1W0HA

Crystallographic structure of the nuclease domain of 3'hexo, a deddh family member, bound to ramp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
200
structure length
200
Chain Sequence
ADSYYDYICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYVRPEINTQLSDFCISLTGITQDQVDRADTFPQVLKKVIDWMKLKELGTKYKYSLLTDGSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPHCGLDDSKNIARIAVRMLQDGCELRINEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Structure of the Nuclease Domain of 3'Hexo, a Deddh Family Member, Bound to Ramp
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords 3'-5' EXONUCLEASE ERI1
total genus 57
structure length 200
sequence length 200
ec nomenclature ec 3.1.-.-:
pdb deposition date 2004-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1w0hA00
4NYFA 3PV8A 5E41A 3IRXA 4O0IA 4HCCA 3QESA 3ZCMA 1KSPA 4B9VA 4BE1A 1U45A 2G8UA 1ITGA 4FLTA 3AVHA 1IKVA 2OPSA 4E89A 1LV5A 3VQ5A 1Z26A 2IAJA 1FK9A 1RT6A 1SL1A 3PO4A 4FLYA 3LZJA 3P83D 1U04A 4BDYA 3ZT3A 4DS5A 2KW4A 3DM2A 2KZMA 3F9KA 5HLFA 3VQDA 3OS2A 3OYKA 3U3GA 4FZZA 4CJQA 4PWDA 4DSLA 4DLEA 3SPYA 2G8VA 4DTNA 2HB5A 3NH0A 3ZSQA 4AHTA 2PZSA 2OYQA 1NK6A 3OYHA 2ETJA 4OGEA 1S9EA 4KB1A 4AHUA 3TARA 3HK2A 3VQAA 4CJ4A 3OS1A 1VSDA 3OJSA 3MEGA 1LWCA 3CYMA 1NK7A 4B9UA 1HRHA 2ZQBA 2A1SA 3QIOA 5JS2A 2A1RA 3LAKA 3SYZA 2PYJA 3OYAA 4W5NA 2BE2A 3EZ5A 3QEPA 3RWUA 3WNEA 4FJHA 2HNZA 1J5OA 1KRPA 3SPZA 4ID1A 1TVRA 5KGXA 1TGOA 3S3MA 2G8KA 1WSEA 1EXQA 1WSJA 2RKIA 4HUEA 5CZ1A 4BE2A 2PYLA 3JYTA 4HVJA 5FROA 4FLWA 4M3XA 4FJLA 3E01A 4QOZB 1C1CA 4LY7A 2X74A 3NGZA 4CEDA 4FLUA 2YNGA 4PA1A 1CZ9A 1R0AA 1BCMA 3NGIA 4NCBA 2OPPA 3L3UA 2OZSA 4ELUA 1EKEA 3SI6A 1TAQA 2FBXA 1VSJA 4GMJB 4CFCA 4CJVA 1TK8A 4KRFA 1CLQA 1TV6A 2QKKA 4CK2A 1GOCA 3DRPA 4E7LA 1UOCA 3KTQA 1NK5A 1JLEA 2AJQA 3V1OA 1Z25A 1L3SA 4CGGA 1HPZA 1KTQA 1RDCA 3O3GA 2YKNA 3HSTB 4N56A 3LP1A 3OYMA 3QEVA 2HMIA 4DQQA 1EP4A 3K57A 4I9QA 3LAMA 3K5NA 1C1AA 1WLJA 3ZSWA 1WSFA 3OVNA 3P1GA 4KO0A 1RT2A 2IGIA 2RN2A 4B8AB 4CEAA 2ATQA 4ELVA 1RT1A 3SV4A 3I0SA 3DRRA 4YNQA 4CIFA 2FBYA 2XY7A 4BWMA 3KK3A 3SQ0A 4CESA 4CJ3A 4DSEA 1U47A 3DYAA 3M8QA 4DSKA 2G8IA 3KIOA 2Y1JA 1BI4B 2G8WA 2Z1HA 4OVLA 3K5LA 3CFPA 3PX4A 1REVA 2PY5A 1KCFA 1QS4A 1WAJA 4CJFA 4RG8A 4CERA 3NF7A 3TAFA 2O4GA 3PX0A 4N76A 4ZTJA 5CYMA 4EZ9A 3MXMA 4CF1A 1WSIA 1BIUA 1ZBUA 4O4GA 4DTXA 4FK2A 2EHGA 4J2DA 1HQEA 2YV0X 3U6FA 5DK5A 1D9FA 1S5JA 3SUQA 1NKCA 4KFBA 1XHZA 3VA3A 2VG5A 3L8BA 4W5QA 3K59A 1NKBA 4DWIA 3C6TA 1I39A 2JLEA 4KB0A 4KHUA 4FVMA 3AVKA 4CEBA 3HVRA 4DTMA 4B3OA 1K6YA 4Z0UA 3ZSXA 1HNVA 1VSHA 3DLKA 1UWBA 4IFVA 1NJZA 3V9XA 3NGYA 3SUNA 4M42A 1EETA 3QLHA 3QEIA 1T03A 1BHLA 3MXJA 3AVLA 5FDLA 3HPOA 4DLGA 2ITGA 3SQ4A 1HJRA 4M41A 1J54A 4CFDA 4BACA 3CM5A 5SZTA 1DTTA 1VRUA 3LANA 4CK3A 4DFJA 4DFPA 2DY4A 4M3RA 3HVTA 1A5WA 2Z1JA 3FFIA 3OJUA 3NCIA 5J2NA 3V6DA 1BGXT 4FJXA 3PY8A 2NUBA 3HP9A 4C8NA 1QSSA 5C42A 1BQNA 4CK1A 1GOAA 4CJEA 4MQ3A 4CGJA 1X9MA 3QIPA 1QE1A 3HL8A 4ZHRA 1IKXA 2HHSA 2KFNA 4E1NA 2D0CA 3AVJA 3OYEA 3QETA 3QEWA 1N6QA 4Q0BA 3AA2A 3SJJA 4DU4A 1G15A 5KI6A 1CXQA 2E6MA 1L3VA 2HW3A 3O4NA 2HHTA 4Y1CA 1U48A 2OPQA 4N47A 2P5OA 4O44A 3U3YA 3RR8A 4DFMA 1RBRA 4RW4A 4DTRA 4FJMA 2E6LA 1RTDA 3V4IA 2B4JA 1HYZA 5HRSA 1Y97A 4CFBA 3SQ2A 3PO5A 3D45A 4O0JA 4UQGA 4DSFA 3LP2A 3VQ4A 3VA0A 3TANA 4IKFA 4CHQA 1RTIA 3ITHA 4CJPA 2B5JA 4EP5A 4BE0A 3V9WA 1NOYA 4CEFA 4CIGA 4FJJA 4FXDA 4CF2A 1WSGA 2IC3A 4KHNA 3T3FA 4C8LA 4FJ7A 4OLAA 1JLBA 2YNFA 4LH4A 4DQSA 4FLVA 1J9AA 1XWLA 1KVAA 1TKDA 2HVIA 4W5RA 4KHQA 4F4KA 4H4OA 4DQIA 1VSIA 1WAFA 3ZSZA 4M3ZA 1BISA 1TKZA 3ZT1A 3THVA 4N41A 5HBMA 4E7KA 3ZSRA 4DS4A 1TK5A 1S9GA 4CEEA 1NOZA 1RT3A 1A5VA 2IOCA 2X6SA 3NFAA 4B9TA 3I0RA 4J2AA 4FM1A 1ZBHA 1ZYQA 3ZT2A 4RW9A 1BCOA 1EX4A 3O3FA 4HHTA 2KZZA 3OYCA 1NJYA 4NCAA 5DMRA 4DF4A 1VRTA 3PUFA 3HT3A 1SKRA 4CEOA 4CHPA 1XC9A 3WNGA 1X9WA 1TL1A 4JS4A 2ZD1A 2G8HA 2P51A 1JXEA 4RW8A 1CXUA 4DU1A 3DOKA 1RT5A 3KLFA 1QSLA 3C95A 4K8XA 2OPRA 4KAZA 4GVMA 3V9ZA 3DLBA 4DSIA 1RBVA 1T7PA 4G1QA 1KLNA 4KTQA 1LWEA 3T1AA 4DQRA 1IKYA 4N5SA 2GV9A 4EP4A 4AH9A 3SQ1A 4CGHA 3RTVA 3HO1A 2XY8A 4KHYA 3ISNC 1L3TA 3WNHA 3L2VA 1J53A 4FLZA 4HCBA 4PQUA 2HHUA 5D3GA 3I8DA 5CYQA 3QNOA 1SL0A 3DLRA 3L2UA 3QNNA 1RILA 3LP0A 3SCXA 4B9NA 4B9MA 1N5YA 3VQ6A 4Z4GA 5CZ2A 3AVMA 3LP3A 3VQ7A 4KTZA 3KLIA 4CJ5A 3TABA 2VWJA 3IG1A 4C8KA 3UIQA 3M8SA 3OYDA 4M3WA 1TAUA 3T19A 1VSEA 1SKWA 4CJSA 3DLHA 3DMJA 4KV8A 4XIUA 3TI0A 3RRHA 3IS9A 3M8PA 3ASMA 1RDBA 2B6AA 3AO1A 1UA0A 3AVAA 4CF9A 5CY4A 1C0TA 4QCLA 1FKPA 3VN5A 2RPIA 3TAQA 1O1WA 3CG7A 1D8YA 4ZTFA 4IG3A 1B92A 5KTQA 3M8RA 4KREA 3LWLA 1HQUA 1LAWA 1IKWA 1NK4A 4KHSA 3LPUA 3VQBA 1KVBA 3HM9A 4KTWA 3L3VA 4NCGA 4F3TA 4CF8A 1B9FA 4F3OA 3MEEA 4TSXA 3OYIA 3NBPA 4E19A 2W42A 4JS5A 1ZBFA 4E1MA 4IFYA 1LAVA 4OKKA 1U4BA 1U49A 3BGRA 4MFBA 4CIEA 4DTUA 4CJKA 3G0ZA 4OPKA 2HNYA 3V81A 1RT7A 3RMDA 1C1BA 4OKJA 3TAMA 3OYBA 2E4LA 2OA8A 2KFZA 4ID5A 4DMNA 4Q5VA 3SZ2A 3OYNA 3ZT0A 5I3UA 3S3NA 4E7JA 5JS1A 1C6VA 4FW1A 2FC0A 1IG9A 2EX3A 3HYFA 2R7YA 2GBZA 4OJRA 3L2WA 3NE6A 1VK0A 4DG1A 1WSHA 1IO2A 1JLGA 3DOLA 3OYJA 2Y1IA 3EY1A 4WE1A 4IG0A 4NYNA 1BIZA 3KLGA 4CECA 1Q8IA 3H08A 5T7BA 3IAYA 3AO2A 4Y1DA 1LW2A 3TR8A 3KKRA 3NF8A 4F2RA 4FK4A 3JSMA 1B9DA 5HRPA 1S1UA 3D0PA 2QKBA 1A5XA 2WOMA 3KKSA 4O5BA 3SUOA 3HPGA 1JXBA 4CJRA 2DTUA 4AHSA 1X1PA 3VQQA 4DSJA 1RTJA 4C8MA 3TAPA 4HUFA 3A2FA 2QK9A 4FW2A 3NF6A 2D0AA 4LSNA 4CHNA 4RW6A 4DFKA 2Q3SA 2Z1IA 3DLEA 4LSLA 5EU7A 4M45A 3QEXA 4KHWA 3V1RA 3AA5X 4B8CA 3OY9A 2WONA 4CHYA 1RNHA 4BDZA 3KLHA 2FBTA 5J1EA 4CHOA 3NHGA 4Z4EA 1W9HA 5HROA 4BDPA 4CJUA 1RCHA 3NF9A 3HP6A 4CJWA 4CGFA 2XO7A 3TAGA 3DRSA 4DU3A 3RR7A 3QO9A 3AA3A 3OYLA 2F8TA 4GW6A 4FJ8A 3AVBA 3CM6A 1NJWA 1JL2A 3NH1A 1ZBLA 3SUPA 4ELTA 1IH7A 1JLCA 4RW7A 2YNIA 2KTQA 1L3UA 3B6PA 4DQPA 3KLEA 5J2QA 1YTAA 4C8OA 1S1VA 4DTOA 1RBTA 4CF0A 1S1XA 5HP1A 1NK9A 3O3HA 4EZ6A 4KI6A 4AHCA 1JLAA 3VQEA 5I42A 1KFSA 4DTJA 3LDSA 3MEDA 2F96A 4AILC 4FK0A 2XY5A 2O4IA 3KK1A 3ALYA 4M3YA 1JLFA 4I2PA 2GUIA 1C0MA 1NKEA 4FJKA 4BWJA 1VSKA 3AVNA 1QQCA 2D5RA 4E7HA 2OZMA 3ZT4A 2DFEA 1Q9XA 3BDPA 4L8RB 3HPHA 4FLXA 5KRSA 3KJVA 2IS3A 4J2EA 1TKTA 1YTUA 1CZBA 4CE9A 4Z4FA 3CFRA 3SNNA 4CCHA 4HTUA 1RTHA 1RDAA 3LWMA 4FM2A 1SUQA 1KLMA 1JLQA 5FRMA 4F8RA 3LPTA 2HVHA 3RMCA 1WN7A 4AHRA 4DTSA 3MXIA 3B6OA 4LH5A 4CEQA 3S9HA 4FYDA 1Q9YA 1X9SA 1S6QA 2YNHA 3AVGA 3KD5E 2HHXA 3ZSOA 4I9LA 1SL2A 4KKOA 4CFAA 4OLBA 4B08A 3K5OA 3HXMA 4DTPA 1S6PA 5J2MA 3CFOA 4PY5A 1HYSA 2HHWA 1WNSA 3SV3A 4FCYA 3VQ9A 4W5TA 1D9DA 1W0HA 4I2QA 4FZYA 1RT4A 4HUGA 1LWFA 4Z4CA 2F8SA 5J2PA 5K14A 3VQCA 3AA4A 3QERA 1L5UA 4OGCA 2VG7A 3ULDA 3KD1E 3OYFA 2VG6A 4FJ9A 2BGGA 1VSFA 1TL3A 1UA1A 2FBVA 4E3SA 4B9SA 2HNDA 4FJIA 4M3UA 2YKMA 1DTQA 1RDDA 3K58A 3RMAA 3VQ8A 1ASUA 2I5JA 2LSNA 4Z4IA 1TK0A 4FZXC 5KGWA 3KK2A 4B9LA 1DLOA 3OYGA 4F2SA 1NK8A 4M3TA 2XY6A 1KFDA 4I7FA 1D5AA 4CHZA 1I3AA 1QTMA 2QXFA 2YHAA 3O4QA 5KRTA 4E7IA 1HYVA 2BANA 2KQ2A 3C6UA 3P5JA 1SV5A 1ASVA 1KVCA 3AO5A 3AO4A 4JRPA 1FKOA 1MU2A 2P1JA 3ZSVA 4FM0A 4FJGA 5C25A 1BL3A 3DI6A 3V9UA 1JL1A 3S3OA 1BI4A 1VSMA 4DF8A 3L2QA 1XHXA 1FXXA 4J2BA 3AO3A 4CEZA 5SWMA 2YHBA 2Z1GA 3PX6A 1C0UA 2IDOA 2X78A 5C24A 2G8FA 4CGDA 4QAGA 4IBNA 1HNIA 3LZIA 4CGIA 1QSYA 4CJTA 1RBSA 3WNFA 4E0DA 2VWKA 4ICLA 2BDPA 2XHBA 3AVFA 4OPJA 1ASWA 1NJXA 4YFUA 3F73A 3QINA 2DFFA 2DFHA 3AVCA 4FJ5A 1T05A 4O55A 4PUOA 3HJFA 3K5MA 2P5GA 2D0BA 3ZSYA 2RF2A 3MECA 4H8KA 3VQPA 3LALA 4W5OA 3AV9A 4AHVA 4Z4HA 3K2PA 3NH2A 3V9SA 3EYZA 1SKSA 4KI4A 4H4MA 4KPYA 1NK0A 1HMVA 3OS0A 1S1TA 1JKHA 3NDKA 3C94A 1ZBIA 2HHVA 3AVIA 2XRIA 3V1QA 1VSLA 3G10A 4IDKA 3MAQA 4JRQA 3RRGA 2HHQA 3TAEA 1S1WA 1TKXA 4K8ZA 1LW0A 4CJLA 3NAEA 3RMBA 2ZE2A 4OKEA 1YT3A 4LD0A 4R5PA 3TWHA 1GOBA 1F21A 1T8EA 5HRNA 1QHTA 4FJNA 1BQMA 2JGUA 1XI1A 5FRNA 1RBUA 1YVUA 5HRRA 3CQ8A 2X6NA 4JLHA 1UAXA 3DLGA 3L2RA
chains in the Genus database with same CATH superfamily
4RTFD 5E41A 5M1KA 4FLTA 3TSQA 1Z26A 4K42A 3A8YA 2HOEA 4FLYA 3LZJA 3PO4A 3THWA 1I94K 4CBUA 2KZMA 3F9KA 1BWFO 5HLFA 4H5VA 4CJQA 4DSLA 3UE5A 2IIRA 3WUHA 2IVOA 3NH0A 4AHTA 5E84A 3P4IA 1NK6A 4OGEA 1N32K 4AHUA 3VQAA 3TSPA 5M1OA 1OH6A 1HRHA 5JS2A 3EZ5A 3RWUA 4FJHA 3WNEA 1BG3A 4OPHA 3SPZA 3S3MA 1WSEA 1YVNA 4BE2A 4FJLA 3E01A 4PKHA 3NGZA 3ATVA 4CEDA 1ATRA 4FWLA 4PA1A 2F9TA 1BCMA 4NCBA 4ELUA 1EKEA 1TAQA 4BC4A 1TV6A 1GOCA 3NMUA 4BRNA 4CGGA 3O3GA 4N56A 4DR2K 3LP1A 2HMIA 4I9QA 3K57A 2RHKA 3LAMA 2F7TA 3OVNA 5AQOA 4KO0A 1RT2A 4CEAA 2RN2A 3NVKA 2ATQA 4BREA 4CIFA 2FBYA 5JLFA 3KIOA 2Y1JA 4JK7A 2Z1HA 4OVLA 3L6QA 1KCFA 1WAJA 3GE1A 3VEZA 3PX0A 4JHDA 4J2DA 3U6FA 2E88A 3SUQA 3D2FA 2YJFA 4W5QA 3FR0A 4KHUA 3SBTA 3M5RA 4UY8O 1K6YA 3ZSXA 4IFVA 1NJZA 3AAPA 2Q1NA 4A5BA 3MXJA 3WXJA 2ZGYA 1RDWX 3SAFA 3HPOA 2ITGA 3SQ4A 4KBOA 1NMDA 4C23A 5EXWA 4JKEA 3O6WA 4DFJA 4DFPA 1QSSA 4MQ3A 2P9UA 4CGJA 1X9MA 4ZHRA 1IKXA 1IBLK 1N6QA 3G4SN 4AQYK 3SJJA 5KI6A 2QWLA 2E6MA 3ZEUB 4Y1CA 3U9ZA 1YXQA 4N47A 4O44A 3U3YA 3RR8A 1LOTB 3KWIA 1XC3A 3NVMA 4RW4A 3EEQA 5LY3A 1YI2N 3LP2A 3VQ4A 1G99A 3V9WA 2GELA 1QHAA 4BR5A 4CEFA 4FJJA 3PIOL 1WSGA 4KHNA 1M90O 1JLBA 1J9AA 1KVAA 4KHQA 1TKZA 3ZT1A 3W3DA 1S9GA 4CEEA 2IOCA 1ZBHA 3I0RA 4J2AA 4B3MK 3P39A 1EX4A 2W6LA 2A41A 4NCAA 4H0YB 5GAGP 1OKJA 1K8AO 1X9WA 1GLJO 4JS4A 2G8HA 4RW8A 1RT5A 3KLFA 3C95A 3WT0A 4GVMA 3V9ZA 5FPNA 2O8EA 2FLOA 3DAWA 4QS8A 1XMOK 4C1NI 2Q31A 3J81O 4KHYA 3ISNC 1L3TA 4FLZA 2F9WA 3L2VA 3HM8A 2V52B 4M7YA 2HHUA 3QNOA 5CYQA 3DLRA 3L2UA 5BN9A 1RILA 3JAMO 4B9MA 1VQ9N 4KTZA 1SKWA 2O8DA 3AO1A 1UA0A 3OBYA 4H5RA 3TAQA 1KAZA 3J7YP 4IG3A 3LWLA 3A5OC 1HQUA 1W2BM 3THXA 4NXNK 3VQBA 1BU6O 1KVBA 3HM9A 4F3TA 4IZ9A 4F3OA 1JCEA 5AQLA 3ATUA 2UUBK 2HSTA 4EAHD 2PFUA 3G0ZA 2KHOA 1RT7A 3RMDA 1C1BA 4DQ8A 3OYBA 2VQEK 4Q5VA 3OYNA 4E7JA 4CZJA 1C6VA 2FC0A 2EX3A 4BVPA 2GBZA 4HTLA 4OJRA 3O9TA 4WE1A 3N4PA 3IMXA 3A5NC 4NYNA 4CECA 3AO2A 2WBNA 3KKRA 3JSMA 1B9DA 1S1UA 4O5BA 1JXBA 1KXPA 4C8MA 3TAPA 4HUFA 3DLEA 1DT9A 5EU7A 3VMFB 3V1RA 4B8CA 3OY9A 1FW6A 3GOIA 3KLHA 2FBTA 3NHGA 5EVZA 4O5FA 2J4RA 3D2EA 3HP6A 3CC2N 4CJWA 4CGFA 3TAGA 3DRSA 3AA3A 2F8TA 4GW6A 1RGIA 3AVBA 1NJWA 3SUPA 1IH7A 2YNIA 3I55N 5IWAK 4BY9C 2QM1A 3C6AA 4EZ6A 1NK9A 4KI6A 2WTUA 3VQEA 3LDSA 3R8EA 2GEMA 3ALYA 4LF4K 5IT9O 4JI4K 2Q97A 4BWJA 2JWKA 1YITN 3O08A 4E7HA 3BDPA 1T44A 5TKWA 2IS3A 1YTUA 4BRAA 1TYQA 4OO1J 2V7ZA 3SNNA 4YY3K 4CCHA 4HTUA 1RTHA 1RDAA 3LWMA 1KLMA 3RMCA 1WN7A 3QMLA 4YORA 4CEQA 4IDHA 3S9HA 3AVGA 3KD5E 4K0KK 1SL2A 4CFAA 3BP8A 1HYSA 1S6PA 3CFOA 3R9PA 4BQLA 1D9DA 1W0HA 4FZYA 1LCUA 3P31A 2E2QA 4Z4CA 4LF6K 5GIPA 4OGCA 2VG7A 3ULDA 3OYFA 3HOTA 4IFEA 4FJIA 2GWKA 3HI0A 1RDDA 1ASUA 4DR1K 3KK2A 3OYGA 1NK8A 4I6MB 2XY6A 1S22A 1HYVA 2KQ2A 3P5JA 4AF1A 1SV5A 1KVCA 5LJWA 3F9MA 3O8MA 4JRPA 1FKOA 3ZSVA 3V9UA 1BI4A 3L2QA 4BC2A 2E2OA 4CEZA 1K8KB 5AQIA 3CI5A 1C0UA 2IDOA 3I8BA 5C24A 5JICA 4CGDA 1E4GT 4CJTA 4E0DA 2XHBA 4OPJA 3FZLA 3CETA 1NJXA 4YFUA 3AVCA 5JMVA 1ATNA 1RDUA 3U9DA 4CI6A 4DV0K 3MECA 4W5OA 3AV9A 4KI4A 5A2QO 3RVCA 4A59A 2UXCK 3NDKA 2HHVA 3C94A 3AVIA 4B1VA 3V1QA 1VSLA 4DUZK 1TKXA 4K8ZA 4LD0A 4OKEA 3TWHA 4R5PA 2FSKA 4H5TA 1QHTA 2JGUA 3THXB 1RBUA 4YHHK 4JLHA 4BGAA 4WFBL 1RFQA 4GKJK 1ATSA 3THYA 1VQLN 4O0IA 3QESA 4BE1A 1U45A 3T1HK 2G8UA 3WXIA 1LV5A 4E89A 4A2AA 5JVGL 2IAJA 1SL1A 1NJIO 3ZX0A 3P83D 4BRFA 1CZAN 4O8KA 4BR4A 3ZT3A 5AZIB 1VQMN 2ZF5O 2KW4A 3DM2A 5LJVA 4H0XB 3U3GA 3ZYYX 4FZZA 2CGLA 4PWDA 2RE2A 4LFCK 4DTNA 2UXBK 2HB5A 2PZSA 4PHTX 4CZGA 3OJSA 3MCPA 4XH1A 3MEGA 3EKUA 3G6EN 3O80A 4FO0A 1QVFM 2A1RA 3QIOA 3SYZA 3C65A 2OTLN 2E5LK 2NNWA 1J5OA 1WSJA 4DV7K 4BVOA 3JYTA 4M3XA 4LY7A 4BR7A 5AQHA 2YNGA 4JI0K 4A62A 2ASPA 1VSJA 4GMJB 4CFCA 2QW9A 2QKKA 4CK2A 4FSVA 3PIPL 4J8FA 1UOCA 5AQQA 1JLEA 5BREA 5E26A 1HKGA 1RDCA 3QEVA 4IOAL 1QQMA 3UKRA 4DQQA 3ZSWA 4B3SK 1WSFA 2VWBA 5LL6Z 4ELVA 5EOYA 1RT1A 4K43A 3DRRA 4YNQA 4CJ3A 2G8IA 4JYAK 2FSNA 3CFPA 3ENBA 1ZC6A 1QS4A 3VF4A 4CJFA 4RG8A 2Q0UA 4XH4A 5AQKA 3SAGA 4DB3A 4YOWA 4ZTJA 3H3OB 3ZEUA 1FJGK 1BIUA 1ZBUA 4DTXA 1EO1A 1D9FA 4CBWA 1NKCA 4KFBA 1XHZA 2VG5A 2JLEA 4FVMA 2E8AA 4FWKA 5EX5A 1VSHA 1UWBA 4FL9A 1QQNA 4M42A 1T03A 3UKUB 1T6DA 1BHLA 2HBMA 5FDLA 4DR7K 3QFUA 1VHXA 3MDQA 5AQZA 3KZBA 4M41A 4CFDA 1VRUA 2DY4A 3UB5A 4FJXA 3RSEA 1BGXT 3HP9A 4C8NA 5C42A 1BQNA 3TSUA 3QIPA 3HL8A 2VYPA 1QZ6A 1YHQN 1BDGA 3CQYA 1G15A 3CIPA 1CXQA 1L3VA 3WEEA 3O4NA 4DV1K 2ZJRL 2ASMA 3M3ZA 2E6LA 3ULEB 3V4IA 3HSCA 1Y97A 4CFBA 3SQ2A 3PO5A 3D45A 4H5NA 4IKFA 3WXKA 4CIGA 4FWSA 4YOUA 3LDLA 2IC3A 1DKGD 4DQSA 2NZTA 1XWLA 2HVIA 4W5RA 4F4KA 4DQIA 1WAFA 1O13A 1HX1A 4H0TB 1U2VB 1NOZA 1RT3A 3NFAA 3CHWA 4B9TA 4FM1A 1H1VA 1ZYQA 3O9QA 4DV6K 3SBGA 3OYCA 2HF3A 4DF4A 3F2KA 2ZD1A 1X3MA 4FOEA 1CXUA 1QVGM 4K8XA 3DLBA 1NU0A 4BROA 4F9OA 5HL7L 4G1QA 1KLNA 3T1AA 4DQRA 2GV9A 2YX6A 1BA1A 4AH9A 4CGHA 4YDUC 3HO1A 4GY2B 3WNHA 1W97L 4MO5A 3QNNA 1NLVA 3CJ1A 4B9NA 4GV6A 3H1VX 4Z4GA 3AVMA 3LP3A 3KLIA 4CJ5A 2O8FB 2VWJA 5AQYA 3SAHA 3QDKA 4B1YB 3UIQA 3M8SA 3OYDA 1TAUA 3THWB 3TI0A 4KV8A 1SAZA 4XIUA 3RRHA 3CCEN 3ASMA 3HOSA 3U4LA 2NRZA 3ENOA 4JAXA 3VN5A 1D8YA 2RPIA 3CG7A 3M8RA 4KH5A 5GAEP 2I7NA 1LAWA 3SK3A 4KHSA 3LPUA 3QFPA 4JI7K 4KTWA 1TUYA 3MEEA 4H5WA 4JS5A 4E1MA 1LAVA 3C7NA 4FWOA 1U4BA 1U49A 4CIEA 2HNYA 4OKJA 3TAMA 2BTFA 2OA8A 3D6RA 2KFZA 4NO7A 3ZT0A 5I3UA 4AM6A 1ZBSA 1IG9A 5BPNA 1OVQA 3L2WA 5C0YA 4DG1A 3EY1A 4H0VB 4KH4A 5H1SQ 1VQ4N 3KLGA 1X3NA 3W0LA 1NGHA 3IAYA 2QXLA 2BH1A 3MK6A 3NF8A 2HF4A 2OCEA 4FK4A 3D0PA 1A5XA 2WOMA 4JN4A 1X1PA 4BQZA 3A2FA 2Q2RA 3ID8A 1VQ6N 5AZJB 2Z1IA 3E9PA 2WONA 4K25A 3A5MC 4CHYA 4BDZA 4CHOA 4FPAA 5HROA 4B3TK 4CJUA 1RCHA 3NF9A 2OTJN 1U2VA 4E1JA 2XO7A 4ISEA 4DU3A 1XQSC 4H03B 3QO9A 4FWMA 3MN9A 3OYLA 3RR7A 4JKBA 3CM6A 1JL2A 3NH1A 1ZBLA 1JLCA 3VF6A 4RW7A 3O9RA 1L3UA 3B6PA 4DQPA 4DV3K 3CD6N 1S1VA 4CF0A 1S1XA 5HP1A 4JV5K 2HMPA 4AHCA 3ULEA 4DTJA 3MEDA 3BZCA 1KD1O 2XY5A 2O4IA 1JLFA 2GUIA 4M63C 1NKEA 3OHRA 4FJKA 1OH7A 3AVNA 3E1YA 4FVUA 3ZT4A 2DFEA 4L8RB 3HPHA 3KJVA 1QQOA 3DXMA 2CGJA 1CZBA 4CE9A 4Z4FA 3CFRA 4WQ4A 5F2RA 5FRMA 5KPRA 2D1KA 3CF5L 4DTSA 1NMNA 2HHXA 2QTDA 3AGKA 4KKOA 4A61A 2HHWA 1S3XA 3SV3A 5LMUK 3VQ9A 2UXDK 1RT4A 3WXMB 2O8EB 1NGCA 2QWMA 1HUXA 5K14A 3QERA 1N36K 2D0PA 5AQMA 3DWLA 4MLEA 1GLFO 2HNDA 4M3UA 1DTQA 1HKCA 5BPLA 1TK0A 5KGWA 3S41A 1DLOA 3O9SA 4M3TA 4I7FA 4CHZA 1QTMA 4DKWA 4FWRA 4BR9A 1ASVA 3AO5A 4B3RK 4JD2B 2P1JA 1N34K 5C25A 2NRXA 1XHXA 1FXXA 2ZWHA 1Q7YO 5SWMA 2YHBA 2X78A 2G8FA 2D4WA 2ZGZA 2P9PB 3LZIA 1QSYA 3WNFA 1NGEA 2H3GX 4ILGB 1TUUA 3J8AA 1EWRA 4MLHA 3F73A 3QINA 2DFFA 2DFHA 3HJFA 3SQ0A 4AHVA 3EYZA 5AQRA 2ZM6K 4KPYA 1S1TA 1JKHA 2QWQA 2HHQA 3RRGA 4JRQA 2FF3B 1S1WA 4CJLA 2P9UB 3RMBA 1YT3A 1T8EA 4FJNA 5FRNA 1BQMA 1YVUA 5HRRA 3CQ8A 2X6NA 3H46O 2P9IB 1UAXA 3QBWA 3AGRA 4NYFA 3PV8A 3ZCMA 4LF9K 4QS7A 1IKVA 1YF5L 2OPSA 4BG8A 1VQPN 4BR2A 1T3VA 1U04A 4BRIA 3D7EO 3LDQA 3Q7CA 4JI1K 3VQDA 5I9EB 3E66A 4PL8A 3SPYA 2UUCK 3DXMB 3FLCO 2YI1A 5CR4A 2OYQA 3K0SA 5AQWA 3OYHA 3TARA 3HK2A 3DXKA 1LWCA 3CYMA 1NK7A 3MN5A 2A1SA 2PYJA 4OX9K 3OYAA 2BE2A 3QEPA 1KRPA 1VQ5N 1E3MA 1VAZA 5AQPA 1TVRA 1TGOA 4KB1A 4GV3A 1EXQA 2RKIA 4HUEA 4IEEA 3CCQN 4FWNA 2E1ZA 1C1CA 4YOVA 4FLUA 1CZ9A 3NGIA 3L3UA 2OZSA 3SI6A 1TK8A 4CJVA 1CLQA 1YJWN 5KPZA 1OVYA 3DRPA 1NK5A 3V1OA 1L3SA 1IBKK 1HPZA 1KTQA 2YKNA 3K5NA 2Q0RA 1WLJA 3P1GA 3MWTA 3SV4A 3VGKA 3SMSA 1K8KA 3KK3A 1NGGA 3BUZB 3M8QA 4B1WB 3MN6A 4FPBA 1BI4B 2G8WA 4CD1A 3PX4A 2YHYA 4IO8A 4CERA 4RCHA 4YOYA 3J7AP 2ASOA 4N76A 5CYMA 3MXMA 4O4GA 4FK2A 2EHGA 4EHTA 2YV0X 2HBJA 5DK5A 4BC5A 1S5JA 5DM7L 3TU5A 1GLAG 3K59A 4DWIA 3C6TA 1NGIA 3FFKB 4KB0A 3AVKA 3HVRA 4DTMA 4B3OA 4Z0UA 3VERA 1HNVA 1GLCG 2WFBA 3DLKA 1NG9A 3V9XA 3NGYA 3SUNA 4DLGA 4U7BA 3ZX2A 3P38A 1DTTA 1K73O 3HVTA 5J2NA 3OJUA 3ENHA 2W40A 3VEXA 3VESA 3TPQA 4CK1A 4CJEA 3O1BA 1NNEA 1QE1A 1TYQB 4X66K 2HHSA 2KFNA 4E1NA 4WF9L 2D0CA 3AVJA 3OYEA 4IXCA 3AA2A 4WQ5A 1EWQA 4DU4A 2A40A 2HW3A 3H45C 3GL1A 1U48A 2OPQA 2QWPA 3BF3A 1GLLO 5M1PA 4DFMA 3MMVA 4A5AA 4DTRA 2FSJA 2O8FA 3CMAN 2B4JA 4JI8K 4O0JA 4BC3A 3TANA 3IFRA 3ITHA 4CJPA 4EP5A 3N4QA 4BE0A 3SMPA 4XEIA 1NOYA 1ESVA 3MWPA 3OTOK 1Z6RA 3L0QA 4FJ7A 4LH4A 4FLVA 1TKDA 5AJ3K 2E2NA 4H4OA 3CCMN 4G9ZA 1J5EK 4M3ZA 4N41A 4BGBA 2IVNA 5HBMA 4E7KA 4EFHA 2VCPA 5AQUA 3ZSRA 4DS4A 3PY8A 3D2EB 4L3QA 3GG4A 1NGDA 4DR3K 4C1NK 2E1YA 3ZT2A 4NLBA 3J7ZO 1BCOA 3O3FA 4HHTA 1NJYA 5DMRA 1JJ2M 4CEOA 3DLLL 1VQ8N 1TL1A 4CZHA 2P51A 1JXEA 4DU1A 3T1YK 1R59O 3DOKA 3ZETB 3VPZA 2OPRA 4KAZA 3CJAA 1RBVA 4R79A 4MDAA 1LWEA 1IKYA 1IV0A 4CJ7A 3RTVA 2XY8A 4H0OA 4O8UA 5D3GA 5FPEA 3LP0A 3VQ6A 5CZ2A 3VTHA 3VQ7A 4BRMA 3IG1A 2P9LA 4C8KA 3DLHA 1DEJA 2DPNA 2O8BA 3IS9A 2B6AA 3WEEB 2P9KA 5CY4A 3IDHA 1C0TA 1FKPA 1O1WA 4ZTFA 1B92A 4KREA 4BR0A 2UU9K 3OW2M 4JK9A 1KAYA 1NK4A 5C2DA 4IJNA 3I56N 3PSIA 4BRDA 3L3VA 3RSEB 4NCGA 5DM6L 4CF8A 4IO9L 1B9FA 4RWTA 4TSXA 4DHYA 3OYIA 1ZBFA 4JKAA 3BGRA 4OPKA 3UKUA 5C15A 5EY4A 3EKSA 3CCJN 4ID5A 4A57A 3CJBA 3BY5A 5AQXA 4CZKA 3SZ2A 2FF6A 5AQGA 2O8CB 5JS1A 4FW1A 2Q36A 3NE6A 1VK0A 2P9SB 1C0FA 1WSHA 3OYJA 4GVEA 2JWLA 2NRRA 1Q8IA 4MDBA 4Y1DA 3TR8A 1LW2A 4KH6A 3EE9A 3WQUA 4DCHA 5HRPA 2QKBA 4AM7A 2E2PA 3HPGA 5AFUH 2DTUA 4AHSA 1RTJA 2QK9A 2VQFK 3NF6A 4CHNA 1GLBG 4RW6A 4V19S 4M45A 3PLAA 2VGNA 3AA5X 3A0IX 3UKRB 1W9HA 3CERA 2VGMA 3LDPA 3CJ9A 4FOIA 1VQKN 1OH8A 3AARA 5TKYA 4CZLA 1WBBA 4CZIA 1NGAA 5KQ8A 2KTQA 5J2QA 1YTAA 4CZEA 4DTOA 4CZMA 1RBTA 3O3HA 4DV4K 1JLAA 1KFSA 1MA9B 3OA9A 2F96A 4AILC 3QB0A 4FK0A 3L4QA 3KK1A 3CCVN 4M3YA 2QEXN 1C0MA 5LMNK 1QQCA 1J6ZA 2D5RA 2OZMA 3SJHA 3VOVA 2QWOA 3FZKA 4FLXA 4J2EA 4JI2K 3LDOA 3EN9A 1VQNN 1SUQA 5AZIA 3LPTA 2HVHA 1WOQA 4JI6K 4AHRA 1DGKN 3CC7N 3MXIA 4LH5A 4FYDA 1Q9YA 1X9SA 2YNHA 4I9LA 1K9MO 3TTCA 4GKKK 3CMEN 4LF5K 1JCFA 4K41A 5J2MA 3ZLJA 1WNSA 2OANA 2CGKA 4FCYA 4W5TA 3THYB 1GLEG 4I2QA 3VTIA 4HUGA 2ZJPL 1LWFA 4XH5A 3QICA 2F8SA 3VQCA 3AA4A 3WQTA 3LL3A 3KD1E 2BGGA 1UA1A 4CW7B 2FBVA 3MX5A 3VQ8A 2LSNA 2I5JA 1Q18A 1NBWA 3R6MA 3M1FA 4ISGA 4FZXC 3M6GA 4F2SA 5C2FA 3CCSN 2YHAA 3O4QA 5KRTA 2BANA 3C6UA 5BRFA 4FM0A 4BRHA 1BL3A 3DI6A 1JL1A 1VSMA 5AQTA 3VGMA 1YAGA 1P8ZA 1HR0K 4IWVA 2AA4A 3EE8A 4IBNA 5F0XA 1HNIA 3O5BA 4CGIA 3FZFA 3AVFA 3CJCA 4JI5K 4DV5K 1WUAA 4FJ5A 2W6KA 4PUOA 5BR9A 3K5MA 2P5GA 2D0BA 2QWNA 1YJ9N 2RF2A 3V9SA 3LALA 4Z4HA 1JCGA 5BRDA 1SKSA 2D0OA 4H4MA 4I6MA 3OS0A 1HPMA 2GUPA 2YHWA 2XRIA 3G10A 4IDKA 3MAQA 2GWJA 3TAEA 3NAEA 2ZE2A 2HHHK 2F4VK 3VENA 4JKDA 3IRXA 4HCCA 1KSPA 4B9VA 1ITGA 3AVHA 2HBKA 4BRGA 2P9NA 3VQ5A 4U67L 1NWKA 1FK9A 1EQYA 1RT6A 3E9LA 4DUYK 4YDUA 4BDYA 3O9UA 4DS5A 1OH5A 3OS2A 2HBLA 3OYKA 4LF7K 3BF1A 4DLEA 2G8VA 2QA4N 1KC8O 4NB4A 3ZSQA 4CZFA 2ETJA 1S9EA 3K9JA 3MN7A 4CJ4A 3OS1A 3AY9A 1VSDA 2KKZA 5M1QA 4KHPK 5CHIA 4B9UA 2ZQBA 3H3NO 3LAKA 3R3LA 5GADP 4W5NA 5B8HA 2HNZA 4ID1A 4B1UB 5KGXA 2G8KA 2PYLA 4B9QA 5CZ1A 4HVJA 5FROA 4FLWA 4QOZB 2CH6A 2X74A 1BA0A 1R0AA 3I33A 1HLUA 2OPPA 2FBXA 4KRFA 4LFBK 2PBDA 4E7LA 2PAVA 3LM2A 3KTQA 2AJQA 1Z25A 5KPTA 3OYMA 3HSTB 1EP4A 3OBWA 1C1AA 2NLXA 3H1QA 3V6DA 4B8AB 2IGIA 3I0SA 2XY7A 4BWMA 4CESA 4DSEA 1HKBA 1U47A 3DYAA 4DSKA 2NRWA 5C12A 1XUPO 3O1WA 4WCEL 5JLHA 3K5LA 1REVA 2PY5A 3NF7A 1YJNN 3TAFA 1M1KO 2O4GA 3HZ6A 4EZ9A 4JEPA 4CF1A 4CBXA 1WSIA 4GNIA 1HQEA 1SQKA 3MCAB 3FE1A 1Z05A 3VA3A 4IEIA 3L8BA 1NKBA 1I39A 4DR5K 5ADXA 4CEBA 3LDNA 4JI3K 4YOTA 2P9NB 4JKFA 1EETA 3QLHA 3QEIA 3AVLA 3GDQA 4QS9A 1HJRA 4DR6K 1J54A 2QI2A 4BACA 3CM5A 5SZTA 1Q82O 4CK3A 3LANA 3ID6A 4M3RA 1A5WA 2Z1JA 3FFIA 3NCIA 4X62K 1MWMA 2NUBA 4IOXA 1GOAA 1V4TA 5AFUA 3WXLA 3QETA 3IUCA 3QEWA 3PSFA 1HNXK 4Q0BA 3T7ZA 3CCLN 1WB9A 2HHTA 2P5OA 2O8DB 5BN8A 1SZ2A 1Q86O 1RBRA 4FJMA 1RTDA 1HYZA 5HRSA 4UQGA 4DSFA 5C10A 3VA0A 4WFNL 4CHQA 1RTIA 3J80O 4WQ4C 2B5JA 3LM9A 2ZJQL 2KLAA 4FXDA 4CF2A 3KWGA 4FWPA 5FPMA 5AR0A 3T3FA 4C8LA 4OLAA 2YNFA 3HBTA 4IOCL 4GV9A 5FLXO 3JXUA 4H0PA 1VSIA 3ZSZA 1BISA 3THVA 4WFAL 1TK5A 3CC4N 2NRTA 1A5VA 2X6SA 4FWQA 4RW9A 4PKGA 2KZZA 1XNQK 3CJ7A 1SKRA 1VRTA 3PUFA 3HT3A 4PKIA 4CHPA 1XC9A 3WNGA 1QSLA 1YIJN 4DSIA 1T7PA 3CQXA 4KTQA 3VEWA 4N5SA 5ADXH 3VETA 4EP4A 3K9KA 3SQ1A 3DXKB 2NRVA 4JNEA 4IJAA 1HJOA 4JK8A 4HCBA 1J53A 4PQUA 1E4FT 3I8DA 1SL0A 3CCRN 3SCXA 3FZMA 4B1XB 1N5YA 3TABA 1Y64A 1VQ7N 4B1ZA 4EHUA 4M3WA 3C6HA 3T19A 1VSEA 4CJSA 3DMJA 5AQNA 3M8PA 1RDBA 4Y0WA 3AVAA 4CF9A 3EO3A 4QCLA 5KTQA 4A2BA 1S72N 1QZ5A 2YCHA 5CE3A 1IKWA 1P90A 2P9IA 4JKGA 3VEYA 4JKHA 4OPAA 4WYBA 3G25A 4JKGB 4EIAA 5FPDA 4HWIA 3NBPA 4E19A 2W42A 4DR4K 4IFYA 4OKKA 2A5XA 4NXMK 1GLDG 4MFBA 4DTUA 4CJKA 3V81A 3CPWM 4BRKA 2E4LA 3KVGA 3KHYA 4DMNA 2IVPA 3S3NA 2GX9A 4ILHA 3HYFA 2R7YA 3D2FB 1U6ZA 2V51B 3TTDA 3DOLA 1IO2A 1JLGA 5AQSA 2Y1IA 4IG0A 1BIZA 4PL7A 3H08A 5T7BA 4JHDB 2P9PA 3JS6A 3IKMA 3U8XA 4F2RA 3FGUA 1D4XA 1YUWA 3KKSA 3SUOA 4ILJA 4CJRA 3VQQA 4DSJA 4FW2A 2D0AA 4JD2A 4LSNA 1KQSM 4DFKA 2Q3SA 4LSLA 1HNZK 3VEVA 5JVHL 3QEXA 2YHXA 4KHWA 2UYTA 1RNHA 2WUSA 1T6CA 5AQJA 3KK7A 5J1EA 4Z4EA 3TTFA 5M1FA 1MDUB 4BDPA 3T69A 1N8RO 1IG8A 2P9SA 1IJJA 3AAQA 2AP1A 3E9OA 1C0GA 4FJ8A 2O8CA 4ISFA 3SLCA 3G71N 4BRQA 4ELTA 1XMQK 3BZKA 4NLCA 2A6AA 4CVNE 2E20A 3ZX3A 1BOTO 3KLEA 4LF8K 4C8OA 3MX2A 2W41A 5AQFA 5I42A 3FZHA 1BUPA 4MO4A 4I2PA 4Z94A 2UUAK 1VSKA 1NGBA 3C0BA 3CPEA 1Q9XA 2P9KB 5KRSA 1TKTA 4M7XA 5M1NA 2O8BB 4FM2A 3CCUN 2P9LB 1JLQA 3Q7BA 5GIOA 4F8RA 2V7YA 2NRHA 5ELZA 5F1XA 2YJEA 4DV2K 3B6OA 1S6QA 3QBXA 3ZSOA 4OLBA 4B08A 3K5OA 5KQDA 3HXMA 4DTPA 4PY5A 4LFAK 3EL2A 1NGJA 3R1XA 2CH5A 1W7AA 5J2PA 1HNWK 1L5UA 4BRCA 4X65K 3DJCA 3EZWA 4FJ9A 2VG6A 3VGLA 1VSFA 1TL3A 5BPMA 4B9SA 4E3SA 3ZETA 4JKCA 1XNRK 1KAXA 2YKMA 3K58A 3RMAA 4Z4IA 2QWRA 1Q81O 1N33K 4B9LA 3HTVA 2A3ZA 1KFDA 4BRLA 1D5AA 1I3AA 2EWSA 3VEOA 2QXFA 4E7IA 3AO4A 5AZJA 1MU2A 4FJGA 2A42A 4WQ5C 1NGFA 3VF2A 3S3OA 4DF8A 1V4SA 5BRHA 4YOXA 4J2BA 4BRPA 1VQON 3AO3A 3PX6A 2Z1GA 3L4IA 3H6EA 5AQVA 5BR8K 4QAGA 1X9JA 1BO5O 5HOOA 1RBSA 2VWKA 4ICLA 2ITMA 5GINA 2BDPA 1ASWA 3HRGA 4X64K 3GBTA 4BG9A 3CXCM 1T05A 4O55A 1IBMK 3B8AX 3ZSYA 2GTDA 4H8KA 3VQPA 3NH2A 3F5TA 3K2PA 1WBDA 1NM1A 2I7PA 4LC9B 1NK0A 1HMVA 3BEXA 1ZBIA 2BUPA 3C7NB 3O4WA 1LW0A 1ILYA 5GAHP 1ZXOA 2WC9A 1GOBA 1F21A 1SS6A 5HRNA 1XI1A 3A5LC 1MWKA 2FXUA 4CD3A 3DLGA 3L2RA 5MLCQ
chains in the Genus database with same CATH topology
4NYFA 3PV8A 5E41A 3IRXA 4O0IA 4HCCA 3QESA 3ZCMA 1KSPA 4B9VA 4BE1A 1U45A 2G8UA 1ITGA 4FLTA 3AVHA 1IKVA 2OPSA 4E89A 1LV5A 3VQ5A 1Z26A 2IAJA 1FK9A 1RT6A 1SL1A 3PO4A 4FLYA 3LZJA 3P83D 1U04A 4BDYA 3ZT3A 4DS5A 2KW4A 3DM2A 2KZMA 3F9KA 5HLFA 3VQDA 3OS2A 3OYKA 3U3GA 4FZZA 4CJQA 4PWDA 4DSLA 4DLEA 3SPYA 2G8VA 4DTNA 2HB5A 3NH0A 3ZSQA 4AHTA 2PZSA 2OYQA 1NK6A 3OYHA 2ETJA 4OGEA 1S9EA 4KB1A 4AHUA 3TARA 3HK2A 3VQAA 4CJ4A 3OS1A 1VSDA 3OJSA 3MEGA 1LWCA 3CYMA 1NK7A 4B9UA 1HRHA 2ZQBA 2A1SA 3QIOA 5JS2A 2A1RA 3LAKA 3SYZA 2PYJA 3OYAA 4W5NA 2BE2A 3EZ5A 3QEPA 3RWUA 3WNEA 4FJHA 2HNZA 1J5OA 1KRPA 3SPZA 4ID1A 1TVRA 5KGXA 1TGOA 3S3MA 2G8KA 1WSEA 1EXQA 1WSJA 2RKIA 4HUEA 5CZ1A 4BE2A 2PYLA 3JYTA 4HVJA 5FROA 4FLWA 4M3XA 4FJLA 3E01A 4QOZB 1C1CA 4LY7A 2X74A 3NGZA 4CEDA 4FLUA 2YNGA 4PA1A 1CZ9A 1R0AA 1BCMA 3NGIA 4NCBA 2OPPA 3L3UA 2OZSA 4ELUA 1EKEA 3SI6A 1TAQA 2FBXA 1VSJA 4GMJB 4CFCA 4CJVA 1TK8A 4KRFA 1CLQA 1TV6A 2QKKA 4CK2A 1GOCA 3DRPA 4E7LA 1UOCA 3KTQA 1NK5A 1JLEA 2AJQA 3V1OA 1Z25A 1L3SA 4CGGA 1HPZA 1KTQA 1RDCA 3O3GA 2YKNA 3HSTB 4N56A 3LP1A 3OYMA 3QEVA 2HMIA 4DQQA 1EP4A 3K57A 4I9QA 3LAMA 3K5NA 1C1AA 1WLJA 3ZSWA 1WSFA 3OVNA 3P1GA 4KO0A 1RT2A 2IGIA 2RN2A 4B8AB 4CEAA 2ATQA 4ELVA 1RT1A 3SV4A 3I0SA 3DRRA 4YNQA 4CIFA 2FBYA 2XY7A 4BWMA 3KK3A 3SQ0A 4CESA 4CJ3A 4DSEA 1U47A 3DYAA 3M8QA 4DSKA 2G8IA 3KIOA 2Y1JA 1BI4B 2G8WA 2Z1HA 4OVLA 3K5LA 3CFPA 3PX4A 1REVA 2PY5A 1KCFA 1QS4A 1WAJA 4CJFA 4RG8A 4CERA 3NF7A 3TAFA 2O4GA 3PX0A 4N76A 4ZTJA 5CYMA 4EZ9A 3MXMA 4CF1A 1WSIA 1BIUA 1ZBUA 4O4GA 4DTXA 4FK2A 2EHGA 4J2DA 1HQEA 2YV0X 3U6FA 5DK5A 1D9FA 1S5JA 3SUQA 1NKCA 4KFBA 1XHZA 3VA3A 2VG5A 3L8BA 4W5QA 3K59A 1NKBA 4DWIA 3C6TA 1I39A 2JLEA 4KB0A 4KHUA 4FVMA 3AVKA 4CEBA 3HVRA 4DTMA 4B3OA 1K6YA 4Z0UA 3ZSXA 1HNVA 1VSHA 3DLKA 1UWBA 4IFVA 1NJZA 3V9XA 3NGYA 3SUNA 4M42A 1EETA 3QLHA 3QEIA 1T03A 1BHLA 3MXJA 3AVLA 5FDLA 3HPOA 4DLGA 2ITGA 3SQ4A 1HJRA 4M41A 1J54A 4CFDA 4BACA 3CM5A 5SZTA 1DTTA 1VRUA 3LANA 4CK3A 4DFJA 4DFPA 2DY4A 4M3RA 3HVTA 1A5WA 2Z1JA 3FFIA 3OJUA 3NCIA 5J2NA 3V6DA 1BGXT 4FJXA 3PY8A 2NUBA 3HP9A 4C8NA 1QSSA 5C42A 1BQNA 4CK1A 1GOAA 4CJEA 4MQ3A 4CGJA 1X9MA 3QIPA 1QE1A 3HL8A 4ZHRA 1IKXA 2HHSA 2KFNA 4E1NA 2D0CA 3AVJA 3OYEA 3QETA 3QEWA 1N6QA 4Q0BA 3AA2A 3SJJA 4DU4A 1G15A 5KI6A 1CXQA 2E6MA 1L3VA 2HW3A 3O4NA 2HHTA 4Y1CA 1U48A 2OPQA 4N47A 2P5OA 4O44A 3U3YA 3RR8A 4DFMA 1RBRA 4RW4A 4DTRA 4FJMA 2E6LA 1RTDA 3V4IA 2B4JA 1HYZA 5HRSA 1Y97A 4CFBA 3SQ2A 3PO5A 3D45A 4O0JA 4UQGA 4DSFA 3LP2A 3VQ4A 3VA0A 3TANA 4IKFA 4CHQA 1RTIA 3ITHA 4CJPA 2B5JA 4EP5A 4BE0A 3V9WA 1NOYA 4CEFA 4CIGA 4FJJA 4FXDA 4CF2A 1WSGA 2IC3A 4KHNA 3T3FA 4C8LA 4FJ7A 4OLAA 1JLBA 2YNFA 4LH4A 4DQSA 4FLVA 1J9AA 1XWLA 1KVAA 1TKDA 2HVIA 4W5RA 4KHQA 4F4KA 4H4OA 4DQIA 1VSIA 1WAFA 3ZSZA 4M3ZA 1BISA 1TKZA 3ZT1A 3THVA 4N41A 5HBMA 4E7KA 3ZSRA 4DS4A 1TK5A 1S9GA 4CEEA 1NOZA 1RT3A 1A5VA 2IOCA 2X6SA 3NFAA 4B9TA 3I0RA 4J2AA 4FM1A 1ZBHA 1ZYQA 3ZT2A 4RW9A 1BCOA 1EX4A 3O3FA 4HHTA 2KZZA 3OYCA 1NJYA 4NCAA 5DMRA 4DF4A 1VRTA 3PUFA 3HT3A 1SKRA 4CEOA 4CHPA 1XC9A 3WNGA 1X9WA 1TL1A 4JS4A 2ZD1A 2G8HA 2P51A 1JXEA 4RW8A 1CXUA 4DU1A 3DOKA 1RT5A 3KLFA 1QSLA 3C95A 4K8XA 2OPRA 4KAZA 4GVMA 3V9ZA 3DLBA 4DSIA 1RBVA 1T7PA 4G1QA 1KLNA 4KTQA 1LWEA 3T1AA 4DQRA 1IKYA 4N5SA 2GV9A 4EP4A 4AH9A 3SQ1A 4CGHA 3RTVA 3HO1A 2XY8A 4KHYA 3ISNC 1L3TA 3WNHA 3L2VA 1J53A 4FLZA 4HCBA 4PQUA 2HHUA 5D3GA 3I8DA 5CYQA 3QNOA 1SL0A 3DLRA 3L2UA 3QNNA 1RILA 3LP0A 3SCXA 4B9NA 4B9MA 1N5YA 3VQ6A 4Z4GA 5CZ2A 3AVMA 3LP3A 3VQ7A 4KTZA 3KLIA 4CJ5A 3TABA 2VWJA 3IG1A 4C8KA 3UIQA 3M8SA 3OYDA 4M3WA 1TAUA 3T19A 1VSEA 1SKWA 4CJSA 3DLHA 3DMJA 4KV8A 4XIUA 3TI0A 3RRHA 3IS9A 3M8PA 3ASMA 1RDBA 2B6AA 3AO1A 1UA0A 3AVAA 4CF9A 5CY4A 1C0TA 4QCLA 1FKPA 3VN5A 2RPIA 3TAQA 1O1WA 3CG7A 1D8YA 4ZTFA 4IG3A 1B92A 5KTQA 3M8RA 4KREA 3LWLA 1HQUA 1LAWA 1IKWA 1NK4A 4KHSA 3LPUA 3VQBA 1KVBA 3HM9A 4KTWA 3L3VA 4NCGA 4F3TA 4CF8A 1B9FA 4F3OA 3MEEA 4TSXA 3OYIA 3NBPA 4E19A 2W42A 4JS5A 1ZBFA 4E1MA 4IFYA 1LAVA 4OKKA 1U4BA 1U49A 3BGRA 4MFBA 4CIEA 4DTUA 4CJKA 3G0ZA 4OPKA 2HNYA 3V81A 1RT7A 3RMDA 1C1BA 4OKJA 3TAMA 3OYBA 2E4LA 2OA8A 2KFZA 4ID5A 4DMNA 4Q5VA 3SZ2A 3OYNA 3ZT0A 5I3UA 3S3NA 4E7JA 5JS1A 1C6VA 4FW1A 2FC0A 1IG9A 2EX3A 3HYFA 2R7YA 2GBZA 4OJRA 3L2WA 3NE6A 1VK0A 4DG1A 1WSHA 1IO2A 1JLGA 3DOLA 3OYJA 2Y1IA 3EY1A 4WE1A 4IG0A 4NYNA 1BIZA 3KLGA 4CECA 1Q8IA 3H08A 5T7BA 3IAYA 3AO2A 4Y1DA 1LW2A 3TR8A 3KKRA 3NF8A 4F2RA 4FK4A 3JSMA 1B9DA 5HRPA 1S1UA 3D0PA 2QKBA 1A5XA 2WOMA 3KKSA 4O5BA 3SUOA 3HPGA 1JXBA 4CJRA 2DTUA 4AHSA 1X1PA 3VQQA 4DSJA 1RTJA 4C8MA 3TAPA 4HUFA 3A2FA 2QK9A 4FW2A 3NF6A 2D0AA 4LSNA 4CHNA 4RW6A 4DFKA 2Q3SA 2Z1IA 3DLEA 4LSLA 5EU7A 4M45A 3QEXA 4KHWA 3V1RA 3AA5X 4B8CA 3OY9A 2WONA 4CHYA 1RNHA 4BDZA 3KLHA 2FBTA 5J1EA 4CHOA 3NHGA 4Z4EA 1W9HA 5HROA 4BDPA 4CJUA 1RCHA 3NF9A 3HP6A 4CJWA 4CGFA 2XO7A 3TAGA 3DRSA 4DU3A 3RR7A 3QO9A 3AA3A 3OYLA 2F8TA 4GW6A 4FJ8A 3AVBA 3CM6A 1NJWA 1JL2A 3NH1A 1ZBLA 3SUPA 4ELTA 1IH7A 1JLCA 4RW7A 2YNIA 2KTQA 1L3UA 3B6PA 4DQPA 3KLEA 5J2QA 1YTAA 4C8OA 1S1VA 4DTOA 1RBTA 4CF0A 1S1XA 5HP1A 1NK9A 3O3HA 4EZ6A 4KI6A 4AHCA 1JLAA 3VQEA 5I42A 1KFSA 4DTJA 3LDSA 3MEDA 2F96A 4AILC 4FK0A 2XY5A 2O4IA 3KK1A 3ALYA 4M3YA 1JLFA 4I2PA 2GUIA 1C0MA 1NKEA 4FJKA 4BWJA 1VSKA 3AVNA 1QQCA 2D5RA 4E7HA 2OZMA 3ZT4A 2DFEA 1Q9XA 3BDPA 4L8RB 3HPHA 4FLXA 5KRSA 3KJVA 2IS3A 4J2EA 1TKTA 1YTUA 1CZBA 4CE9A 4Z4FA 3CFRA 3SNNA 4CCHA 4HTUA 1RTHA 1RDAA 3LWMA 4FM2A 1SUQA 1KLMA 1JLQA 5FRMA 4F8RA 3LPTA 2HVHA 3RMCA 1WN7A 4AHRA 4DTSA 3MXIA 3B6OA 4LH5A 4CEQA 3S9HA 4FYDA 1Q9YA 1X9SA 1S6QA 2YNHA 3AVGA 3KD5E 2HHXA 3ZSOA 4I9LA 1SL2A 4KKOA 4CFAA 4OLBA 4B08A 3K5OA 3HXMA 4DTPA 1S6PA 5J2MA 3CFOA 4PY5A 1HYSA 2HHWA 1WNSA 3SV3A 4FCYA 3VQ9A 4W5TA 1D9DA 1W0HA 4I2QA 4FZYA 1RT4A 4HUGA 1LWFA 4Z4CA 2F8SA 5J2PA 5K14A 3VQCA 3AA4A 3QERA 1L5UA 4OGCA 2VG7A 3ULDA 3KD1E 3OYFA 2VG6A 4FJ9A 2BGGA 1VSFA 1TL3A 1UA1A 2FBVA 4E3SA 4B9SA 2HNDA 4FJIA 4M3UA 2YKMA 1DTQA 1RDDA 3K58A 3RMAA 3VQ8A 1ASUA 2I5JA 2LSNA 4Z4IA 1TK0A 4FZXC 5KGWA 3KK2A 4B9LA 1DLOA 3OYGA 4F2SA 1NK8A 4M3TA 2XY6A 1KFDA 4I7FA 1D5AA 4CHZA 1I3AA 1QTMA 2QXFA 2YHAA 3O4QA 5KRTA 4E7IA 1HYVA 2BANA 2KQ2A 3C6UA 3P5JA 1SV5A 1ASVA 1KVCA 3AO5A 3AO4A 4JRPA 1FKOA 1MU2A 2P1JA 3ZSVA 4FM0A 4FJGA 5C25A 1BL3A 3DI6A 3V9UA 1JL1A 3S3OA 1BI4A 1VSMA 4DF8A 3L2QA 1XHXA 1FXXA 4J2BA 3AO3A 4CEZA 5SWMA 2YHBA 2Z1GA 3PX6A 1C0UA 2IDOA 2X78A 5C24A 2G8FA 4CGDA 4QAGA 4IBNA 1HNIA 3LZIA 4CGIA 1QSYA 4CJTA 1RBSA 3WNFA 4E0DA 2VWKA 4ICLA 2BDPA 2XHBA 3AVFA 4OPJA 1ASWA 1NJXA 4YFUA 3F73A 3QINA 2DFFA 2DFHA 3AVCA 4FJ5A 1T05A 4O55A 4PUOA 3HJFA 3K5MA 2P5GA 2D0BA 3ZSYA 2RF2A 3MECA 4H8KA 3VQPA 3LALA 4W5OA 3AV9A 4AHVA 4Z4HA 3K2PA 3NH2A 3V9SA 3EYZA 1SKSA 4KI4A 4H4MA 4KPYA 1NK0A 1HMVA 3OS0A 1S1TA 1JKHA 3NDKA 3C94A 1ZBIA 2HHVA 3AVIA 2XRIA 3V1QA 1VSLA 3G10A 4IDKA 3MAQA 4JRQA 3RRGA 2HHQA 3TAEA 1S1WA 1TKXA 4K8ZA 1LW0A 4CJLA 3NAEA 3RMBA 2ZE2A 4OKEA 1YT3A 4LD0A 4R5PA 3TWHA 1GOBA 1F21A 1T8EA 5HRNA 1QHTA 4FJNA 1BQMA 2JGUA 1XI1A 5FRNA 1RBUA 1YVUA 5HRRA 3CQ8A 2X6NA 4JLHA 1UAXA 3DLGA 3L2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NYF A;  3PV8 A;  5E41 A;  3IRX A;  4O0I A;  4HCC A;  3QES A;  3ZCM A;  1KSP A;  4B9V A;  4BE1 A;  1U45 A;  2G8U A;  1ITG A;  4FLT A;  3AVH A;  1IKV A;  2OPS A;  4E89 A;  1LV5 A;  3VQ5 A;  1Z26 A;  2IAJ A;  1FK9 A;  1RT6 A;  1SL1 A;  3PO4 A;  4FLY A;  3LZJ A;  3P83 D;  1U04 A;  4BDY A;  3ZT3 A;  4DS5 A;  2KW4 A;  3DM2 A;  2KZM A;  3F9K A;  5HLF A;  3VQD A;  3OS2 A;  3OYK A;  3U3G A;  4FZZ A;  4CJQ A;  4PWD A;  4DSL A;  4DLE A;  3SPY A;  2G8V A;  4DTN A;  2HB5 A;  3NH0 A;  3ZSQ A;  4AHT A;  2PZS A;  2OYQ A;  1NK6 A;  3OYH A;  2ETJ A;  4OGE A;  1S9E A;  4KB1 A;  4AHU A;  3TAR A;  3HK2 A;  3VQA A;  4CJ4 A;  3OS1 A;  1VSD A;  3OJS A;  3MEG A;  1LWC A;  3CYM A;  1NK7 A;  4B9U A;  1HRH A;  2ZQB A;  2A1S A;  3QIO A;  5JS2 A;  2A1R A;  3LAK A;  3SYZ A;  2PYJ A;  3OYA A;  4W5N A;  2BE2 A;  3EZ5 A;  3QEP A;  3RWU A;  3WNE A;  4FJH A;  2HNZ A;  1J5O A;  1KRP A;  3SPZ A;  4ID1 A;  1TVR A;  5KGX A;  1TGO A;  3S3M A;  2G8K A;  1WSE A;  1EXQ A;  1WSJ A;  2RKI A;  4HUE A;  5CZ1 A;  4BE2 A;  2PYL A;  3JYT A;  4HVJ A;  5FRO A;  4FLW A;  4M3X A;  4FJL A;  3E01 A;  4QOZ B;  1C1C A;  4LY7 A;  2X74 A;  3NGZ A;  4CED A;  4FLU A;  2YNG A;  4PA1 A;  1CZ9 A;  1R0A A;  1BCM A;  3NGI A;  4NCB A;  2OPP A;  3L3U A;  2OZS A;  4ELU A;  1EKE A;  3SI6 A;  1TAQ A;  2FBX A;  1VSJ A;  4GMJ B;  4CFC A;  4CJV A;  1TK8 A;  4KRF A;  1CLQ A;  1TV6 A;  2QKK A;  4CK2 A;  1GOC A;  3DRP A;  4E7L A;  1UOC A;  3KTQ A;  1NK5 A;  1JLE A;  2AJQ A;  3V1O A;  1Z25 A;  1L3S A;  4CGG A;  1HPZ A;  1KTQ A;  1RDC A;  3O3G A;  2YKN A;  3HST B;  4N56 A;  3LP1 A;  3OYM A;  3QEV A;  2HMI A;  4DQQ A;  1EP4 A;  3K57 A;  4I9Q A;  3LAM A;  3K5N A;  1C1A A;  1WLJ A;  3ZSW A;  1WSF A;  3OVN A;  3P1G A;  4KO0 A;  1RT2 A;  2IGI A;  2RN2 A;  4B8A B;  4CEA A;  2ATQ A;  4ELV A;  1RT1 A;  3SV4 A;  3I0S A;  3DRR A;  4YNQ A;  4CIF A;  2FBY A;  2XY7 A;  4BWM A;  3KK3 A;  3SQ0 A;  4CES A;  4CJ3 A;  4DSE A;  1U47 A;  3DYA A;  3M8Q A;  4DSK A;  2G8I A;  3KIO A;  2Y1J A;  1BI4 B;  2G8W A;  2Z1H A;  4OVL A;  3K5L A;  3CFP A;  3PX4 A;  1REV A;  2PY5 A;  1KCF A;  1QS4 A;  1WAJ A;  4CJF A;  4RG8 A;  4CER A;  3NF7 A;  3TAF A;  2O4G A;  3PX0 A;  4N76 A;  4ZTJ A;  5CYM A;  4EZ9 A;  3MXM A;  4CF1 A;  1WSI A;  1BIU A;  1ZBU A;  4O4G A;  4DTX A;  4FK2 A;  2EHG A;  4J2D A;  1HQE A;  2YV0 X;  3U6F A;  5DK5 A;  1D9F A;  1S5J A;  3SUQ A;  1NKC A;  4KFB A;  1XHZ A;  3VA3 A;  2VG5 A;  3L8B A;  4W5Q A;  3K59 A;  1NKB A;  4DWI A;  3C6T A;  1I39 A;  2JLE A;  4KB0 A;  4KHU A;  4FVM A;  3AVK A;  4CEB A;  3HVR A;  4DTM A;  4B3O A;  1K6Y A;  4Z0U A;  3ZSX A;  1HNV A;  1VSH A;  3DLK A;  1UWB A;  4IFV A;  1NJZ A;  3V9X A;  3NGY A;  3SUN A;  4M42 A;  1EET A;  3QLH A;  3QEI A;  1T03 A;  1BHL A;  3MXJ A;  3AVL A;  5FDL A;  3HPO A;  4DLG A;  2ITG A;  3SQ4 A;  1HJR A;  4M41 A;  1J54 A;  4CFD A;  4BAC A;  3CM5 A;  5SZT A;  1DTT A;  1VRU A;  3LAN A;  4CK3 A;  4DFJ A;  4DFP A;  2DY4 A;  4M3R A;  3HVT A;  1A5W A;  2Z1J A;  3FFI A;  3OJU A;  3NCI A;  5J2N A;  3V6D A;  1BGX T;  4FJX A;  3PY8 A;  2NUB A;  3HP9 A;  4C8N A;  1QSS A;  5C42 A;  1BQN A;  4CK1 A;  1GOA A;  4CJE A;  4MQ3 A;  4CGJ A;  1X9M A;  3QIP A;  1QE1 A;  3HL8 A;  4ZHR A;  1IKX A;  2HHS A;  2KFN A;  4E1N A;  2D0C A;  3AVJ A;  3OYE A;  3QET A;  3QEW A;  1N6Q A;  4Q0B A;  3AA2 A;  3SJJ A;  4DU4 A;  1G15 A;  5KI6 A;  1CXQ A;  2E6M A;  1L3V A;  2HW3 A;  3O4N A;  2HHT A;  4Y1C A;  1U48 A;  2OPQ A;  4N47 A;  2P5O A;  4O44 A;  3U3Y A;  3RR8 A;  4DFM A;  1RBR A;  4RW4 A;  4DTR A;  4FJM A;  2E6L A;  1RTD A;  3V4I A;  2B4J A;  1HYZ A;  5HRS A;  1Y97 A;  4CFB A;  3SQ2 A;  3PO5 A;  3D45 A;  4O0J A;  4UQG A;  4DSF A;  3LP2 A;  3VQ4 A;  3VA0 A;  3TAN A;  4IKF A;  4CHQ A;  1RTI A;  3ITH A;  4CJP A;  2B5J A;  4EP5 A;  4BE0 A;  3V9W A;  1NOY A;  4CEF A;  4CIG A;  4FJJ A;  4FXD A;  4CF2 A;  1WSG A;  2IC3 A;  4KHN A;  3T3F A;  4C8L A;  4FJ7 A;  4OLA A;  1JLB A;  2YNF A;  4LH4 A;  4DQS A;  4FLV A;  1J9A A;  1XWL A;  1KVA A;  1TKD A;  2HVI A;  4W5R A;  4KHQ A;  4F4K A;  4H4O A;  4DQI A;  1VSI A;  1WAF A;  3ZSZ A;  4M3Z A;  1BIS A;  1TKZ A;  3ZT1 A;  3THV A;  4N41 A;  5HBM A;  4E7K A;  3ZSR A;  4DS4 A;  1TK5 A;  1S9G A;  4CEE A;  1NOZ A;  1RT3 A;  1A5V A;  2IOC A;  2X6S A;  3NFA A;  4B9T A;  3I0R A;  4J2A A;  4FM1 A;  1ZBH A;  1ZYQ A;  3ZT2 A;  4RW9 A;  1BCO A;  1EX4 A;  3O3F A;  4HHT A;  2KZZ A;  3OYC A;  1NJY A;  4NCA A;  5DMR A;  4DF4 A;  1VRT A;  3PUF A;  3HT3 A;  1SKR A;  4CEO A;  4CHP A;  1XC9 A;  3WNG A;  1X9W A;  1TL1 A;  4JS4 A;  2ZD1 A;  2G8H A;  2P51 A;  1JXE A;  4RW8 A;  1CXU A;  4DU1 A;  3DOK A;  1RT5 A;  3KLF A;  1QSL A;  3C95 A;  4K8X A;  2OPR A;  4KAZ A;  4GVM A;  3V9Z A;  3DLB A;  4DSI A;  1RBV A;  1T7P A;  4G1Q A;  1KLN A;  4KTQ A;  1LWE A;  3T1A A;  4DQR A;  1IKY A;  4N5S A;  2GV9 A;  4EP4 A;  4AH9 A;  3SQ1 A;  4CGH A;  3RTV A;  3HO1 A;  2XY8 A;  4KHY A;  3ISN C;  1L3T A;  3WNH A;  3L2V A;  1J53 A;  4FLZ A;  4HCB A;  4PQU A;  2HHU A;  5D3G A;  3I8D A;  5CYQ A;  3QNO A;  1SL0 A;  3DLR A;  3L2U A;  3QNN A;  1RIL A;  3LP0 A;  3SCX A;  4B9N A;  4B9M A;  1N5Y A;  3VQ6 A;  4Z4G A;  5CZ2 A;  3AVM A;  3LP3 A;  3VQ7 A;  4KTZ A;  3KLI A;  4CJ5 A;  3TAB A;  2VWJ A;  3IG1 A;  4C8K A;  3UIQ A;  3M8S A;  3OYD A;  4M3W A;  1TAU A;  3T19 A;  1VSE A;  1SKW A;  4CJS A;  3DLH A;  3DMJ A;  4KV8 A;  4XIU A;  3TI0 A;  3RRH A;  3IS9 A;  3M8P A;  3ASM A;  1RDB A;  2B6A A;  3AO1 A;  1UA0 A;  3AVA A;  4CF9 A;  5CY4 A;  1C0T A;  4QCL A;  1FKP A;  3VN5 A;  2RPI A;  3TAQ A;  1O1W A;  3CG7 A;  1D8Y A;  4ZTF A;  4IG3 A;  1B92 A;  5KTQ A;  3M8R A;  4KRE A;  3LWL A;  1HQU A;  1LAW A;  1IKW A;  1NK4 A;  4KHS A;  3LPU A;  3VQB A;  1KVB A;  3HM9 A;  4KTW A;  3L3V A;  4NCG A;  4F3T A;  4CF8 A;  1B9F A;  4F3O A;  3MEE A;  4TSX A;  3OYI A;  3NBP A;  4E19 A;  2W42 A;  4JS5 A;  1ZBF A;  4E1M A;  4IFY A;  1LAV A;  4OKK A;  1U4B A;  1U49 A;  3BGR A;  4MFB A;  4CIE A;  4DTU A;  4CJK A;  3G0Z A;  4OPK A;  2HNY A;  3V81 A;  1RT7 A;  3RMD A;  1C1B A;  4OKJ A;  3TAM A;  3OYB A;  2E4L A;  2OA8 A;  2KFZ A;  4ID5 A;  4DMN A;  4Q5V A;  3SZ2 A;  3OYN A;  3ZT0 A;  5I3U A;  3S3N A;  4E7J A;  5JS1 A;  1C6V A;  4FW1 A;  2FC0 A;  1IG9 A;  2EX3 A;  3HYF A;  2R7Y A;  2GBZ A;  4OJR A;  3L2W A;  3NE6 A;  1VK0 A;  4DG1 A;  1WSH A;  1IO2 A;  1JLG A;  3DOL A;  3OYJ A;  2Y1I A;  3EY1 A;  4WE1 A;  4IG0 A;  4NYN A;  1BIZ A;  3KLG A;  4CEC A;  1Q8I A;  3H08 A;  5T7B A;  3IAY A;  3AO2 A;  4Y1D A;  1LW2 A;  3TR8 A;  3KKR A;  3NF8 A;  4F2R A;  4FK4 A;  3JSM A;  1B9D A;  5HRP A;  1S1U A;  3D0P A;  2QKB A;  1A5X A;  2WOM A;  3KKS A;  4O5B A;  3SUO A;  3HPG A;  1JXB A;  4CJR A;  2DTU A;  4AHS A;  1X1P A;  3VQQ A;  4DSJ A;  1RTJ A;  4C8M A;  3TAP A;  4HUF A;  3A2F A;  2QK9 A;  4FW2 A;  3NF6 A;  2D0A A;  4LSN A;  4CHN A;  4RW6 A;  4DFK A;  2Q3S A;  2Z1I A;  3DLE A;  4LSL A;  5EU7 A;  4M45 A;  3QEX A;  4KHW A;  3V1R A;  3AA5 X;  4B8C A;  3OY9 A;  2WON A;  4CHY A;  1RNH A;  4BDZ A;  3KLH A;  2FBT A;  5J1E A;  4CHO A;  3NHG A;  4Z4E A;  1W9H A;  5HRO A;  4BDP A;  4CJU A;  1RCH A;  3NF9 A;  3HP6 A;  4CJW A;  4CGF A;  2XO7 A;  3TAG A;  3DRS A;  4DU3 A;  3RR7 A;  3QO9 A;  3AA3 A;  3OYL A;  2F8T A;  4GW6 A;  4FJ8 A;  3AVB A;  3CM6 A;  1NJW A;  1JL2 A;  3NH1 A;  1ZBL A;  3SUP A;  4ELT A;  1IH7 A;  1JLC A;  4RW7 A;  2YNI A;  2KTQ A;  1L3U A;  3B6P A;  4DQP A;  3KLE A;  5J2Q A;  1YTA A;  4C8O A;  1S1V A;  4DTO A;  1RBT A;  4CF0 A;  1S1X A;  5HP1 A;  1NK9 A;  3O3H A;  4EZ6 A;  4KI6 A;  4AHC A;  1JLA A;  3VQE A;  5I42 A;  1KFS A;  4DTJ A;  3LDS A;  3MED A;  2F96 A;  4AIL C;  4FK0 A;  2XY5 A;  2O4I A;  3KK1 A;  3ALY A;  4M3Y A;  1JLF A;  4I2P A;  2GUI A;  1C0M A;  1NKE A;  4FJK A;  4BWJ A;  1VSK A;  3AVN A;  1QQC A;  2D5R A;  4E7H A;  2OZM A;  3ZT4 A;  2DFE A;  1Q9X A;  3BDP A;  4L8R B;  3HPH A;  4FLX A;  5KRS A;  3KJV A;  2IS3 A;  4J2E A;  1TKT A;  1YTU A;  1CZB A;  4CE9 A;  4Z4F A;  3CFR A;  3SNN A;  4CCH A;  4HTU A;  1RTH A;  1RDA A;  3LWM A;  4FM2 A;  1SUQ A;  1KLM A;  1JLQ A;  5FRM A;  4F8R A;  3LPT A;  2HVH A;  3RMC A;  1WN7 A;  4AHR A;  4DTS A;  3MXI A;  3B6O A;  4LH5 A;  4CEQ A;  3S9H A;  4FYD A;  1Q9Y A;  1X9S A;  1S6Q A;  2YNH A;  3AVG A;  3KD5 E;  2HHX A;  3ZSO A;  4I9L A;  1SL2 A;  4KKO A;  4CFA A;  4OLB A;  4B08 A;  3K5O A;  3HXM A;  4DTP A;  1S6P A;  5J2M A;  3CFO A;  4PY5 A;  1HYS A;  2HHW A;  1WNS A;  3SV3 A;  4FCY A;  3VQ9 A;  4W5T A;  1D9D A;  1W0H A;  4I2Q A;  4FZY A;  1RT4 A;  4HUG A;  1LWF A;  4Z4C A;  2F8S A;  5J2P A;  5K14 A;  3VQC A;  3AA4 A;  3QER A;  1L5U A;  4OGC A;  2VG7 A;  3ULD A;  3KD1 E;  3OYF A;  2VG6 A;  4FJ9 A;  2BGG A;  1VSF A;  1TL3 A;  1UA1 A;  2FBV A;  4E3S A;  4B9S A;  2HND A;  4FJI A;  4M3U A;  2YKM A;  1DTQ A;  1RDD A;  3K58 A;  3RMA A;  3VQ8 A;  1ASU A;  2I5J A;  2LSN A;  4Z4I A;  1TK0 A;  4FZX C;  5KGW A;  3KK2 A;  4B9L A;  1DLO A;  3OYG A;  4F2S A;  1NK8 A;  4M3T A;  2XY6 A;  1KFD A;  4I7F A;  1D5A A;  4CHZ A;  1I3A A;  1QTM A;  2QXF A;  2YHA A;  3O4Q A;  5KRT A;  4E7I A;  1HYV A;  2BAN A;  2KQ2 A;  3C6U A;  3P5J A;  1SV5 A;  1ASV A;  1KVC A;  3AO5 A;  3AO4 A;  4JRP A;  1FKO A;  1MU2 A;  2P1J A;  3ZSV A;  4FM0 A;  4FJG A;  5C25 A;  1BL3 A;  3DI6 A;  3V9U A;  1JL1 A;  3S3O A;  1BI4 A;  1VSM A;  4DF8 A;  3L2Q A;  1XHX A;  1FXX A;  4J2B A;  3AO3 A;  4CEZ A;  5SWM A;  2YHB A;  2Z1G A;  3PX6 A;  1C0U A;  2IDO A;  2X78 A;  5C24 A;  2G8F A;  4CGD A;  4QAG A;  4IBN A;  1HNI A;  3LZI A;  4CGI A;  1QSY A;  4CJT A;  1RBS A;  3WNF A;  4E0D A;  2VWK A;  4ICL A;  2BDP A;  2XHB A;  3AVF A;  4OPJ A;  1ASW A;  1NJX A;  4YFU A;  3F73 A;  3QIN A;  2DFF A;  2DFH A;  3AVC A;  4FJ5 A;  1T05 A;  4O55 A;  4PUO A;  3HJF A;  3K5M A;  2P5G A;  2D0B A;  3ZSY A;  2RF2 A;  3MEC A;  4H8K A;  3VQP A;  3LAL A;  4W5O A;  3AV9 A;  4AHV A;  4Z4H A;  3K2P A;  3NH2 A;  3V9S A;  3EYZ A;  1SKS A;  4KI4 A;  4H4M A;  4KPY A;  1NK0 A;  1HMV A;  3OS0 A;  1S1T A;  1JKH A;  3NDK A;  3C94 A;  1ZBI A;  2HHV A;  3AVI A;  2XRI A;  3V1Q A;  1VSL A;  3G10 A;  4IDK A;  3MAQ A;  4JRQ A;  3RRG A;  2HHQ A;  3TAE A;  1S1W A;  1TKX A;  4K8Z A;  1LW0 A;  4CJL A;  3NAE A;  3RMB A;  2ZE2 A;  4OKE A;  1YT3 A;  4LD0 A;  4R5P A;  3TWH A;  1GOB A;  1F21 A;  1T8E A;  5HRN A;  1QHT A;  4FJN A;  1BQM A;  2JGU A;  1XI1 A;  5FRN A;  1RBU A;  1YVU A;  5HRR A;  3CQ8 A;  2X6N A;  4JLH A;  1UAX A;  3DLG A;  3L2R A; 
#chains in the Genus database with same CATH topology
 4RTF D;  5E41 A;  5M1K A;  4FLT A;  3TSQ A;  1Z26 A;  4K42 A;  3A8Y A;  2HOE A;  4FLY A;  3LZJ A;  3PO4 A;  3THW A;  1I94 K;  4CBU A;  2KZM A;  3F9K A;  1BWF O;  5HLF A;  4H5V A;  4CJQ A;  4DSL A;  3UE5 A;  2IIR A;  3WUH A;  2IVO A;  3NH0 A;  4AHT A;  5E84 A;  3P4I A;  1NK6 A;  4OGE A;  1N32 K;  4AHU A;  3VQA A;  3TSP A;  5M1O A;  1OH6 A;  1HRH A;  5JS2 A;  3EZ5 A;  3RWU A;  4FJH A;  3WNE A;  1BG3 A;  4OPH A;  3SPZ A;  3S3M A;  1WSE A;  1YVN A;  4BE2 A;  4FJL A;  3E01 A;  4PKH A;  3NGZ A;  3ATV A;  4CED A;  1ATR A;  4FWL A;  4PA1 A;  2F9T A;  1BCM A;  4NCB A;  4ELU A;  1EKE A;  1TAQ A;  4BC4 A;  1TV6 A;  1GOC A;  3NMU A;  4BRN A;  4CGG A;  3O3G A;  4N56 A;  4DR2 K;  3LP1 A;  2HMI A;  4I9Q A;  3K57 A;  2RHK A;  3LAM A;  2F7T A;  3OVN A;  5AQO A;  4KO0 A;  1RT2 A;  4CEA A;  2RN2 A;  3NVK A;  2ATQ A;  4BRE A;  4CIF A;  2FBY A;  5JLF A;  3KIO A;  2Y1J A;  4JK7 A;  2Z1H A;  4OVL A;  3L6Q A;  1KCF A;  1WAJ A;  3GE1 A;  3VEZ A;  3PX0 A;  4JHD A;  4J2D A;  3U6F A;  2E88 A;  3SUQ A;  3D2F A;  2YJF A;  4W5Q A;  3FR0 A;  4KHU A;  3SBT A;  3M5R A;  4UY8 O;  1K6Y A;  3ZSX A;  4IFV A;  1NJZ A;  3AAP A;  2Q1N A;  4A5B A;  3MXJ A;  3WXJ A;  2ZGY A;  1RDW X;  3SAF A;  3HPO A;  2ITG A;  3SQ4 A;  4KBO A;  1NMD A;  4C23 A;  5EXW A;  4JKE A;  3O6W A;  4DFJ A;  4DFP A;  1QSS A;  4MQ3 A;  2P9U A;  4CGJ A;  1X9M A;  4ZHR A;  1IKX A;  1IBL K;  1N6Q A;  3G4S N;  4AQY K;  3SJJ A;  5KI6 A;  2QWL A;  2E6M A;  3ZEU B;  4Y1C A;  3U9Z A;  1YXQ A;  4N47 A;  4O44 A;  3U3Y A;  3RR8 A;  1LOT B;  3KWI A;  1XC3 A;  3NVM A;  4RW4 A;  3EEQ A;  5LY3 A;  1YI2 N;  3LP2 A;  3VQ4 A;  1G99 A;  3V9W A;  2GEL A;  1QHA A;  4BR5 A;  4CEF A;  4FJJ A;  3PIO L;  1WSG A;  4KHN A;  1M90 O;  1JLB A;  1J9A A;  1KVA A;  4KHQ A;  1TKZ A;  3ZT1 A;  3W3D A;  1S9G A;  4CEE A;  2IOC A;  1ZBH A;  3I0R A;  4J2A A;  4B3M K;  3P39 A;  1EX4 A;  2W6L A;  2A41 A;  4NCA A;  4H0Y B;  5GAG P;  1OKJ A;  1K8A O;  1X9W A;  1GLJ O;  4JS4 A;  2G8H A;  4RW8 A;  1RT5 A;  3KLF A;  3C95 A;  3WT0 A;  4GVM A;  3V9Z A;  5FPN A;  2O8E A;  2FLO A;  3DAW A;  4QS8 A;  1XMO K;  4C1N I;  2Q31 A;  3J81 O;  4KHY A;  3ISN C;  1L3T A;  4FLZ A;  2F9W A;  3L2V A;  3HM8 A;  2V52 B;  4M7Y A;  2HHU A;  3QNO A;  5CYQ A;  3DLR A;  3L2U A;  5BN9 A;  1RIL A;  3JAM O;  4B9M A;  1VQ9 N;  4KTZ A;  1SKW A;  2O8D A;  3AO1 A;  1UA0 A;  3OBY A;  4H5R A;  3TAQ A;  1KAZ A;  3J7Y P;  4IG3 A;  3LWL A;  3A5O C;  1HQU A;  1W2B M;  3THX A;  4NXN K;  3VQB A;  1BU6 O;  1KVB A;  3HM9 A;  4F3T A;  4IZ9 A;  4F3O A;  1JCE A;  5AQL A;  3ATU A;  2UUB K;  2HST A;  4EAH D;  2PFU A;  3G0Z A;  2KHO A;  1RT7 A;  3RMD A;  1C1B A;  4DQ8 A;  3OYB A;  2VQE K;  4Q5V A;  3OYN A;  4E7J A;  4CZJ A;  1C6V A;  2FC0 A;  2EX3 A;  4BVP A;  2GBZ A;  4HTL A;  4OJR A;  3O9T A;  4WE1 A;  3N4P A;  3IMX A;  3A5N C;  4NYN A;  4CEC A;  3AO2 A;  2WBN A;  3KKR A;  3JSM A;  1B9D A;  1S1U A;  4O5B A;  1JXB A;  1KXP A;  4C8M A;  3TAP A;  4HUF A;  3DLE A;  1DT9 A;  5EU7 A;  3VMF B;  3V1R A;  4B8C A;  3OY9 A;  1FW6 A;  3GOI A;  3KLH A;  2FBT A;  3NHG A;  5EVZ A;  4O5F A;  2J4R A;  3D2E A;  3HP6 A;  3CC2 N;  4CJW A;  4CGF A;  3TAG A;  3DRS A;  3AA3 A;  2F8T A;  4GW6 A;  1RGI A;  3AVB A;  1NJW A;  3SUP A;  1IH7 A;  2YNI A;  3I55 N;  5IWA K;  4BY9 C;  2QM1 A;  3C6A A;  4EZ6 A;  1NK9 A;  4KI6 A;  2WTU A;  3VQE A;  3LDS A;  3R8E A;  2GEM A;  3ALY A;  4LF4 K;  5IT9 O;  4JI4 K;  2Q97 A;  4BWJ A;  2JWK A;  1YIT N;  3O08 A;  4E7H A;  3BDP A;  1T44 A;  5TKW A;  2IS3 A;  1YTU A;  4BRA A;  1TYQ A;  4OO1 J;  2V7Z A;  3SNN A;  4YY3 K;  4CCH A;  4HTU A;  1RTH A;  1RDA A;  3LWM A;  1KLM A;  3RMC A;  1WN7 A;  3QML A;  4YOR A;  4CEQ A;  4IDH A;  3S9H A;  3AVG A;  3KD5 E;  4K0K K;  1SL2 A;  4CFA A;  3BP8 A;  1HYS A;  1S6P A;  3CFO A;  3R9P A;  4BQL A;  1D9D A;  1W0H A;  4FZY A;  1LCU A;  3P31 A;  2E2Q A;  4Z4C A;  4LF6 K;  5GIP A;  4OGC A;  2VG7 A;  3ULD A;  3OYF A;  3HOT A;  4IFE A;  4FJI A;  2GWK A;  3HI0 A;  1RDD A;  1ASU A;  4DR1 K;  3KK2 A;  3OYG A;  1NK8 A;  4I6M B;  2XY6 A;  1S22 A;  1HYV A;  2KQ2 A;  3P5J A;  4AF1 A;  1SV5 A;  1KVC A;  5LJW A;  3F9M A;  3O8M A;  4JRP A;  1FKO A;  3ZSV A;  3V9U A;  1BI4 A;  3L2Q A;  4BC2 A;  2E2O A;  4CEZ A;  1K8K B;  5AQI A;  3CI5 A;  1C0U A;  2IDO A;  3I8B A;  5C24 A;  5JIC A;  4CGD A;  1E4G T;  4CJT A;  4E0D A;  2XHB A;  4OPJ A;  3FZL A;  3CET A;  1NJX A;  4YFU A;  3AVC A;  5JMV A;  1ATN A;  1RDU A;  3U9D A;  4CI6 A;  4DV0 K;  3MEC A;  4W5O A;  3AV9 A;  4KI4 A;  5A2Q O;  3RVC A;  4A59 A;  2UXC K;  3NDK A;  2HHV A;  3C94 A;  3AVI A;  4B1V A;  3V1Q A;  1VSL A;  4DUZ K;  1TKX A;  4K8Z A;  4LD0 A;  4OKE A;  3TWH A;  4R5P A;  2FSK A;  4H5T A;  1QHT A;  2JGU A;  3THX B;  1RBU A;  4YHH K;  4JLH A;  4BGA A;  4WFB L;  1RFQ A;  4GKJ K;  1ATS A;  3THY A;  1VQL N;  4O0I A;  3QES A;  4BE1 A;  1U45 A;  3T1H K;  2G8U A;  3WXI A;  1LV5 A;  4E89 A;  4A2A A;  5JVG L;  2IAJ A;  1SL1 A;  1NJI O;  3ZX0 A;  3P83 D;  4BRF A;  1CZA N;  4O8K A;  4BR4 A;  3ZT3 A;  5AZI B;  1VQM N;  2ZF5 O;  2KW4 A;  3DM2 A;  5LJV A;  4H0X B;  3U3G A;  3ZYY X;  4FZZ A;  2CGL A;  4PWD A;  2RE2 A;  4LFC K;  4DTN A;  2UXB K;  2HB5 A;  2PZS A;  4PHT X;  4CZG A;  3OJS A;  3MCP A;  4XH1 A;  3MEG A;  3EKU A;  3G6E N;  3O80 A;  4FO0 A;  1QVF M;  2A1R A;  3QIO A;  3SYZ A;  3C65 A;  2OTL N;  2E5L K;  2NNW A;  1J5O A;  1WSJ A;  4DV7 K;  4BVO A;  3JYT A;  4M3X A;  4LY7 A;  4BR7 A;  5AQH A;  2YNG A;  4JI0 K;  4A62 A;  2ASP A;  1VSJ A;  4GMJ B;  4CFC A;  2QW9 A;  2QKK A;  4CK2 A;  4FSV A;  3PIP L;  4J8F A;  1UOC A;  5AQQ A;  1JLE A;  5BRE A;  5E26 A;  1HKG A;  1RDC A;  3QEV A;  4IOA L;  1QQM A;  3UKR A;  4DQQ A;  3ZSW A;  4B3S K;  1WSF A;  2VWB A;  5LL6 Z;  4ELV A;  5EOY A;  1RT1 A;  4K43 A;  3DRR A;  4YNQ A;  4CJ3 A;  2G8I A;  4JYA K;  2FSN A;  3CFP A;  3ENB A;  1ZC6 A;  1QS4 A;  3VF4 A;  4CJF A;  4RG8 A;  2Q0U A;  4XH4 A;  5AQK A;  3SAG A;  4DB3 A;  4YOW A;  4ZTJ A;  3H3O B;  3ZEU A;  1FJG K;  1BIU A;  1ZBU A;  4DTX A;  1EO1 A;  1D9F A;  4CBW A;  1NKC A;  4KFB A;  1XHZ A;  2VG5 A;  2JLE A;  4FVM A;  2E8A A;  4FWK A;  5EX5 A;  1VSH A;  1UWB A;  4FL9 A;  1QQN A;  4M42 A;  1T03 A;  3UKU B;  1T6D A;  1BHL A;  2HBM A;  5FDL A;  4DR7 K;  3QFU A;  1VHX A;  3MDQ A;  5AQZ A;  3KZB A;  4M41 A;  4CFD A;  1VRU A;  2DY4 A;  3UB5 A;  4FJX A;  3RSE A;  1BGX T;  3HP9 A;  4C8N A;  5C42 A;  1BQN A;  3TSU A;  3QIP A;  3HL8 A;  2VYP A;  1QZ6 A;  1YHQ N;  1BDG A;  3CQY A;  1G15 A;  3CIP A;  1CXQ A;  1L3V A;  3WEE A;  3O4N A;  4DV1 K;  2ZJR L;  2ASM A;  3M3Z A;  2E6L A;  3ULE B;  3V4I A;  3HSC A;  1Y97 A;  4CFB A;  3SQ2 A;  3PO5 A;  3D45 A;  4H5N A;  4IKF A;  3WXK A;  4CIG A;  4FWS A;  4YOU A;  3LDL A;  2IC3 A;  1DKG D;  4DQS A;  2NZT A;  1XWL A;  2HVI A;  4W5R A;  4F4K A;  4DQI A;  1WAF A;  1O13 A;  1HX1 A;  4H0T B;  1U2V B;  1NOZ A;  1RT3 A;  3NFA A;  3CHW A;  4B9T A;  4FM1 A;  1H1V A;  1ZYQ A;  3O9Q A;  4DV6 K;  3SBG A;  3OYC A;  2HF3 A;  4DF4 A;  3F2K A;  2ZD1 A;  1X3M A;  4FOE A;  1CXU A;  1QVG M;  4K8X A;  3DLB A;  1NU0 A;  4BRO A;  4F9O A;  5HL7 L;  4G1Q A;  1KLN A;  3T1A A;  4DQR A;  2GV9 A;  2YX6 A;  1BA1 A;  4AH9 A;  4CGH A;  4YDU C;  3HO1 A;  4GY2 B;  3WNH A;  1W97 L;  4MO5 A;  3QNN A;  1NLV A;  3CJ1 A;  4B9N A;  4GV6 A;  3H1V X;  4Z4G A;  3AVM A;  3LP3 A;  3KLI A;  4CJ5 A;  2O8F B;  2VWJ A;  5AQY A;  3SAH A;  3QDK A;  4B1Y B;  3UIQ A;  3M8S A;  3OYD A;  1TAU A;  3THW B;  3TI0 A;  4KV8 A;  1SAZ A;  4XIU A;  3RRH A;  3CCE N;  3ASM A;  3HOS A;  3U4L A;  2NRZ A;  3ENO A;  4JAX A;  3VN5 A;  1D8Y A;  2RPI A;  3CG7 A;  3M8R A;  4KH5 A;  5GAE P;  2I7N A;  1LAW A;  3SK3 A;  4KHS A;  3LPU A;  3QFP A;  4JI7 K;  4KTW A;  1TUY A;  3MEE A;  4H5W A;  4JS5 A;  4E1M A;  1LAV A;  3C7N A;  4FWO A;  1U4B A;  1U49 A;  4CIE A;  2HNY A;  4OKJ A;  3TAM A;  2BTF A;  2OA8 A;  3D6R A;  2KFZ A;  4NO7 A;  3ZT0 A;  5I3U A;  4AM6 A;  1ZBS A;  1IG9 A;  5BPN A;  1OVQ A;  3L2W A;  5C0Y A;  4DG1 A;  3EY1 A;  4H0V B;  4KH4 A;  5H1S Q;  1VQ4 N;  3KLG A;  1X3N A;  3W0L A;  1NGH A;  3IAY A;  2QXL A;  2BH1 A;  3MK6 A;  3NF8 A;  2HF4 A;  2OCE A;  4FK4 A;  3D0P A;  1A5X A;  2WOM A;  4JN4 A;  1X1P A;  4BQZ A;  3A2F A;  2Q2R A;  3ID8 A;  1VQ6 N;  5AZJ B;  2Z1I A;  3E9P A;  2WON A;  4K25 A;  3A5M C;  4CHY A;  4BDZ A;  4CHO A;  4FPA A;  5HRO A;  4B3T K;  4CJU A;  1RCH A;  3NF9 A;  2OTJ N;  1U2V A;  4E1J A;  2XO7 A;  4ISE A;  4DU3 A;  1XQS C;  4H03 B;  3QO9 A;  4FWM A;  3MN9 A;  3OYL A;  3RR7 A;  4JKB A;  3CM6 A;  1JL2 A;  3NH1 A;  1ZBL A;  1JLC A;  3VF6 A;  4RW7 A;  3O9R A;  1L3U A;  3B6P A;  4DQP A;  4DV3 K;  3CD6 N;  1S1V A;  4CF0 A;  1S1X A;  5HP1 A;  4JV5 K;  2HMP A;  4AHC A;  3ULE A;  4DTJ A;  3MED A;  3BZC A;  1KD1 O;  2XY5 A;  2O4I A;  1JLF A;  2GUI A;  4M63 C;  1NKE A;  3OHR A;  4FJK A;  1OH7 A;  3AVN A;  3E1Y A;  4FVU A;  3ZT4 A;  2DFE A;  4L8R B;  3HPH A;  3KJV A;  1QQO A;  3DXM A;  2CGJ A;  1CZB A;  4CE9 A;  4Z4F A;  3CFR A;  4WQ4 A;  5F2R A;  5FRM A;  5KPR A;  2D1K A;  3CF5 L;  4DTS A;  1NMN A;  2HHX A;  2QTD A;  3AGK A;  4KKO A;  4A61 A;  2HHW A;  1S3X A;  3SV3 A;  5LMU K;  3VQ9 A;  2UXD K;  1RT4 A;  3WXM B;  2O8E B;  1NGC A;  2QWM A;  1HUX A;  5K14 A;  3QER A;  1N36 K;  2D0P A;  5AQM A;  3DWL A;  4MLE A;  1GLF O;  2HND A;  4M3U A;  1DTQ A;  1HKC A;  5BPL A;  1TK0 A;  5KGW A;  3S41 A;  1DLO A;  3O9S A;  4M3T A;  4I7F A;  4CHZ A;  1QTM A;  4DKW A;  4FWR A;  4BR9 A;  1ASV A;  3AO5 A;  4B3R K;  4JD2 B;  2P1J A;  1N34 K;  5C25 A;  2NRX A;  1XHX A;  1FXX A;  2ZWH A;  1Q7Y O;  5SWM A;  2YHB A;  2X78 A;  2G8F A;  2D4W A;  2ZGZ A;  2P9P B;  3LZI A;  1QSY A;  3WNF A;  1NGE A;  2H3G X;  4ILG B;  1TUU A;  3J8A A;  1EWR A;  4MLH A;  3F73 A;  3QIN A;  2DFF A;  2DFH A;  3HJF A;  3SQ0 A;  4AHV A;  3EYZ A;  5AQR A;  2ZM6 K;  4KPY A;  1S1T A;  1JKH A;  2QWQ A;  2HHQ A;  3RRG A;  4JRQ A;  2FF3 B;  1S1W A;  4CJL A;  2P9U B;  3RMB A;  1YT3 A;  1T8E A;  4FJN A;  5FRN A;  1BQM A;  1YVU A;  5HRR A;  3CQ8 A;  2X6N A;  3H46 O;  2P9I B;  1UAX A;  3QBW A;  3AGR A;  4NYF A;  3PV8 A;  3ZCM A;  4LF9 K;  4QS7 A;  1IKV A;  1YF5 L;  2OPS A;  4BG8 A;  1VQP N;  4BR2 A;  1T3V A;  1U04 A;  4BRI A;  3D7E O;  3LDQ A;  3Q7C A;  4JI1 K;  3VQD A;  5I9E B;  3E66 A;  4PL8 A;  3SPY A;  2UUC K;  3DXM B;  3FLC O;  2YI1 A;  5CR4 A;  2OYQ A;  3K0S A;  5AQW A;  3OYH A;  3TAR A;  3HK2 A;  3DXK A;  1LWC A;  3CYM A;  1NK7 A;  3MN5 A;  2A1S A;  2PYJ A;  4OX9 K;  3OYA A;  2BE2 A;  3QEP A;  1KRP A;  1VQ5 N;  1E3M A;  1VAZ A;  5AQP A;  1TVR A;  1TGO A;  4KB1 A;  4GV3 A;  1EXQ A;  2RKI A;  4HUE A;  4IEE A;  3CCQ N;  4FWN A;  2E1Z A;  1C1C A;  4YOV A;  4FLU A;  1CZ9 A;  3NGI A;  3L3U A;  2OZS A;  3SI6 A;  1TK8 A;  4CJV A;  1CLQ A;  1YJW N;  5KPZ A;  1OVY A;  3DRP A;  1NK5 A;  3V1O A;  1L3S A;  1IBK K;  1HPZ A;  1KTQ A;  2YKN A;  3K5N A;  2Q0R A;  1WLJ A;  3P1G A;  3MWT A;  3SV4 A;  3VGK A;  3SMS A;  1K8K A;  3KK3 A;  1NGG A;  3BUZ B;  3M8Q A;  4B1W B;  3MN6 A;  4FPB A;  1BI4 B;  2G8W A;  4CD1 A;  3PX4 A;  2YHY A;  4IO8 A;  4CER A;  4RCH A;  4YOY A;  3J7A P;  2ASO A;  4N76 A;  5CYM A;  3MXM A;  4O4G A;  4FK2 A;  2EHG A;  4EHT A;  2YV0 X;  2HBJ A;  5DK5 A;  4BC5 A;  1S5J A;  5DM7 L;  3TU5 A;  1GLA G;  3K59 A;  4DWI A;  3C6T A;  1NGI A;  3FFK B;  4KB0 A;  3AVK A;  3HVR A;  4DTM A;  4B3O A;  4Z0U A;  3VER A;  1HNV A;  1GLC G;  2WFB A;  3DLK A;  1NG9 A;  3V9X A;  3NGY A;  3SUN A;  4DLG A;  4U7B A;  3ZX2 A;  3P38 A;  1DTT A;  1K73 O;  3HVT A;  5J2N A;  3OJU A;  3ENH A;  2W40 A;  3VEX A;  3VES A;  3TPQ A;  4CK1 A;  4CJE A;  3O1B A;  1NNE A;  1QE1 A;  1TYQ B;  4X66 K;  2HHS A;  2KFN A;  4E1N A;  4WF9 L;  2D0C A;  3AVJ A;  3OYE A;  4IXC A;  3AA2 A;  4WQ5 A;  1EWQ A;  4DU4 A;  2A40 A;  2HW3 A;  3H45 C;  3GL1 A;  1U48 A;  2OPQ A;  2QWP A;  3BF3 A;  1GLL O;  5M1P A;  4DFM A;  3MMV A;  4A5A A;  4DTR A;  2FSJ A;  2O8F A;  3CMA N;  2B4J A;  4JI8 K;  4O0J A;  4BC3 A;  3TAN A;  3IFR A;  3ITH A;  4CJP A;  4EP5 A;  3N4Q A;  4BE0 A;  3SMP A;  4XEI A;  1NOY A;  1ESV A;  3MWP A;  3OTO K;  1Z6R A;  3L0Q A;  4FJ7 A;  4LH4 A;  4FLV A;  1TKD A;  5AJ3 K;  2E2N A;  4H4O A;  3CCM N;  4G9Z A;  1J5E K;  4M3Z A;  4N41 A;  4BGB A;  2IVN A;  5HBM A;  4E7K A;  4EFH A;  2VCP A;  5AQU A;  3ZSR A;  4DS4 A;  3PY8 A;  3D2E B;  4L3Q A;  3GG4 A;  1NGD A;  4DR3 K;  4C1N K;  2E1Y A;  3ZT2 A;  4NLB A;  3J7Z O;  1BCO A;  3O3F A;  4HHT A;  1NJY A;  5DMR A;  1JJ2 M;  4CEO A;  3DLL L;  1VQ8 N;  1TL1 A;  4CZH A;  2P51 A;  1JXE A;  4DU1 A;  3T1Y K;  1R59 O;  3DOK A;  3ZET B;  3VPZ A;  2OPR A;  4KAZ A;  3CJA A;  1RBV A;  4R79 A;  4MDA A;  1LWE A;  1IKY A;  1IV0 A;  4CJ7 A;  3RTV A;  2XY8 A;  4H0O A;  4O8U A;  5D3G A;  5FPE A;  3LP0 A;  3VQ6 A;  5CZ2 A;  3VTH A;  3VQ7 A;  4BRM A;  3IG1 A;  2P9L A;  4C8K A;  3DLH A;  1DEJ A;  2DPN A;  2O8B A;  3IS9 A;  2B6A A;  3WEE B;  2P9K A;  5CY4 A;  3IDH A;  1C0T A;  1FKP A;  1O1W A;  4ZTF A;  1B92 A;  4KRE A;  4BR0 A;  2UU9 K;  3OW2 M;  4JK9 A;  1KAY A;  1NK4 A;  5C2D A;  4IJN A;  3I56 N;  3PSI A;  4BRD A;  3L3V A;  3RSE B;  4NCG A;  5DM6 L;  4CF8 A;  4IO9 L;  1B9F A;  4RWT A;  4TSX A;  4DHY A;  3OYI A;  1ZBF A;  4JKA A;  3BGR A;  4OPK A;  3UKU A;  5C15 A;  5EY4 A;  3EKS A;  3CCJ N;  4ID5 A;  4A57 A;  3CJB A;  3BY5 A;  5AQX A;  4CZK A;  3SZ2 A;  2FF6 A;  5AQG A;  2O8C B;  5JS1 A;  4FW1 A;  2Q36 A;  3NE6 A;  1VK0 A;  2P9S B;  1C0F A;  1WSH A;  3OYJ A;  4GVE A;  2JWL A;  2NRR A;  1Q8I A;  4MDB A;  4Y1D A;  3TR8 A;  1LW2 A;  4KH6 A;  3EE9 A;  3WQU A;  4DCH A;  5HRP A;  2QKB A;  4AM7 A;  2E2P A;  3HPG A;  5AFU H;  2DTU A;  4AHS A;  1RTJ A;  2QK9 A;  2VQF K;  3NF6 A;  4CHN A;  1GLB G;  4RW6 A;  4V19 S;  4M45 A;  3PLA A;  2VGN A;  3AA5 X;  3A0I X;  3UKR B;  1W9H A;  3CER A;  2VGM A;  3LDP A;  3CJ9 A;  4FOI A;  1VQK N;  1OH8 A;  3AAR A;  5TKY A;  4CZL A;  1WBB A;  4CZI A;  1NGA A;  5KQ8 A;  2KTQ A;  5J2Q A;  1YTA A;  4CZE A;  4DTO A;  4CZM A;  1RBT A;  3O3H A;  4DV4 K;  1JLA A;  1KFS A;  1MA9 B;  3OA9 A;  2F96 A;  4AIL C;  3QB0 A;  4FK0 A;  3L4Q A;  3KK1 A;  3CCV N;  4M3Y A;  2QEX N;  1C0M A;  5LMN K;  1QQC A;  1J6Z A;  2D5R A;  2OZM A;  3SJH A;  3VOV A;  2QWO A;  3FZK A;  4FLX A;  4J2E A;  4JI2 K;  3LDO A;  3EN9 A;  1VQN N;  1SUQ A;  5AZI A;  3LPT A;  2HVH A;  1WOQ A;  4JI6 K;  4AHR A;  1DGK N;  3CC7 N;  3MXI A;  4LH5 A;  4FYD A;  1Q9Y A;  1X9S A;  2YNH A;  4I9L A;  1K9M O;  3TTC A;  4GKK K;  3CME N;  4LF5 K;  1JCF A;  4K41 A;  5J2M A;  3ZLJ A;  1WNS A;  2OAN A;  2CGK A;  4FCY A;  4W5T A;  3THY B;  1GLE G;  4I2Q A;  3VTI A;  4HUG A;  2ZJP L;  1LWF A;  4XH5 A;  3QIC A;  2F8S A;  3VQC A;  3AA4 A;  3WQT A;  3LL3 A;  3KD1 E;  2BGG A;  1UA1 A;  4CW7 B;  2FBV A;  3MX5 A;  3VQ8 A;  2LSN A;  2I5J A;  1Q18 A;  1NBW A;  3R6M A;  3M1F A;  4ISG A;  4FZX C;  3M6G A;  4F2S A;  5C2F A;  3CCS N;  2YHA A;  3O4Q A;  5KRT A;  2BAN A;  3C6U A;  5BRF A;  4FM0 A;  4BRH A;  1BL3 A;  3DI6 A;  1JL1 A;  1VSM A;  5AQT A;  3VGM A;  1YAG A;  1P8Z A;  1HR0 K;  4IWV A;  2AA4 A;  3EE8 A;  4IBN A;  5F0X A;  1HNI A;  3O5B A;  4CGI A;  3FZF A;  3AVF A;  3CJC A;  4JI5 K;  4DV5 K;  1WUA A;  4FJ5 A;  2W6K A;  4PUO A;  5BR9 A;  3K5M A;  2P5G A;  2D0B A;  2QWN A;  1YJ9 N;  2RF2 A;  3V9S A;  3LAL A;  4Z4H A;  1JCG A;  5BRD A;  1SKS A;  2D0O A;  4H4M A;  4I6M A;  3OS0 A;  1HPM A;  2GUP A;  2YHW A;  2XRI A;  3G10 A;  4IDK A;  3MAQ A;  2GWJ A;  3TAE A;  3NAE A;  2ZE2 A;  2HHH K;  2F4V K;  3VEN A;  4JKD A;  3IRX A;  4HCC A;  1KSP A;  4B9V A;  1ITG A;  3AVH A;  2HBK A;  4BRG A;  2P9N A;  3VQ5 A;  4U67 L;  1NWK A;  1FK9 A;  1EQY A;  1RT6 A;  3E9L A;  4DUY K;  4YDU A;  4BDY A;  3O9U A;  4DS5 A;  1OH5 A;  3OS2 A;  2HBL A;  3OYK A;  4LF7 K;  3BF1 A;  4DLE A;  2G8V A;  2QA4 N;  1KC8 O;  4NB4 A;  3ZSQ A;  4CZF A;  2ETJ A;  1S9E A;  3K9J A;  3MN7 A;  4CJ4 A;  3OS1 A;  3AY9 A;  1VSD A;  2KKZ A;  5M1Q A;  4KHP K;  5CHI A;  4B9U A;  2ZQB A;  3H3N O;  3LAK A;  3R3L A;  5GAD P;  4W5N A;  5B8H A;  2HNZ A;  4ID1 A;  4B1U B;  5KGX A;  2G8K A;  2PYL A;  4B9Q A;  5CZ1 A;  4HVJ A;  5FRO A;  4FLW A;  4QOZ B;  2CH6 A;  2X74 A;  1BA0 A;  1R0A A;  3I33 A;  1HLU A;  2OPP A;  2FBX A;  4KRF A;  4LFB K;  2PBD A;  4E7L A;  2PAV A;  3LM2 A;  3KTQ A;  2AJQ A;  1Z25 A;  5KPT A;  3OYM A;  3HST B;  1EP4 A;  3OBW A;  1C1A A;  2NLX A;  3H1Q A;  3V6D A;  4B8A B;  2IGI A;  3I0S A;  2XY7 A;  4BWM A;  4CES A;  4DSE A;  1HKB A;  1U47 A;  3DYA A;  4DSK A;  2NRW A;  5C12 A;  1XUP O;  3O1W A;  4WCE L;  5JLH A;  3K5L A;  1REV A;  2PY5 A;  3NF7 A;  1YJN N;  3TAF A;  1M1K O;  2O4G A;  3HZ6 A;  4EZ9 A;  4JEP A;  4CF1 A;  4CBX A;  1WSI A;  4GNI A;  1HQE A;  1SQK A;  3MCA B;  3FE1 A;  1Z05 A;  3VA3 A;  4IEI A;  3L8B A;  1NKB A;  1I39 A;  4DR5 K;  5ADX A;  4CEB A;  3LDN A;  4JI3 K;  4YOT A;  2P9N B;  4JKF A;  1EET A;  3QLH A;  3QEI A;  3AVL A;  3GDQ A;  4QS9 A;  1HJR A;  4DR6 K;  1J54 A;  2QI2 A;  4BAC A;  3CM5 A;  5SZT A;  1Q82 O;  4CK3 A;  3LAN A;  3ID6 A;  4M3R A;  1A5W A;  2Z1J A;  3FFI A;  3NCI A;  4X62 K;  1MWM A;  2NUB A;  4IOX A;  1GOA A;  1V4T A;  5AFU A;  3WXL A;  3QET A;  3IUC A;  3QEW A;  3PSF A;  1HNX K;  4Q0B A;  3T7Z A;  3CCL N;  1WB9 A;  2HHT A;  2P5O A;  2O8D B;  5BN8 A;  1SZ2 A;  1Q86 O;  1RBR A;  4FJM A;  1RTD A;  1HYZ A;  5HRS A;  4UQG A;  4DSF A;  5C10 A;  3VA0 A;  4WFN L;  4CHQ A;  1RTI A;  3J80 O;  4WQ4 C;  2B5J A;  3LM9 A;  2ZJQ L;  2KLA A;  4FXD A;  4CF2 A;  3KWG A;  4FWP A;  5FPM A;  5AR0 A;  3T3F A;  4C8L A;  4OLA A;  2YNF A;  3HBT A;  4IOC L;  4GV9 A;  5FLX O;  3JXU A;  4H0P A;  1VSI A;  3ZSZ A;  1BIS A;  3THV A;  4WFA L;  1TK5 A;  3CC4 N;  2NRT A;  1A5V A;  2X6S A;  4FWQ A;  4RW9 A;  4PKG A;  2KZZ A;  1XNQ K;  3CJ7 A;  1SKR A;  1VRT A;  3PUF A;  3HT3 A;  4PKI A;  4CHP A;  1XC9 A;  3WNG A;  1QSL A;  1YIJ N;  4DSI A;  1T7P A;  3CQX A;  4KTQ A;  3VEW A;  4N5S A;  5ADX H;  3VET A;  4EP4 A;  3K9K A;  3SQ1 A;  3DXK B;  2NRV A;  4JNE A;  4IJA A;  1HJO A;  4JK8 A;  4HCB A;  1J53 A;  4PQU A;  1E4F T;  3I8D A;  1SL0 A;  3CCR N;  3SCX A;  3FZM A;  4B1X B;  1N5Y A;  3TAB A;  1Y64 A;  1VQ7 N;  4B1Z A;  4EHU A;  4M3W A;  3C6H A;  3T19 A;  1VSE A;  4CJS A;  3DMJ A;  5AQN A;  3M8P A;  1RDB A;  4Y0W A;  3AVA A;  4CF9 A;  3EO3 A;  4QCL A;  5KTQ A;  4A2B A;  1S72 N;  1QZ5 A;  2YCH A;  5CE3 A;  1IKW A;  1P90 A;  2P9I A;  4JKG A;  3VEY A;  4JKH A;  4OPA A;  4WYB A;  3G25 A;  4JKG B;  4EIA A;  5FPD A;  4HWI A;  3NBP A;  4E19 A;  2W42 A;  4DR4 K;  4IFY A;  4OKK A;  2A5X A;  4NXM K;  1GLD G;  4MFB A;  4DTU A;  4CJK A;  3V81 A;  3CPW M;  4BRK A;  2E4L A;  3KVG A;  3KHY A;  4DMN A;  2IVP A;  3S3N A;  2GX9 A;  4ILH A;  3HYF A;  2R7Y A;  3D2F B;  1U6Z A;  2V51 B;  3TTD A;  3DOL A;  1IO2 A;  1JLG A;  5AQS A;  2Y1I A;  4IG0 A;  1BIZ A;  4PL7 A;  3H08 A;  5T7B A;  4JHD B;  2P9P A;  3JS6 A;  3IKM A;  3U8X A;  4F2R A;  3FGU A;  1D4X A;  1YUW A;  3KKS A;  3SUO A;  4ILJ A;  4CJR A;  3VQQ A;  4DSJ A;  4FW2 A;  2D0A A;  4JD2 A;  4LSN A;  1KQS M;  4DFK A;  2Q3S A;  4LSL A;  1HNZ K;  3VEV A;  5JVH L;  3QEX A;  2YHX A;  4KHW A;  2UYT A;  1RNH A;  2WUS A;  1T6C A;  5AQJ A;  3KK7 A;  5J1E A;  4Z4E A;  3TTF A;  5M1F A;  1MDU B;  4BDP A;  3T69 A;  1N8R O;  1IG8 A;  2P9S A;  1IJJ A;  3AAQ A;  2AP1 A;  3E9O A;  1C0G A;  4FJ8 A;  2O8C A;  4ISF A;  3SLC A;  3G71 N;  4BRQ A;  4ELT A;  1XMQ K;  3BZK A;  4NLC A;  2A6A A;  4CVN E;  2E20 A;  3ZX3 A;  1BOT O;  3KLE A;  4LF8 K;  4C8O A;  3MX2 A;  2W41 A;  5AQF A;  5I42 A;  3FZH A;  1BUP A;  4MO4 A;  4I2P A;  4Z94 A;  2UUA K;  1VSK A;  1NGB A;  3C0B A;  3CPE A;  1Q9X A;  2P9K B;  5KRS A;  1TKT A;  4M7X A;  5M1N A;  2O8B B;  4FM2 A;  3CCU N;  2P9L B;  1JLQ A;  3Q7B A;  5GIO A;  4F8R A;  2V7Y A;  2NRH A;  5ELZ A;  5F1X A;  2YJE A;  4DV2 K;  3B6O A;  1S6Q A;  3QBX A;  3ZSO A;  4OLB A;  4B08 A;  3K5O A;  5KQD A;  3HXM A;  4DTP A;  4PY5 A;  4LFA K;  3EL2 A;  1NGJ A;  3R1X A;  2CH5 A;  1W7A A;  5J2P A;  1HNW K;  1L5U A;  4BRC A;  4X65 K;  3DJC A;  3EZW A;  4FJ9 A;  2VG6 A;  3VGL A;  1VSF A;  1TL3 A;  5BPM A;  4B9S A;  4E3S A;  3ZET A;  4JKC A;  1XNR K;  1KAX A;  2YKM A;  3K58 A;  3RMA A;  4Z4I A;  2QWR A;  1Q81 O;  1N33 K;  4B9L A;  3HTV A;  2A3Z A;  1KFD A;  4BRL A;  1D5A A;  1I3A A;  2EWS A;  3VEO A;  2QXF A;  4E7I A;  3AO4 A;  5AZJ A;  1MU2 A;  4FJG A;  2A42 A;  4WQ5 C;  1NGF A;  3VF2 A;  3S3O A;  4DF8 A;  1V4S A;  5BRH A;  4YOX A;  4J2B A;  4BRP A;  1VQO N;  3AO3 A;  3PX6 A;  2Z1G A;  3L4I A;  3H6E A;  5AQV A;  5BR8 K;  4QAG A;  1X9J A;  1BO5 O;  5HOO A;  1RBS A;  2VWK A;  4ICL A;  2ITM A;  5GIN A;  2BDP A;  1ASW A;  3HRG A;  4X64 K;  3GBT A;  4BG9 A;  3CXC M;  1T05 A;  4O55 A;  1IBM K;  3B8A X;  3ZSY A;  2GTD A;  4H8K A;  3VQP A;  3NH2 A;  3F5T A;  3K2P A;  1WBD A;  1NM1 A;  2I7P A;  4LC9 B;  1NK0 A;  1HMV A;  3BEX A;  1ZBI A;  2BUP A;  3C7N B;  3O4W A;  1LW0 A;  1ILY A;  5GAH P;  1ZXO A;  2WC9 A;  1GOB A;  1F21 A;  1SS6 A;  5HRN A;  1XI1 A;  3A5L C;  1MWK A;  2FXU A;  4CD3 A;  3DLG A;  3L2R A;  5MLC Q; 
#chains in the Genus database with same CATH homology
 4NYF A;  3PV8 A;  5E41 A;  3IRX A;  4O0I A;  4HCC A;  3QES A;  3ZCM A;  1KSP A;  4B9V A;  4BE1 A;  1U45 A;  2G8U A;  1ITG A;  4FLT A;  3AVH A;  1IKV A;  2OPS A;  4E89 A;  1LV5 A;  3VQ5 A;  1Z26 A;  2IAJ A;  1FK9 A;  1RT6 A;  1SL1 A;  3PO4 A;  4FLY A;  3LZJ A;  3P83 D;  1U04 A;  4BDY A;  3ZT3 A;  4DS5 A;  2KW4 A;  3DM2 A;  2KZM A;  3F9K A;  5HLF A;  3VQD A;  3OS2 A;  3OYK A;  3U3G A;  4FZZ A;  4CJQ A;  4PWD A;  4DSL A;  4DLE A;  3SPY A;  2G8V A;  4DTN A;  2HB5 A;  3NH0 A;  3ZSQ A;  4AHT A;  2PZS A;  2OYQ A;  1NK6 A;  3OYH A;  2ETJ A;  4OGE A;  1S9E A;  4KB1 A;  4AHU A;  3TAR A;  3HK2 A;  3VQA A;  4CJ4 A;  3OS1 A;  1VSD A;  3OJS A;  3MEG A;  1LWC A;  3CYM A;  1NK7 A;  4B9U A;  1HRH A;  2ZQB A;  2A1S A;  3QIO A;  5JS2 A;  2A1R A;  3LAK A;  3SYZ A;  2PYJ A;  3OYA A;  4W5N A;  2BE2 A;  3EZ5 A;  3QEP A;  3RWU A;  3WNE A;  4FJH A;  2HNZ A;  1J5O A;  1KRP A;  3SPZ A;  4ID1 A;  1TVR A;  5KGX A;  1TGO A;  3S3M A;  2G8K A;  1WSE A;  1EXQ A;  1WSJ A;  2RKI A;  4HUE A;  5CZ1 A;  4BE2 A;  2PYL A;  3JYT A;  4HVJ A;  5FRO A;  4FLW A;  4M3X A;  4FJL A;  3E01 A;  4QOZ B;  1C1C A;  4LY7 A;  2X74 A;  3NGZ A;  4CED A;  4FLU A;  2YNG A;  4PA1 A;  1CZ9 A;  1R0A A;  1BCM A;  3NGI A;  4NCB A;  2OPP A;  3L3U A;  2OZS A;  4ELU A;  1EKE A;  3SI6 A;  1TAQ A;  2FBX A;  1VSJ A;  4GMJ B;  4CFC A;  4CJV A;  1TK8 A;  4KRF A;  1CLQ A;  1TV6 A;  2QKK A;  4CK2 A;  1GOC A;  3DRP A;  4E7L A;  1UOC A;  3KTQ A;  1NK5 A;  1JLE A;  2AJQ A;  3V1O A;  1Z25 A;  1L3S A;  4CGG A;  1HPZ A;  1KTQ A;  1RDC A;  3O3G A;  2YKN A;  3HST B;  4N56 A;  3LP1 A;  3OYM A;  3QEV A;  2HMI A;  4DQQ A;  1EP4 A;  3K57 A;  4I9Q A;  3LAM A;  3K5N A;  1C1A A;  1WLJ A;  3ZSW A;  1WSF A;  3OVN A;  3P1G A;  4KO0 A;  1RT2 A;  2IGI A;  2RN2 A;  4B8A B;  4CEA A;  2ATQ A;  4ELV A;  1RT1 A;  3SV4 A;  3I0S A;  3DRR A;  4YNQ A;  4CIF A;  2FBY A;  2XY7 A;  4BWM A;  3KK3 A;  3SQ0 A;  4CES A;  4CJ3 A;  4DSE A;  1U47 A;  3DYA A;  3M8Q A;  4DSK A;  2G8I A;  3KIO A;  2Y1J A;  1BI4 B;  2G8W A;  2Z1H A;  4OVL A;  3K5L A;  3CFP A;  3PX4 A;  1REV A;  2PY5 A;  1KCF A;  1QS4 A;  1WAJ A;  4CJF A;  4RG8 A;  4CER A;  3NF7 A;  3TAF A;  2O4G A;  3PX0 A;  4N76 A;  4ZTJ A;  5CYM A;  4EZ9 A;  3MXM A;  4CF1 A;  1WSI A;  1BIU A;  1ZBU A;  4O4G A;  4DTX A;  4FK2 A;  2EHG A;  4J2D A;  1HQE A;  2YV0 X;  3U6F A;  5DK5 A;  1D9F A;  1S5J A;  3SUQ A;  1NKC A;  4KFB A;  1XHZ A;  3VA3 A;  2VG5 A;  3L8B A;  4W5Q A;  3K59 A;  1NKB A;  4DWI A;  3C6T A;  1I39 A;  2JLE A;  4KB0 A;  4KHU A;  4FVM A;  3AVK A;  4CEB A;  3HVR A;  4DTM A;  4B3O A;  1K6Y A;  4Z0U A;  3ZSX A;  1HNV A;  1VSH A;  3DLK A;  1UWB A;  4IFV A;  1NJZ A;  3V9X A;  3NGY A;  3SUN A;  4M42 A;  1EET A;  3QLH A;  3QEI A;  1T03 A;  1BHL A;  3MXJ A;  3AVL A;  5FDL A;  3HPO A;  4DLG A;  2ITG A;  3SQ4 A;  1HJR A;  4M41 A;  1J54 A;  4CFD A;  4BAC A;  3CM5 A;  5SZT A;  1DTT A;  1VRU A;  3LAN A;  4CK3 A;  4DFJ A;  4DFP A;  2DY4 A;  4M3R A;  3HVT A;  1A5W A;  2Z1J A;  3FFI A;  3OJU A;  3NCI A;  5J2N A;  3V6D A;  1BGX T;  4FJX A;  3PY8 A;  2NUB A;  3HP9 A;  4C8N A;  1QSS A;  5C42 A;  1BQN A;  4CK1 A;  1GOA A;  4CJE A;  4MQ3 A;  4CGJ A;  1X9M A;  3QIP A;  1QE1 A;  3HL8 A;  4ZHR A;  1IKX A;  2HHS A;  2KFN A;  4E1N A;  2D0C A;  3AVJ A;  3OYE A;  3QET A;  3QEW A;  1N6Q A;  4Q0B A;  3AA2 A;  3SJJ A;  4DU4 A;  1G15 A;  5KI6 A;  1CXQ A;  2E6M A;  1L3V A;  2HW3 A;  3O4N A;  2HHT A;  4Y1C A;  1U48 A;  2OPQ A;  4N47 A;  2P5O A;  4O44 A;  3U3Y A;  3RR8 A;  4DFM A;  1RBR A;  4RW4 A;  4DTR A;  4FJM A;  2E6L A;  1RTD A;  3V4I A;  2B4J A;  1HYZ A;  5HRS A;  1Y97 A;  4CFB A;  3SQ2 A;  3PO5 A;  3D45 A;  4O0J A;  4UQG A;  4DSF A;  3LP2 A;  3VQ4 A;  3VA0 A;  3TAN A;  4IKF A;  4CHQ A;  1RTI A;  3ITH A;  4CJP A;  2B5J A;  4EP5 A;  4BE0 A;  3V9W A;  1NOY A;  4CEF A;  4CIG A;  4FJJ A;  4FXD A;  4CF2 A;  1WSG A;  2IC3 A;  4KHN A;  3T3F A;  4C8L A;  4FJ7 A;  4OLA A;  1JLB A;  2YNF A;  4LH4 A;  4DQS A;  4FLV A;  1J9A A;  1XWL A;  1KVA A;  1TKD A;  2HVI A;  4W5R A;  4KHQ A;  4F4K A;  4H4O A;  4DQI A;  1VSI A;  1WAF A;  3ZSZ A;  4M3Z A;  1BIS A;  1TKZ A;  3ZT1 A;  3THV A;  4N41 A;  5HBM A;  4E7K A;  3ZSR A;  4DS4 A;  1TK5 A;  1S9G A;  4CEE A;  1NOZ A;  1RT3 A;  1A5V A;  2IOC A;  2X6S A;  3NFA A;  4B9T A;  3I0R A;  4J2A A;  4FM1 A;  1ZBH A;  1ZYQ A;  3ZT2 A;  4RW9 A;  1BCO A;  1EX4 A;  3O3F A;  4HHT A;  2KZZ A;  3OYC A;  1NJY A;  4NCA A;  5DMR A;  4DF4 A;  1VRT A;  3PUF A;  3HT3 A;  1SKR A;  4CEO A;  4CHP A;  1XC9 A;  3WNG A;  1X9W A;  1TL1 A;  4JS4 A;  2ZD1 A;  2G8H A;  2P51 A;  1JXE A;  4RW8 A;  1CXU A;  4DU1 A;  3DOK A;  1RT5 A;  3KLF A;  1QSL A;  3C95 A;  4K8X A;  2OPR A;  4KAZ A;  4GVM A;  3V9Z A;  3DLB A;  4DSI A;  1RBV A;  1T7P A;  4G1Q A;  1KLN A;  4KTQ A;  1LWE A;  3T1A A;  4DQR A;  1IKY A;  4N5S A;  2GV9 A;  4EP4 A;  4AH9 A;  3SQ1 A;  4CGH A;  3RTV A;  3HO1 A;  2XY8 A;  4KHY A;  3ISN C;  1L3T A;  3WNH A;  3L2V A;  1J53 A;  4FLZ A;  4HCB A;  4PQU A;  2HHU A;  5D3G A;  3I8D A;  5CYQ A;  3QNO A;  1SL0 A;  3DLR A;  3L2U A;  3QNN A;  1RIL A;  3LP0 A;  3SCX A;  4B9N A;  4B9M A;  1N5Y A;  3VQ6 A;  4Z4G A;  5CZ2 A;  3AVM A;  3LP3 A;  3VQ7 A;  4KTZ A;  3KLI A;  4CJ5 A;  3TAB A;  2VWJ A;  3IG1 A;  4C8K A;  3UIQ A;  3M8S A;  3OYD A;  4M3W A;  1TAU A;  3T19 A;  1VSE A;  1SKW A;  4CJS A;  3DLH A;  3DMJ A;  4KV8 A;  4XIU A;  3TI0 A;  3RRH A;  3IS9 A;  3M8P A;  3ASM A;  1RDB A;  2B6A A;  3AO1 A;  1UA0 A;  3AVA A;  4CF9 A;  5CY4 A;  1C0T A;  4QCL A;  1FKP A;  3VN5 A;  2RPI A;  3TAQ A;  1O1W A;  3CG7 A;  1D8Y A;  4ZTF A;  4IG3 A;  1B92 A;  5KTQ A;  3M8R A;  4KRE A;  3LWL A;  1HQU A;  1LAW A;  1IKW A;  1NK4 A;  4KHS A;  3LPU A;  3VQB A;  1KVB A;  3HM9 A;  4KTW A;  3L3V A;  4NCG A;  4F3T A;  4CF8 A;  1B9F A;  4F3O A;  3MEE A;  4TSX A;  3OYI A;  3NBP A;  4E19 A;  2W42 A;  4JS5 A;  1ZBF A;  4E1M A;  4IFY A;  1LAV A;  4OKK A;  1U4B A;  1U49 A;  3BGR A;  4MFB A;  4CIE A;  4DTU A;  4CJK A;  3G0Z A;  4OPK A;  2HNY A;  3V81 A;  1RT7 A;  3RMD A;  1C1B A;  4OKJ A;  3TAM A;  3OYB A;  2E4L A;  2OA8 A;  2KFZ A;  4ID5 A;  4DMN A;  4Q5V A;  3SZ2 A;  3OYN A;  3ZT0 A;  5I3U A;  3S3N A;  4E7J A;  5JS1 A;  1C6V A;  4FW1 A;  2FC0 A;  1IG9 A;  2EX3 A;  3HYF A;  2R7Y A;  2GBZ A;  4OJR A;  3L2W A;  3NE6 A;  1VK0 A;  4DG1 A;  1WSH A;  1IO2 A;  1JLG A;  3DOL A;  3OYJ A;  2Y1I A;  3EY1 A;  4WE1 A;  4IG0 A;  4NYN A;  1BIZ A;  3KLG A;  4CEC A;  1Q8I A;  3H08 A;  5T7B A;  3IAY A;  3AO2 A;  4Y1D A;  1LW2 A;  3TR8 A;  3KKR A;  3NF8 A;  4F2R A;  4FK4 A;  3JSM A;  1B9D A;  5HRP A;  1S1U A;  3D0P A;  2QKB A;  1A5X A;  2WOM A;  3KKS A;  4O5B A;  3SUO A;  3HPG A;  1JXB A;  4CJR A;  2DTU A;  4AHS A;  1X1P A;  3VQQ A;  4DSJ A;  1RTJ A;  4C8M A;  3TAP A;  4HUF A;  3A2F A;  2QK9 A;  4FW2 A;  3NF6 A;  2D0A A;  4LSN A;  4CHN A;  4RW6 A;  4DFK A;  2Q3S A;  2Z1I A;  3DLE A;  4LSL A;  5EU7 A;  4M45 A;  3QEX A;  4KHW A;  3V1R A;  3AA5 X;  4B8C A;  3OY9 A;  2WON A;  4CHY A;  1RNH A;  4BDZ A;  3KLH A;  2FBT A;  5J1E A;  4CHO A;  3NHG A;  4Z4E A;  1W9H A;  5HRO A;  4BDP A;  4CJU A;  1RCH A;  3NF9 A;  3HP6 A;  4CJW A;  4CGF A;  2XO7 A;  3TAG A;  3DRS A;  4DU3 A;  3RR7 A;  3QO9 A;  3AA3 A;  3OYL A;  2F8T A;  4GW6 A;  4FJ8 A;  3AVB A;  3CM6 A;  1NJW A;  1JL2 A;  3NH1 A;  1ZBL A;  3SUP A;  4ELT A;  1IH7 A;  1JLC A;  4RW7 A;  2YNI A;  2KTQ A;  1L3U A;  3B6P A;  4DQP A;  3KLE A;  5J2Q A;  1YTA A;  4C8O A;  1S1V A;  4DTO A;  1RBT A;  4CF0 A;  1S1X A;  5HP1 A;  1NK9 A;  3O3H A;  4EZ6 A;  4KI6 A;  4AHC A;  1JLA A;  3VQE A;  5I42 A;  1KFS A;  4DTJ A;  3LDS A;  3MED A;  2F96 A;  4AIL C;  4FK0 A;  2XY5 A;  2O4I A;  3KK1 A;  3ALY A;  4M3Y A;  1JLF A;  4I2P A;  2GUI A;  1C0M A;  1NKE A;  4FJK A;  4BWJ A;  1VSK A;  3AVN A;  1QQC A;  2D5R A;  4E7H A;  2OZM A;  3ZT4 A;  2DFE A;  1Q9X A;  3BDP A;  4L8R B;  3HPH A;  4FLX A;  5KRS A;  3KJV A;  2IS3 A;  4J2E A;  1TKT A;  1YTU A;  1CZB A;  4CE9 A;  4Z4F A;  3CFR A;  3SNN A;  4CCH A;  4HTU A;  1RTH A;  1RDA A;  3LWM A;  4FM2 A;  1SUQ A;  1KLM A;  1JLQ A;  5FRM A;  4F8R A;  3LPT A;  2HVH A;  3RMC A;  1WN7 A;  4AHR A;  4DTS A;  3MXI A;  3B6O A;  4LH5 A;  4CEQ A;  3S9H A;  4FYD A;  1Q9Y A;  1X9S A;  1S6Q A;  2YNH A;  3AVG A;  3KD5 E;  2HHX A;  3ZSO A;  4I9L A;  1SL2 A;  4KKO A;  4CFA A;  4OLB A;  4B08 A;  3K5O A;  3HXM A;  4DTP A;  1S6P A;  5J2M A;  3CFO A;  4PY5 A;  1HYS A;  2HHW A;  1WNS A;  3SV3 A;  4FCY A;  3VQ9 A;  4W5T A;  1D9D A;  1W0H A;  4I2Q A;  4FZY A;  1RT4 A;  4HUG A;  1LWF A;  4Z4C A;  2F8S A;  5J2P A;  5K14 A;  3VQC A;  3AA4 A;  3QER A;  1L5U A;  4OGC A;  2VG7 A;  3ULD A;  3KD1 E;  3OYF A;  2VG6 A;  4FJ9 A;  2BGG A;  1VSF A;  1TL3 A;  1UA1 A;  2FBV A;  4E3S A;  4B9S A;  2HND A;  4FJI A;  4M3U A;  2YKM A;  1DTQ A;  1RDD A;  3K58 A;  3RMA A;  3VQ8 A;  1ASU A;  2I5J A;  2LSN A;  4Z4I A;  1TK0 A;  4FZX C;  5KGW A;  3KK2 A;  4B9L A;  1DLO A;  3OYG A;  4F2S A;  1NK8 A;  4M3T A;  2XY6 A;  1KFD A;  4I7F A;  1D5A A;  4CHZ A;  1I3A A;  1QTM A;  2QXF A;  2YHA A;  3O4Q A;  5KRT A;  4E7I A;  1HYV A;  2BAN A;  2KQ2 A;  3C6U A;  3P5J A;  1SV5 A;  1ASV A;  1KVC A;  3AO5 A;  3AO4 A;  4JRP A;  1FKO A;  1MU2 A;  2P1J A;  3ZSV A;  4FM0 A;  4FJG A;  5C25 A;  1BL3 A;  3DI6 A;  3V9U A;  1JL1 A;  3S3O A;  1BI4 A;  1VSM A;  4DF8 A;  3L2Q A;  1XHX A;  1FXX A;  4J2B A;  3AO3 A;  4CEZ A;  5SWM A;  2YHB A;  2Z1G A;  3PX6 A;  1C0U A;  2IDO A;  2X78 A;  5C24 A;  2G8F A;  4CGD A;  4QAG A;  4IBN A;  1HNI A;  3LZI A;  4CGI A;  1QSY A;  4CJT A;  1RBS A;  3WNF A;  4E0D A;  2VWK A;  4ICL A;  2BDP A;  2XHB A;  3AVF A;  4OPJ A;  1ASW A;  1NJX A;  4YFU A;  3F73 A;  3QIN A;  2DFF A;  2DFH A;  3AVC A;  4FJ5 A;  1T05 A;  4O55 A;  4PUO A;  3HJF A;  3K5M A;  2P5G A;  2D0B A;  3ZSY A;  2RF2 A;  3MEC A;  4H8K A;  3VQP A;  3LAL A;  4W5O A;  3AV9 A;  4AHV A;  4Z4H A;  3K2P A;  3NH2 A;  3V9S A;  3EYZ A;  1SKS A;  4KI4 A;  4H4M A;  4KPY A;  1NK0 A;  1HMV A;  3OS0 A;  1S1T A;  1JKH A;  3NDK A;  3C94 A;  1ZBI A;  2HHV A;  3AVI A;  2XRI A;  3V1Q A;  1VSL A;  3G10 A;  4IDK A;  3MAQ A;  4JRQ A;  3RRG A;  2HHQ A;  3TAE A;  1S1W A;  1TKX A;  4K8Z A;  1LW0 A;  4CJL A;  3NAE A;  3RMB A;  2ZE2 A;  4OKE A;  1YT3 A;  4LD0 A;  4R5P A;  3TWH A;  1GOB A;  1F21 A;  1T8E A;  5HRN A;  1QHT A;  4FJN A;  1BQM A;  2JGU A;  1XI1 A;  5FRN A;  1RBU A;  1YVU A;  5HRR A;  3CQ8 A;  2X6N A;  4JLH A;  1UAX A;  3DLG A;  3L2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...