3T0YA

Structure of the phyr anti-anti-sigma domain bound to the anti-sigma factor, nepr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
126
structure length
126
Chain Sequence
PMSLLARLAPHLPYIRRYARALTGDQATGDHYVRVALEALAAGELVLDANLSPRVALYRVFHAIWLSSAGDDAAQRLMRIAPRSRQAFLLTALEGFTPTEAAQILDCDFGEVERLIGDAQAEIDAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator/protein binding
molecule keywords Response regulator
publication title Structural basis of a protein partner switch that regulates the general stress response of alpha-proteobacteria
pubmed doi rcsb
source organism Caulobacter vibrioides
total genus 45
structure length 126
sequence length 126
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3t0yA02
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 3t0yA01
5ILSA 2F2EA 3K1PA 4BHCA 4RAYA 1OYWA 2FF4A 3ECHA 2F5CA 3IL2A 2ZBKA 5DYMA 1PP7U 3RDIA 1W5TA 2BYVE 4HYEA 1K78B 1KU9A 2IA2A 3MCZA 3BP8A 1FSHA 3WQQA 2LF8A 2FBHA 2RN7A 4L9NA 4CICA 2FMYA 3F6VA 4TV7A 2JRTA 1YG2A 2V1DA 1S6LA 1O7LA 3LAPA 4AYSA 4G7ZF 2A6HF 1A04A 2ZMEB 5F64A 3ISPA 2HDCA 3F8FA 4HW0A 3QU6A 2EV5A 1FZPB 1PUEE 2Y1EA 2P5KA 2MC3A 4WCGA 4IPAA 3VEPA 4XSZF 5JVTA 1JGIA 3QOPA 1I1GA 1QQIA 3QPTA 3AAFA 4U88A 3HRTA 3H3UA 4HBLA 3V7CA 1D5VA 3KP6A 3GLXA 4L5JA 3DF8A 5CJ9A 3LWFA 3P9KA 3ZMVA 4OOEA 2A6EF 1IF1A 4HX8A 2K86A 2RVCA 1FSEA 2W84A 3EYIA 1P2FA 3R4KA 2M30A 1H9GA 3ZHXA 2H09A 2XAFA 2CGPA 4FLOA 4U0VA 3KP3A 2HR3A 2P7CB 5ILVA 4UVAA 1DDNA 4M73A 4I01A 4GCVA 3I71A 3I54A 1FYLA 2Q2EA 1Z6RA 3KP7A 4M6XA 1TBXA 4L0YB 1I27A 2YPRA 2BE5F 3WE3A 1LDKB 1RUNA 2P6TA 4PGGA 1ZRDA 5JAZA 2L02A 2LDUA 3WGIA 1ZG1A 5KVRA 1R5HA 2M45A 3U1DA 4BHPA 3CLOA 2Y0MA 3EQLF 3GW2A 2HFHA 5IT9K 4LLNA 1O3RA 1YIOA 3FM3A 5LGUA 2JPCA 2OU2A 2GIVA 2VE8A 1SFXA 2XROA 4WWCA 2O0YA 1HW2A 2OZUA 2G9WA 3WTZA 4G6DA 2RV8A 1SFUA 3K9TA 2FRHA 4FLSA 2Z33A 1MW3A 1O7FA 4AIJA 1U5TB 2Q8KA 3DXJF 5H20A 5HS8A 2XV4S 2L4MA 4H0EA 3LA2A 3ZPLA 2IA0A 2YSRA 3CUOA 3HYIA 3T5XA 5L3DA 1MZBA 2L4AA 2VE9A 3BPXA 3L9FA 5DV5A 3IRRA 4NQWA 5BS6A 5CVVA 3OV8A 1BI0A 4KN7X 2ISYA 1J0RA 5D5VB 2ESHA 2YX4A 4XLPF 3K1NA 1ZGJA 2XGXA 3CZEA 4Q4ZF 3D5LA 5LHHA 3HUGA 3P7NA 4ENKA 1LEAA 1ONPA 2JPBA 2BEOA 1BI1A 2VT2A 5JR3A 3J81K 2PLYA 4S04A 1OR7A 2KJCA 2Y1DA 3WE2A 4S05A 1ULYA 1ONOA 4MNUA 4ZN6A 2JD2A 1IAWA 3ZMTA 1CGPA 1BC8C 4EJTA 3L2CA 4Y67A 2LSOA 4Q5SF 3F8CA 2Y75A 4ZYGA 5K1YA 2DFIA 3RJPA 4YFXF 1JXSA 2VC1A 4ENJA 2EWNA 1W4MA 1ZS2A 3I58A 3L00A 3J81Z 2UWMA 1MW0A 5K5QA 2XVCA 1ZAOA 1MKMA 2KKOA 4L9TA 1E2XA 4YG2F 1U2WA 1ZLKA 1T1SA 1SD4A 1R36A 3O3KA 4M72A 1MJAA 1Z05A 2IRFG 2CWEA 2EA4A 4A6EA 1PDNC 1OMIA 3HSRA 4RCVA 2XRNA 1V3FA 2E1NA 4WXHA 1ZG3A 2YR2A 1FC3A 4BXUA 1XMKA 2MBFA 3CZKA 3MEXA 1HSJA 3TOBA 3CJNA 4EGYA 1P6RA 3UERA 4O5VA 1IRFA 2XAHA 3E6DA 1BBYA 3TO9A 2L3DA 4KICA 3EYYA 1ZLJA 2MH9A 1ZGAA 5AONA 3RKWA 4EJWA 1RZ4A 1TQIA 1KGSA 4NB5A 1U8RA 3L09A 1UFMA 4ZYHA 3HOTA 2IJLA 5BMZA 4IRHA 5H6RA 3TDUC 1R00A 1U5TC 3ZMSA 1S29A 4HLXA 3RKYA 3JTHA 2G7HA 2ZKZA 2JT1A 2EFWA 1TTYA 1RUOA 4GAEA 3ZN1A 1FNNA 4LJZF 1VTNC 4A0ZA 4ZQFA 1SD5A 3KEQA 1FBSA 1YTYA 3BROA 2OQGA 3GXOA 3DPTA 1BOAA 5L3GA 4Q47A 1P92A 2VXZA 1B9MA 1STZA 2Z5UA 2P8TA 2VOPA 4HX7A 2A61A 2DPUA 2LNBA 3DV8A 1WKMA 1O3SA 2PI0A 5DUKA 4CDGA 3I5UA 4U7BA 3TKYA 3KE2A 3GEZA 3R61A 4KMUX 2O7GA 1CF7A 2O8XA 3HSEA 2Y1FA 1KU3A 1EV7A 2EK5A 3BZ6A 1J75A 4ZH4F 1YW9A 1LNWA 3HIFA 4LUPA 4IRIA 1OYYA 2AS5F 1BIBA 2ZXJA 2K27A 1O3TA 3K69A 5L3EA 4MTDA 1T38A 3H92A 1W7PA 1MDMA 2HEOA 3ANLA 2DLLA 4LFUA 2FNAA 3REOA 5E1XA 2M8EA 2JCVA 2WPGA 1QO0D 2EFNA 1Z91A 4KIFA 2VBZA 4JBAA 1W7PD 1J7KA 3F8BA 3ROUA 5FFZA 2H94A 3M9AA 1B59A 5E8IA 1S7OA 2W57A 3EUHA 5CYVA 2FA5A 4RGXA 2RKHA 5DEQA 4XBFA 3IKTA 1XSVA 1ON2A 2VONA 1Z9CA 3ANMA 3MWMA 4OIRF 3WQSB 4EJVA 4LB6B 2O6GE 5JMPA 4LD5A 2CG4A 2ZNZA 4HF2A 2Y48A 3F22A 4GYGA 4NHJA 3ZP5A 4AIKA 4LGWA 3I64A 3FMQA 5E8GA 2GXBA 1G3SA 2HZTA 2HYGD 2A3SA 2PN6A 4HA8A 1BC7C 3AU9A 5EEHA 3HTUA 4I09A 2OZ6A 4HF1A 4HLYA 3N97A 3MQ0A 1XGOA 5LLQA 4MGRA 1JE8A 5TRDA 2TDXA 1TQMA 3C1DA 4A2UA 1WWXA 4I7HA 1D8KA 1LDDA 1V4RA 3VODA 4ASNA 4R79A 2JD0A 4P9UA 2V1UA 4IF4A 3KP2A 1R1VA 5D8LB 1GXPA 4JK1X 5LHGA 1SFEA 2COMA 2UXNA 1JVSA 4FLRA 2ACJA 4I0BA 4KUMA 1F1ZA 1W7PB 5LBQA 1MJBA 3SZPA 3COAC 4EM0B 2JD1A 3WU1B 2O03A 1J9IA 3I59A 3TGNA 3MFKA 1I5ZA 1KYZA 2GWRA 3K2ZA 4QWQA 5K5OA 4QLCU 1MJ9A 1ZARA 5BQTA 4RB3C 1YQAA 4XSXF 1LVAA 1L3LA 3S2WA 2A07F 1KU2A 1ZREA 2GQQA 3E5QA 3GZ6A 3SHFA 5HDKA 1LDJA 2VN2A 4EJUA 1TQPA 3KLNA 1G6NA 4I98B 3LA7A 5D6EA 2XKPA 3Q5FA 3WTSC 1MW2A 3RYPA 4EVIA 1WSUA 1DP7P 2STWA 3IHUA 3DP7A 2EJRA 4AD9A 4CYDA 3SXYA 4WXCA 2FOKA 3V8KA 3QPHA 1J2XA 3M8FA 3A14A 4RS8A 3FXQA 1G4DA 4OIOF 2CFXA 5DCFA 2MLKA 5LGTA 2G7UA 4ZZDA 3TO6A 3U9GA 2ISZA 3ABUA 5J8FA 2F5DA 1YLFA 2XAGA 3B73A 4MEYF 2F5EA 2NAZA 5J6XA 4A12A 2C82A 3BJOA 1QBJA 4DQ2A 2IA1A 3HSFA 2DPDA 4L18B 3O6BB 2JZYA 4OMYA 2W25A 4Y6RA 2PJPA 2MAPA 1UCRA 1KU7A 1F5TA 5DULA 5LEJA 2HOEA 3G3ZA 4LB5A 3GFLA 1Q0QA 1Z1DA 2HKXA 1IRGA 4IXAA 3LSTA 4RGRA 2Z9OA 2WTEA 4AIHA 1S7AA 2VBYA 3A06A 3I59B 3QP5A 3CTAA 1ZN2A 3D0SA 3GFJA 5JC1A 4D0PA 1JG9A 4P9FA 3GO5A 4ZZLA 4BHBA 3F6OA 5FD5A 3N4MA 3ZMUA 3GVAA 1FOKA 2M87A 4RGSA 1ZRCA 1O57A 1X3UA 1XDSA 5JHUA 5ERIA 3GZ5A 3L7WA 5L3CA 2P5LC 3E6MA 3F21A 4A5MA 2DBBA 3ZHYA 3ULQB 1FYMA 2F5FA 2W24A 3SZTA 2PFBA 2D1HA 2DQRA 1EH6A 3NQOA 2OBPA 1R23A 4Y17A 2P6SA 5LHIA 5HOOA 2CO5A 4K2EA 5E20A 4PGHA 2XHKA 3CUQA 3GF2A 1BI2A 2R7FA 4YFNF 4UV8A 3IWZA 3OOPA 2EV0A 4UXNA 1SMTA 4N9HA 1DPRA 3CO7C 4RB0A 3F8NA 5AIPA 4FX0A 3DQVC 3U2RA 2HS5A 4IRGA 4I02A 2BBYA 5A2QZ 3W6KB 1T0FA 4L0ZB 2VBWA 2KRFA 1HW1A 3GUDA 4HAMA 4Y13A 2KJBA 4DNCA 2HQRA 4P55A 5FLXK 1HQCA 3ABTA 4U0WA 1K79A 1BIAA 2CW0F 1R5GA 3RPUA 1GHCA 5FO5A 1QZYA 4KNYA 3ZHZA 3KCCA 2DK8A 5LEKA 2M1BA 1BI3A 1IN5A 5L3BA 4ENMA 3V8JA 3VFZA 1JGSA 5ICEA 3WG9A 5HLHA 1ONVA 3IIEA 1EH8A 4EJOA 5FLXZ 4UNOA 3KLOA 1D3YA 1I6XA 3KP4A 4M74A 2OQRA 5BPDA 2RDPA 2MAOA 3PFIA 3SQNA 2PEXA 3CZGA 4ESBA 3W6JB 2DAOA 1YS6A 4EV0A 3B02A 5HDGA 2OAZA 1R0LA 4M6YA 1ZRFA 3ZMDA 3NRVA 4EM2A 1XB4A 5ICGA 4HDVA 5ICCA 3T1BA 4GXOA 1QPMA 2QVOA 3FXRA 1T98A 2VOOA 2WV0A 2QWWA 3BDDA 4CXFA 3KZZA 2JCYA 2RC4A 2QM3A 5BPIA 3ANNA 5CLSA 2EA2A 1K6OA 1IXSB 4OINF 1R22A 3DKWA 1KA8A 2EFQA 4CZZA 4KIBA 3WU0A 3BOQA 2FE3A 1S46A 1G3WA 2W85A 4IHSA 2DO7A 1FWZA 2P7VB 1IXCA 2E7WA 2WWYA 1ONNA 4A03A 4OMZA 3GFMA 5ILUA 5JFRA 3RI4A 1FX7A 3I0TA 4FX4A 4F7ZA 4G94A 2HQNA 3JAMZ 3UCQA 1TNSA 3TQNA 1OPCA 3I53A 2AXLA 2DT5A 2CSOA 1IZ1A 1T6SA 2EV6A 4KT5C 3E97A 2VODA 4UV9A 3F23A 4CGZA 1ZG5A 2GA2A 3ZN0A 4MHGA 2BGCA 3CO6C 2EB7A 3C18A 2K4JA 3GX4X 1WQ2A 2XIGA 5CVJA 4U7DA 2PQ8A 1RP3A 4HV5A 3P9CA 3C3WA 4Q48A 2EGHA 1IUYA 1K78A 1MGTA 3C7JA 3ZI0A 2MD5A 3RTRA 3Q9VA 2RQPA 3PQKA 4HOBA 4LK1F 2L01A 3QP6A 3KZYA 3UEQA 4M9SA 2DU9A 1ZYRF 3TO7A 1XN7A 4BAYA 2X4HA 2ZMEA 4N0BA 3EETA 2E7XA 4MQ9F 3LAJA 1WI9A 3WGHA 4ETSA 5FGMA 4L9JA 2K4BA 4L9VA 1U3EM 2VBXA 5JMWA 3V8LA 1T1RA 1TW2A 2PG4A 2D1VA 1F9NA 1SAXA 2LKPA 5FFXA 4P96A 4LK0F 1UHMA 3FX3A 3H3ZA 2A5YB 5JNLA 4B09A 4G8XA 3BPVA 5HS7A 2QLZA 4G6QA 4EGZA 2JCXA 5HVQC 1OKRA 5L3FA 1H9TA 2KIUA 3LQRA 3ZMZA 4Y15A 5JO0A 2RNJA 4M9ZA 4XRFA 1XMAA 3VB2A 4ZQHA 2VT3A 1ZHFA 1W5SA 2DQLA 5IT3A 5H6QA 1YFHA 1USSA 1G3YA 2Y1CA 3CUQC 2D45A 2L54A 4RB2C 4EMSA 2ETHA 4KDPA 4PCQA 3GYHX 1FPQA 1HW5A 3PQJA 5E1WA 1ON1A 1XDUA 3IWFA 1T2KA 1CF7B 1YW8A 1RI7A 3TDZC 2X0LA 4WK8F 4G9YA 1H0MA 2Z3YA 2KIFA 4Y6PA 5HLGA 3AU8A 1DPUA 1MDMB 1KQ8A 1SD6A 3WTYC 5LRSA 4HQEA 1K5HA 1R58A 1SD7A 1E17A 3KFWX 2LF7A 1XGMA 2ELHA 3E6CC 3FMRA 4G7HF 4MTEA 2KIMA 2DK5A 4GGGA 1WRJA 2R7DA 4RAZA 1LB2A 4AICA 1MD0A 4B8XA 1IN8A 3F8MA 4HQMA 4WX9A 2HGCA 3R6SA 3ELKA 1S8NA 2QQBA 1U5TA 1XCBA 5D5WB 3FZVA 4EM1A 3O2PE 4FHTA 4OU0A 4WF2A 2V9VA 2MLGA 2Q0OA 2FU4A 1J5YA 2P5VA 4U0YA 2JSCA 4LLGF 2QUFA 2PMUA 3QAHA 3I4PA 4N9IA 3T8TA 1AOYA 5E1ZB 1C0WA 1UHWA 4UVCA 3LQQA 2EFOA 1Q1HA 1D8JA 3T0YA 2D2WA 4BYYA 4BQAA 1IXRC 2CYYA 3CZLA 4JQFA 5E17F 3LFKA 2IP2A 2QQ9A 1Y0UA 3VOEA 1HKTA 5BOXA 2M5WA 2ZCWA 3EDPA 1GXQA 4ZYDA 2V79A 1USTA 5D5XB 2OD5A 3T8RA 1B9NA 1H3LA 2CQKA 3K0LA 4A6DA 1PP8F 3HOSA 1G5AA 5TJJA 1F4KA 1SC5A 1IN4A 4I0AA 1BJAA 3AUAA 4PDKA 1B6AA 3FM5A 2MA3A 1BN5A 5D5UB 3IRQA 2NS0A 4AWXB 2STTA 3ML6A 3WTUC 1Q0HA 1UB9A 3M8EA 1FP1D 4GYIA 1U78A 5DUIA 3Q9SA 1B4AA 1P4AA 1XCVA 1XGNA 2Z99A 1T39A 4LMYA 2VC0A 5CVIA 2JTVA 3FHZA 3HRSA 2HWVA 2FBKA 3WTWC 3V7RA 1FBQA 5IT9Z 2HKOA 2V6CA 1B1BA 3E6BA 3HTSB 1HSTA 5E18F 2NNNA 3JW4A 1AWCA 2PMHA 2FBIA 4HF0A 5A2QK 1YS7A 1R1TA 2XKOA 2R3SA 4ENNA 1P4WA 1TNTA 1R0KA 1J59A 2MH2A 4CO8A 2ESNA 1U6GA 3IKVA 5K5RA 4YFKF 2UZKA 3WGGA 1IW7F 1SMYF 1XD7A 3JSPA 4Z2YA 1KQ9A 4KYWA 4PZJA 4WXDA 2NYXA 2YX7A 5HDNA 3HHHA 1YYVA 1XSDA 1K7AA 4A0YA 2Y1GA 5HLIA 1RIOH 2QZ8A 3ECOA 5AIQA 3J80K 5CVUA 2GZWA 4HX4A 1FYKA 2FNPA 3M1EA 4ON0A 3TOAA 3BJAA 3RIRA 2FSWA 2ZNYA 3BY6A 1Z6TA 3WQRA 4KA4A 1TLHB 5EEGA 5KK1A 2K7LA 2V1XA 5DDGA 5J8CA 4CHUA 4UHTA 3GWZA 3E3VA 4BNCA 1BM9A 2PBIA 2B0LA 3JTGA 1O3QA 4LLLA 4HV6A 2QBYA 3J80Z 3HRUA 4RGUA 5LRRA 3WODF 5ICFA 3G73A 5LGNA 2XAQA 4OIPF 1FT9A 1QGPA 3IC7A 1Q0LA 2IW5A 4HZFA 2E1CA 4OIQF 3RYRA 4O3MA 3ZQ7A 2FEZA 4ZQEA 1R7JA 3LA3A 3RASA 1DUXC 4UUVA 1MVYA 2ZFWA 4I2OA 1ZH5A 1KYWA 3CUQB 3KEOA 3K1MA 2DTRA 2WC2A 5DCMA 3MAJA 3SFZA 4YIFA 3JAMK 2QQAA 1KQ0A 1QNTA 2XAJA 1L0OC 1RNLA 4EQQA 3HHGA 4LG0A 5D4SA 3MZYA 2ZO4A 2BV6A 4A5NA 4HDUA 1EH7A 1REPC 5F1RA 1FLIA 1QZZA 2GXGA 2H6CA 2YU3A 5FB2A 2RGVA 3DEUA 3RKXA 1HXDA 3R0JA 4ESFA 2NRAC 2GA1A 1TW3A 1LEBA 4ESJA 4BH9A 1I1SA 1HKSA 1YW7A 1LJ9A 2HTSA 2IPQX 1HBXG 3F3XA 4FLQA 4MEXF 1JHHA 4MQVA 5JBIA 2QBYB 1FY7A 2GAUA 3DFGA 3GFIA 3V4GA 2FXAA 1LQ1A 1FBUA 5DD4A 5D6FA 2ZJ2A 2FQ3A 2NNYA 2C6YA 2QYOA 2HTJA 3BWGA 1YO5C 2A68F 3J7AO 4P5OA 4YIIA 2H27A 1GVJA 3KP5A 1ODDA 2J5OA 3V7SA 1JHFA 2P4WA 4A0XA 3WTVC 4IJAA 5HS9A 3QRFF 4XLNF 4M71A 4FT8A 3FF5A 1P4XA 3M7GA 4M9XA 1MW1A 1Z7UA 4G7OF 1FP2A 3CDHA 4UVBA 2IT0A 3QU3A 3WTTC 2O61A 3R0IA 4KMFA 1HKQA 5ED4A 2FMLA 3WTXC 2XUBA 4R8HA 5DCMB 4OOIA 3RPQA 2O3FA 1S3JA 4OOFA 4L5IA 2J5PA 3FMSA 4RB1A 2ADUA 2K02A 4ZYEA 2UXXA 4Y6SA 1IN7A 2OA4A 4KP7A 1IN6A 3E5XA 2EFPA 1XGSA 1OYIA 4KFCA 2H6BA 4LG0B 3R60A 2IVMA 5F6FA 2HYFA 3BJ6A 1XSXA 3HRMA 4KN4X 3F72A 4E70A 3R0AA 4ZQGA 6PAXA 4O6JA 3P9IA 4IVNA 4KIGA 5JI6A 2DW4A 3FWEA 4R1HA 3KETA 5DD8A 5CVRA 5D4RA 1G3TA 3JSOA 2QENA 3DPLC 3E5UA 4IHTA 3FXUA 1R1UA 3NEUA 2XASA 4AVPA 1NHAA 2DI3A 2A69F 4GO1A 5FD6A 3ERED 5D8KB 3MZHA
chains in the Genus database with same CATH superfamily
2M3AA 4HPQA 3DBHB 1SVOA 5GTHC 5ILSA 2F2EA 3FHNA 3HGYA 3K1PA 4BHCA 4DPRA 2W7NA 4N4NB 4RAYA 1OYWA 4X1EA 2FF4A 1R4NB 3ECHA 2F5CA 3IL2A 3L2VA 2ZBKA 2AQEA 3ABKH 5DYMA 4CCNA 1JGGA 2EQRA 2HQAA 4XNFA 2RJIA 3FH5A 1PP7U 5HODA 4XO4A 1OCPA 2DMQA 3RDIA 2ELJA 1W5TA 5FRMA 2BYVE 2DA6A 3K4KA 4HYEA 1K78B 2D5VA 4DZJA 1KU9A 2IA2A 2KL4A 1MBKA 3MCZA 3A02A 3BP8A 4II2A 1FSHA 3WQQA 2LF8A 3RQ4A 2FBHA 3S3OA 2RN7A 3OYNA 4L9NA 4CICA 2FMYA 3S93A 4Q4EA 4PVBA 2DT6A 3F6VA 4TV7A 2JRTA 1YG2A 3E0JB 2V1DA 4FCYA 1S6LA 1O7LA 4CCJA 3LAPA 4AYSA 4G7ZF 5LFAA 2E1MC 1T95A 2VXDA 2A6HF 1A04A 2ZMEB 5F64A 3ISPA 2HDCA 2L5QA 2GXAA 1R49A 2K85A 3ZR8X 3F8FA 4JX5A 3W2AA 4HW0A 4JP0A 4LOCA 3DTEA 2MFZA 3IH2A 3QU6A 2EV5A 1FZPB 3H0GJ 1PUEE 3FKIJ 3ZQGA 3KX2A 2Y1EA 4UY8I 2P5KA 2MC3A 4IL6C 3ZXSA 1IV6A 4WCGA 4IPAA 3VEPA 3G6EI 4NC8A 3D5RC 1AKHB 4XSZF 4HNVA 5JVTA 1VZ0A 3H9JA 3ZQFA 1JGIA 3QOPA 1I1GA 1QQIA 3QPTA 1UZCA 4U88A 3AAFA 3AG3H 3HRTA 4K5NA 3H3UA 4HBLA 3V7CA 1VQMI 2CUZA 2LKXA 2KHMA 3HOXJ 4QUOA 1D5VA 2XAUA 5J40A 3KP6A 3GLXA 4L5JA 3DF8A 5CJ9A 2JUCA 3LWFA 3P9KA 4X6AJ 4ITVA 1OFCX 1OISA 1SANA 3ZMVA 4OOEA 2CV2A 2A6EF 1IF1A 4HX8A 2K86A 1R4MB 4IHWA 3FTUA 4QPOA 2RVCA 2K40A 2IAIA 1FSEA 2W84A 2YU9J 3CMEI 3EYIA 1P2FA 3R4KA 3DTKA 2M30A 3UKGA 1H9GA 4CUGA 3ZHXA 2H09A 1MMNA 2XAFA 4E7KA 1JKQC 4IQ4A 3ZCOA 2CGPA 2XPYA 2CH0A 4FLOA 2VASA 3CF2A 4U0VA 3KP3A 4A3DJ 2M7AA 3H3VK 1QU3A 1DU6A 2HR3A 1YI2I 3HEFA 3OS1A 2V9PA 2Y9ZA 2P7CB 4M6VA 2F5VA 4UVAA 3TL4X 5ILVA 1DDNA 2R93J 4M73A 4BUPA 2ZJQF 2X6WA 2QSFX 2FQ4A 4I01A 3OYHA 4GCVA 3BR3A 3I71A 4E7LA 2LY1A 3I54A 1LUJB 1FYLA 2Q2EA 1Z6RA 3KP7A 4M6XA 1TBXA 3RSNA 5F27A 2HI3A 4L0YB 5DM6F 1ZKGA 5J47A 3K70C 2CQQA 3QJXA 1I27A 3FUMA 2YPRA 2IS1A 2VLAA 2H8RA 2BE5F 3WE3A 3BTJA 1LDKB 1N75A 2R7VA 4JX4A 1RUNA 2P6TA 1ETKA 3KEYA 4PGGA 1ZRDA 3M8JA 5JAZA 2L02A 3VPRA 3HBLA 3CCJI 3G1LA 1FEXA 2NVYJ 2LDUA 3WGIA 1ZG1A 4XN0A 3H5AA 5KVRA 4RBOA 5E79C 3FTWA 1R5HA 2M45A 1YX5A 3U1DA 4BHPA 1PUFB 3FISA 4BDYA 3CLOA 1VQ9I 2Y0MA 2LK2A 1WJAA 3EQLF 2DMTA 3GW2A 1NH3A 2HFHA 5HNFA 5IT9K 4LLNA 4AC0A 1OCCH 1O3RA 3FUJA 3HPHA 1IDYA 2BHYA 1YIOA 3FM3A 4BKXA 2WAQN 4NC7A 4FASD 3GTMJ 3HOYJ 5LGUA 2KZVA 2JPCA 2OU2A 2HU9A 2GIVA 2M9HA 2GOXB 1A5JA 2VE8A 1SFXA 2BXYA 2M34A 2XROA 4WWCA 3J7AY 2KPMA 2O0YA 1HW2A 2OZUA 2G9WA 2L9VA 3WTZA 4G6DA 2X51A 2RV8A 1YE9A 1SFUA 3K9TA 4DYRA 2FRHA 4FLSA 2DA7A 2Z33A 1MW3A 1ETVA 1O7FA 4AIJA 1U5TB 4QPEA 2Q8KA 3DXJF 5H20A 2BY3A 4XM3A 2XV4S 5HS8A 3Q44A 3PSIA 4B43A 2F6CA 5E3NA 3TBIA 4BS9A 2L4MA 4H0EA 3LA2A 2EILH 1WCMJ 5JHFA 3ZPLA 2IA0A 2YSRA 3CUOA 3HYIA 3BQYA 3T5XA 3VYUB 3OYDA 5L3DA 3Q0WA 2XB0X 1MZBA 2L4AA 5CKTA 4CCOA 2VE9A 3BPXA 3LSIA 3L9FA 1D1CA 2H8WA 1X1DA 1SQMA 3ZQIA 1VQ5I 1S5LC 2ZMEC 4MS6A 5DV5A 3IRRA 4NQWA 4Y3OA 3OS2A 5BS6A 5CVVA 3RC8A 2Y69H 3OV8A 2LMDA 1BI0A 4KN7X 2ISYA 2MYSA 1J0RA 5D5VB 1T33A 3JREA 5GAGJ 3GTQJ 2ESHA 2YX4A 4XLPF 3K1NA 2VJJA 1U0JA 1TT0A 1ZGJA 3G71I 3SJMA 3PO3J 2CUFA 1OCOH 3FU0A 2XGXA 3CZEA 5TISC 2BHZA 4Q4ZF 3HZJA 3D5LA 4PJJA 5LHHA 3HUGA 4XMWA 2WZFA 3CHRA 3P7NA 4ENKA 1LEAA 5J4YA 2JPBA 1ONPA 3TEDA 2BEOA 1BI1A 1VQ8I 4A3BJ 5GPAA 1V5GA 1D0YA 2DOFA 4AU7A 3JRAA 2VT2A 5JR3A 2LY9A 3F9KA 3J81K 2PLYA 4S04A 2BOLA 5F0HA 1OR7A 3FTVA 4BBSJ 1BA5A 2KJCA 2Y1DA 3WE2A 2BXZA 4UUSA 2HVSA 3TW6A 4BDZA 4S05A 1ULYA 4PUSA 1ONOA 4JNDA 4FTHA 1VQLI 3WHCA 4MNUA 3CC4I 1GT0C 4ZN6A 2JD2A 3SZGA 2DFFA 1IAWA 3ZMTA 2B61A 1CGPA 1BC8C 4EJTA 3L2CA 4Y67A 2LSOA 2VPLA 2RQQA 2A05A 3A03A 2Y75A 1D0ZA 3F8CA 2DFIA 4ZYGA 3RJPA 2Y9YA 5K1YA 3F0CA 4UB6C 4YFXF 1JXSA 2VC1A 4ENJA 3AKZA 3BTCA 2EWNA 3V42A 3K2AA 1W4MA 1ZS2A 1WGXA 2OTLI 4HRIA 1JI8A 3I58A 1S9HA 1MMDA 3L00A 4B4CA 2K9SA 3H35A 3BR2A 3J81Z 2UWMA 1MW0A 5K5QA 2XVCA 4V2FA 1ZAOA 4XLFA 3DKYA 1MKMA 4FISA 2KKOA 4L9TA 1EJ9A 3MVPA 2I10A 1E2XA 2DA5A 2OTJI 2IGNA 1P7IA 1HDPA 1U2WA 2F4MB 2MGQA 2X6OA 1SD4A 4F91B 4YG2F 5HNHA 1TWFJ 1T1SA 1ZGWA 1R36A 1WI3A 3O3KA 4M72A 1MJAA 1LFUP 2GIZA 1Z05A 3BZKA 2IRFG 2PJRA 2CWEA 5J1RA 2EA4A 4HNTA 1B72A 2MC4A 2BZTA 4A6EA 1I39A 1PDNC 1OMIA 3FBNB 3SDGA 5HLTA 3LNQA 1YRNB 5KCMA 4RLFA 1GW6A 3HSRA 4RCVA 2XRNA 1Z3XA 1V3FA 5F0FA 2E1NA 4WXHA 1EA3A 1RRJA 4XKVA 3JCUC 1ZG3A 1ETWA 2YR2A 1TP4A 2DMPA 1FC3A 4BXUA 2DN0A 4ZX3A 1XMKA 2MBFA 3CZKA 1POGA 3MEXA 1QRYA 1HSJA 1QVTA 3TOBA 3EUKL 3CJNA 4EGYA 1P6RA 3UERA 1Y8QB 3DKXA 1IRFA 2XAHA 4O5VA 2KQRA 2DA2A 4MIMA 3E6DA 3LSHA 1BBYA 3TO9A 2L3DA 4F3QA 1TZLA 4KICA 2QVWA 3RCOA 3B6AA 3EYYA 4RVBA 4BY7J 1R5ID 2XGDA 1ZLJA 2MH9A 1ZGAA 4NQWB 4XO5A 5AONA 3RKWA 2NVUB 4EJWA 1RZ4A 1TQIA 5FWQA 1KGSA 4NB5A 3S1QJ 2V6EA 1U8RA 3L09A 3OYIA 1IRXA 4K5MA 4ZW8A 1D1BA 2G0EA 2JA7J 1SFKA 5M5XJ 3FTYA 3FUEA 3K10A 3I56I 1UFMA 4ZYHA 3HOTA 2IJLA 1UG0A 1AA7A 4D5CA 5BMZA 2WB1N 4XMVA 2JUGA 2E19A 4IRHA 2DT7B 1MH3A 4XR6A 1MW7A 2ECCA 2W1OA 5H6RA 3TDUC 2VKVA 1R00A 4X2UA 1U5TC 3ZMSA 3FH7A 2OV7A 2KRHA 1S29A 4Q5SF 4XORA 4RAFA 5FKOA 4HLXA 3RKYA 3JTHA 2G7HA 3OYBA 1WJFA 2ZKZA 2JT1A 4HNUA 2EFWA 1TTYA 1RUOA 2JA2A 3ZN1A 4GAEA 1FNNA 4LJZF 1TWCJ 1VTNC 4A0ZA 4IO9F 4ZQFA 1SD5A 5J1UA 2O8KA 4ZDLA 2R7RA 3CHPA 3KEQA 4L2LA 3T8VA 1FBSA 2K9NA 1YTYA 2HZDA 3BROA 2OQGA 5EGOB 3GXOA 4EATA 1XTAA 1BOAA 2BW3B 3DPTA 2EZHA 4XN9A 5L3GA 3B7TA 4XRMA 4Q47A 4PK4A 4F55A 1P92A 1RKWA 2EIMH 3Q43A 2VXZA 1B9MA 1STZA 2Z5UA 2P8TA 1IC8A 3JRFA 3WHBA 2VOPA 5FLMJ 3VSLA 4HX7A 2A61A 3KYCB 3CCYA 4HEA2 4GFBA 2DPUA 3FUHA 2LNBA 4IOCF 3B7SA 3DV8A 4CCLA 3FXLA 3S3MA 1WKMA 2M8GX 3GZNB 1WHUA 2IGKA 1O3SA 2PI0A 2O7OA 2V26A 5DUKA 4CDGA 2CW7A 2VJIA 3I5UA 1GUUA 4U7BA 1IRZA 1NK2P 5KNLA 3BG9A 3TKYA 3KE2A 2W4SA 1SVMA 3GEZA 3R61A 1GVDA 1FTZA 4XN8A 2K9QA 3OS0A 4KMUX 2XGEA 4BE1A 1ZLKA 1X19A 2O7GA 2DDAA 3JRIA 4R7LA 5DYFA 3CZ6A 1CF7A 2VIXA 2O8XA 1JT0A 4ZDOA 2QF7A 3HSEA 4ARFA 2Y1FA 1K83J 1KU3A 2OUMA 3S2DJ 1EV7A 2EK5A 3BZ6A 1J75A 1UAAA 4ZH4F 3RZOJ 1T8IA 1YW9A 1H89C 1LNWA 3HIFA 4LUPA 1MSFC 1IGNA 4IRIA 1OYYA 3DLLF 2AS5F 3Q0UA 1BIBA 2ZXJA 3OWTA 5DM7F 4XRSA 2K27A 1O3TA 3K69A 5L3EA 4MTDA 1T38A 3CQZJ 3H92A 1W7PA 1MDMA 5C4XJ 4FQGA 2E2JJ 2HEOA 2JJ7A 3ANLA 2DLLA 5J3LA 5CPRB 2XF5A 4LFUA 2FNAA 5GAHJ 3REOA 2JMWA 5E1XA 2M8EA 2JCVA 3B7UX 1ZQ3P 2WPGA 1QO0D 2EFNA 1Z91A 4KIFA 4D5FA 1FOWA 4MLOA 2JVHA 2VBZA 1MNDA 4Q4IA 4JBAA 2WAQA 3IH3A 1MMAA 5FRNA 3FXOA 3FDYA 3OYJA 4I99C 1W7PD 2X1CA 1J7KA 1GV2A 1B8IA 1HOMA 5KAFC 1BW6A 3F8BA 3ROUA 5FFZA 2H94A 2VQGA 3M9AA 1B59A 5E8IA 1S7OA 2W57A 3MMYB 3EUHA 5CYVA 1S7EA 2FA5A 3K4JA 1MBEA 2RKHA 4RGXA 5DEQA 1TWGJ 4XBFA 3IKTA 1XSVA 1ON2A 2VONA 4XMXA 2M0CA 4I6ZA 1Z9CA 1T56A 3CXBA 3FHEA 1NK3P 3ANMA 2CRGA 3MWMA 5M3FJ 5IYDJ 4OIRF 2GM4A 2R7WA 1MSEC 4IQJA 5IP6A 4CSWA 1AHDP 3KYLA 3WQSB 2LY2A 1QZEA 1ORKA 4XNAA 4EJVA 4LB6B 2O6GE 1HCRA 5JMPA 1ETXA 4LD5A 1K4SA 2FJ1A 2CG4A 2ZNZA 4HF2A 2CJJA 3FH8A 2Y48A 3F22A 2LLKA 4YELA 4GYGA 4NHJA 3TP3A 3ZP5A 4AIKA 4LGWA 5EZGA 3I64A 1U8BA 3FMQA 2R70A 5E8GA 4AYBN 2HPTA 3JRCA 2GXBA 1G3SA 2HZTA 2HYGD 2A3SA 3S1NJ 2PN6A 4HA8A 1BC7C 2JA8J 3AU9A 3LSRA 5EEHA 2UV1A 3HTUA 4FE7A 1APLC 4I09A 2OZ6A 1V54H 4HF1A 3A01A 1ZK8A 4HLYA 4RSYA 3FU3A 3N97A 1UG2A 3MQ0A 1XGOA 4E7SA 4W1UA 1WZ2A 4AIDA 5LLQA 4ZJZA 3FUFA 4MGRA 4BL0B 1SC7A 5TRDA 1JE8A 2TDXA 1MH4A 1TQMA 3C1DA 2X1DA 4A2UA 2LREA 3J7ZI 1WWXA 4I7HA 1D8KA 1LDDA 2IGOA 1YJWI 1V4RA 3VODA 2NOGA 3IUOA 4ASNA 2DYSH 4R79A 3I4NJ 1X4PA 2C5ZA 3P5JA 3CCVI 2JD0A 4EEFG 3SDBA 4P9UA 2V1UA 4IF4A 3KP2A 3DBRB 3PJRA 1R1VA 2VKDA 5D8LB 1GXPA 2Z2SB 3M1CA 4JK1X 5LHGA 1SFEA 2COMA 2KFDA 2UXNA 2XF6A 3PL8A 1JVSA 3B7RL 4FLRA 2ACJA 4I0BA 1I6HJ 4LITA 1Y56A 3K4LA 4C3JJ 4KUMA 3AG1H 4I76A 1F1ZA 2FUG2 3A1YA 1W7PB 5LBQA 2DDBA 3D5SC 1MJBA 4XKWA 1Y1VJ 2EIJH 3SZPA 5BPPA 1V5FA 3COAC 4EM0B 2JD1A 3WU1B 3GTOJ 3FK7A 3OY9A 2BVMA 2O03A 1J9IA 1ZELA 3I59A 4E4HA 1WJBA 3BLYA 3M3YJ 1F43A 3TGNA 3MFKA 3PNYA 1I5ZA 1KYZA 3HXLA 2GWRA 3K2ZA 4QWQA 5K5OA 3FUIA 1D1AA 2EZIA 2KP6A 4QLCU 4E6KG 4XONA 1XPXA 1MJ9A 1ZARA 5BQTA 3CC2I 1IG7A 2HPOA 4N4OB 1GDTA 4RB3C 1YJ9I 1YQAA 4XSXF 4XICA 4PFOA 4A69C 1LVAA 2R5ZB 1GV5A 2ZSIB 2HYJA 4FE4A 1L3LA 3S2WA 2A07F 1KU2A 1ZREA 1LVKA 4XOPA 1E3HA 2GQQA 3E5QA 3L2QA 2LKSA 3TMOA 4XRSG 3GZ6A 2HOSA 1OJLA 4AR9A 3SHFA 5HDKA 1LDJA 2VN2A 4KT6A 1DP3A 4EJUA 1TQPA 3KLNA 4G6TB 1G6NA 4I98B 3KPHA 3LA7A 2E5ZA 5D6EA 2XKPA 3Q5FA 3WTSC 4QPQA 1MW2A 4BE0A 3RYPA 4XIDA 4EVIA 1WSUA 3QPSA 1DP7P 4DOZA 5B3SH 2STWA 3IHUA 2CUEA 3DP7A 2OPTA 2HDDA 4XLAA 2DXIA 2EJRA 4AD9A 4UB8C 4CYDA 3SXYA 4WXCA 2FOKA 2CW8A 3V8KA 3QPHA 1J2XA 2NVQJ 1JKPC 2L0KA 3M8FA 3A14A 4NBQA 4RS8A 4XMYA 4LIVA 2KISA 3FXQA 1G4DA 4OIOF 1JT6A 4XMZA 2CFXA 3C2BA 5DCFA 2MLKA 3HGGA 5LGTA 2G7UA 3PUBA 3FU6A 4ZZDA 3G2BA 4PJLA 2MW8A 4K5PA 3TO6A 3U9GA 2ISZA 3ABUA 2KDZA 4Y52J 5J8FA 2AXTC 1YLFA 2F5DA 4B48A 2XAGA 3A01B 2WB1A 2Z1DA 5EF6A 3B73A 3KYDB 1X2NA 2R7QA 4MEYF 3CF5F 2F5EA 2NAZA 4F52A 2XB5A 5J6XA 1AU7A 4A12A 2C82A 3BJOA 3VDXA 4DQ2A 1QBJA 3EBGA 3OYCA 2IA1A 3HSFA 3QWLA 2DPDA 2R7SA 5CQEA 5H2FC 1W36D 2L7FP 4L18B 3HOUJ 3O6BB 2B7EA 2JZYA 4BXXJ 4OMYA 2W25A 2OCCH 2XPUA 3NARA 4Y6RA 2PJPA 2MAPA 1UCRA 3HOWJ 1KU7A 1F5TA 5DULA 2COBA 5LEJA 1V55H 2HOEA 3G3ZA 1JUSA 1JTXA 4LB5A 1I50J 4OAYA 3WU2C 3GFLA 5C4JJ 1Z77A 3EBIA 1Q0QA 3QPLA 1Z1DA 4OAZA 2HKXA 1IRGA 3RZDJ 4IXAA 3LSTA 1S72I 3PIPF 4RGRA 2Z9OA 2WTEA 4HG2A 4AIHA 5M5WJ 3LSKA 5FKMA 1S7AA 1JKOC 2VBYA 2R7OA 3CESA 3A06A 3I59B 1MBFA 3LL7A 3CP2A 3QP5A 3CTAA 2M2EA 3ABLH 5EZHA 1ZN2A 4DYQA 1FMWA 4M3BA 3D0SA 3LSGA 2K3FA 3TP0A 3GFJA 5JC1A 3AFHA 1Y1WJ 4D0PA 1JG9A 4P9FA 3U9WA 3GO5A 4B47A 4ZZLA 4BHBA 3F6OA 5FD5A 3B6CA 4XNDA 3N4MA 3WG7H 3ZMUA 4PU2A 4MFDA 3GVAA 4IHVA 1FOKA 3QODA 2M87A 4RGSA 1ZRCA 1O57A 1X3UA 1XDSA 5JHUA 5ERIA 3GZ5A 3PM1A 2R7ZJ 5FLVA 1ITYA 2RREA 3L7WA 2UUZA 2E2IJ 5L3CA 3LMMA 2F48A 3OIQA 2P5LC 2CQ7A 2IBDA 3E6MA 3F21A 4A5MA 1I3AA 2DBBA 4XKBA 3ZHYA 3ULQB 4KITB 2F5FA 2W24A 3ERMA 3HPGA 5C44J 3MD2A 1FYMA 3SZTA 3S17J 2VJ5A 2PFBA 2D1HA 2DQRA 1EH6A 3NQOA 5K7HA 2OBPA 1R23A 4Y17A 5B1AH 1JUMA 4AVZA 2P6SA 5LHIA 2L7ZA 2CO5A 5HOOA 4K2EA 4PJNA 1E3OC 4ABZA 4NUBA 3BC8A 2E35A 5E20A 3CCLI 4PGHA 2XHKA 4DGWB 3CUQA 3GF2A 2ZXHA 2MABA 1BI2A 2R7FA 4YFNF 3GBGA 1Q1VA 1BOBA 3IWZA 3OOPA 4UV8A 1SEUA 2R7TA 2Q2EB 2EV0A 4JYKA 4RM3A 1TC3C 2VQHA 1CQTA 3UNGC 5GPCA 4UXNA 1SMTA 4BBRJ 4N9HA 2R0QC 1DPRA 5DTDA 1BR4A 2HNHA 3CO7C 4RB0A 1Z0XA 3F8NA 3L2UA 5AIPA 4FX0A 1E3PA 2BY2A 5IOZA 3DQVC 3U2RA 2HS5A 1H8AC 1NG6A 5DS9A 4IRGA 4I02A 3LSJA 2BBYA 2L9RA 1KZHA 5A2QZ 3W6KB 1T0FA 3ZGKA 3IAM2 4L0ZB 2LP0A 3BG6A 2VBWA 2KRFA 1HW1A 3GUDA 4HAMA 4Y13A 3FXMA 2KJBA 4DNCA 2HQRA 4P55A 4A3MJ 4HSTA 1RR8C 5FLXK 1X1CA 1LE8A 5TGTA 1HQCA 5F08A 3ABTA 4U0WA 1K79A 4JOMA 3CHQA 2W48A 1BIAA 2CW0F 3A4CA 1R5GA 4CYCA 3RPUA 5D5WB 1GHCA 5FO5A 1LFPA 1QZYA 1YX3A 2GBYA 4KNYA 3ZHZA 5EV7A 3KCCA 2DK8A 5LEKA 2M1BA 1VQKI 1BI3A 1IN5A 3ONQA 2R59A 2LBFA 5L3BA 2IEKA 2WY7Q 2TCTA 4AYBA 4ENMA 2L2OA 1MNEA 4AR1A 3ZRGA 3V8JA 3VFZA 1IV8A 1JGSA 2LH9A 4ZW7A 4BQQA 5ICEA 2ME0A 3WG9A 4BJ6C 1XX5A 5HLHA 3L1PA 1BW5A 2CU7A 4E7HA 1ONVA 1OQYA 3IIEA 4X0GA 4XN4A 1EH8A 1WJ5A 4EJOA 5FLXZ 4UNOA 3E7LA 2LYCA 2IXSA 3KLOA 3L2RA 1D3YA 2PL5A 2O5RA 1I6XA 2CFOA 3KP4A 2OQRA 4M74A 5BPDA 2RDPA 2FFLA 2MAOA 2CMPA 3PFIA 2PEXA 3SQNA 1I3QJ 2AQFA 3DU6A 2VI6A 2KT0A 3OR1C 3CZGA 4ESBA 3W6JB 1X2MA 2DAOA 1YS6A 4EV0A 3B02A 5HDGA 5M3MJ 2OAZA 2QKLB 3BR6A 4M6YA 1R0LA 1ZRFA 3OYLA 3ZMDA 1TWHJ 3NRVA 4EM2A 1FOXA 3KEDA 1XB4A 2I8DA 3BR5A 5ICGA 4HDVA 5EG0A 2K5CA 2YUSA 4II3A 5F1JA 1SAUA 3MZ8A 4J00A 3VVMA 3B37A 4CZCA 1E0EA 1T08B 5ICCA 3T1BA 4GXOA 2LRDA 1QPMA 2QVOA 4W97A 2E2HJ 2O9LA 3OYEA 3FXRA 2DCEA 2Z16A 1T98A 2EINH 2HOAA 2QEXI 2VOOA 2WV0A 2QWWA 3BDDA 4CXFA 3KZZA 2JCYA 3HUGB 2RC4A 2QM3A 3K6GA 5BPIA 1RC9A 2NS7A 5CLSA 3ANNA 2EA2A 1K6OA 1IXSB 1Y6IA 4OINF 4IEJA 4MO7A 4K5LA 1R22A 3DKWA 1EF4A 1KA8A 2ZSHB 2EFQA 4CZZA 4KIBA 4XLEA 2QSGX 3WU0A 2JN6A 2LVSA 3BOQA 2KRCA 2FE3A 1OCZH 4CCMA 2EIKH 3EUAA 3QYFA 1S46A 1G3WA 1J09A 2W85A 1HLVA 1Z3YA 4IHSA 1DGWY 2DO7A 1FWZA 2P7VB 1IXCA 3DCFA 4UUSB 3OOUA 3JT1A 3KIOA 1WH7A 2E7WA 3CMMA 2QQ8A 1ETOA 1QPIA 2WWYA 3S1RJ 5C3EJ 1VQNI 1EKEA 1XS9A 4J19A 1R71A 5EYRA 1ONNA 1JUPA 3GTKJ 4A03A 4AR8A 3O8HA 4OMZA 3GFMA 2TRTA 3GTGJ 3UR3C 3N05A 3HJEA 4XOTA 5ILUA 5JFRA 3RI4A 4RA2A 1K61A 1FX7A 3I0TA 4FX4A 4F7ZA 1YITI 4G94A 2HQNA 3JAMZ 3UCQA 1TNSA 3TQNA 1OPCA 1SFOJ 3I53A 3VYTB 2DOAA 1K4TA 4NDLA 4XK4A 2AXLA 1LPQA 2DT5A 2CSOA 4C9YA 1IZ1A 1YJNI 1T6SA 2WAEA 1QA6A 2LBFB 2EV6A 4KT5C 1W36C 3BG3A 3E97A 2VODA 4UV9A 4E7IA 3F23A 2HXOA 4CGZA 2R7UA 2JRMA 2DFEA 2PJRB 2JSPA 4NC6A 3ZOBA 1X3ZA 1B72B 1ZG5A 4B44A 2GA2A 4UUTA 2X9DA 3ZN0A 2H1KA 2W82A 4MHGA 2BGCA 3GTJJ 3CO6C 2EB7A 3CD6I 2IS4A 3C18A 2K4JA 2PX9A 3GX4X 2PGGA 1WQ2A 2XIGA 2ZJRF 5CVJA 1Y0NA 4LIUA 1IJWC 1ZTRA 4U7DA 2LOOA 2PQ8A 1RP3A 1QHHD 4HV5A 3P9CA 3VYSB 3C3WA 2XPVA 2ZB9A 4Q48A 3H5RA 2CQXA 2JWTA 2EGHA 4RLQA 1JTYA 1UHSA 5F0CA 1IUYA 4ZYAA 1K78A 1MGTA 3C7JA 3ZI0A 3ESWB 2MD5A 3EPZA 3RTRA 4BXFA 3H0DA 3Q9VA 3HB9A 2RQPA 3PQKA 4HOBA 4C30A 4LK1F 2L01A 2DMNA 1BR2A 2DA4A 5FKNA 3QP6A 2RAEA 3W3CA 3KZYA 1G8XA 2CUJA 4XLHA 3UEQA 4M9SA 2DU9A 1ZYRF 3TO7A 1XN7A 4BAYA 1HC8A 2X4HA 2ZMEA 4N0BA 3OIOA 3EETA 4ZDPA 2E7XA 3BR1A 4MQ9F 1MMSA 3LAJA 1XC5A 1WI9A 1XMXA 1WH5A 3WGHA 4ETSA 5FGMA 3LFUA 4L9JA 4BY1J 2K4BA 4L9VA 5IP9J 1U3EM 2VBXA 5JMWA 3V8LA 4A3GJ 5F04A 1T1RA 1TW2A 3JRBA 2PG4A 2E36A 2D1VA 3G4SI 1F9NA 1SAXA 2YS9A 2E34A 2LKPA 2NOJB 5FFXA 3GMEA 3LOCA 1AKHA 4P96A 3FULA 4LK0F 1ACIA 1UHMA 5GADJ 3HOZJ 4M3GA 3FX3A 2B9SA 1MBHA 2KDOA 3H3ZA 2PMZN 3HOVJ 2A5YB 3CDIA 4GRIA 2OJED 4XLCA 4B09A 5JNLA 4G8XA 3BG5A 3E1SA 3BPVA 4S0HB 5HS7A 2LC2A 3B3BA 3EBHA 4GAAA 4ZX6A 3S3NA 2EPFA 2QLZA 3AG2H 4G6QA 3MKZA 3S1MJ 1X3WA 3G1OA 4EGZA 2XDVA 1WFXA 2JCXA 2FOWA 1VI0A 4BU2A 3PNTA 5HVQC 1Y8RB 1OKRA 1A31A 3HDDA 4QIWN 5L3FA 1H9TA 2KIUA 3LQRA 3ZMZA 4Y15A 5JO0A 2MD0A 2RNJA 4M9ZA 2NVXJ 1V5EA 4XRFA 4ZX4A 2R5YA 1XMAA 3VB2A 4ZQHA 2VT3A 1ZHFA 1W5SA 2DQLA 2VB6A 3QYEA 5IT3A 4QIRA 2A5WA 3CC7I 5H6QA 2X6XA 1YFHA 1RKTA 3LSMA 5E3OA 1QVUA 1K6YA 1G3YA 1USSA 4Z6YA 2Y1CA 2BVLA 4M3FA 2IS2A 3CUQC 3W2VA 2D45A 2QJ1A 2KLOA 2L54A 4RB2C 3PFYA 3HC7A 4EMSA 2ETHA 3HKZN 4KDPA 5JLWA 4PCQA 3GYHX 2DJIA 1FPQA 1HW5A 4XQFA 2HOTA 4J3BA 1X58A 1OR7C 3PQJA 1WVRA 5E1WA 2X6YA 3H1CA 3A0HC 1ON1A 1XDUA 3IWFA 1T2KA 1CF7B 2L9NA 1IUFA 1YW8A 1RI7A 3TDZC 2F4OB 2X0LA 3IP4B 3ASNH 4WK8F 3PIOF 1LFBA 4PJMA 1T0FC 2X48A 3CP8A 3DTIA 3I3LA 1KONA 3ZQQA 4G9YA 1YHQI 2WBMA 5KHDA 1PVEA 1H0MA 2L9SA 1OCRH 2Z3YA 2KIFA 4Y6PA 5HLGA 3CMAI 2A6TA 3AU8A 1DPUA 1MDMB 1KQ8A 1SD6A 4DBRA 2Y0SN 1UELB 3WTYC 5LRSA 4HQEA 4PSXA 1R58A 1K5HA 1SD7A 1E17A 1PUFA 2HPIA 3OYGA 3KFWX 3FKJA 2LF7A 1XGMA 4V19K 2ELHA 4DJAA 3E6CC 4PFPA 1U9NA 3FMRA 4G7HF 5GAEJ 1DU0A 1FJLA 4PW4A 1N25A 2KMUA 4MTEA 4QHPA 3Q3SA 4ZC3A 4PJ0C 3W6VA 1GLNA 2ECBA 4F93B 2KIMA 1N78A 2DK5A 3H9QA 4GGGA 3I9V2 2KIQA 5CQGA 1WRJA 4C2UA 3ASOH 2R7DA 4RAZA 1LB2A 4AICA 1X1BA 1Z67A 1OCTC 1MD0A 2CV0A 1B8IB 3MKWB 4C2MJ 4B8XA 1IN8A 3F8MA 3CCEI 4HQMA 4A3KJ 4WX9A 5EDNA 1FMVA 2HGCA 2ZC2A 3R6SA 3ELKA 1S8NA 4U87A 2QQBA 2ICWG 3H5NA 1ERDA 1U5TA 1VQ7I 5FJ8J 2Q1ZB 5B5EC 2Y30A 1XCBA 2N8GA 2K3PA 3FZVA 3O2PE 4FHTA 2FD5A 2V9VA 4OU0A 4V2GA 4WF2A 4EM1A 1RR7A 2PUSA 1VQPI 2MLGA 5K7ZA 2Q0OA 4RDUA 3IH4A 2FU4A 3S32A 1J5YA 1W5CC 3HL2A 3VYRB 1N77A 2P5VA 4U0YA 2JSCA 2M7BA 1X3WB 2QUFA 4LLGF 2PMUA 1F36A 3QAHA 3I4PA 5GTIC 4N9IA 5M5YJ 3T8TA 1AOYA 5E1ZB 1C0WA 1UHWA 3CIAA 4UVCA 1D0XA 2FX0A 3CMYA 3H9GA 3LQQA 1X4OA 1A36A 3CCRI 1TWAJ 2EFOA 1Q1HA 4XN3A 1D8JA 1X1PA 1VQ6I 3T0YA 2K9MA 2D2WA 4BYYA 2EBIA 4BQAA 2R5YB 4ANJA 2LFBA 1IXRC 3PSFA 2CYYA 3CZLA 4JQFA 2P0WA 5E17F 3LFKA 2IP2A 2QQ9A 1Y0UA 1NG7A 1FOYA 3VOEA 1HKTA 5BOXA 2M5WA 2ZCWA 2XC7A 3EDPA 3I4MJ 1GXQA 4ZYDA 5IPAA 2V79A 1PJRA 1USTA 5D5XB 2OD5A 3T8RA 4RM2A 3NWTA 1ZR2A 2V4JC 1B9NA 2VKEA 4D9JA 4GDFA 1SVLA 2ZJPF 1H3LA 4AM3A 3U21A 3OMYA 4Y7NJ 2CQKA 3CJRB 3K0LA 4A6DA 2DA1A 1PP8F 3PUFA 3HOSA 1G5AA 3L2WA 2IGMA 1Z7LA 1WJCA 3BTLA 5TJJA 1F4KA 2HQ5A 1SC5A 2L7MP 2Y2ZA 1IN4A 3RC3A 4I0AA 3K4MA 1BJAA 3K4CA 3AUAA 2E1OA 4PDKA 3SEQA 3OSGA 1B6AA 3FM5A 5B1BH 5IOYA 1W0UA 1BR1A 2MA3A 1BN5A 4Y4RA 2ZFUA 3BCAA 5D5UB 3IRQA 3OSFA 3OL4A 1MIJA 4CH7A 2NS0A 4AWXB 2STTA 1WJEA 4ZQTA 3ML6A 5EEAA 3WTUC 1Q0HA 1UB9A 3FBIB 3M8EA 1FP1D 4GYIA 4XMUA 3S14J 1U78A 5DUIA 2QSHX 3Q9SA 2AHQA 1B4AA 1P4AA 1XCVA 2VKHA 1XGNA 3RKQA 3S2HJ 2Z99A 3FTZA 2HPMA 3A0BC 1T39A 2MSYA 2V1NA 3BT9A 4LMYA 4PSWA 1G59A 1DQUA 2VC0A 2JTVA 5CVIA 2WAFA 4DW6A 3OYAA 2JK3A 3FHZA 3AL0B 2QKMB 3HRSA 1YRNA 3HG9A 2ME6A 1P9QC 4ZW6A 2HWVA 4MFEA 1A6IA 3FXJA 2NS8A 2FBKA 4XN2A 2MG4A 1HF0A 5BNGA 3WTWC 4JX6A 3V7RA 4YRVA 1FBQA 5IT9Z 2ELKA 2HKOA 2V6CA 1B1BA 3E6BA 4B1RA 3I55I 3HTSB 2XQ0A 4ZW3A 1HSTA 5E18F 2NNNA 3JW4A 1AWCA 2DQ6A 2PMHA 2FBIA 4RAGA 2M0MA 4HF0A 1RETA 5FKKA 3TW7A 1JKRC 5A2QK 2DODA 1YS7A 1R1TA 3NAUA 5FROA 2XKOA 2R3SA 3BTIA 4ENNA 2EZKA 4DIQA 1P4WA 1TNTA 3QOEA 1R0KA 1FIAA 1J59A 3MKLA 4A3LJ 3HW2A 1ETYA 2MH2A 4QSHA 2NXNB 2XPZA 3J7YJ 4CO8A 1IDZA 2ESNA 3CJTB 2HDWA 1U6GA 4D7MA 3IKVA 5K5RA 4YFKF 2UZKA 3WGGA 1IW7F 1SMYF 1ZR4A 1XD7A 3S8PA 3JSPA 4IHYA 4Z2YA 2CS3A 1KQ9A 4KYWA 5DLLA 4ZX5A 3C2HA 3ZQHA 4PZJA 3FTSA 3EUHC 3OYKA 2DYRH 2NYXA 3CLQA 4WXDA 4A93J 2YX7A 1ENHA 5HDNA 2ZXGA 2K9LA 3HHHA 4ZTFA 1R9TJ 3C2GA 2X85A 1YYVA 1U9OA 3FTXA 1XSDA 2XSDC 3VSKA 1MBJA 2LR8A 1K7AA 1WPKA 2W00A 4A0YA 2XPWA 2Y1GA 2ID3A 3SYTA 2VJ4A 4AUXA 5HLIA 4CCKA 5K7FA 5IY5H 1VFCA 5E3MA 3DEEA 2PMZA 2VJ8A 1RIOH 2QZ8A 3ECOA 5AIQA 1QHGA 5CVUA 3J80K 5KAIC 2GZWA 4HX4A 3JRDA 2WY8Q 5IYBJ 2GOMA 4KISA 1IO2A 1FYKA 3KZIC 2FNPA 3M1EA 4ON0A 3M07A 3TOAA 3SEZA 4F92B 3BJAA 3RIRA 2FSWA 2ZNYA 3BY6A 4C3IJ 1Z6TA 2DOEA 1W1WE 5EGOA 3WQRA 4IHXA 2VQLA 4KA4A 2BW3A 2R4GA 1TLHB 1VQOI 4M3DA 5EEGA 3ABMH 3BZCA 5KK1A 3IV5A 2K7LA 2V1XA 3OIPA 5DDGA 3D1NI 3HM5A 5J8CA 4OWRB 1MBGA 4CHUA 4UHTA 3GWZA 3E3VA 4BNCA 2DTZA 2E71A 1BM9A 2PBIA 2B0LA 2X1EA 3RPUD 2HVRA 3JTGA 1O3QA 4LLLA 3U1KA 4B3XA 4HV6A 2ZXWH 3DU5A 4D7NA 1MNMC 4MKTA 2QBYA 2GTQA 1DGRM 3OR2C 3J80Z 3FUKA 4A3JJ 3HRUA 1TT5B 4RGUA 2GLOA 3HKZA 5LRRA 3WODF 5ICFA 2LD5A 3G73A 3O8GA 4BQOA 4XO3A 5LGNA 2XAQA 3QQAA 4OIPF 2L7KA 1FT9A 4FETA 9ANTA 3ZQCA 2V7FA 1QGPA 3IC7A 3BQZA 4E7JA 3CCSI 3SFIA 2ID6A 1Q0LA 3G1MA 2JA6J 1G2HA 2IW5A 4BQNA 4HZFA 2E1CA 4A3CJ 2P81A 4OIQF 3FU5A 2QGUA 2R7XA 2OC6A 5EJCA 1BJZA 3RYRA 5JVGF 3DLAA 3PUUA 4O3MA 3ZQ7A 2FEZA 4C2TA 3B34A 4ZQEA 1R7JA 3GLLA 3LA3A 3PO2J 2ZXIA 3GTPJ 2JA5J 3RASA 1DUXC 3X2QH 2Y0SA 4NNJA 4UUVA 2XRLA 4BEHA 2QCOA 2VL8A 3FK6A 1MVYA 1UMQA 2ZFWA 4I2OA 1ZH5A 1KYWA 3CUQB 3KEOA 2M4KA 4H4KC 1W0TA 1X1AA 3K1MA 2DTRA 2WC2A 5DCMA 4Y33A 2DJNA 3MKYB 3VWBA 3AG4H 3MAJA 3SFZA 3VVLA 4YIFA 1RESA 2M4GA 2EH3A 3FIWA 1Z21A 2Y31A 3JAMK 4XMTA 4D1QA 2QQAA 1KQ0A 4A3EJ 1H88C 1O4XA 1QNTA 3FXKA 2XAJA 1SG7A 4XN5A 1L0OC 3K7AJ 4R5XA 1RNLA 2H1LA 4EQQA 1R6RA 2V9KA 3B2PA 4XL9A 3AL0C 3HHGA 4IZZA 4J01A 4LG0A 5D4SA 3MZYA 2ZO4A 4K5OA 2BV6A 4A5NA 4HDUA 1EH7A 1REPC 2OCEA 5F1RA 1FLIA 1BL0A 4FCAA 1QZZA 2GXGA 2H6CA 2YU3A 5FB2A 1HS6A 2RGVA 3DEUA 4ZTJA 4DZPA 3K70D 3FUDA 1LE8B 2R72A 2DFHA 3RKXA 2EZLA 1HXDA 3R0JA 4ESFA 2LTPA 3DPUA 4R5VA 4QMEA 3B2XA 3DBLB 1P7JA 2E1MB 4RMNA 2NRAC 4CYCB 4YIRX 2GA1A 1TW3A 1YOVB 3IAS2 4HSRA 1LEBA 3CJQB 4ESJA 1M1EB 3OYMA 4BH9A 1I1SA 1JJ8C 1HKSA 3S16J 4BGDA 2QA4I 2OF7A 1YW7A 1LJ9A 2HTSA 1A6QA 1PYVA 2NVTJ 2IPQX 1ETQA 3CHSA 4IX7A 2E60A 1HBXG 3F3XA 4FLQA 4G12A 4MEXF 3CCQI 3CDLA 1JHHA 2CQNA 2WV1A 4MQVA 4A3IJ 5JBIA 1LKXA 2QBYB 2E5NA 1FY7A 2GAUA 3DFGA 3BG7A 3V4GA 3GFIA 1HA8A 2FXAA 1LQ1A 1OLTA 2JQ7A 3CCUI 1FBUA 2VQCA 2XGCA 3K4NA 5DD4A 3MN2A 5D6FA 2ZJ2A 2FQ3A 2NNYA 2C6YA 2QYOA 3JSZA 2HTJA 4P1WA 1JJ6C 3BWGA 1YO5C 2A68F 2I5UA 3J7AO 4P5OA 4YIIA 2H27A 1GVJA 3KP5A 1ODDA 4BJ5C 2J5OA 3DEWA 3V7SA 1NTCA 1JHFA 4ZW5A 2P4WA 4A0XA 3WTVC 2HXIA 4IJAA 5HS9A 1XG1A 3QRFF 4YEJA 5IP7J 1D5YA 2VUMJ 3ZQLA 5EG0B 4XLNF 2CV1A 4M71A 1TL8A 3JR9A 4FT8A 4LG3A 3BCBA 5B66C 3CCMI 2RNGA 3FF5A 1Y39A 1WJDA 2LG4A 1P4XA 4L5EA 2XSJC 3M7GA 3PNVA 2WADA 4M9XA 4A3FJ 1MW1A 2R92J 4KJZA 4XN1A 1Z7UA 2BY0A 1FP2A 4G7OF 3CDHA 1YIJI 3NWSA 4UVBA 2A7OA 2IT0A 2XF7A 3W2WA 2WZGA 1VF9A 5JLXA 3QU3A 4BEHB 3OL3A 3WTTC 2O61A 3R0IA 4XN7A 1FTTA 4KMFA 1HKQA 3K4BA 5ED4A 3GCMA 4DBQA 2IS6A 2FMLA 3WTXC 1MMGA 2XUBA 4R8HA 5DCMB 2B63J 4OOIA 5J4VA 3RPQA 4BE2A 2O3FA 1S3JA 3JRGA 4OOFA 4L5IA 2J5PA 3FMSA 3M4OJ 2VPRA 4E7ZA 4RB1A 1HDDC 3OYFA 1VNDA 2ADUA 2K02A 4ZYEA 3LSPA 2UXXA 4Y6SA 1IN7A 2OA4A 4KP7A 1IN6A 3E5XA 2EFPA 5E3LA 2AO9A 4IOAF 1XGSA 1OYIA 4XKCA 4KFCA 2R5ZA 2DA3A 2H6BA 5IYCJ 2F4IA 4LG0B 4B3AA 2BY1A 3R60A 2IVMA 4R5TA 5F6FA 5AENA 1UJ8A 2HYFA 1H19A 3BJ6A 1XSXA 3Q0VA 4M3EA 5FKLA 4IKFA 4QTRA 3HRMA 4XNBA 4KN4X 3F72A 4E70A 3GTLJ 3R0AA 4ZQGA 6PAXA 2JV7A 3FUNA 2DMUA 2DQMA 4O6JA 3P9IA 4IVNA 4KIGA 2WA0A 2DW4A 5JI6A 5J1YA 3BR0A 3FWEA 3H36A 4R1HA 3KETA 5DD8A 1FIPA 5CVRA 5D4RA 5LD2C 1G3TA 3JSOA 2QENA 3S15J 3DPLC 3E5UA 4IHTA 3FXUA 4BACA 3JRHA 1R1UA 3NEUA 3RQIA 1A35A 3CHOA 1RPWA 2HVQA 2XASA 4C3HJ 4AVPA 4BJTA 1NHAA 4DYCA 2DI3A 3QYBA 2A69F 4GO1A 3A2KA 1VQ4I 4CA0A 5FD6A 3ERED 1X3ZB 5GP9A 5D8KB 2KZGA 2JVGA 3MZHA 3DWLE
chains in the Genus database with same CATH topology
5ILSA 2F2EA 3K1PA 4BHCA 4DPRA 4RAYA 1OYWA 2FF4A 3ECHA 2F5CA 3IL2A 2ZBKA 5DYMA 2RJIA 4XO4A 3FH5A 1PP7U 3RDIA 1W5TA 2BYVE 4HYEA 1K78B 1KU9A 2IA2A 3MCZA 3BP8A 1FSHA 3WQQA 2LF8A 2FBHA 4PVBA 2RN7A 4L9NA 4CICA 2FMYA 4Q4EA 3F6VA 4TV7A 2JRTA 1YG2A 2V1DA 1S6LA 1O7LA 3LAPA 4AYSA 4G7ZF 2A6HF 1A04A 2ZMEB 5F64A 3ISPA 2HDCA 3F8FA 4HW0A 3QU6A 2EV5A 1FZPB 1PUEE 2Y1EA 2P5KA 2MC3A 4WCGA 4IPAA 3VEPA 4XSZF 5JVTA 1JGIA 3QOPA 1I1GA 1QQIA 3QPTA 3AAFA 4U88A 3HRTA 4K5NA 3H3UA 4HBLA 3V7CA 4QUOA 1D5VA 3KP6A 3GLXA 4L5JA 3DF8A 5CJ9A 3LWFA 3P9KA 3ZMVA 4OOEA 2A6EF 1IF1A 4HX8A 2K86A 3FTUA 2RVCA 1FSEA 2W84A 3EYIA 1P2FA 3R4KA 2M30A 1H9GA 3ZHXA 2H09A 2XAFA 2CGPA 2XPYA 4FLOA 4U0VA 3KP3A 2HR3A 2P7CB 5ILVA 4UVAA 1DDNA 4M73A 4I01A 4GCVA 3I71A 3I54A 1FYLA 2Q2EA 1Z6RA 3KP7A 4M6XA 1TBXA 4L0YB 3QJXA 1I27A 3FUMA 2YPRA 2VLAA 2BE5F 3WE3A 1LDKB 1RUNA 2P6TA 4PGGA 1ZRDA 5JAZA 2L02A 2LDUA 3WGIA 1ZG1A 5KVRA 3FTWA 1R5HA 2M45A 3U1DA 4BHPA 3CLOA 2Y0MA 3EQLF 3GW2A 2HFHA 5HNFA 5IT9K 4LLNA 1O3RA 3FUJA 1YIOA 3FM3A 4BKXA 5LGUA 2JPCA 2OU2A 2GIVA 2VE8A 1SFXA 2XROA 4WWCA 2O0YA 1HW2A 2OZUA 2G9WA 3WTZA 4G6DA 2RV8A 1SFUA 3K9TA 2FRHA 4FLSA 2Z33A 1MW3A 1O7FA 4AIJA 1U5TB 4QPEA 2Q8KA 3DXJF 5H20A 5HS8A 2XV4S 3Q44A 2L4MA 4H0EA 3LA2A 3ZPLA 2IA0A 2YSRA 3CUOA 3HYIA 3T5XA 5L3DA 1MZBA 2L4AA 2VE9A 3BPXA 3L9FA 1SQMA 4MS6A 5DV5A 3IRRA 4NQWA 5BS6A 5CVVA 3RC8A 3OV8A 1BI0A 4KN7X 2ISYA 1J0RA 5D5VB 2ESHA 2YX4A 4XLPF 3K1NA 1ZGJA 3FU0A 2XGXA 3CZEA 4Q4ZF 3D5LA 5LHHA 3HUGA 4XMWA 2WZFA 3CHRA 3P7NA 4ENKA 1LEAA 1ONPA 2JPBA 2BEOA 1BI1A 2VT2A 5JR3A 3J81K 2PLYA 4S04A 1OR7A 3FTVA 2KJCA 2Y1DA 3WE2A 4S05A 1ULYA 1ONOA 4JNDA 4MNUA 4ZN6A 2JD2A 1IAWA 3ZMTA 2B61A 1CGPA 1BC8C 4EJTA 3L2CA 4Y67A 2LSOA 4Q5SF 3F8CA 2Y75A 4ZYGA 5K1YA 2DFIA 3RJPA 4YFXF 1JXSA 2VC1A 4ENJA 2EWNA 1W4MA 1ZS2A 3I58A 3L00A 3J81Z 2UWMA 1MW0A 5K5QA 2XVCA 1ZAOA 1MKMA 2KKOA 4L9TA 1E2XA 4YG2F 1U2WA 1ZLKA 1T1SA 1SD4A 5HNHA 1R36A 3O3KA 4M72A 1MJAA 1Z05A 2IRFG 2CWEA 2EA4A 4A6EA 1PDNC 1OMIA 5HLTA 1GW6A 3HSRA 4RCVA 2XRNA 1V3FA 2E1NA 4WXHA 1ZG3A 2YR2A 1FC3A 4BXUA 4ZX3A 1XMKA 2MBFA 3CZKA 3MEXA 1HSJA 3TOBA 3CJNA 4EGYA 1P6RA 3UERA 4O5VA 1IRFA 2XAHA 3E6DA 1BBYA 3TO9A 2L3DA 4KICA 2QVWA 3EYYA 4RVBA 1ZLJA 2MH9A 1ZGAA 4XO5A 5AONA 3RKWA 4EJWA 1RZ4A 1TQIA 5FWQA 1KGSA 4NB5A 1U8RA 3L09A 4K5MA 4ZW8A 3FTYA 3FUEA 1UFMA 4ZYHA 3HOTA 2IJLA 5BMZA 4XMVA 4IRHA 5H6RA 3TDUC 1R00A 4X2UA 1U5TC 3ZMSA 3FH7A 1S29A 4HLXA 3RKYA 3JTHA 2G7HA 2ZKZA 2JT1A 2EFWA 1TTYA 1RUOA 4GAEA 3ZN1A 1FNNA 4LJZF 1VTNC 4A0ZA 4ZQFA 1SD5A 3CHPA 3KEQA 4L2LA 3T8VA 1FBSA 1YTYA 3BROA 2OQGA 3GXOA 3DPTA 1BOAA 4XN9A 5L3GA 3B7TA 4Q47A 1P92A 3Q43A 2VXZA 1B9MA 1STZA 2Z5UA 2P8TA 2VOPA 4HX7A 2A61A 2DPUA 3FUHA 2LNBA 3B7SA 3DV8A 1WKMA 1O3SA 2PI0A 5DUKA 4CDGA 3I5UA 4U7BA 3TKYA 3KE2A 3GEZA 3R61A 4XN8A 4KMUX 2O7GA 4R7LA 5DYFA 1CF7A 2O8XA 4ARFA 3HSEA 2Y1FA 1KU3A 1EV7A 2EK5A 3BZ6A 1J75A 4ZH4F 1YW9A 1LNWA 3HIFA 4LUPA 4IRIA 1OYYA 2AS5F 1BIBA 2ZXJA 2K27A 1O3TA 3K69A 5L3EA 4MTDA 1T38A 3H92A 1W7PA 1MDMA 2HEOA 3ANLA 2DLLA 4LFUA 2FNAA 3REOA 5E1XA 2M8EA 2JCVA 3B7UX 2WPGA 1QO0D 2EFNA 1Z91A 4KIFA 2VBZA 4Q4IA 4JBAA 1W7PD 1J7KA 3F8BA 3ROUA 5FFZA 2H94A 3M9AA 1B59A 5E8IA 1S7OA 2W57A 3EUHA 5CYVA 2FA5A 4RGXA 2RKHA 5DEQA 4XBFA 3IKTA 1XSVA 1ON2A 2VONA 4XMXA 1Z9CA 3FHEA 3ANMA 3MWMA 4OIRF 3WQSB 4XNAA 4EJVA 4LB6B 2O6GE 5JMPA 4LD5A 2CG4A 2ZNZA 4HF2A 3FH8A 2Y48A 3F22A 4GYGA 4NHJA 3ZP5A 4AIKA 4LGWA 3I64A 3FMQA 2R70A 5E8GA 2HPTA 2GXBA 1G3SA 2HZTA 2HYGD 2A3SA 2PN6A 4HA8A 1BC7C 3AU9A 5EEHA 3HTUA 4I09A 2OZ6A 4HF1A 4HLYA 4RSYA 3FU3A 3N97A 3MQ0A 1XGOA 5LLQA 3FUFA 4MGRA 1JE8A 5TRDA 2TDXA 1TQMA 3C1DA 4A2UA 1WWXA 4I7HA 1D8KA 1LDDA 1V4RA 3VODA 4ASNA 4R79A 2C5ZA 2JD0A 4P9UA 2V1UA 4IF4A 3KP2A 1R1VA 5D8LB 1GXPA 4JK1X 5LHGA 1SFEA 2COMA 2UXNA 1JVSA 3B7RL 4FLRA 2ACJA 4I0BA 4KUMA 1F1ZA 1W7PB 5LBQA 1MJBA 3SZPA 5BPPA 3COAC 4EM0B 2JD1A 3WU1B 2O03A 1J9IA 3I59A 3TGNA 3MFKA 1I5ZA 1KYZA 2GWRA 3K2ZA 4QWQA 5K5OA 3FUIA 4QLCU 1MJ9A 1ZARA 5BQTA 2HPOA 4RB3C 1YQAA 4XSXF 1LVAA 1L3LA 3S2WA 2A07F 1KU2A 1ZREA 2GQQA 3E5QA 3GZ6A 4AR9A 3SHFA 5HDKA 1LDJA 2VN2A 4EJUA 1TQPA 3KLNA 1G6NA 4I98B 3LA7A 5D6EA 2XKPA 3Q5FA 3WTSC 1MW2A 3RYPA 4EVIA 1WSUA 1DP7P 2STWA 3IHUA 3DP7A 2EJRA 4AD9A 4CYDA 3SXYA 4WXCA 2FOKA 3V8KA 3QPHA 1J2XA 3M8FA 3A14A 4RS8A 3FXQA 1G4DA 4OIOF 4XMZA 2CFXA 5DCFA 2MLKA 5LGTA 2G7UA 3FU6A 4ZZDA 4K5PA 3TO6A 3U9GA 2ISZA 3ABUA 5J8FA 2F5DA 1YLFA 2XAGA 3B73A 4MEYF 2F5EA 2NAZA 5J6XA 4A12A 2C82A 3BJOA 1QBJA 4DQ2A 3EBGA 2IA1A 3HSFA 2DPDA 4L18B 3O6BB 2JZYA 4OMYA 2W25A 4Y6RA 2PJPA 2MAPA 1UCRA 1KU7A 1F5TA 5DULA 5LEJA 2HOEA 3G3ZA 4LB5A 3GFLA 3EBIA 1Q0QA 1Z1DA 2HKXA 1IRGA 4IXAA 3LSTA 4RGRA 2Z9OA 2WTEA 4AIHA 1S7AA 2VBYA 3A06A 3I59B 3QP5A 3CTAA 1ZN2A 3D0SA 3GFJA 5JC1A 4D0PA 1JG9A 4P9FA 3U9WA 3GO5A 4ZZLA 4BHBA 3F6OA 5FD5A 4XNDA 3N4MA 3ZMUA 4PU2A 3GVAA 1FOKA 2M87A 4RGSA 1ZRCA 1O57A 1X3UA 1XDSA 5JHUA 5ERIA 3GZ5A 3L7WA 5L3CA 2P5LC 3E6MA 3F21A 4A5MA 2DBBA 3ZHYA 3ULQB 1FYMA 2F5FA 2W24A 3SZTA 2PFBA 2D1HA 2DQRA 1EH6A 3NQOA 2OBPA 1R23A 4Y17A 2P6SA 5LHIA 5HOOA 2CO5A 4K2EA 5E20A 4PGHA 2XHKA 3CUQA 3GF2A 1BI2A 2R7FA 4YFNF 4UV8A 3IWZA 3OOPA 2EV0A 4UXNA 1SMTA 4N9HA 1DPRA 3CO7C 4RB0A 3F8NA 5AIPA 4FX0A 3DQVC 3U2RA 2HS5A 4IRGA 4I02A 2BBYA 5A2QZ 3W6KB 1T0FA 4L0ZB 2VBWA 2KRFA 1HW1A 3GUDA 4HAMA 4Y13A 2KJBA 4DNCA 2HQRA 4P55A 5FLXK 1HQCA 3ABTA 4U0WA 1K79A 3CHQA 1BIAA 2CW0F 1R5GA 3RPUA 1GHCA 5FO5A 1QZYA 4KNYA 3ZHZA 5EV7A 3KCCA 2DK8A 5LEKA 2M1BA 1BI3A 1IN5A 2R59A 5L3BA 4ENMA 4AR1A 3V8JA 3VFZA 1JGSA 4ZW7A 5ICEA 3WG9A 5HLHA 1ONVA 3IIEA 4XN4A 1EH8A 4EJOA 5FLXZ 4UNOA 3KLOA 1D3YA 2PL5A 1I6XA 3KP4A 4M74A 2OQRA 5BPDA 2RDPA 2FFLA 2MAOA 3PFIA 3SQNA 2PEXA 3CZGA 4ESBA 3W6JB 2DAOA 1YS6A 4EV0A 3B02A 5HDGA 2OAZA 1R0LA 4M6YA 1ZRFA 3ZMDA 3NRVA 4EM2A 3KEDA 1XB4A 5ICGA 4HDVA 3VVMA 3B37A 5ICCA 3T1BA 4GXOA 1QPMA 2QVOA 3FXRA 1T98A 2VOOA 2WV0A 2QWWA 3BDDA 4CXFA 3KZZA 2JCYA 2RC4A 2QM3A 5BPIA 3ANNA 5CLSA 2EA2A 1K6OA 1IXSB 4OINF 4K5LA 1R22A 3DKWA 1KA8A 2EFQA 4CZZA 4KIBA 3WU0A 3BOQA 2FE3A 1S46A 1G3WA 2W85A 4IHSA 2DO7A 1FWZA 2P7VB 1IXCA 3JT1A 2E7WA 2WWYA 1ONNA 4A03A 4AR8A 4OMZA 3GFMA 5ILUA 5JFRA 3RI4A 1FX7A 3I0TA 4FX4A 4F7ZA 4G94A 2HQNA 3JAMZ 3UCQA 1TNSA 3TQNA 1OPCA 3I53A 2AXLA 2DT5A 2CSOA 1IZ1A 1T6SA 2EV6A 4KT5C 3E97A 2VODA 4UV9A 3F23A 4CGZA 1X3ZA 1ZG5A 2GA2A 3ZN0A 4MHGA 2BGCA 3CO6C 2EB7A 3C18A 2K4JA 3GX4X 2PGGA 1WQ2A 2XIGA 5CVJA 4U7DA 2PQ8A 1RP3A 4HV5A 3P9CA 3C3WA 4Q48A 2EGHA 1IUYA 1K78A 1MGTA 3C7JA 3ZI0A 2MD5A 3RTRA 3Q9VA 2RQPA 3PQKA 4HOBA 4LK1F 2L01A 3QP6A 3KZYA 3UEQA 4M9SA 2DU9A 1ZYRF 3TO7A 1XN7A 4BAYA 2X4HA 2ZMEA 4N0BA 3EETA 2E7XA 4MQ9F 3LAJA 1WI9A 3WGHA 4ETSA 5FGMA 4L9JA 2K4BA 4L9VA 1U3EM 2VBXA 5JMWA 3V8LA 1T1RA 1TW2A 2PG4A 2D1VA 1F9NA 1SAXA 2LKPA 5FFXA 4P96A 3FULA 4LK0F 1UHMA 3FX3A 3H3ZA 2A5YB 5JNLA 4B09A 4G8XA 3BPVA 5HS7A 3B3BA 3EBHA 4GAAA 4ZX6A 2QLZA 4G6QA 1X3WA 4EGZA 2JCXA 5HVQC 1OKRA 5L3FA 1H9TA 2KIUA 3LQRA 3ZMZA 4Y15A 5JO0A 2RNJA 4M9ZA 4XRFA 4ZX4A 1XMAA 3VB2A 4ZQHA 2VT3A 1ZHFA 1W5SA 2DQLA 5IT3A 4QIRA 5H6QA 1YFHA 1USSA 1G3YA 2Y1CA 3CUQC 2D45A 2QJ1A 2L54A 4RB2C 4EMSA 2ETHA 4KDPA 4PCQA 3GYHX 1FPQA 1HW5A 4J3BA 3PQJA 5E1WA 1ON1A 1XDUA 3IWFA 1T2KA 1CF7B 1YW8A 1RI7A 3TDZC 2X0LA 4WK8F 4G9YA 1H0MA 2Z3YA 2KIFA 4Y6PA 5HLGA 3AU8A 1DPUA 1MDMB 1KQ8A 1SD6A 3WTYC 5LRSA 4HQEA 1K5HA 1R58A 1SD7A 1E17A 3KFWX 2LF7A 1XGMA 2ELHA 3E6CC 3FMRA 4G7HF 4PW4A 4QHPA 4MTEA 2KIMA 2DK5A 4GGGA 1WRJA 2R7DA 4RAZA 1LB2A 4AICA 1MD0A 4B8XA 1IN8A 3F8MA 4HQMA 4WX9A 2HGCA 3R6SA 3ELKA 1S8NA 2QQBA 1U5TA 1XCBA 5D5WB 3FZVA 4EM1A 3O2PE 4FHTA 4OU0A 4WF2A 2V9VA 2PUSA 4ZW6A 2MLGA 2Q0OA 2FU4A 1J5YA 2P5VA 4U0YA 2JSCA 4LLGF 2QUFA 2PMUA 3QAHA 3I4PA 4N9IA 3T8TA 1AOYA 5E1ZB 1C0WA 1UHWA 3CIAA 4UVCA 3LQQA 2EFOA 1Q1HA 1D8JA 3T0YA 2D2WA 4BYYA 4BQAA 1IXRC 2CYYA 3CZLA 4JQFA 5E17F 3LFKA 2IP2A 2QQ9A 1Y0UA 3VOEA 1HKTA 5BOXA 2M5WA 2ZCWA 3EDPA 1GXQA 4ZYDA 2V79A 1USTA 5D5XB 2OD5A 3T8RA 1B9NA 1H3LA 2CQKA 3K0LA 4A6DA 1PP8F 3HOSA 1G5AA 5TJJA 1F4KA 1SC5A 3RC3A 1IN4A 4I0AA 1BJAA 3AUAA 4PDKA 1B6AA 3FM5A 2MA3A 1BN5A 5D5UB 3IRQA 2NS0A 4AWXB 2STTA 4ZQTA 3ML6A 3WTUC 1Q0HA 1UB9A 3M8EA 1FP1D 4GYIA 4XMUA 1U78A 5DUIA 3Q9SA 1B4AA 1P4AA 1XCVA 1XGNA 2Z99A 3FTZA 1T39A 4LMYA 2VC0A 5CVIA 2JTVA 3FHZA 3HRSA 2HWVA 2FBKA 4XN2A 3WTWC 3V7RA 1FBQA 5IT9Z 2HKOA 2V6CA 1B1BA 3E6BA 3HTSB 4ZW3A 2XQ0A 1HSTA 5E18F 2NNNA 3JW4A 1AWCA 2DQ6A 2PMHA 2FBIA 4HF0A 5A2QK 1YS7A 1R1TA 2XKOA 2R3SA 4ENNA 1P4WA 1TNTA 1R0KA 1J59A 2MH2A 2XPZA 4CO8A 2ESNA 1U6GA 3IKVA 5K5RA 4YFKF 2UZKA 3WGGA 1IW7F 1SMYF 1XD7A 3JSPA 4Z2YA 5DLLA 1KQ9A 4KYWA 4ZX5A 3FTSA 4PZJA 4WXDA 2NYXA 2YX7A 5HDNA 2ZXGA 3HHHA 1YYVA 3FTXA 1XSDA 1K7AA 4A0YA 2Y1GA 5HLIA 2VJ8A 1RIOH 2QZ8A 3ECOA 5AIQA 3J80K 5CVUA 2GZWA 4HX4A 1FYKA 2FNPA 3M1EA 4ON0A 3TOAA 3BJAA 3RIRA 2FSWA 2ZNYA 3BY6A 1Z6TA 3WQRA 4KA4A 1TLHB 5EEGA 5KK1A 2K7LA 2V1XA 5DDGA 5J8CA 4CHUA 4UHTA 3GWZA 3E3VA 4BNCA 1BM9A 2PBIA 2B0LA 3JTGA 1O3QA 4LLLA 4HV6A 4MKTA 2QBYA 2GTQA 3J80Z 3FUKA 3HRUA 4RGUA 5LRRA 3WODF 5ICFA 3G73A 4XO3A 5LGNA 2XAQA 4OIPF 1FT9A 1QGPA 3IC7A 1Q0LA 2IW5A 4HZFA 2E1CA 4OIQF 3FU5A 3RYRA 3PUUA 4O3MA 3ZQ7A 2FEZA 3B34A 4ZQEA 1R7JA 3LA3A 3RASA 1DUXC 4UUVA 1MVYA 2ZFWA 4I2OA 1ZH5A 1KYWA 3CUQB 3KEOA 3K1MA 2DTRA 2WC2A 5DCMA 3MAJA 3SFZA 3VVLA 4YIFA 3JAMK 4XMTA 2QQAA 1KQ0A 1QNTA 2XAJA 1SG7A 4XN5A 1L0OC 4R5XA 1RNLA 4EQQA 3B2PA 3HHGA 4LG0A 5D4SA 3MZYA 2ZO4A 4K5OA 2BV6A 4A5NA 4HDUA 1EH7A 1REPC 5F1RA 1FLIA 4FCAA 1QZZA 2GXGA 2H6CA 2YU3A 5FB2A 1HS6A 2RGVA 3DEUA 3FUDA 2R72A 3RKXA 1HXDA 3R0JA 4ESFA 4R5VA 4QMEA 3B2XA 2NRAC 2GA1A 1TW3A 1LEBA 4ESJA 4BH9A 1I1SA 1HKSA 1YW7A 1LJ9A 2HTSA 2IPQX 3CHSA 1HBXG 3F3XA 4FLQA 4MEXF 1JHHA 4MQVA 5JBIA 2QBYB 1FY7A 2GAUA 3DFGA 3GFIA 3V4GA 2FXAA 1LQ1A 1FBUA 5DD4A 5D6FA 2ZJ2A 2FQ3A 2NNYA 2C6YA 2QYOA 3JSZA 2HTJA 3BWGA 1YO5C 2A68F 3J7AO 4P5OA 4YIIA 2H27A 1GVJA 3KP5A 1ODDA 2J5OA 3V7SA 4ZW5A 1JHFA 2P4WA 4A0XA 3WTVC 4IJAA 5HS9A 3QRFF 4XLNF 4M71A 4FT8A 3FF5A 1P4XA 3M7GA 4M9XA 1MW1A 4XN1A 1Z7UA