1JLCA

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with pett-2
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
547
structure length
534
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords HIV-1 RT A-chain
total genus 130
structure length 534
sequence length 547
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlcA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlcA05
4KAZA 4F3TA 4M42A 1XC9A 1KLMB 4J9KA 4G1QA 3GV7B 2FBVA 2VG7A 2FVPA 2ETJA 5EUHA 1X9WA 4DFJA 3HL8A 1QAIA 4DEZA 3C6UB 3KKSA 4ECYA 1EXQA 5KFXA 4BE1A 4QWAA 3LWMA 2IAJB 3KLFA 3DLRA 4O3RA 4MH8A 2UUWA 1MU2B 1JLGA 1LW0A 3HK2A 1TKXA 1Q8IA 4DLEA 4E7LA 1K1SA 2KTQA 3K58A 4NRTA 4CJRA 3H5YA 2AJQA 3M9OB 1S6PA 1N6QA 3AVBA 4JS4A 4B9SA 3K57A 4CECA 2RF2B 4J9RA 3RAXA 3KTQA 1NNDA 1HJRA 3VQBA 4DSEA 2WHOA 4E19A 4W5QA 4RU9A 4YMEA 3KJVB 4ZPAA 3HJFA 1UWBA 3V81A 3B6OA 4CJ4A 2OZMA 2BDPA 1S6QB 1SV5A 3OL6A 3O4QA 4Y1DA 3V1RA 1U09A 1HQEB 3MEGA 5DG8A 5I3UB 1EETA 3MFIA 3QGHA 4BWMA 2FBYA 1C1CB 4RW4B 3G6YA 2HNZB 2HVIA 4RW6B 5J1EA 2ATLA 5FRMA 1B9DA 4FW1A 3DRPB 4KV8A 1LW2B 3KLEA 4NLVA 1GOAA 3KHLA 2HHSA 2IDOA 4LSNB 4OKKA 4MFBA 3M8QB 2G8VA 1ASWA 5KG2A 2PYJA 5DGAA 1TL3B 4C8KA 5KT3A 3BJYA 1RBRA 4BWJA 1S5JA 4LH5A 2YNHA 4R8UA 3K2PA 4O44A 1X9SA 2G8WA 4U7CA 4ZMMA 4QW8A 1CZBA 4N56A 2WRMA 1S97A 3WNFA 2VG5A 2DY4A 3RMCA 3V6DB 3FFIB 3KIOA 4DL4A 2C2RA 2PY5A 2XY6A 3RMAA 3AVGA 4CE9A 1NK6A 1JLBB 5L1JA 4J2EA 2AX1A 4CK2A 4KTQA 4O3PA 1RT2A 3JSMB 4DQQA 2XCAA 1ZBIA 3QNOA 1S1XA 3V4IB 2BQ3A 5KFQA 3QIPB 2UUTA 2E9RX 4CJKA 1TVRA 4Q5VA 4NZ0A 4OVLA 4EO8A 4W5TA 1S1VB 4TYBA 2C2DA 4ZVEA 2P5OA 4FJXA 4KI4A 4FJ8A 3GYNA 1MMLA 1RCHA 3C6TA 4ED7A 4WZQA 1TKTB 4KKOB 1HPZB 4F8RA 3SUQA 1BCMA 4DF4A 1IKXA 2F96A 2XO7A 2YNGA 2BQRA 1NJWA 1N4LA 4FBTA 2W9CA 2O4GA 4CF1A 4K4UA 2OA8A 3WNEA 2B43A 3M8RA 4IH7A 4EBDA 3FFIA 3S3MA 4DG1A 3L8BA 3HVWA 2W9BB 4RUAA 3NF8A 2C28A 1TV6A 1RDDA 3LDSA 1RYSA 3ZT0A 4TSXA 1BQMA 1QS4A 4ZVGA 5C42A 3PJWA 1HYVA 4FJKA 4AHUA 3AO1A 1TAQA 4RG8A 1NKBA 4CJQA 1TK5A 4NLWA 4DF8A 4K4YA 2NUBA 2IM3A 1DTQB 5DMRA 3B6PA 1S9GB 4K8ZA 2YNGB 3IG1B 2QK9A 2X78A 1Z26A 4KE5A 3GV5B 2W9CB 5CZ2A 2VG6B 4FCYA 4O3NA 3TANA 3DRSB 1A5XA 2OYQA 4Z4FA 4EO6A 3IGNA 4RNOA 3VQ6A 3ZT4A 1JLFA 4IFYA 4G3IA 2R8JA 3HPOA 3DLKB 5C5JA 2P51A 4I7FB 2R8KA 1BQMB 3QZ7A 4ZHRA 4NLSA 3CFRA 3TARA 4KPYA 1JLCB 2OPRB 2G8IA 3DDKA 4E7IA 3PW7A 3KHRA 1KFSA 3AVHA 4DTNA 4CGIA 3GQCA 3NH1A 3AVAA 5KG5A 4WZMA 4K4VA 3SPZA 5L9XA 1Z25A 4IRKA 3PW5A 4BACA 4ECXA 4HHTA 1S0NA 3OY9A 3ALYA 1GOBA 4JV0A 4MK7A 4ECZA 2HWIA 3CWJA 1S49A 5HBMA 2FVRA 4N41A 3KNAA 1GX6A 2F8SA 2AGOA 4FBUA 3HYFA 2J6TA 2OPSA 4B9MA 4FM2A 5HROA 3NDKA 4KB7A 2WONA 3MEDB 4B9NA 5T14A 2KW4A 3NBPB 1SKWA 3AVJA 2RN2A 2JEJA 1YTAA 1EP4B 1RTJB 2IJNA 3VQ8A 3ZT3A 3KHHA 4YP3A 3H4BA 4OLBA 3L3VA 4ZPDA 1RT7B 4RNMA 4BE2A 1RTDB 3T5KA 1NHVA 1R0AA 2ZKUA 4FLZA 3Q8QB 4M3WA 4E3SA 1HNIB 3KLIA 3NF9A 4CJTA 1LW0B 2D0AA 4NLPA 3NHGA 5FDLA 5KFLA 3CDEA 5DLGA 3DLGB 4KHRA 1U04A 1WNEA 4TQRA 1CXUA 1FXXA 1T7PA 3MF5A 2FJVA 2RF2A 4DFMA 1QE1B 4MK8A 4Q0BA 1RBSA 4U6PA 5JXSA 3QERA 3LP2B 4J2AA 4DSLA 3MFHA 4AHCA 1RT7A 4OKEA 4CERA 2YNIB 2I5JA 3OL7A 1W25A 3NH2A 3H98A 4IBNA 4QAGA 3HSTB 3KLIB 2ASJA 3K5NA 2HHQA 3QLHA 4ECWA 3OVNA 3HKWA 4F2RA 3P1GA 3NGIA 2HHUA 3ZSZA 3MEEB 1VK0A 1QTMA 3SQ0A 4Q43A 1JLGB 3OJSA 4KO0A 4IH6A 4CEDA 3IRXB 3FQLA 4CJPA 2QXFA 1KRPA 4ICLB 3JYTA 3BSNA 5EWEA 1OS5A 3ASMA 4CFAA 2JEIA 4LSNA 5F8LA 5F9LA 1QE1A 2ZE2A 1JLEA 1RA6A 4RUCA 3G0ZA 4X2BA 3LZJA 2IJFA 3PVXA 1DLOB 3CM5A 3MXIA 3E01A 4EBEA 4M95A 1B92A 1D9DA 4C8MA 2YKNA 3RTVA 1QHTA 2OPQB 4YR0A 1LWEB 5JS2A 2DFHA 1VSFA 5KFKA 4JLHA 2HNDB 3BDPA 2WB4A 3ZSWA 1LAVA 5C24B 1ZBUA 5F8GA 2CJQA 2IM0A 4FM0A 4KHNA 1RT1A 1ZBFA 3T5JA 1VSJA 4E1MA 1IH7A 4TY9A 2Y1JA 2OH2A 4DS5A 2I1RA 1C6VA 1TP7A 4Z4EA 3C6TB 2R8IA 3ZCMA 3SUPA 2D41A 1Z4UA 3EY1A 4KFBB 3DLEB 4URGA 3KLGB 4RW9A 3QESA 3AVFA 3RB0A 3VA0A 1FK9A 3H40A 2G8FA 5KT5A 5J2PA 3ZSRA 3M8SA 2HHXA 5HP1A 4PA1A 3K59A 4ELVA 2UVWA 4KHQA 1JX4A 3OSNA 4C8LA 1K6YA 3S3OA 5F8IA 2X74A 1HYSB 4QCLA 4IR9A 3IGVA 4CFCA 3ULDA 2XGQA 1C0TB 3FSIA 3LWLA 2HWHA 4E89A 1KFDA 4E7HA 3LAKA 3BREA 5HRNA 2P5GA 4EBCA 3AO4A 2X6SA 1KVAA 2HHWA 4DFPA 4H4MB 3TAMA 3ZSQA 4CEAA 1TKTA 1LWCA 1KHVA 3KK3B 4HCCA 3DRRA 3NF6A 3OYEA 1TK8A 3P5JA 5KFAA 2IA6A 4Z4CA 1RDBA 1L3TA 1S9GA 4M3YA 3PUFA 3OYHA 4QWEA 4CF2A 1UA0A 1HRHA 3FDSA 2V4QA 1F21A 4PY5A 4FLVA 3QGIA 1TAUA 2W9AA 1TK0A 2P1JA 3BGRB 2QE5A 2DTUA 1FKPA 3E51A 1RDRA 2BRKA 1XHZA 1BHLA 3AO2A 5DQGA 4B3OB 1T8EA 3PY8A 1TV6B 1RAJA 4FZZA 4HCBA 4M3TA 5CYMB 1J5OB 4GVMA 4HVJA 2JC0A 2IC3B 2G8UA 3BSOA 2AU0A 3OYGA 1U47A 4L8RB 1RT3B 1SL1A 3V9WA 4PWDA 4K4XA 3RMDA 1NKEA 4DQIA 1Q9YA 5SWMA 2C2EA 1FKOA 1HNVA 3RR8A 2DFFA 4CGDA 2IAJA 4FK4A 4KAIA 3NFAA 4CJEA 3D45A 1NOZA 1WSGA 1J54A 4CGGA 5KFTA 1ASVA 4EP4A 1VRTB 1VRUA 2V0NA 4CGHA 3GIMA 1LV5A 4LY7A 4KHYA 3C95A 2YHBA 3UR0A 4DSFA 2D0BA 2XCPA 3L2WA 1K1QA 2D0CA 4CEEA 2RDJA 1UA1A 4NRUA 3CO9A 1KSPA 3DRPA 1SH0A 5KFNA 4CIEA 5KFYA 1UWBB 1N56A 1L3VA 4PWDB 4KHSA 5J2NA 3CJ2A 3H5XA 4M94A 2ITGA 4YNQA 2XC9A 3C94A 3VQQA 3AVNA 3HXMA 3KLVA 4DL5A 1T3NA 3TAFA 3AVIA 1X9MA 4M3XA 1HQUA 3BQ0A 4M41A 1I3AA 3TQ1A 2YKMB 2HAIA 2JLEA 3HVTB 1RA7A 4HUEA 3F73A 4KB1A 3V9ZA 4NYZA 3IN5A 4NLTA 1JL1A 3CYMA 2XHBA 3SCXA 4KTZA 3G6VA 1I6JA 1NK8A 4MFBB 2W7OA 3HPHA 2Z1HA 3CVKA 5KTQA 2BANA 1SL2A 1S9EA 1VSLA 3MECA 2E9ZA 4O4GA 3OL9A 3K5OA 4HYKA 4IDKA 5KFVA 4YFUA 1S1TB 3AVKA 4F4XA 3IS9B 2VWKA 3MAQA 1RNHA 3VQ9A 3ZSYA 4FYDA 3SUOA 3KD5E 2B5JA 4CF0A 2YNFB 5EDWA 5HLFA 1U45A 2Q3SA 1IG9A 1D9FA 4WFYA 2Z1IA 4BDPA 1UOCA 1C0MA 4CEBA 3SQ4A 3ZT2A 1RT2B 3QEXA 3GILA 3RWUA 4ELUA 4XO0A 4I2PA 3OHBA 5FDLB 1RT5A 3DMJA 3UIQA 1LAWA 4F4KA 3OYFA 3CG7A 3DOLA 3TAEA 3I5CA 4J9LA 5CYQA 3P83D 1D0EA 1WSIA 1HPZA 3U3YA 5KFDA 4IH5A 1ZTWA 1IKYA 4CEFA 3DM2A 5KT7A 4DTJA 1JLQB 1S10A 3ITHA 4Y2CA 2ZQBA 4JUZA 3EZUA 4LQ9A 4M3ZA 1ASUA 4RW7B 3RRGA 3I0SA 3TAQA 1RDAA 2FVSA 3EPIA 5DQIA 2UVVA 1QSLA 4NCAA 1ZBHA 2ILZA 2E6MA 1BQNB 4DSKA 4EYIB 4TY8A 4C8OA 4WYLA 1IKVA 3NF7A 3IG1A 3SI8A 4WXOA 3K5LA 4XIUA 4ED6A 4FZXC 4O3OA 2FLLA 5KFWA 4DSJA 5DLFA 3PZPA 3OYDA 1JLAB 1GX5A 4FLYA 1WLJA 4URQU 3EZ5A 2R2RA 3NGDA 4CGJA 5FRNA 4Z4HA 3Q8SB 1CXQA 4IQXA 1BIUA 1RT6A 4N47A 4O4RA 2W8LA 3LAMA 5J2QB 1IKWA 1NJZA 3LP1A 4PQUA 3RB3A 4ID5A 4LSLA 3OHAA 1NK4A 4F4WA 1SUQA 4IG0B 4ECUA 4ZHRB 5KFIA 5EWFA 4DU1A 1IKXB 1L3UA 4AHVA 3GIKA 2R8GA 2Z1JA 1BISA 1RTHA 2OZSA 5L1LA 4ZP9A 5KT6A 1QQCA 2B6AB 4HKQA 4FS2A 4CJFA 4KHUA 4W5NA 4Q8FA 4B8AB 2RDIA 3D5MA 4TQSA 2BQUA 3KLFB 3VQ5A 1JXLA 1RYRA 2ATQA 4FJMA 3HVRA 3Q8PB 2OPRA 2FJXA 3CJ0A 4OKJA 4GW6A 2AGPA 4DU3A 4BDZA 3L2UA 1RT6B 5KFSA 3V1QA 1YTUA 3KK3A 3T3FA 2VA2A 4FM1A 2J6UA 4OL8A 3HP6A 2QV6A 3NBPA 3DYAA 4CHOA 3PR5B 1N48A 3AVMA 4O0IA 3LP0A 4DLGA 3V6HA 3ZSXA 1MU2A 1U48A 2D3ZA 5HRRA 3DRSA 5HP1B 2FBXA 4LQ3A 4AILC 3DOKA 4WE1A 3C6UA 4DU4A 4KHWA 3QEIA 2A1RA 5KFGA 4ED0A 2AQ4A 1VSKA 4GC7A 4ELTA 4QWCA 1VSHA 3HPGA 3KK1A 1RILA 3N6LA 1J5OA 4DL3A 4CJWA 4B8CA 3AVLA 1RTJA 1JXBA 5E41A 4FJNA 5F8HA 3L2QA 4WXWA 3PX0A 5JS1A 4NCBA 3KK2B 4DTMA 1S6QA 1SV5B 3KOAA 1WAFA 1HQEA 1S0OA 5F8JA 3SV3A 1C0UB 1X1PA 1C1BB 3SQ2A 3M8PA 4MKBA 2XGPA 4ED1A 3OYNA 3L2VA 2RKIB 4B9TA 3NGYA 1RDCA 3ZT1A 3S3NA 3KHGA 4CFBA 1TGOA 4DL6A 2HVHA 2YNIA 3HVAA 3UQSA 4CIFA 3QIDA 4ID1A 3L3UA 4CJSA 4CHYA 5C25B 3F9KA 3MTKA 3V6DA 4ZP6A 4M3UA 2KFZA 2ZD1A 1XR6A 4CF8A 3RMBA 2R2TA 3MR3A 4Z0UA 2HMIA 5SZTA 4DTUA 5L1IA 1YT3A 3VQEA 3I5BA 2C22A 4WFZA 1RT4B 4QWDA 5D3GB 3M9MB 3CFOA 4DMNA 4H8KA 2G8KA 2YNHB 4O0JA 4KTWA 3U6FA 4KV8B 1A5WA 3KKRA 4FXDA 3V6JA 4ECSA 4OGEA 1JLEB 5I42A 4TXSA 2KZZA 3V6KA 1C0UA 2VG5B 4NYNA 4E7KA 1EX4A 2GBZA 1C1CA 3OL8A 2E6LA 4DTPA 2ASLA 3KD1E 1S1WB 2R7YA 3K5MA 4OJRA 4BDYA 3N6NA 1KVBA 2V9WA 3JYTB 4DQSA 3G6XA 2GIRA 1Q9XA 4AHRA 4FJJA 3KLHA 1T03A 4OLAA 3AA2A 2W9BA 1DLOA 3OYIA 1S9EB 3OLBA 1VSDA 1RT1B 1WAJA 1T05A 4DWIA 3PJXA 4JRPA 1RT4A 2XI3A 1WSJA 3I8DA 1C2PA 3V4IA 3SQ1A 5K14A 3M9NB 4KREA 5CY4A 1S1VA 2IS3A 2I5JB 4FZYA 3T19A 1SH2A 2GUIA 3OYBA 4EP5A 4RW8A 3DI6B 1XR5A 2XY5A 4TLRA 1NJYA 4EZ9A 3OYCA 1HARA 4Y34A 3ZSOA 1A5VA 1RTIA 3OYLA 4PUOB 5KG6A 4K4TA 1S1XB 3SFGA 3ISND 4O3QA 2W42A 3OYJA 2UVRA 5J2MA 1XHXA 3KLHB 1T03B 5KI6A 1C1AA 3V9XA 4Y2AA 2KQ2A 4ZP7A 3DLEA 4JS5A 3MXJA 3KLGA 2IOCA 4XPEA 3U3GA 4FLXA 1CLQA 3LANA 4FK0A 4IDKB 2IMWP 1JLCA 5K14B 4CK1A 3LP3A 1JXEA 1KVCA 3PV8A 2WOMA 4RW7A 4XPCA 5KFPA 5EWGA 3CM6A 4IRCA 3PHEA 1SKSA 4NLOA 5KG4A 4EZ6A 5KFCA 4TY8B 2YNFA 4F4ZA 1JLFB 4DG1B 5DQHA 4FJIA 3RBDA 4EEYA 3T5HA 4I7FA 4OPJA 3OYAA 2EC0A 4ZVHA 4FJ5A 3FRZA 4GC6A 3CJ5A 5C42B 3SYZA 4CJ3A 2QKKA 4J9QA 3GIJA 4DQPA 4KI6A 3V9UA 3ICLA 1S1UB 4H54A 3TAMB 1VSEA 4QOZB 2IBKA 2OPSB 3MR2A 4CJLA 4ZTJA 3WNGA 3ZSVA 4KFBA 2CKWA 4F3OA 2A1SA 3QEWA 3FQKA 1JLQA 1T94A 3AO5A 4WYWA 3H5SA 3BQ2A 3LALA 4E1NA 5KFZA 3EYZA 3H08A 1GOCA 1WSFA 1S9FA 3I0RB 3VQSA 3VN5A 1S0MA 1VSMA 3HP9A 1BQNA 3PR4A 5KRSA 1ZTTA 1REVB 4J2BA 2BRLA 2F8EX 1HNIA 5KGWA 5DG7A 3QZ8A 1WNSA 4DTOA 3VQ7A 5KFJA 5KG1A 4CHNA 1KLMA 3NCIA 3O4NA 4OGCA 4LH4A 3DLGA 1RT3A 3NAIA 2AGQA 3A2FA 3TWHA 2GC8A 1BI4A 5KT2A 1RTDA 4J9PA 5J2QA 1N5YB 3SFUA 2PYLA 3BSCA 4EYHB 3LP1B 4PQUB 2AX0A 3QNNA 1FKOB 4J9NA 3SV4A 3I0RA 4NLYA 4R8UB 3DOKB 2KFNA 1REVA 3SI6A 3Q8RB 4KBIA 3NKYA 3OYMA 2J6SA 3DLHA 1S6PB 1N6QB 5HROB 3OJUA 2FVCA 1L3SA 4DSIA 5I3UA 1JL2A 4CEOA 2IGIA 2VA3A 4JV2A 4Q0BB 4FLUA 4DTXA 1G15A 4E7JA 3UPFA 1XR7A 4IKFA 4O5BA 3KMQA 3CJ3A 3WNHA 5DK5A 3KJVA 5KG3A 1BI4B 4H4OA 3CFPA 1N5YA 3LZIA 4IOBA 1R0AB 1RBUA 3TAGA 4N76A 2OPPB 3T1AA 4O55A 2V4RA 2EHGA 4AH9A 1HNVB 4KRFA 4Y3CA 3MEGB 4YR3A 1TL1A 3S9HA 2WK4A 1YVUA 2E4LA 4J9OA 2RPIA 2RKIA 4K8XA 2HNZA 3LP2A 4RW6A 5J1EB 4NLXA 4RNNA 4BE0A 1B9FA 3QIOA 3PO4A 3IRXA 3VQPA 5HRSA 4FJ7A 1LW2A 3KLEB 5HLFB 3TABA 3TI0A 3QLHB 3QETA 5KG7A 3LPTA 4K4SA 1JLBA 4ECQA 2YKNB 3KMSA 4TYAA 1W9HA 1S1TA 2E9TA 3N6MA 3H59A 1VSIA 2W8KA 1XWLA 1D5AA 3QIPA 3SJJA 1TVRB 4GMJB 4N5SA 3KK2A 4ECRA 5JUMA 4FJGA 4FJHA 2B5JB 1S48A 1NJXA 4KKOA 2ILYA 5F8NA 4F2SA 4R0EA 3E01B 5F8MA 1NKCA 1TL1B 3VA3A 4KHMA 3AA4A 1HMVA 1SKRA 4QW9A 4E0DA 4B9LA 4C8NA 5C24A 1S1WA 2O4IA 1LWEA 3ISNC 4QWBA 1NHUA 4ED8A 4J9MA 3MXMA 5T7BA 3OSPA 1NOYA 2PZSA 1BCOA 5FROA 5C25A 5CYQB 1JKHA 4DL7A 2ALZA 1JIHA 4IRDA 3D28A 2ZD1B 2ZE2B 4I9LA 1QSYA 1O1WA 2KZMA 1J53A 1IKYB 4CEQA 3TAPA 3DM2B 2HHTA 1T05B 3TVKA 4G1QB 1KTQA 4FS1A 1RBTA 4CJVA 5J2PB 3I5AA 3DLBA 1IM4A 2AWZA 4AHTA 1KLNA 2BE2B 4MIBA 3D0PA 2Y1IA 1CZ9A 2XY7A 1D1UA 2D3UA 4NLUA 1HMVB 4IFVB 4NLQA 3MR5A 4UQGA 3OS2A 3OYKA 2HW3A 1RTIB 4R5PB 3CDWA 2QKBA 3AA3A 4M45A 2R2UA 5KGXA 2YV0X 4DFKA 4CJUA 3BGRA 3VQCA 3OLAA 4IFYB 3CDUA 3PW4A 1BGXT 3HT3A 1DTQA 4AHSA 4OPKA 2IC3A 2VG7B 4ZP8A 1CSJA 2VG6A 4ZPBA 1QSSA 4CCHA 2BE2A 3I0SB 3HHKA 1WN7A 4FLWA 3SUNA 3QEPA 4RNFA 4F50A 4NLGA 4FK2A 3SPYA 3DI6A 2ASDA 4ZPCA 4W5OA 1ZBLA 3NH0A 3V9SA 1S4FA 5F9NA 4RZRA 4RW4A 4ECVA 2HNYB 3VQAA 1NK5A 4YQWA 4FVMA 4I2QB 4DTSA 5KFRA 4CHZA 4CESA 1QAJA 5J2MB 3O3FA 1J9AA 1FKPB 4B08A 1LWCB 4HTUA 2WONB 3DRRB 3MEDA 4I9QA 4B3OA 4ID5B 4LSLB 1TL3A 1SUQB 4IG0A 3DYAB 3BSAA 4CEZA 3THVA 5L1KA 4WFXA 5DGBA 3LP0B 2XY8A 3OS1A 2UVUA 3QGGA 1LWFA 2FVQA 1NK0A 5KG0A 3V81B 4WE1B 4ED3A 5HBMB 4O44B 3PW2A 3G10A 3RAQA 3H2LA 1VRUB 1VRTA 1U4BA 3PW0A 3BQ1A 1EETB 3KK1B 3LPUA 2HNYA 2VWJA 4O3SA 4FLTA 4I2QA 1EP4A 4QPXA 3HVTA 3NE6A 4FJ9A 2D5RA 3RR7A 3QEVA 1DTTB 3RBEA 4CGFA 3HM9A 3V1OA 5J2NB 2FLNA 2HHVA 3VQDA 4Z4IA 2GIQA 4Q8EA 1TQLA 4RNHA 5KFUA 3MR6A 2FC0A 2JC1A 1KCFA 3M8QA 4ECTA 2BANB 1C1BA 2W7PA 1UAXA 2XRIA 1NK7A 3H5UA 3MECB 4DS4A 4O4GB 1HQUB 4URSA 1I39A 1SH3A 3PX6A 5KFMA 4CFDA 3RB6A 2YKMA 4MIAA 4Q44A 3IS9A 1ITGA 2HB5A 2LSNA 1LWFB 4TN2A 2B4JA 4F4YA 3NL0A 4LD0A 2R2SA 5KFFA 1WSEA 2HNDA 3CIZA 2XI2A 2EX3A 3L2RA 3QO9B 4MKAA 3MEEA 3O3HA 2JEGA 2X6NA 4ZTFA 3AVCA 3PO5A 4Q45A 5KFBA 3JSMA 4I2PB 5D3GA 4NLRA 4B9VA 1DTTA 2R8HA 4K4WA 4H4OB 4MK9A 4ICLA 1BL3A 2WTFA 2BR0A 1L5UA 2DFEA 2OPPA 1TKZA 4CJ5A 3SNNA 3EPGA 3M8PB 4B9UA 4DL2A 1XI1A 4RW9B 1EKEA 4CHQA 4Z4GA 3NMAA 3G86A 3NAHA 2Z1GA 4KO0B 4CHPA 1YVFA 3DOLB 2JEFA 2YHAA 1Y97A 3SZ2A 1HYZA 4JRQA 3UDLA 3NAEA 4RW8B 3QINA 3QO9A 1QUVA 3RRHA 1WSHA 3DLKA 1W0HA 1HYSA 2HMIB 3HO1A 3GV8B 4Y1CA 4NCGB 1JLAA 4KB0A 4HUFA 3VQ4A 2OPQA 1RT5B 3DMJB 2JGUA 3CQ8A 4K50A 1D8YA 3AO3A 3AA5X 4NLDA 3H4DA 2F8TA 2FBTA 1TKZB 5I42B 3O3GA 4ZVFA 4FW2A 1ZETA 4J9SA 4IR1A 3TR8A 2WCXA 4CF9A 5KFOA 2IM1A 4IG3A 4IKAA 1BIZA 4PUOA 2IM2A 3OS0A 1RTHB 5KFEA 2FJWA 1JKHB 4FJLA 1KHWA 4CIGA 3T5LA 2XWYA 4KSEB 3AV9A 2B6AA 5EU7A 1IKWB 5KRTA 1IKVB 3CJ4A 1RBVA 4NCGA 4ED2A 5CYMA 1NK9A 1ZYQA 5DG9A 1C0TA 3ITHB 4M3RA 2D7SA 2WOMB 1FK9B 5HRPA 1S1UA 4K4ZA 4YR2A 3RB4A 5CZ1A 2DPIA 5KFHA 3IAYA 3PX4A 4MQ3A 2FLPA 4DTRA 4IFVA 4HUGA 4J2DA 1TKDA 5KT4A 4IG3B 4R5PA 3BR9A 1U49A 2O5DA 2GV9A 3QYYA 2DPJA 1SL0A 2BGGA 3GIIA 1IO2A 4NYFA 1TKXB 4CK3A 2G8HA 4JV1A 4W5RA 4H4MA 3NGZA 4DQRA
chains in the Genus database with same CATH superfamily
3R2CJ 2IHR1 3P4UB 3VOVA 1FDAA 3AOAA 3EGZA 1VQMN 5EUHA 3CJAA 2A18A 3PNIA 3C7NA 2LLZA 3NGRA 2PBDA 5HVFA 4FF4A 2LEPA 3MN6A 3O8WA 5BJRA 3GOIA 5CHIA 2OAUA 2Z2YB 4BE1A 2UUWA 1OIAA 1IN0A 2UXDK 4LRCA 1JLGA 1LW0A 1Q8IA 4DV3F 1K1SA 2KTQA 5GAGU 4WFBQ 4CJRA 3NS5A 2LKZA 3M9OB 1S6PA 1ROFA 1LOTB 4JS4A 1EQ0A 4B9SA 2A2DA 4FF1A 4CZIA 3RAXA 2WW8A 4OJHA 3IBWA 3E8OA 4DSEA 3LF0A 5HL7L 1GXUA 4ZPAA 5KOWA 3V81A 3B6OA 4CJ4A 4UZCA 1CC7A 2ZDPA 3O4QA 4YHHF 5A0YA 3V1RA 3TSUA 3IM9A 5M2UA 5I3UB 2K2PA 3MFIA 3QGHA 2MKYA 2NXJA 4F9OA 2ZJRL 4OIXA 4JI2K 4DOZA 4RW6B 2CJYB 5FRMA 4JI4J 3DRPB 4ZPVR 2UUAK 3OTOK 3AD8C 4WPAA 4ZVPB 1VC6A 3KLEA 4NA2A 2XO6A 1R0BG 1PC4A 1GT8A 4OKKA 3GE9A 3A12A 5HK4A 5GAEU 3CCMS 2VJUA 3BEXA 5AQTA 3DU5A 3PG9A 3TTDA 2YX4A 4U7CA 4ZMMA 2X7IA 2OSQA 2WRMA 2YXLA 4BVPA 2VG5A 2DY4A 3RMCA 4IO9Q 4MJKA 4DL4A 3S1TA 1G1XA 1JNRB 1FFGB 4IOAL 1RLCL 4YOUA 2E1AA 2L9DA 2BQ3A 3ENOA 3TEGA 4Q5VA 2E29A 4TYBA 4FJXA 4OZ5A 7FDRA 4FJ8A 3SSRA 5LMNK 1MMLA 4OZLA 4PPDA 3O5TB 3TA1A 1WJ9A 1BCMA 1WEZA 5I4MA 2CDRB 1VI7A 3MUVP 2AEMA 3EICA 2F96A 2XO7A 2MHEA 4JBCA 2BQRA 1U0SA 2DGOA 3T6JA 4CF1A 3CCQN 4K4UA 1CJUB 3WNEA 2CVEA 2HHHF 1S99A 4L3KA 4MDAA 2C28A 5GMKa 1NGIA 3ZT0A 2V2QA 1BQMA 1Q78A 2ZBPA 4FN5A 1HYVA 3BO4A 4AHUA 3FZMA 1R59O 2ZFHA 4KGXB 4RG8A 1TK5A 1YJNS 4NLWA 1NBWA 2NUBA 3J7YU 2MZ1A 4RO0A 4GMKA 1DTQB 1HX1A 3B6PA 2GHWA 4QIGA 2HF4A 2QK9A 2X78A 1YG0A 2Q31A 3MPDA 2HSEB 2W9CB 3MI7X 4FCYA 2VQEJ 4WFNL 1CJUA 4ED5A 1A5XA 4IZ9A 1X0FA 3V4MA 3D3CJ 1JLFA 4NI2A 3GP9A 3HPOA 4ILRA 5C5JA 4NZ6A 4DPOA 1M0SA 4WK3A 4ZHRA 3TARA 4KPYA 3DDKA 1RHUB 2GJIA 3PW7A 2J0QD 2VHGA 1Q7YO 1KFSA 3H2UB 4LR8A 1K9MT 2J9CA 3NOGA 4DV7K 4WZMA 4NXMK 3SPZA 2PO4A 4O0NA 1GTHA 4IRKA 3PW5A 3MX2A 2H5EA 1S0NA 3CCSS 3CCLN 2P9NA 1R8BA 3AOCA 4JK9A 1OH8A 1Q81T 4X65K 2F8SA 4ALZA 3OD2A 3HYFA 1VR6A 2F63A 3BKTA 4B9MA 3BH6B 5HROA 2WONA 1FFWB 4B9NA 2ZGYA 1HWIA 1U1NA 3L6QA 1SKWA 1RHJB 1EP4B 1RTJB 1HKAA 1EO1A 3GYGA 1UFKA 4LRAA 2MHNA 2P9IB 1ATSA 1R8AA 4RNMA 4X4SA 4BE2A 4DUZJ 1YUWA 3U1NA 4H5WA 2ZKUA 1C0FA 1J27A 3Q8QB 4EHUA 4M3WA 1F0XA 3JTPA 2YX7A 3HZEA 4GV3A 8RUCA 4LFCK 1GFWB 3HCXA 2CH6A 5L39A 3D2WA 2O1PA 3CETA 4CLPA 3NF9A 4CJTA 5JMVA 3WC2A 5M1KA 3WEEB 2BOPA 5DLGA 3CJKA 4KHRA 1U04A 4TVAB 3VGLA 5L8RC 3FGVA 3MF5A 1WHVA 2RF2A 1NDLA 3HSCA 4DFMA 1QE1B 1WI6A 2HZCA 4MK8A 3O9SA 2KHDA 4HI1A 4OYXA 4RCHA 4U6PA 2G1HA 4NXNJ 1HI0P 3LP2B 4DSLA 3CCEN 1FESA 3UNYA 5AE2A 4CERA 2L48A 2V67A 3CSKA 5F2RA 3OL7A 2HWTA 3H98A 4IBNA 2J7KA 4DR6J 1VIOA 2MJUA 3QLHA 4RWXA 1YBAA 2HHUA 3ZSZA 4YHHJ 5F3ZA 1QTMA 3SQ0A 4Q43A 3MM7A 2ZC3A 4MO5A 4JK8A 1Z2LA 5ELZA 3M3ZA 4C1NI 3M2RB 3ASMA 4BC5A 5E5NA 5F8LA 5F9LA 4EMDA 4X2BA 1V3ZA 3LZJA 2LXIA 3PVXA 3CM5A 3QJLA 3MXIA 1MNEA 5ETVA 1XTZA 1B92A 1D9DA 1X31C 3MCNA 3RTVA 2OPQB 4L6V3 4NE9C 4ZLNA 3MDFA 1LWEB 2DPNA 1PSDA 3NVMA 4P6QA 2JFDA 3BDPA 1GTEA 3MD1A 2WB4A 3IKMA 2MEWA 5AQJA 1RHRB 2GO9A 4B3TJ 2ZEJA 3GFYA 4K43A 2VC0A 1DRZA 2IM0A 4KHNA 3GR1A 3UDVA 4JKDA 3FZFA 5B0BA 2HF3A 2I1RA 3ZTQA 1TP7A 4Z4EA 3LL3A 2R8IA 3HFVA 3SUPA 1R0CB 1Z4UA 2RSQA 3CJ8A 3VF4A 3KLGB 5JICA 2LVWA 3GB0A 4CZMA 3VA0A 4NXMJ 3CJ9A 1HNWK 1YZ7A 2ITMA 1FK9A 1WWHA 3H40A 3MHYA 2NLXA 3M8SA 5AZJB 4PA1A 5M2PA 4OYMA 5LSOA 1OVQA 1GMWD 3OSNA 2LU1A 1HYSB 4AFFA 4QCLA 2B7BB 1QHAA 1RGVA 4CRJA 1KFDA 1UMJA 3FSYA 2AZ3A 5BR8F 4EAHD 2EPIA 2P5GA 2IBOA 3GSDA 3LDQA 2HHWA 2DXEA 1LWCA 3NF6A 3R9PA 3OYEA 4Z4CA 3KJQB 4CZGA 1HBOB 1RHQB 2OANA 1NJIO 1NU0A 4OQJA 1K47A 3KDOA 4FLVA 3CGIA 3I55N 2W9AA 1TK0A 3BGRB 2KG1A 2OI2A 2LA6A 3SQGB 1K8KB 2PDAA 1G99A 1RDRA 3CMEN 4CWBA 1BHLA 4B3OB 1T8EA 1TV6B 1UETA 4HCBA 1RAGB 4GVMA 3TVZA 1BDGA 4HVJA 2JC0A 1NAQA 2AU0A 2P9KA 3OYGA 3EE9A 1SL1A 2HGMA 1VCTA 4K4XA 1YJ9S 3KYLA 2QTDA 2NZCA 1FKOA 4RWWA 2IAJA 4FK4A 1KKHA 3NNHA 3NFAA 4CJEA 4IOCL 3I6PA 3ETMA 1NOZA 9ATCB 2YWKA 4GV9A 1J54A 4YHHK 1NGGA 4JYAF 1G6BA 2ATCB 3JSBA 2V0NA 1LV5A 1I51B 3C95A 3UCGA 4WQ4A 2XCPA 2RDJA 3CI5A 3DRPA 5EOYA 1SH0A 3AFGA 3H6EA 2MQQA 4XK8C 3CJ2A 2ITGA 4NEZA 3VTHA 3VEOA 2ZZMA 3R5AA 2QI2A 2XC9A 4DV3K 4DL5A 2ZWHA 2WSFC 3RUBL 2W6KA 4M41A 4LF2A 1F3VA 1HI1A 2O67A 3F73A 2NRHA 3PFEA 1HKBA 4NLTA 4DV0F 3F2KA 3VAKA 4MFBB 4PXDA 3HPHA 3GTYX 3CVKA 3G8SA 1MSWD 3D0IE 1Y00A 3T1YK 2CXEA 1S9EA 5IT9Y 3M5RA 3OL9A 3JB9k 3GJQB 1S1TB 3GU0A 1IM6A 4H03B 4CZJA 1P27B 1HNWJ 1SZ2A 3A13A 2HLTA 2RILA 1R89A 2YKOA 3KD5E 2WC9A 4CF0A 4M7YA 2Q3SA 1J2VA 2HIYA 2ZVSA 1UOCA 4QOTA 2MKJA 1DARA 4MYTA 1S59A 4JI1F 4ELUA 3I4HX 1RT5A 3DMJA 2NREA 4LFBK 3I5CA 2E1CA 4QYZK 1WBBA 3P83D 2IRUA 1D0EA 1VBYA 4H0XB 3HI9A 5KFDA 2CJBA 2YPYA 4CEFA 4DTJA 1JLQB 4LFAF 3ITHA 4Y2CA 5I9EB 3EZUA 4M3ZA 2JVRA 1AZSA 4RW7B 2RMLA 3RRGA 4P2MA 3TAQA 5DQIA 2UVVA 1ZBHA 2E6MA 4BGAA 2E1RA 4PXEA 2K06A 3NF7A 1XIQA 3DLJA 3SI8A 1RACB 1RWXB 3R8EA 4JI7F 2MTLA 4XIUA 4CQ1A 4ED6A 4N8OA 1H98A 5BXIA 1IQZA 2DEIA 3I87A 1GX5A 2VBWA 3UE2A 3N0VA 4FLYA 1BOTO 1VJWA 3NGDA 3CPWR 4CGJA 2C3MA 1CXQA 4IQXA 2EK6A 4N47A 1HIYA 3VETA 3LAMA 1IKWA 3BY5A 2GQCA 5KPTA 3RB3A 4ID5A 2WAQD 4NYOA 1TUGB 3E9LA 4ZHRB 2NSBA 5KFIA 5C2GA 5EWFA 1IKXB 3C16B 3PIPL 3GIKA 1MG7A 2AJFE 5IS2A 1BA0A 5AE1A 3T1HF 3HOTA 1ZM4A 2E8AA 2GWKA 1TL4A 4KR0B 5L1LA 2BW2A 1HHTP 3VF2A 4CJFA 4KHUA 2VBXA 4TQSA 3KLFB 3TOQA 3EZWA 1IWGA 5GVQA 3Q22A 3VQ5A 1RYRA 2ATQA 2BUPA 4FJMA 2QWNA 1CJKA 4TU9A 2K3IA 3MCMA 3AA9A 1KAXA 1RT6B 5AR0A 3V1QA 3KUGA 3T3FA 1Q4RA 4DR4K 4OI6A 3HP6A 2HBJA 2VCPA 4XAKA 4JI3J 1ZZFA 3DYAA 2UUBF 1N48A 3MURP 1PKUA 2HK3A 3LP0A 3V6HA 2DGQA 4PYDA 1FRLA 3DRSA 4AILC 4F02A 1VQLS 4NPOA 3QEIA 2KU7A 2P6SA 1U0HB 3R5JB 5KFGA 2AQ4A 4GC7A 3BM7A 4J9VA 1VSHA 2CGJA 1V4TA 1RDUA 2BJ7A 3OW2M 2UU9J 4B8CA 1RTJA 5E41A 4PKDB 4FJNA 1Q8BA 5F8HA 3LGNA 4USHA 3D1OA 4QR1A 1PYTA 3L4BC 5JS1A 1WSVA 3UVJB 2VUGA 4DUYF 2FD2A 3FCVA 3U9DA 4JD2A 3I56S 5CR4A 4YDUA 4Z2XA 5C15A 1S0OA 1C0UB 1RP5A 2XGPA 2MB0B 4BG8A 3OYNA 1Q18A 2YWEA 1OYDA 1WB9A 2DJWA 2RKIB 3ZT1A 3ZETA 2NLWA 2YNIA 1N36K 2V8GA 3UQSA 3QIDA 4CJSA 5D8HB 4CHYA 2ZOFA 5D0RA 3ZXWA 1RAFB 4LT6A 3D7EO 2XLJA 4M3UA 4LFBJ 1XR6A 3W3DA 3MWPA 2N3LA 4CLUA 2R2TA 5CA5A 3MR3A 2HMIA 4ZJLA 3I32A 5SZTA 4DTUA 3LDLA 1FI4A 2VPZB 3I5BA 4CDIA 3KZBA 3M9MB 1E3MA 4K5SA 3TX0A 5DRKA 1NZ8A 1H7WA 3AJ1A 4O0JA 3G6ES 3FBBA 3E9PA 1A5WA 3CERA 1Q82T 4GO5X 4ECSA 3VALA 1NUEA 5AZIB 3HDSA 1YHQN 5A0YB 3V6KA 1C0UA 2Q36A 1VBXA 1PAEX 2RRBA 1U2VA 2CYYA 3CMQA 3NRBA 2ZJQL 4E7KA 1EX4A 3ULHA 4DTPA 1T6CA 3KD1E 1WKLA 3BR8A 4BDYA 2C3PA 3D4JA 2MQLA 4XEIA 3ZEUB 2MQNA 3ILLA 4U67L 1J5EF 4DX8H 2GIRA 3QT7A 1Q9XA 3WQUA 4AHRA 1TUYA 2W9BA 2DXFA 3P96A 1RBAA 4DWIA 3TSQA 3H42A 1WSJA 5AQXA 3V4IA 3JQKA 5T7LB 2HURA 2V69A 2DIVA 4L3QA 4KREA 1Q79A 1Q7YT 3O44A 2IS3A 4JI6F 2I5JB 3FZKA 4DQ8A 4FZYA 3T19A 5BRHA 1SH2A 2D9OA 1RJJA 3CC2S 1NJYA 4C8ZA 2V94A 2UUBK 3CMAS 2XULA 1IUJA 3MPWA 4PUOB 1U2CA 5FJ4A 4GKKJ 1IXKA 1YKWA 3ISZA 5DZ6A 3SFGA 3G25A 3A5NC 5BR9A 3ISND 1GEHA 1CULA 5J2MA 4OMFG 1C1AA 3V9XA 2KQ2A 2QL7B 1YVNA 4M5KA 2RUSA 2ZH7A 4PKIA 3U3GA 1CLQA 3LANA 4FK0A 1UKUA 2XMKA 1JLCA 1JXEA 2L3MA 2ZITA 4Q7AA 4CLKA 3G82A 1HLUA 3O6QA 4TY8B 1NDKA 4FJIA 3NG8A 3IXQA 3RBDA 2QX0A 3MEKA 4OPJA 3MM5B 1WHXA 3OYAA 2EC0A 2RRNA 4Z94A 3B82A 4GC6A 1SVDA 3VGKA 3G8TA 3GCXP 1N8RT 3FJ2A 4CJ3A 3V9UA 2RT3A 3EN9A 3TAMB 3TRGA 1VQ4S 3FC9A 2V9KA 4FWSA 3MR2A 2IVYA 4A8FA 3WNGA 3ZSVA 2H4WB 2CKWA 5F1XA 2ALYB 2ZKTA 2I6WA 2CDQA 1HNXJ 4AL6A 4BHQA 1JLQA 4WYWA 3H5SA 2CPFA 4M1KA 2ZWOA 5KFZA 2QWLA 2E2NA 3H08A 2Q43A 1HR0J 3LDNA 1WSFA 1ZM3A 3HSZA 1SC1B 3HP9A 4CVNE 3Q2SC 3PR4A 1ZTTA 4USMA 3HLUA 2V8DA 3FCHA 5DO2A 4LFAK 5KFJA 2OELA 5HMXA 4WF9Q 3I82A 3TZXA 4QIVA 2G0JA 5D0GA 3NCIA 1ZA1B 3DLGA 1RT3A 2AGQA 1YXQA 2AP6A 2GC8A 2VASA 1N34F 1RTDA 4M8LA 2XHWA 4DCPB 1N5YB 2PYLA 3BSCA 2HHPA 4PQUB 5G0RB 1FKOB 3OFGA 1WHYA 1VQLN 3CCES 3QT6A 5LM7E 1YBUA 4LBHA 1JJ4A 4R8UB 1UJ6A 3H8YA 2MLZA 2KFNA 4YDUC 3HJVA 3SI6A 4KBIA 1HNZF 1TL7B 3DLHA 5HROB 3BPDA 1L3SA 5CD4A 4DSIA 3LDPA 4I6WA 2IYIA 5E3QA 1JL2A 5GADP 2VA3A 4C48A 3UPFA 1FERA 4IKFA 2YCHA 1FW6A 3S7RA 2ERRA 4DKWA 3CCUS 4NL5A 4PR6A 1H2VZ 1AT1B 1F6TA 1N5YA 2FTRA 4LVOP 3TAGA 4ETXA 3T1AA 4TU7A 2V4RA 2EHGA 4AH9A 1WOSA 2DCUB 3MEGB 1TL1A 1YVUA 2WK4A 2RPIA 3MUMP 4KGKA 3FEYB 3J81Y 3LP2A 1T02A 4NLXA 1EZZB 4BE0A 3IRXA 2UUBJ 4FJ7A 3QBCA 1FA0A 5B8HA 3FBFA 4BY9C 4GKKK 4RPFA 1NH8A 2YKNB 3WT0A 5A8WB 1S1TA 4U8VA 2QJ3A 4ZVSB 2UUCF 4JI8K 1VSIA 1RAHB 3QIPA 3SJJA 3UVJA 4ECRA 4IOXA 4IFEA 1S48A 2N7CA 2ILYA 2H3EB 5F8MA 4KHMA 2VPXB 3W5XA 4F25A 3BBCA 3RAMA 1UPMB 1N36F 1XJWB 4LF6K 3K0SA 4J9MA 3EX7B 1TFYA 1YWXA 2IA0A 3WHIA 3OSPA 2F4FA 3AH6A 4CNYA 4P71A 1JKHA 4AXJA 2XHCA 1JIHA 1WG1A 3HFKA 2KZMA 3JXUA 1IKYB 2OEMA 4LRDA 4CEQA 2HHTA 3P39A 2AEJA 1VLOA 4BQZA 4C98A 1KTQA 2EFGA 4CJVA 5J2PB 4BR4A 1IM4A 1FNXH 4R79A 1KLNA 3CD6S 2XSFA 4BC9A 3D0PA 2Y1IA 5JLHA 2JH3A 4NLUA 8AT1B 1XMOK 5C2CA 2M88A 3JS6A 1FHTA 1VQ5S 4BRNA 3WQTA 3MM9B 4A8WA 4RUBA 2A1BA 4LFCF 4DFKA 2V6AA 1U02A 3WBZA 4IFYB 1VMBA 3CDUA 1BGXT 4DV5J 1EKRA 3I31A 2MKIA 4AHSA 4OPKA 2OGUA 3H1VX 2QFIA 3SCKE 5FD1A 4ZP8A 2QEXS 3NGUA 3H3OB 2BE2A 1VBKA 3HHKA 1WN7A 1G2EA 1UVJA 3DDIA 4F50A 4D3HA 4L75A 4W5OA 1ZBLA 2VFTA 5D4OA 1HNWF 4RW4A 1QQOA 3L4QA 3CCJN 3ET6B 4Z7CA 5LL6Z 2DNPA 3QNWB 2G2YA 4P52A 5J2MB 2CJXB 1WSRA 2Q0RA 4B08A 1LWCB 4C6AA 3MD3A 2P9CA 5CCMA 3MEDA 3DRRB 4F04B 2O66A 1YITN 3THYB 3BN4A 5H9FJ 4I9QA 4B3OA 3THVA 4WFXA 5DGBA 5ADXA 4PKHA 3MOZA 2XY8A 1RAIB 2DR6A 2H3GX 1LWFA 1TYQA 1NK0A 3OA9A 5KG0A 1ILYA 4WE1B 2G2OA 4BR7A 2HFZA 2QL5B 4BRPA 3PW2A 1BO5O 1I5OB 1XQIA 3RAQA 4DV5F 2DGSA 4FDFA 1IBLJ 4NA3A 1U4BA 1H72C 3BQ1A 2AHOB 3KK1B 2OFGX 5LY3A 4F3QA 5K5MA 1A6LA 1OQ3A 2RIJA 4QPXA 5AQPA 2QGFB 3HVTA 3CCUN 2VWBA 2W40A 4EGLA 4FJ9A 3E9OA 1K8AO 4BRAA 4OPAA 3HM9A 3RBEA 3ZZZA 1S72S 2EG1A 2NUUG 3I8BA 4JI8J 2P6TA 3W8PA 5KFUA 5JVGQ 4BROA 3VPZA 3CMES 1XNRF 4ECTA 2BANB 4DUYK 2XRIA 4GKKF 1S7IA 3MPVA 1TTHB 4O4GB 3CF5Q 1KD1T 3PX6A 4CFDA 3RB6A 3HMJG 4MIAA 3T9ZA 4CLSA 1ITGA 2LSNA 4DN0A 4AE5A 3ZTRA 5B7WA 2FHJA 4TN2A 1CQNA 4QR2A 3VAHA 3CIZA 2XI2A 1BHNA 3B78A 4ZCLA 3QO9B 4MKAA 4OYPA 1OKJA 3MPYA 1HBMB 2VODA 3L95X 3MEEA 4PHTX 3PO5A 3X3UA 3T1HJ 3PKMA 4NLRA 2R8HA 4K4WA 5B0FA 4H4OB 4ICLA 1L5UA 3BN7A 1N33F 2MKCA 4ZVUB 5AZIA 2OPPA 4M5DB 4WFAQ 4RBVA 1U24A 3SNNA 3EDQB 3M8PB 1TMMA 2OIHA 1VK8A 4B9UA 2HVEA 4DXLA 1N32K 3NMAA 1NPPA 3VERA 1U1PA 3G86A 3NAHA 3FZLA 1PAUB 1YVFA 3DOLB 1I94J 4JRQA 4U7UK 5DETA 5E3AA 4MIWA 1HQ2A 3QO9A 3NGSA 2YPZA 3EE8A 4HDGA 2HQIA 3DLKA 5J1PA 4MYUA 1CZAN 2LQBA 2Y3YA 3RBXA 1YJVA 3MM8B 5BR8J 1JLAA 3M2UA 5T7LA 1X9JA 1RT5B 3DMJB 2BKOA 4K50A 1BC6A 4X4PA 2A6MA 2E1ZA 2GX9A 1RHKB 1NSAA 3VESA 3OTOF 2EI5A 3ENAA 2HIQA 4KGZB 3HRGA 4CF9A 2OKQA 3M6XA 1KQKA 4B3SJ 1BIZA 4PUOA 1RTHB 1VQ7S 4CBWA 3FKBA 2BKNA 4CIGA 2K8GA 5AQIA 3M32B 3GJSB 3J80O 4GVLA 4KH5A 1E4GT 2KT3A 3CJ4A 2ZJPQ 3MM8A 4FKXA 4GV6A 1NK9A 1PG5B 1SQGA 1C0TA 3ITHB 4NB4A 2WOMB 5HVHA 3WX4A 2QMXA 3W2WB 1F60B 1NGAA 4YR2A 3RB4A 4X66J 1D9AA 5B0AA 5HAOA 5CZ1A 3M6WA 3PX4A 4JKEA 3BZQA 4WU2A 1IBKK 1ESVA 2CFXA 4FWRA 5KT4A 4FYYB 4LVNP 2OJ3A 2GV9A 3BF3A 1SL0A 4LF8K 2CQ1A 4K59A 1UVNA 3JSYA 1ATNA 1GLEG 2MZTA 2CNOB 4CK3A 2B9XA 3IAS9 3ID6A 3O3LA 4UUXA 5MLCQ 3SIPB 5C2DA 4BRCA 4DV4K 2E1YA 4LR9A 4M42A 4M5LA 2P9SB 1KLMB 2FVPA 2ETJA 2DR8A 1VC5A 3OTCA 1RAEB 1IJJA 3HL8A 1T6DA 2N7YA 3MCSA 3G4SN 3CPEA 2P9LA 2J4RA 3C6UB 3KKSA 5RUBA 1U1OA 5G0RA 2R3VA 2FJBB 2HFUA 3LWMA 3DLRA 2BMBA 5FPDA 3PRBA 2DGWA 4OLOA 1BLUA 4A5AA 1TKXA 3ZTOA 3BBBA 4DLEA 3SAFA 1IJEB 4ZLJA 4W92B 3DRXA 4NRTA 4JKBA 5DM7L 1Q0NA 3K57A 2RF2B 4J9RA 5L9NA 1HJRA 2ZOGA 3QMQA 4PWWA 3M30B 2ZBIA 4DV7J 3JTNA 5IC6B 3K9KA 1N32J 3AAPA 4NLBA 3O80A 2H48B 4Y1DA 3R6MA 1RKJA 4EK2A 5M1NA 1P1TA 2A41A 5DG8A 4MAKA 3L4IA 1EETA 1I94K 4BWMA 3CCVS 4CO5A 3G6YA 1TZ0A 2J9DA 2ATLA 1K73T 4BRLA 3VZHA 4DR5J 3EMTA 4KV8A 3KHLA 3V5RA 2HHSA 2IDOA 1EHWA 2V4JB 1TL3B 5ETSA 4C8KA 1RADB 2FJDB 3JS9A 3W3SA 2V8HA 2IDLA 4YDXA 2XB2D 1CJVA 2R4FA 2YNHA 3HBTA 2JNJA 4L72B 3K2PA 4O44A 2JOQA 2G8WA 3CUNA 3AD7C 1YGYA 4QW8A 4N56A 3AODA 3WNFA 3FFIB 3P45B 3RMAA 1F9HA 3AVGA 1JLBB 4J2EA 5K9FA 3SCLE 5A8WA 1RT2A 2XCAA 1JXVA 4FSVA 1S1XA 2GMJA 5KFQA 3QIPB 2UUTA 2E9RX 4CJKA 2LQ5A 3H7HB 4OVLA 1NDPA 3AD9C 2P5OA 2QW9A 2AYMA 3DOMA 1RCHA 1TKTB 2UZAA 1FNMA 3NWRA 4WP9A 1M90O 1LXJA 4HTLA 2EFNA 4NXNF 3MM6B 1IKXA 3C16A 1ICEB 3SXLA 5ADZA 2RU9A 1N4LA 2W24A 4FBTA 1P8ZA 3VAGA 3DXKA 1C4AA 3NGTA 3M8RA 1WC0A 4IH7A 4EBDA 3FFIA 3P5BP 2JDJA 3L8BA 2W9BB 3NF8A 3CXCR 3THWA 1V3RA 2J0WA 2VGMA 4PZVA 3CW2C 4TSXA 3SJHA 1QS4A 4QIFA 4ZVGA 5C42A 1HA1A 4B9QA 3AO1A 1IWAA 3VZIA 4K8RA 2R42A 1TAQA 1RSCA 3DHWC 2YY3A 4UW2A 1NXIA 1S7HA 3ILOA 2NR0A 3VEZA 2IM3A 4PG8A 5DMRA 1S9GB 1GLCG 1S0VA 5C10A 4IJNA 4ITSA 4JI5J 3NLCA 4B3TK 3IGNA 5ETPA 4HT5A 4RNOA 3VQ6A 1S72N 4E1JA 2VQFJ 3BF4A 2R8JA 3DLKB 1UTAA 5FPMA 1X3NA 1I94F 2W4DA 3QZ7A 4NLSA 3SBMA 5M1PA 2OPRB 3D6HB 2RVJA 4L76A 4E7IA 4E8UA 1D3WA 3EGWB 1F3FA 2WBNA 3AVHA 1YDLA 4DTNA 4ZJQA 3UD4P 3LGHA 2A3JA 1FJGF 2NQPA 3LTOA 4OYZA 3ULEB 3LW5C 3THYA 5FLXY 5L9XA 3C6AA 1Z25A 1RGIA 2VF3A 3OFHA 1V4SA 2WW4A 4HHTA 2FGOA 3OY9A 1GOBA 4MK7A 1EARA 3CWJA 1S49A 2U2FA 2Y8WA 3DAWA 3R7NB 2FSKA 3DN9A 2FVRA 3KNAA 1QAXA 2PI5A 5A8KB 4FBUA 1ZBSA 2J6TA 4FM2A 3NDKA 3MEDB 1N0VC 5AE3A 1RU2A 2KW4A 3NBPB 4JI6J 3D6MB 2PMWA 3H46O 3US5A 2JEJA 2DH7A 4WP8A 4RUHA 4YP3A 3H4BA 2A10A 4OLBA 3L3VA 4ZPDA 3W61A 1RT7B 3OTDA 3C65A 3T5KA 3T41A 1RHMB 4P9SA 4FLZA 5LMNF 2VFVA 4DR1K 3D3BJ 3KLIA 2XMJA 1JK9B 5IOLA 3H2VE 2B0GA 1LW0B 2D0AA 5FDLA 5KFLA 2Q0UA 3CDEA 2DNYA 1VQMS 2YWWA 3D68A 1CXUA 4JEPA 2K7JA 3UB5A 4Q0BA 1GLAG 1N34K 3NXZA 2BUNA 2J5AA 2HS3A 4BRMA 1HFEL 4MLEA 3PKYA 3NS7B 3CC7S 1RT7A 4OKEA 3EVMA 5H9EK 3HTVA 4RU2A 1RU1A 3CD6N 2CQCA 4DPYA 3HSTB 3KLIB 2ASJA 3GSIA 4ECWA 3OVNA 3HKWA 3P1GA 2A2CA 3EO3A 3VEVA 3MEEB 3P3DA 1VK0A 3OR2B 4CEDA 4NXMF 2NPIA 2PIIA 3B54A 4CFAA 2JEIA 2ZE2A 1JLEA 2L08A 3E66A 2M4MA 2IJFA 1DLOB 1U25A 3Q86A 3E01A 4S0MA 4EBEA 5DM6L 4C8MA 1GQEA 4HT7A 1Q8LA 2RE2A 3I55S 2I7PA 1DQ9A 4DV6J 5JS2A 2DFHA 2DO4A 3GBTA 4P7TA 1M5VC 2ZZTA 2HNDB 4A8MP 3MX5A 1O13A 3ZSWA 2HBKA 1LAVA 2CWXA 1WOPA 2FF3B 5F8GA 2JJ4D 5EN1A 1ZBFA 2AEFA 1UW4A 3T5JA 4E1MA 3PRVA 1VC0A 1TUVA 1IH7A 1SB6A 4TY9A 3PDNA 1C6VA 1YJ7A 4CO3A 3R6LB 4DR7J 2ZH3A 4BBYA 2EKYA 1FFSB 3DXMA 1N5QA 3AVFA 3RB0A 1NZAA 2JFKA 1H38A 2ACMA 2PFDA 2NRTA 1OO0B 5J2PA 3ZSRA 3T1YF 1MWKA 5HP1A 3DGPB 5LMUK 3OXFA 3VAFA 4NYPA 4ELVA 2HHHK 2VZ9A 3TZZA 2MGZB 4DV0K 1VK3A 2YWGA 1VQKS 4RKUC 5F8IA 4X4OA 2H1YA 3QSIA 4KRWA 2IPOB 3IGVA 4ZN1A 2GJFA 1VQ5N 5GAGP 3FSIA 3JQMA 4E89A 5HRNA 1VQON 1IBKF 3ENHA 4C23A 4CEAA 1TKTA 4Y00A 4X4TA 1S4EA 2HBRB 2ZUAA 1RDBA 3PUFA 2QG9B 4OO1J 4CF2A 4C3MA 3FDSA 2V4QA 2B51A 5B0GA 3ILIA 4M5HA 3DXKB 1J5EK 5A2QY 2QSWA 3GCWP 4PY5A 4O8UA 1LFWA 3T9NA 1NJIT 1TAUA 4K42A 2E7WA 3U1LA 1NB2A 1RZMA 4B1UB 3F0NA 1U0HA 1XHZA 1X5TA 1HKGA 4M3TA 1NGFA 4ZPTR 3ZZPA 2XLIA 1J5OB 3ATVA 3M1FA 4UZBA 1HWJA 3PEJA 3KG4A 2IC3B 1UEVA 2CJKA 1HL6A 3MN9A 1U47A 4L8RB 2W2QP 2POKA 1VQSA 1NKEA 2PI4A 2KO1A 5SWMA 3MAAB 5GAEP 4P72A 4F0KA 2V51B 1YRUA 4CGDA 4OI2A 2OD6A 1HWLA 4KAIA 1ZAVA 5BN9A 1HD0A 3CCTA 5HOOA 3ZETB 1WSGA 1KVJA 2AW0A 4CLWA 3FK4A 2GUPA 4EP4A 3ZZUA 4UUWA 1S5ZA 3CDAA 4KHYA 3ELHA 3UR0A 4DSFA 5LSLA 4I68A 1K1QA 1UA1A 4KPCA 1KSPA 3VENA 3TZWA 5KFYA 4DB3A 1N56A 1L3VA 5J2NA 3BH7B 3H5XA 4YNQA 4B3TF 2DO0A 2YHWA 3C94A 3MMAA 2FXUA 3KLVA 1T3NA 2GVDA 3TAFA 1X9MA 3AVIA 5LXYA 1HQUA 3IDHA 5D6GA 2HAIA 3TO8A 4CM2A 2VFUA 1N88A 3HVTB 4HUEA 2F9DA 4KB1A 1L3KA 3O1BA 5HI7A 1W2BM 2PAVA 5HQMA 4K7QA 3UN5A 3G87A 2FZKB 2ZH2A 1CJTA 2GMLA 1YIJS 2XHBA 3D6FB 1Q16B 2VC1A 5KTQA 2BEFA 1VQNS 3AQPA 2PFFB 2BANA 5HVGA 1SL2A 5E26A 3K5OA 4IDKA 2V8VA 5KFVA 4YFUA 2ROEA 4F4XA 2CPDA 3J7AP 2CJAA 4N77A 1RNHA 3J7YP 3VQ9A 3ZSYA 1OH5A 3RSEB 1KQSM 1Q82O 2M5YA 4OI1A 3CCSN 1IG9A 1ULRA 2DKOB 2NCKL 4WFYA 3BO3A 2XMVA 3C15B 3A5LC 2HHHJ 1C0MA 2JHEA 3J7Z5 2ZVIA 3LOUA 3SQ4A 4LSZB 1RT2B 2AD9A 4XO0A 1OSCA 1UZHA 4I2PA 5FDLB 3UIQA 2BVZA 3N4PA 1WKKA 5A6PA 4BC4A 1GLBG 3DOLA 4J9LA 1B70B 5J1NA 5CYQA 1WBDA 1WSIA 1GLDG 3J80Y 4DPXA 4ZVRB 1BY9A 3O2IA 4RR5A 1YI2N 2WSEC 2JL9A 4ZDNA 3CHWA 4JUZA 5M2RA 3EPIA 1QSLA 3R5CA 1BQNB 3GDQA 4TY8A 4BG9A 1U6ZA 1IKVA 1J6ZA 4K25A 4WXOA 3K5LA 4DV1J 5TKWA 4FZXC 1R8CA 4O3OA 1KOOA 5DLFA 3PZPA 1WLJA 2MDAA 4Z4HA 1S6OA 7AT1B 1XNQK 1T11A 5J2QB 3M32A 1NJZA 3R5DA 1QLNA 1SXLA 3OHAA 4ECUA 2CPHA 1URRA 4DU1A 1JJ2R 5EY4A 3BO2A 4BR0A 3SQOP 2F9TA 4A5BA 3H3NO 4L73A 5CYJA 1BISA 1RTHA 2GGPA 4IEEA 3QJJA 4Q2MA 3B8HA 4I6AA 5KT6A 4C97A 3TJ9A 2NYHA 4FS2A 4W5NA 1Y7PA 4YS2A 2BQUA 2DR5A 2OPRA 5MLCV 2FJXA 3CJ0A 2ASPA 2NRXA 2AGPA 4DU3A 4BDZA 3L2UA 4BR9A 3GR0A 3OR1A 3CIPA 3KK3A 3SAGA 4JP8A 3MMVA 2KLAA 4PABA 3NBPA 4HHJA 4ILJA 2EEYA 3JSRA 4FO0A 4DX7A 3BZKA 5HRRA 2LCWA 5HP1B 1AXQA 2ZF5O 4DU4A 4H0YB 3SQGA 1K8KA 1XMOF 2A1RA 2LFVA 4ED0A 1VYAA 1OY9A 2H54B 4AXIA 4BC3A 3Q8YA 3MMCB 4ELTA 2DNRA 3HZ6A 1KWMA 1VGYA 5JVHL 3PYDA 3A3OB 2IVFB 1EQMA 4GNIA 4IO1A 4AM6A 3NMRA 2RJZA 1SJRA 2YJFA 3SMSA 4WYBA 4LR7A 3FCWA 1OY8A 1IR2A 5F8JA 3RW6A 4OHXA 1C1BB 3SQ2A 3M8PA 4MKBA 2R7VA 3QBWA 1BU6O 1KXPA 3NVKA 2AZ1A 2ZHOA 2HVHA 3PRDA 2YWHA 3HVAA 4NLCA 2VFRA 3MTKA 2DRAA 3SMPA 3G96A 2ZD1A 3KUEA 4H0OA 1VQ8N 3RMBA 1TU0B 5GAHI 4Z0UA 3VQEA 3IRWP 2KJVA 4QWDA 5D3GB 3CFOA 4K2XA 3Q7CA 4KTWA 3U6FA 1NGDA 1FWLA 2COLA 1I3OB 4O5FA 2YKPA 3GONA 4HACB 2VG5B 2CZ9A 3J81U 2QTWA 4KGMA 5IWAF 2GBZA 5D4LA 2ASLA 1V9OA 2AV5A 5ETTA 1WUAA 1CVJA 3N6NA 4DV1K 2E2PA 4BRIA 5HMZA 4FJJA 3KLHA 1T03A 2PC6A 2VU5A 1X8DA 1DLOA 3R8YA 1S9EB 2B9YA 3W5YA 2CPIA 1RT1B 5G4DA 4BRQA 1RT4A 2XI3A 1GLLO 3I8DA 1C2PA 3SQ1A 3M9NB 2UXDF 5CY4A 2QN6B 4ANCA 3DLLQ 1OVYA 4P73A 1KQGB 2FY1A 2GUIA 1CQMA 4RW8A 4ZCKA 1XR5A 4AQYK 4TLRA 4EZ9A 1HARA 3TUJC 4LF9J 1H7XA 4Y34A 2AF6A 4HH1A 3MM7B 3OYLA 2D3OR 4LF4F 5KG6A 4K4TA 1S1XB 4FP9A 3MM9A 3PXGa 3HHDA 4OYAA 1PJ7A 4CJ7A 1LCUA 4Y2AA 4ZP7A 3DLEA 3MXJA 2IOCA 4FLXA 2DTJA 3Q24A 4F4AA 1VAZA 3VWSA 3ZTPA 4H0VB 2DNNA 3BPSP 4LF7F 4RW7A 4XPCA 1UZDA 3A1YG 4LF8F 2W2OP 2Q1NA 3RSEA 3CM6A 4IRCA 2V50A 3PHEA 1UP1A 1WF0A 3M1VB 3AGRA 5FLXO 1BWFO 2YNFA 4F4ZA 1JLFB 2A6OA 4DG1B 3BGFA 3POTA 1FJCA 5DQHA 5CAAA 4ILMA 1W97L 3PIOL 2DHHA 4NWBA 4PXBA 2LDYA 2EG2A 4JI2F 2NXUA 3SYZA 1IJFB 1BWVA 3FGUA 4BVOA 2QKKA 4J9QA 3BUZB 3ET6A 2F4VF 1UVMA 4UT4A 2P9PA 4G6VB 1D4XA 1S1UB 4H54A 4ZITA 3SSQA 3CT9A 2YX6A 4F3OA 1YJRA 2WVDA 2I38A 2M7SA 4Y0FA 5C12A 3BQ2A 1U2RA 2E44A 4E1NA 5KQDA 4DN9A 3EYZA 1PCAA 1GOCA 4KC5A 3I0RB 2DNLA 1VQ6S 3VN5A 3M1VA 3WXMB 1T3OA 3BKUA 3Q7BA 2J7UA 2DCLA 2F8EX 4ID8A 1HNIA 5DG7A 1WNSA 2OFHX 4DTOA 1RB0A 3VQ7A 5KG1A 3EEQA 2DNQA 3O1WA 2B9EA 3O4NA 1QD1A 4Y65A 2OD4A 3TWHA 2AIRB 4Y6IA 1DEJA 1H2UX 1SJ4P 3TSPA 3PLAA 4EYHB 2CRLA 2HQCA 2VPYB 2F9WA 4FWKA 6FDRA 4PXCA 4IEIA 4J9NA 3C3LA 3ZNUA 3CCRS 4ZK7M 1B99A 4LRBA 4TU8A 3TPQA 4J5OA 1REVA 1K0VA 1FO1A 2O8FB 4WIQA 1TFWA 3Q8RB 3NKYA 1KVKA 3M8ZA 3DGVA 2VIHA 1S6PB 1Q81O 3K5PA 4E2FB 4B1WB 5I3UA 4CEOA 3TJ8A 2IGIA 4AL7A 4DTXA 4E7JA 4DBQA 3RBZA 1XMBA 5CHCB 1HI8A 2XBPA 4O5BA 4RL1A 2DGTA 5DK5A 3HSJA 4ISEA 3C6HA 5H9FK 4I64A 3CFPA 2J7WA 1HWKA 4IOBA 4NO7A 2KKZA 1RBUA 4O55A 4KRFA 3QATA 3S9HA 2E4LA 2RKIA 4YB6A 4IO9L 5TKYA 1FE0A 4IWVA 4AQYJ 2HNZA 1YJWN 2CPJA 4RW6A 3KVGA 3VQPA 5A76A 3NWGA 5HRSA 3W9IA 3KLEB 5HLFB 4PKGA 3CJSA 3L9ZA 1HNXF 3IFRA 2CNKB 2FQQB 4DUZF 2KXFA 4HHHA 3LPTA 1ELOA 1CPZA 2E1PA 2K1RA 3EKUA 4AT1B 1SQFA 4OI3A 2CGKA 2E9TA 3C14B 1NSKL 1D5AA 4FWNA 4L3NA 5JMNA 1CS4A 2B5JB 4AUKA 4EU0A 2H5IB 2M3DA 5F8NA 4R0EA 3SBTA 3E01B 3CJBA 3AA4A 1SKRA 1W26A 1S1WA 1M1KT 4WU3A 4QWBA 1NHUA 3J7A1 2PZSA 4YDDB 2B56A 4IOAQ 4W90B 4CTAB 3ADAC 3NS6A 5EX5A 3HT0A 1VRQC 2ZE2B 1QSYA 4I9LA 2Z0GA 3CJ1A 4V19X 3TAPA 1FRJA 3U27A 4G1QB 4A8KA 1HNXK 1RBTA 5D4PA 2HOEA 1CS4B 3QFHA 1HR0K 3FMWA 2Q1LA 2OTLN 3PYEA 5ETRA 2XY7A 1NMNA 2ROGA 4CD3A 4OV6A 3OS2A 5AFUH 4PEOA 3JXOA 1YAGA 1PYSB 2LQJA 2QKBA 3AA3A 2AJ0A 2Z2LA 3AB2B 5HMWA 3P31A 4DX6A 5KGXA 3J7AN 2YV0X 4JV5J 3BGRA 2Q2RA 3AQOA 3OLAA 2GTDA 3EJMA 1Y9OA 3BEGB 3HT3A 1EQYA 3C8YA 1ATRA 3MGJA 3P4IA 2OTLS 2VG7B 3LA0A 3DDNA 2R7OA 2VG6A 4ZPBA 1N54B 3I0SB 2MPUA 1URNA 3SUNA 2DR7A 3QEPA 4RNFA 3VVUA 3SPYA 3DI6A 4ZPCA 1M5KC 2KHCA 4JAXA 2X3DA 2DGVA 3HHLD 4RZRA 3O4WA 2QLJB 4ECVA 4JYAK 1VOMA 5M1FA 5LJVA 5KFRA 3QGPA 3PIPQ 3QB0A 2P5VA 2HVZA 1W2BR 2PA3A 1GK8A 1FKPB 2YHXA 1F5BA 5L38A 2WONB 1PIEA 4ID5B 1AFJA 3PTWA 3CPWM 1JCEA 2FB0A 3OTEA 2WB1D 4C0BA 2UVUA 2AYGA 1VQ6N 3WXIA 4ED3A 5HBMB 2E5GA 2QIFA 3M4XA 2M9KA 1YJTA 3H2LA 2KB2A 5AQFA 4LF8J 1T9WA 4XH5A 1SQEA 5CZVA 1EETB 1H74A 4O3SA 3RYLA 1Q5VA 4W4MA 1QZ5A 4I2QA 3NE6A 1DTTB 4DV4J 1QQMA 4H0TB 3S6EA 2HHVA 1JJCB 3JAMO 4Z4IA 1TQLA 2XZDB 2V4JA 1C1BA 3O1LA 3H5UA 3MECB 2N4CA 1K9MO 4DS4A 1D8ZA 1RAAB 2XSJA 1NB7A 4URSA 1SH3A 3CJTA 3AHPA 2BM0A 2YKMA 3IS9A 3NCQA 3UNGC 1KC8T 4YOVA 4F4YA 1G3OA 1YF5L 1WSEA 2UXBF 3NOCA 2H51B 4CIOA 3L2RA 3M8YA 1P90A 3ENWA 3W63A 3DJCA 2MY7A 4HHUA 2Z56B 3KDNA 3HHLB 2X6NA 3AVCA 2RQKA 1DTTA 5GINA 3FUYA 3VGMA 2BJEA 2DNMA 4JHDB 2WTFA 4DCHA 4DV4F 3EVOA 2ZH9A 2XSJB 3EPGA 2GIFA 4JI0J 3R5GA 1LXNA 4CHQA 1Q7LB 1SC6A 3M6GA 2IVMA 2UXBK 2C2KB 4DV1F 3NMUA 3SZ2A 5T41A 2HBZB 4J8FA 1GMUA 3RRHA 1QJHA 2HMIB 1HLWA 2HPUA 4UOGA 2V63A 1M5PC 3I33A 5DZ7A 5IM0B 2CUYA 2CVIA 4DHVA 2F8TA 2FBTA 2PD1A 3EL2A 3FLCO 1TKZB 2JLGA 2H65B 4FW2A 1U6BA 2HGLA 4IR1A 1UCNA 2J8SA 5KFOA 1AW0A 3D54A 1A0OB 4FF2A 1SJFA 2FPHX 5KFEA 3AXKA 4P2XA 2FJWA 1JKHB 1KHWA 3T5LA 4KSEB 3AV9A 1IKWB 5KRTA 5E3CA 1M1HA 1IKVB 5D0HA 3R5BA 3QRQA 4NCGA 2JRSA 2L41A 5LMNJ 3BDEA 3VHQA 1FK9B 5IM0A 2N82B 1S1UA 2ZNYA 4ZOSA 3OVBA 4C2MA 2FSJA 1F2GA 2RB7A 1WDDA 2C2OB 3IAYA 4QPTA 4HUGA 4J2DA 5FPEA 2CH5A 1GXLA 3Q23A 3BR9A 2UYTA 4F7VA 2ROPA 3GIIA 4YOWA 5HMYA 4B3RJ 3TA2A 4DPWA 1IO2A 4NYFA 4DL0C 2AYBA 2OLWA 4IO8A 1CULB 1VLYA 5GADU 2OTJS 3UKRA 4H4MA 1FRKA 2YVSA 3NGZA 4ILGB 4I6YA 1N32F 1UVIA 4F3TA 1E6YB 2W2NP 2ZM6F 1XC9A 4J9KA 5ETOA 4G1QA 4RTFD 3UW1A 2FBVA 3BGOP 1X60A 1X9WA 4Y2IA 4DHYA 3ENVA 1QAIA 3R3TA 4PAAA 1HBUA 4ECYA 1OYEA 2M0GB 5HL7Q 5KFXA 3CQYA 1RWKB 2IAJB 1P9YA 4O3RA 5BREA 4PG4A 2FYXA 4OI4A 2XS5A 1W2IA 3HK2A 2DBBA 4Q2LA 2OMOA 3H5YA 2AJQA 1N6QA 1JCGA 3AVBA 3QRPA 3P38A 1NCLA 3WDOA 4Y2KA 1Y0HA 2MQMA 1GH8A 1XK8A 3KTQA 1NNDA 3Q83A 2WHOA 4E19A 4W5QA 4RU9A 2QMWA 4QU6A 2GWJA 3BS9A 2XMUA 2OZMA 2MQOA 2O8FA 1SV5A 2EFVA 2G0IA 3OL6A 2O8BB 1HQEB 2UXBJ 1U2VB 1C1CB 2B8QA 3UKUA 4FWLA 3U02A 2HNZB 3PEHA 1ACMB 2HVIA 4Y28C 1C0GA 1B9DA 4KHPK 3HX9A 4FW1A 3ZEUA 1FVQA 4QU7A 4NLVA 5AFUA 4K41A 4DV2J 3IC1A 3I4PA 4OX9J 4MFBA 4WWSA 5D0EA 1ASWA 3ZYYX 5KG2A 5DGAA 1CC8A 3M05A 5GIOA 5D4NA 3BJYA 2LU2A 4BWJA 4UQTA 1RBRA 1S5JA 4FPRA 2FDNA 2PGCA 4LH5A 2KYZA 4OX9F 4DV2F 4DUZK 1K44A 4FWPA 4KH1B 2KT2A 4R8UA 4GKJF 2IIRA 2RQCA 1HHQA 4LFCJ 4JOUA 1TL7A 3V6DB 2CA9A 2GO8A 3THPA 3W62A 3KIOA 2LMIA 1NK6A 2Q3PA 1GAOA 4F36A 3TA0A 4KTQA 4O3PA 4C0HA 4EFHA 5IC4B 2H5JB 4WTYA 2NZTA 3QNOA 3V4IB 1RCOB 1UW9A 1TVRA 4NZ0A 1GNKA 4EO8A 4W5TA 1V3SA 1FTCA 2CQGA 3GYNA 3C6TA 4ED7A 1QY7A 2W41A 4KKOB 1HPZB 4F8RA 4ILHA 4NXNK 4MMOA 3CCRN 1T0TV 2E5LJ 1XQSC 2V68A 2YNGA 2IY5B 3ATUA 1NJWA 3IWNC 2W9CA 3UDCA 4Y2MA 3DGPA 2A6AA 2MZSA 1M90T 1BMQB 4B3RK 3VAIA 4IYQA 3HVWA 3TYTA 4FVUA 1TV6A 3MAHA 1DKGD 3LDSA 3NY0A 3IM8A 1RYSA 2HFSA 2XEXA 3PJWA 4FJKA 4KYZA 5U47A 2XS2A 1NLVA 1QVGM 1JWWA 4WF9L 4C4WA 3OHRA 2XG8A 4HDHA 4LRFA 4DF8A 2W25A 2F7VA 3EZOA 4K8ZA 2YNGB 4DV6K 1U8SA 5HN0A 1Z26A 1ZC6A 1TR0A 5CZ2A 2VG6B 4LF6F 2OYQA 3MN7A 1HW8A 1CBKA 3BBFA 3ZT4A 1EAYC 5EX0A 2QO3A 3TU5A 3W2VB 2E66A 2AP1A 2MQPA 2ZBQA 1H73A 2R8KA 1BQMB 4FYWB 4HVZA 2X3GA 5LOQA 4JKGB 2BW7A 2BA9A 3G8QA 2RRAA 2P9PB 3K2YA 2KT5A 4CGIA 4CO2A 2P9IA 5FLXU 3AVAA 5AT1B 2ZZNA 4K4VA 4CT8A 2QXLA 2LECA 2YQ3A 1YI2S 2GEMA 4ATNA 3N5BA 4JV0A 4ECZA 2HWIA 3QAEA 4DV0J 5HBMA 1RWOB 4N41A 5EX3A 4OZ2A 4JI2J 2AGOA 3D0HE 2C2MB 3GL1A 4E98A 2D3O1 2OPSA 2RU3A 5B0DA 4KB7A 4DR5K 2J76E 1N0UA 2NRVA 5T14A 2E1MC 2RN2A 3AVJA 2R7WA 1YTAA 4FWOA 2IJNA 2VJVA 3VQ8A 2OP5A 1U1QA 2N3OA 2ZH6A 5K8NA 3DC2A 1NHVA 1R0AA 4X4NA 2YI1A 4JNEA 1FKAF 4E3SA 1FX4A 3QQCD 1HNIB 2OHDA 2QSFA 3W9HA 3U7JA 4TLQA 2HLUA 4NLPA 3N4QA 2KKHA 4MT1A 4UOFA 3NHGA 2RHSB 3GFXA 4DR7F 2D69A 2G4BA 3K8VA 1ITPA 5HJXA 4TQRA 3UKRB 1F9FA 1CLFA 1FXXA 3E1YA 1T7PA 2FJVA 1F2HA 1IR1A 1VQKN 4B3MK 1E6YA 4OZ1A 1YQHA 1RBSA 1EX8A 4JK7A 2Y1RI 1YZ6A 2V2KA 5JXSA 3QERA 3MFHA 1MDUB 4EUVA 4YEAA 3RRKA 1VQ9S 4CI6A 3G71N 2YNIB 1EB0A 1HBUB 4OX7A 2CQPA 3LPYA 2PT0A 3NH2A 3S8SA 4QAGA 3A8KA 1NU4A 5HSPA 2MSSA 1JLGB 3OJSA 4KO0A 1RBOB 2CJ9A 1KRPA 4ISFA 3JYTA 3BSNA 1UPPA 1OS5A 2B4VA 4LSNA 1QE1A 3G0ZA 3EGNA 4RUCA 1U1KA 2V52B 2P9EA 4PYAA 1FDBA 1QHTA 3OPKA 4YR0A 4OV1A 4DV3J 1WKJA 3R1XA 1WC1A 4FWMA 4WJBA 4BCAA 3IBFB 4MLHA 3D1HA 4A8YA 3Q89A 4JI5K 4WKRA 3GZ7A 4PPZA 3KJNB 1Q8KA 1FD2A 5C24B 5K8OA 2CZ4A 3UKUB 1VHXA 4FM0A 3R2DJ 2BOAA 2GQQA 1VSJA 1P6TA 1SJ1A 4H4KA 2BABA 3KWMA 2OH2A 4DS5A 2DT9A 3ZCMA 4W98A 2D41A 4KY3A 4GVEA 4KFBB 1MWMA 5H1SQ 4RW9A 4FYVB 4NA1A 5KT5A 2AA4A 2KG0A 2HHXA 2QA2A 1PYOB 3K59A 4LJMA 4N7TA 2UVWA 4KHQA 1JX4A 1RTZA 4NZ7A 3CC4N 5IT4A 4C8LA 1K6YA 3AY9A 2WBMA 5LL6d 2C42A 2VYPA 4ENOA 1VDHA 2LP4A 4ERDA 3GG0A 3NEKA 4QJVA 4QYZJ 2XGQA 2WTUA 2HWHA 1T9TA 1KEKA 4JI6K 1O51A 2RD5C 3SMZA 3OUYA 4EBCA 4ES1A 2I9SA 2X6SA 1QZ6A 5L46A 4DFPA 4A59A 4H4MB 3TAMA 2DXDA 3SK3A 3GJTB 3KK3B 3VQTA 3DRRA 3A5MC 1TK8A 2YTCA 5KFAA 2IA6A 1L3TA 3IR7B 1S9GA 4G65A 4NMLA 4OJ3A 4DR1J 2J8AA 1F21A 3GJRB 4DCOB 2P1JA 4IQMA 3ID8A 2BH1A 2DTUA 3P5TL 5D78A 4M5JA 3E51A 3MTJA 1CEZA 3AO2A 3PY8A 4FZZA 1VQ8S 4WFBL 1T95A 4B17A 1WDTA 2CZVC 2G8UA 5EGYA 3VCDA 3KG1A 4OZNA 1N34J 2J9EA 1RT3B 3V9WA 4PWDA 4X65F 1V5IB 4V1Ak 3VAJA 4DQIA 1Q9YA 5H9EJ 2C2EA 3RR8A 4K0KF 3T6BA 3W9JA 3TUIC 4WCEL 3D45A 3F9MA 2CNLB 1QQNA 4LF7J 2ZJRQ 4I67A 5KFTA 4JI4F 1ASVA 4A57A 1NM2A 4CGHA 1FRHA 4H5RA 1KN6A 1YBTA 2YWFA 4LUBA 3L2WA 2CQBA 3E2EA 3CO9A 4PWDB 3VV2B 4M94A 3QJPA 2IDEA 2MZJA 4JI3K 4RBUA 3VQQA 1H6KX 2VONA 3AVNA 3HXMA 4M3XA 4HL9A 1AFIA 1A7GE 1WOQA 3BQ0A 1HBMA 1I3AA 4MTPA 3TQ1A 1VQPS 2YKMB 2CPYA 1VISA 3CD0A 1RISA 4OHWA 5E0OA 2JLEA 2RHQB 1YJUA 4NYZA 3O8MA 3IN5A 4D3GA 1XMQF 2DNHA 3H20A 1JL1A 5GAGI 3SCXA 2RQ4A 1X7VA 1DGKN 2Z1HA 1H1VA 1VSLA 3MECA 1Y5NB 2Q6CA 3IP0A 1EWQA 3HHLA 3VEYA 1VHIA 3A8YA 3IS9B 3EE3A 3MAQA 1AZSB 1SCJB 3SUOA 1FE4A 3KNGA 5EDWA 5LMUJ 2KHOA 1NGCA 1QDUB 4CEBA 1N36J 2HBYB 3L0QA 4YB7A 1G7CB 3QEXA 2JVOA 1Q86T 3RWUA 3M2UB 3M8WA 2DNOA 1SAZA 1W7WA 3GYXB 5CCLA 2NPFA 1LAWA 1FXLA 3OYFA 1DQ8A 3BYRA 4JKAA 3CG7A 3D1QA 1WORA 5FIIA 1H2TZ 5E7OB 4NX9A 2HK2A 3FEXB 4JKFA 1HPZA 2DHXA 3U3YA 2P8IA 2BM1A 1ZS6A 4IH5A 2O8EA 1IKYA 2OO4A 4K0KK 5KT7A 2XZWA 3QMLA 3HOSA 1SQKA 4UF4A 2ZQBA 1JQGA 2CPZA 1RKIA 2V7ZA 1LQ9A 4LQ9A 4BRKA 2R9LA 4N8NA 3I0SA 1RDAA 4OYIA 2ABYA 4NCAA 2HRUA 4DSKA 1YSJA 2KM8B 1UWAA 5AQSA 4WFNQ 4C8OA 4WYLA 3FRYA 4FOEA 1FEEA 4USIA 4DSJA 4AYBD 3QICA 3OYDA 2YJEA 2ZHBA 1IR0A 3GFHA 4PL7A 1ZA2B 4URQU 3WC0A 2A40A 3D6TB 1RT6A 4EI2A 4O4RA 2QLXA 2ZBCA 2O8EB 2AJ4A 3FZBA 3MMJA 4PQUA 4LSLA 1NK4A 4F4WA 3HSGA 4WQ5C 2C1EB 1UVLA 1KD1O 3A4TA 4LFBF 2R8GA 3KK7A 2RUGA 4ZP9A 4XTTA 1QQCA 3W65A 4HKQA 4Q8FA 1GLJO 4B8AB 2RDIA 3D5MA 1VQNN 4C7QA 1JB0C 4BRDA 1X4HA 4OKJA 2IRYA 4GW6A 5M1OA 3MUTP 1LFPA 5E3RA 1OJ4A 5KFSA 1Z2ZA 1ZXOA 4H5NA 1FJ7A 3ZZOA 4FM1A 2F3JA 5BYSA 5FPNA 3VR1A 2KYXA 1FJGJ 4CHOA 5C7PA 2V34A 1NG9A 4DLGA 5DJBA 1MU2A 1U26A 4FNIA 4A48A 4YOTA 1AYEA 1KQFB 2FBXA 4LQ3A 1QAYA 3F56A 4WE1A 1VSKA 5A8RA 4U67Q 1Q53A 2E7VA 1K73O 3IBCB 1BXNA 3NP5A 3HPGA 2D9PA 3VEWA 5GIPA 3KK1A 2F65A 3N6LA 1J5OA 4DL3A 1RILA 4DR3J 3BF1A 4FPBA 4CJWA 2ASMA 2Q66A 3DU6A 3MWBA 1JXBA 2GELA 3WEEA 1HJOA 3T1YJ 4WXWA 3PX0A 3C7NB 4NCBA 3KK2B 5ETQA 1S6QA 3FVYA 5AQZA 1ZZNA 3JQJA 3SV3A 2Y1LB 2L9NA 1FNOA 2P9UA 2KH9A 1UFLA 3DXBA 3L2VA 2HZAA 4B9TA 4BRHA 3MMBA 2RS2A 4DL6A 1MROB 2PFUA 4CIFA 4ID1A 3L3UA 5AQLA 5C25B 3TX8A 4ZP6A 2APOA 4CW7B 2WVBA 1WELA 1UJ5A 1YT3A 4HI2A 2Y9HA 2C22A 1WD6A 4WFZA 5JVGL 1FF2A 4DMNA 4H8KA 2KM8C 2XZTB 2G8KA 2YNHB 2I7NA 4CH1A 2PEHA 3KKRA 1F9EB 3C19A 4OJ1A 4OGEA 3AXMA 2KZZA 2D0OA 4UY8T 2HEKA 1LEOA 5IWAJ 3UFCX 2LDIA 3BZCA 4NYNA 6AT1B 1C1CA 3OL8A 2E6LA 1S1WB 3CB4A 3OQ2A