A 4XH5A 3EE8A 4WCEL 4NB4A 4PKGA 1HNWK 1KAXA 4CBXA 1EX4A 4O55A 4YFUA 4CJWA 3WNFA 4BR7A 4E0DA 4MDAA 2HHTA 3L0QA 1NMNA 2YHAA 3L6QA 2YX6A 2QM1A 4LF6K 4DSIA 4WQ4A 4CI6A 3HSTB 4JYAK 2DTUA 3SJJA 4DHYA 3H1QA 4B9NA 3LWLA 3OHRA 1A5VA 3C6TA 3A2FA 2VGMA 3MN5A 1TKZA 3TTFA 2O8DA 1GLLO 3AO1A 3QEWA 5BPNA 2IGIA 4FWSA 1BGXT 1NOYA 2HMPA 4Q5VA 4C8NA 4BRMA 4DS4A 4DWIA 1S9GA 2O8BA 1WB9A 2NRVA 4CFCA 4ISGA 4DQPA 5HL7L 5AQUA 4YDUC 1NG9A 4CJKA 4A59A 3DRPA 3E01A 1K8KA 4F9OA 3VQ5A 4W5OA 1BWFO 2BTFA 4BRHA 1Z6RA 1GOCA 1ZBIA 1HNIA 3HZ6A 4ZTFA 4BRKA 5C25A 2XY5A 4HUGA 2FF6A 5AQYA 3R6MA 5F2RA 1TV6A 1S9EA 1NGDA 3MXIA 4N5SA 2EWSA 5I9EB 4FPBA 1VQPN 3VESA 1C0GA 3CERA 4JI6K 4YOTA 4DF8A 4B1VA 2E5LK 1JLEA 4O0IA 4CHYA 1RFQA 4EHTA 3EKUA 3MN7A 3WNEA 3CQ8A 2YHBA 1LCUA 3ZT0A 4J2BA 2G8KA 3VN5A 3S9HA 4KI6A 3QICA 3F9MA 1TKXA 5ELZA 3J81O 1BA1A 5EVZA 4KI4A 5HRPA 1JJ2M 3M8SA 4CZHA 3LPUA 1FW6A 4DUYK 4DSKA 3UE5A 3JAMO 4OPHA 4DCHA 1ZXOA 5AQKA 2VWKA 1IKWA 2A6AA 2OPPA 5HP1A 4FLXA 3VF4A 2KFZA 3TAMA 1X9SA 2YJEA 3Q7BA 2QWLA 4W5QA 3KD1E 1W2BM 1HYZA 4XEIA 1EQYA 2WBNA 3OYBA 1VQNN 3CCJN 5B8HA 4GNIA 3AY9A 3QMLA 1ILYA 1YTUA 1L3UA 4CZGA 1P8ZA 3G4SN 1U04A 4KV8A 5T7BA 1U47A 1VK0A 3AGRA 4DU3A 2KZMA 3WQUA 1WSHA 5EOYA 3CCEN 3O3GA 2OTJN 4DG1A 3HJFA 3KK2A 3MECA 3OJUA 4LFCK 3SK3A 2HBLA 1CZBA 1YXQA 1H1VA 5CE3A 4JI7K 2D0OA 1DTTA 1HPMA 4E7LA 4JKAA 4LF7K 3V81A 3I55N 4E1NA 3QINA 5ADXA 1ZYQA 3VEWA 3ZEUB 3AAQA 1IBKK 4CD3A 3AVHA 3DOLA 3ULEB 1Z25A 3CJAA 3EE9A 1X1PA 2UXBK 4A57A 4AH9A 1P90A 1NKEA 4YORA 4JS5A 2Q36A 1VSJA 4B9VA 3U4LA 1U6ZA 4CJ3A 4XH1A 3CMAN 2G8UA 3VQPA 3CETA 1BI4B 4N56A 2OCEA 4CGFA 2P9IA 2WOMA 1K73O 5BN8A 3VQQA 4NYNA 3T1HK 3BZCA 4KHUA 1HR0K 2ZGZA 4DU4A 4JI1K 2HBJA 3V9UA 3O9TA 1HNZK 4BVPA 3ZT4A 1NGIA 3H08A 4CW7B 2OPQA 3ZCMA 4FK2A 2HVIA 4DR2K 5JS1A 4B1YB 2P51A 4M41A 2HNZA 3PLAA 4BR4A 4DQRA 3G25A 3O08A 5KPRA 4JS4A 3HL8A 2B5JA 3WEEB 1ZC6A 1TAUA 1N33K 1VSDA 4F3TA 2Q2RA 3BP8A 4C1NI 3L2UA 2CH5A 3T19A 3G0ZA 4AHCA 1OVQA 2EHGA 1UAXA 3P39A 3ZSWA 3NGYA 4AHSA 4CGJA 3NBPA 5AQHA 2YNGA 4CJVA 4OX9K 4FLWA 3D6RA 4CJ5A 1VQ9N 3CCSN 2Z1IA 1IG8A 1LW2A 2F4VK 3ZX0A 5HOOA 3E66A 3IKMA 3ZT2A 2XY6A 4DV0K 1LAVA 4OGEA 1VSEA 1RDAA 1DEJA 3GDQA 3O9QA 3HP6A 1HJRA 2NUBA 4KHWA 1BUPA 2YNHA 4K43A 3EEQA 3TARA 3LALA 1K6YA 3ZLJA 2A5XA 4Z4CA 3G71N 3C95A 1EXQA 4EZ6A 3HPGA 4BDZA 5CZ1A 1N5YA 4O4GA 3FZLA 3THWA 1B92A 5J2MA 3BZKA 4JK9A 2FBYA 2RN2A 3B6PA 2R7YA 4JRQA 4AHRA 2QXFA 2QEXN 1TKTA 3OYIA 3MCPA 1RGIA 1RDBA 3VERA 4FWKA 2ZF5O 4H0OA 3H6EA 4BC2A 2HHSA 2V51B 4LFBK 1K8KB 4CHOA 1SAZA 4CFAA 3CCUN 1RDWX 5C24A 3CM6A 4H0TB 1RT3A 3KLHA 2DFEA 5F1XA 2O8CB 3CI5A 4CJRA 3H45C 1J9AA 3KKRA 3NF8A 2V7ZA 4BGAA 5KRTA 3UIQA 3A5OC 5AQVA 3FGUA 5GAGP 5SWMA 1SL2A 4B3MK 3CF5L 3O9RA 3AA3A 3O9UA 5MLCQ 1DKGD 5CZ2A 4X65K 4IOCL 4CGGA 4DB3A 4XIUA 3CJCA 2A1RA 5E84A 1T44A 5M1QA 2FSNA 4PY5A 2D4WA 5LMUK 2VG6A 2NRTA 1Q86O 1B9DA 4QOZB 1SV5A 3QEIA 3S3NA 1N8RO 2HHQA 3J7ZO 1MDUB 2ASMA 4Z4IA 5H1SQ 2QK9A 1JLGA 4J2AA 1JLAA 4GW6A 2W40A 3I0SA 3EZWA 1E4FT 2ZQBA 2HMIA 1JXBA 4ZHRA 2QW9A 5AR0A 1D9FA 3SUPA 4NCBA 3I33A 3M6GA 4KRFA 3VEVA 3P1GA 3VTHA 3V1QA 3K57A 4F4KA 4DFJA 4ID1A 4WF9L 3MEEA 4H8KA 4DQ8A 2YKMA 5GIOA 3E9OA 1FXXA 3MXMA 4BG9A 3QLHA 4DR3K 4O8UA 1Q7YO 4RW4A 3M8RA 3MDQA 4HWIA 4K25A 4NCGA 5AQGA 4LF4K 3U9ZA 3K59A 2HVHA 4IJNA 1RBUA 4H5VA 3QIOA 2LSNA 4MLEA 1R59O 3VOVA 4BREA 1O1WA 4BRPA 1NJIO 4BR5A 1I3AA 3PX6A 1GLDG 3AA4A 2G8IA 2XY7A 1IV0A 1TYQB 1U48A 1BQNA 3AO2A 4IKFA 2UUBK 1KAZA 2NRHA 1OH8A 1RT4A 1ASVA 4FZXC 1J53A 4A2AA 4CF0A 3HP9A 4YOUA 4GVMA 2GBZA 1XC9A 4I9QA 4ISFA 3VQ8A 3CD6N 1Q82O 4B1WB 3TU5A 3S41A 2WONA 2QKKA 3MX5A 5KGXA 2P9KA 2Q3SA 2FSJA 4YDUA 3THWB 1WLJA 4E7JA 4FVUA 2FBTA 2HHVA 1C0MA 3B6OA 3JYTA 3QEVA 4NO7A 3ZSYA 4CJ4A 4DTXA 4OO1J 1GOBA 2ETJA 3HSCA 4A5BA 3VEXA 3SZ2A 4IEEA 1JL2A 3QB0A 2A3ZA 5I42A 5AQTA 5BRFA 1BCMA 1S1WA 4H4MA 3CCRN 4BRAA 3RSEA 4FXDA 4FL9A 3O8MA 1ATRA 3OYNA 5AQIA 1N36K 3TAQA 1EWRA 5E26A 4FZYA 3JSMA 1NGJA 2QWPA 3SAFA 1RDUA 1ASWA 3QIPA 3J7AP 2B4JA 4ILHA 1RBSA 3QESA 2OYQA 4JI3K 3NVKA 3VQ7A 1U2VB 3F5TA 4MO4A 4OGCA 5J2NA 1X3MA 4Z0UA 2VQFK 1WSEA 1JLBA 3IRXA 4JI8K 1Q81O 3DLHA 2KZZA 4O8KA 4ELUA 2O8FA 3QO9A 1U45A 1KFDA 4AF1A 5LJVA 4DR6K 3CXCM 4IZ9A 1ZBLA 1Z26A 4IG3A 3W0LA 4CF9A 1TUYA 1ATSA 3M1FA 4CJQA 2VYPA 3ZSVA 2UXDK 4OPKA 3PV8A 1LOTB 4Q0BA 5FPNA 3BDPA 4FCYA 3ATUA 3S3OA 4BC4A 3AVCA 4BE2A 4M7XA 3NE6A 5HLFA 2E2PA 3DXMB 2GWJA 4TSXA 1IBMK 4JAXA 2Q0UA 3NVMA 2AJQA 4JD2B 1T7PA 2YKNA 4DKWA 4DR5K 1YF5L 3IS9A 4LF5K 2P1JA 3LDOA 4AM7A 3A5LC 5KTQA 3WUHA 1QHAA 1T8EA 4DV1K 3SQ0A 5HBMA 2WTUA 1TVRA 4FW1A 1R0AA 3D2FA 5EXWA 3CFPA 3EN9A 4PWDA 5AQQA 2YJFA 2IOCA 1S72N 4GY2B 4CZEA 1VAZA 2XHBA 3KHYA 4KTQA 3CG7A 1QQMA 3RRGA 1VQ4N 5C2DA 4B8AB 3PIOL 4DQSA 4EP4A 1QHTA 2QWRA 3ENOA 4WFBL 4E7KA 2PZSA 4PHTX 1BQMA 4OJRA 4FJXA 3P4IA 3MEGA 4KHQA 1WSIA 1NU0A 1NJYA 3LZIA 4CJSA 5GAHP 4LD0A 4GV3A 4FSVA 3LP2A 3AGKA 3WNHA 3MWTA 3VPZA 3KK3A 1Y97A 3LPTA 3SNNA 1S6QA 3KKSA 1KVAA 4IDKA 3LANA 3NH1A 1YIJN 2QWOA 3TSUA 3OS2A 2P5GA 3GL1A 3HT3A 4IOAL 1RBVA 1E4GT 5BR9A 4CK3A 4BRCA 4AQYK 4FLUA 4E19A 4FWLA 5ADXH 1JCEA 3DLGA 1WAFA 1C0UA 3O4NA 2ATQA 5FLXO 4DSLA 2Z1HA 3ALYA 4BRLA 3J8AA 3GG4A 3UKUB 3SQ4A 1HJOA 2F9WA 2RF2A 4GV9A 4DFPA 2QI2A 4JKEA 3VMFB 2QWQA 1BOTO 4CHNA 4CJTA 4B1ZA 5HROA 4CJEA 1RT5A 3HOSA 2XRIA 4QAGA 5SZTA 4JHDB 4DSFA 2E2NA 4A61A 2Y1JA 4FO0A 3GOIA 3V1RA 2VCPA 1EO1A 4ZTJA 1T05A 4N41A 3DM2A 1BISA 1ITGA 4BC5A 3VQBA 3VF2A 3ULEA 1YTAA 1CXUA 1S5JA 2F8SA 2GELA 4CESA 3WXLA 2KW4A 2V52B 4R5PA 4KAZA 3V9XA 4Z4FA 3DAWA 3C94A 5FDLA 1LAWA 1HYVA 4DSJA 3KJVA 4CECA 4C8OA 2A1SA 4BDYA 3AO4A 3T69A 1HQEA 4X64K 3ENHA 1ZBFA 2Q1NA 4JN4A 2D0CA 3CPWM 1RCHA 3OYDA 2E20A 3DXMA 5BRDA 3THYB 3SPYA 2O8EA 3AVNA 3DXKA 1HNVA 1KTQA 4NLBA 4G1QA 4B9QA 4BR9A 4O0JA 1NGCA 1TK5A 3HK2A 4WFNL 2IVOA 1NGHA 4B8CA 3H1VX 3SYZA 5KQDA 3OYGA 3K5NA 2Z1GA 2P9NB 3LP3A 3DRRA 4CE9A 1N6QA 1LWEA 3KTQA 3HBTA 1WNSA 1YI2N 1YJ9N 4BRIA 4MDBA 5AQSA 3AA5X 4QS8A 3OS1A 4M3TA 2E6MA 3KK7A 4M3UA 1KFSA 2DPNA 2DFFA 2YCHA 1N34K 2GUIA 2VG5A 3KWIA 4PKHA 3CJ9A 3QNOA 1A5XA 3THXA 3E9LA 3OYKA 1JLCA 2YI1A 2JLEA 2O8FB 3PSFA 4CK2A 1HKBA 4BE0A 3HI0A 1D5AA 2D0AA 4DV4K 3RR8A 3C6HA 4KB0A 3OJSA 4CGDA 2V7YA 3QBXA 3HPHA 1MU2A 2O8DB 1L3VA 2W42A 1VQON 2G8VA 3V9SA 4CEAA 2P9LA 2RHKA 2IVPA 4LSLA 3L3VA 1X9MA 1X3NA 4LY7A 3L4QA 2I7NA 4M3ZA 4CHZA 4J2DA 3CMEN 4E7IA 3DJCA 1RILA 3ZYYX 1O13A 1IJJA 4FLTA 1S6PA 3TI0A 1W0HA 4KHNA 4KHPK 4HCBA 3VGLA 5C2FA 1X9WA 1NK0A 1FKPA 2BUPA 1GLBG 3IG1A 5E41A 2QA4N 4IEIA 1IBLK 4FM2A 4E1MA 5TKYA 4JD2A 1QTMA 4H5RA 4E3SA 2EX3A 4FJ5A 2KLAA 4WE1A 4A2BA 1NK7A 1WSFA 3C6AA 4BRFA 4I7FA 2IVNA 5HRSA 1KSPA 3V9WA 1X9JA 4CK1A 1KRPA 4FLYA 4RWTA 1C0FA 3TSQA 5BREA 3AVFA 4ID5A 1RT7A 3D0PA 1NLVA 4LSNA 3VEOA 2OA8A 3BUZB 4Y1DA 4C23A 5FPEA 2I7PA 2OTLN 2ZGYA 4OLBA 4YOVA 1JCGA 4B9TA 3R8EA 4KREA 1WN7A 1J6ZA 1XUPO 2Q0RA 4MLHA 3O80A 1G15A 4YOYA 2ITMA 3VGMA 3KK1A 3WT0A 4B3OA 3VQ4A 1IKYA 4IDHA 3VA0A 2HOEA 3PX0A 1S1VA 3HXMA 5F0XA 4AM6A 3LDSA 4QS7A 4R79A 4GV6A 3LDNA 1XNRK 1SL1A 3CC7N 3O1BA 5FPDA 4CEOA 3U3GA 3ITHA 3NMUA 1Q8IA 2HW3A 5JS2A 4B3SK 3IAYA 3D2FB 5AQOA 5K14A 1SKWA 3F2KA 3JXUA 2OPSA 2GWKA 4GKKK 3S3MA 1J54A 1HQUA 3LP0A 1YVNA 3VQDA 3SQ1A 3BGRA 4H0XB 3U9DA 3AO5A 3IMXA 4HTLA 4YY3K 3WXIA 3ZX2A 3WQTA 3CFRA 1HKGA 4CZKA 4KTWA 5FRMA 1CLQA 4JHDA 4K42A 4JEPA 4DU1A 2UUAK 5AQXA 5EU7A 5IWAK 2RKIA 1JCFA 2E2QA 3MEDA 4FM0A 2AP1A 4BR2A 3UKUA 1WSJA 3N4QA 3PO5A 4H4OA 5AQWA 4OPAA 1VSHA 3OBWA 1BHLA 3MXJA 2JWKA 1A5WA 5AQPA 3OYJA 3H3NO 4CJUA 4AHUA 1TL1A 5J2PA 4FZZA 2PYJA 1W9HA 5KPTA 4C1NK 4DFMA 3ULDA 3CCLN 5DMRA 1VSIA 4IFEA 4EIAA 1I39A 5AZJB 5GAEP 2D1KA 4BRGA 4DR1K 1GLCG 4M45A 1E3MA 5C12A 2GEMA 4PUOA 1U49A 1CZ9A 1LW0A 3QFUA 5CYQA 1XHZA 4L3QA 1HNXK 4IXCA 1KQSM 1MWMA 1SKSA 4JKDA 2E2OA 5AQLA 4W5NA 3FZKA 4OKKA 2BDPA 2X6NA 1NBWA 5DK5A 4E89A 4HUEA 4ILGB 4CHQA 1NK8A 2DY4A 1NOZA 3WNGA 4H0YB 1KVBA 3ZEUA 1NNEA 1S22A 1BIUA 1JL1A 4JKGB 2F96A 3OBYA 4KTZA 5EY4A 4DTSA 1ZBSA 3RRHA 1M1KO 4FJ8A 4DTPA 3BEXA 3CJ7A 1BA0A 2YHWA 4CEEA 1IKXA 3KVGA 2KFNA 3T7ZA 1RT6A 2QWMA 4WFAL 3DLLL 4FJ9A 2IDOA 3SMPA 3BF1A 4HTUA 1NGFA 1NJWA 1HRHA 4KHSA 3CQYA 3QFPA 1JLFA 4BQLA 3I0RA 2X74A 3NH0A 2PFUA 3VQCA 1ASUA 5KI6A 1IH7A 5C15A 1VRUA 3HVTA 4KO0A 3NHGA 4BACA 4FLZA 1IKVA 1QSSA 3SV4A 4FLVA 5M1NA 1FKOA 1QQCA 1WUAA 3FFIA 1FK9A 3K5OA 1XC3A 5KQ8A 2YHXA 4K8ZA 4EFHA 3OYCA 3OTOK 1J5EK 3FR0A 4RG8A 2E1YA 1EKEA 3ID6A 5DM6L 4FK0A 2O8BB 3SBTA 2G8FA 1HLUA 3EYZA 4IWVA 4CEZA 4AHVA 3LDQA 3I8DA 3CPEA 3VQAA 5AFUA 3EL2A 4DUZK 1UA1A 1WAJA 3NH2A 3QBWA 2NRWA 3SUNA 4DTRA 3O9SA 4M3XA 1YUWA 4M3WA 4HVJA 4BE1A 1QSLA 3RMAA 4CF8A 1IG9A 3ID8A 5FROA 3RR7A 2VWBA 3NFAA 1YITN 5AQJA 4ISEA 3KLFA 1BU6O 4ELVA 3PUFA 1NK9A 3VQEA 4CFDA 4NYFA 1LV5A 4PA1A 3CYMA 3L2WA 3RMDA 1I94K 4OVLA 4OKJA 3MMVA 1RTJA 3J80O 2G8WA 4FOEA 3HTVA 4X62K 4M3RA 3LM2A 5AQRA 3BY5A 2P9LB 1WSGA 4B3TK 3V9ZA 2P9PA 4CVNE 1TAQA 4E1JA 2NZTA 4FOIA 5EX5A 3ZSOA 4JRPA 4F8RA 4QCLA 1T6DA 3D7EO 3SJHA 1EWQA 4JLHA 4LF9K 4KH4A 4H03B 2KQ2A 2J4RA 2P9NA 3KLIA 5KRSA 3ATVA 4B9UA 3L3UA 3D2EB 4PL8A 4FJIA 1SL0A 4LFAK 3FZHA 2VQEK 4NCAA 2A42A 2XO7A 1NKCA 2IS3A 1NGEA 4I9LA 2E8AA 3C7NB 2P9SB 3ENBA 4DQQA 4I2PA 2AA4A 1OH5A 3RMCA 3O6WA 1OVYA 5M1FA 3CM5A 3UB5A 3DYAA 5CYMA 1SS6A 2BE2A 3GE1A 1RBTA 1OKJA 3SBGA 4NLCA 4EP5A 3MK6A 3KLEA 4JI0K 4DTNA 5M1OA 4IOXA 3HO1A 2CGKA 2D0PA 3IDHA 4EHUA 4N76A 4JI4K 1NK5A 3DLRA 2NLXA 3B8AX 1XWLA 3THYA 4BC3A 1N32K 3QEXA 3N4PA 2IC3A 2Z1JA 2Y1IA 3AVMA 1RTDA 3E9PA 3EY1A 3QETA 3L2VA 4CGIA 4CFBA 2GX9A 3C7NA 4RW8A 4CZJA 5BPLA 4CZLA 5M1PA 4B08A 4FWRA 2CH6A 2YNFA 3C6UA 1ESVA 1HPZA 1RT2A 3V4IA 1S3XA 2E88A 2HSTA 3THVA 5J2QA 4F3OA 3DMJA 3U8XA 4CIFA 3K9JA 4Z4HA 5JVHL 2O4IA 2WC9A 3LWMA 3FZFA 2O8EB 1KCFA 1QS4A 3LAMA 5AQZA 1F21A 1HKCA 4RW7A 2P9UA 3OYHA 4C8KA 3MN6A 4FM1A 4Z4EA 1GLAG 5AQNA 4WYBA 1XMQK 3OYLA 5AJ3K 2BGGA 3Q7CA 3I8BA 1C0TA 5D3GA 3CHWA 3M8PA 4FVMA 4YOXA 4FK4A 2OZSA 1DLOA 1T6CA 3EZ5A 4ILJA 4MO5A 4YHHK 1QZ6A 3HRGA 3U3YA 5LY3A 4JNEA 2FXUA 1VQ7N 3AAPA 3RWUA 4FJNA 1BCOA 4J8FA 1DGKN 3PO4A 1HX1A 3OY9A 2ZJPL 4I2QA 4QS9A 3RTVA 3L2QA 1CXQA 3FLCO 3WXMB 3U6FA 4CBUA 1RT1A 4GMJB 3AA2A 4W5RA 3HM8A 3SV3A 4KH5A 1U2VA 4X66K 3LZJA 4YNQA 1NGAA 4K8XA 2OPRA 4H5TA 1DTQA 4DF4A 3CCVN 1L3SA 4L8RB 1TK8A 3AVAA 1YAGA 5HRNA 4H5WA 3ZSRA 2VGNA 1KLMA 4IBNA 1NWKA 5AQMA 2FF3B 3F9KA 4CHPA 1VHXA 4WQ5A 3EO3A 3UKRA 1VRTA 3HPOA 4LH4A 3O3FA 4B1UB 4BY9C 4DTOA 3EKSA 4Z4GA 4LH5A 3PX4A 4CGHA 3VF6A 3NF7A 4M63C 3CC4N 4DLGA 1JLQA 4KPYA 3M3ZA 3C0BA 2UXCK 4CERA 5AZJA 3ISNC 3C65A 2HHWA 2UYTA 3SMSA 4B9SA 1REVA 3TWHA 3BF3A 3O5BA 1W97L 3F73A 3P38A 4J2EA 4JKCA 2W6KA 4KKOA 5TKWA 1NKBA 3TPQA 2P9KB 1WOQA 4OLAA 4WQ5C 2D0BA 3VEYA 3HOTA 2X78A 1QVGM 1VQ6N 4KFBA 3HYFA 1J5OA 3D2EA 2HF3A 2CGJA 1XI1A 3QDKA 1VSFA 4Y1CA 4CBWA 3KWGA 4NXNK 3VQ6A 4XH4A 1QVFM 3TTDA 3PIPL 1TGOA 2P9SA 1D4XA 3TTCA 1TL3A 2KHOA 4JI5K 2GV9A 1DT9A 3NF6A 3ZT3A 4CJLA 1M90O 3SAHA 5IT9O 4AILC 3P5JA 5JICA 3V1OA 4JKFA 2UU9K 4GVEA 2FSKA 1HUXA 4CF1A 1QSYA 3LDPA 3VGKA 1JXEA 1YJWN 2HF4A 1QZ5A 2RE2A 5BR8K 1HYSA 1CZAN 3JS6A 1OH7A 3K5MA 2UUCK 3OYFA 4O5BA 3NF9A 4E7HA 4DTUA 3MWPA 2E6LA 3DWLA 3AO3A 2NRXA 5AZIA 3NGZA 5M1KA 3K0SA 1NK4A 4B1XB 3KIOA 1BL3A 2H3GX 3AARA 3P31A 4CIGA 3KLGA 3H3OB 4I6MB 2X6SA 3K5LA 4JV5K 3K2PA 3ZT1A 5CHIA 4CEQA 1JKHA 1KAYA 2KTQA 3QNNA 4FPAA 3ZSXA 2QKBA 2ZJQL 3D45A 1Q9YA 3TSPA 4CEBA 3LAKA 2FBXA 3WXJA 5AQFA 3ZETB 5AZIB 1UOCA 4LF8K 3KZBA 1RTHA 2HHUA 2BANA 3DLKA 3R3LA 1C1CA 5GADP 1BO5O 4CJ7A 3AVLA 3VEZA 4KBOA 1D9DA 2ZD1A 4DR7K 1NK6A 4C8LA 1RDDA 1IO2A 4FWQA 3GBTA 1NMDA 2VWJA 1YVUA 1NM1A 1BDGA 2IAJA 4DS5A 3SI6A 4RTFD 2ITGA 5JMVA 4KB1A 3HM9A 2GTDA 4IFVA 4EZ9A 3G6EN 2QXLA 2P9PB 2Q31A 1BI4A 4BVOA 1Q18A 5KPZA 3RMBA 2JWLA 3MCAB 3A0IX 1RNHA 1GLEG 5CY4A 3G10A 4DQIA 2NRRA 1EP4A 4FWNA 2HBMA 4JKBA 2F7TA 1XNQK 1WBBA 3SUOA 4FW2A 4ICLA 1LWFA 2YNIA 3VETA 4FYDA 1MA9B 3OYAA 3DLBA 3MAQA 3UKRB 1B9FA 2YV0X 1VSLA 5J1EA 1VQ5N 1TUUA 3CJ1A 4CJFA 1SKRA 4FWOA 3NAEA 1TYQA 4NXMK 2ZE2A 3OA9A 1U4BA 5FRNA 4IO8A 1S1XA 3CFOA 3FE1A 3O3HA 3M8QA 4IG0A 4H0PA 5DM7L 2I5JA 3O4WA 3LP1A 3TAEA 3CCMN 3NGIA 3ZSQA 2YHYA 3VTIA 4DLEA 1C1BA 2NRZA 3T3FA 2BH1A 4Z94A 3DI6A 1YHQN 3H46O 3O4QA 1NGGA 1T3VA 5FPMA 5C42A 5GINA 4YOWA 1T03A 4ELTA 4DMNA 1D8YA 2P9UB 4UY8O 4OPJA 3IUCA 3NCIA 3PY8A 3M5RA 3O1WA 2ASOA 3AVIA 1BIZA 4MFBA 3AV9A 4CJPA 4CIEA 4PQUA 4PKIA 2ZM6K 2Q97A 1Y64A 3IFRA 2A40A 1OH6A 4H0VB 3TAGA 4EAHD 5CR4A 2G8HA 4BGBA 1RDCA 4C8MA 4DV3K 4G9ZA 2HNYA 3TR8A 3ASMA 3J7YP 4HUFA 5BRHA 1ZBUA 3TABA 4A62A 1NGBA 4JK8A 3FFKB 4LC9B 4KHYA 3OYEA 2OZMA 5LJWA 1SQKA 1V4SA 3OYMA 4DTJA 3MN9A 5GIPA 2GUPA 3T1AA 4BRNA 1KC8O 4K0KK 2W6LA 2CGLA 4JKHA 1TKDA 4HCCA 4B9MA 1C1AA 4FJ7A 4CEDA 3DOKA 1YJNN 3VENA 2QTDA 5I3UA 4DR4K 4FJKA 3CJBA 4BWJA 4IFYA 1YT3A 3W3DA 5JLHA 4DFKA 2XY8A 1VQMN 4GKJK 2HHHK 3LM9A 1BG3A 2E1ZA 1EETA 3CIPA 3OVNA 4K41A 1LWCA 1RBRA 1FJGK 4DSEA 2E4LA 3FZMA 3P83D 1MWKA 4KH6A 3DXKB 4RW6A 3VA3A 3ZETA 1XQSC 1VQ8N 4DV5K 4CCHA 4F2SA 4FJGA 1ATNA 4M3YA 3SCXA 3NDKA 3K58A 4W5TA 3LL3A 4DV2K 1NJZA 4F2RA 1G99A 2PAVA 2DFHA 2IIRA 1TK0A 1C6VA 5JLFA 3ZX3A 2D5RA 1KLNA 3DLEA 4B3RK 2HBKA 3SAGA 1L3TA 2QWNA 4JK7A 2NNWA 1Q9XA 1GLJO 1K8AO 2VG7A 4PL7A 2HHXA 3WEEA 5C10A 4O5FA 2JGUA 3R9PA 5BN9A 5AFUH 4CD1A 3AVGA 4BQZA 1KXPA 2F8TA 5BPMA 4FWPA
chains in the Genus database with same CATH topology
4KB0A 3OJSA 4FM1A 5C24A 4Z4EA 3CM6A 3DRSA 4BWMA 5HRRA 2PYLA 1RT3A 3OYLA 3KLHA 1RTIA 4CGDA 2BGGA 2DFEA 4RW9A 3VQ9A 3HPHA 1MU2A 4CJRA 1J9AA 3KKRA 1C0TA 2W42A 3NF8A 5KRTA 1L3VA 5D3GA 3QEPA 3M8PA 4FVMA 2G8VA 1ZBHA 4BDPA 3UIQA 3V9SA 4CEAA 1S1UA 4FK4A 3AVJA 4LSLA 2HNDA 1DLOA 3L3VA 4O44A 1UWBA 5SWMA 3EZ5A 4LY7A 1X9MA 1SL2A 1L5UA 3OS0A 3AA3A 4M3ZA 3U3YA 2FC0A 4CHZA 5CZ2A 4J2DA 4FJHA 4CGGA 2A1RA 4XIUA 4E7IA 1RILA 2B6AA 3ZSZA 3TANA 4FLTA 1S6PA 3TI0A 1W0HA 3RWUA 4KHNA 4FJNA 4PY5A 3TAFA 1BCOA 2VG6A 1HMVA 4HCBA 4FJJA 4M42A 2RPIA 1QE1A 1B9DA 3SUQA 1X9WA 3PO4A 3KD5E 4CF2A 1KVCA 1NK0A 4FJMA 1FKPA 3OY9A 4QOZB 4I2QA 3IG1A 5E41A 4B9LA 3RTVA 3L2QA 1CXQA 1SV5A 4FM2A 4E1MA 3QEIA 3S3NA 1XHXA 3U6FA 3V6DA 1QTMA 2HHQA 1RT1A 4GMJB 3AA2A 4W5RA 3SV3A 4E3SA 4Z4IA 2EX3A 3LZJA 4YNQA 4FJ5A 2QK9A 1NK7A 4WE1A 1JLGA 4K8XA 4J2AA 1JLAA 4GW6A 1SUQA 1S1TA 1WSFA 2OPRA 3I0SA 4CEFA 3HVRA 2ZQBA 2PY5A 4I7FA 1DTQA 4DF4A 5HRSA 2HMIA 1JXBA 1KSPA 1L3SA 3V9WA 4ZHRA 4CK1A 1KRPA 4L8RB 4FLYA 1TK8A 1D9FA 3AVAA 3SUPA 5HRNA 4NCBA 2FBVA 3AVFA 4DTMA 4ID5A 1RT7A 3AVBA 3ZSRA 3D0PA 4UQGA 4LSNA 2OA8A 4IBNA 1KLMA 3P1GA 2O4GA 4Y1DA 3V1QA 3K57A 2HB5A 3F9KA 4F4KA 4CHPA 3AVKA 4DFJA 4ID1A 4OLBA 3HPOA 1VRTA 4LH4A 3QERA 4AHTA 3O3FA 3L8BA 4B9TA 3MEEA 4H8KA 4DTOA 1NJXA 4Z4GA 4KREA 2YKMA 4LH5A 4CGHA 3PX4A 4FJLA 3NF7A 1WN7A 1FXXA 1GOAA 3MXMA 3QLHA 4DLGA 1G15A 1JLQA 4KPYA 4RW4A 4OKEA 4CERA 3KK1A 3ISNC 3M8RA 4B3OA 1VSMA 2HHWA 3VQ4A 4N47A 1IKYA 4B9SA 1REVA 3TWHA 5KGWA 3L2RA 3VA0A 4NCGA 2P5OA 3F73A 1UA0A 4J2EA 3K59A 4HHTA 4KKOA 1RBUA 4MQ3A 3PX0A 2HVHA 1S1VA 2LSNA 3QIOA 3HXMA 3LDSA 1NKBA 1VSKA 1O1WA 1SL1A 4OLAA 1I3AA 2D0BA 3PX6A 3AA4A 3SPZA 4CEOA 2XY7A 2X78A 3U3GA 3SQ2A 2G8IA 1U48A 1BQNA 3AO2A 3ITHA 3TAPA 4IKFA 1Q8IA 4KFBA 2HW3A 5JS2A 1RT4A 1ASVA 3IAYA 3HYFA 1SKWA 1J53A 5K14A 4CF0A 3HP9A 4FZXC 2OPSA 4GVMA 1J5OA 2GBZA 1XC9A 4I9QA 1EX4A 4O55A 4YFUA 4CJWA 3WNFA 3VQ8A 3S3MA 1J54A 4E0DA 1HQUA 1XI1A 3LP0A 2HHTA 3VQDA 2YHAA 3BGRA 1VSFA 2WONA 4Y1CA 3SQ1A 2QKKA 4DSIA 3VQ6A 3AO5A 5KGXA 3HSTB 2Q3SA 1TGOA 3CFRA 2DTUA 1TL3A 1WLJA 4KTWA 2GV9A 3NF6A 5FRMA 1CLQA 4E7JA 3SJJA 2FBTA 3ZT3A 2HHVA 4B9NA 1C0MA 3B6OA 3LWLA 3JYTA 4CJLA 3QEVA 1A5VA 3C6TA 3A2FA 3ZSYA 4CJ4A 4DTXA 1GOBA 4DU1A 1TKZA 4AILC 2ETJA 3P5JA 3V1OA 5EU7A 2RKIA 3AO1A 4CF1A 3QEWA 1QSYA 2IGIA 1BGXT 3SZ2A 1NOYA 3MEDA 1JL2A 1JXEA 4Q5VA 4C8NA 4DS4A 5I42A 4DWIA 4FM0A 1S9GA 1WSJA 1BCMA 1S1WA 4H4MA 3PO5A 4FXDA 1HYSA 4H4OA 4CFCA 4DQPA 3OYNA 3K5MA 4CJKA 3TAQA 3DRPA 3OYFA 3E01A 1VSHA 4FZYA 4O5BA 3JSMA 3NF9A 4E7HA 4DTUA 1BHLA 3VQ5A 3MXJA 1A5WA 1ASWA 3QIPA 4W5OA 2E6LA 1GOCA 3OYJA 4CJUA 2B4JA 1HNIA 4AHUA 1ZBIA 1TL1A 5J2PA 1RBSA 4ZTFA 3AO3A 2PYJA 4FZZA 3QESA 2OYQA 3NGZA 3VQ7A 1W9HA 5C25A 4DFMA 1NK4A 3ULDA 4OGCA 5J2NA 2XY5A 4Z0UA 4HUGA 5DMRA 1VSIA 1WSEA 1JLBA 1I39A 1TV6A 1S9EA 3KIOA 1BL3A 3IRXA 3MXIA 4M45A 4N5SA 4CIGA 4PUOA 1U49A 3DLHA 1CZ9A 2KZZA 3KLGA 4ELUA 1LW0A 3K5LA 2X6SA 3QO9A 5CYQA 1XHZA 1U45A 1KFDA 3K2PA 4DF8A 3ZT1A 4CEQA 1JLEA 4O0IA 4CHYA 1ZBLA 1Z26A 4IG3A 4CF9A 1SKSA 1JKHA 3WNEA 3CQ8A 2YHBA 4CJQA 3ZT0A 4J2BA 3ZSVA 3QNNA 2G8KA 2KTQA 4W5NA 4OPKA 3VN5A 3PV8A 3S9HA 4KI6A 4Q0BA 3ZSXA 3BDPA 4OKKA 4FCYA 2QKBA 2BDPA 3D45A 1TKXA 3S3OA 1Q9YA 2X6NA 4KRFA 3AVCA 4CEBA 3LAKA 5DK5A 4BE2A 4KI4A 5HRPA 3NE6A 2FBXA 5HLFA 3M8SA 3LPUA 4E89A 4TSXA 4DSKA 4HUEA 1UOCA 4CHQA 1NK8A 1RTHA 2HHUA 2BANA 2DY4A 1NOZA 3DLKA 1C1CA 3WNGA 2AJQA 1T7PA 2YKNA 1KVBA 1BIUA 1JL1A 3IS9A 2VWKA 3AVLA 2F96A 2P1JA 4KTZA 4DTSA 2ZD1A 1D9DA 1NK6A 1IKWA 2OPPA 1RDDA 1IO2A 5KTQA 4FLXA 3RRHA 5HP1A 4C8LA 1T8EA 4FJ8A 2KFZA 4DTPA 3TAMA 3SQ0A 1X9SA 5HBMA 4CEEA 2VWJA 1YVUA 1TVRA 3KD1E 4W5QA 1IKXA 2IAJA 4DS5A 2OZSA 4FW1A 3SI6A 2KFNA 1R0AA 2ITGA 1RT6A 3CFPA 1HYZA 4KB1A 4FJ9A 4PWDA 3OYBA 3HM9A 2IDOA 2IOCA 4IFVA 4EZ9A 4HTUA 2XHBA 1NJWA 1HRHA 4KTQA 3CG7A 4KHSA 1BI4A 1YTUA 3RRGA 1L3UA 3RMBA 4B8AB 1JLFA 3I0RA 2X74A 1RNHA 3NH0A 1U04A 5CY4A 4DQSA 4EP4A 4KV8A 3G10A 3VQCA 1ASUA 5KI6A 5T7BA 1VK0A 1IH7A 1QHTA 1U47A 1EP4A 4DQIA 4DU3A 2KZMA 1VRUA 3HVTA 4E7KA 1WSHA 2PZSA 4KO0A 1BQMA 4OJRA 4FJXA 3SUOA 3O3GA 4FW2A 3MEGA 1LWFA 4ICLA 3NHGA 1IKVA 4BACA 4FLZA 3SV4A 1QSSA 4FLVA 4KHQA 1WSIA 2YNIA 4DG1A 3HJFA 3KK2A 1NJYA 1FKOA 1QQCA 3MECA 3FFIA 3OJUA 4FYDA 3LZIA 1FK9A 4CJSA 3OYAA 4LD0A 3K5OA 3DLBA 3MAQA 4K8ZA 3LP2A 1CZBA 1B9FA 3WNHA 3OYCA 3KK3A 2YV0X 1VSLA 1Y97A 3LPTA 3SNNA 1DTTA 4RG8A 1S6QA 3KKSA 1KVAA 4IDKA 5J1EA 4E7LA 3LANA 3NH1A 1EKEA 3V81A 4E1NA 3QINA 4FK0A 4CJFA 1SKRA 1ZYQA 2G8FA 3EYZA 3NAEA 3OS2A 2ZE2A 4CEZA 3AVHA 3DOLA 4AHVA 1Z25A 3I8DA 1U4BA 2P5GA 5FRNA 3HT3A 1X1PA 1S1XA 3CFOA 3VQAA 1RBVA 1UA1A 1WAJA 4CK3A 3O3HA 4AH9A 3M8QA 4IG0A 4FLUA 3NH2A 2I5JA 1NKEA 3LP1A 4JS5A 4E19A 3TAEA 3NGIA 3ZSQA 4DLEA 3SUNA 1VSJA 1C1BA 4DTRA 4B9VA 3DLGA 4CJ3A 1WAFA 1C0UA 2G8UA 3O4NA 3VQPA 3T3FA 4M3XA 3DI6A 4M3WA 4HVJA 1BI4B 4BE1A 1QSLA 2ATQA 3RMAA 4DSLA 4N56A 4CF8A 3O4QA 2Z1HA 3ALYA 4CGFA 1IG9A 2WOMA 5C42A 5FROA 3RR7A 3NFAA 3VQQA 1T03A 3KLFA 3SQ4A 4ELVA 4NYNA 4ELTA 2RF2A 3PUFA 4DMNA 3VQEA 4DFPA 1NK9A 4CFDA 4NYFA 1D8YA 4KHUA 1LV5A 4DU4A 4PA1A 3CYMA 4OPJA 3L2WA 3NCIA 3V9UA 3PY8A 3RMDA 4CHNA 4OVLA 4CJTA 5HROA 4CJEA 4OKJA 3ZT4A 1RT5A 2G8WA 1RTJA 2XRIA 3H08A 3AVIA 4QAGA 1BIZA 5SZTA 4M3RA 2OPQA 3AV9A 4MFBA 3ZCMA 4DSFA 4FK2A 2HVIA 4CJPA 2Y1JA 5JS1A 4CIEA 4PQUA 3V1RA 2P51A 4M41A 2HNZA 1WSGA 3V9ZA 4ZTJA 1T05A 4N41A 3DM2A 1BISA 1TAQA 4DQRA 4JS4A 4JRPA 3ZSOA 1ITGA 4F8RA 3HL8A 3VQBA 3TAGA 2B5JA 1YTAA 1CXUA 1TAUA 1S5JA 2F8SA 2G8HA 1VSDA 4QCLA 4F3TA 4CESA 1RDCA 4C8MA 2KW4A 2HNYA 4R5PA 3L2UA 3V9XA 4KAZA 4Z4FA 3TR8A 4JLHA 3T19A 3G0ZA 3ASMA 3C94A 5FDLA 4AHCA 4HUFA 1ZBUA 3TABA 1LAWA 2KQ2A 3KLIA 1HYVA 2EHGA 5KRSA 1UAXA 4DSJA 4B9UA 3ZSWA 3NGYA 3KJVA 3L3UA 4FJIA 4CECA 4C8OA 2A1SA 4AHSA 4KHYA 4BDYA 3OYEA 4CGJA 3AO4A 3NBPA 1SL0A 2OZMA 4NCAA 2YNGA 4CJVA 1HQEA 3OYMA 1ZBFA 4DTJA 4FLWA 4CJ5A 2XO7A 1NKCA 2IS3A 2D0CA 4I9LA 1RCHA 3OYDA 4DQQA 3T1AA 2Z1IA 1LW2A 4I2PA 3RMCA 3SPYA 1TKDA 3AVNA 4HCCA 4B9MA 1C1AA 3CM5A 4FJ7A 4CEDA 1HNVA 3DOKA 3DYAA 5CYMA 1KTQA 3ZT2A 2XY6A 2BE2A 1RBTA 4G1QA 1LAVA 4OGEA 1RDAA 1VSEA 3HP6A 5I3UA 4O0JA 1HJRA 2NUBA 4EP5A 4FJKA 4KHWA 4BWJA 4IFYA 1YT3A 1TK5A 3KLEA 4DFKA 3HK2A 2XY8A 4DTNA 2YNHA 3TARA 4B8CA 3HO1A 3LALA 1K6YA 3SYZA 1EETA 3OVNA 4N76A 4Z4CA 1LWCA 2Z1GA 3OYGA 3K5NA 3C95A 3DLRA 1RBRA 3LP3A 1EXQA 1NK5A 4EZ6A 3HPGA 4BDZA 5CZ1A 3DRRA 4CE9A 4DSEA 1XWLA 2E4LA 3P83D 1N6QA 1N5YA 1LWEA 4O4GA 4RW6A 3QEXA 3KTQA 3VA3A 1WNSA 2IC3A 1B92A 2Z1JA 5J2MA 3AVMA 2Y1IA 4CCHA 4F2SA 4FJGA 1RTDA 3EY1A 3QETA 2FBYA 3L2VA 3AA5X 3OS1A 4M3TA 4M3YA 4CGIA 4CFBA 2E6MA 4RW8A 2RN2A 3B6PA 3SCXA 4M3UA 3NDKA 3K58A 1KFSA 4W5TA 2DFFA 4B08A 2R7YA 4JRQA 2YNFA 1NJZA 3C6UA 2GUIA 4F2RA 1HPZA 2VG5A 4AHRA 1RT2A 2DFHA 3V4IA 2QXFA 1TK0A 1C6VA 3QNOA 1TKTA 3OYIA 1A5XA 2D5RA 1KLNA 3DLEA 1RDBA 3THVA 3OYKA 5J2QA 1JLCA 4F3OA 3DMJA 2O4IA 4CIFA 2JLEA 4Z4HA 3LWMA 1L3TA 2HHSA 4CK2A 1Q9XA 2VG7A 2HHXA 1KCFA 1QS4A 3LAMA 4BE0A 1F21A 2JGUA 4CHOA 3AVGA 4CFAA 4RW7A 2F8TA 1D5AA 3OYHA 2D0AA 3RR8A 4C8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KB0 A;  3OJS A;  4FM1 A;  5C24 A;  4Z4E A;  3CM6 A;  3DRS A;  4BWM A;  5HRR A;  2PYL A;  1RT3 A;  3OYL A;  3KLH A;  1RTI A;  4CGD A;  2BGG A;  2DFE A;  4RW9 A;  3VQ9 A;  3HPH A;  1MU2 A;  4CJR A;  1J9A A;  3KKR A;  1C0T A;  2W42 A;  3NF8 A;  5KRT A;  1L3V A;  5D3G A;  3QEP A;  3M8P A;  4FVM A;  2G8V A;  1ZBH A;  4BDP A;  3UIQ A;  3V9S A;  4CEA A;  1S1U A;  4FK4 A;  3AVJ A;  4LSL A;  2HND A;  1DLO A;  3L3V A;  4O44 A;  1UWB A;  5SWM A;  3EZ5 A;  4LY7 A;  1X9M A;  1SL2 A;  1L5U A;  3OS0 A;  3AA3 A;  4M3Z A;  3U3Y A;  2FC0 A;  4CHZ A;  5CZ2 A;  4J2D A;  4FJH A;  4CGG A;  2A1R A;  4XIU A;  4E7I A;  1RIL A;  2B6A A;  3ZSZ A;  3TAN A;  4FLT A;  1S6P A;  3TI0 A;  1W0H A;  3RWU A;  4KHN A;  4FJN A;  4PY5 A;  3TAF A;  1BCO A;  2VG6 A;  1HMV A;  4HCB A;  4FJJ A;  4M42 A;  2RPI A;  1QE1 A;  1B9D A;  3SUQ A;  1X9W A;  3PO4 A;  3KD5 E;  4CF2 A;  1KVC A;  1NK0 A;  4FJM A;  1FKP A;  3OY9 A;  4QOZ B;  4I2Q A;  3IG1 A;  5E41 A;  4B9L A;  3RTV A;  3L2Q A;  1CXQ A;  1SV5 A;  4FM2 A;  4E1M A;  3QEI A;  3S3N A;  1XHX A;  3U6F A;  3V6D A;  1QTM A;  2HHQ A;  1RT1 A;  4GMJ B;  3AA2 A;  4W5R A;  3SV3 A;  4E3S A;  4Z4I A;  2EX3 A;  3LZJ A;  4YNQ A;  4FJ5 A;  2QK9 A;  1NK7 A;  4WE1 A;  1JLG A;  4K8X A;  4J2A A;  1JLA A;  4GW6 A;  1SUQ A;  1S1T A;  1WSF A;  2OPR A;  3I0S A;  4CEF A;  3HVR A;  2ZQB A;  2PY5 A;  4I7F A;  1DTQ A;  4DF4 A;  5HRS A;  2HMI A;  1JXB A;  1KSP A;  1L3S A;  3V9W A;  4ZHR A;  4CK1 A;  1KRP A;  4L8R B;  4FLY A;  1TK8 A;  1D9F A;  3AVA A;  3SUP A;  5HRN A;  4NCB A;  2FBV A;  3AVF A;  4DTM A;  4ID5 A;  1RT7 A;  3AVB A;  3ZSR A;  3D0P A;  4UQG A;  4LSN A;  2OA8 A;  4IBN A;  1KLM A;  3P1G A;  2O4G A;  4Y1D A;  3V1Q A;  3K57 A;  2HB5 A;  3F9K A;  4F4K A;  4CHP A;  3AVK A;  4DFJ A;  4ID1 A;  4OLB A;  3HPO A;  1VRT A;  4LH4 A;  3QER A;  4AHT A;  3O3F A;  3L8B A;  4B9T A;  3MEE A;  4H8K A;  4DTO A;  1NJX A;  4Z4G A;  4KRE A;  2YKM A;  4LH5 A;  4CGH A;  3PX4 A;  4FJL A;  3NF7 A;  1WN7 A;  1FXX A;  1GOA A;  3MXM A;  3QLH A;  4DLG A;  1G15 A;  1JLQ A;  4KPY A;  4RW4 A;  4OKE A;  4CER A;  3KK1 A;  3ISN C;  3M8R A;  4B3O A;  1VSM A;  2HHW A;  3VQ4 A;  4N47 A;  1IKY A;  4B9S A;  1REV A;  3TWH A;  5KGW A;  3L2R A;  3VA0 A;  4NCG A;  2P5O A;  3F73 A;  1UA0 A;  4J2E A;  3K59 A;  4HHT A;  4KKO A;  1RBU A;  4MQ3 A;  3PX0 A;  2HVH A;  1S1V A;  2LSN A;  3QIO A;  3HXM A;  3LDS A;  1NKB A;  1VSK A;  1O1W A;  1SL1 A;  4OLA A;  1I3A A;  2D0B A;  3PX6 A;  3AA4 A;  3SPZ A;  4CEO A;  2XY7 A;  2X78 A;  3U3G A;  3SQ2 A;  2G8I A;  1U48 A;  1BQN A;  3AO2 A;  3ITH A;  3TAP A;  4IKF A;  1Q8I A;  4KFB A;  2HW3 A;  5JS2 A;  1RT4 A;  1ASV A;  3IAY A;  3HYF A;  1SKW A;  1J53 A;  5K14 A;  4CF0 A;  3HP9 A;  4FZX C;  2OPS A;  4GVM A;  1J5O A;  2GBZ A;  1XC9 A;  4I9Q A;  1EX4 A;  4O55 A;  4YFU A;  4CJW A;  3WNF A;  3VQ8 A;  3S3M A;  1J54 A;  4E0D A;  1HQU A;  1XI1 A;  3LP0 A;  2HHT A;  3VQD A;  2YHA A;  3BGR A;  1VSF A;  2WON A;  4Y1C A;  3SQ1 A;  2QKK A;  4DSI A;  3VQ6 A;  3AO5 A;  5KGX A;  3HST B;  2Q3S A;  1TGO A;  3CFR A;  2DTU A;  1TL3 A;  1WLJ A;  4KTW A;  2GV9 A;  3NF6 A;  5FRM A;  1CLQ A;  4E7J A;  3SJJ A;  2FBT A;  3ZT3 A;  2HHV A;  4B9N A;  1C0M A;  3B6O A;  3LWL A;  3JYT A;  4CJL A;  3QEV A;  1A5V A;  3C6T A;  3A2F A;  3ZSY A;  4CJ4 A;  4DTX A;  1GOB A;  4DU1 A;  1TKZ A;  4AIL C;  2ETJ A;  3P5J A;  3V1O A;  5EU7 A;  2RKI A;  3AO1 A;  4CF1 A;  3QEW A;  1QSY A;  2IGI A;  1BGX T;  3SZ2 A;  1NOY A;  3MED A;  1JL2 A;  1JXE A;  4Q5V A;  4C8N A;  4DS4 A;  5I42 A;  4DWI A;  4FM0 A;  1S9G A;  1WSJ A;  1BCM A;  1S1W A;  4H4M A;  3PO5 A;  4FXD A;  1HYS A;  4H4O A;  4CFC A;  4DQP A;  3OYN A;  3K5M A;  4CJK A;  3TAQ A;  3DRP A;  3OYF A;  3E01 A;  1VSH A;  4FZY A;  4O5B A;  3JSM A;  3NF9 A;  4E7H A;  4DTU A;  1BHL A;  3VQ5 A;  3MXJ A;  1A5W A;  1ASW A;  3QIP A;  4W5O A;  2E6L A;  1GOC A;  3OYJ A;  4CJU A;  2B4J A;  1HNI A;  4AHU A;  1ZBI A;  1TL1 A;  5J2P A;  1RBS A;  4ZTF A;  3AO3 A;  2PYJ A;  4FZZ A;  3QES A;  2OYQ A;  3NGZ A;  3VQ7 A;  1W9H A;  5C25 A;  4DFM A;  1NK4 A;  3ULD A;  4OGC A;  5J2N A;  2XY5 A;  4Z0U A;  4HUG A;  5DMR A;  1VSI A;  1WSE A;  1JLB A;  1I39 A;  1TV6 A;  1S9E A;  3KIO A;  1BL3 A;  3IRX A;  3MXI A;  4M45 A;  4N5S A;  4CIG A;  4PUO A;  1U49 A;  3DLH A;  1CZ9 A;  2KZZ A;  3KLG A;  4ELU A;  1LW0 A;  3K5L A;  2X6S A;  3QO9 A;  5CYQ A;  1XHZ A;  1U45 A;  1KFD A;  3K2P A;  4DF8 A;  3ZT1 A;  4CEQ A;  1JLE A;  4O0I A;  4CHY A;  1ZBL A;  1Z26 A;  4IG3 A;  4CF9 A;  1SKS A;  1JKH A;  3WNE A;  3CQ8 A;  2YHB A;  4CJQ A;  3ZT0 A;  4J2B A;  3ZSV A;  3QNN A;  2G8K A;  2KTQ A;  4W5N A;  4OPK A;  3VN5 A;  3PV8 A;  3S9H A;  4KI6 A;  4Q0B A;  3ZSX A;  3BDP A;  4OKK A;  4FCY A;  2QKB A;  2BDP A;  3D45 A;  1TKX A;  3S3O A;  1Q9Y A;  2X6N A;  4KRF A;  3AVC A;  4CEB A;  3LAK A;  5DK5 A;  4BE2 A;  4KI4 A;  5HRP A;  3NE6 A;  2FBX A;  5HLF A;  3M8S A;  3LPU A;  4E89 A;  4TSX A;  4DSK A;  4HUE A;  1UOC A;  4CHQ A;  1NK8 A;  1RTH A;  2HHU A;  2BAN A;  2DY4 A;  1NOZ A;  3DLK A;  1C1C A;  3WNG A;  2AJQ A;  1T7P A;  2YKN A;  1KVB A;  1BIU A;  1JL1 A;  3IS9 A;  2VWK A;  3AVL A;  2F96 A;  2P1J A;  4KTZ A;  4DTS A;  2ZD1 A;  1D9D A;  1NK6 A;  1IKW A;  2OPP A;  1RDD A;  1IO2 A;  5KTQ A;  4FLX A;  3RRH A;  5HP1 A;  4C8L A;  1T8E A;  4FJ8 A;  2KFZ A;  4DTP A;  3TAM A;  3SQ0 A;  1X9S A;  5HBM A;  4CEE A;  2VWJ A;  1YVU A;  1TVR A;  3KD1 E;  4W5Q A;  1IKX A;  2IAJ A;  4DS5 A;  2OZS A;  4FW1 A;  3SI6 A;  2KFN A;  1R0A A;  2ITG A;  1RT6 A;  3CFP A;  1HYZ A;  4KB1 A;  4FJ9 A;  4PWD A;  3OYB A;  3HM9 A;  2IDO A;  2IOC A;  4IFV A;  4EZ9 A;  4HTU A;  2XHB A;  1NJW A;  1HRH A;  4KTQ A;  3CG7 A;  4KHS A;  1BI4 A;  1YTU A;  3RRG A;  1L3U A;  3RMB A;  4B8A B;  1JLF A;  3I0R A;  2X74 A;  1RNH A;  3NH0 A;  1U04 A;  5CY4 A;  4DQS A;  4EP4 A;  4KV8 A;  3G10 A;  3VQC A;  1ASU A;  5KI6 A;  5T7B A;  1VK0 A;  1IH7 A;  1QHT A;  1U47 A;  1EP4 A;  4DQI A;  4DU3 A;  2KZM A;  1VRU A;  3HVT A;  4E7K A;  1WSH A;  2PZS A;  4KO0 A;  1BQM A;  4OJR A;  4FJX A;  3SUO A;  3O3G A;  4FW2 A;  3MEG A;  1LWF A;  4ICL A;  3NHG A;  1IKV A;  4BAC A;  4FLZ A;  3SV4 A;  1QSS A;  4FLV A;  4KHQ A;  1WSI A;  2YNI A;  4DG1 A;  3HJF A;  3KK2 A;  1NJY A;  1FKO A;  1QQC A;  3MEC A;  3FFI A;  3OJU A;  4FYD A;  3LZI A;  1FK9 A;  4CJS A;  3OYA A;  4LD0 A;  3K5O A;  3DLB A;  3MAQ A;  4K8Z A;  3LP2 A;  1CZB A;  1B9F A;  3WNH A;  3OYC A;  3KK3 A;  2YV0 X;  1VSL A;  1Y97 A;  3LPT A;  3SNN A;  1DTT A;  4RG8 A;  1S6Q A;  3KKS A;  1KVA A;  4IDK A;  5J1E A;  4E7L A;  3LAN A;  3NH1 A;  1EKE A;  3V81 A;  4E1N A;  3QIN A;  4FK0 A;  4CJF A;  1SKR A;  1ZYQ A;  2G8F A;  3EYZ A;  3NAE A;  3OS2 A;  2ZE2 A;  4CEZ A;  3AVH A;  3DOL A;  4AHV A;  1Z25 A;  3I8D A;  1U4B A;  2P5G A;  5FRN A;  3HT3 A;  1X1P A;  1S1X A;  3CFO A;  3VQA A;  1RBV A;  1UA1 A;  1WAJ A;  4CK3 A;  3O3H A;  4AH9 A;  3M8Q A;  4IG0 A;  4FLU A;  3NH2 A;  2I5J A;  1NKE A;  3LP1 A;  4JS5 A;  4E19 A;  3TAE A;  3NGI A;  3ZSQ A;  4DLE A;  3SUN A;  1VSJ A;  1C1B A;  4DTR A;  4B9V A;  3DLG A;  4CJ3 A;  1WAF A;  1C0U A;  2G8U A;  3O4N A;  3VQP A;  3T3F A;  4M3X A;  3DI6 A;  4M3W A;  4HVJ A;  1BI4 B;  4BE1 A;  1QSL A;  2ATQ A;  3RMA A;  4DSL A;  4N56 A;  4CF8 A;  3O4Q A;  2Z1H A;  3ALY A;  4CGF A;  1IG9 A;  2WOM A;  5C42 A;  5FRO A;  3RR7 A;  3NFA A;  3VQQ A;  1T03 A;  3KLF A;  3SQ4 A;  4ELV A;  4NYN A;  4ELT A;  2RF2 A;  3PUF A;  4DMN A;  3VQE A;  4DFP A;  1NK9 A;  4CFD A;  4NYF A;  1D8Y A;  4KHU A;  1LV5 A;  4DU4 A;  4PA1 A;  3CYM A;  4OPJ A;  3L2W A;  3NCI A;  3V9U A;  3PY8 A;  3RMD A;  4CHN A;  4OVL A;  4CJT A;  5HRO A;  4CJE A;  4OKJ A;  3ZT4 A;  1RT5 A;  2G8W A;  1RTJ A;  2XRI A;  3H08 A;  3AVI A;  4QAG A;  1BIZ A;  5SZT A;  4M3R A;  2OPQ A;  3AV9 A;  4MFB A;  3ZCM A;  4DSF A;  4FK2 A;  2HVI A;  4CJP A;  2Y1J A;  5JS1 A;  4CIE A;  4PQU A;  3V1R A;  2P51 A;  4M41 A;  2HNZ A;  1WSG A;  3V9Z A;  4ZTJ A;  1T05 A;  4N41 A;  3DM2 A;  1BIS A;  1TAQ A;  4DQR A;  4JS4 A;  4JRP A;  3ZSO A;  1ITG A;  4F8R A;  3HL8 A;  3VQB A;  3TAG A;  2B5J A;  1YTA A;  1CXU A;  1TAU A;  1S5J A;  2F8S A;  2G8H A;  1VSD A;  4QCL A;  4F3T A;  4CES A;  1RDC A;  4C8M A;  2KW4 A;  2HNY A;  4R5P A;  3L2U A;  3V9X A;  4KAZ A;  4Z4F A;  3TR8 A;  4JLH A;  3T19 A;  3G0Z A;  3ASM A;  3C94 A;  5FDL A;  4AHC A;  4HUF A;  1ZBU A;  3TAB A;  1LAW A;  2KQ2 A;  3KLI A;  1HYV A;  2EHG A;  5KRS A;  1UAX A;  4DSJ A;  4B9U A;  3ZSW A;  3NGY A;  3KJV A;  3L3U A;  4FJI A;  4CEC A;  4C8O A;  2A1S A;  4AHS A;  4KHY A;  4BDY A;  3OYE A;  4CGJ A;  3AO4 A;  3NBP A;  1SL0 A;  2OZM A;  4NCA A;  2YNG A;  4CJV A;  1HQE A;  3OYM A;  1ZBF A;  4DTJ A;  4FLW A;  4CJ5 A;  2XO7 A;  1NKC A;  2IS3 A;  2D0C A;  4I9L A;  1RCH A;  3OYD A;  4DQQ A;  3T1A A;  2Z1I A;  1LW2 A;  4I2P A;  3RMC A;  3SPY A;  1TKD A;  3AVN A;  4HCC A;  4B9M A;  1C1A A;  3CM5 A;  4FJ7 A;  4CED A;  1HNV A;  3DOK A;  3DYA A;  5CYM A;  1KTQ A;  3ZT2 A;  2XY6 A;  2BE2 A;  1RBT A;  4G1Q A;  1LAV A;  4OGE A;  1RDA A;  1VSE A;  3HP6 A;  5I3U A;  4O0J A;  1HJR A;  2NUB A;  4EP5 A;  4FJK A;  4KHW A;  4BWJ A;  4IFY A;  1YT3 A;  1TK5 A;  3KLE A;  4DFK A;  3HK2 A;  2XY8 A;  4DTN A;  2YNH A;  3TAR A;  4B8C A;  3HO1 A;  3LAL A;  1K6Y A;  3SYZ A;  1EET A;  3OVN A;  4N76 A;  4Z4C A;  1LWC A;  2Z1G A;  3OYG A;  3K5N A;  3C95 A;  3DLR A;  1RBR A;  3LP3 A;  1EXQ A;  1NK5 A;  4EZ6 A;  3HPG A;  4BDZ A;  5CZ1 A;  3DRR A;  4CE9 A;  4DSE A;  1XWL A;  2E4L A;  3P83 D;  1N6Q A;  1N5Y A;  1LWE A;  4O4G A;  4RW6 A;  3QEX A;  3KTQ A;  3VA3 A;  1WNS A;  2IC3 A;  1B92 A;  2Z1J A;  5J2M A;  3AVM A;  2Y1I A;  4CCH A;  4F2S A;  4FJG A;  1RTD A;  3EY1 A;  3QET A;  2FBY A;  3L2V A;  3AA5 X;  3OS1 A;  4M3T A;  4M3Y A;  4CGI A;  4CFB A;  2E6M A;  4RW8 A;  2RN2 A;  3B6P A;  3SCX A;  4M3U A;  3NDK A;  3K58 A;  1KFS A;  4W5T A;  2DFF A;  4B08 A;  2R7Y A;  4JRQ A;  2YNF A;  1NJZ A;  3C6U A;  2GUI A;  4F2R A;  1HPZ A;  2VG5 A;  4AHR A;  1RT2 A;  2DFH A;  3V4I A;  2QXF A;  1TK0 A;  1C6V A;  3QNO A;  1TKT A;  3OYI A;  1A5X A;  2D5R A;  1KLN A;  3DLE A;  1RDB A;  3THV A;  3OYK A;  5J2Q A;  1JLC A;  4F3O A;  3DMJ A;  2O4I A;  4CIF A;  2JLE A;  4Z4H A;  3LWM A;  1L3T A;  2HHS A;  4CK2 A;  1Q9X A;  2VG7 A;  2HHX A;  1KCF A;  1QS4 A;  3LAM A;  4BE0 A;  1F21 A;  2JGU A;  4CHO A;  3AVG A;  4CFA A;  4RW7 A;  2F8T A;  1D5A A;  3OYH A;  2D0A A;  3RR8 A;  4C8K A; 
#chains in the Genus database with same CATH topology
 3DRS A;  4BWM A;  4I6M A;  5HRR A;  2PYL A;  5LL6 Z;  1RTI A;  4RW9 A;  4U67 L;  3VQ9 A;  5C0Y A;  4BRO A;  4DV7 K;  3QEP A;  2F9T A;  1ZBH A;  4BDP A;  1S1U A;  3AVJ A;  1QQN A;  2HND A;  4BRQ A;  4O44 A;  1UWB A;  1L5U A;  2WFB A;  4Y0W A;  3OS0 A;  1V4T A;  2FC0 A;  2W41 A;  4FJH A;  2B6A A;  3ZSZ A;  4CZM A;  4CZI A;  3TAN A;  3A5M C;  2OAN A;  3TAF A;  3PSI A;  4M42 A;  1HMV A;  4FJJ A;  2RPI A;  3RVC A;  1QE1 A;  3SUQ A;  1K9M O;  3KD5 E;  4FJM A;  4CF2 A;  1KVC A;  4B9L A;  3K9K A;  1VQK N;  1XHX A;  3V6D A;  4JKG A;  2P9I B;  3CQX A;  4CZF A;  4IO9 L;  4RCH A;  1WBD A;  3THX B;  1Z05 A;  3CC2 N;  5LMN K;  2WUS A;  3I56 N;  3A8Y A;  2O8C A;  4CEF A;  1SUQ A;  1GLF O;  1S1T A;  3HVR A;  5A2Q O;  2PY5 A;  3T1Y K;  3WXK A;  2FBV A;  4DTM A;  4DV6 K;  3AVB A;  2A41 A;  4UQG A;  2O4G A;  3LDL A;  3OW2 M;  4U7B A;  1SZ2 A;  2HB5 A;  1QQO A;  3AVK A;  4BRD A;  3QER A;  4AHT A;  3L8B A;  4FWM A;  2PBD A;  3R1X A;  3A5N C;  3E1Y A;  5JVG L;  1NJX A;  2ASP A;  1W7A A;  1VQL N;  4BG8 A;  4FJL A;  3L4I A;  1GOA A;  2KKZ A;  4V19 S;  4OKE A;  4M7Y A;  4JI2 K;  1VSM A;  2ZJR L;  4N47 A;  1KD1 O;  5KGW A;  3L2R A;  2P5O A;  1XMO K;  1UA0 A;  4IJA A;  4HHT A;  4MQ3 A;  4WQ4 C;  4BR0 A;  3CCQ N;  4A5A A;  3RSE B;  1VSK A;  2ZWH A;  3SPZ A;  3SLC A;  3SQ2 A;  2FLO A;  4H5N A;  3TAP A;  3MX2 A;  4XH5 A;  3EE8 A;  4WCE L;  4NB4 A;  4PKG A;  1HNW K;  1KAX A;  4CBX A;  1EX4 A;  4O55 A;  4YFU A;  4CJW A;  3WNF A;  4BR7 A;  4E0D A;  4MDA A;  2HHT A;  3L0Q A;  1NMN A;  2YHA A;  3L6Q A;  2YX6 A;  2QM1 A;  4LF6 K;  4DSI A;  4WQ4 A;  4CI6 A;  3HST B;  4JYA K;  2DTU A;  3SJJ A;  4DHY A;  3H1Q A;  4B9N A;  3LWL A;  3OHR A;  1A5V A;  3C6T A;  3A2F A;  2VGM A;  3MN5 A;  1TKZ A;  3TTF A;  2O8D A;  1GLL O;  3AO1 A;  3QEW A;  5BPN A;  2IGI A;  4FWS A;  1BGX T;  1NOY A;  2HMP A;  4Q5V A;  4C8N A;  4BRM A;  4DS4 A;  4DWI A;  1S9G A;  2O8B A;  1WB9 A;  2NRV A;  4CFC A;  4ISG A;  4DQP A;  5HL7 L;  5AQU A;  4YDU C;  1NG9 A;  4CJK A;  4A59 A;  3DRP A;  3E01 A;  1K8K A;  4F9O A;  3VQ5 A;  4W5O A;  1BWF O;  2BTF A;  4BRH A;  1Z6R A;  1GOC A;  1ZBI A;  1HNI A;  3HZ6 A;  4ZTF A;  4BRK A;  5C25 A;  2XY5 A;  4HUG A;  2FF6 A;  5AQY A;  3R6M A;  5F2R A;  1TV6 A;  1S9E A;  1NGD A;  3MXI A;  4N5S A;  2EWS A;  5I9E B;  4FPB A;  1VQP N;  3VES A;  1C0G A;  3CER A;  4JI6 K;  4YOT A;  4DF8 A;  4B1V A;  2E5L K;  1JLE A;  4O0I A;  4CHY A;  1RFQ A;  4EHT A;  3EKU A;  3MN7 A;  3WNE A;  3CQ8 A;  2YHB A;  1LCU A;  3ZT0 A;  4J2B A;  2G8K A;  3VN5 A;  3S9H A;  4KI6 A;  3QIC A;  3F9M A;  1TKX A;  5ELZ A;  3J81 O;  1BA1 A;  5EVZ A;  4KI4 A;  5HRP A;  1JJ2 M;  3M8S A;  4CZH A;  3LPU A;  1FW6 A;  4DUY K;  4DSK A;  3UE5 A;  3JAM O;  4OPH A;  4DCH A;  1ZXO A;  5AQK A;  2VWK A;  1IKW A;  2A6A A;  2OPP A;  5HP1 A;  4FLX A;  3VF4 A;  2KFZ A;  3TAM A;  1X9S A;  2YJE A;  3Q7B A;  2QWL A;  4W5Q A;  3KD1 E;  1W2B M;  1HYZ A;  4XEI A;  1EQY A;  2WBN A;  3OYB A;  1VQN N;  3CCJ N;  5B8H A;  4GNI A;  3AY9 A;  3QML A;  1ILY A;  1YTU A;  1L3U A;  4CZG A;  1P8Z A;  3G4S N;  1U04 A;  4KV8 A;  5T7B A;  1U47 A;  1VK0 A;  3AGR A;  4DU3 A;  2KZM A;  3WQU A;  1WSH A;  5EOY A;  3CCE N;  3O3G A;  2OTJ N;  4DG1 A;  3HJF A;  3KK2 A;  3MEC A;  3OJU A;  4LFC K;  3SK3 A;  2HBL A;  1CZB A;  1YXQ A;  1H1V A;  5CE3 A;  4JI7 K;  2D0O A;  1DTT A;  1HPM A;  4E7L A;  4JKA A;  4LF7 K;  3V81 A;  3I55 N;  4E1N A;  3QIN A;  5ADX A;  1ZYQ A;  3VEW A;  3ZEU B;  3AAQ A;  1IBK K;  4CD3 A;  3AVH A;  3DOL A;  3ULE B;  1Z25 A;  3CJA A;  3EE9 A;  1X1P A;  2UXB K;  4A57 A;  4AH9 A;  1P90 A;  1NKE A;  4YOR A;  4JS5 A;  2Q36 A;  1VSJ A;  4B9V A;  3U4L A;  1U6Z A;  4CJ3 A;  4XH1 A;  3CMA N;  2G8U A;  3VQP A;  3CET A;  1BI4 B;  4N56 A;  2OCE A;  4CGF A;  2P9I A;  2WOM A;  1K73 O;  5BN8 A;  3VQQ A;  4NYN A;  3T1H K;  3BZC A;  4KHU A;  1HR0 K;  2ZGZ A;  4DU4 A;  4JI1 K;  2HBJ A;  3V9U A;  3O9T A;  1HNZ K;  4BVP A;  3ZT4 A;  1NGI A;  3H08 A;  4CW7 B;  2OPQ A;  3ZCM A;  4FK2 A;  2HVI A;  4DR2 K;  5JS1 A;  4B1Y B;  2P51 A;  4M41 A;  2HNZ A;  3PLA A;  4BR4 A;  4DQR A;  3G25 A;  3O08 A;  5KPR A;  4JS4 A;  3HL8 A;  2B5J A;  3WEE B;  1ZC6 A;  1TAU A;  1N33 K;  1VSD A;  4F3T A;  2Q2R A;  3BP8 A;  4C1N I;  3L2U A;  2CH5 A;  3T19 A;  3G0Z A;  4AHC A;  1OVQ A;  2EHG A;  1UAX A;  3P39 A;  3ZSW A;  3NGY A;  4AHS A;  4CGJ A;  3NBP A;  5AQH A;  2YNG A;  4CJV A;  4OX9 K;  4FLW A;  3D6R A;  4CJ5 A;  1VQ9 N;  3CCS N;  2Z1I A;  1IG8 A;  1LW2 A;  2F4V K;  3ZX0 A;  5HOO A;  3E66 A;  3IKM A;  3ZT2 A;  2XY6 A;  4DV0 K;  1LAV A;  4OGE A;  1VSE A;  1RDA A;  1DEJ A;  3GDQ A;  3O9Q A;  3HP6 A;  1HJR A;  2NUB A;  4KHW A;  1BUP A;  2YNH A;  4K43 A;  3EEQ A;  3TAR A;  3LAL A;  1K6Y A;  3ZLJ A;  2A5X A;  4Z4C A;  3G71 N;  3C95 A;  1EXQ A;  4EZ6 A;  3HPG A;  4BDZ A;  5CZ1 A;  1N5Y A;  4O4G A;  3FZL A;  3THW A;  1B92 A;  5J2M A;  3BZK A;  4JK9 A;  2FBY A;  2RN2 A;  3B6P A;  2R7Y A;  4JRQ A;  4AHR A;  2QXF A;  2QEX N;  1TKT A;  3OYI A;  3MCP A;  1RGI A;  1RDB A;  3VER A;  4FWK A;  2ZF5 O;  4H0O A;  3H6E A;  4BC2 A;  2HHS A;  2V51 B;  4LFB K;  1K8K B;  4CHO A;  1SAZ A;  4CFA A;  3CCU N;  1RDW X;  5C24 A;  3CM6 A;  4H0T B;  1RT3 A;  3KLH A;  2DFE A;  5F1X A;  2O8C B;  3CI5 A;  4CJR A;  3H45 C;  1J9A A;  3KKR A;  3NF8 A;  2V7Z A;  4BGA A;  5KRT A;  3UIQ A;  3A5O C;  5AQV A;  3FGU A;  5GAG P;  5SWM A;  1SL2 A;  4B3M K;  3CF5 L;  3O9R A;  3AA3 A;  3O9U A;  5MLC Q;  1DKG D;  5CZ2 A;  4X65 K;  4IOC L;  4CGG A;  4DB3 A;  4XIU A;  3CJC A;  2A1R A;  5E84 A;  1T44 A;  5M1Q A;  2FSN A;  4PY5 A;  2D4W A;  5LMU K;  2VG6 A;  2NRT A;  1Q86 O;  1B9D A;  4QOZ B;  1SV5 A;  3QEI A;  3S3N A;  1N8R O;  2HHQ A;  3J7Z O;  1MDU B;  2ASM A;  4Z4I A;  5H1S Q;  2QK9 A;  1JLG A;  4J2A A;  1JLA A;  4GW6 A;  2W40 A;  3I0S A;  3EZW A;  1E4F T;  2ZQB A;  2HMI A;  1JXB A;  4ZHR A;  2QW9 A;  5AR0 A;  1D9F A;  3SUP A;  4NCB A;  3I33 A;  3M6G A;  4KRF A;  3VEV A;  3P1G A;  3VTH A;  3V1Q A;  3K57 A;  4F4K A;  4DFJ A;  4ID1 A;  4WF9 L;  3MEE A;  4H8K A;  4DQ8 A;  2YKM A;  5GIO A;  3E9O A;  1FXX A;  3MXM A;  4BG9 A;  3QLH A;  4DR3 K;  4O8U A;  1Q7Y O;  4RW4 A;  3M8R A;  3MDQ A;  4HWI A;  4K25 A;  4NCG A;  5AQG A;  4LF4 K;  3U9Z A;  3K59 A;  2HVH A;  4IJN A;  1RBU A;  4H5V A;  3QIO A;  2LSN A;  4MLE A;  1R59 O;  3VOV A;  4BRE A;  1O1W A;  4BRP A;  1NJI O;  4BR5 A;  1I3A A;  3PX6 A;  1GLD G;  3AA4 A;  2G8I A;  2XY7 A;  1IV0 A;  1TYQ B;  1U48 A;  1BQN A;  3AO2 A;  4IKF A;  2UUB K;  1KAZ A;  2NRH A;  1OH8 A;  1RT4 A;  1ASV A;  4FZX C;  1J53 A;  4A2A A;  4CF0 A;  3HP9 A;  4YOU A;  4GVM A;  2GBZ A;  1XC9 A;  4I9Q A;  4ISF A;  3VQ8 A;  3CD6 N;  1Q82 O;  4B1W B;  3TU5 A;  3S41 A;  2WON A;  2QKK A;  3MX5 A;  5KGX A;  2P9K A;  2Q3S A;  2FSJ A;  4YDU A;  3THW B;  1WLJ A;  4E7J A;  4FVU A;  2FBT A;  2HHV A;  1C0M A;  3B6O A;  3JYT A;  3QEV A;  4NO7 A;  3ZSY A;  4CJ4 A;  4DTX A;  4OO1 J;  1GOB A;  2ETJ A;  3HSC A;  4A5B A;  3VEX A;  3SZ2 A;  4IEE A;  1JL2 A;  3QB0 A;  2A3Z A;  5I42 A;  5AQT A;  5BRF A;  1BCM A;  1S1W A;  4H4M A;  3CCR N;  4BRA A;  3RSE A;  4FXD A;  4FL9 A;  3O8M A;  1ATR A;  3OYN A;  5AQI A;  1N36 K;  3TAQ A;  1EWR A;  5E26 A;  4FZY A;  3JSM A;  1NGJ A;  2QWP A;  3SAF A;  1RDU A;  1ASW A;  3QIP A;  3J7A P;  2B4J A;  4ILH A;  1RBS A;  3QES A;  2OYQ A;  4JI3 K;  3NVK A;  3VQ7 A;  1U2V B;  3F5T A;  4MO4 A;  4OGC A;  5J2N A;  1X3M A;  4Z0U A;  2VQF K;  1WSE A;  1JLB A;  3IRX A;  4JI8 K;  1Q81 O;  3DLH A;  2KZZ A;  4O8K A;  4ELU A;  2O8F A;  3QO9 A;  1U45 A;  1KFD A;  4AF1 A;  5LJV A;  4DR6 K;  3CXC M;  4IZ9 A;  1ZBL A;  1Z26 A;  4IG3 A;  3W0L A;  4CF9 A;  1TUY A;  1ATS A;  3M1F A;  4CJQ A;  2VYP A;  3ZSV A;  2UXD K;  4OPK A;  3PV8 A;  1LOT B;  4Q0B A;  5FPN A;  3BDP A;  4FCY A;  3ATU A;  3S3O A;  4BC4 A;  3AVC A;  4BE2 A;  4M7X A;  3NE6 A;  5HLF A;  2E2P A;  3DXM B;  2GWJ A;  4TSX A;  1IBM K;  4JAX A;  2Q0U A;  3NVM A;  2AJQ A;  4JD2 B;  1T7P A;  2YKN A;  4DKW A;  4DR5 K;  1YF5 L;  3IS9 A;  4LF5 K;  2P1J A;  3LDO A;  4AM7 A;  3A5L C;  5KTQ A;  3WUH A;  1QHA A;  1T8E A;  4DV1 K;  3SQ0 A;  5HBM A;  2WTU A;  1TVR A;  4FW1 A;  1R0A A;  3D2F A;  5EXW A;  3CFP A;  3EN9 A;  4PWD A;  5AQQ A;  2YJF A;  2IOC A;  1S72 N;  4GY2 B;  4CZE A;  1VAZ A;  2XHB A;  3KHY A;  4KTQ A;  3CG7 A;  1QQM A;  3RRG A;  1VQ4 N;  5C2D A;  4B8A B;  3PIO L;  4DQS A;  4EP4 A;  1QHT A;  2QWR A;  3ENO A;  4WFB L;  4E7K A;  2PZS A;  4PHT X;  1BQM A;  4OJR A;  4FJX A;  3P4I A;  3MEG A;  4KHQ A;  1WSI A;  1NU0 A;  1NJY A;  3LZI A;  4CJS A;  5GAH P;  4LD0 A;  4GV3 A;  4FSV A;  3LP2 A;  3AGK A;  3WNH A;  3MWT A;  3VPZ A;  3KK3 A;  1Y97 A;  3LPT A;  3SNN A;  1S6Q A;  3KKS A;  1KVA A;  4IDK A;  3LAN A;  3NH1 A;  1YIJ N;  2QWO A;  3TSU A;  3OS2 A;  2P5G A;  3GL1 A;  3HT3 A;  4IOA L;  1RBV A;  1E4G T;  5BR9 A;  4CK3 A;  4BRC A;  4AQY K;  4FLU A;  4E19 A;  4FWL A;  5ADX H;  1JCE A;  3DLG A;  1WAF A;  1C0U A;  3O4N A;  2ATQ A;  5FLX O;  4DSL A;  2Z1H A;  3ALY A;  4BRL A;  3J8A A;  3GG4 A;  3UKU B;  3SQ4 A;  1HJO A;  2F9W A;  2RF2 A;  4GV9 A;  4DFP A;  2QI2 A;  4JKE A;  3VMF B;  2QWQ A;  1BOT O;  4CHN A;  4CJT A;  4B1Z A;  5HRO A;  4CJE A;  1RT5 A;  3HOS A;  2XRI A;  4QAG A;  5SZT A;  4JHD B;  4DSF A;  2E2N A;  4A61 A;  2Y1J A;  4FO0 A;  3GOI A;  3V1R A;  2VCP A;  1EO1 A;  4ZTJ A;  1T05 A;  4N41 A;  3DM2 A;  1BIS A;  1ITG A;  4BC5 A;  3VQB A;  3VF2 A;  3ULE A;  1YTA A;  1CXU A;  1S5J A;  2F8S A;  2GEL A;  4CES A;  3WXL A;  2KW4 A;  2V52 B;  4R5P A;  4KAZ A;  3V9X A;  4Z4F A;  3DAW A;  3C94 A;  5FDL A;  1LAW A;  1HYV A;  4DSJ A;  3KJV A;  4CEC A;  4C8O A;  2A1S A;  4BDY A;  3AO4 A;  3T69 A;  1HQE A;  4X64 K;  3ENH A;  1ZBF A;  2Q1N A;  4JN4 A;  2D0C A;  3CPW M;  1RCH A;  3OYD A;  2E20 A;  3DXM A;  5BRD A;  3THY B;  3SPY A;  2O8E A;  3AVN A;  3DXK A;  1HNV A;  1KTQ A;  4NLB A;  4G1Q A;  4B9Q A;  4BR9 A;  4O0J A;  1NGC A;  1TK5 A;  3HK2 A;  4WFN L;  2IVO A;  1NGH A;  4B8C A;  3H1V X;  3SYZ A;  5KQD A;  3OYG A;  3K5N A;  2Z1G A;  2P9N B;  3LP3 A;  3DRR A;  4CE9 A;  1N6Q A;  1LWE A;  3KTQ A;  3HBT A;  1WNS A;  1YI2 N;  1YJ9 N;  4BRI A;  4MDB A;  5AQS A;  3AA5 X;  4QS8 A;  3OS1 A;  4M3T A;  2E6M A;  3KK7 A;  4M3U A;  1KFS A;  2DPN A;  2DFF A;  2YCH A;  1N34 K;  2GUI A;  2VG5 A;  3KWI A;  4PKH A;  3CJ9 A;  3QNO A;  1A5X A;  3THX A;  3E9L A;  3OYK A;  1JLC A;  2YI1 A;  2JLE A;  2O8F B;  3PSF A;  4CK2 A;  1HKB A;  4BE0 A;  3HI0 A;  1D5A A;  2D0A A;  4DV4 K;  3RR8 A;  3C6H A;  4KB0 A;  3OJS A;  4CGD A;  2V7Y A;  3QBX A;  3HPH A;  1MU2 A;  2O8D B;  1L3V A;  2W42 A;  1VQO N;  2G8V A;  3V9S A;  4CEA A;  2P9L A;  2RHK A;  2IVP A;  4LSL A;  3L3V A;  1X9M A;  1X3N A;  4LY7 A;  3L4Q A;  2I7N A;  4M3Z A;  4CHZ A;  4J2D A;  3CME N;  4E7I A;  3DJC A;  1RIL A;  3ZYY X;  1O13 A;  1IJJ A;  4FLT A;  1S6P A;  3TI0 A;  1W0H A;  4KHN A;  4KHP K;  4HCB A;  3VGL A;  5C2F A;  1X9W A;  1NK0 A;  1FKP A;  2BUP A;  1GLB G;  3IG1 A;  5E41 A;  2QA4 N;  4IEI A;  1IBL K;  4FM2 A;  4E1M A;  5TKY A;  4JD2 A;  1QTM A;  4H5R A;  4E3S A;  2EX3 A;  4FJ5 A;  2KLA A;  4WE1 A;  4A2B A;  1NK7 A;  1WSF A;  3C6A A;  4BRF A;  4I7F A;  2IVN A;  5HRS A;  1KSP A;  3V9W A;  1X9J A;  4CK1 A;  1KRP A;  4FLY A;  4RWT A;  1C0F A;  3TSQ A;  5BRE A;  3AVF A;  4ID5 A;  1RT7 A;  3D0P A;  1NLV A;  4LSN A;  3VEO A;  2OA8 A;  3BUZ B;  4Y1D A;  4C23 A;  5FPE A;  2I7P A;  2OTL N;  2ZGY A;  4OLB A;  4YOV A;  1JCG A;  4B9T A;  3R8E A;  4KRE A;  1WN7 A;  1J6Z A;  1XUP O;  2Q0R A;  4MLH A;  3O80 A;  1G15 A;  4YOY A;  2ITM A;  3VGM A;  3KK1 A;  3WT0 A;  4B3O A;  3VQ4 A;  1IKY A;  4IDH A;  3VA0 A;  2HOE A;  3PX0 A;  1S1V A;  3HXM A;  5F0X A;  4AM6 A;  3LDS A;  4QS7 A;  4R79 A;  4GV6 A;  3LDN A;  1XNR K;  1SL1 A;  3CC7 N;  3O1B A;  5FPD A;  4CEO A;  3U3G A;  3ITH A;  3NMU A;  1Q8I A;  2HW3 A;  5JS2 A;  4B3S K;  3IAY A;  3D2F B;  5AQO A;  5K14 A;  1SKW A;  3F2K A;  3JXU A;  2OPS A;  2GWK A;  4GKK K;  3S3M A;  1J54 A;  1HQU A;  3LP0 A;  1YVN A;  3VQD A;  3SQ1 A;  3BGR A;  4H0X B;  3U9D A;  3AO5 A;  3IMX A;  4HTL A;  4YY3 K;  3WXI A;  3ZX2 A;  3WQT A;  3CFR A;  1HKG A;  4CZK A;  4KTW A;  5FRM A;  1CLQ A;  4JHD A;  4K42 A;  4JEP A;  4DU1 A;  2UUA K;  5AQX A;  5EU7 A;  5IWA K;  2RKI A;  1JCF A;  2E2Q A;  3MED A;  4FM0 A;  2AP1 A;  4BR2 A;  3UKU A;  1WSJ A;  3N4Q A;  3PO5 A;  4H4O A;  5AQW A;  4OPA A;  1VSH A;  3OBW A;  1BHL A;  3MXJ A;  2JWK A;  1A5W A;  5AQP A;  3OYJ A;  3H3N O;  4CJU A;  4AHU A;  1TL1 A;  5J2P A;  4FZZ A;  2PYJ A;  1W9H A;  5KPT A;  4C1N K;  4DFM A;  3ULD A;  3CCL N;  5DMR A;  1VSI A;  4IFE A;  4EIA A;  1I39 A;  5AZJ B;  5GAE P;  2D1K A;  4BRG A;  4DR1 K;  1GLC G;  4M45 A;  1E3M A;  5C12 A;  2GEM A;  4PUO A;  1U49 A;  1CZ9 A;  1LW0 A;  3QFU A;  5CYQ A;  1XHZ A;  4L3Q A;  1HNX K;  4IXC A;  1KQS M;  1MWM A;  1SKS A;  4JKD A;  2E2O A;  5AQL A;  4W5N A;  3FZK A;  4OKK A;  2BDP A;  2X6N A;  1NBW A;  5DK5 A;  4E89 A;  4HUE A;  4ILG B;  4CHQ A;  1NK8 A;  2DY4 A;  1NOZ A;  3WNG A;  4H0Y B;  1KVB A;  3ZEU A;  1NNE A;  1S22 A;  1BIU A;  1JL1 A;  4JKG B;  2F96 A;  3OBY A;  4KTZ A;  5EY4 A;  4DTS A;  1ZBS A;  3RRH A;  1M1K O;  4FJ8 A;  4DTP A;  3BEX A;  3CJ7 A;  1BA0 A;  2YHW A;  4CEE A;  1IKX A;  3KVG A;  2KFN A;  3T7Z A;  1RT6 A;  2QWM A;  4WFA L;  3DLL L;  4FJ9 A;  2IDO A;  3SMP A;  3BF1 A;  4HTU A;  1NGF A;  1NJW A;  1HRH A;  4KHS A;  3CQY A;  3QFP A;  1JLF A;  4BQL A;  3I0R A;  2X74 A;  3NH0 A;  2PFU A;  3VQC A;  1ASU A;  5KI6 A;  1IH7 A;  5C15 A;  1VRU A;  3HVT A;  4KO0 A;  3NHG A;  4BAC A;  4FLZ A;  1IKV A;  1QSS A;  3SV4 A;  4FLV A;  5M1N A;  1FKO A;  1QQC A;  1WUA A;  3FFI A;  1FK9 A;  3K5O A;  1XC3 A;  5KQ8 A;  2YHX A;  4K8Z A;  4EFH A;  3OYC A;  3OTO K;  1J5E K;  3FR0 A;  4RG8 A;  2E1Y A;  1EKE A;  3ID6 A;  5DM6 L;  4FK0 A;  2O8B B;  3SBT A;  2G8F A;  1HLU A;  3EYZ A;  4IWV A;  4CEZ A;  4AHV A;  3LDQ A;  3I8D A;  3CPE A;  3VQA A;  5AFU A;  3EL2 A;  4DUZ K;  1UA1 A;  1WAJ A;  3NH2 A;  3QBW A;  2NRW A;  3SUN A;  4DTR A;  3O9S A;  4M3X A;  1YUW A;  4M3W A;  4HVJ A;  4BE1 A;  1QSL A;  3RMA A;  4CF8 A;  1IG9 A;  3ID8 A;  5FRO A;  3RR7 A;  2VWB A;  3NFA A;  1YIT N;  5AQJ A;  4ISE A;  3KLF A;  1BU6 O;  4ELV A;  3PUF A;  1NK9 A;  3VQE A;  4CFD A;  4NYF A;  1LV5 A;  4PA1 A;  3CYM A;  3L2W A;  3RMD A;  1I94 K;  4OVL A;  4OKJ A;  3MMV A;  1RTJ A;  3J80 O;  2G8W A;  4FOE A;  3HTV A;  4X62 K;  4M3R A;  3LM2 A;  5AQR A;  3BY5 A;  2P9L B;  1WSG A;  4B3T K;  3V9Z A;  2P9P A;  4CVN E;  1TAQ A;  4E1J A;  2NZT A;  4FOI A;  5EX5 A;  3ZSO A;  4JRP A;  4F8R A;  4QCL A;  1T6D A;  3D7E O;  3SJH A;  1EWQ A;  4JLH A;  4LF9 K;  4KH4 A;  4H03 B;  2KQ2 A;  2J4R A;  2P9N A;  3KLI A;  5KRS A;  3ATV A;  4B9U A;  3L3U A;  3D2E B;  4PL8 A;  4FJI A;  1SL0 A;  4LFA K;  3FZH A;  2VQE K;  4NCA A;  2A42 A;  2XO7 A;  1NKC A;  2IS3 A;  1NGE A;  4I9L A;  2E8A A;  3C7N B;  2P9S B;  3ENB A;  4DQQ A;  4I2P A;  2AA4 A;  1OH5 A;  3RMC A;  3O6W A;  1OVY A;  5M1F A;  3CM5 A;  3UB5 A;  3DYA A;  5CYM A;  1SS6 A;  2BE2 A;  3GE1 A;  1RBT A;  1OKJ A;  3SBG A;  4NLC A;  4EP5 A;  3MK6 A;  3KLE A;  4JI0 K;  4DTN A;  5M1O A;  4IOX A;  3HO1 A;  2CGK A;  2D0P A;  3IDH A;  4EHU A;  4N76 A;  4JI4 K;  1NK5 A;  3DLR A;  2NLX A;  3B8A X;  1XWL A;  3THY A;  4BC3 A;  1N32 K;  3QEX A;  3N4P A;  2IC3 A;  2Z1J A;  2Y1I A;  3AVM A;  1RTD A;  3E9P A;  3EY1 A;  3QET A;  3L2V A;  4CGI A;  4CFB A;  2GX9 A;  3C7N A;  4RW8 A;  4CZJ A;  5BPL A;  4CZL A;  5M1P A;  4B08 A;  4FWR A;  2CH6 A;  2YNF A;  3C6U A;  1ESV A;  1HPZ A;  1RT2 A;  3V4I A;  1S3X A;  2E88 A;  2HST A;  3THV A;  5J2Q A;  4F3O A;  3DMJ A;  3U8X A;  4CIF A;  3K9J A;  4Z4H A;  5JVH L;  2O4I A;  2WC9 A;  3LWM A;  3FZF A;  2O8E B;  1KCF A;  1QS4 A;  3LAM A;  5AQZ A;  1F21 A;  1HKC A;  4RW7 A;  2P9U A;  3OYH A;  4C8K A;  3MN6 A;  4FM1 A;  4Z4E A;  1GLA G;  5AQN A;  4WYB A;  1XMQ K;  3OYL A;  5AJ3 K;  2BGG A;  3Q7C A;  3I8B A;  1C0T A;  5D3G A;  3CHW A;  3M8P A;  4FVM A;  4YOX A;  4FK4 A;  2OZS A;  1DLO A;  1T6C A;  3EZ5 A;  4ILJ A;  4MO5 A;  4YHH K;  1QZ6 A;  3HRG A;  3U3Y A;  5LY3 A;  4JNE A;  2FXU A;  1VQ7 N;  3AAP A;  3RWU A;  4FJN A;  1BCO A;  4J8F A;  1DGK N;  3PO4 A;  1HX1 A;  3OY9 A;  2ZJP L;  4I2Q A;  4QS9 A;  3RTV A;  3L2Q A;  1CXQ A;  3FLC O;  3WXM B;  3U6F A;  4CBU A;  1RT1 A;  4GMJ B;  3AA2 A;  4W5R A;  3HM8 A;  3SV3 A;  4KH5 A;  1U2V A;  4X66 K;  3LZJ A;  4YNQ A;  1NGA A;  4K8X A;  2OPR A;  4H5T A;  1DTQ A;  4DF4 A;  3CCV N;  1L3S A;  4L8R B;  1TK8 A;  3AVA A;  1YAG A;  5HRN A;  4H5W A;  3ZSR A;  2VGN A;  1KLM A;  4IBN A;  1NWK A;  5AQM A;  2FF3 B;  3F9K A;  4CHP A;  1VHX A;  4WQ5 A;  3EO3 A;  3UKR A;  1VRT A;  3HPO A;  4LH4 A;  3O3F A;  4B1U B;  4BY9 C;  4DTO A;  3EKS A;  4Z4G A;  4LH5 A;  3PX4 A;  4CGH A;  3VF6 A;  3NF7 A;  4M63 C;  3CC4 N;  4DLG A;  1JLQ A;  4KPY A;  3M3Z A;  3C0B A;  2UXC K;  4CER A;  5AZJ A;  3ISN C;  3C65 A;  2HHW A;  2UYT A;  3SMS A;  4B9S A;  1REV A;  3TWH A;  3BF3 A;  3O5B A;  1W97 L;  3F73 A;  3P38 A;  4J2E A;  4JKC A;  2W6K A;  4KKO A;  5TKW A;  1NKB A;  3TPQ A;  2P9K B;  1WOQ A;  4OLA A;  4WQ5 C;  2D0B A;  3VEY A;  3HOT A;  2X78 A;  1QVG M;  1VQ6 N;  4KFB A;  3HYF A;  1J5O A;  3D2E A;  2HF3 A;  2CGJ A;  1XI1 A;  3QDK A;  1VSF A;  4Y1C A;  4CBW A;  3KWG A;  4NXN K;  3VQ6 A;  4XH4 A;  1QVF M;  3TTD A;  3PIP L;  1TGO A;  2P9S A;  1D4X A;  3TTC A;  1TL3 A;  2KHO A;  4JI5 K;  2GV9 A;  1DT9 A;  3NF6 A;  3ZT3 A;  4CJL A;  1M90 O;  3SAH A;  5IT9 O;  4AIL C;  3P5J A;  5JIC A;  3V1O A;  4JKF A;  2UU9 K;  4GVE A;  2FSK A;  1HUX A;  4CF1 A;  1QSY A;  3LDP A;  3VGK A;  1JXE A;  1YJW N;  2HF4 A;  1QZ5 A;  2RE2 A;  5BR8 K;  1HYS A;  1CZA N;  3JS6 A;  1OH7 A;  3K5M A;  2UUC K;  3OYF A;  4O5B A;  3NF9 A;  4E7H A;  4DTU A;  3MWP A;  2E6L A;  3DWL A;  3AO3 A;  2NRX A;  5AZI A;  3NGZ A;  5M1K A;  3K0S A;  1NK4 A;  4B1X B;  3KIO A;  1BL3 A;  2H3G X;  3AAR A;  3P31 A;  4CIG A;  3KLG A;  3H3O B;  4I6M B;  2X6S A;  3K5L A;  4JV5 K;  3K2P A;  3ZT1 A;  5CHI A;  4CEQ A;  1JKH A;  1KAY A;  2KTQ A;  3QNN A;  4FPA A;  3ZSX A;  2QKB A;  2ZJQ L;  3D45 A;  1Q9Y A;  3TSP A;  4CEB A;  3LAK A;  2FBX A;  3WXJ A;  5AQF A;  3ZET B;  5AZI B;  1UOC A;  4LF8 K;  3KZB A;  1RTH A;  2HHU A;  2BAN A;  3DLK A;  3R3L A;  1C1C A;  5GAD P;  1BO5 O;  4CJ7 A;  3AVL A;  3VEZ A;  4KBO A;  1D9D A;  2ZD1 A;  4DR7 K;  1NK6 A;  4C8L A;  1RDD A;  1IO2 A;  4FWQ A;  3GBT A;  1NMD A;  2VWJ A;  1YVU A;  1NM1 A;  1BDG A;  2IAJ A;  4DS5 A;  3SI6 A;  4RTF D;  2ITG A;  5JMV A;  4KB1 A;  3HM9 A;  2GTD A;  4IFV A;  4EZ9 A;  3G6E N;  2QXL A;  2P9P B;  2Q31 A;  1BI4 A;  4BVO A;  1Q18 A;  5KPZ A;  3RMB A;  2JWL A;  3MCA B;  3A0I X;  1RNH A;  1GLE G;  5CY4 A;  3G10 A;  4DQI A;  2NRR A;  1EP4 A;  4FWN A;  2HBM A;  4JKB A;  2F7T A;  1XNQ K;  1WBB A;  3SUO A;  4FW2 A;  4ICL A;  1LWF A;  2YNI A;  3VET A;  4FYD A;  1MA9 B;  3OYA A;  3DLB A;  3MAQ A;  3UKR B;  1B9F A;  2YV0 X;  1VSL A;  5J1E A;  1VQ5 N;  1TUU A;  3CJ1 A;  4CJF A;  1SKR A;  4FWO A;  3NAE A;  1TYQ A;  4NXM K;  2ZE2 A;  3OA9 A;  1U4B A;  5FRN A;  4IO8 A;  1S1X A;  3CFO A;  3FE1 A;  3O3H A;  3M8Q A;  4IG0 A;  4H0P A;  5DM7 L;  2I5J A;  3O4W A;  3LP1 A;  3TAE A;  3CCM N;  3NGI A;  3ZSQ A;  2YHY A;  3VTI A;  4DLE A;  1C1B A;  2NRZ A;  3T3F A;  2BH1 A;  4Z94 A;  3DI6 A;  1YHQ N;  3H46 O;  3O4Q A;  1NGG A;  1T3V A;  5FPM A;  5C42 A;  5GIN A;  4YOW A;  1T03 A;  4ELT A;  4DMN A;  1D8Y A;  2P9U B;  4UY8 O;  4OPJ A;  3IUC A;  3NCI A;  3PY8 A;  3M5R A;  3O1W A;  2ASO A;  3AVI A;  1BIZ A;  4MFB A;  3AV9 A;  4CJP A;  4CIE A;  4PQU A;  4PKI A;  2ZM6 K;  2Q97 A;  1Y64 A;  3IFR A;  2A40 A;  1OH6 A;  4H0V B;  3TAG A;  4EAH D;  5CR4 A;  2G8H A;  4BGB A;  1RDC A;  4C8M A;  4DV3 K;  4G9Z A;  2HNY A;  3TR8 A;  3ASM A;  3J7Y P;  4HUF A;  5BRH A;  1ZBU A;  3TAB A;  4A62 A;  1NGB A;  4JK8 A;  3FFK B;  4LC9 B;  4KHY A;  3OYE A;  2OZM A;  5LJW A;  1SQK A;  1V4S A;  3OYM A;  4DTJ A;  3MN9 A;  5GIP A;  2GUP A;  3T1A A;  4BRN A;  1KC8 O;  4K0K K;  2W6L A;  2CGL A;  4JKH A;  1TKD A;  4HCC A;  4B9M A;  1C1A A;  4FJ7 A;  4CED A;  3DOK A;  1YJN N;  3VEN A;  2QTD A;  5I3U A;  4DR4 K;  4FJK A;  3CJB A;  4BWJ A;  4IFY A;  1YT3 A;  3W3D A;  5JLH A;  4DFK A;  2XY8 A;  1VQM N;  4GKJ K;  2HHH K;  3LM9 A;  1BG3 A;  2E1Z A;  1EET A;  3CIP A;  3OVN A;  4K41 A;  1LWC A;  1RBR A;  1FJG K;  4DSE A;  2E4L A;  3FZM A;  3P83 D;  1MWK A;  4KH6 A;  3DXK B;  4RW6 A;  3VA3 A;  3ZET A;  1XQS C;  1VQ8 N;  4DV5 K;  4CCH A;  4F2S A;  4FJG A;  1ATN A;  4M3Y A;  3SCX A;  3NDK A;  3K58 A;  4W5T A;  3LL3 A;  4DV2 K;  1NJZ A;  4F2R A;  1G99 A;  2PAV A;  2DFH A;  2IIR A;  1TK0 A;  1C6V A;  5JLF A;  3ZX3 A;  2D5R A;  1KLN A;  3DLE A;  4B3R K;  2HBK A;  3SAG A;  1L3T A;  2QWN A;  4JK7 A;  2NNW A;  1Q9X A;  1GLJ O;  1K8A O;  2VG7 A;  4PL7 A;  2HHX A;  3WEE A;  5C10 A;  4O5F A;  2JGU A;  3R9P A;  5BN9 A;  5AFU H;  4CD1 A;  3AVG A;  4BQZ A;  1KXP A;  2F8T A;  5BPM A;  4FWP A; 
#chains in the Genus database with same CATH homology
 4KB0 A;  3OJS A;  4FM1 A;  5C24 A;  4Z4E A;  3CM6 A;  3DRS A;  4BWM A;  5HRR A;  2PYL A;  1RT3 A;  3OYL A;  3KLH A;  1RTI A;  4CGD A;  2BGG A;  2DFE A;  4RW9 A;  3VQ9 A;  3HPH A;  1MU2 A;  4CJR A;  1J9A A;  3KKR A;  1C0T A;  2W42 A;  3NF8 A;  5KRT A;  1L3V A;  5D3G A;  3QEP A;  3M8P A;  4FVM A;  2G8V A;  1ZBH A;  4BDP A;  3UIQ A;  3V9S A;  4CEA A;  1S1U A;  4FK4 A;  3AVJ A;  4LSL A;  2HND A;  1DLO A;  3L3V A;  4O44 A;  1UWB A;  5SWM A;  3EZ5 A;  4LY7 A;  1X9M A;  1SL2 A;  1L5U A;  3OS0 A;  3AA3 A;  4M3Z A;  3U3Y A;  2FC0 A;  4CHZ A;  5CZ2 A;  4J2D A;  4FJH A;  4CGG A;  2A1R A;  4XIU A;  4E7I A;  1RIL A;  2B6A A;  3ZSZ A;  3TAN A;  4FLT A;  1S6P A;  3TI0 A;  1W0H A;  3RWU A;  4KHN A;  4FJN A;  4PY5 A;  3TAF A;  1BCO A;  2VG6 A;  1HMV A;  4HCB A;  4FJJ A;  4M42 A;  2RPI A;  1QE1 A;  1B9D A;  3SUQ A;  1X9W A;  3PO4 A;  3KD5 E;  4CF2 A;  1KVC A;  1NK0 A;  4FJM A;  1FKP A;  3OY9 A;  4QOZ B;  4I2Q A;  3IG1 A;  5E41 A;  4B9L A;  3RTV A;  3L2Q A;  1CXQ A;  1SV5 A;  4FM2 A;  4E1M A;  3QEI A;  3S3N A;  1XHX A;  3U6F A;  3V6D A;  1QTM A;  2HHQ A;  1RT1 A;  4GMJ B;  3AA2 A;  4W5R A;  3SV3 A;  4E3S A;  4Z4I A;  2EX3 A;  3LZJ A;  4YNQ A;  4FJ5 A;  2QK9 A;  1NK7 A;  4WE1 A;  1JLG A;  4K8X A;  4J2A A;  1JLA A;  4GW6 A;  1SUQ A;  1S1T A;  1WSF A;  2OPR A;  3I0S A;  4CEF A;  3HVR A;  2ZQB A;  2PY5 A;  4I7F A;  1DTQ A;  4DF4 A;  5HRS A;  2HMI A;  1JXB A;  1KSP A;  1L3S A;  3V9W A;  4ZHR A;  4CK1 A;  1KRP A;  4L8R B;  4FLY A;  1TK8 A;  1D9F A;  3AVA A;  3SUP A;  5HRN A;  4NCB A;  2FBV A;  3AVF A;  4DTM A;  4ID5 A;  1RT7 A;  3AVB A;  3ZSR A;  3D0P A;  4UQG A;  4LSN A;  2OA8 A;  4IBN A;  1KLM A;  3P1G A;  2O4G A;  4Y1D A;  3V1Q A;  3K57 A;  2HB5 A;  3F9K A;  4F4K A;  4CHP A;  3AVK A;  4DFJ A;  4ID1 A;  4OLB A;  3HPO A;  1VRT A;  4LH4 A;  3QER A;  4AHT A;  3O3F A;  3L8B A;  4B9T A;  3MEE A;  4H8K A;  4DTO A;  1NJX A;  4Z4G A;  4KRE A;  2YKM A;  4LH5 A;  4CGH A;  3PX4 A;  4FJL A;  3NF7 A;  1WN7 A;  1FXX A;  1GOA A;  3MXM A;  3QLH A;  4DLG A;  1G15 A;  1JLQ A;  4KPY A;  4RW4 A;  4OKE A;  4CER A;  3KK1 A;  3ISN C;  3M8R A;  4B3O A;  1VSM A;  2HHW A;  3VQ4 A;  4N47 A;  1IKY A;  4B9S A;  1REV A;  3TWH A;  5KGW A;  3L2R A;  3VA0 A;  4NCG A;  2P5O A;  3F73 A;  1UA0 A;  4J2E A;  3K59 A;  4HHT A;  4KKO A;  1RBU A;  4MQ3 A;  3PX0 A;  2HVH A;  1S1V A;  2LSN A;  3QIO A;  3HXM A;  3LDS A;  1NKB A;  1VSK A;  1O1W A;  1SL1 A;  4OLA A;  1I3A A;  2D0B A;  3PX6 A;  3AA4 A;  3SPZ A;  4CEO A;  2XY7 A;  2X78 A;  3U3G A;  3SQ2 A;  2G8I A;  1U48 A;  1BQN A;  3AO2 A;  3ITH A;  3TAP A;  4IKF A;  1Q8I A;  4KFB A;  2HW3 A;  5JS2 A;  1RT4 A;  1ASV A;  3IAY A;  3HYF A;  1SKW A;  1J53 A;  5K14 A;  4CF0 A;  3HP9 A;  4FZX C;  2OPS A;  4GVM A;  1J5O A;  2GBZ A;  1XC9 A;  4I9Q A;  1EX4 A;  4O55 A;  4YFU A;  4CJW A;  3WNF A;  3VQ8 A;  3S3M A;  1J54 A;  4E0D A;  1HQU A;  1XI1 A;  3LP0 A;  2HHT A;  3VQD A;  2YHA A;  3BGR A;  1VSF A;  2WON A;  4Y1C A;  3SQ1 A;  2QKK A;  4DSI A;  3VQ6 A;  3AO5 A;  5KGX A;  3HST B;  2Q3S A;  1TGO A;  3CFR A;  2DTU A;  1TL3 A;  1WLJ A;  4KTW A;  2GV9 A;  3NF6 A;  5FRM A;  1CLQ A;  4E7J A;  3SJJ A;  2FBT A;  3ZT3 A;  2HHV A;  4B9N A;  1C0M A;  3B6O A;  3LWL A;  3JYT A;  4CJL A;  3QEV A;  1A5V A;  3C6T A;  3A2F A;  3ZSY A;  4CJ4 A;  4DTX A;  1GOB A;  4DU1 A;  1TKZ A;  4AIL C;  2ETJ A;  3P5J A;  3V1O A;  5EU7 A;  2RKI A;  3AO1 A;  4CF1 A;  3QEW A;  1QSY A;  2IGI A;  1BGX T;  3SZ2 A;  1NOY A;  3MED A;  1JL2 A;  1JXE A;  4Q5V A;  4C8N A;  4DS4 A;  5I42 A;  4DWI A;  4FM0 A;  1S9G A;  1WSJ A;  1BCM A;  1S1W A;  4H4M A;  3PO5 A;  4FXD A;  1HYS A;  4H4O A;  4CFC A;  4DQP A;  3OYN A;  3K5M A;  4CJK A;  3TAQ A;  3DRP A;  3OYF A;  3E01 A;  1VSH A;  4FZY A;  4O5B A;  3JSM A;  3NF9 A;  4E7H A;  4DTU A;  1BHL A;  3VQ5 A;  3MXJ A;  1A5W A;  1ASW A;  3QIP A;  4W5O A;  2E6L A;  1GOC A;  3OYJ A;  4CJU A;  2B4J A;  1HNI A;  4AHU A;  1ZBI A;  1TL1 A;  5J2P A;  1RBS A;  4ZTF A;  3AO3 A;  2PYJ A;  4FZZ A;  3QES A;  2OYQ A;  3NGZ A;  3VQ7 A;  1W9H A;  5C25 A;  4DFM A;  1NK4 A;  3ULD A;  4OGC A;  5J2N A;  2XY5 A;  4Z0U A;  4HUG A;  5DMR A;  1VSI A;  1WSE A;  1JLB A;  1I39 A;  1TV6 A;  1S9E A;  3KIO A;  1BL3 A;  3IRX A;  3MXI A;  4M45 A;  4N5S A;  4CIG A;  4PUO A;  1U49 A;  3DLH A;  1CZ9 A;  2KZZ A;  3KLG A;  4ELU A;  1LW0 A;  3K5L A;  2X6S A;  3QO9 A;  5CYQ A;  1XHZ A;  1U45 A;  1KFD A;  3K2P A;  4DF8 A;  3ZT1 A;  4CEQ A;  1JLE A;  4O0I A;  4CHY A;  1ZBL A;  1Z26 A;  4IG3 A;  4CF9 A;  1SKS A;  1JKH A;  3WNE A;  3CQ8 A;  2YHB A;  4CJQ A;  3ZT0 A;  4J2B A;  3ZSV A;  3QNN A;  2G8K A;  2KTQ A;  4W5N A;  4OPK A;  3VN5 A;  3PV8 A;  3S9H A;  4KI6 A;  4Q0B A;  3ZSX A;  3BDP A;  4OKK A;  4FCY A;  2QKB A;  2BDP A;  3D45 A;  1TKX A;  3S3O A;  1Q9Y A;  2X6N A;  4KRF A;  3AVC A;  4CEB A;  3LAK A;  5DK5 A;  4BE2 A;  4KI4 A;  5HRP A;  3NE6 A;  2FBX A;  5HLF A;  3M8S A;  3LPU A;  4E89 A;  4TSX A;  4DSK A;  4HUE A;  1UOC A;  4CHQ A;  1NK8 A;  1RTH A;  2HHU A;  2BAN A;  2DY4 A;  1NOZ A;  3DLK A;  1C1C A;  3WNG A;  2AJQ A;  1T7P A;  2YKN A;  1KVB A;  1BIU A;  1JL1 A;  3IS9 A;  2VWK A;  3AVL A;  2F96 A;  2P1J A;  4KTZ A;  4DTS A;  2ZD1 A;  1D9D A;  1NK6 A;  1IKW A;  2OPP A;  1RDD A;  1IO2 A;  5KTQ A;  4FLX A;  3RRH A;  5HP1 A;  4C8L A;  1T8E A;  4FJ8 A;  2KFZ A;  4DTP A;  3TAM A;  3SQ0 A;  1X9S A;  5HBM A;  4CEE A;  2VWJ A;  1YVU A;  1TVR A;  3KD1 E;  4W5Q A;  1IKX A;  2IAJ A;  4DS5 A;  2OZS A;  4FW1 A;  3SI6 A;  2KFN A;  1R0A A;  2ITG A;  1RT6 A;  3CFP A;  1HYZ A;  4KB1 A;  4FJ9 A;  4PWD A;  3OYB A;  3HM9 A;  2IDO A;  2IOC A;  4IFV A;  4EZ9 A;  4HTU A;  2XHB A;  1NJW A;  1HRH A;  4KTQ A;  3CG7 A;  4KHS A;  1BI4 A;  1YTU A;  3RRG A;  1L3U A;  3RMB A;  4B8A B;  1JLF A;  3I0R A;  2X74 A;  1RNH A;  3NH0 A;  1U04 A;  5CY4 A;  4DQS A;  4EP4 A;  4KV8 A;  3G10 A;  3VQC A;  1ASU A;  5KI6 A;  5T7B A;  1VK0 A;  1IH7 A;  1QHT A;  1U47 A;  1EP4 A;  4DQI A;  4DU3 A;  2KZM A;  1VRU A;  3HVT A;  4E7K A;  1WSH A;  2PZS A;  4KO0 A;  1BQM A;  4OJR A;  4FJX A;  3SUO A;  3O3G A;  4FW2 A;  3MEG A;  1LWF A;  4ICL A;  3NHG A;  1IKV A;  4BAC A;  4FLZ A;  3SV4 A;  1QSS A;  4FLV A;  4KHQ A;  1WSI A;  2YNI A;  4DG1 A;  3HJF A;  3KK2 A;  1NJY A;  1FKO A;  1QQC A;  3MEC A;  3FFI A;  3OJU A;  4FYD A;  3LZI A;  1FK9 A;  4CJS A;  3OYA A;  4LD0 A;  3K5O A;  3DLB A;  3MAQ A;  4K8Z A;  3LP2 A;  1CZB A;  1B9F A;  3WNH A;  3OYC A;  3KK3 A;  2YV0 X;  1VSL A;  1Y97 A;  3LPT A;  3SNN A;  1DTT A;  4RG8 A;  1S6Q A;  3KKS A;  1KVA A;  4IDK A;  5J1E A;  4E7L A;  3LAN A;  3NH1 A;  1EKE A;  3V81 A;  4E1N A;  3QIN A;  4FK0 A;  4CJF A;  1SKR A;  1ZYQ A;  2G8F A;  3EYZ A;  3NAE A;  3OS2 A;  2ZE2 A;  4CEZ A;  3AVH A;  3DOL A;  4AHV A;  1Z25 A;  3I8D A;  1U4B A;  2P5G A;  5FRN A;  3HT3 A;  1X1P A;  1S1X A;  3CFO A;  3VQA A;  1RBV A;  1UA1 A;  1WAJ A;  4CK3 A;  3O3H A;  4AH9 A;  3M8Q A;  4IG0 A;  4FLU A;  3NH2 A;  2I5J A;  1NKE A;  3LP1 A;  4JS5 A;  4E19 A;  3TAE A;  3NGI A;  3ZSQ A;  4DLE A;  3SUN A;  1VSJ A;  1C1B A;  4DTR A;  4B9V A;  3DLG A;  4CJ3 A;  1WAF A;  1C0U A;  2G8U A;  3O4N A;  3VQP A;  3T3F A;  4M3X A;  3DI6 A;  4M3W A;  4HVJ A;  1BI4 B;  4BE1 A;  1QSL A;  2ATQ A;  3RMA A;  4DSL A;  4N56 A;  4CF8 A;  3O4Q A;  2Z1H A;  3ALY A;  4CGF A;  1IG9 A;  2WOM A;  5C42 A;  5FRO A;  3RR7 A;  3NFA A;  3VQQ A;  1T03 A;  3KLF A;  3SQ4 A;  4ELV A;  4NYN A;  4ELT A;  2RF2 A;  3PUF A;  4DMN A;  3VQE A;  4DFP A;  1NK9 A;  4CFD A;  4NYF A;  1D8Y A;  4KHU A;  1LV5 A;  4DU4 A;  4PA1 A;  3CYM A;  4OPJ A;  3L2W A;  3NCI A;  3V9U A;  3PY8 A;  3RMD A;  4CHN A;  4OVL A;  4CJT A;  5HRO A;  4CJE A;  4OKJ A;  3ZT4 A;  1RT5 A;  2G8W A;  1RTJ A;  2XRI A;  3H08 A;  3AVI A;  4QAG A;  1BIZ A;  5SZT A;  4M3R A;  2OPQ A;  3AV9 A;  4MFB A;  3ZCM A;  4DSF A;  4FK2 A;  2HVI A;  4CJP A;  2Y1J A;  5JS1 A;  4CIE A;  4PQU A;  3V1R A;  2P51 A;  4M41 A;  2HNZ A;  1WSG A;  3V9Z A;  4ZTJ A;  1T05 A;  4N41 A;  3DM2 A;  1BIS A;  1TAQ A;  4DQR A;  4JS4 A;  4JRP A;  3ZSO A;  1ITG A;  4F8R A;  3HL8 A;  3VQB A;  3TAG A;  2B5J A;  1YTA A;  1CXU A;  1TAU A;  1S5J A;  2F8S A;  2G8H A;  1VSD A;  4QCL A;  4F3T A;  4CES A;  1RDC A;  4C8M A;  2KW4 A;  2HNY A;  4R5P A;  3L2U A;  3V9X A;  4KAZ A;  4Z4F A;  3TR8 A;  4JLH A;  3T19 A;  3G0Z A;  3ASM A;  3C94 A;  5FDL A;  4AHC A;  4HUF A;  1ZBU A;  3TAB A;  1LAW A;  2KQ2 A;  3KLI A;  1HYV A;  2EHG A;  5KRS A;  1UAX A;  4DSJ A;  4B9U A;  3ZSW A;  3NGY A;  3KJV A;  3L3U A;  4FJI A;  4CEC A;  4C8O A;  2A1S A;  4AHS A;  4KHY A;  4BDY A;  3OYE A;  4CGJ A;  3AO4 A;  3NBP A;  1SL0 A;  2OZM A;  4NCA A;  2YNG A;  4CJV A;  1HQE A;  3OYM A;  1ZBF A;  4DTJ A;  4FLW A;  4CJ5 A;  2XO7 A;  1NKC A;  2IS3 A;  2D0C A;  4I9L A;  1RCH A;  3OYD A;  4DQQ A;  3T1A A;  2Z1I A;  1LW2 A;  4I2P A;  3RMC A;  3SPY A;  1TKD A;  3AVN A;  4HCC A;  4B9M A;  1C1A A;  3CM5 A;  4FJ7 A;  4CED A;  1HNV A;  3DOK A;  3DYA A;  5CYM A;  1KTQ A;  3ZT2 A;  2XY6 A;  2BE2 A;  1RBT A;  4G1Q A;  1LAV A;  4OGE A;  1RDA A;  1VSE A;  3HP6 A;  5I3U A;  4O0J A;  1HJR A;  2NUB A;  4EP5 A;  4FJK A;  4KHW A;  4BWJ A;  4IFY A;  1YT3 A;  1TK5 A;  3KLE A;  4DFK A;  3HK2 A;  2XY8 A;  4DTN A;  2YNH A;  3TAR A;  4B8C A;  3HO1 A;  3LAL A;  1K6Y A;  3SYZ A;  1EET A;  3OVN A;  4N76 A;  4Z4C A;  1LWC A;  2Z1G A;  3OYG A;  3K5N A;  3C95 A;  3DLR A;  1RBR A;  3LP3 A;  1EXQ A;  1NK5 A;  4EZ6 A;  3HPG A;  4BDZ A;  5CZ1 A;  3DRR A;  4CE9 A;  4DSE A;  1XWL A;  2E4L A;  3P83 D;  1N6Q A;  1N5Y A;  1LWE A;  4O4G A;  4RW6 A;  3QEX A;  3KTQ A;  3VA3 A;  1WNS A;  2IC3 A;  1B92 A;  2Z1J A;  5J2M A;  3AVM A;  2Y1I A;  4CCH A;  4F2S A;  4FJG A;  1RTD A;  3EY1 A;  3QET A;  2FBY A;  3L2V A;  3AA5 X;  3OS1 A;  4M3T A;  4M3Y A;  4CGI A;  4CFB A;  2E6M A;  4RW8 A;  2RN2 A;  3B6P A;  3SCX A;  4M3U A;  3NDK A;  3K58 A;  1KFS A;  4W5T A;  2DFF A;  4B08 A;  2R7Y A;  4JRQ A;  2YNF A;  1NJZ A;  3C6U A;  2GUI A;  4F2R A;  1HPZ A;  2VG5 A;  4AHR A;  1RT2 A;  2DFH A;  3V4I A;  2QXF A;  1TK0 A;  1C6V A;  3QNO A;  1TKT A;  3OYI A;  1A5X A;  2D5R A;  1KLN A;  3DLE A;  1RDB A;  3THV A;  3OYK A;  5J2Q A;  1JLC A;  4F3O A;  3DMJ A;  2O4I A;  4CIF A;  2JLE A;  4Z4H A;  3LWM A;  1L3T A;  2HHS A;  4CK2 A;  1Q9X A;  2VG7 A;  2HHX A;  1KCF A;  1QS4 A;  3LAM A;  4BE0 A;  1F21 A;  2JGU A;  4CHO A;  3AVG A;  4CFA A;  4RW7 A;  2F8T A;  1D5A A;  3OYH A;  2D0A A;  3RR8 A;  4C8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...