3M8QA

Hiv-1 rt with aminopyrimidine nnrti
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
554
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of piperidin-4-yl-aminopyrimidines as HIV-1 reverse transcriptase inhibitors. N-benzyl derivatives with broad potency against resistant mutant viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 151
structure length 554
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3m8qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8qA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8qA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3m8qA05
3ZSWA 3K5MA 3AVFA 1X9MA 4WYLA 1JL1A 4RNOA 1HYZA 1LAWA 4ZP7A 2ZD1B 4N5SA 4WZMA 1RTHB 4CF2A 4FLZA 3KLGB 3DLRA 1HQEA 4BE1A 3QEPA 3Q8RB 4URGA 2XY6A 4CEFA 3N6NA 4CFAA 2W7PA 5HRSA 3RB3A 4MFBA 3OYMA 1N5YB 2R2RA 2RDJA 4KREA 1LW0B 3DI6B 3WNEA 3QLHA 2OPSB 1JXLA 3OYEA 3E01B 2XWYA 4M3RA 3PX4A 3DLGB 5KT5A 2R8IA 3ZSZA 4DF8A 5CZ1A 4DFKA 1RTDB 2B5JB 3KOAA 2WK4A 1TV6A 4YR2A 4ECXA 4YP3A 1C1AA 4FCYA 2YKNA 4DSFA 2WONA 4B9LA 3L2QA 4I9QA 3OLAA 1S6QA 4EBDA 3I0SB 4IFYA 4HYKA 3D45A 3H59A 1RT7A 1J9AA 3KK1B 3JYTB 1GOBA 3SUQA 1SH2A 1IM4A 4J9OA 1IKWA 4YFUA 4DTNA 3AA4A 1LW2B 1MU2A 3ISNC 1RILA 3L8BA 4EO6A 3WNFA 3F73A 3OSNA 3A2FA 1NK9A 3VQCA 2E6MA 4RUAA 4YNQA 1Z4UA 4DU3A 1IO2A 4KV8B 1BHLA 3RMDA 3KLHB 2OA8A 3PW2A 4ECRA 2G8WA 2YNGB 1S1XB 4KB0A 3LPTA 5KFRA 3OJSA 1RBVA 1SL0A 4DS4A 4CEBA 2XY5A 1FK9A 1QAJA 4I7FA 1ZBFA 3MECA 4M45A 4LD0A 2PZSA 2R8JA 3DLEB 3L3VA 2RDIA 4CECA 5F8IA 4O5BA 3MXJA 3ZT1A 4O4GA 1S9GB 3LZJA 1YTAA 1BCOA 1RT6B 4ED1A 4CHOA 2DTUA 4O4RA 4YR3A 3AVGA 5KT7A 1KSPA 3V1RA 4KHWA 2IA6A 1T05A 1KVAA 3KK3A 1KHWA 2Y1JA 2FVRA 4KO0A 1I39A 3BQ1A 2D41A 2I5JB 4IQXA 3OYJA 4FJLA 5C5JA 3DOKB 1QSSA 4RG8A 3THVA 4TY9A 2X6SA 2XHBA 3C6UA 1JL2A 4I9LA 2W42A 4K4YA 4B8CA 4J9NA 3K59A 3WNGA 1NKEA 2YNFB 2FLLA 3BSNA 3QINA 2D0AA 1BQNA 5EDWA 2AX0A 3DOLA 4TY8A 5KT3A 4EEYA 4FS1A 4RW9B 3MEEB 2R8GA 4ZVEA 4CESA 4Z4FA 1J5OA 3CJ3A 4CF9A 3KLIA 2XI3A 1JLCB 4Z4IA 2AWZA 2W8KA 4AHRA 3M8PB 3TI0A 4W5QA 3MF5A 3DYAA 1TK8A 3SI6A 4AHVA 3ZSQA 3QEWA 4FBUA 3IRXB 4MIAA 3MXMA 2HHQA 4FJKA 2G8KA 4KAIA 4AHTA 1D5AA 2KFNA 1IKYA 4PUOA 4IOBA 3NL0A 2HWHA 4YMEA 3PVXA 2YHAA 4CJVA 4RW8B 1QS4A 4NLDA 4ECZA 3V9UA 4CJKA 3I5AA 3V9WA 3NFAA 2QKBA 4KHMA 1VRUB 3KLFB 2FVCA 4F4ZA 1QSYA 4BACA 3ICLA 1FKPB 3GV8B 3PX0A 5DK5A 3OYAA 4FZZA 4KFBA 4PQUA 3LALA 2W9CA 1S0OA 4QCLA 1RT3A 4OPJA 3OYFA 3OYNA 1NKBA 3BSAA 1QAIA 2B6AB 2D7SA 5KT6A 5CY4A 2G8VA 4W5NA 3EY1A 3DLKB 4ECWA 4ZP6A 4DG1A 2ITGA 4RNMA 2V4RA 4HUEA 5J2PB 3I8DA 4CFDA 4ID5A 1HNIB 5EU7A 2C2EA 1GX5A 4E1NA 3QGIA 5KG6A 4W5RA 4IRDA 3CJ2A 2E9RX 3ZT2A 4K4TA 5DGAA 3HVTA 2HVIA 3OY9A 3ZCMA 3LDSA 2FJWA 3BR9A 4DTSA 5L9XA 5L1LA 1HNVB 5DMRA 4KTZA 4E7HA 3AVJA 4N47A 1QTMA 4DQIA 4CHNA 1TK0A 1VSJA 1BGXT 5I42A 3ZSYA 1RNHA 3CVKA 3NBPA 2R2UA 3KKSA 1JLAB 2AGPA 4Q0BA 3SYZA 2RF2A 3PZPA 5FROA 1RT5A 3VQEA 2JC1A 2IAJB 1RA7A 3TAGA 1JLFA 5KTQA 5DG8A 1TKXB 3KHRA 3OYIA 3QERA 2D5RA 2DFHA 1U45A 2B4JA 1CSJA 4DFMA 3NGIA 1LWEB 4CK3A 4MIBA 3GV5B 3AVBA 4CEAA 1RT1A 3K5LA 1S1VB 2IOCA 4E0DA 4MH8A 3TAMB 2IMWP 1UOCA 3OS2A 3CQ8A 2HHXA 1EKEA 4DTUA 3V4IA 2V4QA 1U04A 3OS0A 3UIQA 4O55A 4OKJA 3NH2A 4LSNB 3QEIA 3RR7A 1S4FA 3ISND 1KFSA 2UUWA 3HYFA 3NCIA 3UQSA 4U7CA 2Z1HA 1KLMA 4ZVHA 4RUCA 1BI4A 2GUIA 1VSMA 3PJWA 1WN7A 3DRRB 1NHVA 4E7IA 3QESA 4FLTA 1Q9XA 5HLFA 3M9NB 1TKZB 1S1TA 3SZ2A 4QWBA 2BANA 3EPGA 3SUOA 5KFUA 3CM6A 3T19A 5D3GA 1WNSA 1Z26A 3P83D 1YVFA 4K4SA 3G86A 5L1JA 3U6FA 3H08A 3SQ1A 3U3YA 3M8QA 3VA0A 4ZPCA 3QYYA 4G1QA 2HNDB 4ECVA 4EBCA 2W9BA 3CJ5A 3LP0A 4PWDB 4XPCA 2OPRA 1RDRA 5EWGA 5F8MA 5C24A 3H5YA 2VWJA 4DMNA 5CYMA 5DLGA 4NYZA 3EYZA 5KFZA 4B3OA 5L1KA 3BQ0A 3HVAA 2RN2A 2BQRA 3OS1A 3OYCA 5KG1A 1SV5B 4NLRA 1SL1A 3KD1E 2HMIB 4E89A 1XWLA 3RAXA 2HB5A 3TQ1A 3OYGA 3QNNA 3KLGA 4IH6A 1S9EB 2UVRA 3NF6A 1TL3B 2F8EX 2VG6B 4XIUA 3NGYA 1OS5A 1SH3A 4DL7A 4W5OA 2AX1A 3AA2A 1WSFA 2YKMA 1KVCA 4IH5A 4O3RA 4EYIB 4M3ZA 4NRUA 1Q9YA 2BDPA 3RB6A 5I3UB 1TAQA 2HVHA 3PHEA 1VRTA 4NCGA 3HPOA 2ATLA 3V81B 1XR5A 3HM9A 3NAEA 5E41A 1TVRA 4RW7B 1RYRA 4ICLB 4I2PB 1REVB 1S0NA 3KLEB 5KFQA 2HNZB 1TAUA 4EZ9A 4FM0A 2VG5B 3NAIA 2E4LA 4J9QA 4TQRA 3I0RA 4E7JA 5HBMA 3HXMA 1HQUB 1C0TA 1XC9A 3IG1B 4CJUA 4DTXA 3MFHA 4RNFA 3FDSA 4B9VA 4EO8A 3MXIA 1LWFA 4C8LA 2YV0X 2KTQA 1BCMA 2PYLA 4I2QB 2HNYA 5DQGA 4URQU 5JUMA 4RW4B 4KHNA 4CGGA 3JYTA 2VG7A 4Y2CA 3KLVA 3NH1A 5K14B 4OKKA 3OL8A 1FKOA 5KFAA 4L8RB 5C42A 4JV1A 1KLNA 3CYMA 3TARA 3CDEA 3QO9A 3G6YA 4WFZA 3H2LA 4IG0A 3VQSA 4F3TA 5KRTA 1RTJB 4F3OA 1VSDA 4ECYA 3AVIA 4QAGA 4M3YA 3CJ0A 3G6XA 4IFVB 1BIUA 3ITHA 2QV6A 3AO2A 2FJXA 4FLYA 1JXBA 1WSHA 4FVMA 4NCBA 1RT4B 1CXUA 3AVKA 3PW7A 3OL7A 4Q5VA 4BDPA 1HPZB 4CGDA 2ASJA 4BWMA 3LP1A 1HARA 5JS2A 3LP2B 3DM2A 4J2AA 1KVBA 5KFBA 4F50A 3FQKA 3V6JA 3ZSXA 3LZIA 3M9OB 3H4DA 3HP6A 2KW4A 4IKAA 3RWUA 1JKHB 2WOMB 1SL2A 3HL8A 1T03A 4CEOA 1J54A 4Y2AA 5F8GA 1YT3A 3O4NA 4DQSA 4HVJA 2WTFA 4NLYA 4R8UA 2YNIB 2DFEA 1U09A 4O3NA 1N6QB 4MK9A 3PO5A 4ECTA 4CJLA 5EWEA 1JLBA 4GW6A 1C0UA 2GC8A 1D9DA 2P5OA 3DMJB 3C95A 4NLQA 1JLQA 4Y1DA 2BRKA 1X9WA 3SPYA 4J2BA 2P1JA 1TQLA 4LQ3A 2CJQA 1XI1A 2G8FA 1IKVA 2O4IA 3HP9A 4FJHA 2HAIA 3ASMA 3KHGA 3UPFA 3HJFA 4CGHA 3SFUA 1R0AB 3PW5A 3GIMA 4Q8FA 1ZBUA 4H54A 4OGEA 1EXQA 4J2EA 4B9SA 4DL2A 3AA3A 3AVNA 4NYNA 1RBRA 4FJ7A 2FBTA 4B9UA 3LAKA 3KK2B 1SUQB 5FDLB 4KTQA 2XY7A 1ZBHA 4HTUA 2YNHA 2X74A 3QGHA 4Q45A 3KLFA 3H5XA 1TGOA 4F8RA 3NF9A 4DU1A 4WE1B 2C2DA 1UWBA 1TL1B 1ZETA 4O0IA 5CYQB 4TLRA 3KHLA 2DPIA 1HJRA 1WAJA 3CFPA 4H8KA 3H40A 2IC3B 3NE6A 3QIOA 5KFHA 4M94A 1RBTA 5J1EA 1NHUA 4K4VA 4FJJA 4DQPA 4Y34A 2FVQA 1C1CB 4H4MA 2IM2A 1HNIA 1K1QA 2YHBA 4ZPDA 3RRHA 2X6NA 2Y1IA 2OPQB 4KTWA 1BQMB 1DTTB 3M8RA 4KHQA 5KFCA 3CM5A 3OHBA 2GIRA 4QWEA 3MR6A 4C8MA 4R5PA 2QKKA 1D8YA 4XPEA 2BE2A 2A1SA 3BJYA 2R8HA 4CIFA 1B92A 1VSHA 3UR0A 2C2RA 3DRSA 2JEIA 4GC7A 4H4OB 4CIGA 3N6LA 5KGXA 3PW0A 3OLBA 3RAQA 2FC0A 3SQ2A 4QWCA 1ZBIA 1JLEB 4MFBB 5L1IA 3G6VA 4W5TA 5T14A 3QLHB 2ZKUA 1RT2A 3RR8A 5DGBA 5HRPA 2Z1GA 1BIZA 4IG3A 1LWEA 2IJFA 5KG3A 2Z1JA 4ZTFA 5DLFA 4ZMMA 3C94A 4EZ6A 4QW8A 4K4XA 4NZ0A 1RDCA 4C8KA 1VSEA 2BGGA 3IN5A 1TV6B 1T3NA 1JLGA 3BGRA 2BRLA 3NKYA 4WFYA 2YKNB 2I1RA 3SUNA 1EP4B 3KJVA 1S6QB 4IFYB 2OYQA 2PY5A 3RMAA 5EUHA 4GMJB 2HHUA 4CEZA 1DLOA 3TVKA 4DS5A 1F21A 1IKWB 3AO1A 3ZT4A 4EP4A 4IR9A 1MU2B 1WSGA 1SH0A 2RKIA 4Z4HA 3TANA 4KKOB 5DQHA 2FBYA 2F8SA 4CJWA 3VQ4A 1N48A 4DWIA 5KFMA 1S97A 5JXSA 1TKZA 2G8UA 1RCHA 3I5BA 4K50A 5C25A 4JS5A 3MAQA 1S1WA 1TKDA 1S1UA 2ZE2A 5KFIA 4KI4A 3VQ7A 3L2UA 5KG7A 5HP1B 4M3TA 4RNHA 3IS9A 1FK9B 4I7FB 3MECB 4CGFA 2J6UA 4BDYA 3JSMB 4YQWA 4IRKA 1TP7A 1K6YA 1LV5A 2HNDA 3O3HA 2OPPB 4M41A 3BDPA 1CZBA 2NUBA 3E51A 5CZ2A 3RMCA 4O4GB 3D0PA 3MEGA 2QE5A 3TAQA 3SV3A 1NOYA 2XGQA 4O0JA 4DTOA 1CLQA 1GX6A 4LQ9A 3L2RA 1WNEA 4FJ8A 1NNDA 3IGVA 1W0HA 1T05B 1HMVB 3KK3B 1TKTA 4TYBA 1K1SA 3Q8PB 1QSLA 5F9LA 5KT2A 5J2QA 3VQPA 1TL3A 3T5HA 2XRIA 2D3ZA 2FJVA 1EETA 4M3WA 2FBVA 4CF1A 3V6HA 2E9ZA 4DTJA 4DL4A 4IRCA 2WRMA 1JXEA 5SWMA 2J6TA 2FBXA 2B43A 1VSKA 3DOLB 5JS1A 3ZSVA 2V0NA 3KIOA 3VQ9A 4Q8EA 3KLEA 2DFFA 2HNZA 1J5OB 4NLWA 3KLIB 3PX6A 2FVSA 1LWCA 3CDUA 3SQ4A 1XR6A 3QIDA 2FVPA 4RW6A 2G8IA 3O4QA 2ILZA 3LWMA 4FK4A 2AU0A 4QOZB 2AJQA 3V9ZA 3QIPA 1BISA 3QEVA 4K4ZA 1KRPA 1IKYB 4PUOB 1DTQA 1YTUA 3MFIA 4OPKA 3PJXA 3V9SA 4ZPAA 4FBTA 4ED2A 4DSLA 2HWIA 1HRHA 3GILA 3SFGA 3K5NA 3OHAA 1IKXA 2KZMA 2JC0A 1NJWA 5J2NA 4KFBB 4PQUB 2W9CB 1RT3B 2EC0A 1NK4A 3QZ8A 1ASUA 4FYDA 4IDKB 2G8HA 1RDBA 4KPYA 4DG1B 4AHUA 4B08A 4HCBA 3V6DA 1A5WA 3B6OA 3DRPA 4ELTA 5KFYA 3K2PA 4KE5A 4O44B 4ZHRB 4ID5B 3VQDA 2GV9A 5HROA 4CIEA 5F9NA 4F4KA 4ED7A 1X9SA 2DY4A 4MK7A 2P51A 3OJUA 3I5CA 5EWFA 3QEXA 1JX4A 4RZRA 3TR8A 4J9MA 3FQLA 1HPZA 4GVMA 3HVTB 2ZD1A 3OYBA 5KFNA 4PY5A 1RTHA 4IBNA 3LWLA 3HK2A 4JS4A 4Y3CA 4RNNA 4J9SA 4DL3A 1B9FA 4OVLA 3RBDA 3EZUA 4N76A 3NGZA 2WOMA 3SNNA 1T8EA 5I42B 5DG7A 4DSKA 2ETJA 4DL6A 1N5YA 4CHPA 4FJ5A 1LW0A 4Q0BB 4CEEA 3DI6A 4IH7A 1U49A 2RF2B 1RT5B 2OPSA 1ZTTA 4E7LA 3L3UA 3E01A 2IBKA 1JLFB 3ALYA 4FJMA 2ATQA 3DLGA 5F8JA 4CEDA 4ECSA 3HVRA 1IH7A 1RTDA 4FJIA 4FJXA 2B5JA 3L2VA 3CIZA 1RT1B 1N56A 3GIIA 4DSIA 2Q3SA 3RB4A 1RDAA 5KFEA 1O1WA 4EYHB 4M42A 3KNAA 2ASLA 3NGDA 1Q8IA 2XO7A 3V4IB 3I0SA 3ZSOA 2OZMA 4FM1A 1NJXA 4DLGA 4FW2A 4X2BA 3VQ5A 3KK1A 3LANA 1L3TA 3DDKA 3NHGA 2XI2A 1D0EA 4QWAA 1LW2A 5KRSA 3EZ5A 4CHYA 4NLPA 1NK6A 4CJ5A 3FRZA 3PUFA 1KLMB 3MR3A 4ECQA 3KK2A 1BI4B 3G10A 1T94A 3LP3A 4KV8A 1B9DA 3PR5B 3KLHA 4LH4A 4DLEA 5KFXA 5HLFB 1S1XA 2YNGA 1XHXA 4URSA 1S1TB 3HPGA 2BANB 3BSCA 4O3QA 1RTIB 5D3GB 5KG2A 3CFRA 1L3SA 3DLHA 1FXXA 4NLSA 2J6SA 3IAYA 3RTVA 3PO4A 2UUTA 2OZSA 1TK5A 1S6PB 4NLXA 2LSNA 4FK0A 3OYHA 4CJ3A 2ALZA 3DLEA 1UA1A 3BSOA 4CF0A 5FRMA 3NDKA 4CJFA 4F2SA 3M8QB 3SQ0A 2F8TA 3AVMA 4IR1A 4FLVA 1KTQA 4CFCA 4G1QB 2W9BB 4KAZA 1S9GA 1A5XA 3KMSA 3HO1A 2OPRB 2IS3A 4Z0UA 2W7OA 5C24B 1RT6A 4OJRA 5CYMB 3NH0A 1BQMA 2RPIA 1ZBLA 4B3OB 1SKSA 3BQ2A 5HRRA 1T7PA 3S3OA 1RBSA 2QK9A 2I5JA 3DOKA 4EP5A 4CFBA 5KFSA 3CO9A 3MEDB 3T1AA 2HHTA 5SZTA 4H4OA 1YVUA 3CG7A 2BQUA 4N56A 4IKFA 1U48A 3EPIA 2W8LA 2YNFA 4OLBA 2YKMB 3V9XA 3T5KA 5KFDA 2D0BA 2IM1A 1JLEA 3Q8QB 1U47A 4ELVA 1KCFA 4RW9A 4CJQA 3MEEA 4TXSA 1VRTB 4NCGB 2W9AA 3HVWA 4CE9A 1VSFA 1GOCA 1TVRB 4DTRA 1JLCA 1CZ9A 4FZXC 4NRTA 3O3GA 3M8PA 1EX4A 1RA6A 2GIQA 4FM2A 4DFJA 5FRNA 3MR2A 3VQAA 3IRXA 3I0RB 3TABA 4AILC 5HBMB 3SJJA 1C0TB 5KG0A 2IGIA 2KFZA 3DLBA 4CJTA 1U4BA 3NMAA 1S48A 4CF8A 3FFIB 2QXFA 1EP4A 3TAEA 4ZP9A 1G15A 1W25A 4NCAA 1LWFB 4RW8A 1S10A 4HUGA 2JEFA 3AV9A 2HNYB 3H98A 1C1BB 1XHZA 2WCXA 3VN5A 1ITGA 4NYFA 1A5VA 3KD5E 2R7YA 4G3IA 1VRUA 3U3GA 4M3UA 4LSLB 2VG7B 3SI8A 4ECUA 1LAVA 1KHVA 4WXOA 1J53A 3D28A 1FKPA 5J2MB 1WLJA 2HHSA 4AHSA 3VA3A 4B9TA 1FKOB 3VQBA 4PA1A 4KKOA 5C42B 4DL5A 4RU9A 4YR0A 2HW3A 3C6TB 2B6AA 3PW4A 3DLKA 4ED3A 3QO9B 3SPZA 1NK5A 1NK8A 4IG0B 3AVAA 4CJPA 2WB4A 4DFPA 3FSIA 5J2PA 4NLOA 5HRNA 3QNOA 2EHGA 4BDZA 1QE1B 5HP1A 2FLNA 1UA0A 3RMBA 3ITHB 3JSMA 3S9HA 4CJRA 5KG4A 4WZQA 2OPPA 3RBEA 1NJYA 1HYSB 3KMQA 3K5OA 4ELUA 4BE2A 3P1GA 2O4GA 2VA3A 4QW9A 4KB1A 4DU4A 1KFDA 1RAJA 3AO4A 4F2RA 3VQ8A 3H4BA 2JGUA 3ZSRA 3LP1B 3L2WA 2XCPA 3KTQA 1HNVA 5KFVA 4F4WA 3DM2B 4K8ZA 1RBUA 1HQEB 1S0MA 1HMVA 3HKWA 4KB7A 3TWHA 5T7BA 4NLUA 4FXDA 1JLAA 2EX3A 3VQQA 1WSJA 1T03B 4MQ3A 4AH9A 3MR5A 2IAJA 4FZYA 4CK2A 2O5DA 1TKXA 3OL9A 4FLUA 4XO0A 4CJ4A 4ZVGA 4R8UB 4J9PA 4KHSA 3IGNA 3M8SA 4CGJA 3BREA 1JLBB 1C0UB 1ZYQA 4JRPA 2D3UA 1S1VA 4FLWA 4ZVFA 3QZ7A 4JRQA 1JLQB 3TAMA 2IJNA 3T5LA 4DF4A 2XGPA 2R8KA 3AA5X 2WONB 4HHTA 3NF7A 4CEQA 4F4XA 5KT4A 4CJSA 1IKVB 3GYNA 4DSJA 3AVCA 4Q44A 1VSIA 4LSNA 4OGCA 1RT7B 3CWJA 1D1UA 3TAFA 4DTPA 1L3VA 4CCHA 2E6LA 3V1QA 3DRRA 5KFFA 1X1PA 3NF8A 3SUPA 4QPXA 2KQ2A 1HYVA 2YNHB 2JEJA 1QHTA 3RB0A 2HHVA 4BWJA 5KFWA 3HHKA 3B6PA 1UWBB 3OL6A 2JLEA 4NLGA 3H5UA 5DG9A 4IDKA 4ID1A 4DQRA 4JV2A 4EBEA 5J1EB 2JEGA 3K57A 4PWDA 4E19A 2ILYA 3GQCA 4O44A 4ZHRA 4Z4EA 4H4MB 1S5JA 3ZT3A 1WSEA 2VA2A 4B9MA 4B8AB 4DQQA 3LPUA 5KFTA 5KGWA 3VQ6A 3PV8A 4DEZA 2BR0A 4NLTA 4WFXA 1ASWA 1SV5A 1NK7A 3M9MB 4ED0A 4FLXA 5KFPA 4KO0B 2HMIA 4OKEA 3ULDA 4R5PB 1C6VA 3O3FA 3TAPA 3V1OA 1S9EA 4J9LA 1VK0A 3T3FA 3MTKA 2BE2B 3CJ4A 2VG6A 1I3AA 2PYJA 4BE0A 3DRSB 5F8HA 1WAFA 3C6UB 1UAXA 2AGOA 5I3UA 3GIKA 4M3XA 2WHOA 2E9TA 4J9RA 3WNHA 1BQNB 3V81A 1XR7A 1QQCA 4TY8B 1CXQA 2XY8A 4RW7A 3V6KA 4ICLA 4I2PA 1REVA 1VSLA 4FJNA 5KFJA 4JUZA 1RT2B 4KHRA 3G0ZA 3ZT0A 2VG5A 1N4LA 1L3UA 4IG3B 4CERA 3RRGA 4J9KA 2P5GA 3DYAB 4M95A 4K4WA 1MMLA 2X78A 1HQUA 1GOAA 3IG1A 3S3NA 4FJ9A 3UDLA 4ZP8A 2F96A 1NKCA 3N6MA 1JLGB 4ED6A 3BGRB 4UQGA 3AVHA 2XC9A 2XCAA 4I2QA 1QUVA 4Z4CA 3KJVB 4RW4A 4CHZA 4NLVA 1C0MA 4TN2A 1ZTWA 5F8LA 5K14A 5KG5A 4B9NA 1DLOB 4DTMA 3HT3A 4R0EA 2R2SA 4MKAA 3OYLA 2RKIB 2V9WA 1C2PA 4JLHA 4MKBA 4KSEB 2HHWA 2Z1IA 4ZPBA 3LAMA 1NOZA 1RTJA 3AO3A 1SKWA 4O3OA 4KHYA 1RTIA 5C25B 3K58A 4GC6A 4KI6A 1S1WB 3AO5A 3GV7B 1S1UB 2ZE2B 4IFVA 4FJGA 1S6PA 2IM0A 3GIJA 4FK2A 1ASVA 3IS9B 4TYAA 3KHHA 1RT4A 4HUFA 4J2DA 3SV4A 4WYWA 3T5JA 3OYDA 1S49A 3HSTB 1IG9A 3QETA 3D5MA 2D0CA 3MEGB 2UVVA 3CFOA 3P5JA 3LP2A 4TQSA 2ZQBA 5KI6A 2CKWA 1WSIA 3OVNA 4E3SA 2C28A 1JIHA 5KFOA 1JKHA 1TKTB 4HCCA 4CGIA 3NBPB 1I6JA 1RYSA 3MEDA 4O3PA 1W9HA 3OSPA 2AGQA 2GBZA 5J2QB 2YNIA 3PR4A 2KZZA 4CJEA 1EETB 1N6QA 4FW1A 4Z4GA 3AVLA 5KFGA 3Q8SB 4E7KA 4U6PA 4ED8A 4HKQA 4DSEA 1S9FA 3DMJA 5KFLA 4KHUA 4F4YA 4C8OA 2R2TA 3QGGA 2AQ4A 4OL8A 1SKRA 1LWCB 4CHQA 3PY8A 2FLPA 4RW6B 3SCXA 2DPJA 2A1RA 1R0AA 3QIPB 2IDOA 3NAHA 4LY7A 3FFIA 3KKRA 2ASDA 4MK8A 4QWDA 1DTQB 1RDDA 3F9KA 1SUQA 5FDLA 5F8NA 4KBIA 2UVWA 1C1BA 4CK1A 2VWKA 4E1MA 4FS2A 4LSLA 4Y1CA 5DQIA 4WE1A 5J2MA 1TL1A 4O3SA 4KRFA 5CYQA 4WXWA 1IKXB 4LH5A 2IM3A 3C6TA 5J2NB 4OLAA 2IC3A 4N41A 1D9FA 5KFKA 4K4UA 1NJZA 3S3MA 2BQ3A 1Y97A 4TSXA 4AHCA 3HPHA 1L5UA 1C1CA 3LP0B 3V6DB 1QE1A 1Z25A 3DRPB 4Q43A 2UVUA 3OYKA 2OPQA 5HROB 2OH2A 1DTTA 1BL3A 3CDWA 1NK0A 4JV0A 1HYSA 3H5SA 4C8NA 4ZTJA 4K8XA 2C22A
chains in the Genus database with same CATH superfamily
2A6OA 3K5MA 4DV0F 1GAOA 4PXCA 3MAAB 1U1PA 1HYZA 1S79A 1IWAA 4M5NA 5AXNA 4FLZA 3CC7S 4M7XA 2F65A 4BE1A 3C14B 2NS1B 5G0RB 2KI2A 4EAHD 2E7VA 1N5YB 4KREA 2P9KB 4LREA 3ENAA 4A8MP 2GTDA 1XNQJ 4RWTA 3E01B 1KEKA 5U47A 2OTLS 4M3RA 3DLGB 4B3MJ 1RISA 3ZSZA 3ZNUA 4DF8A 4KR0B 3SEOA 1RTDB 2KG1A 2KRBA 2HQCA 4WIIA 3FCVA 1OO0B 4FCYA 2WONA 3MMAA 3F9MA 3L2QA 4Y65A 1QUPA 3WIUA 3KK7A 2O3DA 4OZ2A 4IFYA 4HYKA 5BPNA 2CJ9A 3KK1B 3JYTB 1SH2A 3GTYX 2JJ4D 4JI6F 3LTOA 1IKWA 5FIIA 5HMZA 1LW2B 3ISNC 3KVGA 2Y0SD 3CMAS 4EO6A 2V4JB 1WORA 3BN4A 3THXA 3OFGA 1NK9A 3A2FA 2E6MA 4CT8A 4DU3A 1IO2A 2CPDA 3HSZA 4Y28C 4KB0A 3ZZOA 4CW7B 4OHXA 3EGZA 4JI4J 4M8LA 1IVZA 2R8JA 2NXCA 3HM8A 1ZA1B 2RDIA 4JI7K 5BRDA 1UJ4A 2HBKA 3D3BJ 2QN6B 3VEWA 5HMYA 3MXJA 3ZT1A 1S9GB 3LZJA 3B4MA 1BCOA 1RT6B 5D0EA 5C7PA 4J8FA 4ZVSB 3IP0A 5KT7A 2VPXB 3OTOK 1KVAA 4U67L 2PDAA 2Y1JA 2MKIA 2FVRA 4Y6IA 3BQ1A 2VFVA 5IQQA 4IQXA 4FJLA 1RGIA 2RAQA 4OZ1A 3DOKB 1QSSA 2POKA 2QYCA 4RG8A 3THVA 3CD5A 3W5ZA 5HATA 3BGOP 2KHDA 4U96A 4A8FA 2XTJP 2A1BA 2QWLA 5DM7L 4I9LA 4K4YA 4B8CA 3K59A 5E26A 4JK9A 2XMUA 2D0AA 2AX0A 4TY8A 4FWQA 1U24A 5EX0A 1RK8A 1N32J 4B3RF 1HA1A 3CJ3A 1JLCB 2BVZA 2AWZA 3HKZD 2R9LA 4KQZA 2RE2A 2L9DA 3TI0A 1I94K 4W5QA 3DYAA 3ZSQA 4DV5K 3QEWA 3DLJA 3VMFB 2QW9A 4KAIA 2CPZA 2KFNA 4IOBA 2A3JA 3NL0A 4RCHA 4OFZA 1C4AA 2Q36A 1HLWA 2NQPA 3V9UA 2DK2A 1RZMA 4OV6A 2BE9B 3I5AA 3NFAA 4KHMA 4YDUA 1VRUB 1ZPWX 1Y5IB 2VHGA 2A6AA 1QSYA 3I55S 1TFWA 4G1PA 1SB6A 4PQUA 2IY5B 2CA9A 4DR1J 1YZ7A 2CQPA 1NKBA 2PC6A 3BSAA 4AM6A 2B6AB 1VCTA 5MLCV 2MQQA 3DLKB 2WSCC 1RWKB 3HZGA 4UOFA 2CAJA 1VQLN 5AZIB 1GK8A 4RPFA 4JI8F 4QS7A 1HNIB 3RG6A 1YRXA 1WKLA 4ISEA 1RBLA 1FEEA 2C3PA 5GMKa 1AZSB 5BR8F 1F2HA 5KG6A 4W5RA 2GX9A 4IRDA 4Q2MA 3ENOA 3CJ2A 1QDUB 3MWBA 4LF8K 1Y5NB 2HPUA 2HVIA 4U8VA 3I32A 4WFAQ 3Q89A 1HW8A 3VAHA 1EKRA 4DTSA 3VF4A 1VOMA 1QTMA 4DQIA 1TK0A 3GR1A 1BGXT 3CVKA 1SJ4P 2GZOA 4Q0BA 4JYAK 2NUHA 4M5IA 3PZPA 2RF2A 1RT5A 4QZVB 2JC1A 2IAJB 2F9JA 1RA7A 1UVJA 4QS8A 2CJAA 2VV5A 5DG8A 2CRLA 4Y00A 3CULA 2D5RA 2DFHA 4IOCL 1U45A 2CQ0A 2B4JA 3VVTA 3NGUA 4LBHA 4MIBA 4I6MA 2RQ4A 1S1VB 4PL8A 3MD3A 3CT9A 2XMKA 1CLFA 1P8GA 2IMWP 1UOCA 1VDHA 1ZM9A 2V4QA 4X62F 2LQBA 4CJ7A 4CTAA 3ZTSA 3Q24A 2PD1A 3QJPA 2VFRA 4JI5K 3NH2A 2M70A 3C46A 4LSNB 3QEIA 2J9CA 3H2VE 2P6TA 3EM1A 3E9PA 3NMRA 1B64A 3UQSA 4U7CA 1KLMA 4ZVHA 4RUCA 1UP1A 1BI4A 2LXUA 3LH2S 2ADBA 4BC2A 2ASOA 5IZHA 2A0FB 2BANA 1XERA 3SUOA 4MKYA 3T19A 1KQSM 3EE3A 2QSWA 2OKQA 3P83D 2K3KA 4PG7A 5LXRA 3UB5A 1Y9OA 4Y0FA 3VA0A 1R8AA 3GOIA 4U7BA 3W9JA 3G71S 2NXUA 4G1QA 1I51B 2W9BA 3CJ5A 2HOEA 2RDDA 2HQIA 4DR5F 2BH1A 2HFNA 2VWJA 4M5DB 2W2OP 1AUSL 1AT1B 5A8KB 4QPTA 1NZAA 2KJWA 1U0HA 3SSQA 3OS1A 2HLTA 3OYCA 1V5IB 1GLFO 4NLRA 1SL1A 4HACA 2RJZA 4DN9A 3ILIA 3QPIA 3RAXA 3TQ1A 3QNNA 1S9EB 1BQXA 1Q86T 3U1MA 3AAPA 2KH9A 3MOJB 1Q18A 2C2OB 1GNKA 2VG6B 3OR2B 3NGYA 4X64K 4W5OA 1AXQA 1WSFA 2YKMA 5AJ3K 4IH5A 2BE7D 4M3ZA 1Q9YA 1TAQA 4HH1A 1Y10A 1RLCL 4CNYA 3HI0A 4TNOA 3HPOA 4DV2K 1X31C 3HM9A 2ZUGA 1NCLA 5E41A 1TVRA 3A3PB 2CVEA 5D4NA 1S0NA 2WSEC 2HNZB 3C0BA 4DUZF 1HBMB 4BR9A 2ZM6J 1KQSR 4FM0A 3NAIA 2COLA 4J9QA 2FJAB 1YUWA 4XH4A 4TQRA 4NXMJ 1HQUB 4DTXA 4ZLJA 3P8BB 3UDEA 1FRIA 2QA4N 4AFFA 2EKNA 1LWFA 2KTQA 2D69A 2HNYA 2HQFA 1RP5A 1MSWD 5DQGA 1RHQB 4KHNA 1EARA 3WQUA 3NH1A 4LFCK 2QI2A 4OKKA 1DT9A 4L8RB 3ZZPA 1KLNA 1TL7A 2G2OA 1XJWB 2R7RA 3GDQA 1WC3A 3VGVA 5GAEU 4A2BA 4FVCA 1E4FT 3VQSA 1M5PC 2K8GA 5KRTA 4D3GA 3MPUB 2DJWA 2UZAA 4W92B 4M3YA 3CJ0A 4IFVB 3E1YA 1H98A 2C3UA 2QV6A 5BPMA 2FJXA 5GAGI 4LF4F 4PR6A 2ZJQL 1EQMA 1JXBA 1NJIT 5E3AA 1AW0A 1OYDA 3BEXA 1VQ7N 1RT4B 4ZN1A 3PW7A 3OL7A 2MY7A 4Q5VA 1VQON 1WC0A 4CGDA 4BWMA 1E6VB 2ZH9A 4DV4F 3LP2B 3J81j 4J2AA 4AQYK 4WU3A 5LMUJ 3FQKA 2LXIA 3LZIA 2ZH8A 4H4KC 4IKAA 4IXCA 2VKRA 1M1KT 1JKHB 2CXEA 2MEWA 1YI2N 4WP9A 1S99A 2DRAA 2Z8QA 1RWMB 4Y2AA 5F8GA 2F1FA 3O4NA 4HVJA 1Q0NA 4WYBA 4R8UA 4R25A 5AQKA 2CNOB 3W0LA 1N6QB 3IBFB 4NXNK 1D9DA 1KTVA 3MUTP 3AQPA 2E2OA 3G87A 2QG9B 3QJLA 5E3RA 2V7ZA 3JXUA 2Z58B 3FVYA 2XQCA 4J2BA 2YX4A 5IT4A 2Y8WA 1TQLA 4LQ3A 3E66A 5M1QA 4AXJA 4A57A 4LC9B 4R79A 2Q43A 2DHXA 1HFEL 2AA4A 4CLPA 3VWSA 1SXLA 1TELA 3KZBA 1KQKA 3UPFA 4CGHA 3SFUA 1R0AB 4Q8FA 1ZBUA 3FGVA 2O8FA 3AVNA 3C7NB 1YBUA 2FY8A 2X74A 4Q45A 3KLFA 3H5XA 1TGOA 3CPWR 3NF9A 4OX9K 4I6AA 5C15A 1WSRA 1TL1B 1SPBP 2BW2A 2NCKL 1HJRA 1WAJA 2Q66A 3CFPA 5ETOA 1KONA 2D74B 2Q31A 1R89A 2OAUA 5KFHA 4M94A 5J1EA 4K4VA 4V19S 4X65F 4Y34A 5AQHA 3Q83A 1FW6A 5LSOA 3CGIA 4H4MA 2IM2A 3PRVA 2HG4A 2DEIA 3NCQA 1DJ0A 3M4XA 1XMQJ 3PEJA 3RRHA 1DTTB 3CM5A 3OHBA 3MR6A 2EEYA 4PRFA 4C8MA 5DDOC 1FJEB 2XYGB 1RXOB 1D8YA 2Q6CA 5IC6B 2A2DA 3BJYA 2P9SA 1B92A 1Q4RA 2C2RA 2JEIA 4GC7A 4GVEA 4JV5K 3A8IA 1WC5A 4OO1J 1PBUA 2B56A 1V3RA 2BACA 5CHCB 4KGMA 1ZBIA 2W25A 4B1UB 1RAHB 2KL8A 1NGFA 2V8VA 1IN0A 3LGMA 3EZOA 1D09B 4RO0A 1RAEB 1WACA 2ZKUA 1VQNN 4WBFA 5HRPA 1QVFM 2H5EA 2HSTA 2GHPA 2JWNA 1NMDA 1PG5B 5KG3A 2Z1JA 1WOQA 5DLFA 2P6SA 4NZ0A 2W4DA 1U2FA 1VSEA 3MUVP 3CCLS 4ES3A 3M6XA 2AF6A 1JLGA 3BGRA 2BRLA 4F67A 4USVA 3VF6A 2M9KA 2OIHA 1KR4A 3O2IA 2ZKTA 4WFYA 2G2YA 2DNQA 2I1RA 1RBOB 3MMAB 3AA9A 1OSDA 4LBPA 4DR3F 3FGUA 4IFYB 2OYQA 2PY5A 4O0NA 2N82B 4M5LA 5D0GA 4ER8A 1DLOA 4C1NK 3TVKA 1IKWB 3ZZUA 1EKSA 4F3MA 3FKBA 4NEYA 5DQHA 3F2KA 3THXB 2QXLA 4FYWB 1LXJA 2A5XA 1GLJO 1TKZA 1XN9A 2MLXA 2HWTA 1BXNA 1V4TA 3I5BA 1RWOB 1YZ6A 1ACMB 1PIEA 2DCLA 3ZNJ1 5GMDA 3QT8A 5HP1B 4LR7A 4RNHA 5ETSA 3IS9A 2YTCA 2IHR1 2J6UA 3TOQA 4IRKA 3WXIA 1TP7A 1PBAA 2HNDA 1UVLA 3E9LA 4CZIA 2LVWA 3PYDA 2NRTA 1QVFR 2XYPB 2XGQA 4O0JA 1KVKA 2DH7A 1GX6A 1Q81O 1LCUA 1WNEA 2OELA 4U7UK 3DN9A 5B7WA 1N36J 1HMVB 2JH3A 3FZMA 1K1SA 4OJ3A 1DHMA 4KYZA 2LECA 1QSLA 3QT6A 3VQPA 1B0TA 3MN6A 1PILA 2VBYA 2VDIA 2LEPA 1KAZA 3UW1A 2WRMA 4C8ZA 2J6TA 3BS9A 4M63C 2B43A 3FMBA 4AYBD 3CB4A 5K9FA 3VGTA 2ASYA 3DCAA 2DFFA 4LF8F 1M5KC 1OSCA 4DR7K 3JQMA 3PM9A 4FYXB 1H7WA 3L4BC 2G8IA 4NA2A 4A8KA 3VPZA 1HNWJ 1YJWS 4FK4A 2AJQA 4A5BA 3QBCA 1F0XA 1KVIA 1BISA 3A5LC 2M52A 3UFCX 1K9MT 3QEVA 2ACMA 1KRPA 3FK4A 1NUEA 5A6PA 4JYAF 3F44A 2O66A 3PJXA 2MKYA 3V9SA 2WVDA 5D4OA 4JEPA 5ETVA 3GLJA 4DSLA 4M7YA 3GILA 2D9OA 2EBGA 1IKXA 4HH0A 1NJWA 4PQUB 1IBKJ 6FDRA 4FYDA 3G8QA 2G8HA 1HD1A 2H3EB 1XMOF 1S7HA 3M2RA 4DUYJ 3M1VB 4X4PA 3IM8A 4KHPJ 4UT4A 3UD3P 5JVHQ 4ED7A 3W66A 4MK7A 2QRRA 3I5CA 2DYAA 2M2BA 2ZOGA 5ETQA 5I4MA 4BG8A 4PY5A 4CO1A 1RTHA 2HVDA 3FFKB 3HK2A 2ZBIA 4JS4A 1XNRJ 4RNNA 3CHWA 1B9FA 3H20A 3NGZA 5DG7A 2YWEA 1VQ4N 2ETJA 3KWGA 1LW0A 4Q0BB 3OR1A 1U49A 3LPEA 4IH7A 3U7JA 2RF2B 1H7XA 1RT5B 4OHWA 4E7LA 2GAGC 2IBKA 3NWRA 2AMCB 1R27B 4FJMA 5F8JA 3CQYA 1RDUA 4DR6F 3MN5A 2DGXA 4JI3K 4FJXA 2B5JA 2MQ8A 3R9LA 4P73A 3M2UB 2MKSA 3RB4A 1RDAA 4USIA 4EYHB 1WTFA 4M42A 1BY9A 2B9XA 1ZXOA 2XO7A 3I0SA 3ZSOA 2J7WA 3US5A 1NJXA 4FM1A 2B51A 4CTAB 4DLGA 4FW2A 3VQ5A 2GQCA 1U1RA 2WVFA 1N5TA 2XI2A 3VGUA 4QWAA 4X64F 1UEUA 5AJ3F 3L7OA 3FRZA 1KLMB 2U1AA 4ECQA 1BI4B 1T94A 1VQKS 5MLCQ 4KV8A 1H0HB 4OQJA 3AXKA 2ALYB 4B3SF 2W6KA 1S1XA 1XHXA 2EI5A 5IS2A 3UD4P 2BANB 4O3QA 1RTIB 1KC8O 1L3SA 1FXXA 4NLSA 4BRMA 2OZSA 2DRBA 1MMNA 1S6PB 4ID8A 4MKVA 1N8RO 4NLXA 2EVZA 3DLEA 1NO8A 5FRMA 1X60A 4YB7A 3G8TA 3AVMA 4FLVA 1KTQA 4DR2K 4G1QB 2M5YA 3J7AP 2W9BB 1H1VA 3G4SN 3PNIA 1IBMK 2ROEA 3AQOA 4Z0UA 2W7OA 2Z0GA 1DKGD 4QQBA 3CC7N 5B0CA 3R8YA 4DV7F 1WHXA 4ZIVA 3NH0A 2IA0A 4LF9K 1QY7A 1YAGA 1ZBLA 5LT5A 4PWUA 3MR7A 3GBTA 3BQ2A 3RYLA 4GVBA 4P2MA 1U0HB 2QLWA 1SZ2A 2I5JA 1FRLA 2ZVSA 4GV9A 4CFBA 4HACB 3SDEA 3QRRA 3SAFA 3MEDB 4CNZA 2HHTA 1FWLA 1AB8A 5I3QA 3CG7A 2R7XA 2CH6A 2QL9B 1WTBA 2DKOB 4BY9C 1ICEB 3C66A 2W8LA 2YNFA 2YKMB 4IFEA 3LF0A 1U47A 1NSQA 2KDOA 2ZF5O 4LRCA 2CG4A 3GU0A 1VSFA 1Y7PA 1TVRB 2IVPA 1WBBA 2OEKA 4OYXA 4GV3A 2BBEA 3O3GA 3KUEA 2GIQA 4GKKJ 4BVOA 2RU9A 3HHEA 3ZC4A 3IRXA 3DRXA 4CBWA 1E6YB 4BR0A 2MJUA 2KFZA 1BC6A 3DLBA 2KYZA 3L09A 4CJTA 3CMAN 1TUYA 1G15A 4HDHA 3J81U 1LWFB 4ZOSA 3AOAA 2HNYB 3CJTA 2WCXA 4LF5F 3KD5E 2R7YA 2JWLA 2HQDA 1KHVA 3D28A 5BXIA 2V63A 5LL6d 3MI7X 3P96A 2HHSA 2E66A 3C19A 4B9TA 3BBCA 1RI7A 4DL5A 4RU9A 1TL7B 2HW3A 1U6BA 3P39A 4ED5A 1RU1A 3AVAA 4OLPA 2HFZA 2WB4A 1XTZA 3FSIA 5HRNA 4BDZA 1K73T 1UJ5A 1KP6A 3OXFA 1OIAA 3JSMA 3GIRA 2OPPA 3CCES 3RBEA 1HYSB 3K5OA 4BE2A 2GMLA 4BRFA 4WCEL 1HR0J 4QW9A 3N4PA 4DU4A 2YKOA 1XQIA 8AT1B 3AO4A 3VQ8A 3I31A 2YVSA 3GWCA 3LW5C 4OPAA 4B3MK 1YGYA 4X66J 5HMXA 1HQEB 1S0MA 3TUJC 4KB7A 4CVNE 1CJKB 4NLUA 3O5BA 4GMKA 4DX6A 1T9XA 3VQQA 1SC3B 1UVIA 4FLUA 4XO0A 4R8UB 1Q53A 3LDOA 1N34J 2KYXA 3BREA 2WW4A 1WSVA 2B8QA 1RE1B 4JRPA 2CPYA 2MZ1A 4IO9Q 3CMES 2PIIA 3QZ7A 1PYTA 3KKFA 2D1CA 4IEIA 3HHLD 4DF4A 2XGPA 2R8KA 2LCWA 1N54B 5C10A 3T41A 3BN7A 3WIVA 3T1HK 1NH8A 2AYGA 3GCXP 3AVCA 2QX0A 1VSIA 1WI6A 3I96A 4MIWA 3S7RA 1D1UA 3QFUA 1YTYA 5B0EA 1NDPA 1AUDA 3BKUA 2AEFA 3SCLE 2O8FB 2UXDJ 2HBRB 2BJDA 1X1PA 2NYIA 3SUPA 4QPXA 2Q97A 3AFGA 1BE4A 2GIFA 2MLZA 3M2VA 2HBQB 1SJ1A 3HHKA 4PYDA 3FE1A 3L95X 4EWTA 2E5LJ 3VESA 4JV2A 5HK4A 1VBXA 5GAHU 5J1EB 2W40A 2JEGA 4PG8A 4JK7A 4PWDA 5ITHA 4LF6J 5CCMA 4O44A 1YBAA 1CQMA 4H4MB 1G4CA 3ZT3A 5B08A 5KGWA 3FSXA 4WFXA 1SV5A 1RACB 3M9MB 2IYIA 4U8YA 1BUPA 1F3VA 5GAHP 1BOTO 4J9LA 3T3FA 3MTKA 3R5JB 4FF4A 2QLFB 2P9SB 3BR8A 2PYJA 1X4BA 1OJ4A 2NXEA 3R6LB 4M3XA 3IAS9 2E9TA 3WNHA 4H0VB 3V81A 3AY9A 3O1BA 1QQCA 1YJVA 1WD6A 1KS2A 3P31A 4FJNA 3IBCB 4KHRA 3R6MA 3ETOA 2AEMA 3ZT0A 2VG5A 2YX7A 2QTDA 2P5GA 1WG4A 3FBFA 4PEOA 5B0DA 4FN5A 2F8MA 1GOAA 3IG1A 3S3NA 5DO2A 4DR1K 3UDLA 3WUHA 1JLGB 3BGRB 2PSZA 3ULHA 2XC9A 1F9FA 4Y2MA 1QUVA 2GCFA 1K8AT 3UE2A 4A59A 1Q8BA 3HHDA 1T44A 2XO6A 1ZTWA 3TUIC 2J9EA 2PT0A 3MCOA 3W61A 1DLOB 4DTMA 3L0QA 2DT9A 4DXLA 2MZTA 3W65A 4MKAA 3J7AN 3UCUP 4GO7X 1C2PA 4CI6A 2QMXA 2E5IA 4KT0C 4O3OA 3DLLL 1WC4A 4GC6A 4KI6A 1M5HA 4OZ3A 3BM7A 4DV1J 4FJGA 1S77D 2WFBA 4G6VB 3HD1A 4H5TA 1HWJA 2E29A 3IS9B 2GFFA 3SIPB 1V4SA 2JX2A 1RWVB 1EO1A 4J2DA 3T5JA 5CD4H 3HSTB 3QETA 2B4VA 1KVJA 2F9WA 1Y64A 1PYOB 4ZS6A 1NDKA 1IBLF 5KI6A 2QT7A 1VQ6N 4WFBL 4CZLA 1S57A 3TYTA 4Q2LA 3AHPA 4C0HA 2N4CA 4HCCA 3NBPB 4OI6A 2PMZD 3H7HB 4O3PA 1W9HA 3OSPA 4EK2A 2AGQA 4NYOA 4YB5A 2IRUA 2YNIA 2A42A 4CJEA 2PMHA 3TX0A 3O4WA 2PGCA 2CQ4A 3Q8SB 1WC6A 1S72S 4HKQA 4FF2A 4WWSA 4DSEA 5HQ8A 3HMJG 3DMJA 1LKZA 4QR2A 5BRHA 3QSYB 3QGGA 2J8AA 4P75A 2CWXA 4K2JA 4YEAA 2BKPA 4Z2XA 3PY8A 1U2VA 4J91A 2DGOA 3SBTA 2A1RA 1NMNA 3GJTB 2NRZA 2IDOA 3NAHA 4K5RA 2YJFA 2GVZA 2P9EA 5CA5A 2MLYA 4WKYA 2ASDA 4FWRA 1Q5VA 3AGRA 2VODA 2YWHA 3G6EN 2RH3A 1QD1A 1ZAVA 3VEOA 4LSLA 2YKPA 1R0BG 3HZ6A 3UCGA 1MW7A 3CC4N 4EHTA 1RWNB 2CQCA 3GONA 5J2MA 5AQRA 4FF1A 5CYQA 4WXWA 1NM1A 1IKXB 4JI3F 1NRKA 4OJ1A 2HGNA 1R8PA 1D9FA 2NRWA 3TJ9A 1NJZA 2OLWA 3S3MA 1DQAA 4DU8A 4TSXA 2A6MA 2QYGA 4A4JA 1C1CA 3LP0B 1QE1A 3M2RB 3PDNA 2NLXA 1Z25A 3D1QA 4Q43A 3SLCA 1VQ8N 2OPQA 2OH2A 2VC1A 4JOUA 4IWVA 4ILGB 3H5SA 4C8NA 1X4EA 1IR1A 2WBRA 1JL1A 5ETNA 1M5OC 3A12A 3O8WA 5I9EB 4WZMA 1RTHB 4JHDA 2ZM6K 4QIEA 3W9HA 2VF3A 4NXMK 4FL9A 3RSEA 4EUVA 2HEKA 5HSPA 5CR4A 3RB3A 2R2RA 1LW0B 4WK3A 4AL5A 2XMAA 4GKJF 2E5JA 2I9SA 1V3SA 4TKTA 5D78A 1F9EB 2ZWHA 1IBMF 3CJ9A 2AYEA 2R8IA 2O01C 4ENOA 3J80U 2B5JB 3KOAA 4LF9F 4MT1A 3C16A 3OXGA 4YR2A 4X4NA 4BR7A 5M1NA 1M1KO 3NGSA 1C1AA 2DBBA 4ZPWR 2FQQB 4TU8A 1S6QA 2QEXS 2HK2A 4EBDA 3I0SB 1HBUA 2VQFK 2K3IA 3SUQA 4FPRA 2UXBJ 3EL2A 4YFUA 4DTNA 4ZCIA 3L8BA 1YJ9S 5E3CA 3EJMA 2VFTA 3PIPQ 3VAJA 2O67A 3ZETA 3TPQA 3VQCA 1H74A 4KV8B 1BHLA 1HNZF 2AP6A 1U1KA 2OA8A 3KFWX 2CPJA 1N33J 1S1XB 3MHYA 2F4FA 5KFRA 2ZBQA 2OHDA 4QIFA 3TEGA 3OJSA 4CEBA 2XY5A 1YJNN 4MO4A 1QAJA 1M90T 4M45A 5BR9A 2B9YA 5MAOA 1IJJA 2MXYA 3DLEB 2ZWOA 3PIOQ 1OMSA 3WZ0A 4J37A 5IWAJ 3CTRA 4BRAA 3VGLA 1YTAA 3FCHA 3AVGA 1WKKA 1NZ8A 3V1RA 2XMVA 4NZ7A 3T9NA 1KHWA 4LFBJ 2I6WA 3H2UB 4GVBB 3PLAA 1I39A 2D41A 1GMWA 2I5JB 3TA0A 3MCMA 3VAIA 5H9FJ 3SDEB 3CCVS 1HBNA 2XHBA 4WF9L 2PA8D 2IVMA 2Y0BB 4J9NA 3GP9A 1NKEA 2YNFB 3BSNA 1NB7A 1BQNA 5EDWA 1G1XA 3T7ZA 4CZGA 3CCLN 3ZO7A 1M0SA 2NUUG 1FVQA 4ZPTR 3EN9A 4BC5A 1LQ9A 1Q7LB 3ENWA 2XI3A 4NL5A 1G3OA 2VOPA 5HMWA 5AQUA 1B3TA 1JK9B 2W8KA 3MPDA 3A8EA 2WZ1A 1TK8A 2V6AA 3IRXB 2EFQA 4FJKA 3PVXA 2CQIA 5EN1A 5M2PA 4CJVA 3O6WA 1YWXA 2PAVA 4P52A 4ECZA 4CJKA 3NMUA 5HVGA 4QS9A 3VVUA 2FSJA 4F4ZA 4NA3A 4I4BA 3GV8B 3PX0A 2ZH4A 4KFBA 1S0OA 2UUCF 2O8CA 4ISFA 1NU0A 2JFDA 4OPJA 4DV6F 3OYFA 3GSDA 2D7SA 5KT6A 2DR5A 1YXQA 4W5NA 4ECWA 4ZP6A 3QNWB 2JDJA 4B17A 2E1ZA 3CQXA 4JBCA 5SUHA 4O8UA 3MCSA 4CP5A 3TUPA 1BMQB 3T1HF 5D4PA 3CCJN 2R7SA 4UTGA 2X3DA 4E1NA 4CLKA 1O51A 1ATRA 2DXDA 3W63A 4L3KA 1TFYA 4G1IA 4HTLA 2ZH6A 4K4TA 5D4LA 3LDSA 3BPSP 2FJWA 3DNCA 3MDFA 3NNHA 2UU9J 5L1LA 1MMDA 3HZEA 3AVJA 3IWNC 2WW8A 3NGKA 3ZSYA 1RWUA 1RNHA 3P5TL 1TL5A 5EOYA 1YVNA 1IQZA 1MLAA 5AQIA 2A10A 1HNXF 3ZZ0A 2XMJA 2CGJA 3U9DA 3KHRA 1B7FA 2V94A 2MZJA 4JAXA 3GE1A 1H2VZ 5AQSA 3KUGA 3TEHB 4NMLA 3TR5A 3AVBA 2DR9A 5I3PA 3GCWP 2IOCA 4MH8A 4ILLA 1VQ9N 3D6MB 1CVJA 3O1WA 3MZIA 1EWQA 3CQ8A 3VGKA 1VMBA 1GTHA 3K9KA 1GXLA 3OS0A 2ZH7A 1WF2A 4RUHA 4OYIA 3ISND 4JI1K 4FOEA 2RHSB 3NCIA 3J7YI 1IM6A 3TO8A 4DN0A 3CJQA 1WN7A 2WBNA 3KDNA 3QESA 3UO0A 4OLOA 4Z7CA 3CCZA 3T1YJ 4USTA 2CPEA 4QWBA 3EPGA 5KFUA 1RQ0A 4KH1B 4W4MA 2RS2A 3AA8A 5B0FA 1ZBSA 3M2VB 4G9ZA 4K4SA 3G86A 1QLNA 1FDDA 5L1JA 1N36K 3H08A 4WTYA 5D0RA 1K9MO 3U3YA 2MY8A 4DV0J 3NCRA 4ECVA 4PWDB 4XPCA 3MWPA 4P6QA 5EWGA 2NRVA 5F8MA 3I56S 3FZ2A 1PSDA 2RUSA 4JB8B 4U67Q 5CYMA 3JAMO 3EYZA 3RGIA 1YJUA 5L1KA 5TKYA 3BQ0A 2RQKA 1TMMA 1JJ4A 2O8DA 2HMPA 2BQRA 1IWGA 6AT1B 1SV5B 2NRHA 2HFVA 4KC5A 1YITN 3P3DA 1XWLA 2OTJS 4NWBA 5DM7Q 5F0WA 3OYGA 2VFUA 2UVRA 3NF6A 2QWQA 1TL3B 1FX4A 4WK1A 4DL7A 1NGBA 2W6LA 3KJFB 3NS7B 2CQ2A 3HFZB 4EYIB 2BDPA 2BJ1A 4NCGA 3V81B 2FTRA 3NAEA 3NRBA 4FWMA 3Q8YA 1RYRA 4JKBA 5DRKA 3KLEB 1JCGA 3RZAA 3RJMB 2EFNA 4CD1A 2VG5B 3CDBA 2DR7A 2QA1A 4JI6J 2LQ9A 1U1OA 5HBMA 2HGLA 3HXMA 3IG1B 3QBXA 1IBKK 4RNFA 4DX8H 4FOIA 5LOQA 2F63A 3TSQA 4BS2A 1BCMA 1P6TA 5JUMA 4DUYK 3JYTA 3HSGA 3CDAA 1TR0A 4QIVA 3OL8A 1FKOA 5KFAA 5C42A 3H3NO 2NSBA 3CYMA 3TARA 2A2CA 2XZWA 4X4RA 2IDEA 4IG0A 2DNLA 1H6KX 3QAUA 1GLEG 4QR1A 5EX3A 3MCNA 1XNRK 4QAGA 3G6XA 3C65A 5E0OA 3CJ7A 4Z94A 2HSEB 4FLYA 4JD2A 3B4DA 2A41A 4USUA 1WSHA 5A0YA 4KGVB 4L74A 4FVMA 3P4IA 3ATVA 4IEEA 1CXUA 3AVKA 3C6AA 4DCPB 3GZ7A 1HPZB 2ASJA 2C3YA 3W64A 3FZLA 3MMCA 4F50A 3O9QA 3M9OB 2C1EB 3HP6A 1EAYC 1ROFA 3TP2A 2VWBA 2WOMB 4PG5A 4IYQA 3UN5A 5CABA 4CEOA 1J54A 4B3RJ 1YT3A 4DQSA 3VZIA 2YNIB 2MHNA 2DFEA 3M6VA 4BREA 1TL4A 1X3MA 4MK9A 3PO5A 4C8YA 5KOWA 4CJLA 3OVSA 1VK8A 2VC0A 2QMWA 2HIYA 2P5OA 2L08A 3OD2A 3DMJB 4B1ZA 5AE1A 1UFLA 3DU5A 3CJAA 1X9WA 3AAQA 1CG2A 4DCJB 4K0KK 4AL7A 3ZZTA 1ZM2A 2CJQA 3N01A 1XI1A 2O4IA 3HP9A 4FJHA 3ASMA 1E4GT 1FJCA 2MSSA 2BJ9A 1LWXA 4H54A 4OGEA 1EXQA 2GVZB 2ZEJA 5GVQA 4DL2A 5LJVA 4NYNA 2LU2A 4FJ7A 3LAKA 3KK2B 4P2SA 3A13A 2XY7A 1FJ7A 2V7YA 1VQ5S 1ZBHA 4HTUA 1H2UX 3QGHA 1APSA 4JI8J 4F8RA 3OV7A 4KH6A 3L7PA 3JAMU 4DU1A 3R1XA 4F25A 3WDOA 4M5HA 3M6WA 5HJYA 5H9EK 1ZETA 1T9VA 1QVGM 5CYQB 4TLRA 5IT9U 5BR8J 3QIOA 1RBTA 1NHUA 2JVOA 4DQPA 1C1CB 3EE8A 1HNIA 2J7UA 2VQFF 4ZPDA 2OPQB 1BQMB 3MXHP 3CJBA 4KHQA 5KFCA 3N79A 2GIRA 5L8RC 3TVZA 2YY3A 4F26A 4R5PA 1U6FA 3RAMA 1GLAG 3BO4A 4JHDB 4CIFA 1VSHA 4GKKK 1FFGB 3N6LA 1PC4A 2ACYA 1Q1KA 3PW0A 3RAQA 3SQ2A 2LDIA 2D1KA 4QWCA 4BBYA 4L3NA 3CMEN 1JLEB 4HEA9 3G6VA 3W5YA 3RUBL 3DHXA 2GX8A 4W5TA 5T14A 3QRQA 4X62J 1RT2A 4DPTA 3RR8A 5DGBA 4OI4A 2ZZNA 3IWLA 5D6GA 3UR3C 5AT1B 4WFNQ 2IJFA 3RU0A 4ZMMA 1QVGR 3OT9A 1RDCA 4C8KA 3C16B 1T3NA 1FRKA 2XSJA 4WQ5C 3UE5A 4BG9A 1BD6A 3KJVA 3THPA 3WEEA 1S6QB 1NEEA 4PZVA 4HHUA 4FNHA 3IXQA 3WQPA 3A5NC 4CEZA 4DS5A 2MZQA 3AO1A 5DDQC 4IOXA 3ZT4A 4IR9A 2DPNA 4AF1A 1JJ2M 4CDIA 2RKIA 2J9DA 4Z4HA 4KKOB 2U2FA 2UUBF 1S97A 1HR0K 5JXSA 1RDWX 3K9JA 4DR5J 3J81Y 4K50A 1RCHA 5C25A 1TUGB 1CS4A 4JS5A 1S1WA 1O5JA 1TKDA 2ZE2A 2ZJQQ 2HHHF 3HJVA 3VQ7A 1T9YA 4C3KA 3L2UA 4M3TA 5A8RA 4CGFA 2ZHOA 3I82A 3BDPA 1VC6A 3R3TA 2NUBA 5CZ2A 3RMCA 4PXEA 2HLUA 3D0PA 3MEGA 1FEHA 3TAQA 3SV3A 4DTOA 3CD6S 1UEVA 2MGZA 4LQ9A 1N34K 3Q2SC 3A4TA 2X3GA 3DGVA 3EVOA 2AZ3A 3CPEA 2YH1A 4TYBA 5LM7E 2P9LB 1RKIA 5F9LA 2E1YA 5KT2A 1I1GA 3R7SB 2XRIA 4DUZJ 1HBNB 4ZCLA 2FJVA 3GFYA 3THTA 3OR2A 2HFSA 1FXLA 3J7ZO 4DTJA 4RU2A 1SJFA 4DL4A 3OTCA 3TRGA 5GAHI 4IRCA 1XBWA 5J1NA 5SWMA 3QQCD 4WPAA 5JS1A 3ZSVA 2V0NA 3KIOA 3VQ9A 1PKUA 4DB3A 2HNZA 2GELA 3V4MA 3ZXWA 2HS0A 1FNXH 1YIJS 1HWIA 1NPKA 2NSCA 1LWCA 1XR6A 3QIDA 5ETTA 3D1HA 5M1PA 4PWWA 2ILZA 4FPBA 3WBZA 2FLOA 4QOZB 2MKHA 3R5CA 4YUDA 3QIPA 2R7QA 1UVMA 4CQ1A 4K4ZA 2H54B 3AODA 1YTUA 3CJKB 2UXCF 2YJEA 2AYBA 4LF6K 2QC3A 2GS8A 2HWIA 1YHQS 3SFGA 3K5NA 4LF4J 3NOGA 4U95A 1FJGK 4KFBB 2O8CB 1NK4A 2EC0A 1ASUA 2WVBA 4CH7A 3ENHA 4IDKB 2MKJA 1FTCA 1IR0A 2E20A 3IDHA 3V6DA 1SC4B 5IXUA 4DV4J 3FJ2A 5KFYA 4ELTA 3K2PA 4B3TK 1J27A 4ZHRB 2DIVA 3VQDA 4GY2B 4MLEA 5HROA 2RIJA 4OX8A 2M4MA 2V2KA 2DY4A 1Y3JA 4USMA 4FWNA 2BKOA 3WQTA 5EWFA 2HS3A 2D9PA 3TTFA 2FYXA 2JZ5A 3TVYA 3BF3A 4GVMA 4OMFG 5D8HB 2NZTA 2CYYA 2IYGA 1RGVA 4Y3CA 1O0PA 4BRDA 5TKWA 2FJEB 3F5TA 2O8BB 3EZUA 3BZCA 1FTRA 1JJCB 3ATUA 3ULEA 3CCUS 2B9EA 3MWTA 4DL6A 3L4QA 4FJ5A 4CEEA 3DI6A 2OPSA 3JQJA 3L3UA 1V6HA 3NS6A 4XH1A 2NREA 1A0OB 4CEDA 3EGWB 4IO1A 4CO4A 3W3DA 4TLQA 4WTOB 2Z57B 1A7GE 3NNCA 4FJIA 4EGLA 2IVNA 4PXBA 3GIIA 1R0CB 2VB6A 3CC2S 2O8EA 1F6TA 1RWWB 2ASLA 3NGDA 2V67A 2QFIA 2W01A 4MJKA 4X2BA 3BV8A 1VIOA 1L3TA 3DDKA 4DV1K 1N8RT 3OFHA 2YWKA 3EZ5A 3QB0A 2HZAA 4DV3F 4CHYA 3C7NA 4NE9C 1NK6A 3G10A 4HTJA 4X65J 3KLHA 1RJJA 4DLEA 4ZKAA 3EMTA 4WKRA 1RHRB 5HOOA 3BSCA 5IFMA 5KG2A 3CFRA 4K25A 3DLHA 2ZDOA 4K2XA 3EXCX 2J6SA 3IAYA 2C42A 3JTOA 4HLBA 2DNMA 4FK0A 3OYHA 2ALZA 5HN0A 3VOVA 2DCUB 4CJFA 4NPOA 3NDKA 2FJDB 2NZCA 3QBWA 2FC8A 4XEIA 1S76D 1NLKL 2QL7B 4CZJA 3UNGC 2E2PA 3VQTA 4DPUA 5CYMB 2FUG9 4NASA 1PAUB 4FSVA 4XH5A 2XNQA 1REGX 4OZ5A 5HRRA 1T7PA 2O8DB 4IOAQ 1Q82T 3LPYA 2NRRA 4EP5A 1WF0A 5KFSA 1Z6RA 3CO9A 1MA9B 3MM7A 2N4DA 3D0IE 1KQGB 2BQUA 3EPIA 1AFIA 4UY8O 5THWA 1QTNB 3V9XA 5KFDA 3Q8QB 1R7IA 4ZVTB 3MEEA 4NCGB 4CE9A 5DZ7A 3FBBA 4DR3J 1CZ9A 4FZXC 4NRTA 3TW0A 3M8PA 2QEXN 2E2QA 1S3XA 2VBWA 4M5JA 4JKGA 3MR2A 2BYCA 2EWSA 3VQAA 1FWKA 2QLXA 2C2MB 1GLBG 2DNZA 5HBMB 3FC9A 1WG5A 2PMWA 6FD1A 4P72A 4CF8A 3OPKA 3DJCA 3ET6B 3GYGA 5A76A 4HUGA 5AQZA 1KAXA 1ITGA 1S22A 1X4FA 1LAVA 1J53A 2ZH3A 4LF1A 2ATCB 1W2IA 1WLJA 3IMQJ 4AHSA 3L4IA 3VA3A 1FKOB 4PA1A 5CD4A 5C42B 1TU0B 2EKYA 3PW4A 3SQOP 2P9CA 4X4UA 2ASPA 1NK8A 2NNWA 4IG0B 1FE0A 4CH0S 4ES2A 2HS4A 1T9UA 4JKDA 5J2PA 5A8WB 2DO4A 2M7SA 1OYEA 2EHGA 5HP1A 2FLNA 1FRXA 2I2YA 3RMBA 3MPYA 2LKZA 2R3VA 4JD2B 2H5JB 2VGMA 5A0YB 3DXBA 5JICA 2LYVA 3ID6A 2P5VA 3I33A 3TJ8A 4OZJA 3T6JA 4ETXA 5JVHL 1X3NA 3PACA 2QTWA 4PXDA 4CZMA 2JGUA 4FWPA 3H90A 3H3OB 3MMCB 3KTQA 1HNVA 5KFVA 2HRTA 3PSFA 4K8ZA 2RRAA 1ZAWA 2Z4PA 3JTPA 4OYMA 3PEHA 2G0JA 3BO2A 1HMVA 3MX2A 3HKWA 3NWGA 2PFUA 1M90O 3P5BP 4H0TB 3N0VA 4LF8J 2O5DA 2I7PA 4ZVRB 2AYMA 4ZVGA 4J9PA 3BB5A 2IMOA 1HW9A 4KH5A 4CGJA 2M8HA 4CIOA 3QDKA 4YOWA 4ZPVR 1W7AA 3ENBA 3D68A 4FXWA 3TAMA 3KG4A 1LK7A 3L7UA 3B54A 4JYAJ 4LBIA 1URRA 4KBOA 1X9JA 2PO4A 2JSXA 4F4AA 4CEQA 2VBXA 5KT4A 4CLWA 2JL9A 4DSJA 1PAEX 4BR4A 1RT7B 2VQEK 3J80Y 5IC4B 1HWKA 4ZJLA 2VASA 2E6LA 4JI2F 2RRBA 1HX1A 1UW9A 2LA6A 1XMOJ 3EZWA 4C2MA 5D15A 1RAIB 2FB0A 1SQEA 2YWWA 3S1TA 3B6PA 5C2CA 4YDUC 4LFBK 1GLCG 3H5UA 4OYAA 4ID1A 2RVJA 1NXIA 2GVDA 2CGKA 5H9FK 4E19A 1VQLS 4DCOB 3M1VA 4ZIWA 3OFFA 2XBPA 2YKAA 1YG0A 1GLDG 2AHOB 4B8AB 2G13A 1T02A 5KFTA 4ZVUB 5E33A 4DEZA 4DUTA 1DGKN 3K5PA 4DR4K 1UEKA 5KFPA 4KO0B 2PFDA 3MURP 4R5PB 1C6VA 3ISZA 2KB2A 4DL0C 2RHQB 3SBGA 1WHWA 1I3AA 4DR6J 5F8HA 3CE8A 1WAFA 3C6UB 2M88A 5DDPC 2DNPA 5I3UA 3GIKA 4FWLA 2WHOA 1XR7A 2J0QD 4F3QA 4F9OA 4RW7A 3V6KA 1REVA 5KFJA 1RT2B 3G0ZA 3NGRA 2DNNA 3RRGA 2HQGA 4OI3A 1OPIA 3M2UA 4X64J 4JKHA 4LFAK 5AJ3J 4FJ9A 4C23A 2F96A 3N6MA 4USJC 3GYXB 4OZNA 2Q6BA 2ZZMA 2GA7A 3KG0A 3AVHA 2XSJB 2XCAA 3SK3A 4LRDA 3IFEA 4B3SJ 4I2QA 3KJVB 4Q7AA 1RSCA 3TZZA 4RW4A 3WEEB 4NLVA 5HL7Q 1VISA 3OBIA 4FZVA 4N77A 2WAQD 4P7VA 5F8LA 1NGAA 5KG5A 2A40A 1VQPN 3HT3A 1U02A 4FKYA 1GXUA 4R0EA 3O80A 2R2SA 2G9OA 2MTLA 5T41A 2KFYA 4LF7F 2RKIB 5AFUA 2CGLA 4JN4A 4A8SA 4JLHA 4MKBA 4O23A 2HHWA 1JJHA 1J6ZA 2J4RA 2ABYA 3LAMA 1NOZA 3BGUA 3UN3A 3AO3A 1JWWA 4CZFA 4KHYA 3RW7A 2VDHA 1RTIA 5C25B 2V9KA 3AOCA 1CS4B 1S1WB 3AO5A 3BYRA 4UOHA 3GV7B 4DV7J 3I56N 2ZE2B 1S6PA 3CIPA 1AYEA 3GIJA 3LUYA 5AQVA 5A8RB 1Y00A 2PEHA 2YH0A 5M1OA 1XK8A 2BV3A 3B6BA 1EIYB 4WYWA 5D0HA 3GG4A 3OYDA 3NNAA 1NGEA 4BROA 2D0CA 1NHKL 2OTJN 3MEGB 5HO4A 2UVVA 4F0MA 3CJ1A 2MGZB 3MMJA 1WHVA 1DBDA 1NU4A 1WSIA 1VR6A 1JIHA 3J8AA 1Y5LB 3CIMA 4FF3A 2P8IA 2V8PA 1FJGF 1I6JA 4J9UE 3J7Z5 1RYSA 1UVKA 3ILJA 3MEDA 5ADXH 2GBZA 2W1BA 3QT7A 2KZZA 2FC9A 3SMSA 2XULA 2FHOB 4IQMA 4B3TF 3H8YA 3AVLA 3HHLA 4KGKA 1S9FA 2Q1NA 3JSBA 4C8OA 3N4QA 3N4WA 4RWWA 2ZNYA 2V34A 3GL1A 3NY0A 4CBXA 4IO9L 3HULA 2P9PA 2KT5A 4PKIA 5JLFA 4LF5J 3AJDA 3D54A 1LWCB 5CZVA 4NZ6A 3PSIA 3SCXA 3Q23A 2MSTA 1E6YA 5K5MA 1S6OA 3CI5A 1VFJA 2QO3A 3QIPB 3VTHA 1P90A 4LY7A 5AQGA 3BUZB 2QA4S 3LOUA 4BC9A 5LMNK 3EUNA 4DV0K 4QWDA 3OVAA 2HZCA 4EU0A 5F8NA 4KBIA 2NYHA 2UVWA 1MWKA 1MWZA 2CNLB 2Q3PA 3EX7B 3F41A 3MM6A 4Y1CA 1FI4A 4YHHF 4O3SA 5BPLA 1Z2LA 4LH5A 2LEAA 1KQFB 2JNJA 3VHQA 4MLHA 2PN6A 5KFKA 3JB9k 3WHIA 1QQOA 1HLUA 2F7VA 2PI4A 1RCXB 1T0TV 1FWPA 2DY9A 2K7JA 4NI2A 3V6DB 3HX9A 4RR5A 5AQOA 3D2EB 1IUJA 4LR9A 2UVUA 3OYKA 5HROB 2X1AA 3D6HB 1NK0A 3M1FA 1HYSA 3CF5Q 2E2NA 2C22A 5KQ8A 1VQ7S 4WQ4A 4ZK7M 5LSRA 1U8WA 1VQOS 1R6YA 4CLYA 2VKZG 3OFEA 4ZP7A 1LAWA 2RQCA 3E9OA 2MPUA 4CF2A 3MM5A 3KLGB 4XAKA 1OVYA 5AQMA 2QGFB 4UZCA 1HQEA 3Q22A 3QEPA 2RNEA 3Q8RB 2YX1A 1CJKA 3CCTA 4CEFA 3PTWA 1B0VA 3ULEB 4CFAA 2W7PA 2E88A 3DI6B 3WNEA 3OUYB 3QLHA 2OPSB 2AP1A 4W98A 1N5VA 3QT5A 3X1LB 2OEMA 3PX4A 1Q79A 5KT5A 3ZX2A 4NX9A 2WC9A 3MMBA 5CZ1A 4DFKA 5KPZA 2GO8A 3N9UC 2WK4A 1TV6A 2H4YB 2O8EB 2F5GA 2MJNA 1A9NB 4L73A 4B9LA 7FD1A 1QAXA 4Z7YA 4FXVA 4I67A 5GIPA 3D45A 4M5GA 1GOBA 2V2VA 5B0BA 4J9OA 3KJQB 1UTAA 2E1RA 5F41A 4ISGA 5E3PA 3F73A 1CJVA 1Z4UA 2CJYB 3I6PA 3KLHB 4ED4A 1ZZNA 3HOTA 3PW2A 2G8WA 4OZLA 2ZC4A 5M2RA 4F04B 1DY3A 4DS4A 1DRZA 1PJ6A 2ZUAA 4LD0A 3L3VA 4CECA 1OY6A 3LQVA 1KN6A 4USKA 4B3RK 3Q0AA 2JLFA 4O5BA 4WFBQ 4O4GA 3SCIE 5JJBA 3SMZA 4CHOA 2Q1LA 2DTUA 2ZJPL 4YY3K 2IA6A 2BJ8A 1T05A 2DEJA 4DPYA 1WOSA 4RUBA 1GH8A 2DGQA 2WSFC 2CQ3A 3HTVA 4Z37A 3HRGA 4UY85 2VZ9A 1I3OB 3H1QA 1WDDA 3MM7B 5F0UA 2X6SA 2YWFA 1PYSB 1IG8A 4EFAC 3M3ZA 2FGOA 1JL2A 2W42A 5IV3A 3WNGA 2HQ3A 2FLLA 2GO9A 3QINA 1UW4A 3VALA 4EEYA 3R5AA 4FS1A 4EFHA 3MEEB 4JI7F 4ZVEA 3FEZA 4Z4FA 1J5OA 2VOOA 4ZLLA 4CF9A 4LRBA 4Z4IA 2ZJRQ 3UI3A 5D77A 4AHRA 3M8PB 2C3OA 4JKGB 4QOTA 4WP8A 1K0VA 3OTOF 2VPZB 2ZHAA 5BR8K 2GNKA 2R7OA 2KLAA 3OA9A 3DWLA 1IKYA 3QSIA 4ZLNA 2HWHA 3LGNA 2DNRA 2YHAA 2H3GX 4NLDA 2V5HG 4LF2A 3D67A 5ETMA 2QKBA 2V50A 5C12A 3DDIA 3R6GB 1F3FA 2V8DA 2FVCA 3L6QA 3ICLA 3VCDA 5DK5A 4FZZA 1VBYA 1OY8A 4QCLA 3LALA 1Q7YO 1FXDA 3BY5A 3OYNA 1QAIA 4LSZB 5CY4A 2G8VA 2B4UA 3EY1A 1NM2A 4DG1A 1SAZA 4M1KA 2GHWA 1HKAA 4HUEA 2VGNA 5J2PB 1IBLJ 1EWRA 4ID5A 1I94F 1O6XA 2CQHA 3LDQA 3NLCA 1WG1A 1C4CA 3P38A 4DV5F 1K0TA 3VENA 2VQEF 1GX5A 2UV8G 2R42A 5IT9Y 2KT3A 3VETA 3LL3A 3Q2TC 2QFJA 2IPOB 4K5SA 4C11A 3ZT2A 4X62K 3OY9A 2Y1LB 3O8MA 3ZCMA 2H9ZA 3PKMA 5L9XA 3EICA 1HNVB 5DMRA 4KTZA 4E7HA 3WXMB 2LA4A 1TTHB 4YDDB 1YDLA 1KXPA 8RUCA 3LA0A 4HT5A 3NBPA 2R2UA 5LSLA 5AXMA 2AGPA 2QMUB 1FCAA 3SYZA 1FE4A 4HT7A 3J7YU 3TAGA 2H4WB 2V68A 2B3TB 5KTQA 4H5RA 2FIUA 4CLSA 1CSJA 3NGIA 1LWEB 1WUAA 4CK3A 5GINA 4CEAA 1YJRA 3K5LA 4E0DA 2BJ3A 2LLZA 3TAMB 5AZJA 3M30B 3OS2A 4DR4F 4DTUA 1WEZA 1U04A 3J7YP 1D4XA 3UIQA 3CCRS 2ZHBA 4O55A 2OUGA 4OKJA 4OZ0A 1KBRA 2GW8A 3RR7A 1YHQN 1S4FA 4JI3J 1KFSA 3M8YA 2UUWA 2Z1HA 1VSMA 2GUIA 2JHEA 1FERA 3LDLA 3HFVA 1NHVA 1CEZA 4E7IA 2J76E 3H0PA 3PIPL 1S1TA 1RAGB 1NG9A 5D3GA 2F9TA 1Z26A 3C3LA 4GRSA 2ZH5A 4A48A 4LFAF 3W1YC 5GADU 3M6GA 3QYYA 1HHSA 2GVDB 3U27A 4EBCA 1OH7A 3LP0A 1RDRA 2XM3A 4DUZK 1DFDA 4LT6A 2DHHA 3H5YA 1QZ5A 2XS7A 1FXRA 4JI5F 5DLGA 2XLIA 4HHHA 5KFZA 4B3OA 4IZ9A 2LQ5A 3HSCA 2RN2A 4H5VA 4JK8A 5KG1A 2V51B 5GADP 1QZ6A 4GKJJ 4OHYA 1RADB 1QQMA 4DDFA 4UUXA 4EIAA 4IH6A 1IBMJ 4UOCA 3AJ2A 2F8EX 1T3VA 1OS5A 1S7IA 3AA2A 1ZPVA 4O3RA 2D3OR 4LF9J 2HAFA 3W8PA 1OWXA 4NRUA 2HVHA 1FHTA 5I3UB 1VBZA 1VQ4S 2APOA 1YKWA 1MN7A 5C2GA 4JI0K 2UUAK 3RRKA 4RW7B 1J5EK 2MKKA 1REVB 3FLCO 1HKCA 5KFQA 2YHYA 2K7KA 1NGJA 1TAUA 2LXFA 3DFEA 1ULRA 1GTEA 2V52B 7AT1B 2OANA 3U4LA 3MM9A 4HHJA 1WJ9A 4CO3A 5B8HA 4E7JA 4LF4K 1XC9A 1C0TA 3JXOA 4CJUA 3FDSA 4J9VA 3MXIA 5F3TA 2YV0X 1HNZJ 4BC3A 2PYLA 3W60A 4I2QB 2FD2A 4URQU 4RW4B 3BYPA 1EQYA 3HHNB 4CGGA 4DV4K 3A5OC 4Y2CA 3GFZA 4YDXA 2AW0A 5AXKA 3BF4A 1FNOA 4C6AA 2CQDA 3TSPA 1SC6A 2F4VK 4OYPA 5AQLA 2CQ1A 3U1LA 2JFKA 3QO9A 4DV2F 3G6YA 4CM0A 2EPIA 3IFRA 5LY3A 1B70B 4F3OA 2EG1A 2ITMA 2CZ9A 4ECYA 2GGPA 3AVIA 4H0OA 2RRNA 3UVJA 5GMEA 3ITHA 3AO2A 1O13A 3Q8UA 4ILRA 2LEBA 1W97L 3G82B 3VERA 3IRWP 3GJSB 3AAWB 3NS5A 1K8KA 3DRYA 5LMNF 4BDPA 3G4SS 1TYQA 5FPDA 4B1VA 1NSKL 3LP1A 1SQFA 1HARA 5JS2A 1XEZA 2P9GA 3DM2A 4AUKA 4BRGA 1KVBA 5KFBA 4BC4A 4LFCF 3V6JA 3ZSXA 4A8YA 1YSJA 2VU5A 1NBWA 3IKMA 2KW4A 1HWLA 1SL2A 3HL8A 2Q0UA 1R8BA 4JKFA 4QU7A 2V2ZA 3B78A 2WTFA 4NLYA 3MPWA 1RABB 4MYUA 1ELOA 2OTLN 4LMZA 4ECTA 1JLBA 3WX4A 1CC7A 3BP8A 2GMJA 3HHLB 1GLLO 3H25A 2MDAA 4IO8A 3W7BA 2BRKA 1Q82O 3ZZRA 4X65K 2FZKB 3IR6B 2P9PB 2PEBA 4C98A 1RHMB 5BRFA 2KXNB 1P27B 3T69A 1IKVA 3MMVA 1PO6A 4AQYF 2HAIA 2N7CA 3HJFA 3M6UA 2NLWA 2UUCJ 3PW5A 3GIMA 4DV6J 4CLFA 4J2EA 4B9SA 1U1QA 1EX8A 1RBRA 2CG8A 2YPYA 1FFWB 4ES1A 1JQGA 2DNHA 1NH7A 3MM6B 3T1HJ 4NXNF 4OI2A 4YOUA 2YXLA 5EHHA 4O0IA 3AXMA 3KHLA 1Q5YA 4YB1P 3H40A 2KM8C 1Z05A 2IDLA 4NI2B 4J7CA 3D6FB 1VJQA 3EE9A 3F0NA 3SMPA 2DISA 2YHBA 2Y1IA 4KTWA 1MWMA 3PHTA 3VF0B 2BTFA 2DVIA 2FHJA 4I6WA 5A2QO 1VK3A 4QWEA 2VJUA 3EGNA 1HNXJ 1XNQK 2QKKA 2IFXA 1S0VA 3CXCM 4DR3K 4XPEA 2BE2A 2L9NA 2AEJA 3MM5B 2R8HA 5FD1A 3UR0A 4OX9F 4H4OB 1LFPA 5KGXA 2CJBA 2FC0A 4DQ8A 1IR2A 5DS7A 2GJFA 3AGKA 2H51B 4UQTA 5L1IA 3BEGB 4V19X 1CBKA 3QLHB 2CJKA 1KD1T 2Z1GA 3T9ZA 3LGHA 2EG2A 4ZTFA 4IJAA 3MMBB 3SCJE 4QW8A 4K4XA 4YY3F 2HVZA 2DIUA 1TV6B 2B8PA 2YKQA 3NKYA 3R5BA 4LRAA 2MKCA 1EP4B 3SUNA 1FDNA 2QSFA 1SCJB 5EUHA 2HHUA 4ITSA 1N0VC 2B4OA 4DI6A 4JV5F 4JI4K 1R3NA 3I55N 1F21A 1FRJA 4EP4A 1V9OA 1BWFO 3Q7CA 1WSGA 1SH0A 4DCHA 4ZVOB 2HYIB 4ATNA 2FBYA 2F8SA 5FPMA 4CJWA 2J7KA 3VQ4A 1CJVB 5BYRA 2YQ0A 4NYPA 2GMHA 3EWGA 2G8UA 3HSJA 3CXCR 1HJOA 3BGFA 3MAQA 5AQNA 1Q8KA 4KI4A 5KFIA 3ADAC 2GUPA 3FZKA 4Y2KA 4NO7A 5KG7A 3DC2A 3D7SB 2BEFA 2BMBA 5H1SV 4ALZA 2M8DB 1NB2A 4BDYA 4YQWA 4LVOP 1K6YA 3O3HA 4M41A 1CZBA 1LOTB 5L38A 3E51A 3CSKA 1K47A 4F7VA 1NLVA 2R4FA 4O4GB 2OSQA 3J7ZT 1NOYA 1CLQA 3KNGA 3ZYYX 4RX6A 3L2RA 4FJ8A 3P6YC 4YS2A 1NNDA 3MN9A 1KOOA 4OPHA 3IGVA 1W0HA 1T05B 2CZ4A 4PQAA 2Z30B 1N32K 5IM0B 1TZ0A 2LP4A 2EK1A 5J2QA 1TL3A 4CYUA 3T5HA 1C0GA 1EETA 3ILLA 4RKUC 1SVDA 2IIHA 3FRYA 1HI1A 4CF1A 3V6HA 2E9ZA 5E2QA 2YPZA 1T3OA 3UN2A 1JXEA 1YBTA 2FBXA 1X4GA 3HD2A 1YRTA 1VSKA 1S12A 3IAM9 2OJ3A 3O9TA 4Q8EA 1XMOK 2AIRB 3KLEA 1UJ6A 1J5OB 1VQSA 3M05A 4NLWA 3SAHA 5BYQA 1U2CA 3PX6A 1L3KA 2I38A 4OIXA 2MHEA 3CDUA 1BWEA 4RW6A 4KGXB 3AD8C 3O4QA 1SKUB 1PCAA 1UZHA 2D0OA 3V9ZA 3H45C 2E5GA 1VI7A 4H5NA 4MMOA 1IKYB 1MN9A 3MFIA 1RAFB 2XLJA 3BZKA 3WC2A 5T7LA 1U1NA 2KXHA 4ZPAA 4TU7A 2XMTA 4ED2A 2CPHA 4P10A 5FJ4A 1FFSB 4BLGA 1QAYA 1UMJA 3HOSA 2EWHA 2KZMA 4E98A 5A2QU 4YOVA 1VGYA 2IBOA 3G71N 4DG1B 4B08A 4AHUA 3H42A 1K44A 1RKJA 4FWOA 4DR7F 2ZNZA 1BU6O 3CCSS 4ID5B 4DR6K 1TUWA 2VH7A 3DHWC 3KDOA 2GAHC 3VEYA 4F4KA 5C2FA 1X9SA 2GJIA 1EHWA 4YOEA 2P51A 1JX4A 4RZRA 4UUWA 3QMLA 3TR8A 4BRKA 3FSYA 4DJBA 1HPZA 4C11B 1MNEA 5JVGQ 2ZD1A 3PXGa 4N8OA 5KFNA 2F9DA 1ZM4A 3LWLA 2W24A 1VQ6S 3MCPA 2BX6A 4J9SA 3K17A 2WOMA 3SNNA 1T8EA 3PYFA 4DSKA 2P9UB 4CHPA 3VAFA 4H5WA 1LXNA 4HVZA 1HBOA 4Y0WA 5CZXA 3VEXA 1ZTTA 4B3SK 3K8VA 1HQ2A 3ALYA 2OGUA 2ZDPA 5K8NA 4ECSA 3HVRA 3W2VA 3L2VA