1W0HA

Crystallographic structure of the nuclease domain of 3'hexo, a deddh family member, bound to ramp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
200
structure length
200
Chain Sequence
b'ADSYYDYICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYVRPEINTQLSDFCISLTGITQDQVDRADTFPQVLKKVIDWMKLKELGTKYKYSLLTDGSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPHCGLDDSKNIARIAVRMLQDGCELRINEKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3'-5' EXONUCLEASE ERI1
publication title Crystallographic Structure of the Nuclease Domain of 3'Hexo, a Deddh Family Member, Bound to Ramp
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 57
structure length 200
sequence length 200
ec nomenclature ec 3.1.-.-:
pdb deposition date 2004-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1w0hA00
4DTSA 4KHNA 2JGUA 4CGIA 3AVKA 1RDCA 1NK6A 2YHAA 4NCBA 4GVMA 3ZCMA 1KTQA 3DOLA 4H4MA 4NYFA 4CJLA 3M8SA 4H4OA 4CEAA 3LP2A 3NBPA 4CJPA 4HVJA 3CFOA 4RW6A 3D0PA 4M3YA 3HPGA 3A2FA 3V9SA 3NFAA 4FW1A 1S9EA 3T3FA 2P5GA 4F4KA 2KZZA 3G0ZA 1X1PA 5FROA 3U6FA 3C94A 3TI0A 4AHCA 1LAVA 3EY1A 4CIEA 4DF4A 1JLEA 4LD0A 4E89A 1RTDA 1WNSA 4ZTJA 1RDBA 3SPZA 4DMNA 1SL0A 3OYDA 4DQQA 2G8KA 2WONA 4EP5A 1RILA 5E41A 4Z4CA 4FM0A 1ZBUA 1KVAA 1S1UA 3VQAA 4FLZA 3IG1A 3CFRA 1T05A 1NK9A 4DSLA 4FJLA 1BI4A 3HP9A 1S1VA 4OGEA 1RBUA 5HRRA 1WSEA 4B8CA 4N5SA 3SUQA 5FRNA 5I42A 4KFBA 4CGFA 4QCLA 3D45A 3SI6A 1QSSA 1GOBA 4C8NA 3THVA 2F8SA 5HBMA 4CJ5A 4EP4A 4R5PA 4CFBA 3VQ8A 1QSLA 4CJVA 1EETA 3ZSWA 2Z1JA 3VQ9A 3QEVA 1ZBIA 4CF8A 2BANA 3T1AA 3ZSXA 4B9SA 1EP4A 1LW2A 2Z1GA 2HNYA 2OPPA 1VSMA 3C6TA 4OVLA 5C25A 3VA3A 2XY6A 4Q0BA 5KI6A 1HQEA 2Z1HA 3KLGA 3H08A 2D0AA 1W9HA 1VK0A 3RTVA 1NJXA 3AA4A 3SQ4A 3VQ7A 3ZT1A 4AILC 4FJJA 1FXXA 4FK0A 3AVHA 3V9WA 3ISNC 2KFZA 3L8BA 1L3UA 1WSHA 4FCYA 1CZBA 2IC3A 3IS9A 4F8RA 1NK0A 2RF2A 4J2EA 3KD5E 1BQNA 3VQCA 1JLQA 1F21A 1RBTA 3DM2A 3LZIA 5J2MA 3TAPA 5DMRA 2OYQA 1D9FA 4B9VA 4W5RA 1C1BA 3TAFA 4E7IA 1UAXA 1K6YA 4HUFA 3OYEA 1LAWA 3VQ5A 1C0TA 1ZBHA 3TR8A 3HYFA 3OYCA 4BE0A 4FK2A 3L3VA 1IKXA 2HHTA 4E0DA 1L3TA 2P1JA 3OYMA 1YVUA 3K58A 3AA2A 2ETJA 4O4GA 3NDKA 4ID5A 4BE1A 3WNGA 1T7PA 1NOZA 3RMCA 3S3NA 3ZSRA 3LWLA 4M3WA 3C95A 5KGXA 4F2SA 3SNNA 3OYLA 3V81A 2YNHA 3C6UA 3VQDA 3MECA 1D5AA 2VG5A 2HMIA 4KI6A 2HHWA 3G10A 4WE1A 1NOYA 4ELUA 3MEGA 3I0SA 2G8FA 2G8UA 2ZQBA 1RDAA 1CXQA 4FM2A 4PWDA 1JLFA 4CIFA 3F73A 1UOCA 1FKPA 4FJ8A 4BWJA 3V1RA 4PUOA 1WAJA 4BDZA 2XRIA 4FJ5A 5J1EA 4CK2A 4DTMA 1UWBA 2IS3A 4I2QA 1TL3A 2ZE2A 4FLWA 3OVNA 4CE9A 1L5UA 3QNOA 4MFBA 1BL3A 1WSFA 4CEZA 4NCAA 3LZJA 1MU2A 4AHSA 3OYKA 1U47A 3MXMA 2PYLA 1S1TA 3KJVA 3SV4A 2A1RA 1W0HA 1HYZA 4EZ6A 1BISA 4ID1A 3TWHA 2O4GA 3AO1A 3MEDA 5KRTA 1RT3A 1JXBA 2XHBA 4NYNA 2YNIA 3SUPA 1EXQA 4B8AB 3ZSYA 4ELTA 1C0UA 4KPYA 4M41A 4CHPA 1HNVA 3KKRA 3PO5A 4FZYA 3L2WA 5D3GA 4FLYA 3KD1E 3NGZA 2OPSA 3M8RA 3DRRA 1TK5A 2EHGA 3QEPA 2F8TA 1BI4B 3HJFA 2KW4A 3DLRA 4OGCA 4AHVA 1A5WA 4M45A 3CM6A 4B08A 2P51A 5SWMA 4IFYA 3JSMA 3AO4A 4JRPA 1U48A 4OPJA 3DLBA 4C8LA 4FJNA 2YKMA 1S9GA 1VSKA 3AVIA 3DRPA 2GV9A 3MEEA 4DS4A 4CHNA 3NH2A 1HPZA 1NK4A 4W5TA 4AHRA 2HVHA 4CGJA 1L3VA 1J53A 4JS5A 4FJHA 3V1OA 2D0BA 1RT4A 2IDOA 3HPHA 3IRXA 1BCOA 2EX3A 4DU4A 4LH4A 1KVBA 1EX4A 2KQ2A 3KLIA 2HNZA 1B92A 4KB1A 4M42A 3QINA 2X6SA 5CZ2A 5C42A 3HT3A 4Y1CA 4B9NA 2D0CA 4CEQA 1BQMA 4CEEA 4DTNA 3PO4A 3K57A 2P5OA 1TVRA 5HRSA 3L2UA 4CGDA 1KFDA 1C0MA 4E3SA 4DWIA 3KKSA 4DG1A 4L8RB 4DU3A 3F9KA 4GMJB 4CJFA 3NF9A 1BCMA 1Z25A 1T8EA 3MXJA 2Y1IA 4QAGA 1VSIA 4CFCA 4CJUA 3AVFA 3LAMA 4CJWA 1LW0A 1N6QA 3NHGA 1TV6A 2HVIA 2VG6A 1U45A 4DSJA 1LWFA 4CERA 2Y1JA 4I9QA 4CJ4A 1YT3A 1JLAA 2RPIA 1UA0A 4DSKA 3QIPA 4CEBA 4KHQA 4DSIA 3NGYA 3QEIA 4YFUA 1JL2A 4ELVA 2PY5A 1IO2A 3VQQA 4FJ9A 2HW3A 5J2QA 2YNGA 1BIUA 1BGXT 4E7KA 3SQ2A 4FLUA 4UQGA 1RTJA 1TKXA 3BGRA 1O1WA 1HNIA 1SUQA 4CEDA 5KTQA 3JYTA 4HCBA 1Q9YA 4KHSA 4CGGA 3QEXA 4BDPA 4M3RA 3LP0A 4CF9A 4BDYA 4MQ3A 4J2DA 4JRQA 4FLXA 3SQ1A 4HUEA 2YKNA 3AA5X 4ZTFA 2IOCA 3BDPA 4RW4A 1SV5A 3HPOA 1L3SA 1X9SA 4Z4IA 2D5RA 1RT7A 1S6PA 3ZT4A 3NCIA 1JL1A 1C1CA 4DLEA 3OJUA 4KTQA 3NE6A 4DQSA 3EZ5A 1ASUA 1KLMA 3B6OA 1QTMA 4B9UA 1I39A 4KV8A 4C8MA 3HSTB 1T03A 1NKEA 4NCGA 1S6QA 3B6PA 3ZSQA 1R0AA 4DTUA 4HTUA 1LV5A 1NJYA 3I0RA 1ZBFA 4EZ9A 1LWEA 3MXIA 1YTUA 5C24A 4M3UA 3OYAA 1QS4A 1YTAA 1IKWA 3ZSVA 3NH0A 3OYGA 2A1SA 4Y1DA 4FLVA 3SZ2A 4DTJA 3QNNA 5I3UA 4FZXC 4OLBA 2BDPA 3AO3A 1BHLA 4FM1A 4O5BA 3V1QA 1X9WA 3LDSA 4FZZA 2BGGA 3K2PA 3M8QA 3OS1A 4E1NA 1RBRA 1IKVA 2YHBA 4E7JA 3LALA 3AVJA 2KZMA 4FK4A 4DLGA 1KLNA 1RDDA 1IH7A 4CJKA 3AVGA 4CIGA 3V6DA 1TK0A 4QOZB 2E6LA 2X6NA 3CG7A 3QERA 3NH1A 2BE2A 3P1GA 1Q9XA 4FJ7A 4M3ZA 2HNDA 3LAKA 2G8IA 1VSFA 4DQRA 4DTPA 4CF0A 4C8OA 1FKOA 4N41A 1REVA 3AV9A 4CHYA 5T7BA 1NKBA 3K5MA 4I7FA 4CFAA 3L2QA 2G8HA 1RT6A 5HP1A 3KTQA 2ATQA 2OZMA 3ZSZA 1ZBLA 2ZD1A 1SKWA 1XC9A 1RT1A 4B9TA 1CXUA 4YNQA 1XI1A 4G1QA 4OKKA 1NJZA 3WNFA 4Z4GA 4CJ3A 3CQ8A 4KHWA 3P5JA 3VQ4A 4CJTA 4HCCA 2KTQA 1J9AA 3KK2A 1JXEA 1TAQA 2FBVA 3AA3A 4KRFA 3ZT3A 1RNHA 4F3OA 3O4NA 4IFVA 4Z4EA 1BIZA 4FYDA 3LANA 1IKYA 3V9XA 4CECA 3DYAA 3AVAA 2Z1IA 3NF6A 4CF1A 3HM9A 3WNHA 4N47A 1HMVA 1SL1A 2HB5A 3TAGA 2YV0X 2XY7A 3OYHA 4AHTA 2DFFA 5K14A 3PY8A 3QESA 4DQPA 2GUIA 1TKZA 2F96A 1QE1A 1JLCA 3LPUA 4E1MA 3L2RA 3QO9A 1WSJA 3DOKA 3DRSA 3U3YA 5HLFA 1J54A 1KVCA 3QETA 2G8WA 1WSIA 1CZ9A 3PUFA 4FVMA 4ZHRA 2OA8A 1A5XA 4J2BA 4OKEA 3V9UA 1KSPA 4CCHA 1B9FA 2X78A 2B6AA 3SUOA 3MAQA 3UIQA 3O4QA 4DS5A 2RN2A 4N76A 1NK8A 2QKBA 1RTHA 4PA1A 1TK8A 3O3FA 3PX6A 4RW8A 3TAQA 1DLOA 4Z4FA 2W42A 5CYQA 3FFIA 3OYIA 3RWUA 2PYJA 2XY5A 1RT2A 1HQUA 1TAUA 2R7YA 5KRSA 3SCXA 3P83D 1WAFA 3CFPA 1WSGA 4KI4A 4OLAA 4Z0UA 4BWMA 1G15A 4CK3A 3KLEA 3CM5A 3VQPA 4DSFA 3V4IA 4DFMA 2AJQA 4LH5A 1VSEA 4RW7A 3SJJA 4DU1A 1N5YA 4O0IA 2HHVA 4O0JA 1FK9A 2DFEA 3AVMA 2OZSA 2DY4A 1XHXA 3LWMA 2G8VA 3RR8A 1CLQA 4W5QA 4DFPA 3HK2A 3ALYA 2IAJA 1GOAA 3L3UA 3EYZA 3TAMA 3U3GA 2B4JA 1XWLA 4CESA 3T19A 2DTUA 4CGHA 3OS0A 4HHTA 2ITGA 5FDLA 4IG3A 4Q5VA 4CHQA 1U49A 1X9MA 2FBXA 3HXMA 1HYSA 2OPQA 1GOCA 1Y97A 1XHZA 3TARA 2HHUA 2QXFA 1RTIA 4O55A 1JLBA 3NGIA 5EU7A 2VWJA 3AVLA 4F2RA 4B9LA 2X74A 1JKHA 4FJIA 4K8XA 3S3OA 2B5JA 3E01A 3RRHA 1KRPA 4F3TA 1Q8IA 2E6MA 2VG7A 4TSXA 3HVRA 2PZSA 3AVNA 1ITGA 1RBVA 4DSEA 4KREA 3KLFA 3LP1A 2O4IA 3VQEA 4DQIA 4E7LA 4BACA 1ZYQA 3OYJA 3QIOA 3RRGA 4I9LA 2I5JA 1RBSA 1C6VA 3AO2A 3DLEA 4O44A 1ASWA 5DK5A 5JS1A 4N56A 1S5JA 3HVTA 3O3HA 1WLJA 1VSLA 3OYBA 3SYZA 3VN5A 1Z26A 2RKIA 3WNEA 5SZTA 3OYNA 1VSDA 4OKJA 1NJWA 2OPRA 4FXDA 3ASMA 1DTQA 1KFSA 3TAEA 3K59A 2VWKA 2IGIA 3KIOA 1SKSA 4B3OA 5HROA 4KTZA 3M8PA 4B9MA 1IG9A 1VSJA 4LY7A 3V9ZA 3PX4A 3K5OA 3QLHA 3I8DA 2LSNA 4LSNA 4DTOA 4KAZA 1EKEA 4FJKA 4HUGA 3ZSOA 4CK1A 4I2PA 2YNFA 4FJMA 4CHZA 3HP6A 4C8KA 3VQ6A 1VRTA 1I3AA 4CJEA 5JS2A 1HYVA 4Z4HA 1NK5A 4DFKA 2NUBA 3LPTA 3TABA 1A5VA 1QHTA 3SPYA 2FC0A 3AVCA 3QEWA 2WOMA 4IBNA 4KTWA 4OJRA 4M3XA 5HRNA 4E7HA 3OJSA 3RR7A 3KLHA 4FW2A 3NAEA 4FJGA 4XIUA 2HHQA 1B9DA 1NKCA 3PX0A 3IAYA 3DLHA 4W5NA 4LSLA 5J2PA 4BE2A 1TL1A 1NK7A 3HO1A 3L2VA 4AHUA 4CEFA 1TKDA 3K5NA 1VSHA 3AVBA 4AH9A 4JS4A 4FJXA 1D8YA 3RMBA 3CYMA 2QK9A 4E19A 2FBTA 1JLGA 2Q3SA 3RMAA 4DTRA 4CJRA 1U04A 1VRUA 2DFHA 2JLEA 3ITHA 5J2NA 1WN7A 4KHYA 3ZT2A 3OS2A 4ICLA 2HHXA 1LWCA 4CJSA 4CJQA 2GBZA 4CEOA 3K5LA 1KCFA 4IDKA 2FBYA 1QSYA 3VA0A 1HJRA 1QQCA 3LP3A 3OY9A 1SKRA 4H8KA 2QKKA 4KHUA 1HRHA 3VQBA 4JLHA 3DLGA 1D9DA 2XY8A 1UA1A 2HHSA 4RG8A 3RMDA 1S1WA 1C1AA 1DTTA 1TGOA 3HL8A 4IG0A 4W5OA 3DMJA 3O3GA 3ULDA 3PV8A 1SL2A 4J2AA 5FRMA 5CYMA 3SUNA 4M3TA 1RCHA 5KGWA 5CZ1A 3TANA 3AO5A 3OYFA 1TKTA 1U4BA 3DLKA 2E4LA 4DFJA 2KFNA 4DTXA 3ZT0A 3SQ0A 4IKFA 4OPKA 1RT5A 4PQUA 5CY4A 1ASVA 3NF8A 3DI6A 4KO0A 1J5OA 4KB0A 4K8ZA 4FLTA 5HRPA 3SV3A 3KK1A 4DF8A 3S9HA 4CF2A 3KK3A 4RW9A 3S3MA 2XO7A 4KKOA 4CHOA 4GW6A 4CFDA 4PY5A 1S1XA 3NF7A
chains in the Genus database with same CATH superfamily
3CCEN 4KHNA 5FPNA 3E9OA 1NK6A 4NCBA 4GVMA 3T69A 4H4MA 1P8ZA 4CJLA 4LC9B 5LJWA 4HVJA 4RW6A 3D0PA 1ATRA 3HPGA 4FW1A 3T3FA 4I6MA 3G0ZA 1X1PA 2QEXN 1ESVA 5FROA 4GVEA 4CIEA 4LD0A 3U4LA 2YHYA 4QS7A 1HNWK 1WNSA 3SJHA 2ZGYA 3BEXA 4EP5A 4FLZA 2KKZA 1ZBUA 1S1UA 3VQAA 1GLJO 3CFRA 1NK9A 3HP9A 1Y64A 3D7EO 5HRRA 3SUQA 4WCEL 5C2DA 4CGFA 3SI6A 1GOBA 2FF6A 4EP4A 2OCEA 3OBYA 4BQZA 1VAZA 1YIJN 3J7AP 2Z1JA 1MWMA 4H5RA 3T1AA 3ZSXA 1LW2A 3C6TA 4J8FA 1VSMA 3ZEUB 3SAHA 2Z1HA 3H08A 3S41A 2P9SB 4KH4A 3AA4A 4YY3K 4FK0A 3AVHA 3WEEB 4OX9K 3VETA 3A5LC 3GL1A 3P4IA 1SZ2A 3DM2A 1F21A 1RBTA 3LZIA 5J2MA 1D9FA 1Q7YO 3TAFA 2YJEA 3OW2M 3VQ5A 1C0TA 3HYFA 3WQTA 2JWKA 5EX5A 2HHTA 2F7TA 4E0DA 1YVUA 4BE1A 1VQMN 3R8EA 3SBTA 4DV1K 3ZSRA 3C95A 4F2SA 3SNNA 5LMUK 1D4XA 4H0TB 1ATSA 3O4WA 3O6WA 1Z6RA 3G10A 1NOYA 4BREA 3D2FB 3I0SA 4H5NA 3EE8A 1ZBSA 2QWMA 1FKPA 4JD2A 4FL9A 1WAJA 4BR4A 2XRIA 1UWBA 1IBKK 1TL3A 3SMSA 1NGIA 2P9UA 4CE9A 4CEZA 1LOTB 2Q36A 1RFQA 1S1TA 4LFAK 1J5EK 3TWHA 3QDKA 1JXBA 2YNIA 1QQOA 1EXQA 4B8AB 3ZSYA 1C0UA 2GWJA 4IDHA 5BR9A 2OPSA 3DRRA 2EHGA 3QEPA 1VQ6N 1NBWA 4M45A 3CM6A 4ISFA 4M42A 2WBNA 3MEEA 1S9GA 3DRPA 4CHNA 3CCMN 1HPZA 4AHRA 3HSCA 1J53A 4FJHA 3HPHA 5M1QA 1BCOA 2QWNA 3T1HK 1KVBA 1EX4A 2E1ZA 3L6QA 2KQ2A 2GUPA 3R9PA 1IJJA 3QINA 5C42A 4Y1CA 1X3NA 4CEEA 3PO4A 3K57A 2P5OA 3L2UA 4CGDA 1OVQA 1C0MA 3KWIA 5LMNK 3F9KA 1Z25A 2Y1IA 5GIPA 2NLXA 3FE1A 1MWKA 2ASOA 3CCUN 2Y1JA 4CBUA 5M1NA 3QEIA 2I7NA 3UB5A 3WT0A 2Q0UA 2HW3A 3DJCA 2YNGA 1BIUA 1BGXT 1N34K 3MCAB 1XQSC 4UQGA 1TKXA 3F2KA 3JYTA 2VQEK 1Q9YA 4LF8K 4BDPA 4CF9A 3TU5A 4BDYA 4BRHA 4JRQA 4J2DA 2VQFK 2YKNA 3WXKA 1X9SA 3QICA 4Z4IA 2D5RA 3ZT4A 3C7NA 3G25A 3OJUA 3LM9A 3NE6A 4KTQA 4Y0WA 1SQKA 3ID8A 1T03A 1NKEA 2V52B 1R0AA 1RGIA 1LV5A 1NJYA 2W40A 2E8AA 1NGBA 2QXLA 3VGKA 4EHTA 2BUPA 1CZAN 4DUZK 2BDPA 2YHXA 4FWKA 4O5BA 5AQLA 3V1QA 4A62A 4BRFA 1TYQA 1IKVA 5C10A 3O5BA 2F9WA 4DKWA 4FK4A 1RDDA 3QFPA 1X9JA 3AVGA 4CIGA 3V6DA 1TK0A 1Q9XA 3QERA 4M3ZA 3P1GA 4DQRA 1YUWA 1FKOA 3H1QA 3K5MA 2HF4A 3UE5A 5HP1A 2ATQA 3O9TA 3QFUA 1ZBLA 4JKGB 1XC9A 4GKJK 4OKKA 4Z4GA 4JI3K 4CJ3A 3AA3A 2UXBK 3O4NA 2Q97A 4IFVA 4FYDA 3LANA 3A5NC 3CETA 3AVAA 2Z1IA 3NF6A 2BTFA 3HM9A 2O8EB 3GDQA 4K42A 2HB5A 3TAGA 3MWTA 4AHTA 2GUIA 1TKZA 1NK0A 3DRSA 3SBGA 3QETA 4CZJA 4FWNA 1HKGA 2O8DA 4OKEA 3V9UA 1KSPA 2Q1NA 3L4QA 2GWKA 4RWTA 1ILYA 3MAQA 3UIQA 3O4QA 2QKBA 1NK8A 2R7YA 4Z0UA 1G15A 4CK3A 3KLEA 4KHPK 4GV3A 4DFMA 2AJQA 4LH5A 4LFBK 4DU1A 3CMAN 4O0JA 3NVMA 4C1NK 3AVMA 2OZSA 2DY4A 4BRDA 4DFPA 4YORA 3OBWA 1GOAA 3KHYA 1YITN 1DT9A 4CGHA 3OS0A 1X9MA 3HXMA 1HYSA 1GOCA 3NVKA 3TARA 4WFAL 3SAFA 2QXFA 1RTIA 3PLAA 3NGIA 2VWJA 4A5AA 2QI2A 3AVLA 4F2RA 2UXDK 2X74A 5AZIA 4FJIA 4K8XA 4OPAA 2B5JA 3E01A 1Q8IA 2E6MA 4H0VB 1U2VA 3AVNA 1RBVA 3LP1A 3VQEA 3OYJA 4IO9L 5AQVA 5DK5A 1K8KA 4CJ7A 4N56A 1S5JA 3HVTA 1WLJA 3OYBA 3SYZA 5SZTA 1TUYA 2RE2A 3ASMA 3M8PA 2P9LA 4B9MA 3BP8A 2WFBA 1VSJA 2LSNA 4LSNA 4KAZA 3H1VX 4ILGB 4FJKA 3THYB 4C8KA 5JS2A 1HYVA 1NK5A 3CQYA 4OJRA 2F9TA 3OJSA 5A2QO 4DCHA 4IO8A 1NKCA 4U7BA 4BE2A 1TL1A 2ZF5O 4DR4K 1TKDA 3O9UA 2YX6A 3CYMA 3RMBA 4E19A 4L3QA 4JKAA 2FBTA 4E1JA 3VTHA 4DTRA 4GY2B 4CJRA 2JLEA 2HSTA 1M1KO 3OS2A 3CMEN 2HHXA 2O8BB 5EY4A 1LWCA 3L4IA 3KK7A 3VA0A 3THWB 1JJ2M 1HJRA 1HNXK 4KHUA 4BR7A 3EKSA 4JLHA 3MX5A 3OA9A 3RMDA 1DTTA 1TGOA 3DMJA 5FRMA 3SAGA 3SUNA 4M3TA 5JMVA 3TTDA 1O13A 3AO5A 2PFUA 1TKTA 3OTOK 5BPLA 4DFJA 2OTLN 4DTXA 4MO5A 4BC3A 1OVYA 3FR0A 4PQUA 2A42A 1Q81O 3NF8A 2QTDA 1J5OA 3SV3A 3BZCA 3KK3A 4RW9A 2P9NA 4GW6A 2Q0RA 4U67L 4LF4K 1RDCA 2YHAA 1BA0A 3ZCMA 3DOLA 3O9RA 4BGAA 3M8SA 3LP2A 4DV5K 3CFOA 3V9SA 4EFHA 3CCVN 1S9EA 2P5GA 2KZZA 3TI0A 3C94A 4AHCA 4IOXA 5E26A 4E89A 4QS8A 4ZTJA 4DMNA 4DQQA 4FWQA 1RILA 3O1BA 4FM0A 4M3WA 4DSLA 1BI4A 4B8CA 5I42A 4KFBA 4CJ5A 4R5PA 5BRDA 4CJVA 2O8FB 2BANA 1RDWX 2F4VK 2OPPA 5C25A 4OVLA 5KI6A 1HQEA 3FZMA 3TPQA 4FJJA 4WFNL 4JHDA 3V9WA 3ISNC 2KFZA 5GADP 3MN5A 3AAQA 4CZMA 2RF2A 4LF5K 1JLQA 4YDUA 4JD2B 3TAPA 5GINA 2OYQA 3N4QA 3E9LA 1C1BA 4E7IA 1UAXA 1K6YA 4HUFA 2HBJA 3OYEA 1LAWA 1ZBHA 3TR8A 3I55N 4FK2A 2P9UB 3ZX0A 3L3VA 2QWLA 5AQFA 3K58A 3FFKB 4O4GA 3IFRA 4ID5A 3WNGA 2W41A 1T7PA 3RMCA 3LWLA 4QS9A 5KGXA 3CC7N 4DV3K 3V81A 2YNHA 2V7ZA 1D5AA 2VG5A 2HMIA 4MO4A 3CCSN 3E9PA 2G8UA 4AM7A 2ZQBA 1RDAA 1CXQA 4CIFA 3LL3A 4PUOA 3VEXA 5AQQA 4BRKA 5BN9A 3TTFA 3QNOA 1BL3A 4CZLA 4DV0K 4AHSA 1E4FT 3CPWM 1S72N 5F2RA 1U47A 3KJVA 3CJCA 2CH5A 3CCQN 4JK8A 1E4GT 4EZ6A 2GEMA 2JWLA 3AO1A 5KRTA 2E2QA 5TKYA 5F1XA 4YOUA 4FWMA 4KPYA 3KKRA 3PO5A 5BRFA 4FLYA 3M8RA 4PL7A 2F8TA 4H0YB 3HJFA 4M7XA 4AHVA 1U48A 4B08A 2IVOA 1P90A 3JSMA 3AO4A 2AP1A 3DLBA 4OPJA 4C8LA 2GV9A 3L0QA 3NH2A 4X64K 1NK4A 3O9SA 2HVHA 5AQUA 4JS5A 3ENBA 3V1OA 2D0BA 4NXMK 1RT4A 2NZTA 3IRXA 4H0OA 2EX3A 4DU4A 1YHQN 3AARA 3M5RA 3KLIA 2HNZA 4KB1A 5AQMA 3MK6A 1EWRA 1WUAA 5HRSA 4DR1K 4B1YB 1KFDA 4DWIA 3KKSA 1GLDG 4FOEA 4DG1A 2HHHK 3CC2N 4GMJB 4NB4A 3M1FA 3NF9A 5AQSA 4CJFA 1OH7A 4BQLA 1VSIA 4CJUA 4CD1A 1LW0A 1N6QA 3TSPA 1TV6A 2WC9A 4FVUA 4WYBA 5ADXA 2VG6A 5M1OA 1U45A 4I9QA 3K9KA 2RPIA 4DSKA 5FPEA 4DSIA 4KHQA 4CD3A 3SQ2A 4JI0K 1RTJA 4CEDA 5KTQA 3VTIA 4KHSA 5KPRA 4DUYK 3GBTA 1XC3A 1TYQB 3AA5X 4ZTFA 1XNRK 2IOCA 3BUZB 3BDPA 1SV5A 1L3SA 3NCIA 1C1CA 3B6OA 2QWQA 4BRIA 3J80O 3LDLA 4B9UA 4C8MA 4FWPA 5CR4A 1S6QA 4A57A 2ZJPL 1LWEA 4M3UA 3VF2A 1QS4A 1IKWA 3NH0A 5KPTA 4DTJA 4FZXC 3T7ZA 4WFBL 4OLBA 3AO3A 1BHLA 1ATNA 1YI2N 3K2PA 1G99A 1Q82O 1HX1A 2BH1A 4WQ5A 3OS1A 5AR0A 4H5VA 2W6KA 3CJ7A 3T1YK 2A3ZA 1BUPA 4DLGA 2EWSA 4QOZB 4CJKA 3FLCO 1K8AO 3Q7CA 2BE2A 4GNIA 5GAEP 2G8IA 3IUCA 1REVA 1NKBA 4I7FA 2G8HA 2OZMA 3CC4N 4JEPA 1S22A 2ZD1A 1SKWA 1CXUA 2P9PB 1NJZA 4G1QA 1EQYA 3B8AX 3P5JA 2VYPA 3FZFA 3KK2A 1JXEA 1TAQA 2FBVA 1YAGA 4KRFA 4JK9A 3MCPA 1BIZA 2WUSA 5C2FA 4JI1K 1SL1A 3C6HA 1GLAG 1QE1A 1JLCA 3LPUA 4Z4FA 3QO9A 3U3YA 3A5OC 3DAWA 4JYAK 2OA8A 4K41A 4HWIA 4IZ9A 4CCHA 4IEIA 4IJAA 4EHUA 3G4SN 1EO1A 4BR9A 4ISEA 4DS5A 1K9MO 4PA1A 2HBKA 3ZETA 1TK8A 4JI5K 3THXB 5HOOA 3PX6A 3TAQA 2FLOA 2W42A 1BO5O 1HPMA 5CYQA 3UKUB 1TAUA 2WTUA 5KQ8A 1KAYA 2A40A 3SCXA 3QMLA 5GAHP 3TTCA 4KI4A 4OLAA 3VQPA 2HMPA 1DEJA 2QW9A 1VSEA 2DPNA 3F9MA 4RW7A 5AFUA 1N5YA 4BRNA 4JK7A 3DXKA 1XHXA 3RR8A 1CLQA 4W5QA 5FPDA 1MA9B 3CJAA 2A6AA 5FPMA 4K0KK 3WXMB 3EYZA 3O08A 3T19A 5FDLA 4CHQA 1VQKN 3VEYA 2P9LB 1T6CA 5EU7A 2NRXA 4BR2A 5JVGL 4F3TA 1H1VA 3I8BA 2VG7A 2O4IA 1W2BM 4DQIA 4E7LA 4BACA 3R3LA 5BN8A 3MN6A 1XMQK 2I5JA 3DLEA 4X62K 1VSLA 3OYNA 2RKIA 2O8CB 3PIPL 1VSDA 4OKJA 1DTQA 3K59A 3WXIA 4ILJA 4B1WB 3BF1A 4LY7A 1VHXA 4NXNK 4NO7A 4YDUC 4FJMA 3LM2A 3HP6A 1HR0K 1YJWN 3HRGA 4ILHA 3RSEB 4DV4K 4K43A 4DFKA 1A5VA 1QHTA 2FC0A 3QEWA 1W97L 4K25A 3ZEUA 3D6RA 4IBNA 3EO3A 3DXMB 4E7HA 1C0GA 3CCJN 3NAEA 4JI2K 2HHQA 1B9DA 3CCRN 3PX0A 5MLCQ 3IAYA 4W5NA 4CZIA 4XH5A 1T3VA 3WEEA 4AHUA 3K5NA 3AVBA 4JS4A 4FJXA 2QK9A 4CZKA 3VEWA 3RMAA 1U04A 5J2NA 2FSJA 4CZEA 3ZT2A 4ICLA 2YI1A 4CJSA 3I33A 2GBZA 2P9NB 2P9IB 5AJ3K 1QQCA 5BR8K 1SKRA 4H8KA 1HRHA 1D9DA 2XY8A 1UA1A 1NU0A 2HHSA 2YCHA 3HL8A 3PV8A 3ULDA 3O3GA 4B3MK 3WQUA 4BRAA 5CHIA 3M3ZA 1N36K 2PBDA 3VEVA 2KLAA 4JKCA 4JI8K 2UUBK 3TANA 3OYFA 3D2FA 1U4BA 4KH6A 5TKWA 3ZLJA 2D0OA 3ZT0A 1QZ5A 4OPKA 1RT5A 1ASVA 4KB0A 4KO0A 3D2EB 4PL8A 5AQWA 5AZJB 1T44A 4BRCA 4DF8A 4CF2A 3S3MA 2XO7A 4KKOA 3U9ZA 5JVHL 1S1XA 3LDOA 4DTSA 2JGUA 4JAXA 4BRQA 3ZYYX 4CJPA 3AAPA 3DWLA 3A2FA 3UKRB 2HBMA 3NFAA 4O5FA 4F4KA 2QM1A 1Q86O 5E84A 3ATVA 3U6FA 5M1FA 3EY1A 4DF4A 4JHDB 2CGLA 1RDBA 3SPZA 4FOIA 1IV0A 4Z4CA 1KVAA 4FJLA 2E20A 4OGEA 1RBUA 2QWOA 4EAHD 4QCLA 3D45A 2F8SA 1QSSA 1ZXOA 3THVA 5HBMA 4CFBA 1QSLA 3ZSWA 5AQPA 3QEVA 4YOYA 3TSQA 4B9SA 2Z1GA 4Q0BA 3VA3A 4M63C 2XY6A 2D0AA 1W9HA 1VK0A 1NJXA 3SQ4A 3PSFA 1FXXA 3L8BA 1L3UA 1WSHA 4FCYA 3P38A 1IBMK 1CZBA 2NRRA 2IC3A 4DR3K 4F8RA 3KD5E 1V4TA 2FSKA 5DMRA 2NRWA 3VESA 4B9VA 3MN9A 4LF6K 3HM8A 4NLCA 3OYCA 4BE0A 3WXJA 1KXPA 2P9KA 4ISGA 3ULEB 2P1JA 3OYMA 5JLFA 4A2BA 1NOZA 2CH6A 3S3NA 1HKCA 3CERA 4B3SK 3OYLA 1FW6A 3MECA 2UXCK 5ADXH 4KI6A 2HHWA 3HOTA 3FZKA 4WE1A 4G9ZA 4ELUA 3KWGA 4WQ5C 1BG3A 5DM6L 4GV6A 4PWDA 5KPZA 1UOCA 4FJ8A 1WB9A 4BWJA 3V1RA 3A8YA 5J1EA 5LY3A 4DTMA 1QQMA 4I2QA 4RCHA 2ZE2A 4FLWA 3EEQA 3OVNA 5LJVA 1WSFA 3LZJA 1MU2A 3M6GA 4GV9A 5AQJA 1SAZA 3MXMA 5C0YA 1BDGA 2A1RA 1HYZA 5AQYA 4I6MB 1BISA 4ID1A 4PKGA 2O4GA 2H3GX 3SUPA 2NRHA 1GLFO 4IJNA 4CHPA 4FZYA 2HOEA 5D3GA 4IFEA 1TK5A 1OH8A 4MLHA 2KW4A 3DLRA 4OGCA 3ENHA 5SWMA 1YF5L 3PX4A 3AVIA 4JKGA 4DS4A 4JKEA 5IT9O 1C0FA 4CGJA 1L3VA 2A41A 4YOWA 2IDOA 1U6ZA 4CZHA 5CE3A 3SK3A 1NM1A 3MX2A 5CZ2A 3HT3A 4B9NA 4DTNA 2O8EA 4WQ4A 1TVRA 1M90O 4E3SA 4L8RB 4DU3A 2CGKA 4AM6A 5AQGA 1BCMA 1NGDA 2UUCK 3ENOA 4CFCA 3AVFA 1V4SA 4CJWA 1KAZA 3SLCA 3VF4A 2YHWA 4BC4A 3G71N 1XNQK 4DSJA 1LWFA 4CERA 4JKHA 4CJ4A 5GIOA 1N8RO 1JLAA 3O80A 3Q7BA 1S3XA 3NGYA 4FO0A 4YFUA 4ELVA 2A5XA 1IO2A 3R1XA 4E7KA 4FLUA 1O1WA 1HNIA 4YOXA 4HCBA 4CGGA 3QEXA 4A5BA 4M3RA 3LP0A 4MQ3A 5EOYA 4FLXA 2NNWA 4RW4A 3VENA 1HJOA 1HLUA 1S6PA 1JL1A 4DLEA 2ZJQL 1KLMA 1QTMA 4KV8A 3J7ZO 3VPZA 4NCGA 3ZSQA 1K73O 3I0RA 5C15A 1ZBFA 3MXIA 1JCGA 5C24A 3SZ2A 3OYGA 2A1SA 4Y1DA 4FLVA 3QNNA 5I3UA 5AFUH 4O8KA 4X66K 2GTDA 1X9WA 3LDSA 4FZZA 3M8QA 4IOAL 2ZM6K 1RBRA 1Q18A 4E7JA 3LALA 3AVJA 1JCEA 3CHWA 1KLNA 1IH7A 2ASMA 2X6NA 3EZWA 2HNDA 3VGLA 4CF0A 4N41A 3AV9A 5T7BA 1RT6A 4BROA 4GKKK 1W7AA 3H6EA 3WUHA 1VQNN 3W0LA 5AQIA 4YNQA 4A61A 4BGBA 3VQ4A 4B3TK 3QB0A 2KTQA 1J9AA 3ZETB 4Z94A 3ZT3A 4H5TA 4F3OA 4Z4EA 3QBXA 1IKYA 3IKMA 3V9XA 4CECA 1HNZK 4N47A 1IG8A 2YV0X 2XY7A 5K14A 3QESA 4H0XB 3L2RA 1WSJA 3DOKA 1J54A 1KVCA 3EL2A 2G8WA 3PUFA 4FVMA 1A5XA 3LDPA 4IEEA 1B9FA 2X78A 3AY9A 2B6AA 3SUOA 4N76A 2RN2A 1RTHA 3O3FA 2ITMA 3TSUA 2O8BA 1DLOA 4UY8O 3FFIA 2PYJA 1RT2A 4FWSA 5KRSA 3THWA 3P83D 1VQ9N 1WSGA 3VOVA 4XH1A 4F9OA 1N32K 3F5TA 3SJJA 1NGAA 2HHVA 2DFEA 3C7NB 3FZHA 4H03B 3LWMA 2G8VA 3P39A 2RHKA 3ALYA 2B4JA 1XWLA 2DTUA 2NRTA 4HHTA 2ITGA 3VERA 5BREA 4IG3A 4Q5VA 1U49A 2FBXA 2OPQA 1Y97A 4BG9A 3K0SA 3O8MA 4B9LA 1JKHA 1LCUA 2FSNA 3KVGA 4TSXA 4DSEA 4BR5A 1KQSM 3QIOA 3RRGA 3AO2A 1RBSA 1C6VA 1ASWA 4XEIA 3J8AA 3VN5A 3WNEA 3C0BA 3DLLL 1KFSA 3TAEA 4B3OA 1OKJA 5HROA 3FGUA 2GELA 1IG9A 2UYTA 5I9EB 4HUGA 3VEZA 2V51B 3VQ6A 1VRTA 1I3AA 4CJEA 5B8HA 5M1PA 1HKBA 1BA1A 4Z4HA 2O8FA 3LPTA 3TABA 1NGCA 4XH4A 3SPYA 3AVCA 1YVNA 2WOMA 4M3XA 2W6LA 4XIUA 1JCFA 5J2PA 1NK7A 4DV7K 1VSHA 4B1XB 4YOVA 2O8DB 1D8YA 3JS6A 1JLGA 3VGMA 4DR6K 2IVPA 3EE9A 1KD1O 4JI4K 3IDHA 4KHYA 4CEOA 3K5LA 1KCFA 4IDKA 2FBYA 3JXUA 3OY9A 2QKKA 4EIAA 3DLGA 3U9DA 1VQON 1QVFM 4RG8A 1S1WA 1C1AA 4KBOA 4W5OA 4IG0A 4J2AA 4BRPA 2ZJRL 5CYMA 2YJFA 3BF3A 3VF6A 3DLKA 3CI5A 2VWBA 1X3MA 1NNEA 5CY4A 3DI6A 1BOTO 4FLTA 4DQ8A 3S9HA 4CFDA 5AZIB 1VQLN 4PY5A 3NF7A 3CIPA 5FLXO 4CGIA 3PIOL 1WBDA 3AVKA 4LF7K 1U2VB 4IOCL 1KTQA 4CVNE 2Q31A 4NYFA 4H4OA 4CEAA 3NBPA 4M3YA 1K8KB 1BWFO 1LAVA 4BG8A 1JLEA 4MDAA 1RTDA 5KQDA 1SL0A 3OYDA 4WQ4C 2G8KA 4V19S 2WONA 5E41A 4JNEA 1T05A 3IG1A 2UUAK 1S1VA 5FRNA 4N5SA 1WSEA 3JAMO 2IVNA 1NGHA 4C8NA 3VQ8A 1OH6A 4FWLA 1EETA 1ZBIA 3VQ9A 4CF8A 1E3MA 4DR5K 3HI0A 1QZ6A 1EP4A 2HNYA 3U8XA 4FPBA 1J6ZA 3GOIA 2UU9K 2P9KB 4R79A 3KLGA 4FSVA 3H46O 3RTVA 3MN7A 3PSIA 3EN9A 3VQ7A 3ZT1A 1N33K 4AILC 2V7YA 3GG4A 3BZKA 3CJ1A 3IS9A 4FWOA 2VGMA 4J2EA 1BQNA 3VQCA 4B1VA 4IWVA 5BPNA 3J81O 4W5RA 4CBXA 5JICA 3CF5L 3C6AA 5LL6Z 1YXQA 1IKXA 2AA4A 1L3TA 3AA2A 2ETJA 2P9SA 5IWAK 3NDKA 5F0XA 4A59A 4PHTX 3C6UA 3VQDA 3MMVA 3BY5A 3A0IX 3MEGA 2G8FA 3LDNA 4FM2A 1JLFA 3F73A 4BDZA 4FJ5A 4CK2A 4B3RK 2IS3A 4CW7B 1VQ8N 1L5UA 4MFBA 4NCAA 4BVOA 5AQOA 3OYKA 3H45C 1DKGD 2PYLA 1FJGK 4BR0A 3SV4A 1T6DA 3MDQA 1W0HA 3MEDA 5EXWA 1RT3A 2XHBA 4NYNA 5AQKA 3G6EN 4ELTA 1XMOK 4M41A 1HNVA 4H0PA 3L2WA 3KD1E 3NGZA 3J7YP 3K9JA 4O8UA 1BI4B 3FZLA 2D1KA 5HL7L 1A5WA 1GLLO 2P51A 4JRPA 4IFYA 4FJNA 4M7YA 2E1YA 2YKMA 1VSKA 4W5TA 2P9PA 3WXLA 2XY5A 4C8OA 4LH4A 3HBTA 1QQNA 1B92A 2FF3B 2X6SA 2D0CA 4CEQA 1BQMA 3SMPA 5EVZA 4DHYA 4BRLA 1T8EA 3MXJA 3IMXA 4QAGA 5AQZA 3HOSA 3LAMA 3NHGA 2VCPA 2HVIA 4CZFA 1YT3A 2ZGZA 4DV6K 1UA0A 3QIPA 4CEBA 2KHOA 3CCLN 1GLEG 3KZBA 5DM7L 1JL2A 3THXA 4X65K 1SS6A 2PY5A 3VQQA 4FJ9A 5J2QA 3UKUA 1EWQA 4YHHK 2ASPA 4OPHA 3BGRA 3E1YA 1SUQA 4B1ZA 4BRMA 5ELZA 4JKDA 4HTLA 4JI6K 3QBWA 4MDBA 3SQ1A 4HUEA 1MDUB 1NGEA 4AQYK 4BC2A 3HPOA 4PKHA 1RT7A 2QWPA 4DQSA 3EZ5A 1ASUA 1HUXA 1I39A 3HSTB 4JI7K 3B6PA 3CXCM 4DTUA 2E2NA 4HTUA 4EZ9A 1YTUA 3OYAA 1YTAA 3ZSVA 1NWKA 2I7PA 4C1NI 3CPEA 4FM1A 2BGGA 5AQRA 4JKFA 1VQPN 4E1NA 1IBLK 2YHBA 1KAXA 2KZMA 4BC5A 2OANA 2E6LA 3CG7A 3MWPA 4FJ7A 3NH1A 4H5WA 3LAKA 2O8CA 1VSFA 2E5LK 2Q2RA 4DTPA 2ZWHA 4CHYA 3L2QA 4CFAA 2GX9A 3KTQA 3ZSZA 3VMFB 1RT1A 4B9TA 5AQHA 2HBLA 4BVPA 4PKIA 1XI1A 3WNFA 4KH5A 2FXUA 3CQ8A 1VQ7N 4KHWA 1I94K 4CJTA 4HCCA 4JV5K 3ID6A 2D4WA 2QWRA 1RNHA 3RSEA 3ZX3A 2J4RA 3A5MC 3DYAA 4CF1A 3WNHA 1GLCG 1HMVA 3OHRA 4JKBA 3OYHA 2DFFA 3PY8A 3DXMA 4B9QA 4DQPA 2F96A 4E1MA 5HLFA 3H3NO 3CD6N 1WSIA 1CZ9A 2E2PA 4ZHRA 4J2BA 3C65A 4LFCK 3AGKA 1XUPO 2NRVA 3LDQA 4RW8A 3ZX2A 4WF9L 1VQ5N 3RWUA 5BRHA 3OYIA 4IXCA 1HQUA 2P9IA 5AQXA 1WAFA 3CFPA 2IIRA 3VEOA 1NGJA 4BWMA 4CBWA 4DSFA 3CM5A 3O1WA 3V4IA 1RDUA 3HTVA 2E2OA 1NMNA 4O0IA 3CJBA 1FK9A 3HK2A 2IAJA 1NMDA 3L3UA 3TAMA 3U3GA 4CESA 2HF3A 3R6MA 4BRGA 1YJ9N 1XHZA 3D2EA 4DV2K 2HHUA 5AZJA 1OH5A 4O55A 1JLBA 1DGKN 1NGGA 3S3OA 3RRHA 1KRPA 2PZSA 2VGNA 3HVRA 1ITGA 4KREA 3KLFA 1ZYQA 4DR2K 4I9LA 5JS1A 4O44A 3UKRA 1WOQA 3O9QA 3O3HA 2E88A 1GLBG 1Z26A 5JLHA 1VQ4N 4OO1J 3CJ9A 4NLBA 1NJWA 2OPRA 4FXDA 4JN4A 2VWKA 2IGIA 3KIOA 1SKSA 1KC8O 3P31A 4KTZA 1NJIO 3V9ZA 1ZC6A 3K5OA 3QLHA 3I8DA 4AF1A 4DTOA 5M1KA 1EKEA 4BY9C 3ZSOA 4CK1A 4I2PA 2YNFA 4DR7K 5AQNA 4CHZA 3EKUA 4A2AA 1NLVA 4LF9K 2NUBA 3ATUA 4B1UB 1NG9A 4KTWA 5HRNA 3RR7A 3KLHA 4FW2A 4FJGA 3DLHA 4LSLA 3HO1A 5C12A 1NGFA 2QA4N 3L2VA 2OTJN 4CEFA 4AH9A 2D0PA 4CI6A 4FPAA 2Q3SA 4CZGA 3THYA 3GE1A 1VRUA 3ITHA 2DFHA 1WN7A 1YJNN 3AGRA 3I56N 1WBBA 1QHAA 4CJQA 5BPMA 5H1SQ 3HZ6A 1QSYA 3LP3A 3ULEA 1BU6O 3VQBA 4MLEA 3W3DA 5AQTA 1SL2A 3NMUA 3H3OB 3DXKB 1R59O 1RCHA 5KGWA 5CZ1A 1QVGM 4RTFD 3E66A 3CQXA 1TUUA 1Z05A 2E4LA 3RVCA 3N4PA 5GAGP 2KFNA 4DB3A 3SQ0A 4IKFA 2CGJA 4FWRA 4C23A 2NRZA 4K8ZA 5HRPA 3KK1A 4YOTA 4CHOA 2PAVA
chains in the Genus database with same CATH topology
4DTSA 4KHNA 2JGUA 4CGIA 3AVKA 1RDCA 1NK6A 2YHAA 4NCBA 4GVMA 3ZCMA 1KTQA 3DOLA 4H4MA 4NYFA 4CJLA 3M8SA 4H4OA 4CEAA 3LP2A 3NBPA 4CJPA 4HVJA 3CFOA 4RW6A 3D0PA 4M3YA 3HPGA 3A2FA 3V9SA 3NFAA 4FW1A 1S9EA 3T3FA 2P5GA 4F4KA 2KZZA 3G0ZA 1X1PA 5FROA 3U6FA 3C94A 3TI0A 4AHCA 1LAVA 3EY1A 4CIEA 4DF4A 1JLEA 4LD0A 4E89A 1RTDA 1WNSA 4ZTJA 1RDBA 3SPZA 4DMNA 1SL0A 3OYDA 4DQQA 2G8KA 2WONA 4EP5A 1RILA 5E41A 4Z4CA 4FM0A 1ZBUA 1KVAA 1S1UA 3VQAA 4FLZA 3IG1A 3CFRA 1T05A 1NK9A 4DSLA 4FJLA 1BI4A 3HP9A 1S1VA 4OGEA 1RBUA 5HRRA 1WSEA 4B8CA 4N5SA 3SUQA 5FRNA 5I42A 4KFBA 4CGFA 4QCLA 3D45A 3SI6A 1QSSA 1GOBA 4C8NA 3THVA 2F8SA 5HBMA 4CJ5A 4EP4A 4R5PA 4CFBA 3VQ8A 1QSLA 4CJVA 1EETA 3ZSWA 2Z1JA 3VQ9A 3QEVA 1ZBIA 4CF8A 2BANA 3T1AA 3ZSXA 4B9SA 1EP4A 1LW2A 2Z1GA 2HNYA 2OPPA 1VSMA 3C6TA 4OVLA 5C25A 3VA3A 2XY6A 4Q0BA 5KI6A 1HQEA 2Z1HA 3KLGA 3H08A 2D0AA 1W9HA 1VK0A 3RTVA 1NJXA 3AA4A 3SQ4A 3VQ7A 3ZT1A 4AILC 4FJJA 1FXXA 4FK0A 3AVHA 3V9WA 3ISNC 2KFZA 3L8BA 1L3UA 1WSHA 4FCYA 1CZBA 2IC3A 3IS9A 4F8RA 1NK0A 2RF2A 4J2EA 3KD5E 1BQNA 3VQCA 1JLQA 1F21A 1RBTA 3DM2A 3LZIA 5J2MA 3TAPA 5DMRA 2OYQA 1D9FA 4B9VA 4W5RA 1C1BA 3TAFA 4E7IA 1UAXA 1K6YA 4HUFA 3OYEA 1LAWA 3VQ5A 1C0TA 1ZBHA 3TR8A 3HYFA 3OYCA 4BE0A 4FK2A 3L3VA 1IKXA 2HHTA 4E0DA 1L3TA 2P1JA 3OYMA 1YVUA 3K58A 3AA2A 2ETJA 4O4GA 3NDKA 4ID5A 4BE1A 3WNGA 1T7PA 1NOZA 3RMCA 3S3NA 3ZSRA 3LWLA 4M3WA 3C95A 5KGXA 4F2SA 3SNNA 3OYLA 3V81A 2YNHA 3C6UA 3VQDA 3MECA 1D5AA 2VG5A 2HMIA 4KI6A 2HHWA 3G10A 4WE1A 1NOYA 4ELUA 3MEGA 3I0SA 2G8FA 2G8UA 2ZQBA 1RDAA 1CXQA 4FM2A 4PWDA 1JLFA 4CIFA 3F73A 1UOCA 1FKPA 4FJ8A 4BWJA 3V1RA 4PUOA 1WAJA 4BDZA 2XRIA 4FJ5A 5J1EA 4CK2A 4DTMA 1UWBA 2IS3A 4I2QA 1TL3A 2ZE2A 4FLWA 3OVNA 4CE9A 1L5UA 3QNOA 4MFBA 1BL3A 1WSFA 4CEZA 4NCAA 3LZJA 1MU2A 4AHSA 3OYKA 1U47A 3MXMA 2PYLA 1S1TA 3KJVA 3SV4A 2A1RA 1W0HA 1HYZA 4EZ6A 1BISA 4ID1A 3TWHA 2O4GA 3AO1A 3MEDA 5KRTA 1RT3A 1JXBA 2XHBA 4NYNA 2YNIA 3SUPA 1EXQA 4B8AB 3ZSYA 4ELTA 1C0UA 4KPYA 4M41A 4CHPA 1HNVA 3KKRA 3PO5A 4FZYA 3L2WA 5D3GA 4FLYA 3KD1E 3NGZA 2OPSA 3M8RA 3DRRA 1TK5A 2EHGA 3QEPA 2F8TA 1BI4B 3HJFA 2KW4A 3DLRA 4OGCA 4AHVA 1A5WA 4M45A 3CM6A 4B08A 2P51A 5SWMA 4IFYA 3JSMA 3AO4A 4JRPA 1U48A 4OPJA 3DLBA 4C8LA 4FJNA 2YKMA 1S9GA 1VSKA 3AVIA 3DRPA 2GV9A 3MEEA 4DS4A 4CHNA 3NH2A 1HPZA 1NK4A 4W5TA 4AHRA 2HVHA 4CGJA 1L3VA 1J53A 4JS5A 4FJHA 3V1OA 2D0BA 1RT4A 2IDOA 3HPHA 3IRXA 1BCOA 2EX3A 4DU4A 4LH4A 1KVBA 1EX4A 2KQ2A 3KLIA 2HNZA 1B92A 4KB1A 4M42A 3QINA 2X6SA 5CZ2A 5C42A 3HT3A 4Y1CA 4B9NA 2D0CA 4CEQA 1BQMA 4CEEA 4DTNA 3PO4A 3K57A 2P5OA 1TVRA 5HRSA 3L2UA 4CGDA 1KFDA 1C0MA 4E3SA 4DWIA 3KKSA 4DG1A 4L8RB 4DU3A 3F9KA 4GMJB 4CJFA 3NF9A 1BCMA 1Z25A 1T8EA 3MXJA 2Y1IA 4QAGA 1VSIA 4CFCA 4CJUA 3AVFA 3LAMA 4CJWA 1LW0A 1N6QA 3NHGA 1TV6A 2HVIA 2VG6A 1U45A 4DSJA 1LWFA 4CERA 2Y1JA 4I9QA 4CJ4A 1YT3A 1JLAA 2RPIA 1UA0A 4DSKA 3QIPA 4CEBA 4KHQA 4DSIA 3NGYA 3QEIA 4YFUA 1JL2A 4ELVA 2PY5A 1IO2A 3VQQA 4FJ9A 2HW3A 5J2QA 2YNGA 1BIUA 1BGXT 4E7KA 3SQ2A 4FLUA 4UQGA 1RTJA 1TKXA 3BGRA 1O1WA 1HNIA 1SUQA 4CEDA 5KTQA 3JYTA 4HCBA 1Q9YA 4KHSA 4CGGA 3QEXA 4BDPA 4M3RA 3LP0A 4CF9A 4BDYA 4MQ3A 4J2DA 4JRQA 4FLXA 3SQ1A 4HUEA 2YKNA 3AA5X 4ZTFA 2IOCA 3BDPA 4RW4A 1SV5A 3HPOA 1L3SA 1X9SA 4Z4IA 2D5RA 1RT7A 1S6PA 3ZT4A 3NCIA 1JL1A 1C1CA 4DLEA 3OJUA 4KTQA 3NE6A 4DQSA 3EZ5A 1ASUA 1KLMA 3B6OA 1QTMA 4B9UA 1I39A 4KV8A 4C8MA 3HSTB 1T03A 1NKEA 4NCGA 1S6QA 3B6PA 3ZSQA 1R0AA 4DTUA 4HTUA 1LV5A 1NJYA 3I0RA 1ZBFA 4EZ9A 1LWEA 3MXIA 1YTUA 5C24A 4M3UA 3OYAA 1QS4A 1YTAA 1IKWA 3ZSVA 3NH0A 3OYGA 2A1SA 4Y1DA 4FLVA 3SZ2A 4DTJA 3QNNA 5I3UA 4FZXC 4OLBA 2BDPA 3AO3A 1BHLA 4FM1A 4O5BA 3V1QA 1X9WA 3LDSA 4FZZA 2BGGA 3K2PA 3M8QA 3OS1A 4E1NA 1RBRA 1IKVA 2YHBA 4E7JA 3LALA 3AVJA 2KZMA 4FK4A 4DLGA 1KLNA 1RDDA 1IH7A 4CJKA 3AVGA 4CIGA 3V6DA 1TK0A 4QOZB 2E6LA 2X6NA 3CG7A 3QERA 3NH1A 2BE2A 3P1GA 1Q9XA 4FJ7A 4M3ZA 2HNDA 3LAKA 2G8IA 1VSFA 4DQRA 4DTPA 4CF0A 4C8OA 1FKOA 4N41A 1REVA 3AV9A 4CHYA 5T7BA 1NKBA 3K5MA 4I7FA 4CFAA 3L2QA 2G8HA 1RT6A 5HP1A 3KTQA 2ATQA 2OZMA 3ZSZA 1ZBLA 2ZD1A 1SKWA 1XC9A 1RT1A 4B9TA 1CXUA 4YNQA 1XI1A 4G1QA 4OKKA 1NJZA 3WNFA 4Z4GA 4CJ3A 3CQ8A 4KHWA 3P5JA 3VQ4A 4CJTA 4HCCA 2KTQA 1J9AA 3KK2A 1JXEA 1TAQA 2FBVA 3AA3A 4KRFA 3ZT3A 1RNHA 4F3OA 3O4NA 4IFVA 4Z4EA 1BIZA 4FYDA 3LANA 1IKYA 3V9XA 4CECA 3DYAA 3AVAA 2Z1IA 3NF6A 4CF1A 3HM9A 3WNHA 4N47A 1HMVA 1SL1A 2HB5A 3TAGA 2YV0X 2XY7A 3OYHA 4AHTA 2DFFA 5K14A 3PY8A 3QESA 4DQPA 2GUIA 1TKZA 2F96A 1QE1A 1JLCA 3LPUA 4E1MA 3L2RA 3QO9A 1WSJA 3DOKA 3DRSA 3U3YA 5HLFA 1J54A 1KVCA 3QETA 2G8WA 1WSIA 1CZ9A 3PUFA 4FVMA 4ZHRA 2OA8A 1A5XA 4J2BA 4OKEA 3V9UA 1KSPA 4CCHA 1B9FA 2X78A 2B6AA 3SUOA 3MAQA 3UIQA 3O4QA 4DS5A 2RN2A 4N76A 1NK8A 2QKBA 1RTHA 4PA1A 1TK8A 3O3FA 3PX6A 4RW8A 3TAQA 1DLOA 4Z4FA 2W42A 5CYQA 3FFIA 3OYIA 3RWUA 2PYJA 2XY5A 1RT2A 1HQUA 1TAUA 2R7YA 5KRSA 3SCXA 3P83D 1WAFA 3CFPA 1WSGA 4KI4A 4OLAA 4Z0UA 4BWMA 1G15A 4CK3A 3KLEA 3CM5A 3VQPA 4DSFA 3V4IA 4DFMA 2AJQA 4LH5A 1VSEA 4RW7A 3SJJA 4DU1A 1N5YA 4O0IA 2HHVA 4O0JA 1FK9A 2DFEA 3AVMA 2OZSA 2DY4A 1XHXA 3LWMA 2G8VA 3RR8A 1CLQA 4W5QA 4DFPA 3HK2A 3ALYA 2IAJA 1GOAA 3L3UA 3EYZA 3TAMA 3U3GA 2B4JA 1XWLA 4CESA 3T19A 2DTUA 4CGHA 3OS0A 4HHTA 2ITGA 5FDLA 4IG3A 4Q5VA 4CHQA 1U49A 1X9MA 2FBXA 3HXMA 1HYSA 2OPQA 1GOCA 1Y97A 1XHZA 3TARA 2HHUA 2QXFA 1RTIA 4O55A 1JLBA 3NGIA 5EU7A 2VWJA 3AVLA 4F2RA 4B9LA 2X74A 1JKHA 4FJIA 4K8XA 3S3OA 2B5JA 3E01A 3RRHA 1KRPA 4F3TA 1Q8IA 2E6MA 2VG7A 4TSXA 3HVRA 2PZSA 3AVNA 1ITGA 1RBVA 4DSEA 4KREA 3KLFA 3LP1A 2O4IA 3VQEA 4DQIA 4E7LA 4BACA 1ZYQA 3OYJA 3QIOA 3RRGA 4I9LA 2I5JA 1RBSA 1C6VA 3AO2A 3DLEA 4O44A 1ASWA 5DK5A 5JS1A 4N56A 1S5JA 3HVTA 3O3HA 1WLJA 1VSLA 3OYBA 3SYZA 3VN5A 1Z26A 2RKIA 3WNEA 5SZTA 3OYNA 1VSDA 4OKJA 1NJWA 2OPRA 4FXDA 3ASMA 1DTQA 1KFSA 3TAEA 3K59A 2VWKA 2IGIA 3KIOA 1SKSA 4B3OA 5HROA 4KTZA 3M8PA 4B9MA 1IG9A 1VSJA 4LY7A 3V9ZA 3PX4A 3K5OA 3QLHA 3I8DA 2LSNA 4LSNA 4DTOA 4KAZA 1EKEA 4FJKA 4HUGA 3ZSOA 4CK1A 4I2PA 2YNFA 4FJMA 4CHZA 3HP6A 4C8KA 3VQ6A 1VRTA 1I3AA 4CJEA 5JS2A 1HYVA 4Z4HA 1NK5A 4DFKA 2NUBA 3LPTA 3TABA 1A5VA 1QHTA 3SPYA 2FC0A 3AVCA 3QEWA 2WOMA 4IBNA 4KTWA 4OJRA 4M3XA 5HRNA 4E7HA 3OJSA 3RR7A 3KLHA 4FW2A 3NAEA 4FJGA 4XIUA 2HHQA 1B9DA 1NKCA 3PX0A 3IAYA 3DLHA 4W5NA 4LSLA 5J2PA 4BE2A 1TL1A 1NK7A 3HO1A 3L2VA 4AHUA 4CEFA 1TKDA 3K5NA 1VSHA 3AVBA 4AH9A 4JS4A 4FJXA 1D8YA 3RMBA 3CYMA 2QK9A 4E19A 2FBTA 1JLGA 2Q3SA 3RMAA 4DTRA 4CJRA 1U04A 1VRUA 2DFHA 2JLEA 3ITHA 5J2NA 1WN7A 4KHYA 3ZT2A 3OS2A 4ICLA 2HHXA 1LWCA 4CJSA 4CJQA 2GBZA 4CEOA 3K5LA 1KCFA 4IDKA 2FBYA 1QSYA 3VA0A 1HJRA 1QQCA 3LP3A 3OY9A 1SKRA 4H8KA 2QKKA 4KHUA 1HRHA 3VQBA 4JLHA 3DLGA 1D9DA 2XY8A 1UA1A 2HHSA 4RG8A 3RMDA 1S1WA 1C1AA 1DTTA 1TGOA 3HL8A 4IG0A 4W5OA 3DMJA 3O3GA 3ULDA 3PV8A 1SL2A 4J2AA 5FRMA 5CYMA 3SUNA 4M3TA 1RCHA 5KGWA 5CZ1A 3TANA 3AO5A 3OYFA 1TKTA 1U4BA 3DLKA 2E4LA 4DFJA 2KFNA 4DTXA 3ZT0A 3SQ0A 4IKFA 4OPKA 1RT5A 4PQUA 5CY4A 1ASVA 3NF8A 3DI6A 4KO0A 1J5OA 4KB0A 4K8ZA 4FLTA 5HRPA 3SV3A 3KK1A 4DF8A 3S9HA 4CF2A 3KK3A 4RW9A 3S3MA 2XO7A 4KKOA 4CHOA 4GW6A 4CFDA 4PY5A 1S1XA 3NF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DTS A;  4KHN A;  2JGU A;  4CGI A;  3AVK A;  1RDC A;  1NK6 A;  2YHA A;  4NCB A;  4GVM A;  3ZCM A;  1KTQ A;  3DOL A;  4H4M A;  4NYF A;  4CJL A;  3M8S A;  4H4O A;  4CEA A;  3LP2 A;  3NBP A;  4CJP A;  4HVJ A;  3CFO A;  4RW6 A;  3D0P A;  4M3Y A;  3HPG A;  3A2F A;  3V9S A;  3NFA A;  4FW1 A;  1S9E A;  3T3F A;  2P5G A;  4F4K A;  2KZZ A;  3G0Z A;  1X1P A;  5FRO A;  3U6F A;  3C94 A;  3TI0 A;  4AHC A;  1LAV A;  3EY1 A;  4CIE A;  4DF4 A;  1JLE A;  4LD0 A;  4E89 A;  1RTD A;  1WNS A;  4ZTJ A;  1RDB A;  3SPZ A;  4DMN A;  1SL0 A;  3OYD A;  4DQQ A;  2G8K A;  2WON A;  4EP5 A;  1RIL A;  5E41 A;  4Z4C A;  4FM0 A;  1ZBU A;  1KVA A;  1S1U A;  3VQA A;  4FLZ A;  3IG1 A;  3CFR A;  1T05 A;  1NK9 A;  4DSL A;  4FJL A;  1BI4 A;  3HP9 A;  1S1V A;  4OGE A;  1RBU A;  5HRR A;  1WSE A;  4B8C A;  4N5S A;  3SUQ A;  5FRN A;  5I42 A;  4KFB A;  4CGF A;  4QCL A;  3D45 A;  3SI6 A;  1QSS A;  1GOB A;  4C8N A;  3THV A;  2F8S A;  5HBM A;  4CJ5 A;  4EP4 A;  4R5P A;  4CFB A;  3VQ8 A;  1QSL A;  4CJV A;  1EET A;  3ZSW A;  2Z1J A;  3VQ9 A;  3QEV A;  1ZBI A;  4CF8 A;  2BAN A;  3T1A A;  3ZSX A;  4B9S A;  1EP4 A;  1LW2 A;  2Z1G A;  2HNY A;  2OPP A;  1VSM A;  3C6T A;  4OVL A;  5C25 A;  3VA3 A;  2XY6 A;  4Q0B A;  5KI6 A;  1HQE A;  2Z1H A;  3KLG A;  3H08 A;  2D0A A;  1W9H A;  1VK0 A;  3RTV A;  1NJX A;  3AA4 A;  3SQ4 A;  3VQ7 A;  3ZT1 A;  4AIL C;  4FJJ A;  1FXX A;  4FK0 A;  3AVH A;  3V9W A;  3ISN C;  2KFZ A;  3L8B A;  1L3U A;  1WSH A;  4FCY A;  1CZB A;  2IC3 A;  3IS9 A;  4F8R A;  1NK0 A;  2RF2 A;  4J2E A;  3KD5 E;  1BQN A;  3VQC A;  1JLQ A;  1F21 A;  1RBT A;  3DM2 A;  3LZI A;  5J2M A;  3TAP A;  5DMR A;  2OYQ A;  1D9F A;  4B9V A;  4W5R A;  1C1B A;  3TAF A;  4E7I A;  1UAX A;  1K6Y A;  4HUF A;  3OYE A;  1LAW A;  3VQ5 A;  1C0T A;  1ZBH A;  3TR8 A;  3HYF A;  3OYC A;  4BE0 A;  4FK2 A;  3L3V A;  1IKX A;  2HHT A;  4E0D A;  1L3T A;  2P1J A;  3OYM A;  1YVU A;  3K58 A;  3AA2 A;  2ETJ A;  4O4G A;  3NDK A;  4ID5 A;  4BE1 A;  3WNG A;  1T7P A;  1NOZ A;  3RMC A;  3S3N A;  3ZSR A;  3LWL A;  4M3W A;  3C95 A;  5KGX A;  4F2S A;  3SNN A;  3OYL A;  3V81 A;  2YNH A;  3C6U A;  3VQD A;  3MEC A;  1D5A A;  2VG5 A;  2HMI A;  4KI6 A;  2HHW A;  3G10 A;  4WE1 A;  1NOY A;  4ELU A;  3MEG A;  3I0S A;  2G8F A;  2G8U A;  2ZQB A;  1RDA A;  1CXQ A;  4FM2 A;  4PWD A;  1JLF A;  4CIF A;  3F73 A;  1UOC A;  1FKP A;  4FJ8 A;  4BWJ A;  3V1R A;  4PUO A;  1WAJ A;  4BDZ A;  2XRI A;  4FJ5 A;  5J1E A;  4CK2 A;  4DTM A;  1UWB A;  2IS3 A;  4I2Q A;  1TL3 A;  2ZE2 A;  4FLW A;  3OVN A;  4CE9 A;  1L5U A;  3QNO A;  4MFB A;  1BL3 A;  1WSF A;  4CEZ A;  4NCA A;  3LZJ A;  1MU2 A;  4AHS A;  3OYK A;  1U47 A;  3MXM A;  2PYL A;  1S1T A;  3KJV A;  3SV4 A;  2A1R A;  1W0H A;  1HYZ A;  4EZ6 A;  1BIS A;  4ID1 A;  3TWH A;  2O4G A;  3AO1 A;  3MED A;  5KRT A;  1RT3 A;  1JXB A;  2XHB A;  4NYN A;  2YNI A;  3SUP A;  1EXQ A;  4B8A B;  3ZSY A;  4ELT A;  1C0U A;  4KPY A;  4M41 A;  4CHP A;  1HNV A;  3KKR A;  3PO5 A;  4FZY A;  3L2W A;  5D3G A;  4FLY A;  3KD1 E;  3NGZ A;  2OPS A;  3M8R A;  3DRR A;  1TK5 A;  2EHG A;  3QEP A;  2F8T A;  1BI4 B;  3HJF A;  2KW4 A;  3DLR A;  4OGC A;  4AHV A;  1A5W A;  4M45 A;  3CM6 A;  4B08 A;  2P51 A;  5SWM A;  4IFY A;  3JSM A;  3AO4 A;  4JRP A;  1U48 A;  4OPJ A;  3DLB A;  4C8L A;  4FJN A;  2YKM A;  1S9G A;  1VSK A;  3AVI A;  3DRP A;  2GV9 A;  3MEE A;  4DS4 A;  4CHN A;  3NH2 A;  1HPZ A;  1NK4 A;  4W5T A;  4AHR A;  2HVH A;  4CGJ A;  1L3V A;  1J53 A;  4JS5 A;  4FJH A;  3V1O A;  2D0B A;  1RT4 A;  2IDO A;  3HPH A;  3IRX A;  1BCO A;  2EX3 A;  4DU4 A;  4LH4 A;  1KVB A;  1EX4 A;  2KQ2 A;  3KLI A;  2HNZ A;  1B92 A;  4KB1 A;  4M42 A;  3QIN A;  2X6S A;  5CZ2 A;  5C42 A;  3HT3 A;  4Y1C A;  4B9N A;  2D0C A;  4CEQ A;  1BQM A;  4CEE A;  4DTN A;  3PO4 A;  3K57 A;  2P5O A;  1TVR A;  5HRS A;  3L2U A;  4CGD A;  1KFD A;  1C0M A;  4E3S A;  4DWI A;  3KKS A;  4DG1 A;  4L8R B;  4DU3 A;  3F9K A;  4GMJ B;  4CJF A;  3NF9 A;  1BCM A;  1Z25 A;  1T8E A;  3MXJ A;  2Y1I A;  4QAG A;  1VSI A;  4CFC A;  4CJU A;  3AVF A;  3LAM A;  4CJW A;  1LW0 A;  1N6Q A;  3NHG A;  1TV6 A;  2HVI A;  2VG6 A;  1U45 A;  4DSJ A;  1LWF A;  4CER A;  2Y1J A;  4I9Q A;  4CJ4 A;  1YT3 A;  1JLA A;  2RPI A;  1UA0 A;  4DSK A;  3QIP A;  4CEB A;  4KHQ A;  4DSI A;  3NGY A;  3QEI A;  4YFU A;  1JL2 A;  4ELV A;  2PY5 A;  1IO2 A;  3VQQ A;  4FJ9 A;  2HW3 A;  5J2Q A;  2YNG A;  1BIU A;  1BGX T;  4E7K A;  3SQ2 A;  4FLU A;  4UQG A;  1RTJ A;  1TKX A;  3BGR A;  1O1W A;  1HNI A;  1SUQ A;  4CED A;  5KTQ A;  3JYT A;  4HCB A;  1Q9Y A;  4KHS A;  4CGG A;  3QEX A;  4BDP A;  4M3R A;  3LP0 A;  4CF9 A;  4BDY A;  4MQ3 A;  4J2D A;  4JRQ A;  4FLX A;  3SQ1 A;  4HUE A;  2YKN A;  3AA5 X;  4ZTF A;  2IOC A;  3BDP A;  4RW4 A;  1SV5 A;  3HPO A;  1L3S A;  1X9S A;  4Z4I A;  2D5R A;  1RT7 A;  1S6P A;  3ZT4 A;  3NCI A;  1JL1 A;  1C1C A;  4DLE A;  3OJU A;  4KTQ A;  3NE6 A;  4DQS A;  3EZ5 A;  1ASU A;  1KLM A;  3B6O A;  1QTM A;  4B9U A;  1I39 A;  4KV8 A;  4C8M A;  3HST B;  1T03 A;  1NKE A;  4NCG A;  1S6Q A;  3B6P A;  3ZSQ A;  1R0A A;  4DTU A;  4HTU A;  1LV5 A;  1NJY A;  3I0R A;  1ZBF A;  4EZ9 A;  1LWE A;  3MXI A;  1YTU A;  5C24 A;  4M3U A;  3OYA A;  1QS4 A;  1YTA A;  1IKW A;  3ZSV A;  3NH0 A;  3OYG A;  2A1S A;  4Y1D A;  4FLV A;  3SZ2 A;  4DTJ A;  3QNN A;  5I3U A;  4FZX C;  4OLB A;  2BDP A;  3AO3 A;  1BHL A;  4FM1 A;  4O5B A;  3V1Q A;  1X9W A;  3LDS A;  4FZZ A;  2BGG A;  3K2P A;  3M8Q A;  3OS1 A;  4E1N A;  1RBR A;  1IKV A;  2YHB A;  4E7J A;  3LAL A;  3AVJ A;  2KZM A;  4FK4 A;  4DLG A;  1KLN A;  1RDD A;  1IH7 A;  4CJK A;  3AVG A;  4CIG A;  3V6D A;  1TK0 A;  4QOZ B;  2E6L A;  2X6N A;  3CG7 A;  3QER A;  3NH1 A;  2BE2 A;  3P1G A;  1Q9X A;  4FJ7 A;  4M3Z A;  2HND A;  3LAK A;  2G8I A;  1VSF A;  4DQR A;  4DTP A;  4CF0 A;  4C8O A;  1FKO A;  4N41 A;  1REV A;  3AV9 A;  4CHY A;  5T7B A;  1NKB A;  3K5M A;  4I7F A;  4CFA A;  3L2Q A;  2G8H A;  1RT6 A;  5HP1 A;  3KTQ A;  2ATQ A;  2OZM A;  3ZSZ A;  1ZBL A;  2ZD1 A;  1SKW A;  1XC9 A;  1RT1 A;  4B9T A;  1CXU A;  4YNQ A;  1XI1 A;  4G1Q A;  4OKK A;  1NJZ A;  3WNF A;  4Z4G A;  4CJ3 A;  3CQ8 A;  4KHW A;  3P5J A;  3VQ4 A;  4CJT A;  4HCC A;  2KTQ A;  1J9A A;  3KK2 A;  1JXE A;  1TAQ A;  2FBV A;  3AA3 A;  4KRF A;  3ZT3 A;  1RNH A;  4F3O A;  3O4N A;  4IFV A;  4Z4E A;  1BIZ A;  4FYD A;  3LAN A;  1IKY A;  3V9X A;  4CEC A;  3DYA A;  3AVA A;  2Z1I A;  3NF6 A;  4CF1 A;  3HM9 A;  3WNH A;  4N47 A;  1HMV A;  1SL1 A;  2HB5 A;  3TAG A;  2YV0 X;  2XY7 A;  3OYH A;  4AHT A;  2DFF A;  5K14 A;  3PY8 A;  3QES A;  4DQP A;  2GUI A;  1TKZ A;  2F96 A;  1QE1 A;  1JLC A;  3LPU A;  4E1M A;  3L2R A;  3QO9 A;  1WSJ A;  3DOK A;  3DRS A;  3U3Y A;  5HLF A;  1J54 A;  1KVC A;  3QET A;  2G8W A;  1WSI A;  1CZ9 A;  3PUF A;  4FVM A;  4ZHR A;  2OA8 A;  1A5X A;  4J2B A;  4OKE A;  3V9U A;  1KSP A;  4CCH A;  1B9F A;  2X78 A;  2B6A A;  3SUO A;  3MAQ A;  3UIQ A;  3O4Q A;  4DS5 A;  2RN2 A;  4N76 A;  1NK8 A;  2QKB A;  1RTH A;  4PA1 A;  1TK8 A;  3O3F A;  3PX6 A;  4RW8 A;  3TAQ A;  1DLO A;  4Z4F A;  2W42 A;  5CYQ A;  3FFI A;  3OYI A;  3RWU A;  2PYJ A;  2XY5 A;  1RT2 A;  1HQU A;  1TAU A;  2R7Y A;  5KRS A;  3SCX A;  3P83 D;  1WAF A;  3CFP A;  1WSG A;  4KI4 A;  4OLA A;  4Z0U A;  4BWM A;  1G15 A;  4CK3 A;  3KLE A;  3CM5 A;  3VQP A;  4DSF A;  3V4I A;  4DFM A;  2AJQ A;  4LH5 A;  1VSE A;  4RW7 A;  3SJJ A;  4DU1 A;  1N5Y A;  4O0I A;  2HHV A;  4O0J A;  1FK9 A;  2DFE A;  3AVM A;  2OZS A;  2DY4 A;  1XHX A;  3LWM A;  2G8V A;  3RR8 A;  1CLQ A;  4W5Q A;  4DFP A;  3HK2 A;  3ALY A;  2IAJ A;  1GOA A;  3L3U A;  3EYZ A;  3TAM A;  3U3G A;  2B4J A;  1XWL A;  4CES A;  3T19 A;  2DTU A;  4CGH A;  3OS0 A;  4HHT A;  2ITG A;  5FDL A;  4IG3 A;  4Q5V A;  4CHQ A;  1U49 A;  1X9M A;  2FBX A;  3HXM A;  1HYS A;  2OPQ A;  1GOC A;  1Y97 A;  1XHZ A;  3TAR A;  2HHU A;  2QXF A;  1RTI A;  4O55 A;  1JLB A;  3NGI A;  5EU7 A;  2VWJ A;  3AVL A;  4F2R A;  4B9L A;  2X74 A;  1JKH A;  4FJI A;  4K8X A;  3S3O A;  2B5J A;  3E01 A;  3RRH A;  1KRP A;  4F3T A;  1Q8I A;  2E6M A;  2VG7 A;  4TSX A;  3HVR A;  2PZS A;  3AVN A;  1ITG A;  1RBV A;  4DSE A;  4KRE A;  3KLF A;  3LP1 A;  2O4I A;  3VQE A;  4DQI A;  4E7L A;  4BAC A;  1ZYQ A;  3OYJ A;  3QIO A;  3RRG A;  4I9L A;  2I5J A;  1RBS A;  1C6V A;  3AO2 A;  3DLE A;  4O44 A;  1ASW A;  5DK5 A;  5JS1 A;  4N56 A;  1S5J A;  3HVT A;  3O3H A;  1WLJ A;  1VSL A;  3OYB A;  3SYZ A;  3VN5 A;  1Z26 A;  2RKI A;  3WNE A;  5SZT A;  3OYN A;  1VSD A;  4OKJ A;  1NJW A;  2OPR A;  4FXD A;  3ASM A;  1DTQ A;  1KFS A;  3TAE A;  3K59 A;  2VWK A;  2IGI A;  3KIO A;  1SKS A;  4B3O A;  5HRO A;  4KTZ A;  3M8P A;  4B9M A;  1IG9 A;  1VSJ A;  4LY7 A;  3V9Z A;  3PX4 A;  3K5O A;  3QLH A;  3I8D A;  2LSN A;  4LSN A;  4DTO A;  4KAZ A;  1EKE A;  4FJK A;  4HUG A;  3ZSO A;  4CK1 A;  4I2P A;  2YNF A;  4FJM A;  4CHZ A;  3HP6 A;  4C8K A;  3VQ6 A;  1VRT A;  1I3A A;  4CJE A;  5JS2 A;  1HYV A;  4Z4H A;  1NK5 A;  4DFK A;  2NUB A;  3LPT A;  3TAB A;  1A5V A;  1QHT A;  3SPY A;  2FC0 A;  3AVC A;  3QEW A;  2WOM A;  4IBN A;  4KTW A;  4OJR A;  4M3X A;  5HRN A;  4E7H A;  3OJS A;  3RR7 A;  3KLH A;  4FW2 A;  3NAE A;  4FJG A;  4XIU A;  2HHQ A;  1B9D A;  1NKC A;  3PX0 A;  3IAY A;  3DLH A;  4W5N A;  4LSL A;  5J2P A;  4BE2 A;  1TL1 A;  1NK7 A;  3HO1 A;  3L2V A;  4AHU A;  4CEF A;  1TKD A;  3K5N A;  1VSH A;  3AVB A;  4AH9 A;  4JS4 A;  4FJX A;  1D8Y A;  3RMB A;  3CYM A;  2QK9 A;  4E19 A;  2FBT A;  1JLG A;  2Q3S A;  3RMA A;  4DTR A;  4CJR A;  1U04 A;  1VRU A;  2DFH A;  2JLE A;  3ITH A;  5J2N A;  1WN7 A;  4KHY A;  3ZT2 A;  3OS2 A;  4ICL A;  2HHX A;  1LWC A;  4CJS A;  4CJQ A;  2GBZ A;  4CEO A;  3K5L A;  1KCF A;  4IDK A;  2FBY A;  1QSY A;  3VA0 A;  1HJR A;  1QQC A;  3LP3 A;  3OY9 A;  1SKR A;  4H8K A;  2QKK A;  4KHU A;  1HRH A;  3VQB A;  4JLH A;  3DLG A;  1D9D A;  2XY8 A;  1UA1 A;  2HHS A;  4RG8 A;  3RMD A;  1S1W A;  1C1A A;  1DTT A;  1TGO A;  3HL8 A;  4IG0 A;  4W5O A;  3DMJ A;  3O3G A;  3ULD A;  3PV8 A;  1SL2 A;  4J2A A;  5FRM A;  5CYM A;  3SUN A;  4M3T A;  1RCH A;  5KGW A;  5CZ1 A;  3TAN A;  3AO5 A;  3OYF A;  1TKT A;  1U4B A;  3DLK A;  2E4L A;  4DFJ A;  2KFN A;  4DTX A;  3ZT0 A;  3SQ0 A;  4IKF A;  4OPK A;  1RT5 A;  4PQU A;  5CY4 A;  1ASV A;  3NF8 A;  3DI6 A;  4KO0 A;  1J5O A;  4KB0 A;  4K8Z A;  4FLT A;  5HRP A;  3SV3 A;  3KK1 A;  4DF8 A;  3S9H A;  4CF2 A;  3KK3 A;  4RW9 A;  3S3M A;  2XO7 A;  4KKO A;  4CHO A;  4GW6 A;  4CFD A;  4PY5 A;  1S1X A;  3NF7 A; 
#chains in the Genus database with same CATH topology
 3CCE N;  4KHN A;  5FPN A;  3E9O A;  1NK6 A;  4NCB A;  4GVM A;  3T69 A;  4H4M A;  1P8Z A;  4CJL A;  4LC9 B;  5LJW A;  4HVJ A;  4RW6 A;  3D0P A;  1ATR A;  3HPG A;  4FW1 A;  3T3F A;  4I6M A;  3G0Z A;  1X1P A;  2QEX N;  1ESV A;  5FRO A;  4GVE A;  4CIE A;  4LD0 A;  3U4L A;  2YHY A;  4QS7 A;  1HNW K;  1WNS A;  3SJH A;  2ZGY A;  3BEX A;  4EP5 A;  4FLZ A;  2KKZ A;  1ZBU A;  1S1U A;  3VQA A;  1GLJ O;  3CFR A;  1NK9 A;  3HP9 A;  1Y64 A;  3D7E O;  5HRR A;  3SUQ A;  4WCE L;  5C2D A;  4CGF A;  3SI6 A;  1GOB A;  2FF6 A;  4EP4 A;  2OCE A;  3OBY A;  4BQZ A;  1VAZ A;  1YIJ N;  3J7A P;  2Z1J A;  1MWM A;  4H5R A;  3T1A A;  3ZSX A;  1LW2 A;  3C6T A;  4J8F A;  1VSM A;  3ZEU B;  3SAH A;  2Z1H A;  3H08 A;  3S41 A;  2P9S B;  4KH4 A;  3AA4 A;  4YY3 K;  4FK0 A;  3AVH A;  3WEE B;  4OX9 K;  3VET A;  3A5L C;  3GL1 A;  3P4I A;  1SZ2 A;  3DM2 A;  1F21 A;  1RBT A;  3LZI A;  5J2M A;  1D9F A;  1Q7Y O;  3TAF A;  2YJE A;  3OW2 M;  3VQ5 A;  1C0T A;  3HYF A;  3WQT A;  2JWK A;  5EX5 A;  2HHT A;  2F7T A;  4E0D A;  1YVU A;  4BE1 A;  1VQM N;  3R8E A;  3SBT A;  4DV1 K;  3ZSR A;  3C95 A;  4F2S A;  3SNN A;  5LMU K;  1D4X A;  4H0T B;  1ATS A;  3O4W A;  3O6W A;  1Z6R A;  3G10 A;  1NOY A;  4BRE A;  3D2F B;  3I0S A;  4H5N A;  3EE8 A;  1ZBS A;  2QWM A;  1FKP A;  4JD2 A;  4FL9 A;  1WAJ A;  4BR4 A;  2XRI A;  1UWB A;  1IBK K;  1TL3 A;  3SMS A;  1NGI A;  2P9U A;  4CE9 A;  4CEZ A;  1LOT B;  2Q36 A;  1RFQ A;  1S1T A;  4LFA K;  1J5E K;  3TWH A;  3QDK A;  1JXB A;  2YNI A;  1QQO A;  1EXQ A;  4B8A B;  3ZSY A;  1C0U A;  2GWJ A;  4IDH A;  5BR9 A;  2OPS A;  3DRR A;  2EHG A;  3QEP A;  1VQ6 N;  1NBW A;  4M45 A;  3CM6 A;  4ISF A;  4M42 A;  2WBN A;  3MEE A;  1S9G A;  3DRP A;  4CHN A;  3CCM N;  1HPZ A;  4AHR A;  3HSC A;  1J53 A;  4FJH A;  3HPH A;  5M1Q A;  1BCO A;  2QWN A;  3T1H K;  1KVB A;  1EX4 A;  2E1Z A;  3L6Q A;  2KQ2 A;  2GUP A;  3R9P A;  1IJJ A;  3QIN A;  5C42 A;  4Y1C A;  1X3N A;  4CEE A;  3PO4 A;  3K57 A;  2P5O A;  3L2U A;  4CGD A;  1OVQ A;  1C0M A;  3KWI A;  5LMN K;  3F9K A;  1Z25 A;  2Y1I A;  5GIP A;  2NLX A;  3FE1 A;  1MWK A;  2ASO A;  3CCU N;  2Y1J A;  4CBU A;  5M1N A;  3QEI A;  2I7N A;  3UB5 A;  3WT0 A;  2Q0U A;  2HW3 A;  3DJC A;  2YNG A;  1BIU A;  1BGX T;  1N34 K;  3MCA B;  1XQS C;  4UQG A;  1TKX A;  3F2K A;  3JYT A;  2VQE K;  1Q9Y A;  4LF8 K;  4BDP A;  4CF9 A;  3TU5 A;  4BDY A;  4BRH A;  4JRQ A;  4J2D A;  2VQF K;  2YKN A;  3WXK A;  1X9S A;  3QIC A;  4Z4I A;  2D5R A;  3ZT4 A;  3C7N A;  3G25 A;  3OJU A;  3LM9 A;  3NE6 A;  4KTQ A;  4Y0W A;  1SQK A;  3ID8 A;  1T03 A;  1NKE A;  2V52 B;  1R0A A;  1RGI A;  1LV5 A;  1NJY A;  2W40 A;  2E8A A;  1NGB A;  2QXL A;  3VGK A;  4EHT A;  2BUP A;  1CZA N;  4DUZ K;  2BDP A;  2YHX A;  4FWK A;  4O5B A;  5AQL A;  3V1Q A;  4A62 A;  4BRF A;  1TYQ A;  1IKV A;  5C10 A;  3O5B A;  2F9W A;  4DKW A;  4FK4 A;  1RDD A;  3QFP A;  1X9J A;  3AVG A;  4CIG A;  3V6D A;  1TK0 A;  1Q9X A;  3QER A;  4M3Z A;  3P1G A;  4DQR A;  1YUW A;  1FKO A;  3H1Q A;  3K5M A;  2HF4 A;  3UE5 A;  5HP1 A;  2ATQ A;  3O9T A;  3QFU A;  1ZBL A;  4JKG B;  1XC9 A;  4GKJ K;  4OKK A;  4Z4G A;  4JI3 K;  4CJ3 A;  3AA3 A;  2UXB K;  3O4N A;  2Q97 A;  4IFV A;  4FYD A;  3LAN A;  3A5N C;  3CET A;  3AVA A;  2Z1I A;  3NF6 A;  2BTF A;  3HM9 A;  2O8E B;  3GDQ A;  4K42 A;  2HB5 A;  3TAG A;  3MWT A;  4AHT A;  2GUI A;  1TKZ A;  1NK0 A;  3DRS A;  3SBG A;  3QET A;  4CZJ A;  4FWN A;  1HKG A;  2O8D A;  4OKE A;  3V9U A;  1KSP A;  2Q1N A;  3L4Q A;  2GWK A;  4RWT A;  1ILY A;  3MAQ A;  3UIQ A;  3O4Q A;  2QKB A;  1NK8 A;  2R7Y A;  4Z0U A;  1G15 A;  4CK3 A;  3KLE A;  4KHP K;  4GV3 A;  4DFM A;  2AJQ A;  4LH5 A;  4LFB K;  4DU1 A;  3CMA N;  4O0J A;  3NVM A;  4C1N K;  3AVM A;  2OZS A;  2DY4 A;  4BRD A;  4DFP A;  4YOR A;  3OBW A;  1GOA A;  3KHY A;  1YIT N;  1DT9 A;  4CGH A;  3OS0 A;  1X9M A;  3HXM A;  1HYS A;  1GOC A;  3NVK A;  3TAR A;  4WFA L;  3SAF A;  2QXF A;  1RTI A;  3PLA A;  3NGI A;  2VWJ A;  4A5A A;  2QI2 A;  3AVL A;  4F2R A;  2UXD K;  2X74 A;  5AZI A;  4FJI A;  4K8X A;  4OPA A;  2B5J A;  3E01 A;  1Q8I A;  2E6M A;  4H0V B;  1U2V A;  3AVN A;  1RBV A;  3LP1 A;  3VQE A;  3OYJ A;  4IO9 L;  5AQV A;  5DK5 A;  1K8K A;  4CJ7 A;  4N56 A;  1S5J A;  3HVT A;  1WLJ A;  3OYB A;  3SYZ A;  5SZT A;  1TUY A;  2RE2 A;  3ASM A;  3M8P A;  2P9L A;  4B9M A;  3BP8 A;  2WFB A;  1VSJ A;  2LSN A;  4LSN A;  4KAZ A;  3H1V X;  4ILG B;  4FJK A;  3THY B;  4C8K A;  5JS2 A;  1HYV A;  1NK5 A;  3CQY A;  4OJR A;  2F9T A;  3OJS A;  5A2Q O;  4DCH A;  4IO8 A;  1NKC A;  4U7B A;  4BE2 A;  1TL1 A;  2ZF5 O;  4DR4 K;  1TKD A;  3O9U A;  2YX6 A;  3CYM A;  3RMB A;  4E19 A;  4L3Q A;  4JKA A;  2FBT A;  4E1J A;  3VTH A;  4DTR A;  4GY2 B;  4CJR A;  2JLE A;  2HST A;  1M1K O;  3OS2 A;  3CME N;  2HHX A;  2O8B B;  5EY4 A;  1LWC A;  3L4I A;  3KK7 A;  3VA0 A;  3THW B;  1JJ2 M;  1HJR A;  1HNX K;  4KHU A;  4BR7 A;  3EKS A;  4JLH A;  3MX5 A;  3OA9 A;  3RMD A;  1DTT A;  1TGO A;  3DMJ A;  5FRM A;  3SAG A;  3SUN A;  4M3T A;  5JMV A;  3TTD A;  1O13 A;  3AO5 A;  2PFU A;  1TKT A;  3OTO K;  5BPL A;  4DFJ A;  2OTL N;  4DTX A;  4MO5 A;  4BC3 A;  1OVY A;  3FR0 A;  4PQU A;  2A42 A;  1Q81 O;  3NF8 A;  2QTD A;  1J5O A;  3SV3 A;  3BZC A;  3KK3 A;  4RW9 A;  2P9N A;  4GW6 A;  2Q0R A;  4U67 L;  4LF4 K;  1RDC A;  2YHA A;  1BA0 A;  3ZCM A;  3DOL A;  3O9R A;  4BGA A;  3M8S A;  3LP2 A;  4DV5 K;  3CFO A;  3V9S A;  4EFH A;  3CCV N;  1S9E A;  2P5G A;  2KZZ A;  3TI0 A;  3C94 A;  4AHC A;  4IOX A;  5E26 A;  4E89 A;  4QS8 A;  4ZTJ A;  4DMN A;  4DQQ A;  4FWQ A;  1RIL A;  3O1B A;  4FM0 A;  4M3W A;  4DSL A;  1BI4 A;  4B8C A;  5I42 A;  4KFB A;  4CJ5 A;  4R5P A;  5BRD A;  4CJV A;  2O8F B;  2BAN A;  1RDW X;  2F4V K;  2OPP A;  5C25 A;  4OVL A;  5KI6 A;  1HQE A;  3FZM A;  3TPQ A;  4FJJ A;  4WFN L;  4JHD A;  3V9W A;  3ISN C;  2KFZ A;  5GAD P;  3MN5 A;  3AAQ A;  4CZM A;  2RF2 A;  4LF5 K;  1JLQ A;  4YDU A;  4JD2 B;  3TAP A;  5GIN A;  2OYQ A;  3N4Q A;  3E9L A;  1C1B A;  4E7I A;  1UAX A;  1K6Y A;  4HUF A;  2HBJ A;  3OYE A;  1LAW A;  1ZBH A;  3TR8 A;  3I55 N;  4FK2 A;  2P9U B;  3ZX0 A;  3L3V A;  2QWL A;  5AQF A;  3K58 A;  3FFK B;  4O4G A;  3IFR A;  4ID5 A;  3WNG A;  2W41 A;  1T7P A;  3RMC A;  3LWL A;  4QS9 A;  5KGX A;  3CC7 N;  4DV3 K;  3V81 A;  2YNH A;  2V7Z A;  1D5A A;  2VG5 A;  2HMI A;  4MO4 A;  3CCS N;  3E9P A;  2G8U A;  4AM7 A;  2ZQB A;  1RDA A;  1CXQ A;  4CIF A;  3LL3 A;  4PUO A;  3VEX A;  5AQQ A;  4BRK A;  5BN9 A;  3TTF A;  3QNO A;  1BL3 A;  4CZL A;  4DV0 K;  4AHS A;  1E4F T;  3CPW M;  1S72 N;  5F2R A;  1U47 A;  3KJV A;  3CJC A;  2CH5 A;  3CCQ N;  4JK8 A;  1E4G T;  4EZ6 A;  2GEM A;  2JWL A;  3AO1 A;  5KRT A;  2E2Q A;  5TKY A;  5F1X A;  4YOU A;  4FWM A;  4KPY A;  3KKR A;  3PO5 A;  5BRF A;  4FLY A;  3M8R A;  4PL7 A;  2F8T A;  4H0Y B;  3HJF A;  4M7X A;  4AHV A;  1U48 A;  4B08 A;  2IVO A;  1P90 A;  3JSM A;  3AO4 A;  2AP1 A;  3DLB A;  4OPJ A;  4C8L A;  2GV9 A;  3L0Q A;  3NH2 A;  4X64 K;  1NK4 A;  3O9S A;  2HVH A;  5AQU A;  4JS5 A;  3ENB A;  3V1O A;  2D0B A;  4NXM K;  1RT4 A;  2NZT A;  3IRX A;  4H0O A;  2EX3 A;  4DU4 A;  1YHQ N;  3AAR A;  3M5R A;  3KLI A;  2HNZ A;  4KB1 A;  5AQM A;  3MK6 A;  1EWR A;  1WUA A;  5HRS A;  4DR1 K;  4B1Y B;  1KFD A;  4DWI A;  3KKS A;  1GLD G;  4FOE A;  4DG1 A;  2HHH K;  3CC2 N;  4GMJ B;  4NB4 A;  3M1F A;  3NF9 A;  5AQS A;  4CJF A;  1OH7 A;  4BQL A;  1VSI A;  4CJU A;  4CD1 A;  1LW0 A;  1N6Q A;  3TSP A;  1TV6 A;  2WC9 A;  4FVU A;  4WYB A;  5ADX A;  2VG6 A;  5M1O A;  1U45 A;  4I9Q A;  3K9K A;  2RPI A;  4DSK A;  5FPE A;  4DSI A;  4KHQ A;  4CD3 A;  3SQ2 A;  4JI0 K;  1RTJ A;  4CED A;  5KTQ A;  3VTI A;  4KHS A;  5KPR A;  4DUY K;  3GBT A;  1XC3 A;  1TYQ B;  3AA5 X;  4ZTF A;  1XNR K;  2IOC A;  3BUZ B;  3BDP A;  1SV5 A;  1L3S A;  3NCI A;  1C1C A;  3B6O A;  2QWQ A;  4BRI A;  3J80 O;  3LDL A;  4B9U A;  4C8M A;  4FWP A;  5CR4 A;  1S6Q A;  4A57 A;  2ZJP L;  1LWE A;  4M3U A;  3VF2 A;  1QS4 A;  1IKW A;  3NH0 A;  5KPT A;  4DTJ A;  4FZX C;  3T7Z A;  4WFB L;  4OLB A;  3AO3 A;  1BHL A;  1ATN A;  1YI2 N;  3K2P A;  1G99 A;  1Q82 O;  1HX1 A;  2BH1 A;  4WQ5 A;  3OS1 A;  5AR0 A;  4H5V A;  2W6K A;  3CJ7 A;  3T1Y K;  2A3Z A;  1BUP A;  4DLG A;  2EWS A;  4QOZ B;  4CJK A;  3FLC O;  1K8A O;  3Q7C A;  2BE2 A;  4GNI A;  5GAE P;  2G8I A;  3IUC A;  1REV A;  1NKB A;  4I7F A;  2G8H A;  2OZM A;  3CC4 N;  4JEP A;  1S22 A;  2ZD1 A;  1SKW A;  1CXU A;  2P9P B;  1NJZ A;  4G1Q A;  1EQY A;  3B8A X;  3P5J A;  2VYP A;  3FZF A;  3KK2 A;  1JXE A;  1TAQ A;  2FBV A;  1YAG A;  4KRF A;  4JK9 A;  3MCP A;  1BIZ A;  2WUS A;  5C2F A;  4JI1 K;  1SL1 A;  3C6H A;  1GLA G;  1QE1 A;  1JLC A;  3LPU A;  4Z4F A;  3QO9 A;  3U3Y A;  3A5O C;  3DAW A;  4JYA K;  2OA8 A;  4K41 A;  4HWI A;  4IZ9 A;  4CCH A;  4IEI A;  4IJA A;  4EHU A;  3G4S N;  1EO1 A;  4BR9 A;  4ISE A;  4DS5 A;  1K9M O;  4PA1 A;  2HBK A;  3ZET A;  1TK8 A;  4JI5 K;  3THX B;  5HOO A;  3PX6 A;  3TAQ A;  2FLO A;  2W42 A;  1BO5 O;  1HPM A;  5CYQ A;  3UKU B;  1TAU A;  2WTU A;  5KQ8 A;  1KAY A;  2A40 A;  3SCX A;  3QML A;  5GAH P;  3TTC A;  4KI4 A;  4OLA A;  3VQP A;  2HMP A;  1DEJ A;  2QW9 A;  1VSE A;  2DPN A;  3F9M A;  4RW7 A;  5AFU A;  1N5Y A;  4BRN A;  4JK7 A;  3DXK A;  1XHX A;  3RR8 A;  1CLQ A;  4W5Q A;  5FPD A;  1MA9 B;  3CJA A;  2A6A A;  5FPM A;  4K0K K;  3WXM B;  3EYZ A;  3O08 A;  3T19 A;  5FDL A;  4CHQ A;  1VQK N;  3VEY A;  2P9L B;  1T6C A;  5EU7 A;  2NRX A;  4BR2 A;  5JVG L;  4F3T A;  1H1V A;  3I8B A;  2VG7 A;  2O4I A;  1W2B M;  4DQI A;  4E7L A;  4BAC A;  3R3L A;  5BN8 A;  3MN6 A;  1XMQ K;  2I5J A;  3DLE A;  4X62 K;  1VSL A;  3OYN A;  2RKI A;  2O8C B;  3PIP L;  1VSD A;  4OKJ A;  1DTQ A;  3K59 A;  3WXI A;  4ILJ A;  4B1W B;  3BF1 A;  4LY7 A;  1VHX A;  4NXN K;  4NO7 A;  4YDU C;  4FJM A;  3LM2 A;  3HP6 A;  1HR0 K;  1YJW N;  3HRG A;  4ILH A;  3RSE B;  4DV4 K;  4K43 A;  4DFK A;  1A5V A;  1QHT A;  2FC0 A;  3QEW A;  1W97 L;  4K25 A;  3ZEU A;  3D6R A;  4IBN A;  3EO3 A;  3DXM B;  4E7H A;  1C0G A;  3CCJ N;  3NAE A;  4JI2 K;  2HHQ A;  1B9D A;  3CCR N;  3PX0 A;  5MLC Q;  3IAY A;  4W5N A;  4CZI A;  4XH5 A;  1T3V A;  3WEE A;  4AHU A;  3K5N A;  3AVB A;  4JS4 A;  4FJX A;  2QK9 A;  4CZK A;  3VEW A;  3RMA A;  1U04 A;  5J2N A;  2FSJ A;  4CZE A;  3ZT2 A;  4ICL A;  2YI1 A;  4CJS A;  3I33 A;  2GBZ A;  2P9N B;  2P9I B;  5AJ3 K;  1QQC A;  5BR8 K;  1SKR A;  4H8K A;  1HRH A;  1D9D A;  2XY8 A;  1UA1 A;  1NU0 A;  2HHS A;  2YCH A;  3HL8 A;  3PV8 A;  3ULD A;  3O3G A;  4B3M K;  3WQU A;  4BRA A;  5CHI A;  3M3Z A;  1N36 K;  2PBD A;  3VEV A;  2KLA A;  4JKC A;  4JI8 K;  2UUB K;  3TAN A;  3OYF A;  3D2F A;  1U4B A;  4KH6 A;  5TKW A;  3ZLJ A;  2D0O A;  3ZT0 A;  1QZ5 A;  4OPK A;  1RT5 A;  1ASV A;  4KB0 A;  4KO0 A;  3D2E B;  4PL8 A;  5AQW A;  5AZJ B;  1T44 A;  4BRC A;  4DF8 A;  4CF2 A;  3S3M A;  2XO7 A;  4KKO A;  3U9Z A;  5JVH L;  1S1X A;  3LDO A;  4DTS A;  2JGU A;  4JAX A;  4BRQ A;  3ZYY X;  4CJP A;  3AAP A;  3DWL A;  3A2F A;  3UKR B;  2HBM A;  3NFA A;  4O5F A;  4F4K A;  2QM1 A;  1Q86 O;  5E84 A;  3ATV A;  3U6F A;  5M1F A;  3EY1 A;  4DF4 A;  4JHD B;  2CGL A;  1RDB A;  3SPZ A;  4FOI A;  1IV0 A;  4Z4C A;  1KVA A;  4FJL A;  2E20 A;  4OGE A;  1RBU A;  2QWO A;  4EAH D;  4QCL A;  3D45 A;  2F8S A;  1QSS A;  1ZXO A;  3THV A;  5HBM A;  4CFB A;  1QSL A;  3ZSW A;  5AQP A;  3QEV A;  4YOY A;  3TSQ A;  4B9S A;  2Z1G A;  4Q0B A;  3VA3 A;  4M63 C;  2XY6 A;  2D0A A;  1W9H A;  1VK0 A;  1NJX A;  3SQ4 A;  3PSF A;  1FXX A;  3L8B A;  1L3U A;  1WSH A;  4FCY A;  3P38 A;  1IBM K;  1CZB A;  2NRR A;  2IC3 A;  4DR3 K;  4F8R A;  3KD5 E;  1V4T A;  2FSK A;  5DMR A;  2NRW A;  3VES A;  4B9V A;  3MN9 A;  4LF6 K;  3HM8 A;  4NLC A;  3OYC A;  4BE0 A;  3WXJ A;  1KXP A;  2P9K A;  4ISG A;  3ULE B;  2P1J A;  3OYM A;  5JLF A;  4A2B A;  1NOZ A;  2CH6 A;  3S3N A;  1HKC A;  3CER A;  4B3S K;  3OYL A;  1FW6 A;  3MEC A;  2UXC K;  5ADX H;  4KI6 A;  2HHW A;  3HOT A;  3FZK A;  4WE1 A;  4G9Z A;  4ELU A;  3KWG A;  4WQ5 C;  1BG3 A;  5DM6 L;  4GV6 A;  4PWD A;  5KPZ A;  1UOC A;  4FJ8 A;  1WB9 A;  4BWJ A;  3V1R A;  3A8Y A;  5J1E A;  5LY3 A;  4DTM A;  1QQM A;  4I2Q A;  4RCH A;  2ZE2 A;  4FLW A;  3EEQ A;  3OVN A;  5LJV A;  1WSF A;  3LZJ A;  1MU2 A;  3M6G A;  4GV9 A;  5AQJ A;  1SAZ A;  3MXM A;  5C0Y A;  1BDG A;  2A1R A;  1HYZ A;  5AQY A;  4I6M B;  1BIS A;  4ID1 A;  4PKG A;  2O4G A;  2H3G X;  3SUP A;  2NRH A;  1GLF O;  4IJN A;  4CHP A;  4FZY A;  2HOE A;  5D3G A;  4IFE A;  1TK5 A;  1OH8 A;  4MLH A;  2KW4 A;  3DLR A;  4OGC A;  3ENH A;  5SWM A;  1YF5 L;  3PX4 A;  3AVI A;  4JKG A;  4DS4 A;  4JKE A;  5IT9 O;  1C0F A;  4CGJ A;  1L3V A;  2A41 A;  4YOW A;  2IDO A;  1U6Z A;  4CZH A;  5CE3 A;  3SK3 A;  1NM1 A;  3MX2 A;  5CZ2 A;  3HT3 A;  4B9N A;  4DTN A;  2O8E A;  4WQ4 A;  1TVR A;  1M90 O;  4E3S A;  4L8R B;  4DU3 A;  2CGK A;  4AM6 A;  5AQG A;  1BCM A;  1NGD A;  2UUC K;  3ENO A;  4CFC A;  3AVF A;  1V4S A;  4CJW A;  1KAZ A;  3SLC A;  3VF4 A;  2YHW A;  4BC4 A;  3G71 N;  1XNQ K;  4DSJ A;  1LWF A;  4CER A;  4JKH A;  4CJ4 A;  5GIO A;  1N8R O;  1JLA A;  3O80 A;  3Q7B A;  1S3X A;  3NGY A;  4FO0 A;  4YFU A;  4ELV A;  2A5X A;  1IO2 A;  3R1X A;  4E7K A;  4FLU A;  1O1W A;  1HNI A;  4YOX A;  4HCB A;  4CGG A;  3QEX A;  4A5B A;  4M3R A;  3LP0 A;  4MQ3 A;  5EOY A;  4FLX A;  2NNW A;  4RW4 A;  3VEN A;  1HJO A;  1HLU A;  1S6P A;  1JL1 A;  4DLE A;  2ZJQ L;  1KLM A;  1QTM A;  4KV8 A;  3J7Z O;  3VPZ A;  4NCG A;  3ZSQ A;  1K73 O;  3I0R A;  5C15 A;  1ZBF A;  3MXI A;  1JCG A;  5C24 A;  3SZ2 A;  3OYG A;  2A1S A;  4Y1D A;  4FLV A;  3QNN A;  5I3U A;  5AFU H;  4O8K A;  4X66 K;  2GTD A;  1X9W A;  3LDS A;  4FZZ A;  3M8Q A;  4IOA L;  2ZM6 K;  1RBR A;  1Q18 A;  4E7J A;  3LAL A;  3AVJ A;  1JCE A;  3CHW A;  1KLN A;  1IH7 A;  2ASM A;  2X6N A;  3EZW A;  2HND A;  3VGL A;  4CF0 A;  4N41 A;  3AV9 A;  5T7B A;  1RT6 A;  4BRO A;  4GKK K;  1W7A A;  3H6E A;  3WUH A;  1VQN N;  3W0L A;  5AQI A;  4YNQ A;  4A61 A;  4BGB A;  3VQ4 A;  4B3T K;  3QB0 A;  2KTQ A;  1J9A A;  3ZET B;  4Z94 A;  3ZT3 A;  4H5T A;  4F3O A;  4Z4E A;  3QBX A;  1IKY A;  3IKM A;  3V9X A;  4CEC A;  1HNZ K;  4N47 A;  1IG8 A;  2YV0 X;  2XY7 A;  5K14 A;  3QES A;  4H0X B;  3L2R A;  1WSJ A;  3DOK A;  1J54 A;  1KVC A;  3EL2 A;  2G8W A;  3PUF A;  4FVM A;  1A5X A;  3LDP A;  4IEE A;  1B9F A;  2X78 A;  3AY9 A;  2B6A A;  3SUO A;  4N76 A;  2RN2 A;  1RTH A;  3O3F A;  2ITM A;  3TSU A;  2O8B A;  1DLO A;  4UY8 O;  3FFI A;  2PYJ A;  1RT2 A;  4FWS A;  5KRS A;  3THW A;  3P83 D;  1VQ9 N;  1WSG A;  3VOV A;  4XH1 A;  4F9O A;  1N32 K;  3F5T A;  3SJJ A;  1NGA A;  2HHV A;  2DFE A;  3C7N B;  3FZH A;  4H03 B;  3LWM A;  2G8V A;  3P39 A;  2RHK A;  3ALY A;  2B4J A;  1XWL A;  2DTU A;  2NRT A;  4HHT A;  2ITG A;  3VER A;  5BRE A;  4IG3 A;  4Q5V A;  1U49 A;  2FBX A;  2OPQ A;  1Y97 A;  4BG9 A;  3K0S A;  3O8M A;  4B9L A;  1JKH A;  1LCU A;  2FSN A;  3KVG A;  4TSX A;  4DSE A;  4BR5 A;  1KQS M;  3QIO A;  3RRG A;  3AO2 A;  1RBS A;  1C6V A;  1ASW A;  4XEI A;  3J8A A;  3VN5 A;  3WNE A;  3C0B A;  3DLL L;  1KFS A;  3TAE A;  4B3O A;  1OKJ A;  5HRO A;  3FGU A;  2GEL A;  1IG9 A;  2UYT A;  5I9E B;  4HUG A;  3VEZ A;  2V51 B;  3VQ6 A;  1VRT A;  1I3A A;  4CJE A;  5B8H A;  5M1P A;  1HKB A;  1BA1 A;  4Z4H A;  2O8F A;  3LPT A;  3TAB A;  1NGC A;  4XH4 A;  3SPY A;  3AVC A;  1YVN A;  2WOM A;  4M3X A;  2W6L A;  4XIU A;  1JCF A;  5J2P A;  1NK7 A;  4DV7 K;  1VSH A;  4B1X B;  4YOV A;  2O8D B;  1D8Y A;  3JS6 A;  1JLG A;  3VGM A;  4DR6 K;  2IVP A;  3EE9 A;  1KD1 O;  4JI4 K;  3IDH A;  4KHY A;  4CEO A;  3K5L A;  1KCF A;  4IDK A;  2FBY A;  3JXU A;  3OY9 A;  2QKK A;  4EIA A;  3DLG A;  3U9D A;  1VQO N;  1QVF M;  4RG8 A;  1S1W A;  1C1A A;  4KBO A;  4W5O A;  4IG0 A;  4J2A A;  4BRP A;  2ZJR L;  5CYM A;  2YJF A;  3BF3 A;  3VF6 A;  3DLK A;  3CI5 A;  2VWB A;  1X3M A;  1NNE A;  5CY4 A;  3DI6 A;  1BOT O;  4FLT A;  4DQ8 A;  3S9H A;  4CFD A;  5AZI B;  1VQL N;  4PY5 A;  3NF7 A;  3CIP A;  5FLX O;  4CGI A;  3PIO L;  1WBD A;  3AVK A;  4LF7 K;  1U2V B;  4IOC L;  1KTQ A;  4CVN E;  2Q31 A;  4NYF A;  4H4O A;  4CEA A;  3NBP A;  4M3Y A;  1K8K B;  1BWF O;  1LAV A;  4BG8 A;  1JLE A;  4MDA A;  1RTD A;  5KQD A;  1SL0 A;  3OYD A;  4WQ4 C;  2G8K A;  4V19 S;  2WON A;  5E41 A;  4JNE A;  1T05 A;  3IG1 A;  2UUA K;  1S1V A;  5FRN A;  4N5S A;  1WSE A;  3JAM O;  2IVN A;  1NGH A;  4C8N A;  3VQ8 A;  1OH6 A;  4FWL A;  1EET A;  1ZBI A;  3VQ9 A;  4CF8 A;  1E3M A;  4DR5 K;  3HI0 A;  1QZ6 A;  1EP4 A;  2HNY A;  3U8X A;  4FPB A;  1J6Z A;  3GOI A;  2UU9 K;  2P9K B;  4R79 A;  3KLG A;  4FSV A;  3H46 O;  3RTV A;  3MN7 A;  3PSI A;  3EN9 A;  3VQ7 A;  3ZT1 A;  1N33 K;  4AIL C;  2V7Y A;  3GG4 A;  3BZK A;  3CJ1 A;  3IS9 A;  4FWO A;  2VGM A;  4J2E A;  1BQN A;  3VQC A;  4B1V A;  4IWV A;  5BPN A;  3J81 O;  4W5R A;  4CBX A;  5JIC A;  3CF5 L;  3C6A A;  5LL6 Z;  1YXQ A;  1IKX A;  2AA4 A;  1L3T A;  3AA2 A;  2ETJ A;  2P9S A;  5IWA K;  3NDK A;  5F0X A;  4A59 A;  4PHT X;  3C6U A;  3VQD A;  3MMV A;  3BY5 A;  3A0I X;  3MEG A;  2G8F A;  3LDN A;  4FM2 A;  1JLF A;  3F73 A;  4BDZ A;  4FJ5 A;  4CK2 A;  4B3R K;  2IS3 A;  4CW7 B;  1VQ8 N;  1L5U A;  4MFB A;  4NCA A;  4BVO A;  5AQO A;  3OYK A;  3H45 C;  1DKG D;  2PYL A;  1FJG K;  4BR0 A;  3SV4 A;  1T6D A;  3MDQ A;  1W0H A;  3MED A;  5EXW A;  1RT3 A;  2XHB A;  4NYN A;  5AQK A;  3G6E N;  4ELT A;  1XMO K;  4M41 A;  1HNV A;  4H0P A;  3L2W A;  3KD1 E;  3NGZ A;  3J7Y P;  3K9J A;  4O8U A;  1BI4 B;  3FZL A;  2D1K A;  5HL7 L;  1A5W A;  1GLL O;  2P51 A;  4JRP A;  4IFY A;  4FJN A;  4M7Y A;  2E1Y A;  2YKM A;  1VSK A;  4W5T A;  2P9P A;  3WXL A;  2XY5 A;  4C8O A;  4LH4 A;  3HBT A;  1QQN A;  1B92 A;  2FF3 B;  2X6S A;  2D0C A;  4CEQ A;  1BQM A;  3SMP A;  5EVZ A;  4DHY A;  4BRL A;  1T8E A;  3MXJ A;  3IMX A;  4QAG A;  5AQZ A;  3HOS A;  3LAM A;  3NHG A;  2VCP A;  2HVI A;  4CZF A;  1YT3 A;  2ZGZ A;  4DV6 K;  1UA0 A;  3QIP A;  4CEB A;  2KHO A;  3CCL N;  1GLE G;  3KZB A;  5DM7 L;  1JL2 A;  3THX A;  4X65 K;  1SS6 A;  2PY5 A;  3VQQ A;  4FJ9 A;  5J2Q A;  3UKU A;  1EWQ A;  4YHH K;  2ASP A;  4OPH A;  3BGR A;  3E1Y A;  1SUQ A;  4B1Z A;  4BRM A;  5ELZ A;  4JKD A;  4HTL A;  4JI6 K;  3QBW A;  4MDB A;  3SQ1 A;  4HUE A;  1MDU B;  1NGE A;  4AQY K;  4BC2 A;  3HPO A;  4PKH A;  1RT7 A;  2QWP A;  4DQS A;  3EZ5 A;  1ASU A;  1HUX A;  1I39 A;  3HST B;  4JI7 K;  3B6P A;  3CXC M;  4DTU A;  2E2N A;  4HTU A;  4EZ9 A;  1YTU A;  3OYA A;  1YTA A;  3ZSV A;  1NWK A;  2I7P A;  4C1N I;  3CPE A;  4FM1 A;  2BGG A;  5AQR A;  4JKF A;  1VQP N;  4E1N A;  1IBL K;  2YHB A;  1KAX A;  2KZM A;  4BC5 A;  2OAN A;  2E6L A;  3CG7 A;  3MWP A;  4FJ7 A;  3NH1 A;  4H5W A;  3LAK A;  2O8C A;  1VSF A;  2E5L K;  2Q2R A;  4DTP A;  2ZWH A;  4CHY A;  3L2Q A;  4CFA A;  2GX9 A;  3KTQ A;  3ZSZ A;  3VMF B;  1RT1 A;  4B9T A;  5AQH A;  2HBL A;  4BVP A;  4PKI A;  1XI1 A;  3WNF A;  4KH5 A;  2FXU A;  3CQ8 A;  1VQ7 N;  4KHW A;  1I94 K;  4CJT A;  4HCC A;  4JV5 K;  3ID6 A;  2D4W A;  2QWR A;  1RNH A;  3RSE A;  3ZX3 A;  2J4R A;  3A5M C;  3DYA A;  4CF1 A;  3WNH A;  1GLC G;  1HMV A;  3OHR A;  4JKB A;  3OYH A;  2DFF A;  3PY8 A;  3DXM A;  4B9Q A;  4DQP A;  2F96 A;  4E1M A;  5HLF A;  3H3N O;  3CD6 N;  1WSI A;  1CZ9 A;  2E2P A;  4ZHR A;  4J2B A;  3C65 A;  4LFC K;  3AGK A;  1XUP O;  2NRV A;  3LDQ A;  4RW8 A;  3ZX2 A;  4WF9 L;  1VQ5 N;  3RWU A;  5BRH A;  3OYI A;  4IXC A;  1HQU A;  2P9I A;  5AQX A;  1WAF A;  3CFP A;  2IIR A;  3VEO A;  1NGJ A;  4BWM A;  4CBW A;  4DSF A;  3CM5 A;  3O1W A;  3V4I A;  1RDU A;  3HTV A;  2E2O A;  1NMN A;  4O0I A;  3CJB A;  1FK9 A;  3HK2 A;  2IAJ A;  1NMD A;  3L3U A;  3TAM A;  3U3G A;  4CES A;  2HF3 A;  3R6M A;  4BRG A;  1YJ9 N;  1XHZ A;  3D2E A;  4DV2 K;  2HHU A;  5AZJ A;  1OH5 A;  4O55 A;  1JLB A;  1DGK N;  1NGG A;  3S3O A;  3RRH A;  1KRP A;  2PZS A;  2VGN A;  3HVR A;  1ITG A;  4KRE A;  3KLF A;  1ZYQ A;  4DR2 K;  4I9L A;  5JS1 A;  4O44 A;  3UKR A;  1WOQ A;  3O9Q A;  3O3H A;  2E88 A;  1GLB G;  1Z26 A;  5JLH A;  1VQ4 N;  4OO1 J;  3CJ9 A;  4NLB A;  1NJW A;  2OPR A;  4FXD A;  4JN4 A;  2VWK A;  2IGI A;  3KIO A;  1SKS A;  1KC8 O;  3P31 A;  4KTZ A;  1NJI O;  3V9Z A;  1ZC6 A;  3K5O A;  3QLH A;  3I8D A;  4AF1 A;  4DTO A;  5M1K A;  1EKE A;  4BY9 C;  3ZSO A;  4CK1 A;  4I2P A;  2YNF A;  4DR7 K;  5AQN A;  4CHZ A;  3EKU A;  4A2A A;  1NLV A;  4LF9 K;  2NUB A;  3ATU A;  4B1U B;  1NG9 A;  4KTW A;  5HRN A;  3RR7 A;  3KLH A;  4FW2 A;  4FJG A;  3DLH A;  4LSL A;  3HO1 A;  5C12 A;  1NGF A;  2QA4 N;  3L2V A;  2OTJ N;  4CEF A;  4AH9 A;  2D0P A;  4CI6 A;  4FPA A;  2Q3S A;  4CZG A;  3THY A;  3GE1 A;  1VRU A;  3ITH A;  2DFH A;  1WN7 A;  1YJN N;  3AGR A;  3I56 N;  1WBB A;  1QHA A;  4CJQ A;  5BPM A;  5H1S Q;  3HZ6 A;  1QSY A;  3LP3 A;  3ULE A;  1BU6 O;  3VQB A;  4MLE A;  3W3D A;  5AQT A;  1SL2 A;  3NMU A;  3H3O B;  3DXK B;  1R59 O;  1RCH A;  5KGW A;  5CZ1 A;  1QVG M;  4RTF D;  3E66 A;  3CQX A;  1TUU A;  1Z05 A;  2E4L A;  3RVC A;  3N4P A;  5GAG P;  2KFN A;  4DB3 A;  3SQ0 A;  4IKF A;  2CGJ A;  4FWR A;  4C23 A;  2NRZ A;  4K8Z A;  5HRP A;  3KK1 A;  4YOT A;  4CHO A;  2PAV A; 
#chains in the Genus database with same CATH homology
 4DTS A;  4KHN A;  2JGU A;  4CGI A;  3AVK A;  1RDC A;  1NK6 A;  2YHA A;  4NCB A;  4GVM A;  3ZCM A;  1KTQ A;  3DOL A;  4H4M A;  4NYF A;  4CJL A;  3M8S A;  4H4O A;  4CEA A;  3LP2 A;  3NBP A;  4CJP A;  4HVJ A;  3CFO A;  4RW6 A;  3D0P A;  4M3Y A;  3HPG A;  3A2F A;  3V9S A;  3NFA A;  4FW1 A;  1S9E A;  3T3F A;  2P5G A;  4F4K A;  2KZZ A;  3G0Z A;  1X1P A;  5FRO A;  3U6F A;  3C94 A;  3TI0 A;  4AHC A;  1LAV A;  3EY1 A;  4CIE A;  4DF4 A;  1JLE A;  4LD0 A;  4E89 A;  1RTD A;  1WNS A;  4ZTJ A;  1RDB A;  3SPZ A;  4DMN A;  1SL0 A;  3OYD A;  4DQQ A;  2G8K A;  2WON A;  4EP5 A;  1RIL A;  5E41 A;  4Z4C A;  4FM0 A;  1ZBU A;  1KVA A;  1S1U A;  3VQA A;  4FLZ A;  3IG1 A;  3CFR A;  1T05 A;  1NK9 A;  4DSL A;  4FJL A;  1BI4 A;  3HP9 A;  1S1V A;  4OGE A;  1RBU A;  5HRR A;  1WSE A;  4B8C A;  4N5S A;  3SUQ A;  5FRN A;  5I42 A;  4KFB A;  4CGF A;  4QCL A;  3D45 A;  3SI6 A;  1QSS A;  1GOB A;  4C8N A;  3THV A;  2F8S A;  5HBM A;  4CJ5 A;  4EP4 A;  4R5P A;  4CFB A;  3VQ8 A;  1QSL A;  4CJV A;  1EET A;  3ZSW A;  2Z1J A;  3VQ9 A;  3QEV A;  1ZBI A;  4CF8 A;  2BAN A;  3T1A A;  3ZSX A;  4B9S A;  1EP4 A;  1LW2 A;  2Z1G A;  2HNY A;  2OPP A;  1VSM A;  3C6T A;  4OVL A;  5C25 A;  3VA3 A;  2XY6 A;  4Q0B A;  5KI6 A;  1HQE A;  2Z1H A;  3KLG A;  3H08 A;  2D0A A;  1W9H A;  1VK0 A;  3RTV A;  1NJX A;  3AA4 A;  3SQ4 A;  3VQ7 A;  3ZT1 A;  4AIL C;  4FJJ A;  1FXX A;  4FK0 A;  3AVH A;  3V9W A;  3ISN C;  2KFZ A;  3L8B A;  1L3U A;  1WSH A;  4FCY A;  1CZB A;  2IC3 A;  3IS9 A;  4F8R A;  1NK0 A;  2RF2 A;  4J2E A;  3KD5 E;  1BQN A;  3VQC A;  1JLQ A;  1F21 A;  1RBT A;  3DM2 A;  3LZI A;  5J2M A;  3TAP A;  5DMR A;  2OYQ A;  1D9F A;  4B9V A;  4W5R A;  1C1B A;  3TAF A;  4E7I A;  1UAX A;  1K6Y A;  4HUF A;  3OYE A;  1LAW A;  3VQ5 A;  1C0T A;  1ZBH A;  3TR8 A;  3HYF A;  3OYC A;  4BE0 A;  4FK2 A;  3L3V A;  1IKX A;  2HHT A;  4E0D A;  1L3T A;  2P1J A;  3OYM A;  1YVU A;  3K58 A;  3AA2 A;  2ETJ A;  4O4G A;  3NDK A;  4ID5 A;  4BE1 A;  3WNG A;  1T7P A;  1NOZ A;  3RMC A;  3S3N A;  3ZSR A;  3LWL A;  4M3W A;  3C95 A;  5KGX A;  4F2S A;  3SNN A;  3OYL A;  3V81 A;  2YNH A;  3C6U A;  3VQD A;  3MEC A;  1D5A A;  2VG5 A;  2HMI A;  4KI6 A;  2HHW A;  3G10 A;  4WE1 A;  1NOY A;  4ELU A;  3MEG A;  3I0S A;  2G8F A;  2G8U A;  2ZQB A;  1RDA A;  1CXQ A;  4FM2 A;  4PWD A;  1JLF A;  4CIF A;  3F73 A;  1UOC A;  1FKP A;  4FJ8 A;  4BWJ A;  3V1R A;  4PUO A;  1WAJ A;  4BDZ A;  2XRI A;  4FJ5 A;  5J1E A;  4CK2 A;  4DTM A;  1UWB A;  2IS3 A;  4I2Q A;  1TL3 A;  2ZE2 A;  4FLW A;  3OVN A;  4CE9 A;  1L5U A;  3QNO A;  4MFB A;  1BL3 A;  1WSF A;  4CEZ A;  4NCA A;  3LZJ A;  1MU2 A;  4AHS A;  3OYK A;  1U47 A;  3MXM A;  2PYL A;  1S1T A;  3KJV A;  3SV4 A;  2A1R A;  1W0H A;  1HYZ A;  4EZ6 A;  1BIS A;  4ID1 A;  3TWH A;  2O4G A;  3AO1 A;  3MED A;  5KRT A;  1RT3 A;  1JXB A;  2XHB A;  4NYN A;  2YNI A;  3SUP A;  1EXQ A;  4B8A B;  3ZSY A;  4ELT A;  1C0U A;  4KPY A;  4M41 A;  4CHP A;  1HNV A;  3KKR A;  3PO5 A;  4FZY A;  3L2W A;  5D3G A;  4FLY A;  3KD1 E;  3NGZ A;  2OPS A;  3M8R A;  3DRR A;  1TK5 A;  2EHG A;  3QEP A;  2F8T A;  1BI4 B;  3HJF A;  2KW4 A;  3DLR A;  4OGC A;  4AHV A;  1A5W A;  4M45 A;  3CM6 A;  4B08 A;  2P51 A;  5SWM A;  4IFY A;  3JSM A;  3AO4 A;  4JRP A;  1U48 A;  4OPJ A;  3DLB A;  4C8L A;  4FJN A;  2YKM A;  1S9G A;  1VSK A;  3AVI A;  3DRP A;  2GV9 A;  3MEE A;  4DS4 A;  4CHN A;  3NH2 A;  1HPZ A;  1NK4 A;  4W5T A;  4AHR A;  2HVH A;  4CGJ A;  1L3V A;  1J53 A;  4JS5 A;  4FJH A;  3V1O A;  2D0B A;  1RT4 A;  2IDO A;  3HPH A;  3IRX A;  1BCO A;  2EX3 A;  4DU4 A;  4LH4 A;  1KVB A;  1EX4 A;  2KQ2 A;  3KLI A;  2HNZ A;  1B92 A;  4KB1 A;  4M42 A;  3QIN A;  2X6S A;  5CZ2 A;  5C42 A;  3HT3 A;  4Y1C A;  4B9N A;  2D0C A;  4CEQ A;  1BQM A;  4CEE A;  4DTN A;  3PO4 A;  3K57 A;  2P5O A;  1TVR A;  5HRS A;  3L2U A;  4CGD A;  1KFD A;  1C0M A;  4E3S A;  4DWI A;  3KKS A;  4DG1 A;  4L8R B;  4DU3 A;  3F9K A;  4GMJ B;  4CJF A;  3NF9 A;  1BCM A;  1Z25 A;  1T8E A;  3MXJ A;  2Y1I A;  4QAG A;  1VSI A;  4CFC A;  4CJU A;  3AVF A;  3LAM A;  4CJW A;  1LW0 A;  1N6Q A;  3NHG A;  1TV6 A;  2HVI A;  2VG6 A;  1U45 A;  4DSJ A;  1LWF A;  4CER A;  2Y1J A;  4I9Q A;  4CJ4 A;  1YT3 A;  1JLA A;  2RPI A;  1UA0 A;  4DSK A;  3QIP A;  4CEB A;  4KHQ A;  4DSI A;  3NGY A;  3QEI A;  4YFU A;  1JL2 A;  4ELV A;  2PY5 A;  1IO2 A;  3VQQ A;  4FJ9 A;  2HW3 A;  5J2Q A;  2YNG A;  1BIU A;  1BGX T;  4E7K A;  3SQ2 A;  4FLU A;  4UQG A;  1RTJ A;  1TKX A;  3BGR A;  1O1W A;  1HNI A;  1SUQ A;  4CED A;  5KTQ A;  3JYT A;  4HCB A;  1Q9Y A;  4KHS A;  4CGG A;  3QEX A;  4BDP A;  4M3R A;  3LP0 A;  4CF9 A;  4BDY A;  4MQ3 A;  4J2D A;  4JRQ A;  4FLX A;  3SQ1 A;  4HUE A;  2YKN A;  3AA5 X;  4ZTF A;  2IOC A;  3BDP A;  4RW4 A;  1SV5 A;  3HPO A;  1L3S A;  1X9S A;  4Z4I A;  2D5R A;  1RT7 A;  1S6P A;  3ZT4 A;  3NCI A;  1JL1 A;  1C1C A;  4DLE A;  3OJU A;  4KTQ A;  3NE6 A;  4DQS A;  3EZ5 A;  1ASU A;  1KLM A;  3B6O A;  1QTM A;  4B9U A;  1I39 A;  4KV8 A;  4C8M A;  3HST B;  1T03 A;  1NKE A;  4NCG A;  1S6Q A;  3B6P A;  3ZSQ A;  1R0A A;  4DTU A;  4HTU A;  1LV5 A;  1NJY A;  3I0R A;  1ZBF A;  4EZ9 A;  1LWE A;  3MXI A;  1YTU A;  5C24 A;  4M3U A;  3OYA A;  1QS4 A;  1YTA A;  1IKW A;  3ZSV A;  3NH0 A;  3OYG A;  2A1S A;  4Y1D A;  4FLV A;  3SZ2 A;  4DTJ A;  3QNN A;  5I3U A;  4FZX C;  4OLB A;  2BDP A;  3AO3 A;  1BHL A;  4FM1 A;  4O5B A;  3V1Q A;  1X9W A;  3LDS A;  4FZZ A;  2BGG A;  3K2P A;  3M8Q A;  3OS1 A;  4E1N A;  1RBR A;  1IKV A;  2YHB A;  4E7J A;  3LAL A;  3AVJ A;  2KZM A;  4FK4 A;  4DLG A;  1KLN A;  1RDD A;  1IH7 A;  4CJK A;  3AVG A;  4CIG A;  3V6D A;  1TK0 A;  4QOZ B;  2E6L A;  2X6N A;  3CG7 A;  3QER A;  3NH1 A;  2BE2 A;  3P1G A;  1Q9X A;  4FJ7 A;  4M3Z A;  2HND A;  3LAK A;  2G8I A;  1VSF A;  4DQR A;  4DTP A;  4CF0 A;  4C8O A;  1FKO A;  4N41 A;  1REV A;  3AV9 A;  4CHY A;  5T7B A;  1NKB A;  3K5M A;  4I7F A;  4CFA A;  3L2Q A;  2G8H A;  1RT6 A;  5HP1 A;  3KTQ A;  2ATQ A;  2OZM A;  3ZSZ A;  1ZBL A;  2ZD1 A;  1SKW A;  1XC9 A;  1RT1 A;  4B9T A;  1CXU A;  4YNQ A;  1XI1 A;  4G1Q A;  4OKK A;  1NJZ A;  3WNF A;  4Z4G A;  4CJ3 A;  3CQ8 A;  4KHW A;  3P5J A;  3VQ4 A;  4CJT A;  4HCC A;  2KTQ A;  1J9A A;  3KK2 A;  1JXE A;  1TAQ A;  2FBV A;  3AA3 A;  4KRF A;  3ZT3 A;  1RNH A;  4F3O A;  3O4N A;  4IFV A;  4Z4E A;  1BIZ A;  4FYD A;  3LAN A;  1IKY A;  3V9X A;  4CEC A;  3DYA A;  3AVA A;  2Z1I A;  3NF6 A;  4CF1 A;  3HM9 A;  3WNH A;  4N47 A;  1HMV A;  1SL1 A;  2HB5 A;  3TAG A;  2YV0 X;  2XY7 A;  3OYH A;  4AHT A;  2DFF A;  5K14 A;  3PY8 A;  3QES A;  4DQP A;  2GUI A;  1TKZ A;  2F96 A;  1QE1 A;  1JLC A;  3LPU A;  4E1M A;  3L2R A;  3QO9 A;  1WSJ A;  3DOK A;  3DRS A;  3U3Y A;  5HLF A;  1J54 A;  1KVC A;  3QET A;  2G8W A;  1WSI A;  1CZ9 A;  3PUF A;  4FVM A;  4ZHR A;  2OA8 A;  1A5X A;  4J2B A;  4OKE A;  3V9U A;  1KSP A;  4CCH A;  1B9F A;  2X78 A;  2B6A A;  3SUO A;  3MAQ A;  3UIQ A;  3O4Q A;  4DS5 A;  2RN2 A;  4N76 A;  1NK8 A;  2QKB A;  1RTH A;  4PA1 A;  1TK8 A;  3O3F A;  3PX6 A;  4RW8 A;  3TAQ A;  1DLO A;  4Z4F A;  2W42 A;  5CYQ A;  3FFI A;  3OYI A;  3RWU A;  2PYJ A;  2XY5 A;  1RT2 A;  1HQU A;  1TAU A;  2R7Y A;  5KRS A;  3SCX A;  3P83 D;  1WAF A;  3CFP A;  1WSG A;  4KI4 A;  4OLA A;  4Z0U A;  4BWM A;  1G15 A;  4CK3 A;  3KLE A;  3CM5 A;  3VQP A;  4DSF A;  3V4I A;  4DFM A;  2AJQ A;  4LH5 A;  1VSE A;  4RW7 A;  3SJJ A;  4DU1 A;  1N5Y A;  4O0I A;  2HHV A;  4O0J A;  1FK9 A;  2DFE A;  3AVM A;  2OZS A;  2DY4 A;  1XHX A;  3LWM A;  2G8V A;  3RR8 A;  1CLQ A;  4W5Q A;  4DFP A;  3HK2 A;  3ALY A;  2IAJ A;  1GOA A;  3L3U A;  3EYZ A;  3TAM A;  3U3G A;  2B4J A;  1XWL A;  4CES A;  3T19 A;  2DTU A;  4CGH A;  3OS0 A;  4HHT A;  2ITG A;  5FDL A;  4IG3 A;  4Q5V A;  4CHQ A;  1U49 A;  1X9M A;  2FBX A;  3HXM A;  1HYS A;  2OPQ A;  1GOC A;  1Y97 A;  1XHZ A;  3TAR A;  2HHU A;  2QXF A;  1RTI A;  4O55 A;  1JLB A;  3NGI A;  5EU7 A;  2VWJ A;  3AVL A;  4F2R A;  4B9L A;  2X74 A;  1JKH A;  4FJI A;  4K8X A;  3S3O A;  2B5J A;  3E01 A;  3RRH A;  1KRP A;  4F3T A;  1Q8I A;  2E6M A;  2VG7 A;  4TSX A;  3HVR A;  2PZS A;  3AVN A;  1ITG A;  1RBV A;  4DSE A;  4KRE A;  3KLF A;  3LP1 A;  2O4I A;  3VQE A;  4DQI A;  4E7L A;  4BAC A;  1ZYQ A;  3OYJ A;  3QIO A;  3RRG A;  4I9L A;  2I5J A;  1RBS A;  1C6V A;  3AO2 A;  3DLE A;  4O44 A;  1ASW A;  5DK5 A;  5JS1 A;  4N56 A;  1S5J A;  3HVT A;  3O3H A;  1WLJ A;  1VSL A;  3OYB A;  3SYZ A;  3VN5 A;  1Z26 A;  2RKI A;  3WNE A;  5SZT A;  3OYN A;  1VSD A;  4OKJ A;  1NJW A;  2OPR A;  4FXD A;  3ASM A;  1DTQ A;  1KFS A;  3TAE A;  3K59 A;  2VWK A;  2IGI A;  3KIO A;  1SKS A;  4B3O A;  5HRO A;  4KTZ A;  3M8P A;  4B9M A;  1IG9 A;  1VSJ A;  4LY7 A;  3V9Z A;  3PX4 A;  3K5O A;  3QLH A;  3I8D A;  2LSN A;  4LSN A;  4DTO A;  4KAZ A;  1EKE A;  4FJK A;  4HUG A;  3ZSO A;  4CK1 A;  4I2P A;  2YNF A;  4FJM A;  4CHZ A;  3HP6 A;  4C8K A;  3VQ6 A;  1VRT A;  1I3A A;  4CJE A;  5JS2 A;  1HYV A;  4Z4H A;  1NK5 A;  4DFK A;  2NUB A;  3LPT A;  3TAB A;  1A5V A;  1QHT A;  3SPY A;  2FC0 A;  3AVC A;  3QEW A;  2WOM A;  4IBN A;  4KTW A;  4OJR A;  4M3X A;  5HRN A;  4E7H A;  3OJS A;  3RR7 A;  3KLH A;  4FW2 A;  3NAE A;  4FJG A;  4XIU A;  2HHQ A;  1B9D A;  1NKC A;  3PX0 A;  3IAY A;  3DLH A;  4W5N A;  4LSL A;  5J2P A;  4BE2 A;  1TL1 A;  1NK7 A;  3HO1 A;  3L2V A;  4AHU A;  4CEF A;  1TKD A;  3K5N A;  1VSH A;  3AVB A;  4AH9 A;  4JS4 A;  4FJX A;  1D8Y A;  3RMB A;  3CYM A;  2QK9 A;  4E19 A;  2FBT A;  1JLG A;  2Q3S A;  3RMA A;  4DTR A;  4CJR A;  1U04 A;  1VRU A;  2DFH A;  2JLE A;  3ITH A;  5J2N A;  1WN7 A;  4KHY A;  3ZT2 A;  3OS2 A;  4ICL A;  2HHX A;  1LWC A;  4CJS A;  4CJQ A;  2GBZ A;  4CEO A;  3K5L A;  1KCF A;  4IDK A;  2FBY A;  1QSY A;  3VA0 A;  1HJR A;  1QQC A;  3LP3 A;  3OY9 A;  1SKR A;  4H8K A;  2QKK A;  4KHU A;  1HRH A;  3VQB A;  4JLH A;  3DLG A;  1D9D A;  2XY8 A;  1UA1 A;  2HHS A;  4RG8 A;  3RMD A;  1S1W A;  1C1A A;  1DTT A;  1TGO A;  3HL8 A;  4IG0 A;  4W5O A;  3DMJ A;  3O3G A;  3ULD A;  3PV8 A;  1SL2 A;  4J2A A;  5FRM A;  5CYM A;  3SUN A;  4M3T A;  1RCH A;  5KGW A;  5CZ1 A;  3TAN A;  3AO5 A;  3OYF A;  1TKT A;  1U4B A;  3DLK A;  2E4L A;  4DFJ A;  2KFN A;  4DTX A;  3ZT0 A;  3SQ0 A;  4IKF A;  4OPK A;  1RT5 A;  4PQU A;  5CY4 A;  1ASV A;  3NF8 A;  3DI6 A;  4KO0 A;  1J5O A;  4KB0 A;  4K8Z A;  4FLT A;  5HRP A;  3SV3 A;  3KK1 A;  4DF8 A;  3S9H A;  4CF2 A;  3KK3 A;  4RW9 A;  3S3M A;  2XO7 A;  4KKO A;  4CHO A;  4GW6 A;  4CFD A;  4PY5 A;  1S1X A;  3NF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...