3KWIA

X-ray structure of ns1 effector domain w187y mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
TPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLEYNDNTVRVSKTLQRFAWGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title X-ray structures of NS1 effector domain mutants.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 34
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3kwiA00
3KWGA 3M5RA 4OPHA 3OA9A 2KKZA 2RHKA 3O9UA 3P31A 4OPAA 3P39A 3RVCA 2GX9A 3F5TA 3L4QA 3EE9A 3O9SA 3O9TA 3D6RA 3P38A 3KWIA 3EE8A 3O9RA 3O9QA
chains in the Genus database with same CATH superfamily
2P9PB 4X62K 4O8KA 4C23A 4BWMA 3A5LC 3FZFA 3S3NA 3DLHA 3CCQN 2FC0A 4DTJA 2YJEA 1M90O 4CFCA 1WLJA 1QTMA 4YOXA 5AQRA 4KHNA 4FLWA 1ILYA 1UOCA 5IWAK 1ZBHA 3KTQA 1VQPN 1LWEA 4JRQA 4IZ9A 5FRNA 1JLQA 2A40A 3DLKA 4RCHA 3SUPA 4ZTJA 3P38A 1S6PA 1LW2A 3L2VA 2AJQA 1TKZA 3JAMO 2PY5A 1KSPA 3SQ4A 3V1OA 4G9ZA 2Q0RA 2IVNA 4ISEA 1C0MA 4GMJB 1UA0A 3N4QA 2P9IB 4DTSA 3WXMB 3KLIA 1VSKA 5AZJA 5I3UA 3OS0A 1NLVA 3LZJA 1G15A 1X3NA 3IFRA 3O3FA 2V51B 4WQ5A 3VPZA 3NH0A 1RDBA 3QEWA 4FL9A 5CYQA 1RGIA 5DMRA 4E7KA 1HYSA 5C10A 3AV9A 4RG8A 3F9MA 4A5AA 1XUPO 3QO9A 2UYTA 1Z05A 2W41A 4CERA 3J81O 3EEQA 1QHAA 5HLFA 2P5GA 4HTUA 3EKUA 4CFAA 4NCBA 4BVOA 1WSGA 3DMJA 3AVNA 5E84A 5H1SQ 3OYBA 2D5RA 1IBKK 1RTIA 3WNEA 5JVHL 5KRTA 3VA0A 4DQQA 2QWRA 4FOEA 3VQEA 4JI7K 3NVMA 3GL1A 5AZJB 4BE2A 2ZM6K 3PIOL 2R7YA 1X9JA 1WSFA 2P9SB 5KI6A 3FFKB 2O8BA 1XHXA 1BOTO 1S1TA 5AFUH 5AQFA 1TAUA 2GEMA 4H5VA 4CEAA 1OH5A 2VQFK 3VGMA 4KI6A 1BDGA 3MDQA 4ILJA 1HQUA 2VYPA 5CYMA 3AVHA 2BDPA 4RW4A 3CC4N 1HNZK 3C7NA 3QEIA 5EU7A 1NGIA 2Z1GA 4CJQA 3QESA 2O8CA 1Y64A 3IUCA 4M3UA 3D2FA 1Q86O 4EHTA 1D9DA 4UQGA 1YT3A 4H0YB 2PYLA 4ZTFA 5AQPA 4WFAL 5HL7L 4IFYA 1Z26A 5AQWA 2ZF5O 4BRDA 4B3OA 1KFSA 3VA3A 4LSLA 2IDOA 3LWMA 3CJCA 3NAEA 3K57A 2P51A 1VSJA 3MCPA 4LFAK 4GVMA 3M8PA 1FKOA 1ATNA 2WBNA 5M1OA 3VTIA 4R79A 5AQZA 1W9HA 4HUEA 4NYFA 1X9MA 4ID1A 1S72N 2HHVA 2P5OA 4QS7A 5AQXA 3VF6A 5FDLA 1KC8O 2JLEA 5M1NA 1DLOA 3AVGA 4JK9A 1QSSA 4GKJK 2OPPA 3SV3A 3RRGA 1S1VA 3UB5A 4KHWA 3DXKA 3EY1A 3LL3A 3H46O 1OVQA 2F96A 1WAFA 4CZMA 2QEXN 3FZKA 2XHBA 4KTWA 4OGCA 4EP5A 3THXA 3PO4A 4NXNK 1NGHA 2PZSA 2DY4A 1YITN 3AGKA 3OYMA 2QKKA 1J9AA 2X6SA 4X64K 5B8HA 1BUPA 4FJ8A 4K42A 3OBYA 5M1KA 1KAZA 1BQMA 5AQKA 2IVPA 4BRQA 4DU3A 1D4XA 4GW6A 2P9LA 4DV7K 3VEWA 1X1PA 3AO1A 1NK7A 4G1QA 3PUFA 4A5BA 1RT3A 2GWJA 3O4QA 4C8NA 4YOYA 5J2MA 3BEXA 2O4IA 3UE5A 1U04A 4HUFA 3CERA 1NOYA 2CH5A 1J54A 4GNIA 1BIZA 4FW2A 2IAJA 1ASUA 4Y1DA 3OYEA 3VETA 2EHGA 3O4WA 3DXKB 3ZX3A 5I9EB 4ILGB 4BR4A 3V9ZA 3SUNA 4GKKK 5C25A 4CF1A 1ASWA 4O44A 3THXB 4F3TA 5CE3A 3EZ5A 1DTQA 1S1XA 4DTPA 1KVAA 1WN7A 3R6MA 1U6ZA 4CBUA 2IVOA 3VF4A 1BHLA 1A5VA 4KHQA 4FVMA 4KV8A 1T6CA 3KK7A 4CK3A 1IG8A 2PAVA 3RMAA 4FJGA 3TPQA 5EOYA 4QAGA 4FWKA 3CI5A 4FK4A 1VSIA 3CFOA 2YI1A 3L4IA 1N36K 3HP6A 3NF9A 4O5BA 3VMFB 5AQTA 3T1YK 1QQCA 4M7YA 2PYJA 4M3RA 5A2QO 2XY8A 4MLHA 4J2DA 2QM1A 5AFUA 2HHTA 2YJFA 3AVAA 5BRHA 2I5JA 1HRHA 1JL2A 5KPZA 1KLNA 4KPYA 3C6UA 5DM7L 1R0AA 3VQ4A 3SAGA 1FK9A 2E2OA 5HP1A 4Z4CA 4I9QA 4FLUA 3FZHA 4FYDA 3ZEUA 1KAXA 3RMBA 3G25A 2F8SA 4O0IA 2NRVA 2HHSA 3VQ6A 1N6QA 2ITMA 4C1NK 3K5OA 2KFZA 1BQNA 3HM9A 1K9MO 3ZSOA 1TYQA 4NO7A 3DRRA 5BN9A 3ZCMA 1NJXA 4M3TA 4A59A 1KVCA 5HRSA 2YHWA 3TAEA 3UKRA 1WAJA 4C1NI 2JWKA 5EVZA 2WC9A 1B9DA 1UAXA 3QERA 4Q0BA 4DMNA 1S5JA 4OPKA 1YIJN 1N33K 3ASMA 5C0YA 1JLFA 3GE1A 3TAFA 1LV5A 1T44A 3F2KA 4H5TA 4EFHA 1UWBA 4CD3A 3IRXA 3ZEUB 5GADP 3NGZA 2W6KA 1VSEA 2Q1NA 1U45A 1FXXA 4JHDA 1VSFA 3G71N 4IBNA 4QS9A 1ESVA 1SS6A 4FM1A 2DFEA 2KHOA 2XY5A 3AA2A 2YNIA 4H8KA 3I56N 1CZ9A 1IV0A 2OYQA 1JLEA 1EX4A 3WQTA 1DT9A 4K8ZA 3PSFA 3I8DA 3S3OA 3CMAN 4IXCA 4H5RA 4CJWA 2YNHA 5C15A 3THWA 5LMUK 4M3WA 1Z6RA 2BANA 1L3TA 1YTAA 1OVYA 3D2EA 3OYGA 4HHTA 3OW2M 3NMUA 4BC5A 3R8EA 2A42A 3RTVA 3LPTA 2OCEA 3J7YP 3L2QA 3OA9A 2NRXA 3ZYYX 2DTUA 1QS4A 3LM9A 4QOZB 1YVNA 4FWQA 1VK0A 4LF7K 3J8AA 1VAZA 2O8DA 2KZZA 3KIOA 4CF2A 4C8OA 5BRDA 4CGJA 3CQXA 3ZT3A 2F9TA 4H0PA 3K5LA 4FOIA 4JHDB 3RR7A 2HOEA 3AARA 4BR7A 4J2EA 3SBTA 3AVBA 4N41A 3VEZA 2F7TA 4F9OA 4KBOA 1QZ5A 1GLFO 4IFVA 3OS2A 1CZAN 2OTLN 4M45A 2HBJA 3AA5X 4B08A 2HVIA 4H0VB 3QLHA 4FLTA 1TAQA 4I2QA 3D2EB 1ZBIA 3ZSZA 5JVGL 4CJUA 3E9OA 4IOXA 3SJJA 3HZ6A 2NLXA 1IKYA 4IG3A 3HK2A 5CHIA 2OZMA 1SKRA 2Q2RA 2B4JA 1IBMK 4CGHA 4K43A 4LC9B 1RTDA 4IJAA 3OYJA 4B8CA 3IG1A 1VQ6N 2O8FA 1X9WA 3OY9A 4DTUA 4JI8K 4NLBA 4OPJA 4Z4HA 5AQIA 3SAFA 5AQSA 1BCMA 3OYIA 3TTDA 4A62A 3CJ9A 1NK8A 4BC2A 1NG9A 3GG4A 4EHUA 4XH5A 2P9NA 3PO5A 2A1RA 4O5FA 1S1UA 1HPMA 4FJJA 4LF6K 2YNGA 4CBXA 3MEGA 4DTRA 4JV5K 5JICA 3TANA 5SZTA 4KAZA 1MU2A 5HRNA 4B3SK 1WSJA 4J2BA 1SAZA 5ADXH 2FSKA 5CZ2A 3M8SA 1FKPA 5M1FA 1NGAA 3OVNA 4KRFA 4E1NA 1LCUA 3T69A 3SUOA 2VCPA 5TKYA 4DF4A 3CCUN 4AQYK 3V6DA 2NRHA 5J2PA 4ELVA 4DQ8A 5BR9A 4JN4A 1FJGK 1W7AA 4MDBA 1XQSC 4FM0A 4E7IA 1E4FT 2ZGZA 5E26A 2RHKA 4ZHRA 2QWOA 3P39A 4DV5K 1U47A 3RVCA 2V7YA 1JLCA 1YVUA 3NBPA 3MEDA 3MXJA 3OYDA 2E8AA 3CC7N 1W0HA 4LF5K 4O4GA 4PHTX 3O9RA 3HVRA 1ZC6A 4CEDA 1K73O 2Q31A 3VENA 4XIUA 2AP1A 3B6OA 1OH6A 1EETA 3CJ7A 4DQPA 5M1QA 3H45C 4CHOA 4DKWA 1BI4B 4A2AA 2D0AA 4JKHA 3THYB 3L6QA 4M3XA 4Z4EA 1YJ9N 1YJNN 4CI6A 1ITGA 4FJXA 1CLQA 5E41A 1N32K 1N34K 2JGUA 3VQCA 2F9WA 3CCSN 2Q97A 4BRGA 3ULEA 5KRSA 1TUYA 1EQYA 4YY3K 3DRSA 4BR5A 3GDQA 1T7PA 1RBRA 1U2VB 4O55A 1DKGD 4OX9K 4JKAA 2D4WA 4YOWA 3KJVA 4H03B 2HBMA 1Y97A 1I3AA 2E6LA 1T6DA 4V19S 4DR7K 1LAWA 1WB9A 1UA1A 4KTZA 2DFHA 3U3GA 3M1FA 3AO4A 3O9TA 4FLXA 2GWKA 4H4MA 3ZETA 5IT9O 4CEZA 2BUPA 2NNWA 3UKUB 2QXFA 2E88A 2G8HA 3QFPA 1MWMA 5FPMA 4K0KK 2D0BA 3CIPA 3SBGA 3S9HA 5I42A 2G8WA 4JI1K 1XC3A 3TABA 1GLCG 1M1KO 1EXQA 4F2RA 5BREA 4WQ4C 4DTNA 3ZSRA 1RT6A 1NM1A 3AVCA 1TGOA 4ISFA 3HI0A 3VGKA 2F8TA 2ZJPL 4B1WB 4DQSA 2ZJQL 5M1PA 4KH5A 1ZBFA 4JKDA 4FPAA 5HBMA 3KWGA 2Z1IA 3ITHA 2HMIA 1OH7A 3ZSQA 3MXIA 2NRTA 4JKEA 3O5BA 3KK1A 4CEFA 4OKEA 4FZZA 3S41A 4CJLA 2AA4A 3HPHA 3NH1A 2EX3A 4WQ4A 5AQGA 1T03A 4IOCL 1L3VA 4FXDA 3ZETB 3LANA 3WEEA 3CYMA 3JS6A 3TAGA 3P1GA 2WOMA 3TTFA 3IDHA 1S1WA 4BE0A 4DWIA 2ZGYA 2YCHA 1NJYA 4RTFD 4DTOA 4K41A 3SV4A 3OTOK 1KCFA 3D45A 4EAHD 3M6GA 2HHWA 3NGYA 5ADXA 3HP9A 3DLLL 2VWJA 4DSIA 4AF1A 4DR4K 3QB0A 3U4LA 2VWBA 3LP2A 3WUHA 4U67L 3NFAA 3JYTA 1NK6A 1C1AA 4DTMA 1YI2N 4LY7A 5T7BA 1J6ZA 4FSVA 1RDDA 3DOLA 4CJVA 1KFDA 2O4GA 4DR1K 4CZLA 4CGGA 2Y1JA 1HNVA 2P9UA 3MWTA 2QWPA 3TR8A 4QCLA 4MO4A 5KGWA 2P9KA 2D0CA 4PL8A 1HNIA 5GAHP 4FJNA 4O0JA 2E2NA 3WEEB 2CGLA 5GAGP 4IKFA 1WOQA 4IJNA 1LWCA 1NU0A 4JKGA 5C12A 3HO1A 4CFDA 4DFJA 3CETA 5FROA 1YTUA 1IH7A 3H6EA 1YUWA 3B6PA 1CXUA 2GTDA 1WNSA 3V9UA 4FZXC 1JCFA 3VERA 2OTJN 2O8BB 3C65A 5JLHA 3CCMN 3FR0A 4KHYA 2ETJA 3A5MC 3U8XA 4EZ9A 2YHAA 3LAKA 4FLVA 4Z4GA 3VQAA 3AA4A 5FRMA 1IKWA 3FLCO 3QDKA 2E2QA 4K8XA 3E9PA 4DQRA 1I39A 1EWRA 3C6AA 4CVNE 3V9WA 2ASOA 3MX5A 3K0SA 5HRPA 5JS1A 1HKBA 3G6EN 2FBVA 3C95A 4KTQA 3C7NB 1D9FA 3O1WA 2V52B 4BRHA 3NE6A 1SUQA 3LDPA 3PSIA 3VEVA 3KKRA 4AH9A 4LF4K 2A1SA 4BG8A 1VQNN 4MLEA 2O8CB 5AQYA 3R9PA 4GVEA 3U9DA 3D2FB 2QWQA 4CJTA 3M8RA 3ZT1A 4AHTA 1T05A 5F2RA 3P4IA 4KFBA 4YFUA 3EKSA 3MWPA 1GLLO 3IS9A 4E0DA 2ZE2A 5AQHA 4E7LA 2YHXA 4CGDA 3BUZB 1NBWA 4CE9A 4YDUC 3PX4A 1JL1A 5GINA 3VEXA 4NLCA 4F2SA 3CC2N 1LW0A 3H1QA 1QE1A 3O80A 3I55N 4FPBA 2Q36A 3DXMA 3LM2A 3H08A 4DLEA 4ELTA 4BVPA 2IOCA 2NRZA 3D6RA 4DSLA 4YDUA 1O1WA 2VG6A 1SL1A 5K14A 4RWTA 1VQ9N 1JLBA 3SPZA 1C6VA 3OYCA 1NJWA 4DR6K 1TK5A 1C0UA 4XH4A 2GUIA 3A5OC 1B92A 1F21A 2RN2A 5AZIA 3NDKA 4ELUA 2IS3A 1O13A 1C1BA 3WXKA 3NF7A 5LJVA 2P1JA 2P9LB 3MEEA 3MECA 3EL2A 1XC9A 4KI4A 4YNQA 2GELA 1T3VA 5JS2A 4KO0A 4CF9A 3O3HA 1GLEG 1G99A 1W97L 3DXMB 3LP0A 3ZSXA 4BGBA 1RILA 3P5JA 4W5TA 2VG7A 3AA3A 3CHWA 4FCYA 1VQ5N 3TSPA 5C42A 4GV6A 4JKFA 4PQUA 2ASPA 3HPOA 3L8BA 4N5SA 1JLGA 2YX6A 2YKMA 3ALYA 1DEJA 3O9SA 4CF8A 1QVGM 4GV9A 4BREA 5AQLA 1EO1A 1KQSM 4IO8A 3FFIA 2BTFA 4CGFA 4LF8K 4CZGA 4Z4IA 4Z4FA 2Y1IA 4BE1A 4CK1A 1EWQA 1BWFO 1TL3A 4M3ZA 2VG5A 4YOTA 4IG0A 2QWNA 1GOCA 4XH1A 1U4BA 1HQEA 3H1VX 4M63C 5TKWA 2XY7A 1U49A 1NGBA 3J7AP 1BA0A 1V4TA 4DR3K 1YAGA 4IDKA 5ELZA 3I0RA 4ILHA 3LDQA 4FWRA 5F0XA 4HCBA 5AQUA 3AO3A 3KZBA 1VQ7N 5LJWA 3HOTA 4N47A 1QSLA 3DI6A 1NK5A 1NJIO 4OLBA 3L2RA 4CZIA 3ZT0A 3OBWA 3M8QA 1Q9YA 4DSKA 3M3ZA 3SI6A 3K59A 2XY6A 5LMNK 4H5NA 4B1YB 1SL2A 1NJZA 2HF4A 4CECA 1I94K 1QVFM 4DF8A 4JK7A 1NGGA 4DTXA 3VQDA 5J2NA 4NCAA 5KTQA 4CJ7A 4B3MK 4CEBA 4NXMK 1TYQB 2WTUA 2DFFA 5AQJA 1WSEA 1E4GT 3UKRB 3P83D 5LL6Z 3NHGA 3VQPA 3KK3A 2WONA 1QQNA 2VQEK 2ATQA 4JKCA 2FXUA 3RRHA 2G8KA 3CMEN 2UUAK 2NRRA 3CCLN 4XEIA 2CGJA 4ID5A 4BC3A 1RFQA 2W42A 4BY9C 4CEQA 3O4NA 3LAMA 3P31A 4E7HA 5KQ8A 3TAMA 1MDUB 2BGGA 4KKOA 3HXMA 1ZBLA 3OYFA 3QINA 4CJFA 2KFNA 3BZKA 3ENHA 1TKDA 3VQQA 2UUBK 1RT5A 5GIPA 3RWUA 5C24A 4CIGA 4PKGA 4AHSA 3C94A 2CH6A 3HJFA 3TU5A 3SQ0A 1XMQK 3O9UA 4FJ9A 3DLRA 4FJLA 2Q0UA 5FPEA 3KD1E 2G8UA 4CK2A 3DLBA 4J8FA 4E1MA 4FWMA 3NH2A 5MLCQ 3THWB 1VSLA 2UUCK 4OKJA 3VTHA 4B9TA 2WUSA 4MFBA 3HL8A 4CIFA 2EWSA 4C8LA 3L3VA 1REVA 4AHVA 3M5RA 3PX0A 2PBDA 2OZSA 3CG7A 1TUUA 4N56A 1X3MA 3CCVN 2E2PA 1R59O 1TL1A 4QS8A 3VQ7A 2O8DB 3RSEA 1TKTA 3K9KA 4JD2A 3LP3A 3CCJN 2GBZA 4FJIA 1TV6A 4FJMA 4IOAL 1GOBA 4B9UA 3WXIA 4DV6K 4UY8O 1HR0K 2YKNA 4CESA 3IKMA 2GV9A 2GUPA 2I7NA 1RDWX 1C0GA 5C2DA 1XWLA 3MXMA 2ASMA 3QBWA 1SZ2A 3L3UA 3K2PA 4JS4A 3L2WA 1NKBA 5JMVA 2A6AA 3T7ZA 2CGKA 4DS5A 3QEVA 2YHYA 3MMVA 1A5WA 2A41A 1DTTA 3TWHA 3TSQA 3Q7BA 1WBDA 4JLHA 1RBUA 3U6FA 3U3YA 3FZMA 4W5QA 1NGCA 4H5WA 4CCHA 3WNGA 5BPMA 3ZLJA 3L4QA 1HMVA 2IC3A 4R5PA 3LDOA 4BG9A 1JCGA 1MWKA 4X66K 4B8AB 3VOVA 4M7XA 4Z0UA 4DSFA 2O8FB 4DU1A 4EZ6A 4NB4A 3IAYA 1Q18A 3DWLA 1IKVA 4H0OA 1ZXOA 3WQUA 1GOAA 4BRNA 1HJRA 5HRRA 3E9LA 4WFNL 2D0PA 4RW7A 1S9EA 2UXDK 3DRPA 2P9NB 1W2BM 1JXBA 4B9SA 4W5RA 3CF5L 1IBLK 2YHBA 3O08A 4NYNA 4DCHA 2FBXA 2E1ZA 2VWKA 2NRWA 5GIOA 2IGIA 1CXQA 3ULDA 4B1VA 5AQMA 3AVMA 2P9PA 2W40A 3V4IA 2J4RA 3KHYA 1TK0A 4RW8A 3OJSA 4WE1A 4BRIA 1K8AO 1SKWA 1B9FA 4BDPA 2XRIA 4IO9L 4H0XB 3BGRA 1K6YA 4GY2B 4FM2A 1FW6A 4ICLA 1P90A 4CZJA 4E89A 4FLZA 3QEPA 4F4KA 3N4PA 3R3LA 1HYZA 1EP4A 2FBYA 3BP8A 3LP1A 4A57A 3QEXA 4EIAA 1NGEA 3QETA 3S3MA 5EXWA 3PY8A 3LZIA 3WNHA 1QZ6A 4AM7A 2P9IA 1BISA 4CBWA 1HUXA 2ITGA 5JLFA 3KLEA 1XNRK 3O6WA 3C6TA 3DOKA 4CJ3A 1RDCA 1HKCA 2QK9A 3QIPA 4KHSA 4DB3A 5F1XA 3EYZA 2KW4A 3OYAA 4BRCA 4OJRA 3G0ZA 3CQYA 4PKIA 4GV3A 3W3DA 5KQDA 3QNOA 1Q81O 1VQ4N 5FPDA 1RTHA 5CZ1A 2OANA 4BC4A 3ID8A 3K9JA 1YF5L 4HWIA 1NWKA 3ZT4A 4WCEL 3RMDA 4B9NA 4WQ5C 1N5YA 3KD5E 4YOVA 4L3QA 4PL7A 4B3TK 3ZSVA 4M41A 3CPEA 3R1XA 2G8IA 3V1QA 1SKSA 1HPZA 1RTJA 3ULEB 1SL0A 4BRFA 3KK2A 1P8ZA 4AM6A 1NK9A 2ZQBA 3ID6A 3SYZA 3HSCA 2QI2A 5BN8A 4LH4A 2KLAA 2X6NA 4OVLA 4I6MA 2P9SA 3HOSA 1VQLN 4L8RB 4B9QA 3KWIA 1VQKN 2KQ2A 4FJHA 3NCIA 1ZBUA 3NF6A 4H0TB 3LALA 3BY5A 4CGIA 3KLGA 1WSIA 1NMNA 1QQMA 1JLAA 3HPGA 1RNHA 2I7PA 1L5UA 3U9ZA 1ATRA 2QTDA 3HBTA 3E1YA 3V81A 3T3FA 3VQ9A 2ZWHA 1VQON 1OH8A 3A2FA 5EY4A 3NF8A 4C8MA 2HNDA 1L3UA 3L0QA 2HNYA 5FLXO 1YXQA 3L2UA 4HTLA 1GLJO 3TTCA 3ZSYA 2HF3A 4YHHK 3I0SA 1RBSA 5CY4A 5BPLA 3I33A 4C8KA 2Z1JA 3CPWM 1TVRA 3C0BA 4I6MB 3VF2A 4FLYA 1D8YA 1BG3A 4PA1A 1RT2A 3W0LA 2QKBA 3MK6A 2FSNA 3QBXA 4FK0A 4BQZA 3OYLA 3VEYA 4FWOA 1QHTA 3LPUA 3QMLA 1WBBA 2HW3A 3CM6A 4RW6A 4FWLA 4IFEA 4DFMA 1BO5O 1YHQN 3ZX0A 4JS5A 4PUOA 1QQOA 4CHZA 4DHYA 1IG9A 3G10A 4X65K 4CZFA 1ZYQA 4DFPA 3MCAB 4B1XB 3CFRA 1HYVA 3BDPA 4TSXA 1IO2A 4B1ZA 4DG1A 3OYNA 3LDLA 4K25A 4JRPA 4OPHA 2P9UB 3SMSA 5C2FA 3AVLA 2XO7A 4I2PA 2P9KB 2HBKA 4OPAA 4IWVA 4B1UB 1RBVA 1BU6O 2DPNA 4BR2A 3TI0A 4FZYA 4BRLA 2LSNA 1JKHA 2E1YA 4YOUA 2QWMA 4JKGB 3D7EO 3C6HA 3BF1A 1BL3A 4DS4A 3ENOA 3O1BA 3Q7CA 1XHZA 4JAXA 3MN6A 1HX1A 3UIQA 1HLUA 4JI5K 4AHRA 1RBTA 3F73A 1KTQA 2Z1HA 2A3ZA 3CXCM 3OYKA 4Z94A 4CHQA 2X78A 4BDYA 4KHPK 3VGLA 2D1KA 2FSJA 4BGAA 4JI3K 2E4LA 5J2QA 1Q82O 3EE8A 3HSTB 3OS1A 4FVUA 2BH1A 5AQQA 4IEEA 5BPNA 1DGKN 3D0PA 3ZSWA 4NCGA 4B9VA 3DYAA 1GLBG 1XMOK 1S9GA 2G8VA 4FJ7A 1LAVA 1Q9XA 1Z25A 3J80O 4U7BA 3AVIA 4BRMA 4M3YA 3THVA 1HNXK 2HHUA 3EN9A 3DJCA 1N8RO 3AAPA 2NZTA 3AY9A 2HMPA 3MX2A 4LFCK 1NK4A 4JI6K 4JYAK 1NKEA 2GX9A 1VRTA 3V9SA 3JSMA 4DSJA 1TK8A 3K5MA 3PLAA 3EE9A 2RPIA 4Q5VA 1C1CA 3RR8A 5AQNA 3A0IX 1EKEA 4FK2A 3WNFA 4DLGA 1BGXT 4DFKA 1NGJA 4FJKA 3CFPA 1X9SA 1K8KA 3SZ2A 3KLFA 2UXCK 4MDAA 4DQIA 4LD0A 1VQ8N 4FJ5A 2FF3B 3IMXA 3DAWA 1TKXA 1LOTB 1WSHA 5KPTA 2G8FA 4DV1K 4DSEA 2E20A 4IDHA 4JI4K 4CZKA 5EX5A 1KAYA 4H4OA 3T1AA 3HTVA 4CJRA 3I8BA 2H3GX 5KGXA 4CD1A 1XI1A 3QNNA 5SWMA 3CCRN 3F9KA 2HNZA 3FGUA 5AZIB 4CZHA 1J53A 3AVKA 3QFUA 5DM6L 3SUQA 1D5AA 4AHUA 3HYFA 5AR0A 2A5XA 4OGEA 2IIRA 1HNWK 2OPRA 2BE2A 3SLCA 4JNEA 1IJJA 2HBLA 4O8UA 3PIPL 4CW7B 4BRKA 3O9QA 1KLMA 3ATUA 5AJ3K 2OA8A 3A5NC 1K8KB 3MN5A 1SV5A 3K58A 4CEOA 2KKZA 3K5NA 3CCEN 1VHXA 4RW9A 1HJOA 2UXBK 3QIOA 5LY3A 4A61A 5BRFA 1KD1O 4HUGA 1RDAA 4BR0A 4LF9K 4JKBA 1C0FA 3DLEA 3AGRA 5KPRA 3MN7A 3FE1A 5CR4A 2QXLA 1V4SA 4OLAA 2X74A 2UU9K 1RT7A 1IKXA 3ISNC 4CJPA 2B5JA 3G4SN 3ENBA 1VSDA 3VQBA 4BRAA 2E6MA 4CJ5A 3MN9A 3DLGA 4HVJA 4E19A 3E01A 4CEEA 4DV2K 4BR9A 4B3RK 4DUYK 4LFBK 3O8MA 2HHQA 4E1JA 2ZJRL 5GAEP 3E66A 4FWNA 4FWSA 1J5EK 4J2AA 3MAQA 4W5NA 3SQ1A 3EO3A 1Q8IA 4PKHA 4IEIA 1U48A 4KREA 1LWFA 1SQKA 3WXLA 1VSMA 2HB5A 5J1EA 4KH6A 3SAHA 2VGMA 3DM2A 4CHPA 4E3SA 4BWJA 2D0OA 4CJKA 4DV0K 2Q3SA 3SNNA 1ATSA 1RT4A 2W6LA 3GOIA 1XNQK 1WUAA 3KKSA 4PY5A 4DR2K 3CQ8A 4BACA 4OO1J 2RE2A 2KTQA 3LWLA 3SPYA 4FW1A 4CFBA 2OPSA 3H3OB 4JI0K 1NNEA 4BROA 3SK3A 3VESA 3LDNA 1S22A 4CHYA 1S3XA 4KB1A 4FO0A 2HSTA 3CJBA 2VGNA 2HHXA 3SQ2A 3KVGA 4BQLA 5HROA 3OHRA 1VQMN 1OKJA 2O8EA 2HHHK 5HOOA 3CJ1A 3A8YA 2WFBA 3ATVA 1BCOA 3TAQA 3FZLA 1NOZA 3T1HK 4MO5A 2YV0X 1GLDG 2YNFA 3ZT2A 1ZBSA 2ZD1A 2V7ZA 4CJSA 1RT1A 4CJ4A 1A5XA 4JI2K 4WFBL 3SCXA 3CJAA 3BZCA 3AVFA 4B9MA 4LH5A 3WXJA 4AHCA 4KH4A 4CIEA 1NGDA 3BF3A 4WF9L 3RMCA 1QSYA 3LDSA 2B6AA 3SJHA 1KRPA 4CF0A 3PX6A 4N76A 3CD6N 4W5OA 4PWDA 4CJEA 1VSHA 3TSUA 1NGFA 2PFUA 2O8EB 3QICA 4JEPA 3V1RA 1NMDA 3B8AX 1BIUA 3HT3A 1Q7YO 4Y0WA 1E3MA 3RSEB 2QW9A 4JD2B 1CZBA 4B9LA 2OPQA 3HRGA 5AQVA 3AO2A 4BRPA 4MQ3A 3VN5A 5BR8K 5DK5A 2HVHA 4HCCA 5AQOA 4I7FA 1NKCA 3JXUA 2NUBA 4WYBA 4CZEA 1KVBA 1YJWN 3AVJA 3TAPA 1JJ2M 4FWPA 3H3NO 4DV3K 3NGIA 3ZX2A 4A2BA 2KZMA 1GLAG 1JCEA 1BI4A 3AAQA 1VRUA 3NVKA 4DR5K 1JXEA 1RDUA 3F5TA 4F8RA 3HM8A 3SMPA 1RCHA 3THYA 1NK0A 3WT0A 3HVTA 1H1VA 1BA1A 3O3GA 3VQ8A 3GBTA 2E5LK 1U2VA 4BDZA 4JK8A 4E7JA 4KHUA 4M42A 3J7ZO 4F3OA 3VEOA 1ASVA 4DU4A 3T19A 4YORA 2FBTA 4OKKA 1T8EA 5D3GA 3OJUA 3OYHA 1MA9B 2FF6A 3UKUA 1C0TA 1L3SA 4I9LA 4LSNA 3TARA 4ISGA 2RF2A 3EZWA 3KLHA 3CM5A 5FPNA 3AO5A 2QWLA 4AILC 4DV4K 3VQ5A 4EP4A 4CHNA 2JWLA 1HKGA 2RKIA 3PV8A 4KB0A 2F4VK 1J5OA 1S6QA 4Y1CA 2QA4N 4DUZK 3V9XA 2FLOA 1KXPA
chains in the Genus database with same CATH topology
5AQLA 1EO1A 2P9PB 4B1ZA 1KQSM 5JVGL 4O8KA 3E9OA 4IOXA 4C23A 3LDLA 3HZ6A 4IO8A 4K25A 4OPHA 3A5LC 3FZFA 2P9UB 3SMSA 2NLXA 5C2FA 3CCQN 2BTFA 2YJEA 1M90O 5CHIA 4CZGA 2P9KB 2HBKA 4OPAA 4IWVA 5AQRA 4B1UB 4YOXA 2Q2RA 1ILYA 1BU6O 2DPNA 4BR2A 1VQPN 4IZ9A 2A40A 4RCHA 1BWFO 3P38A 4BRLA 4K43A 4LC9B 4YOTA 2E1YA 4IJAA 2QWNA 4YOUA 2QWMA 4JKGB 3D7EO 3C6HA 4XH1A 3BF1A 1VQ6N 3H1VX 3ENOA 3O1BA 3Q7CA 4M63C 5TKWA 4NLBA 1NGBA 4G9ZA 1BA0A 2Q0RA 5AQIA 1V4TA 2IVNA 3MN6A 1YAGA 4ISEA 4JAXA 5ELZA 1HX1A 3SAFA 1HLUA 5AQSA 4ILHA 3LDQA 3N4QA 4FWRA 5F0XA 2P9IB 3TTDA 3WXMB 4A62A 3CJ9A 5AQUA 4BC2A 3KZBA 3PIPL 5AZJA 2A3ZA 3GG4A 4EHUA 5LJWA 4XH5A 3HOTA 1VQ7N 2P9NA 3CXCM 1NLVA 4Z94A 1NJIO 4O5FA 1HPMA 4CZIA 3OBWA 1X3NA 4CBXA 3VGLA 2D1KA 2FSJA 3IFRA 4BGAA 2V51B 3M3ZA 4WQ5A 3VPZA 1Q82O 3EE8A 4FL9A 4FVUA 4H5NA 5JICA 4B1YB 1RGIA 2BH1A 2HF4A 5C10A 5AQQA 4IEEA 1QVFM 4JK7A 1SAZA 3F9MA 5ADXH 1NGGA 5BPNA 2FSKA 1XUPO 4A5AA 1DGKN 2UYTA 1Z05A 5M1FA 1NGAA 2W41A 4CJ7A 1TYQB 1LCUA 3T69A 1GLBG 2VCPA 5AQJA 1QHAA 5TKYA 1E4GT 3EKUA 3CCUN 3UKRB 4BVOA 1QQNA 4U7BA 2NRHA 4BRMA 5E84A 5H1SQ 4DQ8A 4JKCA 2FXUA 5BR9A 4JN4A 5JVHL 3CMEN 4MDBA 1XQSC 2NRRA 3CCLN 4XEIA 1E4FT 3EN9A 2CGJA 3DJCA 1N8RO 2QWRA 2ZGZA 4FOEA 4BC3A 1RFQA 5E26A 2RHKA 3AAPA 2NZTA 4BY9C 3AY9A 3NVMA 2HMPA 3MX2A 2QWOA 3GL1A 3P31A 5AZJB 3P39A 5KQ8A 3RVCA 1MDUB 2V7YA 2GX9A 1X9JA 3PIOL 3PLAA 2P9SB 3EE9A 3FFKB 2E8AA 3ENHA 3CC7N 5AQNA 1BOTO 4PHTX 3A0IX 3O9RA 5AFUH 5AQFA 1NGJA 1ZC6A 2GEMA 4H5VA 5GIPA 1K73O 2Q31A 1K8KA 3VENA 3VGMA 4PKGA 1BDGA 3MDQA 2CH6A 4ILJA 4MDAA 2AP1A 2VYPA 3CJ7A 3TU5A 3O9UA 1VQ8N 2Q0UA 5M1QA 2FF3B 3H45C 3IMXA 5FPEA 3DAWA 1LOTB 5KPTA 4J8FA 4DKWA 4A2AA 4FWMA 4JKHA 5MLCQ 3L6QA 3CC4N 3C7NA 3VTHA 1YJ9N 2E20A 4CI6A 1YJNN 2WUSA 4IDHA 1NGIA 4CZKA 5EX5A 1KAYA 2EWSA 2F9WA 1Y64A 3CCSN 2Q97A 3HTVA 3IUCA 4BRGA 3M5RA 3ULEA 3I8BA 2H3GX 4CD1A 3D2FA 1TUYA 1EQYA 2PBDA 3CCRN 4EHTA 1Q86O 4BR5A 3GDQA 1TUUA 4H0YB 1U2VB 5AQPA 1DKGD 3FGUA 4JKAA 2D4WA 5AZIB 1X3MA 4WFAL 5HL7L 4YOWA 5AQWA 4H03B 4CZHA 2HBMA 2ZF5O 3QFUA 5DM6L 4BRDA 5AR0A 1T6DA 2A5XA 2E2PA 1R59O 2IIRA 4QS8A 3RSEA 3K9KA 4JD2A 3SLCA 3M1FA 3CCJN 4IOAL 3O9TA 3CJCA 4JNEA 2GWKA 3ZETA 1IJJA 3WXIA 3MCPA 2BUPA 2HBLA 2NNWA 4UY8O 4O8UA 1ATNA 2WBNA 5M1OA 3UKUB 4BRKA 2E88A 3IKMA 3ATUA 3O9QA 3VTIA 4R79A 3A5NC 1MWMA 3QFPA 5AQZA 1K8KB 3MN5A 5FPMA 3CIPA 2GUPA 3SBGA 2I7NA 1RDWX 1XC3A 1C0GA 1S72N 5C2DA 2KKZA 1GLCG 3CCEN 4QS7A 1M1KO 5AQXA 2ASMA 3VF6A 3QBWA 5BREA 1HJOA 1SZ2A 4WQ4C 1KC8O 5LY3A 4A61A 5M1NA 5BRFA 1NM1A 1KD1O 4JK9A 4BR0A 5JMVA 4ISFA 3VGKA 3HI0A 2A6AA 3T7ZA 4JKBA 1C0FA 3AGRA 2ZJPL 2CGKA 3UB5A 4B1WB 3DXKA 3MN7A 5KPRA 3LL3A 3H46O 4CZMA 2ZJQL 3FE1A 2YHYA 5M1PA 3MMVA 5CR4A 4KH5A 2QEXN 3FZKA 2A41A 1V4SA 2QXLA 4JKDA 4FPAA 3KWGA 3TSQA 3Q7BA 3G4SN 3ENBA 1NGHA 2NRTA 4JKEA 3O5BA 1YITN 4BRAA 3AGKA 3MN9A 3FZMA 3S41A 2AA4A 5B8HA 1BUPA 4K42A 4WQ4A 1NGCA 3OBYA 5M1KA 1KAZA 5AQKA 4H5WA 5BPMA 2IVPA 5AQGA 4BRQA 4IOCL 3L4QA 1D4XA 4BR9A 3ZETB 2P9LA 3VEWA 3WEEA 3JS6A 3LDOA 4BG9A 1JCGA 1MWKA 3O8MA 4A5BA 3TTFA 3IDHA 2GWJA 4E1JA 3VOVA 5GAEP 2ZJRL 4M7XA 4YOYA 4NB4A 2ZGYA 3BEXA 2YCHA 3E66A 4FWNA 1Q18A 3DWLA 4FWSA 3UE5A 4RTFD 4H0OA 4K41A 1ZXOA 3EO3A 4PKHA 3CERA 4IEIA 3WQUA 1SQKA 2CH5A 4BRNA 3WXLA 3E9LA 4EAHD 3M6GA 4WFNL 2D0PA 4GNIA 5ADXA 3DLLL 4AF1A 2P9NB 3QB0A 2VWBA 3U4LA 4KH6A 3VETA 3WUHA 3O4WA 3SAHA 2VGMA 3CF5L 1W2BM 3DXKB 3ZX3A 4U67L 2D0OA 5I9EB 4ILGB 3O08A 4BR4A 1ATSA 4DCHA 3GOIA 1YI2N 2E1ZA 1WUAA 2NRWA 5GIOA 1J6ZA 5AQMA 4B1VA 2P9PA 2W40A 4FSVA 4OO1J 2RE2A 2J4RA 5CE3A 3KHYA 4CZLA 2P9UA 3MWTA 3H3OB 4BRIA 1K8AO 3R6MA 1U6ZA 4CBUA 2IVOA 2QWPA 3VF4A 4MO4A 2P9KA 1T6CA 3KK7A 4BROA 1IG8A 2PAVA 4PL8A 3SK3A 5GAHP 3VESA 3LDNA 3TPQA 1S22A 4IO9L 4H0XB 5EOYA 4FWKA 2E2NA 3CI5A 3WEEB 2CGLA 1S3XA 5GAGP 4FO0A 1WOQA 3L4IA 2HSTA 2YI1A 3CJBA 4GY2B 2VGNA 4IJNA 3VMFB 1P90A 5AQTA 4CZJA 4JKGA 5C12A 4M7YA 3CCVN 3N4PA 3CETA 3KVGA 3R3LA 4MLHA 3BP8A 4BQLA 2QM1A 4A57A 5AFUA 3OHRA 4EIAA 1VQMN 1NGEA 1OKJA 3H6EA 1YUWA 5EXWA 2YJFA 5HOOA 3CJ1A 5BRHA 3A8YA 2WFBA 3ATVA 1QZ6A 4AM7A 2P9IA 4CBWA 1HUXA 5KPZA 3FZLA 5JLFA 4MO5A 4BREA 1GLDG 2GTDA 3O6WA 5DM7L 1JCFA 3VERA 2OTJN 1ZBSA 3C65A 5JLHA 3CCMN 2V7ZA 3FR0A 1HKCA 3SAGA 3A5MC 3U8XA 2E2OA 4DB3A 3FZHA 3ZEUA 1KAXA 5F1XA 4WFBL 3CJAA 3FLCO 3QDKA 4BRCA 3G25A 2E2QA 3E9PA 2NRVA 3C6AA 3CQYA 2ITMA 4C1NK 3WXJA 2ASOA 4KH4A 4PKIA 3MX5A 3W3DA 5KQDA 4GV3A 1Q81O 1VQ4N 1NGDA 3BF3A 4WF9L 1K9MO 5FPDA 1TYQA 4NO7A 2OANA 1HKBA 3ID8A 3K9JA 5BN9A 1YF5L 4HWIA 4BC4A 3G6EN 1NWKA 4A59A 4WCEL 3SJHA 4WQ5C 3C7NB 4YOVA 2YHWA 3O1WA 4L3QA 3UKRA 2V52B 4C1NI 4PL7A 4BRHA 2JWKA 5EVZA 2WC9A 3LDPA 3CPEA 3R1XA 3VEVA 1VQNN 3CD6N 4BG8A 4MLEA 5AQYA 3R9PA 3ULEB 4GVEA 3U9DA 3TSUA 3D2FB 1NGFA 2PFUA 2QWQA 1YIJN 3QICA 4JEPA 4BRFA 1NMDA 1P8ZA 3B8AX 4AM6A 5F2RA 3P4IA 1Q7YO 3ID6A 4Y0WA 5C0YA 3HSCA 2QI2A 2QW9A 3EKSA 3GE1A 3MWPA 1GLLO 4JD2B 2KLAA 3RSEB 5BN8A 1T44A 3F2KA 5AQHA 3HRGA 5AQVA 2YHXA 4I6MA 2P9SA 3BUZB 1NBWA 3HOSA 4H5TA 4YDUC 4BRPA 1VQLN 4B9QA 4EFHA 3KWIA 5GINA 1VQKN 4CD3A 3ZEUB 5GADP 5AQOA 3VEXA 4NLCA 2Q1NA 3JXUA 4WYBA 4JHDA 3CC2N 4H0TB 4CZEA 3H1QA 3G71N 1YJWN 4QS9A 1ESVA 3O80A 1SS6A 3I55N 1JJ2M 4FWPA 4FPBA 2KHOA 3H3NO 2Q36A 3DXMA 3ZX2A 3I56N 1QQMA 3LM2A 4A2BA 1GLAG 2I7PA 3U9ZA 4BVPA 2QTDA 1ATRA 3HBTA 3WQTA 1DT9A 3E1YA 1JCEA 2NRZA 3AAQA 3CMAN 4IXCA 4H5RA 2ZWHA 3NVKA 1RDUA 3F5TA 3HM8A 3SMPA 1VQON 5C15A 3D6RA 5EY4A 4YDUA 3WT0A 1Z6RA 3L0QA 1H1VA 1BA1A 1YXQA 1OVYA 3D2EA 4HTLA 3OW2M 3NMUA 4BC5A 4RWTA 1VQ9N 1GLJO 3R8EA 2A42A 3TTCA 2HF3A 3GBTA 3OA9A 4XH4A 3A5OC 2NRXA 3ZYYX 1U2VA 5BPLA 4JK8A 5AZIA 3LM9A 3I33A 3J7ZO 1YVNA 3VEOA 1O13A 4FWQA 3CPWM 3J8AA 4YORA 1VAZA 3WXKA 3C0BA 4I6MB 3VF2A 5LJVA 1BG3A 2P9LB 3W0LA 5BRDA 3MK6A 2FSNA 3CQXA 3EL2A 3QBXA 2F9TA 4BQZA 4H0PA 1MA9B 2GELA 2FF6A 3UKUA 4FOIA 4JHDB 4FWOA 3VEYA 1T3VA 2HOEA 3AARA 1GLEG 3QMLA 1G99A 4BR7A 1W97L 3DXMB 3SBTA 4BGBA 3VEZA 4FWLA 2F7TA 4F9OA 4KBOA 1QZ5A 3CHWA 4IFEA 4ISGA 1VQ5N 3EZWA 3TSPA 5FPNA 1GLFO 2QWLA 1BO5O 1YHQN 3ZX0A 4GV6A 4JKFA 2JWLA 1CZAN 1HKGA 2ASPA 2OTLN 2HBJA 1QQOA 2YX6A 4DHYA 4H0VB 1DEJA 3O9SA 4CZFA 1QVGM 3MCAB 4B1XB 2QA4N 3D2EB 4GV9A 2FLOA 1KXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWG A;  3M5R A;  4OPH A;  3OA9 A;  2KKZ A;  2RHK A;  3O9U A;  3P31 A;  4OPA A;  3P39 A;  3RVC A;  2GX9 A;  3F5T A;  3L4Q A;  3EE9 A;  3O9S A;  3O9T A;  3D6R A;  3P38 A;  3KWI A;  3EE8 A;  3O9R A;  3O9Q A; 
#chains in the Genus database with same CATH topology
 2P9P B;  4X62 K;  4O8K A;  4C23 A;  4BWM A;  3A5L C;  3FZF A;  3S3N A;  3DLH A;  3CCQ N;  2FC0 A;  4DTJ A;  2YJE A;  1M90 O;  4CFC A;  1WLJ A;  1QTM A;  4YOX A;  5AQR A;  4KHN A;  4FLW A;  1ILY A;  1UOC A;  5IWA K;  1ZBH A;  3KTQ A;  1VQP N;  1LWE A;  4JRQ A;  4IZ9 A;  5FRN A;  1JLQ A;  2A40 A;  3DLK A;  4RCH A;  3SUP A;  4ZTJ A;  3P38 A;  1S6P A;  1LW2 A;  3L2V A;  2AJQ A;  1TKZ A;  3JAM O;  2PY5 A;  1KSP A;  3SQ4 A;  3V1O A;  4G9Z A;  2Q0R A;  2IVN A;  4ISE A;  1C0M A;  4GMJ B;  1UA0 A;  3N4Q A;  2P9I B;  4DTS A;  3WXM B;  3KLI A;  1VSK A;  5AZJ A;  5I3U A;  3OS0 A;  1NLV A;  3LZJ A;  1G15 A;  1X3N A;  3IFR A;  3O3F A;  2V51 B;  4WQ5 A;  3VPZ A;  3NH0 A;  1RDB A;  3QEW A;  4FL9 A;  5CYQ A;  1RGI A;  5DMR A;  4E7K A;  1HYS A;  5C10 A;  3AV9 A;  4RG8 A;  3F9M A;  4A5A A;  1XUP O;  3QO9 A;  2UYT A;  1Z05 A;  2W41 A;  4CER A;  3J81 O;  3EEQ A;  1QHA A;  5HLF A;  2P5G A;  4HTU A;  3EKU A;  4CFA A;  4NCB A;  4BVO A;  1WSG A;  3DMJ A;  3AVN A;  5E84 A;  5H1S Q;  3OYB A;  2D5R A;  1IBK K;  1RTI A;  3WNE A;  5JVH L;  5KRT A;  3VA0 A;  4DQQ A;  2QWR A;  4FOE A;  3VQE A;  4JI7 K;  3NVM A;  3GL1 A;  5AZJ B;  4BE2 A;  2ZM6 K;  3PIO L;  2R7Y A;  1X9J A;  1WSF A;  2P9S B;  5KI6 A;  3FFK B;  2O8B A;  1XHX A;  1BOT O;  1S1T A;  5AFU H;  5AQF A;  1TAU A;  2GEM A;  4H5V A;  4CEA A;  1OH5 A;  2VQF K;  3VGM A;  4KI6 A;  1BDG A;  3MDQ A;  4ILJ A;  1HQU A;  2VYP A;  5CYM A;  3AVH A;  2BDP A;  4RW4 A;  3CC4 N;  1HNZ K;  3C7N A;  3QEI A;  5EU7 A;  1NGI A;  2Z1G A;  4CJQ A;  3QES A;  2O8C A;  1Y64 A;  3IUC A;  4M3U A;  3D2F A;  1Q86 O;  4EHT A;  1D9D A;  4UQG A;  1YT3 A;  4H0Y B;  2PYL A;  4ZTF A;  5AQP A;  4WFA L;  5HL7 L;  4IFY A;  1Z26 A;  5AQW A;  2ZF5 O;  4BRD A;  4B3O A;  1KFS A;  3VA3 A;  4LSL A;  2IDO A;  3LWM A;  3CJC A;  3NAE A;  3K57 A;  2P51 A;  1VSJ A;  3MCP A;  4LFA K;  4GVM A;  3M8P A;  1FKO A;  1ATN A;  2WBN A;  5M1O A;  3VTI A;  4R79 A;  5AQZ A;  1W9H A;  4HUE A;  4NYF A;  1X9M A;  4ID1 A;  1S72 N;  2HHV A;  2P5O A;  4QS7 A;  5AQX A;  3VF6 A;  5FDL A;  1KC8 O;  2JLE A;  5M1N A;  1DLO A;  3AVG A;  4JK9 A;  1QSS A;  4GKJ K;  2OPP A;  3SV3 A;  3RRG A;  1S1V A;  3UB5 A;  4KHW A;  3DXK A;  3EY1 A;  3LL3 A;  3H46 O;  1OVQ A;  2F96 A;  1WAF A;  4CZM A;  2QEX N;  3FZK A;  2XHB A;  4KTW A;  4OGC A;  4EP5 A;  3THX A;  3PO4 A;  4NXN K;  1NGH A;  2PZS A;  2DY4 A;  1YIT N;  3AGK A;  3OYM A;  2QKK A;  1J9A A;  2X6S A;  4X64 K;  5B8H A;  1BUP A;  4FJ8 A;  4K42 A;  3OBY A;  5M1K A;  1KAZ A;  1BQM A;  5AQK A;  2IVP A;  4BRQ A;  4DU3 A;  1D4X A;  4GW6 A;  2P9L A;  4DV7 K;  3VEW A;  1X1P A;  3AO1 A;  1NK7 A;  4G1Q A;  3PUF A;  4A5B A;  1RT3 A;  2GWJ A;  3O4Q A;  4C8N A;  4YOY A;  5J2M A;  3BEX A;  2O4I A;  3UE5 A;  1U04 A;  4HUF A;  3CER A;  1NOY A;  2CH5 A;  1J54 A;  4GNI A;  1BIZ A;  4FW2 A;  2IAJ A;  1ASU A;  4Y1D A;  3OYE A;  3VET A;  2EHG A;  3O4W A;  3DXK B;  3ZX3 A;  5I9E B;  4ILG B;  4BR4 A;  3V9Z A;  3SUN A;  4GKK K;  5C25 A;  4CF1 A;  1ASW A;  4O44 A;  3THX B;  4F3T A;  5CE3 A;  3EZ5 A;  1DTQ A;  1S1X A;  4DTP A;  1KVA A;  1WN7 A;  3R6M A;  1U6Z A;  4CBU A;  2IVO A;  3VF4 A;  1BHL A;  1A5V A;  4KHQ A;  4FVM A;  4KV8 A;  1T6C A;  3KK7 A;  4CK3 A;  1IG8 A;  2PAV A;  3RMA A;  4FJG A;  3TPQ A;  5EOY A;  4QAG A;  4FWK A;  3CI5 A;  4FK4 A;  1VSI A;  3CFO A;  2YI1 A;  3L4I A;  1N36 K;  3HP6 A;  3NF9 A;  4O5B A;  3VMF B;  5AQT A;  3T1Y K;  1QQC A;  4M7Y A;  2PYJ A;  4M3R A;  5A2Q O;  2XY8 A;  4MLH A;  4J2D A;  2QM1 A;  5AFU A;  2HHT A;  2YJF A;  3AVA A;  5BRH A;  2I5J A;  1HRH A;  1JL2 A;  5KPZ A;  1KLN A;  4KPY A;  3C6U A;  5DM7 L;  1R0A A;  3VQ4 A;  3SAG A;  1FK9 A;  2E2O A;  5HP1 A;  4Z4C A;  4I9Q A;  4FLU A;  3FZH A;  4FYD A;  3ZEU A;  1KAX A;  3RMB A;  3G25 A;  2F8S A;  4O0I A;  2NRV A;  2HHS A;  3VQ6 A;  1N6Q A;  2ITM A;  4C1N K;  3K5O A;  2KFZ A;  1BQN A;  3HM9 A;  1K9M O;  3ZSO A;  1TYQ A;  4NO7 A;  3DRR A;  5BN9 A;  3ZCM A;  1NJX A;  4M3T A;  4A59 A;  1KVC A;  5HRS A;  2YHW A;  3TAE A;  3UKR A;  1WAJ A;  4C1N I;  2JWK A;  5EVZ A;  2WC9 A;  1B9D A;  1UAX A;  3QER A;  4Q0B A;  4DMN A;  1S5J A;  4OPK A;  1YIJ N;  1N33 K;  3ASM A;  5C0Y A;  1JLF A;  3GE1 A;  3TAF A;  1LV5 A;  1T44 A;  3F2K A;  4H5T A;  4EFH A;  1UWB A;  4CD3 A;  3IRX A;  3ZEU B;  5GAD P;  3NGZ A;  2W6K A;  1VSE A;  2Q1N A;  1U45 A;  1FXX A;  4JHD A;  1VSF A;  3G71 N;  4IBN A;  4QS9 A;  1ESV A;  1SS6 A;  4FM1 A;  2DFE A;  2KHO A;  2XY5 A;  3AA2 A;  2YNI A;  4H8K A;  3I56 N;  1CZ9 A;  1IV0 A;  2OYQ A;  1JLE A;  1EX4 A;  3WQT A;  1DT9 A;  4K8Z A;  3PSF A;  3I8D A;  3S3O A;  3CMA N;  4IXC A;  4H5R A;  4CJW A;  2YNH A;  5C15 A;  3THW A;  5LMU K;  4M3W A;  1Z6R A;  2BAN A;  1L3T A;  1YTA A;  1OVY A;  3D2E A;  3OYG A;  4HHT A;  3OW2 M;  3NMU A;  4BC5 A;  3R8E A;  2A42 A;  3RTV A;  3LPT A;  2OCE A;  3J7Y P;  3L2Q A;  3OA9 A;  2NRX A;  3ZYY X;  2DTU A;  1QS4 A;  3LM9 A;  4QOZ B;  1YVN A;  4FWQ A;  1VK0 A;  4LF7 K;  3J8A A;  1VAZ A;  2O8D A;  2KZZ A;  3KIO A;  4CF2 A;  4C8O A;  5BRD A;  4CGJ A;  3CQX A;  3ZT3 A;  2F9T A;  4H0P A;  3K5L A;  4FOI A;  4JHD B;  3RR7 A;  2HOE A;  3AAR A;  4BR7 A;  4J2E A;  3SBT A;  3AVB A;  4N41 A;  3VEZ A;  2F7T A;  4F9O A;  4KBO A;  1QZ5 A;  1GLF O;  4IFV A;  3OS2 A;  1CZA N;  2OTL N;  4M45 A;  2HBJ A;  3AA5 X;  4B08 A;  2HVI A;  4H0V B;  3QLH A;  4FLT A;  1TAQ A;  4I2Q A;  3D2E B;  1ZBI A;  3ZSZ A;  5JVG L;  4CJU A;  3E9O A;  4IOX A;  3SJJ A;  3HZ6 A;  2NLX A;  1IKY A;  4IG3 A;  3HK2 A;  5CHI A;  2OZM A;  1SKR A;  2Q2R A;  2B4J A;  1IBM K;  4CGH A;  4K43 A;  4LC9 B;  1RTD A;  4IJA A;  3OYJ A;  4B8C A;  3IG1 A;  1VQ6 N;  2O8F A;  1X9W A;  3OY9 A;  4DTU A;  4JI8 K;  4NLB A;  4OPJ A;  4Z4H A;  5AQI A;  3SAF A;  5AQS A;  1BCM A;  3OYI A;  3TTD A;  4A62 A;  3CJ9 A;  1NK8 A;  4BC2 A;  1NG9 A;  3GG4 A;  4EHU A;  4XH5 A;  2P9N A;  3PO5 A;  2A1R A;  4O5F A;  1S1U A;  1HPM A;  4FJJ A;  4LF6 K;  2YNG A;  4CBX A;  3MEG A;  4DTR A;  4JV5 K;  5JIC A;  3TAN A;  5SZT A;  4KAZ A;  1MU2 A;  5HRN A;  4B3S K;  1WSJ A;  4J2B A;  1SAZ A;  5ADX H;  2FSK A;  5CZ2 A;  3M8S A;  1FKP A;  5M1F A;  1NGA A;  3OVN A;  4KRF A;  4E1N A;  1LCU A;  3T69 A;  3SUO A;  2VCP A;  5TKY A;  4DF4 A;  3CCU N;  4AQY K;  3V6D A;  2NRH A;  5J2P A;  4ELV A;  4DQ8 A;  5BR9 A;  4JN4 A;  1FJG K;  1W7A A;  4MDB A;  1XQS C;  4FM0 A;  4E7I A;  1E4F T;  2ZGZ A;  5E26 A;  2RHK A;  4ZHR A;  2QWO A;  3P39 A;  4DV5 K;  1U47 A;  3RVC A;  2V7Y A;  1JLC A;  1YVU A;  3NBP A;  3MED A;  3MXJ A;  3OYD A;  2E8A A;  3CC7 N;  1W0H A;  4LF5 K;  4O4G A;  4PHT X;  3O9R A;  3HVR A;  1ZC6 A;  4CED A;  1K73 O;  2Q31 A;  3VEN A;  4XIU A;  2AP1 A;  3B6O A;  1OH6 A;  1EET A;  3CJ7 A;  4DQP A;  5M1Q A;  3H45 C;  4CHO A;  4DKW A;  1BI4 B;  4A2A A;  2D0A A;  4JKH A;  3THY B;  3L6Q A;  4M3X A;  4Z4E A;  1YJ9 N;  1YJN N;  4CI6 A;  1ITG A;  4FJX A;  1CLQ A;  5E41 A;  1N32 K;  1N34 K;  2JGU A;  3VQC A;  2F9W A;  3CCS N;  2Q97 A;  4BRG A;  3ULE A;  5KRS A;  1TUY A;  1EQY A;  4YY3 K;  3DRS A;  4BR5 A;  3GDQ A;  1T7P A;  1RBR A;  1U2V B;  4O55 A;  1DKG D;  4OX9 K;  4JKA A;  2D4W A;  4YOW A;  3KJV A;  4H03 B;  2HBM A;  1Y97 A;  1I3A A;  2E6L A;  1T6D A;  4V19 S;  4DR7 K;  1LAW A;  1WB9 A;  1UA1 A;  4KTZ A;  2DFH A;  3U3G A;  3M1F A;  3AO4 A;  3O9T A;  4FLX A;  2GWK A;  4H4M A;  3ZET A;  5IT9 O;  4CEZ A;  2BUP A;  2NNW A;  3UKU B;  2QXF A;  2E88 A;  2G8H A;  3QFP A;  1MWM A;  5FPM A;  4K0K K;  2D0B A;  3CIP A;  3SBG A;  3S9H A;  5I42 A;  2G8W A;  4JI1 K;  1XC3 A;  3TAB A;  1GLC G;  1M1K O;  1EXQ A;  4F2R A;  5BRE A;  4WQ4 C;  4DTN A;  3ZSR A;  1RT6 A;  1NM1 A;  3AVC A;  1TGO A;  4ISF A;  3HI0 A;  3VGK A;  2F8T A;  2ZJP L;  4B1W B;  4DQS A;  2ZJQ L;  5M1P A;  4KH5 A;  1ZBF A;  4JKD A;  4FPA A;  5HBM A;  3KWG A;  2Z1I A;  3ITH A;  2HMI A;  1OH7 A;  3ZSQ A;  3MXI A;  2NRT A;  4JKE A;  3O5B A;  3KK1 A;  4CEF A;  4OKE A;  4FZZ A;  3S41 A;  4CJL A;  2AA4 A;  3HPH A;  3NH1 A;  2EX3 A;  4WQ4 A;  5AQG A;  1T03 A;  4IOC L;  1L3V A;  4FXD A;  3ZET B;  3LAN A;  3WEE A;  3CYM A;  3JS6 A;  3TAG A;  3P1G A;  2WOM A;  3TTF A;  3IDH A;  1S1W A;  4BE0 A;  4DWI A;  2ZGY A;  2YCH A;  1NJY A;  4RTF D;  4DTO A;  4K41 A;  3SV4 A;  3OTO K;  1KCF A;  3D45 A;  4EAH D;  3M6G A;  2HHW A;  3NGY A;  5ADX A;  3HP9 A;  3DLL L;  2VWJ A;  4DSI A;  4AF1 A;  4DR4 K;  3QB0 A;  3U4L A;  2VWB A;  3LP2 A;  3WUH A;  4U67 L;  3NFA A;  3JYT A;  1NK6 A;  1C1A A;  4DTM A;  1YI2 N;  4LY7 A;  5T7B A;  1J6Z A;  4FSV A;  1RDD A;  3DOL A;  4CJV A;  1KFD A;  2O4G A;  4DR1 K;  4CZL A;  4CGG A;  2Y1J A;  1HNV A;  2P9U A;  3MWT A;  2QWP A;  3TR8 A;  4QCL A;  4MO4 A;  5KGW A;  2P9K A;  2D0C A;  4PL8 A;  1HNI A;  5GAH P;  4FJN A;  4O0J A;  2E2N A;  3WEE B;  2CGL A;  5GAG P;  4IKF A;  1WOQ A;  4IJN A;  1LWC A;  1NU0 A;  4JKG A;  5C12 A;  3HO1 A;  4CFD A;  4DFJ A;  3CET A;  5FRO A;  1YTU A;  1IH7 A;  3H6E A;  1YUW A;  3B6P A;  1CXU A;  2GTD A;  1WNS A;  3V9U A;  4FZX C;  1JCF A;  3VER A;  2OTJ N;  2O8B B;  3C65 A;  5JLH A;  3CCM N;  3FR0 A;  4KHY A;  2ETJ A;  3A5M C;  3U8X A;  4EZ9 A;  2YHA A;  3LAK A;  4FLV A;  4Z4G A;  3VQA A;  3AA4 A;  5FRM A;  1IKW A;  3FLC O;  3QDK A;  2E2Q A;  4K8X A;  3E9P A;  4DQR A;  1I39 A;  1EWR A;  3C6A A;  4CVN E;  3V9W A;  2ASO A;  3MX5 A;  3K0S A;  5HRP A;  5JS1 A;  1HKB A;  3G6E N;  2FBV A;  3C95 A;  4KTQ A;  3C7N B;  1D9F A;  3O1W A;  2V52 B;  4BRH A;  3NE6 A;  1SUQ A;  3LDP A;  3PSI A;  3VEV A;  3KKR A;  4AH9 A;  4LF4 K;  2A1S A;  4BG8 A;  1VQN N;  4MLE A;  2O8C B;  5AQY A;  3R9P A;  4GVE A;  3U9D A;  3D2F B;  2QWQ A;  4CJT A;  3M8R A;  3ZT1 A;  4AHT A;  1T05 A;  5F2R A;  3P4I A;  4KFB A;  4YFU A;  3EKS A;  3MWP A;  1GLL O;  3IS9 A;  4E0D A;  2ZE2 A;  5AQH A;  4E7L A;  2YHX A;  4CGD A;  3BUZ B;  1NBW A;  4CE9 A;  4YDU C;  3PX4 A;  1JL1 A;  5GIN A;  3VEX A;  4NLC A;  4F2S A;  3CC2 N;  1LW0 A;  3H1Q A;  1QE1 A;  3O80 A;  3I55 N;  4FPB A;  2Q36 A;  3DXM A;  3LM2 A;  3H08 A;  4DLE A;  4ELT A;  4BVP A;  2IOC A;  2NRZ A;  3D6R A;  4DSL A;  4YDU A;  1O1W A;  2VG6 A;  1SL1 A;  5K14 A;  4RWT A;  1VQ9 N;  1JLB A;  3SPZ A;  1C6V A;  3OYC A;  1NJW A;  4DR6 K;  1TK5 A;  1C0U A;  4XH4 A;  2GUI A;  3A5O C;  1B92 A;  1F21 A;  2RN2 A;  5AZI A;  3NDK A;  4ELU A;  2IS3 A;  1O13 A;  1C1B A;  3WXK A;  3NF7 A;  5LJV A;  2P1J A;  2P9L B;  3MEE A;  3MEC A;  3EL2 A;  1XC9 A;  4KI4 A;  4YNQ A;  2GEL A;  1T3V A;  5JS2 A;  4KO0 A;  4CF9 A;  3O3H A;  1GLE G;  1G99 A;  1W97 L;  3DXM B;  3LP0 A;  3ZSX A;  4BGB A;  1RIL A;  3P5J A;  4W5T A;  2VG7 A;  3AA3 A;  3CHW A;  4FCY A;  1VQ5 N;  3TSP A;  5C42 A;  4GV6 A;  4JKF A;  4PQU A;  2ASP A;  3HPO A;  3L8B A;  4N5S A;  1JLG A;  2YX6 A;  2YKM A;  3ALY A;  1DEJ A;  3O9S A;  4CF8 A;  1QVG M;  4GV9 A;  4BRE A;  5AQL A;  1EO1 A;  1KQS M;  4IO8 A;  3FFI A;  2BTF A;  4CGF A;  4LF8 K;  4CZG A;  4Z4I A;  4Z4F A;  2Y1I A;  4BE1 A;  4CK1 A;  1EWQ A;  1BWF O;  1TL3 A;  4M3Z A;  2VG5 A;  4YOT A;  4IG0 A;  2QWN A;  1GOC A;  4XH1 A;  1U4B A;  1HQE A;  3H1V X;  4M63 C;  5TKW A;  2XY7 A;  1U49 A;  1NGB A;  3J7A P;  1BA0 A;  1V4T A;  4DR3 K;  1YAG A;  4IDK A;  5ELZ A;  3I0R A;  4ILH A;  3LDQ A;  4FWR A;  5F0X A;  4HCB A;  5AQU A;  3AO3 A;  3KZB A;  1VQ7 N;  5LJW A;  3HOT A;  4N47 A;  1QSL A;  3DI6 A;  1NK5 A;  1NJI O;  4OLB A;  3L2R A;  4CZI A;  3ZT0 A;  3OBW A;  3M8Q A;  1Q9Y A;  4DSK A;  3M3Z A;  3SI6 A;  3K59 A;  2XY6 A;  5LMN K;  4H5N A;  4B1Y B;  1SL2 A;  1NJZ A;  2HF4 A;  4CEC A;  1I94 K;  1QVF M;  4DF8 A;  4JK7 A;  1NGG A;  4DTX A;  3VQD A;  5J2N A;  4NCA A;  5KTQ A;  4CJ7 A;  4B3M K;  4CEB A;  4NXM K;  1TYQ B;  2WTU A;  2DFF A;  5AQJ A;  1WSE A;  1E4G T;  3UKR B;  3P83 D;  5LL6 Z;  3NHG A;  3VQP A;  3KK3 A;  2WON A;  1QQN A;  2VQE K;  2ATQ A;  4JKC A;  2FXU A;  3RRH A;  2G8K A;  3CME N;  2UUA K;  2NRR A;  3CCL N;  4XEI A;  2CGJ A;  4ID5 A;  4BC3 A;  1RFQ A;  2W42 A;  4BY9 C;  4CEQ A;  3O4N A;  3LAM A;  3P31 A;  4E7H A;  5KQ8 A;  3TAM A;  1MDU B;  2BGG A;  4KKO A;  3HXM A;  1ZBL A;  3OYF A;  3QIN A;  4CJF A;  2KFN A;  3BZK A;  3ENH A;  1TKD A;  3VQQ A;  2UUB K;  1RT5 A;  5GIP A;  3RWU A;  5C24 A;  4CIG A;  4PKG A;  4AHS A;  3C94 A;  2CH6 A;  3HJF A;  3TU5 A;  3SQ0 A;  1XMQ K;  3O9U A;  4FJ9 A;  3DLR A;  4FJL A;  2Q0U A;  5FPE A;  3KD1 E;  2G8U A;  4CK2 A;  3DLB A;  4J8F A;  4E1M A;  4FWM A;  3NH2 A;  5MLC Q;  3THW B;  1VSL A;  2UUC K;  4OKJ A;  3VTH A;  4B9T A;  2WUS A;  4MFB A;  3HL8 A;  4CIF A;  2EWS A;  4C8L A;  3L3V A;  1REV A;  4AHV A;  3M5R A;  3PX0 A;  2PBD A;  2OZS A;  3CG7 A;  1TUU A;  4N56 A;  1X3M A;  3CCV N;  2E2P A;  1R59 O;  1TL1 A;  4QS8 A;  3VQ7 A;  2O8D B;  3RSE A;  1TKT A;  3K9K A;  4JD2 A;  3LP3 A;  3CCJ N;  2GBZ A;  4FJI A;  1TV6 A;  4FJM A;  4IOA L;  1GOB A;  4B9U A;  3WXI A;  4DV6 K;  4UY8 O;  1HR0 K;  2YKN A;  4CES A;  3IKM A;  2GV9 A;  2GUP A;  2I7N A;  1RDW X;  1C0G A;  5C2D A;  1XWL A;  3MXM A;  2ASM A;  3QBW A;  1SZ2 A;  3L3U A;  3K2P A;  4JS4 A;  3L2W A;  1NKB A;  5JMV A;  2A6A A;  3T7Z A;  2CGK A;  4DS5 A;  3QEV A;  2YHY A;  3MMV A;  1A5W A;  2A41 A;  1DTT A;  3TWH A;  3TSQ A;  3Q7B A;  1WBD A;  4JLH A;  1RBU A;  3U6F A;  3U3Y A;  3FZM A;  4W5Q A;  1NGC A;  4H5W A;  4CCH A;  3WNG A;  5BPM A;  3ZLJ A;  3L4Q A;  1HMV A;  2IC3 A;  4R5P A;  3LDO A;  4BG9 A;  1JCG A;  1MWK A;  4X66 K;  4B8A B;  3VOV A;  4M7X A;  4Z0U A;  4DSF A;  2O8F B;  4DU1 A;  4EZ6 A;  4NB4 A;  3IAY A;  1Q18 A;  3DWL A;  1IKV A;  4H0O A;  1ZXO A;  3WQU A;  1GOA A;  4BRN A;  1HJR A;  5HRR A;  3E9L A;  4WFN L;  2D0P A;  4RW7 A;  1S9E A;  2UXD K;  3DRP A;  2P9N B;  1W2B M;  1JXB A;  4B9S A;  4W5R A;  3CF5 L;  1IBL K;  2YHB A;  3O08 A;  4NYN A;  4DCH A;  2FBX A;  2E1Z A;  2VWK A;  2NRW A;  5GIO A;  2IGI A;  1CXQ A;  3ULD A;  4B1V A;  5AQM A;  3AVM A;  2P9P A;  2W40 A;  3V4I A;  2J4R A;  3KHY A;  1TK0 A;  4RW8 A;  3OJS A;  4WE1 A;  4BRI A;  1K8A O;  1SKW A;  1B9F A;  4BDP A;  2XRI A;  4IO9 L;  4H0X B;  3BGR A;  1K6Y A;  4GY2 B;  4FM2 A;  1FW6 A;  4ICL A;  1P90 A;  4CZJ A;  4E89 A;  4FLZ A;  3QEP A;  4F4K A;  3N4P A;  3R3L A;  1HYZ A;  1EP4 A;  2FBY A;  3BP8 A;  3LP1 A;  4A57 A;  3QEX A;  4EIA A;  1NGE A;  3QET A;  3S3M A;  5EXW A;  3PY8 A;  3LZI A;  3WNH A;  1QZ6 A;  4AM7 A;  2P9I A;  1BIS A;  4CBW A;  1HUX A;  2ITG A;  5JLF A;  3KLE A;  1XNR K;  3O6W A;  3C6T A;  3DOK A;  4CJ3 A;  1RDC A;  1HKC A;  2QK9 A;  3QIP A;  4KHS A;  4DB3 A;  5F1X A;  3EYZ A;  2KW4 A;  3OYA A;  4BRC A;  4OJR A;  3G0Z A;  3CQY A;  4PKI A;  4GV3 A;  3W3D A;  5KQD A;  3QNO A;  1Q81 O;  1VQ4 N;  5FPD A;  1RTH A;  5CZ1 A;  2OAN A;  4BC4 A;  3ID8 A;  3K9J A;  1YF5 L;  4HWI A;  1NWK A;  3ZT4 A;  4WCE L;  3RMD A;  4B9N A;  4WQ5 C;  1N5Y A;  3KD5 E;  4YOV A;  4L3Q A;  4PL7 A;  4B3T K;  3ZSV A;  4M41 A;  3CPE A;  3R1X A;  2G8I A;  3V1Q A;  1SKS A;  1HPZ A;  1RTJ A;  3ULE B;  1SL0 A;  4BRF A;  3KK2 A;  1P8Z A;  4AM6 A;  1NK9 A;  2ZQB A;  3ID6 A;  3SYZ A;  3HSC A;  2QI2 A;  5BN8 A;  4LH4 A;  2KLA A;  2X6N A;  4OVL A;  4I6M A;  2P9S A;  3HOS A;  1VQL N;  4L8R B;  4B9Q A;  3KWI A;  1VQK N;  2KQ2 A;  4FJH A;  3NCI A;  1ZBU A;  3NF6 A;  4H0T B;  3LAL A;  3BY5 A;  4CGI A;  3KLG A;  1WSI A;  1NMN A;  1QQM A;  1JLA A;  3HPG A;  1RNH A;  2I7P A;  1L5U A;  3U9Z A;  1ATR A;  2QTD A;  3HBT A;  3E1Y A;  3V81 A;  3T3F A;  3VQ9 A;  2ZWH A;  1VQO N;  1OH8 A;  3A2F A;  5EY4 A;  3NF8 A;  4C8M A;  2HND A;  1L3U A;  3L0Q A;  2HNY A;  5FLX O;  1YXQ A;  3L2U A;  4HTL A;  1GLJ O;  3TTC A;  3ZSY A;  2HF3 A;  4YHH K;  3I0S A;  1RBS A;  5CY4 A;  5BPL A;  3I33 A;  4C8K A;  2Z1J A;  3CPW M;  1TVR A;  3C0B A;  4I6M B;  3VF2 A;  4FLY A;  1D8Y A;  1BG3 A;  4PA1 A;  1RT2 A;  3W0L A;  2QKB A;  3MK6 A;  2FSN A;  3QBX A;  4FK0 A;  4BQZ A;  3OYL A;  3VEY A;  4FWO A;  1QHT A;  3LPU A;  3QML A;  1WBB A;  2HW3 A;  3CM6 A;  4RW6 A;  4FWL A;  4IFE A;  4DFM A;  1BO5 O;  1YHQ N;  3ZX0 A;  4JS5 A;  4PUO A;  1QQO A;  4CHZ A;  4DHY A;  1IG9 A;  3G10 A;  4X65 K;  4CZF A;  1ZYQ A;  4DFP A;  3MCA B;  4B1X B;  3CFR A;  1HYV A;  3BDP A;  4TSX A;  1IO2 A;  4B1Z A;  4DG1 A;  3OYN A;  3LDL A;  4K25 A;  4JRP A;  4OPH A;  2P9U B;  3SMS A;  5C2F A;  3AVL A;  2XO7 A;  4I2P A;  2P9K B;  2HBK A;  4OPA A;  4IWV A;  4B1U B;  1RBV A;  1BU6 O;  2DPN A;  4BR2 A;  3TI0 A;  4FZY A;  4BRL A;  2LSN A;  1JKH A;  2E1Y A;  4YOU A;  2QWM A;  4JKG B;  3D7E O;  3C6H A;  3BF1 A;  1BL3 A;  4DS4 A;  3ENO A;  3O1B A;  3Q7C A;  1XHZ A;  4JAX A;  3MN6 A;  1HX1 A;  3UIQ A;  1HLU A;  4JI5 K;  4AHR A;  1RBT A;  3F73 A;  1KTQ A;  2Z1H A;  2A3Z A;  3CXC M;  3OYK A;  4Z94 A;  4CHQ A;  2X78 A;  4BDY A;  4KHP K;  3VGL A;  2D1K A;  2FSJ A;  4BGA A;  4JI3 K;  2E4L A;  5J2Q A;  1Q82 O;  3EE8 A;  3HST B;  3OS1 A;  4FVU A;  2BH1 A;  5AQQ A;  4IEE A;  5BPN A;  1DGK N;  3D0P A;  3ZSW A;  4NCG A;  4B9V A;  3DYA A;  1GLB G;  1XMO K;  1S9G A;  2G8V A;  4FJ7 A;  1LAV A;  1Q9X A;  1Z25 A;  3J80 O;  4U7B A;  3AVI A;  4BRM A;  4M3Y A;  3THV A;  1HNX K;  2HHU A;  3EN9 A;  3DJC A;  1N8R O;  3AAP A;  2NZT A;  3AY9 A;  2HMP A;  3MX2 A;  4LFC K;  1NK4 A;  4JI6 K;  4JYA K;  1NKE A;  2GX9 A;  1VRT A;  3V9S A;  3JSM A;  4DSJ A;  1TK8 A;  3K5M A;  3PLA A;  3EE9 A;  2RPI A;  4Q5V A;  1C1C A;  3RR8 A;  5AQN A;  3A0I X;  1EKE A;  4FK2 A;  3WNF A;  4DLG A;  1BGX T;  4DFK A;  1NGJ A;  4FJK A;  3CFP A;  1X9S A;  1K8K A;  3SZ2 A;  3KLF A;  2UXC K;  4MDA A;  4DQI A;  4LD0 A;  1VQ8 N;  4FJ5 A;  2FF3 B;  3IMX A;  3DAW A;  1TKX A;  1LOT B;  1WSH A;  5KPT A;  2G8F A;  4DV1 K;  4DSE A;  2E20 A;  4IDH A;  4JI4 K;  4CZK A;  5EX5 A;  1KAY A;  4H4O A;  3T1A A;  3HTV A;  4CJR A;  3I8B A;  2H3G X;  5KGX A;  4CD1 A;  1XI1 A;  3QNN A;  5SWM A;  3CCR N;  3F9K A;  2HNZ A;  3FGU A;  5AZI B;  4CZH A;  1J53 A;  3AVK A;  3QFU A;  5DM6 L;  3SUQ A;  1D5A A;  4AHU A;  3HYF A;  5AR0 A;  2A5X A;  4OGE A;  2IIR A;  1HNW K;  2OPR A;  2BE2 A;  3SLC A;  4JNE A;  1IJJ A;  2HBL A;  4O8U A;  3PIP L;  4CW7 B;  4BRK A;  3O9Q A;  1KLM A;  3ATU A;  5AJ3 K;  2OA8 A;  3A5N C;  1K8K B;  3MN5 A;  1SV5 A;  3K58 A;  4CEO A;  2KKZ A;  3K5N A;  3CCE N;  1VHX A;  4RW9 A;  1HJO A;  2UXB K;  3QIO A;  5LY3 A;  4A61 A;  5BRF A;  1KD1 O;  4HUG A;  1RDA A;  4BR0 A;  4LF9 K;  4JKB A;  1C0F A;  3DLE A;  3AGR A;  5KPR A;  3MN7 A;  3FE1 A;  5CR4 A;  2QXL A;  1V4S A;  4OLA A;  2X74 A;  2UU9 K;  1RT7 A;  1IKX A;  3ISN C;  4CJP A;  2B5J A;  3G4S N;  3ENB A;  1VSD A;  3VQB A;  4BRA A;  2E6M A;  4CJ5 A;  3MN9 A;  3DLG A;  4HVJ A;  4E19 A;  3E01 A;  4CEE A;  4DV2 K;  4BR9 A;  4B3R K;  4DUY K;  4LFB K;  3O8M A;  2HHQ A;  4E1J A;  2ZJR L;  5GAE P;  3E66 A;  4FWN A;  4FWS A;  1J5E K;  4J2A A;  3MAQ A;  4W5N A;  3SQ1 A;  3EO3 A;  1Q8I A;  4PKH A;  4IEI A;  1U48 A;  4KRE A;  1LWF A;  1SQK A;  3WXL A;  1VSM A;  2HB5 A;  5J1E A;  4KH6 A;  3SAH A;  2VGM A;  3DM2 A;  4CHP A;  4E3S A;  4BWJ A;  2D0O A;  4CJK A;  4DV0 K;  2Q3S A;  3SNN A;  1ATS A;  1RT4 A;  2W6L A;  3GOI A;  1XNQ K;  1WUA A;  3KKS A;  4PY5 A;  4DR2 K;  3CQ8 A;  4BAC A;  4OO1 J;  2RE2 A;  2KTQ A;  3LWL A;  3SPY A;  4FW1 A;  4CFB A;  2OPS A;  3H3O B;  4JI0 K;  1NNE A;  4BRO A;  3SK3 A;  3VES A;  3LDN A;  1S22 A;  4CHY A;  1S3X A;  4KB1 A;  4FO0 A;  2HST A;  3CJB A;  2VGN A;  2HHX A;  3SQ2 A;  3KVG A;  4BQL A;  5HRO A;  3OHR A;  1VQM N;  1OKJ A;  2O8E A;  2HHH K;  5HOO A;  3CJ1 A;  3A8Y A;  2WFB A;  3ATV A;  1BCO A;  3TAQ A;  3FZL A;  1NOZ A;  3T1H K;  4MO5 A;  2YV0 X;  1GLD G;  2YNF A;  3ZT2 A;  1ZBS A;  2ZD1 A;  2V7Z A;  4CJS A;  1RT1 A;  4CJ4 A;  1A5X A;  4JI2 K;  4WFB L;  3SCX A;  3CJA A;  3BZC A;  3AVF A;  4B9M A;  4LH5 A;  3WXJ A;  4AHC A;  4KH4 A;  4CIE A;  1NGD A;  3BF3 A;  4WF9 L;  3RMC A;  1QSY A;  3LDS A;  2B6A A;  3SJH A;  1KRP A;  4CF0 A;  3PX6 A;  4N76 A;  3CD6 N;  4W5O A;  4PWD A;  4CJE A;  1VSH A;  3TSU A;  1NGF A;  2PFU A;  2O8E B;  3QIC A;  4JEP A;  3V1R A;  1NMD A;  3B8A X;  1BIU A;  3HT3 A;  1Q7Y O;  4Y0W A;  1E3M A;  3RSE B;  2QW9 A;  4JD2 B;  1CZB A;  4B9L A;  2OPQ A;  3HRG A;  5AQV A;  3AO2 A;  4BRP A;  4MQ3 A;  3VN5 A;  5BR8 K;  5DK5 A;  2HVH A;  4HCC A;  5AQO A;  4I7F A;  1NKC A;  3JXU A;  2NUB A;  4WYB A;  4CZE A;  1KVB A;  1YJW N;  3AVJ A;  3TAP A;  1JJ2 M;  4FWP A;  3H3N O;  4DV3 K;  3NGI A;  3ZX2 A;  4A2B A;  2KZM A;  1GLA G;  1JCE A;  1BI4 A;  3AAQ A;  1VRU A;  3NVK A;  4DR5 K;  1JXE A;  1RDU A;  3F5T A;  4F8R A;  3HM8 A;  3SMP A;  1RCH A;  3THY A;  1NK0 A;  3WT0 A;  3HVT A;  1H1V A;  1BA1 A;  3O3G A;  3VQ8 A;  3GBT A;  2E5L K;  1U2V A;  4BDZ A;  4JK8 A;  4E7J A;  4KHU A;  4M42 A;  3J7Z O;  4F3O A;  3VEO A;  1ASV A;  4DU4 A;  3T19 A;  4YOR A;  2FBT A;  4OKK A;  1T8E A;  5D3G A;  3OJU A;  3OYH A;  1MA9 B;  2FF6 A;  3UKU A;  1C0T A;  1L3S A;  4I9L A;  4LSN A;  3TAR A;  4ISG A;  2RF2 A;  3EZW A;  3KLH A;  3CM5 A;  5FPN A;  3AO5 A;  2QWL A;  4AIL C;  4DV4 K;  3VQ5 A;  4EP4 A;  4CHN A;  2JWL A;  1HKG A;  2RKI A;  3PV8 A;  4KB0 A;  2F4V K;  1J5O A;  1S6Q A;  4Y1C A;  2QA4 N;  4DUZ K;  3V9X A;  2FLO A;  1KXP A; 
#chains in the Genus database with same CATH homology
 5AQL A;  1EO1 A;  2P9P B;  4B1Z A;  1KQS M;  5JVG L;  4O8K A;  3E9O A;  4IOX A;  4C23 A;  3LDL A;  3HZ6 A;  4IO8 A;  4K25 A;  4OPH A;  3A5L C;  3FZF A;  2P9U B;  3SMS A;  2NLX A;  5C2F A;  3CCQ N;  2BTF A;  2YJE A;  1M90 O;  5CHI A;  4CZG A;  2P9K B;  2HBK A;  4OPA A;  4IWV A;  5AQR A;  4B1U B;  4YOX A;  2Q2R A;  1ILY A;  1BU6 O;  2DPN A;  4BR2 A;  1VQP N;  4IZ9 A;  2A40 A;  4RCH A;  1BWF O;  3P38 A;  4BRL A;  4K43 A;  4LC9 B;  4YOT A;  2E1Y A;  4IJA A;  2QWN A;  4YOU A;  2QWM A;  4JKG B;  3D7E O;  3C6H A;  4XH1 A;  3BF1 A;  1VQ6 N;  3H1V X;  3ENO A;  3O1B A;  3Q7C A;  4M63 C;  5TKW A;  4NLB A;  1NGB A;  4G9Z A;  1BA0 A;  2Q0R A;  5AQI A;  1V4T A;  2IVN A;  3MN6 A;  1YAG A;  4ISE A;  4JAX A;  5ELZ A;  1HX1 A;  3SAF A;  1HLU A;  5AQS A;  4ILH A;  3LDQ A;  3N4Q A;  4FWR A;  5F0X A;  2P9I B;  3TTD A;  3WXM B;  4A62 A;  3CJ9 A;  5AQU A;  4BC2 A;  3KZB A;  3PIP L;  5AZJ A;  2A3Z A;  3GG4 A;  4EHU A;  5LJW A;  4XH5 A;  3HOT A;  1VQ7 N;  2P9N A;  3CXC M;  1NLV A;  4Z94 A;  1NJI O;  4O5F A;  1HPM A;  4CZI A;  3OBW A;  1X3N A;  4CBX A;  3VGL A;  2D1K A;  2FSJ A;  3IFR A;  4BGA A;  2V51 B;  3M3Z A;  4WQ5 A;  3VPZ A;  1Q82 O;  3EE8 A;  4FL9 A;  4FVU A;  4H5N A;  5JIC A;  4B1Y B;  1RGI A;  2BH1 A;  2HF4 A;  5C10 A;  5AQQ A;  4IEE A;  1QVF M;  4JK7 A;  1SAZ A;  3F9M A;  5ADX H;  1NGG A;  5BPN A;  2FSK A;  1XUP O;  4A5A A;  1DGK N;  2UYT A;  1Z05 A;  5M1F A;  1NGA A;  2W41 A;  4CJ7 A;  1TYQ B;  1LCU A;  3T69 A;  1GLB G;  2VCP A;  5AQJ A;  1QHA A;  5TKY A;  1E4G T;  3EKU A;  3CCU N;  3UKR B;  4BVO A;  1QQN A;  4U7B A;  2NRH A;  4BRM A;  5E84 A;  5H1S Q;  4DQ8 A;  4JKC A;  2FXU A;  5BR9 A;  4JN4 A;  5JVH L;  3CME N;  4MDB A;  1XQS C;  2NRR A;  3CCL N;  4XEI A;  1E4F T;  3EN9 A;  2CGJ A;  3DJC A;  1N8R O;  2QWR A;  2ZGZ A;  4FOE A;  4BC3 A;  1RFQ A;  5E26 A;  2RHK A;  3AAP A;  2NZT A;  4BY9 C;  3AY9 A;  3NVM A;  2HMP A;  3MX2 A;  2QWO A;  3GL1 A;  3P31 A;  5AZJ B;  3P39 A;  5KQ8 A;  3RVC A;  1MDU B;  2V7Y A;  2GX9 A;  1X9J A;  3PIO L;  3PLA A;  2P9S B;  3EE9 A;  3FFK B;  2E8A A;  3ENH A;  3CC7 N;  5AQN A;  1BOT O;  4PHT X;  3A0I X;  3O9R A;  5AFU H;  5AQF A;  1NGJ A;  1ZC6 A;  2GEM A;  4H5V A;  5GIP A;  1K73 O;  2Q31 A;  1K8K A;  3VEN A;  3VGM A;  4PKG A;  1BDG A;  3MDQ A;  2CH6 A;  4ILJ A;  4MDA A;  2AP1 A;  2VYP A;  3CJ7 A;  3TU5 A;  3O9U A;  1VQ8 N;  2Q0U A;  5M1Q A;  2FF3 B;  3H45 C;  3IMX A;  5FPE A;  3DAW A;  1LOT B;  5KPT A;  4J8F A;  4DKW A;  4A2A A;  4FWM A;  4JKH A;  5MLC Q;  3L6Q A;  3CC4 N;  3C7N A;  3VTH A;  1YJ9 N;  2E20 A;  4CI6 A;  1YJN N;  2WUS A;  4IDH A;  1NGI A;  4CZK A;  5EX5 A;  1KAY A;  2EWS A;  2F9W A;  1Y64 A;  3CCS N;  2Q97 A;  3HTV A;  3IUC A;  4BRG A;  3M5R A;  3ULE A;  3I8B A;  2H3G X;  4CD1 A;  3D2F A;  1TUY A;  1EQY A;  2PBD A;  3CCR N;  4EHT A;  1Q86 O;  4BR5 A;  3GDQ A;  1TUU A;  4H0Y B;  1U2V B;  5AQP A;  1DKG D;  3FGU A;  4JKA A;  2D4W A;  5AZI B;  1X3M A;  4WFA L;  5HL7 L;  4YOW A;  5AQW A;  4H03 B;  4CZH A;  2HBM A;  2ZF5 O;  3QFU A;  5DM6 L;  4BRD A;  5AR0 A;  1T6D A;  2A5X A;  2E2P A;  1R59 O;  2IIR A;  4QS8 A;  3RSE A;  3K9K A;  4JD2 A;  3SLC A;  3M1F A;  3CCJ N;  4IOA L;  3O9T A;  3CJC A;  4JNE A;  2GWK A;  3ZET A;  1IJJ A;  3WXI A;  3MCP A;  2BUP A;  2HBL A;  2NNW A;  4UY8 O;  4O8U A;  1ATN A;  2WBN A;  5M1O A;  3UKU B;  4BRK A;  2E88 A;  3IKM A;  3ATU A;  3O9Q A;  3VTI A;  4R79 A;  3A5N C;  1MWM A;  3QFP A;  5AQZ A;  1K8K B;  3MN5 A;  5FPM A;  3CIP A;  2GUP A;  3SBG A;  2I7N A;  1RDW X;  1XC3 A;  1C0G A;  1S72 N;  5C2D A;  2KKZ A;  1GLC G;  3CCE N;  4QS7 A;  1M1K O;  5AQX A;  2ASM A;  3VF6 A;  3QBW A;  5BRE A;  1HJO A;  1SZ2 A;  4WQ4 C;  1KC8 O;  5LY3 A;  4A61 A;  5M1N A;  5BRF A;  1NM1 A;  1KD1 O;  4JK9 A;  4BR0 A;  5JMV A;  4ISF A;  3VGK A;  3HI0 A;  2A6A A;  3T7Z A;  4JKB A;  1C0F A;  3AGR A;  2ZJP L;  2CGK A;  3UB5 A;  4B1W B;  3DXK A;  3MN7 A;  5KPR A;  3LL3 A;  3H46 O;  4CZM A;  2ZJQ L;  3FE1 A;  2YHY A;  5M1P A;  3MMV A;  5CR4 A;  4KH5 A;  2QEX N;  3FZK A;  2A41 A;  1V4S A;  2QXL A;  4JKD A;  4FPA A;  3KWG A;  3TSQ A;  3Q7B A;  3G4S N;  3ENB A;  1NGH A;  2NRT A;  4JKE A;  3O5B A;  1YIT N;  4BRA A;  3AGK A;  3MN9 A;  3FZM A;  3S41 A;  2AA4 A;  5B8H A;  1BUP A;  4K42 A;  4WQ4 A;  1NGC A;  3OBY A;  5M1K A;  1KAZ A;  5AQK A;  4H5W A;  5BPM A;  2IVP A;  5AQG A;  4BRQ A;  4IOC L;  3L4Q A;  1D4X A;  4BR9 A;  3ZET B;  2P9L A;  3VEW A;  3WEE A;  3JS6 A;  3LDO A;  4BG9 A;  1JCG A;  1MWK A;  3O8M A;  4A5B A;  3TTF A;  3IDH A;  2GWJ A;  4E1J A;  3VOV A;  5GAE P;  2ZJR L;  4M7X A;  4YOY A;  4NB4 A;  2ZGY A;  3BEX A;  2YCH A;  3E66 A;  4FWN A;  1Q18 A;  3DWL A;  4FWS A;  3UE5 A;  4RTF D;  4H0O A;  4K41 A;  1ZXO A;  3EO3 A;  4PKH A;  3CER A;  4IEI A;  3WQU A;  1SQK A;  2CH5 A;  4BRN A;  3WXL A;  3E9L A;  4EAH D;  3M6G A;  4WFN L;  2D0P A;  4GNI A;  5ADX A;  3DLL L;  4AF1 A;  2P9N B;  3QB0 A;  2VWB A;  3U4L A;  4KH6 A;  3VET A;  3WUH A;  3O4W A;  3SAH A;  2VGM A;  3CF5 L;  1W2B M;  3DXK B;  3ZX3 A;  4U67 L;  2D0O A;  5I9E B;  4ILG B;  3O08 A;  4BR4 A;  1ATS A;  4DCH A;  3GOI A;  1YI2 N;  2E1Z A;  1WUA A;  2NRW A;  5GIO A;  1J6Z A;  5AQM A;  4B1V A;  2P9P A;  2W40 A;  4FSV A;  4OO1 J;  2RE2 A;  2J4R A;  5CE3 A;  3KHY A;  4CZL A;  2P9U A;  3MWT A;  3H3O B;  4BRI A;  1K8A O;  3R6M A;  1U6Z A;  4CBU A;  2IVO A;  2QWP A;  3VF4 A;  4MO4 A;  2P9K A;  1T6C A;  3KK7 A;  4BRO A;  1IG8 A;  2PAV A;  4PL8 A;  3SK3 A;  5GAH P;  3VES A;  3LDN A;  3TPQ A;  1S22 A;  4IO9 L;  4H0X B;  5EOY A;  4FWK A;  2E2N A;  3CI5 A;  3WEE B;  2CGL A;  1S3X A;  5GAG P;  4FO0 A;  1WOQ A;  3L4I A;  2HST A;  2YI1 A;  3CJB A;  4GY2 B;  2VGN A;  4IJN A;  3VMF B;  1P90 A;  5AQT A;  4CZJ A;  4JKG A;  5C12 A;  4M7Y A;  3CCV N;  3N4P A;  3CET A;  3KVG A;  3R3L A;  4MLH A;  3BP8 A;  4BQL A;  2QM1 A;  4A57 A;  5AFU A;  3OHR A;  4EIA A;  1VQM N;  1NGE A;  1OKJ A;  3H6E A;  1YUW A;  5EXW A;  2YJF A;  5HOO A;  3CJ1 A;  5BRH A;  3A8Y A;  2WFB A;  3ATV A;  1QZ6 A;  4AM7 A;  2P9I A;  4CBW A;  1HUX A;  5KPZ A;  3FZL A;  5JLF A;  4MO5 A;  4BRE A;  1GLD G;  2GTD A;  3O6W A;  5DM7 L;  1JCF A;  3VER A;  2OTJ N;  1ZBS A;  3C65 A;  5JLH A;  3CCM N;  2V7Z A;  3FR0 A;  1HKC A;  3SAG A;  3A5M C;  3U8X A;  2E2O A;  4DB3 A;  3FZH A;  3ZEU A;  1KAX A;  5F1X A;  4WFB L;  3CJA A;  3FLC O;  3QDK A;  4BRC A;  3G25 A;  2E2Q A;  3E9P A;  2NRV A;  3C6A A;  3CQY A;  2ITM A;  4C1N K;  3WXJ A;  2ASO A;  4KH4 A;  4PKI A;  3MX5 A;  3W3D A;  5KQD A;  4GV3 A;  1Q81 O;  1VQ4 N;  1NGD A;  3BF3 A;  4WF9 L;  1K9M O;  5FPD A;  1TYQ A;  4NO7 A;  2OAN A;  1HKB A;  3ID8 A;  3K9J A;  5BN9 A;  1YF5 L;  4HWI A;  4BC4 A;  3G6E N;  1NWK A;  4A59 A;  4WCE L;  3SJH A;  4WQ5 C;  3C7N B;  4YOV A;  2YHW A;  3O1W A;  4L3Q A;  3UKR A;  2V52 B;  4C1N I;  4PL7 A;  4BRH A;  2JWK A;  5EVZ A;  2WC9 A;  3LDP A;  3CPE A;  3R1X A;  3VEV A;  1VQN N;  3CD6 N;  4BG8 A;  4MLE A;  5AQY A;  3R9P A;  3ULE B;  4GVE A;  3U9D A;  3TSU A;  3D2F B;  1NGF A;  2PFU A;  2QWQ A;  1YIJ N;  3QIC A;  4JEP A;  4BRF A;  1NMD A;  1P8Z A;  3B8A X;  4AM6 A;  5F2R A;  3P4I A;  1Q7Y O;  3ID6 A;  4Y0W A;  5C0Y A;  3HSC A;  2QI2 A;  2QW9 A;  3EKS A;  3GE1 A;  3MWP A;  1GLL O;  4JD2 B;  2KLA A;  3RSE B;  5BN8 A;  1T44 A;  3F2K A;  5AQH A;  3HRG A;  5AQV A;  2YHX A;  4I6M A;  2P9S A;  3BUZ B;  1NBW A;  3HOS A;  4H5T A;  4YDU C;  4BRP A;  1VQL N;  4B9Q A;  4EFH A;  3KWI A;  5GIN A;  1VQK N;  4CD3 A;  3ZEU B;  5GAD P;  5AQO A;  3VEX A;  4NLC A;  2Q1N A;  3JXU A;  4WYB A;  4JHD A;  3CC2 N;  4H0T B;  4CZE A;  3H1Q A;  3G71 N;  1YJW N;  4QS9 A;  1ESV A;  3O80 A;  1SS6 A;  3I55 N;  1JJ2 M;  4FWP A;  4FPB A;  2KHO A;  3H3N O;  2Q36 A;  3DXM A;  3ZX2 A;  3I56 N;  1QQM A;  3LM2 A;  4A2B A;  1GLA G;  2I7P A;  3U9Z A;  4BVP A;  2QTD A;  1ATR A;  3HBT A;  3WQT A;  1DT9 A;  3E1Y A;  1JCE A;  2NRZ A;  3AAQ A;  3CMA N;  4IXC A;  4H5R A;  2ZWH A;  3NVK A;  1RDU A;  3F5T A;  3HM8 A;  3SMP A;  1VQO N;  5C15 A;  3D6R A;  5EY4 A;  4YDU A;  3WT0 A;  1Z6R A;  3L0Q A;  1H1V A;  1BA1 A;  1YXQ A;  1OVY A;  3D2E A;  4HTL A;  3OW2 M;  3NMU A;  4BC5 A;  4RWT A;  1VQ9 N;  1GLJ O;  3R8E A;  2A42 A;  3TTC A;  2HF3 A;  3GBT A;  3OA9 A;  4XH4 A;  3A5O C;  2NRX A;  3ZYY X;  1U2V A;  5BPL A;  4JK8 A;  5AZI A;  3LM9 A;  3I33 A;  3J7Z O;  1YVN A;  3VEO A;  1O13 A;  4FWQ A;  3CPW M;  3J8A A;  4YOR A;  1VAZ A;  3WXK A;  3C0B A;  4I6M B;  3VF2 A;  5LJV A;  1BG3 A;  2P9L B;  3W0L A;  5BRD A;  3MK6 A;  2FSN A;  3CQX A;  3EL2 A;  3QBX A;  2F9T A;  4BQZ A;  4H0P A;  1MA9 B;  2GEL A;  2FF6 A;  3UKU A;  4FOI A;  4JHD B;  4FWO A;  3VEY A;  1T3V A;  2HOE A;  3AAR A;  1GLE G;  3QML A;  1G99 A;  4BR7 A;  1W97 L;  3DXM B;  3SBT A;  4BGB A;  3VEZ A;  4FWL A;  2F7T A;  4F9O A;  4KBO A;  1QZ5 A;  3CHW A;  4IFE A;  4ISG A;  1VQ5 N;  3EZW A;  3TSP A;  5FPN A;  1GLF O;  2QWL A;  1BO5 O;  1YHQ N;  3ZX0 A;  4GV6 A;  4JKF A;  2JWL A;  1CZA N;  1HKG A;  2ASP A;  2OTL N;  2HBJ A;  1QQO A;  2YX6 A;  4DHY A;  4H0V B;  1DEJ A;  3O9S A;  4CZF A;  1QVG M;  3MCA B;  4B1X B;  2QA4 N;  3D2E B;  4GV9 A;  2FLO A;  1KXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...