1JLCA

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with pett-2
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
547
structure length
534
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords HIV-1 RT A-chain
total genus 130
structure length 534
sequence length 547
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlcA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlcA05
1S0NA 4K4VA 4CHNA 4F4KA 3KKSA 2BR0A 4JS5A 1FKOA 4TYBA 3RBDA 3HVAA 1KLMB 3G6YA 4Z4EA 4FXDA 4KI4A 2IAJB 2YNHB 3CG7A 3LZJA 1W25A 2P1JA 4ELUA 4GW6A 4F8RA 1RBTA 3H5SA 4KI6A 2HNYB 4CHQA 1NHVA 1C0UA 3Q8RB 4F3TA 3TAGA 1JLCA 1JLGA 4Z4HA 2XY6A 1C1AA 3TANA 3G0ZA 4CGDA 1NK8A 1HQEB 4Q8EA 5KG3A 3SPYA 4PUOB 3V6DB 2I5JA 3VQBA 1UWBB 2AGPA 3H5YA 3KJVB 2GIRA 3ASMA 2D0AA 3A2FA 1VRUA 4JV2A 1QSLA 4CJQA 3PX0A 4DTUA 1WN7A 1JLAA 1N5YB 5I3UA 3SUNA 3BDPA 2GIQA 1SL2A 4JV1A 1C0UB 4FM0A 1S1XA 2DPJA 5KG7A 3CWJA 4MFBB 3NAIA 1VSHA 4WZMA 1IKXB 4AHTA 3QERA 3U3YA 4MK8A 4FLWA 4PWDA 1JKHB 2WK4A 2YKMA 2FLLA 4HUFA 3DRPB 1WNSA 4FS2A 3V9WA 2C2DA 2XCAA 4B3OB 4FLZA 2B43A 2WB4A 3PO4A 4IFVA 4CEZA 5HLFB 5C42B 4O4GA 1RT6A 3ZSZA 1BQMA 3EZ5A 3HHKA 4MK9A 4MQ3A 5F8IA 3LAKA 5KT6A 2HB5A 5CZ2A 2DFEA 3AO3A 1TKTB 1S0MA 3GIJA 4Q43A 1UAXA 3KHHA 1BGXT 2HMIA 3OYMA 1J54A 3RBEA 5HRNA 4DTMA 4FJ9A 4FCYA 1MU2A 5CYQA 2G8UA 3RB3A 4WXWA 3IRXA 4IQXA 4HUEA 4B8CA 2EHGA 2D0BA 1KSPA 3NH0A 4IKAA 4B8AB 4KO0A 5F8HA 2AGOA 5KG6A 3KLGA 3M8PB 4ZP6A 4R5PA 1QAJA 4BE2A 4O3SA 1JIHA 4F2SA 1NNDA 5J2NB 2YHAA 5FROA 3N6MA 3DRSB 3E01A 4DSIA 4C8KA 3U3GA 2WOMB 4B9VA 3LP0B 4QOZB 1GOBA 1REVB 2QXFA 5DLFA 5KFUA 4CGJA 3HVTA 2XHBA 1S6QA 5CZ1A 4CHZA 2WOMA 4XPCA 2VG5B 5F8JA 2X74A 1SL1A 1X9SA 4F4WA 5KRSA 3DRRA 4CEEA 4WFYA 3H2LA 3F9KA 1TKZA 2R2RA 4E89A 2FVSA 3DYAB 4DTNA 3QNOA 1JLEA 3JSMB 3QEWA 4B9MA 1D5AA 3SUOA 4ZP7A 1TKZB 4M3RA 1N6QA 1NKEA 4F4ZA 1A5XA 4AHUA 1C1CA 1RT7A 3NL0A 4G1QB 4QWEA 4M3WA 4MK7A 4O5BA 3G6XA 1HPZB 4DU3A 4H8KA 3DRSA 3RB4A 1XR6A 3HPOA 2OPQA 3KLEA 2YNGB 4CEQA 4FZZA 4KE5A 3GIMA 1G15A 2P5OA 3KMQA 5DK5A 3VQEA 1X9WA 5J1EB 3M8SA 1S0OA 3ZT3A 3PZPA 4Y2AA 4F2RA 3P1GA 3I0SB 2PY5A 3NCIA 1RBUA 3LALA 3V9XA 2JEGA 3JYTA 4AHRA 5HRPA 4ED0A 1KCFA 1KLMA 1LWCA 1WSFA 1IKVA 1BQNB 3LP1B 4ZMMA 4W5NA 2XC9A 3BGRA 3V1RA 4RW9A 3NH1A 2JC1A 3QLHA 3ZT2A 2B6AA 4W5OA 4FJLA 2WTFA 4J9NA 4OPJA 1J5OB 2Q3SA 5KFKA 4CECA 4TY9A 1T94A 1UA0A 3M9NB 3H40A 1S1UA 5EWFA 4TXSA 4YR0A 3GIKA 3C94A 2IM0A 3EPIA 4NLDA 3DOKB 5KG0A 3CJ5A 3ISND 5FRNA 2VG7A 3CVKA 5HP1A 4ZPDA 1J53A 4M3ZA 3MR3A 3C6TB 3KLIB 3FFIB 4DG1A 1YTAA 3LWLA 4MH8A 5KFQA 3SYZA 4DSJA 4R8UB 1JXEA 3MF5A 2BE2A 3TAEA 4RW9B 5EU7A 1R0AB 3MXJA 3KHRA 3QIPA 1RDCA 2Z1HA 4ED1A 2DPIA 4M45A 4M41A 3QETA 4K4ZA 1EP4A 3IG1A 4J2BA 2CJQA 5I42B 3BSCA 3IN5A 2OZSA 3HVRA 4H4MA 4Q0BA 2WHOA 4CE9A 4XO0A 3OVNA 4H54A 3OYNA 4RG8A 4O4GB 4CJ5A 4PUOA 1A5WA 1RAJA 5KFSA 3TAPA 5DG7A 5KGXA 3MEEB 3D28A 4FJ7A 3DLGA 4O44A 4MKBA 4G1QA 3QZ7A 3B6PA 1RTJB 2AQ4A 2A1SA 3AA2A 1JKHA 1XI1A 2W7OA 2JGUA 1ASUA 2R8HA 1TV6B 4OLAA 3ZSQA 4I9QA 3N6NA 5KFVA 4DQIA 4ECZA 2BRLA 2QKKA 5C5JA 2RKIB 2FLPA 4I2QA 3BGRB 3OYJA 4FJKA 2ASDA 3OYKA 4U6PA 4ED3A 4Y1DA 1BQMB 5DGAA 1EP4B 4CK1A 3CJ0A 4I2PA 2E9TA 1S49A 4Z4CA 2IC3B 4CF8A 4DS4A 4FM2A 4FYDA 2R8JA 2HNDA 3K5MA 4GC7A 1JLCB 1RDBA 3HM9A 4K8ZA 3DI6A 2HMIB 3TI0A 2G8FA 3KLVA 3H5UA 4FJMA 2ATQA 1KVAA 4HYKA 4J9LA 4IG3B 4NCAA 2HHVA 4LSNA 3HP9A 1RYSA 3OYEA 2HNZB 3EZUA 3MEDA 4Z4IA 3FSIA 3DRRB 4ECVA 5KFLA 3CDEA 1MU2B 5KFGA 5J1EA 4HVJA 4E1NA 3C6TA 3KLIA 3M9OB 2E6MA 4E7HA 4FJ5A 2PYJA 4B9NA 1RBSA 2G8KA 3VQQA 1UA1A 1BIUA 1IKXA 3NF8A 5L9XA 3OSNA 4FLUA 1NJZA 4CIEA 3S3NA 3H4DA 5HROA 1KTQA 2HW3A 3DMJB 4YQWA 1UOCA 3CM6A 3SUQA 3HO1A 2RDIA 5KFOA 5HBMA 4DU1A 5KFPA 2BQ3A 3M8PA 3L2UA 1SL0A 3RMBA 1RTIA 3OSPA 2HHWA 3KK3B 2YNHA 3M8QA 1FK9B 4MKAA 1S1UB 3ZT1A 2FVPA 1TP7A 3OL6A 4QPXA 3QIDA 2R7YA 4DL4A 4DFPA 3NDKA 1XC9A 1S1TB 5KT5A 4RU9A 4OVLA 4B9TA 1VSFA 1T3NA 4X2BA 2IOCA 1J9AA 4O0JA 3D45A 4RUCA 4GVMA 3AVHA 2R2UA 2W9BA 4ED7A 3L3VA 4RW6A 4WYWA 3KLEB 4RW4A 4EP5A 2HNDB 3PW0A 3PR4A 5KFRA 5KFBA 3DLEA 4O3QA 2ITGA 2IS3A 1ASWA 4RW8B 3NH2A 4CJRA 4WYLA 2IJFA 3HL8A 3E51A 2KFNA 3OJUA 3VQ6A 3MTKA 4Z0UA 4CF2A 4FJJA 4DTPA 1FKOB 1Q9XA 3QIPB 3AA5X 3OS0A 3ZSOA 3K59A 4IG3A 4DQSA 4ZTFA 1T05A 2VA3A 4DSFA 1SUQB 4FK4A 2AGQA 1W0HA 1RT4A 3RR8A 3OY9A 1ZTTA 2OPRA 4K4XA 4BACA 3KLHB 4HHTA 3THVA 4LSLB 4ZHRB 4IG0B 1JX4A 1NJWA 4DTXA 4EBCA 4FK0A 2BQUA 4AH9A 5DMRA 4FLXA 3CJ3A 1IM4A 1RA6A 4H4OB 3CDUA 1HNIA 4QWBA 3H5XA 1S1WA 3HYFA 1TK8A 4EBDA 1JLEB 1NK9A 2C28A 4PY5A 3HP6A 5C42A 3T5LA 3DLRA 2W8LA 4PQUB 2VG7B 2D3ZA 3ISNC 4EEYA 1U4BA 1WSGA 4CGFA 1LV5A 1ZETA 1TV6A 5F8NA 4CJPA 2VG5A 2C2RA 4O3OA 4FM1A 4YP3A 3DOKA 1K1QA 5D3GA 2F8TA 2B5JB 1LW2B 1S4FA 4DFMA 2Z1GA 1RTJA 1S1XB 3NGZA 1LWFB 1TQLA 3PJWA 2V4QA 4M94A 3FFIA 4HTUA 1IKWA 3HT3A 3AVKA 1W9HA 1RBRA 1C0MA 1LW0A 4BE1A 2Y1IA 1LWCB 4NRTA 4KHUA 4FZYA 3EPGA 3ZSWA 3D0PA 2OPPA 4Z4GA 4M3TA 1GOCA 4NLRA 2J6SA 4IH5A 5L1LA 2KFZA 2ASLA 3SFGA 4F4YA 4DSKA 4CEAA 4KREA 1IKYA 2E6LA 5SWMA 5JS1A 2KZMA 1U04A 3MXIA 2IM3A 2IM1A 1KFSA 1WAJA 2FBYA 3TABA 1TAUA 4NYNA 5C25A 2W7PA 1BCMA 3SI6A 1C1BA 1U45A 3RWUA 1RT4B 2UVRA 1QQCA 4RNOA 1VRTA 1EKEA 4J2DA 1HNVB 1KVCA 5KT3A 5K14B 4NLQA 1UWBA 3S3MA 2V9WA 4JRQA 3DM2B 2RKIA 4TSXA 3CFPA 1NOZA 5KFFA 1S9GB 2ILYA 1B9DA 4BDYA 4B9SA 5J2NA 1VRUB 1NKBA 3O3HA 2FVQA 3OLBA 4NLVA 3DLBA 2IM2A 4DQPA 3GV5B 5KFCA 4QW9A 5T7BA 5DLGA 2G8IA 1KRPA 2IA6A 2BDPA 4CIFA 3ZT0A 4DL6A 5DG9A 5KT2A 4C8LA 3OS2A 1GX5A 1TGOA 4FW1A 3MECA 4CJKA 1IKVB 4LH4A 3O4QA 4OL8A 3ZSXA 3JYTB 4H4MB 4Q0BB 4CK3A 4WXOA 5HRSA 3MECB 1ZBFA 1T8EA 3TAMA 3HXMA 1QSYA 4CEFA 3FRZA 4WFZA 4C8MA 4DU4A 3FQKA 3NF7A 5J2MA 4WZQA 2X6SA 2D3UA 4GMJB 4EZ9A 3PX4A 5KTQA 2UUWA 3VQ5A 2AX0A 1S9FA 4ID5A 2KW4A 4B08A 3LP3A 3QEPA 4R8UA 3T5KA 3AVIA 3AVNA 1TKXA 2Z1IA 4U7CA 3TVKA 2QE5A 4IH6A 1VSJA 3QGHA 1JLGB 3HPHA 1S48A 3FDSA 3T5JA 1BI4B 4WFXA 3OHBA 3V1QA 3QO9B 4M3XA 3L3UA 3GILA 4N56A 4ZVHA 1QAIA 2HHSA 1RTHB 1JLBA 3SI8A 4FZXC 4LY7A 3AVJA 3NF9A 1L3VA 2ZE2A 3V9SA 1VSEA 1T7PA 5F9NA 3SUPA 1N4LA 1VSIA 2D41A 4JRPA 5KFYA 1HARA 3M8QB 2E9RX 4KPYA 4YFUA 4ICLB 4B9UA 1Z4UA 1L3UA 1NJXA 4ID5B 2D0CA 4EO6A 3BSOA 2B5JA 4PA1A 1JXLA 3MAQA 1ASVA 3I5CA 4ZPAA 4KV8B 4IFYB 4QAGA 1KHVA 4KBIA 1L3SA 4N5SA 1JLQB 3AVGA 5FRMA 3G86A 5L1IA 1B92A 1D0EA 4AHVA 4DWIA 3LAMA 3LPUA 3PJXA 1XWLA 4NLOA 4XPEA 2YKNA 4IRCA 2XWYA 3ZSVA 4CJUA 4F4XA 1C0TA 1XHXA 5DQGA 1NHUA 2IBKA 3OYFA 4K4SA 1WSHA 2BANB 3V81A 2OPSB 4IOBA 4NRUA 1RT3B 4M95A 2QV6A 1R0AA 4DTOA 3KOAA 3NMAA 2BE2B 2AWZA 2PZSA 4ZHRA 3V6KA 3OJSA 1X1PA 3CQ8A 3TAQA 4TY8A 3SQ0A 1IO2A 1GOAA 1IKYB 1NKCA 5C24B 1C6VA 4CFDA 3VQAA 1FK9A 1Z25A 5HP1B 4KO0B 2YNGA 4O4RA 5F9LA 3MEGB 1HNVA 2ILZA 2J6TA 4KB7A 2JEFA 4N41A 5F8MA 3AVFA 2JEIA 3Q8QB 5FDLA 2IMWP 2V0NA 4CFAA 5T14A 2DY4A 1JL1A 4E3SA 1RT3A 4J9QA 4NCGA 3SPZA 1VK0A 4FK2A 3QZ8A 3LPTA 2FVCA 2Z1JA 4WE1B 3G10A 1F21A 3QLHB 4DL2A 4IRDA 4F50A 4ZVGA 1SV5A 4FW2A 1B9FA 1BISA 2IJNA 2GUIA 3Q8SB 3UIQA 4CCHA 1TK5A 3HVWA 4OLBA 3HPGA 1NK6A 1QE1B 4CGGA 1JLBB 4KHRA 1RILA 2X6NA 2HVIA 5KFTA 3MEGA 4TQSA 3AVMA 4DL7A 4DMNA 3DLEB 3IGNA 3ITHA 2CKWA 3IRXB 1K6YA 4RW7B 3DYAA 4CIGA 4KHMA 1NK0A 4CHPA 4G3IA 1ZBIA 2G8WA 2E9ZA 4DF4A 1QSSA 3ZCMA 3RRGA 1S1WB 1LAWA 1CXQA 4KKOB 2R2TA 1EETB 4DQQA 2XY5A 4RW6B 5KFXA 4FLYA 3MXMA 2HHUA 3KHGA 1BQNA 3M9MB 4FBTA 3KIOA 3PVXA 5HLFA 5CYMB 4RZRA 3ZSRA 4JUZA 1I6JA 4RW8A 3GV8B 1CXUA 1D9FA 3AVCA 4NYZA 1S97A 2KTQA 2BGGA 5CYQB 3AA4A 5CYMA 4NLGA 2JEJA 5KFIA 3UPFA 3VQCA 4IKFA 2VWKA 1DTQA 3NGIA 1TL3A 4ECUA 4CJVA 3V9UA 3ZT4A 4FJNA 5EWGA 5L1JA 3OYCA 3NAHA 3O4NA 3M8RA 1RTHA 3H08A 4O3PA 4O3RA 5J2PA 1K1SA 1QHTA 3ULDA 3QGGA 1C2PA 3OYHA 4R0EA 2PYLA 2AX1A 3RAXA 3TR8A 3V6JA 4DSLA 2WONB 4CFCA 1N6QB 5L1KA 2VG6A 3K2PA 4FLVA 3SQ4A 3QNNA 3QEVA 4IFVB 4UQGA 4DTRA 2OPRB 5FDLB 4CERA 4K4WA 4K4TA 1T05B 1ZBHA 1S5JA 4DF8A 1T03B 2OA8A 2XO7A 1FXXA 5DQHA 2RN2A 2FVRA 1SV5B 4QWDA 2EC0A 4C8OA 1TKXB 5KG2A 3DMJA 2D7SA 5KG5A 3C6UB 4FJ8A 3GYNA 5KT7A 3LZIA 4J2EA 4ELTA 3OL8A 4L8RB 3HKWA 3QO9A 1RBVA 4F3OA 1SKRA 3VA3A 5HBMB 3HSTB 2I1RA 2XY8A 4KHWA 1EXQA 5J2QA 4FJHA 1RDRA 1IH7A 2OPSA 3ITHB 4NLWA 3QYYA 4ED2A 3RMCA 2HHQA 4ECTA 2R8IA 1T03A 4KAIA 1U49A 2HWIA 3MFIA 2HHTA 1BL3A 4N47A 1RCHA 1HRHA 4BWMA 3K5LA 2OH2A 1HQUB 2C22A 3OHAA 4XIUA 3I0RB 4CEBA 3PR5B 3RMDA 4KV8A 4GC6A 1HQUA 3V6DA 3MEEA 3BR9A 3SZ2A 4N76A 5HROB 4E19A 3KKRA 3RAQA 4RUAA 3WNGA 3RB0A 4OKKA 4NCGB 3VA0A 5KFMA 2G8VA 4QWAA 4J9MA 1N48A 4EZ6A 1DTQB 4QW8A 3CFRA 2X78A 3BSAA 1CLQA 3TAMB 4RNHA 1SUQA 3PUFA 2FJWA 2R8KA 3H98A 4CJWA 3T3FA 2RDJA 4Q44A 3IG1B 3KK2B 2KQ2A 3I5BA 5KFJA 2IGIA 3B6OA 4K4YA 3I0SA 3UDLA 3CIZA 1BIZA 1C1BB 3VQ4A 4E0DA 3ICLA 4J9OA 1C0TB 1CSJA 4CJFA 2FBTA 3PW7A 1S9GA 3L2WA 2BQRA 1RTDA 3AVLA 3K57A 4FJGA 2GC8A 3KJVA 4I7FB 3KK1B 2HHXA 4J9PA 4K8XA 4NLSA 2P51A 4URGA 4I2QB 4RNNA 4KHSA 1VSDA 3BJYA 1JL2A 4NYFA 4DTSA 4DFJA 3NHGA 2VA2A 3QEIA 2Y1JA 3SFUA 3I8DA 3VN5A 4LQ3A 3OYDA 1C1CB 1RT7B 2R2SA 4CHYA 3O3FA 2UUTA 2HAIA 1YTUA 5KFZA 4JLHA 3AA3A 3QIOA 4Q8FA 4ZP8A 3V4IA 4W5QA 2RF2A 2GV9A 1D9DA 2JLEA 4Y2CA 4LD0A 3SCXA 4QWCA 3K58A 2W8KA 1RT5B 3QESA 1HNIB 4Y34A 4DS5A 4IH7A 3AV9A 1X9MA 1HYSB 2W9AA 4KB0A 4CJTA 3RTVA 1REVA 1BI4A 4CJ4A 3RB6A 3D5MA 1JLFA 1GX6A 3BSNA 2OYQA 2XRIA 3V9ZA 4RW7A 2UVWA 1I39A 3MR2A 4YMEA 4KHQA 1ZYQA 4ID1A 2W9CB 4EYHB 3WNEA 4OGEA 2YNIA 4RW4B 4EO8A 3DM2A 2VWJA 4IG0A 3T5HA 5KFHA 4KHNA 4HCBA 2HWHA 5K14A 4CFBA 5KT4A 3L2VA 1Q8IA 2AJQA 3PX6A 1HYSA 1NK7A 1LAVA 3OS1A 3NAEA 3MEDB 5EDWA 2XY7A 4CHOA 3CDWA 3HVTB 1QS4A 4ED6A 3KD1E 4HUGA 1U47A 2KZZA 4Y1CA 3KMSA 2ZKUA 2B4JA 3OYBA 3CFOA 1TKTA 3BQ1A 5F8GA 2W9CA 5KFNA 2J6UA 4YR2A 3KLFA 4J2AA 3IS9A 1N5YA 4TYAA 4ZPCA 3AO1A 4MIAA 3VQ8A 3K5OA 4CESA 2IC3A 3KD5E 1RDAA 2QKBA 4CF9A 4TQRA 4FS1A 3C95A 5HRRA 4Y3CA 1CZ9A 2NUBA 5KRTA 5KFEA 3OYLA 1WNEA 4J9SA 3KK1A 1NK4A 4EBEA 1JLAB 4LSNB 2D5RA 2F8EX 1HYZA 3ZSYA 3LP2A 2R8GA 4CF1A 4CK2A 4HKQA 2OPQB 3K5NA 1ZBUA 4DTJA 3HJFA 5KFAA 5J2QB 3RRHA 4CJEA 2WRMA 4KAZA 3LP2B 4CJSA 5D3GB 1J5OA 1TVRB 4QCLA 1XR7A 3DLKA 2HNYA 3N6LA 5J2MB 4OPKA 3NBPB 3S3OA 4NLYA 5KG1A 4M3UA 1WSJA 1SH2A 1DLOB 1TL3B 3IGVA 1RNHA 4YNQA 2YNFB 2OPPB 1S10A 2YKNB 3MR5A 1RT1B 3T19A 4JS4A 3SQ2A 3RMAA 3GV7B 1DLOA 3VQ7A 4E7IA 3H59A 4DLGA 3BREA 4PQUA 1VRTB 2UVVA 3OLAA 3DOLA 4NLPA 2VG6B 2XGQA 2DFHA 2ZD1B 4KHYA 3PY8A 1TVRA 5EWEA 4Q5VA 4LSLA 3V81B 4B9LA 3DOLB 3E01B 3CYMA 1S1TA 3SV3A 1BHLA 3AO4A 1Q9YA 2HVHA 3MFHA 3SV4A 4RNMA 4O3NA 4DG1B 3PO5A 2IAJA 4NZ0A 4NLTA 3DDKA 2HNZA 1S1VA 1VSMA 3GIIA 1ZBLA 3LANA 1ZTWA 1HMVA 4M3YA 2FLNA 1YT3A 3CJ4A 4ZVEA 1RTDB 5DG8A 4FJXA 4YR3A 4AHCA 1DTTB 4ECWA 2RF2B 1JLQA 3DLHA 4B3OA 4K4UA 1Z26A 1WSEA 3DLGB 5DGBA 4BE0A 2DTUA 1RDDA 3AVBA 5JS2A 2V4RA 2ZQBA 2F8SA 3T1AA 4Z4FA 4DEZA 4URSA 3PV8A 3CJ2A 3L2QA 1A5VA 1QUVA 4Q45A 2ETJA 3GQCA 3G6VA 4TLRA 5E41A 4OJRA 1HJRA 3NKYA 4IR1A 3NGDA 4I7FA 1RT2B 3AO5A 4KTWA 2FC0A 4ECYA 3TARA 1QE1A 3KK3A 1JXBA 3VQSA 2IDOA 1TKDA 1RT5A 1ITGA 1LW0B 4TY8B 2EX3A 4OKJA 2ALZA 4KSEB 4BDZA 2YKMB 3I0RA 4DL3A 5I42A 4J9KA 2XGPA 4OGCA 3UR0A 1CZBA 3V4IB 4NLUA 5KG4A 1NOYA 3SJJA 1RYRA 4DFKA 1RTIB 1XHZA 4BDPA 3TAFA 4MIBA 1TL1B 3V6HA 4ECRA 4IDKA 1IKWB 4BWJA 1SKWA 1KVBA 2LSNA 3QINA 3DLKB 3H4BA 3NGYA 3OYGA 4ZVFA 3LP0A 4TN2A 4HCCA 3C6UA 2YHBA 2XI2A 3P5JA 3TQ1A 2WCXA 2FJVA 4DSEA 4CJ3A 3NFAA 3AO2A 3KHLA 3DRPA 3BQ0A 2YNFA 1S6PA 1YVUA 4ELVA 3IS9B 5F8LA 4CJLA 1BCOA 3WNHA 4ZP9A 4EYIB 4LH5A 4IR9A 3L8BA 2O4GA 1NJYA 1EETA 1N56A 1HYVA 2FBXA 2DFFA 4W5TA 4KB1A 1HQEA 2QK9A 5C25B 3KNAA 3DI6B 4O55A 1LWEA 4KFBB 4ECXA 3Q8PB 2AU0A 4KTQA 2WONA 3BQ2A 5DQIA 1IG9A 4ICLA 4CEOA 4WE1A 5J2PB 2JC0A 4DLEA 4DL5A 4I9LA 4NCBA 3KLGB 4I2PB 2C2EA 4K50A 2O4IA 3CO9A 3CM5A 2UVUA 1TAQA 1KHWA 1HMVB 1D1UA 4LQ9A 2YNIB 4IBNA 3VQDA 4AHSA 1FKPB 1I3AA 1NK5A 4FLTA 1U09A 3NBPA 4DQRA 1S9EA 4W5RA 1TK0A 2FJXA 3QGIA 4ED8A 2W42A 3KLFB 1LWEB 1LWFA 4KFBA 4E7LA 4AILC 3I5AA 3LP1A 3OYAA 4KRFA 3TWHA 2ZD1A 3JSMA 4E1MA 1KLNA 2OZMA 3EY1A 2P5GA 1WLJA 1SKSA 4E7KA 2ATLA 3VQ9A 4O44B 3KK2A 4J9RA 3PW4A 3EYZA 1U48A 1VSLA 1RT6B 4KTZA 2O5DA 5CY4A 3NF6A 5KFWA 1O1WA 1FKPA 1S6QB 1D8YA 1SH0A 4IFYA 4ZPBA 3VQPA 3F73A 3PW2A 4CGIA 3UQSA 3PW5A 1OS5A 1RT1A 4IRKA 3ALYA 4JV0A 3LWMA 3SNNA 1MMLA 4E7JA 4NLXA 5JUMA 3NE6A 2YV0X 1VSKA 3KTQA 1S9EB 2I5JB 2E4LA 2F96A 4MFBA 3O3GA 4IDKB 4O0IA 3LDSA 4FJIA 3V1OA 2RPIA 2G8HA 2BRKA 4FBUA 5I3UB 2XCPA 1WSIA 2ZE2B 1YVFA 3P83D 4CEDA 3QEXA 2FBVA 3AVAA 3KLHA 1EX4A 2A1RA 4CF0A 1QTMA 4ECSA 1KFDA 4R5PB 4C8NA 3SQ1A 3U6FA 3IAYA 1WAFA 4CGHA 3MR6A 3OYIA 1S6PB 1RT2A 4RNFA 4PWDB 3L2RA 1L5UA 5EUHA 2W9BB 4M42A 4OKEA 3FQLA 1DTTA 3PHEA 4H4OA 4ZTJA 1LW2A 1HPZA 5KGWA 5C24A 3WNFA 4KKOA 1RA7A 2ASJA 5KI6A 5SZTA 1JLFB 1S1VB 1SH3A 5KFDA 3S9HA 4URQU 1Y97A 1L3TA 2BANA 1XR5A 4ECQA 3RR7A 2XI3A 3HK2A 1TL1A 3OL7A 4EP4A 5JXSA 4FVMA 2B6AB 3OL9A 2GBZA
chains in the Genus database with same CATH superfamily
4P6QA 4F4KA 1G3OA 4KH1B 4ANEA 3IBWA 2MQ8A 4LREA 1QUPA 5GIOA 2A0FB 5M1NA 5AXKA 1VQ6N 2CG4A 2P1JA 4GW6A 4KI6A 4BR4A 4M5IA 4JI4F 2GQCA 2ASYA 1C1AA 2QL5B 4NMLA 2V69A 1NUEA 3O6WA 3HHEA 4PUOB 3Q86A 1TUWA 4WCEL 4OHXA 2V4JA 4ZVRB 3CUNA 1X4HA 2GIRA 2ROGA 1H38A 1E3MA 4IEIA 4X66K 1VRUA 2WAQD 4JV2A 3TTFA 4CJQA 4DTUA 1Y4ZB 2F4FA 1WN7A 3E1YA 4CM0A 3B4MA 1N5YB 2PN6A 3H45C 1HR0F 5E33A 2LU1A 2OP5A 4DR6K 1RBAA 2DPJA 2R7XA 2LECA 3TJAA 2GGPA 3CMQA 3M1FA 3J80Y 2ZVSA 3M30A 5LOQA 3U3YA 1HW8A 2QG9B 1I94K 3VEYA 3IR7B 4WWSA 2WK4A 3WDOA 2YKMA 2ZDOA 2P9SA 3ZC4A 3DRPB 1R0CB 2XCAA 1M5HA 3Q2TC 2ASOA 1IQTA 3PO4A 1Q79A 4CT9A 2NRWA 1YQHA 4P2XA 5ELZA 2VFVA 1IJEB 2O8DA 1XBWA 5F8IA 4OX9K 2JRSA 1JNZB 4CZEA 5CZ2A 3M6VA 4AT1B 2DFEA 2GFFA 5T7LA 3VCDA 1AROP 1KVJA 2O67A 3JAMU 2N7YA 4DTMA 4FJ9A 3TA2A 1IR0A 1WORA 2EW9A 1MWMA 2XS2A 4B8CA 3Q83A 1KSPA 2HRYA 2HQFA 2CZVC 4B8AB 2AGOA 3KLGA 3M8PB 3LUYA 1QAJA 1P1TA 4PXBA 1WKLA 5FROA 2JFDA 4ZLNA 4B9VA 5H9EJ 2P9PB 3M6XA 2MLYA 2XHBA 1ZH5A 2IMOA 4C98A 4NOHA 4XPCA 2B9XA 1WOOA 3MUMP 3D68A 2O8CA 3AB2B 1S22A 1SL1A 2AJ0A 4LF9K 2ZJQQ 1NPKA 4B3MJ 3QBWA 3H2LA 3A5NC 2KO1A 2FVSA 3QICA 3EVMA 4DTNA 1SXLA 1ZOTA 3JSMB 1JK9B 1TL7B 3MN9A 2MKIA 4B9MA 4M3RA 4F4ZA 2E7VA 2MQLA 2DGVA 4O5BA 3TJ9A 2HZCA 3G6XA 2NSBA 5AQOA 4H8KA 3DRSA 3HOTA 3HHDA 4JV5F 2ADBA 2FJDB 3HPOA 4DV5J 2FPHX 3R6GB 1ZBSA 2VQEJ 2YHWA 2YNGB 5AQRA 4CEQA 3CCVS 4DUYJ 4HHJA 5DK5A 4YEAA 3VQEA 4Y2AA 4GV3A 3BBBA 1SJRA 3D1OA 2PY5A 1O5JA 5H9FJ 3V9XA 3HLUA 2R7QA 3ET6A 1U1MA 1MA9B 1AUSL 1BQNB 4W5NA 2XC9A 3BGRA 3QLHA 1I3OB 2DGWA 4DXLA 3VAGA 5KOWA 1AA1B 4U67Q 1VQ8S 5C2CA 3VQTA 1J5OB 3ZTQA 3MEKA 3CJCA 2FGOA 1Y11A 2GVZA 1B7FA 1T94A 3O9TA 5LSRA 4WQ4A 3CXCR 2FY1A 5DM7Q 1S1UA 1SI9A 4TXSA 3M3ZA 2Q66A 2IM0A 3EPIA 4NLDA 1X4DA 1BD6A 3DOKB 5KG0A 2JJ4D 1NGIA 2AEFA 2Z2ZA 4M3ZA 3C6TB 4B3MF 3PIPL 2HAFA 5LM7E 3C14B 4OZLA 2ZUGA 3L9ZA 4H4KA 1TL5A 2AHOB 2ROEA 4R8UB 4USKA 3MF5A 3IM9A 4I69A 1PYOB 2DGQA 5EU7A 1R0AB 2Z1HA 4CZMA 3EEQA 3H46O 2KU7A 3CCJS 2QXLA 1F9EB 1WDDA 1EP4A 4BG9A 1AW0A 2HK2A 3PRVA 1KXPA 3OTDA 1QQNA 3IN5A 1K73T 2OZSA 3HVRA 3OVNA 3JS9A 1B70B 3OYNA 3AQPA 2KN4A 4RG8A 4B3TJ 3HHLD 1UJ5A 1RZMA 3O5TB 4C0OC 3L4QA 3TAPA 2YY3A 1F2GA 3DLGA 4O44A 4MKBA 2NR0A 1YBAA 1WC4A 1BA0A 2AQ4A 1S12A 3PRBA 3AA2A 1TL4A 3TP2A 4A48A 4JKCA 2R8HA 1TV6B 3MAAB 2PA8D 4FYVB 5ETVA 4C11B 3ZSQA 5KFVA 2CPFA 2QKKA 2HGMA 4FWQA 3OYKA 4NZ6A 4U6PA 2PGCA 1ZA2B 2CQCA 3EE3A 1EP4B 5JVHL 2EXUA 4CK1A 1N5QA 3ID6A 2E9TA 4PRFA 5EXWA 5BXIA 4Z4CA 2XULA 2Z2MA 2UUAJ 3SAGA 1XMQF 4FYDA 2R8JA 5I3QA 4IO1A 3IBFB 1OKJA 4U9RA 1RDBA 2QM1A 3KLVA 4FNIA 5LY3A 3H5UA 3HRGA 2VZ9A 4FJMA 2ATQA 3B8AX 4J9LA 3C14A 3CMEN 1U24A 4NCAA 1VQNS 1R8HA 3HP9A 1SC6A 2VIHA 4M7YA 3IWXA 2VOPA 2HNZB 2YQ0A 4Z4IA 4F36A 3FSIA 3DRRB 4ANCA 3CDEA 5D78A 1PIEA 1S3XA 3F5TA 4OLPA 2WSFC 4ZOSA 2CGLA 5CCMA 2E88A 3C6TA 3M9OB 2QLFB 2PYJA 3G9CA 5BRHA 5GAGP 2UXBJ 1RBSA 2G8KA 3VQQA 1Z2ZA 1UA1A 3NF8A 4FLUA 1E6YB 1VQPS 2UUBJ 3PXGa 5HROA 4YQWA 3FUYA 3CM6A 2RDIA 2O8EB 4YB1P 2HPUA 3RYLA 5A2QY 2E2QA 4DU1A 5KFPA 2XNRA 3RMBA 5L38A 1ZM2A 2RRAA 3FBEA 2C2KB 4KIAA 5B0GA 1OSDA 3HTVA 2NRTA 4KGZB 4MYTA 4BRMA 1GLEG 5AXNA 3L4IA 5HMWA 2R7YA 3L3CA 4D3GA 5IT0A 1HI0P 4RU9A 4X2BA 3NCPA 4AM6A 1KC8T 4O0JA 2W9BA 1HNWK 4ED7A 2GV1A 2EBEA 2ZNZA 1LKZA 4CLFA 2DH9A 1KQKA 3VPZA 5LSLA 1R31A 2OSQA 2GVDA 1N5SA 2K06A 3ATUA 2NXUA 2IS3A 1X7VA 4H5TA 1ASWA 4RW8B 6FDRA 3NH2A 4QU7A 3HL8A 3E51A 3OJUA 4OYMA 5AQWA 4CF2A 3R3LA 5A8WB 4DTPA 2AMCB 4IG3A 3BM7A 1X4CA 1VQMS 3RBZA 2VA3A 4WP9A 3T1YK 1K0TA 3H6EA 4FK4A 1RT4A 2PEBA 3RR8A 4K4XA 3KLHB 3QBXA 4JKFA 2QJ3A 2ZJQL 5JVGQ 3THVA 3J7ZO 2VBZA 3GFXA 3VAFA 4DTXA 1UVKA 3R2DJ 4FK0A 1GQEA 5AQLA 5LMNK 1WOQA 3GE1A 4FLXA 1GLDG 4K7QA 1FRXA 2QLXA 3MMVA 3HYFA 1TK8A 3FGVA 5M1KA 3HP6A 5C42A 1YI2S 3OHRA 4OZ0A 1WSGA 4CGFA 3M4XA 2E5IA 2C2RA 3HHLA 3BB5A 4WPAA 3D0HE 3CD6S 3ZTRA 4DMZA 3DOKA 1B4SA 2G1HA 1N32J 1XMOJ 3CJ1A 4DV6K 3KJQB 2V50A 1DURA 1S72N 3QATA 2DB1A 1S1XB 1HFEL 2C3OA 4DR3J 1HNXK 3OBIA 1IKWA 3PYEA 1RBRA 3EL2A 4WFBQ 5AJ3F 2NCKL 3KG1A 3A8KA 1FXDA 4DV5F 5CABA 3ZSWA 4M3TA 4R0JA 4NLRA 1WC6A 4WFNL 4ILRA 3SFGA 2DPNA 2J9EA 4ILJA 3QFHA 4M63C 4CJ7A 4ISFA 1VI7A 1UL3A 2RHKA 2E6LA 2QTWA 2OFHX 5SWMA 1OH8A 1F0XA 4CNZA 2Z30B 2IVYA 3R7NB 2FBYA 5GAEU 1C1BA 5HL7L 1WI6A 1RT4B 2UVRA 1VIXA 2QYCA 1Q78A 1VRTA 2ZZNA 1EKEA 5LXRA 4J2DA 3VF4A 4MDBA 5KT3A 5GAHI 2IIRA 3VTIA 4CZIA 2HLUA 3S3MA 2W2MP 4JRQA 4YHHF 1LXNA 1Y5NB 3I56N 4Y6IA 1S9GB 4BDYA 1PSDA 2DO0A 1VRUB 3NNCA 4WBFA 1K47A 3CHWA 5M2PA 2QSWA 1K0VA 2QWOA 2VPZB 1DRZA 1FRJA 5KFCA 4QW9A 2JOQA 5DLGA 2G8IA 4EWTA 4DR4J 4CIFA 5CCLA 1RWMB 3OS2A 1GX5A 3MECA 4CJKA 3TX8A 5GIPA 1RCOB 4OL8A 3JYTB 4Q0BB 5FPMA 4CK3A 1P27B 4YOEA 1VQPN 3TAMA 4OI4A 1QSYA 4A8MP 2OLWA 1Q8KA 3J7YP 1BUXA 4U7UD 4DU4A 3FQKA 1R8BA 1N88A 1UP1A 1KQGB 2RDDA 4GO5X 3PX4A 3QDKA 3VQ5A 4HDHA 1U0HA 3J7Z5 4ID5A 4B08A 3MX5A 3QEPA 3AVIA 4R8UA 1TKXA 1HBUB 2FHOB 1NSKL 1MDUB 4QQBA 4DR2K 3GP9A 3QGHA 1F3VA 3WC0A 2LFVA 3GDQA 2C2OB 3OHBA 3BEXA 5AE3A 3V1QA 1LK7A 5HVGA 4M3XA 3W60A 3GILA 3DGPA 4N56A 2DKOB 2MQPA 3HFZB 5C10A 1JLBA 4FZXC 3AVJA 3MAHA 1L3VA 2ZE2A 2ZVIA 1T7PA 4RBVA 3U02A 3SUPA 2VKRA 5F3TA 1VSIA 1WG4A 1UZDA 2E9RX 5E84A 2L9NA 5AXMA 1EX8A 3UKUA 4YFUA 1KC8O 4ICLB 5BRDA 4B9UA 2U2FA 2D0CA 1O13A 2HMPA 2IVMA 1JXLA 4P2SA 2MHNA 4ZPAA 2JWKA 4IFYB 2RQ4A 5DJBA 4QAGA 1NRKA 5FRMA 2GQQA 1B92A 1D0EA 3LAMA 4XTTA 4BC4A 4X4OA 3PJXA 2OIHA 1RBLA 1BC6A 3ZSVA 3TSUA 1V9OA 3MM6A 1FCAA 1RWPB 2IBKA 1EAYC 2CPEA 2OJ3A 3OYFA 4K4SA 1Y3KA 3ULEA 1B0PA 2VOOA 1Q5YA 4F0HA 2OPSB 5HQLA 1E6VA 4NRUA 1GK8A 2DR8A 2QV6A 2KG0A 5EHHA 3NMAA 2VDHA 1U1OA 3AGKA 1VQ9S 5HMYA 3CCJN 2E5JA 5SUHA 2LQ5A 4R25A 4TY8A 1KBRA 1GOAA 3CCES 3MPUB 5AQJA 1VLOA 4RWWA 4I64A 4DV0F 3DXMB 5BPMA 5F9LA 4GKKJ 1H3DA 3KKFA 4NXNK 3MEGB 4N41A 3GONA 3AVFA 1S77D 2E2PA 1S6UA 3Q8QB 4Z37A 4KJIA 1B3TA 1IN0A 1UFLA 4M63A 4Y2KA 3QGPA 1R6YA 3G8QA 3SAFA 2FVCA 2N82B 3QMLA 5IV4A 1F21A 2AJ4A 3BV8A 4MMOA 1Y00A 1BISA 1CQMA 3K8WA 1RGVA 4CCHA 1QE1B 1JLBB 4Q2MA 4TQSA 3AVMA 2EFPA 3ITHA 1K6YA 4ZCIA 3UVJB 1NK0A 3FFKB 5K8PA 5JVHQ 4KPCA 1S1WB 1LAWA 4KKOB 2R2TA 4P2MA 2XY5A 4F9OA 3CJ8A 2P8IA 1BQNA 1BUPA 1WC5A 3MD3A 3KIOA 4PKHA 5CYMB 1RHJB 3EXCX 1I6JA 2AZ3A 3GV8B 2KTQA 2WW4A 3D0IE 3QNWB 3BUZB 5H9FK 2O8BB 2JEJA 3W9JA 2VBYA 3DN9A 1X5TA 3NMUA 4IKFA 1YJ7A 3CI5A 3CCZA 1YSJA 1Z05A 3V9UA 4J5OA 3OYCA 4HHUA 3C19A 2VODA 4U8VA 3H08A 5ETKA 2VQEK 2WW8A 2DYAA 3ULDA 3QGGA 4R0EA 4BGBA 3V6JA 3MMCA 4DSLA 4CFCA 4P71A 5L1KA 4HH1A 2F4VF 4IFVB 2KG1A 2VJVA 4DTRA 4AL5A 4CERA 3CMAN 5E2QA 1R59O 2X51A 4RCHA 1PJ7A 2XO7A 2RN2A 1ITPA 4QJVA 5G0RB 2MZRA 3OA9A 1MN7A 3W2WA 1SV5B 3KDOA 3J81Y 1VBXA 5KG5A 1A6LA 1UVMA 1HNXJ 1JJ2M 1DHMA 4ELTA 2DRDA 2KJVA 4F3OA 4GKJJ 3TU5A 2AKWB 2VC1A 2I1RA 2EC2A 2YKPA 5J2QA 2H51B 4NX9A 4ZLLA 1RHKB 2SXLA 4NLWA 4WFAL 1X5PA 3NEKA 5HMZA 3Q23A 4KAIA 3M8ZA 3RW7A 3CCQS 2AV5A 3BPDA 4CNYA 2A6AA 4ZJOA 4OHVA 3ZZRA 2YWWA 5LJVA 2GVZB 1E4GT 2BX6A 4OLOA 3I0RB 3ETMA 2FZCB 3V6DA 4N76A 3J81O 2VYPA 4CZGA 2CG8A 3BYRA 4E19A 2KLAA 1X4GA 2VDIA 3WNGA 1MWZA 4WU2A 3THYA 3VA0A 4K41A 1U2FA 4QWAA 3CIPA 2FQQB 2PE8A 4OYOA 4QW8A 3HOSA 2X78A 3AY0A 4IWVA 3TAMB 2CWXA 2VPXB 2CQ4A 1N36F 1GLAG 2FJWA 3I9ZA 2R8KA 4H03B 5LMUF 4CJWA 2A3ZA 3T3FA 5U47A 2HVDA 3KK2B 1FJGJ 2EFGA 3I5BA 3MOZA 5F0XA 3JQMA 3HZEA 4K4YA 1BIZA 2B4VA 3TUPA 3VQ4A 1Y5LB 3GU0A 3NLCA 3L95X 3MMAB 4J9OA 4JK9A 1C0TB 2HBJA 5LJ5Y 1RGIA 4AQYF 1FHTA 1EKRA 3G2XA 3TZZA 2B0GA 1SC3B 2ZHBA 1S9GA 3W3DA 3KFWX 2RQCA 4BC9A 3G4SS 3VZHA 4BQZA 1RTDA 3NGRA 4LR8A 2IVOA 1SJFA 3KK1B 2HHXA 4J9PA 2ZWHA 4WP3A 4I2QB 3BJYA 1VFJA 4CO5A 1FRIA 4PR6A 2DGOA 1J2VA 2Y1JA 1S59A 1DQ9A 1PC4A 2QEXN 2NYIA 3A8EA 1GNKA 2HAIA 4X84A 1YTUA 3JB9k 3UDEA 1R8AA 3AA3A 4BBYA 3QIOA 5TKYA 4ZP8A 3AHPA 3CJRA 4E1JA 4CT8A 2W2QP 3Q0AA 2CXEA 1HKBA 1D9DA 5GMKa 1LFWA 3MDQA 1VQLN 2XLKA 4ED5A 2W8KA 1F5BA 4K59A 4DV4J 3KJNB 3S01A 2XWXA 4IH7A 2POKA 4LFAJ 1Y3JA 2PT0A 5A8RB 2W9AA 1ZZFA 3CJKA 2CH5A 3FZLA 5HVHA 4IOAL 1N52B 1N0UA 1REVA 3RTVA 3VETA 3UR3C 3EN9A 2Z58B 1ZPWX 1CULA 2F9WA 1SIZA 3PLAA 1I39A 1TFWA 1FE4A 4KHQA 4ID1A 2ZUAA 3O9RA 1VQ9N 2JH3A 4RW4B 1RHQB 1V4TA 3GTYX 4IG0A 4YY3J 3GSDA 4KHNA 1IR2A 3CPWR 4HCBA 4HT5A 2A6MA 5ETPA 1RACB 2V6AA 3QAEA 3PCOB 3UN3A 2W41A 3NMRA 3P5TL 3NAEA 1Q86T 3CCMS 2ACYA 5GAEP 1QS4A 3MCOA 1ACMB 4ED6A 3KD1E 2HBMA 4O23A 4CI6A 2JL9A 1HI1A 2ZKUA 1CVJA 3CFOA 4MO5A 1TKTA 1NB2A 2I6WA 4EIAA 2W9CA 1IQZA 2BOAA 1N5YA 3GE9A 4TYAA 3AO1A 4MIAA 1CJVB 1DQAA 4B17A 2AA4A 4ZVPB 1RDAA 4FYWB 4TQRA 4FS1A 4Y3CA 2NUBA 5AT1B 2AYGA 3KK1A 1FJEB 2E5LJ 2QWNA 1RKIA 4ATNA 3LP2A 4CK2A 2Q97A 1ZBUA 4DX8H 3HJFA 4PG8A 3KG0A 3RRHA 2WRMA 2RE1A 4PKIA 2HBKA 3LP2B 3C3LA 2V4JB 5IQQA 5D3GB 3HSCA 4OZ1A 1W2BR 3DLKA 2OD4A 2OD6A 3WXMB 4CZKA 5J2MB 4GRSA 3NBPB 3JS6A 1J6ZA 3NOCA 4UOGA 1WTBA 4UZCA 1M1GA 4YDDB 3BO3A 1SH2A 3WEEB 1JMTA 1T9VA 2V2QA 3UCZP 5JLFA 1CJKA 2KFYA 1RNHA 3TSQA 2YNFB 4NXMF 3T19A 4DR7J 3GV7B 5GINA 2E7WA 4E7IA 3K7RA 2FGCA 3ZO7A 4QS8A 3H59A 4DLGA 5M1OA 1Q82T 4PQUA 1KWMA 3DOLA 1P1LA 4ZVTB 2XGQA 2ZD1B 1NJIO 4JBCA 4KHYA 4B9LA 2G2YA 1R8CA 3CYMA 5BR8K 2E5LK 1KP6A 3SV3A 3MFHA 2DD8S 3CC2S 4X4PA 3PO5A 4X4SA 3DDKA 3LANA 1YLXA 4JI4J 1ZTWA 1PJ6A 2YX7A 1RB0A 4M3YA 3SMPA 3CJ4A 1KONA 4ZVEA 5DG8A 2C3YA 1T0TV 1YJUA 3DLJA 2RF2B 1V6HA 4X4TA 3MPVA 4F3MA 2HHHJ 4V1Ak 2Y0SD 3SLCA 4QIFA 2O3DA 3RVCA 4URSA 2XZWA 3L2QA 4DV2F 4UOFA 3VAKA 5L39A 3GQCA 5D0HA 2FTRA 4OJRA 3CPEA 4IR1A 3NGDA 1MROA 4GKJF 1RT2B 3AO5A 1NSPA 3ETOA 3RZAA 2MZTA 2GNKA 1TKDA 3NG8A 3CF5Q 1RT5A 1LW0B 4X64K 4OKJA 2JSXA 2KXFA 3TSPA 3D9BA 1XMOF 2YKMB 4BRGA 3N4QA 4C11A 1NOYA 3SJJA 4DFKA 1RTIB 1RHMB 1O6XA 4BDPA 5MLCV 4MIBA 1TL1B 1GLLO 2MKCA 3OT9A 3DLKB 2D0PA 4U8YA 3H4BA 1OYEA 1NZAA 3LP0A 3C6UA 1WOPA 2XI2A 3VMFB 1YKWA 2IYIA 1J5EK 5THWA 3CC4S 5AQSA 3KHLA 3BQ0A 3E9LA 4KHPF 3HSZA 1S6PA 1BCOA 2N3OA 5DM6Q 4CTAB 2PMWA 3VEWA 2KB2A 1I51B 2O8FA 4CZFA 3SXLA 1N56A 3QPIA 1H0HB 3KNAA 3DI6B 1N33K 3Q8PB 2AU0A 3NVMA 4ICLA 1S99A 3NCRA 4I6AA 3UD4P 3POTB 2NRZA 1BOTO 3OUYA 1GXTA 4ZVSB 5IWAF 4NCBA 3KLGB 4I2PB 2O4IA 3D6FB 3CO9A 1X3MA 4M7XA 2UVUA 1VJWA 1TAQA 2K1RA 4CVNE 2LEAA 1JJCB 3TPQA 4DR7K 3VQDA 2GTDA 2B56A 3VGMA 1I3AA 4IOXA 1NK5A 4FLTA 1U09A 1Q8BA 4MDAA 1KQSR 4JI5F 4Q2LA 1LQ9A 5ADZA 1TK0A 3I32A 3ZNJ1 2W42A 3DRXA 2AF6A 3KLFB 1LWEB 3OYAA 2Z8QA 1YIJS 1UAWA 3M7VA 2NXNA 4QYRA 2OSRA 3BS9A 3D67A 4ZN3A 3CCVN 5IXUA 3PW4A 2E5HA 3EYZA 1VQON 1U1QA 2O5DA 5CY4A 1HA1A 5F0UA 1P8ZA 4DV0K 3CJKB 3VQPA 5B7WA 3PW5A 2XYPB 3ALYA 3GBTA 2OAUA 1FDBA 4OZ2A 4RUBA 1MMLA 2RJZA 4E7JA 5JUMA 3PIOQ 3OW2M 3MOJB 2E7XA 2E4LA 4K0KJ 3AOBA 4O0IA 1EO1A 2V34A 5FIIA 4FJIA 2RPIA 3R5AA 3KLHA 1EX4A 1ZA1B 3R9PA 2CQ3A 4C8NA 1DAXA 3KNGA 3IAYA 5A2QO 3OYIA 4OX8A 4BC2A 4PWDB 2YKAA 5IT9O 2W9BB 1SQKA 3FQLA 4WQ5C 1RWNB 4O8UA 3R3TA 1LW2A 5KGWA 3WNFA 3T6JA 4M8LA 1CC7A 2DK2A 1JLFB 1SH3A 2XO6A 5AQIA 1Y97A 2V63A 4PWWA 1XR5A 3HK2A 3I31A 4B1XB 2L48A 3PRDA 1WB9A 3FBFA 1NGCA 4K4VA 2CFXA 2BW7A 2XTJP 2QWMA 3PKYA 2BR0A 4JS5A 1FKOA 1UMJA 4TYBA 1KLMB 4K2JA 3G6YA 4FXDA 4LRDA 1T3VA 2CIMA 3CG7A 4BRIA 1W25A 3HSDA 1NGJA 3UO0A 3OR2A 3Q8RB 4F3TA 1JLCA 1HWUA 2NRVA 2A1BA 2XY6A 2W7AA 1RE1B 3F41A 4CGDA 4LVOP 5CHIA 1HQEB 3CEDA 4Q8EA 4A8KA 4RUHA 1U1KA 3V6DB 2I5JA 3VQBA 5IC4B 4UOCA 2AGPA 3KYLA 1W2IA 3RJMB 3H5YA 4BRPA 2GWKA 4U7BA 2M70A 3N01A 1DFDA 2ZKTA 2R7TA 3PKMA 5A8RA 3DU5A 3A13A 4F4AA 3MN5A 3IO1A 1VQKN 1R27B 2LDIA 1JLAA 4OZNA 3FZHA 3SUNA 1SL2A 4JV1A 1C0UB 3CXCM 4GVBB 3CCSN 4LF2A 3DOMB 1Z1ZA 4X62F 4MFBB 1HWIA 3CTRA 1HNWJ 4MK8A 4LBHA 4FLWA 4PWDA 2LMIA 4HUFA 1E4FT 2ZH1A 4FS2A 3SMSA 3V9WA 2C2DA 4UF4A 4FLZA 2PA3A 2VPWB 5HATA 4IFVA 5LJ3Y 5HLFB 2Z4PA 2LEPA 4O4GA 4NLCA 2ZH4A 1RT6A 4FPBA 2F4VK 2QMWA 4NL5A 4DUZJ 4LR7A 1KTVA 3G82A 4ZN1A 4A5AA 1WDTA 3PYDA 2CPDA 1B64A 3CCQN 2DR5A 2YVSA 4P52A 4Q43A 3KHHA 4BRLA 2DNHA 4LSZB 1FFWB 1MU2A 3RB3A 4WXWA 4HUEA 2QWLA 5E3CA 3NH0A 3TR5A 1S0VA 2EBGA 4KO0A 1RABB 2GS8A 2EWHA 2KYZA 4H5WA 1R0BG 1JIHA 4A8XA 4F2SA 5J2NB 3N6MA 3VALA 4C8KA 3U3GA 4FYYB 5GAGU 5DLFA 5AQVA 5KFUA 4A5BA 2WOMA 2ZBQA 1QD1A 2GJIA 2IHR1 2VG5B 4J8FA 2ZBCA 5F8JA 5FLXY 1X9SA 1HNZK 5AXLA 4CEEA 4WFYA 1IBLJ 1UW9A 4EGLA 3F9KA 2BJ9A 2R2RA 4E89A 3QNOA 1JLEA 1HHQA 2IRYA 4LF7F 2ZJPQ 1R89A 3G87A 4Y0FA 3SUOA 4K5RA 5B0FA 3ENQA 4JI2J 3I96A 2CZ4A 1FFSB 1NKEA 2NUUG 2BBEA 1RT7A 4DV7F 2M0GB 5MLCQ 1HPZB 2J0WA 3MI7X 2LKZA 4DU3A 4H0PA 5K8OA 1T9XA 5LMNF 5ETRA 2OEKA 3RB4A 1NBEB 1RU1A 1UTAA 5CZVA 1MNEA 4RTFD 1NGEA 1HKAA 2HF3A 4KE5A 3GIMA 1G15A 3KMQA 1RBOB 1HBNA 5J1EB 3PSIA 3PZPA 2NLXA 3BO4A 2DITA 3EM1A 3NCIA 4USMA 3O80A 3LALA 4C3MA 1GTEA 2JEGA 4ED0A 2NZTA 2BE9B 3LP1B 3HHNB 4DCOB 3CC7S 2IRXA 3G8TA 2JC1A 4PQAA 2B6AA 4W5OA 3D6TB 2P6SA 4J9NA 4MKVA 3W8PA 4OPJA 4P74A 2MSSA 4ETZA 5KFKA 4QYZJ 4CECA 1YWXA 1XNQK 4AL6A 2J0XA 4BROA 2IBOA 1N54B 3M9NB 2XZTB 1N36J 4LF4K 2NPIA 1UPPA 2EKNA 1UETA 2KM8C 1TELA 1QDUB 5AZIA 2A10A 2VG7A 4ZPDA 2L9WA 3KLIB 4PPDA 4BREA 4CYUB 1YTAA 4U67L 1SVDA 1Q7YT 2BE2A 1FX2A 3W64A 4RW9B 3D4JA 4NEYA 4AM7A 3CERA 2KH9A 1OY8A 3GJTB 3MXJA 1T6DA 4BC5A 2CQ2A 1KS2A 3QFUA 2LVWA 3P39A 1IBKK 3QETA 4HVZA 3O3LA 3TUJC 4K4ZA 4W4MA 3UN5A 2K3IA 2AYEA 5I42B 5D4NA 1NSQA 4CE9A 2WHOA 1BO5O 4H54A 2J0SD 2GHVC 3TNVA 3IAM9 3RG6A 3SBTA 4CLSA 2HWTA 2K7JA 2BACA 4J37A 1A5WA 1NEEA 3ZZOA 5DG7A 4H5VA 5KGXA 5AQKA 3D28A 3QZ7A 1RTJB 3AJDA 3HSGA 3OV7A 1JKHA 1XI1A 2JGUA 5M2UA 2P9NA 1NJIT 4OLAA 2NZCA 1OVYA 5C5JA 4FJKA 3BGRB 5AZJB 5B8HA 2MZSA 4RBTA 1U2CA 2V8PA 5DGAA 5AFUA 2JWLA 3D66A 1T11A 1YGYA 3R9LA 4I2PA 1D4XA 3OR1B 3D2WA 4EFHA 2IC3B 4CF8A 3TUZC 1JXVA 3DXMA 1VQ6S 4A8WA 2UUCK 1RWUA 2BKNA 1CS4B 4UY85 1Q18A 2BV3A 3HM9A 4K8ZA 3U7JA 3DI6A 4PYDA 3HM8A 2DXDA 5HAOA 1V5IB 1MMDA 4BRKA 1BA1A 2UUAF 1KVAA 4HYKA 3VGSA 2VD3A 1NM1A 5ETTA 4IG3B 4S0MA 2OEMA 1BWFO 2COLA 4DZDA 1RYSA 3UDCA 4K43A 3EZUA 2APOA 1O51A 4NASA 3ZX3A 5J1EA 4HVJA 4DHVA 1WOSA 3D2EB 1CS4A 4B9NA 2IPOB 1NB7A 3C6AA 1BIUA 2V8HA 5L9XA 4CM2A 2B51A 1NJZA 3S3NA 3DMJB 3RSEA 4JI7K 1YI2N 3A8YA 5HBMA 3LPYA 2BQ3A 1URNA 2KRBA 5EOYA 3T1YJ 3L2UA 4C1NK 1FKAF 2ZWOA 1AZSA 1H72C 5I3PA 3SDEB 1DY3A 2RD5C 1T44A 2DNKA 1U6FA 3WXIA 4DFPA 4DL4A 1XC9A 1HNXF 2AT1B 5KT5A 4O5FA 1T3NA 4FNHA 2J8AA 3MMJA 5CD4A 5ETLA 2CNKB 4GVMA 1UPMB 1VK3A 3AVHA 2R2UA 2CJBA 1X8DA 2DIUA 4RW6A 4RW4A 4X65K 2HNDB 4JI6F 3G71S 1HBOA 1KOOA 5KFBA 2ITGA 3HKZD 5CA5A 2DRAA 4A4JA 2KFNA 3CPWM 4LRFA 1FKOB 1Q9XA 4DR7F 4J9UE 2CJKA 3OS0A 3ZSOA 3EE9A 2Y1LB 1T05A 2XHWA 2YHYA 2AGQA 4JI7J 4HHTA 1NDPA 4CYUA 1NJWA 3NWGA 3CCMN 3BKFA 2Q0UA 1OH5A 4OJ3A 2Y1RI 2O1PA 3CJ3A 1U1LA 1CG2A 4ZLJA 4GKKF 1RA6A 1HNIA 4JI1K 2HS3A 4F26A 2W8LA 2C2ZB 2VG7B 3RU0A 4EEYA 1U4BA 2GW8A 1ZETA 2XMKA 1TV6A 5F8NA 4CJPA 1R8PA 5AR0A 1P90A 1FT8A 4B1WB 3CJTA 4FN5A 2CNOB 1NCLA 3MM5B 3ZXWA 2MGZB 5D3GA 2F8TA 1S4FA 2Z1GA 3CETA 2I7NA 3GG4A 3NGZA 4JKGA 2P9IB 3FFIA 4DU7A 3HT3A 3T7ZA 3W5ZA 1VQNN 1C0MA 4DV6J 1XMOK 1LW0A 2Y1IA 4GY2B 4ZPTR 2UU9F 4NRTA 4BE1A 4KHUA 3UD5A 3FZKA 4UTGA 2J6SA 5L1LA 2MZ1A 3PEJA 3IR6B 4JK7A 4OFZA 3DAWA 3TA0A 3AD8C 4CEAA 2HOEA 4KREA 3SJHA 3FRYA 3UKUB 1EZZB 1ATSA 2BYCA 2KZMA 4I68A 1U04A 3MXIA 2ZOFA 5KQ8A 4JI7F 3TABA 2D9PA 1TAUA 1BCMA 2IDLA 1YX2A 3ENBA 1QQCA 4ER8A 3GYGA 4KYZA 1HNVB 2QL9B 3S6EA 1NMDA 3D2FA 2YJFA 5D0GA 2V9WA 5KPZA 2RKIA 4TSXA 7FDRA 1BLUA 1LOUA 2ILYA 4B9SA 5J2NA 4PZVA 4CD3A 1K73O 3O3HA 4DV1K 5T7BA 4HLBA 4LRCA 2EG1A 4DL6A 3CIMA 5DG9A 1HX1A 1RADB 1IKVB 1FERA 3H7HB 2NRHA 3O4QA 4H4MB 3MECB 3HXMA 2M2BA 5CH7B 3LQVA 5A0YA 2HBQB 5J2MA 4WZQA 2X6SA 1NDCA 5CE3A 5KTQA 2UUWA 1Y5IB 4G1PA 2KW4A 2HG4A 2YCHA 3AVNA 4FKXA 2Z1IA 2R7OA 2DR9A 1VSJA 2V8DA 3L7UA 3O4WA 2HS4A 3GJRB 3DKDA 3IUCA 4W90B 4XH4A 3EJMA 3NF9A 3GFYA 5D8HB 2BVZA 1N4LA 2RB7A 3VOVA 2D41A 2YKQA 4FWMA 3MWPA 3FMBA 1NU0A 2MKSA 3Q7BA 1DZ5A 3W7BA 2NZ4A 2E5GA 1IBMK 3A5LC 1N5VA 1L3UA 4JI0F 1K8KB 2B5JA 3KHYA 1Q4RA 5AQGA 1VQ4S 2ASPA 4YDUC 1P9QC 2DXEA 5L1IA 3UB5A 2BM0A 1AXQA 4AHVA 3L6QA 3BKUA 4DPOA 2CUYA 4NLOA 3S8SA 2MKJA 2YKNA 2FJAB 2G0CA 3T41A 3C65A 3GMGA 4B3SK 4F4XA 3D1QA 1XHXA 2RUGA 5DQGA 1QVGM 2GO9A 3ZETA 4WIIA 4KH4A 4WJBA 2V51B 3I55N 1A7GE 3R8EA 4LR9A 2FLOA 2C1EB 3A5MC 4ZHRA 3V6KA 2HBLA 5EGYA 3SQ0A 1Y64A 4GVLA 1RAIB 2PSZA 1HD1A 4XEIA 3J80O 4BQLA 4MTPA 1Z25A 4KO0B 2YNGA 3LGHA 2WBNA 5HOOA 2ZBRA 1I1GA 2FSKA 3A8JA 5ADXA 4KB7A 2LYVA 4JKEA 5F8MA 3AH6A 1M1KO 1DGKN 5FDLA 3VF2A 2OANA 1IV0A 2ADCA 4C8YA 1CEZA 2XZDB 1JL1A 5AQHA 2G2OA 1VK0A 4FK2A 4OX9J 3ULEB 3CJAA 2Z1JA 4WE1B 3ILOA 3G10A 1ZM3A 4CLPA 4LFAF 3AAQA 3G82B 1T95A 2FHJD 1G99A 1SV5A 3ZX0A 2CH6A 1B9FA 2F3JA 4A46A 3UNYA 4JI5K 4H0OA 3O44A 2GUIA 1TK5A 3O1WA 4ZIWA 4C1NI 2P2CB 2HVIA 3UD3P 3IGNA 2CKWA 3IRXB 2XHCA 4RW7B 4CIGA 4KHMA 1KR4A 1ZBIA 4LF7J 3OW2R 1NGFA 2E9ZA 1FWKA 4DF4A 1ATNA 4ZK7M 3ZCMA 3RRGA 3W1YC 1U1RA 3DLLL 4JD2B 4DV1J 2MKHA 1S7IA 3C46A 2V94A 2MZJA 5LXYA 4OI6A 1S57A 1PG5B 2RNEA 4RZRA 4AL7A 3WBZA 3BDEA 4JUZA 3CCWA 3JSYA 4C48A 3QB0A 2QIFA 3AVCA 4NYZA 4IYQA 2BGGA 3MD1A 1NGBA 2HURA 1HLUA 5CYMA 2ZF5O 3UPFA 2FZKB 3NGIA 1TL3A 4JI8F 4C0BA 4FJNA 3ENOA 2F5GA 2YH0A 3O4NA 4JI8K 1KQSM 2KXNB 4O3PA 1TMMA 5E3PA 4O3RA 2OO4A 5J2PA 1K1SA 2KHDA 3OYHA 2AX1A 3RAXA 3TR8A 4CLWA 2UXCJ 1U2RA 3RUBL 2WONB 5IT9Y 1N6QB 2DNZA 3SQ4A 5BJRA 2B3TB 4UQGA 2OPRB 1X9JA 4K4TA 1SKUB 1ZBHA 4CO4A 3LO3A 1S5JA 2X1GA 3B4DA 4OI1A 1RAGB 2ROPA 5EX3A 4QWDA 2EC0A 4IDHA 1O8BA 4KY3A 3DMJA 5BREA 2YWFA 3LZIA 3OL8A 4L8RB 5D0RA 3HKWA 2X3DA 3QO9A 1RBVA 1EIYB 1SKRA 1I94F 3BY5A 2YWHA 4D3HA 5HBMB 2XY8A 3THXB 4FJHA 3LW5C 2A2DA 3ZETB 2Y3YA 1IR1A 1CJUA 3CCTA 4C2MA 2DNQA 1F9HA 3W9IA 1SQFA 4DV1F 2R8IA 4DUYF 3K9KA 3MPDA 5FPEA 4YN3B 3WZ0A 5BPLA 2HHTA 2P9UA 3S7RA 4JP8A 4BWMA 1HRHA 2OH2A 4BRQA 3KWIA 2B4PA 3B78A 3OHAA 3L09A 3N0VA 1NDLA 2FC9A 3PR5B 3RMDA 4KV8A 3OTOF 4CIOA 5LMNJ 4GC6A 1HQUA 1RISA 1X0PA 4LMZA 1XNRJ 1IM6A 3NS7B 4RUAA 1ICEB 4OKKA 4IJNA 4J9MA 2H5IB 2HQGA 3VVUA 4EZ6A 5AQUA 4JI3F 3A3PB 2J4RA 1YG0A 4DV7K 3RRKA 1JB0C 2DGSA 1HI8A 3DFEA 1ZBTA 5HSPA 4NXMK 3OR1A 4USIA 2NNWA 1UEKA 3JXUA 1RLDA 1VJQA 4OI0A 3N28A 5L46A 3IG1B 2HBZB 3M32A 3MCAB 2WVBA 2IGIA 3I0SA 4HL9A 1RK8A 4HACB 1M5SA 1VC5A 2F65A 5LSOA 1CSJA 4CJFA 2FBTA 3OR2B 4BS2A 3GFHA 4CLLA 3PW7A 1NGAA 1TZ0A 2HFUA 4YHHK 1KAYA 1IBMF 4YOTA 3DXKB 2KL8A 3H25A 1GLJO 3K57A 4FJGA 7FD1A 2CJAA 3ID8A 2DBBA 5GMEA 4NLSA 4KR0B 2P51A 4X66J 4KHSA 2CA9A 1VSDA 4DFJA 4DTSA 3NHGA 4CO1A 4OHYA 3B82A 4BLGA 1HIYA 1HKGA 5G4DA 4LQ3A 5AQYA 3OYDA 1RT7B 1VHIA 3J80U 4CHYA 2NPFA 1FDAA 1WJ9A 2ABYA 4QS7A 5DETA 3WX8A 3K9JA 2UXBK 3V4IA 3O9SA 4EK2A 2AJFE 2EKYA 2YWKA 2CZ9A 2Y0BB 4PHTX 4HT7A 4QWCA 2WBMA 3O2IA 3ONQA 3CJSA 1X9MA 1HYSB 3NY0A 2BJEA 4CLUA 1FJCA 4KB0A 4CJTA 5IT4A 4CJ4A 4LFBK 3RB6A 2OYQA 2XRIA 3V9ZA 2QX0A 2YX4A 4YY3F 1IJFB 2DH8A 2ZZMA 4WK1A 4JOUA 3J7YU 2ZHAA 3NXZA 3Q7CA 1ZYQA 1BWEA 5BN9A 3M8WA 4OGEA 4X62K 3M6GA 1Q7LB 2VQFK 1B0TA 4YOUA 3T1HK 2CWKA 4JN4A 1BQXA 1FVSA 3T5HA 2CYYA 4DR1J 2MKKA 2XEXA 2AJQA 3FKBA 3PX6A 5JMVA 2OKQA 4Z2XA 5EDWA 2V9KA 3FEXB 4N7TA 2C3PA 3HHLC 4OMFG 3K0JA 1GTHA 4USUA 1URRA 4Y1CA 3KMSA 2B4JA 3TZXA 2LDYA 3BQ1A 2XYHB 1T3OA 5F8GA 3QRPA 3LTOA 5KFNA 3KLFA 4I1TA 1K8AT 3ZFVA 1WUAA 2OGUA 2ATCB 3BZQA 4TU7A 2Q6CA 1U2VA 5KFEA 4J9SA 3KDNA 2RU3A 1NK4A 2HGNA 4EBEA 3R5JB 2QGFB 2D5RA 2AZ1A 4UY8T 1APSA 1HYZA 5AE1A 2Q1LA 3ZSYA 4CF1A 4HKQA 3M05A 4JEPA 4FZVA 5KFAA 2GEMA 5J2QB 4KAZA 3H1QA 4DL0C 4GMKA 2GWJA 4QCLA 2Z57B 4LF6J 2WC9A 3N6LA 2KI2A 5BRFA 1IWAA 1SIWB 2DY9A 3S3OA 2UU9K 5KG1A 4M3UA 1FXRA 1ZS6A 2J9DA 2UUCF 4DBQA 4DCPB 1XMQK 3MR5A 1N36K 1RT1B 5TKWA 4CH0S 4P9SA 3VQ7A 3MAAA 3LDQA 1RXOB 2UVVA 2VPYB 2ZH2A 3ZX2A 1EB0A 3PY8A 3QSYB 4JB8B 4HI2A 5EWEA 2PBDA 4A61A 3E01B 1BHLA 3AO4A 2N4CA 1BMQB 1HWJA 1RI7A 5CXTA 2FF6A 2IAJA 4NZ0A 4NLTA 1S1VA 2HBRB 2F40A 1HMVA 1YT3A 4G65A 1RTDB 4LT6A 1DTTB 3DLHA 1Z26A 1S79A 4MAKA 5DGBA 1RWOB 4L73A 4ZCLA 3ZZPA 3BZCA 3PSFA 3FZFA 1O0PA 2PO4A 3M8YA 1H7XA 3AVBA 1CJTB 5D4LA 4DEZA 2BTFA 1RWXB 4Q45A 2ETJA 2W4CA 3IA0A 3B54A 4CLKA 3NKYA 2GO8A 3QFPA 3TARA 2M8DB 2FJBB 1GLCG 4PG6A 3VQSA 3TWZA 4EU0A 2YKOA 3OVBA 1Y10A 2ZC4A 1ITGA 4X62J 2ZJRQ 4B3MK 4AQYJ 3FMWA 2IVNA 3I0RA 1S7HA 3V4IB 1RYRA 3TAFA 3AFGA 3V6HA 2YWEA 3OFGA 4IDKA 1WHWA 2HFVA 1KVBA 2LSNA 1XJWB 2YX6A 3BF4A 2X1BA 4TN2A 2DT9A 3T6BA 4F0MA 3WQUA 2WCXA 4C8ZA 4DSEA 3AGRA 1NPPA 3CCEN 3AO2A 2BW2A 3DRPA 4B3RJ 4LFCF 4ELVA 2Z2YB 5F8LA 3WNHA 2MQMA 4ZP9A 3KZBA 4IR9A 4IO9Q 2D4WA 3M2RB 1J5EF 2XSFA 1NJYA 2O4GA 1YJTA 3KUHA 2OELA 2QK9A 5C25B 1YITS 2EFQA 1UVLA 2ZDPA 5MAOA 3QJLA 5IT9U 4KTQA 2EG2A 2R7SA 1VHFA 1IG9A 2NREA 3MPYA 2RSQA 1TUGB 2JC0A 3WXKA 4BR2A 4XDCA 2F4VJ 4DL5A 5KOXA 2WFBA 3CNQP 3CT9A 2WB1D 2V2ZA 4K50A 4C97A 4HR2A 2VFSA 1HMVB 8ATCB 2YNIB 4IBNA 5CHCB 2PFUA 5D77A 3AAWB 1P9YA 2VH7A 3CJ9A 4DQRA 5B0DA 4CW7B 3QGIA 2J8SA 3JTOA 5IZHA 1PCAA 5KQDA 1LWFA 1C4CA 1RP5A 3LP1A 3M6UA 4KRFA 4FF2A 2KT3A 4E1MA 1KLNA 1W7AA 2OZMA 1WF1A 3EY1A 3KK2A 2XSJA 3IRWP 2VV5A 3KUEA 1K8AO 4KTZA 4ZCKA 4TU8A 3D6RA 3QMQA 1S6QB 3CO0P 2E1CA 1D8YA 2BM1A 1VQSA 2E1ZA 1ELOA 3F73A 3UW1A 1PYTA 3TA1A 3CD7A 5I9EB 2OFGX 3NE6A 5T7LB 3R8YA 1VSKA 1OPIA 4CWBA 2I5JB 2PFFB 5F3ZA 4X4NA 1S5ZA 3O3GA 1Q86O 4IDKB 1OIAA 2JVOA 2QFJA 3J7ZT 4X4QA 1QJHA 2BRKA 2R42A 3A3OB 4FBUA 5I3UB 4I0WA 3A5OC 2XCPA 4AXIA 5EVZA 1YVFA 3RW6A 1OY9A 3AVAA 2LQ9A 2MZQA 1ZPVA 4NI2A 2A1RA 1KFDA 4R5PB 1REGX 4P7VA 4CGHA 3MR6A 1T6CA 3GCXP 4J7CA 4DV4F 5GAHP 3D1HA 4H0TB 4M42A 1WF0A 2XMJA 5JLHA 2NXCA 3PHEA 1H74A 2HS0A 1GH8A 3MHYA 1HPZA 5C24A 1OQ3A 4RWXA 1YTYA 3M2UB 1RA7A 4EMDA 2QFIA 3JXOA 1TYQB 2ASJA 5KI6A 2ZJPL 2CDQA 2BE7D 5KFDA 3S9HA 1IUJA 4F04B 1L3TA 4ZJQA 5FLXU 4NWBA 1SC1B 2XI3A 1VDHA 3C7NB 2LA4A 2GJ2A 3ZNUA 2RQKA 4FVMA 2F63A 1ZAWA 3U1MA 1S0NA 4CHNA 3U9DA 2Q6BA 2WBRA 4WFBL 3D6MB 2N7CA 3O8WA 3HVAA 4KI4A 3P3DA 4K8RA 4QZVB 4BY9C 2IAJB 2YNHB 3R7SB 1YBUA 4ELUA 3LGMA 1RBTA 4L75A 3H5SA 3F2KA 1V3RA 3VESA 4WFNQ 2HNYB 4OYBA 1RAAB 1NHVA 4PEOA 4JI8J 4DR2F 4ETXA 2HBYB 2KKZA 2LXFA 1RCXB 2KJWA 3MM5A 1BE4A 3CMAS 4P75A 2PI5A 2VBWA 3X1LB 5KG3A 2XLJA 1AUDA 3CDAA 1UWBB 3MURP 5LJWA 5DO2A 4RWTA 1WEXA 3KJVB 3ASMA 2D0AA 3A2FA 3W65A 3CCLN 5C2DA 1FRLA 1A9NB 1NGDA 4N77A 1PKUA 3VEZA 1YHQS 1N5TA 4LUBA 3A3NB 4YB5A 3BDPA 2GIQA 4FM0A 3FBBA 1SBRA 2MJNA 1Q5VA 3BPSP 4X65J 4XK8C 5KG7A 2ZH7A 3CD6N 1HNZF 1HBMB 4F7VA 2G1DA 3NAIA 1VSHA 5JJBA 4DPWA 3QERA 4B1VA 3R6LB 2W40A 1JKHB 5IWAK 2DNPA 2FLLA 1RAHB 3O1BA 3VV2B 3M2RA 3OBYA 3KWGA 2W1BA 1VQLS 3O1LA 3Q24A 2B43A 3G25A 3K8VA 4CEZA 4DX7A 3P8BB 4NXMJ 3EZ5A 3QT6A 3HHKA 4JV5J 4MQ3A 2VBXA 5KT6A 3DDNA 2M5YA 2YH1A 4OJ1A 1NLVA 2VKZG 1HBUA 1J27A 1S0MA 4JYAJ 3GIJA 2HZAA 3OTOJ 3NWRA 2QEXS 4WIQA 1BGXT 4NYOA 3OYMA 2ZH9A 3D6HB 2HQCA 2XMVA 5HRNA 3OTCA 4FCYA 4EI2A 2O01C 3VF6A 3W2VB 3BGUA 3CCRS 3IRXA 1BG3A 4R79A 2G8UA 3L7PA 4IQXA 4MO4A 4DR5K 2KT5A 4IKAA 1FF2A 5BYQA 5A8WA 1DKGD 4PWUA 5F8HA 4KGXB 4ZP6A 4R5PA 4O3SA 4OPAA 1NNDA 4NYPA 2GMLA 3MUVP 3DRSB 3E01A 4DSIA 2QMXA 3LP0B 1GOBA 1REVB 1JNRB 2QXFA 3HVTA 2IYGA 1S6QA 1GMVA 4CHZA 1PBUA 4DV6F 4GKJK 1MG7A 2R4FA 4F4WA 3EXYA 3CD5A 1TKZA 5H1SV 5E7OB 2XLIA 1WTFA 4ZP7A 1TKZB 1MWKA 4DR3F 3GIRA 2X3GA 2XSJB 3NL0A 4G1QB 2J9DE 4LFCJ 4M3WA 4JI3K 4TNOA 2G9OA 2HGLA 5FD1A 4E8UA 2Q36A 2Q0RA 4I6YA 4P7TA 2FZGB 2OPQA 2FC8A 3KLEA 2LQJA 4L6V3 1FE0A 2BJ8A 4B3TF 4OHWA 2AEJA 2H5JB 3M8SA 8RUCA 4F2RA 3GCWP 3P1GA 3VAJA 4DHYA 4BR9A 5IC6B 4UQTA 2W4DA 3TQEA 4EAHD 3SEOA 5HRPA 4FXVA 1FRKA 1IKVA 1XTZA 4E98A 4HHHA 2H3EB 1CJUB 3NH1A 3ZT2A 2CPJA 4FJLA 4L72B 3SCLE 2GIFA 2WTFA 2Q3SA 2HF4A 2FB0A 2D9OA 1FWPA 3B8HA 4TY9A 4YS2A 2W6LA 4LRAA 4HWIA 1UA0A 4DPUA 5EWFA 4YR0A 3CD0A 3GIKA 1XMQJ 4BC7A 4CI0B 4DCHA 2K8GA 4UW2A 1NPRA 3JQKA 3B6BA 4B1UB 3LDOA 1H2UX 5FRNA 1J53A 3MR3A 2JFKA 3DXKA 3FFIB 4DG1A 1WD6A 3WUHA 3FCWA 3LWLA 4A8QA 5KFQA 4DSJA 4JKGB 1IBCB 1U6ZA 1JXEA 2Y8WA 3TAEA 4A8OA 2HKEA 3HF5A 2ZJRL 4QIWD 3NNAA 1H7WA 3KHRA 4Z7CA 4ED1A 2DPIA 1FTCA 2GHWA 2FXUA 3QQCD 4M41A 2WTUA 2VC0A 1KD1O 3GPAA 2X7IA 3THWB 3IG1A 4J2BA 2E1RA 2CJQA 3BSCA 2ASMA 4H4MA 2UUBF 4NXNJ 3KWMA 2Q43A 1VQYA 4O4GB 4CJ5A 4PUOA 3MEEB 3OXGA 1FA0A 4G1QA 4RKUC 3B6PA 3D7SB 4WQ4C 4LF5F 3MPWA 1R3NA 2P6TA 1YXQA 1RWVB 2VASA 3DOMA 2RKIB 2J7UA 3P45B 2ASDA 4ED3A 1QVGR 4EHUA 1L3KA 4Y1DA 1BQMB 5IV3A 5F2RA 3PNIA 4YY3K 4DR3K 3ZEUB 4L3QA 4DS4A 4FM2A 4DV3K 2HNDA 4CZLA 4L76A 3K5MA 1JJHA 3D0GE 3MN7A 1JLCB 5FPNA 3TI0A 4B3SF 3QJPA 4X4UA 1T9UA 5HANA 1N32K 4ISEA 2HQDA 2IY5B 5ETQA 5H9EK 5AQTA 2E2OA 2DCUB 2OTJN 4JI1F 2MDAA 3GJSB 1NU4A 2QA4S 4KRWA 3MEDA 3HD2A 3TOQA 1ATRA 3SDEA 4ECVA 5KFLA 5DM6L 2VGNA 5AQFA 3LOUA 4E7HA 3J7AP 1VQ5S 3MM9A 3EMTA 3T1YF 2UYTA 3I55S 4ZS6A 2AEMA 4CIEA 3H4DA 3M2VA 1KTQA 2ZH6A 2B9WA 4K0KF 1IWGA 1UOCA 3SUQA 3ILJA 5KFOA 4L3KA 4RU2A 1SL0A 2H4YB 4OX7A 4DUZK 3H1VX 4CH7A 1VQ5N 2H3GX 1NGHA 3KK3B 1NMNA 3FK4A 5B08A 3M8QA 3MK6A 2AW0A 3A4TA 1FK9B 3R6MA 4MKAA 4FOIA 3ZT1A 2FVPA 3OUYB 4ZIVA 3NS6A 3R5CA 3QIDA 3KXDA 3NDKA 4OVLA 4B9TA 2RT3A 2IOCA 3VGLA 4JI6J 3D45A 1I94J 2GVDB 1FNXH 3GG0A 3C16A 4WYWA 1RJJA 4DR4K 3KLEB 2ZH3A 4EP5A 2VF3A 3PW0A 4DDFA 1SQEA 4O3QA 3Q8VA 1VK8A 1NG9A 2IJFA 3U1NA 3VQ6A 3MTKA 4H0XB 1YJRA 4FJJA 4EHTA 1GFWB 3JTPA 4ZTFA 2IDEA 4RO0A 5FJ4A 2QLWA 1W0HA 3H2UB 3OY9A 1ZTTA 2OPRA 1NHKL 5F0WA 3T9NA 1MN9A 2QWRA 3Q8UA 4LSLB 1PGZA 4ZHRB 1JX4A 1QY7A 3UNGC 2BQUA 4Y0WA 5DMRA 2NRXA 3U4LA 3PEHA 1IM4A 4DN9A 4H4OB 3AQOA 4QWBA 1S1WA 1JLEB 1NK9A 1AYEA 4PY5A 1F2HA 1RWKB 3HMJG 3DLRA 2MY7A 2D3ZA 3ISNC 1U2VB 2P9EA 2VG5A 2N3LA 1DEJA 4O3OA 3EZWA 4U7UK 3N5BA 4LF9F 3G96A 4YP3A 4DR4F 1K1QA 3VHQA 5C7PA 2B5JB 2F8MA 1YZ6A 2W2NP 1FEHA 4USTA 4AXJA 4RX6A 1RTJA 4GVBA 2EFVA 4CTAA 1TFYA 1TQLA 3PJWA 4BGAA 4M94A 3ZYYX 4HTUA 4ZA1A 5GADP 3AVKA 1W9HA 4ITSA 2DY1A 1CJKB 2V8VA 2FYXA 4BR7A 1RLCL 2HVZA 4RJVA 1RAOA 4UOHA 3CMES 4KH5A 2VCPA 4FZYA 2BKOA 2EFOA 4A8FA 3D0PA 2OPPA 4Z4GA 4IH5A 3GR0A 4WTOB 1F60B 3W62A 4F4YA 2DTJA 4DSKA 2ZBPA 4ALZA 5D6GA 5JS1A 3NP5A 3O8MA 1M5KC 2I9SA 4KH6A 4GV6A 1KFSA 3MGJA 2CQIA 4RL1A 2W7PA 1U45A 1B0VA 4RNOA 1XUPO 3ULHA 1JCGA 4M5KA 1KVCA 4FWRA 1UWBA 1IBKJ 2RAQA 4C6AA 2V2KA 3DM2B 3PHTA 5KFFA 6FD1A 4JKBA 1NKBA 1BY9A 1GEHA 2FVQA 4WF9Q 2IM2A 1LFPA 3GV5B 2G0IA 3E9OA 1KRPA 4LF7K 1JWWA 2IA6A 2B7BB 4FYXB 5KT2A 4C8LA 3QRQA 1TGOA 3J8AA 1VOMA 3LM9A 4LH4A 1KN6A 1C0GA 2ERRA 1QZ6A 4GNIA 1WHVA 4JI6K 4A57A 1Q8LA 1BXNA 4WXOA 2F9DA 3EDRB 2HZVA 2DNGA 5DDQC 4C8MA 1VQ7S 5GADU 3MMAA 1ROFA 1WBDA 2ITMA 3E3XA 2O8DB 4XAKA 4EZ9A 1S9FA 3LP3A 3T5KA 1UEVA 5KPRA 1Q82O 4V19S 4U7CA 3TVKA 2QE5A 2ZBIA 5FLXO 1JLGB 1Y0HA 1NM2A 4NA3A 3T5JA 1BI4B 2UUBK 4ES3A 3QO9B 3TZYA 4ZVHA 3M30B 1GXLA 2DRBA 4LF5J 1WG1A 2FHJA 5AFUH 1TU0B 4JRPA 5KFYA 1HARA 2DR7A 2DHSA 2EVZA 3HFVA 4LBPA 1Z4UA 2Z0GA 2DH7A 2DGXA 3BSOA 2I7PA 4PA1A 4X65F 1M1HA 1ASVA 4A47A 4KV8B 1KHVA 4KBIA 4N5SA 1JLQB 3OVSA 3G86A 2Q79A 3MZIA 4L3NA 1ILYA 4IO8A 3LPUA 1KAZA 4HTLA 1HL6A 1RU2A 4XPEA 2XWYA 4JHDB 2W6KA 1C0TA 2ZEJA 3BF1A 4M1KA 4A59A 3POTA 3E2EA 2PIIA 2DHHA 1WSHA 2P5VA 3CW2C 1RT3B 4M95A 3C7NA 1ZZNA 1R0AA 2BE2B 2CPIA 1G2EA 5DZ7A 1U02A 1FEEA 3OJSA 3TAQA 1X1PA 2NSCA 3CQ8A 3GJQB 1BU6O 2DNOA 5C24B 3FJ2A 1M5PC 4CFDA 4LF5K 3VQAA 4QR1A 1FK9A 2VFTA 4B3TK 1HWLA 4O4RA 3CCLS 3VVTA 2XYGB 1HNVA 2JEFA 2ILZA 2J6TA 2MYFA 2X1AA 4YDUA 2JEIA 1TUYA 3DJCA 2IMWP 3OTOK 5KAKA 5T14A 4E3SA 4J9QA 4NCGA 4OZJA 3SPZA 2J7KA 2FSJA 2UXDF 1U7LA 3QZ8A 3LPTA 1MWQA 4JV5K 3SCJE 3H90A 2CAJA 1WKKA 4OI3A 4IOCL 4P72A 4ZVGA 1RDWX 2MJUA 2IJNA 4U95A 3W63A 3Q8SB 3UIQA 1YZ7A 3HVWA 4OLBA 3HPGA 1NK6A 4DR6F 4FVUA 4DMNA 3DLEB 4N8OA 2OI2A 2BUPA 4JKDA 3DYAA 3MMBA 2WSEC 4G3IA 4LF4J 4J91A 2G8WA 1T9TA 1QSSA 3VEOA 4P10A 3BF3A 3SSRA 5A2QU 1CXQA 3FE1A 1XNQJ 2DNMA 4DX5A 4M5JA 5HVFA 4MJKA 4RW6B 2HHUA 3KHGA 3M9MB 4FBTA 2V2VA 4G6VB 2QT7A 3PVXA 2I2YA 2GZOA 2AJ1A 3ZSRA 4RW8A 2BXJA 1CXUA 1S97A 2E1AA 2PMHA 5CYQB 1WEYA 4LC9B 4NLGA 2F7VA 3VQCA 3DLLQ 3M6WA 2VWKA 1FI4A 2Q1NA 4CJVA 3ZT4A 5EWGA 5L1JA 3UN2A 2O8CB 2BUNA 3FNNA 1RTHA 2CPXA 3VAHA 1C2PA 4DV5K 2PYLA 1YJWS 1ZC6A 2VG6A 3K2PA 3QNNA 3QEVA 4JNEA 4WP8A 5FDLB 4K4WA 4IEEA 4DF8A 4FDFA 2OA8A 2K7KA 1JJ4A 5RUBA 2FVRA 5AZJA 4C8OA 2B9EA 4DV2J 3C6UB 5IOLA 5BYSA