1JLCA

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with pett-2
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
547
structure length
534
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords HIV-1 RT A-chain
total genus 130
structure length 534
sequence length 547
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlcA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlcA05
1W0HA 4EP5A 1VRUB 4DFKA 2D5RA 2OPSA 2J6TA 1A5XA 2Y1IA 4ZP9A 3D5MA 3VQ7A 3KLIA 3VA0A 4KI4A 3VQ9A 3VQ4A 5KFBA 5FRMA 4DTUA 3DMJB 3CFOA 2VWJA 3K5NA 3OYIA 2Z1HA 4Q44A 1C0TB 2YNGB 4GVMA 5F8GA 1NJXA 2VWKA 2DFFA 3QO9A 1QAJA 3M8PA 4RW9A 1S0MA 1S9GA 2Z1JA 4NLWA 2HAIA 4FLTA 3OL9A 1HQEA 4YP3A 3NF9A 4M41A 3VN5A 1NOYA 4ED0A 3I0RA 3KKRA 3OL8A 5L1KA 2XI3A 2JLEA 3RMBA 4C8LA 4IDKB 5HLFB 4KI6A 4RW4A 1X9WA 1BI4A 2HHUA 2W9CB 2HHQA 1WSGA 1IKXB 2OZSA 4DFPA 2G8WA 4CJ5A 4NLSA 2YNGA 4IRDA 2VG6B 2X6NA 4FJLA 3ZSRA 1HYZA 3MEGB 2IM2A 5EWEA 4PA1A 3GQCA 3SPYA 3C6UB 4ED1A 4ZVEA 4KTZA 1RYRA 5KFEA 2AGQA 4HUFA 3QGHA 1MMLA 4HUGA 3KHRA 2G8FA 3L2UA 3V4IA 1VRUA 4CEOA 5KT5A 4C8KA 1VSHA 4CHQA 4ECXA 5KT7A 3GYNA 5HP1B 3TAQA 4FS1A 3I0SA 1JLGB 5KG4A 2JGUA 1RT5A 3AVNA 3SI8A 4KHWA 3SQ2A 1EP4B 1DTTA 5KFYA 1WAJA 1RDCA 4NCGA 1U49A 5FDLA 3RAXA 3HPHA 3RB3A 4DL7A 4MFBA 4RW8B 2XWYA 3OHAA 1KLMA 4WE1B 1JLBA 4H4MB 5JUMA 3PHEA 3UPFA 3OYGA 3AVMA 3WNGA 3IS9A 3LDSA 2WOMA 5J1EB 4KRFA 3EPIA 1LV5A 1SKSA 4FW1A 1WN7A 4IFVA 3HP9A 3OJUA 3OYJA 3ZT1A 5HROB 1TV6B 2IC3B 4H8KA 2XHBA 4EBDA 2XY6A 3V9XA 2KW4A 1ASUA 1JKHB 4CHPA 1HNVB 3THVA 3Q8PB 3MXIA 1DTQB 4DG1B 4JV0A 2W9BA 1BGXT 1IKYA 1JLCA 1C1BB 1NJZA 3L2RA 4KTWA 4N5SA 5C24B 5KRSA 4LSLA 4YFUA 3ZT0A 5D3GA 1JLEB 1VSLA 4IR9A 3VQ5A 4F2SA 4CJ4A 1RA7A 4E3SA 3CDEA 1ZYQA 1RT7A 4B3OA 2FJWA 4QAGA 4DTJA 3JSMA 1QSLA 2R8HA 4MKBA 4FBUA 4W5QA 3AO2A 1XHZA 3CIZA 1KFSA 3NGYA 2XCAA 4CJQA 3AO3A 2KQ2A 2XI2A 4HHTA 2FBYA 1XR7A 2R8GA 4OKKA 5HRPA 3AVLA 2BR0A 4DWIA 3AVBA 3SNNA 1K1QA 4F4XA 1RT7B 4B3OB 4N76A 3PX4A 3GIIA 4JS4A 2OH2A 3BQ1A 1EKEA 2AU0A 2KFNA 1UA1A 4HKQA 1ZTTA 3CJ4A 4K4TA 2ALZA 1TKXA 5HRNA 4HTUA 2R8KA 4O3QA 4J9LA 1RDRA 2QV6A 4NYZA 3LP3A 4O4GA 5J2QA 1VSDA 1C6VA 3OYHA 2FLPA 1IKYB 4N56A 2UVVA 3MTKA 1RT4B 4DG1A 1ZBIA 3CM6A 4HVJA 4JS5A 2JEFA 1HNVA 2PYJA 4KHUA 4F3TA 2E4LA 4KHMA 4E7IA 3DOKB 4KFBB 4F3OA 1U47A 5CYQA 1WSFA 1NKBA 5KG7A 5CZ1A 1TGOA 1O1WA 4IFVB 3BDPA 3H4BA 3DLEA 4J9NA 4XIUA 3OL6A 3DLBA 4B9MA 5J1EA 5KFFA 2HMIB 1TL1B 4GW6A 3IS9B 1RDAA 4TSXA 4DTSA 4FK4A 3HKWA 4ZP8A 4K50A 1S9FA 1ITGA 4EP4A 2ZD1A 2GUIA 5EU7A 4F4YA 4MFBB 4RW8A 3NF6A 3BREA 3HL8A 4OLBA 4X2BA 3OYNA 4XPEA 5KFAA 1T03A 3FFIA 3EPGA 4R5PA 5KG0A 3V6HA 1RT5B 5KGXA 3SJJA 4FLYA 3KK1A 5HP1A 4RW6B 1J5OB 2QXFA 3RRGA 3QESA 1NK7A 4Z4IA 4WFYA 2XRIA 2B43A 4NZ0A 3V6DA 2FBVA 3PO5A 4OKEA 4Z0UA 3GIJA 1DLOA 3VQQA 3QYYA 3L3UA 4ECZA 1HMVA 2E9ZA 3RMDA 2IJFA 3MEGA 4QWBA 4CJSA 3M9NB 1VRTA 3LP1B 3TAMB 5L9XA 5KFMA 4AHRA 3UIQA 1S6PB 1RT2A 3KK3A 1L3VA 4ZTJA 4ED7A 4CFAA 3D0PA 3AA3A 3G6XA 4NRUA 1S6QA 2W9CA 1ZBLA 4NCAA 4CERA 4CEAA 2JC0A 4URSA 4G1QB 1XC9A 4NRTA 1L5UA 2Z1GA 5F8MA 3PW5A 2ASDA 1TAUA 3I0RB 3MAQA 3KTQA 2RDIA 2IMWP 3QETA 4C8NA 3VQ8A 1BCOA 4K4ZA 4CFDA 4TY8A 4K4WA 2AJQA 1S9GB 3TI0A 4ECWA 3MEDA 3QO9B 2FLNA 2A1SA 4U6PA 4J9MA 3HPOA 3D45A 1D9FA 3RMCA 4O0IA 3NGZA 3ZSXA 5KFIA 4FM0A 3DRSB 4CEZA 3HSTB 4E89A 3LANA 1C0MA 2Y1JA 4WYLA 1SL2A 3H2LA 2RKIB 1R0AA 3KLIB 3IN5A 5F8JA 4Z4EA 3CJ0A 4J9QA 2IGIA 2FVSA 3RBDA 2IA6A 3OYDA 3G6VA 4AHSA 4NLRA 1JIHA 4MIBA 4C8OA 1RTHA 3N6NA 1TAQA 2I5JB 5DGAA 1TK0A 3DLKB 2AX0A 5KI6A 5DGBA 2E6MA 5EWFA 3KLFB 2P1JA 4KE5A 4CJLA 4QW8A 3QZ8A 1S9EA 5FRNA 2DPJA 3WNEA 1HARA 4NLUA 5DQHA 2BANA 4DSIA 5I3UA 4B8AB 2BRLA 4YNQA 5J2NB 3U6FA 5KFUA 5DQIA 2W8KA 5KFGA 1TVRB 2B5JA 4MQ3A 4O44B 4DF8A 4QW9A 3BQ2A 3MR2A 3KLGA 2YNFB 4PQUB 1NJYA 4PUOA 4DF4A 2W42A 1JLQA 4URQU 5KFZA 3L2VA 3ICLA 3M8RA 1D8YA 2ATQA 2XY8A 3NH2A 1NNDA 3NBPB 4BE2A 1B92A 3OLBA 4DQQA 1OS5A 4JUZA 3PVXA 4FM1A 2AGOA 2V4QA 1T8EA 2D0BA 4ICLB 4LSNA 2YV0X 1SL1A 1QAIA 4CEFA 4J9RA 3HP6A 4J2AA 3LP0B 3L2WA 5J2PB 4N47A 4ED3A 4ECUA 1NHVA 1S5JA 4ZVHA 4KHYA 1UOCA 4TQSA 4FK2A 3H5SA 2UVUA 2HB5A 1L3UA 3ZT4A 3CYMA 3KLHA 2YNHA 3DRRA 4E7LA 1GOBA 2KFZA 4R0EA 1IO2A 4ID1A 5J2PA 2G8KA 1SUQB 1FXXA 4J9KA 3QGGA 1KHVA 1NK8A 3QEXA 1HPZB 1QE1B 1X1PA 3QEVA 2J6SA 2OYQA 4RNMA 1S97A 4F2RA 3DLHA 4WFZA 4DSEA 3VQSA 4MK9A 3SUPA 2ILYA 1JLFB 4MIAA 2GIRA 3QLHB 5DG7A 4RG8A 1C0UB 2G8HA 5I42A 3KLVA 1TL3B 4ZHRA 4CEEA 3RR8A 3VQAA 3WNHA 3N6LA 1VSFA 4I9QA 4FJ8A 4M3XA 4ZHRB 1RAJA 1JLQB 3AA4A 1TL3A 3AV9A 4PQUA 4IG0A 3QLHA 3KLGB 2EHGA 3LP2A 2HVIA 1JLFA 1VSMA 4DMNA 3ALYA 4CK3A 2QKKA 3TARA 4OGCA 3MR3A 1TVRA 3TQ1A 4O3RA 4YR0A 1S1WB 3OHBA 4W5OA 4DL4A 3AVGA 4ECVA 2B6AA 3CG7A 1EETB 3O4NA 3V1OA 4CEQA 3S9HA 4NLPA 2W7OA 4M95A 2D41A 4WXWA 2GV9A 1S1XA 1S0NA 4NLTA 2KZZA 3KK2B 3UQSA 1GOCA 3UR0A 3NGIA 4B9UA 3VA3A 1NK4A 1ZETA 4ECTA 5KFQA 1RTDB 5CY4A 3M8QB 4M3RA 3KJVA 4O55A 1BISA 4IOBA 4I2QA 4I7FA 2XCPA 3ZSYA 4KB1A 3MR6A 5DLGA 4ICLA 1W25A 2RKIA 3BJYA 2VA3A 2VA2A 5L1IA 4AHTA 4BACA 3DRSA 4CHYA 4E7KA 1U04A 2FJXA 2P5GA 5KG3A 4FJIA 3AA2A 4LQ3A 4CF0A 4PUOB 2OPRB 4CF9A 1GX6A 4CIFA 3OYCA 3MECB 5CYMA 4J2BA 4KAIA 5CZ2A 4GMJB 1WLJA 2HHVA 3UDLA 2C2EA 4O3OA 1XR6A 3SV3A 1HYVA 5DK5A 4AHUA 3VQCA 4FJHA 5J2NA 2HNYB 3H5UA 1NHUA 3D28A 3AVFA 3HVRA 4CEDA 4I2PB 4FM2A 4FZXC 2R7YA 3KLFA 1LW2B 5T14A 3V9WA 1QUVA 2ZQBA 3IRXA 1ASWA 1CLQA 4BDPA 4TXSA 3KK3B 5KFTA 1UAXA 3G0ZA 1TP7A 3CWJA 1S6PA 4RW7A 3TAMA 2OPQB 4E7JA 1RTHB 3LP1A 3SFUA 2FBXA 4M3ZA 3HVTB 1HMVB 4IRKA 1CXUA 1LWCB 3AVIA 1RT3B 1DLOB 3KD5E 3NF8A 4PWDB 1C1CA 4ZP7A 3GIKA 3T5JA 3V6DB 4IKAA 3NAIA 2PZSA 3ZSQA 2GIQA 2GC8A 4XPCA 1JL2A 1J5OA 2IOCA 3NAHA 4RNHA 3V9SA 5KFLA 3HO1A 5HBMB 4ZPDA 4Q45A 3V9ZA 3MF5A 2X6SA 3E01B 3MFHA 4PY5A 2E9TA 1N4LA 2DTUA 4R5PB 3HVWA 3MEDB 4YQWA 3T5KA 5KFOA 3FFIB 3PO4A 1T03B 2FC0A 2FLLA 2C28A 4TY8B 4CFCA 4Q8FA 4DU3A 3QEPA 1C1AA 1RTIB 1ZTWA 3PUFA 3CQ8A 3KMSA 2FJVA 4DQRA 1ZBUA 4FJ7A 4YR3A 1KRPA 4KHSA 2HHXA 3LALA 1WSJA 3IGVA 5KFCA 1IM4A 2HNZB 3CJ3A 4CECA 1S6QB 4KHQA 4CJRA 4CGIA 3DLEB 3AVAA 4ZVFA 3WNFA 2FBTA 4DSKA 1RT2B 4Y2CA 4FLXA 4QCLA 2E6LA 1WAFA 2JC1A 4EYIB 4KPYA 5CYQB 3NDKA 3C6TA 4IH5A 1BL3A 4TLRA 1S1VA 3DOKA 3LAKA 4JRPA 4DQIA 4W5TA 4M3WA 2WONB 2AWZA 4EBEA 4W5NA 3CO9A 5SZTA 2WHOA 1FKPB 2HNDB 3I5CA 1EXQA 3CJ5A 4E0DA 1S1UB 5DG8A 4O4GB 3SI6A 2XC9A 1A5WA 1TKDA 2QE5A 1IG9A 4RW6A 4CJVA 4CK1A 4QWCA 4ZTFA 1JXEA 1TKXB 5JS2A 4J2DA 1YTUA 3GV8B 4DTPA 1JLAA 4CGHA 4M3UA 3BSAA 1Y97A 5F9LA 4QWDA 4OKJA 2ASLA 2WK4A 3KLEB 4JRQA 3OJSA 4WYWA 4M42A 4LY7A 3TR8A 4HUEA 5DMRA 3SQ4A 1Q9YA 3DI6A 1HRHA 2ZD1B 4ZPAA 1RNHA 3VQ6A 1W9HA 4M3YA 4O4RA 2D7SA 2HMIA 1HNIA 3OVNA 3C95A 3PW4A 4KTQA 3DLGA 4CJPA 3SFGA 1T3NA 1SKRA 3KHLA 4ZP6A 3O3GA 3CDWA 4UQGA 2FVPA 3CVKA 2RN2A 3TAPA 4OPJA 3BQ0A 4KAZA 3BGRB 3N6MA 3I5AA 4KFBA 2BGGA 4IQXA 4ID5A 3CM5A 3QGIA 1VSKA 4Y1DA 4DSJA 4E1MA 2D3UA 4KSEB 1RT4A 4IG3B 4KO0A 1WSEA 1T94A 3AA5X 2IAJA 4E1NA 3V81A 1A5VA 4K4YA 1JLCB 3OS2A 3V81B 2QKBA 3HYFA 1QSSA 1S4FA 4IG3A 4KO0B 3OYFA 4ID5B 1FKOB 1N5YA 5L1LA 4WZMA 3HHKA 3BSCA 4IR1A 3QIPB 4EZ9A 4N41A 4NLYA 4RUAA 3FDSA 4Z4FA 1CZBA 4AHCA 4FW2A 2I1RA 1S49A 3DOLB 2XY5A 4OGEA 2WRMA 4C8MA 4ECSA 4B9SA 3VQBA 1HYSA 3P1GA 1REVB 1NK6A 4CE9A 2KZMA 2FVCA 4HCCA 3HM9A 4DFJA 4RNFA 4AHVA 1JLBB 4H4MA 4ED2A 1KLMB 5KT3A 1KVBA 1XR5A 2IBKA 2ZE2A 5J2MA 1S1TB 3QERA 4K4SA 4NCGB 5KFDA 4FJJA 4NYFA 3RBEA 3KLEA 3RB4A 4CHOA 4JLHA 4EBCA 4NLGA 2NUBA 3OYLA 1IKWA 3EZ5A 3DRPA 3MR5A 5F9NA 1JLGA 2ASJA 5F8LA 2RF2B 1YVFA 3SZ2A 4QOZB 4LSLB 4BDYA 1SH2A 3CJ2A 5C24A 3TVKA 3OSNA 4Q0BA 5DG9A 4B9LA 4NLQA 1C1BA 4KKOB 1S1UA 2HNDA 1FKPA 3K5MA 2D0AA 1DTQA 4CGDA 3O4QA 1QHTA 3LWMA 1NK9A 2UUTA 2J6UA 1S1VB 2ETJA 4B08A 2V0NA 3RMAA 2C2DA 2IC3A 1TV6A 1LWFB 3F9KA 3KHHA 2IM3A 3K2PA 3B6PA 1L3TA 1J53A 4O3SA 1QSYA 1QS4A 3KHGA 3RRHA 1TKZB 4JV2A 5KGWA 3K57A 3ASMA 2G8IA 1J9AA 3V1QA 2HNZA 4FYDA 3T5LA 4J2EA 5HLFA 1RDDA 3OY9A 4ELTA 3U3GA 3C94A 4WE1A 3PJXA 3T19A 4CJWA 1RTIA 1HQEB 2DFEA 5EWGA 5FDLB 3IG1B 4BE1A 4HCBA 4CJKA 2B4JA 1DTTB 4RW9B 1EP4A 3M8PB 3S3MA 2Q3SA 3E01A 2JEIA 3G10A 2HWIA 5HBMA 4Q8EA 3I0SB 4FZYA 1C0TA 4F50A 1RILA 3L3VA 3V4IB 4LD0A 2YHAA 3OYAA 3OS0A 4OVLA 3VQPA 4DQSA 1SL0A 1EX4A 2JEJA 4CHNA 1C1CB 3FRZA 3NGDA 2WB4A 4Q43A 4DL2A 2X74A 3K5OA 1RT3A 3C6UA 1JXBA 1LWCA 2O4GA 3KIOA 5FROA 4FLVA 1U09A 3OYEA 1K6YA 2FVRA 1C2PA 4DU1A 3HVTA 2W9AA 3LPTA 1RCHA 3QEIA 4O5BA 4CIEA 3LWLA 2HWHA 4RW7B 3NH0A 4FZZA 2VG6A 3NMAA 4LH5A 5L1JA 3IRXB 3NH1A 1IKXA 1BI4B 2O5DA 1D9DA 1F21A 4RW4B 3P83D 1GX5A 4IDKA 4I2PA 4ZVGA 4R8UA 5KG6A 3IG1A 5KFXA 3VQEA 4FCYA 3LAMA 4DTRA 2BQUA 2PY5A 1J54A 3QIOA 4FLWA 3V6JA 2Z1IA 5F8NA 3V9UA 1TKZA 2OPRA 1LAVA 2RPIA 2W8LA 5KFWA 4ELUA 1FK9B 3ISND 3FQKA 4DFMA 1JXLA 1LWFA 4WZQA 4G3IA 3DMJA 3H40A 1RT6A 4RZRA 4CGJA 4DLEA 2G8UA 1SH3A 3PX0A 2IJNA 3I5BA 1KVAA 3QZ7A 4DS5A 4F4KA 4CF1A 4CJEA 4I2QB 4I7FB 1Q8IA 1X9MA 3SUNA 3KJVB 4KKOA 2OPSB 3H4DA 3M8QA 4LH4A 4Q0BB 1RTDA 4MKAA 4NLDA 4Y3CA 4O3NA 1WSIA 3B6OA 4DTMA 1X9SA 2RF2A 1MU2A 3HVAA 3TAGA 4KV8A 5DLFA 4Y1CA 4DS4A 3CFRA 4E19A 4GC7A 3DRPB 3KK2A 2XO7A 3LPUA 3A2FA 2R2UA 1IKWB 2HHTA 1LW0A 2ITGA 3L2QA 5KFPA 2BDPA 4TYAA 4OL8A 3DYAA 3RWUA 4ECYA 2VG5A 4EEYA 3LZJA 4Z4CA 3OS1A 4H4OA 2R2RA 2G8VA 1S1TA 5J2MB 2ZE2B 4JV1A 3AO1A 4B9TA 2XGPA 2YHBA 1SV5A 3AO4A 3MEEA 1S1WA 5SWMA 1K1SA 1RBUA 2V9WA 4K8XA 2JEGA 1D5AA 1REVA 3EYZA 1HYSB 3RTVA 1BQNB 5KFNA 3DM2B 3ITHA 4IG0B 3AVCA 4QWEA 3DOLA 3QIDA 3KD1E 3QIPA 1KTQA 1B9FA 5KT2A 1KVCA 4BE0A 4WXOA 2C22A 1N5YB 4FJ5A 1FKOA 4OLAA 4CJUA 1RT1A 2R2TA 1S48A 5KTQA 3O3HA 1RYSA 3NE6A 4ECQA 1TK5A 2ZKUA 3H5XA 4DSLA 5T7BA 3ZSOA 2BQ3A 2X78A 1KLNA 2IAJB 2E9RX 1SUQA 5F8IA 4DTNA 5EUHA 3KLHB 1NKEA 3VQDA 3IGNA 4CGGA 3BGRA 4FJMA 4EZ6A 1RA6A 1HQUA 2ILZA 4YMEA 5KFSA 4O0JA 3PW0A 2BE2B 4Q5VA 3Q8QB 4W5RA 3DLGB 2FVQA 4FK0A 3KOAA 4ED8A 2VG7B 1HNIB 4DL5A 3FQLA 3TWHA 3PJWA 3CDUA 1WNEA 3NF7A 3DI6B 4CHZA 2YKNA 5KG1A 1CZ9A 3JYTB 4XO0A 2YKMB 3U3YA 5C25B 3KMQA 4FLZA 2IM0A 5KG5A 2OA8A 4IKFA 3ZSZA 1T05B 1I6JA 3RB6A 4AH9A 3SQ1A 3ULDA 3H5YA 3O3FA 1GOAA 1KFDA 3H08A 3ZT3A 1JLAB 1RTJA 4URGA 2YNIB 1XWLA 1CSJA 3AO5A 2B5JB 3DLRA 4B8CA 3SUOA 4DQPA 5KFJA 4CF8A 4FJNA 1JL1A 1U48A 2BANB 5JXSA 3LZIA 1BQMA 1SH0A 1LWEA 1KSPA 1U45A 1S10A 1S9EB 4CF2A 3ZSVA 2WONA 1TK8A 1LAWA 3OYKA 4DTXA 4QWAA 1UA0A 3C6TB 3ISNC 3I8DA 2I5JA 4CGFA 3SPZA 1UWBB 1L3SA 5K14B 3L8BA 2F96A 3H59A 4I9LA 2OPPB 3PV8A 4K4VA 3NFAA 1TKTB 5C42A 2HHWA 2HHSA 1NK0A 3SQ0A 3PW7A 4ED6A 4NLVA 2W7PA 1N6QB 3AVKA 1CXQA 1I3AA 1R0AB 3PX6A 3S3OA 4DTOA 4MK7A 3ZSWA 1XI1A 1Z26A 1SKWA 4KREA 1TQLA 4TN2A 4IFYA 4QPXA 1JX4A 2F8EX 2UVWA 2P51A 1IKVA 4DLGA 3PY8A 4M94A 3AVJA 1ZBHA 4U7CA 2XY7A 4ELVA 5KRTA 4DSFA 3CFPA 3OLAA 1YT3A 2GBZA 3OL7A 4F8RA 3EZUA 1HJRA 4K8ZA 4FJ9A 3MXMA 4RNNA 3RB0A 3OSPA 2CKWA 2BQRA 2LSNA 4K4XA 1N6QA 4PWDA 4ZPCA 3V1RA 2HVHA 2IS3A 3HK2A 3GIMA 4G1QA 4CJTA 3HT3A 5C42B 1QTMA 1RBRA 4FJXA 5F8HA 3GV7B 3NL0A 5KFVA 2KTQA 4FJGA 1VSIA 2OPQA 5K14A 4J9SA 1UWBA 1VRTB 4E7HA 4NCBA 1G15A 3QINA 4TYBA 1BIUA 3BSNA 1LW2A 4BDZA 3RAQA 4Z4HA 4CJFA 3TABA 3MFIA 4CIGA 5EDWA 1LWEB 3OYMA 4FS2A 4CCHA 2HNYA 2WCXA 2PYLA 4CESA 4H54A 4RU9A 4AILC 4EO8A 1RDBA 2V4RA 1YVUA 3Q8SB 2UVRA 2R8IA 4KHRA 4IBNA 3KK1B 1NOZA 5CYMB 3MECA 3PR5B 4CJ3A 1RTJB 3BSOA 4L8RB 4DU4A 2A1RA 1IKVB 4CEBA 3T5HA 2IDOA 4DL6A 2YKMA 3PR4A 3FSIA 4IFYB 1RBTA 4KB0A 3QNOA 2AQ4A 1WSHA 1BHLA 2UUWA 3ZCMA 1RBVA 1Z4UA 2EX3A 1BCMA 1TL1A 1XHXA 2VG7A 1S0OA 1KCFA 4MH8A 1TKTA 3IAYA 5KT4A 5KFKA 3SV4A 2OPPA 4MK8A 3Q8RB 1U4BA 3SYZA 4ZMMA 2DY4A 3MXJA 1HQUB 3M8SA 5KFRA 4EO6A 1NKCA 3AVHA 1S1XB 3G86A 4BWJA 1WNSA 2C2RA 4TQRA 5KFHA 3RR7A 1BQMB 2QK9A 5E41A 1EETA 4IH6A 2B6AB 3NCIA 5J2QB 2O4IA 3OYBA 2F8SA 4KB7A 1RT1B 1NK5A 2R8JA 4IRCA 3ZT2A 4CK2A 2YNIA 4DEZA 3NHGA 3LP2B 4K4UA 4TY9A 3DDKA 1T05A 3M9MB 3PZPA 1VK0A 4IH7A 4LQ9A 2D0CA 4WFXA 5C25A 3HXMA 3S3NA 3TANA 5I42B 1C0UA 3JYTA 3QNNA 1BQNA 4OJRA 2YKNB 4B9VA 1NJWA 1D0EA 2EC0A 3P5JA 4NLXA 4OPKA 3NKYA 3GILA 4CFBA 2P5OA 1QE1A 4F4WA 1HPZA 5HRSA 2AX1A 1IH7A 4F4ZA 2BE2A 3JSMB 2VG5B 1Z25A 5HRRA 3DYAB 5KT6A 1B9DA 1VSJA 3DRRB 2YNHB 1ASVA 1D1UA 4GC6A 2D3ZA 4Z4GA 1T7PA 1BIZA 3EY1A 2IM1A 1YTAA 3PW2A 1JLEA 4KV8B 1Q9XA 5D3GB 4FLUA 5C5JA 4NYNA 4BWMA 4DL3A 3V6KA 3LP0A 2AGPA 3SUQA 4M45A 4FJKA 2CJQA 3F73A 2W9BB 2DPIA 2RDJA 4LSNB 4HYKA 4Y2AA 1JKHA 3G6YA 1RT6B 2BRKA 4FXDA 1QQCA 2ATLA 3K5LA 2OZMA 4J9OA 3GV5B 3K59A 5HROA 4FVMA 2F8TA 3H98A 3NBPA 1FK9A 3TAFA 2DFHA 3QEWA 3K58A 4FBTA 4KHNA 5JS1A 3M9OB 2WTFA 2YNFA 4YR2A 2HW3A 3ITHB 3DM2A 2WOMB 1I39A 3T3FA 1RBSA 3KKSA 4O44A 3NAEA 5KG2A 3SCXA 5DQGA 4KBIA 3HJFA 3MEEB 1SV5B 3KNAA 4ZPBA 1VSEA 3T1AA 4ECRA 5I3UB 4M3TA 4H4OB 3HPGA 4R8UB 4Y34A 1N56A 4B9NA 4O3PA 4NLOA 4EYHB 1LW0B 2XGQA 1N48A 3TAEA 4RNOA 1ZBFA 1KHWA 3E51A 3DLKA 2R2SA 3BR9A 4J9PA 1MU2B 4RUCA
chains in the Genus database with same CATH superfamily
4P52A 2V2KA 1YF5L 2ADBA 4LIWA 3ZXWA 4DFKA 1YJRA 2OHDA 2J6TA 3T6JA 3N79A 2Y1IA 2WBMA 2ZHOA 2M8DB 5KFBA 5FRMA 4A59A 3DMJB 3CFOA 2R7RA 3QWPA 2EPIA 4LR7A 2Z1HA 2LP4A 2ZH2A 1K8KA 2YWHA 4JI0F 2P9IA 4WQ5A 2V2QA 1NJXA 1NGHA 1FF2A 2AP6A 3QO9A 2CG4A 4ISEA 1RWNB 2EWSA 1NGGA 4CH7A 1W2IA 4LR9A 1HD0A 3RW7A 4NLWA 2FSJA 3MM6A 3OL9A 3QBWA 1HQEA 4YP3A 4M41A 2LVWA 4UTGA 1KD1O 2A6OA 1ESVA 3CD5A 3EZWA 3KKRA 2XI3A 4BC3A 2DR7A 2QMXA 4IDKB 2F9DA 4WIQA 2PT0A 1BI4A 1WSGA 1MSWD 5GMDA 3HSCA 2OZSA 4DFPA 2Q3PA 1DEJA 2YNGA 2VG6B 2CGLA 4DR5J 2ZH7A 3ZSRA 4DUZJ 1Y3KA 3MEGB 2CJ9A 3CETA 4I6WA 3CIMA 5B0DA 5CR4A 3C6UB 4ZVEA 3GFHA 5KFEA 4HUFA 3JSRA 3QGHA 3M32B 2VF3A 4W90B 2A10A 2E2PA 2GZOA 3F44A 2N7YA 2XLJA 1VRUA 2L9DA 3HD2A 1CJVB 5KT5A 4C8KA 3GYNA 5HP1B 1YK9A 4C0BA 2PAVA 1JLGB 2ZFHA 4YDUA 3OR1B 2N7CA 3I96A 1VQ5N 5CZXA 1HHQA 1DTTA 3ENOA 1WAJA 3GIRA 4F7VA 4M5JA 1QAXA 2R7SA 1U49A 5FDLA 4MFBA 1U2CA 4H4MB 3GPAA 2M70A 5LT5A 1N54B 3PHEA 4LJMA 2OSQA 3OYGA 2U2FA 3VAJA 3WNGA 2EEYA 1RCXB 2OTJS 3T41A 2WSCC 1SKSA 4LFBK 4KRWA 3C3LA 3HP9A 3K0SA 2E1ZA 2IC3B 4H8KA 3QT6A 1V3ZA 5A8RA 1DY3A 2DVIA 2IRXA 4BQZA 4LVOP 4NX9A 5H9FJ 1S7HA 1VI7A 2QA4N 1BGXT 3PIPQ 1C1BB 4DCJB 3K17A 2K8GA 1WC3A 5C24B 5KRSA 4CRJA 4ZPWR 4NA1A 5ETRA 5CXTA 5D3GA 3WC2A 3DLLL 3CJ1A 1E6YB 2IDEA 3VQ5A 4U8YA 3IFEA 3NVKA 4ALZA 4DKWA 2DR8A 2RSQA 3M6XA 4H0VB 2MKSA 2PMHA 3MCNA 4FBUA 2WBNA 4G1IA 3AO2A 2EFOA 4F25A 2DGOA 1OYEA 3P49B 2DT9A 4ZPVR 3CCLN 2X51A 3CJBA 2BE9B 1T95A 2QL9B 3HOSA 3G6ES 3QSIA 5AQOA 3QGPA 2FBYA 3R8EA 1HWUA 1VMBA 4P73A 4QZVB 4CLFA 2NSCA 4B3OB 1F1BB 1CG2A 4X4PA 3GIIA 4CTAA 2NQPA 4JYAF 1U7LA 4CZMA 1BD6A 4HKQA 4V1Ak 4GMKA 3M8YA 3GJRB 2RHQB 1NRKA 3CT9A 4RX6A 2NCKL 1MDUB 3Q24A 2E1CA 1C6VA 4H5NA 3OYHA 4J91A 2FYXA 4N56A 3NGSA 4L73A 2UVVA 1OQ3A 4XH5A 2KHOA 4FZVA 3BGFA 2JEFA 1HNVA 3NNAA 2NUHA 2GWKA 2Z56B 4F3OA 1U47A 1HBMB 3J80U 5C15A 4FKYA 1NG9A 3R5GA 4WCEL 4IFVB 3H4BA 3C65A 5KPZA 4YOUA 1TL1B 1RDAA 4PRFA 2RU3A 3N4PA 2GUIA 3PIOL 3QQCD 5IOLA 4PKDB 3F9MA 1RISA 3HL8A 4X2BA 5HMZA 4B3TK 4XPEA 1N36F 5EX3A 2KM8C 1UZHA 1XNQF 3BKTA 3EPGA 4NO7A 1RT5B 1HQ2A 3R5AA 5KGXA 1HLWA 1X4HA 3MAHA 3FBFA 3L4IA 4P6QA 4CO0A 1UVNA 3CJCA 1M5PC 1B3TA 4RW6B 2QXFA 1O6XA 1S5ZA 2GFFA 3QESA 3PKYA 1LFWA 2FBVA 2XMWA 2LDIA 3AQPA 4ZVRB 3Q2TC 4OQJA 1NSPA 3QYYA 4OFZA 2XYHB 4ECZA 3H2VE 2E9ZA 1RXOB 2J7WA 4W98A 3CF5L 2YHXA 3PFEA 3KK3A 1L3VA 1H2TZ 4ZTJA 3IAM9 4CFAA 3G6XA 1NPKA 3H90A 1S6QA 4JI2K 3BF4A 3B8AX 4NCAA 4CERA 4ZITA 4L3QA 4BRHA 2W24A 2MEWA 5F8MA 1M0SA 4JK8A 2R7VA 5FLXO 5T7LA 3I0RB 2G0IA 5B0AA 4YOYA 3FZLA 2RDIA 4K4ZA 3MK6A 2NRXA 2F40A 3WX8A 1S9GB 5GAEP 3AAQA 4UOGA 4QQBA 4FXWA 2CQPA 2BTFA 3P6YC 1R31A 1VQ8N 4J9MA 3HPOA 2A1SA 3RMCA 1R8PA 4A47A 1XMQK 3NGZA 4DCOB 4PZVA 5KFIA 3CJ8A 4CVNE 1AXQA 3EX7B 3KJNB 4PXBA 6AT1B 2XM3A 4NXMJ 2J0XA 4B3SK 1SL2A 3ZX0A 2KB2A 3ZFVA 5ADXH 2IGIA 3D1OA 2FVSA 3LM9A 1N32F 2VFUA 3GR1A 1NGJA 2K2PA 2IA6A 3TOQA 4NLRA 2J76E 1MROB 3N6NA 2J0QD 1TAQA 2OKQA 1SC3B 2AX0A 5KI6A 5DGBA 2RQCA 5EWFA 2LDYA 1V4TA 3KLFB 2F4FA 2FTRA 1H73A 2MQMA 2O01C 3HSDA 1GLJO 5DQHA 3IWXA 3NMUA 3U6FA 2KXNB 5KFUA 2HVDA 1N0UA 4I1TA 4MQ3A 4P72A 3ZX3A 4MIWA 1N5SA 4O44B 3RBXA 4QW9A 2CJXB 1FNXH 2N4CA 5CCMA 4PUOA 2LXIA 3ILIA 4K41A 2ZWOA 4ZDNA 1OH5A 3HHEA 3OFGA 4R0JA 1NNDA 3NBPB 3OLBA 2CWXA 1K9MO 1Z2ZA 1WG5A 1T8EA 5AQHA 2D0BA 3VGKA 3GCXP 1HIYA 3EDRB 3CCQS 4USTA 3OT9A 1CLFA 1SL1A 3J81U 4JKHA 3OBIA 2RS2A 1HNXJ 5IC6B 3TTDA 3LP0B 2LA6A 5J2PB 2UXCJ 1ELOA 4GRSA 3D6HB 2HB5A 5BRDA 2N4DA 3NOGA 1Q81O 4OI4A 1QM9A 7AT1B 3E66A 3KLHA 4GKJK 4LF6F 4P9SA 1DFDA 4FYWB 1SUQB 4DV4K 3SSSA 4J9KA 1KHVA 4RL1A 1NK8A 3EDQB 3QEXA 3BKFA 1HPZB 2HZCA 5FIIA 3RBZA 3G9CA 4RNMA 4JV5J 4DR4K 1QTNB 1TFYA 3SUPA 2ILYA 3TX8A 1JLFB 3AHPA 4KGVB 3KLVA 1TL3B 4ZHRA 1MWZA 4KYZA 3MCPA 2DGQA 4ZHRB 4QR2A 2ZVIA 1VSMA 3ALYA 4CK3A 4WCEQ 3TARA 4OGCA 2Y1LB 3G8SA 2VL1A 2NXNA 3JS6A 4CYUA 4W5OA 3AVGA 2B6AA 4CO3A 1KQSR 3CG7A 1EETB 3O4NA 4CEQA 3AD9C 5D0RA 3D6TB 4FF4A 2ZVSA 3K89A 4FVCA 3HSZA 4R25A 4Y28C 2OMOA 4A48A 1SJRA 4KH5A 2HHHF 1WBDA 1G7CB 4JI2J 4ECTA 3M8QB 1FTCA 3ZZUA 4PEOA 3DFEA 1F3VA 3KJVA 1XNQJ 5EHHA 3HI9A 2IVFB 1BISA 2HYIB 5IZHA 3M30B 3M1VA 3ZSYA 3BKUA 3PJ9A 3MR6A 2XTJP 4ICLA 3CC7N 4NASA 4AHTA 2OFHX 3DRSA 2IBOA 5DDOC 4BACA 1O8BA 1UFLA 4CZIA 1JB0C 4N8OA 2QM1A 2IVPA 1PGZA 2JJ4D 3SLCA 3QJJA 3MECB 1Q81T 5CYMA 4GMJB 2D69A 1RTZA 2C2EA 4O3OA 1XR6A 2AD9A 2FF3B 2HQDA 2X3DA 4HTLA 2HNYB 5H9EK 4LT6A 3D28A 1XNQK 4I2PB 4B3TJ 1F6TA 1WHWA 3B54A 1Q5YA 4LBIA 3C46A 4LF8F 2DB1A 3C6HA 1CLQA 1KVJA 2KXHA 3G0ZA 1TP7A 4WP8A 4RW7A 1F5BA 3VAFA 2KHDA 3VGUA 2MY7A 2NYIA 3G6EN 1B0TA 2WVBA 5FPEA 4IRKA 3NP5A 4D3HA 3U9DA 1RT3B 1QQNA 4DCHA 3NF8A 3UD5A 4PWDB 4BQLA 3V6DB 3NAIA 3VTIA 4OJ3A 4CBXA 3IA0A 2GIQA 2YKOA 4LF5F 1J5OA 2Q66A 1VBZA 1NSQA 3WQPA 2DGVA 2UUBJ 1JJ4A 2P9LB 3E01B 1WC5A 4F0HA 2HF4A 2XSJB 4DV3F 1N33K 3FFIB 4DV6J 1T03B 2FC0A 3U9ZA 3M2RA 2DH8A 4DX8H 3PHTA 3QEPA 1C1AA 1RTIB 1Q86O 2MZ1A 3CQ8A 3HFZB 3DRYA 3WEEB 5GVQA 3R5BA 2HHXA 2DRAA 4IO1A 5KFCA 4KHQA 4ZPTR 4DR3J 4CJRA 3MM9A 3BZQA 4JI3J 3DLEB 3AVAA 2CPEA 1YRXA 2ZITA 4K2XA 1FJEB 4EYIB 5CYQB 2BJDA 5ETKA 1BL3A 3G87A 3K8VA 4TLRA 2ATCB 1CULA 4OO1J 4WQ4A 1WG4A 4ANCA 2H4YB 2WONB 4EBEA 3CO9A 5SZTA 2BYCA 3W64A 1KOHA 2WB1D 3T6BA 3AY0A 3CJ7A 4GKKF 4QYRA 1S1UB 5LJ3Y 4NL5A 1TKDA 2ZNZA 1ZBSA 4DR7J 5JS2A 4J2DA 2COLA 1FEHA 1JLAA 4KPCA 3BSAA 2NUUG 2NXCA 3AJ1A 4OKJA 1N34F 1VQ7N 1QVFR 1RP5A 2KVQE 4BC5A 5DMRA 5LOQA 1VBXA 3PKMA 1HRHA 3DLJA 1N5VA 5A2QY 5LY3A 4GO7X 1JJHA 2D7SA 1MMNA 1SJQA 2QSFA 3BYPA 2DR5A 2PC6A 4OHZA 1X0PA 3TJ9A 1X7VA 2B4VA 2VB6A 3MMBB 2G1DA 3M8ZA 1LK5A 2KG0A 4C3MA 3BQ0A 4KAZA 4GKKJ 4DN0A 4H0PA 2BGGA 1GTHA 4IQXA 1SJ1A 3QGIA 2WZ1A 2CJBA 1VSKA 1Y64A 3A3NB 2D3UA 2KI2A 4KSEB 4KO0A 3AA5X 1U2FA 2Y0BB 1RWMB 2ZJPL 2MHNA 5C0YA 3V81B 1V4SA 3N5FA 1S4FA 3M1FA 2L48A 5CA5A 2FXUA 5BREA 4OYZA 1NAQA 2WVDA 1N5YA 4F02A 3ZZRA 1YKWA 2DNYA 1HBNB 2RUGA 1CPZA 1VGYA 1H1VA 1CJKA 4Z4FA 2KKHA 1H38A 2O1PA 4IDHA 2NXUA 2I1RA 1S49A 2P9PA 2XY5A 2WRMA 4FPRA 1SQFA 4IJNA 1HYSA 1OO0B 2F7VA 4EK2A 3EVOA 2FVCA 2NRRA 4BR0A 1U6ZA 2UXDF 4DV2J 4RNFA 1KLMB 4HACA 1HJOA 1PYOB 1XR5A 4USMA 4C2MA 3N5BA 1H3DA 3DC2A 3RB4A 1B7YB 2VIHA 3OYLA 4DZ6A 2QLBB 3MR5A 3OBYA 4RLEA 1MG7A 1YVFA 2MKCA 2DIUA 4BDYA 1IBCB 3OSNA 3TVKA 1Y11A 3SK3A 3SMSA 3ETMA 4NLQA 1C1BA 1QQOA 4KKOB 2P9KA 3D2FB 3M8WA 1Y0HA 3DLLQ 2B0GA 2LQBA 3PNIA 2U1AA 1XNRJ 4J37A 3RJMB 2E2OA 3LM2A 2C2DA 2IC3A 4USKA 3M2VA 4HWIA 1T6DA 4KHPK 3K2PA 4DZDA 2HS3A 2UXDJ 1OH7A 1G3OA 3MM9B 3RRHA 3K57A 3ASMA 2QWOA 2G8IA 2CAJA 2HNZA 2FGCA 3T5LA 1RDDA 4UY8O 3ENHA 3HX9A 1BQXA 4PABA 1UJ4A 3TW0A 4HEA9 3OVAA 4OYXA 3PJXA 3SQGA 4ISGA 1RTIA 2HS4A 3WIVA 4ATNA 5EWGA 3JAMO 4M5LA 5FDLB 2KT5A 4HCBA 3NVMA 3DHXA 4RW9B 3S3MA 1XQSC 1VDHA 5FJ4A 2Q3SA 3LOUA 3E01A 4U67Q 3NY0A 1PYTA 3HSJA 3QFHA 4P2SA 1UW4A 3L3VA 3W60A 4LD0A 2EFPA 2AIRB 2VBWA 4OVLA 1UVKA 1SL0A 4JI6K 2CPDA 2PA8D 3BUZB 3PYDA 4CHNA 2ZJRL 4U7BA 1R6YA 2X74A 3KIOA 4FLVA 1U09A 1W7WA 4QYZK 2XMMA 3CCLS 1AFJA 3QICA 1WACA 3LPTA 4JEPA 3QEIA 3L7OA 2XLKA 1NB7A 4ER8A 1NDCA 2VG6A 2PBDA 1HI0P 3QMLA 3CDAA 1IKXA 3KUEA 1VS3A 3C6AA 5HL7Q 1BI4B 3JAMU 2ZZMA 4IDKA 1SC4B 3D1HA 1K47A 1HW9A 3VQEA 4FCYA 4PWWA 4ID8A 4CZLA 3CCUN 2PY5A 1M5HA 1KQGB 2PMZD 3WXKA 3J80O 2Z2YB 1TKZA 2LXFA 1HR0F 1HW8A 1URNA 5M2UA 2RPIA 5AZIB 2DH9A 3H8YA 4HVZA 3FJ2A 4LVNP 1JJCB 2OCEA 3D1QA 3MPUB 3GJTB 3DMJA 1VQLS 2G8UA 3FR0A 2DYAA 3I5BA 2RNEA 3QBXA 2ZH6A 4DS5A 4KGZB 3ENBA 1R0CB 3K2YA 3KJVB 4KKOA 1R8AA 4QIVA 3T9NA 3AARA 4Q0BB 2A3ZA 2H54B 4MKAA 4Y3CA 4O3NA 1FVQA 2AHOB 3TSPA 5JVGL 1IV0A 3IBFB 1X9SA 1UTAA 2HGLA 2G1HA 2MDAA 4DTMA 3HVAA 3TAGA 3FSYA 5B0CA 4HT5A 1ILYA 4E19A 1VFJA 3UR3C 3IWLA 1IKWB 1WDTA 1X5SA 1R3NA 2G0CA 4TYAA 4A8KA 4JK9A 3HCXA 3SDEA 4B3SF 1RWUA 4H4OA 1T11A 4NXNF 1S1TA 4JV1A 1CQNA 4V19J 2UUCK 2JH3A 3FEXB 1T9VA 4CYUB 3AO4A 3KWIA 5SWMA 4UZBA 1K1SA 1YXQA 7FD1A 3CCEN 3FZHA 3JB9k 3EYZA 1HYSB 3P8BB 1BQNB 2V8VA 5L9NA 3OQ2A 1RAEB 1CJKB 2UUBF 1QQMA 3KD1E 1HBNA 1FT8A 2LLZA 1KTQA 4C23A 1B9FA 3BEXA 1KVCA 2G9OA 1Y7PA 1X4AA 5L39A 2ZH9A 1NCLA 1ZZNA 4MMOA 4V19S 4OLAA 1GLCG 2CPZA 2W6KA 3RZAA 3VEVA 3GE1A 1A7GE 4ECQA 3C15A 5LMNF 4IEEA 2WAQD 5HANA 1VJWA 3GBTA 2E9RX 5J1PA 4ES2A 3T1YK 4IQMA 2PGCA 3IGNA 2P5VA 4TLQA 1YBUA 2E7XA 4CGGA 1IBLJ 5EGYA 2IVOA 2ILZA 4YMEA 4DV7J 5KFSA 2DHGA 4O0JA 4FNHA 3BV8A 3H45C 5FPNA 3MDFA 3L4BC 3TTCA 5IWAJ 1EQ0A 1RBAA 2VG7B 5LXRA 3O44A 4C7QA 1WNEA 3DRXA 1VQPN 3GFYA 4UOCA 4XO0A 2NZ4A 5C25B 3JTOA 4FLZA 2JWKA 3NGRA 1UJ6A 3X1LB 3RVCA 4HI1A 4AH9A 3RB6A 4OZ3A 4BRPA 1GOAA 1KFDA 1JLAB 1RTJA 4QR0A 5AXNA 1R0BG 1XWLA 2WW4A 3QAUA 2ZUGA 2GGPA 1BU6O 3CD6N 4YS2A 4CO5A 4B8CA 5M1PA 3EE8A 3F2KA 3CNQP 4FJNA 1VQ9N 3RW6A 1BQMA 2AT1B 3M7VA 1LWEA 4OJGA 3G96A 1E4FT 2MKIA 1U45A 3AT1B 1JJ2M 3ZSVA 2WONA 4NYOA 1TK8A 4L3NA 3OYKA 4DTXA 4EGLA 1WI8A 1UA0A 1WKKA 3I8DA 2I5JA 4CGFA 3SPZA 2HIQA 2I7NA 3L8BA 4CT8A 2F96A 3A5OC 4PG5A 1XMOF 2HZVA 1IBMK 3SMZA 3NFAA 3I82A 3QT5A 3PYEA 4WPAA 4DR1K 3EZOA 4L3KA 5BXIA 5CCLA 4NLVA 1N6QB 5LMUJ 1RHRB 4YB1P 3CPEA 1XI1A 3M05A 4WU3A 4QPXA 3J81O 2Z8QA 1JX4A 2F8EX 1QVFM 5C2CA 5BRFA 4F0KA 2BW7A 4DLGA 3CCSN 1IN0A 3A8JA 1X3NA 1ZBHA 2D4WA 5A76A 3UD4P 1SAZA 2MKKA 4DSFA 4A5AA 2A18A 2C3PA 1XK8A 1YT3A 4ILGB 4CT9A 2MHEA 4FJ9A 3CCVS 3MXMA 4OZJA 3RB0A 4FWSA 4R79A 1EWQA 2BQRA 3ZZ0A 1NM2A 3FE1A 4ZPCA 2HVHA 1JNZB 1R8HA 3TX0A 4FWMA 4CI0B 3LL3A 1RBRA 2UXBK 3GV7B 1F9EB 2V63A 4ZN3A 2B51A 2E88A 2JOQA 4USHA 5K14A 4ZOSA 2I6WA 2GVDB 2W7AA 4LRCA 1LW2A 1EQYA 4UQTA 3TABA 3MFIA 4AM6A 3I55N 4KHPJ 1ZA2B 1LWEB 1FDNA 4ZJLA 3OYMA 1RK8A 4FS2A 3EN9A 4GKJF 2HNYA 4CESA 3PYGA 4K59A 4K42A 1IBKF 1RDBA 1YVUA 2R8IA 3W5ZA 1UEVA 1U8SA 2FUG9 5CYMB 3MECA 3PR5B 3A1YG 3Q89A 1WKJA 5GMEA 2K06A 5AQFA 4YOVA 3CC4S 3H1VX 1DHMA 4CEBA 1NXIA 4DL6A 2IDOA 4ZVUB 2FSKA 3PR4A 3T7ZA 2P9NB 2DBBA 4B1UB 1X4EA 2QWRA 3KG1A 1WSHA 3GONA 2IHR1 1SJ4P 2GO8A 1ATRA 2VG7A 2ZDOA 4ILRA 1S0OA 1QDUB 4MH8A 3LF0A 4DV2K 1TKTA 1FD8A 3KKFA 2DNZA 1U4BA 5DDQC 2RT3A 2HEKA 4A8YA 2F9JA 2VQEK 2VOOA 3VGTA 3CCTA 2RJZA 3A8IA 2ZM6K 2XULA 2B56A 1EHWA 4TQRA 1BDGA 1BQMB 3HZEA 5E41A 1EETA 5A8WA 2O4IA 1ZM4A 2R4FA 2HLUA 3ZEUB 3OYBA 1TU0B 2E1YA 2LQJA 2GGPB 3N4WA 4KB7A 2VFSA 3ZT2A 1X3MA 3SJHA 3AOBA 2YNIA 4BRCA 3DU6A 3NHGA 4H5VA 2E5JA 4MT1A 2HK2A 3IM8A 5CABA 1MN7A 3SQOP 2V9KA 3PZPA 1VK0A 1KP6A 2ZKTA 2G4BA 2ASMA 2EC0A 1ATNA 2GJ2A 4Q7AA 2XMAA 1NEEA 5GAGI 4CFBA 2V2VA 3CXCR 3V2UC 2HKEA 2P6TA 1IH7A 4BS2A 4CIOA 5EX5A 4X4SA 5EVZA 4F4ZA 3JSMB 5F2RA 1RHMB 1KNZA 2OAUA 2YNHB 1ASVA 1T3VA 1D1UA 4GC6A 2QWPA 5FPDA 1BIZA 1YTAA 1X9JA 5D3GB 5C5JA 4BRGA 4NYNA 5FLXY 4BG8A 3F0NA 3V6KA 3LP0A 3SUQA 1KQSM 4FJKA 3T1YJ 4DPUA 3C15B 2IVYA 3L3CA 3CE8A 4PWUA 4Y2AA 2CQIA 2CFXA 3JAMY 2G0JA 3G6YA 4WF9L 1NDKA 3I4PA 5A8RB 3CD6S 1M5OC 2GIFA 3AOCA 1HNWJ 3K5LA 2OZMA 3KDOA 4A62A 3OV7A 4M5DB 4OX9F 1BWVA 2HFUA 3ITHB 4FWLA 3VAIA 2WOMB 1PAUB 2J8SA 3NAEA 4DN9A 4FYXB 4G1PA 1HKAA 2ROGA 5IFMA 3KNAA 3T1AA 2KJWA 4ECRA 3AH6A 1U1OA 3HPGA 3FEZA 3UVJB 2XGQA 1N48A 3QDKA 4RNOA 1ZBFA 3DLKA 1N88A 4IFEA 4OI6A 4X64K 2I0XA 3MPWA 1HA1A 3DGVA 3V5RA 4EP5A 1VRUB 4A8WA 3J7AN 2C3YA 3LGMA 4ZP9A 3R27A 1X4FA 3KLIA 3VQ9A 8RUCA 3TJ8A 3VQ4A 4DTUA 4YUDA 4JI0K 3K5NA 2MQQA 3OYIA 1E6VA 4EWTA 2YNGB 5F8GA 3BH6B 2D3O1 5AZIA 1VOMA 3O1BA 3FZMA 2DFFA 4RW9A 1Y5NB 3L09A 4KH0B 1IBLF 1XJWB 2Z1JA 2HAIA 2NLXA 2UZAA 3NF9A 2VFTA 2OANA 3ADAC 3CGIA 4M63A 3I0RA 1PG5B 3WBZA 3IWNC 2O66A 4KI6A 4RW4A 4A8MP 1WG1A 3A3PB 4PL8A 3UN5A 1IKXB 1WHYA 4DR6F 4IRDA 1FI4A 1E6VB 4AXJA 3CCJS 5AJ3K 3VESA 1HYZA 4IZ9A 3M2VB 2P8IA 5EWEA 4PA1A 3DXKA 3FMWA 3GQCA 4M5IA 1ZM3A 4LRBA 1RYRA 5HJYA 2VH7A 4RWWA 2AGQA 2UYTA 3MTJA 1NWKA 3A8EA 3KHRA 2G8FA 4CEOA 2EBGA 3WQTA 1VSHA 4J9VA 4CHQA 3BF3A 2QGFB 2ZJQL 2GELA 5CE3A 3FFKB 1RT5A 4BG9A 2DCLA 3AVNA 3L4QA 1P90A 5KFYA 2F5GA 2LXUA 1RDCA 2PIIA 3MX5A 3FVYA 3RB3A 1TL5A 5GADU 1P8ZA 4JI4J 2EK1A 4CI6A 4AD6A 2YWEA 1FRXA 3E2EA 1SIZA 1B4SA 2YKQA 1RWWB 1DZ5A 3MUVP 2UP1A 2WOMA 3G71N 3AAPA 1WN7A 4IFVA 3OJUA 2Q1NA 3KWMA 1RHJB 3OYJA 3ZT1A 4M5DA 1HBMA 4LF9K 3ISZA 4OX9K 1Y4ZB 2KW4A 1JKHB 4CHPA 1HNVB 2F4VF 3EEQA 3MXIA 2I9SA 2RD5C 9RUBA 2DPNA 1NPPA 2HMPA 4JV0A 4NB4A 1RWOB 4HH1A 1J5EF 3D2FA 3CIPA 1JLCA 1NJZA 2GO9A 3L2RA 4N5SA 4C8YA 1Z1ZA 4YFUA 3ZT0A 4ILHA 2VKZG 4JI8F 1VSLA 2RRBA 3OXLA 3ATVA 4F2SA 2GNKA 4BC4A 4OPHA 2E8AA 4H5TA 2E66A 1ZYQA 3MHYA 4DTJA 3SAFA 2B3TB 3JSMA 3HHLA 2BJ8A 5GAEU 2ZH5A 4J9UE 1O13A 4M1KA 1XHZA 3CIZA 1AUDA 3LDNA 1N52B 3MI7X 3AO3A 4FP9A 1RWPB 3BGLA 4CM0A 3OBWA 1VQMN 3EWGA 1SC6A 3UCGA 1XR7A 6FDRA 2P9PB 4MKYA 2WUSA 3AVBA 3T1YF 1J2VA 4XH4A 2B9XA 3Q0AA 3VHQA 2CDQA 3BQ1A 1ZPWX 3VVUA 1EKEA 2AU0A 2KFNA 2ZGYA 4ANEA 4AL7A 2XO6A 3L7PA 4K4TA 5HRNA 1TKXA 1FHTA 2BM1A 4I6AA 2M8HA 1RU1A 1HNWF 4S0MA 3VERA 4QR1A 2QV6A 1R43A 4B1YB 1S77D 4B3MJ 1HWKA 2FLPA 2KT3A 2ZBRA 3CM6A 4CD1A 4HVJA 4FWQA 2E4LA 4EU0A 3A5NC 4E7IA 5CYQA 4IYQA 4DR3K 1PIEA 1WSFA 1NKBA 4K0KF 3BDPA 4X62J 1FJGK 4PPDA 3NWRA 5THWA 3OL6A 3MX2A 1F60B 2HMIB 1S57A 1VC5A 4DTSA 4FK4A 4ZP8A 5A2QO 1GLAG 3NCPA 5EU7A 4F4YA 4MFBB 4DPOA 3WIUA 4OLBA 1M1KT 4JKAA 1T03A 1Q0NA 5TKYA 3CPWM 4R5PA 4Q2MA 5KG0A 4BVPA 2MQ8A 5AFUH 4CD3A 1DRZA 4WP9A 3O80A 5GMKa 1TELA 2IIHA 4FLYA 2MKHA 2CNKB 3CMAS 4FL9A 1ZA1B 1NK7A 2XRIA 4NZ0A 2I8EA 3M32A 4UY8T 2CJYB 4Z0UA 1UP1A 1UEKA 1WC0A 2GAHC 3EJMA 3GIJA 3DHWC 2PE8A 1NLVA 5AQNA 2QTDA 4H03B 5K5MA 2DO4A 4X62F 4M8LA 3IXQA 4C98A 2MLYA 1SVDA 3MEGA 4QWBA 4CJSA 2FY1A 3EXYA 5KFMA 3UIQA 1S6PB 1RT2A 1YWXA 4I67A 2H1YA 3ENAA 2JC0A 1AYEA 1XC9A 4NRTA 1OPIA 2F9WA 3PW5A 1FWKA 2ASDA 3J7AP 2GWJA 3O6QA 3MAQA 2IMWP 3QETA 4LFAF 3R5CA 4C8NA 3VQ8A 5D4LA 1BCOA 4KJIA 3M2RB 2AJQA 2RS8A 3EVMA 3TI0A 3I4HX 4TKTA 3MEDA 3QO9B 1QVGM 2FLNA 2DO0A 3WDOA 3D45A 4QS7A 2P9IB 1K8KB 2QC3A 1YBAA 2MJNA 5HO4A 2W01A 3ZSXA 3VWSA 3DRSB 2UV8G 3A0IX 3HSTB 4JI6J 4WYLA 2AEMA 2DNMA 5HQMA 1IG8A 1X4CA 3KLIB 1U02A 3VF4A 4Z4EA 2XMJA 3ZZPA 4JN4A 2CPXA 2HFNA 2EWHA 1ATSA 3G6VA 4AHSA 4MIBA 4C8OA 3QT7A 4NE9C 3U8XA 3PM9A 3FC9A 5BR9A 2I5JB 3DLKB 1W26A 2E6MA 3FCVA 4QW8A 1IR2A 1DQ9A 1M5VC 2LQ5A 3DKDA 4DSIA 1GMUA 1OVQA 2CUYA 3RUBL 1VAZA 3W62A 3GYGA 4MDAA 4YY3J 4PQUB 1NJYA 5GAHI 5KFZA 1TUUA 3MPDA 3NH2A 2XY8A 2BKOA 4CQ1A 4DQQA 4BE2A 4DR4J 4CWBA 1OS5A 2XZDB 2LEBA 5GIPA 4JUZA 5B08A 3PVXA 3CXCM 4ICLB 3M1VB 3M30A 5AQMA 3HZ6A 3MOZA 4OX8A 4DCPB 4XAKA 2RE2A 5CD4H 2H3GX 3TSQA 4H5WA 4N47A 4BR2A 1NHVA 3KG0A 2BJ7A 2IPOB 4QU6A 2MB0B 3H5SA 2UVUA 1L3UA 1ZZFA 1Y5IB 2HHHJ 3CYMA 2ASPA 2YNHA 3DRRA 1WKLA 2KFZA 1BA0A 4R0EA 1IO2A 4O8UA 5J2PA 2HBZB 2FJDB 2G8KA 2CQGA 3CCSS 4IOAL 3ILJA 5AQSA 2C2MB 2XG8A 1YUWA 4PXDA 5HVHA 3QEVA 3PIPL 2OYQA 5K8OA 3QAEA 3RSEB 4F2RA 4BR4A 2DY1A 3DLHA 2IA0A 2DITA 4DSEA 4ZLNA 1VCTA 4MK9A 4MIAA 4RG8A 3HHLC 4ES3A 5D4PA 4CEEA 3UCUP 1B99A 1VSFA 4I9QA 5D77A 4FWRA 4FJ8A 3AA4A 1TL3A 3AV9A 4PQUA 2VCPA 2EHGA 3LP2A 4TU7A 1JLFA 2HVIA 4WQ5C 4K7QA 3N4QA 2QLJB 1S59A 3ENWA 4B1VA 4YR0A 4DV0K 4W92B 3CCES 3OHBA 5A8WB 4F26A 4JV5K 1EQMA 1D8ZA 3VGLA 5IT9U 4YHHF 4FOEA 2YXLA 5BPNA 3S9HA 1OIAA 4OZ0A 4JI1F 2D41A 4WXWA 2GV9A 5E3PA 1S0NA 4NLTA 5CH7B 2ADCA 1NGIA 1R6VA 1GOCA 1UWAA 3NNCA 2C42A 2P9SB 4B9UA 1ZETA 2A1BA 5LSLA 4M3RA 4UZCA 3GP9A 5CHIA 4IOBA 1OVYA 3W5XA 2BEFA 3MMCA 1CEZA 4BGAA 2AJ2A 4CLZA 2FHJA 2VA3A 4G9ZA 3GJQB 2P9NA 1U04A 2FJXA 1YJVA 3UE5A 2P5GA 5KG3A 1R7IA 3TVZA 3MWPA 2KL8A 4CF0A 4PUOB 2R42A 3EGNA 1GX6A 3CMES 5IT9O 3OYCA 3H20A 2R3VA 4J2BA 3CPWR 3J81j 3CCZA 2EG1A 2HHVA 4DR6J 3P4UB 3SV3A 4FVUA 1N5TA 3PFOA 4AHUA 3VQCA 2ABYA 4FJHA 3H5UA 1V6HA 2X1BA 3GCWP 4ILMA 3AVFA 4P7VA 4CEDA 3KVGA 3VZIA 3JSBA 3TNVA 1NMEB 4OYWA 3KLFA 1LW2B 1QUVA 1UPPA 2CYYA 1ASWA 3QRQA 2QA2A 4TXSA 3KK3B 3CWJA 3X3UA 1S6PA 1MROA 4E7JA 1RTHB 1BWEA 2O8DA 2ZBPA 1P1LA 4M3ZA 1T44A 1Q1KA 1FDAA 3IMQJ 5MLCQ 3VAGA 3UDVA 2V8GA 3JTPA 2KH9A 2ZM6F 1Q7LB 1D9AA 1FRLA 3I56N 3NAHA 2AJ1A 1Q7YT 2C2KB 4ZPDA 2X6SA 1JJ2R 2DTUA 4R5PB 3T5KA 3PO4A 1C4CA 3DJCA 2LU2A 2EBEA 3WXJA 3P31A 1OY8A 2ACYA 2RHKA 3SQGB 1YJTA 1ZBUA 4YR3A 1KRPA 1RE1B 4LBHA 3TYTA 4DUZF 2HNZB 4CECA 3TUPA 1S6QB 2FF6A 1I1GA 3WNFA 3FGUA 2FBTA 4H5RA 4Y2KA 2JC1A 2EFNA 1XUPO 3VOVA 2JWLA 3W1YC 4GV9A 4KIAA 4DQIA 1VQSA 4M3WA 3MM5A 2AWZA 4W5NA 2G2ZA 2DNKA 2WHOA 1FKPB 2HNDB 3GR0A 1X31C 3I5CA 2FZCB 5DG8A 3J80Y 1FRIA 1H0HB 3ZTOA 5M1OA 2Z4PA 4RW6A 4DR1F 4ZTFA 1TKXB 2ZZTA 1VQ9S 1YTUA 1F0XA 4DTPA 4M3UA 5F9LA 3I56S 4QWDA 2RAQA 2EKYA 3KLEB 1NDPA 4CZEA 1VQ8S 2NRWA 4NA2A 1RI7A 4M42A 5D78A 1BHNA 3PRDA 2DNQA 3TR8A 3ZTSA 2W25A 5DM6L 1YJ9N 2YPYA 1UVLA 2UUAK 4ZPAA 1RNHA 4M3YA 1B70B 1HNIA 2F3JA 3D67A 5E7OB 3OTOF 2GAGC 3CCRS 4J7CA 2Z2ZA 1NPRA 3O3GA 2FVPA 1BE4A 4OPJA 1GT8A 1YVNA 3N6MA 2J8AA 4KFBA 1GH8A 2XHCA 4JI0J 1YZ7A 4DSJA 4L75A 2LMIA 1T94A 5G0RA 5CQGA 4E1NA 3V81A 5KQ8A 1A5VA 4K4YA 1JLCB 2VFVA 3H2UB 3D2EA 4MLHA 3ZLJA 2K3IA 4KO0B 1REGX 3OYFA 1X4BA 4ID5B 1FO1A 4P10A 1RDUA 2Q79A 2GQ2A 3QIPB 4EZ9A 3I87A 3OTBA 3WXLA 1JXVA 3FDSA 1X8DA 3PRVA 4ZIVA 4AHCA 3D7EO 1JWWA 4B9SA 3VAHA 4AYBD 3VQBA 2YH0A 3P1GA 4HCCA 4FF1A 3H3NO 4PG4A 3I9V9 2HOEA 3HULA 4H4MA 2IBKA 4Y2IA 3IFRA 1S1TB 3QERA 4K4SA 2XZWA 4CHOA 2UXCK 3THPA 4JLHA 2BJ9A 3MD3A 3S7RA 3NEKA 1IKWA 3IRWP 1KONA 1E6YA 1HNXK 2CPJA 1NB2A 4NMXA 2UXBF 3SZ2A 4AQYK 4QOZB 4LSLB 4KR0B 3RGIA 1V3SA 5C24A 4BHQA 2R7TA 4Q0BA 3C19A 1Y00A 4H4KC 4B3RF 4C97A 4B9LA 1S1UA 4E1JA 1KQFB 2D0AA 2LQ8A 4Y00A 2VUGA 4CGDA 3O4QA 1NK9A 1QHTA 3VF0B 3DXKB 2UUTA 4KQZA 1KD1T 1S1VB 3KNGA 2V0NA 3J7YU 1H98A 1TV6A 3F9KA 3B6PA 2CG8A 4PHTX 4O3SA 1TKZB 2HBKA 5KGWA 1Q5VA 2E5LJ 2YKPA 2CNLB 4ELTA 3C94A 4BRIA 3WEEA 2ZC4A 5HMXA 3GMGA 2DGTA 3U1NA 3T19A 3R5DA 3QMQA 3MM6B 1WUUA 3IG1B 2C3OA 4NYPA 2FZGB 1FJGJ 5HSPA 4X62K 5JLHA 1DTTB 1EP4A 5TKWA 1DGKN 3U4LA 3S1TA 3G10A 2HWIA 5HBMA 3OW2R 2OTLS 4USUA 2YHAA 3PCOB 3ETOA 4BRDA 3OS0A 4DQSA 5LXYA 2B4OA 4BLGA 3FRZA 2QRRA 2V8HA 3A13A 3NG8A 4DL2A 1RT3A 3C6UA 4I6MB 5FROA 2GVZB 5K8PA 2FVRA 3TUZC 1KC8T 4Z2XA 1RCHA 4CIEA 3IO1A 3MOJB 4PAAA 2Q6CA 4RW7B 5L46A 4FZZA 4LH5A 1NJIO 5L1JA 3IRXB 3C8YA 3NH1A 1GXLA 3UVJA 2CVEA 3BO3A 4OMFG 1D9DA 3P83D 5CHCB 5EXWA 4I2PA 4WK3A 4R8UA 4OYPA 5ETNA 4W4MA 2CQBA 2H5JB 4I4BA 3LAMA 3ULHA 2HRTA 2X1GA 3QIOA 4IEIA 2VC0A 3BF1A 1HI1A 2P2CB 1YDLA 1KDNA 1LAVA 3GFZA 2V6AA 4ELUA 2B9EA 1NUEA 3G8TA 2LYVA 1JXLA 1LWFA 1N32J 1X4GA 3OPKA 2NREA 3PTWA 3H40A 4CGJA 1KTVA 4DLEA 3C2PA 2NPIA 2KHCA 4LF7K 3QZ7A 4F4KA 4HL9A 2QA1A 5AJ3J 1W97L 1X9MA 1V5VA 3SUNA 5ETVA 3MGJA 4E2FB 5L38A 1YJNS 3M8QA 4LH4A 4NLDA 4DU7A 2V51B 1WSIA 4OX9J 1S3XA 4LF9J 3H7HB 5DLFA 4Y1CA 3CFRA 2D1KA 3LPUA 2AYBA 3R3LA 2HHTA 1LW0A 2BW2A 1TFWA 3L2QA 5A6PA 2XYGB 1WELA 4ECYA 3Q22A 2E2QA 1WB9A 5AQUA 3CD7A 5J2MB 3OVSA 3VPZA 4HACB 2DY9A 2QWNA 1G4CA 2YHBA 1SV5A 1I94J 3MEEA 3D4JA 3IR6B 1RBUA 4K8RA 2V9WA 1D5AA 1YRUA 4LRDA 3OTDA 3NGTA 2NRVA 3RTVA 5KFNA 5GADP 4IG0B 4NLBA 1FDBA 2Z57B 1RHUB 2GMHA 4LMZA 3THXA 4ITSA 1U1LA 5KT2A 4BE0A 3Q8VA 2CQ4A 1N5YB 2CPHA 5BR8F 1S48A 2H3EB 4FDFA 5KTQA 2Q1LA 1RYSA 4PXEA 2VQFF 3H5XA 4U96A 1RABB 3TZXA 3ZSOA 1Q82T 2BQ3A 5MLCV 2X78A 2IAJB 1SUQA 2PDAA 2MSSA 5B09A 1RFQA 4DTNA 3UCZP 3KLHB 1I94K 3VQDA 1LQ9A 2PSZA 2BH1A 3CCMN 1CVJA 3MMBA 1BXNA 2FLOA 2KU7A 4RUHA 4JBCA 3SCJE 3W3DA 3NS6A 3PW0A 1KAZA 2HS0A 4W5RA 5DDRC 3CF5Q 4FK0A 1WHXA 2ZC3A 4ED8A 4YOXA 3G8QA 1S72N 2MQLA 5J1NA 5HQ8A 1HL6A 3NF7A 3DI6B 4CHZA 2UXBJ 3FBEA 2E7VA 3VGSA 2RHSB 1CZ9A 3JYTB 1URRA 2UU9F 3KMQA 2IM0A 3CJRA 3C0BA 2N82B 2W4CA 4IKFA 1VIXA 3ZSZA 1T05B 1I6JA 3W8GA 3ZT3A 3H08A 2G2YA 4C11A 4URGA 1FVSA 1SXLA 4EUVA 2ZJPQ 4USWA 4JI7K 4X65F 3VZHA 5HAOA 3OHRA 2R7WA 1EKRA 4CLUA 4RPFA 1U48A 2BANB 3LZIA 3R97A 1SH0A 2OMLA 2F65A 4CW7B 1S10A 1S9EB 2QXLA 2NR0A 3HRGA 4DMZA 1CULB 4QWAA 2QO3A 3C6TB 1TUWA 2GVDA 2B9YA 5JMVA 1UWBB 1QJHA 5K14B 4WBFA 4U95A 2OPPB 4K4VA 5GINA 4USVA 4RTFD 3OUYA 4X66J 2LQ9A 4HT7A 4I69A 3SQ0A 4LF1A 1UJ5A 2QLWA 3CC4N 1R8BA 2FHOB 2W7PA 3AVKA 1I3AA 1R0AB 3KG4A 3THYA 4DTOA 1SKWA 4MDBA 1FNOA 1UPMB 2O8FA 1TQLA 1B0VA 3DU5A 3HMJG 1S72S 2D3OR 2CZVC 2RILA 1FEEA 1WJ9A 2XSJA 2C2ZB 1Q16B 4M94A 4OHXA 1AA1B 4PR6A 2P9LA 2XY7A 4WYBA 1CS4A 1SC1B 3OLAA 3I31A 1AZSB 4ES1A 3VF6A 4F8RA 1DT9A 1XIQA 3OSPA 4AFFA 1VHIA 4K4XA 1N6QA 4PWDA 3LPYA 3PYFA 1I5OB 3DWLA 2IS3A 4DPXA 3HK2A 2O8EB 4CJTA 2HBYB 4FJXA 2P9EA 2KTQA 1KQKA 2YY3A 4FJGA 1VSIA 2OPQA 1WUAA 1W2BR 4J9SA 5JVHQ 4NOHA 2CZ4A 1G15A 2X3GA 3O3LA 4NEZA 2VODA 3RAQA 4MO5A 4JI7J 2Q0UA 4NZ7A 2JFDA 2ZGZA 3HHNB 2NRTA 1Y9OA 1XQIA 2DHSA 4EO8A 2LEAA 3Q8SB 4KHRA 3R6MA 4IBNA 3FKBA 3TEHB 1HD1A 2QLXA 1RAAB 4CJ3A 1FX2A 1RTJB 4ZIWA 1YG0A 3BSOA 3NS7B 4DU4A 1IKVB 5AQTA 2FHKA 3QFWA 3T5HA 4IFYB 1FE0A 3D66A 1F5CA 4C6AA 4DX7A 1RBVA 4JI2F 1N8RT 1TL1A 5DRKA 3IR5B 5FLXU 4AF1A 4DV5J 3TZZA 5KFKA 4MK8A 5EY4A 3SYZA 3T9ZA 1YGYA 3ULEA 2WVFA 4U7UK 3M8SA 3VQTA 3AVHA 1FRKA 4P2FA 5HMYA 2F8HA 3CQXA 4DB3A 4X4VA 1WD6A 1VQMS 3RR7A 2DIVA 1TUVA 1GK8A 4IH6A 4L74A 5AE2A 1BUPA 1BUXA 2B6AB 2F8MA 1P8GA 2UUAF 3A4TA 1Z2LA 4C3KA 2F8SA 4CLLA 2R8JA 1OH8A 4DEZA 4IOCQ 2W1BA 2NSBA 4CTAB 3M9MB 1H74A 3BR8A 4IH7A 4LQ9A 3LA0A 4FYVB 1TYQA 3EXCX 4PG6A 3HXMA 3TANA 2FSNA 4J5OA 2MGZA 3QNNA 1BQNA 2YKNB 4B9VA 3QJLA 1NJWA 3MWBA 1J5EK 1DJ0A 1XN9A 4OPKA 1WSVA 5AQIA 2P5OA 1HPZA 5HRSA 1FXDA 3G82B 1X4DA 5HJXA 2HQIA 2BE2A 3BBBA 1Z25A 5HRRA 3SDEB 4F36A 1B9DA 4NLCA 3D3CJ 3FZFA 2AW0A 3H3OB 3DXMB 2ZBIA 3LDOA 3EY1A 1JLEA 1FTRA 3AJ2A 2VICA 3VV2B 2QN6B 1HNZK 4F9OA 2Z2MA 4DHVA 2KKZA 1MNEA 1EZZB 2HIYA 2BBEA 3R6GB 2XNRA 1K0TA 2NNWA 2RDJA 3F56A 1J6ZA 1NM1A 3QFUA 2XMTA 2BRKA 2GV1A 1Q95G 1Q8KA 3Q83A 4J9OA 1CJUB 3AAWB 3R3TA 3HTVA 3NBPA 1V3RA 1FK9A 1SJFA 3TAFA 2DFHA 2AMCB 2LA4A 4A61A 1VK8A 2D0PA 1BA1A 3M9OB 2ZEJA 2YNFA 4YR2A 3K0JA 3DM2A 1RGVA 4DI6A 1I39A 3T3FA 1RBSA 4O44A 4UT4A 3IMXA 1VJQA 3HJFA 3BO2A 4M3TA 5I3UB 3J8AA 1I94F 1EWRA 4FXVA 2PI4A 1PCAA 1IBMJ 1YJNN 4EYHB 1U2VA 2PEHA 4LBPA 1KHWA 1MA9B 1MU2B 3BBCA 4RUCA 1D4XA 1DURA 4B3TF 1W0HA 5ETPA 1NZAA 1NO8A 3QFPA 3A3OB 4Z7YA 2OPSA 1Q8LA 1A5XA 3O2IA 1C4AA 3M6GA 1UAWA 3D5MA 3JQKA 3VQ7A 3VA0A 1FXLA 4KI4A 1WC6A 3MXHP 4WJBA 3FBBA 1GLLO 3TPQA 1PSDA 3LW5C 4Q44A 2ZH3A 2ZDPA 5MAOA 5ADZA 1KR4A 1NGCA 2CQ1A 3M8PA 2DK2A 3VTHA 1S0MA 4DBQA 1S9GA 4A8OA 4FLTA 1ZM9A 2HK3A 1IBMF 1XMOK 2QL5B 4OZNA 1FNMA 4LUBA 1YX2A 5T7LB 2YCHA 3R1LA 2R7UA 2JLEA 4C8LA 5C10A 1S6UA 5HLFB 1BMQB 1VYAA 4BY9C 4UOFA 1X9WA 2HHUA 4X4QA 2HHQA 5AR0A 2FB0A 2G8WA 4CJ5A 2BJ3A 4NLSA 4OYIA 2X6NA 3IUCA 4FJLA 2DGXA 4JK7A 2YKAA 1CC8A 4WK1A 5LJ5Y 4GVEA 3SPYA 2MY8A 5AQWA 2HQCA 3T1HJ 4JKCA 4U67L 3ILOA 1VQOS 2P9KB 3N9UC 2XEXA 4B3RK 1BY9A 1Q8BA 3L2UA 3V4IA 1MWKA 4ZN1A 2DNPA 3D68A 4ECXA 1T0TV 3TAQA 4FS1A 3I0SA 4M5HA 5KG4A 3MWTA 2MSTA 2F9TA 4WIIA 3SI8A 2AYEA 5HATA 2HBLA 4NCGA 3RAXA 4RW8B 2XWYA 3OHAA 3W9HA 1KLMA 4H4KA 4WE1B 5DM7Q 3CCWA 3UPFA 2DCUB 2YWWA 1HKGA 4C4WA 1ROFA 3KXDA 3LDSA 1YJ7A 3D0IE 1QAYA 1P27B 1S4EA 3IBWA 2E5LK 1D3WA 3GFXA 1PILA 2FDNA 2VGNA 1GMVA 4CH0S 3CJ9A 4YB5A 4AT1B 2XHBA 1KKHA 2W2QP 2XY6A 1TUYA 4DR2K 3MM8A 2ACMA 2QEXN 3THVA 3Q8PB 1DTQB 5KAKA 4LRFA 4OPAA 2W9BA 1IKYA 1ZPVA 4N7TA 4A8QA 1FESA 3EVWA 4JNEA 4DR7K 2WVCA 4KTWA 2LU1A 4NZ6A 1WSRA 2B4PA 4HI2A 2MQPA 5M1NA 4OZ1A 1Q86T 4RKUC 4I0WA 1RA7A 1FX4A 2CNOB 5HN0A 4B3OA 4QAGA 5AE1A 5U47A 1UVJA 5E5NA 1QSLA 1DAXA 2R8HA 2ZOMA 4MKBA 4YN3B 5K9FA 1KAYA 4W5QA 2OO4A 3TZYA 2BZ2A 2K1RA 2UXDK 1OPZA 2J9DA 3VALA 1KFSA 1NH8A 2XCAA 1OSDA 1SQGA 4CJQA 2XI2A 4HHTA 3M6UA 1GXUA 3K7RA 1HI8A 2R8GA 3T69A 5C12A 2BR0A 2Q97A 1U2RA 4N76A 1AUSL 2G13A 1OJ4A 1FRHA 3IC1A 2HURA 2OH2A 4ILJA 4JS4A 2QA4S 3AA8A 3BZCA 3AB4B 5JVHL 4HTUA 1ZAVA 1A0OB 3MPVA 4DV6K 4O3QA 2HQ3A 4P74A 4ZVOB 4JI8J 3VAMA 4LIRA 5J2QA 1VSDA 4EHTA 4MTPA 2UUBK 1ZH5A 1ZBIA 4JS5A 4M5NA 4F3TA 2YX6A 3F5TA 2K7KA 3WZ0A 4C1NI 1UZDA 1RCOB 1YLXA 5F0UA 5KG7A 2QYCA 4CZCA 1VHXA 5LL6Z 1EKSA 4X4OA 3DLEA 4J9NA 2W2NP 4Z7CA 3DLBA 5KFFA 1LKZA 2FHJD 3NCQA 4GW6A 3IS9B 5IT0A 3HKWA 1RGIA 4DV3J 4K50A 5D0HA 1CZAN 1S9FA 2IYIA 1AT1B 4JKDA 3NF6A 4BRLA 2UUAJ 1FA0A 1YTYA 3SBMA 4B1ZA 5KFAA 3ZTPA 3FFIA 4ANDA 4RO0A 1XTZA 3H42A 3V6HA 3OR1A 4USIA 3SJJA 1CBKA 2CXEA 1IQZA 4B9QA 5HP1A 3KZBA 1J5OB 3RRGA 1XNRK 5GAGU 3AGKA 3ILLA 2BJEA 4WFYA 3B78A 3V6DA 3P39A 4GKKK 3DN9A 5I3QA 3PO5A 3VQQA 3TRGA 1S79A 1HMVA 2L3MA 1VRTA 2WVEA 5L9XA 4AHRA 2ZF5O 1DBDA 4ED7A 4CNYA 3HT0A 2AYGA 1N36K 3C7NB 2RU9A 4KH1B 4CEAA 4URSA 2JLFA 2IJRA 4G1QB 4Y6IA 1L5UA 2Z1GA 3J7YI 1RKJA 3LDPA 2RQMA 2P6SA 3PXGa 4WU2A 4UF4A 5M1KA 1HFEL 1K73T 3UKUA 4CFDA 1Q82O 4TY8A 4NEYA 3CD0A 2BVZA 5B8HA 4U6PA 4LF4J 2OIHA 2XWXA 4AL6A 4FM0A 3E1YA 4E89A 1C0MA 2Y1JA 2B8PA 3IM9A 4DUYK 2RKIB 2M0GB 5IQ6A 2DNHA 4DU8A 3IN5A 5F8JA 2IRYA 3CJ0A 4J9QA 1WHVA 2E5IA 4CZFA 2O3DA 5LM7E 2P9CA 1F3FA 2D1CA 1U1PA 1JIHA 1X60A 3WXMB 4TU9A 3QB0A 2XNQA 1MN9A 5DGAA 1TK0A 3ZZTA 4OYOA 1K0VA 4E8UA 2P1JA 2GMLA 4CJLA 4CZHA 3J7A1 1GMWD 1QY7A 2JDJA 3C16A 3D6MB 4LRAA 3GG4A 7FDRA 4DV0J 3ZTRA 4QIGA 2BRLA 3TZWA 4YNQA 5DQIA 3FBCA 4WTOB 1JCGA 2W8KA 4DUYJ 4ZKAA 3O8WA 2CGJA 3LDLA 3BQ2A 3MAAA 4DXLA 5C7PA 3KLGA 4DF4A 2W42A 1JLQA 4URQU 3L2VA 3ICLA 1U0HA 2YWGA 1ZAWA 2L9NA 3NRBA 2PN6A 1M1HA 2R9LA 5DJBA 3DDNA 2BXJA 3CB4A 4FM1A 2AGOA 1DARA 4KGKA 2V4QA 4JI5J 1LWXA 4LSNA 2QW9A 3ZO7A 4OHYA 1YQHA 2EG2A 1G2EA 5E0OA 4J2AA 2HFSA 3W2VA 4DR5F 3UKRA 3MZIA 1HWJA 4ED3A 1PBUA 3EE9A 3TA1A 4KHYA 2ZH8A 2BUPA 4FK2A 5H9EJ 5C2DA 3MN6A 3SBGA 2W2MP 3PSIA 1Q18A 8AT1B 1ACMB 3ZETA 1GOBA 5GIOA 2IY5B 1TZ0A 2QSWA 5IT9Y 1FXXA 5E2QA 2HF3A 4ZVSB 1X0FA 2OELA 3TTFA 1X1PA 2NZCA 1WORA 1KC8O 3O9TA 3HHLD 3WC0A 1YITS 5KOXA 3ET6B 3VQSA 5ETSA 2HVEA 1OY9A 3QLHB 3U1MA 4KH4A 5T41A 4FWKA 4C9DA 5I42A 2OEJA 3GLJA 1WTFA 3VQAA 3WNHA 5K20B 1TL7B 3N6LA 3M3ZA 4PQAA 1FJCA 4M3XA 1RAJA 2Y8YA 3QLHA 2G2OA 1HBOA 3Q7BA 2QKKA 4EAHD 3SEOA 3MR3A 4IUFA 1TVRA 4LF4K 4O3RA 1PAEX 4DL4A 2XSFA 3CDBA 1NBEB 4DV4F 4DPWA 9ATCB 4CH1A 3V1OA 3LH2S 4A8SA 1VQLN 4NLPA 2JLGA 1PJ5A 2W7OA 1PYSB 1WI6A 4LF8J 4FYYB 4CZGA 4OJ1A 1VQKN 1X5OA 5AQKA 3HHDA 3KK2B 2DISA 3UQSA 1U26A 2F1FA 3ONQA 1TR0A 3FK4A 2GW8A 2ZH1A 2LCWA 3ZZZA 3UR0A 3NGIA 1YHQN 1VBKA 5KFQA 1RTDB 2BV3A 2MMYA 4B02A 3UDCA 4K5RA 2E2NA 4YOEA 2XCPA 2UU9K 5HQLA 1U0SA 2CH5A 2CQ0A 3AJDA 3GWCA 1RWVB 4E7KA 3MM7A 3BGOP 1PJ7A 4FJIA 3MURP 2W6LA 4LQ3A 4U9RA 2OPRB 4CF9A 3QBCA 2AJ0A 1T02A 4CIFA 4KAIA 5CZ2A 2RUSA 5EN1A 1WLJA 2JNJA 3KK7A 5DZ7A 4YY3K 2A40A 5D0GA 1HYVA 1NMNA 5DK5A 5J2NA 3ZX2A 2E1MC 4JB8B 4USJC 3HVRA 3MDQA 3C16B 2XYPB 2KYZA 2GEMA 4FZXC 2CPYA 2HHPA 5BPLA 2J7KA 3V9WA 4YDDB 2AKWB 5KFTA 1UAXA 2ROPA 3LP1A 3F41A 2PD1A 3D0HE 1EIYB 3HVTB 1T9TA 1CXUA 2ZOFA 3AD8C 2NLWA 1EAYC 1B7FA 1LWCB 3AVIA 3SBTA 5GADI 3KD5E 1C1CA 4ZP7A 2VV5A 3T5JA 2VFRA 4IKAA 3IP0A 2QT7A 3ZSQA 1YSJA 3MN7A 2GC8A 1JL2A 2IOCA 4RNHA 3V9SA 3MF5A 3UWTA 4PY5A 3GOIA 1N4LA 4GY2B 1OSCA 5IV3A 1QVGR 2SXLA 1WOQA 4YQWA 4NI2A 5A8KB 2FLLA 4FPAA 2C28A 3PLAA 4CFCA 4Q8FA 4DU3A 1SKUB 4JD2B 1CQMA 3PUFA 5GAEI 3KMSA 1RQ0A 4YB7A 4JOUA 4RU2A 2JZ5A 3PIOQ 3LALA 1WSJA 3JTNA 1WEYA 3DGPA 3CJ3A 1F2HA 2W2OP 3C7NA 2WW8A 1H7XA 3GG0A 1U8WA 4Y2CA 2V8DA 5E3QA 2A41A 1BWFO 1NLKL 1X5PA 2K7JA 4IH5A 3DOKA 4LFCK 1H2UX 2V68A 3LAKA 4JRPA 1UMJA 1G6BA 4W5TA 4B3MK 4DR6K 4IO9Q 4DV1J 2Q43A 1VQPS 1H7WA 1XMQF 5E33A 2LFVA 3CJ5A 4A46A 4O4GB 1A5WA 1MWMA 4JI5K 3OXGA 3ID8A 3K8WA 2QE5A 4DL0C 1IG9A 3BN4A 4QWCA 4JKEA 3W8PA 1Y97A 2DNOA 3CQYA 5H9FK 3O1LA 2OEMA 2MXYA 4WYWA 4LY7A 4LF7F 4HUEA 2RB7A 4A8FA 2WSEC 3RG6A 3TUJC 3H1QA 2ZD1B 5B0FA 4DPTA 4OX6A 3VQ6A 2MZTA 3DOMA 3OR2A 4ZVQB 1K9MT 3OVNA 4GVLA 3C95A 4O23A 3DLGA 4CJPA 1APSA 4CNZA 3VR1A 5B7WA 2QX0A 1WEXA 3CDWA 3HSGA 4PG7A 4DR3F 4UQGA 2RN2A 3E9LA 3TAPA 2EW9A 1RHQB 1LCUA 3W0LA 3BGRB 4V19X 3R9LA 3SAHA 2AJFE 3CM5A 1E4GT 4Y1DA 4E1MA 1RT4A 4F3MA 1WSEA 3LQVA 5C2FA 3HM8A 2QKBA 3HYFA 4IG3A 3NWGA 2M9KA 2E1RA 4CBUA 1FKOB 2M88A 5L1LA 4WZMA 3HHKA 3BSCA 2DXDA 4IR1A 4TNOA 2EXUA 4DV3K 3O5BA 4ZCIA 1CZBA 4H0OA 2RIJA 3DOLB 3OXFA 4C8MA 3AQOA 3TUIC 2Y3YA 1REVB 4GO5X 2BX6A 4CE9A 4NPOA 4JI4K 1RSCA 3I8BA 5I3PA 4DFJA 3BGUA 1WC1A 1JLBB 1GTEA 1T3OA 4L76A 2D9OA 2QEXS 2ZE2A 4A4JA 2CVIA 3AXMA 3NOCA 2NUBA 5BYQA 3EZ5A 1JLGA 2ASJA 5F8LA 2DHAA 2EI5A