2VLAA

Crystal structure of restriction endonuclease bpuji recognition domain in complex with cognate dna
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
280
structure length
280
Chain Sequence
MNYNPEEQFRCTIIRGKAKNMLDNLLPAYANIIDDICPCDKASFVKDFNNRLIEILGEETTKKTLDNHRTEIAGKLFGMFYEDDEVIFPSGRTNKYIEDSDQPAFFKDICFKFQFPNGMDKLDKVIEKVGAKIQIRQFPYILQVLLTADNNNIQLSKDDIAYYVLNSLQVLQGKIKPIEVIEKIIEDRSNDITKKVRHPGKETSYSMQHIREQLNYLELANLIRIDGNLVKLNYREAENINYIAQFWGNKPEFNAYKYDFTSEDDKKSFFKDWQQYYSNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RESTRICTION ENDONUCLEASE R.BPUJI
publication title The Recognition Domain of the Bpuji Restriction Endonuclease in Complex with Cognate DNA at 1.3-A Resolution.
pubmed doi rcsb
source organism Bacillus pumilus
total genus 108
structure length 280
sequence length 280
ec nomenclature ec 3.1.21.4: Type II site-specific deoxyribonuclease.
pdb deposition date 2008-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11564 BpuJI_N Restriction endonuclease BpuJI - N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2080 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vlaA01
1.10.10.2090 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vlaA03
1.10.1740.180 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2vlaA02
5HNFA 5HLTA 2VLAA 5HNHA
chains in the Genus database with same CATH superfamily
2LOOA 3GCMA 1BOAA 2XKOA 2DA5A 2X4HA 4BDYA 2O5RA 2K9MA 2X1EA 2CYYA 2KL4A 4KIFA 1LEBA 2AQFA 2UZKA 3A01A 2XAGA 3KLNA 4EQQA 5LFAA 4V19K 2LYCA 2NVYJ 1SD6A 3CZLA 1J75A 2B61A 3FUKA 1HCRA 5BPDA 1XPXA 3CD6I 4J19A 3HSEA 1YJ9I 1TC3C 2DOEA 4W1UA 1Y8RB 2STTA 2HQNA 3G4SI 4BBSJ 5FRNA 4R79A 4XN3A 1WJDA 3N4MA 2GXGA 4WCGA 4XMWA 4WF2A 3HOUJ 3H5NA 1TWFJ 3LA7A 2ZSIB 2E1MC 1BI1A 4A2UA 1IRXA 4RAZA 2HS5A 5DTDA 2L4AA 3U21A 1SFUA 2PGGA 1YRNA 3HSRA 1WGXA 5H6RA 3CC4I 1DU0A 4ZQTA 1KQ0A 3H36A 1ETYA 3KIOA 1H88C 3M1CA 1IF1A 1DP3A 1Q0LA 5H6QA 3WTXC 4LK1F 1TWAJ 3VFZA 2A69F 4UUSB 4L0ZB 2DODA 3CTAA 5GTHC 3S93A 1IRFA 2LTPA 5L3EA 1K83J 1N25A 4CCLA 4DBRA 2E5ZA 2CRGA 2YR2A 2OAZA 2A6TA 3DU6A 3KP2A 3LSKA 1U8BA 5BPIA 3ZMDA 2M34A 3SJMA 3PJRA 2QA4I 2QQ9A 1YI2I 3MZHA 5E20A 3ZMTA 2IS4A 3F22A 4GCVA 1HKTA 2VONA 2M3AA 3H0GJ 3CJTB 1QVTA 3F23A 1SC5A 2Y69H 4K5MA 2NS0A 3RZDJ 3IAM2 3JSZA 2X6WA 3MZYA 4ESFA 1XGSA 1FY7A 2IS6A 1D1CA 1MBJA 1LDDA 1WJCA 1U5TC 1PJRA 5J6XA 2XAJA 3HRUA 5FJ8J 3V8JA 3GTPJ 1H9GA 2O8XA 2VKEA 4OIPF 3S1QJ 2H09A 2MW8A 1FOXA 2LKSA 4EJUA 4XRFA 5DUIA 2BVMA 3FHZA 1VQKI 4ENJA 1FEXA 4NBQA 1O3SA 1YITI 2HOEA 5IPAA 2V79A 5CLSA 2KJBA 5LEKA 1G8XA 4Q48A 1YHQI 3O8GA 2RN7A 4PJMA 4BXFA 3FU3A 3SZPA 3CCMI 3NRVA 2KP6A 2XGEA 1Z7LA 1FYKA 3IHUA 4LLLA 2NNNA 1YRNB 1HBXG 2JZYA 5BNGA 3FU6A 3SXYA 5F1RA 3Q9VA 1LKXA 2M45A 4LOCA 3B34A 2OTLI 2DQMA 3FUJA 2WPGA 2FX0A 4CZCA 2DA2A 4CO8A 4D9JA 2F4OB 2R7SA 2WB1N 2I5UA 1JE8A 2F4IA 4I0AA 4KISA 2DMQA 4GAAA 3DLLF 4LB5A 1DPUA 1H3LA 1ZELA 2DLLA 2NVTJ 1BIBA 1Q0HA 3QJXA 2R5ZB 2K85A 1F5TA 4BNCA 2IA2A 3CZGA 3AU9A 4AC0A 1HW5A 2OQGA 4KIGA 4KN7X 4ENMA 4PUSA 3RYRA 1G3YA 2B63J 4BEHA 1T1SA 3VVMA 2M87A 4B48A 3H9GA 1P9QC 2KIMA 1T39A 3G71I 1X3ZA 2LY1A 3IKTA 2RV8A 4M74A 3WG9A 4Y15A 4BQQA 3ONQA 1ETKA 4DNCA 4B09A 3F6VA 4BJTA 1OMIA 4E7JA 1ZK8A 5IP6A 2JTVA 4G6TB 5FFZA 3QODA 2QQBA 3FK7A 4Y17A 1ULYA 3VDXA 4E4HA 5E8IA 2UWMA 1ZKGA 3ZQ7A 4EATA 3J7YJ 3K4KA 1F36A 3DTEA 3RKYA 4OINF 4LITA 2DA4A 3C2BA 2JK3A 5GAHJ 2BY1A 1JG9A 2BYVE 1MW0A 4BE2A 5D5XB 3LAPA 1V5GA 1X3WA 4HDVA 2YUSA 3E6CC 2QKLB 1B59A 1LDKB 4N0BA 5E1WA 2A07F 1H9TA 4O3MA 5EV7A 4XNAA 4MTEA 3CQZJ 3CP8A 1Z6TA 2M4GA 2IGMA 3A02A 4CYDA 1J09A 2G7UA 2OZUA 1OCCH 4KMUX 4B3AA 3MFKA 1J2XA 1ITYA 1W1WE 2H6CA 4ZX4A 4BEHB 3PFYA 2FMLA 2K7LA 4D7MA 2XRNA 2L7ZA 3OSFA 4IHWA 1ZLKA 1U0JA 5IT3A 4XNDA 5EDNA 2AHQA 3ZR8X 2OA4A 3IH4A 3I54A 4X2UA 1R71A 5FLXZ 2TCTA 3SDBA 4A0XA 2FOWA 4BJ6C 4JNDA 1BR4A 2Y1CA 5F0HA 4B1RA 4AUXA 2L9RA 2ZMEB 2W7NA 1WJEA 2DYSH 1JGIA 3U2RA 3V42A 3FXLA 3FDYA 2CQKA 1XTAA 3HDDA 1P6RA 2BVLA 1W5TA 1SAUA 1LQ1A 3CXBA 4RSYA 3J7AO 4ZQGA 3ZHXA 1G6NA 4RGUA 3VWBA 3BJAA 3E0JB 4DJAA 3H92A 3GZ6A 2R93J 2EILH 2L7FP 2DFFA 3ZHZA 1BJAA 4RGXA 1A31A 2CW8A 3L2WA 2BXYA 3WHBA 4XLNF 1OCPA 2LRDA 1X3WB 2LNBA 1KZHA 3MKLA 3OYJA 2DA6A 1MDMA 2HDDA 3AG4H 1IRZA 2ZO4A 4RLFA 4EGYA 5TGTA 3D5LA 1A36A 5DCMB 5J8FA 1EH8A 2Y75A 3J81Z 1GHCA 1GXQA 4FX4A 3B6AA 2E36A 2IP2A 2OTJI 2L3DA 2Z5UA 2XSJC 2WY7Q 1F4KA 4KICA 2VODA 2R0QC 5FLXK 2VKHA 1QZEA 2XHKA 3WQSB 5KVRA 2PLYA 3PQKA 4ZTJA 5FD6A 2GTQA 4FE4A 4E7SA 2HXIA 4FE7A 2JA5J 3QYBA 4M9ZA 4V2FA 2F5EA 4FCYA 4HX8A 1S8NA 2IBDA 1J0RA 3RKXA 2QQAA 3MN2A 3ZI0A 4UV8A 3WTWC 1WI3A 2RNGA 3A03A 4HF1A 2UXNA 4RAYA 2DTRA 3DP7A 3F72A 3WTVC 4MEXF 1LUJB 2WY8Q 1MMAA 2GIVA 4BL0B 4IHSA 5CVIA 4UVAA 3GW2A 4AWXB 1H8AC 4M3GA 2L02A 3EDPA 1HDDC 2FE3A 3GWZA 1Y39A 3EUHC 4M6XA 1RKTA 5TJJA 2Y31A 4RA2A 3DTKA 4AYBN 1REPC 3ZGKA 4BUPA 4XSXF 5E3NA 4ZQHA 3M9AA 4OIOF 2DI3A 1WCMJ 1ZAOA 4F55A 5LHGA 3FH5A 3CZKA 3ZOBA 4CCJA 1MDMB 1D0YA 4KITB 2W48A 2CQXA 3MWMA 1T38A 1WSUA 4RB0A 4H4KC 5J8CA 3J81K 3OYCA 2ISZA 4GDFA 4XLCA 3ZQHA 4QTRA 1D1BA 1TQIA 3I59A 3LA2A 1U9NA 2LP0A 1HDPA 1I27A 2FUG2 2F5CA 4JX5A 1YX3A 2W84A 4M3DA 3VYUB 1MSEC 3M4OJ 2Y9YA 3I3LA 5L3CA 1S6LA 1WQ2A 1B9NA 2RQPA 1BW6A 1QHGA 3C2HA 1HF0A 1MNEA 2E1CA 1GXPA 3ZMSA 2IA0A 4G94A 1QQIA 3FTYA 1IN6A 1D5YA 4LD5A 3HOXJ 2V1UA 1R7JA 1ZG3A 4CDGA 1HW2A 2KRHA 2HPTA 2E2HJ 1UELB 2XF6A 4LG0B 2NOGA 2CQNA 2QJ1A 1H89C 3X2QH 3KP3A 3A06A 1MIJA 2CUFA 3MEXA 3FTUA 4XN5A 4ABZA 2CUEA 1T8IA 2A05A 3CMYA 2E19A 4PVBA 2PQ8A 3DCFA 4ON0A 4CZZA 1Z05A 2XUBA 3BZCA 1S72I 2FFLA 1QZYA 3G6EI 3EQLF 3AG2H 3DQVC 1VQ6I 4NQWA 3B7SA 1MVYA 4UUVA 3B2XA 3IIEA 3DBLB 5LHHA 1SFXA 5TRDA 2X1DA 2X51A 2XASA 5HS8A 3KZIC 2K3PA 2GQQA 3FTZA 4F91B 2W24A 1W5SA 3HGYA 1XSXA 5M5YJ 3O3KA 1PUFA 1HKQA 2OD5A 4MGRA 3A2KA 2FBKA 1P4WA 2ZJ2A 3JW4A 5ICGA 3W6JB 2ZXGA 1VQ4I 1WH5A 5EG0A 3E6DA 1BR1A 3D5RC 5DCFA 5CJ9A 3QOPA 1PP7U 1X3UA 1D3YA 4XMZA 2FRHA 1YG2A 2QKMB 2CQ7A 5JVGF 3IWZA 3CO7C 3HOTA 4PGHA 4Y7NJ 2E1NA 5BPPA 4NDLA 4XKBA 2HNHA 3WTUC 3K2AA 2DXIA 4Q5SF 3HC7A 4ZW7A 3M8EA 2JA8J 3V7SA 2L7KA 5BS6A 2M0CA 4A6DA 2Z2SB 1R0LA 2XKPA 4ZX5A 2EFQA 1QA6A 1L0OC 2RVCA 2HOSA 4ZH4F 5LLQA 3HKZA 3I5UA 1FT9A 1IN8A 3R0JA 5DEQA 3E7LA 3AG1H 2DA7A 4KUMA 5ICFA 4KIBA 4OOIA 3GZNB 2Z1DA 2M1BA 2K9SA 3BG9A 4ZDLA 4OIQF 3S8PA 3I0TA 4FLQA 5B1AH 1A5JA 2Z99A 3E1SA 2D2WA 1U78A 3CCEI 2JQ7A 1YS6A 2NRAC 1KYZA 1YLFA 5ILVA 2J5OA 1XGNA 5IOZA 4RGSA 2M7BA 1GW6A 3TL4X 4LLNA 1TP4A 2VJJA 3CF2A 4MNUA 3TP0A 1HLVA 2RJIA 1FYLA 1ORKA 2MH2A 3WQRA 5J1RA 3NARA 1MMSA 1IXCA 1Z6RA 4PZJA 3KP6A 4C30A 2LK2A 4U0VA 3FTWA 4OU0A 3IAS2 2A3SA 1YW9A 1PUFB 1R5ID 4ZW5A 3KX2A 1MMNA 2KISA 4AIKA 3HZJA 4UB8C 5E1ZB 4MTDA 2HOTA 1RI7A 4W97A 2YSRA 3Q0UA 5EG0B 2HVRA 2WADA 1F1ZA 1JT0A 2JCYA 2CQQA 5KK1A 1FSHA 1WJAA 4CH7A 3RCOA 2Z3YA 4MFDA 4UY8I 2EGHA 4P1WA 3ZQFA 2A6HF 3H9QA 3TMOA 4FHTA 2JSPA 2WC2A 4UVBA 4CSWA 2ELHA 5EYRA 2X6OA 4ARFA 1HQCA 1IC8A 1T98A 2EV0A 2EZIA 2MGQA 3GYHX 2ZSHB 3EUAA 2ZB9A 4QSHA 2LY9A 5F0CA 2CSOA 3BCAA 4XRMA 2DPUA 3ML6A 5LBQA 3K6GA 2L9VA 2X85A 1S7EA 4PSXA 1OISA 4PJ0C 4EVIA 1A04A 1P2FA 3P9CA 2Y0MA 3GTQJ 4R5VA 2QSGX 1KU9A 5IOYA 1GLNA 4L9JA 3K69A 1FJLA 2MA3A 1VQPI 2JA6J 4BS9A 2EH3A 3HM5A 2ZKZA 1EF4A 1PDNC 1XDSA 5EGOA 1YW8A 2KIUA 2HFHA 2EZKA 1Z7UA 2EK5A 2GAUA 2EINH 2Y1GA 1JJ6C 4IEJA 5GADJ 4RCVA 1I6HJ 1SC7A 3LSHA 3B73A 3C7JA 5LEJA 3CMEI 1N78A 2DU9A 3BP8A 4D5CA 4RGRA 3IV5A 4ZDPA 2L01A 2WTEA 5AONA 2XPVA 3CCRI 4EM2A 1RUOA 4I2OA 1D8JA 5FKKA 1JI8A 5F0FA 4L2LA 4KMFA 2HU9A 2JJ7A 1ZYRF 1SFKA 3QPHA 2GWRA 4EV0A 4F52A 2LR8A 5HLTA 2LMDA 2UUZA 1AWCA 4ZW3A 4HA8A 3WU2C 5H2FC 3OL4A 1AU7A 2MH9A 5HDNA 2XIGA 3ZQCA 1GVJA 3ABLH 4RM3A 4HEA2 1VQ5I 2FXAA 1AKHA 1JHHA 1T08B 2Y9ZA 1TZLA 1IGNA 2CU7A 1JUMA 3JTHA 4WXHA 1ZH5A 3EBIA 1V55H 5HODA 2ID6A 4I6ZA 4HV6A 3LFKA 2ZXIA 4CYCB 2DOAA 3L09A 3JAMZ 3J80Z 3N97A 3K9TA 4M9XA 2K27A 3KYCB 4HSTA 4S0HB 2E1MB 2P5LC 3CO6C 3CMAI 1KGSA 3P5JA 3CCLI 5ED4A 1BJZA 3MMYB 3IL2A 4FISA 2AS5F 5E17F 1B8IB 2RQQA 1YO5C 2IS2A 3LSGA 2AQEA 1EJ9A 2CUZA 3CJQB 4BQNA 1VZ0A 2ME6A 3B7UX 2E7WA 3BR5A 3VOEA 3ZXSA 2NOJB 3A1YA 4RAFA 1H19A 2PJPA 3KEYA 4DW6A 3I55I 3CHPA 3REOA 2ETHA 2P5KA 2VOOA 3TEDA 2LFBA 3LQRA 2O03A 1IRGA 2GM4A 2DDBA 2X1CA 4MFEA 1RUNA 2JD2A 1WZ2A 2G0EA 1UCRA 3DPLC 2LBFB 4BJ5C 2R92J 4JYKA 3A14A 3G1OA 1TW2A 5F04A 3FM3A 3HOSA 1U5TB 1K79A 4YFKF 4BE1A 4IOCF 4BAYA 1SEUA 2R70A 2MD5A 1BW5A 5GAGJ 3E5QA 3GZ5A 2ZJRF 2HQRA 2PBIA 3KE2A 2DAOA 5CVVA 2EFOA 5JHFA 3DEWA 3RPQA 3GTLJ 5AIPA 4BH9A 3JAMK 3J80K 2VC1A 1SFEA 2ZJQF 3S32A 3CP2A 3ISPA 2EIMH 5D4RA 4Z2YA 5J47A 1NG7A 4BHCA 3L2CA 5GAEJ 1W4MA 4BU2A 5CVRA 3DPTA 1IXRC 1XC5A 2Y0SN 2HQ5A 3P9IA 4IPAA 3LL7A 5D6EA 3IKVA 4EMSA 2DMTA 4JBAA 1EA3A 5JHUA 5EEAA 1UAAA 5FRMA 1MKMA 3FTVA 5F27A 3BT9A 3CMMA 1VNDA 3WGHA 4XLAA 3CCJI 3BPVA 3KP4A 2O8KA 1YW7A 4L9NA 4XN0A 2JWTA 1R1TA 3PIOF 2KZVA 3BG3A 2FNAA 2FOKA 1VQ8I 3CUQA 3VPRA 1NH3A 2BW3B 5J4YA 1LE8A 3DBRB 2DQRA 3LSJA 2ISYA 3R4KA 2ZNZA 4DOZA 2QSFX 3PQJA 2JA7J 1BR2A 2FBIA 2TRTA 2JMWA 2PMZA 3ZMZA 1O7FA 2NXNB 3BPXA 1X4PA 1GUUA 2BHZA 2QM3A 1W7PA 1G3WA 2L2OA 4X1EA 2Z16A 3OV8A 5CQEA 1DGWY 2V9KA 3H5RA 1Y0UA 3S1MJ 2E1OA 3BTIA 1R1VA 4B47A 2UXXA 3SZGA 3HTUA 2VBWA 2WAQN 3A01B 3K7AJ 2K9NA 1XSDA 2BY2A 3O8HA 3K10A 4A3EJ 1MSFC 3LSMA 4B43A 2ACJA 3DLAA 3JRFA 5C4XJ 1XGOA 2KMUA 2DFHA 4A6EA 2PJRA 1WKMA 1B4AA 4U88A 1BN5A 3SYTA 2AO9A 2ZXWH 3AAFA 3OIOA 2IJLA 4AYSA 4KN4X 4XORA 3K70C 3SFIA 2VT3A 2W4SA 3Q5FA 2R72A 1HW1A 2P4WA 3MZ8A 3QRFF 4UUTA 4Q4IA 2QEXI 4CUGA 3S3MA 4HF0A 4EGZA 4D7NA 3E6BA 3OYIA 2XGXA 3F8MA 2EIKH 4K5NA 5HLIA 5HLGA 1ETOA 2JRTA 3PFIA 5ICCA 1YFHA 1LE8B 3OS0A 3OYGA 2R7FA 1KONA 4F7ZA 5JC1A 4Y6SA 3OS1A 5FFXA 1F43A 1G3SA 2R7RA 2K86A 1M1EB 1O4XA 2M0MA 2PN6A 4L5EA 2Q8KA 4CXFA 2VE9A 3HHHA 4BDZA 3HTSB 4KYWA 3HW2A 1JVSA 2ADUA 1W36D 1LVAA 3Q3SA 3FHEA 3GMEA 2IRFG 3K4JA 4PK4A 1IUYA 3HRSA 1I3AA 3BTJA 4Z6YA 3RZOJ 4YELA 2E2IJ 1ZRFA 4M6YA 5TISC 1MBGA 1RETA 1OCZH 2O9LA 2QVWA 1RNLA 4LLGF 4P55A 1YQAA 3GTMJ 1OCOH 3HHGA 3KEQA 1JUPA 4WXCA 1TNSA 1YE9A 5K7FA 2R3SA 1VQMI 4HV5A 1OCRH 3EBGA 3PNVA 4YRVA 3SEZA 5JBIA 4GXOA 4IHTA 2V1XA 3SHFA 2ZFUA 2L0KA 3CLOA 3EUHA 4A0YA 1XD7A 3DF8A 1X1PA 1XMKA 2KT0A 3GUDA 3FUIA 5C4JJ 4ZZLA 2XF5A 4E70A 4Y13A 1T6SA 3IP4B 2X6YA 3HUGA 3R61A 2RDPA 4ZC3A 5K1YA 4JP0A 3NAUA 3JSOA 3BG7A 3I4MJ 2HVQA 2X0LA 1ETVA 2XAQA 5JO0A 4ASNA 1VQOI 2XGCA 4RB2C 4NC7A 3TBIA 3QPTA 1IXSB 3LMMA 3GXOA 3CUQC 3DKXA 1DUXC 1I50J 4KNYA 1EH7A 1EKEA 3IRQA 2VC0A 5IT9Z 1R49A 2KZGA 3Q44A 4RLQA 3V7CA 2M7AA 3VODA 3H35A 1QBJA 1BIAA 4QUOA 3GBGA 4KT6A 1I39A 2A68F 2EBIA 1X3ZB 3HEFA 1R36A 3JRCA 3HB9A 5HVQC 1OFCX 2HTSA 1STZA 3EYYA 2FU4A 3OOPA 4MLOA 1XDUA 3Q0WA 5HS7A 1F9NA 3WHCA 1VI0A 1LDJA 3ZN0A 1DPRA 1YYVA 2XRLA 1TNTA 1V54H 2LKPA 1U6GA 2BZTA 3W2AA 4GYGA 2A7OA 2LLKA 2NS8A 1Z67A 2ECBA 4YIFA 3ZQLA 2OV7A 1K78A 5HDGA 4MQ9F 3FXMA 1H0MA 2EWNA 1FP1D 1N77A 1LB2A 4XLHA 2GA2A 2R4GA 1MJAA 1QO0D 1ZTRA 4XKCA 3GX4X 3FTSA 2EA2A 2E34A 5FLMJ 3ABMH 2HR3A 2L5QA 4ESJA 2OU2A 1R22A 4D5FA 2JCVA 1FYMA 2QCOA 1TL8A 2ZC2A 2Y1EA 4J01A 1FTZA 2F48A 3JREA 1QVUA 3E3VA 2DK8A 5IT9K 4IF4A 4QPEA 3BG5A 3T8VA 3S1RJ 1FMWA 2QENA 2CFXA 4V2GA 2CS3A 2ZJPF 1Y56A 1HSJA 1OQYA 2JSCA 4AVZA 3KEDA 3HOZJ 2R7XA 4LUPA 4HX7A 5D6FA 3AL0C 4P5OA 4IVNA 1FZPB 3JCUC 1MH3A 3M8JA 3OR2C 1MMGA 3CHQA 4XN4A 3OSGA 2E7XA 1XCBA 1B72A 4HBLA 5FROA 1L3LA 4RBOA 5KNLA 4MO7A 2EFNA 3QU6A 4JOMA 2W82A 3W2VA 4D0PA 1V5EA 3JR9A 1P4AA 4G6QA 3V8LA 3ZQQA 3CJNA 1E0EA 4HLYA 3BJOA 1ETQA 5C44J 3RDIA 5E8GA 4FQGA 2XB5A 5IP9J 2Y1FA 4C2MJ 2B9SA 4AIJA 3CESA 4HZFA 1I6XA 4EM0B 4Q4EA 3RPUD 4A93J 1JGGA 4CICA 2MAPA 4A5MA 5D8LB 1RR7A 1Z3XA 2HYFA 2KIFA 2IXSA 3DTIA 4P9FA 4XR6A 4A3GJ 3F8CA 4KJZA 5LGNA 1BC8C 1S7OA 4RB3C 2XQ0A 1TQPA 3PUFA 3D1NI 2EZLA 4C2UA 2DJIA 1R9TJ 1E3HA 4GRIA 3OR1C 2NVQJ 2F2EA 2VBZA 2BEOA 5C3EJ 4M3EA 2DDAA 5B3SH 1ZRCA 2DFEA 2VPRA 2DW4A 4XMXA 2KQRA 2V9PA 2IS1A 4YFXF 2GXAA 4I98B 2XB0X 3F3XA 2P6SA 4ITVA 3S15J 2VL8A 4R5XA 3LWFA 2BE5F 2V9VA 3LQQA 1MNMC 4XO4A 1CQTA 1ZREA 5L3FA 2EJRA 2YX7A 4MIMA 1LEAA 2HGCA 4FT8A 4WK8F 3CDHA 3G73A 3AG3H 4G7OF 1OLTA 3FHNA 5DDGA 2B7EA 1WRJA 4EJTA 4AR9A 1HOMA 4IQJA 4X6AJ 1RC9A 1XGMA 2E5NA 2ME0A 2EFWA 1XMAA 4HNUA 1Z21A 2F4MB 4BY7J 1YX5A 1NK2P 4O6JA 4YFNF 3D5SC 5L3BA 3JRDA 1A35A 4B44A 2PMUA 4YIRX 1A6QA 3FUMA 1W7PD 3WGIA 4ZYEA 2A61A 3MAJA 1VQ7I 4DYQA 1PYVA 4XONA 2C6YA 2GLOA 1KYWA 4I99C 3C1DA 5L3DA 4FLSA 2XROA 4KP7A 2XSDC 2HKXA 2V26A 3FMQA 4A69C 1G59A 1R4MB 4IJAA 3I71A 2AXLA 4E7ZA 4D1QA 1MH4A 3OYKA 4A3JJ 4XN8A 4QLCU 1WHUA 2KPMA 4ESBA 4E7IA 1I3QJ 3FZVA 2ESNA 3F8FA 1JT6A 4MQVA 4HLXA 3OYHA 2KDOA 4KDPA 1MW7A 2BV6A 4L9VA 2VB6A 3CCUI 4ZYDA 4I09A 3I59B 4U7DA 2ELJA 4IOAF 4HSRA 2H6BA 3RQIA 1MZBA 4ZQEA 3PSFA 3MQ0A 1R5GA 1WFXA 2VJ4A 3FBIB 3OMYA 2QBYA 1DQUA 2VUMJ 2HI3A 4DIQA 1YS7A 3CHRA 2CH0A 3K4NA 2L4MA 3DKWA 3BQYA 4OMZA 4I0BA 4P96A 2IVMA 4C3JJ 1OYIA 2VBXA 4NB5A 3GTGJ 1ERDA 2LVSA 5J1UA 4CCOA 3ZRGA 3RJPA 3M3YJ 4EJVA 2J5PA 4IHVA 3CCQI 3CCVI 2CW7A 5IYBJ 1ZARA 1WH7A 1ENHA 4IXAA 2M4KA 4QWQA 1PVEA 1YJNI 1HS6A 1QZZA 3HOWJ 3I58A 1Q1VA 1TTYA 3HRTA 3BTLA 1FOWA 5IYCJ 4JX6A 1JJ8C 1Y1WJ 1N75A 1Z77A 3OWTA 5DS9A 4OAZA 3TO9A 2W85A 3GTKJ 1KQ9A 3C18A 4KT5C 4NQWB 3RYPA 3L2UA 2BXZA 5JLWA 5K5OA 5AENA 1RKWA 1R5HA 3V4GA 2MBFA 2RC4A 3H3ZA 3DFGA 2MYSA 4IO9F 3B7TA 3W3CA 2B0LA 3KFWX 3OOUA 4Y52J 1X1BA 1YIOA 2HYJA 3W2WA 3QP5A 1ZR4A 3HXLA 3QQAA 3RC8A 2HWVA 2YPRA 4XL9A 4XKWA 5B5EC 2FMYA 4BBRJ 3SZTA 2CV1A 1BA5A 4LGWA 2EIJH 3ZQGA 1OCTC 4IKFA 2I10A 2MG4A 1AOYA 2O61A 2NS7A 4NC6A 2R7WA 4UVCA 2VT2A 4PFPA 3GLXA 2EV6A 4QPOA 1AA7A 5CQGA 4HW0A 4AICA 2D1HA 2EQRA 4LIVA 4ZX6A 4BGDA 4Y4RA 3EUKL 3HPHA 3I9V2 1VQNI 3H3VK 3G1MA 3FU5A 4WXDA 3RTRA 5EF6A 2DN0A 5FKMA 4PJJA 3ABTA 3DEUA 3HPGA 2WWYA 3CZEA 3ASNH 1ETWA 1E3PA 4C2TA 1SQMA 3KP7A 4MEYF 4RB1A 4PW4A 3CDLA 3M07A 3I56I 2KRCA 4C3HJ 4CCNA 2UV1A 1UMQA 2P6TA 1ZQ3P 1DGRM 1MJ9A 2L7MP 5ERIA 1YJWI 1T1RA 3ANLA 2M30A 2GOMA 3F8BA 4M73A 3R0AA 4HOBA 2YU9J 3Q43A 3F9KA 3OYDA 1FX7A 2M5WA 4G6DA 2MD0A 4YIIA 5F08A 1LPQA 1ZLJA 4XO5A 2XAFA 4MKTA 3LNQA 4R7LA 2AXTC 4K5OA 2NVXJ 3FXOA 2FNPA 3B3BA 3BTCA 2WAFA 1YIJI 4BXUA 1FWZA 3AFHA 1X19A 2DT6A 4RAGA 2JT1A 3BR0A 3DU5A 1NHAA 3ULQB 1Y1VJ 5L3GA 5D5UB 2EPFA 4LB6B 1JKQC 2EFPA 2YS9A 1IN4A 5K7HA 3CHSA 3KZZA 2JA2A 5JVTA 2LDUA 1OKRA 1IO2A 4AR8A 1JKRC 3UERA 3B37A 2RGVA 2VQGA 3CC2I 2NVUB 3BC8A 1MGTA 1UJ8A 4I02A 2VN2A 3P9KA 3BY6A 3ROUA 5JR3A 2K40A 1V4RA 5E3MA 3V7RA 3JRGA 4OWRB 1IG7A 3GFJA 2OF7A 2WZFA 4QIWN 4EJOA 2K3FA 4FLOA 3S16J 2JVGA 2VBYA 2EA4A 3H0DA 1RPWA 3RKWA 4IHXA 2XVCA 4AR1A 3CDIA 3DPUA 1LJ9A 1XS9A 3F21A 2DPDA 2VJ8A 4U7BA 1JUSA 4P9UA 2BHYA 3AKZA 2OC6A 4M6VA 3FM5A 4J00A 3S2WA 3KZYA 3TOAA 2E35A 3ZMUA 4XMVA 5EGOB 3ANMA 4OMYA 2QF7A 2GIZA 2BY0A 3ZPLA 5DM6F 1ONOA 5CYVA 1FP2A 1ZGJA 2R7OA 2HOAA 4DGWB 5IY5H 1O3RA 3VYSB 3I4PA 1BC7C 2FJ1A 1U2WA 4XOTA 1WJFA 1FSEA 4M72A 1NG6A 2MC4A 4LMYA 4ZYGA 2CJJA 3QOEA 2H94A 2LH9A 1T0FA 3QWLA 3LSIA 4DYCA 3IRRA 3VB2A 1HXDA 1XX5A 3RC3A 5E18F 3CCSI 5BQTA 1S7AA 5EZHA 3LOCA 3HGGA 1P92A 1RP3A 1SD4A 3NWSA 1Q1HA 4A3BJ 3MKYB 2WA0A 2CGPA 4L18B 2WV1A 4QIRA 4UUSA 1I1SA 1AKHB 4IRIA 1C0WA 4R5TA 3OS2A 2RREA 3OYLA 2RNJA 4FLRA 1HSTA 1ONNA 1VTNC 3CHOA 3FKJA 1Z0XA 1SG7A 2P8TA 2CMPA 3BROA 3C3WA 5E79C 2WBMA 3GFIA 3L2VA 2N8GA 2MSYA 2X48A 2ZNYA 4CCKA 4JX4A 1OPCA 3SQNA 4XLEA 3UKGA 2D45A 1LFUP 3UR3C 1IN5A 1DP7P 2KFDA 3U1DA 3HBLA 4BY1J 1U3EM 2WB1A 4XRSA 1Z9CA 3CZ6A 5ILSA 2ZXHA 1J5YA 5AIQA 1G4DA 4YG2F 1OJLA 4XK4A 2W00A 3OIPA 4L0YB 2DK5A 1K6YA 4NNJA 1ZR2A 2VE8A 3J7AY 4AIHA 2C5ZA 5JMWA 2DMNA 4LK0F 1S29A 4FTHA 3K2ZA 1S46A 2Q0OA 3H1CA 2JV7A 3G3ZA 2IGOA 4UNOA 1ZGWA 3Q0VA 3SEQA 2H1LA 2IPQX 2BGCA 3V8KA 4G12A 3VSLA 1U8RA 2CUJA 5F6FA 1FBSA 1TLHB 2VOPA 4MHGA 2R7QA 3FUHA 3ESWB 2OCCH 4ZYAA 5J4VA 3ERED 2M8GX 3PO3J 4OOFA 2IAIA 2OCEA 2IGKA 1X2MA 3NEUA 1G3TA 3K0LA 4F92B 2R5ZA 1APLC 1P7JA 1K4TA 3R60A 3T8RA 1MBHA 2YU3A 2NNYA 4EEFG 2Q2EA 1BI3A 1FNNA 4ZYHA 3F0CA 3H5AA 4HRIA 4RVBA 3IWFA 3IUOA 2KRFA 3FUFA 4NC8A 2R5YA 4XN1A 2VI6A 3E5UA 2G9WA 3RI4A 1MW2A 3S14J 1JGSA 3SFZA 1SFOJ 2ZXJA 1ACIA 4CA0A 4G7ZF 4ZTFA 1Y0NA 4FX0A 1FOYA 4BHPA 4DQ2A 3OYEA 3KYLA 3H3UA 2HZDA 5DM7F 2LF8A 3ZQIA 1IV8A 3FH7A 4ETSA 3ABKH 4H0EA 1EV7A 5BMZA 3FK6A 1OR7A 1OYYA 1UG2A 3QU3A 2DQLA 2D5VA 1ZRDA 3BR2A 3KPHA 3CUQB 2HKOA 2V6CA 5FKLA 3WTSC 2Y30A 2O3FA 3KCCA 2O7OA 3KYDB 4AU7A 4A3KJ 3JRAA 2GOXB 3AU8A 1U9OA 2L9NA 2VXZA 3BOQA 4DYRA 5HNHA 2DBBA 2XC7A 5JMPA 3CJRB 2KHMA 3ECHA 5DD8A 1O3TA 2D1VA 4XMYA 2O0YA 2P0WA 3K1NA 1T0FC 1W7PB 2F5VA 4GO1A 2XPYA 1RESA 3RSNA 2ESHA 4XRSG 3PNTA 4S05A 2K5CA 3TO6A 1G5AA 3WTYC 3UEQA 3WTZA 5LRRA 4XN2A 2DTZA 3ZHYA 4IL6C 4K2EA 3VSKA 1ZHFA 4LJZF 3ELKA 1TWCJ 1CGPA 2H27A 5HNFA 1USSA 3HG9A 2PJRB 2XAHA 1X1DA 2HZTA 2LF7A 3DBHB 4BHBA 4BQOA 3FU0A 2Q2EB 5B1BH 2V4JC 1ODDA 2R7VA 5HLHA 2V7FA 4OAYA 2R5YB 3WU0A 3AUAA 1O57A 2MLKA 2PMZN 2HPOA 4WX9A 4F93B 3FXJA 4K5LA 2PL5A 3T8TA 1ON2A 4ENKA 4FASD 2CG4A 1R1UA 2DT7B 4II2A 3KETA 1QRYA 2MAOA 1MMDA 1GDTA 2DFIA 3UNGC 3G2BA 2K4JA 2CW0F 3JTGA 3QP6A 1GV5A 2ZMEA 1PP8F 1WJBA 3M1EA 2I8DA 4DZPA 3R0IA 3I64A 2JN6A 3B2PA 1JXSA 3B6CA 1KA8A 1D0XA 2JPBA 2Z33A 1X1CA 3GFLA 5KAIC 2E60A 3BDDA 1LNWA 3S2HJ 2R7TA 1R0KA 1S9HA 2A5WA 2VKDA 3AL0B 5DLLA 2FQ4A 4RS8A 1UHMA 3N05A 5CVUA 2PX9A 3T0YA 4K5PA 1LFPA 3DWLE 3K1MA 1T33A 1V3FA 3FUDA 3PSIA 3PUUA 2Y2ZA 5JNLA 5DV5A 9ANTA 3E97A 2OUMA 1MNDA 2VQCA 1FBUA 2F5DA 2O7GA 4ZW8A 1MBEA 3OY9A 2VQLA 5M3MJ 2PI0A 4DBQA 4BXXJ 1FMVA 2XPZA 2OJED 3K4MA 3SDGA 2QSHX 1W5CC 3JT1A 4L9TA 4LFUA 5DCMA 3TGNA 2WV0A 4GFBA 1TT0A 5KAFC 5FD5A 1SVMA 2HPIA 3TKYA 4UV9A 1Y6IA 3ANNA 3OL3A 2HVSA 1T95A 1ZGAA 1SMTA 2QQ8A 4U0WA 2CWEA 4AYBA 2P81A 1FOKA 3BWGA 5D5VB 3VVLA 1DU6A 6PAXA 3S17J 4ZZDA 5ILUA 2WZGA 1D1AA 4U0YA 2H1KA 5LGTA 1KU2A 3JRHA 3FMSA 5JFRA 4ZQFA 5IYDJ 4XMTA 1KU7A 3HUGB 4N9IA 1TWHJ 2BY3A 1Q0QA 3FISA 5JLXA 2GXBA 1O3QA 5M3FJ 4Y6PA 3K70D 2VIXA 1FLIA 1DDNA 2C82A 1RZ4A 1XN7A 2E2JJ 1OR7C 3ZP5A 4ENNA 4EM1A 1IAWA 2HPMA 3B7RL 4I01A 1QHHD 1QGPA 4YEJA 4ZJZA 1USTA 2XPWA 1WWXA 4DZJA 2LKXA 4CGZA 1V5FA 4UB6C 3FXQA 3MCZA 3RASA 4A3FJ 1B6AA 1T56A 3ZN1A 3CIAA 3JRBA 1FIAA 2VPLA 4IX7A 4N9HA 2JRMA 2JUCA 4M3FA 2LC2A 3GTOJ 5LD2C 5JI6A 3A0BC 1BI2A 1QPMA 2OPTA 3WGGA 5K5RA 4N4OB 1QU3A 5DULA 3A4CA 3EYIA 3ECOA 3ABUA 2Z9OA 1ON1A 1UFMA 4QMEA 4XNBA 2QLZA 2IGNA 4OIRF 3TOBA 5B66C 3BLYA 1K78B 2O6GE 5BOXA 3O6BB 4L5IA 3GLLA 3NWTA 4C9YA 1SD7A 3DEEA 1ONPA 3PL8A 4RMNA 2W57A 3WU1B 1KQ8A 2DO7A 1D8KA 3PNYA 1J59A 3BG6A 4XLFA 2CFOA 1WJ5A 1YTYA 2XDVA 1PUEE 4UXNA 2WAEA 5IP7J 3OYBA 5FGMA 4LG0A 3H9JA 1GV2A 3L2RA 2ZMEC 3C2GA 4Y6RA 1E2XA 4XNFA 1R6RA 4HYEA 3VEPA 2BOLA 2VASA 4IRGA 5A2QZ 3L1PA 5FO5A 2IA1A 4WWCA 3KEOA 2Y48A 5HOOA 1WVRA 1I5ZA 1GVDA 2FA5A 2HXOA 1HKSA 1P4XA 2XGDA 1MJBA 1S5LC 1I1GA 2PMHA 3B02A 4TV7A 2QVOA 2VJIA 4NUBA 5LRSA 3ZCOA 5E3OA 4I76A 2JD1A 4E7LA 4E6KG 4OOEA 3WQQA 4CHUA 1B72B 1IW7F 3L00A 4XICA 3EETA 2QGUA 3E5XA 4B8XA 3I4NJ 5DYMA 3FTXA 4PU2A 5E3LA 1Z3YA 1IV6A 5HS9A 1D5VA 2ID3A 4G9YA 3HRMA 4HQMA 2FBHA 3JRIA 4PCQA 4HDUA 1IJWC 3FKIJ 4IHYA 3FIWA 4R1HA 2K4BA 3F8NA 2CV2A 1ONVA 1FIPA 5M5XJ 1RR8C 1ZG5A 1EH6A 1W0UA 2MC3A 3PO2J 1G2HA 2FD5A 2IEKA 3GEZA 3HL2A 2KDZA 1RIOH 5FKOA 2JD0A 4XN7A 1JTXA 2E71A 3OYMA 2QUFA 3BJ6A 4L5JA 2DMPA 4R8HA 2HDCA 2OZ6A 1FTTA 2COMA 3IH3A 3UCQA 2RKHA 3FULA 5FWQA 4Q4ZF 2XF7A 3FXRA 4B4CA 1UG0A 3M8FA 1MBFA 1SANA 4JQFA 4MS6A 2L54A 1TBXA 2PFBA 5DD4A 1K4SA 2GBYA 3GF2A 1D0ZA 5GTIC 3L2QA 4AM3A 1P7IA 1XCVA 5A2QK 4QHPA 3FUNA 2ECCA 4A3CJ 3FUEA 3OIQA 2LSOA 4M3BA 2CO5A 2NYXA 5FLVA 2H8WA 1Z91A 3FBNB 4XLPF 1B1BA 3TO7A 3L7WA 3LSPA 1IDYA 5CVJA 2DOFA 4ANJA 2PUSA 2K02A 3QAHA 2FEZA 2EB7A 1SD5A 4IRHA 1XG1A 2KLOA 2NAZA 3CUOA 4A3IJ 5GPAA 1QNTA 3S3OA 2DYRH 4XBFA 4XSZF 1FPQA 4C3IJ 2FSWA 2BBYA 4Q47A 4QPQA 1MW3A 1LFBA 3GO5A 2DMUA 3HOYJ 4XMUA 2COBA 3QPLA 2M8EA 4HQEA 4JK1X 3R6SA 3BQZA 1J9IA 2ICWG 4X0GA 4BYYA 3VYTB 2HQAA 2KKOA 2ZCWA 3BCBA 5EZGA 3M7GA 1MBKA 3MD2A 3D0SA 3L9FA 3GTJJ 1K5HA 5KHDA 1ZS2A 3MKZA 3BR3A 1W0TA 4HF2A 2X6XA 3DXJF 3I53A 4CCMA 2VQHA 5K5QA 2V6EA 3PIPF 4KA4A 1B9MA 2FQ3A 3HSFA 3PM1A 2EZHA 1UHWA 2DA1A 3Q9SA 3FF5A 4Y67A 1K61A 2GZWA 4PGGA 1ETXA 5LHIA 3JSPA 2P7VB 3TQNA 1SMYF 3QPSA 2M2EA 1X2NA 4XO3A 2VXDA 1XB4A 1FC3A 1MW1A 3K4CA 2DA3A 2QWWA 2V1NA 3NQOA 1ZG1A 2HEOA 5GP9A 1OYWA 1TW3A 4PJLA 3T1BA 2P7CB 5DYFA 2KJCA 3TP3A 2LREA 3CF5F 4HNTA 1JTYA 1K7AA 3WTTC 3K4BA 3KLOA 2LY2A 4BACA 5F64A 2ZFWA 3ZMVA 1MD0A 2QBYB 4G8XA 4Y33A 4KFCA 4XOPA 3EPZA 5J3LA 2IT0A 3CCYA 4A12A 1JHFA 1NTCA 1IUFA 4LIUA 3TDZC 4BQAA 1GT0C 5JAZA 2XAUA 3J7ZI 3VYRB 5EEGA 5FKNA 1CF7A 4IQ4A 4A0ZA 3CLQA 4Y3OA 2R7DA 4HNVA 1E3OC 1TT5B 4M9SA 2W25A 3GFMA 1SVOA 1IDZA 2PEXA 3ASOH 3K1PA 4XQFA 4S04A 3KP5A 4RM2A 2XV4S 4NHJA 1KU3A 2QYOA 4LG3A 3PUBA 3LSRA 3BR6A 1FBQA 1LVKA 3WG7H 1XSVA 4FETA 3BZ6A 1R00A 4A3LJ 1SAXA 4M71A 5H20A 1O7LA 4E7KA 1R4NB 1IN7A 4HG2A 4O5VA 4HPQA 4CYCA 1JKPC 4A3DJ 3FXKA 4F3QA 3MKWB 1BOBA 1BBYA 2STWA 2R7ZJ 2DCEA 2LG4A 3LAJA 2HDWA 3HKZN 3HYIA 2JUGA 2V1DA 3LFUA 2YX4A 1QPIA 5DUKA 3WODF 2A6EF 3P7NA 3CC7I 3O2PE 4XIDA 1VFCA 1BI0A 1IZ1A 4HAMA 3RKQA 2A5YB 2P5VA 4U87A 3U1KA 1B8IA 2F5FA 4AVPA 1YOVB 2KIQA 5K7ZA 5HDKA 3IC7A 3HOVJ 1A6IA 4B3XA 2K9QA 1TQMA 1UZCA 5KCMA 3OYFA 3BZKA 2VLAA 3WE3A 2W1OA 3OYAA 3EBHA 5LGUA 2R59A 3BR1A 4FCAA 4PJNA 4RDUA 4A5NA 3COAC 5M5WJ 1T2KA 1JKOC 3S2DJ 5D8KB 4PDKA 1XMXA 4PSWA 5D4SA 3W6VA 2L9SA 2QZ8A 5EJCA 1VQ9I 1E17A 2JVHA 1S3JA 2HTJA 2Y0SA 1AHDP 2MABA 1CF7B 4BKXA 1BL0A 3HIFA 3QYFA 1NK3P 4ZX3A 2EV5A 1Z1DA 3QYEA 3T5XA 2LBFA 3FH8A 1UHSA 2JPCA 2G7HA 2M9HA 4BE0A 3DV8A 1X58A 2Q1ZB 2F6CA 5D5WB 1U5TA 1X1AA 3LSTA 5CPRB 1R23A 3TDUC 4ZDOA 3IH2A 1WPKA 2VJ5A 1POGA 2RAEA 2ELKA 4N4NB 1TWGJ 2K9LA 2ZBKA 4AD9A 3ERMA 3K4LA 2LD5A 4DPRA 2XPUA 3DKYA 1R58A 4UHTA 2DQ6A 4A3MJ 3W6KB 1RRJA 4E7HA 3WE2A 2CV0A 2R7UA 3LA3A 3HJEA 4GGGA 3S1NJ 3FXUA 3TW7A 5F1JA 3FMRA 2JCXA 1SVLA 3RIRA 2X9DA 2TDXA 3TW6A 4A03A 3FWEA 5J40A 4XN9A 3FX3A 2PG4A 4HX4A 4GAEA 4II3A 5FB2A 4XKVA 3U9WA 5E1XA 1J7KA 2OQRA 2MLGA 2H8RA 2OBPA 4I7HA 2FF4A 1HA8A 5EEHA 5GPCA 2IW5A 2WAQA 5CKTA 4EJWA 1ZN2A 4J3BA 2VKVA 1W36C 4GYIA 4ZN6A 4AIDA 1HC8A 3MVPA 4ZW6A 4G7HF 1X4OA 3OYNA 1UB9A 3E6MA 3RQ4A 2HYGD 4PFOA 1VF9A 2BW3A 3G1LA 3A0HC 1K6OA 2DT5A 1Y8QB 4IZZA 2DJNA 5J1YA 2MFZA 1BM9A 5ICEA 3GVAA 2GA1A 1VQLI 2Y1DA 3RPUA 4XM3A 3S3NA 3U9GA 3F6OA 1WI9A
chains in the Genus database with same CATH topology
2LOOA 3UNGC 2EGHA 4P1WA 3G2BA 4BDYA 2O5RA 2K9MA 3H9QA 3TMOA 1WJBA 2X1EA 2KL4A 2JSPA 2I8DA 3R0IA 4CSWA 4XMXA 2AQFA 2KQRA 3B2PA 4ARFA 2IS1A 5LFAA 3CZLA 2LYCA 3FUKA 2B61A 1D0XA 4ITVA 2VL8A 2ZSHB 3EUAA 4R5XA 1X1CA 4XO4A 2E60A 5FRNA 2R7TA 1R0KA 3BCAA 1S9HA 4XN3A 4R79A 2A5WA 2VKDA 1WJDA 3OR1C 3AL0B 3K6GA 5DLLA 2X85A 1OLTA 3N05A 4XMWA 3FHNA 4K5PA 3H5NA 3T0YA 1LFPA 3DWLE 4PSXA 4AR9A 3FUDA 3PSIA 3PUUA 2ZSIB 2E1MC 4IQJA 5JNLA 4R5VA 1IRXA 1GLNA 2OUMA 2E5NA 3U21A 4BS9A 1MNDA 4HNUA 2PGGA 2VQCA 1Z21A 2O7GA 1YX5A 4ZW8A 3OY9A 2VQLA 2XPZA 3D5SC 4DBQA 1FMVA 4ZQTA 4B44A 3K4MA 3JT1A 3M1CA 1DP3A 3FUMA 1Q0LA 1TT0A 1PYVA 2HPIA 4XONA 2Y1GA 1Y6IA 3ANNA 3OL3A 3S93A 2HVSA 1T95A 4RCVA 4CCLA 4DBRA 4FLSA 2E5ZA 4KP7A 3LSHA 2V26A 1N78A 2A6TA 3DU6A 3LSKA 4AYBA 4ZDPA 1G59A 3PJRA 3VVLA 2IS4A 4E7ZA 4D1QA 1JI8A 3OYKA 1D1AA 2WZGA 4XN8A 2M3AA 2KPMA 4E7IA 4L2LA 2HU9A 4ZQFA 1SFKA 1SC5A 4F52A 4K5MA 3JSZA 4XMTA 3IAM2 2X6WA 3HUGB 2IS6A 3OYHA 1D1CA 5HLTA 1Q0QA 2KDOA 1WJCA 2UUZA 1PJRA 1MW7A 4ZW3A 2VB6A 4Y6PA 3K70D 2VIXA 3OL4A 2C82A 4RM3A 2ELJA 1OR7C 4HEA2 4HSRA 2HPMA 4ZQEA 2BVMA 3B7RL 3PSFA 1QHHD 1WFXA 2VJ4A 3FBIB 3OMYA 1TZLA 4YEJA 4ZJZA 1DQUA 3EBIA 4DIQA 1V5FA 3CHRA 2CH0A 3K4NA 1G8XA 2ZXIA 3RASA 2DOAA 1ERDA 3CIAA 2VPLA 4CCOA 4PJMA 3ZRGA 4BXFA 4IX7A 3FU3A 2KP6A 1Z7LA 4HSTA 2LC2A 2E1MB 5LD2C 3FU6A 2CW7A 3B34A 1LKXA 4N4OB 1QU3A 3FUJA 3A4CA 2DQMA 5DULA 3MMYB 2M4KA 1HS6A 2WPGA 4CZCA 4D9JA 2R7SA 2RQQA 2IS2A 2F4IA 1N75A 4KISA 4GAAA 4QMEA 3OWTA 1H3LA 4XNBA 2IGNA 3LSGA 1ZELA 2AQEA 3BLYA 4OAZA 1Q0HA 2CUZA 3CJQB 4NQWB 4BQNA 3L2UA 1VZ0A 3QJXA 3B7UX 5AENA 3NWTA 4C9YA 3ZXSA 2NOJB 3A1YA 3DEEA 1ONPA 3PL8A 1H19A 2MYSA 4RMNA 3KEYA 3AU9A 3CZGA 3B7TA 3W3CA 3CHPA 3OOUA 1X1BA 4PUSA 3W2WA 3PNYA 4BEHA 2X1CA 3BG6A 2CFOA 3HXLA 4XLFA 1T1SA 4B48A 1WJ5A 3H9GA 1P9QC 4XL9A 2JD2A 3VVMA 3RC8A 2XDVA 4XKWA 1X3ZA 2LY1A 2CV1A 3DPLC 2WAEA 2LBFB 4BJ5C 3OYBA 3A14A 4IKFA 3H9JA 4BQQA 3ONQA 3HOSA 3L2RA 2R7WA 4PFPA 4QPOA 5CQGA 1AA7A 3C2GA 4BJTA 4BE1A 4E7JA 4Y6RA 4AICA 4LIVA 4ZX6A 4XNFA 1R6RA 4BGDA 2BOLA 2VASA 4G6TB 3QODA 3EUKL 3HPHA 3I9V2 4Y4RA 2R70A 3FU5A 3RTRA 5HOOA 3VDXA 4PJJA 4E4HA 2UWMA 5JHFA 3HPGA 3CZEA 4C2TA 1SQMA 4PW4A 3S32A 4EATA 3CP2A 3K4KA 3DTEA 2VJIA 2KRCA 4NUBA 3ZCOA 4CCNA 2UV1A 1NG7A 4LITA 2JD1A 4BU2A 1DGRM 4E7LA 4E6KG 4OOEA 3DPTA 1JG9A 1T1RA 1MW0A 3WQQA 4BE2A 3ANLA 3LL7A 2GOMA 1V5GA 3FTXA 4PU2A 1EA3A 1Z3YA 1UAAA 1X3WA 5FRMA 3Q43A 3F9KA 3OYDA 3FTVA 2MD0A 3CMMA 2QKLB 1LDKB 4XO5A 5EV7A 4MKTA 2CV2A 4XNAA 4XLAA 4R7LA 3CP8A 4K5OA 4XN0A 2M4GA 2IGMA 3B3BA 2KZVA 2WAFA 1J09A 3AFHA 1X19A 2DT6A 2BW3B 3HL2A 3DU5A 2JD0A 4XN7A 4DOZA 4ZX4A 4BEHB 3PFYA 3OYMA 3UCQA 1BR2A 1U0JA 2PMZA 3FULA 5FWQA 2XF7A 4XNDA 1UG0A 3CHSA 1X4PA 3ZR8X 4JQFA 2JA2A 4MS6A 4X2UA 3SDBA 2L2OA 4BJ6C 4JNDA 3UERA 4AR8A 1BR4A 2Y1CA 1D0ZA 3B37A 3L2QA 2VQGA 2Z16A 5CQEA 4QHPA 1DGWY 2V9KA 3H5RA 3FUNA 3BC8A 4B47A 3FUEA 2W7NA 1WJEA 3OIQA 3SZGA 1JGIA 3V42A 3FBNB 3FDYA 3K10A 2PUSA 4ANJA 3LSMA 4B43A 2BVLA 3DLAA 2KMUA 2PJRA 1SAUA 4OWRB 2KLOA 4RSYA 3SYTA 4ZQGA 4AYSA 3S3OA 2WZFA 3ZHXA 4FLOA 4XORA 3K70C 2JVGA 3VWBA 3E0JB 4DJAA 3H0DA 2W4SA 2R72A 4QPQA 3ZHZA 1MW3A 2CW8A 4AR1A 3L2WA 3DPUA 4XMUA 2LRDA 4Q4IA 4CUGA 3S3MA 3OYJA 4X0GA 2VJ8A 3VYTB 2HQAA 4U7BA 3BCBA 3AKZA 2OC6A 3MD2A 3OYIA 4J00A 4XMVA 4RLFA 5KHDA 1K5HA 4K5NA 5TGTA 1ZS2A 3ANMA 3D5LA 3MKZA 1ONOA 2X6XA 4CCMA 2VQHA 3OS0A 3OYGA 1KONA 2R7OA 4DGWB 2V6EA 4Y6SA 3OS1A 3VYSB 5JC1A 2R7RA 2XSJC 4XOTA 2WY7Q 1WJFA 2M0MA 4Y67A 1NG6A 2MC4A 4CXFA 2VKHA 4BDZA 3WQSB 1JVSA 4ZTJA 2GTQA 3QOEA 1W36D 4E7SA 3FHEA 3QYBA 4XO3A 2LH9A 2VXDA 3K4JA 3LSIA 1MW1A 4PK4A 3K4CA 2V1NA 3ZI0A 3RC3A 4YELA 2RNGA 4PJLA 1RP3A 2QVWA 5DYFA 3NWSA 3MKYB 2WA0A 2LREA 4HNTA 2WY8Q 1MMAA 4BL0B 4QIRA 4BACA 3K4BA 1YE9A 2LY2A 3EBGA 4Y33A 3PNVA 4R5TA 4YRVA 2RREA 3SEZA 3EUHC 3OS2A 4XOPA 3OYLA 5JBIA 4FLRA 3EPZA 2ZFUA 3DTKA 1ONNA 3CHOA 3FKJA 3ZGKA 4BUPA 1SG7A 4ZQHA 4LIUA 4F55A 2CMPA 5JAZA 3FH5A 2XAUA 3CZKA 3FUIA 4CCJA 2WBMA 1D0YA 2XF5A 3VYRB 4KITB 3L2VA 4IQ4A 3IP4B 4Y3OA 2X6YA 4CCKA 4ZC3A 4XLEA 4H4KC 3UR3C 3OYCA 3BG7A 4XQFA 2HVQA 4XLCA 2WB1A 4RM2A 1D1BA 5JO0A 3CZ6A 2ZXHA 4NC7A 2FUG2 4LG3A 3TBIA 1YX3A 3LMMA 3PUBA 3VYUB 2W00A 3DKXA 1LVKA 3OIPA 4FETA 3I3LA 1K6YA 4NNJA 3Q44A 1QHGA 3C2HA 4E7KA 4HG2A 3J7AY 1MNEA 4HPQA 4RLQA 3FTYA 2M7AA 4F3QA 3MKWB 2C5ZA 1BOBA 3H35A 5JMWA 1S46A 2DCEA 2LG4A 2JV7A 4QUOA 2HDWA 3GBGA 4KT6A 2KRHA 2HPTA 2JUGA 1UELB 3LFUA 2IGOA 2XF6A 2QJ1A 5HVQC 3SEQA 3A06A 4MLOA 4CH7A 3FTUA 3VSLA 2CUJA 4XN5A 2R7QA 4U87A 3FUHA 4PVBA 4ZYAA 3W2AA 2A7OA 2FFLA 4OOFA 2IGKA 3DQVC 2OV7A 4B3XA 3OYFA 5KCMA 2VLAA 4F92B 3B7SA 1MVYA 4NQWA 3B2XA 3IIEA 2W1OA 3OYAA 3EBHA 2R59A 4FCAA 1N77A 2X1DA 2X51A 4PJNA 4XLHA 2K3PA 2R4GA 3FTZA 4PSWA 4XKCA 4F91B 2L9SA 2JVHA 4RVBA 4HRIA 3H5AA 3FTSA 2Y0SA 3IUOA 3FUFA 2MABA 4NC8A 3A2KA 4XN1A 4BKXA 2L5QA 3QYFA 4ZX3A 2ZXGA 3QYEA 1MW2A 1BR1A 2LBFA 3D5RC 3FH8A 2JCVA 4CA0A 4BE0A 4ZTFA 2Q1ZB 2F6CA 4XMZA 1X1AA 5CPRB 3OYEA 3KYLA 4ZDOA 2QKMB 2HZDA 2Y1EA 4J01A 3FH7A 2VJ5A 3HOTA 4N4NB 1OR7A 2K9LA 5BPPA 4XKBA 3K4LA 2HNHA 2DXIA 4ZW7A 3HC7A 4DPRA 3DKYA 4QPEA 3T8VA 2L7KA 1FMWA 2DQ6A 2Z2SB 1R0LA 4E7HA 2R7UA 2CV0A 4AU7A 2CS3A 4ZX5A 1Y56A 3KEDA 4AVZA 2GOXB 2JCXA 2R7XA 3AU8A 3AL0C 2L9NA 4LUPA 2VXZA 5HNHA 4P5OA 2XC7A 3HKZA 3M8JA 5JMPA 3CJRB 2KHMA 3OR2C 1MMGA 4A03A 3CHQA 4XMYA 4XN4A 4XN9A 2P0WA 1T0FC 4GAEA 2F5VA 4II3A 2XPYA 4XKVA 3U9WA 3RSNA 5FROA 2Z1DA 5KNLA 3PNTA 2K5CA 4ZDLA 1G5AA 4JOMA 2W82A 3S8PA 3W2VA 3UEQA 1V5EA 3ZQQA 4FLQA 1HA8A 1E0EA 4XN2A 3ZHYA 3E1SA 2WAQA 5CKTA 3VSKA 2Y1FA 4J3BA 1W36C 4ZN6A 3CESA 5HNFA 4ZW6A 2M7BA 1GW6A 3TL4X 3RPUD 3HG9A 2PJRB 1X4OA 4Q4EA 1X1DA 3OYNA 2VJJA 3CF2A 2RJIA 3WQRA 3RQ4A 4PFOA 2MAPA 2BW3A 4BQOA 3FTWA 3FU0A 4C30A 2Q2EB 2V4JC 3IAS2 1Z3XA 4ZW5A 2R7VA 3KX2A 2V7FA 1MMNA 4OAYA 3AUAA 2IXSA 3DTIA 4XR6A 2XQ0A 4KJZA 2HPOA 4IZZA 2HVRA 2MFZA 2WADA 4F93B 4K5LA 2PL5A 4C2UA 2JCYA 2DJIA 2Y1DA 4FASD 4XM3A 2DT7B 4II2A 3S3NA 4GRIA 2MAOA 1WJAA 1MMDA 3RCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HNF A;  5HLT A;  2VLA A;  5HNH A; 
#chains in the Genus database with same CATH topology
 2LOO A;  3GCM A;  1BOA A;  2XKO A;  2DA5 A;  2X4H A;  4BDY A;  2O5R A;  2K9M A;  2X1E A;  2CYY A;  2KL4 A;  4KIF A;  1LEB A;  2AQF A;  2UZK A;  3A01 A;  2XAG A;  3KLN A;  4EQQ A;  5LFA A;  4V19 K;  2LYC A;  2NVY J;  1SD6 A;  3CZL A;  1J75 A;  2B61 A;  3FUK A;  1HCR A;  5BPD A;  1XPX A;  3CD6 I;  4J19 A;  3HSE A;  1YJ9 I;  1TC3 C;  2DOE A;  4W1U A;  1Y8R B;  2STT A;  2HQN A;  3G4S I;  4BBS J;  5FRN A;  4R79 A;  4XN3 A;  1WJD A;  3N4M A;  2GXG A;  4WCG A;  4XMW A;  4WF2 A;  3HOU J;  3H5N A;  1TWF J;  3LA7 A;  2ZSI B;  2E1M C;  1BI1 A;  4A2U A;  1IRX A;  4RAZ A;  2HS5 A;  5DTD A;  2L4A A;  3U21 A;  1SFU A;  2PGG A;  1YRN A;  3HSR A;  1WGX A;  5H6R A;  3CC4 I;  1DU0 A;  4ZQT A;  1KQ0 A;  3H36 A;  1ETY A;  3KIO A;  1H88 C;  3M1C A;  1IF1 A;  1DP3 A;  1Q0L A;  5H6Q A;  3WTX C;  4LK1 F;  1TWA J;  3VFZ A;  2A69 F;  4UUS B;  4L0Z B;  2DOD A;  3CTA A;  5GTH C;  3S93 A;  1IRF A;  2LTP A;  5L3E A;  1K83 J;  1N25 A;  4CCL A;  4DBR A;  2E5Z A;  2CRG A;  2YR2 A;  2OAZ A;  2A6T A;  3DU6 A;  3KP2 A;  3LSK A;  1U8B A;  5BPI A;  3ZMD A;  2M34 A;  3SJM A;  3PJR A;  2QA4 I;  2QQ9 A;  1YI2 I;  3MZH A;  5E20 A;  3ZMT A;  2IS4 A;  3F22 A;  4GCV A;  1HKT A;  2VON A;  2M3A A;  3H0G J;  3CJT B;  1QVT A;  3F23 A;  1SC5 A;  2Y69 H;  4K5M A;  2NS0 A;  3RZD J;  3IAM 2;  3JSZ A;  2X6W A;  3MZY A;  4ESF A;  1XGS A;  1FY7 A;  2IS6 A;  1D1C A;  1MBJ A;  1LDD A;  1WJC A;  1U5T C;  1PJR A;  5J6X A;  2XAJ A;  3HRU A;  5FJ8 J;  3V8J A;  3GTP J;  1H9G A;  2O8X A;  2VKE A;  4OIP F;  3S1Q J;  2H09 A;  2MW8 A;  1FOX A;  2LKS A;  4EJU A;  4XRF A;  5DUI A;  2BVM A;  3FHZ A;  1VQK I;  4ENJ A;  1FEX A;  4NBQ A;  1O3S A;  1YIT I;  2HOE A;  5IPA A;  2V79 A;  5CLS A;  2KJB A;  5LEK A;  1G8X A;  4Q48 A;  1YHQ I;  3O8G A;  2RN7 A;  4PJM A;  4BXF A;  3FU3 A;  3SZP A;  3CCM I;  3NRV A;  2KP6 A;  2XGE A;  1Z7L A;  1FYK A;  3IHU A;  4LLL A;  2NNN A;  1YRN B;  1HBX G;  2JZY A;  5BNG A;  3FU6 A;  3SXY A;  5F1R A;  3Q9V A;  1LKX A;  2M45 A;  4LOC A;  3B34 A;  2OTL I;  2DQM A;  3FUJ A;  2WPG A;  2FX0 A;  4CZC A;  2DA2 A;  4CO8 A;  4D9J A;  2F4O B;  2R7S A;  2WB1 N;  2I5U A;  1JE8 A;  2F4I A;  4I0A A;  4KIS A;  2DMQ A;  4GAA A;  3DLL F;  4LB5 A;  1DPU A;  1H3L A;  1ZEL A;  2DLL A;  2NVT J;  1BIB A;  1Q0H A;  3QJX A;  2R5Z B;  2K85 A;  1F5T A;  4BNC A;  2IA2 A;  3CZG A;  3AU9 A;  4AC0 A;  1HW5 A;  2OQG A;  4KIG A;  4KN7 X;  4ENM A;  4PUS A;  3RYR A;  1G3Y A;  2B63 J;  4BEH A;  1T1S A;  3VVM A;  2M87 A;  4B48 A;  3H9G A;  1P9Q C;  2KIM A;  1T39 A;  3G71 I;  1X3Z A;  2LY1 A;  3IKT A;  2RV8 A;  4M74 A;  3WG9 A;  4Y15 A;  4BQQ A;  3ONQ A;  1ETK A;  4DNC A;  4B09 A;  3F6V A;  4BJT A;  1OMI A;  4E7J A;  1ZK8 A;  5IP6 A;  2JTV A;  4G6T B;  5FFZ A;  3QOD A;  2QQB A;  3FK7 A;  4Y17 A;  1ULY A;  3VDX A;  4E4H A;  5E8I A;  2UWM A;  1ZKG A;  3ZQ7 A;  4EAT A;  3J7Y J;  3K4K A;  1F36 A;  3DTE A;  3RKY A;  4OIN F;  4LIT A;  2DA4 A;  3C2B A;  2JK3 A;  5GAH J;  2BY1 A;  1JG9 A;  2BYV E;  1MW0 A;  4BE2 A;  5D5X B;  3LAP A;  1V5G A;  1X3W A;  4HDV A;  2YUS A;  3E6C C;  2QKL B;  1B59 A;  1LDK B;  4N0B A;  5E1W A;  2A07 F;  1H9T A;  4O3M A;  5EV7 A;  4XNA A;  4MTE A;  3CQZ J;  3CP8 A;  1Z6T A;  2M4G A;  2IGM A;  3A02 A;  4CYD A;  1J09 A;  2G7U A;  2OZU A;  1OCC H;  4KMU X;  4B3A A;  3MFK A;  1J2X A;  1ITY A;  1W1W E;  2H6C A;  4ZX4 A;  4BEH B;  3PFY A;  2FML A;  2K7L A;  4D7M A;  2XRN A;  2L7Z A;  3OSF A;  4IHW A;  1ZLK A;  1U0J A;  5IT3 A;  4XND A;  5EDN A;  2AHQ A;  3ZR8 X;  2OA4 A;  3IH4 A;  3I54 A;  4X2U A;  1R71 A;  5FLX Z;  2TCT A;  3SDB A;  4A0X A;  2FOW A;  4BJ6 C;  4JND A;  1BR4 A;  2Y1C A;  5F0H A;  4B1R A;  4AUX A;  2L9R A;  2ZME B;  2W7N A;  1WJE A;  2DYS H;  1JGI A;  3U2R A;  3V42 A;  3FXL A;  3FDY A;  2CQK A;  1XTA A;  3HDD A;  1P6R A;  2BVL A;  1W5T A;  1SAU A;  1LQ1 A;  3CXB A;  4RSY A;  3J7A O;  4ZQG A;  3ZHX A;  1G6N A;  4RGU A;  3VWB A;  3BJA A;  3E0J B;  4DJA A;  3H92 A;  3GZ6 A;  2R93 J;  2EIL H;  2L7F P;  2DFF A;  3ZHZ A;  1BJA A;  4RGX A;  1A31 A;  2CW8 A;  3L2W A;  2BXY A;  3WHB A;  4XLN F;  1OCP A;  2LRD A;  1X3W B;  2LNB A;  1KZH A;  3MKL A;  3OYJ A;  2DA6 A;  1MDM A;  2HDD A;  3AG4 H;  1IRZ A;  2ZO4 A;  4RLF A;  4EGY A;  5TGT A;  3D5L A;  1A36 A;  5DCM B;  5J8F A;  1EH8 A;  2Y75 A;  3J81 Z;  1GHC A;  1GXQ A;  4FX4 A;  3B6A A;  2E36 A;  2IP2 A;  2OTJ I;  2L3D A;  2Z5U A;  2XSJ C;  2WY7 Q;  1F4K A;  4KIC A;  2VOD A;  2R0Q C;  5FLX K;  2VKH A;  1QZE A;  2XHK A;  3WQS B;  5KVR A;  2PLY A;  3PQK A;  4ZTJ A;  5FD6 A;  2GTQ A;  4FE4 A;  4E7S A;  2HXI A;  4FE7 A;  2JA5 J;  3QYB A;  4M9Z A;  4V2F A;  2F5E A;  4FCY A;  4HX8 A;  1S8N A;  2IBD A;  1J0R A;  3RKX A;  2QQA A;  3MN2 A;  3ZI0 A;  4UV8 A;  3WTW C;  1WI3 A;  2RNG A;  3A03 A;  4HF1 A;  2UXN A;  4RAY A;  2DTR A;  3DP7 A;  3F72 A;  3WTV C;  4MEX F;  1LUJ B;  2WY8 Q;  1MMA A;  2GIV A;  4BL0 B;  4IHS A;  5CVI A;  4UVA A;  3GW2 A;  4AWX B;  1H8A C;  4M3G A;  2L02 A;  3EDP A;  1HDD C;  2FE3 A;  3GWZ A;  1Y39 A;  3EUH C;  4M6X A;  1RKT A;  5TJJ A;  2Y31 A;  4RA2 A;  3DTK A;  4AYB N;  1REP C;  3ZGK A;  4BUP A;  4XSX F;  5E3N A;  4ZQH A;  3M9A A;  4OIO F;  2DI3 A;  1WCM J;  1ZAO A;  4F55 A;  5LHG A;  3FH5 A;  3CZK A;  3ZOB A;  4CCJ A;  1MDM B;  1D0Y A;  4KIT B;  2W48 A;  2CQX A;  3MWM A;  1T38 A;  1WSU A;  4RB0 A;  4H4K C;  5J8C A;  3J81 K;  3OYC A;  2ISZ A;  4GDF A;  4XLC A;  3ZQH A;  4QTR A;  1D1B A;  1TQI A;  3I59 A;  3LA2 A;  1U9N A;  2LP0 A;  1HDP A;  1I27 A;  2FUG 2;  2F5C A;  4JX5 A;  1YX3 A;  2W84 A;  4M3D A;  3VYU B;  1MSE C;  3M4O J;  2Y9Y A;  3I3L A;  5L3C A;  1S6L A;  1WQ2 A;  1B9N A;  2RQP A;  1BW6 A;  1QHG A;  3C2H A;  1HF0 A;  1MNE A;  2E1C A;  1GXP A;  3ZMS A;  2IA0 A;  4G94 A;  1QQI A;  3FTY A;  1IN6 A;  1D5Y A;  4LD5 A;  3HOX J;  2V1U A;  1R7J A;  1ZG3 A;  4CDG A;  1HW2 A;  2KRH A;  2HPT A;  2E2H J;  1UEL B;  2XF6 A;  4LG0 B;  2NOG A;  2CQN A;  2QJ1 A;  1H89 C;  3X2Q H;  3KP3 A;  3A06 A;  1MIJ A;  2CUF A;  3MEX A;  3FTU A;  4XN5 A;  4ABZ A;  2CUE A;  1T8I A;  2A05 A;  3CMY A;  2E19 A;  4PVB A;  2PQ8 A;  3DCF A;  4ON0 A;  4CZZ A;  1Z05 A;  2XUB A;  3BZC A;  1S72 I;  2FFL A;  1QZY A;  3G6E I;  3EQL F;  3AG2 H;  3DQV C;  1VQ6 I;  4NQW A;  3B7S A;  1MVY A;  4UUV A;  3B2X A;  3IIE A;  3DBL B;  5LHH A;  1SFX A;  5TRD A;  2X1D A;  2X51 A;  2XAS A;  5HS8 A;  3KZI C;  2K3P A;  2GQQ A;  3FTZ A;  4F91 B;  2W24 A;  1W5S A;  3HGY A;  1XSX A;  5M5Y J;  3O3K A;  1PUF A;  1HKQ A;  2OD5 A;  4MGR A;  3A2K A;  2FBK A;  1P4W A;  2ZJ2 A;  3JW4 A;  5ICG A;  3W6J B;  2ZXG A;  1VQ4 I;  1WH5 A;  5EG0 A;  3E6D A;  1BR1 A;  3D5R C;  5DCF A;  5CJ9 A;  3QOP A;  1PP7 U;  1X3U A;  1D3Y A;  4XMZ A;  2FRH A;  1YG2 A;  2QKM B;  2CQ7 A;  5JVG F;  3IWZ A;  3CO7 C;  3HOT A;  4PGH A;  4Y7N J;  2E1N A;  5BPP A;  4NDL A;  4XKB A;  2HNH A;  3WTU C;  3K2A A;  2DXI A;  4Q5S F;  3HC7 A;  4ZW7 A;  3M8E A;  2JA8 J;  3V7S A;  2L7K A;  5BS6 A;  2M0C A;  4A6D A;  2Z2S B;  1R0L A;  2XKP A;  4ZX5 A;  2EFQ A;  1QA6 A;  1L0O C;  2RVC A;  2HOS A;  4ZH4 F;  5LLQ A;  3HKZ A;  3I5U A;  1FT9 A;  1IN8 A;  3R0J A;  5DEQ A;  3E7L A;  3AG1 H;  2DA7 A;  4KUM A;  5ICF A;  4KIB A;  4OOI A;  3GZN B;  2Z1D A;  2M1B A;  2K9S A;  3BG9 A;  4ZDL A;  4OIQ F;  3S8P A;  3I0T A;  4FLQ A;  5B1A H;  1A5J A;  2Z99 A;  3E1S A;  2D2W A;  1U78 A;  3CCE I;  2JQ7 A;  1YS6 A;  2NRA C;  1KYZ A;  1YLF A;  5ILV A;  2J5O A;  1XGN A;  5IOZ A;  4RGS A;  2M7B A;  1GW6 A;  3TL4 X;  4LLN A;  1TP4 A;  2VJJ A;  3CF2 A;  4MNU A;  3TP0 A;  1HLV A;  2RJI A;  1FYL A;  1ORK A;  2MH2 A;  3WQR A;  5J1R A;  3NAR A;  1MMS A;  1IXC A;  1Z6R A;  4PZJ A;  3KP6 A;  4C30 A;  2LK2 A;  4U0V A;  3FTW A;  4OU0 A;  3IAS 2;  2A3S A;  1YW9 A;  1PUF B;  1R5I D;  4ZW5 A;  3KX2 A;  1MMN A;  2KIS A;  4AIK A;  3HZJ A;  4UB8 C;  5E1Z B;  4MTD A;  2HOT A;  1RI7 A;  4W97 A;  2YSR A;  3Q0U A;  5EG0 B;  2HVR A;  2WAD A;  1F1Z A;  1JT0 A;  2JCY A;  2CQQ A;  5KK1 A;  1FSH A;  1WJA A;  4CH7 A;  3RCO A;  2Z3Y A;  4MFD A;  4UY8 I;  2EGH A;  4P1W A;  3ZQF A;  2A6H F;  3H9Q A;  3TMO A;  4FHT A;  2JSP A;  2WC2 A;  4UVB A;  4CSW A;  2ELH A;  5EYR A;  2X6O A;  4ARF A;  1HQC A;  1IC8 A;  1T98 A;  2EV0 A;  2EZI A;  2MGQ A;  3GYH X;  2ZSH B;  3EUA A;  2ZB9 A;  4QSH A;  2LY9 A;  5F0C A;  2CSO A;  3BCA A;  4XRM A;  2DPU A;  3ML6 A;  5LBQ A;  3K6G A;  2L9V A;  2X85 A;  1S7E A;  4PSX A;  1OIS A;  4PJ0 C;  4EVI A;  1A04 A;  1P2F A;  3P9C A;  2Y0M A;  3GTQ J;  4R5V A;  2QSG X;  1KU9 A;  5IOY A;  1GLN A;  4L9J A;  3K69 A;  1FJL A;  2MA3 A;  1VQP I;  2JA6 J;  4BS9 A;  2EH3 A;  3HM5 A;  2ZKZ A;  1EF4 A;  1PDN C;  1XDS A;  5EGO A;  1YW8 A;  2KIU A;  2HFH A;  2EZK A;  1Z7U A;  2EK5 A;  2GAU A;  2EIN H;  2Y1G A;  1JJ6 C;  4IEJ A;  5GAD J;  4RCV A;  1I6H J;  1SC7 A;  3LSH A;  3B73 A;  3C7J A;  5LEJ A;  3CME I;  1N78 A;  2DU9 A;  3BP8 A;  4D5C A;  4RGR A;  3IV5 A;  4ZDP A;  2L01 A;  2WTE A;  5AON A;  2XPV A;  3CCR I;  4EM2 A;  1RUO A;  4I2O A;  1D8J A;  5FKK A;  1JI8 A;  5F0F A;  4L2L A;  4KMF A;  2HU9 A;  2JJ7 A;  1ZYR F;  1SFK A;  3QPH A;  2GWR A;  4EV0 A;  4F52 A;  2LR8 A;  5HLT A;  2LMD A;  2UUZ A;  1AWC A;  4ZW3 A;  4HA8 A;  3WU2 C;  5H2F C;  3OL4 A;  1AU7 A;  2MH9 A;  5HDN A;  2XIG A;  3ZQC A;  1GVJ A;  3ABL H;  4RM3 A;  4HEA 2;  1VQ5 I;  2FXA A;  1AKH A;  1JHH A;  1T08 B;  2Y9Z A;  1TZL A;  1IGN A;  2CU7 A;  1JUM A;  3JTH A;  4WXH A;  1ZH5 A;  3EBI A;  1V55 H;  5HOD A;  2ID6 A;  4I6Z A;  4HV6 A;  3LFK A;  2ZXI A;  4CYC B;  2DOA A;  3L09 A;  3JAM Z;  3J80 Z;  3N97 A;  3K9T A;  4M9X A;  2K27 A;  3KYC B;  4HST A;  4S0H B;  2E1M B;  2P5L C;  3CO6 C;  3CMA I;  1KGS A;  3P5J A;  3CCL I;  5ED4 A;  1BJZ A;  3MMY B;  3IL2 A;  4FIS A;  2AS5 F;  5E17 F;  1B8I B;  2RQQ A;  1YO5 C;  2IS2 A;  3LSG A;  2AQE A;  1EJ9 A;  2CUZ A;  3CJQ B;  4BQN A;  1VZ0 A;  2ME6 A;  3B7U X;  2E7W A;  3BR5 A;  3VOE A;  3ZXS A;  2NOJ B;  3A1Y A;  4RAF A;  1H19 A;  2PJP A;  3KEY A;  4DW6 A;  3I55 I;  3CHP A;  3REO A;  2ETH A;  2P5K A;  2VOO A;  3TED A;  2LFB A;  3LQR A;  2O03 A;  1IRG A;  2GM4 A;  2DDB A;  2X1C A;  4MFE A;  1RUN A;  2JD2 A;  1WZ2 A;  2G0E A;  1UCR A;  3DPL C;  2LBF B;  4BJ5 C;  2R92 J;  4JYK A;  3A14 A;  3G1O A;  1TW2 A;  5F04 A;  3FM3 A;  3HOS A;  1U5T B;  1K79 A;  4YFK F;  4BE1 A;  4IOC F;  4BAY A;  1SEU A;  2R70 A;  2MD5 A;  1BW5 A;  5GAG J;  3E5Q A;  3GZ5 A;  2ZJR F;  2HQR A;  2PBI A;  3KE2 A;  2DAO A;  5CVV A;  2EFO A;  5JHF A;  3DEW A;  3RPQ A;  3GTL J;  5AIP A;  4BH9 A;  3JAM K;  3J80 K;  2VC1 A;  1SFE A;  2ZJQ F;  3S32 A;  3CP2 A;  3ISP A;  2EIM H;  5D4R A;  4Z2Y A;  5J47 A;  1NG7 A;  4BHC A;  3L2C A;  5GAE J;  1W4M A;  4BU2 A;  5CVR A;  3DPT A;  1IXR C;  1XC5 A;  2Y0S N;  2HQ5 A;  3P9I A;  4IPA A;  3LL7 A;  5D6E A;  3IKV A;  4EMS A;  2DMT A;  4JBA A;  1EA3 A;  5JHU A;  5EEA A;  1UAA A;  5FRM A;  1MKM A;  3FTV A;  5F27 A;  3BT9 A;  3CMM A;  1VND A;  3WGH A;  4XLA A;  3CCJ I;  3BPV A;  3KP4 A;  2O8K A;  1YW7 A;  4L9N A;  4XN0 A;  2JWT A;  1R1T A;  3PIO F;  2KZV A;  3BG3 A;  2FNA A;  2FOK A;  1VQ8 I;  3CUQ A;  3VPR A;  1NH3 A;  2BW3 B;  5J4Y A;  1LE8 A;  3DBR B;  2DQR A;  3LSJ A;  2ISY A;  3R4K A;  2ZNZ A;  4DOZ A;  2QSF X;  3PQJ A;  2JA7 J;  1BR2 A;  2FBI A;  2TRT A;  2JMW A;  2PMZ A;  3ZMZ A;  1O7F A;  2NXN B;  3BPX A;  1X4P A;  1GUU A;  2BHZ A;  2QM3 A;  1W7P A;  1G3W A;  2L2O A;  4X1E A;  2Z16 A;  3OV8 A;  5CQE A;  1DGW Y;  2V9K A;  3H5R A;  1Y0U A;  3S1M J;  2E1O A;  3BTI A;  1R1V A;  4B47 A;  2UXX A;  3SZG A;  3HTU A;  2VBW A;  2WAQ N;  3A01 B;  3K7A J;  2K9N A;  1XSD A;  2BY2 A;  3O8H A;  3K10 A;  4A3E J;  1MSF C;  3LSM A;  4B43 A;  2ACJ A;  3DLA A;  3JRF A;  5C4X J;  1XGO A;  2KMU A;  2DFH A;  4A6E A;  2PJR A;  1WKM A;  1B4A A;  4U88 A;  1BN5 A;  3SYT A;  2AO9 A;  2ZXW H;  3AAF A;  3OIO A;  2IJL A;  4AYS A;  4KN4 X;  4XOR A;  3K70 C;  3SFI A;  2VT3 A;  2W4S A;  3Q5F A;  2R72 A;  1HW1 A;  2P4W A;  3MZ8 A;  3QRF F;  4UUT A;  4Q4I A;  2QEX I;  4CUG A;  3S3M A;  4HF0 A;  4EGZ A;  4D7N A;  3E6B A;  3OYI A;  2XGX A;  3F8M A;  2EIK H;  4K5N A;  5HLI A;  5HLG A;  1ETO A;  2JRT A;  3PFI A;  5ICC A;  1YFH A;  1LE8 B;  3OS0 A;  3OYG A;  2R7F A;  1KON A;  4F7Z A;  5JC1 A;  4Y6S A;  3OS1 A;  5FFX A;  1F43 A;  1G3S A;  2R7R A;  2K86 A;  1M1E B;  1O4X A;  2M0M A;  2PN6 A;  4L5E A;  2Q8K A;  4CXF A;  2VE9 A;  3HHH A;  4BDZ A;  3HTS B;  4KYW A;  3HW2 A;  1JVS A;  2ADU A;  1W36 D;  1LVA A;  3Q3S A;  3FHE A;  3GME A;  2IRF G;  3K4J A;  4PK4 A;  1IUY A;  3HRS A;  1I3A A;  3BTJ A;  4Z6Y A;  3RZO J;  4YEL A;  2E2I J;  1ZRF A;  4M6Y A;  5TIS C;  1MBG A;  1RET A;  1OCZ H;  2O9L A;  2QVW A;  1RNL A;  4LLG F;  4P55 A;  1YQA A;  3GTM J;  1OCO H;  3HHG A;  3KEQ A;  1JUP A;  4WXC A;  1TNS A;  1YE9 A;  5K7F A;  2R3S A;  1VQM I;  4HV5 A;  1OCR H;  3EBG A;  3PNV A;  4YRV A;  3SEZ A;  5JBI A;  4GXO A;  4IHT A;  2V1X A;  3SHF A;  2ZFU A;  2L0K A;  3CLO A;  3EUH A;  4A0Y A;  1XD7 A;  3DF8 A;  1X1P A;  1XMK A;  2KT0 A;  3GUD A;  3FUI A;  5C4J J;  4ZZL A;  2XF5 A;  4E70 A;  4Y13 A;  1T6S A;  3IP4 B;  2X6Y A;  3HUG A;  3R61 A;  2RDP A;  4ZC3 A;  5K1Y A;  4JP0 A;  3NAU A;  3JSO A;  3BG7 A;  3I4M J;  2HVQ A;  2X0L A;  1ETV A;  2XAQ A;  5JO0 A;  4ASN A;  1VQO I;  2XGC A;  4RB2 C;  4NC7 A;  3TBI A;  3QPT A;  1IXS B;  3LMM A;  3GXO A;  3CUQ C;  3DKX A;  1DUX C;  1I50 J;  4KNY A;  1EH7 A;  1EKE A;  3IRQ A;  2VC0 A;  5IT9 Z;  1R49 A;  2KZG A;  3Q44 A;  4RLQ A;  3V7C A;  2M7A A;  3VOD A;  3H35 A;  1QBJ A;  1BIA A;  4QUO A;  3GBG A;  4KT6 A;  1I39 A;  2A68 F;  2EBI A;  1X3Z B;  3HEF A;  1R36 A;  3JRC A;  3HB9 A;  5HVQ C;  1OFC X;  2HTS A;  1STZ A;  3EYY A;  2FU4 A;  3OOP A;  4MLO A;  1XDU A;  3Q0W A;  5HS7 A;  1F9N A;  3WHC A;  1VI0 A;  1LDJ A;  3ZN0 A;  1DPR A;  1YYV A;  2XRL A;  1TNT A;  1V54 H;  2LKP A;  1U6G A;  2BZT A;  3W2A A;  4GYG A;  2A7O A;  2LLK A;  2NS8 A;  1Z67 A;  2ECB A;  4YIF A;  3ZQL A;  2OV7 A;  1K78 A;  5HDG A;  4MQ9 F;  3FXM A;  1H0M A;  2EWN A;  1FP1 D;  1N77 A;  1LB2 A;  4XLH A;  2GA2 A;  2R4G A;  1MJA A;  1QO0 D;  1ZTR A;  4XKC A;  3GX4 X;  3FTS A;  2EA2 A;  2E34 A;  5FLM J;  3ABM H;  2HR3 A;  2L5Q A;  4ESJ A;  2OU2 A;  1R22 A;  4D5F A;  2JCV A;  1FYM A;  2QCO A;  1TL8 A;  2ZC2 A;  2Y1E A;  4J01 A;  1FTZ A;  2F48 A;  3JRE A;  1QVU A;  3E3V A;  2DK8 A;  5IT9 K;  4IF4 A;  4QPE A;  3BG5 A;  3T8V A;  3S1R J;  1FMW A;  2QEN A;  2CFX A;  4V2G A;  2CS3 A;  2ZJP F;  1Y56 A;  1HSJ A;  1OQY A;  2JSC A;  4AVZ A;  3KED A;  3HOZ J;  2R7X A;  4LUP A;  4HX7 A;  5D6F A;  3AL0 C;  4P5O A;  4IVN A;  1FZP B;  3JCU C;  1MH3 A;  3M8J A;  3OR2 C;  1MMG A;  3CHQ A;  4XN4 A;  3OSG A;  2E7X A;  1XCB A;  1B72 A;  4HBL A;  5FRO A;  1L3L A;  4RBO A;  5KNL A;  4MO7 A;  2EFN A;  3QU6 A;  4JOM A;  2W82 A;  3W2V A;  4D0P A;  1V5E A;  3JR9 A;  1P4A A;  4G6Q A;  3V8L A;  3ZQQ A;  3CJN A;  1E0E A;  4HLY A;  3BJO A;  1ETQ A;  5C44 J;  3RDI A;  5E8G A;  4FQG A;  2XB5 A;  5IP9 J;  2Y1F A;  4C2M J;  2B9S A;  4AIJ A;  3CES A;  4HZF A;  1I6X A;  4EM0 B;  4Q4E A;  3RPU D;  4A93 J;  1JGG A;  4CIC A;  2MAP A;  4A5M A;  5D8L B;  1RR7 A;  1Z3X A;  2HYF A;  2KIF A;  2IXS A;  3DTI A;  4P9F A;  4XR6 A;  4A3G J;  3F8C A;  4KJZ A;  5LGN A;  1BC8 C;  1S7O A;  4RB3 C;  2XQ0 A;  1TQP A;  3PUF A;  3D1N I;  2EZL A;  4C2U A;  2DJI A;  1R9T J;  1E3H A;  4GRI A;  3OR1 C;  2NVQ J;  2F2E A;  2VBZ A;  2BEO A;  5C3E J;  4M3E A;  2DDA A;  5B3S H;  1ZRC A;  2DFE A;  2VPR A;  2DW4 A;  4XMX A;  2KQR A;  2V9P A;  2IS1 A;  4YFX F;  2GXA A;  4I98 B;  2XB0 X;  3F3X A;  2P6S A;  4ITV A;  3S15 J;  2VL8 A;  4R5X A;  3LWF A;  2BE5 F;  2V9V A;  3LQQ A;  1MNM C;  4XO4 A;  1CQT A;  1ZRE A;  5L3F A;  2EJR A;  2YX7 A;  4MIM A;  1LEA A;  2HGC A;  4FT8 A;  4WK8 F;  3CDH A;  3G73 A;  3AG3 H;  4G7O F;  1OLT A;  3FHN A;  5DDG A;  2B7E A;  1WRJ A;  4EJT A;  4AR9 A;  1HOM A;  4IQJ A;  4X6A J;  1RC9 A;  1XGM A;  2E5N A;  2ME0 A;  2EFW A;  1XMA A;  4HNU A;  1Z21 A;  2F4M B;  4BY7 J;  1YX5 A;  1NK2 P;  4O6J A;  4YFN F;  3D5S C;  5L3B A;  3JRD A;  1A35 A;  4B44 A;  2PMU A;  4YIR X;  1A6Q A;  3FUM A;  1W7P D;  3WGI A;  4ZYE A;  2A61 A;  3MAJ A;  1VQ7 I;  4DYQ A;  1PYV A;  4XON A;  2C6Y A;  2GLO A;  1KYW A;  4I99 C;  3C1D A;  5L3D A;  4FLS A;  2XRO A;  4KP7 A;  2XSD C;  2HKX A;  2V26 A;  3FMQ A;  4A69 C;  1G59 A;  1R4M B;  4IJA A;  3I71 A;  2AXL A;  4E7Z A;  4D1Q A;  1MH4 A;  3OYK A;  4A3J J;  4XN8 A;  4QLC U;  1WHU A;  2KPM A;  4ESB A;  4E7I A;  1I3Q J;  3FZV A;  2ESN A;  3F8F A;  1JT6 A;  4MQV A;  4HLX A;  3OYH A;  2KDO A;  4KDP A;  1MW7 A;  2BV6 A;  4L9V A;  2VB6 A;  3CCU I;  4ZYD A;  4I09 A;  3I59 B;  4U7D A;  2ELJ A;  4IOA F;  4HSR A;  2H6B A;  3RQI A;  1MZB A;  4ZQE A;  3PSF A;  3MQ0 A;  1R5G A;  1WFX A;  2VJ4 A;  3FBI B;  3OMY A;  2QBY A;  1DQU A;  2VUM J;  2HI3 A;  4DIQ A;  1YS7 A;  3CHR A;  2CH0 A;  3K4N A;  2L4M A;  3DKW A;  3BQY A;  4OMZ A;  4I0B A;  4P96 A;  2IVM A;  4C3J J;  1OYI A;  2VBX A;  4NB5 A;  3GTG J;  1ERD A;  2LVS A;  5J1U A;  4CCO A;  3ZRG A;  3RJP A;  3M3Y J;  4EJV A;  2J5P A;  4IHV A;  3CCQ I;  3CCV I;  2CW7 A;  5IYB J;  1ZAR A;  1WH7 A;  1ENH A;  4IXA A;  2M4K A;  4QWQ A;  1PVE A;  1YJN I;  1HS6 A;  1QZZ A;  3HOW J;  3I58 A;  1Q1V A;  1TTY A;  3HRT A;  3BTL A;  1FOW A;  5IYC J;  4JX6 A;  1JJ8 C;  1Y1W J;  1N75 A;  1Z77 A;  3OWT A;  5DS9 A;  4OAZ A;  3TO9 A;  2W85 A;  3GTK J;  1KQ9 A;  3C18 A;  4KT5 C;  4NQW B;  3RYP A;  3L2U A;  2BXZ A;  5JLW A;  5K5O A;  5AEN A;  1RKW A;  1R5H A;  3V4G A;  2MBF A;  2RC4 A;  3H3Z A;  3DFG A;  2MYS A;  4IO9 F;  3B7T A;  3W3C A;  2B0L A;  3KFW X;  3OOU A;  4Y52 J;  1X1B A;  1YIO A;  2HYJ A;  3W2W A;  3QP5 A;  1ZR4 A;  3HXL A;  3QQA A;  3RC8 A;  2HWV A;  2YPR A;  4XL9 A;  4XKW A;  5B5E C;  2FMY A;  4BBR J;  3SZT A;  2CV1 A;  1BA5 A;  4LGW A;  2EIJ H;  3ZQG A;  1OCT C;  4IKF A;  2I10 A;  2MG4 A;  1AOY A;  2O61 A;  2NS7 A;  4NC6 A;  2R7W A;  4UVC A;  2VT2 A;  4PFP A;  3GLX A;  2EV6 A;  4QPO A;  1AA7 A;  5CQG A;  4HW0 A;  4AIC A;  2D1H A;  2EQR A;  4LIV A;  4ZX6 A;  4BGD A;  4Y4R A;  3EUK L;  3HPH A;  3I9V 2;  1VQN I;  3H3V K;  3G1M A;  3FU5 A;  4WXD A;  3RTR A;  5EF6 A;  2DN0 A;  5FKM A;  4PJJ A;  3ABT A;  3DEU A;  3HPG A;  2WWY A;  3CZE A;  3ASN H;  1ETW A;  1E3P A;  4C2T A;  1SQM A;  3KP7 A;  4MEY F;  4RB1 A;  4PW4 A;  3CDL A;  3M07 A;  3I56 I;  2KRC A;  4C3H J;  4CCN A;  2UV1 A;  1UMQ A;  2P6T A;  1ZQ3 P;  1DGR M;  1MJ9 A;  2L7M P;  5ERI A;  1YJW I;  1T1R A;  3ANL A;  2M30 A;  2GOM A;  3F8B A;  4M73 A;  3R0A A;  4HOB A;  2YU9 J;  3Q43 A;  3F9K A;  3OYD A;  1FX7 A;  2M5W A;  4G6D A;  2MD0 A;  4YII A;  5F08 A;  1LPQ A;  1ZLJ A;  4XO5 A;  2XAF A;  4MKT A;  3LNQ A;  4R7L A;  2AXT C;  4K5O A;  2NVX J;  3FXO A;  2FNP A;  3B3B A;  3BTC A;  2WAF A;  1YIJ I;  4BXU A;  1FWZ A;  3AFH A;  1X19 A;  2DT6 A;  4RAG A;  2JT1 A;  3BR0 A;  3DU5 A;  1NHA A;  3ULQ B;  1Y1V J;  5L3G A;  5D5U B;  2EPF A;  4LB6 B;  1JKQ C;  2EFP A;  2YS9 A;  1IN4 A;  5K7H A;  3CHS A;  3KZZ A;  2JA2 A;  5JVT A;  2LDU A;  1OKR A;  1IO2 A;  4AR8 A;  1JKR C;  3UER A;  3B37 A;  2RGV A;  2VQG A;  3CC2 I;  2NVU B;  3BC8 A;  1MGT A;  1UJ8 A;  4I02 A;  2VN2 A;  3P9K A;  3BY6 A;  3ROU A;  5JR3 A;  2K40 A;  1V4R A;  5E3M A;  3V7R A;  3JRG A;  4OWR B;  1IG7 A;  3GFJ A;  2OF7 A;  2WZF A;  4QIW N;  4EJO A;  2K3F A;  4FLO A;  3S16 J;  2JVG A;  2VBY A;  2EA4 A;  3H0D A;  1RPW A;  3RKW A;  4IHX A;  2XVC A;  4AR1 A;  3CDI A;  3DPU A;  1LJ9 A;  1XS9 A;  3F21 A;  2DPD A;  2VJ8 A;  4U7B A;  1JUS A;  4P9U A;  2BHY A;  3AKZ A;  2OC6 A;  4M6V A;  3FM5 A;  4J00 A;  3S2W A;  3KZY A;  3TOA A;  2E35 A;  3ZMU A;  4XMV A;  5EGO B;  3ANM A;  4OMY A;  2QF7 A;  2GIZ A;  2BY0 A;  3ZPL A;  5DM6 F;  1ONO A;  5CYV A;  1FP2 A;  1ZGJ A;  2R7O A;  2HOA A;  4DGW B;  5IY5 H;  1O3R A;  3VYS B;  3I4P A;  1BC7 C;  2FJ1 A;  1U2W A;  4XOT A;  1WJF A;  1FSE A;  4M72 A;  1NG6 A;  2MC4 A;  4LMY A;  4ZYG A;  2CJJ A;  3QOE A;  2H94 A;  2LH9 A;  1T0F A;  3QWL A;  3LSI A;  4DYC A;  3IRR A;  3VB2 A;  1HXD A;  1XX5 A;  3RC3 A;  5E18 F;  3CCS I;  5BQT A;  1S7A A;  5EZH A;  3LOC A;  3HGG A;  1P92 A;  1RP3 A;  1SD4 A;  3NWS A;  1Q1H A;  4A3B J;  3MKY B;  2WA0 A;  2CGP A;  4L18 B;  2WV1 A;  4QIR A;  4UUS A;  1I1S A;  1AKH B;  4IRI A;  1C0W A;  4R5T A;  3OS2 A;  2RRE A;  3OYL A;  2RNJ A;  4FLR A;  1HST A;  1ONN A;  1VTN C;  3CHO A;  3FKJ A;  1Z0X A;  1SG7 A;  2P8T A;  2CMP A;  3BRO A;  3C3W A;  5E79 C;  2WBM A;  3GFI A;  3L2V A;  2N8G A;  2MSY A;  2X48 A;  2ZNY A;  4CCK A;  4JX4 A;  1OPC A;  3SQN A;  4XLE A;  3UKG A;  2D45 A;  1LFU P;  3UR3 C;  1IN5 A;  1DP7 P;  2KFD A;  3U1D A;  3HBL A;  4BY1 J;  1U3E M;  2WB1 A;  4XRS A;  1Z9C A;  3CZ6 A;  5ILS A;  2ZXH A;  1J5Y A;  5AIQ A;  1G4D A;  4YG2 F;  1OJL A;  4XK4 A;  2W00 A;  3OIP A;  4L0Y B;  2DK5 A;  1K6Y A;  4NNJ A;  1ZR2 A;  2VE8 A;  3J7A Y;  4AIH A;  2C5Z A;  5JMW A;  2DMN A;  4LK0 F;  1S29 A;  4FTH A;  3K2Z A;  1S46 A;  2Q0O A;  3H1C A;  2JV7 A;  3G3Z A;  2IGO A;  4UNO A;  1ZGW A;  3Q0V A;  3SEQ A;  2H1L A;  2IPQ X;  2BGC A;  3V8K A;  4G12 A;  3VSL A;  1U8R A;  2CUJ A;  5F6F A;  1FBS A;  1TLH B;  2VOP A;  4MHG A;  2R7Q A;  3FUH A;  3ESW B;  2OCC H;  4ZYA A;  5J4V A;  3ERE D;  2M8G X;  3PO3 J;  4OOF A;  2IAI A;  2OCE A;  2IGK A;  1X2M A;  3NEU A;  1G3T A;  3K0L A;  4F92 B;  2R5Z A;  1APL C;  1P7J A;  1K4T A;  3R60 A;  3T8R A;  1MBH A;  2YU3 A;  2NNY A;  4EEF G;  2Q2E A;  1BI3 A;  1FNN A;  4ZYH A;  3F0C A;  3H5A A;  4HRI A;  4RVB A;  3IWF A;  3IUO A;  2KRF A;  3FUF A;  4NC8 A;  2R5Y A;  4XN1 A;  2VI6 A;  3E5U A;  2G9W A;  3RI4 A;  1MW2 A;  3S14 J;  1JGS A;  3SFZ A;  1SFO J;  2ZXJ A;  1ACI A;  4CA0 A;  4G7Z F;  4ZTF A;  1Y0N A;  4FX0 A;  1FOY A;  4BHP A;  4DQ2 A;  3OYE A;  3KYL A;  3H3U A;  2HZD A;  5DM7 F;  2LF8 A;  3ZQI A;  1IV8 A;  3FH7 A;  4ETS A;  3ABK H;  4H0E A;  1EV7 A;  5BMZ A;  3FK6 A;  1OR7 A;  1OYY A;  1UG2 A;  3QU3 A;  2DQL A;  2D5V A;  1ZRD A;  3BR2 A;  3KPH A;  3CUQ B;  2HKO A;  2V6C A;  5FKL A;  3WTS C;  2Y30 A;  2O3F A;  3KCC A;  2O7O A;  3KYD B;  4AU7 A;  4A3K J;  3JRA A;  2GOX B;  3AU8 A;  1U9O A;  2L9N A;  2VXZ A;  3BOQ A;  4DYR A;  5HNH A;  2DBB A;  2XC7 A;  5JMP A;  3CJR B;  2KHM A;  3ECH A;  5DD8 A;  1O3T A;  2D1V A;  4XMY A;  2O0Y A;  2P0W A;  3K1N A;  1T0F C;  1W7P B;  2F5V A;  4GO1 A;  2XPY A;  1RES A;  3RSN A;  2ESH A;  4XRS G;  3PNT A;  4S05 A;  2K5C A;  3TO6 A;  1G5A A;  3WTY C;  3UEQ A;  3WTZ A;  5LRR A;  4XN2 A;  2DTZ A;  3ZHY A;  4IL6 C;  4K2E A;  3VSK A;  1ZHF A;  4LJZ F;  3ELK A;  1TWC J;  1CGP A;  2H27 A;  5HNF A;  1USS A;  3HG9 A;  2PJR B;  2XAH A;  1X1D A;  2HZT A;  2LF7 A;  3DBH B;  4BHB A;  4BQO A;  3FU0 A;  2Q2E B;  5B1B H;  2V4J C;  1ODD A;  2R7V A;  5HLH A;  2V7F A;  4OAY A;  2R5Y B;  3WU0 A;  3AUA A;  1O57 A;  2MLK A;  2PMZ N;  2HPO A;  4WX9 A;  4F93 B;  3FXJ A;  4K5L A;  2PL5 A;  3T8T A;  1ON2 A;  4ENK A;  4FAS D;  2CG4 A;  1R1U A;  2DT7 B;  4II2 A;  3KET A;  1QRY A;  2MAO A;  1MMD A;  1GDT A;  2DFI A;  3UNG C;  3G2B A;  2K4J A;  2CW0 F;  3JTG A;  3QP6 A;  1GV5 A;  2ZME A;  1PP8 F;  1WJB A;  3M1E A;  2I8D A;  4DZP A;  3R0I A;  3I64 A;  2JN6 A;  3B2P A;  1JXS A;  3B6C A;  1KA8 A;  1D0X A;  2JPB A;  2Z33 A;  1X1C A;  3GFL A;  5KAI C;  2E60 A;  3BDD A;  1LNW A;  3S2H J;  2R7T A;  1R0K A;  1S9H A;  2A5W A;  2VKD A;  3AL0 B;  5DLL A;  2FQ4 A;  4RS8 A;  1UHM A;  3N05 A;  5CVU A;  2PX9 A;  3T0Y A;  4K5P A;  1LFP A;  3DWL E;  3K1M A;  1T33 A;  1V3F A;  3FUD A;  3PSI A;  3PUU A;  2Y2Z A;  5JNL A;  5DV5 A;  9ANT A;  3E97 A;  2OUM A;  1MND A;  2VQC A;  1FBU A;  2F5D A;  2O7G A;  4ZW8 A;  1MBE A;  3OY9 A;  2VQL A;  5M3M J;  2PI0 A;  4DBQ A;  4BXX J;  1FMV A;  2XPZ A;  2OJE D;  3K4M A;  3SDG A;  2QSH X;  1W5C C;  3JT1 A;  4L9T A;  4LFU A;  5DCM A;  3TGN A;  2WV0 A;  4GFB A;  1TT0 A;  5KAF C;  5FD5 A;  1SVM A;  2HPI A;  3TKY A;  4UV9 A;  1Y6I A;  3ANN A;  3OL3 A;  2HVS A;  1T95 A;  1ZGA A;  1SMT A;  2QQ8 A;  4U0W A;  2CWE A;  4AYB A;  2P81 A;  1FOK A;  3BWG A;  5D5V B;  3VVL A;  1DU6 A;  6PAX A;  3S17 J;  4ZZD A;  5ILU A;  2WZG A;  1D1A A;  4U0Y A;  2H1K A;  5LGT A;  1KU2 A;  3JRH A;  3FMS A;  5JFR A;  4ZQF A;  5IYD J;  4XMT A;  1KU7 A;  3HUG B;  4N9I A;  1TWH J;  2BY3 A;  1Q0Q A;  3FIS A;  5JLX A;  2GXB A;  1O3Q A;  5M3F J;  4Y6P A;  3K70 D;  2VIX A;  1FLI A;  1DDN A;  2C82 A;  1RZ4 A;  1XN7 A;  2E2J J;  1OR7 C;  3ZP5 A;  4ENN A;  4EM1 A;  1IAW A;  2HPM A;  3B7R L;  4I01 A;  1QHH D;  1QGP A;  4YEJ A;  4ZJZ A;  1UST A;  2XPW A;  1WWX A;  4DZJ A;  2LKX A;  4CGZ A;  1V5F A;  4UB6 C;  3FXQ A;  3MCZ A;  3RAS A;  4A3F J;  1B6A A;  1T56 A;  3ZN1 A;  3CIA A;  3JRB A;  1FIA A;  2VPL A;  4IX7 A;  4N9H A;  2JRM A;  2JUC A;  4M3F A;  2LC2 A;  3GTO J;  5LD2 C;  5JI6 A;  3A0B C;  1BI2 A;  1QPM A;  2OPT A;  3WGG A;  5K5R A;  4N4O B;  1QU3 A;  5DUL A;  3A4C A;  3EYI A;  3ECO A;  3ABU A;  2Z9O A;  1ON1 A;  1UFM A;  4QME A;  4XNB A;  2QLZ A;  2IGN A;  4OIR F;  3TOB A;  5B66 C;  3BLY A;  1K78 B;  2O6G E;  5BOX A;  3O6B B;  4L5I A;  3GLL A;  3NWT A;  4C9Y A;  1SD7 A;  3DEE A;  1ONP A;  3PL8 A;  4RMN A;  2W57 A;  3WU1 B;  1KQ8 A;  2DO7 A;  1D8K A;  3PNY A;  1J59 A;  3BG6 A;  4XLF A;  2CFO A;  1WJ5 A;  1YTY A;  2XDV A;  1PUE E;  4UXN A;  2WAE A;  5IP7 J;  3OYB A;  5FGM A;  4LG0 A;  3H9J A;  1GV2 A;  3L2R A;  2ZME C;  3C2G A;  4Y6R A;  1E2X A;  4XNF A;  1R6R A;  4HYE A;  3VEP A;  2BOL A;  2VAS A;  4IRG A;  5A2Q Z;  3L1P A;  5FO5 A;  2IA1 A;  4WWC A;  3KEO A;  2Y48 A;  5HOO A;  1WVR A;  1I5Z A;  1GVD A;  2FA5 A;  2HXO A;  1HKS A;  1P4X A;  2XGD A;  1MJB A;  1S5L C;  1I1G A;  2PMH A;  3B02 A;  4TV7 A;  2QVO A;  2VJI A;  4NUB A;  5LRS A;  3ZCO A;  5E3O A;  4I76 A;  2JD1 A;  4E7L A;  4E6K G;  4OOE A;  3WQQ A;  4CHU A;  1B72 B;  1IW7 F;  3L00 A;  4XIC A;  3EET A;  2QGU A;  3E5X A;  4B8X A;  3I4N J;  5DYM A;  3FTX A;  4PU2 A;  5E3L A;  1Z3Y A;  1IV6 A;  5HS9 A;  1D5V A;  2ID3 A;  4G9Y A;  3HRM A;  4HQM A;  2FBH A;  3JRI A;  4PCQ A;  4HDU A;  1IJW C;  3FKI J;  4IHY A;  3FIW A;  4R1H A;  2K4B A;  3F8N A;  2CV2 A;  1ONV A;  1FIP A;  5M5X J;  1RR8 C;  1ZG5 A;  1EH6 A;  1W0U A;  2MC3 A;  3PO2 J;  1G2H A;  2FD5 A;  2IEK A;  3GEZ A;  3HL2 A;  2KDZ A;  1RIO H;  5FKO A;  2JD0 A;  4XN7 A;  1JTX A;  2E71 A;  3OYM A;  2QUF A;  3BJ6 A;  4L5J A;  2DMP A;  4R8H A;  2HDC A;  2OZ6 A;  1FTT A;  2COM A;  3IH3 A;  3UCQ A;  2RKH A;  3FUL A;  5FWQ A;  4Q4Z F;  2XF7 A;  3FXR A;  4B4C A;  1UG0 A;  3M8F A;  1MBF A;  1SAN A;  4JQF A;  4MS6 A;  2L54 A;  1TBX A;  2PFB A;  5DD4 A;  1K4S A;  2GBY A;  3GF2 A;  1D0Z A;  5GTI C;  3L2Q A;  4AM3 A;  1P7I A;  1XCV A;  5A2Q K;  4QHP A;  3FUN A;  2ECC A;  4A3C J;  3FUE A;  3OIQ A;  2LSO A;  4M3B A;  2CO5 A;  2NYX A;  5FLV A;  2H8W A;  1Z91 A;  3FBN B;  4XLP F;  1B1B A;  3TO7 A;  3L7W A;  3LSP A;  1IDY A;  5CVJ A;  2DOF A;  4ANJ A;  2PUS A;  2K02 A;  3QAH A;  2FEZ A;  2EB7 A;  1SD5 A;  4IRH A;  1XG1 A;  2KLO A;  2NAZ A;  3CUO A;  4A3I J;  5GPA A;  1QNT A;  3S3O A;  2DYR H;  4XBF A;  4XSZ F;  1FPQ A;  4C3I J;  2FSW A;  2BBY A;  4Q47 A;  4QPQ A;  1MW3 A;  1LFB A;  3GO5 A;  2DMU A;  3HOY J;  4XMU A;  2COB A;  3QPL A;  2M8E A;  4HQE A;  4JK1 X;  3R6S A;  3BQZ A;  1J9I A;  2ICW G;  4X0G A;  4BYY A;  3VYT B;  2HQA A;  2KKO A;  2ZCW A;  3BCB A;  5EZG A;  3M7G A;  1MBK A;  3MD2 A;  3D0S A;  3L9F A;  3GTJ J;  1K5H A;  5KHD A;  1ZS2 A;  3MKZ A;  3BR3 A;  1W0T A;  4HF2 A;  2X6X A;  3DXJ F;  3I53 A;  4CCM A;  2VQH A;  5K5Q A;  2V6E A;  3PIP F;  4KA4 A;  1B9M A;  2FQ3 A;  3HSF A;  3PM1 A;  2EZH A;  1UHW A;  2DA1 A;  3Q9S A;  3FF5 A;  4Y67 A;  1K61 A;  2GZW A;  4PGG A;  1ETX A;  5LHI A;  3JSP A;  2P7V B;  3TQN A;  1SMY F;  3QPS A;  2M2E A;  1X2N A;  4XO3 A;  2VXD A;  1XB4 A;  1FC3 A;  1MW1 A;  3K4C A;  2DA3 A;  2QWW A;  2V1N A;  3NQO A;  1ZG1 A;  2HEO A;  5GP9 A;  1OYW A;  1TW3 A;  4PJL A;  3T1B A;  2P7C B;  5DYF A;  2KJC A;  3TP3 A;  2LRE A;  3CF5 F;  4HNT A;  1JTY A;  1K7A A;  3WTT C;  3K4B A;  3KLO A;  2LY2 A;  4BAC A;  5F64 A;  2ZFW A;  3ZMV A;  1MD0 A;  2QBY B;  4G8X A;  4Y33 A;  4KFC A;  4XOP A;  3EPZ A;  5J3L A;  2IT0 A;  3CCY A;  4A12 A;  1JHF A;  1NTC A;  1IUF A;  4LIU A;  3TDZ C;  4BQA A;  1GT0 C;  5JAZ A;  2XAU A;  3J7Z I;  3VYR B;  5EEG A;  5FKN A;  1CF7 A;  4IQ4 A;  4A0Z A;  3CLQ A;  4Y3O A;  2R7D A;  4HNV A;  1E3O C;  1TT5 B;  4M9S A;  2W25 A;  3GFM A;  1SVO A;  1IDZ A;  2PEX A;  3ASO H;  3K1P A;  4XQF A;  4S04 A;  3KP5 A;  4RM2 A;  2XV4 S;  4NHJ A;  1KU3 A;  2QYO A;  4LG3 A;  3PUB A;  3LSR A;  3BR6 A;  1FBQ A;  1LVK A;  3WG7 H;  1XSV A;  4FET A;  3BZ6 A;  1R00 A;  4A3L J;  1SAX A;  4M71 A;  5H20 A;  1O7L A;  4E7K A;  1R4N B;  1IN7 A;  4HG2 A;  4O5V A;  4HPQ A;  4CYC A;  1JKP C;  4A3D J;  3FXK A;  4F3Q A;  3MKW B;  1BOB A;  1BBY A;  2STW A;  2R7Z J;  2DCE A;  2LG4 A;  3LAJ A;  2HDW A;  3HKZ N;  3HYI A;  2JUG A;  2V1D A;  3LFU A;  2YX4 A;  1QPI A;  5DUK A;  3WOD F;  2A6E F;  3P7N A;  3CC7 I;  3O2P E;  4XID A;  1VFC A;  1BI0 A;  1IZ1 A;  4HAM A;  3RKQ A;  2A5Y B;  2P5V A;  4U87 A;  3U1K A;  1B8I A;  2F5F A;  4AVP A;  1YOV B;  2KIQ A;  5K7Z A;  5HDK A;  3IC7 A;  3HOV J;  1A6I A;  4B3X A;  2K9Q A;  1TQM A;  1UZC A;  5KCM A;  3OYF A;  3BZK A;  2VLA A;  3WE3 A;  2W1O A;  3OYA A;  3EBH A;  5LGU A;  2R59 A;  3BR1 A;  4FCA A;  4PJN A;  4RDU A;  4A5N A;  3COA C;  5M5W J;  1T2K A;  1JKO C;  3S2D J;  5D8K B;  4PDK A;  1XMX A;  4PSW A;  5D4S A;  3W6V A;  2L9S A;  2QZ8 A;  5EJC A;  1VQ9 I;  1E17 A;  2JVH A;  1S3J A;  2HTJ A;  2Y0S A;  1AHD P;  2MAB A;  1CF7 B;  4BKX A;  1BL0 A;  3HIF A;  3QYF A;  1NK3 P;  4ZX3 A;  2EV5 A;  1Z1D A;  3QYE A;  3T5X A;  2LBF A;  3FH8 A;  1UHS A;  2JPC A;  2G7H A;  2M9H A;  4BE0 A;  3DV8 A;  1X58 A;  2Q1Z B;  2F6C A;  5D5W B;  1U5T A;  1X1A A;  3LST A;  5CPR B;  1R23 A;  3TDU C;  4ZDO A;  3IH2 A;  1WPK A;  2VJ5 A;  1POG A;  2RAE A;  2ELK A;  4N4N B;  1TWG J;  2K9L A;  2ZBK A;  4AD9 A;  3ERM A;  3K4L A;  2LD5 A;  4DPR A;  2XPU A;  3DKY A;  1R58 A;  4UHT A;  2DQ6 A;  4A3M J;  3W6K B;  1RRJ A;  4E7H A;  3WE2 A;  2CV0 A;  2R7U A;  3LA3 A;  3HJE A;  4GGG A;  3S1N J;  3FXU A;  3TW7 A;  5F1J A;  3FMR A;  2JCX A;  1SVL A;  3RIR A;  2X9D A;  2TDX A;  3TW6 A;  4A03 A;  3FWE A;  5J40 A;  4XN9 A;  3FX3 A;  2PG4 A;  4HX4 A;  4GAE A;  4II3 A;  5FB2 A;  4XKV A;  3U9W A;  5E1X A;  1J7K A;  2OQR A;  2MLG A;  2H8R A;  2OBP A;  4I7H A;  2FF4 A;  1HA8 A;  5EEH A;  5GPC A;  2IW5 A;  2WAQ A;  5CKT A;  4EJW A;  1ZN2 A;  4J3B A;  2VKV A;  1W36 C;  4GYI A;  4ZN6 A;  4AID A;  1HC8 A;  3MVP A;  4ZW6 A;  4G7H F;  1X4O A;  3OYN A;  1UB9 A;  3E6M A;  3RQ4 A;  2HYG D;  4PFO A;  1VF9 A;  2BW3 A;  3G1L A;  3A0H C;  1K6O A;  2DT5 A;  1Y8Q B;  4IZZ A;  2DJN A;  5J1Y A;  2MFZ A;  1BM9 A;  5ICE A;  3GVA A;  2GA1 A;  1VQL I;  2Y1D A;  3RPU A;  4XM3 A;  3S3N A;  3U9G A;  3F6O A;  1WI9 A; 
#chains in the Genus database with same CATH homology
 2LOO A;  3UNG C;  2EGH A;  4P1W A;  3G2B A;  4BDY A;  2O5R A;  2K9M A;  3H9Q A;  3TMO A;  1WJB A;  2X1E A;  2KL4 A;  2JSP A;  2I8D A;  3R0I A;  4CSW A;  4XMX A;  2AQF A;  2KQR A;  3B2P A;  4ARF A;  2IS1 A;  5LFA A;  3CZL A;  2LYC A;  3FUK A;  2B61 A;  1D0X A;  4ITV A;  2VL8 A;  2ZSH B;  3EUA A;  4R5X A;  1X1C A;  4XO4 A;  2E60 A;  5FRN A;  2R7T A;  1R0K A;  3BCA A;  1S9H A;  4XN3 A;  4R79 A;  2A5W A;  2VKD A;  1WJD A;  3OR1 C;  3AL0 B;  3K6G A;  5DLL A;  2X85 A;  1OLT A;  3N05 A;  4XMW A;  3FHN A;  4K5P A;  3H5N A;  3T0Y A;  1LFP A;  3DWL E;  4PSX A;  4AR9 A;  3FUD A;  3PSI A;  3PUU A;  2ZSI B;  2E1M C;  4IQJ A;  5JNL A;  4R5V A;  1IRX A;  1GLN A;  2OUM A;  2E5N A;  3U21 A;  4BS9 A;  1MND A;  4HNU A;  2PGG A;  2VQC A;  1Z21 A;  2O7G A;  1YX5 A;  4ZW8 A;  3OY9 A;  2VQL A;  2XPZ A;  3D5S C;  4DBQ A;  1FMV A;  4ZQT A;  4B44 A;  3K4M A;  3JT1 A;  3M1C A;  1DP3 A;  3FUM A;  1Q0L A;  1TT0 A;  1PYV A;  2HPI A;  4XON A;  2Y1G A;  1Y6I A;  3ANN A;  3OL3 A;  3S93 A;  2HVS A;  1T95 A;  4RCV A;  4CCL A;  4DBR A;  4FLS A;  2E5Z A;  4KP7 A;  3LSH A;  2V26 A;  1N78 A;  2A6T A;  3DU6 A;  3LSK A;  4AYB A;  4ZDP A;  1G59 A;  3PJR A;  3VVL A;  2IS4 A;  4E7Z A;  4D1Q A;  1JI8 A;  3OYK A;  1D1A A;  2WZG A;  4XN8 A;  2M3A A;  2KPM A;  4E7I A;  4L2L A;  2HU9 A;  4ZQF A;  1SFK A;  1SC5 A;  4F52 A;  4K5M A;  3JSZ A;  4XMT A;  3IAM 2;  2X6W A;  3HUG B;  2IS6 A;  3OYH A;  1D1C A;  5HLT A;  1Q0Q A;  2KDO A;  1WJC A;  2UUZ A;  1PJR A;  1MW7 A;  4ZW3 A;  2VB6 A;  4Y6P A;  3K70 D;  2VIX A;  3OL4 A;  2C82 A;  4RM3 A;  2ELJ A;  1OR7 C;  4HEA 2;  4HSR A;  2HPM A;  4ZQE A;  2BVM A;  3B7R L;  3PSF A;  1QHH D;  1WFX A;  2VJ4 A;  3FBI B;  3OMY A;  1TZL A;  4YEJ A;  4ZJZ A;  1DQU A;  3EBI A;  4DIQ A;  1V5F A;  3CHR A;  2CH0 A;  3K4N A;  1G8X A;  2ZXI A;  3RAS A;  2DOA A;  1ERD A;  3CIA A;  2VPL A;  4CCO A;  4PJM A;  3ZRG A;  4BXF A;  4IX7 A;  3FU3 A;  2KP6 A;  1Z7L A;  4HST A;  2LC2 A;  2E1M B;  5LD2 C;  3FU6 A;  2CW7 A;  3B34 A;  1LKX A;  4N4O B;  1QU3 A;  3FUJ A;  3A4C A;  2DQM A;  5DUL A;  3MMY B;  2M4K A;  1HS6 A;  2WPG A;  4CZC A;  4D9J A;  2R7S A;  2RQQ A;  2IS2 A;  2F4I A;  1N75 A;  4KIS A;  4GAA A;  4QME A;  3OWT A;  1H3L A;  4XNB A;  2IGN A;  3LSG A;  1ZEL A;  2AQE A;  3BLY A;  4OAZ A;  1Q0H A;  2CUZ A;  3CJQ B;  4NQW B;  4BQN A;  3L2U A;  1VZ0 A;  3QJX A;  3B7U X;  5AEN A;  3NWT A;  4C9Y A;  3ZXS A;  2NOJ B;  3A1Y A;  3DEE A;  1ONP A;  3PL8 A;  1H19 A;  2MYS A;  4RMN A;  3KEY A;  3AU9 A;  3CZG A;  3B7T A;  3W3C A;  3CHP A;  3OOU A;  1X1B A;  4PUS A;  3W2W A;  3PNY A;  4BEH A;  2X1C A;  3BG6 A;  2CFO A;  3HXL A;  4XLF A;  1T1S A;  4B48 A;  1WJ5 A;  3H9G A;  1P9Q C;  4XL9 A;  2JD2 A;  3VVM A;  3RC8 A;  2XDV A;  4XKW A;  1X3Z A;  2LY1 A;  2CV1 A;  3DPL C;  2WAE A;  2LBF B;  4BJ5 C;  3OYB A;  3A14 A;  4IKF A;  3H9J A;  4BQQ A;  3ONQ A;  3HOS A;  3L2R A;  2R7W A;  4PFP A;  4QPO A;  5CQG A;  1AA7 A;  3C2G A;  4BJT A;  4BE1 A;  4E7J A;  4Y6R A;  4AIC A;  4LIV A;  4ZX6 A;  4XNF A;  1R6R A;  4BGD A;  2BOL A;  2VAS A;  4G6T B;  3QOD A;  3EUK L;  3HPH A;  3I9V 2;  4Y4R A;  2R70 A;  3FU5 A;  3RTR A;  5HOO A;  3VDX A;  4PJJ A;  4E4H A;  2UWM A;  5JHF A;  3HPG A;  3CZE A;  4C2T A;  1SQM A;  4PW4 A;  3S32 A;  4EAT A;  3CP2 A;  3K4K A;  3DTE A;  2VJI A;  2KRC A;  4NUB A;  3ZCO A;  4CCN A;  2UV1 A;  1NG7 A;  4LIT A;  2JD1 A;  4BU2 A;  1DGR M;  4E7L A;  4E6K G;  4OOE A;  3DPT A;  1JG9 A;  1T1R A;  1MW0 A;  3WQQ A;  4BE2 A;  3ANL A;  3LL7 A;  2GOM A;  1V5G A;  3FTX A;  4PU2 A;  1EA3 A;  1Z3Y A;  1UAA A;  1X3W A;  5FRM A;  3Q43 A;  3F9K A;  3OYD A;  3FTV A;  2MD0 A;  3CMM A;  2QKL B;  1LDK B;  4XO5 A;  5EV7 A;  4MKT A;  2CV2 A;  4XNA A;  4XLA A;  4R7L A;  3CP8 A;  4K5O A;  4XN0 A;  2M4G A;  2IGM A;  3B3B A;  2KZV A;  2WAF A;  1J09 A;  3AFH A;  1X19 A;  2DT6 A;  2BW3 B;  3HL2 A;  3DU5 A;  2JD0 A;  4XN7 A;  4DOZ A;  4ZX4 A;  4BEH B;  3PFY A;  3OYM A;  3UCQ A;  1BR2 A;  1U0J A;  2PMZ A;  3FUL A;  5FWQ A;  2XF7 A;  4XND A;  1UG0 A;  3CHS A;  1X4P A;  3ZR8 X;  4JQF A;  2JA2 A;  4MS6 A;  4X2U A;  3SDB A;  2L2O A;  4BJ6 C;  4JND A;  3UER A;  4AR8 A;  1BR4 A;  2Y1C A;  1D0Z A;  3B37 A;  3L2Q A;  2VQG A;  2Z16 A;  5CQE A;  4QHP A;  1DGW Y;  2V9K A;  3H5R A;  3FUN A;  3BC8 A;  4B47 A;  3FUE A;  2W7N A;  1WJE A;  3OIQ A;  3SZG A;  1JGI A;  3V42 A;  3FBN B;  3FDY A;  3K10 A;  2PUS A;  4ANJ A;  3LSM A;  4B43 A;  2BVL A;  3DLA A;  2KMU A;  2PJR A;  1SAU A;  4OWR B;  2KLO A;  4RSY A;  3SYT A;  4ZQG A;  4AYS A;  3S3O A;  2WZF A;  3ZHX A;  4FLO A;  4XOR A;  3K70 C;  2JVG A;  3VWB A;  3E0J B;  4DJA A;  3H0D A;  2W4S A;  2R72 A;  4QPQ A;  3ZHZ A;  1MW3 A;  2CW8 A;  4AR1 A;  3L2W A;  3DPU A;  4XMU A;  2LRD A;  4Q4I A;  4CUG A;  3S3M A;  3OYJ A;  4X0G A;  2VJ8 A;  3VYT B;  2HQA A;  4U7B A;  3BCB A;  3AKZ A;  2OC6 A;  3MD2 A;  3OYI A;  4J00 A;  4XMV A;  4RLF A;  5KHD A;  1K5H A;  4K5N A;  5TGT A;  1ZS2 A;  3ANM A;  3D5L A;  3MKZ A;  1ONO A;  2X6X A;  4CCM A;  2VQH A;  3OS0 A;  3OYG A;  1KON A;  2R7O A;  4DGW B;  2V6E A;  4Y6S A;  3OS1 A;  3VYS B;  5JC1 A;  2R7R A;  2XSJ C;  4XOT A;  2WY7 Q;  1WJF A;  2M0M A;  4Y67 A;  1NG6 A;  2MC4 A;  4CXF A;  2VKH A;  4BDZ A;  3WQS B;  1JVS A;  4ZTJ A;  2GTQ A;  3QOE A;  1W36 D;  4E7S A;  3FHE A;  3QYB A;  4XO3 A;  2LH9 A;  2VXD A;  3K4J A;  3LSI A;  1MW1 A;  4PK4 A;  3K4C A;  2V1N A;  3ZI0 A;  3RC3 A;  4YEL A;  2RNG A;  4PJL A;  1RP3 A;  2QVW A;  5DYF A;  3NWS A;  3MKY B;  2WA0 A;  2LRE A;  4HNT A;  2WY8 Q;  1MMA A;  4BL0 B;  4QIR A;  4BAC A;  3K4B A;  1YE9 A;  2LY2 A;  3EBG A;  4Y33 A;  3PNV A;  4R5T A;  4YRV A;  2RRE A;  3SEZ A;  3EUH C;  3OS2 A;  4XOP A;  3OYL A;  5JBI A;  4FLR A;  3EPZ A;  2ZFU A;  3DTK A;  1ONN A;  3CHO A;  3FKJ A;  3ZGK A;  4BUP A;  1SG7 A;  4ZQH A;  4LIU A;  4F55 A;  2CMP A;  5JAZ A;  3FH5 A;  2XAU A;  3CZK A;  3FUI A;  4CCJ A;  2WBM A;  1D0Y A;  2XF5 A;  3VYR B;  4KIT B;  3L2V A;  4IQ4 A;  3IP4 B;  4Y3O A;  2X6Y A;  4CCK A;  4ZC3 A;  4XLE A;  4H4K C;  3UR3 C;  3OYC A;  3BG7 A;  4XQF A;  2HVQ A;  4XLC A;  2WB1 A;  4RM2 A;  1D1B A;  5JO0 A;  3CZ6 A;  2ZXH A;  4NC7 A;  2FUG 2;  4LG3 A;  3TBI A;  1YX3 A;  3LMM A;  3PUB A;  3VYU B;  2W00 A;  3DKX A;  1LVK A;  3OIP A;  4FET A;  3I3L A;  1K6Y A;  4NNJ A;  3Q44 A;  1QHG A;  3C2H A;  4E7K A;  4HG2 A;  3J7A Y;  1MNE A;  4HPQ A;  4RLQ A;  3FTY A;  2M7A A;  4F3Q A;  3MKW B;  2C5Z A;  1BOB A;  3H35 A;  5JMW A;  1S46 A;  2DCE A;  2LG4 A;  2JV7 A;  4QUO A;  2HDW A;  3GBG A;  4KT6 A;  2KRH A;  2HPT A;  2JUG A;  1UEL B;  3LFU A;  2IGO A;  2XF6 A;  2QJ1 A;  5HVQ C;  3SEQ A;  3A06 A;  4MLO A;  4CH7 A;  3FTU A;  3VSL A;  2CUJ A;  4XN5 A;  2R7Q A;  4U87 A;  3FUH A;  4PVB A;  4ZYA A;  3W2A A;  2A7O A;  2FFL A;  4OOF A;  2IGK A;  3DQV C;  2OV7 A;  4B3X A;  3OYF A;  5KCM A;  2VLA A;  4F92 B;  3B7S A;  1MVY A;  4NQW A;  3B2X A;  3IIE A;  2W1O A;  3OYA A;  3EBH A;  2R59 A;  4FCA A;  1N77 A;  2X1D A;  2X51 A;  4PJN A;  4XLH A;  2K3P A;  2R4G A;  3FTZ A;  4PSW A;  4XKC A;  4F91 B;  2L9S A;  2JVH A;  4RVB A;  4HRI A;  3H5A A;  3FTS A;  2Y0S A;  3IUO A;  3FUF A;  2MAB A;  4NC8 A;  3A2K A;  4XN1 A;  4BKX A;  2L5Q A;  3QYF A;  4ZX3 A;  2ZXG A;  3QYE A;  1MW2 A;  1BR1 A;  2LBF A;  3D5R C;  3FH8 A;  2JCV A;  4CA0 A;  4BE0 A;  4ZTF A;  2Q1Z B;  2F6C A;  4XMZ A;  1X1A A;  5CPR B;  3OYE A;  3KYL A;  4ZDO A;  2QKM B;  2HZD A;  2Y1E A;  4J01 A;  3FH7 A;  2VJ5 A;  3HOT A;  4N4N B;  1OR7 A;  2K9L A;  5BPP A;  4XKB A;  3K4L A;  2HNH A;  2DXI A;  4ZW7 A;  3HC7 A;  4DPR A;  3DKY A;  4QPE A;  3T8V A;  2L7K A;  1FMW A;  2DQ6 A;  2Z2S B;  1R0L A;  4E7H A;  2R7U A;  2CV0 A;  4AU7 A;  2CS3 A;  4ZX5 A;  1Y56 A;  3KED A;  4AVZ A;  2GOX B;  2JCX A;  2R7X A;  3AU8 A;  3AL0 C;  2L9N A;  4LUP A;  2VXZ A;  5HNH A;  4P5O A;  2XC7 A;  3HKZ A;  3M8J A;  5JMP A;  3CJR B;  2KHM A;  3OR2 C;  1MMG A;  4A03 A;  3CHQ A;  4XMY A;  4XN4 A;  4XN9 A;  2P0W A;  1T0F C;  4GAE A;  2F5V A;  4II3 A;  2XPY A;  4XKV A;  3U9W A;  3RSN A;  5FRO A;  2Z1D A;  5KNL A;  3PNT A;  2K5C A;  4ZDL A;  1G5A A;  4JOM A;  2W82 A;  3S8P A;  3W2V A;  3UEQ A;  1V5E A;  3ZQQ A;  4FLQ A;  1HA8 A;  1E0E A;  4XN2 A;  3ZHY A;  3E1S A;  2WAQ A;  5CKT A;  3VSK A;  2Y1F A;  4J3B A;  1W36 C;  4ZN6 A;  3CES A;  5HNF A;  4ZW6 A;  2M7B A;  1GW6 A;  3TL4 X;  3RPU D;  3HG9 A;  2PJR B;  1X4O A;  4Q4E A;  1X1D A;  3OYN A;  2VJJ A;  3CF2 A;  2RJI A;  3WQR A;  3RQ4 A;  4PFO A;  2MAP A;  2BW3 A;  4BQO A;  3FTW A;  3FU0 A;  4C30 A;  2Q2E B;  2V4J C;  3IAS 2;  1Z3X A;  4ZW5 A;  2R7V A;  3KX2 A;  2V7F A;  1MMN A;  4OAY A;  3AUA A;  2IXS A;  3DTI A;  4XR6 A;  2XQ0 A;  4KJZ A;  2HPO A;  4IZZ A;  2HVR A;  2MFZ A;  2WAD A;  4F93 B;  4K5L A;  2PL5 A;  4C2U A;  2JCY A;  2DJI A;  2Y1D A;  4FAS D;  4XM3 A;  2DT7 B;  4II2 A;  3S3N A;  4GRI A;  2MAO A;  1WJA A;  1MMD A;  3RCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...