3M8QA

Hiv-1 rt with aminopyrimidine nnrti
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of piperidin-4-yl-aminopyrimidines as HIV-1 reverse transcriptase inhibitors. N-benzyl derivatives with broad potency against resistant mutant viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 151
structure length 554
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3m8qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8qA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3m8qA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3m8qA05
4EBCA 2BQUA 3L3UA 1UWBA 3ALYA 3PX4A 1RBRA 2R7YA 1EETA 3EZUA 4DF8A 3KJVA 2EC0A 4CE9A 3ZT3A 4TY8B 4OKJA 2HHUA 5J2NA 4CCHA 4KB0A 4TY9A 4AHRA 3KHLA 5KT4A 2ZD1A 1FKOB 4CECA 5KFGA 2IC3B 3JYTA 5KFNA 1ZTTA 4N76A 5I42B 1VSFA 4H4MB 4ZTFA 2KZZA 3OY9A 4ID5B 5C24A 1HMVB 3OSNA 1G15A 4KB1A 1CSJA 1CZ9A 3ZSWA 1S1XB 1JLFB 4DFMA 1KHVA 3IGNA 2E9ZA 4ECUA 5C5JA 4RW7A 5HBMB 3RB3A 4G1QB 1BQMA 4TXSA 4LH4A 4CK1A 3OS2A 1WSIA 2G8HA 3HPOA 4KO0A 1DLOA 3QGIA 1UWBB 2FLLA 2ZQBA 3CWJA 2C2RA 4RW6A 3O3GA 2OPQB 3RAQA 4YR3A 4W5NA 1C0UB 3AVLA 3OHAA 1KCFA 4CHQA 1NJYA 4FJXA 3KLFB 1JLGA 2HNDA 3HKWA 4KB7A 1LWCB 4Y1CA 4FBUA 4FLTA 1W9HA 3RTVA 1RDBA 4K8ZA 1RT3B 1JL2A 3AVBA 1KTQA 1NOYA 5KFYA 1NKEA 5DG8A 4B8CA 2YNFA 4W5TA 4WZQA 3AVNA 1MU2A 1EX4A 1XHZA 1SL0A 2B5JA 1IG9A 3H59A 3DLGA 2DFFA 1SKSA 3TR8A 4TYBA 4HTUA 4M3YA 3MEGB 1SKRA 2AU0A 3PJXA 4ZP9A 4M42A 1N4LA 4ZPDA 4J9NA 1WSGA 5J2MB 2C2EA 3QINA 3HL8A 4F4YA 4Z4FA 3DRSA 3MEDB 3QIPB 5J2PB 1LWEB 3S3NA 4DSLA 1JXEA 1RTDA 2GIQA 2HHWA 3TAFA 4QWDA 4DU1A 2Y1JA 2FJVA 2HHQA 4CJWA 2FVPA 4CGFA 4Q44A 3NAIA 3OYHA 5SWMA 4J9PA 1RDRA 4KKOB 4RNMA 3SNNA 4N47A 3VN5A 1T8EA 2HHVA 3QO9B 5KG4A 2EHGA 2A1SA 3AO5A 2FBYA 1HYZA 4CFBA 4B8AB 3SJJA 4NLOA 4KHRA 4DMNA 1T05A 1BQMB 2WONA 3EY1A 1VSEA 3RBDA 4CEEA 4FJNA 3CDEA 2IM2A 3BQ2A 1DTTA 4J2AA 4FJ5A 3SV3A 3NGYA 4JUZA 4IRCA 3K5MA 1TL1B 5HROA 3KHHA 1SV5B 4H8KA 3SFGA 1JKHB 2C22A 3V9XA 5J2QB 3OYBA 3PO4A 3OYKA 4JS5A 2IM1A 4KBIA 1S6PA 1U04A 4F2SA 5KFTA 2PYJA 1S9EA 1S1VB 4M94A 1JIHA 1BQNB 3K5OA 2R8IA 3SZ2A 2I5JB 3LP1B 1TL1A 3L2WA 1BI4B 4KKOA 4LY7A 1K1QA 3O3FA 3LDSA 4ED1A 4KV8A 2G8KA 4DQSA 3IRXA 4WE1A 3K58A 4ECQA 3TAGA 4NYNA 2XY5A 4CEDA 4AH9A 3UIQA 1N48A 3GIJA 4KHNA 4PQUB 1HJRA 3V4IA 2D3UA 1ASWA 4BE1A 3NCIA 4PY5A 4CJEA 3FFIA 3AA5X 2UVRA 3ZSXA 1NK4A 3DM2B 2HMIA 4DTSA 1S9GA 4DTMA 3QNOA 3HM9A 4CGDA 3DRPB 3UR0A 3PW5A 4F3TA 3KHGA 4CHZA 3QZ7A 1REVA 2ASLA 2WOMA 1EETB 1VK0A 2YNGA 3QLHB 4ED8A 3I0RB 2I5JA 3KOAA 2VWKA 4K4UA 2D0AA 5HRRA 3PV8A 1DLOB 3QGGA 4RG8A 1SUQB 3TI0A 1JLAB 4RNNA 5F8HA 3ICLA 5C25A 2D0CA 4JV1A 3RMCA 4G3IA 3U3GA 3VQ7A 4MIBA 2R8JA 4AHCA 1JLGB 3OL7A 4B9VA 4NCAA 4URGA 1L5UA 3Q8SB 4FJJA 2W42A 2D41A 3VQAA 4BDYA 4DSKA 4U7CA 3CO9A 1RBUA 4CIFA 1TVRA 4CF0A 1U47A 1L3UA 4RW6B 2ATLA 2OH2A 3NE6A 4O3PA 1CXUA 1HNVA 3AVHA 3RB0A 5KFXA 1S6PB 4CGHA 5DG7A 4FVMA 4CJTA 1U48A 1YVFA 2YKNA 3T1AA 1C0UA 3OYCA 3IG1A 3OYGA 5F8MA 4H4MA 4LQ9A 4DS4A 3VQPA 1KLMB 4KREA 3H5UA 1KHWA 4Y2CA 3A2FA 1RT3A 2RN2A 4GC6A 1HQEA 4FLUA 1RT2B 3HVTA 1X9MA 4IDKB 5JUMA 3VA0A 2OZMA 4HUGA 1C0TB 2Q3SA 2F8SA 1TV6B 3DLKB 3FQLA 2X78A 1SUQA 3DI6A 3DYAA 1HNVB 3NH2A 1TK0A 5JS2A 4ECTA 4FM1A 4K4ZA 4OKEA 3EYZA 2YKMB 3NHGA 3C6TB 4Q8FA 1RTDB 3V9ZA 4AHUA 3DOKB 2FC0A 1D8YA 1FKOA 3QIOA 3K5NA 3Q8PB 1QSSA 4K8XA 5KFPA 2IGIA 5C42A 1RT4B 3OS1A 5I3UA 4RZRA 1KVBA 3QEXA 1RNHA 1JL1A 4DL6A 3TAPA 1KVAA 2HNYA 4DU4A 4B3OA 1B9DA 1RT1B 1REVB 3HO1A 3ISNC 2YNGB 2D5RA 3M8PB 4FLXA 1RTHA 1J54A 4L8RB 1EP4B 3OYNA 1QTMA 4TN2A 1IKVA 2OYQA 4GMJB 4H54A 1LW2A 3AV9A 4ZVHA 1S1TB 2IAJB 3EZ5A 4ZHRB 4J9MA 3NL0A 2GIRA 3DRRA 4FJ7A 3FDSA 3U6FA 3THVA 4N5SA 5C42B 2YNHA 1RT5A 5HP1B 2IBKA 4EBEA 3MR2A 4O3RA 3G6YA 2QK9A 1NJXA 5JXSA 2BR0A 5KRTA 4FJIA 4OL8A 2AWZA 2QKKA 3S9HA 4Z4IA 2B4JA 1SL1A 3AO1A 5F9NA 1S1XA 4IFVA 3H2LA 3H5XA 1JLBA 3L2VA 1C2PA 4DTUA 4DL4A 4DTOA 3KK3B 3PJWA 1IKYB 4NLUA 2QXFA 2GC8A 1RA6A 4IKAA 3FFIB 3E01A 2VG7A 5EDWA 5J1EA 1HNIA 5HROB 3AO2A 4CHNA 4DFKA 1LV5A 4ZP8A 3KNAA 1JKHA 2HAIA 3ASMA 4FS1A 4DFPA 4DL5A 3F73A 4NCGA 3EPGA 3ZT0A 4E7HA 4IFYB 2OPRB 3NH0A 5SZTA 3CFOA 1RBTA 1BGXT 2GBZA 3M8RA 3G6VA 4O3OA 2ITGA 3M8SA 3HYFA 5DLGA 3ZSOA 3EPIA 2ZD1B 4ICLA 3NAHA 4NRUA 5KT7A 2G8VA 3TWHA 4C8LA 3AVMA 1JLEA 3QEIA 4IG3A 4DG1B 3PW7A 1CXQA 4JLHA 3V6JA 4ED3A 3M9MB 3AA2A 4ELTA 4CEZA 2B43A 2DPIA 1C1BB 2KW4A 1WLJA 2E9RX 4FLYA 4DQPA 4OPKA 3MXIA 5KTQA 4FXDA 3DRSB 1BISA 4LH5A 3QO9A 3VQ5A 4FK4A 5KFIA 1JLFA 5DQIA 3BQ0A 1XR7A 4J2BA 4KRFA 3HHKA 5HLFB 2R2TA 2XI2A 1RBSA 3N6NA 2VA3A 5CYMB 2R2SA 3WNEA 2B6AA 4DG1A 3GV5B 4KTWA 3RMDA 3IAYA 3PR5B 4KHQA 1S6QA 1YVUA 3SFUA 1A5VA 3RR8A 1W25A 3CJ2A 4KFBB 3D28A 4CF9A 3SCXA 4RW8A 3Q8RB 1JXBA 4CJLA 5KI6A 1NK8A 4EYHB 4E7LA 4CK2A 2FLPA 4E1NA 3OYIA 1K1SA 3BR9A 2E6MA 2ZE2B 3OYFA 3V1OA 4F4XA 3V81A 3HP6A 1DTQB 4PQUA 4RNFA 5KFLA 1KVCA 5J2QA 3DLEB 4URQU 1BI4A 3T3FA 3G10A 5DK5A 3OSPA 4XPEA 3PVXA 5KFZA 3MAQA 4F3OA 1U45A 2HW3A 1U49A 3BQ1A 1HNIB 2G8WA 1RTJA 5KFFA 3BDPA 3PO5A 2HNYB 1C6VA 2F8TA 3DOLA 4CJVA 3MECA 3BSCA 4ECWA 3G0ZA 3D5MA 3KIOA 5F8IA 2NUBA 2G8FA 2AX0A 2JEJA 1HRHA 3PX6A 2UVVA 1DTTB 3C6UB 3D0PA 4RU9A 4DLGA 4CIGA 3D45A 4RUCA 3LPTA 1FXXA 2HHXA 1XHXA 2OPPA 4Q5VA 1U4BA 4H4OB 2HHTA 3O3HA 1TKXA 5J2PA 5KGWA 4NLWA 2AX1A 4Y1DA 2WB4A 1SL2A 1ZBFA 5CYMA 2IJFA 4BE2A 4IOBA 3OJSA 2W9AA 5I3UB 2I1RA 1J53A 1XR6A 3HP9A 4OJRA 2OPPB 5HRNA 3PY8A 1S1WB 4ED0A 4NLRA 3I5CA 4WZMA 4KE5A 4HYKA 2ATQA 4ECRA 2R2UA 4B9SA 3L8BA 4WFXA 2FBTA 1T03A 1VSKA 2IOCA 1WAJA 3I0RA 4DQIA 4PWDB 1XC9A 1L3SA 1IO2A 5FROA 4F4KA 2BANB 2J6UA 3H4BA 3G86A 1QHTA 2DFEA 3ISND 4UQGA 4J9QA 1MU2B 2IS3A 3SQ2A 4IG3B 4PA1A 2Z1GA 2P5OA 1WSFA 4NYFA 3TARA 1FK9A 5EWGA 4IRDA 4MIAA 2R8KA 3V4IB 1RTIA 3LAMA 3ULDA 5K14A 5DG9A 1NJWA 1JLQA 2IC3A 4KO0B 4R5PB 4J9LA 3VQBA 1SKWA 3P83D 4YP3A 1NHVA 3GYNA 5DLFA 1F21A 3NGDA 2JC1A 2WCXA 4I2QA 4O0IA 3V9UA 4CF8A 1HQEB 3OJUA 3MR6A 2FVCA 4O3NA 4GW6A 1JLCA 3SI8A 4MH8A 3LZJA 3KMSA 4KHYA 4Q0BB 3I0SB 4NLSA 2P1JA 1K6YA 1KLMA 1N6QB 3CG7A 4W5QA 5L1KA 3E51A 3DDKA 3NMAA 1YTAA 1KRPA 1YT3A 1S0MA 4I2PA 4IG0B 4FK2A 2XO7A 3WNGA 4FZZA 2DY4A 5C24B 3KKSA 1GX5A 4K4VA 1X9SA 1R0AA 5HP1A 4NLTA 2ASJA 4CJ5A 3V6DB 3C94A 4NZ0A 3BGRB 5KG6A 4FLZA 3KK1B 3BREA 2WHOA 3DM2A 2HMIB 1I6JA 1D1UA 3ZSYA 4B9LA 1LAVA 1TAUA 4FJLA 2ILZA 4M41A 2VG6A 5I42A 4KI6A 1WSEA 1TL3A 4QCLA 4W5OA 3V1QA 4J2EA 4ZVGA 2QV6A 2BDPA 3MTKA 5CYQA 4PUOA 1N5YA 4ECZA 3OYEA 3VA3A 5T14A 4EO6A 1J9AA 2YNHB 2BANA 3MEGA 4BDPA 4MK8A 3KLEB 1RDAA 3AVCA 2BGGA 4M45A 4IR1A 5KFVA 3LP3A 3GIMA 1RT6B 1VRUA 4ZTJA 3CJ5A 4ZVFA 4J9RA 2XY8A 3NF6A 4KAZA 2W9CA 1C1AA 1HPZA 4O5BA 1IKXA 2HHSA 2B5JB 1NK7A 2HNZA 4DLEA 4Z4GA 3Q8QB 4EZ9A 5T7BA 2HWIA 3ZT2A 1VRUB 1S49A 3PW0A 1B9FA 4CJ4A 4IH6A 3I0SA 1MMLA 4PUOB 4E3SA 3OL9A 2YKMA 1GX6A 4U6PA 2HVHA 3SQ4A 5D3GB 4CJKA 2V4RA 4Q45A 4CJFA 2G8IA 5EWFA 4LSNB 1TKXB 5KRSA 4NYZA 3V1RA 3RRGA 5J2NB 3JSMA 1ZBIA 1NKCA 1C0TA 4FLVA 2FJWA 1RT4A 4DTPA 4MKBA 5KFAA 5L1LA 2XC9A 2XRIA 3KLIB 4KAIA 3OYJA 4HHTA 3KLVA 4HVJA 3TAQA 4LSLA 4CFCA 1RBVA 1ITGA 3LP0B 4ZPBA 5E41A 4CF1A 3HJFA 3VQCA 1WAFA 1L3TA 1BIUA 3OYDA 4IQXA 1TKDA 3IS9B 1LW2B 3IN5A 3DLKA 4DU3A 3KLEA 5KFWA 1VSHA 4FJ8A 2IJNA 2YNIA 3RWUA 3AVIA 1UOCA 4FM2A 1HQUA 5HRPA 1GOAA 4KSEB 2X6NA 4DTXA 1T7PA 1NHUA 2BE2B 3V9WA 2J6TA 4M3TA 3PW2A 4FM0A 5KFUA 3LWMA 4FLWA 3AVKA 3V6KA 4IFVB 4ECYA 4CJPA 1RTIB 2RF2A 4DTRA 4CJQA 2GUIA 1NJZA 5DQGA 1C0MA 2IDOA 5KG0A 3I8DA 4KHUA 3RRHA 1QSLA 3OL6A 4GVMA 3SQ0A 2BQ3A 1RAJA 4HKQA 5D3GA 5CYQB 4CFDA 1WN7A 4URSA 3MFHA 1Z26A 4OGCA 5KFJA 2XWYA 3DLBA 3KMQA 2W8LA 3NF9A 4M3UA 3KLIA 1ZYQA 5JS1A 4CJRA 4EBDA 4FZXC 3CVKA 5KFRA 1TQLA 4DWIA 2KQ2A 3HXMA 4CEBA 4DS5A 3H40A 1NK0A 2D3ZA 3M9OB 4FJKA 2XCAA 4J9OA 2FVRA 1VSLA 4NLQA 4EEYA 2IMWP 4Q0BA 4I9QA 1VRTB 1TVRB 1JLEB 3ZSZA 2DFHA 5FRMA 2X74A 1RT7B 4LSLB 3NF8A 1J5OB 2YHAA 3S3MA 3H4DA 1WNSA 4K50A 1X9WA 2AQ4A 4E7IA 4C8KA 4KV8B 3N6LA 3QZ8A 1HMVA 1Q8IA 1ZBLA 4M3ZA 5F9LA 3RMBA 4JS4A 1D9DA 3T5HA 1XWLA 3HPGA 3LAKA 4HCBA 2X6SA 4CEFA 1EKEA 3SI6A 2Z1JA 3AA4A 4Z4HA 2W9BA 2JEIA 4C8OA 1Z4UA 1IH7A 2OA8A 1S48A 4FW2A 3HVTB 4WYWA 3L3VA 4O55A 1S1UA 3HVAA 4KTZA 2D7SA 3CM6A 2R8GA 3IS9A 3VQ8A 3OYMA 1WNEA 3V6HA 4K4XA 1S9FA 1SH2A 5KG2A 4Y34A 4RUAA 2F96A 1S0NA 2ZE2A 4NLYA 3ZSQA 1JLBB 5L1IA 3F9KA 1TKZA 3M8QB 3LZIA 1RILA 3KJVB 4LD0A 3I5AA 1A5XA 4R0EA 2UUWA 3MEEB 5KFBA 1QAIA 4DQRA 3NGZA 3AVGA 2AGOA 4ZVEA 2ALZA 4HUFA 2EX3A 1VRTA 4CHPA 2VG5A 5F8LA 3RR7A 3QIPA 3QGHA 5KFHA 3FRZA 3DI6B 1IKWB 3DYAB 1L3VA 5CZ1A 3CQ8A 1CLQA 3QETA 4I9LA 2HVIA 1XR5A 4CEAA 4IH7A 4FJHA 4JRQA 3PX0A 2RKIB 1RT7A 4QW9A 4MKAA 2ZKUA 5KFQA 4TLRA 5KT3A 1S6QB 1Q9YA 2LSNA 4CK3A 2ASDA 2KZMA 4F4WA 2JEFA 2W8KA 4ZHRA 3LP2B 1TK5A 4X2BA 4DL2A 1KFDA 3QERA 1Q9XA 5CY4A 1TKTA 1FK9B 4K4TA 5KG7A 4DSFA 4FW1A 3P1GA 3LPUA 1ASUA 2VA2A 2IM3A 4ID1A 2FLNA 5C25B 3AVFA 4OKKA 2DTUA 4DSEA 1J5OA 2XHBA 1DTQA 1FKPB 4O44A 4XO0A 3TQ1A 4IBNA 4B3OB 1TAQA 1TK8A 2PYLA 4CEQA 1WSJA 3WNFA 4EYIB 5EUHA 1S97A 2RF2B 2XGQA 2YHBA 1SV5A 1C1CB 3OL8A 1LWFA 3SUQA 3T5LA 1GOBA 4MK7A 4I7FB 4DL7A 1HARA 4QWCA 2OPSA 4YR0A 3LALA 2CJQA 3N6MA 3E01B 4NLXA 4ICLB 3BSNA 4OLAA 3TANA 4NRTA 1LWFB 3SYZA 3AO3A 3KK1A 2FVSA 3DMJA 4BWMA 3SPZA 2VWJA 2CKWA 1D9FA 3BSOA 1RA7A 4FK0A 4KHSA 3MR3A 3UQSA 4HCCA 4CGGA 4O3SA 3ZT4A 1LAWA 3JSMB 4IRKA 3P5JA 3L2RA 1TKZB 3HPHA 3KK3A 1JLQB 1KLNA 4DTJA 3KLGA 3KD1E 4WXOA 4LQ3A 4K4WA 1HYVA 4I7FA 1ZBUA 3IRXB 4WE1B 2JGUA 4QAGA 3GILA 1ASVA 4BE0A 4LSNA 2BRLA 3MEEA 1ZTWA 3GIIA 4CEOA 3SUNA 2HNZB 1TKTB 4E89A 2F8EX 1OS5A 1IKWA 4CESA 5L9XA 4EZ6A 4QWBA 3C95A 2E4LA 4AHVA 1S9EB 4O4RA 4OLBA 2RPIA 3RBEA 2UVWA 4H4OA 1NK5A 3M9NB 3HSTB 1WSHA 2IM0A 1IKVB 3PUFA 2UUTA 4K4SA 4MQ3A 1NNDA 3GIKA 4OVLA 4WFZA 1Z25A 1CZBA 2YNIB 3OYLA 4YR2A 1VSMA 1A5WA 3QEWA 3MF5A 1TP7A 3VQQA 2G8UA 4R8UA 1LW0A 5KT5A 1JLAA 3V9SA 3MR5A 1NOZA 4F4ZA 4NLGA 2PZSA 3UPFA 4MFBA 1TGOA 4TYAA 4NCBA 5J2MA 4YMEA 3ZSVA 4FJGA 4IH5A 1GOCA 3LWLA 4RW9B 1R0AB 4IDKA 3NGIA 4CHYA 3C6UA 4KFBA 1ZBHA 4BWJA 3CYMA 1BQNA 2AGQA 1W0HA 4IR9A 1NKBA 3HVRA 1BCMA 3LANA 1RT6A 3TABA 4OPJA 3GV8B 2J6SA 5F8JA 1S5JA 2HB5A 4QPXA 3VQ4A 3BSAA 4Q8EA 2QE5A 3GQCA 3KHRA 2XY6A 3BGRA 3CDUA 4JV0A 3NH1A 2YKNB 4ECSA 3IG1B 3K2PA 2V4QA 2ILYA 2XCPA 4ELVA 1T94A 1N56A 4NLPA 2E9TA 4YNQA 4CERA 3RB6A 4RW4A 3AVAA 1QE1A 3CFRA 1JX4A 3C6TA 2OPSB 3G6XA 1T03B 2KFZA 1HYSA 4NLVA 5DGAA 3KKRA 4C8MA 4CHOA 4E19A 4ED6A 1QS4A 1UAXA 4ED2A 4O4GB 5KFDA 3T5KA 4RW8B 1S0OA 5DGBA 2JLEA 4QWEA 1HQUB 4OGEA 1BHLA 3BJYA 4XPCA 3GV7B 4TQRA 1BIZA 4FBTA 3NBPA 2W9BB 3K57A 2XGPA 4O44B 4B9MA 4Z4EA 3FSIA 1LWEA 1HPZB 3HT3A 5KGXA 4JV2A 4PWDA 4F8RA 4E7KA 2KTQA 2AJQA 4QOZB 1YTUA 3QEVA 1IM4A 3VQ9A 4E0DA 4ZMMA 4FJMA 1S1WA 2UVUA 3DMJB 1RCHA 4EP5A 4CGIA 4CF2A 2R2RA 3AA3A 2P51A 4AILC 3DLHA 4DSJA 2C28A 1VSIA 3DOLB 3CJ3A 4FYDA 2XY7A 1QAJA 4N56A 1EXQA 3CFPA 4E7JA 3SQ1A 5K14B 3PW4A 4ZPCA 2W7OA 2OZSA 3CJ4A 4J9SA 2V9WA 5HBMA 2B6AB 3CM5A 5KT2A 4BDZA 5DMRA 1RDDA 3K59A 3NBPB 4M95A 4B08A 3L2UA 2RDIA 4K4YA 1NK9A 3ZSRA 5EWEA 1ZETA 3LP1A 2JC0A 3DRRB 3CDWA 1HYSB 5J1EB 4N41A 4MK9A 4R5PA 2FJXA 3UDLA 4YQWA 4AHSA 1TV6A 2XI3A 1QE1B 2BE2A 3JYTB 2O5DA 2DPJA 4ZP6A 1VSDA 4NCGB 3H98A 5EU7A 5KFSA 4I2PB 5DQHA 3CIZA 4GC7A 4FS2A 3O4NA 4RW9A 3KD5E 1S1UB 5KG3A 3SV4A 1SH0A 3ITHA 5L1JA 2FBXA 3MXJA 3OLBA 4KHWA 1T3NA 2ETJA 1T05B 3NF7A 4NLDA 1XI1A 4CJSA 2VG5B 4O0JA 3RB4A 1BCOA 1RTJB 4WFYA 3NKYA 3OLAA 3L2QA 2P5GA 3PZPA 3OHBA 4QW8A 4JRPA 3QEPA 3ITHB 3IGVA 4Q43A 4FZYA 2JEGA 2OPRA 4IFYA 2WK4A 1IKXB 3QYYA 4DFJA 4IG0A 4J2DA 3QIDA 1B92A 1QQCA 1RT1A 2RDJA 4B9TA 4CIEA 2KFNA 1TL3B 3KLHB 4MFBB 3CJ0A 2AGPA 4R8UB 1RYSA 3O4QA 5HLFA 3KK2A 4KPYA 4ECXA 3B6OA 4I2QB 4TY8A 4O4GA 2Z1HA 5CZ2A 4Z0UA 1N5YB 4B9UA 2R8HA 1RYRA 1I39A 2IA6A 3NAEA 4B9NA 3SPYA 3SUOA 2VG6B 4DL3A 3RAXA 4WXWA 5KT6A 3T5JA 2PY5A 4FCYA 2GV9A 3H5YA 2FBVA 5FDLA 3TAMB 4CGJA 2O4GA 2O4IA 2C2DA 4QWAA 3B6PA 4KTQA 3V6DA 2HNDB 5KFEA 3QESA 4CJUA 4CJ3A 3PHEA 2W7PA 3T19A 3HVWA 1BL3A 1I3AA 1RT2A 3OYAA 3DLRA 2OPQA 4RW4B 5F8NA 3KTQA 5F8GA 4F2RA 3S3OA 4DQQA 3KLFA 2BRKA 1RDCA 4FJ9A 4RW7B 1O1WA 3K5LA 1LWCA 5HRSA 4DTNA 3U3YA 3VQ6A 3OS0A 3FQKA 3MECB 1UA0A 4ID5A 1N6QA 4M3XA 1NK6A 4ZPAA 1QSYA 4YFUA 3MFIA 1JXLA 1FKPA 1S4FA 4M3WA 3V81B 3I5BA 2HWHA 3VQDA 3LP0A 3H5SA 1S10A 2QKBA 3H08A 3MXMA 3OVNA 2WOMB 4ELUA 3DLEA 3TVKA 4C8NA 1SH3A 4HUEA 2RKIA 3WNHA 4AHTA 2WRMA 4BACA 2VG7B 3HK2A 3RMAA 3KK2B 4KI4A 4W5RA 1D0EA 3ZT1A 5KFCA 2YV0X 2YNFB 4EP4A 1KFSA 3TAEA 1S1TA 2IAJA 1QUVA 2Z1IA 2D0BA 4EO8A 2A1RA 4ECVA 3ZCMA 4RNOA 3PR4A 1D5AA 1EP4A 3NFAA 3QNNA 1RTHB 3AVJA 2FVQA 1C1CA 4CFAA 1S9GB 5FDLB 3TAMA 3VQEA 4ED7A 3M8QA 3LP2A 4M3RA 4TSXA 3DRPA 3MEDA 4ZP7A 5KG1A 2WONB 5KFOA 3DLGB 1VSJA 3NDKA 4IKFA 1RT5B 3VQSA 2BQRA 1IKYA 3QLHA 2V0NA 4KHMA 4DEZA 1KSPA 3KLHA 2Y1IA 4RNHA 5KFMA 4G1QA 5FRNA 3M8PA 2WTFA 1Y97A 4Z4CA 3AO4A 4F50A 3SUPA 5KG5A 4XIUA 4WYLA 2W9CB 4E1MA 4DF4A 4Y3CA 4O3QA 1U09A 1UA1A 3DOKA 1S1VA 2E6LA 4Y2AA 4TQSA 1C1BA 4J9KA 1JLCB 5KFKA 3KLGB 1X1PA 4DSIA 1LW0B
chains in the Genus database with same CATH superfamily
2OIHA 2BQUA 1BE4A 5AQGA 5SUHA 4ISFA 3PX4A 2EVZA 2R7YA 3SCLE 4FWPA 1YJNN 5CD4A 2A0FB 2VPWB 2R7QA 3KJVA 4K59A 3ZT3A 1UJ4A 4H0OA 4JAXA 1HWIA 2M8HA 5KT4A 1QVFR 1FKOB 4CECA 5KFGA 2IC3B 4HR2A 3FZHA 1MROA 4N76A 2AJ0A 3TSQA 1WHWA 4ENOA 1Q8BA 3CC7N 2F40A 1QVGM 2ZM6J 3ENBA 3OY9A 4USWA 4FSVA 1HMVB 2O66A 4MT1A 4KB1A 3ZSWA 1JLFB 4DFMA 1KHVA 2V51B 3DLLQ 3GR1A 3MPVA 2VONA 4G1QB 4LH4A 4CK1A 4DR3F 1S72N 4PXEA 2G13A 1HQ2A 1WC6A 3CWJA 2C2RA 2OPQB 5ELZA 1X5PA 5AQYA 3AVLA 1HWKA 2DNRA 1KQSM 3RGIA 2PT0A 1M5PC 1KTVA 4K0KF 1W9HA 1SB6A 1HL6A 2GGPA 2DRBA 1NOYA 2MXYA 1YJ9N 3MM7A 1NKEA 1TMJA 3UKUA 2OEKA 2ZH2A 4WZQA 5ETTA 2XQCA 4OI3A 3L4QA 3DLGA 1SKSA 2VWBA 4M3YA 4V19S 3MEGB 2QM1A 3GSIA 2AU0A 1N4LA 4ZPDA 4J9NA 1RDUA 2FZCB 4LF6F 1WSGA 3UD5A 5J2MB 2C2EA 4JK7A 4F4YA 4Z4FA 1NSAA 3DNCA 3QIPB 3O1BA 1AZSA 1Q1KA 3G4SN 1AUSL 1TL4A 1RTDA 1FDAA 2W6KA 1GLBG 2DXFA 2BJ8A 4M5LA 2V8VA 4CJWA 3QBXA 2FVPA 4CGFA 1SQFA 4OZ5A 2P9CA 2SXLA 1VK8A 2G0JA 1RLCL 4LF9K 3H7HB 3POTA 3KZBA 3D2EB 3TTFA 3N0VA 4MYUA 5KG4A 1QAXA 1WEZA 4DR1F 3SJJA 1UEKA 4ILMA 4DMNA 1BQMB 3VAIA 2WONA 3EY1A 3G87A 4CP5A 1VSEA 2OD6A 3BQ2A 4BRAA 4FJ5A 4FNIA 1F9FA 2FF6A 4M7YA 4A8FA 4IRCA 2CPDA 3G6ES 5A8WB 3EZWA 1XJWB 3SFGA 2RB7A 4ZVRB 1JKHB 3V9XA 5J2QB 1TUYA 3OYKA 4KBIA 2EWSA 3W5ZA 2ZH3A 2RQMA 2H5IB 3ULHA 3HHNB 2ACYA 1GAOA 5BRHA 1BI4B 5EOYA 2RHQB 4Y65A 4LVOP 4ED1A 4JI7K 3PLAA 4KV8A 1OH5A 4ZPTR 1XMOF 3TAGA 4CEDA 1Q78A 4KHNA 1HJRA 3DDIA 3CD0A 2LA6A 4CM0A 2DNKA 1ASWA 3JXOA 4CJEA 1RWOB 3FZKA 3FFIA 4CD3A 3DM2B 2HMIA 4DTSA 1S9GA 3TVYA 3QNOA 4OZJA 3TTCA 4CHZA 2D3OR 1EETB 1VK0A 2NRTA 4PKGA 1WELA 3KOAA 4LF5J 4DR1K 1E6VA 3EGVA 5HRRA 4A8MP 1DLOB 1SUQB 3TI0A 4G1PA 2YH1A 4JV1A 1X4FA 2CQDA 4MIBA 4NCAA 3Q8SB 2PMZD 2HG4A 4DSKA 3MD3A 4DV5J 2VJUA 4CIFA 1XMQJ 1NMEB 1W26A 3FZFA 1F1BB 2W2PP 2OH2A 3CCMS 3L4IA 1WB9A 5CQGA 1CXUA 1HNVA 1JCEA 4HTIA 3RB0A 1IBMF 5DG7A 3ZXWA 1HBMA 4BQLA 3DC2A 1U48A 1C0UA 3W9JA 1FD2A 1VQ7S 3IG1A 1ZM4A 3OYGA 1WC0A 3TU5A 3AA9A 2XNRA 8RUCA 4DS4A 2YQ1A 4LF8J 1TYQA 2UUAJ 2MQOA 1Q53A 1KLMB 4KQZA 5E26A 3SJHA 1AYEA 4FLUA 1OIAA 2QMWA 3JTOA 2M8DB 1X3NA 2AHOB 4IDKB 1X4BA 3FBFA 5JUMA 3VA0A 4DHYA 2E1ZA 1TV6B 3FQLA 4KYZA 8AT1B 3IWLA 4YY3F 3FZMA 2ZZNA 2COLA 3NH2A 1HNVB 4Y00A 4FM1A 1XNQF 2MHNA 3EYZA 1IR1A 4Q8FA 2D1CA 2HKEA 3QIOA 3EGNA 4LFAK 2J0XA 1GMUA 5KFPA 5C2GA 4DR2J 1OH7A 2QGFB 3HHDA 3SCKE 1FXRA 4DR6F 3IUCA 2ZBPA 3QEXA 2GO9A 1RNHA 3MM5B 2R7WA 3A5LC 1MWKA 3RYLA 3UKRB 1KVAA 2VF3A 3CPWR 1VQ7N 2OTLS 1HKGA 1SPBP 1YJTA 2ZNZA 1RT1B 5BPLA 2F4VF 1REVB 1RHQB 1SAZA 5K20B 4ZN3A 3CCMN 3UCUP 1RTHA 4DR7J 4HACB 3OYNA 4TN2A 3EGWB 4HL9A 1IKVA 4H54A 2DISA 3AV9A 4JV5K 2IAJB 1NWKA 1W97L 2GIRA 4FJ7A 1FJGF 4WFBL 3DRXA 4N5SA 4C7QA 1RT5A 3HRGA 3G6YA 1J5EJ 2XLKA 4IEIA 2AWZA 5A8KB 4OLOA 2MEWA 3TX0A 5F9NA 1S1XA 2KL8A 1WC3A 2RVJA 3KVGA 3GB0A 3L2VA 4FPRA 4WJBA 4DL4A 1HBNB 1T9YA 4M1KA 1IWAA 2GC8A 1RA6A 3BB5A 3FFIB 2CA9A 5M1PA 2UXBJ 3AOCA 1U7LA 4CHNA 3AO2A 2WC9A 4M5NA 1JKHA 4FS1A 3F73A 4NCGA 3QRQA 4E7HA 1RXOB 1H38A 4IFYB 3NH0A 4JI3K 3M8RA 4O3OA 3CPWM 2ITGA 4X62F 4LF4K 3EPIA 2ZD1B 3KYLA 4IO9L 3NAHA 1MWMA 5LL6d 5K8NA 4DV7K 2EK6A 2D0PA 2DNHA 5LMUF 3NMUA 1QZ5A 4HDHA 2OLWA 4ZLLA 1FEEA 1CULB 4NYPA 1ESVA 4LFCJ 1U6ZA 4JV5F 2DB1A 2JRSA 2DPIA 2IIRA 1C1BB 3VGVA 2H65B 1SJ3P 4DX6A 3ENVA 3O3LA 1SJ4P 4LH5A 3W62A 5CE3A 3OTBA 1X5TA 5LJWA 4LR7A 1NDLA 1DRZA 1MMDA 3WT0A 2D9OA 1XR7A 4X65F 1BUPA 2XI2A 4BRFA 4A48A 5CYMB 2R2SA 4L72B 4LF9F 3WNEA 2B6AA 1CEZA 3GIRA 4KTWA 3OPKA 4UQTA 4FKXA 5FPEA 1YVUA 3RR8A 2OMOA 3U02A 1KAXA 2WBRA 4KFBB 3SCXA 1T9TA 3R5GA 2QFJA 5M1OA 5IV3A 4E7LA 1TFWA 4CK2A 1K1SA 2FZGB 2E6MA 3OYFA 4EGLA 4DPXA 4HTLA 4F4XA 3EWGA 2QA4G 1URRA 3KNGA 2JNJA 3UI3A 2I9SA 2HQDA 3A12A 4YDDB 5A6WA 2C3OA 3UO0A 2E1AA 2QX0A 4HLBA 3T3FA 3GPAA 3L6QA 2HRYA 3OSPA 5DK5A 1BWVA 3L09A 3SQGA 4J8FA 1ZAWA 4F3OA 2NRXA 3TJ8A 1HNIB 3MCOA 4QIWD 1C6VA 2P9NB 3DOLA 4USMA 3MECA 1V3SA 1HI1A 4NI2A 1OMSA 3GBTA 1F5CA 2RQKA 2FHOB 1K8KA 1J2VA 4RU9A 3EE9A 4DLGA 3X1LB 3D45A 3LPTA 3ISZA 2E1RA 3MN9A 1JWWA 3J80U 1TKXA 1O5JA 4Y1DA 4M7XA 3ILOA 4IUFA 2VQEF 1SL2A 5ITHA 3WXJA 4ZJLA 4BE2A 1X0FA 4IOBA 1HNZJ 2R7RA 2W9AA 5I3UB 4P75A 1FRJA 5HRNA 1S1WB 1WD6A 4ZVPB 4EFHA 3IBCB 4UOGA 4ANDA 4ECRA 1TFYA 4B9SA 4BGAA 3O44A 4BG8A 2IDLA 2IOCA 1WAJA 5D15A 4UOFA 3P4UB 4DQIA 3EMTA 1L3SA 3RBZA 3GJQB 2NXEA 4F4KA 1PAUB 2BANB 4USIA 4USVA 5GMEA 3H4BA 1S0VA 2BZ2A 1JJCB 4L6V3 2IS3A 4IG3B 4PA1A 2P5OA 3R8YA 4X65J 3CJCA 3TP2A 4IRDA 2RT3A 3V4IB 5JICA 3LAMA 3ULDA 2XYGB 2VGMA 5DG9A 1NJWA 1JLQA 4R5PB 1HA1A 4J9LA 3CETA 5AQFA 3VQBA 1SKWA 4WFNL 5C12A 4F04B 3P83D 4YP3A 2WVBA 1CULA 2AP6A 5DLFA 2CJAA 2QTWA 3NGDA 2JC1A 2WCXA 4O0IA 5H1SV 4FOIA 2E7XA 5CD4H 4UTGA 2FVCA 4N77A 2Z2YB 3O08A 3TRGA 1VQ9S 3FCVA 2O8FA 3PYGA 2P1JA 5C10A 4YOWA 1GMWA 4W5QA 3DDKA 3KJQB 4XAKA 2FUG9 1F2HA 1S0MA 1NZ8A 1BOTO 3QT8A 2XO7A 3WNGA 4FZZA 4U7UK 5M1KA 3ZZ0A 1SIWB 4LRAA 1YJWS 2RQCA 4TU7A 3PNIA 2K3KA 1FI4A 4CJ5A 3V6DB 3VERA 4NZ0A 1FRLA 3I87A 5KG6A 3ZSYA 4OX9J 1VQOS 1LAVA 1TAUA 2ILZA 1DY3A 5I42A 1WSEA 1TL3A 2XULA 2E8AA 2P9KB 4J2EA 4GNIA 1CG2A 4ILHA 4F7VA 1NPRA 1N5YA 2P9UA 1SQGA 2G1DA 4DR1J 1KR4A 4DN0A 3VF2A 4ZCIA 4BRQA 3MEGA 4CZLA 3CCES 5HJYA 3J81O 4MK8A 3KLEB 3UN5A 2BGGA 4D3HA 3T1HJ 3LP3A 2CYYA 1RJJA 1VRUA 3CJ5A 4KGMA 4V19J 5LOQA 2AF6A 5GAHU 1C1AA 4BC9A 1WSVA 2XYHB 3P31A 7FD1A 3ENHA 4DLEA 2MY8A 4KH0B 3ZC4A 5T7BA 2J7WA 4GY2B 1FNXH 3GG4A 2CG8A 2R7UA 1S49A 2FGCA 1RAIB 1QD1A 2QWOA 2HVHA 3SQ4A 3OFFA 2V4RA 1EO1A 1RACB 4CLYA 1CS4A 2BOPA 5EVZA 2V68A 4WTYA 3V1RA 2QL9B 4UUXA 4E8UA 3C8YA 1ZBIA 1NKCA 1C0TA 2ASOA 4CZHA 2BJ9A 1FDNA 4DTPA 2CPEA 3I8BA 4FP9A 3RBXA 2CGLA 4HHTA 2V2QA 1HLUA 5CR4A 3KLVA 5C2FA 4LSLA 1HBOA 3LP0B 4ZPBA 1YHQS 4JKGB 4CF1A 3VQCA 1N88A 1LW2B 3IN5A 4MDBA 4DU3A 3KLEA 1VSHA 2ADBA 2HBKA 2IJNA 5HVGA 1B7FA 4FM2A 4RWWA 1GOAA 4KSEB 2HS4A 3FBCA 2J6TA 4LF2A 2GCFA 1U0SA 4FLWA 5IT9O 1CJTB 2MQMA 2LMIA 3C14B 2CZVC 3EVOA 3V6KA 4U96A 4DCOB 1SC1B 4L3KA 2JLGA 3BF4A 1GFWB 1PJ5A 2ZGZA 5KG0A 3RRHA 1RAFB 4GVMA 4LRFA 3SQ0A 2BW2A 1OVYA 4DV6K 1PJ6A 1WN7A 2GUPA 3AJ2A 4URSA 3MFHA 3GYXB 4C3LA 1UETA 4LFAF 3KMQA 2W8LA 3A8YA 3OR2B 3HBTA 3OXLA 3CC2S 1VDHA 5A8KA 1ZYQA 4DV6J 2WVCA 3HLUA 4EBDA 1VQON 1TQLA 4DWIA 2RRBA 3H40A 4I6MB 2ZOGA 4YY3K 3UN2A 4FJKA 2XCAA 3CJSA 1RHJB 3LGHA 2EK1A 2FHMA 3M2RA 2DY1A 3GJRB 1TVRB 1JLEB 4JKCA 1Y5IB 2LQJA 4BVOA 4UW2A 3M2UA 4AL5A 1J5OB 3WC2A 4E7IA 4C8KA 3N6LA 2E2OA 3R3LA 3QZ8A 5C2CA 4JOUA 2X1GA 1DQAA 2WAQD 2CG4A 3MMAA 3RMBA 4DR4F 4JS4A 2LU2A 1D9DA 3K5PA 2VASA 2JSXA 1LFPA 4YEAA 3TUJC 4DR3K 5FPMA 1EKEA 3SI6A 5F3TA 2FSNA 4IYQA 1WOQA 1F6TA 3GP9A 4C8OA 4UT4A 4BRDA 4FW2A 4WYWA 2PDAA 2ZDOA 5EHHA 3B6BA 3NY0A 4G6VB 1WNEA 3JSYA 5IT9Y 3V6HA 1WF2A 1S9FA 2MZQA 4DR7F 2XMTA 5KG2A 3EE8A 1S0NA 1YJNS 4G1IA 2P9NA 5L1IA 1TKZA 2VOOA 3TZXA 1GQEA 1RILA 1YTYA 2D69A 1GNKA 2UUWA 2Y1RI 3CDAA 3H1VX 3FNNA 3CF5L 4DQRA 5DDOC 5KQ8A 2AGOA 2BVZA 2Q6CA 3VTHA 5D4PA 1YJRA 3QGHA 3FRZA 2VDIA 2KT5A 4YDUA 4ED4A 1VQ4S 4YDXA 4CEAA 1JJHA 4DZ6A 2EC2A 2V6AA 2X7IA 3K8VA 2UXBF 2RKIB 1DZ5A 2Z56B 2ZKUA 5H9EJ 1S6QB 1TL7B 1Q9YA 2P9PB 3PEHA 3TX8A 1AW0A 4P2XA 1UTAA 5FLXO 2UXDK 2A18A 2PMWA 1D9AA 4JYAK 1ZZNA 2JEFA 1RCOB 1YLXA 1SJQA 3NVKA 2MKYA 1TK5A 5CY4A 1JJ2R 1FK9B 4K4TA 5F3ZA 5KG7A 1KQSR 1ASUA 1S79A 3D1OA 1S7IA 1P1TA 3FGVA 2ACMA 2XHBA 4LIWA 1Z05A 1SZ2A 1FKPB 4OPAA 4O44A 3TQ1A 3BKTA 5DS7A 2QWPA 3LDNA 4HWIA 5DDQC 5ETOA 4EYIB 3M6GA 5EUHA 3JQJA 2ZDPA 1S97A 3R5CA 2YX1A 2ZC4A 4BLGA 3PYDA 3SUQA 2Y0SD 1GOBA 2NSCA 4I7FB 1SCJB 2MZTA 4DR4J 4ZCMA 6FD1A 2CJQA 3N6MA 2R7TA 3J7AP 1MSWD 3SDEB 3QRRA 4U8YA 3IWXA 4DV4K 3ZLJA 2E5JA 2EG2A 1QUPA 1S6OA 2UXCK 2DHGA 2BMBA 4KC5A 3D1QA 1YITS 1RQ0A 3KDNA 3SPZA 2DNOA 1D9FA 1YJUA 3MHYA 2CNKB 3BSOA 3MGJA 4QOTA 4HCCA 4O3SA 3ZT4A 4OQJA 1LAWA 3JSMB 4IRKA 3L2RA 3HPHA 2QIFA 4RWTA 4YOEA 3DCAA 4ALZA 1E6VB 1KLNA 4CO1A 4DTJA 3BP8A 3KLGA 1F0XA 3M2RB 2B8QA 2UXCF 1ZBUA 3IRXB 4LSNA 2BRLA 3MEEA 3GIIA 3DGPA 5D78A 1T9WA 3HFVA 2Q0UA 1ZOTA 3QAEA 4CESA 5CYJA 4M8LA 4EZ6A 1CBKA 1URNA 2E29A 2HFOA 2D74B 2W2QP 4J5OA 4LMZA 2RPIA 2R7VA 1M5OC 3QAUA 1NK5A 3E2EA 2BYCA 1QHAA 1AFIA 2IM0A 4ZVSB 1IKVB 3PUFA 2UUTA 2ZJPL 1NBEB 1UW4A 2O8DB 4OVLA 5C2DA 6AT1B 4DV3F 2HURA 4WK1A 3T69A 2CQIA 2QRRA 3MR5A 4F4ZA 2PZSA 4MFBA 4CO5A 4TYAA 4MAKA 5J2MA 2J9EA 1HR0F 1PBUA 4FJGA 2HBLA 4IH5A 1ILYA 3TWZA 1N5VA 2PO4A 4NA2A 1R0AB 3O5TB 1SS6A 4PKHA 4CHYA 1VRQC 1KQKA 3FKBA 2AGQA 1W0HA 2HGNA 1HKAA 3RU0A 5A2QO 3VETA 4I68A 1HJOA 4P7VA 3LANA 3RZAA 4OPJA 4JI0K 3D2EA 4P52A 2QE5A 4ZPWR 3SMZA 3BGRA 3CDUA 3NH1A 3BZKA 4ECSA 3VTIA 3IG1B 2FYXA 3TUPA 2HQCA 2V4QA 4ILGB 1N34K 1T94A 4YNQA 3RB6A 4LIRA 1QE1A 2RD5C 1T03B 1WC4A 2BA9A 3N9UC 2FJEB 2WBNA 4RKUC 2V7YA 3WUHA 2KRBA 3VWSA 3PYEA 2FHJD 2I8EA 5KFDA 2V69A 1S0OA 1D09B 5DGBA 1XMOK 3O8WA 1VC5A 3GV7B 4JD2A 3W7BA 2W9BB 2NRZA 2L41A 4O44B 2HF3A 3FSIA 3HT3A 4U7UD 3SCJE 5D4NA 4ZVTB 2VB6A 1RWVB 4U9RA 3G82B 2V9KA 2HIQA 4E98A 3VQ9A 4E0DA 3TA1A 3L9ZA 5LSOA 3DMJB 2E1CA 1IBMK 2XNQA 4ZCKA 5AZIA 3SSRA 3E66A 4G65A 3HD2A 4FPAA 4NEZA 3QMQA 3CJ3A 4W4MA 3W63A 4N56A 3CFPA 4OFZA 2CGKA 3PW4A 1VYAA 4JI6K 2V9WA 2B6AB 5KT2A 4CNZA 4M95A 1CC8A 1V4TA 3UDEA 4K4YA 2N82B 2OSRA 1LWXA 1Q81T 3ZSRA 4PG8A 2UUAK 1ZETA 5GAGI 2LQ5A 3SK3A 4YQWA 1BUXA 2VCPA 4FYVB 1PKUA 4DV2F 1ULRA 3JYTB 1VSDA 3MN7A 3CIZA 2OO4A 4GC7A 3O9RA 4FS2A 3O4NA 3KD5E 1S1UB 3GCWP 3VF0B 2FQQB 2XTJP 3ITHA 2DHAA 3D66A 1VBZA 2FBXA 5AXKA 3OLBA 4KHWA 2HVDA 3NF7A 3H3OB 3J81U 2VG5B 5L38A 2KDOA 3THWB 3RB4A 4CD1A 1RTJB 4C8ZA 4CZGA 3UNGC 3QEPA 4QW8A 3ITHB 3IGVA 3PRDA 4IO9Q 3E9LA 4FZYA 2O8EB 4IFYA 3KG0A 4ZPVR 1PYTA 1UVJA 4K0KK 4QS8A 4JKAA 2P5VA 1QQCA 4KIAA 1U02A 1JNZB 1YG0A 3THWA 1G4CA 3MXHP 4WTOB 2RDJA 3LM9A 2KFNA 5CCLA 4JKDA 1ZPWX 2AGPA 3C3LA 2DNZA 2MMYA 2W1BA 1NB7A 1U26A 1OH8A 4I2QB 4YB1P 2KG1A 5T41A 2XMAA 2XB2D 4O4GA 4P74A 3AXKA 1ATSA 3GJTB 1I39A 3RG6A 4DV3K 1FDDA 1Q86O 3K2YA 2VG6B 4GO7X 4DL3A 3RAXA 3CIPA 2HK2A 2DXDA 1FESA 1VQ6N 1RFQA 2CXEA 4P72A 2PY5A 3M2VB 1R6YA 4CGJA 2O4GA 2PA3A 3BEXA 4QWAA 3U4LA 4CZEA 4FWLA 2QWMA 1Q95G 3HD1A 3MPWA 1FXLA 3BUZB 1NO8A 3M8ZA 3PHEA 2CZ4A 1NSPA 2J9DE 4OZNA 2DR9A 3T19A 1EKRA 1NU4A 2OPQA 4JI2K 3EICA 1WI6A 3MM7B 4NI2B 4XK8C 1VQMN 1VQ4N 4DV2K 3WQPA 4FJ9A 2BM1A 5HRSA 3PCOB 4DTNA 3VQ6A 4P9SA 3TYTA 1QM9A 2F1FA 4OLPA 2GFFA 3MECB 1UA0A 4Y2KA 1JJ4A 4EWTA 4RUHA 1Q18A 1HBMB 3L7UA 4NPOA 3KG4A 1CJVB 1FKPA 4M5DB 2MQ8A 3H5SA 3F0NA 3MXMA 1ZBTA 3TA2A 2Q36A 2WTUA 1K0TA 4HUEA 2RKIA 3Q7CA 4AHTA 4RBVA 3AY0A 2PN6A 4BACA 5LMNK 2A42A 1FD8A 4JI3F 3KK2B 2QFIA 3SBTA 4HHHA 2VIHA 3ZT1A 1V3ZA 3Q7BA 1FRKA 3J80O 2VQFJ 1JNRB 1QUVA 4C0BA 3CJ1A 2DCUB 4ECVA 4CLSA 5ADXH 1HW9A 5AQLA 4JD2B 3QNNA 3QQCD 3AVJA 2Z2ZA 4CNYA 1C1CA 2L9WA 3TAMA 4ES1A 1HNXK 5I4MA 5KG1A 3PHTA 3NDKA 5LT5A 2YPZA 3F5TA 2CQBA 5B0BA 3O9QA 3ATUA 4KHMA 1H98A 5DM6L 2KXFA 2E1PA 1RTZA 4G1QA 5FRNA 2WTFA 1RUSA 4LF7K 4JHDB 1E6YA 3CGIA 2VQFK 3M6WA 2CIMA 5KG5A 4XIUA 4WYLA 1X5OA 1W7AA 4P2SA 4Y3CA 4O3QA 3CCUN 2F65A 3VEXA 5HI7A 1B7YB 1C1BA 2CPXA 3MK6A 3KLGB 2Z0GA 1GLCG 3UCGA 4FF3A 2JVOA 3ENQA 1DKGD 4OV1A 2W4CA 4AL7A 1N32K 3VQTA 3ALYA 1MWQA 1EETA 4ZJQA 2DRAA 4DF8A 1FFSB 1IBCB 4WFNQ 2WB1D 4OKJA 4O8UA 4KB0A 2B51A 3NGUA 4TY9A 4OX7A 4B1ZA 2ZD1A 1G1XA 3JYTA 5LXYA 4A5AA 3SBMA 4H4MB 3O1WA 2BBEA 3L95X 4J9UE 2CADA 1EB0A 2VICA 2V7ZA 3OSNA 1G15A 3AOBA 2JX2A 4HEA9 1CSJA 2UUBK 4NA1A 1S1XB 3EVWA 5C5JA 1VK3A 5HBMB 2BABA 4MO5A 4TXSA 1WSIA 2O8FB 3HPOA 4KO0A 1JQGA 3QGIA 4K7QA 1XNQK 3C15B 4OYOA 2NCKL 4RW6A 1S7HA 3QT5A 3O3GA 2HBMA 2GEMA 4PABA 1X9JA 1XTZA 1VQPN 3OTOJ 4E2FB 1NMNA 4BRLA 1G6BA 2F9JA 3HSJA 3KLFB 1OPZA 1JLGA 4Q7AA 3ZX0A 4DJBA 2HNDA 3AJDA 5B0DA 1YHQN 4FBUA 3RTVA 6FDRA 4JKBA 4K8ZA 1SBRA 1XNRK 1PBAA 2AJ1A 4GVBB 3ZTSA 3CSKA 2RMLA 2ZJPQ 1HD0A 1XHZA 3RRKA 2HIYA 2FY8A 3UKRA 3NGSA 3CQYA 2IVMA 3MAAB 2DNMA 2DFFA 5AQHA 4OI6A 4OJ1A 4TYBA 3MMBB 1ZM2A 1SKRA 4ZP9A 2K1RB 1M5KC 4BQZA 1VCTA 1N0VC 4HT5A 3QINA 3GG0A 3HL8A 1RBAA 2PEHA 3DRSA 3I31A 3JTPA 2Q66A 3OA9A 4JKGA 1BDGA 2RS8A 2GMLA 3M32A 1SQKA 4AM7A 4QWDA 2XHCA 4DU1A 3NGTA 2Y1JA 3C65A 3G4SS 4Q44A 4OPHA 4J9PA 3OBWA 1XN9A 4K2XA 3CCEN 4BR0A 2EHGA 2A1SA 3AO5A 1HYZA 3A8JA 4B8AB 3AJ1A 4NLOA 4KHRA 2ERRA 4RO0A 4CEEA 3CDEA 4H5VA 2DH7A 1BWEA 3SV3A 4JNEA 1VHIA 3AGRA 4PQAA 4ZA1A 1TL1B 4W92B 2Y0BB 5HROA 3KHHA 4H8KA 3QT7A 3R1XA 4NXMJ 2C22A 2MY7A 2ZH5A 4F2SA 2PYJA 4HH0A 4WQ5A 4M94A 1IR2A 3K5OA 3HTVA 3SZ2A 1S22A 4RTFD 1TL1A 2DHXA 4LY7A 1K1QA 4DQSA 4WE1A 3F9MA 1SQEA 1NM1A 2XY5A 1VBYA 5F0XA 1UW9A 1E4GT 5M2RA 1YDLA 3UIQA 3GIJA 2POKA 4PQUB 2D3UA 5HATA 3IBWA 3KJNB 2Y3YA 4JEPA 1YRUA 3ZSXA 1NK4A 1U1PA 2XZTB 3T41A 1NGAA 3I9V9 1HNZF 3PW5A 4F3TA 2CDQA 5F41A 3J81Y 1FWPA 3CQXA 2HSTA 2ASLA 5AFUH 2YNGA 4HHJA 2I5JA 2CDRB 4K4UA 2FJAB 4RG8A 1Y11A 3B4MA 4OX6A 5C25A 2EFQA 2YJEA 3PKYA 4C98A 2R8JA 2O8DA 4B9VA 4URGA 1L5UA 2E5IA 4FJJA 3VQAA 1ZM9A 4U7CA 2NXUA 1K8AT 1RBUA 1TVRA 5GAGU 3HZGA 2ALYB 3AVHA 4CGHA 2IRYA 4FVMA 3NLCA 4QR2A 3TZZA 3BF1A 3ILLA 4ED5A 5AZJA 1PSDA 2BTFA 4JI8F 5F8MA 4H4MA 4LQ9A 4JK8A 2WUSA 2M5YA 2PFFB 1TTHB 1IBKF 2KM8C 2PFUA 2VZ9A 5MLCV 3QICA 2RN2A 1R0CB 5A8WA 4ZLNA 3NCQA 3R27A 3HVTA 2ZEJA 4EK2A 3Q83A 3DLKB 2AV5A 1VLYA 2E88A 5IFMA 1YVNA 3W9IA 3D9BA 5JS2A 4UY8O 1FW6A 1VQNN 3POTB 3VZHA 1RTDB 1WHVA 4AHUA 1FT8A 2GX8A 2R7XA 1Z6RA 3AH6A 2EWHA 2DIUA 3GFZA 2UXDJ 4K8XA 4ZKAA 2AP1A 3LM2A 4Y0WA 1IXKA 3PIPL 5I3UA 5HJXA 4BC7A 4RZRA 3R5BA 4PPDA 1MLAA 1JL1A 2NRWA 4DL6A 1N8RT 5G0RA 3HHEA 3NNCA 3CCWA 4OYBA 1EJ7L 1MN9A 1HR0J 1B9DA 5LL6Z 4QS7A 3Q24A 1KC8T 1P8GA 3MM9A 4FN5A 2M52A 3SQGB 2ZBCA 3LL3A 2QL7B 1QZ6A 3ETOA 4OYPA 4L8RB 1EHWA 3GWCA 3RW7A 4LF4J 5A2QY 3M32B 1NDPA 1LW2A 2VBWA 2B4VA 4DDFA 4C2MA 3EZ5A 7FDRA 1U1OA 3ID6A 2XLJA 4X4VA 4CI6A 3C7NB 2YNHA 4ETZA 3VEYA 2IBKA 3R5DA 2NLXA 2ROEA 1H2UX 3CMAN 5BRFA 3UCZP 2Z2MA 4OYIA 2QK9A 4FJIA 2AEJA 4HT7A 2WVFA 3S9HA 4X64J 1SL1A 3AO1A 3M1FA 2CQPA 1JLBA 2VD3A 2ZJRL 3EZOA 3KK3B 2QXFA 1IKYB 4NMXA 4TKTA 4DV7J 5J1EA 5HROB 3NG8A 3KNAA 5MLCQ 3ASMA 1Q0NA 2O3DA 1WG1A 2F4FA 2OPRB 3THPA 1X4DA 3GE1A 1RAOA 4N8NA 1BGXT 4NX9A 5HSPA 1HUXA 2GBZA 3MM9B 5IS2A 3HYFA 3ZSOA 1WHXA 4X64F 4NRUA 5KT7A 3NRBA 4I6AA 2G8VA 3AVMA 1JLEA 2Y1LB 1T44A 2KT2A 2O8BA 1FF2A 4ZDNA 5B7WA 1OYEA 1NH8A 4LT6A 1PJ7A 4JLHA 3OTOK 3QPIA 4LF5F 2HFNA 3M9MB 4Q2MA 1U0HB 2L08A 3AGKA 3GLJA 2J9CA 4KH1B 2B43A 5GIOA 3W5YA 1WLJA 2WSFC 3ZEUB 1VGYA 2G2ZA 1RWWB 4DQPA 4BBYA 4PL8A 3MXIA 4K2JA 5KTQA 3CB4A 4FXDA 3LA0A 4KHPJ 3QO9A 3GSDA 3VQ5A 4BC4A 2X51A 5KFIA 2LEAA 2VC1A 5IZHA 5DQIA 1Q79A 5L9NA 3SAGA 1GXLA 2W41A 5AQZA 3EDQB 3CCLN 2LA4A 2DGWA 4L73A 3QMLA 3GV5B 3RMDA 4OZ0A 3PR5B 4KHQA 1YBTA 2KXHA 2XSJB 3LTOA 5AQIA 4LF7F 1YF5L 3WIVA 1W25A 5T7LA 1GLDG 3AAPA 1DAXA 3BGLA 5GMKa 2LYVA 3QDKA 4CF9A 1GLFO 4OHWA 4RW8A 1JXBA 4CJLA 2VUGA 1U25A 1PG5B 4H0VB 4B17A 2XZWA 2FLPA 3MMJA 3OR2A 4CBXA 1WG4A 2OSQA 2PI5A 3QWUA 2H54B 4PQUA 4LF7J 3NS6A 3NWRA 1CJKA 4URQU 1BI4A 1KKHA 1XNQJ 2J5AA 1AB8A 1BMQB 1FRHA 1EQYA 3PVXA 5KFZA 3C46A 1VQLS 5AXNA 3BQ1A 3M30A 4JYAF 4JI4F 3BDPA 2FLOA 4CJVA 3VENA 3KIOA 4FWSA 1CJTA 1UFKA 3CT9A 4BR2A 1BY9A 2F8MA 3PX6A 4EHTA 2HQ3A 2BKOA 5GAHP 1U2VA 5BYSA 4RUCA 1KD1O 2AYEA 1U4BA 3MCPA 2A5XA 2E5LF 1VQKN 2DY9A 2HHTA 2H9ZA 2KI2A 2LP4A 4RBTA 5J2PA 4YS2A 4V19X 1IUJA 4I6WA 4BRMA 5AE3A 2IJFA 2OI2A 3OJSA 1XR6A 1F9EB 3BN7A 4NLRA 1Y5NB 4HYKA 2R2UA 2AJ2A 1GXTA 4WFXA 3CCLS 4A2BA 4P2FA 3OVSA 2CWXA 1T03A 2P9UB 1VQ8N 3I0RA 1FE0A 1LK7A 4PWDB 3RSEB 2CQ3A 2W2NP 5LSRA 1Q16B 5BRDA 3GDQA 3HSDA 1JCFA 1EKSA 2J6UA 4BR7A 3PIOL 5IM0B 1NU0A 1JXVA 2DFEA 3ISND 4UQGA 2IPOB 2RQ4A 3G9CA 3TARA 1RWMB 4CLTA 2MPUA 3MAAA 5FPDA 3CJTA 4FYWB 4A4JA 2FHKA 2YQ0A 2I0XA 2IC3A 3L0QA 2VPXB 3TPQA 1HBUB 4CO2A 3ULEB 2WVEA 3GYNA 4PG5A 1HIYA 1F21A 3CMEN 4B3MK 3HI9A 3KWMA 3DHXA 4PG7A 2ZVIA 4I2QA 4U8VA 3V9UA 5GAEP 4WKYA 3JQMA 3Q89A 3C16A 3WXLA 4O3NA 4CZCA 3BN4A 4GW6A 5D0HA 5DDPC 4CWBA 3BGOP 2MHEA 5CCMA 4KHYA 1I5OB 4B3RJ 4Q0BB 3J8AA 3NMAA 1RCXB 1DURA 3CMQA 2WSCC 4NXNJ 4ILJA 3KKSA 4K4VA 1X9SA 5JLFA 1VHXA 1D8ZA 2FD2A 1NLKL 5HP1A 3LDOA 5KPTA 4FLZA 3KK1B 3DM2A 2HMIB 1CPZA 1LOUA 4M41A 2VG6A 4C4WA 2Q2RA 1K73T 1YJ7A 3MTKA 5CYQA 1H2TZ 4PUOA 2OP5A 4CH1A 2ZBQA 2P9LB 3OYEA 1IJFB 4I69A 5M1QA 1G7CB 3GL1A 4RJVA 5IWAK 4LUBA 3GYGA 3ZNUA 4ZVQB 3AHPA 4DX5A 3LGMA 1RDAA 4JV5J 3M2VA 2OTJS 3IO1A 2DNQA 1Y10A 3UWTA 1RT6B 1VAZA 4OYMA 5AQTA 4ZVFA 4KAZA 2LEPA 3NP5A 1Q8LA 3JQKA 1UP1A 2HS3A 2B5JB 1NK7A 2VJVA 1K8AO 3Q8QB 2AEMA 3IMQJ 3UDVA 4IH6A 1MWYA 1U24A 3OL9A 2DK2A 2YKMA 4U6PA 1AZSB 4CJKA 4DU8A 1Y64A 4CJFA 5IWAJ 3C16B 5EWFA 4LSNB 3RRGA 2LQ9A 4FLVA 1UCNA 2FJWA 4MKBA 3P3DA 2XSFA 2XC9A 1YJ9S 2XRIA 3H6EA 4KAIA 1TL5A 3FC9A 3PXGa 4CFCA 3VEWA 4B9QA 1WDTA 1ITGA 1R8CA 5E41A 3CD6S 3D6FB 5E3CA 2A3ZA 4F0KA 3D2WA 3OYDA 3NXZA 1YRTA 3F2KA 2P9GA 3Q8UA 2HQGA 1FJCA 1UOCA 2ZFHA 4EMDA 1P1LA 5HRPA 5IM0A 1NMDA 4DTXA 4OZ3A 1W2BR 4M3TA 2QSWA 3PW2A 1QY7A 1K8KB 4GO5X 4ECYA 4CJPA 2Q97A 1QLNA 1RTIB 2CH5A 4CZIA 4CJQA 3EO3A 2GS8A 1NJZA 1C0MA 4WU2A 3ULEA 3JAMO 3M6XA 1FRMA 1VQKS 4TVAB 2BQ3A 1RAJA 2NXJA 2ZGYA 1T02A 2QSFA 3QRPA 1UKUA 3VF4A 5KFJA 1TL7A 2R42A 2M4MA 3DLBA 3MOZA 3NS5A 4GVBA 4U7BA 3KLIA 4PR6A 3DRYA 1Q86T 3QFPA 4PHTX 4YOVA 4MLHA 2KQ2A 1NK0A 2D3ZA 2A2DA 4J9OA 2FVRA 1VSLA 3LOUA 5E3PA 4I9QA 3L3CA 5JVHL 4PYAA 1TUUA 3ZSZA 1OY6A 3MAHA 4CBWA 1WNSA 5E3QA 1N5QA 1HMVA 4M3ZA 2ZOMA 1VJWA 1PYSB 2JWKA 1R6VA 3BPSP 2F7VA 3T5HA 4YOYA 4HCBA 3LAKA 3LO3A 4YDUC 4OO1J 2DGOA 2G1HA 3FEXB 1Z4UA 5C15A 3AB2B 2IA0A 3HVTB 1RWUA 2XO6A 2NR0A 3L3VA 4O55A 1U2CA 3A5MC 2AJFE 3N4QA 2VODA 1T9VA 4WF9Q 3CM6A 1F3FA 3VQ8A 3OYMA 5ETRA 3TUZC 2AD9A 2CJKA 2KHOA 4WYBA 1SH2A 5CH7B 4IWVA 3J7AN 4WP3A 2UUBJ 1DBDA 4I4BA 3CCSS 3KJVB 3I5AA 4LD0A 1O6XA 4R0EA 3MEEB 2UUCJ 1IQTA 4YOXA 2V8GA 2CNLB 2OD4A 4ZVEA 4HUFA 2QYGA 4F36A 3W66A 2F7TA 2HLUA 1FFWB 1FE4A 4GKJJ 4XDCA 2UUCK 5GIPA 3RR7A 2HBJA 3QIPA 5KFHA 4I6MA 3DI6B 3DYAB 2N3LA 5E2QA 1HR0K 2EW9A 1U8WA 2CZ9A 1CLQA 2B9WA 3GFYA 2DO0A 3QJJA 2LQBA 3U1LA 3FCWA 4FJHA 3VHQA 1RAHB 3PX0A 4LF4F 4MKAA 4GKKJ 2O8BB 3DXSX 1I3OB 2LSNA 1BG3A 2ASDA 3GTYX 2KZMA 1XMOJ 2W8KA 2P8IA 1PCAA 1KP6A 4X2BA 3QERA 1KFDA 2XLIA 1Q9XA 2MJNA 1HHSA 4DSFA 4FW1A 3LPUA 4LF5K 3PACA 2E2PA 1HWUA 3OQ2A 1BXNA 3AT1B 2FLNA 4JI8J 2GJ2A 2YBVA 1OY9A 4L3QA 2CWKA 1UFLA 4F26A 4OX8A 1HNXJ 4BG9A 1DTQA 2ROPA 4IBNA 3ZZPA 5B0CA 2DNGA 4CEQA 1BU6O 3FR0A 4WU3A 3K9JA 1WSJA 2ZH4A 1Z1ZA 3FBBA 4B3RK 8ATCB 2HWTA 4X84A 4BREA 4IZ9A 4PXDA 5J1PA 2YHBA 1SV5A 1SKUB 1C1CB 3OL8A 2GHPA 2DIVA 4M63A 4R79A 1X4GA 1KQFB 4MK7A 5KQDA 4QWCA 4YR0A 4OJGA 2ROGA 2IVYA 1HNWF 4IOAL 2B4OA 1EAYC 2J8AA 3DOMA 4B3SJ 2PFDA 4ICLB 4NRTA 2A10A 1GLEG 2FVSA 1XEZA 2O01C 3DMJA 4BWMA 1AROP 2CKWA 3X3UA 1VI7A 1MG7A 4K8RA 1QQMA 4KHSA 3UQSA 2RHSB 2CVEA 2C2MB 1TKZB 5HN0A 2ZHOA 5AQKA 3KK3A 3IMXA 2J7UA 1VBXA 5I9EB 4U67L 2WVDA 4WXOA 3VALA 3WEEB 3MN6A 2HQFA 2E1MC 2C42A 7AT1B 2J9DA 1RGIA 1ZBSA 4QYZK 2JGUA 5U47A 1ASVA 4BE0A 4CEOA 1ZTWA 1VQSA 4FF2A 2I2YA 2HNZB 4E89A 4LVNP 2ASYA 3OFEA 3C95A 2W2OP 2LCWA 2DGVA 2E4LA 4AHVA 1S9EB 2XMVA 4DR5F 1Y4ZB 4H4OA 3M9NB 4DX7A 4C9DA 4FWNA 4CLLA 5K9FA 2A3JA 1ZZFA 4CYUA 4CM2A 2W7AA 3GIKA 4C1NI 4WFZA 1RI7A 1A5WA 3QBWA 3QEWA 3LDLA 2H3EB 4R8UA 5KT5A 4HTJA 4X4RA 2VFVA 4YMEA 3ZSVA 3G8SA 1GOCA 3MCMA 4CZKA 3EE3A 1T95A 5E84A 1XBWA 2HBRB 1EIYB 2WFBA 4NXMK 3J7A1 1L3KA 4QR1A 2KH9A 2EFVA 1BQNA 3CO0P 4IR9A 3W2VA 1NKBA 3HVRA 2CPZA 2CFXA 3N4PA 2EG1A 3TEGA 4PKIA 1S5JA 2HB5A 3N4WA 4QPXA 2CJYB 3HX9A 1UZDA 3KHRA 3IR6B 3GQCA 2DPNA 4JV0A 1O8BA 3CCVS 3BKFA 4C0HA 3GR0A 4WK3A 4MKYA 1AUDA 3D0GE 2XCPA 4TU9A 4NXMF 4RW4A 5DO2A 1RLDA 2GIFA 3C6TA 2Y8YA 1SC4B 1KD1T 3GG1A 5ETMA 4ED6A 1QS4A 1UAXA 3ZX2A 2NXNA 1NDCA 2ASPA 1SVDA 4ED2A 4RW8B 2C2ZB 2I6WA 2JLEA 3WX4A 4OGEA 4M5JA 4C48A 4HACA 2VPYB 4PRFA 3ZZRA 5TKYA 2CJXB 3AY9A 4S0MA 4Z4EA 4B9MA 1LWEA 1W7WA 1HPZB 3I6PA 4JV2A 2FSJA 3PIPQ 3C14A 1R27B 2GVDA 2NQPA 4E7KA 3IBFB 3OUYA 1B0TA 4NEYA 3QEVA 2R7OA 3P96A 1S1WA 1LEOA 1RAEB 4UZBA 2UVUA 4W90B 5HMXA 1RCHA 4CJ7A 4EP5A 4CF2A 3BV8A 3BGUA 5DJBA 3AA3A 2P51A 3NS7B 4AILC 4DSJA 3DOLB 1DJ0A 4X64K 4YUDA 2F9TA 3FEYB 5K14B 3JTNA 4ZPCA 2JZ5A 1OQ6A 4J9SA 4UOHA 4BDZA 5DMRA 1VLOA 3PEJA 4B08A 3L7OA 1KN6A 1R43A 2RDIA 3VAHA 4IO1A 2CNNB 3WZ0A 3OTEA 3PRVA 2QTDA 1HKBA 2CJ9A 2YQ3A 3LP1A 3N5BA 5ETKA 1Q82T 3VGLA 2VC0A 3IKMA 2ZOFA 2IFXA 4AHSA 2V94A 4NOHA 1TV6A 2EEYA 2XI3A 3CF5Q 4DV4F 3CCSN 4ZP6A 1SJRA 4I2PB 5DQHA 3W2WA 2FXUA 2YVSA 4JI2J 4ES2A 1S12A 4GVLA 2JVRA 1T3NA 3BS9A 2ETJA 1UJ6A 4RLEA 3ENWA 1XI1A 3WXMB 4QQBA 3EXCX 3NKYA 5BN8A 2P5GA 2Z8QA 3MM8B 2H51B 1JB0C 2JEGA 4KH4A 1U2RA 1HD1A 4DFJA 1EQ0A 1VISA 3QIDA 4J2DA 3HSGA 3QB0A 3J81j 3G8TA 3KHYA 4DR6K 3RUBL 1UFWA 1TL3B 2BXJA 1OWXA 1J5EF 2XS5A 4W98A 1IG8A 2F63A 4R8UB 1RYSA 4B02A 2MGZB 1QTNB 2IRUA 2X1FA 4KR0B 3VEZA 4Z0UA 1BO5O 2D3O1 1N5YB 1VBKA 3DLLL 1X5SA 2IA6A 3NAEA 1W2IA 4HH1A 3U27A 3SUOA 4GV3A 2VYPA 4RU2A 5D0RA 1P9YA 3LGNA 3ZZZA 2E7WA 1WOOA 1XNRF 3H5YA 4OYXA 2EBEA 1FERA 1RKIA 1Y3KA 4WCEQ 5EGYA 4AQYF 3KG1A 3MR7A 4X62J 4H5TA 1CJKB 5KFEA 3GOIA 3VMFB 3QESA 4CJ3A 2OMLA 4ER8A 2ZNYA 3HVWA 4LJMA 4WQ4C 1WDDA 3AD7C 3JS6A 1I3AA 1RT2A 3OYAA 3DLRA 2GTDA 1X0PA 4P6QA 4RW4B 2K7JA 4A8KA 2GQCA 1JMTA 5D0EA 3KTQA 5F8GA 1FHTA 2GAHC 3S3OA 4R25A 3KLFA 4PL7A 4QR0A 1RDCA 4MO4A 2LXFA 4C11A 2L3MA 4RW7B 1RB0A 3DXKB 4AQYK 4LR9A 4A61A 3OS0A 2YX4A 4V1Ak 3IM9A 4M3XA 4ZPAA 1FO1A 2XSJA 1VC6A 1JXLA 4M3WA 4DUYF 3V81B 4CLFA 3I5BA 2QO3A 2HWHA 2KHCA 3VQDA 1S10A 4ELUA 3DLEA 3TVKA 4C8NA 3D6TB 1KXPA 1SH3A 4N7TA 2OTLN 3WNHA 3HK2A 2I38A 4IOCL 1D0EA 4CT8A 2QA1A 5KFCA 3TQEA 4CLKA 2HSEB 1KFSA 3TAEA 2IAJA 2XZDB 4H0XB 5IT0A 2CPFA 4EO8A 3SDEA 2A1RA 3ZCMA 4M5KA 4RNOA 3EGZA 2CPHA 5BJRA 4B3TJ 1RTHB 1WTBA 3FZLA 1Q82O 4CFAA 2QMXA 4ED7A 3VQEA 4TSXA 3B8HA 3DLGB 3VQSA 4A5BA 1BLUA 2RRAA 3CCTA 2AIRB 4NB4A 4DUTA 3A1YG 2Y1IA 3V5RA 2HMPA 5KFMA 1TUGB 4KHPF 1F5BA 2DGUA 3CCQS 1RK8A 4QIGA 1NGCA 3QGPA 4Q2LA 1DFDA 4DF4A 3BBCA 3PFEA 3UKUB 2W2MP 1U09A 1UA1A 1S1VA 2HYIB 4LBHA 4TQSA 4DSIA 1LW0B 4ZIVA 2D1KA 4RBUA 1UPPA 5AE2A 3L3UA 3J7ZO 4CI0B 1YI2N 2EC0A 4RUBA 4TY8B 1U6BA 3ZETA 1YKWA 5DZ6A 3HT0A 2RILA 4IXCA 4AHRA 4ZK7M 1FCAA 5KFNA 2MLYA 5I42B 4ISGA 3H2VE 3CCRS 4DV7F 4ID5B 2K3IA 1ZC6A 5LM7E 1VHFA 3W3SA 5I3PA 3IGNA 2E9ZA 4UUWA 4ECUA 3R97A 5IV4A 3SAFA 2VBYA 4U67Q 1E3MA 4A8YA 3NCRA 4FVCA 5HQMA 4LF8K 1DLOA 1UVIA 2FLLA 2DRDA 1PAEX 4YR3A 4B1VA 4W5NA 1RE1B 1FJ7A 1C0UB 1OH6A 3D7SB 2APOA 5HAOA 1IBLK 5CZVA 1NJYA 4FJXA 2HHHJ 4I6YA 2OAUA 1LWCB 1WF0A 4Y1CA 4I64A 1NAQA 1RDBA 1X60A 1RHUB 4FWMA 1RT3B 1JL2A 3AVBA 1KTQA 5KFYA 3C2PA 1EX8A 4B8CA 4QIFA 2YNFA 4W5TA 1X4CA 2BJ1A 4QYZJ 2LVWA 1EX4A 4F0HA 3D2FA 4RWXA 2YH0A 5C0YA 1HNWJ 2B5JA 3H59A 3TR8A 4HTUA 2HRUA 4DCJB 2HBZB 3FUYA 3D54A 3PJXA 4M42A 3PM9A 2LQ8A 5AT1B 5F2RA 2YCHA 1A7GE 4H5WA 3LPEA 4JI7J 1LWEB 1JXEA 4OZLA 2HHWA 2J8SA 2DJWA 2HHQA 1NGDA 5AZJB 4DHVA 2QLWA 4R0JA 3HMJG 4ZVOB 1FVSA 1FEHA 2VKRA 2E2NA 2UUAF 1RDRA 3EEQA 4KKOB 4N47A 3VN5A 2HHVA 2CQHA 4CFBA 2Q3PA 4X4NA 1U1KA 3CCVN 1T05A 1CZAN 1NB2A 2J76E 3NGYA 2GHVC 4DR5J 3I82A 4YHHK 4JUZA 3K5MA 2G0IA 2VQFF 1E6YB 5E33A 3H90A 1SV5B 1OVQA 1VQLN 4JS5A 3V4MA 2RE1A 2IM1A 1U04A 3WQTA 4WFAL 1S9EA 1S1VB 1JIHA 1BQNB 2R8IA 2I5JB 4CO3A 4WFBQ 1FA0A 2V34A 1QJHA 1OSDA 3TZWA 1NGHA 4I1TA 4KKOA 3LDSA 1RKJA 3TO8A 2BKNA 3VPZA 1JJ2M 5AJ3F 1NGGA 1AXQA 1UAWA 4ECQA 4DKWA 4NYNA 3TA0A 3JS9A 3CXCM 4BE1A 4MTPA 3AQPA 3AA5X 2UVRA 1KOHA 2M0GB 2ZUGA 4F02A 3US5A 1G99A 4LRDA 3DRPB 4CYUB 2RSQA 3D6HB 1REVA 2B4PA 1GTHA 2A41A 4DV0J 3I0RB 1XMQF 2VWKA 3TR5A 2LDYA 4HHUA 2L9NA 3PV8A 3QGGA 1I51B 1JLAB 4CZJA 4RNNA 4FO0A 3RMCA 3U9ZA 4G3IA 3U3GA 3BR8A 3DGPB 5JVHQ 1G2EA 3HULA 3K9KA 2IBOA 3WXKA 4RL1A 2W42A 4NMLA 4BDYA 2LXIA 3G96A 4PXBA 2JFKA 2QLFB 1U47A 1L3UA 4CF0A 4AFFA 1U1MA 4F67A 2ATLA 2W6LA 5AQUA 5K5MA 4O3PA 1FX4A 1Y9OA 1WOSA 5D77A 5KFXA 1S6PB 3CD5A 2JH3A 4CJTA 4OZ2A 1GT8A 2F8HA 4LFBK 3OYCA 4A8SA 5IXUA 3Q23A 5IC6B 2HOEA 5FIIA 5GAEI 3SLCA 2OCEA 3VQPA 4KGKA 1QDUB 3IR5B 3H5UA 4LBPA 4Y2CA 3A2FA 1RT3A 4GC6A 3F41A 4FZVA 3I55N 4Z37A 2YWGA 4O23A 3I32A 3TW0A 2OZMA 1OYDA 2Q3SA 2F8SA 3R7NB 4OHVA 3OXGA 2X78A 4DR4K 4A62A 4FPIA 3GU0A 2ZZMA 1SUQA 3DI6A 3DYAA 4USUA 1TK0A 2B7BB 4ECTA 4K4ZA 3A5NC 4OKEA 4P2MA 4AQYJ 2YKMB 3NHGA 3V9ZA 3CCJN 1VJQA 3P5TL 2XS2A 2XEXA 3K5NA 3KUGA 4O0NA 1QSSA 2Q1LA 4CW7B 3PTWA 2IGIA 2MZRA 1VMBA 5C42A 2M2BA 3MD1A 3OS1A 2Q0RA 2UU9K 5H9EK 3LDPA 2FB0A 4LF9J 1KVBA 3MTJA 3O5BA 2A2CA 5H1SQ 3LDQA 2QEXN 1KWMA 2HNYA 2AJ4A 1B4SA 4DU4A 3VESA 4B3OA 1NHKL 2HZVA 1YUWA 3A0IX 1N54B 4QIEA 3TJ9A 3H42A 5B0EA 4AE5A 4GKJK 3M8PB 1J54A 3THTA 4YN3B 3CC4S 4GMJB 2QLJB 3OFGA 4ZVHA 1RWXB 2EPIA 1S1TB 4EHUA 3C0BA 3NL0A 3MZIA 3U6FA 4GRSA 3THVA 4KHPK 5AQNA 1YIJS 5HP1B 1N32F 1N33K 4O3RA 2G4BA 1ZM3A 5JXSA 5KRTA 4OL8A 1XNRJ 2QKKA 4Z4IA 4FF4A 2B4JA 3AFGA 4BROA 3UE2A 3LW5C 3H2LA 1C2PA 2GNKA 2P6SA 2FHJA 4NLUA 3DJCA 3E01A 2EXUA 3TNVA 2VG7A 3GMGA 2Z57B 3GE9A 4CT9A 1IV0A 1LV5A 5HQ8A 1N32J 2HAIA 2N7CA 4IOAQ 4DL5A 3EPGA 3ZT0A 5KPZA 3AAQA 3QT6A 4U95A 2PSZA 3CFOA 1RWNB 3S6EA 3G6VA 5DLGA 1LFWA 3N28A 4PWUA 2C3UA 2P6TA 1C4AA 1VQPS 5FJ4A 3PW7A 2DT9A 3CW2C 2V2VA 1VIXA 3ZNJ1 4FWKA 3I4HX 4ERDA 3AA2A 3LH2S 1IJJA 5DM7Q 4CEZA 1T0TV 4X4UA 3UFCX 4NXNF 2KW4A 3IXQA 4B1XB 1KBRA 1YSJA 4DPTA 2E9RX 2KKHA 3DXMB 3S1TA 1LOTB 3MWPA 4Z94A 1RHRB 3EUNA 3RJMB 1YGYA 4OHXA 4FK4A 2H48B 3MWBA 1JLFA 4J91A 4ATNA 2F5GA 3UE5A 4J2BA 3HHKA 3G82A 1RBSA 3FFKB 5E3AA 2DBBA 4J37A 1Q4RA 4BC5A 4OX9K 3ADAC 2LECA 4GVEA 3IAYA 4K5SA 2G9OA 1S6QA 4JI5J 1A5VA 1MNEA 1MWZA 4OIXA 3CJ2A 1VQMS 3D28A 2UYTA 2M9KA 4WP8A 1VQYA 3Q8RB 3MMVA 4XH4A 4L76A 5KI6A 1NK8A 3KUHA 1N36J 2E5LK 2VPZB 5F0UA 2A40A 4E1NA 3OYIA 1V4SA 5M2PA 2EFGA 5BYRA 2ZE2B 2DNPA 2HHHK 3V1OA 4K0KJ 1M0SA 3HP6A 3D1HA 4JI1K 4EU0A 3IWNC 5KFLA 3H2UB 2HFUA 2OFGX 5AR0A 4OHYA 2DKOB 1SJFA 3G10A 4M63C 3MAQA 1N36F 1U45A 1U49A 2H1YA 3R2DJ 2G8WA 1RTJA 5KFFA 1VQ5S 2F8TA 3BSCA 3NOGA 4DI6A 3ATVA 4JKHA 3G0ZA 4B3TF 4CQ1A 1YIJN 2G8FA 4WIQA 2JEJA 1X8DA 3T7ZA 3CE8A 1DTTB 3C6UB 3CJRA 4JI7F 2HHXA 4FL9A 1FXXA 1XHXA 2N7YA 4BHQA 2HRTA 2OPPA 4H4OB 1Q7LB 3M3ZA 3CHWA 3O3HA 4NLWA 4BGBA 2WBMA 3M6UA 2AX1A 2M3DA 5FLXU 1Q7YO 2W25A 2JDJA 4B1WB 1ZBFA 4RR5A 3WDOA 3VGUA 2I1RA 3HP9A 3A8EA 1K0VA 3MM5A 4WZMA 2HEKA 4KGVB 2DHSA 2FBTA 1EWQA 3U8XA 1VSKA 3HFKA 3T9NA 2GVDB 1XC9A 3GFXA 3VF6A 5BREA 1IO2A 2ZWHA 2XBPA 3K0SA 5FROA 4P10A 1Q81O 1SI9A 5LJVA 3HSCA 1QHTA 2NREA 4J9QA 4KH5A 1MU2B 3SQ2A 2Z1GA 4NYFA 5EWGA 2ZH8A 2BH1A 2R8KA 3P5BP 5K14A 2K7KA 4BRHA 5DETA 2AYBA 1OO0B 3DHWC 3ZZTA 2ZM6K 3CCQN 1JK9B 2YY3A 1HLWA 2ZUAA 3RAMA 5CHCB 3NOCA 4K41A 3D6RA 3QNWB 4CF8A 1ZA2B 1HQEB 3OJUA 5CXTA 2EFOA 5CZXA 1SJ1A 1JLCA 3SI8A 1KDNA 3LZJA 3THYA 2N3OA 1H3DA 4NLSA 1K6YA 3CG7A 5L1KA 3E51A 2NYHA 3W3DA 1YTAA 1EARA 1YT3A 5GMDA 1TELA 4IG0B 4FK2A 3MDFA 2DY4A 3LQVA 5C24B 1GX5A 2DCLA 3VVUA 1M1KO 4PZVA 5MAOA 2ASJA 4NLTA 3C94A 3JAMU 5GADP 3BGRB 1YJVA 3BREA 2B9EA 2WHOA 1D1UA 2BW7A 4BRKA 2D0OA 3QSIA 1YRXA 4KI6A 1XIQA 1NH7A 2BKPA 4NLCA 4M5HA 2O8CB 3K17A 3DN9A 1A0OB 5ETVA 3VA3A 1YXQA 1T6DA 4EO6A 1J9AA 2YWWA 3FE1A 4ETXA 3BO2A 2NRVA 1CS4B 2M7SA 2HBYB 4DPOA 1UVMA 1XC3A 2E44A 3VAFA 1Y3JA 4A46A 3IFEA 1S99A 4ZTJA 5HMWA 2XY8A 2W9CA 1LXJA 1Q5VA 3ILJA 1NSQA 2HNZA 3W0LA 5CAAA 2CH6A 3P39A 1X31C 4Z4GA 3J7ZT 2ZJRQ 3FZ2A 2HWIA 1XMBA 1VRUB 3PW0A 1B9FA 4CJ4A 1FNMA 1C4CA 1MMLA 5AQRA 1GX6A 3SXLA 3CERA 2KVIA 2A6AA 5CABA 1TKXB 5KRSA 2MKKA 2OJ3A 5G4DA 2KT3A 2VFTA 1RT4A 5KFAA 3KLIB 2HBQB 1CJUB 5JMNA 3ENOA 2BJ3A 3TAQA 4LFCK 3L7PA 1RBVA 3HOSA 4X4QA 1IBKK 1L3TA 5JLHA 1BIUA 2K2PA 1Z2ZA 3ZX3A 2QA4S 4FJ8A 3O6QA 2IJRA 2O67A 1HQUA 3CXCR 3IDHA 1NZAA 4IJAA 2DNNA 3Q22A 4CRJA 3DU6A 2X6NA 4QYRA 1T7PA 1NHUA 1QQOA 2O1PA 2EKYA 4WKRA 5F1XA 2PGCA 4IO8A 4QPTA 4FM0A 3GONA 3FMWA 1K44A 3QSYB 3AVKA 3SMSA 2OEJA 4A2AA 4UF4A 4DTRA 2GUIA 5DQGA 2IDOA 1V5VA 3BBFA 3NVMA 2RUSA 2EFPA 4QU6A 4HKQA 5D3GA 4CFDA 3O9SA 1T3VA 1Z26A 3OUYB 1K9MT 4OGCA 3NGKA 3NF9A 3ZTOA 3VGSA 4OYZA 4QIVA 2GJFA 4FZXC 4CO4A 5KFRA 3HXMA 4DS5A 4CEBA 1EWRA 3M9OB 4NLQA 3OW2M 3BO3A 1NGJA 4EEYA 3HHLB 2IMWP 4BCAA 1D4XA 2KM8B 1VRTB 4A8QA 1HHQA 1MDUB 2DFHA 2X74A 4LSLB 3H4DA 4K50A