1JLCA

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with pett-2
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
547
structure length
534
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT A-chain
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 130
structure length 534
sequence length 547
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlcA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlcA05
4EP5A 4IKAA 4TQSA 4Q8EA 3CQ8A 4PWDA 1RT2A 2OPPB 1NKBA 1CXQA 1KCFA 5C42B 3ISND 2IJNA 2AGQA 3NH0A 3AVFA 2HHSA 4IH7A 2C2DA 3KK2A 2AGPA 4DL2A 2BRLA 2XI2A 4WYWA 2IA6A 3JYTB 1T03A 3NH2A 2RKIA 4ED0A 3KJVA 1QHTA 4K8ZA 4ZPBA 5DG9A 4EYIB 2YKNA 1IO2A 2GUIA 4BDZA 3CYMA 4B9VA 4FK2A 4UQGA 1L3SA 4Y3CA 2DY4A 4W5OA 5DQGA 2VA3A 4E1MA 4CEFA 3SI6A 4ZHRA 4AH9A 4B8AB 4RU9A 4K8XA 1DTTB 1RYSA 1VRUA 3PV8A 2B5JB 4LSLB 1X1PA 1L3VA 5KFQA 1JIHA 4ED6A 1N6QA 4J9PA 1QS4A 1JLCA 4MQ3A 4AHSA 3BDPA 4EZ9A 4G3IA 3TAPA 2JC1A 1KVAA 1NKEA 3KMSA 4F4YA 3KHRA 2YV0X 4ECQA 2AQ4A 3KHLA 1D1UA 3G6YA 4RW4A 3G6VA 3FFIB 4RW8B 1N5YB 3TAMB 3HVAA 2HHQA 2QKKA 3N6LA 1S9FA 4H54A 4CIFA 3NAIA 3OYIA 4CJ4A 2C2RA 4FJMA 2XGQA 2D3UA 2HW3A 1JL1A 5EWGA 4ECXA 1SUQA 4DTJA 4ICLA 1NHUA 3DYAA 2FVCA 2HHTA 4CEOA 3BGRA 1RTHB 2HVIA 1T8EA 1C0TB 4DSKA 4H4MB 4OVLA 3KIOA 4HCBA 1TKTB 4R5PB 2DPJA 4DL7A 2Z1GA 3HO1A 2QV6A 2DPIA 1HRHA 4DFPA 4DMNA 2FBVA 3I0RA 3QO9A 4W5NA 1LWCA 3V9WA 4DWIA 4FJ8A 2UVUA 5KG6A 3VQSA 3NHGA 2JEJA 3SYZA 1JLQB 3V1OA 2HWHA 5KFKA 4J9KA 2GC8A 3N6NA 1HQEA 3ZT1A 4OPJA 2OZMA 4K4WA 4O3NA 4JS4A 3QEXA 3K5NA 1ZBIA 3S3NA 1EP4A 3KLVA 2ATLA 3M8QA 3DLKA 2AX0A 3C95A 1BI4B 5HLFB 3UR0A 4FYDA 2DFFA 4M42A 4YFUA 1S1UB 4K4VA 3K5MA 1QAIA 4DQSA 4NLDA 5SZTA 5F8IA 4CF8A 3Q8QB 4KPYA 1BISA 1RT6B 4N5SA 2WCXA 3OYEA 2AJQA 3PUFA 4CHPA 2ASDA 4ECYA 4M41A 4ZPDA 3TVKA 4IRDA 4O44B 3HHKA 4F50A 2PZSA 3V6KA 3LAMA 3BQ2A 4B9UA 3RMDA 2R8KA 5FRMA 3M8PA 1YVUA 4ID1A 4ZVFA 4HUGA 1I39A 3AVMA 2G8HA 1IKWA 1C1CA 2B6AB 4KSEB 4IG3B 3SJJA 4RW6B 2JC0A 1ASVA 4CCHA 4FJJA 3SV3A 4CK1A 3M9MB 4JV0A 3KNAA 1J9AA 4FK0A 1DTQA 2VG5A 1DLOB 1U48A 3DLEA 2ASJA 3AA5X 4OKJA 2ZD1B 5J2MB 4FJ7A 1JLGB 2ETJA 1CZBA 5KFSA 1TK5A 2C22A 3SPYA 4ID5B 4CEBA 3M9NB 1LWEA 3VQ4A 1C1BA 3FQLA 4CHQA 3RWUA 4QWBA 2OPRA 2IBKA 2G8FA 4EYHB 2QKBA 3LP3A 1BL3A 2YHBA 2F8TA 5F8LA 4FS1A 3IRXA 3FSIA 4DQIA 1NK9A 3VQ8A 3CJ4A 1JL2A 1BIUA 2KW4A 2HMIA 1KVBA 4ZPCA 4AHRA 2RF2A 5KFRA 2XY5A 3RMAA 4F4ZA 4J9RA 4I2PB 1X9SA 4LQ3A 4RW9B 4O4GA 4HUEA 3MFHA 1SV5A 4Q44A 3NFAA 1S1TB 3QYYA 3PW7A 3L2QA 2IJFA 3CDWA 1ITGA 5KT7A 1ZTTA 3E51A 3QEPA 4ECZA 1TL3A 3MR5A 4GW6A 3H4BA 1JLBB 3PHEA 4Q43A 5HRRA 3H40A 5J2PB 4NLYA 2XI3A 4ZTJA 1OS5A 1KLNA 4F3OA 2J6SA 5FRNA 2R8IA 2W9CB 1WAJA 4O3SA 2X6SA 3H4DA 4FM1A 4TY8B 2Q3SA 1VK0A 4BACA 2HNZA 3BREA 4R8UB 3GIIA 3GILA 3O4QA 3DRRA 4TN2A 5DQHA 3RB0A 3NDKA 4AILC 1IM4A 4AHTA 4DSEA 3BQ0A 4JS5A 5EU7A 5KFGA 4NYNA 3V81A 4CJUA 1BQNA 5EDWA 3NKYA 5HRPA 1S9EB 5F9NA 1WSJA 2VWJA 3VN5A 1X9WA 2IC3A 2AWZA 2HHXA 2YNHA 4FW2A 1BCOA 4J9OA 1RT3A 3ULDA 4O55A 3UIQA 4CEEA 4MIAA 1LWFB 5FDLA 1UA0A 1TAUA 3MAQA 1ZBUA 4Q0BB 1FKPB 4NZ0A 1JLAA 1WSEA 4TXSA 4CERA 1SL1A 1IKYB 4CGIA 4ECWA 3THVA 4OKKA 4N56A 4ELTA 5JS1A 4OGCA 3K2PA 4I7FB 1VRTA 3DM2A 3GV5B 3SUOA 3TAGA 1QAJA 2W9BB 1QSLA 4KAZA 3VQCA 4TLRA 4CJEA 4DS5A 4Z4IA 4KB1A 3OYJA 3DLGA 4KAIA 1K1SA 4RW7B 3KLEA 3QINA 3AO4A 4TYBA 3LPUA 1VSFA 1S1VA 3SUNA 3BSNA 3QLHB 1W9HA 4CJTA 3OYNA 1RT7A 2D0BA 5KFJA 4NLOA 5L1JA 4M95A 4NLQA 5J2QB 4IG0A 4J9QA 3MEDB 4TQRA 5C25A 5HROB 1JKHA 3H08A 4YR3A 4J2AA 3TAEA 2R2UA 3QGHA 4OL8A 5SWMA 1BHLA 1CXUA 5KG2A 4CJRA 4O5BA 4GC7A 3VQDA 4KRFA 1Z26A 1LAWA 4CIEA 4QPXA 3HP9A 2YHAA 4PY5A 2ZKUA 1BQMB 5CYMA 4Z4GA 4NLVA 1LW2B 1REVB 3CDEA 5CZ1A 4KTZA 2HHWA 1KLMA 4ELVA 4CESA 4BE1A 4B9NA 4O3QA 2IS3A 4E7IA 1TK0A 4EP4A 3P5JA 2G8UA 3CFPA 3SQ1A 1RT4B 4FLZA 2OPPA 1JXEA 2F96A 5C42A 1LW0B 1C6VA 3KLIB 5KFYA 4K4TA 4C8MA 1RNHA 3H59A 4E7HA 2FVSA 2UUWA 2G8IA 4DFMA 3JYTA 4QW9A 4M3YA 1D9FA 3AVCA 3I8DA 1KFDA 2G8KA 4Y2CA 2LSNA 3PJWA 3DOKA 3NF9A 1UOCA 3AO3A 3MF5A 1A5XA 5KRTA 1YTAA 3KLFB 1HJRA 4ED8A 5HP1A 4TSXA 1ZBLA 5KG0A 4H4OA 1A5WA 3IG1B 1DTTA 3Q8PB 4FLUA 3V6HA 2B5JA 4LSLA 1J53A 1RDBA 4LH4A 3ZSOA 4RNFA 4CE9A 1D8YA 1J54A 1HNIB 3SZ2A 4Q45A 5KG1A 3OY9A 3L2RA 4FJNA 2BANB 3T5JA 1ASWA 1RTIB 4F2RA 4YR0A 1SH0A 3OL8A 2VG7B 4BWJA 2R2TA 4DEZA 3OL6A 3QIPA 5K14B 3QERA 2I5JB 3RB3A 3S9HA 3FFIA 3MXIA 4RW8A 1N5YA 3TAMA 1KVCA 5J1EB 3MXMA 3GV7B 4JRPA 1D5AA 3H5SA 4JV2A 2B43A 2IGIA 4M3XA 2QE5A 1R0AB 3NF6A 4RNMA 5KFIA 3SFUA 2YNGB 4W5QA 3CJ3A 4LQ9A 4G1QB 4OLAA 1RTHA 4KFBB 4TY9A 4MK8A 3M8RA 5DLFA 3MECB 1C0TA 3MR6A 1L5UA 4H4MA 3HSTB 4NCGB 4E89A 3ALYA 4O3PA 3BJYA 4ZTFA 1TKTA 4R5PA 1QE1B 4IFVB 3GYNA 4NLUA 1TKZB 2DFHA 4Z0UA 5F9LA 4WXWA 3ZSQA 3QEWA 3HVTB 4CGDA 4KHWA 3OHBA 4Z4CA 1SKSA 3SNNA 4Z4EA 4O4RA 2D0AA 4CEAA 1B9DA 1JLQA 4KREA 4DF8A 4FZXC 1VSHA 5JUMA 4WFYA 1HMVB 2W8KA 4GC6A 4FJ9A 3ZSYA 1UAXA 2XCAA 1BI4A 3NGZA 4KO0B 5HLFA 1NKCA 4FJHA 1S1UA 3OYFA 1GOCA 4LY7A 5L1IA 1XHZA 4KHYA 1I6JA 1S6QB 2JGUA 3VQ9A 4DTNA 3RR8A 4LSNB 2X74A 4J2BA 3HT3A 3NBPB 3D28A 3V9ZA 3FRZA 4QWEA 3OYGA 2ATQA 3O3GA 1UWBB 4C8LA 3QESA 1CSJA 4O44A 3OLBA 1BIZA 4YP3A 1BCMA 3HM9A 3SV4A 5KFZA 2PY5A 3OS2A 3ZT3A 3RMCA 1GX6A 1FKOB 4M3TA 4J9LA 4Y2AA 2B6AA 4IG3A 3MEEB 4RW6A 3NAEA 2W9AA 4CEQA 3CWJA 3HKWA 3H98A 4H8KA 3NGIA 1DLOA 3TANA 1HNVA 1WN7A 3AVKA 3OL7A 2OPQB 5KFLA 4MH8A 3OYBA 3AVBA 2VG6A 2ZD1A 5J2MA 5L9XA 3QEVA 4B9MA 1IKXB 3MXJA 2XHBA 4DU1A 2Z1HA 3F73A 4O0IA 3V6DB 2OYQA 4KHNA 4U6PA 2IMWP 4ID5A 1VSDA 3HXMA 3D0PA 3RRHA 3IS9B 4MIBA 3ZSRA 2QXFA 3KLGB 1C0MA 5KG5A 4CJWA 1TQLA 3WNGA 5DK5A 3K58A 4IKFA 2EX3A 1XHXA 4I2QB 2IOCA 3K5LA 3U3GA 2JLEA 3WNEA 3AVHA 4QW8A 4PUOB 1T94A 4F8RA 4EBCA 3VA3A 4B9TA 5D3GB 4DG1B 3JSMB 1SL0A 3T1AA 3OL9A 1KHVA 4PWDB 3H5XA 1ZBFA 4I2PA 3I5BA 3AVJA 3K5OA 1QTMA 4RW9A 2XC9A 4CIGA 5C5JA 4E0DA 3C94A 2HHVA 4CF0A 1S1TA 2XY7A 1J5OB 4OGEA 3AVNA 4YNQA 4HUFA 4J9NA 1SKWA 3AA4A 1HYSB 4WXOA 3B6OA 4DQRA 2ZQBA 1JLBA 4J2EA 1KSPA 4NLGA 3L2UA 2R8HA 3NCIA 2ILZA 5J2PA 3QNNA 1RAJA 5KT5A 1WNSA 1A5VA 5KFXA 3DLHA 2W9CA 3LP0B 2D7SA 4KE5A 2FBYA 1XR7A 1S6PB 2V0NA 4ZVEA 4TY8A 3FQKA 3IN5A 4R8UA 2BR0A 2YNFB 4FVMA 4M94A 5KFPA 5F8JA 4ZP8A 1RTDB 4MK9A 3T19A 4QWAA 1EETB 4AHVA 3DI6B 1HQUB 3KK3B 2GIRA 1S9EA 3RBDA 3PR5B 4DTMA 2YNIB 3KD5E 1KTQA 1IKVA 3QZ8A 3OYHA 5FROA 1U49A 4NYZA 3EY1A 1LWFA 4Q0BA 2BE2A 1XR6A 1Q8IA 3L8BA 2B4JA 1KFSA 4CFAA 1IKYA 2FJXA 3MTKA 3LAKA 4F4KA 3DMJB 3BQ1A 4DTSA 2FVPA 3BGRB 4LD0A 4I7FA 1TKDA 2E6LA 4O0JA 3PVXA 4BDPA 2W9BA 4IQXA 4Q8FA 4DSLA 3CO9A 4WZQA 2EHGA 4URQU 4KTWA 3ZT4A 3SQ2A 1FXXA 4RW7A 3H5UA 3I0RB 3BSOA 4F4XA 3QZ7A 3O3HA 4N47A 3OVNA 3HP6A 3OSPA 3QLHA 3G6XA 5J2QA 1RT5B 3MEDA 1NK0A 5HROA 5I3UB 2P5GA 4NCAA 2O4GA 3WNFA 4FLTA 3EZ5A 5C24B 3AO2A 4K50A 3DRPB 3K57A 3DLKB 1TAQA 4TYAA 1EXQA 3PW5A 3DDKA 1HPZB 3LZIA 3G10A 3QIDA 2FVRA 4EO8A 5I42B 4NLSA 1BQMA 4XPEA 2FC0A 2P1JA 1SH3A 2HNDB 1LW2A 1VSEA 2P5OA 1KHWA 2IM3A 4GMJB 2BDPA 1TKXB 3I5CA 1RBVA 2IDOA 4QAGA 1MU2B 4YQWA 3V4IB 5KFOA 4N76A 1Z25A 2UVRA 1S1XB 4EBEA 1FK9A 1RT4A 3NF7A 4MK7A 3LP1B 4ZP9A 4E19A 1Y97A 1LW0A 2O5DA 3KLIA 4CFBA 2IM2A 3NMAA 1WSFA 4J9MA 3Q8SB 2V9WA 1C1CB 3VQQA 1SKRA 1TL1A 4KHUA 4J2DA 5CZ2A 3HVRA 3KLFA 3C6UB 4RNHA 2G8VA 1EX4A 3MR3A 5T14A 3SPZA 3RMBA 2Z1JA 3T5LA 1S9GB 5KTQA 3NL0A 4NLPA 4HCCA 4FJKA 2HAIA 4B3OB 1S97A 2VA2A 1HNIA 1XI1A 1C1BB 4MFBA 1RT1B 1NNDA 2BANA 1RTIA 4URSA 4ED3A 3LZJA 2VG7A 3PX4A 3TQ1A 3OLAA 5K14A 4B08A 2I5JA 4FJLA 2OA8A 4Y1DA 3VQ5A 4KV8B 5J1EA 3G0ZA 1GOBA 3OYCA 4K4UA 1S48A 3PR4A 3V6JA 2GV9A 5EUHA 4K4ZA 1S4FA 3HPHA 1D9DA 1I3AA 3AVGA 4FM2A 1R0AA 5DLGA 3QETA 2WTFA 2G8WA 2YNGA 3CFRA 4G1QA 3TR8A 4HYKA 1RYRA 4KFBA 2ZE2A 1VSLA 1RA6A 1TP7A 3MECA 3PW4A 1X9MA 3GIMA 5DG7A 4NCGA 3PW2A 4M3WA 3DRSB 1QE1A 4IFVA 4Y34A 3PO4A 3RB6A 1WSGA 3O4NA 1TKZA 3H5YA 1RTJB 3LANA 4ZP6A 4JLHA 3LP2B 2PYLA 3HVTA 5KFTA 1WLJA 2GBZA 2BGGA 2KZZA 1LAVA 1JXLA 5EWEA 5DQIA 2J6UA 5KFMA 1VSJA 5KFDA 4FJ5A 3U6FA 2D0CA 3CDUA 2RDJA 2V4RA 4DL4A 3LWLA 4F4WA 3P83D 4CGGA 1HMVA 5DGAA 1K6YA 3V81B 2FLPA 1S1WB 1RILA 1NJYA 4DSIA 4OPKA 2I1RA 4B9LA 4DU3A 4N41A 4KO0A 3RAQA 4ZP7A 5KI6A 4BE0A 3NGDA 1NJWA 5J2NB 2HNYB 4CJ3A 2XY6A 3UPFA 1S6QA 5T7BA 4AHUA 2F8SA 4FJIA 4LSNA 3RBEA 2IAJB 2RDIA 3NBPA 3AA3A 5KFWA 4FZZA 4NRUA 1S0NA 2BQRA 5F8NA 2EC0A 3DOLB 1UWBA 2JEFA 1C1AA 5KT4A 3M9OB 3I0SB 1ZBHA 2R2SA 4L8RB 4E7LA 2R8GA 3V1QA 4CEZA 3PO5A 3KLEB 1FKOA 1NJXA 4O3OA 4CGJA 4DS4A 2FLLA 2F8EX 1B92A 3MEEA 2XO7A 2RN2A 3HL8A 4MKBA 1TV6B 3AVAA 3OS0A 4OJRA 4BE2A 3E01B 4IG0B 3PJXA 1TVRB 4W5TA 4IH6A 3VA0A 4CJKA 2OPQA 2RPIA 3EYZA 3L2VA 5KT3A 4I9QA 1GX5A 4CHNA 4DSFA 5KG3A 1IKXA 3IGVA 4E1NA 3V6DA 1T05B 1NK4A 4KTQA 4KHSA 3Q8RB 4KBIA 2W7OA 4CGFA 3IS9A 4IOBA 4WFXA 2FJVA 3KLGA 3ZT2A 4QOZB 2JEGA 5KG4A 4ECRA 4WE1B 4CFDA 5CYMB 3HPGA 2KFNA 1C0UB 2R8JA 5HBMB 3HPOA 5HRNA 3O3FA 4PUOA 1CLQA 1GOAA 5D3GA 4FBUA 4PQUB 2WOMB 4DG1A 4KKOB 3JSMA 4NLTA 3OS1A 3SI8A 4IR1A 1HARA 4M3RA 4LH5A 1ASUA 4DL5A 4IFYB 4CHZA 2YKMB 2D5RA 3VQ6A 1S0MA 2WONB 1NHVA 2JEIA 4HVJA 5KFVA 4Z4FA 1J5OA 1QSSA 2J6TA 5F8HA 1NJZA 3K59A 1HYSA 2WB4A 5KFUA 4I9LA 3VQBA 3ASMA 3DOKB 1RT6A 3KLHB 3NH1A 3KKRA 5HRSA 4NLWA 4RNNA 1N48A 3VQEA 4CJFA 3D45A 5HP1B 3MEGB 5E41A 3LP0A 4FLYA 2PYJA 1XC9A 4EO6A 4H4OB 1S6PA 2R7YA 5CYQB 4EZ6A 3SQ4A 2YNFA 4OKEA 3OJSA 3PW0A 4B8CA 4QWCA 2E9TA 3ITHB 1RTDA 5DG8A 3C6TB 2C28A 2Y1JA 4F2SA 4WZMA 1CZ9A 5JXSA 1D0EA 1WNEA 4M3ZA 1EETA 1LV5A 1N4LA 2BQ3A 3GQCA 3DI6A 1HQUA 3KK3A 4FJXA 4XO0A 4NCBA 1O1WA 1JLEB 4NLRA 5KG7A 2XRIA 3OYMA 1L3TA 3QIPB 2YNIA 4YMEA 4CECA 1IH7A 3OYDA 3I5AA 2OPSB 4RUAA 4E3SA 1JLGA 3KHHA 5DMRA 1YT3A 4IDKB 1RCHA 1IG9A 4HTUA 3ZSVA 5KFHA 3DMJA 3KK1B 4HKQA 2Y1IA 4IR9A 4B9SA 4CK3A 3KD1E 1ZETA 3PX0A 1JLFB 3OYAA 2DFEA 3QGIA 2D41A 5KFBA 4XIUA 3P1GA 4CHYA 4BDYA 4KI6A 5L1KA 4ECUA 1RT2B 1S10A 2ASLA 3GV8B 1VSKA 3B6PA 4WFZA 4OLBA 4FK4A 3KK2B 1TK8A 1RT5A 4M3UA 1S0OA 3M8SA 1ZTWA 1T03B 5I3UA 1UA1A 2RKIB 3KJVB 4C8OA 4RNOA 3KTQA 1G15A 5C24A 3HVWA 2YKNB 3SUPA 4DLEA 3DRPA 5KT6A 4CJVA 4KHQA 4CK2A 1HPZA 4KHMA 3HK2A 5F8MA 3IGNA 3CJ2A 3RTVA 5I42A 2XWYA 1WAFA 4ZHRB 2AU0A 2HNDA 1VRUB 2IM0A 1TKXA 2WK4A 1QSYA 1S49A 1MU2A 1RBUA 1N6QB 3V4IA 3CG7A 1JLCB 2NUBA 2XCPA 3KHGA 1S1XA 3LP1A 2FVQA 3T5KA 2FBTA 3OYLA 2OH2A 4DFJA 4GVMA 4RW4B 1L3UA 2UUTA 2A1RA 3CJ5A 2ITGA 4ZMMA 1NOYA 4YR2A 1TGOA 3A2FA 1FKPA 4WYLA 4FM0A 1S5JA 3TWHA 2E9RX 1SUQB 3C6UA 3AO1A 3RB4A 4ICLB 2AX1A 1HNVB 1RBTA 4FXDA 3DYAB 4CJSA 2KQ2A 4FLWA 2VG6B 3S3MA 3BSCA 1S9GA 2UVVA 2D3ZA 4FLVA 4AHCA 3SFGA 3IAYA 1ZYQA 4B3OA 3KOAA 4IRKA 1U45A 1RA7A 2QK9A 2P51A 3QO9B 2O4IA 1RT1A 4ZVGA 4ED1A 3UQSA 1RDAA 3AO5A 4HHTA 1LWCB 3ZSXA 3OHAA 3V1RA 4FJGA 5KFAA 1YTUA 4KI4A 3TI0A 2BRKA 4EEYA 1WSHA 2FLNA 4CJLA 4KV8A 1HQEB 4DQQA 1HYVA 4DL6A 3CVKA 4DL3A 3AVLA 3QIOA 4ED7A 1HYZA 3FDSA 1EP4B 1B9FA 1QUVA 2KTQA 3M8QB 3VQ7A 4CF9A 1NK8A 3PZPA 1F21A 4DTRA 4CJ5A 1SL2A 2WRMA 4KB7A 4ED2A 5KFFA 3CFOA 3ZT0A 1JXBA 3CM5A 1REVA 2IM1A 4Q5VA 2C2EA 3TAQA 3DRSA 4J9SA 3L3VA 2CKWA 3OSNA 4NRTA 1MMLA 4ECVA 1RTJA 4FZYA 3LP2A 3CJ0A 5F8GA 1SH2A 4DF4A 4QCLA 2FBXA 1U04A 3BSAA 2W8LA 4Y1CA 3AA2A 2X6NA 5DGBA 2X78A 3M8PB 3TABA 1T7PA 4CGHA 4KHRA 1IKWB 1W25A 2HWIA 1S1WA 2DTUA 3H2LA 1W0HA 1VSMA 4FW1A 4EBDA 4FLXA 1IKVB 1DTQB 2VG5B 2GIQA 1Z4UA 3RAXA 1N56A 3DLEB 5J2NA 2HNYA 4ELUA 1JX4A 2OZSA 3PY8A 3IG1A 2XGPA 4CF1A 2BE2B 1NOZA 3NGYA 1RDDA 3T5HA 1YVFA 4FCYA 1LWEB 4CHOA 2IAJA 3V9UA 2OPRB 3DOLA 3SQ0A 4JV1A 1QQCA 4QWDA 3PX6A 4DU4A 3I0SA 5KRSA 4E7KA 4XPCA 4BWMA 3IRXB 3V9XA 2CJQA 3RR7A 1RDCA 4FS2A 3ZCMA 3LALA 3HJFA 3NAHA 2HMIB 2BQUA 4IRCA 2RF2B 3ICLA 3QEIA 3RRGA 4CFCA 4ZVHA 4F3TA 4O4GB 1TV6A 1SV5B 4C8NA 3V9SA 5JS2A 2AGOA 3OJUA 3VQAA 1XR5A 3L2WA 3E01A 5KFCA 5KGWA 3CIZA 1TVRA 4RUCA 4CEDA 4DFKA 1NK5A 1TL3B 3AV9A 1RDRA 1VSIA 3DLRA 3TAFA 4IBNA 4K4YA 2HB5A 2KFZA 1T05A 4DSJA 4KB0A 3TARA 1RBRA 4W5RA 2FJWA 1U09A 3L3UA 1U47A 4DLGA 4K4SA 4MKAA 2KZMA 2V4QA 4RG8A 3U3YA 4URGA 4WE1A 3G86A 1C0UA 2HNZB 5EWFA 4Z4HA 4E7JA 3DRRB 5HBMA 3MFIA 3GIJA 3ISNC 4PQUA 2WOMA 3LWMA 4KKOA 4ZPAA 4CF2A 4NYFA 3ZSWA 1FK9B 1BQNB 3KMQA 1EKEA 3NE6A 4JUZA 1XWLA 3AVIA 1WSIA 2ALZA 4DTPA 3HYFA 3SUQA 2VWKA 3NF8A 3VQPA 2E9ZA 4IFYA 2IC3B 2YKMA 3T3FA 4M45A 2YNHB 3BR9A 1NK7A 2WONA 3QGGA 2R2RA 1RT3B 4DQPA 1U4BA 3F9KA 4RZRA 5FDLB 4CJQA 1TL1B 4K4XA 3WNHA 5KFNA 3OYKA 1JLAB 3KLHA 4CJPA 4DTUA 2W7PA 3ZSZA 1Q9YA 3MEGA 4PA1A 3EPGA 1VRTB 1C2PA 3DM2B 5CYQA 3EZUA 1T3NA 3MR2A 2E6MA 5KGXA 4ECTA 4U7CA 2E4LA 5KT2A 3ITHA 3DLGB 3C6TA 2UVWA 3CM6A 4MFBB 1KRPA 4X2BA 1S1VB 1RBSA 4NLXA 5KFEA 1NK6A 5L1LA 4FBTA 1RT7B 2W42A 1JLEA 2XY8A 3DLBA 2HVHA 4ECSA 3LPTA 5C25B 1JKHB 2WHOA 2OPSA 2A1SA 3EPIA 3N6MA 3SCXA 4JRQA 1Q9XA 4IDKA 4R0EA 4O3RA 3S3OA 2HHUA 3D5MA 3KK1A 4DTXA 3GIKA 1K1QA 1BGXT 5CY4A 4DTOA 3LDSA 2ZE2B 2ILYA 4C8KA 4IH5A 1JLFA 3QNOA 4I2QA 2Z1IA 3KKSA 1KLMB 3UDLA
chains in the Genus database with same CATH superfamily
5HVHA 4X66F 1G2EA 3GFHA 4YOUA 2BE9B 4TQSA 2JLGA 3TJ8A 2YH1A 3IC1A 4CM0A 1U1NA 2OPPB 3OFHA 1CXQA 1KCFA 1U6ZA 2LQ5A 2BA9A 2QM1A 5MAOA 4OYAA 1NBEB 2C2DA 4BROA 1F9FA 1RGIA 2D4WA 3GR0A 2XB2D 1BWFO 2ZC4A 1FWPA 2XI2A 2IA6A 4X64J 2RKIA 1N5SA 4AL6A 1CC8A 3CCTA 1QHTA 4K8ZA 1XJWB 5MLCV 4ZPBA 2UUCF 2GUIA 1CJVA 2OTJS 3CYMA 4A8XA 3HHNB 2OEMA 3PFOA 4Y3CA 4PG5A 4YS2A 4WFNL 3VF0B 3QB0A 4CI0B 4B8AB 5DM7L 3GFXA 3J7AP 2B5JB 2GVDA 4BBYA 4OV1A 1URRA 4ED6A 1N6QA 2WW4A 4AHSA 2KT3A 3RRKA 3B8AX 4MQ3A 4KGXB 3TAPA 3NLCA 1RSCA 1H6KX 4K7QA 2YV0X 5IS2A 2SXLA 1D1UA 1EQ0A 1Q81T 4A61A 1BDGA 2DKOB 3I4HX 4RW4A 5E0OA 3KDNA 3FFIB 4WPAA 4L74A 1ZBSA 2ASMA 2CNOB 4H54A 4CIFA 3NAIA 4IDHA 2IBOA 2HW3A 4LBHA 5ETRA 5EWGA 4DR1K 1MWMA 3TX0A 2GAHC 1HBMB 4DTJA 4ICLA 3NMRA 4CEOA 3HFZB 1RTHB 3CXCR 4CBXA 2EG2A 1HI0P 4HDHA 3X1LB 1YI2S 2Q1NA 5GAEU 2L41A 3ILJA 4RWXA 2DPIA 1HRHA 4KHPJ 1YDLA 3I0RA 4W5NA 3VGUA 2VBXA 3V9WA 4X4OA 1GTEA 5HJXA 2PMZD 5KG6A 4DR4F 3SYZA 5CCLA 1KVJA 1JLQB 4OPHA 4UUWA 2HWHA 4HLBA 2GC8A 2UUAK 3N6NA 3HM8A 4C7QA 4USMA 4JS4A 1NEEA 4K59A 3K5NA 1ZBIA 3S3NA 3VWSA 1XBWA 2HFZA 2DVIA 2HYIB 2AX0A 2YQ3A 3C95A 4JI7J 3IWNC 3EGVA 5HLFB 2DFFA 3QQCD 2V4JB 2XM3A 2PSZA 3K17A 2YWGA 4ED4A 1FO1A 5HANA 5LMUJ 3M8WA 4LR7A 3Q8QB 1RT6B 2UXBK 3UNGC 3QT5A 2WCXA 3PUFA 3MWBA 2DNNA 4ECYA 1W7WA 5AJ3K 2P9NB 1WUAA 3L3CA 3KVGA 1DQ8A 3X3UA 4KH5A 3QT6A 3R7SB 2HF4A 3Q24A 1T02A 4HUGA 1F9EB 1I39A 3AVMA 1IKWA 5HSPA 1KN6A 4HT7A 2JC0A 2RS2A 2JX2A 3HSDA 3S7RA 4JV5J 2L9NA 1FT8A 3BZKA 4C1NI 4CZMA 1SI9A 2EKYA 3AA5X 2ZJQQ 4BC9A 1FRJA 2NRXA 1CZBA 1VHXA 4JI4F 1R6YA 4CEBA 4UY8T 2ZH8A 4K43A 1C1BA 4CHQA 3LQVA 1F3FA 4LF4J 4EYHB 2CYYA 1HD1A 2DRAA 2DNHA 4OYMA 3MX5A 4JB8B 4K25A 1TELA 1Q8BA 3CCWA 5K8PA 2HHPA 2WVFA 2DJWA 5GMKa 1WORA 2K2PA 2RF2A 2ZOMA 5KFRA 2MLZA 3RMAA 1PC5A 4O4GA 4I6WA 4HUEA 3MWTA 4Q44A 1U0SA 4PXBA 2I7NA 3SSRA 3OR2A 3MR5A 4DV4F 2UXCJ 4UOGA 4DV7F 2GO8A 4Q43A 5HRRA 2AJ2A 3THYB 4ITSA 2XI3A 1W7AA 3MPWA 2J6SA 4CZFA 1E6YA 3CXCM 4O3SA 3UDEA 2Q3SA 4QR0A 4FPIA 3VVUA 3GIIA 1JCFA 2HWTA 1IBMK 1KAYA 3KJFB 5HAOA 3NDKA 5FPDA 3ONQA 3JAMU 2ABYA 4AHTA 4JS5A 1T9TA 4OZ0A 1R6VA 3V81A 4CJUA 3NKYA 3OR1B 1JJ2M 1IBKJ 3FEXB 1NRKA 5F9NA 4BGAA 4BC2A 2DGTA 2IC3A 2AWZA 3O6WA 3D6HB 2W41A 3W3SA 3B4DA 3ULDA 4O55A 1IBLF 2M3DA 2CXEA 5L39A 3TVYA 4B3RJ 4JI3J 1F2HA 4OHZA 1SL1A 4KH1B 3IWLA 1R3NA 3KKFA 4QQBA 4OKKA 2VPWB 1VRTA 1KTVA 3TAGA 2W9BB 3VQCA 1CS4A 4KB1A 3BN4A 3DLGA 2EXUA 3KLEA 2RSQA 2E1MC 2P9EA 4ZOSA 2EWHA 4JI0F 1RUSA 2VPZB 1S1VA 3GOIA 3BSNA 2CNNB 3PXGa 2XS7A 2D0BA 2GUPA 1T9UA 2I9SA 2RVJA 4UF4A 5B0BA 1U1PA 3HSGA 2XNRA 4YOWA 3CJAA 2VL1A 4OL8A 1IBMJ 4NMLA 1FX4A 4KRFA 1TYQB 1RI7A 1Z26A 2G1DA 2UUBK 5IT9U 2YHAA 4HVZA 4OYIA 1CJKB 4NLVA 3J81O 3CDEA 1WBDA 4KTZA 2XULA 4DV5J 5M2PA 4KH4A 2MGZA 5AQXA 3BN7A 4WK3A 1HWUA 1VQ8S 4ZLJA 3UD3P 4BE1A 4JI5F 2H4WB 1Q53A 2HFSA 2QL7B 4O3QA 2IS3A 4E98A 1GEHA 4EP4A 3CFPA 3TJAA 3B4MA 1JXEA 3A3PB 3IP0A 5C42A 5KFYA 2R9LA 2ZWHA 4DCOB 1VQKS 1RAHB 2CZ9A 2PE8A 3TSPA 4C9DA 2G8IA 2RT3A 2P9GA 1E6VA 4USKA 3IMXA 2H3GX 1KFDA 3AO3A 5KRTA 2BJ3A 1PSDA 2WZ1A 1BUPA 5H1SQ 2NRVA 2V63A 5HP1A 3IM9A 1ZBLA 5KG0A 1A5WA 3VZIA 1OVQA 4F36A 1H2TZ 3Q8PB 4A59A 2O8EA 3V6HA 4LSLA 1J53A 3ZSOA 1EWRA 3O4WA 5LSRA 3SLCA 5CABA 3A8IA 1MLAA 4XH5A 4Z2XA 1HR0J 3L2RA 2DHSA 4IOAL 4V19J 2BM1A 3GJRB 4AQYK 3TOQA 3T5JA 1ASWA 4DEZA 3OL6A 3QERA 3VEWA 3ETOA 4TU7A 3MXIA 3RG6A 4RW8A 1N5YA 2ZBRA 5I3QA 3DFEA 2GWJA 3GV7B 2B43A 1K8AO 2LYVA 4BQZA 2IGIA 1A0OB 1YRUA 3U9DA 5A6PA 5KFIA 5KAKA 1GQEA 4W5QA 3EVMA 2ITMA 5F3ZA 1RP5A 2OHDA 1GMVA 4KFBB 3WIVA 5A0YA 3CJQA 3DXBA 3MR6A 1L5UA 3TSQA 2X1FA 5D0EA 3BJYA 2R7QA 4DPOA 2MKCA 1TKTA 4R5PA 4CO1A 3MMBB 4NLUA 5M1KA 2H5JB 3VEVA 4WXWA 5F3TA 3ZSQA 1WHXA 1OH6A 2DXFA 2RILA 2FZGB 3LM9A 3JSYA 4YDXA 2GFFA 2G2YA 1N34K 2UV8G 5BJRA 1EWQA 3UE2A 1VSHA 5JUMA 1HMVB 3VVTA 5BR9A 4FJ9A 4BGBA 2ZZNA 3TUJC 4JI8K 1BI4A 4KO0B 1XNQJ 4FJHA 2RQKA 3OYFA 2UXDK 2DTJA 3RBZA 5L1IA 2V68A 4U95A 4F25A 1VQMS 3R5CA 2KT5A 1DFDA 2CH5A 3Q89A 2JFKA 3V9ZA 2LEAA 4QWEA 3OYGA 2ATQA 4I64A 3HBTA 7AT1B 3QESA 1CSJA 4O44A 4YP3A 2AZ3A 1BCMA 3SV4A 3ZT3A 4KR0B 2XMVA 2P9SB 3MMAA 2PFDA 3MEEB 3T6JA 2VWBA 2IVPA 1YRXA 2W9AA 2F9TA 3ETMA 4CEQA 4LRBA 4LC9B 3CWJA 3HKWA 3NGIA 1XNRK 4DV0F 3CJSA 2DITA 2OPQB 4DUZF 3AVBA 2VG6A 2XHBA 1XN9A 4U6PA 1B64A 1JB0C 2I7PA 4MIBA 4OZJA 3FGVA 5GADP 2E1AA 2W2MP 3L7PA 5KG5A 2M70A 4DX8H 1TQLA 3WNGA 5DK5A 2GGPA 1XHXA 4YB7A 3FE1A 5EXWA 1SBRA 1N36K 1XK8A 4KT0C 2V8VA 4IO1A 2JLEA 2Y1LB 4PUOB 4EBCA 4B9TA 4M63C 3JSMB 3T1AA 3OL9A 4PWDB 4C0OC 1WOPA 3I5BA 2B4VA 1VBXA 3AVJA 4P7VA 1QTMA 4RW9A 2DH7A 1D3WA 1X8DA 1Y10A 3BGUA 1R8AA 1OPIA 2HK2A 1B7YB 2FLOA 2ZOGA 4CF0A 2EVZA 2XY7A 2FF6A 1BG3A 1PILA 4MT1A 4HUFA 3AA4A 1HYSB 2ZQBA 2ZM6F 4J2EA 2DR8A 3AAPA 3MPYA 1WF0A 4GVEA 5J2PA 2ZZTA 5KT5A 3I87A 4LRDA 3MTJA 3LP0B 4KE5A 1SJ1A 2F8HA 3EJMA 2YBVA 3BKTA 4MLEA 1EARA 3MUMP 5F8JA 1TUGB 1RTDB 1HD0A 1U26A 2BE7D 2RQ4A 1MWZA 2V8HA 2PGCA 4CZJA 3MXHP 4NXMJ 2YX1A 1YTYA 4J91A 2M9KA 4IEIA 1KTQA 1IKVA 2VV5A 2DO4A 3E3XA 1WACA 5LL6d 3CJBA 3UVJA 4RKUC 5DETA 1LWFA 4X84A 3ZEUA 4CFAA 3MTKA 5T7LB 4F4KA 2XMUA 1SB6A 3ZO7A 4FSVA 3GWCA 3BQ1A 1NSKL 1HX1A 2DNLA 1WI6A 4LD0A 2E6LA 2RB7A 4BDPA 4MKYA 2O8CA 4URQU 3ZT4A 2W24A 4FYYB 3MM5A 3DAWA 4DXLA 3BSOA 2CQHA 3PM9A 3KWGA 2Q3PA 3BYRA 4NASA 3D67A 1O5JA 2HURA 5HVGA 5J2QA 3NCPA 1RT5B 1U2CA 5I3UB 3WNFA 4X66K 3MM7B 3CQYA 3EZ5A 4PRFA 5C24B 3AO2A 5DZ7A 5B8HA 3NP5A 3K57A 3DLKB 3AAWB 1IJEB 3L6QA 4DPXA 4P74A 3PRDA 2F65A 2FVRA 4EO8A 1BQMA 4XPEA 2FC0A 3TJ9A 2HNDB 1LW2A 5EX0A 3ID8A 1T6DA 4GMJB 1TKXB 1RBVA 2NREA 4QAGA 1U8SA 2HFNA 3D7SB 2CVEA 5LJ3Y 2UUCK 4N76A 4EBEA 1S1XB 2OI2A 3NF7A 5LSLA 2EFOA 4LREA 1RLDA 2ASYA 3PYGA 5LOQA 4B1VA 4H4KC 4J9MA 3ENVA 2OANA 1VQ4N 2X3GA 2B51A 1ZM9A 4BRQA 4KHUA 5GAGI 3HVRA 4DPUA 4USHA 4CT8A 3C6UB 4LF6F 3G8QA 4HTJA 1EX4A 2ZUGA 4U67L 3ULEB 2FF3B 5T14A 5K8MA 7FDRA 2Z1JA 5KPRA 1X7VA 4F02A 3BP8A 1MROB 5KTQA 3NL0A 5HMYA 1RBOB 3R5AA 3I55N 2A2DA 4CI6A 4ZA1A 4B3OB 5CHCB 3QT8A 4CT9A 1FDBA 4P75A 4JI6J 4FWMA 2O67A 3MN9A 4CD1A 1WC1A 1RTIA 2HIQA 1MG7A 2M5YA 6FDRA 3LZJA 3TQ1A 4B1YB 2OA8A 4Y1DA 3FR0A 5C2DA 2ZH3A 4B1XB 3LOUA 2I6WA 2HGMA 3VAGA 2LU2A 4OZ2A 1S48A 1HKCA 4H0XB 1BHNA 3L7UA 3HPHA 1I3AA 2BUPA 2VDHA 3QETA 2ZJQL 1Y64A 5ETKA 2MTLA 4DR4K 2ZE2A 3CIPA 5DG7A 2XLJA 5J1PA 2HLTA 3V2UC 4Y34A 1NCLA 3H5YA 1RTJB 3HVTA 5KFTA 3RBXA 2AT1B 4LF8F 4FF3A 3ZZ0A 2PC6A 1BOTO 3MD3A 4I6YA 5KFDA 3U6FA 3FEZA 1TL7A 4LFCF 3GIRA 1JCGA 2V4RA 3LWLA 3W7BA 5DGAA 4BRPA 1S1WB 1O13A 5HI7A 2CPEA 2QEXN 5IT4A 3I8BA 3AAQA 3MMVA 2VOPA 1C4CA 4JKGB 3OXLA 1FF2A 4LF5J 2XHWA 2GEMA 5E3AA 3FZFA 4LRCA 3AGKA 2BUNA 3R8EA 2HVEA 2CQGA 4XH4A 2IFXA 4FJIA 2CJXB 5M2UA 2HKEA 1UJ4A 2J9EA 3AA3A 5KFWA 2MLXA 3IBWA 5F8NA 3QRRA 1L3KA 1C1AA 5KT4A 3FZHA 3A3NB 1VQYA 4HACA 2CJBA 1OVYA 4Q2LA 2XO6A 1FKOA 4JI4K 4CGJA 3QFUA 2F8EX 2XHCA 1B92A 4FF4A 3Q0AA 2XO7A 3HL8A 2OGUA 3GPAA 1YBAA 4ZLNA 2PDAA 4W5TA 3J80Y 3BF4A 3L2VA 1G3OA 5KG3A 1HHSA 2CPFA 2QLXA 4ZJLA 3CJ9A 3B78A 4E1NA 3V6DA 1NK4A 4YY3F 4MKVA 3DOMA 3IS9A 3MMJA 4WFXA 1OYEA 4QOZB 1GTHA 2D74B 4UOFA 5KG4A 1OQ3A 2Z2MA 3HPGA 3C3LA 2FIUA 3O3FA 3WHIA 4DV4K 5D3GA 4DG1A 1YIJN 4CP5A 3VAMA 3OS1A 3NVMA 1RFQA 3PYDA 3CJ1A 4GY2B 3AA9A 4GKKF 4RBTA 4L3KA 2FXUA 3RSEA 2YKMB 2BKPA 4OI2A 2JEIA 4HVJA 4OX9K 1KXPA 5B7WA 4Z4FA 2D1CA 3G8TA 3GL1A 2EC2A 2BX6A 3H2UB 4JK8A 4M5DB 2CVIA 2WB4A 5KFUA 2F8MA 2RUGA 2HBYB 3KKRA 1HJOA 2BKOA 3O1WA 2YKQA 3BR8A 1U2FA 2AJ1A 4FLYA 4J7CA 2FSNA 2PYJA 1XC9A 4H4OB 1TTHB 1NM2A 2YNFA 1YJVA 4OKEA 1AZSB 5DG8A 3C6TB 2OSQA 1CZ9A 2RHQB 1X4CA 1WNEA 2QMXA 2GO9A 3GQCA 1PJ5A 1C0FA 4FJXA 2FGOA 3WT0A 4NCBA 1O1WA 1WTBA 2Q66A 2QG9B 2YNIA 3ZNUA 4YMEA 2FJAB 2KB2A 3DRXA 2FTRA 3MWPA 2OMOA 4JI1J 4RUAA 1JLGA 1UEUA 3D2WA 2MKIA 4IDKB 1Q8LA 4JI0K 1Y11A 4HTUA 8ATCB 2HLUA 3DMJA 3KK1B 3H1QA 1M90O 4DV7J 1E3MA 3KD1E 2C3UA 3B6BA 2QWOA 5A2QU 1UEKA 1RWNB 2NQPA 1X4BA 3P45B 1OO0B 1XQIA 4CHYA 4BDYA 3J81j 2QWPA 3BBBA 1VSKA 1E4FT 3UNYA 3B8HA 2C3MA 4A8FA 1S0OA 5AQHA 3R2DJ 3R9LA 1UA1A 2RKIB 5JVHQ 4QIVA 4RNOA 1B0TA 4JI5K 2EFNA 2OO4A 1T0TV 3SUPA 4M5NA 3DRPA 1CJVB 2NPFA 3ULHA 2DY1A 5KT6A 3R3TA 4CJVA 1IBLJ 1TUVA 2IY5B 3U8XA 1WKKA 2VOOA 3RTVA 4JKHA 4C8ZA 2AU0A 5IZHA 1LFWA 2GVDB 2A6AA 1TR0A 1N6QB 3V4IA 3Q23A 4LF9F 3UCZP 1V5VA 4HT5A 3KHGA 3AFGA 4E2FB 2HQIA 4NZ7A 3RYLA 5B0CA 1M5KC 4Y0FA 4GVMA 4RW4B 2A10A 4DI6A 2A41A 2ASOA 1H2UX 4CLPA 1X4FA 2ITGA 2NPIA 4NX9A 4OFZA 1PIEA 1TGOA 4WF9Q 2FD2A 1FKPA 3TWHA 4ICLB 2AX1A 1HNVB 5CZXA 2G2ZA 2MYFA 2ZH9A 3QJJA 4YB6A 3J7Z5 2D3ZA 4AM7A 1NJIO 1HWKA 2ZH5A 4AHCA 3SFGA 1TFWA 2N7CA 2E2QA 1AT1B 4J5OA 3ZZYA 5KFAA 1K44A 2FJDB 1AUSL 3W66A 1HYVA 5GMDA 3AVLA 3CVKA 4ED7A 3HHLC 2B9WA 4C0HA 1WOSA 1NK8A 3GYXB 4MDBA 5M1FA 2QMWA 1QVGR 4ZK7M 2BXJA 5G0RA 5C10A 2VD3A 4FPRA 3GCXP 4NA1A 4KB7A 5KFFA 3CFOA 4UOHA 1X4GA 3CCRN 1REVA 4QYRA 3VGMA 4Y00A 1BE4A 2PMWA 4J9SA 4PXEA 1QAYA 3HOTA 1MMLA 4FZYA 2E5LF 3BGFA 3D0IE 2DR6A 3MM9A 1WHYA 2O8DA 3QMLA 3THWA 2X1AA 2X78A 3L09A 5AZJB 2HSEB 2L48A 1T7PA 4HTLA 1IKWB 3EL2A 2HWIA 4JI2F 4FW1A 4C11A 4B9QA 1NSPA 3RAMA 2GIQA 3FSYA 2YKAA 3CMAN 2HNYA 2DNPA 4KGMA 1JX4A 3PIPQ 3PY8A 3M3ZA 4DU7A 3IG1A 2XGPA 4CF1A 3R1LA 4P73A 4NLBA 5HMZA 3SCIE 5AQFA 3T5HA 1KD1T 2ZH6A 3CD0A 2IAJA 1YJWN 2VBWA 3U1MA 4C3KA 2HBKA 4YHHF 3V9UA 5IC6B 1EX8A 4OI6A 3CD5A 1Y7PA 1WEYA 4DUZK 3RR7A 3ZCMA 3NAHA 3UD5A 2BQUA 2RF2B 2W25A 2CZ4A 4XH1A 3QEIA 3RRGA 4IZ9A 4BR9A 4DZDA 4ZVHA 3P6YC 4O4GB 1OWXA 4TLQA 2CRLA 1S22A 3HSZA 5JS2A 2ZDOA 2AGOA 1PO6A 4TNOA 2BJ1A 2K8GA 3D2EB 3L2WA 3E01A 2PFFB 3C6AA 5KGWA 4BVPA 2AYEA 4DX5A 4RUCA 4DFKA 4Y2IA 1U6FA 2ZBCA 3OR2B 3QSYB 3CCUN 2KVQE 5L9NA 1N5QA 1YBUA 2CDRB 1SJ3P 3H46O 4IBNA 2ZUAA 1T05A 2QL5B 4I1TA 3CC2N 4P6QA 3HI9A 4W5RA 2FJWA 1E6YB 1GH8A 3NGKA 4NLCA 4BREA 2HS3A 4WU3A 4EHUA 4WE1A 5D8HB 1R0CB 1C0UA 4Z4HA 4E7JA 1VQ7N 3A3OB 3UCUP 1DRZA 2GWKA 5HBMA 3AA8A 3THXA 3EXCX 2GX9A 3BO2A 3O9UA 2ZM6K 4CZLA 1EKRA 4NYFA 2A18A 2JNJA 1FK9B 3KMQA 1XWLA 3AVIA 1HIYA 2Y1RI 3HYFA 2MZQA 2BV3A 2MQ8A 2IC3B 4OV6A 3VHQA 2WONA 3KWIA 3C7NA 3MDFA 2CWXA 4DQPA 4H5TA 3F9KA 3D6TB 4PG7A 4RZRA 4XAKA 4DV0J 3DWLA 1TL1B 3WNHA 1QVGM 1HNXK 1RLCL 3SQGA 5AXMA 1F6TA 5LSOA 4PWWA 3IKMA 3O8MA 3MEGA 3GG4A 2QYGA 2EBGA 1VRTB 2J9DE 1S99A 2XYPB 4H0VB 5D4NA 3MR2A 2E6MA 1CS4B 5AQJA 4ECTA 2E4LA 5KT2A 3DLGB 2UVWA 3HHDA 3CM6A 1MN9A 2DRDA 1S1VB 4Z37A 4NLXA 2HBMA 1N33F 2WVDA 1UVJA 1M1GA 2W42A 1Y9OA 4ECSA 4OHYA 4V19X 2MHEA 4H5WA 2JHEA 5GIOA 3EPIA 4LFAF 4WQ5C 4LR9A 4R0EA 3S3OA 1FJGF 3G9CA 3R1XA 1R8PA 1U6BA 1APSA 2CQ1A 4JK7A 1VR6A 1K1QA 4DV2J 4C8KA 3GFZA 4IH5A 4CBUA 1GLLO 1VQOS 2MGZB 1DQAA 3UDLA 1UZHA 2AZ1A 1BC6A 1VBYA 3CQ8A 3KNGA 4PKDB 5C42B 3ISND 3HLUA 3CCEN 3OBIA 1T6CA 2MXYA 4RPFA 4DL2A 2BRLA 1T03A 3TVZA 4CH7A 3NH2A 1E6VB 4ES2A 3SMSA 3O44A 4IEEA 1IO2A 4B9VA 3J81U 1L3SA 5DDOC 2PEHA 5HJYA 2DY4A 4W5OA 5GAHI 3W1YC 4E1MA 5CD4A 1UPMB 2H48B 3TUPA 2GS8A 3SI6A 4AH9A 4RU9A 3I56N 4LSLB 1S79A 3K8WA 5DDRC 3NS7B 2AEFA 4QR1A 3FKBA 1JIHA 2RIJA 4UOCA 3DN9A 4J9PA 1JLCA 3THPA 1KDNA 4EZ9A 3TUIC 2BH1A 3EGZA 4F4YA 4LF6K 1M5OC 3QGPA 2HGNA 2AQ4A 3AD8C 3PRBA 4RW8B 1N5YB 4BR2A 2HHQA 2QLBB 2QKKA 1RWKB 1VJQA 3PRVA 3WBZA 2VZ9A 3M6WA 5K8OA 4CJ4A 1NO8A 1SUQA 4ISFA 1X60A 4MYUA 4A5BA 1RE1B 3KUEA 2F5GA 3BGRA 3O5TB 2HVIA 4DR5J 3CGIA 5A0YB 4CO4A 3KIOA 2KRBA 1TKTB 4R5PB 1B3TA 4DL7A 3QWUA 3HO1A 1NU0A 4YORA 5AQGA 5CD4H 4CLLA 4PQAA 4DWIA 2E2NA 3NHGA 2OSRA 1VI7A 3JTPA 2OZMA 4OPJA 2V8DA 4K4WA 4O3NA 5AE2A 3QEXA 2HSTA 1FFWB 1EP4A 3KLVA 1JJCB 3BO3A 3M8QA 5HN0A 5D77A 1H3DA 1BI4B 2V2KA 2LQ9A 1Z2ZA 5GAGP 5AQKA 5D0HA 3K5MA 4DQSA 3A1YG 4LFCK 4UT4A 1GMWA 4Y0WA 4LF6J 5BN8A 2OFGX 1UFLA 4ZCKA 5ELZA 1BISA 3U7JA 4BCAA 2AKWB 1VQNN 1WG5A 3W9IA 3OYEA 3Q8YA 4FWQA 2NYIA 2IVYA 4GV9A 1J2VA 4B3SJ 2MB0B 4ZS6A 4O44B 5A8WA 3LAMA 4LVNP 1RCOB 3UKRA 1I94F 3WEEA 5FRMA 4YDDB 3M8PA 3FMWA 4ISEA 4DR3F 3MMAB 3DLLQ 1NWKA 3U27A 5GAEI 1RK8A 4CK1A 1R89A 4LFBJ 3KNAA 1DTQA 2VG5A 2ROGA 3D54A 1U48A 1ZPVA 3QWPA 4EU0A 2MDAA 2ETJA 3OTBA 1TK5A 1ZOTA 3BPDA 2F7VA 1CJTA 3PHTA 1FTRA 1A9NB 4CM2A 3VQ4A 3RWUA 1U2VA 2QKBA 1BL3A 2YHBA 2F8TA 2ZNZA 2GGPB 3JXOA 5F8LA 4FS1A 3U4LA 3VQ8A 4FF1A 4LF8J 1JL2A 5CXTA 4JHDA 4AHRA 1BD6A 2XWXA 2UU9F 4YY3K 3I9V9 1Q5YA 4RW9B 2IIHA 3MFHA 3QDKA 2JLFA 4QBUA 1B0PA 4PKGA 4ZVPB 5A8RB 2KJVA 2EPIA 2IJFA 3CDWA 4DV6F 1ITGA 1XMOK 5F0XA 3G6EN 5IWAF 2ZH4A 3H40A 5J2PB 3OV7A 1P27B 3CF5L 2K7KA 2CIMA 4JNEA 2R8IA 2Z57B 2X6SA 3H4DA 2YPZA 3I6PA 3O4QA 3DRRA 2IYGA 4F3MA 2J0SD 1VQ5N 2IA0A 4WTOB 3SAFA 2XSFA 3P5BP 5AQIA 5EU7A 5KFGA 3IAM9 4NYNA 1BQNA 2Q43A 2HMPA 1CJUA 1K8KA 3BBFA 3QJPA 2D69A 1BUXA 5JVHL 4Z7CA 3VAFA 2CQ2A 1BCOA 4Y65A 4WQ4C 4J9OA 1R8CA 4RO0A 3UVJB 5A8KA 2YXLA 3AODA 1LWFB 5FDLA 1TAUA 3UO0A 3MAQA 4NZ0A 3ZEUB 1UL3A 5K5MA 2VASA 4LT6A 4A8YA 4N56A 1M0SA 4ELTA 5JS1A 2EG1A 4C6AA 1UJ6A 3A5NC 3SUOA 1QAJA 1QSLA 4TLRA 4DS5A 2O8CB 4KAIA 4RBVA 1JNZB 2W4CA 1UVLA 3LPUA 2YWWA 4PXDA 2WSFC 1YQHA 4CJTA 4M7XA 1SC1B 2B7CB 5J2QB 4IG0A 1Q16B 4GKKJ 4FL9A 4A62A 4TQRA 5C25A 3H08A 1JKHA 3HD2A 1SQKA 3H3NO 2WBNA 4USUA 2R2UA 3TYTA 3QGHA 5F0WA 4WFBL 3KWMA 4PZVA 1WC5A 4W90B 2J7UA 1CXUA 5KG2A 4O5BA 5GVQA 3VQDA 5HK4A 1IN0A 4G65A 1MN7A 3H0PA 3MOZA 1TMMA 4QPXA 1Q8KA 1BQMB 5CYMA 4OI1A 3G25A 1ILYA 1LW2B 3TA1A 1T3VA 1LXNA 2VONA 2UUAF 3ZTRA 4CTAA 5KOXA 4CESA 4B9NA 2J76E 4E7IA 4L6V3 3P5JA 2DXDA 2NYHA 5DM6Q 4FWNA 3I55S 3SQ1A 4FLZA 3K9JA 2F96A 2YY3A 4C8MA 4R0JA 4M5KA 4A5AA 2M88A 3H59A 4DCJB 3DXKA 4ENOA 2FVSA 1NGFA 2IIRA 5AQZA 1KOOA 4QW9A 1D9FA 5LMNF 3AVCA 4Y2CA 2LSNA 2B9YA 2PT0A 3PJWA 3NF9A 1A5XA 4DV3F 1YTAA 3N5FA 1HJRA 4ED8A 3GDQA 1I1GA 2G1HA 3TU5A 4IO8A 3LDPA 4QYZK 2Z30B 3VAHA 2FHJA 5H9EK 3O2IA 1WEXA 4K0KJ 1SQEA 3D3CJ 1LXJA 1HNZF 1J54A 4Q45A 5KG1A 3TQEA 5AFUA 4ZPWR 4BG8A 3OY9A 3EDRB 3RW7A 4FJNA 2MMYA 1RTIB 3EX7B 4KGZB 2RQMA 3T1YK 2QL9B 3S9HA 4ILGB 3TAMA 1KVCA 1D5AA 1S4EA 4DHVA 2QTWA 4QZVB 1PAEX 2KXHA 2VCPA 3NF6A 4RNMA 4HHHA 5HOOA 2BVZA 4H0YB 4LQ9A 3P39A 2QEXS 4AUKA 2RRAA 3HDSA 4MK8A 2RU9A 4H4MA 3HSTB 4E89A 1VS3A 2VKRA 3ALYA 3LDNA 4I0WA 4ZTFA 2XEXA 3GYNA 1BQXA 2DFHA 4DR2F 3UN3A 1GFWB 3D66A 4Z0UA 3HVTB 3VF2A 4KHWA 3OHBA 1SKSA 5AQSA 4Z4CA 5A76A 4Y2KA 4LF9J 3AY9A 4OYOA 1X5OA 4O4RA 2D0AA 1TL7B 3U02A 3PJ9A 1P6TA 4HH0A 4FZXC 2OAUA 5IC4B 5AFUH 2WAQD 1SIZA 4WFYA 2BTFA 3D0GE 2JWKA 1CBKA 2HBZB 2W8KA 4GC6A 1FRLA 2A3JA 3OFFA 1UAXA 5E5NA 4FOEA 1NGCA 2OKQA 1S1UA 1GOCA 1XHZA 4ER8A 1YITN 2JGUA 3VQ9A 4DTNA 1HW9A 2R7OA 1M5VC 3RR8A 1BXNA 1J6ZA 4J2BA 2QFIA 1EQMA 3HT3A 4JI2K 5L38A 3JTOA 3ZC4A 3O3GA 2G2OA 4C8LA 4HACB 1G99A 5CR4A 1WI8A 3IR7B 2R3VA 2FHOB 3CD7A 3PYEA 4WP8A 4M3TA 1FKOB 1IM6A 2LEPA 1K73O 2LQ8A 3CCSN 2J9CA 2ZJRQ 3NAEA 1X5SA 3EE3A 4PKIA 3H98A 1SZ2A 4H8KA 1OSCA 3N4PA 4BRDA 1DLOA 3TANA 1P1TA 4XK8C 3OYBA 3PIOQ 1DY3A 4B9MA 3NS6A 2Y0BB 3DU5A 3F73A 2OD4A 2CPJA 3V6DB 3MM6A 5ETLA 3HXMA 3JSBA 3RRHA 4CH0S 3DOMB 2EK1A 3IS9B 4PYDA 1KKHA 1REGX 4LSZB 1FE0A 1RHMB 4CJWA 3CCJN 4IKFA 4I2QB 2IOCA 3K5LA 3U3GA 1NUEA 2V5HG 2E5LJ 2DGVA 3ZTQA 1SXLA 3FLCO 4MJKA 5D3GB 3NG8A 2KXNB 4DG1B 2E1PA 1SL0A 1OJ4A 2LQJA 1ZBFA 4QIEA 3W8PA 2WC9A 4X4QA 3K5OA 3RSEB 1U25A 2CQDA 4K5SA 1Y3JA 4I67A 5C5JA 4N8NA 1HA1A 2NRRA 2HHVA 1OY6A 1NGGA 2OLWA 4DQRA 2KYXA 1KWMA 2YQ1A 1LK5A 4NLGA 1V6HA 3L2UA 2R8HA 3AB2B 3QNNA 3O1BA 1PCAA 2NXNA 1WNSA 3BEXA 3PDNA 3LDQA 3NS5A 2W9CA 1HBUB 4KYZA 2V0NA 3H25A 1KQGB 2MKHA 3IN5A 4YHHJ 2BR0A 2YNFB 4M5GA 4FVMA 4M94A 1ZZNA 2O8BA 1WG1A 3FCHA 5KPZA 4HEA9 4CBWA 2OMLA 2GIRA 3SCKE 1S72N 1XEZA 4DTMA 2YNIB 1VK8A 1FXLA 1U49A 1A6LA 1HNWJ 4NYZA 4ZVOB 4ZN1A 1I3OB 5EVZA 4Q0BA 2BE2A 1Q8IA 4WYBA 2P9CA 2B4JA 2LU1A 1IKYA 2DHGA 5HL7Q 4QIWD 1DZ5A 1N33K 3DMJB 2A40A 3RW6A 3OW2R 8RUCA 4WCEQ 2AJ4A 3PVXA 1WKJA 2OEJA 1K8AT 1RAGB 3CO9A 1VBZA 4LFAK 3O08A 3AJ2A 1FA0A 1FXXA 4RW7A 3H5UA 2IRXA 4LF7F 4X65F 3WUHA 4N47A 3TPQA 5JJBA 1XQSC 3HP6A 3OSPA 4E8UA 5I3PA 4CW7B 3VESA 2JVRA 1Q4RA 1RWPB 3K7RA 2MY7A 2YHWA 4Q7AA 2KFYA 1NK0A 5HROA 5DJBA 2P5GA 3W63A 4C97A 2B4UA 4FLTA 1QDUB 3I82A 3DRPB 1TAQA 2QT7A 4TYAA 1EXQA 2H3EB 3CPEA 4PEOA 1RHQB 1TU0B 3G10A 3QIDA 2QA2A 1HHQA 1SH3A 4WP9A 4X62J 1KHWA 2IM3A 2BDPA 5IT0A 5AXLA 4U9RA 1R43A 3V4IB 5KFOA 2ZJPL 2ZFHA 4DR7J 4DBQA 1RT4A 4JI8F 4O5FA 2F7TA 3AQOA 2HBJA 2MKKA 1FDAA 3KLIA 3DXMA 1XMQF 4CFBA 4K8RA 1HBOA 1Z05A 4WBFA 1ACMB 1WSFA 3NMAA 4ILHA 5FLXO 4ZIVA 1PJ7A 2V9WA 1C1CB 1X4DA 3SCJE 3VQQA 4N7TA 4A47A 2RDDA 5ADXA 3KG4A 3TZWA 3NGSA 2RMLA 1YJ9S 2BZ2A 1U8WA 2WVEA 2EFPA 3CJRA 4B3MK 2J8SA 1FJGJ 3T5LA 3IM8A 2ZF5O 1S76D 1VAZA 3TRGA 4A46A 3DJCA 2NRHA 4BY9C 4W98A 2HAIA 1S97A 1TUWA 1HNIA 2QGFB 1XI1A 4QJVA 1J5EJ 4JYAJ 2KHCA 4QS8A 4H5NA 3BH7B 2BANA 1XNRF 4AM6A 4URSA 4FXVA 5AQTA 3PX4A 1JJHA 2X1BA 1N32K 3H2VE 2I5JA 3AHPA 1IR1A 3VQ5A 4FXWA 3QAUA 2ADCA 4CLWA 3OYCA 5BR8J 3PR4A 4GNIA 3GFYA 1ICEB 4K4ZA 2QWRA 3AVGA 2I8EA 4HI2A 3PYFA 4LBIA 5LJVA 5G0RB 1YF5L 5ADZA 4G1QA 4J9VA 1RYRA 1X9MA 1NMDA 5ADXH 4NCGA 2MJNA 1FVSA 3PW2A 3OHRA 4UW2A 1QE1A 3OW2M 2FPHX 1X3NA 3QFHA 3MM9B 5H1SV 1LAVA 2O8DB 3THWB 2J6UA 5ETQA 3WX4A 2ZGYA 1Q95G 4ZITA 2RDJA 2WW8A 3F9MA 4D3GA 2AYGA 1UVIA 5IV4A 3CMEN 2P9UA 2XLIA 4HTIA 1RISA 2QSFA 3G71N 4W4MA 4B9LA 2RS8A 4UZCA 4DCPB 4C11B 3RAQA 1RAEB 1UVNA 1EKSA 2IYIA 3UR3C 4BE0A 2HNYB 3SSSA 2KRRA 1I94K 4O23A 3TTCA 2BACA 5H9FJ 4DR3K 4AHUA 2Q2RA 2F8SA 2DR5A 3GLJA 1QZ6A 4LSNA 5U47A 1FESA 2IAJB 2RDIA 3NBPA 2MQMA 4NRUA 2BQRA 4M1KA 3GB0A 3CCUS 2JEFA 2BM0A 2E20A 1KR4A 4ZCLA 3M05A 3M9OB 2DCUB 1ZBHA 5AQQA 1XTZA 4L8RB 2EFVA 2NZTA 2R8GA 5JICA 5ITHA 3PO5A 1ATSA 4QS7A 2YHYA 4DUYF 4WKRA 2ROEA 1VQ7S 2OUGA 4BC3A 2ZC3A 2RN2A 1Y5IB 3M5RA 4MKBA 4DPWA 1SJRA 3OS0A 4BE2A 4RLEA 1Y3KA 2QLJB 3E01B 2QWMA 2XMMA 4LRAA 1GLCG 4ETZA 4CJKA 4NYPA 5KT3A 2CJKA 4CHNA 3ENWA 5EGYA 2FZKB 3IGVA 3M6VA 2UU9K 2MKYA 1T05B 3Q8RB 2OEKA 4KBIA 4DN9A 2EW9A 3TZXA 2FJVA 4GV3A 4MO4A 3ZT2A 2GJIA 3VEYA 4WE1B 5D0RA 4IO9Q 3C0BA 1JQGA 1C0UB 3W0LA 1W26A 4DV6K 3HF5A 5HBMB 4OYBA 4FVUA 3J7ZO 1NM1A 1VQSA 3L0QA 4FBUA 5IWAK 4NLTA 2HRYA 4IR1A 2AJFE 1MSWD 4DR3J 3AT1B 5AQUA 4CNZA 3VQ6A 2WONB 3JAMY 5GAEP 1YI2N 4PPDA 1K47A 3C7NB 1AYEA 1NJZA 3K59A 3CQXA 3G96A 5DRKA 4I9LA 4YDUC 3DOKB 1RT6A 3VQEA 3D45A 3MEGB 1S6PA 2Q6BA 2YX4A 1R31A 1X4AA 3IDHA 4KJIA 4YDUA 2CWKA 4FWRA 3L4BC 4B8CA 4F2SA 2C28A 2YQ0A 4WZMA 2B4OA 1LK7A 4M5LA 1EETA 1X4HA 3UCGA 1FVQA 1LV5A 3F5TA 2BQ3A 4LJMA 2VHGA 1HQUA 4XO0A 2MQNA 2E88A 4MTPA 1Q7YO 1OH7A 3OYMA 3QIPB 3CT9A 4RJVA 4CECA 1IH7A 3I5AA 3W60A 2L3MA 2DPNA 4ID8A 3JQJA 3KHHA 5DMRA 4FWOA 1WUUA 1RCHA 3BGLA 1IG9A 3ZSVA 2LQBA 3H42A 4IR9A 5D4LA 2P9PA 4CK3A 2Q36A 1F3VA 3PX0A 2YJFA 3WQUA 3MAAA 3VMFB 4XIUA 1HL6A 5BRDA 4OMFG 4P52A 3D1HA 2DB1A 3I56S 5IT9Y 2DRBA 1S10A 1S6OA 2ASLA 4DR6F 3B6PA 4BLGA 3SBMA 4C1NK 2LECA 1H7XA 3A4TA 3FVYA 1T03B 3R9PA 3IO1A 2H9ZA 2D0OA 4KGKA 1YAGA 4J37A 4X4VA 4L73A 1YJRA 3VEOA 5ETPA 3NY0A 4KHQA 1NMNA 1ZA1B 4NI2A 1RQ0A 4DV1F 4CK2A 4OYPA 5FPEA 4JKEA 1RHJB 5F8MA 4NXNF 4CH1A 4CZEA 3O1LA 2XWYA 3OTEA 2AP6A 1UVMA 2IM0A 5LMNK 2E1RA 1QSYA 1S49A 1MU2A 2ZOFA 3CG7A 4L72B 1JLCB 4AD6A 3MCOA 2IVOA 2XCPA 4CZIA 4DV3K 5BYSA 4XTTA 3ZZRA 3O9TA 2DNGA 1W2BR 1N5VA 3OYLA 3Q2SC 4O8KA 2BJ7A 1JXVA 3G4SS 4DR1J 3Q8UA 2HBLA 2OFHX 2WBRA 1U1LA 4CLYA 1HNZK 1J27A 3A2FA 4FM0A 5CA5A 1URNA 1S5JA 1SUQB 4FXDA 3RJMB 1NPRA 3S3MA 1U1QA 4OPAA 2HFVA 1S9GA 3CNQP 1UAWA 1D9AA 2RHKA 3IAYA 5GAGU 3KOAA 5BYRA 2GHVC 3MZIA 1VDHA 3E9OA 2QK9A 2UUAJ 2DK2A 1RT1A 4ED1A 1RDAA 1Y00A 2CQPA 1VQNS 2QN6B 5IQ6A 4FWKA 3OHAA 3V1RA 3HT0A 4FJGA 4KI4A 1RWOB 2BRKA 1VLYA 2K1RB 4CRJA 3U1LA 3DGVA 3UFCX 4EEYA 4DQQA 4KV8A 4CJLA 3PEHA 2ZJRL 3FBEA 3FEYB 3BUZB 4BQLA 1EP4B 4DR2K 2DT9A 1F5CA 3M8QB 4IOCL 2FSJA 4CF9A 2M7SA 3PZPA 2UXBJ 2B8PA 1H72C 2ALYB 1RZMA 2YCHA 3O5BA 1JWWA 3D9BA 1PYOB 3CM5A 1NB2A 5AJ3J 3FBCA 4KHPF 5F41A 4F26A 1RKJA 4FOIA 3DRSA 3OSNA 4ECVA 2B56A 4USTA 2NUHA 1R8BA 4QCLA 5A8WB 3CW2C 4ZLPA 2WSCC 3PKMA 4L3QA 1SVDA 3BSAA 2E1YA 4OX9F 2RNEA 4USVA 4Y1CA 4JOUA 3AA2A 1WWHA 2E1ZA 1FRIA 3UKRB 3WEEB 2YPYA 3O3LA 3M8PB 3N5BA 3TABA 2YI1A 2WSEC 4CGHA 2AF6A 4KHRA 4JI7F 1Y5NB 2H5EA 3GG0A 2VFRA 2AHOB 1PG5B 4L76A 1N8RO 1VLOA 1Q1KA 3DLJA 3HSCA 4FLXA 2O8FA 1DTQB 2VG5B 2WTUA 3M4XA 2FJBB 1X0PA 1VQ8N 4ELUA 2DGXA 4U8VA 2OZSA 3VTHA 1FE4A 3NGYA 1CJTB 5KQ8A 3R27A 2C3YA 2OJ3A 3GE9A 4ILJA 3G6ES 3LGNA 3M8YA 4BRMA 3CHWA 5LT5A 5IM0A 1U2VB 4PL8A 4JKFA 4QS9A 4DU4A 3I0SA 3NWRA 3OXGA 4E7KA 3EICA 3ILOA 2B4PA 3SMZA 3M6XA 3V9XA 4H5RA 2E66A 4CLTA 2MEWA 5DS7A 4JHDB 4IRCA 2GCFA 2QWQA 2GAGC 4JV5F 5M1OA 3R7BB 1M90T 1VQ5S 1AA1B 2HQFA 2ZVSA 2MKSA 2CPHA 1TV6A 1S5ZA 4C8NA 3VQAA 1FERA 3HHLD 1GXUA 4CEDA 2RD5C 2VQFK 1EO1A 1NAQA 1VSIA 3DLRA 1QQOA 4K4YA 2HB5A 4LF4F 5FPMA 3NGRA 3TARA 2RRNA 4OJGA 2VF3A 1QQMA 2KZMA 2PMHA 4RG8A 4URGA 2LDYA 4RWWA 1JNRB 4EFAC 2FQQB 5EWFA 2XZTB 3DRRB 1BLUA 3HSJA 5ETNA 2E8AA 4CYUA 2WOMA 4KKOA 4CF2A 1SC4B 4WU2A 3ZSWA 1BQNB 2DIVA 4JUZA 2ALZA 2KG0A 2VWKA 1CJUB 2Q0UA 1K8KB 4IFYA 3T3FA 4P71A 4M45A 4EAHD 2DY9A 3S6EA 1NK7A 2BW7A 2UXCF 2Z56B 1BWVA 1RHUB 2R2RA 1CULA 1U4BA 2C42A 5A8KB 5FDLB 1RU1A 4OLOA 4CJQA 2HFOA 5KFNA 3OYKA 3TX8A 2LP4A 1Q9YA 4FF2A 4PA1A 2ZBPA 1I5OB 1H98A 1C2PA 1O6XA 3WXLA 5CYQA 3EZUA 1T3NA 5KGXA 2P9LA 1WB9A 1HKGA 1WC0A 4IUFA 3SQOP 1IBKF 4KY3A 4MFBB 4HHJA 1KRPA 1RGVA 4OZ1A 3ENAA 4X2BA 1EAYC 3PFEA 1RBSA 5L1LA 4KPCA 2HOEA 1JLEA 1UFKA 1UW4A 1VQMN 3CERA 4B3RF 3LPTA 4JI3F 5C25B 1NJIT 1JKHB 2KM8C 2UUBJ 2WHOA 2OPSA 4DQ8A 3N6MA 1F9HA 2ACYA 1G4CA 4A57A 2DHXA 2L9WA 3BS9A 3K0SA 3EGNA 4LF7K 4X65K 3D5MA 4ZVUB 4JKDA 2GJ2A 3HMJG 3CPWR 3M2VA 1BGXT 3I31A 2ILYA 3GR1A 1DBDA 4FWPA 3MPDA 4CTAB 1IJJA 3C15A 4Q8EA 2IDEA 4PWDA 3ZTPA 1MNEA 1WTFA 2F4FA 4DPYA 1NKBA 1VQPN 2WVCA 3AVFA 2CH6A 2HHSA 4F04B 2VBYA 3KK2A 1TFYA 3DXKB 3WZ0A 2GTDA 1LNQA 4WYWA 5ETVA 1FEEA 2PI4A 2ATCB 2QLWA 3D3BJ 4OQJA 1NXIA 2GMLA 4EYIB 2YKNA 1AB8A 1RBAA 1RWXB 1KVKA 4BDZA 1Q86O 2NXJA 2ZGZA 5KQDA 2L08A 5BPLA 1S7IA 1XMQK 4DV5F 5C12A 4CEFA 2GX8A 4ZHRA 4ZLLA 4AQYJ 3R1HA 4K8XA 1RYSA 1VRUA 2I0XA 3PV8A 1X3MA 2ZH1A 5KFQA 2FSKA 1QS4A 2BJ8A 2JC1A 4G1PA 1KVAA 1NKEA 3D1QA 3KMSA 2F9DA 3KHRA 1U1RA 4ECQA 2QSWA 2VFSA 5GINA 2DYAA 1ZM2A 4IJNA 3TAMB 1T9WA 3HVAA 3T1HK 5B0FA 3TWZA 3N6LA 1S9FA 4FVCA 1CPZA 1FNOA 4CO2A 4FJMA 2D3UA 3IXQA 1JL1A 4ECXA 3HJVA 3EKUA 1ZAVA 3JS6A 4BC7A 3ISZA 3H8YA 1WJ9A 1T8EA 3SAHA 4DSKA 4H4MB 1NLKL 3OTOK 4OVLA 1NPPA 1HR0F 2DPJA 2Z1GA 2KO1A 2QV6A 1N34J 1YITS 4DFPA 4DMNA 3QO9A 1RWWB 1LWCA 2ERRA 3S8SA 3GSIA 2UVUA 4JI8J 5C2FA 3H7HB 5JLHA 3GBTA 1QVFR 1IBCB 3V1OA 2UXDJ 3T41A 3MM7A 2RHSB 5C2CA 3EN9A 2ATLA 2A3ZA 3DLKA 2Y8WA 4CLSA 3ZYYX 4IYQA 3BF3A 4M42A 2KKHA 4YFUA 1S1UB 1C4AA 2YKPA 1QAIA 4OHWA 2E7XA 4F67A 4NLDA 5SZTA 5F8IA 3WXMB 1R59O 3ET6A 4ZPVR 4BR7A 2YX7A 3CCMN 4CHPA 2HHHF 2ASDA 4IO9L 1Q7LB 4UY85 3D6MB 1GNKA 2N3LA 3TVKA 3HHKA 4F50A 3UKUA 4EIAA 2R8KA 1UW9A 5EY4A 2F9JA 1XNRJ 2POKA 2F63A 2DNKA 4ZVFA 1HNXF 3EM1A 4AXIA 2G8HA 4KSEB 1XNQF 3SJJA 3CCLN 3P31A 2D0PA 4ES3A 1J9AA 3LO3A 1DLOB 2PN6A 3ZX0A 5J1NA 3ULEA 2ASJA 4OKJA 2BBEA 5AQNA 4FJ7A 5HQ8A 3KJNB 2C22A 3NRBA 4DUYK 3MM6B 3SPYA 1N36J 2BOPA 3OFEA 4WKYA 3ZZPA 3N4QA 2XG8A 2YVSA 1LWEA 1UJ5A 3FQLA 4MMOA 4QWBA 2OPRA 4V19S 3LP3A 3VEXA 2ZNYA 1K9MT 2CNKB 3FSIA 3A5OC 4YOYA 3UD4P 4TKTA 1CG2A 1BIUA 4Q2MA 4IFEA 2HMIA 1KVBA 2W2NP 5GIPA 3OA9A 2U1AA 1BWEA 2CA9A 1OKJA 2XY5A 4F4ZA 1YZ6A 1X9SA 2IJRA 3L4IA 3O80A 1O8BA 2DGSA 1RADB 2DR7A 1GXTA 3NFAA 3GE1A 1BU6O 3QYYA 3PW7A 3L2QA 2FJEB 2M4MA 4WWSA 1PJ6A 5LXRA 2FHKA 1S72S 1ZTTA 3C65A 2YKOA 2XTJP 3QEPA 4ECZA 4LF1A 2EK6A 1TL3A 2I38A 2QYCA 3B82A 3H4BA 3OQ2A 1NDPA 2CADA 3W3DA 4NLYA 4NPOA 2AYBA 4BHQA 1OS5A 1YKWA 1KLNA 2AMCB 4F3OA 2W2QP 3KG0A 2W9CB 1WAJA 2RE1A 2KDOA 4WP3A 1KOHA 4BACA 3BREA 4IOAQ 3TTDA 4BC5A 1G7CB 1Z1ZA 2O8BB 1ZM4A 4TN2A 2Z0GA 2V51B 5DQHA 4DU8A 3RB0A 1IM4A 3BQ0A 1CQMA 3MCSA 3OBWA 5HRPA 5D15A 4P72A 1FD2A 1X9WA 1B7FA 5F1XA 2AP1A 2DGWA 3IMQJ 1KQFB 3CD6N 2R7SA 3UIQA 3Q22A 4MIAA 1LCUA 1UA0A 1ZBUA 4Q0BB 2IVFB 1JLAA 4TXSA 2Y0SD 3POTA 1IKYB 4CGIA 4CO3A 3O9QA 4ECWA 3THVA 3OVBA 1KC8O 1NNEA 3I32A 3GV5B 4AL7A 2CPXA 3HZGA 4CJEA 4Z4IA 1K1SA 4NXMF 4RW7B 1YUWA 3G8SA 4TYBA 4FNIA 3UDVA 1QAXA 4X66J 1VSFA 3ZETB 3SUNA 2U2FA 5A2QY 1NGIA 4OI4A 2LMIA 1RT7A 3OYNA 5KFJA 4NLOA 4USIA 4NLQA 3UDCA 3JS9A 4J9QA 4GKJK 4FYWB 5HROB 4YR3A 4J2AA 3TAEA 2CPZA 1JK9B 4QU7A 2E2OA 1S7HA 1BHLA 4LVOP 4F3QA 3ENQA 3R2CJ 5BPNA 2P9IB 4DR6K 1LAWA 4CIEA 2UUCJ 1CZAN 4G1IA 2ZKUA 1VGYA 1HPMA 3P96A 4X4NA 1B70B 3E1YA 3W5XA 5CZ1A 2EKNA 2HHWA 1KLMA 3BKUA 2KT2A 2K7JA 1OIAA 3PACA 5AZIA 2G8UA 4ILRA 2NXEA 1RT4B 4DV1K 5K9FA 1YG0A 1UKUA 1NU4A 3KLIB 3DXMB 1ITPA 4NXNK 1CQNA 1H0HB 5E33A 1HBOB 2F40A 3F56A 2HZAA 3QPIA 4DFMA 3JYTA 4M3YA 4QU6A 3VAJA 3H1VX 4HL9A 2G8KA 1YRTA 4B1UB 4X4PA 3NEKA 1PYSB 1UOCA 2VODA 3CC4N 2YTCA 1QUPA 3J7AN 2X7IA 4H5VA 4EMDA 4H4OA 1ATNA 2FUG9 3PKYA 2VH7A 1DTTA 4CWBA 3R6GB 1RDBA 4RNFA 3BB5A 4CE9A 3M30A 1HNIB 1S6UA 2HGLA 1HFEL 3OBYA 3CJKA 3OVAA 1QHAA 5FD1A 5FLXU 2BANB 4OZLA 4N8OA 4F2RA 3NGTA 2NR0A 4EWTA 3CETA 4A4JA 4NYOA 2I5JB 3CCQS 3RB3A 3CC7N 2E29A 4DR6J 1VQ9S 4PCQA 4JRPA 3H5SA 3R5JB 4OYXA 4DR4J 3F2KA 3PLAA 1HKBA 4M3XA 2QE5A 1EQYA 2CFXA 2OIHA 4PL7A 3ZTSA 2H65B 2GNKA 2GQCA 3CJ3A 2DD8S 4G1QB 4RUBA 4DV1J 1YSJA 5DLFA 1C0TA 4JI6F 4NCGB 2ASPA 1SJFA 2A2CA 2FYXA 1QE1B 3MAHA 3JXUA 4FDFA 2HQGA 4HHUA 3D6FB 3QEWA 2NSBA 1OSDA 3RZAA 2V94A 2V50A 1XMOF 4CEAA 5AXNA 4IJAA 4KHPK 2P9UB 3WXKA 2QZ8A 3R6MA 5DDPC 2G0CA 3ZZZA 2HS0A 3L9ZA 2XCAA 3NGZA 2MQPA 5IV3A 3ID6A 1NKCA 2OD6A 2FHJD 4LY7A 2LA6A 4KHYA 1I6JA 1GK8A 3OXFA 4MAKA 4UQTA 1BMQB 4JI7K 1RHKB 4LSNB 2X74A 3ATVA 3K8VA 3NBPB 3D28A 4CO0A 1DQ9A 4B02A 5LMUK 4JI4J 1FDDA 1DGKN 3HM9A 2V2QA 2KLAA 2PY5A 2P5VA 1DURA 3EWGA 4R25A 4J9LA 1R8HA 4BR4A 2B6AA 1RAOA 3MR7A 4IG3A 4RW6A 1YVNA 5B09A 4LF5F 3J80O 1HLWA 1X0FA 1HNVA 3OL7A 3VCDA 5KFLA 2ZD1A 5J2MA 4DU1A 2Z1HA 4O0IA 4CLFA 4JV5K 4KHNA 4ID5A 3ZSRA 2AEJA 2QXFA 4DV4J 3BPSP 2XQCA 2J0QD 2Y9HA 2GA7A 3Q83A 1JJ2R 4QW8A 1T94A 4F8RA 5E84A 4OX9J 4LF4K 2GVZA 4I2PA 1UFWA 4FPAA 1WG4A 4CIGA 1WBBA 4DZ6A 3M32A 3C94A 4Z7YA 1S1TA 4BRNA 3TP2A 4OGEA 1DJ0A 2VQEF 1KAXA 3AVNA 4J9NA 2VYPA 3NNAA 4U67Q 3DCAA 1SKWA 3B6OA 2W2PP 3UB5A 1JLBA 4Y28C 2P2CB 2BJDA 2ILZA 5BN9A 1RAJA 1N0UA 3G2XA 1RWVB 5KFXA 3DLHA 4ATNA 2CQ0A 2K3KA 2D7SA 1XR7A 1S6PB 4ZVEA 4TY8A 1XMBA 2UXCK 2C2KB 4R8UA 4MDAA 4JKAA 3DRYA 2CJYB 3I33A 3T19A 5AZJA 4QWAA 2W2OP 5B0GA 2DGUA 1EETB 1U24A 5F2RA 3IR5B 1HQUB 4OJ3A 3AXKA 1S9EA 4JI0J 3KD5E 3QZ8A 5FROA 4QR2A 3VOVA 4RTFD 2H5IB 1MWQA 1FX2A 1IWGA 1IBKK 1XR6A 3L8BA 4ZVQB 1KFSA 4EFHA 4OJHA 2FJXA 3IBCB 3LAKA 4CZKA 4PG4A 3AH6A 3P4IA 2P9PB 3C2PA 4O8UA 4I7FA 3T1YF 4B3RK 3HOSA 4JI3K 2NNWA 4Q8FA 1LFPA 3BV8A 4WZQA 3Q7CA 3NWGA 3MAAB 1GLDG 2EHGA 4FWSA 4JAXA 4KTWA 3SQ2A 3S01A 4OZ3A 3I0RB 2H1YA 3ENBA 3QZ7A 2CG4A 3C19A 2MHNA 4JI5J 3QLHA 1NZ8A 3LH2S 3G6XA 4JI1F 3D2EA 3VETA 1BY9A 3MEDA 4I6MA 2O4GA 2WUSA 2QA4G 2CQBA 3AJ1A 4BRFA 5CHIA 3TO8A 4NI2B 3GZ7A 2B9EA 3WC0A 3T7ZA 3AY0A 3D6RA 5AQMA 5DO2A 2P5OA 1SCJB 2XSJA 3VF6A 3I5CA 3J81Y 1MU2B 4YQWA 3WXIA 3NCQA 1IV0A 1ULRA 3M6UA 1Z25A 2UVRA 4BG9A 1X9JA 1FK9A 1N54B 2LA4A 4MK7A 4ZP9A 4E19A 1Y97A 1LW0A 2O5DA 1IR0A 4DV5K 2IM2A 4YOVA 2AA4A 1FFGB 2NSCA 2MZ1A 4DX6A 5EX3A 2YHXA 2R7VA 1TL1A 5LJWA 4BRGA 3A8KA 4XDDA 5M2RA 1ZM3A 3KLFA 2AEMA 3MR3A 3SPZA 3QNWB 1VYAA 2HQ3A 4DN0A 2W40A 5BRFA 1S9GB 3P5TL 1K73T 4IWVA 3CUNA 2QIFA 4QIGA 3QICA 2VA2A 1C1BB 4BRKA 3IR6B 4JK9A 1D09B 5ETOA 1RT1B 1NNDA 2ZWOA 4OI0A 4TVAB 4ED3A 2VG7A 1F5BA 3TUZC 1YHQN 5K14A 1FW6A 4B08A 3ELHA 1U1KA 4CLKA 4KV8B 2E5IA 1HR0K 5J1EA 2DISA 3G0ZA 3ZXWA 3ZNJ1 4DOZA 4ANCA 3V6JA 5EUHA 4X4UA 1S4FA 2EBEA 1FRXA 1KAZA 5KOWA 1R0AA 2RUSA 1VK3A 2ZBQA 2G8WA 2YNGA 3CFRA 3TR8A 2P6SA 1DT9A 2HEKA 4HYKA 1VSLA 1RA6A 3MECA 4M3WA 3DRSB 5CAAA 1CLFA 4IFVA 3PO4A 5FIIA 1WSGA 3O4NA 1TKZA 1MA9B 2BOAA 4ZP6A 2IRUA 4NA2A 2PYLA 5EX5A 2Y3YA 3CDBA 2GBZA 2BGGA 2KZZA 3EVOA 4P2XA 1JXLA 4CD3A 1OPZA 2QC3A 3OFGA 1QLNA 5D4OA 3QRPA 2CQ3A 1VSJA 1VIXA 2KJWA 4OI3A 5JMVA 1VQ6N 2D0CA 3VERA 4DL4A 4F4WA 2HAFA 3UN2A 4CGGA 1ZAWA 3V81