3M8QA

Hiv-1 rt with aminopyrimidine nnrti
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of piperidin-4-yl-aminopyrimidines as HIV-1 reverse transcriptase inhibitors. N-benzyl derivatives with broad potency against resistant mutant viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 151
structure length 554
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3m8qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8qA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8qA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3m8qA05
3QO9B 1D1UA 4QW9A 3AVHA 1RBUA 4R8UA 1FKOB 1RAJA 1BISA 3KHRA 3BDPA 3HP9A 4CF0A 3OYJA 5FRMA 1IKWB 4XPCA 3SCXA 5KT4A 4Z4CA 5KFAA 4IG3B 4AHUA 5KFUA 5F8GA 3TANA 3L3UA 4H4MB 5EUHA 4M94A 3AA3A 2DPIA 4N56A 2R2SA 2YNFB 4R0EA 4DLEA 1N5YA 3TAMB 5F8MA 2IBKA 3NF7A 4Q8EA 5DG9A 2W9CB 1JXLA 4IDKB 1TKZA 3LAMA 1S1XB 4U6PA 3QERA 4RUAA 1JLEA 3KJVA 1FKPB 4GW6A 3OL9A 3OL8A 3HT3A 2WK4A 5F8NA 3B6PA 3DLKA 5J2MA 3V81B 1IH7A 3CJ4A 2AGPA 3BR9A 3VA0A 3BQ2A 3IS9A 2F8SA 3D45A 3VQ8A 1IKVB 4MH8A 1TL1A 2BDPA 3CM6A 4M3UA 2AJQA 3BSCA 5KFGA 1HYSB 4QWAA 1S1UB 3JSMB 4GC6A 3OYCA 4I7FA 3PY8A 4NLOA 4B9MA 3SI6A 3OSNA 2X6SA 2ZD1A 3MEGA 1ASUA 1C1CA 3FRZA 4B9UA 4CK2A 4DL2A 4BDZA 1YTUA 3RAXA 4B9VA 1EP4B 1RT2B 3SV4A 4DLGA 3M8QA 1J9AA 2PZSA 1SH0A 3AVBA 4OLAA 1C0UB 1N48A 1XWLA 1D9DA 4KB1A 1HQEB 3M8RA 1TV6A 1VSEA 3QGHA 3TAQA 4Q44A 2G8WA 4E3SA 1TAQA 3T1AA 1YTAA 5KFVA 4CHYA 5KT2A 3GIJA 1JLQA 1S48A 3DMJB 2F8EX 3DI6B 3ZSXA 2JC1A 5KFLA 5D3GB 3AVMA 3NBPA 1UA0A 3DRRB 3KLGB 3GV8B 1NOYA 4NYNA 3I0SA 3H4BA 5EDWA 4KTQA 2HMIA 5CYMA 2Z1GA 3HM9A 1LW0A 4W5TA 1BCMA 2VG5A 1ASWA 4JRQA 5CZ1A 4CIGA 4FZZA 5HLFA 3KD5E 5C5JA 4K4UA 5KFEA 4OKJA 5KFNA 3NAEA 3T3FA 4FK0A 4OKEA 4CIEA 4O3OA 4NLDA 5KFJA 4TSXA 5JS2A 3LP1B 3V9SA 1RTJA 1SKSA 4DU3A 3SFGA 3F73A 2ILYA 4TQSA 1T7PA 3FQLA 3QZ8A 5CYQA 4AHVA 2UUWA 4F2RA 1N5YB 4CJUA 4N41A 3SQ4A 3NCIA 3CDUA 1RBVA 4ELUA 4FK4A 4RNNA 2YNGA 5K14A 4B8AB 1RDAA 3QGGA 3FDSA 2HWIA 3KJVB 4IFYA 4DTSA 3PX6A 1XR5A 3VQ9A 3LALA 3PO5A 3DLEB 4B3OA 2VWJA 3B6OA 4BDYA 4M45A 4DQRA 4CJEA 1NHUA 3NGZA 4ZVGA 4WXWA 5HRPA 4IG0A 1J53A 3IS9B 1JLCA 2IM3A 3H98A 3RBEA 4CHPA 4KHSA 1VSHA 4CEDA 4KHWA 3MXMA 3QZ7A 5KFFA 3KHHA 4QPXA 3CG7A 4JS5A 4LH4A 4HVJA 3H4DA 4HTUA 4I7FB 5SWMA 2R8IA 4R5PA 4O3QA 3NF8A 1WSJA 3KLFA 4FLXA 3QYYA 3MEGB 4ED8A 4CGGA 3OS1A 4AH9A 3O3GA 3KIOA 4CJFA 3QINA 2F8TA 4DTUA 2W7PA 3K5MA 4ECXA 1ZBFA 4J9PA 1HNIA 2WOMB 4IH5A 3VQDA 3FSIA 4KTZA 3AVNA 1IM4A 5F9LA 1TV6B 4MFBB 2HVIA 3QEXA 5F8JA 2FVRA 4EP5A 5HRRA 3OYMA 5KFBA 3H5YA 5FRNA 2BQRA 4M95A 5KG7A 3AO1A 4DTOA 3OJSA 1HPZA 4RW7A 1BQMA 1U4BA 4HCBA 3SPZA 4ECTA 3PX0A 2V9WA 3I0SB 3NGDA 1LW0B 2B5JB 5J1EB 4E1MA 2E9RX 3ZT2A 1NK6A 1RT3A 3DRPA 4KPYA 4DL3A 1ZYQA 2WONA 5HLFB 3VQSA 2XCAA 1TL3A 2XGPA 2R2RA 1S1WB 3NH0A 3L2VA 5FDLB 4K4TA 1SH2A 4FBTA 2HVHA 4DQPA 3PR4A 3IAYA 4Q5VA 1IKYA 4FJ5A 4CJ5A 2QKBA 3V1QA 3FFIA 3C6TA 4IH7A 1EKEA 4DFJA 4FJ9A 1GOBA 3DOLA 5K14B 1JL1A 1JLBA 5KG2A 4OGCA 4ECQA 3RWUA 3RMAA 2YKMA 4IFYB 4NCGA 1WLJA 4EBCA 1C1BA 4URGA 4H8KA 1RBTA 2YNIA 4GC7A 3L2WA 2FJXA 4JUZA 4CGDA 2WHOA 4MK9A 3RB0A 1RYSA 3M9OB 3K58A 4NCBA 4IG0B 1S9EB 1RT4A 4K8ZA 5I3UA 1JLCB 2E6LA 4J2BA 2XY5A 3BSAA 4K4SA 1TKTB 1UA1A 4WFYA 4DTRA 1NK9A 3NKYA 3SUPA 1TK5A 4JV2A 4RUCA 1DTTA 2W42A 2ZQBA 4BWJA 3KLEA 4RNOA 1LW2B 2OPRA 4CFCA 4E0DA 2DFEA 2HNYB 4R5PB 3H5SA 3KLFB 2D3UA 3L2UA 3UDLA 3AO5A 3K59A 4DTPA 2R8GA 4HUFA 4URQU 3I0RA 4J9MA 3V9ZA 4QOZB 4TXSA 2JGUA 3GYNA 3RRGA 4CIFA 4I9QA 4ID5A 4ECVA 2YKNB 3G6XA 5DG7A 3PW7A 1S49A 4Z4HA 3V6HA 2EX3A 3H40A 4LSNA 2UVRA 4AHCA 4E1NA 3DRSA 3OVNA 4LH5A 1KVBA 4DU1A 3KOAA 4O5BA 3QGIA 3C94A 3KK2B 1KTQA 4Y1DA 3TARA 5KFWA 4RW7B 4HKQA 5KFCA 5DG8A 4PUOA 3QETA 1HMVA 5J2QA 4FBUA 3RTVA 2VG6B 2HB5A 3MEEA 4K4XA 2B4JA 4KBIA 2D41A 4C8NA 2FLLA 2ETJA 3OYBA 4FYDA 4ZP6A 1D5AA 1RT3B 3DRPB 3OS2A 2XY6A 4KHNA 4Q43A 2DPJA 4J9OA 3NGIA 1ZBIA 5L1IA 2DFHA 3BGRA 1SUQA 4DS4A 4J9SA 3GIKA 3MXJA 4O55A 2HAIA 3BQ1A 2YHAA 3ZSVA 2BQ3A 3BSNA 3GQCA 3SQ0A 4IH6A 5I42A 4Q0BB 4IR1A 1ASVA 4KV8A 1BCOA 1QHTA 4E89A 4DFKA 5KFYA 2VA2A 3C6TB 1JXBA 4JS4A 4ZPAA 3RB6A 4KTWA 2KTQA 3SYZA 3KMQA 1WAJA 1T05B 4RNMA 3DOLB 3ALYA 1U45A 4BE2A 4CJ4A 1JLGA 1TQLA 3AO4A 1C1BB 2YNIB 4TY8A 3EZUA 4ZPBA 3V1RA 4E7IA 2XY7A 3LP2A 3PX4A 1RT6A 3KKRA 4KE5A 4KFBA 3ICLA 3ZSRA 4CCHA 4CJWA 2QK9A 1RT4B 3V6DA 4CJQA 2Y1IA 3AO2A 2IM0A 4CFDA 2XI2A 4DF8A 3G0ZA 1DTQB 3KLIA 2XGQA 4RW9A 4Z4EA 1REVA 3H5UA 3MFHA 4DWIA 2OPPA 4Q8FA 4FLVA 4ZMMA 3KKSA 4UQGA 1RCHA 3MF5A 4J9RA 1SV5A 2OPRB 4EYHB 5KGXA 3HPOA 3C6UB 4CF1A 4DL7A 1IO2A 5J2PB 1XHZA 3RBDA 4C8KA 4OPKA 2I5JA 2RKIB 3JYTA 3I5CA 1UWBB 2FVPA 2R8HA 1TKXA 4CF8A 4I2QB 2AU0A 4N47A 2D0CA 4DQIA 1HRHA 4QCLA 5KRTA 4K4WA 3RR8A 4QAGA 3WNGA 3AVFA 3ZSQA 2RN2A 1Q9YA 3HJFA 3EZ5A 3KHLA 4LSNB 3ZT3A 2G8KA 2BE2A 5F8LA 3DRSB 3QEVA 1TP7A 3OL7A 5HROA 2OPQB 1B9FA 1U04A 3H5XA 2WRMA 3VQQA 2XC9A 3NF6A 2IOCA 3T5LA 4ID1A 5JS1A 2HNZA 3AV9A 3K5NA 2IM1A 4M41A 1F21A 3IGNA 4PUOB 2FJVA 5KFIA 2B6AA 4ICLA 5J2QB 1S9FA 3HYFA 3WNFA 4FM2A 4KHUA 4RW8B 1EETA 4ECRA 2OZSA 4QWDA 2W8KA 4WFXA 1RTDA 5KFRA 3V6JA 3V9XA 1JXEA 1RT5A 1BQNA 1SL2A 2R8KA 5C25A 4Q45A 1VRUA 2GBZA 4RU9A 3OYIA 1OS5A 5DGAA 3LPTA 5DK5A 4DL6A 5I42B 3TAFA 4KV8B 3NDKA 4E19A 4DSFA 1S1VA 3BQ0A 4DSLA 4CJTA 4ZVFA 5F8IA 3TQ1A 1C2PA 4DL5A 4Y2AA 1KSPA 4O44A 2RF2A 4CK1A 5C24A 4ZP7A 1N6QA 3RMBA 4CHOA 2HHUA 3HPGA 4TN2A 4OJRA 2W7OA 2ATQA 4B08A 3OHAA 4DTJA 2AGQA 1C0MA 1BIUA 1YVUA 1JLGB 1S6PB 1LWEB 4CEBA 3CFRA 3T19A 1NK0A 3V9UA 4RZRA 3AVLA 4BWMA 2G8FA 4TY8B 2D5RA 3HXMA 3LP2B 5JXSA 3AVCA 4IQXA 2XHBA 3V9WA 2XI3A 3Q8PB 1KLNA 2NUBA 1WNSA 3V6DB 3IRXA 1VSFA 5KFSA 3O3FA 4KAZA 3PVXA 3KLIB 4ED0A 4M3WA 3MAQA 4RW9B 1WSEA 1REVB 3SFUA 4DTXA 2OPPB 1QSLA 4YR3A 4FM1A 3H08A 3LP0A 3D0PA 4IRDA 1DLOB 3ISND 2X78A 2QV6A 2HHQA 3M8SA 4KI6A 3MR2A 1C1AA 3BSOA 4CJVA 4LQ3A 3LAKA 4FJLA 3JYTB 1TKXB 3VQEA 2XCPA 4B9NA 4KRFA 3SZ2A 5KFXA 1QUVA 3G86A 5KT7A 2JEJA 3MEDB 3DYAA 2VA3A 4LQ9A 4N76A 3K5OA 4PWDA 3NL0A 4R8UB 3U3GA 4J9QA 2GC8A 4E7LA 3DLRA 2X6NA 1KHWA 3CDEA 1Q9XA 1IKXA 5DMRA 3V4IA 1CXUA 3NAIA 4RW6A 4ED7A 2KQ2A 1QE1A 2IAJA 4KO0A 1S10A 2Y1JA 2IMWP 2FBYA 4KHMA 1QTMA 3OHBA 4KHQA 3GV7B 4CE9A 2B6AB 4ICLB 2W9AA 3P1GA 1X9MA 1S5JA 1JLAA 1QAJA 1ITGA 1NJXA 4C8OA 2FBXA 3QNOA 4F50A 3S3NA 4N5SA 4DFMA 5JUMA 3KMSA 1D0EA 3CJ2A 1TKZB 4TYBA 2C2EA 2GIQA 1JLEB 2DY4A 3SUQA 1RTDB 4NRUA 1XR7A 2JEFA 1VRTA 3DLKB 5J2MB 1BQNB 3ITHA 1JL2A 2C28A 4ECSA 2RDJA 1LWFA 2UVWA 4AHSA 4FS1A 2ASJA 3I5AA 3OLAA 2DFFA 2BGGA 3VQ7A 3IG1A 4TLRA 1LWCA 5J2NA 1X9SA 1TL1B 5FROA 4DFPA 5C24B 5C42A 3ISNC 2KFZA 3L3VA 4I2PA 3CVKA 5KG6A 1B92A 5KFHA 1BGXT 4FCYA 1GX5A 2ZD1B 1C1CB 2AX1A 1X1PA 3U6FA 1RBSA 1O1WA 3CO9A 3UIQA 3HVTA 3N6MA 1VSLA 1NK5A 3M8QB 1WSGA 2V0NA 3A2FA 4J9KA 3MECA 3IRXB 4W5NA 1RTIA 1NJYA 5KFPA 4LY7A 2KZZA 1NKCA 3SUNA 2F96A 4AILC 1NJWA 4NZ0A 3UPFA 1ZTWA 1TGOA 4J2DA 4F2SA 3LP0B 1T3NA 3OYGA 1JLQB 2AGOA 2OZMA 5KFQA 1FK9A 3L2RA 3P83D 1KFSA 1KLMA 1L3UA 3NBPB 3HVRA 1HNVA 3HHKA 4FLYA 5DQIA 2IM2A 3PUFA 4CJLA 1ZBLA 4F4ZA 3RMCA 3HVWA 3CM5A 3MXIA 4FJ7A 1S1TA 4KI4A 1S0MA 4M3YA 4WE1A 5DGBA 4OGEA 2HMIB 5CYMB 2QKKA 3H59A 4B9SA 1HARA 2HHVA 1KCFA 4PWDB 2VG5B 3LWMA 1EXQA 3VQAA 3QIOA 4ECUA 1RTHA 3ASMA 3OYAA 2BANA 1D8YA 3T5HA 1XHXA 3KHGA 1R0AA 4ZHRA 5KT3A 4Z0UA 1RTJB 1JIHA 1QE1B 2IAJB 1A5WA 3N6LA 4FM0A 2W9BA 5CYQB 2P5GA 3OY9A 4IRCA 4WYWA 2P1JA 3O3HA 4FJXA 3GV5B 4G1QA 4FZXC 3CDWA 4CEFA 1RYRA 1Z25A 2YNGB 3M9NB 4KSEB 3K57A 4O0JA 2J6UA 4JV0A 2AX0A 3HK2A 3ZT4A 1W25A 1C0TA 3FQKA 3BREA 4EZ9A 5F9NA 4M3XA 4LSLA 4B3OB 3ITHB 4URSA 3NF9A 2JLEA 1LWFB 4O3NA 3SQ2A 4C8MA 4Y3CA 4NLGA 4RW4A 1LAWA 5L1JA 2Z1HA 3TR8A 3THVA 4MK7A 4CERA 5HP1A 2XWYA 1LWCB 5KRSA 3HVAA 1VK0A 2D3ZA 5KI6A 3L8BA 4ZPCA 4B9TA 4JV1A 4WZMA 4CJPA 2ZKUA 4GMJB 1NKBA 2YNHA 3KK3A 3I8DA 4KREA 4CEEA 2ZE2A 3PW4A 4E7JA 2VWKA 3HO1A 5T7BA 3NFAA 3PO4A 3HVTB 2X74A 2UUTA 3PZPA 1QSYA 1HNIB 3KD1E 4CECA 1RTIB 4CEZA 1NHVA 1VSDA 3EY1A 1D9FA 3C95A 4DSJA 2BR0A 4EEYA 1Y97A 2D0BA 4W5OA 4MKBA 2R8JA 1WNEA 3CWJA 3AA5X 1S97A 1HJRA 1Z26A 1T03A 4YMEA 5EWFA 1FK9B 4F8RA 3KK1A 1EX4A 1HPZB 3QNNA 1BQMB 1JLFA 2IJNA 3QO9A 1RDRA 1S9GA 2JEGA 4OVLA 1KLMB 1TVRA 1BHLA 1HNVB 5KFTA 3M9MB 4CESA 3WNEA 3U3YA 2FBVA 1IKWA 3HPHA 5KT5A 1S1TB 3ZT1A 4WE1B 1J5OA 1QS4A 2FC0A 4CGIA 1NKEA 2C2DA 4H4MA 1L3VA 3LP3A 2GIRA 2G8IA 2CJQA 3Q8QB 4Y2CA 3TAMA 4IBNA 2WONB 3HP6A 4CFBA 1TL3B 5T14A 4W5QA 3OYKA 3PW0A 2Q3SA 4IDKA 4ZHRB 2Z1JA 1WSHA 1QQCA 4I9LA 1W0HA 4MKAA 4NLYA 2XRIA 3VQ4A 4O3SA 1IKYB 2DTUA 1FKPA 5L9XA 2W9BB 4L8RB 4GVMA 3FFIB 4KB0A 3P5JA 4G1QB 1RA6A 4WYLA 3V81A 3KNAA 5HBMA 3HKWA 4K50A 3CQ8A 1JLBB 5CY4A 1C0TB 2YKMB 4NCGB 1IKVA 2BRKA 2FLNA 1SL1A 4NLVA 4IKAA 1ZETA 4FXDA 3TAEA 3Q8RB 3JSMA 4DQSA 4KHYA 3BJYA 4QWBA 5I3UB 4RW4B 5KG0A 5DQHA 2B43A 3TAPA 1GX6A 4M3ZA 5E41A 4FLUA 3TVKA 1TK8A 5KG3A 5F8HA 1DTTB 2HHWA 4FLZA 1EP4A 1K1SA 2WCXA 5KFMA 3KLEB 3OYDA 2D7SA 3KK3B 4LD0A 1HQEA 3I0RB 3OL6A 1X9WA 1KFDA 3HSTB 3TI0A 1RT7A 4ID5B 4ED6A 2BQUA 3QEPA 1UAXA 2AWZA 3ZCMA 3SI8A 4FJNA 2RPIA 4ED2A 1MU2A 3QLHA 4OL8A 1TKDA 5D3GA 1VSJA 1A5XA 3CFPA 3DRRA 1NK7A 4CGFA 1NK4A 4TYAA 4O0IA 2KZMA 3G6VA 4NRTA 3OYLA 1NNDA 2ASLA 4DU4A 2GV9A 1S9GB 4F4WA 1TVRB 1HMVB 3E51A 4DF4A 2WB4A 1MMLA 4EBDA 2XY8A 4CJ3A 2OYQA 3MEEB 1HYVA 3MR3A 1N56A 4JRPA 2FBTA 3LP1A 4Z4IA 2P51A 1J5OB 3VQBA 4Y1CA 1RDCA 1ZBHA 2R2UA 4H54A 2PYJA 1YVFA 3SV3A 2HNDA 4NLQA 1N4LA 2HWHA 5KFKA 3VQ5A 4FVMA 4CHQA 3BGRB 1SUQB 3LZIA 4FLTA 3CJ5A 4J9LA 2EHGA 4ECYA 4EP4A 2CKWA 4WFZA 3OLBA 2E9ZA 2YV0X 3OYEA 4JLHA 5DLGA 3DLEA 2W8LA 4ZVHA 4K8XA 1U49A 4OPJA 4ZTFA 4YP3A 1TK0A 5HBMB 1VSIA 1S6QA 4B8CA 3MTKA 3TAGA 1I6JA 3DDKA 2AQ4A 1JKHA 4F3TA 4CHNA 1BIZA 2O4IA 1L3SA 3PV8A 2RDIA 1RT6B 4XPEA 4KFBB 4M3RA 5EWGA 3TABA 3NMAA 4M42A 2FVSA 2ILZA 5KFOA 4G3IA 2JEIA 4ZP9A 1IG9A 2WTFA 2C22A 4PY5A 2HHSA 1SV5B 1VSKA 4KAIA 2OPSA 1U47A 4J2EA 1NOZA 1BI4A 4CJKA 3G6YA 2WOMA 2V4RA 3DOKA 3OSPA 1KRPA 2IC3A 4ZTJA 2I5JB 3PJXA 3M8PA 4MFBA 4DL4A 3KLVA 4DSIA 1L3TA 4DQQA 4DTMA 4FK2A 3DM2A 5KFZA 1RT7B 4QWCA 1XC9A 2KFNA 3RAQA 1MU2B 1A5VA 3O4NA 3QLHB 1SKWA 2KW4A 2G8HA 2BE2B 3QESA 5HROB 4BE0A 3CJ0A 4W5RA 3S3OA 2HNZB 2UVVA 2B5JA 5J1EA 3WNHA 3CYMA 3G10A 1BL3A 1JX4A 4F4XA 3ZSWA 3EYZA 3ULDA 4ZPDA 4PA1A 4J9NA 1S1WA 3ZSYA 3E01A 5FDLA 1EETB 3RMDA 2FVQA 4ZP8A 4EO6A 1ZBUA 2XO7A 4CEQA 4K4VA 1CZBA 1RT1A 4XO0A 4X2BA 2R2TA 4EZ6A 5DLFA 2HNDB 2GUIA 1RT5B 3MFIA 1Z4UA 5C25B 3UR0A 1RA7A 1VRUB 1QAIA 3NGYA 4CEAA 1RDDA 3L2QA 1S1VB 3I5BA 3PHEA 4FJKA 4NYZA 3PJWA 4O44B 2RF2B 3N6NA 1N6QB 4PQUA 4FZYA 2VG7A 4F4YA 4NCAA 3ZSZA 4ELVA 1S9EA 1S6QB 3KLHA 1TKTA 4OKKA 3RR7A 1JKHB 4YR2A 2J6TA 4YQWA 4DMNA 1SH3A 4FJIA 5EU7A 4C8LA 4IFVA 2FJWA 4Y34A 3HL8A 1LW2A 1FXXA 2UVUA 4NLSA 3AVKA 2HNYA 4FS2A 4MQ3A 2OA8A 1K6YA 4ECWA 4YR0A 4EYIB 4CJRA 4FJGA 5KTQA 3AA2A 3VA3A 2ASDA 1SKRA 2OPSB 2YKNA 1BI4B 3OYFA 5KG1A 4WXOA 2PY5A 3DOKB 3ZSOA 3LDSA 2IC3B 4DG1A 4ELTA 3M8PB 3OJUA 1S4FA 3LPUA 3D28A 3EPIA 4MK8A 1XI1A 4O3RA 4Z4GA 4EBEA 2FVCA 1HQUA 3DM2B 3KK2A 3NHGA 5HRSA 3DYAB 1NJZA 2E9TA 1RILA 4DTNA 1W9HA 2O5DA 3NAHA 4U7CA 4OLBA 3IN5A 3TWHA 2VG6A 2A1RA 4IKFA 3O4QA 4KKOA 2V4QA 4KB7A 1ZTTA 1CZ9A 3AVGA 1IKXB 2IA6A 3AO3A 3KTQA 3V4IB 5KG4A 3RRHA 4RW6B 4KO0B 1SL0A 3LWLA 3OS0A 1JLAB 3V6KA 5CZ2A 2P5OA 4FW2A 1LV5A 3E01B 1WAFA 2D0AA 5L1KA 5HRNA 1YT3A 2ITGA 1RT1B 4Q0BA 5KFDA 1LAVA 3T5KA 1VRTB 1RDBA 3DLBA 4RG8A 1I39A 2E6MA 3NH1A 4O3PA 4CGHA 1T05A 1RBRA 2R7YA 3IG1B 3QIPA 3V1OA 5J2NB 1CXQA 1GOCA 3MR5A 4K4YA 4O4RA 2QE5A 3AVJA 4CJSA 4PQUB 5C42B 2VG7B 3UQSA 4I2PB 4IOBA 3NH2A 5SZTA 3CFOA 2HHXA 3DLGA 4ED3A 4YNQA 1RNHA 3KLHB 4CGJA 1KVCA 1DTQA 2J6SA 4CF9A 3LZJA 3T5JA 3VN5A 3S3MA 4IFVB 3GIIA 3ZT0A 2ATLA 3C6UA 2BRLA 3MECB 1G15A 3AA4A 5J2PA 4MIBA 2FLPA 1WN7A 3CIZA 2RKIA 5L1LA 1UWBA 2Z1IA 4H4OA 4I2QA 4O4GA 4E7HA 1K1QA 2E4LA 5DQGA 4DEZA 4K4ZA 1KVAA 4HUGA 2A1SA 4CK3A 4FJ8A 4TQRA 4IR9A 1QSSA 4DG1B 3D5MA 1FKOA 2IS3A 3NE6A 3SUOA 1T94A 3SNNA 2OPQA 2IDOA 1TAUA 1HQUB 1I3AA 3EPGA 4IG3A 4NLRA 3RB4A 4FJHA 2YHBA 4MIAA 2YNFA 4NLXA 4YFUA 2PYLA 3VQPA 3MR6A 1XR6A 4CF2A 1RTHB 3PW2A 2BANB 4KKOB 4NLWA 1Q8IA 1B9DA 5EWEA 2W9CA 4RW8A 1R0AB 1U09A 4Z4FA 3CJ3A 4BE1A 3QIDA 4QWEA 1S1XA 2IGIA 3SJJA 3AVAA 3IGVA 4TY9A 1L5UA 3QEIA 1GOAA 4NLPA 2LSNA 2HW3A 4EO8A 5KT6A 4AHTA 4ECZA 4FW1A 3S9HA 2JC0A 4LSLB 4RNFA 4CHZA 1NK8A 4KHRA 2G8UA 4AHRA 4NLTA 1HYSA 1CLQA 1S1UA 1J54A 4WZQA 1S0OA 4HCCA 1VSMA 3F9KA 1WSFA 4BDPA 1C6VA 3QIPB 1S6PA 5HP1B 4BACA 1LWEA 5KG5A 3LANA 4ED1A 3PW5A 3Q8SB 1KHVA 4DS5A 4IRKA 1CSJA 3QEWA 4F3OA 3RB3A 4FJMA 2ALZA 4HUEA 4QW8A 4CEOA 1RT2A 4B9LA 1S0NA 3OYNA 2IJFA 3VQ6A 4ZVEA 1HYZA 4J2AA 2O4GA 3DLGB 2YNHB 2ZE2B 1C0UA 2EC0A 4NYFA 4XIUA 3SQ1A 4FJJA 3H2LA 1DLOA 2OH2A 4E7KA 3K5LA 4DSKA 1WSIA 4DSEA 4M3TA 3GIMA 3OYHA 3DMJA 3PR5B 3DI6A 3DLHA 3SPYA 4F4KA 1U48A 3KLGA 2C2RA 1T8EA 3AVIA 4H4OB 4RNHA 4O4GB 1UOCA 4HHTA 2G8VA 2QXFA 4NLUA 3MEDA 2I1RA 3K2PA 5KGWA 1T03B 3VQCA 4CFAA 4HYKA 3KK1B 2HHTA 3GILA 4FLWA 1JLFB
chains in the Genus database with same CATH superfamily
1I51B 5DM6L 1RBUA 3HHLC 2ZH1A 1IBMF 4B1ZA 4DR7F 3H8YA 2BJ1A 1ZC6A 2XZTB 4W92B 3LW5C 5KT4A 5KFAA 2I2YA 1CS4A 3IAM9 3TANA 2V68A 3AA3A 5C0YA 5GADU 3C46A 1RWPB 1K0TA 4UOCA 1U2CA 4K2JA 2VBWA 3R3LA 5DG9A 3CCES 1Z05A 3QGPA 4LF9J 1BUXA 3BB5A 2E5HA 4USKA 1NAQA 3KJVA 2E5IA 3O1LA 2E44A 4EK2A 2JWNA 4DV4K 3B6PA 5J2MA 4JV5K 1IR0A 2GV1A 2HSTA 3CJ4A 4EUVA 2AGPA 3MPDA 4IO9L 4F3MA 3D45A 1XIQA 4KIAA 2BDPA 2AJQA 3BSCA 3K9JA 5KFGA 1HYSB 2AA4A 4PKGA 2HHPA 1UCNA 4GC6A 2ZKTA 3OYCA 2QG9B 3VGMA 4B9MA 3IR5B 4BR4A 1GLEG 1C1CA 3FRZA 1TYQA 1CVJA 4BDZA 4B9VA 1G4CA 4DLGA 4YORA 4ES3A 2K3KA 3AVBA 3ETMA 4OLAA 2VPZB 4UOFA 3RRKA 3S1TA 1TV6A 4JYAK 4BRKA 1YJVA 4JKAA 4Q44A 5H1SQ 2B56A 4E3SA 1YTAA 4X66K 3M1VA 4CLFA 1JLQA 3TVZA 3K0SA 2HIYA 3GFYA 3DI6B 2DXEA 3ZSXA 3AY9A 1QAXA 1UA0A 4DV5K 5AQWA 5ETOA 2CJKA 4Z94A 2EFOA 2M5YA 2VWBA 3HM8A 2OHDA 2HMIA 1VMBA 1BWVA 2LKZA 1UTAA 2FZGB 3SJHA 5CZ1A 4C0BA 7FD1A 2CGKA 4CIGA 3KD5E 3GJQB 2DT9A 5C5JA 4K4UA 5KFEA 3T3FA 4OKJA 1ZAVA 4JKCA 1F9FA 2XM3A 3W2WB 3V9SA 1CS4B 1WEXA 4F0KA 3SFGA 1WSRA 3FQLA 2EBGA 2U2FA 4QQBA 4OQJA 4YDUC 4F2RA 3DHXA 3PKYA 4CJUA 4YN3B 5H1SV 3NCIA 4FWMA 5A6PA 4RNNA 4ZCMA 4HLBA 2MY8A 3O1BA 5HAOA 3RJMB 3KJVB 2XS5A 2UXCK 1XR5A 5E3PA 3TEHB 3PO5A 3DAWA 1Y10A 3UE2A 2V8HA 3HZGA 1VQ5S 1YDLA 1NHUA 4IEIA 3NGZA 4WXWA 4IG0A 3E3XA 4KGZB 4FWKA 4CHPA 4B1YB 3U9DA 1IBLF 3UFCX 4C98A 4KHWA 2PD1A 3Q86A 3QZ7A 5K5MA 4DPUA 2E7XA 2A3JA 3B82A 2O3DA 3HZEA 2R8IA 4UF4A 3SK3A 4CLYA 4AH9A 3O3GA 1TYQB 4DPXA 1IM6A 4MKVA 4JD2B 4HWIA 3KIOA 4JI4K 2LQJA 3CETA 2W7PA 4ECXA 2WBRA 3T69A 5MLCQ 4BR0A 2P5VA 4KTZA 5AXNA 1TV6B 2Q1NA 4MFBB 2FVRA 3JQJA 4DR6K 3M1VB 5KG7A 1XNRK 2FTRA 5AQVA 3AO1A 4JAXA 2XEXA 3ENWA 4OHXA 4W98A 2X3GA 4ILJA 1O13A 1ELOA 2V9WA 2QZ8A 3E2EA 2HFNA 4X64J 2J9DA 5AQRA 3NGDA 5J1EB 2E9RX 3ZT2A 4OO1J 1Y7PA 1X0PA 2WONA 2LP4A 4TU9A 2FHKA 3U1LA 2EVZA 3L2VA 1RP5A 5MLCV 3BPSP 4IUFA 3PR4A 3FEYB 4U8VA 2M52A 3QATA 3CCMN 3M5RA 2RHKA 1WG4A 4JI1J 4CBXA 1U1KA 3W64A 3VF6A 4DFJA 1GOBA 4OX9J 2KYXA 3DOLA 1VRQC 4M5DA 3A3NB 4A2BA 4NCGA 2VQEK 4DR5F 1WLJA 1RUSA 1TFYA 4URGA 4WKRA 4H8KA 2YNIA 3BZQA 4JUZA 3UN5A 2F4FA 3K58A 4IG0B 4IDHA 1RT4A 3M7VA 1OY8A 4J2BA 2E6LA 2GX8A 1TKTB 2QRRA 4ZPVR 4NYOA 2NNWA 4DTRA 3NKYA 3SUPA 1DTTA 2QT7A 3BGLA 4LSZB 3KLEA 1LW2B 4E0DA 3ULEB 5G0RA 2BKOA 4RWTA 1NPPA 2HQCA 3M2RA 4MT1A 3LDLA 2ZC4A 1WC1A 3K59A 1GMWA 1YI2S 4HUFA 3CUNA 3T1HJ 4X4TA 1FE4A 2HK3A 3GYNA 3LM2A 1XJWB 3ZX0A 2VZ9A 1R8HA 4CIFA 3HOSA 4QR0A 2IVMA 2EX3A 2MKYA 1PJ6A 3LDOA 3H40A 1APSA 4K43A 4DB3A 1WEZA 1SBRA 5HANA 3OVNA 4FNHA 2EFQA 3HOTA 3QGIA 3C94A 2CNKB 4BROA 4FF1A 2B7CB 1D4XA 3MOZA 4Y1DA 5T41A 1NSAA 1U6BA 4HKQA 4Z7CA 5AQSA 3AARA 3UKUA 2BJ8A 3MWBA 5J2QA 4RO0A 4FBUA 1K8KB 3RTVA 2HB5A 4M5GA 4LF9F 3CCLS 3LDNA 3KZBA 1P8GA 4C8NA 3RW6A 2JWLA 2FLLA 2BTFA 2KVIA 4ZP6A 1D5AA 2DNPA 3ULHA 4FYXB 2XY6A 1DZ5A 1ZBIA 3W60A 2DGSA 3P31A 2ZBCA 5AQXA 3GIKA 4O55A 1SJRA 2D74B 2CQCA 3ZZTA 4IH6A 5I42A 4IR1A 1BCOA 1PJ7A 2QA1A 4RBVA 2CJBA 3W2VA 2GTDA 4ZPAA 1N0VC 3F0NA 2F9JA 2OELA 2KTQA 1T05B 3L7UA 2YX1A 4RNMA 3DOLB 4U7UD 1H3DA 4NZ6A 1F9HA 5G4DA 2D0OA 3J7ZT 2YNIB 1I94J 3EZUA 3B54A 2QLBB 3ZSRA 1RT4B 3V6DA 4CZGA 2ZHBA 2IM0A 2HF3A 3G0ZA 3WEEA 1DTQB 2G4BA 3KLIA 1RCOB 5D4NA 3GYGA 3GG4A 3MM9A 1YXQA 1EAYC 2G1DA 3NY0A 4GV6A 3AA9A 4EYHB 5KGXA 3K5PA 1NHKL 4DL7A 1FW6A 2HBRB 2RIJA 2MJUA 1VGYA 3PRVA 1B0VA 1WDDA 2RKIB 2ZM6J 1TKXA 1KDNA 4ZVUB 3W7BA 3R9LA 2EXUA 2BACA 1DQ9A 5BPLA 1NSQA 4K4WA 1FRMA 3WNGA 1ICEB 1UEKA 3K7RA 3KHLA 2XLKA 3ZT3A 3U1MA 3MN5A 2BE2A 3QEVA 1TP7A 1YJUA 4YDDB 5HROA 2OPQB 1B9FA 3JAMO 3H5XA 2WRMA 2E5LJ 4PQAA 3T5LA 4ID1A 2F8MA 3AV9A 3L4QA 2QEXS 3N4WA 3IGNA 2UUAJ 4C3MA 1R8PA 3QB0A 4GO7X 5KFIA 2B6AA 5J2QB 3HYFA 1S9FA 4MO4A 4H0YB 3W62A 4FM2A 3CJTA 4L6V3 3CD6S 5KPZA 1IBKK 4N8NA 2DR7A 2BV3A 3HSJA 4ECRA 3EVMA 3FMBA 3D6FB 2ZITA 2W8KA 1RTDA 1S3XA 1HNXF 1RT5A 1OPZA 4WQ4A 1HNWK 2R8KA 4H03B 5HN0A 2GBZA 1WC6A 2IRXA 3GYXB 4DPOA 3LPTA 5DK5A 2FHJA 5I42B 1S1VA 3BQ0A 3W2VB 4I69A 4M5LA 3CCQN 3A0IX 1DARA 1UEVA 3ILIA 4DL5A 4Y2AA 5FJ4A 4O44A 2RF2A 3TP2A 1N6QA 3RMBA 3MN6A 4CHOA 4OJRA 1OSCA 3H46O 3VERA 4MIWA 1C0MA 1JCGA 4X62J 2ZF5O 1YITS 3T19A 4EWTA 2FJBB 4IYQA 4CLSA 2G8FA 2D5RA 2MQLA 3O3LA 1XNQF 4IQXA 2XI3A 3RSEB 5IM0A 1KLNA 2NUBA 4BY9C 2HQDA 3V6DB 4GNIA 1WELA 3R6GB 3O3FA 5MAOA 2QWOA 3WEEB 3IBFB 2ZBPA 3KLIB 3I9V9 3SFUA 1KC8O 2Q0UA 1VAZA 3OUYA 3F2KA 3JS6A 2R7UA 3JQMA 2ZH8A 2LYVA 1PAEX 4CIOA 4LQ3A 1TKXB 3VQEA 2O8BA 3SZ2A 3CDBA 4X64F 1VQON 3DYAA 1IQZA 3UB5A 3A8KA 4PWDA 1T9WA 4R8UB 3U3GA 1MG7A 2XULA 4E7LA 2YY3A 1RAHB 3CDEA 1XTZA 3WHIA 4KH0B 5DMRA 3WXJA 4IXCA 3NAIA 4ED7A 3GLJA 5LMNK 1QE1A 2IAJA 4JI1F 4KHMA 2V7YA 4KHQA 3OHBA 2B6AB 1JLAA 3ZO7A 3CMAS 2FBXA 1NM2A 4OX9F 4N5SA 2BH1A 5I3PA 4Z37A 4DFMA 4NI2B 2O8EB 3CEDA 2YH1A 1TL4A 3Q83A 1ZBTA 1JLEB 4RKUC 3GG1A 4NZ7A 1RTDB 2JEFA 3DXKB 1OPIA 3DLKB 1JL2A 3GMGA 4FS1A 4NA1A 4C4WA 1M1KT 3I5AA 3N5BA 3OLAA 2QLFB 4B1UB 2H3EB 3VQ7A 2ALYB 3ZZZA 1AT1B 4JYAJ 5FROA 1VQLS 3M2UA 2OEKA 1KVIA 5EX0A 2O8DA 3NG8A 4MKYA 3ISNC 2KFZA 2EFPA 5AQHA 2E1AA 1YIJS 5F2RA 1RWVB 3FK4A 4WP9A 4O23A 3T1HF 4Q2MA 4JHDA 3DCAA 1X5OA 3BP8A 5AQQA 3MGJA 1HWIA 4FZVA 1WSGA 5IM0B 1KXPA 5GAGI 4J9KA 1N8RO 4XDDA 3B78A 4ZJQA 2AZ1A 1HIYA 3SUNA 1NJWA 3D2WA 3O9QA 3UPFA 3AGKA 2PFFB 1VS3A 1T3NA 3VEZA 3FVYA 2LXIA 5IXUA 2AGOA 1WOPA 1RKJA 2OZMA 4ILMA 1FK9A 1FKAF 1BDGA 1FRKA 3NBPB 5GAEP 4CJLA 4F4ZA 3RMCA 3CM5A 4FOIA 4V19J 4KI4A 4OGEA 1X3NA 4TNOA 4PWDB 3OPKA 2UUCK 1WG1A 5E0OA 3VQAA 1RFQA 1NMEB 3CCJN 2C2KB 4CZIA 2BANA 3OYAA 1OH5A 4AM7A 3T5HA 1WHXA 1R0AA 2JVRA 1YG0A 1QE1B 2IAJB 1A5WA 1FXRA 3HTVA 2LCWA 5CYQB 2H5IB 2P5GA 1YRUA 1WF2A 3U02A 4ITSA 2VF3A 3MDFA 3GV5B 2WZ1A 1M90T 3G82A 2AEJA 2YNGB 3K57A 3BBFA 2Y1LB 1I94F 4R79A 3PIOQ 4JI4J 3EGVA 4URSA 4RUBA 1JCFA 1BD6A 4B3RJ 3BN4A 3NGTA 4RW4A 1VQMN 4AL7A 5EX3A 2ZJQQ 3QSYB 3T6JA 2D3ZA 4DR6J 1U2VA 4DX7A 4B9TA 3DU5A 2RQMA 1XNRJ 4DZDA 5E5NA 5A8WB 4GMJB 5E26A 4LF4K 1NKBA 2YNHA 3KK3A 2ZM6F 2HURA 2VWKA 5T7BA 4JHDB 1CQNA 1X4EA 3HT0A 3NFAA 1F5CA 5AQOA 1VC5A 1QZ6A 4FWSA 5M2RA 3PZPA 3IO1A 2ZBRA 2XNQA 4CEZA 5FD1A 1FWKA 3EY1A 1G3OA 4DSJA 2D0BA 2E5LF 2R8JA 5BRFA 1WNEA 2DNNA 1S72N 3P96A 1FK9B 1P9YA 2ZOGA 4HVZA 2UUAF 1UPMB 5IT9O 2B9XA 3WDOA 1TVRA 5AQKA 5KFTA 4HHJA 1NGIA 2NLXA 3VETA 3IMQJ 2FBVA 1IKWA 1O5JA 5KT5A 6FDRA 2O8CA 1J5OA 1W97L 2ZJQL 2VQEJ 4OI2A 3N01A 4USMA 3THWA 2DRBA 4CFBA 4W5QA 1X5TA 1RKIA 3R7BB 3QAEA 2XMUA 2BVZA 2VFUA 2Q3SA 4IDKA 8ATCB 1WSHA 1QQCA 3HI0A 4NLYA 5A6WA 3VQ4A 4O3SA 4CZLA 1BHNA 2VOPA 3FFIB 3P5JA 3TA0A 4WYLA 2DHHA 2IIRA 3KNAA 4QIEA 2WSCC 3DNCA 1A7GE 5BR8K 1JLBB 3UKRA 4NXNJ 1EZZB 3KJQB 4ZOSA 1NDLA 4P10A 3Q8RB 4DQSA 4H5WA 1WBBA 4U7BA 4QWBA 5I3UB 2EG2A 4RW4B 4PR6A 2QFJA 3F41A 2KT3A 5B09A 2WVBA 2NZCA 3DKDA 2HHWA 2X1AA 1K1SA 2WCXA 5KFMA 2DNLA 1U2VB 2DXDA 2E7WA 2BE9B 4C1NI 4JI0K 3AOBA 3RUBL 2MQNA 3KK3B 3WZ0A 4Y2KA 3CQXA 1HQEA 3NS7B 3PG9A 1KFDA 1H72C 5DDQC 1H74A 5HQLA 3SQOP 4CH7A 1ZA1B 2MQPA 4ID5B 4ED6A 2BQUA 1GFWB 4DV4F 4LJMA 4OL8A 1RBAA 3O44A 4WBFA 5D3GA 2X3DA 1Y5IB 3DRRA 2NS1B 4MO5A 3BF3A 1RHKB 1NNDA 2VOOA 1HD1A 2EEYA 1RLDA 3EVOA 3D2EA 1TVRB 3CPWR 3UN2A 4R0JA 3PSFA 2ZH2A 2WB4A 1N34J 1MMLA 4CJ3A 3R8EA 3MEEB 3WIUA 4DV1J 3LP1A 4FPRA 1J5OB 1WUUA 2P51A 3SDEA 3VQBA 5FPDA 1K9MT 1XEZA 2MQQA 1RDCA 1EO1A 2R2UA 1Y9OA 2PYJA 4NLQA 2J4RA 2HWHA 2ZC3A 5BN8A 4FLTA 4Y65A 4USHA 4ECYA 4QR1A 4DPWA 4EP4A 2CKWA 4JYAF 2CQGA 2ERRA 5HJXA 4JLHA 2V94A 3EJMA 4H4KA 5FLXU 2K8GA 1U49A 4YP3A 3B8AX 1S6QA 1KOHA 3MTKA 2QLJB 2ZH6A 3DDNA 4A4JA 3MI7X 2NREA 2BE7D 1JKHA 4W90B 4QIVA 4CHNA 1MROA 1BIZA 2HBQB 2RDIA 3UNGC 1RT6B 3B8HA 3C7NA 4KFBB 1TZ0A 3CCVN 5M1KA 2R7OA 4A59A 2YJFA 2UZAA 3AQPA 4DUZK 1IG9A 5LJ3Y 2UUBK 2DNZA 1V4SA 5A8RA 2HHSA 2HZVA 4KAIA 2OPSA 2NCKL 1W2BR 3R2DJ 4CJKA 3G6YA 3AH6A 3OSPA 3D0IE 3KG4A 2IC3A 4ZTJA 2I5JB 3V5RA 5BRHA 2BBEA 4DSIA 2G13A 1L3TA 3OV7A 2CZ4A 3VHQA 5KFZA 3WC0A 1RAFB 1SVDA 1F0XA 1TUWA 2ATCB 4CLKA 1A5VA 3O4NA 3BS9A 1NBWA 3J81U 4F26A 2KW4A 2LVWA 5FLXO 5JVHQ 4KHPJ 2G0IA 4NMXA 3QFPA 4MYUA 3S3OA 3GL1A 4M7XA 4ZVPB 1NB7A 1R3NA 1YJTA 1BL3A 3EYZA 3ULDA 5AE2A 4J9NA 1FXLA 5HMZA 2AYBA 3ZSYA 3R5AA 3E01A 4RCHA 2KYZA 1MMDA 1JNZB 2M3DA 2C3UA 3SDEB 2XO7A 4CP5A 3D0HE 4YB7A 1CZBA 1F60B 2AZ3A 2YKAA 4JI4F 4EZ6A 3D0GE 3MFIA 2YHXA 4LF7J 5ETKA 1CC7A 5M2UA 5C25B 2EK6A 4B3RF 2DHGA 1QAIA 5JMNA 3NGYA 1RDDA 4QBUA 3SXLA 3L9ZA 1PAUB 3VTIA 1NSPA 4DR6F 2KXHA 1XNRF 3N6NA 4PQUA 5FPMA 3ZSZA 1S6QB 1ZM4A 2BZ2A 3DXMA 4OKKA 4WFBQ 4CLZA 5JVHL 1JKHB 1JMTA 1MROB 1YJRA 4YQWA 2CVEA 1SH3A 3J81O 1BUPA 3GU0A 3HL8A 4TKTA 3ADAC 3O4WA 4CJRA 4FJGA 3VA3A 2ASDA 3MPUB 2OPSB 2GFFA 3CC2N 3SCKE 2MY7A 5KG1A 2PY5A 3R27A 2JL9A 3LDSA 2XHCA 2IC3B 4DG1A 4V19X 4NLBA 3GIRA 1HHQA 4O3RA 1ITPA 4DUTA 4EBEA 1PO6A 1XMQK 3SCJE 2B4PA 5HRSA 3NHGA 4IO1A 2VQEF 1NJZA 3M6GA 2CQ3A 3JTOA 2HHHK 4USWA 1FNOA 5E84A 3DLLQ 3W65A 1KAXA 3DLJA 2A1RA 2NLWA 4LR9A 4KKOA 4KB7A 1ZTTA 1CZ9A 4WFBL 5E3CA 5KG4A 4RW6B 2GGPA 2Q0RA 4JKGA 3JAMY 3C16A 3LM9A 1QVFM 2HIQA 1SL0A 4JEPA 5AZIB 3LWLA 4PKHA 1NCLA 2ZFHA 3A1YG 2AW0A 4FW2A 2BUNA 3E01B 1YT3A 1VHXA 5KFDA 4Q0BA 1LAVA 2BM1A 1WC3A 2AV5A 2FYXA 3T5KA 1VQ6N 2LQ5A 4GKKK 2M88A 3EGWB 2D3O1 3AD9C 4DPYA 3W0LA 3MD3A 4WQ4C 2V8VA 1AUDA 1JJ2M 1LK5A 5GIOA 4JK9A 5J2NB 1CXQA 2DIUA 1ATRA 4K4YA 4FL9A 4O4RA 2QE5A 3A3PB 2UXDK 3QT8A 4CZCA 3AAPA 3AVJA 3W3DA 1XMOK 4CJSA 4PQUB 1UKUA 3OR1A 1S5ZA 2AP1A 3UQSA 1UVKA 1VQ4N 4IOBA 4RBUA 3NH2A 2QLXA 4AFFA 3DLLL 3DLGA 1HNZK 4OPAA 1BWFO 3TR5A 5BREA 3SEOA 4CF9A 1NGCA 5E2QA 2VDIA 4RJVA 2KFYA 1VQ8N 3GIIA 1UFKA 5ETNA 2GJFA 2Q6BA 3C6UA 1G15A 3QWUA 2PFUA 5ADXH 5J2PA 4EAHD 1DQAA 2UUCJ 2PSZA 1UWBA 2Z1IA 2C3YA 4I2QA 2KI2A 4RTFD 2QLWA 5B0GA 4O4GA 4D3HA 1WKKA 4I6WA 1KVAA 4K4ZA 3CC7S 3I33A 4HUGA 2A1SA 4H5TA 2MSSA 4IR9A 1FWLA 2X1GA 4E2FB 1T6CA 4PRFA 4AF1A 1P27B 4DG1B 3D5MA 1FKOA 2IS3A 2LLZA 1N34F 1ZBSA 3LL3A 1GLCG 2YKQA 4DV1F 3KG1A 4DR4K 2DISA 2IDOA 4OYBA 1I3AA 2QA4N 1CG2A 5E3RA 1HKCA 1SQEA 2OSRA 1FX4A 4FJHA 3F9MA 1OH8A 2YHBA 4MIAA 5F3TA 1DURA 4CF2A 2HRTA 1RTHB 3PW2A 4KKOB 1GXUA 3D3BJ 3FZLA 3D68A 2V67A 3CJ3A 4P2FA 2WBNA 4JKGB 1T3VA 2IGIA 3C16B 4JP8A 2GS8A 1ZM2A 3WQTA 2NSCA 1RWOB 3QEIA 2PMZD 1QQOA 1GOAA 2JFDA 3NOGA 1S99A 1ILYA 1BOTO 2ASOA 3T7ZA 1VHIA 4TLQA 4FW1A 3MUTP 3RVCA 5EGYA 2UXBK 2JC0A 4PWUA 4CHZA 4YB5A 4A48A 2G8UA 2J7UA 3QNWB 4NLTA 1J54A 1NSKL 2P9IA 2LFVA 2NXUA 2XHWA 3P3DA 1FDNA 4OZ0A 1S6PA 1X4AA 4BACA 1LWEA 4OX7A 3LANA 1Q8KA 2D9OA 2APOA 4DS5A 4FJMA 3RB3A 4QW8A 2FHMA 2A0FB 4B9LA 1S0NA 3OR1B 3OYNA 2AF6A 1HYZA 1R8CA 3CJBA 3DLGB 2WBMA 2P9UB 1WOQA 3CPWM 4FJJA 1YTYA 4H0TB 3N4PA 2OO4A 3K5LA 4DSKA 4KGKA 1WSIA 5L46A 3OYHA 4X84A 3DMJA 4EFAC 4HACB 3PTWA 3N4QA 2PI4A 3CCEN 1T8EA 4H0VB 2I8EA 3MMJA 1K9MO 2KG1A 4O4GB 3AODA 2G8VA 5ADXA 3W9IA 2HBLA 4KPCA 5IV3A 1S0VA 2XLIA 3KK1B 2IA0A 2ZGZA 4CO2A 1HI8A 3AVHA 3D1OA 1FKOB 4ES1A 3KHRA 3O5TB 4U96A 4CF0A 3OYJA 1HBMB 3SCXA 4ANEA 4AHUA 5KFUA 4KBOA 2CPHA 1WC4A 4H4MB 4YOVA 3EM1A 4PG5A 4M94A 5EUHA 5AFUH 4N56A 2AEFA 4XEIA 1SJ1A 1N5YA 5D0HA 1KN6A 5AQJA 5F8MA 2IBKA 4Q8EA 3G71S 2ZGYA 1FERA 3Q24A 2VD3A 1IUJA 1TKZA 4U6PA 3QERA 3VEXA 4ISEA 2P9PB 4GW6A 5CXTA 1DBDA 2WK4A 2HGMA 4CQ1A 1SXLA 2R4FA 3V81B 3G8QA 3MN7A 1CC8A 1Q78A 4U7UK 3BR9A 1RDWX 3ZETA 3BQ2A 4LF2A 4OYZA 2Q36A 1W2BM 2HBKA 4CT9A 5EN1A 4MH8A 5ETVA 4B3SJ 1VISA 1IBMK 1F2GA 3JSMB 4I7FA 4NLOA 2V8PA 4NEYA 2VB6A 2X6SA 3S01A 2W6LA 1ASUA 4B9UA 1ZZFA 4A8XA 2H54B 1YTUA 3EDQB 1EP4B 2GO9A 4EI2A 1P1LA 3M8QA 4K42A 1J9AA 2PZSA 1SH0A 2AMCB 1D9DA 1N32J 1YRTA 2IVPA 4PCQA 1VSEA 3VEOA 3QGHA 1K8AO 2G8WA 3CJKB 3T1AA 3CCQS 5KFVA 2KT2A 5KT2A 1ROFA 1EARA 4F0HA 1LKZA 4H5VA 3DMJB 3TUPA 1WEYA 4FOEA 3VENA 4FPAA 3GV8B 1GAOA 1N36K 3X1LB 4CLUA 3PEJA 2DR5A 1FDAA 2JZ5A 4CVNE 1E6YB 4GVEA 3HM9A 2CIMA 3JTNA 4L3KA 2VG5A 4JRQA 1VQ5N 4FZZA 3U1NA 1HLWA 3HMJG 5HLFA 3NAEA 5KFNA 3EEQA 5IT9Y 4K5RA 4NLDA 3A13A 3Q7BA 1JXVA 3ELHA 3SMSA 1IWGA 2B7BB 1SC1B 4TQSA 2QSFA 3F73A 2FF6A 3DHWC 1U0HA 4LF6J 3OA9A 1NGAA 2UUWA 2RS8A 4KQZA 1N5YB 1HW9A 3NNAA 3WXMB 5AFUA 1RDAA 3H3OB 3IAS9 3M05A 2DK2A 1VQOS 3FDSA 1LOTB 2HWIA 3ZNUA 3BKTA 1Q81T 3DLEB 4QPTA 5M1NA 5K8NA 3B6OA 4F3QA 1FRLA 2YX6A 1MWQA 4O5FA 4IJAA 1JLCA 2HQFA 3Q23A 3RBEA 4KHSA 4CEDA 5AQGA 1T02A 4JS5A 1V5IB 4HTLA 1PG5B 1Q16B 3H4DA 2RE1A 4I7FB 2UUCF 2F65A 4MMOA 1O51A 4DV3J 4R5PA 1WSJA 3P5BP 4DMZA 4FLXA 3QYYA 3EE3A 4WIQA 4CWBA 1CZAN 2M0GB 4CJFA 1RGVA 3HCXA 2MZ1A 1QHAA 4J9PA 3Q8YA 2C2NA 3HULA 4BRLA 4IH5A 3QEXA 4EP5A 2F4VJ 5HRRA 3OYMA 5KFBA 3H5YA 3VWSA 5FRNA 2BQRA 3ZNJ1 5BYQA 2WW8A 4WIIA 4NB4A 2VIHA 2KRBA 2AJFE 4RW7A 2AJ4A 1H73A 1R8AA 1BQMA 1U4BA 1HA1A 2DEIA 1XBWA 3SPZA 3MMAA 3PX0A 2XO6A 4OI3A 1IBLK 3GR0A 3EE9A 4I67A 1PYSB 3C66A 3KFWX 3MMBA 4CO3A 3AJDA 4XH4A 3CCUS 2GWJA 1NK6A 1RI7A 3OTOJ 1CQMA 2W4PA 1TFWA 3DRPA 4KPYA 5HLFB 4LREA 3VQSA 2R2RA 1S1WB 2CDRB 3NH0A 1VJQA 5FDLB 2HLTA 2NYIA 2HZCA 3QFHA 3LOUA 4DQPA 3EMTA 5HI7A 2GUPA 1IKYA 1H0HB 3IC1A 1AZSB 1N5SA 4CJ5A 2ZH4A 4IH7A 5AE1A 4BVOA 2NZ4A 3FZKA 2GX9A 3RWUA 1FA0A 2YKMA 1SJQA 3SBMA 1QLNA 3TTFA 5DS7A 2FJXA 4CGDA 4FYVB 1FDBA 4H4KC 1RYSA 4NCBA 3U7JA 2B9WA 3MMCB 1S9EB 4K8ZA 1WHWA 1JLCB 3K9KA 1WD6A 7AT1B 3MK6A 1W7AA 1LXNA 3BO3A 1TK5A 4BRDA 1QVGM 4JI6K 4RUCA 1PJ5A 3ZYYX 4UY8T 1BA1A 3SSQA 3M6VA 3TA2A 2DCLA 5T7LA 2RDDA 4P71A 1U7LA 1HI0P 2HNYB 2HHHJ 4R5PB 1YZ6A 3H5SA 3B4DA 2D3UA 2W4DA 4I56A 4OYPA 3CCLN 1S6OA 1SC4B 3AOCA 3V9ZA 4OHYA 4QOZB 1TMJA 1F9EB 4I9QA 2B4UA 3VGKA 5DG7A 3IKMA 4LVOP 1GMUA 4BRMA 4CZMA 5A2QY 4USJC 4LSNA 4UY85 1VQMS 2IFXA 5D0RA 4AHCA 4DR5K 3DRSA 4A2AA 3KOAA 1WG5A 1OH7A 3KK2B 2HS0A 3V2UC 1G1XA 3ZZ0A 3DJCA 1KTQA 1Q82T 4UT4A 4RW7B 2P8IA 3O2IA 2D3OR 4PUOA 3MMAB 3HI9A 2V52B 2VG6B 4FPBA 1VBXA 3GB0A 4M1KA 3CXCR 1GMVA 5L39A 2D41A 2FZCB 3DRPB 3D3CJ 2UXDJ 2K1RB 3D2FA 4KHNA 2DPJA 5L1IA 2DFHA 1SUQA 4CI6A 1N54B 3LTOA 3MXJA 2HAIA 3BQ1A 4LRFA 4ZA1A 4D3GA 3KYLA 1O0PA 4KV8A 1QHTA 1JWWA 4B3SF 5CZXA 4DFKA 4OV1A 3EZOA 2VA2A 2EWSA 1DRZA 2W7AA 2CJXB 5KQ8A 3RB6A 3SYZA 2HGLA 3KMQA 1WAJA 3ALYA 2H5EA 4X65J 2YBVA 2B8PA 1X60A 5F0UA 3LP2A 3PX4A 3S41A 2J76E 1YQHA 4L3NA 3CE8A 3IFEA 4KY3A 1KWMA 4LF9K 5CR4A 1FRIA 2A6AA 1N32F 4GVLA 4CFDA 3ZFVA 4DF8A 3CNQP 3V4MA 3TTDA 4RW9A 1SZ2A 4IQMA 4DWIA 2OPPA 2ZH7A 3KKSA 2P9KB 1RCHA 3M2VA 1QZ5A 2QEXN 1SV5A 3D54A 3HPOA 4CF1A 5CE3A 5D78A 3FC9A 2W40A 4LFBJ 1IO2A 3ZZUA 3CD6N 4C8KA 4OPKA 3BPDA 3JYTA 3SIPB 1NEEA 2CRLA 3WC2A 1UJ6A 2OEJA 1X5PA 3I56N 4N47A 4DQIA 4LFAJ 3FBFA 4QCLA 5KRTA 1NJIO 3RR8A 5EVZA 4ANDA 4BS2A 1N0UA 4QAGA 3D7SB 3ZSQA 3HJFA 2RN2A 1Q9YA 4ES2A 2YH0A 4LSNB 3DRSB 3C14A 1RWMB 2YX4A 1U04A 3NF6A 2MHEA 1B99A 2IOCA 2DH8A 4CZEA 1N33K 2HNZA 2WB1D 4LF6F 2IM1A 1NWKA 1F21A 4PUOB 2FJVA 4ICLA 3MEKA 1S57A 5LSOA 1NGJA 2O8FA 4WU2A 3CW2C 3HSCA 2MPUA 4DUZF 1YITN 2OZSA 1EJ7L 1KQGB 4HDHA 4CYUA 1JXEA 3AFGA 2JHEA 4Q45A 3OBWA 4BR2A 1VRUA 3AOAA 2XQCA 4RU9A 4CO1A 4H5NA 1OS5A 3I82A 2IDLA 3GSDA 3TAFA 4KV8B 3HRGA 3NDKA 4E19A 4BR9A 1BO5O 4CJTA 3VF0B 4ZVFA 3TQ1A 1C2PA 2H65B 2P9LA 5C24A 4ZP7A 4I68A 4DV3F 2ZNZA 3HPGA 2E1RA 2W7OA 4B08A 3OHAA 1AUSL 2AGQA 2FXUA 1YVUA 1UW9A 3ENQA 1MDUB 3PDNA 1NK0A 3AVLA 2HPUA 2ACMA 2DGQA 3SQGA 3LP2B 3HXMA 1ULRA 2XHBA 3NGKA 2QA4G 1D3WA 4MLEA 1HFEL 2EKNA 1VSFA 5ELZA 4QU6A 4A57A 3PVXA 3NCQA 3MHYA 5HOOA 1PGZA 4RW9B 2F4VF 3THTA 1WSEA 1KQSR 2OPPB 1QSLA 3H08A 3M2VB 3ISND 1IWAA 3H45C 1Y5LB 2AJ0A 5D15A 3KUHA 3CMAN 2C3PA 2DB1A 1SIZA 4CJVA 3LAKA 4FJLA 3JYTB 5BYRA 3SBTA 4B9NA 4LF5J 4OHZA 1R6VA 1VC6A 4JI8K 4DHVA 1RWUA 3FZ2A 4A47A 3G86A 5KT7A 5D77A 1JJHA 4N76A 1LXJA 3LPYA 3OTOF 1M1HA 2E20A 3SCIE 3CCVS 2GC8A 2U1AA 4ZLNA 1RU2A 1Q9XA 1IKXA 3DC2A 3V4IA 4F36A 1Q81O 2CPYA 1SJ3P 2KQ2A 2WUSA 1VQLN 3D6TB 2Y1JA 4L74A 2IMWP 4GVBA 1VBZA 3GV7B 4CE9A 1B7YB 4ICLB 3SAFA 3P1GA 1NJXA 3C15B 4L72B 1S5JA 4OZJA 3S3NA 1YIJN 1VFJA 1J2VA 3GFHA 3NWGA 5DDOC 3KK7A 2K06A 2DY4A 3SSSA 4NRUA 1XR7A 4CYUB 1VRTA 2F9TA 2V2QA 2PMHA 4FWPA 1LWFA 2R7XA 2XSJA 3HF5A 3OHRA 4X64K 2DGXA 2BJEA 3PRDA 4TLRA 2QWQA 2VBYA 3A8YA 3IWXA 4ISGA 1X9SA 1TL1B 1XMQF 5C24B 1QY7A 5C42A 3L3VA 2HHHF 2K7KA 1B92A 1BGXT 3CJQA 2ZD1B 2XS7A 4A8SA 1PILA 3E9PA 1N36J 3U6FA 4JI1K 4CI0B 4C2MA 3SQGB 3N6MA 1Q1KA 3W66A 1KD1O 2DGVA 3MECA 2DYAA 4ZVRB 1U1OA 4OYMA 4W5NA 4JKDA 2M4MA 1NJYA 5KFPA 2R7SA 1RK8A 1X0FA 1NH8A 2F96A 4AILC 4B3TJ 4NXMJ 1VCTA 5K8MA 1VR6A 1V6HA 4OI6A 3GCXP 4I6AA 3HKZD 3DRYA 3O8MA 4HT5A 3L2RA 3UO0A 1KFSA 3MCSA 1OSDA 1KLMA 1Q86O 3HVRA 5ETQA 3D4JA 5C7PA 1ZBLA 2PAVA 3LF0A 5CYMB 2QKKA 2CA9A 3H59A 1HARA 4K7QA 4A61A 2XS2A 2UXDF 1EXQA 5AQLA 4ECUA 1W26A 3T1HK 3PKMA 1D8YA 4WU3A 1XHXA 1S77D 4C48A 3R6LB 1RTJB 2JRSA 5IT0A 2LEAA 3GDQA 5M1OA 3HFVA 2W9BA 4GVBB 1VK8A 3MM6A 4C8YA 4IOXA 3CC2S 2P1JA 3O3HA 4FJXA 2ZUAA 1RISA 2J9DE 2X7IA 5A0YB 4X65F 4JV0A 2AX0A 2KDOA 1W25A 5KOWA 1C0TA 4KGXB 3FQKA 4L76A 5F9NA 4M3XA 4B3OB 3MMVA 4WWSA 5JICA 4DN0A 3TSQA 1T11A 2PO4A 1LWFB 4O3NA 3MXHP 3SQ2A 4Y3CA 2QGFB 1PSDA 2L3MA 2Z1HA 3TR8A 3HBTA 3THVA 3E1YA 4CERA 1Q95G 2P6TA 4B17A 5KRSA 4HTJA 5B8HA 5GADI 3KWMA 1I1GA 1VK0A 3BUZB 4G1IA 5J1NA 3R1HA 4JV1A 4KT0C 2QWNA 2R9LA 2RB7A 3QRRA 1ACMB 3U4LA 2ZE2A 3PW4A 3HO1A 4O0NA 3ENVA 1Q82O 3ID8A 4LFAF 2UUTA 5GMDA 5DDRC 1FFWB 1QSYA 1HNIB 3CXCM 3KD1E 4CECA 1VC0A 5C2DA 4JI2J 4NX9A 2BR0A 2F63A 1Y97A 3MPVA 1I94K 4Y0WA 2VGNA 2XZWA 1S97A 1UPPA 5EHHA 3CC4N 1OMSA 4K25A 1HPZB 3VTHA 2IJNA 4OVLA 1KLMB 1BHLA 5HVHA 1UJ4A 3ZTPA 2NRVA 1UVJA 2VHGA 4ANCA 5IT4A 3U3YA 5E7OB 2BJ9A 3NEKA 3ZT1A 4CGIA 3DRXA 1QS4A 2YHYA 3ENBA 1NKEA 1WB9A 3Q8QB 4Y2CA 1LCUA 2RVJA 4A8QA 3NCRA 4F0MA 2ZM6K 1TL3B 4DZ6A 3VF4A 5B0EA 4ISFA 2UV8A 1IR2A 3AJ2A 3EL2A 2ZUGA 1HD0A 4M5IA 4MKAA 1O6XA 2HEKA 2DTUA 2PA3A 2FY8A 5A76A 2W9BB 5TKWA 3MM6B 4L8RB 4JI6J 4UW2A 2Y0BB 2IPOB 3OVAA 3ILOA 4OX6A 2NXEA 3J7AN 5EY4A 2E5LK 4K50A 4C0HA 3CQ8A 2XG8A 3HD2A 2QA4S 1C0TB 3MM8A 1SL1A 1RBLA 4NLVA 4IKAA 2CQ1A 4FXDA 3VALA 2QSWA 3FGUA 3ZTSA 4KHYA 2LU2A 5KG0A 3TAPA 1I3OB 2MYFA 5E41A 1TK8A 3TVKA 5KG3A 5AQZA 1CEZA 4DR2J 3ZX2A 5AQNA 4FLZA 3RU0A 4R25A 1X4BA 1NXIA 2NPFA 2MDAA 3TZYA 5C2CA 1F5BA 4UQTA 3BH7B 2D7SA 4KJIA 5ITHA 4C1NK 3OXLA 4LF5F 5CQGA 3I0RB 2F8HA 3C0BA 3BF1A 4NL5A 4JK7A 4YOTA 5GAGP 3CCZA 3QEPA 1UAXA 2G0JA 4JOUA 3SI8A 3TPQA 2RPIA 4ED2A 2MLYA 2CPEA 1TKDA 1VSJA 1IG8A 3FRYA 4X62K 3CFPA 2RU3A 1G6BA 1NK7A 4YDXA 1RABB 1NK4A 4LC9B 4TYAA 2KZMA 3FLCO 2IHR1 2CQIA 4F4WA 2CPXA 1HMVB 3CT9A 1GMWD 4DF4A 2XY8A 4J9UE 1HYVA 3W2WA 2FBTA 3I55S 3THXB 3FSYA 3VEYA 4JI5K 2DPNA 4H54A 1YVFA 5KFKA 5J1PA 1V5VA 2ZWOA 3WBZA 1N5VA 3BGRB 2D1CA 4QS7A 4BRPA 1WOSA 3M30A 1BMQB 3K2YA 2RRBA 2HQGA 2A3ZA 3GZ7A 5ETTA 2W8LA 4JN4A 4K8XA 2ASYA 3BBCA 2YTCA 2D9PA 1KQSM 1IJEB 4CO4A 3SAGA 4PXCA 2H3GX 4ZIVA 1MWKA 3TAGA 3J80O 3DDKA 1FWPA 3MM8B 1N36F 1UEUA 2PE8A 1XUPO 3SMPA 4F3TA 1HBOA 4KGVB 2F5GA 2ZHOA 3PV8A 3CPEA 4XPEA 1MLAA 2PMWA 4CLPA 3MCOA 3LGHA 5KFOA 3TA1A 1VQNN 4B3TF 3Q2TC 2JEIA 4TVAB 3M4XA 2WTFA 4PY5A 1HW8A 4JD2A 4YEAA 1EWRA 3ZEUA 2C2OB 1N33J 3D66A 4NA2A 1NOZA 4K8RA 4NE9C 4NO7A 1NUEA 3D1QA 1YF5L 1KRPA 3M8PA 4MFBA 4KYZA 4PZVA 4DQQA 3DM2A 3BGOP 2QJ3A 1EQ0A 4NA3A 3RAQA 1SKWA 2VC0A 1N88A 3NS5A 2G8HA 1H7WA 4C7QA 3QESA 4OV6A 5EX5A 3C6AA 2DH7A 3VR1A 3S7RA 3LQVA 1VQYA 4W5RA 3BDEA 2A10A 1KC8T 1VHFA 2FGCA 5J1EA 4M5NA 3CYMA 4MDAA 3DGVA 1ATSA 2UYTA 3G10A 4Q2LA 3EXCX 2OD4A 4ZPDA 3EXYA 2DNRA 4KC5A 1Y00A 3X3UA 1EETB 4ZP8A 1NGBA 4CEQA 4K4VA 4GRSA 4FF2A 3AA8A 5AR0A 4LF8J 1YVNA 4WP8A 1V4TA 2Q6CA 1Q7YO 1C4AA 2M9KA 3UR0A 1RA7A 1R59O 5BYSA 4CEAA 2MKJA 1UAWA 3M30B 4A8WA 5F1XA 3L2QA 2N4DA 2DO0A 2DGTA 2DNHA 3I5BA 3AB2B 5I4MA 2QFIA 3TZWA 4O8UA 3BO2A 2E1MC 2VG7A 2OANA 4NCAA 5B08A 1YJ7A 1VBYA 3KLHA 4HTIA 1TKTA 4JKEA 3NGUA 2J6TA 1HBOB 5I9EB 2K2PA 3NRBA 4HI1A 4JI8J 4IFVA 2FJWA 2W1BA 4JKHA 2KJVA 1LW2A 3ULEA 2ZBIA 2UVUA 5DRKA 4NLSA 1OYEA 1MNEA 3HX9A 5B0DA 3QFWA 4P6QA 1BE4A 4EYIB 5KTQA 4B1WB 1M5KC 4WCEQ 3GSIA 1W7WA 2Z2LA 3WT0A 3ZEUB 1Z6RA 3R2CJ 3H1VX 4HH0A 2DNYA 1Q0NA 3ZLJA 4B3RK 2DNGA 3OYFA 4F02A 1Q79A 2OGUA 4ZITA 3ZSOA 2GMJA 1LNQA 4I0WA 3OJUA 3M8PB 2IBOA 5IV4A 1XI1A 4Z4GA 3NNHA 4FPIA 4F04B 4YHHK 3DM2B 4CZJA 4NLCA 4MAKA 4OJGA 4HI2A 5D4LA 4MTPA 4DTNA 1W9HA 2O5DA 1N8RT 1SPBP 4B1XB 4CLWA 3W8PA 4OLBA 1K8KA 3IN5A 1MWYA 1ZA2B 1VQ7S 4IKFA 3O4QA 2B4VA 3AVGA 4ZDNA 2IA6A 2ZZMA 2E2QA 3CJ1A 3RRHA 2JNJA 3OTDA 1AFIA 2AYEA 4KO0B 4JI6F 4ID8A 6AT1B 4C11B 2GHVC 3Q22A 2HYIB 3W61A 3OS0A 1WI8A 5CZ2A 3CMES 2DHSA 2JX2A 5HQMA 1Z2ZA 2ITGA 2OUGA 2ZOMA 4WCEL 5GAHP 3TTCA 3LPEA 1X31C 2DXFA 4RG8A 2E5GA 3PYEA 1ZXOA 1IXKA 4O3PA 2D0PA 1HKGA 1T05A 1RBRA 4QS9A 2IVNA 3IG1B 4LR8A 5JLFA 5KPRA 3V1OA 3MCMA 3RG6A 3K8VA 1FNMA 1FFSB 3CC7N 2GHWA 4ED5A 2VG7B 4KR0B 4I2PB 3CCWA 4FWLA 4A46A 2HHXA 4ED3A 1RNHA 1SC3B 1YJNS 3KLHB 4BRFA 4CGJA 3C19A 1DTQA 3FNNA 1FHTA 3JSRA 3VAIA 3Q7CA 3P8BB 4DDFA 3T5JA 3S3MA 4IFVB 1LWXA 3ZT0A 4WK1A 1R0BG 1XC3A 2BRLA 3CJRA 2HFVA 3FEZA 3AA4A 3OBYA 1HWUA 3CCRN 2RKIA 2NRRA 5L1LA 1U24A 3W3SA 4NXNK 4H4OA 4DU8A 2CQ4A 1HR0J 4J91A 4DX6A 3QJJA 1AFJA 3M8WA 2CYYA 2GMHA 4TQRA 2M2BA 2R7TA 4ZCKA 3PNIA 2YWKA 3NE6A 3SUOA 4DU7A 3OFEA 3SNNA 2C1EB 2OPQA 1Z1ZA 3EPGA 1X8DA 2CQHA 4NOHA 2F1FA 4O8KA 3ZZOA 4P2XA 2H51B 1X7VA 2YNFA 2VKZG 1WBDA 2PYLA 2HVEA 4WTOB 2VJUA 1XR6A 4H0PA 1FCAA 3O9UA 2HFUA 4ZN1A 1Q8IA 1CJUA 2QTWA 5DO2A 1T9UA 4G9ZA 1TELA 4QWEA 4J7CA 3VAHA 2LQ8A 1HHTP 3VVTA 1L5UA 4NLPA 1NO8A 3OR2B 5LSRA 1OY9A 3M1FA 1X4HA 4ECZA 3OVSA 4DL0C 3AJ1A 3VV2B 4ZCIA 3S9HA 1T95A 4C9DA 1C0FA 4LSLB 4MJKA 2Y1RI 4WKYA 2ABYA 1XMBA 3MM7B 1N34K 1YKWA 4HCCA 2EWHA 3F9KA 4DV1K 3VCDA 3R6MA 4BDPA 1C6VA 2PA8D 5HP1B 3DGPB 5KG5A 1QD1A 3PW5A 2Q66A 2DGUA 1KAZA 3GJTB 1KHVA 3VQTA 3IBWA 4CEOA 1RT2A 1N33F 2IJFA 2MKHA 3CDAA 4ZVEA 3RSEA 3OTCA 5ETLA 2DR9A 3THYB 1FDDA 2O4GA 4WK3A 5CYJA 5GINA 2OAUA 1C0UA 2DITA 4ZS6A 1EB0A 2EC0A 4P75A 4NYFA 4FF3A 4XIUA 3MUVP 1X4GA 2EKYA 1GTEA 1U6ZA 2RILA 4NMLA 3H2LA 4OZ1A 2YXLA 3TVYA 4E7KA 8AT1B 2YPZA 4PXEA 1PIEA 4AL6A 3G71N 3J7Z5 2FC9A 4A8KA 1P9QC 4H4OB 3FBEA 3D6MB 2LXFA 2QXFA 5AQFA 4DUYJ 1T03B 3R1XA 5KGWA 4HYKA 2HHTA 1JLFB 3AAWB 3QO9B 4R8UA 1RAJA 3MDQA 3ZXWA 3D9BA 2RUSA 5FRMA 3MUMP 2PC6A 4W4MA 2MKSA 1YWXA 2AIRB 1SC6A 4LF8F 2I7PA 2DPIA 2EG1A 2R2SA 2YNFB 2NZTA 4EMDA 4R0EA 5HVFA 4DLEA 3TAMB 3PCOB 4BGBA 2D1KA 1RHQB 3BO4A 3UDCA 1CJUB 3O5BA 3IWLA 4NI2A 3QT7A 2O8EA 4YOYA 2ZDOA 2CZ9A 2PDAA 3I56S 1JLEA 1FKPB 2D69A 2V6AA 3RZAA 2RRNA 3HT3A 3R1LA 3DXKA 5F8NA 1IN0A 3DLKA 4KHPK 1IH7A 3UD4P 3D6RA 1OQ6A 1Q8BA 2F8SA 3I6PA 1Z2LA 1IKVB 2OKQA 4JI8F 4FP9A 4M3UA 2OI2A 2V63A 3PY8A 1PBAA 1X4DA 1B7FA 4MLHA 3MEGA 4GV3A 1S59A 2DNKA 5M1PA 1RT2B 4LF7K 1OVYA 2BJ3A 1XK8A 5CD4H 1OO0B 1BC6A 5HMXA 1C0UB 3VAKA 1N48A 1XWLA 4ZIWA 3M8RA 2V9KA 1R8BA 3FGVA 1BA0A 1CJKB 1TL7B 2E5JA 4JI5J 2FSJA 4P7TA 4JBCA 3W5ZA 2BYCA 2JC1A 1QQNA 5KFLA 3AVMA 3NBPA 3RYLA 2MEWA 2N4CA 1NZ8A 1WWHA 2RT3A 4Y0FA 2V7ZA 4NYNA 4OYOA 5EDWA 1FO1A 2YVSA 2Z1GA 1LW0A 4E98A 4W5TA 2A41A 1ASWA 1SS6A 4OKEA 4CIEA 4O3OA 3FE1A 2DD8S 3UWTA 3FZHA 1SKSA 2HFSA 3EKSA 4DU3A 1YZ7A 2HOEA 1F2HA 2FF3B 5CYQA 4AHVA 2WTUA 4N41A 3SQ4A 1H98A 2YQ0A 3A5MC 1RBVA 5H9EJ 3K8WA 3W9JA 2YNGA 4RX6A 1YBAA 2KHDA 4IFYA 3PX6A 4BC3A 4UZBA 3CMQA 2VWJA 4PXDA 2IJRA 3P6YC 4BDYA 5AJ3J 1FJGJ 1J53A 4DCOB 2IM3A 3SCLE 3H98A 1VSHA 3MX2A 3CCTA 5KOXA 4BQZA 3CG7A 1CULB 1S7HA 3IR6B 2RNEA 3PRBA 2C2MB 4ZLJA 4CBWA 5A8WA 4YUDA 2RUGA 3TYTA 1NGFA 3KLFA 3ZTRA 5CABA 3IBCB 3MEGB 1NGEA 2E7VA 1HR0F 3OBIA 3CCUN 2F8TA 2QN6B 5M1QA 2HZAA 3K5MA 1ZBFA 1GT8A 2WOMB 1V3ZA 5HO4A 3VQDA 1VI7A 3NP5A 3AVNA 1IM4A 4H0OA 3PFOA 2QXLA 1NBEB 5F8JA 5CD4A 4M95A 4DTOA 3AT1B 2FJEB 4HCBA 4JB8B 3O6QA 2QL5B 2GZOA 2CH6A 5D0GA 2XMKA 4Z7YA 5L38A 1OIAA 2MQ8A 1P1TA 2DY1A 1LW0B 2B5JB 4E1MA 4MYTA 2EI5A 2R7WA 8RUCA 3EKUA 1KOOA 1LFPA 2ZVSA 2HS4A 4QYZK 3L6QA 2XGPA 5EOYA 1TL5A 2BXJA 4K4TA 2MZRA 3K17A 1HKAA 3IAYA 2CJAA 4Q5VA 4E1JA 1J27A 2P9CA 3V1QA 3FFIA 4DV7K 1WJ9A 2WSEC 2BW7A 2J8SA 4BC9A 1EKEA 2YI1A 4ZN3A 1JLBA 5KG2A 4FDFA 4ECQA 3RMAA 3A4TA 3MCNA 4IFYB 4WQ5C 4EBCA 1M5SA 1C1BA 2FZKB 3EDRB 4BRQA 2WHOA 4MK9A 2MQMA 3RB0A 4OMFG 2AD9A 3M9OB 3GJSB 2HWTA 4GO5X 5I3UA 3IMXA 1QVFR 4LFCJ 1FVQA 4K4SA 2V4JA 4WFYA 3TOQA 2UU9J 4F4AA 1Q4RA 4YHHJ 3J80Y 2C3MA 2ZQBA 4FN5A 4RNOA 1F3VA 2JDJA 2OPRA 4B02A 1S76D 4CFCA 1HQ2A 2DFEA 5AQUA 3KLFB 1DAXA 3LO3A 3MN9A 3L2UA 4DTPA 1N5QA 1W2IA 1TTHB 4URQU 1F6TA 4J9MA 2CWKA 2DO4A 1JJ2R 2WC9A 4DUYF 2VFRA 3BY5A 4ID5A 2YKNB 3PW7A 4Z4HA 3TU5A 4ED4A 3PACA 2UVRA 1EHWA 4E1NA 1KVBA 3DDIA 2QTDA 2F3JA 3CCSN 2W25A 1FJEB 5DG8A 1NU0A 4CBUA 2L41A 3QETA 5H9FK 1RHMB 1HPMA 5CCLA 3MEEA 2B4JA 5SUHA 3S8SA 2XMMA 3KHYA 4EIAA 2CJ9A 1RAGB 4PG8A 3GWCA 2ETJA 3BEXA 1KTVA 3TSPA 3OYBA 4YB6A 2J8AA 3W1YC 3OS2A 2LA4A 4J9OA 3NGIA 4DBQA 3O1WA 5LJVA 2KL8A 4J9SA 2C3OA 3FJ2A 2YHAA 3ZSVA 2BQ3A 3BSNA 3GQCA 3SQ0A 1ASVA 4PAAA 4HHUA 4E89A 4H0XB 4C3KA 3CC4S 3MZIA 1FRXA 1RAEB 1JXBA 3UR3C 2I6WA 3DOMB 4DV2K 2VJVA 3LGMA 4XH5A 2MQOA 1U45A 5ETMA 3BYRA 1CJVA 2G1HA 2GQQA 4X62F 4CJ4A 2BABA 4H5RA 1C1BB 4OJ1A 4TY8A 4ZPBA 4E7IA 4WJBA 1RT6A 4M5HA 4QYRA 3CIPA 4KFBA 5LL6Z 3J7YP 3ICLA 4CCHA 2YWWA 2LDYA 4X4QA 3ATVA 2Y1IA 4CJQA 3LH2S 5LT5A 2PBDA 2V4JB 2XI2A 3GPAA 2H48B 3A8EA 4C8ZA 2XGQA 3PYGA 4Z4EA 1REVA 4Q8FA 4FLVA 4ZMMA 3EE8A 2V5HG 5AXMA 3U9ZA 3FFKB 3MF5A 2HBYB 3FKBA 3GCWP 3QJLA 2OPRB 4JI5F 2BEFA 1RGIA 1RWNB 2QYCA 2VPXB 4HH1A 5IZHA 2MHNA 3RBDA 3DU6A 3POTA 2I5JA 3I5CA 2FVPA 2R8HA 4J90A 4B3SK 2BM0A 2H5JB 2I7NA 2HMPA 2AU0A 2D0CA 3ZZYA 3FCHA 2J0QD 4AXJA 1FJCA 2G2YA 3MCAB 1MN7A 4C97A 3EZ5A 3EZWA 2YHWA 5F8LA 3VQQA 3P38A 1OWXA 5JLHA 5L9NA 2GEMA 2PI5A 4YOWA 4M7YA 1LQ9A 1N32K 2N7YA 1YBTA 2FUG9 3NOCA 4DCPB 1RBOB 4IWVA 4RW8B 2XWXA 3MM5B 4EGLA 3DXBA 2WW4A 3V9XA 3B4MA 2CPDA 2MLZA 2PEBA 5AJ3F 1SL2A 4DV0K 5C25A 1FJGF 5B0BA 3OYIA 4I6MB 2HF4A 4DL6A 3VGUA 1RTZA 3CJSA 3MAAA 1VLYA 1MWMA 3AXMA 4DSLA 5F8IA 4CNZA 1KSPA 1DJ0A 2Z2ZA 1UJ5A 1UETA 1K73O 2ATQA 3G4SN 1CJVB 3CO0P 4J9VA 4BLGA 5B7WA 3CFRA 4CEBA 4LF6K 1DT9A 4RZRA 2J9CA 4BVPA 3QT5A 4TY8B 4FSVA 3A8IA 9ATCB 4ER8A 4FXWA 3V9WA 1TUYA 2EFNA 2OMOA 2BOAA 5LL6d 2IRUA 5GMEA 1U1NA 5B0CA 4ED0A 4M3WA 1REVB 5GIPA 3LP0A 3D0PA 1DLOB 3NWRA 5CAAA 2A6MA 4LBPA 3R3TA 1YK9A 2OJ3A 4KI6A 1C1AA 2DHAA 3BSOA 4BC4A 3POTB 5U47A 2ZVIA 2V8DA 2XCPA 4KRFA 4PEOA 3TWZA 1QUVA 2JEJA 3MEDB 2ASMA 2VA3A 4DV3K 3AQOA 2ZEJA 3NL0A 2L48A 1WF1A 5TKYA 3KDNA 1VQNS 3DLRA 2X6NA 4NWBA 3PM9A 1L3KA 4WYBA 1K8AT 1CXUA 4RW6A 1S10A 1EX8A 4BGAA 2FBYA 5AZIA 1QTMA 4F50A 1NPRA 4PG4A 2MXYA 2F4VK 2WVCA 2AP6A 1Y3JA 5JUMA 3KMSA 1H2UX 2YQ1A 4QU7A 2C2EA 3PSIA 2GIQA 2X1FA 5J2MB 1HNXJ 3ITHA 2B3TB 4XAKA 1RJJA 1PBUA 2WVEA 3GTYX 1ZAXA 2QM1A 3Q2SC 2ASJA 4LFCF 2I38A 2UU9F 1FJ7A 3MAAB 3R5CA 3KKFA 1MA9B 1WC0A 4ZJLA 1LWCA 5J2NA 1MMNA 3OTOK 2VFVA 2VDHA 4YHHF 2YWEA 4FYYB 4DFPA 3I96A 4PABA 3CJCA 3NGRA 2VU5A 3N5FA 1YX2A 3CVKA 5KG6A 3LUYA 5KFHA 2BMBA 2FHOB 1NNEA 5AE3A 4FCYA 2VH7A 1U2RA 2YPYA 1C1CB 2Z8QA 2W6KA 1RBSA 1KVKA 1O1WA 3CO9A 5HSPA 4QR2A 1B64A 1VSLA 1XNQJ 2V0NA 4YY3J 4I6YA 4OLPA 1FXDA 1X4CA 2EBEA 1S4EA 4LY7A 3CHWA 2KZZA 1NKCA 3MTJA 2HVDA 1GNKA 4NZ0A 2IVYA 4DQ8A 3HSZA 4J2DA 4F2SA 3LP0B 2A1BA 1QAYA 2AJ1A 2E29A 4CRJA 5D4OA 1JLQB 5KFQA 3P83D 3L4BC 1DKGD 1L3UA 1HNVA 3HHKA 3IDHA 1WOOA 5DQIA 3PUFA 3I32A 1LK7A 4FJ7A 3HVWA 5B0FA 4F7VA 4C6AA 2F7TA 5FPNA 2HMIB 4B9SA 2HHVA 4DN9A 4AD6A 5EXWA 3LWMA 2B4OA 4LBIA 3AAQA 1RTHA 3O9TA 4CO5A 3KHGA 1FE0A 4ZHRA 4PPDA 1JIHA 2QX0A 3VGTA 2M70A 2QWLA 4FM0A 1O8BA 3G8TA 4IRCA 4WYWA 3RGIA 4PL7A 3GE1A 4FZXC 3TUIC 3NMRA 4ZKAA 1FT8A 3AD7C 3G96A 3M9NB 4KSEB 3BH6B 1GK8A 4O0JA 2J6UA 2BA9A 4JK8A 3ZT4A 4HT7A 1Q5VA 1H38A 4NXNF 4F25A 1RADB 1G2EA 2GAGC 3MD1A 3ITHB 2YWFA 3KJFB 3NF9A 2JLEA 4I4BA 3KUEA 3NNCA 4C8MA 4LUBA 4USIA 3VEVA 4MK7A 2ROGA 1LWCB 2E2OA 3JQKA 4DHYA 5JMVA 3PYFA 2BKPA 4ZPCA 4CJPA 4A8OA 3CSKA 3QBXA 3T41A 4UZCA 3I8DA 4KREA 2QWMA 2YWGA 4E7JA 2P9UA 1U1RA 3PO4A 2VBXA 3FUYA 3T9ZA 1GLJO 2X74A 3JB9k 2NYHA 2HRUA 3OQ2A 4J5OA 4HACA 4X65K 1VSDA 3C95A 4QYZJ 1FEHA 4NASA 4W5OA 3PFEA 4MKBA 3AA5X 1FRJA 2MJNA 1IVZA 1T9VA 1HJRA 3MWTA 4YMEA 4F8RA 3KK1A 1EX4A 3QNNA 1QVGR 1RDRA 2R7QA 5KQDA 2JEGA 4DV7J 5LSLA 1HNVB 3M9MB 1HJOA 2NRXA 1RQ0A 4CESA 3GFZA 2M8HA 3WNEA 1HBMA 3HPHA 1QUPA