3KWIA

X-ray structure of ns1 effector domain w187y mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
TPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLEYNDNTVRVSKTLQRFAWGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title X-ray structures of NS1 effector domain mutants.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 34
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3kwiA00
2GX9A 3P31A 3M5RA 3O9UA 2RHKA 3D6RA 4OPAA 3O9TA 3P39A 3O9RA 3P38A 3RVCA 2KKZA 4OPHA 3O9QA 3O9SA 3KWIA 3KWGA 3L4QA 3F5TA 3EE9A 3OA9A 3EE8A
chains in the Genus database with same CATH superfamily
2D0PA 3CI5A 5IT9O 4FWMA 5AQXA 2OZMA 2KW4A 4FW1A 3CHWA 3CERA 3U6FA 3QEXA 4H5WA 4CF2A 5J2MA 3DJCA 2HF4A 3RMDA 2VQEK 2YHXA 4BREA 3O9RA 5M1KA 4LF7K 3W3DA 4CD1A 3OY9A 4RWTA 1HPMA 3VQBA 1RDDA 4KAZA 2YHBA 4FJJA 4RW9A 3CMEN 2DFHA 3GE1A 2NRZA 4JI1K 1XMOK 3RSEB 4CGDA 1N5YA 1ITGA 3ZCMA 1T05A 1B9FA 4F2SA 4H0VB 4FVMA 1NGIA 3AO1A 3H1VX 2Z1GA 3ZSOA 3OJSA 3M1FA 1NJXA 1S1XA 3N4PA 4CZEA 1M1KO 2PYJA 4L8RB 4DU1A 2Q3SA 4BRNA 3MN5A 3IG1A 3VQCA 4BE0A 3T1AA 5FPNA 2P9UB 2QTDA 3CQYA 2UUBK 3LAKA 5AQGA 1KVAA 2GTDA 2Y1JA 1VQ9N 5C42A 3RSEA 2HHHK 4H5RA 3HP9A 4CEFA 1JCEA 3K0SA 5LY3A 4V19S 1DEJA 1RBTA 3CCJN 1QVGM 3OBWA 3VETA 1NG9A 2OPQA 3TAPA 1DGKN 4H5TA 4FCYA 1YJNN 4CBXA 2ZJRL 3UE5A 4E7KA 4O0IA 3SBGA 3KLHA 1VQ6N 3TABA 2P9UA 1IV0A 4KI4A 2HOEA 4CW7B 1VQON 1NKEA 1ZXOA 4FJHA 4DV2K 1HX1A 4CFDA 2YNFA 3PSIA 4M45A 2FC0A 1HLUA 1VSEA 3PIOL 1NGBA 3CD6N 3SUOA 3T19A 3PIPL 3QEVA 2FBVA 4RCHA 3AVLA 3JYTA 2YI1A 3VEXA 4R5PA 4H8KA 4U7BA 5AFUA 1RDWX 4FVUA 1DLOA 1S9GA 1Y64A 3D2EB 3LDNA 4BC2A 2VGMA 4PHTX 2BANA 3CFOA 3AVJA 1WSHA 5AQYA 5M1NA 4FJ9A 1RBVA 1ESVA 1YVUA 3SQ4A 1IBMK 4OO1J 1IBLK 5EXWA 4DWIA 4C8NA 1KLMA 1BOTO 5AQHA 1NK4A 2B4JA 4EAHD 5GIPA 2HF3A 4FL9A 4YOVA 3SQ1A 4DFJA 5AQWA 3D2EA 5HROA 2EWSA 2KLAA 1YT3A 1ZC6A 4H0PA 4IEIA 2P5OA 1VQNN 1HUXA 1IJJA 1H1VA 5C12A 3AVIA 2X78A 3P5JA 3SBTA 3THVA 1WNSA 3JS6A 3D2FB 3QIPA 3R3LA 3RRHA 4FPAA 1OKJA 2Q0RA 4DR5K 3QIOA 4KRFA 3P4IA 3MWPA 1RT1A 4MFBA 4NB4A 3AVHA 4BQLA 4CEOA 2OCEA 4RW4A 2CGJA 3HP6A 1J54A 4Q0BA 2Z1IA 1OH7A 1BL3A 1TUUA 3D2FA 3O9TA 3Q7CA 1OH8A 4JRPA 3L4IA 3O9SA 1WSJA 2KZZA 5KI6A 1SKRA 4M3YA 1MDUB 3NF6A 3VQ8A 4W5NA 4KHPK 2E88A 2HVIA 2YCHA 2G8WA 3PY8A 3RMCA 1JL2A 5AQTA 2YHAA 1HKGA 3MWTA 1HJOA 4KTZA 4FWOA 3NGZA 2GBZA 3LP3A 3NH2A 4AH9A 4B9VA 5HRPA 5LMNK 4K41A 5HBMA 3BDPA 2OPSA 3MMVA 4BC4A 4IFEA 4MDAA 4ICLA 1S3XA 4BRAA 3LWMA 2KQ2A 1N32K 2AJQA 1T8EA 3AVMA 4E0DA 4G9ZA 3D6RA 4DG1A 4BDPA 4YOXA 1X1PA 1WSIA 3EYZA 1E3MA 4AM6A 3WUHA 5LJWA 1NJZA 1DTTA 4TSXA 5EVZA 3EY1A 3PO5A 1DKGD 2BGGA 2GUIA 1BUPA 4JK7A 4DU4A 1YTAA 1YXQA 3AA5X 3F9MA 4LSNA 3MXMA 2VG5A 5F0XA 2P9LA 1VQLN 1D8YA 2HNDA 3KKSA 3L2RA 5AQRA 1BDGA 4FZYA 1E4FT 5GAGP 3HM9A 1GOCA 3OVNA 4ID1A 5EOYA 5J2PA 1T6CA 3O3FA 4DV7K 3K9JA 4O0JA 1NK7A 4IXCA 1XWLA 1TKDA 1NK8A 1VK0A 4I9LA 4BE2A 3NGIA 3L0QA 3FFKB 3TU5A 3NAEA 3T1YK 1L3UA 4JI6K 5KPZA 1S22A 3CFRA 3G71N 3RVCA 4CHZA 3P83D 4MO4A 2OANA 4W5TA 3O9QA 5AQQA 3DLEA 3LPUA 3CCMN 3EKUA 2OPRA 4Z0UA 4WFBL 4JI3K 3A5LC 3FFIA 2IOCA 3ZT2A 4FJKA 2G8HA 4F3TA 1NGFA 3WXKA 4NCAA 3CCSN 2E8AA 2QKKA 3EZWA 3QBWA 1IKYA 4CJTA 4IO9L 4ILHA 1Q82O 2D0AA 3LWLA 1BQMA 3OTOK 4DSIA 1Q18A 4AHUA 4M3RA 4FM0A 4H4MA 3I56N 3P31A 1NGGA 3TAQA 4ELTA 2YNGA 1C0FA 4JHDB 3AVFA 1YF5L 3J8AA 3CFPA 1C1BA 1QHAA 1TK0A 4FJXA 2HHTA 3DLKA 3T1HK 3LP0A 2KKZA 3SYZA 2QI2A 1G99A 3EKSA 3HI0A 4QCLA 3WXLA 4X65K 5FRMA 1EO1A 1N36K 1KCFA 2GEMA 3H08A 5AQFA 2CGKA 3VN5A 5D3GA 4JI5K 4JHDA 2A41A 4E7JA 3MN7A 3AO4A 4W5RA 4YDUA 1KAZA 4E7IA 4NLBA 3VEOA 3WXMB 3TAEA 1D4XA 2FBYA 4OPHA 1YIJN 5AQUA 3LM9A 1TAUA 2EHGA 1TV6A 4A5BA 4LH5A 1NM1A 1K9MO 4JS4A 2VWJA 3SV3A 4O5BA 3CC7N 2WBNA 3CC2N 5KPTA 2Z1JA 1LW0A 4EHUA 3AA4A 4BGAA 5J2NA 2WTUA 3OBYA 3HT3A 5F2RA 3HRGA 2KFZA 4FSVA 4EZ6A 3SNNA 2NRTA 1BU6O 2WC9A 3A5NC 3C6HA 1QQMA 3CETA 4YNQA 4B9LA 4DTNA 1C0MA 2V52B 3CJ9A 1YAGA 4CK3A 4FJLA 1VSFA 3CC4N 3M5RA 5GAHP 4MQ3A 4M3XA 3MEGA 4FZXC 4B9UA 1SQKA 3THXA 1LV5A 3LPTA 4B3SK 1RDAA 3ZSWA 5A2QO 3MX5A 2KTQA 3IMXA 5GIOA 2HW3A 5C2FA 4KB1A 4BRQA 4KHSA 3VA3A 1CZAN 2O8DB 3SAHA 2X74A 1XNQK 4IZ9A 2QEXN 1NGDA 3I55N 1KQSM 1VSHA 3V81A 3FZLA 3CPWM 4B9QA 1J5EK 3DI6A 4PKIA 2QWPA 2FBXA 2JGUA 4AHVA 2D5RA 1K8AO 3KKRA 4JI4K 2O8DA 4IFVA 3V4IA 5TKWA 4BC3A 3TSQA 2A40A 2HSTA 3CJ1A 1EP4A 1RT7A 2Q97A 4KH6A 4OGCA 3A8YA 3HSCA 3DLBA 5LMUK 1X9WA 3WXIA 4DU3A 3VTHA 4CZJA 2HHQA 3U3YA 4K42A 4H03B 3R1XA 1FXXA 5BN8A 4YFUA 2FXUA 4M41A 3FZHA 4NXMK 3AO2A 2VYPA 3OYBA 3OYNA 1ZYQA 4KH4A 4OKJA 3QEPA 1RT2A 4A59A 3MCAB 2V7ZA 2ZJPL 4B9SA 3VQ6A 2CGLA 4CK2A 1HR0K 1I94K 5AQKA 5JS2A 1TK5A 1JLQA 3L2WA 2XY6A 1FJGK 3Q7BA 3KZBA 1QS4A 3EN9A 3VEVA 4Z4FA 4FWQA 5C2DA 2CH6A 3OYKA 2QM1A 3IUCA 4JKFA 4OGEA 4J2EA 1XHXA 4W5OA 3MK6A 2HVHA 3A5OC 3WNFA 3BP8A 3AY9A 5I9EB 3VF4A 4M3TA 4R79A 4HUGA 3DLHA 3C6UA 3MXJA 1HQUA 4M7YA 4Y0WA 4JI8K 4ISGA 1BHLA 3SAGA 5IWAK 1QQNA 1ASWA 1GLJO 1IG9A 1WB9A 1C6VA 1FKOA 3G10A 3RR8A 5DM7L 1JLAA 5C0YA 1RDUA 5I3UA 4GMJB 3M3ZA 4IG0A 2ASOA 3NVKA 4QS8A 4AHSA 2QW9A 3CJCA 1YITN 3KD1E 3KK2A 2GWJA 3O1BA 1ZBLA 4B1ZA 2GX9A 4FW2A 4CJ7A 1KVBA 4CJLA 4DUYK 3G25A 4K25A 2D0OA 2RHKA 2A1SA 4CJ5A 3VEWA 3RMBA 3VERA 4CJFA 3OJUA 4B3MK 5AQSA 5J1EA 1IH7A 3K9KA 5DMRA 5AQJA 2D1KA 1HNVA 4FLYA 3V9ZA 2IGIA 3OYLA 1XMQK 4FLTA 4BR7A 1Y97A 4C1NK 1L3TA 4FK4A 3O4QA 2HHUA 1VRTA 4FZZA 3V9SA 1RT5A 4JAXA 4CGIA 4N76A 3RR7A 1BCMA 1NK0A 2BH1A 4BR9A 5I42A 4DQQA 3WQTA 2YHYA 4EP4A 4DTPA 4K43A 2FLOA 1EXQA 1IKVA 4OKKA 1A5WA 2IDOA 1VSMA 4CJ4A 4GKJK 4IOAL 4FM2A 3EZ5A 4BDYA 4DQIA 3VPZA 2HMIA 3M8PA 4JLHA 1C0GA 1KAXA 2VG6A 4EFHA 4IJNA 5E41A 2O4GA 1K73O 4BRLA 3KWIA 3MECA 4F2RA 1QQCA 3HZ6A 3M8SA 5M1PA 1BIUA 4YY3K 1GLCG 1C0TA 3WNGA 3SJHA 4DHYA 1VQ4N 2RN2A 4K8ZA 2YNIA 4JV5K 2OYQA 1LAWA 1HKCA 4F9OA 4DLEA 4YORA 1U48A 2F8TA 3VQ4A 3VQEA 1NJIO 5J2QA 4J8FA 3D45A 1QSYA 2IAJA 1VQ5N 4CEAA 3RRGA 5BRFA 4CZGA 2ZQBA 4HTLA 1FKPA 3ENBA 3R8EA 1W9HA 3NH1A 2LSNA 4NYNA 3AVAA 3P1GA 4NCBA 2IVNA 5H1SQ 3D0PA 4KHUA 4KV8A 3VEYA 1WUAA 1NOYA 1T6DA 2PZSA 1BQNA 3ZT4A 4DTOA 5AQNA 5GAEP 1YVNA 3L4QA 4FWNA 4EZ9A 4CGHA 1VQKN 3L2QA 4FK0A 3J7AP 3DOKA 4NLCA 2I7PA 3O4NA 3WT0A 3HTVA 3VMFB 2YJEA 3OYAA 1RBUA 1TKXA 1NU0A 3LZJA 3QLHA 2VGNA 3GOIA 3FZMA 3H46O 3CQXA 4BVPA 4IOCL 3K2PA 3S41A 1FK9A 1WAFA 3LP1A 1NGEA 4BR4A 3ZEUB 3ZX0A 4JYAK 3CQ8A 1RCHA 3EO3A 4CBWA 4J2AA 4YDUC 4A5AA 1SKWA 3M6GA 3DRSA 1BO5O 3CF5L 3ENOA 3HBTA 3QBXA 1SL0A 1VRUA 4CEBA 4DSLA 2F96A 4DS4A 4FWRA 2XY7A 5TKYA 3JXUA 1TKZA 3CJ7A 3B6OA 4JK8A 2W41A 4IBNA 3ZEUA 1HNXK 3KVGA 5HLFA 4A61A 4CD3A 4GKKK 4Z94A 3VESA 4JK9A 2AP1A 1K8KB 3PUFA 4JN4A 3VQAA 2ZM6K 1NGCA 1N34K 2CH5A 3DRPA 1FW6A 3AO3A 4DSFA 4FJGA 3FE1A 1HJRA 2WUSA 1WN7A 3TARA 3AVGA 3O1WA 4KH5A 2B5JA 3TR8A 5BRDA 4JKGB 1Q9YA 4RG8A 2WFBA 2VWBA 4B8CA 4CE9A 3L2VA 3I33A 3PLAA 1EWQA 4KHWA 1A5XA 2ETJA 3RWUA 4M3UA 1NLVA 1K8KA 1UWBA 4GY2B 1WBDA 2KZMA 4DR4K 3KJVA 3DXKB 4Z4CA 2WOMA 2F9WA 5KPRA 4LFAK 3ID8A 3SMSA 1YHQN 2BTFA 1E4GT 4CJPA 3MAQA 2IVPA 1JLBA 1VHXA 2QWQA 4JKGA 4FJ5A 4FM1A 4PKHA 4E1NA 3CXCM 2UU9K 3W0LA 5KGXA 1ATRA 4RW8A 4DKWA 3JSMA 4CZMA 3OYHA 4QS7A 1BG3A 3NVMA 1C1CA 2F4VK 2IS3A 4N41A 3DXKA 5AQMA 3B8AX 2P9IB 5AQZA 4CECA 4YOWA 3LDSA 4CZHA 4H5VA 1X3MA 4BR0A 4BRKA 1YI2N 4JD2B 3SI6A 3C6AA 4PQUA 1YJWN 4OPKA 5AJ3K 4ID5A 1TK8A 5FPEA 3NCIA 4CBUA 1CZBA 4H0YB 3OA9A 5CZ1A 4GV3A 4OLAA 3VOVA 5DK5A 4ISEA 3S3MA 4IDHA 2UXDK 3HPHA 4MO5A 4WFNL 1RT6A 3OS1A 2IC3A 3SUPA 4LFBK 3AARA 1HNZK 2P9IA 4BROA 2HHXA 3BF3A 2D0CA 4DMNA 1WSFA 1Q86O 3SLCA 3NGYA 1KXPA 2EX3A 1JJ2M 4JD2A 3TANA 2Q0UA 4BQZA 2ZWHA 1KVCA 3AGRA 3SQ2A 3PX0A 4O5FA 4CJ3A 3AVCA 4B1YB 4CJRA 4IKFA 2P9SB 2FF3B 3CJBA 3PSFA 1Z05A 3VA0A 1D9DA 1S6PA 4YOYA 1MU2A 4CESA 1NOZA 4XH5A 3R6MA 3C65A 4M3WA 2HNZA 3J7YP 3UIQA 1NK9A 1YTUA 1J5OA 3LAMA 4HCBA 1MWMA 2YHWA 4BG9A 2W40A 2DFEA 3K5OA 1NKCA 2P9SA 1RT3A 1ATSA 1S1WA 2GV9A 4DV3K 4X64K 1REVA 1I3AA 4C8OA 3AAPA 2QK9A 1NKBA 1T03A 2DTUA 3HOSA 4XH4A 4OJRA 5K14A 3TSUA 4KB0A 3H3NO 1SKSA 1UAXA 2W42A 4FJ7A 5FPDA 3CCQN 2A6AA 4JKDA 2UUCK 3LM2A 3OYFA 1GLEG 4JI7K 4DB3A 5BN9A 2PAVA 1KAYA 3LDPA 2HMPA 4IDKA 4CHQA 3AVNA 2F7TA 4PKGA 4AHCA 4WF9L 5FLXO 4CIFA 1C1AA 2A1RA 4JEPA 1Z26A 4C1NI 5BRHA 3GG4A 3OYMA 4CEQA 4IFYA 4FWKA 4JRQA 3SK3A 2OA8A 4ILJA 4OVLA 3C95A 3DRRA 2I5JA 3I0RA 3LL3A 5EU7A 4DTJA 2YV0X 2XO7A 4OPJA 3O80A 4BG8A 4HTUA 4O4GA 4Y1DA 1W0HA 4BGBA 1ZBFA 5FPMA 5KTQA 5M1FA 3BZKA 2QWNA 4DTRA 1Q9XA 3VQ5A 2P5GA 1L3VA 1BA0A 3THYB 1W2BM 3SJJA 1R0AA 2G8KA 3LP2A 1WOQA 1BA1A 2JWKA 4BRFA 3VGLA 2OTJN 4CIGA 4CF0A 2XHBA 3ISNC 4F4KA 2HB5A 3TTDA 3SZ2A 4DV1K 4KHNA 3VQ7A 4CIEA 4IWVA 5JVGL 3MDQA 4C8KA 3MEEA 5FDLA 4Z4IA 3MEDA 4ZTJA 1KC8O 5KQDA 1TL1A 3I8BA 3F5TA 5HRSA 2FSKA 2NRWA 3DLLL 2E1YA 3E9PA 2IIRA 3DOLA 1NJYA 3IRXA 4JNEA 1CXUA 3HO1A 1JLFA 2F9TA 3V1RA 1JL1A 1RDCA 1SV5A 1RBRA 4AHTA 1HQEA 4HCCA 3BGRA 4KTQA 1U47A 4I2QA 3ZYYX 4CFAA 5BR9A 3KD5E 1F21A 5HOOA 3HXMA 2X6NA 1N8RO 4JKHA 2QWRA 2A5XA 3LDQA 2ZD1A 1QVFM 4WE1A 3FZKA 3UB5A 4E7LA 3QNOA 3QO9A 1CZ9A 4H0TB 3CPEA 4GW6A 4MLHA 3O6WA 5BPLA 1GLAG 3O4WA 3ZSXA 2VQFK 2QA4N 3D7EO 4N5SA 4CGFA 4CJVA 3CCVN 5ADXH 3H1QA 3K5MA 3O08A 1XNRK 3ULDA 4IJAA 2FSNA 3N4QA 3KK1A 1A5VA 4FOIA 4HWIA 1LWFA 3L8BA 4IO8A 4DSJA 3BZCA 1Q7YO 4WYBA 3P39A 1OH6A 1U04A 3OHRA 5HRRA 4CHNA 2NLXA 2E6MA 4BRDA 4E7HA 3HL8A 3CCUN 2KFNA 4JKBA 4F3OA 3ALYA 5ELZA 2W6KA 2G8IA 3H6EA 4OPAA 3ZETB 3A0IX 3ITHA 4B3OA 2B6AA 4BRHA 3TAGA 4I2PA 1NGAA 4ZHRA 4B1VA 4MLEA 2KHOA 2PY5A 4LFCK 2UYTA 1QTMA 1JXBA 2E1ZA 4KFBA 3B6PA 1EWRA 4DQSA 2YX6A 3VEZA 2YJFA 2ZGYA 3NHGA 1QE1A 4B1WB 3ZETA 4HVJA 3NMUA 2P9PB 2P9NB 3GBTA 3V9UA 3MCPA 3T69A 3O3GA 3BF1A 3F9KA 3K5LA 4DQRA 1S1UA 4BC5A 1IKWA 2P9KB 3TTFA 4DTXA 5JVHL 1JLGA 2J4RA 5E26A 4E19A 2HBKA 3U9DA 2O8EB 1SL2A 1VQPN 4CFBA 3F73A 2GELA 4DR3K 1D5AA 2E6LA 2QKBA 4B3TK 1XHZA 2OZSA 4QOZB 2P9PA 5CY4A 3ID6A 2P9NA 5MLCQ 1ASVA 1YJ9N 4AILC 1TKTA 3CG7A 2O8CB 2NRHA 2P9KA 2RPIA 4CZKA 3QERA 4A2BA 3K5NA 3CCLN 5KQ8A 1GOAA 2O8EA 4A62A 1VSLA 5BPNA 1BISA 1TVRA 2A42A 3SUNA 1QSLA 1P90A 3ENHA 3FR0A 1NJWA 4H0OA 4Q5VA 3C94A 5C10A 3HYFA 1IKXA 5HRNA 4EHTA 3L2UA 1L3SA 2NRRA 4GV9A 5GADP 2VWKA 2P1JA 1RBSA 2O8CA 4WQ5A 2VG7A 5CR4A 1S5JA 3E66A 4FOEA 5B8HA 5SWMA 4U67L 1N6QA 1GLBG 3TAFA 3LDLA 3UKRB 2RE2A 3FGUA 4YOUA 3ZT1A 4CEZA 4B1XB 3WNHA 3TSPA 4RW6A 1U6ZA 1NGJA 1Z25A 2HBJA 3BUZB 3CJAA 3ULEB 4EP5A 3TTCA 5BPMA 3OYCA 1TYQB 2HHSA 1O1WA 4Z4HA 2Q1NA 5AQOA 1KTQA 1HYVA 1HNWK 1JXEA 4PY5A 5E84A 5HP1A 2E4LA 3I0SA 4HUEA 3UKRA 4H4OA 1P8ZA 1TAQA 4AQYK 3SV4A 1RTHA 3R9PA 1ATNA 4I9QA 1WSGA 4BR2A 4CZIA 5T7BA 1RT4A 3WEEB 2E2OA 3ULEA 3JAMO 5F1XA 4FLXA 1TYQA 2FF6A 4JKAA 4M7XA 3TI0A 4CCHA 4GV6A 3QETA 4E3SA 3NF7A 3KLIA 1GLFO 3PV8A 2BE2A 4L3QA 1VSJA 1JCFA 1UOCA 2QWMA 3ZSYA 4CHPA 3IFRA 3U3GA 4QAGA 3WEEA 4FJMA 4RW7A 4N56A 2V7YA 5SZTA 3S9HA 1ZBSA 2NZTA 1NNEA 4Z4EA 5KRTA 4Y1CA 5LJVA 4KPYA 3IS9A 4DUZK 1LW2A 3DAWA 4K0KK 3SCXA 4CHOA 4OKEA 1S1VA 4ISFA 4JI0K 3MX2A 4A2AA 4DQPA 1RTIA 1VQMN 1KFSA 1TL3A 3T7ZA 4W5QA 5C24A 3G6EN 2HHVA 1T44A 1KLNA 1R59O 2YNHA 3S3NA 3QEWA 1IBKK 3HM8A 3VF6A 3RTVA 3MXIA 4O44A 4GVMA 3RMAA 4DR2K 1HYSA 2OTLN 4A57A 3C7NB 3H3OB 4LC9B 1U45A 3J80O 1D9FA 3V9WA 4DV6K 3NBPA 4AF1A 1J9AA 1HPZA 4B9NA 1XI1A 3U4LA 3U8XA 3L3VA 3NF9A 3AVKA 1WSEA 5CZ2A 4OLBA 4NCGA 3OS0A 5LL6Z 3OS2A 3NE6A 2G8FA 1EQYA 4BR5A 5KRSA 5FRNA 1T3VA 4YOTA 5AFUH 3EEQA 1GOBA 3VGMA 4KTWA 4CF1A 4CF8A 2ZE2A 3C7NA 3HVRA 4CJWA 3QB0A 3AVBA 1J53A 3EE9A 3QEIA 3QFPA 3QFUA 4JS5A 1RDBA 2ASMA 1QSSA 1VSDA 3V1OA 4DR1K 1NMNA 3DWLA 3S3OA 3M8RA 4IOXA 3OYJA 2ASPA 5GINA 4ZTFA 1RGIA 1NMDA 4LF5K 2FSJA 1TUYA 4JI2K 4FWSA 1HNIA 5EX5A 3VQQA 2YKMA 1K6YA 3TAMA 4PUOA 1ILYA 2V51B 3AV9A 5AQVA 2Z1HA 3TPQA 3KLGA 3V6DA 1SUQA 4WQ4A 4J2BA 1YUWA 3OYEA 2R7YA 4J2DA 1MA9B 4CGJA 5AQIA 5EY4A 1WAJA 2P51A 3E9OA 3WNEA 3KIOA 4ELUA 3QICA 3A2FA 2ATQA 4X62K 4O8KA 3ZT0A 3HOTA 3QESA 2HNYA 3PX6A 3ZSZA 1NWKA 1KRPA 4DFMA 2G8VA 4CERA 3K59A 4F8RA 1X9JA 3KTQA 1L5UA 4KHQA 1LOTB 2XRIA 4O8UA 1DTQA 3THWB 4E89A 5KGWA 4DFPA 4DCHA 3WQUA 3NDKA 5FROA 1DT9A 2P9LB 4G1QA 4LD0A 3HJFA 4JKEA 1NGHA 5AZJB 4FWPA 4CZLA 3KLFA 3NFAA 1VSIA 3J81O 1BCOA 2E20A 3THWA 1XQSC 4CJKA 2H3GX 4E1MA 3KWGA 4DSKA 3MN9A 3VQ9A 4HUFA 1ZBHA 3EE8A 1XC3A 3O3HA 4K8XA 3CMAN 4CJEA 4BE1A 5AZJA 3DM2A 4CF9A 3G0ZA 1SZ2A 4KREA 2UUAK 3CM6A 4B8AB 5BR8K 4IG3A 3HPGA 3K57A 4CEDA 3ZX3A 2E2PA 4BRPA 3C0BA 4DR7K 4KBOA 2XY8A 2A3ZA 4H0XB 4WFAL 4B3RK 1U49A 2X6SA 4B1UB 4WCEL 1B92A 2UXBK 3HK2A 1NK6A 3CIPA 3FLCO 4BACA 2E5LK 1OVQA 3ZLJA 5JICA 3U9ZA 1CLQA 3HVTA 4DQ8A 5JMVA 3O5BA 1NBWA 2E2QA 3DMJA 3DXMB 3KK3A 4LY7A 2ZJQL 1BWFO 3QNNA 2HBMA 3LALA 4C8LA 4LSLA 5CYQA 4CZFA 3F2KA 3DLGA 3J7ZO 3VF2A 1GLLO 2QXFA 1T7PA 4FO0A 4ELVA 2DY4A 4QS9A 1Q81O 4FJIA 3DXMA 1JLEA 3QMLA 4FK2A 1RTJA 4UQGA 3FZFA 4BRGA 4LF6K 1X9SA 4B9MA 4PA1A 3V9XA 1XC9A 2RKIA 3M8QA 4FLVA 1HYZA 1OVYA 3HSTB 3PO4A 3AO5A 1SAZA 3E1YA 4IEEA 3CCRN 1W7AA 2ITGA 1LWEA 3QINA 4BWMA 4DFKA 2OPPA 5JS1A 1VQ7N 4WQ5C 3OYIA 4M3ZA 4X66K 4KI6A 2D0BA 4CJQA 4DTSA 4XIUA 3V1QA 5M1OA 4LH4A 2E2NA 4CGGA 2BDPA 2JWLA 3EL2A 4C8MA 2JLEA 3BY5A 4LF4K 4DS5A 3AA2A 1RILA 2RF2A 4PL7A 4FJ8A 1EKEA 4E1JA 2QXLA 4DR6K 3WXJA 1Z6RA 2Q36A 3VQPA 3SPZA 4BRIA 5CHIA 3PX4A 4KKOA 3THYA 3LANA 4DV4K 3MN6A 1QZ5A 2QWLA 3KK7A 1LAVA 4YHHK 2HHWA 4DTUA 3E01A 2ZF5O 2O4IA 2Q31A 2PFUA 1M90O 4JKCA 3HPOA 4DLGA 4PL8A 3H45C 1HRHA 4EIAA 3TWHA 4DSEA 1CXQA 4DF4A 3THXB 4PWDA 1LCUA 1UA1A 4XEIA 1QZ6A 3K58A 1S9EA 3IDHA 1KD1O 4NXNK 1OH5A 1X3NA 3VTIA 3L6QA 3E9LA 1W97L 1RTDA 2I7NA 2NNWA 2BUPA 4BVOA 4BDZA 5C15A 4O55A 1WLJA 4GVEA 2O8FB 1B9DA 5ADXA 2GWKA 1X9MA 4BRMA 4FXDA 3OYGA 2PBDA 4I6MB 3I8DA 5BREA 3IKMA 4BWJA 5C25A 3ASMA 4H5NA 3P38A 1Q8IA 4OX9K 3OYDA 3ZSQA 3ZSVA 4NO7A 4CFCA 1RFQA 3L3UA 2IVOA 3NF8A 1ASUA 5JLHA 2O8FA 2O8BB 4FWLA 1VSKA 3A5MC 5AZIB 4FJNA 1LWCA 4M63C 4BY9C 3VQDA 3GDQA 1S72N 4DV0K 1EETA 2QWOA 4I6MA 1U2VB 5CYMA 4ILGB 3ZX2A 4CEEA 3SUQA 4DF8A 4DTMA 3C6TA 1SS6A 1GLDG 2ZGZA 3ZSRA 3GL1A 1XUPO 1RNHA 2O8BA 1IG8A 1JLCA 5HL7L 1BGXT 5AZIA 3OW2M 1J6ZA 2W6LA 3ZT3A 1U2VA 4UY8O 3T3FA 1BIZA 1WBBA 3IAYA 1NK5A 4LF9K 4DV5K 2VCPA 3SMPA 2Y1IA 1IO2A 1V4TA 4RTFD 4CJUA 5CE3A 5JLFA 2PYLA 1N33K 1ZBIA 1I39A 5AQLA 4LF8K 3O9UA 1UA0A 4XH1A 5M1QA 1KSPA 3AAQA 4M42A 1MWKA 3O8MA 5AQPA 4C23A 4I7FA 1VAZA 2NUBA 1HMVA 1BI4B 1S1TA 2Q2RA 4B9TA 4CVNE 2NRVA 3BEXA 3ATUA 1EX4A 4MDBA 4Z4GA 2DPNA 3CM5A 1ZBUA 3CYMA 4N47A 3SPYA 2F8SA 4GNIA 3KHYA 1TGOA 4FPBA 1V4SA 3VENA 1S6QA 2NRXA 4WQ4C 1C0UA 2D4WA 3SQ0A 3DLRA 2UXCK 4KO0A 4FLUA 2G8UA 1JKHA 3AGKA 3LDOA 3VGKA 4HHTA 4B08A 4AHRA 1BI4A 2DFFA 4CK1A 4AM7A 4FLZA 1JCGA 1U4BA 2HBLA 1KFDA 1O13A 1HKBA 4NYFA 3ATVA 3DYAA 3SAFA 3CCEN 4FYDA 3AA3A 5AR0A 3UKUB 5DM6L 3KLEA 2FBTA 2GUPA 1QQOA 4BRCA 3QDKA 2YKNA 1QHTA 2ITMA 1G15A 3NH0A 2AA4A 3G4SN 4CHYA 4CI6A 1SL1A 1VQ8N 4KHYA 2WONA 3LZIA 3UKUA 2XY5A 4CJSA 4FLWA
chains in the Genus database with same CATH topology
2D0PA 3CI5A 3FZLA 3AAPA 3QFPA 3QFUA 4B9QA 3CPWM 4PKIA 2ASMA 2QWPA 4FWMA 5AQXA 3DWLA 3CHWA 3HOSA 3CERA 4XH4A 3TSUA 4H5WA 3H3NO 4IOXA 2ASPA 1K8AO 5GINA 3DJCA 2HF4A 1RGIA 1NMDA 2YHXA 4BREA 3O9RA 5M1KA 2FSJA 1TUYA 5TKWA 3W3DA 4CD1A 4FWSA 4BC3A 3TSQA 2A40A 2HSTA 5EX5A 5FPDA 1HPMA 3CJ1A 4RWTA 1ILYA 4BRKA 3CCQN 2A6AA 4JKDA 2V51B 3LM2A 2Q97A 1GLEG 4KH6A 4DB3A 3CMEN 3GE1A 5BN9A 2NRZA 3A8YA 2PAVA 3HSCA 1KAYA 3LDPA 2HMPA 5AQVA 3RSEB 3WXIA 3TPQA 2F7TA 4PKGA 3VTHA 4WF9L 4CZJA 4WQ4A 4H0VB 1NGIA 3H1VX 4JEPA 1YUWA 4K42A 4C1NI 4H03B 3GG4A 5BRHA 3R1XA 3M1FA 1M1KO 1MA9B 3N4PA 4CZEA 5BN8A 5AQIA 5EY4A 2FXUA 3E9OA 4FWKA 3FZHA 3SK3A 4BRNA 3MN5A 4ILJA 2VYPA 5FPNA 2P9UB 2QTDA 3QICA 3CQYA 3LL3A 5AQGA 2GTDA 4KH4A 4O8KA 1VQ9N 3RSEA 4A59A 3HOTA 3MCAB 2V7ZA 2ZJPL 4H5RA 3O80A 4BG8A 1JCEA 2CGLA 3I55N 5LY3A 1VQNN 1DEJA 1NWKA 1QVGM 3CCJN 5AQKA 3OBWA 3VETA 3Q7BA 5FPMA 4BGBA 3KZBA 5M1FA 1DGKN 3EN9A 3VEVA 4H5TA 1YJNN 4FWQA 1X9JA 2QWNA 4CBXA 2ZJRL 3UE5A 5C2DA 2CH6A 3SBGA 1VQ6N 2QM1A 2P9UA 1BA0A 3IUCA 4JKFA 1W2BM 1LOTB 3MK6A 2HOEA 1WOQA 4O8UA 1VQON 1ZXOA 3A5OC 1BA1A 2JWKA 3BP8A 4BRFA 3VGLA 1HX1A 3AY9A 4DCHA 3WQUA 2OTJN 1DT9A 2P9LB 5I9EB 3VF4A 4R79A 1HLUA 4M7YA 4Y0WA 3PIOL 4ISGA 3TTDA 3SAGA 4JKEA 1NGBA 1QQNA 1GLJO 3CD6N 1NGHA 5AZJB 4FWPA 4CZLA 5DM7L 4IWVA 5C0YA 3PIPL 5JVGL 1RDUA 3MDQA 4RCHA 3M3ZA 2E20A 2YI1A 2ASOA 3VEXA 3NVKA 1XQSC 4QS8A 4U7BA 2H3GX 2QW9A 3CJCA 5AFUA 1YITN 1KC8O 5KQDA 3KWGA 1RDWX 4FVUA 3MN9A 3I8BA 3F5TA 2GWJA 2NRWA 2FSKA 3O1BA 2E1YA 3DLLL 3EE8A 1Y64A 4B1ZA 2GX9A 2IIRA 3D2EB 3E9PA 3LDNA 1XC3A 4CJ7A 4BC2A 2VGMA 3CMAN 3G25A 4K25A 2D0OA 4JNEA 4PHTX 2RHKA 5M1NA 5AQYA 5AZJA 3VEWA 2F9TA 3VERA 1ESVA 1SZ2A 4OO1J 5EXWA 1BOTO 5AQHA 5AQSA 3ZX3A 3K9KA 2E2PA 4BRPA 4EAHD 5AQJA 2D1KA 2HF3A 3C0BA 4FL9A 5GIPA 4YOVA 4KBOA 2A3ZA 4H0XB 4WFAL 5AQWA 3ZYYX 3D2EA 5BR9A 2EWSA 4B1UB 2KLAA 4WCEL 1ZC6A 4BR7A 3CIPA 3FLCO 4H0PA 5HOOA 4C1NK 4IEIA 4JKHA 3U9ZA 1HUXA 2QWRA 2A5XA 3LDQA 4DQ8A 5JICA 5JMVA 1QVFM 1IJJA 1H1VA 3FZKA 3UB5A 5C12A 3O5BA 1NBWA 4JAXA 4H0TB 3SBTA 2E2QA 2ZJQL 3DXMB 3CPEA 3JS6A 3D2FB 3R3LA 4MLHA 3O6WA 5BPLA 2BH1A 1BWFO 4BR9A 4FPAA 3WQTA 1GLAG 2YHYA 3O4WA 2HBMA 1OKJA 2Q0RA 2QA4N 4K43A 4CZFA 2FLOA 3D7EO 3P4IA 3F2KA 3J7ZO 3VF2A 3CCVN 3MWPA 1GLLO 4NB4A 5ADXH 3H1QA 4BQLA 4FO0A 2CGJA 3O08A 4IJAA 4IOAL 2FSNA 3N4QA 4QS9A 1Q81O 3VPZA 4FOIA 3DXMA 4HWIA 1TUUA 3D2FA 3QMLA 4IO8A 3O9TA 3Q7CA 1Q7YO 1C0GA 3FZFA 4WYBA 3P39A 4BRGA 1KAXA 3OHRA 2NLXA 3L4IA 4IJNA 4EFHA 4BRDA 1K73O 4BRLA 3O9SA 3KWIA 1OVYA 1SAZA 3HZ6A 1MDUB 5M1PA 3CCUN 1GLCG 3E1YA 2E88A 4IEEA 4JKBA 3CCRN 3SJHA 5ELZA 4DHYA 1VQ4N 2YCHA 5AQTA 1VQ7N 1HKGA 4WQ5C 3H6EA 1HJOA 3MWTA 4OPAA 3ZETB 3A0IX 4FWOA 1HKCA 4F9OA 4BRHA 4YORA 4K41A 1NGAA 4B1VA 4MLEA 1NJIO 3MMVA 2KHOA 4J8FA 2UYTA 4BC4A 2E1ZA 4IFEA 4MDAA 5M1OA 1S3XA 1VQ5N 2E2NA 2YX6A 3VEZA 4BRAA 2JWLA 3EL2A 5BRFA 2YJFA 4CZGA 2ZGYA 4HTLA 3ENBA 4PL7A 4B1WB 3ZETA 3R8EA 4G9ZA 3D6RA 4E1JA 2QXLA 3NMUA 2IVNA 5H1SQ 4YOXA 3WXJA 1Z6RA 4AM6A 3WUHA 2P9PB 5LJWA 2Q36A 2P9NB 5EVZA 3VEYA 1WUAA 1DKGD 3GBTA 1T6DA 3MCPA 3T69A 4BRIA 5CHIA 3BF1A 5AQNA 3MN6A 1BUPA 4JK7A 1QZ5A 1YXQA 2QWLA 3F9MA 3KK7A 4BC5A 5GAEP 2P9KB 3TTFA 5JVHL 1YVNA 2ZF5O 3L4QA 2J4RA 5E26A 5F0XA 2Q31A 4FWNA 2PFUA 1M90O 1VQKN 2HBKA 2P9LA 3U9DA 1VQLN 4JKCA 4NLCA 2I7PA 4PL8A 3H45C 3WT0A 1VQPN 3HTVA 2GELA 3VMFB 4EIAA 2YJEA 5AQRA 1BDGA 1E4FT 2P9PA 3ID6A 2P9NA 5GAGP 1LCUA 5MLCQ 1YJ9N 2VGNA 4XEIA 1QZ6A 5EOYA 3IDHA 1KD1O 3GOIA 1T6CA 1X3NA 3FZMA 3VTIA 3L6QA 3E9LA 2NRHA 1W97L 2P9KA 3H46O 3K9JA 4CZKA 3CQXA 2I7NA 4A2BA 2NNWA 4BVPA 4IOCL 2BUPA 4BVOA 3CCLN 3S41A 5C15A 4BR4A 1NGEA 5KQ8A 4IXCA 4A62A 3ZEUB 4GVEA 3ZX0A 5BPNA 2A42A 3EO3A 5ADXA 1P90A 3ENHA 3FR0A 4CBWA 4H0OA 3L0QA 2GWKA 3FFKB 4YDUC 3TU5A 4A5AA 5C10A 4BRMA 3M6GA 2PBDA 1BO5O 4I6MB 5BREA 3CF5L 5KPZA 3IKMA 3ENOA 3HBTA 2NRRA 3QBXA 4EHTA 1S22A 4H5NA 4GV9A 5GADP 3G71N 3P38A 3RVCA 4FWRA 4MO4A 4WQ5A 2OANA 5TKYA 3JXUA 4BR0A 3CJ7A 3O9QA 4NO7A 5CR4A 1RFQA 5AQQA 3E66A 3CCMN 2IVOA 4FOEA 2W41A 4JK8A 5B8HA 3EKUA 3ZEUA 4U67L 5JLHA 3KVGA 4FWLA 4WFBL 3A5LC 1GLBG 3A5MC 3LDLA 5AZIB 4A61A 3UKRB 4M63C 4CD3A 4BY9C 3GDQA 1NGFA 3VESA 2RE2A 4JK9A 3WXKA 4Z94A 1S72N 2AP1A 2QWOA 1K8KB 3FGUA 4I6MA 4JN4A 3CCSN 2E8AA 1NGCA 4YOUA 2CH5A 4B1XB 1U2VB 4ILGB 3TSPA 3ZX2A 3EZWA 3QBWA 1U6ZA 1NGJA 2HBJA 3BUZB 3CJAA 3FE1A 2WUSA 3ULEB 3TTCA 1SS6A 3O1WA 4ILHA 4KH5A 1GLDG 5BPMA 2ZGZA 4IO9L 1Q82O 1TYQB 3GL1A 5BRDA 2Q1NA 1XUPO 5AQOA 1Q18A 4JKGB 1IG8A 2WFBA 2VWBA 5E84A 5HL7L 5AZIA 3UKRA 3OW2M 1P8ZA 3I33A 3PLAA 3I56N 3P31A 1NLVA 1K8KA 4GY2B 1J6ZA 1NGGA 3R9PA 1ATNA 1U2VA 4BR2A 4CZIA 4UY8O 1C0FA 3DXKB 2F9WA 3WEEB 4JHDB 5KPRA 3ID8A 2E2OA 1YF5L 3ULEA 3SMSA 3J8AA 1QHAA 1YHQN 2BTFA 5F1XA 1E4GT 1TYQA 2VCPA 2IVPA 2FF6A 4JKAA 4M7XA 2KKZA 3SMPA 2QI2A 2QWQA 1G99A 3EKSA 4JKGA 3HI0A 4GV6A 3WXLA 4PKHA 3CXCM 1V4TA 4RTFD 1GLFO 3W0LA 1EO1A 5CE3A 1ATRA 4DKWA 5JLFA 4CZMA 4QS7A 4L3QA 1BG3A 3NVMA 5AQLA 1JCFA 2QWMA 3O9UA 4XH1A 2GEMA 3IFRA 5AQFA 2CGKA 5M1QA 3AAQA 3DXKA 3WEEA 4JHDA 1MWKA 2V7YA 3O8MA 5AQPA 5AQMA 2A41A 1ZBSA 2NZTA 4C23A 3B8AX 1VAZA 2P9IB 3MN7A 5AQZA 4YOWA 2Q2RA 5LJVA 4CZHA 2NRVA 1X3MA 3BEXA 4H5VA 3ATUA 1KAZA 4JD2B 4NLBA 4YDUA 3VEOA 3C6AA 4MDBA 3WXMB 3DAWA 1YI2N 1D4XA 1YJWN 2DPNA 4OPHA 4GNIA 3KHYA 1YIJN 4ISFA 4FPBA 5AQUA 3LM9A 3MX2A 5FPEA 1V4SA 4A2AA 3VENA 2NRXA 4CBUA 4A5BA 4WQ4C 4H0YB 3OA9A 4GV3A 1NM1A 2D4WA 3VOVA 4ISEA 1K9MO 4IDHA 1VQMN 3CC7N 2WBNA 3T7ZA 3CC2N 4MO5A 4WFNL 3G6EN 5KPTA 3AGKA 1T44A 3LDOA 3VGKA 1R59O 3AARA 4EHUA 2P9IA 4BROA 3HM8A 3BF3A 4BGAA 3VF6A 1Q86O 4AM7A 3SLCA 3OBYA 1KXPA 3HRGA 5F2RA 1JJ2M 4JD2A 4FSVA 2Q0UA 4BQZA 1JCGA 2HBLA 2ZWHA 1O13A 1HKBA 2NRTA 3ATVA 1BU6O 3AGRA 2WC9A 3A5NC 4O5FA 3SAFA 3CCEN 3C6HA 4B1YB 2OTLN 4A57A 1QQMA 2P9SB 3C7NB 3CETA 3H3OB 4LC9B 2FF3B 2V52B 3CJBA 3CJ9A 5AR0A 3UKUB 1YAGA 5DM6L 1Z05A 4YOYA 3CC4N 3M5RA 5GAHP 1N8RO 4AF1A 2GUPA 1QQOA 4BRCA 4XH5A 3U4LA 3U8XA 3R6MA 3C65A 1SQKA 3MX5A 3IMXA 3QDKA 5GIOA 1MWMA 1EQYA 2YHWA 4BG9A 4BRQA 2W40A 4BR5A 2ITMA 1CZAN 5C2FA 3SAHA 1T3VA 2AA4A 4YOTA 5AFUH 3G4SN 3VGMA 2P9SA 3C7NA 4CI6A 1VQ8N 4IZ9A 1ATSA 2QEXN 3UKUA 1NGDA 3QB0A 1KQSM 3EE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GX9 A;  3P31 A;  3M5R A;  3O9U A;  2RHK A;  3D6R A;  4OPA A;  3O9T A;  3P39 A;  3O9R A;  3P38 A;  3RVC A;  2KKZ A;  4OPH A;  3O9Q A;  3O9S A;  3KWI A;  3KWG A;  3L4Q A;  3F5T A;  3EE9 A;  3OA9 A;  3EE8 A; 
#chains in the Genus database with same CATH topology
 2D0P A;  3CI5 A;  5IT9 O;  4FWM A;  5AQX A;  2OZM A;  2KW4 A;  4FW1 A;  3CHW A;  3CER A;  3U6F A;  3QEX A;  4H5W A;  4CF2 A;  5J2M A;  3DJC A;  2HF4 A;  3RMD A;  2VQE K;  2YHX A;  4BRE A;  3O9R A;  5M1K A;  4LF7 K;  3W3D A;  4CD1 A;  3OY9 A;  4RWT A;  1HPM A;  3VQB A;  1RDD A;  4KAZ A;  2YHB A;  4FJJ A;  4RW9 A;  3CME N;  2DFH A;  3GE1 A;  2NRZ A;  4JI1 K;  1XMO K;  3RSE B;  4CGD A;  1N5Y A;  1ITG A;  3ZCM A;  1T05 A;  1B9F A;  4F2S A;  4H0V B;  4FVM A;  1NGI A;  3AO1 A;  3H1V X;  2Z1G A;  3ZSO A;  3OJS A;  3M1F A;  1NJX A;  1S1X A;  3N4P A;  4CZE A;  1M1K O;  2PYJ A;  4L8R B;  4DU1 A;  2Q3S A;  4BRN A;  3MN5 A;  3IG1 A;  3VQC A;  4BE0 A;  3T1A A;  5FPN A;  2P9U B;  2QTD A;  3CQY A;  2UUB K;  3LAK A;  5AQG A;  1KVA A;  2GTD A;  2Y1J A;  1VQ9 N;  5C42 A;  3RSE A;  2HHH K;  4H5R A;  3HP9 A;  4CEF A;  1JCE A;  3K0S A;  5LY3 A;  4V19 S;  1DEJ A;  1RBT A;  3CCJ N;  1QVG M;  3OBW A;  3VET A;  1NG9 A;  2OPQ A;  3TAP A;  1DGK N;  4H5T A;  4FCY A;  1YJN N;  4CBX A;  2ZJR L;  3UE5 A;  4E7K A;  4O0I A;  3SBG A;  3KLH A;  1VQ6 N;  3TAB A;  2P9U A;  1IV0 A;  4KI4 A;  2HOE A;  4CW7 B;  1VQO N;  1NKE A;  1ZXO A;  4FJH A;  4DV2 K;  1HX1 A;  4CFD A;  2YNF A;  3PSI A;  4M45 A;  2FC0 A;  1HLU A;  1VSE A;  3PIO L;  1NGB A;  3CD6 N;  3SUO A;  3T19 A;  3PIP L;  3QEV A;  2FBV A;  4RCH A;  3AVL A;  3JYT A;  2YI1 A;  3VEX A;  4R5P A;  4H8K A;  4U7B A;  5AFU A;  1RDW X;  4FVU A;  1DLO A;  1S9G A;  1Y64 A;  3D2E B;  3LDN A;  4BC2 A;  2VGM A;  4PHT X;  2BAN A;  3CFO A;  3AVJ A;  1WSH A;  5AQY A;  5M1N A;  4FJ9 A;  1RBV A;  1ESV A;  1YVU A;  3SQ4 A;  1IBM K;  4OO1 J;  1IBL K;  5EXW A;  4DWI A;  4C8N A;  1KLM A;  1BOT O;  5AQH A;  1NK4 A;  2B4J A;  4EAH D;  5GIP A;  2HF3 A;  4FL9 A;  4YOV A;  3SQ1 A;  4DFJ A;  5AQW A;  3D2E A;  5HRO A;  2EWS A;  2KLA A;  1YT3 A;  1ZC6 A;  4H0P A;  4IEI A;  2P5O A;  1VQN N;  1HUX A;  1IJJ A;  1H1V A;  5C12 A;  3AVI A;  2X78 A;  3P5J A;  3SBT A;  3THV A;  1WNS A;  3JS6 A;  3D2F B;  3QIP A;  3R3L A;  3RRH A;  4FPA A;  1OKJ A;  2Q0R A;  4DR5 K;  3QIO A;  4KRF A;  3P4I A;  3MWP A;  1RT1 A;  4MFB A;  4NB4 A;  3AVH A;  4BQL A;  4CEO A;  2OCE A;  4RW4 A;  2CGJ A;  3HP6 A;  1J54 A;  4Q0B A;  2Z1I A;  1OH7 A;  1BL3 A;  1TUU A;  3D2F A;  3O9T A;  3Q7C A;  1OH8 A;  4JRP A;  3L4I A;  3O9S A;  1WSJ A;  2KZZ A;  5KI6 A;  1SKR A;  4M3Y A;  1MDU B;  3NF6 A;  3VQ8 A;  4W5N A;  4KHP K;  2E88 A;  2HVI A;  2YCH A;  2G8W A;  3PY8 A;  3RMC A;  1JL2 A;  5AQT A;  2YHA A;  1HKG A;  3MWT A;  1HJO A;  4KTZ A;  4FWO A;  3NGZ A;  2GBZ A;  3LP3 A;  3NH2 A;  4AH9 A;  4B9V A;  5HRP A;  5LMN K;  4K41 A;  5HBM A;  3BDP A;  2OPS A;  3MMV A;  4BC4 A;  4IFE A;  4MDA A;  4ICL A;  1S3X A;  4BRA A;  3LWM A;  2KQ2 A;  1N32 K;  2AJQ A;  1T8E A;  3AVM A;  4E0D A;  4G9Z A;  3D6R A;  4DG1 A;  4BDP A;  4YOX A;  1X1P A;  1WSI A;  3EYZ A;  1E3M A;  4AM6 A;  3WUH A;  5LJW A;  1NJZ A;  1DTT A;  4TSX A;  5EVZ A;  3EY1 A;  3PO5 A;  1DKG D;  2BGG A;  2GUI A;  1BUP A;  4JK7 A;  4DU4 A;  1YTA A;  1YXQ A;  3AA5 X;  3F9M A;  4LSN A;  3MXM A;  2VG5 A;  5F0X A;  2P9L A;  1VQL N;  1D8Y A;  2HND A;  3KKS A;  3L2R A;  5AQR A;  1BDG A;  4FZY A;  1E4F T;  5GAG P;  3HM9 A;  1GOC A;  3OVN A;  4ID1 A;  5EOY A;  5J2P A;  1T6C A;  3O3F A;  4DV7 K;  3K9J A;  4O0J A;  1NK7 A;  4IXC A;  1XWL A;  1TKD A;  1NK8 A;  1VK0 A;  4I9L A;  4BE2 A;  3NGI A;  3L0Q A;  3FFK B;  3TU5 A;  3NAE A;  3T1Y K;  1L3U A;  4JI6 K;  5KPZ A;  1S22 A;  3CFR A;  3G71 N;  3RVC A;  4CHZ A;  3P83 D;  4MO4 A;  2OAN A;  4W5T A;  3O9Q A;  5AQQ A;  3DLE A;  3LPU A;  3CCM N;  3EKU A;  2OPR A;  4Z0U A;  4WFB L;  4JI3 K;  3A5L C;  3FFI A;  2IOC A;  3ZT2 A;  4FJK A;  2G8H A;  4F3T A;  1NGF A;  3WXK A;  4NCA A;  3CCS N;  2E8A A;  2QKK A;  3EZW A;  3QBW A;  1IKY A;  4CJT A;  4IO9 L;  4ILH A;  1Q82 O;  2D0A A;  3LWL A;  1BQM A;  3OTO K;  4DSI A;  1Q18 A;  4AHU A;  4M3R A;  4FM0 A;  4H4M A;  3I56 N;  3P31 A;  1NGG A;  3TAQ A;  4ELT A;  2YNG A;  1C0F A;  4JHD B;  3AVF A;  1YF5 L;  3J8A A;  3CFP A;  1C1B A;  1QHA A;  1TK0 A;  4FJX A;  2HHT A;  3DLK A;  3T1H K;  3LP0 A;  2KKZ A;  3SYZ A;  2QI2 A;  1G99 A;  3EKS A;  3HI0 A;  4QCL A;  3WXL A;  4X65 K;  5FRM A;  1EO1 A;  1N36 K;  1KCF A;  2GEM A;  3H08 A;  5AQF A;  2CGK A;  3VN5 A;  5D3G A;  4JI5 K;  4JHD A;  2A41 A;  4E7J A;  3MN7 A;  3AO4 A;  4W5R A;  4YDU A;  1KAZ A;  4E7I A;  4NLB A;  3VEO A;  3WXM B;  3TAE A;  1D4X A;  2FBY A;  4OPH A;  1YIJ N;  5AQU A;  3LM9 A;  1TAU A;  2EHG A;  1TV6 A;  4A5B A;  4LH5 A;  1NM1 A;  1K9M O;  4JS4 A;  2VWJ A;  3SV3 A;  4O5B A;  3CC7 N;  2WBN A;  3CC2 N;  5KPT A;  2Z1J A;  1LW0 A;  4EHU A;  3AA4 A;  4BGA A;  5J2N A;  2WTU A;  3OBY A;  3HT3 A;  5F2R A;  3HRG A;  2KFZ A;  4FSV A;  4EZ6 A;  3SNN A;  2NRT A;  1BU6 O;  2WC9 A;  3A5N C;  3C6H A;  1QQM A;  3CET A;  4YNQ A;  4B9L A;  4DTN A;  1C0M A;  2V52 B;  3CJ9 A;  1YAG A;  4CK3 A;  4FJL A;  1VSF A;  3CC4 N;  3M5R A;  5GAH P;  4MQ3 A;  4M3X A;  3MEG A;  4FZX C;  4B9U A;  1SQK A;  3THX A;  1LV5 A;  3LPT A;  4B3S K;  1RDA A;  3ZSW A;  5A2Q O;  3MX5 A;  2KTQ A;  3IMX A;  5GIO A;  2HW3 A;  5C2F A;  4KB1 A;  4BRQ A;  4KHS A;  3VA3 A;  1CZA N;  2O8D B;  3SAH A;  2X74 A;  1XNQ K;  4IZ9 A;  2QEX N;  1NGD A;  3I55 N;  1KQS M;  1VSH A;  3V81 A;  3FZL A;  3CPW M;  4B9Q A;  1J5E K;  3DI6 A;  4PKI A;  2QWP A;  2FBX A;  2JGU A;  4AHV A;  2D5R A;  1K8A O;  3KKR A;  4JI4 K;  2O8D A;  4IFV A;  3V4I A;  5TKW A;  4BC3 A;  3TSQ A;  2A40 A;  2HST A;  3CJ1 A;  1EP4 A;  1RT7 A;  2Q97 A;  4KH6 A;  4OGC A;  3A8Y A;  3HSC A;  3DLB A;  5LMU K;  1X9W A;  3WXI A;  4DU3 A;  3VTH A;  4CZJ A;  2HHQ A;  3U3Y A;  4K42 A;  4H03 B;  3R1X A;  1FXX A;  5BN8 A;  4YFU A;  2FXU A;  4M41 A;  3FZH A;  4NXM K;  3AO2 A;  2VYP A;  3OYB A;  3OYN A;  1ZYQ A;  4KH4 A;  4OKJ A;  3QEP A;  1RT2 A;  4A59 A;  3MCA B;  2V7Z A;  2ZJP L;  4B9S A;  3VQ6 A;  2CGL A;  4CK2 A;  1HR0 K;  1I94 K;  5AQK A;  5JS2 A;  1TK5 A;  1JLQ A;  3L2W A;  2XY6 A;  1FJG K;  3Q7B A;  3KZB A;  1QS4 A;  3EN9 A;  3VEV A;  4Z4F A;  4FWQ A;  5C2D A;  2CH6 A;  3OYK A;  2QM1 A;  3IUC A;  4JKF A;  4OGE A;  4J2E A;  1XHX A;  4W5O A;  3MK6 A;  2HVH A;  3A5O C;  3WNF A;  3BP8 A;  3AY9 A;  5I9E B;  3VF4 A;  4M3T A;  4R79 A;  4HUG A;  3DLH A;  3C6U A;  3MXJ A;  1HQU A;  4M7Y A;  4Y0W A;  4JI8 K;  4ISG A;  1BHL A;  3SAG A;  5IWA K;  1QQN A;  1ASW A;  1GLJ O;  1IG9 A;  1WB9 A;  1C6V A;  1FKO A;  3G10 A;  3RR8 A;  5DM7 L;  1JLA A;  5C0Y A;  1RDU A;  5I3U A;  4GMJ B;  3M3Z A;  4IG0 A;  2ASO A;  3NVK A;  4QS8 A;  4AHS A;  2QW9 A;  3CJC A;  1YIT N;  3KD1 E;  3KK2 A;  2GWJ A;  3O1B A;  1ZBL A;  4B1Z A;  2GX9 A;  4FW2 A;  4CJ7 A;  1KVB A;  4CJL A;  4DUY K;  3G25 A;  4K25 A;  2D0O A;  2RHK A;  2A1S A;  4CJ5 A;  3VEW A;  3RMB A;  3VER A;  4CJF A;  3OJU A;  4B3M K;  5AQS A;  5J1E A;  1IH7 A;  3K9K A;  5DMR A;  5AQJ A;  2D1K A;  1HNV A;  4FLY A;  3V9Z A;  2IGI A;  3OYL A;  1XMQ K;  4FLT A;  4BR7 A;  1Y97 A;  4C1N K;  1L3T A;  4FK4 A;  3O4Q A;  2HHU A;  1VRT A;  4FZZ A;  3V9S A;  1RT5 A;  4JAX A;  4CGI A;  4N76 A;  3RR7 A;  1BCM A;  1NK0 A;  2BH1 A;  4BR9 A;  5I42 A;  4DQQ A;  3WQT A;  2YHY A;  4EP4 A;  4DTP A;  4K43 A;  2FLO A;  1EXQ A;  1IKV A;  4OKK A;  1A5W A;  2IDO A;  1VSM A;  4CJ4 A;  4GKJ K;  4IOA L;  4FM2 A;  3EZ5 A;  4BDY A;  4DQI A;  3VPZ A;  2HMI A;  3M8P A;  4JLH A;  1C0G A;  1KAX A;  2VG6 A;  4EFH A;  4IJN A;  5E41 A;  2O4G A;  1K73 O;  4BRL A;  3KWI A;  3MEC A;  4F2R A;  1QQC A;  3HZ6 A;  3M8S A;  5M1P A;  1BIU A;  4YY3 K;  1GLC G;  1C0T A;  3WNG A;  3SJH A;  4DHY A;  1VQ4 N;  2RN2 A;  4K8Z A;  2YNI A;  4JV5 K;  2OYQ A;  1LAW A;  1HKC A;  4F9O A;  4DLE A;  4YOR A;  1U48 A;  2F8T A;  3VQ4 A;  3VQE A;  1NJI O;  5J2Q A;  4J8F A;  3D45 A;  1QSY A;  2IAJ A;  1VQ5 N;  4CEA A;  3RRG A;  5BRF A;  4CZG A;  2ZQB A;  4HTL A;  1FKP A;  3ENB A;  3R8E A;  1W9H A;  3NH1 A;  2LSN A;  4NYN A;  3AVA A;  3P1G A;  4NCB A;  2IVN A;  5H1S Q;  3D0P A;  4KHU A;  4KV8 A;  3VEY A;  1WUA A;  1NOY A;  1T6D A;  2PZS A;  1BQN A;  3ZT4 A;  4DTO A;  5AQN A;  5GAE P;  1YVN A;  3L4Q A;  4FWN A;  4EZ9 A;  4CGH A;  1VQK N;  3L2Q A;  4FK0 A;  3J7A P;  3DOK A;  4NLC A;  2I7P A;  3O4N A;  3WT0 A;  3HTV A;  3VMF B;  2YJE A;  3OYA A;  1RBU A;  1TKX A;  1NU0 A;  3LZJ A;  3QLH A;  2VGN A;  3GOI A;  3FZM A;  3H46 O;  3CQX A;  4BVP A;  4IOC L;  3K2P A;  3S41 A;  1FK9 A;  1WAF A;  3LP1 A;  1NGE A;  4BR4 A;  3ZEU B;  3ZX0 A;  4JYA K;  3CQ8 A;  1RCH A;  3EO3 A;  4CBW A;  4J2A A;  4YDU C;  4A5A A;  1SKW A;  3M6G A;  3DRS A;  1BO5 O;  3CF5 L;  3ENO A;  3HBT A;  3QBX A;  1SL0 A;  1VRU A;  4CEB A;  4DSL A;  2F96 A;  4DS4 A;  4FWR A;  2XY7 A;  5TKY A;  3JXU A;  1TKZ A;  3CJ7 A;  3B6O A;  4JK8 A;  2W41 A;  4IBN A;  3ZEU A;  1HNX K;  3KVG A;  5HLF A;  4A61 A;  4CD3 A;  4GKK K;  4Z94 A;  3VES A;  4JK9 A;  2AP1 A;  1K8K B;  3PUF A;  4JN4 A;  3VQA A;  2ZM6 K;  1NGC A;  1N34 K;  2CH5 A;  3DRP A;  1FW6 A;  3AO3 A;  4DSF A;  4FJG A;  3FE1 A;  1HJR A;  2WUS A;  1WN7 A;  3TAR A;  3AVG A;  3O1W A;  4KH5 A;  2B5J A;  3TR8 A;  5BRD A;  4JKG B;  1Q9Y A;  4RG8 A;  2WFB A;  2VWB A;  4B8C A;  4CE9 A;  3L2V A;  3I33 A;  3PLA A;  1EWQ A;  4KHW A;  1A5X A;  2ETJ A;  3RWU A;  4M3U A;  1NLV A;  1K8K A;  1UWB A;  4GY2 B;  1WBD A;  2KZM A;  4DR4 K;  3KJV A;  3DXK B;  4Z4C A;  2WOM A;  2F9W A;  5KPR A;  4LFA K;  3ID8 A;  3SMS A;  1YHQ N;  2BTF A;  1E4G T;  4CJP A;  3MAQ A;  2IVP A;  1JLB A;  1VHX A;  2QWQ A;  4JKG A;  4FJ5 A;  4FM1 A;  4PKH A;  4E1N A;  3CXC M;  2UU9 K;  3W0L A;  5KGX A;  1ATR A;  4RW8 A;  4DKW A;  3JSM A;  4CZM A;  3OYH A;  4QS7 A;  1BG3 A;  3NVM A;  1C1C A;  2F4V K;  2IS3 A;  4N41 A;  3DXK A;  5AQM A;  3B8A X;  2P9I B;  5AQZ A;  4CEC A;  4YOW A;  3LDS A;  4CZH A;  4H5V A;  1X3M A;  4BR0 A;  4BRK A;  1YI2 N;  4JD2 B;  3SI6 A;  3C6A A;  4PQU A;  1YJW N;  4OPK A;  5AJ3 K;  4ID5 A;  1TK8 A;  5FPE A;  3NCI A;  4CBU A;  1CZB A;  4H0Y B;  3OA9 A;  5CZ1 A;  4GV3 A;  4OLA A;  3VOV A;  5DK5 A;  4ISE A;  3S3M A;  4IDH A;  2UXD K;  3HPH A;  4MO5 A;  4WFN L;  1RT6 A;  3OS1 A;  2IC3 A;  3SUP A;  4LFB K;  3AAR A;  1HNZ K;  2P9I A;  4BRO A;  2HHX A;  3BF3 A;  2D0C A;  4DMN A;  1WSF A;  1Q86 O;  3SLC A;  3NGY A;  1KXP A;  2EX3 A;  1JJ2 M;  4JD2 A;  3TAN A;  2Q0U A;  4BQZ A;  2ZWH A;  1KVC A;  3AGR A;  3SQ2 A;  3PX0 A;  4O5F A;  4CJ3 A;  3AVC A;  4B1Y B;  4CJR A;  4IKF A;  2P9S B;  2FF3 B;  3CJB A;  3PSF A;  1Z05 A;  3VA0 A;  1D9D A;  1S6P A;  4YOY A;  1MU2 A;  4CES A;  1NOZ A;  4XH5 A;  3R6M A;  3C65 A;  4M3W A;  2HNZ A;  3J7Y P;  3UIQ A;  1NK9 A;  1YTU A;  1J5O A;  3LAM A;  4HCB A;  1MWM A;  2YHW A;  4BG9 A;  2W40 A;  2DFE A;  3K5O A;  1NKC A;  2P9S A;  1RT3 A;  1ATS A;  1S1W A;  2GV9 A;  4DV3 K;  4X64 K;  1REV A;  1I3A A;  4C8O A;  3AAP A;  2QK9 A;  1NKB A;  1T03 A;  2DTU A;  3HOS A;  4XH4 A;  4OJR A;  5K14 A;  3TSU A;  4KB0 A;  3H3N O;  1SKS A;  1UAX A;  2W42 A;  4FJ7 A;  5FPD A;  3CCQ N;  2A6A A;  4JKD A;  2UUC K;  3LM2 A;  3OYF A;  1GLE G;  4JI7 K;  4DB3 A;  5BN9 A;  2PAV A;  1KAY A;  3LDP A;  2HMP A;  4IDK A;  4CHQ A;  3AVN A;  2F7T A;  4PKG A;  4AHC A;  4WF9 L;  5FLX O;  4CIF A;  1C1A A;  2A1R A;  4JEP A;  1Z26 A;  4C1N I;  5BRH A;  3GG4 A;  3OYM A;  4CEQ A;  4IFY A;  4FWK A;  4JRQ A;  3SK3 A;  2OA8 A;  4ILJ A;  4OVL A;  3C95 A;  3DRR A;  2I5J A;  3I0R A;  3LL3 A;  5EU7 A;  4DTJ A;  2YV0 X;  2XO7 A;  4OPJ A;  3O80 A;  4BG8 A;  4HTU A;  4O4G A;  4Y1D A;  1W0H A;  4BGB A;  1ZBF A;  5FPM A;  5KTQ A;  5M1F A;  3BZK A;  2QWN A;  4DTR A;  1Q9X A;  3VQ5 A;  2P5G A;  1L3V A;  1BA0 A;  3THY B;  1W2B M;  3SJJ A;  1R0A A;  2G8K A;  3LP2 A;  1WOQ A;  1BA1 A;  2JWK A;  4BRF A;  3VGL A;  2OTJ N;  4CIG A;  4CF0 A;  2XHB A;  3ISN C;  4F4K A;  2HB5 A;  3TTD A;  3SZ2 A;  4DV1 K;  4KHN A;  3VQ7 A;  4CIE A;  4IWV A;  5JVG L;  3MDQ A;  4C8K A;  3MEE A;  5FDL A;  4Z4I A;  3MED A;  4ZTJ A;  1KC8 O;  5KQD A;  1TL1 A;  3I8B A;  3F5T A;  5HRS A;  2FSK A;  2NRW A;  3DLL L;  2E1Y A;  3E9P A;  2IIR A;  3DOL A;  1NJY A;  3IRX A;  4JNE A;  1CXU A;  3HO1 A;  1JLF A;  2F9T A;  3V1R A;  1JL1 A;  1RDC A;  1SV5 A;  1RBR A;  4AHT A;  1HQE A;  4HCC A;  3BGR A;  4KTQ A;  1U47 A;  4I2Q A;  3ZYY X;  4CFA A;  5BR9 A;  3KD5 E;  1F21 A;  5HOO A;  3HXM A;  2X6N A;  1N8R O;  4JKH A;  2QWR A;  2A5X A;  3LDQ A;  2ZD1 A;  1QVF M;  4WE1 A;  3FZK A;  3UB5 A;  4E7L A;  3QNO A;  3QO9 A;  1CZ9 A;  4H0T B;  3CPE A;  4GW6 A;  4MLH A;  3O6W A;  5BPL A;  1GLA G;  3O4W A;  3ZSX A;  2VQF K;  2QA4 N;  3D7E O;  4N5S A;  4CGF A;  4CJV A;  3CCV N;  5ADX H;  3H1Q A;  3K5M A;  3O08 A;  1XNR K;  3ULD A;  4IJA A;  2FSN A;  3N4Q A;  3KK1 A;  1A5V A;  4FOI A;  4HWI A;  1LWF A;  3L8B A;  4IO8 A;  4DSJ A;  3BZC A;  1Q7Y O;  4WYB A;  3P39 A;  1OH6 A;  1U04 A;  3OHR A;  5HRR A;  4CHN A;  2NLX A;  2E6M A;  4BRD A;  4E7H A;  3HL8 A;  3CCU N;  2KFN A;  4JKB A;  4F3O A;  3ALY A;  5ELZ A;  2W6K A;  2G8I A;  3H6E A;  4OPA A;  3ZET B;  3A0I X;  3ITH A;  4B3O A;  2B6A A;  4BRH A;  3TAG A;  4I2P A;  1NGA A;  4ZHR A;  4B1V A;  4MLE A;  2KHO A;  2PY5 A;  4LFC K;  2UYT A;  1QTM A;  1JXB A;  2E1Z A;  4KFB A;  3B6P A;  1EWR A;  4DQS A;  2YX6 A;  3VEZ A;  2YJF A;  2ZGY A;  3NHG A;  1QE1 A;  4B1W B;  3ZET A;  4HVJ A;  3NMU A;  2P9P B;  2P9N B;  3GBT A;  3V9U A;  3MCP A;  3T69 A;  3O3G A;  3BF1 A;  3F9K A;  3K5L A;  4DQR A;  1S1U A;  4BC5 A;  1IKW A;  2P9K B;  3TTF A;  4DTX A;  5JVH L;  1JLG A;  2J4R A;  5E26 A;  4E19 A;  2HBK A;  3U9D A;  2O8E B;  1SL2 A;  1VQP N;  4CFB A;  3F73 A;  2GEL A;  4DR3 K;  1D5A A;  2E6L A;  2QKB A;  4B3T K;  1XHZ A;  2OZS A;  4QOZ B;  2P9P A;  5CY4 A;  3ID6 A;  2P9N A;  5MLC Q;  1ASV A;  1YJ9 N;  4AIL C;  1TKT A;  3CG7 A;  2O8C B;  2NRH A;  2P9K A;  2RPI A;  4CZK A;  3QER A;  4A2B A;  3K5N A;  3CCL N;  5KQ8 A;  1GOA A;  2O8E A;  4A62 A;  1VSL A;  5BPN A;  1BIS A;  1TVR A;  2A42 A;  3SUN A;  1QSL A;  1P90 A;  3ENH A;  3FR0 A;  1NJW A;  4H0O A;  4Q5V A;  3C94 A;  5C10 A;  3HYF A;  1IKX A;  5HRN A;  4EHT A;  3L2U A;  1L3S A;  2NRR A;  4GV9 A;  5GAD P;  2VWK A;  2P1J A;  1RBS A;  2O8C A;  4WQ5 A;  2VG7 A;  5CR4 A;  1S5J A;  3E66 A;  4FOE A;  5B8H A;  5SWM A;  4U67 L;  1N6Q A;  1GLB G;  3TAF A;  3LDL A;  3UKR B;  2RE2 A;  3FGU A;  4YOU A;  3ZT1 A;  4CEZ A;  4B1X B;  3WNH A;  3TSP A;  4RW6 A;  1U6Z A;  1NGJ A;  1Z25 A;  2HBJ A;  3BUZ B;  3CJA A;  3ULE B;  4EP5 A;  3TTC A;  5BPM A;  3OYC A;  1TYQ B;  2HHS A;  1O1W A;  4Z4H A;  2Q1N A;  5AQO A;  1KTQ A;  1HYV A;  1HNW K;  1JXE A;  4PY5 A;  5E84 A;  5HP1 A;  2E4L A;  3I0S A;  4HUE A;  3UKR A;  4H4O A;  1P8Z A;  1TAQ A;  4AQY K;  3SV4 A;  1RTH A;  3R9P A;  1ATN A;  4I9Q A;  1WSG A;  4BR2 A;  4CZI A;  5T7B A;  1RT4 A;  3WEE B;  2E2O A;  3ULE A;  3JAM O;  5F1X A;  4FLX A;  1TYQ A;  2FF6 A;  4JKA A;  4M7X A;  3TI0 A;  4CCH A;  4GV6 A;  3QET A;  4E3S A;  3NF7 A;  3KLI A;  1GLF O;  3PV8 A;  2BE2 A;  4L3Q A;  1VSJ A;  1JCF A;  1UOC A;  2QWM A;  3ZSY A;  4CHP A;  3IFR A;  3U3G A;  4QAG A;  3WEE A;  4FJM A;  4RW7 A;  4N56 A;  2V7Y A;  5SZT A;  3S9H A;  1ZBS A;  2NZT A;  1NNE A;  4Z4E A;  5KRT A;  4Y1C A;  5LJV A;  4KPY A;  3IS9 A;  4DUZ K;  1LW2 A;  3DAW A;  4K0K K;  3SCX A;  4CHO A;  4OKE A;  1S1V A;  4ISF A;  4JI0 K;  3MX2 A;  4A2A A;  4DQP A;  1RTI A;  1VQM N;  1KFS A;  1TL3 A;  3T7Z A;  4W5Q A;  5C24 A;  3G6E N;  2HHV A;  1T44 A;  1KLN A;  1R59 O;  2YNH A;  3S3N A;  3QEW A;  1IBK K;  3HM8 A;  3VF6 A;  3RTV A;  3MXI A;  4O44 A;  4GVM A;  3RMA A;  4DR2 K;  1HYS A;  2OTL N;  4A57 A;  3C7N B;  3H3O B;  4LC9 B;  1U45 A;  3J80 O;  1D9F A;  3V9W A;  4DV6 K;  3NBP A;  4AF1 A;  1J9A A;  1HPZ A;  4B9N A;  1XI1 A;  3U4L A;  3U8X A;  3L3V A;  3NF9 A;  3AVK A;  1WSE A;  5CZ2 A;  4OLB A;  4NCG A;  3OS0 A;  5LL6 Z;  3OS2 A;  3NE6 A;  2G8F A;  1EQY A;  4BR5 A;  5KRS A;  5FRN A;  1T3V A;  4YOT A;  5AFU H;  3EEQ A;  1GOB A;  3VGM A;  4KTW A;  4CF1 A;  4CF8 A;  2ZE2 A;  3C7N A;  3HVR A;  4CJW A;  3QB0 A;  3AVB A;  1J53 A;  3EE9 A;  3QEI A;  3QFP A;  3QFU A;  4JS5 A;  1RDB A;  2ASM A;  1QSS A;  1VSD A;  3V1O A;  4DR1 K;  1NMN A;  3DWL A;  3S3O A;  3M8R A;  4IOX A;  3OYJ A;  2ASP A;  5GIN A;  4ZTF A;  1RGI A;  1NMD A;  4LF5 K;  2FSJ A;  1TUY A;  4JI2 K;  4FWS A;  1HNI A;  5EX5 A;  3VQQ A;  2YKM A;  1K6Y A;  3TAM A;  4PUO A;  1ILY A;  2V51 B;  3AV9 A;  5AQV A;  2Z1H A;  3TPQ A;  3KLG A;  3V6D A;  1SUQ A;  4WQ4 A;  4J2B A;  1YUW A;  3OYE A;  2R7Y A;  4J2D A;  1MA9 B;  4CGJ A;  5AQI A;  5EY4 A;  1WAJ A;  2P51 A;  3E9O A;  3WNE A;  3KIO A;  4ELU A;  3QIC A;  3A2F A;  2ATQ A;  4X62 K;  4O8K A;  3ZT0 A;  3HOT A;  3QES A;  2HNY A;  3PX6 A;  3ZSZ A;  1NWK A;  1KRP A;  4DFM A;  2G8V A;  4CER A;  3K59 A;  4F8R A;  1X9J A;  3KTQ A;  1L5U A;  4KHQ A;  1LOT B;  2XRI A;  4O8U A;  1DTQ A;  3THW B;  4E89 A;  5KGW A;  4DFP A;  4DCH A;  3WQU A;  3NDK A;  5FRO A;  1DT9 A;  2P9L B;  4G1Q A;  4LD0 A;  3HJF A;  4JKE A;  1NGH A;  5AZJ B;  4FWP A;  4CZL A;  3KLF A;  3NFA A;  1VSI A;  3J81 O;  1BCO A;  2E20 A;  3THW A;  1XQS C;  4CJK A;  2H3G X;  4E1M A;  3KWG A;  4DSK A;  3MN9 A;  3VQ9 A;  4HUF A;  1ZBH A;  3EE8 A;  1XC3 A;  3O3H A;  4K8X A;  3CMA N;  4CJE A;  4BE1 A;  5AZJ A;  3DM2 A;  4CF9 A;  3G0Z A;  1SZ2 A;  4KRE A;  2UUA K;  3CM6 A;  4B8A B;  5BR8 K;  4IG3 A;  3HPG A;  3K57 A;  4CED A;  3ZX3 A;  2E2P A;  4BRP A;  3C0B A;  4DR7 K;  4KBO A;  2XY8 A;  2A3Z A;  4H0X B;  4WFA L;  4B3R K;  1U49 A;  2X6S A;  4B1U B;  4WCE L;  1B92 A;  2UXB K;  3HK2 A;  1NK6 A;  3CIP A;  3FLC O;  4BAC A;  2E5L K;  1OVQ A;  3ZLJ A;  5JIC A;  3U9Z A;  1CLQ A;  3HVT A;  4DQ8 A;  5JMV A;  3O5B A;  1NBW A;  2E2Q A;  3DMJ A;  3DXM B;  3KK3 A;  4LY7 A;  2ZJQ L;  1BWF O;  3QNN A;  2HBM A;  3LAL A;  4C8L A;  4LSL A;  5CYQ A;  4CZF A;  3F2K A;  3DLG A;  3J7Z O;  3VF2 A;  1GLL O;  2QXF A;  1T7P A;  4FO0 A;  4ELV A;  2DY4 A;  4QS9 A;  1Q81 O;  4FJI A;  3DXM A;  1JLE A;  3QML A;  4FK2 A;  1RTJ A;  4UQG A;  3FZF A;  4BRG A;  4LF6 K;  1X9S A;  4B9M A;  4PA1 A;  3V9X A;  1XC9 A;  2RKI A;  3M8Q A;  4FLV A;  1HYZ A;  1OVY A;  3HST B;  3PO4 A;  3AO5 A;  1SAZ A;  3E1Y A;  4IEE A;  3CCR N;  1W7A A;  2ITG A;  1LWE A;  3QIN A;  4BWM A;  4DFK A;  2OPP A;  5JS1 A;  1VQ7 N;  4WQ5 C;  3OYI A;  4M3Z A;  4X66 K;  4KI6 A;  2D0B A;  4CJQ A;  4DTS A;  4XIU A;  3V1Q A;  5M1O A;  4LH4 A;  2E2N A;  4CGG A;  2BDP A;  2JWL A;  3EL2 A;  4C8M A;  2JLE A;  3BY5 A;  4LF4 K;  4DS5 A;  3AA2 A;  1RIL A;  2RF2 A;  4PL7 A;  4FJ8 A;  1EKE A;  4E1J A;  2QXL A;  4DR6 K;  3WXJ A;  1Z6R A;  2Q36 A;  3VQP A;  3SPZ A;  4BRI A;  5CHI A;  3PX4 A;  4KKO A;  3THY A;  3LAN A;  4DV4 K;  3MN6 A;  1QZ5 A;  2QWL A;  3KK7 A;  1LAV A;  4YHH K;  2HHW A;  4DTU A;  3E01 A;  2ZF5 O;  2O4I A;  2Q31 A;  2PFU A;  1M90 O;  4JKC A;  3HPO A;  4DLG A;  4PL8 A;  3H45 C;  1HRH A;  4EIA A;  3TWH A;  4DSE A;  1CXQ A;  4DF4 A;  3THX B;  4PWD A;  1LCU A;  1UA1 A;  4XEI A;  1QZ6 A;  3K58 A;  1S9E A;  3IDH A;  1KD1 O;  4NXN K;  1OH5 A;  1X3N A;  3VTI A;  3L6Q A;  3E9L A;  1W97 L;  1RTD A;  2I7N A;  2NNW A;  2BUP A;  4BVO A;  4BDZ A;  5C15 A;  4O55 A;  1WLJ A;  4GVE A;  2O8F B;  1B9D A;  5ADX A;  2GWK A;  1X9M A;  4BRM A;  4FXD A;  3OYG A;  2PBD A;  4I6M B;  3I8D A;  5BRE A;  3IKM A;  4BWJ A;  5C25 A;  3ASM A;  4H5N A;  3P38 A;  1Q8I A;  4OX9 K;  3OYD A;  3ZSQ A;  3ZSV A;  4NO7 A;  4CFC A;  1RFQ A;  3L3U A;  2IVO A;  3NF8 A;  1ASU A;  5JLH A;  2O8F A;  2O8B B;  4FWL A;  1VSK A;  3A5M C;  5AZI B;  4FJN A;  1LWC A;  4M63 C;  4BY9 C;  3VQD A;  3GDQ A;  1S72 N;  4DV0 K;  1EET A;  2QWO A;  4I6M A;  1U2V B;  5CYM A;  4ILG B;  3ZX2 A;  4CEE A;  3SUQ A;  4DF8 A;  4DTM A;  3C6T A;  1SS6 A;  1GLD G;  2ZGZ A;  3ZSR A;  3GL1 A;  1XUP O;  1RNH A;  2O8B A;  1IG8 A;  1JLC A;  5HL7 L;  1BGX T;  5AZI A;  3OW2 M;  1J6Z A;  2W6L A;  3ZT3 A;  1U2V A;  4UY8 O;  3T3F A;  1BIZ A;  1WBB A;  3IAY A;  1NK5 A;  4LF9 K;  4DV5 K;  2VCP A;  3SMP A;  2Y1I A;  1IO2 A;  1V4T A;  4RTF D;  4CJU A;  5CE3 A;  5JLF A;  2PYL A;  1N33 K;  1ZBI A;  1I39 A;  5AQL A;  4LF8 K;  3O9U A;  1UA0 A;  4XH1 A;  5M1Q A;  1KSP A;  3AAQ A;  4M42 A;  1MWK A;  3O8M A;  5AQP A;  4C23 A;  4I7F A;  1VAZ A;  2NUB A;  1HMV A;  1BI4 B;  1S1T A;  2Q2R A;  4B9T A;  4CVN E;  2NRV A;  3BEX A;  3ATU A;  1EX4 A;  4MDB A;  4Z4G A;  2DPN A;  3CM5 A;  1ZBU A;  3CYM A;  4N47 A;  3SPY A;  2F8S A;  4GNI A;  3KHY A;  1TGO A;  4FPB A;  1V4S A;  3VEN A;  1S6Q A;  2NRX A;  4WQ4 C;  1C0U A;  2D4W A;  3SQ0 A;  3DLR A;  2UXC K;  4KO0 A;  4FLU A;  2G8U A;  1JKH A;  3AGK A;  3LDO A;  3VGK A;  4HHT A;  4B08 A;  4AHR A;  1BI4 A;  2DFF A;  4CK1 A;  4AM7 A;  4FLZ A;  1JCG A;  1U4B A;  2HBL A;  1KFD A;  1O13 A;  1HKB A;  4NYF A;  3ATV A;  3DYA A;  3SAF A;  3CCE N;  4FYD A;  3AA3 A;  5AR0 A;  3UKU B;  5DM6 L;  3KLE A;  2FBT A;  2GUP A;  1QQO A;  4BRC A;  3QDK A;  2YKN A;  1QHT A;  2ITM A;  1G15 A;  3NH0 A;  2AA4 A;  3G4S N;  4CHY A;  4CI6 A;  1SL1 A;  1VQ8 N;  4KHY A;  2WON A;  3LZI A;  3UKU A;  2XY5 A;  4CJS A;  4FLW A; 
#chains in the Genus database with same CATH homology
 2D0P A;  3CI5 A;  3FZL A;  3AAP A;  3QFP A;  3QFU A;  4B9Q A;  3CPW M;  4PKI A;  2ASM A;  2QWP A;  4FWM A;  5AQX A;  3DWL A;  3CHW A;  3HOS A;  3CER A;  4XH4 A;  3TSU A;  4H5W A;  3H3N O;  4IOX A;  2ASP A;  1K8A O;  5GIN A;  3DJC A;  2HF4 A;  1RGI A;  1NMD A;  2YHX A;  4BRE A;  3O9R A;  5M1K A;  2FSJ A;  1TUY A;  5TKW A;  3W3D A;  4CD1 A;  4FWS A;  4BC3 A;  3TSQ A;  2A40 A;  2HST A;  5EX5 A;  5FPD A;  1HPM A;  3CJ1 A;  4RWT A;  1ILY A;  4BRK A;  3CCQ N;  2A6A A;  4JKD A;  2V51 B;  3LM2 A;  2Q97 A;  1GLE G;  4KH6 A;  4DB3 A;  3CME N;  3GE1 A;  5BN9 A;  2NRZ A;  3A8Y A;  2PAV A;  3HSC A;  1KAY A;  3LDP A;  2HMP A;  5AQV A;  3RSE B;  3WXI A;  3TPQ A;  2F7T A;  4PKG A;  3VTH A;  4WF9 L;  4CZJ A;  4WQ4 A;  4H0V B;  1NGI A;  3H1V X;  4JEP A;  1YUW A;  4K42 A;  4C1N I;  4H03 B;  3GG4 A;  5BRH A;  3R1X A;  3M1F A;  1M1K O;  1MA9 B;  3N4P A;  4CZE A;  5BN8 A;  5AQI A;  5EY4 A;  2FXU A;  3E9O A;  4FWK A;  3FZH A;  3SK3 A;  4BRN A;  3MN5 A;  4ILJ A;  2VYP A;  5FPN A;  2P9U B;  2QTD A;  3QIC A;  3CQY A;  3LL3 A;  5AQG A;  2GTD A;  4KH4 A;  4O8K A;  1VQ9 N;  3RSE A;  4A59 A;  3HOT A;  3MCA B;  2V7Z A;  2ZJP L;  4H5R A;  3O80 A;  4BG8 A;  1JCE A;  2CGL A;  3I55 N;  5LY3 A;  1VQN N;  1DEJ A;  1NWK A;  1QVG M;  3CCJ N;  5AQK A;  3OBW A;  3VET A;  3Q7B A;  5FPM A;  4BGB A;  3KZB A;  5M1F A;  1DGK N;  3EN9 A;  3VEV A;  4H5T A;  1YJN N;  4FWQ A;  1X9J A;  2QWN A;  4CBX A;  2ZJR L;  3UE5 A;  5C2D A;  2CH6 A;  3SBG A;  1VQ6 N;  2QM1 A;  2P9U A;  1BA0 A;  3IUC A;  4JKF A;  1W2B M;  1LOT B;  3MK6 A;  2HOE A;  1WOQ A;  4O8U A;  1VQO N;  1ZXO A;  3A5O C;  1BA1 A;  2JWK A;  3BP8 A;  4BRF A;  3VGL A;  1HX1 A;  3AY9 A;  4DCH A;  3WQU A;  2OTJ N;  1DT9 A;  2P9L B;  5I9E B;  3VF4 A;  4R79 A;  1HLU A;  4M7Y A;  4Y0W A;  3PIO L;  4ISG A;  3TTD A;  3SAG A;  4JKE A;  1NGB A;  1QQN A;  1GLJ O;  3CD6 N;  1NGH A;  5AZJ B;  4FWP A;  4CZL A;  5DM7 L;  4IWV A;  5C0Y A;  3PIP L;  5JVG L;  1RDU A;  3MDQ A;  4RCH A;  3M3Z A;  2E20 A;  2YI1 A;  2ASO A;  3VEX A;  3NVK A;  1XQS C;  4QS8 A;  4U7B A;  2H3G X;  2QW9 A;  3CJC A;  5AFU A;  1YIT N;  1KC8 O;  5KQD A;  3KWG A;  1RDW X;  4FVU A;  3MN9 A;  3I8B A;  3F5T A;  2GWJ A;  2NRW A;  2FSK A;  3O1B A;  2E1Y A;  3DLL L;  3EE8 A;  1Y64 A;  4B1Z A;  2GX9 A;  2IIR A;  3D2E B;  3E9P A;  3LDN A;  1XC3 A;  4CJ7 A;  4BC2 A;  2VGM A;  3CMA N;  3G25 A;  4K25 A;  2D0O A;  4JNE A;  4PHT X;  2RHK A;  5M1N A;  5AQY A;  5AZJ A;  3VEW A;  2F9T A;  3VER A;  1ESV A;  1SZ2 A;  4OO1 J;  5EXW A;  1BOT O;  5AQH A;  5AQS A;  3ZX3 A;  3K9K A;  2E2P A;  4BRP A;  4EAH D;  5AQJ A;  2D1K A;  2HF3 A;  3C0B A;  4FL9 A;  5GIP A;  4YOV A;  4KBO A;  2A3Z A;  4H0X B;  4WFA L;  5AQW A;  3ZYY X;  3D2E A;  5BR9 A;  2EWS A;  4B1U B;  2KLA A;  4WCE L;  1ZC6 A;  4BR7 A;  3CIP A;  3FLC O;  4H0P A;  5HOO A;  4C1N K;  4IEI A;  4JKH A;  3U9Z A;  1HUX A;  2QWR A;  2A5X A;  3LDQ A;  4DQ8 A;  5JIC A;  5JMV A;  1QVF M;  1IJJ A;  1H1V A;  3FZK A;  3UB5 A;  5C12 A;  3O5B A;  1NBW A;  4JAX A;  4H0T B;  3SBT A;  2E2Q A;  2ZJQ L;  3DXM B;  3CPE A;  3JS6 A;  3D2F B;  3R3L A;  4MLH A;  3O6W A;  5BPL A;  2BH1 A;  1BWF O;  4BR9 A;  4FPA A;  3WQT A;  1GLA G;  2YHY A;  3O4W A;  2HBM A;  1OKJ A;  2Q0R A;  2QA4 N;  4K43 A;  4CZF A;  2FLO A;  3D7E O;  3P4I A;  3F2K A;  3J7Z O;  3VF2 A;  3CCV N;  3MWP A;  1GLL O;  4NB4 A;  5ADX H;  3H1Q A;  4BQL A;  4FO0 A;  2CGJ A;  3O08 A;  4IJA A;  4IOA L;  2FSN A;  3N4Q A;  4QS9 A;  1Q81 O;  3VPZ A;  4FOI A;  3DXM A;  4HWI A;  1TUU A;  3D2F A;  3QML A;  4IO8 A;  3O9T A;  3Q7C A;  1Q7Y O;  1C0G A;  3FZF A;  4WYB A;  3P39 A;  4BRG A;  1KAX A;  3OHR A;  2NLX A;  3L4I A;  4IJN A;  4EFH A;  4BRD A;  1K73 O;  4BRL A;  3O9S A;  3KWI A;  1OVY A;  1SAZ A;  3HZ6 A;  1MDU B;  5M1P A;  3CCU N;  1GLC G;  3E1Y A;  2E88 A;  4IEE A;  4JKB A;  3CCR N;  3SJH A;  5ELZ A;  4DHY A;  1VQ4 N;  2YCH A;  5AQT A;  1VQ7 N;  1HKG A;  4WQ5 C;  3H6E A;  1HJO A;  3MWT A;  4OPA A;  3ZET B;  3A0I X;  4FWO A;  1HKC A;  4F9O A;  4BRH A;  4YOR A;  4K41 A;  1NGA A;  4B1V A;  4MLE A;  1NJI O;  3MMV A;  2KHO A;  4J8F A;  2UYT A;  4BC4 A;  2E1Z A;  4IFE A;  4MDA A;  5M1O A;  1S3X A;  1VQ5 N;  2E2N A;  2YX6 A;  3VEZ A;  4BRA A;  2JWL A;  3EL2 A;  5BRF A;  2YJF A;  4CZG A;  2ZGY A;  4HTL A;  3ENB A;  4PL7 A;  4B1W B;  3ZET A;  3R8E A;  4G9Z A;  3D6R A;  4E1J A;  2QXL A;  3NMU A;  2IVN A;  5H1S Q;  4YOX A;  3WXJ A;  1Z6R A;  4AM6 A;  3WUH A;  2P9P B;  5LJW A;  2Q36 A;  2P9N B;  5EVZ A;  3VEY A;  1WUA A;  1DKG D;  3GBT A;  1T6D A;  3MCP A;  3T69 A;  4BRI A;  5CHI A;  3BF1 A;  5AQN A;  3MN6 A;  1BUP A;  4JK7 A;  1QZ5 A;  1YXQ A;  2QWL A;  3F9M A;  3KK7 A;  4BC5 A;  5GAE P;  2P9K B;  3TTF A;  5JVH L;  1YVN A;  2ZF5 O;  3L4Q A;  2J4R A;  5E26 A;  5F0X A;  2Q31 A;  4FWN A;  2PFU A;  1M90 O;  1VQK N;  2HBK A;  2P9L A;  3U9D A;  1VQL N;  4JKC A;  4NLC A;  2I7P A;  4PL8 A;  3H45 C;  3WT0 A;  1VQP N;  3HTV A;  2GEL A;  3VMF B;  4EIA A;  2YJE A;  5AQR A;  1BDG A;  1E4F T;  2P9P A;  3ID6 A;  2P9N A;  5GAG P;  1LCU A;  5MLC Q;  1YJ9 N;  2VGN A;  4XEI A;  1QZ6 A;  5EOY A;  3IDH A;  1KD1 O;  3GOI A;  1T6C A;  1X3N A;  3FZM A;  3VTI A;  3L6Q A;  3E9L A;  2NRH A;  1W97 L;  2P9K A;  3H46 O;  3K9J A;  4CZK A;  3CQX A;  2I7N A;  4A2B A;  2NNW A;  4BVP A;  4IOC L;  2BUP A;  4BVO A;  3CCL N;  3S41 A;  5C15 A;  4BR4 A;  1NGE A;  5KQ8 A;  4IXC A;  4A62 A;  3ZEU B;  4GVE A;  3ZX0 A;  5BPN A;  2A42 A;  3EO3 A;  5ADX A;  1P90 A;  3ENH A;  3FR0 A;  4CBW A;  4H0O A;  3L0Q A;  2GWK A;  3FFK B;  4YDU C;  3TU5 A;  4A5A A;  5C10 A;  4BRM A;  3M6G A;  2PBD A;  1BO5 O;  4I6M B;  5BRE A;  3CF5 L;  5KPZ A;  3IKM A;  3ENO A;  3HBT A;  2NRR A;  3QBX A;  4EHT A;  1S22 A;  4H5N A;  4GV9 A;  5GAD P;  3G71 N;  3P38 A;  3RVC A;  4FWR A;  4MO4 A;  4WQ5 A;  2OAN A;  5TKY A;  3JXU A;  4BR0 A;  3CJ7 A;  3O9Q A;  4NO7 A;  5CR4 A;  1RFQ A;  5AQQ A;  3E66 A;  3CCM N;  2IVO A;  4FOE A;  2W41 A;  4JK8 A;  5B8H A;  3EKU A;  3ZEU A;  4U67 L;  5JLH A;  3KVG A;  4FWL A;  4WFB L;  3A5L C;  1GLB G;  3A5M C;  3LDL A;  5AZI B;  4A61 A;  3UKR B;  4M63 C;  4CD3 A;  4BY9 C;  3GDQ A;  1NGF A;  3VES A;  2RE2 A;  4JK9 A;  3WXK A;  4Z94 A;  1S72 N;  2AP1 A;  2QWO A;  1K8K B;  3FGU A;  4I6M A;  4JN4 A;  3CCS N;  2E8A A;  1NGC A;  4YOU A;  2CH5 A;  4B1X B;  1U2V B;  4ILG B;  3TSP A;  3ZX2 A;  3EZW A;  3QBW A;  1U6Z A;  1NGJ A;  2HBJ A;  3BUZ B;  3CJA A;  3FE1 A;  2WUS A;  3ULE B;  3TTC A;  1SS6 A;  3O1W A;  4ILH A;  4KH5 A;  1GLD G;  5BPM A;  2ZGZ A;  4IO9 L;  1Q82 O;  1TYQ B;  3GL1 A;  5BRD A;  2Q1N A;  1XUP O;  5AQO A;  1Q18 A;  4JKG B;  1IG8 A;  2WFB A;  2VWB A;  5E84 A;  5HL7 L;  5AZI A;  3UKR A;  3OW2 M;  1P8Z A;  3I33 A;  3PLA A;  3I56 N;  3P31 A;  1NLV A;  1K8K A;  4GY2 B;  1J6Z A;  1NGG A;  3R9P A;  1ATN A;  1U2V A;  4BR2 A;  4CZI A;  4UY8 O;  1C0F A;  3DXK B;  2F9W A;  3WEE B;  4JHD B;  5KPR A;  3ID8 A;  2E2O A;  1YF5 L;  3ULE A;  3SMS A;  3J8A A;  1QHA A;  1YHQ N;  2BTF A;  5F1X A;  1E4G T;  1TYQ A;  2VCP A;  2IVP A;  2FF6 A;  4JKA A;  4M7X A;  2KKZ A;  3SMP A;  2QI2 A;  2QWQ A;  1G99 A;  3EKS A;  4JKG A;  3HI0 A;  4GV6 A;  3WXL A;  4PKH A;  3CXC M;  1V4T A;  4RTF D;  1GLF O;  3W0L A;  1EO1 A;  5CE3 A;  1ATR A;  4DKW A;  5JLF A;  4CZM A;  4QS7 A;  4L3Q A;  1BG3 A;  3NVM A;  5AQL A;  1JCF A;  2QWM A;  3O9U A;  4XH1 A;  2GEM A;  3IFR A;  5AQF A;  2CGK A;  5M1Q A;  3AAQ A;  3DXK A;  3WEE A;  4JHD A;  1MWK A;  2V7Y A;  3O8M A;  5AQP A;  5AQM A;  2A41 A;  1ZBS A;  2NZT A;  4C23 A;  3B8A X;  1VAZ A;  2P9I B;  3MN7 A;  5AQZ A;  4YOW A;  2Q2R A;  5LJV A;  4CZH A;  2NRV A;  1X3M A;  3BEX A;  4H5V A;  3ATU A;  1KAZ A;  4JD2 B;  4NLB A;  4YDU A;  3VEO A;  3C6A A;  4MDB A;  3WXM B;  3DAW A;  1YI2 N;  1D4X A;  1YJW N;  2DPN A;  4OPH A;  4GNI A;  3KHY A;  1YIJ N;  4ISF A;  4FPB A;  5AQU A;  3LM9 A;  3MX2 A;  5FPE A;  1V4S A;  4A2A A;  3VEN A;  2NRX A;  4CBU A;  4A5B A;  4WQ4 C;  4H0Y B;  3OA9 A;  4GV3 A;  1NM1 A;  2D4W A;  3VOV A;  4ISE A;  1K9M O;  4IDH A;  1VQM N;  3CC7 N;  2WBN A;  3T7Z A;  3CC2 N;  4MO5 A;  4WFN L;  3G6E N;  5KPT A;  3AGK A;  1T44 A;  3LDO A;  3VGK A;  1R59 O;  3AAR A;  4EHU A;  2P9I A;  4BRO A;  3HM8 A;  3BF3 A;  4BGA A;  3VF6 A;  1Q86 O;  4AM7 A;  3SLC A;  3OBY A;  1KXP A;  3HRG A;  5F2R A;  1JJ2 M;  4JD2 A;  4FSV A;  2Q0U A;  4BQZ A;  1JCG A;  2HBL A;  2ZWH A;  1O13 A;  1HKB A;  2NRT A;  3ATV A;  1BU6 O;  3AGR A;  2WC9 A;  3A5N C;  4O5F A;  3SAF A;  3CCE N;  3C6H A;  4B1Y B;  2OTL N;  4A57 A;  1QQM A;  2P9S B;  3C7N B;  3CET A;  3H3O B;  4LC9 B;  2FF3 B;  2V52 B;  3CJB A;  3CJ9 A;  5AR0 A;  3UKU B;  1YAG A;  5DM6 L;  1Z05 A;  4YOY A;  3CC4 N;  3M5R A;  5GAH P;  1N8R O;  4AF1 A;  2GUP A;  1QQO A;  4BRC A;  4XH5 A;  3U4L A;  3U8X A;  3R6M A;  3C65 A;  1SQK A;  3MX5 A;  3IMX A;  3QDK A;  5GIO A;  1MWM A;  1EQY A;  2YHW A;  4BG9 A;  4BRQ A;  2W40 A;  4BR5 A;  2ITM A;  1CZA N;  5C2F A;  3SAH A;  1T3V A;  2AA4 A;  4YOT A;  5AFU H;  3G4S N;  3VGM A;  2P9S A;  3C7N A;  4CI6 A;  1VQ8 N;  4IZ9 A;  1ATS A;  2QEX N;  3UKU A;  1NGD A;  3QB0 A;  1KQS M;  3EE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...