1JLCA

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with pett-2
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
547
structure length
534
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT A-chain
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 130
structure length 534
sequence length 547
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlcA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlcA05
3B6PA 4YP3A 2HMIB 1J53A 2IM3A 4F4WA 3RWUA 1SKRA 3KLIA 3VQBA 2WCXA 4EBEA 4CK2A 3DRSA 4DL6A 3V6DA 4KREA 3AO4A 4NLGA 4ZHRA 4KFBB 4FJIA 3B6OA 1DTQA 4Q0BA 3H5XA 4ED6A 1RCHA 2R2SA 4E1NA 3P83D 2VG6B 4M3UA 1O1WA 4CHOA 4Q5VA 5E41A 3AO5A 3VQ9A 3GIMA 2EX3A 5EU7A 1HJRA 4RW6A 3QO9A 4DU1A 4CJSA 3TAPA 2DFFA 1HMVA 1BQNB 4J9OA 4CJ3A 2G8HA 1FK9B 1KCFA 3O4QA 2XGPA 3NE6A 3GIJA 4PQUB 2ZE2B 2QKBA 3Q8QB 3HPGA 4W5RA 3MR6A 4ZP8A 4CESA 4OGEA 1JLGA 4MH8A 2I1RA 4FZYA 3HP6A 1NJYA 1N56A 3RR7A 3LANA 3PV8A 5L1LA 3NCIA 1VSEA 4DTNA 4I2QB 4H4MA 1RYRA 4E0DA 1I39A 2BANB 5KI6A 2UVUA 1KVAA 4CJPA 1U09A 2IM2A 3S3NA 2WONA 1JX4A 3DOKB 3QLHA 5HRSA 3KLVA 1QS4A 2OPSA 5HBMA 5KT5A 4Y2AA 4ECXA 4DSJA 4M42A 4RW4A 1YT3A 4PA1A 2CKWA 3PX4A 3DYAB 4CECA 2AWZA 4O4RA 4TYAA 3LPUA 4ECYA 5EWEA 2JEJA 1C1CB 2X6NA 2IM0A 4DEZA 3V1OA 4IKFA 3UR0A 3PX6A 3HPOA 3QEPA 2JEFA 4NYNA 1Q8IA 2VA3A 5FROA 3GQCA 4QWDA 3CG7A 3QZ8A 4ECWA 3CFOA 1WSIA 3ITHB 4RW8A 3ZSWA 1WSGA 1LW2B 1S1WA 3S3OA 3CVKA 1SL2A 5J2PA 4H4OB 2ITGA 2XC9A 3OS2A 4NCBA 2W7PA 4MK9A 5KRTA 3M8PB 1WNSA 4K4VA 4NLPA 4ICLB 3MEGB 4K8XA 3AA5X 1D5AA 3ISNC 1QSYA 3OHAA 2F8SA 4IG0B 2A1SA 1QE1A 2YHAA 3DOLA 2AX0A 3V9ZA 5KT4A 4K4XA 1RNHA 2XRIA 5SZTA 4R8UA 3AA4A 4O5BA 2RDIA 3GYNA 5DMRA 2QK9A 3KLHA 1SUQA 3K5MA 1T05A 3EZUA 5DQIA 1I3AA 2JLEA 3IAYA 1LW0B 1QUVA 4WFYA 3WNHA 3KLIB 5KFUA 4DSIA 3DRSB 3UIQA 4DF4A 3V6DB 4FJNA 3DDKA 4O3PA 4ZHRB 4AILC 4Z4CA 4CIFA 1VSHA 1ZBLA 4KBIA 1BGXT 1GX6A 1N6QA 2FBYA 4LSNA 2HWIA 1X9MA 4RW9A 3OYHA 4HCCA 3Q8RB 5KG3A 2GIQA 5J2NA 1T94A 1S6QB 3LWMA 2VG5B 1S9FA 4I2PA 2IOCA 1R0AB 4RW6B 3NGYA 3OY9A 1JXBA 1RTDB 5C5JA 2HHQA 4DL4A 2BRLA 1RYSA 3QETA 3KLGB 1XI1A 5KFGA 1MU2A 4ECVA 5KFCA 3SJJA 4FLUA 2HHVA 3CJ4A 4FLWA 3CO9A 1U47A 4B08A 3RB6A 4ELVA 4Z4GA 1HQEB 4NYFA 4L8RB 2AQ4A 4XO0A 1NK4A 4J9RA 4MFBA 3VQ8A 3RMBA 1JLEA 3QEWA 1SH3A 4B9MA 2WOMA 3OSPA 5T14A 4J2DA 3OJUA 1IKWA 3C6TB 5KGXA 4Y3CA 4Y2CA 4QW8A 1S1VA 1L3TA 3P1GA 4AHCA 2WONB 4F2RA 4Q44A 2BR0A 4FJKA 3SI8A 3QLHB 1SH0A 4KKOA 4EYHB 2OPSB 3V1RA 4XPCA 4RNHA 3SZ2A 4DFKA 4M3YA 4DQRA 4NLYA 5KG2A 2W8LA 3QNNA 3MR5A 2VWKA 1TKZA 3Q8PB 5KFFA 4CF1A 3OYDA 4FJMA 5KT6A 4B9LA 1JLCA 4DL3A 1LV5A 3PW4A 3D28A 4CE9A 4OGCA 1YTAA 3M8RA 2E6MA 1BCOA 4NYZA 4E7LA 3N6MA 5J1EA 4OKEA 1BI4A 5KFDA 3LP1A 1W0HA 3M9NB 4WE1A 1T03B 1C0UA 1N5YA 3V9SA 1YVFA 4OKJA 4MIAA 4ZVFA 3OS1A 1NK6A 5KFSA 1S1WB 4B8AB 5EWGA 3ZT4A 3O3HA 5EWFA 2D0BA 4NLQA 4CK1A 1T8EA 2HHWA 4HUEA 1Z4UA 4KPYA 3SCXA 3LDSA 4YMEA 4EEYA 1QE1B 3V9XA 3DOLB 4KB7A 4NCAA 3BDPA 3T3FA 2OPQB 2VG7B 2ILZA 2XO7A 2XY8A 2D41A 1DLOB 1WNEA 1D8YA 3AVGA 3CDEA 4KV8A 2KFNA 3BR9A 3ZSQA 1UOCA 3KLHB 4ED0A 1SUQB 1IKYA 1T05B 3KK3A 4J2AA 3H08A 5F9LA 3QERA 1N48A 1CXQA 5L1KA 3KLEB 3TAGA 2KZMA 4DTXA 4DQQA 4FJ7A 4ELTA 2G8KA 2P1JA 4QCLA 3ZSZA 2O4IA 5F9NA 1XHXA 2CJQA 5SWMA 4CHQA 4FK2A 1LAVA 1QSLA 3BSAA 4ECQA 1J54A 3DMJA 3TAEA 4ZP9A 4WYWA 3AVCA 4CJVA 1N6QB 4EO6A 5DG7A 2ATLA 2PYJA 4AHUA 5KFHA 2IA6A 2VG6A 4I2PB 5DG9A 2HB5A 2DPJA 3DLGB 4J9NA 2E4LA 4EBDA 2YV0X 3RTVA 4FJXA 4M3RA 1JLAA 4KTZA 4ECSA 1EXQA 3KHGA 4O3NA 1JLBB 2E9TA 4K4ZA 3HPHA 2ALZA 4ZPCA 4CEQA 3OYJA 1NJWA 1MU2B 4AHRA 4HYKA 4KHRA 4LSLA 1RTHA 3SUPA 2ZE2A 1T7PA 4JLHA 4NRTA 4E7KA 4KHUA 3SNNA 1RBRA 3IGVA 2P5OA 2XI3A 2RN2A 2I5JB 2WOMB 4YR3A 2PZSA 1IKWB 5CZ1A 4PUOA 4HKQA 2HHUA 4I2QA 3MTKA 4WFXA 4CJFA 5KFRA 2YKMA 4MIBA 4ECZA 4AHTA 1JXLA 4W5QA 3VQ7A 1RDAA 1EETA 3NBPA 2YNIA 1QHTA 3DOKA 1Z25A 5L1JA 4J2EA 3CJ5A 3TQ1A 1QAJA 1K1SA 3DRPB 2HW3A 2FJXA 2JC1A 2R8GA 4CHNA 1U04A 4FJ9A 4FJHA 3OLBA 1NNDA 3VQ6A 3KKRA 4GMJB 5KG4A 1FKOB 3EZ5A 3V6HA 5KGWA 2AJQA 2W9AA 2KQ2A 1S1UA 5J1EB 3PR4A 4ZPBA 1C1CA 1BI4B 2ZD1A 1IG9A 3LP1B 4FS1A 4WE1B 3HXMA 1N5YB 3KJVB 1ASUA 1K1QA 2IDOA 2UVWA 4J9KA 2ZKUA 4EO8A 3S3MA 4ED3A 3ASMA 3ITHA 4JV0A 3ZCMA 4CJTA 1Z26A 3LZIA 1KHVA 3RRHA 4H4OA 1GX5A 3F9KA 4F4YA 4IKAA 2KZZA 2E9RX 4FYDA 5KRSA 1D9DA 4J9QA 4ICLA 2WK4A 3MEGA 2DFHA 1GOBA 3OYNA 3OL6A 2B43A 5HRPA 2C2EA 3FQKA 2IM1A 3RAXA 3DLBA 4KV8B 3WNEA 4FJGA 2FVQA 3RBEA 2FBVA 2XY7A 2P5GA 5KFIA 1IKYB 3PZPA 1LAWA 2IBKA 4DL5A 3VN5A 4FLXA 3AVHA 1HARA 2PY5A 4KB0A 1UA0A 4MKAA 3V6KA 4K4TA 2ASJA 2AGOA 2F96A 5K14A 5KFAA 3H59A 2XCAA 3HO1A 3IN5A 2QXFA 4TQRA 3DMJB 5KFJA 3MF5A 4M3ZA 4YR2A 2W7OA 3N6LA 3K5LA 3TANA 3CDWA 1VRTA 2KFZA 4E7JA 1QAIA 2OZMA 1KSPA 1VSDA 1JLAB 1S6QA 2VG5A 1R0AA 4FJLA 5KT3A 4J9SA 5JUMA 2HHTA 1RTDA 3MR3A 1BCMA 2AGQA 4N56A 2AGPA 2KTQA 3NF6A 4LSLB 1RTHB 1L5UA 2FVCA 4OPKA 2IGIA 3KLGA 2YNFB 3O3FA 4OLAA 4ZPDA 4CF0A 1IKXA 2X6SA 4F4ZA 2XY6A 3M9OB 1UAXA 4MKBA 1HQEA 3BSCA 4QWEA 4KHMA 3DLHA 3EY1A 3KD5E 1MMLA 4PUOB 3G0ZA 3DLEB 4IFVA 2BQUA 2YKMB 1RA7A 3NF8A 3C6TA 3FDSA 4Q8EA 1GOAA 1EETB 4KRFA 3NBPB 2YNIB 5KFMA 5KFKA 3HM9A 4FBUA 2ASLA 3PJWA 3IS9A 4TQSA 4G1QB 4B8CA 5DG8A 3ZT3A 1LWEB 4RUAA 3HJFA 3Q8SB 5DGBA 3AVFA 4CEBA 3HL8A 4AHVA 1A5VA 4M3TA 4O0IA 1J5OA 1S1UB 1ZYQA 4ZPAA 2ZD1B 3H4BA 4YQWA 5KTQA 1S49A 4O55A 3OHBA 1L3VA 2DY4A 5C25A 1IKVA 1RBTA 2GUIA 3K5OA 1T03A 1I6JA 1JXEA 4NZ0A 5KFOA 3TARA 1IO2A 4QWBA 2R8HA 1C2PA 4CERA 3HSTB 5KFVA 1RDCA 1C0TA 2W42A 3ISND 4JV1A 4Q45A 1TKTB 4KI4A 3AVLA 3ZT0A 1VSKA 1HNVA 3QEIA 4O3OA 3GV7B 1BIZA 1ITGA 3RB4A 4FM2A 4RZRA 2OPQA 2VG7A 4K8ZA 4ED8A 4C8KA 1DLOA 4JRQA 4QWAA 4H54A 3PW2A 2Q3SA 1BIUA 4KHYA 3BGRA 3T19A 5KG7A 1HQUB 4IOBA 4CEDA 1J9AA 2B5JA 4ZP6A 3AVNA 4KHNA 5K14B 2JEIA 2IC3A 3VQPA 4ID5A 3KLEA 3JSMA 2QKKA 3K59A 3IRXA 2JC0A 3NFAA 1NK0A 3KK2B 3HVRA 1NK9A 1TKDA 4CJWA 2BRKA 1KFDA 4GVMA 4CF8A 4W5NA 1U4BA 2Y1JA 4DS5A 1LWFA 1L3UA 1VRTB 4TYBA 4DSEA 5KG5A 1XWLA 3LWLA 3H40A 3E51A 1QQCA 3QIOA 3D45A 2JEGA 1HYZA 4K50A 2O5DA 3M8QB 3DLGA 1UWBA 1TQLA 4WXWA 2D3UA 3OJSA 1A5XA 4IFYA 4F3OA 3L3UA 2R2UA 1JLBA 4Q8FA 4B9SA 1IKXB 4FM1A 4Z4IA 3UDLA 1XR5A 2IAJA 2P51A 4C8MA 1C1AA 5KFYA 3OYEA 4TY9A 4WXOA 3MEEA 4MQ3A 4ZP7A 3H5YA 4IFVB 4QW9A 2I5JA 1DTTA 2HNDA 1S4FA 4KTQA 2HHXA 4ED1A 1XR6A 1K6YA 3RMCA 4ZVEA 3IS9B 3V1QA 1S10A 1S5JA 5KFLA 1RT2A 4QPXA 3OYLA 4ZTJA 3AO2A 3ZSVA 4QWCA 3OL8A 3E01B 3TR8A 4DSFA 3AO3A 3DRPA 3CJ2A 1JLQA 2Z1JA 2UUTA 5F8LA 4GC7A 1JLFA 1J5OB 2W9CA 3KLFB 1ZTWA 3LZJA 3I0RA 1JKHB 1KFSA 1FKOA 2FLPA 4CFCA 4ZMMA 5C25B 1IKVB 4RW7A 2R2RA 4FXDA 5C42A 1FXXA 3MECA 4E89A 3L8BA 3KJVA 2V4RA 5F8HA 4M94A 4QOZB 2OH2A 1B9FA 4Z4EA 4Z4HA 3CQ8A 4DSKA 1S9GB 4J9PA 4CJUA 1ZBIA 1C0TB 4HCBA 1TP7A 3KMQA 4JUZA 5DLFA 4F4XA 3WNFA 4FW1A 2FVSA 1WAFA 1S1XB 5CY4A 1HNVB 2YNGB 2ATQA 4K4WA 1S1TB 1RILA 3G10A 4DTUA 4CF2A 2OPPA 5HRNA 3KTQA 4I9LA 3QIPA 3G6XA 3BGRB 1TAQA 3NAIA 4EBCA 3FSIA 2D5RA 3L2RA 3KMSA 3PW0A 4M95A 5KFBA 4N41A 3L3VA 4DTSA 3GIIA 2B5JB 2IC3B 2X74A 3H98A 3MAQA 3NAHA 4ID5B 5KFWA 1U45A 4M3XA 5EUHA 4CJ4A 4NCGA 1REVB 2YKNA 3JSMB 3C95A 3VQDA 3ZSYA 3CM5A 3IRXB 4IDKA 3HKWA 3LAMA 3TVKA 1D1UA 4EYIB 1ZBUA 4BACA 2IJNA 3KK1A 5I42A 3AVAA 1RAJA 5KG1A 4BDZA 3SFGA 4FVMA 3DLRA 1LWFB 2IJFA 4ZVHA 2DPIA 4ID1A 3ICLA 2FLNA 1ZBFA 2YHBA 3KOAA 3BQ0A 3U3GA 4RNMA 3AVJA 4OLBA 4X2BA 4TXSA 4HHTA 1NHUA 1UWBB 2G8FA 1RBUA 3M8SA 3OS0A 4CF9A 5D3GA 2BQRA 4IFYB 4CGDA 3SPZA 3HYFA 2QE5A 2Z1GA 4JRPA 4GC6A 4XIUA 4FLYA 5DK5A 3NMAA 4WYLA 3GILA 2IAJB 2YNFA 3H4DA 4O44B 5DLGA 3NAEA 4DMNA 3IGNA 3SYZA 4JS5A 3MEEB 2V9WA 4CJRA 2XI2A 5FDLA 2UVVA 4W5OA 4CGFA 1DTTB 2HNDB 4NLUA 4N76A 4M45A 4FK0A 2FBXA 4BDPA 3DLEA 1TV6A 4CEOA 3OYGA 2BQ3A 1RT2B 1RDDA 2WRMA 3K2PA 1YTUA 3DLKB 5DGAA 3FQLA 1RT4A 4G1QA 5KG6A 5J2MA 4KAIA 5KT2A 2HWHA 4O3SA 2KW4A 4U7CA 1LWEA 3C94A 1Q9YA 1WN7A 2HNZA 1JLQB 2ZQBA 3QINA 1KVCA 3A2FA 4CEZA 1X9WA 1JLFB 4K4UA 2W9CB 3DRRA 5T7BA 2HVIA 3I5BA 3JYTA 3G86A 1RTJA 3I0RB 4E3SA 2BE2A 2D3ZA 4RW7B 1B9DA 4E7HA 5C42B 3N6NA 3CJ3A 1X1PA 1TKXB 1U48A 3MECB 1S48A 1S6PA 3DM2B 1TK5A 3QEVA 3TI0A 3OYCA 2R8JA 4KAZA 5KFNA 1KLNA 4JS4A 4DFMA 3PW5A 2C22A 3K57A 2AX1A 3L2QA 3QYYA 3TAQA 4EZ9A 3BSNA 3TAFA 1TGOA 4B9NA 4URQU 4J9LA 1YVUA 3PW7A 3K58A 2D0CA 1D0EA 1RTIA 2WHOA 1VSLA 4KSEB 2B6AA 4KB1A 4N47A 4ED7A 4LY7A 3NHGA 2R2TA 4I9QA 4NLSA 2GIRA 1TKTA 2OPPB 3QIDA 1RT6A 3LPTA 4C8LA 3QIPB 2Y1IA 3AVBA 1ZTTA 1HYVA 1CSJA 2OPRA 2J6SA 2XY5A 3SUOA 3SQ2A 2B4JA 1HRHA 3K5NA 2VWJA 4DTRA 4DLGA 4KE5A 4NCGB 3KNAA 1HQUA 2YKNB 5HROB 3CWJA 4J9MA 4CJLA 3MR2A 4IDKB 3NGIA 4WFZA 3PO5A 3OYIA 3CFPA 3LP3A 3QESA 5C24A 3KK1B 5I42B 1RT7B 3UQSA 3KK2A 5F8JA 1B92A 1EKEA 3RRGA 4FJJA 2GC8A 4YFUA 2HVHA 2RF2A 2LSNA 1RT5A 3ZSOA 4OL8A 4O3QA 3ZSRA 4DF8A 4XPEA 4C8OA 4IR1A 3MXJA 1HYSA 1SL1A 4CCHA 5D3GB 4FCYA 2PYLA 1RDRA 3KHHA 1BQMA 1ASVA 3M8QA 3SQ1A 5KG0A 2ETJA 3HVWA 4N5SA 3SPYA 3VQAA 5KT7A 2NUBA 3OL7A 4TY8B 3NH1A 1WSEA 4FLTA 3FRZA 4Y34A 1RDBA 3KHLA 2C2DA 4ECUA 2HHSA 3SV3A 1Y97A 5FDLB 1FKPA 3D5MA 4M41A 4EP5A 1NJXA 3QEXA 4LH4A 5CZ2A 1TV6B 4PWDB 4ZVGA 3CDUA 2JGUA 4BWJA 3BQ1A 4FS2A 1RT4B 5J2MB 1WSFA 3EPGA 1TL1B 4Q43A 3VA3A 3CIZA 1RT3B 4PY5A 3PR5B 2HNZB 5CYQB 4IG3A 4WZMA 1IH7A 4IQXA 4LD0A 4OJRA 3DRRB 3VQQA 3E01A 3O3GA 4I7FA 3T1AA 3JYTB 2VA2A 1RTJB 3PJXA 4RNNA 5J2QA 2BE2B 3KLFA 3H2LA 4F50A 2W9BA 2F8TA 1JKHA 2YNHB 1S6PB 1GOCA 4KO0A 4IRKA 4DQPA 2HNYB 4FZXC 3FFIA 2XHBA 3CFRA 3VQCA 3LP0A 4O4GB 1D9FA 4R5PA 1RTIB 1S9GA 2B6AB 3RB3A 4MK7A 4DTMA 4B9VA 3I0SB 1TVRB 4BWMA 4CIGA 3TWHA 1S1XA 1RT6B 2YNGA 4DU4A 1S1TA 3L2VA 1S9EA 4KHWA 4MK8A 3OLAA 3IG1A 4FBTA 4NRUA 3HVTA 2OPRB 3VQ5A 1SV5B 3OYMA 1NOZA 4CJKA 1HNIA 5EDWA 2J6UA 2ILYA 4F3TA 3UPFA 5HP1A 5HLFB 4B3OA 3BREA 4E19A 1WLJA 1SL0A 1REVA 5C24B 3ZSXA 2Z1IA 4IRDA 2V0NA 4KTWA 4CHPA 2V4QA 1QSSA 3PX0A 2BGGA 4TSXA 1SKSA 2RF2B 4NLWA 3NGDA 1RT5B 1TL3A 3MEDB 4LQ3A 4ECTA 4CGJA 1TAUA 3SQ0A 4OPJA 4Z0UA 1HYSB 1NKEA 3EYZA 3MFHA 4O0JA 2FVRA 1EP4A 1SH2A 3V6JA 4F4KA 3LP2A 4CFBA 1BQMB 4IH6A 4FK4A 1DTQB 4RUCA 4NLTA 4Q0BB 5F8MA 5KFPA 4OVLA 3RMDA 4UQGA 1TK8A 3V81A 4HUFA 4R0EA 4NLVA 1XC9A 5KFTA 4AH9A 3QO9B 3TAMA 4DL2A 1JL1A 3GV8B 1HMVB 1ZETA 1FKPB 4O44A 3NH2A 3VQEA 2R7YA 3NDKA 2A1RA 4M3WA 5KFZA 1EX4A 2W8KA 1WSJA 4BE1A 4HUGA 4CJ5A 4IRCA 3MXMA 4FZZA 3G6YA 1JLGB 1JIHA 4CK3A 2C2RA 5F8IA 3ZT1A 3LALA 1KVBA 3C6UA 1VSMA 2IS3A 1RBSA 3CJ0A 1KTQA 1NK5A 4H4MB 4NLOA 2G8WA 3DLKA 4O3RA 3KKSA 4QAGA 5L9XA 2R8IA 2XCPA 4HTUA 4IG3B 3RMAA 4U6PA 3SFUA 2AU0A 3HHKA 4I7FB 3U6FA 3T5HA 1RA6A 3EPIA 2GBZA 4ZTFA 4BDYA 5J2QB 1RT1A 3L2UA 4JV2A 3OL9A 2E9ZA 2FJWA 2W9BB 1KLMA 3KHRA 5HBMB 2FBTA 3NF9A 3OSNA 2HAIA 4KO0B 4OKKA 2OZSA 4RW4B 2C28A 2O4GA 2R8KA 4NLXA 4Y1DA 1TKXA 3FFIB 3DM2A 3BSOA 5FRMA 4RU9A 1CZ9A 1VRUA 3RBDA 3LP0B 3NH0A 2WTFA 4DSLA 2E6LA 3OYKA 2ASDA 4R5PB 1TK0A 1LWCA 1ASWA 3D0PA 4CGGA 2BDPA 4CIEA 4ELUA 2UUWA 4B9UA 3NGZA 4DG1A 2RKIA 3NF7A 3OYFA 3MXIA 3L2WA 1Q9XA 4RG8A 4GW6A 3AVIA 4Y1CA 3PY8A 2XWYA 4RW8B 4DWIA 3QNOA 4H8KA 4CGHA 1S9EB 5J2PB 1SKWA 3I8DA 3IG1B 2OA8A 4TN2A 3HVTB 2QV6A 3U3YA 2X78A 1JL2A 4IR9A 3S9HA 4CJEA 1HNIB 5CYMA 3HK2A 1OS5A 3DI6A 2D7SA 5HP1B 3V4IA 4URGA 5I3UA 1QTMA 4B3OB 4RNOA 3AVMA 4E7IA 3T5LA 4BE2A 3SUQA 2RDJA 4W5TA 5HROA 3P5JA 1VSJA 3ALYA 2GV9A 4R8UB 1C1BA 4CEAA 1S0NA 4F2SA 4LQ9A 4BE0A 4YR0A 1RT7A 3V9WA 3SI6A 3NKYA 1KHWA 1TL3B 2FLLA 1VSFA 5JXSA 4KHSA 3HT3A 1CLQA 3I5AA 3OVNA 3LAKA 2FJVA 1HPZA 3PVXA 1L3SA 1EP4B 5KFXA 5KFQA 2OYQA 5DQHA 5DQGA 3LP2B 1BL3A 3O4NA 2HMIA 3VQSA 3AA2A 3F73A 4HVJA 4DQSA 3KD1E 1NOYA 4DTOA 1WAJA 5F8NA 4CEFA 4CGIA 3MFIA 3V81B 4LSNB 4RW9B 3RB0A 4FLZA 4KFBA 2D0AA 4K4YA 5J2NB 4RNFA 3HP9A 4CEEA 4ED2A 4IBNA 4TY8A 3TAMB 2RPIA 4DFPA 4DU3A 5KFEA 1VK0A 1KRPA 3AO1A 4B9TA 2G8IA 3OYBA 1S0OA 4IH7A 2FC0A 3SV4A 1BQNA 1FK9A 1S97A 1NJZA 3AV9A 4DL7A 4PQUA 1N4LA 4PWDA 2F8EX 4KHQA 3C6UB 3BQ2A 2IMWP 4MFBB 1JLEB 3T5JA 3OYAA 1T3NA 5L1IA 5HRRA 4CHYA 1S1VB 1BHLA 1NKBA 1TL1A 5F8GA 4NLRA 1RT3A 3KIOA 2Z1HA 1CXUA 2BANA 1RT1B 5CYQA 3AA3A 3NL0A 4KKOB 4NLDA 1KLMB 3ULDA 4FJ8A 3ZT2A 2FVPA 1S0MA 1TKZB 2XGQA 1W25A 3G6VA 3THVA 4DTPA 1NK8A 1JLCB 3RR8A 4CFAA 3VQ4A 2YNHA 3T5KA 3TABA 1ZBHA 2WB4A 4FLVA 4TLRA 3AVKA 1G15A 1VRUB 4AHSA 1C6VA 3VA0A 5FRNA 2HNYA 3CM6A 4DQIA 1F21A 1WSHA 1LWCB 3DYAA 3PUFA 2G8UA 4C8NA 4YNQA 2DTUA 4DG1B 4E1MA 1NHVA 2RKIB 2EC0A 4O4GA 4G3IA 1VSIA 1W9HA 4CFDA 2DFEA 5JS1A 3HVAA 1C0UB 1UA1A 1X9SA 3M9MB 4DFJA 1XHZA 3CYMA 4EP4A 4CJQA 1BISA 3I0SA 1TVRA 3RAQA 3H5UA 1LW2A 4LH5A 2G8VA 5CYMB 3GV5B 5JS2A 1IM4A 4KI6A 3DI6B 4DLEA 3M8PA 3V4IB 1SV5A 5I3UB 3QGGA 1NK7A 3QGHA 4IH5A 3V9UA 4J2BA 3BJYA 2J6TA 4F8RA 1XR7A 4URSA 3H5SA 4WZQA 4IG0A 5HLFA 1C0MA 1C1BB 1A5WA 4CHZA 3PO4A 3QZ7A 1RBVA 3WNGA 3GIKA 3KK3B 4ECRA 3PHEA 4FM0A 1CZBA 4DTJA 1NKCA 4DS4A 3SQ4A 3QGIA 3SUNA 2UVRA 4Z4FA 1HPZB 1U49A 4EZ6A 3MEDA 2EHGA 4FW2A 4FJ5A 1LW0A 3I5CA 4K4SA
chains in the Genus database with same CATH superfamily
1N0VC 3B6PA 3SQGB 4YP3A 2HMIB 3QQCD 1VJWA 3KLIA 2WCXA 1X4BA 3BN7A 2VZ9A 2QO3A 3AO4A 4NLGA 3W2VA 4KFBB 3R5AA 3H5XA 2W6KA 4JI1J 1YGYA 1WUAA 1YX2A 1GT8A 3AO5A 2WVBA 2CQCA 4FWQA 1HJRA 3W9IA 4DU1A 3N5BA 3A8IA 3NGUA 3K89A 3TAPA 2DFFA 1HMVA 1BQNB 1NGGA 4PG6A 1NXIA 1JNRB 2XGPA 4ZPTR 2QKBA 3Q8QB 2VDIA 3HPGA 1HWJA 3CI5A 2HIYA 4ZP8A 5K8PA 2I1RA 4DCJB 4FZYA 4A57A 5TKWA 3TX0A 1NJYA 4DV5K 1P90A 2EFNA 5L1LA 3NCIA 3TJ9A 2NSCA 4DTNA 3HHEA 4E0DA 2GGPB 2BANB 3OV7A 2NYIA 1U09A 4AQYF 4H0OA 3O5BA 3DOKB 4ILGB 2CQHA 1JMTA 2DISA 3KLVA 2UXBF 2E5IA 1QS4A 5FJ4A 1M1HA 5KT5A 2E2PA 3H20A 3N9UC 2R42A 1U26A 2J9DE 1X3MA 1QAYA 2GO8A 4KH6A 2FJBB 1RWUA 4UOFA 2HZCA 2ZJQL 4CECA 3D6FB 4YOVA 2VPZB 4LIWA 2HQ3A 1IBMJ 4HTIA 4JKAA 2QL7B 4ISFA 1XEZA 4WP3A 2O8CA 4FF2A 1N5SA 2ZBCA 5I3QA 3GQCA 1H38A 3CG7A 1WF1A 4ECWA 1T9YA 2V8DA 4BRHA 3ZSWA 1LW2B 3S3OA 2QWRA 3J7YI 2CADA 1SL2A 2XC9A 1DEJA 1TFYA 3H3OB 1DQAA 3S41A 2YY3A 1T95A 4IOAQ 1QSYA 2DYAA 5CABA 4N77A 3DOLA 3TZYA 3D1QA 2FHKA 1Z1ZA 1DZ5A 1Y7PA 1TMMA 4O5BA 4CO3A 2RDIA 3PJ9A 1CULB 2P9KA 5DMRA 3HSZA 3MPYA 3KLHA 1UFLA 2PFUA 3EZUA 3VZHA 2JLEA 2XNRA 5H9EK 2FHJD 2HSEB 2GHPA 5BR8F 1GLEG 1WC0A 2YTCA 1LFWA 3DRSB 1S76D 4DR7K 4FWMA 3DDKA 2SXLA 3MCAB 3M1FA 2CQPA 4AILC 5GIOA 4CIFA 3LDNA 1ZBLA 3VZIA 5HMZA 3SBTA 2V8VA 1BU6O 1N6QA 1X9MA 2HWIA 2LU2A 4OI1A 2Q6BA 3ZETA 5GADI 1R43A 1T94A 1S6QB 3LWMA 4I2PA 1R0AB 4MO4A 2F4VJ 2MQMA 4RW6B 3NGYA 3PSFA 2ZGYA 1HPMA 4DV6F 4KGKA 5LMUJ 2RHSB 4DL4A 4RBVA 1WOSA 1KQGB 2R7WA 5KFGA 1I94K 4LRCA 4ECVA 4P6QA 3IBWA 3ZZOA 3VAGA 5ADZA 3CO9A 4ZITA 4ELVA 1HQEB 1N36K 3CD6N 5BYSA 1JLEA 1SH3A 2D0OA 4FXWA 1YK9A 3C6TB 3E9LA 3KVGA 2P2CB 1VQSA 3P1GA 4JI3K 4AHCA 1C4AA 4F2RA 4JI4F 2BR0A 1TYQB 3WX4A 3SI8A 3QLHB 4ETXA 5AQHA 4HTJA 1SH0A 2HF4A 4KKOA 4I6YA 4J9VA 3Q8PB 4CF1A 4FXVA 5KT6A 4KH4A 3FMBA 4DL3A 2W1BA 3D28A 4ZN1A 3WDOA 1ATSA 1XJWB 2NXCA 1YRTA 3BS9A 4KHPJ 3L09A 1BCOA 3EVOA 4NYZA 4E7LA 5J1EA 4CLTA 2ZJPQ 1LXNA 3LP1A 2OEKA 3RU0A 3ZO7A 4ZVFA 2K1RA 3OS1A 3FSYA 5KFSA 1S1WB 4H0PA 2A10A 1LXJA 5EWGA 3JTPA 3UKRA 4F4AA 4DV2K 3CCJN 1T8EA 1PG5B 1MWMA 1HR0J 4HUEA 2MYFA 3GG1A 4NZ7A 4YB5A 4M5IA 2CG4A 4QR2A 3JXUA 1QE1B 3BKUA 3V9XA 2MEWA 2A2CA 1F2HA 3J7AP 4LRBA 3IM9A 3TUJC 4RR5A 3HSCA 1HA1A 2D4WA 2HHHF 4ED0A 1T05B 3KK3A 5LMNF 1A9NB 1CXQA 5L1KA 1RGIA 4GKJF 5AQLA 3BZQA 5E3RA 2KXNB 3ZSZA 2O4IA 3OFEA 2MZQA 3TSPA 1XHXA 2DNHA 2CJQA 2MTLA 4CHQA 4FK2A 1QSLA 1PYOB 3CCUS 3MM6B 3MMVA 4AFFA 3W0LA 1UW4A 3AVCA 1CS4A 2JVOA 4LF8F 4P72A 1NPPA 4AHUA 2MLXA 5A2QY 1RKJA 1F1BB 3BKTA 2DPJA 2LEBA 5GMEA 4J9NA 1Y5IB 1OY9A 2YV0X 4FJXA 4M3RA 2B9XA 1QD1A 4ECSA 1EXQA 4MO5A 1X5PA 1E6VA 4K4ZA 4ZPCA 1NJWA 1MU2B 4EU0A 4IXCA 4BRNA 3SUPA 1AB8A 2LEAA 1CJVB 4NRTA 3CJCA 4E7KA 1RJJA 4OJHA 1YZ6A 3EN9A 2WOMB 2FUG9 4CVNE 4YR3A 3BF1A 1IKWB 5D4NA 2DIUA 3P31A 5G4DA 1N88A 2RU9A 3QJLA 4CJFA 2VQEK 5HJXA 4WIIA 4BLGA 3VQ7A 1NSPA 1RDAA 5IOLA 1Q95G 1X60A 2YNIA 2UV8A 1QHTA 1V3SA 2FJAB 3DOKA 3FLCO 4EIAA 4OZJA 3ZX2A 4J2EA 5BYRA 2BW7A 4OYBA 3CJ5A 2YQ0A 4YY3K 3AB4B 7AT1B 1V3RA 2DHHA 2FJXA 5AQYA 4L75A 1U1RA 4OZ0A 2N3LA 2NRHA 1TUUA 1X4HA 4WCEQ 1RGVA 1BI4B 2DGTA 5M2UA 4BG9A 4FS1A 1N5YB 1H2TZ 4WQ4A 1ASUA 1K1QA 4C4WA 3DCAA 3AXMA 4J9KA 5AQJA 3S3MA 2GAGC 3EGNA 4JV0A 3LZIA 1GX5A 2AYMA 3MEKA 2XULA 3WQTA 4F4YA 2E1ZA 3RGIA 3SAGA 2UUAF 2WZ1A 3HTVA 4KPCA 5KRSA 4J9QA 2AYEA 4JEPA 1GOBA 1IVZA 3OYNA 3NCQA 1XQSC 3OL6A 2B43A 5LL6Z 3LDQA 3SK3A 3RAXA 3DLBA 3TOQA 5IQQA 1VIOA 2RQCA 3W66A 2A0FB 2ZFHA 2F1FA 1REGX 5IS2A 4FLXA 4MDBA 3TEHB 2QWMA 4ZLPA 2ASJA 3C0BA 1R3NA 2RQKA 2ZZTA 3WBZA 1ZAXA 2HK2A 3OXGA 3MD3A 2RS2A 2FC9A 2DRDA 1WKJA 5D8HB 3DMJB 4PKGA 4EUVA 1S0VA 2W7OA 3EZOA 4P2SA 1DARA 2BEFA 2F63A 3I82A 2Y0SD 3BDEA 4W4MA 2OZMA 1YDLA 3Q22A 2ACMA 4YOYA 2A6OA 1V6HA 1S6QA 4X64K 3M7VA 1R0AA 5KT3A 4NXMK 4J9SA 3KUEA 1NZAA 2AGQA 3SCJE 4LF5K 1CC7A 2BOPA 4RUBA 2DVIA 1IBMF 4ZJQA 2EWSA 3EUNA 4LSLB 1RTHB 2VPWB 4OPKA 4NEZA 4HEA9 3MPDA 1DFDA 4P7TA 1RAAB 4CF0A 1BQXA 2NREA 3M9OB 3M32B 1HQEA 1XC3A 3BSCA 4KHMA 3CULA 1CJKA 3EY1A 1RBAA 3A5NC 2VKRA 1MMLA 1FNXH 3G0ZA 4CZGA 1NBWA 3C6TA 5DM6Q 3VGKA 4DPOA 3NBPB 4JKDA 4FBUA 2ASLA 5LL6d 1O6XA 1U25A 3PCOB 3DNCA 5CYJA 2JJ4D 3Q8SB 1WORA 1PO6A 3WEEB 5K8NA 4QZVB 4RWXA 4CT9A 2NPIA 1XNQK 3JSBA 1K44A 3A8EA 3B6BA 4RTFD 3I32A 2DJWA 3OTOK 2ZD1B 4YQWA 2W6LA 2HWTA 4HL9A 2A40A 4QJVA 2EW9A 3O3LA 1JWWA 4G65A 2GUIA 1JXEA 2W01A 1NCLA 5ETOA 2Q0RA 4A4JA 1G99A 5HOOA 2E29A 4ES2A 1C2PA 3MAAA 1MROB 1K8KB 4HHJA 2DHXA 3ISND 1HNVA 2CPFA 2E1RA 3QEIA 3GV7B 4UOCA 1VQPS 4K8ZA 1R0BG 3D0HE 4ED8A 4C8KA 4OZ2A 2Q3SA 2VIHA 2ZC4A 4AL7A 9RUBA 2CAJA 4MAKA 4IOBA 2K3KA 4ZP6A 4CO1A 2JEIA 2AF6A 3P5TL 3OXLA 2Q3PA 2G2YA 3IRXA 1T9UA 2JC0A 4CT8A 5AXKA 3KK2B 3HVRA 2KRRA 1NK9A 2ASPA 2RAQA 2G1HA 4CJWA 3GU0A 3PG9A 3M05A 4DHYA 3MCSA 3MPVA 4B1VA 4NPOA 2DXFA 4JHDB 1SQFA 5ETKA 2JEGA 1HYZA 2B4UA 4K50A 2CDQA 2D3UA 4JI8K 1QQNA 1M5KC 1GEHA 3J7A1 4KHPF 1Q86O 3OT9A 4TU9A 1U1KA 4MMOA 1ZM4A 1IKXB 1U2CA 2Y9HA 1CJVA 2IAJA 4X4NA 4WXOA 3NCRA 4CRJA 4IFVB 4FL9A 3MTJA 1XMQK 5C0YA 1HR0F 4ED1A 1QLNA 1K0VA 4F0KA 2DGOA 3V1QA 1WI6A 1ZXOA 2VONA 3OYLA 2VOOA 3AO2A 4QU6A 4CNYA 2ZEJA 1FRMA 4HH1A 4XAKA 2E7XA 5AE2A 3NG8A 3E01B 1OVYA 1FTCA 4L72B 3I56N 1M5SA 4C23A 1FJGK 2ROEA 3FEYB 1J5OB 2HSTA 2DR6A 1ZTWA 5FIIA 3LZJA 1JKHB 4LFAJ 1J5EK 2FLPA 3HRGA 1IKVB 4RBUA 5MLCQ 2LECA 2CJKA 3L8BA 4BGAA 2A2DA 2OH2A 4XH1A 1VQKS 4Z4HA 3CQ8A 4J9PA 1OH5A 1RTZA 1C0TB 4JV5J 4JUZA 3G6ES 4F04B 3WNFA 5IT0A 2H5EA 4FW1A 2NZ4A 1S1XB 1KEKA 3QJJA 2XMKA 2V2ZA 4DTUA 5MLCV 2NSBA 3TTDA 6FDRA 3PLAA 2Q97A 2KT2A 2OD4A 3L2RA 1XNRJ 1PIEA 1UPMB 4DPWA 3RSEA 2C42A 3KUHA 1N32J 3SDEB 4CIOA 2IC3B 3D6MB 1BLUA 3NAHA 4ID5B 5KFWA 1U45A 3CJSA 2AP1A 3VQDA 3ZSYA 2QWQA 4IDKA 3PXGa 1NGAA 3LAMA 2GVZA 2HBRB 5CE3A 4LC9B 3AVAA 2ERRA 3CDBA 2V7YA 2MQLA 3M2VB 4BDZA 5F1XA 4FVMA 3DLRA 1LWFB 1K73T 2AYBA 2IJFA 3Q0AA 4ZVHA 3EDRB 3CCUN 2BXJA 6AT1B 2YHBA 4J8FA 1XMOJ 3KOAA 5C10A 1PBUA 1NUEA 1UWBB 2Z2LA 4CLYA 3T1YF 1RBUA 3EE8A 4BS2A 4CF9A 5D3GA 2KB2A 5B0CA 3SPZA 4DMZA 1OH8A 2QE5A 1XBWA 2Z1GA 1FFGB 2FJDB 4UT4A 4XIUA 4GC6A 1GLDG 4WYLA 3AY0A 5DLGA 4NWBA 1FXDA 3MEEB 4ZCLA 2V9WA 4WQ5C 3ZEUB 4CJRA 2XI2A 4CLWA 1UVMA 4CGFA 3M32A 1DTTB 3U7JA 2HNDB 4WQ5A 3VVTA 1UP1A 5J1NA 4TLQA 2WVCA 4BRGA 4CEOA 4ILJA 2DNMA 3NOGA 4FKXA 4X65K 1RT2B 5IT9Y 1YTUA 4L76A 5DGAA 3FQLA 5CXTA 5J2MA 4KAIA 3QGPA 5EX3A 2VICA 3FZHA 4O3SA 2ZWPA 3CCVN 1SI9A 5IC4B 1RWPB 1AXQA 3QINA 3JS6A 4A8KA 4K4UA 1GMUA 4OJGA 4U8VA 3GZ7A 3I0RB 2C2ZB 1RHMB 3V4MA 4E3SA 1TUGB 3U8XA 1KP6A 2ZH4A 4DPYA 2Q43A 2QEXS 2D3ZA 3CCRS 1DT9A 2UUCJ 5C42B 3N6NA 1X1PA 2EK1A 3DXBA 1S3XA 1U48A 3MECB 1S48A 3U1MA 1TK5A 1FD2A 2R8JA 1KLNA 2NRZA 1Q7YT 3GJTB 3TAFA 1RAOA 2PI4A 1TZ0A 2B4PA 3K58A 3FEZA 1D0EA 1RTIA 2XS7A 1MROA 1VSLA 4KSEB 1NU4A 1K8KA 3M6WA 4I0WA 4GMKA 4I9QA 2GIRA 2OUGA 3IM8A 2OPPB 3QIDA 2BYCA 4KGZB 4IO9Q 1YJ9S 3OUYB 2ZZNA 1GXLA 3H6EA 1NLKL 1ZTTA 2BJ7A 3H42A 1BOTO 1KN6A 3EO3A 4AD6A 2OPRA 2J6SA 4CTAA 4NXNF 2HVEA 1GLFO 2FSNA 2PSZA 3K8VA 4KE5A 4DBQA 3DWLA 2Q2RA 4CD3A 3NGIA 1U8WA 3MPWA 1HD1A 1CQNA 3CFPA 2ZHAA 3KK1B 1LCUA 1RT7B 3KK2A 1B92A 4M5JA 2HVHA 3WXIA 3FCVA 3QFWA 3NGKA 1RT5A 3MM9A 4WFBL 2MKSA 3MXJA 4ERDA 3WZ0A 4YB7A 2MSSA 4JHDA 4CCHA 5AQMA 4ISEA 3KJFB 2MB0B 1U1NA 4DV7J 2HVZA 3OXFA 4QIEA 4FYVB 2ETJA 4F25A 3IKMA 4GO7X 3NNHA 2Q66A 2NUBA 3OL7A 3QFUA 2V94A 1UAWA 3I87A 4FLTA 4L3KA 4USVA 4Y34A 2A6MA 3A3OB 5B0BA 3KHLA 4H4KC 2R7XA 5FDLB 3GSDA 4D3HA 3QEXA 1OY6A 1IM6A 2QZ8A 3PKMA 1ZAWA 1VHIA 4LF2A 3W5YA 1Q8BA 2LCWA 4X4RA 4JI6K 4PG7A 3CIPA 2JGUA 3MN5A 2CPHA 1WSFA 1TTHB 2UU9F 1WKLA 2AHOB 2HRYA 1RT3B 3AQPA 2FZKB 4PY5A 3PR5B 4B3RK 4IG3A 4IQXA 4LD0A 4OJRA 3DRRB 3E01A 3H2VE 3O3GA 3JYTB 4RKUC 1WBDA 3PJXA 2VJVA 2BE2B 1RACB 4F50A 1JKHA 2YNHB 4G1PA 3AXKA 3EGWB 2OEMA 2F9TA 2XZDB 2ZJQQ 3VEWA 4F0MA 1YAGA 3VQCA 1ZZFA 4O4GB 3EXYA 1NDPA 3RUBL 3AAPA 5LY3A 2D1CA 1N52B 2MXYA 3G9CA 3T9ZA 1WHVA 1FRXA 2QFIA 4DTMA 1RHJB 1NEEA 3A8JA 5M2RA 4CIGA 2PMHA 4DR5J 1S1XA 1NGIA 4DU4A 1T0TV 3L2VA 2MKIA 1FX2A 2P9GA 4DR3J 2DHGA 5BN9A 3HVTA 4OPAA 2GZOA 2QM1A 3OYMA 1HNIA 4DN0A 4E1JA 1N8RT 1VQPN 2ILYA 4F3TA 3QAUA 3UPFA 2L9DA 2YKOA 2XMUA 2ITMA 3SSQA 3BREA 3SDEA 2K7JA 4FO0A 5C24B 4Q2MA 3U27A 1SC3B 4R0JA 4BRCA 3NMRA 2OMOA 1D9AA 2IVMA 5JJBA 2RF2B 1RCOB 3M8ZA 4JKFA 2QMWA 3CC2N 4LQ3A 1OH6A 1B7YB 3SQ0A 1PAEX 1HYSB 2FHJA 3MFHA 2K06A 1S99A 2O8BB 4ED5A 2DT9A 2OFGX 4KGMA 2CRLA 2B8PA 3LA0A 4Q0BB 3GR0A 1U2VB 2E20A 4LFAF 2YWGA 4IO1A 4I64A 2BJ1A 1YJTA 1HBUB 1Y9OA 5FLXY 5KFTA 1SB6A 1U1MA 2GVDB 4LIRA 1FX4A 1WB9A 4GVLA 5BYQA 4YN3B 3I55S 3NH2A 3DXKA 2R7YA 3O1LA 2GFFA 4GV3A 5KFZA 4CDIA 4BE1A 4JV5F 2WTUA 3PM9A 4FZZA 1I1GA 4UW2A 1JLGB 5AQSA 4ZLNA 3DGPB 1KVBA 1RBSA 1KTQA 2CDRB 4CZMA 2MZ1A 4AQYK 2MHEA 1HJOA 1VQ7S 1BWFO 1F5AA 4OI2A 1EO1A 4U6PA 3SFUA 4BC2A 3ZZUA 4M5GA 1RA6A 4ZTFA 2LQ9A 3MN6A 4BDYA 5J2QB 2XLIA 1N32F 4JV2A 5GAEI 3MWBA 2E9ZA 2W9BB 4ANDA 3NF9A 4P2FA 2RQMA 4OKKA 3CCLS 3NCPA 4OX8A 3SMZA 4Y1DA 3O9RA 2O8EB 3BSOA 5FRMA 4FWKA 3B4DA 3RBDA 2AZ1A 3NH0A 1TK0A 3P45B 1ASWA 3WHIA 3NF7A 5AFUH 2ADCA 3OYFA 2ZH9A 1VQKN 1T6DA 4WFAL 5H1SQ 2GELA 4HT5A 1S9EB 4R79A 4KIAA 3G6EN 1ZZNA 2WC9A 3P4IA 4DR4K 1EQMA 2N7YA 4A8QA 1JL2A 5IWAF 5CYMA 1GMWD 2D7SA 3U9ZA 4DUTA 5HP1B 3D68A 5I3UA 4B1WB 3WIUA 4RNOA 3AVMA 3E1YA 3ZNUA 3OD2A 1VSJA 3ALYA 5H1SV 4LQ9A 5BR8K 4YR0A 2FF6A 1RT7A 2DEIA 3NKYA 4QQBA 1HIYA 1GLLO 2YH0A 3I5AA 3OVNA 3NWGA 3IR6B 2NYHA 2Z58B 1RWKB 4F3QA 2VOPA 1L3SA 3LP2B 4JKCA 1NOYA 3HBTA 1WAJA 2MQPA 5F8NA 3T1HJ 4CEFA 2VQFK 4CGIA 1RP5A 2DGQA 4TNOA 3CPWM 4K4YA 2ABYA 5H9FJ 4OX7A 3HP9A 3W1YC 1KVKA 3W5ZA 4DFPA 2YKQA 1KD1O 2W4CA 2DH7A 2J0QD 3D7EO 4IH7A 3SV4A 4ES1A 2MKCA 3C7NB 3R7NB 1Q4RA 3BEXA 3VMFB 2R7VA 5CZVA 2M3DA 1URRA 1ILYA 2IMWP 1RSCA 2FSJA 4MFBB 1JJ4A 2J9CA 1SQEA 1TFWA 2VD3A 3T5JA 3JSRA 1BMQB 3L6QA 1A6LA 3OYAA 5L1IA 5HRRA 2OIHA 4NLRA 1RT3A 3MCNA 3AA3A 1LWXA 3CT9A 4WIQA 1KLMB 4FJ8A 2FVPA 3ZZPA 1Z2LA 2D69A 2DCLA 2MJNA 3TYTA 1T3VA 3THVA 1RCXB 4CFAA 2YNHA 1ZBHA 4LSZB 3CPEA 4TLRA 2YX4A 2HHPA 4DR1F 2QEXN 3CM6A 3GE1A 1F21A 1WSHA 2L08A 3DYAA 2EFPA 3ZZTA 4YNQA 4JOUA 3K0SA 2O8DB 4Y00A 4O4GA 1VSIA 5IZHA 5CZXA 3MURP 1HQ2A 1C0UB 4DFJA 2ZZMA 1U1PA 1XQIA 3CYMA 4CJQA 3E3XA 5E0OA 3RAQA 4FYWB 3W61A 3UN2A 1UJ4A 2GNKA 4CBWA 4HVZA 3W5XA 2VB6A 5TKYA 3ZTOA 4DUZJ 4OYZA 1FJEB 2AJ2A 4PG8A 1FTRA 3QGHA 3IRWP 1YJ9N 2WBMA 4QU7A 5GAHP 1FXRA 5K8OA 3R5GA 4X62J 5LOQA 1N34F 1FA0A 1LKZA 4FOEA 4B9QA 2QA1A 4LF7K 2VFSA 4QYZJ 1RBVA 4AF1A 4DR2K 4ECRA 3AT1B 4OPHA 2FHOB 2BOAA 1CZBA 1KQSR 4DS4A 3GBTA 1M5VC 4EHTA 4Z4FA 4U67L 8AT1B 3ULEA 4OYWA 3R9LA 3LF0A 1LW0A 5C2GA 3PKYA 1WSRA 4DPXA 1U02A 2IM3A 1SKRA 4EBEA 4CK2A 4ED4A 1F5BA 4W98A 4ZHRA 2UUBJ 4FJIA 1C0FA 1HD0A 1EWQA 4Q0BA 2R2SA 3RZAA 1WTBA 1FJCA 4MYUA 1RKIA 2OSRA 1Y64A 4DV1K 4Q5VA 5HMWA 5E41A 4GVEA 1HBUA 4ZLLA 2EX3A 3AA8A 3IO1A 2UUCK 2LQ8A 4FN5A 2GVDA 4ZVSB 4A8FA 4J9OA 4CJ3A 1ZBSA 4P9SA 1VGYA 1FK9B 3DDNA 3O4QA 1VJQA 3NE6A 3GIJA 2KHOA 4PQUB 4PXBA 1RFQA 4W5RA 2BUPA 4CESA 1X4AA 5JVGL 4OGEA 2OLWA 1JLGA 4MH8A 4DR5F 4WU3A 4ZPVR 1QAXA 1HWKA 3DGPA 3HP6A 3W2WB 3RR7A 3PV8A 3HJVA 1EWRA 4BREA 4DR3F 1RYRA 3HCXA 3IA0A 5KI6A 1KVAA 4RWTA 3GE9A 3D66A 2CVEA 1RHUB 1JX4A 4J9UE 2MJUA 2H3GX 1RWWB 2VC0A 5F3TA 2OPSA 2KT3A 6FD1A 1Z05A 4MTPA 4Y2AA 2QSWA 2J0WA 4M42A 3UO0A 4PA1A 2HQIA 1T9VA 3BF4A 5BPMA 3CD7A 2JFKA 2AWZA 4TYAA 3EGVA 3LPUA 4IEIA 1C1CB 2V68A 2X6NA 2YQ3A 3QRRA 4B1XB 1WKKA 4WPAA 2IM0A 4DEZA 3V1OA 3NY0A 3P39A 3UR0A 3QEPA 1U0HB 5AZJB 3QWPA 5FROA 4JKGB 3TX8A 3QZ8A 2YH1A 5BREA 3CXCR 4FPAA 4K0KF 3GJRB 2UUAK 3H25A 3CVKA 1BC6A 5AXNA 4USMA 4H4OB 2VDHA 4D3GA 2ITGA 2YHYA 3M5RA 2BKPA 4CW7B 5ETRA 2GA7A 4LF4J 4MK9A 5KRTA 2NCKL 4JKHA 2H1YA 4GO5X 2GAHC 5DDPC 3ISNC 1Z6RA 1CVJA 1RU1A 4PCQA 2AX0A 1AFIA 3LM2A 1SIWB 3D2FB 3D4JA 3V9ZA 4K4XA 2XRIA 4ZK7M 2QK9A 4I69A 3ID6A 2CIMA 3M6VA 5DQIA 1I3AA 3RBZA 2QA2A 1YZ7A 3TZZA 3ILJA 1SAZA 2PMZD 3D6RA 1HUXA 2VFUA 3AAQA 2QTWA 4DF4A 3V6DB 4FJNA 2XYHB 4JB8B 1K9MO 4OZ1A 5GAGP 4MJKA 5HATA 2VFTA 1VLYA 1VSHA 1NH8A 3C16A 1BUPA 1SQKA 3OYHA 2GIQA 3BGFA 4PXDA 4OMFG 4QIVA 1S9FA 5LT5A 3OY9A 1JXBA 2YPZA 1RTDB 5IC6B 4CBXA 3KKFA 4FSVA 3R7BB 4QIWD 1RYSA 1TL7B 3SCIE 2QXLA 4LF9K 1XI1A 1IBKK 3VESA 1OSDA 4ZPWR 3I55N 3C7NA 4FLUA 1EJ7L 2KVQE 3CJ4A 3NVKA 1OJ4A 4C98A 2PMWA 3ZZRA 1U47A 4JYAK 4Z4GA 2B7BB 3THTA 2AQ4A 3OA9A 4J9RA 4MFBA 3QRQA 2P9NA 1IBLJ 4M5DB 3OSPA 1MWZA 4J2DA 3W3DA 3MM5B 5KGXA 4DR6J 3S01A 4Y3CA 4DV3J 3FJ2A 4JI7J 4I6MB 4I6WA 2GX9A 3ZZ0A 2WONB 5L39A 1VQ7N 4FJKA 3HI0A 3UVJB 3BUZB 2JRSA 5IT4A 3V1RA 4DFKA 4M3YA 1RWOB 1VIXA 1QJHA 5KG2A 2W8LA 1YHQS 4B3SJ 5HQLA 3D54A 1GH8A 1ZA1B 5EVZA 3O9TA 2FD2A 1LV5A 3UFCX 1VBKA 3CCLN 4Z2XA 4CE9A 2P6SA 1YTAA 3EE3A 2FPHX 2E6MA 1TUWA 5AZIB 3N6MA 1APSA 5KFDA 1MW7A 1W0HA 4WE1A 1C0UA 3V9SA 1YVFA 4OKJA 2YWFA 1MN7A 3VAMA 2XMAA 4B8AB 4X4SA 3DOMB 1KOHA 1G6BA 1U7LA 1YG0A 2V51B 1FDBA 2HHWA 1YRXA 1Z4UA 1KQFB 4HHHA 1UMJA 3SCXA 4YMEA 1NDCA 5D15A 4JKEA 3EICA 3THYB 2MQNA 2OPQB 3MMAA 1WNEA 1D8YA 2V50A 4KV8A 2KFNA 3KXDA 1UOCA 1SVDA 2DITA 3ZX0A 1SUQB 3J81Y 5F9LA 3D3CJ 3UN3A 3QERA 3KLEB 5J1PA 4BG8A 4DTXA 2E7WA 4DQQA 2RQ4A 1RI7A 1RDUA 5SWMA 1LAVA 3LL3A 1KC8T 3BSAA 4EFAC 1J54A 1S6OA 2EKNA 2HFSA 3NGSA 3TAEA 4H0YB 4ZP9A 2XZTB 1YBUA 5DG7A 2MKHA 2LLZA 2IA6A 4DQ8A 5CD4H 5DG9A 3NNAA 1WC6A 2E4LA 1X0FA 2XM3A 3LDLA 3LGNA 3OBIA 3VGSA 3OBYA 5E5NA 2HGLA 2A3JA 4CEQA 1FE0A 2B4OA 3OVBA 4CH0S 4XTTA 3Q7CA 2M2BA 3MUTP 4WYBA 1HNWJ 2CQDA 1OPIA 2P5OA 2CZVC 1DKGD 3DU6A 2V69A 1FD8A 4DUZF 4A5AA 4PUOA 2HHUA 1HBOB 4ES3A 1NGEA 5EY4A 1IWGA 2YKMA 1AT1B 4MIBA 4C1NK 1V3ZA 3O9QA 2OD6A 1VHFA 4X62F 3D7SB 4YDXA 3LOUA 3WUHA 1SC4B 5M1FA 5D77A 1Z25A 5L1JA 3I96A 3G96A 2HZVA 3TQ1A 1K1SA 3KDNA 4IQMA 2JC1A 2R8GA 3NNCA 1U04A 4FJHA 3OLBA 4U9RA 3VQ6A 5A2QU 5KG4A 3SJHA 2RRAA 4OV6A 2AJQA 5KGWA 2W9AA 2EFQA 1SJFA 1S1UA 1Q16B 4ZPBA 1C1CA 5B8HA 1IG9A 3UE2A 3HXMA 3N4QA 1B4SA 5AZJA 2UVWA 4DKWA 4JKGA 3HHDA 2UUBF 2XMMA 2RSQA 3ZCMA 4LF1A 4CJTA 1VDHA 4H4OA 1C4CA 3AD7C 3QBCA 4IKAA 2AP6A 4TVAB 2ZM6K 3BKFA 3CTRA 4DV5J 3VEVA 5AQTA 2P6TA 3FSXA 3V2UC 5ETSA 1FO1A 3A0IX 2VV5A 2IFXA 2FVQA 3RBEA 2FBVA 1HKCA 3ZZYA 2XY7A 1X3NA 4FWSA 1IJFB 5KFIA 1IKYB 5AJ3F 1WDDA 3PZPA 1LAWA 5D0EA 5K8MA 3VN5A 2M8DB 4A46A 2VBZA 2PY5A 3VTIA 2AGOA 4P10A 4K4TA 2LVWA 4ZJLA 3IN5A 2DNRA 2H5JB 4TQRA 1FT8A 3SAFA 5KFJA 2CPJA 3MF5A 2XS5A 3T1YK 3A8KA 4DI6A 1QM9A 4OHYA 1VRTA 4WFBQ 4E7JA 1QAIA 4B17A 4JK7A 1KSPA 2FXUA 2BKOA 2IIRA 1RWNB 2CQ1A 3FBBA 1VSDA 1JLAB 4QIFA 3KDOA 1RTDA 5LJWA 2KTQA 3VGVA 4JI0K 3HZEA 1KVIA 3NF6A 1TL7A 5T7LB 1L5UA 2FVCA 2IGIA 2NNWA 3EM1A 4OLAA 4PYDA 4ZPDA 1NU0A 2X6SA 4BRFA 3IMXA 2XY6A 1W97L 4MKBA 3DLHA 3KD5E 4LF4F 3A5LC 2DGXA 3C14B 3NS7B 3NF8A 2X7IA 2N3OA 4IOCL 1G7CB 5AE3A 2C2KB 3ISZA 5H9EJ 4Q8EA 4OHXA 4I6MA 3VGMA 1GOAA 1EETB 4KRFA 5KFMA 3IAM9 4G1QB 4RWWA 5DG8A 4EAHD 4DR7J 4BRDA 2R7QA 2V9KA 1WHYA 1LWEB 4RUAA 5DGBA 2ZDPA 2KM8B 4O8UA 2DEJA 1WOPA 1A5VA 3H45C 3GYGA 3H7HB 4M3TA 2OTJS 1EAYC 2MZTA 2MGZB 5AZIA 2WW8A 2NRXA 4A8YA 3QDKA 5KFOA 1I94J 2OGUA 2H48B 3W3SA 3O9UA 3DOMA 4DUYK 1TUVA 1N36J 1RDCA 4YORA 2W42A 3QT6A 4JV1A 4Q45A 1TKTB 3AVLA 5D6GA 1AFJA 4NXNK 1GMVA 3RB4A 3OFFA 4YUDA 4JI3J 5ETPA 4RZRA 1AA1B 2OPQA 1D8ZA 2KRBA 4K2XA 2VGNA 4JRQA 4H54A 2BX6A 3RRKA 4KHYA 3BGRA 2P9UA 3C2PA 3T19A 1VQOS 1YXQA 2XSJA 3PDNA 3CD5A 1WOOA 3BBCA 2B5JA 3C19A 4KHNA 2W4DA 5K14B 1O51A 3VQPA 5GVQA 3P49B 3A4TA 4V19J 3KLEA 1HX1A 2E1CA 3K59A 3GJSB 3NFAA 4DR6F 3RW7A 4DV3F 1RWXB 5I4MA 4JI7F 1T02A 2CGJA 3TNVA 4IYQA 3CCWA 4DZDA 4CBUA 2MY7A 4JI5K 1X5TA 1L3UA 3ZTPA 5KG5A 4B3SF 4BROA 2UXDF 2W25A 5IV4A 2E2OA 3ELHA 2H54B 4K2JA 3M8QB 4DV2J 1TQLA 4WXWA 5RUBA 3HLUA 4BRAA 4IFYA 3EWGA 2R2UA 3IAS9 4BRMA 3GWCA 1KNZA 1LQ9A 1VBXA 3UDLA 2UXCK 2WVDA 1W7WA 4C8MA 3DLLL 2Q79A 2XYGB 2V5HG 4QW9A 1XR6A 2UU9K 3J7AN 1HBOA 2Z2ZA 3IS9B 3EJMA 4NX9A 1UVKA 3MCMA 4ZTJA 1QDUB 4DDFA 1KAYA 3CC7S 2CVIA 2EVZA 1VK8A 1M90O 3TR8A 4OZ3A 4CO4A 1I3OB 2UUTA 3ILLA 4GC7A 2PT0A 1JLFA 1RB0A 2V67A 3THXB 3MHYA 1UZHA 4CFCA 3R6MA 2QC3A 1K9MT 5C25B 2BBEA 5AFUA 2ROGA 4E89A 2L41A 1NM1A 2QYGA 1MA9B 4QOZB 4ENOA 4Z4EA 2NUHA 1FDAA 1UEKA 3MUMP 1VQNS 2C3YA 4GNIA 4AE5A 3DXMB 3CJ1A 3U1LA 3MMCB 5DLFA 7FDRA 2FVSA 4WFAQ 2YNGB 2QTDA 4K4WA 1S1TB 4KH0B 1RILA 2KHCA 2XO6A 1Q8KA 3EE9A 3G10A 1PJ5A 1XMBA 4OYOA 4CYUB 5HJYA 2VQEJ 1LNQA 3QIPA 1RBLA 4X4VA 3NAIA 3C15B 1H3DA 3KMSA 3HFZB 3CGIA 4M95A 4N41A 4ILLA 5HSPA 3GIIA 3BBFA 1HNWF 1GMWA 1S59A 2X74A 3H98A 4YY3J 4JAXA 3VEZA 1WG1A 2I38A 3JSMB 5A8RB 3EKSA 5L38A 3C95A 3UB5A 3HKWA 1WWHA 3TVKA 1D1UA 1WC5A 1MWKA 2JWLA 2IJNA 5I42A 1NB7A 3BH6B 1RAJA 5KG1A 3F5TA 3GG0A 4DV0F 3LGMA 2NXUA 2FLNA 4LREA 4XH5A 1ZBFA 4KH1B 3AOBA 3U3GA 3BQ0A 3AVJA 4HHTA 3HHLD 2U2FA 2AW0A 2A6AA 1KQKA 3TUPA 1M5PC 3C6AA 1D4XA 3GCXP 3IFEA 2LU1A 3MDFA 1IUJA 5BRFA 1YUWA 5A8WB 5C2CA 1G4CA 1RAIB 5T7LA 4FLYA 3NMAA 1MSWD 4NYOA 2XHWA 1Y0HA 1P8ZA 3R3TA 1DURA 3L4IA 3NP5A 3NAEA 3IGNA 2YCHA 2AJFE 3AHPA 1M1GA 2UVVA 4W5OA 4NLUA 1EQ0A 3ZTQA 1OPZA 1RLDA 4FK0A 2FBXA 3HM8A 4LF6F 1IG8A 2BQ3A 1HFEL 4CLPA 4DV5F 1RDDA 2WRMA 2X3DA 2P9LA 2AV5A 3M2UB 1QUPA 4G1QA 2M9KA 3BGLA 3OTEA 1IXKA 3D1OA 4OZLA 2L9WA 4A8OA 2HWHA 1A7GE 2KM8C 1LWEA 1R8CA 2FGCA 4FVCA 2HFZA 2HNZA 1JLQB 4X66K 2ZQBA 1KVCA 1X9WA 3PTWA 2W9CB 3DDIA 3O1WA 3I5BA 1RTJA 1TL5A 3NXZA 2HQFA 3M6XA 4X64J 4RW7B 4NXMJ 4E7HA 3CJ3A 3H1VX 2GWJA 3L4BC 4LF5J 4JS4A 3O44A 3PW5A 3MR7A 3GONA 1PGZA 1RUSA 4J9LA 1JJ2M 3J7Z5 1VMBA 4KB1A 4H5RA 4ED7A 5IWAK 1KQSM 2OEJA 2HG4A 3GP9A 2GWKA 1TKTA 2HKEA 4BHQA 4A8MP 2Z56B 3HMJG 2DO4A 3AVBA 3BR8A 1SS6A 1CSJA 1YITS 5A8KA 2XY5A 1CJUA 2FY1A 3SUOA 2X1AA 1UVJA 3SQ2A 1K8AO 3K5PA 1HWIA 3MM8B 3CERA 4NCGB 5HROB 2YKNB 3MR2A 1EQYA 4Q2LA 4DCPB 1M1KT 5BN8A 1NGHA 1YVNA 2VASA 2LYVA 1R7IA 3B82A 4NE9C 3VF6A 5B7WA 1XNQJ 3KWGA 4X84A 2HBMA 3OTCA 2FDNA 5F8JA 3RRGA 1EKEA 3OTOJ 4Z7YA 1JB0C 4YFUA 3I4HX 2J9EA 1FESA 4U67Q 2OANA 3ZSOA 2J7UA 4OL8A 4DR7F 4DF8A 4XPEA 5ETLA 4IR1A 4NEYA 3T6JA 4BRKA 2ASMA 4FCYA 2HQCA 2IYIA 3VOVA 1BQMA 1S22A 3M8QA 2BUNA 5F0XA 2OTLS 3AD8C 4FZVA 2HGMA 3ETOA 5KT7A 4TY8B 2YHWA 4N8NA 2C2DA 2HHSA 2YKAA 2ZJRL 1N0UA 3SV3A 3L4QA 1HBMA 5DS7A 1I94F 4I1TA 2C1EB 4P73A 4EP5A 1NJXA 3A12A 4LH4A 5CZ2A 4EI2A 4UUXA 4QYRA 1QY7A 3ENHA 1TV6B 1ROFA 1N36F 4PWDB 3HOSA 2O8FA 2BJ9A 3CDUA 4PEOA 2EC2A 5JVGQ 1NSAA 4BWJA 5BRDA 4NASA 1RT4B 3MXHP 5AQQA 2I0XA 4U95A 2NRVA 4BR2A 5LSRA 4FYXB 3G25A 2DY9A 5CYQB 1LOTB 1U1QA 1FRHA 3VQQA 2DB1A 4I7FA 3CXCM 2V8GA 2AIRB 4J90A 4RNNA 3LDPA 4H5TA 3H2LA 2F8TA 5F3ZA 4BC4A 1S6PB 4ANCA 4IRKA 4DQPA 4JI8J 3MDQA 3OHRA 2OTJN 2NUUG 4H0VB 3FFIA 2VBWA 2FHMA 1S79A 1Y3JA 3CFRA 4CO0A 1FWLA 1YJNS 2VC1A 5JLHA 3NVMA 3IFRA 3CJ7A 2B6AB 2EEYA 3DXMA 1Q79A 3ILOA 2MLZA 4ZLJA 2Q36A 4DV2F 2CNLB 4F7VA 4USJC 1RT6B 4FNIA 1XMQJ 3UNYA 2YNGA 3TU5A 1WEZA 1UKUA 1S1TA 5I3PA 4GV9A 3OLAA 3IG1A 4FBTA 3M4XA 4CYUA 4QS7A 2Y1LB 5IM0B 3VQ5A 5AT1B 1N34K 1SV5B 1KS2A 1NOZA 4DV4K 1HLWA 2R7SA 1HW8A 3CHWA 5IT9O 3TSQA 4E19A 1SL0A 1NGDA 4A61A 3J80Y 2KL8A 1VQON 5A8RA 1FJGJ 3VGUA 1OWXA 1QSSA 4S0MA 5KQDA 1GXUA 2QMXA 1J5EJ 1SKSA 4TSXA 2V4JB 2AD9A 1TL3A 4X4UA 3OFGA 2W40A 2QT7A 3QB0A 3G71S 4H0TB 2R3VA 3DC2A 1NKEA 1NPKA 1OYDA 1EP4A 1NH7A 1SH2A 2E2NA 4OX9K 2GQCA 2H3EB 3FGVA 1DTQB 2RD5C 3K0JA 5KFPA 4OVLA 4UQGA 4UZCA 3V81A 1B70B 1NMEB 1Q5YA 4GY2B 2ZWHA 4R0EA 4RX6A 1GFWB 3GPAA 2COLA 4GRSA 2W24A 3QO9B 2P9SA 4U7UK 1KDNA 1FKPB 1K0TA 4WFNQ 3MN7A 4DU7A 3VQEA 2CNKB 5G0RB 2XSFA 1B0PA 1QQOA 2CJ9A 3E9PA 3MZIA 4IRCA 3AJ2A 1JIHA 4CK3A 2C2RA 3ZT1A 1FRLA 3LALA 3C6UA 2J8AA 1VSMA 2IS3A 3CJ8A 3CJ0A 2P9PA 3R7SB 1WC4A 2MY8A 2FY8A 2VQEF 2G8WA 3QWUA 2M0GB 4O3RA 3M2UA 4ZA1A 3KKSA 4QAGA 3LUYA 2QLXA 2XCPA 2R8IA 4FF4A 5EXWA 2DO0A 4FPRA 3T5HA 3NS5A 1OSCA 3GCWP 3EPIA 2GBZA 3RVCA 5AQOA 2UP1A 3CC7N 4O23A 4RO0A 1YBTA 4USWA 3OL9A 1FRKA 2KG0A 2FJWA 3KHRA 5JMVA 2HAIA 4KO0B 2RVJA 1K73O 3EMTA 4XDDA 2C28A 2R8KA 4NLXA 2B8QA 1I51B 2I6WA 4CLKA 1QVFR 5M2PA 1YIJS 5HQMA 2V6AA 3LP0B 3A13A 2P5VA 1ZA2B 2XZWA 4R5PB 2ASDA 5FLXU 3P3DA 4P2XA 3S7RA 4CGGA 2CPYA 2UUWA 2VKZG 3NGZA 4DG1A 4K0KK 2RKIA 3SLCA 1E6YA 1SJQA 1Q9XA 1VQNN 4Y0FA 5BXIA 4L3QA 2CZ4A 4CH7A 3PY8A 1Q78A 2XWYA 3KK7A 4DWIA 5CHCB 4WBFA 1NWKA 2ZBQA 1SKWA 3THWA 3JTNA 1JCGA 2QV6A 3U3YA 4CJEA 3OQ2A 4X65J 2B51A 2RB7A 3G87A 1WEYA 3CB4A 4YHHK 2KH9A 4B3OB 2E5LF 4BE2A 5GAHI 3SUQA 5HROA 5EHHA 2YJFA 4AL6A 1N33K 1C1BA 4CEAA 1S0NA 4F2SA 1JXVA 4DX5A 1P27B 3SI6A 1Q53A 2F9WA 5HO4A 2FLLA 2DNQA 1CLQA 5DM7L 1VQ4S 2FJVA 1M90T 3R2DJ 2QLWA 3D2WA 1HPZA 1JNZB 3WC0A 4CI0B 2QWLA 2CUYA 2KG1A 5KFXA 5KFQA 2E5JA 2QN6B 3SQGA 5DQGA 2HMIA 2G0CA 5CD4A 4F0HA 3KD1E 2NXEA 1NJIT 2XLKA 2ZH2A 4OZNA 4MT1A 3VAFA 4RW9B 1RHKB 4FLZA 4KFBA 2D0AA 1Q7YO 4DN9A 2YX1A 1TMJA 2BJEA 3HF5A 4NXMF 2GQQA 1ICEB 1FF2A 4TY8A 2CQGA 3E2EA 3TAMB 4LF5F 4DU3A 4RPFA 3AO1A 2IYGA 4RUHA 2G8IA 3PRBA 1BQNA 4AT1B 2M8HA 2KHDA 1NJZA 2KI2A 2CNNB 9ATCB 4PWDA 3BQ2A 5KQ8A 1KAXA 2GMHA 2A1BA 2E44A 2BKNA 1KTVA 3ZC4A 5AQVA 4CZEA 3CJBA 2GGPA 3KIOA 2BANA 1RT1B 5CYQA 3PIOL 5B0DA 1IR1A 3VEOA 3UE5A 2GUPA 4LFBF 1W25A 2NLXA 1NK8A 2H9ZA 1JLCB 3RR8A 3VETA 2C2NA 2VBXA 1G15A 1VRUB 2FLOA 5ETVA 4M5HA 4EWTA 2POKA 5GINA 1Y11A 2DR9A 1LWCB 3JTOA 5ITHA 2G8UA 2DTUA 1RWVB 1NHVA 5BR9A 5K5MA 3CQYA 1XIQA 2CWXA 1W9HA 4CFDA 4CLZA 1RAHB 5JS1A 1U6FA 1X9SA 3NGRA 3MK6A 5FLXO 1XHZA 1BISA 5L46A 3H5UA 3BEGB 3NGTA 4C3MA 1LW2A 2GW8A 2IIHA 4JI6J 4JI1F 3R5JB 5CA5A 3DI6B 1O5JA 1SJ4P 2XMTA 2QSFA 3SEOA 2AKWB 3AARA 3V4IB 1SV5A 4IH5A 5BPNA 2J6TA 4F8RA 2XQCA 1QZ6A 1WACA 1YITN 4B3RJ 3VCDA 1A5WA 2QWNA 3O6QA 2IVNA 1Y4ZB 2G4BA 3I31A 3LPYA 3PHEA 1CULA 4XH4A 2UVRA 4GV6A 2R4FA 4UY85 1RQ0A 1WC1A 2V4JA 1WJ9A 1U49A 4H03B 2WBNA 1H73A 3Q89A 4FJ5A 2GV1A 4K4SA 2YKPA 3VQBA 3F2KA 1VK3A 3ENOA 4ZKAA 3GLJA 3D6HB 3DRSA 4DL6A 4UUWA 4KREA 4LBPA 4HDGA 4KC5A 5GAGI 2WW4A 1DTQA 3B6OA 2QIFA 1VOMA 4ED6A 4E1NA 1HNZK 3K9KA 1HNXK 2OTLN 3VQ9A 3GR1A 3R8YA 4RW6A 3HHLB 4ZIVA 3QO9A 2XB2D 2R7OA 3UDVA 1S77D 4H5VA 1H98A 4A8XA 5G0RA 1PC4A 1UVLA 1HKBA 1DQ8A 5LJVA 1YJWS 4U96A 1FFWB 1HLUA 3MWPA 1DBDA 2OSQA 1XMQF 2KLAA 1N8RO 4F26A 3SBGA 3RG6A 4I2QB 4B3TK 1I39A 4GVBB 4QS9A 1K8AT 3CETA 1DQ9A 3OVSA 4IOCQ 4BRPA 3W8GA 3S3NA 5KPTA 4WTYA 2I7PA 1TYQA 3QLHA 3L95X 3L9ZA 5HRSA 5F0WA 1FVSA 1HHQA 1O13A 4ECXA 1X0PA 1DHMA 4PKDB 3PX4A 4OHWA 4BR5A 1LK7A 4A62A 3TZWA 2BJ8A 4ECYA 3F41A 5EWEA 1G1XA 1JJCB 2JEJA 1WTFA 2JWKA 4JD2B 1MWQA 2YI1A 3ZXWA 3J7YU 3PX6A 4IO8A 3HPOA 4K5RA 2JEFA 4NYNA 1Q8IA 3W65A 1YJNN 2G2OA 2E1PA 2ZHOA 1WSIA 3UW1A 1S1WA 3LO3A 4NCBA 2HK3A 2CQIA 3M8PB 1ZS6A 1WNSA 1IR2A 4NLPA 4ICLB 1PBAA 3MEGB 4K8XA 3AA5X 5L8RC 2F4VF 4AQYJ 2RUSA 3OHAA 1W2BR 3OVAA 4IG0B 5AJ3K 2A1SA 1QE1A 1S4EA 5LMUF 2C3MA 3QJPA 3Q83A 1RNHA 1VAZA 4BC5A 1FWPA 3GYNA 4E8UA 3R1HA 3BGOP 2JLGA 1T05A 3IAYA 1EX8A 1GLJO 4FDFA 2HFNA 3FEXB 2I7NA 2OHDA 3QMQA 4PQAA 3WNHA 1VQMS 2ZHBA 3KLIB 2A41A 3AGRA 2J0SD 3TP2A 3IMQJ 3UIQA 2YX6A 1CPZA 4UOGA 5GADU 3W2VB 2LDIA 3MM6A 1B7FA 3PYGA 2LA4A 4Z4CA 4WP8A 3TUZC 3UD5A 1BGXT 2FBYA 4RW9A 3Q8RB 5KG3A 2AJ0A 1BWEA 4BR7A 2VG5B 2IOCA 1WC3A 4DR4J 2DK2A 1YSJA 3M1VB 3VEXA 3QETA 2CQBA 2ZBRA 5B08A 3C65A 3KLGB 2E88A 1MU2A 3HD2A 5KFCA 3CD6S 2PFFB 3I6PA 1Q0NA 4FLWA 2VU5A 5D4OA 5I9EB 4B08A 4NYFA 4L8RB 1T6CA 3AODA 4XO0A 3DLLQ 4FPIA 1NK4A 3QBXA 3RMBA 5BR8J 2FB0A 2WOMA 1T9XA 5T14A 2LMIA 3Q8VA 1IKWA 4X65F 2VPXB 1L3TA 2APOA 2RILA 4C2MA 4MYTA 1R8HA 4XPCA 3SZ2A 2MMYA 4DQRA 3F44A 3IWXA 4NLYA 2IVFB 2N82B 4B3MK 2Y0BB 1QTNB 5KFFA 4P52A 4DOZA 2VQFJ 2ZH1A 1JLCA 1JCEA 3HFKA 3VPZA 2MQOA 4AM6A 3VF0B 1YJRA 4M63C 3M8RA 4JNEA 2NS1B 4PXEA 2YWKA 1Y00A 1YIJN 4GKKK 1QVGR 4TU8A 1BI4A 3R9PA 1MG7A 4KR0B 3M9NB 1T03B 1N5YA 1FNOA 3A5OC 1NK6A 4PXCA 4A8WA 3ATUA 2NZCA 4ZS6A 2VGMA 4NLQA 1NBEB 2DNKA 3O6WA 3KG0A 3LDSA 1JJHA 3UCZP 4JI4J 1UW9A 2I2YA 3N79A 3DOLB 4NCAA 2Y8WA 4AUKA 3BDPA 4PPZA 2XO7A 2ILZA 4NI2B 3AH6A 2ZOGA 4KY3A 5CH7B 3AVGA 3CDEA 4ZDNA 2P9KB 3BR9A 4JK8A 2E66A 3KLHB 4FKYA 1I5OB 3CF5L 4J2AA 5B0FA 3H08A 1U8SA 3D2EB 3QMLA 1V4SA 2P8IA 2KZMA 4W90B 3DRYA 4RL1A 3CUNA 4OQJA 2G8KA 1WHWA 2XMWA 3PNIA 2CGKA 5F9NA 4WTOB 2J7WA 1VQ4N 4ECQA 4NMLA 3DMJA 4WYWA 3ILIA 3TA0A 2MKKA 4CJVA 1N6QB 4FPBA 2PO4A 2ATLA 2PYJA 5KFHA 2NR0A 3D9BA 5C2FA 4I2PB 1ZOTA 3E66A 1X5OA 2HB5A 1FEEA 3HHLC 3P5BP 3DLGB 4EBDA 3TPQA 4BR4A 1NG9A 4H5NA 4KTZA 4WKRA 3HHLA 3KHGA 1JLBB 3HPHA 2WSFC 2HEKA 2J0XA 4AHRA 4HYKA 4LSLA 1RTHA 1WI8A 5FPEA 3HT0A 4IEEA 4JLHA 1CG2A 4KH5A 4KHUA 3SNNA 1RBRA 3IGVA 1PJ6A 4LF7J 2GHVC 3IBCB 2RN2A 3UNGC 4DR2J 1VBZA 4LR7A 3J81U 4HKQA 4I2QA 3MTKA 4WFXA 5M1QA 5KFRA 1K47A 4ZCMA 5EGYA 4ECZA 4JI2K 2ZH8A 2G1DA 1WSVA 1KVJA 3G8QA 2EBEA 3NBPA 3FBCA 3FZLA 4CQ1A 4B3RF 3I9ZA 4FP9A 3Q23A 3QFHA 1OIAA 5K9FA 3X3UA 4CHNA 4FJ9A 3WEEA 4WP9A 2YWHA 4DV1J 1MWYA 2HQGA 3BZKA 3K9JA 2MLYA 5J1EB 2KQ2A 2ZD1A 3LP1B 5HK4A 2K1RB 2DR8A 3KJVB 4X4TA 4C3KA 2V52B 2MZRA 3ASMA 1Z26A 3R6LB 1KHVA 1EHWA 2XG8A 1BWVA 4M1KA 2KZZA 5M1NA 1BUXA 4FYDA 1D9DA 4ICLA 2WK4A 3MEGA 2QW9A 3ZLJA 2DFHA 4ITSA 3VF4A 4OLPA 5FPNA 3CCTA 2QA4G 4DPTA 5HRPA 3FQKA 3KZBA 2IM1A 4L6V3 3WNEA 2VODA 4FJGA 5EOYA 4K7QA 1PAUB 2P5GA 1QZ5A 4K8RA 4KB0A 1CC8A 1H7WA 1T11A 4MKAA 3V6KA 3UDEA 3AJ1A 2DR5A 3EGZA 2F96A 4KQZA 5KFAA 2QL9B 1NZ8A 2EFOA 4DV0K 2VF3A 2IPOB 5CQGA 4M3ZA 1CS4B 1RZMA 3N6LA 2BM1A 2A5XA 1NSQA 3TANA 4DB3A 5AQUA 2EWHA 1H2VZ 3FZ2A 2ZGZA 2UUAJ 5HQ8A 2RJZA 5DDQC 4YB1P 2VG5A 4CZIA 2XYPB 4WK3A 2DR7A 1E6VB 2QWPA 3S6EA 4WK1A 3B78A 3M1VA 2GMJA 4X4OA 1ZC6A 3AOAA 3I8BA 3HULA 5B09A 3CQXA 2BH1A 3KLGA 3W9JA 4ZVQB 1SQGA 5K20B 1IKXA 3BPSP 1HHSA 1U24A 2ZJRQ 1HL6A 4F4ZA 2E1MC 2B56A 4LF6K 1UAXA 1TR0A 2PI5A 1YJWN 4LR9A 3JSYA 4H4KA 3THPA 1HKAA 3DLEB 4IFVA 2LEPA 3KNGA 5DRKA 2FSKA 1BG3A 1RA7A 2OELA 2ZOMA 4PZVA 2HBJA 2YNIB 4FNHA 3J81O 3HM9A 3I4PA 3PJWA 1HHTP 4B8CA 3MUVP 3ZT3A 4NL5A 2E5HA 2CZ9A 5F0UA 2VHGA 2XMJA 4ZVPB 3HJFA 3GOIA 3Q24A 2QWOA 1WBBA 3UI3A 2N7CA 3AVFA 4CEBA 4AHVA 1RHQB 2CQ2A 2P9EA 4ETZA 4O0IA 3SIPB 3NLCA 1J5OA 1YKWA 1ZYQA 3H3NO 1R31A 4O55A 4ATNA 3NOCA 4Q7AA 1IKVA 3K5OA 1T03A 4UQTA 4NZ0A 4LF9J 1RLCL 1IBKJ 4N7TA 3TARA 3GDQA 4FWNA 1IO2A 3CJRA 3M30B 4CERA 4JYAJ 5KFVA 1C0TA 5AQNA 2ZNYA 3QSIA 1YI2S 4DR4F 1T9TA 3CNQP 3ZT0A 4LFCK 4IJNA 1OVQA 2I9SA 1ITGA 5C12A 4NI2A 3PW2A 4ALZA 4ZJOA 1NAQA 5KG7A 3PSIA 2PIIA 2H51B 1HQUB 3FK4A 3N28A 1J9AA 4G9ZA 3D2EA 4FF1A 2IC3A 2CPEA 4ID5A 4CM0A 4MLEA 2ACYA 1NK0A 2HS4A 4K5SA 2OI2A 3N5FA 5E3PA 2CH5A 1M5HA 3DLJA 4BCAA 1VQMN 2EI5A 3M2VA 1U4BA 1Q82O 5C15A 5A6WA 1LWFA 1X4GA 4TYBA 4DSEA 1XWLA 1UTAA 3BGUA 3LWLA 3BO4A 1CBKA 3H40A 1QHAA 2W41A 1U1LA 4A5BA 2VFRA 2VQFF 5AXMA 2O5DA 3DLGA 1UWBA 3W7BA 1RDWX 5E7OB 3OJSA 1A5XA 5D4LA 5DZ7A 4E2FB 1ULRA 2ZWOA 4F3OA 1P8GA 1W7AA 3L3UA 1JLBA 4B9SA 4YDUC 3T6BA 1ITPA 4WKYA 4CLSA 4HWIA 4YDDB 4FM1A 4YOXA 4Z4IA 3BO3A 3WIVA 1XR5A 4YDUA 2P51A 1CJKB 3OYEA 5KFYA 2CPDA 1YBAA 4TY9A 3HHNB 2KU7A 1EB0A 3MEEA 3H5YA 4UF4A 3ZEUA 2EK6A 2DGVA 3RW6A 1DTTA 2HNDA 2MDAA 3AAWB 1S4FA 3UN5A 1J6ZA 2HHXA 1Z2ZA 4ZVEA 1QVFM 4Z94A 5D0GA 3TO8A 1S10A 2ZKTA 2KFYA 5KFLA 1RT2A 2R7UA 3SSSA 3I56S 2RE2A 3H8YA 3ZTSA 3ZSVA 4QWCA 3CJQA 2UXBK 3CDAA 3AO3A 1XNRF 3FBEA 4OI4A 2YHXA 3CJ2A 2Z1JA 3CMQA 1KC8O 3I0RA 2JH3A 1KFSA 4IJAA 2UZAA 3K8WA 3CCSS 3D1HA 3UD4P 3VEYA 5C42A 3KJNB 3CJKB 1FXXA 3MECA 2DRBA 4B1UB 3KJVA 4M94A 2P9CA 1B9FA 4DSKA 1IBCB 2NXJA 3MAAB 1S9GB 2QLJB 1SCJB 4CJUA 1UJ5A 2G0IA 1XMOF 3Q2TC 4HCBA 1TP7A 4IFEA 4HT7A 3ENQA 2DIVA 3VVUA 4RLEA 3M8WA 1MMNA 1NO8A 1GQEA 1HNVB 2ATQA 2LA6A 1NSKL 1F9FA 4G6VB 2OPPA 4FF3A 4ZVRB 3OUYA 4I9LA 1TAQA 3O4WA 4EBCA 4HLBA 2KO1A 5GMDA 4E98A 4ZIWA 3MAQA 4OX6A 4M3XA 4LF7F 4CJ4A 1REVB 4DR2F 3CM5A 3IRXB 2QFJA 1VQ9S 1N5TA 3PHTA 3UWTA 3EKUA 1X4CA 3KWMA 1UEVA 3KK1A 2HOEA 3EZWA 3SFGA 1S12A 5DM7Q 3UKUB 2DPIA 3R3LA 3MX5A 4ID1A 3ICLA 2C2OB 4RNMA 2Z30B 4OLBA 4X2BA 4TXSA 4JP8A 3U9DA 2G8FA 4PKHA 3QNWB 3M8SA 3HKZD 3PIPL 3OS0A 2GMLA 2BQRA 4DV1F 1UCNA 2HBZB 2ZM6J 3HYFA 2DD8S 2C3OA 5M1OA 4JRPA 4DV6K 2UUCF 2HBQB 3MI7X 1BD6A 1BA1A 3GILA 2PN6A 2IAJB 3BB5A 3H4DA 4O44B 1YRUA 4DMNA 1KOOA 3SYZA 4JS5A 2XS2A 4DZ6A 4ZCKA 4FYYB 2FYX