3KWIA

X-ray structure of ns1 effector domain w187y mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
b'TPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLEYNDNTVRVSKTLQRFAWGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title X-ray structures of NS1 effector domain mutants.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 34
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3kwiA00
3P39A 3D6RA 3KWGA 3O9QA 3P38A 2KKZA 2RHKA 3L4QA 3O9RA 2GX9A 3O9SA 3M5RA 3O9UA 3KWIA 4OPHA 3P31A 4OPAA 3OA9A 3F5TA 3EE8A 3RVCA 3EE9A 3O9TA
chains in the Genus database with same CATH superfamily
3KK3A 2OZMA 4B3MK 3AA3A 4X64K 5ADXH 1VQON 3OS0A 2WONA 3FR0A 5F1XA 3KTQA 3QINA 3E9LA 4H0VB 3WNEA 1M1KO 2BDPA 1G15A 4O5BA 4PHTX 4KHNA 3OYHA 4BRAA 4W5QA 2B5JA 1GLLO 4BRQA 4BE1A 1U48A 4RW7A 2Q2RA 1HKGA 5CY4A 1YAGA 2ZGYA 4EHUA 1CZBA 2O8DB 1FKOA 4O5FA 5C25A 4LH5A 1VAZA 4BVPA 2ZJQL 3LWMA 4BRKA 5TKWA 2HOEA 1Q18A 3A5MC 5LMUK 4CBWA 3AVIA 3EKSA 5E26A 4EIAA 3O4NA 4XH1A 1QZ5A 1HKCA 4CK3A 1W2BM 5M1QA 2Y1IA 4IOAL 1LCUA 3THVA 2F4VK 4N76A 4BR7A 2IOCA 4YY3K 4JS5A 2HVHA 2YKMA 4FWQA 1GLAG 4BRPA 1K8AO 1YIJN 2E20A 1L3SA 1OVQA 4IO8A 4DV2K 3A5LC 4EZ6A 1NG9A 3MN7A 4KHQA 1K8KB 3C65A 1TVRA 3P38A 1IV0A 5M1NA 3U3YA 2IVNA 3MN5A 4YDUC 1S1WA 4CJWA 3TWHA 4DTXA 1RBTA 3I8BA 3K2PA 2OPPA 4B1ZA 1NJZA 1QE1A 3OA9A 4EZ9A 4BDZA 1BISA 2HBMA 4CZHA 2WC9A 5EY4A 2D1KA 3KVGA 3ZT4A 4CGDA 1ZC6A 1TK8A 4OO1J 2VGMA 4GVMA 3LAMA 2OPSA 3JSMA 1QZ6A 3AGKA 4B1YB 3QICA 4O0IA 4E3SA 3HM8A 3CXCM 2F8SA 2W42A 4FPBA 4DFPA 5HRSA 1U04A 5EVZA 3ULDA 1U49A 1X3NA 1KD1O 1BQMA 2ZQBA 4Z4IA 1BCOA 2F9TA 4MO4A 3J7AP 4JKHA 4LC9B 1RT5A 4BR4A 4B1WB 5E84A 3IS9A 3CJBA 1BUPA 4KI4A 4RTFD 3MX5A 2F9WA 1XMOK 4LSLA 4DV6K 3BY5A 4BRGA 2NRRA 4KHSA 1YTUA 1RT2A 3SAHA 4FWSA 3LL3A 3DRRA 2NRTA 2GELA 5KQDA 5C15A 3RR7A 3LZIA 4Q0BA 4CFDA 3LM2A 3QEVA 1BQNA 4K8XA 4CHZA 3O9TA 2QKKA 1NGEA 3AVKA 4AF1A 3RSEA 4BC5A 4F2RA 3D45A 5I3UA 4YOWA 3OYAA 3MAQA 1F21A 1TK0A 3NVKA 3WEEA 2LSNA 3DLRA 3NF7A 3CJCA 4RW9A 3SCXA 4OPAA 3N4PA 3DYAA 2P9KA 4CHPA 1QTMA 1D9DA 2RF2A 1KVBA 2WTUA 2O8FB 3FGUA 1S1UA 3CPWM 4KHPK 1EQYA 1D4XA 1NGAA 1C0TA 4RW4A 3SUPA 1S1TA 3MEGA 3DLEA 4BREA 1WLJA 3VMFB 3CQXA 1Q86O 4OLBA 4CJVA 4DR6K 5M1KA 2VYPA 4CIGA 3PIOL 1NGBA 2DY4A 4CGIA 4JD2B 4DSFA 4C8MA 2BUPA 4FWRA 2B4JA 3PSIA 1ZBLA 2E8AA 2YHXA 1IBKK 3CMEN 3M8RA 3HI0A 3TAMA 3QEXA 3AV9A 2A5XA 2E2QA 4BC3A 1DKGD 3O4QA 4FJXA 4DTPA 3KWIA 3TANA 5JMVA 3AO4A 1ESVA 4XEIA 2FC0A 4FCYA 1D8YA 4CHYA 1NKEA 4CJ4A 4FK4A 1JXBA 2B6AA 4JEPA 4H5WA 4DFJA 5AQWA 2P1JA 4DLEA 3D7EO 3MK6A 3TSUA 3I56N 4YORA 3TU5A 4FM0A 1MU2A 3FFKB 2YJEA 5J2NA 3HOTA 2P5OA 1C1AA 3UKUA 2P9UA 3ZT2A 2F8TA 3FZKA 2RKIA 3K9KA 1W9HA 1WSEA 4FJMA 2HVIA 1YVUA 1YTAA 2CH5A 2FSKA 4CE9A 5J2QA 3AVMA 2YKNA 1P8ZA 5AFUA 5FLXO 3IFRA 1NKBA 3VGKA 3ENBA 3Q7BA 2QWMA 3PUFA 1D5AA 1C0GA 1TKXA 5JS1A 2NRWA 3C95A 4ID5A 3HSTB 2P9PA 2YHWA 5BPMA 2WBNA 3O6WA 3CERA 3ID8A 3FE1A 3IUCA 2OYQA 4QCLA 4KO0A 4W5RA 4FL9A 4BACA 5CZ2A 5KTQA 3PO5A 3VEZA 1HNIA 5AQPA 2P9SA 4CESA 4H0PA 2E2PA 3OYEA 1RDDA 2NLXA 3TARA 1E3MA 1WB9A 2IVOA 4PL8A 5AQSA 5HRRA 3VQQA 3CCJN 2G8UA 3A5OC 3WXLA 1R0AA 2V51B 3VN5A 3ALYA 4B9SA 5AQXA 1RTDA 4DLGA 3ZSOA 4WQ5C 5KRSA 1ATNA 3GG4A 2FBYA 1JLCA 4J2EA 3I0SA 4B1XB 3AA4A 1EKEA 1VQ5N 4JN4A 2DTUA 4KH6A 1WAFA 3QFPA 2O8DA 3EL2A 1VQ7N 4I2PA 3LDNA 4O55A 4JI3K 4DU4A 3TSQA 3ZYYX 4B3TK 3UIQA 1U45A 4DV5K 1RDAA 3WQTA 1RGIA 4N56A 3V9ZA 5C12A 4J2AA 1MWKA 3EZ5A 4HCBA 3VQBA 4J2BA 1BA1A 3NE6A 4PL7A 2ASOA 4NXMK 3WNGA 3NBPA 1LWFA 2VWBA 5SZTA 3OBWA 4K42A 2Y1JA 3CFRA 1NM1A 4B3OA 3T7ZA 4CIEA 5CYQA 3DLKA 3LP3A 3I0RA 1ATRA 4H5RA 1KQSM 1WAJA 3ZSZA 4UQGA 1TAQA 5T7BA 2W40A 1S1XA 3FZFA 2RHKA 3O3GA 1C0FA 2QWRA 3ZT1A 3NF8A 2IS3A 5AQIA 3RR8A 1N6QA 4CGGA 3AVGA 3C6UA 1NK6A 4BRCA 4C23A 1C0UA 3PX0A 5F2RA 5LJWA 2PAVA 4DTMA 1HPMA 4CGJA 1HQEA 1GLBG 2HB5A 1NKCA 5AQOA 3UB5A 5AQVA 3HT3A 4CEQA 5AQFA 4H8KA 3K5LA 5KPTA 2YI1A 1M90O 3HZ6A 5JLFA 1LAVA 1UA1A 5SWMA 1NK7A 2HSTA 3M3ZA 4G1QA 2V7YA 4H5VA 4E19A 1IH7A 1YITN 3VQDA 1KFDA 2HHTA 4NYFA 4IEEA 3ZSXA 4IKFA 2QWLA 3MX2A 5GIPA 2YHYA 2X6SA 3RSEB 1Q9XA 1UWBA 1NGGA 4AHSA 3DOLA 5LL6Z 4DR3K 1LAWA 1X1PA 4B9VA 1HKBA 1BHLA 4H5NA 1S6PA 1ZBFA 3DAWA 2EWSA 3WEEB 3ZT0A 5A2QO 3NH1A 5KRTA 4DTOA 4KPYA 2J4RA 1ASWA 1GLEG 3AVNA 5CR4A 1X9WA 4DG1A 2P9KB 3M5RA 1FKPA 2HHUA 4C1NK 5FPNA 2Q97A 4U7BA 4LSNA 1NOZA 4KHUA 1GOCA 3PY8A 3OHRA 2G8KA 1OH8A 4JKBA 3WXIA 2NUBA 3ZSRA 2NRXA 5HL7L 3S41A 1RTIA 3QMLA 3SYZA 2Z1JA 3P4IA 3V9UA 5C24A 1S5JA 4BY9C 2XY6A 4JKDA 4E7JA 3DXMA 1H1VA 3CIPA 4DQ8A 2HMIA 1B9DA 1NLVA 4OVLA 1WUAA 2QM1A 3L3UA 1MWMA 2G8WA 3D2EA 4F2SA 3VA3A 2QXLA 4WQ4C 1JCGA 1VSIA 1QQOA 4ZHRA 3BP8A 4DTUA 1W7AA 3NF9A 4W5NA 2VWKA 3CETA 3O8MA 3QBXA 4CK1A 4C8LA 4FJIA 4NB4A 4JKFA 3SUNA 1YJWN 3FFIA 5AQNA 3BGRA 3EEQA 4CK2A 3VGMA 3K58A 3H45C 1CZ9A 4CHOA 1RDUA 1Q82O 3UKUB 1IO2A 4CJRA 1VSEA 2P9UB 5FROA 4MO5A 3LPUA 3NMUA 3OYIA 1BU6O 2X74A 4BRLA 1HYSA 3B8AX 2NRHA 5I42A 5CYMA 1S22A 4GW6A 2XY7A 1N34K 3SUOA 3H1VX 4CJLA 5BRFA 2WUSA 1VQPN 1OH7A 4DSEA 4DV0K 2QKBA 5ADXA 1KAZA 3AGRA 3L2UA 3DJCA 2V52B 3TAPA 3MECA 2NRVA 3WNFA 4OKKA 5CHIA 5I9EB 4AHRA 4YOYA 5EXWA 4IOCL 3U8XA 2P9PB 3G6EN 3E66A 4AM7A 3IRXA 3NF6A 3RMCA 3WXMB 4CJUA 3SV3A 4DR5K 2DFEA 2P9SB 2E2OA 3IDHA 3OYDA 3TAFA 4EP4A 1EX4A 5AZIA 4DS4A 4I6MA 1SUQA 2HF3A 3U9ZA 4C1NI 2VCPA 3R1XA 3SAGA 1HJOA 2ZJRL 3KK1A 1RCHA 3QLHA 3UKRA 2YX6A 2GUPA 3HPOA 1HNXK 4LF7K 3HK2A 3VETA 4CEDA 1JLBA 2ZE2A 3OW2M 3CC4N 3OYMA 3LPTA 1VQ9N 2RN2A 1NK4A 1TV6A 1SL0A 3E01A 3DXKA 3KLIA 4R5PA 1B9FA 4GKKK 5ELZA 4ILHA 4V19S 3SLCA 2JWKA 2GWJA 2VWJA 3VOVA 1SKRA 4BWMA 4CW7B 3LDQA 3K9JA 3VTIA 1E4GT 1G99A 1O1WA 4IFEA 4F3TA 3KKRA 3AARA 4E7IA 5AR0A 4CJTA 1IG9A 4EP5A 1XMQK 1IBLK 3F2KA 2Q0UA 4FO0A 4CEEA 4DV4K 2GWKA 3OYJA 2WFBA 1VSLA 2OCEA 4M3XA 3R6MA 4FWKA 5AQUA 3V1RA 1P90A 1NMDA 1DGKN 5C42A 4RW8A 3G71N 2EHGA 1S3XA 2W41A 3E9OA 4FW1A 1GLJO 4QS7A 1KAXA 1RBVA 3OS2A 1JXEA 1GOBA 1VHXA 3HL8A 4FJ5A 4IZ9A 4LF5K 3KK7A 1CXQA 2CGJA 2Z1GA 4WCEL 4DQPA 1LW2A 1RT1A 3HRGA 5FPDA 3HJFA 1GLDG 4DQSA 1NGDA 4AHCA 2GTDA 3MEDA 3KK2A 2D0BA 3VQEA 2ZGZA 4FJ8A 4FK2A 4W5TA 3O9UA 4KB0A 4FLVA 3DLHA 1IKYA 3P31A 3CJ9A 1L3TA 3NAEA 4QOZB 4BC2A 3HTVA 4BDYA 4DSKA 1QQMA 4DV3K 1FXXA 4FLTA 3BZCA 4NLCA 3T3FA 5LMNK 1NK9A 3NH0A 4HUFA 5MLCQ 2PYLA 2A3ZA 2YCHA 3C0BA 1KFSA 4JKCA 4BRMA 1KLMA 3RMBA 4OGCA 3ASMA 4AHTA 2O4GA 3IG1A 3VQCA 5AZJA 1WSGA 4TSXA 4RW6A 1QSYA 1HNVA 1S1VA 3VQAA 3WNHA 4UY8O 4EAHD 5DM6L 1VQ6N 2Q0RA 1JCEA 3CM5A 5TKYA 4NLBA 4JI6K 1DLOA 4DV7K 4CFAA 1WSIA 5BRHA 3OYKA 1VSFA 5EOYA 4GV9A 4OKEA 1W97L 3D0PA 4QAGA 2DFHA 1NU0A 4Z4CA 3QETA 4J2DA 3N4QA 3M8PA 4X66K 3DWLA 5B8HA 2D5RA 5EX5A 4JRPA 1VSDA 3EE9A 4DCHA 4Y0WA 4WF9L 1BI4B 3QFUA 1XC3A 4CF8A 3SQ4A 2NRZA 2D4WA 4FOIA 4QS9A 4DSJA 3DXMB 3OYLA 1U47A 3ID6A 1UAXA 3K5MA 5JS2A 1JL2A 4YOXA 4CVNE 5J2PA 5BREA 3S3MA 4FWPA 3SAFA 2VQFK 3D2EB 1NJWA 1S9EA 3ZETA 1EO1A 1JCFA 2D0PA 3OYBA 3OJUA 4DR2K 4B9LA 3ZLJA 3HP6A 1RBUA 1XNQK 3FZLA 3EN9A 2KKZA 3NVMA 3JAMO 3LDSA 4ZTJA 3L4QA 4DWIA 3T19A 3CCLN 5BPNA 3TR8A 1N33K 1NJXA 1HUXA 1NGJA 3R3LA 5AQKA 5C0YA 3MCAB 4FYDA 4H4MA 3GE1A 2A6AA 4AH9A 2H3GX 2FXUA 1J53A 3LDLA 1HJRA 3LM9A 4OX9K 4DUZK 3CF5L 1B92A 3L0QA 4CF1A 4DHYA 3MWTA 4WFBL 3TAGA 4JS4A 5BPLA 5HRNA 3M1FA 4CJQA 1A5VA 4CZEA 1ZBHA 2QI2A 1QVGM 5DMRA 4X65K 4GNIA 4AQYK 2GV9A 1XUPO 1BDGA 3J81O 4NYNA 3VQ4A 1N5YA 1WSHA 3P39A 4XH4A 3J80O 3M8QA 3JYTA 4B1UB 4CD3A 4FLZA 2Z1IA 4CEBA 2OZSA 1RT3A 3OYCA 3V9SA 3L2QA 4DKWA 3C6AA 4KTQA 4CFCA 1OH6A 4K43A 3A2FA 5AZIB 3W0LA 3ZX3A 5JLHA 4I6MB 4BRNA 3CPEA 2YNHA 1L3VA 1LV5A 2KTQA 3G10A 1RT4A 1BA0A 4B3RK 3PO4A 1C1BA 3UKRB 2FBVA 3THXA 4BVOA 2O8CA 3V9WA 4DB3A 4GY2B 3P83D 4AHVA 4Z4GA 5FPEA 4E1MA 3DXKB 3QB0A 3H46O 1T3VA 4JYAK 4C8OA 2OANA 1X9SA 1KRPA 4F9OA 4B8CA 3HOSA 3MEEA 1WSJA 3CC7N 3U3GA 1A5WA 3TI0A 4A62A 1N8RO 2ZWHA 1R59O 3JS6A 4Z4FA 4KTZA 1NOYA 1TL3A 4IOXA 3ZSWA 3CJ7A 4KV8A 4BE0A 4PA1A 3CG7A 4O8UA 4FXDA 3PV8A 4CZGA 4H0YB 5CE3A 1J54A 2GEMA 3LALA 3MDQA 4BGBA 3AO3A 1LWCA 1TKZA 1JJ2M 3RMAA 1RBRA 3ENHA 3G0ZA 1NGHA 1K73O 1T6DA 4MLEA 1NWKA 2YV0X 4KHWA 3H6EA 1YI2N 3ZCMA 1SS6A 3AVFA 2A1RA 3WXKA 3OTOK 2ZJPL 3VPZA 1RFQA 2ASMA 2PYJA 3OS1A 1V4TA 1WBBA 4CF0A 2OPRA 4FWLA 4LF6K 1J5OA 3WUHA 3ZSVA 2KZMA 2YJFA 1NGIA 3M8SA 3TAEA 2I5JA 3ZSYA 4R79A 3MXMA 4HUGA 3LAKA 5GAEP 4B08A 2YHBA 4DMNA 3H1QA 1LWEA 3D6RA 1RNHA 4BC4A 5AZJB 4YNQA 3VQ5A 4BE2A 3VF2A 3I55N 2E1YA 4ELVA 1T03A 1T05A 1J6ZA 3RMDA 5GINA 4NCGA 1XNRK 4M3ZA 2BTFA 4BR2A 3CCQN 3FZHA 2NNWA 3KD5E 3A5NC 4N47A 4ISFA 3V81A 4Y1CA 2IVPA 4LY7A 1NGFA 2P9NA 1TL1A 2ZF5O 2XHBA 3L6QA 5FRNA 3AVBA 1LOTB 1TAUA 3E1YA 4DF8A 4IG3A 3OVNA 4H0XB 4AILC 1QHAA 3MWPA 1KXPA 4FVMA 4A2AA 5H1SQ 1IG8A 5IWAK 3OY9A 4PQUA 3I33A 4DQQA 2O8EA 4E89A 2ATQA 4MLHA 4IXCA 3QNNA 1JLGA 4KREA 1Z6RA 4YFUA 3AVAA 1GLCG 3ZETB 2DPNA 2ETJA 5KI6A 4DR7K 4FJ7A 5F0XA 2IC3A 1O13A 3AA2A 5AQLA 3WT0A 3ZT3A 5GIOA 4X62K 1Q8IA 4JKEA 3H3OB 3O1WA 5BR9A 3VF6A 1QS4A 4B9MA 3PX4A 2PFUA 3RWUA 2GBZA 3L2RA 2HNDA 4DS5A 1BI4A 3BEXA 3K59A 3TSPA 4CBUA 2VG7A 4E7KA 4CEAA 1N36K 4EHTA 2HNZA 1YJ9N 5JICA 5AQMA 3TTDA 2XY5A 4A59A 3IMXA 4JI7K 4B9NA 4C8NA 1WNSA 4BRDA 2VG6A 3VEYA 2HF4A 3TABA 2O8BA 2OTJN 4KRFA 4F8RA 4CF9A 2CGLA 3K5OA 2Q3SA 2FSNA 1RBSA 3MN6A 3TTCA 3P5JA 1S6QA 3O9RA 4DFMA 4LFCK 3DRSA 3AVJA 1Y64A 4DR1K 5C10A 4M42A 4ICLA 4WQ5A 3OYNA 3OJSA 3LWLA 5HLFA 2VQEK 1EP4A 1HYZA 4GVEA 3CFOA 1IKXA 3V1QA 1CZAN 2JLEA 4H4OA 4O44A 4CIFA 3T1HK 1U4BA 1Q81O 4A61A 1RILA 4HCCA 4K8ZA 2A41A 1RDCA 3NGYA 2QWOA 3THYA 3SMSA 4CCHA 1W0HA 4CD1A 1K9MO 4M7YA 5J1EA 4HHTA 3ULEA 3LZJA 3NGIA 2ITMA 4BROA 2QXFA 2IDOA 3ATVA 1SAZA 3LP2A 3THXB 5LY3A 2O8CB 1BL3A 1C6VA 3H3NO 4KHYA 4IFVA 1VK0A 2YNIA 4PUOA 3O9SA 3AAPA 1UOCA 4KTWA 1CLQA 4IO9L 3HSCA 4O8KA 4CJSA 4CBXA 3MN9A 5M1OA 2F7TA 2YNFA 4CJ3A 4ISGA 4NO7A 5E41A 3BF3A 3DOKA 3QBWA 4WE1A 1TYQB 3O9QA 2IIRA 4MQ3A 3O3FA 3KHYA 3AO5A 4I7FA 3MMVA 2HHQA 1HNZK 5HP1A 3VTHA 3VF4A 1QSLA 1KLNA 3QIPA 4CZIA 1ZXOA 1IJJA 1XQSC 1T7PA 4GV6A 1OH5A 4I9QA 1JLQA 3SPZA 2UXBK 1Q7YO 3PSFA 3IKMA 1ASVA 2QWPA 2Q1NA 3CCSN 1SV5A 1Q9YA 3HM9A 4AHUA 3L8BA 2KFZA 3JXUA 4CZKA 4BRFA 4RCHA 4F4KA 3VQ8A 2NZTA 3BF1A 4A57A 1JKHA 3Q7CA 4ILGB 4Y1DA 4LFAK 1ZBUA 3HPHA 1JLAA 1BIUA 2FBXA 2X6NA 2UYTA 3T1AA 1RTHA 4HTLA 3SBGA 5BR8K 4FJLA 3AVHA 3SNNA 1ILYA 3CM6A 4HVJA 1DT9A 5C2FA 4CZMA 1T44A 3AAQA 4JI2K 1TK5A 1C1CA 1J9AA 4K25A 2BH1A 4CJEA 3H08A 5AQHA 1XI1A 1DTQA 2E6LA 1BCMA 1WSFA 3M6GA 4I2QA 2KQ2A 4JRQA 4M63C 4J8FA 4NXNK 4KB1A 4FJKA 1YHQN 3QO9A 3SJHA 4FJ9A 4CJPA 4OPJA 1JLFA 4WQ4A 3PLAA 5AQJA 4PY5A 3ITHA 3A8YA 3I8DA 1X9MA 4CZFA 3V4IA 5JVHL 5FRMA 4JNEA 1OKJA 2EX3A 2CH6A 5C2DA 3KJVA 3CFPA 1VQNN 4M3UA 2FF3B 3AO2A 3RVCA 3VQ6A 4BR9A 4IJNA 4Q5VA 1QSSA 4RWTA 3HP9A 3TAQA 2WOMA 1SKSA 2P9NB 1I94K 2HHHK 3MXJA 4JK7A 2BGGA 4CEOA 2AJQA 3LP1A 3CC2N 2R7YA 2P9IA 2YHAA 5IT9O 4CJ5A 4KH4A 2HHXA 2QTDA 1EWQA 1XC9A 2D0CA 4DTNA 1VQLN 1BO5O 3CMAN 2VG5A 3EE8A 1FK9A 4RG8A 3SPYA 1N32K 5AQZA 3QEPA 2O8EB 1DEJA 1J5EK 4LD0A 2Q31A 3O5BA 1ZYQA 4JLHA 1Z05A 4FLWA 4HTUA 4FOEA 1QVFM 1ZBSA 4YHHK 1DTTA 1RT6A 4KH5A 3AA5X 3VQ9A 1HNWK 4FSVA 2PY5A 4FWOA 1EETA 2JWLA 3RRGA 4M3YA 1BGXT 1T6CA 4I9LA 1K6YA 3QEWA 3D2FA 3DM2A 3V1OA 3P1GA 1XHZA 3RTVA 3KD1E 2FLOA 4CFBA 3GBTA 3DRPA 4JI0K 2ZD1A 4BQZA 3G25A 4WFAL 3W3DA 4NCBA 1LW0A 2XRIA 2HMPA 5D3GA 3BZKA 1NK0A 2FSJA 4FW2A 4DV1K 2F96A 2O8BB 3HXMA 4CJ7A 1NMNA 2XO7A 1JL1A 1GLFO 4FWNA 1HX1A 4CHQA 2HHWA 1SKWA 5DM7L 2E1ZA 5BRDA 4KI6A 3OYFA 3CCUN 4DQIA 5FDLA 3QEIA 4DTJA 4ISEA 2I7NA 4CEZA 4GMJB 4DTSA 4K0KK 1ITGA 1L5UA 3C6HA 4H0OA 4PWDA 3R9PA 4BDPA 1KVAA 3SQ2A 1HQUA 1U2VA 3CI5A 1U6ZA 3L3VA 1NK8A 1BG3A 1VRTA 2P51A 3K57A 3SV4A 3CHWA 4FJJA 3THYB 3QDKA 3THWA 2KHOA 4YOUA 4FWMA 2QA4N 4JKAA 3HVTA 4MDAA 4BR0A 3VERA 3ULEB 2QEXN 4FLUA 2KFNA 4B8AB 3NGZA 4QS8A 3CCMN 2E88A 5HBMA 2G8IA 4FPAA 2G8VA 1NK5A 3RRHA 2P9LA 4MDBA 4F3OA 2FBTA 2KLAA 4A5AA 1S72N 3ZSQA 3VEXA 4B9QA 1V4SA 2A42A 4XH5A 5AQGA 4FM2A 5CZ1A 1XHXA 3CQYA 1QQNA 2ASPA 1OVYA 3LDOA 4JKGA 4JK8A 3C7NA 3GOIA 1S9GA 4PKGA 4DU1A 2UUCK 4LF8K 4MFBA 4Z0UA 1X3MA 1YF5L 5GADP 1TKDA 4YDUA 5KPZA 4FJHA 4FM1A 4PKIA 3SZ2A 1D9FA 5KQ8A 2RE2A 3LP0A 3F5TA 3R8EA 3NHGA 4LFBK 4CJFA 4CEFA 1X9JA 1VSJA 1HMVA 3TPQA 1VQ8N 1RT7A 2UUAK 3OBYA 4NCAA 1VSMA 4LF4K 4LF9K 4DSIA 3AVLA 1IKVA 3LANA 4JI4K 3EKUA 4JV5K 4H5TA 3QNOA 3QESA 3BUZB 4JHDA 4E1JA 2O4IA 2OA8A 4DR4K 3AY9A 2FF6A 4OLAA 3WQUA 2G8HA 4IDHA 3KWGA 3DI6A 1SL2A 4E0DA 4BWJA 2ZM6K 3T1YK 4N41A 3ZEUA 1HLUA 4FZZA 3NFAA 3A0IX 3SJJA 1TYQA 1Z25A 1ASUA 4E1NA 4JI8K 5J2MA 4WYBA 5GAGP 1SL1A 1TUYA 3FZMA 2AA4A 3VESA 5M1PA 4OKJA 4IBNA 3MXIA 2HW3A 4Z4HA 4M41A 4ZTFA 4BRIA 3CJAA 4IWVA 3U9DA 4YOVA 1WBDA 3VA0A 5AQRA 3L2VA 3F73A 4DTRA 3ISNC 5AFUH 2ITGA 1YUWA 3SI6A 4B3SK 3VENA 5GAHP 3VQ7A 2AP1A 2QW9A 1HR0K 3AVCA 5M1FA 3GL1A 3MCPA 3CCRN 4BQLA 3PX6A 4IEIA 3NCIA 4KFBA 4L8RB 3SQ1A 1JLEA 5K14A 3BDPA 3B6PA 3C6TA 4BGAA 4FZYA 4FJNA 1KAYA 4ID1A 1REVA 3SQ0A 1WN7A 4HWIA 3SUQA 1GOAA 1YJNN 4M7XA 2CGKA 4DU3A 1T8EA 1TUUA 4JAXA 2HHVA 1RDBA 4CERA 4KBOA 2A40A 3KIOA 4M3RA 1CXUA 4G9ZA 4FZXC 3L2WA 1VSKA 2E5LK 2A1SA 4U67L 3NH2A 4IFYA 4K41A 3EYZA 3CCVN 4KKOA 1KSPA 1KTQA 2P9IB 2BE2A 4M3TA 4O0JA 2W6LA 3IAYA 1FW6A 4BR5A 2E6MA 3ZX2A 4Z4EA 4FJGA 2D0OA 3HVRA 4CF2A 4JI5K 3UE5A 3DLLL 3KLFA 2HHSA 3O4WA 3VEVA 2X78A 5KGWA 1MA9B 1NBWA 1E4FT 4CHNA 1K8KA 1XWLA 4W5OA 1TKTA 3D2FB 3SBTA 3J7YP 2P5GA 3QIOA 3DMJA 4H0TB 2BANA 1BOTO 4XIUA 1VSHA 1KVCA 1YXQA 1RTJA 4DFKA 3K0SA 1BWFO 2HBLA 3F9MA 4DF4A 4B9UA 2RPIA 4ILJA 2UUBK 2OPQA 3KLHA 1QHTA 3HYFA 2HBJA 4CJKA 2UXCK 1HYVA 4C8KA 3KZBA 4LH4A 2PBDA 4WFNL 4M3WA 1ZBIA 2D0AA 1HPZA 4ELUA 2UXDK 5JVGL 3V9XA 3S9HA 2W6KA 3WXJA 5DK5A 3O3HA 3OYGA 3VGLA 3VEOA 3J8AA 4B9TA 3DLGA 2G8FA 1VQKN 3LDPA 3E9PA 4A2BA 3EZWA 4JI1K 4CZJA 4O4GA 4Z94A 2DFFA 3L4IA 1NJIO 2HNYA 3EO3A 4H03B 4BG9A 2E4LA 4FK0A 3NDKA 2I7PA 3V6DA 1KCFA 4KAZA 3O1BA 1QQCA 2GX9A 1L3UA 1VQ4N 4AM6A 1KC8O 4CGFA 1U2VB 3CCEN 5HROA 1RDWX 3CJ1A 3B6OA 3THWB 1WOQA 4OGEA 5AQTA 4E7HA 3GDQA 1C0MA 4FLXA 2V7ZA 4FVUA 3CQ8A 1IBMK 4E7LA 2HBKA 4CECA 2KZZA 2QWNA 2P9LB 5FPMA 2JGUA 1SQKA 3FLCO 5KPRA 4CGHA 1HRHA 2IGIA 1I3AA 1FJGK 2QWQA 3ZX0A 4IG0A 4PKHA 4IJAA 3VEWA 3G4SN 4BG8A 1YT3A 1VRUA 4JKGB 3C7NB 1I39A 4CZLA 5AJ3K 4FLYA 1ATSA 3HBTA 4ELTA 2O8FA 4B1VA 4BRHA 1SZ2A 3EY1A 2XY8A 3CYMA 4GV3A 3TTFA 3KKSA 3F9KA 1NGCA 3KLEA 4M45A 3O80A 5HOOA 4L3QA 3KLGA 2PZSA 2IAJA 3AO1A 4DQRA 3QERA 3ATUA 2VGNA 4JD2A 2E2NA 3PIPL 3S3OA 3HPGA 1VQMN 1IKWA 3VQPA 3DLBA 4CI6A 4HUEA 4JHDB 3K5NA 1MDUB 4OPHA 5BN9A 4OPKA 1EWRA 3CD6N 1YVNA 4JK9A 4OJRA 2KW4A 2Z1HA 4DUYK 3SMPA 4GKJK 2GUIA 3U6FA 2QK9A 3ZEUB 1NNEA 1BIZA 1A5XA 4EFHA 1NJYA 5AQQA 2OTLN 5KGXA 3S3NA 2Q36A 4N5SA 2YNGA 4DSLA 5BN8A 5AQYA 3J7ZO 3HO1A 5EU7A 4YOTA 1TGOA 5LJVA 2UU9K 1Y97A 3C94A 3ENOA 1UA0A 3T69A 1EXQA 4A5BA 1Z26A 4IDKA 5HRPA 3O08A 3SK3A 3U4LA
chains in the Genus database with same CATH topology
1HKBA 2FLOA 4H5NA 3GBTA 3DAWA 2EWSA 3WEEB 4F9OA 4BQZA 3HOSA 3G25A 5ADXH 4WFAL 1VQON 3W3DA 2J4RA 3CC7N 1GLEG 5CR4A 3FR0A 4A62A 5F1XA 1N8RO 2HMPA 2P9KB 3M5RA 2ZWHA 1R59O 3JS6A 4C1NK 5FPNA 3E9LA 2Q97A 2FSJA 4H0VB 4U7BA 1M1KO 4PHTX 4IOXA 3OHRA 3CJ7A 4CJ7A 4JKBA 3WXIA 1GLFO 2NRXA 4O8UA 4FWNA 1HX1A 5HL7L 4CZGA 3S41A 4BRAA 4H0YB 5CE3A 1GLLO 3QMLA 2GEMA 3MDQA 4BRQA 4BGBA 5DM7L 2E1ZA 5BRDA 3P4IA 1JJ2M 2Q2RA 3CCUN 1HKGA 4BY9C 1YAGA 2ZGYA 3ENHA 4EHUA 1NGHA 4ISEA 1K73O 4JKDA 1T6DA 2I7NA 4MLEA 4O5FA 1NWKA 1VAZA 3DXMA 4BVPA 2ZJQL 3C6HA 4H0OA 4BRKA 1H1VA 3R9PA 5TKWA 2HOEA 3CIPA 3H6EA 1Q18A 3A5MC 1SS6A 1U2VA 4DQ8A 1YI2N 1NLVA 4CBWA 1WUAA 3CI5A 2QM1A 1U6ZA 1BG3A 3CHWA 1MWMA 3EKSA 5E26A 3QDKA 3WXKA 4EIAA 2KHOA 4XH1A 2ZJPL 4YOUA 4FWMA 3VPZA 2QA4N 1RFQA 2ASMA 3D2EA 1V4TA 4JKAA 2QXLA 4WQ4C 1QZ5A 1HKCA 4FWLA 1JCGA 4MDAA 1W2BM 4BR0A 5M1QA 3ULEB 3VERA 2QEXN 3WUHA 4IOAL 1QQOA 3BP8A 1LCUA 4QS8A 3CCMN 2E88A 3QBXA 3CETA 3O8MA 2YJFA 4FPAA 4BR7A 1NGIA 2P9LA 4MDBA 4NB4A 4FWQA 1GLAG 4JKFA 4BRPA 2KLAA 4A5AA 4R79A 1YJWN 1K8AO 1S72N 5GAEP 1YIJN 5AQNA 3VEXA 2E20A 4B9QA 4IO8A 3A5LC 3VGMA 1V4SA 3H1QA 2A42A 4XH5A 3H45C 3D6RA 5AQGA 3MN7A 1K8KB 1QQNA 1RDUA 3CQYA 3C65A 5AZJB 4BC4A 1Q82O 3P38A 3UKUB 2ASPA 5M1NA 1OVYA 2IVNA 3LDOA 3MN5A 3VF2A 2P9UB 4JKGA 4JK8A 3C7NA 2E1YA 3GOIA 4YDUC 4MO5A 3I55N 3NMUA 1BU6O 4PKGA 4BRLA 3B8AX 2NRHA 1X3MA 1YF5L 5GADP 1S22A 3I8BA 4YDUA 5KPZA 1J6ZA 3H1VX 4B1ZA 4PKIA 5BRFA 2WUSA 1VQPN 5KQ8A 5GINA 2RE2A 3OA9A 3F5TA 3R8EA 5ADXA 1KAZA 3AGRA 3DJCA 2HBMA 2V52B 4CZHA 2WC9A 2BTFA 1X9JA 5EY4A 2D1KA 3KVGA 4BR2A 3CCQN 2NRVA 3FZHA 3TPQA 2NNWA 5CHIA 5I9EB 4YOYA 1VQ8N 1ZC6A 5EXWA 4IOCL 3OBYA 3U8XA 2P9PB 2VGMA 3A5NC 4OO1J 3G6EN 3E66A 4ISFA 1QZ6A 3AGKA 2IVPA 4AM7A 4B1YB 1NGFA 2P9NA 3EKUA 3QICA 2ZF5O 3HM8A 3L6QA 3WXMB 3CXCM 1LOTB 4H5TA 3E1YA 4FPBA 3BUZB 5EVZA 4JHDA 4E1JA 4H0XB 1X3NA 2P9SB 1KD1O 2E2OA 3IDHA 1QHAA 2F9TA 4MO4A 4JKHA 3MWPA 1KXPA 3AY9A 2FF6A 4LC9B 5AZIA 3WQUA 4IDHA 4I6MA 3KWGA 2HF3A 3U9ZA 4BR4A 4B1WB 2VCPA 5E84A 4A2AA 4C1NI 5H1SQ 1IG8A 3CJBA 1BUPA 3R1XA 4RTFD 3ZEUA 3SAGA 3MX5A 3I33A 1HJOA 1HLUA 2F9WA 2ZJRL 3A0IX 4MLHA 1TYQA 3UKRA 2YX6A 2GUPA 4IXCA 1Z6RA 1GLCG 4BRGA 2NRRA 2DPNA 4WYBA 3VETA 3ZETB 5GAGP 1TUYA 3FZMA 3LL3A 4FWSA 3SAHA 3OW2M 2NRTA 2AA4A 2GELA 5M1PA 3VESA 3CC4N 5F0XA 5C15A 5KQDA 1VQ9N 1O13A 5AQLA 3WT0A 3LM2A 5GIOA 3O9TA 3H3OB 3CJAA 4JKEA 4BRIA 4IWVA 3DXKA 3O1WA 1NGEA 3VF6A 5BR9A 5ELZA 4AF1A 4ILHA 3RSEA 4BC5A 3SLCA 2PFUA 3U9DA 4YOVA 4YOWA 2JWKA 5AQRA 3BEXA 2GWJA 3TSPA 5AFUH 3NVKA 4CBUA 3WEEA 3VOVA 1YUWA 3LDQA 3VENA 3K9JA 3CJCA 1E4GT 1G99A 2AP1A 2QW9A 4IFEA 3VTIA 4EHTA 5GAHP 1YJ9N 3AARA 5JICA 4OPAA 5M1FA 3GL1A 3N4PA 5AQMA 5AR0A 3TTDA 4A59A 2P9KA 3IMXA 3MCPA 3CCRN 4BQLA 3F2KA 4BRDA 3VEYA 2Q0UA 4IEIA 4FO0A 3FGUA 2GWKA 2HF4A 3CPWM 1EQYA 1D4XA 1NGAA 2WFBA 2OTJN 3R6MA 4FWKA 4BGAA 2CGLA 4BREA 2FSNA 5AQUA 3VMFB 1P90A 1NMDA 1KAYA 3CQXA 3MN6A 1DGKN 3TTCA 3G71N 1Q86O 1S3XA 3O9RA 4HWIA 2W41A 3E9OA 4M7XA 1YJNN 2CGKA 1GLJO 4QS7A 5M1KA 1Y64A 2VYPA 1KAXA 1TUUA 4JAXA 5C10A 4WQ5A 3PIOL 1NGBA 4KBOA 4IZ9A 3KK7A 4GVEA 4JD2B 2A40A 2BUPA 2CGJA 4FWRA 4WCEL 1CZAN 4G9ZA 3HRGA 1Q81O 2E8AA 5FPDA 2YHXA 4U67L 3CMEN 4A61A 3HI0A 1GLDG 4K41A 2A41A 3CCVN 1NGDA 2P9IB 2GTDA 2A5XA 2QWOA 2E2QA 3SMSA 4BC3A 1DKGD 2ZGZA 3O9UA 4BR5A 4CD1A 3KWIA 1K9MO 4M7YA 3ZX2A 5JMVA 3P31A 3CJ9A 1ESVA 4XEIA 3ULEA 2D0OA 2ITMA 4BC2A 3HTVA 4BROA 1QQMA 3ATVA 3UE5A 1SAZA 4NLCA 3DLLL 4JEPA 4H5WA 5LY3A 5AQWA 3D7EO 3O4WA 3MK6A 5MLCQ 3TSUA 3VEVA 3I56N 2A3ZA 2YCHA 4YORA 3C0BA 3TU5A 1MA9B 1NBWA 4JKCA 4BRMA 3H3NO 3FFKB 2YJEA 1E4FT 1K8KA 5AZJA 3O9SA 3HOTA 3AAPA 3UKUA 3D2FB 3SBTA 4UY8O 2P9UA 4IO9L 3FZKA 3K9KA 3HSCA 4O8KA 4EAHD 4CBXA 3MN9A 4H0TB 1BOTO 2CH5A 5DM6L 2FSKA 5M1OA 2F7TA 1VQ6N 2Q0RA 4ISGA 4NO7A 1JCEA 3BF3A 1YXQA 1P8ZA 5TKYA 4NLBA 5AFUA 3QBWA 1TYQB 3IFRA 1BWFO 2HBLA 3F9MA 5BRHA 3O9QA 2IIRA 4ILJA 3VGKA 5EOYA 3KHYA 4GV9A 2HBJA 1W97L 3ENBA 3Q7BA 3MMVA 2QWMA 3KZBA 3VTHA 2PBDA 4WFNL 3N4QA 3VF4A 1C0GA 3DWLA 2NRWA 5JVGL 5B8HA 2P9PA 2YHWA 3WXJA 4CZIA 5BPMA 2WBNA 1ZXOA 3O6WA 1IJJA 3CERA 1XQSC 3ID8A 3FE1A 4GV6A 3VGLA 3IUCA 3J8AA 3VEOA 5EX5A 1VQKN 3LDPA 3EE9A 3E9PA 4DCHA 4A2BA 3EZWA 4Y0WA 4CZJA 3QFUA 1XC3A 4WF9L 1Q7YO 4Z94A 4FL9A 3IKMA 3L4IA 1NJIO 2QWPA 2Q1NA 3VEZA 3EO3A 4H03B 3CCSN 4BG9A 5AQPA 2P9SA 2NRZA 2D4WA 4FOIA 2I7PA 4H0PA 2E2PA 4QS9A 3DXMB 3JXUA 4CZKA 3O1BA 2NLXA 2GX9A 1VQ4N 4AM6A 4BRFA 2IVOA 1KC8O 1U2VB 3ID6A 4PL8A 4RCHA 5AQSA 3CCEN 2NZTA 3BF1A 4A57A 4YOXA 1RDWX 3CCJN 3CJ1A 3Q7CA 4ILGB 5BREA 3A5OC 4FWPA 3WXLA 1WOQA 3SAFA 3D2EB 5AQTA 2V51B 3GDQA 3ZETA 1EO1A 1JCFA 2D0PA 2UYTA 2V7ZA 4FVUA 4HTLA 2HBKA 3FZLA 5AQXA 3EN9A 2KKZA 3NVMA 3SBGA 1ILYA 2QWNA 2P9LB 3L4QA 3CCLN 5FPMA 4WQ5C 1ATNA 3GG4A 5C2FA 1DT9A 4CZMA 5BPNA 1SQKA 1T44A 3FLCO 3AAQA 4B1XB 5KPRA 1HUXA 1NGJA 3R3LA 2QWQA 5AQKA 3ZX0A 4PKHA 1VQ5N 4JN4A 3MCAB 5C0YA 4KH6A 4IJAA 3VEWA 3G4SN 4K25A 3GE1A 2BH1A 3QFPA 2A6AA 4BG8A 2H3GX 3EL2A 1VQ7N 3LDNA 2FXUA 4JKGB 3C7NB 5AQHA 4CZLA 3LDLA 3TSQA 3ZYYX 3M6GA 3LM9A 4M63C 1ATSA 3HBTA 4J8FA 3WQTA 1RGIA 3CF5L 4B1VA 4BRHA 3L0QA 4DHYA 1YHQN 3SJHA 3MWTA 5C12A 4WFBL 1SZ2A 4WQ4A 3PLAA 1MWKA 5AQJA 3A8YA 1BA1A 5BPLA 4CZFA 3M1FA 5JVHL 4PL7A 2ASOA 4CZEA 4GV3A 3TTFA 4JNEA 2QI2A 1NGCA 1OKJA 1QVGM 2CH6A 5C2DA 3O80A 4GNIA 2VWBA 5HOOA 3OBWA 4K42A 1VQNN 4L3QA 1XUPO 2FF3B 1BDGA 3RVCA 4BR9A 1NM1A 4IJNA 3T7ZA 4RWTA 3ATUA 3P39A 2VGNA 4JD2A 2E2NA 4XH4A 1ATRA 4H5RA 2P9NB 3PIPL 4B1UB 1KQSM 4JK7A 2W40A 3FZFA 4CD3A 2RHKA 1VQMN 1C0FA 2QWRA 3CC2N 5AQIA 4CI6A 2P9IA 4DKWA 3C6AA 4JHDB 4BRCA 4C23A 1MDUB 4KH4A 4OPHA 2PAVA 5F2RA 5BN9A 5LJWA 2QTDA 4K43A 3CD6N 1HPMA 1YVNA 4JK9A 1VQLN 1BO5O 1GLBG 5AZIB 3W0LA 3ZX3A 3CMAN 5JLHA 4I6MB 4BRNA 3CPEA 3EE8A 5AQOA 3UB5A 5AQZA 3SMPA 1BA0A 5AQVA 3ZEUB 4EFHA 1DEJA 5AQQA 2OTLN 2Q31A 3O5BA 2Q36A 3UKRB 5AQFA 1Z05A 5KPTA 2YI1A 4BVOA 1M90O 5BN8A 5AQYA 3HZ6A 3J7ZO 4FOEA 5JLFA 1QVFM 1ZBSA 4DB3A 4KH5A 2HSTA 3M3ZA 4GY2B 4YOTA 5LJVA 4FSVA 2V7YA 4H5VA 4FWOA 1YITN 2JWLA 3ENOA 1T6CA 3T69A 4IEEA 5FPEA 2QWLA 4A5BA 3DXKB 3MX2A 5GIPA 2YHYA 3QB0A 3H46O 3RSEB 3D2FA 1T3VA 1NGGA 3O08A 3SK3A 3U4LA 2OANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P39 A;  3D6R A;  3KWG A;  3O9Q A;  3P38 A;  2KKZ A;  2RHK A;  3L4Q A;  3O9R A;  2GX9 A;  3O9S A;  3M5R A;  3O9U A;  3KWI A;  4OPH A;  3P31 A;  4OPA A;  3OA9 A;  3F5T A;  3EE8 A;  3RVC A;  3EE9 A;  3O9T A; 
#chains in the Genus database with same CATH topology
 3KK3 A;  2OZM A;  4B3M K;  3AA3 A;  4X64 K;  5ADX H;  1VQO N;  3OS0 A;  2WON A;  3FR0 A;  5F1X A;  3KTQ A;  3QIN A;  3E9L A;  4H0V B;  3WNE A;  1M1K O;  2BDP A;  1G15 A;  4O5B A;  4PHT X;  4KHN A;  3OYH A;  4BRA A;  4W5Q A;  2B5J A;  1GLL O;  4BRQ A;  4BE1 A;  1U48 A;  4RW7 A;  2Q2R A;  1HKG A;  5CY4 A;  1YAG A;  2ZGY A;  4EHU A;  1CZB A;  2O8D B;  1FKO A;  4O5F A;  5C25 A;  4LH5 A;  1VAZ A;  4BVP A;  2ZJQ L;  3LWM A;  4BRK A;  5TKW A;  2HOE A;  1Q18 A;  3A5M C;  5LMU K;  4CBW A;  3AVI A;  3EKS A;  5E26 A;  4EIA A;  3O4N A;  4XH1 A;  1QZ5 A;  1HKC A;  4CK3 A;  1W2B M;  5M1Q A;  2Y1I A;  4IOA L;  1LCU A;  3THV A;  2F4V K;  4N76 A;  4BR7 A;  2IOC A;  4YY3 K;  4JS5 A;  2HVH A;  2YKM A;  4FWQ A;  1GLA G;  4BRP A;  1K8A O;  1YIJ N;  2E20 A;  1L3S A;  1OVQ A;  4IO8 A;  4DV2 K;  3A5L C;  4EZ6 A;  1NG9 A;  3MN7 A;  4KHQ A;  1K8K B;  3C65 A;  1TVR A;  3P38 A;  1IV0 A;  5M1N A;  3U3Y A;  2IVN A;  3MN5 A;  4YDU C;  1S1W A;  4CJW A;  3TWH A;  4DTX A;  1RBT A;  3I8B A;  3K2P A;  2OPP A;  4B1Z A;  1NJZ A;  1QE1 A;  3OA9 A;  4EZ9 A;  4BDZ A;  1BIS A;  2HBM A;  4CZH A;  2WC9 A;  5EY4 A;  2D1K A;  3KVG A;  3ZT4 A;  4CGD A;  1ZC6 A;  1TK8 A;  4OO1 J;  2VGM A;  4GVM A;  3LAM A;  2OPS A;  3JSM A;  1QZ6 A;  3AGK A;  4B1Y B;  3QIC A;  4O0I A;  4E3S A;  3HM8 A;  3CXC M;  2F8S A;  2W42 A;  4FPB A;  4DFP A;  5HRS A;  1U04 A;  5EVZ A;  3ULD A;  1U49 A;  1X3N A;  1KD1 O;  1BQM A;  2ZQB A;  4Z4I A;  1BCO A;  2F9T A;  4MO4 A;  3J7A P;  4JKH A;  4LC9 B;  1RT5 A;  4BR4 A;  4B1W B;  5E84 A;  3IS9 A;  3CJB A;  1BUP A;  4KI4 A;  4RTF D;  3MX5 A;  2F9W A;  1XMO K;  4LSL A;  4DV6 K;  3BY5 A;  4BRG A;  2NRR A;  4KHS A;  1YTU A;  1RT2 A;  3SAH A;  4FWS A;  3LL3 A;  3DRR A;  2NRT A;  2GEL A;  5KQD A;  5C15 A;  3RR7 A;  3LZI A;  4Q0B A;  4CFD A;  3LM2 A;  3QEV A;  1BQN A;  4K8X A;  4CHZ A;  3O9T A;  2QKK A;  1NGE A;  3AVK A;  4AF1 A;  3RSE A;  4BC5 A;  4F2R A;  3D45 A;  5I3U A;  4YOW A;  3OYA A;  3MAQ A;  1F21 A;  1TK0 A;  3NVK A;  3WEE A;  2LSN A;  3DLR A;  3NF7 A;  3CJC A;  4RW9 A;  3SCX A;  4OPA A;  3N4P A;  3DYA A;  2P9K A;  4CHP A;  1QTM A;  1D9D A;  2RF2 A;  1KVB A;  2WTU A;  2O8F B;  3FGU A;  1S1U A;  3CPW M;  4KHP K;  1EQY A;  1D4X A;  1NGA A;  1C0T A;  4RW4 A;  3SUP A;  1S1T A;  3MEG A;  3DLE A;  4BRE A;  1WLJ A;  3VMF B;  3CQX A;  1Q86 O;  4OLB A;  4CJV A;  4DR6 K;  5M1K A;  2VYP A;  4CIG A;  3PIO L;  1NGB A;  2DY4 A;  4CGI A;  4JD2 B;  4DSF A;  4C8M A;  2BUP A;  4FWR A;  2B4J A;  3PSI A;  1ZBL A;  2E8A A;  2YHX A;  1IBK K;  3CME N;  3M8R A;  3HI0 A;  3TAM A;  3QEX A;  3AV9 A;  2A5X A;  2E2Q A;  4BC3 A;  1DKG D;  3O4Q A;  4FJX A;  4DTP A;  3KWI A;  3TAN A;  5JMV A;  3AO4 A;  1ESV A;  4XEI A;  2FC0 A;  4FCY A;  1D8Y A;  4CHY A;  1NKE A;  4CJ4 A;  4FK4 A;  1JXB A;  2B6A A;  4JEP A;  4H5W A;  4DFJ A;  5AQW A;  2P1J A;  4DLE A;  3D7E O;  3MK6 A;  3TSU A;  3I56 N;  4YOR A;  3TU5 A;  4FM0 A;  1MU2 A;  3FFK B;  2YJE A;  5J2N A;  3HOT A;  2P5O A;  1C1A A;  3UKU A;  2P9U A;  3ZT2 A;  2F8T A;  3FZK A;  2RKI A;  3K9K A;  1W9H A;  1WSE A;  4FJM A;  2HVI A;  1YVU A;  1YTA A;  2CH5 A;  2FSK A;  4CE9 A;  5J2Q A;  3AVM A;  2YKN A;  1P8Z A;  5AFU A;  5FLX O;  3IFR A;  1NKB A;  3VGK A;  3ENB A;  3Q7B A;  2QWM A;  3PUF A;  1D5A A;  1C0G A;  1TKX A;  5JS1 A;  2NRW A;  3C95 A;  4ID5 A;  3HST B;  2P9P A;  2YHW A;  5BPM A;  2WBN A;  3O6W A;  3CER A;  3ID8 A;  3FE1 A;  3IUC A;  2OYQ A;  4QCL A;  4KO0 A;  4W5R A;  4FL9 A;  4BAC A;  5CZ2 A;  5KTQ A;  3PO5 A;  3VEZ A;  1HNI A;  5AQP A;  2P9S A;  4CES A;  4H0P A;  2E2P A;  3OYE A;  1RDD A;  2NLX A;  3TAR A;  1E3M A;  1WB9 A;  2IVO A;  4PL8 A;  5AQS A;  5HRR A;  3VQQ A;  3CCJ N;  2G8U A;  3A5O C;  3WXL A;  1R0A A;  2V51 B;  3VN5 A;  3ALY A;  4B9S A;  5AQX A;  1RTD A;  4DLG A;  3ZSO A;  4WQ5 C;  5KRS A;  1ATN A;  3GG4 A;  2FBY A;  1JLC A;  4J2E A;  3I0S A;  4B1X B;  3AA4 A;  1EKE A;  1VQ5 N;  4JN4 A;  2DTU A;  4KH6 A;  1WAF A;  3QFP A;  2O8D A;  3EL2 A;  1VQ7 N;  4I2P A;  3LDN A;  4O55 A;  4JI3 K;  4DU4 A;  3TSQ A;  3ZYY X;  4B3T K;  3UIQ A;  1U45 A;  4DV5 K;  1RDA A;  3WQT A;  1RGI A;  4N56 A;  3V9Z A;  5C12 A;  4J2A A;  1MWK A;  3EZ5 A;  4HCB A;  3VQB A;  4J2B A;  1BA1 A;  3NE6 A;  4PL7 A;  2ASO A;  4NXM K;  3WNG A;  3NBP A;  1LWF A;  2VWB A;  5SZT A;  3OBW A;  4K42 A;  2Y1J A;  3CFR A;  1NM1 A;  4B3O A;  3T7Z A;  4CIE A;  5CYQ A;  3DLK A;  3LP3 A;  3I0R A;  1ATR A;  4H5R A;  1KQS M;  1WAJ A;  3ZSZ A;  4UQG A;  1TAQ A;  5T7B A;  2W40 A;  1S1X A;  3FZF A;  2RHK A;  3O3G A;  1C0F A;  2QWR A;  3ZT1 A;  3NF8 A;  2IS3 A;  5AQI A;  3RR8 A;  1N6Q A;  4CGG A;  3AVG A;  3C6U A;  1NK6 A;  4BRC A;  4C23 A;  1C0U A;  3PX0 A;  5F2R A;  5LJW A;  2PAV A;  4DTM A;  1HPM A;  4CGJ A;  1HQE A;  1GLB G;  2HB5 A;  1NKC A;  5AQO A;  3UB5 A;  5AQV A;  3HT3 A;  4CEQ A;  5AQF A;  4H8K A;  3K5L A;  5KPT A;  2YI1 A;  1M90 O;  3HZ6 A;  5JLF A;  1LAV A;  1UA1 A;  5SWM A;  1NK7 A;  2HST A;  3M3Z A;  4G1Q A;  2V7Y A;  4H5V A;  4E19 A;  1IH7 A;  1YIT N;  3VQD A;  1KFD A;  2HHT A;  4NYF A;  4IEE A;  3ZSX A;  4IKF A;  2QWL A;  3MX2 A;  5GIP A;  2YHY A;  2X6S A;  3RSE B;  1Q9X A;  1UWB A;  1NGG A;  4AHS A;  3DOL A;  5LL6 Z;  4DR3 K;  1LAW A;  1X1P A;  4B9V A;  1HKB A;  1BHL A;  4H5N A;  1S6P A;  1ZBF A;  3DAW A;  2EWS A;  3WEE B;  3ZT0 A;  5A2Q O;  3NH1 A;  5KRT A;  4DTO A;  4KPY A;  2J4R A;  1ASW A;  1GLE G;  3AVN A;  5CR4 A;  1X9W A;  4DG1 A;  2P9K B;  3M5R A;  1FKP A;  2HHU A;  4C1N K;  5FPN A;  2Q97 A;  4U7B A;  4LSN A;  1NOZ A;  4KHU A;  1GOC A;  3PY8 A;  3OHR A;  2G8K A;  1OH8 A;  4JKB A;  3WXI A;  2NUB A;  3ZSR A;  2NRX A;  5HL7 L;  3S41 A;  1RTI A;  3QML A;  3SYZ A;  2Z1J A;  3P4I A;  3V9U A;  5C24 A;  1S5J A;  4BY9 C;  2XY6 A;  4JKD A;  4E7J A;  3DXM A;  1H1V A;  3CIP A;  4DQ8 A;  2HMI A;  1B9D A;  1NLV A;  4OVL A;  1WUA A;  2QM1 A;  3L3U A;  1MWM A;  2G8W A;  3D2E A;  4F2S A;  3VA3 A;  2QXL A;  4WQ4 C;  1JCG A;  1VSI A;  1QQO A;  4ZHR A;  3BP8 A;  4DTU A;  1W7A A;  3NF9 A;  4W5N A;  2VWK A;  3CET A;  3O8M A;  3QBX A;  4CK1 A;  4C8L A;  4FJI A;  4NB4 A;  4JKF A;  3SUN A;  1YJW N;  3FFI A;  5AQN A;  3BGR A;  3EEQ A;  4CK2 A;  3VGM A;  3K58 A;  3H45 C;  1CZ9 A;  4CHO A;  1RDU A;  1Q82 O;  3UKU B;  1IO2 A;  4CJR A;  1VSE A;  2P9U B;  5FRO A;  4MO5 A;  3LPU A;  3NMU A;  3OYI A;  1BU6 O;  2X74 A;  4BRL A;  1HYS A;  3B8A X;  2NRH A;  5I42 A;  5CYM A;  1S22 A;  4GW6 A;  2XY7 A;  1N34 K;  3SUO A;  3H1V X;  4CJL A;  5BRF A;  2WUS A;  1VQP N;  1OH7 A;  4DSE A;  4DV0 K;  2QKB A;  5ADX A;  1KAZ A;  3AGR A;  3L2U A;  3DJC A;  2V52 B;  3TAP A;  3MEC A;  2NRV A;  3WNF A;  4OKK A;  5CHI A;  5I9E B;  4AHR A;  4YOY A;  5EXW A;  4IOC L;  3U8X A;  2P9P B;  3G6E N;  3E66 A;  4AM7 A;  3IRX A;  3NF6 A;  3RMC A;  3WXM B;  4CJU A;  3SV3 A;  4DR5 K;  2DFE A;  2P9S B;  2E2O A;  3IDH A;  3OYD A;  3TAF A;  4EP4 A;  1EX4 A;  5AZI A;  4DS4 A;  4I6M A;  1SUQ A;  2HF3 A;  3U9Z A;  4C1N I;  2VCP A;  3R1X A;  3SAG A;  1HJO A;  2ZJR L;  3KK1 A;  1RCH A;  3QLH A;  3UKR A;  2YX6 A;  2GUP A;  3HPO A;  1HNX K;  4LF7 K;  3HK2 A;  3VET A;  4CED A;  1JLB A;  2ZE2 A;  3OW2 M;  3CC4 N;  3OYM A;  3LPT A;  1VQ9 N;  2RN2 A;  1NK4 A;  1TV6 A;  1SL0 A;  3E01 A;  3DXK A;  3KLI A;  4R5P A;  1B9F A;  4GKK K;  5ELZ A;  4ILH A;  4V19 S;  3SLC A;  2JWK A;  2GWJ A;  2VWJ A;  3VOV A;  1SKR A;  4BWM A;  4CW7 B;  3LDQ A;  3K9J A;  3VTI A;  1E4G T;  1G99 A;  1O1W A;  4IFE A;  4F3T A;  3KKR A;  3AAR A;  4E7I A;  5AR0 A;  4CJT A;  1IG9 A;  4EP5 A;  1XMQ K;  1IBL K;  3F2K A;  2Q0U A;  4FO0 A;  4CEE A;  4DV4 K;  2GWK A;  3OYJ A;  2WFB A;  1VSL A;  2OCE A;  4M3X A;  3R6M A;  4FWK A;  5AQU A;  3V1R A;  1P90 A;  1NMD A;  1DGK N;  5C42 A;  4RW8 A;  3G71 N;  2EHG A;  1S3X A;  2W41 A;  3E9O A;  4FW1 A;  1GLJ O;  4QS7 A;  1KAX A;  1RBV A;  3OS2 A;  1JXE A;  1GOB A;  1VHX A;  3HL8 A;  4FJ5 A;  4IZ9 A;  4LF5 K;  3KK7 A;  1CXQ A;  2CGJ A;  2Z1G A;  4WCE L;  4DQP A;  1LW2 A;  1RT1 A;  3HRG A;  5FPD A;  3HJF A;  1GLD G;  4DQS A;  1NGD A;  4AHC A;  2GTD A;  3MED A;  3KK2 A;  2D0B A;  3VQE A;  2ZGZ A;  4FJ8 A;  4FK2 A;  4W5T A;  3O9U A;  4KB0 A;  4FLV A;  3DLH A;  1IKY A;  3P31 A;  3CJ9 A;  1L3T A;  3NAE A;  4QOZ B;  4BC2 A;  3HTV A;  4BDY A;  4DSK A;  1QQM A;  4DV3 K;  1FXX A;  4FLT A;  3BZC A;  4NLC A;  3T3F A;  5LMN K;  1NK9 A;  3NH0 A;  4HUF A;  5MLC Q;  2PYL A;  2A3Z A;  2YCH A;  3C0B A;  1KFS A;  4JKC A;  4BRM A;  1KLM A;  3RMB A;  4OGC A;  3ASM A;  4AHT A;  2O4G A;  3IG1 A;  3VQC A;  5AZJ A;  1WSG A;  4TSX A;  4RW6 A;  1QSY A;  1HNV A;  1S1V A;  3VQA A;  3WNH A;  4UY8 O;  4EAH D;  5DM6 L;  1VQ6 N;  2Q0R A;  1JCE A;  3CM5 A;  5TKY A;  4NLB A;  4JI6 K;  1DLO A;  4DV7 K;  4CFA A;  1WSI A;  5BRH A;  3OYK A;  1VSF A;  5EOY A;  4GV9 A;  4OKE A;  1W97 L;  3D0P A;  4QAG A;  2DFH A;  1NU0 A;  4Z4C A;  3QET A;  4J2D A;  3N4Q A;  3M8P A;  4X66 K;  3DWL A;  5B8H A;  2D5R A;  5EX5 A;  4JRP A;  1VSD A;  3EE9 A;  4DCH A;  4Y0W A;  4WF9 L;  1BI4 B;  3QFU A;  1XC3 A;  4CF8 A;  3SQ4 A;  2NRZ A;  2D4W A;  4FOI A;  4QS9 A;  4DSJ A;  3DXM B;  3OYL A;  1U47 A;  3ID6 A;  1UAX A;  3K5M A;  5JS2 A;  1JL2 A;  4YOX A;  4CVN E;  5J2P A;  5BRE A;  3S3M A;  4FWP A;  3SAF A;  2VQF K;  3D2E B;  1NJW A;  1S9E A;  3ZET A;  1EO1 A;  1JCF A;  2D0P A;  3OYB A;  3OJU A;  4DR2 K;  4B9L A;  3ZLJ A;  3HP6 A;  1RBU A;  1XNQ K;  3FZL A;  3EN9 A;  2KKZ A;  3NVM A;  3JAM O;  3LDS A;  4ZTJ A;  3L4Q A;  4DWI A;  3T19 A;  3CCL N;  5BPN A;  3TR8 A;  1N33 K;  1NJX A;  1HUX A;  1NGJ A;  3R3L A;  5AQK A;  5C0Y A;  3MCA B;  4FYD A;  4H4M A;  3GE1 A;  2A6A A;  4AH9 A;  2H3G X;  2FXU A;  1J53 A;  3LDL A;  1HJR A;  3LM9 A;  4OX9 K;  4DUZ K;  3CF5 L;  1B92 A;  3L0Q A;  4CF1 A;  4DHY A;  3MWT A;  4WFB L;  3TAG A;  4JS4 A;  5BPL A;  5HRN A;  3M1F A;  4CJQ A;  1A5V A;  4CZE A;  1ZBH A;  2QI2 A;  1QVG M;  5DMR A;  4X65 K;  4GNI A;  4AQY K;  2GV9 A;  1XUP O;  1BDG A;  3J81 O;  4NYN A;  3VQ4 A;  1N5Y A;  1WSH A;  3P39 A;  4XH4 A;  3J80 O;  3M8Q A;  3JYT A;  4B1U B;  4CD3 A;  4FLZ A;  2Z1I A;  4CEB A;  2OZS A;  1RT3 A;  3OYC A;  3V9S A;  3L2Q A;  4DKW A;  3C6A A;  4KTQ A;  4CFC A;  1OH6 A;  4K43 A;  3A2F A;  5AZI B;  3W0L A;  3ZX3 A;  5JLH A;  4I6M B;  4BRN A;  3CPE A;  2YNH A;  1L3V A;  1LV5 A;  2KTQ A;  3G10 A;  1RT4 A;  1BA0 A;  4B3R K;  3PO4 A;  1C1B A;  3UKR B;  2FBV A;  3THX A;  4BVO A;  2O8C A;  3V9W A;  4DB3 A;  4GY2 B;  3P83 D;  4AHV A;  4Z4G A;  5FPE A;  4E1M A;  3DXK B;  3QB0 A;  3H46 O;  1T3V A;  4JYA K;  4C8O A;  2OAN A;  1X9S A;  1KRP A;  4F9O A;  4B8C A;  3HOS A;  3MEE A;  1WSJ A;  3CC7 N;  3U3G A;  1A5W A;  3TI0 A;  4A62 A;  1N8R O;  2ZWH A;  1R59 O;  3JS6 A;  4Z4F A;  4KTZ A;  1NOY A;  1TL3 A;  4IOX A;  3ZSW A;  3CJ7 A;  4KV8 A;  4BE0 A;  4PA1 A;  3CG7 A;  4O8U A;  4FXD A;  3PV8 A;  4CZG A;  4H0Y B;  5CE3 A;  1J54 A;  2GEM A;  3LAL A;  3MDQ A;  4BGB A;  3AO3 A;  1LWC A;  1TKZ A;  1JJ2 M;  3RMA A;  1RBR A;  3ENH A;  3G0Z A;  1NGH A;  1K73 O;  1T6D A;  4MLE A;  1NWK A;  2YV0 X;  4KHW A;  3H6E A;  1YI2 N;  3ZCM A;  1SS6 A;  3AVF A;  2A1R A;  3WXK A;  3OTO K;  2ZJP L;  3VPZ A;  1RFQ A;  2ASM A;  2PYJ A;  3OS1 A;  1V4T A;  1WBB A;  4CF0 A;  2OPR A;  4FWL A;  4LF6 K;  1J5O A;  3WUH A;  3ZSV A;  2KZM A;  2YJF A;  1NGI A;  3M8S A;  3TAE A;  2I5J A;  3ZSY A;  4R79 A;  3MXM A;  4HUG A;  3LAK A;  5GAE P;  4B08 A;  2YHB A;  4DMN A;  3H1Q A;  1LWE A;  3D6R A;  1RNH A;  4BC4 A;  5AZJ B;  4YNQ A;  3VQ5 A;  4BE2 A;  3VF2 A;  3I55 N;  2E1Y A;  4ELV A;  1T03 A;  1T05 A;  1J6Z A;  3RMD A;  5GIN A;  4NCG A;  1XNR K;  4M3Z A;  2BTF A;  4BR2 A;  3CCQ N;  3FZH A;  2NNW A;  3KD5 E;  3A5N C;  4N47 A;  4ISF A;  3V81 A;  4Y1C A;  2IVP A;  4LY7 A;  1NGF A;  2P9N A;  1TL1 A;  2ZF5 O;  2XHB A;  3L6Q A;  5FRN A;  3AVB A;  1LOT B;  1TAU A;  3E1Y A;  4DF8 A;  4IG3 A;  3OVN A;  4H0X B;  4AIL C;  1QHA A;  3MWP A;  1KXP A;  4FVM A;  4A2A A;  5H1S Q;  1IG8 A;  5IWA K;  3OY9 A;  4PQU A;  3I33 A;  4DQQ A;  2O8E A;  4E89 A;  2ATQ A;  4MLH A;  4IXC A;  3QNN A;  1JLG A;  4KRE A;  1Z6R A;  4YFU A;  3AVA A;  1GLC G;  3ZET B;  2DPN A;  2ETJ A;  5KI6 A;  4DR7 K;  4FJ7 A;  5F0X A;  2IC3 A;  1O13 A;  3AA2 A;  5AQL A;  3WT0 A;  3ZT3 A;  5GIO A;  4X62 K;  1Q8I A;  4JKE A;  3H3O B;  3O1W A;  5BR9 A;  3VF6 A;  1QS4 A;  4B9M A;  3PX4 A;  2PFU A;  3RWU A;  2GBZ A;  3L2R A;  2HND A;  4DS5 A;  1BI4 A;  3BEX A;  3K59 A;  3TSP A;  4CBU A;  2VG7 A;  4E7K A;  4CEA A;  1N36 K;  4EHT A;  2HNZ A;  1YJ9 N;  5JIC A;  5AQM A;  3TTD A;  2XY5 A;  4A59 A;  3IMX A;  4JI7 K;  4B9N A;  4C8N A;  1WNS A;  4BRD A;  2VG6 A;  3VEY A;  2HF4 A;  3TAB A;  2O8B A;  2OTJ N;  4KRF A;  4F8R A;  4CF9 A;  2CGL A;  3K5O A;  2Q3S A;  2FSN A;  1RBS A;  3MN6 A;  3TTC A;  3P5J A;  1S6Q A;  3O9R A;  4DFM A;  4LFC K;  3DRS A;  3AVJ A;  1Y64 A;  4DR1 K;  5C10 A;  4M42 A;  4ICL A;  4WQ5 A;  3OYN A;  3OJS A;  3LWL A;  5HLF A;  2VQE K;  1EP4 A;  1HYZ A;  4GVE A;  3CFO A;  1IKX A;  3V1Q A;  1CZA N;  2JLE A;  4H4O A;  4O44 A;  4CIF A;  3T1H K;  1U4B A;  1Q81 O;  4A61 A;  1RIL A;  4HCC A;  4K8Z A;  2A41 A;  1RDC A;  3NGY A;  2QWO A;  3THY A;  3SMS A;  4CCH A;  1W0H A;  4CD1 A;  1K9M O;  4M7Y A;  5J1E A;  4HHT A;  3ULE A;  3LZJ A;  3NGI A;  2ITM A;  4BRO A;  2QXF A;  2IDO A;  3ATV A;  1SAZ A;  3LP2 A;  3THX B;  5LY3 A;  2O8C B;  1BL3 A;  1C6V A;  3H3N O;  4KHY A;  4IFV A;  1VK0 A;  2YNI A;  4PUO A;  3O9S A;  3AAP A;  1UOC A;  4KTW A;  1CLQ A;  4IO9 L;  3HSC A;  4O8K A;  4CJS A;  4CBX A;  3MN9 A;  5M1O A;  2F7T A;  2YNF A;  4CJ3 A;  4ISG A;  4NO7 A;  5E41 A;  3BF3 A;  3DOK A;  3QBW A;  4WE1 A;  1TYQ B;  3O9Q A;  2IIR A;  4MQ3 A;  3O3F A;  3KHY A;  3AO5 A;  4I7F A;  3MMV A;  2HHQ A;  1HNZ K;  5HP1 A;  3VTH A;  3VF4 A;  1QSL A;  1KLN A;  3QIP A;  4CZI A;  1ZXO A;  1IJJ A;  1XQS C;  1T7P A;  4GV6 A;  1OH5 A;  4I9Q A;  1JLQ A;  3SPZ A;  2UXB K;  1Q7Y O;  3PSF A;  3IKM A;  1ASV A;  2QWP A;  2Q1N A;  3CCS N;  1SV5 A;  1Q9Y A;  3HM9 A;  4AHU A;  3L8B A;  2KFZ A;  3JXU A;  4CZK A;  4BRF A;  4RCH A;  4F4K A;  3VQ8 A;  2NZT A;  3BF1 A;  4A57 A;  1JKH A;  3Q7C A;  4ILG B;  4Y1D A;  4LFA K;  1ZBU A;  3HPH A;  1JLA A;  1BIU A;  2FBX A;  2X6N A;  2UYT A;  3T1A A;  1RTH A;  4HTL A;  3SBG A;  5BR8 K;  4FJL A;  3AVH A;  3SNN A;  1ILY A;  3CM6 A;  4HVJ A;  1DT9 A;  5C2F A;  4CZM A;  1T44 A;  3AAQ A;  4JI2 K;  1TK5 A;  1C1C A;  1J9A A;  4K25 A;  2BH1 A;  4CJE A;  3H08 A;  5AQH A;  1XI1 A;  1DTQ A;  2E6L A;  1BCM A;  1WSF A;  3M6G A;  4I2Q A;  2KQ2 A;  4JRQ A;  4M63 C;  4J8F A;  4NXN K;  4KB1 A;  4FJK A;  1YHQ N;  3QO9 A;  3SJH A;  4FJ9 A;  4CJP A;  4OPJ A;  1JLF A;  4WQ4 A;  3PLA A;  5AQJ A;  4PY5 A;  3ITH A;  3A8Y A;  3I8D A;  1X9M A;  4CZF A;  3V4I A;  5JVH L;  5FRM A;  4JNE A;  1OKJ A;  2EX3 A;  2CH6 A;  5C2D A;  3KJV A;  3CFP A;  1VQN N;  4M3U A;  2FF3 B;  3AO2 A;  3RVC A;  3VQ6 A;  4BR9 A;  4IJN A;  4Q5V A;  1QSS A;  4RWT A;  3HP9 A;  3TAQ A;  2WOM A;  1SKS A;  2P9N B;  1I94 K;  2HHH K;  3MXJ A;  4JK7 A;  2BGG A;  4CEO A;  2AJQ A;  3LP1 A;  3CC2 N;  2R7Y A;  2P9I A;  2YHA A;  5IT9 O;  4CJ5 A;  4KH4 A;  2HHX A;  2QTD A;  1EWQ A;  1XC9 A;  2D0C A;  4DTN A;  1VQL N;  1BO5 O;  3CMA N;  2VG5 A;  3EE8 A;  1FK9 A;  4RG8 A;  3SPY A;  1N32 K;  5AQZ A;  3QEP A;  2O8E B;  1DEJ A;  1J5E K;  4LD0 A;  2Q31 A;  3O5B A;  1ZYQ A;  4JLH A;  1Z05 A;  4FLW A;  4HTU A;  4FOE A;  1QVF M;  1ZBS A;  4YHH K;  1DTT A;  1RT6 A;  4KH5 A;  3AA5 X;  3VQ9 A;  1HNW K;  4FSV A;  2PY5 A;  4FWO A;  1EET A;  2JWL A;  3RRG A;  4M3Y A;  1BGX T;  1T6C A;  4I9L A;  1K6Y A;  3QEW A;  3D2F A;  3DM2 A;  3V1O A;  3P1G A;  1XHZ A;  3RTV A;  3KD1 E;  2FLO A;  4CFB A;  3GBT A;  3DRP A;  4JI0 K;  2ZD1 A;  4BQZ A;  3G25 A;  4WFA L;  3W3D A;  4NCB A;  1LW0 A;  2XRI A;  2HMP A;  5D3G A;  3BZK A;  1NK0 A;  2FSJ A;  4FW2 A;  4DV1 K;  2F96 A;  2O8B B;  3HXM A;  4CJ7 A;  1NMN A;  2XO7 A;  1JL1 A;  1GLF O;  4FWN A;  1HX1 A;  4CHQ A;  2HHW A;  1SKW A;  5DM7 L;  2E1Z A;  5BRD A;  4KI6 A;  3OYF A;  3CCU N;  4DQI A;  5FDL A;  3QEI A;  4DTJ A;  4ISE A;  2I7N A;  4CEZ A;  4GMJ B;  4DTS A;  4K0K K;  1ITG A;  1L5U A;  3C6H A;  4H0O A;  4PWD A;  3R9P A;  4BDP A;  1KVA A;  3SQ2 A;  1HQU A;  1U2V A;  3CI5 A;  1U6Z A;  3L3V A;  1NK8 A;  1BG3 A;  1VRT A;  2P51 A;  3K57 A;  3SV4 A;  3CHW A;  4FJJ A;  3THY B;  3QDK A;  3THW A;  2KHO A;  4YOU A;  4FWM A;  2QA4 N;  4JKA A;  3HVT A;  4MDA A;  4BR0 A;  3VER A;  3ULE B;  2QEX N;  4FLU A;  2KFN A;  4B8A B;  3NGZ A;  4QS8 A;  3CCM N;  2E88 A;  5HBM A;  2G8I A;  4FPA A;  2G8V A;  1NK5 A;  3RRH A;  2P9L A;  4MDB A;  4F3O A;  2FBT A;  2KLA A;  4A5A A;  1S72 N;  3ZSQ A;  3VEX A;  4B9Q A;  1V4S A;  2A42 A;  4XH5 A;  5AQG A;  4FM2 A;  5CZ1 A;  1XHX A;  3CQY A;  1QQN A;  2ASP A;  1OVY A;  3LDO A;  4JKG A;  4JK8 A;  3C7N A;  3GOI A;  1S9G A;  4PKG A;  4DU1 A;  2UUC K;  4LF8 K;  4MFB A;  4Z0U A;  1X3M A;  1YF5 L;  5GAD P;  1TKD A;  4YDU A;  5KPZ A;  4FJH A;  4FM1 A;  4PKI A;  3SZ2 A;  1D9F A;  5KQ8 A;  2RE2 A;  3LP0 A;  3F5T A;  3R8E A;  3NHG A;  4LFB K;  4CJF A;  4CEF A;  1X9J A;  1VSJ A;  1HMV A;  3TPQ A;  1VQ8 N;  1RT7 A;  2UUA K;  3OBY A;  4NCA A;  1VSM A;  4LF4 K;  4LF9 K;  4DSI A;  3AVL A;  1IKV A;  3LAN A;  4JI4 K;  3EKU A;  4JV5 K;  4H5T A;  3QNO A;  3QES A;  3BUZ B;  4JHD A;  4E1J A;  2O4I A;  2OA8 A;  4DR4 K;  3AY9 A;  2FF6 A;  4OLA A;  3WQU A;  2G8H A;  4IDH A;  3KWG A;  3DI6 A;  1SL2 A;  4E0D A;  4BWJ A;  2ZM6 K;  3T1Y K;  4N41 A;  3ZEU A;  1HLU A;  4FZZ A;  3NFA A;  3A0I X;  3SJJ A;  1TYQ A;  1Z25 A;  1ASU A;  4E1N A;  4JI8 K;  5J2M A;  4WYB A;  5GAG P;  1SL1 A;  1TUY A;  3FZM A;  2AA4 A;  3VES A;  5M1P A;  4OKJ A;  4IBN A;  3MXI A;  2HW3 A;  4Z4H A;  4M41 A;  4ZTF A;  4BRI A;  3CJA A;  4IWV A;  3U9D A;  4YOV A;  1WBD A;  3VA0 A;  5AQR A;  3L2V A;  3F73 A;  4DTR A;  3ISN C;  5AFU H;  2ITG A;  1YUW A;  3SI6 A;  4B3S K;  3VEN A;  5GAH P;  3VQ7 A;  2AP1 A;  2QW9 A;  1HR0 K;  3AVC A;  5M1F A;  3GL1 A;  3MCP A;  3CCR N;  4BQL A;  3PX6 A;  4IEI A;  3NCI A;  4KFB A;  4L8R B;  3SQ1 A;  1JLE A;  5K14 A;  3BDP A;  3B6P A;  3C6T A;  4BGA A;  4FZY A;  4FJN A;  1KAY A;  4ID1 A;  1REV A;  3SQ0 A;  1WN7 A;  4HWI A;  3SUQ A;  1GOA A;  1YJN N;  4M7X A;  2CGK A;  4DU3 A;  1T8E A;  1TUU A;  4JAX A;  2HHV A;  1RDB A;  4CER A;  4KBO A;  2A40 A;  3KIO A;  4M3R A;  1CXU A;  4G9Z A;  4FZX C;  3L2W A;  1VSK A;  2E5L K;  2A1S A;  4U67 L;  3NH2 A;  4IFY A;  4K41 A;  3EYZ A;  3CCV N;  4KKO A;  1KSP A;  1KTQ A;  2P9I B;  2BE2 A;  4M3T A;  4O0J A;  2W6L A;  3IAY A;  1FW6 A;  4BR5 A;  2E6M A;  3ZX2 A;  4Z4E A;  4FJG A;  2D0O A;  3HVR A;  4CF2 A;  4JI5 K;  3UE5 A;  3DLL L;  3KLF A;  2HHS A;  3O4W A;  3VEV A;  2X78 A;  5KGW A;  1MA9 B;  1NBW A;  1E4F T;  4CHN A;  1K8K A;  1XWL A;  4W5O A;  1TKT A;  3D2F B;  3SBT A;  3J7Y P;  2P5G A;  3QIO A;  3DMJ A;  4H0T B;  2BAN A;  1BOT O;  4XIU A;  1VSH A;  1KVC A;  1YXQ A;  1RTJ A;  4DFK A;  3K0S A;  1BWF O;  2HBL A;  3F9M A;  4DF4 A;  4B9U A;  2RPI A;  4ILJ A;  2UUB K;  2OPQ A;  3KLH A;  1QHT A;  3HYF A;  2HBJ A;  4CJK A;  2UXC K;  1HYV A;  4C8K A;  3KZB A;  4LH4 A;  2PBD A;  4WFN L;  4M3W A;  1ZBI A;  2D0A A;  1HPZ A;  4ELU A;  2UXD K;  5JVG L;  3V9X A;  3S9H A;  2W6K A;  3WXJ A;  5DK5 A;  3O3H A;  3OYG A;  3VGL A;  3VEO A;  3J8A A;  4B9T A;  3DLG A;  2G8F A;  1VQK N;  3LDP A;  3E9P A;  4A2B A;  3EZW A;  4JI1 K;  4CZJ A;  4O4G A;  4Z94 A;  2DFF A;  3L4I A;  1NJI O;  2HNY A;  3EO3 A;  4H03 B;  4BG9 A;  2E4L A;  4FK0 A;  3NDK A;  2I7P A;  3V6D A;  1KCF A;  4KAZ A;  3O1B A;  1QQC A;  2GX9 A;  1L3U A;  1VQ4 N;  4AM6 A;  1KC8 O;  4CGF A;  1U2V B;  3CCE N;  5HRO A;  1RDW X;  3CJ1 A;  3B6O A;  3THW B;  1WOQ A;  4OGE A;  5AQT A;  4E7H A;  3GDQ A;  1C0M A;  4FLX A;  2V7Z A;  4FVU A;  3CQ8 A;  1IBM K;  4E7L A;  2HBK A;  4CEC A;  2KZZ A;  2QWN A;  2P9L B;  5FPM A;  2JGU A;  1SQK A;  3FLC O;  5KPR A;  4CGH A;  1HRH A;  2IGI A;  1I3A A;  1FJG K;  2QWQ A;  3ZX0 A;  4IG0 A;  4PKH A;  4IJA A;  3VEW A;  3G4S N;  4BG8 A;  1YT3 A;  1VRU A;  4JKG B;  3C7N B;  1I39 A;  4CZL A;  5AJ3 K;  4FLY A;  1ATS A;  3HBT A;  4ELT A;  2O8F A;  4B1V A;  4BRH A;  1SZ2 A;  3EY1 A;  2XY8 A;  3CYM A;  4GV3 A;  3TTF A;  3KKS A;  3F9K A;  1NGC A;  3KLE A;  4M45 A;  3O80 A;  5HOO A;  4L3Q A;  3KLG A;  2PZS A;  2IAJ A;  3AO1 A;  4DQR A;  3QER A;  3ATU A;  2VGN A;  4JD2 A;  2E2N A;  3PIP L;  3S3O A;  3HPG A;  1VQM N;  1IKW A;  3VQP A;  3DLB A;  4CI6 A;  4HUE A;  4JHD B;  3K5N A;  1MDU B;  4OPH A;  5BN9 A;  4OPK A;  1EWR A;  3CD6 N;  1YVN A;  4JK9 A;  4OJR A;  2KW4 A;  2Z1H A;  4DUY K;  3SMP A;  4GKJ K;  2GUI A;  3U6F A;  2QK9 A;  3ZEU B;  1NNE A;  1BIZ A;  1A5X A;  4EFH A;  1NJY A;  5AQQ A;  2OTL N;  5KGX A;  3S3N A;  2Q36 A;  4N5S A;  2YNG A;  4DSL A;  5BN8 A;  5AQY A;  3J7Z O;  3HO1 A;  5EU7 A;  4YOT A;  1TGO A;  5LJV A;  2UU9 K;  1Y97 A;  3C94 A;  3ENO A;  1UA0 A;  3T69 A;  1EXQ A;  4A5B A;  1Z26 A;  4IDK A;  5HRP A;  3O08 A;  3SK3 A;  3U4L A; 
#chains in the Genus database with same CATH homology
 1HKB A;  2FLO A;  4H5N A;  3GBT A;  3DAW A;  2EWS A;  3WEE B;  4F9O A;  4BQZ A;  3HOS A;  3G25 A;  5ADX H;  4WFA L;  1VQO N;  3W3D A;  2J4R A;  3CC7 N;  1GLE G;  5CR4 A;  3FR0 A;  4A62 A;  5F1X A;  1N8R O;  2HMP A;  2P9K B;  3M5R A;  2ZWH A;  1R59 O;  3JS6 A;  4C1N K;  5FPN A;  3E9L A;  2Q97 A;  2FSJ A;  4H0V B;  4U7B A;  1M1K O;  4PHT X;  4IOX A;  3OHR A;  3CJ7 A;  4CJ7 A;  4JKB A;  3WXI A;  1GLF O;  2NRX A;  4O8U A;  4FWN A;  1HX1 A;  5HL7 L;  4CZG A;  3S41 A;  4BRA A;  4H0Y B;  5CE3 A;  1GLL O;  3QML A;  2GEM A;  3MDQ A;  4BRQ A;  4BGB A;  5DM7 L;  2E1Z A;  5BRD A;  3P4I A;  1JJ2 M;  2Q2R A;  3CCU N;  1HKG A;  4BY9 C;  1YAG A;  2ZGY A;  3ENH A;  4EHU A;  1NGH A;  4ISE A;  1K73 O;  4JKD A;  1T6D A;  2I7N A;  4MLE A;  4O5F A;  1NWK A;  1VAZ A;  3DXM A;  4BVP A;  2ZJQ L;  3C6H A;  4H0O A;  4BRK A;  1H1V A;  3R9P A;  5TKW A;  2HOE A;  3CIP A;  3H6E A;  1Q18 A;  3A5M C;  1SS6 A;  1U2V A;  4DQ8 A;  1YI2 N;  1NLV A;  4CBW A;  1WUA A;  3CI5 A;  2QM1 A;  1U6Z A;  1BG3 A;  3CHW A;  1MWM A;  3EKS A;  5E26 A;  3QDK A;  3WXK A;  4EIA A;  2KHO A;  4XH1 A;  2ZJP L;  4YOU A;  4FWM A;  3VPZ A;  2QA4 N;  1RFQ A;  2ASM A;  3D2E A;  1V4T A;  4JKA A;  2QXL A;  4WQ4 C;  1QZ5 A;  1HKC A;  4FWL A;  1JCG A;  4MDA A;  1W2B M;  4BR0 A;  5M1Q A;  3ULE B;  3VER A;  2QEX N;  3WUH A;  4IOA L;  1QQO A;  3BP8 A;  1LCU A;  4QS8 A;  3CCM N;  2E88 A;  3QBX A;  3CET A;  3O8M A;  2YJF A;  4FPA A;  4BR7 A;  1NGI A;  2P9L A;  4MDB A;  4NB4 A;  4FWQ A;  1GLA G;  4JKF A;  4BRP A;  2KLA A;  4A5A A;  4R79 A;  1YJW N;  1K8A O;  1S72 N;  5GAE P;  1YIJ N;  5AQN A;  3VEX A;  2E20 A;  4B9Q A;  4IO8 A;  3A5L C;  3VGM A;  1V4S A;  3H1Q A;  2A42 A;  4XH5 A;  3H45 C;  3D6R A;  5AQG A;  3MN7 A;  1K8K B;  1QQN A;  1RDU A;  3CQY A;  3C65 A;  5AZJ B;  4BC4 A;  1Q82 O;  3P38 A;  3UKU B;  2ASP A;  5M1N A;  1OVY A;  2IVN A;  3LDO A;  3MN5 A;  3VF2 A;  2P9U B;  4JKG A;  4JK8 A;  3C7N A;  2E1Y A;  3GOI A;  4YDU C;  4MO5 A;  3I55 N;  3NMU A;  1BU6 O;  4PKG A;  4BRL A;  3B8A X;  2NRH A;  1X3M A;  1YF5 L;  5GAD P;  1S22 A;  3I8B A;  4YDU A;  5KPZ A;  1J6Z A;  3H1V X;  4B1Z A;  4PKI A;  5BRF A;  2WUS A;  1VQP N;  5KQ8 A;  5GIN A;  2RE2 A;  3OA9 A;  3F5T A;  3R8E A;  5ADX A;  1KAZ A;  3AGR A;  3DJC A;  2HBM A;  2V52 B;  4CZH A;  2WC9 A;  2BTF A;  1X9J A;  5EY4 A;  2D1K A;  3KVG A;  4BR2 A;  3CCQ N;  2NRV A;  3FZH A;  3TPQ A;  2NNW A;  5CHI A;  5I9E B;  4YOY A;  1VQ8 N;  1ZC6 A;  5EXW A;  4IOC L;  3OBY A;  3U8X A;  2P9P B;  2VGM A;  3A5N C;  4OO1 J;  3G6E N;  3E66 A;  4ISF A;  1QZ6 A;  3AGK A;  2IVP A;  4AM7 A;  4B1Y B;  1NGF A;  2P9N A;  3EKU A;  3QIC A;  2ZF5 O;  3HM8 A;  3L6Q A;  3WXM B;  3CXC M;  1LOT B;  4H5T A;  3E1Y A;  4FPB A;  3BUZ B;  5EVZ A;  4JHD A;  4E1J A;  4H0X B;  1X3N A;  2P9S B;  1KD1 O;  2E2O A;  3IDH A;  1QHA A;  2F9T A;  4MO4 A;  4JKH A;  3MWP A;  1KXP A;  3AY9 A;  2FF6 A;  4LC9 B;  5AZI A;  3WQU A;  4IDH A;  4I6M A;  3KWG A;  2HF3 A;  3U9Z A;  4BR4 A;  4B1W B;  2VCP A;  5E84 A;  4A2A A;  4C1N I;  5H1S Q;  1IG8 A;  3CJB A;  1BUP A;  3R1X A;  4RTF D;  3ZEU A;  3SAG A;  3MX5 A;  3I33 A;  1HJO A;  1HLU A;  2F9W A;  2ZJR L;  3A0I X;  4MLH A;  1TYQ A;  3UKR A;  2YX6 A;  2GUP A;  4IXC A;  1Z6R A;  1GLC G;  4BRG A;  2NRR A;  2DPN A;  4WYB A;  3VET A;  3ZET B;  5GAG P;  1TUY A;  3FZM A;  3LL3 A;  4FWS A;  3SAH A;  3OW2 M;  2NRT A;  2AA4 A;  2GEL A;  5M1P A;  3VES A;  3CC4 N;  5F0X A;  5C15 A;  5KQD A;  1VQ9 N;  1O13 A;  5AQL A;  3WT0 A;  3LM2 A;  5GIO A;  3O9T A;  3H3O B;  3CJA A;  4JKE A;  4BRI A;  4IWV A;  3DXK A;  3O1W A;  1NGE A;  3VF6 A;  5BR9 A;  5ELZ A;  4AF1 A;  4ILH A;  3RSE A;  4BC5 A;  3SLC A;  2PFU A;  3U9D A;  4YOV A;  4YOW A;  2JWK A;  5AQR A;  3BEX A;  2GWJ A;  3TSP A;  5AFU H;  3NVK A;  4CBU A;  3WEE A;  3VOV A;  1YUW A;  3LDQ A;  3VEN A;  3K9J A;  3CJC A;  1E4G T;  1G99 A;  2AP1 A;  2QW9 A;  4IFE A;  3VTI A;  4EHT A;  5GAH P;  1YJ9 N;  3AAR A;  5JIC A;  4OPA A;  5M1F A;  3GL1 A;  3N4P A;  5AQM A;  5AR0 A;  3TTD A;  4A59 A;  2P9K A;  3IMX A;  3MCP A;  3CCR N;  4BQL A;  3F2K A;  4BRD A;  3VEY A;  2Q0U A;  4IEI A;  4FO0 A;  3FGU A;  2GWK A;  2HF4 A;  3CPW M;  1EQY A;  1D4X A;  1NGA A;  2WFB A;  2OTJ N;  3R6M A;  4FWK A;  4BGA A;  2CGL A;  4BRE A;  2FSN A;  5AQU A;  3VMF B;  1P90 A;  1NMD A;  1KAY A;  3CQX A;  3MN6 A;  1DGK N;  3TTC A;  3G71 N;  1Q86 O;  1S3X A;  3O9R A;  4HWI A;  2W41 A;  3E9O A;  4M7X A;  1YJN N;  2CGK A;  1GLJ O;  4QS7 A;  5M1K A;  1Y64 A;  2VYP A;  1KAX A;  1TUU A;  4JAX A;  5C10 A;  4WQ5 A;  3PIO L;  1NGB A;  4KBO A;  4IZ9 A;  3KK7 A;  4GVE A;  4JD2 B;  2A40 A;  2BUP A;  2CGJ A;  4FWR A;  4WCE L;  1CZA N;  4G9Z A;  3HRG A;  1Q81 O;  2E8A A;  5FPD A;  2YHX A;  4U67 L;  3CME N;  4A61 A;  3HI0 A;  1GLD G;  4K41 A;  2A41 A;  3CCV N;  1NGD A;  2P9I B;  2GTD A;  2A5X A;  2QWO A;  2E2Q A;  3SMS A;  4BC3 A;  1DKG D;  2ZGZ A;  3O9U A;  4BR5 A;  4CD1 A;  3KWI A;  1K9M O;  4M7Y A;  3ZX2 A;  5JMV A;  3P31 A;  3CJ9 A;  1ESV A;  4XEI A;  3ULE A;  2D0O A;  2ITM A;  4BC2 A;  3HTV A;  4BRO A;  1QQM A;  3ATV A;  3UE5 A;  1SAZ A;  4NLC A;  3DLL L;  4JEP A;  4H5W A;  5LY3 A;  5AQW A;  3D7E O;  3O4W A;  3MK6 A;  5MLC Q;  3TSU A;  3VEV A;  3I56 N;  2A3Z A;  2YCH A;  4YOR A;  3C0B A;  3TU5 A;  1MA9 B;  1NBW A;  4JKC A;  4BRM A;  3H3N O;  3FFK B;  2YJE A;  1E4F T;  1K8K A;  5AZJ A;  3O9S A;  3HOT A;  3AAP A;  3UKU A;  3D2F B;  3SBT A;  4UY8 O;  2P9U A;  4IO9 L;  3FZK A;  3K9K A;  3HSC A;  4O8K A;  4EAH D;  4CBX A;  3MN9 A;  4H0T B;  1BOT O;  2CH5 A;  5DM6 L;  2FSK A;  5M1O A;  2F7T A;  1VQ6 N;  2Q0R A;  4ISG A;  4NO7 A;  1JCE A;  3BF3 A;  1YXQ A;  1P8Z A;  5TKY A;  4NLB A;  5AFU A;  3QBW A;  1TYQ B;  3IFR A;  1BWF O;  2HBL A;  3F9M A;  5BRH A;  3O9Q A;  2IIR A;  4ILJ A;  3VGK A;  5EOY A;  3KHY A;  4GV9 A;  2HBJ A;  1W97 L;  3ENB A;  3Q7B A;  3MMV A;  2QWM A;  3KZB A;  3VTH A;  2PBD A;  4WFN L;  3N4Q A;  3VF4 A;  1C0G A;  3DWL A;  2NRW A;  5JVG L;  5B8H A;  2P9P A;  2YHW A;  3WXJ A;  4CZI A;  5BPM A;  2WBN A;  1ZXO A;  3O6W A;  1IJJ A;  3CER A;  1XQS C;  3ID8 A;  3FE1 A;  4GV6 A;  3VGL A;  3IUC A;  3J8A A;  3VEO A;  5EX5 A;  1VQK N;  3LDP A;  3EE9 A;  3E9P A;  4DCH A;  4A2B A;  3EZW A;  4Y0W A;  4CZJ A;  3QFU A;  1XC3 A;  4WF9 L;  1Q7Y O;  4Z94 A;  4FL9 A;  3IKM A;  3L4I A;  1NJI O;  2QWP A;  2Q1N A;  3VEZ A;  3EO3 A;  4H03 B;  3CCS N;  4BG9 A;  5AQP A;  2P9S A;  2NRZ A;  2D4W A;  4FOI A;  2I7P A;  4H0P A;  2E2P A;  4QS9 A;  3DXM B;  3JXU A;  4CZK A;  3O1B A;  2NLX A;  2GX9 A;  1VQ4 N;  4AM6 A;  4BRF A;  2IVO A;  1KC8 O;  1U2V B;  3ID6 A;  4PL8 A;  4RCH A;  5AQS A;  3CCE N;  2NZT A;  3BF1 A;  4A57 A;  4YOX A;  1RDW X;  3CCJ N;  3CJ1 A;  3Q7C A;  4ILG B;  5BRE A;  3A5O C;  4FWP A;  3WXL A;  1WOQ A;  3SAF A;  3D2E B;  5AQT A;  2V51 B;  3GDQ A;  3ZET A;  1EO1 A;  1JCF A;  2D0P A;  2UYT A;  2V7Z A;  4FVU A;  4HTL A;  2HBK A;  3FZL A;  5AQX A;  3EN9 A;  2KKZ A;  3NVM A;  3SBG A;  1ILY A;  2QWN A;  2P9L B;  3L4Q A;  3CCL N;  5FPM A;  4WQ5 C;  1ATN A;  3GG4 A;  5C2F A;  1DT9 A;  4CZM A;  5BPN A;  1SQK A;  1T44 A;  3FLC O;  3AAQ A;  4B1X B;  5KPR A;  1HUX A;  1NGJ A;  3R3L A;  2QWQ A;  5AQK A;  3ZX0 A;  4PKH A;  1VQ5 N;  4JN4 A;  3MCA B;  5C0Y A;  4KH6 A;  4IJA A;  3VEW A;  3G4S N;  4K25 A;  3GE1 A;  2BH1 A;  3QFP A;  2A6A A;  4BG8 A;  2H3G X;  3EL2 A;  1VQ7 N;  3LDN A;  2FXU A;  4JKG B;  3C7N B;  5AQH A;  4CZL A;  3LDL A;  3TSQ A;  3ZYY X;  3M6G A;  3LM9 A;  4M63 C;  1ATS A;  3HBT A;  4J8F A;  3WQT A;  1RGI A;  3CF5 L;  4B1V A;  4BRH A;  3L0Q A;  4DHY A;  1YHQ N;  3SJH A;  3MWT A;  5C12 A;  4WFB L;  1SZ2 A;  4WQ4 A;  3PLA A;  1MWK A;  5AQJ A;  3A8Y A;  1BA1 A;  5BPL A;  4CZF A;  3M1F A;  5JVH L;  4PL7 A;  2ASO A;  4CZE A;  4GV3 A;  3TTF A;  4JNE A;  2QI2 A;  1NGC A;  1OKJ A;  1QVG M;  2CH6 A;  5C2D A;  3O80 A;  4GNI A;  2VWB A;  5HOO A;  3OBW A;  4K42 A;  1VQN N;  4L3Q A;  1XUP O;  2FF3 B;  1BDG A;  3RVC A;  4BR9 A;  1NM1 A;  4IJN A;  3T7Z A;  4RWT A;  3ATU A;  3P39 A;  2VGN A;  4JD2 A;  2E2N A;  4XH4 A;  1ATR A;  4H5R A;  2P9N B;  3PIP L;  4B1U B;  1KQS M;  4JK7 A;  2W40 A;  3FZF A;  4CD3 A;  2RHK A;  1VQM N;  1C0F A;  2QWR A;  3CC2 N;  5AQI A;  4CI6 A;  2P9I A;  4DKW A;  3C6A A;  4JHD B;  4BRC A;  4C23 A;  1MDU B;  4KH4 A;  4OPH A;  2PAV A;  5F2R A;  5BN9 A;  5LJW A;  2QTD A;  4K43 A;  3CD6 N;  1HPM A;  1YVN A;  4JK9 A;  1VQL N;  1BO5 O;  1GLB G;  5AZI B;  3W0L A;  3ZX3 A;  3CMA N;  5JLH A;  4I6M B;  4BRN A;  3CPE A;  3EE8 A;  5AQO A;  3UB5 A;  5AQZ A;  3SMP A;  1BA0 A;  5AQV A;  3ZEU B;  4EFH A;  1DEJ A;  5AQQ A;  2OTL N;  2Q31 A;  3O5B A;  2Q36 A;  3UKR B;  5AQF A;  1Z05 A;  5KPT A;  2YI1 A;  4BVO A;  1M90 O;  5BN8 A;  5AQY A;  3HZ6 A;  3J7Z O;  4FOE A;  5JLF A;  1QVF M;  1ZBS A;  4DB3 A;  4KH5 A;  2HST A;  3M3Z A;  4GY2 B;  4YOT A;  5LJV A;  4FSV A;  2V7Y A;  4H5V A;  4FWO A;  1YIT N;  2JWL A;  3ENO A;  1T6C A;  3T69 A;  4IEE A;  5FPE A;  2QWL A;  4A5B A;  3DXK B;  3MX2 A;  5GIP A;  2YHY A;  3QB0 A;  3H46 O;  3RSE B;  3D2F A;  1T3V A;  1NGG A;  3O08 A;  3SK3 A;  3U4L A;  2OAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...