1W0HA

Crystallographic structure of the nuclease domain of 3'hexo, a deddh family member, bound to ramp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
200
structure length
200
Chain Sequence
ADSYYDYICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYVRPEINTQLSDFCISLTGITQDQVDRADTFPQVLKKVIDWMKLKELGTKYKYSLLTDGSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPHCGLDDSKNIARIAVRMLQDGCELRINEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Structure of the Nuclease Domain of 3'Hexo, a Deddh Family Member, Bound to Ramp
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords 3'-5' EXONUCLEASE ERI1
total genus 57
structure length 200
sequence length 200
ec nomenclature ec 3.1.-.-:
pdb deposition date 2004-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1w0hA00
1EKEA 1JLCA 3MEDA 3U3GA 3NBPA 2ITGA 3A2FA 3K5OA 1NK4A 1SL2A 2LSNA 1ASUA 4PY5A 5HRSA 4CGIA 4M3WA 4FJ9A 2D0CA 3M8PA 1GOAA 3ITHA 4H8KA 4CJVA 3ISNC 1LW2A 3HVTA 1VSHA 2Y1JA 1B9DA 3VQ4A 1VRUA 1HYZA 4CF9A 4DS4A 1DLOA 1SV5A 3HXMA 1KVCA 3SQ1A 3CM5A 3VQ5A 1TK0A 3TAQA 4DTMA 3MXMA 1TK5A 4RW6A 5C24A 1Z26A 1U48A 3LAMA 1J5OA 3IS9A 3OY9A 1C1BA 1IO2A 3NF7A 4DTUA 1SKWA 1UAXA 4FLWA 2X74A 4IG3A 2XO7A 2KZMA 2G8VA 1S1TA 3QEIA 4DSJA 2VG6A 5CZ1A 3T3FA 1FXXA 4F2RA 1NK5A 4DF8A 4FZZA 4Z4EA 3K5NA 3ZT1A 4KB1A 4F2SA 4OPKA 2ETJA 1IKYA 1IKWA 4M3ZA 1JLBA 3TAGA 2QKKA 1ZBUA 4DQSA 5HLFA 3TWHA 2G8HA 2Q3SA 3P5JA 2IC3A 2XY8A 4E1NA 2ZE2A 4FJIA 1A5VA 2YKNA 1U04A 5FRMA 1RT5A 1F21A 3KLEA 3OYDA 1LWCA 4BDYA 4BE2A 4DQRA 4CHNA 3V9ZA 3SQ2A 4IG0A 3QINA 4KRFA 2OPSA 4XIUA 4CHQA 4CJ4A 3TR8A 4KFBA 3V1QA 4JS5A 2IAJA 3OYMA 3ASMA 3AA2A 4B08A 1JLAA 2EHGA 4E7LA 1NKBA 3KTQA 4NCGA 3U3YA 1EETA 1HYVA 1KVAA 3VQCA 4FJLA 3ZCMA 3LP3A 1REVA 5DMRA 2B4JA 4M41A 3AVMA 4DFKA 4I7FA 1C0TA 3V1RA 4DSLA 4BWJA 2GBZA 4M45A 4I9LA 4HCCA 4OGEA 2F8SA 5HBMA 4CFCA 4E7IA 3ZT3A 2F96A 2XHBA 1WN7A 3M8QA 4FLUA 4AHRA 4E7JA 3O3FA 1ASWA 2FBVA 4O0JA 4LH5A 2P5OA 3H08A 3ZSQA 4KI4A 2GUIA 3K2PA 1KRPA 4KAZA 4DSKA 3KLGA 4I2QA 4DQPA 1HRHA 4M3XA 3NHGA 4ZTFA 2FBXA 3C6TA 1UWBA 2YNIA 4AHTA 3NGZA 3KLHA 3VA3A 4FZYA 4PUOA 1ZBHA 4KHWA 3K59A 3OJUA 2HVIA 1J53A 4CFAA 2HHQA 4CF0A 1RBRA 2B6AA 4DFJA 4DFMA 1QSYA 1L5UA 4FJGA 1CXUA 2D5RA 3E01A 3ZSZA 1I3AA 4DQIA 4CJ5A 5HROA 4AHSA 2W42A 1NJZA 1KLMA 1RT3A 4EZ9A 4Z4HA 5FROA 2ZD1A 4CJWA 3I0SA 4B3OA 4H4MA 3LP2A 3LZIA 1KCFA 1CZ9A 1TVRA 3L8BA 3TABA 1C0UA 1ZBFA 4CERA 1J9AA 1JLEA 3LWLA 5J2PA 3NE6A 1JLQA 4QAGA 3MAQA 3THVA 1S1WA 5CYMA 2BANA 4AHCA 4W5QA 3IAYA 4C8OA 1CZBA 4Q5VA 1B92A 1BIUA 4CF8A 3RMAA 1T7PA 3VQBA 3DI6A 1LWEA 4CEOA 3V9UA 2RF2A 1JLGA 3AA5X 1CXQA 1TL3A 3OYEA 4FCYA 3KD5E 1A5XA 4OGCA 1KVBA 2HNZA 3LALA 3VQEA 3M8RA 3QERA 1T8EA 1SKRA 1VSDA 4KHSA 3HK2A 1D8YA 1BHLA 1I39A 3DRPA 2BDPA 1XC9A 1JLFA 2GV9A 4JRPA 4HTUA 4WE1A 3SCXA 1O1WA 3AVLA 3L2QA 4DLGA 3CFRA 1JKHA 3BGRA 4E19A 4N56A 4MFBA 3TANA 3AA4A 1TK8A 2PY5A 2BGGA 3LP1A 3L2VA 4O4GA 4CHOA 3UIQA 1HMVA 3V81A 3SPYA 2IDOA 2Z1GA 1IKXA 4B9NA 2PYLA 1XWLA 2ZQBA 4RW4A 4EP5A 4BE1A 2D0AA 1RILA 4CCHA 4M3YA 4DTNA 3QNOA 2F8TA 3WNEA 3DLBA 3HSTB 1U49A 3OYKA 5HP1A 1NOZA 1UOCA 1YVUA 5SWMA 3S3NA 4I9QA 3IG1A 3AO2A 1QHTA 1BISA 3LANA 2Z1JA 4QCLA 2A1SA 1U4BA 2OYQA 1RTHA 2HNYA 4RW7A 5KI6A 3L3VA 3V9XA 3C95A 3LPTA 3HL8A 1X9WA 4F8RA 3OYAA 4CIGA 2Y1IA 3TAMA 4N5SA 3QESA 1TV6A 4FK4A 1ITGA 3P1GA 4M3RA 3DLEA 3WNFA 3ZT2A 4CJLA 1BCOA 3AVBA 3QNNA 3ALYA 1HQEA 4FLYA 1WSIA 4AHVA 4KI6A 1DTQA 1U45A 4Q0BA 1TKZA 3MXIA 2QKBA 1KSPA 1S9GA 4CEEA 4DG1A 4B9UA 4LH4A 4FLZA 1D5AA 2HNDA 4B9MA 5C42A 4M42A 2G8IA 5K14A 3K58A 4HUEA 2OPQA 5C25A 4ELVA 3OYLA 1RDBA 3AO4A 1ASVA 3DLRA 5J2MA 1VSLA 4OLBA 3TAPA 4E7KA 4KHNA 1Y97A 2YNGA 3WNHA 4ZHRA 4DTRA 1U47A 4Z4FA 4Z4IA 3F73A 4FJ7A 2NUBA 3T1AA 4ICLA 4FYDA 2OPPA 3VA0A 3CM6A 1YT3A 3ZSVA 2WOMA 3VQAA 1VRTA 3MEEA 3JYTA 3K5MA 1N5YA 1RT4A 1JXEA 4CK1A 3L2WA 3RMCA 4K8ZA 2HHUA 2E6LA 1LAWA 4JLHA 3VQQA 3SV3A 1R0AA 1TL1A 4B8CA 1NK0A 2E6MA 3P83D 4DS5A 4L8RB 4AILC 2AJQA 3AO5A 3NH0A 3DRRA 3LDSA 3V9SA 4ID5A 4OVLA 3RRGA 4IDKA 1EXQA 1UA1A 1QSSA 3KJVA 3HP9A 5CYQA 4Z4CA 4DSIA 3OYCA 1LW0A 3OYGA 4CK3A 3KK2A 4CEAA 3K5LA 3KKRA 3OYHA 2G8UA 3SUPA 4K8XA 3HO1A 4J2AA 1BI4B 3MECA 1T03A 1NK9A 3O4NA 2OA8A 2KW4A 2X78A 1BIZA 1VSKA 3B6OA 3NGYA 4CIFA 4FJJA 4KPYA 4M3UA 4PQUA 1ZYQA 1RBVA 4B9SA 3ZSYA 4Y1CA 4IFYA 3SI6A 4DU3A 2B5JA 4FVMA 4RG8A 4CHPA 4EP4A 1L3VA 4FM2A 2XY5A 5FRNA 2KFNA 3OVNA 1B9FA 3M8SA 1QQCA 3OS0A 1L3SA 1RTJA 2KFZA 3VQ8A 3K57A 4GW6A 5KGWA 2HHTA 1RT6A 3CYMA 3LPUA 4OKEA 3CFOA 3JSMA 5J2NA 1WAFA 2VWKA 3WNGA 3PX6A 3PO5A 3KD1E 4BACA 3HJFA 2IOCA 2OPRA 2O4IA 1RBSA 1RT1A 3KLIA 2IGIA 1TKDA 1WSGA 3NDKA 2HHSA 1NK7A 1A5WA 1S1XA 2OZSA 3HPGA 1RTDA 4HUFA 1RT7A 3DOLA 4RW9A 3OYBA 3RMDA 1SUQA 4F3OA 4F3TA 1TAQA 3CFPA 2YHAA 4DFPA 4W5OA 1BQNA 1WLJA 3G0ZA 4NCBA 2HHWA 1HNVA 1S5JA 3NCIA 1TAUA 4CGHA 2OZMA 1SL0A 2DY4A 2XRIA 4CEBA 3NH1A 1FKOA 4C8LA 3SQ4A 4E89A 5CZ2A 3HM9A 1L3UA 5I42A 2I5JA 4DTSA 3TAEA 1S1UA 3AVFA 1HNIA 3NFAA 1HQUA 1QSLA 3ZT4A 4OJRA 3V9WA 4OLAA 4O44A 4GVMA 3S3OA 1BQMA 5T7BA 3ZSXA 1K6YA 1RTIA 4LY7A 1JL1A 2P5GA 3KK3A 2PZSA 4FW1A 1Q9XA 5J2QA 3KIOA 1VSEA 4IFVA 3TARA 1RBTA 3KLFA 4CF2A 4N76A 3DM2A 2G8FA 1EX4A 5SZTA 1JXBA 4Y1DA 4DSFA 3L3UA 4FJMA 3QLHA 3CQ8A 3DMJA 4KHUA 3V1OA 1QE1A 3EY1A 3QIPA 2FC0A 1LWFA 2P1JA 4OKKA 1NK6A 3RR7A 4M3TA 2YNHA 4DWIA 1XI1A 4JS4A 2DFHA 4CJRA 3OS2A 1BL3A 2P51A 4OPJA 1C0MA 4DU4A 4Z4GA 4CJFA 4CJPA 2YKMA 4AHUA 4C8NA 4W5RA 3PY8A 3C6UA 3QIOA 4KO0A 5I3UA 3VQ6A 1KLNA 2RKIA 3V4IA 4CE9A 2QK9A 1KFSA 3MEGA 4C8MA 4CJUA 3VQ7A 4YFUA 4B9TA 3NAEA 4DQQA 4E3SA 5J1EA 4FLVA 4FJHA 1IG9A 1BCMA 2WONA 4NYFA 4AH9A 4KKOA 3I8DA 3OJSA 1NOYA 2YHBA 3VQ9A 4FLXA 3QEWA 3TAFA 4GMJB 3DLGA 2HVHA 2XY7A 4KHQA 2IS3A 1S6QA 4CGDA 3NGIA 5HRPA 2RPIA 1T05A 4B8AB 3KK1A 4CHZA 1FKPA 4LSLA 1LAVA 1WSJA 3RMBA 3CG7A 2A1RA 3SJJA 3SPZA 4BDPA 4F4KA 3ZSWA 4CJ3A 4CJKA 1RDCA 3HPHA 4EZ6A 4FJ8A 2KZZA 4DTPA 4CFDA 5HRRA 4PWDA 1VK0A 3EYZA 4KTZA 1C1AA 2RN2A 4DMNA 1IH7A 4CEFA 2R7YA 2JLEA 1MU2A 1QTMA 4CK2A 3S3MA 4FW2A 3NF9A 1BGXT 1L3TA 1DTTA 2EX3A 1X1PA 3HPOA 4FJ5A 3FFIA 4PA1A 2X6SA 3D45A 4E7HA 2PYJA 3AVIA 3EZ5A 1W9HA 1Z25A 4UQGA 3NF8A 5CY4A 3D0PA 1VSMA 4HHTA 2DFFA 4CJSA 2D0BA 2DTUA 2Z1HA 3AVKA 1TGOA 3LWMA 2DFEA 2HHVA 1GOBA 3AV9A 2VWJA 3SZ2A 3LAKA 4IKFA 3NF6A 1NKEA 4CIEA 4KREA 4CEQA 4ID1A 1WSFA 4TSXA 3SNNA 1D9FA 1X9MA 3C94A 4MQ3A 1LV5A 3QEXA 2FBYA 3TI0A 1NJXA 1VSIA 5KRSA 4R5PA 3PO4A 4YNQA 1TKXA 4FK0A 3QO9A 2ATQA 2G8KA 3PX4A 2FBTA 4CESA 3DLKA 1XHXA 4CECA 4DF4A 3O4QA 4J2DA 1FK9A 3VQPA 1VSJA 3AVGA 3PV8A 3RWUA 1BI4A 4DSEA 2KTQA 2O4GA 1NKCA 3BDPA 4KTQA 4J2EA 4O5BA 3AVCA 3O3HA 3HT3A 1WAJA 3LP0A 3NH2A 4BDZA 2VG5A 4HUGA 4E1MA 1ZBLA 3F9KA 5KRTA 4LD0A 1RBUA 1N6QA 2HHXA 2KQ2A 3QETA 4FM1A 1WNSA 4ZTJA 4IBNA 3AVHA 2YNFA 4O0IA 3HP6A 4CJTA 2HMIA 1VSFA 1NK8A 1J54A 5KTQA 4KHYA 4CHYA 3SUOA 4BWMA 4JRQA 3DRSA 5JS2A 4CGGA 4B9VA 4J2BA 2G8WA 3DOKA 2BE2A 4B9LA 1S1VA 1RDAA 4Z0UA 3HVRA 4E0DA 4HVJA 3B6PA 3I0RA 3OYFA 5EU7A 1KFDA 3AVNA 3O3GA 5DK5A 4CEZA 1NJWA 4ELUA 3QEPA 4FJNA 1RNHA 2HW3A 4FZXC 3QEVA 1UA0A 1RT2A 3SV4A 1HPZA 1WSEA 4DTJA 1JL2A 2Z1IA 3AA3A 4CJEA 3SQ0A 3V6DA 3VQDA 4ELTA 4FXDA 1NJYA 3L2UA 3MXJA 4FJXA 1CLQA 3SYZA 3G10A 1KTQA 1HJRA 1RCHA 4CGFA 4CFBA 1D9DA 4QOZB 5D3GA 3ZT0A 4CJQA 4RW8A 5FDLA 4CEDA 3L2RA 1SL1A 4OKJA 4FM0A 1W0HA 1YTAA 4FJKA 4FK2A 3AVAA 3RR8A 3T19A 4DTXA 1YTUA 1WSHA 4HCBA 1RDDA 2YV0X 3OYJA 3AO1A 3PX0A 3HYFA 3DLHA 1HYSA 1TKTA 4W5NA 1S9EA 3DYAA 2JGUA 5KGXA 4DTOA 4DU1A 3SUNA 4KV8A 2XY6A 1SKSA 4C8KA 4O55A 1XHZA 2E4LA 3U6FA 4KTWA 2QXFA 4N47A 3ZSOA 3OS1A 3OYIA 4W5TA 3S9HA 3IRXA 1C1CA 1Q9YA 4FLTA 1EP4A 3RRHA 1GOCA 4CF1A 4NCAA 4LSNA 1QS4A 1C6VA 1Q8IA 3VN5A 4DLEA 3OYNA 2X6NA 4H4OA 1X9SA 1S6PA 3LZJA 4CGJA 4KB0A 4NYNA 1ZBIA 4BE0A 3ZSRA 3RTVA 1G15A 3KKSA 3AO3A 5HRNA 3PUFA 4G1QA 4N41A 2VG7A 3AVJA 5E41A 3SUQA 2HB5A 5JS1A 4I2PA 1IKVA 3ULDA
chains in the Genus database with same CATH superfamily
1HUXA 3U3GA 3WXLA 2FSJA 4CJ7A 3J7ZO 4H5RA 4PY5A 1YHQN 4DR5K 3JS6A 5HRSA 4CGIA 4FJ9A 3CQYA 4BC2A 1GOAA 4H8KA 1LW2A 3HVTA 2VQEK 1HYZA 4CF9A 1Q81O 1KVCA 3TAQA 2P9NB 4CZEA 1U48A 3LAMA 3U9ZA 4C1NI 3NF7A 1SKWA 2DPNA 2KZMA 2G8VA 3J81O 3C7NA 1BO5O 5I9EB 5AQTA 4KB1A 4BVOA 4IO8A 4OPKA 4B3SK 1IKYA 2QKKA 3FZLA 3P39A 3P5JA 2XY8A 2ZE2A 2YKNA 3THYA 4H0PA 1F21A 1C0GA 3OYDA 3KLEA 5LJVA 4IG0A 4A2BA 1E4GT 3AGRA 4KFBA 4WF9L 4JS5A 4IOCL 1OH7A 3OYMA 3AA2A 4B08A 1NKBA 4H5WA 1HYVA 3H45C 4I7FA 4XEIA 4DSLA 1N32K 3PSIA 4M45A 4I9LA 5M1FA 4A61A 4A5BA 2UU9K 2F8SA 4V19S 3FZFA 4JI6K 4E7IA 1WN7A 3M8QA 4AHRA 2D0PA 2FBVA 4JKBA 5AQWA 4KI4A 4EHTA 4KAZA 4DSKA 2A42A 4M3XA 4YDUC 4DQPA 2FBXA 3KLHA 2YNIA 4FZYA 3K59A 1J53A 4CFAA 3MX5A 2HHQA 2UXDK 1QSYA 4FJGA 1L5UA 5ADXH 4JI3K 1SQKA 4JHDB 3E01A 3P38A 4CJ5A 5FROA 2ZD1A 5AZJA 2E2QA 4CERA 1J9AA 1JLEA 4RTFD 3LWLA 4WQ4C 3THWB 1JLQA 3C7NB 4QAGA 3TSQA 2F7TA 4X66K 3THVA 2RE2A 3ENHA 4W5QA 1VQLN 1B92A 4R79A 1KAZA 2W6LA 5EY4A 4FCYA 1ZC6A 1T8EA 2HNZA 2GV9A 4U7BA 4WE1A 4BR2A 3GE1A 5F0XA 3AVLA 3ENOA 3CFRA 3ZX0A 4E19A 3TANA 4MFBA 3LP1A 4FWQA 4O4GA 3L2VA 1HMVA 3H6EA 3P31A 1GLEG 1NGHA 4JI2K 1XWLA 2PYLA 2NRTA 3BF3A 2AA4A 3QFPA 2E88A 4AF1A 1U4BA 3SAHA 2W40A 4CIGA 4Z94A 2WFBA 4ISGA 4N5SA 1JJ2M 3RVCA 1NGIA 3MN6A 4RWTA 5GINA 5AQRA 4BC4A 4G9ZA 3AGKA 3WEEB 1TKZA 1KSPA 2QXLA 3CPWM 4B9UA 3AARA 5C42A 1TYQA 3K58A 5C25A 4JKGA 1SAZA 3AO4A 4FWRA 3L6QA 3MK6A 1VQ6N 4KHNA 1Y97A 3IFRA 3WNHA 5B8HA 4DTRA 4MDAA 2YI1A 3TTCA 4Z4IA 3T1AA 1ATSA 1Q7YO 3VA0A 2OYQA 3MEEA 1N5YA 4K8ZA 1LAWA 4CI6A 4B8CA 3P83D 4L8RB 3BZKA 3AO5A 1NU0A 3NH0A 2P9NA 3DRRA 3V9SA 3SAFA 2ZJRL 4FWSA 1UA1A 3BEXA 1QSSA 1JCFA 3OYGA 3KK2A 1M90O 3HO1A 4B1YB 3BF1A 4J2AA 3VTIA 4BG8A 2KW4A 4BC3A 2X78A 3B6OA 2CH5A 4KPYA 4MO4A 2UUBK 2VCPA 4JAXA 4EFHA 3ZSYA 4B9SA 4IFYA 4DU3A 1L3VA 4NXMK 4FM2A 3CI5A 5FRNA 2KFNA 4BRNA 3DXMA 3VQ8A 4F9OA 1HKGA 3CCLN 3CYMA 3LPUA 3PX6A 3PO5A 4FZZA 2HVIA 3J7YP 2O4IA 3HJFA 3GDQA 2IOCA 4A62A 3KLIA 1NGDA 2HHTA 3MWPA 1RTDA 3OYBA 1TAQA 3SAGA 4PKGA 4W5OA 1BQNA 2HHWA 1K9MO 1TAUA 3QB0A 3NH1A 1HX1A 3EL2A 4DTSA 2F4VK 3AVFA 4JKGB 4DR3K 1NM1A 4OLAA 4O44A 4GVMA 3S3OA 5T7BA 3ZSXA 2P5GA 2Q31A 3CCUN 3TARA 5EXWA 3DM2A 5SZTA 1JXBA 4Y1DA 4IO9L 3L3UA 3N4QA 3DMJA 3V1OA 2FC0A 1NK6A 4IXCA 3O6WA 4JS4A 4CJRA 3MDQA 3CC7N 1C0MA 3FLCO 5BR8K 4K41A 5M1KA 2YKMA 2OTLN 3PY8A 3K9KA 3QIOA 3Q7BA 2V7YA 4C8MA 3PIPL 4DQQA 4JN4A 3ZLJA 4X64K 2O8EB 4RCHA 2YHBA 1NOYA 3VQ9A 4FLXA 3QEWA 3TAFA 4KHQA 1S6QA 3A8YA 1T05A 4JK8A 3SK3A 4CHZA 1FKPA 4O8KA 3RMBA 3SJJA 3P4IA 2BTFA 4F4KA 4YOUA 1RDCA 3HPHA 4EZ6A 2AP1A 4CFDA 3EYZA 4KTZA 1BU6O 1QZ5A 3TPQA 2RN2A 1IH7A 2JLEA 4LF8K 1EWRA 4FJ5A 2NRWA 4MDBA 4E7HA 3DLLL 5CY4A 3D0PA 3GG4A 4DUYK 1TGOA 4LFAK 1NBWA 4DR1K 2VWJA 1S72N 1NKEA 4CIEA 5ADXA 1P90A 1NGCA 4OPAA 3VEYA 1LV5A 4FWPA 3QEXA 5BPMA 2FBYA 1NJXA 3T1YK 3EZWA 3R6MA 3QO9A 3PX4A 4H0TB 4CESA 1XHXA 4DR4K 2NNWA 4FWNA 1VSJA 3AVGA 2KTQA 5TKWA 4GV3A 4J2EA 3HT3A 4BDZA 2O8FA 3EE8A 3I55N 3VETA 1OH6A 2I7PA 4CJTA 4LF5K 4QS9A 1NK8A 1J54A 4BR7A 5F2RA 2OTJN 3AAPA 3G6EN 4BWMA 4JRQA 3BP8A 4J2BA 2YHWA 3DOKA 2BE2A 2P9UA 3HVRA 2FXUA 3JXUA 3O3GA 5DK5A 1NJWA 3QEPA 3B8AX 4FZXC 3QEVA 4FPBA 1UA0A 4DR7K 1JL2A 2Z1IA 1BWFO 4CJEA 3V6DA 3VQDA 3IUCA 3L2UA 3UE5A 1RCHA 1HJRA 3O9QA 1TYQB 1K73O 3GOIA 3ZEUA 3ZT0A 4CJQA 1TUUA 5FDLA 4CEDA 3L2RA 4OKJA 4FM0A 1W0HA 2FSKA 5ELZA 3RR8A 1BA1A 5LMUK 4HCBA 4W5NA 2YV0X 3DWLA 3AO1A 3LDOA 5AR0A 4BR0A 3PX0A 2O8EA 3DYAA 5BPNA 1M1KO 2YX6A 3U6FA 4KTWA 2QXFA 3IMXA 4N47A 3ZSOA 3OYIA 1Q9YA 2BH1A 1C1CA 4FLTA 3RRHA 4CF1A 3ULEB 1JCEA 1Q8IA 4JI4K 3OYNA 1DEJA 3LZJA 4KB0A 1ZBIA 3H1QA 3G4SN 1QQNA 1VQ9N 5HRNA 4N41A 2VGNA 3ATUA 3C6HA 4I2PA 5AQUA 4DCHA 1JLCA 3CIPA 3NBPA 2ITGA 3A2FA 3UKRA 5KQDA 3THXA 1SL2A 1ASUA 3QBWA 4H03B 1T44A 3CHWA 1VQ7N 1N34K 4FWOA 4PL8A 1QVFM 1XUPO 3ITHA 2RHKA 4CJVA 3ISNC 1VSHA 3CJ9A 1VRUA 1TK0A 3T69A 3HTVA 4LF6K 1TK5A 3CJ7A 4ILHA 1J5OA 5AQSA 4DTUA 1UAXA 4FLWA 2X74A 2VG6A 4F2RA 1NK5A 4Z4EA 1VQ4N 4F2SA 3O9TA 4DUZK 1IKWA 2O8BA 5AQZA 5JVHL 4O5FA 1A5VA 1U04A 4DQRA 4BDYA 4XIUA 2UUAK 4GVEA 1JLAA 1RDWX 4ISFA 4GV6A 4NCGA 2BUPA 1KVAA 1K8KA 3ZCMA 5DMRA 5AQXA 5BRFA 5GAHP 4DFKA 3V1RA 3O80A 1EO1A 4FL9A 2OCEA 1LOTB 3CXCM 5EX5A 3MMVA 2P9SB 1ASWA 3MN9A 5C10A 4LH5A 2P5OA 3QDKA 1KRPA 4NLBA 3KLGA 1HRHA 3NHGA 3C6TA 2ASMA 1UWBA 4GY2B 3VEVA 3NGZA 3VA3A 3VERA 2I7NA 1NMDA 2B6AA 3G25A 4DFMA 4JKAA 1VAZA 1OKJA 3UKUA 4DQIA 1GLJO 4IZ9A 3I0SA 3VF6A 4B3OA 4JKHA 1CZ9A 1TVRA 3L8BA 5GIOA 4ILJA 2PFUA 5J2PA 4DV0K 4IOAL 2PBDA 2A40A 4XH1A 4JEPA 1HNZK 4BY9C 1BIUA 4WFNL 3NVMA 3DI6A 1VQPN 2RF2A 1JLGA 3OYEA 5EVZA 3QERA 3VQEA 3LALA 2E2OA 5KPTA 1SKRA 1I39A 2BDPA 1JLFA 4BRAA 2YJFA 3OA9A 3AA4A 2PY5A 4CZKA 4CHOA 3V81A 4MLEA 3BY5A 3SPYA 3HZ6A 4KHPK 4BE1A 4EP5A 2F8TA 4DTNA 1VQNN 3HSTB 3ZETA 3OYKA 3IG1A 3K9JA 3R9PA 3LANA 1RTHA 4JK9A 1ILYA 3V9XA 3CF5L 4AM6A 4UY8O 4NO7A 3HM8A 2QI2A 4BRMA 1YF5L 1I94K 4CBUA 4JNEA 3ZT2A 4CJLA 1BCOA 3AVBA 3ALYA 4FLYA 4AHVA 4H0OA 4KI6A 4Q0BA 3WQUA 4DG1A 4NXNK 3THYB 1D5AA 2HNDA 4M42A 2OPQA 3OYLA 3OBWA 1ASVA 3DLRA 5J2MA 2YCHA 1NJIO 1X3MA 4ZHRA 3EKSA 1BA0A 3HI0A 4Z4FA 3F73A 3WXIA 3DXKB 4FYDA 2OPPA 3VESA 2NZTA 3U9DA 3L0QA 3JYTA 1JXEA 4CK1A 5FPMA 3L2WA 2E6LA 4ISEA 1TL1A 1T6DA 2GWJA 4DS5A 5JVGL 3VEXA 4DV7K 2AJQA 4LFCK 4OVLA 3RRGA 4IDKA 5AQPA 3HP9A 5CYQA 4B3TK 3E1YA 4I6MB 2G8UA 4CEAA 3KKRA 3OYHA 3OBYA 2VGMA 3HOSA 1T03A 1NK9A 2OA8A 3D2FB 3TTFA 1VSKA 3AAQA 1GLBG 1NG9A 1RBVA 4Y1CA 4M3UA 3BUZB 4FVMA 4RG8A 2XY5A 4WQ5A 3OVNA 2P9SA 3OS0A 1L3SA 1RTJA 4JI1K 5KGWA 2HMPA 5J2NA 3WNGA 1EWQA 2OPRA 4BGBA 3PIOL 1S1XA 2NRHA 3HPGA 4HWIA 1NGEA 2HSTA 4CZLA 4DB3A 2YHAA 3IKMA 3VGMA 1WLJA 1HNVA 1S5JA 4PKIA 3NCIA 3VEZA 2XRIA 1ESVA 4YHHK 5JMVA 4E89A 2QWPA 4IJAA 1YAGA 1L3UA 5I42A 3NMUA 4JD2B 2PAVA 4OJRA 1H1VA 1BQMA 4QS7A 1OVQA 1CZAN 4CD3A 2KKZA 4BR4A 1RTIA 3WQTA 3KWIA 1HLUA 1U2VB 4FW1A 5FLXO 3WXKA 3F9MA 1VSEA 3KIOA 4CF2A 3A5OC 4DSFA 4FJMA 3QLHA 2QM1A 3RR7A 3QIPA 4M3TA 1XI1A 1SS6A 3LM2A 2CGKA 4YORA 4DU4A 2E2NA 4IOXA 4Z4GA 2E20A 4CJFA 4AHUA 1KXPA 3O9SA 3A5LC 5I3UA 1J6ZA 4CE9A 1Q18A 4CW7B 1KFSA 1MA9B 4E3SA 4DQ8A 4AH9A 4KKOA 5LL6Z 3DLGA 2IS3A 4K43A 4CGDA 1LAVA 1WSJA 3SPZA 1XNRK 3ZSWA 4CJKA 2KZZA 3O1WA 5HRRA 5HL7L 3OTOK 2CGLA 4CK2A 4FW2A 2EX3A 2X6SA 1WBDA 5DM7L 3NF8A 3CJ1A 1OVYA 3D2EB 2HHHK 4CJSA 1T6CA 3AVKA 2HHVA 2DFEA 1GOBA 4YDUA 4KREA 4FVUA 4ID1A 1WSFA 3UKUB 3TI0A 3LL3A 1VSIA 1HNWK 3PO4A 1W97L 1TKXA 2O8DB 3O9RA 1IV0A 4CECA 4J2DA 3O1BA 5LY3A 3VQPA 5AQGA 3RWUA 3PV8A 1HKBA 3S41A 1QQMA 1HPMA 2E1ZA 4KTQA 1YIJN 1C0FA 1QQOA 3AVCA 3C6AA 3LP0A 1X9JA 4HUGA 4E1MA 3Q7CA 4J8FA 5KRTA 1RBUA 3QETA 2UYTA 4IBNA 3AVHA 2YNFA 3HP6A 1VSFA 1V4SA 5KTQA 3M3ZA 1IBMK 1K8KB 3DRSA 4IFEA 5JS2A 4B9VA 2G8WA 2ASPA 4B9QA 4HVJA 2YHYA 3I0RA 5EU7A 3AVNA 4ELUA 3EO3A 4CZMA 4DV5K 3N4PA 1RT2A 4ELTA 4FXDA 1NJYA 4FJXA 1CLQA 3CJCA 4CGFA 4CFBA 1D9DA 4RW8A 5JICA 3CCJN 4MO5A 5AQFA 1YTAA 3MX2A 1ZXOA 4FK2A 3PSFA 4DV1K 4DTXA 2P9IB 3D2EA 1V4TA 4BRGA 2CH6A 1KD1O 2ZWHA 3SUNA 2QWLA 3QMLA 1ATNA 1NGFA 4O55A 2HBKA 3S9HA 5C2DA 3IRXA 2IVOA 3VF4A 4BVPA 4DLEA 2YHXA 4H4OA 4CGJA 4NYNA 1VQON 3RTVA 3FZKA 3CCRN 4G1QA 2VG7A 4BQLA 2HB5A 5JS1A 3KVGA 3E66A 3ULDA 3AY9A 1EKEA 3MEDA 4C8LA 4EHUA 1QVGM 5AJ3K 2ZM6K 4M3WA 2D0CA 3M8PA 3VEWA 2IIRA 1NGGA 4DV3K 3HXMA 1SV5A 3VQ5A 1RGIA 5C24A 5AQJA 1WOQA 1C1BA 1QHAA 2D1KA 4IG3A 5FPEA 3QEIA 5CZ1A 3T3FA 3T7ZA 3ZT1A 5C0YA 4DV2K 3TSUA 2ETJA 3TAGA 1ZBUA 3FR0A 4DQSA 2NRVA 5HLFA 4BGAA 1QZ6A 3SMPA 3VGLA 5BPLA 1XMQK 1RT5A 4BE2A 5FRMA 3CQXA 1LWCA 2Q1NA 3V9ZA 3WEEA 2OPSA 4KRFA 4CHQA 4JKDA 4CJ4A 4IEIA 2EHGA 2H3GX 3KTQA 2KHOA 4B1XB 3U3YA 3LP3A 1REVA 4I6MA 4M41A 2F9TA 4WFAL 2D4WA 4HCCA 5E26A 1OH8A 4CFCA 3ZT3A 4QS8A 3H3NO 1ATRA 3GBTA 3O3FA 1W2BM 4O0JA 3H08A 2O8CB 3EE9A 3ZSQA 3K2PA 3D6RA 2FLOA 4I2QA 2IVPA 3UKRB 4ZTFA 4AHTA 4PUOA 1U2VA 5C2FA 4CF0A 1RBRA 2FF3B 5GAGP 4DFJA 4A5AA 2E5LK 3ZSZA 3ZEUB 5KPZA 5HROA 2W42A 1NJZA 1RT3A 3OW2M 3L4IA 4CJWA 3CD6N 3LZIA 2Q97A 1BG3A 5BR9A 3SJHA 3R8EA 1E3MA 3MCPA 3MAQA 3F2KA 2P9IA 1JCGA 1CZBA 4FOEA 1DGKN 4Q5VA 3V9UA 3KD5E 1CXQA 4OGCA 1YJ9N 4KHSA 1VSDA 3SBGA 4GNIA 1D8YA 1BHLA 4JI8K 3SLCA 1E4FT 4XH5A 4JRPA 3T1HK 3VPZA 4A59A 5AQHA 3L2QA 2HOEA 4DLGA 1JKHA 3CERA 4N56A 1G99A 4BRIA 2BGGA 3UIQA 2Z1GA 1IKXA 4B9NA 3QICA 4RW4A 2D0AA 1RILA 3QNOA 1U49A 5HP1A 1NOZA 1YVUA 2V52B 1QHTA 1BISA 2Z1JA 3M6GA 5M1PA 2HNYA 4RW7A 1FJGK 3L3VA 2ZJQL 1BUPA 3LDLA 3WT0A 3HL8A 2P9LA 4F8RA 3OYAA 1ITGA 3P1GA 1YXQA 4CZIA 5H1SQ 4FSVA 5BN9A 4JI0K 2P9PA 5FPNA 5CR4A 2NRRA 3MXIA 1S9GA 4CEEA 2A3ZA 4FLZA 2G8IA 1U6ZA 3TU5A 5KPRA 1RDBA 1YVNA 4E7KA 5JLFA 2NUBA 3J8AA 3WXJA 1DKGD 3D7EO 3K5MA 3VGKA 3ZSVA 3VQAA 1VRTA 3VEOA 3SV3A 1R0AA 2E6MA 3LDPA 2GTDA 3FZMA 3CJAA 3E9OA 4BRQA 3LDSA 3CCVN 5AZIA 4ID5A 4GKKK 1J5EK 1EXQA 1Q86O 3KJVA 1VHXA 4XH4A 3K5LA 3O8MA 4CK3A 3F5TA 2QWRA 5BRDA 2HBMA 3K0SA 4LFBK 5AQMA 1ZYQA 4YY3K 4H5VA 4A2AA 4CHPA 2QWMA 3M8SA 2JWKA 3K57A 3UB5A 4GW6A 5BREA 2FSNA 1XQSC 3CFOA 4OKEA 1YUWA 3KD1E 3H46O 4BACA 3KWGA 3LDNA 1TKDA 2IGIA 4CBWA 4BG9A 1WUAA 1A5WA 2OZSA 3I8BA 4F3OA 4HUFA 1RT7A 4RW9A 1T3VA 3DOLA 2E1YA 3FZHA 4F3TA 1RFQA 3CFPA 1KAXA 3RSEA 4YOVA 1N36K 3G0ZA 4NCBA 2GELA 2OZMA 1SL0A 2DY4A 4CEBA 3H1VX 3I56N 3HM9A 4C1NK 3VMFB 3LDQA 4BRHA 1IBLK 3JAMO 3O9UA 1QSLA 3ZT4A 3CJBA 3V9WA 5AQNA 1ZBSA 3BZCA 3FFKB 4LY7A 2J4RA 1JL1A 5J2QA 4KH4A 3R1XA 4IFVA 1RBTA 3KLFA 1KAYA 4CZJA 1O13A 2G8FA 3A5MC 4M7YA 3E9LA 2Q0UA 1TUYA 4AQYK 3CQ8A 1QE1A 3EY1A 2P1JA 4X65K 2P51A 5KQ8A 2HF4A 4CJPA 1KC8O 1KLNA 3VQ6A 3MEGA 4B9TA 4B1WB 5AQYA 4FJHA 5J1EA 1IG9A 4OPHA 2ZGYA 4FWLA 5GADP 4GMJB 2HVHA 1OH5A 3M5RA 3NGIA 5HRPA 2RPIA 4B8AB 4EAHD 4LSLA 3ZYYX 3CG7A 4BRLA 2W41A 4BDPA 2UUCK 4FJ8A 1GLAG 3MN5A 4DTPA 4PWDA 1VK0A 1C1AA 3CMAN 1QTMA 2YJEA 4BREA 4GV9A 3S3MA 3NF9A 2UXCK 4BQZA 1BGXT 3HPOA 3FFIA 3FGUA 4PA1A 5BRHA 3ZX3A 1W9HA 1Z25A 4CD1A 4UQGA 2GWKA 2P9UB 1VSMA 4HHTA 1HNXK 2D0BA 4L3QA 3LWMA 5IT9O 3AV9A 4LF4K 2VWBA 3HBTA 4IKFA 5E84A 3NF6A 3J7AP 3SNNA 1D9FA 4H0VB 4PL7A 3DXMB 3C94A 4MQ3A 1X9MA 2O8FB 2WBNA 5KRSA 4R5PA 2HF3A 4YNQA 4WYBA 1XNQK 3HSCA 3WUHA 2FBTA 4JI7K 3DLKA 3THXB 4PHTX 4K0KK 4DSEA 2O4GA 1NKCA 3BDPA 3DAWA 4WFBL 1WAJA 4X62K 1ZBLA 3F9KA 3W0LA 3I33A 3E9PA 2KQ2A 4FM1A 1WNSA 4O0IA 2HMIA 4OO1J 3OHRA 1K8AO 3SUOA 4B9LA 1N8RO 4Z0UA 3CCEN 4E0DA 3B6PA 3OYFA 3A0IX 4CEZA 1HR0K 4DV4K 4FJNA 2HW3A 3SV4A 1HPZA 1WSEA 3SQ0A 1YI2N 2F9WA 5M1QA 4E1JA 4BR5A 4H5TA 2HBJA 5D3GA 1SL1A 4YOYA 3O08A 1N33K 4BC5A 4FOIA 3AVAA 3T19A 2QWOA 1RDDA 3DLHA 3HYFA 1TKTA 4DV6K 1S9EA 2JGUA 5KGXA 4KV8A 1SKSA 2E4LA 1NK4A 2ASOA 4W5TA 1VQKN 3MN7A 1GOCA 3VTHA 4A57A 4LSNA 1QS4A 1C6VA 3VN5A 2X6NA 1S6PA 4K42A 4BE0A 3ZSRA 1G15A 3KKSA 3PUFA 3AVJA 5E41A 2V7ZA 3SUQA 4CZFA 1EQYA 3K5OA 4JKCA 2LSNA 4HTLA 1NNEA 4NB4A 1W7AA 1Z6RA 1MWMA 1BDGA 2Y1JA 1B9DA 3VQ4A 5AQKA 1DLOA 4DS4A 3SQ1A 3CM5A 5AZIB 3QFUA 4DTMA 3MXMA 3CCSN 4RW6A 1Z26A 4K25A 4KH5A 3IS9A 3OY9A 3SBTA 1IO2A 3M1FA 3CCMN 4H0XB 2XO7A 1DT9A 3VF2A 4DHYA 1S1TA 4DSJA 4JKFA 1FXXA 4DF8A 3K5NA 1NLVA 4M3ZA 1JLBA 3TWHA 2G8HA 2Q3SA 2IC3A 4E1NA 4FJIA 5C12A 5C15A 1YJWN 4CHNA 4WQ4A 3MCAB 4IEEA 3SQ2A 3QINA 2GUPA 3CPEA 2A6AA 3TR8A 3V1QA 2IAJA 4E7LA 3ASMA 3RSEB 5AFUH 3ATVA 1EETA 1Y64A 3VQCA 4FJLA 3TSPA 2O8CA 2B4JA 3AVMA 2UXBK 1C0TA 2V51B 4BWJA 2GBZA 1P8ZA 4M7XA 4OGEA 1IG8A 5HBMA 1R59O 4YOXA 3EN9A 1RDUA 2F96A 2ITMA 1NWKA 3W3DA 2XHBA 4FLUA 4E7JA 5HOOA 2Q2RA 2GUIA 5DM6L 4KH6A 1SZ2A 4H5NA 4DR2K 1ZBHA 4CZHA 2QW9A 4KHWA 3OJUA 5IWAK 2WUSA 1HKCA 4C23A 1CXUA 2D5RA 1I3AA 4DR6K 4AHSA 4B1UB 1KLMA 4EZ9A 3L4QA 4Z4HA 2P9KB 3KZBA 4H4MA 3LP2A 3ULEA 4EIAA 1KCFA 4B1ZA 4O8UA 3TABA 1C0UA 1ZBFA 5M1OA 1FW6A 3NE6A 3EKUA 1S1WA 5CYMA 3EEQA 2BANA 4AHCA 3IAYA 4C8OA 4ILGB 4CF8A 3RMAA 1T7PA 3VQBA 4CEOA 1LWEA 2E2PA 5F1XA 3AA5X 1TL3A 3G71N 1A5XA 3M8RA 1KVBA 4H0YB 4B3RK 2Q36A 3HK2A 2KLAA 3DRPA 1XC9A 3SCXA 4HTUA 1O1WA 4LF7K 5GIPA 3BGRA 1TK8A 3CC4N 4YOTA 3ENBA 5AQQA 2IDOA 2ZGZA 4JV5K 5LJWA 2ZQBA 4CCHA 4M3YA 4IJNA 1YITN 3WNEA 3DLBA 1UOCA 3VENA 1NGAA 5SWMA 2P9LB 1GLDG 3DJCA 3S3NA 3AO2A 4I9QA 4IDHA 1NMNA 4QCLA 2A1SA 5KI6A 3PLAA 5GAEP 2E8AA 3C95A 3LPTA 1X9WA 2Y1IA 3TAMA 4BRCA 3QESA 1TV6A 4FK4A 4M3RA 3DLEA 3WNFA 3QNNA 1HQEA 4NLCA 1WSIA 2O8DA 3DXKA 1DTQA 4MLHA 1U45A 2OANA 2QKBA 2A5XA 4LH4A 4B9MA 4JKEA 5K14A 4HUEA 4ELVA 2JWLA 1BOTO 1YJNN 1VSLA 1WBBA 4OLBA 3TAPA 5CHIA 4M63C 2YNGA 3U8XA 1U47A 5FPDA 4FJ7A 2IVNA 4ICLA 4Y0WA 3C65A 2P9PB 1YT3A 4BROA 3CM6A 2WOMA 2HHUA 1RT4A 3RMCA 2ZJPL 4JLHA 3VQQA 3O4WA 1NK0A 2CGJA 5BN8A 4AILC 3U4LA 2P9KA 4Z4CA 4DSIA 4BRFA 3OYCA 1LW0A 1D4XA 4CBXA 3CMEN 4K8XA 3SUPA 1BI4B 3MECA 3O4NA 1BIZA 3NGYA 5AQVA 4CIFA 4FJJA 4PQUA 1X3NA 4B3MK 3SI6A 2B5JA 4EP4A 1B9FA 3CCQN 1QQCA 5EOYA 2KFZA 1RT6A 3JSMA 4DKWA 1WAFA 2VWKA 4JD2A 3J80O 4WQ5C 1RBSA 1RT1A 2QA4N 2HHSA 1WSGA 3NDKA 1VQMN 1S22A 1NK7A 3RMDA 1SUQA 4DFPA 2WTUA 1XMOK 4CGHA 1XC3A 1FKOA 3LM9A 2FF6A 3SQ4A 5CZ2A 4BR9A 2QEXN 2QWQA 2I5JA 3TAEA 1S1UA 1WB9A 2O8BB 1HNIA 3NFAA 1HQUA 2D0OA 2QTDA 3ID6A 1K6YA 3KK3A 2PZSA 1IBKK 1Q9XA 4B1VA 3IDHA 4GKJK 3QBXA 4N76A 3WXMB 1EX4A 4FWMA 3NVKA 2W6KA 4JYAK 4KHUA 1GLCG 5MLCQ 2WC9A 4OKKA 1LWFA 2YNHA 4OX9K 4DWIA 3HRGA 4CZGA 2DFHA 3OS2A 2NLXA 1BL3A 4OPJA 1IJJA 4C8NA 4W5RA 3C6UA 3R3LA 4KO0A 2RKIA 3V4IA 5AQOA 2QK9A 4CJUA 4YFUA 3VQ7A 3NAEA 4FLVA 4KBOA 1BCMA 2WONA 4NYFA 3I8DA 3CETA 3OJSA 3D2FA 3GL1A 1VQ5N 2XY7A 4FWKA 4BRDA 3KK1A 2A1RA 3ID8A 1LCUA 5AQIA 5JLHA 5LMNK 4CJ3A 3TTDA 1Z05A 4DMNA 4CEFA 3MWTA 2R7YA 1MU2A 2GEMA 1L3TA 1DTTA 1X1PA 3D45A 2PYJA 4WCEL 3AVIA 3EZ5A 4AM7A 2VQFK 2DFFA 2DTUA 2Z1HA 4U67L 1GLFO 3O5BA 3SZ2A 3LAKA 3KHYA 4CEQA 4TSXA 1NGBA 1KQSM 5A2QO 1MWKA 2ZF5O 4FK0A 3VOVA 2ATQA 2G8KA 3HOTA 4DF4A 3O4QA 4FO0A 1FK9A 4IWVA 5CE3A 4LC9B 1BI4A 3A5NC 4O5BA 3O3HA 2A41A 3NH2A 2VG5A 1GLLO 2QWNA 2Q0RA 4LD0A 1N6QA 1NGJA 2HHXA 4ZTJA 5TKYA 4CVNE 5AFUA 4KHYA 4CHYA 4CGGA 1MDUB 1RDAA 1S1VA 2NRXA 4JK7A 3THWA 1KFDA 2EWSA 5M1NA 4BRPA 3ZX2A 1RNHA 3H3OB 4DTJA 3AA3A 5AZJB 3MXJA 3SYZA 3G10A 1KTQA 1VQ8N 4QOZB 4FPAA 3C0BA 4JI5K 4JHDA 5AQLA 4FJKA 3KK7A 4BRKA 2NRZA 1YTUA 1WSHA 3OYJA 1HYSA 4DTOA 4DU1A 2HBLA 2XY6A 4C8KA 1S3XA 1XHZA 3OS1A 1EP4A 4NCAA 1Q82O 3CC2N 3SMSA 1X9SA 2VYPA 1HJOA 3AO3A 4PKHA 4YOWA 3ZETB 2GX9A 4LF9K 3FE1A 1IKVA
chains in the Genus database with same CATH topology
1EKEA 1JLCA 3MEDA 3U3GA 3NBPA 2ITGA 3A2FA 3K5OA 1NK4A 1SL2A 2LSNA 1ASUA 4PY5A 5HRSA 4CGIA 4M3WA 4FJ9A 2D0CA 3M8PA 1GOAA 3ITHA 4H8KA 4CJVA 3ISNC 1LW2A 3HVTA 1VSHA 2Y1JA 1B9DA 3VQ4A 1VRUA 1HYZA 4CF9A 4DS4A 1DLOA 1SV5A 3HXMA 1KVCA 3SQ1A 3CM5A 3VQ5A 1TK0A 3TAQA 4DTMA 3MXMA 1TK5A 4RW6A 5C24A 1Z26A 1U48A 3LAMA 1J5OA 3IS9A 3OY9A 1C1BA 1IO2A 3NF7A 4DTUA 1SKWA 1UAXA 4FLWA 2X74A 4IG3A 2XO7A 2KZMA 2G8VA 1S1TA 3QEIA 4DSJA 2VG6A 5CZ1A 3T3FA 1FXXA 4F2RA 1NK5A 4DF8A 4FZZA 4Z4EA 3K5NA 3ZT1A 4KB1A 4F2SA 4OPKA 2ETJA 1IKYA 1IKWA 4M3ZA 1JLBA 3TAGA 2QKKA 1ZBUA 4DQSA 5HLFA 3TWHA 2G8HA 2Q3SA 3P5JA 2IC3A 2XY8A 4E1NA 2ZE2A 4FJIA 1A5VA 2YKNA 1U04A 5FRMA 1RT5A 1F21A 3KLEA 3OYDA 1LWCA 4BDYA 4BE2A 4DQRA 4CHNA 3V9ZA 3SQ2A 4IG0A 3QINA 4KRFA 2OPSA 4XIUA 4CHQA 4CJ4A 3TR8A 4KFBA 3V1QA 4JS5A 2IAJA 3OYMA 3ASMA 3AA2A 4B08A 1JLAA 2EHGA 4E7LA 1NKBA 3KTQA 4NCGA 3U3YA 1EETA 1HYVA 1KVAA 3VQCA 4FJLA 3ZCMA 3LP3A 1REVA 5DMRA 2B4JA 4M41A 3AVMA 4DFKA 4I7FA 1C0TA 3V1RA 4DSLA 4BWJA 2GBZA 4M45A 4I9LA 4HCCA 4OGEA 2F8SA 5HBMA 4CFCA 4E7IA 3ZT3A 2F96A 2XHBA 1WN7A 3M8QA 4FLUA 4AHRA 4E7JA 3O3FA 1ASWA 2FBVA 4O0JA 4LH5A 2P5OA 3H08A 3ZSQA 4KI4A 2GUIA 3K2PA 1KRPA 4KAZA 4DSKA 3KLGA 4I2QA 4DQPA 1HRHA 4M3XA 3NHGA 4ZTFA 2FBXA 3C6TA 1UWBA 2YNIA 4AHTA 3NGZA 3KLHA 3VA3A 4FZYA 4PUOA 1ZBHA 4KHWA 3K59A 3OJUA 2HVIA 1J53A 4CFAA 2HHQA 4CF0A 1RBRA 2B6AA 4DFJA 4DFMA 1QSYA 1L5UA 4FJGA 1CXUA 2D5RA 3E01A 3ZSZA 1I3AA 4DQIA 4CJ5A 5HROA 4AHSA 2W42A 1NJZA 1KLMA 1RT3A 4EZ9A 4Z4HA 5FROA 2ZD1A 4CJWA 3I0SA 4B3OA 4H4MA 3LP2A 3LZIA 1KCFA 1CZ9A 1TVRA 3L8BA 3TABA 1C0UA 1ZBFA 4CERA 1J9AA 1JLEA 3LWLA 5J2PA 3NE6A 1JLQA 4QAGA 3MAQA 3THVA 1S1WA 5CYMA 2BANA 4AHCA 4W5QA 3IAYA 4C8OA 1CZBA 4Q5VA 1B92A 1BIUA 4CF8A 3RMAA 1T7PA 3VQBA 3DI6A 1LWEA 4CEOA 3V9UA 2RF2A 1JLGA 3AA5X 1CXQA 1TL3A 3OYEA 4FCYA 3KD5E 1A5XA 4OGCA 1KVBA 2HNZA 3LALA 3VQEA 3M8RA 3QERA 1T8EA 1SKRA 1VSDA 4KHSA 3HK2A 1D8YA 1BHLA 1I39A 3DRPA 2BDPA 1XC9A 1JLFA 2GV9A 4JRPA 4HTUA 4WE1A 3SCXA 1O1WA 3AVLA 3L2QA 4DLGA 3CFRA 1JKHA 3BGRA 4E19A 4N56A 4MFBA 3TANA 3AA4A 1TK8A 2PY5A 2BGGA 3LP1A 3L2VA 4O4GA 4CHOA 3UIQA 1HMVA 3V81A 3SPYA 2IDOA 2Z1GA 1IKXA 4B9NA 2PYLA 1XWLA 2ZQBA 4RW4A 4EP5A 4BE1A 2D0AA 1RILA 4CCHA 4M3YA 4DTNA 3QNOA 2F8TA 3WNEA 3DLBA 3HSTB 1U49A 3OYKA 5HP1A 1NOZA 1UOCA 1YVUA 5SWMA 3S3NA 4I9QA 3IG1A 3AO2A 1QHTA 1BISA 3LANA 2Z1JA 4QCLA 2A1SA 1U4BA 2OYQA 1RTHA 2HNYA 4RW7A 5KI6A 3L3VA 3V9XA 3C95A 3LPTA 3HL8A 1X9WA 4F8RA 3OYAA 4CIGA 2Y1IA 3TAMA 4N5SA 3QESA 1TV6A 4FK4A 1ITGA 3P1GA 4M3RA 3DLEA 3WNFA 3ZT2A 4CJLA 1BCOA 3AVBA 3QNNA 3ALYA 1HQEA 4FLYA 1WSIA 4AHVA 4KI6A 1DTQA 1U45A 4Q0BA 1TKZA 3MXIA 2QKBA 1KSPA 1S9GA 4CEEA 4DG1A 4B9UA 4LH4A 4FLZA 1D5AA 2HNDA 4B9MA 5C42A 4M42A 2G8IA 5K14A 3K58A 4HUEA 2OPQA 5C25A 4ELVA 3OYLA 1RDBA 3AO4A 1ASVA 3DLRA 5J2MA 1VSLA 4OLBA 3TAPA 4E7KA 4KHNA 1Y97A 2YNGA 3WNHA 4ZHRA 4DTRA 1U47A 4Z4FA 4Z4IA 3F73A 4FJ7A 2NUBA 3T1AA 4ICLA 4FYDA 2OPPA 3VA0A 3CM6A 1YT3A 3ZSVA 2WOMA 3VQAA 1VRTA 3MEEA 3JYTA 3K5MA 1N5YA 1RT4A 1JXEA 4CK1A 3L2WA 3RMCA 4K8ZA 2HHUA 2E6LA 1LAWA 4JLHA 3VQQA 3SV3A 1R0AA 1TL1A 4B8CA 1NK0A 2E6MA 3P83D 4DS5A 4L8RB 4AILC 2AJQA 3AO5A 3NH0A 3DRRA 3LDSA 3V9SA 4ID5A 4OVLA 3RRGA 4IDKA 1EXQA 1UA1A 1QSSA 3KJVA 3HP9A 5CYQA 4Z4CA 4DSIA 3OYCA 1LW0A 3OYGA 4CK3A 3KK2A 4CEAA 3K5LA 3KKRA 3OYHA 2G8UA 3SUPA 4K8XA 3HO1A 4J2AA 1BI4B 3MECA 1T03A 1NK9A 3O4NA 2OA8A 2KW4A 2X78A 1BIZA 1VSKA 3B6OA 3NGYA 4CIFA 4FJJA 4KPYA 4M3UA 4PQUA 1ZYQA 1RBVA 4B9SA 3ZSYA 4Y1CA 4IFYA 3SI6A 4DU3A 2B5JA 4FVMA 4RG8A 4CHPA 4EP4A 1L3VA 4FM2A 2XY5A 5FRNA 2KFNA 3OVNA 1B9FA 3M8SA 1QQCA 3OS0A 1L3SA 1RTJA 2KFZA 3VQ8A 3K57A 4GW6A 5KGWA 2HHTA 1RT6A 3CYMA 3LPUA 4OKEA 3CFOA 3JSMA 5J2NA 1WAFA 2VWKA 3WNGA 3PX6A 3PO5A 3KD1E 4BACA 3HJFA 2IOCA 2OPRA 2O4IA 1RBSA 1RT1A 3KLIA 2IGIA 1TKDA 1WSGA 3NDKA 2HHSA 1NK7A 1A5WA 1S1XA 2OZSA 3HPGA 1RTDA 4HUFA 1RT7A 3DOLA 4RW9A 3OYBA 3RMDA 1SUQA 4F3OA 4F3TA 1TAQA 3CFPA 2YHAA 4DFPA 4W5OA 1BQNA 1WLJA 3G0ZA 4NCBA 2HHWA 1HNVA 1S5JA 3NCIA 1TAUA 4CGHA 2OZMA 1SL0A 2DY4A 2XRIA 4CEBA 3NH1A 1FKOA 4C8LA 3SQ4A 4E89A 5CZ2A 3HM9A 1L3UA 5I42A 2I5JA 4DTSA 3TAEA 1S1UA 3AVFA 1HNIA 3NFAA 1HQUA 1QSLA 3ZT4A 4OJRA 3V9WA 4OLAA 4O44A 4GVMA 3S3OA 1BQMA 5T7BA 3ZSXA 1K6YA 1RTIA 4LY7A 1JL1A 2P5GA 3KK3A 2PZSA 4FW1A 1Q9XA 5J2QA 3KIOA 1VSEA 4IFVA 3TARA 1RBTA 3KLFA 4CF2A 4N76A 3DM2A 2G8FA 1EX4A 5SZTA 1JXBA 4Y1DA 4DSFA 3L3UA 4FJMA 3QLHA 3CQ8A 3DMJA 4KHUA 3V1OA 1QE1A 3EY1A 3QIPA 2FC0A 1LWFA 2P1JA 4OKKA 1NK6A 3RR7A 4M3TA 2YNHA 4DWIA 1XI1A 4JS4A 2DFHA 4CJRA 3OS2A 1BL3A 2P51A 4OPJA 1C0MA 4DU4A 4Z4GA 4CJFA 4CJPA 2YKMA 4AHUA 4C8NA 4W5RA 3PY8A 3C6UA 3QIOA 4KO0A 5I3UA 3VQ6A 1KLNA 2RKIA 3V4IA 4CE9A 2QK9A 1KFSA 3MEGA 4C8MA 4CJUA 3VQ7A 4YFUA 4B9TA 3NAEA 4DQQA 4E3SA 5J1EA 4FLVA 4FJHA 1IG9A 1BCMA 2WONA 4NYFA 4AH9A 4KKOA 3I8DA 3OJSA 1NOYA 2YHBA 3VQ9A 4FLXA 3QEWA 3TAFA 4GMJB 3DLGA 2HVHA 2XY7A 4KHQA 2IS3A 1S6QA 4CGDA 3NGIA 5HRPA 2RPIA 1T05A 4B8AB 3KK1A 4CHZA 1FKPA 4LSLA 1LAVA 1WSJA 3RMBA 3CG7A 2A1RA 3SJJA 3SPZA 4BDPA 4F4KA 3ZSWA 4CJ3A 4CJKA 1RDCA 3HPHA 4EZ6A 4FJ8A 2KZZA 4DTPA 4CFDA 5HRRA 4PWDA 1VK0A 3EYZA 4KTZA 1C1AA 2RN2A 4DMNA 1IH7A 4CEFA 2R7YA 2JLEA 1MU2A 1QTMA 4CK2A 3S3MA 4FW2A 3NF9A 1BGXT 1L3TA 1DTTA 2EX3A 1X1PA 3HPOA 4FJ5A 3FFIA 4PA1A 2X6SA 3D45A 4E7HA 2PYJA 3AVIA 3EZ5A 1W9HA 1Z25A 4UQGA 3NF8A 5CY4A 3D0PA 1VSMA 4HHTA 2DFFA 4CJSA 2D0BA 2DTUA 2Z1HA 3AVKA 1TGOA 3LWMA 2DFEA 2HHVA 1GOBA 3AV9A 2VWJA 3SZ2A 3LAKA 4IKFA 3NF6A 1NKEA 4CIEA 4KREA 4CEQA 4ID1A 1WSFA 4TSXA 3SNNA 1D9FA 1X9MA 3C94A 4MQ3A 1LV5A 3QEXA 2FBYA 3TI0A 1NJXA 1VSIA 5KRSA 4R5PA 3PO4A 4YNQA 1TKXA 4FK0A 3QO9A 2ATQA 2G8KA 3PX4A 2FBTA 4CESA 3DLKA 1XHXA 4CECA 4DF4A 3O4QA 4J2DA 1FK9A 3VQPA 1VSJA 3AVGA 3PV8A 3RWUA 1BI4A 4DSEA 2KTQA 2O4GA 1NKCA 3BDPA 4KTQA 4J2EA 4O5BA 3AVCA 3O3HA 3HT3A 1WAJA 3LP0A 3NH2A 4BDZA 2VG5A 4HUGA 4E1MA 1ZBLA 3F9KA 5KRTA 4LD0A 1RBUA 1N6QA 2HHXA 2KQ2A 3QETA 4FM1A 1WNSA 4ZTJA 4IBNA 3AVHA 2YNFA 4O0IA 3HP6A 4CJTA 2HMIA 1VSFA 1NK8A 1J54A 5KTQA 4KHYA 4CHYA 3SUOA 4BWMA 4JRQA 3DRSA 5JS2A 4CGGA 4B9VA 4J2BA 2G8WA 3DOKA 2BE2A 4B9LA 1S1VA 1RDAA 4Z0UA 3HVRA 4E0DA 4HVJA 3B6PA 3I0RA 3OYFA 5EU7A 1KFDA 3AVNA 3O3GA 5DK5A 4CEZA 1NJWA 4ELUA 3QEPA 4FJNA 1RNHA 2HW3A 4FZXC 3QEVA 1UA0A 1RT2A 3SV4A 1HPZA 1WSEA 4DTJA 1JL2A 2Z1IA 3AA3A 4CJEA 3SQ0A 3V6DA 3VQDA 4ELTA 4FXDA 1NJYA 3L2UA 3MXJA 4FJXA 1CLQA 3SYZA 3G10A 1KTQA 1HJRA 1RCHA 4CGFA 4CFBA 1D9DA 4QOZB 5D3GA 3ZT0A 4CJQA 4RW8A 5FDLA 4CEDA 3L2RA 1SL1A 4OKJA 4FM0A 1W0HA 1YTAA 4FJKA 4FK2A 3AVAA 3RR8A 3T19A 4DTXA 1YTUA 1WSHA 4HCBA 1RDDA 2YV0X 3OYJA 3AO1A 3PX0A 3HYFA 3DLHA 1HYSA 1TKTA 4W5NA 1S9EA 3DYAA 2JGUA 5KGXA 4DTOA 4DU1A 3SUNA 4KV8A 2XY6A 1SKSA 4C8KA 4O55A 1XHZA 2E4LA 3U6FA 4KTWA 2QXFA 4N47A 3ZSOA 3OS1A 3OYIA 4W5TA 3S9HA 3IRXA 1C1CA 1Q9YA 4FLTA 1EP4A 3RRHA 1GOCA 4CF1A 4NCAA 4LSNA 1QS4A 1C6VA 1Q8IA 3VN5A 4DLEA 3OYNA 2X6NA 4H4OA 1X9SA 1S6PA 3LZJA 4CGJA 4KB0A 4NYNA 1ZBIA 4BE0A 3ZSRA 3RTVA 1G15A 3KKSA 3AO3A 5HRNA 3PUFA 4G1QA 4N41A 2VG7A 3AVJA 5E41A 3SUQA 2HB5A 5JS1A 4I2PA 1IKVA 3ULDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EKE A;  1JLC A;  3MED A;  3U3G A;  3NBP A;  2ITG A;  3A2F A;  3K5O A;  1NK4 A;  1SL2 A;  2LSN A;  1ASU A;  4PY5 A;  5HRS A;  4CGI A;  4M3W A;  4FJ9 A;  2D0C A;  3M8P A;  1GOA A;  3ITH A;  4H8K A;  4CJV A;  3ISN C;  1LW2 A;  3HVT A;  1VSH A;  2Y1J A;  1B9D A;  3VQ4 A;  1VRU A;  1HYZ A;  4CF9 A;  4DS4 A;  1DLO A;  1SV5 A;  3HXM A;  1KVC A;  3SQ1 A;  3CM5 A;  3VQ5 A;  1TK0 A;  3TAQ A;  4DTM A;  3MXM A;  1TK5 A;  4RW6 A;  5C24 A;  1Z26 A;  1U48 A;  3LAM A;  1J5O A;  3IS9 A;  3OY9 A;  1C1B A;  1IO2 A;  3NF7 A;  4DTU A;  1SKW A;  1UAX A;  4FLW A;  2X74 A;  4IG3 A;  2XO7 A;  2KZM A;  2G8V A;  1S1T A;  3QEI A;  4DSJ A;  2VG6 A;  5CZ1 A;  3T3F A;  1FXX A;  4F2R A;  1NK5 A;  4DF8 A;  4FZZ A;  4Z4E A;  3K5N A;  3ZT1 A;  4KB1 A;  4F2S A;  4OPK A;  2ETJ A;  1IKY A;  1IKW A;  4M3Z A;  1JLB A;  3TAG A;  2QKK A;  1ZBU A;  4DQS A;  5HLF A;  3TWH A;  2G8H A;  2Q3S A;  3P5J A;  2IC3 A;  2XY8 A;  4E1N A;  2ZE2 A;  4FJI A;  1A5V A;  2YKN A;  1U04 A;  5FRM A;  1RT5 A;  1F21 A;  3KLE A;  3OYD A;  1LWC A;  4BDY A;  4BE2 A;  4DQR A;  4CHN A;  3V9Z A;  3SQ2 A;  4IG0 A;  3QIN A;  4KRF A;  2OPS A;  4XIU A;  4CHQ A;  4CJ4 A;  3TR8 A;  4KFB A;  3V1Q A;  4JS5 A;  2IAJ A;  3OYM A;  3ASM A;  3AA2 A;  4B08 A;  1JLA A;  2EHG A;  4E7L A;  1NKB A;  3KTQ A;  4NCG A;  3U3Y A;  1EET A;  1HYV A;  1KVA A;  3VQC A;  4FJL A;  3ZCM A;  3LP3 A;  1REV A;  5DMR A;  2B4J A;  4M41 A;  3AVM A;  4DFK A;  4I7F A;  1C0T A;  3V1R A;  4DSL A;  4BWJ A;  2GBZ A;  4M45 A;  4I9L A;  4HCC A;  4OGE A;  2F8S A;  5HBM A;  4CFC A;  4E7I A;  3ZT3 A;  2F96 A;  2XHB A;  1WN7 A;  3M8Q A;  4FLU A;  4AHR A;  4E7J A;  3O3F A;  1ASW A;  2FBV A;  4O0J A;  4LH5 A;  2P5O A;  3H08 A;  3ZSQ A;  4KI4 A;  2GUI A;  3K2P A;  1KRP A;  4KAZ A;  4DSK A;  3KLG A;  4I2Q A;  4DQP A;  1HRH A;  4M3X A;  3NHG A;  4ZTF A;  2FBX A;  3C6T A;  1UWB A;  2YNI A;  4AHT A;  3NGZ A;  3KLH A;  3VA3 A;  4FZY A;  4PUO A;  1ZBH A;  4KHW A;  3K59 A;  3OJU A;  2HVI A;  1J53 A;  4CFA A;  2HHQ A;  4CF0 A;  1RBR A;  2B6A A;  4DFJ A;  4DFM A;  1QSY A;  1L5U A;  4FJG A;  1CXU A;  2D5R A;  3E01 A;  3ZSZ A;  1I3A A;  4DQI A;  4CJ5 A;  5HRO A;  4AHS A;  2W42 A;  1NJZ A;  1KLM A;  1RT3 A;  4EZ9 A;  4Z4H A;  5FRO A;  2ZD1 A;  4CJW A;  3I0S A;  4B3O A;  4H4M A;  3LP2 A;  3LZI A;  1KCF A;  1CZ9 A;  1TVR A;  3L8B A;  3TAB A;  1C0U A;  1ZBF A;  4CER A;  1J9A A;  1JLE A;  3LWL A;  5J2P A;  3NE6 A;  1JLQ A;  4QAG A;  3MAQ A;  3THV A;  1S1W A;  5CYM A;  2BAN A;  4AHC A;  4W5Q A;  3IAY A;  4C8O A;  1CZB A;  4Q5V A;  1B92 A;  1BIU A;  4CF8 A;  3RMA A;  1T7P A;  3VQB A;  3DI6 A;  1LWE A;  4CEO A;  3V9U A;  2RF2 A;  1JLG A;  3AA5 X;  1CXQ A;  1TL3 A;  3OYE A;  4FCY A;  3KD5 E;  1A5X A;  4OGC A;  1KVB A;  2HNZ A;  3LAL A;  3VQE A;  3M8R A;  3QER A;  1T8E A;  1SKR A;  1VSD A;  4KHS A;  3HK2 A;  1D8Y A;  1BHL A;  1I39 A;  3DRP A;  2BDP A;  1XC9 A;  1JLF A;  2GV9 A;  4JRP A;  4HTU A;  4WE1 A;  3SCX A;  1O1W A;  3AVL A;  3L2Q A;  4DLG A;  3CFR A;  1JKH A;  3BGR A;  4E19 A;  4N56 A;  4MFB A;  3TAN A;  3AA4 A;  1TK8 A;  2PY5 A;  2BGG A;  3LP1 A;  3L2V A;  4O4G A;  4CHO A;  3UIQ A;  1HMV A;  3V81 A;  3SPY A;  2IDO A;  2Z1G A;  1IKX A;  4B9N A;  2PYL A;  1XWL A;  2ZQB A;  4RW4 A;  4EP5 A;  4BE1 A;  2D0A A;  1RIL A;  4CCH A;  4M3Y A;  4DTN A;  3QNO A;  2F8T A;  3WNE A;  3DLB A;  3HST B;  1U49 A;  3OYK A;  5HP1 A;  1NOZ A;  1UOC A;  1YVU A;  5SWM A;  3S3N A;  4I9Q A;  3IG1 A;  3AO2 A;  1QHT A;  1BIS A;  3LAN A;  2Z1J A;  4QCL A;  2A1S A;  1U4B A;  2OYQ A;  1RTH A;  2HNY A;  4RW7 A;  5KI6 A;  3L3V A;  3V9X A;  3C95 A;  3LPT A;  3HL8 A;  1X9W A;  4F8R A;  3OYA A;  4CIG A;  2Y1I A;  3TAM A;  4N5S A;  3QES A;  1TV6 A;  4FK4 A;  1ITG A;  3P1G A;  4M3R A;  3DLE A;  3WNF A;  3ZT2 A;  4CJL A;  1BCO A;  3AVB A;  3QNN A;  3ALY A;  1HQE A;  4FLY A;  1WSI A;  4AHV A;  4KI6 A;  1DTQ A;  1U45 A;  4Q0B A;  1TKZ A;  3MXI A;  2QKB A;  1KSP A;  1S9G A;  4CEE A;  4DG1 A;  4B9U A;  4LH4 A;  4FLZ A;  1D5A A;  2HND A;  4B9M A;  5C42 A;  4M42 A;  2G8I A;  5K14 A;  3K58 A;  4HUE A;  2OPQ A;  5C25 A;  4ELV A;  3OYL A;  1RDB A;  3AO4 A;  1ASV A;  3DLR A;  5J2M A;  1VSL A;  4OLB A;  3TAP A;  4E7K A;  4KHN A;  1Y97 A;  2YNG A;  3WNH A;  4ZHR A;  4DTR A;  1U47 A;  4Z4F A;  4Z4I A;  3F73 A;  4FJ7 A;  2NUB A;  3T1A A;  4ICL A;  4FYD A;  2OPP A;  3VA0 A;  3CM6 A;  1YT3 A;  3ZSV A;  2WOM A;  3VQA A;  1VRT A;  3MEE A;  3JYT A;  3K5M A;  1N5Y A;  1RT4 A;  1JXE A;  4CK1 A;  3L2W A;  3RMC A;  4K8Z A;  2HHU A;  2E6L A;  1LAW A;  4JLH A;  3VQQ A;  3SV3 A;  1R0A A;  1TL1 A;  4B8C A;  1NK0 A;  2E6M A;  3P83 D;  4DS5 A;  4L8R B;  4AIL C;  2AJQ A;  3AO5 A;  3NH0 A;  3DRR A;  3LDS A;  3V9S A;  4ID5 A;  4OVL A;  3RRG A;  4IDK A;  1EXQ A;  1UA1 A;  1QSS A;  3KJV A;  3HP9 A;  5CYQ A;  4Z4C A;  4DSI A;  3OYC A;  1LW0 A;  3OYG A;  4CK3 A;  3KK2 A;  4CEA A;  3K5L A;  3KKR A;  3OYH A;  2G8U A;  3SUP A;  4K8X A;  3HO1 A;  4J2A A;  1BI4 B;  3MEC A;  1T03 A;  1NK9 A;  3O4N A;  2OA8 A;  2KW4 A;  2X78 A;  1BIZ A;  1VSK A;  3B6O A;  3NGY A;  4CIF A;  4FJJ A;  4KPY A;  4M3U A;  4PQU A;  1ZYQ A;  1RBV A;  4B9S A;  3ZSY A;  4Y1C A;  4IFY A;  3SI6 A;  4DU3 A;  2B5J A;  4FVM A;  4RG8 A;  4CHP A;  4EP4 A;  1L3V A;  4FM2 A;  2XY5 A;  5FRN A;  2KFN A;  3OVN A;  1B9F A;  3M8S A;  1QQC A;  3OS0 A;  1L3S A;  1RTJ A;  2KFZ A;  3VQ8 A;  3K57 A;  4GW6 A;  5KGW A;  2HHT A;  1RT6 A;  3CYM A;  3LPU A;  4OKE A;  3CFO A;  3JSM A;  5J2N A;  1WAF A;  2VWK A;  3WNG A;  3PX6 A;  3PO5 A;  3KD1 E;  4BAC A;  3HJF A;  2IOC A;  2OPR A;  2O4I A;  1RBS A;  1RT1 A;  3KLI A;  2IGI A;  1TKD A;  1WSG A;  3NDK A;  2HHS A;  1NK7 A;  1A5W A;  1S1X A;  2OZS A;  3HPG A;  1RTD A;  4HUF A;  1RT7 A;  3DOL A;  4RW9 A;  3OYB A;  3RMD A;  1SUQ A;  4F3O A;  4F3T A;  1TAQ A;  3CFP A;  2YHA A;  4DFP A;  4W5O A;  1BQN A;  1WLJ A;  3G0Z A;  4NCB A;  2HHW A;  1HNV A;  1S5J A;  3NCI A;  1TAU A;  4CGH A;  2OZM A;  1SL0 A;  2DY4 A;  2XRI A;  4CEB A;  3NH1 A;  1FKO A;  4C8L A;  3SQ4 A;  4E89 A;  5CZ2 A;  3HM9 A;  1L3U A;  5I42 A;  2I5J A;  4DTS A;  3TAE A;  1S1U A;  3AVF A;  1HNI A;  3NFA A;  1HQU A;  1QSL A;  3ZT4 A;  4OJR A;  3V9W A;  4OLA A;  4O44 A;  4GVM A;  3S3O A;  1BQM A;  5T7B A;  3ZSX A;  1K6Y A;  1RTI A;  4LY7 A;  1JL1 A;  2P5G A;  3KK3 A;  2PZS A;  4FW1 A;  1Q9X A;  5J2Q A;  3KIO A;  1VSE A;  4IFV A;  3TAR A;  1RBT A;  3KLF A;  4CF2 A;  4N76 A;  3DM2 A;  2G8F A;  1EX4 A;  5SZT A;  1JXB A;  4Y1D A;  4DSF A;  3L3U A;  4FJM A;  3QLH A;  3CQ8 A;  3DMJ A;  4KHU A;  3V1O A;  1QE1 A;  3EY1 A;  3QIP A;  2FC0 A;  1LWF A;  2P1J A;  4OKK A;  1NK6 A;  3RR7 A;  4M3T A;  2YNH A;  4DWI A;  1XI1 A;  4JS4 A;  2DFH A;  4CJR A;  3OS2 A;  1BL3 A;  2P51 A;  4OPJ A;  1C0M A;  4DU4 A;  4Z4G A;  4CJF A;  4CJP A;  2YKM A;  4AHU A;  4C8N A;  4W5R A;  3PY8 A;  3C6U A;  3QIO A;  4KO0 A;  5I3U A;  3VQ6 A;  1KLN A;  2RKI A;  3V4I A;  4CE9 A;  2QK9 A;  1KFS A;  3MEG A;  4C8M A;  4CJU A;  3VQ7 A;  4YFU A;  4B9T A;  3NAE A;  4DQQ A;  4E3S A;  5J1E A;  4FLV A;  4FJH A;  1IG9 A;  1BCM A;  2WON A;  4NYF A;  4AH9 A;  4KKO A;  3I8D A;  3OJS A;  1NOY A;  2YHB A;  3VQ9 A;  4FLX A;  3QEW A;  3TAF A;  4GMJ B;  3DLG A;  2HVH A;  2XY7 A;  4KHQ A;  2IS3 A;  1S6Q A;  4CGD A;  3NGI A;  5HRP A;  2RPI A;  1T05 A;  4B8A B;  3KK1 A;  4CHZ A;  1FKP A;  4LSL A;  1LAV A;  1WSJ A;  3RMB A;  3CG7 A;  2A1R A;  3SJJ A;  3SPZ A;  4BDP A;  4F4K A;  3ZSW A;  4CJ3 A;  4CJK A;  1RDC A;  3HPH A;  4EZ6 A;  4FJ8 A;  2KZZ A;  4DTP A;  4CFD A;  5HRR A;  4PWD A;  1VK0 A;  3EYZ A;  4KTZ A;  1C1A A;  2RN2 A;  4DMN A;  1IH7 A;  4CEF A;  2R7Y A;  2JLE A;  1MU2 A;  1QTM A;  4CK2 A;  3S3M A;  4FW2 A;  3NF9 A;  1BGX T;  1L3T A;  1DTT A;  2EX3 A;  1X1P A;  3HPO A;  4FJ5 A;  3FFI A;  4PA1 A;  2X6S A;  3D45 A;  4E7H A;  2PYJ A;  3AVI A;  3EZ5 A;  1W9H A;  1Z25 A;  4UQG A;  3NF8 A;  5CY4 A;  3D0P A;  1VSM A;  4HHT A;  2DFF A;  4CJS A;  2D0B A;  2DTU A;  2Z1H A;  3AVK A;  1TGO A;  3LWM A;  2DFE A;  2HHV A;  1GOB A;  3AV9 A;  2VWJ A;  3SZ2 A;  3LAK A;  4IKF A;  3NF6 A;  1NKE A;  4CIE A;  4KRE A;  4CEQ A;  4ID1 A;  1WSF A;  4TSX A;  3SNN A;  1D9F A;  1X9M A;  3C94 A;  4MQ3 A;  1LV5 A;  3QEX A;  2FBY A;  3TI0 A;  1NJX A;  1VSI A;  5KRS A;  4R5P A;  3PO4 A;  4YNQ A;  1TKX A;  4FK0 A;  3QO9 A;  2ATQ A;  2G8K A;  3PX4 A;  2FBT A;  4CES A;  3DLK A;  1XHX A;  4CEC A;  4DF4 A;  3O4Q A;  4J2D A;  1FK9 A;  3VQP A;  1VSJ A;  3AVG A;  3PV8 A;  3RWU A;  1BI4 A;  4DSE A;  2KTQ A;  2O4G A;  1NKC A;  3BDP A;  4KTQ A;  4J2E A;  4O5B A;  3AVC A;  3O3H A;  3HT3 A;  1WAJ A;  3LP0 A;  3NH2 A;  4BDZ A;  2VG5 A;  4HUG A;  4E1M A;  1ZBL A;  3F9K A;  5KRT A;  4LD0 A;  1RBU A;  1N6Q A;  2HHX A;  2KQ2 A;  3QET A;  4FM1 A;  1WNS A;  4ZTJ A;  4IBN A;  3AVH A;  2YNF A;  4O0I A;  3HP6 A;  4CJT A;  2HMI A;  1VSF A;  1NK8 A;  1J54 A;  5KTQ A;  4KHY A;  4CHY A;  3SUO A;  4BWM A;  4JRQ A;  3DRS A;  5JS2 A;  4CGG A;  4B9V A;  4J2B A;  2G8W A;  3DOK A;  2BE2 A;  4B9L A;  1S1V A;  1RDA A;  4Z0U A;  3HVR A;  4E0D A;  4HVJ A;  3B6P A;  3I0R A;  3OYF A;  5EU7 A;  1KFD A;  3AVN A;  3O3G A;  5DK5 A;  4CEZ A;  1NJW A;  4ELU A;  3QEP A;  4FJN A;  1RNH A;  2HW3 A;  4FZX C;  3QEV A;  1UA0 A;  1RT2 A;  3SV4 A;  1HPZ A;  1WSE A;  4DTJ A;  1JL2 A;  2Z1I A;  3AA3 A;  4CJE A;  3SQ0 A;  3V6D A;  3VQD A;  4ELT A;  4FXD A;  1NJY A;  3L2U A;  3MXJ A;  4FJX A;  1CLQ A;  3SYZ A;  3G10 A;  1KTQ A;  1HJR A;  1RCH A;  4CGF A;  4CFB A;  1D9D A;  4QOZ B;  5D3G A;  3ZT0 A;  4CJQ A;  4RW8 A;  5FDL A;  4CED A;  3L2R A;  1SL1 A;  4OKJ A;  4FM0 A;  1W0H A;  1YTA A;  4FJK A;  4FK2 A;  3AVA A;  3RR8 A;  3T19 A;  4DTX A;  1YTU A;  1WSH A;  4HCB A;  1RDD A;  2YV0 X;  3OYJ A;  3AO1 A;  3PX0 A;  3HYF A;  3DLH A;  1HYS A;  1TKT A;  4W5N A;  1S9E A;  3DYA A;  2JGU A;  5KGX A;  4DTO A;  4DU1 A;  3SUN A;  4KV8 A;  2XY6 A;  1SKS A;  4C8K A;  4O55 A;  1XHZ A;  2E4L A;  3U6F A;  4KTW A;  2QXF A;  4N47 A;  3ZSO A;  3OS1 A;  3OYI A;  4W5T A;  3S9H A;  3IRX A;  1C1C A;  1Q9Y A;  4FLT A;  1EP4 A;  3RRH A;  1GOC A;  4CF1 A;  4NCA A;  4LSN A;  1QS4 A;  1C6V A;  1Q8I A;  3VN5 A;  4DLE A;  3OYN A;  2X6N A;  4H4O A;  1X9S A;  1S6P A;  3LZJ A;  4CGJ A;  4KB0 A;  4NYN A;  1ZBI A;  4BE0 A;  3ZSR A;  3RTV A;  1G15 A;  3KKS A;  3AO3 A;  5HRN A;  3PUF A;  4G1Q A;  4N41 A;  2VG7 A;  3AVJ A;  5E41 A;  3SUQ A;  2HB5 A;  5JS1 A;  4I2P A;  1IKV A;  3ULD A; 
#chains in the Genus database with same CATH topology
 1HUX A;  3U3G A;  3WXL A;  2FSJ A;  4CJ7 A;  3J7Z O;  4H5R A;  4PY5 A;  1YHQ N;  4DR5 K;  3JS6 A;  5HRS A;  4CGI A;  4FJ9 A;  3CQY A;  4BC2 A;  1GOA A;  4H8K A;  1LW2 A;  3HVT A;  2VQE K;  1HYZ A;  4CF9 A;  1Q81 O;  1KVC A;  3TAQ A;  2P9N B;  4CZE A;  1U48 A;  3LAM A;  3U9Z A;  4C1N I;  3NF7 A;  1SKW A;  2DPN A;  2KZM A;  2G8V A;  3J81 O;  3C7N A;  1BO5 O;  5I9E B;  5AQT A;  4KB1 A;  4BVO A;  4IO8 A;  4OPK A;  4B3S K;  1IKY A;  2QKK A;  3FZL A;  3P39 A;  3P5J A;  2XY8 A;  2ZE2 A;  2YKN A;  3THY A;  4H0P A;  1F21 A;  1C0G A;  3OYD A;  3KLE A;  5LJV A;  4IG0 A;  4A2B A;  1E4G T;  3AGR A;  4KFB A;  4WF9 L;  4JS5 A;  4IOC L;  1OH7 A;  3OYM A;  3AA2 A;  4B08 A;  1NKB A;  4H5W A;  1HYV A;  3H45 C;  4I7F A;  4XEI A;  4DSL A;  1N32 K;  3PSI A;  4M45 A;  4I9L A;  5M1F A;  4A61 A;  4A5B A;  2UU9 K;  2F8S A;  4V19 S;  3FZF A;  4JI6 K;  4E7I A;  1WN7 A;  3M8Q A;  4AHR A;  2D0P A;  2FBV A;  4JKB A;  5AQW A;  4KI4 A;  4EHT A;  4KAZ A;  4DSK A;  2A42 A;  4M3X A;  4YDU C;  4DQP A;  2FBX A;  3KLH A;  2YNI A;  4FZY A;  3K59 A;  1J53 A;  4CFA A;  3MX5 A;  2HHQ A;  2UXD K;  1QSY A;  4FJG A;  1L5U A;  5ADX H;  4JI3 K;  1SQK A;  4JHD B;  3E01 A;  3P38 A;  4CJ5 A;  5FRO A;  2ZD1 A;  5AZJ A;  2E2Q A;  4CER A;  1J9A A;  1JLE A;  4RTF D;  3LWL A;  4WQ4 C;  3THW B;  1JLQ A;  3C7N B;  4QAG A;  3TSQ A;  2F7T A;  4X66 K;  3THV A;  2RE2 A;  3ENH A;  4W5Q A;  1VQL N;  1B92 A;  4R79 A;  1KAZ A;  2W6L A;  5EY4 A;  4FCY A;  1ZC6 A;  1T8E A;  2HNZ A;  2GV9 A;  4U7B A;  4WE1 A;  4BR2 A;  3GE1 A;  5F0X A;  3AVL A;  3ENO A;  3CFR A;  3ZX0 A;  4E19 A;  3TAN A;  4MFB A;  3LP1 A;  4FWQ A;  4O4G A;  3L2V A;  1HMV A;  3H6E A;  3P31 A;  1GLE G;  1NGH A;  4JI2 K;  1XWL A;  2PYL A;  2NRT A;  3BF3 A;  2AA4 A;  3QFP A;  2E88 A;  4AF1 A;  1U4B A;  3SAH A;  2W40 A;  4CIG A;  4Z94 A;  2WFB A;  4ISG A;  4N5S A;  1JJ2 M;  3RVC A;  1NGI A;  3MN6 A;  4RWT A;  5GIN A;  5AQR A;  4BC4 A;  4G9Z A;  3AGK A;  3WEE B;  1TKZ A;  1KSP A;  2QXL A;  3CPW M;  4B9U A;  3AAR A;  5C42 A;  1TYQ A;  3K58 A;  5C25 A;  4JKG A;  1SAZ A;  3AO4 A;  4FWR A;  3L6Q A;  3MK6 A;  1VQ6 N;  4KHN A;  1Y97 A;  3IFR A;  3WNH A;  5B8H A;  4DTR A;  4MDA A;  2YI1 A;  3TTC A;  4Z4I A;  3T1A A;  1ATS A;  1Q7Y O;  3VA0 A;  2OYQ A;  3MEE A;  1N5Y A;  4K8Z A;  1LAW A;  4CI6 A;  4B8C A;  3P83 D;  4L8R B;  3BZK A;  3AO5 A;  1NU0 A;  3NH0 A;  2P9N A;  3DRR A;  3V9S A;  3SAF A;  2ZJR L;  4FWS A;  1UA1 A;  3BEX A;  1QSS A;  1JCF A;  3OYG A;  3KK2 A;  1M90 O;  3HO1 A;  4B1Y B;  3BF1 A;  4J2A A;  3VTI A;  4BG8 A;  2KW4 A;  4BC3 A;  2X78 A;  3B6O A;  2CH5 A;  4KPY A;  4MO4 A;  2UUB K;  2VCP A;  4JAX A;  4EFH A;  3ZSY A;  4B9S A;  4IFY A;  4DU3 A;  1L3V A;  4NXM K;  4FM2 A;  3CI5 A;  5FRN A;  2KFN A;  4BRN A;  3DXM A;  3VQ8 A;  4F9O A;  1HKG A;  3CCL N;  3CYM A;  3LPU A;  3PX6 A;  3PO5 A;  4FZZ A;  2HVI A;  3J7Y P;  2O4I A;  3HJF A;  3GDQ A;  2IOC A;  4A62 A;  3KLI A;  1NGD A;  2HHT A;  3MWP A;  1RTD A;  3OYB A;  1TAQ A;  3SAG A;  4PKG A;  4W5O A;  1BQN A;  2HHW A;  1K9M O;  1TAU A;  3QB0 A;  3NH1 A;  1HX1 A;  3EL2 A;  4DTS A;  2F4V K;  3AVF A;  4JKG B;  4DR3 K;  1NM1 A;  4OLA A;  4O44 A;  4GVM A;  3S3O A;  5T7B A;  3ZSX A;  2P5G A;  2Q31 A;  3CCU N;  3TAR A;  5EXW A;  3DM2 A;  5SZT A;  1JXB A;  4Y1D A;  4IO9 L;  3L3U A;  3N4Q A;  3DMJ A;  3V1O A;  2FC0 A;  1NK6 A;  4IXC A;  3O6W A;  4JS4 A;  4CJR A;  3MDQ A;  3CC7 N;  1C0M A;  3FLC O;  5BR8 K;  4K41 A;  5M1K A;  2YKM A;  2OTL N;  3PY8 A;  3K9K A;  3QIO A;  3Q7B A;  2V7Y A;  4C8M A;  3PIP L;  4DQQ A;  4JN4 A;  3ZLJ A;  4X64 K;  2O8E B;  4RCH A;  2YHB A;  1NOY A;  3VQ9 A;  4FLX A;  3QEW A;  3TAF A;  4KHQ A;  1S6Q A;  3A8Y A;  1T05 A;  4JK8 A;  3SK3 A;  4CHZ A;  1FKP A;  4O8K A;  3RMB A;  3SJJ A;  3P4I A;  2BTF A;  4F4K A;  4YOU A;  1RDC A;  3HPH A;  4EZ6 A;  2AP1 A;  4CFD A;  3EYZ A;  4KTZ A;  1BU6 O;  1QZ5 A;  3TPQ A;  2RN2 A;  1IH7 A;  2JLE A;  4LF8 K;  1EWR A;  4FJ5 A;  2NRW A;  4MDB A;  4E7H A;  3DLL L;  5CY4 A;  3D0P A;  3GG4 A;  4DUY K;  1TGO A;  4LFA K;  1NBW A;  4DR1 K;  2VWJ A;  1S72 N;  1NKE A;  4CIE A;  5ADX A;  1P90 A;  1NGC A;  4OPA A;  3VEY A;  1LV5 A;  4FWP A;  3QEX A;  5BPM A;  2FBY A;  1NJX A;  3T1Y K;  3EZW A;  3R6M A;  3QO9 A;  3PX4 A;  4H0T B;  4CES A;  1XHX A;  4DR4 K;  2NNW A;  4FWN A;  1VSJ A;  3AVG A;  2KTQ A;  5TKW A;  4GV3 A;  4J2E A;  3HT3 A;  4BDZ A;  2O8F A;  3EE8 A;  3I55 N;  3VET A;  1OH6 A;  2I7P A;  4CJT A;  4LF5 K;  4QS9 A;  1NK8 A;  1J54 A;  4BR7 A;  5F2R A;  2OTJ N;  3AAP A;  3G6E N;  4BWM A;  4JRQ A;  3BP8 A;  4J2B A;  2YHW A;  3DOK A;  2BE2 A;  2P9U A;  3HVR A;  2FXU A;  3JXU A;  3O3G A;  5DK5 A;  1NJW A;  3QEP A;  3B8A X;  4FZX C;  3QEV A;  4FPB A;  1UA0 A;  4DR7 K;  1JL2 A;  2Z1I A;  1BWF O;  4CJE A;  3V6D A;  3VQD A;  3IUC A;  3L2U A;  3UE5 A;  1RCH A;  1HJR A;  3O9Q A;  1TYQ B;  1K73 O;  3GOI A;  3ZEU A;  3ZT0 A;  4CJQ A;  1TUU A;  5FDL A;  4CED A;  3L2R A;  4OKJ A;  4FM0 A;  1W0H A;  2FSK A;  5ELZ A;  3RR8 A;  1BA1 A;  5LMU K;  4HCB A;  4W5N A;  2YV0 X;  3DWL A;  3AO1 A;  3LDO A;  5AR0 A;  4BR0 A;  3PX0 A;  2O8E A;  3DYA A;  5BPN A;  1M1K O;  2YX6 A;  3U6F A;  4KTW A;  2QXF A;  3IMX A;  4N47 A;  3ZSO A;  3OYI A;  1Q9Y A;  2BH1 A;  1C1C A;  4FLT A;  3RRH A;  4CF1 A;  3ULE B;  1JCE A;  1Q8I A;  4JI4 K;  3OYN A;  1DEJ A;  3LZJ A;  4KB0 A;  1ZBI A;  3H1Q A;  3G4S N;  1QQN A;  1VQ9 N;  5HRN A;  4N41 A;  2VGN A;  3ATU A;  3C6H A;  4I2P A;  5AQU A;  4DCH A;  1JLC A;  3CIP A;  3NBP A;  2ITG A;  3A2F A;  3UKR A;  5KQD A;  3THX A;  1SL2 A;  1ASU A;  3QBW A;  4H03 B;  1T44 A;  3CHW A;  1VQ7 N;  1N34 K;  4FWO A;  4PL8 A;  1QVF M;  1XUP O;  3ITH A;  2RHK A;  4CJV A;  3ISN C;  1VSH A;  3CJ9 A;  1VRU A;  1TK0 A;  3T69 A;  3HTV A;  4LF6 K;  1TK5 A;  3CJ7 A;  4ILH A;  1J5O A;  5AQS A;  4DTU A;  1UAX A;  4FLW A;  2X74 A;  2VG6 A;  4F2R A;  1NK5 A;  4Z4E A;  1VQ4 N;  4F2S A;  3O9T A;  4DUZ K;  1IKW A;  2O8B A;  5AQZ A;  5JVH L;  4O5F A;  1A5V A;  1U04 A;  4DQR A;  4BDY A;  4XIU A;  2UUA K;  4GVE A;  1JLA A;  1RDW X;  4ISF A;  4GV6 A;  4NCG A;  2BUP A;  1KVA A;  1K8K A;  3ZCM A;  5DMR A;  5AQX A;  5BRF A;  5GAH P;  4DFK A;  3V1R A;  3O80 A;  1EO1 A;  4FL9 A;  2OCE A;  1LOT B;  3CXC M;  5EX5 A;  3MMV A;  2P9S B;  1ASW A;  3MN9 A;  5C10 A;  4LH5 A;  2P5O A;  3QDK A;  1KRP A;  4NLB A;  3KLG A;  1HRH A;  3NHG A;  3C6T A;  2ASM A;  1UWB A;  4GY2 B;  3VEV A;  3NGZ A;  3VA3 A;  3VER A;  2I7N A;  1NMD A;  2B6A A;  3G25 A;  4DFM A;  4JKA A;  1VAZ A;  1OKJ A;  3UKU A;  4DQI A;  1GLJ O;  4IZ9 A;  3I0S A;  3VF6 A;  4B3O A;  4JKH A;  1CZ9 A;  1TVR A;  3L8B A;  5GIO A;  4ILJ A;  2PFU A;  5J2P A;  4DV0 K;  4IOA L;  2PBD A;  2A40 A;  4XH1 A;  4JEP A;  1HNZ K;  4BY9 C;  1BIU A;  4WFN L;  3NVM A;  3DI6 A;  1VQP N;  2RF2 A;  1JLG A;  3OYE A;  5EVZ A;  3QER A;  3VQE A;  3LAL A;  2E2O A;  5KPT A;  1SKR A;  1I39 A;  2BDP A;  1JLF A;  4BRA A;  2YJF A;  3OA9 A;  3AA4 A;  2PY5 A;  4CZK A;  4CHO A;  3V81 A;  4MLE A;  3BY5 A;  3SPY A;  3HZ6 A;  4KHP K;  4BE1 A;  4EP5 A;  2F8T A;  4DTN A;  1VQN N;  3HST B;  3ZET A;  3OYK A;  3IG1 A;  3K9J A;  3R9P A;  3LAN A;  1RTH A;  4JK9 A;  1ILY A;  3V9X A;  3CF5 L;  4AM6 A;  4UY8 O;  4NO7 A;  3HM8 A;  2QI2 A;  4BRM A;  1YF5 L;  1I94 K;  4CBU A;  4JNE A;  3ZT2 A;  4CJL A;  1BCO A;  3AVB A;  3ALY A;  4FLY A;  4AHV A;  4H0O A;  4KI6 A;  4Q0B A;  3WQU A;  4DG1 A;  4NXN K;  3THY B;  1D5A A;  2HND A;  4M42 A;  2OPQ A;  3OYL A;  3OBW A;  1ASV A;  3DLR A;  5J2M A;  2YCH A;  1NJI O;  1X3M A;  4ZHR A;  3EKS A;  1BA0 A;  3HI0 A;  4Z4F A;  3F73 A;  3WXI A;  3DXK B;  4FYD A;  2OPP A;  3VES A;  2NZT A;  3U9D A;  3L0Q A;  3JYT A;  1JXE A;  4CK1 A;  5FPM A;  3L2W A;  2E6L A;  4ISE A;  1TL1 A;  1T6D A;  2GWJ A;  4DS5 A;  5JVG L;  3VEX A;  4DV7 K;  2AJQ A;  4LFC K;  4OVL A;  3RRG A;  4IDK A;  5AQP A;  3HP9 A;  5CYQ A;  4B3T K;  3E1Y A;  4I6M B;  2G8U A;  4CEA A;  3KKR A;  3OYH A;  3OBY A;  2VGM A;  3HOS A;  1T03 A;  1NK9 A;  2OA8 A;  3D2F B;  3TTF A;  1VSK A;  3AAQ A;  1GLB G;  1NG9 A;  1RBV A;  4Y1C A;  4M3U A;  3BUZ B;  4FVM A;  4RG8 A;  2XY5 A;  4WQ5 A;  3OVN A;  2P9S A;  3OS0 A;  1L3S A;  1RTJ A;  4JI1 K;  5KGW A;  2HMP A;  5J2N A;  3WNG A;  1EWQ A;  2OPR A;  4BGB A;  3PIO L;  1S1X A;  2NRH A;  3HPG A;  4HWI A;  1NGE A;  2HST A;  4CZL A;  4DB3 A;  2YHA A;  3IKM A;  3VGM A;  1WLJ A;  1HNV A;  1S5J A;  4PKI A;  3NCI A;  3VEZ A;  2XRI A;  1ESV A;  4YHH K;  5JMV A;  4E89 A;  2QWP A;  4IJA A;  1YAG A;  1L3U A;  5I42 A;  3NMU A;  4JD2 B;  2PAV A;  4OJR A;  1H1V A;  1BQM A;  4QS7 A;  1OVQ A;  1CZA N;  4CD3 A;  2KKZ A;  4BR4 A;  1RTI A;  3WQT A;  3KWI A;  1HLU A;  1U2V B;  4FW1 A;  5FLX O;  3WXK A;  3F9M A;  1VSE A;  3KIO A;  4CF2 A;  3A5O C;  4DSF A;  4FJM A;  3QLH A;  2QM1 A;  3RR7 A;  3QIP A;  4M3T A;  1XI1 A;  1SS6 A;  3LM2 A;  2CGK A;  4YOR A;  4DU4 A;  2E2N A;  4IOX A;  4Z4G A;  2E20 A;  4CJF A;  4AHU A;  1KXP A;  3O9S A;  3A5L C;  5I3U A;  1J6Z A;  4CE9 A;  1Q18 A;  4CW7 B;  1KFS A;  1MA9 B;  4E3S A;  4DQ8 A;  4AH9 A;  4KKO A;  5LL6 Z;  3DLG A;  2IS3 A;  4K43 A;  4CGD A;  1LAV A;  1WSJ A;  3SPZ A;  1XNR K;  3ZSW A;  4CJK A;  2KZZ A;  3O1W A;  5HRR A;  5HL7 L;  3OTO K;  2CGL A;  4CK2 A;  4FW2 A;  2EX3 A;  2X6S A;  1WBD A;  5DM7 L;  3NF8 A;  3CJ1 A;  1OVY A;  3D2E B;  2HHH K;  4CJS A;  1T6C A;  3AVK A;  2HHV A;  2DFE A;  1GOB A;  4YDU A;  4KRE A;  4FVU A;  4ID1 A;  1WSF A;  3UKU B;  3TI0 A;  3LL3 A;  1VSI A;  1HNW K;  3PO4 A;  1W97 L;  1TKX A;  2O8D B;  3O9R A;  1IV0 A;  4CEC A;  4J2D A;  3O1B A;  5LY3 A;  3VQP A;  5AQG A;  3RWU A;  3PV8 A;  1HKB A;  3S41 A;  1QQM A;  1HPM A;  2E1Z A;  4KTQ A;  1YIJ N;  1C0F A;  1QQO A;  3AVC A;  3C6A A;  3LP0 A;  1X9J A;  4HUG A;  4E1M A;  3Q7C A;  4J8F A;  5KRT A;  1RBU A;  3QET A;  2UYT A;  4IBN A;  3AVH A;  2YNF A;  3HP6 A;  1VSF A;  1V4S A;  5KTQ A;  3M3Z A;  1IBM K;  1K8K B;  3DRS A;  4IFE A;  5JS2 A;  4B9V A;  2G8W A;  2ASP A;  4B9Q A;  4HVJ A;  2YHY A;  3I0R A;  5EU7 A;  3AVN A;  4ELU A;  3EO3 A;  4CZM A;  4DV5 K;  3N4P A;  1RT2 A;  4ELT A;  4FXD A;  1NJY A;  4FJX A;  1CLQ A;  3CJC A;  4CGF A;  4CFB A;  1D9D A;  4RW8 A;  5JIC A;  3CCJ N;  4MO5 A;  5AQF A;  1YTA A;  3MX2 A;  1ZXO A;  4FK2 A;  3PSF A;  4DV1 K;  4DTX A;  2P9I B;  3D2E A;  1V4T A;  4BRG A;  2CH6 A;  1KD1 O;  2ZWH A;  3SUN A;  2QWL A;  3QML A;  1ATN A;  1NGF A;  4O55 A;  2HBK A;  3S9H A;  5C2D A;  3IRX A;  2IVO A;  3VF4 A;  4BVP A;  4DLE A;  2YHX A;  4H4O A;  4CGJ A;  4NYN A;  1VQO N;  3RTV A;  3FZK A;  3CCR N;  4G1Q A;  2VG7 A;  4BQL A;  2HB5 A;  5JS1 A;  3KVG A;  3E66 A;  3ULD A;  3AY9 A;  1EKE A;  3MED A;  4C8L A;  4EHU A;  1QVG M;  5AJ3 K;  2ZM6 K;  4M3W A;  2D0C A;  3M8P A;  3VEW A;  2IIR A;  1NGG A;  4DV3 K;  3HXM A;  1SV5 A;  3VQ5 A;  1RGI A;  5C24 A;  5AQJ A;  1WOQ A;  1C1B A;  1QHA A;  2D1K A;  4IG3 A;  5FPE A;  3QEI A;  5CZ1 A;  3T3F A;  3T7Z A;  3ZT1 A;  5C0Y A;  4DV2 K;  3TSU A;  2ETJ A;  3TAG A;  1ZBU A;  3FR0 A;  4DQS A;  2NRV A;  5HLF A;  4BGA A;  1QZ6 A;  3SMP A;  3VGL A;  5BPL A;  1XMQ K;  1RT5 A;  4BE2 A;  5FRM A;  3CQX A;  1LWC A;  2Q1N A;  3V9Z A;  3WEE A;  2OPS A;  4KRF A;  4CHQ A;  4JKD A;  4CJ4 A;  4IEI A;  2EHG A;  2H3G X;  3KTQ A;  2KHO A;  4B1X B;  3U3Y A;  3LP3 A;  1REV A;  4I6M A;  4M41 A;  2F9T A;  4WFA L;  2D4W A;  4HCC A;  5E26 A;  1OH8 A;  4CFC A;  3ZT3 A;  4QS8 A;  3H3N O;  1ATR A;  3GBT A;  3O3F A;  1W2B M;  4O0J A;  3H08 A;  2O8C B;  3EE9 A;  3ZSQ A;  3K2P A;  3D6R A;  2FLO A;  4I2Q A;  2IVP A;  3UKR B;  4ZTF A;  4AHT A;  4PUO A;  1U2V A;  5C2F A;  4CF0 A;  1RBR A;  2FF3 B;  5GAG P;  4DFJ A;  4A5A A;  2E5L K;  3ZSZ A;  3ZEU B;  5KPZ A;  5HRO A;  2W42 A;  1NJZ A;  1RT3 A;  3OW2 M;  3L4I A;  4CJW A;  3CD6 N;  3LZI A;  2Q97 A;  1BG3 A;  5BR9 A;  3SJH A;  3R8E A;  1E3M A;  3MCP A;  3MAQ A;  3F2K A;  2P9I A;  1JCG A;  1CZB A;  4FOE A;  1DGK N;  4Q5V A;  3V9U A;  3KD5 E;  1CXQ A;  4OGC A;  1YJ9 N;  4KHS A;  1VSD A;  3SBG A;  4GNI A;  1D8Y A;  1BHL A;  4JI8 K;  3SLC A;  1E4F T;  4XH5 A;  4JRP A;  3T1H K;  3VPZ A;  4A59 A;  5AQH A;  3L2Q A;  2HOE A;  4DLG A;  1JKH A;  3CER A;  4N56 A;  1G99 A;  4BRI A;  2BGG A;  3UIQ A;  2Z1G A;  1IKX A;  4B9N A;  3QIC A;  4RW4 A;  2D0A A;  1RIL A;  3QNO A;  1U49 A;  5HP1 A;  1NOZ A;  1YVU A;  2V52 B;  1QHT A;  1BIS A;  2Z1J A;  3M6G A;  5M1P A;  2HNY A;  4RW7 A;  1FJG K;  3L3V A;  2ZJQ L;  1BUP A;  3LDL A;  3WT0 A;  3HL8 A;  2P9L A;  4F8R A;  3OYA A;  1ITG A;  3P1G A;  1YXQ A;  4CZI A;  5H1S Q;  4FSV A;  5BN9 A;  4JI0 K;  2P9P A;  5FPN A;  5CR4 A;  2NRR A;  3MXI A;  1S9G A;  4CEE A;  2A3Z A;  4FLZ A;  2G8I A;  1U6Z A;  3TU5 A;  5KPR A;  1RDB A;  1YVN A;  4E7K A;  5JLF A;  2NUB A;  3J8A A;  3WXJ A;  1DKG D;  3D7E O;  3K5M A;  3VGK A;  3ZSV A;  3VQA A;  1VRT A;  3VEO A;  3SV3 A;  1R0A A;  2E6M A;  3LDP A;  2GTD A;  3FZM A;  3CJA A;  3E9O A;  4BRQ A;  3LDS A;  3CCV N;  5AZI A;  4ID5 A;  4GKK K;  1J5E K;  1EXQ A;  1Q86 O;  3KJV A;  1VHX A;  4XH4 A;  3K5L A;  3O8M A;  4CK3 A;  3F5T A;  2QWR A;  5BRD A;  2HBM A;  3K0S A;  4LFB K;  5AQM A;  1ZYQ A;  4YY3 K;  4H5V A;  4A2A A;  4CHP A;  2QWM A;  3M8S A;  2JWK A;  3K57 A;  3UB5 A;  4GW6 A;  5BRE A;  2FSN A;  1XQS C;  3CFO A;  4OKE A;  1YUW A;  3KD1 E;  3H46 O;  4BAC A;  3KWG A;  3LDN A;  1TKD A;  2IGI A;  4CBW A;  4BG9 A;  1WUA A;  1A5W A;  2OZS A;  3I8B A;  4F3O A;  4HUF A;  1RT7 A;  4RW9 A;  1T3V A;  3DOL A;  2E1Y A;  3FZH A;  4F3T A;  1RFQ A;  3CFP A;  1KAX A;  3RSE A;  4YOV A;  1N36 K;  3G0Z A;  4NCB A;  2GEL A;  2OZM A;  1SL0 A;  2DY4 A;  4CEB A;  3H1V X;  3I56 N;  3HM9 A;  4C1N K;  3VMF B;  3LDQ A;  4BRH A;  1IBL K;  3JAM O;  3O9U A;  1QSL A;  3ZT4 A;  3CJB A;  3V9W A;  5AQN A;  1ZBS A;  3BZC A;  3FFK B;  4LY7 A;  2J4R A;  1JL1 A;  5J2Q A;  4KH4 A;  3R1X A;  4IFV A;  1RBT A;  3KLF A;  1KAY A;  4CZJ A;  1O13 A;  2G8F A;  3A5M C;  4M7Y A;  3E9L A;  2Q0U A;  1TUY A;  4AQY K;  3CQ8 A;  1QE1 A;  3EY1 A;  2P1J A;  4X65 K;  2P51 A;  5KQ8 A;  2HF4 A;  4CJP A;  1KC8 O;  1KLN A;  3VQ6 A;  3MEG A;  4B9T A;  4B1W B;  5AQY A;  4FJH A;  5J1E A;  1IG9 A;  4OPH A;  2ZGY A;  4FWL A;  5GAD P;  4GMJ B;  2HVH A;  1OH5 A;  3M5R A;  3NGI A;  5HRP A;  2RPI A;  4B8A B;  4EAH D;  4LSL A;  3ZYY X;  3CG7 A;  4BRL A;  2W41 A;  4BDP A;  2UUC K;  4FJ8 A;  1GLA G;  3MN5 A;  4DTP A;  4PWD A;  1VK0 A;  1C1A A;  3CMA N;  1QTM A;  2YJE A;  4BRE A;  4GV9 A;  3S3M A;  3NF9 A;  2UXC K;  4BQZ A;  1BGX T;  3HPO A;  3FFI A;  3FGU A;  4PA1 A;  5BRH A;  3ZX3 A;  1W9H A;  1Z25 A;  4CD1 A;  4UQG A;  2GWK A;  2P9U B;  1VSM A;  4HHT A;  1HNX K;  2D0B A;  4L3Q A;  3LWM A;  5IT9 O;  3AV9 A;  4LF4 K;  2VWB A;  3HBT A;  4IKF A;  5E84 A;  3NF6 A;  3J7A P;  3SNN A;  1D9F A;  4H0V B;  4PL7 A;  3DXM B;  3C94 A;  4MQ3 A;  1X9M A;  2O8F B;  2WBN A;  5KRS A;  4R5P A;  2HF3 A;  4YNQ A;  4WYB A;  1XNQ K;  3HSC A;  3WUH A;  2FBT A;  4JI7 K;  3DLK A;  3THX B;  4PHT X;  4K0K K;  4DSE A;  2O4G A;  1NKC A;  3BDP A;  3DAW A;  4WFB L;  1WAJ A;  4X62 K;  1ZBL A;  3F9K A;  3W0L A;  3I33 A;  3E9P A;  2KQ2 A;  4FM1 A;  1WNS A;  4O0I A;  2HMI A;  4OO1 J;  3OHR A;  1K8A O;  3SUO A;  4B9L A;  1N8R O;  4Z0U A;  3CCE N;  4E0D A;  3B6P A;  3OYF A;  3A0I X;  4CEZ A;  1HR0 K;  4DV4 K;  4FJN A;  2HW3 A;  3SV4 A;  1HPZ A;  1WSE A;  3SQ0 A;  1YI2 N;  2F9W A;  5M1Q A;  4E1J A;  4BR5 A;  4H5T A;  2HBJ A;  5D3G A;  1SL1 A;  4YOY A;  3O08 A;  1N33 K;  4BC5 A;  4FOI A;  3AVA A;  3T19 A;  2QWO A;  1RDD A;  3DLH A;  3HYF A;  1TKT A;  4DV6 K;  1S9E A;  2JGU A;  5KGX A;  4KV8 A;  1SKS A;  2E4L A;  1NK4 A;  2ASO A;  4W5T A;  1VQK N;  3MN7 A;  1GOC A;  3VTH A;  4A57 A;  4LSN A;  1QS4 A;  1C6V A;  3VN5 A;  2X6N A;  1S6P A;  4K42 A;  4BE0 A;  3ZSR A;  1G15 A;  3KKS A;  3PUF A;  3AVJ A;  5E41 A;  2V7Z A;  3SUQ A;  4CZF A;  1EQY A;  3K5O A;  4JKC A;  2LSN A;  4HTL A;  1NNE A;  4NB4 A;  1W7A A;  1Z6R A;  1MWM A;  1BDG A;  2Y1J A;  1B9D A;  3VQ4 A;  5AQK A;  1DLO A;  4DS4 A;  3SQ1 A;  3CM5 A;  5AZI B;  3QFU A;  4DTM A;  3MXM A;  3CCS N;  4RW6 A;  1Z26 A;  4K25 A;  4KH5 A;  3IS9 A;  3OY9 A;  3SBT A;  1IO2 A;  3M1F A;  3CCM N;  4H0X B;  2XO7 A;  1DT9 A;  3VF2 A;  4DHY A;  1S1T A;  4DSJ A;  4JKF A;  1FXX A;  4DF8 A;  3K5N A;  1NLV A;  4M3Z A;  1JLB A;  3TWH A;  2G8H A;  2Q3S A;  2IC3 A;  4E1N A;  4FJI A;  5C12 A;  5C15 A;  1YJW N;  4CHN A;  4WQ4 A;  3MCA B;  4IEE A;  3SQ2 A;  3QIN A;  2GUP A;  3CPE A;  2A6A A;  3TR8 A;  3V1Q A;  2IAJ A;  4E7L A;  3ASM A;  3RSE B;  5AFU H;  3ATV A;  1EET A;  1Y64 A;  3VQC A;  4FJL A;  3TSP A;  2O8C A;  2B4J A;  3AVM A;  2UXB K;  1C0T A;  2V51 B;  4BWJ A;  2GBZ A;  1P8Z A;  4M7X A;  4OGE A;  1IG8 A;  5HBM A;  1R59 O;  4YOX A;  3EN9 A;  1RDU A;  2F96 A;  2ITM A;  1NWK A;  3W3D A;  2XHB A;  4FLU A;  4E7J A;  5HOO A;  2Q2R A;  2GUI A;  5DM6 L;  4KH6 A;  1SZ2 A;  4H5N A;  4DR2 K;  1ZBH A;  4CZH A;  2QW9 A;  4KHW A;  3OJU A;  5IWA K;  2WUS A;  1HKC A;  4C23 A;  1CXU A;  2D5R A;  1I3A A;  4DR6 K;  4AHS A;  4B1U B;  1KLM A;  4EZ9 A;  3L4Q A;  4Z4H A;  2P9K B;  3KZB A;  4H4M A;  3LP2 A;  3ULE A;  4EIA A;  1KCF A;  4B1Z A;  4O8U A;  3TAB A;  1C0U A;  1ZBF A;  5M1O A;  1FW6 A;  3NE6 A;  3EKU A;  1S1W A;  5CYM A;  3EEQ A;  2BAN A;  4AHC A;  3IAY A;  4C8O A;  4ILG B;  4CF8 A;  3RMA A;  1T7P A;  3VQB A;  4CEO A;  1LWE A;  2E2P A;  5F1X A;  3AA5 X;  1TL3 A;  3G71 N;  1A5X A;  3M8R A;  1KVB A;  4H0Y B;  4B3R K;  2Q36 A;  3HK2 A;  2KLA A;  3DRP A;  1XC9 A;  3SCX A;  4HTU A;  1O1W A;  4LF7 K;  5GIP A;  3BGR A;  1TK8 A;  3CC4 N;  4YOT A;  3ENB A;  5AQQ A;  2IDO A;  2ZGZ A;  4JV5 K;  5LJW A;  2ZQB A;  4CCH A;  4M3Y A;  4IJN A;  1YIT N;  3WNE A;  3DLB A;  1UOC A;  3VEN A;  1NGA A;  5SWM A;  2P9L B;  1GLD G;  3DJC A;  3S3N A;  3AO2 A;  4I9Q A;  4IDH A;  1NMN A;  4QCL A;  2A1S A;  5KI6 A;  3PLA A;  5GAE P;  2E8A A;  3C95 A;  3LPT A;  1X9W A;  2Y1I A;  3TAM A;  4BRC A;  3QES A;  1TV6 A;  4FK4 A;  4M3R A;  3DLE A;  3WNF A;  3QNN A;  1HQE A;  4NLC A;  1WSI A;  2O8D A;  3DXK A;  1DTQ A;  4MLH A;  1U45 A;  2OAN A;  2QKB A;  2A5X A;  4LH4 A;  4B9M A;  4JKE A;  5K14 A;  4HUE A;  4ELV A;  2JWL A;  1BOT O;  1YJN N;  1VSL A;  1WBB A;  4OLB A;  3TAP A;  5CHI A;  4M63 C;  2YNG A;  3U8X A;  1U47 A;  5FPD A;  4FJ7 A;  2IVN A;  4ICL A;  4Y0W A;  3C65 A;  2P9P B;  1YT3 A;  4BRO A;  3CM6 A;  2WOM A;  2HHU A;  1RT4 A;  3RMC A;  2ZJP L;  4JLH A;  3VQQ A;  3O4W A;  1NK0 A;  2CGJ A;  5BN8 A;  4AIL C;  3U4L A;  2P9K A;  4Z4C A;  4DSI A;  4BRF A;  3OYC A;  1LW0 A;  1D4X A;  4CBX A;  3CME N;  4K8X A;  3SUP A;  1BI4 B;  3MEC A;  3O4N A;  1BIZ A;  3NGY A;  5AQV A;  4CIF A;  4FJJ A;  4PQU A;  1X3N A;  4B3M K;  3SI6 A;  2B5J A;  4EP4 A;  1B9F A;  3CCQ N;  1QQC A;  5EOY A;  2KFZ A;  1RT6 A;  3JSM A;  4DKW A;  1WAF A;  2VWK A;  4JD2 A;  3J80 O;  4WQ5 C;  1RBS A;  1RT1 A;  2QA4 N;  2HHS A;  1WSG A;  3NDK A;  1VQM N;  1S22 A;  1NK7 A;  3RMD A;  1SUQ A;  4DFP A;  2WTU A;  1XMO K;  4CGH A;  1XC3 A;  1FKO A;  3LM9 A;  2FF6 A;  3SQ4 A;  5CZ2 A;  4BR9 A;  2QEX N;  2QWQ A;  2I5J A;  3TAE A;  1S1U A;  1WB9 A;  2O8B B;  1HNI A;  3NFA A;  1HQU A;  2D0O A;  2QTD A;  3ID6 A;  1K6Y A;  3KK3 A;  2PZS A;  1IBK K;  1Q9X A;  4B1V A;  3IDH A;  4GKJ K;  3QBX A;  4N76 A;  3WXM B;  1EX4 A;  4FWM A;  3NVK A;  2W6K A;  4JYA K;  4KHU A;  1GLC G;  5MLC Q;  2WC9 A;  4OKK A;  1LWF A;  2YNH A;  4OX9 K;  4DWI A;  3HRG A;  4CZG A;  2DFH A;  3OS2 A;  2NLX A;  1BL3 A;  4OPJ A;  1IJJ A;  4C8N A;  4W5R A;  3C6U A;  3R3L A;  4KO0 A;  2RKI A;  3V4I A;  5AQO A;  2QK9 A;  4CJU A;  4YFU A;  3VQ7 A;  3NAE A;  4FLV A;  4KBO A;  1BCM A;  2WON A;  4NYF A;  3I8D A;  3CET A;  3OJS A;  3D2F A;  3GL1 A;  1VQ5 N;  2XY7 A;  4FWK A;  4BRD A;  3KK1 A;  2A1R A;  3ID8 A;  1LCU A;  5AQI A;  5JLH A;  5LMN K;  4CJ3 A;  3TTD A;  1Z05 A;  4DMN A;  4CEF A;  3MWT A;  2R7Y A;  1MU2 A;  2GEM A;  1L3T A;  1DTT A;  1X1P A;  3D45 A;  2PYJ A;  4WCE L;  3AVI A;  3EZ5 A;  4AM7 A;  2VQF K;  2DFF A;  2DTU A;  2Z1H A;  4U67 L;  1GLF O;  3O5B A;  3SZ2 A;  3LAK A;  3KHY A;  4CEQ A;  4TSX A;  1NGB A;  1KQS M;  5A2Q O;  1MWK A;  2ZF5 O;  4FK0 A;  3VOV A;  2ATQ A;  2G8K A;  3HOT A;  4DF4 A;  3O4Q A;  4FO0 A;  1FK9 A;  4IWV A;  5CE3 A;  4LC9 B;  1BI4 A;  3A5N C;  4O5B A;  3O3H A;  2A41 A;  3NH2 A;  2VG5 A;  1GLL O;  2QWN A;  2Q0R A;  4LD0 A;  1N6Q A;  1NGJ A;  2HHX A;  4ZTJ A;  5TKY A;  4CVN E;  5AFU A;  4KHY A;  4CHY A;  4CGG A;  1MDU B;  1RDA A;  1S1V A;  2NRX A;  4JK7 A;  3THW A;  1KFD A;  2EWS A;  5M1N A;  4BRP A;  3ZX2 A;  1RNH A;  3H3O B;  4DTJ A;  3AA3 A;  5AZJ B;  3MXJ A;  3SYZ A;  3G10 A;  1KTQ A;  1VQ8 N;  4QOZ B;  4FPA A;  3C0B A;  4JI5 K;  4JHD A;  5AQL A;  4FJK A;  3KK7 A;  4BRK A;  2NRZ A;  1YTU A;  1WSH A;  3OYJ A;  1HYS A;  4DTO A;  4DU1 A;  2HBL A;  2XY6 A;  4C8K A;  1S3X A;  1XHZ A;  3OS1 A;  1EP4 A;  4NCA A;  1Q82 O;  3CC2 N;  3SMS A;  1X9S A;  2VYP A;  1HJO A;  3AO3 A;  4PKH A;  4YOW A;  3ZET B;  2GX9 A;  4LF9 K;  3FE1 A;  1IKV A; 
#chains in the Genus database with same CATH homology
 1EKE A;  1JLC A;  3MED A;  3U3G A;  3NBP A;  2ITG A;  3A2F A;  3K5O A;  1NK4 A;  1SL2 A;  2LSN A;  1ASU A;  4PY5 A;  5HRS A;  4CGI A;  4M3W A;  4FJ9 A;  2D0C A;  3M8P A;  1GOA A;  3ITH A;  4H8K A;  4CJV A;  3ISN C;  1LW2 A;  3HVT A;  1VSH A;  2Y1J A;  1B9D A;  3VQ4 A;  1VRU A;  1HYZ A;  4CF9 A;  4DS4 A;  1DLO A;  1SV5 A;  3HXM A;  1KVC A;  3SQ1 A;  3CM5 A;  3VQ5 A;  1TK0 A;  3TAQ A;  4DTM A;  3MXM A;  1TK5 A;  4RW6 A;  5C24 A;  1Z26 A;  1U48 A;  3LAM A;  1J5O A;  3IS9 A;  3OY9 A;  1C1B A;  1IO2 A;  3NF7 A;  4DTU A;  1SKW A;  1UAX A;  4FLW A;  2X74 A;  4IG3 A;  2XO7 A;  2KZM A;  2G8V A;  1S1T A;  3QEI A;  4DSJ A;  2VG6 A;  5CZ1 A;  3T3F A;  1FXX A;  4F2R A;  1NK5 A;  4DF8 A;  4FZZ A;  4Z4E A;  3K5N A;  3ZT1 A;  4KB1 A;  4F2S A;  4OPK A;  2ETJ A;  1IKY A;  1IKW A;  4M3Z A;  1JLB A;  3TAG A;  2QKK A;  1ZBU A;  4DQS A;  5HLF A;  3TWH A;  2G8H A;  2Q3S A;  3P5J A;  2IC3 A;  2XY8 A;  4E1N A;  2ZE2 A;  4FJI A;  1A5V A;  2YKN A;  1U04 A;  5FRM A;  1RT5 A;  1F21 A;  3KLE A;  3OYD A;  1LWC A;  4BDY A;  4BE2 A;  4DQR A;  4CHN A;  3V9Z A;  3SQ2 A;  4IG0 A;  3QIN A;  4KRF A;  2OPS A;  4XIU A;  4CHQ A;  4CJ4 A;  3TR8 A;  4KFB A;  3V1Q A;  4JS5 A;  2IAJ A;  3OYM A;  3ASM A;  3AA2 A;  4B08 A;  1JLA A;  2EHG A;  4E7L A;  1NKB A;  3KTQ A;  4NCG A;  3U3Y A;  1EET A;  1HYV A;  1KVA A;  3VQC A;  4FJL A;  3ZCM A;  3LP3 A;  1REV A;  5DMR A;  2B4J A;  4M41 A;  3AVM A;  4DFK A;  4I7F A;  1C0T A;  3V1R A;  4DSL A;  4BWJ A;  2GBZ A;  4M45 A;  4I9L A;  4HCC A;  4OGE A;  2F8S A;  5HBM A;  4CFC A;  4E7I A;  3ZT3 A;  2F96 A;  2XHB A;  1WN7 A;  3M8Q A;  4FLU A;  4AHR A;  4E7J A;  3O3F A;  1ASW A;  2FBV A;  4O0J A;  4LH5 A;  2P5O A;  3H08 A;  3ZSQ A;  4KI4 A;  2GUI A;  3K2P A;  1KRP A;  4KAZ A;  4DSK A;  3KLG A;  4I2Q A;  4DQP A;  1HRH A;  4M3X A;  3NHG A;  4ZTF A;  2FBX A;  3C6T A;  1UWB A;  2YNI A;  4AHT A;  3NGZ A;  3KLH A;  3VA3 A;  4FZY A;  4PUO A;  1ZBH A;  4KHW A;  3K59 A;  3OJU A;  2HVI A;  1J53 A;  4CFA A;  2HHQ A;  4CF0 A;  1RBR A;  2B6A A;  4DFJ A;  4DFM A;  1QSY A;  1L5U A;  4FJG A;  1CXU A;  2D5R A;  3E01 A;  3ZSZ A;  1I3A A;  4DQI A;  4CJ5 A;  5HRO A;  4AHS A;  2W42 A;  1NJZ A;  1KLM A;  1RT3 A;  4EZ9 A;  4Z4H A;  5FRO A;  2ZD1 A;  4CJW A;  3I0S A;  4B3O A;  4H4M A;  3LP2 A;  3LZI A;  1KCF A;  1CZ9 A;  1TVR A;  3L8B A;  3TAB A;  1C0U A;  1ZBF A;  4CER A;  1J9A A;  1JLE A;  3LWL A;  5J2P A;  3NE6 A;  1JLQ A;  4QAG A;  3MAQ A;  3THV A;  1S1W A;  5CYM A;  2BAN A;  4AHC A;  4W5Q A;  3IAY A;  4C8O A;  1CZB A;  4Q5V A;  1B92 A;  1BIU A;  4CF8 A;  3RMA A;  1T7P A;  3VQB A;  3DI6 A;  1LWE A;  4CEO A;  3V9U A;  2RF2 A;  1JLG A;  3AA5 X;  1CXQ A;  1TL3 A;  3OYE A;  4FCY A;  3KD5 E;  1A5X A;  4OGC A;  1KVB A;  2HNZ A;  3LAL A;  3VQE A;  3M8R A;  3QER A;  1T8E A;  1SKR A;  1VSD A;  4KHS A;  3HK2 A;  1D8Y A;  1BHL A;  1I39 A;  3DRP A;  2BDP A;  1XC9 A;  1JLF A;  2GV9 A;  4JRP A;  4HTU A;  4WE1 A;  3SCX A;  1O1W A;  3AVL A;  3L2Q A;  4DLG A;  3CFR A;  1JKH A;  3BGR A;  4E19 A;  4N56 A;  4MFB A;  3TAN A;  3AA4 A;  1TK8 A;  2PY5 A;  2BGG A;  3LP1 A;  3L2V A;  4O4G A;  4CHO A;  3UIQ A;  1HMV A;  3V81 A;  3SPY A;  2IDO A;  2Z1G A;  1IKX A;  4B9N A;  2PYL A;  1XWL A;  2ZQB A;  4RW4 A;  4EP5 A;  4BE1 A;  2D0A A;  1RIL A;  4CCH A;  4M3Y A;  4DTN A;  3QNO A;  2F8T A;  3WNE A;  3DLB A;  3HST B;  1U49 A;  3OYK A;  5HP1 A;  1NOZ A;  1UOC A;  1YVU A;  5SWM A;  3S3N A;  4I9Q A;  3IG1 A;  3AO2 A;  1QHT A;  1BIS A;  3LAN A;  2Z1J A;  4QCL A;  2A1S A;  1U4B A;  2OYQ A;  1RTH A;  2HNY A;  4RW7 A;  5KI6 A;  3L3V A;  3V9X A;  3C95 A;  3LPT A;  3HL8 A;  1X9W A;  4F8R A;  3OYA A;  4CIG A;  2Y1I A;  3TAM A;  4N5S A;  3QES A;  1TV6 A;  4FK4 A;  1ITG A;  3P1G A;  4M3R A;  3DLE A;  3WNF A;  3ZT2 A;  4CJL A;  1BCO A;  3AVB A;  3QNN A;  3ALY A;  1HQE A;  4FLY A;  1WSI A;  4AHV A;  4KI6 A;  1DTQ A;  1U45 A;  4Q0B A;  1TKZ A;  3MXI A;  2QKB A;  1KSP A;  1S9G A;  4CEE A;  4DG1 A;  4B9U A;  4LH4 A;  4FLZ A;  1D5A A;  2HND A;  4B9M A;  5C42 A;  4M42 A;  2G8I A;  5K14 A;  3K58 A;  4HUE A;  2OPQ A;  5C25 A;  4ELV A;  3OYL A;  1RDB A;  3AO4 A;  1ASV A;  3DLR A;  5J2M A;  1VSL A;  4OLB A;  3TAP A;  4E7K A;  4KHN A;  1Y97 A;  2YNG A;  3WNH A;  4ZHR A;  4DTR A;  1U47 A;  4Z4F A;  4Z4I A;  3F73 A;  4FJ7 A;  2NUB A;  3T1A A;  4ICL A;  4FYD A;  2OPP A;  3VA0 A;  3CM6 A;  1YT3 A;  3ZSV A;  2WOM A;  3VQA A;  1VRT A;  3MEE A;  3JYT A;  3K5M A;  1N5Y A;  1RT4 A;  1JXE A;  4CK1 A;  3L2W A;  3RMC A;  4K8Z A;  2HHU A;  2E6L A;  1LAW A;  4JLH A;  3VQQ A;  3SV3 A;  1R0A A;  1TL1 A;  4B8C A;  1NK0 A;  2E6M A;  3P83 D;  4DS5 A;  4L8R B;  4AIL C;  2AJQ A;  3AO5 A;  3NH0 A;  3DRR A;  3LDS A;  3V9S A;  4ID5 A;  4OVL A;  3RRG A;  4IDK A;  1EXQ A;  1UA1 A;  1QSS A;  3KJV A;  3HP9 A;  5CYQ A;  4Z4C A;  4DSI A;  3OYC A;  1LW0 A;  3OYG A;  4CK3 A;  3KK2 A;  4CEA A;  3K5L A;  3KKR A;  3OYH A;  2G8U A;  3SUP A;  4K8X A;  3HO1 A;  4J2A A;  1BI4 B;  3MEC A;  1T03 A;  1NK9 A;  3O4N A;  2OA8 A;  2KW4 A;  2X78 A;  1BIZ A;  1VSK A;  3B6O A;  3NGY A;  4CIF A;  4FJJ A;  4KPY A;  4M3U A;  4PQU A;  1ZYQ A;  1RBV A;  4B9S A;  3ZSY A;  4Y1C A;  4IFY A;  3SI6 A;  4DU3 A;  2B5J A;  4FVM A;  4RG8 A;  4CHP A;  4EP4 A;  1L3V A;  4FM2 A;  2XY5 A;  5FRN A;  2KFN A;  3OVN A;  1B9F A;  3M8S A;  1QQC A;  3OS0 A;  1L3S A;  1RTJ A;  2KFZ A;  3VQ8 A;  3K57 A;  4GW6 A;  5KGW A;  2HHT A;  1RT6 A;  3CYM A;  3LPU A;  4OKE A;  3CFO A;  3JSM A;  5J2N A;  1WAF A;  2VWK A;  3WNG A;  3PX6 A;  3PO5 A;  3KD1 E;  4BAC A;  3HJF A;  2IOC A;  2OPR A;  2O4I A;  1RBS A;  1RT1 A;  3KLI A;  2IGI A;  1TKD A;  1WSG A;  3NDK A;  2HHS A;  1NK7 A;  1A5W A;  1S1X A;  2OZS A;  3HPG A;  1RTD A;  4HUF A;  1RT7 A;  3DOL A;  4RW9 A;  3OYB A;  3RMD A;  1SUQ A;  4F3O A;  4F3T A;  1TAQ A;  3CFP A;  2YHA A;  4DFP A;  4W5O A;  1BQN A;  1WLJ A;  3G0Z A;  4NCB A;  2HHW A;  1HNV A;  1S5J A;  3NCI A;  1TAU A;  4CGH A;  2OZM A;  1SL0 A;  2DY4 A;  2XRI A;  4CEB A;  3NH1 A;  1FKO A;  4C8L A;  3SQ4 A;  4E89 A;  5CZ2 A;  3HM9 A;  1L3U A;  5I42 A;  2I5J A;  4DTS A;  3TAE A;  1S1U A;  3AVF A;  1HNI A;  3NFA A;  1HQU A;  1QSL A;  3ZT4 A;  4OJR A;  3V9W A;  4OLA A;  4O44 A;  4GVM A;  3S3O A;  1BQM A;  5T7B A;  3ZSX A;  1K6Y A;  1RTI A;  4LY7 A;  1JL1 A;  2P5G A;  3KK3 A;  2PZS A;  4FW1 A;  1Q9X A;  5J2Q A;  3KIO A;  1VSE A;  4IFV A;  3TAR A;  1RBT A;  3KLF A;  4CF2 A;  4N76 A;  3DM2 A;  2G8F A;  1EX4 A;  5SZT A;  1JXB A;  4Y1D A;  4DSF A;  3L3U A;  4FJM A;  3QLH A;  3CQ8 A;  3DMJ A;  4KHU A;  3V1O A;  1QE1 A;  3EY1 A;  3QIP A;  2FC0 A;  1LWF A;  2P1J A;  4OKK A;  1NK6 A;  3RR7 A;  4M3T A;  2YNH A;  4DWI A;  1XI1 A;  4JS4 A;  2DFH A;  4CJR A;  3OS2 A;  1BL3 A;  2P51 A;  4OPJ A;  1C0M A;  4DU4 A;  4Z4G A;  4CJF A;  4CJP A;  2YKM A;  4AHU A;  4C8N A;  4W5R A;  3PY8 A;  3C6U A;  3QIO A;  4KO0 A;  5I3U A;  3VQ6 A;  1KLN A;  2RKI A;  3V4I A;  4CE9 A;  2QK9 A;  1KFS A;  3MEG A;  4C8M A;  4CJU A;  3VQ7 A;  4YFU A;  4B9T A;  3NAE A;  4DQQ A;  4E3S A;  5J1E A;  4FLV A;  4FJH A;  1IG9 A;  1BCM A;  2WON A;  4NYF A;  4AH9 A;  4KKO A;  3I8D A;  3OJS A;  1NOY A;  2YHB A;  3VQ9 A;  4FLX A;  3QEW A;  3TAF A;  4GMJ B;  3DLG A;  2HVH A;  2XY7 A;  4KHQ A;  2IS3 A;  1S6Q A;  4CGD A;  3NGI A;  5HRP A;  2RPI A;  1T05 A;  4B8A B;  3KK1 A;  4CHZ A;  1FKP A;  4LSL A;  1LAV A;  1WSJ A;  3RMB A;  3CG7 A;  2A1R A;  3SJJ A;  3SPZ A;  4BDP A;  4F4K A;  3ZSW A;  4CJ3 A;  4CJK A;  1RDC A;  3HPH A;  4EZ6 A;  4FJ8 A;  2KZZ A;  4DTP A;  4CFD A;  5HRR A;  4PWD A;  1VK0 A;  3EYZ A;  4KTZ A;  1C1A A;  2RN2 A;  4DMN A;  1IH7 A;  4CEF A;  2R7Y A;  2JLE A;  1MU2 A;  1QTM A;  4CK2 A;  3S3M A;  4FW2 A;  3NF9 A;  1BGX T;  1L3T A;  1DTT A;  2EX3 A;  1X1P A;  3HPO A;  4FJ5 A;  3FFI A;  4PA1 A;  2X6S A;  3D45 A;  4E7H A;  2PYJ A;  3AVI A;  3EZ5 A;  1W9H A;  1Z25 A;  4UQG A;  3NF8 A;  5CY4 A;  3D0P A;  1VSM A;  4HHT A;  2DFF A;  4CJS A;  2D0B A;  2DTU A;  2Z1H A;  3AVK A;  1TGO A;  3LWM A;  2DFE A;  2HHV A;  1GOB A;  3AV9 A;  2VWJ A;  3SZ2 A;  3LAK A;  4IKF A;  3NF6 A;  1NKE A;  4CIE A;  4KRE A;  4CEQ A;  4ID1 A;  1WSF A;  4TSX A;  3SNN A;  1D9F A;  1X9M A;  3C94 A;  4MQ3 A;  1LV5 A;  3QEX A;  2FBY A;  3TI0 A;  1NJX A;  1VSI A;  5KRS A;  4R5P A;  3PO4 A;  4YNQ A;  1TKX A;  4FK0 A;  3QO9 A;  2ATQ A;  2G8K A;  3PX4 A;  2FBT A;  4CES A;  3DLK A;  1XHX A;  4CEC A;  4DF4 A;  3O4Q A;  4J2D A;  1FK9 A;  3VQP A;  1VSJ A;  3AVG A;  3PV8 A;  3RWU A;  1BI4 A;  4DSE A;  2KTQ A;  2O4G A;  1NKC A;  3BDP A;  4KTQ A;  4J2E A;  4O5B A;  3AVC A;  3O3H A;  3HT3 A;  1WAJ A;  3LP0 A;  3NH2 A;  4BDZ A;  2VG5 A;  4HUG A;  4E1M A;  1ZBL A;  3F9K A;  5KRT A;  4LD0 A;  1RBU A;  1N6Q A;  2HHX A;  2KQ2 A;  3QET A;  4FM1 A;  1WNS A;  4ZTJ A;  4IBN A;  3AVH A;  2YNF A;  4O0I A;  3HP6 A;  4CJT A;  2HMI A;  1VSF A;  1NK8 A;  1J54 A;  5KTQ A;  4KHY A;  4CHY A;  3SUO A;  4BWM A;  4JRQ A;  3DRS A;  5JS2 A;  4CGG A;  4B9V A;  4J2B A;  2G8W A;  3DOK A;  2BE2 A;  4B9L A;  1S1V A;  1RDA A;  4Z0U A;  3HVR A;  4E0D A;  4HVJ A;  3B6P A;  3I0R A;  3OYF A;  5EU7 A;  1KFD A;  3AVN A;  3O3G A;  5DK5 A;  4CEZ A;  1NJW A;  4ELU A;  3QEP A;  4FJN A;  1RNH A;  2HW3 A;  4FZX C;  3QEV A;  1UA0 A;  1RT2 A;  3SV4 A;  1HPZ A;  1WSE A;  4DTJ A;  1JL2 A;  2Z1I A;  3AA3 A;  4CJE A;  3SQ0 A;  3V6D A;  3VQD A;  4ELT A;  4FXD A;  1NJY A;  3L2U A;  3MXJ A;  4FJX A;  1CLQ A;  3SYZ A;  3G10 A;  1KTQ A;  1HJR A;  1RCH A;  4CGF A;  4CFB A;  1D9D A;  4QOZ B;  5D3G A;  3ZT0 A;  4CJQ A;  4RW8 A;  5FDL A;  4CED A;  3L2R A;  1SL1 A;  4OKJ A;  4FM0 A;  1W0H A;  1YTA A;  4FJK A;  4FK2 A;  3AVA A;  3RR8 A;  3T19 A;  4DTX A;  1YTU A;  1WSH A;  4HCB A;  1RDD A;  2YV0 X;  3OYJ A;  3AO1 A;  3PX0 A;  3HYF A;  3DLH A;  1HYS A;  1TKT A;  4W5N A;  1S9E A;  3DYA A;  2JGU A;  5KGX A;  4DTO A;  4DU1 A;  3SUN A;  4KV8 A;  2XY6 A;  1SKS A;  4C8K A;  4O55 A;  1XHZ A;  2E4L A;  3U6F A;  4KTW A;  2QXF A;  4N47 A;  3ZSO A;  3OS1 A;  3OYI A;  4W5T A;  3S9H A;  3IRX A;  1C1C A;  1Q9Y A;  4FLT A;  1EP4 A;  3RRH A;  1GOC A;  4CF1 A;  4NCA A;  4LSN A;  1QS4 A;  1C6V A;  1Q8I A;  3VN5 A;  4DLE A;  3OYN A;  2X6N A;  4H4O A;  1X9S A;  1S6P A;  3LZJ A;  4CGJ A;  4KB0 A;  4NYN A;  1ZBI A;  4BE0 A;  3ZSR A;  3RTV A;  1G15 A;  3KKS A;  3AO3 A;  5HRN A;  3PUF A;  4G1Q A;  4N41 A;  2VG7 A;  3AVJ A;  5E41 A;  3SUQ A;  2HB5 A;  5JS1 A;  4I2P A;  1IKV A;  3ULD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...