3VQCA

Hiv-1 in core domain in complex with (5-methyl-3-phenyl-1,2-oxazol-4-yl)methanol
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
151
structure length
141
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPSMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
molecule keywords POL polyprotein
total genus 49
structure length 141
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqcA00
4K8ZA 4RG8A 1RBSA 2QKKA 3NH1A 1ASVA 2XHBA 3DOKA 3NF7A 4DTJA 4C8MA 3B6OA 3KIOA 4BDYA 1JLGA 3IS9A 2P1JA 4MQ3A 4KRFA 4BWMA 3AVCA 5CY4A 4CF9A 4KB0A 4FZXC 1JLEA 3M8PA 1WAJA 4W5TA 3KK2A 4E89A 3QEPA 3DRPA 4N41A 4CJTA 3JSMA 1C6VA 3M8SA 4FK2A 3DRRA 4DLEA 4CEOA 4KI4A 1CZ9A 1JKHA 1HPZA 1VSMA 3QESA 3DRSA 1NJYA 4KO0A 4ZTJA 3AO2A 1YTUA 1RT1A 1ZBUA 3LALA 1G15A 1DLOA 1U04A 4IBNA 3U3GA 3KLGA 3V4IA 4Z4IA 1UAXA 1I39A 3TI0A 2PZSA 3AVAA 3AVJA 5JS2A 4GMJB 1TV6A 3OYAA 1TKXA 3V1OA 1LAVA 2BE2A 1WSJA 4Y1DA 3ZSZA 3AA3A 4M42A 1W0HA 3SQ2A 2B4JA 3OYKA 3SV3A 3LWLA 2OZSA 4DSKA 1JXEA 3VQAA 1J53A 1GOCA 4ZTFA 1HQUA 1HRHA 4O0JA 4OLAA 3RMDA 4FJGA 4HTUA 4E7KA 5HROA 4Q5VA 3T19A 4FJXA 4NCAA 1RTJA 2FBVA 2GUIA 3LP0A 3V9SA 4FZZA 4ID5A 1VSIA 4RW8A 1Q9XA 2HHUA 1UA1A 3FFIA 3ULDA 1RBRA 2ITGA 3OYNA 4NYNA 3SI6A 3NAEA 4EP4A 3V9UA 4OKEA 1NK4A 4OJRA 4CIFA 4F3TA 3VQQA 2VG5A 2F8TA 2G8KA 1B92A 1VRUA 3K5NA 1KFDA 3ZT2A 4B8CA 2FC0A 1TAUA 4FW2A 4CJ4A 3TARA 3AVIA 5C25A 3OYCA 5J2QA 1IKWA 3LZIA 4W5RA 4RW6A 1A5XA 2OYQA 4H4MA 4DU3A 4CF8A 3OS0A 4ELTA 1BL3A 4AHSA 1BCOA 3VA3A 5HP1A 3LANA 4DSLA 2DY4A 1XWLA 4ID1A 4CGJA 1VSKA 4FLWA 4E7LA 1A5WA 1HYVA 3SJJA 4B9TA 4CJFA 1WSHA 4CK3A 1W9HA 2HHSA 3QLHA 4CEEA 4CK2A 3KLFA 2HHWA 5CZ1A 4FLYA 3D45A 1HNVA 3VQPA 3BDPA 1EP4A 2HVIA 1BI4B 3ZSOA 3QERA 3HK2A 4I2QA 4CHZA 4C8NA 4KTWA 4BDPA 2YKMA 1DTQA 4CHOA 3K59A 2WONA 2VWKA 1CXUA 4GVMA 1T03A 1UOCA 2IOCA 2HHVA 1SV5A 5J1EA 1DTTA 3LDSA 1K6YA 4FLUA 2O4IA 1X9WA 2DFHA 4AHVA 3M8RA 4YFUA 4PQUA 2E6LA 1C0UA 3T1AA 1L3UA 4B9LA 1O1WA 3DLRA 1LW2A 2HMIA 3PY8A 2F8SA 3LP1A 2FBTA 4DFPA 3AO1A 4M3ZA 2DTUA 3AVBA 5KTQA 4HUGA 1NKEA 1J5OA 2HVHA 1TVRA 3HSTB 1YVUA 1BGXT 2RKIA 3L3UA 3NF6A 5K14A 4CIEA 4DTUA 1L3SA 4B9NA 4O44A 4FZYA 2P5OA 1S9EA 4Y1CA 4KHUA 1RCHA 2P5GA 1UWBA 1NKCA 4NYFA 1BQMA 4I9LA 2XY7A 3EY1A 2G8VA 3IG1A 3OYIA 1FKPA 2BANA 2YHAA 3L2VA 4DTOA 4ELUA 4DFJA 1ZBLA 2YNFA 3TAGA 3LZJA 3AO3A 5KRTA 2PYJA 4ELVA 1XHXA 5C42A 3OYMA 1VK0A 4OKKA 1U48A 1VSJA 3S3OA 4KHWA 4CJQA 3THVA 3OJUA 3SUPA 4ICLA 1NJZA 4EZ6A 1TKZA 4O0IA 3SZ2A 4PUOA 1C1CA 2QXFA 3VQDA 3ZT4A 4HCBA 3V6DA 1NK5A 1QSLA 4LH4A 5HRPA 2DFFA 4FJLA 4IG3A 3KD5E 1S6QA 4Z4HA 3VQBA 3OYHA 4BDZA 4AHTA 2KFNA 4KAZA 3WNFA 1KCFA 2G8WA 1JLCA 2Z1IA 4FJ8A 2A1RA 4JS4A 4CCHA 3RTVA 2X6NA 3QIPA 1LWEA 1IKYA 4KTZA 1TK5A 1S1UA 5KGWA 3MEGA 3TANA 4Z4EA 3PUFA 4CIGA 4FLTA 4CJ3A 1IH7A 4EP5A 3LWMA 3VA0A 4DQRA 5FRMA 4IFVA 4CECA 2YNGA 3HPHA 3OY9A 4FJ5A 3C95A 3KLIA 4KKOA 4CJUA 4CFDA 2KZZA 1TK8A 3CQ8A 3KJVA 4E19A 3VQ6A 3CM5A 3DOLA 4CK1A 3OYEA 3HP9A 1VSFA 3VQ7A 3AA4A 1NJXA 3D0PA 2QKBA 2G8FA 1ZBFA 3AA2A 3SNNA 5DMRA 4CHPA 3ZT1A 3RMBA 5E41A 1X9MA 1QE1A 3CG7A 4KHSA 3TR8A 2D5RA 4CJRA 3KD1E 3TAQA 3WNGA 1EX4A 1JXBA 4W5OA 1ZYQA 1T05A 4KI6A 1TL3A 4FM2A 3VQCA 2B6AA 2IDOA 4IFYA 3SYZA 3KLHA 4CEDA 4KTQA 3NGZA 1Z26A 1ASUA 1JLQA 3M8QA 2ZD1A 4CGDA 1NKBA 4C8KA 1WSFA 2Z1GA 1NK0A 4M3XA 3AA5X 4N47A 3I0SA 3VQ5A 1RBVA 2ZQBA 4DF4A 4I9QA 1RDBA 3RWUA 3QEXA 2HHTA 3ZSQA 4CHQA 1KFSA 1MU2A 1RT5A 3HP6A 3VQ8A 4O4GA 4E1MA 3UIQA 1VSLA 3LPTA 4DSFA 1RT6A 4YNQA 1TK0A 4KV8A 2B5JA 2A1SA 3KKRA 2Z1JA 3O3GA 1S1XA 3OYDA 3PX4A 4J2AA 3QEVA 4GW6A 1REVA 5C24A 3NE6A 3RMCA 4FJIA 3ZSYA 3SV4A 1RBUA 3K5LA 1SKWA 3KTQA 4FJHA 3RRGA 1Z25A 4KFBA 5T7BA 4AILC 3SUQA 1RILA 4AHCA 3S3MA 2D0AA 4B9VA 4BE0A 4DQQA 1RBTA 1U4BA 1TKDA 2RN2A 3K5MA 4BE1A 5FDLA 4UQGA 4HCCA 2HB5A 4E3SA 2E6MA 3G0ZA 2XRIA 1QHTA 4FLZA 4TSXA 4LD0A 4I7FA 1D8YA 3EZ5A 4M3UA 1BI4A 1BIZA 4OVLA 2VWJA 3ITHA 1NK8A 1L5UA 4CEFA 3AVMA 2XY5A 1JL1A 4OKJA 1YT3A 3PV8A 3SQ0A 5D3GA 1XC9A 2OPSA 3ZT0A 3NH0A 1I3AA 2PY5A 4FJNA 3CFPA 1QQCA 1HQEA 1VSHA 1KRPA 4F8RA 1KSPA 1TKTA 1FK9A 4HUEA 3S3NA 2BDPA 1VRTA 1U47A 1JLAA 4N56A 1S1WA 3F73A 4CERA 4B9UA 4AHRA 3QEWA 1EETA 4L8RB 3NF8A 4E7JA 3O4NA 1U49A 2X78A 3C6UA 2YKNA 3C94A 3OYBA 3NGIA 3TAFA 4E0DA 3KKSA 1YTAA 4HHTA 4FM0A 1JLFA 2I5JA 4H8KA 5KGXA 3NH2A 4DQSA 3SPZA 3MECA 4M3YA 4DQIA 1TGOA 4E7IA 4CFAA 3L8BA 1S6PA 3QNOA 4B9SA 4FXDA 3HXMA 2Y1IA 1EKEA 3ZSVA 3CFRA 1NK6A 2AJQA 4ZHRA 1J54A 3P5JA 4CF1A 4DTXA 2D0BA 1XHZA 4M41A 1A5VA 3MEEA 3VN5A 1WNSA 4BE2A 3QETA 3AVNA 4H4OA 4Q0BA 1LAWA 1NOZA 1S5JA 3DI6A 2X74A 4F4KA 3HT3A 1TAQA 4OLBA 4PWDA 2HHXA 2KW4A 3PX0A 3DMJA 4N76A 4Z4GA 4JLHA 4KHQA 4NCGA 4B08A 4WE1A 1RT3A 1QSSA 3MXMA 1T8EA 3HM9A 1HNIA 4K8XA 2F96A 2OPQA 4FCYA 1NOYA 3S9HA 1BQNA 1CZBA 4R5PA 1FKOA 1UA0A 3P1GA 4G1QA 3TAMA 5SZTA 2NUBA 1SL2A 4CF0A 3CYMA 1GOAA 5FRNA 3ASMA 1Y97A 4CJPA 1GOBA 2OPPA 3SQ4A 4DU1A 4C8OA 4IKFA 3KLEA 2OZMA 1D5AA 4IDKA 2HHQA 4CEQA 1RT2A 1WSEA 4CE9A 5CZ2A 3DLGA 4DQPA 4DTMA 1ZBIA 4N5SA 3OS1A 1BCMA 1T7PA 1WSIA 3P83D 4CGGA 5SWMA 3OS2A 1D9DA 4CJKA 3G10A 3CFOA 4DTNA 2IAJA 4LSLA 4DU4A 2DFEA 2R7YA 1RDDA 2GV9A 4J2DA 4CEBA 2VG6A 4CGFA 4CGHA 4CESA 1IG9A 3AVGA 1KTQA 4M45A 3WNHA 3L2UA 4MFBA 2EX3A 1NK7A 5CYQA 3AO4A 3VQEA 1NJWA 4F2SA 3HJFA 1C1AA 1WLJA 3K2PA 1SKSA 2IS3A 4KHYA 5I42A 4PY5A 3AVHA 3HL8A 3I8DA 2HNDA 1SL0A 3L3VA 4W5NA 4AHUA 1RDAA 4F3OA 1VSEA 3JYTA 1VSDA 1X9SA 3NGYA 1ITGA 1X1PA 2YHBA 4LSNA 3ZSWA 4CJWA 2W42A 3EYZA 3V1QA 2RPIA 3T3FA 1RTDA 3DLHA 3KK3A 3LP2A 3ZSRA 3ZSXA 1SUQA 4CJVA 5HRSA 4FLXA 3WNEA 3PO4A 1LV5A 4DG1A 3U6FA 5CYMA 4DLGA 2YNIA 4RW4A 1FXXA 3HVTA 1JLBA 4FJMA 4FK4A 5KRSA 2Y1JA 4M3RA 1HYZA 2KZMA 2RF2A 4OGEA 5KI6A 3L2WA 3QINA 3ZT3A 1WAFA 4E7HA 4BWJA 3OJSA 3LAKA 4CHYA 4DFMA 1EXQA 1BIUA 4J2BA 4KREA 1KVCA 2VG7A 2KTQA 4KB1A 1B9DA 3VQ9A 5HRNA 4FM1A 1S1TA 3SPYA 4EZ9A 2JLEA 3ZCMA 1NK9A 3DLBA 4IG0A 2Q3SA 1RNHA 4AH9A 4OPKA 2YNHA 4QAGA 3PX6A 3K58A 3LPUA 5J2NA 4CEZA 3IAYA 3BGRA 4FYDA 4HVJA 1QTMA 1KLNA 4FJ7A 1C0TA 1RDCA 1U45A 5HRRA 3MAQA 2XY6A 4E1NA 1ASWA 3HVRA 5JS1A 4DS5A 1HJRA 3H08A 2ETJA 2QK9A 2KFZA 4W5QA 3DLKA 4DTSA 2P51A 4M3WA 3C6TA 4Z4FA 3HO1A 5FROA 3HYFA 4CF2A 3O3FA 3SCXA 3DLEA 3SUOA 4JS5A 2E4LA 3OYGA 1BHLA 3NBPA 3HPGA 1QSYA 1KVAA 3AO5A 4OGCA 2G8HA 3NHGA 1J9AA 4Z4CA 3OYJA 4OPJA 4DF8A 4FJKA 3RMAA 2IC3A 4DS4A 4J2EA 3OYLA 3MXIA 1SL1A 4LH5A 1C1BA 2XO7A 2LSNA 4CJEA 1IKXA 4DSIA 1RTIA 3K57A 3QEIA 3L2QA 3V1RA 4DTRA 1BISA 4CFCA 4B8AB 5J2PA 3U3YA 1LWCA 1RTHA 2G8UA 3TAEA 3PO5A 2WOMA 2KQ2A 2FBYA 4CJ5A 2OPRA 5HLFA 3IRXA 1CLQA 1SKRA 3TAPA 3RR7A 2XY8A 4O5BA 4CFBA 3VQ4A 3V9XA 4BACA 4C8LA 2BGGA 3QIOA 4NCBA 1F21A 3AVLA 3I0RA 3RRHA 1LWFA 1C0MA 2D0CA 2HW3A 4FLVA 1IO2A 4JRQA 1D9FA 1RT4A 1IKVA 4O55A 4XIUA 1WN7A 3V9WA 4FK0A 2YV0X 2ATQA 2FBXA 4CHNA 4FJ9A 1TL1A 2GBZA 2O4GA 4QOZB 3O3HA 3NDKA 3SUNA 3ISNC 2EHGA 3A2FA 5I3UA 1XI1A 1L3TA 3MXJA 3DYAA 3NF9A 4KHNA 2X6SA 2G8IA 3CM6A 4CEAA 3SQ1A 1S9GA 2OA8A 4RW7A 1KLMA 1ZBHA 4M3TA 1B9FA 5DK5A 4DTPA 1N5YA 1Q9YA 4KPYA 3F9KA 3QO9A 4Z0UA 4F2RA 3L2RA 3LAMA 1CXQA 4DFKA 5HBMA 1N6QA 3OVNA 4FW1A 3K5OA 3RR8A 3NCIA 3AV9A 4DSJA 1JL2A 3V9ZA 4FVMA 1RT7A 3MEDA 3O4QA 4RW9A 4CJSA 2ZE2A 4DMNA 3QNNA 3DM2A 2HNZA 4JRPA 5J2MA 4QCLA 3V81A 4DWIA 1Q8IA 3E01A 2PYLA 2IGIA 1WSGA 1R0AA 1KVBA 4DSEA 3KK1A 3AVKA 1HMVA 2JGUA 1L3VA 1LW0A 3HPOA 4HUFA 1QS4A 1HYSA 4PA1A 4B9MA 4I2PA 5EU7A 3B6PA 4FJJA 4B3OA 2HNYA 3LP3A 2Z1HA 3ALYA 3TABA 4CJLA 3OYFA 3AVFA 3TWHA 1S1VA 3NFAA 4CGIA 4LY7A
chains in the Genus database with same CATH superfamily
4K8ZA 1ZC6A 5FPDA 2E1ZA 3B6OA 1JLGA 4MQ3A 4BWMA 3AVCA 1JLEA 1KAYA 3KK2A 3DRPA 4BR7A 4KI4A 4KH4A 1HNXK 3T7ZA 1BU6O 1CZ9A 1JKHA 1R59O 1VSMA 1RT1A 2QA4N 4Z4IA 1RDWX 2Q1NA 1UAXA 4LC9B 3TI0A 3CJ7A 1YAGA 3CPWM 1MA9B 1TKXA 4JK8A 3V1OA 5JLHA 4B1WB 1BDGA 1W0HA 3UB5A 4WQ4C 2B4JA 2OZSA 3VQAA 1GOCA 1HQUA 3CC7N 5BN9A 4O5FA 5AQRA 1WBDA 2O8BA 2GUIA 3S41A 3HZ6A 3PSFA 1KC8O 2ZM6K 2P9SA 4NYNA 3SAFA 4OKEA 4F3TA 3VQQA 2F8TA 2O8CB 3LDPA 2A6AA 4YHHK 3ZT2A 2FC0A 4CJ4A 5J2QA 2VWBA 1A5XA 2NRWA 4DU3A 3DXMB 3HSCA 1BCOA 4GY2B 4DSLA 2OANA 3BF1A 3CJCA 4CZJA 4E7LA 3R6MA 3EKSA 2FLOA 4WQ4A 1NBWA 4PL8A 3H46O 4CEEA 3D45A 3BDPA 3VETA 2HVIA 1BI4B 3LDQA 2P9SB 3QERA 4I2QA 1QQMA 4BRGA 4FSVA 1VHXA 3K59A 5J1EA 1DTTA 3T1HK 1K6YA 3TSUA 3M8RA 4BC2A 1XMQK 2E6LA 3QBWA 3T1AA 1O1WA 2IVPA 2NNWA 4DFPA 5IT9O 2P9UA 4DV3K 1TVRA 5K14A 2RKIA 4B9NA 1L3SA 5AFUA 1NGBA 3SBTA 4Y1CA 4KHUA 3DJCA 1SQKA 2BTFA 5AQWA 3OYIA 3L2VA 4DTOA 1ZBLA 5BRDA 3AO3A 4H0OA 5KPTA 1U48A 3S3OA 1HNZK 3OJUA 1NJZA 1NGEA 4EZ6A 1TKZA 2QXFA 4JK9A 3QMLA 5HRPA 2YX6A 1S6QA 4DR5K 4BDZA 2P9LB 3R3LA 3WNFA 4WFAL 2G8WA 1JLCA 1J6ZA 4CCHA 3RTVA 4KTZA 1S1UA 2JWLA 2A40A 3MEGA 4L3QA 1XMOK 1JCGA 5FRMA 1IH7A 3FZFA 4DQRA 4A61A 4CECA 2YNGA 5AZJB 3C95A 3KLIA 2P9NB 4FWOA 3ZYYX 1VSFA 2D4WA 4KHSA 3TR8A 3ID8A 4CJRA 4LF7K 4UY8O 1ZYQA 1NGHA 4KI6A 4PKGA 3VQCA 2IDOA 3SYZA 4CEDA 2VYPA 3BUZB 3NGZA 1Z26A 1ASUA 5EX5A 2ZD1A 3I8BA 5E84A 4EHTA 2CGJA 1WOQA 4H0XB 3I0SA 3VQ5A 1RBVA 3C7NA 1RDBA 2HHTA 3QEXA 3ZSQA 1OKJA 1RT5A 3VQ8A 4O4GA 3UIQA 3J80O 3W0LA 4YNQA 1TK0A 1Z6RA 4WFBL 3KKRA 2Z1JA 3O3GA 2P9KA 4GW6A 4DV0K 1NLVA 4ILHA 1VQ7N 1RBUA 3KTQA 4FJHA 5GIPA 4DKWA 5C10A 4AM6A 2D0AA 3ZX3A 4BC5A 5JLFA 1HUXA 1QQNA 4CZEA 3THXA 3MN7A 1QHTA 3CXCM 4I7FA 1BI4A 1BIZA 4OVLA 1NGJA 3H45C 1NGGA 4CEFA 1JL1A 3THWA 2OPSA 3NH0A 4DR1K 4DR2K 5AQSA 4F8RA 1KRPA 1KSPA 1FK9A 1VRTA 4AM7A 1U47A 5B8HA 4N56A 4EFHA 1GLDG 4AHRA 3ZX2A 1EETA 1C0FA 3OYBA 4FWSA 4H0PA 3KKSA 4DV6K 5LY3A 4U67L 3SPZA 2RHKA 1ATRA 2I5JA 5KGXA 4M3YA 2GWKA 4E7IA 3UKRA 3WEEB 4AF1A 4FXDA 4JN4A 3VF4A 2Y1IA 2A3ZA 1J54A 3ZETB 2O8BB 1OVYA 3KWIA 4BE2A 2P9IA 3QETA 3AVNA 1S5JA 4OLBA 4BG9A 4FO0A 4JLHA 1T8EA 3HM9A 1HNIA 2OPQA 4FCYA 1NOYA 3C0BA 4R5PA 1C0GA 4CF0A 4CZHA 3ASMA 1Y97A 4C8OA 2HHQA 2WTUA 5CZ2A 4K42A 4CGGA 1D9DA 3RSEB 2GTDA 4CJKA 3CC2N 4DTNA 2IAJA 3MN9A 2E1YA 3E1YA 3DAWA 1BUPA 2GV9A 3P39A 4JKDA 3L4IA 1IG9A 3WNHA 4MFBA 1NK7A 3AO4A 1C1AA 1SKSA 3GOIA 1BA0A 1JJ2M 1SL0A 3L3VA 4MLEA 1X9SA 5C12A 3K9KA 2QWOA 4CJWA 2W42A 2RPIA 3LM9A 1YJWN 3CMEN 3ZSXA 4CJVA 4FLXA 4JHDB 2YNIA 4RW4A 2OTJN 1YJ9N 3A5OC 4FJMA 5F1XA 2Y1JA 4M3RA 5M1QA 2UUCK 3D2FA 3EEQA 4YORA 3L2WA 4WQ5C 3WQUA 1XNRK 4H5TA 1EXQA 4J2BA 1KXPA 4KREA 4WF9L 4KB1A 1B9DA 3VQ9A 2VGMA 4FM1A 3SPYA 1K9MO 1VAZA 3ZCMA 3L4QA 1NK9A 3NMUA 1RNHA 3PX6A 3K58A 5J2NA 4FYDA 4FJ7A 5HRRA 4GV6A 2XY6A 1E3MA 1HJRA 3OA9A 1RFQA 1IBLK 1NGIA 4M3WA 3M5RA 4CF2A 3GBTA 3SUOA 3MDQA 4JS5A 2E4LA 1FW6A 4QS7A 4BG8A 3NHGA 4OX9K 1J9AA 4Z4CA 4DF8A 4FJKA 4IFEA 3RMAA 4DS4A 3OYLA 1TYQA 1SL1A 1C1BA 1GLAG 1W2BM 1IKXA 3QEIA 3HRGA 3EZWA 3V1RA 4JI0K 5I9EB 5J2PA 2G8UA 3VENA 2KQ2A 5HLFA 4FWNA 2E20A 4OO1J 4CZKA 3J7AP 3RRHA 3I0RA 1LWFA 1IG8A 3C7NB 1IO2A 1RT4A 1BO5O 2YV0X 4A5BA 2FBXA 3SUNA 3A2FA 4FWRA 2YI1A 4JKBA 2G8IA 4CEAA 1S9GA 3LM2A 4RW7A 4OPAA 2OA8A 1ZBHA 3OBWA 4DTPA 5EXWA 1VQ5N 4LF4K 2NRZA 3O9SA 5HBMA 3VEWA 1N6QA 5C15A 1JL2A 4FVMA 4CJSA 4FPBA 4BR2A 1T6CA 3DM2A 2P9NA 1Q8IA 2PYLA 2IGIA 3VEVA 4DR3K 4DSEA 2D0PA 2V7YA 2YJFA 3KK1A 1LW0A 3HPOA 2QWLA 4DUZK 4IEEA 1QS4A 3QBXA 4PA1A 3B6PA 4B3OA 2HNYA 4CJ7A 3O8MA 4B3RK 4LY7A 4RG8A 3G25A 3UKUA 1ASVA 1DKGD 4BRHA 4X66K 2QW9A 2NRXA 1XQSC 1X3MA 4KB0A 5CY4A 4FZXC 2CH6A 4N41A 1WAJA 4E89A 3QEPA 4PKIA 4FK2A 3UKRB 4DLEA 3FZHA 2ITMA 3ULEB 4BRDA 4FWMA 1Q7YO 3QESA 3DRSA 4M7XA 1NJYA 4YOWA 2O8EB 4ZTJA 3LALA 1G15A 1U04A 4IBNA 3SBGA 3M3ZA 1LCUA 5H1SQ 5KQ8A 4YOVA 5JS2A 2BE2A 3AA3A 4JI1K 4AQYK 3LWLA 4DSKA 4ZTFA 2GELA 3A5NC 1M1KO 4FJGA 5HROA 3T19A 3BZKA 2HBMA 3V9SA 4RW8A 2HHUA 3SI6A 4EP4A 1NK4A 3AGKA 4OJRA 1OH7A 2QTDA 2WUSA 3K5NA 5F0XA 4FW2A 3J8AA 4BRQA 3LZIA 4W5RA 2O8FA 2FSNA 4NLBA 3MWTA 4ELTA 2WBNA 3SJJA 1WSHA 1W9HA 3QLHA 4CK2A 1HNVA 4JNEA 1EP4A 2Q31A 3PLAA 3ZSOA 3QB0A 4CHZA 4C8NA 4KTWA 4CHOA 2VWKA 1CXUA 2IOCA 4IWVA 1SV5A 4IO9L 2O4IA 4I6MA 4IJAA 1X9WA 5HOOA 3CQXA 3LP1A 2FBTA 4M3ZA 5KTQA 1BGXT 3L3UA 4DV1K 4DTUA 4X62K 2QWRA 4BR0A 4K41A 1XC3A 2P5GA 1UWBA 2QWPA 1NKCA 2IIRA 1BQMA 4I9LA 3EY1A 4ELUA 3WXMB 2FF6A 4Z94A 3LZJA 5KRTA 2E5LK 2PYJA 4ELVA 1XHXA 1VK0A 4OKKA 3A5LC 4WQ5A 4PUOA 2HHHK 3VQDA 3ZT4A 3V6DA 1NK5A 4LH4A 2Q36A 2DFFA 4H5WA 3OYHA 4ISGA 4JKAA 4KAZA 2Z1IA 1IBMK 2A1RA 1FJGK 3PIPL 3QIPA 1KAZA 4EIAA 5KGWA 4PHTX 4CIGA 3VGMA 3AY9A 4EP5A 3OY9A 3LDNA 1TK8A 3CQ8A 1NG9A 2W41A 3KJVA 3VQ6A 3CM5A 3HP9A 3AA4A 1Y64A 3D0PA 3OHRA 3JS6A 3AA2A 3RMBA 5E41A 3CG7A 3J81O 2NRRA 1K8KA 3WNGA 3EE9A 4A5AA 4W5OA 5AQZA 4FM2A 2F4VK 1GLCG 3H3NO 3KLHA 4BY9C 4B3MK 2FSJA 2ZJQL 1JLQA 4CGDA 2Z1GA 3CJAA 4DQ8A 3HOTA 4M3XA 4BRNA 1VQON 3R1XA 3THXB 2GEMA 3RWUA 4FWQA 1MU2A 1VSLA 3LPTA 1TUYA 4BRKA 4DSFA 3THYA 3MK6A 2GUPA 4KV8A 1E4GT 2E2PA 3QEVA 1Q86O 3SV4A 3K5LA 2YHXA 3RRGA 5ADXH 5T7BA 2RN2A 4UQGA 2XRIA 4FVUA 5M1OA 3EZ5A 1EO1A 1O13A 3PV8A 4OKJA 1YT3A 3HM8A 1I3AA 1QQCA 1VSHA 4HUEA 1VQNN 4B9UA 3MX2A 3QEWA 3NF8A 4E7JA 3NGIA 4KH5A 1S22A 1YTAA 4HHTA 4FM0A 3MECA 4E1JA 5AQGA 4DV7K 4CFAA 3HXMA 1EKEA 1NK6A 4ZHRA 3EE8A 4DTXA 4CF1A 2D0BA 3SMPA 1QVFM 2QEXN 1WNSA 4ISEA 1VQPN 4PWDA 1TAQA 3F5TA 1BG3A 2KW4A 3PX0A 4WE1A 5BRHA 1RT3A 2NLXA 1NWKA 5AQTA 2F96A 2CGKA 3S9HA 1BQNA 1CZBA 3W3DA 3TAMA 3CYMA 1GOAA 4IKFA 4H0YB 1GOBA 2OPPA 4CJPA 1Z05A 3WXIA 4IDKA 2ASOA 4CE9A 4DTMA 1ZBIA 1BCMA 1T7PA 1WSIA 5SWMA 1U6ZA 3P4IA 3O5BA 4DU4A 2DFEA 2R7YA 3O9QA 1HR0K 4FL9A 1W7AA 4J2DA 4CEBA 4CGFA 3AVGA 4M45A 1NJWA 4F2SA 2YHYA 4LFCK 2IS3A 3T69A 3O9RA 1EWQA 5AQNA 4W5NA 3JYTA 1QZ5A 3NGYA 1X1PA 3EYZA 1RTDA 1OH6A 3V1QA 2QWMA 3KK3A 3ZSRA 3WNEA 1LV5A 4X65K 4YOXA 3QICA 4JI7K 1JLBA 4DV4K 3CIPA 5AQIA 2V51B 2KZMA 1GLEG 3VEZA 3UE5A 4OGEA 2A5XA 4E7HA 3TPQA 3LAKA 4CHYA 1NGCA 1U2VA 1E4FT 3GL1A 2HBLA 4DB3A 1J5EK 1BOTO 4AH9A 3U9ZA 3CI5A 3LPUA 1BA1A 5HL7L 2QWQA 1KLNA 1JCEA 1C0TA 1RDCA 4H03B 3WUHA 3HVRA 5JS1A 4DS5A 3DLKA 4DTSA 2P51A 3VGKA 4Z4FA 3HO1A 3HYFA 4YDUA 3O3FA 3P38A 3DLEA 2OTLN 5CR4A 4OGCA 1GLFO 4J8FA 3H3OB 4J2EA 3MCAB 2LSNA 3K57A 3L2QA 4CFCA 1BISA 5LL6Z 3WT0A 5AQXA 4B8AB 1EWRA 4BQLA 3TTFA 2FBYA 1CLQA 3IRXA 4CZLA 4BRLA 4DV2K 1HX1A 4BRCA 3TAPA 3JXUA 4CFBA 3VQ4A 4CBWA 2BGGA 4C8LA 4H0TB 5GIOA 1F21A 2D0CA 4IOXA 3H6EA 1GLJO 4O55A 3V9WA 4CHNA 2GBZA 1WB9A 3MWPA 2O4GA 3Q7CA 5I3UA 5AQOA 1XI1A 3ZLJA 1HNWK 4KHNA 2X6SA 3F9MA 5LJWA 3DXMA 1B9FA 2UXDK 1BWFO 3QO9A 4Z0UA 5M1FA 3LAMA 3QDKA 3O80A 4DFKA 1YUWA 3RR8A 2O8DB 5CE3A 4WCEL 3V9ZA 2HF3A 3O4QA 4IXCA 3HBTA 5C2DA 1WSGA 4IO8A 4K43A 1HMVA 3SAHA 5EOYA 1U2VB 1ESVA 5EU7A 4FJJA 3LP3A 2Z1HA 3TABA 3AVFA 2DY4A 1S1VA 3THVA 4CGIA 4H0VB 1RBSA 2V7ZA 3NH1A 1XUPO 2XHBA 3E9LA 3DOKA 3NF7A 4DTJA 4C8MA 5CHIA 5AQYA 4BDYA 3IS9A 2NRTA 4B1VA 3M8PA 1K8AO 4CJTA 3JSMA 2EWSA 1Q82O 1ATSA 1IBKK 5JMVA 4RTFD 1N36K 1HPZA 2NZTA 1NMNA 1ZBUA 5KPZA 1DLOA 3IUCA 3U3GA 3KLGA 4GNIA 3CCRN 3AVAA 3AVJA 2O8FB 3E66A 4B3TK 4GMJB 1TV6A 4B1ZA 3OYAA 1LAVA 1WSJA 5BR8K 3ZSZA 3CCJN 3SQ2A 3OYKA 1DGKN 5GAHP 1KD1O 1VQKN 1HRHA 4O0JA 5EY4A 3RMDA 2UUAK 4FJXA 4JI4K 4NCAA 2QI2A 4NO7A 4ID5A 1Q9XA 3FFIA 3OYNA 4CZFA 1YVNA 3V9UA 5AQLA 2VG5A 1V4SA 2G8KA 1VRUA 3CPEA 3CJBA 4B8CA 2FF3B 4GKJK 3TTDA 3TARA 3OYCA 4RW6A 2OYQA 1HLUA 4H4MA 4BRIA 3OS0A 1BL3A 2CH5A 3VA3A 2Q97A 1M90O 3LANA 4CBUA 4IZ9A 1XWLA 4ID1A 4CGJA 1VSKA 4FLWA 1X9JA 1VQ8N 4CJFA 3RSEA 4CK3A 4YOUA 5AQPA 5CZ1A 3VQPA 2W40A 3VEYA 1ZXOA 1MWMA 5FPEA 3FFKB 4BDPA 1YF5L 4JHDA 4A2BA 2WONA 3VESA 4GVMA 4Y0WA 1UOCA 2HHVA 3BEXA 1H1VA 3GE1A 3P31A 3LDSA 1MWKA 5ELZA 1P90A 3SMSA 2I7PA 3VEOA 2DFHA 5BR9A 4YFUA 4PQUA 1C0UA 1L3UA 4B9LA 2ZF5O 2PFUA 3AARA 1LW2A 3DLRA 1VQLN 2F8SA 3DXKB 2DTUA 3AVBA 4HUGA 5E26A 1NKEA 1J5OA 2HVHA 1CZAN 1YVUA 3HSTB 3NF6A 4CIEA 4FZYA 1RCHA 4O8KA 4CW7B 3D2FB 4NYFA 2G8VA 3D2EA 1FKPA 2BANA 4M7YA 3TAGA 5C42A 5BN8A 1VSJA 4KHWA 4O0IA 3BZCA 3SZ2A 4LFAK 4FJLA 3KD5E 4Z4HA 3VQBA 1X3NA 3KK7A 3OTOK 4A59A 1TUUA 4R79A 4Z4EA 3PUFA 4FLTA 3O4WA 3VA0A 4IFVA 4CFDA 2BH1A 4KKOA 2NRHA 3CHWA 4CK1A 3OYEA 1WUAA 1NJXA 1ZBFA 3SNNA 5DMRA 4JK7A 3THYB 5AQJA 3KD1E 5BPMA 3TAQA 1EX4A 4YOYA 1T05A 4BRAA 2B6AA 1HJOA 4HTLA 5JICA 2HF4A 3M8QA 3CCSN 1NKBA 4C8KA 1NK0A 3AA5X 4N47A 1YI2N 2ZQBA 4NXMK 4DF4A 2UXCK 4CHQA 1KFSA 2QWNA 3MN6A 5FPNA 4E1MA 1VQ4N 2B5JA 2A1SA 4BGAA 3SLCA 4H5RA 1S1XA 3OYDA 3PX4A 4J2AA 4RWTA 2IVNA 3M6GA 5C24A 3NE6A 3C6AA 3CF5L 3KHYA 4JKEA 3FLCO 1SKWA 1YITN 3OBYA 2ZJRL 2KLAA 4KFBA 3SUQA 1Q81O 4AHCA 3S3MA 4DQQA 1TKDA 1U4BA 2HSTA 3K5MA 5M1KA 3CJ1A 5FDLA 1N33K 2HB5A 2E6MA 3G0ZA 4IDHA 3LL3A 4TSXA 4LD0A 4FWKA 2VWJA 3ITHA 3AVMA 4CI6A 2XY5A 5D3GA 2D0OA 3C6HA 1XC9A 2PY5A 5GINA 4FJNA 3D6RA 4IEIA 2BDPA 5C2FA 3F73A 4KBOA 4CERA 1KQSM 4L8RB 1U49A 1K73O 1GLBG 2X78A 3C6UA 2P9KB 3C94A 3TAFA 4E0DA 3NVKA 3NH2A 1KAXA 4H8KA 3RVCA 4DQIA 4NLCA 4EAHD 1S6PA 2HBJA 4B9SA 4V19S 3CFRA 2Q0UA 1NM1A 4WYBA 3P5JA 3K9JA 3CCVN 1A5VA 5AJ3K 3BF3A 4H4OA 2YHWA 1NOZA 2X74A 3HT3A 2KHOA 4N76A 2CGLA 4Z4GA 4NCGA 4DV5K 3PIOL 3MXMA 1IV0A 2RE2A 3TU5A 3AGRA 1FKOA 3O9UA 3P1GA 4G1QA 1SL2A 5SZTA 2NUBA 1HKBA 3EL2A 4DU1A 3WEEA 2OZMA 1G99A 4YDUC 1WSEA 4CEQA 3ZEUA 4DQPA 4N5SA 3OS1A 2W6KA 1VQ9N 3A8YA 4LSLA 3I55N 3NVMA 1RDDA 5FPMA 5LMUK 5CYQA 3HI0A 1WLJA 3HL8A 3I8DA 4CZIA 2F7TA 1VSEA 1SS6A 2ZJPL 2VQFK 1ITGA 3CJ9A 3DLHA 1OH8A 1SUQA 5HRSA 4XH5A 4IJNA 3PO4A 3U6FA 5CYMA 1NGAA 4MLHA 1FXXA 3EN9A 5KPRA 1ATNA 4FK4A 5KRSA 3KVGA 5KI6A 3DLLL 3QINA 3ZT3A 2ZGZA 1RGIA 4A2AA 3OJSA 5AZIA 3E9PA 4KH6A 5AQMA 2VG7A 2KTQA 3VF6A 1S1TA 4EZ9A 2AA4A 4IG0A 2Q3SA 3VERA 4OPKA 1NGFA 2YNHA 3B8AX 4QAGA 4CEZA 3CC4N 3BGRA 4BROA 4HVJA 1U45A 3MAQA 1ASWA 1W97L 2QK9A 3H08A 2ETJA 2KFZA 3VGLA 2UUBK 5BREA 3C6TA 4LF9K 1QZ6A 3EKUA 3L6QA 3QFPA 3SCXA 2UYTA 1BHLA 3NBPA 4MO5A 3G71N 2Q2RA 3HPGA 1QSYA 1KVAA 4RCHA 3WQTA 2G8HA 4LFBK 3FZLA 3WXJA 5AQUA 3I33A 4LH5A 2XO7A 4CJEA 4DSIA 4DTRA 2VGNA 3U3YA 1RTHA 3MMVA 2FXUA 3PO5A 2WOMA 1OH5A 4BC3A 4CJ5A 2F9WA 2XY8A 5JVHL 4O5BA 4I6MB 4BACA 3QIOA 4NCBA 3AVLA 1T3VA 3U4LA 2F9TA 5DM6L 5A2QO 1MDUB 4JRQA 4XIUA 4BVOA 3AAPA 4FK0A 2ATQA 4FJ9A 1TL1A 4QOZB 3NDKA 3ISNC 2V52B 3K0SA 2DPNA 3NF9A 3DYAA 4GKKK 4CZGA 3CM6A 1KLMA 3VMFB 4M3TA 5DK5A 4FPAA 1EQYA 1YIJN 1Q9YA 5JVGL 4KPYA 3F9KA 2JWKA 3ZX0A 3VEXA 3OVNA 4FW1A 3NCIA 3AV9A 1RT7A 3MEDA 4JKGA 4DMNA 4C23A 2ZE2A 3QNNA 4CBXA 4GVEA 2HNZA 3ZEUB 4JRPA 5J2MA 3V81A 3H1VX 3SJHA 4MO4A 3AVKA 1XNQK 4LF5K 4I2PA 3TSPA 4JI2K 3ALYA 3BY5A 2QKKA 4BC4A 3CD6N 3FZKA 3KIOA 4NB4A 2UXBK 2NRVA 2P1JA 3J7ZO 4KRFA 1NMDA 4CF9A 5C0YA 4C1NK 4W5TA 4BRMA 3LDLA 1C6VA 3M8SA 4K0KK 3DRRA 4CEOA 2E88A 5KQDA 3Q7BA 3TTCA 4XH1A 3GDQA 4KO0A 3AO2A 1YTUA 4JAXA 3WXLA 4IOAL 2GWJA 3V4IA 4LF8K 5DM7L 3HTVA 1I39A 2PZSA 4JYAK 3CMAN 2FSKA 2UU9K 3CCUN 4DR4K 2E2QA 1NGDA 2P9UB 1VQ6N 5TKYA 4M42A 4Y1DA 3IMXA 3SV3A 1JXEA 1J53A 4OLAA 3AAQA 3SAGA 4HTUA 4E7KA 4Q5VA 1RTJA 2FBVA 3LP0A 3O1BA 4FZZA 1VSIA 4JI6K 3CETA 3ATVA 1UA1A 2BUPA 3ULDA 1RBRA 2ITGA 3N4PA 3NAEA 5AQHA 4CIFA 1B92A 3VTHA 1KFDA 3E9OA 1Q18A 1TAUA 3AVIA 5C25A 1IKWA 4JD2A 4CF8A 2QXLA 4AHSA 3G6EN 5HP1A 1A5WA 1HYVA 4B9TA 1LOTB 1DEJA 4CD1A 2HHSA 2GX9A 3KLFA 2HHWA 4H5VA 4FLYA 2I7NA 3O6WA 1WBBA 3HK2A 3G4SN 2YKMA 1DTQA 4OPHA 2ZGYA 1T03A 1HPMA 4FLUA 4AHVA 1GLLO 4CZMA 1YHQN 5TKWA 4GV9A 4JI8K 2HMIA 3PY8A 3AO1A 1QVGM 3FE1A 3ID6A 3M1FA 2WFBA 1K8KB 3O1WA 4O44A 2P5OA 1S9EA 2A41A 2P9PB 5FLXO 5AZIB 4BR4A 2XY7A 3IG1A 2YHAA 3LDOA 3IKMA 4DFJA 2YNFA 3SK3A 3OW2M 4JKHA 2A42A 3OYMA 4CJQA 3SUPA 4ICLA 2J4RA 3DWLA 1YJNN 1C1CA 4HCBA 2E2OA 1QSLA 3DXKA 1T6DA 5EVZA 4IG3A 3UKUB 4A62A 4AHTA 2KFNA 1KCFA 1P8ZA 4FJ8A 4JS4A 2VCPA 2X6NA 1LWEA 1IKYA 1TK5A 3GG4A 3CCMN 3TANA 4M63C 4CJ3A 3LWMA 3CCEN 3HPHA 4FWPA 5AQVA 4FJ5A 4CJUA 2KZZA 3ATUA 3FR0A 4E19A 5BPNA 3DOLA 3ENBA 3VQ7A 4JI3K 2QKBA 2G8FA 4X64K 1YXQA 1ILYA 3IFRA 4CHPA 3ZT1A 1X9MA 1QE1A 2D5RA 3I56N 1JXBA 1TL3A 4IFYA 4PL7A 1I94K 4KTQA 2IVOA 4ILJA 4DCHA 4BVPA 1D4XA 1WSFA 4PKHA 4B1UB 3ZETA 1V4TA 3D2EB 3H1QA 4I9QA 4A57A 2D1KA 4NXNK 4WFNL 3HP6A 4F9OA 3A5MC 3ENHA 1RT6A 1S3XA 1NJIO 2H3GX 1N34K 1REVA 5M1NA 3RMCA 4FJIA 3ZSYA 3J7YP 3CQYA 2ZWHA 1Z25A 4ISFA 3C65A 4AILC 4KHPK 1RILA 3WXKA 2E2NA 4FWLA 4B9VA 4BE0A 5GAEP 1RBTA 4BQZA 4BE1A 1HKGA 4HCCA 4E3SA 1N32K 4FLZA 1D8YA 4M3UA 1NK8A 3ULEA 1L5UA 3SQ0A 1QHAA 3ZT0A 4H5NA 3CFPA 3MX5A 1HQEA 1TKTA 3S3NA 4LF6K 4QS8A 1SAZA 1JLAA 1SZ2A 1S1WA 2HOEA 4DR6K 4O8UA 3VF2A 3O4NA 5GAGP 2YKNA 1DT9A 4BREA 4G9ZA 4EHUA 1JLFA 4DQSA 4JEPA 1TGOA 3L8BA 3QNOA 3CCLN 4B9QA 3VOVA 1N8RO 3ZSVA 2AJQA 5LJVA 1XHZA 4M41A 3MEEA 3VN5A 2YJEA 5BPLA 1S72N 1NU0A 3THWB 4Q0BA 1LAWA 3DI6A 2O8CA 4F4KA 2HHXA 3DMJA 4KHQA 4JKFA 4B08A 1QSSA 4IOCL 4K8XA 2AP1A 1UA0A 5AQKA 5FRNA 3SQ4A 1IJJA 3KLEA 4B3SK 1D5AA 1RT2A 3F2KA 3DLGA 1QQOA 1HKCA 4JKGB 3P83D 2P9IB 4CD3A 3OS2A 5LMNK 3R9PA 3G10A 3CFOA 3O9TA 4YOTA 3CCQN 5F2RA 3FGUA 4BR9A 2VG6A 4CGHA 4CESA 3L2UA 1KTQA 4BR5A 2EX3A 3VQEA 4JI5K 3HJFA 2PAVA 2W6LA 3K2PA 4BRPA 4KHYA 1T44A 3R8EA 5I42A 1OVQA 3AVHA 3O08A 3U8XA 2HNDA 4PY5A 3ENOA 3FZMA 4AHUA 1RDAA 4F3OA 1VSDA 2YHBA 4LSNA 3ZSWA 3T3FA 5AFUH 2OCEA 3LP2A 5AQFA 5AQQA 5IWAK 4JV5K 4DG1A 4DLGA 3HVTA 4B1XB 1HYZA 2ASMA 3TSQA 2RF2A 1WAFA 4BWJA 4DFMA 1BIUA 1KVCA 4BGBA 3N4QA 5HRNA 2JLEA 2ASPA 3VPZA 3DLBA 5BRFA 4JKCA 3QFUA 3U9DA 2P9PA 3IAYA 1RDUA 1QTMA 1TYQB 4BRFA 4E1NA 1ZBSA 3MCPA 4U7BA 4W5QA 3HOSA 4CVNE 4MDAA 5FROA 2QM1A 1JCFA 3OYGA 4C1NI 3AO5A 3L0QA 5AZJA 3KWGA 3OYJA 4OPJA 4JD2B 2KKZA 2IC3A 3MXIA 4HWIA 2HBKA 1RTIA 2E8AA 2O8DA 3D7EO 5MLCQ 4ILGB 1LWCA 2YCHA 3A0IX 4XEIA 3TAEA 2OPRA 4XH4A 1SKRA 3KZBA 3RR7A 4DR7K 5GADP 3V9XA 3T1YK 4MDBA 3VTIA 1C0MA 4DUYK 2HW3A 4FLVA 1D9FA 3JAMO 1IKVA 1WN7A 2Q0RA 4GV3A 3O3HA 2EHGA 4B1YB 1L3TA 3MXJA 3BP8A 3SQ1A 4DHYA 5ADXA 4YY3K 1N5YA 1VQMN 3IDHA 4F2RA 3L2RA 1CXQA 3PSIA 3K5OA 4DSJA 2VQEK 4RW9A 3MN5A 4FOEA 4QS9A 4K25A 4DWIA 4QCLA 3E01A 2O8EA 1R0AA 1KVBA 1L3VA 2JGUA 4HUFA 2HMPA 1HYSA 2WC9A 4B9MA 3CERA 3EO3A 5AR0A 1NNEA 4FOIA 4CJLA 3OYFA 2P9LA 2PBDA 3TWHA 3NFAA 5M1PA
chains in the Genus database with same CATH topology
4K8ZA 4RG8A 1RBSA 2QKKA 3NH1A 1ASVA 2XHBA 3DOKA 3NF7A 4DTJA 4C8MA 3B6OA 3KIOA 4BDYA 1JLGA 3IS9A 2P1JA 4MQ3A 4KRFA 4BWMA 3AVCA 5CY4A 4CF9A 4KB0A 4FZXC 1JLEA 3M8PA 1WAJA 4W5TA 3KK2A 4E89A 3QEPA 3DRPA 4N41A 4CJTA 3JSMA 1C6VA 3M8SA 4FK2A 3DRRA 4DLEA 4CEOA 4KI4A 1CZ9A 1JKHA 1HPZA 1VSMA 3QESA 3DRSA 1NJYA 4KO0A 4ZTJA 3AO2A 1YTUA 1RT1A 1ZBUA 3LALA 1G15A 1DLOA 1U04A 4IBNA 3U3GA 3KLGA 3V4IA 4Z4IA 1UAXA 1I39A 3TI0A 2PZSA 3AVAA 3AVJA 5JS2A 4GMJB 1TV6A 3OYAA 1TKXA 3V1OA 1LAVA 2BE2A 1WSJA 4Y1DA 3ZSZA 3AA3A 4M42A 1W0HA 3SQ2A 2B4JA 3OYKA 3SV3A 3LWLA 2OZSA 4DSKA 1JXEA 3VQAA 1J53A 1GOCA 4ZTFA 1HQUA 1HRHA 4O0JA 4OLAA 3RMDA 4FJGA 4HTUA 4E7KA 5HROA 4Q5VA 3T19A 4FJXA 4NCAA 1RTJA 2FBVA 2GUIA 3LP0A 3V9SA 4FZZA 4ID5A 1VSIA 4RW8A 1Q9XA 2HHUA 1UA1A 3FFIA 3ULDA 1RBRA 2ITGA 3OYNA 4NYNA 3SI6A 3NAEA 4EP4A 3V9UA 4OKEA 1NK4A 4OJRA 4CIFA 4F3TA 3VQQA 2VG5A 2F8TA 2G8KA 1B92A 1VRUA 3K5NA 1KFDA 3ZT2A 4B8CA 2FC0A 1TAUA 4FW2A 4CJ4A 3TARA 3AVIA 5C25A 3OYCA 5J2QA 1IKWA 3LZIA 4W5RA 4RW6A 1A5XA 2OYQA 4H4MA 4DU3A 4CF8A 3OS0A 4ELTA 1BL3A 4AHSA 1BCOA 3VA3A 5HP1A 3LANA 4DSLA 2DY4A 1XWLA 4ID1A 4CGJA 1VSKA 4FLWA 4E7LA 1A5WA 1HYVA 3SJJA 4B9TA 4CJFA 1WSHA 4CK3A 1W9HA 2HHSA 3QLHA 4CEEA 4CK2A 3KLFA 2HHWA 5CZ1A 4FLYA 3D45A 1HNVA 3VQPA 3BDPA 1EP4A 2HVIA 1BI4B 3ZSOA 3QERA 3HK2A 4I2QA 4CHZA 4C8NA 4KTWA 4BDPA 2YKMA 1DTQA 4CHOA 3K59A 2WONA 2VWKA 1CXUA 4GVMA 1T03A 1UOCA 2IOCA 2HHVA 1SV5A 5J1EA 1DTTA 3LDSA 1K6YA 4FLUA 2O4IA 1X9WA 2DFHA 4AHVA 3M8RA 4YFUA 4PQUA 2E6LA 1C0UA 3T1AA 1L3UA 4B9LA 1O1WA 3DLRA 1LW2A 2HMIA 3PY8A 2F8SA 3LP1A 2FBTA 4DFPA 3AO1A 4M3ZA 2DTUA 3AVBA 5KTQA 4HUGA 1NKEA 1J5OA 2HVHA 1TVRA 3HSTB 1YVUA 1BGXT 2RKIA 3L3UA 3NF6A 5K14A 4CIEA 4DTUA 1L3SA 4B9NA 4O44A 4FZYA 2P5OA 1S9EA 4Y1CA 4KHUA 1RCHA 2P5GA 1UWBA 1NKCA 4NYFA 1BQMA 4I9LA 2XY7A 3EY1A 2G8VA 3IG1A 3OYIA 1FKPA 2BANA 2YHAA 3L2VA 4DTOA 4ELUA 4DFJA 1ZBLA 2YNFA 3TAGA 3LZJA 3AO3A 5KRTA 2PYJA 4ELVA 1XHXA 5C42A 3OYMA 1VK0A 4OKKA 1U48A 1VSJA 3S3OA 4KHWA 4CJQA 3THVA 3OJUA 3SUPA 4ICLA 1NJZA 4EZ6A 1TKZA 4O0IA 3SZ2A 4PUOA 1C1CA 2QXFA 3VQDA 3ZT4A 4HCBA 3V6DA 1NK5A 1QSLA 4LH4A 5HRPA 2DFFA 4FJLA 4IG3A 3KD5E 1S6QA 4Z4HA 3VQBA 3OYHA 4BDZA 4AHTA 2KFNA 4KAZA 3WNFA 1KCFA 2G8WA 1JLCA 2Z1IA 4FJ8A 2A1RA 4JS4A 4CCHA 3RTVA 2X6NA 3QIPA 1LWEA 1IKYA 4KTZA 1TK5A 1S1UA 5KGWA 3MEGA 3TANA 4Z4EA 3PUFA 4CIGA 4FLTA 4CJ3A 1IH7A 4EP5A 3LWMA 3VA0A 4DQRA 5FRMA 4IFVA 4CECA 2YNGA 3HPHA 3OY9A 4FJ5A 3C95A 3KLIA 4KKOA 4CJUA 4CFDA 2KZZA 1TK8A 3CQ8A 3KJVA 4E19A 3VQ6A 3CM5A 3DOLA 4CK1A 3OYEA 3HP9A 1VSFA 3VQ7A 3AA4A 1NJXA 3D0PA 2QKBA 2G8FA 1ZBFA 3AA2A 3SNNA 5DMRA 4CHPA 3ZT1A 3RMBA 5E41A 1X9MA 1QE1A 3CG7A 4KHSA 3TR8A 2D5RA 4CJRA 3KD1E 3TAQA 3WNGA 1EX4A 1JXBA 4W5OA 1ZYQA 1T05A 4KI6A 1TL3A 4FM2A 3VQCA 2B6AA 2IDOA 4IFYA 3SYZA 3KLHA 4CEDA 4KTQA 3NGZA 1Z26A 1ASUA 1JLQA 3M8QA 2ZD1A 4CGDA 1NKBA 4C8KA 1WSFA 2Z1GA 1NK0A 4M3XA 3AA5X 4N47A 3I0SA 3VQ5A 1RBVA 2ZQBA 4DF4A 4I9QA 1RDBA 3RWUA 3QEXA 2HHTA 3ZSQA 4CHQA 1KFSA 1MU2A 1RT5A 3HP6A 3VQ8A 4O4GA 4E1MA 3UIQA 1VSLA 3LPTA 4DSFA 1RT6A 4YNQA 1TK0A 4KV8A 2B5JA 2A1SA 3KKRA 2Z1JA 3O3GA 1S1XA 3OYDA 3PX4A 4J2AA 3QEVA 4GW6A 1REVA 5C24A 3NE6A 3RMCA 4FJIA 3ZSYA 3SV4A 1RBUA 3K5LA 1SKWA 3KTQA 4FJHA 3RRGA 1Z25A 4KFBA 5T7BA 4AILC 3SUQA 1RILA 4AHCA 3S3MA 2D0AA 4B9VA 4BE0A 4DQQA 1RBTA 1U4BA 1TKDA 2RN2A 3K5MA 4BE1A 5FDLA 4UQGA 4HCCA 2HB5A 4E3SA 2E6MA 3G0ZA 2XRIA 1QHTA 4FLZA 4TSXA 4LD0A 4I7FA 1D8YA 3EZ5A 4M3UA 1BI4A 1BIZA 4OVLA 2VWJA 3ITHA 1NK8A 1L5UA 4CEFA 3AVMA 2XY5A 1JL1A 4OKJA 1YT3A 3PV8A 3SQ0A 5D3GA 1XC9A 2OPSA 3ZT0A 3NH0A 1I3AA 2PY5A 4FJNA 3CFPA 1QQCA 1HQEA 1VSHA 1KRPA 4F8RA 1KSPA 1TKTA 1FK9A 4HUEA 3S3NA 2BDPA 1VRTA 1U47A 1JLAA 4N56A 1S1WA 3F73A 4CERA 4B9UA 4AHRA 3QEWA 1EETA 4L8RB 3NF8A 4E7JA 3O4NA 1U49A 2X78A 3C6UA 2YKNA 3C94A 3OYBA 3NGIA 3TAFA 4E0DA 3KKSA 1YTAA 4HHTA 4FM0A 1JLFA 2I5JA 4H8KA 5KGXA 3NH2A 4DQSA 3SPZA 3MECA 4M3YA 4DQIA 1TGOA 4E7IA 4CFAA 3L8BA 1S6PA 3QNOA 4B9SA 4FXDA 3HXMA 2Y1IA 1EKEA 3ZSVA 3CFRA 1NK6A 2AJQA 4ZHRA 1J54A 3P5JA 4CF1A 4DTXA 2D0BA 1XHZA 4M41A 1A5VA 3MEEA 3VN5A 1WNSA 4BE2A 3QETA 3AVNA 4H4OA 4Q0BA 1LAWA 1NOZA 1S5JA 3DI6A 2X74A 4F4KA 3HT3A 1TAQA 4OLBA 4PWDA 2HHXA 2KW4A 3PX0A 3DMJA 4N76A 4Z4GA 4JLHA 4KHQA 4NCGA 4B08A 4WE1A 1RT3A 1QSSA 3MXMA 1T8EA 3HM9A 1HNIA 4K8XA 2F96A 2OPQA 4FCYA 1NOYA 3S9HA 1BQNA 1CZBA 4R5PA 1FKOA 1UA0A 3P1GA 4G1QA 3TAMA 5SZTA 2NUBA 1SL2A 4CF0A 3CYMA 1GOAA 5FRNA 3ASMA 1Y97A 4CJPA 1GOBA 2OPPA 3SQ4A 4DU1A 4C8OA 4IKFA 3KLEA 2OZMA 1D5AA 4IDKA 2HHQA 4CEQA 1RT2A 1WSEA 4CE9A 5CZ2A 3DLGA 4DQPA 4DTMA 1ZBIA 4N5SA 3OS1A 1BCMA 1T7PA 1WSIA 3P83D 4CGGA 5SWMA 3OS2A 1D9DA 4CJKA 3G10A 3CFOA 4DTNA 2IAJA 4LSLA 4DU4A 2DFEA 2R7YA 1RDDA 2GV9A 4J2DA 4CEBA 2VG6A 4CGFA 4CGHA 4CESA 1IG9A 3AVGA 1KTQA 4M45A 3WNHA 3L2UA 4MFBA 2EX3A 1NK7A 5CYQA 3AO4A 3VQEA 1NJWA 4F2SA 3HJFA 1C1AA 1WLJA 3K2PA 1SKSA 2IS3A 4KHYA 5I42A 4PY5A 3AVHA 3HL8A 3I8DA 2HNDA 1SL0A 3L3VA 4W5NA 4AHUA 1RDAA 4F3OA 1VSEA 3JYTA 1VSDA 1X9SA 3NGYA 1ITGA 1X1PA 2YHBA 4LSNA 3ZSWA 4CJWA 2W42A 3EYZA 3V1QA 2RPIA 3T3FA 1RTDA 3DLHA 3KK3A 3LP2A 3ZSRA 3ZSXA 1SUQA 4CJVA 5HRSA 4FLXA 3WNEA 3PO4A 1LV5A 4DG1A 3U6FA 5CYMA 4DLGA 2YNIA 4RW4A 1FXXA 3HVTA 1JLBA 4FJMA 4FK4A 5KRSA 2Y1JA 4M3RA 1HYZA 2KZMA 2RF2A 4OGEA 5KI6A 3L2WA 3QINA 3ZT3A 1WAFA 4E7HA 4BWJA 3OJSA 3LAKA 4CHYA 4DFMA 1EXQA 1BIUA 4J2BA 4KREA 1KVCA 2VG7A 2KTQA 4KB1A 1B9DA 3VQ9A 5HRNA 4FM1A 1S1TA 3SPYA 4EZ9A 2JLEA 3ZCMA 1NK9A 3DLBA 4IG0A 2Q3SA 1RNHA 4AH9A 4OPKA 2YNHA 4QAGA 3PX6A 3K58A 3LPUA 5J2NA 4CEZA 3IAYA 3BGRA 4FYDA 4HVJA 1QTMA 1KLNA 4FJ7A 1C0TA 1RDCA 1U45A 5HRRA 3MAQA 2XY6A 4E1NA 1ASWA 3HVRA 5JS1A 4DS5A 1HJRA 3H08A 2ETJA 2QK9A 2KFZA 4W5QA 3DLKA 4DTSA 2P51A 4M3WA 3C6TA 4Z4FA 3HO1A 5FROA 3HYFA 4CF2A 3O3FA 3SCXA 3DLEA 3SUOA 4JS5A 2E4LA 3OYGA 1BHLA 3NBPA 3HPGA 1QSYA 1KVAA 3AO5A 4OGCA 2G8HA 3NHGA 1J9AA 4Z4CA 3OYJA 4OPJA 4DF8A 4FJKA 3RMAA 2IC3A 4DS4A 4J2EA 3OYLA 3MXIA 1SL1A 4LH5A 1C1BA 2XO7A 2LSNA 4CJEA 1IKXA 4DSIA 1RTIA 3K57A 3QEIA 3L2QA 3V1RA 4DTRA 1BISA 4CFCA 4B8AB 5J2PA 3U3YA 1LWCA 1RTHA 2G8UA 3TAEA 3PO5A 2WOMA 2KQ2A 2FBYA 4CJ5A 2OPRA 5HLFA 3IRXA 1CLQA 1SKRA 3TAPA 3RR7A 2XY8A 4O5BA 4CFBA 3VQ4A 3V9XA 4BACA 4C8LA 2BGGA 3QIOA 4NCBA 1F21A 3AVLA 3I0RA 3RRHA 1LWFA 1C0MA 2D0CA 2HW3A 4FLVA 1IO2A 4JRQA 1D9FA 1RT4A 1IKVA 4O55A 4XIUA 1WN7A 3V9WA 4FK0A 2YV0X 2ATQA 2FBXA 4CHNA 4FJ9A 1TL1A 2GBZA 2O4GA 4QOZB 3O3HA 3NDKA 3SUNA 3ISNC 2EHGA 3A2FA 5I3UA 1XI1A 1L3TA 3MXJA 3DYAA 3NF9A 4KHNA 2X6SA 2G8IA 3CM6A 4CEAA 3SQ1A 1S9GA 2OA8A 4RW7A 1KLMA 1ZBHA 4M3TA 1B9FA 5DK5A 4DTPA 1N5YA 1Q9YA 4KPYA 3F9KA 3QO9A 4Z0UA 4F2RA 3L2RA 3LAMA 1CXQA 4DFKA 5HBMA 1N6QA 3OVNA 4FW1A 3K5OA 3RR8A 3NCIA 3AV9A 4DSJA 1JL2A 3V9ZA 4FVMA 1RT7A 3MEDA 3O4QA 4RW9A 4CJSA 2ZE2A 4DMNA 3QNNA 3DM2A 2HNZA 4JRPA 5J2MA 4QCLA 3V81A 4DWIA 1Q8IA 3E01A 2PYLA 2IGIA 1WSGA 1R0AA 1KVBA 4DSEA 3KK1A 3AVKA 1HMVA 2JGUA 1L3VA 1LW0A 3HPOA 4HUFA 1QS4A 1HYSA 4PA1A 4B9MA 4I2PA 5EU7A 3B6PA 4FJJA 4B3OA 2HNYA 3LP3A 2Z1HA 3ALYA 3TABA 4CJLA 3OYFA 3AVFA 3TWHA 1S1VA 3NFAA 4CGIA 4LY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K8Z A;  4RG8 A;  1RBS A;  2QKK A;  3NH1 A;  1ASV A;  2XHB A;  3DOK A;  3NF7 A;  4DTJ A;  4C8M A;  3B6O A;  3KIO A;  4BDY A;  1JLG A;  3IS9 A;  2P1J A;  4MQ3 A;  4KRF A;  4BWM A;  3AVC A;  5CY4 A;  4CF9 A;  4KB0 A;  4FZX C;  1JLE A;  3M8P A;  1WAJ A;  4W5T A;  3KK2 A;  4E89 A;  3QEP A;  3DRP A;  4N41 A;  4CJT A;  3JSM A;  1C6V A;  3M8S A;  4FK2 A;  3DRR A;  4DLE A;  4CEO A;  4KI4 A;  1CZ9 A;  1JKH A;  1HPZ A;  1VSM A;  3QES A;  3DRS A;  1NJY A;  4KO0 A;  4ZTJ A;  3AO2 A;  1YTU A;  1RT1 A;  1ZBU A;  3LAL A;  1G15 A;  1DLO A;  1U04 A;  4IBN A;  3U3G A;  3KLG A;  3V4I A;  4Z4I A;  1UAX A;  1I39 A;  3TI0 A;  2PZS A;  3AVA A;  3AVJ A;  5JS2 A;  4GMJ B;  1TV6 A;  3OYA A;  1TKX A;  3V1O A;  1LAV A;  2BE2 A;  1WSJ A;  4Y1D A;  3ZSZ A;  3AA3 A;  4M42 A;  1W0H A;  3SQ2 A;  2B4J A;  3OYK A;  3SV3 A;  3LWL A;  2OZS A;  4DSK A;  1JXE A;  3VQA A;  1J53 A;  1GOC A;  4ZTF A;  1HQU A;  1HRH A;  4O0J A;  4OLA A;  3RMD A;  4FJG A;  4HTU A;  4E7K A;  5HRO A;  4Q5V A;  3T19 A;  4FJX A;  4NCA A;  1RTJ A;  2FBV A;  2GUI A;  3LP0 A;  3V9S A;  4FZZ A;  4ID5 A;  1VSI A;  4RW8 A;  1Q9X A;  2HHU A;  1UA1 A;  3FFI A;  3ULD A;  1RBR A;  2ITG A;  3OYN A;  4NYN A;  3SI6 A;  3NAE A;  4EP4 A;  3V9U A;  4OKE A;  1NK4 A;  4OJR A;  4CIF A;  4F3T A;  3VQQ A;  2VG5 A;  2F8T A;  2G8K A;  1B92 A;  1VRU A;  3K5N A;  1KFD A;  3ZT2 A;  4B8C A;  2FC0 A;  1TAU A;  4FW2 A;  4CJ4 A;  3TAR A;  3AVI A;  5C25 A;  3OYC A;  5J2Q A;  1IKW A;  3LZI A;  4W5R A;  4RW6 A;  1A5X A;  2OYQ A;  4H4M A;  4DU3 A;  4CF8 A;  3OS0 A;  4ELT A;  1BL3 A;  4AHS A;  1BCO A;  3VA3 A;  5HP1 A;  3LAN A;  4DSL A;  2DY4 A;  1XWL A;  4ID1 A;  4CGJ A;  1VSK A;  4FLW A;  4E7L A;  1A5W A;  1HYV A;  3SJJ A;  4B9T A;  4CJF A;  1WSH A;  4CK3 A;  1W9H A;  2HHS A;  3QLH A;  4CEE A;  4CK2 A;  3KLF A;  2HHW A;  5CZ1 A;  4FLY A;  3D45 A;  1HNV A;  3VQP A;  3BDP A;  1EP4 A;  2HVI A;  1BI4 B;  3ZSO A;  3QER A;  3HK2 A;  4I2Q A;  4CHZ A;  4C8N A;  4KTW A;  4BDP A;  2YKM A;  1DTQ A;  4CHO A;  3K59 A;  2WON A;  2VWK A;  1CXU A;  4GVM A;  1T03 A;  1UOC A;  2IOC A;  2HHV A;  1SV5 A;  5J1E A;  1DTT A;  3LDS A;  1K6Y A;  4FLU A;  2O4I A;  1X9W A;  2DFH A;  4AHV A;  3M8R A;  4YFU A;  4PQU A;  2E6L A;  1C0U A;  3T1A A;  1L3U A;  4B9L A;  1O1W A;  3DLR A;  1LW2 A;  2HMI A;  3PY8 A;  2F8S A;  3LP1 A;  2FBT A;  4DFP A;  3AO1 A;  4M3Z A;  2DTU A;  3AVB A;  5KTQ A;  4HUG A;  1NKE A;  1J5O A;  2HVH A;  1TVR A;  3HST B;  1YVU A;  1BGX T;  2RKI A;  3L3U A;  3NF6 A;  5K14 A;  4CIE A;  4DTU A;  1L3S A;  4B9N A;  4O44 A;  4FZY A;  2P5O A;  1S9E A;  4Y1C A;  4KHU A;  1RCH A;  2P5G A;  1UWB A;  1NKC A;  4NYF A;  1BQM A;  4I9L A;  2XY7 A;  3EY1 A;  2G8V A;  3IG1 A;  3OYI A;  1FKP A;  2BAN A;  2YHA A;  3L2V A;  4DTO A;  4ELU A;  4DFJ A;  1ZBL A;  2YNF A;  3TAG A;  3LZJ A;  3AO3 A;  5KRT A;  2PYJ A;  4ELV A;  1XHX A;  5C42 A;  3OYM A;  1VK0 A;  4OKK A;  1U48 A;  1VSJ A;  3S3O A;  4KHW A;  4CJQ A;  3THV A;  3OJU A;  3SUP A;  4ICL A;  1NJZ A;  4EZ6 A;  1TKZ A;  4O0I A;  3SZ2 A;  4PUO A;  1C1C A;  2QXF A;  3VQD A;  3ZT4 A;  4HCB A;  3V6D A;  1NK5 A;  1QSL A;  4LH4 A;  5HRP A;  2DFF A;  4FJL A;  4IG3 A;  3KD5 E;  1S6Q A;  4Z4H A;  3VQB A;  3OYH A;  4BDZ A;  4AHT A;  2KFN A;  4KAZ A;  3WNF A;  1KCF A;  2G8W A;  1JLC A;  2Z1I A;  4FJ8 A;  2A1R A;  4JS4 A;  4CCH A;  3RTV A;  2X6N A;  3QIP A;  1LWE A;  1IKY A;  4KTZ A;  1TK5 A;  1S1U A;  5KGW A;  3MEG A;  3TAN A;  4Z4E A;  3PUF A;  4CIG A;  4FLT A;  4CJ3 A;  1IH7 A;  4EP5 A;  3LWM A;  3VA0 A;  4DQR A;  5FRM A;  4IFV A;  4CEC A;  2YNG A;  3HPH A;  3OY9 A;  4FJ5 A;  3C95 A;  3KLI A;  4KKO A;  4CJU A;  4CFD A;  2KZZ A;  1TK8 A;  3CQ8 A;  3KJV A;  4E19 A;  3VQ6 A;  3CM5 A;  3DOL A;  4CK1 A;  3OYE A;  3HP9 A;  1VSF A;  3VQ7 A;  3AA4 A;  1NJX A;  3D0P A;  2QKB A;  2G8F A;  1ZBF A;  3AA2 A;  3SNN A;  5DMR A;  4CHP A;  3ZT1 A;  3RMB A;  5E41 A;  1X9M A;  1QE1 A;  3CG7 A;  4KHS A;  3TR8 A;  2D5R A;  4CJR A;  3KD1 E;  3TAQ A;  3WNG A;  1EX4 A;  1JXB A;  4W5O A;  1ZYQ A;  1T05 A;  4KI6 A;  1TL3 A;  4FM2 A;  3VQC A;  2B6A A;  2IDO A;  4IFY A;  3SYZ A;  3KLH A;  4CED A;  4KTQ A;  3NGZ A;  1Z26 A;  1ASU A;  1JLQ A;  3M8Q A;  2ZD1 A;  4CGD A;  1NKB A;  4C8K A;  1WSF A;  2Z1G A;  1NK0 A;  4M3X A;  3AA5 X;  4N47 A;  3I0S A;  3VQ5 A;  1RBV A;  2ZQB A;  4DF4 A;  4I9Q A;  1RDB A;  3RWU A;  3QEX A;  2HHT A;  3ZSQ A;  4CHQ A;  1KFS A;  1MU2 A;  1RT5 A;  3HP6 A;  3VQ8 A;  4O4G A;  4E1M A;  3UIQ A;  1VSL A;  3LPT A;  4DSF A;  1RT6 A;  4YNQ A;  1TK0 A;  4KV8 A;  2B5J A;  2A1S A;  3KKR A;  2Z1J A;  3O3G A;  1S1X A;  3OYD A;  3PX4 A;  4J2A A;  3QEV A;  4GW6 A;  1REV A;  5C24 A;  3NE6 A;  3RMC A;  4FJI A;  3ZSY A;  3SV4 A;  1RBU A;  3K5L A;  1SKW A;  3KTQ A;  4FJH A;  3RRG A;  1Z25 A;  4KFB A;  5T7B A;  4AIL C;  3SUQ A;  1RIL A;  4AHC A;  3S3M A;  2D0A A;  4B9V A;  4BE0 A;  4DQQ A;  1RBT A;  1U4B A;  1TKD A;  2RN2 A;  3K5M A;  4BE1 A;  5FDL A;  4UQG A;  4HCC A;  2HB5 A;  4E3S A;  2E6M A;  3G0Z A;  2XRI A;  1QHT A;  4FLZ A;  4TSX A;  4LD0 A;  4I7F A;  1D8Y A;  3EZ5 A;  4M3U A;  1BI4 A;  1BIZ A;  4OVL A;  2VWJ A;  3ITH A;  1NK8 A;  1L5U A;  4CEF A;  3AVM A;  2XY5 A;  1JL1 A;  4OKJ A;  1YT3 A;  3PV8 A;  3SQ0 A;  5D3G A;  1XC9 A;  2OPS A;  3ZT0 A;  3NH0 A;  1I3A A;  2PY5 A;  4FJN A;  3CFP A;  1QQC A;  1HQE A;  1VSH A;  1KRP A;  4F8R A;  1KSP A;  1TKT A;  1FK9 A;  4HUE A;  3S3N A;  2BDP A;  1VRT A;  1U47 A;  1JLA A;  4N56 A;  1S1W A;  3F73 A;  4CER A;  4B9U A;  4AHR A;  3QEW A;  1EET A;  4L8R B;  3NF8 A;  4E7J A;  3O4N A;  1U49 A;  2X78 A;  3C6U A;  2YKN A;  3C94 A;  3OYB A;  3NGI A;  3TAF A;  4E0D A;  3KKS A;  1YTA A;  4HHT A;  4FM0 A;  1JLF A;  2I5J A;  4H8K A;  5KGX A;  3NH2 A;  4DQS A;  3SPZ A;  3MEC A;  4M3Y A;  4DQI A;  1TGO A;  4E7I A;  4CFA A;  3L8B A;  1S6P A;  3QNO A;  4B9S A;  4FXD A;  3HXM A;  2Y1I A;  1EKE A;  3ZSV A;  3CFR A;  1NK6 A;  2AJQ A;  4ZHR A;  1J54 A;  3P5J A;  4CF1 A;  4DTX A;  2D0B A;  1XHZ A;  4M41 A;  1A5V A;  3MEE A;  3VN5 A;  1WNS A;  4BE2 A;  3QET A;  3AVN A;  4H4O A;  4Q0B A;  1LAW A;  1NOZ A;  1S5J A;  3DI6 A;  2X74 A;  4F4K A;  3HT3 A;  1TAQ A;  4OLB A;  4PWD A;  2HHX A;  2KW4 A;  3PX0 A;  3DMJ A;  4N76 A;  4Z4G A;  4JLH A;  4KHQ A;  4NCG A;  4B08 A;  4WE1 A;  1RT3 A;  1QSS A;  3MXM A;  1T8E A;  3HM9 A;  1HNI A;  4K8X A;  2F96 A;  2OPQ A;  4FCY A;  1NOY A;  3S9H A;  1BQN A;  1CZB A;  4R5P A;  1FKO A;  1UA0 A;  3P1G A;  4G1Q A;  3TAM A;  5SZT A;  2NUB A;  1SL2 A;  4CF0 A;  3CYM A;  1GOA A;  5FRN A;  3ASM A;  1Y97 A;  4CJP A;  1GOB A;  2OPP A;  3SQ4 A;  4DU1 A;  4C8O A;  4IKF A;  3KLE A;  2OZM A;  1D5A A;  4IDK A;  2HHQ A;  4CEQ A;  1RT2 A;  1WSE A;  4CE9 A;  5CZ2 A;  3DLG A;  4DQP A;  4DTM A;  1ZBI A;  4N5S A;  3OS1 A;  1BCM A;  1T7P A;  1WSI A;  3P83 D;  4CGG A;  5SWM A;  3OS2 A;  1D9D A;  4CJK A;  3G10 A;  3CFO A;  4DTN A;  2IAJ A;  4LSL A;  4DU4 A;  2DFE A;  2R7Y A;  1RDD A;  2GV9 A;  4J2D A;  4CEB A;  2VG6 A;  4CGF A;  4CGH A;  4CES A;  1IG9 A;  3AVG A;  1KTQ A;  4M45 A;  3WNH A;  3L2U A;  4MFB A;  2EX3 A;  1NK7 A;  5CYQ A;  3AO4 A;  3VQE A;  1NJW A;  4F2S A;  3HJF A;  1C1A A;  1WLJ A;  3K2P A;  1SKS A;  2IS3 A;  4KHY A;  5I42 A;  4PY5 A;  3AVH A;  3HL8 A;  3I8D A;  2HND A;  1SL0 A;  3L3V A;  4W5N A;  4AHU A;  1RDA A;  4F3O A;  1VSE A;  3JYT A;  1VSD A;  1X9S A;  3NGY A;  1ITG A;  1X1P A;  2YHB A;  4LSN A;  3ZSW A;  4CJW A;  2W42 A;  3EYZ A;  3V1Q A;  2RPI A;  3T3F A;  1RTD A;  3DLH A;  3KK3 A;  3LP2 A;  3ZSR A;  3ZSX A;  1SUQ A;  4CJV A;  5HRS A;  4FLX A;  3WNE A;  3PO4 A;  1LV5 A;  4DG1 A;  3U6F A;  5CYM A;  4DLG A;  2YNI A;  4RW4 A;  1FXX A;  3HVT A;  1JLB A;  4FJM A;  4FK4 A;  5KRS A;  2Y1J A;  4M3R A;  1HYZ A;  2KZM A;  2RF2 A;  4OGE A;  5KI6 A;  3L2W A;  3QIN A;  3ZT3 A;  1WAF A;  4E7H A;  4BWJ A;  3OJS A;  3LAK A;  4CHY A;  4DFM A;  1EXQ A;  1BIU A;  4J2B A;  4KRE A;  1KVC A;  2VG7 A;  2KTQ A;  4KB1 A;  1B9D A;  3VQ9 A;  5HRN A;  4FM1 A;  1S1T A;  3SPY A;  4EZ9 A;  2JLE A;  3ZCM A;  1NK9 A;  3DLB A;  4IG0 A;  2Q3S A;  1RNH A;  4AH9 A;  4OPK A;  2YNH A;  4QAG A;  3PX6 A;  3K58 A;  3LPU A;  5J2N A;  4CEZ A;  3IAY A;  3BGR A;  4FYD A;  4HVJ A;  1QTM A;  1KLN A;  4FJ7 A;  1C0T A;  1RDC A;  1U45 A;  5HRR A;  3MAQ A;  2XY6 A;  4E1N A;  1ASW A;  3HVR A;  5JS1 A;  4DS5 A;  1HJR A;  3H08 A;  2ETJ A;  2QK9 A;  2KFZ A;  4W5Q A;  3DLK A;  4DTS A;  2P51 A;  4M3W A;  3C6T A;  4Z4F A;  3HO1 A;  5FRO A;  3HYF A;  4CF2 A;  3O3F A;  3SCX A;  3DLE A;  3SUO A;  4JS5 A;  2E4L A;  3OYG A;  1BHL A;  3NBP A;  3HPG A;  1QSY A;  1KVA A;  3AO5 A;  4OGC A;  2G8H A;  3NHG A;  1J9A A;  4Z4C A;  3OYJ A;  4OPJ A;  4DF8 A;  4FJK A;  3RMA A;  2IC3 A;  4DS4 A;  4J2E A;  3OYL A;  3MXI A;  1SL1 A;  4LH5 A;  1C1B A;  2XO7 A;  2LSN A;  4CJE A;  1IKX A;  4DSI A;  1RTI A;  3K57 A;  3QEI A;  3L2Q A;  3V1R A;  4DTR A;  1BIS A;  4CFC A;  4B8A B;  5J2P A;  3U3Y A;  1LWC A;  1RTH A;  2G8U A;  3TAE A;  3PO5 A;  2WOM A;  2KQ2 A;  2FBY A;  4CJ5 A;  2OPR A;  5HLF A;  3IRX A;  1CLQ A;  1SKR A;  3TAP A;  3RR7 A;  2XY8 A;  4O5B A;  4CFB A;  3VQ4 A;  3V9X A;  4BAC A;  4C8L A;  2BGG A;  3QIO A;  4NCB A;  1F21 A;  3AVL A;  3I0R A;  3RRH A;  1LWF A;  1C0M A;  2D0C A;  2HW3 A;  4FLV A;  1IO2 A;  4JRQ A;  1D9F A;  1RT4 A;  1IKV A;  4O55 A;  4XIU A;  1WN7 A;  3V9W A;  4FK0 A;  2YV0 X;  2ATQ A;  2FBX A;  4CHN A;  4FJ9 A;  1TL1 A;  2GBZ A;  2O4G A;  4QOZ B;  3O3H A;  3NDK A;  3SUN A;  3ISN C;  2EHG A;  3A2F A;  5I3U A;  1XI1 A;  1L3T A;  3MXJ A;  3DYA A;  3NF9 A;  4KHN A;  2X6S A;  2G8I A;  3CM6 A;  4CEA A;  3SQ1 A;  1S9G A;  2OA8 A;  4RW7 A;  1KLM A;  1ZBH A;  4M3T A;  1B9F A;  5DK5 A;  4DTP A;  1N5Y A;  1Q9Y A;  4KPY A;  3F9K A;  3QO9 A;  4Z0U A;  4F2R A;  3L2R A;  3LAM A;  1CXQ A;  4DFK A;  5HBM A;  1N6Q A;  3OVN A;  4FW1 A;  3K5O A;  3RR8 A;  3NCI A;  3AV9 A;  4DSJ A;  1JL2 A;  3V9Z A;  4FVM A;  1RT7 A;  3MED A;  3O4Q A;  4RW9 A;  4CJS A;  2ZE2 A;  4DMN A;  3QNN A;  3DM2 A;  2HNZ A;  4JRP A;  5J2M A;  4QCL A;  3V81 A;  4DWI A;  1Q8I A;  3E01 A;  2PYL A;  2IGI A;  1WSG A;  1R0A A;  1KVB A;  4DSE A;  3KK1 A;  3AVK A;  1HMV A;  2JGU A;  1L3V A;  1LW0 A;  3HPO A;  4HUF A;  1QS4 A;  1HYS A;  4PA1 A;  4B9M A;  4I2P A;  5EU7 A;  3B6P A;  4FJJ A;  4B3O A;  2HNY A;  3LP3 A;  2Z1H A;  3ALY A;  3TAB A;  4CJL A;  3OYF A;  3AVF A;  3TWH A;  1S1V A;  3NFA A;  4CGI A;  4LY7 A; 
#chains in the Genus database with same CATH topology
 4K8Z A;  1ZC6 A;  5FPD A;  2E1Z A;  3B6O A;  1JLG A;  4MQ3 A;  4BWM A;  3AVC A;  1JLE A;  1KAY A;  3KK2 A;  3DRP A;  4BR7 A;  4KI4 A;  4KH4 A;  1HNX K;  3T7Z A;  1BU6 O;  1CZ9 A;  1JKH A;  1R59 O;  1VSM A;  1RT1 A;  2QA4 N;  4Z4I A;  1RDW X;  2Q1N A;  1UAX A;  4LC9 B;  3TI0 A;  3CJ7 A;  1YAG A;  3CPW M;  1MA9 B;  1TKX A;  4JK8 A;  3V1O A;  5JLH A;  4B1W B;  1BDG A;  1W0H A;  3UB5 A;  4WQ4 C;  2B4J A;  2OZS A;  3VQA A;  1GOC A;  1HQU A;  3CC7 N;  5BN9 A;  4O5F A;  5AQR A;  1WBD A;  2O8B A;  2GUI A;  3S41 A;  3HZ6 A;  3PSF A;  1KC8 O;  2ZM6 K;  2P9S A;  4NYN A;  3SAF A;  4OKE A;  4F3T A;  3VQQ A;  2F8T A;  2O8C B;  3LDP A;  2A6A A;  4YHH K;  3ZT2 A;  2FC0 A;  4CJ4 A;  5J2Q A;  2VWB A;  1A5X A;  2NRW A;  4DU3 A;  3DXM B;  3HSC A;  1BCO A;  4GY2 B;  4DSL A;  2OAN A;  3BF1 A;  3CJC A;  4CZJ A;  4E7L A;  3R6M A;  3EKS A;  2FLO A;  4WQ4 A;  1NBW A;  4PL8 A;  3H46 O;  4CEE A;  3D45 A;  3BDP A;  3VET A;  2HVI A;  1BI4 B;  3LDQ A;  2P9S B;  3QER A;  4I2Q A;  1QQM A;  4BRG A;  4FSV A;  1VHX A;  3K59 A;  5J1E A;  1DTT A;  3T1H K;  1K6Y A;  3TSU A;  3M8R A;  4BC2 A;  1XMQ K;  2E6L A;  3QBW A;  3T1A A;  1O1W A;  2IVP A;  2NNW A;  4DFP A;  5IT9 O;  2P9U A;  4DV3 K;  1TVR A;  5K14 A;  2RKI A;  4B9N A;  1L3S A;  5AFU A;  1NGB A;  3SBT A;  4Y1C A;  4KHU A;  3DJC A;  1SQK A;  2BTF A;  5AQW A;  3OYI A;  3L2V A;  4DTO A;  1ZBL A;  5BRD A;  3AO3 A;  4H0O A;  5KPT A;  1U48 A;  3S3O A;  1HNZ K;  3OJU A;  1NJZ A;  1NGE A;  4EZ6 A;  1TKZ A;  2QXF A;  4JK9 A;  3QML A;  5HRP A;  2YX6 A;  1S6Q A;  4DR5 K;  4BDZ A;  2P9L B;  3R3L A;  3WNF A;  4WFA L;  2G8W A;  1JLC A;  1J6Z A;  4CCH A;  3RTV A;  4KTZ A;  1S1U A;  2JWL A;  2A40 A;  3MEG A;  4L3Q A;  1XMO K;  1JCG A;  5FRM A;  1IH7 A;  3FZF A;  4DQR A;  4A61 A;  4CEC A;  2YNG A;  5AZJ B;  3C95 A;  3KLI A;  2P9N B;  4FWO A;  3ZYY X;  1VSF A;  2D4W A;  4KHS A;  3TR8 A;  3ID8 A;  4CJR A;  4LF7 K;  4UY8 O;  1ZYQ A;  1NGH A;  4KI6 A;  4PKG A;  3VQC A;  2IDO A;  3SYZ A;  4CED A;  2VYP A;  3BUZ B;  3NGZ A;  1Z26 A;  1ASU A;  5EX5 A;  2ZD1 A;  3I8B A;  5E84 A;  4EHT A;  2CGJ A;  1WOQ A;  4H0X B;  3I0S A;  3VQ5 A;  1RBV A;  3C7N A;  1RDB A;  2HHT A;  3QEX A;  3ZSQ A;  1OKJ A;  1RT5 A;  3VQ8 A;  4O4G A;  3UIQ A;  3J80 O;  3W0L A;  4YNQ A;  1TK0 A;  1Z6R A;  4WFB L;  3KKR A;  2Z1J A;  3O3G A;  2P9K A;  4GW6 A;  4DV0 K;  1NLV A;  4ILH A;  1VQ7 N;  1RBU A;  3KTQ A;  4FJH A;  5GIP A;  4DKW A;  5C10 A;  4AM6 A;  2D0A A;  3ZX3 A;  4BC5 A;  5JLF A;  1HUX A;  1QQN A;  4CZE A;  3THX A;  3MN7 A;  1QHT A;  3CXC M;  4I7F A;  1BI4 A;  1BIZ A;  4OVL A;  1NGJ A;  3H45 C;  1NGG A;  4CEF A;  1JL1 A;  3THW A;  2OPS A;  3NH0 A;  4DR1 K;  4DR2 K;  5AQS A;  4F8R A;  1KRP A;  1KSP A;  1FK9 A;  1VRT A;  4AM7 A;  1U47 A;  5B8H A;  4N56 A;  4EFH A;  1GLD G;  4AHR A;  3ZX2 A;  1EET A;  1C0F A;  3OYB A;  4FWS A;  4H0P A;  3KKS A;  4DV6 K;  5LY3 A;  4U67 L;  3SPZ A;  2RHK A;  1ATR A;  2I5J A;  5KGX A;  4M3Y A;  2GWK A;  4E7I A;  3UKR A;  3WEE B;  4AF1 A;  4FXD A;  4JN4 A;  3VF4 A;  2Y1I A;  2A3Z A;  1J54 A;  3ZET B;  2O8B B;  1OVY A;  3KWI A;  4BE2 A;  2P9I A;  3QET A;  3AVN A;  1S5J A;  4OLB A;  4BG9 A;  4FO0 A;  4JLH A;  1T8E A;  3HM9 A;  1HNI A;  2OPQ A;  4FCY A;  1NOY A;  3C0B A;  4R5P A;  1C0G A;  4CF0 A;  4CZH A;  3ASM A;  1Y97 A;  4C8O A;  2HHQ A;  2WTU A;  5CZ2 A;  4K42 A;  4CGG A;  1D9D A;  3RSE B;  2GTD A;  4CJK A;  3CC2 N;  4DTN A;  2IAJ A;  3MN9 A;  2E1Y A;  3E1Y A;  3DAW A;  1BUP A;  2GV9 A;  3P39 A;  4JKD A;  3L4I A;  1IG9 A;  3WNH A;  4MFB A;  1NK7 A;  3AO4 A;  1C1A A;  1SKS A;  3GOI A;  1BA0 A;  1JJ2 M;  1SL0 A;  3L3V A;  4MLE A;  1X9S A;  5C12 A;  3K9K A;  2QWO A;  4CJW A;  2W42 A;  2RPI A;  3LM9 A;  1YJW N;  3CME N;  3ZSX A;  4CJV A;  4FLX A;  4JHD B;  2YNI A;  4RW4 A;  2OTJ N;  1YJ9 N;  3A5O C;  4FJM A;  5F1X A;  2Y1J A;  4M3R A;  5M1Q A;  2UUC K;  3D2F A;  3EEQ A;  4YOR A;  3L2W A;  4WQ5 C;  3WQU A;  1XNR K;  4H5T A;  1EXQ A;  4J2B A;  1KXP A;  4KRE A;  4WF9 L;  4KB1 A;  1B9D A;  3VQ9 A;  2VGM A;  4FM1 A;  3SPY A;  1K9M O;  1VAZ A;  3ZCM A;  3L4Q A;  1NK9 A;  3NMU A;  1RNH A;  3PX6 A;  3K58 A;  5J2N A;  4FYD A;  4FJ7 A;  5HRR A;  4GV6 A;  2XY6 A;  1E3M A;  1HJR A;  3OA9 A;  1RFQ A;  1IBL K;  1NGI A;  4M3W A;  3M5R A;  4CF2 A;  3GBT A;  3SUO A;  3MDQ A;  4JS5 A;  2E4L A;  1FW6 A;  4QS7 A;  4BG8 A;  3NHG A;  4OX9 K;  1J9A A;  4Z4C A;  4DF8 A;  4FJK A;  4IFE A;  3RMA A;  4DS4 A;  3OYL A;  1TYQ A;  1SL1 A;  1C1B A;  1GLA G;  1W2B M;  1IKX A;  3QEI A;  3HRG A;  3EZW A;  3V1R A;  4JI0 K;  5I9E B;  5J2P A;  2G8U A;  3VEN A;  2KQ2 A;  5HLF A;  4FWN A;  2E20 A;  4OO1 J;  4CZK A;  3J7A P;  3RRH A;  3I0R A;  1LWF A;  1IG8 A;  3C7N B;  1IO2 A;  1RT4 A;  1BO5 O;  2YV0 X;  4A5B A;  2FBX A;  3SUN A;  3A2F A;  4FWR A;  2YI1 A;  4JKB A;  2G8I A;  4CEA A;  1S9G A;  3LM2 A;  4RW7 A;  4OPA A;  2OA8 A;  1ZBH A;  3OBW A;  4DTP A;  5EXW A;  1VQ5 N;  4LF4 K;  2NRZ A;  3O9S A;  5HBM A;  3VEW A;  1N6Q A;  5C15 A;  1JL2 A;  4FVM A;  4CJS A;  4FPB A;  4BR2 A;  1T6C A;  3DM2 A;  2P9N A;  1Q8I A;  2PYL A;  2IGI A;  3VEV A;  4DR3 K;  4DSE A;  2D0P A;  2V7Y A;  2YJF A;  3KK1 A;  1LW0 A;  3HPO A;  2QWL A;  4DUZ K;  4IEE A;  1QS4 A;  3QBX A;  4PA1 A;  3B6P A;  4B3O A;  2HNY A;  4CJ7 A;  3O8M A;  4B3R K;  4LY7 A;  4RG8 A;  3G25 A;  3UKU A;  1ASV A;  1DKG D;  4BRH A;  4X66 K;  2QW9 A;  2NRX A;  1XQS C;  1X3M A;  4KB0 A;  5CY4 A;  4FZX C;  2CH6 A;  4N41 A;  1WAJ A;  4E89 A;  3QEP A;  4PKI A;  4FK2 A;  3UKR B;  4DLE A;  3FZH A;  2ITM A;  3ULE B;  4BRD A;  4FWM A;  1Q7Y O;  3QES A;  3DRS A;  4M7X A;  1NJY A;  4YOW A;  2O8E B;  4ZTJ A;  3LAL A;  1G15 A;  1U04 A;  4IBN A;  3SBG A;  3M3Z A;  1LCU A;  5H1S Q;  5KQ8 A;  4YOV A;  5JS2 A;  2BE2 A;  3AA3 A;  4JI1 K;  4AQY K;  3LWL A;  4DSK A;  4ZTF A;  2GEL A;  3A5N C;  1M1K O;  4FJG A;  5HRO A;  3T19 A;  3BZK A;  2HBM A;  3V9S A;  4RW8 A;  2HHU A;  3SI6 A;  4EP4 A;  1NK4 A;  3AGK A;  4OJR A;  1OH7 A;  2QTD A;  2WUS A;  3K5N A;  5F0X A;  4FW2 A;  3J8A A;  4BRQ A;  3LZI A;  4W5R A;  2O8F A;  2FSN A;  4NLB A;  3MWT A;  4ELT A;  2WBN A;  3SJJ A;  1WSH A;  1W9H A;  3QLH A;  4CK2 A;  1HNV A;  4JNE A;  1EP4 A;  2Q31 A;  3PLA A;  3ZSO A;  3QB0 A;  4CHZ A;  4C8N A;  4KTW A;  4CHO A;  2VWK A;  1CXU A;  2IOC A;  4IWV A;  1SV5 A;  4IO9 L;  2O4I A;  4I6M A;  4IJA A;  1X9W A;  5HOO A;  3CQX A;  3LP1 A;  2FBT A;  4M3Z A;  5KTQ A;  1BGX T;  3L3U A;  4DV1 K;  4DTU A;  4X62 K;  2QWR A;  4BR0 A;  4K41 A;  1XC3 A;  2P5G A;  1UWB A;  2QWP A;  1NKC A;  2IIR A;  1BQM A;  4I9L A;  3EY1 A;  4ELU A;  3WXM B;  2FF6 A;  4Z94 A;  3LZJ A;  5KRT A;  2E5L K;  2PYJ A;  4ELV A;  1XHX A;  1VK0 A;  4OKK A;  3A5L C;  4WQ5 A;  4PUO A;  2HHH K;  3VQD A;  3ZT4 A;  3V6D A;  1NK5 A;  4LH4 A;  2Q36 A;  2DFF A;  4H5W A;  3OYH A;  4ISG A;  4JKA A;  4KAZ A;  2Z1I A;  1IBM K;  2A1R A;  1FJG K;  3PIP L;  3QIP A;  1KAZ A;  4EIA A;  5KGW A;  4PHT X;  4CIG A;  3VGM A;  3AY9 A;  4EP5 A;  3OY9 A;  3LDN A;  1TK8 A;  3CQ8 A;  1NG9 A;  2W41 A;  3KJV A;  3VQ6 A;  3CM5 A;  3HP9 A;  3AA4 A;  1Y64 A;  3D0P A;  3OHR A;  3JS6 A;  3AA2 A;  3RMB A;  5E41 A;  3CG7 A;  3J81 O;  2NRR A;  1K8K A;  3WNG A;  3EE9 A;  4A5A A;  4W5O A;  5AQZ A;  4FM2 A;  2F4V K;  1GLC G;  3H3N O;  3KLH A;  4BY9 C;  4B3M K;  2FSJ A;  2ZJQ L;  1JLQ A;  4CGD A;  2Z1G A;  3CJA A;  4DQ8 A;  3HOT A;  4M3X A;  4BRN A;  1VQO N;  3R1X A;  3THX B;  2GEM A;  3RWU A;  4FWQ A;  1MU2 A;  1VSL A;  3LPT A;  1TUY A;  4BRK A;  4DSF A;  3THY A;  3MK6 A;  2GUP A;  4KV8 A;  1E4G T;  2E2P A;  3QEV A;  1Q86 O;  3SV4 A;  3K5L A;  2YHX A;  3RRG A;  5ADX H;  5T7B A;  2RN2 A;  4UQG A;  2XRI A;  4FVU A;  5M1O A;  3EZ5 A;  1EO1 A;  1O13 A;  3PV8 A;  4OKJ A;  1YT3 A;  3HM8 A;  1I3A A;  1QQC A;  1VSH A;  4HUE A;  1VQN N;  4B9U A;  3MX2 A;  3QEW A;  3NF8 A;  4E7J A;  3NGI A;  4KH5 A;  1S22 A;  1YTA A;  4HHT A;  4FM0 A;  3MEC A;  4E1J A;  5AQG A;  4DV7 K;  4CFA A;  3HXM A;  1EKE A;  1NK6 A;  4ZHR A;  3EE8 A;  4DTX A;  4CF1 A;  2D0B A;  3SMP A;  1QVF M;  2QEX N;  1WNS A;  4ISE A;  1VQP N;  4PWD A;  1TAQ A;  3F5T A;  1BG3 A;  2KW4 A;  3PX0 A;  4WE1 A;  5BRH A;  1RT3 A;  2NLX A;  1NWK A;  5AQT A;  2F96 A;  2CGK A;  3S9H A;  1BQN A;  1CZB A;  3W3D A;  3TAM A;  3CYM A;  1GOA A;  4IKF A;  4H0Y B;  1GOB A;  2OPP A;  4CJP A;  1Z05 A;  3WXI A;  4IDK A;  2ASO A;  4CE9 A;  4DTM A;  1ZBI A;  1BCM A;  1T7P A;  1WSI A;  5SWM A;  1U6Z A;  3P4I A;  3O5B A;  4DU4 A;  2DFE A;  2R7Y A;  3O9Q A;  1HR0 K;  4FL9 A;  1W7A A;  4J2D A;  4CEB A;  4CGF A;  3AVG A;  4M45 A;  1NJW A;  4F2S A;  2YHY A;  4LFC K;  2IS3 A;  3T69 A;  3O9R A;  1EWQ A;  5AQN A;  4W5N A;  3JYT A;  1QZ5 A;  3NGY A;  1X1P A;  3EYZ A;  1RTD A;  1OH6 A;  3V1Q A;  2QWM A;  3KK3 A;  3ZSR A;  3WNE A;  1LV5 A;  4X65 K;  4YOX A;  3QIC A;  4JI7 K;  1JLB A;  4DV4 K;  3CIP A;  5AQI A;  2V51 B;  2KZM A;  1GLE G;  3VEZ A;  3UE5 A;  4OGE A;  2A5X A;  4E7H A;  3TPQ A;  3LAK A;  4CHY A;  1NGC A;  1U2V A;  1E4F T;  3GL1 A;  2HBL A;  4DB3 A;  1J5E K;  1BOT O;  4AH9 A;  3U9Z A;  3CI5 A;  3LPU A;  1BA1 A;  5HL7 L;  2QWQ A;  1KLN A;  1JCE A;  1C0T A;  1RDC A;  4H03 B;  3WUH A;  3HVR A;  5JS1 A;  4DS5 A;  3DLK A;  4DTS A;  2P51 A;  3VGK A;  4Z4F A;  3HO1 A;  3HYF A;  4YDU A;  3O3F A;  3P38 A;  3DLE A;  2OTL N;  5CR4 A;  4OGC A;  1GLF O;  4J8F A;  3H3O B;  4J2E A;  3MCA B;  2LSN A;  3K57 A;  3L2Q A;  4CFC A;  1BIS A;  5LL6 Z;  3WT0 A;  5AQX A;  4B8A B;  1EWR A;  4BQL A;  3TTF A;  2FBY A;  1CLQ A;  3IRX A;  4CZL A;  4BRL A;  4DV2 K;  1HX1 A;  4BRC A;  3TAP A;  3JXU A;  4CFB A;  3VQ4 A;  4CBW A;  2BGG A;  4C8L A;  4H0T B;  5GIO A;  1F21 A;  2D0C A;  4IOX A;  3H6E A;  1GLJ O;  4O55 A;  3V9W A;  4CHN A;  2GBZ A;  1WB9 A;  3MWP A;  2O4G A;  3Q7C A;  5I3U A;  5AQO A;  1XI1 A;  3ZLJ A;  1HNW K;  4KHN A;  2X6S A;  3F9M A;  5LJW A;  3DXM A;  1B9F A;  2UXD K;  1BWF O;  3QO9 A;  4Z0U A;  5M1F A;  3LAM A;  3QDK A;  3O80 A;  4DFK A;  1YUW A;  3RR8 A;  2O8D B;  5CE3 A;  4WCE L;  3V9Z A;  2HF3 A;  3O4Q A;  4IXC A;  3HBT A;  5C2D A;  1WSG A;  4IO8 A;  4K43 A;  1HMV A;  3SAH A;  5EOY A;  1U2V B;  1ESV A;  5EU7 A;  4FJJ A;  3LP3 A;  2Z1H A;  3TAB A;  3AVF A;  2DY4 A;  1S1V A;  3THV A;  4CGI A;  4H0V B;  1RBS A;  2V7Z A;  3NH1 A;  1XUP O;  2XHB A;  3E9L A;  3DOK A;  3NF7 A;  4DTJ A;  4C8M A;  5CHI A;  5AQY A;  4BDY A;  3IS9 A;  2NRT A;  4B1V A;  3M8P A;  1K8A O;  4CJT A;  3JSM A;  2EWS A;  1Q82 O;  1ATS A;  1IBK K;  5JMV A;  4RTF D;  1N36 K;  1HPZ A;  2NZT A;  1NMN A;  1ZBU A;  5KPZ A;  1DLO A;  3IUC A;  3U3G A;  3KLG A;  4GNI A;  3CCR N;  3AVA A;  3AVJ A;  2O8F B;  3E66 A;  4B3T K;  4GMJ B;  1TV6 A;  4B1Z A;  3OYA A;  1LAV A;  1WSJ A;  5BR8 K;  3ZSZ A;  3CCJ N;  3SQ2 A;  3OYK A;  1DGK N;  5GAH P;  1KD1 O;  1VQK N;  1HRH A;  4O0J A;  5EY4 A;  3RMD A;  2UUA K;  4FJX A;  4JI4 K;  4NCA A;  2QI2 A;  4NO7 A;  4ID5 A;  1Q9X A;  3FFI A;  3OYN A;  4CZF A;  1YVN A;  3V9U A;  5AQL A;  2VG5 A;  1V4S A;  2G8K A;  1VRU A;  3CPE A;  3CJB A;  4B8C A;  2FF3 B;  4GKJ K;  3TTD A;  3TAR A;  3OYC A;  4RW6 A;  2OYQ A;  1HLU A;  4H4M A;  4BRI A;  3OS0 A;  1BL3 A;  2CH5 A;  3VA3 A;  2Q97 A;  1M90 O;  3LAN A;  4CBU A;  4IZ9 A;  1XWL A;  4ID1 A;  4CGJ A;  1VSK A;  4FLW A;  1X9J A;  1VQ8 N;  4CJF A;  3RSE A;  4CK3 A;  4YOU A;  5AQP A;  5CZ1 A;  3VQP A;  2W40 A;  3VEY A;  1ZXO A;  1MWM A;  5FPE A;  3FFK B;  4BDP A;  1YF5 L;  4JHD A;  4A2B A;  2WON A;  3VES A;  4GVM A;  4Y0W A;  1UOC A;  2HHV A;  3BEX A;  1H1V A;  3GE1 A;  3P31 A;  3LDS A;  1MWK A;  5ELZ A;  1P90 A;  3SMS A;  2I7P A;  3VEO A;  2DFH A;  5BR9 A;  4YFU A;  4PQU A;  1C0U A;  1L3U A;  4B9L A;  2ZF5 O;  2PFU A;  3AAR A;  1LW2 A;  3DLR A;  1VQL N;  2F8S A;  3DXK B;  2DTU A;  3AVB A;  4HUG A;  5E26 A;  1NKE A;  1J5O A;  2HVH A;  1CZA N;  1YVU A;  3HST B;  3NF6 A;  4CIE A;  4FZY A;  1RCH A;  4O8K A;  4CW7 B;  3D2F B;  4NYF A;  2G8V A;  3D2E A;  1FKP A;  2BAN A;  4M7Y A;  3TAG A;  5C42 A;  5BN8 A;  1VSJ A;  4KHW A;  4O0I A;  3BZC A;  3SZ2 A;  4LFA K;  4FJL A;  3KD5 E;  4Z4H A;  3VQB A;  1X3N A;  3KK7 A;  3OTO K;  4A59 A;  1TUU A;  4R79 A;  4Z4E A;  3PUF A;  4FLT A;  3O4W A;  3VA0 A;  4IFV A;  4CFD A;  2BH1 A;  4KKO A;  2NRH A;  3CHW A;  4CK1 A;  3OYE A;  1WUA A;  1NJX A;  1ZBF A;  3SNN A;  5DMR A;  4JK7 A;  3THY B;  5AQJ A;  3KD1 E;  5BPM A;  3TAQ A;  1EX4 A;  4YOY A;  1T05 A;  4BRA A;  2B6A A;  1HJO A;  4HTL A;  5JIC A;  2HF4 A;  3M8Q A;  3CCS N;  1NKB A;  4C8K A;  1NK0 A;  3AA5 X;  4N47 A;  1YI2 N;  2ZQB A;  4NXM K;  4DF4 A;  2UXC K;  4CHQ A;  1KFS A;  2QWN A;  3MN6 A;  5FPN A;  4E1M A;  1VQ4 N;  2B5J A;  2A1S A;  4BGA A;  3SLC A;  4H5R A;  1S1X A;  3OYD A;  3PX4 A;  4J2A A;  4RWT A;  2IVN A;  3M6G A;  5C24 A;  3NE6 A;  3C6A A;  3CF5 L;  3KHY A;  4JKE A;  3FLC O;  1SKW A;  1YIT N;  3OBY A;  2ZJR L;  2KLA A;  4KFB A;  3SUQ A;  1Q81 O;  4AHC A;  3S3M A;  4DQQ A;  1TKD A;  1U4B A;  2HST A;  3K5M A;  5M1K A;  3CJ1 A;  5FDL A;  1N33 K;  2HB5 A;  2E6M A;  3G0Z A;  4IDH A;  3LL3 A;  4TSX A;  4LD0 A;  4FWK A;  2VWJ A;  3ITH A;  3AVM A;  4CI6 A;  2XY5 A;  5D3G A;  2D0O A;  3C6H A;  1XC9 A;  2PY5 A;  5GIN A;  4FJN A;  3D6R A;  4IEI A;  2BDP A;  5C2F A;  3F73 A;  4KBO A;  4CER A;  1KQS M;  4L8R B;  1U49 A;  1K73 O;  1GLB G;  2X78 A;  3C6U A;  2P9K B;  3C94 A;  3TAF A;  4E0D A;  3NVK A;  3NH2 A;  1KAX A;  4H8K A;  3RVC A;  4DQI A;  4NLC A;  4EAH D;  1S6P A;  2HBJ A;  4B9S A;  4V19 S;  3CFR A;  2Q0U A;  1NM1 A;  4WYB A;  3P5J A;  3K9J A;  3CCV N;  1A5V A;  5AJ3 K;  3BF3 A;  4H4O A;  2YHW A;  1NOZ A;  2X74 A;  3HT3 A;  2KHO A;  4N76 A;  2CGL A;  4Z4G A;  4NCG A;  4DV5 K;  3PIO L;  3MXM A;  1IV0 A;  2RE2 A;  3TU5 A;  3AGR A;  1FKO A;  3O9U A;  3P1G A;  4G1Q A;  1SL2 A;  5SZT A;  2NUB A;  1HKB A;  3EL2 A;  4DU1 A;  3WEE A;  2OZM A;  1G99 A;  4YDU C;  1WSE A;  4CEQ A;  3ZEU A;  4DQP A;  4N5S A;  3OS1 A;  2W6K A;  1VQ9 N;  3A8Y A;  4LSL A;  3I55 N;  3NVM A;  1RDD A;  5FPM A;  5LMU K;  5CYQ A;  3HI0 A;  1WLJ A;  3HL8 A;  3I8D A;  4CZI A;  2F7T A;  1VSE A;  1SS6 A;  2ZJP L;  2VQF K;  1ITG A;  3CJ9 A;  3DLH A;  1OH8 A;  1SUQ A;  5HRS A;  4XH5 A;  4IJN A;  3PO4 A;  3U6F A;  5CYM A;  1NGA A;  4MLH A;  1FXX A;  3EN9 A;  5KPR A;  1ATN A;  4FK4 A;  5KRS A;  3KVG A;  5KI6 A;  3DLL L;  3QIN A;  3ZT3 A;  2ZGZ A;  1RGI A;  4A2A A;  3OJS A;  5AZI A;  3E9P A;  4KH6 A;  5AQM A;  2VG7 A;  2KTQ A;  3VF6 A;  1S1T A;  4EZ9 A;  2AA4 A;  4IG0 A;  2Q3S A;  3VER A;  4OPK A;  1NGF A;  2YNH A;  3B8A X;  4QAG A;  4CEZ A;  3CC4 N;  3BGR A;  4BRO A;  4HVJ A;  1U45 A;  3MAQ A;  1ASW A;  1W97 L;  2QK9 A;  3H08 A;  2ETJ A;  2KFZ A;  3VGL A;  2UUB K;  5BRE A;  3C6T A;  4LF9 K;  1QZ6 A;  3EKU A;  3L6Q A;  3QFP A;  3SCX A;  2UYT A;  1BHL A;  3NBP A;  4MO5 A;  3G71 N;  2Q2R A;  3HPG A;  1QSY A;  1KVA A;  4RCH A;  3WQT A;  2G8H A;  4LFB K;  3FZL A;  3WXJ A;  5AQU A;  3I33 A;  4LH5 A;  2XO7 A;  4CJE A;  4DSI A;  4DTR A;  2VGN A;  3U3Y A;  1RTH A;  3MMV A;  2FXU A;  3PO5 A;  2WOM A;  1OH5 A;  4BC3 A;  4CJ5 A;  2F9W A;  2XY8 A;  5JVH L;  4O5B A;  4I6M B;  4BAC A;  3QIO A;  4NCB A;  3AVL A;  1T3V A;  3U4L A;  2F9T A;  5DM6 L;  5A2Q O;  1MDU B;  4JRQ A;  4XIU A;  4BVO A;  3AAP A;  4FK0 A;  2ATQ A;  4FJ9 A;  1TL1 A;  4QOZ B;  3NDK A;  3ISN C;  2V52 B;  3K0S A;  2DPN A;  3NF9 A;  3DYA A;  4GKK K;  4CZG A;  3CM6 A;  1KLM A;  3VMF B;  4M3T A;  5DK5 A;  4FPA A;  1EQY A;  1YIJ N;  1Q9Y A;  5JVG L;  4KPY A;  3F9K A;  2JWK A;  3ZX0 A;  3VEX A;  3OVN A;  4FW1 A;  3NCI A;  3AV9 A;  1RT7 A;  3MED A;  4JKG A;  4DMN A;  4C23 A;  2ZE2 A;  3QNN A;  4CBX A;  4GVE A;  2HNZ A;  3ZEU B;  4JRP A;  5J2M A;  3V81 A;  3H1V X;  3SJH A;  4MO4 A;  3AVK A;  1XNQ K;  4LF5 K;  4I2P A;  3TSP A;  4JI2 K;  3ALY A;  3BY5 A;  2QKK A;  4BC4 A;  3CD6 N;  3FZK A;  3KIO A;  4NB4 A;  2UXB K;  2NRV A;  2P1J A;  3J7Z O;  4KRF A;  1NMD A;  4CF9 A;  5C0Y A;  4C1N K;  4W5T A;  4BRM A;  3LDL A;  1C6V A;  3M8S A;  4K0K K;  3DRR A;  4CEO A;  2E88 A;  5KQD A;  3Q7B A;  3TTC A;  4XH1 A;  3GDQ A;  4KO0 A;  3AO2 A;  1YTU A;  4JAX A;  3WXL A;  4IOA L;  2GWJ A;  3V4I A;  4LF8 K;  5DM7 L;  3HTV A;  1I39 A;  2PZS A;  4JYA K;  3CMA N;  2FSK A;  2UU9 K;  3CCU N;  4DR4 K;  2E2Q A;  1NGD A;  2P9U B;  1VQ6 N;  5TKY A;  4M42 A;  4Y1D A;  3IMX A;  3SV3 A;  1JXE A;  1J53 A;  4OLA A;  3AAQ A;  3SAG A;  4HTU A;  4E7K A;  4Q5V A;  1RTJ A;  2FBV A;  3LP0 A;  3O1B A;  4FZZ A;  1VSI A;  4JI6 K;  3CET A;  3ATV A;  1UA1 A;  2BUP A;  3ULD A;  1RBR A;  2ITG A;  3N4P A;  3NAE A;  5AQH A;  4CIF A;  1B92 A;  3VTH A;  1KFD A;  3E9O A;  1Q18 A;  1TAU A;  3AVI A;  5C25 A;  1IKW A;  4JD2 A;  4CF8 A;  2QXL A;  4AHS A;  3G6E N;  5HP1 A;  1A5W A;  1HYV A;  4B9T A;  1LOT B;  1DEJ A;  4CD1 A;  2HHS A;  2GX9 A;  3KLF A;  2HHW A;  4H5V A;  4FLY A;  2I7N A;  3O6W A;  1WBB A;  3HK2 A;  3G4S N;  2YKM A;  1DTQ A;  4OPH A;  2ZGY A;  1T03 A;  1HPM A;  4FLU A;  4AHV A;  1GLL O;  4CZM A;  1YHQ N;  5TKW A;  4GV9 A;  4JI8 K;  2HMI A;  3PY8 A;  3AO1 A;  1QVG M;  3FE1 A;  3ID6 A;  3M1F A;  2WFB A;  1K8K B;  3O1W A;  4O44 A;  2P5O A;  1S9E A;  2A41 A;  2P9P B;  5FLX O;  5AZI B;  4BR4 A;  2XY7 A;  3IG1 A;  2YHA A;  3LDO A;  3IKM A;  4DFJ A;  2YNF A;  3SK3 A;  3OW2 M;  4JKH A;  2A42 A;  3OYM A;  4CJQ A;  3SUP A;  4ICL A;  2J4R A;  3DWL A;  1YJN N;  1C1C A;  4HCB A;  2E2O A;  1QSL A;  3DXK A;  1T6D A;  5EVZ A;  4IG3 A;  3UKU B;  4A62 A;  4AHT A;  2KFN A;  1KCF A;  1P8Z A;  4FJ8 A;  4JS4 A;  2VCP A;  2X6N A;  1LWE A;  1IKY A;  1TK5 A;  3GG4 A;  3CCM N;  3TAN A;  4M63 C;  4CJ3 A;  3LWM A;  3CCE N;  3HPH A;  4FWP A;  5AQV A;  4FJ5 A;  4CJU A;  2KZZ A;  3ATU A;  3FR0 A;  4E19 A;  5BPN A;  3DOL A;  3ENB A;  3VQ7 A;  4JI3 K;  2QKB A;  2G8F A;  4X64 K;  1YXQ A;  1ILY A;  3IFR A;  4CHP A;  3ZT1 A;  1X9M A;  1QE1 A;  2D5R A;  3I56 N;  1JXB A;  1TL3 A;  4IFY A;  4PL7 A;  1I94 K;  4KTQ A;  2IVO A;  4ILJ A;  4DCH A;  4BVP A;  1D4X A;  1WSF A;  4PKH A;  4B1U B;  3ZET A;  1V4T A;  3D2E B;  3H1Q A;  4I9Q A;  4A57 A;  2D1K A;  4NXN K;  4WFN L;  3HP6 A;  4F9O A;  3A5M C;  3ENH A;  1RT6 A;  1S3X A;  1NJI O;  2H3G X;  1N34 K;  1REV A;  5M1N A;  3RMC A;  4FJI A;  3ZSY A;  3J7Y P;  3CQY A;  2ZWH A;  1Z25 A;  4ISF A;  3C65 A;  4AIL C;  4KHP K;  1RIL A;  3WXK A;  2E2N A;  4FWL A;  4B9V A;  4BE0 A;  5GAE P;  1RBT A;  4BQZ A;  4BE1 A;  1HKG A;  4HCC A;  4E3S A;  1N32 K;  4FLZ A;  1D8Y A;  4M3U A;  1NK8 A;  3ULE A;  1L5U A;  3SQ0 A;  1QHA A;  3ZT0 A;  4H5N A;  3CFP A;  3MX5 A;  1HQE A;  1TKT A;  3S3N A;  4LF6 K;  4QS8 A;  1SAZ A;  1JLA A;  1SZ2 A;  1S1W A;  2HOE A;  4DR6 K;  4O8U A;  3VF2 A;  3O4N A;  5GAG P;  2YKN A;  1DT9 A;  4BRE A;  4G9Z A;  4EHU A;  1JLF A;  4DQS A;  4JEP A;  1TGO A;  3L8B A;  3QNO A;  3CCL N;  4B9Q A;  3VOV A;  1N8R O;  3ZSV A;  2AJQ A;  5LJV A;  1XHZ A;  4M41 A;  3MEE A;  3VN5 A;  2YJE A;  5BPL A;  1S72 N;  1NU0 A;  3THW B;  4Q0B A;  1LAW A;  3DI6 A;  2O8C A;  4F4K A;  2HHX A;  3DMJ A;  4KHQ A;  4JKF A;  4B08 A;  1QSS A;  4IOC L;  4K8X A;  2AP1 A;  1UA0 A;  5AQK A;  5FRN A;  3SQ4 A;  1IJJ A;  3KLE A;  4B3S K;  1D5A A;  1RT2 A;  3F2K A;  3DLG A;  1QQO A;  1HKC A;  4JKG B;  3P83 D;  2P9I B;  4CD3 A;  3OS2 A;  5LMN K;  3R9P A;  3G10 A;  3CFO A;  3O9T A;  4YOT A;  3CCQ N;  5F2R A;  3FGU A;  4BR9 A;  2VG6 A;  4CGH A;  4CES A;  3L2U A;  1KTQ A;  4BR5 A;  2EX3 A;  3VQE A;  4JI5 K;  3HJF A;  2PAV A;  2W6L A;  3K2P A;  4BRP A;  4KHY A;  1T44 A;  3R8E A;  5I42 A;  1OVQ A;  3AVH A;  3O08 A;  3U8X A;  2HND A;  4PY5 A;  3ENO A;  3FZM A;  4AHU A;  1RDA A;  4F3O A;  1VSD A;  2YHB A;  4LSN A;  3ZSW A;  3T3F A;  5AFU H;  2OCE A;  3LP2 A;  5AQF A;  5AQQ A;  5IWA K;  4JV5 K;  4DG1 A;  4DLG A;  3HVT A;  4B1X B;  1HYZ A;  2ASM A;  3TSQ A;  2RF2 A;  1WAF A;  4BWJ A;  4DFM A;  1BIU A;  1KVC A;  4BGB A;  3N4Q A;  5HRN A;  2JLE A;  2ASP A;  3VPZ A;  3DLB A;  5BRF A;  4JKC A;  3QFU A;  3U9D A;  2P9P A;  3IAY A;  1RDU A;  1QTM A;  1TYQ B;  4BRF A;  4E1N A;  1ZBS A;  3MCP A;  4U7B A;  4W5Q A;  3HOS A;  4CVN E;  4MDA A;  5FRO A;  2QM1 A;  1JCF A;  3OYG A;  4C1N I;  3AO5 A;  3L0Q A;  5AZJ A;  3KWG A;  3OYJ A;  4OPJ A;  4JD2 B;  2KKZ A;  2IC3 A;  3MXI A;  4HWI A;  2HBK A;  1RTI A;  2E8A A;  2O8D A;  3D7E O;  5MLC Q;  4ILG B;  1LWC A;  2YCH A;  3A0I X;  4XEI A;  3TAE A;  2OPR A;  4XH4 A;  1SKR A;  3KZB A;  3RR7 A;  4DR7 K;  5GAD P;  3V9X A;  3T1Y K;  4MDB A;  3VTI A;  1C0M A;  4DUY K;  2HW3 A;  4FLV A;  1D9F A;  3JAM O;  1IKV A;  1WN7 A;  2Q0R A;  4GV3 A;  3O3H A;  2EHG A;  4B1Y B;  1L3T A;  3MXJ A;  3BP8 A;  3SQ1 A;  4DHY A;  5ADX A;  4YY3 K;  1N5Y A;  1VQM N;  3IDH A;  4F2R A;  3L2R A;  1CXQ A;  3PSI A;  3K5O A;  4DSJ A;  2VQE K;  4RW9 A;  3MN5 A;  4FOE A;  4QS9 A;  4K25 A;  4DWI A;  4QCL A;  3E01 A;  2O8E A;  1R0A A;  1KVB A;  1L3V A;  2JGU A;  4HUF A;  2HMP A;  1HYS A;  2WC9 A;  4B9M A;  3CER A;  3EO3 A;  5AR0 A;  1NNE A;  4FOI A;  4CJL A;  3OYF A;  2P9L A;  2PBD A;  3TWH A;  3NFA A;  5M1P A; 
#chains in the Genus database with same CATH homology
 4K8Z A;  4RG8 A;  1RBS A;  2QKK A;  3NH1 A;  1ASV A;  2XHB A;  3DOK A;  3NF7 A;  4DTJ A;  4C8M A;  3B6O A;  3KIO A;  4BDY A;  1JLG A;  3IS9 A;  2P1J A;  4MQ3 A;  4KRF A;  4BWM A;  3AVC A;  5CY4 A;  4CF9 A;  4KB0 A;  4FZX C;  1JLE A;  3M8P A;  1WAJ A;  4W5T A;  3KK2 A;  4E89 A;  3QEP A;  3DRP A;  4N41 A;  4CJT A;  3JSM A;  1C6V A;  3M8S A;  4FK2 A;  3DRR A;  4DLE A;  4CEO A;  4KI4 A;  1CZ9 A;  1JKH A;  1HPZ A;  1VSM A;  3QES A;  3DRS A;  1NJY A;  4KO0 A;  4ZTJ A;  3AO2 A;  1YTU A;  1RT1 A;  1ZBU A;  3LAL A;  1G15 A;  1DLO A;  1U04 A;  4IBN A;  3U3G A;  3KLG A;  3V4I A;  4Z4I A;  1UAX A;  1I39 A;  3TI0 A;  2PZS A;  3AVA A;  3AVJ A;  5JS2 A;  4GMJ B;  1TV6 A;  3OYA A;  1TKX A;  3V1O A;  1LAV A;  2BE2 A;  1WSJ A;  4Y1D A;  3ZSZ A;  3AA3 A;  4M42 A;  1W0H A;  3SQ2 A;  2B4J A;  3OYK A;  3SV3 A;  3LWL A;  2OZS A;  4DSK A;  1JXE A;  3VQA A;  1J53 A;  1GOC A;  4ZTF A;  1HQU A;  1HRH A;  4O0J A;  4OLA A;  3RMD A;  4FJG A;  4HTU A;  4E7K A;  5HRO A;  4Q5V A;  3T19 A;  4FJX A;  4NCA A;  1RTJ A;  2FBV A;  2GUI A;  3LP0 A;  3V9S A;  4FZZ A;  4ID5 A;  1VSI A;  4RW8 A;  1Q9X A;  2HHU A;  1UA1 A;  3FFI A;  3ULD A;  1RBR A;  2ITG A;  3OYN A;  4NYN A;  3SI6 A;  3NAE A;  4EP4 A;  3V9U A;  4OKE A;  1NK4 A;  4OJR A;  4CIF A;  4F3T A;  3VQQ A;  2VG5 A;  2F8T A;  2G8K A;  1B92 A;  1VRU A;  3K5N A;  1KFD A;  3ZT2 A;  4B8C A;  2FC0 A;  1TAU A;  4FW2 A;  4CJ4 A;  3TAR A;  3AVI A;  5C25 A;  3OYC A;  5J2Q A;  1IKW A;  3LZI A;  4W5R A;  4RW6 A;  1A5X A;  2OYQ A;  4H4M A;  4DU3 A;  4CF8 A;  3OS0 A;  4ELT A;  1BL3 A;  4AHS A;  1BCO A;  3VA3 A;  5HP1 A;  3LAN A;  4DSL A;  2DY4 A;  1XWL A;  4ID1 A;  4CGJ A;  1VSK A;  4FLW A;  4E7L A;  1A5W A;  1HYV A;  3SJJ A;  4B9T A;  4CJF A;  1WSH A;  4CK3 A;  1W9H A;  2HHS A;  3QLH A;  4CEE A;  4CK2 A;  3KLF A;  2HHW A;  5CZ1 A;  4FLY A;  3D45 A;  1HNV A;  3VQP A;  3BDP A;  1EP4 A;  2HVI A;  1BI4 B;  3ZSO A;  3QER A;  3HK2 A;  4I2Q A;  4CHZ A;  4C8N A;  4KTW A;  4BDP A;  2YKM A;  1DTQ A;  4CHO A;  3K59 A;  2WON A;  2VWK A;  1CXU A;  4GVM A;  1T03 A;  1UOC A;  2IOC A;  2HHV A;  1SV5 A;  5J1E A;  1DTT A;  3LDS A;  1K6Y A;  4FLU A;  2O4I A;  1X9W A;  2DFH A;  4AHV A;  3M8R A;  4YFU A;  4PQU A;  2E6L A;  1C0U A;  3T1A A;  1L3U A;  4B9L A;  1O1W A;  3DLR A;  1LW2 A;  2HMI A;  3PY8 A;  2F8S A;  3LP1 A;  2FBT A;  4DFP A;  3AO1 A;  4M3Z A;  2DTU A;  3AVB A;  5KTQ A;  4HUG A;  1NKE A;  1J5O A;  2HVH A;  1TVR A;  3HST B;  1YVU A;  1BGX T;  2RKI A;  3L3U A;  3NF6 A;  5K14 A;  4CIE A;  4DTU A;  1L3S A;  4B9N A;  4O44 A;  4FZY A;  2P5O A;  1S9E A;  4Y1C A;  4KHU A;  1RCH A;  2P5G A;  1UWB A;  1NKC A;  4NYF A;  1BQM A;  4I9L A;  2XY7 A;  3EY1 A;  2G8V A;  3IG1 A;  3OYI A;  1FKP A;  2BAN A;  2YHA A;  3L2V A;  4DTO A;  4ELU A;  4DFJ A;  1ZBL A;  2YNF A;  3TAG A;  3LZJ A;  3AO3 A;  5KRT A;  2PYJ A;  4ELV A;  1XHX A;  5C42 A;  3OYM A;  1VK0 A;  4OKK A;  1U48 A;  1VSJ A;  3S3O A;  4KHW A;  4CJQ A;  3THV A;  3OJU A;  3SUP A;  4ICL A;  1NJZ A;  4EZ6 A;  1TKZ A;  4O0I A;  3SZ2 A;  4PUO A;  1C1C A;  2QXF A;  3VQD A;  3ZT4 A;  4HCB A;  3V6D A;  1NK5 A;  1QSL A;  4LH4 A;  5HRP A;  2DFF A;  4FJL A;  4IG3 A;  3KD5 E;  1S6Q A;  4Z4H A;  3VQB A;  3OYH A;  4BDZ A;  4AHT A;  2KFN A;  4KAZ A;  3WNF A;  1KCF A;  2G8W A;  1JLC A;  2Z1I A;  4FJ8 A;  2A1R A;  4JS4 A;  4CCH A;  3RTV A;  2X6N A;  3QIP A;  1LWE A;  1IKY A;  4KTZ A;  1TK5 A;  1S1U A;  5KGW A;  3MEG A;  3TAN A;  4Z4E A;  3PUF A;  4CIG A;  4FLT A;  4CJ3 A;  1IH7 A;  4EP5 A;  3LWM A;  3VA0 A;  4DQR A;  5FRM A;  4IFV A;  4CEC A;  2YNG A;  3HPH A;  3OY9 A;  4FJ5 A;  3C95 A;  3KLI A;  4KKO A;  4CJU A;  4CFD A;  2KZZ A;  1TK8 A;  3CQ8 A;  3KJV A;  4E19 A;  3VQ6 A;  3CM5 A;  3DOL A;  4CK1 A;  3OYE A;  3HP9 A;  1VSF A;  3VQ7 A;  3AA4 A;  1NJX A;  3D0P A;  2QKB A;  2G8F A;  1ZBF A;  3AA2 A;  3SNN A;  5DMR A;  4CHP A;  3ZT1 A;  3RMB A;  5E41 A;  1X9M A;  1QE1 A;  3CG7 A;  4KHS A;  3TR8 A;  2D5R A;  4CJR A;  3KD1 E;  3TAQ A;  3WNG A;  1EX4 A;  1JXB A;  4W5O A;  1ZYQ A;  1T05 A;  4KI6 A;  1TL3 A;  4FM2 A;  3VQC A;  2B6A A;  2IDO A;  4IFY A;  3SYZ A;  3KLH A;  4CED A;  4KTQ A;  3NGZ A;  1Z26 A;  1ASU A;  1JLQ A;  3M8Q A;  2ZD1 A;  4CGD A;  1NKB A;  4C8K A;  1WSF A;  2Z1G A;  1NK0 A;  4M3X A;  3AA5 X;  4N47 A;  3I0S A;  3VQ5 A;  1RBV A;  2ZQB A;  4DF4 A;  4I9Q A;  1RDB A;  3RWU A;  3QEX A;  2HHT A;  3ZSQ A;  4CHQ A;  1KFS A;  1MU2 A;  1RT5 A;  3HP6 A;  3VQ8 A;  4O4G A;  4E1M A;  3UIQ A;  1VSL A;  3LPT A;  4DSF A;  1RT6 A;  4YNQ A;  1TK0 A;  4KV8 A;  2B5J A;  2A1S A;  3KKR A;  2Z1J A;  3O3G A;  1S1X A;  3OYD A;  3PX4 A;  4J2A A;  3QEV A;  4GW6 A;  1REV A;  5C24 A;  3NE6 A;  3RMC A;  4FJI A;  3ZSY A;  3SV4 A;  1RBU A;  3K5L A;  1SKW A;  3KTQ A;  4FJH A;  3RRG A;  1Z25 A;  4KFB A;  5T7B A;  4AIL C;  3SUQ A;  1RIL A;  4AHC A;  3S3M A;  2D0A A;  4B9V A;  4BE0 A;  4DQQ A;  1RBT A;  1U4B A;  1TKD A;  2RN2 A;  3K5M A;  4BE1 A;  5FDL A;  4UQG A;  4HCC A;  2HB5 A;  4E3S A;  2E6M A;  3G0Z A;  2XRI A;  1QHT A;  4FLZ A;  4TSX A;  4LD0 A;  4I7F A;  1D8Y A;  3EZ5 A;  4M3U A;  1BI4 A;  1BIZ A;  4OVL A;  2VWJ A;  3ITH A;  1NK8 A;  1L5U A;  4CEF A;  3AVM A;  2XY5 A;  1JL1 A;  4OKJ A;  1YT3 A;  3PV8 A;  3SQ0 A;  5D3G A;  1XC9 A;  2OPS A;  3ZT0 A;  3NH0 A;  1I3A A;  2PY5 A;  4FJN A;  3CFP A;  1QQC A;  1HQE A;  1VSH A;  1KRP A;  4F8R A;  1KSP A;  1TKT A;  1FK9 A;  4HUE A;  3S3N A;  2BDP A;  1VRT A;  1U47 A;  1JLA A;  4N56 A;  1S1W A;  3F73 A;  4CER A;  4B9U A;  4AHR A;  3QEW A;  1EET A;  4L8R B;  3NF8 A;  4E7J A;  3O4N A;  1U49 A;  2X78 A;  3C6U A;  2YKN A;  3C94 A;  3OYB A;  3NGI A;  3TAF A;  4E0D A;  3KKS A;  1YTA A;  4HHT A;  4FM0 A;  1JLF A;  2I5J A;  4H8K A;  5KGX A;  3NH2 A;  4DQS A;  3SPZ A;  3MEC A;  4M3Y A;  4DQI A;  1TGO A;  4E7I A;  4CFA A;  3L8B A;  1S6P A;  3QNO A;  4B9S A;  4FXD A;  3HXM A;  2Y1I A;  1EKE A;  3ZSV A;  3CFR A;  1NK6 A;  2AJQ A;  4ZHR A;  1J54 A;  3P5J A;  4CF1 A;  4DTX A;  2D0B A;  1XHZ A;  4M41 A;  1A5V A;  3MEE A;  3VN5 A;  1WNS A;  4BE2 A;  3QET A;  3AVN A;  4H4O A;  4Q0B A;  1LAW A;  1NOZ A;  1S5J A;  3DI6 A;  2X74 A;  4F4K A;  3HT3 A;  1TAQ A;  4OLB A;  4PWD A;  2HHX A;  2KW4 A;  3PX0 A;  3DMJ A;  4N76 A;  4Z4G A;  4JLH A;  4KHQ A;  4NCG A;  4B08 A;  4WE1 A;  1RT3 A;  1QSS A;  3MXM A;  1T8E A;  3HM9 A;  1HNI A;  4K8X A;  2F96 A;  2OPQ A;  4FCY A;  1NOY A;  3S9H A;  1BQN A;  1CZB A;  4R5P A;  1FKO A;  1UA0 A;  3P1G A;  4G1Q A;  3TAM A;  5SZT A;  2NUB A;  1SL2 A;  4CF0 A;  3CYM A;  1GOA A;  5FRN A;  3ASM A;  1Y97 A;  4CJP A;  1GOB A;  2OPP A;  3SQ4 A;  4DU1 A;  4C8O A;  4IKF A;  3KLE A;  2OZM A;  1D5A A;  4IDK A;  2HHQ A;  4CEQ A;  1RT2 A;  1WSE A;  4CE9 A;  5CZ2 A;  3DLG A;  4DQP A;  4DTM A;  1ZBI A;  4N5S A;  3OS1 A;  1BCM A;  1T7P A;  1WSI A;  3P83 D;  4CGG A;  5SWM A;  3OS2 A;  1D9D A;  4CJK A;  3G10 A;  3CFO A;  4DTN A;  2IAJ A;  4LSL A;  4DU4 A;  2DFE A;  2R7Y A;  1RDD A;  2GV9 A;  4J2D A;  4CEB A;  2VG6 A;  4CGF A;  4CGH A;  4CES A;  1IG9 A;  3AVG A;  1KTQ A;  4M45 A;  3WNH A;  3L2U A;  4MFB A;  2EX3 A;  1NK7 A;  5CYQ A;  3AO4 A;  3VQE A;  1NJW A;  4F2S A;  3HJF A;  1C1A A;  1WLJ A;  3K2P A;  1SKS A;  2IS3 A;  4KHY A;  5I42 A;  4PY5 A;  3AVH A;  3HL8 A;  3I8D A;  2HND A;  1SL0 A;  3L3V A;  4W5N A;  4AHU A;  1RDA A;  4F3O A;  1VSE A;  3JYT A;  1VSD A;  1X9S A;  3NGY A;  1ITG A;  1X1P A;  2YHB A;  4LSN A;  3ZSW A;  4CJW A;  2W42 A;  3EYZ A;  3V1Q A;  2RPI A;  3T3F A;  1RTD A;  3DLH A;  3KK3 A;  3LP2 A;  3ZSR A;  3ZSX A;  1SUQ A;  4CJV A;  5HRS A;  4FLX A;  3WNE A;  3PO4 A;  1LV5 A;  4DG1 A;  3U6F A;  5CYM A;  4DLG A;  2YNI A;  4RW4 A;  1FXX A;  3HVT A;  1JLB A;  4FJM A;  4FK4 A;  5KRS A;  2Y1J A;  4M3R A;  1HYZ A;  2KZM A;  2RF2 A;  4OGE A;  5KI6 A;  3L2W A;  3QIN A;  3ZT3 A;  1WAF A;  4E7H A;  4BWJ A;  3OJS A;  3LAK A;  4CHY A;  4DFM A;  1EXQ A;  1BIU A;  4J2B A;  4KRE A;  1KVC A;  2VG7 A;  2KTQ A;  4KB1 A;  1B9D A;  3VQ9 A;  5HRN A;  4FM1 A;  1S1T A;  3SPY A;  4EZ9 A;  2JLE A;  3ZCM A;  1NK9 A;  3DLB A;  4IG0 A;  2Q3S A;  1RNH A;  4AH9 A;  4OPK A;  2YNH A;  4QAG A;  3PX6 A;  3K58 A;  3LPU A;  5J2N A;  4CEZ A;  3IAY A;  3BGR A;  4FYD A;  4HVJ A;  1QTM A;  1KLN A;  4FJ7 A;  1C0T A;  1RDC A;  1U45 A;  5HRR A;  3MAQ A;  2XY6 A;  4E1N A;  1ASW A;  3HVR A;  5JS1 A;  4DS5 A;  1HJR A;  3H08 A;  2ETJ A;  2QK9 A;  2KFZ A;  4W5Q A;  3DLK A;  4DTS A;  2P51 A;  4M3W A;  3C6T A;  4Z4F A;  3HO1 A;  5FRO A;  3HYF A;  4CF2 A;  3O3F A;  3SCX A;  3DLE A;  3SUO A;  4JS5 A;  2E4L A;  3OYG A;  1BHL A;  3NBP A;  3HPG A;  1QSY A;  1KVA A;  3AO5 A;  4OGC A;  2G8H A;  3NHG A;  1J9A A;  4Z4C A;  3OYJ A;  4OPJ A;  4DF8 A;  4FJK A;  3RMA A;  2IC3 A;  4DS4 A;  4J2E A;  3OYL A;  3MXI A;  1SL1 A;  4LH5 A;  1C1B A;  2XO7 A;  2LSN A;  4CJE A;  1IKX A;  4DSI A;  1RTI A;  3K57 A;  3QEI A;  3L2Q A;  3V1R A;  4DTR A;  1BIS A;  4CFC A;  4B8A B;  5J2P A;  3U3Y A;  1LWC A;  1RTH A;  2G8U A;  3TAE A;  3PO5 A;  2WOM A;  2KQ2 A;  2FBY A;  4CJ5 A;  2OPR A;  5HLF A;  3IRX A;  1CLQ A;  1SKR A;  3TAP A;  3RR7 A;  2XY8 A;  4O5B A;  4CFB A;  3VQ4 A;  3V9X A;  4BAC A;  4C8L A;  2BGG A;  3QIO A;  4NCB A;  1F21 A;  3AVL A;  3I0R A;  3RRH A;  1LWF A;  1C0M A;  2D0C A;  2HW3 A;  4FLV A;  1IO2 A;  4JRQ A;  1D9F A;  1RT4 A;  1IKV A;  4O55 A;  4XIU A;  1WN7 A;  3V9W A;  4FK0 A;  2YV0 X;  2ATQ A;  2FBX A;  4CHN A;  4FJ9 A;  1TL1 A;  2GBZ A;  2O4G A;  4QOZ B;  3O3H A;  3NDK A;  3SUN A;  3ISN C;  2EHG A;  3A2F A;  5I3U A;  1XI1 A;  1L3T A;  3MXJ A;  3DYA A;  3NF9 A;  4KHN A;  2X6S A;  2G8I A;  3CM6 A;  4CEA A;  3SQ1 A;  1S9G A;  2OA8 A;  4RW7 A;  1KLM A;  1ZBH A;  4M3T A;  1B9F A;  5DK5 A;  4DTP A;  1N5Y A;  1Q9Y A;  4KPY A;  3F9K A;  3QO9 A;  4Z0U A;  4F2R A;  3L2R A;  3LAM A;  1CXQ A;  4DFK A;  5HBM A;  1N6Q A;  3OVN A;  4FW1 A;  3K5O A;  3RR8 A;  3NCI A;  3AV9 A;  4DSJ A;  1JL2 A;  3V9Z A;  4FVM A;  1RT7 A;  3MED A;  3O4Q A;  4RW9 A;  4CJS A;  2ZE2 A;  4DMN A;  3QNN A;  3DM2 A;  2HNZ A;  4JRP A;  5J2M A;  4QCL A;  3V81 A;  4DWI A;  1Q8I A;  3E01 A;  2PYL A;  2IGI A;  1WSG A;  1R0A A;  1KVB A;  4DSE A;  3KK1 A;  3AVK A;  1HMV A;  2JGU A;  1L3V A;  1LW0 A;  3HPO A;  4HUF A;  1QS4 A;  1HYS A;  4PA1 A;  4B9M A;  4I2P A;  5EU7 A;  3B6P A;  4FJJ A;  4B3O A;  2HNY A;  3LP3 A;  2Z1H A;  3ALY A;  3TAB A;  4CJL A;  3OYF A;  3AVF A;  3TWH A;  1S1V A;  3NFA A;  4CGI A;  4LY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...