3M8QA

Hiv-1 rt with aminopyrimidine nnrti
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of piperidin-4-yl-aminopyrimidines as HIV-1 reverse transcriptase inhibitors. N-benzyl derivatives with broad potency against resistant mutant viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 151
structure length 554
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3m8qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8qA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8qA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3m8qA05
1RTHB 2V4RA 2J6SA 4FM1A 1BL3A 1TL3B 2B5JA 3ZT3A 1S49A 1UOCA 4O4GB 1RA7A 1SH3A 3M8RA 3V81B 4KKOA 3MECA 5F8NA 4G1QB 4NLDA 5D3GB 4Z4IA 1FKPB 4ZVGA 4URGA 4B9UA 4ELUA 2JEIA 2KFNA 5L1KA 3AVGA 1I39A 5CYQB 4I2QA 1S1UA 1S1WA 3NF9A 1BCOA 1EP4B 4J9RA 1B9FA 5J1EB 3VA3A 1L3VA 3HPGA 4CGIA 1HNVA 3TANA 4IG0A 4NCGB 2R2UA 3T5KA 3NFAA 2D5RA 3K59A 3GIKA 4URSA 3BR9A 4MK7A 2B43A 4H4MB 4DSEA 1DLOB 1TL3A 4K4VA 1JLAA 1S0MA 4O4GA 2BGGA 1ZTWA 1RT6A 4KV8B 1T05B 1NJYA 5D3GA 2ZE2A 4IOBA 4QWDA 5KT5A 1CXUA 1EKEA 4QW9A 4NYZA 4QOZB 4EZ6A 3GQCA 2OPPA 3V6DA 3I5AA 1QSYA 3G0ZA 2PYJA 1EP4A 5DGAA 3CJ5A 3KLFA 1X1PA 3VQ5A 2IM1A 4CF9A 4NCGA 2HMIA 3OYBA 4FM0A 1WSEA 3Q8SB 3KK1A 2CKWA 1NJWA 1BIZA 4H4MA 1WSHA 3S9HA 3I0SA 1ZBFA 3K57A 4DTRA 1KHWA 1RYRA 1X9WA 4KV8A 3UPFA 3WNFA 3GIIA 1S9GA 5JS1A 4KO0A 3NBPB 1MMLA 3ALYA 2B6AB 1HYZA 2IS3A 1JLBA 3DRRB 3BDPA 4CGDA 1T7PA 3ZSWA 3DLGA 4EYIB 2DPJA 3EZUA 4NLVA 3VQQA 1KHVA 3SUPA 3KLEB 3KD1E 2C28A 1SUQB 2IA6A 3LWMA 4LQ9A 4F50A 5KFZA 4E89A 1KSPA 4W5RA 2HNYB 3OYHA 2BRLA 1JXEA 4O5BA 4WFYA 4B3OB 1F21A 4XIUA 4M42A 5E41A 5DG8A 4ECZA 1BCMA 2YNFB 3AO5A 2JGUA 2GV9A 4M95A 4RW7A 1RT4B 3MEEA 2V9WA 3QEPA 3KLVA 4ZPDA 2WOMB 3TAGA 3RMDA 2O4IA 4DFJA 1YTUA 3KLEA 1IKXA 4Z4CA 1SUQA 3LPTA 1ZBLA 1YTAA 5KFEA 1C1AA 4Q8EA 2HNYA 4CEZA 1RDRA 3ZSRA 5KFLA 2AGOA 5KT3A 2VG6A 3KTQA 2IGIA 3OL8A 4ED8A 4ZP6A 5KRSA 4J2AA 3AVLA 3HPHA 1RTJB 1T03B 4YNQA 4KSEB 3PZPA 3QIPB 4DFKA 3PW5A 4OGEA 2F8SA 4ECWA 3D0PA 2E9TA 2FJWA 4FLTA 4CHQA 2HWIA 4N76A 3HKWA 3O4QA 4FK0A 1JLCB 4R8UA 1BIUA 3MF5A 2FLLA 3DI6A 5KFKA 4IH6A 4O44A 3CG7A 4HTUA 4CF8A 2ALZA 5C24B 4FJ8A 3KLGA 4KB1A 5DLGA 4IBNA 4NLYA 3ZT4A 1CZ9A 4YQWA 3OJSA 1RTJA 3BQ2A 3NAEA 1C6VA 3ZT1A 5JXSA 3QIPA 3MXIA 3D5MA 4TQRA 4IDKB 2YKMA 3LP3A 3EY1A 4HKQA 4Q43A 4KAZA 1RBRA 4QWAA 5KG2A 2W9CA 1TKZA 4F4WA 4IR1A 1RTIA 3OS0A 5F8IA 1QHTA 4CF0A 3DLBA 5KGXA 4NLSA 3QNNA 1CXQA 3TAQA 4F2RA 5C24A 3FQKA 1TL1A 2IM2A 4DSJA 4PUOB 2ASDA 4KREA 3BSOA 2IM3A 4NLRA 3VQ4A 3PHEA 4FJXA 4R0EA 5KFCA 4CGFA 2I1RA 4Z0UA 2XRIA 1RT3B 3LP0B 3L2WA 3L2UA 2W8LA 1C0TB 4C8KA 2GC8A 1TK8A 3QLHB 3E01A 2F96A 2VG7B 1C2PA 1C1BB 1S1VB 4CJKA 5L1LA 3N6MA 3DLKB 4ED0A 3VQ6A 3EZ5A 4R5PB 4RNFA 3MEDB 3VQ8A 1REVB 4L8RB 1N5YB 3LPUA 4RW6B 3NF7A 4DTXA 4ZHRA 4EO8A 4CK2A 2ATQA 3QIDA 3AVIA 1VSMA 4B9VA 2IAJA 4CJLA 1WSIA 2FBYA 1D1UA 3Q8RB 3RMBA 3LP0A 4KTZA 3HL8A 5HRRA 4YMEA 4FJ7A 4KHNA 3HO1A 4ZPAA 3OL7A 3NGDA 3PW4A 2BE2B 2Q3SA 1JLGB 4RW8B 2IOCA 1S1VA 4GC7A 4TQSA 1DTTB 4FJGA 3LAMA 4R5PA 4NLPA 3MEDA 3HM9A 1REVA 4CGGA 3DOKB 5FDLB 1JLEB 1RBVA 3OYKA 5HLFB 3H59A 1JLQA 2E9RX 1EXQA 1HRHA 3QO9B 4BDYA 2G8UA 1NOZA 3ITHA 2XO7A 4ID5A 3GILA 3DM2B 3P1GA 3B6PA 4DL7A 2HVIA 3F73A 3VQPA 4CECA 1FKOB 1ZBIA 1N56A 3JSMA 1TVRA 3NH1A 5FRMA 4OPKA 5KRTA 4J9NA 1JLGA 1C1CB 1IH7A 4K50A 2KQ2A 2D7SA 2C2EA 1LWEA 2AU0A 3DOKA 1TP7A 5HLFA 1RBSA 4IG3A 2ATLA 1RT7B 3PV8A 3OSPA 3ASMA 4B08A 2KZMA 4K4YA 4B9SA 2FVSA 5DLFA 4JLHA 3PW0A 2OPQA 4KHRA 4OJRA 1Z25A 2Z1GA 1KLMA 1QE1A 4N47A 2X74A 5EU7A 4AHRA 3PX4A 3KK2A 1JIHA 5KFSA 3C6TB 2FVPA 3AVBA 4B8AB 5SZTA 3PX0A 1Q9YA 3C94A 4CJ5A 1LV5A 3LAKA 4LSNB 2JEJA 3CIZA 3V1OA 4E7JA 3S3OA 1IKYB 3LALA 4B9TA 3PO4A 4C8LA 1SH0A 4IKFA 1SV5B 4TY9A 1JXBA 3QYYA 4DWIA 4KTWA 4J2BA 4DL3A 3IAYA 3SZ2A 4I7FB 3EYZA 3G6VA 5KG5A 2ZD1B 3HT3A 4WZMA 2R8GA 4KAIA 2YHAA 1TAQA 4W5QA 3N6NA 1R0AB 5FRNA 1GX6A 4CJTA 2HHTA 3C6TA 5KT2A 1NK7A 2KW4A 3P5JA 3TWHA 5HRPA 2OH2A 3AVNA 3VQDA 3T19A 2G8VA 2WONA 4AILC 5I3UB 1LW2A 1SV5A 1IKVA 1S5JA 2GIQA 3PW2A 4GW6A 3SUQA 2YV0X 3ZCMA 3L8BA 4J9MA 4MK8A 3CM6A 2O4GA 5CZ1A 1HNIB 3O3GA 4ED7A 4CIEA 3AVCA 3RRHA 2ILYA 1R0AA 3LWLA 2VG5B 1HPZB 3IRXB 4IH7A 1XR6A 1JKHB 1RTDA 2VWKA 3TVKA 4HUGA 1ZBHA 3D28A 5KFDA 1BI4A 2ILZA 4HHTA 5HP1B 4GMJB 4FW2A 1I6JA 3HVTA 5KI6A 2FC0A 4LH5A 3NGYA 2JEFA 1NK4A 2WHOA 5KFHA 1TKTA 3AA5X 4DFPA 4FJKA 4EP5A 4ZVHA 4M45A 2HHXA 4KE5A 3FFIB 3OYEA 4LD0A 3DYAA 1VSLA 1JKHA 4I2PB 4E19A 2IMWP 3M8QA 1WN7A 4CHNA 3I0RB 3BQ1A 1EETA 4FJLA 4HUEA 5KFVA 1WLJA 4RNHA 4NLUA 4AHVA 1LWFB 3RBDA 1WSGA 4JS4A 4CGHA 1RT5B 4NYFA 1S6QB 4G3IA 4QWCA 3U3YA 4OLBA 2YKNA 2GUIA 4B8CA 4YR3A 1T8EA 1KTQA 2UVRA 2X6SA 4KHQA 4QWBA 3BGRB 4KB7A 4RNMA 3OYFA 3CVKA 3OYIA 4BDPA 3T5JA 4CJEA 2BR0A 4NLQA 1GOCA 4J2DA 4J9OA 3MR2A 3OLAA 4MKAA 3FFIA 3KJVA 2ITGA 4K4XA 4ZPCA 1N6QB 1DTQA 3KHRA 3LDSA 4DTUA 3I0RA 3EPGA 4GVMA 1FXXA 1JL1A 1TK0A 1J53A 3AA2A 3KOAA 4Q8FA 3T5LA 4CF1A 3HXMA 1RT5A 1S9EA 1S6QA 1S0NA 2UVWA 1RBUA 4F4YA 2F8TA 2AGPA 5KT7A 4TY8B 3DLRA 3PJWA 4JRPA 4DLEA 4MIAA 5KFPA 3H5SA 1UA1A 2FBXA 4CHZA 1JLFB 4E0DA 5T7BA 4ECQA 3AA3A 3H5UA 5JUMA 3I5CA 4RNNA 5T14A 1RTHA 4FLYA 4DSIA 3S3MA 1D0EA 3V81A 4YR0A 4EBDA 4G1QA 1QTMA 1FKPA 2E4LA 3G86A 2R8IA 4WZQA 5F8GA 4O0IA 1WAJA 3NL0A 4H54A 3EPIA 5CYQA 1NHUA 3V1RA 4BDZA 2R2RA 5J1EA 2I5JB 1GX5A 5C5JA 4Y34A 1JLFA 2O5DA 3NMAA 2FJXA 3L3UA 3V6KA 1A5VA 1ZYQA 1VSEA 4CJVA 4CEAA 3CFOA 1DLOA 3RBEA 4CFCA 3KMSA 2C2RA 1T05A 4NLXA 1CZBA 2D0CA 5CYMB 4IFVB 3V9WA 2AX0A 3V4IB 1RAJA 1TV6B 4MKBA 2V4QA 4DSFA 2W9AA 5F8LA 3T1AA 2FVCA 4BE0A 4M3TA 4E7IA 2JEGA 1J5OB 2E6MA 3H4DA 5KT6A 4DG1B 3CJ4A 3VN5A 3C95A 1BQMB 5L1JA 1RNHA 2YNGB 4DSKA 5KGWA 2YNHB 1TAUA 3DLHA 2YNIB 3NBPA 4CJFA 2B6AA 1XHZA 2XHBA 1HQUB 4IFVA 4C8MA 1O1WA 1SL2A 4ECTA 3DRRA 5F8JA 4CEQA 1TV6A 2A1RA 1D9FA 2WB4A 4U6PA 2W8KA 1J9AA 3T3FA 3NF6A 2BDPA 5KG1A 2HW3A 4W5OA 1XHXA 1VSIA 4ELVA 1BQNB 4CHOA 5HRSA 2VA2A 3RWUA 1U4BA 4F8RA 4DU3A 2XY7A 3SUOA 4ECVA 4ECSA 5I42B 4FS1A 3CYMA 4FJIA 2YNGA 3H5YA 3D45A 3PVXA 2HHWA 3TI0A 4B3OA 2IBKA 2CJQA 5KG7A 3SCXA 1WNEA 1HQUA 2IM0A 2AWZA 3G6YA 1RDAA 3ZSQA 2YNFA 3SI6A 3E51A 3H4BA 4WYWA 1L5UA 1IKWB 4NLTA 1RT4A 2WOMA 1QUVA 1XI1A 2HHQA 3HPOA 4O3OA 4DTJA 3ISNC 1VSHA 3CJ2A 4K4ZA 4RW4B 1YT3A 2FVQA 4E1NA 3NH2A 1W25A 2EHGA 5JS2A 4DMNA 4PQUB 1IG9A 1VK0A 3JYTB 3U6FA 1Q8IA 2HNDB 2OPSB 4DEZA 5DG7A 2B4JA 4MK9A 1T03A 4C8NA 5KFYA 3QZ8A 1S4FA 4QW8A 4KHWA 1IKWA 4MIBA 3THVA 3OY9A 4FK4A 4AHSA 1JLCA 3OYAA 2AJQA 4M94A 1NKCA 1T3NA 1Z26A 1L3UA 2D0BA 3HHKA 3RB6A 4PQUA 2ASLA 2ZQBA 5KT4A 3OHAA 1NHVA 1LW0B 2RPIA 2HNDA 4KBIA 4J9SA 1VRUB 3K5OA 1RT1B 2W9BB 3DMJB 4FYDA 4H8KA 3HK2A 3NGIA 5FROA 2BQUA 1D5AA 4IDKA 1YVFA 1S9FA 4EBCA 4DL6A 3AVHA 3DRPB 1C0UB 4O3NA 4Q0BB 1RBTA 1HYSB 3KLHB 3HYFA 1VRTB 3KHLA 1MU2B 3TR8A 5KFOA 3K5LA 1QAJA 1U48A 3MEGB 5KFJA 3M8SA 1U04A 3QZ7A 4PY5A 4CJSA 4PUOA 4LQ3A 4NLOA 4WYLA 3AVFA 3CDWA 5F8MA 4E1MA 1VRUA 4NYNA 1RDCA 3WNHA 4CK3A 1RT3A 5DGBA 5DK5A 3VQCA 1U47A 3MR5A 3VQBA 1C0TA 3PO5A 4H4OB 4OKJA 3QLHA 2VG7A 1C1BA 4E7HA 4OGCA 3DLKA 3SQ1A 4U7CA 4NCBA 3QETA 5KG0A 1S1XB 1N5YA 3LZJA 4RW6A 2HNZB 2GBZA 2UUWA 3KD5E 2HAIA 1RDBA 5J2PB 3KK3B 4CFDA 4M3ZA 1FK9B 1TKXB 4O3PA 4E7LA 4PWDB 4FS2A 4J2EA 2BE2A 4RW8A 3MXMA 4OLAA 3IS9B 3VQEA 3S3NA 1DTTA 3TAEA 1N48A 2AQ4A 2XWYA 4CJRA 4RW9B 3OVNA 4DU4A 3CO9A 2XY5A 5KFGA 3OS1A 5EWFA 5FDLA 1JLEA 2HNZA 3O4NA 4CE9A 1NK0A 3BSCA 3SJJA 1KLNA 3QO9A 1SL0A 5J2PA 3AO3A 3DM2A 1WSJA 4CIGA 4KHSA 4JRQA 3TAFA 4K8XA 1U49A 4DF8A 3CM5A 4E3SA 1FKOA 4PWDA 4DL5A 3PX6A 1L3TA 4DQSA 5SWMA 3KNAA 1CSJA 4ZVFA 1C1CA 3QERA 2DFHA 4FJMA 1HQEB 3LANA 4M3WA 3TABA 1SKRA 5EWGA 5HROB 1RT7A 2IDOA 1SL1A 4IFYB 4FW1A 3KKRA 4EYHB 4N41A 3MR3A 5F8HA 3HJFA 4QCLA 3O3FA 4DQQA 3DRSB 3QEVA 4O4RA 4IQXA 5DQHA 1KCFA 3OLBA 4OKEA 2WRMA 4Q5VA 3KHGA 2Z1JA 3ISND 1LAVA 3B6OA 4EP4A 4LSLB 1W0HA 1S1TB 4K8ZA 3G10A 3HP9A 3RRGA 2RF2B 4LSNA 3NAHA 3V9ZA 3MR6A 1IKYA 3KLIB 4ED3A 5K14B 5HROA 4DU1A 4NRTA 3SI8A 5J2QB 4I7FA 1NK8A 4JS5A 2ZD1A 3UIQA 3PR5B 3V9XA 4ECYA 3LP2B 4RG8A 1NJXA 5C42B 3RB4A 4O0JA 1ASUA 3AV9A 3AVAA 4OVLA 4RNOA 1KVCA 4KFBB 1L3SA 1XWLA 1S97A 2E9ZA 4BWMA 3IGNA 4IH5A 4DTOA 5I3UA 3H2LA 3P83D 2G8IA 3UDLA 1ZETA 2RDJA 4Q44A 3PJXA 3OJUA 4CJUA 3PR4A 3CDEA 1KVAA 4NRUA 5EWEA 5KG3A 4FXDA 4Y2CA 1KFDA 1HNIA 2VA3A 3QGHA 3I5BA 1X9SA 2BANB 3LP2A 1D8YA 1S6PB 4F2SA 2VG5A 1HPZA 3IRXA 4FZZA 4CJWA 1N4LA 2BQRA 3M9OB 5J2NB 3BREA 3L3VA 2D3UA 3ULDA 4CEEA 3BSAA 2OZMA 5HP1A 2RDIA 4KB0A 2BRKA 2G8FA 1C0MA 1W9HA 4CEOA 2VWJA 5J2MB 2XI2A 4KHUA 4KHYA 1GOBA 4J9QA 1TQLA 3FQLA 2B5JB 4ED2A 3G6XA 2Z1IA 3SNNA 2QKKA 2J6TA 3AO2A 3OYGA 4ZTJA 1SKSA 3ZSYA 3MECB 4KHMA 3SYZA 2DFEA 2QK9A 3C6UB 1TGOA 4AHUA 4I2PA 3RAXA 1VSFA 4KRFA 4Z4FA 4I2QB 1S1UB 1S1WB 3RMAA 1EX4A 2HHUA 1VSDA 4B9MA 2FLPA 1LWFA 1HNVB 4IG0B 2W7PA 5J2MA 4FJ5A 1NK6A 2FJVA 4DF4A 3QIOA 3QEWA 3BGRA 1JLAB 4XPEA 1RT6B 4K4UA 1XR5A 1U09A 5F9NA 3OYNA 4FLXA 3C6UA 2ZE2B 1RA6A 3KHHA 2A1SA 4JV1A 3AVMA 2OPPB 1N6QA 3V6DB 2R2TA 4W5NA 2KTQA 3OL6A 3M8PB 2QXFA 1UA0A 3HVRA 3KLFB 2HMIB 1I3AA 3KK1B 1Z4UA 1SKWA 4TY8A 4IKAA 4ZTFA 4Y2AA 3I0SB 3OYLA 3NDKA 4J9LA 5DQIA 3BQ0A 4FLUA 3NH0A 4NLGA 4ZPBA 3OHBA 1WNSA 1S9GB 4KO0B 4FBTA 2DFFA 3RTVA 3FRZA 1A5XA 3H08A 4N56A 1JLBB 3N6LA 4DQRA 3OS2A 3NHGA 3SV4A 1VSJA 3DLGB 3M8PA 1K1QA 4WFZA 4QAGA 3IG1B 4ZP8A 5KFWA 3QESA 4OKKA 1RYSA 4DQPA 3NCIA 1S10A 3Q8QB 2JC1A 3CDUA 2OPRB 4FCYA 1X9MA 2WCXA 4ED1A 3SQ2A 1SH2A 5KFRA 2I5JA 2HVHA 2XI3A 3QINA 3RAQA 4F4ZA 4DSLA 5KTQA 4RW7B 3K5NA 4QPXA 3MEEB 2UVVA 1BGXT 4M3XA 1RT2B 2D41A 2C2DA 4BE2A 3IG1A 4M3UA 4NLWA 1IKXB 3ZSOA 2WK4A 5CYMA 2W7OA 3V4IA 2OPRA 4Z4GA 5F9LA 4N5SA 3RB3A 1NJZA 3SUNA 1ZBUA 4MQ3A 3QGIA 2VG6B 2DPIA 1K6YA 4FJ9A 2OZSA 4HUFA 2HB5A 3NE6A 1J5OA 2C22A 4FBUA 4DG1A 1BQMA 2PY5A 3FDSA 2YNHA 4CESA 2R2SA 3OYDA 1RT2A 2YNIA 2DTUA 4R8UB 4FK2A 2LSNA 5KFQA 3GV8B 3DI6B 4B9LA 4O44B 4IRDA 2Y1JA 3IN5A 3VQ9A 4CCHA 4WFXA 2XCPA 3A2FA 1UAXA 4M3RA 1JX4A 1D9DA 1BQNA 1LAWA 1KFSA 1NNDA 3GIMA 3KLGB 4O3RA 1Y97A 4OL8A 2J6UA 5HRNA 4F4KA 4B9NA 1K1SA 4NCAA 4MH8A 3H5XA 1S0OA 4W5TA 5I42A 2FVRA 4IRCA 2D0AA 3NAIA 3GV7B 2Z1HA 2AX1A 5L1IA 2YKMB 3QGGA 4DL2A 2RKIB 4ZP7A 4RUCA 4Q45A 3OYJA 3TAMB 4CFAA 3HP6A 5KFNA 4TYBA 2W9CB 1TKZB 4WXWA 4CJQA 3V9UA 1RTIB 4TXSA 2QV6A 3AVJA 4ZP9A 4DTSA 3ICLA 1B92A 5C25B 4ID1A 3PUFA 1VSKA 4CEDA 3AVKA 4FJNA 2G8HA 1TL1B 2P51A 3L2QA 2ASJA 2XCAA 4X2BA 2OYQA 3MXJA 4JV0A 3SFUA 3MFIA 4ECXA 4RW4A 1S48A 4RU9A 4I9LA 3CQ8A 4I9QA 3TAPA 3JYTA 4DLGA 4BE1A 3QNOA 3SPZA 4OPJA 2RKIA 4TLRA 1HMVB 4NZ0A 3TAMA 2OPSA 3IGVA 3KKSA 3E01B 3QEIA 2R8KA 1OS5A 4ZVEA 1UWBB 3CFRA 4EZ9A 3VQAA 1HYVA 4F3OA 5C25A 4HVJA 3M9MB 3RR8A 1QAIA 4ZHRB 2ZKUA 3RMCA 4KI6A 2IAJB 3OL9A 1B9DA 3DOLB 2Y1IA 2X78A 2HHVA 2P5GA 5EUHA 2XGQA 3VQSA 4O3SA 2X6NA 1QSSA 4IRKA 2V0NA 4CEBA 3ZSXA 4IR9A 4YP3A 5DQGA 4YR2A 4FVMA 1LW0A 1HMVA 2W42A 5CZ2A 2QKBA 4JUZA 1BISA 1RT1A 1HJRA 2W9BA 1UWBA 4FZXC 4FJJA 4EO6A 1Q9XA 5KFFA 3DMJA 2IJFA 4CJPA 3L2VA 3M9NB 4E7KA 3WNEA 3TQ1A 3MFHA 1JLQB 3Q8PB 4DS4A 5KFIA 3T5HA 3DRPA 3VA0A 1NK9A 2XGPA 1J54A 1C0UA 3K58A 2GIRA 1G15A 3ITHB 3DOLA 4ECUA 4JV2A 4DS5A 4Q0BA 1WAFA 1HYSA 4ID5B 3KLHA 1VRTA 1CLQA 1HARA 1MU2A 4Y1CA 2UUTA 2XY6A 3H98A 3MEGA 3JSMB 1TVRB 1ASWA 4AHTA 3KIOA 2QE5A 4DFMA 3DDKA 1ITGA 1T94A 1KVBA 3LP1B 4WXOA 3DLEB 1XR7A 1LWEB 3WNGA 3V9SA 3ZT0A 2G8KA 3ZSVA 4IG3B 4XPCA 4H4OA 2EX3A 2KFZA 4UQGA 3HVWA 5KFXA 2UVUA 3ZSZA 4ZMMA 1S1XA 3CJ0A 2OPQB 2XC9A 1A5WA 1KLMB 4Y3CA 1WSFA 1QE1B 3AO4A 2EC0A 4F3TA 3GYNA 3CWJA 4HYKA 4HCCA 3KK2B 3LP1A 3UQSA 3KK3A 5KFBA 1YVUA 3DLEA 4K4TA 4QWEA 3QEXA 1RILA 2DY4A 1FK9A 1TKXA 2E6LA 4URQU 3SFGA 4PA1A 1NKEA 5DG9A 4J9KA 4TSXA 1QSLA 3V6HA 4RZRA 4CFBA 3IS9A 4ECRA 3V6JA 2R8HA 3FSIA 4FLVA 4RW9A 3I8DA 3GIJA 1NOYA 4M3YA 1RCHA 3K5MA 3ZT2A 3MTKA 1JL2A 3SQ4A 3LZIA 4YFUA 2XY8A 3F9KA 4O55A 3HVAA 2WONB 4CEFA 4C8OA 5KFAA 4EBEA 1LW2B 1ZTTA 3RR7A 1XC9A 3U3GA 1IKVB 4Z4HA 4HCBA 3RB0A 1TKDA 1HQEA 4CJ4A 3SV3A 4ED6A 1GOAA 4FLZA 3AA4A 3KMQA 2IC3B 1NKBA 4TN2A 4CK1A 3CFPA 4RUAA 2ETJA 4IFYA 1BHLA 1RTDB 2RN2A 4FZYA 5HBMB 3PY8A 4KPYA 5DMRA 3V1QA 3DRSA 5KFTA 2IJNA 1BI4B 1RDDA 3CJ3A 3NF8A 4CF2A 3HVTB 4DTPA 3SPYA 2JC0A 2PZSA 4XO0A 4AHCA 5EDWA 4Y1DA 4LSLA 1S1TA 1JXLA 3UR0A 2D3ZA 1TKTB 1IO2A 1LWCB 3BSNA 3AO1A 2RF2A 3L2RA 2R7YA 4ELTA 4DQIA 4FJHA 3NKYA 2IC3A 3KLIA 2FBTA 5K14A 4BWJA 5J2QA 2NUBA 3DYAB 1IM4A 3M8QB 4DL4A 5KG6A 4K4WA 4CHPA 2JLEA 5HBMA 4CERA 4FM2A 3PW7A 1EETB 4WE1B 2PYLA 5C42A 4CIFA 2R8JA 4AH9A 2F8EX 3H40A 2AGQA 1U45A 5KG4A 4DTMA 1KRPA 2YKNB 5CY4A 4KFBA 4J9PA 5KFMA 4K4SA 4LY7A 4DTNA 1LWCA 2FBVA 5KFUA 3VQ7A 4Z4EA 4KI4A 4ICLB 4F4XA 4BACA 2OA8A 4CGJA 4MFBB 4CJ3A 2BQ3A 2P5OA 4CHYA 3KJVB 1QQCA 2HHSA 1DTQB 3GV5B 4LH4A 4O3QA 4GC6A 4KKOB 2KZZA 4M41A 3OYCA 1TK5A 4WE1A 2BANA 3TARA 4TYAA 1S6PA 5L9XA 4EEYA 1S9EB 3O3HA 1ASVA 1NK5A 3OYMA 3NGZA 5J2NA 2P1JA 3K2PA 2HWHA 4KTQA 2YHBA 2FLNA 3OSNA 3MAQA 3BJYA 3HSTB 2WTFA 4ICLA 3SQ0A 2G8WA 4MFBA 1QS4A 4FLWA
chains in the Genus database with same CATH superfamily
1RTHB 5RUBA 2J6SA 2UZAA 3PHTA 1RA7A 2RS2A 1AYEA 4KKOA 3LDNA 1T0TV 3LL3A 4NLDA 2MKCA 4B9UA 4ELUA 2XNQA 5L1KA 3AVGA 1I39A 5CYQB 3G82A 2XZTB 1HHTP 4I2QA 1S1WA 1BCOA 3PFEA 3A13A 2FHJD 4WYBA 1B4SA 1HNVA 1S57A 1E6YB 4IG0A 3TANA 3T5KA 4LF2A 2HGMA 4FPAA 2V52B 4DSEA 4LRDA 1SQFA 3UD4P 1OKJA 2UUCK 3S01A 3FGUA 2HBKA 3L7OA 1ZTWA 1S72S 3SAFA 5D3GA 1F60B 1GLCG 3CCES 4QW9A 5BR8J 5LMUJ 1WC0A 4CLWA 3B78A 3I5AA 3UWTA 5LMNJ 1DQAA 1LNQA 3KLFA 3UFCX 1X1PA 3OYBA 4NCGA 4OI2A 4GVLA 2CKWA 5AZIA 1TL4A 1ZBFA 4DTRA 1RKIA 3BKFA 3K5PA 3HZ6A 4KV8A 3UPFA 3WNFA 3QWPA 3VGUA 3GIIA 3NBPB 2B6AB 1XC3A 4PKGA 4JV5J 2IS3A 3BDPA 2HAFA 3EZUA 2EFGA 3OFGA 3R5DA 1U1QA 3IBFB 1FFGB 1KHVA 3KLEB 3B82A 4CDIA 2D9PA 2YHWA 1HFEL 1V9OA 4EIAA 3K7RA 1GLJO 2VC1A 5KFZA 1KSPA 4E89A 2ACMA 1DARA 4Q2MA 4K41A 5AQKA 4WFYA 4B3OB 1F21A 1NZ8A 5BR9A 5E41A 5DG8A 4ECZA 4M5DA 3AY9A 1FE0A 1BCMA 2W4DA 3AO5A 2JGUA 1RWKB 2GFFA 3QEPA 1C0GA 3KLVA 5FLXU 3G9CA 4O0NA 2GVZB 4CYUA 3VF6A 4DFJA 3CMQA 5AE2A 4Z4CA 1ZBLA 1YTAA 2ZZTA 1VQ4N 5D6GA 5KFEA 1RDRA 3UB5A 2IGIA 4CLLA 2YJEA 3R7SB 1O5JA 1KQSR 3HPHA 1EWRA 1MWYA 1YRUA 3W62A 4N8NA 5T7LA 2GHVC 2NCKL 2HFUA 4C11A 4ECWA 2F40A 1SJFA 4F02A 4JP8A 1HNZJ 4FK0A 1JLCB 1DZ5A 4R8UA 1LFPA 3RW6A 2VPXB 3BGUA 3CJRA 2QO3A 5C24B 1T11A 1UVKA 4NXNK 3WXLA 4KB1A 3P38A 1CZ9A 1RTJA 1C6VA 4TQRA 1H72C 4EHTA 3LP3A 3EY1A 5B0GA 2EW9A 3ENVA 2D74B 3H90A 3CJ7A 2FJAB 3D67A 5AXKA 3W5XA 2GA7A 3FMBA 1QHTA 3GZ7A 5KGXA 4NLSA 4KGKA 1RDWX 4WKRA 1VBZA 2MHNA 4LMZA 3SQGB 2ASMA 5CCMA 4NYPA 3ADAC 4Z7YA 2GMHA 2APOA 3MCMA 4KH4A 2K3KA 1DFDA 3PSIA 2PEBA 3L2UA 2W8LA 3VTIA 2MQOA 2MZRA 1TMJA 2R7RA 3C14A 2F96A 1C2PA 1S1VB 2UXDF 1T9VA 1X8DA 3N6MA 4ED0A 3GJQB 3S7RA 1N32J 4R5PB 1N5YB 1VQ8N 1MWQA 1NXIA 4EO8A 1A6LA 2PE8A 3QIDA 1VSMA 1O8BA 4F3QA 4CJLA 3WZ0A 4HT7A 2F9DA 2KRBA 3RMBA 4KTZA 3EX7B 4BGAA 3GSIA 2MZJA 2MY7A 3UCUP 4MKYA 2Q2RA 1JLGB 3PDNA 2UUCJ 4TQSA 4NLPA 3R1HA 1REVA 5ETVA 3RSEA 4FWQA 1JLEB 2E9RX 3WBZA 1EXQA 1WUAA 2QN6B 1HRHA 2PBDA 4ATNA 1VQLN 1NDPA 2A3ZA 4JKDA 3Q7CA 4BR4A 1LXJA 4K0KJ 1ZH5A 3DM2B 3P1GA 3B6PA 3CNQP 3UN3A 3I82A 1ZBIA 1HX1A 3HMJG 3L95X 2VB6A 1P8GA 4OV1A 3QSIA 4GKKJ 4Z7CA 2NRXA 1VAZA 4K50A 2IVOA 1PYTA 4QS7A 2C2EA 2RRBA 2AU0A 3BZKA 4UOCA 1TP7A 5HLFA 4YB5A 3OSPA 2KKHA 2KZMA 2FVSA 2JWLA 2OPQA 1QHAA 2FJBB 2X74A 3QRPA 4ZS6A 1JIHA 4HVZA 5KFSA 4WJBA 4DPXA 1NMEB 4IOAQ 3PX0A 1S7HA 2IY5B 3PO4A 1VJQA 1UFWA 1WG4A 1HWKA 1FRMA 4KTWA 4J2BA 3IAYA 3SZ2A 1GLLO 3EYZA 1ZXOA 3G6VA 2KVQE 3PYFA 5A8RB 9ATCB 3N5FA 2I38A 3J81U 3SSRA 3LGHA 4RLEA 2YHAA 4AT1B 4RBUA 3N6NA 1JK9B 4OJ3A 3C6TA 4IWVA 3GONA 1FEEA 5HVGA 3TWHA 3TJAA 4HLBA 1VC0A 2WONA 4F36A 4X62F 5HVHA 1Z6RA 5F0UA 3PNIA 4MK8A 4CZIA 5IZHA 3BF4A 3M32A 1NGEA 4CIEA 2IJRA 2V50A 3VCDA 1F9HA 4BC4A 1LOTB 1R0AA 1HBMB 1FW6A 2VWKA 4HUGA 3UO0A 4LF8F 2CFXA 3MM9A 1Q7YO 1T9TA 3M6WA 4NXNJ 2EBGA 1U26A 1I6JA 4B3RK 3HSCA 2VDIA 1NK4A 4KGZB 5B08A 1TKTA 3FNNA 2BKOA 3CQXA 4C1NI 4DR4J 1NGJA 2QT7A 3GWCA 2UXDK 2AJ2A 4M45A 1CJUA 4HHUA 4D3HA 4KE5A 3A3OB 1JKHA 1HHQA 3M8QA 2ROGA 4CHNA 5BYRA 2KG0A 1VQLS 1NSKL 5AXLA 3BQ1A 1ZA2B 1WEXA 1VK8A 3SEOA 1WLJA 1U02A 1XMQK 2K1RA 3PTWA 1WSGA 4GVBB 1VS3A 3QAEA 1RT5B 1SKUB 4WU3A 1IR1A 4OLBA 2KRRA 3TZYA 3QMQA 1T8EA 2NRRA 5AQQA 3UKRB 3T5JA 3TA2A 4CJEA 2D1CA 3EE9A 1ZZFA 3L6QA 5ETLA 4J2DA 2OD6A 1BUXA 4J9OA 4K4XA 4C4WA 1VISA 2R7OA 3EICA 1NSPA 5A76A 4L72B 5GMEA 1JL1A 3M30B 2NXJA 3KOAA 4P6QA 4Q8FA 1NCLA 3T5LA 2A6OA 3CCZA 1S6QA 4GMKA 3ENBA 2RQ4A 5GAEI 1MMNA 4BLGA 5HMXA 5KFPA 1KNZA 3NCQA 5LJWA 3H5SA 1R8BA 4QIFA 5T7BA 2Z2MA 4ECQA 3MPWA 3I5CA 1RTZA 4FLYA 1K9MT 4YR0A 2DISA 2J9CA 3DRXA 4IDHA 2KM8C 4JBCA 3VOVA 2OTLN 3R5CA 4BDZA 1XNQF 4WCEQ 3KHYA 5G0RA 1M1KT 5J1EA 2I5JB 1GX5A 1B0VA 3HSGA 3W9IA 5BN8A 3OTCA 3CFOA 3F41A 3PEHA 4LRCA 3QT8A 4QYZK 5EGYA 3EXCX 2C2RA 3OBYA 4NLXA 1LKZA 2MZTA 3OTDA 4O23A 1X4DA 4NYOA 4PG6A 5IM0B 3T9ZA 3V4IB 1TV6B 1IG8A 3Q2TC 2YX1A 4ISFA 4M3TA 1NDKA 2ABYA 4DG1B 3WEEA 1BQMB 4CT8A 2YNGB 4X62K 3BPSP 2FHJA 4JI7F 1QAYA 3OXGA 4WIQA 2XHBA 1ZOTA 4IFVA 4C8MA 1UVJA 2D0PA 3KNGA 3P5BP 1WORA 4USIA 2YWEA 4U6PA 3QAUA 2HW3A 3ZTPA 1XHXA 4NASA 2MDAA 5HRSA 2VA2A 1U4BA 4F8RA 2BM0A 3AD9C 4LF8K 2KJVA 2C1EB 4CVNE 2W6KA 3CJTA 2YH1A 2J0WA 4HTLA 4FJIA 2K06A 1U7LA 3QWUA 2DKOB 4CIOA 2JFKA 2CJQA 2LEBA 4WFNL 1WNEA 4KH5A 2IM0A 5D4NA 4HACA 1CZAN 3G6YA 4K43A 2YNFA 3NGUA 4BQZA 3OBWA 2RS8A 5LXRA 2WOMA 4LIRA 3T1HJ 3QPIA 3MPYA 2VUGA 4JKEA 1RAHB 3L7UA 2M52A 3PYGA 5AQYA 1R8AA 4K4ZA 1YT3A 2IBOA 5JS2A 1RHJB 3JYTB 3TOQA 4LRBA 4OHWA 4U67L 3D9BA 2HG4A 1D8ZA 3KG1A 2HF3A 4DEZA 3HD1A 4MK9A 4BRCA 2FZGB 2CJKA 1NGAA 3E3XA 4KHWA 3THVA 2AT1B 1WBBA 5B8HA 2P9CA 4FK4A 2VGNA 1KAZA 3OT9A 4YOTA 5GIOA 4M94A 2BJEA 3CCRN 3J8AA 1VCTA 1T9YA 2D0BA 3HHKA 4PQUA 4JHDA 2QWQA 3LO3A 3OHAA 1NHVA 3NLCA 1HHSA 2VQFJ 2BX6A 2OTLS 2HNDA 4J9SA 1VRUB 3FZBA 3LUYA 2W9BB 2MSTA 3VGKA 3DMJB 3W65A 1ROFA 4M5KA 3HK2A 2BYCA 5FROA 4OYBA 5GAEP 2ZWPA 1WC1A 3MD3A 1XK8A 4LF4F 3VAHA 4YOEA 1DHMA 1RBTA 2AEJA 1SC4B 1HYSB 4CZFA 1V3RA 2L3MA 4DPWA 1ZA1B 1QAJA 3CC7N 1D9AA 1FVSA 3QZ7A 3RBXA 1D3WA 4PUOA 1F9EB 5A6PA 2FHMA 2NUHA 3BZQA 4E1MA 1N5TA 1TYQB 3UR3C 3SBTA 5BPLA 3VQCA 1YTYA 5M1KA 1C0TA 4H4OB 3A8EA 4CLFA 1ILYA 3QLHA 3KFWX 3U7JA 2VG7A 1C1BA 3DLKA 4LF5J 1HNWF 3GFZA 2IVYA 3LZJA 1VQNN 2GBZA 3HHLC 4KH1B 3KD5E 3N79A 2OFGX 1GLFO 3AGKA 1RDBA 1WBDA 2RIJA 3D2EB 4CFDA 4FPRA 2K7KA 2RE1A 4YDUC 3BGFA 4PWDB 1VYAA 2DHGA 3VERA 5DRKA 2LYVA 5AXMA 3SDEB 4FYYB 4J2EA 1GXTA 1YAGA 3CDBA 4KH0B 3S3NA 4QYZJ 1N48A 3W66A 4JI7K 4RW9B 4DU4A 3CO9A 1FJGF 3W2WA 5KFGA 2OIHA 4ERDA 5CZVA 2HNZA 2F9TA 1NK0A 2FHKA 3DCAA 1KLNA 3QO9A 1WUUA 2Z57B 3O9UA 3AO3A 3AT1B 4NO7A 2B4OA 4CIGA 4B3TF 3THWB 1EQYA 4KHSA 3G4SN 4DL5A 2NLXA 4IO9Q 2V9KA 1UJ4A 1Z1ZA 1L3TA 3PIPL 2F9JA 1CSJA 4J37A 1C1CA 3TW0A 3DDIA 1H2TZ 3DWLA 4X62J 4M3WA 3TABA 4FWRA 3AXKA 1NPKA 4WQ4A 3TU5A 4C6AA 4A8FA 5HROB 2B8QA 5FPNA 4IFYB 1KS2A 4FW1A 2RAQA 1QQOA 3MPDA 3HCXA 4EYHB 1JJHA 1YQHA 2M70A 4E1JA 4DPTA 1K73T 5GAEU 3DRSB 3QEVA 4O4RA 4WP9A 3GR0A 3CCRS 1LQ9A 3LM2A 2Z1JA 3ISND 1X60A 3OXFA 3B6OA 4KIAA 2P5VA 3FJ2A 1S1TB 2QTWA 4Y65A 3H0PA 5AQTA 4KQZA 3QBCA 2KXNB 4LSNA 4ZCMA 3DXKA 3O9SA 2Y8YA 3MR6A 3A0IX 1IKYA 3KLIB 4ED3A 5K14B 3I33A 4DV0F 5J2QB 1R6VA 4G9ZA 4I7FA 1NK8A 2B9EA 4JS5A 1BY9A 2ZD1A 1X4EA 2P9KB 3PR5B 2W40A 1FNOA 4O0JA 1G7CB 4LC9B 4ES3A 4OVLA 4UW2A 1G4CA 1KVCA 1KVKA 3CC7S 3KJNB 2F4VF 4P7VA 1XWLA 3I96A 1UAWA 1W2BM 3TZWA 5I3UA 4DTOA 3UDLA 1ZETA 2RDJA 3FK4A 2EFPA 3OJUA 3D68A 3NWGA 3PR4A 3CDEA 5AQWA 2DEIA 4UUXA 3MDFA 4B3SF 5EWEA 5KG3A 5FD1A 3N9UC 4GKJF 2LVWA 1HNIA 2VA3A 3P31A 4LF4K 5AZJB 4USWA 3OVSA 1S6PB 4F2SA 2UXCF 3H3OB 4KRWA 1HPZA 4XDCA 4K25A 1IR0A 1VQNS 4CJWA 4UUWA 2D3UA 3BZCA 5E33A 4P2SA 3CCLN 4Y2KA 5CZXA 5HP1A 2ZVSA 3D7SB 1JJ2M 3W9JA 4CM2A 3ZYYX 1C0MA 1W9HA 4CEOA 1RHQB 2E1YA 5F41A 5J2MB 2XI2A 3CB4A 4M5JA 1CC8A 2MXYA 1HWJA 2EG1A 4ED2A 3SNNA 1IJEB 4ZTJA 3CIMA 3AO2A 2ZM6F 3SYZA 2HS3A 3B4MA 2W6LA 1HNWK 4AHUA 2DPNA 4I2PA 2OD4A 2HLTA 3W8GA 3G82B 1VSFA 2GGPB 2AYBA 4I2QB 2E2PA 4J8FA 1S1WB 1JCEA 1V4SA 4B9MA 1VSDA 1HBNB 5DDRC 4ANCA 1HNVB 8ATCB 4IG0B 2W7PA 1XNQJ 3G4SS 5F1XA 2X1AA 5LT5A 3D66A 1NK6A 4QS8A 2MGZA 2DGWA 3CI5A 4XPEA 2G1DA 3E9LA 4RWWA 4Y2MA 4HI1A 5F9NA 3OYNA 1KN6A 1N5VA 4DUZF 4JV1A 1FJGK 2PFUA 2KTQA 4H5WA 4ZPVR 4CLSA 1WKKA 2A42A 3OL6A 2QXFA 2CADA 3KLFB 2VASA 1HD1A 3C15B 1VI7A 5B09A 4DV5F 4YOXA 5AZIB 4TY8A 3NXZA 4DV4F 5DQIA 4MDAA 3NH0A 2E5LJ 3OHBA 3IXQA 3SMPA 2DFFA 1WOQA 2WVEA 2FY1A 4N56A 2HHPA 4ETXA 4JI7J 2M5YA 4UZBA 5ETRA 3JTOA 3SV4A 4WFZA 2QMUB 4ZP8A 3QESA 1NAQA 4EU0A 3NCIA 3Q8QB 5EX3A 1N34F 2HRUA 1LCUA 2W1BA 2HVHA 1RCOB 1UETA 2XI3A 4J7CA 1HKBA 3Q8UA 4Y2IA 1BO5O 2ZWHA 4ZLNA 3HZEA 3GU0A 2J7KA 3MM6B 2YPYA 4M3XA 1RT2B 3C6HA 4CYUB 4DV0K 2Y9HA 2BV3A 4YUDA 1VQ6N 2PEHA 3ZSOA 5A2QO 5LSOA 5CYMA 1RBLA 2A1BA 2OPRA 3RB3A 3VETA 1QZ6A 3QGIA 4U7UD 5KQDA 2DPIA 3DLLL 3FVYA 2HGLA 4MTPA 2AJ4A 2F4VK 5FIIA 4F0KA 3FSXA 1WEZA 1KC8O 4FYVB 3FUYA 2E2NA 4C11B 2CA9A 2O66A 2R2SA 2XG8A 5BYSA 3PM9A 2YNIA 2DTUA 4R8UB 2HS0A 4AE5A 4GKJK 3GV8B 4JI3F 2C2OB 5IXUA 2XCPA 1V5IB 2H9ZA 2VH7A 3A2FA 4M3RA 2R4FA 3UE2A 4O3RA 3EE3A 1KR4A 3GPAA 1UPPA 4IRCA 4JKHA 2QYGA 3WDOA 5L1IA 2VF3A 3UN2A 3HX9A 4DL2A 1HLWA 1EIYB 2RKIB 1RGIA 4RUCA 3G71S 4CFAA 2CPIA 4HI2A 1C4AA 4X4OA 1Q86O 2ZC4A 1PO6A 4OO1J 3V9UA 2ZM6K 1YRXA 2WVBA 4LF4J 2VONA 4FJNA 5THWA 2VL1A 1HKCA 1DBDA 3JS9A 4QIWD 2GO8A 4JV0A 3SFUA 4LR7A 1QQNA 4BRPA 3M5RA 2C42A 3TAMA 4U96A 2UV8G 3KKSA 4X4RA 2R8KA 1OS5A 1UWBB 2BA9A 4BRLA 3VQAA 5C25A 4DUZK 3Q7BA 3DOLB 4OYZA 3HRGA 3GCWP 2HHVA 1X5SA 1O51A 2XGQA 4O3SA 2B56A 1X4HA 2X6NA 2A2CA 3CCTA 4DPYA 4CEBA 5LSRA 1LW0A 4A5BA 1NPPA 1Y5LB 5E84A 2W42A 3EL2A 4WP3A 4DV4K 3OW2M 1BISA 1HJRA 4UOHA 4FZXC 1W7WA 4CJPA 2P6SA 4AL7A 3MMVA 3L2VA 4E7KA 3FKBA 3RSEB 2DTJA 3TQ1A 2H48B 2GELA 4TU7A 3SSSA 5KFIA 3VA0A 2XGPA 1J54A 3K58A 4ECUA 2VZ9A 2J5AA 1WAFA 3KLHA 1VQ6S 5FJ4A 5D15A 5GVQA 2VOPA 3C16B 1N34K 4CO0A 3ENAA 2QE5A 1KVBA 4B3TJ 1BDGA 1YBAA 3M2VA 3JAMO 1YJWN 1IN0A 4JI6J 1XR7A 1CC7A 3ZT0A 1M5HA 5AQOA 4S0MA 2WW4A 2V67A 2EX3A 3S1TA 3MZIA 3LQVA 4Z94A 1S1XA 3CJ0A 4JI8F 2OPQB 5HQMA 4WQ5A 1WSFA 5BRDA 2ZOFA 3AO4A 2QA2A 4A2AA 2F4FA 1KTVA 2NQPA 4FVUA 4HYKA 3LP1A 3UQSA 1NB2A 4R25A 3K89A 3ILIA 3DLEA 4HR2A 3ZO7A 1TKXA 2E6LA 1YJUA 4URQU 1KQKA 3W1YC 4TSXA 3DXBA 2P9IA 5B0DA 2A41A 5K5MA 3IS9A 3HT0A 2XYGB 3UNGC 2EWSA 5FLXO 4CQ1A 1NOYA 4DV0J 1GXLA 3AOAA 3UDVA 1FERA 1UFKA 1UJ5A 1QVGR 4J91A 4JI3K 3ZT2A 3DKDA 3MTKA 1OSCA 2J4RA 3P4UB 5GAGP 1BWVA 3MUMP 4R79A 3J80U 2WONB 4Y0WA 4LRFA 1SB6A 3BYRA 1WTFA 3EDRB 4W4MA 1TKDA 3SV3A 4ED6A 3CPWR 4FLZA 3E9PA 3M32B 3KMQA 1PC5A 2ZOMA 3MUTP 4B3SJ 2GUPA 1TL7A 1N33F 1NLKL 2Y0BB 4ILGB 3CFPA 4RUAA 2W4CA 4ZOSA 5HN0A 1FRIA 1YI2S 4KPYA 2UXCJ 1M5PC 4NWBA 3MM9B 1RDDA 4K7QA 3CJ3A 3SPYA 2E5HA 4XO0A 2HWTA 1FRKA 4Y1DA 4LSLA 1E6VB 4E8UA 1TKTB 5I3PA 3IM8A 4BCAA 4QR1A 5BRHA 3L2RA 3O8MA 3C8YA 2DNGA 2IC3A 1PAEX 2HQ3A 5C7PA 1CJUB 4BRGA 4FKXA 5E3PA 2NUBA 2EFOA 4JI4J 1F2GA 2ZM6J 3M8QB 4DL4A 3NMUA 3E1YA 2JLEA 3CE8A 5MLCV 1UW9A 2YWKA 4WE1B 2CVEA 2K1RB 2GZOA 3JS6A 2F8EX 2HOEA 1C4CA 2BUPA 5HQ8A 4MKVA 4J9PA 4TVAB 2L41A 1VQOS 2AEMA 1PGZA 4K4SA 1OY8A 2OEMA 4Z4EA 4BACA 3VMFB 2OA8A 4MFBB 3MTJA 2LXUA 4ILRA 1T6DA 4CJ3A 1N52B 2P5OA 4YB6A 1RAOA 2IPOB 2FJDB 3D1OA 1HKGA 3TVYA 5M2UA 4CLYA 3AFGA 4DUZJ 3TTFA 1NSAA 5KAKA 4M41A 3TARA 2A18A 3LDOA 3W8PA 4OJHA 3RGIA 1OQ3A 3C65A 3FCHA 5J2NA 4D3GA 3A8YA 4DV5J 3P45B 5BYQA 2HWHA 3V5RA 3HSTB 4ICLA 3U1NA 2R7WA 3GG0A 3TUZC 4DV4J 2G8WA 1HBOB 2V94A 3LDPA 5GAGU 1U0SA 5HVFA 1S49A 2W7AA 3DGPA 1Z2ZA 2JZ5A 5HQLA 3AOCA 4H0OA 4RBVA 2QL5B 4JI8K 3CMAS 5HJYA 2KFNA 4E2FB 1CJVA 3A5LC 2EKYA 1TFYA 4J9RA 5G0RB 1B9FA 1RADB 1N34J 5J1EB 2R2UA 3NFAA 1YSJA 2D5RA 3GIKA 1TELA 8RUCA 4MK7A 2B43A 4A8KA 4H0PA 1FX4A 2VFTA 3ENHA 3KG0A 3NS6A 3PXGa 2HBJA 1S0MA 4G6VB 2A3JA 1RT6A 2RRAA 1BWFO 3F5TA 2ZE2A 4WK1A 3J7ZT 4YY3F 4A4JA 3N28A 1GLAG 3V6DA 3EKUA 2CZVC 2PYJA 2QYCA 3KWMA 2DITA 2RHSB 4CF9A 2M3DA 5AR0A 1NGCA 1WSEA 3Q8SB 4CD3A 2FHOB 5LM7E 1BIZA 1WSHA 3S9HA 5M1QA 3ZFVA 1KHWA 1RYRA 1X9WA 2UP1A 2F7TA 5JS1A 1RE1B 4KO0A 4AM7A 1QVFM 5C2CA 4NA1A 3ZSWA 3CJQA 2IRUA 2ZHAA 1N33K 1WI8A 4EYIB 2Z56B 2E5JA 1KQSM 3VQQA 3O1WA 1KAXA 4JI3J 4FPBA 2IA6A 4ZJQA 2HEKA 2LFVA 4DX8H 4RU2A 1IQTA 5CR4A 2HNYB 2HF4A 5A2QY 2ZBPA 2UYTA 1JXEA 4UZCA 1O6XA 4XIUA 2RRNA 4UOGA 2YY3A 4HACB 2YNFB 3K8WA 4M95A 4RW7A 1TU0B 3NNHA 2V9WA 2LQ8A 3GIRA 4ZPDA 2WOMB 3RZAA 2DXEA 3TAGA 2OMLA 2NPIA 4HDHA 5D0HA 1GEHA 4ALZA 3OV7A 1OWXA 1YTUA 3KLEA 1IKXA 3THTA 2KLAA 5F3TA 1IJJA 3BUZB 4JYAJ 3QRRA 4B1VA 2IRXA 5KT3A 4C0OC 3KTQA 4ZP6A 2X1FA 3AVLA 3MCOA 5AE1A 5H9EJ 4DFKA 3QIPB 2O8CA 1KEKA 3PW5A 1EWQA 3N0VA 2F8SA 5B7WA 5ITHA 3D0PA 2E9TA 2VPWB 2FJWA 4CHQA 1UVNA 2GWJA 3VTHA 3O9QA 2FLLA 3IAM9 1N88A 3DI6A 4V1Ak 3NGRA 1V4TA 4O44A 3CG7A 5LJVA 2JWKA 2PAVA 2ALZA 1B0TA 5E26A 5K8PA 2VODA 4NLYA 4BRFA 3G8TA 3MXIA 3IWLA 4HHJA 4MYUA 4Q43A 4KAZA 2ZWOA 1RBRA 2Q43A 3EO3A 1X4GA 4AD6A 5KG2A 1TKZA 3CCVN 1M5SA 2FXUA 3ID8A 4A8WA 1YJ7A 2VU5A 3DLBA 2DRBA 4U8YA 4F2RA 5C24A 2DR6A 2W24A 4DR3K 4PUOB 5E5NA 4EI2A 1MWMA 4FOEA 4FNHA 4CGFA 2I1RA 4LF6F 1DQ9A 3LP0B 2VJVA 1UW4A 2P9SA 1GLEG 1C0TB 3CD7A 2F8HA 2BKNA 2O01C 3QLHB 3NS5A 2BKPA 2VG7B 1C1BB 2MLYA 1WOPA 4CJKA 1ATNA 3DLKB 2DR8A 3VQ6A 5M2RA 3EZ5A 2CQ1A 4B1YB 2AYMA 3FE1A 1IV0A 1SC3B 3TTCA 4F3MA 4KT0C 2XMVA 4MAKA 1SIZA 1K9MO 4YY3K 4B9VA 2IAJA 4BR9A 2F3JA 4X4PA 3Q8RB 2OTJN 2LU1A 3W63A 1R3NA 3HL8A 1PJ6A 4YMEA 1B7YB 3CCSS 1S1VA 1X9JA 4GC7A 3W60A 4FJGA 4R5PA 1BC6A 2P9LB 3OTBA 4CGGA 3W2WB 3VAFA 3C6AA 3JAMY 1K0VA 3ENQA 2IVPA 1K8AT 3QO9B 5GIPA 2CQBA 1U6FA 1VQKN 1EKRA 3FZLA 2HVIA 3F73A 3CCMN 4CECA 1TVRA 5FRMA 4I6MB 2HZCA 4C98A 4J9NA 1SVDA 1H2UX 1JLGA 1UVIA 1C1CB 1IH7A 3D6MB 5LY3A 3BKUA 1H7WA 3Q83A 4HT5A 4IG3A 2ATLA 3PV8A 3ZEUA 3ULEB 3KYLA 2C2KB 2CPEA 3ASMA 1Q0NA 4WTYA 1N33J 3HDSA 1N36F 4ZITA 4DPUA 3CF5Q 1Z25A 1F5AA 2CH5A 1Q4RA 3CMES 1QE1A 2QW9A 2HRYA 1CPZA 4U8VA 2LEPA 4AHRA 5FLXY 3PX4A 4B1XB 3KK2A 2NLWA 1M0SA 3KUGA 1LV5A 4CJ5A 3LAKA 4LSNB 3DXKB 3WXJA 2JEJA 2HQIA 3V1OA 3S3OA 1IKYB 4XTTA 4BBYA 3MM7B 3AARA 5AQFA 1SV5B 4TY9A 2DGOA 2HVDA 2HBMA 2CGKA 2CJBA 3QICA 1PG5B 5AQZA 4I7FB 2R7SA 4U9RA 4B3MK 2ZD1B 4I56A 3HT3A 2JLGA 1XUPO 4WFBQ 3VAIA 3T1YJ 3CCVS 2QGFB 2DT9A 2GCFA 4CJTA 5KT2A 2KW4A 2BJ7A 1WACA 2FB0A 2XTJP 2ASOA 1ZC6A 3NWRA 2OH2A 3AVNA 4AILC 5I3UB 1BLUA 3ENWA 3TNVA 1S5JA 3AB4B 2GIQA 3NRBA 4UY8O 1YUWA 3ZCMA 3L8BA 4DV6J 1VBXA 3MMCA 1O0PA 5CZ1A 1HNIB 4PXBA 5F0XA 4ED7A 3WIVA 1ZPVA 4NMLA 1RQ0A 2ASYA 3LWLA 1HPZB 1K44A 3TVKA 1NRKA 5DZ7A 5KFDA 5HP1B 1RB0A 4FW2A 3R6LB 3R3LA 2I7PA 4LH5A 4LF6K 2JEFA 2WHOA 1CJKB 2XMUA 1HBUB 5JLFA 4FWPA 3M6VA 3EGNA 5CA5A 4RO0A 2OCEA 3NY0A 1Q78A 1VHFA 4EP5A 4ZVHA 5JMVA 2R42A 1OPZA 1HBMA 3OYEA 5AXNA 4I2PB 5AQJA 4U7UK 7FDRA 4PAAA 2BOPA 4QJVA 1EETA 4FJLA 4HUEA 5KFVA 4OZ5A 4RNHA 2GQQA 4NLUA 2EVZA 3RBDA 4YOUA 4JS4A 1VQKS 2E2QA 1IJFB 3BH6B 2ZKTA 3CCMS 2HBRB 2YKNA 4DR6F 1TUYA 1T3VA 2MGZB 2IIHA 4YS2A 1KTQA 4KHQA 4QWBA 2BMBA 1B3TA 4NLBA 4BDPA 1H6KX 3M6GA 3THYB 1GOCA 4OQJA 3MR2A 4JI0J 3ZNJ1 4A61A 2CPDA 4A47A 4MKAA 1Q79A 1NMNA 4A8QA 3MMAA 5A0YA 3PCOB 3LDSA 4DTUA 4WWSA 1FXXA 1TK0A 2NZCA 1J53A 3M2UA 3EMTA 3ZZYA 3HXMA 1RISA 1RT5A 3QATA 1FT8A 4RUBA 2UVWA 2AGPA 1S77D 3K0JA 4TY8B 4M7YA 5EHHA 6AT1B 3H25A 8AT1B 3UKRA 2QLJB 5DO2A 1Q8KA 3IMXA 2ZFHA 2FBXA 1JLFB 2JWNA 3L3CA 3VEWA 2VCPA 5JUMA 3CCUN 5T14A 4DV1F 1MROB 4DSIA 4C9DA 3S3MA 1D0EA 3V81A 1B70B 4EBDA 3G96A 2GV1A 4M63C 1FKPA 3M1FA 2CDQA 2V8VA 1N36K 1NG9A 4GRSA 4H54A 3EPIA 2E7XA 4YOWA 1BQXA 1Y3KA 1FTCA 3V1RA 3DAWA 2JDJA 4CW7B 5C5JA 1WC5A 4Y34A 4AL5A 1A5VA 1ZYQA 1ELOA 1DLOA 2X51A 3RBEA 3VPZA 3TJ8A 2DNOA 4MIWA 4DR1F 1T05A 4DB3A 1CZBA 1NJIT 5CYMB 4JK9A 1SQKA 4MKBA 4BC5A 1K73O 4DX5A 1MN7A 1RK8A 4M8LA 1JMTA 1R0CB 4BE0A 4E7IA 5AQPA 3S6EA 1VQ5N 2JEGA 2RMLA 2E6MA 3J81Y 5G4DA 3HFVA 4DV3K 3H4DA 1WF2A 2Q31A 2XMJA 4DV2F 2E7WA 3CJ4A 1YHQN 2CQDA 2N7CA 3VZIA 5L1JA 1NMDA 5C0YA 2YNIB 2J9DA 1MSWD 1XHZA 2J0QD 5IM0A 4ECTA 1TV6A 4LF9J 2A1RA 3FBBA 4OV6A 5KG1A 3KK7A 4M5GA 3TEGA 5ETMA 1IBMF 3MCPA 4LVOP 1SXLA 4CHOA 3IP0A 3T9NA 2BUNA 2NRTA 3UKUB 4FS1A 3CYMA 3CD5A 3R7NB 2YNGA 2G0IA 1IQZA 2IBKA 2M0GB 3Q8YA 2NSBA 3SCXA 4IXCA 3OFEA 3ZSQA 5K9FA 4DOZA 4OI4A 1EX8A 4WYWA 1IKWB 1KQFB 5JVHL 1QUVA 1RACB 1XI1A 3HPOA 4O8KA 3V4MA 4QIGA 2FPHX 1VSHA 3CJ2A 3A8IA 4CZCA 3CC4N 4E1NA 2HZVA 1RAGB 2QWOA 2HIQA 5EOYA 3IUCA 3UW1A 1YZ6A 1Q8IA 1ITPA 4DR6K 1U1RA 2OELA 4C8NA 3CTRA 5KFYA 4QW8A 4DN9A 5DDQC 4MIBA 2ROPA 3CCUS 4AHSA 2V8HA 1CULA 1ICEB 3CO0P 5AQHA 3M2RA 2LP4A 2BJ9A 1SQGA 1TFWA 1RP5A 2ZQBA 1W97L 2FTRA 2EFNA 3MK6A 1RLDA 1LW0B 5IT0A 4KBIA 1FNMA 3FLCO 2O8EA 4L3KA 1TUWA 4FYDA 2BQUA 4IDKA 5HK4A 2MKSA 3MURP 4ISGA 3SCKE 4DV1K 4O3NA 1J5EF 2RHKA 3J7YI 2B51A 4KJIA 4F7VA 3KLHB 3SQOP 2QZ8A 2QWLA 2MZQA 5KFOA 3K5LA 4BRIA 2HIYA 3M8SA 1U04A 4WK3A 4LQ3A 2WSFC 3FEZA 3CDWA 5F8MA 3AVFA 3M2VB 4H5RA 1VRUA 2C3OA 3ZZOA 1YIJS 1RDCA 3WNHA 4CK3A 1RT3A 2WSCC 1VQ5S 2VKZG 1M1GA 2KVIA 1XMOF 2HBQB 2YWFA 2V7YA 1YHQS 4F67A 3PO5A 4OKJA 4DR5F 1W7AA 1AT1B 3TUIC 2NXNA 4OGCA 1IBKF 3QETA 5KG0A 2FC8A 1S1XB 4FZVA 4EHUA 1J6ZA 4DR1K 1UZHA 3DHXA 4RW6A 2UUWA 4Y0FA 4BRDA 1BA0A 1AW0A 3QFHA 3VGLA 2CZ4A 4P71A 2G2OA 2KYZA 2K7JA 1D09B 2BXJA 1Q8LA 1TYQA 1SJRA 1TKXB 2UUBF 4O3PA 1X0PA 4ER8A 3WX4A 3O9TA 2ZH7A 4L6V3 2P9IB 4DV2K 3R2DJ 3MXMA 4PWUA 1IM6A 3IS9B 1VIXA 3VQEA 1DTTA 2XWYA 3OVNA 2XY5A 5AQMA 3OS1A 3O4NA 5AQRA 4WF9Q 4CT9A 3QBWA 2HLUA 1MMDA 3D7EO 3R2CJ 3FZ2A 1IBMK 3R1LA 2YKPA 5DM6Q 3CM5A 4PWDA 2CQ3A 1D4XA 3PX6A 3CC4S 3SDEA 2VBZA 4AYBD 4DQSA 4NB4A 3IM9A 4IOCQ 1N0VC 2G2ZA 3QERA 3DJCA 4FJMA 2H4WB 3LANA 1U6BA 3C46A 4OHZA 2RD5C 2V8DA 5H9FJ 1ACMB 1TL7B 3GR1A 1FD2A 1LWXA 3D3CJ 1SL1A 2XMWA 1A9NB 4N41A 2HBLA 2G2YA 2BJ1A 3THWA 5DQHA 2V51B 1VQ7N 4FF2A 3TQEA 1MW7A 1LAVA 3EUNA 4EP4A 4LSLB 2MMYA 1ZZNA 2J8AA 3G10A 5LXYA 2MLXA 4CH1A 5HROA 1YLXA 4DU1A 1NGGA 1Y3JA 5IQ6A 4JI2F 3E8OA 2KJWA 3LA0A 3TO8A 4ECYA 5AJ3F 1LK5A 3AA9A 2E66A 4RNOA 4ZK7M 1KC8T 3AH6A 3HKZD 1Q16B 2E9ZA 2L9NA 1BE4A 4DR6J 2LQ5A 3H2LA 2W2NP 1OH8A 2G8IA 3PJXA 3IKMA 4NRUA 3F56A 1HKAA 2JL9A 5TKWA 4Y2CA 2QWRA 4FYXB 3QGHA 3I5BA 4CH0S 1J5EK 1XNRF 4KH6A 4YB7A 3DXSX 4A59A 1YWXA 2VG5A 4ZCIA 5LL6Z 1XMBA 4LVNP 4FZZA 2BQRA 5J2NB 5M1NA 3J7YP 4CEEA 3CEDA 3MUVP 4I67A 3MX2A 2N82B 5BPNA 1RKJA 2DY9A 3AA8A 1NGDA 4UT4A 3KJQB 4KHYA 1XMOK 4YHHF 4J9QA 3G6EN 4BR2A 3G6XA 2J6TA 1SKSA 4C8YA 2KYXA 2Y1LB 2DFEA 4LFBF 4CZHA 4BRNA 4DV1J 1GFWB 5CCLA 2Q3PA 1IBKK 4A8MP 4BG8A 5A8KB 3T41A 1CJVB 1HR0F 3A3NB 5ETTA 2CRLA 2Q0RA 3HHLD 2HHUA 3GB0A 2FLPA 1LWFA 5ETNA 1FHTA 4KBOA 3EGZA 5K8MA 5J2MA 2UUBK 1P1TA 2FJVA 2XS7A 4DF4A 2ITMA 2IRYA 3BGRA 1VR6A 2KL8A 1RT6B 1RJJA 3P6YC 1XR5A 1DGKN 1U09A 4TU9A 4A46A 4FLXA 2VOOA 2ZE2B 2YH0A 4NPOA 5GADI 4HH0A 3SMSA 2A1SA 2BH1A 1N6QA 3V6DB 5HMYA 2R2TA 4DR1J 5C12A 3ZTQA 2GGPA 2IMOA 1DURA 4PG8A 2I2YA 3M8PB 2DCLA 5JLHA 3FZHA 1NWKA 1UA0A 1G99A 2YPZA 1HBNA 2HMPA 5ADXA 2YX4A 4BRAA 1Z4UA 1SKWA 3J7AN 1VQ7S 5CQGA 1JWWA 4ZTFA 4Y2AA 2B3TB 2HHHF 4CWBA 1SPBP 4QBUA 4X4VA 2ZJRQ 3FEYB 2YHYA 4KO0B 4DV2J 3GJRB 1A7GE 2P9PA 3H08A 4CZGA 3VAJA 2H1YA 3OS2A 3NHGA 1K1QA 1H3DA 3CJSA 1NU0A 4KGMA 3N4QA 5EXWA 3C15A 1HL6A 2E88A 4DQPA 1S10A 5IWAF 3PYDA 3IMQJ 2YWWA 1IBMJ 4ED1A 4NX9A 3WT0A 1SH2A 1YG0A 3VAGA 5KFRA 4A8SA 1TMMA 5H1SQ 5JVGL 2RE2A 1R8HA 3IR7B 3GYGA 4F4ZA 4NXMF 1SC1B 3J7YU 4RJVA 4RW7B 1U24A 3UCGA 1R6YA 2CJYB 2D41A 2DO4A 2C2DA 4H03B 4NLWA 2CDRB 1IKXB 3NGKA 4JI2K 3TP2A 3FR0A 5AJ3K 1V3ZA 3R3TA 1VQ9S 4MQ3A 2MKYA 4HTJA 3CCJN 4FJ9A 2OZSA 2V2VA 3VAKA 2RHQB 1PCAA 3JQJA 2W2OP 3NE6A 2C22A 3LPYA 4OI0A 1HI8A 2XMTA 2O8CB 1CBKA 3JTNA 2YJFA 3FDSA 3MM6A 4CESA 1RT2A 2V4JA 2NZ4A 4N8OA 1RZMA 1EB0A 4NMXA 2ACYA 5KFQA 3DI6B 2E1ZA 1H0HB 4O44B 1FRHA 1XNRK 4LBPA 3IN5A 4CCHA 4WFXA 2RNEA 3AGRA 1UAXA 1N5SA 2FUG9 1D9DA 2NXEA 4FWNA 1LAWA 1NNDA 3I31A 4OL8A 2IVNA 4F4KA 4B9NA 4NCAA 4LBIA 4MH8A 5KOWA 1S0OA 2FVRA 2Z1HA 3NAIA 4IFEA 2GO9A 2A40A 1YZ7A 5DZ6A 1QZ5A 2EFVA 3CERA 3C7NA 4ZVTB 4U67Q 4YHHK 3OYJA 2GNKA 3HZGA 3THXB 1TKZB 3NNCA 3AVJA 4IOXA 2QV6A 4DTSA 4LFBK 1VK3A 1J5EJ 3AVKA 2G8HA 2FSKA 1IWGA 1HR0K 4N77A 3M3ZA 2RDDA 2OYQA 3HHNB 4RW4A 1S48A 2VFSA 2M9KA 1PYSB 3CQ8A 4MDBA 1RFQA 2P9SB 5BPMA 4DLGA 3G2XA 4BE1A 4OPJA 2RKIA 1HMVB 3BF1A 5LOQA 2OPSA 3IGVA 3QEIA 1HIYA 4PCQA 3B8HA 4AQYF 4NLCA 3AAWB 4DR5J 1R43A 2QL9B 4AXIA 1KWMA 4OYOA 1IBKJ 1EJ7L 2ZKUA 5HOOA 2IAJB 2CNKB 6FD1A 2Y1IA 4B3RF 2X78A 5GADP 4O8UA 4KHPF 1QSSA 3CJ9A 3ILJA 4OFZA 4L76A 1RAIB 3C0BA 1OH7A 4IR9A 4YR2A 2NS1B 4FOIA 3EXYA 2UUBJ 5CZ2A 1FXLA 2HHHK 1FFSB 2QKBA 1UWBA 2CPZA 1IUJA 4FJJA 4EO6A 2JVOA 1Q9XA 4FWOA 2IJFA 5CD4A 4X66F 1GH8A 3R27A 3WUHA 3WNEA 4FSVA 3BM7A 3T5HA 3CPEA 3DRPA 4I64A 2GIRA 2DGUA 1XMQF 4JV2A 3DOLA 4BVOA 3BPDA 3J7ZO 4LR8A 4F04B 4RCHA 1MU2A 4Y1CA 2XY6A 1AA1B 2RJZA 3H98A 3MEGA 1TVRB 3SMZA 5IWAK 2AZ1A 3R5JB 2B0GA 2HPUA 4XDDA 2QWMA 2LECA 3T6JA 4OYXA 5CABA 4ED5A 3ILOA 4PYDA 3HF5A 1QVGM 3L09A 3J7A1 5B0EA 3HFKA 3F2KA 5DM7Q 2LA6A 5CH7B 3ZSVA 4IG3B 4NXMK 3ZEUB 2AJ1A 2XMAA 3HVWA 5KFXA 2UVUA 3ZSZA 4LFAF 4ZMMA 4C97A 4CZMA 4MO4A 2AJFE 2MQLA 3C16A 3O8WA 1VQ4S 1QE1B 4F3TA 2CPHA 4JK7A 3CWJA 2E5GA 3CPWM 4HCCA 3KK2B 5KFBA 3KK3A 4HTIA 3B6BA 3M6UA 3WQTA 2DNRA 2CGLA 2P2CB 2DNNA 2XYPB 4C3KA 3ETOA 3PIPQ 1QSLA 2OAUA 3I9V9 2E20A 3L0QA 3V6HA 4CFBA 4ECRA 1S12A 3KZBA 1X4CA 2PD1A 3UVJA 2ZEJA 2CNOB 3RBZA 1RCHA 4JI2J 3PLAA 1YDLA 3K5MA 3QFWA 1I94F 1JL2A 5AJ3J 5BJRA 4EMDA 1IBLF 4YFUA 2LQBA 1O13A 4W90B 2DRAA 1YJ9N 3M7VA 4JI5F 2PN6A 5AQVA 3TSUA 4Z4HA 5GADU 1M5VC 2G0CA 2OEKA 3RB0A 1HQEA 2FZCB 3MMCB 3JSBA 4I4BA 3NOGA 1Q7LB 2HQGA 1P1LA 2ETJA 2Z2YB 1DKGD 2Q97A 4FZYA 5HBMB 1UZDA 2ZC3A 1WKJA 3BGOP 1APSA 2MJNA 1X3NA 2PMWA 2PZSA 3MAAA 5AE3A 5EDWA 5ETPA 2ZITA 3MWTA 1IO2A 3ZZZA 3ONQA 5HL7L 1WELA 3DXMB 4LF7K 4H0XB 3NKYA 1YJNN 3ULHA 4YHHJ 2AD9A 3G87A 2PDAA 1UJ6A 4AQYK 1VQ8S 4ED4A 4P2FA 4CHPA 4CERA 1OY9A 4IEIA 1EETB 5AFUA 2GHWA 2R8JA 1UL3A 2DNHA 3SIPB 2AGQA 4DTMA 1KRPA 3HSDA 4KHPK 1TL5A 4PZVA 2YKNB 4KFBA 5KFMA 1E6VA 4ZIVA 1AUDA 4LY7A 4DTNA 3MWPA 2FBVA 5JJBA 2VBYA 3DC2A 1VQPN 3TSQA 3EE8A 1J2VA 1FCAA 2QM1A 1SQEA 5BN9A 3P3DA 1QQCA 1R0BG 1NO8A 4X66K 2HHSA 4DHVA 2ZJQQ 3MMAB 5A0YB 2VC0A 4RR5A 2ZH1A 4QU6A 2ZBCA 2KZZA 4WE1A 4AFFA 3GG1A 3M2UB 3E2EA 4EEYA 2P9UA 1WDTA 4K42A 4BC9A 5GAHI 3OYMA 3POTB 3NGZA 2P1JA 2GAHC 2Q66A 4EFHA 1YBTA 1OYDA 3W5ZA 2FLNA 3H8YA 3ZNUA 2WTFA 4JKCA 3ZXWA 1NEEA 4DHYA 4MFBA 2HFVA 5DDOC 5D4LA 3SSQA 2XS5A 4C1NK 4FM1A 1PSDA 2XMKA 1BL3A 4H0YB 1TL3B 2B5JA 2VQEF 3D0GE 3ZT3A 2DNMA 3BN7A 5A6WA 2DGVA 4O4GB 1SH3A 3V81B 3MECA 4HWIA 4Z4IA 1FKPB 4ZVGA 4URGA 4LFAK 3I55N 2PMZD 1K8AO 3DOMA 2JEIA 2HFNA 4QS9A 4PQAA 1S1UA 4A2BA 2JLFA 1EP4B 5IWAJ 5T41A 3VA3A 4P72A 2FYXA 3HPGA 4CGIA 1YJ9S 5ETOA 1G2EA 3K59A 5MLCQ 2HSTA 1HBOA 3SBMA 2QG9B 3VHQA 2WUSA 4H4MB 1DLOB 4K4VA 4MMOA 1JLAA 2BGGA 4PRFA 3A3PB 3TX8A 2DHXA 1T05B 4OZNA 2ZNYA 3M05A 3PG9A 4IOBA 4JNEA 4QWDA 1EKEA 4DQ8A 4NYZA 3CJAA 3GQCA 3BEXA 1VOMA 3FBFA 5F2RA 1QSYA 5C2GA 1S3XA 3FZMA 1QD1A 4P10A 3AAQA 3LGNA 5DGAA 3CJ5A 4KYZA 4CI0B 1I94K 2IM1A 2HMIA 1IBLK 4FM0A 3KK1A 1NJWA 3RVCA 2QA4N 4JI5K 3QJJA 2DH8A 3KVGA 2RU9A 5DETA 5KOXA 5C15A 5EN1A 3L4BC 5TKYA 2FY8A 3ALYA 3GOIA 4H5VA 4QOTA 3R8EA 1JLBA 3U1MA 4CGDA 1PILA 2YCHA 3DLGA 5BR8F 3QMLA 4GV6A 4NLVA 3KD1E 2C28A 2I7NA 4CI6A 1SUQB 4F50A 1N8RO 4QIVA 4W5RA 2BM1A 4I1TA 1X5PA 3OYHA 1X5OA 2BRLA 2IYGA 4O5BA 3DLLQ 4OX9F 2RB7A 1FFWB 4ZIWA 1MLAA 1WEYA 3N01A 3GTYX 3MEEA 1S6OA 4JV5F 4A5AA 2O4IA 2ZH8A 2E44A 3OVBA 2VPZB 3IRWP 2H4YB 2DYAA 5LJ5Y 4OPAA 4WFAL 4Q8EA 4RWXA 2HNYA 3ZSRA 1PKUA 2VG6A 3H46O 4J2AA 4DJBA 2YQ0A 2V68A 4KGXB 1TUVA 3ETMA 3PZPA 2GW8A 3TJ9A 4P2MA 3SJHA 4JK8A 2MHEA 1MA9B 4N76A 2M4MA 3TZXA 1CULB 2OP5A 3MF5A 3LTOA 3M2RB 2DNQA 1CG2A 1HNXK 4B3RJ 4KHPJ 1URNA 4FJ8A 3GL1A 4UY8T 5D77A 3MCSA 5DLGA 3TPQA 2PO4A 4L74A 4ETZA 3OJSA 5EX0A 2O8EB 1WHVA 2AW0A 3ZT1A 5GAHP 3QIPA 3OVAA 4OJ1A 3B8AX 2OJ3A 4IDKB 2YKMA 2UXDJ 2J7WA 4HKQA 2IIRA 2RQMA 1AFJA 2PFFB 5F0WA 4HHHA 5A8WA 3JXOA 4QWAA 2JRSA 3DNCA 2VQEK 4X66J 1FRJA 4IR1A 1RTIA 5EX5A 3IDHA 4AUKA 4CF0A 2RUSA 2GX9A 3UDCA 1XMQJ 3QNNA 1FDAA 1LEOA 3TAQA 1CXQA 2PIIA 3ZX3A 1P9YA 2EC2A 4KREA 2IM3A 4NLRA 2BW2A 2Z8QA 4PEOA 4FJXA 4R0EA 5KFCA 3EEQA 4PKDB 2XRIA 1RT3B 1U25A 1RBOB 3HSJA 3L2WA 2ZHOA 2QA4S 3BO3A 2CQ0A 3GCXP 3UD3P 5C2DA 4A62A 3E01A 2X7IA 2HFSA 3RUBL 5L1LA 1HLUA 1LOUA 2F63A 3MEDB 1VRQC 4IO8A 3VQ8A 4L8RB 1F5BA 4RW6B 4DTXA 3U02A 4ZHRA 3MI7X 2HURA 4LFAJ 2ATQA 3AVIA 6FDRA 2K3IA 4DUYF 4OI3A 1D1UA 4CNZA 1FF2A 2QWPA 2E1CA 3LP0A 2QSFA 1XN9A 3ZC4A 3DLJA 4FJ7A 4KHNA 2DBBA 4ZPAA 3OL7A 3NGDA 3PW4A 2IOCA 4GV3A 1DTTB 1RWWB 3LAMA 2XHWA 3DOKB 3TSPA 4EGLA 4YEAA 1BXNA 1RBVA 3OYKA 3H59A 1JLQA 5HSPA 1N32F 3CCQN 5D8HB 3WIUA 4J9VA 2JHEA 4BDYA 4LBHA 1NOZA 4DR2F 2JNJA 5BR8K 1NJIO 2XO7A 4ID5A 4ANDA 1IXKA 1I94J 3VQPA 3CD6N 4OPKA 5KRTA 3TUPA 4I6YA 2H54B 3BBFA 1PYOB 2ERRA 1XJWB 4L73A 2D7SA 1FD8A 2P9LA 4OX9K 4ILHA 1YJVA 3D4JA 3FFKB 2G4BA 1RBSA 2C3PA 2O8FB 1UVLA 2V5HG 3FSYA 4JV5K 5GAHU 4Y28C 4NI2A 5BRFA 3D2WA 4JLHA 2L48A 2D3O1 2DNYA 4OJRA 3D3BJ 4WU2A 3CF5L 2MZ1A 4K0KF 2Z1GA 2DO0A 4H5TA 1KLMA 4I6MA 2DHAA 5MAOA 3EZWA 5EU7A 2XULA 3AJ1A 2XBPA 2FVPA 3VF4A 1UMJA 1Q9YA 2WVDA 4A48A 3C94A 5IT9U 2NRHA 4CO4A 2HBYB 3CIZA 4ITSA 4E7JA 3LALA 4B9TA 2GTDA 1DEJA 1SH0A 4IKFA 3Q8VA 1V6HA 4DWIA 1TZ0A 1XTZA 4DV7F 3ULEA 4ZVOB 4DL3A 1LXNA 1EARA 2H5EA 1WSRA 2H3GX 2MKJA 1UWAA 4W5QA 4LF8J 2JVRA 2HHTA 1NK7A 2VIHA 4CLKA 2DR9A 3P5JA 5HRPA 1JQGA 3QBXA 3MM7A 2PT0A 1SV5A 1IKVA 3CHWA 1R31A 2V7ZA 3PW2A 4GW6A 1M90T 3SUQA 2ALYB 3CM6A 5ETQA 2O4GA 2O8BB 3D0HE 2VWBA 3AVCA 3RRHA 1F9FA 5AQXA 2Q1NA 2VG5B 1U6ZA 4P9SA 4IH7A 3D28A 4OZ0A 2KXFA 4QU7A 1HI1A 3VZHA 1BI4A 2ILZA 1P90A 4FN5A 2Y8WA 1YXQA 3X3UA 4BG9A 1RWPB 5KFHA 2C2ZB 5E3AA 1J27A 2R9LA 3AA5X 4DFPA 4CH7A 2ZBIA 3TZZA 3QRQA 2VQEJ 2OSQA 5L38A 1LFWA 1Y5NB 5E3CA 3FFIB 2M2BA 5EVZA 1VSLA 3ZX0A 4E19A 3BP8A 3MWBA 3I0RB 5K20B 1KD1T 3PACA 4DUYK 1LWFB 2GEMA 4NYFA 2M7SA 2YVSA 4QWCA 2KU7A 1CJKA 2R7VA 1HBUA 3F9MA 2GUIA 1XIQA 1IVZA 2UVRA 2QL7B 2X6SA 3BGRB 3P5TL 1VBYA 4RNMA 3IR5B 3R8YA 1T9XA 2BR0A 3THPA 2P6TA 3CXCM 1GMUA 3D2FB 4DR4F 5M1FA 2ZZMA 2ITGA 1RWUA 4ZPCA 1N6QB 1DTQA 1Q18A 2QX0A 5H1SV 4NOHA 1N32K 3Q86A 3EPGA 1S99A 4GVMA 2E8AA 1PJ5A 4DR2K 2VV5A 2XZDB 1PJ7A 1RWMB 3G25A 3S8SA 1RBUA 1Z2LA 5KT7A 3GMGA 3FMWA 2HVEA 2B8PA 5B0FA 3PJWA 4JN4A 1KBRA 4DLEA 1QJHA 4MIAA 2MPUA 3THYA 1UA1A 1WOSA 1ZM2A 3AA3A 2P9PB 3JSRA 4JAXA 3ZZPA 3H5UA 3HBTA 4F0HA 3CC2N 4G1QA 1QTMA 4USJC 2CZ9A 4OYAA 4WZQA 5F8GA 1CVJA 4O0IA 1WAJA 1S59A 3NL0A 1NHUA 4K0KK 4DR7F 4KPCA 2R2RA 1NSQA 1RBAA 3B54A 4ZPWR 5SUHA 3ILLA 4CZJA 1JLFA 2O5DA 3NMAA 4HEA9 1RHMB 3L3UA 4ZVRB 3JAMU 4DZ6A 4GKKK 3VEVA 4OX9J 1MROA 2DK2A 3KXDA 3A5NC 4QZVB 2HSEB 5D0EA 4MYTA 1YGYA 3A5OC 1WKLA 4DV7K 3MMBB 4RL1A 4EUVA 3D6RA 1U8WA 4FO0A 4QR0A 3V9WA 2IHR1 1F3VA 1RAJA 1PBAA 1S6UA 2YQ1A 3ATUA 4ZN3A 4DSFA 2W9AA 5KPZA 2HQFA 4ZVQB 1K47A 1FTRA 1FDNA 1KXPA 3M4XA 2GJFA 5KGWA 1WWHA 1TAUA 1DAXA 2V4JB 3OFHA 4CJFA 1HQUB 3DU6A 4OLOA 1SL2A 3DRRA 2D1KA 2WB4A 1W2IA 1CS4B 3T3FA 3NF6A 1CJTB 3TX0A 1VSIA 4OLPA 4OX6A 2CPXA 2XY7A 3SUOA 3CCLS 1VBKA 2CPYA 2VFVA 1QVFR 2VFRA 2XSFA 1V5VA 3PVXA 2Q6BA 3TI0A 4Z2XA 3C7NB 2ZBQA 5GMKa 2ZUAA 5KG7A 2YWGA 2YBVA 2AWZA 1RDAA 3ZTOA 1FXRA 3FRYA 1RHRB 1NDCA 3H4BA 1L5UA 3P8BB 4NLTA 5ELZA 1RT4A 4N7TA 2KT5A 2RSQA 2LLZA 3QT5A 1YX2A 3HD2A 1HW8A 2HHQA 4O3OA 4DTJA 3ZTSA 1E4GT 3SLCA 2HKEA 3M8YA 3GYXB 4RW4B 1HWLA 2FVQA 3M6XA 4BHQA 3UKUA 2NRWA 1VK0A 1VFJA 3PSFA 1RWOB 2KKZA 1YK9A 4DPOA 2OPSB 4RX6A 2BTFA 5DG7A 3C19A 3QFPA 2DH9A 1T03A 1S4FA 4CO3A 3PJ9A 3EVOA 1BG3A 1IKWA 3I9ZA 4CO5A 2KT2A 4DR4K 2BJ8A 3OY9A 3VALA 2UV8A 3LH2S 3GBTA 3R5AA 3WHIA 3OYAA 3T1HF 1NKCA 4KY3A 1T3NA 1L3UA 3ZZUA 1Z26A 2LDYA 3CC2S 1JCFA 4ZCLA 1FRXA 3P39A 2A0FB 3RB6A 4DUYJ 1X3MA 3MM5A 2DJWA 4TLQA 2JOQA 4BRKA 1SS6A 2R7XA 4ZLPA 5EY4A 4H8KA 3OR2A 2QWNA 3NGIA 3OR1A 2WBNA 4V19X 1S9FA 4EBCA 5LL6d 2HK3A 4DL6A 1HNWJ 3AVHA 3DRPB 3UDEA 4KC5A 1E4FT 4I6WA 1U0HA 4X84A 4B02A 3HYFA 1MU2B 4PXEA 4DCJB 3TR8A 4DR2J 5IV4A 3HM8A 3LPEA 3MEGB 1P6TA 1RGVA 1KQGB 4ZVPB 4CLZA 4DU7A 2G9OA 4NLOA 4DR7K 4NYNA 2VQFF 2O3DA 2OEJA 4BRMA 5DK5A 3T7ZA 3MR5A 2V2ZA 1RU1A 1FJGJ 3IBWA 4QR2A 3KKFA 1FA0A 4NCBA 1FVQA 3K9KA 2LQ9A 2CNNB 3BH7B 1OPIA 3VV2B 5J2PB 1NGBA 3KK3B 2L9WA 2VPYB 4AF1A 2MY8A 2HZAA 5L46A 3D1QA 4RPFA 2E29A 4E7LA 4L3NA 4CLPA 2VD3A 1X4BA 2BE2A 4RW8A 2DNLA 2NXCA 4ES2A 2QXLA 2FGOA 3US5A 2GVDB 2KM8B 4CJRA 3VGSA 3X1LB 3RRKA 2BE9B 4OHXA 2DVIA 4DV7J 3UVJB 5EWFA 5FDLA 4CE9A 1YRTA 4LF5F 4WF9L 4EAHD 4FF1A 2CJXB 3WXKA 3GG4A 5CE3A 2KHDA 5C2FA 3JSYA 5DM6L 4K8XA 1U49A 4BR5A 1FKOA 5KQ8A 1I5OB 2CIMA 5SWMA 2QA1A 4JB8B 4H4KA 2ZJPL 4IOCL 4ZVFA 2CPFA 1WC6A 2DFHA 1E3MA 1HQEB 4CO2A 2OKQA 4JKFA 3OA9A 4CLTA 2I6WA 2P9GA 3U27A 4FF4A 4G1PA 4LR9A 3H6EA 1BOTO 1SKRA 5EWGA 1RT7A 2IDOA 3V2UC 2WSEC 2C2NA 3KKRA 1DJ0A 5C10A 3MR3A 5D0GA 2V2KA 4X65F 3HJFA 1T6CA 4DQQA 1OIAA 3AJDA 3O3FA 4FPIA 3R5BA 3OLBA 1FJEB 1U2VA 2NXUA 2WRMA 4Q5VA 2F4VJ 3KHGA 2CH6A 4PXCA 2F9WA