3VQCA

Hiv-1 in core domain in complex with (5-methyl-3-phenyl-1,2-oxazol-4-yl)methanol
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
151
structure length
141
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPSMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
total genus 49
structure length 141
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqcA00
1SL1A 1EP4A 4HUGA 1RBTA 5CYMA 1XHZA 4DQRA 4DQPA 3L2QA 3ZT4A 4I9QA 3C6TA 3OS0A 4KPYA 3OYKA 1N5YA 1YTUA 3DOLA 3TR8A 3QERA 1T03A 3TAEA 4FK4A 1KFDA 4H8KA 2PYJA 3BDPA 5CY4A 3QETA 1RBSA 4Z4GA 3NH2A 5JS1A 3VA0A 1L5UA 1C1CA 4KB1A 1LAWA 2G8HA 4DSIA 1S9GA 2YNFA 3S3NA 1ZBIA 3SQ4A 3G0ZA 1RT2A 3CFPA 5J2NA 1SL2A 4IBNA 2G8UA 1LWCA 2YNHA 3CFRA 5HBMA 1U04A 5JS2A 3OYDA 2A1RA 2DY4A 4WE1A 4FJ8A 3VQ5A 3LDSA 4W5TA 3M8RA 4CGJA 1IKVA 4LSNA 4CEZA 3HXMA 3SQ2A 3OYEA 4FVMA 5KGXA 3NBPA 1CZ9A 3L2VA 3LP1A 2RPIA 4DU4A 1X9SA 4IFVA 1SKRA 2ITGA 3VQDA 2F8TA 1REVA 4R5PA 4AILC 5J2PA 4DTJA 4LH4A 3TAFA 4M42A 4LY7A 4C8OA 4DFKA 1KCFA 3DLHA 4DF8A 1RDBA 2G8WA 3C6UA 4XIUA 3SYZA 4OGEA 4DSFA 3OYIA 4CHNA 1J5OA 1VSFA 1BISA 1J54A 2XO7A 3RMDA 2BANA 4PY5A 3K59A 1U47A 2IGIA 2IOCA 1U49A 3DMJA 3RRHA 4OGCA 4AHTA 3AVIA 2GBZA 2HNZA 1TL1A 3HSTB 4E19A 3I8DA 1QTMA 1WSHA 4AH9A 4DTNA 3DRRA 1TK0A 4DQSA 4CE9A 3C95A 2IC3A 3NFAA 1TK5A 1A5WA 1VSKA 4ELVA 1D8YA 1HPZA 3HO1A 1RBRA 3OYMA 5KTQA 3V1QA 4C8KA 4M3WA 4CFBA 5SWMA 3EYZA 4FM1A 3OYHA 1WSEA 1ZBFA 4CGGA 1QQCA 1C1AA 1EXQA 1HMVA 4O0JA 3NH1A 5HRNA 3SJJA 1WSIA 3QIOA 5HRSA 1I39A 3SPYA 1U4BA 2KZMA 2Y1IA 4I2QA 1KVBA 4Q0BA 1HYVA 3V1RA 3NCIA 4DTUA 1NK6A 5CZ2A 3DLGA 4CJTA 2FBTA 3AO2A 4KB0A 3TAPA 4E3SA 4FJNA 4OKEA 4HVJA 2YKNA 5HROA 1JL2A 3PX0A 3DI6A 3HJFA 4CEDA 4KHQA 1XWLA 4CERA 1RTIA 3VA3A 2XY7A 3SQ1A 3TI0A 2YKMA 3ZSQA 2LSNA 3A2FA 3LP2A 4M41A 4B9MA 4C8LA 1FK9A 2F8SA 4BWJA 1U48A 3KK3A 1LV5A 3WNEA 2Q3SA 4FK0A 1LW2A 4FJGA 1TKXA 2G8FA 1HJRA 2QK9A 4KAZA 4BE2A 3TARA 3IRXA 4AHRA 4FJLA 1BL3A 3S3MA 1VSDA 4RG8A 2HHSA 1S1UA 4RW7A 4C8MA 3KLGA 4DS4A 1Q8IA 1KRPA 4FJHA 4DF4A 1LW0A 4FLZA 2Z1JA 3KJVA 2X74A 3ASMA 2X6NA 4DG1A 4O4GA 4KHSA 2B4JA 4C8NA 4DFMA 4JS4A 4FJ5A 4N41A 4F8RA 4E7JA 1RBUA 4CK1A 2PZSA 4CJPA 1BQNA 4LD0A 3QNNA 2G8VA 3HPOA 2ZE2A 4CJWA 4CF1A 4BDPA 1YVUA 3OYGA 1RILA 2OZMA 4FJ7A 1WN7A 1HQEA 4IG3A 1BIUA 4W5RA 2QXFA 5SZTA 3VQ8A 1XHXA 3OYCA 1UA0A 3DLKA 4QOZB 1IKYA 4HUFA 3DRPA 3NE6A 4O55A 3L3VA 4CJVA 2XY8A 2GUIA 4QAGA 3C94A 1HRHA 4NCBA 1NK5A 2YHAA 3VN5A 4DQIA 5D3GA 3QLHA 4DTMA 3M8SA 1HNIA 4CEOA 3DLBA 4B9SA 3AVAA 1RT6A 3QINA 3NDKA 4W5OA 4CIFA 4CJ5A 1TK8A 1ASWA 3RMAA 3HPHA 1WSGA 4CFCA 2HNYA 1SUQA 3V6DA 3TAGA 3PUFA 4CHOA 3OS2A 3M8QA 3ZSXA 3RRGA 1QS4A 1A5VA 1SV5A 4E89A 3JYTA 3KLFA 3PV8A 2I5JA 1JLFA 1IKXA 1WSFA 2QKBA 4B9NA 3VQBA 1Z26A 3AA3A 4CK2A 1Q9XA 2OZSA 4OVLA 3JSMA 3L3UA 3AVFA 4M3UA 1D9DA 1NK9A 2OPSA 3AVLA 4Z0UA 3ZT2A 2Z1GA 3HP6A 2XY6A 4ELUA 3AVHA 2R7YA 2YNGA 1TGOA 2HB5A 3FFIA 4RW8A 5EU7A 5HLFA 4F2SA 4CCHA 4I7FA 3SV4A 1NJXA 1RCHA 4CGHA 1RT3A 4HCBA 4DTOA 3VQPA 3UIQA 1VSHA 3P5JA 3HVRA 4BDZA 3V4IA 3IAYA 1LWEA 3ZT0A 2HW3A 3RR7A 3KLHA 5FDLA 3LZIA 3LPTA 1JLEA 2EX3A 4OLBA 4CGIA 3SNNA 3O4QA 4Y1CA 4Z4HA 3CQ8A 1JLAA 1RTDA 4DU1A 4E7IA 2OPRA 1J53A 1VSLA 3SUPA 4KRFA 1ZBHA 2ETJA 4E7KA 3LP0A 2B6AA 4NYNA 1DTQA 2P5OA 2O4IA 1JLQA 2KTQA 3AVMA 1RBVA 2VWJA 1EETA 4ID5A 3L2UA 3I0SA 3ULDA 3TWHA 1UWBA 1X9MA 1BI4B 3SQ0A 3ZSZA 2HHXA 1S6QA 3F9KA 3F73A 2ZD1A 4K8XA 4I2PA 4AHUA 5KRSA 2DTUA 1BHLA 1KVAA 2YV0X 3T3FA 2OPQA 4H4OA 4FJKA 2JLEA 4G1QA 3O4NA 4AHVA 3DOKA 2D0AA 2RKIA 3OYFA 3QEVA 1NKBA 1L3UA 4RW9A 4CECA 4CHYA 2XHBA 4HUEA 2D5RA 4E0DA 3OYJA 5HRPA 3MXIA 2HVHA 1WAJA 3QEIA 4FZZA 1YT3A 3P1GA 1TL3A 2HHTA 3K2PA 3NF8A 4CF2A 3ZSWA 1IG9A 4B9LA 2OPPA 4KTWA 3AA2A 4HCCA 4CJ3A 4CJLA 2QKKA 3HT3A 4ID1A 4B9UA 5C24A 2E4LA 3VQEA 4CIGA 1TKDA 3VQQA 4LSLA 2DFFA 4CJ4A 1JL1A 3TANA 4DTXA 3HYFA 4ICLA 1NJYA 1VRUA 1HQUA 3PO5A 3T19A 4RW6A 4FJ9A 4FZXC 1RDCA 1ZBUA 2KZZA 2OYQA 4PA1A 4DSEA 4Q5VA 4M3TA 1EX4A 3S9HA 5J1EA 2G8IA 3HL8A 4CIEA 1BGXT 4AHSA 4AHCA 2GV9A 3AO1A 3RMCA 2HHWA 3ZCMA 3PX6A 3KIOA 3AVBA 3NGYA 1GOAA 3NH0A 2DFEA 5J2QA 3V81A 2B5JA 4GMJB 3KD1E 3AO4A 1JXEA 1ITGA 1IH7A 3LALA 3AV9A 4LH5A 1W0HA 1ASUA 4O5BA 1UA1A 2PY5A 3V9WA 1NOZA 1Q9YA 3ZT1A 1KFSA 1I3AA 1TAUA 1TKTA 3I0RA 1IO2A 3CM6A 4M45A 4DSKA 4OKKA 3V1OA 3KK1A 1FKPA 3M8PA 4FXDA 1BQMA 3DLRA 5FROA 3ZSRA 4B3OA 3LAMA 5E41A 4B08A 1S1XA 1T8EA 1TVRA 3ZSYA 4CHPA 2F96A 1IKWA 1RT5A 1HNVA 3V9UA 3PX4A 4KI6A 1WSJA 4EZ6A 2Z1HA 4IFYA 1L3SA 1SKWA 4EP5A 5HRRA 4PQUA 1JLGA 5I42A 3O3HA 1EKEA 4Z4FA 1S6PA 4E7LA 1XI1A 4PUOA 4KHUA 4DMNA 4QCLA 3KLEA 1BI4A 4DFPA 3D0PA 4IDKA 1K6YA 3OS1A 1NK8A 3DYAA 3AVCA 3P83D 4Z4CA 4F3TA 3SPZA 3DM2A 1ZYQA 1QE1A 2HNDA 5KRTA 4CJKA 5DMRA 4KHNA 4HTUA 1QSLA 3CFOA 4CEBA 1U45A 4F4KA 4YFUA 1GOCA 2Y1JA 1C1BA 2W42A 4KTZA 3NGIA 1UAXA 3KD5E 3LWMA 3VQAA 3MXJA 3VQ6A 3V9XA 1C0MA 4CEEA 3ITHA 4CF0A 2G8KA 4DLGA 4CGDA 1KVCA 3RTVA 2KQ2A 3H08A 2FC0A 2PYLA 1A5XA 3MXMA 4CFDA 4PWDA 4CF9A 3LZJA 2IAJA 3B6PA 4CJRA 1D5AA 3OYNA 1SKSA 3MECA 3KTQA 2HHQA 4DSJA 4W5NA 3WNGA 1BCMA 2VG7A 1JLBA 2ATQA 4L8RB 4BWMA 4DLEA 4J2DA 1RDAA 5KI6A 4FK2A 4W5QA 1NOYA 2E6MA 3CG7A 3AA5X 4CEFA 3TABA 5I3UA 3HP9A 3VQ9A 4GVMA 3BGRA 1NKEA 4B8CA 2KW4A 4N47A 4E1NA 3NHGA 1L3TA 1QSSA 3U3GA 1NK7A 4DTSA 2HHVA 4O0IA 2WONA 4H4MA 4KO0A 4CEAA 3CYMA 3QNOA 4DSLA 1DTTA 3TAQA 4E1MA 4NYFA 1BCOA 3HK2A 4YNQA 1NK0A 2FBVA 5C42A 3IG1A 4TSXA 3AVJA 1JXBA 2D0CA 3KLIA 3G10A 4BACA 4GW6A 2D0BA 1FXXA 1L3VA 1CLQA 4FW1A 2XRIA 1VSEA 1Y97A 3WNFA 4KKOA 1TV6A 3MEGA 1NJWA 4KHYA 2Z1IA 1WLJA 3OYAA 4FJMA 1S9EA 3SV3A 2VG6A 4M3RA 5CZ1A 1RT4A 3KK2A 2O4GA 5KGWA 1LWFA 1FKOA 1Z25A 3K5MA 4DTRA 4KHWA 3OYBA 3EZ5A 3SUNA 4NCGA 1WAFA 1DLOA 1VRTA 3O3GA 1WNSA 3AA4A 1N6QA 1KSPA 2E6LA 1HYZA 1KLMA 4CEQA 2AJQA 4RW4A 1B9DA 3DRSA 4FLTA 1C0TA 1XC9A 3L2WA 4CGFA 1G15A 2FBXA 4I9LA 3T1AA 3VQ4A 4FZYA 4KI4A 4EP4A 2ZQBA 3WNHA 3PO4A 4KTQA 1X9WA 4BE0A 1UOCA 2IDOA 3HPGA 4J2EA 4DQQA 1NKCA 4J2BA 2BDPA 3CM5A 1CZBA 4ZTFA 3ZSOA 4ELTA 4NCAA 4E7HA 2X78A 3ALYA 1RT7A 4KREA 2NUBA 1NJZA 5FRMA 2P5GA 3E01A 3EY1A 3SUOA 2YNIA 3HVTA 3S3OA 4B9TA 4CJSA 2DFHA 2KFNA 4CHQA 2HMIA 4CESA 1KLNA 2IS3A 4B8AB 4CHZA 1VK0A 3K5NA 3V9ZA 4K8ZA 4OLAA 5DK5A 3AVGA 2X6SA 3QIPA 3NF7A 4FLYA 4N5SA 4FLVA 4FJJA 1C6VA 1X1PA 3THVA 1S1TA 4CJEA 3SUQA 1QSYA 3VQCA 4DTPA 3QEWA 3NAEA 4M3XA 4ZHRA 4BDYA 3LP3A 3RMBA 1S5JA 1CXUA 3D45A 1RTHA 1B9FA 1BIZA 4DS5A 4Z4IA 5J2MA 3NF9A 3RR8A 3OYLA 3L2RA 4FCYA 4B9VA 1RDDA 2HVIA 3O3FA 1RT1A 4OPJA 4DWIA 3L8BA 4IKFA 1RTJA 1C0UA 3K57A 3KKSA 1KTQA 4FJXA 1GOBA 3TAMA 4UQGA 4FW2A 4FLXA 2RF2A 2WOMA 1S1WA 1HYSA 4IG0A 3SI6A 2A1SA 4JLHA 1B92A 5C25A 3SZ2A 4N76A 3NF6A 4FM2A 1YTAA 4KV8A 1R0AA 5T7BA 1JKHA 2FBYA 3AVNA 1W9HA 4OKJA 3KKRA 1MU2A 3LWLA 1RNHA 4MFBA 1T05A 1T7PA 2P1JA 4ZTJA 4FJIA 4CF8A 4FM0A 4OPKA 3SCXA 4M3YA 3NGZA 5K14A 3K5LA 3QO9A 4JS5A 4FLWA 2OA8A 3OVNA 1VSJA 1QHTA 2BE2A 3MEEA 4O44A 4CK3A 4Z4EA 1J9AA 3QEXA 4M3ZA 3K58A 2KFZA 3OJSA 3DLEA 1D9FA 4F2RA 4DFJA 4F3OA 4J2AA 4JRQA 1O1WA 3LAKA 3U3YA 5HP1A 3RWUA 3U6FA 3AVKA 1NK4A 4N56A 3OY9A 4CJQA 4KFBA 1F21A 3B6OA 3AO5A 3MEDA 3OJUA 4OJRA 2RN2A 4EZ9A 1TKZA 4FYDA 1ASVA 1CXQA 3V9SA 1LAVA 3ZT3A 2VG5A 3LPUA 4DU3A 3LANA 2YHBA 3K5OA 2HHUA 1S1VA 2BGGA 3ZSVA 2JGUA 2EHGA 3ISNC 3HM9A 2VWKA 3MAQA 1SL0A 4HHTA 3QEPA 1ZBLA 5FRNA 1JLCA 4FLUA 5CYQA 4Y1DA 4CFAA 3IS9A 4BE1A 4MQ3A 2P51A 1VSIA 3VQ7A 4CJFA 3AO3A 3QESA 3PY8A 1TAQA 2XY5A 1VSMA 4JRPA 4CJUA
chains in the Genus database with same CATH superfamily
1OVQA 4JK8A 4ILGB 5BN8A 2E1ZA 3F5TA 4DQPA 3ZT4A 1YTUA 1T03A 2H3GX 4H8KA 3BDPA 1RBSA 3NH2A 3VA0A 2ZJRL 3S3NA 5BN9A 2UU9K 3G0ZA 1HNWK 2G8UA 1LWCA 1U04A 3LDSA 4AM6A 1RDUA 3FR0A 3NBPA 3L2VA 2WTUA 3LP1A 2P9IA 2F8TA 3I56N 4LF8K 4AILC 5J2PA 4LH4A 3TAFA 3ZX0A 4M42A 4C8OA 3PLAA 1RDBA 3C6UA 3GE1A 2I7NA 4PKIA 1GLCG 1NG9A 1RDWX 4CD3A 1U47A 2IGIA 1OH5A 4AHTA 5JVHL 4AH9A 4DTNA 1WUAA 4CE9A 1KXPA 3GBTA 1VSKA 1HPZA 3HO1A 4R79A 4C8KA 4CFBA 4PHTX 4FM1A 3OYHA 1ZBFA 3CQYA 3THYA 1C1AA 4O0JA 1HMVA 5BPMA 5HRNA 4FOIA 2Y1IA 3NCIA 1NK6A 4LFAK 3DLGA 2FBTA 1TYQA 4KB0A 3TAPA 1U2VA 5FPMA 2HBKA 4HVJA 2YKNA 3HJFA 4JKFA 4B9MA 1GLBG 2P9UB 4I6MB 3P4IA 2A42A 1LW2A 4FJGA 2AA4A 3ZEUA 2QK9A 3LDPA 4AHRA 4FJLA 4RG8A 1S1UA 4C8MA 4DS4A 4FJHA 1Q8IA 1ATRA 2Z1JA 3ASMA 3O08A 3GL1A 4O4GA 4JHDA 3ZETA 4DFMA 3LDLA 4N41A 3VF4A 2PZSA 3OHRA 4H5RA 1XC3A 2G8VA 4B1YB 4C23A 3BUZB 5B8HA 3OYGA 4FJ7A 1WN7A 4IG3A 3BP8A 1XMOK 2NRVA 3Q7BA 2YJEA 5LY3A 1XQSC 4CJVA 3EE8A 4QAGA 2OTLN 4NCBA 3C94A 4DR6K 5D3GA 4FSVA 4DQIA 5M1QA 4CD1A 4QS8A 1HNIA 2J4RA 4KBOA 4CEOA 1BG3A 1RT6A 4CIFA 4JYAK 4JI6K 3PUFA 3OS2A 3RRGA 2GTDA 1A5VA 4KHPK 3KLFA 5ELZA 3U9ZA 3CHWA 2HBMA 3VQBA 1OH7A 4FWQA 1Q9XA 4OVLA 2WBNA 4ELUA 3HP6A 3AVHA 2R7YA 2HB5A 5EU7A 2E88A 1NJXA 4MLHA 4DV3K 1VSHA 3U8XA 3IAYA 4FWNA 4BRFA 3KLHA 3LZIA 3LPTA 1JLEA 1EQYA 4DHYA 3FZHA 1JLAA 1RTDA 4DU1A 4JAXA 4KRFA 3WXLA 2ETJA 3VEOA 3DXKB 4WF9L 3AVMA 1QZ6A 3ULDA 3VEVA 3UKRA 3F9KA 2ZD1A 5BPLA 4JI8K 4AHUA 5KRSA 1BHLA 2I7PA 1KVAA 2PFUA 3DOKA 3O6WA 3QEVA 1NKBA 2D5RA 3OYJA 1HKCA 2UXDK 1WAJA 3DLLL 4CF2A 3ZSWA 4B9LA 2OPPA 4CJ3A 2FXUA 3VQEA 3O9QA 5AQFA 4LSLA 4CJ4A 3TANA 4DTXA 1NJYA 4ICLA 3VF2A 3PO5A 4PA1A 4DSEA 4Q5VA 3SLCA 1EX4A 2G8IA 1ATNA 2FLOA 2HHWA 3GG4A 3NH0A 4IOCL 3FZMA 4GMJB 3UKUB 1ITGA 1IH7A 4JI1K 2D0PA 2Q1NA 2QWLA 4YHHK 1Q9YA 1M1KO 3I0RA 1NLVA 1N34K 1VQ5N 3CPEA 4RCHA 2VQFK 3BF3A 3CCMN 1K73O 2VQEK 5LJVA 1T8EA 4YOUA 4CHPA 1HNVA 5HOOA 1L3SA 5JMVA 4GV6A 1W97L 3WQTA 3D2EB 1BI4A 3OS1A 3SPZA 3DM2A 5AQOA 2HNDA 3CC2N 3QBWA 4KHNA 3BY5A 3CFOA 4Y0WA 4BC4A 1GOCA 2W42A 3ZLJA 2Q0RA 3NGIA 1QQOA 3MXJA 3V9XA 4CF0A 3LDQA 1KVCA 2KQ2A 2PYLA 4PWDA 5C10A 3LZJA 2IAJA 3A5NC 4YDUC 1D5AA 3WUHA 4W5NA 3A5LC 4IEIA 2ATQA 2YI1A 3R8EA 1RDAA 2E6MA 5I3UA 3ATUA 2P9KA 3J8AA 2PBDA 4E1NA 3NVMA 3ENBA 1L3TA 3CCRN 1NK7A 4DB3A 3FE1A 2HHVA 4O0IA 3IKMA 2YHXA 3HZ6A 3TAQA 1S22A 2FSNA 4X64K 4FL9A 4CZEA 1BCOA 1J5EK 2D4WA 2FBVA 5KPZA 3IG1A 4YORA 1N32K 4TSXA 3AVJA 3G10A 1BWFO 3Q7CA 1TV6A 2F9TA 1NJWA 4O8KA 1S9EA 5KGWA 1Z25A 3SUNA 1WAFA 1DLOA 1WNSA 3AA4A 4O5FA 1KAZA 4RW4A 5M1FA 3FZLA 1XC9A 1Z6RA 1K8KB 3VQ4A 2ZQBA 1HX1A 5C15A 4BE0A 2YHWA 3HPGA 3KZBA 4DQQA 3CM5A 4ZTFA 4ELTA 3TTCA 4E7HA 3ALYA 2HSTA 2O8FA 2P5GA 4RWTA 3EY1A 3HVTA 3VENA 4B3SK 3EEQA 2O8EB 4CJSA 3THXA 1X9JA 2KFNA 3R1XA 2OCEA 3AARA 4B8AB 4V19S 1NGGA 4FLYA 3LM9A 3QIPA 5EY4A 4BRQA 3SUQA 5KPTA 3J7YP 2KKZA 4BDYA 3LP3A 1S5JA 4LF4K 1CXUA 1BIZA 5J2MA 4FCYA 4B9VA 3WEEB 3K57A 1GOBA 4FLXA 2RF2A 1S1WA 3MWTA 5C25A 3O9RA 3AVNA 1GLFO 3WXIA 2NRWA 4PKGA 3A0IX 4B1XB 1C0GA 4NXMK 5K14A 3K5LA 3QO9A 2HF4A 1U6ZA 4FLWA 3CJ1A 2IVNA 4O44A 1YITN 2QI2A 2E5LK 3K58A 2KFZA 3OJSA 4DFJA 3U3YA 3U6FA 3AVKA 3OY9A 1F21A 1CZAN 4DR3K 3VEWA 1TKZA 1NGCA 4JI4K 1ZC6A 2VG5A 3LANA 2BGGA 4A61A 2O8CA 3ISNC 3HM9A 2F4VK 3MAQA 3ID6A 1SL0A 4HHTA 1ZBLA 1JLCA 4FLUA 4H5VA 4Y1DA 3IS9A 3R3LA 3VQ7A 1SQKA 3QDKA 3QESA 2RHKA 3DAWA 3O9SA 4DCHA 1RBTA 1XHZA 1X3NA 3OS0A 3A5OC 2ZM6K 2PYJA 3B8AX 1L5UA 1C1CA 1LAWA 3E9PA 2G8HA 1S9GA 2YNFA 3EKSA 4H0VB 2ZGYA 5J2NA 1SL2A 4IBNA 2DY4A 4M7XA 2YX6A 4W5TA 3M8RA 4CGJA 3SQ2A 3HXMA 5KGXA 1BU6O 4GKJK 3VQDA 2Q2RA 4BC2A 4A2AA 4FVUA 1P8ZA 2CH5A 1GLAG 4DSFA 3OYIA 2QM1A 4B3TK 4PY5A 3IFRA 3K59A 2AP1A 1U49A 3RRHA 2CGJA 3AVIA 4H5WA 5M1OA 3SAGA 1QTMA 2P9PA 3DRRA 2IC3A 1TK5A 2O8BB 1QZ5A 3V1QA 2HF3A 4YOYA 3EYZA 4FWMA 2F7TA 1WSEA 4XH4A 1EXQA 4JK9A 3NH1A 2KZMA 4I2QA 1VQ8N 2VYPA 3H46O 3V1RA 4EIAA 2YHYA 3R9PA 3CJAA 5AZIB 4PKHA 4LF6K 1YI2N 1JL2A 4CEDA 4KHQA 2YKMA 3G6EN 4C8LA 1FK9A 4BWJA 4FK0A 3KK3A 3WNEA 2Q3SA 1HJRA 2P9NB 4LF9K 4BE2A 3TARA 1BL3A 4OPAA 4BRIA 4X62K 3HOTA 1VSDA 3PSIA 1ZXOA 5AQJA 2Q31A 2GX9A 5AQKA 4KHSA 4H0OA 4JS4A 1BA0A 3P31A 1RBUA 4JKDA 4B1WB 1LCUA 1S72N 2O8DB 3QNNA 3HPOA 4CJWA 4BDPA 1HQEA 1DEJA 5H1SQ 2W6LA 3VQ8A 1UA0A 4QOZB 3CCSN 2QA4N 4O55A 1GLDG 1HRHA 1NK5A 2YHAA 5AQVA 1R59O 4B9SA 4BRCA 1VAZA 3CJBA 1TK8A 3C65A 4X66K 1WSGA 4IO9L 4CFCA 4CZLA 3IMXA 1Q81O 3KK7A 2I5JA 1JLFA 1WSFA 3VGLA 3CMEN 2IVOA 4BR7A 3JSMA 4DR1K 4M3UA 1D9DA 3WXJA 1NK9A 3AVLA 1NNEA 4JD2B 3RSEB 4BRPA 1VQMN 3QFUA 3FFIA 4A57A 4EHTA 4CCHA 4I7FA 3S41A 4CGHA 3SK3A 2OANA 4BDZA 2P9UA 4BRLA 4I6MA 2E2OA 2HW3A 4DR4K 5FDLA 1OH8A 4OLBA 3O4QA 4EFHA 4OO1J 1MDUB 2OPRA 3MDQA 3UE5A 3O1BA 4E7KA 4DV1K 2P5OA 1DTQA 2ZWHA 3TWHA 1UWBA 3QBXA 4ISGA 2A5XA 1X9MA 2VGNA 1GLLO 2HHXA 3MN6A 2DTUA 1XMQK 2YV0X 5LL6Z 3TSUA 1E4GT 2ASPA 2NNWA 4AHVA 2RKIA 3GOIA 4X65K 4CECA 5AQGA 2YJFA 3QEIA 4FZZA 1T3VA 4CJ7A 1JCGA 2HHTA 2IVPA 3K2PA 3NF8A 1YF5L 2KHOA 3AA2A 3HT3A 4B9UA 1TKDA 5AZJB 1N8RO 2Q36A 2DFFA 2E1YA 4BROA 1HNXK 5F0XA 3HL8A 1BGXT 2GV9A 5I9EB 2NRZA 3ZCMA 3AVBA 2IIRA 2ZJQL 2DFEA 4DUZK 5J2QA 2B5JA 3LALA 3AV9A 2GWJA 4H03B 1N33K 3F9MA 1ASUA 1UA1A 1NOZA 1TAUA 1WB9A 3J81O 4K42A 3CM6A 4M45A 4OKKA 3V1OA 3I8BA 1XUPO 1BQMA 3DLRA 5FROA 3ZSRA 4B08A 3K0SA 1TVRA 4KH6A 1X3MA 3DXKA 2Z1HA 5EOYA 1SKWA 2QWOA 1JLGA 2NRRA 3C6AA 5I42A 5IWAK 3JAMO 4PUOA 3KLEA 2PAVA 4IDKA 1K6YA 4Z4CA 3VF6A 5CR4A 4BGAA 1ZYQA 5GAGP 4JI2K 4CJKA 4EAHD 4MDBA 4CEBA 4F4KA 2Y1JA 1C1BA 5FPEA 3VQ6A 1C0MA 4CEEA 3BZCA 2G8KA 4DLGA 4CGDA 5DM6L 3RTVA 3DWLA 2FC0A 5IT9O 4CF9A 2BH1A 3B6PA 3E66A 3OYNA 4DSJA 1T6CA 3WNGA 1BCMA 1JLBA 4IWVA 5EVZA 4BWMA 1NOYA 4CEFA 4JKBA 4BRHA 3HP9A 1JJ2M 1NGAA 1NKEA 4B8CA 2KW4A 4A2BA 4DTSA 4H4MA 3QMLA 5MLCQ 3ZEUB 5FPDA 3UKUA 4E1MA 1NGHA 3M1FA 5C42A 1OVYA 2D0CA 3DXMB 1CLQA 2XRIA 1VSEA 4JKAA 2ZGZA 3CCEN 4KHYA 1QVFM 4CZFA 2VG6A 5CZ1A 2O4GA 3MX5A 5GIPA 1FKOA 2E2PA 1NBWA 1VRTA 1N6QA 1HYZA 1KLMA 4CEQA 3JXUA 3CCVN 4FLTA 1C0TA 2FBXA 4BRKA 4KI4A 1FJGK 3ZYYX 3CPWM 4LC9B 3TTFA 2IDOA 1KAXA 1HUXA 2WC9A 3W3DA 1RT7A 5AQIA 4KREA 4AM7A 1NJZA 5FRMA 3E01A 2P9SA 5M1NA 4B9TA 4IZ9A 4DV6K 2HMIA 3J7AP 3N4QA 4CESA 1QQMA 4CHZA 4CZJA 1VK0A 4HTLA 4K8ZA 4OLAA 4FLVA 1YIJN 1X1PA 3THVA 1S1TA 4DTPA 3AAPA 3QEWA 5AQTA 1RTHA 4MO5A 3NF9A 3L2RA 4OPJA 1SS6A 1K9MO 3T1HK 3KHYA 1VQNN 4L3QA 4UQGA 3O1WA 2ITMA 4IG0A 1ZBSA 4CW7B 3SZ2A 4N76A 1YTAA 4KV8A 4UY8O 2FBYA 1W9HA 4BQZA 1MU2A 3C6HA 4MFBA 1T05A 4C1NI 4ZTJA 4FJIA 4FM0A 4JS5A 4CZMA 4JI7K 3OVNA 1VSJA 3MX2A 3ID8A 4CK3A 4Z4EA 4M3ZA 3QEXA 1Q86O 1IBKK 4F2RA 3O8MA 2NLXA 3FLCO 1QHAA 1Q18A 3B6OA 1K8KA 3MEDA 4JKCA 1ASVA 4DV4K 3LPUA 2YHBA 2HHUA 3BF1A 1KQSM 1N36K 1JCEA 2QW9A 2EHGA 3CC4N 2VWKA 1IV0A 2QEXN 3KWGA 4WYBA 4BE1A 4BRNA 4CFAA 4GY2B 4MQ3A 2O8EA 4CJFA 1VSMA 3K9KA 1HKGA 4BRMA 1X9SA 4PL7A 1EP4A 3H3OB 3D6RA 5CYMA 4DQRA 3L2QA 4I9QA 4KPYA 1N5YA 3TR8A 3TAEA 1KFDA 1BOTO 4U7BA 5CY4A 3SBGA 3A5MC 3H1VX 3I33A 4KB1A 1ZBIA 1RT2A 3WEEA 3WXKA 2YNHA 3CFRA 5BR8K 5JS2A 4CZIA 3OYDA 4WE1A 2FF3B 3VQ5A 1IKVA 4LSNA 4CEZA 4FVMA 4DU4A 4IFVA 2ITGA 3MWPA 4OPHA 5BPNA 2Q0UA 3E9OA 4BG8A 4LY7A 1TUYA 4DFKA 1KCFA 4BRDA 3DLHA 2BTFA 3RVCA 2G8WA 1HPMA 1BDGA 2XO7A 3CJCA 3RMDA 1O13A 3O9TA 2IOCA 1VQKN 3DMJA 4OGCA 5A2QO 2GBZA 3MCAB 3HSTB 5AQSA 2QWMA 1WSHA 1TK0A 3C95A 3NFAA 5ADXA 1A5WA 1D8YA 3T7ZA 3THWB 4K0KK 3OYMA 2FSKA 3E1YA 4HWIA 3L4IA 4NO7A 1QQCA 2KLAA 4CGGA 3U4LA 3SJJA 1WSIA 3QIOA 3SPYA 4Q0BA 1KVBA 2EWSA 4DTUA 5AQPA 4K43A 4QS9A 2WFBA 5CZ2A 3T1YK 4E3SA 4FJNA 2HBJA 1HR0K 4H0XB 5HROA 2A41A 3VA3A 2P9KB 3TI0A 2XY7A 2OTJN 2LSNA 3LP2A 2F8SA 3GDQA 4XH5A 1U48A 1W7AA 4JKGB 3QB0A 1TKXA 1E4FT 4DV0K 2G8FA 4KAZA 5TKWA 4YOXA 5AR0A 2NRHA 1NWKA 4RW7A 3KLGA 4DF4A 4DG1A 1BO5O 2B4JA 4C8NA 4BC3A 4NB4A 1NGJA 1NGBA 4F8RA 4E7JA 1GLJO 4CK1A 3NVKA 1NGDA 4WQ4A 4LD0A 1XNQK 4CF1A 1YVUA 1BIUA 4W5RA 5SZTA 1BA1A 1XHXA 3DLKA 4HUFA 3L3VA 2XY8A 2GUIA 4FPBA 2GUPA 3LDOA 3VN5A 2ZJPL 3QLHA 3OA9A 3FZFA 4IOAL 4FWSA 4M7YA 3DLBA 3AVAA 2VCPA 3QINA 3J7ZO 4W5OA 1ASWA 2HOEA 3HPHA 2HNYA 1SUQA 3MMVA 1DGKN 1T44A 4CHOA 5JVGL 2O8BA 3ZSXA 3CJ7A 4E89A 3M6GA 4NXNK 1IKXA 2QKBA 4B9NA 4CK2A 4PL8A 3WXMB 3L3UA 3VTIA 2OPSA 5AZIA 3ZT2A 2XY6A 4JV5K 2YNGA 1TGOA 4RW8A 1LOTB 5HLFA 4F2SA 3MK6A 1RT3A 3SAFA 4DTOA 3UIQA 3HVRA 4ISEA 2P9NA 4FWOA 4CGIA 3SNNA 3IDHA 4Y1CA 3CQ8A 4E7IA 3F2KA 3SUPA 1ZBHA 2O4IA 1JLQA 1RBVA 3VERA 4LFCK 4BVPA 1W2BM 2NRXA 4FWKA 2O8DA 3PIPL 4DV7K 3SQ0A 3ZSZA 5C12A 3CCJN 3F73A 2GWKA 4K8XA 2QWPA 4I2PA 1YJNN 2OPQA 2HMPA 3FGUA 5AQZA 1NMNA 3MN9A 4RW9A 4CHYA 4HUEA 4E0DA 2HVHA 4G9ZA 4FOEA 3P1GA 1TL3A 1IG9A 4KTWA 4HCCA 4CJLA 2E4LA 1BUPA 3HYFA 3E9LA 5LMNK 3CF5L 4DR2K 4B9QA 4FZXC 4FJ9A 1ZBUA 2KZZA 3L0QA 3U9DA 3ENHA 3K9JA 4DV2K 3S9HA 1IBMK 5J1EA 4JKEA 4CIEA 3T69A 4AHSA 4OX9K 2HBLA 3AY9A 4WFAL 3AO1A 3RMCA 4FPAA 4JN4A 3ULEB 3KIOA 4JD2A 1GOAA 2NRTA 3V81A 3KD1E 3AO4A 1JXEA 1NGIA 3KWIA 4LH5A 1W0HA 4IDHA 4O5BA 3VESA 3V9WA 4IJAA 3ZT1A 1I3AA 3QICA 1TKTA 1IO2A 3SBTA 3AGKA 1FKPA 3CMAN 4B3OA 4CZHA 1S1XA 3LL3A 2F96A 3PIOL 3PX4A 4EZ6A 4EP5A 1S3XA 3EO3A 1EKEA 4KH5A 1QVGM 4IXCA 2JWLA 4DMNA 3P38A 5TKYA 3D0PA 4YY3K 3DYAA 3AVCA 1NK8A 1Q7YO 1YHQN 3EL2A 4GNIA 4C1NK 2P9PB 3KD5E 1UAXA 3LWMA 3ENOA 3VQAA 5EXWA 2CGKA 3H08A 1A5XA 3MXMA 4FWPA 4CFDA 4CJRA 3KTQA 1SKSA 3HI0A 5AZJA 1NM1A 3OBYA 2A6AA 3AGRA 3H45C 4BR0A 4DLEA 5KI6A 4FK2A 4W5QA 3CG7A 3TABA 2D0OA 5F2RA 3VQ9A 4GVMA 3NHGA 1QSSA 2P9LB 4DUYK 2WONA 4KO0A 1Q82O 1DTTA 3HSCA 4NYFA 1NK0A 4WFNL 5LJWA 5CE3A 1G99A 2QTDA 1JXBA 1YJWN 2DPNA 3W0LA 3VEYA 5ADXH 1Y97A 3WNFA 4KKOA 2UXCK 3HRGA 3EZWA 1HLUA 3TSQA 1WLJA 4M3RA 1RT4A 3KK2A 4DTRA 4ILJA 3OYBA 1KSPA 2AJQA 5GAHP 2W41A 1V4TA 3L2WA 2FF6A 4GVEA 1G15A 3D2FB 4I9LA 3T1AA 4CGFA 4GV3A 3C7NB 2V52B 5AQMA 4CBUA 4EHUA 4AQYK 5FPNA 3G71N 4KTQA 5AQUA 1X9WA 1UOCA 2W6KA 4YOWA 3CC7N 2V7YA 1NKCA 3MN7A 3VOVA 2BDPA 4DV5K 4J2BA 5KQDA 2X78A 2NUBA 2CGLA 4XEIA 2YNIA 3J80O 4NLBA 2V51B 1KLNA 5DK5A 4DR5K 1EO1A 4N5SA 4FJJA 1C6VA 1QSYA 4XH1A 3P39A 5C0YA 4M3XA 3HTVA 1VQ9N 3RMBA 4DS5A 3A8YA 4Z4IA 3RR8A 1JCFA 2HVIA 1RDDA 1RT1A 4DWIA 4IKFA 1RTJA 1C0UA 4FJXA 3KKSA 1KTQA 4FW2A 1HYSA 3SI6A 4JLHA 1YVNA 4FM2A 2F9WA 3WQUA 4U67L 2P9IB 4OKJA 3KKRA 3EN9A 3MN5A 3DXMA 1RNHA 1T7PA 2P1JA 4CF8A 4IEEA 4OPKA 3SCXA 3NGZA 2OA8A 3UB5A 4WQ4C 2BE2A 3MEEA 1J9AA 1D9FA 4F3OA 5C2FA 5HP1A 3RWUA 1I94K 1IJJA 4N56A 4CJQA 4KFBA 3AO5A 4OJRA 1M90O 2RN2A 4EZ9A 1CXQA 5BRDA 1VQ6N 3ZT3A 4QS7A 4DU3A 4FWRA 3THYB 2E8AA 4H0PA 3ZSVA 1OH6A 2JGUA 5AQYA 4O8UA 4BC5A 3QEPA 4CI6A 1TYQB 5CYQA 2FSJA 1U2VB 2P51A 2NZTA 4JI3K 3AO3A 3FFKB 5AQRA 2XY5A 3WT0A 4CJUA 5KQ8A 1SL1A 3TU5A 2E2QA 4HUGA 3G25A 3C6TA 1VQLN 3OYKA 3DOLA 3QERA 4FK4A 4JI0K 3QETA 1HJOA 4Z4GA 3CD6N 5JS1A 4DSIA 2BUPA 4IFEA 3SQ4A 3CFPA 4JHDB 3ZETB 5HBMA 2A1RA 5AFUH 4FJ8A 3BZKA 3OYEA 1CZ9A 4BR2A 5BREA 1SKRA 2RPIA 4LF5K 1REVA 3ATVA 3H3NO 4R5PA 3OW2M 4DTJA 3O5BA 3TPQA 3C0BA 1HNZK 3D2EA 4DF8A 4XIUA 3SYZA 4OGEA 3L6QA 4CHNA 1J5OA 1VSFA 1BISA 1J54A 1NGFA 3ZX2A 2BANA 5AQNA 2QWNA 5HL7L 2HNZA 1TL1A 4E19A 3I8DA 1NJIO 4DQSA 1VQON 4ELVA 1RBRA 5KTQA 4WFBL 4M3WA 5KPRA 4LF7K 5SWMA 4GV9A 5HRSA 1I39A 1YJ9N 1U4BA 1HYVA 4CJTA 4IOXA 3AO2A 4OKEA 3PX0A 3DI6A 2E2NA 4IO8A 1XWLA 4A62A 1RTIA 4CERA 1D4XA 3SQ1A 1Z05A 3ZSQA 3A2FA 4M41A 4JEPA 2GEMA 1LV5A 4BR5A 3CCUN 2E20A 2UUAK 2UUBK 3IRXA 3S3MA 5CHIA 2HHSA 1KRPA 4B1UB 1LW0A 4FLZA 3KJVA 2X74A 2X6NA 2VWBA 1MA9B 2A40A 3FZKA 4FJ5A 4CJPA 4CVNE 3OTOK 4MDAA 3UKRB 1BQNA 3EE9A 2ZE2A 4Z94A 1RILA 2OZMA 3KVGA 4H0TB 1DKGD 2QXFA 4CBXA 2HHHK 3OYCA 1IKYA 3DRPA 3NE6A 1WBBA 2ASOA 4JKHA 4WQ5A 3SJHA 4LFBK 3DJCA 1SZ2A 4DTMA 3M8SA 1Y64A 3VETA 3NDKA 4CJ5A 1C0FA 3RMAA 2ASMA 3LM2A 4FO0A 5LMUK 3V6DA 4BREA 1NU0A 4F9OA 3CCQN 3TAGA 2P9SB 3THWA 3M8QA 5E26A 1QS4A 3NMUA 1SV5A 3JYTA 3PV8A 3OBWA 3CQXA 4JI5K 1VHXA 1YUWA 1Z26A 3AA3A 4BR4A 2OZSA 3AVFA 4Z0UA 2Z1GA 4ISFA 3BEXA 3SV4A 1RCHA 5AQHA 4HCBA 2YCHA 3VQPA 3P5JA 3CIPA 3V4IA 1LWEA 1VQ7N 2UXBK 3ZT0A 3RR7A 4JKGA 2D1KA 3IUCA 3TSPA 2EX3A 4Z4HA 3QFPA 1J53A 1VSLA 4J8FA 3SAHA 1V4SA 3LP0A 1ATSA 2B6AA 4NYNA 2KTQA 2VWJA 4DKWA 1NGEA 4FWLA 1EETA 4ID5A 3L2UA 3I0SA 1XNRK 1BI4B 3O4WA 1S6QA 3EKUA 3O80A 3AAQA 4A5AA 1IBLK 3N4PA 1T6DA 3T3FA 4H4OA 4FJKA 2JLEA 4G1QA 3O4NA 2D0AA 3OYFA 1L3UA 2XHBA 5M1KA 5HRPA 3MXIA 3MCPA 2V7ZA 1YT3A 1ILYA 4JK7A 4M63C 2QKKA 1QQNA 4ID1A 5C2DA 5C24A 4CIGA 3VQQA 1JL1A 1VRUA 1HQUA 3T19A 4RW6A 3SMSA 4BVOA 1RDCA 2OYQA 4M3TA 2WUSA 4WCEL 4AHCA 1MWMA 3PX6A 4IJNA 3NGYA 4MLEA 4YOVA 2A3ZA 1FW6A 3L4QA 5F1XA 2PY5A 1P90A 1KFSA 4DSKA 4DQ8A 3KK1A 2UUCK 3M8PA 4FXDA 5AJ3K 3LAMA 5E41A 3ZSYA 1IKWA 4JNEA 1RT5A 3V9UA 3R6MA 4KI6A 2QXLA 1WSJA 4IFYA 4PQUA 5HRRA 3O3HA 4Z4FA 1S6PA 4E7LA 1XI1A 4KHUA 3I55N 5BRFA 4DR7K 4QCLA 4DFPA 1KC8O 3P83D 4F3TA 2Q97A 4BQLA 1QE1A 5KRTA 5DM7L 5JICA 5DMRA 3HBTA 4HTUA 1QSLA 1U45A 4YFUA 2O8FB 1VQPN 4YOTA 4KTZA 3CI5A 3THXB 4MO4A 3ITHA 3VPZA 4BGBA 4KH4A 5M1PA 5JLHA 1GLEG 5GADP 4BR9A 2HHQA 3MECA 1E3MA 3VMFB 2VG7A 4L8RB 4J2DA 1IG8A 3ZX3A 3AA5X 4A5BA 3BGRA 3D7EO 4N47A 3U3GA 3ULEA 5AQQA 1EWQA 4CBWA 4H5TA 4CEAA 1TUUA 3CYMA 3QNOA 4DSLA 1RFQA 3HK2A 4YNQA 1NMDA 4BACA 3KLIA 4RTFD 4GW6A 1MWKA 1FXXA 2D0BA 3H1QA 1L3VA 4FW1A 1KAYA 4K25A 5BRHA 2GELA 3MEGA 2Z1IA 3OYAA 4FJMA 3SV3A 3CCLN 3K5MA 4KHWA 1LWFA 1OKJA 3EZ5A 4NCGA 3TTDA 3O3GA 2E6LA 1B9DA 3DRSA 3VEXA 4B1VA 5GIOA 1H1VA 5AFUA 4BRGA 2UYTA 4FZYA 3VGKA 4EP4A 3WNHA 3PO4A 2W40A 3CJ9A 1HKBA 5AQWA 4J2EA 1CZBA 3ZSOA 4NCAA 2O8CB 2RE2A 5FLXO 3SUOA 3S3OA 2DFHA 5GAEP 4CHQA 2VGMA 4H5NA 4BG9A 4B3MK 4NLCA 2IS3A 3K5NA 3V9ZA 3AVGA 2X6SA 3NF7A 1WOQA 3RSEA 4H0YB 4CJEA 3VQCA 3NAEA 2ZF5O 4ZHRA 4B3RK 3D45A 4CZKA 1B9FA 3H6EA 3O9UA 3OYLA 3O3FA 3L8BA 1KD1O 3TAMA 4A59A 1SAZA 2P9LA 2WOMA 3CERA 2A1SA 3CXCM 3CETA 1B92A 5GINA 4GKKK 3NF6A 1YAGA 1R0AA 5T7BA 1JKHA 2QWQA 4B1ZA 3LDNA 5BR9A 1YXQA 3LWLA 2JWKA 3HOSA 4BRAA 3VTHA 4M3YA 5EX5A 3HM8A 1DT9A 3VGMA 1QHTA 4ILHA 1ESVA 2CH6A 3M3ZA 4J2AA 3DLEA 1WBDA 3PSFA 4JRQA 1O1WA 3LAKA 4BY9C 5AQLA 1NK4A 2QWRA 1K8AO 3D2FA 3OJUA 4E1JA 1EWRA 3C7NA 5AQXA 3SMPA 1J6ZA 4FYDA 4WQ5C 5E84A 3V9SA 1LAVA 3M5RA 4CZGA 3K5OA 1S1VA 4YDUA 4AF1A 5FRNA 3VEZA 3PY8A 1VSIA 5JLFA 1TAQA 3G4SN 4K41A 1RGIA 3JS6A 1VQ4N 4JRPA
chains in the Genus database with same CATH topology
1SL1A 1EP4A 4HUGA 1RBTA 5CYMA 1XHZA 4DQRA 4DQPA 3L2QA 3ZT4A 4I9QA 3C6TA 3OS0A 4KPYA 3OYKA 1N5YA 1YTUA 3DOLA 3TR8A 3QERA 1T03A 3TAEA 4FK4A 1KFDA 4H8KA 2PYJA 3BDPA 5CY4A 3QETA 1RBSA 4Z4GA 3NH2A 5JS1A 3VA0A 1L5UA 1C1CA 4KB1A 1LAWA 2G8HA 4DSIA 1S9GA 2YNFA 3S3NA 1ZBIA 3SQ4A 3G0ZA 1RT2A 3CFPA 5J2NA 1SL2A 4IBNA 2G8UA 1LWCA 2YNHA 3CFRA 5HBMA 1U04A 5JS2A 3OYDA 2A1RA 2DY4A 4WE1A 4FJ8A 3VQ5A 3LDSA 4W5TA 3M8RA 4CGJA 1IKVA 4LSNA 4CEZA 3HXMA 3SQ2A 3OYEA 4FVMA 5KGXA 3NBPA 1CZ9A 3L2VA 3LP1A 2RPIA 4DU4A 1X9SA 4IFVA 1SKRA 2ITGA 3VQDA 2F8TA 1REVA 4R5PA 4AILC 5J2PA 4DTJA 4LH4A 3TAFA 4M42A 4LY7A 4C8OA 4DFKA 1KCFA 3DLHA 4DF8A 1RDBA 2G8WA 3C6UA 4XIUA 3SYZA 4OGEA 4DSFA 3OYIA 4CHNA 1J5OA 1VSFA 1BISA 1J54A 2XO7A 3RMDA 2BANA 4PY5A 3K59A 1U47A 2IGIA 2IOCA 1U49A 3DMJA 3RRHA 4OGCA 4AHTA 3AVIA 2GBZA 2HNZA 1TL1A 3HSTB 4E19A 3I8DA 1QTMA 1WSHA 4AH9A 4DTNA 3DRRA 1TK0A 4DQSA 4CE9A 3C95A 2IC3A 3NFAA 1TK5A 1A5WA 1VSKA 4ELVA 1D8YA 1HPZA 3HO1A 1RBRA 3OYMA 5KTQA 3V1QA 4C8KA 4M3WA 4CFBA 5SWMA 3EYZA 4FM1A 3OYHA 1WSEA 1ZBFA 4CGGA 1QQCA 1C1AA 1EXQA 1HMVA 4O0JA 3NH1A 5HRNA 3SJJA 1WSIA 3QIOA 5HRSA 1I39A 3SPYA 1U4BA 2KZMA 2Y1IA 4I2QA 1KVBA 4Q0BA 1HYVA 3V1RA 3NCIA 4DTUA 1NK6A 5CZ2A 3DLGA 4CJTA 2FBTA 3AO2A 4KB0A 3TAPA 4E3SA 4FJNA 4OKEA 4HVJA 2YKNA 5HROA 1JL2A 3PX0A 3DI6A 3HJFA 4CEDA 4KHQA 1XWLA 4CERA 1RTIA 3VA3A 2XY7A 3SQ1A 3TI0A 2YKMA 3ZSQA 2LSNA 3A2FA 3LP2A 4M41A 4B9MA 4C8LA 1FK9A 2F8SA 4BWJA 1U48A 3KK3A 1LV5A 3WNEA 2Q3SA 4FK0A 1LW2A 4FJGA 1TKXA 2G8FA 1HJRA 2QK9A 4KAZA 4BE2A 3TARA 3IRXA 4AHRA 4FJLA 1BL3A 3S3MA 1VSDA 4RG8A 2HHSA 1S1UA 4RW7A 4C8MA 3KLGA 4DS4A 1Q8IA 1KRPA 4FJHA 4DF4A 1LW0A 4FLZA 2Z1JA 3KJVA 2X74A 3ASMA 2X6NA 4DG1A 4O4GA 4KHSA 2B4JA 4C8NA 4DFMA 4JS4A 4FJ5A 4N41A 4F8RA 4E7JA 1RBUA 4CK1A 2PZSA 4CJPA 1BQNA 4LD0A 3QNNA 2G8VA 3HPOA 2ZE2A 4CJWA 4CF1A 4BDPA 1YVUA 3OYGA 1RILA 2OZMA 4FJ7A 1WN7A 1HQEA 4IG3A 1BIUA 4W5RA 2QXFA 5SZTA 3VQ8A 1XHXA 3OYCA 1UA0A 3DLKA 4QOZB 1IKYA 4HUFA 3DRPA 3NE6A 4O55A 3L3VA 4CJVA 2XY8A 2GUIA 4QAGA 3C94A 1HRHA 4NCBA 1NK5A 2YHAA 3VN5A 4DQIA 5D3GA 3QLHA 4DTMA 3M8SA 1HNIA 4CEOA 3DLBA 4B9SA 3AVAA 1RT6A 3QINA 3NDKA 4W5OA 4CIFA 4CJ5A 1TK8A 1ASWA 3RMAA 3HPHA 1WSGA 4CFCA 2HNYA 1SUQA 3V6DA 3TAGA 3PUFA 4CHOA 3OS2A 3M8QA 3ZSXA 3RRGA 1QS4A 1A5VA 1SV5A 4E89A 3JYTA 3KLFA 3PV8A 2I5JA 1JLFA 1IKXA 1WSFA 2QKBA 4B9NA 3VQBA 1Z26A 3AA3A 4CK2A 1Q9XA 2OZSA 4OVLA 3JSMA 3L3UA 3AVFA 4M3UA 1D9DA 1NK9A 2OPSA 3AVLA 4Z0UA 3ZT2A 2Z1GA 3HP6A 2XY6A 4ELUA 3AVHA 2R7YA 2YNGA 1TGOA 2HB5A 3FFIA 4RW8A 5EU7A 5HLFA 4F2SA 4CCHA 4I7FA 3SV4A 1NJXA 1RCHA 4CGHA 1RT3A 4HCBA 4DTOA 3VQPA 3UIQA 1VSHA 3P5JA 3HVRA 4BDZA 3V4IA 3IAYA 1LWEA 3ZT0A 2HW3A 3RR7A 3KLHA 5FDLA 3LZIA 3LPTA 1JLEA 2EX3A 4OLBA 4CGIA 3SNNA 3O4QA 4Y1CA 4Z4HA 3CQ8A 1JLAA 1RTDA 4DU1A 4E7IA 2OPRA 1J53A 1VSLA 3SUPA 4KRFA 1ZBHA 2ETJA 4E7KA 3LP0A 2B6AA 4NYNA 1DTQA 2P5OA 2O4IA 1JLQA 2KTQA 3AVMA 1RBVA 2VWJA 1EETA 4ID5A 3L2UA 3I0SA 3ULDA 3TWHA 1UWBA 1X9MA 1BI4B 3SQ0A 3ZSZA 2HHXA 1S6QA 3F9KA 3F73A 2ZD1A 4K8XA 4I2PA 4AHUA 5KRSA 2DTUA 1BHLA 1KVAA 2YV0X 3T3FA 2OPQA 4H4OA 4FJKA 2JLEA 4G1QA 3O4NA 4AHVA 3DOKA 2D0AA 2RKIA 3OYFA 3QEVA 1NKBA 1L3UA 4RW9A 4CECA 4CHYA 2XHBA 4HUEA 2D5RA 4E0DA 3OYJA 5HRPA 3MXIA 2HVHA 1WAJA 3QEIA 4FZZA 1YT3A 3P1GA 1TL3A 2HHTA 3K2PA 3NF8A 4CF2A 3ZSWA 1IG9A 4B9LA 2OPPA 4KTWA 3AA2A 4HCCA 4CJ3A 4CJLA 2QKKA 3HT3A 4ID1A 4B9UA 5C24A 2E4LA 3VQEA 4CIGA 1TKDA 3VQQA 4LSLA 2DFFA 4CJ4A 1JL1A 3TANA 4DTXA 3HYFA 4ICLA 1NJYA 1VRUA 1HQUA 3PO5A 3T19A 4RW6A 4FJ9A 4FZXC 1RDCA 1ZBUA 2KZZA 2OYQA 4PA1A 4DSEA 4Q5VA 4M3TA 1EX4A 3S9HA 5J1EA 2G8IA 3HL8A 4CIEA 1BGXT 4AHSA 4AHCA 2GV9A 3AO1A 3RMCA 2HHWA 3ZCMA 3PX6A 3KIOA 3AVBA 3NGYA 1GOAA 3NH0A 2DFEA 5J2QA 3V81A 2B5JA 4GMJB 3KD1E 3AO4A 1JXEA 1ITGA 1IH7A 3LALA 3AV9A 4LH5A 1W0HA 1ASUA 4O5BA 1UA1A 2PY5A 3V9WA 1NOZA 1Q9YA 3ZT1A 1KFSA 1I3AA 1TAUA 1TKTA 3I0RA 1IO2A 3CM6A 4M45A 4DSKA 4OKKA 3V1OA 3KK1A 1FKPA 3M8PA 4FXDA 1BQMA 3DLRA 5FROA 3ZSRA 4B3OA 3LAMA 5E41A 4B08A 1S1XA 1T8EA 1TVRA 3ZSYA 4CHPA 2F96A 1IKWA 1RT5A 1HNVA 3V9UA 3PX4A 4KI6A 1WSJA 4EZ6A 2Z1HA 4IFYA 1L3SA 1SKWA 4EP5A 5HRRA 4PQUA 1JLGA 5I42A 3O3HA 1EKEA 4Z4FA 1S6PA 4E7LA 1XI1A 4PUOA 4KHUA 4DMNA 4QCLA 3KLEA 1BI4A 4DFPA 3D0PA 4IDKA 1K6YA 3OS1A 1NK8A 3DYAA 3AVCA 3P83D 4Z4CA 4F3TA 3SPZA 3DM2A 1ZYQA 1QE1A 2HNDA 5KRTA 4CJKA 5DMRA 4KHNA 4HTUA 1QSLA 3CFOA 4CEBA 1U45A 4F4KA 4YFUA 1GOCA 2Y1JA 1C1BA 2W42A 4KTZA 3NGIA 1UAXA 3KD5E 3LWMA 3VQAA 3MXJA 3VQ6A 3V9XA 1C0MA 4CEEA 3ITHA 4CF0A 2G8KA 4DLGA 4CGDA 1KVCA 3RTVA 2KQ2A 3H08A 2FC0A 2PYLA 1A5XA 3MXMA 4CFDA 4PWDA 4CF9A 3LZJA 2IAJA 3B6PA 4CJRA 1D5AA 3OYNA 1SKSA 3MECA 3KTQA 2HHQA 4DSJA 4W5NA 3WNGA 1BCMA 2VG7A 1JLBA 2ATQA 4L8RB 4BWMA 4DLEA 4J2DA 1RDAA 5KI6A 4FK2A 4W5QA 1NOYA 2E6MA 3CG7A 3AA5X 4CEFA 3TABA 5I3UA 3HP9A 3VQ9A 4GVMA 3BGRA 1NKEA 4B8CA 2KW4A 4N47A 4E1NA 3NHGA 1L3TA 1QSSA 3U3GA 1NK7A 4DTSA 2HHVA 4O0IA 2WONA 4H4MA 4KO0A 4CEAA 3CYMA 3QNOA 4DSLA 1DTTA 3TAQA 4E1MA 4NYFA 1BCOA 3HK2A 4YNQA 1NK0A 2FBVA 5C42A 3IG1A 4TSXA 3AVJA 1JXBA 2D0CA 3KLIA 3G10A 4BACA 4GW6A 2D0BA 1FXXA 1L3VA 1CLQA 4FW1A 2XRIA 1VSEA 1Y97A 3WNFA 4KKOA 1TV6A 3MEGA 1NJWA 4KHYA 2Z1IA 1WLJA 3OYAA 4FJMA 1S9EA 3SV3A 2VG6A 4M3RA 5CZ1A 1RT4A 3KK2A 2O4GA 5KGWA 1LWFA 1FKOA 1Z25A 3K5MA 4DTRA 4KHWA 3OYBA 3EZ5A 3SUNA 4NCGA 1WAFA 1DLOA 1VRTA 3O3GA 1WNSA 3AA4A 1N6QA 1KSPA 2E6LA 1HYZA 1KLMA 4CEQA 2AJQA 4RW4A 1B9DA 3DRSA 4FLTA 1C0TA 1XC9A 3L2WA 4CGFA 1G15A 2FBXA 4I9LA 3T1AA 3VQ4A 4FZYA 4KI4A 4EP4A 2ZQBA 3WNHA 3PO4A 4KTQA 1X9WA 4BE0A 1UOCA 2IDOA 3HPGA 4J2EA 4DQQA 1NKCA 4J2BA 2BDPA 3CM5A 1CZBA 4ZTFA 3ZSOA 4ELTA 4NCAA 4E7HA 2X78A 3ALYA 1RT7A 4KREA 2NUBA 1NJZA 5FRMA 2P5GA 3E01A 3EY1A 3SUOA 2YNIA 3HVTA 3S3OA 4B9TA 4CJSA 2DFHA 2KFNA 4CHQA 2HMIA 4CESA 1KLNA 2IS3A 4B8AB 4CHZA 1VK0A 3K5NA 3V9ZA 4K8ZA 4OLAA 5DK5A 3AVGA 2X6SA 3QIPA 3NF7A 4FLYA 4N5SA 4FLVA 4FJJA 1C6VA 1X1PA 3THVA 1S1TA 4CJEA 3SUQA 1QSYA 3VQCA 4DTPA 3QEWA 3NAEA 4M3XA 4ZHRA 4BDYA 3LP3A 3RMBA 1S5JA 1CXUA 3D45A 1RTHA 1B9FA 1BIZA 4DS5A 4Z4IA 5J2MA 3NF9A 3RR8A 3OYLA 3L2RA 4FCYA 4B9VA 1RDDA 2HVIA 3O3FA 1RT1A 4OPJA 4DWIA 3L8BA 4IKFA 1RTJA 1C0UA 3K57A 3KKSA 1KTQA 4FJXA 1GOBA 3TAMA 4UQGA 4FW2A 4FLXA 2RF2A 2WOMA 1S1WA 1HYSA 4IG0A 3SI6A 2A1SA 4JLHA 1B92A 5C25A 3SZ2A 4N76A 3NF6A 4FM2A 1YTAA 4KV8A 1R0AA 5T7BA 1JKHA 2FBYA 3AVNA 1W9HA 4OKJA 3KKRA 1MU2A 3LWLA 1RNHA 4MFBA 1T05A 1T7PA 2P1JA 4ZTJA 4FJIA 4CF8A 4FM0A 4OPKA 3SCXA 4M3YA 3NGZA 5K14A 3K5LA 3QO9A 4JS5A 4FLWA 2OA8A 3OVNA 1VSJA 1QHTA 2BE2A 3MEEA 4O44A 4CK3A 4Z4EA 1J9AA 3QEXA 4M3ZA 3K58A 2KFZA 3OJSA 3DLEA 1D9FA 4F2RA 4DFJA 4F3OA 4J2AA 4JRQA 1O1WA 3LAKA 3U3YA 5HP1A 3RWUA 3U6FA 3AVKA 1NK4A 4N56A 3OY9A 4CJQA 4KFBA 1F21A 3B6OA 3AO5A 3MEDA 3OJUA 4OJRA 2RN2A 4EZ9A 1TKZA 4FYDA 1ASVA 1CXQA 3V9SA 1LAVA 3ZT3A 2VG5A 3LPUA 4DU3A 3LANA 2YHBA 3K5OA 2HHUA 1S1VA 2BGGA 3ZSVA 2JGUA 2EHGA 3ISNC 3HM9A 2VWKA 3MAQA 1SL0A 4HHTA 3QEPA 1ZBLA 5FRNA 1JLCA 4FLUA 5CYQA 4Y1DA 4CFAA 3IS9A 4BE1A 4MQ3A 2P51A 1VSIA 3VQ7A 4CJFA 3AO3A 3QESA 3PY8A 1TAQA 2XY5A 1VSMA 4JRPA 4CJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SL1 A;  1EP4 A;  4HUG A;  1RBT A;  5CYM A;  1XHZ A;  4DQR A;  4DQP A;  3L2Q A;  3ZT4 A;  4I9Q A;  3C6T A;  3OS0 A;  4KPY A;  3OYK A;  1N5Y A;  1YTU A;  3DOL A;  3TR8 A;  3QER A;  1T03 A;  3TAE A;  4FK4 A;  1KFD A;  4H8K A;  2PYJ A;  3BDP A;  5CY4 A;  3QET A;  1RBS A;  4Z4G A;  3NH2 A;  5JS1 A;  3VA0 A;  1L5U A;  1C1C A;  4KB1 A;  1LAW A;  2G8H A;  4DSI A;  1S9G A;  2YNF A;  3S3N A;  1ZBI A;  3SQ4 A;  3G0Z A;  1RT2 A;  3CFP A;  5J2N A;  1SL2 A;  4IBN A;  2G8U A;  1LWC A;  2YNH A;  3CFR A;  5HBM A;  1U04 A;  5JS2 A;  3OYD A;  2A1R A;  2DY4 A;  4WE1 A;  4FJ8 A;  3VQ5 A;  3LDS A;  4W5T A;  3M8R A;  4CGJ A;  1IKV A;  4LSN A;  4CEZ A;  3HXM A;  3SQ2 A;  3OYE A;  4FVM A;  5KGX A;  3NBP A;  1CZ9 A;  3L2V A;  3LP1 A;  2RPI A;  4DU4 A;  1X9S A;  4IFV A;  1SKR A;  2ITG A;  3VQD A;  2F8T A;  1REV A;  4R5P A;  4AIL C;  5J2P A;  4DTJ A;  4LH4 A;  3TAF A;  4M42 A;  4LY7 A;  4C8O A;  4DFK A;  1KCF A;  3DLH A;  4DF8 A;  1RDB A;  2G8W A;  3C6U A;  4XIU A;  3SYZ A;  4OGE A;  4DSF A;  3OYI A;  4CHN A;  1J5O A;  1VSF A;  1BIS A;  1J54 A;  2XO7 A;  3RMD A;  2BAN A;  4PY5 A;  3K59 A;  1U47 A;  2IGI A;  2IOC A;  1U49 A;  3DMJ A;  3RRH A;  4OGC A;  4AHT A;  3AVI A;  2GBZ A;  2HNZ A;  1TL1 A;  3HST B;  4E19 A;  3I8D A;  1QTM A;  1WSH A;  4AH9 A;  4DTN A;  3DRR A;  1TK0 A;  4DQS A;  4CE9 A;  3C95 A;  2IC3 A;  3NFA A;  1TK5 A;  1A5W A;  1VSK A;  4ELV A;  1D8Y A;  1HPZ A;  3HO1 A;  1RBR A;  3OYM A;  5KTQ A;  3V1Q A;  4C8K A;  4M3W A;  4CFB A;  5SWM A;  3EYZ A;  4FM1 A;  3OYH A;  1WSE A;  1ZBF A;  4CGG A;  1QQC A;  1C1A A;  1EXQ A;  1HMV A;  4O0J A;  3NH1 A;  5HRN A;  3SJJ A;  1WSI A;  3QIO A;  5HRS A;  1I39 A;  3SPY A;  1U4B A;  2KZM A;  2Y1I A;  4I2Q A;  1KVB A;  4Q0B A;  1HYV A;  3V1R A;  3NCI A;  4DTU A;  1NK6 A;  5CZ2 A;  3DLG A;  4CJT A;  2FBT A;  3AO2 A;  4KB0 A;  3TAP A;  4E3S A;  4FJN A;  4OKE A;  4HVJ A;  2YKN A;  5HRO A;  1JL2 A;  3PX0 A;  3DI6 A;  3HJF A;  4CED A;  4KHQ A;  1XWL A;  4CER A;  1RTI A;  3VA3 A;  2XY7 A;  3SQ1 A;  3TI0 A;  2YKM A;  3ZSQ A;  2LSN A;  3A2F A;  3LP2 A;  4M41 A;  4B9M A;  4C8L A;  1FK9 A;  2F8S A;  4BWJ A;  1U48 A;  3KK3 A;  1LV5 A;  3WNE A;  2Q3S A;  4FK0 A;  1LW2 A;  4FJG A;  1TKX A;  2G8F A;  1HJR A;  2QK9 A;  4KAZ A;  4BE2 A;  3TAR A;  3IRX A;  4AHR A;  4FJL A;  1BL3 A;  3S3M A;  1VSD A;  4RG8 A;  2HHS A;  1S1U A;  4RW7 A;  4C8M A;  3KLG A;  4DS4 A;  1Q8I A;  1KRP A;  4FJH A;  4DF4 A;  1LW0 A;  4FLZ A;  2Z1J A;  3KJV A;  2X74 A;  3ASM A;  2X6N A;  4DG1 A;  4O4G A;  4KHS A;  2B4J A;  4C8N A;  4DFM A;  4JS4 A;  4FJ5 A;  4N41 A;  4F8R A;  4E7J A;  1RBU A;  4CK1 A;  2PZS A;  4CJP A;  1BQN A;  4LD0 A;  3QNN A;  2G8V A;  3HPO A;  2ZE2 A;  4CJW A;  4CF1 A;  4BDP A;  1YVU A;  3OYG A;  1RIL A;  2OZM A;  4FJ7 A;  1WN7 A;  1HQE A;  4IG3 A;  1BIU A;  4W5R A;  2QXF A;  5SZT A;  3VQ8 A;  1XHX A;  3OYC A;  1UA0 A;  3DLK A;  4QOZ B;  1IKY A;  4HUF A;  3DRP A;  3NE6 A;  4O55 A;  3L3V A;  4CJV A;  2XY8 A;  2GUI A;  4QAG A;  3C94 A;  1HRH A;  4NCB A;  1NK5 A;  2YHA A;  3VN5 A;  4DQI A;  5D3G A;  3QLH A;  4DTM A;  3M8S A;  1HNI A;  4CEO A;  3DLB A;  4B9S A;  3AVA A;  1RT6 A;  3QIN A;  3NDK A;  4W5O A;  4CIF A;  4CJ5 A;  1TK8 A;  1ASW A;  3RMA A;  3HPH A;  1WSG A;  4CFC A;  2HNY A;  1SUQ A;  3V6D A;  3TAG A;  3PUF A;  4CHO A;  3OS2 A;  3M8Q A;  3ZSX A;  3RRG A;  1QS4 A;  1A5V A;  1SV5 A;  4E89 A;  3JYT A;  3KLF A;  3PV8 A;  2I5J A;  1JLF A;  1IKX A;  1WSF A;  2QKB A;  4B9N A;  3VQB A;  1Z26 A;  3AA3 A;  4CK2 A;  1Q9X A;  2OZS A;  4OVL A;  3JSM A;  3L3U A;  3AVF A;  4M3U A;  1D9D A;  1NK9 A;  2OPS A;  3AVL A;  4Z0U A;  3ZT2 A;  2Z1G A;  3HP6 A;  2XY6 A;  4ELU A;  3AVH A;  2R7Y A;  2YNG A;  1TGO A;  2HB5 A;  3FFI A;  4RW8 A;  5EU7 A;  5HLF A;  4F2S A;  4CCH A;  4I7F A;  3SV4 A;  1NJX A;  1RCH A;  4CGH A;  1RT3 A;  4HCB A;  4DTO A;  3VQP A;  3UIQ A;  1VSH A;  3P5J A;  3HVR A;  4BDZ A;  3V4I A;  3IAY A;  1LWE A;  3ZT0 A;  2HW3 A;  3RR7 A;  3KLH A;  5FDL A;  3LZI A;  3LPT A;  1JLE A;  2EX3 A;  4OLB A;  4CGI A;  3SNN A;  3O4Q A;  4Y1C A;  4Z4H A;  3CQ8 A;  1JLA A;  1RTD A;  4DU1 A;  4E7I A;  2OPR A;  1J53 A;  1VSL A;  3SUP A;  4KRF A;  1ZBH A;  2ETJ A;  4E7K A;  3LP0 A;  2B6A A;  4NYN A;  1DTQ A;  2P5O A;  2O4I A;  1JLQ A;  2KTQ A;  3AVM A;  1RBV A;  2VWJ A;  1EET A;  4ID5 A;  3L2U A;  3I0S A;  3ULD A;  3TWH A;  1UWB A;  1X9M A;  1BI4 B;  3SQ0 A;  3ZSZ A;  2HHX A;  1S6Q A;  3F9K A;  3F73 A;  2ZD1 A;  4K8X A;  4I2P A;  4AHU A;  5KRS A;  2DTU A;  1BHL A;  1KVA A;  2YV0 X;  3T3F A;  2OPQ A;  4H4O A;  4FJK A;  2JLE A;  4G1Q A;  3O4N A;  4AHV A;  3DOK A;  2D0A A;  2RKI A;  3OYF A;  3QEV A;  1NKB A;  1L3U A;  4RW9 A;  4CEC A;  4CHY A;  2XHB A;  4HUE A;  2D5R A;  4E0D A;  3OYJ A;  5HRP A;  3MXI A;  2HVH A;  1WAJ A;  3QEI A;  4FZZ A;  1YT3 A;  3P1G A;  1TL3 A;  2HHT A;  3K2P A;  3NF8 A;  4CF2 A;  3ZSW A;  1IG9 A;  4B9L A;  2OPP A;  4KTW A;  3AA2 A;  4HCC A;  4CJ3 A;  4CJL A;  2QKK A;  3HT3 A;  4ID1 A;  4B9U A;  5C24 A;  2E4L A;  3VQE A;  4CIG A;  1TKD A;  3VQQ A;  4LSL A;  2DFF A;  4CJ4 A;  1JL1 A;  3TAN A;  4DTX A;  3HYF A;  4ICL A;  1NJY A;  1VRU A;  1HQU A;  3PO5 A;  3T19 A;  4RW6 A;  4FJ9 A;  4FZX C;  1RDC A;  1ZBU A;  2KZZ A;  2OYQ A;  4PA1 A;  4DSE A;  4Q5V A;  4M3T A;  1EX4 A;  3S9H A;  5J1E A;  2G8I A;  3HL8 A;  4CIE A;  1BGX T;  4AHS A;  4AHC A;  2GV9 A;  3AO1 A;  3RMC A;  2HHW A;  3ZCM A;  3PX6 A;  3KIO A;  3AVB A;  3NGY A;  1GOA A;  3NH0 A;  2DFE A;  5J2Q A;  3V81 A;  2B5J A;  4GMJ B;  3KD1 E;  3AO4 A;  1JXE A;  1ITG A;  1IH7 A;  3LAL A;  3AV9 A;  4LH5 A;  1W0H A;  1ASU A;  4O5B A;  1UA1 A;  2PY5 A;  3V9W A;  1NOZ A;  1Q9Y A;  3ZT1 A;  1KFS A;  1I3A A;  1TAU A;  1TKT A;  3I0R A;  1IO2 A;  3CM6 A;  4M45 A;  4DSK A;  4OKK A;  3V1O A;  3KK1 A;  1FKP A;  3M8P A;  4FXD A;  1BQM A;  3DLR A;  5FRO A;  3ZSR A;  4B3O A;  3LAM A;  5E41 A;  4B08 A;  1S1X A;  1T8E A;  1TVR A;  3ZSY A;  4CHP A;  2F96 A;  1IKW A;  1RT5 A;  1HNV A;  3V9U A;  3PX4 A;  4KI6 A;  1WSJ A;  4EZ6 A;  2Z1H A;  4IFY A;  1L3S A;  1SKW A;  4EP5 A;  5HRR A;  4PQU A;  1JLG A;  5I42 A;  3O3H A;  1EKE A;  4Z4F A;  1S6P A;  4E7L A;  1XI1 A;  4PUO A;  4KHU A;  4DMN A;  4QCL A;  3KLE A;  1BI4 A;  4DFP A;  3D0P A;  4IDK A;  1K6Y A;  3OS1 A;  1NK8 A;  3DYA A;  3AVC A;  3P83 D;  4Z4C A;  4F3T A;  3SPZ A;  3DM2 A;  1ZYQ A;  1QE1 A;  2HND A;  5KRT A;  4CJK A;  5DMR A;  4KHN A;  4HTU A;  1QSL A;  3CFO A;  4CEB A;  1U45 A;  4F4K A;  4YFU A;  1GOC A;  2Y1J A;  1C1B A;  2W42 A;  4KTZ A;  3NGI A;  1UAX A;  3KD5 E;  3LWM A;  3VQA A;  3MXJ A;  3VQ6 A;  3V9X A;  1C0M A;  4CEE A;  3ITH A;  4CF0 A;  2G8K A;  4DLG A;  4CGD A;  1KVC A;  3RTV A;  2KQ2 A;  3H08 A;  2FC0 A;  2PYL A;  1A5X A;  3MXM A;  4CFD A;  4PWD A;  4CF9 A;  3LZJ A;  2IAJ A;  3B6P A;  4CJR A;  1D5A A;  3OYN A;  1SKS A;  3MEC A;  3KTQ A;  2HHQ A;  4DSJ A;  4W5N A;  3WNG A;  1BCM A;  2VG7 A;  1JLB A;  2ATQ A;  4L8R B;  4BWM A;  4DLE A;  4J2D A;  1RDA A;  5KI6 A;  4FK2 A;  4W5Q A;  1NOY A;  2E6M A;  3CG7 A;  3AA5 X;  4CEF A;  3TAB A;  5I3U A;  3HP9 A;  3VQ9 A;  4GVM A;  3BGR A;  1NKE A;  4B8C A;  2KW4 A;  4N47 A;  4E1N A;  3NHG A;  1L3T A;  1QSS A;  3U3G A;  1NK7 A;  4DTS A;  2HHV A;  4O0I A;  2WON A;  4H4M A;  4KO0 A;  4CEA A;  3CYM A;  3QNO A;  4DSL A;  1DTT A;  3TAQ A;  4E1M A;  4NYF A;  1BCO A;  3HK2 A;  4YNQ A;  1NK0 A;  2FBV A;  5C42 A;  3IG1 A;  4TSX A;  3AVJ A;  1JXB A;  2D0C A;  3KLI A;  3G10 A;  4BAC A;  4GW6 A;  2D0B A;  1FXX A;  1L3V A;  1CLQ A;  4FW1 A;  2XRI A;  1VSE A;  1Y97 A;  3WNF A;  4KKO A;  1TV6 A;  3MEG A;  1NJW A;  4KHY A;  2Z1I A;  1WLJ A;  3OYA A;  4FJM A;  1S9E A;  3SV3 A;  2VG6 A;  4M3R A;  5CZ1 A;  1RT4 A;  3KK2 A;  2O4G A;  5KGW A;  1LWF A;  1FKO A;  1Z25 A;  3K5M A;  4DTR A;  4KHW A;  3OYB A;  3EZ5 A;  3SUN A;  4NCG A;  1WAF A;  1DLO A;  1VRT A;  3O3G A;  1WNS A;  3AA4 A;  1N6Q A;  1KSP A;  2E6L A;  1HYZ A;  1KLM A;  4CEQ A;  2AJQ A;  4RW4 A;  1B9D A;  3DRS A;  4FLT A;  1C0T A;  1XC9 A;  3L2W A;  4CGF A;  1G15 A;  2FBX A;  4I9L A;  3T1A A;  3VQ4 A;  4FZY A;  4KI4 A;  4EP4 A;  2ZQB A;  3WNH A;  3PO4 A;  4KTQ A;  1X9W A;  4BE0 A;  1UOC A;  2IDO A;  3HPG A;  4J2E A;  4DQQ A;  1NKC A;  4J2B A;  2BDP A;  3CM5 A;  1CZB A;  4ZTF A;  3ZSO A;  4ELT A;  4NCA A;  4E7H A;  2X78 A;  3ALY A;  1RT7 A;  4KRE A;  2NUB A;  1NJZ A;  5FRM A;  2P5G A;  3E01 A;  3EY1 A;  3SUO A;  2YNI A;  3HVT A;  3S3O A;  4B9T A;  4CJS A;  2DFH A;  2KFN A;  4CHQ A;  2HMI A;  4CES A;  1KLN A;  2IS3 A;  4B8A B;  4CHZ A;  1VK0 A;  3K5N A;  3V9Z A;  4K8Z A;  4OLA A;  5DK5 A;  3AVG A;  2X6S A;  3QIP A;  3NF7 A;  4FLY A;  4N5S A;  4FLV A;  4FJJ A;  1C6V A;  1X1P A;  3THV A;  1S1T A;  4CJE A;  3SUQ A;  1QSY A;  3VQC A;  4DTP A;  3QEW A;  3NAE A;  4M3X A;  4ZHR A;  4BDY A;  3LP3 A;  3RMB A;  1S5J A;  1CXU A;  3D45 A;  1RTH A;  1B9F A;  1BIZ A;  4DS5 A;  4Z4I A;  5J2M A;  3NF9 A;  3RR8 A;  3OYL A;  3L2R A;  4FCY A;  4B9V A;  1RDD A;  2HVI A;  3O3F A;  1RT1 A;  4OPJ A;  4DWI A;  3L8B A;  4IKF A;  1RTJ A;  1C0U A;  3K57 A;  3KKS A;  1KTQ A;  4FJX A;  1GOB A;  3TAM A;  4UQG A;  4FW2 A;  4FLX A;  2RF2 A;  2WOM A;  1S1W A;  1HYS A;  4IG0 A;  3SI6 A;  2A1S A;  4JLH A;  1B92 A;  5C25 A;  3SZ2 A;  4N76 A;  3NF6 A;  4FM2 A;  1YTA A;  4KV8 A;  1R0A A;  5T7B A;  1JKH A;  2FBY A;  3AVN A;  1W9H A;  4OKJ A;  3KKR A;  1MU2 A;  3LWL A;  1RNH A;  4MFB A;  1T05 A;  1T7P A;  2P1J A;  4ZTJ A;  4FJI A;  4CF8 A;  4FM0 A;  4OPK A;  3SCX A;  4M3Y A;  3NGZ A;  5K14 A;  3K5L A;  3QO9 A;  4JS5 A;  4FLW A;  2OA8 A;  3OVN A;  1VSJ A;  1QHT A;  2BE2 A;  3MEE A;  4O44 A;  4CK3 A;  4Z4E A;  1J9A A;  3QEX A;  4M3Z A;  3K58 A;  2KFZ A;  3OJS A;  3DLE A;  1D9F A;  4F2R A;  4DFJ A;  4F3O A;  4J2A A;  4JRQ A;  1O1W A;  3LAK A;  3U3Y A;  5HP1 A;  3RWU A;  3U6F A;  3AVK A;  1NK4 A;  4N56 A;  3OY9 A;  4CJQ A;  4KFB A;  1F21 A;  3B6O A;  3AO5 A;  3MED A;  3OJU A;  4OJR A;  2RN2 A;  4EZ9 A;  1TKZ A;  4FYD A;  1ASV A;  1CXQ A;  3V9S A;  1LAV A;  3ZT3 A;  2VG5 A;  3LPU A;  4DU3 A;  3LAN A;  2YHB A;  3K5O A;  2HHU A;  1S1V A;  2BGG A;  3ZSV A;  2JGU A;  2EHG A;  3ISN C;  3HM9 A;  2VWK A;  3MAQ A;  1SL0 A;  4HHT A;  3QEP A;  1ZBL A;  5FRN A;  1JLC A;  4FLU A;  5CYQ A;  4Y1D A;  4CFA A;  3IS9 A;  4BE1 A;  4MQ3 A;  2P51 A;  1VSI A;  3VQ7 A;  4CJF A;  3AO3 A;  3QES A;  3PY8 A;  1TAQ A;  2XY5 A;  1VSM A;  4JRP A;  4CJU A; 
#chains in the Genus database with same CATH topology
 1OVQ A;  4JK8 A;  4ILG B;  5BN8 A;  2E1Z A;  3F5T A;  4DQP A;  3ZT4 A;  1YTU A;  1T03 A;  2H3G X;  4H8K A;  3BDP A;  1RBS A;  3NH2 A;  3VA0 A;  2ZJR L;  3S3N A;  5BN9 A;  2UU9 K;  3G0Z A;  1HNW K;  2G8U A;  1LWC A;  1U04 A;  3LDS A;  4AM6 A;  1RDU A;  3FR0 A;  3NBP A;  3L2V A;  2WTU A;  3LP1 A;  2P9I A;  2F8T A;  3I56 N;  4LF8 K;  4AIL C;  5J2P A;  4LH4 A;  3TAF A;  3ZX0 A;  4M42 A;  4C8O A;  3PLA A;  1RDB A;  3C6U A;  3GE1 A;  2I7N A;  4PKI A;  1GLC G;  1NG9 A;  1RDW X;  4CD3 A;  1U47 A;  2IGI A;  1OH5 A;  4AHT A;  5JVH L;  4AH9 A;  4DTN A;  1WUA A;  4CE9 A;  1KXP A;  3GBT A;  1VSK A;  1HPZ A;  3HO1 A;  4R79 A;  4C8K A;  4CFB A;  4PHT X;  4FM1 A;  3OYH A;  1ZBF A;  3CQY A;  3THY A;  1C1A A;  4O0J A;  1HMV A;  5BPM A;  5HRN A;  4FOI A;  2Y1I A;  3NCI A;  1NK6 A;  4LFA K;  3DLG A;  2FBT A;  1TYQ A;  4KB0 A;  3TAP A;  1U2V A;  5FPM A;  2HBK A;  4HVJ A;  2YKN A;  3HJF A;  4JKF A;  4B9M A;  1GLB G;  2P9U B;  4I6M B;  3P4I A;  2A42 A;  1LW2 A;  4FJG A;  2AA4 A;  3ZEU A;  2QK9 A;  3LDP A;  4AHR A;  4FJL A;  4RG8 A;  1S1U A;  4C8M A;  4DS4 A;  4FJH A;  1Q8I A;  1ATR A;  2Z1J A;  3ASM A;  3O08 A;  3GL1 A;  4O4G A;  4JHD A;  3ZET A;  4DFM A;  3LDL A;  4N41 A;  3VF4 A;  2PZS A;  3OHR A;  4H5R A;  1XC3 A;  2G8V A;  4B1Y B;  4C23 A;  3BUZ B;  5B8H A;  3OYG A;  4FJ7 A;  1WN7 A;  4IG3 A;  3BP8 A;  1XMO K;  2NRV A;  3Q7B A;  2YJE A;  5LY3 A;  1XQS C;  4CJV A;  3EE8 A;  4QAG A;  2OTL N;  4NCB A;  3C94 A;  4DR6 K;  5D3G A;  4FSV A;  4DQI A;  5M1Q A;  4CD1 A;  4QS8 A;  1HNI A;  2J4R A;  4KBO A;  4CEO A;  1BG3 A;  1RT6 A;  4CIF A;  4JYA K;  4JI6 K;  3PUF A;  3OS2 A;  3RRG A;  2GTD A;  1A5V A;  4KHP K;  3KLF A;  5ELZ A;  3U9Z A;  3CHW A;  2HBM A;  3VQB A;  1OH7 A;  4FWQ A;  1Q9X A;  4OVL A;  2WBN A;  4ELU A;  3HP6 A;  3AVH A;  2R7Y A;  2HB5 A;  5EU7 A;  2E88 A;  1NJX A;  4MLH A;  4DV3 K;  1VSH A;  3U8X A;  3IAY A;  4FWN A;  4BRF A;  3KLH A;  3LZI A;  3LPT A;  1JLE A;  1EQY A;  4DHY A;  3FZH A;  1JLA A;  1RTD A;  4DU1 A;  4JAX A;  4KRF A;  3WXL A;  2ETJ A;  3VEO A;  3DXK B;  4WF9 L;  3AVM A;  1QZ6 A;  3ULD A;  3VEV A;  3UKR A;  3F9K A;  2ZD1 A;  5BPL A;  4JI8 K;  4AHU A;  5KRS A;  1BHL A;  2I7P A;  1KVA A;  2PFU A;  3DOK A;  3O6W A;  3QEV A;  1NKB A;  2D5R A;  3OYJ A;  1HKC A;  2UXD K;  1WAJ A;  3DLL L;  4CF2 A;  3ZSW A;  4B9L A;  2OPP A;  4CJ3 A;  2FXU A;  3VQE A;  3O9Q A;  5AQF A;  4LSL A;  4CJ4 A;  3TAN A;  4DTX A;  1NJY A;  4ICL A;  3VF2 A;  3PO5 A;  4PA1 A;  4DSE A;  4Q5V A;  3SLC A;  1EX4 A;  2G8I A;  1ATN A;  2FLO A;  2HHW A;  3GG4 A;  3NH0 A;  4IOC L;  3FZM A;  4GMJ B;  3UKU B;  1ITG A;  1IH7 A;  4JI1 K;  2D0P A;  2Q1N A;  2QWL A;  4YHH K;  1Q9Y A;  1M1K O;  3I0R A;  1NLV A;  1N34 K;  1VQ5 N;  3CPE A;  4RCH A;  2VQF K;  3BF3 A;  3CCM N;  1K73 O;  2VQE K;  5LJV A;  1T8E A;  4YOU A;  4CHP A;  1HNV A;  5HOO A;  1L3S A;  5JMV A;  4GV6 A;  1W97 L;  3WQT A;  3D2E B;  1BI4 A;  3OS1 A;  3SPZ A;  3DM2 A;  5AQO A;  2HND A;  3CC2 N;  3QBW A;  4KHN A;  3BY5 A;  3CFO A;  4Y0W A;  4BC4 A;  1GOC A;  2W42 A;  3ZLJ A;  2Q0R A;  3NGI A;  1QQO A;  3MXJ A;  3V9X A;  4CF0 A;  3LDQ A;  1KVC A;  2KQ2 A;  2PYL A;  4PWD A;  5C10 A;  3LZJ A;  2IAJ A;  3A5N C;  4YDU C;  1D5A A;  3WUH A;  4W5N A;  3A5L C;  4IEI A;  2ATQ A;  2YI1 A;  3R8E A;  1RDA A;  2E6M A;  5I3U A;  3ATU A;  2P9K A;  3J8A A;  2PBD A;  4E1N A;  3NVM A;  3ENB A;  1L3T A;  3CCR N;  1NK7 A;  4DB3 A;  3FE1 A;  2HHV A;  4O0I A;  3IKM A;  2YHX A;  3HZ6 A;  3TAQ A;  1S22 A;  2FSN A;  4X64 K;  4FL9 A;  4CZE A;  1BCO A;  1J5E K;  2D4W A;  2FBV A;  5KPZ A;  3IG1 A;  4YOR A;  1N32 K;  4TSX A;  3AVJ A;  3G10 A;  1BWF O;  3Q7C A;  1TV6 A;  2F9T A;  1NJW A;  4O8K A;  1S9E A;  5KGW A;  1Z25 A;  3SUN A;  1WAF A;  1DLO A;  1WNS A;  3AA4 A;  4O5F A;  1KAZ A;  4RW4 A;  5M1F A;  3FZL A;  1XC9 A;  1Z6R A;  1K8K B;  3VQ4 A;  2ZQB A;  1HX1 A;  5C15 A;  4BE0 A;  2YHW A;  3HPG A;  3KZB A;  4DQQ A;  3CM5 A;  4ZTF A;  4ELT A;  3TTC A;  4E7H A;  3ALY A;  2HST A;  2O8F A;  2P5G A;  4RWT A;  3EY1 A;  3HVT A;  3VEN A;  4B3S K;  3EEQ A;  2O8E B;  4CJS A;  3THX A;  1X9J A;  2KFN A;  3R1X A;  2OCE A;  3AAR A;  4B8A B;  4V19 S;  1NGG A;  4FLY A;  3LM9 A;  3QIP A;  5EY4 A;  4BRQ A;  3SUQ A;  5KPT A;  3J7Y P;  2KKZ A;  4BDY A;  3LP3 A;  1S5J A;  4LF4 K;  1CXU A;  1BIZ A;  5J2M A;  4FCY A;  4B9V A;  3WEE B;  3K57 A;  1GOB A;  4FLX A;  2RF2 A;  1S1W A;  3MWT A;  5C25 A;  3O9R A;  3AVN A;  1GLF O;  3WXI A;  2NRW A;  4PKG A;  3A0I X;  4B1X B;  1C0G A;  4NXM K;  5K14 A;  3K5L A;  3QO9 A;  2HF4 A;  1U6Z A;  4FLW A;  3CJ1 A;  2IVN A;  4O44 A;  1YIT N;  2QI2 A;  2E5L K;  3K58 A;  2KFZ A;  3OJS A;  4DFJ A;  3U3Y A;  3U6F A;  3AVK A;  3OY9 A;  1F21 A;  1CZA N;  4DR3 K;  3VEW A;  1TKZ A;  1NGC A;  4JI4 K;  1ZC6 A;  2VG5 A;  3LAN A;  2BGG A;  4A61 A;  2O8C A;  3ISN C;  3HM9 A;  2F4V K;  3MAQ A;  3ID6 A;  1SL0 A;  4HHT A;  1ZBL A;  1JLC A;  4FLU A;  4H5V A;  4Y1D A;  3IS9 A;  3R3L A;  3VQ7 A;  1SQK A;  3QDK A;  3QES A;  2RHK A;  3DAW A;  3O9S A;  4DCH A;  1RBT A;  1XHZ A;  1X3N A;  3OS0 A;  3A5O C;  2ZM6 K;  2PYJ A;  3B8A X;  1L5U A;  1C1C A;  1LAW A;  3E9P A;  2G8H A;  1S9G A;  2YNF A;  3EKS A;  4H0V B;  2ZGY A;  5J2N A;  1SL2 A;  4IBN A;  2DY4 A;  4M7X A;  2YX6 A;  4W5T A;  3M8R A;  4CGJ A;  3SQ2 A;  3HXM A;  5KGX A;  1BU6 O;  4GKJ K;  3VQD A;  2Q2R A;  4BC2 A;  4A2A A;  4FVU A;  1P8Z A;  2CH5 A;  1GLA G;  4DSF A;  3OYI A;  2QM1 A;  4B3T K;  4PY5 A;  3IFR A;  3K59 A;  2AP1 A;  1U49 A;  3RRH A;  2CGJ A;  3AVI A;  4H5W A;  5M1O A;  3SAG A;  1QTM A;  2P9P A;  3DRR A;  2IC3 A;  1TK5 A;  2O8B B;  1QZ5 A;  3V1Q A;  2HF3 A;  4YOY A;  3EYZ A;  4FWM A;  2F7T A;  1WSE A;  4XH4 A;  1EXQ A;  4JK9 A;  3NH1 A;  2KZM A;  4I2Q A;  1VQ8 N;  2VYP A;  3H46 O;  3V1R A;  4EIA A;  2YHY A;  3R9P A;  3CJA A;  5AZI B;  4PKH A;  4LF6 K;  1YI2 N;  1JL2 A;  4CED A;  4KHQ A;  2YKM A;  3G6E N;  4C8L A;  1FK9 A;  4BWJ A;  4FK0 A;  3KK3 A;  3WNE A;  2Q3S A;  1HJR A;  2P9N B;  4LF9 K;  4BE2 A;  3TAR A;  1BL3 A;  4OPA A;  4BRI A;  4X62 K;  3HOT A;  1VSD A;  3PSI A;  1ZXO A;  5AQJ A;  2Q31 A;  2GX9 A;  5AQK A;  4KHS A;  4H0O A;  4JS4 A;  1BA0 A;  3P31 A;  1RBU A;  4JKD A;  4B1W B;  1LCU A;  1S72 N;  2O8D B;  3QNN A;  3HPO A;  4CJW A;  4BDP A;  1HQE A;  1DEJ A;  5H1S Q;  2W6L A;  3VQ8 A;  1UA0 A;  4QOZ B;  3CCS N;  2QA4 N;  4O55 A;  1GLD G;  1HRH A;  1NK5 A;  2YHA A;  5AQV A;  1R59 O;  4B9S A;  4BRC A;  1VAZ A;  3CJB A;  1TK8 A;  3C65 A;  4X66 K;  1WSG A;  4IO9 L;  4CFC A;  4CZL A;  3IMX A;  1Q81 O;  3KK7 A;  2I5J A;  1JLF A;  1WSF A;  3VGL A;  3CME N;  2IVO A;  4BR7 A;  3JSM A;  4DR1 K;  4M3U A;  1D9D A;  3WXJ A;  1NK9 A;  3AVL A;  1NNE A;  4JD2 B;  3RSE B;  4BRP A;  1VQM N;  3QFU A;  3FFI A;  4A57 A;  4EHT A;  4CCH A;  4I7F A;  3S41 A;  4CGH A;  3SK3 A;  2OAN A;  4BDZ A;  2P9U A;  4BRL A;  4I6M A;  2E2O A;  2HW3 A;  4DR4 K;  5FDL A;  1OH8 A;  4OLB A;  3O4Q A;  4EFH A;  4OO1 J;  1MDU B;  2OPR A;  3MDQ A;  3UE5 A;  3O1B A;  4E7K A;  4DV1 K;  2P5O A;  1DTQ A;  2ZWH A;  3TWH A;  1UWB A;  3QBX A;  4ISG A;  2A5X A;  1X9M A;  2VGN A;  1GLL O;  2HHX A;  3MN6 A;  2DTU A;  1XMQ K;  2YV0 X;  5LL6 Z;  3TSU A;  1E4G T;  2ASP A;  2NNW A;  4AHV A;  2RKI A;  3GOI A;  4X65 K;  4CEC A;  5AQG A;  2YJF A;  3QEI A;  4FZZ A;  1T3V A;  4CJ7 A;  1JCG A;  2HHT A;  2IVP A;  3K2P A;  3NF8 A;  1YF5 L;  2KHO A;  3AA2 A;  3HT3 A;  4B9U A;  1TKD A;  5AZJ B;  1N8R O;  2Q36 A;  2DFF A;  2E1Y A;  4BRO A;  1HNX K;  5F0X A;  3HL8 A;  1BGX T;  2GV9 A;  5I9E B;  2NRZ A;  3ZCM A;  3AVB A;  2IIR A;  2ZJQ L;  2DFE A;  4DUZ K;  5J2Q A;  2B5J A;  3LAL A;  3AV9 A;  2GWJ A;  4H03 B;  1N33 K;  3F9M A;  1ASU A;  1UA1 A;  1NOZ A;  1TAU A;  1WB9 A;  3J81 O;  4K42 A;  3CM6 A;  4M45 A;  4OKK A;  3V1O A;  3I8B A;  1XUP O;  1BQM A;  3DLR A;  5FRO A;  3ZSR A;  4B08 A;  3K0S A;  1TVR A;  4KH6 A;  1X3M A;  3DXK A;  2Z1H A;  5EOY A;  1SKW A;  2QWO A;  1JLG A;  2NRR A;  3C6A A;  5I42 A;  5IWA K;  3JAM O;  4PUO A;  3KLE A;  2PAV A;  4IDK A;  1K6Y A;  4Z4C A;  3VF6 A;  5CR4 A;  4BGA A;  1ZYQ A;  5GAG P;  4JI2 K;  4CJK A;  4EAH D;  4MDB A;  4CEB A;  4F4K A;  2Y1J A;  1C1B A;  5FPE A;  3VQ6 A;  1C0M A;  4CEE A;  3BZC A;  2G8K A;  4DLG A;  4CGD A;  5DM6 L;  3RTV A;  3DWL A;  2FC0 A;  5IT9 O;  4CF9 A;  2BH1 A;  3B6P A;  3E66 A;  3OYN A;  4DSJ A;  1T6C A;  3WNG A;  1BCM A;  1JLB A;  4IWV A;  5EVZ A;  4BWM A;  1NOY A;  4CEF A;  4JKB A;  4BRH A;  3HP9 A;  1JJ2 M;  1NGA A;  1NKE A;  4B8C A;  2KW4 A;  4A2B A;  4DTS A;  4H4M A;  3QML A;  5MLC Q;  3ZEU B;  5FPD A;  3UKU A;  4E1M A;  1NGH A;  3M1F A;  5C42 A;  1OVY A;  2D0C A;  3DXM B;  1CLQ A;  2XRI A;  1VSE A;  4JKA A;  2ZGZ A;  3CCE N;  4KHY A;  1QVF M;  4CZF A;  2VG6 A;  5CZ1 A;  2O4G A;  3MX5 A;  5GIP A;  1FKO A;  2E2P A;  1NBW A;  1VRT A;  1N6Q A;  1HYZ A;  1KLM A;  4CEQ A;  3JXU A;  3CCV N;  4FLT A;  1C0T A;  2FBX A;  4BRK A;  4KI4 A;  1FJG K;  3ZYY X;  3CPW M;  4LC9 B;  3TTF A;  2IDO A;  1KAX A;  1HUX A;  2WC9 A;  3W3D A;  1RT7 A;  5AQI A;  4KRE A;  4AM7 A;  1NJZ A;  5FRM A;  3E01 A;  2P9S A;  5M1N A;  4B9T A;  4IZ9 A;  4DV6 K;  2HMI A;  3J7A P;  3N4Q A;  4CES A;  1QQM A;  4CHZ A;  4CZJ A;  1VK0 A;  4HTL A;  4K8Z A;  4OLA A;  4FLV A;  1YIJ N;  1X1P A;  3THV A;  1S1T A;  4DTP A;  3AAP A;  3QEW A;  5AQT A;  1RTH A;  4MO5 A;  3NF9 A;  3L2R A;  4OPJ A;  1SS6 A;  1K9M O;  3T1H K;  3KHY A;  1VQN N;  4L3Q A;  4UQG A;  3O1W A;  2ITM A;  4IG0 A;  1ZBS A;  4CW7 B;  3SZ2 A;  4N76 A;  1YTA A;  4KV8 A;  4UY8 O;  2FBY A;  1W9H A;  4BQZ A;  1MU2 A;  3C6H A;  4MFB A;  1T05 A;  4C1N I;  4ZTJ A;  4FJI A;  4FM0 A;  4JS5 A;  4CZM A;  4JI7 K;  3OVN A;  1VSJ A;  3MX2 A;  3ID8 A;  4CK3 A;  4Z4E A;  4M3Z A;  3QEX A;  1Q86 O;  1IBK K;  4F2R A;  3O8M A;  2NLX A;  3FLC O;  1QHA A;  1Q18 A;  3B6O A;  1K8K A;  3MED A;  4JKC A;  1ASV A;  4DV4 K;  3LPU A;  2YHB A;  2HHU A;  3BF1 A;  1KQS M;  1N36 K;  1JCE A;  2QW9 A;  2EHG A;  3CC4 N;  2VWK A;  1IV0 A;  2QEX N;  3KWG A;  4WYB A;  4BE1 A;  4BRN A;  4CFA A;  4GY2 B;  4MQ3 A;  2O8E A;  4CJF A;  1VSM A;  3K9K A;  1HKG A;  4BRM A;  1X9S A;  4PL7 A;  1EP4 A;  3H3O B;  3D6R A;  5CYM A;  4DQR A;  3L2Q A;  4I9Q A;  4KPY A;  1N5Y A;  3TR8 A;  3TAE A;  1KFD A;  1BOT O;  4U7B A;  5CY4 A;  3SBG A;  3A5M C;  3H1V X;  3I33 A;  4KB1 A;  1ZBI A;  1RT2 A;  3WEE A;  3WXK A;  2YNH A;  3CFR A;  5BR8 K;  5JS2 A;  4CZI A;  3OYD A;  4WE1 A;  2FF3 B;  3VQ5 A;  1IKV A;  4LSN A;  4CEZ A;  4FVM A;  4DU4 A;  4IFV A;  2ITG A;  3MWP A;  4OPH A;  5BPN A;  2Q0U A;  3E9O A;  4BG8 A;  4LY7 A;  1TUY A;  4DFK A;  1KCF A;  4BRD A;  3DLH A;  2BTF A;  3RVC A;  2G8W A;  1HPM A;  1BDG A;  2XO7 A;  3CJC A;  3RMD A;  1O13 A;  3O9T A;  2IOC A;  1VQK N;  3DMJ A;  4OGC A;  5A2Q O;  2GBZ A;  3MCA B;  3HST B;  5AQS A;  2QWM A;  1WSH A;  1TK0 A;  3C95 A;  3NFA A;  5ADX A;  1A5W A;  1D8Y A;  3T7Z A;  3THW B;  4K0K K;  3OYM A;  2FSK A;  3E1Y A;  4HWI A;  3L4I A;  4NO7 A;  1QQC A;  2KLA A;  4CGG A;  3U4L A;  3SJJ A;  1WSI A;  3QIO A;  3SPY A;  4Q0B A;  1KVB A;  2EWS A;  4DTU A;  5AQP A;  4K43 A;  4QS9 A;  2WFB A;  5CZ2 A;  3T1Y K;  4E3S A;  4FJN A;  2HBJ A;  1HR0 K;  4H0X B;  5HRO A;  2A41 A;  3VA3 A;  2P9K B;  3TI0 A;  2XY7 A;  2OTJ N;  2LSN A;  3LP2 A;  2F8S A;  3GDQ A;  4XH5 A;  1U48 A;  1W7A A;  4JKG B;  3QB0 A;  1TKX A;  1E4F T;  4DV0 K;  2G8F A;  4KAZ A;  5TKW A;  4YOX A;  5AR0 A;  2NRH A;  1NWK A;  4RW7 A;  3KLG A;  4DF4 A;  4DG1 A;  1BO5 O;  2B4J A;  4C8N A;  4BC3 A;  4NB4 A;  1NGJ A;  1NGB A;  4F8R A;  4E7J A;  1GLJ O;  4CK1 A;  3NVK A;  1NGD A;  4WQ4 A;  4LD0 A;  1XNQ K;  4CF1 A;  1YVU A;  1BIU A;  4W5R A;  5SZT A;  1BA1 A;  1XHX A;  3DLK A;  4HUF A;  3L3V A;  2XY8 A;  2GUI A;  4FPB A;  2GUP A;  3LDO A;  3VN5 A;  2ZJP L;  3QLH A;  3OA9 A;  3FZF A;  4IOA L;  4FWS A;  4M7Y A;  3DLB A;  3AVA A;  2VCP A;  3QIN A;  3J7Z O;  4W5O A;  1ASW A;  2HOE A;  3HPH A;  2HNY A;  1SUQ A;  3MMV A;  1DGK N;  1T44 A;  4CHO A;  5JVG L;  2O8B A;  3ZSX A;  3CJ7 A;  4E89 A;  3M6G A;  4NXN K;  1IKX A;  2QKB A;  4B9N A;  4CK2 A;  4PL8 A;  3WXM B;  3L3U A;  3VTI A;  2OPS A;  5AZI A;  3ZT2 A;  2XY6 A;  4JV5 K;  2YNG A;  1TGO A;  4RW8 A;  1LOT B;  5HLF A;  4F2S A;  3MK6 A;  1RT3 A;  3SAF A;  4DTO A;  3UIQ A;  3HVR A;  4ISE A;  2P9N A;  4FWO A;  4CGI A;  3SNN A;  3IDH A;  4Y1C A;  3CQ8 A;  4E7I A;  3F2K A;  3SUP A;  1ZBH A;  2O4I A;  1JLQ A;  1RBV A;  3VER A;  4LFC K;  4BVP A;  1W2B M;  2NRX A;  4FWK A;  2O8D A;  3PIP L;  4DV7 K;  3SQ0 A;  3ZSZ A;  5C12 A;  3CCJ N;  3F73 A;  2GWK A;  4K8X A;  2QWP A;  4I2P A;  1YJN N;  2OPQ A;  2HMP A;  3FGU A;  5AQZ A;  1NMN A;  3MN9 A;  4RW9 A;  4CHY A;  4HUE A;  4E0D A;  2HVH A;  4G9Z A;  4FOE A;  3P1G A;  1TL3 A;  1IG9 A;  4KTW A;  4HCC A;  4CJL A;  2E4L A;  1BUP A;  3HYF A;  3E9L A;  5LMN K;  3CF5 L;  4DR2 K;  4B9Q A;  4FZX C;  4FJ9 A;  1ZBU A;  2KZZ A;  3L0Q A;  3U9D A;  3ENH A;  3K9J A;  4DV2 K;  3S9H A;  1IBM K;  5J1E A;  4JKE A;  4CIE A;  3T69 A;  4AHS A;  4OX9 K;  2HBL A;  3AY9 A;  4WFA L;  3AO1 A;  3RMC A;  4FPA A;  4JN4 A;  3ULE B;  3KIO A;  4JD2 A;  1GOA A;  2NRT A;  3V81 A;  3KD1 E;  3AO4 A;  1JXE A;  1NGI A;  3KWI A;  4LH5 A;  1W0H A;  4IDH A;  4O5B A;  3VES A;  3V9W A;  4IJA A;  3ZT1 A;  1I3A A;  3QIC A;  1TKT A;  1IO2 A;  3SBT A;  3AGK A;  1FKP A;  3CMA N;  4B3O A;  4CZH A;  1S1X A;  3LL3 A;  2F96 A;  3PIO L;  3PX4 A;  4EZ6 A;  4EP5 A;  1S3X A;  3EO3 A;  1EKE A;  4KH5 A;  1QVG M;  4IXC A;  2JWL A;  4DMN A;  3P38 A;  5TKY A;  3D0P A;  4YY3 K;  3DYA A;  3AVC A;  1NK8 A;  1Q7Y O;  1YHQ N;  3EL2 A;  4GNI A;  4C1N K;  2P9P B;  3KD5 E;  1UAX A;  3LWM A;  3ENO A;  3VQA A;  5EXW A;  2CGK A;  3H08 A;  1A5X A;  3MXM A;  4FWP A;  4CFD A;  4CJR A;  3KTQ A;  1SKS A;  3HI0 A;  5AZJ A;  1NM1 A;  3OBY A;  2A6A A;  3AGR A;  3H45 C;  4BR0 A;  4DLE A;  5KI6 A;  4FK2 A;  4W5Q A;  3CG7 A;  3TAB A;  2D0O A;  5F2R A;  3VQ9 A;  4GVM A;  3NHG A;  1QSS A;  2P9L B;  4DUY K;  2WON A;  4KO0 A;  1Q82 O;  1DTT A;  3HSC A;  4NYF A;  1NK0 A;  4WFN L;  5LJW A;  5CE3 A;  1G99 A;  2QTD A;  1JXB A;  1YJW N;  2DPN A;  3W0L A;  3VEY A;  5ADX H;  1Y97 A;  3WNF A;  4KKO A;  2UXC K;  3HRG A;  3EZW A;  1HLU A;  3TSQ A;  1WLJ A;  4M3R A;  1RT4 A;  3KK2 A;  4DTR A;  4ILJ A;  3OYB A;  1KSP A;  2AJQ A;  5GAH P;  2W41 A;  1V4T A;  3L2W A;  2FF6 A;  4GVE A;  1G15 A;  3D2F B;  4I9L A;  3T1A A;  4CGF A;  4GV3 A;  3C7N B;  2V52 B;  5AQM A;  4CBU A;  4EHU A;  4AQY K;  5FPN A;  3G71 N;  4KTQ A;  5AQU A;  1X9W A;  1UOC A;  2W6K A;  4YOW A;  3CC7 N;  2V7Y A;  1NKC A;  3MN7 A;  3VOV A;  2BDP A;  4DV5 K;  4J2B A;  5KQD A;  2X78 A;  2NUB A;  2CGL A;  4XEI A;  2YNI A;  3J80 O;  4NLB A;  2V51 B;  1KLN A;  5DK5 A;  4DR5 K;  1EO1 A;  4N5S A;  4FJJ A;  1C6V A;  1QSY A;  4XH1 A;  3P39 A;  5C0Y A;  4M3X A;  3HTV A;  1VQ9 N;  3RMB A;  4DS5 A;  3A8Y A;  4Z4I A;  3RR8 A;  1JCF A;  2HVI A;  1RDD A;  1RT1 A;  4DWI A;  4IKF A;  1RTJ A;  1C0U A;  4FJX A;  3KKS A;  1KTQ A;  4FW2 A;  1HYS A;  3SI6 A;  4JLH A;  1YVN A;  4FM2 A;  2F9W A;  3WQU A;  4U67 L;  2P9I B;  4OKJ A;  3KKR A;  3EN9 A;  3MN5 A;  3DXM A;  1RNH A;  1T7P A;  2P1J A;  4CF8 A;  4IEE A;  4OPK A;  3SCX A;  3NGZ A;  2OA8 A;  3UB5 A;  4WQ4 C;  2BE2 A;  3MEE A;  1J9A A;  1D9F A;  4F3O A;  5C2F A;  5HP1 A;  3RWU A;  1I94 K;  1IJJ A;  4N56 A;  4CJQ A;  4KFB A;  3AO5 A;  4OJR A;  1M90 O;  2RN2 A;  4EZ9 A;  1CXQ A;  5BRD A;  1VQ6 N;  3ZT3 A;  4QS7 A;  4DU3 A;  4FWR A;  3THY B;  2E8A A;  4H0P A;  3ZSV A;  1OH6 A;  2JGU A;  5AQY A;  4O8U A;  4BC5 A;  3QEP A;  4CI6 A;  1TYQ B;  5CYQ A;  2FSJ A;  1U2V B;  2P51 A;  2NZT A;  4JI3 K;  3AO3 A;  3FFK B;  5AQR A;  2XY5 A;  3WT0 A;  4CJU A;  5KQ8 A;  1SL1 A;  3TU5 A;  2E2Q A;  4HUG A;  3G25 A;  3C6T A;  1VQL N;  3OYK A;  3DOL A;  3QER A;  4FK4 A;  4JI0 K;  3QET A;  1HJO A;  4Z4G A;  3CD6 N;  5JS1 A;  4DSI A;  2BUP A;  4IFE A;  3SQ4 A;  3CFP A;  4JHD B;  3ZET B;  5HBM A;  2A1R A;  5AFU H;  4FJ8 A;  3BZK A;  3OYE A;  1CZ9 A;  4BR2 A;  5BRE A;  1SKR A;  2RPI A;  4LF5 K;  1REV A;  3ATV A;  3H3N O;  4R5P A;  3OW2 M;  4DTJ A;  3O5B A;  3TPQ A;  3C0B A;  1HNZ K;  3D2E A;  4DF8 A;  4XIU A;  3SYZ A;  4OGE A;  3L6Q A;  4CHN A;  1J5O A;  1VSF A;  1BIS A;  1J54 A;  1NGF A;  3ZX2 A;  2BAN A;  5AQN A;  2QWN A;  5HL7 L;  2HNZ A;  1TL1 A;  4E19 A;  3I8D A;  1NJI O;  4DQS A;  1VQO N;  4ELV A;  1RBR A;  5KTQ A;  4WFB L;  4M3W A;  5KPR A;  4LF7 K;  5SWM A;  4GV9 A;  5HRS A;  1I39 A;  1YJ9 N;  1U4B A;  1HYV A;  4CJT A;  4IOX A;  3AO2 A;  4OKE A;  3PX0 A;  3DI6 A;  2E2N A;  4IO8 A;  1XWL A;  4A62 A;  1RTI A;  4CER A;  1D4X A;  3SQ1 A;  1Z05 A;  3ZSQ A;  3A2F A;  4M41 A;  4JEP A;  2GEM A;  1LV5 A;  4BR5 A;  3CCU N;  2E20 A;  2UUA K;  2UUB K;  3IRX A;  3S3M A;  5CHI A;  2HHS A;  1KRP A;  4B1U B;  1LW0 A;  4FLZ A;  3KJV A;  2X74 A;  2X6N A;  2VWB A;  1MA9 B;  2A40 A;  3FZK A;  4FJ5 A;  4CJP A;  4CVN E;  3OTO K;  4MDA A;  3UKR B;  1BQN A;  3EE9 A;  2ZE2 A;  4Z94 A;  1RIL A;  2OZM A;  3KVG A;  4H0T B;  1DKG D;  2QXF A;  4CBX A;  2HHH K;  3OYC A;  1IKY A;  3DRP A;  3NE6 A;  1WBB A;  2ASO A;  4JKH A;  4WQ5 A;  3SJH A;  4LFB K;  3DJC A;  1SZ2 A;  4DTM A;  3M8S A;  1Y64 A;  3VET A;  3NDK A;  4CJ5 A;  1C0F A;  3RMA A;  2ASM A;  3LM2 A;  4FO0 A;  5LMU K;  3V6D A;  4BRE A;  1NU0 A;  4F9O A;  3CCQ N;  3TAG A;  2P9S B;  3THW A;  3M8Q A;  5E26 A;  1QS4 A;  3NMU A;  1SV5 A;  3JYT A;  3PV8 A;  3OBW A;  3CQX A;  4JI5 K;  1VHX A;  1YUW A;  1Z26 A;  3AA3 A;  4BR4 A;  2OZS A;  3AVF A;  4Z0U A;  2Z1G A;  4ISF A;  3BEX A;  3SV4 A;  1RCH A;  5AQH A;  4HCB A;  2YCH A;  3VQP A;  3P5J A;  3CIP A;  3V4I A;  1LWE A;  1VQ7 N;  2UXB K;  3ZT0 A;  3RR7 A;  4JKG A;  2D1K A;  3IUC A;  3TSP A;  2EX3 A;  4Z4H A;  3QFP A;  1J53 A;  1VSL A;  4J8F A;  3SAH A;  1V4S A;  3LP0 A;  1ATS A;  2B6A A;  4NYN A;  2KTQ A;  2VWJ A;  4DKW A;  1NGE A;  4FWL A;  1EET A;  4ID5 A;  3L2U A;  3I0S A;  1XNR K;  1BI4 B;  3O4W A;  1S6Q A;  3EKU A;  3O80 A;  3AAQ A;  4A5A A;  1IBL K;  3N4P A;  1T6D A;  3T3F A;  4H4O A;  4FJK A;  2JLE A;  4G1Q A;  3O4N A;  2D0A A;  3OYF A;  1L3U A;  2XHB A;  5M1K A;  5HRP A;  3MXI A;  3MCP A;  2V7Z A;  1YT3 A;  1ILY A;  4JK7 A;  4M63 C;  2QKK A;  1QQN A;  4ID1 A;  5C2D A;  5C24 A;  4CIG A;  3VQQ A;  1JL1 A;  1VRU A;  1HQU A;  3T19 A;  4RW6 A;  3SMS A;  4BVO A;  1RDC A;  2OYQ A;  4M3T A;  2WUS A;  4WCE L;  4AHC A;  1MWM A;  3PX6 A;  4IJN A;  3NGY A;  4MLE A;  4YOV A;  2A3Z A;  1FW6 A;  3L4Q A;  5F1X A;  2PY5 A;  1P90 A;  1KFS A;  4DSK A;  4DQ8 A;  3KK1 A;  2UUC K;  3M8P A;  4FXD A;  5AJ3 K;  3LAM A;  5E41 A;  3ZSY A;  1IKW A;  4JNE A;  1RT5 A;  3V9U A;  3R6M A;  4KI6 A;  2QXL A;  1WSJ A;  4IFY A;  4PQU A;  5HRR A;  3O3H A;  4Z4F A;  1S6P A;  4E7L A;  1XI1 A;  4KHU A;  3I55 N;  5BRF A;  4DR7 K;  4QCL A;  4DFP A;  1KC8 O;  3P83 D;  4F3T A;  2Q97 A;  4BQL A;  1QE1 A;  5KRT A;  5DM7 L;  5JIC A;  5DMR A;  3HBT A;  4HTU A;  1QSL A;  1U45 A;  4YFU A;  2O8F B;  1VQP N;  4YOT A;  4KTZ A;  3CI5 A;  3THX B;  4MO4 A;  3ITH A;  3VPZ A;  4BGB A;  4KH4 A;  5M1P A;  5JLH A;  1GLE G;  5GAD P;  4BR9 A;  2HHQ A;  3MEC A;  1E3M A;  3VMF B;  2VG7 A;  4L8R B;  4J2D A;  1IG8 A;  3ZX3 A;  3AA5 X;  4A5B A;  3BGR A;  3D7E O;  4N47 A;  3U3G A;  3ULE A;  5AQQ A;  1EWQ A;  4CBW A;  4H5T A;  4CEA A;  1TUU A;  3CYM A;  3QNO A;  4DSL A;  1RFQ A;  3HK2 A;  4YNQ A;  1NMD A;  4BAC A;  3KLI A;  4RTF D;  4GW6 A;  1MWK A;  1FXX A;  2D0B A;  3H1Q A;  1L3V A;  4FW1 A;  1KAY A;  4K25 A;  5BRH A;  2GEL A;  3MEG A;  2Z1I A;  3OYA A;  4FJM A;  3SV3 A;  3CCL N;  3K5M A;  4KHW A;  1LWF A;  1OKJ A;  3EZ5 A;  4NCG A;  3TTD A;  3O3G A;  2E6L A;  1B9D A;  3DRS A;  3VEX A;  4B1V A;  5GIO A;  1H1V A;  5AFU A;  4BRG A;  2UYT A;  4FZY A;  3VGK A;  4EP4 A;  3WNH A;  3PO4 A;  2W40 A;  3CJ9 A;  1HKB A;  5AQW A;  4J2E A;  1CZB A;  3ZSO A;  4NCA A;  2O8C B;  2RE2 A;  5FLX O;  3SUO A;  3S3O A;  2DFH A;  5GAE P;  4CHQ A;  2VGM A;  4H5N A;  4BG9 A;  4B3M K;  4NLC A;  2IS3 A;  3K5N A;  3V9Z A;  3AVG A;  2X6S A;  3NF7 A;  1WOQ A;  3RSE A;  4H0Y B;  4CJE A;  3VQC A;  3NAE A;  2ZF5 O;  4ZHR A;  4B3R K;  3D45 A;  4CZK A;  1B9F A;  3H6E A;  3O9U A;  3OYL A;  3O3F A;  3L8B A;  1KD1 O;  3TAM A;  4A59 A;  1SAZ A;  2P9L A;  2WOM A;  3CER A;  2A1S A;  3CXC M;  3CET A;  1B92 A;  5GIN A;  4GKK K;  3NF6 A;  1YAG A;  1R0A A;  5T7B A;  1JKH A;  2QWQ A;  4B1Z A;  3LDN A;  5BR9 A;  1YXQ A;  3LWL A;  2JWK A;  3HOS A;  4BRA A;  3VTH A;  4M3Y A;  5EX5 A;  3HM8 A;  1DT9 A;  3VGM A;  1QHT A;  4ILH A;  1ESV A;  2CH6 A;  3M3Z A;  4J2A A;  3DLE A;  1WBD A;  3PSF A;  4JRQ A;  1O1W A;  3LAK A;  4BY9 C;  5AQL A;  1NK4 A;  2QWR A;  1K8A O;  3D2F A;  3OJU A;  4E1J A;  1EWR A;  3C7N A;  5AQX A;  3SMP A;  1J6Z A;  4FYD A;  4WQ5 C;  5E84 A;  3V9S A;  1LAV A;  3M5R A;  4CZG A;  3K5O A;  1S1V A;  4YDU A;  4AF1 A;  5FRN A;  3VEZ A;  3PY8 A;  1VSI A;  5JLF A;  1TAQ A;  3G4S N;  4K41 A;  1RGI A;  3JS6 A;  1VQ4 N;  4JRP A; 
#chains in the Genus database with same CATH homology
 1SL1 A;  1EP4 A;  4HUG A;  1RBT A;  5CYM A;  1XHZ A;  4DQR A;  4DQP A;  3L2Q A;  3ZT4 A;  4I9Q A;  3C6T A;  3OS0 A;  4KPY A;  3OYK A;  1N5Y A;  1YTU A;  3DOL A;  3TR8 A;  3QER A;  1T03 A;  3TAE A;  4FK4 A;  1KFD A;  4H8K A;  2PYJ A;  3BDP A;  5CY4 A;  3QET A;  1RBS A;  4Z4G A;  3NH2 A;  5JS1 A;  3VA0 A;  1L5U A;  1C1C A;  4KB1 A;  1LAW A;  2G8H A;  4DSI A;  1S9G A;  2YNF A;  3S3N A;  1ZBI A;  3SQ4 A;  3G0Z A;  1RT2 A;  3CFP A;  5J2N A;  1SL2 A;  4IBN A;  2G8U A;  1LWC A;  2YNH A;  3CFR A;  5HBM A;  1U04 A;  5JS2 A;  3OYD A;  2A1R A;  2DY4 A;  4WE1 A;  4FJ8 A;  3VQ5 A;  3LDS A;  4W5T A;  3M8R A;  4CGJ A;  1IKV A;  4LSN A;  4CEZ A;  3HXM A;  3SQ2 A;  3OYE A;  4FVM A;  5KGX A;  3NBP A;  1CZ9 A;  3L2V A;  3LP1 A;  2RPI A;  4DU4 A;  1X9S A;  4IFV A;  1SKR A;  2ITG A;  3VQD A;  2F8T A;  1REV A;  4R5P A;  4AIL C;  5J2P A;  4DTJ A;  4LH4 A;  3TAF A;  4M42 A;  4LY7 A;  4C8O A;  4DFK A;  1KCF A;  3DLH A;  4DF8 A;  1RDB A;  2G8W A;  3C6U A;  4XIU A;  3SYZ A;  4OGE A;  4DSF A;  3OYI A;  4CHN A;  1J5O A;  1VSF A;  1BIS A;  1J54 A;  2XO7 A;  3RMD A;  2BAN A;  4PY5 A;  3K59 A;  1U47 A;  2IGI A;  2IOC A;  1U49 A;  3DMJ A;  3RRH A;  4OGC A;  4AHT A;  3AVI A;  2GBZ A;  2HNZ A;  1TL1 A;  3HST B;  4E19 A;  3I8D A;  1QTM A;  1WSH A;  4AH9 A;  4DTN A;  3DRR A;  1TK0 A;  4DQS A;  4CE9 A;  3C95 A;  2IC3 A;  3NFA A;  1TK5 A;  1A5W A;  1VSK A;  4ELV A;  1D8Y A;  1HPZ A;  3HO1 A;  1RBR A;  3OYM A;  5KTQ A;  3V1Q A;  4C8K A;  4M3W A;  4CFB A;  5SWM A;  3EYZ A;  4FM1 A;  3OYH A;  1WSE A;  1ZBF A;  4CGG A;  1QQC A;  1C1A A;  1EXQ A;  1HMV A;  4O0J A;  3NH1 A;  5HRN A;  3SJJ A;  1WSI A;  3QIO A;  5HRS A;  1I39 A;  3SPY A;  1U4B A;  2KZM A;  2Y1I A;  4I2Q A;  1KVB A;  4Q0B A;  1HYV A;  3V1R A;  3NCI A;  4DTU A;  1NK6 A;  5CZ2 A;  3DLG A;  4CJT A;  2FBT A;  3AO2 A;  4KB0 A;  3TAP A;  4E3S A;  4FJN A;  4OKE A;  4HVJ A;  2YKN A;  5HRO A;  1JL2 A;  3PX0 A;  3DI6 A;  3HJF A;  4CED A;  4KHQ A;  1XWL A;  4CER A;  1RTI A;  3VA3 A;  2XY7 A;  3SQ1 A;  3TI0 A;  2YKM A;  3ZSQ A;  2LSN A;  3A2F A;  3LP2 A;  4M41 A;  4B9M A;  4C8L A;  1FK9 A;  2F8S A;  4BWJ A;  1U48 A;  3KK3 A;  1LV5 A;  3WNE A;  2Q3S A;  4FK0 A;  1LW2 A;  4FJG A;  1TKX A;  2G8F A;  1HJR A;  2QK9 A;  4KAZ A;  4BE2 A;  3TAR A;  3IRX A;  4AHR A;  4FJL A;  1BL3 A;  3S3M A;  1VSD A;  4RG8 A;  2HHS A;  1S1U A;  4RW7 A;  4C8M A;  3KLG A;  4DS4 A;  1Q8I A;  1KRP A;  4FJH A;  4DF4 A;  1LW0 A;  4FLZ A;  2Z1J A;  3KJV A;  2X74 A;  3ASM A;  2X6N A;  4DG1 A;  4O4G A;  4KHS A;  2B4J A;  4C8N A;  4DFM A;  4JS4 A;  4FJ5 A;  4N41 A;  4F8R A;  4E7J A;  1RBU A;  4CK1 A;  2PZS A;  4CJP A;  1BQN A;  4LD0 A;  3QNN A;  2G8V A;  3HPO A;  2ZE2 A;  4CJW A;  4CF1 A;  4BDP A;  1YVU A;  3OYG A;  1RIL A;  2OZM A;  4FJ7 A;  1WN7 A;  1HQE A;  4IG3 A;  1BIU A;  4W5R A;  2QXF A;  5SZT A;  3VQ8 A;  1XHX A;  3OYC A;  1UA0 A;  3DLK A;  4QOZ B;  1IKY A;  4HUF A;  3DRP A;  3NE6 A;  4O55 A;  3L3V A;  4CJV A;  2XY8 A;  2GUI A;  4QAG A;  3C94 A;  1HRH A;  4NCB A;  1NK5 A;  2YHA A;  3VN5 A;  4DQI A;  5D3G A;  3QLH A;  4DTM A;  3M8S A;  1HNI A;  4CEO A;  3DLB A;  4B9S A;  3AVA A;  1RT6 A;  3QIN A;  3NDK A;  4W5O A;  4CIF A;  4CJ5 A;  1TK8 A;  1ASW A;  3RMA A;  3HPH A;  1WSG A;  4CFC A;  2HNY A;  1SUQ A;  3V6D A;  3TAG A;  3PUF A;  4CHO A;  3OS2 A;  3M8Q A;  3ZSX A;  3RRG A;  1QS4 A;  1A5V A;  1SV5 A;  4E89 A;  3JYT A;  3KLF A;  3PV8 A;  2I5J A;  1JLF A;  1IKX A;  1WSF A;  2QKB A;  4B9N A;  3VQB A;  1Z26 A;  3AA3 A;  4CK2 A;  1Q9X A;  2OZS A;  4OVL A;  3JSM A;  3L3U A;  3AVF A;  4M3U A;  1D9D A;  1NK9 A;  2OPS A;  3AVL A;  4Z0U A;  3ZT2 A;  2Z1G A;  3HP6 A;  2XY6 A;  4ELU A;  3AVH A;  2R7Y A;  2YNG A;  1TGO A;  2HB5 A;  3FFI A;  4RW8 A;  5EU7 A;  5HLF A;  4F2S A;  4CCH A;  4I7F A;  3SV4 A;  1NJX A;  1RCH A;  4CGH A;  1RT3 A;  4HCB A;  4DTO A;  3VQP A;  3UIQ A;  1VSH A;  3P5J A;  3HVR A;  4BDZ A;  3V4I A;  3IAY A;  1LWE A;  3ZT0 A;  2HW3 A;  3RR7 A;  3KLH A;  5FDL A;  3LZI A;  3LPT A;  1JLE A;  2EX3 A;  4OLB A;  4CGI A;  3SNN A;  3O4Q A;  4Y1C A;  4Z4H A;  3CQ8 A;  1JLA A;  1RTD A;  4DU1 A;  4E7I A;  2OPR A;  1J53 A;  1VSL A;  3SUP A;  4KRF A;  1ZBH A;  2ETJ A;  4E7K A;  3LP0 A;  2B6A A;  4NYN A;  1DTQ A;  2P5O A;  2O4I A;  1JLQ A;  2KTQ A;  3AVM A;  1RBV A;  2VWJ A;  1EET A;  4ID5 A;  3L2U A;  3I0S A;  3ULD A;  3TWH A;  1UWB A;  1X9M A;  1BI4 B;  3SQ0 A;  3ZSZ A;  2HHX A;  1S6Q A;  3F9K A;  3F73 A;  2ZD1 A;  4K8X A;  4I2P A;  4AHU A;  5KRS A;  2DTU A;  1BHL A;  1KVA A;  2YV0 X;  3T3F A;  2OPQ A;  4H4O A;  4FJK A;  2JLE A;  4G1Q A;  3O4N A;  4AHV A;  3DOK A;  2D0A A;  2RKI A;  3OYF A;  3QEV A;  1NKB A;  1L3U A;  4RW9 A;  4CEC A;  4CHY A;  2XHB A;  4HUE A;  2D5R A;  4E0D A;  3OYJ A;  5HRP A;  3MXI A;  2HVH A;  1WAJ A;  3QEI A;  4FZZ A;  1YT3 A;  3P1G A;  1TL3 A;  2HHT A;  3K2P A;  3NF8 A;  4CF2 A;  3ZSW A;  1IG9 A;  4B9L A;  2OPP A;  4KTW A;  3AA2 A;  4HCC A;  4CJ3 A;  4CJL A;  2QKK A;  3HT3 A;  4ID1 A;  4B9U A;  5C24 A;  2E4L A;  3VQE A;  4CIG A;  1TKD A;  3VQQ A;  4LSL A;  2DFF A;  4CJ4 A;  1JL1 A;  3TAN A;  4DTX A;  3HYF A;  4ICL A;  1NJY A;  1VRU A;  1HQU A;  3PO5 A;  3T19 A;  4RW6 A;  4FJ9 A;  4FZX C;  1RDC A;  1ZBU A;  2KZZ A;  2OYQ A;  4PA1 A;  4DSE A;  4Q5V A;  4M3T A;  1EX4 A;  3S9H A;  5J1E A;  2G8I A;  3HL8 A;  4CIE A;  1BGX T;  4AHS A;  4AHC A;  2GV9 A;  3AO1 A;  3RMC A;  2HHW A;  3ZCM A;  3PX6 A;  3KIO A;  3AVB A;  3NGY A;  1GOA A;  3NH0 A;  2DFE A;  5J2Q A;  3V81 A;  2B5J A;  4GMJ B;  3KD1 E;  3AO4 A;  1JXE A;  1ITG A;  1IH7 A;  3LAL A;  3AV9 A;  4LH5 A;  1W0H A;  1ASU A;  4O5B A;  1UA1 A;  2PY5 A;  3V9W A;  1NOZ A;  1Q9Y A;  3ZT1 A;  1KFS A;  1I3A A;  1TAU A;  1TKT A;  3I0R A;  1IO2 A;  3CM6 A;  4M45 A;  4DSK A;  4OKK A;  3V1O A;  3KK1 A;  1FKP A;  3M8P A;  4FXD A;  1BQM A;  3DLR A;  5FRO A;  3ZSR A;  4B3O A;  3LAM A;  5E41 A;  4B08 A;  1S1X A;  1T8E A;  1TVR A;  3ZSY A;  4CHP A;  2F96 A;  1IKW A;  1RT5 A;  1HNV A;  3V9U A;  3PX4 A;  4KI6 A;  1WSJ A;  4EZ6 A;  2Z1H A;  4IFY A;  1L3S A;  1SKW A;  4EP5 A;  5HRR A;  4PQU A;  1JLG A;  5I42 A;  3O3H A;  1EKE A;  4Z4F A;  1S6P A;  4E7L A;  1XI1 A;  4PUO A;  4KHU A;  4DMN A;  4QCL A;  3KLE A;  1BI4 A;  4DFP A;  3D0P A;  4IDK A;  1K6Y A;  3OS1 A;  1NK8 A;  3DYA A;  3AVC A;  3P83 D;  4Z4C A;  4F3T A;  3SPZ A;  3DM2 A;  1ZYQ A;  1QE1 A;  2HND A;  5KRT A;  4CJK A;  5DMR A;  4KHN A;  4HTU A;  1QSL A;  3CFO A;  4CEB A;  1U45 A;  4F4K A;  4YFU A;  1GOC A;  2Y1J A;  1C1B A;  2W42 A;  4KTZ A;  3NGI A;  1UAX A;  3KD5 E;  3LWM A;  3VQA A;  3MXJ A;  3VQ6 A;  3V9X A;  1C0M A;  4CEE A;  3ITH A;  4CF0 A;  2G8K A;  4DLG A;  4CGD A;  1KVC A;  3RTV A;  2KQ2 A;  3H08 A;  2FC0 A;  2PYL A;  1A5X A;  3MXM A;  4CFD A;  4PWD A;  4CF9 A;  3LZJ A;  2IAJ A;  3B6P A;  4CJR A;  1D5A A;  3OYN A;  1SKS A;  3MEC A;  3KTQ A;  2HHQ A;  4DSJ A;  4W5N A;  3WNG A;  1BCM A;  2VG7 A;  1JLB A;  2ATQ A;  4L8R B;  4BWM A;  4DLE A;  4J2D A;  1RDA A;  5KI6 A;  4FK2 A;  4W5Q A;  1NOY A;  2E6M A;  3CG7 A;  3AA5 X;  4CEF A;  3TAB A;  5I3U A;  3HP9 A;  3VQ9 A;  4GVM A;  3BGR A;  1NKE A;  4B8C A;  2KW4 A;  4N47 A;  4E1N A;  3NHG A;  1L3T A;  1QSS A;  3U3G A;  1NK7 A;  4DTS A;  2HHV A;  4O0I A;  2WON A;  4H4M A;  4KO0 A;  4CEA A;  3CYM A;  3QNO A;  4DSL A;  1DTT A;  3TAQ A;  4E1M A;  4NYF A;  1BCO A;  3HK2 A;  4YNQ A;  1NK0 A;  2FBV A;  5C42 A;  3IG1 A;  4TSX A;  3AVJ A;  1JXB A;  2D0C A;  3KLI A;  3G10 A;  4BAC A;  4GW6 A;  2D0B A;  1FXX A;  1L3V A;  1CLQ A;  4FW1 A;  2XRI A;  1VSE A;  1Y97 A;  3WNF A;  4KKO A;  1TV6 A;  3MEG A;  1NJW A;  4KHY A;  2Z1I A;  1WLJ A;  3OYA A;  4FJM A;  1S9E A;  3SV3 A;  2VG6 A;  4M3R A;  5CZ1 A;  1RT4 A;  3KK2 A;  2O4G A;  5KGW A;  1LWF A;  1FKO A;  1Z25 A;  3K5M A;  4DTR A;  4KHW A;  3OYB A;  3EZ5 A;  3SUN A;  4NCG A;  1WAF A;  1DLO A;  1VRT A;  3O3G A;  1WNS A;  3AA4 A;  1N6Q A;  1KSP A;  2E6L A;  1HYZ A;  1KLM A;  4CEQ A;  2AJQ A;  4RW4 A;  1B9D A;  3DRS A;  4FLT A;  1C0T A;  1XC9 A;  3L2W A;  4CGF A;  1G15 A;  2FBX A;  4I9L A;  3T1A A;  3VQ4 A;  4FZY A;  4KI4 A;  4EP4 A;  2ZQB A;  3WNH A;  3PO4 A;  4KTQ A;  1X9W A;  4BE0 A;  1UOC A;  2IDO A;  3HPG A;  4J2E A;  4DQQ A;  1NKC A;  4J2B A;  2BDP A;  3CM5 A;  1CZB A;  4ZTF A;  3ZSO A;  4ELT A;  4NCA A;  4E7H A;  2X78 A;  3ALY A;  1RT7 A;  4KRE A;  2NUB A;  1NJZ A;  5FRM A;  2P5G A;  3E01 A;  3EY1 A;  3SUO A;  2YNI A;  3HVT A;  3S3O A;  4B9T A;  4CJS A;  2DFH A;  2KFN A;  4CHQ A;  2HMI A;  4CES A;  1KLN A;  2IS3 A;  4B8A B;  4CHZ A;  1VK0 A;  3K5N A;  3V9Z A;  4K8Z A;  4OLA A;  5DK5 A;  3AVG A;  2X6S A;  3QIP A;  3NF7 A;  4FLY A;  4N5S A;  4FLV A;  4FJJ A;  1C6V A;  1X1P A;  3THV A;  1S1T A;  4CJE A;  3SUQ A;  1QSY A;  3VQC A;  4DTP A;  3QEW A;  3NAE A;  4M3X A;  4ZHR A;  4BDY A;  3LP3 A;  3RMB A;  1S5J A;  1CXU A;  3D45 A;  1RTH A;  1B9F A;  1BIZ A;  4DS5 A;  4Z4I A;  5J2M A;  3NF9 A;  3RR8 A;  3OYL A;  3L2R A;  4FCY A;  4B9V A;  1RDD A;  2HVI A;  3O3F A;  1RT1 A;  4OPJ A;  4DWI A;  3L8B A;  4IKF A;  1RTJ A;  1C0U A;  3K57 A;  3KKS A;  1KTQ A;  4FJX A;  1GOB A;  3TAM A;  4UQG A;  4FW2 A;  4FLX A;  2RF2 A;  2WOM A;  1S1W A;  1HYS A;  4IG0 A;  3SI6 A;  2A1S A;  4JLH A;  1B92 A;  5C25 A;  3SZ2 A;  4N76 A;  3NF6 A;  4FM2 A;  1YTA A;  4KV8 A;  1R0A A;  5T7B A;  1JKH A;  2FBY A;  3AVN A;  1W9H A;  4OKJ A;  3KKR A;  1MU2 A;  3LWL A;  1RNH A;  4MFB A;  1T05 A;  1T7P A;  2P1J A;  4ZTJ A;  4FJI A;  4CF8 A;  4FM0 A;  4OPK A;  3SCX A;  4M3Y A;  3NGZ A;  5K14 A;  3K5L A;  3QO9 A;  4JS5 A;  4FLW A;  2OA8 A;  3OVN A;  1VSJ A;  1QHT A;  2BE2 A;  3MEE A;  4O44 A;  4CK3 A;  4Z4E A;  1J9A A;  3QEX A;  4M3Z A;  3K58 A;  2KFZ A;  3OJS A;  3DLE A;  1D9F A;  4F2R A;  4DFJ A;  4F3O A;  4J2A A;  4JRQ A;  1O1W A;  3LAK A;  3U3Y A;  5HP1 A;  3RWU A;  3U6F A;  3AVK A;  1NK4 A;  4N56 A;  3OY9 A;  4CJQ A;  4KFB A;  1F21 A;  3B6O A;  3AO5 A;  3MED A;  3OJU A;  4OJR A;  2RN2 A;  4EZ9 A;  1TKZ A;  4FYD A;  1ASV A;  1CXQ A;  3V9S A;  1LAV A;  3ZT3 A;  2VG5 A;  3LPU A;  4DU3 A;  3LAN A;  2YHB A;  3K5O A;  2HHU A;  1S1V A;  2BGG A;  3ZSV A;  2JGU A;  2EHG A;  3ISN C;  3HM9 A;  2VWK A;  3MAQ A;  1SL0 A;  4HHT A;  3QEP A;  1ZBL A;  5FRN A;  1JLC A;  4FLU A;  5CYQ A;  4Y1D A;  4CFA A;  3IS9 A;  4BE1 A;  4MQ3 A;  2P51 A;  1VSI A;  3VQ7 A;  4CJF A;  3AO3 A;  3QES A;  3PY8 A;  1TAQ A;  2XY5 A;  1VSM A;  4JRP A;  4CJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...