1JLCA

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with pett-2
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
547
structure length
534
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 RT A-chain
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 130
structure length 534
sequence length 547
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlcA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlcA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlcA05
2YNFA 2YNHB 1T05A 2UVWA 3OS2A 3ZSYA 4G1QB 3O4QA 2YKMA 3DLGA 3TAMB 4W5TA 3OYEA 4J9SA 1A5VA 2AGQA 1UA1A 2OPPA 2D41A 4KPYA 4CGIA 2EHGA 2DTUA 1VSHA 2C2DA 4NLOA 4DQRA 4RW7B 3K5OA 2KFNA 4I2QB 4H54A 1O1WA 4Z4HA 5J2QB 5C5JA 1TP7A 4TYBA 4RW6B 4ICLB 3QEVA 2OPRB 5KFGA 1RTHA 3EPIA 5KG7A 3OYKA 3AVFA 1S0NA 1EP4A 4TQRA 4AHRA 4KB1A 4KHMA 1S0MA 3V1RA 4M3RA 1NK8A 2FJWA 2XY7A 4IG0A 3MR5A 1SH0A 4LH5A 1RYSA 4XIUA 3I5BA 4DSEA 2BE2B 3NH0A 4J9PA 3UIQA 4DFPA 5KFXA 4FJJA 3AVLA 4HYKA 1CZ9A 3HL8A 3KLFA 3T5LA 3VN5A 3AVCA 3CYMA 3GQCA 3NL0A 3HPHA 3DLHA 1KFDA 4F2RA 1C0MA 2IC3A 3KLIA 5C24A 3TQ1A 1LWFA 4NLWA 4I7FB 1T8EA 3CJ5A 2ZD1B 4PUOA 3KK1B 1HNVA 1RAJA 4NLRA 4U7CA 3KHGA 1KSPA 2ATQA 3CWJA 2YKNB 2QE5A 1FKOB 4Q8FA 1S9FA 3AA2A 5FDLB 3NH2A 2O4IA 2R8HA 5KFJA 1VRTA 1C0UA 1XC9A 5F8IA 4EBDA 3PZPA 1EX4A 3M8QA 3ZT0A 1JLFA 1IKWB 3V1QA 3KK2A 3KJVB 4RU9A 5EDWA 2RN2A 2YHBA 1RT6B 3FQKA 5F9LA 3PW2A 1TKXB 3VQ8A 3PR4A 1REVA 3V6JA 1JXEA 2VA2A 1ZBLA 1RT1B 1CXQA 4AHTA 2OPSB 4YP3A 3NGIA 3AO3A 5D3GA 3E01B 2O5DA 4OKJA 4KHSA 4ID5A 2J6SA 3MR2A 4HCCA 2E9ZA 1TV6B 1ASWA 4CIFA 1WAFA 2XGPA 3EY1A 4RZRA 2W8LA 3VQQA 4TY9A 1JIHA 2FBXA 5CZ1A 2YNGA 5KFEA 4ZTFA 4DQIA 5KG0A 3V9ZA 4DLGA 2FBTA 1J53A 1BIZA 4CGHA 3ISND 4PQUA 2R7YA 4FS1A 4MK7A 3DM2A 4R8UB 4Y3CA 1SUQA 2HMIA 4C8LA 3T5HA 3KLHB 3DRSB 5CYMB 4LQ9A 3NH1A 3FFIB 1S6PB 1N4LA 3QERA 1TAQA 3VA3A 3LANA 4MFBA 3OYIA 1J9AA 2ILYA 1FK9B 1KRPA 3H5SA 1GX6A 2HHQA 3ICLA 1RDCA 1BQNA 5JS2A 4CK1A 1S9EA 3E51A 1JLCB 1RT7A 3DDKA 4EBEA 1UOCA 4WZMA 4KHYA 3I0SB 4KTQA 1JKHA 4EYIB 3CG7A 5L1KA 4DTXA 1N48A 3D0PA 4O4GA 1VSJA 4Q0BA 1KCFA 3F9KA 2WCXA 4DF8A 1HRHA 5F9NA 2XO7A 1S9GA 3PW4A 4CF2A 4URGA 1HPZB 3S3OA 2PY5A 2IM2A 3OYGA 3G6VA 4E7HA 1IKVA 1NKCA 1S6QA 1WSEA 2FJVA 3NBPB 1X9WA 3K57A 5C25B 4HUFA 3C6UA 2D3ZA 4DU4A 4I2PB 2R2SA 3AVGA 3OYAA 4R0EA 2AGPA 1BI4A 1L3VA 1EKEA 5HP1B 2FLNA 1VSIA 1OS5A 3MECB 4FZXC 3CVKA 1GOCA 4CERA 2HHSA 4CJUA 2VG7A 3PO4A 3QIPA 3KLVA 2DFEA 2J6UA 4K4ZA 4KHQA 3BQ2A 4TN2A 4C8MA 5HRSA 3PX0A 2HHUA 1WSHA 2IS3A 3G86A 3RAQA 5HRRA 2UUWA 1S1UB 4CESA 5KG1A 4WFZA 2R2RA 4ECVA 3H2LA 2RDJA 3ALYA 4M41A 4M3YA 1NJWA 4CFDA 4BDZA 1JLQA 2FBYA 2XHBA 4KKOB 1RTDB 4O3RA 1U09A 1C1BA 5CYQB 1YVFA 3C6TA 4ZP6A 4NZ0A 3CDUA 4R5PB 4M95A 1TKZB 3GIKA 2G8KA 4F4YA 4XO0A 3FDSA 3SUOA 1QQCA 3S9HA 1RA7A 4EZ9A 2FC0A 3HXMA 2HWHA 5JXSA 4ED1A 5HBMA 4FJ8A 2B5JB 1CLQA 3D45A 4Q44A 3ZT3A 3P5JA 3B6OA 4K4SA 4HHTA 3TAFA 4ELVA 4K4TA 5KFQA 3RB4A 4F4KA 1G15A 3T1AA 4FYDA 3NKYA 2PYJA 1VSMA 4Y34A 4E7KA 4TY8A 1NK5A 3SI6A 2B43A 3MEEB 1TK0A 2VWJA 3B6PA 5K14B 4FLVA 3SYZA 4NLPA 3GIJA 3G10A 4J9OA 3N6NA 3T3FA 4ZPCA 3KK3B 4LQ3A 1N5YA 1QSYA 1DTTB 2RKIB 1QE1B 3VQCA 3K5NA 3OHAA 2HNDB 1XR5A 3PW0A 2Y1IA 4N76A 1K1SA 1LW2B 1HMVB 4WXWA 3PV8A 4W5OA 3DRRA 3MTKA 3GIMA 4Y2AA 5KG2A 3LP2B 4BWJA 4KAIA 4Y1CA 3SUPA 1N6QB 4CEQA 3HKWA 4RUAA 3V6DB 4B3OA 4DU1A 4K8XA 3TWHA 4KV8A 1JLAB 4CJFA 3QEWA 2IDOA 1BQMB 2WRMA 2KTQA 4TQSA 3T19A 4DWIA 4PWDA 4ECWA 2GIRA 3HO1A 3CQ8A 4BE0A 2YHAA 5KFHA 2IA6A 4EO8A 4NLXA 3BREA 2QKBA 3UQSA 4ZHRA 4CJTA 3DYAA 5F8HA 4ELUA 3SUNA 4QCLA 3ZT1A 2FBVA 3SCXA 1IH7A 4CF8A 4CHQA 2XGQA 4ECTA 3TAGA 1IG9A 1IKYA 1BCOA 2BANA 1RILA 3BQ1A 4K4UA 2YNFB 4OKKA 1T05B 1ZBHA 1SL2A 3JYTA 3AA3A 2YKMB 3DLGB 1DTQA 4NYNA 1RCHA 1L3UA 3K58A 3ULDA 1NKBA 2OPPB 3H5XA 4DS5A 4B08A 3QZ7A 2BQUA 1UA0A 3AV9A 3LZJA 2R8GA 1NOZA 3V9WA 5DQHA 1L3TA 2XI3A 1UAXA 4F4WA 1CSJA 5SWMA 4FW2A 2ASDA 3GV5B 4BE2A 4KTZA 1C0TA 4FJGA 2I1RA 4RG8A 2WOMA 4LSLA 1RT5A 2CKWA 2FVPA 1RTHB 4HTUA 3IG1A 3P1GA 2GIQA 3NMAA 3HSTB 4CCHA 1S0OA 3ZT4A 1EP4B 4QAGA 1EETA 1HQEA 3AVBA 4FJMA 3N6LA 4M3UA 5KT2A 3M8PA 3LP0A 4FBTA 2YV0X 4IG0B 4CJLA 3IS9A 2JEFA 1RTJA 4WYWA 5KRTA 4DFJA 2JEGA 1KVAA 3ITHA 4EYHB 3O4NA 4Q8EA 1XHXA 3RRHA 2UVVA 4J9MA 4K8ZA 1FKPA 4ZPDA 4FLXA 4L8RB 3KLFB 1LAVA 3NDKA 3RMCA 3VQSA 1WSFA 3VQ6A 2F8EX 3K2PA 3KLIB 1LWFB 3DRPA 2OH2A 1TGOA 3SQ2A 4KHRA 3TAQA 3DLRA 3LWLA 1RBUA 4PUOB 3M8SA 1HNVB 2HNYA 1RBRA 2WONA 3OL7A 1XR6A 5J2PA 1JL1A 2XC9A 2JLEA 1U04A 4NCGA 4G3IA 1WAJA 3QETA 1Q9XA 1VRUA 3AA4A 3MFHA 4TSXA 2UUTA 1ZBUA 4M3TA 1VRTB 4WYLA 1C0UB 2KZZA 2XY8A 1TKDA 4DFKA 4FXDA 3RAXA 4O3QA 3M8QB 3BSNA 2J6TA 3KLEA 3FSIA 4DSJA 1ASVA 1JLFB 2A1SA 3KK2B 1LWCA 5HLFA 3SUQA 1NK7A 2JGUA 3ZSXA 1T94A 5KTQA 1RDDA 3CDEA 1X9MA 4DSIA 1REVB 4IFVA 4CF0A 3HVTA 5D3GB 4FJXA 1KHVA 4ID5B 3QNOA 3HVAA 3D5MA 4DS4A 3DLEB 4CHPA 5FRMA 2W9CA 3Q8RB 3ZSWA 3SPYA 2IM3A 5KFIA 4DTPA 3NF9A 5L1IA 3NCIA 5KFZA 2OA8A 4M3WA 1HYVA 4IKAA 5J1EA 4IQXA 3OL6A 3VQ5A 1TK8A 2YNGB 5EWFA 1RT3A 1GX5A 4RW8A 4CGJA 1RT4A 3QIDA 1I3AA 4XPEA 3QNNA 4O0JA 4O44A 4ED8A 4PQUB 3Q8PB 4RNFA 5KFUA 3DM2B 1NOYA 3LZIA 4KAZA 3GIIA 1TL3A 4TYAA 2XRIA 1SUQB 2HMIB 4O3OA 2AGOA 4BDYA 3HT3A 2RF2A 4FW1A 2P5GA 3MEGA 1WN7A 1I39A 2XCAA 2FJXA 4DTRA 4MFBB 3MR6A 2B6AA 3V6KA 5HROA 4QPXA 5I3UA 1B9DA 1BQNB 4BACA 4U6PA 1S9EB 5KGWA 2IOCA 3MXMA 2WHOA 1RT7B 5KT3A 2ZQBA 2RDIA 5DG8A 5KFAA 2D0BA 1JKHB 3L3VA 2ASLA 3H40A 2R8IA 3KMSA 4O4GB 4Q0BB 1D9DA 1LW0A 3QESA 4CIGA 5J2NA 3H5YA 1S9GB 4FJHA 5KFTA 4ECQA 1R0AA 1NKEA 2ZE2A 1HYSA 4FM2A 1TL1A 4O55A 4FLTA 4FZYA 2EX3A 3KLGA 3K5LA 2AX1A 4FZZA 3U6FA 1IKVB 1S6QB 4N41A 1KLMA 2IAJA 4W5NA 4IRKA 3SFGA 3C6UB 3KNAA 2AJQA 1BI4B 2BQ3A 3QGHA 4NLVA 5L1JA 5EU7A 1SV5A 1QAIA 2VG7B 3QIPB 1LWEA 2G8WA 4WFYA 4AHVA 2W7PA 4J9QA 4JRPA 1NK0A 2W9BA 4J9RA 2LSNA 1KLNA 4I2QA 1MU2A 2QK9A 3CFOA 1VSLA 1RT2A 3CO9A 3M9OB 4JV1A 3VQDA 1BIUA 4YQWA 1JLQB 4K4YA 4CJ4A 3NF8A 1KHWA 5FRNA 3WNFA 3F73A 2HB5A 2VWKA 1C1BB 3HPOA 3O3FA 3DI6A 4O0IA 1HARA 3K59A 4DEZA 3LWMA 5KRSA 1BL3A 4F4ZA 2HAIA 4FJ7A 2C2EA 4KRFA 4EZ6A 3RBDA 4NRTA 1YTAA 4QWDA 4JS5A 5KFLA 2QKKA 5HBMB 2WB4A 4QOZB 3AO2A 4AHUA 5JUMA 3OYFA 1A5XA 3I0RA 5EWEA 4I9QA 3HM9A 4I9LA 2WTFA 1C1CA 2E6LA 5F8MA 4OPKA 4TY8B 4B8AB 2I5JA 4IH7A 2WK4A 1RNHA 4KTWA 1RA6A 2OPQA 4ID1A 4FCYA 3L3UA 2CJQA 2Q3SA 3G0ZA 2IM0A 1QAJA 3HP9A 3SQ0A 1NJXA 1N5YB 2KZMA 5KG5A 4M42A 4DLEA 5CY4A 3TAPA 4FJLA 4ZP9A 2ASJA 4NYFA 5DMRA 2IMWP 3DRRB 4J2AA 1Y97A 2V0NA 4N56A 4FS2A 1HQUA 1W9HA 4NLGA 2W8KA 4H4MA 2DPJA 4IRCA 4ZVEA 4ECRA 3RB3A 4KO0A 3AA5X 1T3NA 4DTJA 3TARA 4URQU 4B3OB 5SZTA 3RMDA 2R8JA 4J2DA 4KV8B 4CK3A 4FM0A 5JS1A 3DLKA 2HNZB 4DTSA 3SNNA 2KQ2A 3IN5A 4RNMA 4E1MA 1Z4UA 3CM6A 4PWDB 3IRXA 2VG5A 4J9KA 3V4IA 1TKTA 4NLTA 4RNNA 4DMNA 1U48A 1S5JA 4J9LA 4BDPA 1K6YA 3CJ2A 3TR8A 4CEFA 4Z4IA 4TXSA 4OLBA 3T5JA 4E3SA 4JLHA 3V81A 4ZHRB 2JEIA 1WSIA 2D3UA 1XWLA 3DYAB 3BR9A 4E7LA 4WE1A 3A2FA 1TAUA 1IKYB 3O3HA 2BANB 2D7SA 3OYLA 4FBUA 3SPZA 1S97A 3JYTB 3BGRA 3AO1A 1DTQB 4DTOA 4RNOA 4NLYA 5KT6A 4MH8A 4XPCA 1RTIA 1U45A 3I5CA 5HRNA 5I42A 3ZSZA 3HJFA 4KSEB 1WSGA 5KFRA 1CZBA 1SKSA 3NAIA 1IKXA 3I5AA 4IR1A 4NCAA 4J9NA 3ZSOA 1HNIA 1T03A 1C0TB 3OYMA 4DF4A 1U4BA 3OJUA 2WOMB 4LSLB 1RT5B 3IG1B 4B9TA 3DOLB 1QUVA 4Q45A 2KW4A 4Z4GA 3NGZA 1JLBA 1EETB 3BDPA 4QW8A 1HQEB 1WLJA 1NK4A 1VSDA 5EWGA 1JLEA 4B9SA 3TVKA 2HHVA 2JC1A 3M8PB 4LSNB 3VQ4A 3CFPA 3OYCA 3IS9B 5DGAA 3KD5E 1B92A 3OL9A 2VG6A 3CDWA 3MXIA 1RTJB 1VSEA 3H98A 4C8OA 1SH2A 3PR5B 2AQ4A 2GBZA 4AHSA 2Y1JA 3ITHB 5KFWA 1ZBIA 1YTUA 1FKPB 2IBKA 4HCBA 3PX6A 4N47A 3L2VA 3DMJA 3AVNA 4N5SA 4RNHA 5KFMA 4YR3A 1N56A 1JLGA 3KIOA 5KFFA 4YR2A 3OYNA 1J54A 3AO4A 4Z4EA 1J5OA 3DRPB 3OS0A 4DTUA 4DFMA 4LD0A 5C42B 4W5QA 2HNYB 1HYZA 2WONB 3UR0A 4ED6A 4Q43A 3GV8B 2DFHA 5J2PB 3V1OA 1Z26A 5KFNA 4K50A 1ZBFA 3MEDA 4B9NA 3NAEA 4E7IA 4NCGB 1VRUB 1DLOA 4CIEA 5F8GA 2F8SA 1S1VA 4NRUA 1Q9YA 1C1AA 4IR9A 4ZMMA 3AVKA 3IGNA 4IOBA 3KLEB 3RMAA 5KFOA 4B9VA 4EEYA 1L5UA 5F8LA 1LWCB 5HLFB 4FJNA 4B9MA 4ECYA 3VQAA 1UWBA 4FJ5A 4HUEA 1C6VA 4DTMA 2W9AA 2C2RA 3HYFA 2YNIA 2BGGA 2G8FA 4IFVB 3HVTB 3NF6A 2C22A 4DG1A 4JUZA 3L2WA 4FJKA 1HJRA 3DOKA 5KFPA 3RR8A 3CJ3A 2V4RA 4QWAA 2W9CB 2V9WA 3N6MA 3I8DA 5KG3A 1QSLA 2FVQA 4IFYA 4RW9A 3M9NB 4DL6A 4KB7A 2XI2A 3NHGA 5J1EB 4FLYA 2D0CA 2G8UA 4FK0A 1EXQA 3GV7B 1T7PA 3ISNC 1RT3B 3QYYA 1SKRA 4DSKA 4RW8B 1RT4B 3MXJA 4CHZA 3KOAA 2KFZA 4O44B 4DQSA 3QLHA 2B4JA 1S1XA 4QWCA 4NYZA 2Z1JA 3L2RA 2UVUA 1S4FA 3OL8A 3LDSA 1TL3B 4RW4A 3MAQA 4F3OA 3TABA 2RF2B 5KT5A 4ED7A 3RB0A 2AU0A 3MEGB 1KFSA 3LPTA 2IC3B 3OLBA 5C24B 5DK5A 2B6AB 4H4OA 4TLRA 5HROB 3PJWA 5I3UB 1BHLA 3NE6A 1BISA 2QXFA 4M94A 1S1WA 3JSMA 4F8RA 5KFBA 1NNDA 3S3MA 5KT7A 3LAMA 3SV4A 1LW0B 4DL4A 1WNSA 3H08A 4IG3A 4CFBA 5J2NB 4MQ3A 3OLAA 2GV9A 1R0AB 3BQ0A 3CFRA 4Z0UA 5CZ2A 1TQLA 3V9UA 2ZE2B 1HYSB 2QV6A 2P1JA 1TL1B 4IH5A 1JX4A 3U3YA 2PZSA 3KLGB 4IDKA 4ZPAA 1X1PA 1NK6A 1S10A 3V6HA 5T14A 1KLMB 2IAJB 4MIAA 3OYHA 3HP6A 2RPIA 2G8HA 4FJIA 1Z25A 4FK2A 3MF5A 2NUBA 2X74A 4KBIA 2HHWA 4FM1A 3UPFA 1D0EA 3MR3A 4CECA 3QO9A 3CJ4A 1JXLA 3HVWA 3KKRA 3PW7A 1KVCA 3P83D 3AVAA 4RUCA 2BQRA 1SV5B 4O5BA 4FLUA 1LWEB 1WNEA 2ETJA 3OSPA 3EYZA 3SV3A 3LP1A 5KG4A 2W9BB 4CGGA 2R8KA 1MU2B 3SQ1A 5J2MA 3RBEA 4ZTJA 3CIZA 1RT2B 2ATLA 1SH3A 3FQLA 3S3NA 1L3SA 3FRZA 5KFYA 1SL0A 3O3GA 3EZ5A 2BRLA 1TVRA 1RBSA 4ED2A 5DLFA 2XCPA 4CJKA 3Q8QB 3H4DA 4YFUA 3DI6B 3RWUA 2BRKA 1VK0A 2F8TA 3HK2A 2HHTA 3CJ0A 4W5RA 3RB6A 1NHUA 4PA1A 3RRGA 3VQ9A 3CM5A 4YMEA 4IKFA 1RBTA 2X6SA 4WXOA 1SL1A 4Z4CA 2Z1HA 3EPGA 4CHYA 3I0RB 1S1TA 4CJ3A 3AVIA 4C8NA 5F8JA 4E1NA 3H59A 3NAHA 3PO5A 1C1CB 4KFBA 2JEJA 4NLDA 1YVUA 2FVSA 2I5JB 4GVMA 3THVA 3L2QA 3NGDA 2OPQB 4CEZA 2HW3A 5HRPA 4F4XA 1RBVA 1ASUA 1ZTWA 2X6NA 2O4GA 5KFVA 2P51A 4KI6A 1ZETA 1BCMA 3L8BA 2V4QA 2D0AA 1A5WA 3H4BA 4LY7A 2YNHA 3G6YA 4F50A 4H8KA 2E6MA 4CJRA 4G1QA 3TAMA 3NF7A 4DSFA 1HQUB 4OLAA 4H4MB 3PY8A 4ECXA 4KO0B 2X78A 4QWBA 3HPGA 4O3NA 3LAKA 4RW7A 3OYBA 3GILA 4EP5A 5DG7A 3DLKB 4CJPA 4DL7A 2UVRA 1K1QA 5J2QA 4F3TA 1RYRA 2IM1A 3IRXB 4J2BA 4NLSA 2VG5B 3V4IB 1TKTB 4CJ5A 2OZSA 4B9LA 4RW6A 4ICLA 3DLEA 4M3XA 2OPRA 1D8YA 3U3GA 5KFKA 1XHZA 3V9SA 4ZP7A 3ZSQA 1F21A 1IM4A 3C6TB 3V81B 4KHWA 5FROA 4KREA 3TI0A 3G6XA 4ECZA 4CJVA 4NCBA 4DQPA 3PX4A 4WE1B 2BE2A 3OHBA 3Q8SB 4OGCA 1B9FA 3TAEA 4KI4A 5L1LA 3BGRB 1LAWA 3C94A 5E41A 4WZQA 2F96A 2G8IA 1RTIB 3BSAA 4CEAA 3PHEA 5I42B 5KFSA 3DLBA 4NLUA 3C95A 4PY5A 4CK2A 1LV5A 4CGFA 4FJ9A 2AWZA 1ZTTA 1KTQA 4M3ZA 3QIOA 4Y1DA 4NLQA 4I7FA 1IKXB 2ZD1A 2E4LA 4IBNA 3WNHA 3KTQA 1HNIB 3KK1A 1T03B 2FVCA 3L2UA 1ITGA 1KVBA 2IJFA 3D28A 2YKNA 4O4RA 3PW5A 1FKOA 4J2EA 4CF1A 5FDLA 3VQ7A 3M9MB 1JLBB 4ED0A 3AVMA 3KHHA 4JV2A 1JLEB 4ZP8A 5KFDA 4CJQA 1SKWA 3WNGA 3BSCA 3T5KA 4GC7A 3WNEA 2VG6B 1IKWA 5KT4A 4MIBA 3KJVA 1JXBA 1NK9A 1RT6A 2IGIA 1TKXA 4UQGA 4DL5A 4KE5A 3DMJB 1QHTA 4DL2A 4ECUA 1IO2A 1RT1A 1JLGB 3V9XA 2OPSA 1GOAA 5L9XA 3E01A 4ZVHA 1YT3A 4CJWA 3LPUA 1J5OB 1TV6A 4Z4FA 4ZVGA 1RDAA 4K4VA 3ZSRA 5KI6A 4AHCA 3MEDB 4E0DA 1RDRA 4LH4A 4OGEA 4CEOA 3KD1E 1W0HA 1DLOB 4O3SA 1RDBA 4HUGA 1S1VB 3VQEA 4K4WA 4JS4A 2OZMA 1TK5A 2C28A 4IRDA 4R8UA 3OS1A 1UWBB 4JV0A 4ED3A 2HWIA 3UDLA 4FLWA 3KLHA 4OKEA 3DRSA 4CEDA 5CYMA 4GW6A 3SI8A 2G8VA 3M8RA 3OY9A 2YNIB 3FFIA 4KB0A 1S6PA 4YR0A 5KG6A 2XY5A 2HVIA 1FK9A 4WFXA 4DG1B 3QEPA 3DOKB 1JLCA 4OVLA 3QINA 4HVJA 4QW9A 4ZPBA 4CFAA 3I0SA 1X9SA 4EP4A 3KHLA 3IGVA 1I6JA 3OVNA 4IFYB 4BE1A 4RW9B 4B9UA 2HHXA 3LALA 2P5OA 2E9RX 3KKSA 4B8CA 1XI1A 3OYDA 1Q8IA 1QSSA 4CEBA 4EBCA 4CFCA 3QGGA 3LP0B 3OJSA 3ZSVA 2ILZA 1CXUA 1HPZA 1D5AA 1U47A 4EO6A 2EC0A 3QLHB 2XWYA 1S1XB 2Z1IA 3TANA 3NBPA 5C25A 3GYNA 4RW4B 3AVJA 1NJYA 3H5UA 4E19A 4I2PA 2GUIA 3K5MA 1U49A 2Z1GA 5HP1A 4DSLA 3MECA 3QEXA 3RTVA 4H4OB 2ITGA 2ZKUA 4URSA 3QGIA 3BJYA 5F8NA 2GC8A 2D5RA 2FVRA 1S1WB 4AILC 3JSMB 3RR7A 4OL8A 3KHRA 2HNZA 5KGXA 1BGXT 2VA3A 3RMBA 4X2BA 4IG3B 1S1UA 4CF9A 1S48A 3VQBA 4DTNA 1JL2A 4MKBA 4ZVFA 3KMQA 5KFCA 4HKQA 4KKOA 1RTDA 4IDKB 5CYQA 4BWMA 3ASMA 4AH9A 2PYLA 3LP3A 5T7BA 4R5PA 2BDPA 3IAYA 1TKZA 4QWEA 2W7OA 3SFUA 3EZUA 1C2PA 3QO9B 4OPJA 2B5JA 4MK8A 4C8KA 1WSJA 3AVHA 3QEIA 4FLZA 3OSNA 3PVXA 4CE9A 2R2TA 3LP1B 2HVHA 5DGBA 4Y2CA 5J2MB 4KHNA 2DY4A 3MEEA 3PJXA 1W25A 5K14A 4CGDA 3OYJA 4E7JA 1QTMA 5DQIA 1TVRB 4F2SA 4CHNA 2FLPA 3KK3A 3DOLA 2JC0A 4GMJB 1DTTA 5DG9A 2RKIA 1VSFA 4IH6A 4M45A 1QE1A 2W42A 2DPIA 4JRQA 2HNDA 3ZCMA 1LW2A 2BR0A 1D1UA 4LSNA 2ALZA 1HMVA 1NHVA 1XR7A 4DU3A 4DL3A 3VQPA 2A1RA 3LP2A 3MFIA 1VSKA 4MK9A 3SQ4A 4Q5VA 1D9FA 5DLGA 1N6QA 2E9TA 1GOBA 4ECSA 1ZYQA 3V6DA 3NFAA 4E89A 3HVRA 2XY6A 4YNQA 4O3PA 4MKAA 5EUHA 1JLAA 1S1TB 1QS4A 1BQMA 4FK4A 3PUFA 3HHKA 3VA0A 3QZ8A 1FXXA 3BSOA 4KFBB 1S49A 3NGYA 2DFFA 3SJJA 1MMLA 3AO5A 5DQGA 5C42A 2IJNA 1NJZA 4OJRA 2FLLA 4KHUA 2R2UA 2OYQA 4CJSA 4DQQA 4ELTA 4GC6A 4CEEA 2AX0A 4K4XA 4FVMA 4CHOA 3SZ2A 4CJEA 3ZT2A
chains in the Genus database with same CATH superfamily
4KGXB 2YNHB 1T05A 4K5RA 4HDGA 1XNRJ 4DV7J 1J27A 3OYEA 1SKUB 2DB1A 1A5VA 4KPYA 2NXCA 4JAXA 3B6BA 2HQFA 4DQRA 5M2UA 2KFNA 1WB9A 4I2QB 4H54A 3BB5A 4JI2K 2VBZA 4ICLB 2Z2MA 1GTEA 2KHOA 3TZYA 3EPIA 1RTHA 2FYXA 3BYPA 3AVFA 1EP4A 4AHRA 4KHMA 1IBMF 2CDQA 4HHUA 2HIYA 3QRQA 4IG0A 1PC4A 1JB0C 3I5BA 1FWKA 3NH0A 4BRIA 3UIQA 3R9LA 4FJJA 2VC0A 5KFXA 4ZLNA 2I2YA 4LF7J 3AVLA 4HYKA 3V2UC 2DR6A 3HL8A 4OX8A 1FRMA 3KLFA 2A5XA 3VN5A 4BRDA 5D4NA 1VJWA 4K43A 1E3MA 3PRBA 1KFDA 1C0MA 3LA0A 5C24A 4WK3A 1DAXA 4ILRA 4BCAA 2EK1A 1T8EA 3IWXA 5D0GA 4LR7A 4B17A 1FXLA 2B4PA 5KOWA 3KHGA 4ZA1A 5AZIA 2MQPA 4QJVA 2HZCA 2QE5A 2Q1LA 4Q8FA 5FDLB 2NXEA 2GNKA 1GLEG 1O8BA 2R8HA 2HK3A 5L39A 1T9TA 3E9OA 1VRTA 3RW7A 3ZO7A 2XWXA 1J5EF 2DTJA 3J7YP 1EX4A 1BG3A 4JEPA 5IC6B 5BN9A 3WXLA 3I56S 3FEXB 1X7VA 4HACB 2DO0A 2RN2A 2YHBA 3PW2A 5DDOC 3V6JA 2VIHA 1RT1B 4Y2IA 2GEMA 3MMBB 4YP3A 3NGIA 3JTNA 3PLAA 4DR2F 2O5DA 1X3NA 3EUNA 4ID5A 3L09A 1PILA 2RUGA 4HT5A 4MKVA 1Y3KA 4OYIA 1XERA 4YHHJ 3E66A 1S5ZA 1BQXA 2W8LA 3VVUA 2GQCA 1BMQB 1JIHA 2FBXA 2CNOB 4BS2A 5CZ1A 3A8IA 3V9ZA 3U1MA 2IFXA 1J53A 2MSTA 4ZVRB 4X4NA 1FDDA 4CGHA 3UN2A 2R7YA 2AEMA 4ZVUB 3DM2A 4DCHA 4R8UB 1H98A 3HHLA 4X4VA 2F4VF 1HWUA 4C8LA 3D2WA 2O8CB 3R7NB 3KFWX 1N4LA 1TAQA 3N5FA 2ILYA 1FK9B 1KRPA 5JS2A 3TSPA 3QFWA 1S9EA 1JLCB 3H45C 3EWGA 1SI9A 1GEHA 3AODA 3PYFA 2DNPA 2D9OA 4WZMA 2AJ2A 4KHYA 3M2UA 3MN5A 5L1KA 2LKZA 2FJDB 4Q0BA 2UXBJ 4MLHA 3F9KA 1Q8KA 1UKUA 2MMYA 1MLAA 5F9NA 1DARA 2JWKA 1FFWB 2IIRA 4FWPA 1OPIA 5FD1A 4CF2A 4CIOA 3CCJS 3PYGA 2GX8A 2A6AA 1UVNA 2GHPA 1IBMJ 4E7HA 2CJ9A 1M5SA 3NBPB 2FZKB 3LDLA 2P9KA 4I2PB 2OCEA 1QVFR 3W2WB 4R0EA 1BI4A 1VSIA 3EJMA 1XMOJ 3MM9B 4FZXC 2BA9A 2PI5A 1GOCA 2VCPA 4CJUA 2VG7A 3QIPA 4CT9A 3IDHA 3CUNA 3BQ2A 2HSTA 4MIWA 5L8RC 2CQIA 5HRSA 2IS3A 4UF4A 1T3VA 2FHJD 1F1BB 4J5OA 2R2RA 4ATNA 4M3YA 4M41A 2WSFC 2PIIA 3GCXP 3QWUA 4CFDA 4KKOB 3B78A 2AJ4A 1U09A 3FJ2A 4DV4K 5CYQB 4K7QA 4M63A 3IAM9 3NS7B 1J5EJ 3D66A 4A48A 1PAEX 3PYDA 4KH4A 4X62F 2G8KA 4F4YA 3FDSA 2FC0A 3HXMA 3G82A 3W5YA 2ZUGA 4QBUA 4IDHA 2ZM6K 2B5JB 3O44A 4PXCA 1Q16B 1URNA 1CLQA 2HIQA 1DURA 3H3OB 1U0HA 3ZT3A 3OQ2A 4F4KA 5KPTA 1G15A 4B3SK 3NKYA 3IC1A 1WG5A 1AA1B 3P3DA 1VSMA 2XS7A 4E7KA 1NK5A 2QEXS 1UVIA 3BY5A 4ISEA 3MZIA 1TK0A 2VWJA 1X60A 3L4QA 4C3LA 3SYZA 4NLPA 4LIWA 3G10A 1FD2A 3N6NA 1VCTA 4JKDA 3KK3B 1WSRA 2RKIB 1ZBTA 3BN4A 2HS0A 3LUYA 2HVDA 4N76A 1K1SA 1LW2B 4WXWA 4USVA 3PV8A 1PGZA 3VAJA 3LP2B 3QAEA 4K0KF 2YCHA 3H2UB 2F4VJ 1U1LA 4CW7B 3UDVA 4RUAA 4K8XA 3VGLA 3MM6A 1JLAB 4CJFA 1EQMA 1T3OA 4GV3A 3L0QA 3DXKA 3T19A 1YQHA 4KGVB 2W4DA 2ZJQL 2IDEA 4FOIA 3HO1A 2LQJA 4IO1A 1HFEL 3HI9A 2J7UA 2E7XA 5D0RA 4NLXA 3BREA 4ZLJA 2QKBA 1K8AO 3IBFB 3G4SS 2FBVA 1TUVA 4W90B 2PA3A 3BQ1A 1SC3B 1ZBHA 1T05B 3G8QA 4WQ5A 1SL2A 4OO1J 1EZZB 1UMJA 1L3UA 4GVEA 4OV6A 3J80O 1RISA 2KVIA 3H5XA 4DS5A 4B08A 3AV9A 3MX2A 5K8PA 4K8RA 5DQHA 1UAXA 4F4WA 5SWMA 4FW2A 4DV6F 1LFWA 4L73A 2E1MC 1KAYA 3OBYA 3VF2A 4KTZA 4B9QA 4X65F 4FJGA 1N32J 2WOMA 3TJ8A 3MWTA 1RTHB 4QIVA 3W3DA 5H9EJ 3VPZA 1ACMB 3S1TA 2Q6CA 1EP4B 1Q81O 4FJMA 2Z58B 5ADXH 4IG0B 2LQ9A 4K41A 3IS9A 2R7WA 2GS8A 3CCUS 3CTRA 1RTJA 3MUVP 2H51B 1FE4A 4Q8EA 4K8ZA 4ZPDA 2O8FA 1V5IB 2KI2A 1D8ZA 3KLFB 4X62J 2AJ1A 4ER8A 3VQ6A 1VAZA 2OFHX 1YJNS 3SQ2A 3CC7N 2J0WA 2J9DE 4DUYK 1FJEB 1N8RT 1PJ6A 2HNYA 2CJKA 3FZLA 2LXUA 5AZIB 5C2GA 4OHZA 3GDQA 4V1Ak 1BWVA 1M5VC 1NEEA 3SMPA 4G3IA 1PO6A 1WAJA 1VRUA 3UO0A 2NUHA 4TSXA 2ERRA 1ZBUA 3CPWR 4M3TA 1VRTB 4ILMA 4DV5K 1WC3A 3UD4P 2D3O1 1TKDA 4TU8A 3BSNA 2A1SA 3A3PB 3OVBA 5HLFA 2ZH2A 3SUQA 3TPQA 1HWLA 2JGUA 3BEGB 2GQ2A 3GYGA 2EFNA 1X9MA 3O8MA 4BRNA 3IP0A 2C3OA 4M8LA 3FNNA 4CF0A 4K0KJ 3R1LA 3TA1A 3KWIA 4ZDNA 1E4FT 1KHVA 4ID5B 2VBWA 4OJHA 4DS4A 4CHPA 5FRMA 3H6EA 3A8YA 4I64A 2CPXA 3KWMA 3GR0A 1RAOA 5ADZA 1RAHB 3ZNUA 4V19X 4LF5K 3R7BB 1LK5A 3KJNB 4IKAA 2NR0A 5CR4A 3CDAA 1TK8A 1BLUA 2CRLA 2WVDA 4YOWA 4A8QA 4QYZJ 4GY2B 1RT3A 3PIPL 3WXIA 2VU5A 4XPEA 3PFEA 4DR5F 4ED8A 2NZTA 4NLBA 3CJRA 4RNFA 3DM2B 3LZIA 2KXNB 1TL3A 3HHLB 3HT3A 2RF2A 2NRHA 3MEGA 1WN7A 3QSYB 1I39A 2DGVA 3IR5B 3MR6A 5HROA 3QFHA 5I3UA 4BACA 1U24A 1ATSA 1FI4A 1ZH5A 1S9EB 2ZQBA 1FRXA 2M52A 4IEEA 5KFAA 4DV6J 3M2UB 4C97A 2VGNA 2R8IA 4Q0BB 3QESA 2ZVIA 3THTA 4X65J 4CIGA 5J2NA 3H5YA 2KXFA 4CZMA 1QZ6A 4FJHA 5KFTA 2LECA 3MOJB 4CLTA 2EBGA 3FSXA 4FM2A 5DM6Q 3K5LA 2BOPA 2Y1LB 3O9SA 1R7IA 1KLMA 2IAJA 1ZA1B 4DN9A 1YBAA 4OJ3A 3BPDA 3CW2C 3WXMB 5LMUJ 3J7Z5 3NCRA 3DCAA 4GRSA 2P9KB 3OTCA 3OW2R 2AJQA 3W9IA 1FO1A 1BI4B 5LXYA 2VQEF 4USKA 4LF4K 4PG7A 2ZDPA 4YS2A 5L1JA 5EU7A 2VG7B 3QIPB 4OX9K 3M6WA 4E2FB 1GLDG 4AHVA 4J9QA 2MKJA 3V4MA 3QJLA 3BEXA 3D4JA 2W9BA 5JJBA 1KLNA 4WYBA 3VAGA 1S4EA 4JKCA 1ZPVA 4RBVA 4JV1A 3BH6B 5A0YA 5HSPA 1HIYA 3EDRB 2Z4PA 1E4GT 2RU3A 1WORA 3F73A 2VWKA 3HPOA 1KXPA 3ENOA 4FN5A 2QIFA 2ZUAA 3O3FA 3TU5A 3MDQA 3M6VA 3ZZPA 3K59A 4DEZA 3LWMA 5KRSA 1BL3A 2YHYA 2HAIA 4M5MA 5EHHA 1YTAA 3H3NO 1FJGK 3ZZTA 1CVJA 3A1YG 3G82B 4JS5A 2C1EB 2V94A 1JJ2R 4AHUA 1R27B 3VGUA 4DV0K 2HSEB 2DGUA 1A5XA 1U0HB 5JVGQ 2LLZA 4BLGA 3QICA 4QIGA 2NZCA 1F5AA 3HM9A 3HHNB 1RACB 3POTA 4OPKA 1IXKA 3L7UA 4IH7A 1YRTA 4A2AA 2EI5A 4QR1A 2WK4A 1RNHA 4KTWA 3EKUA 4ID1A 4FCYA 3L3UA 3E3XA 1O13A 1DGKN 2CJQA 3G0ZA 5C7PA 1RWXB 3WC0A 4M42A 1HBNA 3NCQA 3TOQA 3TAPA 4FJLA 4LREA 3R7SB 3NGSA 3ZTPA 4DR5J 3PFOA 5H9FJ 1Y97A 4Y2KA 1UWAA 2W8KA 4H4MA 4IRCA 3R6MA 4ECRA 4KO0A 1T3NA 4DTJA 2A0FB 3TARA 4URQU 5SZTA 3RMDA 2FJEB 5A6PA 3MM6B 4CK3A 3J8AA 2HNZB 2C2NA 1PCAA 3IN5A 2KQ2A 1KQSR 3DXKB 2KM8C 3CM6A 3IRXA 4NLTA 1TKTA 1HKBA 4DMNA 2DNNA 1S5JA 3DGVA 1K6YA 2B9WA 2CNLB 4NE9C 4JLHA 3Q22A 3ZFVA 3NWGA 2U2FA 1YZ7A 1BUXA 4WE1A 1TAUA 3THPA 1UEUA 5GAEU 2L9DA 3QGPA 3AH6A 4C48A 5M1OA 2YVSA 4MMOA 3D68A 3V5RA 4DTOA 5KT6A 2Q79A 4JI6K 4ANDA 3I5CA 3C6AA 1IBLK 4KSEB 5LJWA 5IT4A 4DR6F 2V8HA 3VGMA 3CCMS 4PWWA 3MX5A 2UU9F 4IR1A 1N34K 1HNIA 4LF6K 3OYMA 3NNAA 3KDNA 2QZ8A 3TTFA 3SAHA 3OJUA 1APSA 2WOMB 4NXNK 2LU2A 2KW4A 2DH8A 3NGZA 3J7YU 5HMZA 3BDPA 3P96A 5EWGA 3EX7B 2JC1A 3FZKA 5BN8A 4LSNB 2LDYA 3CFPA 3IS9B 4DHVA 3KD5E 4R0JA 4EI2A 2FLOA 4WIIA 4OMFG 1RTJB 1K0VA 1VSEA 3H98A 3EZOA 4MAKA 1Q5YA 4YB1P 2IBKA 4HCBA 2O8FB 5ITHA 4AQYK 4DKWA 1RHUB 2ZBRA 4DR4J 2DNKA 3AVNA 4N5SA 4OPHA 4YR3A 1N56A 1NDCA 4P52A 5KFFA 4YR2A 3WIUA 3L7OA 3KUEA 1DKGD 4Z4EA 3SCLE 2VONA 2MLXA 4DFMA 4NO7A 2HNYB 3H25A 1HYZA 4W5QA 3VZIA 3I55N 4FL9A 4FDFA 2KG1A 4K50A 1Y00A 3MEDA 3UE5A 4E7IA 4RWTA 3AOAA 1SXLA 1VRUB 1RBLA 3CJQA 5HJYA 2HRUA 1C1AA 4YOVA 4ZMMA 3G6ES 1YJVA 2NSCA 2VDHA 4IOBA 3RMAA 5KFOA 4EEYA 3FEZA 3A0IX 5HLFB 4FJNA 2EEYA 1UWBA 2HGNA 2C2ZB 4OLPA 3D3BJ 1IG8A 5AQZA 3BGFA 1LNQA 1VYAA 2NPIA 2DRDA 2JHEA 2OO4A 1AZSA 3NF6A 4JI7F 2BMBA 3CJ3A 1FNXH 2V9WA 2DNZA 5FLXU 4ITSA 4LRDA 3M9NB 1VQLS 2XI2A 4FLYA 2D74B 1DQ8A 2D0CA 2G8UA 3NP5A 5HQLA 1RT3B 4TU9A 2EFPA 2MPUA 3KOAA 1OIAA 5EXWA 4ZJLA 2JOQA 4NYZA 2Z1JA 3L2RA 3U27A 5E3QA 5K8OA 1S4FA 1WKJA 1TL3B 5GAGU 3LGMA 4L3KA 2MB0B 1BE4A 3OUYA 4F3OA 2AD9A 1XNQF 2RF2B 4FP9A 1WF0A 2CJAA 3MEGB 3H8YA 1KFSA 3CIMA 3OLBA 3L3CA 4B3TJ 5HROB 1QJHA 5I3UB 3NE6A 1TFYA 1N5TA 1OSDA 2QA4G 1BISA 2QXFA 3OBIA 1S1WA 4F8RA 3CHWA 3BKTA 2M3DA 3S3MA 1F0XA 3LAMA 1R3NA 4YB7A 4DL4A 1WEXA 1UFKA 4CFBA 1LXNA 5J2NB 1XJWB 3B4DA 5AXMA 2QL7B 2IIHA 2W4CA 4JK7A 1RDUA 5L9NA 5CZ2A 3G9CA 2P1JA 2MKKA 3U3YA 2PZSA 1U2RA 3LPYA 1URRA 1NK6A 5D8HB 4DUTA 4L74A 2HS3A 1M1KO 1KLMB 2IAJB 1G4CA 3AJ2A 2F4FA 3HP6A 2RPIA 5E3CA 4FXWA 2ZH1A 4FK2A 2P9SA 3MF5A 4R25A 5ADXA 1WG4A 4GKJF 2UV8A 3WXKA 3PW7A 1KVCA 2EVZA 4RUCA 4H5TA 1F5CA 4LMZA 1RAAB 4F3QA 4G1PA 2GV1A 2VPXB 2ZDOA 2OLWA 3M3ZA 3B82A 3LP1A 4KH6A 2W9BB 1H73A 4CGGA 2DT9A 3CJBA 1R0BG 1MG7A 3CXCM 1ZAWA 1SZ2A 2DRAA 3DLLQ 2XQCA 5A0YB 2ZGZA 1VC6A 2BRLA 1QTNB 1Y7PA 5ETMA 4YOTA 2UUBF 4YFUA 4RBTA 3TNVA 2DVIA 1VLYA 4TLQA 5AJ3K 3BZKA 1G3OA 2F65A 2D69A 2BUNA 1VK0A 2PFFB 3RRGA 4WTYA 4PR6A 2DXEA 1H1VA 3HX9A 3GMGA 5EN1A 1SL1A 1N36F 3O2IA 4AM7A 2Z1HA 1YIJN 1NG9A 1QQOA 1S1TA 2E20A 4CJ3A 4DPYA 3VENA 3D2FA 2UUAF 3NAHA 2NXUA 4JI7J 1WOOA 3POTB 4KFBA 3O80A 1IR0A 4DX6A 1QDUB 1Y5NB 4FYXB 1ILYA 4P74A 2K06A 1X4HA 4OLOA 5HRPA 3R5CA 2CXEA 4HT7A 4WP3A 4DV2K 3U7JA 1ZTWA 4YB5A 1JQGA 4EFAC 2P51A 1VQYA 2E1CA 2A2DA 1HBNB 5DJBA 2AKWB 2QA1A 3U9DA 2DNQA 4HI2A 2V4QA 1XUPO 3KVGA 3W7BA 4DCOB 3U8XA 4LY7A 5E3AA 4H8KA 2W24A 3D3CJ 3CSKA 4BRQA 4H4MB 3FZ2A 4KO0B 1JNRB 1XNQJ 5IXUA 3HPGA 2DH9A 3LAKA 4CLSA 3L4IA 3GILA 1IBKJ 5DG7A 4JI3F 3SCKE 1X4CA 2UVRA 1K1QA 5LMNK 4F3TA 4XH4A 2N7YA 1SC1B 2PFDA 2Y8WA 3IRXB 4NLSA 1TKTB 4ISFA 3H1VX 2OPRA 2AP6A 3TR5A 3AQPA 3V9SA 4OZJA 4ZP7A 3ZEUA 2J0SD 3R27A 1Y10A 5AQQA 1QY7A 4CI6A 1PIEA 4N8NA 4NCBA 3QT7A 1FJ7A 3W8PA 4WE1B 1M0SA 5C0YA 5B8HA 2K7JA 4GVLA 4M7YA 1RWPB 1KBRA 2P9GA 1B0PA 3PHEA 2B9EA 4PY5A 5G0RA 1LQ9A 4FJ9A 1KTQA 1ZTTA 2XNRA 4M3ZA 4ZCMA 4OYAA 1T9XA 4JV5F 2AJFE 2F3JA 4NLQA 2QLBB 2GW8A 1R31A 2E4LA 3KTQA 4WF9L 1HNIB 3KK1A 2FVCA 1CG2A 4TKTA 3VEVA 2WVEA 2V67A 2H1YA 1FKOA 3M9MB 1RLDA 1WDTA 1T6CA 1VQ5N 4DR7K 3ENVA 4P75A 4HH0A 4BRAA 3PM9A 4JV2A 1SKWA 3BSCA 4GC7A 2CH5A 3WNEA 1WF2A 4ZJQA 4RX6A 4DR3F 1RT6A 5H1SQ 2K1RB 3OR1A 2IVMA 5FIIA 3GTYX 3HHDA 1QHTA 4DL2A 2CIMA 4CD1A 2BTFA 2OPSA 3SSSA 2CAJA 3DXBA 1YT3A 4KT0C 2GGPA 3LPUA 2AT1B 1VI7A 2XNQA 3TO8A 1TV6A 1ZM4A 2I8EA 1C0FA 1IVZA 1HNZJ 5KI6A 4AHCA 3MEDB 1VGYA 2HFOA 2IVFB 4YUDA 2XMUA 4LH4A 1U6FA 1JMTA 2VODA 4WBFA 1Y4ZB 1Q82O 2B4OA 1S22A 2C28A 4OYXA 4X64K 2YX4A 3F2KA 3D0GE 1UWBB 4JV0A 3HSZA 4ED3A 2HWIA 1OMSA 4OKEA 2ZHBA 5CYMA 3SI8A 5DZ6A 2RH3A 2ZHAA 3UR3C 1K47A 4P2MA 3FFIA 4KB0A 1S6PA 4YR0A 3HSDA 3WUHA 1AZSB 1S0VA 1TFWA 3BBCA 4IOAQ 2BV3A 3QEPA 2MKSA 3GE9A 3D6TB 3IR6B 1UVJA 1UW4A 4ZPBA 4NYOA 1X9SA 5AQPA 4JI3J 2FSNA 1I6JA 2HHXA 3LALA 2P5OA 2E9RX 1ZBSA 4B8CA 3KYLA 1VR6A 1QSSA 4EBCA 3QGGA 5GIOA 3LP0B 3ZSVA 1HPZA 1U47A 3D1QA 3OTDA 2R7OA 2XWYA 4RWXA 1ZXOA 3SCIE 2EC2A 1CULA 4DU7A 3GL1A 3MN6A 2WW4A 3S8SA 5C25A 4A59A 3GYXB 4E19A 3OUYB 3AARA 2C42A 2HQ3A 3LQVA 5GAHU 4EHUA 4RU2A 1U49A 5HP1A 2BYCA 3MECA 4ED4A 5HO4A 3FE1A 4DV7K 1XNRK 4B1VA 4URSA 5F8NA 2WTUA 2C2OB 2GC8A 2D5RA 2FVRA 1S1WB 4AILC 4OL8A 4OI1A 5BPNA 4F7VA 3RMBA 5AE2A 2E1YA 4C1NK 1S1UA 4F3MA 4CF9A 3H1QA 4MKBA 2ZWOA 3HLUA 3TWZA 3PIOQ 2NLXA 2ASOA 3AB4B 1X5OA 2IVNA 1CC8A 1SIWB 3WZ0A 3UVJA 3GB0A 4BWMA 2NQPA 2Q1NA 1HWIA 2PYLA 3IAYA 2OSRA 3UI3A 4CLLA 2QO3A 1FESA 4R79A 2CG8A 2P9SB 1KAZA 4X4PA 1R8HA 4ZVPB 4DR3J 2XTJP 1QLNA 3VAIA 1FFSB 1RHJB 4LBIA 3QEIA 1KQKA 2IYGA 1HNXF 2RT3A 3PCOB 2R2TA 1JCGA 3LP1B 3TQEA 1P1LA 3RRKA 3VMFB 1RBAA 2YQ0A 2DY4A 3OYJA 3CD6N 3FSYA 1NUEA 3Q7BA 5AQFA 2FJAB 3Q8VA 3IWLA 4PXDA 3JQJA 3MM7A 1YKWA 2W42A 1P1TA 4JRQA 2HNDA 3M6XA 3ZCMA 3ZC4A 1NHVA 1HHSA 1WJ9A 3VQPA 2A1RA 2N3LA 4K59A 5HMYA 1Y9OA 1RBOB 4MK9A 1HJOA 1NHKL 4KQZA 1VLOA 1N6QA 5D4PA 1GOBA 1VRQC 2HFNA 3V6DA 3NFAA 1U2CA 3O4WA 1Q7LB 4CLYA 5EUHA 3QBXA 2G1HA 1S1TB 2DIUA 4PXBA 5AQVA 2K3IA 2E2NA 3D2FB 4FK4A 2AEJA 3TZXA 2E8AA 2NLWA 1FXXA 3BSOA 4KFBB 4HH1A 1S49A 3W9HA 2DHAA 2DFFA 2OANA 1X5SA 3ETMA 3EE8A 5C42A 2IJNA 4OYMA 4NXMF 1O6XA 4OJRA 3EO3A 2RNEA 1R8AA 3MWBA 3O9TA 4LVNP 2OYQA 3CCJN 1AXQA 4ELTA 4GC6A 4FVMA 1YHQN 1VC5A 2QW9A 4JI0F 1OY8A 1NB7A 2UVWA 3O4QA 3LH2S 5IWAF 5M2PA 3QQCD 2BXJA 2AGQA 1UA1A 1MROA 2D41A 3SQOP 2C2DA 2P9PA 1UL3A 3K5OA 5BRHA 4Z4HA 2X7IA 4CZLA 5C5JA 2BM1A 2O8DA 1CJKA 1FRIA 5BREA 3CJCA 2OPRB 1SAZA 2DHXA 4WU3A 1NMEB 4X4TA 5KG7A 3ZEUB 3KG4A 3LDQA 3NMUA 2UXBK 4KB1A 4ZN1A 3A5MC 2JZ5A 1NK8A 2FJWA 2XY7A 3KWGA 4DSEA 4J9PA 4L6V3 2OEMA 5I4MA 6FD1A 3P5BP 1HA1A 2YI1A 3M4XA 3I4HX 4P2FA 3T1HF 3T5LA 3ZX0A 3S01A 4PKGA 1BHNA 5G0RB 3ZTSA 2IYIA 3HPHA 5BXIA 4F2RA 2BABA 2ZH7A 2IC3A 3KLIA 1LWFA 1R89A 1QHAA 5ETNA 1XMOK 3CJ5A 3MMAA 2YWKA 3KK1B 2JRSA 3UDCA 2RQCA 4NLRA 8RUCA 4ZLLA 4YDUC 1FKOB 1LKZA 5AQWA 3M6UA 4FYWB 2BOAA 2E88A 3BUZB 3N9UC 1C0UA 1XC9A 2P9IA 2UYTA 1EHWA 3PZPA 2R7QA 5ELZA 3ZT0A 1JLFA 3V1QA 3KK2A 1W26A 2NREA 1RHQB 1RT6B 3FQKA 2W40A 5FJ4A 3VQ8A 2Q31A 3OR1B 1W7AA 4MKYA 3MCMA 1Z6RA 1TZ0A 5LSRA 1CXQA 2OPSB 3ENAA 2CFXA 3AO3A 1MN7A 2GGPB 1HR0K 4OKJA 4KHSA 2P9UA 2SXLA 1VFJA 5ETSA 2DXDA 1TV6B 1ASWA 2HK2A 4NB4A 1WAFA 3EY1A 3ETOA 4TVAB 2VBXA 4CD3A 1UJ6A 1GH8A 2ZZMA 2YNGA 5KFEA 5F0XA 4ZTFA 5HN0A 5KG0A 4NXMJ 2YTCA 4L3QA 3PRVA 3JAMY 4M1KA 2CQHA 3O6QA 5DS7A 3ISND 4FS1A 3T7ZA 2K8GA 4IXCA 1B70B 2HMIA 1XEZA 5FLXO 3T5HA 1B0TA 5CYMB 5BYQA 2Y1RI 3FFIB 4ZIWA 5IWAJ 4USUA 1S6PB 3VA3A 3OYIA 1VOMA 1GX6A 2XSFA 1BQNA 4CK1A 2A18A 2CPEA 3MCNA 4WFNQ 1GLFO 2ITMA 1HPMA 3CC7S 4FWMA 1DHMA 4KTQA 2YKQA 4DTXA 4O4GA 1VSJA 4DUZF 2WCXA 2XMMA 3L4BC 3H7HB 2F63A 3PXGa 2XO7A 3W9JA 1RK8A 2RE1A 4U7BA 1V3RA 1VQ8N 3I96A 1HPZB 3D6FB 1Q78A 2IM2A 4JV5K 1CULB 1H7XA 1NKCA 1PSDA 1S6QA 2W01A 4CLZA 1X9WA 3K57A 5C25B 4HUFA 2NXJA 2I7PA 2XB2D 2P9CA 1HBUA 3IRWP 5M1KA 5HP1B 2EKNA 5IQ6A 3MECB 2PN6A 3T1HJ 2I0XA 3ZNJ1 4DZ6A 1Y3JA 3AD8C 2DFEA 3H20A 3ZX3A 2DNHA 2P5VA 4KPCA 3WBZA 5AQOA 1F3FA 2AMCB 1U02A 1GMUA 2E7VA 5IT0A 3RAQA 2G1DA 5HRRA 2UUWA 1S1UB 3HMJG 4CESA 1E6YA 4ECVA 3ALYA 3C16A 1FNMA 2Z56B 1N32K 2NYIA 4KH1B 1JLQA 1WOPA 1QQNA 3UVJB 2XMWA 4RUBA 1X4AA 3VEWA 3G71N 5GAEI 3GIKA 3CNQP 1XQSC 3S9HA 4EZ9A 3SUOA 1RA7A 3AD9C 3QFPA 2HWHA 5JXSA 3CQYA 3AY0A 1W2BR 4YOEA 2GWJA 1RXOB 4JHDA 2YKAA 3P5JA 3B6OA 4ELVA 2Q6BA 2PYJA 2C2KB 3NG8A 1AW0A 4C4WA 3SI6A 3AFGA 5MLCQ 3PYEA 3G25A 1NH7A 4OHWA 4J9OA 2FF3B 4LQ3A 1XTZA 2ALYB 2O1PA 1RAIB 3MM7B 5K5MA 2HNDB 1XR5A 3FBEA 3K8WA 2BJ7A 1REGX 2KG0A 4PCQA 3SBGA 4Y2AA 1HBOA 1O5JA 2BJDA 1QAXA 2ZWHA 4BWJA 2ZOGA 2JSXA 1U1MA 3SUPA 1N6QB 3W1YC 3E8OA 5AQRA 3NOGA 3V6DB 1NH8A 3JTOA 1MNEA 4NI2A 2QFIA 2EG1A 2Y9HA 3TWHA 3DKDA 7FD1A 2HVZA 4PWDA 4BR9A 1A7GE 1YWXA 1FVQA 3R3LA 5A2QY 2XHWA 4EO8A 4DUZJ 3W60A 1H2UX 4CZJA 4GMKA 4CJTA 1HL6A 1KN6A 3SUNA 3ZT1A 4I4BA 4CHQA 3CCES 3TAGA 1IKYA 1BCOA 1N33F 4K4UA 1ZAVA 4OKKA 3TA2A 2CZ9A 1B7FA 1DQ9A 3BGUA 1DTQA 1MROB 1UA0A 1YJ7A 1Q1KA 4FNIA 3QZ7A 3LZJA 1L3TA 2XI3A 3ENBA 1Q4RA 2HBJA 2XM3A 2P9PB 2EFGA 3N0VA 3Q8UA 2R7SA 1TUUA 2R7VA 3SK3A 3T1YJ 1KEKA 2O8DB 1Q86O 1CJKB 3U1NA 3CEDA 4C2MA 1RT5A 2B9YA 2CKWA 2FVPA 4HTUA 3IG1A 1MWQA 3HCXA 3MDFA 4ZVTB 3NMAA 3HSTB 2HBZB 4F36A 1EETA 1M1KT 4FVUA 1HQEA 3AVBA 1KTVA 4UOGA 4M3UA 2AA4A 2G4BA 4BREA 4ZCLA 4Y28C 2OHDA 2KT2A 4DFJA 1OYDA 2DO4A 4RUHA 3O4NA 4EYHB 3NGUA 2UVVA 4J9MA 1FKPA 4UUXA 3GFZA 5GAGI 4CO1A 4LF1A 3RMCA 4OI4A 5LMUK 2A3ZA 5BPMA 2VQFF 3KLIB 1LWFB 3DRPA 2QM1A 1TGOA 3HKZD 3X3UA 1TTHB 3MMAB 3DJCA 3CCRN 3OTBA 2WONA 3KKFA 1XR6A 1VQPN 1JL1A 2XC9A 1H7WA 2DNMA 1V9OA 4B1XB 3AA4A 2HLTA 2W2PP 2OSQA 2UUTA 3I8BA 4WYLA 1C0UB 1D9AA 2P9IB 3W66A 2KZZA 2XY8A 3MN7A 4FXDA 3RAXA 2J6TA 2CPIA 3BZCA 3FSIA 1JLFB 2HGMA 1NGEA 3KK2B 2I9SA 1LWCA 4F0MA 4JI2F 4FF2A 4DB3A 4PEOA 2QMWA 3CDEA 4DSIA 3HZ6A 3VQTA 2C2MB 3US5A 2A1BA 2Y0BB 2W2OP 5GADU 1NRKA 2P9UB 4OZLA 4NLCA 2KYZA 4JI8K 3D0HE 3DLEB 2DHSA 2ZZNA 5A8WA 4JI0K 2H5IB 3ZSWA 2CPZA 4OYOA 4JB8B 2WVFA 5KFIA 5J1PA 2KO1A 1PJ7A 3LL3A 2XMKA 3NF9A 1CS4A 5KFZA 4QIEA 4FKXA 2YX1A 2YNGB 4ILLA 5T7LA 1RT4A 4UW2A 1U1RA 1N8RO 3QNNA 2P9LA 3DXMA 4O0JA 1FD8A 1XMQJ 2HG4A 4TYAA 2HMIB 1SVDA 2AGOA 2BX6A 1H74A 1N33J 1UPMB 2X3DA 1IR2A 1T11A 3TUJC 2HQCA 3A4TA 4DTRA 2B6AA 1BQNB 3G2XA 5KGWA 3TX0A 2W2QP 5DG8A 2A41A 3MTJA 4BGAA 2ASLA 3BGLA 3ATVA 4O4GB 2LEBA 1TR0A 1D9DA 4B1YB 2WW8A 4G9ZA 3I55S 4J90A 3E1YA 4P72A 4FWQA 1HKGA 3W63A 1HWJA 1DQAA 2B3TB 1F9EB 1EX8A 1NKEA 4O55A 2GHWA 4FSVA 1JK9B 3T9NA 5F2RA 1S6QB 5LSLA 3FCHA 3KNAA 4A8FA 5I3QA 3MHYA 3M7VA 1HBUB 4H5RA 4EHTA 4K5SA 1Q18A 2H9ZA 2BQ3A 4X66J 2ZF5O 2MY7A 5DM6L 4M5JA 3U4LA 1QAIA 1UW9A 5DDQC 2DR8A 4CBXA 1Q95G 3HI0A 2W7PA 1RAEB 2VQFJ 1NK0A 4J9RA 2CQBA 4CZIA 4I2QA 1UVLA 1NSPA 1X4FA 4PZVA 2C3PA 2QK9A 3CFOA 5E0OA 1RT2A 1SPBP 1E6YB 3TX8A 1YG0A 1FWLA 3C16B 2CWXA 2YWFA 4YQWA 1JLQB 3SMSA 5FRNA 3MK6A 3WNFA 5A76A 1KVJA 2DCUB 1UJ4A 4DR1K 2FSJA 1ZM2A 1U1QA 2RD5C 3CMEN 4FWSA 4JBCA 2E66A 3O3LA 2B8QA 2Z0GA 1T9UA 4EZ6A 3RBDA 2F9WA 3EN9A 4QWDA 4JI2J 2QKKA 1VHIA 4PRFA 1JCEA 5JUMA 4JI1K 2GA7A 4JHDB 3OYFA 3OBWA 2JLGA 3O5BA 4I9LA 4ZIVA 3DHWC 3RBZA 3K2YA 4WQ4C 4QS7A 3MAAB 2CQGA 2RRNA 4YOXA 3F5TA 2BW2A 1RWUA 5H1SV 1BOTO 3CC2N 2IM0A 1QAJA 3SQ0A 1NJXA 2ASPA 1I5OB 2IBOA 3WDOA 1EARA 4JP8A 5JVGL 2J4RA 4BR4A 2COLA 5CY4A 2W1BA 1GT8A 2RUSA 4ZP9A 5DMRA 2HS4A 2IMWP 1U0SA 3LPEA 3ILJA 1FHTA 1HBOB 1GLCG 1ESVA 2BVZA 4FS2A 3K89A 3M8YA 3TJ9A 3RB3A 3AA5X 3CJ8A 4NI2B 2OELA 2R8JA 3PEJA 4J2DA 5JS1A 4EUVA 4DTSA 2Q2RA 3C65A 3J7AN 4RNMA 4DV4F 1GMVA 4PWDB 5AFUH 4WU2A 1KS2A 3W2VA 3VAMA 4J9LA 2FZCB 4BDPA 2XLKA 2KDOA 1RKIA 2ZH5A 3CJ2A 4TXSA 4OLBA 1IJJA 1N54B 3T5JA 4C23A 3MR7A 2ZM6F 3H42A 4ISGA 1QM9A 1RUSA 1WSIA 2CPYA 1XWLA 3BR9A 3TVZA 3THYA 4E7LA 3A2FA 3WHIA 1IKYB 2HBYB 3O3HA 3N4PA 2D7SA 3OYLA 3O6WA 4FBUA 2MZTA 4B3SF 3SPZA 3AO1A 3BGRA 2VWBA 1DTQB 3HZEA 4RNOA 4NLYA 2MXYA 4CLWA 1RTIA 4WP9A 3HJFA 3B54A 1TUYA 1WSGA 3T6BA 1CZBA 5BRDA 1YIJS 2KFYA 3OXLA 5DO2A 3ZSOA 2NRTA 1EKSA 2N3OA 1RT5B 3ZZRA 2LP4A 3MAHA 3JSRA 3IG1B 4CNZA 1FDBA 3DOLB 1QUVA 3P4UB 2FD2A 1EETB 2VFTA 4QW8A 1HQEB 1F2GA 1VSDA 4CBUA 2DNLA 3VQ4A 2CGKA 5DGAA 1B92A 2NXNA 5HQ8A 3CDWA 2RDDA 2DD8S 1SH2A 3ILIA 2AQ4A 5EX0A 3VTHA 1WC1A 5KFWA 4U9RA 3W8GA 1NNEA 1YTUA 1FKPB 4BVPA 3WX8A 4N47A 5GINA 3DMJA 3AGKA 1V3ZA 1NGGA 4J9VA 2LQ8A 5GAHI 4RNHA 5KFMA 1JLGA 1J54A 4NL5A 1V5VA 1WSVA 2QWOA 1NDPA 1J5OA 3DRPB 2H48B 4DTUA 1MMNA 1U1NA 2V8PA 1FRKA 1OWXA 1IWGA 1FE0A 2QC3A 2WONB 1MMDA 3UR0A 4Q43A 3V1OA 5KFNA 1B99A 3NAEA 1FA0A 1K44A 2V2VA 1DLOA 1NGAA 2F8SA 2OP5A 1S1VA 9RUBA 1I94K 2KRBA 3AB2B 1DFDA 2XHCA 2XBPA 1B3TA 3P31A 1LWCB 3GFXA 4FJ5A 1WTFA 1SJ4P 2C2RA 3HYFA 3MWPA 4J9UE 2DK2A 4DOZA 3BN7A 4DG1A 2V69A 3OVAA 3TZWA 2ZOMA 3H0PA 5KFPA 4H5NA 3THWA 5AQSA 4CTAA 1VC0A 4QWAA 5A8WB 3A3NB 1VISA 3N6MA 3R5JB 5KG3A 2YKPA 2FVQA 1CS4B 3GJQB 2XLJA 1SJFA 5HI7A 2O8EA 1YUWA 3GV7B 3C3LA 3ISNC 3QYYA 4DPUA 1VQ5S 5T7LB 1RT4B 1NGDA 3O1BA 2P9LB 3DXMB 4BROA 5CZVA 5AXLA 1S1XA 4AXIA 2ZM6J 3NXZA 2V68A 3M2RA 1A9NB 4DUYF 2KHCA 3OL8A 1VQKN 2AYMA 1VMBA 2E1PA 2CQ0A 2I6WA 3TABA 4MJKA 5KT5A 1SQEA 3KUHA 2E2QA 3MMCA 5DK5A 4C3KA 4WCEQ 2B6AB 2ZITA 4H4OA 1GLJO 1BHLA 4DV5F 4I56A 5IS2A 3G96A 5B0FA 3SV4A 1IBKK 7FDRA 5GMEA 1WNSA 3DRYA 4IWVA 4MQ3A 1Y5IB 3GJTB 1F60B 4BR2A 3OLAA 2L08A 3BQ0A 5LOQA 1VIOA 4OJ1A 3V9UA 2QV6A 3UNYA 4IUFA 1VDHA 4BQZA 5G4DA 3CJ1A 3TTDA 3KXDA 3VERA 1HQ2A 3OYHA 3CMAN 2QX0A 4FJIA 3L9ZA 1Z25A 1P9YA 2HHWA 4FM1A 2H54B 1D0EA 5AE3A 4CECA 3QO9A 1C4CA 3CJ4A 4LF5F 2JWLA 1MWMA 4Z7YA 3TUPA 2PMHA 5JMNA 3M2VA 4FXVA 2BQRA 4M5NA 3KJQB 4N77A 3BBBA 1HLUA 4XDDA 2B4UA 5KG4A 1BUPA 2R8KA 3IAS9 2MKYA 1RT2B 2ATLA 3QJJA 5KFYA 3O3GA 1EWRA 3EZ5A 2MZJA 4CRJA 4ENOA 2LMIA 3AOBA 2D1CA 5CD4H 1VS3A 4CJKA 3Q8QB 3NEKA 1FKAF 2J7WA 1FFGB 1CEZA 2WVBA 1VQ6N 4A8WA 5LL6d 3C66A 2FC8A 3EICA 3UB5A 2BRKA 4NYPA 2HQDA 4W5RA 1WHYA 3I87A 3VQ9A 3CM5A 5GAEP 3CPEA 2UXDF 1TELA 4CM0A 4BG9A 4IYQA 4USTA 3Q23A 4NEZA 3HULA 5GMKa 2HQIA 5GIPA 4CHYA 4Z37A 3R9PA 4PWUA 4CJ7A 3EGVA 3AVIA 1ZM3A 3O1WA 2J8AA 3PO5A 2DIVA 2X51A 5C15A 1YVUA 4D3GA 3NMRA 1MSWD 2ZH9A 4GVMA 4FWNA 2CYYA 1W97L 3L2QA 4F26A 1EB0A 4BG8A 5CHIA 2HW3A 1YJ9N 3RSEA 1ASUA 4LF4F 1YGYA 2VPZB 1ZETA 3R6GB 4GNIA 4OX9F 2PI4A 2B56A 5TKYA 2MJUA 1A5WA 3D6MB 2L9WA 5HATA 3G6YA 2E6MA 5CYJA 4G1QA 2YWHA 2N4CA 3TAMA 4DUYJ 4AM6A 4DSFA 3PY8A 4H5VA 1S99A 5IV4A 2X78A 5CHCB 4FF1A 4O3NA 3NNHA 3OYBA 3C14A 3HM8A 1OVYA 2JFDA 3J7ZT 4DL7A 1RYRA 2DEJA 3W2VB 2OZSA 4RW6A 2M8HA 1X4GA 1D8YA 4YOUA 5KFKA 4ANEA 4RL1A 2GWKA 4A5BA 2CGLA 1FJGF 1F21A 1VQNN 1NSKL 3CD6S 3C6TB 1LFPA 2VV5A 4KREA 4BRLA 3FGVA 4DV0F 3R2CJ 3VAKA 2M0GB 1HWKA 3THYB 2J76E 2BE2A 4FPBA 1U7LA 1GMWD 3TAEA 4E98A 3BGRB 4ZPTR 3SQGA 1LAWA 1B64A 3C94A 2KJVA 5K9FA 1RQ0A 1G1XA 2F96A 2ROEA 1RTIB 2E1AA 1FERA 5KFSA 3JXOA 3DLBA 2RAQA 3IXQA 3C95A 4CGFA 2UV8G 2CG4A 4LF5J 2HBLA 1S7IA 4FYYB 4EMDA 4C9DA 2IMOA 2V2QA 3WNHA 3ZZUA 3GIRA 2R4FA 4JKGA 2IJFA 3PW5A 4J2EA 3F56A 3M6GA 1YJWN 3CD5A 4WFAQ 1KOHA 3K0JA 2PE8A 4ED0A 3AVMA 5KFDA 4ZP8A 2HMPA 1T9VA 2FXUA 3UNGC 1FW6A 3C8YA 1YHQS 2IRXA 3MPVA 3KJVA 2GAGC 1NXIA 4NA2A 2IGIA 1TKXA 1X0PA 4UQGA 4ZCKA 3DMJB 2PMWA 1IO2A 1JLGB 3V9XA 4C0BA 5GAGP 1GOAA 3PDNA 5KQDA 1M1HA 1TYQA 3E01A 4ZVHA 3BS9A 4CJWA 3UKRA 1J5OB 3BYRA 3M8ZA 2PC6A 3LM2A 5M2RA 1BC6A 4ZVGA 2DCLA 1RDAA 4K4VA 4OHVA 4FPRA 2RS8A 5CA5A 4E0DA 4JI6F 1DLOB 4O3SA 2I7NA 1S1VB 4LR8A 1NSQA 1IBLF 2LA6A 2OZMA 2YQ1A 4RJVA 1N34F 1GTHA 3T6JA 4OX9J 4LF6F 2B0GA 3KLHA 4CEDA 2V7ZA 5L46A 5AR0A 3M8RA 3CGIA 4Y6IA 4YEAA 4NXNF 2XYHB 5MLCV 4DG1B 1RWMB 4OZNA 3BO4A 1OSCA 5ETQA 2DYAA 3THWB 3QINA 4CTAB 4AL6A 1PBUA 5ETRA 2CWKA 2EG2A 3I0SA 4WP8A 2IJRA 4DR2J 1F6TA 3KHLA 3OVNA 3P4IA 2HWTA 2GJ2A 1U25A 2RHQB 3PSIA 4AQYF 3C6HA 2XZDB 2O8EB 1NZ8A 3OJSA 5AFUA 2ILZA 4A4JA 1CXUA 4IOAL 1D5AA 1YI2N 2L41A 1FJGJ 1UZDA 2BJ8A 1S1XB 4WK1A 2Z1IA 3M2RB 4DV0J 3DXSX 4MDBA 4O8KA 2DHGA 3CJ9A 3BKUA 3K5MA 1IN0A 3CIPA 3MMCB 2RB7A 3QEXA 2UXCK 4H4OB 5CCLA 1Q86T 4M5GA 2ZKUA 2MDAA 3ILLA 4CLKA 3QGIA 5HVFA 4A8XA 4IOXA 2P8IA 4IJNA 2R7XA 2HNZA 2JNJA 5ETVA 1C4AA 3HZGA 2GJFA 4DTNA 1RHRB 3NLCA 1YJRA 4ZVFA 2ZBQA 3NNCA 4PG4A 2OEJA 3Q8YA 4AH9A 5F3TA 1U6BA 2ZOFA 4A8KA 1TKZA 4QR2A 3AHPA 3PKMA 1LEOA 2ZBIA 3FC9A 2W7OA 3SFUA 4XTTA 3QO9B 3PIOL 3M2VB 1WSJA 3AVHA 4KGZB 3OSNA 4PKHA 3AJDA 4GO7X 2HVHA 5CH7B 5DGBA 1U8SA 1WI8A 3IO1A 1CBKA 1U1OA 3N5BA 5RUBA 2O01C 4HI1A 3MEEA 1W25A 4CO3A 5IFMA 1QTMA 3OTOK 2OUGA 4CHNA 2FLPA 4CDIA 4JK9A 4GMJB 5DG9A 5GVQA 1WTBA 1VQ8S 1RADB 2UZAA 2G0JA 4I6YA 2HBRB 4JI6J 4M45A 4P2XA 4LSNA 1NWKA 4DU3A 4H4KC 5AQKA 1VSKA 1N34J 4RTFD 2NCKL 5DLGA 2IVYA 2M70A 4LF6J 1TUWA 4CH7A 4ECSA 2XY6A 3VEYA 1P8GA 1PYTA 1U2FA 1V6HA 1BQMA 4HVZA 4DZDA 2MKHA 3QZ8A 2J9EA 2Q66A 1N52B 3NGYA 1MMLA 3TJAA 3AO5A 5DQGA 4DMZA 2H65B 2HBQB 3VR1A 1NJZA 2ZZTA 2O8BA 1TMJA 3RSEB 1QD1A 4UQTA 4KHUA 3NRBA 2X1AA 4AQYJ 2M5YA 3A8EA 2AX0A 3ZT2A 2YNFA 3UFCX 4JNEA 3ZSYA 4G1QB 2MQMA 2VD3A 3BF3A 4B3RK 3G71S 3DLGA 3TAMB 4OX6A 3D7SB 4NA3A 4OYBA 1VBXA 2ZBPA 1UFLA 4CGIA 2GO9A 4I6WA 3ZTRA 3J81Y 2EHGA 3QRPA 2DTUA 2HRTA 1VSHA 4BVOA 4DPTA 2VB6A 4JD2A 1NDLA 3PNIA 1S6OA 5GADI 3C14B 1O1WA 2E1RA 3MCPA 1FF2A 1R8PA 4RW6B 2O66A 5AJ3F 3U1LA 4Y0FA 5HAOA 5KFGA 3Q89A 4I0WA 3OYKA 1S0NA 1S0MA 4RBUA 3BP8A 1NLKL 1SCJB 3F0NA 3OXFA 3MR5A 3RW6A 4XIUA 2Q0UA 2BE2B 1WKLA 3CETA 3ELHA 4AE5A 3HD2A 1K0TA 3SQGB 1CZ9A 2O3DA 2YX7A 1WELA 2MQOA 3HOTA 2CVIA 4UTGA 4DV1K 2OTJS 1VK3A 1MN9A 3NL0A 3DLHA 1PYSB 3GJRB 4DV2F 4U8YA 3TQ1A 4ANCA 2GMJA 1HUXA 3FLCO 5AQLA 3IM9A 1RAJA 4Z7CA 2LXIA 2QLJB 3Q0AA 4JKGB 3MUTP 3H2VE 1WUAA 4PL8A 3T9ZA 4QU7A 2BEFA 3NH2A 4WKYA 2UXDK 2M8DB 5KFJA 1NB2A 4FVCA 4PQAA 4Y00A 3MCOA 4NMXA 3VF6A 4OHXA 2CPDA 3TEHB 4C8ZA 3JSYA 2A6MA 5LMNF 3KJVB 4RU9A 2KRRA 3UW1A 5F9LA 1TKXB 5A8KA 5CD4A 2P6TA 4FWLA 1JXEA 5L38A 3JSBA 2VA2A 2E7WA 2FF6A 3CE8A 1TYQB 5D3GA 3E01B 2XYGB 1YBUA 5GAHP 3UKRB 4UUWA 2JH3A 2E9ZA 4KGKA 2G2YA 4OYZA 1Y64A 2QTDA 3R5DA 4QPTA 4TY9A 2KM8B 3AJ1A 4DQIA 4DLGA 3K17A 3EXYA 4USWA 2W2MP 4PPDA 3RZAA 1BIZA 2V51B 2RU9A 2YJEA 2RSQA 2PT0A 4G1IA 4PQUA 3CCEN 2O67A 1CJUA 2EFOA 2BKPA 4Y3CA 2GUPA 3TYTA 5D0EA 3KLHB 2KU7A 4O5FA 4F0HA 4UOHA 2YWEA 4O0NA 3QERA 3LANA 4MFBA 2HFZA 2FTRA 1J9AA 3M32A 4GKKK 3H5SA 2HHQA 3ICLA 4DR7F 3ZXWA 3ZZ0A 3CJAA 1RT7A 1M90T 3AD7C 4EBEA 4H0VB 1UOCA 3I0SB 3CCRS 5AQIA 4EYIB 2GCFA 4OFZA 1N48A 2PAVA 3D0PA 1O0PA 1VQPS 2C3MA 3ISZA 1HRHA 5AJ3J 3CT9A 1S9GA 3BR8A 3TUIC 3BF4A 5DDPC 2APOA 1I3OB 3S3OA 3VEZA 3U02A 2AP1A 4WFNL 3OYGA 3G6VA 1IKVA 2RS2A 1ATNA 3N4QA 3ZYYX 1WSEA 2ADCA 4C7QA 2Q43A 2DNOA 3C6UA 4DU4A 4JYAK 2R2SA 1HW9A 3AVGA 2AGPA 3ZTQA 1L3VA 4LFCF 1OS5A 2NUUG 2BJ3A 4OZ3A 4DU8A 4PXEA 3KLVA 4F4AA 4K4ZA 2MKIA 4TN2A 4DV2J 4C8MA 2YWGA 3JTPA 1FEEA 4WJBA 3PX0A 2HHUA 1VQ7N 4QU6A 3G86A 4X64F 4LSZB 5KQ8A 3EEQA 1YBTA 1T95A 1RDWX 3H2LA 2RDJA 3T1YK 2W6KA 5LM7E 4BDZA 2BKNA 1S72N 2XHBA 4CLPA 3W5XA 2QRRA 1YVFA 1WD6A 2LVWA 4ZP6A 1FRHA 4NZ0A 2EPIA 4M95A 1TKZB 5EVZA 3VEOA 3SDEA 4X4UA 1VQON 5LMNJ 3JS6A 1SQKA 4ED1A 5HBMA 3CXCR 4U7UD 4FJ8A 3HBTA 4KC5A 1JCFA 3LDPA 4Q44A 4C1NI 3D9BA 1ZC6A 5KFQA 5IT9Y 5LJ3Y 2VQEJ 4K42A 3T1AA 5KPRA 1Y0HA 4FYDA 2RJZA 3UCUP 5IOLA 3AAPA 3DGPA 1XN9A 4Y34A 1YJTA 4TY8A 2XO6A 2VOOA 2OMOA 2B43A 4LVOP 4H0OA 3MEEB 3B6PA 1DT9A 1H0HB 3TSUA 2DISA 1QSYA 1XNRF 4DV7F 3QT5A 3R8YA 4ZKAA 3IM8A 3WQPA 3K5NA 3CD0A 4DCJB 3PW0A 1HI8A 4I69A 4NPOA 4W5OA 2IPOB 1WHWA 4OZ1A 3DRRA 3GIMA 5KG2A 2MHNA 2NPFA 3IFEA 2D0PA 4CEQA 5JVHQ 2PSZA 2K1RA 3K0SA 3MOZA 1IQZA 4CH1A 4B3OA 4DU1A 3OR2A 2CQ3A 1BQMB 1ZZFA 2KTQA 4ZVOB 3CCVN 4DR7J 4DWIA 4ECWA 2GIRA 2DRBA 5AQMA 3CQ8A 4FPAA 2O8BB 3DRXA 2IA6A 1S76D 2ZC4A 3M1FA 4ZHRA 3ZZZA 5F8HA 5AQXA 3MGJA 3SCXA 1IH7A 2XGQA 4ECTA 1RILA 4C98A 1CQMA 3HHLD 2YNFB 3CMES 2VICA 3AA3A 2E5LK 1RFQA 3FVYA 3DLGB 4NYNA 3VESA 2V2ZA 2DEIA 3K58A 3QPIA 2A42A 3ULDA 1NKBA 3FFKB 4DBQA 2BQUA 1OPZA 1NOZA 4ILHA 3V9WA 5C10A 1H38A 1T0TV 4JD2B 3LGNA 3UN3A 5JMVA 3NGKA 4BE2A 2RQ4A 2WSCC 4M5LA 4RG8A 2HZVA 3P1GA 3O5TB 3SEOA 2VBYA 4X64J 1S0OA 3ZT4A 1MWYA 4QAGA 1VQ4N 3CC2S 1BXNA 1IJEB 5CAAA 5D78A 3N6LA 3LP0A 3R5GA 3NWRA 2JEFA 4WYWA 3GG0A 1X4EA 1XMBA 2JEGA 3BH7B 4MDAA 1KVAA 3ITHA 4YY3K 3RRHA 3S41A 1AYEA 2HYIB 3SSRA 1AUSL 1V4SA 1WSFA 2F8EX 1RAFB 3D6RA 3P6YC 3VCDA 5KOXA 1LOTB 4KHRA 4UZCA 3LWLA 4X66K 4DV3K 3M8SA 5HANA 1NU4A 1N5VA 3IFRA 3AY9A 3OL7A 4H0XB 4DR6J 1HNWK 2Q36A 5J2PA 1DJ0A 3AXKA 1FXDA 4OI2A 2JL9A 2JLEA 4IOCQ 2UU9J 1U04A 4NCGA 3LDOA 4Y0WA 1Q9XA 2N4DA 3QFUA 2D9PA 3MFHA 4CP5A 2XYPB 1DRZA 5I3PA 4O3QA 1PJ5A 3KLEA 1WC4A 3UE2A 4P7VA 1ASVA 1N5SA 2IDLA 3IBWA 5LY3A 1NM2A 2C3YA 2PBDA 5A8KB 1QVGR 5M1PA 4P10A 2R3VA 2RMLA 3QMLA 4IFVA 3MUMP 5D3GB 2UXBF 3W61A 4M5DA 3HVAA 1Z05A 1OQ3A 3D5MA 2MSSA 3OA9A 3PG9A 3SPYA 1UEKA 2E5HA 2IM3A 3CJKA 2ZVSA 5L1IA 1HYVA 2EFQA 4JOUA 4BC9A 3VQ5A 4LF8K 1GX5A 2GVDB 4RW8A 3QIDA 4L76A 1WHXA 1U2VA 3D0IE 2HHHK 1D09B 2QWRA 3LF0A 2F8MA 1RJJA 4OI6A 2QA2A 1S57A 4PQUB 1NGIA 1XMOF 1NOYA 3QSIA 2CQPA 4KAZA 1CJUB 3GIIA 2XRIA 3SAFA 3AGRA 3J7AP 1IBCB 4JKBA 4BDYA 1CQNA 3EE3A 4FW1A 4M7XA 2P5GA 2ZNYA 3ILOA 3JAMU 2IY5B 2WFBA 4MFBB 4UOCA 3M32B 3V6KA 4QQBA 1B9DA 5JICA 1FXRA 2XS2A 4U6PA 1WDDA 4OZ0A 4XAKA 2E5GA 2IOCA 2WHOA 1RT7B 3K5PA 4CO5A 4KHPK 1BDGA 3NGRA 3MI7X 3H40A 1RWWB 2RVJA 4KR0B 1LW0A 1JJHA 4KY3A 4P2SA 1S9GB 3MCAB 3D54A 4FOEA 4ECQA 3OFFA 4UY8T 2ZE2A 1HYSA 1TL1A 4FLTA 4YDUA 2EX3A 1FWPA 4NMLA 1HR0F 4JKFA 3U6FA 1IKVB 3VV2B 1HI1A 4QOTA 1I51B 4W5NA 1UPPA 1KP6A 3SFGA 3C6UB 4DX5A 3CF5Q 2F5GA 2OKQA 8ATCB 2CH6A 1ZPWX 5EOYA 4NLVA 2V52B 2G9OA 1SV5A 3BKFA 2E2OA 1WF1A 1K8KA 2G8WA 4JRPA 1CJTA 3SMZA 2LSNA 1Q7YT 1MU2A 4LRBA 2DR9A 2P6SA 3IA0A 2MTLA 3B4MA 2IA0A 4DPWA 3O9UA 2PMZD 3VQDA 1BIUA 1E6VA 3CI5A 3QNWB 4B3MK 3O9QA 3M30A 3KDOA 4JI5K 1WWHA 3D2EA 4LF9K 1Z1ZA 3UD5A 4O0IA 1HARA 3VALA 2V2KA 2EFVA 4F4ZA 1OJ4A 4I1TA 1P8ZA 1VQKS 4NRTA 3SDEB 4LFBK 5B0AA 5HBMB 4WFBQ 1CJVA 4CO2A 4A8OA 3LOUA 4JI4K 4W4MA 1HD1A 4GKJJ 3ONQA 2MJNA 3WXJA 4I9QA 1RCOB 2WTFA 2FPHX 2E6LA 3DGPB 5AQGA 3MM8A 3PHTA 4TY8B 6FDRA 2I5JA 1KAXA 2HBKA 2MKCA 1RA6A 2OPQA 4BQLA 4CZGA 2FZGB 4EFHA 2YQ3A 2UUCK 1VBYA 4YDDB 2ASJA 4NYFA 3WC2A 1KNZA 5BYSA 3DRRB 2YJFA 3CMAS 3ID8A 3HOSA 2UUBJ 3BGOP 1HQUA 1W9HA 4NLGA 2DPJA 2Z57B 4ZVEA 1S12A 3J80Y 3O1LA 3EVWA 1N32F 2KHDA 4B3OB 2OD4A 4P71A 3OR2B 4FM0A 3DLKA 1SS6A 1KVIA 1EO1A 5DDRC 2VFSA 3BPSP 2WVCA 1H2TZ 4J9KA 3V4IA 3C15A 4RNNA 1U48A 1N36J 3KHYA 4BC2A 3R2DJ 3TR8A 4CEFA 5BR8K 1QVGM 4Z4IA 2UUAJ 2MY8A 2LXFA 4ES3A 2ASMA 4LFAK 4LFCK 4BRPA 4ZHRB 4ERDA 2JEIA 2AF6A 2KB2A 2HRYA 5CXTA 1N0VC 1RB0A 4PG8A 1VQ6S 5AQHA 2NYHA 4ZCIA 5A2QU 3DDNA 1HR0J 1EQ0A 3C46A 3MPDA 5D0HA 9ATCB 3CCSN 2GHVC 1NPPA 3ZSZA 2GAHC 1KKHA 5KFRA 2X1GA 2HLUA 1XK8A 3QAUA 3QBCA 1IKXA 1RCXB 3I5AA 1Z2ZA 3FCVA 1FDAA 1T03A 2W6LA 3UDEA 2DITA 4DF4A 5GADP 3Q7CA 1CPZA 1R8BA 2HZAA 4Q45A 2CGJA 4Z4GA 1YJ9S 1K9MO 2QSFA 3ENQA 1WLJA 1NK4A 2HHVA 5GMDA 4C8OA 4AHSA 1RP5A 1AFIA 4W98A 2MGZA 2Y1JA 3ITHB 5F3ZA 1ZBIA 2ZJPQ 2AYBA 3PX6A 4J91A 2FUG9 2NRVA 2OGUA 1U8WA 2CVEA 2CQDA 3KIOA 3FMWA 4QR0A 3OS0A 2G2OA 1FX4A 1K73T 3A12A 3TRGA 3GV8B 2DFHA 5J2PB 3CCQN 4NWBA