3KWIA

X-ray structure of ns1 effector domain w187y mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
TPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLEYNDNTVRVSKTLQRFAWGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Non-structural protein 1
publication title X-ray structures of NS1 effector domain mutants.
pubmed doi rcsb
source organism Influenza a virus
total genus 34
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3kwiA00
3P31A 3O9SA 3O9TA 3O9QA 3P39A 3KWGA 2RHKA 2KKZA 4OPAA 3EE9A 3D6RA 3O9UA 3KWIA 3OA9A 3O9RA 3F5TA 3P38A 3L4QA 4OPHA 3M5RA 2GX9A 3EE8A 3RVCA
chains in the Genus database with same CATH superfamily
4KB1A 1QTMA 3ZT2A 3HXMA 1RT3A 4YOWA 1Q9YA 4Z0UA 5JVHL 2NRXA 3SBGA 4FWMA 1K8KB 3MK6A 4KHQA 3ASMA 3WNGA 1EP4A 2QK9A 3LDSA 5IWAK 3J8AA 1QSYA 4BRQA 1NJYA 4QCLA 2P9NB 2AJQA 1RBTA 3G25A 4JI7K 4CEBA 4YOXA 3RMCA 2Z1HA 3VQ6A 3DXMB 3VF6A 3EN9A 4BRFA 3CJCA 3LALA 4CJTA 4FJKA 1C0MA 2CH5A 1SQKA 3QBXA 5HRNA 3R3LA 2E2OA 2QWNA 3FLCO 1RFQA 3CM5A 4NLBA 2E88A 3VGLA 2P5GA 1C1CA 1S1UA 1SAZA 2YHAA 4FOEA 5KPTA 1NJZA 3R9PA 1YT3A 5GIPA 4I2PA 2WC9A 1WB9A 4I2QA 1VQKN 1NK6A 4GV3A 3THYA 4ILGB 5BRHA 1YVNA 2FSKA 3O4WA 1YHQN 3SJHA 3AVFA 2YX6A 1HJRA 5AQZA 2IVPA 2VYPA 3ATVA 3WNFA 1VSJA 4NCBA 3MXMA 4CEAA 5M1KA 3Q7CA 1NOZA 2B5JA 1VSEA 4W5TA 4FLVA 1YITN 3WUHA 1T44A 3DYAA 4CCHA 4JK8A 4E7IA 4J2BA 3AO3A 4F9OA 3ID8A 3V9XA 3K5NA 2D0BA 5CZ1A 4BRGA 3S3NA 1YXQA 5E26A 4JD2B 3UKUA 3JAMO 3CERA 3U4LA 1XC3A 4FM1A 4CVNE 4QAGA 3SV4A 2BE2A 5H1SQ 2UUCK 1NGGA 3QETA 1XI1A 4DV3K 1BQMA 4DF4A 1U04A 3QMLA 4NB4A 4JI4K 1IV0A 3NMUA 5AQIA 1VSHA 2GV9A 4E7JA 3KJVA 1TKZA 3H46O 4GKJK 1S6PA 2HVHA 3LZJA 4BE0A 5HBMA 1BISA 1HR0K 2FBTA 5AQTA 4C8KA 1WUAA 2BDPA 2O8BA 3LL3A 1A5WA 4OGEA 3SNNA 2OCEA 2A1RA 5GINA 4LF6K 3O5BA 4LC9B 1NMDA 2VGMA 4B9QA 2VQFK 5LY3A 1DGKN 1R0AA 3P39A 2UYTA 1E4GT 3KD1E 3HK2A 4GKKK 3WXJA 2W40A 1NM1A 4JKGA 3TAEA 2HBKA 1T6DA 4GW6A 4DUZK 3MDQA 2A6AA 3T19A 4K8ZA 4CF8A 3AVMA 5ELZA 1HYZA 4JHDB 1TAUA 4JV5K 1WOQA 2E8AA 1XNRK 4B9TA 4M63C 2ITGA 4M3WA 2Q97A 4LH4A 1D4XA 3J7ZO 4IOAL 1OKJA 4TSXA 4N41A 3ZLJA 4JRPA 4HHTA 4JI0K 1SUQA 3V6DA 4BDZA 3BZCA 1YTAA 4CGIA 3ZSVA 1VQ5N 2YHXA 3OYNA 2KZZA 2F8TA 3RR7A 3D2FB 2ASOA 4ID1A 4EZ6A 2RN2A 1IKWA 5FPMA 1KAYA 4BRDA 2E1ZA 2BTFA 3EE9A 3SYZA 2BANA 3CQ8A 1OH8A 4FLTA 3C0BA 4DR5K 4A2BA 2Q31A 3I33A 3AVCA 2NRVA 2GWKA 1YAGA 1JCFA 1KCFA 3A8YA 2A41A 3M3ZA 5HP1A 2HMPA 4DLGA 3TAGA 3AAPA 1LW0A 4NCAA 4R5PA 1JLEA 3FZKA 4EP5A 1TK0A 1ATSA 4CF1A 3LPTA 1LCUA 2HSTA 5LL6Z 2KTQA 1NGJA 3OYMA 1NLVA 2CH6A 3AV9A 3TTCA 3F73A 4RW8A 3OS2A 1LWEA 3OHRA 1H1VA 5EVZA 4FLWA 3QEVA 3OBWA 3C7NA 3T7ZA 4BC3A 4B1WB 3HL8A 5CZ2A 2B6AA 3SV3A 3VTIA 4DQSA 3QFUA 1VSDA 1BGXT 1RNHA 3NGZA 4KKOA 1ASUA 1RCHA 1C1AA 4EHTA 4DTUA 2QWRA 4CEZA 4E1JA 4EP4A 4Z4FA 3LDQA 2QKKA 1WSEA 1JLFA 5EXWA 1K8KA 3V9ZA 2QXLA 1FKOA 4WE1A 3MWPA 3QDKA 3CCMN 3OYDA 4MLHA 3SAFA 2G8FA 4CJ5A 5JLFA 3ZX0A 4Z4EA 4GMJB 4CEQA 3ZSWA 5J1EA 1K6YA 4MO5A 4UY8O 4LD0A 3DXMA 2CGKA 4LFAK 3KK1A 2P9LB 1Q7YO 1X9MA 3RR8A 5GAGP 2PYJA 1YVUA 3GL1A 1BG3A 4E7KA 1O13A 5ADXH 3LDOA 2YHBA 4H03B 3CCVN 3V81A 2F8SA 3THVA 3EZWA 1U4BA 1HYVA 4FZYA 3H1QA 3WQUA 5BPMA 1QZ6A 2ZWHA 1W9HA 4JKFA 3JS6A 3CJBA 3BUZB 3MX2A 2RE2A 3HVRA 2ITMA 2GUPA 4YORA 5J2NA 4UQGA 3VENA 4CJRA 2XY5A 1SL2A 5AQLA 4CW7B 1HX1A 3OYAA 5HRSA 4J2DA 3VN5A 3MMVA 3ZT3A 3ZX2A 4CK3A 1IG9A 3LWLA 4B8CA 5BN9A 1Z6RA 1XHZA 1JXEA 1Q86O 1D9FA 4M3YA 2HNYA 1I39A 2WFBA 3NVKA 1DLOA 4Y1CA 1VAZA 2NNWA 4BR5A 1DKGD 1KFDA 4XEIA 3AO2A 1RT7A 3LP2A 2V51B 4K41A 3CFOA 1EETA 1N6QA 1KLNA 1HNWK 1U6ZA 4O0JA 3M8SA 5AQXA 5M1PA 4QOZB 1QQOA 2ASMA 2X74A 4FJ8A 1EKEA 2HHVA 3IDHA 4B3OA 4BWJA 4CBXA 4KTQA 1S22A 4C8MA 3MN6A 4HTLA 2D0CA 3GE1A 5C2FA 4MDBA 3VEXA 2VQEK 4E7HA 3I8DA 4DSIA 1VSFA 3PSIA 2RKIA 1VQON 4E89A 3RTVA 4FYDA 5M1FA 4LF5K 1EO1A 4JKEA 3F5TA 3MXIA 2VG6A 4L8RB 1MU2A 4FWKA 1VRTA 3QERA 4CD1A 5AQUA 5FLXO 4H0VB 3AGKA 4RCHA 2PYLA 1ESVA 2GBZA 3A5LC 3WNEA 3EKUA 3AVLA 1HPMA 2A5XA 3CJ7A 5J2PA 3ZETA 4NLCA 5C42A 3SJJA 4FVUA 1JLCA 3VQ8A 2ZF5O 3R6MA 3KZBA 4AQYK 3O3GA 3L4IA 4BRIA 4CHPA 2KW4A 5BPNA 1X3MA 1REVA 2E4LA 2RF2A 3HSCA 1X9SA 4PY5A 4JN4A 1RBRA 3A0IX 2A1SA 4BREA 1D9DA 2RPIA 2G8HA 4ILHA 3NF6A 3EL2A 5EOYA 3TTFA 3VQ4A 4OLAA 3G4SN 2IDOA 4PWDA 1WSGA 3VQEA 4CJLA 5CY4A 4B9UA 3LWMA 3OYCA 2DTUA 1EWRA 3MN7A 1LWFA 4M3ZA 4O44A 5DK5A 1TKTA 3KHYA 1RT4A 3KWGA 3VGMA 4BQZA 4WQ4C 4JS5A 1WLJA 3P1GA 4N76A 4DTSA 3HSTB 3N4QA 1J5EK 3IKMA 3CI5A 1B9DA 4JI3K 3WEEB 4M41A 2ZGZA 4K0KK 4K8XA 3K0SA 4FK0A 4ISEA 1KTQA 2VWKA 4PL7A 3OYFA 4CJVA 3THXB 4O5FA 1SL0A 5T7BA 3VERA 3DLRA 4DTRA 5HROA 4DU3A 4FJJA 5BPLA 3PIPL 3OS0A 4L3QA 2OZSA 1IKYA 3QNOA 3CMEN 2KHOA 3D0PA 4ISFA 2QWQA 3C94A 3NFAA 3VPZA 4FPBA 4A57A 3CQXA 3DOLA 1EQYA 3DRRA 4GVEA 1VHXA 1CZAN 2Y1JA 4LH5A 4KAZA 4DTNA 1NGAA 2XO7A 5I3UA 2OPSA 4DFJA 2P9LA 3EO3A 4FW2A 3D45A 3MXJA 2HHQA 5FPDA 5BN8A 3QEIA 5AQWA 1VSMA 2HBMA 3UIQA 4DR6K 4B3MK 4WQ4A 4IXCA 4AM7A 3HT3A 4F3OA 5HOOA 4CZJA 1NK7A 3TAQA 3NH2A 4YOYA 3EE8A 2ZGYA 2IS3A 4DTMA 2ZD1A 3I56N 1HYSA 4JKBA 4LSNA 5AFUH 4ZHRA 1KLMA 4IG0A 4GY2B 2P5OA 1QZ5A 4F2RA 1V4SA 2QWOA 2P9PB 3WXIA 3SUOA 3MCAB 4H5RA 5AQFA 2P9UB 1UA1A 4KHPK 3H3NO 4RW4A 1G15A 1SKWA 3SMSA 4KV8A 3E66A 2KLAA 2P51A 3H45C 4DV4K 1HNZK 4FLZA 4FJIA 3MN9A 1FKPA 4QS9A 3CJAA 5CHIA 3NDKA 4B9SA 3MCPA 4B1ZA 5AZJA 1YJWN 3T1AA 1U49A 2W6LA 1KAXA 1J53A 2YKNA 2QM1A 3IUCA 1ASWA 4BGBA 2YHYA 1KFSA 4GVMA 4I6MB 5AQMA 3HM8A 4DSKA 2HHWA 3FFIA 4DTPA 2OZMA 4OVLA 1Q9XA 4CHQA 2QWPA 3VMFB 2P9IA 4A2AA 3HVTA 1P90A 4KRFA 3HP6A 1VSLA 1X3NA 3VESA 2O8EA 2RHKA 3JSMA 3VQDA 2VG5A 1HUXA 2D1KA 1NGBA 1JCEA 2VGNA 3R8EA 1NG9A 3T69A 3HP9A 4JYAK 3G10A 4DMNA 4RW6A 4ZTFA 4BR0A 5AQHA 1DTTA 2D0PA 2EX3A 1KD1O 3B6OA 2ASPA 4M3RA 4WCEL 3F9MA 4DQQA 3P31A 1LAWA 2IGIA 1TGOA 1N33K 4IDKA 1BCMA 4DU1A 2WBNA 2HBJA 5BREA 5DM6L 4HCCA 1VQ7N 4CJPA 2X6SA 2HF4A 3A5OC 1XMQK 2NRHA 5AQVA 1NK4A 4HCBA 1QHTA 1NKBA 4KBOA 3SLCA 3RWUA 5AZIB 3KLIA 4CJ7A 3TTDA 5FRNA 1NKEA 1RTJA 3CFPA 3E1YA 4LFBK 1SZ2A 1B92A 4KHSA 4IOCL 1BL3A 3PO4A 2D5RA 4FWRA 4JKDA 2JWKA 3CFRA 3IS9A 4Z4GA 3OYJA 2A40A 2OYQA 3S41A 3CM6A 4BRNA 4M3UA 4BG8A 4BC2A 2FBXA 4K42A 3HPOA 3CCUN 3CQYA 4BRHA 3IG1A 1WN7A 3RSEB 4CZLA 4FZXC 4FJNA 3FZHA 4JNEA 1Q82O 1RDAA 2Q2RA 4CECA 3KK3A 2DFHA 4BRKA 4MFBA 5HRPA 4FJ9A 3K5MA 4B1YB 4GNIA 3SAHA 2Q3SA 4YDUC 3ZEUA 4ISGA 2OANA 1A5XA 3SBTA 1HNIA 3OVNA 3SI6A 3TAPA 1QE1A 2P9KB 3SPZA 4CGJA 3AARA 2OPRA 3MAQA 1NGIA 5IT9O 3DRPA 4B9LA 3VQ5A 5BR8K 4WF9L 1UOCA 2QI2A 4BR2A 5C24A 4CZMA 5LJWA 2UXBK 2XY7A 4ID5A 3W0LA 1ZBUA 1MWKA 4DB3A 3ULEA 1RDWX 3K2PA 3CJ1A 2V7ZA 3MWTA 5M1NA 1GLLO 1NJXA 3OYGA 3WEEA 3L2UA 1UWBA 3U3YA 1S1TA 1FXXA 4C8NA 4DCHA 1VSIA 4WFNL 1GLJO 5GAEP 5BR9A 2NLXA 3DMJA 3THXA 3QIOA 3RMAA 3V4IA 4O0IA 3NGIA 3L8BA 3I0RA 3BDPA 2Z1JA 4FJ7A 3NH0A 3QB0A 2OPQA 5KGXA 3OS1A 4CF0A 1FJGK 3J7AP 2HNZA 4YDUA 3KIOA 2E20A 1KRPA 4ELVA 1E4FT 4B1UB 1TL1A 3VETA 5F0XA 3OY9A 3QICA 5HLFA 2W41A 3FFKB 1XQSC 5CR4A 1EWQA 3SMPA 2IVNA 1C6VA 2EWSA 2QWLA 4MO4A 3CCQN 5AQOA 1X9WA 1WSHA 3LDPA 4BC4A 2FBYA 2KFNA 3MEDA 4FWSA 2Z1GA 4DFPA 4F4KA 3EEQA 2XRIA 4FK2A 4KB0A 3C95A 1C0TA 3O9SA 4FJ5A 4CJWA 1BHLA 3VQQA 5C25A 1ZBHA 4NO7A 2PY5A 2WONA 4CZHA 2H3GX 3ENHA 1RGIA 1WSIA 1BIUA 2P9PA 3ITHA 2NRWA 2NRRA 3G0ZA 4CJSA 5KI6A 1YJ9N 3MX5A 2OTLN 4FWOA 2HHTA 5AQQA 4IZ9A 4FVMA 4RW9A 1K8AO 3P4IA 2UUBK 3VEZA 4DU4A 1SKRA 4J8FA 4LF4K 1RDUA 4M7YA 4EZ9A 4CIEA 3J80O 3KTQA 3P5JA 1C1BA 3WXLA 1TKDA 1I94K 4DSFA 1S9EA 3EKSA 3K5OA 4DTOA 4R79A 4CJ4A 3KVGA 2QWMA 3EYZA 2D0OA 2P9SB 4EAHD 2P9NA 1DEJA 3L2RA 5FDLA 3LP0A 4DR1K 4DV2K 2F4VK 3DLBA 4ILJA 4CHYA 3GDQA 4AM6A 5J2QA 2HHXA 3RMBA 1VQ8N 5D3GA 4JI1K 2O4IA 1U2VB 5I9EB 5KQ8A 5KRSA 4LF8K 3KK2A 3SZ2A 4CBUA 4FLXA 2DY4A 2QXFA 4OPHA 4CIGA 1NK8A 3VF4A 1NWKA 3MN5A 4IJNA 2P1JA 2HHSA 3ZSXA 4V19S 3RMDA 2X6NA 3OYEA 2HF3A 3D6RA 4KTZA 2FC0A 1KC8O 5CYQA 1VQ9N 1FK9A 4FJHA 3M8RA 1N34K 5AQNA 4AHVA 4KREA 3OJUA 3O8MA 4PL8A 1S6QA 4DV7K 1L3SA 4PQUA 4IJAA 1YTUA 3RVCA 3VQPA 3LDLA 1JL1A 3VEVA 4FL9A 3AVGA 5KPRA 2HW3A 2FLOA 4B9VA 3BF1A 1YF5L 4H0TB 1NK9A 3HYFA 1IBMK 4JD2A 3QINA 3AO1A 3HPGA 4FJGA 3KLGA 4FLUA 2FF6A 3CJ9A 4QS8A 3BZKA 3U3GA 3RSEA 1WBDA 2YNHA 4IFVA 3B6PA 3VA3A 1ZBSA 4CJ3A 5LJVA 3JYTA 1NKCA 4BY9C 3PIOL 3L3UA 3AVBA 3OYHA 3PX4A 4DHYA 3S3OA 4BR7A 4AH9A 3VQCA 2YKMA 3O3HA 1Y64A 4KTWA 4HUEA 1VK0A 4RG8A 5M1QA 2GUIA 3NF9A 2P9KA 1HMVA 3C6TA 4DR4K 4DQRA 3DI6A 2ZJPL 2E6MA 3ISNC 4RTFD 4U7BA 3P83D 1BA0A 1HKBA 3G6EN 3BP8A 4KHYA 4BE1A 1TYQB 1T6CA 3O9QA 2F9TA 1ZYQA 4G1QA 4WYBA 3PLAA 2FF3B 5HL7L 4FJXA 3OBYA 4FOIA 4DWIA 3VQ7A 4CGGA 1BDGA 3NE6A 4N47A 2O4GA 4AHSA 4DV6K 3W3DA 4JHDA 1RTDA 1IO2A 3U8XA 4AHCA 4YNQA 3NVMA 4AHRA 2OTJN 2D0AA 2YCHA 1WSFA 4CZFA 3QIPA 4H4OA 2A3ZA 4FLYA 4FSVA 3O9RA 4CJFA 3CD6N 1BUPA 4CHOA 3LZIA 3MEGA 4H0OA 2PZSA 2CGLA 5JVGL 1K73O 3DXKB 3FR0A 3CPEA 4BVOA 1VQPN 2E2NA 3D2FA 3SAGA 1LW2A 1JLBA 1HLUA 1ZXOA 4KO0A 1VQMN 4RW7A 2E2QA 5C2DA 3O6WA 4M3TA 4M7XA 2UU9K 1CXUA 4FW1A 1UAXA 3UE5A 3RRGA 3U9DA 3M1FA 4KH5A 4ICLA 1OH5A 5SZTA 1XMOK 2QA4N 4BROA 3KK7A 1IH7A 4XH1A 1KQSM 3QNNA 3CF5L 2IAJA 4DSLA 3I55N 3JXUA 1HQEA 4X64K 1T8EA 2HHHK 2Z1IA 3KWIA 5JICA 3DJCA 1TK5A 2EHGA 4HWIA 2X78A 2DPNA 4BR4A 3KD5E 4G9ZA 2I7NA 1N8RO 4N5SA 4CZKA 4JLHA 2VWBA 4CFAA 4YOVA 4E3SA 1S1WA 3V1OA 5I42A 1EXQA 2KKZA 3EZ5A 2Y1IA 1L3VA 2GTDA 4NYFA 4CJEA 1TUUA 4LSLA 4H5WA 2J4RA 3QEXA 3OA9A 3CCSN 1HKCA 5AJ3K 1NOYA 3LP1A 3QBWA 1VSKA 4DTJA 2P9SA 4E1MA 3TARA 2E6LA 3M5RA 1HJOA 4C1NI 4NCGA 4DR3K 1BI4B 1NBWA 1NMNA 3KKSA 2F9WA 1GLAG 4CF9A 1J54A 1C0UA 4A5AA 1U2VA 4B3SK 3WXMB 2G8VA 4FJLA 3HTVA 1ZBFA 1NGEA 1NGFA 1IJJA 3TSQA 4CFBA 3S3MA 4X65K 4DR2K 2VCPA 4W5OA 4DFKA 1KSPA 4GV9A 5A2QO 1D5AA 3ID6A 4OKJA 2E2PA 4WQ5C 1HNXK 4FK4A 2YNIA 3AVHA 4CK1A 1JJ2M 2YHWA 5FPNA 5AR0A 1M1KO 4M3XA 3T1YK 3CCLN 4DF8A 4BRMA 1M90O 4JEPA 5JS2A 3E9PA 4K25A 2B4JA 1KVBA 3OTOK 4JRQA 2BH1A 3FZFA 1K9MO 1NJWA 3LM2A 4B8AB 4PKHA 3BY5A 3TI0A 3CC4N 3ZSRA 4A5BA 4B9NA 4LF7K 4F3TA 1JLGA 1WSJA 2ZQBA 2W42A 3CPWM 3SQ2A 3LP3A 4ELTA 3O1WA 5LMNK 2PFUA 4Q0BA 2YJFA 4H0XB 2UXDK 1VQ6N 1TVRA 2D4WA 2R7YA 1WNSA 3CMAN 1WBBA 3K9JA 1F21A 3CHWA 3SUNA 3SQ0A 3F2KA 2V52B 1L3UA 4Z4CA 4Z94A 5KRTA 3TSUA 4YY3K 3CG7A 3VQ9A 4JKAA 1T05A 1HQUA 1SL1A 3OW2M 4CF2A 3U6FA 4CZIA 3L3VA 4WQ5A 1S1XA 3VQBA 1GLFO 3VOVA 2BGGA 4BGAA 3DOKA 2ZJQL 1YI2N 1ZBIA 5FPEA 4BVPA 3HBTA 4H5TA 3HJFA 2IIRA 3HZ6A 2F96A 4MQ3A 3DLGA 3AGRA 4FWNA 1QS4A 3AO5A 4F2SA 3C65A 2VWJA 3OYLA 1RBSA 1TYQA 1W97L 3DAWA 2HNDA 4IEIA 4EIAA 1EX4A 1OH6A 3O9UA 1Q18A 4J2AA 3HRGA 4WFAL 2G8KA 4FM2A 4JI8K 1JKHA 3V1QA 4KI6A 4FWQA 4H0YB 1T03A 3AO4A 1GOBA 3TU5A 4U67L 3K57A 5E41A 3L6QA 4F8RA 4H0PA 4JKHA 4OLBA 5HRRA 4HTUA 3FGUA 3B8AX 3IMXA 3E9LA 3NH1A 4QS7A 5AQKA 3AY9A 5KGWA 2FXUA 3TR8A 3ZSYA 4JS4A 1N36K 1GLBG 3SQ4A 4W5QA 4AHUA 1NK5A 4I7FA 4M45A 3E9OA 4KHWA 2ZE2A 4DKWA 3DXKA 3WQTA 1LV5A 5C15A 4KH4A 3H1VX 1X9JA 4LFCK 2GWJA 1E3MA 1ZC6A 4FZZA 3Q7BA 1SS6A 4XIUA 1J5OA 4FPAA 1VQ4N 4N56A 3A5NC 2KZMA 2HVIA 4CD3A 1R59O 4KI4A 2HBLA 4CJQA 3TAMA 3OYBA 3H3OB 4DSEA 1W0HA 3CCJN 1ZBLA 1ATNA 2FSJA 2IOCA 4CZGA 5CYMA 4DTXA 2O8DB 3M8QA 3SQ1A 1LWCA 4DLEA 4IOXA 3UKRB 2UUAK 2G8UA 2QKBA 2HHUA 1GLEG 2V7YA 1XUPO 3VF2A 4H5NA 1TL3A 3R1XA 3TPQA 3TSPA 2YV0X 1BA1A 1D8YA 3CYMA 4X66K 4Y0WA 3DWLA 3HM9A 5JS1A 3K59A 3O4NA 4BQLA 2PBDA 1NGDA 5F2RA 3HO1A 3ZCMA 3SUPA 2WOMA 3CETA 4OO1J 4FJMA 4DR7K 1HPZA 3C6HA 4OPAA 4MLEA 1Z26A 3QLHA 3AVJA 3WXKA 4DQIA 4CERA 1NK0A 2I7PA 2YJEA 4CGDA 2JWLA 3NAEA 3KKRA 1RDCA 4E19A 3M8PA 4WFBL 4H8KA 4W5RA 1CLQA 1QVFM 1HNVA 1GOCA 4DFMA 3O80A 4Z4IA 1BI4A 1Z05A 4JKCA 1S3XA 3HOTA 1Z25A 1RILA 3LPUA 3TANA 1N32K 1NU0A 3QESA 2XHBA 1VRUA 1NGCA 3GBTA 3HI0A 1HRHA 3UB5A 2DFFA 3D2EB 4CHZA 4PHTX 3ZETB 4KPYA 1XHXA 1JL2A 1W7AA 1S1VA 3VEOA 3I0SA 2O8CB 4CEFA 4E1NA 4JI5K 3V9UA 2OA8A 5FROA 4J2EA 3DLLL 4DV0K 2YNGA 3DM2A 3WT0A 3IAYA 4YOTA 2Q1NA 1RBVA 4W5NA 3FZMA 3QEWA 3O1BA 1MDUB 4BG9A 5TKWA 5C0YA 3ENOA 2YNFA 2KQ2A 5F1XA 2P9UA 3T3FA 1QSSA 1FW6A 2GEMA 3DRSA 4IFYA 1WAJA 3ZSZA 4IO8A 1VQLN 4DQPA 2NZTA 3SPYA 2AP1A 4B9MA 1SKSA 3QFPA 3NF8A 4AHTA 3VEYA 1RTIA 1RDDA 1CXQA 4HUGA 3AA4A 4BRLA 4OPKA 3TABA 3NHGA 2GELA 3NF7A 4I6MA 1RT6A 1YIJN 4IG3A 2Q36A 3ALYA 4BWMA 5JLHA 1J9AA 5J2MA 4IO9L 1IKVA 1QQNA 3OYKA 4E7LA 5AQRA 4DS5A 4DV5K 4JI2K 4PUOA 1GLDG 3ULDA 3K58A 3LDNA 2O8FB 1QQMA 1WAFA 3AA5X 4OPJA 1VQNN 2F7TA 1RBUA 3L2QA 4B08A 2IVOA 2BUPA 3CIPA 3NBPA 1TAQA 5C10A 3V9SA 5EU7A 4CK2A 2GX9A 5AQGA 3ZYYX 1QHAA 2ATQA 3WNHA 5ADXA 1ATRA 2JGUA 3J81O 3ZT4A 4JAXA 3THWB 4A61A 2KFZA 3SK3A 2HMIA 4CI6A 4B1VA 4KHUA 4YHHK 4FWLA 2Q0RA 2HOEA 4BC5A 4RWTA 4H4MA 4OKKA 3L4QA 2PAVA 4IEEA 1RDBA 1T7PA 5AZIA 3DLEA 5LMUK 4LY7A 5AQPA 1RTHA 2E1YA 1RT5A 1OVYA 1IBKK 3O3FA 4IDHA 1ILYA 1GLCG 5BRFA 4Y1DA 4GV6A 5B8HA 3VGKA 1RT2A 5K14A 4CZEA 5DM7L 4O5BA 1W2BM 4IWVA 3PO5A 1GOAA 1S72N 1RT1A 4LF9K 1G99A 4C8LA 3AA3A 3PSFA 5E84A 4FCYA 3RRHA 1NGHA 3ZT1A 4CFCA 2NRZA 2XY6A 3DLKA 4MDAA 3LM9A 3L2WA 1UA0A 5GIOA 5EY4A 4XH4A 4YFUA 5AZJB 3AVIA 3C6UA 4FWPA 3ATUA 1OH7A 1IKXA 3CC2N 3ZSOA 2ZM6K 2WUSA 4NXMK 4DSJA 1NJIO 4CEDA 3P38A 4DQ8A 4BRCA 1BU6O 3V1RA 4AF1A 2W6KA 3V9WA 2A42A 3VTHA 4I9LA 4KFBA 2O8DA 2YI1A 3M6GA 2P9IB 1KAZA 4IBNA 4OJRA 3H6EA 3T1HK 4NYNA 2O8EB 1XNQK 1DTQA 3UKRA 1CZBA 3VQAA 4I9QA 1V4TA 3K5LA 4PA1A 1Q8IA 4C23A 3A5MC 3LANA 2DFEA 2I5JA 5C12A 4HUFA 4CJKA 1YUWA 3ENBA 3BGRA 2Q0UA 4AILC 3CCEN 2LSNA 4ZTJA 2AA4A 5JMVA 1XWLA 3ZSQA 4FM0A 1BCOA 3THYB 4CGHA 3NGYA 5KQDA 3PUFA 4Q5VA 2G8WA 4O8KA 1L5UA 1HKGA 4DUYK 5KPZA 3SUQA 2XY8A 4B1XB 4BRAA 1JLAA 4CEOA 4M42A 4CE9A 4CEEA 3CXCM 4OGCA 3IRXA 2QEXN 5TKYA 4BACA 1BO5O 3PV8A 1N5YA 3E01A 4ELUA 3I8BA 3GG4A 1XC9A 3ZX3A 1TV6A 2QW9A 1ITGA 4BDYA 1MWMA 3O9TA 3SCXA 4IFEA 1BWFO 3D2EA 1JCGA 3UKUB 3AAQA 4DV1K 3A2FA 3KLFA 5MLCQ 3S9HA 1DT9A 2O8CA 4KHNA 2IC3A 4HVJA 5CE3A 1Y97A 4FXDA 4IKFA 2FSNA 1KVCA 3IFRA 4DG1A 4KH6A 3KLHA 1TUYA 1JLQA 3AA2A 3L0QA 3TWHA 3OYIA 1J6ZA 4DS4A 3ZEUB 3CCRN 1BOTO 4CGFA 3J7YP 1U47A 4OKEA 1T3VA 4O4GA 3PX0A 1LOTB 3MECA 2NUBA 1S5JA 2QTDA 4O55A 4JI6K 1U45A 2O8BB 4PKGA 2CGJA 4CIFA 2UXCK 5FRMA 4C1NK 1TKXA 3C6AA 3LAKA 4CBWA 3LAMA 3O4QA 2ZJRL 2HB5A 4YOUA 1S9GA 1B9FA 1KXPA 1L3TA 1C0GA 1KVAA 3O08A 3MEEA 3G71N 1NNEA 4B3TK 4XH5A 2G8IA 1BIZA 1P8ZA 3N4PA 4FO0A 5M1OA 3VA0A 1Q81O 3ULEB 4PKIA 4CJUA 1U48A 2VG7A 4Z4HA 1SV5A 4JKGB 1YJNN 1C0FA 1TK8A 5AQYA 1X1PA 3U9ZA 4O8UA 3L2VA 5BRDA 3PX6A 1I3AA 3TAFA 4X62K 2E5LK 3ZT0A 2FBVA 2NRTA 4JK7A 5GAHP 4CFDA 4BR9A 1LAVA 4EHUA 4A59A 2O8FA 4JK9A 1QSLA 1O1WA 1BQNA 4BDPA 3FZLA 1MA9B 3AVAA 1A5VA 3AVKA 4BE2A 1OVQA 3F9KA 4NXNK 1QQCA 3THWA 1ASVA 2ETJA 3K9KA 5KTQA 3CC7N 3HOSA 4C8OA 2WTUA 4B3RK 5AFUA 4E0DA 3GOIA 4EFHA 4OX9K 5DMRA 4BRPA 1IG8A 3D7EO 3BF3A 4CHNA 4CESA 5AQJA 3EY1A 4A62A 3KLEA 3DLHA 1JXBA 3HPHA 3FE1A 3VEWA 4H5VA 5AQSA 4K43A 3QEPA 5SWMA 3PY8A 5GADP 5EX5A 1IBLK 3BEXA 3AVNA 3OJSA 3C7NB 2OPPA 3NCIA 3H08A 1CZ9A 3QO9A 2JLEA 1QVGM
chains in the Genus database with same CATH topology
1NWKA 3MN5A 3HSCA 4IJNA 4JN4A 3CETA 4OO1J 3A0IX 4YOWA 5JVHL 2NRXA 4BREA 3C6HA 4OPAA 4MLEA 2HF3A 3D6RA 3SBGA 4FWMA 1KC8O 1K8KB 3MK6A 3WXKA 1VQ9N 4ILHA 3EL2A 2I7PA 2YJEA 5EOYA 3J8AA 3TTFA 2JWLA 4BRQA 4WFBL 3G4SN 1QVFM 2P9NB 5AQNA 3G25A 3O8MA 4PL8A 3O80A 1Z05A 4IJAA 4JKCA 1S3XA 4YOXA 3HOTA 3RVCA 3LDLA 3MN7A 3VEVA 3DXMB 4FL9A 5KPRA 2FLOA 3VF6A 3EN9A 4BRFA 3BF1A 3CJCA 1YF5L 3KHYA 4H0TB 3KWGA 3VGMA 4BQZA 2CH5A 1SQKA 1NGCA 1NGDA 3GBTA 3HI0A 3QBXA 4JD2A 3R3LA 4WQ4C 2E2OA 3UB5A 3D2EB 4PHTX 2QWNA 3FLCO 1RFQA 2FF6A 3N4QA 3ZETB 3CJ9A 4NLBA 2E88A 3VGLA 3IKMA 3CI5A 4QS8A 5KPTA 1SAZA 4FOEA 3VEOA 3RSEA 3WEEB 3R9PA 2ZGZA 5GIPA 2WC9A 1VQKN 4GV3A 4ISEA 3DLLL 1ZBSA 4PL7A 4ILGB 5BRHA 5LJVA 1YVNA 4O5FA 2FSKA 3WT0A 3O4WA 4YOTA 4BY9C 2Q1NA 3VERA 3PIOL 1YHQN 3FZMA 3SJHA 3O1BA 1MDUB 2YX6A 4BG9A 4DHYA 5AQZA 4BR7A 2IVPA 5TKWA 5C0YA 1Y64A 5BPLA 2VYPA 3ATVA 3PIPL 3ENOA 4L3QA 5M1QA 5F1XA 3CMEN 2KHOA 2P9UA 2P9KA 5M1KA 3Q7CA 4ISFA 2QWQA 2ZJPL 3VPZA 4FPBA 4A57A 4RTFD 2GEMA 1YITN 3CQXA 4U7BA 3WUHA 1T44A 1EQYA 4JK8A 4GVEA 1BA0A 4F9OA 1HKBA 1CZAN 4IO8A 3BP8A 3G6EN 1VQLN 2NZTA 3ID8A 2AP1A 1TYQB 1NGAA 1T6CA 4BRGA 1YXQA 3O9QA 5E26A 2P9LA 2F9TA 3EO3A 4WYBA 3QFPA 4JD2B 3VEYA 3PLAA 2FF3B 5HL7L 5FPDA 4BRLA 5BN8A 3UKUA 5AQWA 2HBMA 2GELA 3OBYA 4FOIA 4I6MA 4WQ4A 1YIJN 4IXCA 4AM7A 3CERA 1BDGA 2Q36A 3U4LA 1XC3A 4CZJA 5HOOA 5JLHA 4IO9L 4YOYA 3EE8A 5H1SQ 1NGGA 1QQNA 3W3DA 2ZGYA 4JHDA 3U8XA 5AQRA 3I56N 3QMLA 4NB4A 3NVMA 4JKBA 2OTJN 5AFUH 2YCHA 3NMUA 4GY2B 1GLDG 5AQIA 3LDNA 1QQMA 1QZ5A 4CZFA 1V4SA 2QWOA 3H46O 2P9PB 2A3ZA 1VQNN 3WXIA 2F7TA 4FSVA 3MCAB 4H5RA 5AQFA 2P9UB 3O9RA 2IVOA 3H3NO 2BUPA 5AQTA 1WUAA 3CD6N 3CIPA 3SMSA 1BUPA 3E66A 2KLAA 5C10A 3LL3A 3H45C 2GX9A 5AQGA 3ZYYX 1QHAA 4H0OA 2CGLA 5ADXA 5JVGL 5GINA 3MN9A 1ATRA 3DXKB 3FR0A 3CPEA 4QS9A 4BVOA 3CJAA 3O5BA 4LC9B 2E2NA 5CHIA 3D2FA 4JAXA 1NMDA 2VGMA 3SK3A 4A61A 3SAGA 4B9QA 1HLUA 1ZXOA 3MCPA 4CI6A 1VQMN 4B1ZA 5AZJA 2E2QA 5LY3A 1DGKN 4B1VA 5C2DA 3P39A 1YJWN 3O6WA 4FWLA 2UYTA 1KAXA 2Q0RA 4M7XA 2HOEA 1E4GT 4BC5A 4RWTA 2QM1A 3IUCA 4BGBA 2YHYA 3UE5A 2W40A 3WXJA 4I6MB 3M1FA 4KH5A 1NM1A 4JKGA 5AQMA 3U9DA 2HBKA 3HM8A 3L4QA 2PAVA 1T6DA 4IEEA 3MDQA 2A6AA 5AZIA 2QA4N 4BROA 3KK7A 1KQSM 4XH1A 2QWPA 5AQPA 3VMFB 2E1YA 5ELZA 1OVYA 3CF5L 4JHDB 4IDHA 2P9IA 4A2AA 3I55N 1P90A 1ILYA 1GLCG 1WOQA 1X3NA 3JXUA 5BRFA 2E8AA 4GV6A 5B8HA 3VESA 3VGKA 2RHKA 4CZEA 1HUXA 2D1KA 3KWIA 5JICA 1NGBA 3DJCA 1JCEA 4M63C 2VGNA 5DM7L 1W2BM 4HWIA 4IWVA 2DPNA 3R8EA 2Q97A 1D4XA 3J7ZO 3T69A 4IOAL 1OKJA 1S72N 1G99A 4BR0A 5AQHA 4BR4A 4G9ZA 5E84A 1NGHA 2D0PA 1VQ5N 2YHXA 2NRZA 1KD1O 2I7NA 1N8RO 4MDAA 4WCEL 2ASPA 3D2FB 3LM9A 3F9MA 4CZKA 2ASOA 3P31A 5GIOA 5FPMA 5EY4A 2VWBA 4XH4A 4YOVA 5AZJB 1KAYA 4FWPA 3ATUA 4BRDA 2KKZA 2E1ZA 2WBNA 2BTFA 3CC2N 3EE9A 2GTDA 2HBJA 5BREA 1TUUA 5DM6L 2WUSA 4H5WA 1VQ7N 2J4RA 3C0BA 1NJIO 2HF4A 3A5OC 3OA9A 2NRHA 4A2BA 1HKCA 3CCSN 5AQVA 2Q31A 3I33A 3QBWA 2NRVA 3P38A 2GWKA 1YAGA 4KBOA 1JCFA 3SLCA 4DQ8A 2P9SA 5AZIB 3A8YA 2A41A 4BRCA 4CJ7A 1BU6O 3M3ZA 3M5RA 3TTDA 4AF1A 1HJOA 4C1NI 2A42A 2HMPA 3E1YA 3VTHA 3AAPA 2YI1A 3M6GA 2P9IB 1NBWA 1SZ2A 1KAZA 3FZKA 3H6EA 2F9WA 4IOCL 1ATSA 1GLAG 4FWRA 3UKRA 4JKDA 1LCUA 1V4TA 2HSTA 2JWKA 4A5AA 1NGJA 4C23A 3A5MC 1NLVA 2A40A 1U2VA 2CH6A 3S41A 3WXMB 4BRNA 3HTVA 3TTCA 5C12A 4BG8A 1NGEA 4BC2A 3OHRA 4K42A 1H1VA 1IJJA 1NGFA 3CQYA 5EVZA 3OBWA 3TSQA 3C7NA 4BRHA 3CCUN 3T7ZA 1YUWA 3ENBA 4BC3A 2Q0UA 4B1WB 3RSEB 4CZLA 3CCEN 2VCPA 3VTIA 2AA4A 4GV9A 3FZHA 4JNEA 5JMVA 3QFUA 1Q82O 3ID6A 2E2PA 2Q2RA 4WQ5C 5KQDA 4BRKA 2YHWA 1JJ2M 5FPNA 5AR0A 1M1KO 4EHTA 4O8KA 1HKGA 2QWRA 3CCLN 4B1YB 4BRMA 1M90O 4JEPA 4E1JA 5KPZA 4GNIA 3E9PA 3LDQA 4K25A 3SAHA 4YDUC 5EXWA 3ZEUA 1K8KA 4B1XB 2QXLA 2BH1A 2OANA 4ISGA 4BRAA 3FZFA 3MWPA 1K9MO 3QDKA 3SBTA 3LM2A 3CCMN 2P9KB 4PKHA 4MLHA 3CC4N 3AARA 4A5BA 3SAFA 1K73O 5JLFA 3ZX0A 3CXCM 1NGIA 3CPWM 2QEXN 5TKYA 1BO5O 4MO5A 3I8BA 4WF9L 3O1WA 4UY8O 2PFUA 3GG4A 2QI2A 3ZX3A 2QW9A 2YJFA 3DXMA 4BR2A 2CGKA 4CZMA 4H0XB 5LJWA 1MWMA 3O9TA 1VQ6N 2P9LB 1Q7YO 2D4WA 3W0LA 5GAGP 1MWKA 3GL1A 4IFEA 1BG3A 3CMAN 4DB3A 3K9JA 1BWFO 3D2EA 1JCGA 3CHWA 1O13A 1RDWX 3UKUB 3AAQA 2V7ZA 3CJ1A 5ADXH 3MWTA 3F2KA 3LDOA 2V52B 5M1NA 1GLLO 5MLCQ 4H03B 1DT9A 3WEEA 4Z94A 3CCVN 3TSUA 5CE3A 4DCHA 4WFNL 4JKAA 1GLJO 3EZWA 5GAEP 5BR9A 2FSNA 2NLXA 3H1QA 3IFRA 3OW2M 3WQUA 5BPMA 4KH6A 1QZ6A 2ZWHA 1TUYA 3L0QA 4JKFA 3JS6A 4CZIA 3CJBA 3BUZB 3MX2A 2RE2A 1J6ZA 3QB0A 4WQ5A 3ZEUB 2ITMA 2GUPA 4YORA 1BOTO 3CCRN 3VENA 1GLFO 1T3VA 3VOVA 4BGAA 5AQLA 1LOTB 2ZJQL 2QTDA 1HX1A 1YI2N 5FPEA 4YDUA 4PKGA 4BVPA 2CGJA 3HBTA 4H5TA 2IIRA 3HZ6A 4C1NK 3C6AA 3MMVA 2E20A 3AGRA 4CBWA 2ZJRL 4FWNA 3ZX2A 4YOUA 3C65A 1E4FT 4B1UB 1KXPA 3VETA 1C0GA 3O08A 5F0XA 3G71N 1TYQA 1W97L 3QICA 4XH5A 1Z6RA 3DAWA 5BN9A 4IEIA 1P8ZA 3N4PA 4EIAA 1Q86O 4FO0A 2W41A 3FFKB 1XQSC 5CR4A 5M1OA 3O9UA 3SMPA 1Q18A 1Q81O 2IVNA 3HRGA 2WFBA 3ULEB 4WFAL 4PKIA 2EWSA 3NVKA 2QWLA 4MO4A 3CCQN 4JKGB 1YJNN 5AQOA 1C0FA 1VAZA 3LDPA 4FWQA 2NNWA 5AQYA 4BC4A 4H0YB 3U9ZA 4O8UA 4BR5A 1DKGD 3TU5A 4U67L 5BRDA 4FWSA 4XEIA 3L6QA 4H0PA 2V51B 4K41A 3ULEA 4JKHA 2NRTA 3O9SA 1U6ZA 4JK7A 3FGUA 5GAHP 4NO7A 4BR9A 4CZHA 2H3GX 4EHUA 3ENHA 1RGIA 4A59A 3B8AX 3IMXA 3E9LA 5AQXA 4JK9A 4QS7A 5AQKA 3AY9A 5M1PA 2FXUA 1QQOA 2ASMA 2NRWA 2P9PA 2NRRA 1GLBG 1YJ9N 3MX5A 2OTLN 3FZLA 1MA9B 4FWOA 5AQQA 3IDHA 4IZ9A 4CBXA 1K8AO 1S22A 3P4IA 3MN6A 3E9OA 4HTLA 3VEZA 3GE1A 5C2FA 4MDBA 3VEXA 4J8FA 4DKWA 3DXKA 3WQTA 1RDUA 5C15A 4M7YA 1VQPN 4KH4A 3H1VX 1X9JA 2GWJA 1ZC6A 3K9KA 3Q7BA 1SS6A 1VQON 3WXLA 3CC7N 4FPAA 3EKSA 1VQ4N 4R79A 5M1FA 3HOSA 3A5NC 3KVGA 2QWMA 4CD3A 4JKEA 3GOIA 5AFUA 1R59O 2D0OA 3F5TA 2HBLA 4EFHA 1EO1A 2P9SB 3H3OB 4BRPA 4EAHD 1IG8A 3D7EO 2P9NA 1ATNA 1DEJA 4FWKA 3BF3A 2FSJA 3CCJN 4CZGA 5AQJA 4CD1A 5AQUA 4A62A 4H0VB 3AGKA 4RCHA 3FE1A 4IOXA 4ILJA 3VEWA 4H5VA 1ESVA 3A5LC 3UKRB 5AQSA 3GDQA 1GLEG 2V7YA 1XUPO 4K43A 4AM6A 3EKUA 4H5NA 3VF2A 1VQ8N 1HPMA 1U2VB 2A5XA 3R1XA 3TPQA 5I9EB 5KQ8A 3CJ7A 3TSPA 1BA1A 5GADP 5EX5A 4Y0WA 4CBUA 3DWLA 3BEXA 3ZETA 4NLCA 4FVUA 4OPHA 3C7NB 2ZF5O 3R6MA 3KZBA 3VF4A 3L4IA 4BRIA 5BPNA 1X3MA 4BQLA 2PBDA 5F2RA 1QVGM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P31 A;  3O9S A;  3O9T A;  3O9Q A;  3P39 A;  3KWG A;  2RHK A;  2KKZ A;  4OPA A;  3EE9 A;  3D6R A;  3O9U A;  3KWI A;  3OA9 A;  3O9R A;  3F5T A;  3P38 A;  3L4Q A;  4OPH A;  3M5R A;  2GX9 A;  3EE8 A;  3RVC A; 
#chains in the Genus database with same CATH topology
 4KB1 A;  1QTM A;  3ZT2 A;  3HXM A;  1RT3 A;  4YOW A;  1Q9Y A;  4Z0U A;  5JVH L;  2NRX A;  3SBG A;  4FWM A;  1K8K B;  3MK6 A;  4KHQ A;  3ASM A;  3WNG A;  1EP4 A;  2QK9 A;  3LDS A;  5IWA K;  3J8A A;  1QSY A;  4BRQ A;  1NJY A;  4QCL A;  2P9N B;  2AJQ A;  1RBT A;  3G25 A;  4JI7 K;  4CEB A;  4YOX A;  3RMC A;  2Z1H A;  3VQ6 A;  3DXM B;  3VF6 A;  3EN9 A;  4BRF A;  3CJC A;  3LAL A;  4CJT A;  4FJK A;  1C0M A;  2CH5 A;  1SQK A;  3QBX A;  5HRN A;  3R3L A;  2E2O A;  2QWN A;  3FLC O;  1RFQ A;  3CM5 A;  4NLB A;  2E88 A;  3VGL A;  2P5G A;  1C1C A;  1S1U A;  1SAZ A;  2YHA A;  4FOE A;  5KPT A;  1NJZ A;  3R9P A;  1YT3 A;  5GIP A;  4I2P A;  2WC9 A;  1WB9 A;  4I2Q A;  1VQK N;  1NK6 A;  4GV3 A;  3THY A;  4ILG B;  5BRH A;  1YVN A;  2FSK A;  3O4W A;  1YHQ N;  3SJH A;  3AVF A;  2YX6 A;  1HJR A;  5AQZ A;  2IVP A;  2VYP A;  3ATV A;  3WNF A;  1VSJ A;  4NCB A;  3MXM A;  4CEA A;  5M1K A;  3Q7C A;  1NOZ A;  2B5J A;  1VSE A;  4W5T A;  4FLV A;  1YIT N;  3WUH A;  1T44 A;  3DYA A;  4CCH A;  4JK8 A;  4E7I A;  4J2B A;  3AO3 A;  4F9O A;  3ID8 A;  3V9X A;  3K5N A;  2D0B A;  5CZ1 A;  4BRG A;  3S3N A;  1YXQ A;  5E26 A;  4JD2 B;  3UKU A;  3JAM O;  3CER A;  3U4L A;  1XC3 A;  4FM1 A;  4CVN E;  4QAG A;  3SV4 A;  2BE2 A;  5H1S Q;  2UUC K;  1NGG A;  3QET A;  1XI1 A;  4DV3 K;  1BQM A;  4DF4 A;  1U04 A;  3QML A;  4NB4 A;  4JI4 K;  1IV0 A;  3NMU A;  5AQI A;  1VSH A;  2GV9 A;  4E7J A;  3KJV A;  1TKZ A;  3H46 O;  4GKJ K;  1S6P A;  2HVH A;  3LZJ A;  4BE0 A;  5HBM A;  1BIS A;  1HR0 K;  2FBT A;  5AQT A;  4C8K A;  1WUA A;  2BDP A;  2O8B A;  3LL3 A;  1A5W A;  4OGE A;  3SNN A;  2OCE A;  2A1R A;  5GIN A;  4LF6 K;  3O5B A;  4LC9 B;  1NMD A;  2VGM A;  4B9Q A;  2VQF K;  5LY3 A;  1DGK N;  1R0A A;  3P39 A;  2UYT A;  1E4G T;  3KD1 E;  3HK2 A;  4GKK K;  3WXJ A;  2W40 A;  1NM1 A;  4JKG A;  3TAE A;  2HBK A;  1T6D A;  4GW6 A;  4DUZ K;  3MDQ A;  2A6A A;  3T19 A;  4K8Z A;  4CF8 A;  3AVM A;  5ELZ A;  1HYZ A;  4JHD B;  1TAU A;  4JV5 K;  1WOQ A;  2E8A A;  1XNR K;  4B9T A;  4M63 C;  2ITG A;  4M3W A;  2Q97 A;  4LH4 A;  1D4X A;  3J7Z O;  4IOA L;  1OKJ A;  4TSX A;  4N41 A;  3ZLJ A;  4JRP A;  4HHT A;  4JI0 K;  1SUQ A;  3V6D A;  4BDZ A;  3BZC A;  1YTA A;  4CGI A;  3ZSV A;  1VQ5 N;  2YHX A;  3OYN A;  2KZZ A;  2F8T A;  3RR7 A;  3D2F B;  2ASO A;  4ID1 A;  4EZ6 A;  2RN2 A;  1IKW A;  5FPM A;  1KAY A;  4BRD A;  2E1Z A;  2BTF A;  3EE9 A;  3SYZ A;  2BAN A;  3CQ8 A;  1OH8 A;  4FLT A;  3C0B A;  4DR5 K;  4A2B A;  2Q31 A;  3I33 A;  3AVC A;  2NRV A;  2GWK A;  1YAG A;  1JCF A;  1KCF A;  3A8Y A;  2A41 A;  3M3Z A;  5HP1 A;  2HMP A;  4DLG A;  3TAG A;  3AAP A;  1LW0 A;  4NCA A;  4R5P A;  1JLE A;  3FZK A;  4EP5 A;  1TK0 A;  1ATS A;  4CF1 A;  3LPT A;  1LCU A;  2HST A;  5LL6 Z;  2KTQ A;  1NGJ A;  3OYM A;  1NLV A;  2CH6 A;  3AV9 A;  3TTC A;  3F73 A;  4RW8 A;  3OS2 A;  1LWE A;  3OHR A;  1H1V A;  5EVZ A;  4FLW A;  3QEV A;  3OBW A;  3C7N A;  3T7Z A;  4BC3 A;  4B1W B;  3HL8 A;  5CZ2 A;  2B6A A;  3SV3 A;  3VTI A;  4DQS A;  3QFU A;  1VSD A;  1BGX T;  1RNH A;  3NGZ A;  4KKO A;  1ASU A;  1RCH A;  1C1A A;  4EHT A;  4DTU A;  2QWR A;  4CEZ A;  4E1J A;  4EP4 A;  4Z4F A;  3LDQ A;  2QKK A;  1WSE A;  1JLF A;  5EXW A;  1K8K A;  3V9Z A;  2QXL A;  1FKO A;  4WE1 A;  3MWP A;  3QDK A;  3CCM N;  3OYD A;  4MLH A;  3SAF A;  2G8F A;  4CJ5 A;  5JLF A;  3ZX0 A;  4Z4E A;  4GMJ B;  4CEQ A;  3ZSW A;  5J1E A;  1K6Y A;  4MO5 A;  4UY8 O;  4LD0 A;  3DXM A;  2CGK A;  4LFA K;  3KK1 A;  2P9L B;  1Q7Y O;  1X9M A;  3RR8 A;  5GAG P;  2PYJ A;  1YVU A;  3GL1 A;  1BG3 A;  4E7K A;  1O13 A;  5ADX H;  3LDO A;  2YHB A;  4H03 B;  3CCV N;  3V81 A;  2F8S A;  3THV A;  3EZW A;  1U4B A;  1HYV A;  4FZY A;  3H1Q A;  3WQU A;  5BPM A;  1QZ6 A;  2ZWH A;  1W9H A;  4JKF A;  3JS6 A;  3CJB A;  3BUZ B;  3MX2 A;  2RE2 A;  3HVR A;  2ITM A;  2GUP A;  4YOR A;  5J2N A;  4UQG A;  3VEN A;  4CJR A;  2XY5 A;  1SL2 A;  5AQL A;  4CW7 B;  1HX1 A;  3OYA A;  5HRS A;  4J2D A;  3VN5 A;  3MMV A;  3ZT3 A;  3ZX2 A;  4CK3 A;  1IG9 A;  3LWL A;  4B8C A;  5BN9 A;  1Z6R A;  1XHZ A;  1JXE A;  1Q86 O;  1D9F A;  4M3Y A;  2HNY A;  1I39 A;  2WFB A;  3NVK A;  1DLO A;  4Y1C A;  1VAZ A;  2NNW A;  4BR5 A;  1DKG D;  1KFD A;  4XEI A;  3AO2 A;  1RT7 A;  3LP2 A;  2V51 B;  4K41 A;  3CFO A;  1EET A;  1N6Q A;  1KLN A;  1HNW K;  1U6Z A;  4O0J A;  3M8S A;  5AQX A;  5M1P A;  4QOZ B;  1QQO A;  2ASM A;  2X74 A;  4FJ8 A;  1EKE A;  2HHV A;  3IDH A;  4B3O A;  4BWJ A;  4CBX A;  4KTQ A;  1S22 A;  4C8M A;  3MN6 A;  4HTL A;  2D0C A;  3GE1 A;  5C2F A;  4MDB A;  3VEX A;  2VQE K;  4E7H A;  3I8D A;  4DSI A;  1VSF A;  3PSI A;  2RKI A;  1VQO N;  4E89 A;  3RTV A;  4FYD A;  5M1F A;  4LF5 K;  1EO1 A;  4JKE A;  3F5T A;  3MXI A;  2VG6 A;  4L8R B;  1MU2 A;  4FWK A;  1VRT A;  3QER A;  4CD1 A;  5AQU A;  5FLX O;  4H0V B;  3AGK A;  4RCH A;  2PYL A;  1ESV A;  2GBZ A;  3A5L C;  3WNE A;  3EKU A;  3AVL A;  1HPM A;  2A5X A;  3CJ7 A;  5J2P A;  3ZET A;  4NLC A;  5C42 A;  3SJJ A;  4FVU A;  1JLC A;  3VQ8 A;  2ZF5 O;  3R6M A;  3KZB A;  4AQY K;  3O3G A;  3L4I A;  4BRI A;  4CHP A;  2KW4 A;  5BPN A;  1X3M A;  1REV A;  2E4L A;  2RF2 A;  3HSC A;  1X9S A;  4PY5 A;  4JN4 A;  1RBR A;  3A0I X;  2A1S A;  4BRE A;  1D9D A;  2RPI A;  2G8H A;  4ILH A;  3NF6 A;  3EL2 A;  5EOY A;  3TTF A;  3VQ4 A;  4OLA A;  3G4S N;  2IDO A;  4PWD A;  1WSG A;  3VQE A;  4CJL A;  5CY4 A;  4B9U A;  3LWM A;  3OYC A;  2DTU A;  1EWR A;  3MN7 A;  1LWF A;  4M3Z A;  4O44 A;  5DK5 A;  1TKT A;  3KHY A;  1RT4 A;  3KWG A;  3VGM A;  4BQZ A;  4WQ4 C;  4JS5 A;  1WLJ A;  3P1G A;  4N76 A;  4DTS A;  3HST B;  3N4Q A;  1J5E K;  3IKM A;  3CI5 A;  1B9D A;  4JI3 K;  3WEE B;  4M41 A;  2ZGZ A;  4K0K K;  4K8X A;  3K0S A;  4FK0 A;  4ISE A;  1KTQ A;  2VWK A;  4PL7 A;  3OYF A;  4CJV A;  3THX B;  4O5F A;  1SL0 A;  5T7B A;  3VER A;  3DLR A;  4DTR A;  5HRO A;  4DU3 A;  4FJJ A;  5BPL A;  3PIP L;  3OS0 A;  4L3Q A;  2OZS A;  1IKY A;  3QNO A;  3CME N;  2KHO A;  3D0P A;  4ISF A;  2QWQ A;  3C94 A;  3NFA A;  3VPZ A;  4FPB A;  4A57 A;  3CQX A;  3DOL A;  1EQY A;  3DRR A;  4GVE A;  1VHX A;  1CZA N;  2Y1J A;  4LH5 A;  4KAZ A;  4DTN A;  1NGA A;  2XO7 A;  5I3U A;  2OPS A;  4DFJ A;  2P9L A;  3EO3 A;  4FW2 A;  3D45 A;  3MXJ A;  2HHQ A;  5FPD A;  5BN8 A;  3QEI A;  5AQW A;  1VSM A;  2HBM A;  3UIQ A;  4DR6 K;  4B3M K;  4WQ4 A;  4IXC A;  4AM7 A;  3HT3 A;  4F3O A;  5HOO A;  4CZJ A;  1NK7 A;  3TAQ A;  3NH2 A;  4YOY A;  3EE8 A;  2ZGY A;  2IS3 A;  4DTM A;  2ZD1 A;  3I56 N;  1HYS A;  4JKB A;  4LSN A;  5AFU H;  4ZHR A;  1KLM A;  4IG0 A;  4GY2 B;  2P5O A;  1QZ5 A;  4F2R A;  1V4S A;  2QWO A;  2P9P B;  3WXI A;  3SUO A;  3MCA B;  4H5R A;  5AQF A;  2P9U B;  1UA1 A;  4KHP K;  3H3N O;  4RW4 A;  1G15 A;  1SKW A;  3SMS A;  4KV8 A;  3E66 A;  2KLA A;  2P51 A;  3H45 C;  4DV4 K;  1HNZ K;  4FLZ A;  4FJI A;  3MN9 A;  1FKP A;  4QS9 A;  3CJA A;  5CHI A;  3NDK A;  4B9S A;  3MCP A;  4B1Z A;  5AZJ A;  1YJW N;  3T1A A;  1U49 A;  2W6L A;  1KAX A;  1J53 A;  2YKN A;  2QM1 A;  3IUC A;  1ASW A;  4BGB A;  2YHY A;  1KFS A;  4GVM A;  4I6M B;  5AQM A;  3HM8 A;  4DSK A;  2HHW A;  3FFI A;  4DTP A;  2OZM A;  4OVL A;  1Q9X A;  4CHQ A;  2QWP A;  3VMF B;  2P9I A;  4A2A A;  3HVT A;  1P90 A;  4KRF A;  3HP6 A;  1VSL A;  1X3N A;  3VES A;  2O8E A;  2RHK A;  3JSM A;  3VQD A;  2VG5 A;  1HUX A;  2D1K A;  1NGB A;  1JCE A;  2VGN A;  3R8E A;  1NG9 A;  3T69 A;  3HP9 A;  4JYA K;  3G10 A;  4DMN A;  4RW6 A;  4ZTF A;  4BR0 A;  5AQH A;  1DTT A;  2D0P A;  2EX3 A;  1KD1 O;  3B6O A;  2ASP A;  4M3R A;  4WCE L;  3F9M A;  4DQQ A;  3P31 A;  1LAW A;  2IGI A;  1TGO A;  1N33 K;  4IDK A;  1BCM A;  4DU1 A;  2WBN A;  2HBJ A;  5BRE A;  5DM6 L;  4HCC A;  1VQ7 N;  4CJP A;  2X6S A;  2HF4 A;  3A5O C;  1XMQ K;  2NRH A;  5AQV A;  1NK4 A;  4HCB A;  1QHT A;  1NKB A;  4KBO A;  3SLC A;  3RWU A;  5AZI B;  3KLI A;  4CJ7 A;  3TTD A;  5FRN A;  1NKE A;  1RTJ A;  3CFP A;  3E1Y A;  4LFB K;  1SZ2 A;  1B92 A;  4KHS A;  4IOC L;  1BL3 A;  3PO4 A;  2D5R A;  4FWR A;  4JKD A;  2JWK A;  3CFR A;  3IS9 A;  4Z4G A;  3OYJ A;  2A40 A;  2OYQ A;  3S41 A;  3CM6 A;  4BRN A;  4M3U A;  4BG8 A;  4BC2 A;  2FBX A;  4K42 A;  3HPO A;  3CCU N;  3CQY A;  4BRH A;  3IG1 A;  1WN7 A;  3RSE B;  4CZL A;  4FZX C;  4FJN A;  3FZH A;  4JNE A;  1Q82 O;  1RDA A;  2Q2R A;  4CEC A;  3KK3 A;  2DFH A;  4BRK A;  4MFB A;  5HRP A;  4FJ9 A;  3K5M A;  4B1Y B;  4GNI A;  3SAH A;  2Q3S A;  4YDU C;  3ZEU A;  4ISG A;  2OAN A;  1A5X A;  3SBT A;  1HNI A;  3OVN A;  3SI6 A;  3TAP A;  1QE1 A;  2P9K B;  3SPZ A;  4CGJ A;  3AAR A;  2OPR A;  3MAQ A;  1NGI A;  5IT9 O;  3DRP A;  4B9L A;  3VQ5 A;  5BR8 K;  4WF9 L;  1UOC A;  2QI2 A;  4BR2 A;  5C24 A;  4CZM A;  5LJW A;  2UXB K;  2XY7 A;  4ID5 A;  3W0L A;  1ZBU A;  1MWK A;  4DB3 A;  3ULE A;  1RDW X;  3K2P A;  3CJ1 A;  2V7Z A;  3MWT A;  5M1N A;  1GLL O;  1NJX A;  3OYG A;  3WEE A;  3L2U A;  1UWB A;  3U3Y A;  1S1T A;  1FXX A;  4C8N A;  4DCH A;  1VSI A;  4WFN L;  1GLJ O;  5GAE P;  5BR9 A;  2NLX A;  3DMJ A;  3THX A;  3QIO A;  3RMA A;  3V4I A;  4O0I A;  3NGI A;  3L8B A;  3I0R A;  3BDP A;  2Z1J A;  4FJ7 A;  3NH0 A;  3QB0 A;  2OPQ A;  5KGX A;  3OS1 A;  4CF0 A;  1FJG K;  3J7A P;  2HNZ A;  4YDU A;  3KIO A;  2E20 A;  1KRP A;  4ELV A;  1E4F T;  4B1U B;  1TL1 A;  3VET A;  5F0X A;  3OY9 A;  3QIC A;  5HLF A;  2W41 A;  3FFK B;  1XQS C;  5CR4 A;  1EWQ A;  3SMP A;  2IVN A;  1C6V A;  2EWS A;  2QWL A;  4MO4 A;  3CCQ N;  5AQO A;  1X9W A;  1WSH A;  3LDP A;  4BC4 A;  2FBY A;  2KFN A;  3MED A;  4FWS A;  2Z1G A;  4DFP A;  4F4K A;  3EEQ A;  2XRI A;  4FK2 A;  4KB0 A;  3C95 A;  1C0T A;  3O9S A;  4FJ5 A;  4CJW A;  1BHL A;  3VQQ A;  5C25 A;  1ZBH A;  4NO7 A;  2PY5 A;  2WON A;  4CZH A;  2H3G X;  3ENH A;  1RGI A;  1WSI A;  1BIU A;  2P9P A;  3ITH A;  2NRW A;  2NRR A;  3G0Z A;  4CJS A;  5KI6 A;  1YJ9 N;  3MX5 A;  2OTL N;  4FWO A;  2HHT A;  5AQQ A;  4IZ9 A;  4FVM A;  4RW9 A;  1K8A O;  3P4I A;  2UUB K;  3VEZ A;  4DU4 A;  1SKR A;  4J8F A;  4LF4 K;  1RDU A;  4M7Y A;  4EZ9 A;  4CIE A;  3J80 O;  3KTQ A;  3P5J A;  1C1B A;  3WXL A;  1TKD A;  1I94 K;  4DSF A;  1S9E A;  3EKS A;  3K5O A;  4DTO A;  4R79 A;  4CJ4 A;  3KVG A;  2QWM A;  3EYZ A;  2D0O A;  2P9S B;  4EAH D;  2P9N A;  1DEJ A;  3L2R A;  5FDL A;  3LP0 A;  4DR1 K;  4DV2 K;  2F4V K;  3DLB A;  4ILJ A;  4CHY A;  3GDQ A;  4AM6 A;  5J2Q A;  2HHX A;  3RMB A;  1VQ8 N;  5D3G A;  4JI1 K;  2O4I A;  1U2V B;  5I9E B;  5KQ8 A;  5KRS A;  4LF8 K;  3KK2 A;  3SZ2 A;  4CBU A;  4FLX A;  2DY4 A;  2QXF A;  4OPH A;  4CIG A;  1NK8 A;  3VF4 A;  1NWK A;  3MN5 A;  4IJN A;  2P1J A;  2HHS A;  3ZSX A;  4V19 S;  3RMD A;  2X6N A;  3OYE A;  2HF3 A;  3D6R A;  4KTZ A;  2FC0 A;  1KC8 O;  5CYQ A;  1VQ9 N;  1FK9 A;  4FJH A;  3M8R A;  1N34 K;  5AQN A;  4AHV A;  4KRE A;  3OJU A;  3O8M A;  4PL8 A;  1S6Q A;  4DV7 K;  1L3S A;  4PQU A;  4IJA A;  1YTU A;  3RVC A;  3VQP A;  3LDL A;  1JL1 A;  3VEV A;  4FL9 A;  3AVG A;  5KPR A;  2HW3 A;  2FLO A;  4B9V A;  3BF1 A;  1YF5 L;  4H0T B;  1NK9 A;  3HYF A;  1IBM K;  4JD2 A;  3QIN A;  3AO1 A;  3HPG A;  4FJG A;  3KLG A;  4FLU A;  2FF6 A;  3CJ9 A;  4QS8 A;  3BZK A;  3U3G A;  3RSE A;  1WBD A;  2YNH A;  4IFV A;  3B6P A;  3VA3 A;  1ZBS A;  4CJ3 A;  5LJV A;  3JYT A;  1NKC A;  4BY9 C;  3PIO L;  3L3U A;  3AVB A;  3OYH A;  3PX4 A;  4DHY A;  3S3O A;  4BR7 A;  4AH9 A;  3VQC A;  2YKM A;  3O3H A;  1Y64 A;  4KTW A;  4HUE A;  1VK0 A;  4RG8 A;  5M1Q A;  2GUI A;  3NF9 A;  2P9K A;  1HMV A;  3C6T A;  4DR4 K;  4DQR A;  3DI6 A;  2ZJP L;  2E6M A;  3ISN C;  4RTF D;  4U7B A;  3P83 D;  1BA0 A;  1HKB A;  3G6E N;  3BP8 A;  4KHY A;  4BE1 A;  1TYQ B;  1T6C A;  3O9Q A;  2F9T A;  1ZYQ A;  4G1Q A;  4WYB A;  3PLA A;  2FF3 B;  5HL7 L;  4FJX A;  3OBY A;  4FOI A;  4DWI A;  3VQ7 A;  4CGG A;  1BDG A;  3NE6 A;  4N47 A;  2O4G A;  4AHS A;  4DV6 K;  3W3D A;  4JHD A;  1RTD A;  1IO2 A;  3U8X A;  4AHC A;  4YNQ A;  3NVM A;  4AHR A;  2OTJ N;  2D0A A;  2YCH A;  1WSF A;  4CZF A;  3QIP A;  4H4O A;  2A3Z A;  4FLY A;  4FSV A;  3O9R A;  4CJF A;  3CD6 N;  1BUP A;  4CHO A;  3LZI A;  3MEG A;  4H0O A;  2PZS A;  2CGL A;  5JVG L;  1K73 O;  3DXK B;  3FR0 A;  3CPE A;  4BVO A;  1VQP N;  2E2N A;  3D2F A;  3SAG A;  1LW2 A;  1JLB A;  1HLU A;  1ZXO A;  4KO0 A;  1VQM N;  4RW7 A;  2E2Q A;  5C2D A;  3O6W A;  4M3T A;  4M7X A;  2UU9 K;  1CXU A;  4FW1 A;  1UAX A;  3UE5 A;  3RRG A;  3U9D A;  3M1F A;  4KH5 A;  4ICL A;  1OH5 A;  5SZT A;  1XMO K;  2QA4 N;  4BRO A;  3KK7 A;  1IH7 A;  4XH1 A;  1KQS M;  3QNN A;  3CF5 L;  2IAJ A;  4DSL A;  3I55 N;  3JXU A;  1HQE A;  4X64 K;  1T8E A;  2HHH K;  2Z1I A;  3KWI A;  5JIC A;  3DJC A;  1TK5 A;  2EHG A;  4HWI A;  2X78 A;  2DPN A;  4BR4 A;  3KD5 E;  4G9Z A;  2I7N A;  1N8R O;  4N5S A;  4CZK A;  4JLH A;  2VWB A;  4CFA A;  4YOV A;  4E3S A;  1S1W A;  3V1O A;  5I42 A;  1EXQ A;  2KKZ A;  3EZ5 A;  2Y1I A;  1L3V A;  2GTD A;  4NYF A;  4CJE A;  1TUU A;  4LSL A;  4H5W A;  2J4R A;  3QEX A;  3OA9 A;  3CCS N;  1HKC A;  5AJ3 K;  1NOY A;  3LP1 A;  3QBW A;  1VSK A;  4DTJ A;  2P9S A;  4E1M A;  3TAR A;  2E6L A;  3M5R A;  1HJO A;  4C1N I;  4NCG A;  4DR3 K;  1BI4 B;  1NBW A;  1NMN A;  3KKS A;  2F9W A;  1GLA G;  4CF9 A;  1J54 A;  1C0U A;  4A5A A;  1U2V A;  4B3S K;  3WXM B;  2G8V A;  4FJL A;  3HTV A;  1ZBF A;  1NGE A;  1NGF A;  1IJJ A;  3TSQ A;  4CFB A;  3S3M A;  4X65 K;  4DR2 K;  2VCP A;  4W5O A;  4DFK A;  1KSP A;  4GV9 A;  5A2Q O;  1D5A A;  3ID6 A;  4OKJ A;  2E2P A;  4WQ5 C;  1HNX K;  4FK4 A;  2YNI A;  3AVH A;  4CK1 A;  1JJ2 M;  2YHW A;  5FPN A;  5AR0 A;  1M1K O;  4M3X A;  3T1Y K;  3CCL N;  4DF8 A;  4BRM A;  1M90 O;  4JEP A;  5JS2 A;  3E9P A;  4K25 A;  2B4J A;  1KVB A;  3OTO K;  4JRQ A;  2BH1 A;  3FZF A;  1K9M O;  1NJW A;  3LM2 A;  4B8A B;  4PKH A;  3BY5 A;  3TI0 A;  3CC4 N;  3ZSR A;  4A5B A;  4B9N A;  4LF7 K;  4F3T A;  1JLG A;  1WSJ A;  2ZQB A;  2W42 A;  3CPW M;  3SQ2 A;  3LP3 A;  4ELT A;  3O1W A;  5LMN K;  2PFU A;  4Q0B A;  2YJF A;  4H0X B;  2UXD K;  1VQ6 N;  1TVR A;  2D4W A;  2R7Y A;  1WNS A;  3CMA N;  1WBB A;  3K9J A;  1F21 A;  3CHW A;  3SUN A;  3SQ0 A;  3F2K A;  2V52 B;  1L3U A;  4Z4C A;  4Z94 A;  5KRT A;  3TSU A;  4YY3 K;  3CG7 A;  3VQ9 A;  4JKA A;  1T05 A;  1HQU A;  1SL1 A;  3OW2 M;  4CF2 A;  3U6F A;  4CZI A;  3L3V A;  4WQ5 A;  1S1X A;  3VQB A;  1GLF O;  3VOV A;  2BGG A;  4BGA A;  3DOK A;  2ZJQ L;  1YI2 N;  1ZBI A;  5FPE A;  4BVP A;  3HBT A;  4H5T A;  3HJF A;  2IIR A;  3HZ6 A;  2F96 A;  4MQ3 A;  3DLG A;  3AGR A;  4FWN A;  1QS4 A;  3AO5 A;  4F2S A;  3C65 A;  2VWJ A;  3OYL A;  1RBS A;  1TYQ A;  1W97 L;  3DAW A;  2HND A;  4IEI A;  4EIA A;  1EX4 A;  1OH6 A;  3O9U A;  1Q18 A;  4J2A A;  3HRG A;  4WFA L;  2G8K A;  4FM2 A;  4JI8 K;  1JKH A;  3V1Q A;  4KI6 A;  4FWQ A;  4H0Y B;  1T03 A;  3AO4 A;  1GOB A;  3TU5 A;  4U67 L;  3K57 A;  5E41 A;  3L6Q A;  4F8R A;  4H0P A;  4JKH A;  4OLB A;  5HRR A;  4HTU A;  3FGU A;  3B8A X;  3IMX A;  3E9L A;  3NH1 A;  4QS7 A;  5AQK A;  3AY9 A;  5KGW A;  2FXU A;  3TR8 A;  3ZSY A;  4JS4 A;  1N36 K;  1GLB G;  3SQ4 A;  4W5Q A;  4AHU A;  1NK5 A;  4I7F A;  4M45 A;  3E9O A;  4KHW A;  2ZE2 A;  4DKW A;  3DXK A;  3WQT A;  1LV5 A;  5C15 A;  4KH4 A;  3H1V X;  1X9J A;  4LFC K;  2GWJ A;  1E3M A;  1ZC6 A;  4FZZ A;  3Q7B A;  1SS6 A;  4XIU A;  1J5O A;  4FPA A;  1VQ4 N;  4N56 A;  3A5N C;  2KZM A;  2HVI A;  4CD3 A;  1R59 O;  4KI4 A;  2HBL A;  4CJQ A;  3TAM A;  3OYB A;  3H3O B;  4DSE A;  1W0H A;  3CCJ N;  1ZBL A;  1ATN A;  2FSJ A;  2IOC A;  4CZG A;  5CYM A;  4DTX A;  2O8D B;  3M8Q A;  3SQ1 A;  1LWC A;  4DLE A;  4IOX A;  3UKR B;  2UUA K;  2G8U A;  2QKB A;  2HHU A;  1GLE G;  2V7Y A;  1XUP O;  3VF2 A;  4H5N A;  1TL3 A;  3R1X A;  3TPQ A;  3TSP A;  2YV0 X;  1BA1 A;  1D8Y A;  3CYM A;  4X66 K;  4Y0W A;  3DWL A;  3HM9 A;  5JS1 A;  3K59 A;  3O4N A;  4BQL A;  2PBD A;  1NGD A;  5F2R A;  3HO1 A;  3ZCM A;  3SUP A;  2WOM A;  3CET A;  4OO1 J;  4FJM A;  4DR7 K;  1HPZ A;  3C6H A;  4OPA A;  4MLE A;  1Z26 A;  3QLH A;  3AVJ A;  3WXK A;  4DQI A;  4CER A;  1NK0 A;  2I7P A;  2YJE A;  4CGD A;  2JWL A;  3NAE A;  3KKR A;  1RDC A;  4E19 A;  3M8P A;  4WFB L;  4H8K A;  4W5R A;  1CLQ A;  1QVF M;  1HNV A;  1GOC A;  4DFM A;  3O80 A;  4Z4I A;  1BI4 A;  1Z05 A;  4JKC A;  1S3X A;  3HOT A;  1Z25 A;  1RIL A;  3LPU A;  3TAN A;  1N32 K;  1NU0 A;  3QES A;  2XHB A;  1VRU A;  1NGC A;  3GBT A;  3HI0 A;  1HRH A;  3UB5 A;  2DFF A;  3D2E B;  4CHZ A;  4PHT X;  3ZET B;  4KPY A;  1XHX A;  1JL2 A;  1W7A A;  1S1V A;  3VEO A;  3I0S A;  2O8C B;  4CEF A;  4E1N A;  4JI5 K;  3V9U A;  2OA8 A;  5FRO A;  4J2E A;  3DLL L;  4DV0 K;  2YNG A;  3DM2 A;  3WT0 A;  3IAY A;  4YOT A;  2Q1N A;  1RBV A;  4W5N A;  3FZM A;  3QEW A;  3O1B A;  1MDU B;  4BG9 A;  5TKW A;  5C0Y A;  3ENO A;  2YNF A;  2KQ2 A;  5F1X A;  2P9U A;  3T3F A;  1QSS A;  1FW6 A;  2GEM A;  3DRS A;  4IFY A;  1WAJ A;  3ZSZ A;  4IO8 A;  1VQL N;  4DQP A;  2NZT A;  3SPY A;  2AP1 A;  4B9M A;  1SKS A;  3QFP A;  3NF8 A;  4AHT A;  3VEY A;  1RTI A;  1RDD A;  1CXQ A;  4HUG A;  3AA4 A;  4BRL A;  4OPK A;  3TAB A;  3NHG A;  2GEL A;  3NF7 A;  4I6M A;  1RT6 A;  1YIJ N;  4IG3 A;  2Q36 A;  3ALY A;  4BWM A;  5JLH A;  1J9A A;  5J2M A;  4IO9 L;  1IKV A;  1QQN A;  3OYK A;  4E7L A;  5AQR A;  4DS5 A;  4DV5 K;  4JI2 K;  4PUO A;  1GLD G;  3ULD A;  3K58 A;  3LDN A;  2O8F B;  1QQM A;  1WAF A;  3AA5 X;  4OPJ A;  1VQN N;  2F7T A;  1RBU A;  3L2Q A;  4B08 A;  2IVO A;  2BUP A;  3CIP A;  3NBP A;  1TAQ A;  5C10 A;  3V9S A;  5EU7 A;  4CK2 A;  2GX9 A;  5AQG A;  3ZYY X;  1QHA A;  2ATQ A;  3WNH A;  5ADX A;  1ATR A;  2JGU A;  3J81 O;  3ZT4 A;  4JAX A;  3THW B;  4A61 A;  2KFZ A;  3SK3 A;  2HMI A;  4CI6 A;  4B1V A;  4KHU A;  4YHH K;  4FWL A;  2Q0R A;  2HOE A;  4BC5 A;  4RWT A;  4H4M A;  4OKK A;  3L4Q A;  2PAV A;  4IEE A;  1RDB A;  1T7P A;  5AZI A;  3DLE A;  5LMU K;  4LY7 A;  5AQP A;  1RTH A;  2E1Y A;  1RT5 A;  1OVY A;  1IBK K;  3O3F A;  4IDH A;  1ILY A;  1GLC G;  5BRF A;  4Y1D A;  4GV6 A;  5B8H A;  3VGK A;  1RT2 A;  5K14 A;  4CZE A;  5DM7 L;  4O5B A;  1W2B M;  4IWV A;  3PO5 A;  1GOA A;  1S72 N;  1RT1 A;  4LF9 K;  1G99 A;  4C8L A;  3AA3 A;  3PSF A;  5E84 A;  4FCY A;  3RRH A;  1NGH A;  3ZT1 A;  4CFC A;  2NRZ A;  2XY6 A;  3DLK A;  4MDA A;  3LM9 A;  3L2W A;  1UA0 A;  5GIO A;  5EY4 A;  4XH4 A;  4YFU A;  5AZJ B;  3AVI A;  3C6U A;  4FWP A;  3ATU A;  1OH7 A;  1IKX A;  3CC2 N;  3ZSO A;  2ZM6 K;  2WUS A;  4NXM K;  4DSJ A;  1NJI O;  4CED A;  3P38 A;  4DQ8 A;  4BRC A;  1BU6 O;  3V1R A;  4AF1 A;  2W6K A;  3V9W A;  2A42 A;  3VTH A;  4I9L A;  4KFB A;  2O8D A;  2YI1 A;  3M6G A;  2P9I B;  1KAZ A;  4IBN A;  4OJR A;  3H6E A;  3T1H K;  4NYN A;  2O8E B;  1XNQ K;  1DTQ A;  3UKR A;  1CZB A;  3VQA A;  4I9Q A;  1V4T A;  3K5L A;  4PA1 A;  1Q8I A;  4C23 A;  3A5M C;  3LAN A;  2DFE A;  2I5J A;  5C12 A;  4HUF A;  4CJK A;  1YUW A;  3ENB A;  3BGR A;  2Q0U A;  4AIL C;  3CCE N;  2LSN A;  4ZTJ A;  2AA4 A;  5JMV A;  1XWL A;  3ZSQ A;  4FM0 A;  1BCO A;  3THY B;  4CGH A;  3NGY A;  5KQD A;  3PUF A;  4Q5V A;  2G8W A;  4O8K A;  1L5U A;  1HKG A;  4DUY K;  5KPZ A;  3SUQ A;  2XY8 A;  4B1X B;  4BRA A;  1JLA A;  4CEO A;  4M42 A;  4CE9 A;  4CEE A;  3CXC M;  4OGC A;  3IRX A;  2QEX N;  5TKY A;  4BAC A;  1BO5 O;  3PV8 A;  1N5Y A;  3E01 A;  4ELU A;  3I8B A;  3GG4 A;  1XC9 A;  3ZX3 A;  1TV6 A;  2QW9 A;  1ITG A;  4BDY A;  1MWM A;  3O9T A;  3SCX A;  4IFE A;  1BWF O;  3D2E A;  1JCG A;  3UKU B;  3AAQ A;  4DV1 K;  3A2F A;  3KLF A;  5MLC Q;  3S9H A;  1DT9 A;  2O8C A;  4KHN A;  2IC3 A;  4HVJ A;  5CE3 A;  1Y97 A;  4FXD A;  4IKF A;  2FSN A;  1KVC A;  3IFR A;  4DG1 A;  4KH6 A;  3KLH A;  1TUY A;  1JLQ A;  3AA2 A;  3L0Q A;  3TWH A;  3OYI A;  1J6Z A;  4DS4 A;  3ZEU B;  3CCR N;  1BOT O;  4CGF A;  3J7Y P;  1U47 A;  4OKE A;  1T3V A;  4O4G A;  3PX0 A;  1LOT B;  3MEC A;  2NUB A;  1S5J A;  2QTD A;  4O55 A;  4JI6 K;  1U45 A;  2O8B B;  4PKG A;  2CGJ A;  4CIF A;  2UXC K;  5FRM A;  4C1N K;  1TKX A;  3C6A A;  3LAK A;  4CBW A;  3LAM A;  3O4Q A;  2ZJR L;  2HB5 A;  4YOU A;  1S9G A;  1B9F A;  1KXP A;  1L3T A;  1C0G A;  1KVA A;  3O08 A;  3MEE A;  3G71 N;  1NNE A;  4B3T K;  4XH5 A;  2G8I A;  1BIZ A;  1P8Z A;  3N4P A;  4FO0 A;  5M1O A;  3VA0 A;  1Q81 O;  3ULE B;  4PKI A;  4CJU A;  1U48 A;  2VG7 A;  4Z4H A;  1SV5 A;  4JKG B;  1YJN N;  1C0F A;  1TK8 A;  5AQY A;  1X1P A;  3U9Z A;  4O8U A;  3L2V A;  5BRD A;  3PX6 A;  1I3A A;  3TAF A;  4X62 K;  2E5L K;  3ZT0 A;  2FBV A;  2NRT A;  4JK7 A;  5GAH P;  4CFD A;  4BR9 A;  1LAV A;  4EHU A;  4A59 A;  2O8F A;  4JK9 A;  1QSL A;  1O1W A;  1BQN A;  4BDP A;  3FZL A;  1MA9 B;  3AVA A;  1A5V A;  3AVK A;  4BE2 A;  1OVQ A;  3F9K A;  4NXN K;  1QQC A;  3THW A;  1ASV A;  2ETJ A;  3K9K A;  5KTQ A;  3CC7 N;  3HOS A;  4C8O A;  2WTU A;  4B3R K;  5AFU A;  4E0D A;  3GOI A;  4EFH A;  4OX9 K;  5DMR A;  4BRP A;  1IG8 A;  3D7E O;  3BF3 A;  4CHN A;  4CES A;  5AQJ A;  3EY1 A;  4A62 A;  3KLE A;  3DLH A;  1JXB A;  3HPH A;  3FE1 A;  3VEW A;  4H5V A;  5AQS A;  4K43 A;  3QEP A;  5SWM A;  3PY8 A;  5GAD P;  5EX5 A;  1IBL K;  3BEX A;  3AVN A;  3OJS A;  3C7N B;  2OPP A;  3NCI A;  3H08 A;  1CZ9 A;  3QO9 A;  2JLE A;  1QVG M; 
#chains in the Genus database with same CATH homology
 1NWK A;  3MN5 A;  3HSC A;  4IJN A;  4JN4 A;  3CET A;  4OO1 J;  3A0I X;  4YOW A;  5JVH L;  2NRX A;  4BRE A;  3C6H A;  4OPA A;  4MLE A;  2HF3 A;  3D6R A;  3SBG A;  4FWM A;  1KC8 O;  1K8K B;  3MK6 A;  3WXK A;  1VQ9 N;  4ILH A;  3EL2 A;  2I7P A;  2YJE A;  5EOY A;  3J8A A;  3TTF A;  2JWL A;  4BRQ A;  4WFB L;  3G4S N;  1QVF M;  2P9N B;  5AQN A;  3G25 A;  3O8M A;  4PL8 A;  3O80 A;  1Z05 A;  4IJA A;  4JKC A;  1S3X A;  4YOX A;  3HOT A;  3RVC A;  3LDL A;  3MN7 A;  3VEV A;  3DXM B;  4FL9 A;  5KPR A;  2FLO A;  3VF6 A;  3EN9 A;  4BRF A;  3BF1 A;  3CJC A;  1YF5 L;  3KHY A;  4H0T B;  3KWG A;  3VGM A;  4BQZ A;  2CH5 A;  1SQK A;  1NGC A;  1NGD A;  3GBT A;  3HI0 A;  3QBX A;  4JD2 A;  3R3L A;  4WQ4 C;  2E2O A;  3UB5 A;  3D2E B;  4PHT X;  2QWN A;  3FLC O;  1RFQ A;  2FF6 A;  3N4Q A;  3ZET B;  3CJ9 A;  4NLB A;  2E88 A;  3VGL A;  3IKM A;  3CI5 A;  4QS8 A;  5KPT A;  1SAZ A;  4FOE A;  3VEO A;  3RSE A;  3WEE B;  3R9P A;  2ZGZ A;  5GIP A;  2WC9 A;  1VQK N;  4GV3 A;  4ISE A;  3DLL L;  1ZBS A;  4PL7 A;  4ILG B;  5BRH A;  5LJV A;  1YVN A;  4O5F A;  2FSK A;  3WT0 A;  3O4W A;  4YOT A;  4BY9 C;  2Q1N A;  3VER A;  3PIO L;  1YHQ N;  3FZM A;  3SJH A;  3O1B A;  1MDU B;  2YX6 A;  4BG9 A;  4DHY A;  5AQZ A;  4BR7 A;  2IVP A;  5TKW A;  5C0Y A;  1Y64 A;  5BPL A;  2VYP A;  3ATV A;  3PIP L;  3ENO A;  4L3Q A;  5M1Q A;  5F1X A;  3CME N;  2KHO A;  2P9U A;  2P9K A;  5M1K A;  3Q7C A;  4ISF A;  2QWQ A;  2ZJP L;  3VPZ A;  4FPB A;  4A57 A;  4RTF D;  2GEM A;  1YIT N;  3CQX A;  4U7B A;  3WUH A;  1T44 A;  1EQY A;  4JK8 A;  4GVE A;  1BA0 A;  4F9O A;  1HKB A;  1CZA N;  4IO8 A;  3BP8 A;  3G6E N;  1VQL N;  2NZT A;  3ID8 A;  2AP1 A;  1TYQ B;  1NGA A;  1T6C A;  4BRG A;  1YXQ A;  3O9Q A;  5E26 A;  2P9L A;  2F9T A;  3EO3 A;  4WYB A;  3QFP A;  4JD2 B;  3VEY A;  3PLA A;  2FF3 B;  5HL7 L;  5FPD A;  4BRL A;  5BN8 A;  3UKU A;  5AQW A;  2HBM A;  2GEL A;  3OBY A;  4FOI A;  4I6M A;  4WQ4 A;  1YIJ N;  4IXC A;  4AM7 A;  3CER A;  1BDG A;  2Q36 A;  3U4L A;  1XC3 A;  4CZJ A;  5HOO A;  5JLH A;  4IO9 L;  4YOY A;  3EE8 A;  5H1S Q;  1NGG A;  1QQN A;  3W3D A;  2ZGY A;  4JHD A;  3U8X A;  5AQR A;  3I56 N;  3QML A;  4NB4 A;  3NVM A;  4JKB A;  2OTJ N;  5AFU H;  2YCH A;  3NMU A;  4GY2 B;  1GLD G;  5AQI A;  3LDN A;  1QQM A;  1QZ5 A;  4CZF A;  1V4S A;  2QWO A;  3H46 O;  2P9P B;  2A3Z A;  1VQN N;  3WXI A;  2F7T A;  4FSV A;  3MCA B;  4H5R A;  5AQF A;  2P9U B;  3O9R A;  2IVO A;  3H3N O;  2BUP A;  5AQT A;  1WUA A;  3CD6 N;  3CIP A;  3SMS A;  1BUP A;  3E66 A;  2KLA A;  5C10 A;  3LL3 A;  3H45 C;  2GX9 A;  5AQG A;  3ZYY X;  1QHA A;  4H0O A;  2CGL A;  5ADX A;  5JVG L;  5GIN A;  3MN9 A;  1ATR A;  3DXK B;  3FR0 A;  3CPE A;  4QS9 A;  4BVO A;  3CJA A;  3O5B A;  4LC9 B;  2E2N A;  5CHI A;  3D2F A;  4JAX A;  1NMD A;  2VGM A;  3SK3 A;  4A61 A;  3SAG A;  4B9Q A;  1HLU A;  1ZXO A;  3MCP A;  4CI6 A;  1VQM N;  4B1Z A;  5AZJ A;  2E2Q A;  5LY3 A;  1DGK N;  4B1V A;  5C2D A;  3P39 A;  1YJW N;  3O6W A;  4FWL A;  2UYT A;  1KAX A;  2Q0R A;  4M7X A;  2HOE A;  1E4G T;  4BC5 A;  4RWT A;  2QM1 A;  3IUC A;  4BGB A;  2YHY A;  3UE5 A;  2W40 A;  3WXJ A;  4I6M B;  3M1F A;  4KH5 A;  1NM1 A;  4JKG A;  5AQM A;  3U9D A;  2HBK A;  3HM8 A;  3L4Q A;  2PAV A;  1T6D A;  4IEE A;  3MDQ A;  2A6A A;  5AZI A;  2QA4 N;  4BRO A;  3KK7 A;  1KQS M;  4XH1 A;  2QWP A;  5AQP A;  3VMF B;  2E1Y A;  5ELZ A;  1OVY A;  3CF5 L;  4JHD B;  4IDH A;  2P9I A;  4A2A A;  3I55 N;  1P90 A;  1ILY A;  1GLC G;  1WOQ A;  1X3N A;  3JXU A;  5BRF A;  2E8A A;  4GV6 A;  5B8H A;  3VES A;  3VGK A;  2RHK A;  4CZE A;  1HUX A;  2D1K A;  3KWI A;  5JIC A;  1NGB A;  3DJC A;  1JCE A;  4M63 C;  2VGN A;  5DM7 L;  1W2B M;  4HWI A;  4IWV A;  2DPN A;  3R8E A;  2Q97 A;  1D4X A;  3J7Z O;  3T69 A;  4IOA L;  1OKJ A;  1S72 N;  1G99 A;  4BR0 A;  5AQH A;  4BR4 A;  4G9Z A;  5E84 A;  1NGH A;  2D0P A;  1VQ5 N;  2YHX A;  2NRZ A;  1KD1 O;  2I7N A;  1N8R O;  4MDA A;  4WCE L;  2ASP A;  3D2F B;  3LM9 A;  3F9M A;  4CZK A;  2ASO A;  3P31 A;  5GIO A;  5FPM A;  5EY4 A;  2VWB A;  4XH4 A;  4YOV A;  5AZJ B;  1KAY A;  4FWP A;  3ATU A;  4BRD A;  2KKZ A;  2E1Z A;  2WBN A;  2BTF A;  3CC2 N;  3EE9 A;  2GTD A;  2HBJ A;  5BRE A;  1TUU A;  5DM6 L;  2WUS A;  4H5W A;  1VQ7 N;  2J4R A;  3C0B A;  1NJI O;  2HF4 A;  3A5O C;  3OA9 A;  2NRH A;  4A2B A;  1HKC A;  3CCS N;  5AQV A;  2Q31 A;  3I33 A;  3QBW A;  2NRV A;  3P38 A;  2GWK A;  1YAG A;  4KBO A;  1JCF A;  3SLC A;  4DQ8 A;  2P9S A;  5AZI B;  3A8Y A;  2A41 A;  4BRC A;  4CJ7 A;  1BU6 O;  3M3Z A;  3M5R A;  3TTD A;  4AF1 A;  1HJO A;  4C1N I;  2A42 A;  2HMP A;  3E1Y A;  3VTH A;  3AAP A;  2YI1 A;  3M6G A;  2P9I B;  1NBW A;  1SZ2 A;  1KAZ A;  3FZK A;  3H6E A;  2F9W A;  4IOC L;  1ATS A;  1GLA G;  4FWR A;  3UKR A;  4JKD A;  1LCU A;  1V4T A;  2HST A;  2JWK A;  4A5A A;  1NGJ A;  4C23 A;  3A5M C;  1NLV A;  2A40 A;  1U2V A;  2CH6 A;  3S41 A;  3WXM B;  4BRN A;  3HTV A;  3TTC A;  5C12 A;  4BG8 A;  1NGE A;  4BC2 A;  3OHR A;  4K42 A;  1H1V A;  1IJJ A;  1NGF A;  3CQY A;  5EVZ A;  3OBW A;  3TSQ A;  3C7N A;  4BRH A;  3CCU N;  3T7Z A;  1YUW A;  3ENB A;  4BC3 A;  2Q0U A;  4B1W B;  3RSE B;  4CZL A;  3CCE N;  2VCP A;  3VTI A;  2AA4 A;  4GV9 A;  3FZH A;  4JNE A;  5JMV A;  3QFU A;  1Q82 O;  3ID6 A;  2E2P A;  2Q2R A;  4WQ5 C;  5KQD A;  4BRK A;  2YHW A;  1JJ2 M;  5FPN A;  5AR0 A;  1M1K O;  4EHT A;  4O8K A;  1HKG A;  2QWR A;  3CCL N;  4B1Y B;  4BRM A;  1M90 O;  4JEP A;  4E1J A;  5KPZ A;  4GNI A;  3E9P A;  3LDQ A;  4K25 A;  3SAH A;  4YDU C;  5EXW A;  3ZEU A;  1K8K A;  4B1X B;  2QXL A;  2BH1 A;  2OAN A;  4ISG A;  4BRA A;  3FZF A;  3MWP A;  1K9M O;  3QDK A;  3SBT A;  3LM2 A;  3CCM N;  2P9K B;  4PKH A;  4MLH A;  3CC4 N;  3AAR A;  4A5B A;  3SAF A;  1K73 O;  5JLF A;  3ZX0 A;  3CXC M;  1NGI A;  3CPW M;  2QEX N;  5TKY A;  1BO5 O;  4MO5 A;  3I8B A;  4WF9 L;  3O1W A;  4UY8 O;  2PFU A;  3GG4 A;  2QI2 A;  3ZX3 A;  2QW9 A;  2YJF A;  3DXM A;  4BR2 A;  2CGK A;  4CZM A;  4H0X B;  5LJW A;  1MWM A;  3O9T A;  1VQ6 N;  2P9L B;  1Q7Y O;  2D4W A;  3W0L A;  5GAG P;  1MWK A;  3GL1 A;  4IFE A;  1BG3 A;  3CMA N;  4DB3 A;  3K9J A;  1BWF O;  3D2E A;  1JCG A;  3CHW A;  1O13 A;  1RDW X;  3UKU B;  3AAQ A;  2V7Z A;  3CJ1 A;  5ADX H;  3MWT A;  3F2K A;  3LDO A;  2V52 B;  5M1N A;  1GLL O;  5MLC Q;  4H03 B;  1DT9 A;  3WEE A;  4Z94 A;  3CCV N;  3TSU A;  5CE3 A;  4DCH A;  4WFN L;  4JKA A;  1GLJ O;  3EZW A;  5GAE P;  5BR9 A;  2FSN A;  2NLX A;  3H1Q A;  3IFR A;  3OW2 M;  3WQU A;  5BPM A;  4KH6 A;  1QZ6 A;  2ZWH A;  1TUY A;  3L0Q A;  4JKF A;  3JS6 A;  4CZI A;  3CJB A;  3BUZ B;  3MX2 A;  2RE2 A;  1J6Z A;  3QB0 A;  4WQ5 A;  3ZEU B;  2ITM A;  2GUP A;  4YOR A;  1BOT O;  3CCR N;  3VEN A;  1GLF O;  1T3V A;  3VOV A;  4BGA A;  5AQL A;  1LOT B;  2ZJQ L;  2QTD A;  1HX1 A;  1YI2 N;  5FPE A;  4YDU A;  4PKG A;  4BVP A;  2CGJ A;  3HBT A;  4H5T A;  2IIR A;  3HZ6 A;  4C1N K;  3C6A A;  3MMV A;  2E20 A;  3AGR A;  4CBW A;  2ZJR L;  4FWN A;  3ZX2 A;  4YOU A;  3C65 A;  1E4F T;  4B1U B;  1KXP A;  3VET A;  1C0G A;  3O08 A;  5F0X A;  3G71 N;  1TYQ A;  1W97 L;  3QIC A;  4XH5 A;  1Z6R A;  3DAW A;  5BN9 A;  4IEI A;  1P8Z A;  3N4P A;  4EIA A;  1Q86 O;  4FO0 A;  2W41 A;  3FFK B;  1XQS C;  5CR4 A;  5M1O A;  3O9U A;  3SMP A;  1Q18 A;  1Q81 O;  2IVN A;  3HRG A;  2WFB A;  3ULE B;  4WFA L;  4PKI A;  2EWS A;  3NVK A;  2QWL A;  4MO4 A;  3CCQ N;  4JKG B;  1YJN N;  5AQO A;  1C0F A;  1VAZ A;  3LDP A;  4FWQ A;  2NNW A;  5AQY A;  4BC4 A;  4H0Y B;  3U9Z A;  4O8U A;  4BR5 A;  1DKG D;  3TU5 A;  4U67 L;  5BRD A;  4FWS A;  4XEI A;  3L6Q A;  4H0P A;  2V51 B;  4K41 A;  3ULE A;  4JKH A;  2NRT A;  3O9S A;  1U6Z A;  4JK7 A;  3FGU A;  5GAH P;  4NO7 A;  4BR9 A;  4CZH A;  2H3G X;  4EHU A;  3ENH A;  1RGI A;  4A59 A;  3B8A X;  3IMX A;  3E9L A;  5AQX A;  4JK9 A;  4QS7 A;  5AQK A;  3AY9 A;  5M1P A;  2FXU A;  1QQO A;  2ASM A;  2NRW A;  2P9P A;  2NRR A;  1GLB G;  1YJ9 N;  3MX5 A;  2OTL N;  3FZL A;  1MA9 B;  4FWO A;  5AQQ A;  3IDH A;  4IZ9 A;  4CBX A;  1K8A O;  1S22 A;  3P4I A;  3MN6 A;  3E9O A;  4HTL A;  3VEZ A;  3GE1 A;  5C2F A;  4MDB A;  3VEX A;  4J8F A;  4DKW A;  3DXK A;  3WQT A;  1RDU A;  5C15 A;  4M7Y A;  1VQP N;  4KH4 A;  3H1V X;  1X9J A;  2GWJ A;  1ZC6 A;  3K9K A;  3Q7B A;  1SS6 A;  1VQO N;  3WXL A;  3CC7 N;  4FPA A;  3EKS A;  1VQ4 N;  4R79 A;  5M1F A;  3HOS A;  3A5N C;  3KVG A;  2QWM A;  4CD3 A;  4JKE A;  3GOI A;  5AFU A;  1R59 O;  2D0O A;  3F5T A;  2HBL A;  4EFH A;  1EO1 A;  2P9S B;  3H3O B;  4BRP A;  4EAH D;  1IG8 A;  3D7E O;  2P9N A;  1ATN A;  1DEJ A;  4FWK A;  3BF3 A;  2FSJ A;  3CCJ N;  4CZG A;  5AQJ A;  4CD1 A;  5AQU A;  4A62 A;  4H0V B;  3AGK A;  4RCH A;  3FE1 A;  4IOX A;  4ILJ A;  3VEW A;  4H5V A;  1ESV A;  3A5L C;  3UKR B;  5AQS A;  3GDQ A;  1GLE G;  2V7Y A;  1XUP O;  4K43 A;  4AM6 A;  3EKU A;  4H5N A;  3VF2 A;  1VQ8 N;  1HPM A;  1U2V B;  2A5X A;  3R1X A;  3TPQ A;  5I9E B;  5KQ8 A;  3CJ7 A;  3TSP A;  1BA1 A;  5GAD P;  5EX5 A;  4Y0W A;  4CBU A;  3DWL A;  3BEX A;  3ZET A;  4NLC A;  4FVU A;  4OPH A;  3C7N B;  2ZF5 O;  3R6M A;  3KZB A;  3VF4 A;  3L4I A;  4BRI A;  5BPN A;  1X3M A;  4BQL A;  2PBD A;  5F2R A;  1QVG M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...