3M8QA

Hiv-1 rt with aminopyrimidine nnrti
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of piperidin-4-yl-aminopyrimidines as HIV-1 reverse transcriptase inhibitors. N-benzyl derivatives with broad potency against resistant mutant viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 151
structure length 554
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3m8qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8qA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8qA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3m8qA05
1ZETA 1S6QB 1WSEA 4NCBA 3TR8A 3U3YA 1NOZA 1LWFB 1RAJA 3CFOA 3Q8QB 3DRSB 2WOMA 2GBZA 3OYIA 1T05A 3HL8A 4IRDA 4CIGA 4FJMA 3HKWA 2ZD1A 2Y1IA 5CYQB 3M8RA 5K14A 4KE5A 1S0OA 3OYKA 4ZPBA 2HW3A 4O4GB 3WNEA 4Q44A 3MEEA 1IKXA 4ED0A 4B8CA 3BQ0A 1C1CA 4QWDA 5KT5A 3PW2A 2YKNA 3KLEB 4LD0A 4JUZA 3OLBA 3K2PA 5KFTA 2KZZA 3KMQA 3QIPB 4FZXC 4ZHRB 1XR6A 3AO2A 1BIUA 2HWIA 5F8IA 1WN7A 3LP1A 4OPJA 4QOZB 2FLNA 4OKKA 3OJUA 4IKAA 2O5DA 3GIIA 1RT3B 3JYTA 2VG5B 5L1LA 1LWCA 1JLCA 3QETA 5KFYA 4ED7A 3MXJA 4CHYA 2YNIA 5KFJA 3VQPA 1RT6A 3IN5A 5KFFA 3KNAA 3OYCA 2ILYA 1TL3A 5J2PB 2YNHA 4RNHA 4E1MA 1J53A 4FXDA 1HQUB 3RBDA 1NKCA 5KFXA 1LWEB 3TWHA 3KTQA 2KQ2A 1HARA 3QIDA 3MECA 4CJKA 2V9WA 3KOAA 1X9WA 1JLQA 4IG0A 3U3GA 1UA1A 4XIUA 1LW2A 4EO8A 4K4UA 3BSNA 5C24B 2RN2A 4FJ9A 1A5WA 4MFBB 3P5JA 1TKDA 5KRTA 3LDSA 1D8YA 4KO0B 4K4SA 2WB4A 1KHVA 4CK3A 1XI1A 2OZSA 1HYSA 1WAJA 2ETJA 2HNYB 3K59A 2OZMA 3DI6A 3SPYA 4J2BA 1BI4B 4TN2A 1FKPA 1HMVB 2XCPA 3T5LA 1XWLA 3OSPA 4N76A 4LH4A 3H4DA 1RBUA 4CJRA 3OYMA 3K58A 5T7BA 4XPCA 1S1WA 4WYLA 3U6FA 4ELTA 1RTDA 1NOYA 4DF8A 1SH2A 1TKXB 4CGFA 4JV0A 4YP3A 1YTUA 4KTQA 1Q9YA 2F8SA 3N6LA 3VQEA 4B9NA 1QAIA 4FLTA 4HHTA 3K5NA 2V0NA 3PV8A 1RT5A 2PYJA 5HROB 1SV5A 3IRXA 1NK5A 1WSIA 3I5BA 4Q8FA 4NRUA 3ISND 1S1TA 1WNEA 5EWFA 1OS5A 2ZE2B 1GX5A 3QZ7A 5KG7A 4F3TA 3D0PA 3MXIA 5HP1A 1IO2A 4ED3A 1T03A 2JEGA 4DSIA 2C2RA 3OYAA 2FVSA 4U7CA 1RDCA 4CHNA 1HNIA 4FLZA 1D0EA 1S5JA 4MKBA 4F4ZA 4DSKA 5J2NA 4I2QA 3G0ZA 2FLPA 4QAGA 4ICLA 4Z4FA 1VSMA 2D7SA 3S3MA 4M3YA 2IM3A 3RMDA 4E7IA 4KB7A 2XC9A 4CJQA 4GC7A 5C42A 4R8UB 3VQSA 4M41A 1ZBIA 4J2DA 1RBSA 1TKZB 2WRMA 3CJ4A 3LWMA 3O3GA 1RT1B 2YNFB 2IJFA 2VWJA 4CJEA 4KHSA 2UVWA 3QZ8A 3SZ2A 5EWEA 3D28A 4BE1A 4NYNA 4EYHB 1ZTTA 1NK7A 3KLFB 5D3GB 5CYMB 2X6SA 2GIQA 1IM4A 5SZTA 5HBMA 3PO4A 3G86A 4WFZA 3C6TA 4KV8B 4QWAA 3KHGA 4DL6A 4RNNA 2VA2A 4M3WA 2RF2B 4OJRA 3UIQA 3PR4A 1SUQB 1HNVB 2XY8A 3DLHA 2FBTA 1NKEA 4W5NA 1NJYA 1N6QB 1RBTA 3RMCA 1QE1A 3G6XA 4OLBA 1HPZB 1RTHA 4Y3CA 4NLVA 3IGNA 4RW6B 4CGJA 3QEWA 3DMJA 3KK2B 4IG3B 3HVRA 2WONA 3M8PA 5I42A 1YTAA 4Q43A 4TYBA 3NBPB 3SJJA 5KG0A 1C0TB 3MR2A 1TVRB 2BQUA 4CJ3A 5KFNA 5KG4A 3NAIA 4ECXA 3TAFA 2YV0X 1T05B 4FZYA 1JXLA 1QHTA 1VSKA 4M3XA 1UWBA 4CGDA 4BWJA 2JGUA 3FQLA 3GIJA 1IKXB 3KIOA 4J9RA 3HJFA 2HNDA 4NLTA 1BCMA 1RT2A 1B9FA 1HYZA 2YHBA 3CVKA 1RDRA 1C0MA 1RNHA 2A1SA 2XY5A 1CZBA 3K5OA 4IDKA 4ECVA 4NLQA 4RW4B 4KAZA 3CM5A 4PY5A 5KFVA 1I39A 1S6QA 3FRZA 1VSFA 4Q8EA 1LWFA 5KFCA 3DRSA 4PQUB 5C5JA 4X2BA 2Q3SA 3OY9A 3AVFA 4FS1A 1IKWB 1LW0B 4G1QB 5CYQA 3NDKA 1WSFA 1TL1B 4O4GA 1YVUA 3RRGA 1J54A 3WNFA 2P1JA 5J2QB 3EZ5A 2AX0A 3L2VA 4DTMA 3AO3A 3KLEA 3T5HA 4YNQA 3AVCA 1F21A 3QIPA 3H5SA 1QSSA 4ZHRA 2AU0A 4CJVA 4EBCA 4TSXA 2HVIA 3MTKA 2XWYA 2P51A 4CHZA 4E1NA 3AO4A 1S49A 1HYSB 5KFBA 2RPIA 3AVNA 4K50A 2VG5A 4F3OA 3PX6A 1JL1A 4DTUA 3DI6B 1GX6A 3KMSA 3NF8A 1BCOA 3L2WA 3LP2B 2ZQBA 1WSGA 2D0CA 4FK4A 3C6UB 3V1OA 4B9UA 1W0HA 1RDBA 5J2PA 4E7JA 4MQ3A 4CIFA 3NF6A 1HQUA 3AVAA 2HHWA 2C22A 1LWEA 1RTDB 2HHQA 4FLVA 1UAXA 3H5UA 3UR0A 2W8LA 4CEQA 4Y1DA 4CEAA 3HT3A 5F8GA 4DSFA 3ISNC 1RYSA 4FK2A 1BQNA 1N5YB 3KLGB 4MFBA 3ZCMA 4KO0A 1O1WA 1KVCA 4DL5A 3OYNA 2HNYA 2QE5A 4ZTJA 1BI4A 3UQSA 1HMVA 3HSTB 1REVB 4RNMA 4DS4A 3OL9A 4DQPA 2BDPA 4TXSA 2J6TA 3KHHA 1U4BA 2ALZA 1S9EB 5HRSA 5EU7A 3ZSWA 3GV5B 3QGGA 5FRNA 5J2NB 1TKXA 1HRHA 2IS3A 3SFUA 2BRLA 1S0NA 5KT3A 2FJWA 4Y2CA 1U48A 1KLNA 4BWMA 4CJUA 4QW9A 3OVNA 5KFAA 4RW7B 4LQ9A 2IOCA 4CGHA 4NLYA 5L1KA 5C25B 1U45A 5HROA 3H98A 4NYFA 3SQ0A 1N4LA 4DLGA 1GOCA 1VSJA 4O44B 4EBDA 2ZE2A 5HRRA 3QNNA 3VQ7A 1JL2A 1LAVA 3VQAA 5J1EB 3CJ5A 4DS5A 1CXUA 3GQCA 3BQ1A 5F8MA 4PWDB 4DTSA 3BGRB 4TY8B 4YR2A 5HBMB 3S3NA 1VSIA 1S4FA 4CCHA 3KKSA 1HJRA 1TP7A 4R8UA 1S97A 4KHYA 5KFRA 1TKZA 3MAQA 3KLIB 3MFIA 4ZPAA 4Q0BA 1RYRA 3GYNA 5CZ2A 1RT1A 2FJVA 4FJLA 1TAQA 3FDSA 4OKJA 1ZBLA 2AGQA 4NCGB 2WONB 3KLFA 5D3GA 4W5RA 5CYMA 4ZP9A 2P5OA 2Y1JA 1TGOA 3DRRB 3NFAA 4DSJA 4RW8B 4K8ZA 4KV8A 2R2SA 3M9NB 3I0RA 2YHAA 2PYLA 2RF2A 4F4WA 4JRPA 2G8KA 1CLQA 3C94A 4OLAA 5JS2A 1RTIB 3ZSZA 1SUQA 1HNVA 3A2FA 4FLXA 2FVRA 1N6QA 5KFDA 1KFSA 4N56A 4K4TA 2EC0A 2J6UA 1HPZA 4ZMMA 3KKRA 3AVJA 4RW6A 4WXWA 4OGCA 2JC1A 1FK9B 3NE6A 1KLMB 4RW9B 4IG3A 5F9LA 1BQMB 5DG8A 4KHNA 4M3TA 4OGEA 1C2PA 4WXOA 3NBPA 4CHQA 3LAKA 1C0TA 4DWIA 3HK2A 1TVRA 3RBEA 2FVPA 4TQSA 4JLHA 1ZBFA 1GOAA 3AVGA 3T1AA 1S6PA 1TKTB 1N48A 4KHRA 3AO1A 5KG3A 1KVBA 1KTQA 3TI0A 3PY8A 4F4XA 4ED8A 1BIZA 3I5AA 1RBVA 1RA7A 4NLRA 4E0DA 2DPIA 2E6LA 5HRNA 1U09A 2ZKUA 2BQ3A 1XR7A 1SKWA 4GC6A 3CM6A 4FYDA 4CF1A 3RTVA 4RW4A 3VQBA 1VRTB 4ID5A 1UOCA 2GIRA 4MIBA 3B6PA 4IQXA 4FJ5A 4CFCA 3T5JA 3OYDA 4J2AA 4PQUA 2HHUA 2FBVA 4J9NA 1ZBHA 4ZVGA 3IAYA 3HVWA 3SQ4A 1T94A 5KG2A 2FVQA 2A1RA 1IKWA 1LW0A 2NUBA 3KLVA 2XY7A 4YMEA 4QWCA 4G1QA 4WYWA 3O4NA 2OH2A 1S1VB 1TL1A 3AA5X 4B3OB 5J2QA 3H5XA 4CEDA 3DLRA 3VA3A 1S1UB 4CEEA 3EPIA 1BQNB 1FKOB 2HAIA 4DSLA 4KSEB 4O0JA 3N6MA 4QW8A 3LAMA 3V4IB 1EKEA 3MFHA 2HMIB 3LP2A 1WAFA 5KFWA 2XI3A 3C6UA 3IGVA 3FQKA 5F8HA 2R8GA 1Y97A 1JKHA 2C28A 3TAGA 4O5BA 2HHXA 3MXMA 4C8KA 3ZT1A 1C0UB 1HQEB 4H54A 3V81A 5KFQA 1RBRA 2R7YA 2ATQA 2DFFA 3RR8A 2D3ZA 3PJXA 4TLRA 1N5YA 3KLGA 4F2RA 4B8AB 4E7LA 3OSNA 3CQ8A 4FK0A 3OL7A 1JLBB 1N56A 4F4YA 4CGGA 1JLAB 2GC8A 3OS1A 4FLUA 1ASVA 3CFRA 3AA3A 1BHLA 3PUFA 3VQCA 1REVA 4H4MB 3HHKA 3NF7A 5I3UB 5F9NA 4JV1A 3QLHB 2Z1GA 1SH0A 2R2TA 4ED1A 5KRSA 4NLDA 4RUCA 4CHPA 4BDZA 1T3NA 3ZSXA 2R2RA 5L1IA 1S9EA 4E19A 4M3ZA 2IJNA 3ZSQA 4DFJA 4CK2A 1D9DA 4RG8A 5J2MB 4ZPCA 3TAQA 2DFEA 4DQRA 3M9OB 3DRPB 1Z26A 3OYHA 1VK0A 4QCLA 1NK4A 4RW7A 1S1XB 1FXXA 5C25A 1VSEA 2KFNA 4FJ8A 1EX4A 2VG6B 4CJSA 4F8RA 4F50A 3HP6A 4O44A 4Q0BB 3L3VA 1L3UA 4IH7A 4EZ6A 4KI6A 4O55A 5J1EA 4KKOA 2QK9A 3L3UA 2JEJA 1WNSA 4PWDA 4DTRA 4H4OB 3JSMB 4M95A 3O3FA 3BGRA 3NGZA 4CERA 3CYMA 1S0MA 4TY8A 4JS4A 2G8IA 2Z1JA 4KB0A 1HYVA 4DG1B 1IG9A 5FRMA 3I0RB 5F8NA 3DYAB 1G15A 4QWBA 2IGIA 2V4RA 4IRCA 4B08A 4C8LA 3NAHA 5FDLB 1QSYA 3QO9B 4M42A 3KLIA 4Q45A 2IM0A 1NJXA 3VQ9A 3PHEA 4AHTA 3NH2A 4J9PA 3PZPA 4F4KA 1NK8A 4O3SA 2WTFA 2D0BA 4FW2A 2R2UA 4W5OA 1CSJA 1RDAA 4ID1A 4KREA 3SQ1A 2E9RX 4NCGA 4DMNA 4PA1A 1BGXT 2W7OA 3DRRA 3MR5A 2LSNA 3TABA 1JLEB 4RW8A 3MEDB 4MK8A 4LH5A 3EY1A 3SUNA 1WLJA 1S9GB 4F2SA 3QERA 3TAPA 1S6PB 1RTIA 2B6AB 4O0IA 5JUMA 3EYZA 3QEPA 4LY7A 4B9TA 4GMJB 4FJIA 3ITHB 4Y34A 3QGIA 3Q8RB 3RAQA 5DK5A 5HRPA 3UDLA 2W42A 3V1RA 1UA0A 3KHLA 2XO7A 1FK9A 1KLMA 4RW9A 1BQMA 3HP9A 3CJ0A 5KTQA 1TAUA 4ID5B 4M45A 4J9KA 4K8XA 1VSDA 2JEFA 1RA6A 4URSA 3T5KA 4FJJA 3IG1B 2F8EX 1TKTA 5DGBA 2DY4A 2R8IA 2WCXA 4AHRA 1NK0A 4YQWA 4BE0A 1RCHA 3KK3B 4O4RA 3HVTB 1L3SA 3DOLB 5L9XA 1JXBA 4NCAA 2W9CA 2R8KA 4FS2A 4I2PB 2W9AA 2IDOA 1K1QA 3QYYA 5DLFA 2WHOA 5KGXA 2HHTA 1VRTA 3PX4A 5KT2A 4DL7A 5KT6A 3ZT2A 3ASMA 3HXMA 2DTUA 4KBIA 1KFDA 5F8JA 3OS0A 1Q8IA 5DLGA 4IFVB 4CF9A 3NMAA 1JKHB 2BANB 2QKBA 3AV9A 4NLXA 1S1VA 4IR1A 1IKVA 3AVIA 3V81B 3V9WA 3ICLA 2C2DA 4B3OA 2VG7A 2E9TA 4EO6A 2P5GA 5KFMA 1S1UA 3DLEB 4C8MA 4CF8A 4G3IA 1FKOA 4FM0A 1CXQA 1WSHA 2D41A 3ZSRA 4W5QA 2FBYA 2IAJB 4CJ4A 3OYFA 3BQ2A 2V4QA 3BDPA 3V4IA 1JLFB 3WNGA 3GIKA 2HMIA 1BISA 1ITGA 3V9UA 2AX1A 3C95A 2QXFA 1C0UA 1HQEA 1TV6B 4OPKA 2R8HA 2F8TA 3MEGA 1L5UA 2C2EA 2G8HA 3LP0B 4LSLB 2BR0A 4ED6A 1NHUA 4JRQA 3CO9A 4N47A 2ITGA 1RT7A 2IM1A 3VQ5A 4ECZA 3ZT4A 3L2QA 3KJVB 1T8EA 1JLBA 3QNOA 3QGHA 3PJWA 3EZUA 1JLAA 4NLGA 4K4ZA 4LQ3A 4ECQA 3OHAA 5DQGA 4IFYB 3AVKA 3KK1B 3TAMB 1XR5A 3SUOA 3NGDA 4H4MA 3OL8A 5I3UA 3QLHA 1EXQA 3D45A 4KKOB 1QAJA 3DM2B 4KFBB 3N6NA 1QSLA 4DQQA 1ASUA 1JXEA 3KD1E 2VWKA 3IS9B 5E41A 3P83D 4TQRA 2GV9A 3LANA 5J2MA 1Z4UA 3GV7B 4IBNA 3S9HA 5DQHA 4JV2A 3DRPA 4BDYA 2ILZA 3SNNA 2YNGA 3MR6A 2W8KA 4ZTFA 3PX0A 3TVKA 3Q8PB 3VQ4A 1S1XA 4FLYA 1RDDA 1IH7A 1JLGB 4E3SA 4TYAA 4L8RB 2VG6A 4J9LA 4KTWA 3NHGA 5T14A 3V9XA 3NCIA 5KFGA 3SYZA 4HVJA 5CZ1A 1DLOB 4I9QA 3QINA 4HCCA 4CEZA 4MH8A 4XPEA 4B9VA 1Z25A 4H4OA 3JSMA 2FLLA 3PW4A 4Z4CA 4EBEA 2OYQA 1VSLA 4DG1A 2W7PA 3NL0A 4IKFA 4ZPDA 3DYAA 3NF9A 2X78A 4O3QA 5KFZA 2AJQA 1B92A 1X9MA 5FDLA 4DFKA 3B6OA 4ELUA 3QO9A 1C6VA 2XRIA 2HWHA 3OHBA 3CG7A 4KRFA 3P1GA 1T7PA 3AVHA 4EP4A 5DQIA 5KFHA 2XI2A 4ZVEA 4H8KA 3I5CA 2JC0A 4N5SA 1VRUB 4FZZA 4DEZA 1VSHA 3M8QA 3HO1A 4CJTA 4WE1B 3KD5E 1RTJB 3PW0A 3T3FA 2KW4A 1JLEA 2XGPA 3SI8A 3MEDA 5EDWA 1S9GA 4HUFA 3E51A 2FJXA 2B6AA 1XHXA 3OLAA 2RDIA 3HM9A 5KFSA 3E01B 3TAEA 2WK4A 3VN5A 4DQIA 3ITHA 2OPQB 3Q8SB 1QTMA 3DLBA 2Z1HA 4ZP8A 2RDJA 4ECUA 2W9CB 2Z1IA 3SUQA 4KHUA 4CFDA 4HUGA 4Z4EA 4CESA 4J9SA 2UVUA 3LPUA 1RT4A 4RZRA 4CIEA 1TK5A 4CEBA 4N41A 4Z4IA 3RRHA 1QQCA 3RMAA 3ZSVA 3IG1A 5DG7A 4AILC 2XGQA 3CJ2A 4AH9A 3MR3A 4KI4A 4B9MA 2IC3B 4YR0A 3DOKA 3ZT3A 4ZP6A 3NGIA 3LALA 4ECWA 1LV5A 2OPRB 3KK3A 1IKVB 2AWZA 3HVTA 3H59A 4BE2A 3DLKB 3VQDA 3DOLA 2UUWA 2VG7B 1WSJA 1W25A 4R0EA 3H08A 2DPJA 4I2PA 2HNZB 2EX3A 4DU3A 5KT4A 2OPSB 3VQ6A 1D1UA 3V9SA 1X9SA 4B9LA 2DFHA 1EETB 4AHSA 2XY6A 1U04A 3G6VA 1B9DA 3CDUA 1JIHA 4CJLA 2G8FA 1I3AA 2YKMB 1DTTA 4U6PA 2W9BB 4IFVA 3PVXA 3GILA 3V6KA 3O3HA 4KHQA 2BANA 5KFKA 1KSPA 2CJQA 3PW7A 2D0AA 2QKKA 1ZTWA 3MEGB 2OPPB 4C8OA 4LSNB 3UPFA 3RWUA 3O4QA 1KRPA 4WFXA 3DLEA 1RT7B 4Y2AA 4W5TA 4J9OA 2FBXA 1KVAA 2IAJA 3G10A 2D3UA 2B5JB 4I7FB 4OVLA 1JLFA 3HPOA 1W9HA 3WNHA 2I5JB 4XO0A 4Z4HA 4AHVA 3ALYA 4YR3A 3CDWA 4R5PB 4DFMA 4RU9A 4NZ0A 4FCYA 3SUPA 2I1RA 2E9ZA 4E7KA 1TV6A 3V6DB 5KFLA 4RNFA 4AHCA 4FJNA 2BE2B 4BACA 1CZ9A 4MIAA 1JX4A 1TQLA 3LP0A 3SQ2A 4LSLA 4CJPA 4NLWA 4GW6A 3LP3A 4O3RA 5KFIA 5SWMA 2YNGB 2RKIA 4KB1A 3KJVA 3BSAA 4FW1A 5KFUA 4FJHA 4DL2A 4J2EA 2ASLA 2O4IA 1DTQB 4YFUA 2QV6A 2X74A 3V6JA 1XHZA 4E89A 4IFYA 4URQU 1J5OB 3KK1A 3TAMA 4FVMA 4Y1CA 3I0SB 3VQQA 5HLFB 2G8WA 1L3TA 4DF4A 1J9AA 3DM2A 4KFBA 4O3NA 1R0AB 3ULDA 1XC9A 3IS9A 4K4YA 3RMBA 3H4BA 4ECTA 4CE9A 1NJWA 2F96A 4FJXA 1IKYB 3DDKA 5JS1A 5KG1A 2ASJA 4DTPA 2AGOA 3CJ3A 1JLGA 3KLHB 5KFPA 3TANA 1NK9A 4M3UA 2B4JA 3VA0A 1K6YA 3EPGA 3FFIB 1DLOA 3CFPA 4FBUA 3I8DA 2KZMA 4IRKA 3AVBA 4CJFA 2IMWP 4CJWA 1QUVA 1MU2B 1KHWA 3AVMA 2R8JA 4O3PA 2CKWA 3M8QB 4PUOB 4NRTA 3DLGB 3NH1A 2ASDA 1D5AA 1EP4B 4HKQA 3M8SA 4Z0UA 3OJSA 3OS2A 3SI6A 3T19A 1ASWA 1D9FA 4DSEA 4HUEA 3LPTA 4IH5A 3RB4A 3QEXA 4GVMA 4M94A 5DMRA 4ZVFA 1C1BB 4Q5VA 4ECRA 3RB0A 3F73A 5KFEA 1SL2A 2HVHA 5KT7A 1RILA 3PW5A 2WOMB 2AQ4A 2FC0A 1TK8A 1VRUA 4MK9A 3OYEA 4NYZA 1S10A 2IM2A 2OA8A 2EHGA 2ZD1B 4HCBA 4WE1A 1RT4B 5K14B 1RTJA 4B9SA 3AO5A 3MEEB 4Z4GA 3OYJA 1C1CB 3NKYA 2YKNB 1I6JA 3BREA 2HHSA 4CGIA 2E6MA 4M3RA 5F8LA 1SKRA 1SL0A 4HTUA 2UUTA 2JLEA 4RUAA 3DOKB 3F9KA 1A5XA 2BRKA 4AHUA 3LP1B 3E01A 1NJZA 5KFOA 2G8VA 3OYLA 3L2UA 4DTNA 1A5VA 2OPQA 3JYTB 4UQGA 1JLCB 1LWCB 1X1PA 3ZSOA 4FBTA 3QEVA 3SV4A 2YNIB 3KHRA 4DL4A 1RT6B 1NNDA 5FROA 2D5RA 1TL3B 2YNHB 3GV8B 4DLEA 2X6NA 3LZIA 1S9FA 2GUIA 1Q9XA 4DL3A 3SV3A 4KAIA 3MECB 4EYIB 2IBKA 1YT3A 1JLQB 4IG0B 4EP5A 4NLSA 1LW2B 2HHVA 1DTTB 3VQ8A 2IC3A 1NHVA 4EZ9A 3CWJA 4OL8A 4KHWA 1NK6A 4KHMA 1RT3A 2BQRA 2OPRA 2B43A 3DLKA 3OYBA 3SPZA 1FKPB 1BL3A 3H2LA 5L1JA 2KTQA 2HNZA 3CDEA 2OPSA 4DTJA 1EETA 1S1WB 4WZMA 3FSIA 2G8UA 4FM2A 3BSCA 3BR9A 5KGWA 4EEYA 5KG6A 5JXSA 3RB3A 2YKMA 3H40A 2W9BA 5C24A 2KFZA 1RT5B 4FLWA 1SV5B 3IRXB 1QS4A 3GIMA 2OPPA 4FJ7A 4CJ5A 1SH3A 4I9LA 1S1TB 4LSNA 4DU4A 4ECSA 1KCFA 1U49A 5HP1B 4WFYA 2RKIB 2O4GA 1ZYQA 1T03B 5KI6A 3ZSYA 4CF2A 2E4LA 3LZJA 5EUHA 3BJYA 1HNIB 1LAWA 2B5JA 1YVFA 4I7FA 4I2QB 1TK0A 4ICLB 3RAXA 4QPXA 2I5JA 3H5YA 2XCAA 3ZT0A 3D5MA 3K5MA 2AGPA 4FJGA 4R5PA 5EWGA 4MKAA 3HPHA 5C42B 4IH6A 3V6DA 1MMLA 2BE2A 4J9QA 4NLPA 1K1SA 4E7HA 4CF0A 4TY9A 3HVAA 4ZP7A 3AVLA 4IOBA 2ATLA 2XHBA 2PY5A 4K4XA 5DGAA 3PO5A 3QEIA 3M9MB 1DTQA 3NGYA 1C1AA 4ELVA 4CK1A 1J5OA 3QESA 3K5LA 4RNOA 4FJKA 3BSOA 3L8BA 4ECYA 3I0SA 5HLFA 3C6TB 3V1QA 4DFPA 4DTOA 3THVA 4BDPA 1R0AA 3TQ1A 4CHOA 4NLUA 2VA3A 3HPGA 2PZSA 2FVCA 3V9ZA 4C8NA 3SFGA 4O3OA 1IKYA 1QE1B 4NLOA 4K4VA 2YNFA 1RTHB 1L3VA 3HYFA 3LWLA 2UVRA 3SCXA 1SKSA 4OKEA 4DU1A 3AA2A 3QIOA 4URGA 1GOBA 1ZBUA 4JS5A 4HYKA 3RB6A 3V6HA 4CEFA 3DMJB 3KLHA 4ED2A 4CECA 3M8PB 5I42B 4DQSA 4MK7A 1U47A 3OL6A 3K57A 4QWEA 4CEOA 2JEIA 3FFIA 3L2RA 3PR5B 4CFAA 3OYGA 1MU2A 4J9MA 2J6SA 1S48A 5KG5A 4PUOA 3TARA 3DLGA 4KTZA 1EP4A 5DG9A 2UVVA 4IR9A 1UWBB 4CFBA 3NH0A 1SL1A 3AA4A 4DTXA 5CY4A 3RR7A 3NAEA 4KPYA 3S3OA 4FM1A 2HNDB 2BGGA 1RT2B 3CIZA 2HB5A 2IA6A 3KK2A 3MF5A 4IDKB 3G6YA 4WZQA 1NKBA 4ZVHA 4K4WA 1C1BA
chains in the Genus database with same CATH superfamily
3GG4A 3U3YA 2A40A 5F3ZA 3HDSA 3OYIA 5TKYA 1F2GA 1B99A 1RU1A 1YSJA 4IRDA 4CIGA 2ZD1A 4PABA 1HNZF 3R5AA 3M8RA 3OYKA 4ZPBA 5M2RA 1RHJB 2O8CA 4CBUA 3WNEA 3O9TA 1VBZA 5LMNJ 1IBLF 4WTYA 1Q95G 1C1CA 4QWDA 3PW2A 4CZFA 4N8NA 3E3XA 4JUZA 3K2PA 3LGNA 5C15A 4KH6A 1HBUA 4AT1B 3DGVA 2IVYA 1XR6A 3AO2A 1R3NA 1R0CB 1SZ2A 4QOZB 1FFWB 4X65J 2NRZA 3HFKA 5L1LA 3VEZA 4F0HA 2HBMA 3QETA 5KFYA 2A3ZA 2YNIA 5KFJA 1RCOB 1FA0A 3T6JA 3OXFA 3QFWA 3RAMA 1J53A 4FXDA 3PSIA 1HQUB 3RBDA 1XMOK 4RUHA 4I1TA 3KTQA 3TWHA 2XO6A 1HARA 1PC5A 1K0VA 4ATNA 3OXLA 3NS7B 3Q8UA 3P5JA 3GFYA 2UUCF 3O08A 5KRTA 1NPPA 4CZCA 1UZHA 1TR0A 1VQYA 4JI0K 1WAJA 3J81Y 3SPYA 1HMVB 1WI8A 3RW6A 1QHAA 4N76A 3H2UB 1DJ0A 2RRNA 4RLEA 2DGVA 1VQLN 5LMNK 3IFEA 1SJ4P 4XH4A 3BGOP 4DF8A 2QLFB 3W5YA 2FY8A 5GMEA 4YP3A 2YTCA 1UETA 3J81O 1N52B 3UKUA 4X65K 4FLTA 4DR7J 3PV8A 3BR8A 1CQMA 2X7IA 1NK5A 1FFGB 1RWOB 3I5BA 2QA4G 3ISND 2NXJA 3P96A 1OS5A 1GX5A 3QZ7A 1YIJN 3FEXB 2CVIA 3GCWP 1GLJO 3PIOQ 1RAAB 1T03A 2H5IB 1OPZA 2FVSA 4U7CA 1F2HA 4CHNA 4FLZA 1D0EA 1JXVA 4OI4A 5AJ3F 4DSKA 4XEIA 3K0JA 1RADB 1RGIA 2EI5A 3HHNB 4ERDA 4M3YA 1WF2A 2DCUB 5JMNA 3B82A 1HA1A 4FF1A 2HAFA 5AQGA 2C1EB 1Q4RA 3GJSB 1T9TA 5C42A 4IQMA 1TKZB 1WOOA 2YVSA 4DI6A 1RDWX 4WCEL 1HBNA 1EB0A 4MT1A 2VZ9A 3V4MA 4P71A 5AQVA 3SZ2A 5GAHU 4BE1A 4EYHB 4FWOA 4P6QA 3Q7CA 3AAWB 2GIQA 1B0PA 5FLXU 4ZN3A 3F41A 3CIPA 3Q86A 4KV8B 2AJ4A 4QWAA 3KHGA 4DR7K 1CQNA 4M3WA 1GMUA 5JVGL 3M2UA 4OJRA 4FOIA 4CYUA 3UIQA 2A42A 1RDUA 3NGKA 2FBTA 1IUJA 1NKEA 3W2WB 4USIA 1RBTA 3FKBA 1BWVA 2CPXA 2DXDA 2ZOGA 3ZETA 1QE1A 2DXFA 4DN0A 3W2VA 2HHPA 5KPTA 3OHRA 3KUEA 1FXLA 2G2YA 1JJ2R 3EKUA 4IDHA 3U9DA 2Z0GA 3HVRA 2WONA 3M8PA 5I42A 3PYEA 4TYBA 3O3LA 4MJKA 4YS2A 1W7AA 4ITSA 1UPMB 2CJKA 3BKUA 4QS8A 5BJRA 3TVZA 3M5RA 3A3NB 4FL9A 1JXLA 2JZ5A 3SQGB 4AD6A 1QHTA 3FBCA 4ILGB 4M3XA 2VFUA 3U4LA 3HF5A 2JGUA 2DHXA 3CXCR 2WSFC 2J5AA 4J9RA 2P9UA 2KFYA 1RT2A 1RAHB 1B9FA 3C7NB 2KT5A 1HYZA 2YHBA 3CVKA 2RU3A 3SSSA 4ZJQA 2A1SA 1N34J 2XY5A 4IDKA 4ECVA 5EX5A 4NLQA 3Q8VA 4PY5A 5AR0A 1RAEB 4Q8EA 1KTVA 1RHUB 3EZOA 3ILIA 4M5MA 2MZRA 3OY9A 2HSTA 4IZ9A 3VZHA 3OTEA 1F9FA 1IKWB 2RD5C 2V50A 4XAKA 1ZM9A 2DIVA 1YVUA 1FESA 2HFZA 2P1JA 4UUWA 2KHOA 1SJFA 3KNGA 1KXPA 1SC3B 4DTMA 4M1KA 1QVFR 4BRKA 1F21A 4X4NA 2HVIA 2FSNA 4ZLLA 2RPIA 1F3FA 3M3ZA 1GX6A 3D54A 3LP2B 3VQTA 1EJ7L 3C6UB 4DV3F 4B9UA 5IM0B 3V1OA 1Q5VA 1RDBA 3VF2A 2YCHA 4MQ3A 1JMTA 4DUZJ 4CIFA 1HQUA 1GFWB 2QIFA 1RTDB 4CEQA 1N34K 3HT3A 2ZH2A 1KQSR 1HNWF 3W1YC 3ISNC 1RYSA 1NZ8A 4FK2A 3KLGB 1NDCA 3ZCMA 5JMVA 3J81U 3SK3A 3B4DA 3CJ8A 2QE5A 2HZCA 2HLTA 1HMVA 3HSTB 1SCJB 4CD1A 2OAUA 2EWSA 2BDPA 1LKZA 2ROEA 5EX0A 1M90O 1U4BA 2OTLN 2DH8A 3ENWA 2ALZA 4LIWA 5HRSA 3CQXA 5EU7A 1ZS6A 4QJVA 2XG8A 1HUXA 2MQOA 4O0NA 2QWLA 2BRLA 2FJWA 3IDHA 1SI9A 1KVIA 3GBTA 3HMJG 5ADZA 4WPAA 4BWMA 4LC9B 1AXQA 4MO5A 2IOCA 4LF4J 2GO9A 5IOLA 2AYEA 4NYFA 1N4LA 4C1NI 1RB0A 1GLDG 3QNNA 2HBZB 2HG4A 1LAVA 4DUZK 2VB6A 1JNRB 2AJ2A 1N36F 3GQCA 3BQ1A 3N0VA 5F8MA 3PYGA 2R3VA 1N8RT 4BR7A 2QI2A 2VC1A 5KAKA 4YR2A 1CBKA 1UKUA 3S3NA 3NOCA 4CO2A 3ENQA 3MUTP 4DR4J 5G4DA 4NXMF 4XK8C 1TKZA 2LU1A 3KLIB 4ALZA 4PXDA 3HBTA 1PJ6A 4K8RA 1IWAA 3GYNA 1UTAA 2FJVA 1M1GA 1KQGB 1NGBA 3GB0A 1TAQA 3L7OA 4NO7A 1Y5NB 5H9EJ 2AGQA 5CHIA 2YX6A 4NCGB 3MN6A 1N5QA 2P5OA 2UUAJ 3EGVA 2ZH9A 1GK8A 1WG5A 4HL9A 1CC8A 1E3MA 3SCLE 4QZVB 4KV8A 2R2SA 3R1LA 2OTJN 5BR8K 2G8KA 3IM8A 4OV1A 5JS2A 3ZSZA 3PDNA 3TSQA 3W2WA 2DBBA 4A48A 2XMAA 1PYTA 2KDOA 4N56A 4HHJA 1FTRA 2J6UA 3THXB 3KKRA 2EG2A 1E6YB 4YOEA 1RUSA 2JC1A 2ZJQQ 4EU0A 1FK9B 2XSJB 1G1XA 4RW9B 2BW7A 1BQMB 2C3PA 2I6WA 3SSRA 4KHNA 2B4PA 5F0WA 3IWLA 2OFGX 1CC7A 3MTJA 3LUYA 1Z1ZA 2ERRA 3MPDA 3AVGA 3HCXA 1OKJA 1S77D 5C2DA 4JV5F 3SQGA 4P73A 4KHPJ 1KVBA 4LR8A 2V68A 3TI0A 3PY8A 3VEYA 4O8KA 3DHXA 3I5AA 2DPIA 3UCUP 1U09A 2BKOA 3C7NA 2BQ3A 1HI8A 4ZPVR 2ZM6K 2VQFK 2UUAK 5FD1A 2QN6B 2XS5A 4ZOSA 2G1DA 3CF5L 5IWAJ 4CF1A 4FWQA 1NLKL 3P8BB 1KAZA 1VRTB 3W8GA 1UOCA 3K9KA 3UDCA 2GIRA 4XTTA 4FJ5A 1SQFA 4I6AA 1M5PC 3IAYA 2XHCA 2XZWA 1IKWA 2E2QA 1WC1A 2XY7A 3FSXA 4WYWA 2E2NA 2OH2A 3TX0A 3DNCA 4Z2XA 1C4AA 4B3OB 2HYIB 5C0YA 3MAAB 2CQBA 3GSIA 1S79A 1U2VA 5CD4A 2UXDJ 3DLRA 4C3KA 1G3OA 4JI7F 1GLCG 1BQNB 2H4YB 4DSLA 4O0JA 2KU7A 5C12A 3N6MA 3R3TA 2MKHA 3V4IB 3MFHA 4OZLA 1YJ9N 5U47A 3LP2A 1WAFA 4G1PA 1HKGA 5KFWA 2ZWPA 2VPZB 3C6UA 2A10A 1ZA1B 4OZJA 5IM0A 2X3DA 1JKHA 5M2PA 3TAGA 4O5BA 4BRFA 3P39A 1C0UB 3OW2M 2AEJA 5KFQA 1RBRA 4U96A 3J7YP 2R7YA 3HTVA 2CH6A 2D3ZA 3KLGA 4MKYA 2FF6A 4MIWA 3PEHA 4F4YA 4CGGA 1ESVA 2GC8A 4LVOP 2E66A 1U6ZA 1ASVA 2F4VJ 3CFRA 1H7XA 2HKEA 4CO1A 1BHLA 5J1PA 5ETNA 3MZIA 3O8MA 5F9NA 3C19A 2UP1A 4DX8H 4LF5J 2Z1GA 3W66A 2R2TA 1REGX 5KRSA 1EWRA 4NLDA 4RUCA 4BDZA 1KDNA 3ZSXA 5L1IA 2W2OP 2LLZA 2IJNA 1YITS 3NG8A 4DU8A 4DQRA 1FKAF 3OYHA 2OCEA 2UUBF 4E8UA 3ZX0A 1S76D 2YKQA 2NPIA 5ETSA 1H2VZ 3IKMA 1VQMS 4A8KA 1S1XB 1FXXA 1WBDA 2MQPA 3FCWA 3P45B 3KJFB 1KWMA 4Q0BB 2LMIA 3BB5A 4AE5A 1L3UA 3AHPA 4LBHA 1ICEB 2CNLB 4ZDNA 2PA8D 2PMZD 1NGAA 3IMQJ 3L3UA 1U1QA 3K8VA 5GAGP 2PA3A 4ZLJA 5EVZA 2XNRA 1G15A 3X1LB 4QIEA 2RRBA 3NAHA 5B09A 1VC6A 2F4VK 1QSYA 3QO9B 3KLIA 5F0UA 1NJXA 8RUCA 4AHTA 3NH2A 1S59A 4J9PA 4H5RA 3PZPA 4F4KA 1NK8A 4FW2A 1X3MA 2R2UA 4JAXA 5FPDA 3D0IE 4DV7F 3ZZZA 3GYXB 5HJXA 2EKYA 3EMTA 4DR6J 3SQ1A 4NCGA 4I4BA 4PA1A 4M5DB 1XEZA 3GL1A 2CJAA 4HI2A 2W7OA 3VPZA 1RP5A 1XK8A 4MK8A 9RUBA 2D0PA 4KQZA 3SUNA 1TZ0A 2Q6CA 3TAPA 2QYCA 2B6AB 3EYZA 5AXKA 2X1FA 2FZGB 5BXIA 3CJBA 2H4WB 4IO1A 1RAOA 5BPLA 3ITHB 3THXA 3RAQA 5B0BA 1E6YA 3UDLA 2EBGA 4FYYB 3THWB 1FK9A 2XSJA 3CULA 4JI5J 4RW9A 2J9CA 1BQMA 4NMLA 3GJTB 1ZM3A 1TAUA 1V6HA 4ID5B 3CPWR 3KHYA 2DHAA 1RA6A 5F3TA 3HX9A 5LY3A 3IG1B 4FJJA 4CVNE 3GZ7A 2F8EX 2A5XA 3HHLB 2VBWA 5DGBA 2VICA 4V19X 2PI5A 4LF7F 4AHRA 1OMSA 1V3SA 3OBIA 2XTJP 1NK0A 3NGSA 4BE0A 5LXRA 3W62A 1XC3A 5K8OA 1VFJA 4I0WA 3DOLB 5L9XA 3E8OA 5BN8A 4DR6K 4NCAA 1YTYA 3HHLD 3WXIA 3UI3A 5DLFA 2HHTA 1VRTA 4HHUA 1ZBSA 5L9NA 5LSLA 3LO3A 2RT3A 4LMZA 3CIMA 5F8JA 2DR8A 2UXBF 1Q8IA 3UD5A 3NCQA 5B0FA 3H25A 2M88A 2PIIA 4OI3A 1IKVA 4LRBA 3V81B 3ICLA 2C2DA 3MGJA 4B3OA 3MAAA 4EO6A 1R43A 4P2SA 4JI1F 4CF8A 4P7VA 3AJ2A 2G2ZA 2D41A 1VQOS 4JYAF 4LBPA 2QJ3A 4TKTA 4CJ4A 3OYFA 3CC4S 3V4IA 1BISA 2W2PP 1SC1B 4DV6J 1ITGA 1WKKA 2QXFA 1C0UA 2KG0A 1L5UA 3EE8A 2BR0A 4LT6A 4JRQA 4CO0A 1OWXA 4LF5F 3ZT4A 2P6TA 3IBCB 5ETQA 4HTJA 3G96A 1CEZA 3QGHA 4DV2K 1FD8A 1GLEG 2AMCB 4B3SJ 4K4ZA 3AB2B 3AVKA 2A18A 1S4EA 2C3YA 3NGDA 3OL8A 1H7WA 2XB2D 3CE8A 2R7OA 1NGJA 1WEYA 2ZUAA 5EHHA 5BPNA 4Z7CA 5D78A 1N32K 1QSLA 2C2NA 2GW8A 5LOQA 4NWBA 4Z94A 5D77A 3IS9B 2XMWA 3M2VB 3F44A 5DQHA 4YB5A 4JV2A 2ILZA 3PX0A 4RX6A 2HQCA 4CTAB 1S1XA 4FLYA 1PAEX 3FEYB 4BRQA 1WHWA 1GT8A 1U6BA 3C6HA 3NCIA 2DIUA 4F25A 3ZNJ1 4L73A 4K42A 2JWKA 4I9QA 3VGUA 3FGVA 4P74A 3E9PA 4FP9A 3JQKA 2AYBA 2IYGA 4ED5A 2FZCB 2ZZNA 3PYDA 3PW4A 4Z4CA 2KRBA 4RBVA 2JLGA 5IQQA 5F2RA 4ZPDA 2YHWA 4AQYF 2LQ9A 1LFPA 3EGWB 4J9UE 2IIHA 4DFKA 3B6OA 4PWWA 2IPOB 3QO9A 5AQJA 2DGTA 1C0FA 3MD1A 2QTDA 2HWHA 4KRFA 2OEMA 2XS2A 2FHJD 7FD1A 1T7PA 2XZTB 3BF3A 5FIIA 3M6XA 3W9HA 3SAGA 2O67A 5KFHA 3R6MA 3A3OB 1N5TA 4N5SA 5HQ8A 1FEHA 3ENAA 5BREA 4BGBA 4M5DA 5IT0A 3T1YK 1FJGF 2FYXA 3B6BA 1RTJB 3KD5E 4LJMA 1FWPA 2A0FB 2A6MA 3NMRA 4BR9A 3LDPA 1VIOA 1RFQA 3E51A 2V69A 3WT0A 2FJXA 2B6AA 1FO1A 1XHXA 1XMQJ 4X62J 4DV5F 4CIOA 1MA9B 5KFSA 3HHLC 2XWXA 1ZXOA 4JI6F 3ITHA 4OX9J 2F63A 1GLAG 1PC4A 2EK1A 1QTMA 4USUA 4Y2IA 1NSQA 5HVGA 3THWA 2W9CB 2GGPB 4S0MA 4KHUA 1NCLA 3MN9A 2YH0A 3VALA 4CESA 3UVJB 4OZ3A 4N41A 1QQCA 4EAHD 1FDDA 3G4SS 3IG1A 1XNRF 5DG7A 2F7TA 1B3TA 3D2FB 3RGIA 4KI4A 4B9MA 3KWIA 2MZQA 2DGQA 3ZT3A 4ZP6A 2VFRA 1DT9A 4ECWA 2FQQB 1LV5A 4CLFA 3H59A 1NU0A 3DOLA 2UUWA 2CPEA 1WSJA 5KPZA 3H08A 1HKAA 5AQZA 4DU3A 5KT4A 5DDOC 1MDUB 1V3RA 4FYVB 1D1UA 5DZ6A 4OI2A 3TA0A 3VENA 1NMEB 3CCEN 1VCTA 2L08A 3J7YU 1RWUA 4CJLA 3HI0A 5IC4B 2Q1NA 4X62K 2HBYB 2DTJA 2W9BB 5E3PA 3GILA 1DURA 4DPUA 5DM7Q 1KSPA 2CJQA 2QRRA 1Q8KA 1T9YA 3MEGB 1FRHA 4RWWA 3WZ0A 1LOUA 1KRPA 3IM9A 4DUTA 1RT7B 3CCQS 1W97L 3VHQA 3VGSA 5EX3A 3QPIA 1KVAA 4WKRA 3G10A 3VGLA 2D3UA 2VHGA 2UXCJ 4RUBA 4I7FB 4ETZA 2NXCA 1H3DA 4XH5A 2MQ8A 5AQOA 1W9HA 4AHVA 3S8SA 5IQ6A 7AT1B 3ALYA 2VFSA 2DGUA 4YR3A 2YX4A 3CDWA 4NLBA 4DFMA 4NZ0A 2E9ZA 1FRLA 1CZ9A 4H0PA 2GO8A 4KGZB 3C14A 1OIAA 3SQ2A 4DR3F 3IAM9 4NLWA 4KYZA 3CC2S 2XLKA 5KFIA 2VDHA 3H1VX 2RKIA 4KB1A 1K73O 1H72C 4O23A 2ASLA 2O4IA 3B8AX 3L09A 4MDBA 1NSAA 3Q24A 2CPDA 1XHZA 1IJEB 1XNQF 2P9LB 4F3MA 1H98A 4DUYJ 2VD3A 3VQQA 2HGNA 4QQBA 2MMYA 3M7VA 3O6QA 3UDVA 2JOQA 4DR2K 2FPHX 2APOA 1FF2A 3IS9A 3C3LA 3M2VA 4LF8J 1CJVB 4CE9A 5JS1A 1TU0B 2GMHA 2ZH3A 4CTAA 5CZXA 2PO4A 1Q82O 1CG2A 3KLHB 1NK9A 2HBLA 3GFHA 3W61A 2DVIA 2EFVA 1K6YA 4LFCJ 3I82A 2I0XA 4E1JA 3FFIB 3CFPA 2KZMA 1MU2B 4A8QA 4DX6A 3AVMA 3BP8A 3M8QB 1CVJA 3IA0A 2NLWA 3CD5A 4F67A 1N33F 1U2CA 3OJSA 3OS2A 2PBDA 3SI6A 3T19A 1ASWA 4PAAA 1XMOF 1VQNS 3TO8A 2XMMA 3WXKA 1VIXA 3LPTA 1Q8LA 2AJ1A 2R7VA 2C3UA 4F0MA 4C8ZA 4DUYK 2HK2A 4CI0B 4ECRA 2ZEJA 2VASA 5KFEA 2HVHA 2RH3A 1UEKA 4JI0F 2WOMB 2AQ4A 3AY0A 3TX8A 1AZSB 3OYEA 4NYZA 1CJUB 2EHGA 1VGYA 2E1RA 4HCBA 1RT4B 1RTJA 3MEEB 1YITN 4UY8T 4Z4GA 2D9PA 4I6YA 3OYJA 1W26A 4HDHA 3I55N 3J8AA 3BREA 4CGIA 3CCMS 5F8LA 3TUPA 2UUTA 1NSKL 3F9KA 5HANA 2A6OA 3NVKA 4QIGA 2IVPA 4CWBA 1A5VA 3CTRA 1JLCB 1RWKB 2GGPA 4XDCA 1RT6B 2LEAA 4OHZA 1T6DA 4ISFA 2V8VA 3D68A 1I94J 1TL3B 2YNHB 3GV8B 3M6GA 4CD3A 4DV4K 4KAIA 1JLQB 2VUGA 4NLSA 3D2FA 1XQSC 3WC2A 3CNQP 3QBCA 1JJHA 3CWJA 2P9IB 1MWQA 1NK6A 3R7BB 4KHMA 2LA6A 3DRYA 5CD4H 1XMBA 3G8SA 3SPZA 1BL3A 5CHCB 3H20A 1TL7B 2NRRA 2CRLA 3C0BA 4NZ6A 2O8EB 2QFIA 2MEWA 2OSQA 4ES1A 5M1NA 1S1WB 5HMWA 3BM7A 2C42A 4FDFA 2CJYB 3BSCA 1NGGA 5KGWA 5KG6A 2G0CA 5HQMA 3NOGA 2N7CA 5JXSA 1WD6A 3G9CA 3RB3A 2W9BA 5C24A 3WX4A 1YHQN 1PYOB 2MXYA 2JJ4D 2PDAA 3UWTA 4OMFG 1F6TA 3SXLA 1KC8O 1VQ7S 4X4VA 3IRXB 1QS4A 5M1FA 2DRAA 3QT7A 1I94K 2B56A 4RL1A 4QS9A 1MN7A 1VBXA 2HK3A 3ZSYA 4A4JA 1AYEA 4I7FA 1HR0J 4NI2B 3RAXA 4QPTA 2ROPA 3L95X 3ZT0A 2P9CA 4HTIA 1ZM4A 3KK7A 5C2GA 2V67A 3HPHA 4A61A 3ZTSA 3FBEA 3CJCA 2NXNA 4IUFA 1Y0HA 4CF0A 3VAJA 1JQGA 1MWKA 3ZZPA 4BGAA 3EVMA 3PO5A 2RQCA 2M9KA 5E3RA 4ELVA 3P4IA 2P9LA 3QESA 4GY2B 1HX1A 1PSDA 2YQ1A 4ECYA 3E2EA 1HNXJ 2FD2A 1N54B 5DM6L 1BY9A 5IXUA 1KOOA 4NLUA 4NXNK 3QRPA 3HPGA 2MLXA 1MWMA 1CJVA 5D4PA 2Z2MA 1LQ9A 4O3OA 4YDUC 4Y28C 2Y9HA 1L3VA 3DXKB 2CPIA 3QIOA 2FLOA 4PG7A 5GADP 1KD1O 2E5HA 3MR7A 2ZNZA 4JHDB 3KLHA 3RJMB 4DQSA 1GLLO 3K57A 4QWEA 4ED4A 2DY9A 3CC4N 3FFIA 3L2RA 3QQCD 2X3GA 3ZZTA 3PR5B 2F5GA 4CFAA 3OYGA 1MU2A 2QLJB 4J9MA 4YDUA 1GNKA 3EO3A 3O80A 3JSYA 1NJIT 2ABYA 2JFDA 2W1BA 5DG9A 1S6UA 1UWBB 5CY4A 2UU9K 3S3OA 2AIRB 4X4TA 3TRGA 2AD9A 2IA6A 3MUVP 1ELOA 3G6YA 5ETKA 4ZVHA 3F56A 4K4WA 1GTHA 4JI3F 4WKYA 1CJKB 3SDEB 3W64A 5GAHI 2B9YA 4NCBA 3KWMA 3U02A 2MKSA 3Q8QB 3GIRA 2WOMA 2GBZA 1AZSA 3Q83A 2B51A 3HL8A 3MX2A 1SJ3P 3UE5A 1CJUA 3FEZA 3CETA 3HKWA 4IO9L 4KE5A 4M63C 2ZC3A 3MEEA 1IKXA 2AYMA 4ED0A 4B8CA 2CQCA 2IA0A 3JS9A 3OLBA 5KFTA 1SS6A 3SMZA 4DMZA 3TTFA 2HWIA 3ETMA 1WN7A 3T7ZA 2FLNA 2VPXB 4IKAA 3GIIA 1RT3B 4LF9J 3FC9A 4ILHA 1JLCA 3UD3P 1EWQA 5B0CA 4M63A 2VF3A 3BBBA 1VMBA 3VQPA 1RT6A 1U02A 3OYCA 5IFMA 1TL3A 2YNHA 4RNHA 4E1MA 2GZOA 2KVQE 5KFXA 2PT0A 4B1UB 3QAEA 2EFGA 1IWGA 1P9QC 3KOAA 1S3XA 1JLQA 3AOAA 3U3GA 4XIUA 4EO8A 1RWMB 4K0KJ 1A5WA 3FZ2A 2P9IA 2LXUA 5AQTA 3LDSA 1RWXB 5DJBA 4WFAQ 2W24A 2WB4A 2OZSA 1XI1A 1SKUB 2ETJA 3AH6A 3K59A 4WWSA 2VPYB 4OYWA 3DI6A 2F8MA 1TL7A 5M2UA 1VQ9S 2BXJA 3GR1A 3H4DA 1RBUA 2ALYB 1D9AA 2O8EA 4QYRA 1BO5O 4BR5A 5T7BA 4XPCA 3CCLS 1S1WA 1UFLA 3U6FA 2FB0A 1NOYA 3FR0A 5CZVA 5HAOA 4JV0A 4JI8F 2D9OA 1XBWA 4KTQA 3VAMA 2YHYA 3UO0A 3U27A 2F8SA 2JRSA 3K5NA 5M1KA 4QBUA 5BR8F 4LF9K 3IRXA 1MWYA 2JFKA 2ZE2B 4DR1J 3MPYA 1HHSA 5KG7A 3MXIA 1IO2A 1M5KC 4F02A 2JEGA 4DSIA 1CZAN 2H51B 3OYAA 3M1VB 4CZMA 2HVDA 1S5JA 2KYXA 2YWFA 4F4ZA 4PPDA 2FLPA 4DV0K 1NMDA 4NI2A 3D3BJ 1VSMA 1A6LA 1NRKA 4KB7A 5JICA 3G4SN 2HS4A 1TTHB 2J7WA 2Q3PA 3VQSA 3OTOJ 1I1GA 4J2DA 1RBSA 2HQGA 1TUWA 3AOCA 1VQKS 4ZLPA 3CJ4A 3LWMA 4FWMA 1F9HA 3A8JA 2IJFA 2WW8A 3N9UC 3QZ8A 4J7CA 1A7GE 4BLGA 5EWEA 3M6WA 5D15A 2KB2A 2XYHB 2O8FB 2ZM6F 2VQFF 2B0GA 3HZ6A 3KLFB 3QSYB 2X6SA 3MM8B 3H46O 4X4SA 5IZHA 5B0EA 3G6ES 5DRKA 3GPAA 2AV5A 3PO4A 3G86A 1VC0A 4RNNA 2DNGA 1NGFA 1T9UA 1DEJA 2MTLA 5JVHL 3PACA 1N5SA 2R7TA 1HHQA 1N6QB 1S7IA 4FSVA 4CQ1A 4OLBA 1TFWA 3DXKA 4RW6B 4CGJA 3NGRA 1MNEA 2D74B 4M5GA 4JHDA 3KK2B 2K7JA 2DGWA 4IG3B 4HH0A 2IIRA 4FYWB 3CCQN 2IMOA 1R6VA 2M8DB 4DQ8A 2NNWA 1C0GA 3IMXA 2Q0RA 2RMLA 5CR4A 3R2DJ 2V6AA 4OHYA 4AUKA 4CLKA 3HFZB 2BJ1A 2XBPA 1UP1A 1YJVA 5KFNA 4CJ3A 3UFCX 4ECXA 2YV0X 1T05B 2KJWA 3BF1A 1UWBA 2PFDA 4UZCA 3GIJA 3P31A 3HJFA 2ZUGA 3VEWA 4HH1A 1Q0NA 3CC2N 3G8QA 3KDOA 3R8YA 3K5OA 2ZVSA 4KAZA 1CJKA 3SDEA 1VLYA 3MM5B 1WDTA 1EIYB 4ZVPB 2LFVA 3LGHA 3F5TA 3L0QA 4E2FB 5C5JA 1Q16B 3CUNA 3BBCA 2HQ3A 3AVFA 4J90A 3IBWA 4FS1A 1LW0B 4OLPA 4G1QB 1KNZA 3NDKA 1YZ6A 4YY3J 1WSFA 3ENBA 3MCPA 1GAOA 1XTZA 3W5XA 2VKZG 2ZH4A 3RRGA 1YGYA 5J2QB 4PG5A 3AO3A 2IDEA 4OYIA 3T5HA 2EFQA 4YNQA 1QSSA 4RBTA 5DZ7A 1G2EA 1Q7LB 3MTKA 2P51A 4PXCA 1S49A 1HYSB 3GTYX 5KFBA 3AVNA 4K50A 2OP5A 4A2BA 4F3OA 3PX6A 4DTUA 3KMSA 3NF8A 3ZEUB 1RI7A 4KY3A 1WSGA 4FK4A 4PXBA 2DPNA 1TL4A 4LRDA 2NS1B 4FKXA 3NF6A 5AXLA 3UR0A 2MHNA 2B9EA 3RBXA 4F04B 2R7WA 4Y1DA 4J37A 4DSFA 1YDLA 1VQNN 5HQLA 1Q53A 3AT1B 4CP5A 3FZKA 3TZYA 4WJBA 1KVCA 4FYXB 4ZCIA 1IBKK 4BG9A 1RACB 4JN4A 3VAIA 2ZH8A 2AW0A 2BKPA 1T9VA 4YY3K 2LCWA 5FRNA 1UPPA 1G4CA 5J2NB 3HSDA 4X64F 4CZGA 3VERA 2Z4PA 3QT6A 4I6MB 4FKYA 5KT3A 1KLNA 4A8YA 2IFXA 2BM1A 4QW9A 5KFAA 4RW7B 4LQ9A 4NLYA 4X4PA 1QQNA 1U45A 3H98A 3SQ0A 4DLGA 1U1MA 2KM8B 3PCOB 4O44B 4EBDA 3AFGA 2ZE2A 4J91A 3VQ7A 1JL2A 2DEJA 1VQ8N 3CJ5A 5LXYA 4DS5A 3M1VA 3R5BA 3TJ8A 5E3QA 4EHUA 3BGRB 3VAGA 4FXWA 4TY8B 3CJAA 2X1AA 5HBMB 1VSIA 3T9ZA 1S4FA 4ISEA 4JI4J 1K9MO 3J80Y 4PHTX 2AJFE 5GADU 1S97A 3M8WA 3MAQA 3MFIA 3UN3A 4ZPAA 2MQNA 4FPBA 4WYBA 5CZ2A 1NSPA 3FBFA 2HZAA 2PE8A 1ZH5A 3PXGa 1R8CA 3FDSA 1NPRA 3J80O 3KLFA 1B0TA 4W5RA 1DQ8A 3MM8A 1VQ4S 3CCSN 2YHAA 3I0RA 4DCPB 5FJ4A 4JRPA 4YB6A 3QATA 4M7XA 4G65A 3C94A 4CZKA 4KH4A 4OLAA 4LF2A 3SBGA 1Q79A 5HI7A 4JKGB 4LF6J 3A2FA 2RQKA 1N6QA 1WKJA 5CH7B 5KFDA 3J7ZT 1JJ2M 3I4PA 1VQ7N 4BR0A 2A2CA 4RW6A 4WXWA 2D1KA 1AW0A 4IG3A 1DARA 2DISA 3VZIA 4GVBA 4OGEA 2FF3B 3O9SA 3OFHA 3LAKA 4JI4K 1IJFB 3HK2A 3T1HJ 4LRAA 2HMPA 1JNZB 5THWA 4TQSA 1ZBFA 3T1AA 2BA9A 3KG1A 1KS2A 2GQ2A 2HVZA 5MAOA 3CXCM 2ZH5A 2H3EB 1ZAVA 4U7BA 2DRBA 2FC9A 4F3QA 2P9PB 1AUDA 1RA7A 2UV8A 4Q7AA 1P6TA 1SKWA 1GH8A 4A8FA 1Z05A 4FYDA 3CM6A 2D1CA 2HHHF 4DPOA 2J4RA 2WBRA 1OY6A 3MM5A 5SUHA 2QA4S 2DO4A 4DKWA 4M5KA 1E4GT 2CH5A 1GTEA 4LF6K 2F8HA 4PL8A 1U8WA 2FVQA 1LW0A 2NUBA 3KLVA 5D0HA 3ZFVA 4YMEA 3O9RA 4G1QA 2NZ4A 3O4NA 3MI7X 3SSQA 3OXGA 4FWNA 3AA5X 5G0RB 1N32F 3KUGA 3FZHA 5J2QA 2HOEA 3R9PA 3H5XA 3MHYA 2GHVC 2YWHA 4G1IA 2B9XA 4H03B 2V94A 4NEYA 4UUXA 3I4HX 4JD2B 3NGTA 4W92B 4PKDB 4RO0A 4B17A 2VFVA 5AQNA 5KOXA 3ZEUA 2HMIB 4PG4A 3FZBA 2CYYA 3IGVA 1HD0A 4DCOB 4DPWA 4YHHJ 2C28A 1Q7YT 2HHXA 2I7NA 2DNOA 2E88A 1Q86O 1FRJA 3KDNA 3PJXA 3R3LA 3BGLA 3O2IA 2RS2A 4M5HA 2SXLA 3FUYA 2BOAA 2ZBQA 4GKJK 3W60A 2GV1A 1X4EA 3AA3A 1HBOB 3IWXA 3QLHB 2QEXS 1ATRA 5AQQA 5AE1A 2KM8C 4CH1A 2I8EA 4QR0A 4OZ0A 3RYLA 4M3ZA 3LM9A 4CK2A 1D9DA 4RG8A 5J2MB 1FNOA 3FGUA 3R5CA 3T1YF 3IR5B 1WC3A 4I6MA 5MLCQ 2FJAB 4LFBK 1HWIA 4RW7A 3HRGA 2XULA 4RU2A 2ZITA 2VG6B 3B78A 4O44A 2R7SA 3L3VA 3NS6A 1FDAA 4EZ6A 3QBXA 2MDAA 1O0PA 2F9TA 2AZ1A 4H0XB 4KKOA 3WQPA 2JEJA 5HO4A 3M6UA 4M95A 1V3ZA 1RXOB 1EARA 5M1PA 3BGRA 3NGZA 2LEPA 1S0MA 4TY8A 2G8IA 3J80U 2CQDA 4DG1B 2OSRA 1KR4A 4QWBA 1R31A 1WTBA 4C8LA 2RNEA 3D6MB 2QC3A 4OYOA 5AQPA 3NNAA 4M42A 3VQ9A 1OQ6A 3BN4A 3PHEA 2ZJPL 1QLNA 4C11B 3PFOA 3N4WA 2XZDB 3L3CA 1VQ9N 4KREA 2E9RX 1FHTA 3ATUA 4DMNA 3TQEA 1BGXT 2V4JB 4IO9Q 3CCLN 2ASYA 1J2VA 4GKKJ 1GXTA 3HT0A 3QAUA 3E9OA 1UJ4A 1VJWA 4F2SA 2AT1B 1S6PB 1PBUA 4ISGA 1VDHA 4DN9A 5JUMA 1BE4A 4X4OA 4JKGA 4ZK7M 4LY7A 4B9TA 4GMJB 4B3TJ 2E5LF 4EGLA 1SQEA 1CJTB 4JI2J 1S5ZA 3FZLA 3V1RA 2E2OA 2X1BA 2ZOMA 4Y0WA 2CA9A 2YQ3A 4I56A 4NASA 3NRBA 3CJ0A 1X3NA 2VBXA 1EHWA 4DPTA 4J9KA 2OGUA 4URSA 2NRVA 3NCPA 1U7LA 2P9KB 3JTOA 2R8IA 1PGZA 1HNZJ 1NWKA 4YQWA 5A8WA 4BBYA 3KK3B 1YXQA 2P9PA 3GSDA 1L3SA 1VQKN 1J5EF 2DKOB 1IBLJ 1MN9A 1OVQA 2MZSA 2CQ0A 3BEGB 3BKFA 2Y8WA 3U8XA 3A1YG 3M8YA 1K1QA 3QYYA 1FJEB 5KGXA 2Q79A 2DTUA 3G6EN 5HVHA 1KFDA 1FWLA 3SJHA 3OS0A 2RHQB 1K8KB 4C4WA 2QO3A 3VV2B 3NCRA 3W3DA 3NMAA 1YWXA 4KGVB 2PEHA 4DR2F 4C0HA 4KH5A 3AVIA 3C2PA 3V9WA 1RK8A 2MB0B 4JKEA 4FO0A 2VG7A 5KFMA 2QX0A 5AT1B 3GLJA 3K9JA 4FM0A 1CXQA 4W5QA 1O5JA 2FBYA 4YB1P 2FXUA 2V4QA 1B7FA 4B3RF 1JLFB 3WNGA 3GIKA 2HMIA 3SQOP 1HNZK 1VQ5S 5HK4A 2AX1A 1X5SA 2VDIA 2Q2RA 3C95A 2HBRB 3TSPA 4OV6A 2G8HA 4ED6A 4QIFA 1EKSA 4ANEA 3L2QA 5E5NA 2DB1A 4Q2LA 2ZH7A 1RKJA 1UVKA 5DQGA 1HBOA 4KC5A 3KK1B 1XR5A 3PRVA 1FX2A 1M1KO 2BJ3A 3QLHA 3LPEA 3LH2S 3Q2TC 2Z2LA 4OYPA 1JCEA 3MCAB 4BC7A 4R79A 3ENOA 1ACMB 3J7YI 1HW9A 5JVHQ 5TKWA 5CXTA 1JXEA 5AJ3J 4DCJB 3RW7A 4MDAA 5J2MA 4MTPA 3S9HA 1IR0A 2CGLA 3N79A 5IT4A 4WF9L 3CC7S 3SNNA 2YNGA 2W8KA 1K8AT 2UUCK 3MD3A 3TVKA 4U67L 1IH7A 1LEOA 4E3SA 2VG6A 1KVKA 2UYTA 2E1ZA 2Y1LB 4EFHA 2ZHOA 1DLOB 2GJFA 2DNHA 3IC1A 2WBNA 4HCCA 1Y3KA 4MH8A 4B9VA 4KJIA 3JSBA 3MUMP 4GV9A 4K43A 5AQYA 3EWGA 3S01A 3NVMA 4IOCL 1YLXA 4EBEA 4DG1A 3NL0A 1A9NB 3N5FA 3QFHA 4DV4F 2F9WA 4Y2MA 1HIYA 1UFWA 2XRIA 1IQTA 4IWVA 3CG7A 3P1GA 2V63A 3ZTPA 3AVHA 2XI2A 1BA0A 4H8KA 3I5CA 5AZJB 1DFDA 1GMWA 4FZZA 3OBWA 5GAGI 5D0EA 3N28A 2V4JA 4NPOA 3LQVA 4CJTA 1WEXA 3PW0A 1FDBA 1EQYA 2FSJA 3DDNA 3NEKA 3HLUA 2FGCA 4LSZB 1PIEA 2P9SA 3U1NA 3KUHA 3PM9A 3OLAA 5EGYA 4WFBL 2MLZA 4EI2A 1H73A 3E01B 3CJ7A 1OY9A 3JSRA 1CJTA 1Q81O 3THTA 4P9SA 3BEXA 4M5NA 4TU8A 2B8PA 3CPWM 1NAQA 2L9DA 5ETTA 2BUNA 4Z4EA 1S99A 1GQEA 4RZRA 1TK5A 4CIEA 4HACB 4Z4IA 4U95A 2QL7B 2MZTA 2V7ZA 4CI6A 1GEHA 2HEKA 3ZSVA 2V8PA 4AILC 2VGMA 1NDLA 2P9KA 1NGEA 4X66F 4LR7A 3BPSP 3LALA 1U26A 1NBWA 3KK3A 1QQOA 4FF2A 3UB5A 3CB4A 3A5MC 3VQDA 2ACYA 3PIPL 4R0EA 3AAQA 1S6OA 3QNWB 3HZEA 3IXQA 3ULEB 2HNZB 2EX3A 2G0IA 2OPSB 2OFHX 2XMVA 4TU7A 4BC2A 3AAPA 4IJNA 1T0TV 1NM1A 1B9DA 3D1HA 1SIZA 3M32B 1Q78A 1VQ4N 2IJRA 2YWKA 3EVOA 2YKMB 3D1OA 1T9WA 2J9DE 2YBVA 3PVXA 1K8KA 4DV3J 2EK6A 2ZKTA 1PYSB 4KHQA 2K3KA 2V7YA 3O44A 2BYCA 4JKBA 3MDFA 4OJGA 3PW7A 4LFAF 1S12A 2O1PA 3B4MA 2D0AA 2QKKA 2R9LA 4NXNF 2E29A 4C8OA 4KGKA 1J27A 4GO7X 5ETLA 3AODA 1SQKA 3LGMA 2WSEC 1HNWJ 3H1QA 4ZN1A 2QA2A 3MMCB 4J9OA 3CCWA 1WB9A 2JVOA 1SJ1A 2V52B 2B5JB 1F5CA 1JLFA 3HPOA 1NB7A 3WNHA 3GOIA 4WQ5C 1WOSA 3IP0A 3KKFA 4R5PB 1O13A 4RU9A 4FCYA 4E7KA 3S7RA 4CLUA 5KFLA 4AHCA 4TNOA 1UJ5A 4V19S 2W6LA 1TQLA 5CA5A 4ZVQB 1SIWB 2E1AA 5BN9A 1FTCA 2B4OA 2Q66A 4FJHA 4ILLA 4DL2A 2UU9F 4J2EA 2MKYA 3ONQA 5KOWA 1T3OA 2B4UA 4NE9C 2QV6A 2X74A 3LM2A 3TW0A 3G25A 1J5OB 3KK1A 3R8EA 3HD2A 4DV3K 3I0SB 2QA4N 2G8WA 2YHXA 1J9AA 1VRQC 4M7YA 3OFFA 1N36J 3O1WA 3ULDA 1N0VC 2MJNA 4B3MJ 3CGIA 2HSEB 4ECTA 2Z30B 2ZBCA 2HFSA 4FJXA 3MPWA 1V4SA 3QFUA 3MWTA 2Z57B 2CAJA 3L7UA 3UD4P 1MW7A 3G87A 4P2XA 1PAUB 3CJ3A 3AARA 4NXMJ 3D0GE 4M3UA 1UWAA 1UCNA 2B4JA 2HS0A 3VA0A 3RG6A 1DQ9A 3UNYA 3KVGA 3BO2A 2DCLA 1DLOA 2DNZA 3I8DA 2Q6BA 4YOUA 1VHIA 4M5LA 4ANCA 4IRKA 4X4UA 3LDOA 2IMWP 1KHWA 2GX9A 3ADAC 3TWZA 2ZGZA 1YJNS 3OUYB 1D5AA 2FHOB 4HKQA 3WQUA 5AZIB 3FCHA 1SQGA 4DSEA 3OVBA 4CZHA 5RUBA 4A8SA 4WTOB 3QEXA 2CJBA 3DKDA 4M94A 3FMWA 4LIRA 1C1BB 1VJQA 2XLIA 2G2OA 3RB0A 3F73A 1SL2A 2G9OA 1N36K 2F40A 5AZJA 2CQ2A 3CCUS 3PW5A 1D09B 4MK9A 2QEXN 1S10A 2IM2A 2QSFA 3DHWC 4GO5X 5E26A 3AO5A 3TP2A 1OYDA 3EX7B 3PLAA 1PO6A 3ETOA 5K8MA 2JLFA 1IVZA 4IO8A 2NRHA 2YKNB 3VEOA 4PG6A 2MLYA 4Z37A 4M3RA 1N88A 4JV5J 4RUAA 3DOKB 3LP1B 3E01A 5T7LB 3L2UA 4DTNA 2G4BA 1HI1A 4UQGA 3N01A 1X1PA 2HRTA 2HF4A 4FBTA 3QEVA 3KHRA 1V5VA 1LXNA 2VGNA 9ATCB 1LK5A 1X31C 4HACA 4EMDA 4KH0B 3UW1A 5AQWA 1YT3A 4IG0B 4EP5A 4PWUA 1LW2B 4DV0F 1WC5A 3EJMA 1DTTB 2IBOA 2YWEA 4OL8A 2B43A 3S41A 5B0AA 4WP9A 3OYBA 3W63A 1YQHA 1FKPB 2WVBA 3WC0A 2BVZA 3ULEA 2HNZA 1B7YB 2QLBB 3CDEA 4JI7J 3SLCA 2OPSA 2BJ7A 4ILJA 3C15B 5I3PA 4DTJA 1NGCA 1SC6A 4WZMA 5A8RB 3SMPA 4FM2A 2G8UA 2FY1A 1RHRB 4OQJA 3FRYA 2YKMA 2FDNA 2KFZA 3BGUA 4BC5A 2M5YA 1BUPA 1AT1B 1SV5B 4CM0A 4P2FA 1G7CB 2DR9A 2ZGYA 4ECSA 1KCFA 1MLAA 5HP1B 1ZYQA 2O4GA 3IFRA 2KG1A 1K9MT 3MMCA 5KI6A 4J5OA 2GWJA 4YDDB 3I8BA 2E4LA 3KYLA 1HKCA 4W90B 5EUHA 1DGKN 4JEPA 2B5JA 1YVFA 4I2QB 3L4BC 4B02A 4UOFA 2ADCA 2AF6A 3HSZA 2DRDA 3H5YA 4USWA 1MWZA 1X5TA 2CJ9A 2W7AA 2XSFA 4FJGA 4R5PA 1NU4A 4YOTA 4MKAA 4QR2A 2OANA 4IH6A 2K1RB 5AQRA 1K1SA 3A0IX 2ZJPQ 3MM9B 2RAQA 4L76A 4BROA 2YWWA 2UUBJ 2XHBA 1P90A 1EO1A 4K4XA 1FWKA 1K44A 2J7KA 1WI6A 4X4RA 3WIVA 4B3MF 1J5OA 2NQPA 4RNOA 3BSOA 3L8BA 3I0SA 3BV8A 1W2BR 4WU2A 3EE9A 3AQPA 1FT8A 4DFPA 3VEXA 3VTIA 2EFOA 2X51A 3THVA 4BDPA 3TQ1A 3G2XA 1YG0A 4K2XA 2E2PA 2PZSA 1F5BA 1RWPB 4W98A 4U8VA 1U1KA 1RTHB 3P5BP 1SKSA 4OKEA 2VBYA 2E7WA 4JS5A 4AL7A 4N77A 3DMJB 1P8GA 2D3O1 4MK7A 1N8RO 1JWWA 4CEOA 4C48A 2JEIA 4BVOA 5M1OA 4LF4K 3SIPB 4CNYA 1VHFA 4DV7J 4V1Ak 3CCVS 1JB0C 3PEJA 2J6SA 1S48A 3GJRB 2Q31A 1VQ5N 3OUYA 2VQEF 4CZJA 1R8PA 2CDRB 2Y0BB 3BKTA 3MEKA 1SL1A 3AA4A 5AZIA 3NS5A 2UUBK 4DTXA 4BVPA 3RR7A 3NAEA 3QICA 2UV8G 2BGGA 1LFWA 2HB5A 2DHGA 4CO4A 3CERA 1CPZA 2JNJA 2GJIA 3NXZA 4WZQA 2PD1A 1C1BA 4AXIA 3FLCO 3V2UC 3TVYA 1S6QB 1ZETA 1WSEA 2R42A 3TR8A 1NOZA 1LWFB 4XH1A 1IBKF 4DR4K 5BYRA 2LECA 1UJ6A 4JKAA 1OY8A 2YX7A 3RVCA 3ENHA 3RBZA 4FJMA 4FWPA 2P2CB 5M1QA 3CMQA 1S0OA 1RSCA 2ZBIA 2HW3A 4O4GB 1TYQB 4Q44A 3B54A 2MQMA 2ZZMA 3DRXA 5H9EK 3BQ0A 3UKRB 5KT5A 1MSWD 2YKNA 1UFKA 3CC7N 3ZXWA 2D69A 3KMQA 2KZZA 2G13A 4FZXC 1YF5L 4LF7J 4OIXA 1BIUA 5F8IA 3LP1A 4OPJA 3OJUA 1VR6A 2E7VA 5T7LA 4FWKA 3WEEB 1LK7A 2VG5B 1TMMA 2LU2A 4JK8A 4WFNQ 5FPEA 1Q86T 4ED7A 3MXJA 4CZLA 4CHYA 4GNIA 1YI2S 2XLJA 4ZCKA 5KFFA 4FNIA 5J2PB 2QMWA 1TFYA 1YKWA 1PJ5A 1LWEB 3QIDA 4CJKA 1X9WA 4IG0A 3AXMA 1JJCB 1LW2A 4TLQA 3FE1A 1RAGB 4K4UA 2UXBJ 3BSNA 4FJ9A 2RN2A 4MFBB 1TKDA 3M6VA 1UAWA 1KHVA 4CK3A 3CJ1A 1HHTP 2HNYB 1H2TZ 3TPQA 4BQZA 1FKPA 1XWLA 3OSPA 4KHPK 4LH4A 4JI1J 4JB8B 3C15A 5A2QY 3N5BA 4EWTA 4JYAJ 4WYLA 4ELTA 1RTDA 3KFWX 5EXWA 1SH2A 1TKXB 1Q9YA 5IWAK 4WF9Q 2RQMA 3N6LA 3VQEA 1DRZA 3CJKB 1QAIA 4HHTA 4U67Q 2PYJA 2GMLA 1DQAA 1FNXH 3ZZOA 4Y2KA 1SV5A 1CULB 1WSIA 5A2QO 5ADXH 4NRUA 5HVFA 1WNEA 5EWFA 4F3TA 3D0PA 2W41A 5HP1A 3ZC4A 3OV7A 2C2RA 2FZKB 2RUSA 4OPAA 1WEZA 3CHWA 4YEAA 2P5VA 4I2QA 2UXDK 4IOCQ 3G0ZA 3OFEA 3AOBA 1QQMA 2UXBK 3LW5C 4Z4FA 1VYAA 2C2MB 2CXEA 2D7SA 2IM3A 4E7IA 1U1NA 2XC9A 4CJQA 1RWWB 1S0VA 2ZVIA 4R8UB 2LQBA 2K1RA 1ZBIA 3R97A 3VESA 1UVLA 1JCFA 1SC4B 1R8AA 2QWQA 1OO0B 4C9DA 3O3GA 3MM9A 4JI1K 4UF4A 3MCMA 2YNFB 3MPUB 2N3OA 1WJ9A 1PJ7A 3ILOA 4CJEA 1T44A 4DR5F 1X8DA 2ZDPA 2UVWA 2A2DA 4NYNA 3EUNA 3QWUA 3C16B 5CYMB 1T95A 2QL5B 2DNKA 3JS6A 4WFZA 2B9WA 2RF2B 1QAXA 1LWXA 3P38A 1ILYA 3DLHA 4W5NA 3CDBA 4WFBQ 2MKKA 1UW4A 3GCXP 1NJYA 4LF5K 4CT8A 3G6XA 5ELZA 1RTHA 4NLVA 3IGNA 4AQYJ 3JQMA 1GXUA 3LDNA 5AQUA 3CI5A 2BV3A 3DMJA 1Y00A 1RWVB 2WFBA 4NA2A 4Q43A 1WTFA 1OH8A 1VI7A 1C0TB 3MR2A 1R7IA 4QIVA 1TVRB 3QRQA 2DNLA 4FPAA 4FZYA 1GLBG 4FVUA 3SAFA 3W65A 2MQQA 4C3LA 3PNIA 1FJGJ 2PSZA 2MYFA 3HM8A 5GADI 5I4MA 3KIOA 3BN7A 1OVYA 1AUSL 1BCMA 1SAZA 2MZJA 4K5RA 3PIPQ 2BABA 2I7PA 1RDRA 2Z58B 4PXEA 4DV5J 2WBMA 5KFVA 2FGOA 1S6QA 3H2VE 4JI6J 2CNKB 2EPIA 3FRZA 1LWFA 5GMKa 4GKJF 4BCAA 5KFCA 4PQUB 1BU6O 4X2BA 2Q3SA 1Y9OA 1U8SA 4RJVA 2XMKA 4LF1A 2O8DB 1TL1B 4O4GA 5DDQC 1TYQA 3OT9A 1U1OA 2ZC4A 1J54A 2QLWA 3O6WA 1XNRJ 1FRXA 3M30B 3H5SA 3MK6A 3WXJA 2AU0A 4CJVA 4EBCA 4D3GA 4TSXA 4LFBF 4CHZA 4E1NA 3FFKB 4DZDA 2Y8YA 1JCGA 3AO4A 3EZWA 4ZCLA 3WEEA 2VG5A 1NH7A 1JL1A 1BCOA 2E8AA 2BTFA 1VQSA 2ZQBA 4ZITA 1W0HA 5J2PA 4E7JA 2PMWA 1FX4A 1NGHA 2GHPA 1YJNN 1NM2A 1LWEA 2HHQA 2U2FA 2YJFA 2W8LA 2CUYA 4JI5K 3A8EA 3ID8A 1TUUA 1XJWB 4DV5K 3A12A 1N5VA 1BQNA 4K2JA 4MFBA 2BUPA 2FUG9 1O1WA 3OYNA 2HNYA 4ZTJA 3UQSA 1REVB 4DS4A 3OL9A 5A2QU 4L75A 4TXSA 2CQIA 3OR1B 3CCUN 2RJZA 3O1LA 1UW9A 3K7RA 3K8WA 2AA4A 3QGGA 4M5JA 3WX8A 1XNRK 3L4QA 1TKXA 4WCEQ 1HRHA 2IS3A 2W25A 3SFUA 3M1FA 4WQ4C 4Y2CA 1U48A 3CJKA 4PR6A 3UE2A 3OVNA 4CO3A 4CGHA 5L1KA 3AGKA 5C25B 1NH8A 1CULA 4MYUA 2F3JA 2NXUA 1X5OA 1HBNB 3I87A 4DR3J 5ETRA 3CJSA 2NR0A 4B1VA 1U1RA 3VQAA 3EE3A 1P8ZA 5J1EB 5JVGQ 2YJEA 5JJBA 3D6FB 5H9FJ 1W7WA 4WQ4A 3D3CJ 2XS7A 3CDAA 2NRXA 2J7UA 2EC2A 2YWGA 4UOGA 1XNQJ 2K3IA 2W40A 4NX9A 2OD4A 2YXLA 2W4PA 4OJ1A 1SXLA 1HJRA 1TP7A 4R8UA 1Q5YA 3QMQA 3MMJA 5KFRA 4A5AA 1XUPO 1RWNB 5D4LA 3UCGA 4Q0BA 2DNQA 4DV6K 4FJLA 4DPYA 3W2VB 1YBAA 2Z56B 1FEEA 1ZBLA 1APSA 2WONB 3C16A 5CYMA 3DRRB 1C4CA 3E1YA 1TL5A 5T41A 4K8ZA 3M9NB 2RF2A 3D1QA 4B3SK 1RTIB 1OSCA 3QMLA 3HOTA 1YJWS 4OI1A 4FLXA 2FVRA 4OYAA 5F41A 1N33J 1KFSA 4K4TA 2BZ2A 5LSOA 1XMOJ 1A0OB 4GVLA 1ZPWX 1FRIA 3ILLA 1XNQK 4FF4A 5DG8A 4M3TA 2DYAA 3HZGA 3OR2B 2IVMA 3GU0A 1C0TA 4DWIA 1TVRA 3H7HB 4JLHA 4JI0J 2M4MA 1FJCA 3PTWA 1N48A 4KHRA 4UOHA 3AO1A 3A5OC 1KTQA 4K41A 4ED8A 3POTB 5LMUF 3VR1A 1RBVA 4NLRA 4E0DA 2E6LA 2ZKUA 5BRHA 1XR7A 2GAHC 4N7TA 3ZNUA 3VGVA 3IRWP 4GC6A 1BOTO 2ZH6A 4P10A 4DV1F 1NLVA 4ID5A 4LRCA 4ZJOA 3UNGC 3TOQA 1RCXB 4MIBA 3B6PA 3AQOA 4IQXA 3TJAA 4CFCA 2ITMA 3T5JA 3OYDA 3HHLA 4J2AA 4PQUA 2HHUA 2Q43A 1ZBHA 4ZVGA 5H1SV 1N33K 1ITPA 2RHKA 4QWCA 2O8DA 2QWOA 1V5IB 1WUAA 3L7PA 1TL1A 2VONA 4N8OA 1RTZA 1SPBP 3TSUA 4NZ7A 4ZKAA 3SEOA 3WUHA 4FNHA 3M30A 3T9NA 3O5BA 3LL3A 1WSRA 4KSEB 2LA4A 4QW8A 1E6VB 2CPYA 3LAMA 1VS3A 1XMQK 2XI3A 1MG7A 3VF6A 4W4MA 5E3AA 1NPKA 2R8GA 1Y97A 3EVWA 3D6TB 3CCVN 3WXLA 4OX9K 4YB7A 1KAXA 4C8KA 4H54A 3V81A 3MOJB 5CE3A 1NDKA 5L39A 2ATQA 2XMJA 1OJ4A 5C7PA 1IBMF 1F1BB 3NGUA 4B8AB 4A8WA 4E7LA 3CQ8A 4FK0A 2PMHA 4L6V3 2V34A 3OS1A 3OFGA 4FLUA 2V2KA 4ANDA 1FI4A 3PUFA 1REVA 2QZ8A 3WBZA 3CSKA 4H4MB 3HHKA 5I3UB 1R89A 3S6EA 3OR1A 5GAEP 4CHPA 2JVRA 4HLBA 1T3NA 2DJWA 2FJBB 1NBEB 4E19A 3CJRA 3ZSQA 4DFJA 3TAQA 1UEUA 4V19J 3FJ2A 3M9OB 1AA1B 4BRLA 4CLYA 3DRPB 4GV6A 1VK0A 2IVOA 3EL2A 1NK4A 3L6QA 1PILA 1BD6A 2KHCA 4U9RA 2LKZA 2H5JB 4RR5A 4WP8A 5C25A 1VSEA 2KFNA 1EX4A 4CJSA 4Y65A 4WIQA 4F50A 3HP6A 4F8RA 2ZDOA 2K8GA 2DNMA 3VCDA 2CQ3A 5GAGU 4IH7A 1XIQA 4ZJLA 3BS9A 2WAQD 2CVEA 5J1EA 3ILJA 2QK9A 2H3GX 1RLCL 1YI2N 1F9EB 4H4OB 3JSMB 2R7XA 4CERA 3MMBB 2P8IA 4KB0A 3LPYA 1HYVA 2BE9B 1S7HA 1IG9A 4BRAA 3VGMA 5F8NA 3DYAB 4CLZA 3ID6A 2IGIA 2V4RA 4CLLA 3ZO7A 3D2EB 3Q2SC 3HHDA 2UXCK 1WHXA 2GNKA 2KKHA 4Q45A 3BZQA 3W9IA 4O3SA 3G8TA 2D0BA 4W5OA 1CSJA 1RDAA 2YKAA 4ID1A 4WBFA 2MKIA 4ZVSB 4KT0C 2FHJA 1IM6A 4Y6IA 4G6VB 1Y64A 4AXJA 3DWLA 4IJAA 3DRRA 3MR5A 3TABA 1JLEB 2EEYA 1WLJA 1S9GB 1J6ZA 5LJ5Y 5H1SQ 3QERA 1SJQA 1RTIA 2XMUA 4CH7A 3CF5Q 5KQDA 3GMGA 3QEPA 4YN3B 4FJIA 4JKHA 3Q89A 4Y34A 4B1YB 4IOAL 2RS8A 5DK5A 5HRPA 2Z2ZA 2W42A 1UA0A 3D2WA 4LF8K 3FNNA 3HP9A 1EZZB 2BJ8A 1YJUA 2HQDA 3OR2A 1Y3JA 1TUGB 2JWLA 4M45A 1MMDA 4JI3J 3KJQB 5FPNA 1VSDA 4C8YA 2JEFA 5LMNF 2Q36A 3T5KA 3UDEA 5HMXA 1VBYA 1BWFO 2VBZA 5D0GA 2MHEA 4BC9A 2DY4A 1YUWA 1VQMN 4LFCK 1FJ7A 3NWRA 2WC9A 2WCXA 3KG0A 1IG8A 3ZZRA 4X65F 3R5JB 3POTA 1HI0P 1NGDA 2F4FA 3W7BA 2JHEA 2CDQA 1U2VB 1YZ7A 2W9CA 2R8KA 4FS2A 3U9ZA 2WVDA 3CCJS 2W9AA 2YKOA 3QB0A 4P75A 2WHOA 3D7SB 3UVJA 1V4TA 5KT2A 4DL7A 4IOXA 3R6LB 3ASMA 2HZVA 4UY8O 2HBQB 4KBIA 2QYGA 4NEZA 1NB2A 4P2MA 2OKQA 5DLGA 4IFVB 4H0OA 1U6FA 2HIQA 1M5SA 1M90T 1JKHB 2QKBA 3AV9A 4IR1A 1HWUA 3EDRB 4OYBA 2V2QA 3O8WA 3RRKA 3GG1A 1Z2ZA 3FVYA 2AP6A 3RSEB 2P5GA 3DLEB 5AFUH 4C8MA 4OLOA 4JI3K 3ET6B 4ES3A 2IAJB 3ZZUA 1E6VA 3D7EO 3BQ2A 3BDPA 4MYTA 1VHXA 4QU6A 3OVSA 2UZAA 3HD1A 2B3TB 4MAKA 1GMVA 4F9OA 4DR7F 2MQLA 1S72S 3VF4A 4OPKA 3OPKA 3MEGA 3LP0B 4LSLB 5ETMA 1NG9A 4JI8J 1NHUA 1SJRA 3CO9A 2ITGA 4CO5A 1RT7A 2IM1A 3VQ5A 1T8EA 5DM7L 3ZLJA 1R6YA 3IBFB 5BR8J 3J7AP 4NLGA 4LQ3A 4ECQA 1I3OB 4IFYB 3NLCA 3W9JA 1HL6A 3SUOA 3QJJA 4H4MA 5I3UA 1EXQA 3AD7C 2N4CA