3M8QA

Hiv-1 rt with aminopyrimidine nnrti
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of piperidin-4-yl-aminopyrimidines as HIV-1 reverse transcriptase inhibitors. N-benzyl derivatives with broad potency against resistant mutant viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 151
structure length 554
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3m8qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8qA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8qA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3m8qA05
5KG5A 2VWKA 3KKSA 3LALA 4B08A 2FBTA 2KW4A 3NGIA 2ILYA 2A1SA 2AGPA 3QEWA 4NYZA 3ZSRA 5FROA 1HYSA 4OLBA 4R8UA 1RT6B 2PYLA 1ZYQA 1S6PB 4URQU 3SI8A 1S49A 4XIUA 3JYTA 2G8HA 2QV6A 4HCCA 2JEFA 2XY8A 3VQBA 3KD1E 3EPGA 5CY4A 2GBZA 3LP2A 4Q0BB 3V9SA 3QNOA 4KV8B 1HNIA 2IJNA 4PWDB 3MECA 2QK9A 2C2DA 4FZXC 3HPOA 4ID5A 3BSNA 1WAFA 3ZT3A 1R0AB 3GIIA 4M3ZA 1J54A 3I5AA 3P5JA 2HNZB 1C1CA 2E9ZA 4F8RA 4J9NA 4Y34A 2FBYA 3QZ8A 3VN5A 4BWJA 2WHOA 2XY6A 1JX4A 4EBEA 5KFPA 4CHOA 4RG8A 4FJ9A 2OH2A 4FLTA 4DL4A 4RW8A 1JLFA 1ZBLA 2UVVA 4MH8A 1S1VB 4F4YA 4CHQA 3P83D 2ZD1B 4TYBA 2Z1IA 1BQNB 3AV9A 2ILZA 3DOKA 2W9CB 1B9DA 1LW0B 1G15A 4O44A 5JUMA 1T8EA 5KRTA 2IM0A 4ZHRA 2BRKA 2F8EX 5KFZA 1EX4A 4IH7A 4DTSA 4OKKA 1C0TA 4ZP8A 3T5HA 1TGOA 4CIFA 4JLHA 4WE1A 2HWHA 2JGUA 3K5LA 1U04A 2XY5A 2JEIA 5HLFA 1BI4B 3PR5B 4Y1DA 3CIZA 1LWFB 2R8IA 3D0PA 5T7BA 3K5OA 4R5PA 5KT7A 1IH7A 4R8UB 4DF8A 4CGIA 3OS2A 5KFUA 3MEEA 4RNFA 2FLNA 1Y97A 5DQHA 2BQ3A 2IM1A 3C6UB 4H4MA 1C2PA 4ECXA 1RBVA 4DSFA 5F9NA 3ITHB 3BSCA 4KHSA 4FW2A 4WZQA 4TXSA 2OPRA 2D0BA 3D45A 4FBUA 4K8XA 2FLPA 4F3TA 3AVJA 1ZTTA 2RN2A 1IKYB 3Q8PB 4CHZA 1YTAA 4RW4B 3E01B 1QE1A 5T14A 4FS1A 1XWLA 3AA5X 3M8PA 1T94A 5DGAA 2A1RA 1RILA 3I8DA 2HAIA 3LWLA 3DRPB 1S97A 1WSFA 2FVCA 4M45A 4WYWA 1Z4UA 2OPQA 3O3FA 3KK3A 3K59A 3KLFA 3OS0A 2KFNA 3OLAA 4GC6A 1WSGA 1UWBA 3AO3A 3QO9A 1N56A 2JC0A 2HNDA 4AHVA 4EYHB 4K8ZA 5KFSA 2JLEA 4DL7A 2WOMA 3KLHB 4CHPA 1JLQB 2WRMA 2F96A 1UA1A 5CYQB 5C25B 2BQRA 4RNNA 2W9BB 1JL1A 3OYLA 4O4GB 1DTQA 1S1TA 3QNNA 1ZBUA 4ECRA 4NLPA 3NMAA 3CWJA 3G6YA 3ICLA 1VSMA 5HLFB 2E6MA 1RBTA 3MXMA 2BE2A 4ZVGA 3GYNA 4H4OA 5KFDA 4XPEA 3DLGA 1RTJA 3SNNA 3K57A 4FYDA 4E89A 1XHXA 3QIOA 4W5RA 3QESA 1D9FA 3PV8A 1NK9A 4QW9A 2OZMA 4K50A 3LP1A 4DEZA 1SH3A 3OS1A 5KI6A 4JS5A 1BL3A 4DTNA 4Z0UA 4KTZA 3S9HA 3KD5E 2P1JA 4IKAA 1RT6A 2KTQA 4E7IA 3TI0A 2HMIB 4NYFA 1EP4A 5EWFA 1RT1A 4OL8A 2YNIB 4B9TA 3RAQA 5DMRA 4DS5A 2AX1A 4EO8A 2FLLA 4HKQA 3IS9A 3HKWA 4F2SA 4W5NA 1CSJA 3Q8QB 2GIQA 3ZT1A 4HVJA 4AILC 2XWYA 4FJ5A 4NLGA 3VQSA 2OPPA 1B92A 4TYAA 5L9XA 1FKOB 3KKRA 4Q5VA 1C0UB 4J2BA 3JYTB 2W9BA 4PQUB 3E51A 4M3XA 4Q45A 3WNEA 3OYAA 3HXMA 3KHGA 2JC1A 3KLIB 3F73A 4ECSA 3F9KA 4C8KA 1OS5A 3BQ1A 4EBCA 5K14B 5SZTA 1JLQA 2FJVA 2XO7A 4CEOA 4DU4A 3SPZA 2ASLA 3G0ZA 3SV3A 3MEDB 3S3OA 1RTHB 5J2MB 3N6LA 4JRPA 4F2RA 3AVFA 1RTDB 3G10A 3LPTA 3RBEA 2W8LA 4NYNA 4ELUA 3AVAA 2Y1JA 3NFAA 2HHUA 4IG3A 4N41A 3FSIA 3H98A 4DFKA 3FQKA 3SI6A 4TLRA 3BR9A 4FK2A 1X1PA 2G8UA 1U47A 1QS4A 2WK4A 4NRUA 1X9SA 1NJZA 3CFRA 2O4GA 2YNFA 1QAIA 3M9OB 5CYMB 3M8QA 4K4YA 2XY7A 4GC7A 3ZT4A 1KFSA 4E19A 1Q9XA 3DMJA 3IRXB 4H8KA 4CGFA 1X9MA 3DLRA 1S6QA 3FRZA 4OKJA 1JLAB 2YNGB 5K14A 1RT3B 4DQIA 3TAPA 2V0NA 4M42A 1SH0A 3BQ2A 3MEGB 4KFBA 1QSSA 3BREA 3B6OA 1JLFB 4N76A 3DRSA 3TANA 2HW3A 4CJKA 5CZ1A 2HHXA 1S9FA 1QUVA 2B4JA 4FBTA 1BHLA 3HL8A 1BCOA 1S9GB 3QEXA 4IG3B 2YV0X 4M3UA 4Q44A 5J1EA 1VRTB 2V9WA 3NAEA 1A5WA 1IKWA 3VQAA 4WE1B 1KFDA 1L3TA 5KT4A 2W9AA 1RTHA 4BE0A 2E9TA 4HTUA 4DSKA 1JKHB 3L2UA 4NLUA 4HCBA 3K58A 4NCGB 1T03A 4NLSA 2ZE2A 4Y2AA 4PUOA 4I2PA 5I42B 4EZ9A 1W9HA 3OYNA 3KK2A 4ED6A 2YNGA 4N47A 2FVPA 3SFGA 1FK9A 1N6QB 2B5JA 2VWJA 3SV4A 1RYSA 1KVAA 4CJUA 4FM1A 4Y1CA 3V4IB 2D3UA 1U48A 2FJXA 3KK3B 2O4IA 2P5GA 4RU9A 5KG7A 3HP6A 4ICLA 3KLVA 1HNIB 1S4FA 4FVMA 4IFVA 5J2MA 2BE2B 4I2QA 4WYLA 1WNSA 4ZP6A 1TL3A 5KFCA 4FS2A 1CXQA 4MK8A 1GOBA 1LWCB 4YNQA 2HNYA 4IOBA 3PZPA 4Q8FA 4O5BA 3KK1B 3AVNA 5KFKA 3QERA 3NHGA 1ITGA 4J9OA 1C6VA 4BWMA 4FJIA 5KFEA 4QOZB 1RT5A 3ULDA 3KOAA 1IKVB 3PX0A 2YNHA 2HNZA 4K4ZA 3OJUA 4EP4A 4E7JA 2HHVA 4K4VA 1IKXA 4DQPA 4CGJA 3H40A 3D28A 3QGGA 5EUHA 4WXWA 3OYIA 1HNVA 3DM2B 3O3GA 2DTUA 3PW0A 3O4NA 4RW8B 3EZ5A 3Q8SB 1JLCA 4K4SA 3KK2B 3NBPA 3NAHA 3T1AA 1RDDA 2FBVA 4E1NA 2D5RA 2D3ZA 1BISA 3V9XA 3EYZA 1JL2A 4ED3A 1QHTA 1TKZB 1ZBHA 2ITGA 2XGQA 3TAFA 3QLHB 3OSPA 4LH4A 4H4OB 4NLOA 3T3FA 3HK2A 1LW2A 1HQUA 2HHTA 4DU3A 1RBUA 3U6FA 4O3OA 2OA8A 4H54A 5HRPA 4LQ3A 4RNHA 4DTXA 2RKIA 1U49A 3CJ2A 1RNHA 4DFMA 3AA4A 3AA2A 3HVWA 4HYKA 4CJSA 1CZBA 4CFDA 3LP3A 4J2EA 3AO1A 1HNVB 5F8HA 2OPSB 4J9MA 3O3HA 4FLWA 5DG8A 3DLKB 4Y2CA 1KVCA 1NK0A 4NLDA 3V4IA 2VG5A 4M3TA 1A5VA 5C42A 3PW7A 1RCHA 2B43A 4KKOA 1A5XA 4CK2A 5KFYA 1TAQA 4KB0A 3BSAA 4CJ4A 3WNHA 4ECUA 3I0RA 4EZ6A 4FLYA 2B6AB 5FRMA 4I9LA 2YHBA 1RT3A 3PW4A 4CF9A 2GV9A 4OGEA 4CF0A 4TSXA 1KLMA 5KFFA 2OPQB 1UWBB 3SPYA 3OVNA 3I0SA 3H4BA 3KLFB 2C2RA 2O5DA 5CYMA 4ECTA 1RT2A 1S1WA 4PWDA 2W7PA 2X6SA 2J6SA 1XR6A 4OJRA 3AVLA 4W5TA 1JLGA 4FCYA 3HVRA 4O3QA 3GQCA 4ECZA 1WN7A 4IDKB 4DTMA 1NK7A 1N4LA 1D1UA 4FK0A 4LSNB 4CJEA 1XI1A 4DF4A 1JLEA 3SUOA 4DWIA 5KFNA 2RKIB 2IDOA 1TVRB 2OYQA 3LANA 1TL1A 3FFIB 1NK6A 3PUFA 5F8JA 3ZT2A 4F4KA 1U09A 2V4QA 4CEZA 1XR5A 5KFRA 3TABA 1R0AA 1C1CB 4B9MA 1IM4A 2XI2A 3K5NA 1NJYA 4Z4EA 1WSEA 5KFVA 3PO5A 4CEBA 4ZVEA 5FDLB 4KHUA 1SV5B 4J9QA 4IR1A 3U3GA 1YTUA 3H4DA 4O3NA 5KGWA 2IA6A 3SCXA 1LWFA 4B3OB 3DYAA 1VSJA 3KLEA 2E6LA 2WONB 4R5PB 3HO1A 2PY5A 1B9FA 3T5LA 2C22A 3V9ZA 3SQ0A 5L1JA 1LWCA 4OGCA 3OYKA 4E7LA 4ZHRB 3B6PA 3VQ7A 3M9MB 1I6JA 3CJ4A 1NHVA 1IKWB 1YVUA 1EETA 4DG1A 3VQ8A 2ZD1A 1D8YA 1BQMA 2AQ4A 1WSJA 3NE6A 2YNHB 4Z4IA 3OHAA 4QAGA 1NNDA 3KHHA 3RRGA 4J9RA 4FZYA 4Q8EA 3KMSA 3RAXA 2R8HA 5D3GA 3NH2A 1U4BA 4GW6A 1ASVA 3AO4A 4LY7A 3ISND 3VQ9A 3DRRB 3UR0A 4RNOA 4CJLA 3QEVA 4BE2A 2AGOA 4Z4FA 1JLBB 5KT2A 5KG6A 5I3UB 2IOCA 3H5UA 3JSMA 4XO0A 4Q43A 4KB7A 1JXLA 5KFTA 1KLMB 4ED8A 1TVRA 1HPZB 4YFUA 2RF2B 5L1KA 4DSIA 1TL1B 3FFIA 1LWEB 3GILA 1REVB 5KG2A 4IRCA 1HMVB 3CJ3A 3NGZA 4CEAA 4ELTA 3NBPB 1VSFA 4B3OA 1TKXA 2ASDA 4DMNA 1FXXA 3KLGB 3LZIA 4DU1A 3RB4A 3UIQA 3T19A 2EC0A 3MTKA 3QO9B 4WXOA 1JLAA 4RW6B 5DG7A 5J2QB 1TV6A 4MFBA 4WFYA 3LPUA 4KPYA 4E7HA 4FJXA 4EP5A 5KFJA 3HPGA 1EKEA 3OJSA 3LDSA 5J2NA 4CERA 3PY8A 2J6UA 4DL2A 3TAEA 4HHTA 4B9VA 1MU2A 1ZBFA 3WNGA 4ED0A 4J2AA 4M41A 1HPZA 2BANB 3HM9A 2G8VA 1IKYA 4FJ8A 1REVA 4IKFA 1SL1A 4KE5A 2BQUA 1LWEA 3KIOA 3SQ4A 1RTJB 4EEYA 2VA3A 2EX3A 4RZRA 4AHUA 3L3VA 1NKCA 3LP0A 2HHSA 1RT1B 4NLXA 3DRRA 3N6NA 3LP2B 4Q0BA 3BGRB 4RW9A 5HBMB 1BIUA 2JEJA 4CCHA 1WAJA 1S0OA 2B6AA 2HNYB 4DSJA 3CM6A 1UOCA 1ASWA 3CO9A 1SUQB 5KFAA 3VQCA 4MFBB 3IS9B 2HWIA 4ZVFA 4QPXA 1KHWA 1S0MA 3C94A 4NLQA 5I3UA 3OYEA 3MEDA 2XCAA 4Z4HA 3MXIA 4YR2A 4CJVA 3KHRA 3QEPA 1EXQA 4J9SA 1MU2B 3QZ7A 2XCPA 1NK8A 4CGGA 4ZPCA 4CF2A 4NLTA 3RTVA 1QSLA 1N5YA 3KK1A 1HMVA 4CGHA 4NRTA 1SH2A 3DYAB 1CZ9A 5KFQA 3VQ5A 4CF1A 2R2RA 1O1WA 3SUQA 4JV0A 4IFVB 5CZ2A 4NZ0A 2Z1JA 2C2EA 2W42A 1LW0A 1DLOB 2D7SA 3V6KA 5KT3A 3ZSXA 2W8KA 1RT7A 1RT4A 1RDCA 3AO2A 4GMJB 3KHLA 3M8RA 5L1LA 4IR9A 1Z26A 3TQ1A 5KTQA 2FBXA 2QKKA 5KG1A 3EPIA 4RW9B 3OL8A 3HSTB 4B8CA 1ASUA 3V1RA 5EWGA 4C8NA 1NK4A 4BDZA 2ETJA 1RTDA 5KFLA 4PA1A 2FC0A 2HNDB 4MK7A 1YVFA 3NF6A 4FJ7A 2E9RX 4RW7B 4FM2A 3ALYA 1VRUA 1T7PA 4OPKA 4KV8A 1SUQA 1TK8A 4WFZA 3CM5A 4CFBA 3TVKA 3V9WA 1NOYA 5KT6A 2IAJB 5KT5A 2G8KA 3NF9A 4FJNA 5F8LA 2I5JB 5KGXA 4JS4A 3I0RB 3ZSQA 2X78A 2IC3B 3QYYA 4B9LA 1QE1B 3BQ0A 4ED2A 4QWEA 3U3YA 3PR4A 3KLHA 4FJKA 1QQCA 5KG4A 4M3RA 4KTWA 4DQQA 3L3UA 2IJFA 3MFHA 4KHMA 3CJ5A 4CEQA 4HUEA 4KBIA 5J2PB 5KFBA 3PX6A 5EWEA 2DFEA 4TY8B 3KLGA 4IQXA 3DLEA 1FKPB 1RTIB 4IG0B 4E0DA 3OL7A 3PW2A 1Q9YA 1WSIA 4PUOB 1S5JA 3CFPA 3OYJA 3H5YA 3L2VA 1C0UA 1JLGB 2Z1HA 4E1MA 1Q8IA 4RUCA 4TY9A 3KTQA 4O4GA 1F21A 2ZKUA 3ASMA 1LAWA 3QGIA 2G8IA 3TAMA 3RR7A 4IFYB 1BI4A 1VRUB 3OYFA 4CE9A 4ICLB 3QGHA 3L8BA 4ZP7A 4DQRA 3AVCA 3DI6B 4CF8A 5J2QA 2BANA 4ZP9A 4Z4CA 2RPIA 4O44B 1KVBA 4ED7A 4G3IA 4KB1A 3QEIA 5EU7A 3BJYA 2XGPA 1S9GA 4YMEA 4CIEA 3KLIA 3M8PB 5F9LA 2P5OA 2ATLA 3RB0A 4M3YA 4R0EA 4LSNA 3K2PA 1C1BB 3CDWA 3MAQA 4B9NA 3KLEB 2BR0A 1QAJA 3QIPB 2XRIA 5J2NB 3M9NB 3A2FA 5KFGA 3DLEB 3OHBA 1NJXA 3TAGA 3V81B 1GOCA 4ECYA 2Z1GA 4O3RA 1TKTA 3GIJA 1I3AA 3KMQA 5KG3A 5F8GA 1RBRA 4ZTJA 3MEEB 2FVRA 3NL0A 3CFOA 1RT5B 4IRDA 2D41A 5F8MA 4ZPBA 1S1XB 4F4WA 1TKZA 4JUZA 3P1GA 3TR8A 4DTUA 3ZSWA 1U45A 1QSYA 2BRLA 3TWHA 1UA0A 3AVBA 4AH9A 3MR6A 4M95A 3DM2A 3FDSA 1L3UA 2OZSA 4BDPA 3C95A 1W0HA 1J5OB 3S3MA 1LW2B 1ZTWA 1EETB 4N56A 1CXUA 3SJJA 2FVQA 5HP1A 2UUTA 3L2WA 3V1QA 3JSMB 2HVHA 1WLJA 4F4ZA 3PO4A 3DLBA 1BGXT 5JS1A 3V6DA 4NLYA 4KSEB 1L3VA 4FLXA 5KG0A 2G8FA 1BIZA 2KZZA 1VSKA 4LSLA 2P51A 4LD0A 2QE5A 1RDRA 1MMLA 1JXBA 4URGA 1D5AA 4ZPAA 5CYQA 4GVMA 3ZCMA 3VA0A 4BACA 3LZJA 3CDUA 3FQLA 3H5SA 1C1BA 1HYSB 4IH5A 2WOMB 1DTQB 4CJ5A 1KSPA 3VQDA 4DG1B 3TAQA 4HUFA 4KRFA 4FJGA 4FZZA 1BQMB 3OYCA 1RYRA 1TKDA 4LH5A 3HVTB 4ECQA 4JV1A 4O4RA 2VG6B 1NOZA 4DL5A 3RMCA 4K4UA 4CJRA 3MECB 5KFXA 1BQNA 4F50A 3KJVA 3PJXA 3T5JA 1KCFA 4W5OA 4YP3A 4O0IA 4DLGA 2LSNA 3O4QA 2D0CA 3RR8A 2UVUA 4X2BA 3OYGA 1IG9A 4YR3A 2YKNB 3OYMA 4KHYA 4U7CA 3LP1B 2IM2A 3G6VA 2IBKA 2IAJA 4CHNA 1YT3A 3V6DB 3I5BA 2VA2A 1S1XA 1XC9A 3MXJA 3I0SB 4NCAA 3V81A 1TV6B 4CFCA 1SL2A 4Z4GA 4OKEA 4CJ3A 1NKBA 2ATQA 1IO2A 2DPIA 3HYFA 4NCBA 2AX0A 2CJQA 3V9UA 3OL6A 1D0EA 4IDKA 2R2TA 4K4TA 1JKHA 3QETA 3BGRA 2AJQA 1VSIA 1JXEA 3GIMA 1I39A 3AVHA 2OPPB 5HBMA 2BGGA 1ZETA 4I2QB 4EYIB 4EBDA 3RMAA 1HYZA 5EDWA 2HHQA 4J9KA 4G1QA 5L1IA 3GV7B 3C6UA 4H4MB 2R2UA 3K5MA 3G6XA 4B9SA 2DY4A 2AGQA 3N6MA 1NJWA 3SUPA 4RUAA 4NLWA 4QWBA 1UAXA 4CECA 3DOLA 3DRPA 3DRSB 4O55A 1NHUA 4RW4A 3AVKA 4KO0B 2IM3A 3RMBA 1FKPA 1RTIA 4IG0A 2KQ2A 4PQUA 1QTMA 2CKWA 5SWMA 3LWMA 3SYZA 2RDIA 1HJRA 4DFJA 3L2QA 5FDLA 2R8GA 3KJVB 4WFXA 2F8TA 1BCMA 3SFUA 5KFOA 4FJMA 4FM0A 2R8JA 5JS2A 4KHQA 1ZBIA 1W25A 1GOAA 2GUIA 4ED1A 2DFFA 3V6JA 4DL6A 2HMIA 3LAMA 4J9PA 4ELVA 2E4LA 1S1TB 4I7FA 2YHAA 2V4RA 5D3GB 1JLCB 1N5YB 1K6YA 3IAYA 4DS4A 4FLZA 4PY5A 3AVMA 3QIDA 4ZVHA 4F4XA 5JXSA 4AHCA 2JEGA 2DFHA 3GV5B 2IMWP 4E7KA 1JLBA 3IN5A 2QXFA 1TKTB 4K4WA 1DLOA 4LQ9A 4TQRA 3MFIA 4ECWA 3CJ0A 5HRSA 3L2RA 2G8WA 4W5QA 3SQ1A 3H2LA 3NAIA 3BDPA 3SUNA 1FK9B 1N6QA 3ZSYA 4QWAA 4B8AB 3DDKA 2HB5A 1C0MA 5HROA 3UDLA 2NUBA 3NF7A 4MKBA 4MIBA 5KFWA 3QIPA 4DTJA 1JLEB 4UQGA 1VSHA 1JIHA 3NGYA 1RDBA 4FJJA 3DOLB 4KO0A 4CGDA 5C42B 4OPJA 4KREA 4NCGA 1TL3B 1IKXB 4CEEA 2VG7A 2ASJA 4ID5B 3OYHA 1C0TB 3NKYA 3V6HA 4RW6A 1J5OA 3DLGB 1TAUA 5DLGA 5DLFA 4CEFA 4YR0A 2XHBA 2R7YA 4Y3CA 2B5JB 2YNFB 4ID1A 1HQEA 1S1UA 2YKMA 3ZSZA 4RNMA 1TKXB 1L3SA 2IC3A 4QW8A 3M8SA 1GX6A 1S48A 4L8RB 4CEDA 2WONA 4O3PA 4ZTFA 4KAIA 1SKRA 3CVKA 1RT2B 1S1WB 4O3SA 5F8NA 4O0JA 1XHZA 4AHRA 4CJWA 3IG1B 1Z25A 3LP0B 4TY8A 2X74A 5FRNA 4DSEA 4IFYA 3M8QB 1N48A 2X6NA 5C24A 2EHGA 3H5XA 4FLVA 3RBDA 1WSHA 4IRKA 3D5MA 3E01A 1KRPA 3NGDA 1S6PA 2Y1IA 4IH6A 4J2DA 2YKNA 4KAZA 1XR7A 4OLAA 2J6TA 5C25A 1KTQA 3ZSOA 2XC9A 3T5KA 4DQSA 3S3NA 2KZMA 1S9EA 3VQ4A 1J53A 1S0NA 4URSA 4YQWA 1HARA 3RB3A 5E41A 3QLHA 3AA3A 1RA7A 1VSEA 3PHEA 2R2SA 3DLHA 4F3OA 3GV8B 4BE1A 4KI6A 2UVRA 2VG7B 2Q3SA 3AO5A 3BSOA 4DFPA 1VSLA 4I9QA 3PW5A 4WZMA 3ZT0A 3CDEA 3SQ2A 3VQPA 1GX5A 1HQEB 2YKMB 3MEGA 1TK5A 5KRSA 4E3SA 4QCLA 1RDAA 3RWUA 4KHWA 3HJFA 4HUGA 4DL3A 3RB6A 4JV2A 5HRRA 4FJHA 1S1UB 5C24B 4IBNA 3VQEA 2RF2A 3OL9A 3CG7A 2IGIA 3OY9A 4M3WA 3DMJB 4CK3A 1RAJA 4DTOA 5HRNA 3HT3A 3IG1A 1EP4B 3Q8RB 3TARA 2YNIA 3H08A 2WCXA 2ALZA 2XI3A 3OYDA 2F8SA 2I1RA 3UQSA 2C28A 4U6PA 3NH0A 1L5UA 1WNEA 1KLNA 4LSLB 1RT7B 4QWDA 2GIRA 4RW7A 1S10A 4DSLA 4CJFA 3C6TA 3QINA 4ZPDA 4C8MA 3DLKA 5HP1B 1LAVA 4JRQA 4AHSA 3HVTA 3UPFA 4BDYA 1IKVA 2WB4A 4NLVA 2HVIA 4FW1A 1KHVA 2W7OA 3DOKB 2W9CA 2PZSA 3OYBA 3OSNA 3V1OA 2I5JA 1RA6A 3MR3A 2PYJA 4I7FB 3AVGA 1FKOA 4CK1A 3VQ6A 2FVSA 1DTTB 4MK9A 1SV5A 2RDJA 3NCIA 1SKSA 3CYMA 4CJPA 4TQSA 3RMDA 5J2PA 4ECVA 3MR5A 3I5CA 4KHRA 3VQQA 2R8KA 3GIKA 3SZ2A 5C5JA 2UUWA 4C8OA 1T05B 1X9WA 1D9DA 3LAKA 4CFAA 2BDPA 4CHYA 1NK5A 2UVWA 4MKAA 5HROB 3H59A 2QKBA 3PJWA 5KFMA 2KFZA 3RRHA 3EZUA 3HVAA 5DG9A 3G86A 3IGVA 4FJLA 2D0AA 2OPRB 3NF8A 3DI6A 3ISNC 1T3NA 4B9UA 1HQUB 4OVLA 1S6QB 5KFHA 4M94A 3C6TB 3IRXA 1VK0A 2WTFA 1VSDA 5J1EB 1HYVA 1C1AA 1DTTA 3CQ8A 3NDKA 1NKEA 3MF5A 5F8IA 3NH1A 1TK0A 4KI4A 4DTPA 3THVA 1J9AA 3PVXA 1RBSA 3KNAA 3HP9A 3ZSVA 4KTQA 4QWCA 4KKOB 1T03B 4K4XA 3PX4A 2ZQBA 5DQGA 5DK5A 1T05A 3HHKA 2AU0A 4KHNA 4MIAA 4G1QB 2HHWA 4AHTA 3WNFA 2OPSA 1TP7A 1SKWA 5KFIA 4FXDA 1VRTA 4FK4A 2GC8A 1LV5A 1S9EB 3TAMB 1S1VA 4KFBB 1K1QA 4I2PB 5I42A 4MQ3A 2DPJA 1K1SA 3MR2A 4DLEA 3HPHA 3VA3A 4CESA 3EY1A 5DGBA 2ZE2B 1SL0A 4DTRA 4J9LA 1RT4B 3OLBA 4CJQA 2FJWA 3AVIA 3ITHA 4TN2A 3IGNA 4CJTA 2IS3A 2VG5B 4FLUA 1CLQA 4ZMMA 5DQIA 2AWZA 4XPCA 1TQLA 4C8LA 4EO6A 2VG6A 4N5SA 4NLRA 1HRHA 4CIGA
chains in the Genus database with same CATH superfamily
4PG8A 5KG5A 4H5WA 4F3QA 1OH6A 2UXCJ 1GLAG 1AB8A 1HYSA 4R8UA 4LC9B 1S6PB 1GH8A 1HI1A 2B9XA 2QWRA 3CW2C 2O8CB 5LXRA 3VZHA 5M1FA 1FWLA 3N4QA 3EPGA 2FZGB 3LP2A 3QNOA 2O8FB 2OTLS 4K25A 2O66A 4BRFA 2GAGC 1HNIA 2QK9A 2WAQD 1BDGA 3HPOA 3ZT3A 1FJEB 3P5JA 1YLXA 3FBFA 4BCAA 1D3WA 2XB2D 2P9IB 2BKNA 1HBUA 2WHOA 4Q2LA 1JX4A 1U6ZA 4BR5A 5FPDA 3WXIA 2IRUA 1MSWD 4RG8A 2OH2A 2CJAA 4RW8A 2Y8YA 4RLEA 4H0YB 1S1VB 4CHQA 4TYBA 1BQNB 3AV9A 2ILZA 2W9CB 1NM2A 2FGCA 1LW0B 4PPDA 5JUMA 2G2YA 4BRNA 3R8YA 4KH6A 4YOVA 4DTSA 1XNRF 4HH0A 1TGOA 4PHTX 4WE1A 1CC8A 2HWHA 1RAEB 2JGUA 2XY5A 1QTNB 1U1LA 3TTCA 2CJKA 1EO1A 3QFWA 1YI2N 1SQFA 4LFCF 4JHDA 3L4IA 3A1YG 1JK9B 3H3NO 3US5A 4R5PA 4NEZA 4ZPWR 2Z2LA 2NXUA 4DF8A 1WUAA 4KIAA 2FD2A 5DQHA 2XYPB 1D09B 2UUBJ 3R1XA 4I67A 3NXZA 1C2PA 3ITHB 4ISFA 1WI6A 4FW2A 2DKOB 2JX2A 3DU6A 3PJ9A 4K8XA 2FLPA 1HHTP 2RN2A 1IKYB 3Q8PB 4CHZA 3W61A 1YTAA 2VB6A 4Z7YA 4RW4B 1QE1A 5T14A 2JFDA 5CYJA 1XWLA 5JMNA 3AA5X 5DGAA 2A1RA 2DTJA 4IWVA 1GXUA 1H7WA 3I56S 2W25A 3LWLA 3N5BA 1U8SA 2U1AA 2MQQA 1VBZA 4KH4A 1YKWA 1WSFA 4HHJA 1FRJA 3HFKA 2IVYA 4P74A 4WYWA 4M45A 1U2RA 2OPQA 2VFRA 3MPDA 1FDBA 4NI2B 3FMBA 2F4VK 2XBPA 2HGLA 1N56A 5CCMA 5AE3A 5KFSA 5D0EA 1JMTA 3KLHB 4CHPA 4JI1K 1UA1A 1VMBA 5CYQB 2ADBA 2BQRA 4RNNA 1FFSB 1JL1A 3R1LA 2GAHC 2GJIA 4AQYJ 3VPZA 3QNNA 1KNZA 3CMQA 1RWOB 4ECRA 4DV3J 4F04B 5IZHA 2MKYA 4Y2MA 4BC4A 1RBTA 2BE2A 3EVOA 2VL1A 2MGZA 3DLGA 2LEAA 4J8FA 4DPUA 3K57A 4FYDA 1HD0A 3EE3A 2HEKA 4E89A 1XHXA 4LF4J 3EZOA 4HL9A 4X4SA 4QW9A 4B3TF 4OYPA 4DEZA 1H1VA 1KDNA 2VONA 1Z1ZA 1ZM3A 2OAUA 1BL3A 3U27A 1YHQN 2HQFA 3DHWC 1TL4A 3KD5E 2P1JA 2V7YA 3FLCO 1PJ5A 4KJIA 3TI0A 2HMIB 2ROPA 2EG1A 2PIIA 5EN1A 2J7WA 3MM6B 2AX1A 1G2EA 5EGYA 2B9YA 2FLLA 3OTCA 1OY8A 5JVGQ 3Q8VA 3PG9A 3HKWA 1CSJA 1IBLF 2R4FA 2J76E 1WEYA 1BUXA 5IT4A 3ZT1A 4AILC 5AQXA 4DR5J 1FKOB 1K73O 3KKRA 2WVDA 4J2BA 3RSEA 2W9BA 4PQUB 2BOAA 4WU3A 4M3XA 4HDHA 4Q45A 3WNEA 3HXMA 2JC1A 4ECSA 1UJ5A 3BQ1A 1U0HB 3A8KA 5SZTA 2HKEA 1N34F 3G0ZA 3MEDB 8AT1B 3S3OA 1VQ7S 1T95A 3C2PA 3N6LA 1SQEA 4G1IA 1HR0K 4OYBA 4P71A 3DGVA 1WOPA 2QM1A 5LJWA 3V4MA 2LU1A 2P9SB 3T1HF 1TFWA 3CC7N 1UWAA 3FSIA 3G6EN 5HN0A 1IM6A 3SI6A 4GKKF 2B7CB 2GHVC 3EXYA 2M5YA 2A2CA 3MGJA 2C3PA 4AL5A 2D1KA 4NRUA 3BS9A 3POTA 4BR7A 3FKBA 3VETA 2CJYB 4IUFA 4EIAA 4PWWA 3ULEA 5CYMB 3I87A 4GC7A 1EIYB 3QRRA 1W26A 1TUWA 1XJWB 2YY3A 3T6JA 1Q9XA 1KQFB 5BXIA 1QVFR 4AFFA 4CGFA 1IBMJ 3NLCA 2VD3A 3IWXA 4P73A 4AD6A 1X4BA 2V0NA 1VQPN 1DAXA 1HBMA 3AHPA 5IQ6A 1QSSA 4OO1J 1TUVA 1VC6A 1EHWA 1KN6A 3DRSA 1PJ6A 2HW3A 5B0BA 3M6GA 1QUVA 1YSJA 2BJDA 3RAMA 2XM3A 4FO0A 3QEXA 3H20A 2F40A 1QQNA 1VRTB 3CJRA 3CCJS 3ADAC 1U0SA 3T1HK 3OVAA 4NYOA 2VBZA 5A2QO 3D0HE 4FVCA 2W9AA 3ZNJ1 2W2OP 2AP1A 4NLUA 4NLSA 4Y2AA 5IWAJ 1PSDA 1RKJA 1N34K 1NDCA 4KGZB 2CGKA 4MIWA 3OTDA 2QIFA 3KK2A 3NGTA 2YNGA 4H0OA 4N47A 3CT9A 3SFGA 2OKQA 3R3LA 1FK9A 2VWJA 1RABB 2XYGB 4LF6J 2D3UA 3K2YA 1YJWS 1WBBA 3MURP 4JI7F 1HNIB 5J2MA 4GKKK 2WBMA 4BC7A 4XH4A 3I96A 4FS2A 4MK8A 4DR3J 2AZ3A 3Q22A 4WFBQ 4FOIA 1KQKA 1SC6A 3KK1B 1N32J 3QERA 1YX2A 3NHGA 1X4CA 2QLXA 3NY0A 5AQNA 4FJIA 4QOZB 1S59A 1DZ5A 1H0HB 2YNHA 5LMNF 3THTA 4EP4A 2HHVA 4K4VA 1IKXA 1RAIB 4S0MA 3H7HB 3QGGA 4CD1A 3G82A 3DM2B 4IJNA 2IA0A 3EZ5A 3Q8SB 4J9VA 1JLCA 2KYZA 5HSPA 4C6AA 4J91A 1KR4A 1RDDA 2FBVA 1SAZA 2R9LA 1F9HA 2D5RA 2D3ZA 3EYZA 4AL7A 1J5EK 5DDOC 2D0PA 3ILLA 3QLHB 1XIQA 4LH4A 3R97A 2D74B 3MMAA 4H4OB 4NLOA 1HQUA 1H74A 4JI3K 4LMZA 1PAUB 2HOEA 2OA8A 3TO8A 4UY85 4H54A 4LQ3A 2EEYA 1NMDA 4M63C 3O1LA 1RISA 2MXYA 4DFMA 1O51A 4CZIA 2QXLA 2MMYA 5KOWA 3VERA 4DR3K 5BYRA 4B3SJ 3AO1A 2BJ7A 1YGYA 2YBVA 5F8HA 1YJNN 2MZJA 3IR6B 4L72B 2WSFC 1MNEA 4JKBA 1KVCA 4GKJJ 5F1XA 5HMWA 1JXVA 5H9EK 3V4IA 4DV1K 2VG5A 2P9EA 3CCQN 2IVNA 3UDEA 4NLBA 4CK2A 2HF3A 5KFYA 1TAQA 3D9BA 3BSAA 4GRSA 4YN3B 3N79A 4EZ6A 3TU5A 2H3GX 1C4CA 2AT1B 3PW4A 1GTEA 3IUCA 3CCZA 3CJ1A 4CF0A 1GAOA 4NB4A 4I64A 1IBLK 1RHJB 1UWBB 1DBDA 2AJ0A 3I0SA 4QIEA 4AL6A 4B3SF 4IFEA 1NGEA 4PG4A 1BWVA 4PWDA 2F9WA 2W7PA 5AQOA 3SSSA 3NWGA 4ILLA 3VV2B 3AVLA 5A8RA 4ECZA 4QS9A 1LK5A 4IDKB 1YG0A 3EZWA 2XNRA 1AROP 3LL3A 1XI1A 1JLEA 1R3NA 5KFNA 1MWMA 1FWKA 1R8AA 1TVRB 1NDPA 2VFTA 5ADXA 3PUFA 1FJGF 5KQ8A 1U09A 3CJCA 5KFRA 3TABA 5HAOA 4L73A 1IM4A 2B7BB 3TZWA 1IBKF 4CNYA 3MN7A 1XMQK 4Z4EA 3NOGA 3DNCA 5KFVA 3PO5A 4ZVEA 2QL7B 2ZGYA 5FDLB 1SV5B 3U3GA 3H4DA 3W2WB 3D1HA 4O3NA 5KGWA 1YDLA 2LA4A 1LWFA 4B3OB 1VSJA 3ZC4A 3KLEA 2WONB 2ZH5A 3FBCA 3CF5Q 5AQLA 4JI2J 1KQSR 1FXRA 4X64J 2PY5A 2HYIB 4FWKA 2C22A 1B7YB 4JI1F 5L1JA 4DN9A 4MT1A 4ZVOB 4OGCA 2QLBB 2N82B 4FPBA 2D9PA 1UVMA 1K0TA 4DG1A 4DCOB 3UE2A 2PMZD 2G2ZA 3NE6A 4Z4IA 3M3ZA 1RE1B 1M5VC 2OO4A 4DR3F 1VLYA 1VQ8N 3RRGA 3P5TL 4FZYA 4Q8EA 4CP5A 3PHTA 1WBDA 5K8PA 5D3GA 3G2XA 3CCRS 4KY3A 4LF6F 3NWRA 1OO0B 3DRRB 2RAQA 5F41A 3UO0A 3QEVA 1GLFO 2R7TA 5KT2A 5KG6A 3JSMA 4XO0A 1V5VA 4Q43A 4WP3A 3GB0A 2A3JA 4IO9L 2O8DA 4ZVSB 1TVRA 1F3VA 1HPZB 5IWAF 4DR4F 2MZSA 4DSIA 1LWEB 3GILA 3GBTA 1REVB 3N4WA 1ZA2B 3CJKA 3NBPB 1VSFA 4HVZA 2JDJA 3R2CJ 4DMNA 2VQEK 1FXXA 3ZEUA 3B8HA 3KLGB 4DU1A 1HL6A 3RB4A 3T19A 1R89A 2Z56B 3MTKA 3IMQJ 2UUAK 2D69A 3KVGA 3LPUA 4E7HA 2M8DB 1O13A 1QZ6A 3HPGA 2E1ZA 5EX0A 4FXVA 2CQBA 5J2NA 2RE1A 3PY8A 3S7RA 5LSRA 1GLCG 4HHTA 4B9VA 1A0OB 1FTRA 4ED0A 5A8WB 1RWXB 1WELA 1N0VC 3S01A 1IKYA 4FJ8A 1SL1A 3WHIA 3KIOA 3AA8A 1QQMA 5T7LA 2EX3A 3L3VA 1V6HA 4M5JA 4NLXA 3DRRA 3FR0A 1UVKA 3EDQB 2V2QA 2QWNA 3T1HJ 1QVGR 4OI3A 2EI5A 3I33A 3U9ZA 4JP8A 1BIUA 2JEJA 1S0OA 2B6AA 3A5MC 3R6GB 4A8YA 5T41A 2XEXA 3CO9A 2NPFA 5KFAA 2LQJA 4MFBB 4ZS6A 1N34J 2QC3A 3J7AN 4GV3A 3OXFA 3IS9B 4QPXA 2IYIA 4DV7J 2RQMA 4A5AA 1HBNB 4ZVTB 5D77A 4WQ4A 1H73A 2FB0A 2IY5B 5A8KB 2YQ0A 2HG4A 3ZX0A 1KC8O 3O9QA 2BUPA 1YI2S 5LL6d 2LQBA 1RADB 4ZPCA 1REGX 4NRTA 3FBBA 5LOQA 2VUGA 3D67A 1O1WA 3SUQA 4JV0A 2N7YA 3HHNB 2M9KA 4NZ0A 2QWLA 3ZFVA 1HNZK 4WQ5A 2VODA 2QX0A 5KPTA 1FX2A 3AO2A 4QR0A 5B7WA 4RL1A 4LF4F 1Z26A 3TQ1A 1EWRA 2FBXA 2QLWA 5E3RA 2A0FB 4RW9B 3CIPA 4OX9J 1DRZA 3ZYYX 3DXMB 1QY7A 4MK7A 3D1OA 1VAZA 4WFZA 3GFZA 4IEIA 2KFYA 2OTJN 2RS8A 2G8KA 1Y5IB 3NF9A 3LA0A 3H2VE 4WP9A 2GW8A 4DV5K 3N28A 4QJVA 4B9LA 4ED2A 3W5XA 3L7UA 4CLPA 2QA4S 4DR6J 4KTWA 3N0VA 3MFHA 3CJ5A 1IBKJ 4X66J 4CBUA 4TY8B 2WW8A 2P9LA 2PE8A 1FJGJ 5H1SV 1C0FA 4XAKA 3VGVA 3ET6B 1C0UA 2Z1HA 2EK6A 1YUWA 2CZ4A 4MJKA 2ZKUA 3QGIA 2G8IA 1UVIA 4NXNJ 3TAMA 4H0XB 3C14B 3D66A 1RFQA 4CE9A 2GVZB 3BO4A 1AA1B 4H03B 3CE8A 3DI6B 2N3OA 5J2QA 2BANA 3OVSA 1KVBA 2RPIA 4ED7A 3QEIA 5IC4B 5JMVA 3BJYA 2XGPA 1VIXA 3W9JA 5F9LA 2P6TA 4KH5A 2P9UB 4R0EA 4B9NA 1QM9A 2B9EA 3KLEB 3C16A 2BR0A 3HOSA 3BF4A 4R25A 3QIPB 2XRIA 3MMVA 1FERA 5TKWA 3A2FA 1N36K 1FA0A 4AE5A 1F5BA 2XS7A 1RHKB 2FQQB 3BP8A 3QQCD 2WVCA 2GQ2A 3LGMA 2Z1GA 1H7XA 4X4QA 3FUYA 1YJRA 3IR5B 1HNWF 5E7OB 3KMQA 5GIPA 1U02A 4UOGA 4PZVA 1VQ7N 2JZ5A 3M2RA 2CPFA 4ZTJA 3UVJB 1U1RA 1HJOA 2HMPA 1JJ2M 3CFOA 4IRDA 2R7RA 1RAHB 2KJVA 5AXNA 4F4WA 2SXLA 3BB5A 5JVHQ 1U45A 3G6ES 3TWHA 1UA0A 2FY1A 4LF9F 1B7FA 1TUYA 3DRYA 1L3UA 3R7NB 3S3MA 2MQNA 1CXUA 1SXLA 3IP0A 4BBYA 3JSRA 4LF2A 3JSMB 4V1Ak 3FZBA 4FXWA 4F4ZA 4M5GA 1FD2A 1WSRA 2JWKA 2UXCF 1P8GA 4NLYA 3D6TB 3DDIA 2G8FA 1F5CA 1VSKA 4LSLA 2ZOMA 4LD0A 2ZITA 1VQPS 1RDRA 3CCUN 1MMLA 5CYQA 4GVMA 5FLXO 5C0YA 3HSJA 2DHHA 4U67L 1OMSA 4DG1B 1KAZA 4KRFA 1K47A 4LIRA 3DFEA 1RYRA 1NOZA 2F3JA 2Y1RI 3R9LA 4K4UA 3MECB 1TMJA 3E8OA 2W01A 4WP8A 3AQOA 1BQNA 1KQGB 4F50A 3UKRB 4NZ6A 3PJXA 2JLFA 2XZWA 4YP3A 2FHJD 4DLGA 5B8HA 2QLJB 4B3RJ 4X2BA 3OYGA 4LF1A 4YR3A 1N32F 2B0GA 2IM2A 3R5GA 3NGKA 4CHNA 1HWKA 3I5BA 2KL8A 5AT1B 3CCWA 1XC9A 4O5FA 4DV1J 1UPPA 3PYGA 3P39A 3I0SB 5HL7Q 2OD6A 4NCAA 1T44A 3V81A 2XWXA 2M0GB 5EXWA 4UOHA 1TV6B 1SL2A 4CFCA 4UUWA 4PXCA 2VASA 2UUBK 1WI8A 3NP5A 1IO2A 5D8HB 2AX0A 2L9WA 1OVQA 3U1LA 4Z94A 1D0EA 4IDKA 3T6BA 2PI5A 3ZZUA 1EKSA 1TZ0A 4K4TA 4LF8K 1T11A 3QETA 1AFJA 1KVJA 4ZLNA 3GIMA 2LA6A 3CULA 2ZF5O 3VOVA 4U7UD 3FEYB 4USKA 4JI8K 3P6YC 5EDWA 4J9KA 3C6UA 1XC3A 1KTVA 4PWUA 2DY4A 3NCPA 5GMKa 3HSGA 1W7WA 2YWGA 5TKYA 3I82A 2IVOA 1I51B 4RKUC 3VGLA 2LP4A 1RP5A 3DRSB 2ZDPA 3CIMA 2BW2A 4DI6A 1UVNA 3GG1A 1V4TA 1YBUA 3LUYA 1QTMA 3CMEN 3VCDA 2H9ZA 5LJVA 3EVMA 2DR9A 2C2MB 2Y3YA 4WFXA 4PKGA 2DGUA 4DV6F 2R8JA 1OWXA 3GJRB 3Q7BA 2W2PP 3DU5A 2W4PA 2CQHA 2WSCC 2DFFA 3LAMA 4LF7F 5K20B 3CNQP 4I7FA 1ELOA 5D3GB 1N5YB 1WF1A 4DS4A 2V8GA 3AVMA 4DB3A 3WEEA 3IFEA 3QIDA 4ZVHA 2P6SA 3RVCA 3BEGB 4PXDA 3WX8A 2JHEA 3GV5B 2DFHA 4ZOSA 3PIPL 4E7KA 1LFWA 4UY8O 2QXFA 3QFPA 1T3OA 2K1RB 4LQ9A 5G0RB 3MFIA 2PSZA 1OH5A 3CJ0A 1M90O 3L2RA 3UW1A 5BPLA 4W5QA 4LVOP 3H2LA 3SXLA 3NAIA 5HANA 3DGPA 1WEZA 2NUBA 2QTWA 3UDLA 4H0TB 4MIBA 4JYAJ 4FKXA 4UQGA 3OTOJ 2EBGA 1RWPB 4P72A 3FRYA 3OTBA 4U95A 1CC7A 1IKXB 1F6TA 2UU9K 2VG7A 1V3ZA 1A7GE 2IBOA 1X9JA 3OYHA 4U67Q 3UKUB 1S7HA 3NKYA 2G0JA 4XK8C 1J5OA 3DLGB 1MMDA 4ZCKA 2YNFB 4H5RA 3ZSZA 1VK8A 2MDAA 2WBRA 5A8WA 1NGFA 5DM6L 3LTOA 4C3MA 3H1QA 4ZTFA 1R6YA 4DV7K 1Q8BA 1RT2B 4B3TJ 1FTCA 4OI0A 1XHZA 4AHRA 1Z25A 2GVZA 4O8KA 2VFVA 2VV5A 2WUSA 3M8QB 4QS7A 5H9FK 3JTPA 3K8WA 1AUSL 4ETXA 3SSQA 4FLVA 3ENHA 3UD4P 3HHLC 1U2FA 2FHJA 2M8HA 3A3OB 1TR0A 3EGNA 2Y1IA 2L48A 4IH6A 3SQGA 4OLAA 2J6TA 3LM2A 5C25A 2ATCB 1UPMB 1KTQA 2XC9A 3DCAA 5BRFA 2OGUA 2PD1A 3GZ7A 4URSA 2YHXA 2ZH2A 4YQWA 1HARA 1OPZA 1WD6A 3QLHA 1ZM2A 2J0WA 4BRPA 1K44A 3W0LA 5BREA 2R2SA 4F3OA 3OFFA 2VG7B 3UDVA 2Q3SA 4K8RA 3BSOA 4HDGA 3ZT0A 3MM7B 2B4UA 3EKSA 3SQ2A 3VQPA 5AQHA 3UCGA 3MEGA 2IJRA 3U02A 4QCLA 4A8SA 1SB6A 1MWQA 1RACB 2V69A 4V19J 2HSEB 4JV2A 5IC6B 2HFUA 3VQEA 2J0SD 1C0GA 2GO8A 3GJTB 4CK3A 5HRNA 3HT3A 4B3MK 3Q8RB 2YNIA 3H08A 1PKUA 4ES1A 5D0RA 2ALZA 1Z2LA 3J7YU 2KHDA 2F9TA 3OYDA 5H9FJ 1LXNA 3E9OA 5ETVA 4QOTA 2N3LA 1KLNA 4LSLB 3MAAB 4QWDA 3CJBA 4K0KK 5B0AA 2DB1A 3DDNA 3DLKA 1RWMB 1IWAA 2CVIA 5GAGP 1AZSB 2F9JA 1TUUA 3VF2A 2W7OA 3W63A 3WT0A 4LFBJ 4ENOA 1Y00A 2CNOB 3W9HA 1RA6A 3BO2A 1HIYA 3L0QA 4CK1A 2J8AA 5E3CA 5CAAA 3C19A 2AYBA 2JH3A 2RDJA 2FJEB 2DEIA 2GVDB 3I5CA 1HNXF 1RAGB 3O44A 4DMZA 2GO9A 3FEZA 3GFHA 5THWA 2UUCK 2YTCA 3VAIA 2UUWA 4Z2XA 1D9DA 4YDUA 2BDPA 4KC5A 4O0NA 2FZCB 2EFQA 3RRHA 4V19S 4FJLA 1U2VA 2CG4A 4OMFG 2OPRB 3DI6A 2H48B 1T3NA 3K17A 1ZM4A 5KFHA 1OYEA 1VK0A 2WTFA 5J1EB 1DTTA 2AKWB 4QIVA 4LFAJ 2HIQA 5F8IA 2E2PA 2L9DA 1TK0A 4UZCA 5IM0A 3THVA 3PVXA 2OEKA 4LF5J 2P9LB 2ZQBA 3A8EA 2KN4A 2F4VJ 4OHXA 5FJ4A 1YXQA 2Z0GA 3UWTA 4KHNA 2RB7A 2Q6CA 1QDUB 3CETA 1N0UA 1SKWA 4FXDA 4DR4K 3D54A 2AF6A 1LV5A 1S9EB 3TAMB 1S3XA 3C15B 4K42A 3RU0A 1YAGA 1FD8A 3ENBA 2XULA 4OX8A 3VEOA 4KFBB 2RILA 3KUEA 1KVIA 3ELHA 3HPHA 3EY1A 2GHPA 5DGBA 4UT4A 4XH1A 1XN9A 1SL0A 3BN4A 3ID8A 4J9LA 1U1MA 5ETLA 3AVIA 2V52B 4EMDA 4CJTA 1MN7A 2CJ9A 3VAMA 4DUZF 2A18A 4C8LA 3A8YA 2VG6A 4NLRA 5K5MA 1M5KC 4I6MA 4ZCIA 3H0PA 3LALA 4B08A 5CHCB 1A6LA 2HBQB 5DZ6A 2KRBA 1RT6B 3Q2SC 3O2IA 1XMQJ 2QI2A 1ZYQA 3SI8A 1EQ0A 2CNKB 2HBJA 2HVEA 3CO0P 2YQ3A 5IV4A 5LM7E 4OPHA 3VQBA 4M63A 1HW9A 4YOWA 1DQ8A 4Q0BB 3V9SA 3PTWA 4CH7A 3C0BA 4KV8B 2IJNA 3MAHA 5F3ZA 4PG5A 2DNNA 3IBFB 3JQMA 1R0AB 3GWCA 2GELA 1JCEA 3I5AA 2HNZB 1C1CA 1R0BG 3AJ2A 4DUYF 4J9NA 2BABA 4DPWA 3VN5A 2XY6A 2Q66A 4EBEA 5KFPA 2BYCA 2XG8A 1OYDA 4FLTA 1H98A 1PO6A 3BGLA 2UVVA 4MH8A 4F4YA 3LF0A 4WBFA 2W2QP 2Z1IA 1SIZA 3DOKA 1B9DA 4USTA 3VF6A 5KRTA 2IRXA 2IM0A 4ZHRA 2BRKA 5LY3A 1YJ9S 2EWSA 4RUBA 1IQZA 3T5HA 2DRBA 5C10A 4CIFA 5L8RC 4JLHA 4H0VB 3IR7B 4U8YA 4OZ3A 2VQFF 2X1AA 2VKRA 5HLFA 2MLXA 1BI4B 3PR5B 2DPNA 5I3PA 1LWFB 2VPXB 2R8IA 5KAKA 4DXLA 5KT7A 3CXCM 1IH7A 5DRKA 2WVEA 2HFVA 4R8UB 4CGIA 5ETSA 3HHEA 3MEEA 1Y97A 2BQ3A 2DR6A 4GKJK 4AYBD 2VH7A 3THPA 3C6UB 2ZNYA 2ZM6K 1M1GA 4PCQA 2OMLA 4LF8J 3AVJA 4J9UE 1MDUB 3TJAA 1U26A 3E01B 1S57A 4OYAA 4X84A 1P27B 3BZQA 3M8PA 3ZO7A 1T94A 3OHRA 1VJQA 1RILA 2Q3PA 3I8DA 3DRPB 3WX4A 5ETQA 3G96A 1ZC6A 2LECA 4CBWA 2OLWA 4QS8A 2FVCA 1NHKL 1LWXA 5JLFA 2XZTB 3E1YA 3KLFA 3ZTRA 2DK2A 3OLAA 4RPFA 4LIWA 2JC0A 1X4DA 5D0GA 4EYHB 4AHVA 2WOMA 3VVUA 2CDQA 1N8RT 2VBYA 4CO2A 1RSCA 2P9NB 1JLQB 1CS4B 5C25B 3OTOK 5AZIB 4BRMA 1IR0A 4OHYA 4U8VA 2I6WA 3NMAA 3UI3A 3CWJA 3G6YA 5GAEU 3ICLA 5HLFB 3KNGA 4ZVGA 4K2JA 2V4JB 5KOXA 1VHIA 2CWXA 3SNNA 1V5IB 1YTYA 5E3QA 4W5RA 1U0HA 2OZMA 3TEHB 2VFSA 5LMNK 5KI6A 4MYUA 2AYGA 1JJCB 3GSIA 3S9HA 2G13A 1W97L 4IKAA 3EWGA 3HX9A 4FWPA 4E7IA 2CPHA 1RT1A 4OL8A 4NYPA 2YNIB 5DMRA 1YIJS 3K9KA 4EO8A 4C1NK 3C46A 4FVUA 3N4PA 3Q8QB 2GIQA 4LFCK 3A13A 2XWYA 4FJ5A 4NLGA 2OPPA 4TYAA 4Q5VA 1HKCA 1GEHA 3JYTB 2GV1A 4CLZA 2P9NA 4CBXA 3OYAA 3KHGA 4LFBK 4C8KA 1JLQA 2FJVA 1GFWB 2XO7A 5L46A 3SPZA 3SV3A 2J9EA 2QW9A 4JRPA 2EC2A 1G4CA 1RTDB 3LPTA 3RBEA 2W8LA 4ELUA 3AVAA 3BY5A 4LF7K 3M4XA 4IG3A 1CJUB 4N41A 2KU7A 4C97A 4A59A 3THXA 3FQKA 4WKRA 3SJHA 1XMOJ 1X1PA 5HJXA 4IOAL 2WK4A 1NU4A 1NJZA 3EX7B 3TUJC 2UUAJ 2NZ4A 2CRLA 3CFRA 2YNFA 2J4RA 3SMZA 4FWSA 4ANCA 4RTFD 3O1BA 5AXMA 3ZT4A 3M6XA 2KKHA 1KFSA 4CZJA 5U47A 3G25A 1QLNA 1X9MA 1S6QA 3FRZA 4DR6K 4OKJA 3W66A 1JLAB 2YNGB 3CJ9A 3T1YJ 4USIA 2MQ8A 1RT3B 1XMOF 1NH8A 1K8KA 1LQ9A 3BYRA 1TMMA 3MEGB 4KFBA 2MQOA 3B6OA 2DNRA 4CRJA 1BWEA 5CZ1A 2B4JA 4FBTA 3J81j 2X3GA 1BCOA 4C98A 4M3UA 2YV0X 4OFZA 3VGSA 4Q44A 2XLIA 5J1EA 3NAEA 3GU0A 3QDKA 2Z8QA 1IKWA 2ZHBA 4WE1B 2XZDB 3OPKA 2YVSA 1B4SA 1W2IA 4DBQA 4BE0A 4HTUA 2W6KA 4NCGB 2ZE2A 1HKGA 4PUOA 4I2PA 4PL8A 1W9HA 2QSWA 2DO0A 2YH0A 3OTEA 4XDDA 3KDNA 4JI5F 1N6QB 2B5JA 4CJUA 1U48A 6FDRA 2FJXA 3QBWA 2QN6B 4ICLA 3KLVA 2W1BA 2BA9A 1S4FA 4FVMA 2BE2B 3RG6A 5LSLA 4WYLA 1WNSA 4ZP6A 2RT3A 4P7TA 1NXIA 1GOBA 4CYUA 3AB4B 3CD6N 1FNMA 3OR1B 1VQLS 3PZPA 1I94K 2Q97A 1IUJA 4PEOA 2ZH4A 4J9OA 3EMTA 4A8QA 3W5YA 3KOAA 3PX0A 1SJQA 3B4DA 5GMEA 1PBUA 4E7JA 1WC6A 3VALA 2MZTA 2HLTA 4G65A 1X3MA 1IJJA 4LFAK 1VQ6S 3D28A 5EUHA 3OYIA 1HNVA 2OHDA 3O3GA 3MDFA 3PW0A 5IFMA 4CD3A 2VQFK 3NBPA 1FKAF 3T1AA 3O5TB 4UY8T 4ER8A 1BISA 2CQ0A 1T9TA 2I8EA 3V9XA 3RUBL 3SCIE 1VQ5S 2VYPA 4ED3A 3VAGA 1TKZB 1VIOA 1ZBHA 1M1KO 2ITGA 2XGQA 3KDOA 4DR2K 1Q8LA 3PCOB 3GFXA 3C6AA 2KXHA 4ILJA 1BOTO 2W2MP 1LW2A 4ANEA 2HHTA 1OQ3A 1HPMA 1RBUA 3U6FA 5AQPA 5HRPA 1S6UA 1KOHA 1PBAA 2X1GA 5AQSA 1F60B 1RNHA 2I7NA 2KM8C 3HVWA 1YITN 1WSVA 1EJ7L 2DBBA 2A42A 5HK4A 3FCHA 1CZBA 4H4KC 3LP3A 4J2EA 4LRBA 1ILYA 5AZJA 3HT0A 3PM9A 2UXDF 5G4DA 3SBMA 2E5LJ 2WBNA 4FLWA 5DG8A 3D7SB 2E7WA 2KDOA 2Q2RA 4TVAB 4M3TA 1VI7A 1A5VA 2AA4A 5C42A 1RCHA 4L3KA 4K59A 3GOIA 4JI4F 3ULEB 4KB0A 8RUCA 4ECUA 3J80Y 4X64K 4FLYA 2B6AB 5A2QU 2C2KB 1ATNA 1X5TA 1ZOTA 3HJVA 1E6VB 1FWPA 4CF9A 2QO3A 4EI2A 2WZ1A 2GV9A 4C23A 1VQON 4OYIA 4TSXA 3O9TA 1KLMA 2JWLA 3H4BA 3MM9A 3TNVA 4ECTA 1S1WA 4YB5A 4KH0B 1XR6A 4OJRA 1JLGA 2MHNA 3HVRA 1WN7A 5C12A 1QUPA 1FDAA 4DTMA 3G71S 1N4LA 4FK0A 3TZYA 2VHGA 4F25A 3C6HA 4DF4A 3SUOA 4ATNA 3ZTSA 4USJC 3BGOP 2RS2A 2IDOA 3DXSX 5RUBA 2ZH3A 3FFIB 1NK6A 1F9EB 1P90A 5A76A 4B1ZA 5F8JA 3ZT2A 4CEZA 4B9MA 4LF4K 1R0AA 1C1CB 4KYZA 2ZZNA 2V7ZA 3SBGA 4USWA 2MQLA 4JKHA 3K5NA 4L3NA 1WSEA 2QMWA 1CQNA 4KHUA 1YTUA 2AV5A 2IA6A 3DYAA 2E6LA 4M5LA 1MWYA 1YRUA 4DL0C 1GQEA 2XMMA 1NGJA 4QBUA 1FT8A 1B9FA 1S6OA 1HBOA 4F4AA 2G0CA 3H3OB 4OZ5A 4DUZJ 3OYKA 4E7LA 4ZHRB 2E44A 1UMJA 4C4WA 3M9MB 2CNLB 1I6JA 3CJ4A 3V2UC 1YVUA 2IIRA 1ACMB 2V9KA 3R27A 3O6WA 3GLJA 2ZD1A 1D8YA 4JI0K 2YNHB 3GCXP 3OHAA 3ZEUB 1QAXA 3K0SA 2ACMA 4OX9K 5L38A 2MSTA 3HZGA 4J9RA 2Q0RA 4BG9A 2MKCA 4OX6A 3F9MA 5E3AA 2R8HA 3PXGa 3NH2A 4LY7A 3VQ9A 3UR0A 4RNOA 5KQDA 1RKIA 2EWHA 4B9QA 2YKQA 4Z4FA 5I3UB 3KWIA 4JKFA 2ZBPA 1BHNA 4L76A 5KFTA 2K7KA 1UL3A 3SDEB 3M1FA 1M1HA 3CXCR 3FFIA 2H5IB 7FDRA 3FZKA 1NWKA 4KPCA 2ROGA 3AAWB 3C7NB 4CEAA 4ELTA 3J80U 4CO4A 4B3OA 1PGZA 3FZLA 3PRBA 2VPYB 4A8KA 3UIQA 2EC0A 1Y11A 3GJSB 1K9MO 5AQZA 2COLA 3M2VA 4WXOA 2CJXB 2PMHA 2AYMA 4YB1P 3PIPQ 3I56N 5DG7A 5J2QB 1VQNS 5DDQC 4KPYA 1HKAA 1WG5A 5BRDA 2WFBA 4BRAA 4FJXA 2B8PA 4C11A 1EKEA 3C16B 4X4NA 4LRDA 3A8IA 4JI0J 3BN7A 1RLCL 4ZITA 1WF2A 2V8DA 2BJ3A 1MU2A 2HHHF 1H2TZ 4JN4A 2C2ZB 1N5SA 4KE5A 3M2RB 3ILIA 3K5PA 3W8GA 1P6TA 2BH1A 2CQIA 2V8PA 2GCFA 3GR1A 3MMBB 2KHOA 3LP2B 2O8FA 1TELA 3G8QA 3LPEA 2V2VA 2E29A 2ZH1A 3HTVA 2N7CA 3L4BC 1DKGD 1SUQB 4OYWA 2W6LA 4JKGB 3VQCA 4N8OA 3VAHA 1OVYA 4BY9C 2HWIA 4MLHA 4BC5A 2HZVA 4OYZA 3CI5A 4C8YA 1KHWA 5MAOA 2X1FA 1Q86O 4Z7CA 4NLQA 3HZ6A 3OYEA 4Z4HA 3MXIA 4YR2A 4HTJA 2FHKA 4HWIA 4X65K 5AQWA 2XCPA 1NK8A 4HT5A 3M2UB 4B1WB 4CF2A 4NLTA 3KK1A 1HMVA 2X7IA 2KVQE 1SH2A 4C0OC 2HBMA 4OZ2A 3VQ5A 5KFQA 3D2FB 4CF1A 3BGFA 4Y0FA 4UOCA 5B0EA 5IXUA 1B0VA 5CZ2A 2Z1JA 4USUA 1NAQA 1DLOB 2RRAA 2V51B 1WHYA 3VVTA 2IDEA 2J7KA 2W8KA 3N01A 2XSJB 5AQMA 3MOZA 5M1QA 2QKKA 2UU9J 2HRTA 3TZZA 3R6LB 3EPIA 2ASOA 3L4QA 3HSTB 4B8CA 2G1DA 4B1VA 4ZPTR 4C8NA 4FDFA 4BDZA 3L95X 4PA1A 2IYGA 1GK8A 2HNDB 3DAWA 4NXMJ 1T7PA 3ALYA 2CQ3A 5CD4A 4OPKA 1SUQA 4C48A 1MW7A 3CM5A 4CFBA 3V9WA 1NOYA 1NDKA 3MN6A 2IAJB 5KT5A 4FYYB 5F8LA 2I5JB 3ZSQA 5EX5A 4B3TK 5DM7Q 3H45C 2IC3B 1G99A 2W40A 4QWEA 4JEPA 4WCEL 3GE1A 3KLHA 1QQCA 1KQSM 3MM8B 2IJFA 4HUEA 4KBIA 5AQTA 2H1YA 2BV3A 4DV2F 1N36F 3KLGA 2OEJA 1Z2ZA 3R5CA 3OL7A 3PW2A 2C3YA 3OFHA 1WSIA 4PUOB 3H5YA 1JLGB 1HLUA 4DCHA 3KTQA 4O4GA 4X4OA 3ZZ0A 5B08A 5BR9A 2CFXA 9ATCB 1X4FA 3TSPA 1S7IA 1VRUB 2W2NP 2CGLA 3OYFA 2MHEA 4ICLB 3VENA 1WKLA 3AVCA 2FGOA 2I0XA 2XMAA 4P7VA 2YJEA 3OQ2A 2X3DA 4KB1A 4G3IA 1ITPA 4TU7A 3OTOF 5FPMA 4CIEA 1FHTA 4ZVUB 3M8PB 2CDRB 2UXBF 1GMUA 3IFRA 2J7UA 1YJWN 3UN2A 2HRUA 4M3YA 2ACYA 2KT3A 4LSNA 1C1BB 1SS6A 3CDWA 3MAQA 2Y0BB 1I3OB 1FJ7A 1ATRA 2G4BA 5KFGA 3DLEB 3CCMS 3OHBA 1N8RO 2FUG9 1GOCA 2M88A 2K1RA 5I4MA 4X65F 2H51B 5KG3A 1EQYA 1RBRA 3MEEB 3MM8A 2FVRA 3LO3A 4C0HA 3W8PA 1RT5B 2Q0UA 3MWPA 2D41A 5F8MA 1B0PA 1S1XB 3CGIA 3RZAA 2VC0A 1FDNA 3PACA 2EBEA 3AOAA 4USHA 3ZSWA 1HI8A 2BRLA 3A5NC 2B4PA 3AVBA 4HHHA 4M95A 2OZSA 4OPAA 2ZJRL 1J5OB 2HRYA 1LW2B 1EETB 4N56A 5CA5A 2FVQA 5GADU 1QD1A 5HP1A 2E1YA 4M1KA 4HEA9 3M30B 2RVJA 4NASA 4OV6A 3HMJG 3SBTA 2R3VA 2HF4A 3HD1A 2P51A 1NB2A 2BJ8A 2HBLA 4BQLA 3FFKB 1JXBA 1QVGM 4ZPAA 1SVDA 3LZJA 3A3NB 2DRDA 2NSCA 3FQLA 4CJ5A 2WOMB 1VBXA 2RU9A 3VQDA 1HUXA 3BKFA 3HSDA 3H2UB 2QA1A 2VG6B 3EJMA 2VGMA 2V4JA 5MLCQ 4OYMA 1YJNS 3T5JA 1SBRA 2KHCA 2PEHA 2UV8A 1EKRA 3VF0B 3D6MB 3RR8A 1NB7A 4U7UK 2AP6A 1YT3A 2VA2A 3NMRA 1S1XA 4A8OA 3CDBA 4FKYA 2OFGX 4WWSA 2D0OA 1W2BR 3MXJA 2NPIA 5BR8K 4LF9K 3P31A 1IV0A 4Z4GA 3UB5A 4OZJA 4OKEA 1NKBA 4NCBA 2KXNB 2KJWA 3PYEA 4CI0B 4H0PA 3RJMB 4NXMF 4D3GA 3HKZD 2BACA 3CD6S 1VQLN 2ZBRA 4J37A 1VSIA 2F4VF 3ZTPA 1EB0A 2OPPB 4HHUA 2KLAA 2E1MC 1WHWA 4EYIB 2Y0SD 4TLQA 4G1QA 4H4MB 2R2UA 3R5BA 5BYSA 4LFAF 4B9SA 5J1PA 1OQ6A 5IQQA 2HAFA 5BJRA 3MZIA 1QZ5A 3DRPA 3GFYA 2DR8A 3AQPA 3BBBA 4O55A 1NHUA 5AQFA 3AVKA 2IM3A 1WF0A 1KEKA 3RMBA 1O8BA 2ZBCA 1RXOB 1N33K 2UXBK 3IXQA 2CKWA 5SWMA 3FVYA 3M8YA 4BRKA 3AA9A 4YHHF 3L2QA 3T41A 3HSCA 4CM2A 2XS2A 4JK8A 4JI3J 3FC9A 1VQ9S 1BCMA 3SFUA 1X4GA 4FJMA 2QTDA 5GIOA 5JS2A 4A2BA 2KXFA 3ENVA 4DR1F 2AZ1A 2HQDA 2MJNA 2VBWA 1NGDA 3TQEA 1FRKA 3EDRB 2HHHK 5ETTA 3ETMA 1Y5NB 3MUMP 5CQGA 1RU1A 1YBAA 4J9PA 3P3DA 4YDXA 1FXDA 2VOOA 3ATVA 1S1TB 3F0NA 3IAYA 2XSJA 2Y9HA 5FD1A 4PY5A 3T1YF 1QQOA 4F4XA 1TYQA 4AHCA 2JEGA 2FSJA 1S22A 1NZAA 1FFWB 1Q81T 2Q1NA 1X5OA 2AD9A 3UFCX 3HULA 2IMWP 4CLYA 5CCLA 1HNWJ 3ILJA 2DRAA 4LFBF 1P9YA 2MY8A 4K4WA 2VICA 2BE9B 4TQRA 4ECWA 4A46A 1FVQA 4FPIA 3TUIC 3BF3A 4XTTA 1HBOB 2EKYA 2W24A 3SUNA 1UJ4A 2HB5A 3W64A 4U7BA 4W98A 3NF7A 5F0WA 2A2DA 2DH9A 2MKJA 3KUGA 3QIPA 1JLEB 2YX4A 4JI8F 2GUPA 4FJJA 1Q86T 4NCGA 1TL3B 3VAKA 2R7XA 1GLEG 2B8QA 4CLLA 1VHXA 1C0TB 3V6HA 4MKYA 3KHYA 1V3RA 2AYEA 5DLGA 3BPDA 4YR0A 1WWHA 2XHBA 4Y3CA 1Y64A 2DISA 2B5JB 3IM8A 4JV5J 4ID1A 5CD4H 5CHIA 3MDQA 2GHWA 4RNMA 5BN9A 1TKXB 4RJVA 1RB0A 4L8RB 4CEDA 2WONA 1OY6A 4OV1A 5GVQA 5HL7L 3ISZA 3GP9A 4KAIA 4WFAL 4X66F 4O0JA 5A8RB 3W65A 4O3SA 3THYA 2F9DA 1NGIA 3KWMA 2M3DA 4CVNE 5FRNA 4TU8A 4KR0B 3QJPA 1GXLA 2DGTA 1W7AA 4I6WA 3H5XA 4FWOA 5KPZA 2HS0A 3BZKA 3NS5A 3TW0A 5HMZA 1KRPA 3NGDA 3ET6A 5ETMA 3KUHA 1XMBA 1E3MA 2KZMA 3VMFB 4AM6A 4EUVA 1S0NA 3EM1A 2NXNA 2JVRA 5E41A 4P2XA 3LQVA 3PHEA 3FBEA 3VQTA 4NEYA 3RYLA 4I6AA 4DZDA 4EFHA 1VGYA 4FWLA 1VSLA 4L6V3 3TUZC 3PW5A 3CDEA 4BR4A 3FEXB 2WVBA 2E5IA 3N9UC 4R79A 5LMUK 1H6KX 2MKKA 2PGCA 1TK5A 5KRSA 2NRVA 3RWUA 3HJFA 4FL9A 4QU6A 4HUGA 3RB6A 5HRRA 3TUPA 2CA9A 1X60A 5C24B 4IBNA 2RF2A 1UCNA 2HGMA 3OL9A 3CG7A 1RK8A 3WXKA 2F4FA 2U2FA 1NJIO 1URNA 5C7PA 4DTOA 2UXCK 4ZPVR 5AZJB 3MI7X 2A1BA 3VGUA 4BREA 1SKUB 4JKGA 4ZN1A 4X4VA 2XI3A 2HK2A 5SUHA 3OD2A 4CZLA 4WFAQ 3UR3C 4OHZA 3NH0A 1Q1KA 4F26A 1YQHA 3O9UA 1L5UA 4DX8H 2NLWA 1V3SA 1EARA 2QMUB 4ZJQA 1I94J 3NG8A 1S10A 4JYAF 3C6TA 4NWBA 3Q7CA 3QINA 4C8MA 3HHLD 4AHSA 4BDYA 2YWFA 5H1SQ 3PIOL 1P8ZA 4FWNA 2HVIA 2DHGA 3M7VA 1H72C 4BROA 4OHVA 2E5GA 1OKJA 4B1XB 2I5JA 3MR3A 2PYJA 2R7QA 3G8SA 3AVGA 1FKOA 3CD0A 2VQFJ 4WIIA 4GV9A 2OTJS 4MAKA 3M30A 1DTTB 2V94A 4MK9A 5AJ3K 3CYMA 4CJPA 1XNQF 2OEMA 4ECVA 3MR5A 2ALYB 3IMXA 3CEDA 3UNGC 2IVMA 4QPTA 3SZ2A 1X31C 4DV2K 2WTUA 1BY9A 3UNYA 2O8CA 1JCGA 1B99A 1X9WA 3LAKA 4OIXA 1PIEA 3E9PA 3OR1A 1RAAB 1CJKB 3HI0A 2RIJA 4QIFA 5HROB 2XHWA 3JS6A 2P9KB 4KGKA 4P2FA 1GXTA 3PJWA 2J0QD 1FESA 1O6XA 2KFZA 3W3DA 3HVAA 5DG9A 1FFGB 3G86A 2FSNA 1RJJA 2KYXA 4B3MF 4XEIA 2D0AA 3GL1A 1YJVA 5GAHP 3MMCA 3W9IA 2J9DA 3C15A 1Z6RA 3NF8A 2MKIA 5AR0A 2HBZB 3QT6A 1R8BA 1UFLA 1JJHA 4OVLA 5IT9Y 4M94A 5DM7L 3CMAN 4A8FA 2DNPA 4WFNQ 3MUVP 1C1AA 3CQ8A 3DXKA 3CPWR 4JB8B 3U1NA 1NSPA 3A0IX 4KI4A 1Q79A 5GMDA 5A6PA 1M5OC 2G1HA 1OIAA 4KTQA 3HD2A 3KNAA 4P2MA 5DJBA 3MPWA 1T03B 4K4XA 3AAQA 1WACA 1ZA1B 1T05A 2OANA 3HHKA 3AJ1A 1RI7A 4MIAA 1SIWB 2ZKTA 4AHTA 3FGUA 2OPSA 2ZHOA 4E98A 5KFIA 1PG5B 1VRTA 3LOUA 1JNZB 2NYIA 1BG3A 4M8LA 1FXLA 2PEBA 2B3TB 4MKVA 5LSOA 4KBOA 2F7VA 4HT7A 4Q2MA 2MEWA 5I42A 4MQ3A 4FYXB 1T6CA 4DTRA 2AIRB 2FJWA 1SQGA 3ITHA 3VEYA 3WQUA 3M6WA 2VG5B 1CLQA 3JS9A 1WOOA 2EKNA 2AWZA 1TQLA 4EO6A 4ALZA 5F0UA 2D3O1 3LW5C 2OMOA 4B17A 2VWKA 4LF5F 4C8ZA 2KW4A 3NGIA 2AGPA 3KFWX 1X4EA 4B1YB 3QEWA 4NYZA 3ZSRA 5FROA 3R3TA 2WVFA 2V67A 4URQU 4XIUA 3JYTA 2G8HA 4HCCA 1NGCA 5IT0A 2XY8A 3EGVA 4K7QA 3KD1E 2GBZA 1TL5A 4PWDB 3MECA 3CCUS 2C2DA 4NMLA 3GIIA 1WKJA 1HKBA 4CT9A 1J54A 2DO4A 3M32A 3DRXA 2E9ZA 5DETA 4Y34A 2FBYA 2EFOA 4B02A 5AQYA 4AXIA 1VBKA 4CHOA 3GTYX 3HLUA 4FJ9A 1JLFA 1CJVA 3EUNA 3O8WA 5M1OA 4CZCA 2ZD1B 2PDAA 3AAPA 5D4LA 1F3FA 1VK3A 1G15A 1D8ZA 1T8EA 4JI6K 2KT2A 2F1FA 2F8EX 1HNXJ 2DVIA 5EOYA 4DHVA 4CLSA 3OXGA 4P10A 4OKKA 2V63A 3F56A 1YZ6A 4OLOA 3K5LA 1U04A 4A57A 2QYGA 2JEIA 1HWUA 2VKZG 2WC9A 4Y1DA 3CIZA 5T7BA 3OS2A 5EVZA 2FLNA 4RNFA 4LR7A 1UFWA 4OLPA 4BGBA 1B64A 1UFKA 4DX5A 1BA0A 4H4MA 2HS3A 4DSFA 3GE9A 5F9NA 3BSCA 3QNWB 4KHSA 4A5BA 4WZQA 2OPRA 1IG8A 3I9ZA 2D0BA 3D45A 4FBUA 4F3TA 1NJIT 1ZTTA 1U2CA 3IM9A 1RHMB 3MN5A 2MYFA 4FS1A 4CIOA 4NXNF 2O1PA 3GJQB 1S97A 4HH1A 1UTAA 3D0GE 3VESA 3O3FA 2NZCA 3B6BA 3K59A 3CMES 1RHRB 3O9RA 2V8HA 3OS0A 3OBYA 4GC6A 1UEKA 1UWBA 4NMXA 2F8HA 2HNDA 4K8ZA 2NXJA 4KHPK 2CIMA 2NYHA 2WRMA 3OYLA 4O4GB 3S1TA 3PFOA 1DTQA 1YJUA 2CQ4A 1RUSA 2A41A 1S1TA 4FNHA 3CTRA 3UCZP 5JVHL 2M7SA 4CZMA 4NLPA 2CPEA 1QJHA 1PYOB 2NSBA 3MXMA 3KWGA 2GJ2A 3R5DA 3SMPA 2QWMA 3M5RA 1RTJA 4DR7K 3BDEA 2I2YA 4HR2A 4BRDA 1AYEA 3QIOA 1D9FA 3PV8A 1Q0NA 2G9OA 1NK9A 3CUNA 3J81O 2VC1A 2CZVC 4K50A 1PC5A 3LP1A 4LRFA 4ZVRB 4JS5A 1T3VA 4KTZA 2AJ4A 8ATCB 5E0OA 1RT6A 1MROB 1O0PA 3UKRA 2HZAA 3T9NA 3WXJA 4H5TA 2H54B 1VYAA 3PRVA 3RAQA 2LEBA 1EAYC 4CWBA 3S6EA 1J27A 4HKQA 1CZAN 4LRAA 2APOA 2BX6A 2QMXA 3O5BA 1ATSA 3I9V9 1UW4A 3O6QA 1VQKS 2NQPA 1B92A 2ZH9A 1CJKA 3I55S 3SCJE 3AOBA 3E51A 2XMTA 4FF1A 5GAHU 1MG7A 1CG2A 4X62J 3F9KA 4EBCA 4GO5X 1M5PC 3M8WA 4DU4A 2ASLA 3NGSA 3GSDA 1NU0A 5J2MB 3HSZA 5B0FA 4F2RA 3OFEA 3AVFA 3PEJA 3QFHA 3MK6A 2A6AA 2BZ2A 3GPAA 2Y1JA 4C9DA 3NFAA 2DXFA 1XQSC 4B3SK 5L9NA 4USMA 2CH5A 4TLRA 3BR9A 4YY3F 2G8UA 4GNIA 1U47A 4YY3J 1WOSA 5GINA 3RRKA 1IBMF 3J8AA 1QAIA 3NOCA 3M9OB 5HMYA 5AXKA 1VQ9N 3DMJA 2LDIA 3IRXB 4LRCA 2MQMA 3DLRA 2LQ9A 5IS2A 4N77A 5K14A 4ED4A 4B1UB 1X8DA 5GADI 3TAPA 5J1NA 3DLLQ 4LF5K 3BQ2A 3TANA 3GG0A 2MLZA 1S9FA 5DS7A 4WF9Q 1VBYA 1FEHA 4YUDA 2PA8D 3OVBA 3CC2S 1N5VA 1S9GB 2P9SA 3LDLA 4DV6J 1U1OA 1U8WA 4C7QA 4P2SA 1KFDA 3CCVN 3C66A 4HI1A 1L3TA 1RBOB 3OA9A 4FZVA 3L2UA 4HCBA 3NCQA 1T03A 4DV4F 2XMKA 2VBXA 4ED6A 4JKAA 2BEFA 3AGRA 4NZ7A 4WK1A 3J80O 2FVPA 4BG8A 4ZIVA 3SV4A 1RYSA 2VJUA 4TU9A 4FM1A 4Y1CA 3V4IB 1WHXA 3B4MA 1XMQF 1SC1B 3TA2A 3KK3B 1HBNA 2KM8B 2DGWA 3HP6A 2RE2A 1VQ4N 4DOZA 4IFVA 4LJMA 4I2QA 5KFCA 4F02A 3CCTA 5AFUA 1LWCB 4CQ1A 3Q83A 2HNYA 4Q8FA 1YBTA 3AVNA 4F0HA 5KFKA 4MYTA 2BM1A 3QSYB 1RHQB 4QZVB 4YHHK 2MPUA 4BWMA 1RT5A 3ULDA 3P5BP 3KZBA 5E3PA 4OX7A 1IKVB 2OSQA 2HWTA 4WTOB 3OJUA 4K4ZA 1K73T 3OW2R 3BZCA 2RUGA 1NEEA 1ZAVA 4W4MA 2B56A 2GEMA 2DTUA 9RUBA 2KKZA 4RW8B 3KK2B 2A10A 3P49B 2ZVSA 1FF2A 4JI1J 2HQIA 2Z58B 2FC9A 3AFGA 2ZVIA 4NXMK 3DHXA 4WIQA 3BH6B 4ILHA 3TAFA 3OSPA 2AHOB 1WKKA 4QR1A 2YPZA 1U1PA 1KC8T 4DU3A 4M5DB 4O3OA 1JWWA 3J7ZO 1KONA 4ISEA 1HFEL 2QWPA 4F67A 2K06A 2H4YB 2BOPA 4CJSA 2NRRA 5EHHA 2FPHX 1RU2A 4CO5A 4G6VB 2W41A 4KT0C 2DIVA 2C42A 4Y2KA 3SK3A 2OPSB 3O3HA 1X0FA 3B54A 1Q8KA 3J81U 5M1PA 3DLKB 2JLGA 3R6MA 1P1TA 1WC1A 4NLDA 4O8UA 3HBTA 1EX8A 4YS2A 4LF9J 3WXLA 2FZKB 4KKOA 1A5XA 4RO0A 3WNHA 2NREA 3I0RA 1KKHA 5FRMA 4LFCJ 1RT3A 3W2WA 2VDIA 4DUZK 3J81Y 4BRQA 4BVOA 3B78A 3NNAA 1N5TA 5KFFA 2OPQB 1S72N 1IBCB 2X1BA 4P6QA 2FJAB 3BYPA 3VEWA 2DEJA 4IO1A 1ZPWX 4WQ5C 1RQ0A 4YDUC 4NL5A 4O3QA 3MAAA 3GQCA 2KG1A 5HVGA 2VU5A 2PFFB 1D1UA 2OELA 2QA4G 4CJEA 2RRNA 4KHPJ 3CF5L 4DWIA 3AY0A 3ZZTA 4AUKA 4PKIA 1NSKL 1NH7A 3CHWA 3J7Z5 1FCAA 3LANA 4NA1A 2V4QA 4FF4A 1XR5A 4OZLA 2XI2A 2NUUG 2HQ3A 1NJYA 1HWJA 1QVFM 4CEBA 2VDHA 4J9QA 2L41A 1XUPO 4DV5J 1CJVB 2YJFA 3SCXA 3MCOA 2JSXA 2RH3A 3HO1A 4ES3A 2V2ZA 3T9ZA 3VWSA 4O23A 2C1EB 1IKWB 5B0GA 5CXTA 2H5JB 2HQCA 2DNHA 3VQ8A 1Q5VA 1WSJA 2AQ4A 4MO5A 1RBLA 3WBZA 4QAGA 1YJ9N 3KHHA 1DQ9A 3TSUA 2DCLA 1WTFA 3O3LA 3KMSA 3U4LA 2Q36A 3RAXA 2BBEA 5K8MA 4FSVA 4BLGA 1U4BA 2CAJA 3ISND 3L7OA 4CJLA 3QT8A 3GG4A 4OQJA 1KD1O 3EICA 5CABA 1J5EF 3W62A 1SC4B 1JQGA 1JXLA 1RWNB 4ED8A 4F36A 3QWPA 4YFUA 4DV4J 1T0TV 2RF2B 1MMNA 4LBPA 4OX9F 5L1KA 2RNEA 3HF5A 1K9MT 5KG2A 1SJ4P 2W7AA 4B3MJ 3TTDA 4IRCA 1Q7LB 3BKTA 3NGZA 4FF2A 3WDOA 3ID6A 3IWNC 4CW7B 2ASDA 4E1JA 3LZIA 1IBKK 3VGMA 1G6BA 1S0VA 4WPAA 1WEXA 5BYQA 2R7SA 2O8BB 1XK8A 4RW6B 4MFBA 2Z4PA 1XNQJ 1LEOA 1BLUA 2DHSA 4EP5A 5KFJA 1ZBTA 5M1NA 3OJSA 3W3SA 5H9EJ 4F0MA 1NBWA 1KBRA 3RBZA 2WSEC 4CERA 3DXBA 3D4JA 4DL2A 2KT5A 3O08A 4BQZA 2PA3A 1ZBFA 2NCKL 3WNGA 2Z2ZA 3ETOA 3KG0A 1HPZA 1U7LA 2DIUA 2NUHA 2G8VA 4IKFA 4Y28C 2BQUA 1LWEA 1CBKA 5AXLA 1RTJB 2RMLA 3FSYA 3IBWA 4JI5K 1NKCA 1DGKN 3LP0A 2HHSA 2AEJA 3N6NA 1NPPA 4Q0BA 2GIFA 3D2FA 3BGRB 3CJKB 4ZJLA 3D7EO 2E5HA 5HBMB 2HNYB 3BM7A 3OUYB 4JAXA 1UOCA 4DX6A 1ASWA 1DEJA 4FYVB 3QB0A 4DR7J 2FJBB 2IFXA 4MDBA 3NRBA 4ZVFA 2WW4A 4LF7J 2YWHA 1SJRA 3MEDA 2XCAA 4CJVA 3IC1A 3QZ7A 4YY3K 2DITA 1QSLA 1N5YA 4CGHA 3AODA 4CM0A 3QMQA 2BJEA 3DYAB 2QT7A 1CZ9A 1GLBG 4YEAA 2R2RA 4UW2A 4IFVB 1X4HA 2F65A 3OR2A 1ZXOA 2HS4A 3EE9A 3D0IE 4M5KA 1IBLJ 2DY9A 1RT4A 1RDCA 3M8RA 3HI9A 4IR9A 3R7SB 2E5JA 4X62K 5KTQA 2DGOA 3BEXA 2JFKA 4FP9A 5KG1A 4RWXA 2K7JA 3OL8A 3AY9A 3V1RA 4DCPB 5EWGA 4OJ3A 2ZJPL 2C3MA 1ZM9A 1N5QA 1NK4A 2ZJQL 2LXFA 2K8GA 4CLFA 4JOUA 1YWXA 3UVJA 2HBKA 2FC0A 2RUSA 2Q31A 1R0CB 4FJ7A 1KVKA 2E9RX 4RW7B 2BVZA 4NE9C 1TK8A 3TVKA 4YB6A 3CCEN 1UAWA 1UEUA 1MN9A 5KGXA 3I0RB 5BPNA 2X78A 1P9QC 3GDQA 3QYYA 3HFZB 2XS5A 3SAGA 2V5HG 1UETA 3BQ0A 3BKUA 3U3YA 5IT9O 3X1LB 4DV5F 4FJKA 5KG4A 4M3RA 5BRHA 1RZMA 4ZDNA 3QFUA 1IN0A 2HFOA 5J2PB 4DU8A 5KFBA 3PX6A 4OI6A 2UYTA 3PFEA 1OY9A 3ENQA 3M1VB 4IQXA 3DLEA 2FTRA 1ZZNA 4E0DA 3R2DJ 4HTLA 1Q9YA 3CFPA 3OYJA 3HDSA 3L2VA 1IR2A 2PT0A 2POKA 4KHPF 5AQVA 4TY9A 1VLOA 1F21A 3CPWM 4JHDB 1WC0A 3TVZA 3H90A 4KQZA 1Q7YT 2N4DA 1ICEB 3PYFA 3SIPB 3RBXA 1VQSA 5M2PA 4CF8A 3MM9B 2GZOA 1K8AT 4MLEA 1S9GA 3KLIA 2OD4A 1TU0B 3FNNA 2P5OA 4A47A 1OSCA 4X4RA 3RB0A 3ZTOA 1VQKN 3P4UB 2UUBF 5D78A 5EX3A 4NOHA 2I38A 1NDLA 3M9NB 4OYXA 3I55N 3NGRA 1NJXA 1VQMS 3V81B